3CJNA

Crystal structure of transcriptional regulator, marr family, from silicibacter pomeroyi
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
146
Chain Sequence
RELAEIGLEGYAPYLMNRIMGRYNANLRKEMTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDDQRSSRVYLTPAGRAVYDRLWPHMRASHDRMFQGITPQERQAFLATLNKMLANIRVHEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Crystal structure of MarR family transcriptional regulator from Silicibacter pomeroyi.
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Transcription regulator
total genus 40
structure length 146
sequence length 148
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cjnA00
2EJRA 1Z6RA 2VE8A 2DK5A 4BAYA 5E17F 1D3YA 3V4GA 1W7PA 1QZYA 4LGWA 2FMYA 2NS0A 4FX4A 3DF8A 1V3FA 1FSHA 2K4BA 1RNLA 5CVVA 3LQRA 4H0EA 4AIJA 1EV7A 4ENNA 1SD5A 1BI2A 2Y75A 1FYMA 1ULYA 1L0OC 5BS6A 3CO6C 1Y0UA 1ZHFA 2DQRA 2HZTA 1YTYA 5J8CA 2F2EA 4M9ZA 1G3YA 2ESHA 1I6XA 3V7CA 4M6XA 2V9VA 5ILUA 1BIBA 3V8JA 1Z9CA 4N9HA 3R61A 1FP2A 4I09A 1IZ1A 2V1UA 4BNCA 3BY6A 1R22A 1K78A 5DD4A 1PP8F 2GA2A 3T8TA 1O3TA 2EK5A 4MEYF 4YIFA 1KYZA 1BOAA 5J6XA 4RB1A 4N0BA 3WE2A 2IA1A 5KK1A 3LWFA 4JBAA 2IVMA 4MTDA 1RI7A 4XRFA 2CG4A 1YYVA 1DDNA 2VBXA 3HSFA 1FLIA 1B4AA 3I71A 2GAUA 3ZMZA 2GZWA 5E1WA 1XB4A 3ULQB 2K27A 1Z91A 2MLGA 1ZRDA 3GVAA 1P2FA 1LDKB 2LSOA 2IW5A 4MGRA 2P5VA 3L09A 1ZH5A 4HQEA 4YFXF 3LA7A 4WF2A 1T39A 3ECOA 3MWMA 3F8NA 3KP2A 3U2RA 4IPAA 3ZMUA 4I0BA 5ILVA 2EFWA 4XBFA 2W25A 3J81K 2L54A 2PI0A 1R1UA 4E70A 1XMAA 4Q48A 3WGGA 2DPUA 1GVJA 4CDGA 2IP2A 2QWWA 4LLNA 5HDNA 2YU3A 4P9FA 3ISPA 2CFXA 2NRAC 1IXSB 1U8RA 2ISZA 3SZPA 3E6MA 2VT3A 5D6FA 3V8KA 1T6SA 1HKQA 2OBPA 2A6HF 1OYWA 3DXJF 4HDVA 3AAFA 4OMYA 3FWEA 1OKRA 4YFKF 2MH9A 3DEUA 2O3FA 3JTHA 1YS6A 1Z7UA 3KLNA 5IT9Z 4A6DA 4EJVA 3CUOA 5L3DA 4ASNA 4LG0A 4G7OF 2CQKA 3BROA 2QQBA 4MTEA 4A0XA 3DP7A 1QPMA 2OD5A 5E8IA 3KFWX 3U1DA 5HLHA 4A5NA 3SHFA 2EA4A 1TW3A 3N4MA 4DQ2A 3D0SA 4G8XA 1A04A 2F5CA 2VT2A 4YFNF 1RZ4A 2BE5F 1TTYA 3EYYA 3KLOA 3ZPLA 4GYIA 4B09A 1FT9A 2L02A 3L00A 2C6YA 3H92A 1G6NA 3TOAA 2O8XA 4A6EA 3FXQA 1YO5C 3F6OA 4UXNA 1IRGA 3COAC 2ZNZA 4F7ZA 5TJJA 2KRFA 1E2XA 5FD6A 1R36A 2FNPA 3FHZA 2HWVA 3WTTC 1HW5A 3RKWA 3HOSA 4KN7X 4U88A 2XAJA 2XUBA 1SAXA 1ZYRF 2TDXA 1RUNA 2O6GE 4I02A 3F8CA 2RN7A 2VBYA 4PDKA 2UZKA 4P96A 2VE9A 2XKPA 3HOTA 1NHAA 2XRNA 4ZYDA 1FBQA 5AONA 3KP4A 1LEBA 5DV5A 2M5WA 2OQRA 3FF5A 1P4XA 3K1MA 3KP5A 4RB2C 3SZTA 1SFXA 1MZBA 3HRTA 4Q4ZF 4KDPA 1JHHA 3BJOA 2E1NA 4IHSA 4UUVA 3E6CC 5JFRA 1T98A 1XSXA 2WC2A 1R23A 1MKMA 4R79A 1U6GA 1UB9A 1S3JA 3FMSA 2X0LA 4UNOA 1XGNA 1BIAA 2F5FA 1S8NA 3G3ZA 4HZFA 2G7UA 1AOYA 1T38A 1TNTA 5ICEA 5LHHA 5LHGA 3RIRA 5F64A 4ZZDA 5JHUA 4EGYA 1USSA 3L2CA 2ZFWA 1FBSA 4KIBA 2JZYA 1QO0D 2XAFA 4K2EA 2HYFA 1KQ8A 4IVNA 5DUIA 2QM3A 1S29A 4KT5C 5FGMA 5HS9A 3F8BA 2CGPA 3O2PE 1ZREA 4RGSA 3RJPA 3QU3A 4L9NA 3IWFA 3T8RA 2PEXA 1IN5A 2ETHA 4ESFA 5LEKA 2PJPA 1D5VA 2UXNA 2L01A 3JSOA 3TQNA 4IRIA 4PZJA 5HDKA 5BQTA 2R7DA 2W85A 4Y13A 2DLLA 2HDCA 3P7NA 3IC7A 1MJBA 4BHCA 3I59B 5KVRA 3GF2A 3JSPA 4NHJA 1KU9A 3RTRA 4KNYA 2OQGA 3V7RA 3BJAA 3Q5FA 1KA8A 4RS8A 2VOPA 2FF4A 4EM0B 4CYDA 5JVTA 4U0YA 3HSEA 4DNCA 3I64A 3W6KB 2ACJA 5FFZA 2Q8KA 5K1YA 1ON2A 1J75A 1KU2A 1IN7A 3GUDA 4RB3C 1MDMA 4M9SA 5ERIA 2RDPA 3GLXA 4XSXF 4EVIA 5K5OA 1MGTA 3HTUA 5ICFA 3GZ5A 5ILSA 1U78A 5LLQA 5CYVA 2FQ3A 2WTEA 4PGHA 1FYLA 4IRHA 1B6AA 1FOKA 5DCMB 3FMRA 1JGSA 2NNYA 5D6EA 2DBBA 1R7JA 2UXXA 3JW4A 1YG2A 4P9UA 5E20A 1P4WA 3JAMZ 2E7XA 4CZZA 4EJUA 4O6JA 1XD7A 3R4KA 3I5UA 3M1EA 3WTZA 2W57A 3QPHA 3NRVA 1ZLKA 1BC8C 5D5XB 2A5YB 3CTAA 5E18F 4A2UA 2Z33A 3HYIA 1Z6TA 3KP3A 4M6YA 3VOEA 1H9GA 1REPC 3BJ6A 1R1TA 2EA2A 3ELKA 1S7OA 2VBZA 2MC3A 2HKOA 2FMLA 1SD4A 2P8TA 1CF7B 2HTSA 5FD5A 4NQWA 1OYYA 1IXCA 4KUMA 4AWXB 3ZMDA 1J9IA 1SFUA 2D1HA 4IJAA 1FPQA 3B02A 5F6FA 2A07F 4O5VA 1BBYA 5BMZA 1D8KA 2XGXA 3GEZA 1ODDA 3F6VA 5A2QZ 4YG2F 5E1ZB 3TDZC 4OIOF 4IRGA 2O0YA 3ABUA 3WTXC 1BM9A 1S6LA 1YW9A 2QQ9A 3J80K 2BGCA 5ICCA 4Y15A 1KGSA 2OA4A 2DQLA 4LK1F 5IT3A 3FM5A 3I4PA 1QGPA 3WTVC 2F5EA 4ON0A 3SXYA 3DQVC 3GXOA 3EQLF 1G3TA 4LLGF 3E3VA 2XASA 3VFZA 1HQCA 3R60A 1CGPA 2EFOA 3CO7C 4HX4A 5EEGA 4KA4A 3E6DA 4M71A 5D5UB 4MQVA 2BBYA 3O3KA 5D4RA 5HS7A 4GYGA 4ENMA 1FX7A 4WX9A 2J5PA 3F72A 1BC7C 1FY7A 4HBLA 5DUKA 4BXUA 1YIOA 1I5ZA 2XVCA 4L5IA 1MD0A 1J0RA 1ON1A 3IWZA 4CGZA 4IHTA 3F21A 1TQPA 2E1CA 4A12A 1WSUA 3BZ6A 2VBWA 2YX4A 2P5KA 2G7HA 2QBYB 4HYEA 3U9GA 2QUFA 2J5OA 1QZZA 4L0ZB 5L3FA 2HTJA 4ZYEA 1YFHA 5DCFA 3IKVA 3NEUA 2CWEA 1U5TB 3CUQB 1DUXC 1IRFA 3RDIA 1LJ9A 2EFQA 2HQNA 3KZZA 3QP5A 4KIFA 2FE3A 2QBYA 1EH7A 3JTGA 3QOPA 3GFIA 3Q9SA 4ESJA 4KFCA 4OMZA 2COMA 3LAPA 3IRRA 1W4MA 3SFZA 3E5XA 1XGSA 3R0AA 1IN8A 1JE8A 2Z9OA 4GO1A 4I7HA 2EB7A 3HSRA 5HDGA 2Z99A 1FSEA 1XDUA 4U0VA 1FC3A 2M1BA 5LBQA 4CXFA 2VN2A 3TO6A 2OZUA 1F5TA 5D8KB 2L3DA 4Y17A 1I1SA 4G9YA 3WG9A 3Q9VA 4HF0A 4Q47A 5HLIA 2QENA 4G6QA 3R0JA 3K9TA 3VB2A 3P9IA 4KMUX 1UCRA 4I0AA 2WWYA 4XSZF 3HUGA 5JR3A 2IA2A 3LA3A 3M9AA 1K7AA 4OIPF 1P4AA 4MEXF 1JXSA 5D5WB 3GO5A 1T0FA 1EH6A 4LFUA 4L9TA 2RNJA 3BOQA 4G7ZF 3FZVA 2G9WA 5AIQA 3QPTA 3BP8A 3BDDA 2IRFG 5J8FA 3ZN0A 5LGTA 2ISYA 4M74A 3N97A 3RPUA 2EV5A 1STZA 1HSTA 3EETA 4HDUA 3MZHA 2D45A 4A0ZA 1O3SA 4OINF 1O3QA 5DYMA 3MEXA 5L3EA 5L3CA 1P92A 3ZN1A 4TV7A 2YPRA 3BPVA 4HV5A 3RI4A 4U7BA 1H0MA 2EV0A 1MJAA 4RB0A 5DD8A 2DFIA 3T0YA 3MAJA 2Y48A 2OU2A 3F8FA 3ABTA 1SD6A 3NQOA 4N9IA 1XCBA 4JQFA 5FLXZ 2PBIA 3WTYC 2QLZA 4HA8A 1XSVA 2PFBA 3TOBA 3IL2A 4AVPA 1XMKA 4EGZA 2HEOA 4OOIA 3DPLC 1DPUA 3GYHX 1PUEE 1RIOH 3M7GA 4UVBA 4HAMA 2A69F 1MJ9A 2DW4A 2DT5A 2XHKA 3KEQA 5CVIA 3G73A 3HIFA 2ZJ2A 2GA1A 4LB6B 4FT8A 4ZZLA 4KN4X 5FB2A 1J59A 4EJOA 2P7CB 3B73A 2DAOA 2FNAA 5BPIA 1J2XA 2RC4A 1V4RA 2YSRA 5E8GA 1ZG5A 4WWCA 3H3ZA 3ZP5A 3V7SA 1F1ZA 2K02A 3EDPA 1IW7F 2ZXJA 2Q2EA 3KE2A 3ML6A 2JTVA 2V6CA 4OIQF 4WXCA 4EM2A 2XIGA 3ZMSA 1ZARA 1IF1A 4M72A 4HLXA 4O3MA 3GFMA 2MBFA 2M87A 5K5QA 4ETSA 4GGGA 3C3WA 3DFGA 3HTSB 2LF8A 4HLYA 1KQ9A 5A2QK 3IKTA 4L5JA 5DEQA 4BHPA 2O61A 5LGUA 1G3SA 2QQAA 1G4DA 3KP7A 5LGNA 2BV6A 4I01A 3F3XA 3DV8A 3WTUC 1KQ0A 2R3SA 3VEPA 4B8XA 3W6JB 2FXAA 2HS5A 1HKSA 2BYVE 2WV0A 4LK0F 1TBXA 1R5HA 1ZGAA 4HOBA 3M8FA 1O3RA 4R8HA 2QYOA 4RAZA 4MQ9F 6PAXA 5CVUA 3I59A 2VXZA 5HS8A 1SMYF 2VC0A 3K2ZA 4HX8A 3H3UA 2JPCA 1ZRCA 4GCVA 2A6EF 3WE3A 1VTNC 1C0WA 1L3LA 4I2OA 1WRJA 2DI3A 2XAQA 2DPDA 4U0WA 1XGMA 4RAYA 3OOPA 4UV8A 4EM1A 1B9NA 3WGIA 2H27A 1WQ2A 2EFNA 2P6TA 1U5TC 2PLYA 3PQJA 1Q1HA 3CUQC 5K5RA 2RV8A 1IAWA 3I58A 5LRRA 2EV6A 3QAHA 4UVCA 2F5DA 5H6QA 1JHFA 2XV4S 2P6SA 3QP6A 3REOA 3TDUC 1YS7A 1P6RA 3FXUA 4OIRF 2MD5A 1H9TA 3CLOA 1BI3A 5DCMA 3IRQA 4WCGA 3LA2A 1QQIA 3I53A 4QWQA 1U2WA 3QRFF 2HGCA 3O6BB 1O57A 5LHIA 2VOOA 2ZO4A 1K79A 4U7DA 1YW7A 3R6SA 2KKOA 1KU3A 2VC1A 4L0YB 1FNNA 4WK8F 3GWZA 2K86A 3WU0A 1LQ1A 3ZMTA 1S7AA 2IPQX 5HOOA 2GQQA 3L7WA 1QNTA 1BN5A 1B9MA 1O7LA 1UHMA 2M8EA 5CVJA 3J7AO 1UFMA 4CO8A 2HFHA 2JPBA 3RYPA 3PFIA 5FO5A 3KZYA 2STTA 1CF7A 5IT9K 1TNSA 1K78B 1YW8A 2M30A 1IXRC 4HQMA 5F1RA 1AWCA 1DP7P 1B59A 3WODF 2PQ8A 2CYYA 1RUOA 2V79A 5H20A 5DDGA 2W24A 1XCVA 3GW2A 1SFEA 1YLFA 3LSTA 4L9JA 4AD9A 3WTWC 2H6CA 3PQKA 1J5YA 3WTSC 2Z3YA 3L9FA 3LFKA 3FXRA 1BI1A 4ZH4F 2D2WA 2ESNA 4RGUA 4IXAA 3WU1B 5CVRA 1IN6A 2A68F 4WXHA 3ROUA 4ENKA 4KMFA 2PN6A 5H6RA 1WI9A 2FBIA 3DKWA 1YQAA 5HVQC 2V1DA 3FX3A 2A61A 2XAGA 1UHWA 2Y0MA 4G7HF 5BOXA 1I1GA 3C18A 3GZ6A 2DU9A 3OV8A 4LLLA 1R58A 4EQQA 2HQRA 3F23A 2K4JA 4KIGA 1T2KA 4RGXA 3VODA 1WWXA 3GFLA 4HV6A 2GXBA 2A3SA 3RYRA 4L18B 3EYIA 2ZKZA 4ZYGA 2DTRA 1HSJA 2FA5A 3GFJA 4EJWA 2AXLA 1OPCA 2H6BA 2PMUA 3TO9A 2STWA 1TQMA 3HHGA 2MLKA 3ZQ7A 3HHHA 2MA3A 5D8LB 1GHCA 5FLXK 4S05A 1PDNC 3K69A 2KIUA 2ZMEB 3HRUA 4NB5A 4OU0A 1WKMA 3P9CA 1J7KA 1HW1A 4HX7A 4BH9A 4FX0A 2FBHA 4XLNF 1TLHB 2PG4A 3HRSA 4M73A 1U5TA 3CUQA 2L4AA 3F8MA 3MQ0A 3F22A 2IA0A 2ZMEA 3DPTA 4G94A 3ECHA 4CHUA 2PMHA 2RGVA 4LG0B 2HYGD 4A0YA 3E5UA 5FFXA 4L9VA 1FZPB 2CSOA 4HW0A 1W7PD 1FWZA 1R00A 2L4MA 2ZBKA 1EH8A 1IUYA 1HBXG 2Q0OA 4JK1X 1TQIA 4EJTA 3J80Z 1I27A 4UV9A 1BI0A 1X3UA 2AS5F 1R5GA 5D4SA 2OZ6A 5AIPA 1TW2A 2KJCA 2LDUA 2NNNA 2B0LA 2IJLA 5HLGA 1O7FA 4CICA 5L3GA 2JSCA 2D1VA 4EV0A 1DPRA 4MNUA 4ENJA 3SQNA 1USTA 2GIVA 3IHUA 2XROA 2EFPA 4XLPF 4Z2YA 1GXQA 1ZG3A 2O03A 4ZYHA 1XN7A 2NYXA 3TKYA 4YIIA 4FHTA 3C1DA 1ZGJA 1FBUA 2P7VB 4ESBA 2H09A 3BPXA 5ICGA 2RVCA 4RGRA 2E7WA 2M45A 2QVOA 1ZAOA 1GXPA 2FBKA 2KIMA 1HW2A 1LNWA 1U3EM 1LEAA 5JI6A 4BHBA 1LB2A 2K7LA 3JAMK 2BEOA 4IF4A 1E17A 3M8EA 3WGHA 2UWMA 1QBJA 5L3BA 3J81Z 1Z05A 5LEJA 2JRTA 5ED4A 2HOEA 4KICA 4UHTA 2LKPA 5D5VB 2JT1A 2FSWA 3S2WA 3CDHA 2RQPA 1XGOA 4GXOA 2ELHA 1SMTA 2EWNA 4QLCU 1IN4A 3KCCA 1ZRFA 1HXDA 1OMIA 1PP7U 3ZMVA 3GX4X 2FU4A 4MHGA 1LDJA 4I98B 1D8JA 1W5TA 3FM3A 3I0TA 3V8LA 1KYWA 4R1HA 5LRSA 4M9XA 4P5OA 5EEHA 3BWGA 1F4KA 4BQAA 2KJBA 4BYYA 2FRHA 2FOKA 3TGNA 2IT0A 4LB5A 4EMSA 1LDDA 3P9KA 2HR3A 3K1NA 4HF1A 3LAJA 3E97A 4UVAA 1FYKA 2W84A 1OR7A 4A5MA 1XDSA 3MZYA 3QU6A 4WXDA 5TRDA 2CO5A 1Z1DA 2H94A 2CW0F 2RKHA 2YX7A 5BPDA 3K1PA 3KEOA 1R1VA 3K0LA 3HRMA 2ZCWA 1W5SA 2QZ8A 2P4WA 2KIFA 3MCZA 1MDMB 4LJZF 1B1BA 2OAZA 2GWRA 4S04A 3ERED 2YR2A 2NAZA 2Z5UA 3E6BA 3MFKA 4LMYA 5CLSA 4G6DA 4HF2A 3LQQA 2GXGA 2HKXA 2MH2A 3RKYA 2XKOA 3T1BA 4D0PA 4Q5SF 2P5LC 4KYWA 1ZN2A 4PGGA 2V1XA 3E5QA 3FMQA 4LD5A 3TO7A 4PCQA 4AIKA 4P55A 2DK8A 3C7JA 3KP6A 3KETA 1OYIA 2DO7A 3D5LA 1F9NA 3EUHA 5CJ9A 1KU7A 5E1XA 1FP1D 2ZNYA 1BJAA 1HKTA 1K6OA 3RKXA 3CJNA 3RPQA 2LF7A 1W7PB 2FEZA 4AIHA 1SD7A 3I54A 2VODA 1ZLJA 2X4HA 1XSDA 2VONA 1ONVA 1LVAA 2R7FA 3T5XA 1G3WA 2LNBA 2XAHA 2ADUA 1ZG1A
chains in the Genus database with same CATH superfamily
2EJRA 4F92B 1YJNI 1Z6RA 1FOWA 3IH4A 1K83J 3EUKL 1WH7A 1NK3P 4ZTJA 2DA6A 2VE8A 3ZQIA 2DK5A 2Q1ZB 4BAYA 3CC7I 3Q3SA 5E17F 1RKWA 2K9SA 1D3YA 4HG2A 3GTKJ 4BY1J 3V4GA 1W7PA 1QZYA 4LGWA 1BW6A 2LD5A 2FMYA 2KP6A 1WJCA 1VQOI 1A6QA 2NS0A 4FX4A 3DF8A 1UG2A 1V3FA 3NWSA 4E6KG 1FSHA 3PSFA 1E3PA 2M0MA 2DJNA 2K4BA 1RR7A 4XR6A 1RNLA 2CFOA 1ITYA 5CVVA 3LQRA 1X4OA 4KITB 4XLFA 4H0EA 4AIJA 1EV7A 4ENNA 1A36A 1SD5A 1BI2A 2Y75A 1D0YA 1FYMA 1ULYA 1X1PA 1L0OC 5BS6A 4F93B 2OCCH 3CO6C 3IUOA 1Y0UA 1ZHFA 2VPRA 3TW7A 4CCOA 2XPVA 4UUTA 2DQRA 2HZTA 1YTYA 5J8CA 2F2EA 4M9ZA 1G3YA 2ESHA 3H36A 1ETXA 1I6XA 2XDVA 3V7CA 4M6XA 2V9VA 3BTJA 3QYEA 5ILUA 4IHWA 1BIBA 3V8JA 3K2AA 3PSIA 3MKZA 4N9HA 1Z9CA 5IPAA 2VQLA 3R61A 1FP2A 1I3QJ 4I09A 1JKQC 4RM3A 3CZ6A 2IXSA 3VWBA 3OYIA 4BQOA 1QVTA 1IZ1A 2V1UA 4BNCA 3CCMI 3BY6A 1Z21A 4Y33A 1R22A 2JRMA 1K78A 5DD4A 1TWGJ 1PP8F 2GA2A 2KZVA 3T8TA 2X6WA 1O3TA 4CCLA 4W1UA 2EK5A 2EPFA 2X85A 2LFBA 1OISA 4MEYF 4YIFA 1KYZA 1BOAA 3ERMA 5J6XA 4RB1A 4D1QA 2EZHA 4N0BA 2IA1A 3WE2A 2RNGA 4N4NB 1AA7A 3LWFA 5KK1A 4JBAA 2IVMA 4MTDA 2JVGA 2XPWA 4DW6A 1G59A 1RI7A 3LOCA 4XRFA 2R5YB 2DOAA 4RLFA 1VQMI 5DTDA 3EUAA 3OYFA 1RRJA 3AL0C 2R7ZJ 2CG4A 1YYVA 2F6CA 1DDNA 3PUBA 4OAZA 3CMEI 2BY2A 2VBXA 3HSFA 1FLIA 1B4AA 3I71A 5E3LA 1YRNB 2W00A 3IV5A 2QKMB 2WA0A 2CQXA 2GAUA 3ZMZA 4XKWA 2GZWA 5E1WA 4MIMA 2VKVA 3CD6I 4HEA2 1Q1VA 1XB4A 1S9HA 3WG7H 3ULQB 3FXJA 1MSFC 3HB9A 3JRAA 2K27A 1Z91A 2MLGA 4MFEA 1ZRDA 4CSWA 5FLVA 1FIAA 5HNHA 3BR1A 3K4LA 3ZQFA 3HG9A 4BDYA 1LVKA 5EZHA 2DXIA 3GVAA 1QHHD 5EGOB 3H5NA 3KEYA 3OR2C 1P2FA 5C44J 1LDKB 2LSOA 5M5WJ 2IW5A 4MGRA 2KIQA 3HEFA 3H0DA 1FMVA 2OTJI 2P5VA 2E35A 3L09A 1ZH5A 4HQEA 3AG1H 4YFXF 3LA7A 3OWTA 3HDDA 1Y1VJ 3OYHA 4WF2A 5CKTA 3JRCA 1T39A 3ECOA 3MWMA 3F8NA 2E1OA 3J7ZI 3KP2A 4XLAA 4XRSG 3U2RA 3H9JA 4IPAA 3ZMUA 4YELA 4I0BA 3BT9A 5CQEA 5ILVA 2QA4I 1WCMJ 2V6EA 3BG6A 4BBSJ 2EFWA 4XBFA 2VJ5A 3A4CA 2W25A 1TWHJ 4AUXA 1LFPA 3J81K 2L54A 2PI0A 3QYBA 1R1UA 4E70A 1XMAA 1IUFA 4XN3A 4Q48A 3WGGA 2L9VA 2DPUA 