3CJNA

Crystal structure of transcriptional regulator, marr family, from silicibacter pomeroyi
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
146
Chain Sequence
RELAEIGLEGYAPYLMNRIMGRYNANLRKEMTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDDQRSSRVYLTPAGRAVYDRLWPHMRASHDRMFQGITPQERQAFLATLNKMLANIRVHEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structure of MarR family transcriptional regulator from Silicibacter pomeroyi.
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Transcription regulator
total genus 40
structure length 146
sequence length 148
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cjnA00
4M72A 4O6JA 5D5UB 2XASA 2EFQA 2GQQA 2PG4A 2OBPA 4L9TA 1IUYA 1QNTA 4HQEA 4D0PA 5L3EA 4I2OA 4P5OA 2UXNA 2ZJ2A 1IN7A 3BROA 3QPHA 3HRSA 4U0VA 2FRHA 4KMFA 4ENNA 3ZN0A 2ELHA 2DQLA 3RI4A 4AIKA 1HBXG 3VB2A 4U0YA 4GGGA 3DP7A 3ERED 3HSRA 2HQRA 3FMSA 1FP2A 1R23A 4JBAA 2M5WA 1SD5A 4UV8A 3J81K 2DK8A 2DAOA 2KIFA 2RV8A 3FXQA 4B8XA 1FBUA 3QP5A 5LRRA 1B9MA 3J80Z 3K69A 1UHWA 1OR7A 3F6OA 4ZYHA 1UHMA 3GFIA 2PMHA 2K4JA 1CF7B 3OOPA 1OPCA 5TRDA 2IA1A 2RKHA 2H6BA 3KEOA 2XROA 3IL2A 3T8TA 2CO5A 2NYXA 3GFJA 2ACJA 4NQWA 4GO1A 1U8RA 4PGHA 4HDVA 1USTA 2FA5A 3MZYA 5LHHA 3F8MA 3FZVA 4CXFA 2XAHA 3KETA 1KGSA 1SD4A 2MD5A 5JI6A 3TKYA 2NNYA 4G9YA 3COAC 1DP7P 1J7KA 1QPMA 1DDNA 3MQ0A 2D1VA 1FWZA 4OIQF 4FT8A 3U1DA 2BV6A 3T0YA 4KIFA 3I59A 4L9VA 1Q1HA 2PMUA 5HOOA 1EH7A 1LNWA 1P4AA 2L4AA 1O3RA 2VBWA 4WXDA 3WE2A 2F5FA 1IXCA 4KYWA 3ZPLA 3QP6A 2L02A 5E8GA 5D6FA 2GA1A 3TDZC 5EEHA 1FC3A 4GCVA 4XSZF 1F9NA 4MEXF 4EGYA 1L3LA 4MHGA 3SZPA 3ZMDA 4MQVA 2CYYA 2ESNA 2PBIA 5BS6A 1U3EM 5LBQA 5JHUA 1J75A 1FNNA 1ZAOA 3WTTC 2VC0A 2H27A 4KFCA 4EMSA 3GYHX 2HYFA 2PFBA 3K0LA 2DFIA 2K27A 1S29A 1HSJA 4PDKA 4OIRF 2R7FA 4CHUA 3F8CA 4OINF 1P6RA 5K1YA 2FSWA 1SFXA 3HRUA 4A0YA 1FLIA 4ESJA 4L9NA 1W4MA 1UB9A 1SAXA 3O6BB 1KYZA 1W7PD 1BN5A 5FLXK 4HF1A 5HVQC 2QUFA 3MEXA 4EJUA 2LF7A 4FX4A 3QOPA 1TQMA 2XAGA 2PLYA 3IWZA 2Y48A 2MBFA 5L3GA 2IPQX 1ZLKA 2VT3A 2W57A 1USSA 3DKWA 4WWCA 3MFKA 2A6HF 2W24A 3HTSB 3LSTA 3IRRA 1ON1A 2M45A 1PP7U 4NB5A 3GW2A 3HUGA 1ZRCA 2CG4A 4LGWA 2MC3A 1O3SA 2UXXA 3RPUA 3WTYC 1QZYA 2YX4A 2P6TA 4RB0A 1XCBA 3WGIA 2OZUA 1ZREA 5IT9K 5DCMA 2LNBA 3B02A 4BHBA 3S2WA 5BQTA 1ZGJA 4LJZF 2H94A 1Z6TA 1WI9A 1FSEA 3E5QA 3R6SA 5JR3A 5HDKA 2W85A 2VBXA 4ZYEA 4WK8F 1RI7A 1B6AA 3LWFA 4I0AA 2FBKA 2FMLA 5E1XA 1K6OA 4LB5A 2KIMA 4WF2A 2MH9A 2CW0F 5E17F 1ZN2A 1LDDA 1UFMA 4HBLA 5H6QA 4UNOA 2V1DA 4M9XA 1F4KA 1QQIA 1J0RA 4AWXB 1YG2A 1XDUA 3IKTA 2ZCWA 2BE5F 3I0TA 3GUDA 2XV4S 4ON0A 5H20A 3LQRA 5FB2A 4QLCU 1FT9A 3OV8A 1V3FA 3F8FA 2ZXJA 1SMYF 4R8HA 4Z2YA 4LLLA 2VE8A 1U78A 3CO6C 4ZZLA 4KN4X 5HS7A 2HKOA 3ZQ7A 1BM9A 4WCGA 2E7WA 1I5ZA 5FD6A 2HQNA 2JTVA 1REPC 3CTAA 1B1BA 1BOAA 3GZ5A 4HF0A 3TDUC 4XLPF 2WTEA 3HOTA 4OIPF 1YIOA 1YS7A 3TOAA 5LLQA 4G8XA 5EEGA 5A2QK 3FF5A 3RKXA 1A04A 1TTYA 3BJAA 3V8KA 2GWRA 2DLLA 3K1NA 4RAYA 3KLOA 2ZNZA 4QWQA 3HIFA 1FOKA 3ML6A 3K2ZA 3PFIA 5K5OA 5ERIA 4ENJA 1KU2A 3SHFA 1EV7A 4MTDA 4KUMA 4JQFA 1H0MA 2VE9A 4UUVA 3GO5A 4EM0B 2QQBA 3ZN1A 1LDKB 3K1MA 2O61A 4BNCA 1K79A 1JHFA 4KA4A 4G94A 3O2PE 1OYYA 2ISYA 4BAYA 4G7ZF 2L3DA 3ECHA 4G6QA 1EH8A 2E1NA 3HYIA 3L7WA 2HZTA 3LA2A 1WSUA 1XSVA 5H6RA 5AONA 1ZRFA 2PJPA 1LDJA 4ETSA 2C6YA 3WTXC 1B9NA 4ZH4F 2XAJA 1BI1A 2ESHA 3IC7A 3WU1B 2V1XA 5E8IA 4KT5C 2P8TA 2BBYA 3J80K 1G3YA 2M8EA 3V4GA 1FYMA 3BJOA 5ED4A 1S3JA 2XAQA 2CGPA 4HAMA 1WWXA 2F5CA 3PQKA 4ESBA 5D8LB 3G73A 4XRFA 3HRMA 1LEBA 3IKVA 1JXSA 2LF8A 2Y75A 3FM5A 1W7PB 3M1EA 2PEXA 2YR2A 5LGNA 4YIFA 1OYWA 1EH6A 3GLXA 1BC7C 4A2UA 4EM2A 5DUIA 5FFXA 3ELKA 4AD9A 1DPUA 1SMTA 1XGNA 1K78B 4IXAA 1P2FA 3V7CA 3RYPA 4A6EA 1ZLJA 1ZH5A 3HRTA 2KRFA 1S7OA 4AIHA 3GEZA 3V8JA 5CVIA 1E2XA 2R7DA 5HLHA 4ASNA 5CVUA 1F5TA 3R61A 4LFUA 4U88A 3I64A 5DD8A 2FMYA 2IA2A 5BMZA 5DCFA 3WTWC 1PDNC 1XMAA 2K7LA 1XGSA 1YO5C 2RQPA 2QZ8A 4KIBA 2IW5A 3WTSC 4OMYA 1P4XA 4Q47A 2M87A 2MH2A 3BPXA 1H9TA 4M6YA 3WODF 5LHGA 5D5XB 3EDPA 2D1HA 2ZO4A 3EETA 4CYDA 2EV0A 3E6DA 3L00A 4I09A 4RB3C 2HS5A 4BQAA 3GXOA 2DU9A 4Q4ZF 3N4MA 1D8KA 2VN2A 2EFWA 1IAWA 2RN7A 3VOEA 1S6LA 1ONVA 3L09A 5LGUA 2HTSA 3L2CA 2GA2A 4YIIA 2IRFG 5DV5A 1YS6A 2LDUA 2M1BA 3RTRA 5LGTA 3KE2A 2IA0A 4LK1F 3HOSA 2WV0A 2ZFWA 2ZMEB 5DYMA 3TQNA 4HDUA 2HR3A 3Q9SA 2VBZA 2A6EF 2X4HA 3FMQA 1FPQA 4LB6B 4A5NA 2A69F 4BH9A 4AVPA 4XSXF 2EB7A 3W6KB 2HTJA 4WX9A 3G3ZA 3P9CA 1R22A 1OYIA 3J7AO 1Z7UA 1JE8A 2Z5UA 2O03A 3R0JA 1DUXC 4NHJA 4KNYA 1Z6RA 3GX4X 3LAJA 1IXSB 4M71A 3WU0A 4LLGF 3QU6A 2JPCA 1TNTA 1RUOA 4HQMA 2P5KA 1Y0UA 2Z99A 4EM1A 1MD0A 3QAHA 3QU3A 1XB4A 3P9KA 1PUEE 2A61A 1SFEA 1R5HA 2XHKA 1J9IA 2LSOA 3WTZA 1W7PA 4L18B 3F8NA 4ENMA 2OA4A 4HX7A 1CGPA 5CVVA 1ZHFA 1TQPA 5HS8A 1P4WA 1B4AA 5AIQA 1XCVA 4KDPA 2OZ6A 2RNJA 2CQKA 4HX8A 1GXPA 5FD5A 2O3FA 2FNAA 1I1SA 1K78A 1BIAA 2NS0A 1MJ9A 1R00A 1L0OC 5D4SA 4MQ9F 4MTEA 4LMYA 5F64A 2DI3A 3DF8A 3M7GA 3F3XA 3E6CC 3KZZA 5D4RA 3I54A 2GAUA 1FBSA 5KVRA 4CDGA 3M8FA 3M8EA 2VBYA 4OIOF 4HV6A 1U5TB 1R7JA 2EFOA 3E97A 4IF4A 3WTUC 1CF7A 1BIBA 3LA3A 1YQAA 2UZKA 4HLYA 2ETHA 1J59A 3FX3A 1YLFA 4IPAA 1RIOH 1TQIA 3DFGA 3TO9A 4I01A 4YFKF 2GXBA 5CVJA 3E3VA 3KP2A 4XBFA 4ZZDA 4IRGA 3NRVA 4UVBA 1TW2A 4YFXF 1RUNA 4BXUA 4L5IA 2JT1A 1HW5A 3BWGA 3DPTA 4U7DA 2Y0MA 3K1PA 3SFZA 2BYVE 2Q8KA 3R0AA 2NRAC 1MJBA 2EFNA 5KK1A 3GZ6A 3CUOA 1R5GA 3JSPA 3BJ6A 3FWEA 2W84A 1Z1DA 4ZYGA 2XRNA 4KN7X 4UHTA 2VXZA 3F21A 3T1BA 1FY7A 1W5TA 2XUBA 1ZGAA 4UVAA 1XSXA 4M9SA 4YG2F 4OU0A 4K2EA 3AAFA 5D8KB 1ZYRF 2A5YB 2Q0OA 2MLGA 3SXYA 3HSEA 1ON2A 1QBJA 2QQ9A 2K02A 5CYVA 5J8FA 2DQRA 1JGSA 3Q5FA 3TO7A 3I5UA 5HLIA 2DT5A 2AXLA 1YW7A 5ICGA 4P96A 3M9AA 3BP8A 4L5JA 4G7HF 3KFWX 5DDGA 1SFUA 2V79A 3WE3A 4L0YB 5HDGA 2Z3YA 5D6EA 3E5XA 2HWVA 5HS9A 1MZBA 1BI0A 5DUKA 4YFNF 3EYYA 5E20A 1O7FA 2CSOA 4UXNA 3JW4A 2QYOA 4P9FA 5JFRA 2OAZA 4KIGA 3V7SA 4AIJA 3ZP5A 4Y15A 1MJAA 4EJWA 4IHTA 4O5VA 2ZKZA 3E6BA 2L54A 3CUQB 1T38A 5E18F 2G9WA 3D0SA 2X0LA 2V1UA 2MA3A 2EFPA 3O3KA 5CVRA 4LLNA 1D8JA 3C3WA 4UV9A 1O3QA 1ZG1A 3KLNA 1XMKA 2RVCA 4L0ZB 4U0WA 3SQNA 4EGZA 3NQOA 4IVNA 4HA8A 5L3BA 2OD5A 4PZJA 4U7BA 3ABUA 2G7HA 2Z9OA 4HW0A 3V8LA 3B73A 3RJPA 4P55A 4Q5SF 2DBBA 3ZMSA 2P6SA 1T2KA 1GVJA 1KQ9A 3ABTA 3F8BA 5K5RA 2A68F 1IXRC 1U5TA 3WGHA 3F23A 1S7AA 2RC4A 3R4KA 4R79A 2FBIA 4BHCA 1LB2A 2XKOA 4RB2C 1O57A 1KQ0A 1U5TC 2W25A 2QWWA 3ZMTA 1BJAA 4PGGA 4RGSA 4MGRA 1KU3A 2EA4A 2ZNYA 4FHTA 1B59A 2V6CA 5DD4A 3ZMUA 4IHSA 1IRGA 1KQ8A 2E7XA 4L9JA 4N9IA 5TJJA 3ZMZA 5HDNA 1G3SA 4M6XA 4BHPA 1XDSA 1G6NA 2COMA 5AIPA 1HKTA 4P9UA 3T5XA 2WWYA 4HV5A 1XGOA 2K4BA 1W5SA 1H9GA 2DTRA 1X3UA 1VTNC 3GF2A 2YSRA 2FBHA 2VODA 5D5WB 2BGCA 4KMUX 2XIGA 1IN4A 1HW2A 3GVAA 2L01A 3VODA 2UWMA 4RB1A 5ICFA 3JTGA 1NHAA 5CJ9A 3L9FA 2VONA 2CWEA 4N9HA 3LAPA 2QBYB 4DQ2A 1GHCA 2O0YA 1IW7F 2EWNA 2NNNA 4OOIA 4IJAA 1R36A 3E5UA 4A12A 5ILSA 4I98B 3JAMZ 1C0WA 3KCCA 4N0BA 2JPBA 4F7ZA 4TV7A 3P7NA 3JSOA 1LJ9A 4B09A 1K7AA 3I71A 5BPIA 1Z9CA 2HGCA 2YPRA 2JSCA 1ZG5A 1V4RA 1WQ2A 2WC2A 4HLXA 5LRSA 3F72A 1ULYA 5ILVA 5DCMB 3TGNA 1R1TA 3MCZA 5DEQA 3CUQA 1RNLA 2EA2A 5F6FA 1MDMB 3R60A 1IRFA 2FNPA 3V7RA 5BPDA 3ULQB 1SD6A 5IT3A 2D45A 3H3ZA 3CUQC 3DQVC 1IN6A 1P92A 2QVOA 3KP5A 5K5QA 2XVCA 5LEJA 2VC1A 1WKMA 4FX0A 4Y17A 3NEUA 3H92A 3JTHA 1PP8F 1HQCA 2CFXA 4MEYF 4H0EA 3J81Z 3RYRA 3GFLA 2A3SA 5LEKA 3FXUA 1RZ4A 4M9ZA 1U2WA 2HYGD 2FXAA 1OMIA 3KZYA 1IF1A 1F1ZA 4XLNF 2A07F 1HXDA 3IWFA 4HOBA 4PCQA 5FFZA 2KIUA 1YYVA 2H6CA 2ISZA 5LHIA 1IN8A 1MKMA 4IRIA 1KA8A 2YX7A 3CO7C 1JHHA 3MAJA 2QQAA 2YU3A 1R58A 1FSHA 3KP4A 3QPTA 1FBQA 3ROUA 4S05A 1XSDA 4DNCA 4RS8A 2J5OA 1ODDA 4IRHA 3CJNA 3DPLC 5E1WA 4I7HA 5J6XA 1TLHB 5ICEA 2DPUA 1FYLA 1I6XA 1QO0D 1DPRA 2FOKA 2P5LC 5CLSA 4EQQA 3QRFF 4Y13A 3I58A 1KU9A 2KKOA 3RKWA 1I27A 3H3UA 1BC8C 3EYIA 2Q2EA 2EV6A 4Q48A 2QM3A 4M73A 1HSTA 3PQJA 2IP2A 4A5MA 3Q9VA 4M74A 3ECOA 5E1ZB 4GYIA 3N97A 1ZRDA 2PI0A 2DO7A 2O6GE 3F6VA 3U9GA 3ISPA 2XGXA 1XN7A 2FEZA 4CZZA 1R1VA 1FYKA 3IRQA 2KJCA 3CLOA 5FO5A 4UVCA 3RIRA 3F22A 2QBYA 4I02A 1KU7A 3BY6A 3WGGA 1T6SA 2JRTA 3FHZA 3KP7A 2H09A 1LEAA 2FQ3A 4A0XA 3FM3A 3T8RA 2MLKA 3GWZA 4E70A 5BOXA 1YFHA 1LVAA 2FF4A 4LG0B 1QZZA 3C7JA 3HHHA 3WTVC 3I4PA 3BPVA 4EJTA 4G7OF 2M30A 3C1DA 3E6MA 1HKQA 4ENKA 2DK5A 3C18A 2F5DA 1IZ1A 1HW1A 5HLGA 2P4WA 3TO6A 5L3DA 4GXOA 3D5LA 2G7UA 4RGRA 3WG9A 2GZWA 4S04A 4BYYA 1FX7A 4O3MA 2NAZA 1AOYA 1SD7A 3SZTA 3DEUA 1STZA 1OKRA 1MDMA 5JVTA 1IN5A 2RGVA 3DV8A 1T39A 1MGTA 2OQGA 4CGZA 3KP6A 5FLXZ 1R1UA 1ZARA 1FZPB 1LQ1A 1Z91A 1XD7A 2EV5A 5L3CA 3RKYA 3CDHA 2VT2A 2PN6A 3LQQA 2O8XA 4HX4A 2F5EA 2V9VA 4R1HA 1BBYA 1J2XA 5L3FA 2VOOA 2ZMEA 2L4MA 2OU2A 2Z33A 3MZHA 3HHGA 2AS5F 4RAZA 3BDDA 4CO8A 5F1RA 4A0ZA 1HKSA 6PAXA 1I1GA 1TW3A 1O7LA 3FXRA 2EJRA 3EQLF 3RDIA 2FU4A 2P7CB 1D3YA 1S8NA 1KYWA 3RPQA 3HTUA 2TDXA 5IT9Z 4EVIA 4HF2A 2P5VA 3U2RA 3BZ6A 2J5PA 1D5VA 1G3WA 1GXQA 1TBXA 2JZYA 4JK1X 2BEOA 1UCRA 1YW9A 1BI3A 2HFHA 5D5VB 1QGPA 3HSFA 5FGMA 2P7VB 4GYGA 2XAFA 2IJLA 1E17A 4WXHA 1Z05A 2IVMA 3DXJF 3IHUA 2QENA 1U6GA 4RGXA 2B0LA 3LA7A 2E1CA 2HDCA 1T98A 2GXGA 5ILUA 3P9IA 2EK5A 2FE3A 2HKXA 4EV0A 1J5YA 1YTYA 2HOEA 2F2EA 3I59B 3REOA 2PQ8A 1G4DA 5J8CA 1BI2A 2KJBA 3I53A 1YW8A 4RGUA 4ZYDA 1TNSA 1G3TA 4G6DA 2QLZA 4EJOA 1T0FA 3VEPA 3K9TA 1AWCA 2K86A 4HYEA 2ADUA 3BOQA 2OQRA 4A6DA 4LG0A 3VFZA 3MWMA 3JAMK 3KEQA 5A2QZ 2HEOA 2RDPA 4OMZA 3ZMVA 1XGMA 1WRJA 3TOBA 4ESFA 4MNUA 4LD5A 4CICA 4EJVA 5ICCA 3KP3A 3GFMA 1FP1D 2D2WA 4I0BA 4KICA 4LK0F 2XKPA 4HZFA 2R3SA 2DW4A 2STWA 3EUHA 2IT0A 2VOPA 2ZBKA 3FMRA 1O3TA 2STTA 2GIVA 3LFKA 2DPDA 1ZG3A 2LKPA 4WXCA 3W6JB
chains in the Genus database with same CATH superfamily
4M72A 2IS2A 5M3MJ 1SEUA 3CJRB 4O6JA 2GOXB 2R7OA 3EUHC 2HZDA 5D5UB 2MC4A 2XASA 3BG6A 2EFQA 2GQQA 2PG4A 2X48A 3E1SA 2UV1A 2OBPA 2K40A 4L9TA 3S1NJ 1QNTA 1IUYA 4A3BJ 3FXOA 1WJCA 2ME6A 4D0PA 5L3EA 4HQEA 1NK3P 4KISA 4I2OA 4P5OA 2UXNA 2XB0X 2ZJ2A 3PSIA 1IN7A 3BROA 3QPHA 4V2GA 2CW7A 2W82A 3HRSA 4U0VA 2FRHA 4KMFA 4ENNA 3BTIA 3ZN0A 2ELHA 5EG0A 2QEXI 1RKTA 2DQLA 3ZCOA 4HG2A 3RI4A 5KNLA 4AIKA 1HBXG 3VB2A 4U0YA 4GGGA 1LFPA 3DP7A 3ERED 3HSRA 1F36A 2E1OA 2HQRA 3FMSA 1FP2A 2DOEA 1R23A 2OTJI 4II2A 4JBAA 1W36C 2M5WA 1SD5A 1X1DA 4UV8A 3J81K 3HOUJ 2DK8A 1FMVA 4CCKA 2DAOA 2KIFA 2RV8A 5J4YA 2DT6A 4UB6C 4Y7NJ 1MBHA 4AVZA 5E3MA 1F43A 1D0ZA 3FXQA 2KFDA 3S3OA 1BW5A 5J1RA 4B8XA 1FBUA 1RETA 3QP5A 5LRRA 1B9MA 3HUGB 3J80Z 3K69A 3BR2A 3DTEA 1UHWA 2BY1A 1OR7A 3F6OA 1MMDA 2PX9A 4ZYHA 1UHMA 3GFIA 2PMHA 2K4JA 1YJ9I 1CF7B 3OOPA 1OPCA 3C2BA 2M4GA 1DGRM 5TRDA 4BY1J 2IA1A 3LSIA 2FX0A 2JRMA 2RKHA 2R7WA 2H6BA 4B43A 4FCYA 3KEOA 3UNGC 3X2QH 1SFKA 1TT5B 2XROA 1B72B 5GTHC 3IL2A 1OR7C 3T8TA 3W2VA 4BS9A 1JTXA 2CO5A 2NYXA 3GFJA 2HVSA 2ACJA 3FXMA 1XTAA 4NQWA 4GO1A 1U8RA 3SYTA 4PGHA 4HDVA 2WAQN 4E7JA 1USTA 2L9NA 2FA5A 5FLVA 3CCUI 3CJQB 3MZYA 2Y9ZA 4QIWN 5LHHA 3F8MA 3FZVA 4W1UA 4CXFA 2XAHA 3KETA 1KGSA 4UUSA 5M5YJ 1SD4A 2MD5A 3M07A 5JI6A 2IGNA 3TKYA 3S17J 2NNYA 4G9YA 1G59A 3GTKJ 3COAC 1DP7P 1J7KA 1QPMA 3QOEA 1HF0A 1DDNA 3PNYA 1I3QJ 3FK7A 1I3AA 2D1VA 3MQ0A 1ETXA 1FWZA 3BT9A 3K70D 1NH3A 4JP0A 4OIQF 4FT8A 2NVQJ 5K7HA 3U1DA 3M4OJ 2BV6A 3T0YA 4KIFA 1APLC 2LG4A 3I59A 4L9VA 3CDLA 1Q1HA 2PMUA 2TCTA 3DTIA 5HOOA 1EH7A 1LNWA 1P4AA 5DTDA 2L4AA 1IDYA 1O3RA 2VBWA 2DMUA 3IUOA 1K6YA 2BW3A 4WXDA 3CCJI 2L7ZA 2XGEA 1PVEA 3WE2A 2F5FA 3CZ6A 1IXCA 4KYWA 3ZPLA 3BTJA 3QP6A 5B3SH 1IUFA 2L02A 4HEA2 5TISC 5EYRA 5E8GA 2LRDA 5D6FA 4QPOA 2H1KA 2GA1A 3C2GA 3TDZC 2L5QA 1UG0A 2E71A 3K4MA 5EEHA 3SFIA 4BQOA 2HPMA 1FC3A 2DMQA 4GCVA 2I8DA 4XSZF 2FUG2 3HC7A 2VKDA 1F9NA 4MEXF 1UJ8A 4EGYA 1L3LA 4MHGA 1ETVA 3JRHA 1KZHA 4E7ZA 1QVTA 3SZPA 2VLAA 3ZMDA 3DPUA 2CH0A 3L2QA 1FOXA 4MQVA 