3CJNA

Crystal structure of transcriptional regulator, marr family, from silicibacter pomeroyi
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
148
structure length
146
Chain Sequence
RELAEIGLEGYAPYLMNRIMGRYNANLRKEMTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDDQRSSRVYLTPAGRAVYDRLWPHMRASHDRMFQGITPQERQAFLATLNKMLANIRVHEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MarR family transcriptional regulator from Silicibacter pomeroyi.
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
total genus 40
structure length 146
sequence length 148
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3cjnA00
1BC8C 3F8MA 3KZYA 1CF7B 1XCVA 3K1NA 1KQ8A 3R60A 4ZZLA 5E20A 3HTSB 1YLFA 2MC3A 1LVAA 1MD0A 2F5DA 2Z3YA 3FWEA 4UUVA 1B9NA 3WU0A 5E1ZB 1IN8A 4HZFA 4IPAA 3H3UA 1XMAA 2NS0A 1IN7A 1ZREA 2DFIA 2FBKA 5K1YA 3J7AO 1U5TB 3BOQA 2K27A 1QBJA 2P6SA 2E7XA 5DD8A 3AAFA 4AIKA 2ISZA 1CGPA 3QOPA 3T1BA 2A5YB 1TW3A 2DU9A 5ED4A 5LGTA 5LGUA 4U7BA 3EQLF 4R79A 4GO1A 1KQ0A 3E5QA 4KIGA 2ZXJA 4BHBA 2FOKA 3P9CA 4KICA 4KYWA 4MEXF 3GLXA 1RIOH 1ODDA 2VOPA 3IKTA 4MNUA 5EEHA 3IC7A 1XDUA 2A69F 3GF2A 3T8TA 1ZAOA 1LEAA 3F22A 3KEOA 2JSCA 2FMYA 1HW2A 2P6TA 3V8LA 1TLHB 1KGSA 2UWMA 5DD4A 1MDMB 3O2PE 1FP1D 2ACJA 2P7VB 2XAQA 5KK1A 2G7UA 2IA2A 3E97A 2P4WA 3ISPA 3HYIA 1B6AA 2JPBA 4WWCA 1GXPA 4WXHA 3ZN0A 1D3YA 1XGOA 3Q9SA 4O3MA 2G7HA 5LGNA 3VOEA 3QRFF 4CXFA 2NRAC 1R5GA 4ESJA 3WTYC 2G9WA 3KP5A 2EV5A 1BI0A 2HQRA 2HKXA 3ZN1A 2OU2A 2V1XA 2ZNYA 5CYVA 2CYYA 3ABUA 1KYWA 2DQLA 4F7ZA 2MH2A 3L00A 4KIFA 3JAMK 3K9TA 1ZLJA 3TDZC 1Z1DA 3I71A 1O57A 2ZNZA 4KN4X 5DCFA 3DPLC 1YS6A 1BN5A 1HBXG 5HDNA 4FT8A 3K0LA 1YYVA 2XUBA 3O6BB 5BPDA 2P5KA 5JI6A 4KNYA 4FX4A 1MJ9A 1U6GA 4EV0A 2P5LC 5F6FA 1B59A 4GXOA 3REOA 5H20A 1R1UA 4JQFA 1ZLKA 3F8BA 1GXQA 5CJ9A 2OBPA 3ZMZA 4ETSA 2NYXA 1K78B 1UHWA 3J80K 4N9HA 2FMLA 2HYFA 1PP8F 4MQ9F 2HR3A 3E5UA 2MH9A 3RIRA 4BHCA 2K4JA 3Q5FA 4A0ZA 2BV6A 2GAUA 1G3TA 2IA1A 4RB2C 3LFKA 2HZTA 2HDCA 4HBLA 2OZ6A 4TV7A 3R0AA 1EV7A 2QUFA 3VEPA 1XSVA 3ZMVA 5D4SA 3MEXA 4OMYA 3H3ZA 3QPTA 3CUOA 3M9AA 5E8IA 5CVJA 3E3VA 3IWZA 3CUQA 2R7DA 3CO6C 2DLLA 3IHUA 4CO8A 1JHHA 1R1TA 2VOOA 4IHSA 4HF1A 2QVOA 2CO5A 1BI1A 4LLNA 3JW4A 2DQRA 1T98A 4LD5A 3I54A 4CHUA 3HOTA 1HXDA 5D4RA 2VT2A 1O3RA 3KP4A 2CG4A 4M71A 3GFIA 2EA2A 3EYYA 3HTUA 3L7WA 3G3ZA 2XAGA 4Y13A 2EFWA 3I0TA 5D6EA 2PLYA 5H6RA 3VFZA 5FB2A 2Z9OA 4HQMA 3WGIA 5FLXK 3H92A 3JSPA 2XAHA 1XSDA 1X3UA 1WQ2A 1LEBA 4FHTA 1F4KA 1V4RA 4UVBA 4PDKA 3V7RA 1FSEA 3S2WA 4M72A 2MA3A 1W7PB 4NQWA 1ON1A 3ELKA 1SD7A 4A0XA 1HQCA 1UFMA 4I01A 3QU3A 3QP5A 5E18F 4ESFA 3MZHA 2FBHA 3FX3A 1AWCA 4KDPA 3E6MA 2YX4A 2K4BA 2ESHA 3LQQA 1JGSA 4LGWA 1J75A 1T6SA 2KIMA 1JXSA 1IRGA 4I7HA 3KE2A 4LK1F 4XRFA 1YW7A 3F8FA 5TJJA 2O61A 1IF1A 5ILVA 2GWRA 3CTAA 2W57A 2BEOA 5F64A 3E6CC 5E1WA 5FLXZ 2FE3A 4BHPA 1IW7F 1P4XA 1J59A 5DYMA 3WTVC 2A3SA 3BZ6A 3ULQB 3I64A 1MKMA 4RS8A 1LQ1A 4GYIA 4UXNA 2W24A 3QP6A 2KIUA 3ZP5A 1VTNC 4RGXA 2QQAA 2GQQA 2Y0MA 1J0RA 3V7SA 3ABTA 2A6HF 1G3WA 4EM2A 1F5TA 2PMHA 1DPUA 4G94A 3WTXC 1G4DA 2XKOA 1FYKA 4LG0A 5J6XA 3WTZA 5TRDA 3TO6A 4CYDA 4BXUA 1ZG1A 2EV6A 3GFLA 1ZG5A 3RYRA 3GW2A 2FXAA 2XKPA 1YFHA 3HSEA 3NQOA 4RAZA 2X0LA 3P7NA 3FM3A 3OV8A 2V6CA 5D5UB 3F6VA 1Y0UA 2E1CA 1H9TA 3FF5A 4LK0F 4M9XA 5J8CA 1FLIA 3MZYA 2XVCA 4KA4A 3M1EA 2H6CA 1YG2A 3RKYA 4HX8A 2OQGA 1TNSA 3RPQA 1USTA 3JTGA 1XSXA 3VB2A 3BJAA 4B8XA 4U0WA 3GO5A 3KP2A 2P7CB 2VE9A 2Z5UA 1PP7U 5CVVA 2PFBA 3SFZA 3DQVC 4JBAA 2RQPA 2QQBA 1IN6A 2HTSA 4QWQA 2RN7A 3V4GA 1O7FA 3P9IA 3BWGA 3C7JA 4YFKF 2RV8A 4N0BA 5AIQA 3KEQA 5HVQC 1ZYRF 2B0LA 5BQTA 3ZQ7A 1FZPB 3JSOA 1Z91A 4EVIA 1I6XA 4AVPA 4FX0A 4Q4ZF 3DV8A 3WGGA 1BM9A 5HS8A 1P2FA 1C0WA 1QPMA 2H94A 4XSXF 4MEYF 3T8RA 3BY6A 3OOPA 4G7ZF 2DBBA 1K78A 3ECHA 1TTYA 3V7CA 2NAZA 1R1VA 3DPTA 3HSRA 3EYIA 6PAXA 3GUDA 2STWA 4A6DA 4NHJA 3WODF 2DPDA 4HA8A 2NNYA 2IPQX 3CLOA 3TGNA 2WTEA 5E1XA 1MZBA 2FBIA 3F21A 1ULYA 2Y75A 1PDNC 1HSTA 1P4AA 4OIQF 2YSRA 3HRUA 2D45A 5LHGA 2FF4A 2VBXA 5L3GA 2XRNA 2MBFA 3GFMA 2R7FA 2HKOA 3ZMSA 5ICFA 2EFNA 1FNNA 1T0FA 4P96A 5LBQA 4RB1A 4GYGA 4LLLA 4R8HA 1WKMA 4A5MA 1L3LA 1Z6RA 2OZUA 4K2EA 1LB2A 4HOBA 3P9KA 3TDUC 4EM0B 4KFCA 1STZA 1FC3A 2M5WA 2K02A 5BOXA 2CQKA 1KQ9A 1YW9A 1UCRA 5AIPA 3ZPLA 2L3DA 2OA4A 4EGZA 3TOBA 1XD7A 2QZ8A 1OR7A 4M9ZA 4O5VA 4DNCA 3HSFA 2H6BA 4UV9A 4ZH4F 3ERED 4PGHA 1FYMA 1V3FA 3I4PA 3M7GA 3EDPA 1XGNA 4HX7A 1ZGAA 2CWEA 5FO5A 4ENMA 4P55A 3WTUC 1MJBA 1BJAA 5LLQA 1MDMA 5LHIA 4U0YA 3DF8A 3R6SA 3GVAA 4KUMA 4P9UA 3GX4X 4A5NA 4G7HF 3N97A 4LMYA 1XN7A 4RGSA 1R36A 2RNJA 3FXUA 3QAHA 1Z7UA 4L0YB 2AXLA 2IP2A 5DDGA 2XAJA 3HHHA 5FD5A 1U2WA 1QZZA 3F8NA 2ZCWA 3FZVA 4ENKA 3F72A 5LEKA 3GYHX 3DXJF 5DV5A 1S7AA 1K7AA 5ICGA 4A2UA 4ENJA 4R1HA 3SXYA 4XLPF 3C1DA 4L18B 4MTDA 2LDUA 4XSZF 2PBIA 2AS5F 1YIOA 4LJZF 4GCVA 3HOSA 2P8TA 2VBWA 3FM5A 2LNBA 4L9TA 4KT5C 5LHHA 3N4MA 2EK5A 2ZMEA 2Z33A 1XGMA 3WGHA 4S04A 1YO5C 2LSOA 3I53A 2VONA 3BDDA 1R23A 1R00A 2CFXA 2HYGD 4E70A 5HLHA 3KLNA 3HRMA 1W5SA 2K7LA 4G7OF 3LA7A 1TQMA 3WG9A 4AWXB 4A12A 1IXCA 1AOYA 4M9SA 1J2XA 1Q1HA 2GXBA 4IRGA 2KJBA 3IKVA 3WE2A 1ZRFA 1PUEE 2M1BA 1MJAA 3GEZA 4IJAA 2F5CA 2FNAA 5CVIA 2UZKA 3K2ZA 2ZFWA 2GXGA 1HKQA 4DQ2A 1LNWA 2D1HA 2BE5F 4KN7X 1LJ9A 4UHTA 2VN2A 3E5XA 2VT3A 3CUQB 1P4WA 4L5IA 1DUXC 4EJTA 2HGCA 2COMA 2V79A 3WTTC 1J7KA 2KJCA 2XROA 1ZN2A 4WCGA 4YFNF 5H6QA 3R0JA 4HV6A 5EEGA 1E17A 2PEXA 4RB3C 4MQVA 4U88A 4P9FA 4Z2YA 2QBYB 2JT1A 3F8CA 3HRSA 2ZMEB 4YIIA 2V1UA 3TO9A 2HEOA 3WU1B 2X4HA 4ZYDA 4LB5A 5LEJA 4L9NA 3K1MA 2MD5A 1BOAA 3B02A 3HIFA 3F6OA 1FP2A 3K1PA 4MGRA 1B4AA 4EQQA 2KRFA 3FHZA 2Q8KA 3IWFA 1Z9CA 5JHUA 3QU6A 4BQAA 5HS9A 2O03A 1U8RA 4KMFA 1YS7A 3PQJA 4L5JA 4NB5A 1SAXA 2OQRA 5E17F 1TQIA 5D6FA 5L3EA 2A6EF 2VODA 2XGXA 1RZ4A 4EJWA 3RYPA 3V8KA 4G9YA 3CO7C 3GWZA 3BPXA 2XASA 5D5WB 4BYYA 1F1ZA 1P92A 1REPC 2XV4S 2M30A 3U2RA 3SHFA 3DP7A 2O3FA 5ILSA 4BAYA 5HOOA 3RI4A 1H9GA 1D8JA 5DCMB 3HRTA 4IRHA 1KU3A 2W84A 4YG2F 2QENA 1O3TA 4ZYHA 4HLXA 2BBYA 1JE8A 2IW5A 3KP3A 2OAZA 1CF7A 5CVUA 4M73A 5D5XB 3SZPA 5JR3A 4WK8F 3L2CA 3GZ6A 3LA2A 3BROA 4I09A 3RKXA 1KU7A 3BJOA 1I5ZA 1ZRDA 1SFEA 3R61A 4HYEA 3LSTA 3FXRA 1LDDA 4IXAA 5DUKA 4A6EA 2FEZA 2LKPA 1I27A 1QNTA 5D8KB 2RGVA 3KFWX 1ZRCA 1H0MA 3L09A 2M87A 3J81K 5E8GA 2VBZA 5DCMA 3RDIA 3PQKA 1YW8A 2R3SA 1D5VA 1J9IA 3PFIA 1I1GA 4ASNA 3RJPA 3ECOA 1S8NA 3MAJA 3VODA 1F9NA 4GGGA 3I5UA 2YR2A 4M6XA 3J81Z 3O3KA 2PG4A 3ZMDA 3MWMA 5FGMA 5HS7A 4HAMA 1IAWA 2LF7A 4CDGA 4EJVA 5IT9K 4G6QA 4IRIA 1FPQA 3MCZA 5J8FA 1S29A 3BP8A 1BI2A 1IN4A 3LQRA 3JAMZ 4HF2A 1R5HA 2WC2A 2C6YA 4I02A 1TBXA 5HLGA 3ZMTA 3HUGA 3TQNA 2JRTA 5F1RA 1ONVA 5CVRA 1KYZA 1LDJA 2P5VA 3L9FA 1ZG3A 2VXZA 3G73A 3MQ0A 2GA2A 4A0YA 3M8EA 1DPRA 4EGYA 2L4AA 1TQPA 3EUHA 1G3SA 3E6DA 2GZWA 4WXDA 2YPRA 4QLCU 2L4MA 4U0VA 1S6LA 1OKRA 4HX4A 4KIBA 1HW1A 3JTHA 2ETHA 2LF8A 1R58A 1FBUA 2VC0A 2YU3A 2UXNA 1T38A 2OD5A 2BYVE 1FT9A 3W6JB 2KKOA 5K5QA 1FSHA 4N9IA 4LFUA 1WRJA 4OMZA 4UNOA 4HDUA 5CLSA 5L3BA 1XCBA 3TO7A 2XHKA 3K69A 3RPUA 1SD6A 4RGUA 3C3WA 2DT5A 2PN6A 3J80Z 2E1NA 4KMUX 3BPVA 5HLIA 1NHAA 3LWFA 4Y17A 2RKHA 1R7JA 2STTA 2VC1A 1XMKA 1SMYF 4G8XA 1ZGJA 1BBYA 2IRFG 4Q48A 2QM3A 1U78A 4O6JA 2FNPA 4PGGA 2IT0A 4YIFA 3GFJA 3E6BA 4CICA 2K86A 3V8JA 1I1SA 2DK5A 1SD5A 2ADUA 3CJNA 4WX9A 2DTRA 4CZZA 1S3JA 2MLGA 2PMUA 1MGTA 2HQNA 1USSA 1OYIA 2O8XA 1QGPA 1HKTA 5HDGA 2IA0A 2E7WA 5A2QZ 2HWVA 4LB6B 1T2KA 3ZMUA 3LAPA 1OMIA 1IN5A 1QO0D 1KU9A 1EH7A 2NNNA 5JFRA 3I58A 4L0ZB 1RI7A 3I59A 4Y15A 4OU0A 3DFGA 2FU4A 1FBQA 1W5TA 4G6DA 1O3QA 4UVAA 1XB4A 1G6NA 2EJRA 5A2QK 5K5OA 2UXXA 4EM1A 1IXRC 1BIBA 3IL2A 1ZHFA 1IZ1A 2D2WA 2GIVA 1ZARA 4LG0B 4D0PA 1DDNA 2XIGA 1UB9A 1EH8A 1UHMA 2DAOA 3F3XA 4RB0A 2HS5A 2Q0OA 3IRRA 4B09A 1RUOA 3TOAA 2EV0A 1W4MA 1IXSB 3W6KB 1XGSA 4HDVA 2QYOA 1A04A 4P5OA 3C18A 2L54A 2FQ3A 4AIHA 1O3SA 1BI3A 2ELHA 4MTEA 4AD9A 1OYWA 1YTYA 2HTJA 3F23A 3QPHA 3GZ5A 4XLNF 4OIOF 3NRVA 2ZJ2A 4UVCA 5L3CA 2Y48A 3LA3A 3KZZA 3CDHA 5D5VB 4EJUA 5K5RA 4RGRA 2RC4A 4OINF 2L01A 1W7PD 4HF0A 4IF4A 1SMTA 4LLGF 5L3FA 1KU2A 3FMRA 1BC7C 3KCCA 2DW4A 5L3DA 3WTSC 5BMZA 3ML6A 2CSOA 4Q47A 3B73A 4UV8A 1RNLA 1U5TA 2PJPA 2RDPA 3WTWC 1KA8A 4ZYGA 2EWNA 1K6OA 2D1VA 2Z99A 2EFQA 3Q9VA 3FMSA 3M8FA 1JHFA 5BS6A 1FYLA 1YQAA 2GA1A 2DI3A 1LDKB 2ISYA 4S05A 2EFOA 2W25A 1ON2A 1ZH5A 1FBSA 3FMQA 1B9MA 3LAJA 4MHGA 4WXCA 2A61A 2FA5A 4XBFA 5AONA 1W7PA 1GVJA 1RUNA 5DUIA 2CGPA 3KP6A 1G3YA 4ZZDA 2QBYA 4IVNA 2V9VA 1B1BA 2J5OA 5ILUA 2EA4A 3U1DA 2H09A 3BJ6A 2TDXA 1J5YA 3T0YA 4WF2A 2JPCA 4HV5A 1WI9A 1T39A 2EB7A 1P6RA 1E2XA 2BGCA 3KP7A 4ZYEA 1R22A 4PZJA 3KETA 1SFUA 3U9GA 3FXQA 4JK1X 1HW5A 5HDKA 5D8LB 2ZBKA 2F2EA 1WWXA 1HSJA 1Z6TA 2FRHA 4I0BA 1XDSA 2IVMA 2XAFA 4BNCA 5FFXA 2WWYA 5IT3A 3IRQA 4M74A 2ZKZA 2W85A 1U5TC 4ESBA 3MFKA 2EFPA 3T5XA 1QZYA 1D8KA 1FWZA 4HLYA 3GXOA 1GHCA 2M45A 4BH9A 1K79A 3R4KA 1IUYA 1DP7P 2YX7A 4OIRF 4EMSA 5ICCA 3D0SA 5KVRA 2PQ8A 4L9VA 4U7DA 5JVTA 4I98B 4ON0A 1SFXA 3RTRA 1HKSA 4EJOA 4YFXF 3SZTA 3NEUA 3D5LA 2F5EA 3CUQC 4RAYA 2DPUA 2CW0F 2VBYA 2WV0A 2KIFA 4PCQA 4H0EA 3KLOA 1QQIA 3ROUA 4I2OA 4IHTA 4AIJA 2HOEA 2IJLA 1Z05A 2RVCA 2FSWA 1TW2A 1BIAA 3DKWA 5ERIA 3TKYA 2ZO4A 4HQEA 2A07F 1TNTA 1OYYA 3EETA 2QQ9A 2O0YA 1O7LA 5LRRA 3SQNA 2VE8A 4L9JA 2JZYA 4ENNA 3I59B 1FX7A 2ESNA 2Q2EA 4OOIA 5LRSA 1S7OA 3HHGA 2JTVA 3WE3A 2F5FA 2H27A 4Q5SF 2J5PA 2PI0A 2QLZA 1IRFA 1L0OC 2O6GE 5IT9Z 1OPCA 4OIPF 2HFHA 2MLKA 4HW0A 2V1DA 2QWWA 2A68F 5BPIA 3DEUA 1U3EM 2M8EA 1WSUA 5FD6A 2L02A 2DK8A 1EH6A 1FY7A 3COAC 4CGZA 1SD4A 4I0AA 5ICEA 5DEQA 3RKWA 1FOKA 4M6YA 5FFZA 2DO7A
chains in the Genus database with same CATH superfamily
3K4CA 2HDWA 1BC8C 2OV7A 2XSDC 1MBFA 4B47A 3D1NI 3F8MA 3VYRB 3KZYA 2QKLB 1CF7B 2HU9A 3MKLA 1XCVA 3DTKA 2K9MA 3K1NA 5C3EJ 1KQ8A 1D0XA 4RMNA 3VYSB 3R60A 4ZZLA 2QCOA 3G1MA 5J4YA 2X1DA 5E3MA 1OQYA 5E20A 3HTSB 1YLFA 2MC3A 2JA2A 2E60A 1X1BA 1LVAA 1MD0A 2B7EA 2F5DA 1WH7A 3JRCA 3CMAI 1YI2I 4AVZA 3HUGB 2Z3YA 3FWEA 2Y0SN 4UUVA 3BR1A 1B9NA 3DTEA 1S5LC 5HNFA 2KLOA 4A3LJ 1RPWA 2KISA 3WU0A 5E1ZB 3QQAA 3SYTA 1YIJI 1IN8A 4V2GA 2OF7A 1K4SA 3W2AA 4HZFA 4IPAA 9ANTA 3H3UA 1XMAA 4EATA 3SEZA 3K4MA 2NS0A 1IN7A 4PJNA 1ZREA 2DFIA 2FBKA 3DU6A 1MBHA 5IY5H 5K1YA 3J7AO 1U5TB 4UB8C 3BOQA 3GTOJ 2K27A 5CQGA 1QBJA 4E4HA 2DA1A 2P6SA 4AYBN 1DQUA 2E7XA 5DD8A 1TT0A 2JWTA 4KITB 5LFAA 3AAFA 2X1EA 4AIKA 1IG7A 2YS9A 2ISZA 1EA3A 1CGPA 1AA7A 3QOPA 3T1BA 2A5YB 1TW3A 2DU9A 5ED4A 5LGTA 5LGUA 4U7BA 3EQLF 1MMSA 5B1BH 3JRFA 4F3QA 3ONQA 4R79A 3P5JA 5EDNA 3SFIA 1WI3A 4ABZA 3A1YA 4GO1A 3W3CA 2Q1ZB 2XAUA 1D0YA 1KQ0A 4A3DJ 2R5ZA 2EZIA 3BT9A 3E5QA 4FETA 3PNVA 4HEA2 4KIGA 2LFBA 4ZDOA 1MBJA 3LSPA 2VPRA 3HGYA 2ZXJA 1ORKA 4BHBA 1VQ7I 2FOKA 3P9CA 4FTHA 2Z1DA 4CYCB 4KICA 1YJ9I 2MSYA 4KYWA 4MEXF 3GLXA 1RIOH 1NH3A 1GV5A 2H1KA 1N78A 1ODDA 2VOPA 4XK4A 3IKTA 2BVLA 4MNUA 2HVSA 3L2WA 3K2AA 5EEHA 2WY7Q 3CMMA 2DJNA 3DBHB 2LG4A 3IC7A 1XDUA 1IV8A 2A69F 1ETYA 2X6YA 3S3NA 4D7NA 3GF2A 1LPQA 4BXFA 4HNVA 3T8TA 1ZAOA 1LEAA 3F22A 3KEOA 3WHBA 4XN3A 2JSCA 1LE8B 2FMYA 4AC0A 1PYVA 1HW2A 3PO3J 2P6TA 4Y4RA 3V8LA 1TLHB 5F0CA 1KGSA 2UWMA 5DD4A 1MDMB 2B9SA 1B8IA 2JUGA 3DPUA 3O2PE 1FP1D 2ACJA 4A3JJ 4C2MJ 2BXYA 3OSFA 4FE4A 2FOWA 3ZQFA 4DYQA 2P7VB 4PJLA 2XAQA 5KK1A 2G7UA 2IA2A 3E97A 2P4WA 3ISPA 3HYIA 3GTKJ 1B6AA 2JPBA 4WWCA 1VI0A 4B3XA 1V54H 1I3QJ 1GXPA 4WXHA 3ZN0A 5EG0A 1D3YA 1XGOA 3Q9SA 1U8BA 5IOZA 4O3MA 2G7HA 2KQRA 5LGNA 2HXIA 3VOEA 2WAFA 4CXFA 3QRFF 1R5GA 3CJRB 3WTYC 3GMEA 4ESJA 1RRJA 2NRAC 2G9WA 5EG0B 3KP5A 1Y0NA 2EV5A 4BY7J 1O4XA 4E7LA 1BI0A 1T95A 2HKXA 2HQRA 2OU2A 2V1XA 3ZN1A 2ZNYA 5CYVA 1XG1A 2G0EA 2H8WA 2CYYA 3ABUA 1KYWA 1JTXA 2DQLA 4F7ZA 2R92J 2MH2A 3L00A 4KIFA 4BEHA 4JYKA 3JAMK 