1GVJA 4CDGA 2IP2A 2QWWA 5J1YA 5GAGJ 4LLNA 3OS1A 4BBRJ 2AXTC 5HDNA 4M3BA 2YU3A 3OYKA 1ETQA 4P9FA 3G1LA 4M3GA 3K10A 3ISPA 3DEWA 4PFPA 2CFXA 2JSPA 1ZELA 4XK4A 2KZGA 2X51A 2NRAC 1GUUA 3JRDA 1IXSB 1Y1WJ 1U8RA 2IGNA 1HOMA 2HQAA 2ISZA 5F04A 3SZPA 3K70D 3E6MA 2M34A 3PUFA 2VT3A 5D6FA 3C2BA 1T6SA 3V8KA 1HKQA 2OBPA 2A6HF 2JA5J 2QCOA 1OYWA 5C3EJ 2A5WA 2IEKA 1NK2P 4IOCF 4LITA 3DXJF 2LR8A 4HDVA 5B5EC 3AAFA 2XC7A 4OMYA 3FWEA 4XOPA 3ZXSA 4B43A 1OKRA 4YRVA 4YFKF 3H0GJ 3FKIJ 2MH9A 3DEUA 4C2TA 2O3FA 1GT0C 1Z3YA 3JTHA 3CMYA 1JUSA 1YS6A 1VF9A 1Z7UA 3KLNA 5IT9Z 3IH3A 3HUGB 4A6DA 3SDGA 4EJVA 3CUOA 5L3DA 4ASNA 5HLTA 3WHCA 2XF7A 3ZQGA 4XQFA 5F0HA 1EF4A 1MBHA 4LG0A 4G7OF 2CQKA 3BROA 5FROA 2QQBA 1VQLI 4MTEA 1MMSA 4A0XA 3DP7A 1QPMA 3KYLA 2WAEA 3W2AA 3NARA 2OD5A 1U9NA 4CZCA 1A6IA 3CCQI 5E8IA 3KFWX 3U1DA 5HLHA 1V5EA 1WI3A 1MNMC 4A5NA 3SHFA 2EA4A 1TW3A 3N4MA 4DQ2A 2JA7J 2DA2A 3FK6A 2JJ7A 4FISA 3CMAI 3D0SA 3U1KA 4G8XA 1A04A 2F5CA 2VT2A 5F08A 4YFNF 1RZ4A 2BE5F 1TTYA 3OYDA 4LIVA 2HVRA 2PJRA 4IZZA 2DDBA 3EYYA 3DCFA 3QWLA 3KLOA 3ZPLA 2EINH 3K4CA 4GYIA 4B09A 1FT9A 2L02A 3L00A 1TL8A 2C6YA 3H92A 1G6NA 2ME0A 3TOAA 2HZDA 2O8XA 2KDOA 4A6EA 2KL4A 4NUBA 3FXQA 3MMYB 3F6OA 4UXNA 1YO5C 3CJTB 1IRGA 3COAC 2ZNZA 4F7ZA 4ZC3A 5TJJA 2K85A 1LE8B 1JJ8C 2KRFA 1E2XA 1N78A 4CYCA 3PM1A 5FD6A 1WJEA 1R36A 2CU7A 2FNPA 3FHZA 2HWVA 3WTTC 4CH7A 3PNVA 1H8AC 1HW5A 3RKWA 3E0JB 3HOSA 4KN7X 1A31A 4U88A 2XAJA 2XUBA 3CDLA 1RPWA 3HPHA 1SAXA 1ZYRF 2TDXA 3VSLA 1RUNA 2O6GE 4I02A 2V1NA 3Q0VA 3ZGKA 3F8CA 2K9LA 2RN7A 3TL4X 2VBYA 4PDKA 3DLLF 2AQFA 2UZKA 4P96A 2VE9A 2XKPA 3HOTA 3CCUI 3LSMA 5DM7F 2HPMA 2E36A 1NHAA 4A3BJ 2XRNA 4ZYDA 1FBQA 4QPQA 5AONA 3KP4A 5M3FJ 3AG3H 4D7NA 4W97A 3AL0B 1LEBA 5DV5A 2M5WA 2OQRA 2DDAA 3FF5A 2F4IA 1R5ID 1P4XA 2F48A 2FOWA 3K1MA 4FE4A 3KP5A 1U0JA 3BG7A 1WHUA 4RB2C 2HDWA 1TZLA 3CP8A 3SZTA 4B48A 1SFXA 2JVHA 1MZBA 3HRTA 3DU6A 4Q4ZF 4KDPA 1JHHA 3ZQHA 4ZDLA 3BJOA 2E1NA 4IHSA 4UUVA 3GTQJ 2EBIA 3E6CC 5JFRA 1T98A 3MZ8A 2RAEA 5J4VA 4B3XA 3JRFA 1XSXA 2WC2A 1R23A 1MKMA 2KHMA 4R79A 2DA1A 1U6GA 3EPZA 1UB9A 3S8PA 4G6TB 4XRMA 1S3JA 3FMSA 1TT0A 2X0LA 2FUG2 4UNOA 1XGNA 1BIAA 4QTRA 2F5FA 1S8NA 3G3ZA 4HZFA 2G7UA 4PJNA 3S2DJ 1AOYA 3B6AA 3BTCA 2VL8A 1T38A 1TNTA 5ICEA 1X4PA 5LHHA 5LHGA 2LYCA 3F0CA 5F64A 3RIRA 4ZZDA 5JHUA 2EZKA 2NS7A 1W0TA 4EGYA 1USSA 3L2CA 2ZFWA 4B3AA 1FBSA 4KIBA 2QGUA 5J4YA 2JZYA 1QO0D 2QKLB 2XAFA 4FCYA 4K2EA 3PIPF 2HYFA 1KQ8A 3HGGA 2GOXB 1P7JA 2YS9A 4IVNA 4RDUA 5DUIA 2QM3A 1JTXA 3KIOA 1TWFJ 2DMUA 1S29A 4KT5C 1QPIA 1VQ7I 5FGMA 1DGRM 3PNTA 5HS9A 2LY1A 3F8BA 2CGPA 3O2PE 3E7LA 5IP9J 4RGSA 2FX0A 3RJPA 1ZREA 2HXOA 3QU3A 4HSTA 2QEXI 1FTZA 4L9NA 3IWFA 2R7TA 3T8RA 3VPRA 2DFFA 4F52A 3RQ4A 3CCRI 2PEXA 1IN5A 1I3AA 2CJJA 3OYBA 1LFUP 1OJLA 2ETHA 2CUZA 3A0HC 4ESFA 5LEKA 2PJPA 2H1LA 1D5VA 2UXNA 3OMYA 2L01A 3JSOA 3TQNA 5IOYA 2W4SA 2CV2A 4IRIA 4PZJA 2HDDA 1Z77A 2JUCA 2OJED 5HDKA 4BE2A 1OCPA 5BQTA 5J47A 1IG7A 1A5JA 2R7DA 2W85A 4Y13A 1FIPA 2LC2A 2DLLA 2HDCA 4HRIA 3P7NA 3IC7A 4B4CA 5TGTA 2NVXJ 1WJBA 2LTPA 2DA5A 3L2VA 1MJBA 4BHCA 3I59B 2JK3A 3GF2A 5KVRA 3JSPA 2VUMJ 4NHJA 3S3NA 1KU9A 5KAIC 3RTRA 4KNYA 3CQZJ 5M5XJ 2OQGA 3V7RA 5JLXA 3ZOBA 3BJAA 2M4GA 2WB1A 4KT6A 4PFOA 3K4NA 1OCOH 2H8WA 2ZJRF 3Q5FA 1KA8A 4RS8A 1MIJA 2EIKH 3I9V2 2VOPA 2FF4A 2WADA 2V4JC 4EM0B 4CYDA 5IP7J 1S7EA 1SFOJ 5KAFC 3H1CA 1XG1A 5JVTA 2M8GX 4U0YA 3BZCA 3HSEA 4DNCA 3I64A 3VDXA 1PUFA 3W6KB 3CCEI 2ACJA 5FFZA 2R7WA 4NC6A 2Q8KA 5K1YA 1ON2A 5H2FC 1J75A 1KU2A 1IN7A 3GUDA 4RB3C 1MDMA 4M9SA 5ERIA 2RDPA 3M07A 2WBMA 4PSWA 3GLXA 3ZCOA 4GDFA 4XSXF 4EVIA 2O5RA 1MGTA 1SFKA 5K5OA 4BE1A 1GDTA 3HTUA 5ICFA 3GZ5A 3OYMA 5ILSA 4BGDA 3CF2A 2WV1A 1U78A 3WHBA 3SFIA 5LLQA 2F4OB 1Y8QB 2E2HJ 1N25A 5J1RA 3CCYA 1YX5A 5CYVA 2FQ3A 2WTEA 1NTCA 2BHZA 4PGHA 3OSGA 2ELJA 1FYLA 2R92J 2E19A 4IRHA 1B6AA 1FOKA 3PL8A 5DCMB 3FMRA 1V55H 5K7ZA 1JGSA 2NNYA 5D6EA 2DBBA 3LSPA 2ELKA 3KYDB 1PJRA 4HNVA 1R7JA 2VXDA 3M1CA 4CCNA 2UXXA 3JW4A 1YG2A 5LD2C 1XMXA 4P9UA 3N05A 3RQIA 5E20A 5B1AH 1P4WA 3RPUD 2L0KA 1DGWY 3OYNA 5B3SH 3JAMZ 5HNFA 2E7XA 1OQYA 2BW3A 4CZZA 4EJUA 4NC8A 4O6JA 1IV8A 1XD7A 3JRGA 3R4KA 3I5UA 2E2IJ 3SZGA 3M1EA 3WTZA 2W57A 3QPHA 3NRVA 2CQQA 3CCSI 4NQWB 1BC8C 1ZLKA 5D5XB 5EG0B 1SC7A 3CTAA 2A5YB 5FKMA 3AG4H 3S32A 1NG6A 1OCRH 2NVYJ 3DBLB 3HJEA 2JN6A 4JP0A 4A2UA 3AFHA 2Z33A 4BJ6C 2XB5A 3MKYB 2VKDA 3HYIA 1Z6TA 3KP3A 4M6YA 3VOEA 1X19A 3S16J 1H9GA 3JRIA 3K4BA 1X3ZB 1REPC 4KISA 3BJ6A 1R1TA 3CJQB 1BOBA 3O8GA 1WPKA 3LFUA 2EA2A 3ELKA 4F3QA 1S7OA 2VBZA 2HVQA 2MC3A 1RKTA 2HKOA 2FMLA 2NXNB 1SD4A 1EJ9A 2IGOA 2P8TA 1HCRA 1CF7B 2HTSA 5FD5A 2XGDA 4H4KC 5GAHJ 2VQGA 4NQWA 1OYYA 4BKXA 2XGCA 5EG0A 1IXCA 4KUMA 4AWXB 1POGA 3ZMDA 1T0FC 1J9IA 1FOYA 2WAQN 1SFUA 5FRNA 3CMMA 2CMPA 2GLOA 5GPAA 2JA6J 2DA7A 2MSYA 2D1HA 4IJAA 1FPQA 3B02A 2HOAA 2X9DA 4U87A 1KONA 5F6FA 3PO3J 2A07F 4O5VA 4YEJA 3GTPJ 1BBYA 3G71I 5BMZA 1D8KA 2XGXA 3GEZA 3OL3A 4HNTA 4A3DJ 2HOTA 3X2QH 1ODDA 2DFEA 3F6VA 4M3EA 5C4XJ 1D1BA 4Y3OA 4PJLA 3ZQCA 2GXAA 5A2QZ 2L9SA 3FIWA 4YG2F 5E1ZB 3TDZC 4OIOF 4UY8I 3HOWJ 4IRGA 2O0YA 1W1WE 2Y9ZA 3ABUA 1YITI 3BR5A 3WTXC 1BM9A 1S6LA 1YW9A 2ZXHA 3VYRB 3K6GA 2QQ9A 3J80K 2IS1A 1AKHB 2BGCA 5ICCA 5IYCJ 2L7KA 4Y15A 1KGSA 2OA4A 5M5YJ 2DQLA 4A3CJ 4LK1F 1O4XA 2MW8A 3FM5A 2VKHA 3LL7A 4JX4A 3I4PA 2ME6A 1QGPA 5GTIC 5IT3A 2F5EA 3WTVC 3RZOJ 4ON0A 3SXYA 1YJ9I 3DQVC 2R7VA 3GXOA 5BNGA 1JI8A 2JWTA 3EQLF 1G3TA 1R49A 4LLGF 3E3VA 4RBOA 4XN0A 2XASA 3VFZA 1HQCA 2ZSIB 3R60A 1CGPA 1BR4A 2EFOA 1AHDP 4N4OB 3GTLJ 3CO7C 2M7AA 4HX4A 4ZYAA 2ZSHB 4I76A 5EEGA 3I55I 4KA4A 3E6DA 4M71A 5D5UB 5J3LA 4MQVA 1UG0A 5GPCA 1AKHA 2BBYA 3O3KA 3ZRGA 1G2HA 2R0QC 5D4RA 5HS7A 4GYGA 4ENMA 5J1UA 1FX7A 4ZJZA 3CCJI 3D1NI 1BW5A 4PJ0C 3LSRA 5FKNA 4WX9A 1N77A 2J5PA 3F72A 1MBFA 1BC7C 1FY7A 1VQ6I 4HBLA 5DUKA 3L2QA 1SANA 3C2GA 4BXUA 4A3KJ 5B1BH 2DFHA 2B9SA 1YIOA 1EA3A 1I5ZA 3PFYA 5K7FA 2XVCA 1WJ5A 2F4MB 4L5IA 3VSKA 3OIOA 5JHFA 2KDZA 1MD0A 1J0RA 1ON1A 3IH2A 3HOUJ 3IWZA 4F91B 2R5YA 4CGZA 3IP4B 4IHTA 3GTMJ 3F21A 1TQPA 2E1CA 3OY9A 1X1AA 3BQYA 3OIQA 4A12A 4RM2A 5CPRB 1WSUA 1YRNA 5F1JA 3BZ6A 2VBWA 3MKLA 2YX4A 2P5KA 3ZR8X 5EEAA 2G7HA 2QBYB 5E3MA 1HF0A 4HYEA 1ZR2A 3U9GA 2PX9A 2QUFA 4G12A 2CW8A 2J5OA 1AU7A 3OL4A 1QZZA 4DBRA 5EGOA 4L0ZB 5L3FA 2OUMA 2HTJA 3BG9A 4ZYEA 3S1MJ 2LKXA 1TT5B 1YFHA 2XB0X 3RCOA 5DCFA 1GV5A 3IKVA 1T08B 2K40A 4KJZA 5M3MJ 3NEUA 2CWEA 1MNDA 1DQUA 3GTGJ 1U5TB 4E7IA 2UV1A 2Y31A 3CUQB 2CUFA 3FISA 1S72I 1DUXC 2IGMA 3VYSB 1IRFA 5FKKA 1LJ9A 2EFQA 3DTEA 3RDIA 2RQQA 2HQNA 2LMDA 1F43A 3KZZA 3QP5A 4KIFA 3I3LA 2FE3A 2QBYA 3MKWB 2MC4A 1EH7A 5E18F 1BL0A 2O7OA 3JTGA 3QOPA 2CW7A 2HXIA 3GFIA 2LOOA 3Q9SA 4AIDA 2QQ8A 4A3MJ 1JKOC 4ESJA 2M9HA 1PVEA 4KFCA 4OMZA 1TWAJ 3W3CA 2COMA 3LAPA 5C4JJ 4D9JA 3IRRA 3K4JA 2VKEA 1RC9A 2L7ZA 1W4MA 3SFZA 9ANTA 2CS3A 3E5XA 1JTYA 2QSGX 1XGSA 1Y39A 3R0AA 1IN8A 2Y9YA 4C3IJ 1BR2A 1JE8A 2Z9OA 3FHNA 4GO1A 4I7HA 3G2BA 2EB7A 3HSRA 4JX5A 5HDGA 2Z99A 1FSEA 1XDUA 1YI2I 2I10A 4U0VA 4XM3A 2WY7Q 1VQ8I 3TEDA 2M3AA 1FC3A 1VI0A 1F36A 2M1BA 5LBQA 4QPOA 3HOXJ 2A6TA 2VN2A 3TO6A 4CXFA 2NOGA 2OZUA 1F5TA 5D8KB 5FJ8J 2YUSA 2L3DA 4Y17A 4FTHA 1I1SA 2EIMH 4G9YA 1IC8A 1X1DA 2QF7A 1Y56A 3WG9A 3Q9VA 4HF0A 4Q47A 1I39A 3DLAA 5HLIA 2QENA 4G6QA 4YIRX 2EQRA 3ASNH 3FDYA 3LSJA 3R0JA 4XRSA 3K9TA 5EDNA 1LPQA 4GFBA 2MYSA 1X2MA 3VB2A 3P9IA 4KMUX 1UCRA 4I0AA 2E60A 2WWYA 2E71A 4XSZF 3HUGA 1IJWC 5JR3A 2IA2A 1MMAA 3LA3A 3M9AA 1K7AA 1D0ZA 4OIPF 1X1CA 3QPLA 4B1RA 1P4AA 4MEXF 4PJJA 1JXSA 4DZPA 2Z1DA 3GO5A 5D5WB 1BR1A 1T0FA 2WY8Q 2ECCA 1EH6A 3HC7A 3HZJA 4LFUA 3KX2A 2PMZA 4L9TA 2RNJA 2PMZN 3D5SC 3BOQA 4G7ZF 3FZVA 2G9WA 4NC7A 3L2WA 5AIQA 1IRZA 2O9LA 4C2UA 3SJMA 2GOMA 3QPTA 3BP8A 2DN0A 3BDDA 3G4SI 4AU7A 4BU2A 3K70C 2ZB9A 2IRFG 5J8FA 3ZN0A 4A3FJ 4M3FA 1XPXA 5LGTA 3ZQLA 1JKRC 2ISYA 2P81A 4M74A 3N97A 2BXZA 4DYQA 4PUSA 1SVLA 2DJIA 4IO9F 3RPUA 1Z67A 2EV5A 1STZA 1HSTA 5LFAA 3EETA 4HDUA 4MO7A 3MZHA 2D45A 4A0ZA 1O3SA 1ZK8A 4M3DA 4OINF 1O3QA 5DYMA 3MEXA 5L3EA 1CQTA 2HI3A 5L3CA 1P92A 2CV0A 3ZN1A 4BACA 1OCZH 1LE8A 4TV7A 2YPRA 3BPVA 4HV5A 3RI4A 4U7BA 1H0MA 2EV0A 2VIXA 3DKXA 1MJAA 3VYTB 1APLC 2HVSA 2DCEA 4RB0A 5DD8A 4C9YA 2DFIA 3T0YA 1B8IB 2W7NA 1TC3C 3MAJA 2K5CA 1MSEC 5IYBJ 1W5CC 1X1BA 2Y48A 4CCMA 1FMWA 2OU2A 2HPIA 3F8FA 3ABTA 3OR1C 4NBQA 3BR6A 2AHQA 1SD6A 3S1QJ 3NQOA 3S3MA 4N9IA 1OLTA 1XCBA 4JQFA 3BG3A 5FLXZ 2OC6A 2PBIA 3WTYC 2QLZA 2H1KA 4HA8A 1XSVA 2PFBA 3OSFA 1N75A 2OCEA 3TOBA 3IL2A 3DTIA 4AVPA 4MLOA 3HKZN 1XMKA 4EGZA 2HEOA 4OOIA 3DPLC 2HNHA 4HPQA 1DPUA 3GYHX 4BY7J 1PUEE 1RIOH 2R7QA 2D5VA 3M7GA 4UVBA 2MABA 3U21A 4HAMA 2A69F 2KQRA 1MJ9A 2DW4A 1JGGA 4X1EA 4D5FA 2IBDA 2DT5A 3JRBA 2ECBA 2Q2EB 1Y8RB 2DMPA 1S5LC 2XHKA 3A1YA 3KEQA 5CVIA 3W2WA 2IS4A 3KPHA 2LBFB 3G73A 3HIFA 2ZJ2A 3V42A 2GA1A 4LB6B 2EZLA 2DMNA 4FT8A 4FQGA 4ZZLA 2K3FA 4B44A 4KN4X 5FB2A 1J59A 4EJOA 2P7CB 2V7FA 3B73A 4XLEA 4XKVA 2MGQA 1FJLA 2DAOA 2FNAA 5BPIA 1J2XA 4JYKA 2RC4A 1V4RA 2YSRA 3A2KA 5E8GA 3I56I 1ZG5A 4WWCA 3H3ZA 3ZP5A 3V7SA 4V2GA 1F1ZA 2K02A 3EDPA 3LSHA 1ETVA 1SVMA 4UUSB 3ABKH 1IW7F 3FXLA 2ZXJA 1X3WB 1K61A 2Q2EA 3KE2A 3ML6A 2LY9A 1E3OC 1V5FA 1WJFA 1LKXA 2DOFA 1QZEA 2JTVA 3MN2A 4B47A 2NVTJ 2V6CA 2X6YA 4OIQF 4WXCA 1WH5A 3SEQA 4EM2A 2XIGA 3CF5F 1T8IA 3ZMSA 1ZARA 2DYSH 1IF1A 3ESWB 4M72A 4HLXA 2ZJQF 4O3MA 2L7FP 3GFMA 2ZXIA 2MBFA 2M87A 5K5QA 3DU5A 4ETSA 4GGGA 3C3WA 3DFGA 3HTSB 2LF8A 3BTIA 4HLYA 1KQ9A 4UUSA 1QA6A 2UUZA 1OCCH 3HGYA 2KISA 2Z2SB 5A2QK 3IKTA 4L5JA 3PJRA 2CQ7A 5DEQA 4BHPA 1A35A 4XMYA 1MBKA 1TP4A 1LFBA 4RA2A 5HODA 2O61A 5LGUA 1G3SA 2QQAA 3OS2A 1G4DA 5TISC 5IOZA 1QVUA 1MH4A 3KP7A 5LGNA 2BV6A 4IQJA 1H88C 4E7ZA 3IAS2 4I01A 1X2NA 3F3XA 5DM6F 4XLHA 4A69C 3DV8A 3WTUC 1KQ0A 2R3SA 5CQGA 3VEPA 4B8XA 3HPGA 4PK4A 3W6JB 2FXAA 2W48A 2HS5A 1HKSA 3SEZA 1D0XA 2BYVE 2WV0A 4LK0F 3L2UA 1TBXA 2BVLA 3A0BC 2NVUB 2EZIA 1R5HA 1ZGAA 4HOBA 3CC2I 3M8FA 1RR8C 1O3RA 5GADJ 4R8HA 4C3HJ 2QYOA 4RAZA 4IEJA 4MQ9F 4QIWN 6PAXA 4E7HA 5CVUA 3I59A 3S17J 3M4OJ 1XTAA 2VXZA 1Y6IA 5HS8A 5E3OA 1SMYF 2VC0A 3K2ZA 4HX8A 2BVMA 3H3UA 1MMGA 2JPCA 1ZRCA 2XSDC 4GCVA 2A6EF 3QYFA 3WE3A 5EZGA 1VTNC 4II2A 3OS0A 1C0WA 2FQ4A 1UHSA 4XNFA 1L3LA 4I2OA 4XORA 1WRJA 1MMDA 2DI3A 2XAQA 4J19A 2DPDA 3O8HA 3M3YJ 4U0WA 3K4MA 4Y52J 2Y30A 4XL9A 2M4KA 1QU3A 1XGMA 3GTOJ 3MD2A 3OOPA 4RAYA 3ZQQA 1ZKGA 3BCAA 3OYEA 4UV8A 3BCBA 2R5ZB 4EM1A 4E7JA 1B9NA 3WGIA 2OPTA 2CH0A 2JA2A 3TBIA 1WQ2A 2H27A 4E7SA 2EFNA 2OF7A 1WVRA 1VZ0A 2P6TA 5J40A 1U5TC 2PLYA 4IKFA 3QOEA 3PQJA 1Q1HA 3CUQC 1P9QC 5F0FA 2RV8A 4DYRA 5K5RA 1IAWA 3I58A 3BR2A 2CUJA 2ZMEC 5LRRA 2EV6A 2XF6A 3QAHA 4UVCA 3BC8A 2F5DA 4HNUA 1VQKI 1M1EB 3GTJJ 5H6QA 1JHFA 4IHVA 2XV4S 4RMNA 2AQEA 4LOCA 2P6SA 4S0HB 3QP6A 3REOA 3TDUC 3OYAA 1YS7A 1P6RA 3FXUA 4OIRF 1K4TA 2FD5A 2MD5A 2NOJB 1H9TA 1OFCX 2L2OA 3CLOA 1BI3A 2K3PA 5DCMA 2V26A 4I6ZA 3IRQA 4CCJA 4WCGA 3LA2A 1GVDA 1QQIA 2I8DA 3I53A 3CDIA 4QWQA 3OYCA 2KLOA 1D1AA 3RZDJ 1U2WA 1E0EA 5E3NA 2HGCA 3QRFF 1XX5A 3O6BB 1O57A 3FBNB 3QQAA 4PJMA 5LHIA 2VOOA 2LK2A 3W2VA 4Z6YA 2COBA 5F0CA 2ZO4A 5GTHC 1K79A 3DEEA 2K9NA 4A3JJ 3CCVI 1GLNA 2VASA 4U7DA 1MBGA 1YW7A 2KKOA 3R6SA 3BLYA 1QRYA 2BZTA 1KU3A 2ID3A 2XGEA 3GLLA 2Y69H 2VC1A 1IDYA 1R4MB 1UJ8A 2ICWG 4L0YB 1FNNA 2VI6A 4WK8F 3GWZA 2K86A 1MBJA 3FXMA 3WU0A 3WU2C 2WAQA 1LQ1A 3S15J 3ZMTA 4J00A 1S7AA 2IPQX 3BR0A 2XPUA 5HOOA 2GQQA 3L7WA 1QNTA 1BN5A 1B9MA 1WGXA 1ERDA 1O7LA 1UHMA 2M8EA 5CVJA 2GM4A 1MMNA 3J7AO 2DMQA 1UFMA 4CO8A 2HFHA 3BQZA 2JPBA 3RYPA 3LNQA 1D1CA 2K9QA 3PFIA 5FO5A 2DYRH 1TWCJ 3KZYA 1VFCA 2STTA 3CESA 1CF7A 4BJ5C 3SYTA 5IT9K 1TNSA 1K78B 1YW8A 2M30A 1IXRC 1MBEA 4HQMA 4DBQA 2W82A 3A02A 5F1RA 2E2JJ 4BS9A 1AWCA 1HDPA 3DPUA 1DP7P 1B59A 4NDLA 2K9MA 4BE0A 2LRDA 4EEFG 3WODF 