3CJNA

Crystal structure of transcriptional regulator, marr family, from silicibacter pomeroyi
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
146
Chain Sequence
RELAEIGLEGYAPYLMNRIMGRYNANLRKEMTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDDQRSSRVYLTPAGRAVYDRLWPHMRASHDRMFQGITPQERQAFLATLNKMLANIRVHEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structure of MarR family transcriptional regulator from Silicibacter pomeroyi.
rcsb
source organism Silicibacter pomeroyi dss-3
total genus 40
structure length 146
sequence length 148
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cjnA00
3GX4X 2WC2A 2P5LC 4L9NA 4HF0A 3E6DA 3BROA 1O3SA 3R61A 4N9HA 3CTAA 5D5UB 3I0TA 4HOBA 1F1ZA 5LRRA 3WE2A 1RUNA 4FX0A 4HBLA 4I0AA 3F8NA 2C6YA 3SZPA 4TV7A 4U7BA 2JPCA 4ENJA 4I98B 2OZ6A 3K1MA 4UVBA 3E5UA 3WTWC 1TQIA 2P6SA 1CF7B 3T5XA 1W5SA 2K4JA 1D8JA 1R36A 1IN7A 2UZKA 3GFIA 3HRUA 2M8EA 3F8CA 5H6RA 4EGZA 1YO5C 4HV6A 4EM1A 2ZMEB 3SXYA 5F1RA 1HW2A 2XV4S 3DEUA 3LA3A 1P4XA 2LKPA 5HOOA 1DPUA 2J5OA 1JHHA 2NRAC 2E1NA 4DQ2A 4CYDA 3IWZA 3WTVC 1O3QA 2P7VB 2FA5A 5CVIA 1IW7F 3E3VA 1BN5A 4MTDA 4B09A 3IC7A 4UUVA 1BI3A 3I54A 4AIKA 2EV5A 2RNJA 1ZREA 1R58A 1G3YA 4OIQF 2ELHA 3TQNA 3VFZA 1LDJA 2F5EA 1B6AA 1ZG3A 4PGGA 4OMZA 5FD5A 3TO6A 3V4GA 5DUIA 2IA2A 4M74A 5DDGA 2FF4A 1W7PD 1SFEA 3HOSA 5D5XB 1SD4A 1MDMB 2FRHA 2AS5F 4RAYA 2VT2A 3GO5A 2G7HA 3HRSA 4LD5A 1HKTA 5L3GA 1HSTA 3WE3A 1XCVA 4OINF 3R6SA 1ZGAA 2NYXA 1REPC 4BQAA 2P4WA 2PFBA 4XSXF 1H0MA 3FM5A 5FLXK 3IRQA 2DK8A 1BI0A 4XLNF 3F6VA 3GFMA 5BPDA 3BJ6A 4ESFA 2DQRA 2DO7A 3WG9A 2Q2EA 4KA4A 3WTYC 3DPTA 1GVJA 4N0BA 5AIPA 1YS7A 2F5DA 1QZZA 1WSUA 2FBHA 2EFNA 1ONVA 2Y0MA 2RQPA 4P9FA 2B0LA 3TDUC 2NS0A 4I7HA 2FNAA 2EFOA 1WI9A 5ERIA 3DF8A 2ADUA 2QVOA 4Z2YA 1FBSA 2MH2A 1G3WA 2Z99A 2OBPA 2X4HA 2ZJ2A 5DCFA 2IPQX 2G7UA 2XKOA 4UXNA 2O8XA 1QBJA 4KIFA 4ZYHA 2IA0A 2VXZA 2P7CB 1SMTA 2ZNZA 2ZBKA 1L0OC 2KJBA 4YG2F 2O61A 2A3SA 1JE8A 3OOPA 5DYMA 4U0VA 2CW0F 1FYLA 3J81K 2NNYA 4Q5SF 3GVAA 1UFMA 1BOAA 3RYRA 1FPQA 3LA7A 5HDKA 1IN8A 3F22A 1CGPA 3C3WA 2DAOA 3GEZA 3GLXA 5HS7A 5JR3A 4WXDA 3SHFA 4F7ZA 1U78A 3TO9A 1R00A 2IP2A 4GYGA 3GXOA 4JBAA 1R23A 3EYYA 3IHUA 1RI7A 1YIOA 4BXUA 4LG0A 5JI6A 1W5TA 2BBYA 1KU2A 1I6XA 5E8IA 5K5RA 5DCMB 2W84A 1XSDA 1XMKA 3LA2A 2LF7A 3L09A 3HTUA 1FP1D 3DQVC 5HDNA 1PP7U 3MZYA 4IHSA 2FEZA 5FB2A 1SD6A 3CLOA 1YLFA 1G3SA 3R0JA 2KRFA 4YFNF 1ZGJA 3K2ZA 3Q5FA 3P9KA 3T1BA 4A0ZA 1IZ1A 5HS9A 4EJVA 2H6BA 4KMFA 4I0BA 5IT9K 4QWQA 1Z6RA 3RPUA 3DFGA 1JGSA 2R7FA 1UB9A 3BY6A 2DBBA 1IXCA 2L4AA 1V4RA 1LEBA 3HUGA 4L9TA 4CZZA 4ZH4F 3KEOA 2JSCA 4A0YA 1J5YA 3WTXC 3E5QA 2K02A 2XAHA 3LQQA 3EQLF 5D4SA 1IXRC 4S05A 1R1UA 4ASNA 2EA2A 4ZZLA 1ZLKA 2DQLA 1TQMA 1SFXA 4BHCA 4KIGA 2WV0A 5L3FA 1KQ0A 1SMYF 4ZYEA 4U0YA 2XKPA 4UNOA 1PUEE 1BIBA 1STZA 3QU3A 2KIMA 3HHGA 1XCBA 4ENNA 2YU3A 4KNYA 1ZHFA 1XSVA 2TDXA 3MEXA 4KT5C 3WODF 5E17F 3JW4A 1USTA 1DDNA 3HOTA 4MHGA 3R60A 1YW9A 2HDCA 1Q1HA 2JRTA 6PAXA 3JTGA 1B1BA 2YR2A 4UVAA 1MJ9A 3C7JA 3J7AO 4XSZF 3F72A 4L18B 3E5XA 4G9YA 2MLGA 5JVTA 3GZ5A 3LAJA 1S7OA 4HLXA 3N97A 1NHAA 2PEXA 1GHCA 4MEXF 1IUYA 3ZP5A 2W25A 1R7JA 2VN2A 1ZH5A 3V8JA 2ZMEA 5HS8A 4RGUA 1J7KA 5BS6A 5E1ZB 3O2PE 4KDPA 1P92A 3BJAA 4OMYA 4ZYDA 1O57A 2O03A 5ICCA 3EETA 3BPXA 1BJAA 3O3KA 5J6XA 1GXQA 2MH9A 1D3YA 5ICGA 1RUOA 3FMSA 4ENKA 1FSHA 2FE3A 2MD5A 4RGRA 1G3TA 1ULYA 2LNBA 3HTSB 1J59A 2GAUA 3T8RA 2A69F 3LQRA 1KGSA 2HS5A 1HXDA 2QQ9A 2P6TA 4IRGA 3P7NA 2K7LA 2OAZA 4O3MA 2O0YA 3BWGA 1OMIA 5HLIA 1I27A 4B8XA 4GGGA 4YFKF 2XUBA 1W4MA 2IT0A 5CVUA 3AAFA 4A12A 1FBQA 3WU0A 2UXNA 1S3JA 2JZYA 1B59A 4AIJA 4EGYA 1K78B 2VBXA 2DI3A 2KKOA 2BE5F 1LNWA 1IRGA 3JAMZ 2A5YB 1WRJA 4CDGA 4EJOA 2F5FA 2FSWA 2HWVA 3QPTA 3ZN0A 2PJPA 1IN6A 4P5OA 3DKWA 3FX3A 1OYYA 3J80Z 3KFWX 5D6FA 1MZBA 1YFHA 2VE9A 1FOKA 1XGNA 1GXPA 2GA1A 1JHFA 2H6CA 5CVRA 1H9GA 5BQTA 4Y17A 1XD7A 2XIGA 4XRFA 2D45A 2O6GE 1C0WA 2PQ8A 1XMAA 1YS6A 5LEJA 2CYYA 3I59B 1LJ9A 1QNTA 1P6RA 1H9TA 3Q9VA 5DD4A 1OPCA 1O3TA 2VOPA 1AOYA 4R8HA 1P2FA 1F4KA 2HZTA 1QQIA 5A2QZ 1IF1A 3R0AA 4L5JA 3EUHA 2RGVA 5D6EA 4IRHA 1QZYA 5FD6A 3Q9SA 3SQNA 2Q0OA 1OKRA 2HYFA 2FMLA 1YW8A 2M5WA 4CGZA 3MAJA 4Q47A 1U8RA 2FBKA 2A6EF 4Y13A 1EH6A 3ECOA 3FXUA 5TRDA 2NAZA 4CICA 3HSFA 4PCQA 2VONA 1BM9A 5D5WB 1ZARA 1FLIA 1S8NA 3P9IA 2AXLA 5LGNA 3MZHA 1OYWA 4M9XA 3L00A 4M71A 5HLGA 3GF2A 1ZRDA 5ED4A 1E2XA 3ZMTA 4UV8A 4R1HA 1XGSA 4HYEA 2QBYB 2KIFA 5DD8A 3GUDA 1F9NA 1K79A 4D0PA 2STTA 4G6DA 5F64A 1TNTA 2VBYA 1R22A 2W85A 4ETSA 1ZRFA 1Z05A 3ZPLA 5ICFA 2XAQA 5CVVA 3WTUC 3HRMA 4UHTA 2PLYA 3KETA 4LMYA 1FX7A 3IWFA 3KP4A 3FXRA 4ZYGA 1S7AA 1Z9CA 4EJTA 3CO6C 3TKYA 2PBIA 2BV6A 5ILVA 3TOAA 1JXSA 1B9MA 1DUXC 1HKSA 3RKYA 4ESJA 2YX4A 5AIQA 2EV0A 2EFPA 1HW1A 3ABUA 3VOEA 2XRNA 4YFXF 2RN7A 2HQNA 2DTRA 5ILUA 4LGWA 5L3CA 2VOOA 1BI2A 1O7LA 4Q48A 3ULQB 2GQQA 4RB1A 4E70A 2RKHA 2XAJA 2GXBA 3HIFA 4DNCA 2QQBA 2E7WA 2XGXA 4LJZF 1MD0A 2FXAA 4LLNA 4RGXA 3BDDA 1MJAA 3DP7A 1E17A 1EV7A 4IF4A 2H94A 3LAPA 4EQQA 2RDPA 4WCGA 1I1GA 3KZYA 3D0SA 4EJUA 3C18A 4GXOA 3V7CA 3HSEA 2PI0A 1B4AA 2ETHA 1TTYA 2YX7A 3CUQC 3NQOA 2XASA 2Z33A 4P9UA 1U5TC 3PQJA 4OIOF 2NNNA 4BH9A 1TW2A 2KJCA 3O6BB 1DP7P 4EV0A 1R1VA 1HKQA 4Y15A 3PFIA 2XAGA 4M6XA 1Z7UA 2VODA 4M9ZA 4OIRF 3WTSC 5H20A 5CJ9A 4RB0A 3HRTA 4BNCA 1L3LA 3WTZA 1EH7A 4R79A 3EDPA 2V1XA 4HX4A 5CLSA 4U0WA 1ZLJA 3U2RA 4I01A 2QM3A 3WGHA 2ACJA 3LWFA 1ON1A 1YTYA 3H92A 2HQRA 1U3EM 2HOEA 2CG4A 2GA2A 3CJNA 1QPMA 2M87A 4LB6B 1FT9A 2STWA 2OQRA 2FQ3A 1MJBA 4G7ZF 4YIIA 5FO5A 4KIBA 1YG2A 2HTSA 3F23A 4HV5A 3FMQA 3GFLA 1IN5A 3E6MA 5D8KB 2A6HF 3ZMZA 2HGCA 3DV8A 3VODA 2HFHA 1HSJA 3NRVA 3JSOA 4QLCU 1HQCA 2ZO4A 2A61A 2ZKZA 4UV9A 4ENMA 4LFUA 4RB2C 4KICA 2K86A 4HF1A 1UHWA 5LHIA 2GXGA 2Y75A 3F8FA 3RKWA 1RZ4A 2CFXA 3CO7C 4CO8A 1XGOA 2EJRA 3TOBA 3TO7A 3F8BA 1U2WA 2HKOA 2QUFA 5ILSA 3MFKA 4EM0B 3ZMSA 2OU2A 4UVCA 4YIFA 2DLLA 2OA4A 3DXJF 2VC0A 4G8XA 3D5LA 3GWZA 5E1XA 3ABTA 2D1VA 4O5VA 4G7HF 3CUQB 1S29A 4A6EA 1U5TB 3QAHA 1K78A 1SD5A 5F6FA 2HTJA 3KLOA 4PGHA 3V7RA 3REOA 2PN6A 1XSXA 2UXXA 5KK1A 3GW2A 5HVQC 2RV8A 3L2CA 2D2WA 2KIUA 3FZVA 3MWMA 3ZQ7A 3U9GA 1BI1A 4K2EA 2HEOA 3ZMDA 1CF7A 4ZZDA 4L9VA 2QLZA 2ZXJA 1D8KA 4NHJA 1T39A 5CVJA 2Z9OA 1T0FA 5CYVA 1PDNC 5AONA 3QOPA 5LGTA 2XAFA 2WTEA 5LLQA 3BOQA 4G94A 3VB2A 1XB4A 5E18F 2QQAA 1KU3A 1FY7A 4AVPA 1I1SA 4HLYA 5FFXA 2BEOA 5TJJA 2V1DA 2DW4A 4ON0A 3I58A 4WX9A 3ECHA 2LSOA 2XROA 4A2UA 2HYGD 3S2WA 1G4DA 2VT3A 3BPVA 1BBYA 4Q4ZF 5J8FA 3M8EA 4G6QA 3EYIA 1FSEA 4N9IA 2V1UA 2L01A 2VBWA 2DPUA 2GWRA 2L54A 3FM3A 3E6BA 4IXAA 1FBUA 4IRIA 5E20A 4BHBA 1PP8F 2ISYA 4HAMA 3WTTC 2EA4A 4OU0A 5JHUA 5FFZA 1MDMA 1OR7A 4MQ9F 2QYOA 4KYWA 3RJPA 4KFCA 2VC1A 3K1NA 2M45A 3KP3A 4LK0F 4RB3C 1SD7A 1G6NA 3KP2A 4AWXB 1T2KA 1KU9A 2ZNYA 3VEPA 2IVMA 2R3SA 2OZUA 2DU9A 2OD5A 3B73A 1IN4A 1TW3A 1IRFA 2ZFWA 3QP6A 1O7FA 1DPRA 2LDUA 1A04A 3RIRA 5HDGA 2BYVE 1R5GA 3K9TA 5E1WA 1U6GA 1YYVA 2O3FA 4HX8A 1LDDA 3FWEA 2L3DA 1WQ2A 1B9NA 1XN7A 2A68F 2Q8KA 1XDSA 2P8TA 1T6SA 4KUMA 3QU6A 2DPDA 1UCRA 1WWXA 3ROUA 3ZMVA 3GYHX 2P5KA 3V8KA 2Z5UA 3F21A 1J2XA 3H3UA 4IVNA 3L9FA 3JAMK 3QP5A 3I53A 2X0LA 2PMUA 5D8LB 4OIPF 3NEUA 3BZ6A 4HDUA 3F3XA 2GIVA 2YSRA 3J80K 2V9VA 5ICEA 4KN4X 5FLXZ 1K6OA 5L3DA 3G3ZA 2IA1A 4M73A 2QWWA 1Z6TA 2RVCA 3RPQA 1QO0D 4MEYF 2CO5A 4O6JA 3RKXA 4L0YB 5FGMA 5DEQA 3WGGA 2ESNA 2HR3A 4OOIA 1FNNA 4U7DA 1ON2A 5LBQA 1J9IA 2DT5A 1LVAA 1UHMA 3QPHA 2BGCA 2FBIA 1W7PB 4RAZA 2L4MA 1KYWA 3BP8A 1R5HA 5A2QK 5DCMA 3WU1B 4WXCA 3SZTA 3WGIA 4WK8F 3FHZA 3F6OA 1BC8C 3IRRA 1S6LA 2IJLA 1AWCA 2UWMA 2A07F 1FZPB 2XHKA 2K4BA 1V3FA 3COAC 1R1TA 3FMRA 2ZCWA 4BYYA 2M30A 1J0RA 3BJOA 4A0XA 4I09A 2ISZA 4HA8A 3J81Z 1ZG5A 5K5QA 2E1CA 3KP7A 3G73A 4WWCA 2Y48A 4EM2A 2IW5A 3IKTA 3KEQA 2MC3A 4G7OF 3I4PA 4IJAA 3JSPA 2GZWA 2G9WA 1J75A 2XVCA 1ZRCA 1FP2A 4ESBA 4HW0A 4A5MA 2IRFG 4NQWA 4AD9A 4L5IA 2COMA 1WKMA 1KA8A 3T8TA 2QZ8A 3PQKA 1ZAOA 4S04A 1IAWA 2LF8A 3CUQA 4NB5A 1U5TA 1XDUA 2FU4A 3P9CA 3KE2A 1O3RA 2R7DA 4RGSA 3IL2A 4CXFA 3T0YA 1P4AA 3CDHA 1LEAA 2EB7A 4PZJA 1VTNC 2HKXA 4GCVA 2FMYA 1Y0UA 5IT9Z 1LDKB 4BAYA 4U88A 5KVRA 4GYIA 4JK1X 2OQGA 2QENA 3LSTA 3V7SA 5LGUA 3N4MA 3M1EA 5BOXA 1MKMA 2EWNA 3SFZA 4RS8A 2DK5A 1BIAA 4P96A 3R4KA 3ML6A 5D5VB 4P55A 1TBXA 2RC4A 3HHHA 4LB5A 4KMUX 5LHHA 4EMSA 3K0LA 2JTVA 4LK1F 3OV8A 3TGNA 2MBFA 1TQPA 3HYIA 5EEGA 3KP6A 1K7AA 1QGPA 3IKVA 2DFIA 4HQEA 3KLNA 5D4RA 4WXHA 5LHGA 4GO1A 1RNLA 2V79A 4WF2A 4MTEA 3ERED 2WWYA 4AIHA 3L7WA 3RYPA 1RIOH 1FWZA 4MQVA 5K5OA 1I5ZA 1LB2A 1Z1DA 5JFRA 1ZN2A 4XBFA 3KZZA 2ESHA 3E6CC 3ZN1A 1IXSB 2FNPA 4MNUA 1HBXG 3ISPA 3MCZA 4EJWA 3C1DA 3F8MA 5LRSA 3RTRA 3GFJA 2K27A 4M72A 3RI4A 2CQKA 2MA3A 4KN7X 3HSRA 1ODDA 3I64A 4LLGF 1YW7A 5DV5A 4IHTA 4LLLA 2VE8A 3CUOA 3M8FA 1BC7C 4MGRA 5L3BA 1KYZA 3FXQA 5J8CA 1P4WA 3ELKA 3ZMUA 2F2EA 1D5VA 3M7GA 5IT3A 4FHTA 2JT1A 3U1DA 2CWEA 5L3EA 1TNSA 2PMHA 4HZFA 2D1HA 4LG0B 1FYMA 4A5NA 5EEHA 4I2OA 3FF5A 3QRFF 3DPLC 3K69A 4BHPA 2H27A 3H3ZA 1HW5A 3KP5A 1TLHB 4FT8A 2VBZA 5BPIA 4M9SA 4EVIA 3LFKA 3I59A 2CGPA 1XGMA 4XLPF 4CHUA 2F5CA 4IPAA 1LQ1A 4JQFA 1T38A 2YPRA 1Z91A 4H0EA 2EFWA 4HQMA 3TDZC 2JPBA 1OYIA 4I02A 3B02A 3RDIA 1X3UA 2P5VA 4HDVA 4HX7A 3I71A 2EFQA 2PG4A 2M1BA 2EV6A 1USSA 2L02A 1KQ8A 4L9JA 2FOKA 1SAXA 3MQ0A 5LEKA 3W6JB 1F5TA 5HLHA 1FC3A 1KU7A 1ZYRF 1EH8A 4A6DA 1FYKA 3W6KB 5K1YA 5H6QA 1SFUA 4L0ZB 2H09A 1T98A 4HF2A 3GZ6A 1KQ9A 3M9AA 2E7XA 1MGTA 5BMZA 2QBYA 2MLKA 1W7PA 4M6YA 3I5UA 5E8GA 3K1PA 1ZG1A 3V8LA 2J5PA 2W24A 2V6CA 3KCCA 2Z3YA 3JTHA 1YQAA 2EK5A 4FX4A 3E97A 5DUKA 2W57A 4PDKA 2CSOA
chains in the Genus database with same CATH superfamily
1TT5B 3GX4X 2WC2A 1ENHA 3KEYA 1BW6A 4L9NA 2P5LC 4HF0A 2R7WA 3BR0A 5M5WJ 2E35A 1UZCA 3E6DA 2L9NA 2BHYA 3BROA 4BJ5C 2BY1A 5EZHA 1O3SA 3R61A 1OCZH 3F0CA 4N9HA 1XX5A 2CFOA 3CTAA 5D5UB 1S5LC 3GCMA 3I0TA 4HOBA 2VQCA 1F1ZA 5LRRA 3WE2A 1RUNA 3K4JA 2M9HA 3Q0VA 2F4OB 3B6CA 4FX0A 4CCLA 4HBLA 4I0AA 2L9VA 3F8NA 4DBQA 2C6YA 3SZPA 2DN0A 4TV7A 4U7BA 1HLVA 2JPCA 3W2WA 2F4MB 4ENJA 4I98B 1GT0C 4DIQA 2E5NA 3OY9A 2OZ6A 3K1MA 3OYGA 4UVBA 3E5UA 3WTWC 1TQIA 2K40A 2P6SA 1CF7B 4W1UA 3W3CA 3BR5A 3T5XA 3BG6A 1W5SA 3WG7H 3S2HJ 2X48A 2K4JA 4C2TA 1R36A 1D8JA 1IN7A 2UZKA 3GFIA 3HRUA 2HDDA 3CF5F 2M8EA 3F8CA 5H6RA 4EGZA 4IL6C 1YO5C 4HV6A 4EM1A 2ZMEB 3SXYA 5F1RA 4A3MJ 2XV4S 1HW2A 3DEUA 1VQLI 2Z2SB 3LA3A 2ZB9A 1P4XA 2LKPA 3O8HA 4C3HJ 5HOOA 4RLQA 1DPUA 3CF2A 2K9QA 2J5OA 1R6RA 4BKXA 2LD5A 2FQ4A 4CCMA 1JHHA 3FBNB 2LKXA 2NRAC 1X3ZB 1HC8A 2HOTA 3HEFA 2E1NA 4DZPA 4DQ2A 4CYDA 3ABLH 3IWZA 2TRTA 3K4LA 3WTVC 1O3QA 2P7VB 1WJ5A 2FA5A 3GTGJ 5CVIA 1IW7F 4AYBA 3K2AA 3E3VA 3JRDA 3S2DJ 1BN5A 3ZOBA 4B09A 4MTDA 3IC7A 1BL0A 4UUVA 3UKGA 3WU2C 2B9SA 1BI3A 3WHBA 1YJ9I 3I54A 1K83J 4AIKA 3S1NJ 4M3FA 2CUFA 3S3NA 2EV5A 4PK4A 3PL8A 2RNJA 1YE9A 1ZREA 1R58A 1G3YA 2K3FA 1LFUP 4OIQF 2ELHA 3TQNA 2L0KA 3VFZA 2CRGA 2ZXIA 4UY8I 1LDJA 2EZHA 1FMVA 1B6AA 1ZG3A 2F5EA 2LVSA 3JRGA 3BQYA 4PGGA 3C2BA 4JX5A 4OMZA 5FD5A 3HGYA 3TO6A 3BC8A 2DJIA 3V4GA 5DUIA 3JRCA 2IA2A 4M74A 3DTIA 3OYKA 5DDGA 3HOZJ 2FF4A 1W7PD 1SFEA 4AIDA 1UG2A 3HOSA 2R4GA 2OUMA 5D5XB 1SD4A 1U0JA 2LP0A 5DM6F 1MDMB 2FRHA 2AS5F 4RAYA 3BR2A 5KAFC 2V1NA 2VT2A 3GO5A 2EPFA 3H1CA 4M3EA 3S3OA 1X1BA 2G7HA 3HRSA 1VQPI 4LD5A 3QYEA 1VQ9I 2R7QA 3OIQA 1HKTA 5L3GA 3BT9A 1HSTA 3WE3A 3LL7A 2CV1A 1XCVA 3BQZA 3ASOH 3HXLA 2XPWA 4OINF 3R6SA 1ZGAA 2L7KA 1Y0NA 1D0ZA 3LSRA 3GTPJ 2NYXA 2Y9YA 5IP9J 2LR8A 1REPC 4BQAA 1J09A 2P4WA 2PFBA 4XSXF 1H0MA 1G8XA 2DA7A 4XIDA 3FM5A 5FLXK 3TP0A 3A01A 3IRQA 1GVDA 2DMUA 2DK8A 3OYIA 1BI0A 4XLNF 3F6VA 3GFMA 3OIOA 1APLC 3MKYB 1ZR2A 2NVTJ 5BPDA 3BJ6A 4ESFA 5DS9A 3TBIA 2DQRA 2DO7A 3K4NA 1I3AA 2Q2EA 3WG9A 4KA4A 3WTYC 1K4TA 