1SAXA

Three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci in complex with 25-bp ds-dna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
120
structure length
120
Chain Sequence
NKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the transcriptional regulation of methicillin resistance: MecI repressor in complex with its operator
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transcription/dna
molecule keywords 5'-d(GCTCCGATATTACAGTTGTAATTTT)-3'
total genus 38
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1saxA01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1saxA02
4BYYA 3M1EA 3M7GA 4OMZA 1C0WA 4XSZF 1XB4A 5DUKA 4ZZDA 2DAOA 3GFLA 3ZP5A 3RPQA 2XV4S 4FHTA 5LHIA 2JZYA 2MH9A 2W85A 5CVVA 5L3DA 2AXLA 4HV5A 1P4WA 2DK5A 4N9HA 3CDHA 1I1GA 3E97A 1G4DA 3DP7A 5FO5A 1STZA 1ZG3A 3VFZA 3TDUC 4RS8A 3OV8A 3CUOA 3FM5A 2H27A 2F2EA 1HKQA 3WODF 5ICCA 3WGIA 2IA1A 4Q48A 3J7AO 2P8TA 1R7JA 3DXJF 3VOEA 1B59A 2ZMEB 3R4KA 3V8LA 3WTVC 1YFHA 4L9JA 1H0MA 4KNYA 1S6LA 2V79A 1SD4A 5J6XA 1YW9A 4R79A 4LB6B 1B4AA 2LF7A 2HDCA 5E8IA 3OOPA 2PLYA 4UV8A 4I7HA 4KN7X 4BHBA 3T8RA 2BGCA 5BPDA 1BBYA 2A3SA 1Z9CA 5DEQA 4ENMA 2JT1A 2HFHA 5E1WA 4A6EA 4Q47A 1R23A 3V7RA 4EM0B 1TBXA 3JSPA 1U6GA 2KKOA 3K2ZA 4XSXF 3BPVA 3CJNA 2DW4A 3KP2A 2X4HA 3WTYC 3GFJA 1T38A 1O7FA 1S7AA 1IN5A 4KN4X 2VE8A 3LA3A 1EV7A 5DV5A 5LEJA 3U9GA 1IZ1A 3PQJA 4IVNA 1ZGJA 4LLNA 3G73A 4RAZA 3IHUA 4PCQA 2XKPA 3FM3A 1VTNC 2NNNA 5BQTA 1IW7F 4YIFA 3B02A 1J5YA 3J81K 4PZJA 4P5OA 4HLXA 2MLKA 1O57A 4BAYA 1KU2A 3GF2A 2IA2A 3TOAA 2ZFWA 1O3SA 1WQ2A 1FOKA 1H9TA 2DT5A 5ILVA 1W5TA 4KMUX 1UFMA 1FWZA 2LNBA 4LK0F 1ONVA 1KQ0A 1D8JA 5LGUA 3ZMUA 1KU7A 3SHFA 4YFKF 2DU9A 2GAUA 3TOBA 4U88A 1R00A 2XUBA 2CFXA 4OIPF 2PG4A 2E1CA 4KT5C 1IXSB 5HDGA 1BIBA 3CUQA 3RJPA 5F64A 1KU3A 1K78B 4IRGA 1G6NA 2V6CA 2ESHA 1RUNA 1R5HA 2CWEA 1IAWA 2DQLA 4IRIA 3VEPA 1IRFA 1QNTA 1WWXA 1U5TA 4PGHA 5E1XA 1EH7A 4L0YB 3RYPA 3HIFA 4HQMA 3HOSA 5FD6A 1PUEE 4CGZA 4MNUA 2V1DA 5LGNA 5AIQA 4B09A 1TQPA 3KLOA 1PP7U 3BROA 4HDVA 2ZNYA 1Z05A 2UXXA 1LEAA 5L3GA 1DUXC 1L0OC 1D8KA 3GFMA 2WTEA 1BI3A 4CYDA 3EYIA 1BN5A 4BHCA 5L3BA 1SFUA 3RTRA 3KETA 1WI9A 1QO0D 5HS9A 4UVBA 4HZFA 1FP1D 5IT9K 5LEKA 4EVIA 1TW3A 3BJ6A 5ICFA 2VBYA 2VONA 1BI0A 3Q9VA 1LQ1A 1HSJA 2K27A 2XAFA 2WWYA 3O2PE 1OYWA 1S29A 3TGNA 1HQCA 4A2UA 3N4MA 5ILUA 2JSCA 3SFZA 3R61A 1MJAA 3SZTA 4XRFA 1G3YA 2HKXA 1E2XA 1T39A 3WU1B 4KUMA 2OQGA 5ICGA 2M8EA 3FXRA 4NHJA 3T0YA 4RAYA 2K86A 1KYZA 2FSWA 3HRUA 3B73A 4LFUA 1Y0UA 1F5TA 1HSTA 4KFCA 2Z33A 2J5OA 3IWZA 3L9FA 3ELKA 1TW2A 5EEGA 2HOEA 1YW8A 5CVJA 3K69A 2QZ8A 3LQRA 3L2CA 4I0BA 2CYYA 4WXCA 4OIOF 1AOYA 1P6RA 3D0SA 5BS6A 5D5WB 4IF4A 2EFOA 4O3MA 1UCRA 1O3RA 1T98A 3AAFA 3TQNA 1SFXA 4CXFA 3E6MA 4EGZA 4L0ZB 4A0XA 1J75A 4I09A 4GYIA 5E20A 4MEYF 4CICA 2QBYB 1MD0A 3FWEA 4I02A 2VBXA 4QLCU 4EJOA 1ZGAA 2ZCWA 3GW2A 4F7ZA 4HA8A 2FBKA 4HF0A 5CVIA 3MQ0A 1QZYA 5CVRA 5DD4A 1R36A 3N97A 2Q2EA 5JHUA 4U0VA 2LSOA 2VBZA 1QPMA 1ZRDA 2FXAA 3TO6A 5D5VB 4PGGA 3WU0A 2NNYA 2CQKA 2EV0A 2L02A 1ZG1A 3ECOA 1USSA 1HKSA 5HOOA 4OINF 1SD5A 3ECHA 4I0AA 3KLNA 3LWFA 4KIBA 4LG0A 5HDKA 1B6AA 3FXQA 5K5RA 2HWVA 5J8FA 2XKOA 4WWCA 3R0JA 1FY7A 4QWQA 3HRSA 3BP8A 2STTA 4CHUA 4OMYA 1YO5C 3C3WA 4TV7A 2EFNA 5LRRA 5FFZA 1T2KA 1R58A 4E70A 4BXUA 4PDKA 1DP7P 3SXYA 5IT3A 2IVMA 2EV5A 2J5PA 2YSRA 2FA5A 2MC3A 3KZYA 1OMIA 3LFKA 4HLYA 5LRSA 2M5WA 2O3FA 1GXQA 2KRFA 2FF4A 2R7DA 2ZJ2A 3DPTA 3G3ZA 1XSVA 1MKMA 2ZO4A 5H6QA 4XLPF 4HAMA 1QQIA 2ACJA 2PBIA 3GYHX 2Z3YA 4LMYA 2K4BA 5A2QK 1EH8A 1ZG5A 2V1UA 1XN7A 2EFPA 4G94A 1DPUA 2VXZA 3BJOA 2K7LA 3GVAA 3VB2A 3IKVA 1IF1A 2P7VB 3LSTA 1R1UA 3KFWX 4M9ZA 2ETHA 1XMAA 1YS6A 5DUIA 1FX7A 5ED4A 3ROUA 2MA3A 3F21A 3WTXC 3DQVC 1R1TA 4FT8A 2DO7A 2F5FA 3IL2A 4M6YA 3Q5FA 4R8HA 3Q9SA 3ZQ7A 2IW5A 4KICA 4Q5SF 5J8CA 5E17F 2UXNA 2M30A 2P7CB 4IPAA 1R5GA 4IJAA 5H6RA 2E7XA 3EUHA 3CUQB 1JHFA 1MJBA 3J80Z 5DCFA 1O3QA 2ISYA 3L00A 4CZZA 1SD7A 3K9TA 3MCZA 3U1DA 3QP6A 3K1MA 2YPRA 5KVRA 1XMKA 3QU3A 2H6CA 2R7FA 2UZKA 2GWRA 1IXCA 2W84A 5D5UB 4A12A 5F6FA 3JTHA 4Y13A 3NEUA 1F9NA 3EDPA 2FOKA 3P9KA 1D3YA 1OR7A 4YG2F 5BPIA 1U78A 3W6JB 1U5TC 4EGYA 4M73A 2HGCA 3O6BB 4MQ9F 2BE5F 3GFIA 4H0EA 2P5VA 1FBUA 1KYWA 3RI4A 1QBJA 3I59A 2BBYA 1SD6A 1I6XA 5CJ9A 2KIMA 4IHSA 1R22A 2CO5A 3WTTC 4RGUA 1FC3A 4UUVA 4GCVA 2NS0A 2Y75A 5FD5A 4D0PA 5KK1A 3J81Z 2XAHA 2FNAA 2AS5F 4KIGA 4NQWA 3E5XA 1REPC 2STWA 3F8BA 2PMHA 2HR3A 3QP5A 3HRMA 2QLZA 2DPUA 3ABUA 5E1ZB 2P6TA 5CYVA 2QENA 2RQPA 1F4KA 5D4RA 3FXUA 4MTEA 1MZBA 1KA8A 3C7JA 4EM2A 3VODA 4A5MA 3HHHA 3JSOA 1EH6A 3GX4X 2A61A 5JR3A 3HSEA 1ZYRF 3RDIA 2DLLA 4O6JA 5TJJA 1ZREA 4S04A 4HF1A 3CLOA 4FX0A 1XDUA 4A5NA 3HSRA 1JHHA 5E18F 3V8JA 1ZLKA 1YLFA 2ZBKA 4R1HA 1RUOA 2Y0MA 3JTGA 3FMQA 4IRHA 2L4MA 5A2QZ 1DPRA 2VBWA 3KE2A 5FB2A 2D1HA 2NAZA 1HW1A 1YG2A 3FX3A 2EA2A 3ZMDA 4LG0B 4M6XA 3RKYA 1GXPA 3WG9A 3I71A 4XLNF 3E6CC 5LHHA 2IP2A 2KJCA 1HW2A 4CO8A 5LHGA 4JK1X 4AWXB 2O0YA 1MDMA 3I54A 3HRTA 1YW7A 2Z9OA 5CLSA 5D8LB 2DBBA 2VOOA 1I1SA 4CDGA 1UHWA 1B9MA 5TRDA 1JGSA 3R0AA 4S05A 3CO7C 5LGTA 3F3XA 3IRRA 1ZLJA 1FZPB 2MBFA 5IT9Z 3S2WA 1DDNA 4UHTA 3LQQA 3HTUA 1F1ZA 1O7LA 5ILSA 2QBYA 2E7WA 2UWMA 1U5TB 3F8CA 3JAMZ 1RI7A 1YTYA 3O3KA 3GZ5A 2M1BA 3DV8A 