3CJNA

Crystal structure of transcriptional regulator, marr family, from silicibacter pomeroyi
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
146
Chain Sequence
RELAEIGLEGYAPYLMNRIMGRYNANLRKEMTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDDQRSSRVYLTPAGRAVYDRLWPHMRASHDRMFQGITPQERQAFLATLNKMLANIRVHEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MarR family transcriptional regulator from Silicibacter pomeroyi.
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
total genus 40
structure length 146
sequence length 148
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cjnA00
3FWEA 4CXFA 3H3ZA 1FP2A 2O0YA 5D5XB 1Z91A 3DEUA 4G6DA 1BC7C 2ETHA 5E1ZB 1TBXA 2P5LC 1FP1D 3BP8A 3QU6A 2A6EF 4KIFA 4HX7A 2FNAA 5ED4A 2O3FA 1MJBA 2JRTA 2OAZA 1YLFA 3TDUC 4GGGA 1U6GA 2V1DA 4XSZF 1KA8A 2A68F 4O6JA 5JI6A 2EWNA 1MJAA 2DT5A 2G7UA 2FF4A 3E6MA 2EFWA 2DAOA 3FX3A 3V8LA 1B59A 3IC7A 1DP7P 3DXJF 2FEZA 2DQLA 3J80K 5BPDA 3BZ6A 3V8JA 2PMUA 4ASNA 3CO7C 1IXSB 2V9VA 2MLKA 2M30A 2OU2A 4LK1F 1YO5C 4ZZDA 2QBYA 3ECHA 5FFXA 4ZYEA 4CO8A 2GWRA 3TKYA 4RB1A 2M5WA 5DD4A 3F6OA 4YG2F 2YX7A 1TQPA 3I59B 3F23A 5HDKA 3CDHA 3LSTA 3WTUC 1T38A 1R36A 2L4AA 2QM3A 4E70A 2FE3A 4KICA 3GYHX 4IPAA 5L3CA 4JBAA 2AS5F 3SXYA 2Z5UA 3HRTA 2X4HA 1OR7A 2DBBA 4QLCU 1YTYA 3R6SA 5FD6A 4KNYA 1FOKA 3TDZC 5E8IA 4PDKA 2NS0A 4EVIA 1V3FA 2EV5A 5LGTA 1YFHA 1HKTA 3BY6A 5CYVA 3T0YA 1WRJA 3JTHA 1OMIA 1ZRCA 2Z3YA 2F5DA 4MEYF 1ZARA 2LDUA 2K02A 1OYYA 3BDDA 2YPRA 5LLQA 1I6XA 1U2WA 2DW4A 3ML6A 3ZMZA 2XGXA 2JZYA 4ENMA 4A6DA 2EFQA 4HF2A 2FBIA 3HYIA 3IKVA 1GXPA 5HVQC 3E6CC 2A5YB 1KU2A 2XIGA 1J0RA 1LJ9A 1LVAA 1W7PD 5HS9A 3W6KB 3OOPA 2A6HF 4IRIA 3KFWX 5BQTA 4M72A 3RTRA 4L5JA 1WKMA 4M71A 1MDMB 5AIQA 1SFEA 1T0FA 2W85A 4EJTA 2H6BA 1JHHA 2EB7A 4RB3C 2R7DA 4I7HA 4ESBA 3L09A 1CF7A 2R3SA 1RUNA 2L4MA 3DQVC 2IW5A 4UNOA 1OYIA 3F72A 3OV8A 2PJPA 1XDSA 1S8NA 3FHZA 3I58A 1AWCA 2DLLA 4CGZA 2NNNA 2HKXA 1RIOH 3N97A 2VONA 3TQNA 1S6LA 4HDVA 4OIQF 3ZPLA 3HOTA 2PLYA 1I5ZA 1Z6TA 4ENNA 1Z05A 4Y15A 3FMQA 2QQ9A 1T98A 4R8HA 4I0AA 2XVCA 4KMUX 1KQ9A 2UXNA 2QWWA 3BOQA 3K1MA 4NB5A 1LDJA 3P7NA 5LEKA 3B02A 2HYFA 3LAPA 3FM5A 2OZ6A 2O8XA 2J5PA 4M9SA 1USTA 3M1EA 5D4RA 3RPUA 2MD5A 3MZHA 2ESHA 1BM9A 3I64A 2RN7A 2DI3A 3NEUA 1O3QA 1SFXA 2A07F 2GIVA 1TLHB 3KP4A 4LLLA 4OINF 1FT9A 4CHUA 2XRNA 5HS7A 4UUVA 3GO5A 1TTYA 4OIRF 3FXRA 2HGCA 1KU9A 5K5OA 1R1UA 1ZG3A 3FMRA 4BNCA 1G3YA 5LRSA 3HOSA 4HV5A 1FSEA 2F5CA 1YG2A 1XSXA 5LGUA 2A69F 4HDUA 3GX4X 4I98B 1K79A 3BJAA 1HSTA 2WTEA 3U2RA 3FXUA 4P96A 4EQQA 1QNTA 5ILUA 2DK5A 5LHIA 3EUHA 3BPXA 3J7AO 4LB6B 1K78B 3ZN1A 2KJBA 3WTTC 3GUDA 5F1RA 2HS5A 1PUEE 4Y13A 4L9NA 2EFPA 1LDDA 2LF7A 3KP2A 2D45A 2VODA 1J75A 1UFMA 3REOA 2DTRA 5DUKA 4NHJA 4EJOA 3LA7A 1IRFA 2GQQA 2KKOA 4YIFA 5D4SA 2CQKA 4UVBA 2BYVE 2P7CB 4IVNA 4LLGF 4RAYA 2ZMEB 3RYRA 3Q9VA 1D8KA 3WTZA 4M9ZA 3BPVA 3MAJA 4ON0A 2VBZA 1LQ1A 4HF1A 2P6SA 3MZYA 1E17A 1G3SA 1W4MA 4F7ZA 1BBYA 5BPIA 3SHFA 1SMTA 1KQ0A 1C0WA 3G73A 5CVJA 2ZNYA 3AAFA 3GFJA 5AONA 1MJ9A 4GCVA 2P5KA 4BAYA 2OA4A 2E7WA 3FF5A 2VN2A 4A2UA 5D6EA 4WXHA 5CVVA 1IAWA 2PI0A 3ULQB 4FHTA 2PQ8A 2EA4A 1GVJA 1R23A 3QP6A 3W6JB 3ROUA 4ZZLA 5FO5A 1ZN2A 1FYLA 1YS6A 3F3XA 1BIAA 3HRMA 2DK8A 3SFZA 3ZMDA 5L3DA 1HKSA 3IKTA 1ZREA 1Y0UA 4DNCA 4CZZA 1NHAA 3TO7A 2E1NA 3VODA 1EH8A 1KYZA 2PN6A 3H92A 2GXGA 1MGTA 4BYYA 1ULYA 1FC3A 3WU1B 4S04A 2V6CA 1BIBA 2FQ3A 5DCFA 4M74A 1QGPA 3R4KA 4Z2YA 1JHFA 3E3VA 3TOAA 4XSXF 4GXOA 1XGNA 2FBKA 2XKOA 1ZGAA 3JTGA 4MQ9F 1P4XA 5FB2A 3TGNA 1O3TA 2EK5A 2XAGA 2UZKA 4HYEA 3S2WA 1XGMA 2AXLA 1IN6A 2K4JA 3CLOA 2IJLA 4A5NA 3WU0A 3K9TA 4IF4A 2RDPA 2OQRA 2QZ8A 2PEXA 4EJUA 2TDXA 2GAUA 2HYGD 3HRUA 4L0ZB 1W5TA 2MH9A 1VTNC 3HIFA 2RGVA 2V79A 3RYPA 1FWZA 1V4RA 1R5HA 4ZYHA 1STZA 5D5UB 1IZ1A 5J6XA 3QPHA 1R7JA 4G7HF 5H6QA 5L3GA 3CO6C 2NNYA 5FLXZ 4I2OA 4LGWA 2EFOA 2IVMA 2FRHA 2R7FA 3SZPA 5CVIA 1J2XA 1UHMA 3GFMA 2A61A 2BV6A 5FGMA 2H09A 2XAHA 2H6CA 3ZMUA 2FU4A 1YW9A 4KN7X 1O3RA 5H6RA 4UVCA 1QO0D 4HW0A 3E6BA 2RNJA 1Q1HA 3KP5A 3RKXA 4BH9A 5JR3A 3V7RA 4HAMA 3I53A 2G9WA 1HXDA 4AVPA 2FOKA 4UVAA 3LAJA 4FT8A 4MHGA 5D6FA 4RAZA 2V1UA 2IA0A 1IRGA 5BOXA 3KP7A 3FM3A 3R0AA 4O3MA 1JGSA 1KU3A 3HUGA 2FNPA 3Q9SA 1ON2A 3NQOA 2Q8KA 2QQBA 2QENA 1ZG1A 1XB4A 1S7OA 2YX4A 3M8FA 1B9MA 1W7PA 2IA2A 2L01A 1YW8A 4RB2C 3ECOA 5D5VB 1PP7U 2FA5A 5ILVA 4B09A 3C7JA 4NQWA 1H0MA 4O5VA 3V7SA 5CVUA 1O3SA 3IRQA 2E1CA 3ZMSA 1I27A 4S05A 1S29A 4Y17A 4P55A 2XKPA 4M73A 1D5VA 2XROA 4L9VA 1EH7A 3WE2A 4RGSA 2VOOA 1H9TA 4HLYA 2QYOA 2G7HA 3KLNA 1ZRDA 3F21A 4ZYGA 3KP6A 3TO6A 3DPTA 2O03A 2H27A 4M6YA 3ABTA 1R58A 3F8MA 1KGSA 5E1WA 2KJCA 1SD6A 1R00A 4JQFA 2CWEA 3R61A 3F22A 5E18F 1K7AA 2FMLA 3O3KA 1U8RA 4PGHA 3VB2A 5KVRA 4IRHA 1J5YA 1HW2A 3WTVC 4LJZF 2OBPA 1LB2A 2ZKZA 2QVOA 4ENJA 3CUQC 4IJAA 1MDMA 1BI3A 2L02A 4P5OA 4KMFA 3F8CA 4XBFA 1IF1A 4U7DA 2COMA 3C1DA 3V4GA 3SQNA 1U78A 2EJRA 1FX7A 3EDPA 2DU9A 4AIKA 2XUBA 2VBXA 3LFKA 2VC1A 4EM1A 4Q5SF 1SD4A 3HSFA 4HA8A 4KA4A 3O6BB 4EJVA 1K78A 5F64A 1MD0A 3HTUA 1XSVA 1PDNC 3BJ6A 1XMKA 4BQAA 2FBHA 3GXOA 2Q2EA 2PBIA 1D3YA 4ZYDA 3HSRA 4LMYA 2HZTA 1T39A 2Z33A 2E7XA 4WF2A 4U0VA 1BC8C 2F2EA 4LB5A 4QWQA 3ZN0A 4EJWA 1P4AA 3MWMA 3HRSA 2FSWA 5HLIA 5EEHA 2ACJA 2BE5F 2K4BA 1QZZA 2LSOA 2DQRA 3U9GA 3T8RA 1W5SA 2Z9OA 5EEGA 3K1PA 3PQKA 4RGRA 4PZJA 3HSEA 4XLNF 4U0YA 4YFKF 1F1ZA 1SFUA 1K6OA 2L54A 4AIJA 3RPQA 5TJJA 3GZ5A 1FYMA 3VOEA 3LA3A 5J8FA 1Z1DA 5LEJA 5ILSA 2VE9A 2YR2A 2CG4A 3PQJA 4ENKA 3O2PE 3KE2A 1G3WA 2IP2A 3RDIA 1P6RA 2VOPA 5D8KB 2GA2A 4KFCA 1YQAA 2VT2A 2VT3A 1U3EM 3JAMZ 5KK1A 2HFHA 3IWFA 4RB0A 2ZXJA 5BMZA 3M8EA 3WG9A 3ZQ7A 1JE8A 3ZP5A 3RI4A 1Z9CA 3GFLA 1ZYRF 1ZG5A 2BEOA 1CF7B 4RGXA 2KRFA 1SMYF 4I09A 4LG0A 4AWXB 2RC4A 3FMSA 1R22A 4N9IA 1FNNA 2W84A 5E20A 5HDGA 1FZPB 3VEPA 3P9CA 4H0EA 1XGOA 4PCQA 4UV9A 5AIPA 1XMAA 1O7LA 3CJNA 3IL2A 2Z99A 6PAXA 2IPQX 5DV5A 3CUQB 1KYWA 3GWZA 1DPRA 2ZBKA 3DV8A 2EA2A 4EM0B 5L3BA 3MFKA 2YSRA 3EYYA 3KZYA 2HTSA 2P4WA 2LF8A 4R1HA 3C3WA 5JHUA 1IUYA 3LA2A 3E5XA 1YW7A 4A6EA 2K27A 2V1XA 4OU0A 1XGSA 2HQNA 4GYGA 2XASA 2XHKA 4UHTA 3COAC 2CSOA 3V8KA 2ZJ2A 3CUQA 4DQ2A 5HLGA 2EV0A 1RZ4A 4MTDA 3U1DA 4RS8A 1QPMA 2ISYA 4FX4A 1G6NA 2K7LA 2B0LA 3BROA 4RGUA 5DCMB 5ICGA 4HQMA 3GEZA 1U5TA 4HZFA 2HR3A 1T6SA 4EGZA 2OQGA 1BI1A 2STTA 3EYIA 4EV0A 5LBQA 2P7VB 1BOAA 3F8NA 2D1VA 1WI9A 1E2XA 2CO5A 4B8XA 1EH6A 1UHWA 1WWXA 4BXUA 1Z7UA 4YFNF 2D1HA 4I02A 1XDUA 2KIUA 2KIFA 4G6QA 3RJPA 3ERED 2CGPA 4CICA 1DPUA 4I01A 1IW7F 3LQRA 4IHTA 3FZVA 3E97A 3DP7A 1I1SA 5CVRA 2HOEA 3M9AA 1ZLJA 4UXNA 2WV0A 2M45A 4GYIA 3BJOA 1REPC 5DUIA 2W24A 2H94A 5K1YA 1RI7A 3GZ6A 1H9GA 5HS8A 3ELKA 2CYYA 5A2QZ 1BJAA 4HOBA 4FX0A 3G3ZA 2VBYA 3DFGA 5CLSA 3L9FA 1DUXC 3TO9A 1OKRA 2DPUA 2A3SA 1XN7A 5HDNA 2BGCA 4HV6A 4G8XA 4KIBA 3L00A 5FD5A 2MLGA 2QBYB 1S7AA 4XRFA 2Y75A 3QOPA 3V7CA 2OZUA 1ODDA 3J80Z 4LD5A 1MZBA 1X3UA 3MEXA 5FLXK 1IN8A 1XSDA 1YIOA 2JPCA 3LQQA 5TRDA 5IT9Z 5LHHA 1P92A 3JW4A 5L3FA 3QAHA 1S3JA 1O7FA 3E6DA 3WTXC 1GHCA 4G7ZF 3CTAA 3T1BA 4EMSA 3K2ZA 1YS7A 4L9JA 1A04A 3QP5A 1B4AA 3RIRA 4AD9A 4MNUA 3N4MA 1O57A 2DFIA 1F5TA 3L7WA 4KDPA 5ICEA 1TQIA 1P4WA 5H20A 1L3LA 2RQPA 5A2QK 2MH2A 4UV8A 3RKYA 4WWCA 4KYWA 1CGPA 4YFXF 1R1TA 2YU3A 3I4PA 1TQMA 3D0SA 1IN4A 5E1XA 5IT3A 1HW5A 3R60A 1HSJA 4N9HA 2ADUA 5JVTA 3C18A 3T5XA 2UXXA 1LEAA 3MQ0A 4U7BA 2QQAA 4Q4ZF 1IXCA 2HWVA 2P6TA 4KT5C 1U5TC 3QRFF 4MTEA 4AIHA 1LEBA 1HBXG 5LRRA 5JFRA 1ZGJA 3CUOA 2OD5A 4OIPF 2ZFWA 2RVCA 3GW2A 3I71A 5DCMA 2HQRA 1TNSA 2HDCA 4A0YA 4OIOF 3QU3A 4YIIA 1XD7A 2ZMEA 1ONVA 1L0OC 3WODF 3TOBA 2ZO4A 1WSUA 2MA3A 3KEOA 1QBJA 3HTSB 4A12A 2JTVA 2XAQA 2VE8A 2GXBA 2RV8A 2WC2A 2F5EA 4WXDA 1FSHA 4TV7A 2JT1A 4U0WA 2PFBA 1SD5A 2ZNZA 4ESJA 2ISZA 5DEQA 2ESNA 1R5GA 3I5UA 2HTJA 2QUFA 1FPQA 3QPTA 4XLPF 2NAZA 3K1NA 4ZH4F 2LNBA 4G7OF 4ETSA 4P9FA 1ZAOA 3EQLF 3E5UA 4IHSA 1PP8F 2UWMA 1AOYA 3J81Z 4WX9A 3DKWA 1B9NA 5ICCA 3IHUA 3F8BA 2VXZA 5BS6A 3F8FA 1KU7A 2M87A 1FYKA 3F6VA 3KEQA 4HX8A 4OMYA 2PG4A 1OYWA 4HQEA 1T2KA 1HQCA 1J9IA 2HKOA 4CDGA 1MKMA 5K5RA 3H3UA 1G3TA 3KCCA 3M7GA 4M6XA 4EGYA 2MC3A 3WTYC 4L0YB 1IN5A 1TNTA 2F5FA 2C6YA 1UB9A 4M9XA 1J59A 3ABUA 1R1VA 4G94A 4IXAA 2GA1A 3RKWA 4BHCA 4LFUA 5ERIA 3WGHA 4HBLA 2P8TA 4A0XA 1W7PB 2ELHA 1ZH5A 3JSOA 1FY7A 1DDNA 1ZHFA 5E17F 1QQIA 1XCBA 1IXRC 1I1GA 4KUMA 1P2FA 2IA1A 3WTSC 1OPCA 4MQVA 3JAMK 5D5WB 3JSPA 1BI2A 1KQ8A 2KIMA 1EV7A 2O61A 1B6AA 3IRRA 4I0BA 5ICFA 2M8EA 4R79A 2PMHA 2FMYA 3L2CA 5L3EA 2XAJA 4IRGA 2D2WA 1ZLKA 4D0PA 4U88A 3FXQA 1WQ2A 4L18B 3ZMVA 3BWGA 4A5MA 1SAXA 2GZWA 3WTWC 1F4KA 2W25A 3T8TA 3I59A 2Q0OA 2X0LA 1HKQA 3GF2A 1UCRA 2VBWA 2L3DA 1BN5A 4L5IA 2JSCA 2P5VA 2VC0A 2ZCWA 2EV6A 3PFIA 4KIGA 4HF0A 3P9KA 1Z6RA 3GFIA 4WK8F 4L9TA 4OOIA 2RKHA 3I0TA 4OMZA 3Q5FA 4JK1X 4LK0F 5J8CA 2DPDA 1FLIA 1RUOA 1FBUA 2LKPA 2MBFA 5E8GA 4CYDA 2QLZA 5HLHA 2STWA 4ESFA 1D8JA 2Y0MA 1USSA 4HLXA 1LNWA 5F6FA 3E5QA 2Y48A 4HX4A 2XAFA 1IN7A 3D5LA 3HHGA 4KN4X 3K0LA 2JPBA 4G9YA 5HOOA 2FXAA 2W57A 5DYMA 4GO1A 1F9NA 3GLXA 1QZYA 2EFNA 3HHHA 5FFZA 2O6GE 3ZMTA 3KETA 3WGGA 3K69A 1SD7A 1FBQA 1GXQA 1FBSA 5LGNA 2IRFG 4MGRA 1JXSA 3GVAA 5DDGA 1B1BA 1J7KA 1U5TB 4A0ZA 1ON1A 3SZTA 2NYXA 4Q47A 2CFXA 3I54A 4P9UA 3DPLC 4Q48A 5CJ9A 2IT0A 1YYVA 4WXCA 3NRVA 2DO7A 3R0JA 3KLOA 4LLNA 3J81K 1RNLA 5D8LB 2HEOA 1XCVA 2M1BA 2NRAC 4LG0B 3KZZA 4PGGA 3IWZA 3P9IA 1TW2A 1TW3A 3B73A 4EM2A 3LWFA 3WGIA 5IT9K 3DF8A 2BBYA 3WE3A 4N0BA 2CW0F 2K86A 3EETA 5LHGA 3VFZA 3ISPA 4K2EA 4BHBA 2WWYA 2J5OA 4BHPA 4WCGA 5K5QA 1BI0A 3KP3A 3MCZA 1HW1A 1LDKB 1G4DA 4MEXF 2XV4S 1ZRFA 5DD8A
chains in the Genus database with same CATH superfamily
3FWEA 3F0CA 4CXFA 1HCRA 3H3ZA 1FP2A 2O0YA 3G1OA 5D5XB 1Z91A 2MC4A 3L2RA 3DEUA 4G6DA 1BC7C 2ETHA 5E1ZB 1TBXA 4QPQA 2DA2A 2P5LC 1FP1D 3BP8A 3QU6A 2A6EF 5K7ZA 1OCTC 2L7ZA 2WAQN 4KIFA 4DW6A 2R7WA 4HX7A 2FNAA 5ED4A 2O3FA 2Y30A 3G4SI 5J1RA 4BE2A 3Q3SA 1MJBA 2JRTA 5CKTA 2ZJRF 2OAZA 1YLFA 3TDUC 4GGGA 1U6GA 2V1DA 2VJIA 4XSZF 1KA8A 2W7NA 3MMYB 4DBRA 2HYJA 2AXTC 3MVPA 1TWCJ 2K3FA 5EG0A 2A68F 3BG9A 4ZTFA 4O6JA 1ERDA 1KONA 5JI6A 2KDOA 2FQ4A 1ZTRA 2EWNA 1MJAA 3BC8A 2DT5A 2G7UA 4M3BA 3OYGA 2ID3A 1E0EA 1SFKA 2FF4A 1Z0XA 3E6MA 4M3DA 2X51A 2EFWA 3HXLA 2DAOA 3FX3A 2GIZA 3V8LA 3N05A 2JA5J 1B59A 3IC7A 2VQLA 2KIQA 2X1CA 5DS9A 4E7HA 1DP7P 3DXJF 3PSFA 4XLHA 4BXXJ 2FEZA 2EQRA 2JA6J 1K6YA 3S16J 2DQLA 3HOYJ 4FE4A 3J80K 1X2MA 2GBYA 3CCRI 1LE8A 3IP4B 2M34A 5BPDA 3AFHA 3BZ6A 3ESWB 2PMUA 3V8JA 4ASNA 1IXSB 3CO7C 2V9VA 2MLKA 2M30A 4RAGA 2OU2A 4LK1F 1YO5C 2FX0A 2OPTA 4ZZDA 2MG4A 2QBYA 3V42A 2TCTA 3ECHA 5FFXA 4ZYEA 4CO8A 2FD5A 2GWRA 4II2A 5J3LA 3TKYA 4NUBA 2V4JC 3HDDA 4UY8I 4FE7A 4XKWA 2AHQA 4RB1A 3AG4H 3A01A 2M5WA 3A1YA 3F6OA 5DD4A 1YRNA 4YG2F 4PSXA 3VWBA 4RA2A 3JRAA 3Q0WA 2YX7A 4CCLA 1TQPA 2BXZA 3I59B 1BOBA 3JRCA 3F23A 4FCYA 5HDKA 1ENHA 3CDHA 3LSTA 3WTUC 3VYTB 1T38A 3GBGA 2JQ7A 1R36A 2L4AA 2IGKA 2QM3A 4E70A 2FE3A 4KICA 3GYHX 4IPAA 2L2OA 1JTXA 3DKYA 5L3CA 4BY1J 1UMQA 4JBAA 3S32A 2E71A 2AS5F 1O4XA 3SXYA 1X4OA 3EUHC 2KL4A 2Z5UA 3HRTA 2KFDA 2X4HA 1OR7A 2DBBA 3QYFA 4QLCU 1YTYA 3R6SA 5FD6A 4KNYA 4XK4A 4DZJA 1T56A 2CQNA 2X48A 3OYNA 1T0FC 1FOKA 3TDZC 5E8IA 4MIMA 4PDKA 2NS0A 4G6TB 2F48A 4EVIA 1V3FA 2EV5A 2LRDA 5LGTA 1YFHA 1HKTA 3BY6A 3CCJI 5CYVA 3T0YA 1WRJA 3IUOA 1OMIA 3JTHA 4XRMA 1ZRCA 3FXLA 2Z3YA 2F5DA 4MEYF 1ZARA 2LDUA 2K02A 2LKXA 1OYYA 1Y6IA 1IRZA 3PUBA 2FOWA 4JX4A 3BDDA 3CLQA 5DM7F 2YPRA 5LLQA 1I6XA 2R7SA 1U2WA 2DW4A 3ML6A 3RZDJ 2BY3A 2DFEA 2UV1A 4Z6YA 3ZMZA 3WHBA 2XGXA 2JZYA 2DFHA 1JUSA 1X4PA 1GT0C 4ENMA 3H1CA 2EFQA 4A6DA 4HF2A 1VQ8I 2FBIA 2RAEA 3HYIA 3IKVA 1TP4A 1P7JA 4YIRX 1GXPA 5HVQC 2VJ4A 4A69C 5C44J 3E6CC 3I55I 2A5YB 1KU2A 2XIGA 3W6VA 1Q1VA 1J0RA 