3HXLA 2CYYA 5LFAA 3MZ8A 2ESNA 2H8WA 1Z21A 2PBIA 5BS6A 3HGGA 5LBQA 1U3EM 4D7NA 5JHUA 3K2AA 1MNEA 3G71I 1J75A 1FNNA 1ZAOA 1MBJA 3WTTC 2VC0A 2H27A 4V19K 1X1PA 4KFCA 4EMSA 3MKLA 3GYHX 1Z7LA 2DCEA 2HYFA 4G6TB 2PFBA 4LOCA 3WHCA 3K0LA 2R5ZA 1MBGA 2DFIA 3S3NA 1X1CA 2K27A 4XL9A 3MD2A 3JRDA 3QYBA 2R7SA 3AL0C 5M5WJ 4Y52J 1S29A 4FTHA 1HSJA 3Q0VA 2IXSA 4PDKA 3RZDJ 3FISA 4OIRF 2R7FA 4NUBA 2QA4I 4CHUA 3F8CA 2AQEA 4OINF 1P6RA 3ZQFA 3HBLA 3HOVJ 4F3QA 5K1YA 2FSWA 1SFXA 3HRUA 2CU7A 4A0YA 3PIOF 1FLIA 3IH4A 1HCRA 4ESJA 4D5FA 3LOCA 4L9NA 1OQYA 2WADA 1W4MA 1UB9A 1FIPA 1SAXA 1MSEC 3O6BB 5K7FA 1KYZA 2X1CA 1W7PD 2PMZN 1BN5A 1MH3A 2L9VA 2Z16A 5FLXK 3EUAA 2P81A 4HF1A 5B5EC 2K9LA 5HVQC 2O7OA 2QUFA 3MEXA 4EJUA 2ZFUA 2A5WA 2LF7A 3K4LA 2CQXA 4BQQA 4FX4A 2NVTJ 1IV6A 3QOPA 4XIDA 1TQMA 4F55A 3GLLA 2X1EA 2XAGA 5B1BH 2PLYA 3IWZA 3L2RA 2Y48A 2BHZA 2MBFA 5L3GA 1U9OA 2IPQX 1ZLKA 2VT3A 2KRCA 2W57A 1USSA 3DKWA 4KT6A 4WWCA 3MFKA 2OCEA 2VJ4A 1P7JA 2A6HF 3A03A 3PO2J 2W24A 3HOWJ 1DU6A 3HTSB 3LSTA 3Q0UA 3OYFA 3IRRA 1ON1A 2L7KA 1MBEA 1MMNA 1W5CC 2A6TA 3S2HJ 2M45A 1PP7U 4XOPA 3PO3J 2GOMA 4NB5A 1VF9A 3S2DJ 3GW2A 3MN2A 3HUGA 4IHXA 5DS9A 1ZRCA 1BW6A 2HDDA 5B66C 1WI3A 3PUFA 2CG4A 4LGWA 2MC3A 1O3SA 1H8AC 2UXXA 3RPUA 3DBRB 3WTYC 5EGOB 1QZYA 2YX4A 2KQRA 1OCPA 2P6TA 4RB0A 3W3CA 1XCBA 3VPRA 1BOBA 3LFUA 3WGIA 2OZUA 1ZREA 3OYJA 3LSKA 5IT9K 5DCMA 2LNBA 3B02A 4BHBA 3S2WA 5BQTA 4C2UA 1ZGJA 2XF7A 1B72A 1YX3A 1WJEA 4LJZF 2H94A 3IAM2 2XGDA 1Z6TA 3PFYA 1WI9A 2BY0A 3IH2A 2R7ZJ 1FSEA 1ERDA 3E5QA 3WG7H 3R6SA 5JR3A 5HDKA 2CS3A 2W85A 2VBXA 4E7SA 3CMAI 2HYJA 4ZYEA 4WK8F 1RI7A 2L7MP 1B6AA 1TWAJ 2K9SA 3LWFA 4B48A 3OYAA 4I0AA 1HLVA 2FBKA 2FMLA 5E1XA 4KITB 1K6OA 4LB5A 3BR0A 2KIMA 4WF2A 2MH9A 2CW0F 3DLAA 5E17F 1ZN2A 4M3FA 2M0MA 4DJAA 1PYVA 1LDDA 1UFMA 4HBLA 5H6QA 4UNOA 4I99C 3JRAA 2V1DA 3ASNH 4M9XA 2V9KA 1QQIA 1F4KA 1WH7A 1J0RA 1SC7A 4AWXB 3FK6A 2KDZA 1YG2A 1XDUA 2ZCWA 2HXIA 1OJLA 2I5UA 2BE5F 3IKTA 3I0TA 3GUDA 2XV4S 4ON0A 5CQGA 5H20A 3OYLA 3LQRA 4HPQA 3OY9A 4GDFA 5FB2A 4NBQA 4QLCU 1FT9A 1ETOA 1V3FA 3OV8A 4IO9F 3F8FA 2EPFA 2ZXJA 3LSGA 1SMYF 1ZGWA 5IP7J 4R8HA 1W0UA 4Z2YA 3CCMI 4LLLA 3OYHA 2VE8A 4JOMA 1QHHD 5J4VA 1U78A 3CO6C 2BVLA 4ZZLA 4KN4X 5HS7A 2HKOA 3ZQ7A 4ANJA 3OSFA 1BM9A 4WCGA 2E7WA 1I5ZA 5FD6A 2VJ5A 2HQNA 3FKIJ 2JTVA 1REPC 3CTAA 1I50J 5K7ZA 5LD2C 3KYLA 4CA0A 5KHDA 3DTKA 1B1BA 3PNTA 1X3ZB 1BOAA 3GZ5A 3HG9A 3S32A 4A3CJ 4HF0A 1AU7A 1IG7A 4P1WA 2IAIA 3W2AA 3TDUC 4XLPF 3OIPA 2WTEA 3HOTA 3DU5A 4OIPF 4M3GA 1YIOA 1IDZA 1YS7A 4DIQA 1VQNI 4DOZA 5HNHA 3F9KA 3TOAA 5LLQA 4G8XA 5M3FJ 4DGWB 5EEGA 5A2QK 3FF5A 3OYDA 2XPUA 3RKXA 4JX4A 1A04A 3A0BC 1TTYA 3BJAA 4A3GJ 3V8KA 2GWRA 4CSWA 2DLLA 1YIJI 1XG1A 3K1NA 2X6XA 4CZCA 4RAYA 3KLOA 2ZNZA 3S1QJ 4QWQA 3HIFA 2KPMA 2DODA 1FOKA 3ML6A 4II3A 3OS2A 1ETQA 3K2ZA 3PFIA 5K5OA 3KX2A 1V5FA 1DGWY 5ERIA 4ENJA 2ID6A 1KU2A 3SHFA 5IYBJ 3CC7I 2ELKA 1EV7A 4C3IJ 4MTDA 4KUMA 3FDYA 4JQFA 1D1AA 2XB5A 3ZOBA 1H0MA 2VE9A 3LSJA 4IHVA 4UUVA 3GO5A 5JLXA 4EM0B 4BL0B 3OS0A 2QQBA 3ZN1A 1LDKB 3K1MA 2O61A 5E3LA 2AO9A 4BNCA 1K83J 1IGNA 1K79A 4IL6C 1JHFA 2ECBA 4MO7A 2XC7A 2WA0A 1MBFA 1FTTA 4N4OB 4KA4A 4XLFA 4G94A 4EATA 1R71A 3O2PE 3DEWA 1OYYA 2ISYA 4BAYA 4G7ZF 2L3DA 3ECHA 4G6QA 1EH8A 2CW8A 2E1NA 2W1OA 2CMPA 3FXJA 4E4HA 1OFCX 3HYIA 3BCBA 3HKZN 2RQQA 3L7WA 2HZTA 3WU2C 2DOFA 2NVXJ 1R5ID 2MG4A 3LA2A 2F6CA 1WSUA 1XSVA 4GFBA 5H6RA 5AONA 1ZRFA 2PJPA 3BLYA 1LDJA 2F4MB 2CQ7A 2AXTC 4ETSA 2C6YA 2DA5A 3WTXC 1XMXA 1IC8A 4D7MA 1FEXA 1X4PA 1B9NA 4ZH4F 2EILH 2XAJA 1SVMA 1BI1A 2ESHA 5FKOA 2TRTA 3IC7A 2GXAA 3WU1B 4FQGA 2V1XA 3AG2H 3NWSA 5E8IA 1N75A 3CESA 1VQOI 3RKQA 4KT5C 4HNTA 2P8TA 4F92B 2BBYA 2ICWG 4HNVA 3J80K 5EGOA 1YI2I 3ZQIA 4B4CA 1G3YA 2M8EA 1CQTA 3S15J 3V4GA 1FYMA 4BE1A 3SDBA 2DMTA 2RNGA 3CD6I 5F0HA 3BJOA 1ZR4A 2CRGA 2GLOA 5ED4A 1S3JA 1RESA 2XAQA 2JA6J 2CGPA 2XPWA 1SAUA 4HAMA 1WWXA 2F5CA 3PQKA 4ESBA 5IOZA 5D8LB 4RMNA 3CF5F 3G73A 4F52A 3CMEI 4XRFA 3HRMA 2F48A 1LEBA 3IKVA 5H2FC 2KMUA 4XRSG 4ZYAA 3W2WA 2M8GX 1JXSA 2V1NA 2LF8A 2Y75A 2D5VA 3FM5A 3TP3A 1TL8A 1W7PB 1YRNB 2K9MA 3M1EA 2FJ1A 2PEXA 2YR2A 3OYNA 2EH3A 5LGNA 4FE7A 2OF7A 1QA6A 2R7UA 4YIFA 1OYWA 1EH6A 1VQPI 2EZHA 3GLXA 1BC7C 2IEKA 4DZPA 5IPAA 4A2UA 4EM2A 4XK4A 5DUIA 2R7VA 5FFXA 3ELKA 5IYCJ 2CV2A 3TW6A 1NG7A 5GADJ 1R4NB 3D5SC 3H5RA 2G0EA 4AD9A 1DPUA 1SMTA 1XGNA 3TL4X 1N77A 1K78B 2R5YB 2IBDA 2LYCA 2XDVA 4IXAA 4DYRA 1P2FA 3QPSA 5EEAA 3V7CA 2ZXHA 3RYPA 1VQ7I 5KCMA 4A6EA 4NC7A 2KRHA 1ZLJA 1XX5A 1ZH5A 2DOAA 3HOXJ 2NOJB 1SANA 2W48A 3HRTA 4A3DJ 2WAFA 2DDBA 1S7OA 2KRFA 2V4JC 4AC0A 3GEZA 3V8JA 5CVIA 1E2XA 1P9QC 4AIHA 4DBQA 4IOAF 3G4SI 2R7DA 5HLHA 5JVGF 1LPQA 3CCEI 4ASNA 1AKHB 3D1NI 1VI0A 4CCLA 5J47A 4AYBA 3ZRGA 5CVUA 1F5TA 3R61A 4BEHB 1A36A 4W97A 4E7HA 4C2TA 4LFUA 2W7NA 5GAHJ 4U88A 2A05A 3I64A 3NAUA 1W0TA 5DD8A 2FMYA 2IA2A 5E79C 3GTMJ 3DCFA 5BMZA 5DCFA 4ZDLA 3WTWC 1PDNC 3A0HC 2V7FA 1XMAA 1QHGA 1M1EB 2K7LA 1XGSA 1YO5C 2RQPA 2QZ8A 2R0QC 4KIBA 3ZGKA 3MMYB 3MVPA 1U8BA 2GIZA 5HNFA 2IW5A 3WTSC 2XF6A 5F0FA 3OYMA 2ZB9A 4OMYA 2E1MB 1P4XA 4Q47A 2M87A 4BDYA 3GTJJ 2MH2A 2HQ5A 3BPXA 1XC5A 2B7EA 4ZTJA 1H9TA 2BXYA 4M6YA 2EINH 3WODF 3L1PA 5LHGA 4IOCF 5D5XB 2OCCH 3EDPA 2ZSIB 2D1HA 2ZO4A 3EETA 4Y3OA 3VDXA 3S93A 4CYDA 2EV0A 1V54H 3E6DA 3L00A 4I09A 4RB3C 2HS5A 3ONQA 2EIKH 4BQAA 1WCMJ 3LL7A 3I56I 3GXOA 2LC2A 2JVHA 3PNVA 3GTPJ 3L2UA 2DU9A 2FOWA 1T95A 2L9SA 4Q4ZF 4BBRJ 3N4MA 1HC8A 1D8KA 4YIRX 2VN2A 2EFWA 1IAWA 2RN7A 4C3JJ 3VOEA 1Y0NA 3CMYA 3K70C 1S6LA 1ONVA 4QSHA 2B63J 4BJ5C 3L09A 1Y56A 2LP0A 3KYDB 1OCZH 5LGUA 2HTSA 2GBYA 3A01B 2OUMA 3L2CA 2GA2A 4YIIA 2IRFG 2LH9A 2ME0A 3AFHA 2JA5J 2DDAA 5DV5A 1YS6A 2LDUA 2M1BA 3W6VA 3U1KA 3RTRA 1Z67A 1JTYA 2UUZA 5LGTA 5FRMA 3KE2A 3F0CA 2IA0A 4LK1F 3HOSA 2WV0A 3OIOA 1X58A 4RA2A 2ZFWA 2ZMEB 5DYMA 5KAIC 1WJBA 3I4NJ 2LK2A 3TQNA 3VYUB 4HDUA 4I6ZA 5E3NA 2DFFA 2HR3A 3Q9SA 5F04A 2VBZA 5C4XJ 3M3YJ 2X9DA 2Y0SN 4AUXA 4E6KG 3NARA 5IOYA 3AKZA 2A6EF 2X4HA 3ZQLA 4ABZA 4CCJA 2JA7J 3FMQA 1FPQA 3FXKA 4LB6B 2A69F 4A5NA 4BH9A 5EF6A 4AVPA 3PM1A 4XSXF 2EB7A 2DT7B 3W6KB 2HTJA 2KHMA 4WX9A 4B3AA 3J7ZI 2E35A 1ETKA 3G3ZA 3P9CA 1R22A 1OYIA 2VJJA 2WAQA 4RBOA 3J7AO 1Z7UA 1EJ9A 3DBLB 2NVUB 2CV0A 1JE8A 2HVQA 2VQGA 1UELB 2Z5UA 2O03A 3R0JA 4B47A 1UHSA 1DUXC 4NHJA 1PJRA 2M34A 4KNYA 3H5AA 1Z6RA 3GX4X 2M7BA 3LAJA 4PJNA 2K85A 1K61A 2DA1A 1IXSB 4M71A 4M6VA 3WU0A 1OLTA 1WHUA 4LLGF 2MW8A 3QU6A 1MNDA 2JPCA 1BR4A 2VKHA 1TNTA 1RUOA 3G1OA 2R7TA 4HQMA 2P5KA 1LFUP 1Y0UA 2Z99A 4EM1A 5M5XJ 1MH4A 2EIMH 3JRGA 3QQAA 1MD0A 3QAHA 3QU3A 1XB4A 3P9KA 5FKLA 1PUEE 2WY7Q 4RLFA 2A61A 1V55H 1SFEA 2NOGA 1D1CA 1R5HA 2XHKA 4UY8I 1J9IA 1T56A 2LSOA 2DA4A 1W7PA 3WTZA 5CPRB 2LKXA 2Y9YA 4L18B 3F8NA 1GT0C 4ENMA 2OA4A 1VZ0A 3HJEA 1JT6A 4HX7A 1RC9A 4S0HB 2VIXA 2XAUA 1CGPA 1A6QA 1IJWC 5CVVA 1ZHFA 1TQPA 2YU9J 3ABLH 4XLCA 2IGMA 5HS8A 3DEEA 1P4WA 5FKNA 4XQFA 5E3OA 2DYSH 4MIMA 1B4AA 1X1AA 5AIQA 1LE8B 1XCVA 4KDPA 2OZ6A 2RNJA 2CQKA 4HX8A 1GXPA 5FD5A 3S3MA 2O3FA 2FNAA 1I1SA 1K78A 2R5YA 1BIAA 2NS0A 5GPAA 1ZR2A 5GP9A 2PJRB 1MJ9A 2Y0SA 1R00A 1L0OC 1N78A 5D4SA 2HU9A 4MQ9F 3I9V2 4MTEA 4LMYA 5F64A 2DI3A 3DF8A 4MFDA 3M7GA 3F3XA 3E6CC 2HOTA 2AQFA 1X19A 4BKXA 3KZZA 3OIQA 2NXNB 5D4RA 1TWHJ 1I39A 3I54A 2GAUA 2H8RA 1FBSA 5KVRA 3I3LA 4CDGA 3JRFA 3FBNB 3M8FA 3M8EA 2KDOA 5FRNA 4AIDA 2FD5A 3BZCA 5BNGA 2VBYA 4OIOF 4HV6A 1U5TB 1R7JA 2EFOA 3E97A 4IF4A 1E3OC 3WTUC 2QKMB 2E2IJ 4BEHA 1CF7A 1BIBA 3LA3A 1YQAA 2K5CA 4IKFA 3H9GA 2UZKA 4HLYA 1VQMI 1JKPC 4PJLA 1TWCJ 2ETHA 1J59A 1MMSA 2LY2A 3FX3A 3GTQJ 2DMNA 1YLFA 4IPAA 2YUSA 3K4NA 2M0CA 2V6EA 2QSGX 4XICA 1RIOH 1TQIA 3DFGA 3TO9A 4I01A 4YFKF 2GXBA 5CVJA 3E3VA 3KP2A 5EJCA 4XBFA 4IRGA 4ZZDA 1K4SA 3TW7A 3NRVA 1T8IA 2JUCA 2K3PA 4UVBA 1I6HJ 1TW2A 1NTCA 1YITI 2CFOA 1HDPA 4YFXF 4PSWA 2WAEA 4ZC3A 5C3EJ 4BY7J 1RUNA 4QTRA 4DBRA 1R49A 2DJNA 4BXUA 3SEZA 4L5IA 2JT1A 1HW5A 2PMZA 4XKWA 2JA2A 2LR8A 2L0KA 3BWGA 3DPTA 4DW6A 1BL0A 4KJZA 4U7DA 1MNMC 2Y0MA 3K1PA 3SFZA 2BYVE 2Q8KA 3R0AA 5C4JJ 1JKRC 2NRAC 1MIJA 3SDGA 2M9HA 1MJBA 2EFNA 5KK1A 1V5EA 1JJ6C 3GZ6A 1SVOA 3CUOA 1R5GA 3M1CA 3JSPA 3H35A 1H88C 3BJ6A 3FWEA 1X4OA 2K9NA 2LD5A 1S7EA 2RAEA 4XKBA 2MYSA 3MKWB 3ZQGA 2W84A 1Z1DA 3BR6A 4DYQA 4ZYGA 4IX7A 2XRNA 4KN7X 4UHTA 2VXZA 3F21A 3T1BA 1FY7A 1W5TA 2XUBA 3Q0WA 4XRSA 3GTGJ 1ZGAA 4BXFA 4UVAA 2JMWA 1XSXA 4M9SA 1JUMA 2QKLB 4YG2F 4OU0A 3B6AA 1DQUA 4K2EA 3AAFA 5D8KB 1YE9A 1ZYRF 3A01A 3ABKH 4XR6A 1PUFB 2A5YB 2Q0OA 2WB1N 2M7AA 3AG1H 2IGKA 2MLGA 3SXYA 1ZTRA 3HSEA 3CCYA 2IGOA 5EG0B 1ON2A 1QBJA 2QQ9A 4XLEA 3K6GA 2K02A 4MLOA 2DA3A 5CYVA 3SZGA 2DQRA 1JGSA 5J8FA 3Q5FA 1O4XA 3TO7A 4NC8A 3I5UA 5HLIA 1ETWA 3KPHA 4CCOA 1R6RA 4OAZA 2DT5A 5DM7F 2AXLA 2HOSA 1YW7A 5ICGA 4P96A 3M9AA 3DLLF 3BP8A 2EQRA 3A1YA 3KFWX 4L5JA 5DDGA 4G7HF 1SFUA 1BJZA 4CCNA 3S1MJ 2KIQA 3CCVI 2V79A 3WE3A 2XRLA 4L0YB 3CQZJ 1K4TA 5HDGA 1T08B 2HQAA 3QWLA 4A3IJ 2Z3YA 2O8KA 5D6EA 3E5XA 2HWVA 3HM5A 5HS9A 1MZBA 1X2NA 1BI0A 1D1BA 5DUKA 3WHBA 4YFNF 3OMYA 3OL4A 3EYYA 4HNUA 1YOVB 3GZNB 1O7FA 5E20A 2CSOA 4UXNA 3JW4A 1RKWA 2QYOA 3QYFA 4OWRB 3JRIA 4P9FA 1IV8A 4CUGA 1VQKI 5JFRA 2ID3A 1E3HA 2MD0A 2OAZA 4KIGA 3IV5A 3FHNA 3DBHB 4HSTA 3V7SA 2MABA 4AIJA 3ZP5A 4Y15A 1MJAA 4XN0A 4A3MJ 4EJWA 2R7RA 4IHTA 2MFZA 4O5VA 4PJMA 2ZKZA 3E6BA 2L54A 2W00A 4A93J 1ZK8A 2NS8A 3CUQB 1T38A 5J1UA 5E18F 1VQ4I 2X85A 4E7KA 2BY2A 2G9WA 3EPZA 3OYCA 1G2HA 3D0SA 2H1LA 2X0LA 3CP8A 3CC4I 3ZQHA 3L2VA 2V1UA 2OTLI 4RDUA 4A3JJ 2OJED 2MA3A 2EFPA 3O3KA 1Y1VJ 3A02A 5CVRA 4LLNA 1D8JA 2NVYJ 3C3WA 3FXLA 4C3HJ 4UV9A 4X6AJ 1O3QA 1ZG1A 3KLNA 1XMKA 2RVCA 9ANTA 4L0ZB 4U0WA 3OR1C 1MSFC 4BXXJ 3SQNA 4EGZA 1TWFJ 3NQOA 3H9JA 3OSGA 4HSRA 4IVNA 5IY5H 4DZJA 4HA8A 5L3BA 2OD5A 4PZJA 1BR1A 4I76A 5TGTA 4U7BA 3ABUA 2G7HA 5GPCA 2Z9OA 2PJRA 1R9TJ 3VSLA 4HW0A 3V8LA 2M3AA 3B73A 3J7YJ 3RJPA 4FETA 4BBSJ 1BA5A 4P55A 4Q5SF 2DBBA 1N25A 3ZMSA 2P6SA 1T2KA 1GVJA 4XOTA 3I55I 2ZXIA 1KQ9A 2VL8A 4XN3A 2LVSA 3ABTA 4QPQA 1ACIA 4MFEA 3F8BA 5K5RA 2A68F 2Y31A 1GV2A 3BR3A 1IXRC 1OCOH 3CLQA 1HOMA 1U5TA 3WGHA 3BG5A 3CDIA 3F23A 1LVKA 1S7AA 2YS9A 2RC4A 5IP9J 1NK2P 1Y8QB 3K7AJ 2KL4A 3R4KA 4R79A 2VI6A 2FBIA 4BHCA 3OR2C 4C9YA 1LB2A 2XKOA 3V42A 2LY1A 4RB2C 4HRIA 2QGUA 1Y6IA 1O57A 1ZKGA 4X0GA 3HGYA 4C2MJ 3IP4B 1KQ0A 1A6IA 3BTLA 1KONA 1YX5A 2COBA 1U5TC 1A5JA 2LFBA 2QWWA 2W25A 4NDLA 2LKSA 3ZMTA 3O8GA 1BJAA 2VB6A 2I10A 4PGGA 4RGSA 1GUUA 4MGRA 1KU3A 2EA4A 4NC6A 2ZNYA 4FHTA 1B59A 3A4CA 1VNDA 2EBIA 4UB8C 2V6CA 5DD4A 2LLKA 1TC3C 1ETYA 3ZMUA 2E36A 5CQEA 4IHSA 1IRGA 1KQ8A 3E0JB 1YJWI 2E7XA 4PJ0C 2VASA 4L9JA 4N9IA 5TJJA 1WFXA 1FOYA 3ZMZA 5HDNA 1G3SA 2OV7A 3BC8A 4M6XA 4BHPA 1XDSA 1G6NA 2COMA 2Q2EB 5AIPA 4ZTFA 1Z77A 3ESWB 4XONA 3P5JA 1HKTA 3BG3A 3H9QA 3HKZA 2NS7A 4P9UA 3G2BA 3T5XA 4D5CA 1IRZA 2WWYA 4HV5A 3S16J 3AG3H 3JRBA 1XGOA 2K4BA 1W5SA 2DMPA 1H9GA 4BE0A 2DTRA 1X3UA 1VTNC 3GF2A 2YSRA 2FBHA 2VODA 2L2OA 5D5WB 2BGCA 4KMUX 2M4KA 3ABMH 2XIGA 5FKKA 1IN4A 2WV1A 4OAYA 4XORA 1HW2A 3GVAA 2L01A 3VODA 2UWMA 3RQIA 4RB1A 5ICFA 3JTGA 2K3FA 4M3BA 1NHAA 5CJ9A 4BU2A 1PUFA 3L9FA 3AG4H 3HOYJ 3S14J 2VONA 2CWEA 4IZZA 1W36D 2IS1A 2CUZA 4N9HA 3FKJA 3LAPA 2QBYB 4DQ2A 3OYKA 1MBKA 1GHCA 2O0YA 5EDNA 1IW7F 2O5RA 1E3PA 2EWNA 1D0YA 3TBIA 2WY8Q 4YRVA 2DXIA 2NNNA 4RM2A 4OOIA 4IJAA 4F91B 1WJDA 1R36A 3E5UA 4A12A 1V5GA 4A3FJ 5FKMA 2B9SA 2DFEA 4I98B 5ILSA 5FROA 3JAMZ 3JRCA 2V9PA 1C0WA 3KCCA 4N0BA 2JPBA 4F7ZA 1MMGA 4TV7A 4XLAA 1JI8A 4CCMA 2MGQA 3BG9A 3P7NA 1Z3XA 4XNFA 3JSOA 1LJ9A 4B09A 1ITYA 4FE4A 4V2FA 5CKTA 1K7AA 3I71A 5BPIA 2CUFA 1Z9CA 3E7LA 2HGCA 4DYCA 2KLOA 3LSHA 2YPRA 2EZKA 4F93B 2XSDC 1RR8C 2HOAA 2JSCA 3VYTB 2RREA 1ZG5A 1B8IB 1V4RA 1WQ2A 2WC2A 4HLXA 5LRSA 3CCQI 1X3WB 3F72A 1ULYA 5ILVA 1TZLA 5DCMB 1RRJA 2W4SA 3TGNA 