4E7KA 3GTMJ 3LNQA 3ZGKA 1YX5A 3ZXSA 3K9TA 2L5QA 3IAM2 1ZLJA 3TDZC 3E7LA 1Z1DA 3S3OA 2FX0A 5E3OA 2ZMEC 3I71A 3HKZN 1O57A 2O9LA 1GT0C 2ZNZA 4MFDA 4KN4X 5DCFA 3DPLC 1YS6A 2OTLI 1BN5A 1HBXG 5HDNA 3K70C 4FT8A 4JX4A 3K0LA 3K70D 2XB5A 1YYVA 2XUBA 3O6BB 5M5XJ 5BPDA 4C3JJ 3BC8A 4V19K 2P5KA 2CH0A 2LY9A 5JI6A 5F27A 4KNYA 4FX4A 1MJ9A 1U6GA 2VB6A 4XLCA 4EV0A 3M07A 3H1CA 1MMGA 1MIJA 2P5LC 5F6FA 1B59A 1VZ0A 4GXOA 3REOA 5H20A 1ZELA 1R1UA 1W36D 4Y52J 4JQFA 1ZLKA 2IS4A 3F8BA 1GXQA 2BY1A 2OBPA 5CJ9A 3ZMZA 4ETSA 2NYXA 1K78B 2X6XA 2BW3A 1UHWA 3J80K 2IS6A 4V2FA 1BW5A 2KZVA 5DM7F 2R7TA 3H5NA 4N9HA 5B1AH 2L7KA 2FMLA 2BY0A 1PUFB 3M4OJ 2HYFA 2JUCA 3ZQQA 1PP8F 2YU9J 4MQ9F 4BBSJ 4JX5A 2HR3A 3E5UA 2MH9A 4M3FA 3RIRA 4NQWB 4BHCA 1K61A 2K4JA 3ERMA 3Q5FA 4L5EA 2XB0X 3OS0A 4A0ZA 2BV6A 3A01B 4CH7A 2GAUA 3GTLJ 1G3TA 2QQ8A 2IA1A 4RB2C 3LFKA 2HZTA 2HDCA 2JMWA 4HBLA 1X3WB 2OZ6A 1R5ID 4OAYA 4TV7A 4D9JA 3R0AA 3L2UA 1D5YA 2DMQA 1EV7A 3SDGA 2QUFA 4BUPA 3OS2A 2DMPA 1JUPA 1XSVA 3VEPA 3CCUI 2M7BA 4IKFA 4C3IJ 1Y6IA 2DFEA 3KYLA 4IOCF 2LMDA 4J01A 3BTIA 1NK3P 4DJAA 3ZMVA 2JA6J 5D4SA 3DLAA 3MEXA 1X1CA 1MNMC 1WFXA 2W1OA 4OMYA 1FOWA 3H3ZA 2GOXB 3QPTA 3CUOA 3S2DJ 3M9AA 5E8IA 5CVJA 1R71A 3E3VA 2HZDA 3IWZA 3CUQA 2UV1A 2JVHA 2R7DA 3CO6C 2DLLA 3IHUA 4CO8A 1JHHA 4BDYA 3DU5A 3M8JA 3U21A 5J4VA 3PNYA 1R1TA 2VOOA 4HRIA 3JRGA 2E19A 4IHSA 3BLYA 5FKOA 4HF1A 4DBQA 3HXLA 2QVOA 2CO5A 1APLC 3ASOH 2CQ7A 1BI1A 4LLNA 3JW4A 1ZR2A 2DQRA 1T98A 4LD5A 1ETWA 3I54A 4CHUA 1I3AA 3HOTA 2VQCA 1HXDA 1V5FA 4A3BJ 1JGGA 2LREA 5D4RA 2VT2A 2NVYJ 1O3RA 4B3AA 1MSEC 3CCQI 4CCOA 3OYFA 2Y9ZA 3TW7A 3KP4A 5M3FJ 2CG4A 4M71A 1TT5B 3CMYA 3SEQA 3GFIA 2EA2A 3EYYA 3C2BA 3HTUA 3L7WA 3G3ZA 2KZGA 2R4GA 3S16J 2XAGA 4Y13A 2XF7A 2EFWA 1IV6A 1VQ8I 3I0TA 3HGGA 5D6EA 2E2IJ 4ZJZA 5FKLA 2PLYA 3S2HJ 3HZJA 5H6RA 3VFZA 2LKSA 5FB2A 2Z9OA 3K4BA 4C2UA 2D5VA 4HQMA 5IP6A 4XKWA 3WGIA 5FLXK 2V1NA 3H92A 2H1LA 3JSPA 4S0HB 2XAHA 1XSDA 1X3UA 2M34A 1WQ2A 1LEBA 3CCRI 2K9LA 1Y56A 4FHTA 5GAGJ 1X19A 1F4KA 1V4RA 4UVBA 2CV2A 4PDKA 2OC6A 4PFPA 3CJQB 4HNTA 3AG3H 1YJWI 3V7RA 1JI8A 3JRHA 1FSEA 1NG6A 3S2WA 2UUZA 2M0MA 4YRVA 2M3AA 3SDBA 4M72A 2MA3A 2CU7A 1W7PB 4NQWA 3PSIA 1ON1A 3BZKA 3ELKA 1SD7A 1XX5A 3H5AA 3QYFA 3CMEI 5C4XJ 4A0XA 5M3MJ 2LH9A 1HQCA 4F93B 3FKJA 2A6TA 2E5NA 4BKXA 4QPQA 1UFMA 4I01A 1MH4A 3QU3A 2JVGA 3QP5A 2L9SA 4LIVA 2DFHA 5E18F 4AIDA 2WAEA 4ESFA 3MZHA 5FRNA 1OFCX 2FBHA 2NOJB 3FX3A 4BJTA 1AWCA 2ID3A 3A4CA 2LBFB 1ETVA 3G4SI 1X4PA 3DLLF 3RPUD 4KDPA 2R5YA 2CUZA 3E6MA 2YX4A 1A36A 4PK4A 2MFZA 2K4BA 2ESHA 3LQQA 1JGSA 1KZHA 4LGWA 1J75A 1T6SA 2KIMA 4IX7A 3PNTA 1FIPA 5GTHC 1JXSA 1POGA 1IRGA 1ZTRA 4I7HA 2V9KA 3CCEI 4X6AJ 1ENHA 3FXOA 3KE2A 4LK1F 4XRFA 3HJEA 5HODA 1YW7A 3CCMI 4LG3A 5F08A 3F8FA 5TJJA 2BW3B 2O61A 1IF1A 2HQ5A 2GWRA 3CTAA 5ILVA 2CUEA 2W57A 2BEOA 5F64A 4JP0A 3OYAA 3E6CC 5E1WA 5FLXZ 1PJRA 2NVXJ 2FE3A 4BHPA 1BA5A 1IW7F 3HKZA 1P4XA 4CSWA 1J59A 5DYMA 2QA4I 4J19A 2IS1A 3WTVC 2A3SA 2EZKA 3BZ6A 5GTIC 3HOWJ 2HI3A 1WHUA 3ULQB 3TL4X 2GLOA 3OL3A 3I64A 1MKMA 4RS8A 3OYLA 1R9TJ 2IXSA 1Y1VJ 1LQ1A 4GYIA 3E1SA 2W24A 3QP6A 4UXNA 2F4OB 5GADJ 2KIUA 2R5ZB 3LOCA 3ZP5A 1VTNC 4RAGA 4RGXA 1YX3A 2QQAA 5EZHA 2GQQA 2Y0MA 1J0RA 3V7SA 2DOAA 1VQPI 3ABTA 1SFKA 2A6HF 4NUBA 4IOAF 2WV1A 1G3WA 4EM2A 3LMMA 4JOMA 1F5TA 2PMHA 1QVUA 3CJTB 1DPUA 4G94A 3WTXC 1G4DA 4E7ZA 3M1CA 1TL8A 1A31A 4HPQA 3PIOF 3KIOA 2XKOA 1FYKA 3DWLE 4KT6A 3HEFA 4LG0A 4XR6A 5J6XA 3WTZA 2JA5J 1TC3C 2HQAA 5TRDA 3TO6A 2HVRA 4CYDA 1X58A 1WJCA 4XMYA 4BXUA 1ZG1A 2EV6A 1K6YA 3GFLA 2ID6A 1ZG5A 4G12A 3KYCB 3RYRA 3GW2A 2EZHA 2ME6A 5FRMA 4RM2A 2FXAA 2XKPA 5J1RA 1YFHA 2WB1A 4E7IA 3HSEA 4M3GA 3NQOA 1IO2A 4RAZA 2X0LA 1BJZA 3P7NA 1NG7A 4Y33A 2E1MB 3FM3A 3OV8A 2V6CA 5D5UB 2Z16A 4I6ZA 3F6VA 5KHDA 1LFBA 3MD2A 3E0JB 1R6RA 1Y0UA 5FROA 5IP9J 2LP0A 4XOTA 1AKHB 3KEYA 2E1CA 1H9TA 3FF5A 4LK0F 4M9XA 5KCMA 5J8CA 5EF6A 3MZYA 1FLIA 2XVCA 4KA4A 2ZSIB 2EH3A 3M1EA 2H6CA 4AM3A 1YG2A 4B48A 2HPMA 3RKYA 3ESWB 4HX8A 2OQGA 1TNSA 3RPQA 1USTA 1YOVB 2VQGA 2ICWG 3JTGA 2MC4A 1XSXA 2L7FP 3VB2A 4PSWA 3BJAA 1JKOC 4B8XA 1X1AA 1HC8A 4U0WA 3GO5A 2WAQA 3KP2A 4BL0B 2P7CB 2VE9A 2DJIA 2Z5UA 5EEAA 1PP7U 2JK3A 5CVVA 2PFBA 3SFZA 3X2QH 3VYUB 2CUFA 3GCMA 1WPKA 3CESA 3DQVC 2RQPA 4JBAA 2QQBA 1IN6A 2HTSA 4QWQA 4CUGA 2RN7A 2K85A 4C2TA 3V4GA 1OISA 2L9VA 3OYDA 4ZC3A 4YEJA 1O7FA 1VQ9I 3P9IA 3BWGA 3WG7H 2R5YB 3FDYA 3C7JA 1YJNI 3OYGA 4YFKF 2RV8A 4N0BA 5AIQA 3KEQA 3QYEA 5HVQC 1ZYRF 4YIRX 2B0LA 2MD0A 4JX6A 5BQTA 2OTJI 1MNEA 3ZQ7A 1FZPB 1WJEA 2E71A 3JSOA 3HOYJ 4GDFA 1Z91A 4EVIA 5F04A 1I6XA 1UJ8A 4AVPA 3B6CA 1Z0XA 4FX0A 2GBYA 4Q4ZF 3BG9A 3CLQA 4XRSG 1Z3XA 1D1AA 3DV8A 3PUBA 3WGGA 5KNLA 1VQKI 2MW8A 1BM9A 5HS8A 1P2FA 1C0WA 1QPMA 2H94A 4XSXF 4DBRA 4BE2A 4MEYF 3T8RA 3RCOA 3BY6A 1IUFA 2KRHA 3OOPA 4G7ZF 2IAIA 2DBBA 2R7RA 2IGKA 1K78A 3ECHA 1TTYA 3V7CA 1GV2A 5EGOB 2NAZA 4B44A 1U9NA 1MSFC 1R1VA 2XRLA 3DPTA 3HSRA 3EYIA 6PAXA 3GUDA 4MLOA 2STWA 4A6DA 2VJ5A 4NHJA 3WODF 3MVPA 3ZCOA 4H4KC 2XPWA 4XN0A 2R7UA 2DPDA 4NC8A 4HA8A 2NNYA 4XNFA 4PSXA 4PJMA 2IPQX 1DU6A 1TZLA 3CLOA 3TGNA 2WTEA 2L7MP 2Y69H 2W82A 5IOYA 5E1XA 4RM3A 1MZBA 2FBIA 2JRMA 3OYKA 3F21A 1ULYA 3AL0B 2Y75A 2LLKA 4BGDA 1OCPA 2WBMA 4QTRA 4RA2A 1HSTA 1P4AA 2ZFUA 2YSRA 3JCUC 4B4CA 1Y39A 1XPXA 1PDNC 4OIQF 3HC7A 3HRUA 4ZTFA 2IGOA 4XIDA 2HVQA 2D45A 5LHGA 1UHSA 2FF4A 2VBXA 3JRIA 2K9NA 5L3GA 3S93A 5JHFA 3I56I 2XRNA 2MBFA 2DDBA 3GFMA 4LIUA 5JLXA 2R7FA 1RESA 1WJ5A 2HKOA 3K4LA 1E3HA 3S1QJ 1R4MB 5ICFA 3ZMSA 2VQLA 2EFNA 1FNNA 1T0FA 1LFPA 1HA8A 5EGOA 4P96A 5LBQA 3ZRGA 3HL2A 4RB1A 4B43A 4GYGA 4LLLA 4R8HA 2VL8A 1WKMA 4A5MA 2LK2A 3TEDA 1L3LA 3FBIB 3FXLA 1Z6RA 2OZUA 4K2EA 2ZXHA 1LB2A 4HOBA 2CQNA 3P9KA 3TDUC 4EM0B 4KFCA 1STZA 1FC3A 1Z7LA 1H8AC 3H9GA 3MKWB 2M5WA 2X85A 2K02A 5K7ZA 5H2FC 5BOXA 1RR8C 2CQKA 1KQ9A 1YW9A 2OJED 4J00A 3JRDA 5B5EC 1BR4A 1UCRA 5AIPA 1TWGJ 3OL4A 4XL9A 3CCSI 2V6EA 3ZPLA 3TP0A 1V5EA 3CC4I 2L3DA 3DEWA 2Z2SB 2OA4A 4EGZA 3TOBA 4IQJA 3KX2A 5J47A 1XD7A 2QZ8A 1OR7A 2V7FA 4M9ZA 4O5VA 4DNCA 1OLTA 3HSFA 3GZNB 1DGWY 2I8DA 3A03A 3J7YJ 2H6BA 4D7MA 4UV9A 1X2MA 2XPUA 4ZH4F 4NNJA 4YELA 3Q0WA 2V9PA 3ERED 4PGHA 3OOUA 1FYMA 1W1WE 1V3FA 1ZGWA 5GAHJ 3I4PA 1UG2A 2DA5A 1JT0A 3M7GA 1H88C 3EDPA 1XGNA 2L2OA 3JREA 4HX7A 1ZGAA 1EF4A 1X1PA 2CWEA 4X1EA 2AQFA 5FO5A 1RKTA 3UKGA 2ZJPF 2HPIA 4ENMA 1SEUA 4P55A 3WTUC 1MJBA 3CCJI 1BJAA 5LLQA 1MDMA 3K4KA 1NTCA 1I50J 5IP7J 5LHIA 1SANA 4U0YA 3DF8A 3R6SA 1FOXA 3GVAA 4KUMA 4P9UA 3AG4H 3GX4X 5EJCA 1P7JA 2FUG2 4A5NA 4G7HF 1GLNA 1LE8A 4N4OB 3DCFA 3OSGA 4XKCA 1AHDP 4BJ5C 4QPOA 4U87A 2M0CA 4F52A 3N97A 4LMYA 2R7ZJ 1TWAJ 2R7OA 1XN7A 4RGSA 1B72A 1R36A 2RNJA 3FXUA 3QAHA 4KJZA 1Z7UA 2HNHA 4L0YB 1EKEA 2AXLA 1MW7A 2IP2A 2EBIA 5DDGA 2XAJA 3HHHA 2FJ1A 1U2WA 3F8NA 1QZZA 5FD5A 3W6VA 2ZCWA 4A93J 3FZVA 4ENKA 2BXZA 3F72A 5LEKA 3GYHX 3DXJF 1AKHA 5DV5A 4BDZA 4CCKA 1S7AA 1K7AA 3HPGA 5ICGA 2AHQA 1JTYA 4IZZA 2ME0A 2LBFA 4A2UA 4BE1A 2QKMB 4FISA 2Y30A 1HDDC 1VFCA 4XRMA 4ENJA 4R1HA 4XKVA 1AU7A 3SXYA 4XLPF 3C1DA 5KAIC 3KYDB 4L18B 4BACA 4MTDA 2F48A 2LDUA 2XDVA 2XPVA 2PBIA 4XSZF 1YIOA 4XM3A 2AS5F 4LJZF 4UUTA 2KPMA 4GCVA 3HOSA 2P8TA 1S7EA 4XQFA 2VBWA 3FM5A 3H9JA 2LNBA 3ABLH 4L9TA 1Z77A 5DM6F 4KT5C 3I4MJ 5LHHA 3CF2A 3N4MA 2EK5A 1P9QC 3DBRB 2ECCA 2ZMEA 2Z33A 3VPRA 1WVRA 1YE9A 1XGMA 3WGHA 3OIQA 3M3YJ 2HOAA 4S04A 1YO5C 2F4MB 2LSOA 4UB6C 3I53A 2VONA 2E36A 3BDDA 2O7OA 3S32A 1R23A 1R00A 2CFXA 2HYGD 4E70A 1BR2A 5HLHA 3HBLA 1LFUP 3FHNA 3KLNA 4UY8I 3HRMA 2W00A 1W5SA 2DCEA 2K7LA 1F36A 4G7OF 3LA7A 1TQMA 3WG9A 4AWXB 2ZXWH 3OYBA 3ZQCA 3IV5A 4A12A 2A5WA 3BR6A 2DOEA 3DEEA 1IXCA 5GP9A 1AOYA 4M9SA 2XF5A 1X2NA 2R7VA 1J2XA 1QHGA 2E34A 1Q1HA 2P81A 2GXBA 1FTTA 4IRGA 2KJBA 1SAUA 3IKVA 2ELJA 2ZJRF 4NBQA 3WE2A 1ZRFA 2MABA 1PUEE 2ZJQF 1N77A 2M1BA 1MJAA 3GEZA 4IJAA 3S3MA 2F5CA 2FNAA 5CVIA 1VNDA 2UZKA 3HOZJ 3GBGA 1DU0A 1OJLA 3K2ZA 5JVGF 2ZFWA 2GXGA 1HKQA 4DQ2A 1LNWA 4M3BA 2D1HA 2EIMH 2BE5F 4KN7X 1QPIA 1LJ9A 1WGXA 3V42A 4UHTA 2VN2A 3OR1C 3E5XA 2KDOA 2VT3A 3CUQB 1P4WA 2L7ZA 4IQ4A 4L5IA 1DUXC 1EJ9A 4EJTA 1T56A 2HGCA 2COMA 2V79A 3WTTC 2K3FA 1J7KA 1QA6A 3HG9A 4W97A 2KJCA 4XICA 1S72I 2CUJA 1ZN2A 3FBNB 4UUSA 2XROA 4WCGA 4YFNF 5H6QA 1VQ6I 3R0JA 5LD2C 4HV6A 3RQ4A 2LD5A 1Y8QB 5EEGA 1E17A 3I4NJ 2PEXA 5FKMA 5GPCA 1RC9A 4RB3C 2DMTA 4MQVA 2KMUA 5F0HA 3OY9A 1IJWC 4U88A 3KZIC 4P9FA 3GTQJ 3IAS2 2NVUB 5FLMJ 1E3PA 2KP6A 4Z2YA 5TGTA 2QBYB 5IYBJ 2JT1A 3F8CA 3HRSA 2ZMEB 3BR5A 1T33A 4YIIA 4I99C 3TO9A 2V1UA 3HDDA 2HEOA 4A3KJ 3WU1B 2KIQA 4GRIA 5KAFC 2X4HA 4ZYDA 1VQMI 4LB5A 5LEJA 2NOGA 5J1YA 4L9NA 3K1MA 5DTDA 1Q1VA 1LUJB 2MD5A 2M4GA 1BOAA 4E7JA 2JQ7A 2CFOA 3B02A 3HIFA 3NWSA 3F6OA 1FP2A 3K1PA 1WJAA 4MGRA 3S1NJ 2NS8A 4A3GJ 1Z21A 2Y9YA 1B4AA 3ABKH 4EQQA 3CZ6A 2KRFA 3FK7A 2VKHA 1QHHD 3FHZA 2Q8KA 2XGEA 1IRXA 3IWFA 3DBLB 1Z9CA 1VQ4I 4B1RA 5GAEJ 5JHUA 3FXJA 3QU6A 3GTGJ 4BQAA 2JN6A 2EINH 1ZK8A 2R93J 3DKYA 2RNGA 5HS9A 1R49A 2O03A 1WJDA 1U8RA 4KMFA 1YS7A 3AG1H 2E2JJ 3PQJA 4AUXA 5FJ8J 4L5JA 3OIPA 4NB5A 1SAXA 2CS3A 1QU3A 2OQRA 1MMNA 4DYRA 5E17F 1TQIA 1YITI 5D6FA 3W2WA 5L3EA 2A6EF 2KHMA 2VODA 3OYEA 2XGXA 1QVTA 1RZ4A 4EJWA 3RYPA 2V4JC 3V8KA 4G9YA 3CO7C 2M4KA 1Z3YA 2X51A 3BTCA 3GWZA 4W1UA 2KT0A 2VIXA 3BPXA 2XF6A 2XASA 3GTPJ 5D5WB 4BYYA 1H89C 1F1ZA 2LY2A 1P92A 1REPC 4BEHB 2XV4S 1ETXA 2LY1A 1V55H 3G2BA 2WADA 2M30A 3LFUA 2LOOA 3UNGC 3U2RA 3SHFA 3DP7A 3OYNA 1JT6A 2IBDA 2LKXA 2O3FA 5EYRA 5ILSA 3ABMH 1U0JA 3TW6A 4BAYA 4E6KG 3BG7A 4E7SA 5HOOA 3L1PA 1RR7A 4AU7A 3RI4A 1H9GA 1D8JA 2VKVA 1ERDA 2I10A 5DCMB 3HRTA 4IRHA 1KU3A 2W84A 3ZQIA 4YG2F 1D0ZA 2QENA 1O3TA 1M1EB 3PSFA 4ZYHA 1B8IB 4HLXA 1DGRM 2BBYA 1JE8A 2VXDA 5E3LA 2IEKA 2IW5A 4ZDPA 4ZYAA 3OYCA 3S1RJ 3KP3A 2OAZA 4CCJA 1CF7A 2OPTA 2PMZN 5CVUA 4M73A 3A01A 5D5XB 3SZPA 5JR3A 4WK8F 3L2CA 3GZ6A 2DDAA 1A6IA 3LA2A 3BROA 4I09A 3RKXA 4IHXA 3OYJA 1KU7A 1RETA 3BJOA 1UMQA 1I5ZA 4D5FA 1ZRDA 3OYHA 3LSMA 3Q0VA 2DT6A 3CP8A 1SFEA 3HM5A 3R61A 4HYEA 3LSTA 3FXRA 4MO7A 4P1WA 5FLVA 1LDDA 2HXOA 1SC7A 2DA6A 4IXAA 5DUKA 2NXNB 4A6EA 4CCLA 2FEZA 2LKPA 4XRSA 4FCYA 4EEFG 1T0FC 3CC7I 1I27A 5J1UA 3SJMA 3S15J 2CRGA 1QNTA 1XMXA 5D8KB 2A05A 3BTLA 3NARA 1WH5A 2OCEA 3BR3A 3LSIA 2BHYA 2ZSHB 2K9QA 2RGVA 4Z6YA 1G8XA 3KFWX 1ZRCA 1BR1A 1H0MA 1ZR4A 3L09A 2M87A 5E3NA 3J81K 2QF7A 1XC5A 5E8GA 2VBZA 5DCMA 4RLQA 2L9RA 3RDIA 1I6HJ 3PQKA 3ZQHA 1YW8A 2R3SA 1D5VA 1J9IA 3PFIA 1I1GA 4ASNA 5CQEA 3RJPA 2FQ4A 3ECOA 3K10A 1OCTC 1S8NA 3VSKA 3K4NA 3MAJA 3VODA 2R7SA 4OAZA 1F9NA 4GGGA 2XSJC 3I5UA 1OCRH 1D1CA 2YR2A 4M6XA 3G1OA 2IS2A 2Y0SA 4C9YA 3J81Z 2VASA 3O3KA 4C30A 2DODA 4E7HA 2PG4A 1Z67A 1BOBA 1JJ8C 3ZMDA 3MWMA 5FGMA 5HS7A 3PIPF 4HAMA 2DYSH 2L9NA 3Q3SA 2PX9A 3BCBA 1IAWA 2LF7A 4CDGA 2HDDA 1FMVA 2R0QC 4EJVA 5IT9K 2DA3A 4G6QA 4IRIA 1FPQA 3MCZA 5B3SH 4BE0A 5J8FA 1S29A 3BP8A 1IN4A 1BI2A 4DOZA 3MN2A 3CDLA 3LQRA 3JAMZ 1JKRC 3IH3A 4HF2A 3ZQGA 1LKXA 3NAUA 1R5HA 2WC2A 2VUMJ 5C44J 2KL4A 2C6YA 2DA7A 3PL8A 4I02A 2M2EA 1TBXA 5HLGA 3ZMTA 4AYBA 3HUGA 3TQNA 2AQEA 2JRTA 3OWTA 5F1RA 1ONVA 4IHYA 5CVRA 3D5SC 1KYZA 1LDJA 2P5VA 3OYIA 3CCLI 3L9FA 1ZG3A 1Y8RB 3KPHA 2VXZA 3G73A 4XLHA 4BBRJ 3MQ0A 1JJ6C 2WA0A 2GA2A 4A0YA 1I39A 3M8EA 4XLFA 1DPRA 4EGYA 2LVSA 1WZ2A 4CCMA 1KONA 4FQGA 3A2KA 2L4AA 1TQPA 3EUHA 1G3SA 3E6DA 5HLTA 2GZWA 4WXDA 3PUFA 1HOMA 5J3LA 1A35A 2YPRA 1VF9A 4QLCU 4BXXJ 2ELKA 2L4MA 2X1CA 4U0VA 1S6LA 1OKRA 4HX4A 4KIBA 1HW1A 3C2GA 3JTHA 2ETHA 2QSGX 2LF8A 3HOVJ 2M8GX 3EUAA 4M3EA 1R58A 2F5VA 2CW8A 5IPAA 1V5GA 2TRTA 1FBUA 2VC0A 2YU3A 3GTJJ 2UXNA 1T38A 2OD5A 1HLVA 2BYVE 1FT9A 3W6JB 1E0EA 4F91B 1YRNB 1SFOJ 1TP4A 4UUSB 3MKZA 2KKOA 3PJRA 1UG0A 5K5QA 1FSHA 3A02A 4N9IA 2VJ4A 1MBGA 1MBEA 4LFUA 2DFFA 1WRJA 4OMZA 3VSLA 3J7ZI 3OYMA 4UNOA 4LITA 2K9SA 