1U8BA 2PQ8A 1HA8A 1DU6A 2BY0A 1ZTRA 2CYYA 2M7BA 5FLMJ 2V79A 1RUOA 5H20A 5DDGA 2W24A 1XCVA 2E1MB 3GW2A 3QODA 1SFEA 1ETOA 2X48A 1Z0XA 2G0EA 5DS9A 1ENHA 1G8XA 2E5ZA 1QHGA 1YLFA 3LSTA 4L9JA 4AD9A 3WTWC 4D7MA 2H6CA 3HOZJ 3PQKA 1FEXA 1YOVB 1JT6A 3I4MJ 2JA8J 1J5YA 4BQNA 3WTSC 2Z3YA 4C3JJ 2R93J 3L9FA 2ZJPF 3LFKA 2IGKA 1SEUA 1BA5A 3FXRA 1BI1A 4ZH4F 2D2WA 2ESNA 3QPSA 4RGUA 3S1RJ 4IXAA 3WU1B 5CVRA 4XOTA 4MFDA 4DGWB 1IN6A 2XRLA 1ACIA 2A68F 3DKYA 4WXHA 5FRMA 3ROUA 2EH3A 4ENKA 4KMFA 2PN6A 5H6RA 1WI9A 4L5EA 2FBIA 3DKWA 3H5AA 1YQAA 5HVQC 2V1DA 3FX3A 3CP2A 2A61A 2XAGA 1UHWA 2Y0MA 5IYDJ 4G7HF 5BOXA 3FBIB 2N8GA 1I1GA 3C18A 3CJRB 3TP3A 2DU9A 2VJIA 3OV8A 3GZ6A 2ZXWH 4LLLA 1R58A 3NAUA 3ABMH 4FE7A 4EQQA 2R7UA 2FJ1A 2HQRA 3F23A 4A3LJ 4BXFA 3L1PA 2K4JA 4KIGA 1T2KA 1WZ2A 4RGXA 4Y7NJ 3L2RA 1P7IA 4EATA 3VODA 3DBRB 4X0GA 4ZDPA 1WWXA 1YIJI 3GFLA 4HV6A 2GXBA 4OAYA 2A3SA 2JMWA 3RYRA 4L18B 1YJWI 3EYIA 4FASD 1YHQI 1UELB 2ZKZA 3P5JA 1W0UA 2BHYA 3S14J 3OYGA 4ZYGA 2DTRA 3TW6A 1HSJA 2FA5A 3GFJA 3DTKA 4EJWA 1UAAA 2ID6A 2QSHX 1LUJB 2AXLA 2DA4A 1OPCA 2H6BA 4A93J 2PMUA 2QSFX 1VQ5I 1DU0A 2IS6A 3TO9A 2STWA 1TQMA 2R7SA 4JX6A 3HHGA 3UR3C 4DYCA 2MLKA 1ETYA 3ZQ7A 2LG4A 4XKBA 3HHHA 4E7KA 4X6AJ 2O8KA 1Z7LA 2MA3A 2Y0SA 5D8LB 2Y0SN 2L9NA 4BDZA 1GHCA 2JQ7A 1R4NB 5FLXK 2VPLA 4S05A 1PDNC 1JUMA 3K69A 2KIUA 1V5GA 4XICA 2ZMEB 3HRUA 4NB5A 4OU0A 1WKMA 3HXLA 3P9CA 1J7KA 3ASOH 1HW1A 1K4SA 3LSGA 2H8RA 4A3EJ 5EJCA 5B66C 4HX7A 2R4GA 4BH9A 1OR7C 2DT6A 2CQNA 3FXKA 4FX0A 3BZKA 2FBHA 3KZIC 2R7XA 4DJAA 4XLNF 1TLHB 2DOEA 2PG4A 5IP6A 3HRSA 4M73A 1U5TA 1YX3A 3CUQA 2L4AA 3F8MA 2E5NA 3MQ0A 4D5CA 3F22A 1FOXA 2IA0A 2ZMEA 3DPTA 4G94A 3OYJA 2V9KA 3ECHA 4AM3A 4CHUA 3Q0WA 1EKEA 4XONA 2PMHA 2RGVA 4LG0B 2HYGD 4A0YA 1B72B 4P1WA 3E5UA 2Z16A 5FFXA 1VNDA 4PSXA 3PO2J 2VQHA 2OTLI 1I6HJ 2XF5A 4L9VA 3K4KA 1FZPB 1OCTC 2CSOA 1ZGWA 2VJJA 4DZJA 3LMMA 5KHDA 2HOSA 3A03A 3G1MA 4HW0A 1D5YA 3J7AY 1FWZA 1R00A 1W7PD 2L4MA 2CUEA 5EF6A 3GZNB 2ZBKA 1JT0A 2PJRB 3RSNA 1EH8A 2BY1A 5F27A 4C30A 1IUYA 1HBXG 4V19K 2Q0OA 1MNEA 4JK1X 3C2HA 3JRHA 1TQIA 4EJTA 2CRGA 1MW7A 2V9PA 1B72A 1IGNA 2LH9A 1DP3A 3J80Z 1I27A 1KZHA 4UV9A 1BI0A 3OYLA 2BY3A 1WFXA 1WJAA 1RETA 4M6VA 1X3UA 3OIPA 2AS5F 4CYCB 1R5GA 5FKLA 5IY5H 4LIUA 3EUHC 3FK7A 4ANJA 5GP9A 5D4SA 4AYBA 2OZ6A 4AYBN 5AIPA 4NNJA 2L7MP 1TW2A 1R71A 3HM5A 5FKOA 4IHYA 3G1OA 2KJCA 2HU9A 2LDUA 2NNNA 2B0LA 2IJLA 5HLGA 2KRHA 3LSKA 4BJTA 1O7FA 4CICA 1RESA 5L3GA 4F55A 5EYRA 3HOVJ 2JSCA 1PYVA 2D1VA 2I5UA 5JVGF 4C2MJ 4J01A 2LY2A 4EV0A 3NWTA 1DPRA 4MNUA 3SDBA 4BUPA 3HL2A 4E4HA 3SQNA 1USTA 4ENJA 2GIVA 3AKZA 3B6CA 3IHUA 4IOAF 2R7RA 2XROA 2IS2A 1BJZA 2EFPA 3F9KA 4XLPF 3FKJA 4XKCA 4Z2YA 1ZQ3P 2AO9A 1GXQA 1ZG3A 2O03A 1X58A 4ZYHA 1ETWA 3BTLA 1JJ6C 1XN7A 2NYXA 2CV1A 3UNGC 1UMQA 3TKYA 3UKGA 4YIIA 2MFZA 3C1DA 4FHTA 1ZGJA 3ABLH 4Y4RA 1FBUA 2P7VB 4A3GJ 5JLWA 1NG7A 4ESBA 2H09A 3BPXA 3DWLE 5ICGA 2B63J 2RVCA 2L5QA 4RGRA 5KCMA 3TMOA 2RREA 2VQCA 2E7WA 3CCLI 1E3HA 4DIQA 2M45A 1ZR4A 2QVOA 1ZAOA 1GXPA 1IO2A 2FBKA 2KIMA 3S3OA 1HW2A 3G6EI 3JCUC 3M8JA 2LREA 3S93A 1LNWA 4II3A 4ITVA 1W36D 1U3EM 1LEAA 2WAFA 5JI6A 1JUPA 1K6YA 2KT0A 4BHBA 1R9TJ 3H9GA 3HKZA 1LB2A 2K7LA 3JAMK 2BEOA 4IF4A 3RKQA 2LVSA 1E17A 4ZDOA 3LSIA 3M8EA 3WGHA 3JR9A 2UWMA 3H5RA 1QBJA 1B8IA 5L3BA 3J81Z 1Z05A 5LEJA 2JRTA 5ED4A 2HOEA 4KICA 4UHTA 2LKPA 1FTTA 2BXYA 5D5VB 1XC5A 2JT1A 2FSWA 3S2WA 3A01B 3CDHA 4ZTFA 1U9OA 3H3VK 3K7AJ 4LG3A 2RQPA 1XGOA 4GXOA 2ELHA 1SMTA 2EWNA 4QSHA 4QLCU 2KPMA 2DMTA 1IN4A 1MH3A 2NVQJ 3KCCA 4BXXJ 1ZRFA 1HXDA 1OMIA 2NS8A 1PP7U 2L9RA 1Z3XA 3ZMVA 3GX4X 2FU4A 1WJDA 4MHGA 3AG2H 1LDJA 4I98B 2XSJC 1D8JA 1W5TA 3FM3A 2GBYA 3I0TA 2BOLA 2LP0A 1SVOA 2TCTA 4RAGA 3V8LA 2VB6A 1KYWA 4R1HA 3TP0A 3A01A 1HC8A 5LRSA 1JKPC 2W1OA 2LBFA 2ZC2A 4M9XA 4P5OA 2LKSA 5KNLA 5EEHA 1XS9A 2YU9J 3BWGA 1VQPI 1F4KA 2XAUA 4IHXA 2E1MC 1SAUA 4BQAA 2KJBA 4BYYA 2FRHA 2FOKA 3MVPA 3TGNA 2IT0A 4LB5A 3BR3A 4CA0A 4EMSA 1LDDA 3OOUA 1GV2A 1J09A 3P9KA 2HR3A 3K1NA 4HF1A 5K7HA 3LAJA 3E97A 1VQ9I 1W36C 2EILH 4RAFA 4XLCA 4BEHB 4HSRA 4IL6C 4UVAA 4DOZA 1FYKA 2W84A 2X1DA 2MD0A 1OR7A 4XIDA 4A5MA 4AC0A 4BL0B 3S2HJ 1XDSA 3MZYA 2JUGA 3QU6A 3I4NJ 2X6XA 4WXDA 4A3IJ 5TRDA 2CO5A 1VQNI 1IRXA 4GRIA 3ONQA 1Z1DA 2H94A 2R7OA 2CW0F 2RKHA 2YX7A 2VLAA 1ORKA 2HQ5A 3H35A 3BG5A 5BPDA 2GIZA 3K1PA 3KEOA 1Y0NA 1PUFB 1R1VA 1YE9A 2DTZA 1H89C 2DA3A 3K0LA 3HRMA 2ZCWA 5GAEJ 1IDZA 4BQQA 4V2FA 3E1SA 4ABZA 2DODA 1W5SA 2QZ8A 2P4WA 2KIFA 4UB8C 4BEHA 2EIJH 3MCZA 1MDMB 3PIOF 2DT7B 2F5VA 4LJZF 1B1BA 2OAZA 2WB1N 2GWRA 1T95A 1T56A 4CUGA 2KFDA 4S04A 2M0CA 2B7EA 3KYCB 3GBGA 3ERED 2YR2A 4UB6C 2NAZA 2Z5UA 2Y2ZA 3E6BA 3MFKA 3PNYA 2HYJA 4LMYA 1NH3A 5CLSA 4G6DA 4HF2A 3LQQA 2GXGA 2HKXA 2MH2A 3RKYA 3W6VA 2XKOA 2OV7A 3T1BA 4D0PA 3CC4I 4Q5SF 3DBHB 3J7YJ 1R6RA 4IX7A 2E34A 3D5RC 2P5LC 2KMUA 1ZN2A 4KYWA 4PGGA 4E7LA 2V1XA 3E5QA 4CCKA 4I99C 2VJ4A 3FMQA 2P0WA 4IQ4A 4LD5A 2KRCA 3TO7A 2X1EA 4PCQA 2TRTA 4AIKA 1HDDC 4P55A 2DK8A 3S1NJ 2X6OA 3C7JA 5E79C 3KP6A 3KETA 2BW3B 3GMEA 3HBLA 1OYIA 3GCMA 2DO7A 3D5LA 1F9NA 3EUHA 2X1CA 5CJ9A 1KU7A 3Q0UA 1VQ4I 1HLVA 5E1XA 1FP1D 4RLQA 2ZNYA 3JREA 2ZFUA 1IV6A 1BJAA 2A05A 2IAIA 1T33A 1HKTA 1K6OA 4AVZA 3RKXA 2R5ZA 3CJNA 3HOYJ 3RPQA 2LF7A 1W7PB 2FEZA 4AIHA 1SD7A 3H9QA 2MG4A 3I54A 1UZCA 2VODA 4JOMA 3VYUB 3FXOA 1ZLJA 4FETA 3CLQA 2X4HA 1XSDA 2VONA 1ONVA 1ETKA 2LLKA 1LVAA 1I50J 2R7FA 3T5XA 1G3WA 2LNBA 2M2EA 3IAM2 2XAHA 2ADUA 4OWRB 1V54H 1ZG1A
chains in the Genus database with same CATH topology
2EJRA 1Z6RA 2VE8A 2DK5A 4BAYA 5E17F 1D3YA 3V4GA 1W7PA 1QZYA 4LGWA 2FMYA 2NS0A 4FX4A 3DF8A 1V3FA 1FSHA 2K4BA 1RNLA 5CVVA 3LQRA 4H0EA 4AIJA 1EV7A 4ENNA 1SD5A 1BI2A 2Y75A 1FYMA 1ULYA 1L0OC 5BS6A 3CO6C 1Y0UA 1ZHFA 2DQRA 2HZTA 1YTYA 5J8CA 2F2EA 4M9ZA 1G3YA 2ESHA 1I6XA 3V7CA 4M6XA 2V9VA 5ILUA 1BIBA 3V8JA 1Z9CA 4N9HA 3R61A 1FP2A 4I09A 1IZ1A 2V1UA 4BNCA 3BY6A 1R22A 1K78A 5DD4A 1PP8F 2GA2A 3T8TA 1O3TA 2EK5A 4MEYF 4YIFA 1KYZA 1BOAA 5J6XA 4RB1A 4N0BA 3WE2A 2IA1A 5KK1A 3LWFA 4JBAA 2IVMA 4MTDA 1RI7A 4XRFA 2CG4A 1YYVA 1DDNA 2VBXA 3HSFA 1FLIA 1B4AA 3I71A 2GAUA 3ZMZA 2GZWA 5E1WA 1XB4A 3ULQB 2K27A 1Z91A 2MLGA 1ZRDA 3GVAA 1P2FA 1LDKB 2LSOA 2IW5A 4MGRA 2P5VA 3L09A 1ZH5A 4HQEA 4YFXF 3LA7A 4WF2A 1T39A 3ECOA 3MWMA 3F8NA 3KP2A 3U2RA 4IPAA 3ZMUA 4I0BA 5ILVA 2EFWA 4XBFA 2W25A 3J81K 2L54A 2PI0A 1R1UA 4E70A 1XMAA 4Q48A 3WGGA 2DPUA 1GVJA 4CDGA 2IP2A 2QWWA 4LLNA 5HDNA 2YU3A 4P9FA 3ISPA 2CFXA 2NRAC 1IXSB 1U8RA 2ISZA 3SZPA 3E6MA 2VT3A 5D6FA 3V8KA 1T6SA 1HKQA 2OBPA 2A6HF 1OYWA 3DXJF 4HDVA 3AAFA 4OMYA 3FWEA 1OKRA 4YFKF 2MH9A 3DEUA 2O3FA 3JTHA 1YS6A 1Z7UA 3KLNA 5IT9Z 4A6DA 4EJVA 3CUOA 5L3DA 4ASNA 4LG0A 4G7OF 2CQKA 3BROA 2QQBA 4MTEA 4A0XA 3DP7A 1QPMA 2OD5A 5E8IA 3KFWX 3U1DA 5HLHA 4A5NA 3SHFA 2EA4A 1TW3A 3N4MA 4DQ2A 3D0SA 4G8XA 1A04A 2F5CA 2VT2A 4YFNF 1RZ4A 2BE5F 1TTYA 3EYYA 3KLOA 3ZPLA 4GYIA 4B09A 1FT9A 2L02A 3L00A 2C6YA 3H92A 1G6NA 3TOAA 2O8XA 4A6EA 3FXQA 1YO5C 3F6OA 4UXNA 1IRGA 3COAC 2ZNZA 4F7ZA 5TJJA 2KRFA 1E2XA 5FD6A 1R36A 2FNPA 3FHZA 2HWVA 3WTTC 1HW5A 3RKWA 3HOSA 4KN7X 4U88A 2XAJA 2XUBA 1SAXA 1ZYRF 2TDXA 1RUNA 2O6GE 4I02A 3F8CA 2RN7A 2VBYA 4PDKA 2UZKA 4P96A 2VE9A 2XKPA 3HOTA 1NHAA 2XRNA 4ZYDA 1FBQA 5AONA 3KP4A 1LEBA 5DV5A 2M5WA 2OQRA 3FF5A 1P4XA 3K1MA 3KP5A 4RB2C 3SZTA 1SFXA 1MZBA 3HRTA 4Q4ZF 4KDPA 1JHHA 3BJOA 2E1NA 4IHSA 4UUVA 3E6CC 5JFRA 1T98A 1XSXA 2WC2A 1R23A 1MKMA 4R79A 1U6GA 1UB9A 1S3JA 3FMSA 2X0LA 4UNOA 1XGNA 1BIAA 2F5FA 1S8NA 3G3ZA 4HZFA 2G7UA 1AOYA 1T38A 1TNTA 5ICEA 5LHHA 5LHGA 3RIRA 5F64A 4ZZDA 5JHUA 4EGYA 1USSA 3L2CA 2ZFWA 1FBSA 4KIBA 2JZYA 1QO0D 2XAFA 4K2EA 2HYFA 1KQ8A 4IVNA 5DUIA 2QM3A 1S29A 4KT5C 5FGMA 5HS9A 3F8BA 2CGPA 3O2PE 1ZREA 4RGSA 3RJPA 3QU3A 4L9NA 3IWFA 3T8RA 2PEXA 1IN5A 2ETHA 4ESFA 5LEKA 2PJPA 1D5VA 2UXNA 2L01A 3JSOA 3TQNA 4IRIA 4PZJA 5HDKA 5BQTA 2R7DA 2W85A 4Y13A 2DLLA 2HDCA 3P7NA 3IC7A 1MJBA 4BHCA 3I59B 5KVRA 3GF2A 3JSPA 4NHJA 1KU9A 3RTRA 4KNYA 2OQGA 3V7RA 3BJAA 3Q5FA 1KA8A 4RS8A 2VOPA 2FF4A 4EM0B 4CYDA 5JVTA 4U0YA 3HSEA 4DNCA 3I64A 3W6KB 2ACJA 5FFZA 2Q8KA 5K1YA 1ON2A 1J75A 1KU2A 1IN7A 3GUDA 4RB3C 1MDMA 4M9SA 5ERIA 2RDPA 3GLXA 4XSXF 4EVIA 5K5OA 1MGTA 3HTUA 5ICFA 3GZ5A 5ILSA 1U78A 5LLQA 5CYVA 2FQ3A 2WTEA 4PGHA 1FYLA 4IRHA 1B6AA 1FOKA 5DCMB 3FMRA 1JGSA 2NNYA 5D6EA 2DBBA 1R7JA 2UXXA 3JW4A 1YG2A 4P9UA 5E20A 1P4WA 3JAMZ 2E7XA 4CZZA 4EJUA 4O6JA 1XD7A 3R4KA 3I5UA 3M1EA 3WTZA 2W57A 3QPHA 3NRVA 1ZLKA 1BC8C 5D5XB 2A5YB 3CTAA 5E18F 4A2UA 2Z33A 3HYIA 1Z6TA 3KP3A 4M6YA 3VOEA 1H9GA 1REPC 3BJ6A 1R1TA 2EA2A 3ELKA 1S7OA 2VBZA 2MC3A 2HKOA 2FMLA 1SD4A 2P8TA 1CF7B 2HTSA 5FD5A 4NQWA 1OYYA 1IXCA 4KUMA 4AWXB 3ZMDA 1J9IA 1SFUA 2D1HA 4IJAA 1FPQA 3B02A 5F6FA 2A07F 4O5VA 1BBYA 5BMZA 1D8KA 2XGXA 3GEZA 1ODDA 3F6VA 5A2QZ 4YG2F 5E1ZB 3TDZC 4OIOF 4IRGA 2O0YA 3ABUA 3WTXC 1BM9A 1S6LA 1YW9A 2QQ9A 3J80K 2BGCA 5ICCA 4Y15A 1KGSA 2OA4A 2DQLA 4LK1F 5IT3A 3FM5A 3I4PA 1QGPA 3WTVC 2F5EA 4ON0A 3SXYA 3DQVC 3GXOA 3EQLF 1G3TA 4LLGF 3E3VA 2XASA 3VFZA 1HQCA 3R60A 1CGPA 2EFOA 3CO7C 4HX4A 5EEGA 4KA4A 3E6DA 4M71A 5D5UB 4MQVA 2BBYA 3O3KA 5D4RA 5HS7A 4GYGA 4ENMA 1FX7A 4WX9A 2J5PA 3F72A 1BC7C 1FY7A 4HBLA 5DUKA 4BXUA 1YIOA 1I5ZA 2XVCA 4L5IA 1MD0A 1J0RA 1ON1A 3IWZA 4CGZA 4IHTA 3F21A 1TQPA 2E1CA 4A12A 1WSUA 3BZ6A 2VBWA 2YX4A 2P5KA 2G7HA 2QBYB 4HYEA 3U9GA 2QUFA 2J5OA 1QZZA 4L0ZB 5L3FA 2HTJA 4ZYEA 1YFHA 5DCFA 3IKVA 3NEUA 2CWEA 1U5TB 3CUQB 1DUXC 1IRFA 3RDIA 1LJ9A 2EFQA 2HQNA 3KZZA 3QP5A 4KIFA 2FE3A 2QBYA 1EH7A 3JTGA 3QOPA 3GFIA 3Q9SA 4ESJA 4KFCA 4OMZA 2COMA 3LAPA 3IRRA 1W4MA 3SFZA 3E5XA 1XGSA 3R0AA 1IN8A 1JE8A 2Z9OA 4GO1A 4I7HA 2EB7A 3HSRA 5HDGA 2Z99A 1FSEA 1XDUA 4U0VA 1FC3A 2M1BA 5LBQA 4CXFA 2VN2A 3TO6A 2OZUA 1F5TA 5D8KB 2L3DA 4Y17A 1I1SA 4G9YA 3WG9A 3Q9VA 4HF0A 4Q47A 5HLIA 2QENA 4G6QA 3R0JA 3K9TA 3VB2A 3P9IA 4KMUX 1UCRA 4I0AA 2WWYA 4XSZF 3HUGA 5JR3A 2IA2A 3LA3A 3M9AA 1K7AA 4OIPF 1P4AA 4MEXF 1JXSA 5D5WB 3GO5A 1T0FA 1EH6A 4LFUA 4L9TA 2RNJA 3BOQA 4G7ZF 3FZVA 2G9WA 5AIQA 3QPTA 3BP8A 3BDDA 2IRFG 5J8FA 3ZN0A 5LGTA 2ISYA 4M74A 3N97A 3RPUA 2EV5A 1STZA 1HSTA 3EETA 4HDUA 3MZHA 2D45A 4A0ZA 1O3SA 4OINF 1O3QA 5DYMA 3MEXA 5L3EA 5L3CA 1P92A 3ZN1A 4TV7A 2YPRA 3BPVA 4HV5A 3RI4A 4U7BA 1H0MA 2EV0A 1MJAA 4RB0A 5DD8A 2DFIA 3T0YA 3MAJA 2Y48A 2OU2A 3F8FA 3ABTA 1SD6A 3NQOA 4N9IA 1XCBA 4JQFA 5FLXZ 2PBIA 3WTYC 2QLZA 4HA8A 1XSVA 2PFBA 3TOBA 3IL2A 4AVPA 1XMKA 4EGZA 2HEOA 4OOIA 3DPLC 1DPUA 3GYHX 1PUEE 1RIOH 3M7GA 4UVBA 4HAMA 2A69F 1MJ9A 2DW4A 2DT5A 2XHKA 3KEQA 5CVIA 3G73A 3HIFA 2ZJ2A 2GA1A 4LB6B 4FT8A 4ZZLA 4KN4X 5FB2A 1J59A 4EJOA 2P7CB 3B73A 2DAOA 2FNAA 5BPIA 1J2XA 2RC4A 1V4RA 2YSRA 5E8GA 1ZG5A 4WWCA 3H3ZA 3ZP5A 3V7SA 1F1ZA 2K02A 3EDPA 1IW7F 2ZXJA 2Q2EA 3KE2A 3ML6A 2JTVA 2V6CA 4OIQF 4WXCA 4EM2A 2XIGA 3ZMSA 1ZARA 1IF1A 4M72A 4HLXA 4O3MA 3GFMA 2MBFA 2M87A 5K5QA 4ETSA 4GGGA 3C3WA 3DFGA 3HTSB 2LF8A 4HLYA 1KQ9A 5A2QK 3IKTA 4L5JA 5DEQA 4BHPA 2O61A 5LGUA 1G3SA 2QQAA 1G4DA 3KP7A 5LGNA 2BV6A 4I01A 3F3XA 3DV8A 3WTUC 1KQ0A 2R3SA 3VEPA 4B8XA 3W6JB 2FXAA 2HS5A 1HKSA 2BYVE 2WV0A 4LK0F 1TBXA 1R5HA 1ZGAA 4HOBA 3M8FA 1O3RA 4R8HA 2QYOA 4RAZA 4MQ9F 6PAXA 5CVUA 3I59A 2VXZA 5HS8A 1SMYF 2VC0A 3K2ZA 4HX8A 3H3UA 2JPCA 1ZRCA 4GCVA 2A6EF 3WE3A 1VTNC 1C0WA 1L3LA 4I2OA 1WRJA 2DI3A 2XAQA 2DPDA 4U0WA 1XGMA 4RAYA 3OOPA 4UV8A 4EM1A 1B9NA 3WGIA 2H27A 1WQ2A 2EFNA 2P6TA 1U5TC 2PLYA 3PQJA 1Q1HA 3CUQC 5K5RA 2RV8A 1IAWA 3I58A 5LRRA 2EV6A 3QAHA 4UVCA 2F5DA 5H6QA 1JHFA 2XV4S 2P6SA 3QP6A 3REOA 3TDUC 1YS7A 1P6RA 3FXUA 4OIRF 2MD5A 1H9TA 3CLOA 1BI3A 5DCMA 3IRQA 4WCGA 3LA2A 1QQIA 3I53A 4QWQA 1U2WA 3QRFF 2HGCA 3O6BB 1O57A 5LHIA 2VOOA 2ZO4A 1K79A 4U7DA 1YW7A 3R6SA 2KKOA 1KU3A 2VC1A 4L0YB 1FNNA 4WK8F 3GWZA 2K86A 3WU0A 1LQ1A 3ZMTA 1S7AA 2IPQX 5HOOA 2GQQA 