3IAS2 1MMAA 3A2KA 2XPVA 1R1TA 2ECCA 3MCZA 1VQ6I 3KIOA 5DEQA 3CUQA 1RNLA 4Y4RA 2ZC2A 2EA2A 5F6FA 5F27A 2CV1A 4A3EJ 1X2MA 3DKXA 2Y2ZA 1UZCA 3R60A 1MDMB 1IRFA 4IQJA 1POGA 1WJ5A 2FNPA 3BCAA 2X6OA 3V7RA 2BHYA 5BPDA 2CJJA 1QZEA 3DU6A 2OPTA 3BQYA 3ULQB 1WJFA 1SD6A 2LREA 5IT3A 2D45A 3H3ZA 3VYSB 3CUQC 3DQVC 1IN6A 1P92A 4IEJA 2QVOA 3KP5A 5K5QA 2XVCA 4CYCB 5LEJA 3S1RJ 2VC1A 1WKMA 4FX0A 4Y17A 2EZLA 3QODA 4EEFG 3NEUA 5J3LA 1QRYA 3H92A 4XKVA 2HDWA 2L7FP 2CUJA 3JTHA 1HQCA 2CFXA 4MEYF 1PP8F 4H0EA 1RPWA 3H36A 2KISA 2Z2SB 1JKOC 3J81Z 3DWLE 3RYRA 5J1YA 3GFLA 2A3SA 1D0XA 4CH7A 3FXUA 5LEKA 1RZ4A 4IHWA 4M9ZA 2R93J 2X51A 4BJTA 1U2WA 2HYGD 2FXAA 1OMIA 3KZIC 2Z1DA 3KZYA 1IF1A 2JK3A 1F1ZA 4XLNF 5IP6A 1LUJB 2A07F 1HXDA 3IWFA 3VSKA 2XGCA 3LSRA 4HOBA 1JGGA 4PCQA 4XM3A 2JVGA 2KIUA 5FFZA 1FMWA 1YYVA 2H6CA 2ISZA 5LHIA 2HXOA 3PUBA 3UKGA 1IN8A 4FASD 5EZGA 3FIWA 3TEDA 2P0WA 4BUPA 4BQNA 1MKMA 4IRIA 1FTZA 1KA8A 2YX7A 2EZIA 4RAGA 3BG7A 5HODA 3CO7C 1JHHA 3MAJA 4GRIA 2QQAA 2F5VA 2YU3A 3GTOJ 2JSPA 1R58A 1FSHA 1Y1WJ 2VQLA 3KP4A 3KYCB 3OL3A 5KAFC 4G12A 4XLHA 3QPTA 1FBQA 2E5NA 3U21A 3ROUA 2R92J 3GBGA 3CCRI 4B44A 4S05A 3OYIA 3PJRA 2CQQA 1XSDA 2JJ7A 4DNCA 4RS8A 3K4BA 1LFBA 2J5OA 1ODDA 3H5NA 4IRHA 3CJNA 3DPLC 5E1WA 3HOZJ 2QSHX 1XPXA 4I7HA 1TLHB 5J6XA 5ICEA 2DPUA 1FYLA 1I6XA 1TWGJ 3OYGA 3MKZA 4A3LJ 1QO0D 1Q1VA 1DPRA 2FOKA 3CP2A 2P5LC 5CLSA 4EQQA 3QRFF 3MKYB 4LG3A 4Y13A 3I58A 1YRNA 1KU9A 2DTZA 2KKOA 2Q1ZB 2X1DA 1GV5A 4M3EA 3RKWA 1I27A 3S8PA 1UG2A 2JWTA 3G1MA 4LITA 1HDDC 1X1BA 3H3UA 1BC8C 3EYIA 2Q2EA 3ERMA 3ASOH 2EV6A 2L9RA 3HB9A 2QM3A 4Q48A 2ZJRF 3ZQCA 3LMMA 2AHQA 4M73A 2DFHA 2KZVA 3BTCA 3HPHA 1HSTA 1Z3YA 3PQJA 2IP2A 4RAFA 1J09A 4A5MA 3Q9VA 4AM3A 1EF4A 3Q3SA 2E19A 4M74A 1NG6A 3ECOA 5E1ZB 1JUSA 1WGXA 4GYIA 2DA6A 3PSFA 3N97A 1ZRDA 2PI0A 2DO7A 2O6GE 4ZJZA 2IS6A 3F6VA 1FJLA 3U9GA 3ISPA 3N05A 2XGXA 1XN7A 3BR1A 2FEZA 1UMQA 4CZZA 2ZJPF 3HL2A 3CC2I 2FQ4A 1R1VA 1FYKA 3IRQA 2KJCA 2LOOA 3GMEA 3CLOA 1RR7A 5FO5A 1ORKA 4UVCA 1JJ8C 2XF5A 5F0CA 3RIRA 3GTLJ 1UAAA 4PUSA 3F22A 2QBYA 2R7XA 3BZKA 2CQNA 1GVDA 4I02A 1U0JA 1KU7A 2ELJA 4XRMA 3FBIB 3DKYA 3BY6A 3WGGA 1T6SA 2JRTA 3H1CA 3FHZA 4IHYA 1DP3A 3KP7A 1FIAA 2H09A 1LEAA 1EA3A 2FQ3A 3ZR8X 1WPKA 3LSPA 4A0XA 1AKHA 5GAGJ 3H0DA 2E2HJ 2M2EA 3FM3A 3T8RA 1JT0A 2MLKA 3GWZA 2Y69H 4E70A 1WJAA 5BOXA 1YFHA 5J40A 3LNQA 1S5LC 1LVAA 2Y30A 1ZELA 2FF4A 4LG0B 1QZZA 3C7JA 3HHHA 3WTVC 3SEQA 3I4PA 3BPVA 3O8HA 3RSNA 4EJTA 2BZTA 1SVLA 4G7OF 2M30A 3C1DA 3E6MA 1BR2A 1Z0XA 2VQCA 1HKQA 4ENKA 2DK5A 3C18A 2R7QA 3CCLI 3BQZA 2DYRH 1GLNA 2F5DA 1B8IA 1IZ1A 1HW1A 1FOWA 3RPUD 5HLGA 3GCMA 2ZXWH 2P4WA 2X6WA 2JN6A 3TO6A 5L3DA 2BY3A 4GXOA 3K4KA 3D5LA 2G7UA 2WBMA 4RGRA 2LBFB 3WG9A 2DJIA 2GZWA 2QF7A 4S04A 3UR3C 4BYYA 1FX7A 3ZQQA 3CCSI 2NAZA 4O3MA 1AOYA 1SD7A 2BOLA 4RLQA 3SZTA 3DEUA 1STZA 4B3XA 5GAEJ 2F4IA 2JQ7A 1OKRA 1MDMA 1D5YA 1T33A 5HLTA 2E1MC 4M3DA 2VPLA 5JVTA 1IN5A 2F4OB 2RGVA 3DV8A 4Y33A 1T39A 1S72I 1MGTA 3JCUC 4ZDPA 2HVRA 2CUEA 2QCOA 4X1EA 2KT0A 2OQGA 3JR9A 4LIUA 4CGZA 3KP6A 1EKEA 5FLXZ 1R1UA 1ZARA 3QYEA 1FZPB 1LQ1A 1VQ9I 3PIPF 1YJNI 1Z91A 1XD7A 2X6YA 3RZOJ 4N4NB 2EV5A 5L3CA 2IS4A 5JHFA 4CYCA 2DN0A 3RKYA 3CDHA 4XMYA 2VT2A 2VKVA 5F08A 3OWTA 4PFOA 2PN6A 2LY9A 5C44J 3LQQA 4JYKA 2O8XA 4HX4A 2DA2A 4D9JA 2R4GA 2F5EA 2V9VA 1DU0A 1QU3A 4R1HA 1Y39A 1BBYA 1J2XA 5L3FA 2VOOA 2ZMEA 3RCOA 4PJJA 2L4MA 3HZJA 5GTIC 1IO2A 2OU2A 2Z33A 3MZHA 3HHGA 2AS5F 4J19A 2N8GA 1GDTA 3CF2A 3BDDA 4RAZA 4CO8A 5F1RA 5B1AH 3CMMA 3QPLA 3H3VK 3I4MJ 4A0ZA 1HKSA 1TT0A 3OS1A 4J00A 6PAXA 1I1GA 2VUMJ 1TW3A 2LTPA 1O7LA 3SJMA 4Z6YA 1YHQI 2MSYA 3FXRA 2EJRA 3EQLF 1S9HA 3RDIA 2ZMEC 4U87A 2FU4A 3H0GJ 2P7CB 4H4KC 1D3YA 1S8NA 1Y8RB 1KYWA 3RPQA 3HTUA 2XSJC 2TDXA 4NNJA 5IT9Z 4EVIA 4HF2A 3G6EI 2P5VA 3U2RA 3BZ6A 2J5PA 1D5VA 5FLMJ 1W1WE 1G3WA 1GXQA 1TBXA 2JZYA 4ITVA 4JK1X 2BEOA 1R4MB 1UCRA 1YW9A 5EZHA 1BI3A 2HFHA 4D1QA 5D5VB 1QGPA 3HSFA 4PSXA 5FGMA 1VFCA 3TMOA 2P7VB 3HEFA 4BDZA 4GYGA 1A31A 2QQ8A 2XAFA 2VQHA 4A3KJ 2IJLA 1QVUA 1E17A 2ZSHB 1Z05A 4WXHA 1A35A 3ZXSA 2IVMA 3DXJF 3IHUA 1LKXA 2HPIA 2QENA 4NQWB 1OCTC 1VQ8I 1JUPA 2LMDA 4IQ4A 2VJIA 2VPRA 3TP0A 4B1RA 1VQLI 1U6GA 2JUGA 4RGXA 1IRXA 2B0LA 3LA7A 2E1CA 5JLWA 3OYEA 1WH5A 4AU7A 2VXDA 4UUSB 2HDCA 4E7LA 3HDDA 3LSMA 2WB1A 1QPIA 1WVRA 1WZ2A 3PL8A 3C2HA 1T98A 2GXGA 5ILUA 1ZQ3P 2E60A 3P9IA 4JX6A 2EK5A 2FE3A 2ZJQF 1XS9A 2HKXA 1H89C 1LE8A 5IYDJ 4EV0A 3EUKL 4J01A 3K4CA 1J5YA 1YTYA 4PFPA 4YELA 3BR5A 2HOEA 2HNHA 3M8JA 2F2EA 3I59B 1AHDP 3REOA 2HI3A 3NWTA 1P7IA 1JKQC 2BW3B 3RQ4A 2PQ8A 1G4DA 3B6CA 3CJTB 5J8CA 2JA8J 1HA8A 3OOUA 4L5EA 1BI2A 3IH3A 2KJBA 2O9LA 3I53A 1YW8A 1ENHA 3OYBA 4RGUA 4ZYDA 1TNSA 2K9QA 1G3TA 4BE2A 4G6DA 2QLZA 2V26A 4EJOA 1T0FA 3VEPA 3K9TA 1AWCA 2K86A 2VKEA 3K4JA 3JREA 4HYEA 4XKCA 1SFOJ 4YEJA 2ADUA 3BOQA 2OQRA 4A6DA 4LG0A 2E5ZA 3VFZA 3MWMA 3JAMK 2E2JJ 3KEQA 5A2QZ 1G8XA 2HEOA 2KZGA 2DA7A 2RDPA 4OMZA 3ZMVA 1T0FC 3VYRB 1XGMA 3AL0B 3HPGA 4LIVA 5FJ8J 1WRJA 1OCRH 4BJ6C 3TOBA 4ESFA 1VQ5I 4MNUA 4LD5A 4CICA 2QSFX 4PK4A 4EJVA 5ICCA 1MW7A 3KP3A 3J7AY 3GFMA 4RM3A 4ZDOA 4E7IA 1FP1D 2GM4A 1OCCH 2D2WA 4AYBN 4UUTA 4C30A 5F1JA 4I0BA 4BGDA 3VWBA 2KP6A 3D5RC 2R5ZB 4KICA 4LK0F 2XKPA 2LBFA 4HZFA 5DM6F 1U9NA 2BVMA 3K10A 2R3SA 2DW4A 4FISA 2STWA 2E34A 3EUHA 2IT0A 2VOPA 2ZBKA 3L2WA 1TP4A 3FMRA 1O3TA 4JX5A 2STTA 4BACA 2BXZA 4A69C 1OISA 2GIVA 1AA7A 3LFKA 2DPDA 1ZG3A 2LKPA 2OC6A 4WXCA 3W6JB 2EIJH 1E0EA 3KEYA 3G1LA
chains in the Genus database with same CATH topology
4M72A 4O6JA 5D5UB 2XASA 2EFQA 2GQQA 2PG4A 2OBPA 4L9TA 1IUYA 1QNTA 4HQEA 4D0PA 5L3EA 4I2OA 4P5OA 2UXNA 2ZJ2A 1IN7A 3BROA 3QPHA 3HRSA 4U0VA 2FRHA 4KMFA 4ENNA 3ZN0A 2ELHA 2DQLA 3RI4A 4AIKA 1HBXG 3VB2A 4U0YA 4GGGA 3DP7A 3ERED 3HSRA 2HQRA 3FMSA 1FP2A 1R23A 4JBAA 2M5WA 1SD5A 4UV8A 3J81K 2DK8A 2DAOA 2KIFA 2RV8A 3FXQA 4B8XA 1FBUA 3QP5A 5LRRA 1B9MA 3J80Z 3K69A 1UHWA 1OR7A 3F6OA 4ZYHA 1UHMA 3GFIA 2PMHA 2K4JA 1CF7B 3OOPA 1OPCA 5TRDA 2IA1A 2RKHA 2H6BA 3KEOA 2XROA 3IL2A 3T8TA 2CO5A 2NYXA 3GFJA 2ACJA 4NQWA 4GO1A 1U8RA 4PGHA 4HDVA 1USTA 2FA5A 3MZYA 5LHHA 3F8MA 3FZVA 4CXFA 2XAHA 3KETA 1KGSA 1SD4A 2MD5A 5JI6A 3TKYA 2NNYA 4G9YA 3COAC 1DP7P 1J7KA 1QPMA 1DDNA 3MQ0A 2D1VA 1FWZA 4OIQF 4FT8A 3U1DA 2BV6A 3T0YA 4KIFA 3I59A 4L9VA 1Q1HA 2PMUA 5HOOA 1EH7A 1LNWA 1P4AA 2L4AA 1O3RA 2VBWA 4WXDA 3WE2A 2F5FA 1IXCA 4KYWA 3ZPLA 3QP6A 2L02A 5E8GA 5D6FA 2GA1A 3TDZC 5EEHA 1FC3A 4GCVA 4XSZF 1F9NA 4MEXF 4EGYA 1L3LA 4MHGA 3SZPA 3ZMDA 4MQVA 2CYYA 2ESNA 2PBIA 5BS6A 1U3EM 5LBQA 5JHUA 1J75A 1FNNA 1ZAOA 3WTTC 2VC0A 2H27A 4KFCA 4EMSA 3GYHX 2HYFA 2PFBA 3K0LA 2DFIA 2K27A 1S29A 1HSJA 4PDKA 4OIRF 2R7FA 4CHUA 3F8CA 4OINF 1P6RA 5K1YA 2FSWA 1SFXA 3HRUA 4A0YA 1FLIA 4ESJA 4L9NA 1W4MA 1UB9A 1SAXA 3O6BB 1KYZA 1W7PD 1BN5A 5FLXK 4HF1A 5HVQC 2QUFA 3MEXA 4EJUA 2LF7A 4FX4A 3QOPA 1TQMA 2XAGA 2PLYA 3IWZA 2Y48A 2MBFA 5L3GA 2IPQX 1ZLKA 2VT3A 2W57A 1USSA 3DKWA 4WWCA 3MFKA 2A6HF 2W24A 3HTSB 3LSTA 3IRRA 1ON1A 2M45A 1PP7U 4NB5A 3GW2A 3HUGA 1ZRCA 2CG4A 4LGWA 2MC3A 1O3SA 2UXXA 3RPUA 3WTYC 1QZYA 2YX4A 2P6TA 4RB0A 1XCBA 3WGIA 2OZUA 1ZREA 5IT9K 5DCMA 2LNBA 3B02A 4BHBA 3S2WA 5BQTA 1ZGJA 4LJZF 2H94A 1Z6TA 1WI9A 1FSEA 3E5QA 3R6SA 5JR3A 5HDKA 2W85A 2VBXA 4ZYEA 4WK8F 1RI7A 1B6AA 3LWFA 4I0AA 2FBKA 2FMLA 5E1XA 1K6OA 4LB5A 2KIMA 4WF2A 2MH9A 2CW0F 5E17F 1ZN2A 1LDDA 1UFMA 4HBLA 5H6QA 4UNOA 2V1DA 4M9XA 1F4KA 1QQIA 1J0RA 4AWXB 1YG2A 1XDUA 3IKTA 2ZCWA 2BE5F 3I0TA 3GUDA 2XV4S 4ON0A 5H20A 3LQRA 5FB2A 4QLCU 1FT9A 3OV8A 1V3FA 3F8FA 2ZXJA 1SMYF 4R8HA 4Z2YA 4LLLA 2VE8A 1U78A 3CO6C 4ZZLA 4KN4X 5HS7A 2HKOA 3ZQ7A 1BM9A 4WCGA 2E7WA 1I5ZA 5FD6A 2HQNA 2JTVA 1REPC 3CTAA 1B1BA 1BOAA 3GZ5A 4HF0A 3TDUC 4XLPF 2WTEA 3HOTA 4OIPF 1YIOA 1YS7A 3TOAA 5LLQA 4G8XA 5EEGA 5A2QK 3FF5A 3RKXA 1A04A 1TTYA 3BJAA 3V8KA 2GWRA 2DLLA 3K1NA 4RAYA 3KLOA 2ZNZA 4QWQA 3HIFA 1FOKA 3ML6A 3K2ZA 3PFIA 5K5OA 5ERIA 4ENJA 1KU2A 3SHFA 1EV7A 4MTDA 4KUMA 4JQFA 1H0MA 2VE9A 4UUVA 3GO5A 4EM0B 2QQBA 3ZN1A 1LDKB 3K1MA 2O61A 4BNCA 1K79A 1JHFA 4KA4A 4G94A 3O2PE 1OYYA 2ISYA 4BAYA 4G7ZF 2L3DA 3ECHA 4G6QA 1EH8A 2E1NA 3HYIA 3L7WA 2HZTA 3LA2A 1WSUA 1XSVA 5H6RA 5AONA 1ZRFA 2PJPA 1LDJA 4ETSA 2C6YA 3WTXC 1B9NA 4ZH4F 2XAJA 1BI1A 2ESHA 3IC7A 3WU1B 2V1XA 5E8IA 4KT5C 2P8TA 2BBYA 3J80K 1G3YA 2M8EA 3V4GA 1FYMA 3BJOA 5ED4A 1S3JA 2XAQA 2CGPA 4HAMA 1WWXA 2F5CA 3PQKA 4ESBA 5D8LB 3G73A 4XRFA 3HRMA 1LEBA 3IKVA 1JXSA 2LF8A 2Y75A 3FM5A 1W7PB 3M1EA 2PEXA 2YR2A 5LGNA 4YIFA 1OYWA 1EH6A 3GLXA 1BC7C 4A2UA 4EM2A 5DUIA 5FFXA 3ELKA 4AD9A 1DPUA 1SMTA 1XGNA 1K78B 4IXAA 1P2FA 3V7CA 3RYPA 4A6EA 1ZLJA 1ZH5A 3HRTA 2KRFA 1S7OA 4AIHA 3GEZA 3V8JA 5CVIA 1E2XA 2R7DA 5HLHA 4ASNA 5CVUA 1F5TA 3R61A 4LFUA 4U88A 3I64A 5DD8A 2FMYA 2IA2A 5BMZA 5DCFA 3WTWC 1PDNC 1XMAA 2K7LA 1XGSA 1YO5C 2RQPA 2QZ8A 4KIBA 2IW5A 3WTSC 4OMYA 1P4XA 4Q47A 2M87A 2MH2A 3BPXA 1H9TA 4M6YA 3WODF 5LHGA 5D5XB 3EDPA 2D1HA 2ZO4A 3EETA 4CYDA 2EV0A 3E6DA 3L00A 4I09A 4RB3C 2HS5A 4BQAA 3GXOA 2DU9A 4Q4ZF 3N4MA 1D8KA 2VN2A 2EFWA 1IAWA 2RN7A 3VOEA 1S6LA 1ONVA 3L09A 5LGUA 2HTSA 3L2CA 2GA2A 4YIIA 2IRFG 5DV5A 1YS6A 2LDUA 2M1BA 3RTRA 5LGTA 3KE2A 2IA0A 4LK1F 3HOSA 2WV0A 2ZFWA 2ZMEB 5DYMA 3TQNA 4HDUA 2HR3A 3Q9SA 2VBZA 2A6EF 2X4HA 3FMQA 1FPQA 4LB6B 4A5NA 2A69F 4BH9A 4AVPA 4XSXF 2EB7A 3W6KB 2HTJA 4WX9A 3G3ZA 3P9CA 1R22A 1OYIA 3J7AO 1Z7UA 1JE8A 2Z5UA 2O03A 3R0JA 1DUXC 4NHJA 4KNYA 1Z6RA 3GX4X 3LAJA 1IXSB 4M71A 3WU0A 4LLGF 3QU6A 2JPCA 1TNTA 1RUOA 4HQMA 2P5KA 1Y0UA 2Z99A 4EM1A 1MD0A 3QAHA 3QU3A 1XB4A 3P9KA 1PUEE 2A61A 1SFEA 1R5HA 2XHKA 1J9IA 2LSOA 3WTZA 1W7PA 4L18B 3F8NA 4ENMA 2OA4A 4HX7A 1CGPA 5CVVA 1ZHFA 1TQPA 5HS8A 1P4WA 1B4AA 5AIQA 1XCVA 4KDPA 2OZ6A 2RNJA 2CQKA 4HX8A 1GXPA 5FD5A 2O3FA 2FNAA 1I1SA 1K78A 1BIAA 2NS0A 1MJ9A 1R00A 1L0OC 5D4SA 4MQ9F 4MTEA 4LMYA 5F64A 2DI3A 3DF8A 3M7GA 3F3XA 3E6CC 3KZZA 5D4RA 3I54A 2GAUA 1FBSA 5KVRA 4CDGA 3M8FA 3M8EA 2VBYA 4OIOF 4HV6A 1U5TB 1R7JA 2EFOA 3E97A 4IF4A 3WTUC 1CF7A 1BIBA 3LA3A 1YQAA 2UZKA 4HLYA 2ETHA 1J59A 3FX3A 1YLFA 4IPAA 1RIOH 1TQIA 3DFGA 3TO9A 4I01A 4YFKF 2GXBA 5CVJA 3E3VA 3KP2A 4XBFA 4ZZDA 4IRGA 3NRVA 4UVBA 1TW2A 4YFXF 1RUNA 4BXUA 4L5IA 2JT1A 1HW5A 3BWGA 3DPTA 4U7DA 2Y0MA 3K1PA 3SFZA 2BYVE 2Q8KA 3R0AA 2NRAC 1MJBA 2EFNA 5KK1A 3GZ6A 3CUOA 1R5GA 3JSPA 3BJ6A 3FWEA 2W84A 1Z1DA 4ZYGA 2XRNA 4KN7X 4UHTA 2VXZA 3F21A 3T1BA 1FY7A 1W5TA 2XUBA 1ZGAA 4UVAA 1XSXA 4M9SA 4YG2F 4OU0A 4K2EA 3AAFA 5D8KB 1ZYRF 2A5YB 2Q0OA 2MLGA 3SXYA 3HSEA 1ON2A 1QBJA 2QQ9A 2K02A 5CYVA 5J8FA 2DQRA 1JGSA 3Q5FA 3TO7A 3I5UA 5HLIA 2DT5A 2AXLA 1YW7A 5ICGA 4P96A 3M9AA 3BP8A 4L5JA 4G7HF 3KFWX 5DDGA 1SFUA 2V79A 3WE3A 4L0YB 5HDGA 2Z3YA 5D6EA 3E5XA 2HWVA 5HS9A 1MZBA 1BI0A 5DUKA 4YFNF 3EYYA 5E20A 1O7FA 2CSOA 4UXNA 3JW4A 2QYOA 4P9FA 5JFRA 2OAZA 4KIGA 3V7SA 4AIJA 3ZP5A 4Y15A 1MJAA 4EJWA 4IHTA 4O5VA 2ZKZA 3E6BA 2L54A 3CUQB 1T38A 5E18F 2G9WA 3D0SA 2X0LA 2V1UA 2MA3A 2EFPA 3O3KA 5CVRA 4LLNA 1D8JA 3C3WA 4UV9A 1O3QA 1ZG1A 3KLNA 1XMKA 2RVCA 4L0ZB 4U0WA 3SQNA 4EGZA 3NQOA 4IVNA 4HA8A 5L3BA 2OD5A 4PZJA 4U7BA 3ABUA 2G7HA 2Z9OA 4HW0A 3V8LA 3B73A 3RJPA 4P55A 4Q5SF 2DBBA 3ZMSA 2P6SA 1T2KA 1GVJA 1KQ9A 3ABTA 3F8BA 5K5RA 2A68F 1IXRC 1U5TA 3WGHA 3F23A 1S7AA 2RC4A 3R4KA 4R79A 2FBIA 4BHCA 1LB2A 2XKOA 4RB2C 1O57A 1KQ0A 1U5TC 2W25A 2QWWA 3ZMTA 1BJAA 4PGGA 4RGSA 4MGRA 1KU3A 2EA4A 2ZNYA 4FHTA 1B59A 2V6CA 5DD4A 3ZMUA 4IHSA 1IRGA 1KQ8A 2E7XA 4L9JA 4N9IA 5TJJA 3ZMZA 5HDNA 1G3SA 4M6XA 4BHPA 1XDSA 1G6NA 2COMA 5AIPA 1HKTA 4P9UA 3T5XA 2WWYA 4HV5A 1XGOA 2K4BA 1W5SA 1H9GA 2DTRA 1X3UA 1VTNC 3GF2A 2YSRA 2FBHA 2VODA 5D5WB 2BGCA 4KMUX 2XIGA 1IN4A 1HW2A 3GVAA 2L01A 3VODA 2UWMA 4RB1A 5ICFA 3JTGA 1NHAA 5CJ9A 3L9FA 2VONA 2CWEA 4N9HA 3LAPA 2QBYB 4DQ2A 1GHCA 2O0YA 1IW7F 2EWNA 2NNNA 4OOIA 4IJAA 1R36A 3E5UA 