1N25A 3JRBA 4HDUA 2LR8A 3S1MJ 5CLSA 1CQTA 5L3BA 1XCBA 3PFYA 3TO7A 2XHKA 1MH3A 4PJ0C 3OR2C 3K69A 2L0KA 3RPUA 1SD6A 4GFBA 2K3PA 2LRDA 4RGUA 1OCZH 4II2A 4Y3OA 3C3WA 3O8HA 4BU2A 3BZCA 2DT5A 2PN6A 3J80Z 2B63J 4M3DA 1W36C 4G6TB 2E1NA 1SVOA 3H3VK 3D5RC 4KMUX 5TISC 4CYCA 3DTIA 1BW6A 3BPVA 2LC2A 5HLIA 1NHAA 1TWHJ 3LWFA 1X1DA 4HNUA 4Y17A 2RKHA 3CC2I 2VPLA 1DP3A 2F6CA 1R7JA 1W5CC 3BR0A 4F92B 5DS9A 2VLAA 2VC1A 2STTA 1XMKA 1SMYF 4G8XA 2XGDA 1ZGJA 3F0CA 1BBYA 4Q48A 2QM3A 2IRFG 1U78A 4O6JA 2FNPA 4PGGA 3GFJA 3E6BA 3LSJA 4CICA 2BZTA 2K86A 4YIFA 2IT0A 3CDIA 3V8JA 2DK5A 1I1SA 1SD5A 2ADUA 3CJNA 2F4IA 4WX9A 4A3IJ 5CKTA 2I5UA 2DTRA 3A0BC 3FK6A 2OCCH 2R7QA 2COBA 3MZ8A 4CZZA 1IRZA 1S3JA 2MLGA 2PMUA 1FOYA 1MGTA 1NK2P 2V26A 2HQNA 1W0UA 1USSA 5M5YJ 1BL0A 2GM4A 1OYIA 2O8XA 1QGPA 5M5WJ 1HKTA 4II3A 1OCCH 5HDGA 3QOEA 2IA0A 4D5CA 2E7WA 1Y1WJ 1MMAA 5A2QZ 2HWVA 4PUSA 4LB6B 1T2KA 1S9HA 4D1QA 3ZMUA 3LAPA 1OMIA 1IN5A 1QO0D 4XLEA 1KU9A 3FIWA 2MG4A 2KFDA 1EH7A 2NNNA 5JFRA 4BS9A 2RAEA 3I58A 4L0ZB 1RI7A 3I59A 2HOTA 3L2VA 4Y15A 4OU0A 3VYTB 4CZCA 2GXAA 4DYCA 3DFGA 2FU4A 1FBQA 1W5TA 1G2HA 4G6DA 1O3QA 4UVAA 1PUFA 1XB4A 1G6NA 2EJRA 2E35A 3WU2C 5A2QK 3CD6I 1FIAA 5K5OA 2VJIA 2M9HA 2UXXA 1QRYA 4EM1A 1IXRC 3QPLA 1BIBA 1MBKA 2HYJA 2K40A 3IL2A 1ZHFA 3S17J 4ANJA 1LVKA 2JA7J 1IZ1A 2D2WA 3NWTA 1VQOI 2GIVA 1ZARA 3I55I 5GPAA 4LG0B 2TCTA 5C4JJ 4D0PA 1N75A 1HDPA 4XLAA 1ETQA 1DDNA 2XIGA 4RAFA 3IH2A 2X9DA 4MFEA 3MKYB 4N4NB 3H0GJ 1UB9A 1EH8A 1UHMA 2DAOA 3F3XA 2GOMA 1HCRA 3BCAA 1A6QA 4A3MJ 4RB0A 2HS5A 2Q0OA 3IRRA 4B09A 1B72B 1RUOA 1JKQC 1F43A 2EIKH 3TOAA 1VQNI 2EV0A 1W4MA 2EZLA 2H8RA 3O8GA 1IXSB 3W6KB 1ZKGA 2NVQJ 1IC8A 1XGSA 3FISA 4M6VA 4HDVA 2FD5A 2QYOA 2KDZA 1A04A 2R7XA 4P5OA 3C18A 4A69C 2QGUA 3LL7A 3TMOA 2L54A 4HG2A 4FE7A 2FQ3A 4AIHA 1O3SA 1VQLI 3HOUJ 1BI3A 3OIOA 2ELHA 4HSTA 4MTEA 1J09A 4AD9A 2CJJA 4FASD 1OYWA 1YTYA 2HTJA 3F23A 2MYSA 2CV0A 3L2RA 4PJJA 2QEXI 3QPHA 2Y2ZA 3IH4A 2VI6A 3S8PA 3GZ5A 3S14J 4NDLA 1XTAA 4XLNF 4OIOF 3CCYA 1QZEA 3NRVA 2ZJ2A 3Q0UA 4UVCA 3SZGA 5L3CA 5FKNA 3H5RA 4IL6C 2Y48A 3LA3A 3KZZA 1TWFJ 3CDHA 5D5VB 4HSRA 3AG2H 3QYBA 4EJUA 5K5RA 3QODA 3RKQA 3RSNA 4RGRA 2DXIA 1IDYA 2EILH 2RC4A 2CV1A 4OINF 3H36A 3TP3A 3TBIA 1JUMA 3N05A 4IHWA 2L01A 2Y31A 3A0HC 1K4TA 1W7PD 4HF0A 2IGNA 3CQZJ 4IF4A 4RBOA 1SMTA 4LLGF 5L3FA 3FXMA 3IUOA 1KU2A 3FMRA 4CCNA 5EZGA 1BC7C 2AO9A 3G6EI 1R4NB 5CPRB 3KCCA 5F1JA 2DW4A 5L3DA 1IGNA 2QSHX 4IO9F 4RDUA 3UR3C 3H9QA 1G59A 1A5JA 3WTSC 2BHZA 5BMZA 2DT7B 3ML6A 2CSOA 4Q47A 3JR9A 1T08B 3B73A 2DMNA 3C2HA 4UV8A 1RNLA 1U5TA 3AKZA 1X3ZB 3K6GA 4A3FJ 2PJPA 1GVDA 2RDPA 2DMUA 1KA8A 4ZYGA 3WTWC 2E1OA 4DW6A 2EWNA 2Z99A 2D1VA 1K6OA 1ETOA 2EFQA 2W4SA 2X6OA 3BQZA 3Q9VA 4A3CJ 2AXTC 3FMSA 3ZOBA 1E3OC 4BJ6C 2WY8Q 2VJJA 2ZC2A 3K4JA 3M8FA 1JHFA 2W48A 1RKWA 5BS6A 2CQXA 1FYLA 1TWCJ 1YQAA 2GA1A 2DI3A 5J40A 2K5CA 1LDKB 2ISYA 4KISA 2BY3A 4S05A 2EFOA 1GDTA 2W25A 3CP2A 3U1KA 1ON2A 2O8KA 1ZH5A 1FBSA 3FMQA 1B9MA 1MNDA 3LAJA 4MHGA 2E2HJ 4WXCA 2A61A 2FA5A 2WAQN 4XORA 2Q2EB 4XBFA 5AONA 2E1MC 3W2VA 1W7PA 3LSKA 4XONA 3BG6A 1GVJA 1RUNA 1U9OA 2RREA 5DUIA 1WCMJ 2CGPA 3KP6A 1G3YA 4ZZDA 3L2QA 2EPFA 2RQQA 4MIMA 2QBYA 3BTJA 4IVNA 1UZCA 2V9VA 1B1BA 2EQRA 3ASNH 2J5OA 2EA4A 2ZB9A 5ILUA 3OMYA 1WJBA 2H09A 3U1DA 2BVMA 4ZTJA 3BJ6A 2TDXA 1P7IA 1J5YA 2VKEA 4BY1J 3T0YA 1FEXA 4WF2A 2JPCA 4HV5A 4I76A 5F0FA 3BG3A 2DYRH 1WI9A 1T39A 3B6AA 3EUKL 1K83J 4BQQA 2ECBA 2EB7A 2N8GA 1OCOH 3H0DA 3G1LA 1P6RA 1E2XA 2BGCA 3IP4B 3KP7A 4ZYEA 1R22A 1YHQI 4PZJA 3KETA 1SFUA 2IGMA 3U9GA 3FXQA 3J7AY 5E79C 4JK1X 5B66C 1HW5A 5HDKA 5D8LB 4IEJA 2ZBKA 2F2EA 1T8IA 3EUHC 1WWXA 3LSRA 1HSJA 1Z6TA 2P0WA 3I9V2 2FRHA 4I0BA 1XDSA 3BR2A 4DIQA 4A3EJ 2M7AA 2EIJH 2IVMA 2VKDA 2XAFA 2PJRB 4BNCA 2BY2A 5FFXA 2WWYA 1SVLA 4QSHA 1UAAA 5IT3A 2LTPA 2PJRA 3IRQA 4M74A 2ZKZA 2W85A 1U5TC 4ESBA 3QWLA 2QSFX 3MFKA 2EFPA 3T5XA 1QZYA 1GUUA 3AFHA 1D8KA 1FWZA 4HLYA 4ZDLA 2LYCA 3FKIJ 2JJ7A 3GXOA 4DZPA 2XGCA 1JKPC 2R7WA 3RZDJ 5IYCJ 2XC7A 4QIWN 3AL0C 1GHCA 4DGWB 2DN0A 2M45A 4BH9A 1K79A 1W0TA 3R4KA 1IUYA 1DP7P 3GLLA 2DA4A 2YX7A 4OIRF 4EMSA 4LOCA 5K7HA 3BG5A 3FXKA 2NS7A 5BNGA 1ITYA 5ICCA 3D0SA 5KVRA 1JUSA 2DTZA 2PQ8A 4L9VA 4U7DA 2VQHA 5JVTA 4I98B 2W7NA 1VQ5I 4ON0A 4PFOA 1SFXA 2X48A 3RTRA 1HKSA 4EJOA 4YFXF 3SZTA 1X4OA 2X6WA 3NEUA 3D5LA 2F5EA 1PVEA 3JRAA 3CUQC 1FMWA 4RAYA 2DPUA 2CW0F 2VBYA 5IYDJ 2WV0A 4CA0A 2KIFA 3BQYA 3DKXA 2GIZA 2DA2A 4PCQA 4H0EA 3KLOA 1QQIA 1MMDA 1ZQ3P 3ROUA 4I2OA 4IHTA 4AIJA 2HOEA 2IJLA 1Z05A 2RVCA 3H35A 2FSWA 1TW2A 1BIAA 3DKWA 5ERIA 1FJLA 1IDZA 3TKYA 2ZO4A 4HQEA 3LSHA 2A07F 2OUMA 1YRNA 1TNTA 2CMPA 2CQQA 1OYYA 3EETA 4X0GA 2QQ9A 3F9KA 5HNHA 3VWBA 2O0YA 3PO2J 1O7LA 5LRRA 4BQOA 2CW7A 3SQNA 2VE8A 4BQNA 4L9JA 4NC7A 2JZYA 2JSPA 2WB1N 2DOFA 4ENNA 3I59B 1FX7A 2ESNA 2Q2EA 3QPSA 4OOIA 5LRSA 1WJFA 1XS9A 1S7OA 4Y7NJ 3I3LA 4XKBA 5FKKA 3MMYB 3HHGA 3EPZA 3LSGA 2JTVA 4ITVA 3G71I 3WE3A 2F5FA 2O5RA 1D1BA 2H27A 4Q5SF 2J5PA 3CF5F 2PI0A 2QLZA 4OWRB 2PMZA 3OS1A 2KRCA 3WHCA 1IRFA 1HF0A 1L0OC 2O6GE 5IT9Z 1OPCA 5JLWA 2E5ZA 4DZJA 1ACIA 4OIPF 1ETKA 2HFHA 4F55A 2MLKA 4HW0A 3RZOJ 2V1DA 3ZQLA 3CCVI 2QWWA 3HPHA 2A68F 4XOPA 3VDXA 2BOLA 2HOSA 1FTZA 5BPIA 5K7FA 1OR7C 3DEUA 1U3EM 4RLFA 2M8EA 1WSUA 1SVMA 5FD6A 2L02A 2DK8A 1EH6A 1FY7A 3COAC 2ZXIA 4CGZA 4C3HJ 1SD4A 2YUSA 4I0AA 3ZR8X 5ICEA 1UELB 3HOXJ 2JA8J 5DEQA 4IHVA 3K7AJ 3RQIA 3PM1A 3RKWA 1FOKA 4NC6A 4M6YA 2MGQA 5FFZA 2NVTJ 3HB9A 2DO7A
chains in the Genus database with same CATH topology
1BC8C 3F8MA 3KZYA 1CF7B 1XCVA 3K1NA 1KQ8A 3R60A 4ZZLA 5E20A 3HTSB 1YLFA 2MC3A 1LVAA 1MD0A 2F5DA 2Z3YA 3FWEA 4UUVA 1B9NA 3WU0A 5E1ZB 1IN8A 4HZFA 4IPAA 3H3UA 1XMAA 2NS0A 1IN7A 1ZREA 2DFIA 2FBKA 5K1YA 3J7AO 1U5TB 3BOQA 2K27A 1QBJA 2P6SA 2E7XA 5DD8A 3AAFA 4AIKA 2ISZA 1CGPA 3QOPA 3T1BA 2A5YB 1TW3A 2DU9A 5ED4A 5LGTA 5LGUA 4U7BA 3EQLF 4R79A 4GO1A 1KQ0A 3E5QA 4KIGA 2ZXJA 4BHBA 2FOKA 3P9CA 4KICA 4KYWA 4MEXF 3GLXA 1RIOH 1ODDA 2VOPA 3IKTA 4MNUA 5EEHA 3IC7A 1XDUA 2A69F 3GF2A 3T8TA 1ZAOA 1LEAA 3F22A 3KEOA 2JSCA 2FMYA 1HW2A 2P6TA 3V8LA 1TLHB 1KGSA 2UWMA 5DD4A 1MDMB 3O2PE 1FP1D 2ACJA 2P7VB 2XAQA 5KK1A 2G7UA 2IA2A 3E97A 2P4WA 3ISPA 3HYIA 1B6AA 2JPBA 4WWCA 1GXPA 4WXHA 3ZN0A 1D3YA 1XGOA 3Q9SA 4O3MA 2G7HA 5LGNA 3VOEA 3QRFF 4CXFA 2NRAC 1R5GA 4ESJA 3WTYC 2G9WA 3KP5A 2EV5A 1BI0A 2HQRA 2HKXA 3ZN1A 2OU2A 2V1XA 2ZNYA 5CYVA 2CYYA 3ABUA 1KYWA 2DQLA 4F7ZA 2MH2A 3L00A 4KIFA 3JAMK 3K9TA 1ZLJA 3TDZC 1Z1DA 3I71A 1O57A 2ZNZA 4KN4X 5DCFA 3DPLC 1YS6A 1BN5A 1HBXG 5HDNA 4FT8A 3K0LA 1YYVA 2XUBA 3O6BB 5BPDA 2P5KA 5JI6A 4KNYA 4FX4A 1MJ9A 1U6GA 4EV0A 2P5LC 5F6FA 1B59A 4GXOA 3REOA 5H20A 1R1UA 4JQFA 1ZLKA 3F8BA 1GXQA 5CJ9A 2OBPA 3ZMZA 4ETSA 2NYXA 1K78B 1UHWA 3J80K 4N9HA 2FMLA 2HYFA 1PP8F 4MQ9F 2HR3A 3E5UA 2MH9A 3RIRA 4BHCA 2K4JA 3Q5FA 4A0ZA 2BV6A 2GAUA 1G3TA 2IA1A 4RB2C 3LFKA 2HZTA 2HDCA 4HBLA 2OZ6A 4TV7A 3R0AA 1EV7A 2QUFA 3VEPA 1XSVA 3ZMVA 5D4SA 3MEXA 4OMYA 3H3ZA 3QPTA 3CUOA 3M9AA 5E8IA 5CVJA 3E3VA 3IWZA 3CUQA 2R7DA 3CO6C 2DLLA 3IHUA 4CO8A 1JHHA 1R1TA 2VOOA 4IHSA 4HF1A 2QVOA 2CO5A 1BI1A 4LLNA 3JW4A 2DQRA 1T98A 4LD5A 3I54A 4CHUA 3HOTA 1HXDA 5D4RA 2VT2A 1O3RA 3KP4A 2CG4A 4M71A 3GFIA 2EA2A 3EYYA 3HTUA 3L7WA 3G3ZA 2XAGA 4Y13A 2EFWA 3I0TA 5D6EA 2PLYA 5H6RA 3VFZA 5FB2A 2Z9OA 4HQMA 3WGIA 5FLXK 3H92A 3JSPA 2XAHA 1XSDA 1X3UA 1WQ2A 1LEBA 4FHTA 1F4KA 1V4RA 4UVBA 4PDKA 3V7RA 1FSEA 3S2WA 4M72A 2MA3A 1W7PB 4NQWA 1ON1A 3ELKA 1SD7A 4A0XA 1HQCA 1UFMA 4I01A 3QU3A 3QP5A 5E18F 4ESFA 3MZHA 2FBHA 3FX3A 1AWCA 4KDPA 3E6MA 2YX4A 2K4BA 2ESHA 3LQQA 1JGSA 4LGWA 1J75A 1T6SA 2KIMA 1JXSA 1IRGA 4I7HA 3KE2A 4LK1F 4XRFA 1YW7A 3F8FA 5TJJA 2O61A 1IF1A 5ILVA 2GWRA 3CTAA 2W57A 2BEOA 5F64A 3E6CC 5E1WA 5FLXZ 2FE3A 4BHPA 1IW7F 1P4XA 1J59A 5DYMA 3WTVC 2A3SA 3BZ6A 3ULQB 3I64A 1MKMA 4RS8A 1LQ1A 4GYIA 4UXNA 2W24A 3QP6A 2KIUA 3ZP5A 1VTNC 4RGXA 2QQAA 2GQQA 2Y0MA 1J0RA 3V7SA 3ABTA 2A6HF 1G3WA 4EM2A 1F5TA 2PMHA 1DPUA 4G94A 3WTXC 1G4DA 2XKOA 1FYKA 4LG0A 5J6XA 3WTZA 5TRDA 3TO6A 4CYDA 4BXUA 1ZG1A 2EV6A 3GFLA 1ZG5A 3RYRA 3GW2A 2FXAA 2XKPA 1YFHA 3HSEA 3NQOA 4RAZA 2X0LA 3P7NA 3FM3A 3OV8A 2V6CA 5D5UB 3F6VA 1Y0UA 2E1CA 1H9TA 3FF5A 4LK0F 4M9XA 5J8CA 1FLIA 3MZYA 2XVCA 4KA4A 3M1EA 2H6CA 1YG2A 3RKYA 4HX8A 2OQGA 1TNSA 3RPQA 1USTA 3JTGA 1XSXA 3VB2A 3BJAA 4B8XA 4U0WA 3GO5A 3KP2A 2P7CB 2VE9A 2Z5UA 1PP7U 5CVVA 2PFBA 3SFZA 3DQVC 4JBAA 2RQPA 2QQBA 1IN6A 2HTSA 4QWQA 2RN7A 3V4GA 1O7FA 3P9IA 3BWGA 3C7JA 4YFKF 2RV8A 4N0BA 5AIQA 3KEQA 5HVQC 1ZYRF 2B0LA 5BQTA 3ZQ7A 1FZPB 3JSOA 1Z91A 4EVIA 1I6XA 4AVPA 4FX0A 4Q4ZF 3DV8A 3WGGA 1BM9A 5HS8A 1P2FA 1C0WA 1QPMA 2H94A 4XSXF 4MEYF 3T8RA 3BY6A 3OOPA 4G7ZF 2DBBA 1K78A 3ECHA 1TTYA 3V7CA 2NAZA 1R1VA 3DPTA 3HSRA 3EYIA 6PAXA 3GUDA 2STWA 4A6DA 4NHJA 3WODF 2DPDA 4HA8A 2NNYA 2IPQX 3CLOA 3TGNA 2WTEA 5E1XA 1MZBA 2FBIA 3F21A 1ULYA 2Y75A 1PDNC 1HSTA 1P4AA 4OIQF 2YSRA 3HRUA 2D45A 5LHGA 2FF4A 2VBXA 5L3GA 2XRNA 2MBFA 3GFMA 2R7FA 2HKOA 3ZMSA 5ICFA 2EFNA 1FNNA 1T0FA 4P96A 5LBQA 4RB1A 4GYGA 4LLLA 4R8HA 1WKMA 4A5MA 1L3LA 1Z6RA 2OZUA 4K2EA 1LB2A 4HOBA 3P9KA 3TDUC 4EM0B 4KFCA 1STZA 1FC3A 2M5WA 2K02A 5BOXA 2CQKA 1KQ9A 1YW9A 1UCRA 5AIPA 3ZPLA 2L3DA 2OA4A 4EGZA 3TOBA 1XD7A 2QZ8A 1OR7A 4M9ZA 4O5VA 4DNCA 3HSFA 2H6BA 4UV9A 4ZH4F 3ERED 4PGHA 1FYMA 1V3FA 3I4PA 3M7GA 3EDPA 1XGNA 4HX7A 1ZGAA 2CWEA 5FO5A 4ENMA 4P55A 3WTUC 1MJBA 1BJAA 5LLQA 1MDMA 5LHIA 4U0YA 3DF8A 3R6SA 3GVAA 4KUMA 4P9UA 3GX4X 4A5NA 4G7HF 3N97A 4LMYA 1XN7A 4RGSA 1R36A 2RNJA 3FXUA 3QAHA 1Z7UA 4L0YB 2AXLA 2IP2A 5DDGA 2XAJA 3HHHA 5FD5A 1U2WA 1QZZA 3F8NA 2ZCWA 3FZVA 4ENKA 3F72A 5LEKA 3GYHX 3DXJF 5DV5A 1S7AA 1K7AA 5ICGA 4A2UA 4ENJA 4R1HA 3SXYA 4XLPF 3C1DA 4L18B 4MTDA 2LDUA 4XSZF 2PBIA 2AS5F 1YIOA 4LJZF 4GCVA 3HOSA 2P8TA 2VBWA 3FM5A 2LNBA 4L9TA 4KT5C 5LHHA 3N4MA 2EK5A 2ZMEA 2Z33A 1XGMA 3WGHA 4S04A 1YO5C 2LSOA 3I53A 2VONA 3BDDA 1R23A 1R00A 2CFXA 2HYGD 4E70A 5HLHA 3KLNA 3HRMA 1W5SA 2K7LA 4G7OF 3LA7A 1TQMA 3WG9A 4AWXB 4A12A 1IXCA 1AOYA 4M9SA 1J2XA 1Q1HA 2GXBA 4IRGA 2KJBA 3IKVA 3WE2A 1ZRFA 1PUEE 2M1BA 1MJAA 3GEZA 4IJAA 2F5CA 2FNAA 5CVIA 2UZKA 3K2ZA 2ZFWA 2GXGA 1HKQA 4DQ2A 1LNWA 2D1HA 2BE5F 4KN7X 1LJ9A 4UHTA 2VN2A 3E5XA 2VT3A 3CUQB 1P4WA 4L5IA 1DUXC 4EJTA 2HGCA 2COMA 2V79A 3WTTC 1J7KA 2KJCA 2XROA 1ZN2A 4WCGA 4YFNF 5H6QA 3R0JA 4HV6A 5EEGA 1E17A 2PEXA 4RB3C 4MQVA 4U88A 4P9FA 4Z2YA 2QBYB 2JT1A 3F8CA 3HRSA 2ZMEB 4YIIA 2V1UA 3TO9A 2HEOA 3WU1B 2X4HA 4ZYDA 4LB5A 5LEJA 4L9NA 3K1MA 2MD5A 1BOAA 3B02A 3HIFA 3F6OA 1FP2A 3K1PA 4MGRA 1B4AA 4EQQA 2KRFA 3FHZA 2Q8KA 3IWFA 1Z9CA 5JHUA 3QU6A 4BQAA 5HS9A 2O03A 1U8RA 4KMFA 1YS7A 3PQJA 4L5JA 4NB5A 1SAXA 2OQRA 5E17F 1TQIA 5D6FA 5L3EA 2A6EF 2VODA 2XGXA 1RZ4A 4EJWA 3RYPA 3V8KA 4G9YA 3CO7C 3GWZA 3BPXA 2XASA 5D5WB 4BYYA 1F1ZA 1P92A 1REPC 2XV4S 2M30A 3U2RA 3SHFA 3DP7A 2O3FA 5ILSA 4BAYA 5HOOA 3RI4A 1H9GA 1D8JA 5DCMB 3HRTA 4IRHA 1KU3A 2W84A 4YG2F 2QENA 1O3TA 4ZYHA 4HLXA 2BBYA 1JE8A 2IW5A 3KP3A 2OAZA 1CF7A 5CVUA 4M73A 5D5XB 3SZPA 5JR3A 4WK8F 3L2CA 3GZ6A 3LA2A 3BROA 4I09A 3RKXA 1KU7A 3BJOA 1I5ZA 1ZRDA 1SFEA 3R61A 4HYEA 3LSTA 3FXRA 1LDDA 4IXAA 5DUKA 4A6EA 2FEZA 2LKPA 1I27A 1QNTA 5D8KB 2RGVA 3KFWX 1ZRCA 1H0MA 3L09A 2M87A 3J81K 5E8GA 2VBZA 5DCMA 3RDIA 3PQKA 1YW8A 2R3SA 1D5VA 1J9IA 3PFIA 1I1GA 4ASNA 3RJPA 3ECOA 1S8NA 3MAJA 3VODA 1F9NA 4GGGA 3I5UA 2YR2A 4M6XA 3J81Z 3O3KA 2PG4A 3ZMDA 3MWMA 5FGMA 5HS7A 4HAMA 1IAWA 2LF7A 4CDGA 4EJVA 5IT9K 4G6QA 4IRIA 1FPQA 3MCZA 5J8FA 1S29A 3BP8A 1BI2A 1IN4A 3LQRA 3JAMZ 4HF2A 1R5HA 2WC2A 2C6YA 4I02A 1TBXA 5HLGA 3ZMTA 3HUGA 3TQNA 2JRTA 5F1RA 1ONVA 5CVRA 1KYZA 1LDJA 2P5VA 3L9FA 1ZG3A 2VXZA 3G73A 3MQ0A 2GA2A 4A0YA 3M8EA 1DPRA 4EGYA 2L4AA 1TQPA 3EUHA 1G3SA 3E6DA 2GZWA 4WXDA 2YPRA 4QLCU 2L4MA 4U0VA 1S6LA 1OKRA 4HX4A 4KIBA 1HW1A 3JTHA 2ETHA 2LF8A 1R58A 1FBUA 2VC0A 2YU3A 2UXNA 1T38A 2OD5A 2BYVE 1FT9A 3W6JB 2KKOA 5K5QA 1FSHA 4N9IA 4LFUA 1WRJA 4OMZA 4UNOA 4HDUA 5CLSA 5L3BA 1XCBA 3TO7A 2XHKA 3K69A 3RPUA 1SD6A 4RGUA 3C3WA 2DT5A 2PN6A 3J80Z 2E1NA 4KMUX 3BPVA 5HLIA 1NHAA 3LWFA 4Y17A 2RKHA 1R7JA 2STTA 2VC1A 1XMKA 1SMYF 4G8XA 1ZGJA 1BBYA 2IRFG 4Q48A 2QM3A 1U78A 4O6JA 2FNPA 4PGGA 2IT0A 4YIFA 3GFJA 3E6BA 4CICA 2K86A 3V8JA 1I1SA 2DK5A 1SD5A 2ADUA 3CJNA 4WX9A 2DTRA 4CZZA 1S3JA 2MLGA 2PMUA 1MGTA 2HQNA 1USSA 1OYIA 2O8XA 1QGPA 1HKTA 5HDGA 2IA0A 2E7WA 5A2QZ 2HWVA 4LB6B 1T2KA 3ZMUA 3LAPA 1OMIA 1IN5A 1QO0D 1KU9A 1EH7A 2NNNA 5JFRA 3I58A 4L0ZB 1RI7A 3I59A 4Y15A 4OU0A 3DFGA 2FU4A 1FBQA 1W5TA 4G6DA 1O3QA 4UVAA 1XB4A 1G6NA 2EJRA 5A2QK 5K5OA 2UXXA 4EM1A 1IXRC 1BIBA 3IL2A 1ZHFA 1IZ1A 2D2WA 2GIVA 1ZARA 4LG0B 4D0PA 1DDNA 2XIGA 1UB9A 1EH8A 1UHMA 2DAOA 3F3XA 4RB0A 2HS5A 2Q0OA 3IRRA 4B09A 1RUOA 3TOAA 2EV0A 1W4MA 1IXSB 3W6KB 1XGSA 4HDVA 2QYOA 1A04A 4P5OA 3C18A 2L54A 2FQ3A 4AIHA 1O3SA 1BI3A 2ELHA 4MTEA 4AD9A 1OYWA 1YTYA 2HTJA 3F23A 3QPHA 3GZ5A 4XLNF 4OIOF 3NRVA 2ZJ2A 4UVCA 5L3CA 2Y48A 3LA3A 3KZZA 3CDHA 5D5VB 4EJUA 5K5RA 4RGRA 2RC4A 4OINF 2L01A 1W7PD 4HF0A 4IF4A 1SMTA 4LLGF 5L3FA 1KU2A 3FMRA 1BC7C 3KCCA 2DW4A 5L3DA 3WTSC 5BMZA 3ML6A 2CSOA 4Q47A 3B73A 4UV8A 1RNLA 1U5TA 2PJPA 2RDPA 3WTWC 1KA8A 4ZYGA 2EWNA 1K6OA 2D1VA 2Z99A 2EFQA 3Q9VA 3FMSA 3M8FA 1JHFA 5BS6A 1FYLA 1YQAA 2GA1A 2DI3A 1LDKB 2ISYA 4S05A 2EFOA 2W25A 1ON2A 1ZH5A 1FBSA 3FMQA 1B9MA 3LAJA 4MHGA 4WXCA 2A61A 2FA5A 4XBFA 5AONA 1W7PA 1GVJA 1RUNA 5DUIA 2CGPA 3KP6A 1G3YA 4ZZDA 2QBYA 4IVNA 2V9VA 1B1BA 2J5OA 5ILUA 2EA4A 3U1DA 2H09A 3BJ6A 2TDXA 1J5YA 3T0YA 4WF2A 2JPCA 4HV5A 1WI9A 1T39A 2EB7A 1P6RA 1E2XA 2BGCA 3KP7A 4ZYEA 1R22A 4PZJA 3KETA 1SFUA 3U9GA 3FXQA 4JK1X 1HW5A 5HDKA 5D8LB 2ZBKA 2F2EA 1WWXA 1HSJA 1Z6TA 2FRHA 4I0BA 1XDSA 2IVMA 2XAFA 4BNCA 5FFXA 2WWYA 5IT3A 3IRQA 4M74A 2ZKZA 2W85A 1U5TC 4ESBA 3MFKA 2EFPA 3T5XA 1QZYA 1D8KA 1FWZA 4HLYA 3GXOA 1GHCA 2M45A 4BH9A 1K79A 3R4KA 1IUYA 1DP7P 2YX7A 4OIRF 4EMSA 5ICCA 3D0SA 5KVRA 2PQ8A 4L9VA 4U7DA 5JVTA 4I98B 4ON0A 1SFXA 3RTRA 1HKSA 4EJOA 4YFXF 3SZTA 3NEUA 3D5LA 2F5EA 3CUQC 4RAYA 2DPUA 2CW0F 2VBYA 2WV0A 2KIFA 4PCQA 4H0EA 3KLOA 1QQIA 3ROUA 4I2OA 4IHTA 4AIJA 2HOEA 2IJLA 1Z05A 2RVCA 2FSWA 1TW2A 1BIAA 3DKWA 5ERIA 3TKYA 2ZO4A 4HQEA 2A07F 1TNTA 1OYYA 3EETA 2QQ9A 2O0YA 1O7LA 5LRRA 3SQNA 2VE8A 4L9JA 2JZYA 4ENNA 3I59B 1FX7A 2ESNA 2Q2EA 4OOIA 5LRSA 1S7OA 3HHGA 2JTVA 3WE3A 2F5FA 2H27A 4Q5SF 2J5PA 2PI0A 2QLZA 1IRFA 1L0OC 2O6GE 5IT9Z 1OPCA 4OIPF 2HFHA 2MLKA 4HW0A 2V1DA 2QWWA 2A68F 5BPIA 3DEUA 1U3EM 2M8EA 1WSUA 5FD6A 2L02A 2DK8A 1EH6A 1FY7A 3COAC 4CGZA 1SD4A 4I0AA 5ICEA 5DEQA 3RKWA 1FOKA 4M6YA 5FFZA 2DO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BC8 C;  3F8M A;  3KZY A;  1CF7 B;  1XCV A;  3K1N A;  1KQ8 A;  3R60 A;  4ZZL A;  5E20 A;  3HTS B;  1YLF A;  2MC3 A;  1LVA A;  1MD0 A;  2F5D A;  2Z3Y A;  3FWE A;  4UUV A;  1B9N A;  3WU0 A;  5E1Z B;  1IN8 A;  4HZF A;  4IPA A;  3H3U A;  1XMA A;  2NS0 A;  1IN7 A;  1ZRE A;  2DFI A;  2FBK A;  5K1Y A;  3J7A O;  1U5T B;  3BOQ A;  2K27 A;  1QBJ A;  2P6S A;  2E7X A;  5DD8 A;  3AAF A;  4AIK A;  2ISZ A;  1CGP A;  3QOP A;  3T1B A;  2A5Y B;  1TW3 A;  2DU9 A;  5ED4 A;  5LGT A;  5LGU A;  4U7B A;  3EQL F;  4R79 A;  4GO1 A;  1KQ0 A;  3E5Q A;  4KIG A;  2ZXJ A;  4BHB A;  2FOK A;  3P9C A;  4KIC A;  4KYW A;  4MEX F;  3GLX A;  1RIO H;  1ODD A;  2VOP A;  3IKT A;  4MNU A;  5EEH A;  3IC7 A;  1XDU A;  2A69 F;  3GF2 A;  3T8T A;  1ZAO A;  1LEA A;  3F22 A;  3KEO A;  2JSC A;  2FMY A;  1HW2 A;  2P6T A;  3V8L A;  1TLH B;  1KGS A;  2UWM A;  5DD4 A;  1MDM B;  3O2P E;  1FP1 D;  2ACJ A;  2P7V B;  2XAQ A;  5KK1 A;  2G7U A;  2IA2 A;  3E97 A;  2P4W A;  3ISP A;  3HYI A;  1B6A A;  2JPB A;  4WWC A;  1GXP A;  4WXH A;  3ZN0 A;  1D3Y A;  1XGO A;  3Q9S A;  4O3M A;  2G7H A;  5LGN A;  3VOE A;  3QRF F;  4CXF A;  2NRA C;  1R5G A;  4ESJ A;  3WTY C;  2G9W A;  3KP5 A;  2EV5 A;  1BI0 A;  2HQR A;  2HKX A;  3ZN1 A;  2OU2 A;  2V1X A;  2ZNY A;  5CYV A;  2CYY A;  3ABU A;  1KYW A;  2DQL A;  4F7Z A;  2MH2 A;  3L00 A;  4KIF A;  3JAM K;  3K9T A;  1ZLJ A;  3TDZ C;  1Z1D A;  3I71 A;  1O57 A;  2ZNZ A;  4KN4 X;  5DCF A;  3DPL C;  1YS6 A;  1BN5 A;  1HBX G;  5HDN A;  4FT8 A;  3K0L A;  1YYV A;  2XUB A;  3O6B B;  5BPD A;  2P5K A;  5JI6 A;  4KNY A;  4FX4 A;  1MJ9 A;  1U6G A;  4EV0 A;  2P5L C;  5F6F A;  1B59 A;  4GXO A;  3REO A;  5H20 A;  1R1U A;  4JQF A;  1ZLK A;  3F8B A;  1GXQ A;  5CJ9 A;  2OBP A;  3ZMZ A;  4ETS A;  2NYX A;  1K78 B;  1UHW A;  3J80 K;  4N9H A;  2FML A;  2HYF A;  1PP8 F;  4MQ9 F;  2HR3 A;  3E5U A;  2MH9 A;  3RIR A;  4BHC A;  2K4J A;  3Q5F A;  4A0Z A;  2BV6 A;  2GAU A;  1G3T A;  2IA1 A;  4RB2 C;  3LFK A;  2HZT A;  2HDC A;  4HBL A;  2OZ6 A;  4TV7 A;  3R0A A;  1EV7 A;  2QUF A;  3VEP A;  1XSV A;  3ZMV A;  5D4S A;  3MEX A;  4OMY A;  3H3Z A;  3QPT A;  3CUO A;  3M9A A;  5E8I A;  5CVJ A;  3E3V A;  3IWZ A;  3CUQ A;  2R7D A;  3CO6 C;  2DLL A;  3IHU A;  4CO8 A;  1JHH A;  1R1T A;  2VOO A;  4IHS A;  4HF1 A;  2QVO A;  2CO5 A;  1BI1 A;  4LLN A;  3JW4 A;  2DQR A;  1T98 A;  4LD5 A;  3I54 A;  4CHU A;  3HOT A;  1HXD A;  5D4R A;  2VT2 A;  1O3R A;  3KP4 A;  2CG4 A;  4M71 A;  3GFI A;  2EA2 A;  3EYY A;  3HTU A;  3L7W A;  3G3Z A;  2XAG A;  4Y13 A;  2EFW A;  3I0T A;  5D6E A;  2PLY A;  5H6R A;  3VFZ A;  5FB2 A;  2Z9O A;  4HQM A;  3WGI A;  5FLX K;  3H92 A;  3JSP A;  2XAH A;  1XSD A;  1X3U A;  1WQ2 A;  1LEB A;  4FHT A;  1F4K A;  1V4R A;  4UVB A;  4PDK A;  3V7R A;  1FSE A;  3S2W A;  4M72 A;  2MA3 A;  1W7P B;  4NQW A;  1ON1 A;  3ELK A;  1SD7 A;  4A0X A;  1HQC A;  1UFM A;  4I01 A;  3QU3 A;  3QP5 A;  5E18 F;  4ESF A;  3MZH A;  2FBH A;  3FX3 A;  1AWC A;  4KDP A;  3E6M A;  2YX4 A;  2K4B A;  2ESH A;  3LQQ A;  1JGS A;  4LGW A;  1J75 A;  1T6S A;  2KIM A;  1JXS A;  1IRG A;  4I7H A;  3KE2 A;  4LK1 F;  4XRF A;  1YW7 A;  3F8F A;  5TJJ A;  2O61 A;  1IF1 A;  5ILV A;  2GWR A;  3CTA A;  2W57 A;  2BEO A;  5F64 A;  3E6C C;  5E1W A;  5FLX Z;  2FE3 A;  4BHP A;  1IW7 F;  1P4X A;  1J59 A;  5DYM A;  3WTV C;  2A3S A;  3BZ6 A;  3ULQ B;  3I64 A;  1MKM A;  4RS8 A;  1LQ1 A;  4GYI A;  4UXN A;  2W24 A;  3QP6 A;  2KIU A;  3ZP5 A;  1VTN C;  4RGX A;  2QQA A;  2GQQ A;  2Y0M A;  1J0R A;  3V7S A;  3ABT A;  2A6H F;  1G3W A;  4EM2 A;  1F5T A;  2PMH A;  1DPU A;  4G94 A;  3WTX C;  1G4D A;  2XKO A;  1FYK A;  4LG0 A;  5J6X A;  3WTZ A;  5TRD A;  3TO6 A;  4CYD A;  4BXU A;  1ZG1 A;  2EV6 A;  3GFL A;  1ZG5 A;  3RYR A;  3GW2 A;  2FXA A;  2XKP A;  1YFH A;  3HSE A;  3NQO A;  4RAZ A;  2X0L A;  3P7N A;  3FM3 A;  3OV8 A;  2V6C A;  5D5U B;  3F6V A;  1Y0U A;  2E1C A;  1H9T A;  3FF5 A;  4LK0 F;  4M9X A;  5J8C A;  1FLI A;  3MZY A;  2XVC A;  4KA4 A;  3M1E A;  2H6C A;  1YG2 A;  3RKY A;  4HX8 A;  2OQG A;  1TNS A;  3RPQ A;  1UST A;  3JTG A;  1XSX A;  3VB2 A;  3BJA A;  4B8X A;  4U0W A;  3GO5 A;  3KP2 A;  2P7C B;  2VE9 A;  2Z5U A;  1PP7 U;  5CVV A;  2PFB A;  3SFZ A;  3DQV C;  4JBA A;  2RQP A;  2QQB A;  1IN6 A;  2HTS A;  4QWQ A;  2RN7 A;  3V4G A;  1O7F A;  3P9I A;  3BWG A;  3C7J A;  4YFK F;  2RV8 A;  4N0B A;  5AIQ A;  3KEQ A;  5HVQ C;  1ZYR F;  2B0L A;  5BQT A;  3ZQ7 A;  1FZP B;  3JSO A;  1Z91 A;  4EVI A;  1I6X A;  4AVP A;  4FX0 A;  4Q4Z F;  3DV8 A;  3WGG A;  1BM9 A;  5HS8 A;  1P2F A;  1C0W A;  1QPM A;  2H94 A;  4XSX F;  4MEY F;  3T8R A;  3BY6 A;  3OOP A;  4G7Z F;  2DBB A;  1K78 A;  3ECH A;  1TTY A;  3V7C A;  2NAZ A;  1R1V A;  3DPT A;  3HSR A;  3EYI A;  6PAX A;  3GUD A;  2STW A;  4A6D A;  4NHJ A;  3WOD F;  2DPD A;  4HA8 A;  2NNY A;  2IPQ X;  3CLO A;  3TGN A;  2WTE A;  5E1X A;  1MZB A;  2FBI A;  3F21 A;  1ULY A;  2Y75 A;  1PDN C;  1HST A;  1P4A A;  4OIQ F;  2YSR A;  3HRU A;  2D45 A;  5LHG A;  2FF4 A;  2VBX A;  5L3G A;  2XRN A;  2MBF A;  3GFM A;  2R7F A;  2HKO A;  3ZMS A;  5ICF A;  2EFN A;  1FNN A;  1T0F A;  4P96 A;  5LBQ A;  4RB1 A;  4GYG A;  4LLL A;  4R8H A;  1WKM A;  4A5M A;  1L3L A;  1Z6R A;  2OZU A;  4K2E A;  1LB2 A;  4HOB A;  3P9K A;  3TDU C;  4EM0 B;  4KFC A;  1STZ A;  1FC3 A;  2M5W A;  2K02 A;  5BOX A;  2CQK A;  1KQ9 A;  1YW9 A;  1UCR A;  5AIP A;  3ZPL A;  2L3D A;  2OA4 A;  4EGZ A;  3TOB A;  1XD7 A;  2QZ8 A;  1OR7 A;  4M9Z A;  4O5V A;  4DNC A;  3HSF A;  2H6B A;  4UV9 A;  4ZH4 F;  3ERE D;  4PGH A;  1FYM A;  1V3F A;  3I4P A;  3M7G A;  3EDP A;  1XGN A;  4HX7 A;  1ZGA A;  2CWE A;  5FO5 A;  4ENM A;  4P55 A;  3WTU C;  1MJB A;  1BJA A;  5LLQ A;  1MDM A;  5LHI A;  4U0Y A;  3DF8 A;  3R6S A;  3GVA A;  4KUM A;  4P9U A;  3GX4 X;  4A5N A;  4G7H F;  3N97 A;  4LMY A;  1XN7 A;  4RGS A;  1R36 A;  2RNJ A;  3FXU A;  3QAH A;  1Z7U A;  4L0Y B;  2AXL A;  2IP2 A;  5DDG A;  2XAJ A;  3HHH A;  5FD5 A;  1U2W A;  1QZZ A;  3F8N A;  2ZCW A;  3FZV A;  4ENK A;  3F72 A;  5LEK A;  3GYH X;  3DXJ F;  5DV5 A;  1S7A A;  1K7A A;  5ICG A;  4A2U A;  4ENJ A;  4R1H A;  3SXY A;  4XLP F;  3C1D A;  4L18 B;  4MTD A;  2LDU A;  4XSZ F;  2PBI A;  2AS5 F;  1YIO A;  4LJZ F;  4GCV A;  3HOS A;  2P8T A;  2VBW A;  3FM5 A;  2LNB A;  4L9T A;  4KT5 C;  5LHH A;  3N4M A;  2EK5 A;  2ZME A;  2Z33 A;  1XGM A;  3WGH A;  4S04 A;  1YO5 C;  2LSO A;  3I53 A;  2VON A;  3BDD A;  1R23 A;  1R00 A;  2CFX A;  2HYG D;  4E70 A;  5HLH A;  3KLN A;  3HRM A;  1W5S A;  2K7L A;  4G7O F;  3LA7 A;  1TQM A;  3WG9 A;  4AWX B;  4A12 A;  1IXC A;  1AOY A;  4M9S A;  1J2X A;  1Q1H A;  2GXB A;  4IRG A;  2KJB A;  3IKV A;  3WE2 A;  1ZRF A;  1PUE E;  2M1B A;  1MJA A;  3GEZ A;  4IJA A;  2F5C A;  2FNA A;  5CVI A;  2UZK A;  3K2Z A;  2ZFW A;  2GXG A;  1HKQ A;  4DQ2 A;  1LNW A;  2D1H A;  2BE5 F;  4KN7 X;  1LJ9 A;  4UHT A;  2VN2 A;  3E5X A;  2VT3 A;  3CUQ B;  1P4W A;  4L5I A;  1DUX C;  4EJT A;  2HGC A;  2COM A;  2V79 A;  3WTT C;  1J7K A;  2KJC A;  2XRO A;  1ZN2 A;  4WCG A;  4YFN F;  5H6Q A;  3R0J A;  4HV6 A;  5EEG A;  1E17 A;  2PEX A;  4RB3 C;  4MQV A;  4U88 A;  4P9F A;  4Z2Y A;  2QBY B;  2JT1 A;  3F8C A;  3HRS A;  2ZME B;  4YII A;  2V1U A;  3TO9 A;  2HEO A;  3WU1 B;  2X4H A;  4ZYD A;  4LB5 A;  5LEJ A;  4L9N A;  3K1M A;  2MD5 A;  1BOA A;  3B02 A;  3HIF A;  3F6O A;  1FP2 A;  3K1P A;  4MGR A;  1B4A A;  4EQQ A;  2KRF A;  3FHZ A;  2Q8K A;  3IWF A;  1Z9C A;  5JHU A;  3QU6 A;  4BQA A;  5HS9 A;  2O03 A;  1U8R A;  4KMF A;  1YS7 A;  3PQJ A;  4L5J A;  4NB5 A;  1SAX A;  2OQR A;  5E17 F;  1TQI A;  5D6F A;  5L3E A;  2A6E F;  2VOD A;  2XGX A;  1RZ4 A;  4EJW A;  3RYP A;  3V8K A;  4G9Y A;  3CO7 C;  3GWZ A;  3BPX A;  2XAS A;  5D5W B;  4BYY A;  1F1Z A;  1P92 A;  1REP C;  2XV4 S;  2M30 A;  3U2R A;  3SHF A;  3DP7 A;  2O3F A;  5ILS A;  4BAY A;  5HOO A;  3RI4 A;  1H9G A;  1D8J A;  5DCM B;  3HRT A;  4IRH A;  1KU3 A;  2W84 A;  4YG2 F;  2QEN A;  1O3T A;  4ZYH A;  4HLX A;  2BBY A;  1JE8 A;  2IW5 A;  3KP3 A;  2OAZ A;  1CF7 A;  5CVU A;  4M73 A;  5D5X B;  3SZP A;  5JR3 A;  4WK8 F;  3L2C A;  3GZ6 A;  3LA2 A;  3BRO A;  4I09 A;  3RKX A;  1KU7 A;  3BJO A;  1I5Z A;  1ZRD A;  1SFE A;  3R61 A;  4HYE A;  3LST A;  3FXR A;  1LDD A;  4IXA A;  5DUK A;  4A6E A;  2FEZ A;  2LKP A;  1I27 A;  1QNT A;  5D8K B;  2RGV A;  3KFW X;  1ZRC A;  1H0M A;  3L09 A;  2M87 A;  3J81 K;  5E8G A;  2VBZ A;  5DCM A;  3RDI A;  3PQK A;  1YW8 A;  2R3S A;  1D5V A;  1J9I A;  3PFI A;  1I1G A;  4ASN A;  3RJP A;  3ECO A;  1S8N A;  3MAJ A;  3VOD A;  1F9N A;  4GGG A;  3I5U A;  2YR2 A;  4M6X A;  3J81 Z;  3O3K A;  2PG4 A;  3ZMD A;  3MWM A;  5FGM A;  5HS7 A;  4HAM A;  1IAW A;  2LF7 A;  4CDG A;  4EJV A;  5IT9 K;  4G6Q A;  4IRI A;  1FPQ A;  3MCZ A;  5J8F A;  1S29 A;  3BP8 A;  1BI2 A;  1IN4 A;  3LQR A;  3JAM Z;  4HF2 A;  1R5H A;  2WC2 A;  2C6Y A;  4I02 A;  1TBX