3L7WA 1QNTA 1BN5A 1B9MA 1O7LA 1UHMA 2M8EA 5CVJA 3J7AO 1UFMA 4CO8A 2HFHA 2JPBA 3RYPA 3PFIA 5FO5A 3KZYA 2STTA 1CF7A 5IT9K 1TNSA 1K78B 1YW8A 2M30A 1IXRC 4HQMA 5F1RA 1AWCA 1DP7P 1B59A 3WODF 2PQ8A 2CYYA 1RUOA 2V79A 5H20A 5DDGA 2W24A 1XCVA 3GW2A 1SFEA 1YLFA 3LSTA 4L9JA 4AD9A 3WTWC 2H6CA 3PQKA 1J5YA 3WTSC 2Z3YA 3L9FA 3LFKA 3FXRA 1BI1A 4ZH4F 2D2WA 2ESNA 4RGUA 4IXAA 3WU1B 5CVRA 1IN6A 2A68F 4WXHA 3ROUA 4ENKA 4KMFA 2PN6A 5H6RA 1WI9A 2FBIA 3DKWA 1YQAA 5HVQC 2V1DA 3FX3A 2A61A 2XAGA 1UHWA 2Y0MA 4G7HF 5BOXA 1I1GA 3C18A 3GZ6A 2DU9A 3OV8A 4LLLA 1R58A 4EQQA 2HQRA 3F23A 2K4JA 4KIGA 1T2KA 4RGXA 3VODA 1WWXA 3GFLA 4HV6A 2GXBA 2A3SA 3RYRA 4L18B 3EYIA 2ZKZA 4ZYGA 2DTRA 1HSJA 2FA5A 3GFJA 4EJWA 2AXLA 1OPCA 2H6BA 2PMUA 3TO9A 2STWA 1TQMA 3HHGA 2MLKA 3ZQ7A 3HHHA 2MA3A 5D8LB 1GHCA 5FLXK 4S05A 1PDNC 3K69A 2KIUA 2ZMEB 3HRUA 4NB5A 4OU0A 1WKMA 3P9CA 1J7KA 1HW1A 4HX7A 4BH9A 4FX0A 2FBHA 4XLNF 1TLHB 2PG4A 3HRSA 4M73A 1U5TA 3CUQA 2L4AA 3F8MA 3MQ0A 3F22A 2IA0A 2ZMEA 3DPTA 4G94A 3ECHA 4CHUA 2PMHA 2RGVA 4LG0B 2HYGD 4A0YA 3E5UA 5FFXA 4L9VA 1FZPB 2CSOA 4HW0A 1W7PD 1FWZA 1R00A 2L4MA 2ZBKA 1EH8A 1IUYA 1HBXG 2Q0OA 4JK1X 1TQIA 4EJTA 3J80Z 1I27A 4UV9A 1BI0A 1X3UA 2AS5F 1R5GA 5D4SA 2OZ6A 5AIPA 1TW2A 2KJCA 2LDUA 2NNNA 2B0LA 2IJLA 5HLGA 1O7FA 4CICA 5L3GA 2JSCA 2D1VA 4EV0A 1DPRA 4MNUA 4ENJA 3SQNA 1USTA 2GIVA 3IHUA 2XROA 2EFPA 4XLPF 4Z2YA 1GXQA 1ZG3A 2O03A 4ZYHA 1XN7A 2NYXA 3TKYA 4YIIA 4FHTA 3C1DA 1ZGJA 1FBUA 2P7VB 4ESBA 2H09A 3BPXA 5ICGA 2RVCA 4RGRA 2E7WA 2M45A 2QVOA 1ZAOA 1GXPA 2FBKA 2KIMA 1HW2A 1LNWA 1U3EM 1LEAA 5JI6A 4BHBA 1LB2A 2K7LA 3JAMK 2BEOA 4IF4A 1E17A 3M8EA 3WGHA 2UWMA 1QBJA 5L3BA 3J81Z 1Z05A 5LEJA 2JRTA 5ED4A 2HOEA 4KICA 4UHTA 2LKPA 5D5VB 2JT1A 2FSWA 3S2WA 3CDHA 2RQPA 1XGOA 4GXOA 2ELHA 1SMTA 2EWNA 4QLCU 1IN4A 3KCCA 1ZRFA 1HXDA 1OMIA 1PP7U 3ZMVA 3GX4X 2FU4A 4MHGA 1LDJA 4I98B 1D8JA 1W5TA 3FM3A 3I0TA 3V8LA 1KYWA 4R1HA 5LRSA 4M9XA 4P5OA 5EEHA 3BWGA 1F4KA 4BQAA 2KJBA 4BYYA 2FRHA 2FOKA 3TGNA 2IT0A 4LB5A 4EMSA 1LDDA 3P9KA 2HR3A 3K1NA 4HF1A 3LAJA 3E97A 4UVAA 1FYKA 2W84A 1OR7A 4A5MA 1XDSA 3MZYA 3QU6A 4WXDA 5TRDA 2CO5A 1Z1DA 2H94A 2CW0F 2RKHA 2YX7A 5BPDA 3K1PA 3KEOA 1R1VA 3K0LA 3HRMA 2ZCWA 1W5SA 2QZ8A 2P4WA 2KIFA 3MCZA 1MDMB 4LJZF 1B1BA 2OAZA 2GWRA 4S04A 3ERED 2YR2A 2NAZA 2Z5UA 3E6BA 3MFKA 4LMYA 5CLSA 4G6DA 4HF2A 3LQQA 2GXGA 2HKXA 2MH2A 3RKYA 2XKOA 3T1BA 4D0PA 4Q5SF 2P5LC 4KYWA 1ZN2A 4PGGA 2V1XA 3E5QA 3FMQA 4LD5A 3TO7A 4PCQA 4AIKA 4P55A 2DK8A 3C7JA 3KP6A 3KETA 1OYIA 2DO7A 3D5LA 1F9NA 3EUHA 5CJ9A 1KU7A 5E1XA 1FP1D 2ZNYA 1BJAA 1HKTA 1K6OA 3RKXA 3CJNA 3RPQA 2LF7A 1W7PB 2FEZA 4AIHA 1SD7A 3I54A 2VODA 1ZLJA 2X4HA 1XSDA 2VONA 1ONVA 1LVAA 2R7FA 3T5XA 1G3WA 2LNBA 2XAHA 2ADUA 1ZG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJR A;  1Z6R A;  2VE8 A;  2DK5 A;  4BAY A;  5E17 F;  1D3Y A;  3V4G A;  1W7P A;  1QZY A;  4LGW A;  2FMY A;  2NS0 A;  4FX4 A;  3DF8 A;  1V3F A;  1FSH A;  2K4B A;  1RNL A;  5CVV A;  3LQR A;  4H0E A;  4AIJ A;  1EV7 A;  4ENN A;  1SD5 A;  1BI2 A;  2Y75 A;  1FYM A;  1ULY A;  1L0O C;  5BS6 A;  3CO6 C;  1Y0U A;  1ZHF A;  2DQR A;  2HZT A;  1YTY A;  5J8C A;  2F2E A;  4M9Z A;  1G3Y A;  2ESH A;  1I6X A;  3V7C A;  4M6X A;  2V9V A;  5ILU A;  1BIB A;  3V8J A;  1Z9C A;  4N9H A;  3R61 A;  1FP2 A;  4I09 A;  1IZ1 A;  2V1U A;  4BNC A;  3BY6 A;  1R22 A;  1K78 A;  5DD4 A;  1PP8 F;  2GA2 A;  3T8T A;  1O3T A;  2EK5 A;  4MEY F;  4YIF A;  1KYZ A;  1BOA A;  5J6X A;  4RB1 A;  4N0B A;  3WE2 A;  2IA1 A;  5KK1 A;  3LWF A;  4JBA A;  2IVM A;  4MTD A;  1RI7 A;  4XRF A;  2CG4 A;  1YYV A;  1DDN A;  2VBX A;  3HSF A;  1FLI A;  1B4A A;  3I71 A;  2GAU A;  3ZMZ A;  2GZW A;  5E1W A;  1XB4 A;  3ULQ B;  2K27 A;  1Z91 A;  2MLG A;  1ZRD A;  3GVA A;  1P2F A;  1LDK B;  2LSO A;  2IW5 A;  4MGR A;  2P5V A;  3L09 A;  1ZH5 A;  4HQE A;  4YFX F;  3LA7 A;  4WF2 A;  1T39 A;  3ECO A;  3MWM A;  3F8N A;  3KP2 A;  3U2R A;  4IPA A;  3ZMU A;  4I0B A;  5ILV A;  2EFW A;  4XBF A;  2W25 A;  3J81 K;  2L54 A;  2PI0 A;  1R1U A;  4E70 A;  1XMA A;  4Q48 A;  3WGG A;  2DPU A;  1GVJ A;  4CDG A;  2IP2 A;  2QWW A;  4LLN A;  5HDN A;  2YU3 A;  4P9F A;  3ISP A;  2CFX A;  2NRA C;  1IXS B;  1U8R A;  2ISZ A;  3SZP A;  3E6M A;  2VT3 A;  5D6F A;  3V8K A;  1T6S A;  1HKQ A;  2OBP A;  2A6H F;  1OYW A;  3DXJ F;  4HDV A;  3AAF A;  4OMY A;  3FWE A;  1OKR A;  4YFK F;  2MH9 A;  3DEU A;  2O3F A;  3JTH A;  1YS6 A;  1Z7U A;  3KLN A;  5IT9 Z;  4A6D A;  4EJV A;  3CUO A;  5L3D A;  4ASN A;  4LG0 A;  4G7O F;  2CQK A;  3BRO A;  2QQB A;  4MTE A;  4A0X A;  3DP7 A;  1QPM A;  2OD5 A;  5E8I A;  3KFW X;  3U1D A;  5HLH A;  4A5N A;  3SHF A;  2EA4 A;  1TW3 A;  3N4M A;  4DQ2 A;  3D0S A;  4G8X A;  1A04 A;  2F5C A;  2VT2 A;  4YFN F;  1RZ4 A;  2BE5 F;  1TTY A;  3EYY A;  3KLO A;  3ZPL A;  4GYI A;  4B09 A;  1FT9 A;  2L02 A;  3L00 A;  2C6Y A;  3H92 A;  1G6N A;  3TOA A;  2O8X A;  4A6E A;  3FXQ A;  1YO5 C;  3F6O A;  4UXN A;  1IRG A;  3COA C;  2ZNZ A;  4F7Z A;  5TJJ A;  2KRF A;  1E2X A;  5FD6 A;  1R36 A;  2FNP A;  3FHZ A;  2HWV A;  3WTT C;  1HW5 A;  3RKW A;  3HOS A;  4KN7 X;  4U88 A;  2XAJ A;  2XUB A;  1SAX A;  1ZYR F;  2TDX A;  1RUN A;  2O6G E;  4I02 A;  3F8C A;  2RN7 A;  2VBY A;  4PDK A;  2UZK A;  4P96 A;  2VE9 A;  2XKP A;  3HOT A;  1NHA A;  2XRN A;  4ZYD A;  1FBQ A;  5AON A;  3KP4 A;  1LEB A;  5DV5 A;  2M5W A;  2OQR A;  3FF5 A;  1P4X A;  3K1M A;  3KP5 A;  4RB2 C;  3SZT A;  1SFX A;  1MZB A;  3HRT A;  4Q4Z F;  4KDP A;  1JHH A;  3BJO A;  2E1N A;  4IHS A;  4UUV A;  3E6C C;  5JFR A;  1T98 A;  1XSX A;  2WC2 A;  1R23 A;  1MKM A;  4R79 A;  1U6G A;  1UB9 A;  1S3J A;  3FMS A;  2X0L A;  4UNO A;  1XGN A;  1BIA A;  2F5F A;  1S8N A;  3G3Z A;  4HZF A;  2G7U A;  1AOY A;  1T38 A;  1TNT A;  5ICE A;  5LHH A;  5LHG A;  3RIR A;  5F64 A;  4ZZD A;  5JHU A;  4EGY A;  1USS A;  3L2C A;  2ZFW A;  1FBS A;  4KIB A;  2JZY A;  1QO0 D;  2XAF A;  4K2E A;  2HYF A;  1KQ8 A;  4IVN A;  5DUI A;  2QM3 A;  1S29 A;  4KT5 C;  5FGM A;  5HS9 A;  3F8B A;  2CGP A;  3O2P E;  1ZRE A;  4RGS A;  3RJP A;  3QU3 A;  4L9N A;  3IWF A;  3T8R A;  2PEX A;  1IN5 A;  2ETH A;  4ESF A;  5LEK A;  2PJP A;  1D5V A;  2UXN A;  2L01 A;  3JSO A;  3TQN A;  4IRI A;  4PZJ A;  5HDK A;  5BQT A;  2R7D A;  2W85 A;  4Y13 A;  2DLL A;  2HDC A;  3P7N A;  3IC7 A;  1MJB A;  4BHC A;  3I59 B;  5KVR A;  3GF2 A;  3JSP A;  4NHJ A;  1KU9 A;  3RTR A;  4KNY A;  2OQG A;  3V7R A;  3BJA A;  3Q5F A;  1KA8 A;  4RS8 A;  2VOP A;  2FF4 A;  4EM0 B;  4CYD A;  5JVT A;  4U0Y A;  3HSE A;  4DNC A;  3I64 A;  3W6K B;  2ACJ A;  5FFZ A;  2Q8K A;  5K1Y A;  1ON2 A;  1J75 A;  1KU2 A;  1IN7 A;  3GUD A;  4RB3 C;  1MDM A;  4M9S A;  5ERI A;  2RDP A;  3GLX A;  4XSX F;  4EVI A;  5K5O A;  1MGT A;  3HTU A;  5ICF A;  3GZ5 A;  5ILS A;  1U78 A;  5LLQ A;  5CYV A;  2FQ3 A;  2WTE A;  4PGH A;  1FYL A;  4IRH A;  1B6A A;  1FOK A;  5DCM B;  3FMR A;  1JGS A;  2NNY A;  5D6E A;  2DBB A;  1R7J A;  2UXX A;  3JW4 A;  1YG2 A;  4P9U A;  5E20 A;  1P4W A;  3JAM Z;  2E7X A;  4CZZ A;  4EJU A;  4O6J A;  1XD7 A;  3R4K A;  3I5U A;  3M1E A;  3WTZ A;  2W57 A;  3QPH A;  3NRV A;  1ZLK A;  1BC8 C;  5D5X B;  2A5Y B;  3CTA A;  5E18 F;  4A2U A;  2Z33 A;  3HYI A;  1Z6T A;  3KP3 A;  4M6Y A;  3VOE A;  1H9G A;  1REP C;  3BJ6 A;  1R1T A;  2EA2 A;  3ELK A;  1S7O A;  2VBZ A;  2MC3 A;  2HKO A;  2FML A;  1SD4 A;  2P8T A;  1CF7 B;  2HTS A;  5FD5 A;  4NQW A;  1OYY A;  1IXC A;  4KUM A;  4AWX B;  3ZMD A;  1J9I A;  1SFU A;  2D1H A;  4IJA A;  1FPQ A;  3B02 A;  5F6F A;  2A07 F;  4O5V A;  1BBY A;  5BMZ A;  1D8K A;  2XGX A;  3GEZ A;  1ODD A;  3F6V A;  5A2Q Z;  4YG2 F;  5E1Z B;  3TDZ C;  4OIO F;  4IRG A;  2O0Y A;  3ABU A;  3WTX C;  1BM9 A;  1S6L A;  1YW9 A;  2QQ9 A;  3J80 K;  2BGC A;  5ICC A;  4Y15 A;  1KGS A;  2OA4 A;  2DQL A;  4LK1 F;  5IT3 A;  3FM5 A;  3I4P A;  1QGP A;  3WTV C;  2F5E A;  4ON0 A;  3SXY A;  3DQV C;  3GXO A;  3EQL F;  1G3T A;  4LLG F;  3E3V A;  2XAS A;  3VFZ A;  1HQC A;  3R60 A;  1CGP A;  2EFO A;  3CO7 C;  4HX4 A;  5EEG A;  4KA4 A;  3E6D A;  4M71 A;  5D5U B;  4MQV A;  2BBY A;  3O3K A;  5D4R A;  5HS7 A;  4GYG A;  4ENM A;  1FX7 A;  4WX9 A;  2J5P A;  3F72 A;  1BC7 C;  1FY7 A;  4HBL A;  5DUK A;  4BXU A;  1YIO A;  1I5Z A;  2XVC A;  4L5I A;  1MD0 A;  1J0R A;  1ON1 A;  3IWZ A;  4CGZ A;  4IHT A;  3F21 A;  1TQP A;  2E1C A;  4A12 A;  1WSU A;  3BZ6 A;  2VBW A;  2YX4 A;  2P5K A;  2G7H A;  2QBY B;  4HYE A;  3U9G A;  2QUF A;  2J5O A;  1QZZ A;  4L0Z B;  5L3F A;  2HTJ A;  4ZYE A;  1YFH A;  5DCF A;  3IKV A;  3NEU A;  2CWE A;  1U5T B;  3CUQ B;  1DUX C;  1IRF A;  3RDI A;  1LJ9 A;  2EFQ A;  2HQN A;  3KZZ A;  3QP5 A;  4KIF A;  2FE3 A;  2QBY A;  1EH7 A;  3JTG A;  3QOP A;  3GFI A;  3Q9S A;  4ESJ A;  4KFC A;  4OMZ A;  2COM A;  3LAP A;  3IRR A;  1W4M A;  3SFZ A;  3E5X A;  1XGS A;  3R0A A;  1IN8 A;  1JE8 A;  2Z9O A;  4GO1 A;  4I7H A;  2EB7 A;  3HSR A;  5HDG A;  2Z99 A;  1FSE A;  1XDU A;  4U0V A;  1FC3 A;  2M1B A;  5LBQ A;  4CXF A;  2VN2 A;  3TO6 A;  2OZU A;  1F5T A;  5D8K B;  2L3D A;  4Y17 A;  1I1S A;  4G9Y A;  3WG9 A;  3Q9V A;  4HF0 A;  4Q47 A;  5HLI A;  2QEN A;  4G6Q A;  3R0J A;  3K9T A;  3VB2 A;  3P9I A;  4KMU X;  1UCR A;  4I0A A;  2WWY A;  4XSZ F;  3HUG A;  5JR3 A;  2IA2 A;  3LA3 A;  3M9A A;  1K7A A;  4OIP F;  1P4A A;  4MEX F;  1JXS A;  5D5W B;  3GO5 A;  1T0F A;  1EH6 A;  4LFU A;  4L9T A;  2RNJ A;  3BOQ A;  4G7Z F;  3FZV A;  2G9W A;  5AIQ A;  3QPT A;  3BP8 A;  3BDD A;  2IRF G;  5J8F A;  3ZN0 A;  5LGT A;  2ISY A;  4M74 A;  3N97 A;  3RPU A;  2EV5 A;  1STZ A;  1HST A;  3EET A;  4HDU A;  3MZH A;  2D45 A;  4A0Z A;  1O3S A;  4OIN F;  1O3Q A;  5DYM A;  3MEX A;  5L3E A;  5L3C A;  1P92 A;  3ZN1 A;  4TV7 A;  2YPR A;  3BPV A;  4HV5 A;  3RI4 A;  4U7B A;  1H0M A;  2EV0 A;  1MJA A;  4RB0 A;  5DD8 A;  2DFI A;  3T0Y A;  3MAJ A;  2Y48 A;  2OU2 A;  3F8F A;  3ABT A;  1SD6 A;  3NQO A;  4N9I A;  1XCB A;  4JQF A;  5FLX Z;  2PBI A;  3WTY C;  2QLZ A;  4HA8 A;  1XSV A;  2PFB A;  3TOB A;  3IL2 A;  4AVP A;  1XMK A;  4EGZ A;  2HEO A;  4OOI A;  3DPL C;  1DPU A;  3GYH X;  1PUE E;  1RIO H;  3M7G A;  4UVB A;  4HAM A;  2A69 F;  1MJ9 A;  2DW4 A;  2DT5 A;  2XHK A;  3KEQ A;  5CVI A;  3G73 A;  3HIF A;  2ZJ2 A;  2GA1 A;  4LB6 B;  4FT8 A;  4ZZL A;  4KN4 X;  5FB2 A;  1J59 A;  4EJO A;  2P7C B;  3B73 A;  2DAO A;  2FNA A;  5BPI A;  1J2X A;  2RC4 A;  1V4R A;  2YSR A;  5E8G A;  1ZG5 A;  4WWC A;  3H3Z A;  3ZP5 A;  3V7S A;  1F1Z A;  2K02 A;  3EDP A;  1IW7 F;  2ZXJ A;  2Q2E A;  3KE2 A;  3ML6 A;  2JTV A;  2V6C A;  4OIQ F;  4WXC A;  4EM2 A;  2XIG A;  3ZMS A;  1ZAR A;  1IF1 A;  4M72 A;  4HLX A;  4O3M A;  3GFM A;  2MBF A;  2M87 A;  5K5Q A;  4ETS A;  4GGG A;  3C3W A;  3DFG A;  3HTS B;  2LF8 A;  4HLY A;  1KQ9 A;  5A2Q K;  3IKT A;  4L5J A;  5DEQ A;  4BHP A;  2O61 A;  5LGU A;  1G3S A;  2QQA A;  1G4D A;  3KP7 A;  5LGN A;  2BV6 A;  4I01 A;  3F3X A;  3DV8 A;  3WTU C;  1KQ0 A;  2R3S A;  3VEP A;  4B8X A;  3W6J B;  2FXA A;  2HS5 A;  1HKS A;  2BYV E;  2WV0 A;  4LK0 F;  1TBX A;  1R5H A;  1ZGA A;  4HOB A;  3M8F A;  1O3R A;  4R8H A;  2QYO A;  4RAZ A;  4MQ9 F;  6PAX A;  5CVU A;  3I59 A;  2VXZ A;  5HS8 A;  1SMY F;  2VC0 A;  3K2Z A;  4HX8 A;  3H3U A;  2JPC A;  1ZRC A;  4GCV A;  2A6E F;  3WE3 A;  1VTN C;  1C0W A;  1L3L A;  4I2O A;  1WRJ A;  2DI3 A;  2XAQ A;  2DPD A;  4U0W A;  1XGM A;  4RAY A;  3OOP A;  4UV8 A;  4EM1 A;  1B9N A;  3WGI A;  2H27 A;  1WQ2 A;  2EFN A;  2P6T A;  1U5T C;  2PLY A;  3PQJ A;  1Q1H A;  3CUQ C;  5K5R A;  2RV8 A;  1IAW A;  3I58 A;  5LRR A;  2EV6 A;  3QAH A;  4UVC A;  2F5D A;  5H6Q A;  1JHF A;  2XV4 S;  2P6S A;  3QP6 A;  3REO A;  3TDU C;  1YS7 A;  1P6R A;  3FXU A;  