3K6GA 3DPTA 3LSPA 2JVGA 1IDZA 1GVJA 4ZJZA 2LRDA 4N0BA 2V9KA 5AIPA 1YS7A 2F5DA 3AG4H 1QZZA 2ECCA 1ZK8A 1WSUA 1IRXA 4HNTA 2FBHA 2EFNA 1ONVA 2GBYA 2Y0MA 3CCYA 3KIOA 2RQPA 3KPHA 1MMAA 2B0LA 2WB1N 4P9FA 5J4VA 3I4MJ 3TDUC 2NS0A 2E2HJ 3VYUB 3K4MA 4I7HA 2FNAA 1VZ0A 2EFOA 1W0UA 4DW6A 4JX6A 2JUCA 1WI9A 1YRNB 5ERIA 3DF8A 2ADUA 4MFEA 2QVOA 1B72B 3OL4A 4Z2YA 2KIQA 4PSWA 1FBSA 3TL4X 2HU9A 1QA6A 4XL9A 2MH2A 1G3WA 2Z99A 2ID6A 2OBPA 2X4HA 2ZJ2A 3NARA 5DCFA 3G71I 4LITA 2IPQX 2G7UA 2XKOA 4UXNA 2KHMA 2O8XA 4J19A 2R5YB 3VSLA 1QBJA 4KIFA 4ZYHA 2IA0A 2R92J 2CUJA 1RESA 4UB8C 5M3MJ 2VXZA 2P7CB 2GOXB 1SMTA 2ZNZA 2B63J 2VJ4A 3HOXJ 2ZBKA 2DA3A 3H3VK 1L0OC 1JUSA 2KJBA 4ANJA 1GV2A 2VXDA 4YG2F 2O61A 1N25A 1Z0XA 1YJNI 4X6AJ 1DGRM 2A3SA 2OCCH 3SEZA 3Q0UA 1JE8A 1IO2A 3OOPA 5DYMA 2NVXJ 4U0VA 3F9KA 2V7FA 2CW0F 1T08B 3BR6A 1FYLA 1T33A 5GAGJ 3J81K 2NNYA 2KZGA 4Q5SF 1OLTA 1I6HJ 2VKEA 3GVAA 1UFMA 1BOAA 4IHXA 3HOUJ 5JVGF 3RYRA 2DFFA 2L2OA 1FPQA 3KYCB 3LA7A 1QRYA 5HDKA 3MMYB 1IN8A 1V54H 2ZXWH 3HJEA 3F22A 1GLNA 1CGPA 3C3WA 2RNGA 2DAOA 3GEZA 5E3MA 3FXKA 3H0GJ 1RRJA 3GLXA 4E7IA 5HS7A 1Z3YA 5JR3A 4WXDA 3SHFA 4F7ZA 1HCRA 2VKHA 1U78A 3TO9A 1R00A 2M0CA 2IP2A 4XICA 1DGWY 4GYGA 1V55H 4BY7J 3GXOA 4JBAA 1KONA 1R23A 3EYYA 3IHUA 1RI7A 4XNFA 2XGEA 4DOZA 4XR6A 3HPHA 1YIOA 4BXUA 4LG0A 1V5FA 5JI6A 1W5TA 1JKQC 2BBYA 2R0QC 1KU2A 2K3PA 1I6XA 5J1YA 5E8IA 5K5RA 3HOWJ 5DCMB 2W84A 2H8RA 1XSDA 1NH3A 1JJ6C 1MMDA 1XMKA 4U87A 3CCRI 2Y2ZA 5F08A 3LA2A 2LF7A 3L09A 3HTUA 5FLMJ 1FP1D 3DQVC 5HDNA 1PP7U 3A0BC 3HC7A 1Y1VJ 2V26A 3MZYA 4IHSA 2FEZA 5FB2A 1SD6A 3CLOA 2CUZA 2MABA 5K7HA 1YLFA 1G3SA 3R0JA 2KRFA 1D1AA 2M3AA 3K4BA 1EA3A 3D5SC 1R49A 4DBRA 2MFZA 4YFNF 1ZGJA 4Y33A 1MNDA 3K2ZA 4G6TB 3FXLA 3Q5FA 1P7JA 3P9KA 4AUXA 3T1BA 2XB5A 2DCEA 4A0ZA 1JTYA 1IZ1A 1SVLA 2M2EA 4ITVA 5HS9A 2X1CA 2ZXHA 4EJVA 2H6BA 4KMFA 4I0BA 5IT9K 4QWQA 1Z6RA 3RPUA 3DFGA 1JGSA 2R7FA 1UB9A 2BY2A 2XSJC 2F6CA 3BY6A 3AG2H 4A93J 2DBBA 1AKHB 1IXCA 2L4AA 4XONA 2R5ZA 1V4RA 4NC6A 3S14J 1A5JA 1LEBA 3HUGA 4L9TA 4CZZA 2WY7Q 4ZH4F 3KEOA 1MSEC 2JSCA 2WAEA 4A0YA 1J5YA 2MD0A 3WTXC 1QVUA 1YITI 2XC7A 1ZKGA 3GTOJ 3E5QA 2K02A 1UG0A 2XAHA 3IAM2 3CESA 1AHDP 2EIKH 2KT0A 3A03A 3LQQA 3ERMA 3EQLF 3ZQHA 2N8GA 5D4SA 1X4OA 1IXRC 2VJJA 4S05A 1R1UA 1K6YA 1JI8A 4ASNA 2EA2A 3A0HC 4ZZLA 1ZLKA 4NQWB 4II2A 2DQLA 1TQMA 1WH7A 1WGXA 2LKSA 1SFXA 3EPZA 4NNJA 5F04A 4BHCA 4UUSB 4KIGA 1MMSA 2WV0A 5L3FA 1KQ0A 1SMYF 1WJDA 3V42A 4ZYEA 3BZCA 4U0YA 2XKPA 1B8IB 5KNLA 4UNOA 1Y8QB 3ONQA 1HDPA 5E3LA 1PUEE 1BIBA 1STZA 3QU3A 4BUPA 3PNYA 4RAGA 5EEAA 5GTHC 5EG0B 2R7UA 3SJMA 3Q0WA 2KIMA 3MD2A 3HHGA 3ZXSA 1XCBA 3KX2A 4ENNA 2COBA 2XGDA 4QIWN 2YU3A 4KNYA 1ZHFA 1Y6IA 1TL8A 1ETVA 1XSVA 2KMUA 1ZQ3P 1IC8A 2TDXA 3MEXA 3LFUA 4QPOA 4KT5C 3WODF 3LSKA 4GRIA 2CQXA 5E17F 1V5GA 1BR2A 2QSGX 1Y8RB 2GOMA 3JW4A 1USTA 1DDNA 2EIMH 4UB6C 3HOTA 3RQIA 4MHGA 3CDLA 3R60A 2HYJA 2OCEA 2Y30A 1FIAA 1YW9A 3G1MA 4A3CJ 3NAUA 2HDCA 1Q1HA 1S7EA 2JRTA 3SDGA 6PAXA 2WADA 1Y39A 2DA1A 3ZQQA 2ELJA 3FISA 3AG1H 3JTGA 1B1BA 2KDZA 2LY1A 2YR2A 1PVEA 4UVAA 1MJ9A 3C7JA 4DYQA 3J7AO 2ME0A 4XSZF 3F72A 4L18B 3DLAA 3E5XA 4G9YA 4C2MJ 2MLGA 1SFOJ 5JVTA 1T0FC 1U9NA 2PMZA 3GZ5A 3I9V2 4DJAA 4Z6YA 3LAJA 3GTLJ 1FJLA 2BVMA 1S7OA 4HLXA 1A36A 3N97A 4BQOA 1NHAA 2PEXA 2V4JC 3OL3A 2JA6J 1GHCA 2Y0SA 5GPCA 5C44J 4XQFA 3N05A 4MEXF 1IUYA 3ZP5A 2W25A 1R7JA 2VN2A 2XAUA 1ZH5A 3V8JA 2ZMEA 5HS8A 4RGUA 3TMOA 3RCOA 1J7KA 3O8GA 5BS6A 2A05A 3LSJA 4JYKA 1OQYA 3O2PE 5E1ZB 4KDPA 1P92A 2ME6A 5JLXA 3BJAA 1WI3A 4OMYA 2LC2A 1MMNA 4ZYDA 5KAIC 1O57A 2O03A 5ICCA 3EETA 3BPXA 3RPUD 4Y7NJ 2VQGA 3DKXA 4HEA2 4PJMA 3M07A 1BJAA 3O3KA 1VQ7I 1FEXA 2DTZA 5J6XA 1IUFA 1GXQA 2MH9A 1D3YA 5ICGA 4JX4A 4B1RA 1IDYA 4BGDA 1RUOA 2BW3B 3FMSA 3ZQGA 2K9SA 1VQNI 4ENKA 1FSHA 3L2UA 4E7KA 3PUBA 2WAQN 2FE3A 2MD5A 4RGRA 2UV1A 1G3TA 2ZJPF 1ULYA 2BXYA 2DMQA 2LNBA 3HTSB 4LOCA 2JA5J 1J59A 2GAUA 3K4KA 1ACIA 1A6IA 3IUOA 3T8RA 2A69F 2ZJQF 2E34A 4E6KG 3LQRA 3DLLF 1KGSA 2EZKA 2HS5A 1HXDA 1XPXA 1LPQA 3DTEA 2QQ9A 2I5UA 2GXAA 2P6TA 4ZTFA 3L1PA 4CSWA 2BOLA 2DOFA 1D1BA 2PX9A 4IRGA 4FE7A 2I8DA 1AA7A 3P7NA 4PSXA 2VLAA 3PSIA 2K7LA 2OAZA 4RLFA 4NUBA 4CH7A 1FMWA 3HL2A 4O3MA 3K70C 4BACA 2O0YA 4C30A 4FISA 3BWGA 1JKPC 4GDFA 1OMIA 1P9QC 2DFEA 5HLIA 1I27A 3UNGC 2M4KA 4B8XA 2OC6A 3C2GA 4GGGA 4YFKF 2XUBA 2ZC2A 2EINH 1W4MA 3ABMH 2IT0A 5CVUA 3AAFA 4MFDA 3CD6I 4A12A 1FBQA 1R5ID 3CQZJ 3WU0A 2UXNA 1S3JA 2JZYA 2M0MA 3PUFA 1B59A 1LUJB 2L7MP 2PJRA 4AIJA 2DDAA 5FKKA 4EGYA 1K78B 1QHGA 4IX7A 2VBXA 2DI3A 2KKOA 4YEJA 3W6VA 2Y9ZA 2JA8J 2BE5F 1LNWA 1IRGA 3JAMZ 2A5YB 1WRJA 2RQQA 3CCUI 4IOAF 4CDGA 4EJOA 2F5FA 3LSMA 2FSWA 2HWVA 3QPTA 3ZN0A 2V9PA 2PJPA 4M6VA 1IN6A 1VFCA 4I99C 2GM4A 4P5OA 2BXZA 2CQNA 2VI6A 3DKWA 3FX3A 3S32A 4AVZA 1OYYA 3J80Z 3KFWX 1YX3A 2AXTC 4RDUA 1BOBA 5D6FA 1MZBA 1YFHA 5IYBJ 2VE9A 1FOKA 1N78A 1MBGA 2O7OA 1XGNA 1GXPA 2GA1A 1JHFA 2H6CA 5CVRA 1H9GA 5BQTA 3VYRB 4Y17A 2NOJB 2DA4A 1XD7A 1YI2I 4IHYA 3RZOJ 2XIGA 4XRFA 3OIPA 2D45A 3S15J 2W00A 2O6GE 4XRMA 3HKZN 1ZR4A 1C0WA 2PQ8A 1YRNA 2H1KA 1XMAA 1YS6A 2JQ7A 4BXFA 5LEJA 2E2JJ 2CYYA 3I59B 1LJ9A 1QNTA 3OS1A 1P6RA 4Y3OA 1H9TA 2DA6A 2QKLB 3Q9VA 4NC7A 5DD4A 1OPCA 4XKWA 1O3TA 2VOPA 3GLLA 3X2QH 1X58A 1AOYA 4R8HA 1P2FA 1F4KA 3M1CA 2TCTA 2HZTA 4KJZA 1QQIA 3H36A 3HM5A 3Q3SA 5A2QZ 1IF1A 1T8IA 3R0AA 3W2VA 2IAIA 4L5JA 2KRCA 3EUHA 2RGVA 1ETQA 4IRHA 5D6EA 3VWBA 1QZYA 3M8JA 5FD6A 3Q9SA 2QQ8A 5FKLA 2FD5A 4BJTA 4XM3A 3SQNA 2P81A 2Q0OA 1OKRA 2HYFA 3FHNA 2MGQA 2FMLA 2LH9A 3H9GA 1G2HA 1YW8A 2M5WA 4CGZA 3MAJA 4Q47A 2MG4A 1DU6A 1HA8A 4XORA 5CQGA 1U8RA 2FBKA 1RKTA 1YIJI 2A6EF 3PFYA 2QA4I 1ZGWA 1HF0A 4Y13A 3A02A 1EH6A 3ECOA 3FXUA 4B4CA 5TRDA 2NAZA 3AFHA 4CICA 3HSFA 4PCQA 2VONA 1BM9A 3K4CA 5D5WB 1ZARA 1MIJA 1FLIA 1S8NA 3K10A 3P9IA 5J3LA 2AXLA 2LK2A 1I39A 2E1MC 2HZDA 4V2GA 3IH4A 4BJ6C 5LGNA 1JGGA 3MZHA 1OYWA 4M9XA 3L00A 3S17J 4M71A 5HLGA 3GF2A 1ZRDA 3S16J 4ZDOA 3I4NJ 2CQ7A 4BL0B 2XGCA 3UR3C 4B43A 5ED4A 1E2XA 3ZMTA 5F0HA 5FKOA 4UV8A 5CPRB 2HNHA 1Z7LA 4R1HA 1X1AA 2FUG2 5J40A 1XGSA 4HYEA 4RAFA 2QBYB 5J1RA 2FJ1A 2XF5A 2WBMA 2KIFA 5DD8A 1W36C 3SEQA 5J1UA 3GUDA 3GTJJ 1F9NA 1K79A 4D0PA 4F91B 2STTA 4G6DA 5F64A 5TISC 1TNTA 2VBYA 1ETWA 1R22A 2W85A 4ETSA 1ZRFA 1MH3A 3E0JB 1Z05A 3ZPLA 2LREA 1FTTA 2IS6A 5ICFA 3SDBA 4XRSG 3OYHA 2XAQA 5CVVA 3WTUC 3HRMA 4UHTA 2PLYA 3KETA 4LMYA 1K4SA 2ELKA 1FX7A 2OV7A 3IWFA 4C2UA 3KP4A 3FXRA 3G2BA 4ZYGA 4II3A 1S7AA 1Z9CA 4EJTA 3CO6C 1LKXA 3TKYA 2PBIA 2BV6A 4X1EA 2K9NA 5ILVA 4XKCA 3TOAA 3G6EI 5HODA 1JXSA 4P1WA 2WAFA 1B9MA 1OCCH 4CYCB 3L2RA 4AYBN 1DUXC 2L7FP 1HKSA 3DBLB 1TWCJ 3OWTA 3RKYA 4ESJA 2YX4A 5AIQA 2EV0A 4FASD 2EFPA 2QCOA 4B48A 1HW1A 3ABUA 2EILH 3VOEA 3OYAA 2D5VA 2XRNA 4YFXF 2RN7A 2HQNA 2DTRA 2OPTA 3BTIA 4LGWA 5L3CA 5ILUA 4HSTA 2VOOA 1BI2A 3U21A 1O7LA 4Q48A 4IQ4A 3ULQB 1MBHA 1WPKA 4EEFG 4BXXJ 2GQQA 3MKLA 5TGTA 4RB1A 3K7AJ 1MNMC 2E36A 2DYSH 1R71A 2BY3A 4E70A 2RKHA 2LBFA 2XAJA 2GXBA 3HIFA 4DNCA 1JT0A 2QQBA 4EATA 1E0EA 2R7SA 2LY9A 1X2MA 2E7WA 5CKTA 2XGXA 2MW8A 4LJZF 1MD0A 1PUFB 2CS3A 2FXAA 4IKFA 4LLNA 4XOTA 4FETA 4RGXA 3BDDA 1MJAA 2K85A 3DP7A 1QZEA 2HVSA 1E17A 1EV7A 4IF4A 2H94A 3LAPA 4BE1A 1RKWA 4XKVA 4BEHB 4EQQA 1DQUA 2RDPA 4UUSA 4WCGA 1I1GA 3KZYA 3D0SA 1E3HA 1PJRA 4EJUA 3C18A 4GXOA 3OYFA 1B8IA 3DU6A 1QU3A 1FOXA 3V7CA 3ASNH 3HSEA 2PI0A 1B4AA 4I6ZA 2ETHA 2X6OA 1RR8C 1TTYA 5GAHJ 1EJ9A 4CCKA 2YX7A 3CUQC 3NQOA 2XASA 2Z33A 4P9UA 2HXOA 1U5TC 3PQJA 1OCTC 1R4NB 1MW7A 4OIOF 2NNNA 4BH9A 1TW2A 3JRIA 3RZDJ 4DZJA 1WH5A 4N4OB 2KJCA 3O6BB 4A3IJ 1JUPA 2DDBA 4OAYA 3PIPF 1DP7P 4EV0A 1R1VA 2RAEA 1HKQA 4C3JJ 4Y15A 3PO3J 3PFIA 2XAGA 4M6XA 4F55A 1Z7UA 1P7IA 2VODA 4M9ZA 4OIRF 1LFBA 2CV2A 3WTSC 3E1SA 2E1MB 3CP2A 1N75A 5H20A 5C3EJ 5CJ9A 2E19A 4RB0A 3HRTA 4BNCA 3VDXA 1L3LA 1WJCA 3C2HA 4XKBA 3WTZA 1GDTA 1EH7A 3HZJA 2M4GA 1M1EB 4R79A 2LG4A 1ZTRA 3EDPA 4XN0A 2V1XA 2EQRA 5C4XJ 4HX4A 3OS2A 5CLSA 1WFXA 4U0WA 1ZLJA 4ZDLA 3U2RA 4I01A 5FLVA 2QM3A 2E71A 3WGHA 2HVRA 1PYVA 2ACJA 3LWFA 1ON1A 1YTYA 1QVTA 1I3QJ 3H92A 1ZELA 2HQRA 5E3NA 1U3EM 4ABZA 2HOEA 2CG4A 3JRAA 2GA2A 1JKRC 3CJNA 2HOSA 1QPMA 2M87A 2M8GX 4LB6B 4QSHA 1FT9A 3BZKA 2R7TA 2STWA 1N77A 2OQRA 3A01B 2XF6A 2BZTA 2FQ3A 2KZVA 3G1LA 1MJBA 4G7ZF 2DODA 4YIIA 4H4KC 5FO5A 4KIBA 1YG2A 2HTSA 3F23A 4HV5A 1WVRA 2DOEA 3G1OA 3FMQA 1X3WB 5H2FC 1VI0A 1HOMA 2Q2EB 3GFLA 1IN5A 3E6MA 5D8KB 2A6HF 2JJ7A 3ZMZA 2HGCA 1WJFA 5F0CA 1VF9A 3DV8A 3OYMA 3KYDB 2MYSA 2HQAA 2YUSA 3VODA 2O8KA 1XC5A 2BW3A 1TWGJ 2HFHA 1HSJA 3NRVA 1WJEA 4ZYAA 3JSOA 4QLCU 1HQCA 2ZO4A 4E7HA 2A61A 2ZKZA 4UV9A 4ENMA 2CW7A 3OYLA 2EIJH 1ERDA 3FDYA 4LFUA 4RB2C 2H1LA 4KICA 2K86A 3TW6A 4L5EA 4HF1A 3LNQA 1UHWA 3CMEI 3J7ZI 1ORKA 1CQTA 4QPQA 5LHIA 2GXGA 3OYCA 4F3QA 3LMMA 2Y75A 5EGOB 3F8FA 3RKWA 1RZ4A 4Y52J 2CFXA 2ICWG 3CO7C 4CO8A 1XGOA 1NG7A 2H8WA 2EJRA 4B3AA 4QTRA 2IGMA 4IQJA 3TOBA 4PJ0C 3TO7A 3F8BA 1U2WA 5EJCA 2CQQA 2HKOA 2QUFA 5ILSA 1WJAA 3MFKA 1G59A 2WV1A 3BCAA 4EM0B 4MLOA 3ZMSA 2OU2A 2IGNA 1RR7A 3IH2A 3VYSB 4UVCA 2BVLA 4YIFA 4XLHA 2VB6A 2I10A 2DLLA 2OA4A 2ZFUA 3DXJF 2VC0A 4G8XA 2FOWA 1SANA 4CCOA 3D5LA 2G0EA 4BQNA 3GWZA 5E1XA 3ABTA 2D1VA 4O5VA 4G7HF 3ZQFA 3CUQB 1S29A 2DMNA 4A6EA 1U5TB 3QAHA 1K78A 2R7XA 2WAQA 1SD5A 5F6FA 1XG1A 4KT6A 2XRLA 2HTJA 1R9TJ 3KLOA 4PGHA 1I50J 3V7RA 3REOA 2L9SA 2PN6A 1XSXA 2R7VA 2UXXA 3IP4B 5KK1A 3GTKJ 3GW2A 4XOPA 1NTCA 5HVQC 2EZIA 2RV8A 3KZIC 5IP7J 3CCSI 3BTCA 5LD2C 1DP3A 2LLKA 3L2CA 2K9MA 3BR1A 2D2WA 3QPLA 2KIUA 3FZVA 3I56I 3MZ8A 3BTLA 3MWMA 4BBSJ 1YHQI 3ZQ7A 3U9GA 1BI1A 2VL8A 4K2EA 2HEOA 9ANTA 3ZMDA 1CF7A 4D5FA 4ZZDA 1MH4A 3SZGA 4L9VA 2QLZA 3HGGA 2ZXJA 1D8KA 4NHJA 3FXJA 4CA0A 1MBEA 2QSHX 1T39A 5CVJA 2Z9OA 3AL0C 1T0FA 4D9JA 3FKJA 5CYVA 3IAS2 1PDNC 5AONA 3QOPA 5LGTA 2XAFA 2WTEA 1IRZA 1X1CA 2ECBA 5LLQA 2ZMEC 3MKZA 1ITYA 3BOQA 3QYBA 4G94A 3VB2A 1XB4A 2P0WA 5E18F 2QQAA 1D0XA 1KU3A 3H9JA 1FY7A 2NXNB 3OSFA 4AVPA 2X9DA 5FRMA 1I1SA 1POGA 2VUMJ 4HLYA 5FFXA 2BEOA 3PNVA 2RREA 1YOVB 5TJJA 2V1DA 2DW4A 2F5VA 2VKDA 3I58A 4ON0A 1UMQA 2B7EA 4IOCF 4WX9A 3ECHA 3OYJA 3JRBA 3BG9A 2LSOA 2XROA 3QODA 4A2UA 2L7ZA 3FIWA 2HYGD 2LOOA 3H5NA 3S2WA 1G4DA 2VT3A 4NC8A 1TC3C 4F52A 2DMPA 3EUKL 4D5CA 4X0GA 2DA5A 4A3LJ 3BPVA 1BBYA 4Q4ZF 2R5ZB 1MMGA 5J8FA 3M8EA 3HUGB 4G6QA 3EYIA 1FSEA 4N9IA 4HRIA 2V1UA 2L01A 3JR9A 2VBWA 1X1PA 3FBIB 2DPUA 2WA0A 2GWRA 2L54A 3FM3A 3E6BA 2XSDC 4IXAA 1FBUA 3D1NI 4MO7A 1UHSA 4IRIA 1SFKA 1SVMA 5E20A 3VSKA 4BHBA 2XPVA 2VPRA 1PP8F 3OMYA 1NK3P 2ISYA 4HAMA 5J47A 3WTTC 2EA4A 4OU0A 5JHUA 5FFZA 1MDMA 3QYFA 3BG3A 1OR7A 5IP6A 2OTLI 4MQ9F 4IHWA 2QYOA 3I55I 4KYWA 3RJPA 3FXOA 2L5QA 4PFOA 4KFCA 2NS7A 2VC1A 3K1NA 2M45A 3I3LA 3KP3A 4LK0F 4M3BA 1VQOI 2PMZN 3IV5A 4RB3C 2W48A 3VYTB 3CMMA 5M5YJ 1SD7A 3S1RJ 1G6NA 4CCNA 3TP3A 3KP2A 4AWXB 3CJQB 2Y0SN 1T2KA 1MNEA 1KU9A 2ZNYA 2R7OA 5FKMA 3OYEA 1MSFC 4PJJA 3GTQJ 1Z77A 4E4HA 3VEPA 1HDDC 2IVMA 2QF7A 2R3SA 2OZUA 5FKNA 4YRVA 2DU9A 2OD5A 4J00A 4AM3A 2QKMB 3B73A 5FJ8J 1IN4A 1H8AC 3PO2J 4B3XA 4YIRX 1TW3A 1FTZA 1IRFA 5HNHA 3KYLA 2ZFWA 3MKWB 2GLOA 5JLWA 3QP6A 1O7FA 1DPRA 3H35A 2LDUA 5B66C 4UUTA 1A04A 1LVKA 4PFPA 3RIRA 1S72I 3NWTA 2E1OA 4E7SA 3OYNA 5HDGA 4CYCA 2BYVE 1R5GA 3K9TA 1VQ4I 2NVYJ 4BE0A 2X85A 1SC7A 2EBIA 5E1WA 1U6GA 1MBJA 3JCUC 1YYVA 3J7YJ 2K5CA 4C9YA 5KCMA 4PUSA 2O3FA 2QGUA 2JWTA 4HX8A 1WZ2A 3LOCA 1LDDA 3DEEA 1W0TA 4W97A 4IO9F 3FWEA 2L3DA 2F4IA 1B72A 1WQ2A 1B9NA 1XN7A 1AU7A 1W1WE 2A68F 3FXMA 2Q8KA 2O9LA 4D7NA 2CUEA 1EKEA 3DU5A 3AL0B 1XDSA 2P8TA 2M7AA 1T6SA 4KUMA 3QU6A 2R5YA 2DPDA 1UCRA 1WWXA 3ROUA 3ZMVA 3GYHX 2P5KA 3J7AY 3S8PA 1LE8B 3BG5A 3V8KA 3HOYJ 2Z5UA 3F21A 2XF7A 1J2XA 1PUFA 1Z67A 3H3UA 1R4MB 2KL4A 3HB9A 4IVNA 3CC2I 3ZCOA 2F48A 3L9FA 5EYRA 4KITB 3JAMK 3QP5A 3I53A 