1IUYA 5BOXA 4WXDA 2LDUA 2P6SA 2C6YA 3TO7A 4L5IA 2X0LA 3F6VA 1TNTA 4KDPA 4MGRA 3PFIA 4I2OA 4JBAA 1CF7A 4OU0A 2A68F 2GXGA 1QZZA 3H3ZA 1S3JA 3KEQA 1W7PB 2YX4A 4A0YA 3LAPA 2EJRA 3KZZA 3V7SA 3K1NA 2G7HA 3DEUA 4ENNA 1FYKA 1XSXA 2ISZA 3DFGA 1J59A 1SFEA 2IA0A 1Z91A 3WGGA 3REOA 2G7UA 2NYXA 3HSFA 1A04A 3L09A 2VC0A 2OZ6A 2D45A 3LAJA 3RPUA 4DNCA 1FBQA 5HVQC 3GEZA 1PP8F 1BOAA 4MTDA 4UVCA 2GQQA 1ZRCA 3DKWA 5EEHA 5AONA 1PDNC 1O3TA 1Z6TA 4ETSA 4LD5A 2EB7A 1V3FA 5JVTA 2M87A 3KP6A 2VODA 4ZYDA 3I64A 4GO1A 1YYVA 3WTZA 1K78A 4ON0A 3LA2A 1AWCA 4LB5A 4IXAA 3JAMK 2QWWA 3KCCA 1BI2A 2PFBA 3COAC 4MHGA 3V7CA 5L3CA 1BI1A 3I4PA 4HX8A 1ZAOA 2JTVA 2E1NA 4GXOA 2FNPA 1LNWA 3MAJA 4M9SA 4GYGA 2QM3A 1TTYA 1H9GA 1SAXA 1IN7A 3GWZA 4WF2A 3F23A 2VN2A 2EK5A 2FE3A 1K7AA 3TDZC 1HW5A 5H20A 2IJLA 4G8XA 4XBFA 4A6DA 4ASNA 4AIJA 2P5LC 2ZNZA 1ON2A 2HEOA 1JE8A 5FLXK 3K0LA 4EJVA 4HQEA 1ZN2A 4A0ZA 4UVAA 2GZWA 5JI6A 3T1BA 4RB0A 5HS7A 1I5ZA 2QQBA 2XRNA 3ZMVA 4G7HF 1T0FA 1XCBA 2OBPA 3WE3A 4Z2YA 3ZMSA 1IN8A 2JPBA 3BZ6A 2XAGA 2COMA 3J80K 1LDJA 4RB1A 5L3FA 2DI3A 2BYVE 4YFXF 1G3TA 3ULQB 1V4RA 4G7OF 2K02A 1IN6A 4BQAA 2H09A 1ZARA 1L3LA 2ZMEA 5K1YA 3F22A 2RC4A 4HYEA 2DK8A 4B8XA 4ESBA 4HBLA 4P9UA 1R1VA 3ZPLA 2W57A 4AD9A 4AVPA 4WXHA 3WTWC 2CG4A 1BC7C 2B0LA 3P9CA 3EQLF 4M74A 1YS7A 3BWGA 5D6EA 2H94A 1YIOA 2JRTA 1FSHA 4EJWA 2L54A 2GXBA 3GXOA 2IRFG 2R3SA 4OIQF 3P9IA 1XGSA 4M72A 2GA2A 2HYGD 1E17A 1IN4A 1BIAA 4EMSA 1U3EM 4AIKA 2XGXA 2OD5A 3NRVA 5DCMA 3QU6A 3ISPA 1LDKB 1FBSA 1T6SA 4LK1F 2QQAA 3RKXA 1G3SA 1BM9A 3E5QA 1W5SA 2EFQA 2A69F 2EFWA 2GA1A 1Z1DA 2ESNA 4HDUA 2BEOA 3ZMTA 3ZN0A 1FYMA 4LLLA 2FQ3A 4FX4A 1KQ8A 3CUQC 4WCGA 3KP7A 1RZ4A 5D4SA 5E8GA 2O6GE 5ICEA 2FBIA 1LJ9A 1B9NA 2WC2A 4N0BA 2VT2A 3TKYA 4G9YA 1UHMA 2FEZA 4WX9A 2PI0A 2ZKZA 1J7KA 4KA4A 4L5JA 3F8FA 2M45A 1IXRC 4P96A 2LKPA 1ZRFA 1IRGA 2MH2A 3V4GA 3QAHA 2MD5A 2Q8KA 4ZH4F 1P92A 2F5CA 2RV8A 3CTAA 1FLIA 4UNOA 1YQAA 2PQ8A 3IRQA 1OKRA 4RB2C 3FZVA 4ESFA 1GHCA 4RB3C 1W4MA 4KIFA 2A5YB 2YX7A 2IPQX 1J2XA 1FPQA 5F1RA 4LJZF 2P4WA 1WSUA 3FMRA 2KIUA 1OPCA 4DQ2A 3KP4A 2VE9A 3GLXA 3MZYA 4U0YA 4KMFA 1FT9A 2O8XA 4BHPA 3MEXA 5DCMB 3F72A 2XAQA 3FHZA 5FFXA 1LEBA 3BJAA 4GGGA 4ZYHA 4HX7A 4U7BA 2DQRA 2FBHA 1HXDA 2RDPA 4M71A 2FRHA 1MGTA 5HLHA 1SMTA 1XGMA 2XIGA 1BJAA 2CSOA 1Z6RA 3HHGA 3IC7A 4ZYEA 2OA4A 2P5KA 3QPTA 4I98B 5D5XB 4UXNA 3R6SA 3DF8A 3QPHA 3E3VA 2RN7A 1J9IA 1Q1HA 3I0TA 2Q0OA 3E5UA 2CGPA 4ENKA 4HF2A 1XDSA 3MFKA 2OQRA 2ADUA 1ZH5A 5HLIA 4P9FA 1UB9A 3ZN1A 4NB5A 4IHTA 2XASA 2XROA 4LLGF 3ABTA 5DDGA 1P2FA 1S8NA 4HX4A 5D6FA 2L4AA 4G6QA 3F8NA 4Y17A 1USTA 2JPCA 4I01A 5HLGA 3PQKA 2KIFA 1SMYF 1TQIA 1RNLA 2XVCA 3HTSB 2MLGA 4U0WA 1XD7A 2QUFA 5ERIA 3EETA 1WKMA 3MZHA 3LA7A 2V9VA 5BMZA 3HYIA 3BPXA 5AIPA 5LBQA 1FSEA 4AIHA 5LLQA 2HYFA 3BOQA 1P4XA 3DPLC 2L01A 1FP2A 2W24A 3KEOA 4L18B 1XGNA 3H3UA 4BH9A 5HDNA 4RGRA 3WTUC 4EM1A 1S7OA 3GO5A 3U2RA 2A6EF 3KP3A 2CW0F 2XAJA 1XCVA 3T5XA 1MJ9A 3WTSC 3T8TA 3QRFF 4ZZLA 2FU4A 3K1PA 2Z99A 3RKWA 2YU3A 2V1XA 1HBXG 2LF8A 3FF5A 2QQ9A 3ERED 1ON1A 3KP5A 1XGOA 3GUDA 2DTRA 3I59B 3SZPA 1TNSA 4LGWA 2F5EA 3ZMZA 1RIOH 4YFNF 2QYOA 3SQNA 2RVCA 6PAXA 3F8MA 4U7DA 1LDDA 1KQ9A 1B1BA 4RGSA 2PJPA 1TLHB 2DPDA 4KYWA 2WV0A 4BNCA 1HKTA 3D5LA 3IKTA 1U8RA 2O03A 5D8KB 3L7WA 1CGPA 4Y15A 2H6BA 1WRJA 2HTJA 4G7ZF 2GIVA 1OYIA 1J0RA 5L3EA 3E6DA 3M8EA 4K2EA 2EA4A 2FMLA 1GVJA 3W6KB 2D1VA 2PMUA 4OOIA 3M8FA 4HV6A 5FLXZ 2ZXJA 1CF7B 2TDXA 3C18A 3P7NA 2A6HF 1D5VA 1KGSA 2OU2A 1TQMA 2VT3A 5DD8A 2RKHA 5CVUA 4ENJA 1LVAA 1LB2A 2L3DA 1KU9A 4HW0A 3BY6A 1W7PA 2O61A 1QGPA 2RNJA 3MWMA 2VOPA 2DFIA 2A07F 1ZHFA 2OAZA 3IWFA 4JQFA 2EWNA 3TO9A 4P55A 3R60A 1OYYA 3FMSA 3RIRA 4MEXF 3NQOA 3M9AA 2HQRA 2HQNA 5JFRA 4UV9A 1FYLA 2F5DA 2YR2A 4L9NA 1FNNA 3EYYA 5FGMA 2FMYA 4EJTA 4EJUA 4OIRF 3ML6A 1U2WA 3F6OA 5K5QA 1K79A 5DYMA 4YIIA 2VC1A 2NRAC 2IT0A 4L9TA 4G6DA 1MDMB 3WE2A 2QVOA 1NHAA 1P4AA 3H92A 4M9XA 2XHKA 4MQVA 3I5UA 5HS8A 2RGVA 1X3UA 1JXSA 2HTSA 4ZYGA 2OZUA 2PN6A 3WGHA 4L9VA 1I27A 4RGXA 2KJBA 1Z7UA 2HZTA 3I58A 2PEXA 2HS5A 2Y48A 2EV6A 1ULYA 2HKOA 3GZ6A 4N9IA 2D2WA 3HUGA 4EQQA 3JW4A 1W7PD 2W25A 3E6BA 4O5VA 4HOBA 1K6OA 3QOPA 1XSDA 1G3WA 4WK8F 3V8KA 1BC8C 3HOTA 1ODDA 5K5OA 3C1DA 3RYRA 3CO6C 2BV6A 4Q4ZF 3I53A 2Z5UA 4EV0A 2G9WA 2ELHA 2K4JA 3BDDA 4ESJA
chains in the Genus database with same CATH superfamily
4G12A 4BYYA 2ZXIA 3OYIA 2PX9A 3OYFA 2R5YA 3M1EA 1YX3A 3EPZA 3RQ4A 5M5YJ 3M7GA 4JOMA 4OMZA 1C0WA 3WU2C 4XSZF 2MG4A 3A01A 1XB4A 1RKWA 5DUKA 3BCAA 4ZZDA 1MSFC 1ETYA 4IHYA 2DAOA 3GFLA 1D1CA 3ZP5A 3RPQA 2XV4S 4FHTA 5LHIA 2JZYA 2MH9A 2W85A 5CVVA 5L3DA 2AQEA 3NAUA 2AXLA 4NDLA 5IY5H 5K7HA 3BLYA 4HV5A 4XMYA 1P4WA 2VPRA 2DK5A 4N9HA 3TP3A 3CDHA 2Z1DA 2VB6A 2VQHA 1I1GA 1BL0A 2LFBA 3E97A 1G4DA 3DP7A 1TT0A 4XOTA 5FO5A 4B4CA 1STZA 3KZIC 1A5JA 1ZG3A 3VFZA 3TDUC 4XR6A 4RS8A 3KX2A 3OV8A 2XB0X 3CUOA 3Q3SA 3FM5A 1O4XA 4BE2A 2H27A 2F2EA 4CCNA 1HKQA 3WODF 3WHBA 2Q1ZB 5ICCA 3WGIA 1FJLA 1X4OA 2IA1A 2HDDA 3IAM2 4Q48A 3J7AO 3OIOA 1JT0A 4JX6A 2P8TA 3SEZA 5FROA 4RMNA 1R7JA 3DXJF 3VOEA 1S9HA 3OSGA 1B59A 2GOMA 2ZMEB 4CYCA 3R4KA 3V8LA 3WTVC 1QPIA 1YFHA 4L9JA 4BJTA 2NVUB 1H0MA 4KNYA 2EQRA 1S6LA 1OLTA 2V79A 1SD4A 3K4CA 2DOAA 5J6XA 5EG0B 1YW9A 4CYCB 4R79A 4LB6B 1JKOC 4F3QA 1B4AA 