4A12A 5ILSA 4I98B 3JAMZ 1C0WA 3KCCA 4N0BA 2JPBA 4F7ZA 4TV7A 3P7NA 3JSOA 1LJ9A 4B09A 1K7AA 3I71A 5BPIA 1Z9CA 2HGCA 2YPRA 2JSCA 1ZG5A 1V4RA 1WQ2A 2WC2A 4HLXA 5LRSA 3F72A 1ULYA 5ILVA 5DCMB 3TGNA 1R1TA 3MCZA 5DEQA 3CUQA 1RNLA 2EA2A 5F6FA 1MDMB 3R60A 1IRFA 2FNPA 3V7RA 5BPDA 3ULQB 1SD6A 5IT3A 2D45A 3H3ZA 3CUQC 3DQVC 1IN6A 1P92A 2QVOA 3KP5A 5K5QA 2XVCA 5LEJA 2VC1A 1WKMA 4FX0A 4Y17A 3NEUA 3H92A 3JTHA 1PP8F 1HQCA 2CFXA 4MEYF 4H0EA 3J81Z 3RYRA 3GFLA 2A3SA 5LEKA 3FXUA 1RZ4A 4M9ZA 1U2WA 2HYGD 2FXAA 1OMIA 3KZYA 1IF1A 1F1ZA 4XLNF 2A07F 1HXDA 3IWFA 4HOBA 4PCQA 5FFZA 2KIUA 1YYVA 2H6CA 2ISZA 5LHIA 1IN8A 1MKMA 4IRIA 1KA8A 2YX7A 3CO7C 1JHHA 3MAJA 2QQAA 2YU3A 1R58A 1FSHA 3KP4A 3QPTA 1FBQA 3ROUA 4S05A 1XSDA 4DNCA 4RS8A 2J5OA 1ODDA 4IRHA 3CJNA 3DPLC 5E1WA 4I7HA 5J6XA 1TLHB 5ICEA 2DPUA 1FYLA 1I6XA 1QO0D 1DPRA 2FOKA 2P5LC 5CLSA 4EQQA 3QRFF 4Y13A 3I58A 1KU9A 2KKOA 3RKWA 1I27A 3H3UA 1BC8C 3EYIA 2Q2EA 2EV6A 4Q48A 2QM3A 4M73A 1HSTA 3PQJA 2IP2A 4A5MA 3Q9VA 4M74A 3ECOA 5E1ZB 4GYIA 3N97A 1ZRDA 2PI0A 2DO7A 2O6GE 3F6VA 3U9GA 3ISPA 2XGXA 1XN7A 2FEZA 4CZZA 1R1VA 1FYKA 3IRQA 2KJCA 3CLOA 5FO5A 4UVCA 3RIRA 3F22A 2QBYA 4I02A 1KU7A 3BY6A 3WGGA 1T6SA 2JRTA 3FHZA 3KP7A 2H09A 1LEAA 2FQ3A 4A0XA 3FM3A 3T8RA 2MLKA 3GWZA 4E70A 5BOXA 1YFHA 1LVAA 2FF4A 4LG0B 1QZZA 3C7JA 3HHHA 3WTVC 3I4PA 3BPVA 4EJTA 4G7OF 2M30A 3C1DA 3E6MA 1HKQA 4ENKA 2DK5A 3C18A 2F5DA 1IZ1A 1HW1A 5HLGA 2P4WA 3TO6A 5L3DA 4GXOA 3D5LA 2G7UA 4RGRA 3WG9A 2GZWA 4S04A 4BYYA 1FX7A 4O3MA 2NAZA 1AOYA 1SD7A 3SZTA 3DEUA 1STZA 1OKRA 1MDMA 5JVTA 1IN5A 2RGVA 3DV8A 1T39A 1MGTA 2OQGA 4CGZA 3KP6A 5FLXZ 1R1UA 1ZARA 1FZPB 1LQ1A 1Z91A 1XD7A 2EV5A 5L3CA 3RKYA 3CDHA 2VT2A 2PN6A 3LQQA 2O8XA 4HX4A 2F5EA 2V9VA 4R1HA 1BBYA 1J2XA 5L3FA 2VOOA 2ZMEA 2L4MA 2OU2A 2Z33A 3MZHA 3HHGA 2AS5F 4RAZA 3BDDA 4CO8A 5F1RA 4A0ZA 1HKSA 6PAXA 1I1GA 1TW3A 1O7LA 3FXRA 2EJRA 3EQLF 3RDIA 2FU4A 2P7CB 1D3YA 1S8NA 1KYWA 3RPQA 3HTUA 2TDXA 5IT9Z 4EVIA 4HF2A 2P5VA 3U2RA 3BZ6A 2J5PA 1D5VA 1G3WA 1GXQA 1TBXA 2JZYA 4JK1X 2BEOA 1UCRA 1YW9A 1BI3A 2HFHA 5D5VB 1QGPA 3HSFA 5FGMA 2P7VB 4GYGA 2XAFA 2IJLA 1E17A 4WXHA 1Z05A 2IVMA 3DXJF 3IHUA 2QENA 1U6GA 4RGXA 2B0LA 3LA7A 2E1CA 2HDCA 1T98A 2GXGA 5ILUA 3P9IA 2EK5A 2FE3A 2HKXA 4EV0A 1J5YA 1YTYA 2HOEA 2F2EA 3I59B 3REOA 2PQ8A 1G4DA 5J8CA 1BI2A 2KJBA 3I53A 1YW8A 4RGUA 4ZYDA 1TNSA 1G3TA 4G6DA 2QLZA 4EJOA 1T0FA 3VEPA 3K9TA 1AWCA 2K86A 4HYEA 2ADUA 3BOQA 2OQRA 4A6DA 4LG0A 3VFZA 3MWMA 3JAMK 3KEQA 5A2QZ 2HEOA 2RDPA 4OMZA 3ZMVA 1XGMA 1WRJA 3TOBA 4ESFA 4MNUA 4LD5A 4CICA 4EJVA 5ICCA 3KP3A 3GFMA 1FP1D 2D2WA 4I0BA 4KICA 4LK0F 2XKPA 4HZFA 2R3SA 2DW4A 2STWA 3EUHA 2IT0A 2VOPA 2ZBKA 3FMRA 1O3TA 2STTA 2GIVA 3LFKA 2DPDA 1ZG3A 2LKPA 4WXCA 3W6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M72 A;  4O6J A;  5D5U B;  2XAS A;  2EFQ A;  2GQQ A;  2PG4 A;  2OBP A;  4L9T A;  1IUY A;  1QNT A;  4HQE A;  4D0P A;  5L3E A;  4I2O A;  4P5O A;  2UXN A;  2ZJ2 A;  1IN7 A;  3BRO A;  3QPH A;  3HRS A;  4U0V A;  2FRH A;  4KMF A;  4ENN A;  3ZN0 A;  2ELH A;  2DQL A;  3RI4 A;  4AIK A;  1HBX G;  3VB2 A;  4U0Y A;  4GGG A;  3DP7 A;  3ERE D;  3HSR A;  2HQR A;  3FMS A;  1FP2 A;  1R23 A;  4JBA A;  2M5W A;  1SD5 A;  4UV8 A;  3J81 K;  2DK8 A;  2DAO A;  2KIF A;  2RV8 A;  3FXQ A;  4B8X A;  1FBU A;  3QP5 A;  5LRR A;  1B9M A;  3J80 Z;  3K69 A;  1UHW A;  1OR7 A;  3F6O A;  4ZYH A;  1UHM A;  3GFI A;  2PMH A;  2K4J A;  1CF7 B;  3OOP A;  1OPC A;  5TRD A;  2IA1 A;  2RKH A;  2H6B A;  3KEO A;  2XRO A;  3IL2 A;  3T8T A;  2CO5 A;  2NYX A;  3GFJ A;  2ACJ A;  4NQW A;  4GO1 A;  1U8R A;  4PGH A;  4HDV A;  1UST A;  2FA5 A;  3MZY A;  5LHH A;  3F8M A;  3FZV A;  4CXF A;  2XAH A;  3KET A;  1KGS A;  1SD4 A;  2MD5 A;  5JI6 A;  3TKY A;  2NNY A;  4G9Y A;  3COA C;  1DP7 P;  1J7K A;  1QPM A;  1DDN A;  3MQ0 A;  2D1V A;  1FWZ A;  4OIQ F;  4FT8 A;  3U1D A;  2BV6 A;  3T0Y A;  4KIF A;  3I59 A;  4L9V A;  1Q1H A;  2PMU A;  5HOO A;  1EH7 A;  1LNW A;  1P4A A;  2L4A A;  1O3R A;  2VBW A;  4WXD A;  3WE2 A;  2F5F A;  1IXC A;  4KYW A;  3ZPL A;  3QP6 A;  2L02 A;  5E8G A;  5D6F A;  2GA1 A;  3TDZ C;  5EEH A;  1FC3 A;  4GCV A;  4XSZ F;  1F9N A;  4MEX F;  4EGY A;  1L3L A;  4MHG A;  3SZP A;  3ZMD A;  4MQV A;  2CYY A;  2ESN A;  2PBI A;  5BS6 A;  1U3E M;  5LBQ A;  5JHU A;  1J75 A;  1FNN A;  1ZAO A;  3WTT C;  2VC0 A;  2H27 A;  4KFC A;  4EMS A;  3GYH X;  2HYF A;  2PFB A;  3K0L A;  2DFI A;  2K27 A;  1S29 A;  1HSJ A;  4PDK A;  4OIR F;  2R7F A;  4CHU A;  3F8C A;  4OIN F;  1P6R A;  5K1Y A;  2FSW A;  1SFX A;  3HRU A;  4A0Y A;  1FLI A;  4ESJ A;  4L9N A;  1W4M A;  1UB9 A;  1SAX A;  3O6B B;  1KYZ A;  1W7P D;  1BN5 A;  5FLX K;  4HF1 A;  5HVQ C;  2QUF A;  3MEX A;  4EJU A;  2LF7 A;  4FX4 A;  3QOP A;  1TQM A;  2XAG A;  2PLY A;  3IWZ A;  2Y48 A;  2MBF A;  5L3G A;  2IPQ X;  1ZLK A;  2VT3 A;  2W57 A;  1USS A;  3DKW A;  4WWC A;  3MFK A;  2A6H F;  2W24 A;  3HTS B;  3LST A;  3IRR A;  1ON1 A;  2M45 A;  1PP7 U;  4NB5 A;  3GW2 A;  3HUG A;  1ZRC A;  2CG4 A;  4LGW A;  2MC3 A;  1O3S A;  2UXX A;  3RPU A;  3WTY C;  1QZY A;  2YX4 A;  2P6T A;  4RB0 A;  1XCB A;  3WGI A;  2OZU A;  1ZRE A;  5IT9 K;  5DCM A;  2LNB A;  3B02 A;  4BHB A;  3S2W A;  5BQT A;  1ZGJ A;  4LJZ F;  2H94 A;  1Z6T A;  1WI9 A;  1FSE A;  3E5Q A;  3R6S A;  5JR3 A;  5HDK A;  2W85 A;  2VBX A;  4ZYE A;  4WK8 F;  1RI7 A;  1B6A A;  3LWF A;  4I0A A;  2FBK A;  2FML A;  5E1X A;  1K6O A;  4LB5 A;  2KIM A;  4WF2 A;  2MH9 A;  2CW0 F;  5E17 F;  1ZN2 A;  1LDD A;  1UFM A;  4HBL A;  5H6Q A;  4UNO A;  2V1D A;  4M9X A;  1F4K A;  1QQI A;  1J0R A;  4AWX B;  1YG2 A;  1XDU A;  3IKT A;  2ZCW A;  2BE5 F;  3I0T A;  3GUD A;  2XV4 S;  4ON0 A;  5H20 A;  3LQR A;  5FB2 A;  4QLC U;  1FT9 A;  3OV8 A;  1V3F A;  3F8F A;  2ZXJ A;  1SMY F;  4R8H A;  4Z2Y A;  4LLL A;  2VE8 A;  1U78 A;  3CO6 C;  4ZZL A;  4KN4 X;  5HS7 A;  2HKO A;  3ZQ7 A;  1BM9 A;  4WCG A;  2E7W A;  1I5Z A;  5FD6 A;  2HQN A;  2JTV A;  1REP C;  3CTA A;  1B1B A;  1BOA A;  3GZ5 A;  4HF0 A;  3TDU C;  4XLP F;  2WTE A;  3HOT A;  4OIP F;  1YIO A;  1YS7 A;  3TOA A;  5LLQ A;  4G8X A;  5EEG A;  5A2Q K;  3FF5 A;  3RKX A;  1A04 A;  1TTY A;  3BJA A;  3V8K A;  2GWR A;  2DLL A;  3K1N A;  4RAY A;  3KLO A;  2ZNZ A;  4QWQ A;  3HIF A;  1FOK A;  3ML6 A;  3K2Z A;  3PFI A;  5K5O A;  5ERI A;  4ENJ A;  1KU2 A;  3SHF A;  1EV7 A;  4MTD A;  4KUM A;  4JQF A;  1H0M A;  2VE9 A;  4UUV A;  3GO5 A;  4EM0 B;  2QQB A;  3ZN1 A;  1LDK B;  3K1M A;  2O61 A;  4BNC A;  1K79 A;  1JHF A;  4KA4 A;  4G94 A;  3O2P E;  1OYY A;  2ISY A;  4BAY A;  4G7Z F;  2L3D A;  3ECH A;  4G6Q A;  1EH8 A;  2E1N A;  3HYI A;  3L7W A;  2HZT A;  3LA2 A;  1WSU A;  1XSV A;  5H6R A;  5AON A;  1ZRF A;  2PJP A;  1LDJ A;  4ETS A;  2C6Y A;  3WTX C;  1B9N A;  4ZH4 F;  2XAJ A;  1BI1 A;  2ESH A;  3IC7 A;  3WU1 B;  2V1X A;  5E8I A;  4KT5 C;  2P8T A;  2BBY A;  3J80 K;  1G3Y A;  2M8E A;  3V4G A;  1FYM A;  3BJO A;  5ED4 A;  1S3J A;  2XAQ A;  2CGP A;  4HAM A;  1WWX A;  2F5C A;  3PQK A;  4ESB A;  5D8L B;  3G73 A;  4XRF A;  3HRM A;  1LEB A;  3IKV A;  1JXS A;  2LF8 A;  2Y75 A;  3FM5 A;  1W7P B;  3M1E A;  2PEX A;  2YR2 A;  5LGN A;  4YIF A;  1OYW A;  1EH6 A;  3GLX A;  1BC7 C;  4A2U A;  4EM2 A;  5DUI A;  5FFX A;  3ELK A;  4AD9 A;  1DPU A;  1SMT A;  1XGN A;  1K78 B;  4IXA A;  1P2F A;  3V7C A;  3RYP A;  4A6E A;  1ZLJ A;  1ZH5 A;  3HRT A;  2KRF A;  1S7O A;  4AIH A;  3GEZ A;  3V8J A;  5CVI A;  1E2X A;  2R7D A;  5HLH A;  4ASN A;  5CVU A;  1F5T A;  3R61 A;  4LFU A;  4U88 A;  3I64 A;  5DD8 A;  2FMY A;  2IA2 A;  5BMZ A;  5DCF A;  3WTW C;  1PDN C;  1XMA A;  2K7L A;  1XGS A;  1YO5 C;  2RQP A;  2QZ8 A;  4KIB A;  2IW5 A;  3WTS C;  4OMY A;  1P4X A;  4Q47 A;  2M87 A;  2MH2 A;  3BPX A;  1H9T A;  4M6Y A;  3WOD F;  5LHG A;  5D5X B;  3EDP A;  2D1H A;  2ZO4 A;  3EET A;  4CYD A;  2EV0 A;  3E6D A;  3L00 A;  4I09 A;  4RB3 C;  2HS5 A;  4BQA A;  3GXO A;  2DU9 A;  4Q4Z F;  3N4M A;  1D8K A;  2VN2 A;  2EFW A;  1IAW A;  2RN7 A;  3VOE A;  1S6L A;  1ONV A;  3L09 A;  5LGU A;  2HTS A;  3L2C A;  2GA2 A;  4YII A;  2IRF G;  5DV5 A;  1YS6 A;  2LDU A;  2M1B A;  3RTR A;  5LGT A;  3KE2 A;  2IA0 A;  4LK1 F;  3HOS A;  2WV0 A;  2ZFW A;  2ZME B;  5DYM A;  3TQN A;  4HDU A;  2HR3 A;  3Q9S A;  2VBZ A;  2A6E F;  2X4H A;  3FMQ A;  1FPQ A;  4LB6 B;  4A5N A;  2A69 F;  4BH9 A;  4AVP A;  4XSX F;  2EB7 A;  3W6K B;  2HTJ A;  4WX9 A;  3G3Z A;  3P9C A;  1R22 A;  1OYI A;  3J7A O;  1Z7U A;  1JE8 A;  2Z5U A;  2O03 A;  3R0J A;  1DUX C;  4NHJ A;  4KNY A;  1Z6R A;  3GX4 X;  3LAJ A;  1IXS B;  4M71 A;  3WU0 A;  4LLG F;  3QU6 A;  2JPC A;  1TNT A;  1RUO A;  4HQM A;  2P5K A;  1Y0U A;  2Z99 A;  4EM1 A;  1MD0 A;  3QAH A;  3QU3 A;  1XB4 A;  3P9K A;  1PUE E;  2A61 A;  1SFE A;  1R5H A;  2XHK A;  1J9I A;  2LSO A;  3WTZ A;  1W7P A;  4L18 B;  3F8N A;  4ENM A;  2OA4 A;  4HX7 A;  1CGP A;  5CVV A;  1ZHF A;  1TQP A;  5HS8 A;  1P4W A;  1B4A A;  5AIQ A;  1XCV A;  4KDP A;  2OZ6 A;  2RNJ A;  2CQK A;  4HX8 A;  1GXP A;  5FD5 A;  2O3F A;  2FNA A;  1I1S A;  1K78 A;  1BIA A;  2NS0 A;  1MJ9 A;  1R00 A;  1L0O C;  5D4S A;  4MQ9 F;  4MTE A;  4LMY A;  5F64 A;  2DI3 A;  3DF8 A;  3M7G A;  3F3X A;  3E6C C;  3KZZ A;  5D4R A;  3I54 A;  2GAU A;  1FBS A;  5KVR A;  4CDG A;  3M8F A;  3M8E A;  2VBY A;  4OIO F;  4HV6 A;  1U5T B;  1R7J A;  2EFO A;  3E97 A;  4IF4 A;  3WTU C;  1CF7 A;  1BIB A;  3LA3 A;  1YQA A;  2UZK A;  4HLY A;  2ETH A;  1J59 A;  3FX3 A;  1YLF A;  4IPA A;  1RIO H;  1TQI A;  3DFG A;  3TO9 A;  4I01 A;  4YFK F;  2GXB A;  5CVJ A;  3E3V A;  3KP2 A;  4XBF A;  4ZZD A;  4IRG A;  3NRV A;  4UVB A;  1TW2 A;  4YFX F;  1RUN A;  4BXU A;  4L5I A;  2JT1 A;  1HW5 A;  3BWG A;  3DPT A;  4U7D A;  2Y0M A;  3K1P A;  3SFZ A;  2BYV E;  2Q8K A;  3R0A A;  2NRA C;  1MJB A;  2EFN A;  5KK1 A;  3GZ6 A;  3CUO A;  1R5G A;  3JSP A;  3BJ6 A;  3FWE A;  2W84 A;  1Z1D A;  4ZYG A;  2XRN A;  4KN7 X;  4UHT A;  2VXZ A;  3F21 A;  3T1B A;  1FY7 A;  1W5T A;  2XUB A;  1ZGA A;  4UVA A;  1XSX A;  4M9S A;  4YG2 F;  4OU0 A;  4K2E A;  3AAF A;  5D8K B;  1ZYR F;  2A5Y B;  2Q0O A;  2MLG A;  3SXY A;  3HSE A;  1ON2 A;  1QBJ A;  2QQ9 A;  2K02 A;  5CYV A;  5J8F A;  2DQR A;  1JGS A;  3Q5F A;  3TO7 A;  3I5U A;  5HLI A;  2DT5 A;  2AXL A;  1YW7 A;  5ICG A;  4P96 A;  3M9A A;  3BP8 A;  4L5J A;  4G7H F;  3KFW X;  5DDG A;  1SFU A;  2V79 A;  3WE3 A;  4L0Y B;  5HDG A;  2Z3Y A;  5D6E A;  3E5X A;  2HWV A;  5HS9 A;  1MZB A;  1BI0 A;  5DUK A;  4YFN F;  3EYY A;  5E20 A;  1O7F A;  2CSO A;  4UXN A;  3JW4 A;  2QYO A;  4P9F A;  5JFR A;  2OAZ A;  4KIG A;  3V7S A;  4AIJ A;  3ZP5 A;  4Y15 A;  1MJA A;  4EJW A;  4IHT A;  4O5V A;  2ZKZ A;  3E6B A;  2L54 A;  3CUQ B;  1T38 A;  5E18 F;  2G9W A;  3D0S A;  2X0L A;  2V1U A;  2MA3 A;  2EFP A;  3O3K A;  5CVR A;  4LLN A;  1D8J A;  3C3W A;  4UV9 A;  1O3Q A;  1ZG1 A;  3KLN A;  1XMK A;  2RVC A;  4L0Z B;  4U0W A;  3SQN A;  4EGZ A;  3NQO A;  4IVN A;  4HA8 A;  5L3B A;  2OD5 A;  4PZJ A;  4U7B A;  3ABU A;  2G7H A;  2Z9O A;  4HW0 A;  3V8L A;  3B73 A;  3RJP A;  4P55 A;  4Q5S F;  2DBB A;  3ZMS A;  2P6S A;  1T2K A;  1GVJ A;  1KQ9 A;  3ABT A;  3F8B A;  5K5R A;  2A68 F;  1IXR C;  1U5T A;  3WGH A;  3F23 A;  1S7A A;  2RC4 A;  3R4K A;  4R79 A;  2FBI A;  4BHC A;  1LB2 A;  2XKO A;  4RB2 C;  1O57 A;  1KQ0 A;  1U5T C;  2W25 A;  2QWW A;  3ZMT A;  1BJA A;  4PGG A;  4RGS A;  4MGR A;  1KU3 A;  2EA4 A;  2ZNY A;  4FHT A;  1B59 A;  2V6C A;  5DD4 A;  3ZMU A;  4IHS A;  1IRG A;  1KQ8 A;  2E7X A;  4L9J A;  4N9I A;  5TJJ A;  3ZMZ A;  5HDN A;  1G3S A;  4M6X A;  4BHP A;  1XDS A;  1G6N A;  2COM A;  5AIP A;  1HKT A;  4P9U A;  3T5X A;  2WWY A;  4HV5 A;  1XGO A;  2K4B A;  1W5S A;  1H9G