2X0LA 3L2WA 1D1CA 1UJ8A 2X6WA 2PMUA 2X6YA 2QSFX 4NBQA 3EUHC 4BEHA 5D8LB 2DA2A 1IJWC 4OIPF 3D5RC 3DWLE 3BZ6A 3NEUA 2KDOA 2LMDA 4HDUA 3F3XA 2GIVA 2YSRA 4CCJA 5IYCJ 3J80K 1Y56A 2V9VA 5ICEA 4KN4X 1BW5A 2WB1A 5FLXZ 1K6OA 5L3DA 1V5EA 3FK6A 3H5RA 4NDLA 1RPWA 3G3ZA 2VKVA 2IA1A 3LSGA 4M73A 1WJBA 2QWWA 1Z6TA 4ZC3A 5GPAA 5DTDA 2RVCA 1GV5A 3RPQA 4RA2A 1VQ5I 2KP6A 5F1JA 3MVPA 1QO0D 2VJ5A 4MEYF 2CO5A 4O6JA 4V19K 3RKXA 4L0YB 3DTKA 5DEQA 5FGMA 3WGGA 3RSNA 5IOZA 2VQLA 4E7ZA 2ESNA 1WCMJ 2HR3A 4OOIA 1FNNA 4U7DA 1ON2A 2AQEA 5LBQA 3GTMJ 3CC4I 5M3FJ 4E7JA 2DOAA 4GFBA 2FX0A 2CV0A 3RKQA 4N4NB 3CP8A 1TWHJ 4A3FJ 5EZGA 1ETOA 1J9IA 2DT5A 3K70D 2MC4A 1LVAA 1UHMA 3QPHA 5F0FA 2BGCA 1W5CC 3CMYA 2FBIA 4FQGA 2KISA 1W7PB 2KFDA 4RAZA 2L4MA 4J01A 2CU7A 1KYWA 2Y69H 3BP8A 1R5HA 5IPAA 5A2QK 5DCMA 3QWLA 3BTJA 3WU1B 4WXCA 2JUGA 4BY1J 3SZTA 3WGIA 2IS1A 2DYRH 4WK8F 1RETA 1QHHD 3FHZA 3F6OA 1EF4A 3FK7A 1XS9A 1BC8C 4HSRA 3IRRA 4I76A 1S6LA 2IJLA 1E3OC 1AWCA 1IG7A 2UWMA 2PJRB 2A07F 1MBFA 3H0DA 1FZPB 2XHKA 4HNUA 1A31A 4E7LA 1A6QA 3JRFA 2K4BA 3A1YA 1V3FA 4XLAA 1R1TA 3FMRA 3COAC 1DU0A 2ZCWA 2NS8A 4A3KJ 4RBOA 4Y4RA 4BYYA 2E5ZA 3OR2C 1TP4A 2HVQA 3DCFA 4RM3A 2M30A 1J0RA 3FKIJ 3B6AA 2LFBA 3JREA 5FRNA 2Y31A 3BJOA 2ZJRF 3M3YJ 3CJRB 4A0XA 5K7FA 4I09A 4KISA 2DT6A 2LTPA 4A3JJ 2W82A 3L2QA 1D0YA 2ISZA 4HA8A 4BDZA 1F36A 3J81Z 1ZG5A 4LIUA 5K5QA 4BU2A 2E1CA 3BLYA 3KP7A 3G73A 4WWCA 4IZZA 2Y48A 4HNVA 3E7LA 4CUGA 4EM2A 3ESWB 1AKHA 1BR1A 2IW5A 2HOAA 4A3GJ 4FE4A 3M4OJ 3IKTA 2X1DA 1OJLA 3KEQA 2M34A 2MC3A 2OJED 1X4PA 5HNFA 4G7OF 3I4PA 2R93J 4IJAA 3JSPA 2GZWA 1UELB 2G9WA 1J75A 2XVCA 1ZRCA 1FP2A 2HI3A 2X6XA 3SYTA 1BR4A 4ESBA 4HW0A 4A5MA 2IBDA 2IRFG 1ETYA 4NQWA 4AD9A 4PJNA 4L5IA 3CDIA 2COMA 5EGOA 4C3IJ 1WKMA 3HOVJ 1KA8A 3T8TA 1SAUA 3DEWA 1OCOH 2KLOA 1ETKA 4JP0A 2QZ8A 3LSIA 5HLTA 5IYDJ 3CJTB 3DPUA 5EG0A 3ZQLA 2HPIA 3S3MA 3PQKA 2X51A 2IEKA 4ZTJA 1ZAOA 4JOMA 4S04A 1TZLA 5GP9A 1ETXA 2EH3A 1D5YA 3G4SI 1WHUA 1FIPA 1IAWA 1X19A 2LF8A 3MN2A 4AC0A 3CUQA 4NB5A 5EF6A 1U5TA 1XDUA 2FU4A 3P9CA 1H88C 3KE2A 1O3RA 2R7DA 4RGSA 2M7BA 4CXFA 3IL2A 3T0YA 3PM1A 1P4AA 3CDHA 1LEAA 2EB7A 3BR3A 4PZJA 1VTNC 2HKXA 4GCVA 2FMYA 3OYBA 3CC7I 1Y0UA 5IT9Z 2L9RA 2R7RA 1Z21A 2VQHA 4HPQA 1LDKB 4BAYA 3S93A 4U88A 5KVRA 4ZDPA 4GYIA 1YJWI 4JK1X 3QQAA 2HQ5A 2OQGA 2EZLA 3NWSA 2KQRA 2QENA 2VJIA 3LSTA 4M3DA 1W36D 1OCPA 2OF7A 2XB0X 3V7SA 5LGUA 3PSFA 1OCRH 3N4MA 3M1EA 1K61A 3ZQIA 5BOXA 1MKMA 3TEDA 2JA7J 2EWNA 3SFZA 4RS8A 2DK5A 3WHCA 1VQKI 1BIAA 4P96A 2ZSIB 2BY0A 3R4KA 2KRHA 4XLFA 3ML6A 5GADJ 2JSPA 5D5VB 4P55A 1TBXA 2RC4A 3OYDA 2WY8Q 2BHZA 4F92B 3HHHA 3DBHB 4XRSA 4RM2A 4LB5A 4KMUX 3H9QA 5LHHA 3ZRGA 3GZNB 1YX5A 3A4CA 3K0LA 4EMSA 2JTVA 1JT6A 1UAAA 2VIXA 1LFPA 4LK1F 3OV8A 3TGNA 4DYCA 2MBFA 2OTJI 1TQPA 3HYIA 5EEGA 1RC9A 3KP6A 2DMTA 2LY2A 1K7AA 1QGPA 3JRHA 3IKVA 2DFIA 4HQEA 3ZR8X 3KLNA 2AO9A 1OFCX 3ABKH 4MIMA 5D4RA 3S1MJ 4WXHA 1F43A 5LHGA 4GO1A 5KHDA 1RNLA 2LYCA 3RQ4A 4XMYA 2HXIA 2V79A 5B3SH 4WF2A 3VPRA 4MTEA 3ERED 2WWYA 4AIHA 1VQMI 5M5XJ 2Z16A 3L7WA 2X1EA 2ID3A 1X2NA 3GMEA 3RYPA 2O5RA 5GTIC 3HPGA 3ZGKA 1IV6A 4FTHA 1RIOH 1FWZA 4MQVA 5K5OA 1I5ZA 2DXIA 2CMPA 3HBLA 4CZCA 1LB2A 1Z1DA 5JFRA 1ZN2A 5FROA 4XBFA 1JTXA 3KZZA 2ZSHB 1FOWA 3W2AA 2CH0A 2LBFB 4XLCA 2ESHA 3E6CC 3SFIA 3PNTA 3ZN1A 3AG3H 1IXSB 2FNPA 5JHFA 4MNUA 3BG7A 4BE2A 1HBXG 3ISPA 3MCZA 4EJWA 3C1DA 3F8MA 3AKZA 1OISA 4A69C 2UUZA 4BBRJ 1Z3XA 1NG6A 1TWFJ 3CCJI 4F93B 5LRSA 3RTRA 2K9LA 3GFJA 2NVUB 4LIVA 1XTAA 2K27A 5IY5H 1JKOC 4M72A 3RI4A 2IGOA 5EDNA 2CQKA 2MA3A 4KN7X 3HSRA 3PJRA 1XMXA 1ODDA 2JN6A 3I64A 1JUMA 4LLGF 1YW7A 1U9OA 5DV5A 4IHTA 1T56A 4LLLA 2A6TA 3QOEA 2VE8A 3CUOA 2AQFA 4A3EJ 3M8FA 2JRMA 3QPSA 2DJNA 2JMWA 4LG3A 3S1QJ 4D1QA 1BC7C 4MGRA 4XLEA 5L3BA 1KYZA 1Q1VA 3FXQA 5J8CA 2QEXI 1P4WA 1A35A 3ELKA 5B1AH 4AU7A 3ZMUA 1SEUA 2F2EA 1D5VA 2IGKA 3M7GA 5IT3A 2R7ZJ 4FHTA 2MSYA 4FCYA 4B44A 5DM7F 2A5WA 3CLQA 2JT1A 2YS9A 3U1DA 2CWEA 5L3EA 1TNSA 1S9HA 2AHQA 1SVOA 1O4XA 3H5AA 3U1KA 2W1OA 4B47A 3CZ6A 3CCMI 1VNDA 2VASA 2PMHA 3EUAA 4HZFA 5J4YA 1BJZA 2D1HA 4LG0B 5LFAA 2XPUA 2XDVA 1T95A 5C4JJ 1FYMA 4A5NA 5EEHA 2JVHA 4I2OA 3FF5A 1KZHA 2IS4A 3QRFF 3DPLC 3K69A 1X1DA 4BHPA 2H27A 3H3ZA 1HW5A 3KP5A 2IXSA 1TLHB 1TWAJ 4FT8A 2VBZA 5BPIA 2V6EA 4M9SA 4EVIA 3LFKA 3I59A 4BQQA 3ZQCA 1XGMA 2CGPA 4XLPF 4CHUA 3LSHA 4S0HB 1TT0A 3OR1C 2F5CA 4IPAA 1VQ8I 3PIOF 4IHVA 2DT7B 1LQ1A 5BNGA 1VQ6I 4JQFA 2GIZA 3DBRB 1MBKA 1T38A 3HG9A 3L2VA 2YPRA 4IEJA 4M3GA 1Z91A 2IS2A 4H0EA 2EFWA 3CCQI 4HQMA 3TDZC 1LE8A 5K7ZA 2JPBA 1QPIA 1OYIA 2E60A 4I02A 3B02A 3RDIA 2NVQJ 1X3UA 5F27A 2P5VA 2VPLA 2DFHA 1FOYA 4DYRA 4HDVA 4HX7A 4G12A 3CCVI 3I71A 2EFQA 2W7NA 2PG4A 1GUUA 4HG2A 3TW7A 1Y1WJ 4RMNA 2M1BA 2EV6A 5CQEA 2Q1ZB 5IOYA 4V2FA 3P5JA 2JK3A 1USSA 2CJJA 4YELA 2L02A 1KQ8A 2Z1DA 4L9JA 2FOKA 5B5EC 2KPMA 2JA2A 2NOGA 1SAXA 1E3PA 2YU9J 3HKZA 3MQ0A 5LEKA 4XK4A 2E2IJ 5E79C 3W6JB 2HPMA 1F5TA 1IGNA 5HLHA 1FC3A 4OWRB 5E3OA 4D7MA 1KU7A 1ZYRF 3OSGA 2CW8A 1EH8A 4A6DA 1H89C 1FYKA 1JJ8C 3W6KB 5K1YA 5H6QA 2HDWA 1SFUA 4L0ZB 2H09A 1T98A 4DGWB 5B1BH 4HF2A 3GZ6A 2W4SA 3IH3A 3CCLI 1KQ9A 4OAZA 4BDYA 1OR7C 3OS0A 3M9AA 2E7XA 1MGTA 5BMZA 3CMAI 2QBYA 3A2KA 2MLKA 3HDDA 4A3DJ 1IV8A 1W7PA 3BCBA 4M6YA 4PJLA 3I5UA 5E8GA 3GBGA 3K1PA 1ZG1A 3V8LA 4BS9A 2J5PA 2W24A 2V6CA 3OOUA 3KCCA 4A3BJ 2Z3YA 3JTHA 4XN3A 5GAEJ 1YQAA 2EK5A 3CCEI 3DKYA 1BA5A 1U8BA 1NK2P 4FX4A 3E97A 5DUKA 2W57A 4PDKA 2CSOA
chains in the Genus database with same CATH topology
3GX4X 2WC2A 2P5LC 4L9NA 4HF0A 3E6DA 3BROA 1O3SA 3R61A 4N9HA 3CTAA 5D5UB 3I0TA 4HOBA 1F1ZA 5LRRA 3WE2A 1RUNA 4FX0A 4HBLA 4I0AA 3F8NA 2C6YA 3SZPA 4TV7A 4U7BA 2JPCA 4ENJA 4I98B 2OZ6A 3K1MA 4UVBA 3E5UA 3WTWC 1TQIA 2P6SA 1CF7B 3T5XA 1W5SA 2K4JA 1D8JA 1R36A 1IN7A 2UZKA 3GFIA 3HRUA 2M8EA 3F8CA 5H6RA 4EGZA 1YO5C 4HV6A 4EM1A 2ZMEB 3SXYA 5F1RA 1HW2A 2XV4S 3DEUA 3LA3A 1P4XA 2LKPA 5HOOA 1DPUA 2J5OA 1JHHA 2NRAC 2E1NA 4DQ2A 4CYDA 3IWZA 3WTVC 1O3QA 2P7VB 2FA5A 5CVIA 1IW7F 3E3VA 1BN5A 4MTDA 4B09A 3IC7A 4UUVA 1BI3A 3I54A 4AIKA 2EV5A 2RNJA 1ZREA 1R58A 1G3YA 4OIQF 2ELHA 3TQNA 3VFZA 1LDJA 2F5EA 1B6AA 1ZG3A 4PGGA 4OMZA 5FD5A 3TO6A 3V4GA 5DUIA 2IA2A 4M74A 5DDGA 2FF4A 1W7PD 1SFEA 3HOSA 5D5XB 1SD4A 1MDMB 2FRHA 2AS5F 4RAYA 2VT2A 3GO5A 2G7HA 3HRSA 4LD5A 1HKTA 5L3GA 1HSTA 3WE3A 1XCVA 4OINF 3R6SA 1ZGAA 2NYXA 1REPC 4BQAA 2P4WA 2PFBA 4XSXF 1H0MA 3FM5A 5FLXK 3IRQA 2DK8A 1BI0A 4XLNF 3F6VA 3GFMA 5BPDA 3BJ6A 4ESFA 2DQRA 2DO7A 3WG9A 2Q2EA 4KA4A 3WTYC 3DPTA 1GVJA 4N0BA 5AIPA 1YS7A 2F5DA 1QZZA 1WSUA 2FBHA 2EFNA 1ONVA 2Y0MA 2RQPA 4P9FA 2B0LA 3TDUC 2NS0A 4I7HA 2FNAA 2EFOA 1WI9A 5ERIA 3DF8A 2ADUA 2QVOA 4Z2YA 1FBSA 2MH2A 1G3WA 2Z99A 2OBPA 2X4HA 2ZJ2A 5DCFA 2IPQX 2G7UA 2XKOA 4UXNA 2O8XA 1QBJA 4KIFA 4ZYHA 2IA0A 2VXZA 2P7CB 1SMTA 2ZNZA 2ZBKA 1L0OC 2KJBA 4YG2F 2O61A 2A3SA 1JE8A 3OOPA 5DYMA 4U0VA 2CW0F 1FYLA 3J81K 2NNYA 4Q5SF 3GVAA 1UFMA 1BOAA 3RYRA 1FPQA 3LA7A 5HDKA 1IN8A 3F22A 1CGPA 3C3WA 2DAOA 3GEZA 3GLXA 5HS7A 5JR3A 4WXDA 3SHFA 4F7ZA 1U78A 3TO9A 1R00A 2IP2A 4GYGA 3GXOA 4JBAA 1R23A 3EYYA 3IHUA 1RI7A 1YIOA 4BXUA 4LG0A 5JI6A 1W5TA 2BBYA 1KU2A 1I6XA 5E8IA 5K5RA 5DCMB 2W84A 1XSDA 1XMKA 3LA2A 2LF7A 3L09A 3HTUA 1FP1D 3DQVC 5HDNA 1PP7U 3MZYA 4IHSA 2FEZA 5FB2A 1SD6A 3CLOA 1YLFA 1G3SA 3R0JA 2KRFA 4YFNF 1ZGJA 3K2ZA 3Q5FA 3P9KA 3T1BA 4A0ZA 1IZ1A 5HS9A 4EJVA 2H6BA 4KMFA 4I0BA 5IT9K 4QWQA 1Z6RA 3RPUA 3DFGA 1JGSA 2R7FA 1UB9A 3BY6A 2DBBA 1IXCA 2L4AA 1V4RA 1LEBA 3HUGA 4L9TA 4CZZA 4ZH4F 3KEOA 2JSCA 4A0YA 1J5YA 3WTXC 3E5QA 2K02A 2XAHA 3LQQA 3EQLF 5D4SA 1IXRC 4S05A 1R1UA 4ASNA 2EA2A 4ZZLA 1ZLKA 2DQLA 1TQMA 1SFXA 4BHCA 4KIGA 2WV0A 5L3FA 1KQ0A 1SMYF 4ZYEA 4U0YA 2XKPA 4UNOA 1PUEE 1BIBA 1STZA 3QU3A 2KIMA 3HHGA 1XCBA 4ENNA 2YU3A 4KNYA 1ZHFA 1XSVA 2TDXA 3MEXA 4KT5C 3WODF 5E17F 3JW4A 1USTA 1DDNA 3HOTA 4MHGA 3R60A 1YW9A 2HDCA 1Q1HA 2JRTA 6PAXA 3JTGA 1B1BA 2YR2A 4UVAA 1MJ9A 3C7JA 3J7AO 4XSZF 3F72A 4L18B 3E5XA 4G9YA 2MLGA 5JVTA 3GZ5A 3LAJA 1S7OA 4HLXA 3N97A 1NHAA 2PEXA 1GHCA 4MEXF 1IUYA 3ZP5A 2W25A 1R7JA 2VN2A 1ZH5A 3V8JA 2ZMEA 5HS8A 4RGUA 1J7KA 5BS6A 5E1ZB 3O2PE 4KDPA 1P92A 3BJAA 4OMYA 4ZYDA 1O57A 2O03A 5ICCA 3EETA 3BPXA 1BJAA 3O3KA 5J6XA 1GXQA 2MH9A 1D3YA 5ICGA 1RUOA 3FMSA 4ENKA 1FSHA 2FE3A 2MD5A 4RGRA 1G3TA 1ULYA 2LNBA 3HTSB 1J59A 2GAUA 3T8RA 2A69F 3LQRA 1KGSA 2HS5A 1HXDA 2QQ9A 2P6TA 4IRGA 3P7NA 2K7LA 2OAZA 4O3MA 2O0YA 3BWGA 1OMIA 5HLIA 1I27A 4B8XA 4GGGA 4YFKF 2XUBA 1W4MA 2IT0A 5CVUA 3AAFA 4A12A 1FBQA 3WU0A 2UXNA 1S3JA 2JZYA 1B59A 4AIJA 4EGYA 1K78B 2VBXA 2DI3A 2KKOA 2BE5F 1LNWA 1IRGA 3JAMZ 2A5YB 1WRJA 4CDGA 4EJOA 2F5FA 2FSWA 2HWVA 3QPTA 3ZN0A 2PJPA 1IN6A 4P5OA 3DKWA 3FX3A 1OYYA 3J80Z 3KFWX 5D6FA 1MZBA 1YFHA 2VE9A 1FOKA 1XGNA 1GXPA 2GA1A 1JHFA 2H6CA 5CVRA 1H9GA 5BQTA 4Y17A 1XD7A 2XIGA 4XRFA 2D45A 2O6GE 1C0WA 2PQ8A 1XMAA 1YS6A 5LEJA 2CYYA 3I59B 1LJ9A 1QNTA 1P6RA 1H9TA 3Q9VA 5DD4A 1OPCA 1O3TA 2VOPA 1AOYA 4R8HA 1P2FA 1F4KA 2HZTA 1QQIA 5A2QZ 1IF1A 3R0AA 4L5JA 3EUHA 2RGVA 5D6EA 4IRHA 1QZYA 5FD6A 3Q9SA 3SQNA 2Q0OA 1OKRA 2HYFA 2FMLA 1YW8A 2M5WA 4CGZA 3MAJA 4Q47A 1U8RA 2FBKA 2A6EF 4Y13A 1EH6A 3ECOA 3FXUA 5TRDA 2NAZA 4CICA 3HSFA 4PCQA 2VONA 1BM9A 5D5WB 1ZARA 1FLIA 1S8NA 3P9IA 2AXLA 5LGNA 3MZHA 1OYWA 4M9XA 3L00A 4M71A 5HLGA 3GF2A 1ZRDA 5ED4A 1E2XA 3ZMTA 4UV8A 4R1HA 1XGSA 4HYEA 2QBYB 2KIFA 5DD8A 3GUDA 1F9NA 1K79A 4D0PA 2STTA 4G6DA 5F64A 1TNTA 2VBYA 1R22A 2W85A 4ETSA 1ZRFA 1Z05A 3ZPLA 5ICFA 2XAQA 5CVVA 3WTUC 3HRMA 4UHTA 2PLYA 3KETA 4LMYA 1FX7A 3IWFA 3KP4A 3FXRA 4ZYGA 1S7AA 1Z9CA 4EJTA 3CO6C 3TKYA 2PBIA 2BV6A 5ILVA 3TOAA 1JXSA 1B9MA 1DUXC 1HKSA 3RKYA 4ESJA 2YX4A 5AIQA 2EV0A 2EFPA 1HW1A 3ABUA 3VOEA 2XRNA 4YFXF 2RN7A 2HQNA 2DTRA 5ILUA 4LGWA 5L3CA 2VOOA 1BI2A 1O7LA 4Q48A 3ULQB 2GQQA 4RB1A 4E70A 2RKHA 2XAJA 2GXBA 3HIFA 4DNCA 2QQBA 2E7WA 2XGXA 4LJZF 1MD0A 2FXAA 4LLNA 4RGXA 3BDDA 1MJAA 3DP7A 1E17A 1EV7A 4IF4A 2H94A 3LAPA 4EQQA 2RDPA 4WCGA 1I1GA 3KZYA 3D0SA 4EJUA 3C18A 4GXOA 3V7CA 3HSEA 2PI0A 1B4AA 2ETHA 1TTYA 2YX7A 3CUQC 3NQOA 2XASA 2Z33A 4P9UA 1U5TC 3PQJA 4OIOF 2NNNA 4BH9A 1TW2A 2KJCA 3O6BB 1DP7P 4EV0A 1R1VA 1HKQA 4Y15A 3PFIA 2XAGA 4M6XA 1Z7UA 2VODA 4M9ZA 4OIRF 3WTSC 5H20A 5CJ9A 4RB0A 3HRTA 4BNCA 1L3LA 3WTZA 1EH7A 4R79A 3EDPA 2V1XA 4HX4A 5CLSA 4U0WA 1ZLJA 3U2RA 4I01A 2QM3A 3WGHA 2ACJA 3LWFA 1ON1A 1YTYA 3H92A 2HQRA 1U3EM 2HOEA 2CG4A 2GA2A 3CJNA 1QPMA 2M87A 4LB6B 1FT9A 2STWA 2OQRA 2FQ3A 1MJBA 4G7ZF 4YIIA 5FO5A 4KIBA 1YG2A 2HTSA 3F23A 4HV5A 3FMQA 3GFLA 1IN5A 3E6MA 5D8KB 2A6HF 3ZMZA 2HGCA 3DV8A 3VODA 2HFHA 1HSJA 3NRVA 3JSOA 4QLCU 1HQCA 2ZO4A 2A61A 2ZKZA 4UV9A 4ENMA 4LFUA 4RB2C 4KICA 2K86A 4HF1A 1UHWA 5LHIA 2GXGA 2Y75A 3F8FA 3RKWA 1RZ4A 2CFXA 3CO7C 4CO8A 1XGOA 2EJRA 3TOBA 3TO7A 3F8BA 1U2WA 2HKOA 2QUFA 5ILSA 3MFKA 4EM0B 3ZMSA 2OU2A 4UVCA 4YIFA 2DLLA 2OA4A 3DXJF 2VC0A 4G8XA 3D5LA 3GWZA 5E1XA 3ABTA 2D1VA 4O5VA 4G7HF 3CUQB 1S29A 4A6EA 1U5TB 3QAHA 1K78A 1SD5A 5F6FA 2HTJA 3KLOA 4PGHA 3V7RA 3REOA 2PN6A 1XSXA 2UXXA 5KK1A 3GW2A 5HVQC 2RV8A 3L2CA 2D2WA 2KIUA 3FZVA 3MWMA 3ZQ7A 3U9GA 1BI1A 4K2EA 2HEOA 3ZMDA 1CF7A 4ZZDA 4L9VA 2QLZA 2ZXJA 1D8KA 4NHJA 1T39A 5CVJA 2Z9OA 1T0FA 5CYVA 1PDNC 5AONA 3QOPA 5LGTA 2XAFA 2WTEA 5LLQA 3BOQA 4G94A 3VB2A 1XB4A 5E18F 2QQAA 1KU3A 1FY7A 4AVPA 1I1SA 4HLYA 5FFXA 2BEOA 5TJJA 2V1DA 2DW4A 4ON0A 3I58A 4WX9A 3ECHA 2LSOA 2XROA 4A2UA 2HYGD 3S2WA 1G4DA 2VT3A 3BPVA 1BBYA 4Q4ZF 5J8FA 3M8EA 4G6QA 3EYIA 1FSEA 4N9IA 2V1UA 2L01A 2VBWA 2DPUA 2GWRA 2L54A 3FM3A 3E6BA 4IXAA 1FBUA 4IRIA 5E20A 4BHBA 1PP8F 2ISYA 4HAMA 3WTTC 2EA4A 4OU0A 5JHUA 5FFZA 1MDMA 1OR7A 4MQ9F 2QYOA 4KYWA 3RJPA 4KFCA 2VC1A 3K1NA 2M45A 3KP3A 4LK0F 4RB3C 1SD7A 1G6NA 3KP2A 4AWXB 1T2KA 1KU9A 2ZNYA 3VEPA 2IVMA 2R3SA 2OZUA 2DU9A 2OD5A 3B73A 1IN4A 1TW3A 1IRFA 2ZFWA 