1Z7LA 2LF7A 4BS9A 2HDCA 5E8IA 3OOPA 1X3WB 3BG9A 2PLYA 5IYBJ 3PJRA 4UV8A 4I7HA 5CQEA 4KN7X 3ZOBA 4BHBA 3T8RA 2E5ZA 2BGCA 5BPDA 1BBYA 2A3SA 1Z9CA 3S1RJ 5DEQA 3E7LA 5EGOB 1W1WE 3FK7A 2DODA 1I50J 2JT1A 2HFHA 2KZVA 1TWCJ 3IUOA 3NWTA 5E1WA 4FCYA 4ENMA 4A6EA 4Q47A 4CA0A 5K7ZA 1R23A 3V7RA 4EM0B 1TBXA 1X1AA 2M2EA 3JSPA 4I99C 2KRHA 1PYVA 1U6GA 1XC5A 2KKOA 2LBFA 1BOBA 3G71I 2LD5A 2OCEA 4NQWB 3K2ZA 4XSXF 3FXMA 3BPVA 4MLOA 2Y31A 1R9TJ 1QA6A 2D5VA 3CJNA 2AXTC 5GAEJ 2DW4A 1WVRA 3HJEA 3KP2A 1WJDA 2X4HA 3WTYC 2R5ZA 1RPWA 3GFJA 3A2KA 1XPXA 1N78A 1T38A 1O7FA 3RPUD 2JWTA 3S1QJ 1S7AA 1IN5A 4KN4X 3TW6A 2VE8A 4S0HB 3LA3A 1EV7A 5DV5A 2ECBA 2M34A 5LEJA 3U9GA 1IZ1A 3PQJA 4IVNA 2R5YB 3S1MJ 1ZGJA 4LLNA 1CQTA 3G73A 2TCTA 2DCEA 4RAZA 3IHUA 2W00A 4PCQA 2XKPA 3FM3A 3RKQA 1VTNC 2OTJI 2NNNA 5BQTA 1IW7F 4YIFA 5HODA 4M3GA 3BG3A 1IDZA 3B02A 5E79C 3LSRA 3LOCA 1J5YA 3J81K 4PZJA 4P5OA 3BC8A 1E0EA 3W2AA 1S72I 4HLXA 2MLKA 1O57A 4BAYA 1JUSA 1KU2A 3ASOH 3GF2A 2KMUA 3JCUC 2IA2A 2LG4A 3TOAA 1YI2I 1X2NA 2ZFWA 1O3SA 1WQ2A 3W2WA 1FOKA 1H9TA 2DT5A 5ILVA 1W5TA 1IG7A 4KMUX 1ZKGA 2WB1N 1TC3C 1TWFJ 1UFMA 4E7JA 1FWZA 2LNBA 1OJLA 1ONVA 1KQ0A 4LK0F 1D8JA 5LGUA 3C2HA 3ZMUA 1KU7A 3SHFA 4YFKF 2DU9A 2GAUA 4BGDA 3TOBA 5B1AH 2LY2A 4U88A 3S16J 1R00A 2XUBA 2CFXA 1KONA 4OIPF 2PG4A 1XTAA 1B8IB 2DXIA 2E1CA 1Z3XA 3HZJA 4KT5C 3FXOA 1VQ9I 1IXSB 2VJ5A 5HDGA 3CUQA 1BIBA 2XF6A 5F64A 3RJPA 1KU3A 1Z3YA 1Y39A 3A02A 2F48A 1WH5A 2M4GA 2B7EA 2KDOA 3LSGA 3BR2A 1K78B 2CQXA 2R7QA 4IRGA 1G6NA 4C3HJ 5J47A 1MH4A 2ICWG 1WJAA 5EEAA 2V6CA 3CD6I 4E7ZA 2ESHA 2KP6A 1RUNA 4KISA 1R5HA 2CWEA 1IAWA 1Z21A 2DQLA 4I76A 4IRIA 5FKOA 1WJFA 4CCLA 1X1CA 4XRSG 3VEPA 1IRFA 2JA7J 1QNTA 1WWXA 1U5TA 4PGHA 5E1XA 4BEHB 1EH7A 4CH7A 4L0YB 3DLLF 3CJRB 3HIFA 3RYPA 3HKZN 1MMDA 4QPQA 4HQMA 4V2GA 3BQZA 3HOSA 5FD6A 1DU6A 2R4GA 1PUEE 1ITYA 3A03A 1NK3P 4CGZA 3OYMA 4MNUA 2EINH 2ZFUA 2V1DA 1FIAA 3ZGKA 5LGNA 1K61A 5AIQA 2I8DA 2WY7Q 2COBA 5FKMA 4B09A 1TQPA 2EIMH 3KLOA 1PP7U 3BROA 4HDVA 2ZNYA 1Z05A 2UXXA 3U1KA 1LEAA 1V5FA 5L3GA 3ZQIA 2GXAA 1DUXC 3G4SI 1L0OC 1D8KA 1W36C 3TP0A 3ZQFA 3GFMA 2WTEA 2XB5A 4BQQA 1LFUP 1BI3A 2M0CA 4CYDA 2BHZA 3EYIA 1BN5A 4BHCA 5L3BA 1SFUA 2HXOA 2NVTJ 2E5NA 3RTRA 3DTEA 4NC7A 4BE1A 2BHYA 2VPLA 3KETA 4DYQA 1WI9A 1FMWA 4FISA 1KZHA 4BJ6C 4M3FA 1QO0D 2ZC2A 5HS9A 1A31A 3RSNA 3HOWJ 4XM3A 5DTDA 4UVBA 4HZFA 3M4OJ 1FP1D 1UZCA 1V54H 2P0WA 3H9GA 5LEKA 5IT9K 4AYBA 4EVIA 1TW3A 3BJ6A 4N4NB 5ICFA 2M0MA 2VBYA 3IH3A 1JKPC 2VONA 1BI0A 2ZXWH 4HSRA 1HF0A 2ELKA 1JKQC 3Q9VA 1OCPA 2W7NA 1HSJA 1LQ1A 1JJ8C 2K27A 3VPRA 2XAFA 2OPTA 2WWYA 3DU6A 2MD0A 1ZK8A 4C3JJ 2CH0A 1OYWA 3O2PE 1S29A 3TGNA 1HQCA 4A2UA 3N4MA 1VQLI 5ILUA 2LR8A 2E19A 2JSCA 3SFZA 3R61A 1BR4A 2OC6A 1MJAA 1TWGJ 3SZTA 3L2WA 4XRFA 1WFXA 4AC0A 1G3YA 2LC2A 3PNYA 2JUCA 2HKXA 3OR2C 1E2XA 1T39A 3WU1B 4PJMA 2EIJH 3LSJA 4KUMA 2CV2A 2OQGA 5ICGA 1TP4A 2M8EA 3DTIA 3FXRA 1PUFB 4NHJA 3T0YA 4RAYA 2K86A 1KYZA 2FSWA 3IAS2 3HRUA 3B73A 4LFUA 3SZGA 4DBRA 1Y0UA 2WAEA 2AQFA 2VKHA 3CCLI 1T08B 1F5TA 1HSTA 4KFCA 2Z33A 2J5OA 2VI6A 2JJ7A 2Y69H 2X6WA 3ELKA 1TW2A 3GLLA 3IWZA 3L9FA 4P1WA 4A3IJ 2L9VA 4C2MJ 4A3KJ 3JRFA 5EEGA 2GIZA 2HOEA 3HEFA 3SDGA 1NG7A 1JTYA 1YW8A 2TRTA 5CVJA 3K69A 2QCOA 1TL8A 5EF6A 2QZ8A 1QVUA 2DA2A 3LQRA 5C3EJ 2ZMEC 3L2CA 4I0BA 2QSGX 4ANJA 2B63J 2VJJA 2CYYA 2QKMB 5DM7F 4WXCA 4OIOF 1AOYA 3I3LA 1P6RA 3D0SA 3AG1H 3A0BC 1MBEA 3FHNA 4RAGA 5BS6A 5D5WB 4IF4A 1W36D 2EFOA 2HOSA 3QODA 3E1SA 4O3MA 1UCRA 5M5XJ 4A3JJ 5HNFA 3CCVI 1O3RA 3KEYA 1T98A 3AAFA 1MNEA 4ZYAA 2ZJQF 2CV1A 2DMUA 2L7MP 3TQNA 3MKYB 3TEDA 1A36A 1SFXA 2K5CA 4N4OB 3E6MA 4CXFA 5HNHA 4EGZA 4L0ZB 4A0XA 5J4YA 4I09A 4GYIA 1J75A 3CF2A 5E20A 5M5WJ 4MEYF 4CICA 2QBYB 4ZDOA 1MD0A 3H0DA 3S93A 3OYHA 5KCMA 3ZR8X 2EZHA 3FWEA 2N8GA 5E3OA 2BY2A 4I02A 1OCTC 3RCOA 2VBXA 1JGGA 4QLCU 1QRYA 3I9V2 4EJOA 1ZGAA 2ZCWA 3PIOF 1X1BA 2R7RA 4MIMA 3GW2A 3KIOA 4F7ZA 4HA8A 2FBKA 4HF0A 5CVIA 3MQ0A 1QZYA 2BOLA 5CVRA 5DD4A 3FISA 1EF4A 2HU9A 1R36A 2DFEA 5J3LA 4E4HA 2R5ZB 3RZOJ 1OCRH 2KT0A 1V5EA 1V5GA 3TW7A 1FIPA 2PJRA 3N97A 3MMYB 3H0GJ 2Q2EA 5JHUA 3CF5F 2NS7A 4U0VA 2QSFX 2LSOA 2LRDA 2BZTA 2VBZA 1QPMA 2H1LA 1ZRDA 4HNVA 2FXAA 4PFPA 3MKZA 3FBNB 3TO6A 2E60A 2X6XA 4RBOA 1UAAA 3TMOA 5D5VB 4NC6A 1MNDA 2F5VA 4PGGA 1D0XA 3BQYA 3WU0A 2NNYA 4HEA2 2CQKA 2EV0A 2L02A 3BTIA 1ZG1A 1ZR4A 3OYBA 3ECOA 1USSA 1HKSA 4B47A 2EBIA 5HOOA 4OINF 3N05A 1SD5A 3DKYA 2ZJRF 2CUZA 3ECHA 4I0AA 3BZCA 3KLNA 3LWFA 4KIBA 4C3IJ 4LG0A 5HDKA 3F9KA 1B6AA 3FXQA 5K5RA 2E36A 2HWVA 3FK6A 1HLVA 5J8FA 2R7SA 3PL8A 2XKOA 5IOYA 4WWCA 3R0JA 1FY7A 3QQAA 4C30A 5E3LA 4QWQA 4LIUA 3HRSA 3BP8A 2STTA 4CHUA 2Y0SN 1YO5C 4OMYA 2ZSHB 5K7FA 3C3WA 2M3AA 4TV7A 1VQ4I 2CU7A 4DJAA 2EFNA 5LRRA 4PJLA 3JRAA 5FFZA 2KRCA 1R58A 1T2KA 4E70A 2ZJPF 4BXUA 4PDKA 2KZGA 1J09A 1DP7P 3OOUA 3SXYA 2IGOA 2IVMA 2EV5A 2J5PA 4Y4RA 5IT3A 3OL3A 2YSRA 5KHDA 4BACA 2FA5A 4AIDA 2F6CA 2MC3A 3KZYA 1OMIA 3LFKA 1MNMC 3WHCA 4HLYA 2DDBA 3BZKA 5LRSA 2M5WA 4ZDPA 1D5YA 1MIJA 2XPVA 2O3FA 5F27A 1GXQA 2KRFA 2XPUA 1PUFA 3AG3H 3LSMA 2FF4A 3AKZA 2R7DA 2ZJ2A 3DPTA 3G3ZA 1XSVA 2HVRA 4LIVA 3HOYJ 1B72B 1MKMA 4FTHA 1YJ9I 2ZO4A 2V4JC 5H6QA 4XLPF 1IC8A 4HAMA 1QQIA 4M3EA 3BR0A 5HLTA 4XRSA 2ACJA 1T95A 2PBIA 3GYHX 2Z3YA 4LMYA 2K4BA 5A2QK 2WB1A 