A;  2DTR A;  1X3U A;  1VTN C;  3GF2 A;  2YSR A;  2FBH A;  2VOD A;  5D5W B;  2BGC A;  4KMU X;  2XIG A;  1IN4 A;  1HW2 A;  3GVA A;  2L01 A;  3VOD A;  2UWM A;  4RB1 A;  5ICF A;  3JTG A;  1NHA A;  5CJ9 A;  3L9F A;  2VON A;  2CWE A;  4N9H A;  3LAP A;  2QBY B;  4DQ2 A;  1GHC A;  2O0Y A;  1IW7 F;  2EWN A;  2NNN A;  4OOI A;  4IJA A;  1R36 A;  3E5U A;  4A12 A;  5ILS A;  4I98 B;  3JAM Z;  1C0W A;  3KCC A;  4N0B A;  2JPB A;  4F7Z A;  4TV7 A;  3P7N A;  3JSO A;  1LJ9 A;  4B09 A;  1K7A A;  3I71 A;  5BPI A;  1Z9C A;  2HGC A;  2YPR A;  2JSC A;  1ZG5 A;  1V4R A;  1WQ2 A;  2WC2 A;  4HLX A;  5LRS A;  3F72 A;  1ULY A;  5ILV A;  5DCM B;  3TGN A;  1R1T A;  3MCZ A;  5DEQ A;  3CUQ A;  1RNL A;  2EA2 A;  5F6F A;  1MDM B;  3R60 A;  1IRF A;  2FNP A;  3V7R A;  5BPD A;  3ULQ B;  1SD6 A;  5IT3 A;  2D45 A;  3H3Z A;  3CUQ C;  3DQV C;  1IN6 A;  1P92 A;  2QVO A;  3KP5 A;  5K5Q A;  2XVC A;  5LEJ A;  2VC1 A;  1WKM A;  4FX0 A;  4Y17 A;  3NEU A;  3H92 A;  3JTH A;  1PP8 F;  1HQC A;  2CFX A;  4MEY F;  4H0E A;  3J81 Z;  3RYR A;  3GFL A;  2A3S A;  5LEK A;  3FXU A;  1RZ4 A;  4M9Z A;  1U2W A;  2HYG D;  2FXA A;  1OMI A;  3KZY A;  1IF1 A;  1F1Z A;  4XLN F;  2A07 F;  1HXD A;  3IWF A;  4HOB A;  4PCQ A;  5FFZ A;  2KIU A;  1YYV A;  2H6C A;  2ISZ A;  5LHI A;  1IN8 A;  1MKM A;  4IRI A;  1KA8 A;  2YX7 A;  3CO7 C;  1JHH A;  3MAJ A;  2QQA A;  2YU3 A;  1R58 A;  1FSH A;  3KP4 A;  3QPT A;  1FBQ A;  3ROU A;  4S05 A;  1XSD A;  4DNC A;  4RS8 A;  2J5O A;  1ODD A;  4IRH A;  3CJN A;  3DPL C;  5E1W A;  4I7H A;  5J6X A;  1TLH B;  5ICE A;  2DPU A;  1FYL A;  1I6X A;  1QO0 D;  1DPR A;  2FOK A;  2P5L C;  5CLS A;  4EQQ A;  3QRF F;  4Y13 A;  3I58 A;  1KU9 A;  2KKO A;  3RKW A;  1I27 A;  3H3U A;  1BC8 C;  3EYI A;  2Q2E A;  2EV6 A;  4Q48 A;  2QM3 A;  4M73 A;  1HST A;  3PQJ A;  2IP2 A;  4A5M A;  3Q9V A;  4M74 A;  3ECO A;  5E1Z B;  4GYI A;  3N97 A;  1ZRD A;  2PI0 A;  2DO7 A;  2O6G E;  3F6V A;  3U9G A;  3ISP A;  2XGX A;  1XN7 A;  2FEZ A;  4CZZ A;  1R1V A;  1FYK A;  3IRQ A;  2KJC A;  3CLO A;  5FO5 A;  4UVC A;  3RIR A;  3F22 A;  2QBY A;  4I02 A;  1KU7 A;  3BY6 A;  3WGG A;  1T6S A;  2JRT A;  3FHZ A;  3KP7 A;  2H09 A;  1LEA A;  2FQ3 A;  4A0X A;  3FM3 A;  3T8R A;  2MLK A;  3GWZ A;  4E70 A;  5BOX A;  1YFH A;  1LVA A;  2FF4 A;  4LG0 B;  1QZZ A;  3C7J A;  3HHH A;  3WTV C;  3I4P A;  3BPV A;  4EJT A;  4G7O F;  2M30 A;  3C1D A;  3E6M A;  1HKQ A;  4ENK A;  2DK5 A;  3C18 A;  2F5D A;  1IZ1 A;  1HW1 A;  5HLG A;  2P4W A;  3TO6 A;  5L3D A;  4GXO A;  3D5L A;  2G7U A;  4RGR A;  3WG9 A;  2GZW A;  4S04 A;  4BYY A;  1FX7 A;  4O3M A;  2NAZ A;  1AOY A;  1SD7 A;  3SZT A;  3DEU A;  1STZ A;  1OKR A;  1MDM A;  5JVT A;  1IN5 A;  2RGV A;  3DV8 A;  1T39 A;  1MGT A;  2OQG A;  4CGZ A;  3KP6 A;  5FLX Z;  1R1U A;  1ZAR A;  1FZP B;  1LQ1 A;  1Z91 A;  1XD7 A;  2EV5 A;  5L3C A;  3RKY A;  3CDH A;  2VT2 A;  2PN6 A;  3LQQ A;  2O8X A;  4HX4 A;  2F5E A;  2V9V A;  4R1H A;  1BBY A;  1J2X A;  5L3F A;  2VOO A;  2ZME A;  2L4M A;  2OU2 A;  2Z33 A;  3MZH A;  3HHG A;  2AS5 F;  4RAZ A;  3BDD A;  4CO8 A;  5F1R A;  4A0Z A;  1HKS A;  6PAX A;  1I1G A;  1TW3 A;  1O7L A;  3FXR A;  2EJR A;  3EQL F;  3RDI A;  2FU4 A;  2P7C B;  1D3Y A;  1S8N A;  1KYW A;  3RPQ A;  3HTU A;  2TDX A;  5IT9 Z;  4EVI A;  4HF2 A;  2P5V A;  3U2R A;  3BZ6 A;  2J5P A;  1D5V A;  1G3W A;  1GXQ A;  1TBX A;  2JZY A;  4JK1 X;  2BEO A;  1UCR A;  1YW9 A;  1BI3 A;  2HFH A;  5D5V B;  1QGP A;  3HSF A;  5FGM A;  2P7V B;  4GYG A;  2XAF A;  2IJL A;  1E17 A;  4WXH A;  1Z05 A;  2IVM A;  3DXJ F;  3IHU A;  2QEN A;  1U6G A;  4RGX A;  2B0L A;  3LA7 A;  2E1C A;  2HDC A;  1T98 A;  2GXG A;  5ILU A;  3P9I A;  2EK5 A;  2FE3 A;  2HKX A;  4EV0 A;  1J5Y A;  1YTY A;  2HOE A;  2F2E A;  3I59 B;  3REO A;  2PQ8 A;  1G4D A;  5J8C A;  1BI2 A;  2KJB A;  3I53 A;  1YW8 A;  4RGU A;  4ZYD A;  1TNS A;  1G3T A;  4G6D A;  2QLZ A;  4EJO A;  1T0F A;  3VEP A;  3K9T A;  1AWC A;  2K86 A;  4HYE A;  2ADU A;  3BOQ A;  2OQR A;  4A6D A;  4LG0 A;  3VFZ A;  3MWM A;  3JAM K;  3KEQ A;  5A2Q Z;  2HEO A;  2RDP A;  4OMZ A;  3ZMV A;  1XGM A;  1WRJ A;  3TOB A;  4ESF A;  4MNU A;  4LD5 A;  4CIC A;  4EJV A;  5ICC A;  3KP3 A;  3GFM A;  1FP1 D;  2D2W A;  4I0B A;  4KIC A;  4LK0 F;  2XKP A;  4HZF A;  2R3S A;  2DW4 A;  2STW A;  3EUH A;  2IT0 A;  2VOP A;  2ZBK A;  3FMR A;  1O3T A;  2STT A;  2GIV A;  3LFK A;  2DPD A;  1ZG3 A;  2LKP A;  4WXC A;  3W6J B; 
#chains in the Genus database with same CATH topology
 4M72 A;  2IS2 A;  5M3M J;  1SEU A;  3CJR B;  4O6J A;  2GOX B;  2R7O A;  3EUH C;  2HZD A;  5D5U B;  2MC4 A;  2XAS A;  3BG6 A;  2EFQ A;  2GQQ A;  2PG4 A;  2X48 A;  3E1S A;  2UV1 A;  2OBP A;  2K40 A;  4L9T A;  3S1N J;  1QNT A;  1IUY A;  4A3B J;  3FXO A;  1WJC A;  2ME6 A;  4D0P A;  5L3E A;  4HQE A;  1NK3 P;  4KIS A;  4I2O A;  4P5O A;  2UXN A;  2XB0 X;  2ZJ2 A;  3PSI A;  1IN7 A;  3BRO A;  3QPH A;  4V2G A;  2CW7 A;  2W82 A;  3HRS A;  4U0V A;  2FRH A;  4KMF A;  4ENN A;  3BTI A;  3ZN0 A;  2ELH A;  5EG0 A;  2QEX I;  1RKT A;  2DQL A;  3ZCO A;  4HG2 A;  3RI4 A;  5KNL A;  4AIK A;  1HBX G;  3VB2 A;  4U0Y A;  4GGG A;  1LFP A;  3DP7 A;  3ERE D;  3HSR A;  1F36 A;  2E1O A;  2HQR A;  3FMS A;  1FP2 A;  2DOE A;  1R23 A;  2OTJ I;  4II2 A;  4JBA A;  1W36 C;  2M5W A;  1SD5 A;  1X1D A;  4UV8 A;  3J81 K;  3HOU J;  2DK8 A;  1FMV A;  4CCK A;  2DAO A;  2KIF A;  2RV8 A;  5J4Y A;  2DT6 A;  4UB6 C;  4Y7N J;  1MBH A;  4AVZ A;  5E3M A;  1F43 A;  1D0Z A;  3FXQ A;  2KFD A;  3S3O A;  1BW5 A;  5J1R A;  4B8X A;  1FBU A;  1RET A;  3QP5 A;  5LRR A;  1B9M A;  3HUG B;  3J80 Z;  3K69 A;  3BR2 A;  3DTE A;  1UHW A;  2BY1 A;  1OR7 A;  3F6O A;  1MMD A;  2PX9 A;  4ZYH A;  1UHM A;  3GFI A;  2PMH A;  2K4J A;  1YJ9 I;  1CF7 B;  3OOP A;  1OPC A;  3C2B A;  2M4G A;  1DGR M;  5TRD A;  4BY1 J;  2IA1 A;  3LSI A;  2FX0 A;  2JRM A;  2RKH A;  2R7W A;  2H6B A;  4B43 A;  4FCY A;  3KEO A;  3UNG C;  3X2Q H;  1SFK A;  1TT5 B;  2XRO A;  1B72 B;  5GTH C;  3IL2 A;  1OR7 C;  3T8T A;  3W2V A;  4BS9 A;  1JTX A;  2CO5 A;  2NYX A;  3GFJ A;  2HVS A;  2ACJ A;  3FXM A;  1XTA A;  4NQW A;  4GO1 A;  1U8R A;  3SYT A;  4PGH A;  4HDV A;  2WAQ N;  4E7J A;  1UST A;  2L9N A;  2FA5 A;  5FLV A;  3CCU I;  3CJQ B;  3MZY A;  2Y9Z A;  4QIW N;  5LHH A;  3F8M A;  3FZV A;  4W1U A;  4CXF A;  2XAH A;  3KET A;  1KGS A;  4UUS A;  5M5Y J;  1SD4 A;  2MD5 A;  3M07 A;  5JI6 A;  2IGN A;  3TKY A;  3S17 J;  2NNY A;  4G9Y A;  1G59 A;  3GTK J;  3COA C;  1DP7 P;  1J7K A;  1QPM A;  3QOE A;  1HF0 A;  1DDN A;  3PNY A;  1I3Q J;  3FK7 A;  1I3A A;  2D1V A;  3MQ0 A;  1ETX A;  1FWZ A;  3BT9 A;  3K70 D;  1NH3 A;  4JP0 A;  4OIQ F;  4FT8 A;  2NVQ J;  5K7H A;  3U1D A;  3M4O J;  2BV6 A;  3T0Y A;  4KIF A;  1APL C;  2LG4 A;  3I59 A;  4L9V A;  3CDL A;  1Q1H A;  2PMU A;  2TCT A;  3DTI A;  5HOO A;  1EH7 A;  1LNW A;  1P4A A;  5DTD A;  2L4A A;  1IDY A;  1O3R A;  2VBW A;  2DMU A;  3IUO A;  1K6Y A;  2BW3 A;  4WXD A;  3CCJ I;  2L7Z A;  2XGE A;  1PVE A;  3WE2 A;  2F5F A;  3CZ6 A;  1IXC A;  4KYW A;  3ZPL A;  3BTJ A;  3QP6 A;  5B3S H;  1IUF A;  2L02 A;  4HEA 2;  5TIS C;  5EYR A;  5E8G A;  2LRD A;  5D6F A;  4QPO A;  2H1K A;  2GA1 A;  3C2G A;  3TDZ C;  2L5Q A;  1UG0 A;  2E71 A;  3K4M A;  5EEH A;  3SFI A;  4BQO A;  2HPM A;  1FC3 A;  2DMQ A;  4GCV A;  2I8D A;  4XSZ F;  2FUG 2;  3HC7 A;  2VKD A;  1F9N A;  4MEX F;  1UJ8 A;  4EGY A;  1L3L A;  4MHG A;  1ETV A;  3JRH A;  1KZH A;  4E7Z A;  1QVT A;  3SZP A;  2VLA A;  3ZMD A;  3DPU A;  2CH0 A;  3L2Q A;  1FOX A;  4MQV A;  3HXL A;  2CYY A;  5LFA A;  3MZ8 A;  2ESN A;  2H8W A;  1Z21 A;  2PBI A;  5BS6 A;  3HGG A;  5LBQ A;  1U3E M;  4D7N A;  5JHU A;  3K2A A;  1MNE A;  3G71 I;  1J75 A;  1FNN A;  1ZAO A;  1MBJ A;  3WTT C;  2VC0 A;  2H27 A;  4V19 K;  1X1P A;  4KFC A;  4EMS A;  3MKL A;  3GYH X;  1Z7L A;  2DCE A;  2HYF A;  4G6T B;  2PFB A;  4LOC A;  3WHC A;  3K0L A;  2R5Z A;  1MBG A;  2DFI A;  3S3N A;  1X1C A;  2K27 A;  4XL9 A;  3MD2 A;  3JRD A;  3QYB A;  2R7S A;  3AL0 C;  5M5W J;  4Y52 J;  1S29 A;  4FTH A;  1HSJ A;  3Q0V A;  2IXS A;  4PDK A;  3RZD J;  3FIS A;  4OIR F;  2R7F A;  4NUB A;  2QA4 I;  4CHU A;  3F8C A;  2AQE A;  4OIN F;  1P6R A;  3ZQF A;  3HBL A;  3HOV J;  4F3Q A;  5K1Y A;  2FSW A;  1SFX A;  3HRU A;  2CU7 A;  4A0Y A;  3PIO F;  1FLI A;  3IH4 A;  1HCR A;  4ESJ A;  4D5F A;  3LOC A;  4L9N A;  1OQY A;  2WAD A;  1W4M A;  1UB9 A;  1FIP A;  1SAX A;  1MSE C;  3O6B B;  5K7F A;  1KYZ A;  2X1C A;  1W7P D;  2PMZ N;  1BN5 A;  1MH3 A;  2L9V A;  2Z16 A;  5FLX K;  3EUA A;  2P81 A;  4HF1 A;  5B5E C;  2K9L A;  5HVQ C;  2O7O A;  2QUF A;  3MEX A;  4EJU A;  2ZFU A;  2A5W A;  2LF7 A;  3K4L A;  2CQX A;  4BQQ A;  4FX4 A;  2NVT J;  1IV6 A;  3QOP A;  4XID A;  1TQM A;  4F55 A;  3GLL A;  2X1E A;  2XAG A;  5B1B H;  2PLY A;  3IWZ A;  3L2R A;  2Y48 A;  2BHZ A;  2MBF A;  5L3G A;  1U9O A;  2IPQ X;  1ZLK A;  2VT3 A;  2KRC A;  2W57 A;  1USS A;  3DKW A;  4KT6 A;  4WWC A;  3MFK A;  2OCE A;  2VJ4 A;  1P7J A;  2A6H F;  3A03 A;  3PO2 J;  2W24 A;  3HOW J;  1DU6 A;  3HTS B;  3LST A;  3Q0U A;  3OYF A;  3IRR A;  1ON1 A;  2L7K A;  1MBE A;  1MMN A;  1W5C C;  2A6T A;  3S2H J;  2M45 A;  1PP7 U;  4XOP A;  3PO3 J;  2GOM A;  4NB5 A;  1VF9 A;  3S2D J;  3GW2 A;  3MN2 A;  3HUG A;  4IHX A;  5DS9 A;  1ZRC A;  1BW6 A;  2HDD A;  5B66 C;  1WI3 A;  3PUF A;  2CG4 A;  4LGW A;  2MC3 A;  1O3S A;  1H8A C;  2UXX A;  3RPU A;  3DBR B;  3WTY C;  5EGO B;  1QZY A;  2YX4 A;  2KQR A;  1OCP A;  2P6T A;  4RB0 A;  3W3C A;  1XCB A;  3VPR A;  1BOB A;  3LFU A;  3WGI A;  2OZU A;  1ZRE A;  3OYJ A;  3LSK A;  5IT9 K;  5DCM A;  2LNB A;  3B02 A;  4BHB A;  3S2W A;  5BQT A;  4C2U A;  1ZGJ A;  2XF7 A;  1B72 A;  1YX3 A;  1WJE A;  4LJZ F;  2H94 A;  3IAM 2;  2XGD A;  1Z6T A;  3PFY A;  1WI9 A;  2BY0 A;  3IH2 A;  2R7Z J;  1FSE A;  1ERD A;  3E5Q A;  3WG7 H;  3R6S A;  5JR3 A;  5HDK A;  2CS3 A;  2W85 A;  2VBX A;  4E7S A;  3CMA I;  2HYJ A;  4ZYE A;  4WK8 F;  1RI7 A;  2L7M P;  1B6A A;  1TWA J;  2K9S A;  3LWF A;  4B48 A;  3OYA A;  4I0A A;  1HLV A;  2FBK A;  2FML A;  5E1X A;  4KIT B;  1K6O A;  4LB5 A;  3BR0 A;  2KIM A;  4WF2 A;  2MH9 A;  2CW0 F;  3DLA A;  5E17 F;  1ZN2 A;  4M3F A;  2M0M A;  4DJA A;  1PYV A;  1LDD A;  1UFM A;  4HBL A;  5H6Q A;  4UNO A;  4I99 C;  3JRA A;  2V1D A;  3ASN H;  4M9X A;  2V9K A;  1QQI A;  1F4K A;  1WH7 A;  1J0R A;  1SC7 A;  4AWX B;  3FK6 A;  2KDZ A;  1YG2 A;  1XDU A;  2ZCW A;  2HXI A;  1OJL A;  2I5U A;  2BE5 F;  3IKT A;  3I0T A;  3GUD A;  2XV4 S;  4ON0 A;  5CQG A;  5H20 A;  3OYL A;  3LQR A;  4HPQ A;  3OY9 A;  4GDF A;  5FB2 A;  4NBQ A;  4QLC U;  1FT9 A;  1ETO A;  1V3F A;  3OV8 A;  4IO9 F;  3F8F A;  2EPF A;  2ZXJ A;  3LSG A;  1SMY F;  1ZGW A;  5IP7 J;  4R8H A;  1W0U A;  4Z2Y A;  3CCM I;  4LLL A;  3OYH A;  2VE8 A;  4JOM A;  1QHH D;  5J4V A;  1U78 A;  3CO6 C;  2BVL A;  4ZZL A;  4KN4 X;  5HS7 A;  2HKO A;  3ZQ7 A;  4ANJ A;  3OSF A;  1BM9 A;  4WCG A;  2E7W A;  1I5Z A;  5FD6 A;  2VJ5 A;  2HQN A;  3FKI J;  2JTV A;  1REP C;  3CTA A;  1I50 J;  5K7Z A;  5LD2 C;  3KYL A;  4CA0 A;  5KHD A;  3DTK A;  1B1B A;  3PNT A;  1X3Z B;  1BOA A;  3GZ5 A;  3HG9 A;  3S32 A;  4A3C J;  4HF0 A;  1AU7 A;  1IG7 A;  4P1W A;  2IAI A;  3W2A A;  3TDU C;  4XLP F;  3OIP A;  2WTE A;  3HOT A;  3DU5 A;  4OIP F;  4M3G A;  1YIO A;  1IDZ A;  1YS7 A;  4DIQ A;  1VQN I;  4DOZ A;  5HNH A;  3F9K A;  3TOA A;  5LLQ A;  4G8X A;  5M3F J;  4DGW B;  5EEG A;  5A2Q K;  3FF5 A;  3OYD A;  2XPU A;  3RKX A;  4JX4 A;  1A04 A;  3A0B C;  1TTY A;  3BJA A;  4A3G J;  3V8K A;  2GWR A;  4CSW A;  2DLL A;  1YIJ I;  1XG1 A;  3K1N A;  2X6X A;  4CZC A;  4RAY A;  3KLO