4JP0A 2EIJH 3HOVJ 1LJ9A 4AU7A 1LVAA 5GP9A 1W7PD 3QYEA 4AYBN 2JRMA 5HS9A 4N4OB 1E3OC 3W6KB 4J00A 1BR1A 2CJJA 3OOPA 3S8PA 3HKZN 2A6HF 4XRSA 4OWRB 1S7EA 3RSNA 3HKZA 4IRIA 2R93J 2MGQA 3KFWX 1QRYA 4E7ZA 1ZGWA 1BA5A 1FEXA 5BQTA 3K70D 4M72A 3RTRA 4L5JA 1WKMA 2DYSH 2VJJA 1E3HA 4M71A 1A6IA 1MDMB 5AIQA 1SFEA 1T0FA 2W85A 4EJTA 2H6BA 1JHHA 2EB7A 2V9KA 4RB3C 4V2GA 4MLOA 4RMNA 2R7DA 4I7HA 4HEA2 4ESBA 3PIOF 3L09A 3W2AA 5KHDA 1CF7A 2R3SA 2AQEA 2H1KA 2JSPA 2HXIA 1RUNA 2L4MA 3DQVC 2EZKA 2IW5A 4UNOA 1S72I 1OYIA 3F72A 3OV8A 2PJPA 1XDSA 4C2UA 1S8NA 3FHZA 2ZXWH 3I58A 1AWCA 2DLLA 4CGZA 2NNNA 2IS4A 3E7LA 1X3ZB 2HKXA 1RIOH 3OYBA 1DP3A 3N97A 2CV2A 2VONA 4UUSB 3TQNA 2R4GA 3BZCA 4E7SA 1S6LA 3H36A 3U21A 3BZKA 4HDVA 3K2AA 2O5RA 2LY2A 4OIQF 4E6KG 3ZPLA 3HOTA 2PLYA 1I5ZA 1Z6TA 2LC2A 3BG3A 3K6GA 4ENNA 3H0GJ 2H8WA 5IOZA 4A3EJ 1Z05A 2QKMB 2DCEA 1MMSA 4BEHB 5J1UA 4Y15A 2DA3A 4BQQA 4CCNA 3FMQA 9ANTA 2QQ9A 1T98A 1V5FA 1QU3A 3JCUC 4R8HA 4I0AA 2XVCA 4KMUX 1KQ9A 2UXNA 2QWWA 3BOQA 2ME6A 4KITB 3CCUI 4FETA 4A3FJ 1SVOA 1JKOC 3K1MA 4NB5A 1LDJA 3P7NA 2W4SA 2CMPA 3CDIA 5FRNA 5LEKA 3B02A 2HYFA 3LAPA 3OYKA 3FM5A 2OZ6A 3FHNA 2O8XA 2J5PA 2HXOA 4M9SA 5F04A 4XIDA 1USTA 3M1EA 1SFOJ 1DQUA 1BL0A 5D4RA 2JUCA 3RPUA 3L1PA 5IY5H 3HOWJ 2MD5A 2DOEA 3MZHA 2ESHA 1EKEA 1SVLA 1BM9A 1D5YA 3I64A 2UUZA 2RN7A 3I4MJ 2DI3A 3NEUA 1UZCA 3KPHA 2VL8A 1O3QA 1SFXA 4HNTA 2LMDA 2GIVA 2A07F 3KYDB 1TLHB 2WB1A 3KP4A 4LLLA 1FT9A 3FK6A 1MBGA 4OINF 3UNGC 3KYLA 4AC0A 4CHUA 5IPAA 3AG1H 2XRNA 5HS7A 4UUVA 3GO5A 3SZGA 1TTYA 3FXRA 4OIRF 2HGCA 1KU9A 5K5OA 1R1UA 1ZG3A 5GAHJ 2DA1A 3QODA 3BLYA 1Y8RB 4IHVA 2CS3A 2DDBA 3FMRA 4BNCA 5F1JA 1G3YA 5LRSA 1SAUA 3HOSA 4XL9A 2XF7A 3ASOH 3TP3A 3ZQGA 4HV5A 1T8IA 1FSEA 1FMWA 3RPUD 4M6VA 2F5CA 4PUSA 2WAFA 1YG2A 4B47A 1XSXA 4CZCA 1HLVA 5LGUA 1OJLA 2A69F 4HDUA 3GX4X 1FOXA 4I98B 1K79A 2V26A 3BJAA 1HSTA 2WTEA 3U2RA 3FXUA 4P96A 2M0MA 4Y7NJ 3CF5F 4HNUA 2VQCA 1QVUA 4XORA 4EQQA 1QNTA 1B72B 5ILUA 2DK5A 5LHIA 3EUHA 2XAUA 3BPXA 3J7AO 2R5YB 4LB6B 1K78B 2CW7A 2KJBA 3ZN1A 5EGOB 3B6CA 1YJWI 5CPRB 3WTTC 3GUDA 2TRTA 3F9KA 5F1RA 2Q1ZB 2HS5A 2VKVA 2L7MP 1PUEE 1S5LC 4QSHA 4Y13A 4L9NA 2EFPA 3TW7A 1LDDA 2LF7A 3SEQA 1NG6A 3A4CA 4AUXA 2OF7A 4YEJA 3KP2A 4KJZA 2D45A 2K9LA 2VODA 5GTIC 2JK3A 3S93A 1J75A 1UFMA 2CUZA 2K40A 3H5NA 3REOA 5M5XJ 5M3MJ 5DTDA 1Y1VJ 2DTRA 5DUKA 5FKMA 1DU6A 4NHJA 4EJOA 2MABA 3LA7A 4M3EA 1IRFA 2JVGA 3HUGB 2GQQA 2KKOA 4YIFA 5D4SA 2CQKA 2DJNA 2BYVE 4UVBA 2B63J 5JLWA 2P7CB 4IVNA 4LLGF 4RAYA 2M8GX 2COBA 2ZMEB 1MBKA 2VQHA 3RYRA 3Q9VA 1V5GA 2DMUA 2DODA 1D8KA 3WTZA 4M9ZA 3HB9A 3BPVA 3WU2C 3MAJA 1JKQC 4ON0A 2VBZA 1X1CA 2LLKA 2P81A 3HM5A 2KMUA 3HGGA 5J47A 1LQ1A 1MH3A 3L2VA 4HF1A 2XPUA 2E1OA 1FJLA 2P6SA 3MZYA 1E17A 2WY7Q 1G3SA 1W4MA 5FKOA 1F43A 4F7ZA 4ABZA 3DCFA 2X85A 5KNLA 1VQKI 1BBYA 1MBJA 1TZLA 2R7RA 5EG0B 5BPIA 3SHFA 2NOJB 4IEJA 3PO2J 4F91B 2ZC2A 5FKNA 1SMTA 2R7XA 1OCRH 1KQ0A 1C0WA 2HVSA 3G73A 3J7YJ 5IP9J 2O8KA 5B5EC 1OLTA 1OCPA 5FROA 5CVJA 1I3AA 1JT6A 2ZNYA 3AAFA 2HOAA 3GFJA 4YELA 1VNDA 4QPOA 1KZHA 5AONA 1MJ9A 4GCVA 4BBRJ 2P5KA 4BAYA 2OA4A 2E7WA 3Q0UA 3FF5A 3J7ZI 1AKHB 4J01A 2VN2A 4A2UA 5D6EA 1LFPA 1SVMA 5GADJ 3CMYA 1FIPA 2CQXA 4WXHA 5CVVA 1LE8B 1IAWA 2PI0A 3ULQB 4FHTA 2PQ8A 5IP7J 1HA8A 2EA4A 1GVJA 5CQGA 1R23A 3QP6A 3H35A 3W6JB 3K4KA 3ROUA 4ZZLA 1Y8QB 4IL6C 3VPRA 3IV5A 1G8XA 5FO5A 1ZN2A 1FYLA 1YS6A 3F3XA 1BIAA 2XPWA 3QPLA 3HRMA 2DK8A 4BXFA 2K9SA 3SFZA 5L3DA 1HKSA 3ZMDA 1W0TA 3BTIA 3RKQA 3IKTA 5M5WJ 3LSHA 1GV2A 1ZREA 1Y0UA 3DTKA 4DNCA 2GOXB 4CZZA 1NHAA 1YRNB 3TO7A 2E1NA 3VODA 2R7UA 1EH8A 3CCSI 1KYZA 2PN6A 3H92A 1ETKA 2GXGA 2VPRA 1MGTA 4DJAA 4BYYA 1ULYA 1FC3A 3WU1B 4S04A 4NC6A 3I9V2 2DOFA 1BIBA 2V6CA 2FQ3A 4I76A 3HPGA 5DCFA 2L0KA 3ZQHA 4M74A 1QGPA 2MD0A 3KZIC 3R4KA 4E7JA 5E3OA 2CQ7A 4IKFA 1MBHA 4Z2YA 1JHFA 1JT0A 3E3VA 3TOAA 3CC7I 4XSXF 3TL4X 4GXOA 3OYAA 4RAFA 1XGNA 2JWTA 3O8HA 2FBKA 5GPAA 2XKOA 4OAYA 1N25A 1ZGAA 2KRCA 4MQ9F 3JTGA 1B8IB 3OYLA 1P4XA 1LPQA 5FB2A 3TGNA 1O3TA 4A93J 1VQ4I 2EK5A 2XAGA 4BEHA 2UZKA 2X6XA 4HYEA 3S2WA 3ABMH 2WY8Q 1XGMA 4IOCF 3LSMA 3SDGA 2AXLA 4CA0A 1JTYA 1IN6A 2K4JA 3CLOA 2IJLA 1IRXA 2QF7A 4A5NA 3G1LA 3BCAA 3WU0A 4LITA 3K9TA 2OTJI 4IF4A 1UAAA 2BW3A 1EA3A 2Z1DA 1W36C 2H8RA 2EPFA 2BVMA 1Y39A 2R5ZA 2MFZA 1XX5A 2OQRA 2QZ8A 2RDPA 1OCZH 3NWSA 2VI6A 1PYVA 3HOXJ 2DT6A 2PEXA 2W00A 4EJUA 3P5JA 1SANA 4F92B 2TDXA 2GAUA 2HYGD 3HRUA 3VYSB 4L0ZB 1W5TA 1OCCH 4RM3A 2MH9A 1VTNC 4A3DJ 5C4XJ 3OR1C 3HIFA 2RGVA 4BBSJ 2V79A 2WB1N 3RYPA 4XOTA 2DJIA 1FWZA 1V4RA 3CZ6A 4B4CA 3G1MA 4LIVA 1R5HA 1S9HA 4ZYHA 1STZA 2HOSA 5D5UB 1IZ1A 2K3PA 3IAS2 3QPHA 1R7JA 4FASD 5H6QA 5J6XA 4G7HF 5L3GA 3K10A 3CO6C 2QSHX 2NNYA 5FLXZ 4I2OA 4LGWA 5FKKA 2EFOA 2L7KA 2IVMA 2PX9A 3OL4A 2FRHA 2R7FA 3SZPA 1H88C 5CVIA 1J2XA 1MIJA 2XDVA 1UHMA 2HPIA 2LP0A 1WI3A 3GFMA 1VQNI 3MKYB 2A61A 2QA4I 2BV6A 2LK2A 4CYCB 5FLMJ 1YJ9I 2KDZA 5FGMA 2H09A 2XAHA 2M4GA 2H6CA 2L9VA 3ZMUA 2FU4A 1YW9A 2VQGA 4KN7X 1XPXA 1O3RA 4BUPA 5H6RA 4UVCA 1QO0D 4HW0A 4XOPA 1ZKGA 3E6BA 2RNJA 1Q1HA 3KP5A 3RKXA 4BH9A 5JR3A 3V7RA 4CCKA 2ECBA 1MBFA 2F4OB 1HOMA 4HAMA 3S3OA 3I53A 3FBIB 3GTPJ 2KZGA 1GUUA 3X2QH 2G9WA 2WAEA 1HXDA 4Y33A 4AVPA 5F0CA 2FOKA 4UVAA 4FT8A 4MHGA 3LAJA 3GZNB 2G0EA 3TEDA 4IQ4A 2XSJC 5D6FA 4RAZA 2V1UA 4Y4RA 1VI0A 3S1QJ 3PNYA 2IA0A 1IRGA 3BG7A 3MN2A 2R7TA 1MH4A 1YX5A 3LSJA 5BOXA 3KP7A 3FM3A 3R0AA 4O3MA 1HC8A 4D7MA 4RDUA 3J7AY 1IUFA 1JGSA 4CH7A 2JA7J 1KU3A 2ZSHB 3HUGA 2FNPA 4M3GA 3Q9SA 3CCEI 1ON2A 3NQOA 4PK4A 2Q8KA 3K70C 2QQBA 2F4IA 2IXSA 3H9QA 5IYBJ 2HVRA 2QENA 1ZG1A 2K9QA 1XB4A 3K4MA 4XMYA 1S7OA 2DMPA 1POGA 1B9MA 2YX4A 2KT0A 3M8FA 1W7PA 3CC4I 2IA2A 2L01A 1WJCA 4B44A 1YW8A 1RR8C 5CQEA 4F52A 4RB2C 2DMQA 1IDYA 2DA7A 3ECOA 3KX2A 4BQOA 5D5VB 4J19A 2AQFA 1DU0A 3SYTA 1PP7U 2FA5A 2M7AA 5ILVA 3OIQA 4NNJA 4B09A 3O8GA 2XF6A 3CQZJ 1ACIA 3VDXA 3C7JA 4NQWA 1H0MA 3UKGA 5EEAA 4O5VA 1JUPA 3V7SA 4MFEA 5CVUA 1O3SA 3HPHA 3IRQA 1I50J 2HQAA 2E1CA 1IO2A 4BJTA 3ZMSA 2NVTJ 1I27A 1Y0NA 5E79C 4S05A 3K4JA 5EJCA 3CMAI 3HBLA 1XMXA 1S29A 2XB5A 2DT7B 2V1NA 4Y17A 2DA4A 1HDPA 4P55A 2XKPA 4M73A 1D5VA 4BDYA 3BR3A 2XROA 4L9VA 1YITI 3TBIA 2GLOA 1EH7A 2BXYA 3WE2A 4XQFA 4RGSA 4BE0A 2VOOA 1H9TA 4HLYA 2QYOA 2BOLA 2Z2SB 2X1DA 2G7HA 3KLNA 1ZRDA 3F21A 3JREA 4ZYGA 3KP6A 3DEWA 4X6AJ 3TO6A 2LY1A 2O03A 3DPTA 3JRDA 2H27A 4M6YA 3ABTA 1R58A 1WFXA 3F8MA 2NS8A 3GTQJ 1KGSA 5E1WA 2KJCA 1SD6A 2E1MC 2QGUA 1R00A 4JQFA 1QPIA 2EBIA 2L7FP 2VASA 2CWEA 3HZJA 2IBDA 1CQTA 1HF0A 3R61A 2ME0A 3M3YJ 1R6RA 3F22A 5E18F 1BR4A 1K7AA 1ORKA 2V6EA 3A2KA 3H9JA 2FMLA 3O3KA 4HPQA 3H9GA 2Y69H 1U8RA 4PGHA 4MO7A 1APLC 4IHWA 3VB2A 1D0ZA 3E0JB 3K7AJ 1G59A 2B9SA 5KVRA 5FRMA 4ITVA 2OJED 4IRHA 1J5YA 4XONA 5IYDJ 2BY1A 3EPZA 3H3VK 2PMZN 2HDDA 2K85A 1HW2A 3WTVC 4C3IJ 3VSKA 2LFBA 3ZXSA 3CP8A 2YUSA 4LJZF 2K9NA 2OBPA 4H4KC 5B3SH 1LB2A 2CRGA 2ZKZA 1B8IA 2QVOA 2CUFA 2KPMA 3CUQC 4IJAA 4ENJA 4PFOA 3A0BC 3JRHA 1ZR4A 1MDMA 1BI3A 2LBFB 4PJNA 1ETXA 2L02A 4P5OA 4KMFA 4JX5A 2YU9J 3F8CA 4XBFA 1MSEC 1IF1A 4BACA 3KEYA 2COMA 4RLFA 4U7DA 1VFCA 4XLFA 3C1DA 4ANJA 3V4GA 3SQNA 1U78A 2EJRA 1FX7A 3K4LA 5C3EJ 3A01B 1R71A 3EDPA 2DU9A 5KAIC 3IH3A 4AIKA 1WJEA 2CV1A 2XUBA 2VBXA 1QA6A 4IQJA 3NAUA 3LFKA 3A0HC 3PFYA 3FDYA 2VC1A 2DFFA 2HVQA 4EM1A 4Q5SF 1SD4A 1U0JA 3HSFA 1BW5A 4HA8A 3BQZA 4ZTJA 4KA4A 2OUMA 3O6BB 4JYKA 4EJVA 1W36D 3PUFA 1K78A 5F64A 1MD0A 3HTUA 3SFIA 1XSVA 1PDNC 3BJ6A 1XMKA 3OY9A 5E3NA 2FBHA 4BQAA 3GXOA 1ETOA 2Q2EA 3OYFA 2PBIA 2XGEA 4C9YA 3OYEA 1D3YA 1LUJB 4AM3A 4ZYDA 2ELKA 3HSRA 4LMYA 2BZTA 2HZTA 1T39A 2Z33A 2E7XA 3CMMA 2RQQA 4WF2A 4XLEA 4HG2A 3JRBA 1RKTA 2KQRA 4U0VA 1BC8C 4HRIA 2F2EA 4LIUA 4LB5A 4QWQA 2Y2ZA 2ZB9A 1MW7A 3ZN0A 4EJWA 4XKBA 1P4AA 4PJ0C 2XRLA 2PJRA 4Y3OA 2M3AA 3MWMA 3HRSA 1JUMA 2E35A 1D0YA 3ZR8X 2FSWA 5HLIA 5EEHA 2ACJA 2KP6A 5IOYA 4XICA 2BE5F 2K4BA 4DBQA 1QZZA 2LSOA 4G12A 4LG3A 2DQRA 3GTMJ 4XRSG 3BCBA 3U9GA 3T8RA 1W5SA 2Z9OA 3LSPA 2X6OA 2NVUB 5EEGA 5J1YA 3K1PA 3FK7A 1Z7LA 3PQKA 4RGRA 2DYRH 4PZJA 1TC3C 3HSEA 4XLNF 2XGCA 4U0YA 3HJEA 3OIOA 1F1ZA 4YFKF 1SFUA 4W97A 3AL0B 1K6OA 3DKXA 2L54A 4XLAA 1HDDC 4HSRA 3RPQA 5TJJA 4AIJA 3GZ5A 2CUJA 5KAFC 3VOEA 3LA3A 2EIKH 1FYMA 2K9MA 5J8FA 1WJ5A 3U1KA 3JRGA 2NVYJ 1Z1DA 3OYJA 2H1LA 5LEJA 1BJZA 5ILSA 3GCMA 3DBLB 2VE9A 1FTZA 3OSGA 2YR2A 2CG4A 1T08B 3PQJA 2XSDC 4ENKA 3O2PE 4BJ6C 2NOGA 3KE2A 1G3WA 2IP2A 5IYCJ 1JGGA 3RDIA 1P6RA 1PUFB 2VOPA 5D8KB 4AIDA 2GA2A 4KFCA 2FUG2 1V55H 3CDLA 3JRFA 1YQAA 5J4VA 2VT2A 2X6YA 1XC5A 2VT3A 3ZOBA 1U3EM 4PJJA 2WV1A 2VB6A 5KK1A 3JAMZ 2HFHA 2KZVA 4HSTA 3IWFA 5LFAA 4RB0A 4B1RA 2ZXJA 3ZQIA 5BMZA 3M8EA 3PSIA 4D5FA 3WG9A 1Z77A 3ZQ7A 3S17J 2CQQA 1JE8A 2HU9A 3VYUB 3ZP5A 3RI4A 1Z9CA 3GFLA 4DYCA 1ZYRF 5TISC 1ZG5A 3S2HJ 2BEOA 1CF7B 4RGXA 2LKSA 1RRJA 3IAM2 2KRFA 2BY2A 1SMYF 4I09A 4LG0A 4AWXB 2VUMJ 2RC4A 2JUGA 3FMSA 1R22A 4N9IA 1FNNA 2W84A 5E20A 5HDGA 1TWGJ 2R5ZB 1FZPB 4A3KJ 4E7LA 3VEPA 3TP0A 3P9CA 4H0EA 3NWTA 1UHSA 1XGOA 4PCQA 4UV9A 5IP6A 5AIPA 2DTZA 1XMAA 1O7LA 2Y31A 1X1BA 3CJNA 3IL2A 1JKRC 2Z99A 3K4BA 4UUSA 6PAXA 2IPQX 1Y56A 4B48A 5DV5A 5F27A 3CUQB 1D1BA 1UG2A 3UR3C 4C3JJ 1KYWA 3GWZA 1U8BA 3S1NJ 2E60A 1D1AA 1DPRA 2NVQJ 2ZBKA 3DV8A 2EA2A 1WJBA 4EM0B 2JA2A 5F0FA 3LFUA 1VF9A 5L3BA 3MFKA 1R9TJ 2YSRA 3AKZA 3EYYA 1RKWA 1WVRA 3I3LA 3KZYA 2HTSA 3OMYA 5HODA 2WAQA 2Y9YA 2P4WA 2IGOA 5H2FC 4A3IJ 2M7BA 2LF8A 4R1HA 2ZSIB 3C3WA 3DTIA 5JHUA 2YS9A 1IUYA 3LA2A 3VYRB 2OV7A 2LG4A 4FISA 3OYHA 3E5XA 4A3MJ 2X6WA 4S0HB 2EILH 3EUKL 3GLLA 1YW7A 4A6EA 2K27A 4F55A 2F4MB 4CCOA 1VQLI 2V1XA 4OU0A 3EUAA 1XGSA 2HQNA 4GYGA 2XASA 4LOCA 2XHKA 4UHTA 2E5ZA 3COAC 2JA8J 2CSOA 2VPLA 1TWFJ 3V8KA 4IO9F 3OSFA 2ZJ2A 4ZDPA 2LVSA 1I3QJ 2IS2A 3CUQA 4DQ2A 5HLGA 4C30A 3RZOJ 1DGRM 2EV0A 1RZ4A 3PO3J 3AG2H 4MTDA 4AYBA 2IS1A 3U1DA 4RS8A 1QPMA 2ISYA 3H5RA 4PFPA 2KISA 2PMZA 4FX4A 1G6NA 2K7LA 1K4TA 4P1WA 4XN3A 2B0LA 3BROA 4RGUA 4C2MJ 5DCMB 1N77A 4BU2A 1A5JA 4CSWA 5ICGA 1TT0A 4HQMA 5F08A 3GEZA 1A36A 3MKZA 4BE1A 1U5TA 3LSGA 4A3CJ 4MFDA 4HZFA 1MMAA 2HR3A 1WCMJ 1T6SA 1MSFC 4EGZA 5B1AH 4DGWB 2A6TA 2OC6A 2OQGA 1BI1A 3GMEA 3ONQA 2STTA 4XR6A 3EYIA 4EV0A 4X0GA 4CYCA 5LBQA 2P7VB 1B72A 3M4OJ 3HL2A 4IZZA 3OYDA 1BOAA 3F8NA 1Z21A 3OS1A 1H8AC 1VQ9I 2IGNA 2R5YA 2D1VA 2WBMA 2M9HA 1WI9A 1E2XA 4BKXA 2CO5A 4B8XA 1EH6A 1UHWA 1W0UA 4EATA 1WWXA 5B1BH 2VKEA 1JJ6C 2Q2EB 1ETYA 2JJ7A 4BXUA 1Z7UA 4YFNF 3FXJA 1X1AA 3LMMA 3OYCA 3CCMI 1YI2I 3AG3H 2D1HA 4I02A 4BY7J 3RQIA 1XDUA 2JMWA 2XC7A 2KIUA 4FTHA 3GTLJ 2NS7A 5EZHA 3LSRA 2KIFA 4G6QA 3RJPA 3HG9A 1T95A 3ABKH 3ERED 2CGPA 1EF4A 4CICA 1DPUA 4I01A 1IW7F 5LD2C 3BR1A 3LQRA 4IHTA 4D7NA 1AA7A 3FZVA 3E97A 3BR0A 3FISA 2X9DA 2W82A 4ZYAA 3DP7A 3GTOJ 3C2HA 1RPWA 2I8DA 3BTJA 1I1SA 2CW8A 5CVRA 2HOEA 3M9AA 1ZLJA 2BW3B 4UXNA 1ETVA 2XF5A 2IAIA 2WV0A 2M45A 4GYIA 5B66C 2E2IJ 2ZFUA 3BJOA 3PJRA 1YJNI 1UG0A 2W48A 5DUIA 1REPC 2W24A 2H94A 3QQAA 2FJ1A 5K1YA 1RI7A 3GZ6A 1IV8A 1H9GA 2K5CA 5HS8A 3SJMA 3ELKA 2CYYA 1A35A 4CCMA 4B3AA 2NVXJ 2ZJQF 2L9RA 5A2QZ 4D5CA 1WHUA 1BJAA 4HOBA 4FX0A 3FXKA 3G3ZA 4NQWB 2VBYA 1V5EA 3DFGA 5CLSA 2HZDA 3L9FA 1DUXC 3FXMA 1WZ2A 3TO9A 1OKRA 1IC8A 2DPUA 3Q0VA 1NG7A 2A3SA 1AKHA 1XN7A 1Z3XA 2GM4A 1U9NA 2L5QA 1X58A 1OQYA 5JLXA 5HDNA 2V9PA 3LSKA 2BGCA 1UJ8A 3DU5A 2QKLB 4HV6A 2ID6A 4G8XA 1Z67A 4KIBA 4DOZA 3L00A 1YE9A 5FD5A 4XNFA 4PJMA 3DLLF 2MLGA 3LSIA 3BR2A 1VQMI 2OCEA 1QHGA 1EJ9A 1FOYA 2L9SA 2QBYB 2CH0A 2I5UA 1S7AA 4XRFA 3GTJJ 3PNVA 2VLAA 2Y75A 3QOPA 3V7CA 4DIQA 2OTLI 4ZJZA 2OZUA 1ODDA 3J80Z 4LD5A 3DBRB 1MZBA 1X3UA 3HC7A 4F3QA 3MEXA 2EZLA 4L5EA 4BJ5C 3LNQA 1ZELA 3S1MJ 1PVEA 1R4NB 2LY9A 3CESA 5FLXK 3CCYA 3HEFA 2XPVA 1IN8A 1XSDA 2E2HJ 3S2DJ 5DM6F 1LKXA 1YIOA 2E19A 2JPCA 3LQQA 2QCOA 5TRDA 1MMNA 1SEUA 5IT9Z 2HI3A 3I56I 