3HUGB 1WJBA 2LP0A 1EH8A 1ZG5A 2V1UA 1XN7A 2EFPA 4G94A 5GADJ 2VXZA 1DPUA 3WG7H 3BJOA 2K7LA 3S1NJ 3GVAA 3VB2A 2Y9YA 3IKVA 1IF1A 1U8BA 1N77A 1YRNB 2P7VB 4IX7A 3IH4A 5GAGJ 3LSTA 1R1UA 3AFHA 3JRHA 1ZELA 3A4CA 3KFWX 4M9ZA 2X9DA 2ETHA 1HDPA 1XMAA 1R4NB 3OWTA 5IP9J 1VFCA 3PFYA 3QYFA 1YS6A 3PNTA 3UR3C 3OIQA 5DUIA 1FX7A 4DOZA 5ED4A 1FOXA 3HGGA 4XRMA 1ZQ3P 3ROUA 4CZCA 2JVHA 2MA3A 4MO7A 2E34A 3OL4A 3WTXC 3F21A 3DQVC 1R1TA 2Y0SA 4FT8A 1VQKI 4II2A 2DO7A 2F5FA 3IL2A 1PJRA 4M6YA 3Q5FA 4UB8C 4ZTJA 4R8HA 3Q9SA 3ZQ7A 3PUFA 3KPHA 2IW5A 4KICA 4Q5SF 4BL0B 1T8IA 3DBRB 5J8CA 2H1KA 4B48A 2IS1A 5E17F 2UXNA 2CFOA 3OYAA 2M30A 2FUG2 2P7CB 4IPAA 1R5GA 4A3DJ 4QPOA 4YIRX 2XAUA 4IJAA 5CKTA 9ANTA 1G8XA 5H6RA 3D5SC 1E3OC 2EZIA 2X85A 2E7XA 3EUHA 4F52A 3CUQB 1JHFA 1XX5A 2HYJA 4OAZA 1MJBA 3J80Z 5DCFA 3K7AJ 1O3QA 2PJRB 2ISYA 1OFCX 3L00A 4CZZA 1SD7A 3K9TA 3MCZA 3DTKA 1VQ7I 1E3PA 1R4MB 4IHWA 4PK4A 4FASD 3U1DA 3HC7A 4BJ5C 3QP6A 3K1MA 2YPRA 1A35A 4RM3A 3H36A 5KVRA 1XMKA 4KJZA 2WADA 3QU3A 2BW3A 2DA3A 2H6CA 3M3YJ 2R7FA 2EPFA 1AKHB 2UZKA 2GWRA 4E7IA 3Q0UA 1IXCA 3CCMI 2IGKA 2W84A 1LPQA 2O5RA 5D5UB 4A12A 3DBHB 5F6FA 3JTHA 3VYUB 1F36A 3PO2J 4Y13A 3NEUA 4GFBA 3CCRI 2DA1A 3G1LA 2W4SA 1F9NA 2V9KA 3FKJA 4RLQA 3EDPA 2QKLB 2FOKA 3P9KA 3L2QA 1D3YA 1QZEA 1OR7A 3PSIA 3AG4H 2DOFA 3ONQA 4YG2F 3MVPA 3GMEA 5BPIA 2HPMA 1U78A 3W6JB 1U5TC 4EGYA 4M73A 3I4NJ 2FJ1A 2HGCA 3O6BB 4MQ9F 1SVLA 2BE5F 3OYDA 5B66C 5EDNA 3GFIA 4H0EA 2P5VA 1FBUA 1KYWA 3RI4A 2LYCA 1QBJA 2R7ZJ 3I59A 1AU7A 2BBYA 2L7KA 1SD6A 3VSKA 1I6XA 3IH2A 3HGYA 5CJ9A 4CCJA 3CQZJ 4F55A 4IZZA 5LFAA 2KIMA 2FX0A 3BR5A 1DGWY 5KAIC 4IHSA 1R22A 3L2UA 1T56A 2CO5A 4X1EA 3WTTC 4XKVA 4RGUA 1FC3A 1I6HJ 2M8GX 4UUVA 4D1QA 4GCVA 2HQAA 2NS0A 2Y75A 2HQ5A 1UHSA 3LSHA 5FD5A 4D0PA 5KK1A 3J81Z 2XAHA 2FNAA 2AS5F 4RM2A 4C2TA 4OAYA 5FJ8J 5IYCJ 1IRZA 4KIGA 4NQWA 3E5XA 1REPC 5JLWA 2STWA 3F8BA 3H3VK 2E2JJ 2PMHA 4B44A 4DW6A 2HR3A 1WI3A 3BR1A 4A3FJ 3AL0C 3QP5A 3HRMA 3K4LA 1T33A 2WAQN 2QLZA 5EZGA 2DPUA 3BTLA 3ABUA 5E1ZB 2P6TA 5CYVA 3CJQB 2LTPA 2M7AA 2QENA 2RQPA 1F4KA 1RR8C 4A3MJ 5D4RA 1G59A 1Y56A 3UNGC 4Y33A 3FXUA 4XN0A 4MTEA 1MZBA 1KA8A 3C7JA 4EM2A 5GP9A 2YS9A 3VODA 3CC7I 4A5MA 3K4MA 3HHHA 3JRBA 3JSOA 2DA7A 3K4KA 1EH6A 3GX4X 3HPHA 2A61A 2VJ4A 5JR3A 3HSEA 1ZYRF 4D5CA 3DLAA 3RDIA 3M07A 1X58A 4UUSA 2DLLA 4O6JA 1MMGA 3LSIA 5TJJA 1ZREA 3D5RC 2GLOA 4S04A 4V2FA 4HF1A 3CLOA 4FX0A 1XDUA 4A5NA 3HSRA 5EJCA 3FKIJ 1JHHA 2K3FA 5E18F 3JRDA 1APLC 3V8JA 1ZLKA 1YLFA 2K9SA 2ZBKA 4D5FA 2JA2A 3ZQHA 4CCOA 4R1HA 1RUOA 2Y0MA 1WZ2A 3JTGA 2E2IJ 1QHHD 1BW5A 3FXLA 4ZJZA 3FMQA 5FKNA 1Y8QB 4IRHA 1YIJI 4II3A 2L4MA 4FE7A 5A2QZ 5B5EC 3OYCA 1DPRA 2VBWA 3CCYA 3OIPA 2WV1A 3BTCA 3KE2A 4AVZA 5FB2A 5FRNA 2CQNA 2D1HA 2NAZA 3QPSA 2X48A 4RA2A 1HW1A 1WGXA 1YG2A 3FX3A 2EA2A 3ZMDA 4LG0B 4M6XA 3RKYA 1GXPA 3S3MA 3WG9A 3K70C 4BXFA 3I71A 1ZR2A 4XLNF 1IO2A 3GTLJ 3QYBA 2KFDA 3OR1C 4B43A 3E6CC 5LHHA 3GBGA 4HRIA 2IP2A 1ETXA 2KJCA 1HW2A 4CO8A 3DWLE 4A3BJ 5LHGA 2KHMA 4JK1X 4AWXB 4JP0A 2O0YA 2WA0A 1MDMA 2VIXA 1U0JA 3HRTA 3I54A 2PMZA 4BQOA 3JREA 1YW7A 2Z9OA 2K3PA 2LKSA 5CLSA 1OR7C 1VQMI 1VQ5I 2L9SA 5D8LB 2DBBA 2VOOA 1I1SA 2KISA 2R7XA 2CMPA 2HOTA 4L5EA 1UG0A 4CDGA 3A0HC 1UHWA 1B9MA 4D9JA 5TRDA 4F93B 1JGSA 3R0AA 3CMEI 2X6YA 4S05A 3L2VA 3CO7C 1NG6A 3HB9A 3SJMA 2GOXB 5LGTA 1SEUA 5E3NA 3VSLA 4XORA 3F3XA 3IRRA 1ZLJA 3G6EI 2RNGA 3CDLA 1FZPB 1LUJB 2R7OA 2MBFA 5IT9Z 3S2WA 2JRMA 1DDNA 4UHTA 2E1MB 2BY3A 3LQQA 3HTUA 2IGNA 4HG2A 3CCSI 1F1ZA 1O7LA 5ILSA 4CSWA 4DIQA 3OS0A 2QBYA 2E7WA 2UWMA 1U5TB 3F8CA 3JAMZ 3X2QH 1RI7A 3CC2I 3JR9A 4FQGA 3O3KA 1YTYA 1MBJA 3GZ5A 2M1BA 3DV8A 1MSEC 1IUYA 2LY1A 5BOXA 1UJ8A 4WXDA 2LDUA 3PSFA 1NTCA 3K4NA 2P6SA 2C6YA 3TO7A 1TT5B 2K9NA 2NXNB 2OJED 4L5IA 3HOZJ 2X0LA 3F6VA 5J1UA 1W0UA 3G1OA 4UY8I 1TNTA 4KDPA 4MGRA 3PFIA 4J01A 4I2OA 4JBAA 1CF7A 4OU0A 2A68F 2X1DA 2CUJA 3LL7A 2GXGA 1QZZA 3H3ZA 1LFBA 1S3JA 4UB6C 3AG2H 2R7UA 3GTJJ 3KEQA 1W7PB 2RREA 2YX4A 1VI0A 4A0YA 2H8WA 3LAPA 4BY7J 2EJRA 3KZZA 4BKXA 3V7SA 4XN3A 1VQNI 3K1NA 2G7HA 4DZJA 3PIPF 3DEUA 4ENNA 2M4KA 1OCZH 4XLFA 2QQ8A 5EYRA 1FYKA 1XSXA 5BNGA 2ISZA 2JSPA 3DFGA 1SFEA 2IA0A 1J59A 1WPKA 1Z91A 4JYKA 1ZGWA 3S2DJ 3WGGA 2I10A 3REOA 2G7UA 2NYXA 3HSFA 4PSXA 2VUMJ 3BR3A 3MD2A 5KAFC 2JMWA 1A04A 3HBLA 3L09A 2VC0A 4XLHA 1MMAA 1GDTA 2OZ6A 2ZB9A 2D45A 1V55H 3LAJA 1FOYA 1ORKA 2F4MB 4F92B 3HL2A 2JQ7A 3RPUA 1R6RA 2XF7A 4DNCA 5E3MA 1G2HA 4IHXA 1FBQA 2EZLA 5HVQC 3GEZA 2Z16A 4E7KA 1PP8F 2GM4A 2NVXJ 1BOAA 3CLQA 4MTDA 3V42A 2IBDA 4UVCA 3CCUI 2GQQA 1UMQA 1ZRCA 3DKWA 5EEHA 5AONA 5M3MJ 1PDNC 4G6TB 1EA3A 4E7SA 1O3TA 2PMZN 1Z6TA 4ETSA 2DA4A 2EB7A 4LD5A 1V3FA 5CQGA 5JVTA 1Y6IA 2DN0A 2M87A 3KP6A 2OF7A 3K2AA 2VODA 4ZYDA 3I64A 4GO1A 3W2VA 3OS1A 1YYVA 2DMTA 3WTZA 1K78A 3QYEA 2VXDA 2X6OA 4ON0A 3LA2A 1AWCA 4LB5A 4IXAA 2DT6A 2IS6A 3JAMK 2QWWA 3KCCA 1BI2A 2PFBA 4XLAA 2L7FP 3COAC 4MHGA 2XF5A 4IO9F 4XL9A 3V7CA 3H5NA 5L3CA 1BI1A 1BR2A 4UUTA 3I4PA 1X1DA 5EGOA 4HX8A 3M1CA 1BJZA 2A5WA 1SVMA 1ZAOA 3JRGA 2JK3A 2LVSA 2JTVA 1Y0NA 2E1NA 4GXOA 4X6AJ 3CZ6A 2FNPA 1LNWA 2ID3A 2A6TA 3MAJA 1K4SA 5JHFA 4M9SA 4GYGA 2QM3A 1TTYA 2VLAA 1H9GA 1SAXA 2E2HJ 1IN7A 3GWZA 4WF2A 3F23A 2VN2A 2EK5A 2FE3A 1K7AA 4Z6YA 3SFIA 3TDZC 2BVMA 2VKVA 1HW5A 5H20A 2DMPA 2DT7B 