A;  2ZNZ A;  3S1Q J;  4QWQ A;  3HIF A;  2KPM A;  2DOD A;  1FOK A;  3ML6 A;  4II3 A;  3OS2 A;  1ETQ A;  3K2Z A;  3PFI A;  5K5O A;  3KX2 A;  1V5F A;  1DGW Y;  5ERI A;  4ENJ A;  2ID6 A;  1KU2 A;  3SHF A;  5IYB J;  3CC7 I;  2ELK A;  1EV7 A;  4C3I J;  4MTD A;  4KUM A;  3FDY A;  4JQF A;  1D1A A;  2XB5 A;  3ZOB A;  1H0M A;  2VE9 A;  3LSJ A;  4IHV A;  4UUV A;  3GO5 A;  5JLX A;  4EM0 B;  4BL0 B;  3OS0 A;  2QQB A;  3ZN1 A;  1LDK B;  3K1M A;  2O61 A;  5E3L A;  2AO9 A;  4BNC A;  1K83 J;  1IGN A;  1K79 A;  4IL6 C;  1JHF A;  2ECB A;  4MO7 A;  2XC7 A;  2WA0 A;  1MBF A;  1FTT A;  4N4O B;  4KA4 A;  4XLF A;  4G94 A;  4EAT A;  1R71 A;  3O2P E;  3DEW A;  1OYY A;  2ISY A;  4BAY A;  4G7Z F;  2L3D A;  3ECH A;  4G6Q A;  1EH8 A;  2CW8 A;  2E1N A;  2W1O A;  2CMP A;  3FXJ A;  4E4H A;  1OFC X;  3HYI A;  3BCB A;  3HKZ N;  2RQQ A;  3L7W A;  2HZT A;  3WU2 C;  2DOF A;  2NVX J;  1R5I D;  2MG4 A;  3LA2 A;  2F6C A;  1WSU A;  1XSV A;  4GFB A;  5H6R A;  5AON A;  1ZRF A;  2PJP A;  3BLY A;  1LDJ A;  2F4M B;  2CQ7 A;  2AXT C;  4ETS A;  2C6Y A;  2DA5 A;  3WTX C;  1XMX A;  1IC8 A;  4D7M A;  1FEX A;  1X4P A;  1B9N A;  4ZH4 F;  2EIL H;  2XAJ A;  1SVM A;  1BI1 A;  2ESH A;  5FKO A;  2TRT A;  3IC7 A;  2GXA A;  3WU1 B;  4FQG A;  2V1X A;  3AG2 H;  3NWS A;  5E8I A;  1N75 A;  3CES A;  1VQO I;  3RKQ A;  4KT5 C;  4HNT A;  2P8T A;  4F92 B;  2BBY A;  2ICW G;  4HNV A;  3J80 K;  5EGO A;  1YI2 I;  3ZQI A;  4B4C A;  1G3Y A;  2M8E A;  1CQT A;  3S15 J;  3V4G A;  1FYM A;  4BE1 A;  3SDB A;  2DMT A;  2RNG A;  3CD6 I;  5F0H A;  3BJO A;  1ZR4 A;  2CRG A;  2GLO A;  5ED4 A;  1S3J A;  1RES A;  2XAQ A;  2JA6 J;  2CGP A;  2XPW A;  1SAU A;  4HAM A;  1WWX A;  2F5C A;  3PQK A;  4ESB A;  5IOZ A;  5D8L B;  4RMN A;  3CF5 F;  3G73 A;  4F52 A;  3CME I;  4XRF A;  3HRM A;  2F48 A;  1LEB A;  3IKV A;  5H2F C;  2KMU A;  4XRS G;  4ZYA A;  3W2W A;  2M8G X;  1JXS A;  2V1N A;  2LF8 A;  2Y75 A;  2D5V A;  3FM5 A;  3TP3 A;  1TL8 A;  1W7P B;  1YRN B;  2K9M A;  3M1E A;  2FJ1 A;  2PEX A;  2YR2 A;  3OYN A;  2EH3 A;  5LGN A;  4FE7 A;  2OF7 A;  1QA6 A;  2R7U A;  4YIF A;  1OYW A;  1EH6 A;  1VQP I;  2EZH A;  3GLX A;  1BC7 C;  2IEK A;  4DZP A;  5IPA A;  4A2U A;  4EM2 A;  4XK4 A;  5DUI A;  2R7V A;  5FFX A;  3ELK A;  5IYC J;  2CV2 A;  3TW6 A;  1NG7 A;  5GAD J;  1R4N B;  3D5S C;  3H5R A;  2G0E A;  4AD9 A;  1DPU A;  1SMT A;  1XGN A;  3TL4 X;  1N77 A;  1K78 B;  2R5Y B;  2IBD A;  2LYC A;  2XDV A;  4IXA A;  4DYR A;  1P2F A;  3QPS A;  5EEA A;  3V7C A;  2ZXH A;  3RYP A;  1VQ7 I;  5KCM A;  4A6E A;  4NC7 A;  2KRH A;  1ZLJ A;  1XX5 A;  1ZH5 A;  2DOA A;  3HOX J;  2NOJ B;  1SAN A;  2W48 A;  3HRT A;  4A3D J;  2WAF A;  2DDB A;  1S7O A;  2KRF A;  2V4J C;  4AC0 A;  3GEZ A;  3V8J A;  5CVI A;  1E2X A;  1P9Q C;  4AIH A;  4DBQ A;  4IOA F;  3G4S I;  2R7D A;  5HLH A;  5JVG F;  1LPQ A;  3CCE I;  4ASN A;  1AKH B;  3D1N I;  1VI0 A;  4CCL A;  5J47 A;  4AYB A;  3ZRG A;  5CVU A;  1F5T A;  3R61 A;  4BEH B;  1A36 A;  4W97 A;  4E7H A;  4C2T A;  4LFU A;  2W7N A;  5GAH J;  4U88 A;  2A05 A;  3I64 A;  3NAU A;  1W0T A;  5DD8 A;  2FMY A;  2IA2 A;  5E79 C;  3GTM J;  3DCF A;  5BMZ A;  5DCF A;  4ZDL A;  3WTW C;  1PDN C;  3A0H C;  2V7F A;  1XMA A;  1QHG A;  1M1E B;  2K7L A;  1XGS A;  1YO5 C;  2RQP A;  2QZ8 A;  2R0Q C;  4KIB A;  3ZGK A;  3MMY B;  3MVP A;  1U8B A;  2GIZ A;  5HNF A;  2IW5 A;  3WTS C;  2XF6 A;  5F0F A;  3OYM A;  2ZB9 A;  4OMY A;  2E1M B;  1P4X A;  4Q47 A;  2M87 A;  4BDY A;  3GTJ J;  2MH2 A;  2HQ5 A;  3BPX A;  1XC5 A;  2B7E A;  4ZTJ A;  1H9T A;  2BXY A;  4M6Y A;  2EIN H;  3WOD F;  3L1P A;  5LHG A;  4IOC F;  5D5X B;  2OCC H;  3EDP A;  2ZSI B;  2D1H A;  2ZO4 A;  3EET A;  4Y3O A;  3VDX A;  3S93 A;  4CYD A;  2EV0 A;  1V54 H;  3E6D A;  3L00 A;  4I09 A;  4RB3 C;  2HS5 A;  3ONQ A;  2EIK H;  4BQA A;  1WCM J;  3LL7 A;  3I56 I;  3GXO A;  2LC2 A;  2JVH A;  3PNV A;  3GTP J;  3L2U A;  2DU9 A;  2FOW A;  1T95 A;  2L9S A;  4Q4Z F;  4BBR J;  3N4M A;  1HC8 A;  1D8K A;  4YIR X;  2VN2 A;  2EFW A;  1IAW A;  2RN7 A;  4C3J J;  3VOE A;  1Y0N A;  3CMY A;  3K70 C;  1S6L A;  1ONV A;  4QSH A;  2B63 J;  4BJ5 C;  3L09 A;  1Y56 A;  2LP0 A;  3KYD B;  1OCZ H;  5LGU A;  2HTS A;  2GBY A;  3A01 B;  2OUM A;  3L2C A;  2GA2 A;  4YII A;  2IRF G;  2LH9 A;  2ME0 A;  3AFH A;  2JA5 J;  2DDA A;  5DV5 A;  1YS6 A;  2LDU A;  2M1B A;  3W6V A;  3U1K A;  3RTR A;  1Z67 A;  1JTY A;  2UUZ A;  5LGT A;  5FRM A;  3KE2 A;  3F0C A;  2IA0 A;  4LK1 F;  3HOS A;  2WV0 A;  3OIO A;  1X58 A;  4RA2 A;  2ZFW A;  2ZME B;  5DYM A;  5KAI C;  1WJB A;  3I4N J;  2LK2 A;  3TQN A;  3VYU B;  4HDU A;  4I6Z A;  5E3N A;  2DFF A;  2HR3 A;  3Q9S A;  5F04 A;  2VBZ A;  5C4X J;  3M3Y J;  2X9D A;  2Y0S N;  4AUX A;  4E6K G;  3NAR A;  5IOY A;  3AKZ A;  2A6E F;  2X4H A;  3ZQL A;  4ABZ A;  4CCJ A;  2JA7 J;  3FMQ A;  1FPQ A;  3FXK A;  4LB6 B;  2A69 F;  4A5N A;  4BH9 A;  5EF6 A;  4AVP A;  3PM1 A;  4XSX F;  2EB7 A;  2DT7 B;  3W6K B;  2HTJ A;  2KHM A;  4WX9 A;  4B3A A;  3J7Z I;  2E35 A;  1ETK A;  3G3Z A;  3P9C A;  1R22 A;  1OYI A;  2VJJ A;  2WAQ A;  4RBO A;  3J7A O;  1Z7U A;  1EJ9 A;  3DBL B;  2NVU B;  2CV0 A;  1JE8 A;  2HVQ A;  2VQG A;  1UEL B;  2Z5U A;  2O03 A;  3R0J A;  4B47 A;  1UHS A;  1DUX C;  4NHJ A;  1PJR A;  2M34 A;  4KNY A;  3H5A A;  1Z6R A;  3GX4 X;  2M7B A;  3LAJ A;  4PJN A;  2K85 A;  1K61 A;  2DA1 A;  1IXS B;  4M71 A;  4M6V A;  3WU0 A;  1OLT A;  1WHU A;  4LLG F;  2MW8 A;  3QU6 A;  1MND A;  2JPC A;  1BR4 A;  2VKH A;  1TNT A;  1RUO A;  3G1O A;  2R7T A;  4HQM A;  2P5K A;  1LFU P;  1Y0U A;  2Z99 A;  4EM1 A;  5M5X J;  1MH4 A;  2EIM H;  3JRG A;  3QQA A;  1MD0 A;  3QAH A;  3QU3 A;  1XB4 A;  3P9K A;  5FKL A;  1PUE E;  2WY7 Q;  4RLF A;  2A61 A;  1V55 H;  1SFE A;  2NOG A;  1D1C A;  1R5H A;  2XHK A;  4UY8 I;  1J9I A;  1T56 A;  2LSO A;  2DA4 A;  1W7P A;  3WTZ A;  5CPR B;  2LKX A;  2Y9Y A;  4L18 B;  3F8N A;  1GT0 C;  4ENM A;  2OA4 A;  1VZ0 A;  3HJE A;  1JT6 A;  4HX7 A;  1RC9 A;  4S0H B;  2VIX A;  2XAU A;  1CGP A;  1A6Q A;  1IJW C;  5CVV A;  1ZHF A;  1TQP A;  2YU9 J;  3ABL H;  4XLC A;  2IGM A;  5HS8 A;  3DEE A;  1P4W A;  5FKN A;  4XQF A;  5E3O A;  2DYS H;  4MIM A;  1B4A A;  1X1A A;  5AIQ A;  1LE8 B;  1XCV A;  4KDP A;  2OZ6 A;  2RNJ A;  2CQK A;  4HX8 A;  1GXP A;  5FD5 A;  3S3M A;  2O3F A;  2FNA A;  1I1S A;  1K78 A;  2R5Y A;  1BIA A;  2NS0 A;  5GPA A;  1ZR2 A;  5GP9 A;  2PJR B;  1MJ9 A;  2Y0S A;  1R00 A;  1L0O C;  1N78 A;  5D4S A;  2HU9 A;  4MQ9 F;  3I9V 2;  4MTE A;  4LMY A;  5F64 A;  2DI3 A;  3DF8 A;  4MFD A;  3M7G A;  3F3X A;  3E6C C;  2HOT A;  2AQF A;  1X19 A;  4BKX A;  3KZZ A;  3OIQ A;  2NXN B;  5D4R A;  1TWH J;  1I39 A;  3I54 A;  2GAU A;  2H8R A;  1FBS A;  5KVR A;  3I3L A;  4CDG A;  3JRF A;  3FBN B;  3M8F A;  3M8E A;  2KDO A;  5FRN A;  4AID A;  2FD5 A;  3BZC A;  5BNG A;  2VBY A;  4OIO F;  4HV6 A;  1U5T B;  1R7J A;  2EFO A;  3E97 A;  4IF4 A;  1E3O C;  3WTU C;  2QKM B;  2E2I J;  4BEH A;  1CF7 A;  1BIB A;  3LA3 A;  1YQA A;  2K5C A;  4IKF A;  3H9G A;  2UZK A;  4HLY A;  1VQM I;  1JKP C;  4PJL A;  1TWC J;  2ETH A;  1J59 A;  1MMS A;  2LY2 A;  3FX3 A;  3GTQ J;  2DMN A;  1YLF A;  4IPA A;  2YUS A;  3K4N A;  2M0C A;  2V6E A;  2QSG X;  4XIC A;  1RIO H;  1TQI A;  3DFG A;  3TO9 A;  4I01 A;  4YFK F;  2GXB A;  5CVJ A;  3E3V A;  3KP2 A;  5EJC A;  4XBF A;  4IRG A;  4ZZD A;  1K4S A;  3TW7 A;  3NRV A;  1T8I A;  2JUC A;  2K3P A;  4UVB A;  1I6H J;  1TW2 A;  1NTC A;  1YIT I;  2CFO A;  1HDP A;  4YFX F;  4PSW A;  2WAE A;  4ZC3 A;  5C3E J;  4BY7 J;  1RUN A;  4QTR A;  4DBR A;  1R49 A;  2DJN A;  4BXU A;  3SEZ A;  4L5I A;  2JT1 A;  1HW5 A;  2PMZ A;  4XKW A;  2JA2 A;  2LR8 A;  2L0K A;  3BWG A;  3DPT A;  4DW6 A;  1BL0 A;  4KJZ A;  4U7D A;  1MNM C;  2Y0M A;  3K1P A;  3SFZ A;  2BYV E;  2Q8K A;  3R0A A;  5C4J J;  1JKR C;  2NRA C;  1MIJ A;  3SDG A;  2M9H A;  1MJB A;  2EFN A;  5KK1 A;  1V5E A;  1JJ6 C;  3GZ6 A;  1SVO A;  3CUO A;  1R5G A;  3M1C A;  3JSP A;  3H35 A;  1H88 C;  3BJ6 A;  3FWE A;  1X4O A;  2K9N A;  2LD5 A;  1S7E A;  2RAE A;  4XKB A;  2MYS A;  3MKW B;  3ZQG A;  2W84 A;  1Z1D A;  3BR6 A;  4DYQ A;  4ZYG A;  4IX7 A;  2XRN A;  4KN7 X;  4UHT A;  2VXZ A;  3F21 A;  3T1B A;  1FY7 A;  1W5T A;  2XUB A;  3Q0W A;  4XRS A;  3GTG J;  1ZGA A;  4BXF A;  4UVA A;  2JMW A;  1XSX A;  4M9S A;  1JUM A;  2QKL B;  4YG2 F;  4OU0 A;  3B6A A;  1DQU A;  4K2E A;  3AAF A;  5D8K B;  1YE9 A;  1ZYR F;  3A01 A;  3ABK H;  4XR6 A;  1PUF B;  2A5Y B;  2Q0O A;  2WB1 N;  2M7A A;  3AG1 H;  2IGK A;  2MLG A;  3SXY A;  1ZTR A;  3HSE A;  3CCY A;  2IGO A;  5EG0 B;  1ON2 A;  1QBJ A;  2QQ9 A;  4XLE A;  3K6G A;  2K02 A;  4MLO A;  2DA3 A;  5CYV A;  3SZG A;  2DQR A;  1JGS A;  5J8F A;  3Q5F A;  1O4X A;  3TO7 A;  4NC8 A;  3I5U A;  5HLI A;  1ETW A;  3KPH A;  4CCO A;  1R6R A;  4OAZ A;  2DT5 A;  5DM7 F;  2AXL A;  2HOS A;  1YW7 A;  5ICG A;  4P96 A;  3M9A A;  3DLL F;  3BP8 A;  2EQR A;  3A1Y A;  3KFW X;  4L5J A;  5DDG A;  4G7H F;  1SFU A;  1BJZ A;  4CCN A;  3S1M J;  2KIQ A;  3CCV I;  2V79 A;  3WE3 A;  2XRL A;  4L0Y B;  3CQZ J;  1K4T A;  5HDG A;  1T08 B;  2HQA A;  3QWL A;  4A3I J;  2Z3Y A;  2O8K A;  5D6E A;  3E5X A;  2HWV A;  3HM5 A;  5HS9 A;  1MZB A;  1X2N A;  1BI0 A;  1D1B A;  5DUK A;  3WHB A;  4YFN F;  3OMY A;  3OL4 A;  3EYY A;  4HNU A;  1YOV B;  3GZN B;  1O7F A;  5E20 A;  2CSO A;  4UXN A;  3JW4 A;  1RKW A;  2QYO A;  3QYF A;  4OWR B;  3JRI A;  4P9F A;  1IV8 A;  4CUG A;  1VQK I;  5JFR A;  2ID3 A;  1E3H A;  2MD0 A;  2OAZ A;  4KIG A;  3IV5 A;  3FHN A;  3DBH B;  4HST A;  3V7S A;  2MAB A;  4AIJ A;  3ZP5 A;  4Y15 A;  1MJA A;  4XN0 A;  4A3M J;  4EJW A;  2R7R A;  4IHT A;  2MFZ A;  4O5V A;  4PJM A;  2ZKZ A;  3E6B A;  2L54 A;  2W00 A;  4A93 J;  1ZK8 A;  2NS8 A;  3CUQ B;  1T38 A;  5J1U A;  5E18 F;  1VQ4 I;  2X85 A;  4E7K A;  2BY2 A;  2G9W A;  3EPZ A;  3OYC A;  1G2H A;  3D0S A;  2H1L A;  2X0L A;  3CP8 A;  3CC4 I;  3ZQH A;  3L2V A;  2V1U A;  2OTL I;  4RDU A;  4A3J J;  2OJE D;  2MA3 A;  2EFP A;  3O3K A;  1Y1V J;  3A02 A;  5CVR A;  4LLN A;  1D8J A;  2NVY J;  3C3W A;  3FXL A;  4C3H J;  4UV9 A;  4X6A J;  1O3Q A;  1ZG1 A;  3KLN A;  1XMK A;  2RVC A;  9ANT A;  4L0Z B;  4U0W A;  3OR1 C;  1MSF C;  4BXX J;  3SQN A;  4EGZ A;  1TWF J;  3NQO A;  3H9J A;  3OSG A;  4HSR A;  4IVN A;  5IY5 H;  4DZJ A;  4HA8 A;  5L3B A;  2OD5 A;  4PZJ A;  1BR1 A;  4I76 A;  5TGT A;  4U7B A;  3ABU A;  2G7H A;  5GPC A;  2Z9O A;  2PJR A;  1R9T J;  3VSL A;  4HW0 A;  3V8L A;  2M3A A;  3B73 A;  3J7Y J;  3RJP A;  4FET A;  4BBS J;  1BA5 A;  4P55 A;  4Q5S F;  2DBB A;  1N25 A;  3ZMS A;  2P6S A;  1T2K A;  1GVJ A;  4XOT A;  3I55 I;  2ZXI A;  1KQ9 A;  2VL8 A;  4XN3 A;  2LVS A;  3ABT A;  4QPQ A;  1ACI A;  4MFE A;  3F8B A;  5K5R A;  2A68 F;  2Y31 A;  1GV2 A;  3BR3 A;  1IXR C;  1OCO H;  3CLQ A;  1HOM A;  1U5T A;  3WGH A;  3BG5 A;  3CDI A;  3F23 A;  1LVK A;  1S7A A;  2YS9 A;  2RC4 A;  5IP9 J;  1NK2 P;  1Y8Q B;  3K7A J;  2KL4 A;  3R4K A;  4R79 A;  2VI6 A;  2FBI A;  4BHC A;  3OR2 C;  4C9Y A;  1LB2 A;  2XKO A;  3V42 A;  2LY1 A;  4RB2 C;  4HRI A;  2QGU A;  1Y6I A;  1O57 A;  1ZKG A;  4X0G A;  3HGY A;  4C2M J;  3IP4 B;  1KQ0 A;  1A6I A;  3BTL A;  1KON A;  1YX5 A;  2COB A;  1U5T C;  1A5J A;  2LFB A;  2QWW A;  2W25 A;  4NDL A;  2LKS A;  3ZMT A;  3O8G A;  1BJA A;  2VB6 A;  2I10 A;  4PGG A;  4RGS A;  1GUU A;  4MGR A;  1KU3 A;  2EA4 A;  4NC6 A;  2ZNY A;  4FHT A;  1B59 A;  3A4C A;  1VND A;  2EBI A;  4UB8 C;  2V6C A;  5DD4 A;  2LLK A;  1TC3 C;  1ETY A;  3ZMU A;  2E36 A;  5CQE A;  4IHS A;  1IRG A;  1KQ8 A;  3E0J B;  1YJW I;  2E7X A;  4PJ0 C;  2VAS A;  4L9J A;  4N9I A;  5TJJ A;  1WFX A;  1FOY A;  3ZMZ A;  5HDN A;  1G3S A;  2OV7 A;  3BC8 A;  4M6X A;  4BHP A;  1XDS A;  1G6N A;  2COM A;  2Q2E B;  5AIP A;  4ZTF A;  1Z77 A;  3ESW B;  4XON A;  3P5J A;  1HKT A;  3BG3 A;  3H9Q A;  3HKZ A;  2NS7 A;  4P9U A;  3G2B A;  3T5X A;  4D5C A;  1IRZ A;  2WWY A;  4HV5 A;  3S16 J;  3AG3 H;  3JRB A;  1XGO A;  2K4B A;  1W5S A;  2DMP A;  1H9G A;  4BE0 A;  2DTR A;  1X3U A;  1VTN C;  3GF2 A;  2YSR A;  2FBH A;  2VOD A;  2L2O A;  5D5W B;  2BGC A;  4KMU X;  2M4K A;  3ABM H;  2XIG A;  5FKK A;  1IN4 A;  2WV1 A;  4OAY A;  4XOR A;  1HW2 A;  3GVA A;  2L01 A;  3VOD A;  2UWM A;  3RQI A;  4RB1 A;  5ICF A;  3JTG A;  2K3F A;  4M3B A;  1NHA A;  5CJ9 A;  4BU2 A;  1PUF A;  3L9F A;  3AG4 H;  3HOY J;  3S14 J;  2VON A;  2CWE A;  4IZZ A;  1W36 D;  2IS1 A;  2CUZ A;  4N9H A;  3FKJ A;  3LAP A;  2QBY B;  4DQ2 A;  3OYK A;  1MBK A;  1GHC A;  2O0Y A;  5EDN A;  1IW7 F;  2O5R A;  1E3P A;  2EWN A;  1D0Y A;  3TBI A;  2WY8 Q;  4YRV A;  2DXI A;  2NNN A;  4RM2 A;  4OOI A;  4IJA A;  4F91 B;  1WJD A;  1R36 A;  3E5U A;  4A12 A;  1V5G A;  4A3F J;  5FKM A;  2B9S A;  2DFE A;  4I98 B;  5ILS A;  5FRO A;  3JAM Z;  3JRC A;  2V9P A;  1C0W A;  3KCC A;  4N0B A;  2JPB A;  4F7Z A;  1MMG A;  4TV7 A;  4XLA A;  1JI8 A;  4CCM A;  2MGQ A;  3BG9 A;  3P7N A;  1Z3X A;  4XNF A;  3JSO A;  1LJ9 A;  4B09 A;  1ITY A;  4FE4 A;  4V2F A;  5CKT A;  1K7A A;  3I71 A;  5BPI A;  2CUF A;  1Z9C A;  3E7L A;  2HGC A;  4DYC A;  2KLO A;  3LSH A;  2YPR A;  2EZK A;  4F93 B;  2XSD C;  1RR8 C;  2HOA A;  2JSC A;  3VYT B;  2RRE A;  1ZG5 A;  1B8I B;  1V4R A;  1WQ2 A;  2WC2 A;  4HLX A;  5LRS A;  3CCQ I;  1X3W B;  3F72 A;  1ULY A;  5ILV A;  1TZL A;  5DCM B;  1RRJ A;  2W4S A;  3TGN A;  3IAS 2;  1MMA A;  3A2K A;  2XPV A;  1R1T A;  2ECC A;  3MCZ A;  1VQ6 I;  3KIO A;  5DEQ A;  3CUQ A;  1RNL A;  4Y4R A;  2ZC2 A;  2EA2 A;  5F6F A;  5F27 A;  2CV1 A;  4A3E J;  1X2M A;  3DKX A;  2Y2Z A;  1UZC A;  3R60 A;  1MDM B;  1IRF A;  4IQJ A;  1POG A;  1WJ5 A;  2FNP A;  3BCA A;  2X6O A;  3V7R A;  2BHY A;  5BPD A;  2CJJ A;  1QZE A;  3DU6 A;  2OPT A;  3BQY A;  3ULQ B;  1WJF A;  1SD6 A;  2LRE A;  5IT3 A;  2D45 A;  3H3Z A;  3VYS B;  3CUQ C;  3DQV C;  1IN6 A;  1P92 A;  4IEJ A;  2QVO A;  3KP5 A;  5K5Q A;  2XVC A;  4CYC B;  5LEJ A;  3S1R J;  2VC1 A;  1WKM A;  4FX0 A;  4Y17 A;  2EZL A;  3QOD A;  4EEF G;  3NEU A;  5J3L A;  1QRY A;  3H92 A;  4XKV A;  2HDW A;  2L7F P;  2CUJ A;  3JTH A;  1HQC A;  2CFX A;  4MEY F;  1PP8 F;  4H0E A;  1RPW A;  3H36 A;  2KIS A;  2Z2S B;  1JKO C;  3J81 Z;  3DWL E;  3RYR A;  5J1Y A;  3GFL A;  2A3S A;  1D0X A;  4CH7 A;  3FXU A;  5LEK A;  1RZ4 A;  4IHW A;  4M9Z A;  2R93 J;  2X51 A;  4BJT A;  1U2W A;  2HYG D;  2FXA A;  1OMI A;  3KZI C;  2Z1D A;  3KZY A;  1IF1 A;  2JK3 A;  1F1Z A;  4XLN F;  5IP6 A;  1LUJ B;  2A07 F;  1HXD A;  3IWF A;  3VSK A;  2XGC A;  3LSR A;  4HOB A;  1JGG A;  4PCQ A;  4XM3 A;  2JVG A;  2KIU A;  5FFZ A;  1FMW A;  1YYV A;  2H6C A;  2ISZ A;  5LHI A;  2HXO A;  3PUB A;  3UKG A;  1IN8 A;  4FAS D;  5EZG A;  3FIW A;  3TED A;  2P0W A;  4BUP A;  4BQN A;  1MKM A;  4IRI A;  1FTZ A;  1KA8 A;  2YX7 A;  2EZI A;  4RAG A;  3BG7 A;  5HOD A;  3CO7 C;  1JHH A;  3MAJ A;  4GRI A;  2QQA A;  2F5V A;  2YU3 A;  3GTO J;  2JSP A;  1R58 A;  1FSH A;  1Y1W J;  2VQL A;  3KP4 A;  3KYC B;  3OL3 A;  5KAF C;  4G12 A;  4XLH A;  3QPT A;  1FBQ A;  2E5N A;  3U21 A;  3ROU A;  2R92 J;  3GBG A;  3CCR I;  4B44 A;  4S05 A;  3OYI A;  3PJR A;  2CQQ A;  1XSD A;  2JJ7 A;  4DNC A;  4RS8 A;  3K4B A;  1LFB A;  2J5O A;  1ODD A;  3H5N A;  4IRH A;  3CJN A;  3DPL C;  5E1W A;  3HOZ J;  2QSH X;  1XPX A;  4I7H A;  1TLH B;  5J6X A;  5ICE A;  2DPU A;  1FYL A;  1I6X A;  1TWG J;  3OYG A;  3MKZ A;  4A3L J;  1QO0 D;  1Q1V A;  1DPR A;  2FOK A;  3CP2 A;  2P5L C;  5CLS A;  4EQQ A;  3QRF F;  3MKY B;  4LG3 A;  4Y13 A;  3I58 A;  1YRN A;  1KU9 A;  2DTZ A;  2KKO A;  2Q1Z B;  2X1D A;  1GV5 A;  4M3E A;  3RKW A;  1I27 A;  3S8P A;  1UG2 A;  2JWT A;  3G1M A;  4LIT A;  1HDD C;  1X1B A;  3H3U A;  1BC8 C;  3EYI A;  2Q2E A;  3ERM A;  3ASO H;  2EV6 A;  2L9R A;  3HB9 A;  2QM3 A;  4Q48 A;  2ZJR F;  3ZQC A;  3LMM A;  2AHQ A;  4M73 A;  2DFH A;  2KZV A;  3BTC A;  3HPH A;  1HST A;  1Z3Y A;  3PQJ A;  2IP2 A;  4RAF A;  1J09 A;  4A5M A;  3Q9V A;  4AM3 A;  1EF4 A;  3Q3S A;  2E19 A;  4M74 A;  1NG6 A;  3ECO A;  5E1Z B;  1JUS A;  1WGX A;  4GYI A;  2DA6 A;  3PSF A;  3N97 A;  1ZRD A;  2PI0 A;  2DO7 A;  2O6G E;  4ZJZ A;  2IS6 A;  3F6V A;  1FJL A;  3U9G A;  3ISP A;  3N05 A;  2XGX A;  1XN7 A;  3BR1 A;  2FEZ A;  1UMQ A;  4CZZ A;  2ZJP F;  3HL2 A;  3CC2 I;  2FQ4 A;  1R1V A;  1FYK A;  3IRQ A;  2KJC A;  2LOO A;  3GME A;  3CLO A;  1RR7 A;  5FO5 A;  1ORK A;  4UVC A;  1JJ8 C;  2XF5 A;  5F0C A;  3RIR A;  3GTL J;  1UAA A;  4PUS A;  3F22 A;  2QBY A;  2R7X A;  3BZK A;  2CQN A;  1GVD A;  4I02 A;  1U0J A;  1KU7 A;  2ELJ A;  4XRM A;  3FBI B;  3DKY A;  3BY6 A;  3WGG A;  1T6S A;  2JRT A;  3H1C A;  3FHZ A;  4IHY A;  1DP3 A;  3KP7 A;  1FIA A;  2H09 A;  1LEA A;  1EA3 A;  2FQ3 A;  3ZR8 X;  1WPK A;  3LSP A;  4A0X A;  1AKH A;  5GAG J;  3H0D A;  2E2H J;  2M2E A;  3FM3 A;  3T8R A;  1JT0 A;  2MLK A;  3GWZ A;  2Y69 H;  4E70 A;  1WJA A;  5BOX A;  1YFH A;  5J40 A;  3LNQ A;  1S5L C;  1LVA A;  2Y30 A;  1ZEL A;  2FF4 A;  4LG0 B;  1QZZ A;  3C7J A;  3HHH A;  3WTV C;  3SEQ A;  3I4P A;  3BPV A;  3O8H A;  3RSN A;  4EJT A;  2BZT A;  1SVL A;  4G7O F;  2M30 A;  3C1D A;  3E6M A;  1BR2 A;  1Z0X A;  2VQC A;  1HKQ A;  4ENK A;  2DK5 A;  3C18 A;  2R7Q A;  3CCL I;  3BQZ A;  2DYR H;  1GLN A;  2F5D A;  1B8I A;  1IZ1 A;  1HW1 A;  1FOW A;  3RPU D;  5HLG A;  3GCM A;  2ZXW H;  2P4W A;  2X6W A;  2JN6 A;  3TO6 A;  5L3D A;  2BY3 A;  4GXO A;  3K4K A;  3D5L A;  2G7U A;  2WBM A;  4RGR A;  2LBF B;  3WG9 A;  2DJI A;  2GZW A;  2QF7 A;  4S04 A;  3UR3 C;  4BYY A;  1FX7 A;  3ZQQ A;  3CCS I;  2NAZ A;  4O3M A;  1AOY A;  1SD7 A;  2BOL A;  4RLQ A;  3SZT A;  3DEU A;  1STZ A;  4B3X A;  5GAE J;  2F4I A;  2JQ7 A;  1OKR A;  1MDM A;  1D5Y A;  1T33 A;  5HLT A;  2E1M C;  4M3D A;  2VPL A;  5JVT A;  1IN5 A;  2F4O B;  2RGV A;  3DV8 A;  4Y33 A;  1T39 A;  1S72 I;  1MGT A;  3JCU C;  4ZDP A;  2HVR A;  2CUE A;  2QCO A;  4X1E A;  2KT0 A;  2OQG A;  3JR9 A;  4LIU A;  4CGZ A;  3KP6 A;  1EKE A;  5FLX Z;  1R1U A;  1ZAR A;  3QYE A;  1FZP B;  1LQ1 A;  1VQ9 I;  3PIP F;  1YJN I;  1Z91 A;  1XD7 A;  2X6Y A;  3RZO J;  4N4N B;  2EV5 A;  5L3C A;  2IS4 A;  5JHF A;  4CYC A;  2DN0 A;  3RKY A;  3CDH A;  4XMY A;  2VT2 A;  2VKV A;  5F08 A;  3OWT A;  4PFO A;  2PN6 A;  2LY9 A;  5C44 J;  3LQQ A;  4JYK A;  2O8X A;  4HX4 A;  2DA2 A;  4D9J A;  2R4G A;  2F5E A;  2V9V A;  1DU0 A;  1QU3 A;  4R1H A;  1Y39 A;  1BBY A;  1J2X A;  5L3F A;  2VOO A;  2ZME A;  3RCO A;  4PJJ A;  2L4M A;  3HZJ A;  5GTI C;  1IO2 A;  2OU2 A;  2Z33 A;  3MZH A;  3HHG A;  2AS5 F;  4J19 A;  2N8G A;  1GDT A;  3CF2 A;  3BDD A;  4RAZ A;  4CO8 A;  5F1R A;  5B1A H;  3CMM A;  3QPL A;  3H3V K;  3I4M J;  4A0Z A;  1HKS A;  1TT0 A;  3OS1 A;  4J00 A;  6PAX A;  1I1G A;  2VUM J;  1TW3 A;  2LTP A;  1O7L A;  3SJM A;  4Z6Y A;  1YHQ I;  2MSY A;  3FXR A;  2EJR A;  3EQL F;  1S9H A;  3RDI A;  2ZME C;  4U87 A;  2FU4 A;  3H0G J;  2P7C B;  4H4K C;  1D3Y A;  1S8N A;  1Y8R B;  1KYW A;  3RPQ A;  3HTU A;  2XSJ C;  2TDX A;  4NNJ A;  5IT9 Z;  4EVI A;  4HF2 A;  3G6E I;  2P5V A;  3U2R A;  3BZ6 A;  2J5P A;  1D5V A;  5FLM J;  1W1W E;  1G3W A;  1GXQ A;  1TBX A;  2JZY A;  4ITV A;  4JK1 X;  2BEO A;  1R4M B;  1UCR A;  1YW9 A;  5EZH A;  1BI3 A;  2HFH A;  4D1Q A;  5D5V B;  1QGP A;  3HSF A;  4PSX A;  5FGM A;  1VFC A;  3TMO A;  2P7V B;  3HEF A;  4BDZ A;  4GYG A;  1A31 A;  2QQ8 A;  2XAF A;  2VQH A;  4A3K J;  2IJL A;  1QVU A;  1E17 A;  2ZSH B;  1Z05 A;  4WXH A;  1A35 A;  3ZXS A;  2IVM A;  3DXJ F;  3IHU A;  1LKX A;  2HPI A;  2QEN A;  4NQW B;  1OCT C;  1VQ8 I;  1JUP A;  2LMD A;  4IQ4 A;  2VJI A;  2VPR A;  3TP0 A;  4B1R A;  1VQL I;  1U6G A;  2JUG A;  4RGX A;  1IRX A;  2B0L A;  3LA7 A;  2E1C A;  5JLW A;  3OYE A;  1WH5 A;  4AU7 A;  2VXD A;  4UUS B;  2HDC A;  4E7L A;  3HDD A;  3LSM A;  2WB1 A;  1QPI A;  1WVR A;  1WZ2 A;  3PL8 A;  3C2H A;  1T98 A;  2GXG A;  5ILU A;  1ZQ3 P;  2E60 A;  3P9I A;  4JX6 A;  2EK5 A;  2FE3 A;  2ZJQ F;  1XS9 A;  2HKX A;  1H89 C;  1LE8 A;  5IYD J;  4EV0 A;  3EUK L;  4J01 A;  3K4C A;  1J5Y A;  1YTY A;  4PFP A;  4YEL A;  3BR5 A;  2HOE A;  2HNH A;  3M8J A;  2F2E A;  3I59 B;  1AHD P;  3REO A;  2HI3 A;  3NWT A;  1P7I A;  1JKQ C;  2BW3 B;  3RQ4 A;  2PQ8 A;  1G4D A;  3B6C A;  3CJT B;  5J8C A;  2JA8 J;  1HA8 A;  3OOU A;  4L5E A;  1BI2 A;  3IH3 A;  2KJB A;  2O9L A;  3I53 A;  1YW8 A;  1ENH A;  3OYB A;  4RGU A;  4ZYD A;  1TNS A;  2K9Q A;  1G3T A;  4BE2 A;  4G6D A;  2QLZ A;  2V26 A;  4EJO A;  1T0F A;  3VEP A;  3K9T A;  1AWC A;  2K86 A;  2VKE A;  3K4J A;  3JRE A;  4HYE A;  4XKC A;  1SFO J;  4YEJ A;  2ADU A;  3BOQ A;  2OQR A;  4A6D A;  4LG0 A;  2E5Z A;  3VFZ A;  3MWM A;  3JAM K;  2E2J J;  3KEQ A;  5A2Q Z;  1G8X A;  2HEO A;  2KZG A;  2DA7 A;  2RDP A;  4OMZ A;  3ZMV A;  1T0F C;  3VYR B;  1XGM A;  3AL0 B;  3HPG A;  4LIV A;  5FJ8 J;  1WRJ A;  1OCR H;  4BJ6 C;  3TOB A;  4ESF A;  1VQ5 I;  4MNU A;  4LD5 A;  4CIC A;  2QSF X;  4PK4 A;  4EJV A;  5ICC A;  1MW7 A;  3KP3 A;  3J7A Y;  3GFM A;  4RM3 A;  4ZDO A;  4E7I A;  1FP1 D;  2GM4 A;  1OCC H;  2D2W A;  4AYB N;  4UUT A;  4C30 A;  5F1J A;  4I0B A;  4BGD A;  3VWB A;  2KP6 A;  3D5R C;  2R5Z B;  4KIC A;  4LK0 F;  2XKP A;  2LBF A;  4HZF A;  5DM6 F;  1U9N A;  2BVM A;  3K10 A;  2R3S A;  2DW4 A;  4FIS A;  2STW A;  2E34 A;  3EUH A;  2IT0 A;  2VOP A;  2ZBK A;  3L2W A;  1TP4 A;  3FMR A;  1O3T A;  4JX5 A;  2STT A;  4BAC A;  2BXZ A;  4A69 C;  1OIS A;  2GIV A;  1AA7 A;  3LFK A;  2DPD A;  1ZG3 A;  2LKP A;  2OC6 A;  4WXC A;  3W6J B;  2EIJ H;  1E0E A;  3KEY A;  3G1L A; 
#chains in the Genus database with same CATH homology