3QP6A 1O7FA 1DPRA 2LDUA 1A04A 3RIRA 5HDGA 2BYVE 1R5GA 3K9TA 5E1WA 1U6GA 1YYVA 2O3FA 4HX8A 1LDDA 3FWEA 2L3DA 1WQ2A 1B9NA 1XN7A 2A68F 2Q8KA 1XDSA 2P8TA 1T6SA 4KUMA 3QU6A 2DPDA 1UCRA 1WWXA 3ROUA 3ZMVA 3GYHX 2P5KA 3V8KA 2Z5UA 3F21A 1J2XA 3H3UA 4IVNA 3L9FA 3JAMK 3QP5A 3I53A 2X0LA 2PMUA 5D8LB 4OIPF 3NEUA 3BZ6A 4HDUA 3F3XA 2GIVA 2YSRA 3J80K 2V9VA 5ICEA 4KN4X 5FLXZ 1K6OA 5L3DA 3G3ZA 2IA1A 4M73A 2QWWA 1Z6TA 2RVCA 3RPQA 1QO0D 4MEYF 2CO5A 4O6JA 3RKXA 4L0YB 5FGMA 5DEQA 3WGGA 2ESNA 2HR3A 4OOIA 1FNNA 4U7DA 1ON2A 5LBQA 1J9IA 2DT5A 1LVAA 1UHMA 3QPHA 2BGCA 2FBIA 1W7PB 4RAZA 2L4MA 1KYWA 3BP8A 1R5HA 5A2QK 5DCMA 3WU1B 4WXCA 3SZTA 3WGIA 4WK8F 3FHZA 3F6OA 1BC8C 3IRRA 1S6LA 2IJLA 1AWCA 2UWMA 2A07F 1FZPB 2XHKA 2K4BA 1V3FA 3COAC 1R1TA 3FMRA 2ZCWA 4BYYA 2M30A 1J0RA 3BJOA 4A0XA 4I09A 2ISZA 4HA8A 3J81Z 1ZG5A 5K5QA 2E1CA 3KP7A 3G73A 4WWCA 2Y48A 4EM2A 2IW5A 3IKTA 3KEQA 2MC3A 4G7OF 3I4PA 4IJAA 3JSPA 2GZWA 2G9WA 1J75A 2XVCA 1ZRCA 1FP2A 4ESBA 4HW0A 4A5MA 2IRFG 4NQWA 4AD9A 4L5IA 2COMA 1WKMA 1KA8A 3T8TA 2QZ8A 3PQKA 1ZAOA 4S04A 1IAWA 2LF8A 3CUQA 4NB5A 1U5TA 1XDUA 2FU4A 3P9CA 3KE2A 1O3RA 2R7DA 4RGSA 3IL2A 4CXFA 3T0YA 1P4AA 3CDHA 1LEAA 2EB7A 4PZJA 1VTNC 2HKXA 4GCVA 2FMYA 1Y0UA 5IT9Z 1LDKB 4BAYA 4U88A 5KVRA 4GYIA 4JK1X 2OQGA 2QENA 3LSTA 3V7SA 5LGUA 3N4MA 3M1EA 5BOXA 1MKMA 2EWNA 3SFZA 4RS8A 2DK5A 1BIAA 4P96A 3R4KA 3ML6A 5D5VB 4P55A 1TBXA 2RC4A 3HHHA 4LB5A 4KMUX 5LHHA 4EMSA 3K0LA 2JTVA 4LK1F 3OV8A 3TGNA 2MBFA 1TQPA 3HYIA 5EEGA 3KP6A 1K7AA 1QGPA 3IKVA 2DFIA 4HQEA 3KLNA 5D4RA 4WXHA 5LHGA 4GO1A 1RNLA 2V79A 4WF2A 4MTEA 3ERED 2WWYA 4AIHA 3L7WA 3RYPA 1RIOH 1FWZA 4MQVA 5K5OA 1I5ZA 1LB2A 1Z1DA 5JFRA 1ZN2A 4XBFA 3KZZA 2ESHA 3E6CC 3ZN1A 1IXSB 2FNPA 4MNUA 1HBXG 3ISPA 3MCZA 4EJWA 3C1DA 3F8MA 5LRSA 3RTRA 3GFJA 2K27A 4M72A 3RI4A 2CQKA 2MA3A 4KN7X 3HSRA 1ODDA 3I64A 4LLGF 1YW7A 5DV5A 4IHTA 4LLLA 2VE8A 3CUOA 3M8FA 1BC7C 4MGRA 5L3BA 1KYZA 3FXQA 5J8CA 1P4WA 3ELKA 3ZMUA 2F2EA 1D5VA 3M7GA 5IT3A 4FHTA 2JT1A 3U1DA 2CWEA 5L3EA 1TNSA 2PMHA 4HZFA 2D1HA 4LG0B 1FYMA 4A5NA 5EEHA 4I2OA 3FF5A 3QRFF 3DPLC 3K69A 4BHPA 2H27A 3H3ZA 1HW5A 3KP5A 1TLHB 4FT8A 2VBZA 5BPIA 4M9SA 4EVIA 3LFKA 3I59A 2CGPA 1XGMA 4XLPF 4CHUA 2F5CA 4IPAA 1LQ1A 4JQFA 1T38A 2YPRA 1Z91A 4H0EA 2EFWA 4HQMA 3TDZC 2JPBA 1OYIA 4I02A 3B02A 3RDIA 1X3UA 2P5VA 4HDVA 4HX7A 3I71A 2EFQA 2PG4A 2M1BA 2EV6A 1USSA 2L02A 1KQ8A 4L9JA 2FOKA 1SAXA 3MQ0A 5LEKA 3W6JB 1F5TA 5HLHA 1FC3A 1KU7A 1ZYRF 1EH8A 4A6DA 1FYKA 3W6KB 5K1YA 5H6QA 1SFUA 4L0ZB 2H09A 1T98A 4HF2A 3GZ6A 1KQ9A 3M9AA 2E7XA 1MGTA 5BMZA 2QBYA 2MLKA 1W7PA 4M6YA 3I5UA 5E8GA 3K1PA 1ZG1A 3V8LA 2J5PA 2W24A 2V6CA 3KCCA 2Z3YA 3JTHA 1YQAA 2EK5A 4FX4A 3E97A 5DUKA 2W57A 4PDKA 2CSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GX4 X;  2WC2 A;  2P5L C;  4L9N A;  4HF0 A;  3E6D A;  3BRO A;  1O3S A;  3R61 A;  4N9H A;  3CTA A;  5D5U B;  3I0T A;  4HOB A;  1F1Z A;  5LRR A;  3WE2 A;  1RUN A;  4FX0 A;  4HBL A;  4I0A A;  3F8N A;  2C6Y A;  3SZP A;  4TV7 A;  4U7B A;  2JPC A;  4ENJ A;  4I98 B;  2OZ6 A;  3K1M A;  4UVB A;  3E5U A;  3WTW C;  1TQI A;  2P6S A;  1CF7 B;  3T5X A;  1W5S A;  2K4J A;  1D8J A;  1R36 A;  1IN7 A;  2UZK A;  3GFI A;  3HRU A;  2M8E A;  3F8C A;  5H6R A;  4EGZ A;  1YO5 C;  4HV6 A;  4EM1 A;  2ZME B;  3SXY A;  5F1R A;  1HW2 A;  2XV4 S;  3DEU A;  3LA3 A;  1P4X A;  2LKP A;  5HOO A;  1DPU A;  2J5O A;  1JHH A;  2NRA C;  2E1N A;  4DQ2 A;  4CYD A;  3IWZ A;  3WTV C;  1O3Q A;  2P7V B;  2FA5 A;  5CVI A;  1IW7 F;  3E3V A;  1BN5 A;  4MTD A;  4B09 A;  3IC7 A;  4UUV A;  1BI3 A;  3I54 A;  4AIK A;  2EV5 A;  2RNJ A;  1ZRE A;  1R58 A;  1G3Y A;  4OIQ F;  2ELH A;  3TQN A;  3VFZ A;  1LDJ A;  2F5E A;  1B6A A;  1ZG3 A;  4PGG A;  4OMZ A;  5FD5 A;  3TO6 A;  3V4G A;  5DUI A;  2IA2 A;  4M74 A;  5DDG A;  2FF4 A;  1W7P D;  1SFE A;  3HOS A;  5D5X B;  1SD4 A;  1MDM B;  2FRH A;  2AS5 F;  4RAY A;  2VT2 A;  3GO5 A;  2G7H A;  3HRS A;  4LD5 A;  1HKT A;  5L3G A;  1HST A;  3WE3 A;  1XCV A;  4OIN F;  3R6S A;  1ZGA A;  2NYX A;  1REP C;  4BQA A;  2P4W A;  2PFB A;  4XSX F;  1H0M A;  3FM5 A;  5FLX K;  3IRQ A;  2DK8 A;  1BI0 A;  4XLN F;  3F6V A;  3GFM A;  5BPD A;  3BJ6 A;  4ESF A;  2DQR A;  2DO7 A;  3WG9 A;  2Q2E A;  4KA4 A;  3WTY C;  3DPT A;  1GVJ A;  4N0B A;  5AIP A;  1YS7 A;  2F5D A;  1QZZ A;  1WSU A;  2FBH A;  2EFN A;  1ONV A;  2Y0M A;  2RQP A;  4P9F A;  2B0L A;  3TDU C;  2NS0 A;  4I7H A;  2FNA A;  2EFO A;  1WI9 A;  5ERI A;  3DF8 A;  2ADU A;  2QVO A;  4Z2Y A;  1FBS A;  2MH2 A;  1G3W A;  2Z99 A;  2OBP A;  2X4H A;  2ZJ2 A;  5DCF A;  2IPQ X;  2G7U A;  2XKO A;  4UXN A;  2O8X A;  1QBJ A;  4KIF A;  4ZYH A;  2IA0 A;  2VXZ A;  2P7C B;  1SMT A;  2ZNZ A;  2ZBK A;  1L0O C;  2KJB A;  4YG2 F;  2O61 A;  2A3S A;  1JE8 A;  3OOP A;  5DYM A;  4U0V A;  2CW0 F;  1FYL A;  3J81 K;  2NNY A;  4Q5S F;  3GVA A;  1UFM A;  1BOA A;  3RYR A;  1FPQ A;  3LA7 A;  5HDK A;  1IN8 A;  3F22 A;  1CGP A;  3C3W A;  2DAO A;  3GEZ A;  3GLX A;  5HS7 A;  5JR3 A;  4WXD A;  3SHF A;  4F7Z A;  1U78 A;  3TO9 A;  1R00 A;  2IP2 A;  4GYG A;  3GXO A;  4JBA A;  1R23 A;  3EYY A;  3IHU A;  1RI7 A;  1YIO A;  4BXU A;  4LG0 A;  5JI6 A;  1W5T A;  2BBY A;  1KU2 A;  1I6X A;  5E8I A;  5K5R A;  5DCM B;  2W84 A;  1XSD A;  1XMK A;  3LA2 A;  2LF7 A;  3L09 A;  3HTU A;  1FP1 D;  3DQV C;  5HDN A;  1PP7 U;  3MZY A;  4IHS A;  2FEZ A;  5FB2 A;  1SD6 A;  3CLO A;  1YLF A;  1G3S A;  3R0J A;  2KRF A;  4YFN F;  1ZGJ A;  3K2Z A;  3Q5F A;  3P9K A;  3T1B A;  4A0Z A;  1IZ1 A;  5HS9 A;  4EJV A;  2H6B A;  4KMF A;  4I0B A;  5IT9 K;  4QWQ A;  1Z6R A;  3RPU A;  3DFG A;  1JGS A;  2R7F A;  1UB9 A;  3BY6 A;  2DBB A;  1IXC A;  2L4A A;  1V4R A;  1LEB A;  3HUG A;  4L9T A;  4CZZ A;  4ZH4 F;  3KEO A;  2JSC A;  4A0Y A;  1J5Y A;  3WTX C;  3E5Q A;  2K02 A;  2XAH A;  3LQQ A;  3EQL F;  5D4S A;  1IXR C;  4S05 A;  1R1U A;  4ASN A;  2EA2 A;  4ZZL A;  1ZLK A;  2DQL A;  1TQM A;  1SFX A;  4BHC A;  4KIG A;  2WV0 A;  5L3F A;  1KQ0 A;  1SMY F;  4ZYE A;  4U0Y A;  2XKP A;  4UNO A;  1PUE E;  1BIB A;  1STZ A;  3QU3 A;  2KIM A;  3HHG A;  1XCB A;  4ENN A;  2YU3 A;  4KNY A;  1ZHF A;  1XSV A;  2TDX A;  3MEX A;  4KT5 C;  3WOD F;  5E17 F;  3JW4 A;  1UST A;  1DDN A;  3HOT A;  4MHG A;  3R60 A;  1YW9 A;  2HDC A;  1Q1H A;  2JRT A;  6PAX A;  3JTG A;  1B1B A;  2YR2 A;  4UVA A;  1MJ9 A;  3C7J A;  3J7A O;  4XSZ F;  3F72 A;  4L18 B;  3E5X A;  4G9Y A;  2MLG A;  5JVT A;  3GZ5 A;  3LAJ A;  1S7O A;  4HLX A;  3N97 A;  1NHA A;  2PEX A;  1GHC A;  4MEX F;  1IUY A;  3ZP5 A;  2W25 A;  1R7J A;  2VN2 A;  1ZH5 A;  3V8J A;  2ZME A;  5HS8 A;  4RGU A;  1J7K A;  5BS6 A;  5E1Z B;  3O2P E;  4KDP A;  1P92 A;  3BJA A;  4OMY A;  4ZYD A;  1O57 A;  2O03 A;  5ICC A;  3EET A;  3BPX A;  1BJA A;  3O3K A;  5J6X A;  1GXQ A;  2MH9 A;  1D3Y A;  5ICG A;  1RUO A;  3FMS A;  4ENK A;  1FSH A;  2FE3 A;  2MD5 A;  4RGR A;  1G3T A;  1ULY A;  2LNB A;  3HTS B;  1J59 A;  2GAU A;  3T8R A;  2A69 F;  3LQR A;  1KGS A;  2HS5 A;  1HXD A;  2QQ9 A;  2P6T A;  4IRG A;  3P7N A;  2K7L A;  2OAZ A;  4O3M A;  2O0Y A;  3BWG A;  1OMI A;  5HLI A;  1I27 A;  4B8X A;  4GGG A;  4YFK F;  2XUB A;  1W4M A;  2IT0 A;  5CVU A;  3AAF A;  4A12 A;  1FBQ A;  3WU0 A;  2UXN A;  1S3J A;  2JZY A;  1B59 A;  4AIJ A;  4EGY A;  1K78 B;  2VBX A;  2DI3 A;  2KKO A;  2BE5 F;  1LNW A;  1IRG A;  3JAM Z;  2A5Y B;  1WRJ A;  4CDG A;  4EJO A;  2F5F A;  2FSW A;  2HWV A;  3QPT A;  3ZN0 A;  2PJP A;  1IN6 A;  4P5O A;  3DKW A;  3FX3 A;  1OYY A;  3J80 Z;  3KFW X;  5D6F A;  1MZB A;  1YFH A;  2VE9 A;  1FOK A;  1XGN A;  1GXP A;  2GA1 A;  1JHF A;  2H6C A;  5CVR A;  1H9G A;  5BQT A;  4Y17 A;  1XD7 A;  2XIG A;  4XRF A;  2D45 A;  2O6G E;  1C0W A;  2PQ8 A;  1XMA A;  1YS6 A;  5LEJ A;  2CYY A;  3I59 B;  1LJ9 A;  1QNT A;  1P6R A;  1H9T A;  3Q9V A;  5DD4 A;  1OPC A;  1O3T A;  2VOP A;  1AOY A;  4R8H A;  1P2F A;  1F4K A;  2HZT A;  1QQI A;  5A2Q Z;  1IF1 A;  3R0A A;  4L5J A;  3EUH A;  2RGV A;  5D6E A;  4IRH A;  1QZY A;  5FD6 A;  3Q9S A;  3SQN A;  2Q0O A;  1OKR A;  2HYF A;  2FML A;  1YW8 A;  2M5W A;  4CGZ A;  3MAJ A;  4Q47 A;  1U8R A;  2FBK A;  2A6E F;  4Y13 A;  1EH6 A;  3ECO A;  3FXU A;  5TRD A;  2NAZ A;  4CIC A;  3HSF A;  4PCQ A;  2VON A;  1BM9 A;  5D5W B;  1ZAR A;  1FLI A;  1S8N A;  3P9I A;  2AXL A;  5LGN A;  3MZH A;  1OYW A;  4M9X A;  3L00 A;  4M71 A;  5HLG A;  3GF2 A;  1ZRD A;  5ED4 A;  1E2X A;  3ZMT A;  4UV8 A;  4R1H A;  1XGS A;  4HYE A;  2QBY B;  2KIF A;  5DD8 A;  3GUD A;  1F9N A;  1K79 A;  4D0P A;  2STT A;  4G6D A;  5F64 A;  1TNT A;  2VBY A;  1R22 A;  2W85 A;  4ETS A;  1ZRF A;  1Z05 A;  3ZPL A;  5ICF A;  2XAQ A;  5CVV A;  3WTU C;  3HRM A;  4UHT A;  2PLY A;  3KET A;  4LMY A;  1FX7 A;  3IWF A;  3KP4 A;  3FXR A;  4ZYG A;  1S7A A;  1Z9C A;  4EJT A;  3CO6 C;  3TKY A;  2PBI A;  2BV6 A;  5ILV A;  3TOA A;  1JXS A;  1B9M A;  1DUX C;  1HKS A;  3RKY A;  4ESJ A;  2YX4 A;  5AIQ A;  2EV0 A;  2EFP A;  1HW1 A;  3ABU A;  3VOE A;  2XRN A;  4YFX F;  2RN7 A;  2HQN A;  2DTR A;  5ILU A;  4LGW A;  5L3C A;  2VOO A;  1BI2 A;  1O7L A;  4Q48 A;  3ULQ B;  2GQQ A;  4RB1 A;  4E70 A;  2RKH A;  2XAJ A;  2GXB A;  3HIF A;  4DNC A;  2QQB A;  2E7W A;  2XGX A;  4LJZ F;  1MD0 A;  2FXA A;  4LLN A;  4RGX A;  3BDD A;  1MJA A;  3DP7 A;  1E17 A;  1EV7 A;  4IF4 A;  2H94 A;  3LAP A;  4EQQ A;  2RDP A;  4WCG A;  1I1G A;  3KZY A;  3D0S A;  4EJU A;  3C18 A;  4GXO A;  3V7C A;  3HSE A;  2PI0 A;  1B4A A;  2ETH A;  1TTY A;  2YX7 A;  3CUQ C;  3NQO A;  2XAS A;  2Z33 A;  4P9U A;  1U5T C;  3PQJ A;  4OIO F;  2NNN A;  4BH9 A;  1TW2 A;  2KJC A;  3O6B B;  1DP7 P;  4EV0 A;  1R1V A;  1HKQ A;  4Y15 A;  3PFI A;  2XAG A;  4M6X A;  1Z7U A;  2VOD A;  4M9Z A;  4OIR F;  3WTS C;  5H20 A;  5CJ9 A;  4RB0 A;  3HRT A;  4BNC A;  1L3L A;  3WTZ A;  1EH7 A;  4R79 A;  3EDP A;  2V1X A;  4HX4 A;  5CLS A;  4U0W A;  1ZLJ A;  3U2R A;  4I01 A;  2QM3 A;  3WGH A;  2ACJ A;  3LWF A;  1ON1 A;  1YTY A;  3H92 A;  2HQR A;  1U3E M;  2HOE A;  2CG4 A;  2GA2 A;  3CJN A;  1QPM A;  2M87 A;  4LB6 B;  1FT9 A;  2STW A;  2OQR A;  2FQ3 A;  1MJB A;  4G7Z F;  4YII A;  5FO5 A;  4KIB A;  1YG2 A;  2HTS A;  3F23 A;  4HV5 A;  3FMQ A;  3GFL A;  1IN5 A;  3E6M A;  5D8K B;  2A6H F;  3ZMZ A;  2HGC A;  3DV8 A;  3VOD A;  2HFH A;  1HSJ A;  3NRV A;  3JSO A;  4QLC U;  1HQC A;  2ZO4 A;  2A61 A;  2ZKZ A;  4UV9 A;  4ENM A;  4LFU A;  4RB2 C;  4KIC A;  2K86 A;  4HF1 A;  1UHW A;  5LHI A;  2GXG A;  2Y75 A;  3F8F A;  3RKW A;  1RZ4 A;  2CFX A;  3CO7 C;  4CO8 A;  1XGO A;  2EJR A;  3TOB A;  3TO7 A;  3F8B A;  1U2W A;  2HKO A;  2QUF A;  5ILS A;  3MFK A;  4EM0 B;  3ZMS A;  2OU2 A;  4UVC A;  4YIF A;  2DLL A;  2OA4 A;  3DXJ F;  2VC0 A;  4G8X A;  3D5L A;  3GWZ A;  5E1X A;  3ABT A;  2D1V A;  4O5V A;  4G7H F;  3CUQ B;  1S29 A;  4A6E A;  1U5T B;  3QAH A;  1K78 A;  1SD5 A;  5F6F A;  2HTJ A;  3KLO A;  4PGH A;  3V7R A;  3REO A;  2PN6 A;  1XSX A;  2UXX A;  5KK1 A;  3GW2 A;  5HVQ C;  2RV8 A;  3L2C A;  2D2W A;  2KIU A;  3FZV A;  3MWM A;  3ZQ7 A;  3U9G A;  1BI1 A;  4K2E A;  2HEO A;  3ZMD A;  1CF7 A;  4ZZD A;  4L9V A;  2QLZ A;  2ZXJ A;  1D8K A;  4NHJ A;  1T39 A;  5CVJ A;  2Z9O A;  1T0F A;  5CYV A;  1PDN C;  5AON A;  3QOP A;  5LGT A;  2XAF A;  2WTE A;  5LLQ A;  3BOQ A;  4G94 A;  3VB2 A;  1XB4 A;  5E18 F;  2QQA A;  1KU3 A;  1FY7 A;  4AVP A;  1I1S A;  4HLY A;  5FFX A;  2BEO A;  5TJJ A;  2V1D A;  2DW4 A;  4ON0 A;  3I58 A;  4WX9 A;  3ECH A;  2LSO A;  2XRO A;  4A2U A;  2HYG D;  3S2W A;  1G4D A;  2VT3 A;  3BPV A;  1BBY A;  4Q4Z F;  5J8F A;  3M8E A;  4G6Q A;  3EYI A;  1FSE A;  4N9I A;  2V1U A;  2L01 A;  2VBW A;  2DPU A;  2GWR A;  2L54 A;  3FM3 A;  3E6B A;  4IXA A;  1FBU A;  4IRI A;  5E20 A;  