2IJLA 4G8XA 4XBFA 4A6DA 4ASNA 4AIJA 2O7OA 2P5LC 2ZNZA 1IGNA 1ON2A 2HEOA 4PSWA 1JE8A 3J7AY 5FLXK 3K0LA 2IS4A 4EJVA 4HQEA 1ZN2A 4QSHA 1VQ8I 3F0CA 2DOEA 3OMYA 4A0ZA 1IUFA 4UVAA 2Z2SB 4PJ0C 4YRVA 2GZWA 5JI6A 1Y1WJ 3T1BA 2XGCA 4RB0A 5HS7A 2V26A 1I5ZA 2QQBA 2XRNA 3ZMVA 3EUKL 2E1MC 2DYSH 3H5RA 3K4JA 4NUBA 3J7YJ 4G7HF 1T0FA 1XCBA 4D7MA 2OBPA 3WE3A 4Z2YA 4W97A 4KITB 3ZMSA 1IN8A 1QU3A 2JPBA 3BZ6A 2XAGA 2W48A 2COMA 2KL4A 2VASA 4B3XA 3J80K 1LDJA 4BEHA 4RB1A 3HKZA 5L3FA 2HI3A 4BBRJ 2DI3A 1SVOA 2JN6A 4A3EJ 1YX5A 2BYVE 3ZQCA 3S3NA 3G1MA 3CDIA 4YFXF 1G3TA 3OS2A 3ULQB 3VWBA 1V4RA 4IKFA 3G2BA 1QVTA 4G7OF 2LLKA 3HDDA 4HPQA 2K02A 3FBIB 1IN6A 4BQAA 3BR6A 4XQFA 2H09A 4EEFG 1ZARA 2W82A 4I6ZA 2RAEA 1UG2A 1IDYA 3MZ8A 3L2RA 5GTHC 4XONA 1L3LA 2ZMEA 5J1RA 5K1YA 1A6IA 2F4OB 3F22A 2RC4A 4HYEA 2WAQA 2DK8A 2NOJB 4B8XA 1TWAJ 3B6AA 4ESBA 4HBLA 4JX5A 1VQ6I 1E3HA 2NOGA 4LOCA 4P9UA 1XMXA 1H88C 1R1VA 3ZCOA 3M8JA 1GUUA 3ERMA 3ZPLA 2W57A 5JVGF 4AD9A 4FE4A 1MBHA 1OCCH 4XIDA 2MABA 1YITI 4AVPA 1U9OA 2Y30A 4C2UA 4WXHA 3WTWC 2CG4A 3GZNB 1BC7C 2B0LA 3P9CA 4XICA 3EQLF 4M74A 2M7BA 1YS7A 4PUSA 3NWSA 3BWGA 2FD5A 2VJIA 2H94A 2VKEA 5D6EA 1YIOA 2EZKA 3BG6A 2LKXA 2JRTA 3L1PA 1FSHA 1PVEA 4EJWA 2L54A 2GXBA 3GXOA 1H8AC 2IRFG 1QHGA 2R3SA 3ABLH 4OIQF 3P9IA 1XGSA 4M72A 2DA5A 2DDAA 3CMYA 2GA2A 2CUFA 2HYGD 2XSJC 1E17A 1IN4A 3H1CA 4UUSB 2DFFA 1BIAA 4EMSA 2HVSA 1U3EM 3CCQI 4AIKA 2XGXA 4JX4A 1FTZA 2OD5A 3NRVA 5DCMA 2ZXHA 5IOZA 3QU6A 2O8KA 3ISPA 3O8HA 2NVYJ 5F1JA 3S3OA 2XSDC 1LDKB 1FBSA 4QIWN 2XDVA 2X1CA 1T6SA 3SDBA 4LK1F 5C44J 1DGRM 2OV7A 2V7FA 2QQAA 1HA8A 3RKXA 2CRGA 5F0CA 1G3SA 4Y7NJ 1BM9A 2LOOA 2LBFB 2Y2ZA 3E5QA 1NK2P 1W5SA 1DP3A 2EFQA 2L7ZA 2A69F 2FQ4A 1SFKA 2DMNA 3E0JB 2GA1A 2EFWA 2BXYA 1Z1DA 2ESNA 3SYTA 1SAUA 4HDUA 1YHQI 2BXZA 1Z67A 2BEOA 1H89C 2QGUA 3ZQLA 3ZMTA 1JI8A 3ZN0A 1FYMA 4LLLA 2FQ3A 4FX4A 1XG1A 1KQ8A 2KPMA 3CUQC 1I3QJ 4WCGA 1NH3A 3KP7A 2O9LA 2GBYA 1BA5A 1RZ4A 4OWRB 1WJCA 2CV0A 1AKHA 5H2FC 3AL0B 1ETQA 5D4SA 5E8GA 2O6GE 4GRIA 3OY9A 5ICEA 2FBIA 4J19A 2K9MA 1LJ9A 4ABZA 2UUZA 1B9NA 2WC2A 4B1RA 2CQ7A 1R71A 3PM1A 3GTQJ 4N0BA 2VT2A 3TKYA 3FDYA 4G9YA 5J4VA 1UHMA 1X19A 3EUAA 2FEZA 2F4IA 1U9NA 1TWHJ 4WX9A 2PI0A 2ZKZA 1J7KA 5C4JJ 4KA4A 4L5JA 3F8FA 2M45A 1YRNA 3CJTB 3MKLA 1IXRC 4P96A 2LKPA 4KT6A 4DBQA 1ZRFA 4GDFA 4PFOA 4BE0A 1IRGA 2MH2A 2V1NA 3V4GA 4BDZA 2CUEA 1M1EB 3QAHA 2MD5A 1TZLA 2Q8KA 3VYTB 1RETA 1MW7A 2ELJA 2HZDA 4ZH4F 3CMAI 1P92A 1OISA 2DA6A 2MFZA 2LH9A 2F5CA 5B1BH 2RV8A 2MYSA 3CTAA 4E7LA 1SFOJ 1FLIA 2R93J 4UNOA 2R7TA 3OYLA 1YQAA 2PQ8A 3W3CA 4IEJA 5FRMA 1K6YA 3IRQA 3CP2A 1OKRA 2BW3B 4RB2C 4IQ4A 2L5QA 2VQGA 2KDZA 3FZVA 4ESFA 1GHCA 1AA7A 4RB3C 1W4MA 4KIFA 1K4TA 2A5YB 1BW6A 2YX7A 2IPQX 1J2XA 5M3FJ 1FPQA 5F1RA 2JVGA 1S5LC 1ACIA 5GTIC 4LJZF 3I56I 4NNJA 2P4WA 1WSUA 3FMRA 1RESA 1WCMJ 2KIUA 5IP7J 1LE8A 1N25A 1OPCA 4DQ2A 1A6QA 2HNHA 3KP4A 2MGQA 2VE9A 1JUMA 3GLXA 4BUPA 4ITVA 3MZYA 4U0YA 4KMFA 3OYGA 1FT9A 4HSTA 1T0FC 3CC4I 4AM3A 3I4MJ 3C2GA 2O8XA 2BY0A 1RR7A 4BHPA 2IS2A 3MEXA 5DCMB 2DFHA 3F72A 2XAQA 3FHZA 5GPCA 3BG7A 5FFXA 4ZTFA 1LEBA 3BJAA 4GGGA 1I39A 1W0TA 3FIWA 4BU2A 2W1OA 4AUXA 2CW7A 4ZYHA 4IOAF 3QWLA 3RZDJ 2IGMA 5JLXA 3KYLA 4HX7A 4U7BA 3S17J 2DQRA 1MBKA 1HXDA 2FBHA 2RDPA 5J40A 4M71A 1Z0XA 1MGTA 2FRHA 5HLHA 1SMTA 1X2MA 1SANA 1XGMA 2XIGA 3VDXA 1BJAA 3U21A 2DMQA 1AHDP 2VQLA 2CSOA 5KNLA 5B3SH 1OCOH 1Z6RA 2KQRA 3KYCB 2BVLA 3HHGA 3IC7A 4ZYEA 3Q0WA 2OA4A 2P5KA 3QPTA 4I98B 1VQPI 5D5XB 4UXNA 3ZXSA 5EZHA 1W5CC 2DTZA 2K40A 3R6SA 1D1AA 1I3AA 2VL8A 2L9RA 3DF8A 3QPHA 3E3VA 1IJWC 2RN7A 3HXLA 3UKGA 1YJWI 1Z77A 1B8IA 4M3BA 1J9IA 1Q1HA 3I0TA 3H5AA 2Q0OA 4DYRA 4DYCA 3JRIA 4BQNA 4E7HA 3E5UA 3FXJA 4DGWB 2RQQA 1R5ID 2CGPA 1WJEA 3BG5A 1N75A 2Q2EB 2I5UA 1LVKA 1P7JA 3ESWB 3P5JA 3OYKA 4Y3OA 4FETA 2DJIA 3ZQGA 4ENKA 3ABMH 3GCMA 4HF2A 2NVQJ 3GTPJ 1XDSA 4M6VA 2UV1A 2LMDA 4NBQA 1IV8A 1VZ0A 3MFKA 2QF7A 3K70D 2OQRA 2ADUA 4XKBA 1ZH5A 1WJ5A 3S8PA 2V9PA 5HLIA 4P9FA 1UB9A 3Q0VA 3ZN1A 3DEWA 4NB5A 4IHTA 2R0QC 1HCRA 1SC7A 2XASA 2XROA 4LLGF 2QSHX 2ME6A 3ABTA 1GV5A 5DDGA 2XGEA 1P2FA 1S8NA 3MN2A 5IP6A 4HX4A 5D6FA 2L4AA 1K83J 3LSKA 2ECCA 3LNQA 4G6QA 3F8NA 2JUGA 4EATA 1R49A 2LY9A 4YEJA 4Y17A 2EILH 1USTA 2JPCA 1FEXA 3B6CA 4A93J 4IHVA 4BXXJ 4I01A 5HLGA 2E1OA 3PO3J 1ENHA 3PQKA 2KIFA 2XVCA 1SMYF 1TQIA 1RNLA 3DPUA 2L9NA 2MLGA 3K6GA 2HDWA 3HTSB 1HC8A 4U0WA 3SEQA 1XD7A 2QUFA 5ERIA 3EETA 4PJJA 1WKMA 3MZHA 3LA7A 2B9SA 2V9VA 5BMZA 4F91B 1B72A 3S14J 2K9QA 3HYIA 3BPXA 5AIPA 4BDYA 5LBQA 1GVDA 2ZSIB 5F04A 1FSEA 2E71A 2IXSA 5GAHJ 4AIHA 5LLQA 1Y8RB 2HYFA 3BOQA 3K4BA 1P4XA 3DPLC 2JA6J 3ASNH 4Y52J 3VYRB 2L01A 4XK4A 1FP2A 2W24A 3KEOA 4L18B 3QPLA 1XGNA 3H3UA 1VF9A 4BH9A 5HDNA 3OYNA 2Y9ZA 1VQOI 4BBSJ 4RGRA 1JT6A 3WTUC 4EM1A 3CCJI 1S7OA 3ABKH 1LE8B 3GO5A 1EKEA 3U2RA 2A6EF 2R7WA 2P81A 3KP3A 5LD2C 2CW0F 2EIKH 1ETVA 4A3GJ 2XAJA 1XCVA 2CS3A 1X1PA 4ZC3A 3T5XA 1YE9A 1MJ9A 3WTSC 3T8TA 3QRFF 5GPAA 5FLVA 4ZZLA 2FU4A 3K1PA 3DCFA 3LSPA 2Z99A 3RKWA 1ETOA 2YU3A 2EH3A 2E35A 3HM5A 4U87A 2V1XA 3LFUA 3BCBA 1FOWA 3GTMJ 1HBXG 4ZDLA 4B3AA 2LF8A 3FF5A 2QQ9A 2CQQA 3ERED 2LK2A 3PNVA 1ON1A 3KP5A 1XGOA 5FKKA 3OYEA 3GUDA 1GT0C 2VKDA 3HPGA 4XLEA 5F08A 2DTRA 3I59B 5J1YA 4X0GA 1Q1VA 3W6VA 4AYBN 3SZPA 1TNSA 4LGWA 2OCCH 