5LHHA 1P92A 4GDFA 3TW6A 3MKWB 4IOAF 3MZ8A 3JW4A 5L3FA 3QAHA 4C2TA 3ASNH 1S3JA 1O7FA 2DN0A 4UUTA 3E6DA 4UB6C 3PNTA 3CCLI 3WTXC 1GHCA 2HDWA 1OFCX 4G7ZF 3CTAA 3T1BA 4EMSA 3K2ZA 1YS7A 4L9JA 1A04A 3QP5A 1B4AA 3RIRA 4AD9A 4IHXA 2MYSA 4MNUA 2ELJA 4IX7A 1BR2A 1O57A 3N4MA 2P0WA 2DFIA 1F5TA 5TGTA 2DMNA 4NDLA 1FMVA 3L7WA 4XN0A 3BR6A 4KDPA 5ICEA 1TQIA 2DMTA 1P4WA 1JKPC 5H20A 2GOMA 1FTTA 1L3LA 2RQPA 3B6AA 4A3GJ 5A2QK 2MH2A 4UV8A 3RKYA 2F5VA 2ECCA 1YHQI 4WWCA 2O7OA 3OYIA 4KYWA 5J40A 1CGPA 4YFXF 1R1TA 2BY0A 2LREA 3A03A 1VQ7I 3QPSA 2YU3A 3I4PA 1TQMA 3OL3A 1ITYA 1QVTA 3JR9A 5GAEJ 2X1EA 3D0SA 1W1WE 1IN4A 2VXDA 5E1XA 5IT3A 1HW5A 3R60A 1HSJA 4N9HA 2ADUA 3BTLA 5JVTA 1E3PA 3C18A 3OWTA 3T5XA 2UXXA 1LEAA 3MQ0A 1MNDA 3G2BA 3K4NA 4DYRA 4U7BA 1SC7A 2R0QC 1X1PA 1I6HJ 2QQAA 4Q4ZF 1IXCA 1Z3YA 2BVLA 2HWVA 3FBNB 3CP2A 2P6TA 4KT5C 3S3MA 1U5TC 1VQ6I 1QHHD 4N4NB 2EIMH 4B43A 3QRFF 4MTEA 4AIHA 4XM3A 1MMDA 4KISA 3E1SA 1HBXG 1LEBA 5LRRA 2LD5A 5JFRA 1ZGJA 3CUOA 3S15J 2OD5A 1WJFA 4OIPF 3QWLA 2ZFWA 2RVCA 3D5RC 3GW2A 3I71A 4V19K 4DYQA 5GTHC 5DCMA 3OIPA 2WA0A 3OYMA 1AHDP 2DA5A 2HQRA 1TNSA 3SDBA 4A0YA 2HDCA 2KHMA 4OIOF 2PJRB 2VIXA 3QU3A 3DEEA 4I6ZA 4YIIA 1XD7A 4BGDA 3ZQCA 1GLNA 3DPUA 1XG1A 2ZMEA 1WJDA 3KIOA 1ONVA 1L0OC 2QSGX 1QZEA 4JOMA 3WODF 3TOBA 3OS2A 2QEXI 2ZO4A 3BTCA 3NARA 4HNVA 5EDNA 5F0HA 1WSUA 2MA3A 3KEOA 2NXNB 1QBJA 3HTSB 4A12A 3OS0A 1N78A 1MNMC 2JTVA 3IH4A 2XAQA 3HOUJ 3ZQFA 3L2WA 2VE8A 1IGNA 2EINH 2GXBA 2RV8A 2WC2A 2F5EA 2M2EA 4WXDA 1N75A 1FSHA 4GRIA 4TV7A 3ERMA 2HOTA 3L2UA 5KCMA 2JT1A 5JHFA 4U0WA 2PFBA 1SD5A 1BW6A 1P7IA 2ZNZA 2XGDA 2DA6A 4ESJA 2ISZA 2R7OA 2A5WA 1M1EB 5DEQA 2ESNA 3DU6A 1FOWA 1GV5A 3CD6I 1R5GA 3SEZA 3I5UA 2HTJA 5E3LA 2QUFA 1FPQA 2LBFA 3D5SC 3QPTA 4V2FA 4XLPF 2NAZA 3K1NA 1IJWC 3W2VA 4ZH4F 4U87A 2LNBA 1TWAJ 2ZJPF 4G7OF 4ETSA 4P9FA 1ZAOA 2QQ8A 3EQLF 3E5UA 2E1MB 4IHSA 3BG5A 3CJQB 1PP8F 4GFBA 1TT5B 4II3A 3D1NI 2UWMA 3BT9A 1AOYA 3J81Z 4WX9A 3DTEA 2XB0X 2CV0A 1H89C 3DKWA 3M1CA 1T33A 1R4MB 2GXAA 1Y1WJ 1XS9A 1B9NA 2E5NA 3IH2A 2CUEA 4KT6A 5ICCA 1WGXA 3IHUA 1ZQ3P 1YOVB 4X1EA 3F8BA 2VXZA 2BHYA 1TL8A 5BS6A 4RLQA 3F8FA 1KU7A 2M87A 4W1UA 1FYKA 3F6VA 4ZC3A 3KEQA 3GTGJ 4HX8A 1AU7A 4OMYA 1GDTA 4IHYA 2PG4A 1OYWA 3W2WA 4HQEA 1T2KA 1HQCA 3A02A 1JJ8C 1J9IA 1ETQA 2HKOA 1WH7A 4CDGA 1MKMA 3LL7A 5E3MA 5K5RA 3H3UA 3C2BA 2DOAA 3S1RJ 1IDZA 1FIAA 3DLAA 1G3TA 3ZGKA 3KCCA 3M7GA 4M6XA 1K4SA 4EGYA 2MC3A 3WTYC 4L0YB 1IN5A 3MD2A 1TNTA 2F5FA 1UB9A 4M9XA 2C6YA 1J59A 1LFBA 4EEFG 3ABUA 1R1VA 2AO9A 4G94A 4IXAA 2GA1A 4CUGA 3RKWA 4BHCA 4QIWN 4LFUA 1UELB 5M3FJ 5ERIA 3WGHA 4HBLA 4RBOA 2P8TA 1RC9A 4A0XA 1W7PB 2ELHA 1ZH5A 3JSOA 1YIJI 1FY7A 1X1DA 2OCCH 3CMEI 1DDNA 1ZHFA 5E17F 1WH5A 1QQIA 1XCBA 1IXRC 2E34A 4BDZA 3S14J 1I1GA 4OAZA 2JN6A 1R5ID 4ZDOA 3I4NJ 4RM2A 2EH3A 1K61A 2QSFX 3CF2A 4KUMA 1P2FA 1F36A 2IA1A 4D9JA 3WTSC 1OPCA 4MQVA 3TMOA 4AVZA 3JAMK 3RQ4A 5D5WB 3JSPA 3S3NA 1BI2A 1KQ8A 2KIMA 3G71I 1PJRA 1EV7A 2O61A 1A31A 1B6AA 3IRRA 4I0BA 5ICFA 3OOUA 1OCOH 2M8EA 2MW8A 4D1QA 4R79A 2PMHA 1NK3P 4UB8C 5EYRA 2FMYA 3L2CA 2VKHA 4A3BJ 2KLOA 2XAJA 4IRGA 3BR5A 2D2WA 4B3XA 5L3EA 1ZLKA 4D0PA 5FLVA 4QTRA 1I39A 3C2GA 1RETA 1XTAA 3BQYA 4U88A 3FXQA 1WQ2A 2V7FA 3LOCA 4DZPA 4L18B 3ZMVA 5BNGA 3RCOA 1RR7A 3BWGA 3AL0C 4A5MA 1SAXA 2GZWA 5FJ8J 1X19A 3WTWC 1F4KA 1MNEA 2W25A 1WPKA 3K4CA 3WG7H 3T8TA 2IEKA 4C3HJ 2DXIA 3I59A 2Q0OA 3ZQQA 2X0LA 4A3JJ 4PJLA 1HKQA 3GF2A 3ZQLA 1MMGA 1UCRA 1ZR2A 2VBWA 1ETWA 2L3DA 1V54H 1BN5A 2LH9A 2VKDA 2IGMA 1YX3A 4BL0B 5GPCA 4L5IA 5J4YA 2JSCA 2P5VA 2VC0A 2ZCWA 5JVGF 1D0XA 2EV6A 3PFIA 1G2HA 4KIGA 2IS6A 3WHCA 3W3CA 5FKLA 5K7FA 4HF0A 3GTKJ 3P9KA 1Z6RA 1LFUP 3GFIA 4WK8F 2B7EA 4L9TA 2DDAA 4OOIA 1VZ0A 2RKHA 2JVHA 3CCQI 1NK2P 3I0TA 2E2JJ 2ZMEC 4OMZA 2I10A 2Y0SN 3Q5FA 2HPMA 4JK1X 4LK0F 1J09A 5J8CA 1TWHJ 2DPDA 5EF6A 1FLIA 1RUOA 1FBUA 4YRVA 2LKPA 2MBFA 3H5AA 1NTCA 3M8JA 5E8GA 4CCJA 4CYDA 4A3LJ 2QLZA 5HLHA 1IV6A 2STWA 4ESFA 1DGWY 2Y0MA 1D8JA 3VSLA 1USSA 2HNHA 1OISA 3PIPF 2D5VA 2L9NA 4HLXA 1OR7C 4I99C 1LNWA 2CFOA 5F6FA 2WADA 4E7KA 3E5QA 3CJTB 2Y48A 3CC2I 2R7QA 1VQOI 4HX4A 2XAFA 2ZXHA 1IN7A 3D5LA 3HHGA 4KN4X 2EZIA 3OR2C 4ZDLA 1K83J 3K0LA 2N8GA 2JPBA 2R92J 4G9YA 5HOOA 2CU7A 1MBEA 2FXAA 2W57A 5DYMA 1ZK8A 4GO1A 4NC8A 2R7VA 2A05A 4NBQA 3H0DA 2O9LA 1F9NA 3GLXA 1QZYA 2W1OA 3CJRB 2EFNA 3HHHA 5FFZA 1VQPI 2LOOA 2O6GE 2ICWG 4E7IA 3ZMTA 2F6CA 3KETA 3WGGA 3K69A 5HNHA 2Z16A 1SD7A 1FBQA 1GXQA 1FBSA 2HQ5A 4Y52J 1RESA 5LGNA 4PSWA 2IRFG 5K7HA 3FXOA 4MGRA 3MKLA 1PUFA 2Y9ZA 1JXSA 3GVAA 5DDGA 1B1BA 1J7KA 1U5TB 3DWLE 4A0ZA 1ON1A 3JRIA 4E4HA 3SZTA 2NYXA 1LVKA 4Q47A 2CFXA 2ZXIA 3I54A 4XLCA 3DPLC 4P9UA 2LR8A 4Q48A 5CJ9A 2IT0A 2BHZA 1YYVA 2R7ZJ 3QYBA 4WXCA 3NRVA 4BQNA 2E36A 3L2QA 2DO7A 4JX6A 3ABLH 3DBHB 3R0JA 3KLOA 4LLNA 3J81K 1P9QC 1R49A 1RNLA 2KRHA 3HGYA 5D8LB 2HEOA 1XCVA 3HOZJ 4XKVA 1X2NA 2RREA 2LYCA 2M1BA 2RNGA 5EZGA 1NH3A 2NRAC 1WJAA 4LG0B 4M3FA 1VQ5I 3KZZA 3QOEA 4PGGA 4BS9A 3IWZA 3ZCOA 5EGOA 3P9IA 3PL8A 2MSYA 3FKJA 2M0CA 5HLTA 1A6QA 1TW2A 1GVDA 1TW3A 5M5YJ 3B73A 4EM2A 3LWFA 3PM1A 2VJ5A 3WGIA 1U9OA 5IT9K 3ZRGA 3DF8A 2BBYA 3WE3A 4N0BA 4FQGA 5GAGJ 2CW0F 4NC7A 2K86A 3KYCB 3EETA 5LHGA 3VFZA 3ISPA 4K2EA 4XKCA 4BHBA 1IG7A 3G6EI 2WWYA 2J5OA 4BHPA 2EZHA 3FKIJ 1BI0A 5K5QA 4WCGA 2Y0SA 3FIWA 3KP3A 1X3WB 3MCZA 1HW1A 1LDKB 5HNFA 4F93B 1D1CA 2LTPA 1W5CC 1G4DA 4MEXF 2XV4S 1ZRFA 3M07A 5DD8A 3CCVI 5C4JJ 1JI8A 3BG6A 2M4KA
chains in the Genus database with same CATH topology
3FWEA 4CXFA 3H3ZA 1FP2A 2O0YA 5D5XB 1Z91A 3DEUA 4G6DA 1BC7C 2ETHA 5E1ZB 1TBXA 2P5LC 1FP1D 3BP8A 3QU6A 2A6EF 4KIFA 4HX7A 2FNAA 5ED4A 2O3FA 1MJBA 2JRTA 2OAZA 1YLFA 3TDUC 4GGGA 1U6GA 2V1DA 4XSZF 1KA8A 2A68F 4O6JA 5JI6A 2EWNA 1MJAA 2DT5A 2G7UA 2FF4A 3E6MA 2EFWA 2DAOA 3FX3A 3V8LA 1B59A 3IC7A 1DP7P 3DXJF 2FEZA 2DQLA 3J80K 5BPDA 3BZ6A 3V8JA 2PMUA 4ASNA 3CO7C 1IXSB 2V9VA 2MLKA 2M30A 2OU2A 4LK1F 1YO5C 4ZZDA 2QBYA 3ECHA 5FFXA 4ZYEA 4CO8A 2GWRA 3TKYA 4RB1A 2M5WA 5DD4A 3F6OA 4YG2F 2YX7A 1TQPA 3I59B 3F23A 5HDKA 3CDHA 3LSTA 3WTUC 1T38A 1R36A 2L4AA 2QM3A 4E70A 2FE3A 4KICA 3GYHX 4IPAA 5L3CA 4JBAA 2AS5F 3SXYA 2Z5UA 3HRTA 2X4HA 1OR7A 2DBBA 4QLCU 1YTYA 3R6SA 5FD6A 4KNYA 1FOKA 3TDZC 5E8IA 4PDKA 2NS0A 4EVIA 1V3FA 2EV5A 5LGTA 1YFHA 1HKTA 3BY6A 5CYVA 3T0YA 1WRJA 3JTHA 1OMIA 1ZRCA 2Z3YA 2F5DA 4MEYF 1ZARA 2LDUA 2K02A 1OYYA 3BDDA 2YPRA 5LLQA 1I6XA 1U2WA 2DW4A 3ML6A 3ZMZA 2XGXA 2JZYA 4ENMA 4A6DA 2EFQA 4HF2A 2FBIA 3HYIA 3IKVA 1GXPA 5HVQC 3E6CC 2A5YB 1KU2A 2XIGA 1J0RA 1LJ9A 1LVAA 1W7PD 5HS9A 3W6KB 3OOPA 2A6HF 4IRIA 3KFWX 5BQTA 4M72A 3RTRA 4L5JA 1WKMA 4M71A 1MDMB 5AIQA 1SFEA 1T0FA 2W85A 4EJTA 2H6BA 1JHHA 2EB7A 4RB3C 2R7DA 4I7HA 4ESBA 3L09A 1CF7A 2R3SA 1RUNA 2L4MA 3DQVC 2IW5A 4UNOA 1OYIA 3F72A 3OV8A 2PJPA 1XDSA 1S8NA 3FHZA 3I58A 1AWCA 2DLLA 4CGZA 2NNNA 2HKXA 1RIOH 3N97A 2VONA 3TQNA 1S6LA 4HDVA 4OIQF 3ZPLA 3HOTA 2PLYA 1I5ZA 1Z6TA 4ENNA 1Z05A 4Y15A 3FMQA 2QQ9A 1T98A 4R8HA 4I0AA 2XVCA 4KMUX 1KQ9A 2UXNA 2QWWA 3BOQA 3K1MA 4NB5A 1LDJA 3P7NA 5LEKA 3B02A 2HYFA 3LAPA 3FM5A 2OZ6A 2O8XA 2J5PA 4M9SA 1USTA 3M1EA 5D4RA 3RPUA 2MD5A 3MZHA 2ESHA 1BM9A 3I64A 2RN7A 2DI3A 3NEUA 1O3QA 1SFXA 2A07F 2GIVA 1TLHB 3KP4A 4LLLA 4OINF 1FT9A 4CHUA 2XRNA 5HS7A 4UUVA 3GO5A 1TTYA 4OIRF 3FXRA 2HGCA 1KU9A 5K5OA 1R1UA 1ZG3A 3FMRA 4BNCA 1G3YA 5LRSA 3HOSA 4HV5A 1FSEA 2F5CA 1YG2A 1XSXA 5LGUA 2A69F 4HDUA 3GX4X 4I98B 1K79A 3BJAA 1HSTA 2WTEA 3U2RA 3FXUA 4P96A 4EQQA 1QNTA 5ILUA 2DK5A 5LHIA 3EUHA 3BPXA 3J7AO 4LB6B 1K78B 3ZN1A 2KJBA 3WTTC 3GUDA 5F1RA 2HS5A 1PUEE 4Y13A 4L9NA 2EFPA 1LDDA 2LF7A 3KP2A 2D45A 2VODA 1J75A 1UFMA 3REOA 2DTRA 5DUKA 4NHJA 4EJOA 3LA7A 1IRFA 2GQQA 2KKOA 4YIFA 5D4SA 2CQKA 4UVBA 2BYVE 2P7CB 4IVNA 4LLGF 4RAYA 2ZMEB 3RYRA 3Q9VA 1D8KA 3WTZA 4M9ZA 3BPVA 3MAJA 4ON0A 2VBZA 1LQ1A 4HF1A 2P6SA 3MZYA 1E17A 1G3SA 1W4MA 4F7ZA 1BBYA 5BPIA 3SHFA 1SMTA 1KQ0A 1C0WA 3G73A 5CVJA 2ZNYA 3AAFA 3GFJA 5AONA 1MJ9A 4GCVA 2P5KA 4BAYA 2OA4A 2E7WA 3FF5A 2VN2A 4A2UA 5D6EA 4WXHA 5CVVA 1IAWA 2PI0A 3ULQB 4FHTA 2PQ8A 2EA4A 1GVJA 1R23A 3QP6A 3W6JB 3ROUA 4ZZLA 5FO5A 1ZN2A 1FYLA 1YS6A 3F3XA 1BIAA 3HRMA 2DK8A 3SFZA 3ZMDA 5L3DA 1HKSA 3IKTA 1ZREA 1Y0UA 4DNCA 4CZZA 1NHAA 3TO7A 2E1NA 3VODA 1EH8A 1KYZA 2PN6A 3H92A 2GXGA 1MGTA 4BYYA 1ULYA 1FC3A 3WU1B 4S04A 2V6CA 1BIBA 2FQ3A 5DCFA 4M74A 1QGPA 3R4KA 4Z2YA 1JHFA 3E3VA 3TOAA 4XSXF 4GXOA 1XGNA 2FBKA 2XKOA 1ZGAA 3JTGA 4MQ9F 1P4XA 5FB2A 3TGNA 1O3TA 2EK5A 2XAGA 2UZKA 4HYEA 3S2WA 1XGMA 2AXLA 1IN6A 2K4JA 3CLOA 2IJLA 4A5NA 3WU0A 3K9TA 4IF4A 2RDPA 2OQRA 2QZ8A 2PEXA 4EJUA 2TDXA 2GAUA 2HYGD 3HRUA 4L0ZB 1W5TA 2MH9A 1VTNC 3HIFA 2RGVA 2V79A 3RYPA 1FWZA 1V4RA 1R5HA 4ZYHA 1STZA 5D5UB 1IZ1A 5J6XA 3QPHA 1R7JA 4G7HF 5H6QA 5L3GA 3CO6C 2NNYA 5FLXZ 4I2OA 4LGWA 2EFOA 2IVMA 2FRHA 2R7FA 3SZPA 5CVIA 1J2XA 1UHMA 3GFMA 2A61A 2BV6A 5FGMA 2H09A 2XAHA 2H6CA 3ZMUA 2FU4A 1YW9A 4KN7X 1O3RA 5H6RA 4UVCA 1QO0D 4HW0A 3E6BA 2RNJA 1Q1HA 3KP5A 3RKXA 4BH9A 5JR3A 3V7RA 4HAMA 3I53A 2G9WA 1HXDA 4AVPA 2FOKA 4UVAA 3LAJA 4FT8A 4MHGA 5D6FA 4RAZA 2V1UA 2IA0A 1IRGA 5BOXA 3KP7A 3FM3A 3R0AA 4O3MA 1JGSA 1KU3A 3HUGA 2FNPA 3Q9SA 1ON2A 3NQOA 2Q8KA 2QQBA 2QENA 1ZG1A 1XB4A 1S7OA 2YX4A 3M8FA 1B9MA 1W7PA 2IA2A 2L01A 1YW8A 4RB2C 3ECOA 5D5VB 1PP7U 2FA5A 5ILVA 4B09A 3C7JA 4NQWA 1H0MA 4O5VA 3V7SA 5CVUA 1O3SA 3IRQA 2E1CA 3ZMSA 1I27A 4S05A 1S29A 4Y17A 4P55A 2XKPA 4M73A 1D5VA 2XROA 4L9VA 1EH7A 3WE2A 4RGSA 2VOOA 1H9TA 4HLYA 2QYOA 2G7HA 3KLNA 1ZRDA 3F21A 4ZYGA 3KP6A 3TO6A 3DPTA 2O03A 2H27A 4M6YA 3ABTA 1R58A 3F8MA 1KGSA 5E1WA 2KJCA 1SD6A 1R00A 4JQFA 2CWEA 3R61A 3F22A 5E18F 1K7AA 2FMLA 3O3KA 1U8RA 4PGHA 3VB2A 5KVRA 4IRHA 1J5YA 1HW2A 3WTVC 4LJZF 2OBPA 1LB2A 2ZKZA 2QVOA 4ENJA 3CUQC 4IJAA 1MDMA 1BI3A 2L02A 4P5OA 4KMFA 3F8CA 4XBFA 1IF1A 4U7DA 2COMA 3C1DA 3V4GA 3SQNA 1U78A 2EJRA 1FX7A 3EDPA 2DU9A 4AIKA 2XUBA 2VBXA 3LFKA 2VC1A 4EM1A 4Q5SF 1SD4A 3HSFA 4HA8A 4KA4A 3O6BB 4EJVA 1K78A 5F64A 1MD0A 3HTUA 1XSVA 1PDNC 3BJ6A 1XMKA 4BQAA 2FBHA 3GXOA 2Q2EA 2PBIA 1D3YA 4ZYDA 3HSRA 4LMYA 2HZTA 1T39A 2Z33A 2E7XA 4WF2A 4U0VA 1BC8C 2F2EA 4LB5A 4QWQA 3ZN0A 4EJWA 1P4AA 3MWMA 3HRSA 2FSWA 5HLIA 5EEHA 2ACJA 2BE5F 2K4BA 1QZZA 2LSOA 2DQRA 3U9GA 3T8RA 1W5SA 2Z9OA 5EEGA 3K1PA 3PQKA 4RGRA 4PZJA 3HSEA 4XLNF 4U0YA 4YFKF 1F1ZA 1SFUA 1K6OA 2L54A 4AIJA 3RPQA 5TJJA 3GZ5A 1FYMA 3VOEA 3LA3A 5J8FA 1Z1DA 5LEJA 5ILSA 2VE9A 2YR2A 2CG4A 3PQJA 4ENKA 3O2PE 3KE2A 1G3WA 2IP2A 3RDIA 1P6RA 2VOPA 5D8KB 2GA2A 4KFCA 1YQAA 2VT2A 2VT3A 1U3EM 3JAMZ 5KK1A 2HFHA 3IWFA 4RB0A 2ZXJA 5BMZA 3M8EA 3WG9A 3ZQ7A 1JE8A 3ZP5A 3RI4A 1Z9CA 3GFLA 1ZYRF 1ZG5A 2BEOA 1CF7B 4RGXA 2KRFA 1SMYF 4I09A 4LG0A 4AWXB 2RC4A 3FMSA 1R22A 4N9IA 1FNNA 2W84A 5E20A 5HDGA 1FZPB 3VEPA 3P9CA 4H0EA 1XGOA 4PCQA 4UV9A 5AIPA 1XMAA 1O7LA 3CJNA 3IL2A 2Z99A 6PAXA 2IPQX 5DV5A 3CUQB 1KYWA 3GWZA 1DPRA 2ZBKA 3DV8A 2EA2A 4EM0B 5L3BA 3MFKA 2YSRA 3EYYA 3KZYA 2HTSA 2P4WA 2LF8A 4R1HA 3C3WA 5JHUA 1IUYA 3LA2A 3E5XA 1YW7A 4A6EA 2K27A 2V1XA 4OU0A 1XGSA 2HQNA 4GYGA 2XASA 2XHKA 4UHTA 3COAC 2CSOA 3V8KA 2ZJ2A 3CUQA 4DQ2A 5HLGA 2EV0A 1RZ4A 4MTDA 3U1DA 4RS8A 1QPMA 2ISYA 4FX4A 1G6NA 2K7LA 2B0LA 3BROA 4RGUA 5DCMB 5ICGA 4HQMA 3GEZA 1U5TA 4HZFA 2HR3A 1T6SA 4EGZA 2OQGA 1BI1A 2STTA 3EYIA 4EV0A 5LBQA 2P7VB 1BOAA 3F8NA 2D1VA 1WI9A 1E2XA 2CO5A 4B8XA 1EH6A 1UHWA 1WWXA 4BXUA 1Z7UA 4YFNF 2D1HA 4I02A 1XDUA 2KIUA 2KIFA 4G6QA 3RJPA 3ERED 2CGPA 4CICA 1DPUA 4I01A 1IW7F 3LQRA 4IHTA 3FZVA 3E97A 3DP7A 1I1SA 5CVRA 2HOEA 3M9AA 1ZLJA 4UXNA 2WV0A 2M45A 4GYIA 3BJOA 1REPC 5DUIA 2W24A 2H94A 5K1YA 1RI7A 3GZ6A 1H9GA 5HS8A 3ELKA 2CYYA 5A2QZ 1BJAA 4HOBA 4FX0A 3G3ZA 2VBYA 3DFGA 5CLSA 3L9FA 1DUXC 3TO9A 1OKRA 2DPUA 2A3SA 1XN7A 5HDNA 2BGCA 4HV6A 4G8XA 4KIBA 3L00A 5FD5A 2MLGA 2QBYB 1S7AA 4XRFA 2Y75A 3QOPA 3V7CA 2OZUA 