A;  5HLG A;  3ZMT A;  3HUG A;  3TQN A;  2JRT A;  5F1R A;  1ONV A;  5CVR A;  1KYZ A;  1LDJ A;  2P5V A;  3L9F A;  1ZG3 A;  2VXZ A;  3G73 A;  3MQ0 A;  2GA2 A;  4A0Y A;  3M8E A;  1DPR A;  4EGY A;  2L4A A;  1TQP A;  3EUH A;  1G3S A;  3E6D A;  2GZW A;  4WXD A;  2YPR A;  4QLC U;  2L4M A;  4U0V A;  1S6L A;  1OKR A;  4HX4 A;  4KIB A;  1HW1 A;  3JTH A;  2ETH A;  2LF8 A;  1R58 A;  1FBU A;  2VC0 A;  2YU3 A;  2UXN A;  1T38 A;  2OD5 A;  2BYV E;  1FT9 A;  3W6J B;  2KKO A;  5K5Q A;  1FSH A;  4N9I A;  4LFU A;  1WRJ A;  4OMZ A;  4UNO A;  4HDU A;  5CLS A;  5L3B A;  1XCB A;  3TO7 A;  2XHK A;  3K69 A;  3RPU A;  1SD6 A;  4RGU A;  3C3W A;  2DT5 A;  2PN6 A;  3J80 Z;  2E1N A;  4KMU X;  3BPV A;  5HLI A;  1NHA A;  3LWF A;  4Y17 A;  2RKH A;  1R7J A;  2STT A;  2VC1 A;  1XMK A;  1SMY F;  4G8X A;  1ZGJ A;  1BBY A;  2IRF G;  4Q48 A;  2QM3 A;  1U78 A;  4O6J A;  2FNP A;  4PGG A;  2IT0 A;  4YIF A;  3GFJ A;  3E6B A;  4CIC A;  2K86 A;  3V8J A;  1I1S A;  2DK5 A;  1SD5 A;  2ADU A;  3CJN A;  4WX9 A;  2DTR A;  4CZZ A;  1S3J A;  2MLG A;  2PMU A;  1MGT A;  2HQN A;  1USS A;  1OYI A;  2O8X A;  1QGP A;  1HKT A;  5HDG A;  2IA0 A;  2E7W A;  5A2Q Z;  2HWV A;  4LB6 B;  1T2K A;  3ZMU A;  3LAP A;  1OMI A;  1IN5 A;  1QO0 D;  1KU9 A;  1EH7 A;  2NNN A;  5JFR A;  3I58 A;  4L0Z B;  1RI7 A;  3I59 A;  4Y15 A;  4OU0 A;  3DFG A;  2FU4 A;  1FBQ A;  1W5T A;  4G6D A;  1O3Q A;  4UVA A;  1XB4 A;  1G6N A;  2EJR A;  5A2Q K;  5K5O A;  2UXX A;  4EM1 A;  1IXR C;  1BIB A;  3IL2 A;  1ZHF A;  1IZ1 A;  2D2W A;  2GIV A;  1ZAR A;  4LG0 B;  4D0P A;  1DDN A;  2XIG A;  1UB9 A;  1EH8 A;  1UHM A;  2DAO A;  3F3X A;  4RB0 A;  2HS5 A;  2Q0O A;  3IRR A;  4B09 A;  1RUO A;  3TOA A;  2EV0 A;  1W4M A;  1IXS B;  3W6K B;  1XGS A;  4HDV A;  2QYO A;  1A04 A;  4P5O A;  3C18 A;  2L54 A;  2FQ3 A;  4AIH A;  1O3S A;  1BI3 A;  2ELH A;  4MTE A;  4AD9 A;  1OYW A;  1YTY A;  2HTJ A;  3F23 A;  3QPH A;  3GZ5 A;  4XLN F;  4OIO F;  3NRV A;  2ZJ2 A;  4UVC A;  5L3C A;  2Y48 A;  3LA3 A;  3KZZ A;  3CDH A;  5D5V B;  4EJU A;  5K5R A;  4RGR A;  2RC4 A;  4OIN F;  2L01 A;  1W7P D;  4HF0 A;  4IF4 A;  1SMT A;  4LLG F;  5L3F A;  1KU2 A;  3FMR A;  1BC7 C;  3KCC A;  2DW4 A;  5L3D A;  3WTS C;  5BMZ A;  3ML6 A;  2CSO A;  4Q47 A;  3B73 A;  4UV8 A;  1RNL A;  1U5T A;  2PJP A;  2RDP A;  3WTW C;  1KA8 A;  4ZYG A;  2EWN A;  1K6O A;  2D1V A;  2Z99 A;  2EFQ A;  3Q9V A;  3FMS A;  3M8F A;  1JHF A;  5BS6 A;  1FYL A;  1YQA A;  2GA1 A;  2DI3 A;  1LDK B;  2ISY A;  4S05 A;  2EFO A;  2W25 A;  1ON2 A;  1ZH5 A;  1FBS A;  3FMQ A;  1B9M A;  3LAJ A;  4MHG A;  4WXC A;  2A61 A;  2FA5 A;  4XBF A;  5AON A;  1W7P A;  1GVJ A;  1RUN A;  5DUI A;  2CGP A;  3KP6 A;  1G3Y A;  4ZZD A;  2QBY A;  4IVN A;  2V9V A;  1B1B A;  2J5O A;  5ILU A;  2EA4 A;  3U1D A;  2H09 A;  3BJ6 A;  2TDX A;  1J5Y A;  3T0Y A;  4WF2 A;  2JPC A;  4HV5 A;  1WI9 A;  1T39 A;  2EB7 A;  1P6R A;  1E2X A;  2BGC A;  3KP7 A;  4ZYE A;  1R22 A;  4PZJ A;  3KET A;  1SFU A;  3U9G A;  3FXQ A;  4JK1 X;  1HW5 A;  5HDK A;  5D8L B;  2ZBK A;  2F2E A;  1WWX A;  1HSJ A;  1Z6T A;  2FRH A;  4I0B A;  1XDS A;  2IVM A;  2XAF A;  4BNC A;  5FFX A;  2WWY A;  5IT3 A;  3IRQ A;  4M74 A;  2ZKZ A;  2W85 A;  1U5T C;  4ESB A;  3MFK A;  2EFP A;  3T5X A;  1QZY A;  1D8K A;  1FWZ A;  4HLY A;  3GXO A;  1GHC A;  2M45 A;  4BH9 A;  1K79 A;  3R4K A;  1IUY A;  1DP7 P;  2YX7 A;  4OIR F;  4EMS A;  5ICC A;  3D0S A;  5KVR A;  2PQ8 A;  4L9V A;  4U7D A;  5JVT A;  4I98 B;  4ON0 A;  1SFX A;  3RTR A;  1HKS A;  4EJO A;  4YFX F;  3SZT A;  3NEU A;  3D5L A;  2F5E A;  3CUQ C;  4RAY A;  2DPU A;  2CW0 F;  2VBY A;  2WV0 A;  2KIF A;  4PCQ A;  4H0E A;  3KLO A;  1QQI A;  3ROU A;  4I2O A;  4IHT A;  4AIJ A;  2HOE A;  2IJL A;  1Z05 A;  2RVC A;  2FSW A;  1TW2 A;  1BIA A;  3DKW A;  5ERI A;  3TKY A;  2ZO4 A;  4HQE A;  2A07 F;  1TNT A;  1OYY A;  3EET A;  2QQ9 A;  2O0Y A;  1O7L A;  5LRR A;  3SQN A;  2VE8 A;  4L9J A;  2JZY A;  4ENN A;  3I59 B;  1FX7 A;  2ESN A;  2Q2E A;  4OOI A;  5LRS A;  1S7O A;  3HHG A;  2JTV A;  3WE3 A;  2F5F A;  2H27 A;  4Q5S F;  2J5P A;  2PI0 A;  2QLZ A;  1IRF A;  1L0O C;  2O6G E;  5IT9 Z;  1OPC A;  4OIP F;  2HFH A;  2MLK A;  4HW0 A;  2V1D A;  2QWW A;  2A68 F;  5BPI A;  3DEU A;  1U3E M;  2M8E A;  1WSU A;  5FD6 A;  2L02 A;  2DK8 A;  1EH6 A;  1FY7 A;  3COA C;  4CGZ A;  1SD4 A;  4I0A A;  5ICE A;  5DEQ A;  3RKW A;  1FOK A;  4M6Y A;  5FFZ A;  2DO7 A; 
#chains in the Genus database with same CATH topology
 3K4C A;  2HDW A;  1BC8 C;  2OV7 A;  2XSD C;  1MBF A;  4B47 A;  3D1N I;  3F8M A;  3VYR B;  3KZY A;  2QKL B;  1CF7 B;  2HU9 A;  3MKL A;  1XCV A;  3DTK A;  2K9M A;  3K1N A;  5C3E J;  1KQ8 A;  1D0X A;  4RMN A;  3VYS B;  3R60 A;  4ZZL A;  2QCO A;  3G1M A;  5J4Y A;  2X1D A;  5E3M A;  1OQY A;  5E20 A;  3HTS B;  1YLF A;  2MC3 A;  2JA2 A;  2E60 A;  1X1B A;  1LVA A;  1MD0 A;  2B7E A;  2F5D A;  1WH7 A;  3JRC A;  3CMA I;  1YI2 I;  4AVZ A;  3HUG B;  2Z3Y A;  3FWE A;  2Y0S N;  4UUV A;  3BR1 A;  1B9N A;  3DTE A;  1S5L C;  5HNF A;  2KLO A;  4A3L J;  1RPW A;  2KIS A;  3WU0 A;  5E1Z B;  3QQA A;  3SYT A;  1YIJ I;  1IN8 A;  4V2G A;  2OF7 A;  1K4S A;  3W2A A;  4HZF A;  4IPA A;  9ANT A;  3H3U A;  1XMA A;  4EAT A;  3SEZ A;  3K4M A;  2NS0 A;  1IN7 A;  4PJN A;  1ZRE A;  2DFI A;  2FBK A;  3DU6 A;  1MBH A;  5IY5 H;  5K1Y A;  3J7A O;  1U5T B;  4UB8 C;  3BOQ A;  3GTO J;  2K27 A;  5CQG A;  1QBJ A;  4E4H A;  2DA1 A;  2P6S A;  4AYB N;  1DQU A;  2E7X A;  5DD8 A;  1TT0 A;  2JWT A;  4KIT B;  5LFA A;  3AAF A;  2X1E A;  4AIK A;  1IG7 A;  2YS9 A;  2ISZ A;  1EA3 A;  1CGP A;  1AA7 A;  3QOP A;  3T1B A;  2A5Y B;  1TW3 A;  2DU9 A;  5ED4 A;  5LGT A;  5LGU A;  4U7B A;  3EQL F;  1MMS A;  5B1B H;  3JRF A;  4F3Q A;  3ONQ A;  4R79 A;  3P5J A;  5EDN A;  3SFI A;  1WI3 A;  4ABZ A;  3A1Y A;  4GO1 A;  3W3C A;  2Q1Z B;  2XAU A;  1D0Y A;  1KQ0 A;  4A3D J;  2R5Z A;  2EZI A;  3BT9 A;  3E5Q A;  4FET A;  3PNV A;  4HEA 2;  4KIG A;  2LFB A;  4ZDO A;  1MBJ A;  3LSP A;  2VPR A;  3HGY A;  2ZXJ A;  1ORK A;  4BHB A;  1VQ7 I;  2FOK A;  3P9C A;  4FTH A;  2Z1D A;  4CYC B;  4KIC A;  1YJ9 I;  2MSY A;  4KYW A;  4MEX F;  3GLX A;  1RIO H;  1NH3 A;  1GV5 A;  2H1K A;  1N78 A;  1ODD A;  2VOP A;  4XK4 A;  3IKT A;  2BVL A;  4MNU A;  2HVS A;  3L2W A;  3K2A A;  5EEH A;  2WY7 Q;  3CMM A;  2DJN A;  3DBH B;  2LG4 A;  3IC7 A;  1XDU A;  1IV8 A;  2A69 F;  1ETY A;  2X6Y A;  3S3N A;  4D7N A;  3GF2 A;  1LPQ A;  4BXF A;  4HNV A;  3T8T A;  1ZAO A;  1LEA A;  3F22 A;  3KEO A;  3WHB A;  4XN3 A;  2JSC A;  1LE8 B;  2FMY A;  4AC0 A;  1PYV A;  1HW2 A;  3PO3 J;  2P6T A;  4Y4R A;  3V8L A;  1TLH B;  5F0C A;  1KGS A;  2UWM A;  5DD4 A;  1MDM B;  2B9S A;  1B8I A;  2JUG A;  3DPU A;  3O2P E;  1FP1 D;  2ACJ A;  4A3J J;  4C2M J;  2BXY A;  3OSF A;  4FE4 A;  2FOW A;  3ZQF A;  4DYQ A;  2P7V B;  4PJL A;  2XAQ A;  5KK1 A;  2G7U A;  2IA2 A;  3E97 A;  2P4W A;  3ISP A;  3HYI A;  3GTK J;  1B6A A;  2JPB A;  4WWC A;  1VI0 A;  4B3X A;  1V54 H;  1I3Q J;  1GXP A;  4WXH A;  3ZN0 A;  5EG0 A;  1D3Y A;  1XGO A;  3Q9S A;  1U8B A;  5IOZ A;  4O3M A;  2G7H A;  2KQR A;  5LGN A;  2HXI A;  3VOE A;  2WAF A;  4CXF A;  3QRF F;  1R5G A;  3CJR B;  3WTY C;  3GME A;  4ESJ A;  1RRJ A;  2NRA C;  2G9W A;  5EG0 B;  3KP5 A;  1Y0N A;  2EV5 A;  4BY7 J;  1O4X A;  4E7L A;  1BI0 A;  1T95 A;  2HKX A;  2HQR A;  2OU2 A;  2V1X A;  3ZN1 A;  2ZNY A;  5CYV A;  1XG1 A;  2G0E A;  2H8W A;  2CYY A;  3ABU A;  1KYW A;  1JTX A;  2DQL A;  4F7Z A;  2R92 J;  2MH2 A;  3L00 A;  4KIF A;  4BEH A;  4JYK A;  3JAM K;  4E7K A;  3GTM J;  3LNQ A;  3ZGK A;  1YX5 A;  3ZXS A;  3K9T A;  2L5Q A;  3IAM 2;  1ZLJ A;  3TDZ C;  3E7L A;  1Z1D A;  3S3O A;  2FX0 A;  5E3O A;  2ZME C;  3I71 A;  3HKZ N;  1O57 A;  2O9L A;  1GT0 C;  2ZNZ A;  4MFD A;  4KN4 X;  5DCF A;  3DPL C;  1YS6 A;  2OTL I;  1BN5 A;  1HBX G;  5HDN A;  3K70 C;  4FT8 A;  4JX4 A;  3K0L A;  3K70 D;  2XB5 A;  1YYV A;  2XUB A;  3O6B B;  5M5X J;  5BPD A;  4C3J J;  3BC8 A;  4V19 K;  2P5K A;  2CH0 A;  2LY9 A;  5JI6 A;  5F27 A;  4KNY A;  4FX4 A;  1MJ9 A;  1U6G A;  2VB6 A;  4XLC A;  4EV0 A;  3M07 A;  3H1C A;  1MMG A;  1MIJ A;  2P5L C;  5F6F A;  1B59 A;  1VZ0 A;  4GXO A;  3REO A;  5H20 A;  1ZEL A;  1R1U A;  1W36 D;  4Y52 J;  4JQF A;  1ZLK A;  2IS4 A;  3F8B A;  1GXQ A;  2BY1 A;  2OBP A;  5CJ9 A;  3ZMZ A;  4ETS A;  2NYX A;  1K78 B;  2X6X A;  2BW3 A;  1UHW A;  3J80 K;  2IS6 A;  4V2F A;  1BW5 A;  2KZV A;  5DM7 F;  2R7T A;  3H5N A;  4N9H A;  5B1A H;  2L7K A;  2FML A;  2BY0 A;  1PUF B;  3M4O J;  2HYF A;  2JUC A;  3ZQQ A;  1PP8 F;  2YU9 J;  4MQ9 F;  4BBS J;  4JX5 A;  2HR3 A;  3E5U A;  2MH9 A;  4M3F A;  3RIR A;  4NQW B;  4BHC A;  1K61 A;  2K4J A;  3ERM A;  3Q5F A;  4L5E A;  2XB0 X;  3OS0 A;  4A0Z A;  2BV6 A;  3A01 B;  4CH7 A;  2GAU A;  3GTL J;  1G3T A;  2QQ8 A;  2IA1 A;  4RB2 C;  3LFK A;  2HZT A;  2HDC A;  2JMW A;  4HBL A;  1X3W B;  2OZ6 A;  1R5I D;  4OAY A;  4TV7 A;  4D9J A;  3R0A A;  3L2U A;  1D5Y A;  2DMQ A;  1EV7 A;  3SDG A;  2QUF A;  4BUP A;  3OS2 A;  2DMP A;  1JUP A;  1XSV A;  3VEP A;  3CCU I;  2M7B A;  4IKF A;  4C3I J;  1Y6I A;  2DFE A;  3KYL A;  4IOC F;  2LMD A;  4J01 A;  3BTI A;  1NK3 P;  4DJA A;  3ZMV A;  2JA6 J;  5D4S A;  3DLA A;  3MEX A;  1X1C A;  1MNM C;  1WFX A;  2W1O A;  4OMY A;  1FOW A;  3H3Z A;  2GOX B;  3QPT A;  3CUO A;  3S2D J;  3M9A A;  5E8I A;  5CVJ A;  1R71 A;  3E3V A;  2HZD A;  3IWZ A;  3CUQ A;  2UV1 A;  2JVH A;  2R7D A;  3CO6 C;  2DLL A;  3IHU A;  4CO8 A;  1JHH A;  4BDY A;  3DU5 A;  3M8J A;  3U21 A;  5J4V A;  3PNY A;  1R1T A;  2VOO A;  4HRI A;  3JRG A;  2E19 A;  4IHS A;  3BLY A;  5FKO A;  4HF1 A;  4DBQ A;  3HXL A;  2QVO A;  2CO5 A;  1APL C;  3ASO H;  2CQ7 A;  1BI1 A;  4LLN A;  3JW4 A;  1ZR2 A;  2DQR A;  1T98 A;  4LD5 A;  1ETW A;  3I54 A;  4CHU A;  1I3A A;  3HOT A;  2VQC A;  1HXD A;  1V5F A;  4A3B J;  1JGG A;  2LRE A;  5D4R A;  2VT2 A;  2NVY J;  1O3R A;  4B3A A;  1MSE C;  3CCQ I;  4CCO A;  3OYF A;  2Y9Z A;  3TW7 A;  3KP4 A;  5M3F J;  2CG4 A;  4M71 A;  1TT5 B;  3CMY A;  3SEQ A;  3GFI A;  2EA2 A;  3EYY A;  3C2B A;  3HTU A;  3L7W A;  3G3Z A;  2KZG A;  2R4G A;  3S16 J;  2XAG A;  4Y13 A;  2XF7 A;  2EFW A;  1IV6 A;  1VQ8 I;  3I0T A;  3HGG A;  5D6E A;  2E2I J;  4ZJZ A;  5FKL A;  2PLY A;  3S2H J;  3HZJ A;  5H6R A;  3VFZ A;  2LKS A;  5FB2 A;  2Z9O A;  3K4B A;  4C2U A;  2D5V A;  4HQM A;  5IP6 A;  4XKW A;  3WGI A;  5FLX K;  2V1N A;  3H92 A;  2H1L A;  3JSP A;  4S0H B;  2XAH A;  1XSD A;  1X3U A;  2M34 A;  1WQ2 A;  1LEB A;  3CCR I;  2K9L A;  1Y56 A;  4FHT A;  5GAG J;  1X19 A;  1F4K A;  1V4R A;  4UVB A;  2CV2 A;  4PDK A;  2OC6 A;  4PFP A;  3CJQ B;  4HNT A;  3AG3 H;  1YJW I;  3V7R A;  1JI8 A;  3JRH A;  1FSE A;  1NG6 A;  3S2W A;  2UUZ A;  2M0M A;  4YRV A;  2M3A A;  3SDB A;  4M72 A;  2MA3 A;  2CU7 A;  1W7P B;  4NQW A;  3PSI A;  1ON1 A;  3BZK A;  3ELK A;  1SD7 A;  1XX5 A;  3H5A A;  3QYF A;  3CME I;  5C4X J;  4A0X A;  5M3M J;  2LH9 A;  1HQC A;  4F93 B;  3FKJ A;  2A6T A;  2E5N A;  4BKX A;  4QPQ A;  1UFM A;  4I01 A;  1MH4 A;  3QU3 A;  2JVG A;  3QP5 A;  2L9S A;  4LIV A;  2DFH A;  5E18 F;  4AID A;  2WAE A;  4ESF A;  3MZH A;  5FRN A;  1OFC X;  2FBH A;  2NOJ B;  3FX3 A;  4BJT A;  1AWC A;  2ID3 A;  3A4C A;  2LBF B;  1ETV A;  3G4S I;  1X4P A;  3DLL F;  3RPU D;  4KDP A;  2R5Y A;  2CUZ A;  3E6M A;  2YX4 A;  1A36 A;  4PK4 A;  2MFZ A;  2K4B A;  2ESH A;  3LQQ A;  1JGS A;  1KZH A;  4LGW A;  1J75 A;  1T6S A;  2KIM A;  4IX7 A;  3PNT A;  1FIP A;  5GTH C;  1JXS A;  1POG A;  1IRG A;  1ZTR A;  4I7H A;  2V9K A;  3CCE I;  4X6A J;  1ENH A;  3FXO A;  3KE2 A;  4LK1 F;  4XRF A;  3HJE A;  5HOD A;  