3FXKA 4H4KC 2F5EA 4J00A 1JTXA 2L0KA 3ZMZA 5EG0A 1RIOH 2AO9A 2ME0A 1ERDA 2XGDA 3HOVJ 3H35A 4YFNF 2QYOA 2BY1A 5CPRB 3SQNA 1WHUA 2RVCA 6PAXA 2YUSA 4YELA 3F8MA 4U7DA 1LDDA 2G0EA 5TGTA 1KQ9A 1B1BA 3O8GA 4RGSA 2PJPA 1TLHB 2JA5J 3PUBA 4XOPA 2DPDA 2WV0A 4BNCA 1X4PA 4KYWA 1MMNA 1HDDC 4HNTA 1HKTA 3D5LA 3IKTA 4C9YA 2CW8A 1S7EA 1U8RA 2YU9J 1RC9A 2O03A 5D8KB 3L7WA 2WAFA 1JJ6C 1CGPA 4Y15A 2H6BA 1WRJA 2R92J 4CCMA 2A05A 2HXIA 2HTJA 1UELB 2GIVA 4G7ZF 4A69C 3IV5A 1DU0A 1OYIA 2X1EA 1J0RA 4PJNA 5L3EA 1D0ZA 3NARA 2OUMA 3E6DA 3M8EA 4K2EA 2EA4A 2FMLA 1GVJA 3W6KB 2D1VA 2PMUA 4OOIA 2HOAA 1FTTA 3M8FA 1GV2A 2WY8Q 3A1YA 3DKXA 4HV6A 5FLXZ 2ZXJA 1F43A 4M3DA 1CF7B 2TDXA 3C18A 3P7NA 2A6HF 1D5VA 1KGSA 1GLNA 1TQMA 2OU2A 5F0HA 3A01B 3MKWB 3HOUJ 2VT3A 5DD8A 2RKHA 5CVUA 4ENJA 2DJNA 1LVAA 2DYRH 1LB2A 3QOEA 2V6EA 2L3DA 1KU9A 1MBFA 4MFDA 4HW0A 1YOVB 3BY6A 1W7PA 2AHQA 2LREA 5IPAA 2K85A 2O61A 4A3CJ 2MC4A 1QGPA 2K9LA 2RNJA 3MWMA 4XKCA 4NC8A 2VOPA 4IL6C 2DFIA 2A07F 1ZHFA 3CCEI 5DM6F 2OAZA 4XKWA 1JKRC 3S15J 3I55I 3IWFA 3S2HJ 4JQFA 4RLFA 4DZPA 1POGA 2EWNA 4LITA 1IV6A 1BR1A 5TISC 3TO9A 4P55A 3CP8A 3R60A 3IP4B 3TL4X 4RDUA 1OYYA 3FMSA 2NS8A 2QA4I 3DBLB 1WH7A 3RIRA 4MEXF 1P9QC 3NQOA 3M9AA 1D0YA 3DU5A 3ZQQA 3GTGJ 4CUGA 2HQRA 2HQNA 2HPIA 5JFRA 4UV9A 2FOWA 3K10A 2OTLI 1MBGA 1FYLA 4XNFA 5DS9A 3H9QA 2F5DA 3HOXJ 2YR2A 3ZRGA 2H8RA 3DEEA 4L9NA 1FNNA 4W1UA 3EYYA 5FGMA 1XS9A 2FMYA 1YJNI 2QEXI 2CJJA 4EJTA 3S32A 4EJUA 4OIRF 4HNUA 3ML6A 1U2WA 2XRLA 3TBIA 3F6OA 5K5QA 1K79A 5DYMA 1RKTA 3OYJA 1FMVA 4RAFA 4YIIA 1VNDA 2VC1A 3RQIA 2IT0A 2NRAC 4L9TA 3BTJA 4G6DA 2XPWA 1MDMB 3WE2A 1EJ9A 2QVOA 1NHAA 1P4AA 1OQYA 4IOCF 3H92A 4M9XA 2XHKA 4V19K 3EUHC 3D1NI 2X51A 4MQVA 3JRCA 3CMMA 2HVQA 3I5UA 4BY1J 1JUPA 1P7IA 1LKXA 1RRJA 5HS8A 2RGVA 3GTKJ 3GTOJ 1X3UA 4D7NA 1JXSA 3VYSB 2KIQA 2HTSA 4ZYGA 2OZUA 2WBMA 4A3LJ 1ETKA 2PN6A 3WGHA 1LFPA 2ID6A 4L9VA 1I27A 2KLOA 4RGXA 2KJBA 2XC7A 1Z7UA 2HZTA 3I58A 1IRXA 4MFEA 3HG9A 5FLMJ 4QTRA 1ZTRA 5FKLA 3OSFA 2PEXA 2HS5A 2Y48A 2EV6A 1ULYA 2HKOA 3GZ6A 2R7VA 4N9IA 2JA8J 3J7ZI 2D2WA 1D1BA 1X3ZB 3HUGA 4EQQA 3JW4A 1W7PD 2W25A 3E6BA 4O5VA 4XLCA 1MH3A 4HOBA 1K6OA 3QOPA 5F0FA 1MMSA 1XSDA 1G3WA 4WK8F 3V8KA 2VQCA 1BC8C 3HOTA 2MSYA 1ODDA 2IEKA 5K5OA 3C1DA 2L2OA 3BT9A 3RYRA 3CO6C 2BV6A 4Q4ZF 3LMMA 1Y1VJ 2M9HA 4IQJA 3CESA 3I53A 3KYDB 2Z5UA 2G9WA 4EV0A 5IYDJ 2ELHA 2K4JA 2MW8A 3BDDA 2IAIA 3H9JA 5C4XJ 1ETWA 4AU7A 3C2BA 4E6KG 4ESJA 1HOMA 4LG3A 4CCKA 1DQUA
chains in the Genus database with same CATH topology
4BYYA 3M1EA 3M7GA 4OMZA 1C0WA 4XSZF 1XB4A 5DUKA 4ZZDA 2DAOA 3GFLA 3ZP5A 3RPQA 2XV4S 4FHTA 5LHIA 2JZYA 2MH9A 2W85A 5CVVA 5L3DA 2AXLA 4HV5A 1P4WA 2DK5A 4N9HA 3CDHA 1I1GA 3E97A 1G4DA 3DP7A 5FO5A 1STZA 1ZG3A 3VFZA 3TDUC 4RS8A 3OV8A 3CUOA 3FM5A 2H27A 2F2EA 1HKQA 3WODF 5ICCA 3WGIA 2IA1A 4Q48A 3J7AO 2P8TA 1R7JA 3DXJF 3VOEA 1B59A 2ZMEB 3R4KA 3V8LA 3WTVC 1YFHA 4L9JA 1H0MA 4KNYA 1S6LA 2V79A 1SD4A 5J6XA 1YW9A 4R79A 4LB6B 1B4AA 2LF7A 2HDCA 5E8IA 3OOPA 2PLYA 4UV8A 4I7HA 4KN7X 4BHBA 3T8RA 2BGCA 5BPDA 1BBYA 2A3SA 1Z9CA 5DEQA 4ENMA 2JT1A 2HFHA 5E1WA 4A6EA 4Q47A 1R23A 3V7RA 4EM0B 1TBXA 3JSPA 1U6GA 2KKOA 3K2ZA 4XSXF 3BPVA 3CJNA 2DW4A 3KP2A 2X4HA 3WTYC 3GFJA 1T38A 1O7FA 1S7AA 1IN5A 4KN4X 2VE8A 3LA3A 1EV7A 5DV5A 5LEJA 3U9GA 1IZ1A 3PQJA 4IVNA 1ZGJA 4LLNA 3G73A 4RAZA 3IHUA 4PCQA 2XKPA 3FM3A 1VTNC 2NNNA 5BQTA 1IW7F 4YIFA 3B02A 1J5YA 3J81K 4PZJA 4P5OA 4HLXA 2MLKA 1O57A 4BAYA 1KU2A 3GF2A 2IA2A 3TOAA 2ZFWA 1O3SA 1WQ2A 1FOKA 1H9TA 2DT5A 5ILVA 1W5TA 4KMUX 1UFMA 1FWZA 2LNBA 4LK0F 1ONVA 1KQ0A 1D8JA 5LGUA 3ZMUA 1KU7A 3SHFA 4YFKF 2DU9A 2GAUA 3TOBA 4U88A 1R00A 2XUBA 2CFXA 4OIPF 2PG4A 2E1CA 4KT5C 1IXSB 5HDGA 1BIBA 3CUQA 3RJPA 5F64A 1KU3A 1K78B 4IRGA 1G6NA 2V6CA 2ESHA 1RUNA 1R5HA 2CWEA 1IAWA 2DQLA 4IRIA 3VEPA 1IRFA 1QNTA 1WWXA 1U5TA 4PGHA 5E1XA 1EH7A 4L0YB 3RYPA 3HIFA 4HQMA 3HOSA 5FD6A 1PUEE 4CGZA 4MNUA 2V1DA 5LGNA 5AIQA 4B09A 1TQPA 3KLOA 1PP7U 3BROA 4HDVA 2ZNYA 1Z05A 2UXXA 1LEAA 5L3GA 1DUXC 1L0OC 1D8KA 3GFMA 2WTEA 1BI3A 4CYDA 3EYIA 1BN5A 4BHCA 5L3BA 1SFUA 3RTRA 3KETA 1WI9A 1QO0D 5HS9A 4UVBA 4HZFA 1FP1D 5IT9K 5LEKA 4EVIA 1TW3A 3BJ6A 5ICFA 2VBYA 2VONA 1BI0A 3Q9VA 1LQ1A 1HSJA 2K27A 2XAFA 2WWYA 3O2PE 1OYWA 1S29A 3TGNA 1HQCA 4A2UA 3N4MA 5ILUA 2JSCA 3SFZA 3R61A 1MJAA 3SZTA 4XRFA 1G3YA 2HKXA 1E2XA 1T39A 3WU1B 4KUMA 2OQGA 5ICGA 2M8EA 3FXRA 4NHJA 3T0YA 4RAYA 2K86A 1KYZA 2FSWA 3HRUA 3B73A 4LFUA 1Y0UA 1F5TA 1HSTA 4KFCA 2Z33A 2J5OA 3IWZA 3L9FA 3ELKA 1TW2A 5EEGA 2HOEA 1YW8A 5CVJA 3K69A 2QZ8A 3LQRA 3L2CA 4I0BA 2CYYA 4WXCA 4OIOF 1AOYA 1P6RA 3D0SA 5BS6A 5D5WB 4IF4A 2EFOA 4O3MA 1UCRA 1O3RA 1T98A 3AAFA 3TQNA 1SFXA 4CXFA 3E6MA 4EGZA 4L0ZB 4A0XA 1J75A 4I09A 4GYIA 5E20A 4MEYF 4CICA 2QBYB 1MD0A 3FWEA 4I02A 2VBXA 4QLCU 4EJOA 1ZGAA 2ZCWA 3GW2A 4F7ZA 4HA8A 2FBKA 4HF0A 5CVIA 3MQ0A 1QZYA 5CVRA 5DD4A 1R36A 3N97A 2Q2EA 5JHUA 4U0VA 2LSOA 2VBZA 1QPMA 1ZRDA 2FXAA 3TO6A 5D5VB 4PGGA 3WU0A 2NNYA 2CQKA 2EV0A 2L02A 1ZG1A 3ECOA 1USSA 1HKSA 5HOOA 4OINF 1SD5A 3ECHA 4I0AA 3KLNA 3LWFA 4KIBA 4LG0A 5HDKA 1B6AA 3FXQA 5K5RA 2HWVA 5J8FA 2XKOA 4WWCA 3R0JA 1FY7A 4QWQA 3HRSA 3BP8A 2STTA 4CHUA 4OMYA 1YO5C 3C3WA 4TV7A 2EFNA 5LRRA 5FFZA 1T2KA 1R58A 4E70A 4BXUA 4PDKA 1DP7P 3SXYA 5IT3A 2IVMA 2EV5A 2J5PA 2YSRA 2FA5A 