4OIR F;  2MD5 A;  1H9T A;  3CLO A;  1BI3 A;  5DCM A;  3IRQ A;  4WCG A;  3LA2 A;  1QQI A;  3I53 A;  4QWQ A;  1U2W A;  3QRF F;  2HGC A;  3O6B B;  1O57 A;  5LHI A;  2VOO A;  2ZO4 A;  1K79 A;  4U7D A;  1YW7 A;  3R6S A;  2KKO A;  1KU3 A;  2VC1 A;  4L0Y B;  1FNN A;  4WK8 F;  3GWZ A;  2K86 A;  3WU0 A;  1LQ1 A;  3ZMT A;  1S7A A;  2IPQ X;  5HOO A;  2GQQ A;  3L7W A;  1QNT A;  1BN5 A;  1B9M A;  1O7L A;  1UHM A;  2M8E A;  5CVJ A;  3J7A O;  1UFM A;  4CO8 A;  2HFH A;  2JPB A;  3RYP A;  3PFI A;  5FO5 A;  3KZY A;  2STT A;  1CF7 A;  5IT9 K;  1TNS A;  1K78 B;  1YW8 A;  2M30 A;  1IXR C;  4HQM A;  5F1R A;  1AWC A;  1DP7 P;  1B59 A;  3WOD F;  2PQ8 A;  2CYY A;  1RUO A;  2V79 A;  5H20 A;  5DDG A;  2W24 A;  1XCV A;  3GW2 A;  1SFE A;  1YLF A;  3LST A;  4L9J A;  4AD9 A;  3WTW C;  2H6C A;  3PQK A;  1J5Y A;  3WTS C;  2Z3Y A;  3L9F A;  3LFK A;  3FXR A;  1BI1 A;  4ZH4 F;  2D2W A;  2ESN A;  4RGU A;  4IXA A;  3WU1 B;  5CVR A;  1IN6 A;  2A68 F;  4WXH A;  3ROU A;  4ENK A;  4KMF A;  2PN6 A;  5H6R A;  1WI9 A;  2FBI A;  3DKW A;  1YQA A;  5HVQ C;  2V1D A;  3FX3 A;  2A61 A;  2XAG A;  1UHW A;  2Y0M A;  4G7H F;  5BOX A;  1I1G A;  3C18 A;  3GZ6 A;  2DU9 A;  3OV8 A;  4LLL A;  1R58 A;  4EQQ A;  2HQR A;  3F23 A;  2K4J A;  4KIG A;  1T2K A;  4RGX A;  3VOD A;  1WWX A;  3GFL A;  4HV6 A;  2GXB A;  2A3S A;  3RYR A;  4L18 B;  3EYI A;  2ZKZ A;  4ZYG A;  2DTR A;  1HSJ A;  2FA5 A;  3GFJ A;  4EJW A;  2AXL A;  1OPC A;  2H6B A;  2PMU A;  3TO9 A;  2STW A;  1TQM A;  3HHG A;  2MLK A;  3ZQ7 A;  3HHH A;  2MA3 A;  5D8L B;  1GHC A;  5FLX K;  4S05 A;  1PDN C;  3K69 A;  2KIU A;  2ZME B;  3HRU A;  4NB5 A;  4OU0 A;  1WKM A;  3P9C A;  1J7K A;  1HW1 A;  4HX7 A;  4BH9 A;  4FX0 A;  2FBH A;  4XLN F;  1TLH B;  2PG4 A;  3HRS A;  4M73 A;  1U5T A;  3CUQ A;  2L4A A;  3F8M A;  3MQ0 A;  3F22 A;  2IA0 A;  2ZME A;  3DPT A;  4G94 A;  3ECH A;  4CHU A;  2PMH A;  2RGV A;  4LG0 B;  2HYG D;  4A0Y A;  3E5U A;  5FFX A;  4L9V A;  1FZP B;  2CSO A;  4HW0 A;  1W7P D;  1FWZ A;  1R00 A;  2L4M A;  2ZBK A;  1EH8 A;  1IUY A;  1HBX G;  2Q0O A;  4JK1 X;  1TQI A;  4EJT A;  3J80 Z;  1I27 A;  4UV9 A;  1BI0 A;  1X3U A;  2AS5 F;  1R5G A;  5D4S A;  2OZ6 A;  5AIP A;  1TW2 A;  2KJC A;  2LDU A;  2NNN A;  2B0L A;  2IJL A;  5HLG A;  1O7F A;  4CIC A;  5L3G A;  2JSC A;  2D1V A;  4EV0 A;  1DPR A;  4MNU A;  4ENJ A;  3SQN A;  1UST A;  2GIV A;  3IHU A;  2XRO A;  2EFP A;  4XLP F;  4Z2Y A;  1GXQ A;  1ZG3 A;  2O03 A;  4ZYH A;  1XN7 A;  2NYX A;  3TKY A;  4YII A;  4FHT A;  3C1D A;  1ZGJ A;  1FBU A;  2P7V B;  4ESB A;  2H09 A;  3BPX A;  5ICG A;  2RVC A;  4RGR A;  2E7W A;  2M45 A;  2QVO A;  1ZAO A;  1GXP A;  2FBK A;  2KIM A;  1HW2 A;  1LNW A;  1U3E M;  1LEA A;  5JI6 A;  4BHB A;  1LB2 A;  2K7L A;  3JAM K;  2BEO A;  4IF4 A;  1E17 A;  3M8E A;  3WGH A;  2UWM A;  1QBJ A;  5L3B A;  3J81 Z;  1Z05 A;  5LEJ A;  2JRT A;  5ED4 A;  2HOE A;  4KIC A;  4UHT A;  2LKP A;  5D5V B;  2JT1 A;  2FSW A;  3S2W A;  3CDH A;  2RQP A;  1XGO A;  4GXO A;  2ELH A;  1SMT A;  2EWN A;  4QLC U;  1IN4 A;  3KCC A;  1ZRF A;  1HXD A;  1OMI A;  1PP7 U;  3ZMV A;  3GX4 X;  2FU4 A;  4MHG A;  1LDJ A;  4I98 B;  1D8J A;  1W5T A;  3FM3 A;  3I0T A;  3V8L A;  1KYW A;  4R1H A;  5LRS A;  4M9X A;  4P5O A;  5EEH A;  3BWG A;  1F4K A;  4BQA A;  2KJB A;  4BYY A;  2FRH A;  2FOK A;  3TGN A;  2IT0 A;  4LB5 A;  4EMS A;  1LDD A;  3P9K A;  2HR3 A;  3K1N A;  4HF1 A;  3LAJ A;  3E97 A;  4UVA A;  1FYK A;  2W84 A;  1OR7 A;  4A5M A;  1XDS A;  3MZY A;  3QU6 A;  4WXD A;  5TRD A;  2CO5 A;  1Z1D A;  2H94 A;  2CW0 F;  2RKH A;  2YX7 A;  5BPD A;  3K1P A;  3KEO A;  1R1V A;  3K0L A;  3HRM A;  2ZCW A;  1W5S A;  2QZ8 A;  2P4W A;  2KIF A;  3MCZ A;  1MDM B;  4LJZ F;  1B1B A;  2OAZ A;  2GWR A;  4S04 A;  3ERE D;  2YR2 A;  2NAZ A;  2Z5U A;  3E6B A;  3MFK A;  4LMY A;  5CLS A;  4G6D A;  4HF2 A;  3LQQ A;  2GXG A;  2HKX A;  2MH2 A;  3RKY A;  2XKO A;  3T1B A;  4D0P A;  4Q5S F;  2P5L C;  4KYW A;  1ZN2 A;  4PGG A;  2V1X A;  3E5Q A;  3FMQ A;  4LD5 A;  3TO7 A;  4PCQ A;  4AIK A;  4P55 A;  2DK8 A;  3C7J A;  3KP6 A;  3KET A;  1OYI A;  2DO7 A;  3D5L A;  1F9N A;  3EUH A;  5CJ9 A;  1KU7 A;  5E1X A;  1FP1 D;  2ZNY A;  1BJA A;  1HKT A;  1K6O A;  3RKX A;  3CJN A;  3RPQ A;  2LF7 A;  1W7P B;  2FEZ A;  4AIH A;  1SD7 A;  3I54 A;  2VOD A;  1ZLJ A;  2X4H A;  1XSD A;  2VON A;  1ONV A;  1LVA A;  2R7F A;  3T5X A;  1G3W A;  2LNB A;  2XAH A;  2ADU A;  1ZG1 A; 
#chains in the Genus database with same CATH topology
 2EJR A;  4F92 B;  1YJN I;  1Z6R A;  1FOW A;  3IH4 A;  1K83 J;  3EUK L;  1WH7 A;  1NK3 P;  4ZTJ A;  2DA6 A;  2VE8 A;  3ZQI A;  2DK5 A;  2Q1Z B;  4BAY A;  3CC7 I;  3Q3S A;  5E17 F;  1RKW A;  2K9S A;  1D3Y A;  4HG2 A;  3GTK J;  4BY1 J;  3V4G A;  1W7P A;  1QZY A;  4LGW A;  1BW6 A;  2LD5 A;  2FMY A;  2KP6 A;  1WJC A;  1VQO I;  1A6Q A;  2NS0 A;  4FX4 A;  3DF8 A;  1UG2 A;  1V3F A;  3NWS A;  4E6K G;  1FSH A;  3PSF A;  1E3P A;  2M0M A;  2DJN A;  2K4B A;  1RR7 A;  4XR6 A;  1RNL A;  2CFO A;  1ITY A;  5CVV A;  3LQR A;  1X4O A;  4KIT B;  4XLF A;  4H0E A;  4AIJ A;  1EV7 A;  4ENN A;  1A36 A;  1SD5 A;  1BI2 A;  2Y75 A;  1D0Y A;  1FYM A;  1ULY A;  1X1P A;  1L0O C;  5BS6 A;  4F93 B;  2OCC H;  3CO6 C;  3IUO A;  1Y0U A;  1ZHF A;  2VPR A;  3TW7 A;  4CCO A;  2XPV A;  4UUT A;  2DQR A;  2HZT A;  1YTY A;  5J8C A;  2F2E A;  4M9Z A;  1G3Y A;  2ESH A;  3H36 A;  1ETX A;  1I6X A;  2XDV A;  3V7C A;  4M6X A;  2V9V A;  3BTJ A;  3QYE A;  5ILU A;  4IHW A;  1BIB A;  3V8J A;  3K2A A;  3PSI A;  3MKZ A;  4N9H A;  1Z9C A;  5IPA A;  2VQL A;  3R61 A;  1FP2 A;  1I3Q J;  4I09 A;  1JKQ C;  4RM3 A;  3CZ6 A;  2IXS A;  3VWB A;  3OYI A;  4BQO A;  1QVT A;  1IZ1 A;  2V1U A;  4BNC A;  3CCM I;  3BY6 A;  1Z21 A;  4Y33 A;  1R22 A;  2JRM A;  1K78 A;  5DD4 A;  1TWG J;  1PP8 F;  2GA2 A;  2KZV A;  3T8T A;  2X6W A;  1O3T A;  4CCL A;  4W1U A;  2EK5 A;  2EPF A;  2X85 A;  2LFB A;  1OIS A;  4MEY F;  4YIF A;  1KYZ A;  1BOA A;  3ERM A;  5J6X A;  4RB1 A;  4D1Q A;  2EZH A;  4N0B A;  2IA1 A;  3WE2 A;  2RNG A;  4N4N B;  1AA7 A;  3LWF A;  5KK1 A;  4JBA A;  2IVM A;  4MTD A;  2JVG A;  2XPW A;  4DW6 A;  1G59 A;  1RI7 A;  3LOC A;  4XRF A;  2R5Y B;  2DOA A;  4RLF A;  1VQM I;  5DTD A;  3EUA A;  3OYF A;  1RRJ A;  3AL0 C;  2R7Z J;  2CG4 A;  1YYV A;  2F6C A;  1DDN A;  3PUB A;  4OAZ A;  3CME I;  2BY2 A;  2VBX A;  3HSF A;  1FLI A;  1B4A A;  3I71 A;  5E3L A;  1YRN B;  2W00 A;  3IV5 A;  2QKM B;  2WA0 A;  2CQX A;  2GAU A;  3ZMZ A;  4XKW A;  2GZW A;  5E1W A;  4MIM A;  2VKV A;  3CD6 I;  4HEA 2;  1Q1V A;  1XB4 A;  1S9H A;  3WG7 H;  3ULQ B;  3FXJ A;  1MSF C;  3HB9 A;  3JRA A;  2K27 A;  1Z91 A;  2MLG A;  4MFE A;  1ZRD A;  4CSW A;  5FLV A;  1FIA A;  5HNH A;  3BR1 A;  3K4L A;  3ZQF A;  3HG9 A;  4BDY A;  1LVK A;  5EZH A;  2DXI A;  3GVA A;  1QHH D;  5EGO B;  3H5N A;  3KEY A;  3OR2 C;  1P2F A;  5C44 J;  1LDK B;  2LSO A;  5M5W J;  2IW5 A;  4MGR A;  2KIQ A;  3HEF A;  3H0D A;  1FMV A;  2OTJ I;  2P5V A;  2E35 A;  3L09 A;  1ZH5 A;  4HQE A;  3AG1 H;  4YFX F;  3LA7 A;  3OWT A;  3HDD A;  1Y1V J;  3OYH A;  4WF2 A;  5CKT A;  3JRC A;  1T39 A;  3ECO A;  3MWM A;  3F8N A;  2E1O A;  3J7Z I;  3KP2 A;  4XLA A;  4XRS G;  3U2R A;  3H9J A;  4IPA A;  3ZMU A;  4YEL A;  4I0B A;  3BT9 A;  5CQE A;  5ILV A;  2QA4 I;  1WCM J;  2V6E A;  3BG6 A;  4BBS J;  2EFW A;  4XBF A;  2VJ5 A;  3A4C A;  2W25 A;  1TWH J;  4AUX A;  1LFP A;  3J81 K;  2L54 A;  2PI0 A;  3QYB A;  1R1U A;  4E70 A;  1XMA A;  1IUF A;  4XN3 A;  4Q48 A;  3WGG A;  2L9V A;  2DPU A;  1GVJ A;  4CDG A;  2IP2 A;  2QWW A;  5J1Y A;  5GAG J;  4LLN A;  3OS1 A;  4BBR J;  2AXT C;  5HDN A;  4M3B A;  2YU3 A;  3OYK A;  1ETQ A;  4P9F A;  3G1L A;  4M3G A;  3K10 A;  3ISP A;  3DEW A;  4PFP A;  2CFX A;  2JSP A;  1ZEL A;  4XK4 A;  2KZG A;  2X51 A;  2NRA C;  1GUU A;  3JRD A;  1IXS B;  1Y1W J;  1U8R A;  2IGN A;  1HOM A;  2HQA A;  2ISZ A;  5F04 A;  3SZP A;  3K70 D;  3E6M A;  2M34 A;  3PUF A;  2VT3 A;  5D6F A;  3C2B A;  1T6S A;  3V8K A;  1HKQ A;  2OBP A;  2A6H F;  2JA5 J;  2QCO A;  1OYW A;  5C3E J;  2A5W A;  2IEK A;  1NK2 P;  4IOC F;  4LIT A;  3DXJ F;  2LR8 A;  4HDV A;  5B5E C;  3AAF A;  2XC7 A;  4OMY A;  3FWE A;  4XOP A;  3ZXS A;  4B43 A;  1OKR A;  4YRV A;  4YFK F;  3H0G J;  3FKI J;  2MH9 A;  3DEU A;  4C2T A;  2O3F A;  1GT0 C;  1Z3Y A;  3JTH A;  3CMY A;  1JUS A;  1YS6 A;  1VF9 A;  1Z7U A;  3KLN A;  5IT9 Z;  3IH3 A;  3HUG B;  4A6D A;  3SDG A;  4EJV A;  3CUO A;  5L3D A;  4ASN A;  5HLT A;  3WHC A;  2XF7 A;  3ZQG A;  4XQF A;  5F0H A;  1EF4 A;  1MBH A;  4LG0 A;  4G7O F;  2CQK A;  3BRO A;  5FRO A;  2QQB A;  1VQL I;  4MTE A;  1MMS A;  4A0X A;  3DP7 A;  1QPM A;  3KYL A;  2WAE A;  3W2A A;  3NAR A;  2OD5 A;  1U9N A;  4CZC A;  1A6I A;  3CCQ I;  5E8I A;  3KFW X;  3U1D A;  5HLH A;  1V5E A;  1WI3 A;  1MNM C;  4A5N A;  3SHF A;  2EA4 A;  1TW3 A;  3N4M A;  4DQ2 A;  2JA7 J;  2DA2 A;  3FK6 A;  2JJ7 A;  4FIS A;  3CMA I;  3D0S A;  3U1K A;  4G8X A;  1A04 A;  2F5C A;  2VT2 A;  5F08 A;  4YFN F;  1RZ4 A;  2BE5 F;  1TTY A;  3OYD A;  4LIV A;  2HVR A;  2PJR A;  4IZZ A;  2DDB A;  3EYY A;  3DCF A;  3QWL A;  3KLO A;  3ZPL A;  2EIN H;  3K4C A;  4GYI A;  4B09 A;  1FT9 A;  2L02 A;  3L00 A;  1TL8 A;  2C6Y A;  3H92 A;  1G6N A;  2ME0 A;  3TOA A;  2HZD A;  2O8X A;  2KDO A;  4A6E A;  2KL4 A;  4NUB A;  3FXQ A;  3MMY B;  3F6O A;  4UXN A;  1YO5 C;  3CJT B;  1IRG A;  3COA C;  2ZNZ A;  4F7Z A;  4ZC3 A;  5TJJ A;  2K85 A;  1LE8 B;  1JJ8 C;  2KRF A;  1E2X A;  1N78 A;  4CYC A;  3PM1 A;  5FD6 A;  1WJE A;  1R36 A;  2CU7 A;  2FNP A;  3FHZ A;  2HWV A;  3WTT C;  4CH7 A;  3PNV A;  1H8A C;  1HW5 A;  3RKW A;  3E0J B;  3HOS A;  4KN7 X;  1A31 A;  4U88 A;  2XAJ A;  2XUB A;  3CDL A;  1RPW A;  3HPH A;  1SAX A;  1ZYR F;  2TDX A;  3VSL A;  1RUN A;  2O6G E;  4I02 A;  2V1N A;  3Q0V A;  3ZGK A;  3F8C A;  2K9L A;  2RN7 A;  3TL4 X;  2VBY A;  4PDK A;  3DLL F;  2AQF A;  2UZK A;  4P96 A;  2VE9 A;  2XKP A;  3HOT A;  3CCU I;  3LSM A;  5DM7 F;  2HPM A;  2E36 A;  1NHA A;  4A3B J;  2XRN A;  4ZYD A;  1FBQ A;  4QPQ A;  5AON A;  3KP4 A;  5M3F J;  3AG3 H;  4D7N A;  4W97 A;  3AL0 B;  1LEB A;  5DV5 A;  2M5W A;  2OQR A;  2DDA A;  3FF5 A;  2F4I A;  1R5I D;  1P4X A;  2F48 A;  2FOW A;  3K1M A;  4FE4 A;  3KP5 A;  1U0J A;  3BG7 A;  1WHU A;  4RB2 C;  2HDW A;  1TZL A;  3CP8 A;  3SZT A;  4B48 A;  1SFX A;  2JVH A;  1MZB A;  3HRT A;  3DU6 A;  4Q4Z F;  4KDP A;  1JHH A;  3ZQH A;  4ZDL A;  3BJO A;  2E1N A;  4IHS A;  4UUV A;  3GTQ J;  2EBI A;  3E6C C;  5JFR A;  1T98 A;  3MZ8 A;  2RAE A;  5J4V A;  4B3X A;  3JRF A;  1XSX A;  2WC2 A;  1R23 A;  1MKM A;  2KHM A;  4R79 A;  2DA1 A;  1U6G A;  3EPZ A;  1UB9 A;  3S8P A;  4G6T B;  4XRM A;  1S3J A;  3FMS A;  1TT0 A;  2X0L A;  2FUG 2;  4UNO A;  1XGN A;  1BIA A;  4QTR A;  2F5F A;  1S8N A;  3G3Z A;  4HZF A;  2G7U A;  4PJN A;  3S2D J;  1AOY A;  3B6A A;  3BTC A;  2VL8 A;  1T38 A;  1TNT A;  5ICE A;  1X4P A;  5LHH A;  5LHG A;  2LYC A;  3F0C A;  5F64 A;  3RIR A;  4ZZD A;  5JHU A;  2EZK A;  2NS7 A;  1W0T A;  4EGY A;  1USS A;  3L2C A;  2ZFW A;  4B3A A;  1FBS A;  4KIB A;  2QGU A;  5J4Y A;  2JZY A;  1QO0 D;  2QKL B;  2XAF A;  4FCY A;  4K2E A;  3PIP F;  2HYF A;  1KQ8 A;  3HGG A;  2GOX B;  1P7J A;  2YS9 A;  4IVN A;  4RDU A;  5DUI A;  2QM3 A;  1JTX A;  3KIO A;  1TWF J;  2DMU A;  1S29 A;  4KT5 C;  1QPI A;  1VQ7 I;  5FGM A;  1DGR M;  3PNT A;  5HS9 A;  2LY1 A;  3F8B A;  2CGP A;  3O2P E;  3E7L A;  5IP9 J;  4RGS A;  2FX0 A;  3RJP A;  1ZRE A;  2HXO A;  3QU3 A;  4HST A;  2QEX I;  1FTZ A;  4L9N A;  3IWF A;  2R7T A;  3T8R A;  3VPR A;  2DFF A;  4F52 A;  3RQ4 A;  3CCR I;  2PEX A;  1IN5 A;  