1ODDA 3J80Z 4LD5A 1MZBA 1X3UA 3MEXA 5FLXK 1IN8A 1XSDA 1YIOA 2JPCA 3LQQA 5TRDA 5IT9Z 5LHHA 1P92A 3JW4A 5L3FA 3QAHA 1S3JA 1O7FA 3E6DA 3WTXC 1GHCA 4G7ZF 3CTAA 3T1BA 4EMSA 3K2ZA 1YS7A 4L9JA 1A04A 3QP5A 1B4AA 3RIRA 4AD9A 4MNUA 3N4MA 1O57A 2DFIA 1F5TA 3L7WA 4KDPA 5ICEA 1TQIA 1P4WA 5H20A 1L3LA 2RQPA 5A2QK 2MH2A 4UV8A 3RKYA 4WWCA 4KYWA 1CGPA 4YFXF 1R1TA 2YU3A 3I4PA 1TQMA 3D0SA 1IN4A 5E1XA 5IT3A 1HW5A 3R60A 1HSJA 4N9HA 2ADUA 5JVTA 3C18A 3T5XA 2UXXA 1LEAA 3MQ0A 4U7BA 2QQAA 4Q4ZF 1IXCA 2HWVA 2P6TA 4KT5C 1U5TC 3QRFF 4MTEA 4AIHA 1LEBA 1HBXG 5LRRA 5JFRA 1ZGJA 3CUOA 2OD5A 4OIPF 2ZFWA 2RVCA 3GW2A 3I71A 5DCMA 2HQRA 1TNSA 2HDCA 4A0YA 4OIOF 3QU3A 4YIIA 1XD7A 2ZMEA 1ONVA 1L0OC 3WODF 3TOBA 2ZO4A 1WSUA 2MA3A 3KEOA 1QBJA 3HTSB 4A12A 2JTVA 2XAQA 2VE8A 2GXBA 2RV8A 2WC2A 2F5EA 4WXDA 1FSHA 4TV7A 2JT1A 4U0WA 2PFBA 1SD5A 2ZNZA 4ESJA 2ISZA 5DEQA 2ESNA 1R5GA 3I5UA 2HTJA 2QUFA 1FPQA 3QPTA 4XLPF 2NAZA 3K1NA 4ZH4F 2LNBA 4G7OF 4ETSA 4P9FA 1ZAOA 3EQLF 3E5UA 4IHSA 1PP8F 2UWMA 1AOYA 3J81Z 4WX9A 3DKWA 1B9NA 5ICCA 3IHUA 3F8BA 2VXZA 5BS6A 3F8FA 1KU7A 2M87A 1FYKA 3F6VA 3KEQA 4HX8A 4OMYA 2PG4A 1OYWA 4HQEA 1T2KA 1HQCA 1J9IA 2HKOA 4CDGA 1MKMA 5K5RA 3H3UA 1G3TA 3KCCA 3M7GA 4M6XA 4EGYA 2MC3A 3WTYC 4L0YB 1IN5A 1TNTA 2F5FA 2C6YA 1UB9A 4M9XA 1J59A 3ABUA 1R1VA 4G94A 4IXAA 2GA1A 3RKWA 4BHCA 4LFUA 5ERIA 3WGHA 4HBLA 2P8TA 4A0XA 1W7PB 2ELHA 1ZH5A 3JSOA 1FY7A 1DDNA 1ZHFA 5E17F 1QQIA 1XCBA 1IXRC 1I1GA 4KUMA 1P2FA 2IA1A 3WTSC 1OPCA 4MQVA 3JAMK 5D5WB 3JSPA 1BI2A 1KQ8A 2KIMA 1EV7A 2O61A 1B6AA 3IRRA 4I0BA 5ICFA 2M8EA 4R79A 2PMHA 2FMYA 3L2CA 5L3EA 2XAJA 4IRGA 2D2WA 1ZLKA 4D0PA 4U88A 3FXQA 1WQ2A 4L18B 3ZMVA 3BWGA 4A5MA 1SAXA 2GZWA 3WTWC 1F4KA 2W25A 3T8TA 3I59A 2Q0OA 2X0LA 1HKQA 3GF2A 1UCRA 2VBWA 2L3DA 1BN5A 4L5IA 2JSCA 2P5VA 2VC0A 2ZCWA 2EV6A 3PFIA 4KIGA 4HF0A 3P9KA 1Z6RA 3GFIA 4WK8F 4L9TA 4OOIA 2RKHA 3I0TA 4OMZA 3Q5FA 4JK1X 4LK0F 5J8CA 2DPDA 1FLIA 1RUOA 1FBUA 2LKPA 2MBFA 5E8GA 4CYDA 2QLZA 5HLHA 2STWA 4ESFA 1D8JA 2Y0MA 1USSA 4HLXA 1LNWA 5F6FA 3E5QA 2Y48A 4HX4A 2XAFA 1IN7A 3D5LA 3HHGA 4KN4X 3K0LA 2JPBA 4G9YA 5HOOA 2FXAA 2W57A 5DYMA 4GO1A 1F9NA 3GLXA 1QZYA 2EFNA 3HHHA 5FFZA 2O6GE 3ZMTA 3KETA 3WGGA 3K69A 1SD7A 1FBQA 1GXQA 1FBSA 5LGNA 2IRFG 4MGRA 1JXSA 3GVAA 5DDGA 1B1BA 1J7KA 1U5TB 4A0ZA 1ON1A 3SZTA 2NYXA 4Q47A 2CFXA 3I54A 4P9UA 3DPLC 4Q48A 5CJ9A 2IT0A 1YYVA 4WXCA 3NRVA 2DO7A 3R0JA 3KLOA 4LLNA 3J81K 1RNLA 5D8LB 2HEOA 1XCVA 2M1BA 2NRAC 4LG0B 3KZZA 4PGGA 3IWZA 3P9IA 1TW2A 1TW3A 3B73A 4EM2A 3LWFA 3WGIA 5IT9K 3DF8A 2BBYA 3WE3A 4N0BA 2CW0F 2K86A 3EETA 5LHGA 3VFZA 3ISPA 4K2EA 4BHBA 2WWYA 2J5OA 4BHPA 4WCGA 5K5QA 1BI0A 3KP3A 3MCZA 1HW1A 1LDKB 1G4DA 4MEXF 2XV4S 1ZRFA 5DD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWE A;  4CXF A;  3H3Z A;  1FP2 A;  2O0Y A;  5D5X B;  1Z91 A;  3DEU A;  4G6D A;  1BC7 C;  2ETH A;  5E1Z B;  1TBX A;  2P5L C;  1FP1 D;  3BP8 A;  3QU6 A;  2A6E F;  4KIF A;  4HX7 A;  2FNA A;  5ED4 A;  2O3F A;  1MJB A;  2JRT A;  2OAZ A;  1YLF A;  3TDU C;  4GGG A;  1U6G A;  2V1D A;  4XSZ F;  1KA8 A;  2A68 F;  4O6J A;  5JI6 A;  2EWN A;  1MJA A;  2DT5 A;  2G7U A;  2FF4 A;  3E6M A;  2EFW A;  2DAO A;  3FX3 A;  3V8L A;  1B59 A;  3IC7 A;  1DP7 P;  3DXJ F;  2FEZ A;  2DQL A;  3J80 K;  5BPD A;  3BZ6 A;  3V8J A;  2PMU A;  4ASN A;  3CO7 C;  1IXS B;  2V9V A;  2MLK A;  2M30 A;  2OU2 A;  4LK1 F;  1YO5 C;  4ZZD A;  2QBY A;  3ECH A;  5FFX A;  4ZYE A;  4CO8 A;  2GWR A;  3TKY A;  4RB1 A;  2M5W A;  5DD4 A;  3F6O A;  4YG2 F;  2YX7 A;  1TQP A;  3I59 B;  3F23 A;  5HDK A;  3CDH A;  3LST A;  3WTU C;  1T38 A;  1R36 A;  2L4A A;  2QM3 A;  4E70 A;  2FE3 A;  4KIC A;  3GYH X;  4IPA A;  5L3C A;  4JBA A;  2AS5 F;  3SXY A;  2Z5U A;  3HRT A;  2X4H A;  1OR7 A;  2DBB A;  4QLC U;  1YTY A;  3R6S A;  5FD6 A;  4KNY A;  1FOK A;  3TDZ C;  5E8I A;  4PDK A;  2NS0 A;  4EVI A;  1V3F A;  2EV5 A;  5LGT A;  1YFH A;  1HKT A;  3BY6 A;  5CYV A;  3T0Y A;  1WRJ A;  3JTH A;  1OMI A;  1ZRC A;  2Z3Y A;  2F5D A;  4MEY F;  1ZAR A;  2LDU A;  2K02 A;  1OYY A;  3BDD A;  2YPR A;  5LLQ A;  1I6X A;  1U2W A;  2DW4 A;  3ML6 A;  3ZMZ A;  2XGX A;  2JZY A;  4ENM A;  4A6D A;  2EFQ A;  4HF2 A;  2FBI A;  3HYI A;  3IKV A;  1GXP A;  5HVQ C;  3E6C C;  2A5Y B;  1KU2 A;  2XIG A;  1J0R A;  1LJ9 A;  1LVA A;  1W7P D;  5HS9 A;  3W6K B;  3OOP A;  2A6H F;  4IRI A;  3KFW X;  5BQT A;  4M72 A;  3RTR A;  4L5J A;  1WKM A;  4M71 A;  1MDM B;  5AIQ A;  1SFE A;  1T0F A;  2W85 A;  4EJT A;  2H6B A;  1JHH A;  2EB7 A;  4RB3 C;  2R7D A;  4I7H A;  4ESB A;  3L09 A;  1CF7 A;  2R3S A;  1RUN A;  2L4M A;  3DQV C;  2IW5 A;  4UNO A;  1OYI A;  3F72 A;  3OV8 A;  2PJP A;  1XDS A;  1S8N A;  3FHZ A;  3I58 A;  1AWC A;  2DLL A;  4CGZ A;  2NNN A;  2HKX A;  1RIO H;  3N97 A;  2VON A;  3TQN A;  1S6L A;  4HDV A;  4OIQ F;  3ZPL A;  3HOT A;  2PLY A;  1I5Z A;  1Z6T A;  4ENN A;  1Z05 A;  4Y15 A;  3FMQ A;  2QQ9 A;  1T98 A;  4R8H A;  4I0A A;  2XVC A;  4KMU X;  1KQ9 A;  2UXN A;  2QWW A;  3BOQ A;  3K1M A;  4NB5 A;  1LDJ A;  3P7N A;  5LEK A;  3B02 A;  2HYF A;  3LAP A;  3FM5 A;  2OZ6 A;  2O8X A;  2J5P A;  4M9S A;  1UST A;  3M1E A;  5D4R A;  3RPU A;  2MD5 A;  3MZH A;  2ESH A;  1BM9 A;  3I64 A;  2RN7 A;  2DI3 A;  3NEU A;  1O3Q A;  1SFX A;  2A07 F;  2GIV A;  1TLH B;  3KP4 A;  4LLL A;  4OIN F;  1FT9 A;  4CHU A;  2XRN A;  5HS7 A;  4UUV A;  3GO5 A;  1TTY A;  4OIR F;  3FXR A;  2HGC A;  1KU9 A;  5K5O A;  1R1U A;  1ZG3 A;  3FMR A;  4BNC A;  1G3Y A;  5LRS A;  3HOS A;  4HV5 A;  1FSE A;  2F5C A;  1YG2 A;  1XSX A;  5LGU A;  2A69 F;  4HDU A;  3GX4 X;  4I98 B;  1K79 A;  3BJA A;  1HST A;  2WTE A;  3U2R A;  3FXU A;  4P96 A;  4EQQ A;  1QNT A;  5ILU A;  2DK5 A;  5LHI A;  3EUH A;  3BPX A;  3J7A O;  4LB6 B;  1K78 B;  3ZN1 A;  2KJB A;  3WTT C;  3GUD A;  5F1R A;  2HS5 A;  1PUE E;  4Y13 A;  4L9N A;  2EFP A;  1LDD A;  2LF7 A;  3KP2 A;  2D45 A;  2VOD A;  1J75 A;  1UFM A;  3REO A;  2DTR A;  5DUK A;  4NHJ A;  4EJO A;  3LA7 A;  1IRF A;  2GQQ A;  2KKO A;  4YIF A;  5D4S A;  2CQK A;  4UVB A;  2BYV E;  2P7C B;  4IVN A;  4LLG F;  4RAY A;  2ZME B;  3RYR A;  3Q9V A;  1D8K A;  3WTZ A;  4M9Z A;  3BPV A;  3MAJ A;  4ON0 A;  2VBZ A;  1LQ1 A;  4HF1 A;  2P6S A;  3MZY A;  1E17 A;  1G3S A;  1W4M A;  4F7Z A;  1BBY A;  5BPI A;  3SHF A;  1SMT A;  1KQ0 A;  1C0W A;  3G73 A;  5CVJ A;  2ZNY A;  3AAF A;  3GFJ A;  5AON A;  1MJ9 A;  4GCV A;  2P5K A;  4BAY A;  2OA4 A;  2E7W A;  3FF5 A;  2VN2 A;  4A2U A;  5D6E A;  4WXH A;  5CVV A;  1IAW A;  2PI0 A;  3ULQ B;  4FHT A;  2PQ8 A;  2EA4 A;  1GVJ A;  1R23 A;  3QP6 A;  3W6J B;  3ROU A;  4ZZL A;  5FO5 A;  1ZN2 A;  1FYL A;  1YS6 A;  3F3X A;  1BIA A;  3HRM A;  2DK8 A;  3SFZ A;  3ZMD A;  5L3D A;  1HKS A;  3IKT A;  1ZRE A;  1Y0U A;  4DNC A;  4CZZ A;  1NHA A;  3TO7 A;  2E1N A;  3VOD A;  1EH8 A;  1KYZ A;  2PN6 A;  3H92 A;  2GXG A;  1MGT A;  4BYY A;  1ULY A;  1FC3 A;  3WU1 B;  4S04 A;  2V6C A;  1BIB A;  2FQ3 A;  5DCF A;  4M74 A;  1QGP A;  3R4K A;  4Z2Y A;  1JHF A;  3E3V A;  3TOA A;  4XSX F;  4GXO A;  1XGN A;  2FBK A;  2XKO A;  1ZGA A;  3JTG A;  4MQ9 F;  1P4X A;  5FB2 A;  3TGN A;  1O3T A;  2EK5 A;  2XAG A;  2UZK A;  4HYE A;  3S2W A;  1XGM A;  2AXL A;  1IN6 A;  2K4J A;  3CLO A;  2IJL A;  4A5N A;  3WU0 A;  3K9T A;  4IF4 A;  2RDP A;  2OQR A;  2QZ8 A;  2PEX A;  4EJU A;  2TDX A;  2GAU A;  2HYG D;  3HRU A;  4L0Z B;  1W5T A;  2MH9 A;  1VTN C;  3HIF A;  2RGV A;  2V79 A;  3RYP A;  1FWZ A;  1V4R A;  1R5H A;  4ZYH A;  1STZ A;  5D5U B;  1IZ1 A;  5J6X A;  3QPH A;  1R7J A;  4G7H F;  5H6Q A;  5L3G A;  3CO6 C;  2NNY A;  5FLX Z;  4I2O A;  4LGW A;  2EFO A;  2IVM A;  2FRH A;  2R7F A;  3SZP A;  5CVI A;  1J2X A;  1UHM A;  3GFM A;  2A61 A;  2BV6 A;  5FGM A;  2H09 A;  2XAH A;  2H6C A;  3ZMU A;  2FU4 A;  1YW9 A;  4KN7 X;  1O3R A;  5H6R A;  4UVC A;  1QO0 D;  4HW0 A;  3E6B A;  2RNJ A;  1Q1H A;  3KP5 A;  3RKX A;  4BH9 A;  5JR3 A;  3V7R A;  4HAM A;  3I53 A;  2G9W A;  1HXD A;  4AVP A;  2FOK A;  4UVA A;  3LAJ A;  4FT8 A;  4MHG A;  5D6F A;  4RAZ A;  2V1U A;  2IA0 A;  1IRG A;  5BOX A;  3KP7 A;  3FM3 A;  3R0A A;  4O3M A;  1JGS A;  1KU3 A;  3HUG A;  2FNP A;  3Q9S A;  1ON2 A;  3NQO A;  2Q8K A;  2QQB A;  2QEN A;  1ZG1 A;  1XB4 A;  1S7O A;  2YX4 A;  3M8F A;  1B9M A;  1W7P A;  2IA2 A;  2L01 A;  1YW8 A;  4RB2 C;  3ECO A;  5D5V B;  1PP7 U;  2FA5 A;  5ILV A;  4B09 A;  3C7J A;  4NQW A;  1H0M A;  4O5V A;  3V7S A;  5CVU A;  1O3S A;  3IRQ A;  2E1C A;  3ZMS A;  1I27 A;  4S05 A;  1S29 A;  4Y17 A;  4P55 A;  2XKP A;  4M73 A;  1D5V A;  2XRO A;  4L9V A;  1EH7 A;  3WE2 A;  4RGS A;  2VOO A;  1H9T A;  4HLY A;  2QYO A;  2G7H A;  3KLN A;  1ZRD A;  3F21 A;  4ZYG A;  3KP6 A;  3TO6 A;  3DPT A;  2O03 A;  2H27 A;  4M6Y A;  3ABT A;  1R58 A;  3F8M A;  1KGS A;  5E1W A;  2KJC A;  1SD6 A;  1R00 A;  4JQF A;  2CWE A;  3R61 A;  3F22 A;  5E18 F;  1K7A A;  2FML A;  3O3K A;  1U8R A;  4PGH A;  3VB2 A;  5KVR A;  4IRH A;  1J5Y A;  1HW2 A;  3WTV C;  4LJZ F;  2OBP A;  1LB2 A;  2ZKZ A;  2QVO A;  4ENJ A;  3CUQ C;  4IJA A;  1MDM A;  1BI3 A;  2L02 A;  4P5O A;  4KMF A;  3F8C A;  4XBF A;  1IF1 A;  4U7D A;  2COM A;  3C1D A;  3V4G A;  3SQN A;  1U78 A;  2EJR A;  1FX7 A;  3EDP A;  2DU9 A;  4AIK A;  2XUB A;  2VBX A;  3LFK A;  2VC1 A;  4EM1 A;  4Q5S F;  1SD4 A;  3HSF A;  4HA8 A;  4KA4 A;  3O6B B;  4EJV A;  1K78 A;  5F64 A;  1MD0 A;  3HTU A;  1XSV A;  1PDN C;  3BJ6 A;  1XMK A;  4BQA A;  2FBH A;  3GXO A;  2Q2E A;  2PBI A;  1D3Y A;  4ZYD A;  3HSR A;  4LMY A;  2HZT A;  1T39 A;  2Z33 A;  2E7X A;  4WF2 A;  4U0V A;  1BC8 C;  2F2E A;  4LB5 A;  4QWQ A;  3ZN0 A;  4EJW A;  1P4A A;  3MWM A;  3HRS A;  2FSW A;  5HLI A;  5EEH A;  2ACJ A;  2BE5 F;  2K4B A;  1QZZ A;  2LSO A;  2DQR A;  3U9G A;  3T8R A;  1W5S A;  2Z9O A;  5EEG A;  3K1P A;  3PQK A;  4RGR A;  4PZJ A;  3HSE A;  4XLN F;  4U0Y A;  4YFK F;  1F1Z A;  1SFU A;  1K6O A;  2L54 A;  4AIJ A;  3RPQ A;  5TJJ A;  3GZ5 A;  1FYM A;  3VOE A;  3LA3 A;  5J8F A;  1Z1D A;  5LEJ A;  5ILS A;  2VE9 A;  2YR2 A;  2CG4 A;  3PQJ A;  4ENK A;  3O2P E;  3KE2 A;  1G3W A;  2IP2 A;  3RDI A;  1P6R A;  2VOP A;  5D8K B;  2GA2 A;  4KFC A;  1YQA A;  2VT2 A;  2VT3 A;  1U3E M;  3JAM Z;  5KK1 A;  2HFH A;  3IWF A;  4RB0 A;  2ZXJ A;  5BMZ A;  3M8E A;  3WG9 A;  3ZQ7 A;  1JE8 A;  3ZP5 A;  3RI4 A;  1Z9C A;  3GFL A;  1ZYR F;  1ZG5 A;  2BEO A;  1CF7 B;  4RGX A;  2KRF A;  1SMY F;  4I09 A;  4LG0 A;  4AWX B;  2RC4 A;  3FMS A;  1R22 A;  4N9I A;  1FNN A;  2W84 A;  5E20 A;  5HDG A;  1FZP B;  3VEP A;  3P9C A;  4H0E A;  1XGO A;  4PCQ A;  4UV9 A;  5AIP A;  1XMA A;  1O7L A;  3CJN A;  3IL2 A;  2Z99 A;  6PAX A;  2IPQ X;  5DV5 A;  3CUQ B;  1KYW A;  3GWZ A;  1DPR A;  2ZBK A;  3DV8 A;  2EA2 A;  4EM0 B;  5L3B A;  3MFK A;  2YSR A;  3EYY A;  3KZY A;  2HTS A;  2P4W A;  2LF8 A;  4R1H A;  3C3W A;  5JHU A;  1IUY A;  3LA2 A;  3E5X A;  1YW7 A;  4A6E A;  2K27 A;  2V1X A;  4OU0 A;  1XGS A;  2HQN A;  4GYG A;  2XAS A;  2XHK A;  4UHT A;  3COA C;  2CSO A;  3V8K A;  2ZJ2 A;  3CUQ A;  4DQ2 A;  5HLG A;  2EV0 A;  1RZ4 A;  4MTD A;  3U1D A;  4RS8 A;  1QPM A;  2ISY A;  4FX4 A;  1G6N A;  2K7L A;  2B0L A;  3BRO A;  4RGU A;  5DCM B;  5ICG A;  4HQM A;  3GEZ A;  1U5T A;  4HZF A;  2HR3 A;  1T6S A;  4EGZ A;  2OQG A;  1BI1 A;  2STT A;  3EYI A;  4EV0 A;  5LBQ A;  2P7V B;  1BOA A;  3F8N A;  2D1V A;  1WI9 A;  1E2X A;  2CO5 A;  4B8X A;  1EH6 A;  1UHW A;  1WWX A;  4BXU A;  1Z7U A;  4YFN F;  2D1H A;  4I02 A;  1XDU A;  2KIU A;  2KIF A;  4G6Q A;  3RJP A;  3ERE D;  2CGP A;  4CIC A;  1DPU A;  4I01 A;  1IW7 F;  3LQR A;  4IHT A;  3FZV A;  3E97 A;  3DP7 A;  1I1S A;  5CVR A;  2HOE A;  3M9A A;  1ZLJ A;  4UXN A;  2WV0 A;  2M45 A;  4GYI A;  3BJO A;  1REP