2MC3A 3KZYA 1OMIA 3LFKA 4HLYA 5LRSA 2M5WA 2O3FA 1GXQA 2KRFA 2FF4A 2R7DA 2ZJ2A 3DPTA 3G3ZA 1XSVA 1MKMA 2ZO4A 5H6QA 4XLPF 4HAMA 1QQIA 2ACJA 2PBIA 3GYHX 2Z3YA 4LMYA 2K4BA 5A2QK 1EH8A 1ZG5A 2V1UA 1XN7A 2EFPA 4G94A 1DPUA 2VXZA 3BJOA 2K7LA 3GVAA 3VB2A 3IKVA 1IF1A 2P7VB 3LSTA 1R1UA 3KFWX 4M9ZA 2ETHA 1XMAA 1YS6A 5DUIA 1FX7A 5ED4A 3ROUA 2MA3A 3F21A 3WTXC 3DQVC 1R1TA 4FT8A 2DO7A 2F5FA 3IL2A 4M6YA 3Q5FA 4R8HA 3Q9SA 3ZQ7A 2IW5A 4KICA 4Q5SF 5J8CA 5E17F 2UXNA 2M30A 2P7CB 4IPAA 1R5GA 4IJAA 5H6RA 2E7XA 3EUHA 3CUQB 1JHFA 1MJBA 3J80Z 5DCFA 1O3QA 2ISYA 3L00A 4CZZA 1SD7A 3K9TA 3MCZA 3U1DA 3QP6A 3K1MA 2YPRA 5KVRA 1XMKA 3QU3A 2H6CA 2R7FA 2UZKA 2GWRA 1IXCA 2W84A 5D5UB 4A12A 5F6FA 3JTHA 4Y13A 3NEUA 1F9NA 3EDPA 2FOKA 3P9KA 1D3YA 1OR7A 4YG2F 5BPIA 1U78A 3W6JB 1U5TC 4EGYA 4M73A 2HGCA 3O6BB 4MQ9F 2BE5F 3GFIA 4H0EA 2P5VA 1FBUA 1KYWA 3RI4A 1QBJA 3I59A 2BBYA 1SD6A 1I6XA 5CJ9A 2KIMA 4IHSA 1R22A 2CO5A 3WTTC 4RGUA 1FC3A 4UUVA 4GCVA 2NS0A 2Y75A 5FD5A 4D0PA 5KK1A 3J81Z 2XAHA 2FNAA 2AS5F 4KIGA 4NQWA 3E5XA 1REPC 2STWA 3F8BA 2PMHA 2HR3A 3QP5A 3HRMA 2QLZA 2DPUA 3ABUA 5E1ZB 2P6TA 5CYVA 2QENA 2RQPA 1F4KA 5D4RA 3FXUA 4MTEA 1MZBA 1KA8A 3C7JA 4EM2A 3VODA 4A5MA 3HHHA 3JSOA 1EH6A 3GX4X 2A61A 5JR3A 3HSEA 1ZYRF 3RDIA 2DLLA 4O6JA 5TJJA 1ZREA 4S04A 4HF1A 3CLOA 4FX0A 1XDUA 4A5NA 3HSRA 1JHHA 5E18F 3V8JA 1ZLKA 1YLFA 2ZBKA 4R1HA 1RUOA 2Y0MA 3JTGA 3FMQA 4IRHA 2L4MA 5A2QZ 1DPRA 2VBWA 3KE2A 5FB2A 2D1HA 2NAZA 1HW1A 1YG2A 3FX3A 2EA2A 3ZMDA 4LG0B 4M6XA 3RKYA 1GXPA 3WG9A 3I71A 4XLNF 3E6CC 5LHHA 2IP2A 2KJCA 1HW2A 4CO8A 5LHGA 4JK1X 4AWXB 2O0YA 1MDMA 3I54A 3HRTA 1YW7A 2Z9OA 5CLSA 5D8LB 2DBBA 2VOOA 1I1SA 4CDGA 1UHWA 1B9MA 5TRDA 1JGSA 3R0AA 4S05A 3CO7C 5LGTA 3F3XA 3IRRA 1ZLJA 1FZPB 2MBFA 5IT9Z 3S2WA 1DDNA 4UHTA 3LQQA 3HTUA 1F1ZA 1O7LA 5ILSA 2QBYA 2E7WA 2UWMA 1U5TB 3F8CA 3JAMZ 1RI7A 1YTYA 3O3KA 3GZ5A 2M1BA 3DV8A 1IUYA 5BOXA 4WXDA 2LDUA 2P6SA 2C6YA 3TO7A 4L5IA 2X0LA 3F6VA 1TNTA 4KDPA 4MGRA 3PFIA 4I2OA 4JBAA 1CF7A 4OU0A 2A68F 2GXGA 1QZZA 3H3ZA 1S3JA 3KEQA 1W7PB 2YX4A 4A0YA 3LAPA 2EJRA 3KZZA 3V7SA 3K1NA 2G7HA 3DEUA 4ENNA 1FYKA 1XSXA 2ISZA 3DFGA 1J59A 1SFEA 2IA0A 1Z91A 3WGGA 3REOA 2G7UA 2NYXA 3HSFA 1A04A 3L09A 2VC0A 2OZ6A 2D45A 3LAJA 3RPUA 4DNCA 1FBQA 5HVQC 3GEZA 1PP8F 1BOAA 4MTDA 4UVCA 2GQQA 1ZRCA 3DKWA 5EEHA 5AONA 1PDNC 1O3TA 1Z6TA 4ETSA 4LD5A 2EB7A 1V3FA 5JVTA 2M87A 3KP6A 2VODA 4ZYDA 3I64A 4GO1A 1YYVA 3WTZA 1K78A 4ON0A 3LA2A 1AWCA 4LB5A 4IXAA 3JAMK 2QWWA 3KCCA 1BI2A 2PFBA 3COAC 4MHGA 3V7CA 5L3CA 1BI1A 3I4PA 4HX8A 1ZAOA 2JTVA 2E1NA 4GXOA 2FNPA 1LNWA 3MAJA 4M9SA 4GYGA 2QM3A 1TTYA 1H9GA 1SAXA 1IN7A 3GWZA 4WF2A 3F23A 2VN2A 2EK5A 2FE3A 1K7AA 3TDZC 1HW5A 5H20A 2IJLA 4G8XA 4XBFA 4A6DA 4ASNA 4AIJA 2P5LC 2ZNZA 1ON2A 2HEOA 1JE8A 5FLXK 3K0LA 4EJVA 4HQEA 1ZN2A 4A0ZA 4UVAA 2GZWA 5JI6A 3T1BA 4RB0A 5HS7A 1I5ZA 2QQBA 2XRNA 3ZMVA 4G7HF 1T0FA 1XCBA 2OBPA 3WE3A 4Z2YA 3ZMSA 1IN8A 2JPBA 3BZ6A 2XAGA 2COMA 3J80K 1LDJA 4RB1A 5L3FA 2DI3A 2BYVE 4YFXF 1G3TA 3ULQB 1V4RA 4G7OF 2K02A 1IN6A 4BQAA 2H09A 1ZARA 1L3LA 2ZMEA 5K1YA 3F22A 2RC4A 4HYEA 2DK8A 4B8XA 4ESBA 4HBLA 4P9UA 1R1VA 3ZPLA 2W57A 4AD9A 4AVPA 4WXHA 3WTWC 2CG4A 1BC7C 2B0LA 3P9CA 3EQLF 4M74A 1YS7A 3BWGA 5D6EA 2H94A 1YIOA 2JRTA 1FSHA 4EJWA 2L54A 2GXBA 3GXOA 2IRFG 2R3SA 4OIQF 3P9IA 1XGSA 4M72A 2GA2A 2HYGD 1E17A 1IN4A 1BIAA 4EMSA 1U3EM 4AIKA 2XGXA 2OD5A 3NRVA 5DCMA 3QU6A 3ISPA 1LDKB 1FBSA 1T6SA 4LK1F 2QQAA 3RKXA 1G3SA 1BM9A 3E5QA 1W5SA 2EFQA 2A69F 2EFWA 2GA1A 1Z1DA 2ESNA 4HDUA 2BEOA 3ZMTA 3ZN0A 1FYMA 4LLLA 2FQ3A 4FX4A 1KQ8A 3CUQC 4WCGA 3KP7A 1RZ4A 5D4SA 5E8GA 2O6GE 5ICEA 2FBIA 1LJ9A 1B9NA 2WC2A 4N0BA 2VT2A 3TKYA 4G9YA 1UHMA 2FEZA 4WX9A 2PI0A 2ZKZA 1J7KA 4KA4A 4L5JA 3F8FA 2M45A 1IXRC 4P96A 2LKPA 1ZRFA 1IRGA 2MH2A 3V4GA 3QAHA 2MD5A 2Q8KA 4ZH4F 1P92A 2F5CA 2RV8A 3CTAA 1FLIA 4UNOA 1YQAA 2PQ8A 3IRQA 1OKRA 4RB2C 3FZVA 4ESFA 1GHCA 4RB3C 1W4MA 4KIFA 2A5YB 2YX7A 2IPQX 1J2XA 1FPQA 5F1RA 4LJZF 2P4WA 1WSUA 3FMRA 2KIUA 1OPCA 4DQ2A 3KP4A 2VE9A 3GLXA 3MZYA 4U0YA 4KMFA 1FT9A 2O8XA 4BHPA 3MEXA 5DCMB 3F72A 2XAQA 3FHZA 5FFXA 1LEBA 3BJAA 4GGGA 4ZYHA 4HX7A 4U7BA 2DQRA 2FBHA 1HXDA 2RDPA 4M71A 2FRHA 1MGTA 5HLHA 1SMTA 1XGMA 2XIGA 1BJAA 2CSOA 1Z6RA 3HHGA 3IC7A 4ZYEA 2OA4A 2P5KA 3QPTA 4I98B 5D5XB 4UXNA 3R6SA 3DF8A 3QPHA 3E3VA 2RN7A 1J9IA 1Q1HA 3I0TA 2Q0OA 3E5UA 2CGPA 4ENKA 4HF2A 1XDSA 3MFKA 2OQRA 2ADUA 1ZH5A 5HLIA 4P9FA 1UB9A 3ZN1A 4NB5A 4IHTA 2XASA 2XROA 4LLGF 3ABTA 5DDGA 1P2FA 1S8NA 4HX4A 5D6FA 2L4AA 4G6QA 3F8NA 4Y17A 1USTA 2JPCA 4I01A 5HLGA 3PQKA 2KIFA 1SMYF 1TQIA 1RNLA 2XVCA 3HTSB 2MLGA 4U0WA 1XD7A 2QUFA 5ERIA 3EETA 1WKMA 3MZHA 3LA7A 2V9VA 5BMZA 3HYIA 3BPXA 5AIPA 5LBQA 1FSEA 4AIHA 5LLQA 2HYFA 3BOQA 1P4XA 3DPLC 2L01A 1FP2A 2W24A 3KEOA 4L18B 1XGNA 3H3UA 4BH9A 5HDNA 4RGRA 3WTUC 4EM1A 1S7OA 3GO5A 3U2RA 2A6EF 3KP3A 2CW0F 2XAJA 1XCVA 3T5XA 1MJ9A 3WTSC 3T8TA 3QRFF 4ZZLA 2FU4A 3K1PA 2Z99A 3RKWA 2YU3A 2V1XA 1HBXG 2LF8A 3FF5A 2QQ9A 3ERED 1ON1A 3KP5A 1XGOA 3GUDA 2DTRA 3I59B 3SZPA 1TNSA 4LGWA 2F5EA 3ZMZA 1RIOH 4YFNF 2QYOA 3SQNA 2RVCA 6PAXA 3F8MA 4U7DA 1LDDA 1KQ9A 1B1BA 4RGSA 2PJPA 1TLHB 2DPDA 4KYWA 2WV0A 4BNCA 1HKTA 3D5LA 3IKTA 1U8RA 2O03A 5D8KB 3L7WA 1CGPA 4Y15A 2H6BA 1WRJA 2HTJA 4G7ZF 2GIVA 1OYIA 1J0RA 5L3EA 3E6DA 3M8EA 4K2EA 2EA4A 2FMLA 