1YW7 A;  3CCM I;  4LG3 A;  5F08 A;  3F8F A;  5TJJ A;  2BW3 B;  2O61 A;  1IF1 A;  2HQ5 A;  2GWR A;  3CTA A;  5ILV A;  2CUE A;  2W57 A;  2BEO A;  5F64 A;  4JP0 A;  3OYA A;  3E6C C;  5E1W A;  5FLX Z;  1PJR A;  2NVX J;  2FE3 A;  4BHP A;  1BA5 A;  1IW7 F;  3HKZ A;  1P4X A;  4CSW A;  1J59 A;  5DYM A;  2QA4 I;  4J19 A;  2IS1 A;  3WTV C;  2A3S A;  2EZK A;  3BZ6 A;  5GTI C;  3HOW J;  2HI3 A;  1WHU A;  3ULQ B;  3TL4 X;  2GLO A;  3OL3 A;  3I64 A;  1MKM A;  4RS8 A;  3OYL A;  1R9T J;  2IXS A;  1Y1V J;  1LQ1 A;  4GYI A;  3E1S A;  2W24 A;  3QP6 A;  4UXN A;  2F4O B;  5GAD J;  2KIU A;  2R5Z B;  3LOC A;  3ZP5 A;  1VTN C;  4RAG A;  4RGX A;  1YX3 A;  2QQA A;  5EZH A;  2GQQ A;  2Y0M A;  1J0R A;  3V7S A;  2DOA A;  1VQP I;  3ABT A;  1SFK A;  2A6H F;  4NUB A;  4IOA F;  2WV1 A;  1G3W A;  4EM2 A;  3LMM A;  4JOM A;  1F5T A;  2PMH A;  1QVU A;  3CJT B;  1DPU A;  4G94 A;  3WTX C;  1G4D A;  4E7Z A;  3M1C A;  1TL8 A;  1A31 A;  4HPQ A;  3PIO F;  3KIO A;  2XKO A;  1FYK A;  3DWL E;  4KT6 A;  3HEF A;  4LG0 A;  4XR6 A;  5J6X A;  3WTZ A;  2JA5 J;  1TC3 C;  2HQA A;  5TRD A;  3TO6 A;  2HVR A;  4CYD A;  1X58 A;  1WJC A;  4XMY A;  4BXU A;  1ZG1 A;  2EV6 A;  1K6Y A;  3GFL A;  2ID6 A;  1ZG5 A;  4G12 A;  3KYC B;  3RYR A;  3GW2 A;  2EZH A;  2ME6 A;  5FRM A;  4RM2 A;  2FXA A;  2XKP A;  5J1R A;  1YFH A;  2WB1 A;  4E7I A;  3HSE A;  4M3G A;  3NQO A;  1IO2 A;  4RAZ A;  2X0L A;  1BJZ A;  3P7N A;  1NG7 A;  4Y33 A;  2E1M B;  3FM3 A;  3OV8 A;  2V6C A;  5D5U B;  2Z16 A;  4I6Z A;  3F6V A;  5KHD A;  1LFB A;  3MD2 A;  3E0J B;  1R6R A;  1Y0U A;  5FRO A;  5IP9 J;  2LP0 A;  4XOT A;  1AKH B;  3KEY A;  2E1C A;  1H9T A;  3FF5 A;  4LK0 F;  4M9X A;  5KCM A;  5J8C A;  5EF6 A;  3MZY A;  1FLI A;  2XVC A;  4KA4 A;  2ZSI B;  2EH3 A;  3M1E A;  2H6C A;  4AM3 A;  1YG2 A;  4B48 A;  2HPM A;  3RKY A;  3ESW B;  4HX8 A;  2OQG A;  1TNS A;  3RPQ A;  1UST A;  1YOV B;  2VQG A;  2ICW G;  3JTG A;  2MC4 A;  1XSX A;  2L7F P;  3VB2 A;  4PSW A;  3BJA A;  1JKO C;  4B8X A;  1X1A A;  1HC8 A;  4U0W A;  3GO5 A;  2WAQ A;  3KP2 A;  4BL0 B;  2P7C B;  2VE9 A;  2DJI A;  2Z5U A;  5EEA A;  1PP7 U;  2JK3 A;  5CVV A;  2PFB A;  3SFZ A;  3X2Q H;  3VYU B;  2CUF A;  3GCM A;  1WPK A;  3CES A;  3DQV C;  2RQP A;  4JBA A;  2QQB A;  1IN6 A;  2HTS A;  4QWQ A;  4CUG A;  2RN7 A;  2K85 A;  4C2T A;  3V4G A;  1OIS A;  2L9V A;  3OYD A;  4ZC3 A;  4YEJ A;  1O7F A;  1VQ9 I;  3P9I A;  3BWG A;  3WG7 H;  2R5Y B;  3FDY A;  3C7J A;  1YJN I;  3OYG A;  4YFK F;  2RV8 A;  4N0B A;  5AIQ A;  3KEQ A;  3QYE A;  5HVQ C;  1ZYR F;  4YIR X;  2B0L A;  2MD0 A;  4JX6 A;  5BQT A;  2OTJ I;  1MNE A;  3ZQ7 A;  1FZP B;  1WJE A;  2E71 A;  3JSO A;  3HOY J;  4GDF A;  1Z91 A;  4EVI A;  5F04 A;  1I6X A;  1UJ8 A;  4AVP A;  3B6C A;  1Z0X A;  4FX0 A;  2GBY A;  4Q4Z F;  3BG9 A;  3CLQ A;  4XRS G;  1Z3X A;  1D1A A;  3DV8 A;  3PUB A;  3WGG A;  5KNL A;  1VQK I;  2MW8 A;  1BM9 A;  5HS8 A;  1P2F A;  1C0W A;  1QPM A;  2H94 A;  4XSX F;  4DBR A;  4BE2 A;  4MEY F;  3T8R A;  3RCO A;  3BY6 A;  1IUF A;  2KRH A;  3OOP A;  4G7Z F;  2IAI A;  2DBB A;  2R7R A;  2IGK A;  1K78 A;  3ECH A;  1TTY A;  3V7C A;  1GV2 A;  5EGO B;  2NAZ A;  4B44 A;  1U9N A;  1MSF C;  1R1V A;  2XRL A;  3DPT A;  3HSR A;  3EYI A;  6PAX A;  3GUD A;  4MLO A;  2STW A;  4A6D A;  2VJ5 A;  4NHJ A;  3WOD F;  3MVP A;  3ZCO A;  4H4K C;  2XPW A;  4XN0 A;  2R7U A;  2DPD A;  4NC8 A;  4HA8 A;  2NNY A;  4XNF A;  4PSX A;  4PJM A;  2IPQ X;  1DU6 A;  1TZL A;  3CLO A;  3TGN A;  2WTE A;  2L7M P;  2Y69 H;  2W82 A;  5IOY A;  5E1X A;  4RM3 A;  1MZB A;  2FBI A;  2JRM A;  3OYK A;  3F21 A;  1ULY A;  3AL0 B;  2Y75 A;  2LLK A;  4BGD A;  1OCP A;  2WBM A;  4QTR A;  4RA2 A;  1HST A;  1P4A A;  2ZFU A;  2YSR A;  3JCU C;  4B4C A;  1Y39 A;  1XPX A;  1PDN C;  4OIQ F;  3HC7 A;  3HRU A;  4ZTF A;  2IGO A;  4XID A;  2HVQ A;  2D45 A;  5LHG A;  1UHS A;  2FF4 A;  2VBX A;  3JRI A;  2K9N A;  5L3G A;  3S93 A;  5JHF A;  3I56 I;  2XRN A;  2MBF A;  2DDB A;  3GFM A;  4LIU A;  5JLX A;  2R7F A;  1RES A;  1WJ5 A;  2HKO A;  3K4L A;  1E3H A;  3S1Q J;  1R4M B;  5ICF A;  3ZMS A;  2VQL A;  2EFN A;  1FNN A;  1T0F A;  1LFP A;  1HA8 A;  5EGO A;  4P96 A;  5LBQ A;  3ZRG A;  3HL2 A;  4RB1 A;  4B43 A;  4GYG A;  4LLL A;  4R8H A;  2VL8 A;  1WKM A;  4A5M A;  2LK2 A;  3TED A;  1L3L A;  3FBI B;  3FXL A;  1Z6R A;  2OZU A;  4K2E A;  2ZXH A;  1LB2 A;  4HOB A;  2CQN A;  3P9K A;  3TDU C;  4EM0 B;  4KFC A;  1STZ A;  1FC3 A;  1Z7L A;  1H8A C;  3H9G A;  3MKW B;  2M5W A;  2X85 A;  2K02 A;  5K7Z A;  5H2F C;  5BOX A;  1RR8 C;  2CQK A;  1KQ9 A;  1YW9 A;  2OJE D;  4J00 A;  3JRD A;  5B5E C;  1BR4 A;  1UCR A;  5AIP A;  1TWG J;  3OL4 A;  4XL9 A;  3CCS I;  2V6E A;  3ZPL A;  3TP0 A;  1V5E A;  3CC4 I;  2L3D A;  3DEW A;  2Z2S B;  2OA4 A;  4EGZ A;  3TOB A;  4IQJ A;  3KX2 A;  5J47 A;  1XD7 A;  2QZ8 A;  1OR7 A;  2V7F A;  4M9Z A;  4O5V A;  4DNC A;  1OLT A;  3HSF A;  3GZN B;  1DGW Y;  2I8D A;  3A03 A;  3J7Y J;  2H6B A;  4D7M A;  4UV9 A;  1X2M A;  2XPU A;  4ZH4 F;  4NNJ A;  4YEL A;  3Q0W A;  2V9P A;  3ERE D;  4PGH A;  3OOU A;  1FYM A;  1W1W E;  1V3F A;  1ZGW A;  5GAH J;  3I4P A;  1UG2 A;  2DA5 A;  1JT0 A;  3M7G A;  1H88 C;  3EDP A;  1XGN A;  2L2O A;  3JRE A;  4HX7 A;  1ZGA A;  1EF4 A;  1X1P A;  2CWE A;  4X1E A;  2AQF A;  5FO5 A;  1RKT A;  3UKG A;  2ZJP F;  2HPI A;  4ENM A;  1SEU A;  4P55 A;  3WTU C;  1MJB A;  3CCJ I;  1BJA A;  5LLQ A;  1MDM A;  3K4K A;  1NTC A;  1I50 J;  5IP7 J;  5LHI A;  1SAN A;  4U0Y A;  3DF8 A;  3R6S A;  1FOX A;  3GVA A;  4KUM A;  4P9U A;  3AG4 H;  3GX4 X;  5EJC A;  1P7J A;  2FUG 2;  4A5N A;  4G7H F;  1GLN A;  1LE8 A;  4N4O B;  3DCF A;  3OSG A;  4XKC A;  1AHD P;  4BJ5 C;  4QPO A;  4U87 A;  2M0C A;  4F52 A;  3N97 A;  4LMY A;  2R7Z J;  1TWA J;  2R7O A;  1XN7 A;  4RGS A;  1B72 A;  1R36 A;  2RNJ A;  3FXU A;  3QAH A;  4KJZ A;  1Z7U A;  2HNH A;  4L0Y B;  1EKE A;  2AXL A;  1MW7 A;  2IP2 A;  2EBI A;  5DDG A;  2XAJ A;  3HHH A;  2FJ1 A;  1U2W A;  3F8N A;  1QZZ A;  5FD5 A;  3W6V A;  2ZCW A;  4A93 J;  3FZV A;  4ENK A;  2BXZ A;  3F72 A;  5LEK A;  3GYH X;  3DXJ F;  1AKH A;  5DV5 A;  4BDZ A;  4CCK A;  1S7A A;  1K7A A;  3HPG A;  5ICG A;  2AHQ A;  1JTY A;  4IZZ A;  2ME0 A;  2LBF A;  4A2U A;  4BE1 A;  2QKM B;  4FIS A;  2Y30 A;  1HDD C;  1VFC A;  4XRM A;  4ENJ A;  4R1H A;  4XKV A;  1AU7 A;  3SXY A;  4XLP F;  3C1D A;  5KAI C;  3KYD B;  4L18 B;  4BAC A;  4MTD A;  2F48 A;  2LDU A;  2XDV A;  2XPV A;  2PBI A;  4XSZ F;  1YIO A;  4XM3 A;  2AS5 F;  4LJZ F;  4UUT A;  2KPM A;  4GCV A;  3HOS A;  2P8T A;  1S7E A;  4XQF A;  2VBW A;  3FM5 A;  3H9J A;  2LNB A;  3ABL H;  4L9T A;  1Z77 A;  5DM6 F;  4KT5 C;  3I4M J;  5LHH A;  3CF2 A;  3N4M A;  2EK5 A;  1P9Q C;  3DBR B;  2ECC A;  2ZME A;  2Z33 A;  3VPR A;  1WVR A;  1YE9 A;  1XGM A;  3WGH A;  3OIQ A;  3M3Y J;  2HOA A;  4S04 A;  1YO5 C;  2F4M B;  2LSO A;  4UB6 C;  3I53 A;  2VON A;  2E36 A;  3BDD A;  2O7O A;  3S32 A;  1R23 A;  1R00 A;  2CFX A;  2HYG D;  4E70 A;  1BR2 A;  5HLH A;  3HBL A;  1LFU P;  3FHN A;  3KLN A;  4UY8 I;  3HRM A;  2W00 A;  1W5S A;  2DCE A;  2K7L A;  1F36 A;  4G7O F;  3LA7 A;  1TQM A;  3WG9 A;  4AWX B;  2ZXW H;  3OYB A;  3ZQC A;  3IV5 A;  4A12 A;  2A5W A;  3BR6 A;  2DOE A;  3DEE A;  1IXC A;  5GP9 A;  1AOY A;  4M9S A;  2XF5 A;  1X2N A;  2R7V A;  1J2X A;  1QHG A;  2E34 A;  1Q1H A;  2P81 A;  2GXB A;  1FTT A;  4IRG A;  2KJB A;  1SAU A;  3IKV A;  2ELJ A;  2ZJR F;  4NBQ A;  3WE2 A;  1ZRF A;  2MAB A;  1PUE E;  2ZJQ F;  1N77 A;  2M1B A;  1MJA A;  3GEZ A;  4IJA A;  3S3M A;  2F5C A;  2FNA A;  5CVI A;  1VND A;  2UZK A;  3HOZ J;  3GBG A;  1DU0 A;  1OJL A;  3K2Z A;  5JVG F;  2ZFW A;  2GXG A;  1HKQ A;  4DQ2 A;  1LNW A;  4M3B A;  2D1H A;  2EIM H;  2BE5 F;  4KN7 X;  1QPI A;  1LJ9 A;  1WGX A;  3V42 A;  4UHT A;  2VN2 A;  3OR1 C;  3E5X A;  2KDO A;  2VT3 A;  3CUQ B;  1P4W A;  2L7Z A;  4IQ4 A;  4L5I A;  1DUX C;  1EJ9 A;  4EJT A;  1T56 A;  2HGC A;  2COM A;  2V79 A;  3WTT C;  2K3F A;  1J7K A;  1QA6 A;  3HG9 A;  4W97 A;  2KJC A;  4XIC A;  1S72 I;  2CUJ A;  1ZN2 A;  3FBN B;  4UUS A;  2XRO A;  4WCG A;  4YFN F;  5H6Q A;  1VQ6 I;  3R0J A;  5LD2 C;  4HV6 A;  3RQ4 A;  2LD5 A;  1Y8Q B;  5EEG A;  1E17 A;  3I4N J;  2PEX A;  5FKM A;  5GPC A;  1RC9 A;  4RB3 C;  2DMT A;  4MQV A;  2KMU A;  5F0H A;  3OY9 A;  1IJW C;  4U88 A;  3KZI C;  4P9F A;  3GTQ J;  3IAS 2;  2NVU B;  5FLM J;  1E3P A;  2KP6 A;  4Z2Y A;  5TGT A;  2QBY B;  5IYB J;  2JT1 A;  3F8C A;  3HRS A;  2ZME B;  3BR5 A;  1T33 A;  4YII A;  4I99 C;  3TO9 A;  2V1U A;  3HDD A;  2HEO A;  4A3K J;  3WU1 B;  2KIQ A;  4GRI A;  5KAF C;  2X4H A;  4ZYD A;  1VQM I;  4LB5 A;  5LEJ A;  2NOG A;  5J1Y A;  4L9N A;  3K1M A;  5DTD A;  1Q1V A;  1LUJ B;  2MD5 A;  2M4G A;  1BOA A;  4E7J A;  2JQ7 A;  2CFO A;  3B02 A;  3HIF A;  3NWS A;  3F6O A;  1FP2 A;  3K1P A;  1WJA A;  4MGR A;  3S1N J;  2NS8 A;  4A3G J;  1Z21 A;  2Y9Y A;  1B4A A;  3ABK H;  4EQQ A;  3CZ6 A;  2KRF A;  3FK7 A;  2VKH A;  1QHH D;  3FHZ A;  2Q8K A;  2XGE A;  1IRX A;  3IWF A;  3DBL B;  1Z9C A;  1VQ4 I;  4B1R A;  5GAE J;  5JHU A;  3FXJ A;  3QU6 A;  3GTG J;  4BQA A;  2JN6 A;  2EIN H;  1ZK8 A;  2R93 J;  3DKY A;  2RNG A;  5HS9 A;  1R49 A;  2O03 A;  1WJD A;  1U8R A;  4KMF A;  1YS7 A;  3AG1 H;  2E2J J;  3PQJ A;  4AUX A;  5FJ8 J;  4L5J A;  3OIP A;  4NB5 A;  1SAX A;  2CS3 A;  1QU3 A;  2OQR A;  1MMN A;  4DYR A;  5E17 F;  1TQI A;  1YIT I;  5D6F A;  3W2W A;  5L3E A;  2A6E F;  2KHM A;  2VOD A;  3OYE A;  2XGX A;  1QVT A;  1RZ4 A;  4EJW A;  3RYP A;  2V4J C;  3V8K A;  4G9Y A;  3CO7 C;  2M4K A;  1Z3Y A;  2X51 A;  3BTC A;  3GWZ A;  4W1U A;  2KT0 A;  2VIX A;  3BPX A;  2XF6 A;  2XAS A;  3GTP J;  5D5W B;  4BYY A;  1H89 C;  1F1Z A;  2LY2 A;  1P92 A;  1REP C;  4BEH B;  2XV4 S;  1ETX A;  2LY1 A;  1V55 H;  3G2B A;  2WAD A;  2M30 A;  3LFU A;  2LOO A;  3UNG C;  3U2R A;  3SHF A;  3DP7 A;  3OYN A;  1JT6 A;  2IBD A;  2LKX A;  2O3F A;  5EYR A;  5ILS A;  3ABM H;  1U0J A;  3TW6 A;  4BAY A;  4E6K G;  3BG7 A;  4E7S A;  5HOO A;  3L1P A;  1RR7 A;  4AU7 A;  3RI4 A;  1H9G A;  1D8J A;  2VKV A;  1ERD A;  2I10 A;  5DCM B;  3HRT A;  4IRH A;  1KU3 A;  2W84 A;  3ZQI A;  4YG2 F;  1D0Z A;  2QEN A;  1O3T A;  1M1E B;  3PSF A;  4ZYH A;  1B8I B;  4HLX A;  1DGR M;  2BBY A;  1JE8 A;  2VXD A;  5E3L A;  2IEK A;  2IW5 A;  4ZDP A;  4ZYA A;  3OYC A;  3S1R J;  3KP3 A;  2OAZ A;  4CCJ A;  1CF7 A;  2OPT A;  2PMZ N;  5CVU A;  4M73 A;  3A01 A;  5D5X B;  3SZP A;  5JR3 A;  4WK8 F;  3L2C A;  3GZ6 A;  2DDA A;  1A6I A;  3LA2 A;  3BRO A;  4I09 A;  3RKX A;  4IHX A;  3OYJ A;  1KU7 A;  1RET A;  3BJO A;  1UMQ A;  1I5Z A;  4D5F A;  1ZRD A;  3OYH A;  3LSM A;  3Q0V A;  2DT6 A;  3CP8 A;  1SFE A;  3HM5 A;  3R61 A;  4HYE A;  3LST A;  3FXR A;  4MO7 A;  4P1W A;  5FLV A;  1LDD A;  2HXO A;  1SC7 A;  2DA6 A;  4IXA A;  5DUK A;  2NXN B;  4A6E A;  4CCL A;  2FEZ A;  2LKP A;  4XRS A;  4FCY A;  4EEF G;  1T0F C;  3CC7 I;  1I27 A;  5J1U A;  3SJM A;  3S15 J;  2CRG A;  1QNT A;  1XMX A;  5D8K B;  2A05 A;  3BTL A;  3NAR A;  1WH5 A;  2OCE A;  3BR3 A;  3LSI A;  2BHY A;  2ZSH B;  2K9Q A;  2RGV A;  4Z6Y A;  1G8X A;  3KFW X;  1ZRC A;  1BR1 A;  1H0M A;  1ZR4 A;  3L09 A;  2M87 A;  5E3N A;  3J81 K;  2QF7 A;  1XC5 A;  5E8G A;  2VBZ A;  5DCM A;  4RLQ A;  2L9R A;  3RDI A;  1I6H J;  3PQK A;  3ZQH A;  1YW8 A;  2R3S A;  1D5V A;  1J9I A;  3PFI A;  1I1G A;  4ASN A;  5CQE A;  3RJP A;  2FQ4 A;  3ECO A;  3K10 A;  1OCT C;  1S8N A;  3VSK A;  3K4N A;  3MAJ A;  3VOD A;  2R7S A;  4OAZ A;  1F9N A;  4GGG A;  2XSJ C;  3I5U A;  1OCR H;  1D1C A;  2YR2 A;  4M6X A;  3G1O A;  2IS2 A;  2Y0S A;  4C9Y A;  3J81 Z;  