C;  5DUI A;  2W24 A;  2H94 A;  5K1Y A;  1RI7 A;  3GZ6 A;  1H9G A;  5HS8 A;  3ELK A;  2CYY A;  5A2Q Z;  1BJA A;  4HOB A;  4FX0 A;  3G3Z A;  2VBY A;  3DFG A;  5CLS A;  3L9F A;  1DUX C;  3TO9 A;  1OKR A;  2DPU A;  2A3S A;  1XN7 A;  5HDN A;  2BGC A;  4HV6 A;  4G8X A;  4KIB A;  3L00 A;  5FD5 A;  2MLG A;  2QBY B;  1S7A A;  4XRF A;  2Y75 A;  3QOP A;  3V7C A;  2OZU A;  1ODD A;  3J80 Z;  4LD5 A;  1MZB A;  1X3U A;  3MEX A;  5FLX K;  1IN8 A;  1XSD A;  1YIO A;  2JPC A;  3LQQ A;  5TRD A;  5IT9 Z;  5LHH A;  1P92 A;  3JW4 A;  5L3F A;  3QAH A;  1S3J A;  1O7F A;  3E6D A;  3WTX C;  1GHC A;  4G7Z F;  3CTA A;  3T1B A;  4EMS A;  3K2Z A;  1YS7 A;  4L9J A;  1A04 A;  3QP5 A;  1B4A A;  3RIR A;  4AD9 A;  4MNU A;  3N4M A;  1O57 A;  2DFI A;  1F5T A;  3L7W A;  4KDP A;  5ICE A;  1TQI A;  1P4W A;  5H20 A;  1L3L A;  2RQP A;  5A2Q K;  2MH2 A;  4UV8 A;  3RKY A;  4WWC A;  4KYW A;  1CGP A;  4YFX F;  1R1T A;  2YU3 A;  3I4P A;  1TQM A;  3D0S A;  1IN4 A;  5E1X A;  5IT3 A;  1HW5 A;  3R60 A;  1HSJ A;  4N9H A;  2ADU A;  5JVT A;  3C18 A;  3T5X A;  2UXX A;  1LEA A;  3MQ0 A;  4U7B A;  2QQA A;  4Q4Z F;  1IXC A;  2HWV A;  2P6T A;  4KT5 C;  1U5T C;  3QRF F;  4MTE A;  4AIH A;  1LEB A;  1HBX G;  5LRR A;  5JFR A;  1ZGJ A;  3CUO A;  2OD5 A;  4OIP F;  2ZFW A;  2RVC A;  3GW2 A;  3I71 A;  5DCM A;  2HQR A;  1TNS A;  2HDC A;  4A0Y A;  4OIO F;  3QU3 A;  4YII A;  1XD7 A;  2ZME A;  1ONV A;  1L0O C;  3WOD F;  3TOB A;  2ZO4 A;  1WSU A;  2MA3 A;  3KEO A;  1QBJ A;  3HTS B;  4A12 A;  2JTV A;  2XAQ A;  2VE8 A;  2GXB A;  2RV8 A;  2WC2 A;  2F5E A;  4WXD A;  1FSH A;  4TV7 A;  2JT1 A;  4U0W A;  2PFB A;  1SD5 A;  2ZNZ A;  4ESJ A;  2ISZ A;  5DEQ A;  2ESN A;  1R5G A;  3I5U A;  2HTJ A;  2QUF A;  1FPQ A;  3QPT A;  4XLP F;  2NAZ A;  3K1N A;  4ZH4 F;  2LNB A;  4G7O F;  4ETS A;  4P9F A;  1ZAO A;  3EQL F;  3E5U A;  4IHS A;  1PP8 F;  2UWM A;  1AOY A;  3J81 Z;  4WX9 A;  3DKW A;  1B9N A;  5ICC A;  3IHU A;  3F8B A;  2VXZ A;  5BS6 A;  3F8F A;  1KU7 A;  2M87 A;  1FYK A;  3F6V A;  3KEQ A;  4HX8 A;  4OMY A;  2PG4 A;  1OYW A;  4HQE A;  1T2K A;  1HQC A;  1J9I A;  2HKO A;  4CDG A;  1MKM A;  5K5R A;  3H3U A;  1G3T A;  3KCC A;  3M7G A;  4M6X A;  4EGY A;  2MC3 A;  3WTY C;  4L0Y B;  1IN5 A;  1TNT A;  2F5F A;  2C6Y A;  1UB9 A;  4M9X A;  1J59 A;  3ABU A;  1R1V A;  4G94 A;  4IXA A;  2GA1 A;  3RKW A;  4BHC A;  4LFU A;  5ERI A;  3WGH A;  4HBL A;  2P8T A;  4A0X A;  1W7P B;  2ELH A;  1ZH5 A;  3JSO A;  1FY7 A;  1DDN A;  1ZHF A;  5E17 F;  1QQI A;  1XCB A;  1IXR C;  1I1G A;  4KUM A;  1P2F A;  2IA1 A;  3WTS C;  1OPC A;  4MQV A;  3JAM K;  5D5W B;  3JSP A;  1BI2 A;  1KQ8 A;  2KIM A;  1EV7 A;  2O61 A;  1B6A A;  3IRR A;  4I0B A;  5ICF A;  2M8E A;  4R79 A;  2PMH A;  2FMY A;  3L2C A;  5L3E A;  2XAJ A;  4IRG A;  2D2W A;  1ZLK A;  4D0P A;  4U88 A;  3FXQ A;  1WQ2 A;  4L18 B;  3ZMV A;  3BWG A;  4A5M A;  1SAX A;  2GZW A;  3WTW C;  1F4K A;  2W25 A;  3T8T A;  3I59 A;  2Q0O A;  2X0L A;  1HKQ A;  3GF2 A;  1UCR A;  2VBW A;  2L3D A;  1BN5 A;  4L5I A;  2JSC A;  2P5V A;  2VC0 A;  2ZCW A;  2EV6 A;  3PFI A;  4KIG A;  4HF0 A;  3P9K A;  1Z6R A;  3GFI A;  4WK8 F;  4L9T A;  4OOI A;  2RKH A;  3I0T A;  4OMZ A;  3Q5F A;  4JK1 X;  4LK0 F;  5J8C A;  2DPD A;  1FLI A;  1RUO A;  1FBU A;  2LKP A;  2MBF A;  5E8G A;  4CYD A;  2QLZ A;  5HLH A;  2STW A;  4ESF A;  1D8J A;  2Y0M A;  1USS A;  4HLX A;  1LNW A;  5F6F A;  3E5Q A;  2Y48 A;  4HX4 A;  2XAF A;  1IN7 A;  3D5L A;  3HHG A;  4KN4 X;  3K0L A;  2JPB A;  4G9Y A;  5HOO A;  2FXA A;  2W57 A;  5DYM A;  4GO1 A;  1F9N A;  3GLX A;  1QZY A;  2EFN A;  3HHH A;  5FFZ A;  2O6G E;  3ZMT A;  3KET A;  3WGG A;  3K69 A;  1SD7 A;  1FBQ A;  1GXQ A;  1FBS A;  5LGN A;  2IRF G;  4MGR A;  1JXS A;  3GVA A;  5DDG A;  1B1B A;  1J7K A;  1U5T B;  4A0Z A;  1ON1 A;  3SZT A;  2NYX A;  4Q47 A;  2CFX A;  3I54 A;  4P9U A;  3DPL C;  4Q48 A;  5CJ9 A;  2IT0 A;  1YYV A;  4WXC A;  3NRV A;  2DO7 A;  3R0J A;  3KLO A;  4LLN A;  3J81 K;  1RNL A;  5D8L B;  2HEO A;  1XCV A;  2M1B A;  2NRA C;  4LG0 B;  3KZZ A;  4PGG A;  3IWZ A;  3P9I A;  1TW2 A;  1TW3 A;  3B73 A;  4EM2 A;  3LWF A;  3WGI A;  5IT9 K;  3DF8 A;  2BBY A;  3WE3 A;  4N0B A;  2CW0 F;  2K86 A;  3EET A;  5LHG A;  3VFZ A;  3ISP A;  4K2E A;  4BHB A;  2WWY A;  2J5O A;  4BHP A;  4WCG A;  5K5Q A;  1BI0 A;  3KP3 A;  3MCZ A;  1HW1 A;  1LDK B;  1G4D A;  4MEX F;  2XV4 S;  1ZRF A;  5DD8 A; 
#chains in the Genus database with same CATH topology
 3FWE A;  3F0C A;  4CXF A;  1HCR A;  3H3Z A;  1FP2 A;  2O0Y A;  3G1O A;  5D5X B;  1Z91 A;  2MC4 A;  3L2R A;  3DEU A;  4G6D A;  1BC7 C;  2ETH A;  5E1Z B;  1TBX A;  4QPQ A;  2DA2 A;  2P5L C;  1FP1 D;  3BP8 A;  3QU6 A;  2A6E F;  5K7Z A;  1OCT C;  2L7Z A;  2WAQ N;  4KIF A;  4DW6 A;  2R7W A;  4HX7 A;  2FNA A;  5ED4 A;  2O3F A;  2Y30 A;  3G4S I;  5J1R A;  4BE2 A;  3Q3S A;  1MJB A;  2JRT A;  5CKT A;  2ZJR F;  2OAZ A;  1YLF A;  3TDU C;  4GGG A;  1U6G A;  2V1D A;  2VJI A;  4XSZ F;  1KA8 A;  2W7N A;  3MMY B;  4DBR A;  2HYJ A;  2AXT C;  3MVP A;  1TWC J;  2K3F A;  5EG0 A;  2A68 F;  3BG9 A;  4ZTF A;  4O6J A;  1ERD A;  1KON A;  5JI6 A;  2KDO A;  2FQ4 A;  1ZTR A;  2EWN A;  1MJA A;  3BC8 A;  2DT5 A;  2G7U A;  4M3B A;  3OYG A;  2ID3 A;  1E0E A;  1SFK A;  2FF4 A;  1Z0X A;  3E6M A;  4M3D A;  2X51 A;  2EFW A;  3HXL A;  2DAO A;  3FX3 A;  2GIZ A;  3V8L A;  3N05 A;  2JA5 J;  1B59 A;  3IC7 A;  2VQL A;  2KIQ A;  2X1C A;  5DS9 A;  4E7H A;  1DP7 P;  3DXJ F;  3PSF A;  4XLH A;  4BXX J;  2FEZ A;  2EQR A;  2JA6 J;  1K6Y A;  3S16 J;  2DQL A;  3HOY J;  4FE4 A;  3J80 K;  1X2M A;  2GBY A;  3CCR I;  1LE8 A;  3IP4 B;  2M34 A;  5BPD A;  3AFH A;  3BZ6 A;  3ESW B;  2PMU A;  3V8J A;  4ASN A;  1IXS B;  3CO7 C;  2V9V A;  2MLK A;  2M30 A;  4RAG A;  2OU2 A;  4LK1 F;  1YO5 C;  2FX0 A;  2OPT A;  4ZZD A;  2MG4 A;  2QBY A;  3V42 A;  2TCT A;  3ECH A;  5FFX A;  4ZYE A;  4CO8 A;  2FD5 A;  2GWR A;  4II2 A;  5J3L A;  3TKY A;  4NUB A;  2V4J C;  3HDD A;  4UY8 I;  4FE7 A;  4XKW A;  2AHQ A;  4RB1 A;  3AG4 H;  3A01 A;  2M5W A;  3A1Y A;  3F6O A;  5DD4 A;  1YRN A;  4YG2 F;  4PSX A;  3VWB A;  4RA2 A;  3JRA A;  3Q0W A;  2YX7 A;  4CCL A;  1TQP A;  2BXZ A;  3I59 B;  1BOB A;  3JRC A;  3F23 A;  4FCY A;  5HDK A;  1ENH A;  3CDH A;  3LST A;  3WTU C;  3VYT B;  1T38 A;  3GBG A;  2JQ7 A;  1R36 A;  2L4A A;  2IGK A;  2QM3 A;  4E70 A;  2FE3 A;  4KIC A;  3GYH X;  4IPA A;  2L2O A;  1JTX A;  3DKY A;  5L3C A;  4BY1 J;  1UMQ A;  4JBA A;  3S32 A;  2E71 A;  2AS5 F;  1O4X A;  3SXY A;  1X4O A;  3EUH C;  2KL4 A;  2Z5U A;  3HRT A;  2KFD A;  2X4H A;  1OR7 A;  2DBB A;  3QYF A;  4QLC U;  1YTY A;  3R6S A;  5FD6 A;  4KNY A;  4XK4 A;  4DZJ A;  1T56 A;  2CQN A;  2X48 A;  3OYN A;  1T0F C;  1FOK A;  3TDZ C;  5E8I A;  4MIM A;  4PDK A;  2NS0 A;  4G6T B;  2F48 A;  4EVI A;  1V3F A;  2EV5 A;  2LRD A;  5LGT A;  1YFH A;  1HKT A;  3BY6 A;  3CCJ I;  5CYV A;  3T0Y A;  1WRJ A;  3IUO A;  1OMI A;  3JTH A;  4XRM A;  1ZRC A;  3FXL A;  2Z3Y A;  2F5D A;  4MEY F;  1ZAR A;  2LDU A;  2K02 A;  2LKX A;  1OYY A;  1Y6I A;  1IRZ A;  3PUB A;  2FOW A;  4JX4 A;  3BDD A;  3CLQ A;  5DM7 F;  2YPR A;  5LLQ A;  1I6X A;  2R7S A;  1U2W A;  2DW4 A;  3ML6 A;  3RZD J;  2BY3 A;  2DFE A;  2UV1 A;  4Z6Y A;  3ZMZ A;  3WHB A;  2XGX A;  2JZY A;  2DFH A;  1JUS A;  1X4P A;  1GT0 C;  4ENM A;  3H1C A;  2EFQ A;  4A6D A;  4HF2 A;  1VQ8 I;  2FBI A;  2RAE A;  3HYI A;  3IKV A;  1TP4 A;  1P7J A;  4YIR X;  1GXP A;  5HVQ C;  2VJ4 A;  4A69 C;  5C44 J;  3E6C C;  3I55 I;  2A5Y B;  1KU2 A;  2XIG A;  3W6V A;  1Q1V A;  1J0R A;  4JP0 A;  2EIJ H;  3HOV J;  1LJ9 A;  4AU7 A;  1LVA A;  5GP9 A;  1W7P D;  3QYE A;  4AYB N;  2JRM A;  5HS9 A;  4N4O B;  1E3O C;  3W6K B;  4J00 A;  1BR1 A;  2CJJ A;  3OOP A;  3S8P A;  3HKZ N;  2A6H F;  4XRS A;  4OWR B;  1S7E A;  3RSN A;  3HKZ A;  4IRI A;  2R93 J;  2MGQ A;  3KFW X;  1QRY A;  4E7Z A;  1ZGW A;  1BA5 A;  1FEX A;  5BQT A;  3K70 D;  4M72 A;  3RTR A;  4L5J A;  1WKM A;  2DYS H;  2VJJ A;  1E3H A;  4M71 A;  1A6I A;  1MDM B;  5AIQ A;  1SFE A;  1T0F A;  2W85 A;  4EJT A;  2H6B A;  1JHH A;  2EB7 A;  2V9K A;  4RB3 C;  4V2G A;  4MLO A;  4RMN A;  2R7D A;  4I7H A;  4HEA 2;  4ESB A;  3PIO F;  3L09 A;  3W2A A;  5KHD A;  1CF7 A;  2R3S A;  2AQE A;  2H1K A;  2JSP A;  2HXI A;  1RUN A;  2L4M A;  3DQV C;  2EZK A;  2IW5 A;  4UNO A;  1S72 I;  1OYI A;  3F72 A;  3OV8 A;  2PJP A;  1XDS A;  4C2U A;  1S8N A;  3FHZ A;  2ZXW H;  3I58 A;  1AWC A;  2DLL A;  4CGZ A;  2NNN A;  2IS4 A;  3E7L A;  1X3Z B;  2HKX A;  1RIO H;  3OYB A;  1DP3 A;  3N97 A;  2CV2 A;  2VON A;  4UUS B;  3TQN A;  2R4G A;  3BZC A;  4E7S A;  1S6L A;  3H36 A;  3U21 A;  3BZK A;  4HDV A;  3K2A A;  2O5R A;  2LY2 A;  4OIQ F;  4E6K G;  3ZPL A;  3HOT A;  2PLY A;  1I5Z A;  1Z6T A;  2LC2 A;  3BG3 A;  3K6G A;  4ENN A;  3H0G J;  2H8W A;  5IOZ A;  4A3E J;  1Z05 A;  2QKM B;  2DCE A;  1MMS A;  4BEH B;  5J1U A;  4Y15 A;  2DA3 A;  4BQQ A;  4CCN A;  3FMQ A;  9ANT A;  2QQ9 A;  1T98 A;  1V5F A;  1QU3 A;  3JCU C;  4R8H A;  4I0A A;  2XVC A;  4KMU X;  1KQ9 A;  2UXN A;  2QWW A;  3BOQ A;  2ME6 A;  4KIT B;  3CCU I;  4FET A;  4A3F J;  1SVO A;  1JKO C;  3K1M A;  4NB5 A;  1LDJ A;  3P7N A;  2W4S A;  2CMP A;  3CDI A;  5FRN A;  5LEK A;  3B02 A;  2HYF A;  3LAP A;  3OYK A;  3FM5 A;  2OZ6 A;  3FHN A;  2O8X A;  2J5P A;  2HXO A;  4M9S A;  5F04 A;  4XID A;  1UST A;  3M1E A;  1SFO J;  1DQU A;  1BL0 A;  5D4R A;  2JUC A;  3RPU A;  3L1P A;  5IY5 H;  3HOW J;  2MD5 A;  2DOE A;  3MZH A;  2ESH A;  1EKE A;  1SVL A;  1BM9 A;  1D5Y A;  3I64 A;  2UUZ A;  2RN7 A;  3I4M J;  2DI3 A;  3NEU A;  1UZC A;  3KPH A;  2VL8 A;  1O3Q A;  1SFX A;  4HNT A;  2LMD A;  2GIV A;  2A07 F;  3KYD B;  1TLH B;  2WB1 A;  3KP4 A;  4LLL A;  1FT9 A;  3FK6 A;  1MBG A;  4OIN F;  3UNG C;  3KYL A;  4AC0 A;  4CHU A;  5IPA A;  3AG1 H;  2XRN A;  5HS7 A;  4UUV A;  3GO5 A;  3SZG A;  1TTY A;  3FXR A;  4OIR F;  2HGC A;  1KU9 A;  5K5O A;  1R1U A;  1ZG3 A;  5GAH J;  2DA1 A;  3QOD A;  3BLY A;  1Y8R B;  4IHV A;  2CS3 A;  2DDB A;  3FMR A;  4BNC A;  5F1J A;  1G3Y A;  5LRS A;  1SAU A;  3HOS A;  4XL9 A;  2XF7 A;  3ASO H;  3TP3 A;  3ZQG A;  4HV5 A;  1T8I A;  1FSE A;  1FMW A;  3RPU D;  4M6V A;  2F5C A;  4PUS A;  2WAF A;  1YG2 A;  4B47 A;  1XSX A;  4CZC A;  1HLV A;  5LGU A;  1OJL A;  2A69 F;  4HDU A;  3GX4 X;  1FOX A;  4I98 B;  1K79 A;  2V26 A;  3BJA A;  1HST A;  2WTE A;  3U2R A;  3FXU A;  4P96 A;  2M0M A;  4Y7N J;  3CF5 F;  4HNU A;  2VQC A;  1QVU A;  4XOR A;  4EQQ A;  1QNT A;  1B72 B;  5ILU A;  2DK5 A;  5LHI A;  3EUH A;  2XAU A;  3BPX A;  3J7A O;  2R5Y B;  4LB6 B;  1K78 B;  2CW7 A;  2KJB A;  3ZN1 A;  5EGO B;  3B6C A;  1YJW I;  5CPR B;  3WTT C;  3GUD A;  2TRT A;  3F9K A;  5F1R A;  2Q1Z B;  2HS5 A;  2VKV A;  2L7M P;  1PUE E;  1S5L C;  4QSH A;  4Y13 A;  4L9N A;  2EFP A;  3TW7 A;  1LDD A;  2LF7 A;  3SEQ A;  1NG6 A;  3A4C A;  4AUX A;  2OF7 A;  4YEJ A;  3KP2 A;  4KJZ A;  2D45 A;  2K9L A;  2VOD A;  5GTI C;  2JK3 A;  3S93 A;  1J75 A;  1UFM A;  2CUZ A;  2K40 A;  3H5N A;  3REO A;  5M5X J;  5M3M J;  5DTD A;  1Y1V J;  2DTR A;  5DUK A;  5FKM A;  1DU6 A;  4NHJ A;  4EJO A;  2MAB A;  3LA7 A;  4M3E A;  1IRF A;  2JVG A;  3HUG B;  2GQQ A;  2KKO A;  4YIF A;  5D4S A;  2CQK A;  2DJN A;  2BYV E;  4UVB A;  2B63 J;  5JLW A;  2P7C B;  4IVN A;  4LLG F;  4RAY A;  2M8G X;  2COB A;  2ZME B;  1MBK A;  2VQH A;  3RYR A;  3Q9V A;  1V5G A;  2DMU A;  2DOD A;  1D8K A;  3WTZ A;  4M9Z A;  3HB9 A;  3BPV A;  3WU2 C;  3MAJ A;  1JKQ C;  4ON0 A;  2VBZ A;  1X1C A;  2LLK A;  2P81 A;  3HM5 A;  2KMU A;  3HGG A;  5J47 A;  1LQ1 A;  1MH3 A;  3L2V A;  4HF1 A;  2XPU A;  2E1O A;  