4BHB A;  1PP8 F;  2ISY A;  4HAM A;  3WTT C;  2EA4 A;  4OU0 A;  5JHU A;  5FFZ A;  1MDM A;  1OR7 A;  4MQ9 F;  2QYO A;  4KYW A;  3RJP A;  4KFC A;  2VC1 A;  3K1N A;  2M45 A;  3KP3 A;  4LK0 F;  4RB3 C;  1SD7 A;  1G6N A;  3KP2 A;  4AWX B;  1T2K A;  1KU9 A;  2ZNY A;  3VEP A;  2IVM A;  2R3S A;  2OZU A;  2DU9 A;  2OD5 A;  3B73 A;  1IN4 A;  1TW3 A;  1IRF A;  2ZFW A;  3QP6 A;  1O7F A;  1DPR A;  2LDU A;  1A04 A;  3RIR A;  5HDG A;  2BYV E;  1R5G A;  3K9T A;  5E1W A;  1U6G A;  1YYV A;  2O3F A;  4HX8 A;  1LDD A;  3FWE A;  2L3D A;  1WQ2 A;  1B9N A;  1XN7 A;  2A68 F;  2Q8K A;  1XDS A;  2P8T A;  1T6S A;  4KUM A;  3QU6 A;  2DPD A;  1UCR A;  1WWX A;  3ROU A;  3ZMV A;  3GYH X;  2P5K A;  3V8K A;  2Z5U A;  3F21 A;  1J2X A;  3H3U A;  4IVN A;  3L9F A;  3JAM K;  3QP5 A;  3I53 A;  2X0L A;  2PMU A;  5D8L B;  4OIP F;  3NEU A;  3BZ6 A;  4HDU A;  3F3X A;  2GIV A;  2YSR A;  3J80 K;  2V9V A;  5ICE A;  4KN4 X;  5FLX Z;  1K6O A;  5L3D A;  3G3Z A;  2IA1 A;  4M73 A;  2QWW A;  1Z6T A;  2RVC A;  3RPQ A;  1QO0 D;  4MEY F;  2CO5 A;  4O6J A;  3RKX A;  4L0Y B;  5FGM A;  5DEQ A;  3WGG A;  2ESN A;  2HR3 A;  4OOI A;  1FNN A;  4U7D A;  1ON2 A;  5LBQ A;  1J9I A;  2DT5 A;  1LVA A;  1UHM A;  3QPH A;  2BGC A;  2FBI A;  1W7P B;  4RAZ A;  2L4M A;  1KYW A;  3BP8 A;  1R5H A;  5A2Q K;  5DCM A;  3WU1 B;  4WXC A;  3SZT A;  3WGI A;  4WK8 F;  3FHZ A;  3F6O A;  1BC8 C;  3IRR A;  1S6L A;  2IJL A;  1AWC A;  2UWM A;  2A07 F;  1FZP B;  2XHK A;  2K4B A;  1V3F A;  3COA C;  1R1T A;  3FMR A;  2ZCW A;  4BYY A;  2M30 A;  1J0R A;  3BJO A;  4A0X A;  4I09 A;  2ISZ A;  4HA8 A;  3J81 Z;  1ZG5 A;  5K5Q A;  2E1C A;  3KP7 A;  3G73 A;  4WWC A;  2Y48 A;  4EM2 A;  2IW5 A;  3IKT A;  3KEQ A;  2MC3 A;  4G7O F;  3I4P A;  4IJA A;  3JSP A;  2GZW A;  2G9W A;  1J75 A;  2XVC A;  1ZRC A;  1FP2 A;  4ESB A;  4HW0 A;  4A5M A;  2IRF G;  4NQW A;  4AD9 A;  4L5I A;  2COM A;  1WKM A;  1KA8 A;  3T8T A;  2QZ8 A;  3PQK A;  1ZAO A;  4S04 A;  1IAW A;  2LF8 A;  3CUQ A;  4NB5 A;  1U5T A;  1XDU A;  2FU4 A;  3P9C A;  3KE2 A;  1O3R A;  2R7D A;  4RGS A;  3IL2 A;  4CXF A;  3T0Y A;  1P4A A;  3CDH A;  1LEA A;  2EB7 A;  4PZJ A;  1VTN C;  2HKX A;  4GCV A;  2FMY A;  1Y0U A;  5IT9 Z;  1LDK B;  4BAY A;  4U88 A;  5KVR A;  4GYI A;  4JK1 X;  2OQG A;  2QEN A;  3LST A;  3V7S A;  5LGU A;  3N4M A;  3M1E A;  5BOX A;  1MKM A;  2EWN A;  3SFZ A;  4RS8 A;  2DK5 A;  1BIA A;  4P96 A;  3R4K A;  3ML6 A;  5D5V B;  4P55 A;  1TBX A;  2RC4 A;  3HHH A;  4LB5 A;  4KMU X;  5LHH A;  4EMS A;  3K0L A;  2JTV A;  4LK1 F;  3OV8 A;  3TGN A;  2MBF A;  1TQP A;  3HYI A;  5EEG A;  3KP6 A;  1K7A A;  1QGP A;  3IKV A;  2DFI A;  4HQE A;  3KLN A;  5D4R A;  4WXH A;  5LHG A;  4GO1 A;  1RNL A;  2V79 A;  4WF2 A;  4MTE A;  3ERE D;  2WWY A;  4AIH A;  3L7W A;  3RYP A;  1RIO H;  1FWZ A;  4MQV A;  5K5O A;  1I5Z A;  1LB2 A;  1Z1D A;  5JFR A;  1ZN2 A;  4XBF A;  3KZZ A;  2ESH A;  3E6C C;  3ZN1 A;  1IXS B;  2FNP A;  4MNU A;  1HBX G;  3ISP A;  3MCZ A;  4EJW A;  3C1D A;  3F8M A;  5LRS A;  3RTR A;  3GFJ A;  2K27 A;  4M72 A;  3RI4 A;  2CQK A;  2MA3 A;  4KN7 X;  3HSR A;  1ODD A;  3I64 A;  4LLG F;  1YW7 A;  5DV5 A;  4IHT A;  4LLL A;  2VE8 A;  3CUO A;  3M8F A;  1BC7 C;  4MGR A;  5L3B A;  1KYZ A;  3FXQ A;  5J8C A;  1P4W A;  3ELK A;  3ZMU A;  2F2E A;  1D5V A;  3M7G A;  5IT3 A;  4FHT A;  2JT1 A;  3U1D A;  2CWE A;  5L3E A;  1TNS A;  2PMH A;  4HZF A;  2D1H A;  4LG0 B;  1FYM A;  4A5N A;  5EEH A;  4I2O A;  3FF5 A;  3QRF F;  3DPL C;  3K69 A;  4BHP A;  2H27 A;  3H3Z A;  1HW5 A;  3KP5 A;  1TLH B;  4FT8 A;  2VBZ A;  5BPI A;  4M9S A;  4EVI A;  3LFK A;  3I59 A;  2CGP A;  1XGM A;  4XLP F;  4CHU A;  2F5C A;  4IPA A;  1LQ1 A;  4JQF A;  1T38 A;  2YPR A;  1Z91 A;  4H0E A;  2EFW A;  4HQM A;  3TDZ C;  2JPB A;  1OYI A;  4I02 A;  3B02 A;  3RDI A;  1X3U A;  2P5V A;  4HDV A;  4HX7 A;  3I71 A;  2EFQ A;  2PG4 A;  2M1B A;  2EV6 A;  1USS A;  2L02 A;  1KQ8 A;  4L9J A;  2FOK A;  1SAX A;  3MQ0 A;  5LEK A;  3W6J B;  1F5T A;  5HLH A;  1FC3 A;  1KU7 A;  1ZYR F;  1EH8 A;  4A6D A;  1FYK A;  3W6K B;  5K1Y A;  5H6Q A;  1SFU A;  4L0Z B;  2H09 A;  1T98 A;  4HF2 A;  3GZ6 A;  1KQ9 A;  3M9A A;  2E7X A;  1MGT A;  5BMZ A;  2QBY A;  2MLK A;  1W7P A;  4M6Y A;  3I5U A;  5E8G A;  3K1P A;  1ZG1 A;  3V8L A;  2J5P A;  2W24 A;  2V6C A;  3KCC A;  2Z3Y A;  3JTH A;  1YQA A;  2EK5 A;  4FX4 A;  3E97 A;  5DUK A;  2W57 A;  4PDK A;  2CSO A; 
#chains in the Genus database with same CATH topology
 1TT5 B;  3GX4 X;  2WC2 A;  1ENH A;  3KEY A;  1BW6 A;  4L9N A;  2P5L C;  4HF0 A;  2R7W A;  3BR0 A;  5M5W J;  2E35 A;  1UZC A;  3E6D A;  2L9N A;  2BHY A;  3BRO A;  4BJ5 C;  2BY1 A;  5EZH A;  1O3S A;  3R61 A;  1OCZ H;  3F0C A;  4N9H A;  1XX5 A;  2CFO A;  3CTA A;  5D5U B;  1S5L C;  3GCM A;  3I0T A;  4HOB A;  2VQC A;  1F1Z A;  5LRR A;  3WE2 A;  1RUN A;  3K4J A;  2M9H A;  3Q0V A;  2F4O B;  3B6C A;  4FX0 A;  4CCL A;  4HBL A;  4I0A A;  2L9V A;  3F8N A;  4DBQ A;  2C6Y A;  3SZP A;  2DN0 A;  4TV7 A;  4U7B A;  1HLV A;  2JPC A;  3W2W A;  2F4M B;  4ENJ A;  4I98 B;  1GT0 C;  4DIQ A;  2E5N A;  3OY9 A;  2OZ6 A;  3K1M A;  3OYG A;  4UVB A;  3E5U A;  3WTW C;  1TQI A;  2K40 A;  2P6S A;  1CF7 B;  4W1U A;  3W3C A;  3BR5 A;  3T5X A;  3BG6 A;  1W5S A;  3WG7 H;  3S2H J;  2X48 A;  2K4J A;  4C2T A;  1R36 A;  1D8J A;  1IN7 A;  2UZK A;  3GFI A;  3HRU A;  2HDD A;  3CF5 F;  2M8E A;  3F8C A;  5H6R A;  4EGZ A;  4IL6 C;  1YO5 C;  4HV6 A;  4EM1 A;  2ZME B;  3SXY A;  5F1R A;  4A3M J;  2XV4 S;  1HW2 A;  3DEU A;  1VQL I;  2Z2S B;  3LA3 A;  2ZB9 A;  1P4X A;  2LKP A;  3O8H A;  4C3H J;  5HOO A;  4RLQ A;  1DPU A;  3CF2 A;  2K9Q A;  2J5O A;  1R6R A;  4BKX A;  2LD5 A;  2FQ4 A;  4CCM A;  1JHH A;  3FBN B;  2LKX A;  2NRA C;  1X3Z B;  1HC8 A;  2HOT A;  3HEF A;  2E1N A;  4DZP A;  4DQ2 A;  4CYD A;  3ABL H;  3IWZ A;  2TRT A;  3K4L A;  3WTV C;  1O3Q A;  2P7V B;  1WJ5 A;  2FA5 A;  3GTG J;  5CVI A;  1IW7 F;  4AYB A;  3K2A A;  3E3V A;  3JRD A;  3S2D J;  1BN5 A;  3ZOB A;  4B09 A;  4MTD A;  3IC7 A;  1BL0 A;  4UUV A;  3UKG A;  3WU2 C;  2B9S A;  1BI3 A;  3WHB A;  1YJ9 I;  3I54 A;  1K83 J;  4AIK A;  3S1N J;  4M3F A;  2CUF A;  3S3N A;  2EV5 A;  4PK4 A;  3PL8 A;  2RNJ A;  1YE9 A;  1ZRE A;  1R58 A;  1G3Y A;  2K3F A;  1LFU P;  4OIQ F;  2ELH A;  3TQN A;  2L0K A;  3VFZ A;  2CRG A;  2ZXI A;  4UY8 I;  1LDJ A;  2EZH A;  1FMV A;  1B6A A;  1ZG3 A;  2F5E A;  2LVS A;  3JRG A;  3BQY A;  4PGG A;  3C2B A;  4JX5 A;  4OMZ A;  5FD5 A;  3HGY A;  3TO6 A;  3BC8 A;  2DJI A;  3V4G A;  5DUI A;  3JRC A;  2IA2 A;  4M74 A;  3DTI A;  3OYK A;  5DDG A;  3HOZ J;  2FF4 A;  1W7P D;  1SFE A;  4AID A;  1UG2 A;  3HOS A;  2R4G A;  2OUM A;  5D5X B;  1SD4 A;  1U0J A;  2LP0 A;  5DM6 F;  1MDM B;  2FRH A;  2AS5 F;  4RAY A;  3BR2 A;  5KAF C;  2V1N A;  2VT2 A;  3GO5 A;  2EPF A;  3H1C A;  4M3E A;  3S3O A;  1X1B A;  2G7H A;  3HRS A;  1VQP I;  4LD5 A;  3QYE A;  1VQ9 I;  2R7Q A;  3OIQ A;  1HKT A;  5L3G A;  3BT9 A;  1HST A;  3WE3 A;  3LL7 A;  2CV1 A;  1XCV A;  3BQZ A;  3ASO H;  3HXL A;  2XPW A;  4OIN F;  3R6S A;  1ZGA A;  2L7K A;  1Y0N A;  1D0Z A;  3LSR A;  3GTP J;  2NYX A;  2Y9Y A;  5IP9 J;  2LR8 A;  1REP C;  4BQA A;  1J09 A;  2P4W A;  2PFB A;  4XSX F;  1H0M A;  1G8X A;  2DA7 A;  4XID A;  3FM5 A;  5FLX K;  3TP0 A;  3A01 A;  3IRQ A;  1GVD A;  2DMU A;  2DK8 A;  3OYI A;  1BI0 A;  4XLN F;  3F6V A;  3GFM A;  3OIO A;  1APL C;  3MKY B;  1ZR2 A;  2NVT J;  5BPD A;  3BJ6 A;  4ESF A;  5DS9 A;  3TBI A;  2DQR A;  2DO7 A;  3K4N A;  1I3A A;  2Q2E A;  3WG9 A;  4KA4 A;  3WTY C;  1K4T A;  3K6G A;  3DPT A;  3LSP A;  2JVG A;  1IDZ A;  1GVJ A;  4ZJZ A;  2LRD A;  4N0B A;  2V9K A;  5AIP A;  1YS7 A;  2F5D A;  3AG4 H;  1QZZ A;  2ECC A;  1ZK8 A;  1WSU A;  1IRX A;  4HNT A;  2FBH A;  2EFN A;  1ONV A;  2GBY A;  2Y0M A;  3CCY A;  3KIO A;  2RQP A;  3KPH A;  1MMA A;  2B0L A;  2WB1 N;  4P9F A;  5J4V A;  3I4M J;  3TDU C;  2NS0 A;  2E2H J;  3VYU B;  3K4M A;  4I7H A;  2FNA A;  1VZ0 A;  2EFO A;  1W0U A;  4DW6 A;  4JX6 A;  2JUC A;  1WI9 A;  1YRN B;  5ERI A;  3DF8 A;  2ADU A;  4MFE A;  2QVO A;  1B72 B;  3OL4 A;  4Z2Y A;  2KIQ A;  4PSW A;  1FBS A;  3TL4 X;  2HU9 A;  1QA6 A;  4XL9 A;  2MH2 A;  1G3W A;  2Z99 A;  2ID6 A;  2OBP A;  2X4H A;  2ZJ2 A;  3NAR A;  5DCF A;  3G71 I;  4LIT A;  2IPQ X;  2G7U A;  2XKO A;  4UXN A;  2KHM A;  2O8X A;  4J19 A;  2R5Y B;  3VSL A;  1QBJ A;  4KIF A;  4ZYH A;  2IA0 A;  2R92 J;  2CUJ A;  1RES A;  4UB8 C;  5M3M J;  2VXZ A;  2P7C B;  2GOX B;  1SMT A;  2ZNZ A;  2B63 J;  2VJ4 A;  3HOX J;  2ZBK A;  2DA3 A;  3H3V K;  1L0O C;  1JUS A;  2KJB A;  4ANJ A;  1GV2 A;  2VXD A;  4YG2 F;  2O61 A;  1N25 A;  1Z0X A;  1YJN I;  4X6A J;  1DGR M;  2A3S A;  2OCC H;  3SEZ A;  3Q0U A;  1JE8 A;  1IO2 A;  3OOP A;  5DYM A;  2NVX J;  4U0V A;  3F9K A;  2V7F A;  2CW0 F;  1T08 B;  3BR6 A;  1FYL A;  1T33 A;  5GAG J;  3J81 K;  2NNY A;  2KZG A;  4Q5S F;  1OLT A;  1I6H J;  2VKE A;  3GVA A;  1UFM A;  1BOA A;  4IHX A;  3HOU J;  5JVG F;  3RYR A;  2DFF A;  2L2O A;  1FPQ A;  3KYC B;  3LA7 A;  1QRY A;  5HDK A;  3MMY B;  1IN8 A;  1V54 H;  2ZXW H;  3HJE A;  3F22 A;  1GLN A;  1CGP A;  3C3W A;  2RNG A;  2DAO A;  3GEZ A;  5E3M A;  3FXK A;  3H0G J;  1RRJ A;  3GLX A;  4E7I A;  5HS7 A;  1Z3Y A;  5JR3 A;  4WXD A;  3SHF A;  4F7Z A;  1HCR A;  2VKH A;  1U78 A;  3TO9 A;  1R00 A;  2M0C A;  2IP2 A;  4XIC A;  1DGW Y;  4GYG A;  1V55 H;  4BY7 J;  3GXO A;  4JBA A;  1KON A;  1R23 A;  3EYY A;  3IHU A;  1RI7 A;  4XNF A;  2XGE A;  4DOZ A;  4XR6 A;  3HPH A;  1YIO A;  4BXU A;  4LG0 A;  1V5F A;  5JI6 A;  1W5T A;  1JKQ C;  2BBY A;  2R0Q C;  1KU2 A;  2K3P A;  1I6X A;  5J1Y A;  5E8I A;  5K5R A;  3HOW J;  5DCM B;  2W84 A;  2H8R A;  1XSD A;  1NH3 A;  1JJ6 C;  1MMD A;  1XMK A;  4U87 A;  3CCR I;  2Y2Z A;  5F08 A;  3LA2 A;  2LF7 A;  3L09 A;  3HTU A;  5FLM J;  1FP1 D;  3DQV C;  5HDN A;  1PP7 U;  3A0B C;  3HC7 A;  1Y1V J;  2V26 A;  3MZY A;  4IHS A;  2FEZ A;  5FB2 A;  1SD6 A;  3CLO A;  2CUZ A;  2MAB A;  5K7H A;  1YLF A;  1G3S A;  3R0J A;  2KRF A;  1D1A A;  2M3A A;  3K4B A;  1EA3 A;  3D5S C;  1R49 A;  4DBR A;  2MFZ A;  4YFN F;  1ZGJ A;  4Y33 A;  1MND A;  3K2Z A;  4G6T B;  3FXL A;  3Q5F A;  1P7J A;  3P9K A;  4AUX A;  3T1B A;  2XB5 A;  2DCE A;  4A0Z A;  1JTY A;  1IZ1 A;  1SVL A;  2M2E A;  4ITV A;  5HS9 A;  2X1C A;  2ZXH A;  4EJV A;  2H6B A;  4KMF A;  4I0B A;  5IT9 K;  4QWQ A;  1Z6R A;  3RPU A;  3DFG A;  1JGS A;  2R7F A;  1UB9 A;  2BY2 A;  2XSJ C;  2F6C A;  3BY6 A;  3AG2 H;  4A93 J;  2DBB A;  1AKH B;  1IXC A;  2L4A A;  4XON A;  2R5Z A;  1V4R A;  4NC6 A;  3S14 J;  1A5J A;  1LEB A;  3HUG A;  4L9T A;  4CZZ A;  2WY7 Q;  4ZH4 F;  3KEO A;  1MSE C;  2JSC A;  2WAE A;  4A0Y A;  1J5Y A;  2MD0 A;  3WTX C;  1QVU A;  1YIT I;  2XC7 A;  1ZKG A;  3GTO J;  3E5Q A;  2K02 A;  1UG0 A;  2XAH A;  3IAM 2;  3CES A;  1AHD P;  2EIK H;  2KT0 A;  3A03 A;  3LQQ A;  3ERM A;  3EQL F;  3ZQH A;  2N8G A;  5D4S A;  1X4O A;  1IXR C;  2VJJ A;  4S05 A;  1R1U A;  1K6Y A;  1JI8 A;  4ASN A;  2EA2 A;  3A0H C;  4ZZL A;  1ZLK A;  4NQW B;  4II2 A;  2DQL A;  1TQM A;  1WH7 A;  1WGX A;  2LKS A;  1SFX A;  3EPZ A;  4NNJ A;  5F04 A;  4BHC A;  4UUS B;  4KIG A;  1MMS A;  2WV0 A;  5L3F A;  1KQ0 A;  1SMY F;  1WJD A;  3V42 A;  4ZYE A;  3BZC A;  4U0Y A;  2XKP A;  1B8I B;  5KNL A;  4UNO A;  1Y8Q B;  3ONQ A;  1HDP A;  5E3L A;  1PUE E;  1BIB A;  1STZ A;  3QU3 A;  4BUP A;  3PNY A;  4RAG A;  5EEA A;  5GTH C;  5EG0 B;  2R7U A;  3SJM A;  3Q0W A;  2KIM A;  3MD2 A;  3HHG A;  3ZXS A;  1XCB A;  3KX2 A;  4ENN A;  2COB A;  2XGD A;  4QIW N;  2YU3 A;  4KNY A;  1ZHF A;  1Y6I A;  1TL8 A;  1ETV A;  1XSV A;  2KMU