1I3A A;  2CJJ A;  3OYB A;  1LFU P;  1OJL A;  2ETH A;  2CUZ A;  3A0H C;  4ESF A;  5LEK A;  2PJP A;  2H1L A;  1D5V A;  2UXN A;  3OMY A;  2L01 A;  3JSO A;  3TQN A;  5IOY A;  2W4S A;  2CV2 A;  4IRI A;  4PZJ A;  2HDD A;  1Z77 A;  2JUC A;  2OJE D;  5HDK A;  4BE2 A;  1OCP A;  5BQT A;  5J47 A;  1IG7 A;  1A5J A;  2R7D A;  2W85 A;  4Y13 A;  1FIP A;  2LC2 A;  2DLL A;  2HDC A;  4HRI A;  3P7N A;  3IC7 A;  4B4C A;  5TGT A;  2NVX J;  1WJB A;  2LTP A;  2DA5 A;  3L2V A;  1MJB A;  4BHC A;  3I59 B;  2JK3 A;  3GF2 A;  5KVR A;  3JSP A;  2VUM J;  4NHJ A;  3S3N A;  1KU9 A;  5KAI C;  3RTR A;  4KNY A;  3CQZ J;  5M5X J;  2OQG A;  3V7R A;  5JLX A;  3ZOB A;  3BJA A;  2M4G A;  2WB1 A;  4KT6 A;  4PFO A;  3K4N A;  1OCO H;  2H8W A;  2ZJR F;  3Q5F A;  1KA8 A;  4RS8 A;  1MIJ A;  2EIK H;  3I9V 2;  2VOP A;  2FF4 A;  2WAD A;  2V4J C;  4EM0 B;  4CYD A;  5IP7 J;  1S7E A;  1SFO J;  5KAF C;  3H1C A;  1XG1 A;  5JVT A;  2M8G X;  4U0Y A;  3BZC A;  3HSE A;  4DNC A;  3I64 A;  3VDX A;  1PUF A;  3W6K B;  3CCE I;  2ACJ A;  5FFZ A;  2R7W A;  4NC6 A;  2Q8K A;  5K1Y A;  1ON2 A;  5H2F C;  1J75 A;  1KU2 A;  1IN7 A;  3GUD A;  4RB3 C;  1MDM A;  4M9S A;  5ERI A;  2RDP A;  3M07 A;  2WBM A;  4PSW A;  3GLX A;  3ZCO A;  4GDF A;  4XSX F;  4EVI A;  2O5R A;  1MGT A;  1SFK A;  5K5O A;  4BE1 A;  1GDT A;  3HTU A;  5ICF A;  3GZ5 A;  3OYM A;  5ILS A;  4BGD A;  3CF2 A;  2WV1 A;  1U78 A;  3WHB A;  3SFI A;  5LLQ A;  2F4O B;  1Y8Q B;  2E2H J;  1N25 A;  5J1R A;  3CCY A;  1YX5 A;  5CYV A;  2FQ3 A;  2WTE A;  1NTC A;  2BHZ A;  4PGH A;  3OSG A;  2ELJ A;  1FYL A;  2R92 J;  2E19 A;  4IRH A;  1B6A A;  1FOK A;  3PL8 A;  5DCM B;  3FMR A;  1V55 H;  5K7Z A;  1JGS A;  2NNY A;  5D6E A;  2DBB A;  3LSP A;  2ELK A;  3KYD B;  1PJR A;  4HNV A;  1R7J A;  2VXD A;  3M1C A;  4CCN A;  2UXX A;  3JW4 A;  1YG2 A;  5LD2 C;  1XMX A;  4P9U A;  3N05 A;  3RQI A;  5E20 A;  5B1A H;  1P4W A;  3RPU D;  2L0K A;  1DGW Y;  3OYN A;  5B3S H;  3JAM Z;  5HNF A;  2E7X A;  1OQY A;  2BW3 A;  4CZZ A;  4EJU A;  4NC8 A;  4O6J A;  1IV8 A;  1XD7 A;  3JRG A;  3R4K A;  3I5U A;  2E2I J;  3SZG A;  3M1E A;  3WTZ A;  2W57 A;  3QPH A;  3NRV A;  2CQQ A;  3CCS I;  4NQW B;  1BC8 C;  1ZLK A;  5D5X B;  5EG0 B;  1SC7 A;  3CTA A;  2A5Y B;  5FKM A;  3AG4 H;  3S32 A;  1NG6 A;  1OCR H;  2NVY J;  3DBL B;  3HJE A;  2JN6 A;  4JP0 A;  4A2U A;  3AFH A;  2Z33 A;  4BJ6 C;  2XB5 A;  3MKY B;  2VKD A;  3HYI A;  1Z6T A;  3KP3 A;  4M6Y A;  3VOE A;  1X19 A;  3S16 J;  1H9G A;  3JRI A;  3K4B A;  1X3Z B;  1REP C;  4KIS A;  3BJ6 A;  1R1T A;  3CJQ B;  1BOB A;  3O8G A;  1WPK A;  3LFU A;  2EA2 A;  3ELK A;  4F3Q A;  1S7O A;  2VBZ A;  2HVQ A;  2MC3 A;  1RKT A;  2HKO A;  2FML A;  2NXN B;  1SD4 A;  1EJ9 A;  2IGO A;  2P8T A;  1HCR A;  1CF7 B;  2HTS A;  5FD5 A;  2XGD A;  4H4K C;  5GAH J;  2VQG A;  4NQW A;  1OYY A;  4BKX A;  2XGC A;  5EG0 A;  1IXC A;  4KUM A;  4AWX B;  1POG A;  3ZMD A;  1T0F C;  1J9I A;  1FOY A;  2WAQ N;  1SFU A;  5FRN A;  3CMM A;  2CMP A;  2GLO A;  5GPA A;  2JA6 J;  2DA7 A;  2MSY A;  2D1H A;  4IJA A;  1FPQ A;  3B02 A;  2HOA A;  2X9D A;  4U87 A;  1KON A;  5F6F A;  3PO3 J;  2A07 F;  4O5V A;  4YEJ A;  3GTP J;  1BBY A;  3G71 I;  5BMZ A;  1D8K A;  2XGX A;  3GEZ A;  3OL3 A;  4HNT A;  4A3D J;  2HOT A;  3X2Q H;  1ODD A;  2DFE A;  3F6V A;  4M3E A;  5C4X J;  1D1B A;  4Y3O A;  4PJL A;  3ZQC A;  2GXA A;  5A2Q Z;  2L9S A;  3FIW A;  4YG2 F;  5E1Z B;  3TDZ C;  4OIO F;  4UY8 I;  3HOW J;  4IRG A;  2O0Y A;  1W1W E;  2Y9Z A;  3ABU A;  1YIT I;  3BR5 A;  3WTX C;  1BM9 A;  1S6L A;  1YW9 A;  2ZXH A;  3VYR B;  3K6G A;  2QQ9 A;  3J80 K;  2IS1 A;  1AKH B;  2BGC A;  5ICC A;  5IYC J;  2L7K A;  4Y15 A;  1KGS A;  2OA4 A;  5M5Y J;  2DQL A;  4A3C J;  4LK1 F;  1O4X A;  2MW8 A;  3FM5 A;  2VKH A;  3LL7 A;  4JX4 A;  3I4P A;  2ME6 A;  1QGP A;  5GTI C;  5IT3 A;  2F5E A;  3WTV C;  3RZO J;  4ON0 A;  3SXY A;  1YJ9 I;  3DQV C;  2R7V A;  3GXO A;  5BNG A;  1JI8 A;  2JWT A;  3EQL F;  1G3T A;  1R49 A;  4LLG F;  3E3V A;  4RBO A;  4XN0 A;  2XAS A;  3VFZ A;  1HQC A;  2ZSI B;  3R60 A;  1CGP A;  1BR4 A;  2EFO A;  1AHD P;  4N4O B;  3GTL J;  3CO7 C;  2M7A A;  4HX4 A;  4ZYA A;  2ZSH B;  4I76 A;  5EEG A;  3I55 I;  4KA4 A;  3E6D A;  4M71 A;  5D5U B;  5J3L A;  4MQV A;  1UG0 A;  5GPC A;  1AKH A;  2BBY A;  3O3K A;  3ZRG A;  1G2H A;  2R0Q C;  5D4R A;  5HS7 A;  4GYG A;  4ENM A;  5J1U A;  1FX7 A;  4ZJZ A;  3CCJ I;  3D1N I;  1BW5 A;  4PJ0 C;  3LSR A;  5FKN A;  4WX9 A;  1N77 A;  2J5P A;  3F72 A;  1MBF A;  1BC7 C;  1FY7 A;  1VQ6 I;  4HBL A;  5DUK A;  3L2Q A;  1SAN A;  3C2G A;  4BXU A;  4A3K J;  5B1B H;  2DFH A;  2B9S A;  1YIO A;  1EA3 A;  1I5Z A;  3PFY A;  5K7F A;  2XVC A;  1WJ5 A;  2F4M B;  4L5I A;  3VSK A;  3OIO A;  5JHF A;  2KDZ A;  1MD0 A;  1J0R A;  1ON1 A;  3IH2 A;  3HOU J;  3IWZ A;  4F91 B;  2R5Y A;  4CGZ A;  3IP4 B;  4IHT A;  3GTM J;  3F21 A;  1TQP A;  2E1C A;  3OY9 A;  1X1A A;  3BQY A;  3OIQ A;  4A12 A;  4RM2 A;  5CPR B;  1WSU A;  1YRN A;  5F1J A;  3BZ6 A;  2VBW A;  3MKL A;  2YX4 A;  2P5K A;  3ZR8 X;  5EEA A;  2G7H A;  2QBY B;  5E3M A;  1HF0 A;  4HYE A;  1ZR2 A;  3U9G A;  2PX9 A;  2QUF A;  4G12 A;  2CW8 A;  2J5O A;  1AU7 A;  3OL4 A;  1QZZ A;  4DBR A;  5EGO A;  4L0Z B;  5L3F A;  2OUM A;  2HTJ A;  3BG9 A;  4ZYE A;  3S1M J;  2LKX A;  1TT5 B;  1YFH A;  2XB0 X;  3RCO A;  5DCF A;  1GV5 A;  3IKV A;  1T08 B;  2K40 A;  4KJZ A;  5M3M J;  3NEU A;  2CWE A;  1MND A;  1DQU A;  3GTG J;  1U5T B;  4E7I A;  2UV1 A;  2Y31 A;  3CUQ B;  2CUF A;  3FIS A;  1S72 I;  1DUX C;  2IGM A;  3VYS B;  1IRF A;  5FKK A;  1LJ9 A;  2EFQ A;  3DTE A;  3RDI A;  2RQQ A;  2HQN A;  2LMD A;  1F43 A;  3KZZ A;  3QP5 A;  4KIF A;  3I3L A;  2FE3 A;  2QBY A;  3MKW B;  2MC4 A;  1EH7 A;  5E18 F;  1BL0 A;  2O7O A;  3JTG A;  3QOP A;  2CW7 A;  2HXI A;  3GFI A;  2LOO A;  3Q9S A;  4AID A;  2QQ8 A;  4A3M J;  1JKO C;  4ESJ A;  2M9H A;  1PVE A;  4KFC A;  4OMZ A;  1TWA J;  3W3C A;  2COM A;  3LAP A;  5C4J J;  4D9J A;  3IRR A;  3K4J A;  2VKE A;  1RC9 A;  2L7Z A;  1W4M A;  3SFZ A;  9ANT A;  2CS3 A;  3E5X A;  1JTY A;  2QSG X;  1XGS A;  1Y39 A;  3R0A A;  1IN8 A;  2Y9Y A;  4C3I J;  1BR2 A;  1JE8 A;  2Z9O A;  3FHN A;  4GO1 A;  4I7H A;  3G2B A;  2EB7 A;  3HSR A;  4JX5 A;  5HDG A;  2Z99 A;  1FSE A;  1XDU A;  1YI2 I;  2I10 A;  4U0V A;  4XM3 A;  2WY7 Q;  1VQ8 I;  3TED A;  2M3A A;  1FC3 A;  1VI0 A;  1F36 A;  2M1B A;  5LBQ A;  4QPO A;  3HOX J;  2A6T A;  2VN2 A;  3TO6 A;  4CXF A;  2NOG A;  2OZU A;  1F5T A;  5D8K B;  5FJ8 J;  2YUS A;  2L3D A;  4Y17 A;  4FTH A;  1I1S A;  2EIM H;  4G9Y A;  1IC8 A;  1X1D A;  2QF7 A;  1Y56 A;  3WG9 A;  3Q9V A;  4HF0 A;  4Q47 A;  1I39 A;  3DLA A;  5HLI A;  2QEN A;  4G6Q A;  4YIR X;  2EQR A;  3ASN H;  3FDY A;  3LSJ A;  3R0J A;  4XRS A;  3K9T A;  5EDN A;  1LPQ A;  4GFB A;  2MYS A;  1X2M A;  3VB2 A;  3P9I A;  4KMU X;  1UCR A;  4I0A A;  2E60 A;  2WWY A;  2E71 A;  4XSZ F;  3HUG A;  1IJW C;  5JR3 A;  2IA2 A;  1MMA A;  3LA3 A;  3M9A A;  1K7A A;  1D0Z A;  4OIP F;  1X1C A;  3QPL A;  4B1R A;  1P4A A;  4MEX F;  4PJJ A;  1JXS A;  4DZP A;  2Z1D A;  3GO5 A;  5D5W B;  1BR1 A;  1T0F A;  2WY8 Q;  2ECC A;  1EH6 A;  3HC7 A;  3HZJ A;  4LFU A;  3KX2 A;  2PMZ A;  4L9T A;  2RNJ A;  2PMZ N;  3D5S C;  3BOQ A;  4G7Z F;  3FZV A;  2G9W A;  4NC7 A;  3L2W A;  5AIQ A;  1IRZ A;  2O9L A;  4C2U A;  3SJM A;  2GOM A;  3QPT A;  3BP8 A;  2DN0 A;  3BDD A;  3G4S I;  4AU7 A;  4BU2 A;  3K70 C;  2ZB9 A;  2IRF G;  5J8F A;  3ZN0 A;  4A3F J;  4M3F A;  1XPX A;  5LGT A;  3ZQL A;  1JKR C;  2ISY A;  2P81 A;  4M74 A;  3N97 A;  2BXZ A;  4DYQ A;  4PUS A;  1SVL A;  2DJI A;  4IO9 F;  3RPU A;  1Z67 A;  2EV5 A;  1STZ A;  1HST A;  5LFA A;  3EET A;  4HDU A;  4MO7 A;  3MZH A;  2D45 A;  4A0Z A;  1O3S A;  1ZK8 A;  4M3D A;  4OIN F;  1O3Q A;  5DYM A;  3MEX A;  5L3E A;  1CQT A;  2HI3 A;  5L3C A;  1P92 A;  2CV0 A;  3ZN1 A;  4BAC A;  1OCZ H;  1LE8 A;  4TV7 A;  2YPR A;  3BPV A;  4HV5 A;  3RI4 A;  4U7B A;  1H0M A;  2EV0 A;  2VIX A;  3DKX A;  1MJA A;  3VYT B;  1APL C;  2HVS A;  2DCE A;  4RB0 A;  5DD8 A;  4C9Y A;  2DFI A;  3T0Y A;  1B8I B;  2W7N A;  1TC3 C;  3MAJ A;  2K5C A;  1MSE C;  5IYB J;  1W5C C;  1X1B A;  2Y48 A;  4CCM A;  1FMW A;  2OU2 A;  2HPI A;  3F8F A;  3ABT A;  3OR1 C;  4NBQ A;  3BR6 A;  2AHQ A;  1SD6 A;  3S1Q J;  3NQO A;  3S3M A;  4N9I A;  1OLT A;  1XCB A;  4JQF A;  3BG3 A;  5FLX Z;  2OC6 A;  2PBI A;  3WTY C;  2QLZ A;  2H1K A;  4HA8 A;  1XSV A;  2PFB A;  3OSF A;  1N75 A;  2OCE A;  3TOB A;  3IL2 A;  3DTI A;  4AVP A;  4MLO A;  3HKZ N;  1XMK A;  4EGZ A;  2HEO A;  4OOI A;  3DPL C;  2HNH A;  4HPQ A;  1DPU A;  3GYH X;  4BY7 J;  1PUE E;  1RIO H;  2R7Q A;  2D5V A;  3M7G A;  4UVB A;  2MAB A;  3U21 A;  4HAM A;  2A69 F;  2KQR A;  1MJ9 A;  2DW4 A;  1JGG A;  4X1E A;  4D5F A;  2IBD A;  2DT5 A;  3JRB A;  2ECB A;  2Q2E B;  1Y8R B;  2DMP A;  1S5L C;  2XHK A;  3A1Y A;  3KEQ A;  5CVI A;  3W2W A;  2IS4 A;  3KPH A;  2LBF B;  3G73 A;  3HIF A;  2ZJ2 A;  3V42 A;  2GA1 A;  4LB6 B;  2EZL A;  2DMN A;  4FT8 A;  4FQG A;  4ZZL A;  2K3F A;  4B44 A;  4KN4 X;  5FB2 A;  1J59 A;  4EJO A;  2P7C B;  2V7F A;  3B73 A;  4XLE A;  4XKV A;  2MGQ A;  1FJL A;  2DAO A;  2FNA A;  5BPI A;  1J2X A;  4JYK A;  2RC4 A;  1V4R A;  2YSR A;  3A2K A;  5E8G A;  3I56 I;  1ZG5 A;  4WWC A;  3H3Z A;  3ZP5 A;  3V7S A;  4V2G A;  1F1Z A;  2K02 A;  3EDP A;  3LSH A;  1ETV A;  1SVM A;  4UUS B;  3ABK H;  1IW7 F;  3FXL A;  2ZXJ A;  1X3W B;  1K61 A;  2Q2E A;  3KE2 A;  3ML6 A;  2LY9 A;  1E3O C;  1V5F A;  1WJF A;  1LKX A;  2DOF A;  1QZE A;  2JTV A;  3MN2 A;  4B47 A;  2NVT J;  2V6C A;  2X6Y A;  4OIQ F;  4WXC A;  1WH5 A;  3SEQ A;  4EM2 A;  2XIG A;  3CF5 F;  1T8I A;  3ZMS A;  1ZAR A;  2DYS H;  1IF1 A;  3ESW B;  4M72 A;  4HLX A;  2ZJQ F;  4O3M A;  2L7F P;  3GFM A;  2ZXI A;  2MBF A;  2M87 A;  5K5Q A;  3DU5 A;  4ETS A;  4GGG A;  3C3W A;  3DFG A;  3HTS B;  2LF8 A;  3BTI A;  4HLY A;  1KQ9 A;  4UUS A;  1QA6 A;  2UUZ A;  1OCC H;  3HGY A;  2KIS A;  2Z2S B;  5A2Q K;  3IKT A;  4L5J A;  3PJR A;  2CQ7 A;  5DEQ A;  4BHP A;  1A35 A;  4XMY A;  1MBK A;  1TP4 A;  1LFB A;  4RA2 A;  5HOD A;  2O61 A;  5LGU A;  1G3S A;  2QQA A;  3OS2 A;  1G4D A;  5TIS C;  5IOZ A;  1QVU A;  1MH4 A;  3KP7 A;  5LGN A;  2BV6 A;  4IQJ A;  1H88 C;  4E7Z A;  3IAS 2;  4I01 A;  1X2N A;  3F3X A;  5DM6 F;  4XLH A;  4A69 C;  3DV8 A;  3WTU C;  1KQ0 A;  2R3S A;  5CQG A;  3VEP A;  4B8X A;  3HPG A;  4PK4 A;  3W6J B;  2FXA A;  2W48 A;  2HS5 A;  1HKS A;  3SEZ A;  1D0X A;  2BYV E;  2WV0 A;  4LK0 F;  3L2U A;  1TBX A;  2BVL A;  3A0B C;  2NVU B;  2EZI A;  1R5H A;  1ZGA A;  4HOB A;  3CC2 I;  3M8F A;  1RR8 C;  1O3R A;  5GAD J;  4R8H A;  4C3H J;  2QYO A;  4RAZ A;  4IEJ A;  4MQ9 F;  4QIW N;  6PAX A;  4E7H A;  5CVU A;  3I59 A;  3S17 J;  3M4O J;  1XTA A;  2VXZ A;  1Y6I A;  5HS8 A;  5E3O A;  1SMY F;  2VC0 A;  3K2Z A;  4HX8 A;  2BVM A;  3H3U A;  1MMG A;  2JPC A;  1ZRC A;  2XSD C;  4GCV A;  2A6E F;  3QYF A;  3WE3 A;  5EZG A;  1VTN C;  4II2 A;  3OS0 A;  1C0W A;  2FQ4 A;  1UHS A;  4XNF A;  1L3L A;  4I2O A;  4XOR A;  1WRJ A;  1MMD A;  2DI3 A;  2XAQ A;  4J19 A;  2DPD A;  3O8H A;  3M3Y J;  4U0W A;  3K4M A;  4Y52 J;  2Y30 A;  4XL9 A;  2M4K A;  1QU3 A;  1XGM A;  3GTO J;  3MD2 A;  3OOP A;  4RAY A;  3ZQQ A;  1ZKG A;  3BCA A;  3OYE A;  4UV8 A;  3BCB A;  2R5Z B;  4EM1 A;  4E7J A;  1B9N A;  3WGI A;  2OPT A;  2CH0 A;  2JA2 A;  3TBI A;  1WQ2 A;  2H27 A;  4E7S A;  2EFN A;  2OF7 A;  1WVR A;  1VZ0 A;  2P6T A;  5J40 A;  1U5T C;  2PLY A;  4IKF A;  3QOE A;  3PQJ A;  1Q1H A;  3CUQ C;  1P9Q C;  5F0F A;  2RV8 A;  4DYR A;  5K5R A;  1IAW A;  3I58 A;  3BR2 A;  2CUJ A;  2ZME