1FJL A;  2P6S A;  3MZY A;  1E17 A;  2WY7 Q;  1G3S A;  1W4M A;  5FKO A;  1F43 A;  4F7Z A;  4ABZ A;  3DCF A;  2X85 A;  5KNL A;  1VQK I;  1BBY A;  1MBJ A;  1TZL A;  2R7R A;  5EG0 B;  5BPI A;  3SHF A;  2NOJ B;  4IEJ A;  3PO2 J;  4F91 B;  2ZC2 A;  5FKN A;  1SMT A;  2R7X A;  1OCR H;  1KQ0 A;  1C0W A;  2HVS A;  3G73 A;  3J7Y J;  5IP9 J;  2O8K A;  5B5E C;  1OLT A;  1OCP A;  5FRO A;  5CVJ A;  1I3A A;  1JT6 A;  2ZNY A;  3AAF A;  2HOA A;  3GFJ A;  4YEL A;  1VND A;  4QPO A;  1KZH A;  5AON A;  1MJ9 A;  4GCV A;  4BBR J;  2P5K A;  4BAY A;  2OA4 A;  2E7W A;  3Q0U A;  3FF5 A;  3J7Z I;  1AKH B;  4J01 A;  2VN2 A;  4A2U A;  5D6E A;  1LFP A;  1SVM A;  5GAD J;  3CMY A;  1FIP A;  2CQX A;  4WXH A;  5CVV A;  1LE8 B;  1IAW A;  2PI0 A;  3ULQ B;  4FHT A;  2PQ8 A;  5IP7 J;  1HA8 A;  2EA4 A;  1GVJ A;  5CQG A;  1R23 A;  3QP6 A;  3H35 A;  3W6J B;  3K4K A;  3ROU A;  4ZZL A;  1Y8Q B;  4IL6 C;  3VPR A;  3IV5 A;  1G8X A;  5FO5 A;  1ZN2 A;  1FYL A;  1YS6 A;  3F3X A;  1BIA A;  2XPW A;  3QPL A;  3HRM A;  2DK8 A;  4BXF A;  2K9S A;  3SFZ A;  5L3D A;  1HKS A;  3ZMD A;  1W0T A;  3BTI A;  3RKQ A;  3IKT A;  5M5W J;  3LSH A;  1GV2 A;  1ZRE A;  1Y0U A;  3DTK A;  4DNC A;  2GOX B;  4CZZ A;  1NHA A;  1YRN B;  3TO7 A;  2E1N A;  3VOD A;  2R7U A;  1EH8 A;  3CCS I;  1KYZ A;  2PN6 A;  3H92 A;  1ETK A;  2GXG A;  2VPR A;  1MGT A;  4DJA A;  4BYY A;  1ULY A;  1FC3 A;  3WU1 B;  4S04 A;  4NC6 A;  3I9V 2;  2DOF A;  1BIB A;  2V6C A;  2FQ3 A;  4I76 A;  3HPG A;  5DCF A;  2L0K A;  3ZQH A;  4M74 A;  1QGP A;  2MD0 A;  3KZI C;  3R4K A;  4E7J A;  5E3O A;  2CQ7 A;  4IKF A;  1MBH A;  4Z2Y A;  1JHF A;  1JT0 A;  3E3V A;  3TOA A;  3CC7 I;  4XSX F;  3TL4 X;  4GXO A;  3OYA A;  4RAF A;  1XGN A;  2JWT A;  3O8H A;  2FBK A;  5GPA A;  2XKO A;  4OAY A;  1N25 A;  1ZGA A;  2KRC A;  4MQ9 F;  3JTG A;  1B8I B;  3OYL A;  1P4X A;  1LPQ A;  5FB2 A;  3TGN A;  1O3T A;  4A93 J;  1VQ4 I;  2EK5 A;  2XAG A;  4BEH A;  2UZK A;  2X6X A;  4HYE A;  3S2W A;  3ABM H;  2WY8 Q;  1XGM A;  4IOC F;  3LSM A;  3SDG A;  2AXL A;  4CA0 A;  1JTY A;  1IN6 A;  2K4J A;  3CLO A;  2IJL A;  1IRX A;  2QF7 A;  4A5N A;  3G1L A;  3BCA A;  3WU0 A;  4LIT A;  3K9T A;  2OTJ I;  4IF4 A;  1UAA A;  2BW3 A;  1EA3 A;  2Z1D A;  1W36 C;  2H8R A;  2EPF A;  2BVM A;  1Y39 A;  2R5Z A;  2MFZ A;  1XX5 A;  2OQR A;  2QZ8 A;  2RDP A;  1OCZ H;  3NWS A;  2VI6 A;  1PYV A;  3HOX J;  2DT6 A;  2PEX A;  2W00 A;  4EJU A;  3P5J A;  1SAN A;  4F92 B;  2TDX A;  2GAU A;  2HYG D;  3HRU A;  3VYS B;  4L0Z B;  1W5T A;  1OCC H;  4RM3 A;  2MH9 A;  1VTN C;  4A3D J;  5C4X J;  3OR1 C;  3HIF A;  2RGV A;  4BBS J;  2V79 A;  2WB1 N;  3RYP A;  4XOT A;  2DJI A;  1FWZ A;  1V4R A;  3CZ6 A;  4B4C A;  3G1M A;  4LIV A;  1R5H A;  1S9H A;  4ZYH A;  1STZ A;  2HOS A;  5D5U B;  1IZ1 A;  2K3P A;  3IAS 2;  3QPH A;  1R7J A;  4FAS D;  5H6Q A;  5J6X A;  4G7H F;  5L3G A;  3K10 A;  3CO6 C;  2QSH X;  2NNY A;  5FLX Z;  4I2O A;  4LGW A;  5FKK A;  2EFO A;  2L7K A;  2IVM A;  2PX9 A;  3OL4 A;  2FRH A;  2R7F A;  3SZP A;  1H88 C;  5CVI A;  1J2X A;  1MIJ A;  2XDV A;  1UHM A;  2HPI A;  2LP0 A;  1WI3 A;  3GFM A;  1VQN I;  3MKY B;  2A61 A;  2QA4 I;  2BV6 A;  2LK2 A;  4CYC B;  5FLM J;  1YJ9 I;  2KDZ A;  5FGM A;  2H09 A;  2XAH A;  2M4G A;  2H6C A;  2L9V A;  3ZMU A;  2FU4 A;  1YW9 A;  2VQG A;  4KN7 X;  1XPX A;  1O3R A;  4BUP A;  5H6R A;  4UVC A;  1QO0 D;  4HW0 A;  4XOP A;  1ZKG A;  3E6B A;  2RNJ A;  1Q1H A;  3KP5 A;  3RKX A;  4BH9 A;  5JR3 A;  3V7R A;  4CCK A;  2ECB A;  1MBF A;  2F4O B;  1HOM A;  4HAM A;  3S3O A;  3I53 A;  3FBI B;  3GTP J;  2KZG A;  1GUU A;  3X2Q H;  2G9W A;  2WAE A;  1HXD A;  4Y33 A;  4AVP A;  5F0C A;  2FOK A;  4UVA A;  4FT8 A;  4MHG A;  3LAJ A;  3GZN B;  2G0E A;  3TED A;  4IQ4 A;  2XSJ C;  5D6F A;  4RAZ A;  2V1U A;  4Y4R A;  1VI0 A;  3S1Q J;  3PNY A;  2IA0 A;  1IRG A;  3BG7 A;  3MN2 A;  2R7T A;  1MH4 A;  1YX5 A;  3LSJ A;  5BOX A;  3KP7 A;  3FM3 A;  3R0A A;  4O3M A;  1HC8 A;  4D7M A;  4RDU A;  3J7A Y;  1IUF A;  1JGS A;  4CH7 A;  2JA7 J;  1KU3 A;  2ZSH B;  3HUG A;  2FNP A;  4M3G A;  3Q9S A;  3CCE I;  1ON2 A;  3NQO A;  4PK4 A;  2Q8K A;  3K70 C;  2QQB A;  2F4I A;  2IXS A;  3H9Q A;  5IYB J;  2HVR A;  2QEN A;  1ZG1 A;  2K9Q A;  1XB4 A;  3K4M A;  4XMY A;  1S7O A;  2DMP A;  1POG A;  1B9M A;  2YX4 A;  2KT0 A;  3M8F A;  1W7P A;  3CC4 I;  2IA2 A;  2L01 A;  1WJC A;  4B44 A;  1YW8 A;  1RR8 C;  5CQE A;  4F52 A;  4RB2 C;  2DMQ A;  1IDY A;  2DA7 A;  3ECO A;  3KX2 A;  4BQO A;  5D5V B;  4J19 A;  2AQF A;  1DU0 A;  3SYT A;  1PP7 U;  2FA5 A;  2M7A A;  5ILV A;  3OIQ A;  4NNJ A;  4B09 A;  3O8G A;  2XF6 A;  3CQZ J;  1ACI A;  3VDX A;  3C7J A;  4NQW A;  1H0M A;  3UKG A;  5EEA A;  4O5V A;  1JUP A;  3V7S A;  4MFE A;  5CVU A;  1O3S A;  3HPH A;  3IRQ A;  1I50 J;  2HQA A;  2E1C A;  1IO2 A;  4BJT A;  3ZMS A;  2NVT J;  1I27 A;  1Y0N A;  5E79 C;  4S05 A;  3K4J A;  5EJC A;  3CMA I;  3HBL A;  1XMX A;  1S29 A;  2XB5 A;  2DT7 B;  2V1N A;  4Y17 A;  2DA4 A;  1HDP A;  4P55 A;  2XKP A;  4M73 A;  1D5V A;  4BDY A;  3BR3 A;  2XRO A;  4L9V A;  1YIT I;  3TBI A;  2GLO A;  1EH7 A;  2BXY A;  3WE2 A;  4XQF A;  4RGS A;  4BE0 A;  2VOO A;  1H9T A;  4HLY A;  2QYO A;  2BOL A;  2Z2S B;  2X1D A;  2G7H A;  3KLN A;  1ZRD A;  3F21 A;  3JRE A;  4ZYG A;  3KP6 A;  3DEW A;  4X6A J;  3TO6 A;  2LY1 A;  2O03 A;  3DPT A;  3JRD A;  2H27 A;  4M6Y A;  3ABT A;  1R58 A;  1WFX A;  3F8M A;  2NS8 A;  3GTQ J;  1KGS A;  5E1W A;  2KJC A;  1SD6 A;  2E1M C;  2QGU A;  1R00 A;  4JQF A;  1QPI A;  2EBI A;  2L7F P;  2VAS A;  2CWE A;  3HZJ A;  2IBD A;  1CQT A;  1HF0 A;  3R61 A;  2ME0 A;  3M3Y J;  1R6R A;  3F22 A;  5E18 F;  1BR4 A;  1K7A A;  1ORK A;  2V6E A;  3A2K A;  3H9J A;  2FML A;  3O3K A;  4HPQ A;  3H9G A;  2Y69 H;  1U8R A;  4PGH A;  4MO7 A;  1APL C;  4IHW A;  3VB2 A;  1D0Z A;  3E0J B;  3K7A J;  1G59 A;  2B9S A;  5KVR A;  5FRM A;  4ITV A;  2OJE D;  4IRH A;  1J5Y A;  4XON A;  5IYD J;  2BY1 A;  3EPZ A;  3H3V K;  2PMZ N;  2HDD A;  2K85 A;  1HW2 A;  3WTV C;  4C3I J;  3VSK A;  2LFB A;  3ZXS A;  3CP8 A;  2YUS A;  4LJZ F;  2K9N A;  2OBP A;  4H4K C;  5B3S H;  1LB2 A;  2CRG A;  2ZKZ A;  1B8I A;  2QVO A;  2CUF A;  2KPM A;  3CUQ C;  4IJA A;  4ENJ A;  4PFO A;  3A0B C;  3JRH A;  1ZR4 A;  1MDM A;  1BI3 A;  2LBF B;  4PJN A;  1ETX A;  2L02 A;  4P5O A;  4KMF A;  4JX5 A;  2YU9 J;  3F8C A;  4XBF A;  1MSE C;  1IF1 A;  4BAC A;  3KEY A;  2COM A;  4RLF A;  4U7D A;  1VFC A;  4XLF A;  3C1D A;  4ANJ A;  3V4G A;  3SQN A;  1U78 A;  2EJR A;  1FX7 A;  3K4L A;  5C3E J;  3A01 B;  1R71 A;  3EDP A;  2DU9 A;  5KAI C;  3IH3 A;  4AIK A;  1WJE A;  2CV1 A;  2XUB A;  2VBX A;  1QA6 A;  4IQJ A;  3NAU A;  3LFK A;  3A0H C;  3PFY A;  3FDY A;  2VC1 A;  2DFF A;  2HVQ A;  4EM1 A;  4Q5S F;  1SD4 A;  1U0J A;  3HSF A;  1BW5 A;  4HA8 A;  3BQZ A;  4ZTJ A;  4KA4 A;  2OUM A;  3O6B B;  4JYK A;  4EJV A;  1W36 D;  3PUF A;  1K78 A;  5F64 A;  1MD0 A;  3HTU A;  3SFI A;  1XSV A;  1PDN C;  3BJ6 A;  1XMK A;  3OY9 A;  5E3N A;  2FBH A;  4BQA A;  3GXO A;  1ETO A;  2Q2E A;  3OYF A;  2PBI A;  2XGE A;  4C9Y A;  3OYE A;  1D3Y A;  1LUJ B;  4AM3 A;  4ZYD A;  2ELK A;  3HSR A;  4LMY A;  2BZT A;  2HZT A;  1T39 A;  2Z33 A;  2E7X A;  3CMM A;  2RQQ A;  4WF2 A;  4XLE A;  4HG2 A;  3JRB A;  1RKT A;  2KQR A;  4U0V A;  1BC8 C;  4HRI A;  2F2E A;  4LIU A;  4LB5 A;  4QWQ A;  2Y2Z A;  2ZB9 A;  1MW7 A;  3ZN0 A;  4EJW A;  4XKB A;  1P4A A;  4PJ0 C;  2XRL A;  2PJR A;  4Y3O A;  2M3A A;  3MWM A;  3HRS A;  1JUM A;  2E35 A;  1D0Y A;  3ZR8 X;  2FSW A;  5HLI A;  5EEH A;  2ACJ A;  2KP6 A;  5IOY A;  4XIC A;  2BE5 F;  2K4B A;  4DBQ A;  1QZZ A;  2LSO A;  4G12 A;  4LG3 A;  2DQR A;  3GTM J;  4XRS G;  3BCB A;  3U9G A;  3T8R A;  1W5S A;  2Z9O A;  3LSP A;  2X6O A;  2NVU B;  5EEG A;  5J1Y A;  3K1P A;  3FK7 A;  1Z7L A;  3PQK A;  4RGR A;  2DYR H;  4PZJ A;  1TC3 C;  3HSE A;  4XLN F;  2XGC A;  4U0Y A;  3HJE A;  3OIO A;  1F1Z A;  4YFK F;  1SFU A;  4W97 A;  3AL0 B;  1K6O A;  3DKX A;  2L54 A;  4XLA A;  1HDD C;  4HSR A;  3RPQ A;  5TJJ A;  4AIJ A;  3GZ5 A;  2CUJ A;  5KAF C;  3VOE A;  3LA3 A;  2EIK H;  1FYM A;  2K9M A;  5J8F A;  1WJ5 A;  3U1K A;  3JRG A;  2NVY J;  1Z1D A;  3OYJ A;  2H1L A;  5LEJ A;  1BJZ A;  5ILS A;  3GCM A;  3DBL B;  2VE9 A;  1FTZ A;  3OSG A;  2YR2 A;  2CG4 A;  1T08 B;  3PQJ A;  2XSD C;  4ENK A;  3O2P E;  4BJ6 C;  2NOG A;  3KE2 A;  1G3W A;  2IP2 A;  5IYC J;  1JGG A;  3RDI A;  1P6R A;  1PUF B;  2VOP A;  5D8K B;  4AID A;  2GA2 A;  4KFC A;  2FUG 2;  1V55 H;  3CDL A;  3JRF A;  1YQA A;  5J4V A;  2VT2 A;  2X6Y A;  1XC5 A;  2VT3 A;  3ZOB A;  1U3E M;  4PJJ A;  2WV1 A;  2VB6 A;  5KK1 A;  3JAM Z;  2HFH A;  2KZV A;  4HST A;  3IWF A;  5LFA A;  4RB0 A;  4B1R A;  2ZXJ A;  3ZQI A;  5BMZ A;  3M8E A;  3PSI A;  4D5F A;  3WG9 A;  1Z77 A;  3ZQ7 A;  3S17 J;  2CQQ A;  1JE8 A;  2HU9 A;  3VYU B;  3ZP5 A;  3RI4 A;  1Z9C A;  3GFL A;  4DYC A;  1ZYR F;  5TIS C;  1ZG5 A;  3S2H J;  2BEO A;  1CF7 B;  4RGX A;  2LKS A;  1RRJ A;  3IAM 2;  2KRF A;  2BY2 A;  1SMY F;  4I09 A;  4LG0 A;  4AWX B;  2VUM J;  2RC4 A;  2JUG A;  3FMS A;  1R22 A;  4N9I A;  1FNN A;  2W84 A;  5E20 A;  5HDG A;  1TWG J;  2R5Z B;  1FZP B;  4A3K J;  4E7L A;  3VEP A;  3TP0 A;  3P9C A;  4H0E A;  3NWT A;  1UHS A;  1XGO A;  4PCQ A;  4UV9 A;  5IP6 A;  5AIP A;  2DTZ A;  1XMA A;  1O7L A;  2Y31 A;  1X1B A;  3CJN A;  3IL2 A;  1JKR C;  2Z99 A;  3K4B A;  4UUS A;  6PAX A;  2IPQ X;  1Y56 A;  4B48 A;  5DV5 A;  5F27 A;  3CUQ B;  1D1B A;  1UG2 A;  3UR3 C;  4C3J J;  1KYW A;  3GWZ A;  1U8B A;  3S1N J;  2E60 A;  1D1A A;  1DPR A;  2NVQ J;  2ZBK A;  3DV8 A;  2EA2 A;  1WJB A;  4EM0 B;  2JA2 A;  5F0F A;  3LFU A;  1VF9 A;  5L3B A;  3MFK A;  1R9T J;  2YSR A;  3AKZ A;  3EYY A;  1RKW A;  1WVR A;  3I3L A;  3KZY A;  2HTS A;  3OMY A;  5HOD A;  2WAQ A;  2Y9Y A;  2P4W A;  2IGO A;  5H2F C;  4A3I J;  2M7B A;  2LF8 A;  4R1H A;  2ZSI B;  3C3W A;  3DTI A;  5JHU A;  2YS9 A;  1IUY A;  3LA2 A;  3VYR B;  2OV7 A;  2LG4 A;  4FIS A;  3OYH A;  3E5X A;  4A3M J;  2X6W A;  4S0H B;  2EIL H;  3EUK L;  3GLL A;  1YW7 A;  4A6E A;  2K27 A;  4F55 A;  2F4M B;  4CCO A;  1VQL I;  2V1X A;  4OU0 A;  3EUA A;  1XGS A;  2HQN A;  4GYG A;  2XAS A;  4LOC A;  2XHK A;  4UHT A;  2E5Z A;  3COA C;  2JA8 J;  2CSO A;  2VPL A;  1TWF J;  3V8K A;  4IO9 F;  3OSF A;  2ZJ2 A;  4ZDP A;  2LVS A;  1I3Q J;  2IS2 A;  3CUQ A;  4DQ2 A;  5HLG A;  4C30 A;  3RZO J;  1DGR M;  2EV0 A;  1RZ4 A;  3PO3 J;  3AG2 H;  4MTD A;  4AYB A;  2IS1 A;  3U1D A;  4RS8 A;  1QPM A;  2ISY A;  3H5R A;  4PFP A;  2KIS A;  2PMZ A;  4FX4 A;  1G6N A;  2K7L A;  1K4T A;  4P1W A;  4XN3 A;  2B0L A;  3BRO A;  4RGU A;  4C2M J;  5DCM B;  1N77 A;  4BU2 A;  1A5J A;  4CSW A;  5ICG A;  1TT0 A;  4HQM A;  5F08 A;  3GEZ A;  1A36 A;  3MKZ A;  4BE1 A;  1U5T A;  3LSG A;  4A3C J;  4MFD A;  4HZF A;  1MMA A;  2HR3 A;  1WCM J;  1T6S A;  1MSF C;  4EGZ A;  5B1A H;  4DGW B;  2A6T A;  2OC6 A;  2OQG A;  1BI1 A;  3GME A;  3ONQ A;  2STT A;  4XR6 A;  3EYI A;  4EV0 A;  4X0G A;  4CYC A;  5LBQ A;  2P7V B;  1B72 A;  3M4O J;  3HL2 A;  4IZZ A;  3OYD A;  1BOA A;  3F8N A;  1Z21 A;  3OS1 A;  1H8A C;  1VQ9 I;  2IGN A;  2R5Y A;  2D1V A;  2WBM A;  2M9H A;  1WI9 A;  1E2X A;  4BKX A;  2CO5 A;  4B8X A;  1EH6 A;  1UHW A;  1W0U A;  4EAT A;  1WWX A;  5B1B H;  2VKE A;  1JJ6 C;  2Q2E B;  1ETY A;  2JJ7 A;  4BXU A;  1Z7U A;  4YFN F;  3FXJ A;  1X1A A;  3LMM A;  3OYC A;  3CCM I;  1YI2 I;  3AG3 H;  2D1H A;  4I02 A;  4BY7 J;  3RQI A;  1XDU A;  2JMW A;  2XC7 A;  2KIU A;  4FTH A;  3GTL J;  2NS7 A;  5EZH A;  3LSR A;  2KIF A;  4G6Q A;  3RJP A;  3HG9 A;  1T95 A;  3ABK H;  3ERE D;  2CGP A;  1EF4 