A;  1ZQ3 P;  1IC8 A;  2TDX A;  3MEX A;  3LFU A;  4QPO A;  4KT5 C;  3WOD F;  3LSK A;  4GRI A;  2CQX A;  5E17 F;  1V5G A;  1BR2 A;  2QSG X;  1Y8R B;  2GOM A;  3JW4 A;  1UST A;  1DDN A;  2EIM H;  4UB6 C;  3HOT A;  3RQI A;  4MHG A;  3CDL A;  3R60 A;  2HYJ A;  2OCE A;  2Y30 A;  1FIA A;  1YW9 A;  3G1M A;  4A3C J;  3NAU A;  2HDC A;  1Q1H A;  1S7E A;  2JRT A;  3SDG A;  6PAX A;  2WAD A;  1Y39 A;  2DA1 A;  3ZQQ A;  2ELJ A;  3FIS A;  3AG1 H;  3JTG A;  1B1B A;  2KDZ A;  2LY1 A;  2YR2 A;  1PVE A;  4UVA A;  1MJ9 A;  3C7J A;  4DYQ A;  3J7A O;  2ME0 A;  4XSZ F;  3F72 A;  4L18 B;  3DLA A;  3E5X A;  4G9Y A;  4C2M J;  2MLG A;  1SFO J;  5JVT A;  1T0F C;  1U9N A;  2PMZ A;  3GZ5 A;  3I9V 2;  4DJA A;  4Z6Y A;  3LAJ A;  3GTL J;  1FJL A;  2BVM A;  1S7O A;  4HLX A;  1A36 A;  3N97 A;  4BQO A;  1NHA A;  2PEX A;  2V4J C;  3OL3 A;  2JA6 J;  1GHC A;  2Y0S A;  5GPC A;  5C44 J;  4XQF A;  3N05 A;  4MEX F;  1IUY A;  3ZP5 A;  2W25 A;  1R7J A;  2VN2 A;  2XAU A;  1ZH5 A;  3V8J A;  2ZME A;  5HS8 A;  4RGU A;  3TMO A;  3RCO A;  1J7K A;  3O8G A;  5BS6 A;  2A05 A;  3LSJ A;  4JYK A;  1OQY A;  3O2P E;  5E1Z B;  4KDP A;  1P92 A;  2ME6 A;  5JLX A;  3BJA A;  1WI3 A;  4OMY A;  2LC2 A;  1MMN A;  4ZYD A;  5KAI C;  1O57 A;  2O03 A;  5ICC A;  3EET A;  3BPX A;  3RPU D;  4Y7N J;  2VQG A;  3DKX A;  4HEA 2;  4PJM A;  3M07 A;  1BJA A;  3O3K A;  1VQ7 I;  1FEX A;  2DTZ A;  5J6X A;  1IUF A;  1GXQ A;  2MH9 A;  1D3Y A;  5ICG A;  4JX4 A;  4B1R A;  1IDY A;  4BGD A;  1RUO A;  2BW3 B;  3FMS A;  3ZQG A;  2K9S A;  1VQN I;  4ENK A;  1FSH A;  3L2U A;  4E7K A;  3PUB A;  2WAQ N;  2FE3 A;  2MD5 A;  4RGR A;  2UV1 A;  1G3T A;  2ZJP F;  1ULY A;  2BXY A;  2DMQ A;  2LNB A;  3HTS B;  4LOC A;  2JA5 J;  1J59 A;  2GAU A;  3K4K A;  1ACI A;  1A6I A;  3IUO A;  3T8R A;  2A69 F;  2ZJQ F;  2E34 A;  4E6K G;  3LQR A;  3DLL F;  1KGS A;  2EZK A;  2HS5 A;  1HXD A;  1XPX A;  1LPQ A;  3DTE A;  2QQ9 A;  2I5U A;  2GXA A;  2P6T A;  4ZTF A;  3L1P A;  4CSW A;  2BOL A;  2DOF A;  1D1B A;  2PX9 A;  4IRG A;  4FE7 A;  2I8D A;  1AA7 A;  3P7N A;  4PSX A;  2VLA A;  3PSI A;  2K7L A;  2OAZ A;  4RLF A;  4NUB A;  4CH7 A;  1FMW A;  3HL2 A;  4O3M A;  3K70 C;  4BAC A;  2O0Y A;  4C30 A;  4FIS A;  3BWG A;  1JKP C;  4GDF A;  1OMI A;  1P9Q C;  2DFE A;  5HLI A;  1I27 A;  3UNG C;  2M4K A;  4B8X A;  2OC6 A;  3C2G A;  4GGG A;  4YFK F;  2XUB A;  2ZC2 A;  2EIN H;  1W4M A;  3ABM H;  2IT0 A;  5CVU A;  3AAF A;  4MFD A;  3CD6 I;  4A12 A;  1FBQ A;  1R5I D;  3CQZ J;  3WU0 A;  2UXN A;  1S3J A;  2JZY A;  2M0M A;  3PUF A;  1B59 A;  1LUJ B;  2L7M P;  2PJR A;  4AIJ A;  2DDA A;  5FKK A;  4EGY A;  1K78 B;  1QHG A;  4IX7 A;  2VBX A;  2DI3 A;  2KKO A;  4YEJ A;  3W6V A;  2Y9Z A;  2JA8 J;  2BE5 F;  1LNW A;  1IRG A;  3JAM Z;  2A5Y B;  1WRJ A;  2RQQ A;  3CCU I;  4IOA F;  4CDG A;  4EJO A;  2F5F A;  3LSM A;  2FSW A;  2HWV A;  3QPT A;  3ZN0 A;  2V9P A;  2PJP A;  4M6V A;  1IN6 A;  1VFC A;  4I99 C;  2GM4 A;  4P5O A;  2BXZ A;  2CQN A;  2VI6 A;  3DKW A;  3FX3 A;  3S32 A;  4AVZ A;  1OYY A;  3J80 Z;  3KFW X;  1YX3 A;  2AXT C;  4RDU A;  1BOB A;  5D6F A;  1MZB A;  1YFH A;  5IYB J;  2VE9 A;  1FOK A;  1N78 A;  1MBG A;  2O7O A;  1XGN A;  1GXP A;  2GA1 A;  1JHF A;  2H6C A;  5CVR A;  1H9G A;  5BQT A;  3VYR B;  4Y17 A;  2NOJ B;  2DA4 A;  1XD7 A;  1YI2 I;  4IHY A;  3RZO J;  2XIG A;  4XRF A;  3OIP A;  2D45 A;  3S15 J;  2W00 A;  2O6G E;  4XRM A;  3HKZ N;  1ZR4 A;  1C0W A;  2PQ8 A;  1YRN A;  2H1K A;  1XMA A;  1YS6 A;  2JQ7 A;  4BXF A;  5LEJ A;  2E2J J;  2CYY A;  3I59 B;  1LJ9 A;  1QNT A;  3OS1 A;  1P6R A;  4Y3O A;  1H9T A;  2DA6 A;  2QKL B;  3Q9V A;  4NC7 A;  5DD4 A;  1OPC A;  4XKW A;  1O3T A;  2VOP A;  3GLL A;  3X2Q H;  1X58 A;  1AOY A;  4R8H A;  1P2F A;  1F4K A;  3M1C A;  2TCT A;  2HZT A;  4KJZ A;  1QQI A;  3H36 A;  3HM5 A;  3Q3S A;  5A2Q Z;  1IF1 A;  1T8I A;  3R0A A;  3W2V A;  2IAI A;  4L5J A;  2KRC A;  3EUH A;  2RGV A;  1ETQ A;  4IRH A;  5D6E A;  3VWB A;  1QZY A;  3M8J A;  5FD6 A;  3Q9S A;  2QQ8 A;  5FKL A;  2FD5 A;  4BJT A;  4XM3 A;  3SQN A;  2P81 A;  2Q0O A;  1OKR A;  2HYF A;  3FHN A;  2MGQ A;  2FML A;  2LH9 A;  3H9G A;  1G2H A;  1YW8 A;  2M5W A;  4CGZ A;  3MAJ A;  4Q47 A;  2MG4 A;  1DU6 A;  1HA8 A;  4XOR A;  5CQG A;  1U8R A;  2FBK A;  1RKT A;  1YIJ I;  2A6E F;  3PFY A;  2QA4 I;  1ZGW A;  1HF0 A;  4Y13 A;  3A02 A;  1EH6 A;  3ECO A;  3FXU A;  4B4C A;  5TRD A;  2NAZ A;  3AFH A;  4CIC A;  3HSF A;  4PCQ A;  2VON A;  1BM9 A;  3K4C A;  5D5W B;  1ZAR A;  1MIJ A;  1FLI A;  1S8N A;  3K10 A;  3P9I A;  5J3L A;  2AXL A;  2LK2 A;  1I39 A;  2E1M C;  2HZD A;  4V2G A;  3IH4 A;  4BJ6 C;  5LGN A;  1JGG A;  3MZH A;  1OYW A;  4M9X A;  3L00 A;  3S17 J;  4M71 A;  5HLG A;  3GF2 A;  1ZRD A;  3S16 J;  4ZDO A;  3I4N J;  2CQ7 A;  4BL0 B;  2XGC A;  3UR3 C;  4B43 A;  5ED4 A;  1E2X A;  3ZMT A;  5F0H A;  5FKO A;  4UV8 A;  5CPR B;  2HNH A;  1Z7L A;  4R1H A;  1X1A A;  2FUG 2;  5J40 A;  1XGS A;  4HYE A;  4RAF A;  2QBY B;  5J1R A;  2FJ1 A;  2XF5 A;  2WBM A;  2KIF A;  5DD8 A;  1W36 C;  3SEQ A;  5J1U A;  3GUD A;  3GTJ J;  1F9N A;  1K79 A;  4D0P A;  4F91 B;  2STT A;  4G6D A;  5F64 A;  5TIS C;  1TNT A;  2VBY A;  1ETW A;  1R22 A;  2W85 A;  4ETS A;  1ZRF A;  1MH3 A;  3E0J B;  1Z05 A;  3ZPL A;  2LRE A;  1FTT A;  2IS6 A;  5ICF A;  3SDB A;  4XRS G;  3OYH A;  2XAQ A;  5CVV A;  3WTU C;  3HRM A;  4UHT A;  2PLY A;  3KET A;  4LMY A;  1K4S A;  2ELK A;  1FX7 A;  2OV7 A;  3IWF A;  4C2U A;  3KP4 A;  3FXR A;  3G2B A;  4ZYG A;  4II3 A;  1S7A A;  1Z9C A;  4EJT A;  3CO6 C;  1LKX A;  3TKY A;  2PBI A;  2BV6 A;  4X1E A;  2K9N A;  5ILV A;  4XKC A;  3TOA A;  3G6E I;  5HOD A;  1JXS A;  4P1W A;  2WAF A;  1B9M A;  1OCC H;  4CYC B;  3L2R A;  4AYB N;  1DUX C;  2L7F P;  1HKS A;  3DBL B;  1TWC J;  3OWT A;  3RKY A;  4ESJ A;  2YX4 A;  5AIQ A;  2EV0 A;  4FAS D;  2EFP A;  2QCO A;  4B48 A;  1HW1 A;  3ABU A;  2EIL H;  3VOE A;  3OYA A;  2D5V A;  2XRN A;  4YFX F;  2RN7 A;  2HQN A;  2DTR A;  2OPT A;  3BTI A;  4LGW A;  5L3C A;  5ILU A;  4HST A;  2VOO A;  1BI2 A;  3U21 A;  1O7L A;  4Q48 A;  4IQ4 A;  3ULQ B;  1MBH A;  1WPK A;  4EEF G;  4BXX J;  2GQQ A;  3MKL A;  5TGT A;  4RB1 A;  3K7A J;  1MNM C;  2E36 A;  2DYS H;  1R71 A;  2BY3 A;  4E70 A;  2RKH A;  2LBF A;  2XAJ A;  2GXB A;  3HIF A;  4DNC A;  1JT0 A;  2QQB A;  4EAT A;  1E0E A;  2R7S A;  2LY9 A;  1X2M A;  2E7W A;  5CKT A;  2XGX A;  2MW8 A;  4LJZ F;  1MD0 A;  1PUF B;  2CS3 A;  2FXA A;  4IKF A;  4LLN A;  4XOT A;  4FET A;  4RGX A;  3BDD A;  1MJA A;  2K85 A;  3DP7 A;  1QZE A;  2HVS A;  1E17 A;  1EV7 A;  4IF4 A;  2H94 A;  3LAP A;  4BE1 A;  1RKW A;  4XKV A;  4BEH B;  4EQQ A;  1DQU A;  2RDP A;  4UUS A;  4WCG A;  1I1G A;  3KZY A;  3D0S A;  1E3H A;  1PJR A;  4EJU A;  3C18 A;  4GXO A;  3OYF A;  1B8I A;  3DU6 A;  1QU3 A;  1FOX A;  3V7C A;  3ASN H;  3HSE A;  2PI0 A;  1B4A A;  4I6Z A;  2ETH A;  2X6O A;  1RR8 C;  1TTY A;  5GAH J;  1EJ9 A;  4CCK A;  2YX7 A;  3CUQ C;  3NQO A;  2XAS A;  2Z33 A;  4P9U A;  2HXO A;  1U5T C;  3PQJ A;  1OCT C;  1R4N B;  1MW7 A;  4OIO F;  2NNN A;  4BH9 A;  1TW2 A;  3JRI A;  3RZD J;  4DZJ A;  1WH5 A;  4N4O B;  2KJC A;  3O6B B;  4A3I J;  1JUP A;  2DDB A;  4OAY A;  3PIP F;  1DP7 P;  4EV0 A;  1R1V A;  2RAE A;  1HKQ A;  4C3J J;  4Y15 A;  3PO3 J;  3PFI A;  2XAG A;  4M6X A;  4F55 A;  1Z7U A;  1P7I A;  2VOD A;  4M9Z A;  4OIR F;  1LFB A;  2CV2 A;  3WTS C;  3E1S A;  2E1M B;  3CP2 A;  1N75 A;  5H20 A;  5C3E J;  5CJ9 A;  2E19 A;  4RB0 A;  3HRT A;  4BNC A;  3VDX A;  1L3L A;  1WJC A;  3C2H A;  4XKB A;  3WTZ A;  1GDT A;  1EH7 A;  3HZJ A;  2M4G A;  1M1E B;  4R79 A;  2LG4 A;  1ZTR A;  3EDP A;  4XN0 A;  2V1X A;  2EQR A;  5C4X J;  4HX4 A;  3OS2 A;  5CLS A;  1WFX A;  4U0W A;  1ZLJ A;  4ZDL A;  3U2R A;  4I01 A;  5FLV A;  2QM3 A;  2E71 A;  3WGH A;  2HVR A;  1PYV A;  2ACJ A;  3LWF A;  1ON1 A;  1YTY A;  1QVT A;  1I3Q J;  3H92 A;  1ZEL A;  2HQR A;  5E3N A;  1U3E M;  4ABZ A;  2HOE A;  2CG4 A;  3JRA A;  2GA2 A;  1JKR C;  3CJN A;  2HOS A;  1QPM A;  2M87 A;  2M8G X;  4LB6 B;  4QSH A;  1FT9 A;  3BZK A;  2R7T A;  2STW A;  1N77 A;  2OQR A;  3A01 B;  2XF6 A;  2BZT A;  2FQ3 A;  2KZV A;  3G1L A;  1MJB A;  4G7Z F;  2DOD A;  4YII A;  4H4K C;  5FO5 A;  4KIB A;  1YG2 A;  2HTS A;  3F23 A;  4HV5 A;  1WVR A;  2DOE A;  3G1O A;  3FMQ A;  1X3W B;  5H2F C;  1VI0 A;  1HOM A;  2Q2E B;  3GFL A;  1IN5 A;  3E6M A;  5D8K B;  2A6H F;  2JJ7 A;  3ZMZ A;  2HGC A;  1WJF A;  5F0C A;  1VF9 A;  3DV8 A;  3OYM A;  3KYD B;  2MYS A;  2HQA A;  2YUS A;  3VOD A;  2O8K A;  1XC5 A;  2BW3 A;  1TWG J;  2HFH A;  1HSJ A;  3NRV A;  1WJE A;  4ZYA A;  3JSO A;  4QLC U;  1HQC A;  2ZO4 A;  4E7H A;  2A61 A;  2ZKZ A;  4UV9 A;  4ENM A;  2CW7 A;  3OYL A;  2EIJ H;  1ERD A;  3FDY A;  4LFU A;  4RB2 C;  2H1L A;  4KIC A;  2K86 A;  3TW6 A;  4L5E A;  4HF1 A;  3LNQ A;  1UHW A;  3CME I;  3J7Z I;  1ORK A;  1CQT A;  4QPQ A;  5LHI A;  2GXG A;  3OYC A;  4F3Q A;  3LMM A;  2Y75 A;  5EGO B;  3F8F A;  3RKW A;  1RZ4 A;  4Y52 J;  2CFX A;  2ICW G;  3CO7 C;  4CO8 A;  1XGO A;  1NG7 A;  2H8W A;  2EJR A;  4B3A A;  4QTR A;  2IGM A;  4IQJ A;  3TOB A;  4PJ0 C;  3TO7 A;  3F8B A;  1U2W A;  5EJC A;  2CQQ A;  2HKO A;  2QUF A;  5ILS A;  1WJA A;  3MFK A;  1G59 A;  2WV1 A;  3BCA A;  4EM0 B;  4MLO A;  3ZMS A;  2OU2 A;  2IGN A;  1RR7 A;  3IH2 A;  3VYS B;  4UVC A;  2BVL A;  4YIF A;  4XLH A;  2VB6 A;  2I10 A;  2DLL A;  2OA4 A;  2ZFU A;  3DXJ F;  2VC0 A;  4G8X A;  2FOW A;  1SAN A;  4CCO A;  3D5L A;  2G0E A;  4BQN A;  3GWZ A;  5E1X A;  3ABT A;  2D1V A;  4O5V A;  4G7H F;  3ZQF A;  3CUQ B;  1S29 A;  2DMN A;  4A6E A;  1U5T B;  3QAH A;  1K78 A;  2R7X A;  2WAQ A;  1SD5 A;  5F6F A;  1XG1 A;  4KT6 A;  2XRL A;  2HTJ A;  1R9T J;  3KLO A;  4PGH A;  1I50 J;  3V7R A;  3REO A;  2L9S A;  2PN6 A;  1XSX A;  2R7V A;  2UXX A;  3IP4 B;  5KK1 A;  3GTK J;  3GW2 A;  4XOP A;  1NTC A;  5HVQ C;  2EZI A;  2RV8 A;  3KZI C;  5IP7 J;  3CCS I;  3BTC A;  5LD2 C;  1DP3 A;  2LLK A;  3L2C A;  2K9M A;  3BR1 A;  2D2W A;  3QPL A;  2KIU A;  3FZV A;  3I56 I;  3MZ8 A;  3BTL A;  3MWM A;  4BBS J;  1YHQ I;  3ZQ7 A;  3U9G A;  1BI1 A;  2VL8 A;  4K2E A;  2HEO A;  9ANT A;  3ZMD A;  1CF7 A;  4D5F A;  4ZZD A;  1MH4 A;  3SZG A;  4L9V A;  2QLZ A;  3HGG A;  2ZXJ A;  1D8K A;  4NHJ A;  3FXJ A;  4CA0 A;  1MBE A;  2QSH X;  1T39 A;  5CVJ A;  2Z9O A;  3AL0 C;  1T0F A;  4D9J A;  3FKJ A;  5CYV A;  3IAS 2;  1PDN C;  5AON A;  3QOP A;  5LGT A;  2XAF A;  2WTE A;  1IRZ A;  1X1C A;  2ECB A;  5LLQ A;  2ZME C;  3MKZ A;  1ITY A;  3BOQ A;  3QYB A;  4G94 A;  3VB2 A;  1XB4 A;  2P0W A;  5E18 F;  2QQA A;  1D0X A;  1KU3 A;  3H9J A;  1FY7 A;  2NXN B;  3OSF A;  4AVP A;  2X9D A;  5FRM A;  1I1S A;  1POG A;  2VUM J;  4HLY A;  5FFX A;  2BEO A;  3PNV A;  2RRE A;  1YOV B;  5TJJ A;  2V1D A;  2DW4 A;  2F5V A;  2VKD A;  3I58 A;  4ON0 A;  1UMQ A;  2B7E A;  4IOC F;  4WX9 A;  3ECH A;  3OYJ A;  3JRB A;  3BG9 A;  2LSO A;  2XRO A;  3QOD A;  4A2U A;  2L7Z A;  3FIW A;  2HYG D;  2LOO A;  3H5N A;  3S2W A;  1G4D A;  2VT3 A;  4NC8 A;  1TC3 C;  4F52 A;  2DMP A;  3EUK L;  4D5C A;  4X0G A;  2DA5 A;  4A3L J;  3BPV A;  1BBY A;  4Q4Z F;  2R5Z B;  1MMG A;  5J8F A;  3M8E A;  3HUG B;  4G6Q A;  3EYI A;  1FSE A;  4N9I A;  4HRI A;  2V1U A;  2L01 A;  3JR9 A;  2VBW A;  1X1P A;  3FBI B;  2DPU A;  2WA0 A;  2GWR A;  2L54 A;  3FM3 A;  3E6B A;  2XSD C;  4IXA A;  1FBU A;  3D1N I;  4MO7 A;  1UHS A;  4IRI A;  1SFK A;  1SVM A;  5E20 A;  3VSK A;  4BHB A;  2XPV A;  2VPR A;  1PP8 F;  3OMY A;  1NK3 P;  2ISY A;  4HAM A;  5J47 A;  3WTT C;  2EA4 A;  4OU0 A;  5JHU A;  5FFZ A;  1MDM A;  3QYF A;  3BG3 A;  1OR7 A;  5IP6 