C;  5LRR A;  2EV6 A;  2XF6 A;  3QAH A;  4UVC A;  3BC8 A;  2F5D A;  4HNU A;  1VQK I;  1M1E B;  3GTJ J;  5H6Q A;  1JHF A;  4IHV A;  2XV4 S;  4RMN A;  2AQE A;  4LOC A;  2P6S A;  4S0H B;  3QP6 A;  3REO A;  3TDU C;  3OYA A;  1YS7 A;  1P6R A;  3FXU A;  4OIR F;  1K4T A;  2FD5 A;  2MD5 A;  2NOJ B;  1H9T A;  1OFC X;  2L2O A;  3CLO A;  1BI3 A;  2K3P A;  5DCM A;  2V26 A;  4I6Z A;  3IRQ A;  4CCJ A;  4WCG A;  3LA2 A;  1GVD A;  1QQI A;  2I8D A;  3I53 A;  3CDI A;  4QWQ A;  3OYC A;  2KLO A;  1D1A A;  3RZD J;  1U2W A;  1E0E A;  5E3N A;  2HGC A;  3QRF F;  1XX5 A;  3O6B B;  1O57 A;  3FBN B;  3QQA A;  4PJM A;  5LHI A;  2VOO A;  2LK2 A;  3W2V A;  4Z6Y A;  2COB A;  5F0C A;  2ZO4 A;  5GTH C;  1K79 A;  3DEE A;  2K9N A;  4A3J J;  3CCV I;  1GLN A;  2VAS A;  4U7D A;  1MBG A;  1YW7 A;  2KKO A;  3R6S A;  3BLY A;  1QRY A;  2BZT A;  1KU3 A;  2ID3 A;  2XGE A;  3GLL A;  2Y69 H;  2VC1 A;  1IDY A;  1R4M B;  1UJ8 A;  2ICW G;  4L0Y B;  1FNN A;  2VI6 A;  4WK8 F;  3GWZ A;  2K86 A;  1MBJ A;  3FXM A;  3WU0 A;  3WU2 C;  2WAQ A;  1LQ1 A;  3S15 J;  3ZMT A;  4J00 A;  1S7A A;  2IPQ X;  3BR0 A;  2XPU A;  5HOO A;  2GQQ A;  3L7W A;  1QNT A;  1BN5 A;  1B9M A;  1WGX A;  1ERD A;  1O7L A;  1UHM A;  2M8E A;  5CVJ A;  2GM4 A;  1MMN A;  3J7A O;  2DMQ A;  1UFM A;  4CO8 A;  2HFH A;  3BQZ A;  2JPB A;  3RYP A;  3LNQ A;  1D1C A;  2K9Q A;  3PFI A;  5FO5 A;  2DYR H;  1TWC J;  3KZY A;  1VFC A;  2STT A;  3CES A;  1CF7 A;  4BJ5 C;  3SYT A;  5IT9 K;  1TNS A;  1K78 B;  1YW8 A;  2M30 A;  1IXR C;  1MBE A;  4HQM A;  4DBQ A;  2W82 A;  3A02 A;  5F1R A;  2E2J J;  4BS9 A;  1AWC A;  1HDP A;  3DPU A;  1DP7 P;  1B59 A;  4NDL A;  2K9M A;  4BE0 A;  2LRD A;  4EEF G;  3WOD F;  1U8B A;  2PQ8 A;  1HA8 A;  1DU6 A;  2BY0 A;  1ZTR A;  2CYY A;  2M7B A;  5FLM J;  2V79 A;  1RUO A;  5H20 A;  5DDG A;  2W24 A;  1XCV A;  2E1M B;  3GW2 A;  3QOD A;  1SFE A;  1ETO A;  2X48 A;  1Z0X A;  2G0E A;  5DS9 A;  1ENH A;  1G8X A;  2E5Z A;  1QHG A;  1YLF A;  3LST A;  4L9J A;  4AD9 A;  3WTW C;  4D7M A;  2H6C A;  3HOZ J;  3PQK A;  1FEX A;  1YOV B;  1JT6 A;  3I4M J;  2JA8 J;  1J5Y A;  4BQN A;  3WTS C;  2Z3Y A;  4C3J J;  2R93 J;  3L9F A;  2ZJP F;  3LFK A;  2IGK A;  1SEU A;  1BA5 A;  3FXR A;  1BI1 A;  4ZH4 F;  2D2W A;  2ESN A;  3QPS A;  4RGU A;  3S1R J;  4IXA A;  3WU1 B;  5CVR A;  4XOT A;  4MFD A;  4DGW B;  1IN6 A;  2XRL A;  1ACI A;  2A68 F;  3DKY A;  4WXH A;  5FRM A;  3ROU A;  2EH3 A;  4ENK A;  4KMF A;  2PN6 A;  5H6R A;  1WI9 A;  4L5E A;  2FBI A;  3DKW A;  3H5A A;  1YQA A;  5HVQ C;  2V1D A;  3FX3 A;  3CP2 A;  2A61 A;  2XAG A;  1UHW A;  2Y0M A;  5IYD J;  4G7H F;  5BOX A;  3FBI B;  2N8G A;  1I1G A;  3C18 A;  3CJR B;  3TP3 A;  2DU9 A;  2VJI A;  3OV8 A;  3GZ6 A;  2ZXW H;  4LLL A;  1R58 A;  3NAU A;  3ABM H;  4FE7 A;  4EQQ A;  2R7U A;  2FJ1 A;  2HQR A;  3F23 A;  4A3L J;  4BXF A;  3L1P A;  2K4J A;  4KIG A;  1T2K A;  1WZ2 A;  4RGX A;  4Y7N J;  3L2R A;  1P7I A;  4EAT A;  3VOD A;  3DBR B;  4X0G A;  4ZDP A;  1WWX A;  1YIJ I;  3GFL A;  4HV6 A;  2GXB A;  4OAY A;  2A3S A;  2JMW A;  3RYR A;  4L18 B;  1YJW I;  3EYI A;  4FAS D;  1YHQ I;  1UEL B;  2ZKZ A;  3P5J A;  1W0U A;  2BHY A;  3S14 J;  3OYG A;  4ZYG A;  2DTR A;  3TW6 A;  1HSJ A;  2FA5 A;  3GFJ A;  3DTK A;  4EJW A;  1UAA A;  2ID6 A;  2QSH X;  1LUJ B;  2AXL A;  2DA4 A;  1OPC A;  2H6B A;  4A93 J;  2PMU A;  2QSF X;  1VQ5 I;  1DU0 A;  2IS6 A;  3TO9 A;  2STW A;  1TQM A;  2R7S A;  4JX6 A;  3HHG A;  3UR3 C;  4DYC A;  2MLK A;  1ETY A;  3ZQ7 A;  2LG4 A;  4XKB A;  3HHH A;  4E7K A;  4X6A J;  2O8K A;  1Z7L A;  2MA3 A;  2Y0S A;  5D8L B;  2Y0S N;  2L9N A;  4BDZ A;  1GHC A;  2JQ7 A;  1R4N B;  5FLX K;  2VPL A;  4S05 A;  1PDN C;  1JUM A;  3K69 A;  2KIU A;  1V5G A;  4XIC A;  2ZME B;  3HRU A;  4NB5 A;  4OU0 A;  1WKM A;  3HXL A;  3P9C A;  1J7K A;  3ASO H;  1HW1 A;  1K4S A;  3LSG A;  2H8R A;  4A3E J;  5EJC A;  5B66 C;  4HX7 A;  2R4G A;  4BH9 A;  1OR7 C;  2DT6 A;  2CQN A;  3FXK A;  4FX0 A;  3BZK A;  2FBH A;  3KZI C;  2R7X A;  4DJA A;  4XLN F;  1TLH B;  2DOE A;  2PG4 A;  5IP6 A;  3HRS A;  4M73 A;  1U5T A;  1YX3 A;  3CUQ A;  2L4A A;  3F8M A;  2E5N A;  3MQ0 A;  4D5C A;  3F22 A;  1FOX A;  2IA0 A;  2ZME A;  3DPT A;  4G94 A;  3OYJ A;  2V9K A;  3ECH A;  4AM3 A;  4CHU A;  3Q0W A;  1EKE A;  4XON A;  2PMH A;  2RGV A;  4LG0 B;  2HYG D;  4A0Y A;  1B72 B;  4P1W A;  3E5U A;  2Z16 A;  5FFX A;  1VND A;  4PSX A;  3PO2 J;  2VQH A;  2OTL I;  1I6H J;  2XF5 A;  4L9V A;  3K4K A;  1FZP B;  1OCT C;  2CSO A;  1ZGW A;  2VJJ A;  4DZJ A;  3LMM A;  5KHD A;  2HOS A;  3A03 A;  3G1M A;  4HW0 A;  1D5Y A;  3J7A Y;  1FWZ A;  1R00 A;  1W7P D;  2L4M A;  2CUE A;  5EF6 A;  3GZN B;  2ZBK A;  1JT0 A;  2PJR B;  3RSN A;  1EH8 A;  2BY1 A;  5F27 A;  4C30 A;  1IUY A;  1HBX G;  4V19 K;  2Q0O A;  1MNE A;  4JK1 X;  3C2H A;  3JRH A;  1TQI A;  4EJT A;  2CRG A;  1MW7 A;  2V9P A;  1B72 A;  1IGN A;  2LH9 A;  1DP3 A;  3J80 Z;  1I27 A;  1KZH A;  4UV9 A;  1BI0 A;  3OYL A;  2BY3 A;  1WFX A;  1WJA A;  1RET A;  4M6V A;  1X3U A;  3OIP A;  2AS5 F;  4CYC B;  1R5G A;  5FKL A;  5IY5 H;  4LIU A;  3EUH C;  3FK7 A;  4ANJ A;  5GP9 A;  5D4S A;  4AYB A;  2OZ6 A;  4AYB N;  5AIP A;  4NNJ A;  2L7M P;  1TW2 A;  1R71 A;  3HM5 A;  5FKO A;  4IHY A;  3G1O A;  2KJC A;  2HU9 A;  2LDU A;  2NNN A;  2B0L A;  2IJL A;  5HLG A;  2KRH A;  3LSK A;  4BJT A;  1O7F A;  4CIC A;  1RES A;  5L3G A;  4F55 A;  5EYR A;  3HOV J;  2JSC A;  1PYV A;  2D1V A;  2I5U A;  5JVG F;  4C2M J;  4J01 A;  2LY2 A;  4EV0 A;  3NWT A;  1DPR A;  4MNU A;  3SDB A;  4BUP A;  3HL2 A;  4E4H A;  3SQN A;  1UST A;  4ENJ A;  2GIV A;  3AKZ A;  3B6C A;  3IHU A;  4IOA F;  2R7R A;  2XRO A;  2IS2 A;  1BJZ A;  2EFP A;  3F9K A;  4XLP F;  3FKJ A;  4XKC A;  4Z2Y A;  1ZQ3 P;  2AO9 A;  1GXQ A;  1ZG3 A;  2O03 A;  1X58 A;  4ZYH A;  1ETW A;  3BTL A;  1JJ6 C;  1XN7 A;  2NYX A;  2CV1 A;  3UNG C;  1UMQ A;  3TKY A;  3UKG A;  4YII A;  2MFZ A;  3C1D A;  4FHT A;  1ZGJ A;  3ABL H;  4Y4R A;  1FBU A;  2P7V B;  4A3G J;  5JLW A;  1NG7 A;  4ESB A;  2H09 A;  3BPX A;  3DWL E;  5ICG A;  2B63 J;  2RVC A;  2L5Q A;  4RGR A;  5KCM A;  3TMO A;  2RRE A;  2VQC A;  2E7W A;  3CCL I;  1E3H A;  4DIQ A;  2M45 A;  1ZR4 A;  2QVO A;  1ZAO A;  1GXP A;  1IO2 A;  2FBK A;  2KIM A;  3S3O A;  1HW2 A;  3G6E I;  3JCU C;  3M8J A;  2LRE A;  3S93 A;  1LNW A;  4II3 A;  4ITV A;  1W36 D;  1U3E M;  1LEA A;  2WAF A;  5JI6 A;  1JUP A;  1K6Y A;  2KT0 A;  4BHB A;  1R9T J;  3H9G A;  3HKZ A;  1LB2 A;  2K7L A;  3JAM K;  2BEO A;  4IF4 A;  3RKQ A;  2LVS A;  1E17 A;  4ZDO A;  3LSI A;  3M8E A;  3WGH A;  3JR9 A;  2UWM A;  3H5R A;  1QBJ A;  1B8I A;  5L3B A;  3J81 Z;  1Z05 A;  5LEJ A;  2JRT A;  5ED4 A;  2HOE A;  4KIC A;  4UHT A;  2LKP A;  1FTT A;  2BXY A;  5D5V B;  1XC5 A;  2JT1 A;  2FSW A;  3S2W A;  3A01 B;  3CDH A;  4ZTF A;  1U9O A;  3H3V K;  3K7A J;  4LG3 A;  2RQP A;  1XGO A;  4GXO A;  2ELH A;  1SMT A;  2EWN A;  4QSH A;  4QLC U;  2KPM A;  2DMT A;  1IN4 A;  1MH3 A;  2NVQ J;  3KCC A;  4BXX J;  1ZRF A;  1HXD A;  1OMI A;  2NS8 A;  1PP7 U;  2L9R A;  1Z3X A;  3ZMV A;  3GX4 X;  2FU4 A;  1WJD A;  4MHG A;  3AG2 H;  1LDJ A;  4I98 B;  2XSJ C;  1D8J A;  1W5T A;  3FM3 A;  2GBY A;  3I0T A;  2BOL A;  2LP0 A;  1SVO A;  2TCT A;  4RAG A;  3V8L A;  2VB6 A;  1KYW A;  4R1H A;  3TP0 A;  3A01 A;  1HC8 A;  5LRS A;  1JKP C;  2W1O A;  2LBF A;  2ZC2 A;  4M9X A;  4P5O A;  2LKS A;  5KNL A;  5EEH A;  1XS9 A;  2YU9 J;  3BWG A;  1VQP I;  1F4K A;  2XAU A;  4IHX A;  2E1M C;  1SAU A;  4BQA A;  2KJB A;  4BYY A;  2FRH A;  2FOK A;  3MVP A;  3TGN A;  2IT0 A;  4LB5 A;  3BR3 A;  4CA0 A;  4EMS A;  1LDD A;  3OOU A;  1GV2 A;  1J09 A;  3P9K A;  2HR3 A;  3K1N A;  4HF1 A;  5K7H A;  3LAJ A;  3E97 A;  1VQ9 I;  1W36 C;  2EIL H;  4RAF A;  4XLC A;  4BEH B;  4HSR A;  4IL6 C;  4UVA A;  4DOZ A;  1FYK A;  2W84 A;  2X1D A;  2MD0 A;  1OR7 A;  4XID A;  4A5M A;  4AC0 A;  4BL0 B;  3S2H J;  1XDS A;  3MZY A;  2JUG A;  3QU6 A;  3I4N J;  2X6X A;  4WXD A;  4A3I J;  5TRD A;  2CO5 A;  1VQN I;  1IRX A;  4GRI A;  3ONQ A;  1Z1D A;  2H94 A;  2R7O A;  2CW0 F;  2RKH A;  2YX7 A;  2VLA A;  1ORK A;  2HQ5 A;  3H35 A;  3BG5 A;  5BPD A;  2GIZ A;  3K1P A;  3KEO A;  1Y0N A;  1PUF B;  1R1V A;  1YE9 A;  2DTZ A;  1H89 C;  2DA3 A;  3K0L A;  3HRM A;  2ZCW A;  5GAE J;  1IDZ A;  4BQQ A;  4V2F A;  3E1S A;  4ABZ A;  2DOD A;  1W5S A;  2QZ8 A;  2P4W A;  2KIF A;  4UB8 C;  4BEH A;  2EIJ H;  3MCZ A;  1MDM B;  3PIO F;  2DT7 B;  2F5V A;  4LJZ F;  1B1B A;  2OAZ A;  2WB1 N;  2GWR A;  1T95 A;  1T56 A;  4CUG A;  2KFD A;  4S04 A;  2M0C A;  2B7E A;  3KYC B;  3GBG A;  3ERE D;  2YR2 A;  4UB6 C;  2NAZ A;  2Z5U A;  2Y2Z A;  3E6B A;  3MFK A;  3PNY A;  2HYJ A;  4LMY A;  1NH3 A;  5CLS A;  4G6D A;  4HF2 A;  3LQQ A;  2GXG A;  2HKX A;  2MH2 A;  3RKY A;  3W6V A;  2XKO A;  2OV7 A;  3T1B A;  4D0P A;  3CC4 I;  4Q5S F;  3DBH B;  3J7Y J;  1R6R A;  4IX7 A;  2E34 A;  3D5R C;  2P5L C;  2KMU A;  1ZN2 A;  4KYW A;  4PGG A;  4E7L A;  2V1X A;  3E5Q A;  4CCK A;  4I99 C;  2VJ4 A;  3FMQ A;  2P0W A;  4IQ4 A;  4LD5 A;  2KRC A;  3TO7 A;  2X1E A;  4PCQ A;  2TRT A;  4AIK A;  1HDD C;  4P55 A;  2DK8 A;  3S1N J;  2X6O A;  3C7J A;  5E79 C;  3KP6 A;  3KET A;  2BW3 B;  3GME A;  3HBL A;  1OYI A;  3GCM A;  2DO7 A;  3D5L A;  1F9N A;  3EUH A;  2X1C A;  5CJ9 A;  1KU7 A;  3Q0U A;  1VQ4 I;  1HLV A;  5E1X A;  1FP1 D;  4RLQ A;  2ZNY A;  3JRE A;  2ZFU A;  1IV6 A;  1BJA A;  2A05 A;  2IAI A;  1T33 A;  1HKT A;  1K6O A;  4AVZ A;  3RKX A;  2R5Z A;  3CJN A;  3HOY J;  3RPQ A;  2LF7 A;  1W7P B;  2FEZ A;  4AIH A;  1SD7 A;  3H9Q A;  2MG4 A;  3I54 A;  1UZC A;  2VOD A;  4JOM A;  3VYU B;  3FXO A;  1ZLJ A;  4FET A;  3CLQ A;  2X4H A;  1XSD A;  2VON A;  1ONV A;  1ETK A;  2LLK A;  1LVA A;  1I50 J;  2R7F A;  3T5X A;  1G3W A;  2LNB A;  2M2E A;  3IAM 2;  2XAH A;  2ADU A;  4OWR B;  1V54 H;  1ZG1 A; 
#chains in the Genus database with same CATH homology