A;  4CIC A;  1DPU A;  4I01 A;  1IW7 F;  5LD2 C;  3BR1 A;  3LQR A;  4IHT A;  4D7N A;  1AA7 A;  3FZV A;  3E97 A;  3BR0 A;  3FIS A;  2X9D A;  2W82 A;  4ZYA A;  3DP7 A;  3GTO J;  3C2H A;  1RPW A;  2I8D A;  3BTJ A;  1I1S A;  2CW8 A;  5CVR A;  2HOE A;  3M9A A;  1ZLJ A;  2BW3 B;  4UXN A;  1ETV A;  2XF5 A;  2IAI A;  2WV0 A;  2M45 A;  4GYI A;  5B66 C;  2E2I J;  2ZFU A;  3BJO A;  3PJR A;  1YJN I;  1UG0 A;  2W48 A;  5DUI A;  1REP C;  2W24 A;  2H94 A;  3QQA A;  2FJ1 A;  5K1Y A;  1RI7 A;  3GZ6 A;  1IV8 A;  1H9G A;  2K5C A;  5HS8 A;  3SJM A;  3ELK A;  2CYY A;  1A35 A;  4CCM A;  4B3A A;  2NVX J;  2ZJQ F;  2L9R A;  5A2Q Z;  4D5C A;  1WHU A;  1BJA A;  4HOB A;  4FX0 A;  3FXK A;  3G3Z A;  4NQW B;  2VBY A;  1V5E A;  3DFG A;  5CLS A;  2HZD A;  3L9F A;  1DUX C;  3FXM A;  1WZ2 A;  3TO9 A;  1OKR A;  1IC8 A;  2DPU A;  3Q0V A;  1NG7 A;  2A3S A;  1AKH A;  1XN7 A;  1Z3X A;  2GM4 A;  1U9N A;  2L5Q A;  1X58 A;  1OQY A;  5JLX A;  5HDN A;  2V9P A;  3LSK A;  2BGC A;  1UJ8 A;  3DU5 A;  2QKL B;  4HV6 A;  2ID6 A;  4G8X A;  1Z67 A;  4KIB A;  4DOZ A;  3L00 A;  1YE9 A;  5FD5 A;  4XNF A;  4PJM A;  3DLL F;  2MLG A;  3LSI A;  3BR2 A;  1VQM I;  2OCE A;  1QHG A;  1EJ9 A;  1FOY A;  2L9S A;  2QBY B;  2CH0 A;  2I5U A;  1S7A A;  4XRF A;  3GTJ J;  3PNV A;  2VLA A;  2Y75 A;  3QOP A;  3V7C A;  4DIQ A;  2OTL I;  4ZJZ A;  2OZU A;  1ODD A;  3J80 Z;  4LD5 A;  3DBR B;  1MZB A;  1X3U A;  3HC7 A;  4F3Q A;  3MEX A;  2EZL A;  4L5E A;  4BJ5 C;  3LNQ A;  1ZEL A;  3S1M J;  1PVE A;  1R4N B;  2LY9 A;  3CES A;  5FLX K;  3CCY A;  3HEF A;  2XPV A;  1IN8 A;  1XSD A;  2E2H J;  3S2D J;  5DM6 F;  1LKX A;  1YIO A;  2E19 A;  2JPC A;  3LQQ A;  2QCO A;  5TRD A;  1MMN A;  1SEU A;  5IT9 Z;  2HI3 A;  3I56 I;  5LHH A;  1P92 A;  4GDF A;  3TW6 A;  3MKW B;  4IOA F;  3MZ8 A;  3JW4 A;  5L3F A;  3QAH A;  4C2T A;  3ASN H;  1S3J A;  1O7F A;  2DN0 A;  4UUT A;  3E6D A;  4UB6 C;  3PNT A;  3CCL I;  3WTX C;  1GHC A;  2HDW A;  1OFC X;  4G7Z F;  3CTA A;  3T1B A;  4EMS A;  3K2Z A;  1YS7 A;  4L9J A;  1A04 A;  3QP5 A;  1B4A A;  3RIR A;  4AD9 A;  4IHX A;  2MYS A;  4MNU A;  2ELJ A;  4IX7 A;  1BR2 A;  1O57 A;  3N4M A;  2P0W A;  2DFI A;  1F5T A;  5TGT A;  2DMN A;  4NDL A;  1FMV A;  3L7W A;  4XN0 A;  3BR6 A;  4KDP A;  5ICE A;  1TQI A;  2DMT A;  1P4W A;  1JKP C;  5H20 A;  2GOM A;  1FTT A;  1L3L A;  2RQP A;  3B6A A;  4A3G J;  5A2Q K;  2MH2 A;  4UV8 A;  3RKY A;  2F5V A;  2ECC A;  1YHQ I;  4WWC A;  2O7O A;  3OYI A;  4KYW A;  5J40 A;  1CGP A;  4YFX F;  1R1T A;  2BY0 A;  2LRE A;  3A03 A;  1VQ7 I;  3QPS A;  2YU3 A;  3I4P A;  1TQM A;  3OL3 A;  1ITY A;  1QVT A;  3JR9 A;  5GAE J;  2X1E A;  3D0S A;  1W1W E;  1IN4 A;  2VXD A;  5E1X A;  5IT3 A;  1HW5 A;  3R60 A;  1HSJ A;  4N9H A;  2ADU A;  3BTL A;  5JVT A;  1E3P A;  3C18 A;  3OWT A;  3T5X A;  2UXX A;  1LEA A;  3MQ0 A;  1MND A;  3G2B A;  3K4N A;  4DYR A;  4U7B A;  1SC7 A;  2R0Q C;  1X1P A;  1I6H J;  2QQA A;  4Q4Z F;  1IXC A;  1Z3Y A;  2BVL A;  2HWV A;  3FBN B;  3CP2 A;  2P6T A;  4KT5 C;  3S3M A;  1U5T C;  1VQ6 I;  1QHH D;  4N4N B;  2EIM H;  4B43 A;  3QRF F;  4MTE A;  4AIH A;  4XM3 A;  1MMD A;  4KIS A;  3E1S A;  1HBX G;  1LEB A;  5LRR A;  2LD5 A;  5JFR A;  1ZGJ A;  3CUO A;  3S15 J;  2OD5 A;  1WJF A;  4OIP F;  3QWL A;  2ZFW A;  2RVC A;  3D5R C;  3GW2 A;  3I71 A;  4V19 K;  4DYQ A;  5GTH C;  5DCM A;  3OIP A;  2WA0 A;  3OYM A;  1AHD P;  2DA5 A;  2HQR A;  1TNS A;  3SDB A;  4A0Y A;  2HDC A;  2KHM A;  4OIO F;  2PJR B;  2VIX A;  3QU3 A;  3DEE A;  4I6Z A;  4YII A;  1XD7 A;  4BGD A;  3ZQC A;  1GLN A;  3DPU A;  1XG1 A;  2ZME A;  1WJD A;  3KIO A;  1ONV A;  1L0O C;  2QSG X;  1QZE A;  4JOM A;  3WOD F;  3TOB A;  3OS2 A;  2QEX I;  2ZO4 A;  3BTC A;  3NAR A;  4HNV A;  5EDN A;  5F0H A;  1WSU A;  2MA3 A;  3KEO A;  2NXN B;  1QBJ A;  3HTS B;  4A12 A;  3OS0 A;  1N78 A;  1MNM C;  2JTV A;  3IH4 A;  2XAQ A;  3HOU J;  3ZQF A;  3L2W A;  2VE8 A;  1IGN A;  2EIN H;  2GXB A;  2RV8 A;  2WC2 A;  2F5E A;  2M2E A;  4WXD A;  1N75 A;  1FSH A;  4GRI A;  4TV7 A;  3ERM A;  2HOT A;  3L2U A;  5KCM A;  2JT1 A;  5JHF A;  4U0W A;  2PFB A;  1SD5 A;  1BW6 A;  1P7I A;  2ZNZ A;  2XGD A;  2DA6 A;  4ESJ A;  2ISZ A;  2R7O A;  2A5W A;  1M1E B;  5DEQ A;  2ESN A;  3DU6 A;  1FOW A;  1GV5 A;  3CD6 I;  1R5G A;  3SEZ A;  3I5U A;  2HTJ A;  5E3L A;  2QUF A;  1FPQ A;  2LBF A;  3D5S C;  3QPT A;  4V2F A;  4XLP F;  2NAZ A;  3K1N A;  1IJW C;  3W2V A;  4ZH4 F;  4U87 A;  2LNB A;  1TWA J;  2ZJP F;  4G7O F;  4ETS A;  4P9F A;  1ZAO A;  2QQ8 A;  3EQL F;  3E5U A;  2E1M B;  4IHS A;  3BG5 A;  3CJQ B;  1PP8 F;  4GFB A;  1TT5 B;  4II3 A;  3D1N I;  2UWM A;  3BT9 A;  1AOY A;  3J81 Z;  4WX9 A;  3DTE A;  2XB0 X;  2CV0 A;  1H89 C;  3DKW A;  3M1C A;  1T33 A;  1R4M B;  2GXA A;  1Y1W J;  1XS9 A;  1B9N A;  2E5N A;  3IH2 A;  2CUE A;  4KT6 A;  5ICC A;  1WGX A;  3IHU A;  1ZQ3 P;  1YOV B;  4X1E A;  3F8B A;  2VXZ A;  2BHY A;  1TL8 A;  5BS6 A;  4RLQ A;  3F8F A;  1KU7 A;  2M87 A;  4W1U A;  1FYK A;  3F6V A;  4ZC3 A;  3KEQ A;  3GTG J;  4HX8 A;  1AU7 A;  4OMY A;  1GDT A;  4IHY A;  2PG4 A;  1OYW A;  3W2W A;  4HQE A;  1T2K A;  1HQC A;  3A02 A;  1JJ8 C;  1J9I A;  1ETQ A;  2HKO A;  1WH7 A;  4CDG A;  1MKM A;  3LL7 A;  5E3M A;  5K5R A;  3H3U A;  3C2B A;  2DOA A;  3S1R J;  1IDZ A;  1FIA A;  3DLA A;  1G3T A;  3ZGK A;  3KCC A;  3M7G A;  4M6X A;  1K4S A;  4EGY A;  2MC3 A;  3WTY C;  4L0Y B;  1IN5 A;  3MD2 A;  1TNT A;  2F5F A;  1UB9 A;  4M9X A;  2C6Y A;  1J59 A;  1LFB A;  4EEF G;  3ABU A;  1R1V A;  2AO9 A;  4G94 A;  4IXA A;  2GA1 A;  4CUG A;  3RKW A;  4BHC A;  4QIW N;  4LFU A;  1UEL B;  5M3F J;  5ERI A;  3WGH A;  4HBL A;  4RBO A;  2P8T A;  1RC9 A;  4A0X A;  1W7P B;  2ELH A;  1ZH5 A;  3JSO A;  1YIJ I;  1FY7 A;  1X1D A;  2OCC H;  3CME I;  1DDN A;  1ZHF A;  5E17 F;  1WH5 A;  1QQI A;  1XCB A;  1IXR C;  2E34 A;  4BDZ A;  3S14 J;  1I1G A;  4OAZ A;  2JN6 A;  1R5I D;  4ZDO A;  3I4N J;  4RM2 A;  2EH3 A;  1K61 A;  2QSF X;  3CF2 A;  4KUM A;  1P2F A;  1F36 A;  2IA1 A;  4D9J A;  3WTS C;  1OPC A;  4MQV A;  3TMO A;  4AVZ A;  3JAM K;  3RQ4 A;  5D5W B;  3JSP A;  3S3N A;  1BI2 A;  1KQ8 A;  2KIM A;  3G71 I;  1PJR A;  1EV7 A;  2O61 A;  1A31 A;  1B6A A;  3IRR A;  4I0B A;  5ICF A;  3OOU A;  1OCO H;  2M8E A;  2MW8 A;  4D1Q A;  4R79 A;  2PMH A;  1NK3 P;  4UB8 C;  5EYR A;  2FMY A;  3L2C A;  2VKH A;  4A3B J;  2KLO A;  2XAJ A;  4IRG A;  3BR5 A;  2D2W A;  4B3X A;  5L3E A;  1ZLK A;  4D0P A;  5FLV A;  4QTR A;  1I39 A;  3C2G A;  1RET A;  1XTA A;  3BQY A;  4U88 A;  3FXQ A;  1WQ2 A;  2V7F A;  3LOC A;  4DZP A;  4L18 B;  3ZMV A;  5BNG A;  3RCO A;  1RR7 A;  3BWG A;  3AL0 C;  4A5M A;  1SAX A;  2GZW A;  5FJ8 J;  1X19 A;  3WTW C;  1F4K A;  1MNE A;  2W25 A;  1WPK A;  3K4C A;  3WG7 H;  3T8T A;  2IEK A;  4C3H J;  2DXI A;  3I59 A;  2Q0O A;  3ZQQ A;  2X0L A;  4A3J J;  4PJL A;  1HKQ A;  3GF2 A;  3ZQL A;  1MMG A;  1UCR A;  1ZR2 A;  2VBW A;  1ETW A;  2L3D A;  1V54 H;  1BN5 A;  2LH9 A;  2VKD A;  2IGM A;  1YX3 A;  4BL0 B;  5GPC A;  4L5I A;  5J4Y A;  2JSC A;  2P5V A;  2VC0 A;  2ZCW A;  5JVG F;  1D0X A;  2EV6 A;  3PFI A;  1G2H A;  4KIG A;  2IS6 A;  3WHC A;  3W3C A;  5FKL A;  5K7F A;  4HF0 A;  3GTK J;  3P9K A;  1Z6R A;  1LFU P;  3GFI A;  4WK8 F;  2B7E A;  4L9T A;  2DDA A;  4OOI A;  1VZ0 A;  2RKH A;  2JVH A;  3CCQ I;  1NK2 P;  3I0T A;  2E2J J;  2ZME C;  4OMZ A;  2I10 A;  2Y0S N;  3Q5F A;  2HPM A;  4JK1 X;  4LK0 F;  1J09 A;  5J8C A;  1TWH J;  2DPD A;  5EF6 A;  1FLI A;  1RUO A;  1FBU A;  4YRV A;  2LKP A;  2MBF A;  3H5A A;  1NTC A;  3M8J A;  5E8G A;  4CCJ A;  4CYD A;  4A3L J;  2QLZ A;  5HLH A;  1IV6 A;  2STW A;  4ESF A;  1DGW Y;  2Y0M A;  1D8J A;  3VSL A;  1USS A;  2HNH A;  1OIS A;  3PIP F;  2D5V A;  2L9N A;  4HLX A;  1OR7 C;  4I99 C;  1LNW A;  2CFO A;  5F6F A;  2WAD A;  4E7K A;  3E5Q A;  3CJT B;  2Y48 A;  3CC2 I;  2R7Q A;  1VQO I;  4HX4 A;  2XAF A;  2ZXH A;  1IN7 A;  3D5L A;  3HHG A;  4KN4 X;  2EZI A;  3OR2 C;  4ZDL A;  1K83 J;  3K0L A;  2N8G A;  2JPB A;  2R92 J;  4G9Y A;  5HOO A;  2CU7 A;  1MBE A;  2FXA A;  2W57 A;  5DYM A;  1ZK8 A;  4GO1 A;  4NC8 A;  2R7V A;  2A05 A;  4NBQ A;  3H0D A;  2O9L A;  1F9N A;  3GLX A;  1QZY A;  2W1O A;  3CJR B;  2EFN A;  3HHH A;  5FFZ A;  1VQP I;  2LOO A;  2O6G E;  2ICW G;  4E7I A;  3ZMT A;  2F6C A;  3KET A;  3WGG A;  3K69 A;  5HNH A;  2Z16 A;  1SD7 A;  1FBQ A;  1GXQ A;  1FBS A;  2HQ5 A;  4Y52 J;  1RES A;  5LGN A;  4PSW A;  2IRF G;  5K7H A;  3FXO A;  4MGR A;  3MKL A;  1PUF A;  2Y9Z A;  1JXS A;  3GVA A;  5DDG A;  1B1B A;  1J7K A;  1U5T B;  3DWL E;  4A0Z A;  1ON1 A;  3JRI A;  4E4H A;  3SZT A;  2NYX A;  1LVK A;  4Q47 A;  2CFX A;  2ZXI A;  3I54 A;  4XLC A;  3DPL C;  4P9U A;  2LR8 A;  4Q48 A;  5CJ9 A;  2IT0 A;  2BHZ A;  1YYV A;  2R7Z J;  3QYB A;  4WXC A;  3NRV A;  4BQN A;  2E36 A;  3L2Q A;  2DO7 A;  4JX6 A;  3ABL H;  3DBH B;  3R0J A;  3KLO A;  4LLN A;  3J81 K;  1P9Q C;  1R49 A;  1RNL A;  2KRH A;  3HGY A;  5D8L B;  2HEO A;  1XCV A;  3HOZ J;  4XKV A;  1X2N A;  2RRE A;  2LYC A;  2M1B A;  2RNG A;  5EZG A;  1NH3 A;  2NRA C;  1WJA A;  4LG0 B;  4M3F A;  1VQ5 I;  3KZZ A;  3QOE A;  4PGG A;  4BS9 A;  3IWZ A;  3ZCO A;  5EGO A;  3P9I A;  3PL8 A;  2MSY A;  3FKJ A;  2M0C A;  5HLT A;  1A6Q A;  1TW2 A;  1GVD A;  1TW3 A;  5M5Y J;  3B73 A;  4EM2 A;  3LWF A;  3PM1 A;  2VJ5 A;  3WGI A;  1U9O A;  5IT9 K;  3ZRG A;  3DF8 A;  2BBY A;  3WE3 A;  4N0B A;  4FQG A;  5GAG J;  2CW0 F;  4NC7 A;  2K86 A;  3KYC B;  3EET A;  5LHG A;  3VFZ A;  3ISP A;  4K2E A;  4XKC A;  4BHB A;  1IG7 A;  3G6E I;  2WWY A;  2J5O A;  4BHP A;  2EZH A;  3FKI J;  1BI0 A;  5K5Q A;  4WCG A;  2Y0S A;  3FIW A;  3KP3 A;  1X3W B;  3MCZ A;  1HW1 A;  1LDK B;  5HNF A;  4F93 B;  1D1C A;  2LTP A;  1W5C C;  1G4D A;  4MEX F;  2XV4 S;  1ZRF A;  3M07 A;  5DD8 A;  3CCV I;  5C4J J;  1JI8 A;  3BG6 A;  2M4K A; 
#chains in the Genus database with same CATH homology