2VAS A;  3O3K A;  4C30 A;  2DOD A;  4E7H A;  2PG4 A;  1Z67 A;  1BOB A;  1JJ8 C;  3ZMD A;  3MWM A;  5FGM A;  5HS7 A;  3PIP F;  4HAM A;  2DYS H;  2L9N A;  3Q3S A;  2PX9 A;  3BCB A;  1IAW A;  2LF7 A;  4CDG A;  2HDD A;  1FMV A;  2R0Q C;  4EJV A;  5IT9 K;  2DA3 A;  4G6Q A;  4IRI A;  1FPQ A;  3MCZ A;  5B3S H;  4BE0 A;  5J8F A;  1S29 A;  3BP8 A;  1IN4 A;  1BI2 A;  4DOZ A;  3MN2 A;  3CDL A;  3LQR A;  3JAM Z;  1JKR C;  3IH3 A;  4HF2 A;  3ZQG A;  1LKX A;  3NAU A;  1R5H A;  2WC2 A;  2VUM J;  5C44 J;  2KL4 A;  2C6Y A;  2DA7 A;  3PL8 A;  4I02 A;  2M2E A;  1TBX A;  5HLG A;  3ZMT A;  4AYB A;  3HUG A;  3TQN A;  2AQE A;  2JRT A;  3OWT A;  5F1R A;  1ONV A;  4IHY A;  5CVR A;  3D5S C;  1KYZ A;  1LDJ A;  2P5V A;  3OYI A;  3CCL I;  3L9F A;  1ZG3 A;  1Y8R B;  3KPH A;  2VXZ A;  3G73 A;  4XLH A;  4BBR J;  3MQ0 A;  1JJ6 C;  2WA0 A;  2GA2 A;  4A0Y A;  1I39 A;  3M8E A;  4XLF A;  1DPR A;  4EGY A;  2LVS A;  1WZ2 A;  4CCM A;  1KON A;  4FQG A;  3A2K A;  2L4A A;  1TQP A;  3EUH A;  1G3S A;  3E6D A;  5HLT A;  2GZW A;  4WXD A;  3PUF A;  1HOM A;  5J3L A;  1A35 A;  2YPR A;  1VF9 A;  4QLC U;  4BXX J;  2ELK A;  2L4M A;  2X1C A;  4U0V A;  1S6L A;  1OKR A;  4HX4 A;  4KIB A;  1HW1 A;  3C2G A;  3JTH A;  2ETH A;  2QSG X;  2LF8 A;  3HOV J;  2M8G X;  3EUA A;  4M3E A;  1R58 A;  2F5V A;  2CW8 A;  5IPA A;  1V5G A;  2TRT A;  1FBU A;  2VC0 A;  2YU3 A;  3GTJ J;  2UXN A;  1T38 A;  2OD5 A;  1HLV A;  2BYV E;  1FT9 A;  3W6J B;  1E0E A;  4F91 B;  1YRN B;  1SFO J;  1TP4 A;  4UUS B;  3MKZ A;  2KKO A;  3PJR A;  1UG0 A;  5K5Q A;  1FSH A;  3A02 A;  4N9I A;  2VJ4 A;  1MBG A;  1MBE A;  4LFU A;  2DFF A;  1WRJ A;  4OMZ A;  3VSL A;  3J7Z I;  3OYM A;  4UNO A;  4LIT A;  2K9S A;  1N25 A;  3JRB A;  4HDU A;  2LR8 A;  3S1M J;  5CLS A;  1CQT A;  5L3B A;  1XCB A;  3PFY A;  3TO7 A;  2XHK A;  1MH3 A;  4PJ0 C;  3OR2 C;  3K69 A;  2L0K A;  3RPU A;  1SD6 A;  4GFB A;  2K3P A;  2LRD A;  4RGU A;  1OCZ H;  4II2 A;  4Y3O A;  3C3W A;  3O8H A;  4BU2 A;  3BZC A;  2DT5 A;  2PN6 A;  3J80 Z;  2B63 J;  4M3D A;  1W36 C;  4G6T B;  2E1N A;  1SVO A;  3H3V K;  3D5R C;  4KMU X;  5TIS C;  4CYC A;  3DTI A;  1BW6 A;  3BPV A;  2LC2 A;  5HLI A;  1NHA A;  1TWH J;  3LWF A;  1X1D A;  4HNU A;  4Y17 A;  2RKH A;  3CC2 I;  2VPL A;  1DP3 A;  2F6C A;  1R7J A;  1W5C C;  3BR0 A;  4F92 B;  5DS9 A;  2VLA A;  2VC1 A;  2STT A;  1XMK A;  1SMY F;  4G8X A;  2XGD A;  1ZGJ A;  3F0C A;  1BBY A;  4Q48 A;  2QM3 A;  2IRF G;  1U78 A;  4O6J A;  2FNP A;  4PGG A;  3GFJ A;  3E6B A;  3LSJ A;  4CIC A;  2BZT A;  2K86 A;  4YIF A;  2IT0 A;  3CDI A;  3V8J A;  2DK5 A;  1I1S A;  1SD5 A;  2ADU A;  3CJN A;  2F4I A;  4WX9 A;  4A3I J;  5CKT A;  2I5U A;  2DTR A;  3A0B C;  3FK6 A;  2OCC H;  2R7Q A;  2COB A;  3MZ8 A;  4CZZ A;  1IRZ A;  1S3J A;  2MLG A;  2PMU A;  1FOY A;  1MGT A;  1NK2 P;  2V26 A;  2HQN A;  1W0U A;  1USS A;  5M5Y J;  1BL0 A;  2GM4 A;  1OYI A;  2O8X A;  1QGP A;  5M5W J;  1HKT A;  4II3 A;  1OCC H;  5HDG A;  3QOE A;  2IA0 A;  4D5C A;  2E7W A;  1Y1W J;  1MMA A;  5A2Q Z;  2HWV A;  4PUS A;  4LB6 B;  1T2K A;  1S9H A;  4D1Q A;  3ZMU A;  3LAP A;  1OMI A;  1IN5 A;  1QO0 D;  4XLE A;  1KU9 A;  3FIW A;  2MG4 A;  2KFD A;  1EH7 A;  2NNN A;  5JFR A;  4BS9 A;  2RAE A;  3I58 A;  4L0Z B;  1RI7 A;  3I59 A;  2HOT A;  3L2V A;  4Y15 A;  4OU0 A;  3VYT B;  4CZC A;  2GXA A;  4DYC A;  3DFG A;  2FU4 A;  1FBQ A;  1W5T A;  1G2H A;  4G6D A;  1O3Q A;  4UVA A;  1PUF A;  1XB4 A;  1G6N A;  2EJR A;  2E35 A;  3WU2 C;  5A2Q K;  3CD6 I;  1FIA A;  5K5O A;  2VJI A;  2M9H A;  2UXX A;  1QRY A;  4EM1 A;  1IXR C;  3QPL A;  1BIB A;  1MBK A;  2HYJ A;  2K40 A;  3IL2 A;  1ZHF A;  3S17 J;  4ANJ A;  1LVK A;  2JA7 J;  1IZ1 A;  2D2W A;  3NWT A;  1VQO I;  2GIV A;  1ZAR A;  3I55 I;  5GPA A;  4LG0 B;  2TCT A;  5C4J J;  4D0P A;  1N75 A;  1HDP A;  4XLA A;  1ETQ A;  1DDN A;  2XIG A;  4RAF A;  3IH2 A;  2X9D A;  4MFE A;  3MKY B;  4N4N B;  3H0G J;  1UB9 A;  1EH8 A;  1UHM A;  2DAO A;  3F3X A;  2GOM A;  1HCR A;  3BCA A;  1A6Q A;  4A3M J;  4RB0 A;  2HS5 A;  2Q0O A;  3IRR A;  4B09 A;  1B72 B;  1RUO A;  1JKQ C;  1F43 A;  2EIK H;  3TOA A;  1VQN I;  2EV0 A;  1W4M A;  2EZL A;  2H8R A;  3O8G A;  1IXS B;  3W6K B;  1ZKG A;  2NVQ J;  1IC8 A;  1XGS A;  3FIS A;  4M6V A;  4HDV A;  2FD5 A;  2QYO A;  2KDZ A;  1A04 A;  2R7X A;  4P5O A;  3C18 A;  4A69 C;  2QGU A;  3LL7 A;  3TMO A;  2L54 A;  4HG2 A;  4FE7 A;  2FQ3 A;  4AIH A;  1O3S A;  1VQL I;  3HOU J;  1BI3 A;  3OIO A;  2ELH A;  4HST A;  4MTE A;  1J09 A;  4AD9 A;  2CJJ A;  4FAS D;  1OYW A;  1YTY A;  2HTJ A;  3F23 A;  2MYS A;  2CV0 A;  3L2R A;  4PJJ A;  2QEX I;  3QPH A;  2Y2Z A;  3IH4 A;  2VI6 A;  3S8P A;  3GZ5 A;  3S14 J;  4NDL A;  1XTA A;  4XLN F;  4OIO F;  3CCY A;  1QZE A;  3NRV A;  2ZJ2 A;  3Q0U A;  4UVC A;  3SZG A;  5L3C A;  5FKN A;  3H5R A;  4IL6 C;  2Y48 A;  3LA3 A;  3KZZ A;  1TWF J;  3CDH A;  5D5V B;  4HSR A;  3AG2 H;  3QYB A;  4EJU A;  5K5R A;  3QOD A;  3RKQ A;  3RSN A;  4RGR A;  2DXI A;  1IDY A;  2EIL H;  2RC4 A;  2CV1 A;  4OIN F;  3H36 A;  3TP3 A;  3TBI A;  1JUM A;  3N05 A;  4IHW A;  2L01 A;  2Y31 A;  3A0H C;  1K4T A;  1W7P D;  4HF0 A;  2IGN A;  3CQZ J;  4IF4 A;  4RBO A;  1SMT A;  4LLG F;  5L3F A;  3FXM A;  3IUO A;  1KU2 A;  3FMR A;  4CCN A;  5EZG A;  1BC7 C;  2AO9 A;  3G6E I;  1R4N B;  5CPR B;  3KCC A;  5F1J A;  2DW4 A;  5L3D A;  1IGN A;  2QSH X;  4IO9 F;  4RDU A;  3UR3 C;  3H9Q A;  1G59 A;  1A5J A;  3WTS C;  2BHZ A;  5BMZ A;  2DT7 B;  3ML6 A;  2CSO A;  4Q47 A;  3JR9 A;  1T08 B;  3B73 A;  2DMN A;  3C2H A;  4UV8 A;  1RNL A;  1U5T A;  3AKZ A;  1X3Z B;  3K6G A;  4A3F J;  2PJP A;  1GVD A;  2RDP A;  2DMU A;  1KA8 A;  4ZYG A;  3WTW C;  2E1O A;  4DW6 A;  2EWN A;  2Z99 A;  2D1V A;  1K6O A;  1ETO A;  2EFQ A;  2W4S A;  2X6O A;  3BQZ A;  3Q9V A;  4A3C J;  2AXT C;  3FMS A;  3ZOB A;  1E3O C;  4BJ6 C;  2WY8 Q;  2VJJ A;  2ZC2 A;  3K4J A;  3M8F A;  1JHF A;  2W48 A;  1RKW A;  5BS6 A;  2CQX A;  1FYL A;  1TWC J;  1YQA A;  2GA1 A;  2DI3 A;  5J40 A;  2K5C A;  1LDK B;  2ISY A;  4KIS A;  2BY3 A;  4S05 A;  2EFO A;  1GDT A;  2W25 A;  3CP2 A;  3U1K A;  1ON2 A;  2O8K A;  1ZH5 A;  1FBS A;  3FMQ A;  1B9M A;  1MND A;  3LAJ A;  4MHG A;  2E2H J;  4WXC A;  2A61 A;  2FA5 A;  2WAQ N;  4XOR A;  2Q2E B;  4XBF A;  5AON A;  2E1M C;  3W2V A;  1W7P A;  3LSK A;  4XON A;  3BG6 A;  1GVJ A;  1RUN A;  1U9O A;  2RRE A;  5DUI A;  1WCM J;  2CGP A;  3KP6 A;  1G3Y A;  4ZZD A;  3L2Q A;  2EPF A;  2RQQ A;  4MIM A;  2QBY A;  3BTJ A;  4IVN A;  1UZC A;  2V9V A;  1B1B A;  2EQR A;  3ASN H;  2J5O A;  2EA4 A;  2ZB9 A;  5ILU A;  3OMY A;  1WJB A;  2H09 A;  3U1D A;  2BVM A;  4ZTJ A;  3BJ6 A;  2TDX A;  1P7I A;  1J5Y A;  2VKE A;  4BY1 J;  3T0Y A;  1FEX A;  4WF2 A;  2JPC A;  4HV5 A;  4I76 A;  5F0F A;  3BG3 A;  2DYR H;  1WI9 A;  1T39 A;  3B6A A;  3EUK L;  1K83 J;  4BQQ A;  2ECB A;  2EB7 A;  2N8G A;  1OCO H;  3H0D A;  3G1L A;  1P6R A;  1E2X A;  2BGC A;  3IP4 B;  3KP7 A;  4ZYE A;  1R22 A;  1YHQ I;  4PZJ A;  3KET A;  1SFU A;  2IGM A;  3U9G A;  3FXQ A;  3J7A Y;  5E79 C;  4JK1 X;  5B66 C;  1HW5 A;  5HDK A;  5D8L B;  4IEJ A;  2ZBK A;  2F2E A;  1T8I A;  3EUH C;  1WWX A;  3LSR A;  1HSJ A;  1Z6T A;  2P0W A;  3I9V 2;  2FRH A;  4I0B A;  1XDS A;  3BR2 A;  4DIQ A;  4A3E J;  2M7A A;  2EIJ H;  2IVM A;  2VKD A;  2XAF A;  2PJR B;  4BNC A;  2BY2 A;  5FFX A;  2WWY A;  1SVL A;  4QSH A;  1UAA A;  5IT3 A;  2LTP A;  2PJR A;  3IRQ A;  4M74 A;  2ZKZ A;  2W85 A;  1U5T C;  4ESB A;  3QWL A;  2QSF X;  3MFK A;  2EFP A;  3T5X A;  1QZY A;  1GUU A;  3AFH A;  1D8K A;  1FWZ A;  4HLY A;  4ZDL A;  2LYC A;  3FKI J;  2JJ7 A;  3GXO A;  4DZP A;  2XGC A;  1JKP C;  2R7W A;  3RZD J;  5IYC J;  2XC7 A;  4QIW N;  3AL0 C;  1GHC A;  4DGW B;  2DN0 A;  2M45 A;  4BH9 A;  1K79 A;  1W0T A;  3R4K A;  1IUY A;  1DP7 P;  3GLL A;  2DA4 A;  2YX7 A;  4OIR F;  4EMS A;  4LOC A;  5K7H A;  3BG5 A;  3FXK A;  2NS7 A;  5BNG A;  1ITY A;  5ICC A;  3D0S A;  5KVR A;  1JUS A;  2DTZ A;  2PQ8 A;  4L9V A;  4U7D A;  2VQH A;  5JVT A;  4I98 B;  2W7N A;  1VQ5 I;  4ON0 A;  4PFO A;  1SFX A;  2X48 A;  3RTR A;  1HKS A;  4EJO A;  4YFX F;  3SZT A;  1X4O A;  2X6W A;  3NEU A;  3D5L A;  2F5E A;  1PVE A;  3JRA A;  3CUQ C;  1FMW A;  4RAY A;  2DPU A;  2CW0 F;  2VBY A;  5IYD J;  2WV0 A;  4CA0 A;  2KIF A;  3BQY A;  3DKX A;  2GIZ A;  2DA2 A;  4PCQ A;  4H0E A;  3KLO A;  1QQI A;  1MMD A;  1ZQ3 P;  3ROU A;  4I2O A;  4IHT A;  4AIJ A;  2HOE A;  2IJL A;  1Z05 A;  2RVC A;  3H35 A;  2FSW A;  1TW2 A;  1BIA A;  3DKW A;  5ERI A;  1FJL A;  1IDZ A;  3TKY A;  2ZO4 A;  4HQE A;  3LSH A;  2A07 F;  2OUM A;  1YRN A;  1TNT A;  2CMP A;  2CQQ A;  1OYY A;  3EET A;  4X0G A;  2QQ9 A;  3F9K A;  5HNH A;  3VWB A;  2O0Y A;  3PO2 J;  1O7L A;  5LRR A;  4BQO A;  2CW7 A;  3SQN A;  2VE8 A;  4BQN A;  4L9J A;  4NC7 A;  2JZY A;  2JSP A;  2WB1 N;  2DOF A;  4ENN A;  3I59 B;  1FX7 A;  2ESN A;  2Q2E A;  3QPS A;  4OOI A;  5LRS A;  1WJF A;  1XS9 A;  1S7O A;  4Y7N J;  3I3L A;  4XKB A;  5FKK A;  3MMY B;  3HHG A;  3EPZ A;  3LSG A;  2JTV A;  4ITV A;  3G71 I;  3WE3 A;  2F5F A;  2O5R A;  1D1B A;  2H27 A;  4Q5S F;  2J5P A;  3CF5 F;  2PI0 A;  2QLZ A;  4OWR B;  2PMZ A;  3OS1 A;  2KRC A;  3WHC A;  1IRF A;  1HF0 A;  1L0O C;  2O6G E;  5IT9 Z;  1OPC A;  5JLW A;  2E5Z A;  4DZJ A;  1ACI A;  4OIP F;  1ETK A;  2HFH A;  4F55 A;  2MLK A;  4HW0 A;  3RZO J;  2V1D A;  3ZQL A;  3CCV I;  2QWW A;  3HPH A;  2A68 F;  4XOP A;  3VDX A;  2BOL A;  2HOS A;  1FTZ A;  5BPI A;  5K7F A;  1OR7 C;  3DEU A;  1U3E M;  4RLF A;  2M8E A;  1WSU A;  1SVM A;  5FD6 A;  2L02 A;  2DK8 A;  1EH6 A;  1FY7 A;  3COA C;  2ZXI A;  4CGZ A;  4C3H J;  1SD4 A;  2YUS A;  4I0A A;  3ZR8 X;  5ICE A;  1UEL B;  3HOX J;  2JA8 J;  5DEQ A;  4IHV A;  3K7A J;  3RQI A;  3PM1 A;  3RKW A;  1FOK A;  4NC6 A;  4M6Y A;  2MGQ A;  5FFZ A;  2NVT J;  3HB9 A;  2DO7 A; 
#chains in the Genus database with same CATH homology