 4M72 A;  4O6J A;  5D5U B;  2XAS A;  2EFQ A;  2GQQ A;  2PG4 A;  2OBP A;  4L9T A;  1IUY A;  1QNT A;  4HQE A;  4D0P A;  5L3E A;  4I2O A;  4P5O A;  2UXN A;  2ZJ2 A;  1IN7 A;  3BRO A;  3QPH A;  3HRS A;  4U0V A;  2FRH A;  4KMF A;  4ENN A;  3ZN0 A;  2ELH A;  2DQL A;  3RI4 A;  4AIK A;  1HBX G;  3VB2 A;  4U0Y A;  4GGG A;  3DP7 A;  3ERE D;  3HSR A;  2HQR A;  3FMS A;  1FP2 A;  1R23 A;  4JBA A;  2M5W A;  1SD5 A;  4UV8 A;  3J81 K;  2DK8 A;  2DAO A;  2KIF A;  2RV8 A;  3FXQ A;  4B8X A;  1FBU A;  3QP5 A;  5LRR A;  1B9M A;  3J80 Z;  3K69 A;  1UHW A;  1OR7 A;  3F6O A;  4ZYH A;  1UHM A;  3GFI A;  2PMH A;  2K4J A;  1CF7 B;  3OOP A;  1OPC A;  5TRD A;  2IA1 A;  2RKH A;  2H6B A;  3KEO A;  2XRO A;  3IL2 A;  3T8T A;  2CO5 A;  2NYX A;  3GFJ A;  2ACJ A;  4NQW A;  4GO1 A;  1U8R A;  4PGH A;  4HDV A;  1UST A;  2FA5 A;  3MZY A;  5LHH A;  3F8M A;  3FZV A;  4CXF A;  2XAH A;  3KET A;  1KGS A;  1SD4 A;  2MD5 A;  5JI6 A;  3TKY A;  2NNY A;  4G9Y A;  3COA C;  1DP7 P;  1J7K A;  1QPM A;  1DDN A;  3MQ0 A;  2D1V A;  1FWZ A;  4OIQ F;  4FT8 A;  3U1D A;  2BV6 A;  3T0Y A;  4KIF A;  3I59 A;  4L9V A;  1Q1H A;  2PMU A;  5HOO A;  1EH7 A;  1LNW A;  1P4A A;  2L4A A;  1O3R A;  2VBW A;  4WXD A;  3WE2 A;  2F5F A;  1IXC A;  4KYW A;  3ZPL A;  3QP6 A;  2L02 A;  5E8G A;  5D6F A;  2GA1 A;  3TDZ C;  5EEH A;  1FC3 A;  4GCV A;  4XSZ F;  1F9N A;  4MEX F;  4EGY A;  1L3L A;  4MHG A;  3SZP A;  3ZMD A;  4MQV A;  2CYY A;  2ESN A;  2PBI A;  5BS6 A;  1U3E M;  5LBQ A;  5JHU A;  1J75 A;  1FNN A;  1ZAO A;  3WTT C;  2VC0 A;  2H27 A;  4KFC A;  4EMS A;  3GYH X;  2HYF A;  2PFB A;  3K0L A;  2DFI A;  2K27 A;  1S29 A;  1HSJ A;  4PDK A;  4OIR F;  2R7F A;  4CHU A;  3F8C A;  4OIN F;  1P6R A;  5K1Y A;  2FSW A;  1SFX A;  3HRU A;  4A0Y A;  1FLI A;  4ESJ A;  4L9N A;  1W4M A;  1UB9 A;  1SAX A;  3O6B B;  1KYZ A;  1W7P D;  1BN5 A;  5FLX K;  4HF1 A;  5HVQ C;  2QUF A;  3MEX A;  4EJU A;  2LF7 A;  4FX4 A;  3QOP A;  1TQM A;  2XAG A;  2PLY A;  3IWZ A;  2Y48 A;  2MBF A;  5L3G A;  2IPQ X;  1ZLK A;  2VT3 A;  2W57 A;  1USS A;  3DKW A;  4WWC A;  3MFK A;  2A6H F;  2W24 A;  3HTS B;  3LST A;  3IRR A;  1ON1 A;  2M45 A;  1PP7 U;  4NB5 A;  3GW2 A;  3HUG A;  1ZRC A;  2CG4 A;  4LGW A;  2MC3 A;  1O3S A;  2UXX A;  3RPU A;  3WTY C;  1QZY A;  2YX4 A;  2P6T A;  4RB0 A;  1XCB A;  3WGI A;  2OZU A;  1ZRE A;  5IT9 K;  5DCM A;  2LNB A;  3B02 A;  4BHB A;  3S2W A;  5BQT A;  1ZGJ A;  4LJZ F;  2H94 A;  1Z6T A;  1WI9 A;  1FSE A;  3E5Q A;  3R6S A;  5JR3 A;  5HDK A;  2W85 A;  2VBX A;  4ZYE A;  4WK8 F;  1RI7 A;  1B6A A;  3LWF A;  4I0A A;  2FBK A;  2FML A;  5E1X A;  1K6O A;  4LB5 A;  2KIM A;  4WF2 A;  2MH9 A;  2CW0 F;  5E17 F;  1ZN2 A;  1LDD A;  1UFM A;  4HBL A;  5H6Q A;  4UNO A;  2V1D A;  4M9X A;  1F4K A;  1QQI A;  1J0R A;  4AWX B;  1YG2 A;  1XDU A;  3IKT A;  2ZCW A;  2BE5 F;  3I0T A;  3GUD A;  2XV4 S;  4ON0 A;  5H20 A;  3LQR A;  5FB2 A;  4QLC U;  1FT9 A;  3OV8 A;  1V3F A;  3F8F A;  2ZXJ A;  1SMY F;  4R8H A;  4Z2Y A;  4LLL A;  2VE8 A;  1U78 A;  3CO6 C;  4ZZL A;  4KN4 X;  5HS7 A;  2HKO A;  3ZQ7 A;  1BM9 A;  4WCG A;  2E7W A;  1I5Z A;  5FD6 A;  2HQN A;  2JTV A;  1REP C;  3CTA A;  1B1B A;  1BOA A;  3GZ5 A;  4HF0 A;  3TDU C;  4XLP F;  2WTE A;  3HOT A;  4OIP F;  1YIO A;  1YS7 A;  3TOA A;  5LLQ A;  4G8X A;  5EEG A;  5A2Q K;  3FF5 A;  3RKX A;  1A04 A;  1TTY A;  3BJA A;  3V8K A;  2GWR A;  2DLL A;  3K1N A;  4RAY A;  3KLO A;  2ZNZ A;  4QWQ A;  3HIF A;  1FOK A;  3ML6 A;  3K2Z A;  3PFI A;  5K5O A;  5ERI A;  4ENJ A;  1KU2 A;  3SHF A;  1EV7 A;  4MTD A;  4KUM A;  4JQF A;  1H0M A;  2VE9 A;  4UUV A;  3GO5 A;  4EM0 B;  2QQB A;  3ZN1 A;  1LDK B;  3K1M A;  2O61 A;  4BNC A;  1K79 A;  1JHF A;  4KA4 A;  4G94 A;  3O2P E;  1OYY A;  2ISY A;  4BAY A;  4G7Z F;  2L3D A;  3ECH A;  4G6Q A;  1EH8 A;  2E1N A;  3HYI A;  3L7W A;  2HZT A;  3LA2 A;  1WSU A;  1XSV A;  5H6R A;  5AON A;  1ZRF A;  2PJP A;  1LDJ A;  4ETS A;  2C6Y A;  3WTX C;  1B9N A;  4ZH4 F;  2XAJ A;  1BI1 A;  2ESH A;  3IC7 A;  3WU1 B;  2V1X A;  5E8I A;  4KT5 C;  2P8T A;  2BBY A;  3J80 K;  1G3Y A;  2M8E A;  3V4G A;  1FYM A;  3BJO A;  5ED4 A;  1S3J A;  2XAQ A;  2CGP A;  4HAM A;  1WWX A;  2F5C A;  3PQK A;  4ESB A;  5D8L B;  3G73 A;  4XRF A;  3HRM A;  1LEB A;  3IKV A;  1JXS A;  2LF8 A;  2Y75 A;  3FM5 A;  1W7P B;  3M1E A;  2PEX A;  2YR2 A;  5LGN A;  4YIF A;  1OYW A;  1EH6 A;  3GLX A;  1BC7 C;  4A2U A;  4EM2 A;  5DUI A;  5FFX A;  3ELK A;  4AD9 A;  1DPU A;  1SMT A;  1XGN A;  1K78 B;  4IXA A;  1P2F A;  3V7C A;  3RYP A;  4A6E A;  1ZLJ A;  1ZH5 A;  3HRT A;  2KRF A;  1S7O A;  4AIH A;  3GEZ A;  3V8J A;  5CVI A;  1E2X A;  2R7D A;  5HLH A;  4ASN A;  5CVU A;  1F5T A;  3R61 A;  4LFU A;  4U88 A;  3I64 A;  5DD8 A;  2FMY A;  2IA2 A;  5BMZ A;  5DCF A;  3WTW C;  1PDN C;  1XMA A;  2K7L A;  1XGS A;  1YO5 C;  2RQP A;  2QZ8 A;  4KIB A;  2IW5 A;  3WTS C;  4OMY A;  1P4X A;  4Q47 A;  2M87 A;  2MH2 A;  3BPX A;  1H9T A;  4M6Y A;  3WOD F;  5LHG A;  5D5X B;  3EDP A;  2D1H A;  2ZO4 A;  3EET A;  4CYD A;  2EV0 A;  3E6D A;  3L00 A;  4I09 A;  4RB3 C;  2HS5 A;  4BQA A;  3GXO A;  2DU9 A;  4Q4Z F;  3N4M A;  1D8K A;  2VN2 A;  2EFW A;  1IAW A;  2RN7 A;  3VOE A;  1S6L A;  1ONV A;  3L09 A;  5LGU A;  2HTS A;  3L2C A;  2GA2 A;  4YII A;  2IRF G;  5DV5 A;  1YS6 A;  2LDU A;  2M1B A;  3RTR A;  5LGT A;  3KE2 A;  2IA0 A;  4LK1 F;  3HOS A;  2WV0 A;  2ZFW A;  2ZME B;  5DYM A;  3TQN A;  4HDU A;  2HR3 A;  3Q9S A;  2VBZ A;  2A6E F;  2X4H A;  3FMQ A;  1FPQ A;  4LB6 B;  4A5N A;  2A69 F;  4BH9 A;  4AVP A;  4XSX F;  2EB7 A;  3W6K B;  2HTJ A;  4WX9 A;  3G3Z A;  3P9C A;  1R22 A;  1OYI A;  3J7A O;  1Z7U A;  1JE8 A;  2Z5U A;  2O03 A;  3R0J A;  1DUX C;  4NHJ A;  4KNY A;  1Z6R A;  3GX4 X;  3LAJ A;  1IXS B;  4M71 A;  3WU0 A;  4LLG F;  3QU6 A;  2JPC A;  1TNT A;  1RUO A;  4HQM A;  2P5K A;  1Y0U A;  2Z99 A;  4EM1 A;  1MD0 A;  3QAH A;  3QU3 A;  1XB4 A;  3P9K A;  1PUE E;  2A61 A;  1SFE A;  1R5H A;  2XHK A;  1J9I A;  2LSO A;  3WTZ A;  1W7P A;  4L18 B;  3F8N A;  4ENM A;  2OA4 A;  4HX7 A;  1CGP A;  5CVV A;  1ZHF A;  1TQP A;  5HS8 A;  1P4W A;  1B4A A;  5AIQ A;  1XCV A;  4KDP A;  2OZ6 A;  2RNJ A;  2CQK A;  4HX8 A;  1GXP A;  5FD5 A;  2O3F A;  2FNA A;  1I1S A;  1K78 A;  1BIA A;  2NS0 A;  1MJ9 A;  1R00 A;  1L0O C;  5D4S A;  4MQ9 F;  4MTE A;  4LMY A;  5F64 A;  2DI3 A;  3DF8 A;  3M7G A;  3F3X A;  3E6C C;  3KZZ A;  5D4R A;  3I54 A;  2GAU A;  1FBS A;  5KVR A;  4CDG A;  3M8F A;  3M8E A;  2VBY A;  4OIO F;  4HV6 A;  1U5T B;  1R7J A;  2EFO A;  3E97 A;  4IF4 A;  3WTU C;  1CF7 A;  1BIB A;  3LA3 A;  1YQA A;  2UZK A;  4HLY A;  2ETH A;  1J59 A;  3FX3 A;  1YLF A;  4IPA A;  1RIO H;  1TQI A;  3DFG A;  3TO9 A;  4I01 A;  4YFK F;  2GXB A;  5CVJ A;  3E3V A;  3KP2 A;  4XBF A;  4ZZD A;  4IRG A;  3NRV A;  4UVB A;  1TW2 A;  4YFX F;  1RUN A;  4BXU A;  4L5I A;  2JT1 A;  1HW5 A;  3BWG A;  3DPT A;  4U7D A;  2Y0M A;  3K1P A;  3SFZ A;  2BYV E;  2Q8K A;  3R0A A;  2NRA C;  1MJB A;  2EFN A;  5KK1 A;  3GZ6 A;  3CUO A;  1R5G A;  3JSP A;  3BJ6 A;  3FWE A;  2W84 A;  1Z1D A;  4ZYG A;  2XRN A;  4KN7 X;  4UHT A;  2VXZ A;  3F21 A;  3T1B A;  1FY7 A;  1W5T A;  2XUB A;  1ZGA A;  4UVA A;  1XSX A;  4M9S A;  4YG2 F;  4OU0 A;  4K2E A;  3AAF A;  5D8K B;  1ZYR F;  2A5Y B;  2Q0O A;  2MLG A;  3SXY A;  3HSE A;  1ON2 A;  1QBJ A;  2QQ9 A;  2K02 A;  5CYV A;  5J8F A;  2DQR A;  1JGS A;  3Q5F A;  3TO7 A;  3I5U A;  5HLI A;  2DT5 A;  2AXL A;  1YW7 A;  5ICG A;  4P96 A;  3M9A A;  3BP8 A;  4L5J A;  4G7H F;  3KFW X;  5DDG A;  1SFU A;  2V79 A;  3WE3 A;  4L0Y B;  5HDG A;  2Z3Y A;  5D6E A;  3E5X A;  2HWV A;  5HS9 A;  1MZB A;  1BI0 A;  5DUK A;  4YFN F;  3EYY A;  5E20 A;  1O7F A;  2CSO A;  4UXN A;  3JW4 A;  2QYO A;  4P9F A;  5JFR A;  2OAZ A;  4KIG A;  3V7S A;  4AIJ A;  3ZP5 A;  4Y15 A;  1MJA A;  4EJW A;  4IHT A;  4O5V A;  2ZKZ A;  3E6B A;  2L54 A;  3CUQ B;  1T38 A;  5E18 F;  2G9W A;  3D0S A;  2X0L A;  2V1U A;  2MA3 A;  2EFP A;  3O3K A;  5CVR A;  4LLN A;  1D8J A;  3C3W A;  4UV9 A;  1O3Q A;  1ZG1 A;  3KLN A;  1XMK A;  2RVC A;  4L0Z B;  4U0W A;  3SQN A;  4EGZ A;  3NQO A;  4IVN A;  4HA8 A;  5L3B A;  2OD5 A;  4PZJ A;  4U7B A;  3ABU A;  2G7H A;  2Z9O A;  4HW0 A;  3V8L A;  3B73 A;  3RJP A;  4P55 A;  4Q5S F;  2DBB A;  3ZMS A;  2P6S A;  1T2K A;  1GVJ A;  1KQ9 A;  3ABT A;  3F8B A;  5K5R A;  2A68 F;  1IXR C;  1U5T A;  3WGH A;  3F23 A;  1S7A A;  2RC4 A;  3R4K A;  4R79 A;  2FBI A;  4BHC A;  1LB2 A;  2XKO A;  4RB2 C;  1O57 A;  1KQ0 A;  1U5T C;  2W25 A;  2QWW A;  3ZMT A;  1BJA A;  4PGG A;  4RGS A;  4MGR A;  1KU3 A;  2EA4 A;  2ZNY A;  4FHT A;  1B59 A;  2V6C A;  5DD4 A;  3ZMU A;  4IHS A;  1IRG A;  1KQ8 A;  2E7X A;  4L9J A;  4N9I A;  5TJJ A;  3ZMZ A;  5HDN A;  1G3S A;  4M6X A;  4BHP A;  1XDS A;  1G6N A;  2COM A;  5AIP A;  1HKT A;  4P9U A;  3T5X A;  2WWY A;  4HV5 A;  1XGO A;  2K4B A;  1W5S A;  1H9G A;  2DTR A;  1X3U A;  1VTN C;  3GF2 A;  2YSR A;  2FBH A;  2VOD A;  5D5W B;  2BGC A;  4KMU X;  2XIG A;  1IN4 A;  1HW2 A;  3GVA A;  2L01 A;  3VOD A;  2UWM A;  4RB1 A;  5ICF A;  3JTG A;  1NHA A;  5CJ9 A;  3L9F A;  2VON A;  2CWE A;  4N9H A;  3LAP A;  2QBY B;  4DQ2 A;  1GHC A;  2O0Y A;  1IW7 F;  2EWN A;  2NNN A;  4OOI A;  4IJA A;  1R36 A;  3E5U A;  4A12 A;  5ILS A;  4I98 B;  3JAM Z;  1C0W A;  3KCC A;  4N0B A;  2JPB A;  4F7Z A;  4TV7 A;  3P7N A;  3JSO A;  1LJ9 A;  4B09 A;  1K7A A;  3I71 A;  5BPI A;  1Z9C A;  2HGC A;  2YPR A;  2JSC A;  1ZG5 A;  1V4R A;  1WQ2 A;  2WC2 A;  4HLX A;  5LRS A;  3F72 A;  1ULY A;  5ILV A;  5DCM B;  3TGN A;  1R1T A;  3MCZ A;  5DEQ A;  3CUQ A;  1RNL A;  2EA2 A;  5F6F A;  1MDM B;  3R60 A;  1IRF A;  2FNP A;  3V7R A;  5BPD A;  3ULQ B;  1SD6 A;  5IT3 A;  2D45 A;  3H3Z A;  3CUQ C;  3DQV C;  1IN6 A;  1P92 A;  2QVO A;  3KP5 A;  5K5Q A;  2XVC A;  5LEJ A;  2VC1 A;  1WKM A;  4FX0 A;  4Y17 A;  3NEU A;  3H92 A;  3JTH A;  1PP8 F;  1HQC A;  2CFX A;  4MEY F;  4H0E A;  3J81 Z;  3RYR A;  3GFL A;  2A3S A;  5LEK A;  3FXU A;  1RZ4 A;  4M9Z A;  1U2W A;  2HYG D;  2FXA A;  1OMI A;  3KZY A;  1IF1 A;  1F1Z A;  4XLN F;  2A07 F;  1HXD A;  3IWF A;  4HOB A;  4PCQ A;  5FFZ A;  2KIU A;  1YYV A;  2H6C A;  2ISZ A;  5LHI A;  1IN8 A;  1MKM A;  4IRI A;  1KA8 A;  2YX7 A;  3CO7 C;  1JHH A;  3MAJ A;  2QQA A;  2YU3 A;  1R58 A;  1FSH A;  3KP4 A;  3QPT A;  1FBQ A;  3ROU A;  4S05 A;  1XSD A;  4DNC A;  4RS8 A;  2J5O A;  1ODD A;  4IRH A;  3CJN A;  3DPL C;  5E1W A;  4I7H A;  5J6X A;  1TLH B;  5ICE A;  2DPU A;  1FYL A;  1I6X A;  1QO0 D;  1DPR A;  2FOK A;  2P5L C;  5CLS A;  4EQQ A;  3QRF F;  4Y13 A;  3I58 A;  1KU9 A;  2KKO A;  3RKW A;  1I27 A;  3H3U A;  1BC8 C;  3EYI A;  2Q2E A;  2EV6 A;  4Q48 A;  2QM3 A;  4M73 A;  1HST A;  3PQJ A;  2IP2 A;  4A5M A;  3Q9V A;  4M74 A;  3ECO A;  5E1Z B;  4GYI A;  3N97 A;  1ZRD A;  2PI0 A;  2DO7 A;  2O6G E;  3F6V A;  3U9G A;  3ISP A;  2XGX A;  1XN7 A;  2FEZ A;  4CZZ A;  1R1V A;  1FYK A;  3IRQ A;  2KJC A;  3CLO A;  5FO5 A;  4UVC A;  3RIR A;  3F22 A;  2QBY A;  4I02 A;  1KU7 A;  3BY6 A;  3WGG A;  1T6S A;  2JRT A;  3FHZ A;  3KP7 A;  2H09 A;  1LEA A;  2FQ3 A;  4A0X A;  3FM3 A;  3T8R A;  2MLK A;  3GWZ A;  4E70 A;  5BOX A;  1YFH A;  1LVA A;  2FF4 A;  4LG0 B;  1QZZ A;  3C7J A;  3HHH A;  3WTV C;  3I4P A;  3BPV A;  4EJT A;  4G7O F;  2M30 A;  3C1D A;  3E6M A;  1HKQ A;  4ENK A;  2DK5 A;  3C18 A;  2F5D A;  1IZ1 A;  1HW1 A;  5HLG A;  2P4W A;  3TO6 A;  5L3D A;  4GXO A;  3D5L A;  2G7U A;  4RGR A;  3WG9 A;  2GZW A;  4S04 A;  4BYY A;  1FX7 A;  4O3M A;  2NAZ A;  1AOY A;  1SD7 A;  3SZT A;  3DEU A;  1STZ A;  1OKR A;  1MDM A;  5JVT A;  1IN5 A;  2RGV A;  3DV8 A;  1T39 A;  1MGT A;  2OQG A;  4CGZ A;  3KP6 A;  5FLX Z;  1R1U A;  1ZAR A;  1FZP B;  1LQ1 A;  1Z91 A;  1XD7 A;  2EV5 A;  5L3C A;  3RKY A;  3CDH A;  2VT2 A;  2PN6 A;  3LQQ A;  2O8X A;  4HX4 A;  2F5E A;  2V9V A;  4R1H A;  1BBY A;  1J2X A;  5L3F A;  2VOO A;  2ZME A;  2L4M A;  2OU2 A;  2Z33 A;  3MZH A;  3HHG A;  2AS5 F;  4RAZ A;  3BDD A;  4CO8 A;  5F1R A;  4A0Z A;  1HKS A;  6PAX A;  1I1G A;  1TW3 A;  1O7L A;  3FXR A;  2EJR A;  3EQL F;  3RDI A;  2FU4 A;  2P7C B;  1D3Y A;  1S8N A;  1KYW A;  3RPQ A;  3HTU A;  2TDX A;  5IT9 Z;  4EVI A;  4HF2 A;  2P5V A;  3U2R A;  3BZ6 A;  2J5P A;  1D5V A;  1G3W A;  1GXQ A;  1TBX A;  2JZY A;  4JK1 X;  2BEO A;  1UCR A;  1YW9 A;  1BI3 A;  2HFH A;  5D5V B;  1QGP A;  3HSF A;  5FGM A;  2P7V B;  4GYG A;  2XAF A;  2IJL A;  1E17 A;  4WXH A;  1Z05 A;  2IVM A;  3DXJ F;  3IHU A;  2QEN A;  1U6G A;  4RGX A;  2B0L A;  3LA7 A;  2E1C A;  2HDC A;  1T98 A;  2GXG A;  5ILU A;  3P9I A;  2EK5 A;  2FE3 A;  2HKX A;  4EV0 A;  1J5Y A;  1YTY A;  2HOE A;  2F2E A;  3I59 B;  3REO A;  2PQ8 A;  1G4D A;  5J8C A;  1BI2 A;  2KJB A;  3I53 A;  1YW8 A;  4RGU A;  4ZYD A;  1TNS A;  1G3T A;  4G6D A;  2QLZ A;  4EJO A;  1T0F A;  3VEP A;  3K9T A;  1AWC A;  2K86 A;  4HYE A;  2ADU A;  3BOQ A;  2OQR A;  4A6D A;  4LG0 A;  3VFZ A;  3MWM A;  3JAM K;  3KEQ A;  5A2Q Z;  2HEO A;  2RDP A;  4OMZ A;  3ZMV A;  1XGM A;  1WRJ A;  3TOB A;  4ESF A;  4MNU A;  4LD5 A;  4CIC A;  4EJV A;  5ICC A;  3KP3 A;  3GFM A;  1FP1 D;  2D2W A;  4I0B A;  4KIC A;  4LK0 F;  2XKP A;  4HZF A;  2R3S A;  2DW4 A;  2STW A;  3EUH A;  2IT0 A;  2VOP A;  2ZBK A;  3FMR A;  1O3T A;  2STT A;  2GIV A;  3LFK A;  2DPD A;  1ZG3 A;  2LKP A;  4WXC A;  3W6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...