 3FWE A;  4CXF A;  3H3Z A;  1FP2 A;  2O0Y A;  5D5X B;  1Z91 A;  3DEU A;  4G6D A;  1BC7 C;  2ETH A;  5E1Z B;  1TBX A;  2P5L C;  1FP1 D;  3BP8 A;  3QU6 A;  2A6E F;  4KIF A;  4HX7 A;  2FNA A;  5ED4 A;  2O3F A;  1MJB A;  2JRT A;  2OAZ A;  1YLF A;  3TDU C;  4GGG A;  1U6G A;  2V1D A;  4XSZ F;  1KA8 A;  2A68 F;  4O6J A;  5JI6 A;  2EWN A;  1MJA A;  2DT5 A;  2G7U A;  2FF4 A;  3E6M A;  2EFW A;  2DAO A;  3FX3 A;  3V8L A;  1B59 A;  3IC7 A;  1DP7 P;  3DXJ F;  2FEZ A;  2DQL A;  3J80 K;  5BPD A;  3BZ6 A;  3V8J A;  2PMU A;  4ASN A;  3CO7 C;  1IXS B;  2V9V A;  2MLK A;  2M30 A;  2OU2 A;  4LK1 F;  1YO5 C;  4ZZD A;  2QBY A;  3ECH A;  5FFX A;  4ZYE A;  4CO8 A;  2GWR A;  3TKY A;  4RB1 A;  2M5W A;  5DD4 A;  3F6O A;  4YG2 F;  2YX7 A;  1TQP A;  3I59 B;  3F23 A;  5HDK A;  3CDH A;  3LST A;  3WTU C;  1T38 A;  1R36 A;  2L4A A;  2QM3 A;  4E70 A;  2FE3 A;  4KIC A;  3GYH X;  4IPA A;  5L3C A;  4JBA A;  2AS5 F;  3SXY A;  2Z5U A;  3HRT A;  2X4H A;  1OR7 A;  2DBB A;  4QLC U;  1YTY A;  3R6S A;  5FD6 A;  4KNY A;  1FOK A;  3TDZ C;  5E8I A;  4PDK A;  2NS0 A;  4EVI A;  1V3F A;  2EV5 A;  5LGT A;  1YFH A;  1HKT A;  3BY6 A;  5CYV A;  3T0Y A;  1WRJ A;  3JTH A;  1OMI A;  1ZRC A;  2Z3Y A;  2F5D A;  4MEY F;  1ZAR A;  2LDU A;  2K02 A;  1OYY A;  3BDD A;  2YPR A;  5LLQ A;  1I6X A;  1U2W A;  2DW4 A;  3ML6 A;  3ZMZ A;  2XGX A;  2JZY A;  4ENM A;  4A6D A;  2EFQ A;  4HF2 A;  2FBI A;  3HYI A;  3IKV A;  1GXP A;  5HVQ C;  3E6C C;  2A5Y B;  1KU2 A;  2XIG A;  1J0R A;  1LJ9 A;  1LVA A;  1W7P D;  5HS9 A;  3W6K B;  3OOP A;  2A6H F;  4IRI A;  3KFW X;  5BQT A;  4M72 A;  3RTR A;  4L5J A;  1WKM A;  4M71 A;  1MDM B;  5AIQ A;  1SFE A;  1T0F A;  2W85 A;  4EJT A;  2H6B A;  1JHH A;  2EB7 A;  4RB3 C;  2R7D A;  4I7H A;  4ESB A;  3L09 A;  1CF7 A;  2R3S A;  1RUN A;  2L4M A;  3DQV C;  2IW5 A;  4UNO A;  1OYI A;  3F72 A;  3OV8 A;  2PJP A;  1XDS A;  1S8N A;  3FHZ A;  3I58 A;  1AWC A;  2DLL A;  4CGZ A;  2NNN A;  2HKX A;  1RIO H;  3N97 A;  2VON A;  3TQN A;  1S6L A;  4HDV A;  4OIQ F;  3ZPL A;  3HOT A;  2PLY A;  1I5Z A;  1Z6T A;  4ENN A;  1Z05 A;  4Y15 A;  3FMQ A;  2QQ9 A;  1T98 A;  4R8H A;  4I0A A;  2XVC A;  4KMU X;  1KQ9 A;  2UXN A;  2QWW A;  3BOQ A;  3K1M A;  4NB5 A;  1LDJ A;  3P7N A;  5LEK A;  3B02 A;  2HYF A;  3LAP A;  3FM5 A;  2OZ6 A;  2O8X A;  2J5P A;  4M9S A;  1UST A;  3M1E A;  5D4R A;  3RPU A;  2MD5 A;  3MZH A;  2ESH A;  1BM9 A;  3I64 A;  2RN7 A;  2DI3 A;  3NEU A;  1O3Q A;  1SFX A;  2A07 F;  2GIV A;  1TLH B;  3KP4 A;  4LLL A;  4OIN F;  1FT9 A;  4CHU A;  2XRN A;  5HS7 A;  4UUV A;  3GO5 A;  1TTY A;  4OIR F;  3FXR A;  2HGC A;  1KU9 A;  5K5O A;  1R1U A;  1ZG3 A;  3FMR A;  4BNC A;  1G3Y A;  5LRS A;  3HOS A;  4HV5 A;  1FSE A;  2F5C A;  1YG2 A;  1XSX A;  5LGU A;  2A69 F;  4HDU A;  3GX4 X;  4I98 B;  1K79 A;  3BJA A;  1HST A;  2WTE A;  3U2R A;  3FXU A;  4P96 A;  4EQQ A;  1QNT A;  5ILU A;  2DK5 A;  5LHI A;  3EUH A;  3BPX A;  3J7A O;  4LB6 B;  1K78 B;  3ZN1 A;  2KJB A;  3WTT C;  3GUD A;  5F1R A;  2HS5 A;  1PUE E;  4Y13 A;  4L9N A;  2EFP A;  1LDD A;  2LF7 A;  3KP2 A;  2D45 A;  2VOD A;  1J75 A;  1UFM A;  3REO A;  2DTR A;  5DUK A;  4NHJ A;  4EJO A;  3LA7 A;  1IRF A;  2GQQ A;  2KKO A;  4YIF A;  5D4S A;  2CQK A;  4UVB A;  2BYV E;  2P7C B;  4IVN A;  4LLG F;  4RAY A;  2ZME B;  3RYR A;  3Q9V A;  1D8K A;  3WTZ A;  4M9Z A;  3BPV A;  3MAJ A;  4ON0 A;  2VBZ A;  1LQ1 A;  4HF1 A;  2P6S A;  3MZY A;  1E17 A;  1G3S A;  1W4M A;  4F7Z A;  1BBY A;  5BPI A;  3SHF A;  1SMT A;  1KQ0 A;  1C0W A;  3G73 A;  5CVJ A;  2ZNY A;  3AAF A;  3GFJ A;  5AON A;  1MJ9 A;  4GCV A;  2P5K A;  4BAY A;  2OA4 A;  2E7W A;  3FF5 A;  2VN2 A;  4A2U A;  5D6E A;  4WXH A;  5CVV A;  1IAW A;  2PI0 A;  3ULQ B;  4FHT A;  2PQ8 A;  2EA4 A;  1GVJ A;  1R23 A;  3QP6 A;  3W6J B;  3ROU A;  4ZZL A;  5FO5 A;  1ZN2 A;  1FYL A;  1YS6 A;  3F3X A;  1BIA A;  3HRM A;  2DK8 A;  3SFZ A;  3ZMD A;  5L3D A;  1HKS A;  3IKT A;  1ZRE A;  1Y0U A;  4DNC A;  4CZZ A;  1NHA A;  3TO7 A;  2E1N A;  3VOD A;  1EH8 A;  1KYZ A;  2PN6 A;  3H92 A;  2GXG A;  1MGT A;  4BYY A;  1ULY A;  1FC3 A;  3WU1 B;  4S04 A;  2V6C A;  1BIB A;  2FQ3 A;  5DCF A;  4M74 A;  1QGP A;  3R4K A;  4Z2Y A;  1JHF A;  3E3V A;  3TOA A;  4XSX F;  4GXO A;  1XGN A;  2FBK A;  2XKO A;  1ZGA A;  3JTG A;  4MQ9 F;  1P4X A;  5FB2 A;  3TGN A;  1O3T A;  2EK5 A;  2XAG A;  2UZK A;  4HYE A;  3S2W A;  1XGM A;  2AXL A;  1IN6 A;  2K4J A;  3CLO A;  2IJL A;  4A5N A;  3WU0 A;  3K9T A;  4IF4 A;  2RDP A;  2OQR A;  2QZ8 A;  2PEX A;  4EJU A;  2TDX A;  2GAU A;  2HYG D;  3HRU A;  4L0Z B;  1W5T A;  2MH9 A;  1VTN C;  3HIF A;  2RGV A;  2V79 A;  3RYP A;  1FWZ A;  1V4R A;  1R5H A;  4ZYH A;  1STZ A;  5D5U B;  1IZ1 A;  5J6X A;  3QPH A;  1R7J A;  4G7H F;  5H6Q A;  5L3G A;  3CO6 C;  2NNY A;  5FLX Z;  4I2O A;  4LGW A;  2EFO A;  2IVM A;  2FRH A;  2R7F A;  3SZP A;  5CVI A;  1J2X A;  1UHM A;  3GFM A;  2A61 A;  2BV6 A;  5FGM A;  2H09 A;  2XAH A;  2H6C A;  3ZMU A;  2FU4 A;  1YW9 A;  4KN7 X;  1O3R A;  5H6R A;  4UVC A;  1QO0 D;  4HW0 A;  3E6B A;  2RNJ A;  1Q1H A;  3KP5 A;  3RKX A;  4BH9 A;  5JR3 A;  3V7R A;  4HAM A;  3I53 A;  2G9W A;  1HXD A;  4AVP A;  2FOK A;  4UVA A;  3LAJ A;  4FT8 A;  4MHG A;  5D6F A;  4RAZ A;  2V1U A;  2IA0 A;  1IRG A;  5BOX A;  3KP7 A;  3FM3 A;  3R0A A;  4O3M A;  1JGS A;  1KU3 A;  3HUG A;  2FNP A;  3Q9S A;  1ON2 A;  3NQO A;  2Q8K A;  2QQB A;  2QEN A;  1ZG1 A;  1XB4 A;  1S7O A;  2YX4 A;  3M8F A;  1B9M A;  1W7P A;  2IA2 A;  2L01 A;  1YW8 A;  4RB2 C;  3ECO A;  5D5V B;  1PP7 U;  2FA5 A;  5ILV A;  4B09 A;  3C7J A;  4NQW A;  1H0M A;  4O5V A;  3V7S A;  5CVU A;  1O3S A;  3IRQ A;  2E1C A;  3ZMS A;  1I27 A;  4S05 A;  1S29 A;  4Y17 A;  4P55 A;  2XKP A;  4M73 A;  1D5V A;  2XRO A;  4L9V A;  1EH7 A;  3WE2 A;  4RGS A;  2VOO A;  1H9T A;  4HLY A;  2QYO A;  2G7H A;  3KLN A;  1ZRD A;  3F21 A;  4ZYG A;  3KP6 A;  3TO6 A;  3DPT A;  2O03 A;  2H27 A;  4M6Y A;  3ABT A;  1R58 A;  3F8M A;  1KGS A;  5E1W A;  2KJC A;  1SD6 A;  1R00 A;  4JQF A;  2CWE A;  3R61 A;  3F22 A;  5E18 F;  1K7A A;  2FML A;  3O3K A;  1U8R A;  4PGH A;  3VB2 A;  5KVR A;  4IRH A;  1J5Y A;  1HW2 A;  3WTV C;  4LJZ F;  2OBP A;  1LB2 A;  2ZKZ A;  2QVO A;  4ENJ A;  3CUQ C;  4IJA A;  1MDM A;  1BI3 A;  2L02 A;  4P5O A;  4KMF A;  3F8C A;  4XBF A;  1IF1 A;  4U7D A;  2COM A;  3C1D A;  3V4G A;  3SQN A;  1U78 A;  2EJR A;  1FX7 A;  3EDP A;  2DU9 A;  4AIK A;  2XUB A;  2VBX A;  3LFK A;  2VC1 A;  4EM1 A;  4Q5S F;  1SD4 A;  3HSF A;  4HA8 A;  4KA4 A;  3O6B B;  4EJV A;  1K78 A;  5F64 A;  1MD0 A;  3HTU A;  1XSV A;  1PDN C;  3BJ6 A;  1XMK A;  4BQA A;  2FBH A;  3GXO A;  2Q2E A;  2PBI A;  1D3Y A;  4ZYD A;  3HSR A;  4LMY A;  2HZT A;  1T39 A;  2Z33 A;  2E7X A;  4WF2 A;  4U0V A;  1BC8 C;  2F2E A;  4LB5 A;  4QWQ A;  3ZN0 A;  4EJW A;  1P4A A;  3MWM A;  3HRS A;  2FSW A;  5HLI A;  5EEH A;  2ACJ A;  2BE5 F;  2K4B A;  1QZZ A;  2LSO A;  2DQR A;  3U9G A;  3T8R A;  1W5S A;  2Z9O A;  5EEG A;  3K1P A;  3PQK A;  4RGR A;  4PZJ A;  3HSE A;  4XLN F;  4U0Y A;  4YFK F;  1F1Z A;  1SFU A;  1K6O A;  2L54 A;  4AIJ A;  3RPQ A;  5TJJ A;  3GZ5 A;  1FYM A;  3VOE A;  3LA3 A;  5J8F A;  1Z1D A;  5LEJ A;  5ILS A;  2VE9 A;  2YR2 A;  2CG4 A;  3PQJ A;  4ENK A;  3O2P E;  3KE2 A;  1G3W A;  2IP2 A;  3RDI A;  1P6R A;  2VOP A;  5D8K B;  2GA2 A;  4KFC A;  1YQA A;  2VT2 A;  2VT3 A;  1U3E M;  3JAM Z;  5KK1 A;  2HFH A;  3IWF A;  4RB0 A;  2ZXJ A;  5BMZ A;  3M8E A;  3WG9 A;  3ZQ7 A;  1JE8 A;  3ZP5 A;  3RI4 A;  1Z9C A;  3GFL A;  1ZYR F;  1ZG5 A;  2BEO A;  1CF7 B;  4RGX A;  2KRF A;  1SMY F;  4I09 A;  4LG0 A;  4AWX B;  2RC4 A;  3FMS A;  1R22 A;  4N9I A;  1FNN A;  2W84 A;  5E20 A;  5HDG A;  1FZP B;  3VEP A;  3P9C A;  4H0E A;  1XGO A;  4PCQ A;  4UV9 A;  5AIP A;  1XMA A;  1O7L A;  3CJN A;  3IL2 A;  2Z99 A;  6PAX A;  2IPQ X;  5DV5 A;  3CUQ B;  1KYW A;  3GWZ A;  1DPR A;  2ZBK A;  3DV8 A;  2EA2 A;  4EM0 B;  5L3B A;  3MFK A;  2YSR A;  3EYY A;  3KZY A;  2HTS A;  2P4W A;  2LF8 A;  4R1H A;  3C3W A;  5JHU A;  1IUY A;  3LA2 A;  3E5X A;  1YW7 A;  4A6E A;  2K27 A;  2V1X A;  4OU0 A;  1XGS A;  2HQN A;  4GYG A;  2XAS A;  2XHK A;  4UHT A;  3COA C;  2CSO A;  3V8K A;  2ZJ2 A;  3CUQ A;  4DQ2 A;  5HLG A;  2EV0 A;  1RZ4 A;  4MTD A;  3U1D A;  4RS8 A;  1QPM A;  2ISY A;  4FX4 A;  1G6N A;  2K7L A;  2B0L A;  3BRO A;  4RGU A;  5DCM B;  5ICG A;  4HQM A;  3GEZ A;  1U5T A;  4HZF A;  2HR3 A;  1T6S A;  4EGZ A;  2OQG A;  1BI1 A;  2STT A;  3EYI A;  4EV0 A;  5LBQ A;  2P7V B;  1BOA A;  3F8N A;  2D1V A;  1WI9 A;  1E2X A;  2CO5 A;  4B8X A;  1EH6 A;  1UHW A;  1WWX A;  4BXU A;  1Z7U A;  4YFN F;  2D1H A;  4I02 A;  1XDU A;  2KIU A;  2KIF A;  4G6Q A;  3RJP A;  3ERE D;  2CGP A;  4CIC A;  1DPU A;  4I01 A;  1IW7 F;  3LQR A;  4IHT A;  3FZV A;  3E97 A;  3DP7 A;  1I1S A;  5CVR A;  2HOE A;  3M9A A;  1ZLJ A;  4UXN A;  2WV0 A;  2M45 A;  4GYI A;  3BJO A;  1REP C;  5DUI A;  2W24 A;  2H94 A;  5K1Y A;  1RI7 A;  3GZ6 A;  1H9G A;  5HS8 A;  3ELK A;  2CYY A;  5A2Q Z;  1BJA A;  4HOB A;  4FX0 A;  3G3Z A;  2VBY A;  3DFG A;  5CLS A;  3L9F A;  1DUX C;  3TO9 A;  1OKR A;  2DPU A;  2A3S A;  1XN7 A;  5HDN A;  2BGC A;  4HV6 A;  4G8X A;  4KIB A;  3L00 A;  5FD5 A;  2MLG A;  2QBY B;  1S7A A;  4XRF A;  2Y75 A;  3QOP A;  3V7C A;  2OZU A;  1ODD A;  3J80 Z;  4LD5 A;  1MZB A;  1X3U A;  3MEX A;  5FLX K;  1IN8 A;  1XSD A;  1YIO A;  2JPC A;  3LQQ A;  5TRD A;  5IT9 Z;  5LHH A;  1P92 A;  3JW4 A;  5L3F A;  3QAH A;  1S3J A;  1O7F A;  3E6D A;  3WTX C;  1GHC A;  4G7Z F;  3CTA A;  3T1B A;  4EMS A;  3K2Z A;  1YS7 A;  4L9J A;  1A04 A;  3QP5 A;  1B4A A;  3RIR A;  4AD9 A;  4MNU A;  3N4M A;  1O57 A;  2DFI A;  1F5T A;  3L7W A;  4KDP A;  5ICE A;  1TQI A;  1P4W A;  5H20 A;  1L3L A;  2RQP A;  5A2Q K;  2MH2 A;  4UV8 A;  3RKY A;  4WWC A;  4KYW A;  1CGP A;  4YFX F;  1R1T A;  2YU3 A;  3I4P A;  1TQM A;  3D0S A;  1IN4 A;  5E1X A;  5IT3 A;  1HW5 A;  3R60 A;  1HSJ A;  4N9H A;  2ADU A;  5JVT A;  3C18 A;  3T5X A;  2UXX A;  1LEA A;  3MQ0 A;  4U7B A;  2QQA A;  4Q4Z F;  1IXC A;  2HWV A;  2P6T A;  4KT5 C;  1U5T C;  3QRF F;  4MTE A;  4AIH A;  1LEB A;  1HBX G;  5LRR A;  5JFR A;  1ZGJ A;  3CUO A;  2OD5 A;  4OIP F;  2ZFW A;  2RVC A;  3GW2 A;  3I71 A;  5DCM A;  2HQR A;  1TNS A;  2HDC A;  4A0Y A;  4OIO F;  3QU3 A;  4YII A;  1XD7 A;  2ZME A;  1ONV A;  1L0O C;  3WOD F;  3TOB A;  2ZO4 A;  1WSU A;  2MA3 A;  3KEO A;  1QBJ A;  3HTS B;  4A12 A;  2JTV A;  2XAQ A;  2VE8 A;  2GXB A;  2RV8 A;  2WC2 A;  2F5E A;  4WXD A;  1FSH A;  4TV7 A;  2JT1 A;  4U0W A;  2PFB A;  1SD5 A;  2ZNZ A;  4ESJ A;  2ISZ A;  5DEQ A;  2ESN A;  1R5G A;  3I5U A;  2HTJ A;  2QUF A;  1FPQ A;  3QPT A;  4XLP F;  2NAZ A;  3K1N A;  4ZH4 F;  2LNB A;  4G7O F;  4ETS A;  4P9F A;  1ZAO A;  3EQL F;  3E5U A;  4IHS A;  1PP8 F;  2UWM A;  1AOY A;  3J81 Z;  4WX9 A;  3DKW A;  1B9N A;  5ICC A;  3IHU A;  3F8B A;  2VXZ A;  5BS6 A;  3F8F A;  1KU7 A;  2M87 A;  1FYK A;  3F6V A;  3KEQ A;  4HX8 A;  4OMY A;  2PG4 A;  1OYW A;  4HQE A;  1T2K A;  1HQC A;  1J9I A;  2HKO A;  4CDG A;  1MKM A;  5K5R A;  3H3U A;  1G3T A;  3KCC A;  3M7G A;  4M6X A;  4EGY A;  2MC3 A;  3WTY C;  4L0Y B;  1IN5 A;  1TNT A;  2F5F A;  2C6Y A;  1UB9 A;  4M9X A;  1J59 A;  3ABU A;  1R1V A;  4G94 A;  4IXA A;  2GA1 A;  3RKW A;  4BHC A;  4LFU A;  5ERI A;  3WGH A;  4HBL A;  2P8T A;  4A0X A;  1W7P B;  2ELH A;  1ZH5 A;  3JSO A;  1FY7 A;  1DDN A;  1ZHF A;  5E17 F;  1QQI A;  1XCB A;  1IXR C;  1I1G A;  4KUM A;  1P2F A;  2IA1 A;  3WTS C;  1OPC A;  4MQV A;  3JAM K;  5D5W B;  3JSP A;  1BI2 A;  1KQ8 A;  2KIM A;  1EV7 A;  2O61 A;  1B6A A;  3IRR A;  4I0B A;  5ICF A;  2M8E A;  4R79 A;  2PMH A;  2FMY A;  3L2C A;  5L3E A;  2XAJ A;  4IRG A;  2D2W A;  1ZLK A;  4D0P A;  4U88 A;  3FXQ A;  1WQ2 A;  4L18 B;  3ZMV A;  3BWG A;  4A5M A;  1SAX A;  2GZW A;  3WTW C;  1F4K A;  2W25 A;  3T8T A;  3I59 A;  2Q0O A;  2X0L A;  1HKQ A;  3GF2 A;  1UCR A;  2VBW A;  2L3D A;  1BN5 A;  4L5I A;  2JSC A;  2P5V A;  2VC0 A;  2ZCW A;  2EV6 A;  3PFI A;  4KIG A;  4HF0 A;  3P9K A;  1Z6R A;  3GFI A;  4WK8 F;  4L9T A;  4OOI A;  2RKH A;  3I0T A;  4OMZ A;  3Q5F A;  4JK1 X;  4LK0 F;  5J8C A;  2DPD A;  1FLI A;  1RUO A;  1FBU A;  2LKP A;  2MBF A;  5E8G A;  4CYD A;  2QLZ A;  5HLH A;  2STW A;  4ESF A;  1D8J A;  2Y0M A;  1USS A;  4HLX A;  1LNW A;  5F6F A;  3E5Q A;  2Y48 A;  4HX4 A;  2XAF A;  1IN7 A;  3D5L A;  3HHG A;  4KN4 X;  3K0L A;  2JPB A;  4G9Y A;  5HOO A;  2FXA A;  2W57 A;  5DYM A;  4GO1 A;  1F9N A;  3GLX A;  1QZY A;  2EFN A;  3HHH A;  5FFZ A;  2O6G E;  3ZMT A;  3KET A;  3WGG A;  3K69 A;  1SD7 A;  1FBQ A;  1GXQ A;  1FBS A;  5LGN A;  2IRF G;  4MGR A;  1JXS A;  3GVA A;  5DDG A;  1B1B A;  1J7K A;  1U5T B;  4A0Z A;  1ON1 A;  3SZT A;  2NYX A;  4Q47 A;  2CFX A;  3I54 A;  4P9U A;  3DPL C;  4Q48 A;  5CJ9 A;  2IT0 A;  1YYV A;  4WXC A;  3NRV A;  2DO7 A;  3R0J A;  3KLO A;  4LLN A;  3J81 K;  1RNL A;  5D8L B;  2HEO A;  1XCV A;  2M1B A;  2NRA C;  4LG0 B;  3KZZ A;  4PGG A;  3IWZ A;  3P9I A;  1TW2 A;  1TW3 A;  3B73 A;  4EM2 A;  3LWF A;  3WGI A;  5IT9 K;  3DF8 A;  2BBY A;  3WE3 A;  4N0B A;  2CW0 F;  2K86 A;  3EET A;  5LHG A;  3VFZ A;  3ISP A;  4K2E A;  4BHB A;  2WWY A;  2J5O A;  4BHP A;  4WCG A;  5K5Q A;  1BI0 A;  3KP3 A;  3MCZ A;  1HW1 A;  1LDK B;  1G4D A;  4MEX F;  2XV4 S;  1ZRF A;  5DD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...