A;  2OTL I;  4MQ9 F;  4IHW A;  2QYO A;  3I55 I;  4KYW A;  3RJP A;  3FXO A;  2L5Q A;  4PFO A;  4KFC A;  2NS7 A;  2VC1 A;  3K1N A;  2M45 A;  3I3L A;  3KP3 A;  4LK0 F;  4M3B A;  1VQO I;  2PMZ N;  3IV5 A;  4RB3 C;  2W48 A;  3VYT B;  3CMM A;  5M5Y J;  1SD7 A;  3S1R J;  1G6N A;  4CCN A;  3TP3 A;  3KP2 A;  4AWX B;  3CJQ B;  2Y0S N;  1T2K A;  1MNE A;  1KU9 A;  2ZNY A;  2R7O A;  5FKM A;  3OYE A;  1MSF C;  4PJJ A;  3GTQ J;  1Z77 A;  4E4H A;  3VEP A;  1HDD C;  2IVM A;  2QF7 A;  2R3S A;  2OZU A;  5FKN A;  4YRV A;  2DU9 A;  2OD5 A;  4J00 A;  4AM3 A;  2QKM B;  3B73 A;  5FJ8 J;  1IN4 A;  1H8A C;  3PO2 J;  4B3X A;  4YIR X;  1TW3 A;  1FTZ A;  1IRF A;  5HNH A;  3KYL A;  2ZFW A;  3MKW B;  2GLO A;  5JLW A;  3QP6 A;  1O7F A;  1DPR A;  3H35 A;  2LDU A;  5B66 C;  4UUT A;  1A04 A;  1LVK A;  4PFP A;  3RIR A;  1S72 I;  3NWT A;  2E1O A;  4E7S A;  3OYN A;  5HDG A;  4CYC A;  2BYV E;  1R5G A;  3K9T A;  1VQ4 I;  2NVY J;  4BE0 A;  2X85 A;  1SC7 A;  2EBI A;  5E1W A;  1U6G A;  1MBJ A;  3JCU C;  1YYV A;  3J7Y J;  2K5C A;  4C9Y A;  5KCM A;  4PUS A;  2O3F A;  2QGU A;  2JWT A;  4HX8 A;  1WZ2 A;  3LOC A;  1LDD A;  3DEE A;  1W0T A;  4W97 A;  4IO9 F;  3FWE A;  2L3D A;  2F4I A;  1B72 A;  1WQ2 A;  1B9N A;  1XN7 A;  1AU7 A;  1W1W E;  2A68 F;  3FXM A;  2Q8K A;  2O9L A;  4D7N A;  2CUE A;  1EKE A;  3DU5 A;  3AL0 B;  1XDS A;  2P8T A;  2M7A A;  1T6S A;  4KUM A;  3QU6 A;  2R5Y A;  2DPD A;  1UCR A;  1WWX A;  3ROU A;  3ZMV A;  3GYH X;  2P5K A;  3J7A Y;  3S8P A;  1LE8 B;  3BG5 A;  3V8K A;  3HOY J;  2Z5U A;  3F21 A;  2XF7 A;  1J2X A;  1PUF A;  1Z67 A;  3H3U A;  1R4M B;  2KL4 A;  3HB9 A;  4IVN A;  3CC2 I;  3ZCO A;  2F48 A;  3L9F A;  5EYR A;  4KIT B;  3JAM K;  3QP5 A;  3I53 A;  2X0L A;  3L2W A;  1D1C A;  1UJ8 A;  2X6W A;  2PMU A;  2X6Y A;  2QSF X;  4NBQ A;  3EUH C;  4BEH A;  5D8L B;  2DA2 A;  1IJW C;  4OIP F;  3D5R C;  3DWL E;  3BZ6 A;  3NEU A;  2KDO A;  2LMD A;  4HDU A;  3F3X A;  2GIV A;  2YSR A;  4CCJ A;  5IYC J;  3J80 K;  1Y56 A;  2V9V A;  5ICE A;  4KN4 X;  1BW5 A;  2WB1 A;  5FLX Z;  1K6O A;  5L3D A;  1V5E A;  3FK6 A;  3H5R A;  4NDL A;  1RPW A;  3G3Z A;  2VKV A;  2IA1 A;  3LSG A;  4M73 A;  1WJB A;  2QWW A;  1Z6T A;  4ZC3 A;  5GPA A;  5DTD A;  2RVC A;  1GV5 A;  3RPQ A;  4RA2 A;  1VQ5 I;  2KP6 A;  5F1J A;  3MVP A;  1QO0 D;  2VJ5 A;  4MEY F;  2CO5 A;  4O6J A;  4V19 K;  3RKX A;  4L0Y B;  3DTK A;  5DEQ A;  5FGM A;  3WGG A;  3RSN A;  5IOZ A;  2VQL A;  4E7Z A;  2ESN A;  1WCM J;  2HR3 A;  4OOI A;  1FNN A;  4U7D A;  1ON2 A;  2AQE A;  5LBQ A;  3GTM J;  3CC4 I;  5M3F J;  4E7J A;  2DOA A;  4GFB A;  2FX0 A;  2CV0 A;  3RKQ A;  4N4N B;  3CP8 A;  1TWH J;  4A3F J;  5EZG A;  1ETO A;  1J9I A;  2DT5 A;  3K70 D;  2MC4 A;  1LVA A;  1UHM A;  3QPH A;  5F0F A;  2BGC A;  1W5C C;  3CMY A;  2FBI A;  4FQG A;  2KIS A;  1W7P B;  2KFD A;  4RAZ A;  2L4M A;  4J01 A;  2CU7 A;  1KYW A;  2Y69 H;  3BP8 A;  1R5H A;  5IPA A;  5A2Q K;  5DCM A;  3QWL A;  3BTJ A;  3WU1 B;  4WXC A;  2JUG A;  4BY1 J;  3SZT A;  3WGI A;  2IS1 A;  2DYR H;  4WK8 F;  1RET A;  1QHH D;  3FHZ A;  3F6O A;  1EF4 A;  3FK7 A;  1XS9 A;  1BC8 C;  4HSR A;  3IRR A;  4I76 A;  1S6L A;  2IJL A;  1E3O C;  1AWC A;  1IG7 A;  2UWM A;  2PJR B;  2A07 F;  1MBF A;  3H0D A;  1FZP B;  2XHK A;  4HNU A;  1A31 A;  4E7L A;  1A6Q A;  3JRF A;  2K4B A;  3A1Y A;  1V3F A;  4XLA A;  1R1T A;  3FMR A;  3COA C;  1DU0 A;  2ZCW A;  2NS8 A;  4A3K J;  4RBO A;  4Y4R A;  4BYY A;  2E5Z A;  3OR2 C;  1TP4 A;  2HVQ A;  3DCF A;  4RM3 A;  2M30 A;  1J0R A;  3FKI J;  3B6A A;  2LFB A;  3JRE A;  5FRN A;  2Y31 A;  3BJO A;  2ZJR F;  3M3Y J;  3CJR B;  4A0X A;  5K7F A;  4I09 A;  4KIS A;  2DT6 A;  2LTP A;  4A3J J;  2W82 A;  3L2Q A;  1D0Y A;  2ISZ A;  4HA8 A;  4BDZ A;  1F36 A;  3J81 Z;  1ZG5 A;  4LIU A;  5K5Q A;  4BU2 A;  2E1C A;  3BLY A;  3KP7 A;  3G73 A;  4WWC A;  4IZZ A;  2Y48 A;  4HNV A;  3E7L A;  4CUG A;  4EM2 A;  3ESW B;  1AKH A;  1BR1 A;  2IW5 A;  2HOA A;  4A3G J;  4FE4 A;  3M4O J;  3IKT A;  2X1D A;  1OJL A;  3KEQ A;  2M34 A;  2MC3 A;  2OJE D;  1X4P A;  5HNF A;  4G7O F;  3I4P A;  2R93 J;  4IJA A;  3JSP A;  2GZW A;  1UEL B;  2G9W A;  1J75 A;  2XVC A;  1ZRC A;  1FP2 A;  2HI3 A;  2X6X A;  3SYT A;  1BR4 A;  4ESB A;  4HW0 A;  4A5M A;  2IBD A;  2IRF G;  1ETY A;  4NQW A;  4AD9 A;  4PJN A;  4L5I A;  3CDI A;  2COM A;  5EGO A;  4C3I J;  1WKM A;  3HOV J;  1KA8 A;  3T8T A;  1SAU A;  3DEW A;  1OCO H;  2KLO A;  1ETK A;  4JP0 A;  2QZ8 A;  3LSI A;  5HLT A;  5IYD J;  3CJT B;  3DPU A;  5EG0 A;  3ZQL A;  2HPI A;  3S3M A;  3PQK A;  2X51 A;  2IEK A;  4ZTJ A;  1ZAO A;  4JOM A;  4S04 A;  1TZL A;  5GP9 A;  1ETX A;  2EH3 A;  1D5Y A;  3G4S I;  1WHU A;  1FIP A;  1IAW A;  1X19 A;  2LF8 A;  3MN2 A;  4AC0 A;  3CUQ A;  4NB5 A;  5EF6 A;  1U5T A;  1XDU A;  2FU4 A;  3P9C A;  1H88 C;  3KE2 A;  1O3R A;  2R7D A;  4RGS A;  2M7B A;  4CXF A;  3IL2 A;  3T0Y A;  3PM1 A;  1P4A A;  3CDH A;  1LEA A;  2EB7 A;  3BR3 A;  4PZJ A;  1VTN C;  2HKX A;  4GCV A;  2FMY A;  3OYB A;  3CC7 I;  1Y0U A;  5IT9 Z;  2L9R A;  2R7R A;  1Z21 A;  2VQH A;  4HPQ A;  1LDK B;  4BAY A;  3S93 A;  4U88 A;  5KVR A;  4ZDP A;  4GYI A;  1YJW I;  4JK1 X;  3QQA A;  2HQ5 A;  2OQG A;  2EZL A;  3NWS A;  2KQR A;  2QEN A;  2VJI A;  3LST A;  4M3D A;  1W36 D;  1OCP A;  2OF7 A;  2XB0 X;  3V7S A;  5LGU A;  3PSF A;  1OCR H;  3N4M A;  3M1E A;  1K61 A;  3ZQI A;  5BOX A;  1MKM A;  3TED A;  2JA7 J;  2EWN A;  3SFZ A;  4RS8 A;  2DK5 A;  3WHC A;  1VQK I;  1BIA A;  4P96 A;  2ZSI B;  2BY0 A;  3R4K A;  2KRH A;  4XLF A;  3ML6 A;  5GAD J;  2JSP A;  5D5V B;  4P55 A;  1TBX A;  2RC4 A;  3OYD A;  2WY8 Q;  2BHZ A;  4F92 B;  3HHH A;  3DBH B;  4XRS A;  4RM2 A;  4LB5 A;  4KMU X;  3H9Q A;  5LHH A;  3ZRG A;  3GZN B;  1YX5 A;  3A4C A;  3K0L A;  4EMS A;  2JTV A;  1JT6 A;  1UAA A;  2VIX A;  1LFP A;  4LK1 F;  3OV8 A;  3TGN A;  4DYC A;  2MBF A;  2OTJ I;  1TQP A;  3HYI A;  5EEG A;  1RC9 A;  3KP6 A;  2DMT A;  2LY2 A;  1K7A A;  1QGP A;  3JRH A;  3IKV A;  2DFI A;  4HQE A;  3ZR8 X;  3KLN A;  2AO9 A;  1OFC X;  3ABK H;  4MIM A;  5D4R A;  3S1M J;  4WXH A;  1F43 A;  5LHG A;  4GO1 A;  5KHD A;  1RNL A;  2LYC A;  3RQ4 A;  4XMY A;  2HXI A;  2V79 A;  5B3S H;  4WF2 A;  3VPR A;  4MTE A;  3ERE D;  2WWY A;  4AIH A;  1VQM I;  5M5X J;  2Z16 A;  3L7W A;  2X1E A;  2ID3 A;  1X2N A;  3GME A;  3RYP A;  2O5R A;  5GTI C;  3HPG A;  3ZGK A;  1IV6 A;  4FTH A;  1RIO H;  1FWZ A;  4MQV A;  5K5O A;  1I5Z A;  2DXI A;  2CMP A;  3HBL A;  4CZC A;  1LB2 A;  1Z1D A;  5JFR A;  1ZN2 A;  5FRO A;  4XBF A;  1JTX A;  3KZZ A;  2ZSH B;  1FOW A;  3W2A A;  2CH0 A;  2LBF B;  4XLC A;  2ESH A;  3E6C C;  3SFI A;  3PNT A;  3ZN1 A;  3AG3 H;  1IXS B;  2FNP A;  5JHF A;  4MNU A;  3BG7 A;  4BE2 A;  1HBX G;  3ISP A;  3MCZ A;  4EJW A;  3C1D A;  3F8M A;  3AKZ A;  1OIS A;  4A69 C;  2UUZ A;  4BBR J;  1Z3X A;  1NG6 A;  1TWF J;  3CCJ I;  4F93 B;  5LRS A;  3RTR A;  2K9L A;  3GFJ A;  2NVU B;  4LIV A;  1XTA A;  2K27 A;  5IY5 H;  1JKO C;  4M72 A;  3RI4 A;  2IGO A;  5EDN A;  2CQK A;  2MA3 A;  4KN7 X;  3HSR A;  3PJR A;  1XMX A;  1ODD A;  2JN6 A;  3I64 A;  1JUM A;  4LLG F;  1YW7 A;  1U9O A;  5DV5 A;  4IHT A;  1T56 A;  4LLL A;  2A6T A;  3QOE A;  2VE8 A;  3CUO A;  2AQF A;  4A3E J;  3M8F A;  2JRM A;  3QPS A;  2DJN A;  2JMW A;  4LG3 A;  3S1Q J;  4D1Q A;  1BC7 C;  4MGR A;  4XLE A;  5L3B A;  1KYZ A;  1Q1V A;  3FXQ A;  5J8C A;  2QEX I;  1P4W A;  1A35 A;  3ELK A;  5B1A H;  4AU7 A;  3ZMU A;  1SEU A;  2F2E A;  1D5V A;  2IGK A;  3M7G A;  5IT3 A;  2R7Z J;  4FHT A;  2MSY A;  4FCY A;  4B44 A;  5DM7 F;  2A5W A;  3CLQ A;  2JT1 A;  2YS9 A;  3U1D A;  2CWE A;  5L3E A;  1TNS A;  1S9H A;  2AHQ A;  1SVO A;  1O4X A;  3H5A A;  3U1K A;  2W1O A;  4B47 A;  3CZ6 A;  3CCM I;  1VND A;  2VAS A;  2PMH A;  3EUA A;  4HZF A;  5J4Y A;  1BJZ A;  2D1H A;  4LG0 B;  5LFA A;  2XPU A;  2XDV A;  1T95 A;  5C4J J;  1FYM A;  4A5N A;  5EEH A;  2JVH A;  4I2O A;  3FF5 A;  1KZH A;  2IS4 A;  3QRF F;  3DPL C;  3K69 A;  1X1D A;  4BHP A;  2H27 A;  3H3Z A;  1HW5 A;  3KP5 A;  2IXS A;  1TLH B;  1TWA J;  4FT8 A;  2VBZ A;  5BPI A;  2V6E A;  4M9S A;  4EVI A;  3LFK A;  3I59 A;  4BQQ A;  3ZQC A;  1XGM A;  2CGP A;  4XLP F;  4CHU A;  3LSH A;  4S0H B;  1TT0 A;  3OR1 C;  2F5C A;  4IPA A;  1VQ8 I;  3PIO F;  4IHV A;  2DT7 B;  1LQ1 A;  5BNG A;  1VQ6 I;  4JQF A;  2GIZ A;  3DBR B;  1MBK A;  1T38 A;  3HG9 A;  3L2V A;  2YPR A;  4IEJ A;  4M3G A;  1Z91 A;  2IS2 A;  4H0E A;  2EFW A;  3CCQ I;  4HQM A;  3TDZ C;  1LE8 A;  5K7Z A;  2JPB A;  1QPI A;  1OYI A;  2E60 A;  4I02 A;  3B02 A;  3RDI A;  2NVQ J;  1X3U A;  5F27 A;  2P5V A;  2VPL A;  2DFH A;  1FOY A;  4DYR A;  4HDV A;  4HX7 A;  4G12 A;  3CCV I;  3I71 A;  2EFQ A;  2W7N A;  2PG4 A;  1GUU A;  4HG2 A;  3TW7 A;  1Y1W J;  4RMN A;  2M1B A;  2EV6 A;  5CQE A;  2Q1Z B;  5IOY A;  4V2F A;  3P5J A;  2JK3 A;  1USS A;  2CJJ A;  4YEL A;  2L02 A;  1KQ8 A;  2Z1D A;  4L9J A;  2FOK A;  5B5E C;  2KPM A;  2JA2 A;  2NOG A;  1SAX A;  1E3P A;  2YU9 J;  3HKZ A;  3MQ0 A;  5LEK A;  4XK4 A;  2E2I J;  5E79 C;  3W6J B;  2HPM A;  1F5T A;  1IGN A;  5HLH A;  1FC3 A;  4OWR B;  5E3O A;  4D7M A;  1KU7 A;  1ZYR F;  3OSG A;  2CW8 A;  1EH8 A;  4A6D A;  1H89 C;  1FYK A;  1JJ8 C;  3W6K B;  5K1Y A;  5H6Q A;  2HDW A;  1SFU A;  4L0Z B;  2H09 A;  1T98 A;  4DGW B;  5B1B H;  4HF2 A;  3GZ6 A;  2W4S A;  3IH3 A;  3CCL I;  1KQ9 A;  4OAZ A;  4BDY A;  1OR7 C;  3OS0 A;  3M9A A;  2E7X A;  1MGT A;  5BMZ A;  3CMA I;  2QBY A;  3A2K A;  2MLK A;  3HDD A;  4A3D J;  1IV8 A;  1W7P A;  3BCB A;  4M6Y A;  4PJL A;  3I5U A;  5E8G A;  3GBG A;  3K1P A;  1ZG1 A;  3V8L A;  4BS9 A;  2J5P A;  2W24 A;  2V6C A;  3OOU A;  3KCC A;  4A3B J;  2Z3Y A;  3JTH A;  4XN3 A;  5GAE J;  1YQA A;  2EK5 A;  3CCE I;  3DKY A;  1BA5 A;  1U8B A;  1NK2 P;  4FX4 A;  3E97 A;  5DUK A;  2W57 A;  4PDK A;  2CSO A; 
#chains in the Genus database with same CATH homology