 1BC8 C;  3F8M A;  3KZY A;  1CF7 B;  1XCV A;  3K1N A;  1KQ8 A;  3R60 A;  4ZZL A;  5E20 A;  3HTS B;  1YLF A;  2MC3 A;  1LVA A;  1MD0 A;  2F5D A;  2Z3Y A;  3FWE A;  4UUV A;  1B9N A;  3WU0 A;  5E1Z B;  1IN8 A;  4HZF A;  4IPA A;  3H3U A;  1XMA A;  2NS0 A;  1IN7 A;  1ZRE A;  2DFI A;  2FBK A;  5K1Y A;  3J7A O;  1U5T B;  3BOQ A;  2K27 A;  1QBJ A;  2P6S A;  2E7X A;  5DD8 A;  3AAF A;  4AIK A;  2ISZ A;  1CGP A;  3QOP A;  3T1B A;  2A5Y B;  1TW3 A;  2DU9 A;  5ED4 A;  5LGT A;  5LGU A;  4U7B A;  3EQL F;  4R79 A;  4GO1 A;  1KQ0 A;  3E5Q A;  4KIG A;  2ZXJ A;  4BHB A;  2FOK A;  3P9C A;  4KIC A;  4KYW A;  4MEX F;  3GLX A;  1RIO H;  1ODD A;  2VOP A;  3IKT A;  4MNU A;  5EEH A;  3IC7 A;  1XDU A;  2A69 F;  3GF2 A;  3T8T A;  1ZAO A;  1LEA A;  3F22 A;  3KEO A;  2JSC A;  2FMY A;  1HW2 A;  2P6T A;  3V8L A;  1TLH B;  1KGS A;  2UWM A;  5DD4 A;  1MDM B;  3O2P E;  1FP1 D;  2ACJ A;  2P7V B;  2XAQ A;  5KK1 A;  2G7U A;  2IA2 A;  3E97 A;  2P4W A;  3ISP A;  3HYI A;  1B6A A;  2JPB A;  4WWC A;  1GXP A;  4WXH A;  3ZN0 A;  1D3Y A;  1XGO A;  3Q9S A;  4O3M A;  2G7H A;  5LGN A;  3VOE A;  3QRF F;  4CXF A;  2NRA C;  1R5G A;  4ESJ A;  3WTY C;  2G9W A;  3KP5 A;  2EV5 A;  1BI0 A;  2HQR A;  2HKX A;  3ZN1 A;  2OU2 A;  2V1X A;  2ZNY A;  5CYV A;  2CYY A;  3ABU A;  1KYW A;  2DQL A;  4F7Z A;  2MH2 A;  3L00 A;  4KIF A;  3JAM K;  3K9T A;  1ZLJ A;  3TDZ C;  1Z1D A;  3I71 A;  1O57 A;  2ZNZ A;  4KN4 X;  5DCF A;  3DPL C;  1YS6 A;  1BN5 A;  1HBX G;  5HDN A;  4FT8 A;  3K0L A;  1YYV A;  2XUB A;  3O6B B;  5BPD A;  2P5K A;  5JI6 A;  4KNY A;  4FX4 A;  1MJ9 A;  1U6G A;  4EV0 A;  2P5L C;  5F6F A;  1B59 A;  4GXO A;  3REO A;  5H20 A;  1R1U A;  4JQF A;  1ZLK A;  3F8B A;  1GXQ A;  5CJ9 A;  2OBP A;  3ZMZ A;  4ETS A;  2NYX A;  1K78 B;  1UHW A;  3J80 K;  4N9H A;  2FML A;  2HYF A;  1PP8 F;  4MQ9 F;  2HR3 A;  3E5U A;  2MH9 A;  3RIR A;  4BHC A;  2K4J A;  3Q5F A;  4A0Z A;  2BV6 A;  2GAU A;  1G3T A;  2IA1 A;  4RB2 C;  3LFK A;  2HZT A;  2HDC A;  4HBL A;  2OZ6 A;  4TV7 A;  3R0A A;  1EV7 A;  2QUF A;  3VEP A;  1XSV A;  3ZMV A;  5D4S A;  3MEX A;  4OMY A;  3H3Z A;  3QPT A;  3CUO A;  3M9A A;  5E8I A;  5CVJ A;  3E3V A;  3IWZ A;  3CUQ A;  2R7D A;  3CO6 C;  2DLL A;  3IHU A;  4CO8 A;  1JHH A;  1R1T A;  2VOO A;  4IHS A;  4HF1 A;  2QVO A;  2CO5 A;  1BI1 A;  4LLN A;  3JW4 A;  2DQR A;  1T98 A;  4LD5 A;  3I54 A;  4CHU A;  3HOT A;  1HXD A;  5D4R A;  2VT2 A;  1O3R A;  3KP4 A;  2CG4 A;  4M71 A;  3GFI A;  2EA2 A;  3EYY A;  3HTU A;  3L7W A;  3G3Z A;  2XAG A;  4Y13 A;  2EFW A;  3I0T A;  5D6E A;  2PLY A;  5H6R A;  3VFZ A;  5FB2 A;  2Z9O A;  4HQM A;  3WGI A;  5FLX K;  3H92 A;  3JSP A;  2XAH A;  1XSD A;  1X3U A;  1WQ2 A;  1LEB A;  4FHT A;  1F4K A;  1V4R A;  4UVB A;  4PDK A;  3V7R A;  1FSE A;  3S2W A;  4M72 A;  2MA3 A;  1W7P B;  4NQW A;  1ON1 A;  3ELK A;  1SD7 A;  4A0X A;  1HQC A;  1UFM A;  4I01 A;  3QU3 A;  3QP5 A;  5E18 F;  4ESF A;  3MZH A;  2FBH A;  3FX3 A;  1AWC A;  4KDP A;  3E6M A;  2YX4 A;  2K4B A;  2ESH A;  3LQQ A;  1JGS A;  4LGW A;  1J75 A;  1T6S A;  2KIM A;  1JXS A;  1IRG A;  4I7H A;  3KE2 A;  4LK1 F;  4XRF A;  1YW7 A;  3F8F A;  5TJJ A;  2O61 A;  1IF1 A;  5ILV A;  2GWR A;  3CTA A;  2W57 A;  2BEO A;  5F64 A;  3E6C C;  5E1W A;  5FLX Z;  2FE3 A;  4BHP A;  1IW7 F;  1P4X A;  1J59 A;  5DYM A;  3WTV C;  2A3S A;  3BZ6 A;  3ULQ B;  3I64 A;  1MKM A;  4RS8 A;  1LQ1 A;  4GYI A;  4UXN A;  2W24 A;  3QP6 A;  2KIU A;  3ZP5 A;  1VTN C;  4RGX A;  2QQA A;  2GQQ A;  2Y0M A;  1J0R A;  3V7S A;  3ABT A;  2A6H F;  1G3W A;  4EM2 A;  1F5T A;  2PMH A;  1DPU A;  4G94 A;  3WTX C;  1G4D A;  2XKO A;  1FYK A;  4LG0 A;  5J6X A;  3WTZ A;  5TRD A;  3TO6 A;  4CYD A;  4BXU A;  1ZG1 A;  2EV6 A;  3GFL A;  1ZG5 A;  3RYR A;  3GW2 A;  2FXA A;  2XKP A;  1YFH A;  3HSE A;  3NQO A;  4RAZ A;  2X0L A;  3P7N A;  3FM3 A;  3OV8 A;  2V6C A;  5D5U B;  3F6V A;  1Y0U A;  2E1C A;  1H9T A;  3FF5 A;  4LK0 F;  4M9X A;  5J8C A;  1FLI A;  3MZY A;  2XVC A;  4KA4 A;  3M1E A;  2H6C A;  1YG2 A;  3RKY A;  4HX8 A;  2OQG A;  1TNS A;  3RPQ A;  1UST A;  3JTG A;  1XSX A;  3VB2 A;  3BJA A;  4B8X A;  4U0W A;  3GO5 A;  3KP2 A;  2P7C B;  2VE9 A;  2Z5U A;  1PP7 U;  5CVV A;  2PFB A;  3SFZ A;  3DQV C;  4JBA A;  2RQP A;  2QQB A;  1IN6 A;  2HTS A;  4QWQ A;  2RN7 A;  3V4G A;  1O7F A;  3P9I A;  3BWG A;  3C7J A;  4YFK F;  2RV8 A;  4N0B A;  5AIQ A;  3KEQ A;  5HVQ C;  1ZYR F;  2B0L A;  5BQT A;  3ZQ7 A;  1FZP B;  3JSO A;  1Z91 A;  4EVI A;  1I6X A;  4AVP A;  4FX0 A;  4Q4Z F;  3DV8 A;  3WGG A;  1BM9 A;  5HS8 A;  1P2F A;  1C0W A;  1QPM A;  2H94 A;  4XSX F;  4MEY F;  3T8R A;  3BY6 A;  3OOP A;  4G7Z F;  2DBB A;  1K78 A;  3ECH A;  1TTY A;  3V7C A;  2NAZ A;  1R1V A;  3DPT A;  3HSR A;  3EYI A;  6PAX A;  3GUD A;  2STW A;  4A6D A;  4NHJ A;  3WOD F;  2DPD A;  4HA8 A;  2NNY A;  2IPQ X;  3CLO A;  3TGN A;  2WTE A;  5E1X A;  1MZB A;  2FBI A;  3F21 A;  1ULY A;  2Y75 A;  1PDN C;  1HST A;  1P4A A;  4OIQ F;  2YSR A;  3HRU A;  2D45 A;  5LHG A;  2FF4 A;  2VBX A;  5L3G A;  2XRN A;  2MBF A;  3GFM A;  2R7F A;  2HKO A;  3ZMS A;  5ICF A;  2EFN A;  1FNN A;  1T0F A;  4P96 A;  5LBQ A;  4RB1 A;  4GYG A;  4LLL A;  4R8H A;  1WKM A;  4A5M A;  1L3L A;  1Z6R A;  2OZU A;  4K2E A;  1LB2 A;  4HOB A;  3P9K A;  3TDU C;  4EM0 B;  4KFC A;  1STZ A;  1FC3 A;  2M5W A;  2K02 A;  5BOX A;  2CQK A;  1KQ9 A;  1YW9 A;  1UCR A;  5AIP A;  3ZPL A;  2L3D A;  2OA4 A;  4EGZ A;  3TOB A;  1XD7 A;  2QZ8 A;  1OR7 A;  4M9Z A;  4O5V A;  4DNC A;  3HSF A;  2H6B A;  4UV9 A;  4ZH4 F;  3ERE D;  4PGH A;  1FYM A;  1V3F A;  3I4P A;  3M7G A;  3EDP A;  1XGN A;  4HX7 A;  1ZGA A;  2CWE A;  5FO5 A;  4ENM A;  4P55 A;  3WTU C;  1MJB A;  1BJA A;  5LLQ A;  1MDM A;  5LHI A;  4U0Y A;  3DF8 A;  3R6S A;  3GVA A;  4KUM A;  4P9U A;  3GX4 X;  4A5N A;  4G7H F;  3N97 A;  4LMY A;  1XN7 A;  4RGS A;  1R36 A;  2RNJ A;  3FXU A;  3QAH A;  1Z7U A;  4L0Y B;  2AXL A;  2IP2 A;  5DDG A;  2XAJ A;  3HHH A;  5FD5 A;  1U2W A;  1QZZ A;  3F8N A;  2ZCW A;  3FZV A;  4ENK A;  3F72 A;  5LEK A;  3GYH X;  3DXJ F;  5DV5 A;  1S7A A;  1K7A A;  5ICG A;  4A2U A;  4ENJ A;  4R1H A;  3SXY A;  4XLP F;  3C1D A;  4L18 B;  4MTD A;  2LDU A;  4XSZ F;  2PBI A;  2AS5 F;  1YIO A;  4LJZ F;  4GCV A;  3HOS A;  2P8T A;  2VBW A;  3FM5 A;  2LNB A;  4L9T A;  4KT5 C;  5LHH A;  3N4M A;  2EK5 A;  2ZME A;  2Z33 A;  1XGM A;  3WGH A;  4S04 A;  1YO5 C;  2LSO A;  3I53 A;  2VON A;  3BDD A;  1R23 A;  1R00 A;  2CFX A;  2HYG D;  4E70 A;  5HLH A;  3KLN A;  3HRM A;  1W5S A;  2K7L A;  4G7O F;  3LA7 A;  1TQM A;  3WG9 A;  4AWX B;  4A12 A;  1IXC A;  1AOY A;  4M9S A;  1J2X A;  1Q1H A;  2GXB A;  4IRG A;  2KJB A;  3IKV A;  3WE2 A;  1ZRF A;  1PUE E;  2M1B A;  1MJA A;  3GEZ A;  4IJA A;  2F5C A;  2FNA A;  5CVI A;  2UZK A;  3K2Z A;  2ZFW A;  2GXG A;  1HKQ A;  4DQ2 A;  1LNW A;  2D1H A;  2BE5 F;  4KN7 X;  1LJ9 A;  4UHT A;  2VN2 A;  3E5X A;  2VT3 A;  3CUQ B;  1P4W A;  4L5I A;  1DUX C;  4EJT A;  2HGC A;  2COM A;  2V79 A;  3WTT C;  1J7K A;  2KJC A;  2XRO A;  1ZN2 A;  4WCG A;  4YFN F;  5H6Q A;  3R0J A;  4HV6 A;  5EEG A;  1E17 A;  2PEX A;  4RB3 C;  4MQV A;  4U88 A;  4P9F A;  4Z2Y A;  2QBY B;  2JT1 A;  3F8C A;  3HRS A;  2ZME B;  4YII A;  2V1U A;  3TO9 A;  2HEO A;  3WU1 B;  2X4H A;  4ZYD A;  4LB5 A;  5LEJ A;  4L9N A;  3K1M A;  2MD5 A;  1BOA A;  3B02 A;  3HIF A;  3F6O A;  1FP2 A;  3K1P A;  4MGR A;  1B4A A;  4EQQ A;  2KRF A;  3FHZ A;  2Q8K A;  3IWF A;  1Z9C A;  5JHU A;  3QU6 A;  4BQA A;  5HS9 A;  2O03 A;  1U8R A;  4KMF A;  1YS7 A;  3PQJ A;  4L5J A;  4NB5 A;  1SAX A;  2OQR A;  5E17 F;  1TQI A;  5D6F A;  5L3E A;  2A6E F;  2VOD A;  2XGX A;  1RZ4 A;  4EJW A;  3RYP A;  3V8K A;  4G9Y A;  3CO7 C;  3GWZ A;  3BPX A;  2XAS A;  5D5W B;  4BYY A;  1F1Z A;  1P92 A;  1REP C;  2XV4 S;  2M30 A;  3U2R A;  3SHF A;  3DP7 A;  2O3F A;  5ILS A;  4BAY A;  5HOO A;  3RI4 A;  1H9G A;  1D8J A;  5DCM B;  3HRT A;  4IRH A;  1KU3 A;  2W84 A;  4YG2 F;  2QEN A;  1O3T A;  4ZYH A;  4HLX A;  2BBY A;  1JE8 A;  2IW5 A;  3KP3 A;  2OAZ A;  1CF7 A;  5CVU A;  4M73 A;  5D5X B;  3SZP A;  5JR3 A;  4WK8 F;  3L2C A;  3GZ6 A;  3LA2 A;  3BRO A;  4I09 A;  3RKX A;  1KU7 A;  3BJO A;  1I5Z A;  1ZRD A;  1SFE A;  3R61 A;  4HYE A;  3LST A;  3FXR A;  1LDD A;  4IXA A;  5DUK A;  4A6E A;  2FEZ A;  2LKP A;  1I27 A;  1QNT A;  5D8K B;  2RGV A;  3KFW X;  1ZRC A;  1H0M A;  3L09 A;  2M87 A;  3J81 K;  5E8G A;  2VBZ A;  5DCM A;  3RDI A;  3PQK A;  1YW8 A;  2R3S A;  1D5V A;  1J9I A;  3PFI A;  1I1G A;  4ASN A;  3RJP A;  3ECO A;  1S8N A;  3MAJ A;  3VOD A;  1F9N A;  4GGG A;  3I5U A;  2YR2 A;  4M6X A;  3J81 Z;  3O3K A;  2PG4 A;  3ZMD A;  3MWM A;  5FGM A;  5HS7 A;  4HAM A;  1IAW A;  2LF7 A;  4CDG A;  4EJV A;  5IT9 K;  4G6Q A;  4IRI A;  1FPQ A;  3MCZ A;  5J8F A;  1S29 A;  3BP8 A;  1BI2 A;  1IN4 A;  3LQR A;  3JAM Z;  4HF2 A;  1R5H A;  2WC2 A;  2C6Y A;  4I02 A;  1TBX A;  5HLG A;  3ZMT A;  3HUG A;  3TQN A;  2JRT A;  5F1R A;  1ONV A;  5CVR A;  1KYZ A;  1LDJ A;  2P5V A;  3L9F A;  1ZG3 A;  2VXZ A;  3G73 A;  3MQ0 A;  2GA2 A;  4A0Y A;  3M8E A;  1DPR A;  4EGY A;  2L4A A;  1TQP A;  3EUH A;  1G3S A;  3E6D A;  2GZW A;  4WXD A;  2YPR A;  4QLC U;  2L4M A;  4U0V A;  1S6L A;  1OKR A;  4HX4 A;  4KIB A;  1HW1 A;  3JTH A;  2ETH A;  2LF8 A;  1R58 A;  1FBU A;  2VC0 A;  2YU3 A;  2UXN A;  1T38 A;  2OD5 A;  2BYV E;  1FT9 A;  3W6J B;  2KKO A;  5K5Q A;  1FSH A;  4N9I A;  4LFU A;  1WRJ A;  4OMZ A;  4UNO A;  4HDU A;  5CLS A;  5L3B A;  1XCB A;  3TO7 A;  2XHK A;  3K69 A;  3RPU A;  1SD6 A;  4RGU A;  3C3W A;  2DT5 A;  2PN6 A;  3J80 Z;  2E1N A;  4KMU X;  3BPV A;  5HLI A;  1NHA A;  3LWF A;  4Y17 A;  2RKH A;  1R7J A;  2STT A;  2VC1 A;  1XMK A;  1SMY F;  4G8X A;  1ZGJ A;  1BBY A;  2IRF G;  4Q48 A;  2QM3 A;  1U78 A;  4O6J A;  2FNP A;  4PGG A;  2IT0 A;  4YIF A;  3GFJ A;  3E6B A;  4CIC A;  2K86 A;  3V8J A;  1I1S A;  2DK5 A;  1SD5 A;  2ADU A;  3CJN A;  4WX9 A;  2DTR A;  4CZZ A;  1S3J A;  2MLG A;  2PMU A;  1MGT A;  2HQN A;  1USS A;  1OYI A;  2O8X A;  1QGP A;  1HKT A;  5HDG A;  2IA0 A;  2E7W A;  5A2Q Z;  2HWV A;  4LB6 B;  1T2K A;  3ZMU A;  3LAP A;  1OMI A;  1IN5 A;  1QO0 D;  1KU9 A;  1EH7 A;  2NNN A;  5JFR A;  3I58 A;  4L0Z B;  1RI7 A;  3I59 A;  4Y15 A;  4OU0 A;  3DFG A;  2FU4 A;  1FBQ A;  1W5T A;  4G6D A;  1O3Q A;  4UVA A;  1XB4 A;  1G6N A;  2EJR A;  5A2Q K;  5K5O A;  2UXX A;  4EM1 A;  1IXR C;  1BIB A;  3IL2 A;  1ZHF A;  1IZ1 A;  2D2W A;  2GIV A;  1ZAR A;  4LG0 B;  4D0P A;  1DDN A;  2XIG A;  1UB9 A;  1EH8 A;  1UHM A;  2DAO A;  3F3X A;  4RB0 A;  2HS5 A;  2Q0O A;  3IRR A;  4B09 A;  1RUO A;  3TOA A;  2EV0 A;  1W4M A;  1IXS B;  3W6K B;  1XGS A;  4HDV A;  2QYO A;  1A04 A;  4P5O A;  3C18 A;  2L54 A;  2FQ3 A;  4AIH A;  1O3S A;  1BI3 A;  2ELH A;  4MTE A;  4AD9 A;  1OYW A;  1YTY A;  2HTJ A;  3F23 A;  3QPH A;  3GZ5 A;  4XLN F;  4OIO F;  3NRV A;  2ZJ2 A;  4UVC A;  5L3C A;  2Y48 A;  3LA3 A;  3KZZ A;  3CDH A;  5D5V B;  4EJU A;  5K5R A;  4RGR A;  2RC4 A;  4OIN F;  2L01 A;  1W7P D;  4HF0 A;  4IF4 A;  1SMT A;  4LLG F;  5L3F A;  1KU2 A;  3FMR A;  1BC7 C;  3KCC A;  2DW4 A;  5L3D A;  3WTS C;  5BMZ A;  3ML6 A;  2CSO A;  4Q47 A;  3B73 A;  4UV8 A;  1RNL A;  1U5T A;  2PJP A;  2RDP A;  3WTW C;  1KA8 A;  4ZYG A;  2EWN A;  1K6O A;  2D1V A;  2Z99 A;  2EFQ A;  3Q9V A;  3FMS A;  3M8F A;  1JHF A;  5BS6 A;  1FYL A;  1YQA A;  2GA1 A;  2DI3 A;  1LDK B;  2ISY A;  4S05 A;  2EFO A;  2W25 A;  1ON2 A;  1ZH5 A;  1FBS A;  3FMQ A;  1B9M A;  3LAJ A;  4MHG A;  4WXC A;  2A61 A;  2FA5 A;  4XBF A;  5AON A;  1W7P A;  1GVJ A;  1RUN A;  5DUI A;  2CGP A;  3KP6 A;  1G3Y A;  4ZZD A;  2QBY A;  4IVN A;  2V9V A;  1B1B A;  2J5O A;  5ILU A;  2EA4 A;  3U1D A;  2H09 A;  3BJ6 A;  2TDX A;  1J5Y A;  3T0Y A;  4WF2 A;  2JPC A;  4HV5 A;  1WI9 A;  1T39 A;  2EB7 A;  1P6R A;  1E2X A;  2BGC A;  3KP7 A;  4ZYE A;  1R22 A;  4PZJ A;  3KET A;  1SFU A;  3U9G A;  3FXQ A;  4JK1 X;  1HW5 A;  5HDK A;  5D8L B;  2ZBK A;  2F2E A;  1WWX A;  1HSJ A;  1Z6T A;  2FRH A;  4I0B A;  1XDS A;  2IVM A;  2XAF A;  4BNC A;  5FFX A;  2WWY A;  5IT3 A;  3IRQ A;  4M74 A;  2ZKZ A;  2W85 A;  1U5T C;  4ESB A;  3MFK A;  2EFP A;  3T5X A;  1QZY A;  1D8K A;  1FWZ A;  4HLY A;  3GXO A;  1GHC A;  2M45 A;  4BH9 A;  1K79 A;  3R4K A;  1IUY A;  1DP7 P;  2YX7 A;  4OIR F;  4EMS A;  5ICC A;  3D0S A;  5KVR A;  2PQ8 A;  4L9V A;  4U7D A;  5JVT A;  4I98 B;  4ON0 A;  1SFX A;  3RTR A;  1HKS A;  4EJO A;  4YFX F;  3SZT A;  3NEU A;  3D5L A;  2F5E A;  3CUQ C;  4RAY A;  2DPU A;  2CW0 F;  2VBY A;  2WV0 A;  2KIF A;  4PCQ A;  4H0E A;  3KLO A;  1QQI A;  3ROU A;  4I2O A;  4IHT A;  4AIJ A;  2HOE A;  2IJL A;  1Z05 A;  2RVC A;  2FSW A;  1TW2 A;  1BIA A;  3DKW A;  5ERI A;  3TKY A;  2ZO4 A;  4HQE A;  2A07 F;  1TNT A;  1OYY A;  3EET A;  2QQ9 A;  2O0Y A;  1O7L A;  5LRR A;  3SQN A;  2VE8 A;  4L9J A;  2JZY A;  4ENN A;  3I59 B;  1FX7 A;  2ESN A;  2Q2E A;  4OOI A;  5LRS A;  1S7O A;  3HHG A;  2JTV A;  3WE3 A;  2F5F A;  2H27 A;  4Q5S F;  2J5P A;  2PI0 A;  2QLZ A;  1IRF A;  1L0O C;  2O6G E;  5IT9 Z;  1OPC A;  4OIP F;  2HFH A;  2MLK A;  4HW0 A;  2V1D A;  2QWW A;  2A68 F;  5BPI A;  3DEU A;  1U3E M;  2M8E A;  1WSU A;  5FD6 A;  2L02 A;  2DK8 A;  1EH6 A;  1FY7 A;  3COA C;  4CGZ A;  1SD4 A;  4I0A A;  5ICE A;  5DEQ A;  3RKW A;  1FOK A;  4M6Y A;  5FFZ A;  2DO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...