 2EJR A;  1Z6R A;  2VE8 A;  2DK5 A;  4BAY A;  5E17 F;  1D3Y A;  3V4G A;  1W7P A;  1QZY A;  4LGW A;  2FMY A;  2NS0 A;  4FX4 A;  3DF8 A;  1V3F A;  1FSH A;  2K4B A;  1RNL A;  5CVV A;  3LQR A;  4H0E A;  4AIJ A;  1EV7 A;  4ENN A;  1SD5 A;  1BI2 A;  2Y75 A;  1FYM A;  1ULY A;  1L0O C;  5BS6 A;  3CO6 C;  1Y0U A;  1ZHF A;  2DQR A;  2HZT A;  1YTY A;  5J8C A;  2F2E A;  4M9Z A;  1G3Y A;  2ESH A;  1I6X A;  3V7C A;  4M6X A;  2V9V A;  5ILU A;  1BIB A;  3V8J A;  1Z9C A;  4N9H A;  3R61 A;  1FP2 A;  4I09 A;  1IZ1 A;  2V1U A;  4BNC A;  3BY6 A;  1R22 A;  1K78 A;  5DD4 A;  1PP8 F;  2GA2 A;  3T8T A;  1O3T A;  2EK5 A;  4MEY F;  4YIF A;  1KYZ A;  1BOA A;  5J6X A;  4RB1 A;  4N0B A;  3WE2 A;  2IA1 A;  5KK1 A;  3LWF A;  4JBA A;  2IVM A;  4MTD A;  1RI7 A;  4XRF A;  2CG4 A;  1YYV A;  1DDN A;  2VBX A;  3HSF A;  1FLI A;  1B4A A;  3I71 A;  2GAU A;  3ZMZ A;  2GZW A;  5E1W A;  1XB4 A;  3ULQ B;  2K27 A;  1Z91 A;  2MLG A;  1ZRD A;  3GVA A;  1P2F A;  1LDK B;  2LSO A;  2IW5 A;  4MGR A;  2P5V A;  3L09 A;  1ZH5 A;  4HQE A;  4YFX F;  3LA7 A;  4WF2 A;  1T39 A;  3ECO A;  3MWM A;  3F8N A;  3KP2 A;  3U2R A;  4IPA A;  3ZMU A;  4I0B A;  5ILV A;  2EFW A;  4XBF A;  2W25 A;  3J81 K;  2L54 A;  2PI0 A;  1R1U A;  4E70 A;  1XMA A;  4Q48 A;  3WGG A;  2DPU A;  1GVJ A;  4CDG A;  2IP2 A;  2QWW A;  4LLN A;  5HDN A;  2YU3 A;  4P9F A;  3ISP A;  2CFX A;  2NRA C;  1IXS B;  1U8R A;  2ISZ A;  3SZP A;  3E6M A;  2VT3 A;  5D6F A;  3V8K A;  1T6S A;  1HKQ A;  2OBP A;  2A6H F;  1OYW A;  3DXJ F;  4HDV A;  3AAF A;  4OMY A;  3FWE A;  1OKR A;  4YFK F;  2MH9 A;  3DEU A;  2O3F A;  3JTH A;  1YS6 A;  1Z7U A;  3KLN A;  5IT9 Z;  4A6D A;  4EJV A;  3CUO A;  5L3D A;  4ASN A;  4LG0 A;  4G7O F;  2CQK A;  3BRO A;  2QQB A;  4MTE A;  4A0X A;  3DP7 A;  1QPM A;  2OD5 A;  5E8I A;  3KFW X;  3U1D A;  5HLH A;  4A5N A;  3SHF A;  2EA4 A;  1TW3 A;  3N4M A;  4DQ2 A;  3D0S A;  4G8X A;  1A04 A;  2F5C A;  2VT2 A;  4YFN F;  1RZ4 A;  2BE5 F;  1TTY A;  3EYY A;  3KLO A;  3ZPL A;  4GYI A;  4B09 A;  1FT9 A;  2L02 A;  3L00 A;  2C6Y A;  3H92 A;  1G6N A;  3TOA A;  2O8X A;  4A6E A;  3FXQ A;  1YO5 C;  3F6O A;  4UXN A;  1IRG A;  3COA C;  2ZNZ A;  4F7Z A;  5TJJ A;  2KRF A;  1E2X A;  5FD6 A;  1R36 A;  2FNP A;  3FHZ A;  2HWV A;  3WTT C;  1HW5 A;  3RKW A;  3HOS A;  4KN7 X;  4U88 A;  2XAJ A;  2XUB A;  1SAX A;  1ZYR F;  2TDX A;  1RUN A;  2O6G E;  4I02 A;  3F8C A;  2RN7 A;  2VBY A;  4PDK A;  2UZK A;  4P96 A;  2VE9 A;  2XKP A;  3HOT A;  1NHA A;  2XRN A;  4ZYD A;  1FBQ A;  5AON A;  3KP4 A;  1LEB A;  5DV5 A;  2M5W A;  2OQR A;  3FF5 A;  1P4X A;  3K1M A;  3KP5 A;  4RB2 C;  3SZT A;  1SFX A;  1MZB A;  3HRT A;  4Q4Z F;  4KDP A;  1JHH A;  3BJO A;  2E1N A;  4IHS A;  4UUV A;  3E6C C;  5JFR A;  1T98 A;  1XSX A;  2WC2 A;  1R23 A;  1MKM A;  4R79 A;  1U6G A;  1UB9 A;  1S3J A;  3FMS A;  2X0L A;  4UNO A;  1XGN A;  1BIA A;  2F5F A;  1S8N A;  3G3Z A;  4HZF A;  2G7U A;  1AOY A;  1T38 A;  1TNT A;  5ICE A;  5LHH A;  5LHG A;  3RIR A;  5F64 A;  4ZZD A;  5JHU A;  4EGY A;  1USS A;  3L2C A;  2ZFW A;  1FBS A;  4KIB A;  2JZY A;  1QO0 D;  2XAF A;  4K2E A;  2HYF A;  1KQ8 A;  4IVN A;  5DUI A;  2QM3 A;  1S29 A;  4KT5 C;  5FGM A;  5HS9 A;  3F8B A;  2CGP A;  3O2P E;  1ZRE A;  4RGS A;  3RJP A;  3QU3 A;  4L9N A;  3IWF A;  3T8R A;  2PEX A;  1IN5 A;  2ETH A;  4ESF A;  5LEK A;  2PJP A;  1D5V A;  2UXN A;  2L01 A;  3JSO A;  3TQN A;  4IRI A;  4PZJ A;  5HDK A;  5BQT A;  2R7D A;  2W85 A;  4Y13 A;  2DLL A;  2HDC A;  3P7N A;  3IC7 A;  1MJB A;  4BHC A;  3I59 B;  5KVR A;  3GF2 A;  3JSP A;  4NHJ A;  1KU9 A;  3RTR A;  4KNY A;  2OQG A;  3V7R A;  3BJA A;  3Q5F A;  1KA8 A;  4RS8 A;  2VOP A;  2FF4 A;  4EM0 B;  4CYD A;  5JVT A;  4U0Y A;  3HSE A;  4DNC A;  3I64 A;  3W6K B;  2ACJ A;  5FFZ A;  2Q8K A;  5K1Y A;  1ON2 A;  1J75 A;  1KU2 A;  1IN7 A;  3GUD A;  4RB3 C;  1MDM A;  4M9S A;  5ERI A;  2RDP A;  3GLX A;  4XSX F;  4EVI A;  5K5O A;  1MGT A;  3HTU A;  5ICF A;  3GZ5 A;  5ILS A;  1U78 A;  5LLQ A;  5CYV A;  2FQ3 A;  2WTE A;  4PGH A;  1FYL A;  4IRH A;  1B6A A;  1FOK A;  5DCM B;  3FMR A;  1JGS A;  2NNY A;  5D6E A;  2DBB A;  1R7J A;  2UXX A;  3JW4 A;  1YG2 A;  4P9U A;  5E20 A;  1P4W A;  3JAM Z;  2E7X A;  4CZZ A;  4EJU A;  4O6J A;  1XD7 A;  3R4K A;  3I5U A;  3M1E A;  3WTZ A;  2W57 A;  3QPH A;  3NRV A;  1ZLK A;  1BC8 C;  5D5X B;  2A5Y B;  3CTA A;  5E18 F;  4A2U A;  2Z33 A;  3HYI A;  1Z6T A;  3KP3 A;  4M6Y A;  3VOE A;  1H9G A;  1REP C;  3BJ6 A;  1R1T A;  2EA2 A;  3ELK A;  1S7O A;  2VBZ A;  2MC3 A;  2HKO A;  2FML A;  1SD4 A;  2P8T A;  1CF7 B;  2HTS A;  5FD5 A;  4NQW A;  1OYY A;  1IXC A;  4KUM A;  4AWX B;  3ZMD A;  1J9I A;  1SFU A;  2D1H A;  4IJA A;  1FPQ A;  3B02 A;  5F6F A;  2A07 F;  4O5V A;  1BBY A;  5BMZ A;  1D8K A;  2XGX A;  3GEZ A;  1ODD A;  3F6V A;  5A2Q Z;  4YG2 F;  5E1Z B;  3TDZ C;  4OIO F;  4IRG A;  2O0Y A;  3ABU A;  3WTX C;  1BM9 A;  1S6L A;  1YW9 A;  2QQ9 A;  3J80 K;  2BGC A;  5ICC A;  4Y15 A;  1KGS A;  2OA4 A;  2DQL A;  4LK1 F;  5IT3 A;  3FM5 A;  3I4P A;  1QGP A;  3WTV C;  2F5E A;  4ON0 A;  3SXY A;  3DQV C;  3GXO A;  3EQL F;  1G3T A;  4LLG F;  3E3V A;  2XAS A;  3VFZ A;  1HQC A;  3R60 A;  1CGP A;  2EFO A;  3CO7 C;  4HX4 A;  5EEG A;  4KA4 A;  3E6D A;  4M71 A;  5D5U B;  4MQV A;  2BBY A;  3O3K A;  5D4R A;  5HS7 A;  4GYG A;  4ENM A;  1FX7 A;  4WX9 A;  2J5P A;  3F72 A;  1BC7 C;  1FY7 A;  4HBL A;  5DUK A;  4BXU A;  1YIO A;  1I5Z A;  2XVC A;  4L5I A;  1MD0 A;  1J0R A;  1ON1 A;  3IWZ A;  4CGZ A;  4IHT A;  3F21 A;  1TQP A;  2E1C A;  4A12 A;  1WSU A;  3BZ6 A;  2VBW A;  2YX4 A;  2P5K A;  2G7H A;  2QBY B;  4HYE A;  3U9G A;  2QUF A;  2J5O A;  1QZZ A;  4L0Z B;  5L3F A;  2HTJ A;  4ZYE A;  1YFH A;  5DCF A;  3IKV A;  3NEU A;  2CWE A;  1U5T B;  3CUQ B;  1DUX C;  1IRF A;  3RDI A;  1LJ9 A;  2EFQ A;  2HQN A;  3KZZ A;  3QP5 A;  4KIF A;  2FE3 A;  2QBY A;  1EH7 A;  3JTG A;  3QOP A;  3GFI A;  3Q9S A;  4ESJ A;  4KFC A;  4OMZ A;  2COM A;  3LAP A;  3IRR A;  1W4M A;  3SFZ A;  3E5X A;  1XGS A;  3R0A A;  1IN8 A;  1JE8 A;  2Z9O A;  4GO1 A;  4I7H A;  2EB7 A;  3HSR A;  5HDG A;  2Z99 A;  1FSE A;  1XDU A;  4U0V A;  1FC3 A;  2M1B A;  5LBQ A;  4CXF A;  2VN2 A;  3TO6 A;  2OZU A;  1F5T A;  5D8K B;  2L3D A;  4Y17 A;  1I1S A;  4G9Y A;  3WG9 A;  3Q9V A;  4HF0 A;  4Q47 A;  5HLI A;  2QEN A;  4G6Q A;  3R0J A;  3K9T A;  3VB2 A;  3P9I A;  4KMU X;  1UCR A;  4I0A A;  2WWY A;  4XSZ F;  3HUG A;  5JR3 A;  2IA2 A;  3LA3 A;  3M9A A;  1K7A A;  4OIP F;  1P4A A;  4MEX F;  1JXS A;  5D5W B;  3GO5 A;  1T0F A;  1EH6 A;  4LFU A;  4L9T A;  2RNJ A;  3BOQ A;  4G7Z F;  3FZV A;  2G9W A;  5AIQ A;  3QPT A;  3BP8 A;  3BDD A;  2IRF G;  5J8F A;  3ZN0 A;  5LGT A;  2ISY A;  4M74 A;  3N97 A;  3RPU A;  2EV5 A;  1STZ A;  1HST A;  3EET A;  4HDU A;  3MZH A;  2D45 A;  4A0Z A;  1O3S A;  4OIN F;  1O3Q A;  5DYM A;  3MEX A;  5L3E A;  5L3C A;  1P92 A;  3ZN1 A;  4TV7 A;  2YPR A;  3BPV A;  4HV5 A;  3RI4 A;  4U7B A;  1H0M A;  2EV0 A;  1MJA A;  4RB0 A;  5DD8 A;  2DFI A;  3T0Y A;  3MAJ A;  2Y48 A;  2OU2 A;  3F8F A;  3ABT A;  1SD6 A;  3NQO A;  4N9I A;  1XCB A;  4JQF A;  5FLX Z;  2PBI A;  3WTY C;  2QLZ A;  4HA8 A;  1XSV A;  2PFB A;  3TOB A;  3IL2 A;  4AVP A;  1XMK A;  4EGZ A;  2HEO A;  4OOI A;  3DPL C;  1DPU A;  3GYH X;  1PUE E;  1RIO H;  3M7G A;  4UVB A;  4HAM A;  2A69 F;  1MJ9 A;  2DW4 A;  2DT5 A;  2XHK A;  3KEQ A;  5CVI A;  3G73 A;  3HIF A;  2ZJ2 A;  2GA1 A;  4LB6 B;  4FT8 A;  4ZZL A;  4KN4 X;  5FB2 A;  1J59 A;  4EJO A;  2P7C B;  3B73 A;  2DAO A;  2FNA A;  5BPI A;  1J2X A;  2RC4 A;  1V4R A;  2YSR A;  5E8G A;  1ZG5 A;  4WWC A;  3H3Z A;  3ZP5 A;  3V7S A;  1F1Z A;  2K02 A;  3EDP A;  1IW7 F;  2ZXJ A;  2Q2E A;  3KE2 A;  3ML6 A;  2JTV A;  2V6C A;  4OIQ F;  4WXC A;  4EM2 A;  2XIG A;  3ZMS A;  1ZAR A;  1IF1 A;  4M72 A;  4HLX A;  4O3M A;  3GFM A;  2MBF A;  2M87 A;  5K5Q A;  4ETS A;  4GGG A;  3C3W A;  3DFG A;  3HTS B;  2LF8 A;  4HLY A;  1KQ9 A;  5A2Q K;  3IKT A;  4L5J A;  5DEQ A;  4BHP A;  2O61 A;  5LGU A;  1G3S A;  2QQA A;  1G4D A;  3KP7 A;  5LGN A;  2BV6 A;  4I01 A;  3F3X A;  3DV8 A;  3WTU C;  1KQ0 A;  2R3S A;  3VEP A;  4B8X A;  3W6J B;  2FXA A;  2HS5 A;  1HKS A;  2BYV E;  2WV0 A;  4LK0 F;  1TBX A;  1R5H A;  1ZGA A;  4HOB A;  3M8F A;  1O3R A;  4R8H A;  2QYO A;  4RAZ A;  4MQ9 F;  6PAX A;  5CVU A;  3I59 A;  2VXZ A;  5HS8 A;  1SMY F;  2VC0 A;  3K2Z A;  4HX8 A;  3H3U A;  2JPC A;  1ZRC A;  4GCV A;  2A6E F;  3WE3 A;  1VTN C;  1C0W A;  1L3L A;  4I2O A;  1WRJ A;  2DI3 A;  2XAQ A;  2DPD A;  4U0W A;  1XGM A;  4RAY A;  3OOP A;  4UV8 A;  4EM1 A;  1B9N A;  3WGI A;  2H27 A;  1WQ2 A;  2EFN A;  2P6T A;  1U5T C;  2PLY A;  3PQJ A;  1Q1H A;  3CUQ C;  5K5R A;  2RV8 A;  1IAW A;  3I58 A;  5LRR A;  2EV6 A;  3QAH A;  4UVC A;  2F5D A;  5H6Q A;  1JHF A;  2XV4 S;  2P6S A;  3QP6 A;  3REO A;  3TDU C;  1YS7 A;  1P6R A;  3FXU A;  4OIR F;  2MD5 A;  1H9T A;  3CLO A;  1BI3 A;  5DCM A;  3IRQ A;  4WCG A;  3LA2 A;  1QQI A;  3I53 A;  4QWQ A;  1U2W A;  3QRF F;  2HGC A;  3O6B B;  1O57 A;  5LHI A;  2VOO A;  2ZO4 A;  1K79 A;  4U7D A;  1YW7 A;  3R6S A;  2KKO A;  1KU3 A;  2VC1 A;  4L0Y B;  1FNN A;  4WK8 F;  3GWZ A;  2K86 A;  3WU0 A;  1LQ1 A;  3ZMT A;  1S7A A;  2IPQ X;  5HOO A;  2GQQ A;  3L7W A;  1QNT A;  1BN5 A;  1B9M A;  1O7L A;  1UHM A;  2M8E A;  5CVJ A;  3J7A O;  1UFM A;  4CO8 A;  2HFH A;  2JPB A;  3RYP A;  3PFI A;  5FO5 A;  3KZY A;  2STT A;  1CF7 A;  5IT9 K;  1TNS A;  1K78 B;  1YW8 A;  2M30 A;  1IXR C;  4HQM A;  5F1R A;  1AWC A;  1DP7 P;  1B59 A;  3WOD F;  2PQ8 A;  2CYY A;  1RUO A;  2V79 A;  5H20 A;  5DDG A;  2W24 A;  1XCV A;  3GW2 A;  1SFE A;  1YLF A;  3LST A;  4L9J A;  4AD9 A;  3WTW C;  2H6C A;  3PQK A;  1J5Y A;  3WTS C;  2Z3Y A;  3L9F A;  3LFK A;  3FXR A;  1BI1 A;  4ZH4 F;  2D2W A;  2ESN A;  4RGU A;  4IXA A;  3WU1 B;  5CVR A;  1IN6 A;  2A68 F;  4WXH A;  3ROU A;  4ENK A;  4KMF A;  2PN6 A;  5H6R A;  1WI9 A;  2FBI A;  3DKW A;  1YQA A;  5HVQ C;  2V1D A;  3FX3 A;  2A61 A;  2XAG A;  1UHW A;  2Y0M A;  4G7H F;  5BOX A;  1I1G A;  3C18 A;  3GZ6 A;  2DU9 A;  3OV8 A;  4LLL A;  1R58 A;  4EQQ A;  2HQR A;  3F23 A;  2K4J A;  4KIG A;  1T2K A;  4RGX A;  3VOD A;  1WWX A;  3GFL A;  4HV6 A;  2GXB A;  2A3S A;  3RYR A;  4L18 B;  3EYI A;  2ZKZ A;  4ZYG A;  2DTR A;  1HSJ A;  2FA5 A;  3GFJ A;  4EJW A;  2AXL A;  1OPC A;  2H6B A;  2PMU A;  3TO9 A;  2STW A;  1TQM A;  3HHG A;  2MLK A;  3ZQ7 A;  3HHH A;  2MA3 A;  5D8L B;  1GHC A;  5FLX K;  4S05 A;  1PDN C;  3K69 A;  2KIU A;  2ZME B;  3HRU A;  4NB5 A;  4OU0 A;  1WKM A;  3P9C A;  1J7K A;  1HW1 A;  4HX7 A;  4BH9 A;  4FX0 A;  2FBH A;  4XLN F;  1TLH B;  2PG4 A;  3HRS A;  4M73 A;  1U5T A;  3CUQ A;  2L4A A;  3F8M A;  3MQ0 A;  3F22 A;  2IA0 A;  2ZME A;  3DPT A;  4G94 A;  3ECH A;  4CHU A;  2PMH A;  2RGV A;  4LG0 B;  2HYG D;  4A0Y A;  3E5U A;  5FFX A;  4L9V A;  1FZP B;  2CSO A;  4HW0 A;  1W7P D;  1FWZ A;  1R00 A;  2L4M A;  2ZBK A;  1EH8 A;  1IUY A;  1HBX G;  2Q0O A;  4JK1 X;  1TQI A;  4EJT A;  3J80 Z;  1I27 A;  4UV9 A;  1BI0 A;  1X3U A;  2AS5 F;  1R5G A;  5D4S A;  2OZ6 A;  5AIP A;  1TW2 A;  2KJC A;  2LDU A;  2NNN A;  2B0L A;  2IJL A;  5HLG A;  1O7F A;  4CIC A;  5L3G A;  2JSC A;  2D1V A;  4EV0 A;  1DPR A;  4MNU A;  4ENJ A;  3SQN A;  1UST A;  2GIV A;  3IHU A;  2XRO A;  2EFP A;  4XLP F;  4Z2Y A;  1GXQ A;  1ZG3 A;  2O03 A;  4ZYH A;  1XN7 A;  2NYX A;  3TKY A;  4YII A;  4FHT A;  3C1D A;  1ZGJ A;  1FBU A;  2P7V B;  4ESB A;  2H09 A;  3BPX A;  5ICG A;  2RVC A;  4RGR A;  2E7W A;  2M45 A;  2QVO A;  1ZAO A;  1GXP A;  2FBK A;  2KIM A;  1HW2 A;  1LNW A;  1U3E M;  1LEA A;  5JI6 A;  4BHB A;  1LB2 A;  2K7L A;  3JAM K;  2BEO A;  4IF4 A;  1E17 A;  3M8E A;  3WGH A;  2UWM A;  1QBJ A;  5L3B A;  3J81 Z;  1Z05 A;  5LEJ A;  2JRT A;  5ED4 A;  2HOE A;  4KIC A;  4UHT A;  2LKP A;  5D5V B;  2JT1 A;  2FSW A;  3S2W A;  3CDH A;  2RQP A;  1XGO A;  4GXO A;  2ELH A;  1SMT A;  2EWN A;  4QLC U;  1IN4 A;  3KCC A;  1ZRF A;  1HXD A;  1OMI A;  1PP7 U;  3ZMV A;  3GX4 X;  2FU4 A;  4MHG A;  1LDJ A;  4I98 B;  1D8J A;  1W5T A;  3FM3 A;  3I0T A;  3V8L A;  1KYW A;  4R1H A;  5LRS A;  4M9X A;  4P5O A;  5EEH A;  3BWG A;  1F4K A;  4BQA A;  2KJB A;  4BYY A;  2FRH A;  2FOK A;  3TGN A;  2IT0 A;  4LB5 A;  4EMS A;  1LDD A;  3P9K A;  2HR3 A;  3K1N A;  4HF1 A;  3LAJ A;  3E97 A;  4UVA A;  1FYK A;  2W84 A;  1OR7 A;  4A5M A;  1XDS A;  3MZY A;  3QU6 A;  4WXD A;  5TRD A;  2CO5 A;  1Z1D A;  2H94 A;  2CW0 F;  2RKH A;  2YX7 A;  5BPD A;  3K1P A;  3KEO A;  1R1V A;  3K0L A;  3HRM A;  2ZCW A;  1W5S A;  2QZ8 A;  2P4W A;  2KIF A;  3MCZ A;  1MDM B;  4LJZ F;  1B1B A;  2OAZ A;  2GWR A;  4S04 A;  3ERE D;  2YR2 A;  2NAZ A;  2Z5U A;  3E6B A;  3MFK A;  4LMY A;  5CLS A;  4G6D A;  4HF2 A;  3LQQ A;  2GXG A;  2HKX A;  2MH2 A;  3RKY A;  2XKO A;  3T1B A;  4D0P A;  4Q5S F;  2P5L C;  4KYW A;  1ZN2 A;  4PGG A;  2V1X A;  3E5Q A;  3FMQ A;  4LD5 A;  3TO7 A;  4PCQ A;  4AIK A;  4P55 A;  2DK8 A;  3C7J A;  3KP6 A;  3KET A;  1OYI A;  2DO7 A;  3D5L A;  1F9N A;  3EUH A;  5CJ9 A;  1KU7 A;  5E1X A;  1FP1 D;  2ZNY A;  1BJA A;  1HKT A;  1K6O A;  3RKX A;  3CJN A;  3RPQ A;  2LF7 A;  1W7P B;  2FEZ A;  4AIH A;  1SD7 A;  3I54 A;  2VOD A;  1ZLJ A;  2X4H A;  1XSD A;  2VON A;  1ONV A;  1LVA A;  2R7F A;  3T5X A;  1G3W A;  2LNB A;  2XAH A;  2ADU A;  1ZG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...