 3GX4 X;  2WC2 A;  2P5L C;  4L9N A;  4HF0 A;  3E6D A;  3BRO A;  1O3S A;  3R61 A;  4N9H A;  3CTA A;  5D5U B;  3I0T A;  4HOB A;  1F1Z A;  5LRR A;  3WE2 A;  1RUN A;  4FX0 A;  4HBL A;  4I0A A;  3F8N A;  2C6Y A;  3SZP A;  4TV7 A;  4U7B A;  2JPC A;  4ENJ A;  4I98 B;  2OZ6 A;  3K1M A;  4UVB A;  3E5U A;  3WTW C;  1TQI A;  2P6S A;  1CF7 B;  3T5X A;  1W5S A;  2K4J A;  1D8J A;  1R36 A;  1IN7 A;  2UZK A;  3GFI A;  3HRU A;  2M8E A;  3F8C A;  5H6R A;  4EGZ A;  1YO5 C;  4HV6 A;  4EM1 A;  2ZME B;  3SXY A;  5F1R A;  1HW2 A;  2XV4 S;  3DEU A;  3LA3 A;  1P4X A;  2LKP A;  5HOO A;  1DPU A;  2J5O A;  1JHH A;  2NRA C;  2E1N A;  4DQ2 A;  4CYD A;  3IWZ A;  3WTV C;  1O3Q A;  2P7V B;  2FA5 A;  5CVI A;  1IW7 F;  3E3V A;  1BN5 A;  4MTD A;  4B09 A;  3IC7 A;  4UUV A;  1BI3 A;  3I54 A;  4AIK A;  2EV5 A;  2RNJ A;  1ZRE A;  1R58 A;  1G3Y A;  4OIQ F;  2ELH A;  3TQN A;  3VFZ A;  1LDJ A;  2F5E A;  1B6A A;  1ZG3 A;  4PGG A;  4OMZ A;  5FD5 A;  3TO6 A;  3V4G A;  5DUI A;  2IA2 A;  4M74 A;  5DDG A;  2FF4 A;  1W7P D;  1SFE A;  3HOS A;  5D5X B;  1SD4 A;  1MDM B;  2FRH A;  2AS5 F;  4RAY A;  2VT2 A;  3GO5 A;  2G7H A;  3HRS A;  4LD5 A;  1HKT A;  5L3G A;  1HST A;  3WE3 A;  1XCV A;  4OIN F;  3R6S A;  1ZGA A;  2NYX A;  1REP C;  4BQA A;  2P4W A;  2PFB A;  4XSX F;  1H0M A;  3FM5 A;  5FLX K;  3IRQ A;  2DK8 A;  1BI0 A;  4XLN F;  3F6V A;  3GFM A;  5BPD A;  3BJ6 A;  4ESF A;  2DQR A;  2DO7 A;  3WG9 A;  2Q2E A;  4KA4 A;  3WTY C;  3DPT A;  1GVJ A;  4N0B A;  5AIP A;  1YS7 A;  2F5D A;  1QZZ A;  1WSU A;  2FBH A;  2EFN A;  1ONV A;  2Y0M A;  2RQP A;  4P9F A;  2B0L A;  3TDU C;  2NS0 A;  4I7H A;  2FNA A;  2EFO A;  1WI9 A;  5ERI A;  3DF8 A;  2ADU A;  2QVO A;  4Z2Y A;  1FBS A;  2MH2 A;  1G3W A;  2Z99 A;  2OBP A;  2X4H A;  2ZJ2 A;  5DCF A;  2IPQ X;  2G7U A;  2XKO A;  4UXN A;  2O8X A;  1QBJ A;  4KIF A;  4ZYH A;  2IA0 A;  2VXZ A;  2P7C B;  1SMT A;  2ZNZ A;  2ZBK A;  1L0O C;  2KJB A;  4YG2 F;  2O61 A;  2A3S A;  1JE8 A;  3OOP A;  5DYM A;  4U0V A;  2CW0 F;  1FYL A;  3J81 K;  2NNY A;  4Q5S F;  3GVA A;  1UFM A;  1BOA A;  3RYR A;  1FPQ A;  3LA7 A;  5HDK A;  1IN8 A;  3F22 A;  1CGP A;  3C3W A;  2DAO A;  3GEZ A;  3GLX A;  5HS7 A;  5JR3 A;  4WXD A;  3SHF A;  4F7Z A;  1U78 A;  3TO9 A;  1R00 A;  2IP2 A;  4GYG A;  3GXO A;  4JBA A;  1R23 A;  3EYY A;  3IHU A;  1RI7 A;  1YIO A;  4BXU A;  4LG0 A;  5JI6 A;  1W5T A;  2BBY A;  1KU2 A;  1I6X A;  5E8I A;  5K5R A;  5DCM B;  2W84 A;  1XSD A;  1XMK A;  3LA2 A;  2LF7 A;  3L09 A;  3HTU A;  1FP1 D;  3DQV C;  5HDN A;  1PP7 U;  3MZY A;  4IHS A;  2FEZ A;  5FB2 A;  1SD6 A;  3CLO A;  1YLF A;  1G3S A;  3R0J A;  2KRF A;  4YFN F;  1ZGJ A;  3K2Z A;  3Q5F A;  3P9K A;  3T1B A;  4A0Z A;  1IZ1 A;  5HS9 A;  4EJV A;  2H6B A;  4KMF A;  4I0B A;  5IT9 K;  4QWQ A;  1Z6R A;  3RPU A;  3DFG A;  1JGS A;  2R7F A;  1UB9 A;  3BY6 A;  2DBB A;  1IXC A;  2L4A A;  1V4R A;  1LEB A;  3HUG A;  4L9T A;  4CZZ A;  4ZH4 F;  3KEO A;  2JSC A;  4A0Y A;  1J5Y A;  3WTX C;  3E5Q A;  2K02 A;  2XAH A;  3LQQ A;  3EQL F;  5D4S A;  1IXR C;  4S05 A;  1R1U A;  4ASN A;  2EA2 A;  4ZZL A;  1ZLK A;  2DQL A;  1TQM A;  1SFX A;  4BHC A;  4KIG A;  2WV0 A;  5L3F A;  1KQ0 A;  1SMY F;  4ZYE A;  4U0Y A;  2XKP A;  4UNO A;  1PUE E;  1BIB A;  1STZ A;  3QU3 A;  2KIM A;  3HHG A;  1XCB A;  4ENN A;  2YU3 A;  4KNY A;  1ZHF A;  1XSV A;  2TDX A;  3MEX A;  4KT5 C;  3WOD F;  5E17 F;  3JW4 A;  1UST A;  1DDN A;  3HOT A;  4MHG A;  3R60 A;  1YW9 A;  2HDC A;  1Q1H A;  2JRT A;  6PAX A;  3JTG A;  1B1B A;  2YR2 A;  4UVA A;  1MJ9 A;  3C7J A;  3J7A O;  4XSZ F;  3F72 A;  4L18 B;  3E5X A;  4G9Y A;  2MLG A;  5JVT A;  3GZ5 A;  3LAJ A;  1S7O A;  4HLX A;  3N97 A;  1NHA A;  2PEX A;  1GHC A;  4MEX F;  1IUY A;  3ZP5 A;  2W25 A;  1R7J A;  2VN2 A;  1ZH5 A;  3V8J A;  2ZME A;  5HS8 A;  4RGU A;  1J7K A;  5BS6 A;  5E1Z B;  3O2P E;  4KDP A;  1P92 A;  3BJA A;  4OMY A;  4ZYD A;  1O57 A;  2O03 A;  5ICC A;  3EET A;  3BPX A;  1BJA A;  3O3K A;  5J6X A;  1GXQ A;  2MH9 A;  1D3Y A;  5ICG A;  1RUO A;  3FMS A;  4ENK A;  1FSH A;  2FE3 A;  2MD5 A;  4RGR A;  1G3T A;  1ULY A;  2LNB A;  3HTS B;  1J59 A;  2GAU A;  3T8R A;  2A69 F;  3LQR A;  1KGS A;  2HS5 A;  1HXD A;  2QQ9 A;  2P6T A;  4IRG A;  3P7N A;  2K7L A;  2OAZ A;  4O3M A;  2O0Y A;  3BWG A;  1OMI A;  5HLI A;  1I27 A;  4B8X A;  4GGG A;  4YFK F;  2XUB A;  1W4M A;  2IT0 A;  5CVU A;  3AAF A;  4A12 A;  1FBQ A;  3WU0 A;  2UXN A;  1S3J A;  2JZY A;  1B59 A;  4AIJ A;  4EGY A;  1K78 B;  2VBX A;  2DI3 A;  2KKO A;  2BE5 F;  1LNW A;  1IRG A;  3JAM Z;  2A5Y B;  1WRJ A;  4CDG A;  4EJO A;  2F5F A;  2FSW A;  2HWV A;  3QPT A;  3ZN0 A;  2PJP A;  1IN6 A;  4P5O A;  3DKW A;  3FX3 A;  1OYY A;  3J80 Z;  3KFW X;  5D6F A;  1MZB A;  1YFH A;  2VE9 A;  1FOK A;  1XGN A;  1GXP A;  2GA1 A;  1JHF A;  2H6C A;  5CVR A;  1H9G A;  5BQT A;  4Y17 A;  1XD7 A;  2XIG A;  4XRF A;  2D45 A;  2O6G E;  1C0W A;  2PQ8 A;  1XMA A;  1YS6 A;  5LEJ A;  2CYY A;  3I59 B;  1LJ9 A;  1QNT A;  1P6R A;  1H9T A;  3Q9V A;  5DD4 A;  1OPC A;  1O3T A;  2VOP A;  1AOY A;  4R8H A;  1P2F A;  1F4K A;  2HZT A;  1QQI A;  5A2Q Z;  1IF1 A;  3R0A A;  4L5J A;  3EUH A;  2RGV A;  5D6E A;  4IRH A;  1QZY A;  5FD6 A;  3Q9S A;  3SQN A;  2Q0O A;  1OKR A;  2HYF A;  2FML A;  1YW8 A;  2M5W A;  4CGZ A;  3MAJ A;  4Q47 A;  1U8R A;  2FBK A;  2A6E F;  4Y13 A;  1EH6 A;  3ECO A;  3FXU A;  5TRD A;  2NAZ A;  4CIC A;  3HSF A;  4PCQ A;  2VON A;  1BM9 A;  5D5W B;  1ZAR A;  1FLI A;  1S8N A;  3P9I A;  2AXL A;  5LGN A;  3MZH A;  1OYW A;  4M9X A;  3L00 A;  4M71 A;  5HLG A;  3GF2 A;  1ZRD A;  5ED4 A;  1E2X A;  3ZMT A;  4UV8 A;  4R1H A;  1XGS A;  4HYE A;  2QBY B;  2KIF A;  5DD8 A;  3GUD A;  1F9N A;  1K79 A;  4D0P A;  2STT A;  4G6D A;  5F64 A;  1TNT A;  2VBY A;  1R22 A;  2W85 A;  4ETS A;  1ZRF A;  1Z05 A;  3ZPL A;  5ICF A;  2XAQ A;  5CVV A;  3WTU C;  3HRM A;  4UHT A;  2PLY A;  3KET A;  4LMY A;  1FX7 A;  3IWF A;  3KP4 A;  3FXR A;  4ZYG A;  1S7A A;  1Z9C A;  4EJT A;  3CO6 C;  3TKY A;  2PBI A;  2BV6 A;  5ILV A;  3TOA A;  1JXS A;  1B9M A;  1DUX C;  1HKS A;  3RKY A;  4ESJ A;  2YX4 A;  5AIQ A;  2EV0 A;  2EFP A;  1HW1 A;  3ABU A;  3VOE A;  2XRN A;  4YFX F;  2RN7 A;  2HQN A;  2DTR A;  5ILU A;  4LGW A;  5L3C A;  2VOO A;  1BI2 A;  1O7L A;  4Q48 A;  3ULQ B;  2GQQ A;  4RB1 A;  4E70 A;  2RKH A;  2XAJ A;  2GXB A;  3HIF A;  4DNC A;  2QQB A;  2E7W A;  2XGX A;  4LJZ F;  1MD0 A;  2FXA A;  4LLN A;  4RGX A;  3BDD A;  1MJA A;  3DP7 A;  1E17 A;  1EV7 A;  4IF4 A;  2H94 A;  3LAP A;  4EQQ A;  2RDP A;  4WCG A;  1I1G A;  3KZY A;  3D0S A;  4EJU A;  3C18 A;  4GXO A;  3V7C A;  3HSE A;  2PI0 A;  1B4A A;  2ETH A;  1TTY A;  2YX7 A;  3CUQ C;  3NQO A;  2XAS A;  2Z33 A;  4P9U A;  1U5T C;  3PQJ A;  4OIO F;  2NNN A;  4BH9 A;  1TW2 A;  2KJC A;  3O6B B;  1DP7 P;  4EV0 A;  1R1V A;  1HKQ A;  4Y15 A;  3PFI A;  2XAG A;  4M6X A;  1Z7U A;  2VOD A;  4M9Z A;  4OIR F;  3WTS C;  5H20 A;  5CJ9 A;  4RB0 A;  3HRT A;  4BNC A;  1L3L A;  3WTZ A;  1EH7 A;  4R79 A;  3EDP A;  2V1X A;  4HX4 A;  5CLS A;  4U0W A;  1ZLJ A;  3U2R A;  4I01 A;  2QM3 A;  3WGH A;  2ACJ A;  3LWF A;  1ON1 A;  1YTY A;  3H92 A;  2HQR A;  1U3E M;  2HOE A;  2CG4 A;  2GA2 A;  3CJN A;  1QPM A;  2M87 A;  4LB6 B;  1FT9 A;  2STW A;  2OQR A;  2FQ3 A;  1MJB A;  4G7Z F;  4YII A;  5FO5 A;  4KIB A;  1YG2 A;  2HTS A;  3F23 A;  4HV5 A;  3FMQ A;  3GFL A;  1IN5 A;  3E6M A;  5D8K B;  2A6H F;  3ZMZ A;  2HGC A;  3DV8 A;  3VOD A;  2HFH A;  1HSJ A;  3NRV A;  3JSO A;  4QLC U;  1HQC A;  2ZO4 A;  2A61 A;  2ZKZ A;  4UV9 A;  4ENM A;  4LFU A;  4RB2 C;  4KIC A;  2K86 A;  4HF1 A;  1UHW A;  5LHI A;  2GXG A;  2Y75 A;  3F8F A;  3RKW A;  1RZ4 A;  2CFX A;  3CO7 C;  4CO8 A;  1XGO A;  2EJR A;  3TOB A;  3TO7 A;  3F8B A;  1U2W A;  2HKO A;  2QUF A;  5ILS A;  3MFK A;  4EM0 B;  3ZMS A;  2OU2 A;  4UVC A;  4YIF A;  2DLL A;  2OA4 A;  3DXJ F;  2VC0 A;  4G8X A;  3D5L A;  3GWZ A;  5E1X A;  3ABT A;  2D1V A;  4O5V A;  4G7H F;  3CUQ B;  1S29 A;  4A6E A;  1U5T B;  3QAH A;  1K78 A;  1SD5 A;  5F6F A;  2HTJ A;  3KLO A;  4PGH A;  3V7R A;  3REO A;  2PN6 A;  1XSX A;  2UXX A;  5KK1 A;  3GW2 A;  5HVQ C;  2RV8 A;  3L2C A;  2D2W A;  2KIU A;  3FZV A;  3MWM A;  3ZQ7 A;  3U9G A;  1BI1 A;  4K2E A;  2HEO A;  3ZMD A;  1CF7 A;  4ZZD A;  4L9V A;  2QLZ A;  2ZXJ A;  1D8K A;  4NHJ A;  1T39 A;  5CVJ A;  2Z9O A;  1T0F A;  5CYV A;  1PDN C;  5AON A;  3QOP A;  5LGT A;  2XAF A;  2WTE A;  5LLQ A;  3BOQ A;  4G94 A;  3VB2 A;  1XB4 A;  5E18 F;  2QQA A;  1KU3 A;  1FY7 A;  4AVP A;  1I1S A;  4HLY A;  5FFX A;  2BEO A;  5TJJ A;  2V1D A;  2DW4 A;  4ON0 A;  3I58 A;  4WX9 A;  3ECH A;  2LSO A;  2XRO A;  4A2U A;  2HYG D;  3S2W A;  1G4D A;  2VT3 A;  3BPV A;  1BBY A;  4Q4Z F;  5J8F A;  3M8E A;  4G6Q A;  3EYI A;  1FSE A;  4N9I A;  2V1U A;  2L01 A;  2VBW A;  2DPU A;  2GWR A;  2L54 A;  3FM3 A;  3E6B A;  4IXA A;  1FBU A;  4IRI A;  5E20 A;  4BHB A;  1PP8 F;  2ISY A;  4HAM A;  3WTT C;  2EA4 A;  4OU0 A;  5JHU A;  5FFZ A;  1MDM A;  1OR7 A;  4MQ9 F;  2QYO A;  4KYW A;  3RJP A;  4KFC A;  2VC1 A;  3K1N A;  2M45 A;  3KP3 A;  4LK0 F;  4RB3 C;  1SD7 A;  1G6N A;  3KP2 A;  4AWX B;  1T2K A;  1KU9 A;  2ZNY A;  3VEP A;  2IVM A;  2R3S A;  2OZU A;  2DU9 A;  2OD5 A;  3B73 A;  1IN4 A;  1TW3 A;  1IRF A;  2ZFW A;  3QP6 A;  1O7F A;  1DPR A;  2LDU A;  1A04 A;  3RIR A;  5HDG A;  2BYV E;  1R5G A;  3K9T A;  5E1W A;  1U6G A;  1YYV A;  2O3F A;  4HX8 A;  1LDD A;  3FWE A;  2L3D A;  1WQ2 A;  1B9N A;  1XN7 A;  2A68 F;  2Q8K A;  1XDS A;  2P8T A;  1T6S A;  4KUM A;  3QU6 A;  2DPD A;  1UCR A;  1WWX A;  3ROU A;  3ZMV A;  3GYH X;  2P5K A;  3V8K A;  2Z5U A;  3F21 A;  1J2X A;  3H3U A;  4IVN A;  3L9F A;  3JAM K;  3QP5 A;  3I53 A;  2X0L A;  2PMU A;  5D8L B;  4OIP F;  3NEU A;  3BZ6 A;  4HDU A;  3F3X A;  2GIV A;  2YSR A;  3J80 K;  2V9V A;  5ICE A;  4KN4 X;  5FLX Z;  1K6O A;  5L3D A;  3G3Z A;  2IA1 A;  4M73 A;  2QWW A;  1Z6T A;  2RVC A;  3RPQ A;  1QO0 D;  4MEY F;  2CO5 A;  4O6J A;  3RKX A;  4L0Y B;  5FGM A;  5DEQ A;  3WGG A;  2ESN A;  2HR3 A;  4OOI A;  1FNN A;  4U7D A;  1ON2 A;  5LBQ A;  1J9I A;  2DT5 A;  1LVA A;  1UHM A;  3QPH A;  2BGC A;  2FBI A;  1W7P B;  4RAZ A;  2L4M A;  1KYW A;  3BP8 A;  1R5H A;  5A2Q K;  5DCM A;  3WU1 B;  4WXC A;  3SZT A;  3WGI A;  4WK8 F;  3FHZ A;  3F6O A;  1BC8 C;  3IRR A;  1S6L A;  2IJL A;  1AWC A;  2UWM A;  2A07 F;  1FZP B;  2XHK A;  2K4B A;  1V3F A;  3COA C;  1R1T A;  3FMR A;  2ZCW A;  4BYY A;  2M30 A;  1J0R A;  3BJO A;  4A0X A;  4I09 A;  2ISZ A;  4HA8 A;  3J81 Z;  1ZG5 A;  5K5Q A;  2E1C A;  3KP7 A;  3G73 A;  4WWC A;  2Y48 A;  4EM2 A;  2IW5 A;  3IKT A;  3KEQ A;  2MC3 A;  4G7O F;  3I4P A;  4IJA A;  3JSP A;  2GZW A;  2G9W A;  1J75 A;  2XVC A;  1ZRC A;  1FP2 A;  4ESB A;  4HW0 A;  4A5M A;  2IRF G;  4NQW A;  4AD9 A;  4L5I A;  2COM A;  1WKM A;  1KA8 A;  3T8T A;  2QZ8 A;  3PQK A;  1ZAO A;  4S04 A;  1IAW A;  2LF8 A;  3CUQ A;  4NB5 A;  1U5T A;  1XDU A;  2FU4 A;  3P9C A;  3KE2 A;  1O3R A;  2R7D A;  4RGS A;  3IL2 A;  4CXF A;  3T0Y A;  1P4A A;  3CDH A;  1LEA A;  2EB7 A;  4PZJ A;  1VTN C;  2HKX A;  4GCV A;  2FMY A;  1Y0U A;  5IT9 Z;  1LDK B;  4BAY A;  4U88 A;  5KVR A;  4GYI A;  4JK1 X;  2OQG A;  2QEN A;  3LST A;  3V7S A;  5LGU A;  3N4M A;  3M1E A;  5BOX A;  1MKM A;  2EWN A;  3SFZ A;  4RS8 A;  2DK5 A;  1BIA A;  4P96 A;  3R4K A;  3ML6 A;  5D5V B;  4P55 A;  1TBX A;  2RC4 A;  3HHH A;  4LB5 A;  4KMU X;  5LHH A;  4EMS A;  3K0L A;  2JTV A;  4LK1 F;  3OV8 A;  3TGN A;  2MBF A;  1TQP A;  3HYI A;  5EEG A;  3KP6 A;  1K7A A;  1QGP A;  3IKV A;  2DFI A;  4HQE A;  3KLN A;  5D4R A;  4WXH A;  5LHG A;  4GO1 A;  1RNL A;  2V79 A;  4WF2 A;  4MTE A;  3ERE D;  2WWY A;  4AIH A;  3L7W A;  3RYP A;  1RIO H;  1FWZ A;  4MQV A;  5K5O A;  1I5Z A;  1LB2 A;  1Z1D A;  5JFR A;  1ZN2 A;  4XBF A;  3KZZ A;  2ESH A;  3E6C C;  3ZN1 A;  1IXS B;  2FNP A;  4MNU A;  1HBX G;  3ISP A;  3MCZ A;  4EJW A;  3C1D A;  3F8M A;  5LRS A;  3RTR A;  3GFJ A;  2K27 A;  4M72 A;  3RI4 A;  2CQK A;  2MA3 A;  4KN7 X;  3HSR A;  1ODD A;  3I64 A;  4LLG F;  1YW7 A;  5DV5 A;  4IHT A;  4LLL A;  2VE8 A;  3CUO A;  3M8F A;  1BC7 C;  4MGR A;  5L3B A;  1KYZ A;  3FXQ A;  5J8C A;  1P4W A;  3ELK A;  3ZMU A;  2F2E A;  1D5V A;  3M7G A;  5IT3 A;  4FHT A;  2JT1 A;  3U1D A;  2CWE A;  5L3E A;  1TNS A;  2PMH A;  4HZF A;  2D1H A;  4LG0 B;  1FYM A;  4A5N A;  5EEH A;  4I2O A;  3FF5 A;  3QRF F;  3DPL C;  3K69 A;  4BHP A;  2H27 A;  3H3Z A;  1HW5 A;  3KP5 A;  1TLH B;  4FT8 A;  2VBZ A;  5BPI A;  4M9S A;  4EVI A;  3LFK A;  3I59 A;  2CGP A;  1XGM A;  4XLP F;  4CHU A;  2F5C A;  4IPA A;  1LQ1 A;  4JQF A;  1T38 A;  2YPR A;  1Z91 A;  4H0E A;  2EFW A;  4HQM A;  3TDZ C;  2JPB A;  1OYI A;  4I02 A;  3B02 A;  3RDI A;  1X3U A;  2P5V A;  4HDV A;  4HX7 A;  3I71 A;  2EFQ A;  2PG4 A;  2M1B A;  2EV6 A;  1USS A;  2L02 A;  1KQ8 A;  4L9J A;  2FOK A;  1SAX A;  3MQ0 A;  5LEK A;  3W6J B;  1F5T A;  5HLH A;  1FC3 A;  1KU7 A;  1ZYR F;  1EH8 A;  4A6D A;  1FYK A;  3W6K B;  5K1Y A;  5H6Q A;  1SFU A;  4L0Z B;  2H09 A;  1T98 A;  4HF2 A;  3GZ6 A;  1KQ9 A;  3M9A A;  2E7X A;  1MGT A;  5BMZ A;  2QBY A;  2MLK A;  1W7P A;  4M6Y A;  3I5U A;  5E8G A;  3K1P A;  1ZG1 A;  3V8L A;  2J5P A;  2W24 A;  2V6C A;  3KCC A;  2Z3Y A;  3JTH A;  1YQA A;  2EK5 A;  4FX4 A;  3E97 A;  5DUK A;  2W57 A;  4PDK A;  2CSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...