1GVJA 3W6KB 2D1VA 2PMUA 4OOIA 3M8FA 4HV6A 5FLXZ 2ZXJA 1CF7B 2TDXA 3C18A 3P7NA 2A6HF 1D5VA 1KGSA 2OU2A 1TQMA 2VT3A 5DD8A 2RKHA 5CVUA 4ENJA 1LVAA 1LB2A 2L3DA 1KU9A 4HW0A 3BY6A 1W7PA 2O61A 1QGPA 2RNJA 3MWMA 2VOPA 2DFIA 2A07F 1ZHFA 2OAZA 3IWFA 4JQFA 2EWNA 3TO9A 4P55A 3R60A 1OYYA 3FMSA 3RIRA 4MEXF 3NQOA 3M9AA 2HQRA 2HQNA 5JFRA 4UV9A 1FYLA 2F5DA 2YR2A 4L9NA 1FNNA 3EYYA 5FGMA 2FMYA 4EJTA 4EJUA 4OIRF 3ML6A 1U2WA 3F6OA 5K5QA 1K79A 5DYMA 4YIIA 2VC1A 2NRAC 2IT0A 4L9TA 4G6DA 1MDMB 3WE2A 2QVOA 1NHAA 1P4AA 3H92A 4M9XA 2XHKA 4MQVA 3I5UA 5HS8A 2RGVA 1X3UA 1JXSA 2HTSA 4ZYGA 2OZUA 2PN6A 3WGHA 4L9VA 1I27A 4RGXA 2KJBA 1Z7UA 2HZTA 3I58A 2PEXA 2HS5A 2Y48A 2EV6A 1ULYA 2HKOA 3GZ6A 4N9IA 2D2WA 3HUGA 4EQQA 3JW4A 1W7PD 2W25A 3E6BA 4O5VA 4HOBA 1K6OA 3QOPA 1XSDA 1G3WA 4WK8F 3V8KA 1BC8C 3HOTA 1ODDA 5K5OA 3C1DA 3RYRA 3CO6C 2BV6A 4Q4ZF 3I53A 2Z5UA 4EV0A 2G9WA 2ELHA 2K4JA 3BDDA 4ESJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BYY A;  3M1E A;  3M7G A;  4OMZ A;  1C0W A;  4XSZ F;  1XB4 A;  5DUK A;  4ZZD A;  2DAO A;  3GFL A;  3ZP5 A;  3RPQ A;  2XV4 S;  4FHT A;  5LHI A;  2JZY A;  2MH9 A;  2W85 A;  5CVV A;  5L3D A;  2AXL A;  4HV5 A;  1P4W A;  2DK5 A;  4N9H A;  3CDH A;  1I1G A;  3E97 A;  1G4D A;  3DP7 A;  5FO5 A;  1STZ A;  1ZG3 A;  3VFZ A;  3TDU C;  4RS8 A;  3OV8 A;  3CUO A;  3FM5 A;  2H27 A;  2F2E A;  1HKQ A;  3WOD F;  5ICC A;  3WGI A;  2IA1 A;  4Q48 A;  3J7A O;  2P8T A;  1R7J A;  3DXJ F;  3VOE A;  1B59 A;  2ZME B;  3R4K A;  3V8L A;  3WTV C;  1YFH A;  4L9J A;  1H0M A;  4KNY A;  1S6L A;  2V79 A;  1SD4 A;  5J6X A;  1YW9 A;  4R79 A;  4LB6 B;  1B4A A;  2LF7 A;  2HDC A;  5E8I A;  3OOP A;  2PLY A;  4UV8 A;  4I7H A;  4KN7 X;  4BHB A;  3T8R A;  2BGC A;  5BPD A;  1BBY A;  2A3S A;  1Z9C A;  5DEQ A;  4ENM A;  2JT1 A;  2HFH A;  5E1W A;  4A6E A;  4Q47 A;  1R23 A;  3V7R A;  4EM0 B;  1TBX A;  3JSP A;  1U6G A;  2KKO A;  3K2Z A;  4XSX F;  3BPV A;  3CJN A;  2DW4 A;  3KP2 A;  2X4H A;  3WTY C;  3GFJ A;  1T38 A;  1O7F A;  1S7A A;  1IN5 A;  4KN4 X;  2VE8 A;  3LA3 A;  1EV7 A;  5DV5 A;  5LEJ A;  3U9G A;  1IZ1 A;  3PQJ A;  4IVN A;  1ZGJ A;  4LLN A;  3G73 A;  4RAZ A;  3IHU A;  4PCQ A;  2XKP A;  3FM3 A;  1VTN C;  2NNN A;  5BQT A;  1IW7 F;  4YIF A;  3B02 A;  1J5Y A;  3J81 K;  4PZJ A;  4P5O A;  4HLX A;  2MLK A;  1O57 A;  4BAY A;  1KU2 A;  3GF2 A;  2IA2 A;  3TOA A;  2ZFW A;  1O3S A;  1WQ2 A;  1FOK A;  1H9T A;  2DT5 A;  5ILV A;  1W5T A;  4KMU X;  1UFM A;  1FWZ A;  2LNB A;  4LK0 F;  1ONV A;  1KQ0 A;  1D8J A;  5LGU A;  3ZMU A;  1KU7 A;  3SHF A;  4YFK F;  2DU9 A;  2GAU A;  3TOB A;  4U88 A;  1R00 A;  2XUB A;  2CFX A;  4OIP F;  2PG4 A;  2E1C A;  4KT5 C;  1IXS B;  5HDG A;  1BIB A;  3CUQ A;  3RJP A;  5F64 A;  1KU3 A;  1K78 B;  4IRG A;  1G6N A;  2V6C A;  2ESH A;  1RUN A;  1R5H A;  2CWE A;  1IAW A;  2DQL A;  4IRI A;  3VEP A;  1IRF A;  1QNT A;  1WWX A;  1U5T A;  4PGH A;  5E1X A;  1EH7 A;  4L0Y B;  3RYP A;  3HIF A;  4HQM A;  3HOS A;  5FD6 A;  1PUE E;  4CGZ A;  4MNU A;  2V1D A;  5LGN A;  5AIQ A;  4B09 A;  1TQP A;  3KLO A;  1PP7 U;  3BRO A;  4HDV A;  2ZNY A;  1Z05 A;  2UXX A;  1LEA A;  5L3G A;  1DUX C;  1L0O C;  1D8K A;  3GFM A;  2WTE A;  1BI3 A;  4CYD A;  3EYI A;  1BN5 A;  4BHC A;  5L3B A;  1SFU A;  3RTR A;  3KET A;  1WI9 A;  1QO0 D;  5HS9 A;  4UVB A;  4HZF A;  1FP1 D;  5IT9 K;  5LEK A;  4EVI A;  1TW3 A;  3BJ6 A;  5ICF A;  2VBY A;  2VON A;  1BI0 A;  3Q9V A;  1LQ1 A;  1HSJ A;  2K27 A;  2XAF A;  2WWY A;  3O2P E;  1OYW A;  1S29 A;  3TGN A;  1HQC A;  4A2U A;  3N4M A;  5ILU A;  2JSC A;  3SFZ A;  3R61 A;  1MJA A;  3SZT A;  4XRF A;  1G3Y A;  2HKX A;  1E2X A;  1T39 A;  3WU1 B;  4KUM A;  2OQG A;  5ICG A;  2M8E A;  3FXR A;  4NHJ A;  3T0Y A;  4RAY A;  2K86 A;  1KYZ A;  2FSW A;  3HRU A;  3B73 A;  4LFU A;  1Y0U A;  1F5T A;  1HST A;  4KFC A;  2Z33 A;  2J5O A;  3IWZ A;  3L9F A;  3ELK A;  1TW2 A;  5EEG A;  2HOE A;  1YW8 A;  5CVJ A;  3K69 A;  2QZ8 A;  3LQR A;  3L2C A;  4I0B A;  2CYY A;  4WXC A;  4OIO F;  1AOY A;  1P6R A;  3D0S A;  5BS6 A;  5D5W B;  4IF4 A;  2EFO A;  4O3M A;  1UCR A;  1O3R A;  1T98 A;  3AAF A;  3TQN A;  1SFX A;  4CXF A;  3E6M A;  4EGZ A;  4L0Z B;  4A0X A;  1J75 A;  4I09 A;  4GYI A;  5E20 A;  4MEY F;  4CIC A;  2QBY B;  1MD0 A;  3FWE A;  4I02 A;  2VBX A;  4QLC U;  4EJO A;  1ZGA A;  2ZCW A;  3GW2 A;  4F7Z A;  4HA8 A;  2FBK A;  4HF0 A;  5CVI A;  3MQ0 A;  1QZY A;  5CVR A;  5DD4 A;  1R36 A;  3N97 A;  2Q2E A;  5JHU A;  4U0V A;  2LSO A;  2VBZ A;  1QPM A;  1ZRD A;  2FXA A;  3TO6 A;  5D5V B;  4PGG A;  3WU0 A;  2NNY A;  2CQK A;  2EV0 A;  2L02 A;  1ZG1 A;  3ECO A;  1USS A;  1HKS A;  5HOO A;  4OIN F;  1SD5 A;  3ECH A;  4I0A A;  3KLN A;  3LWF A;  4KIB A;  4LG0 A;  5HDK A;  1B6A A;  3FXQ A;  5K5R A;  2HWV A;  5J8F A;  2XKO A;  4WWC A;  3R0J A;  1FY7 A;  4QWQ A;  3HRS A;  3BP8 A;  2STT A;  4CHU A;  4OMY A;  1YO5 C;  3C3W A;  4TV7 A;  2EFN A;  5LRR A;  5FFZ A;  1T2K A;  1R58 A;  4E70 A;  4BXU A;  4PDK A;  1DP7 P;  3SXY A;  5IT3 A;  2IVM A;  2EV5 A;  2J5P A;  2YSR A;  2FA5 A;  2MC3 A;  3KZY A;  1OMI A;  3LFK A;  4HLY A;  5LRS A;  2M5W A;  2O3F A;  1GXQ A;  2KRF A;  2FF4 A;  2R7D A;  2ZJ2 A;  3DPT A;  3G3Z A;  1XSV A;  1MKM A;  2ZO4 A;  5H6Q A;  4XLP F;  4HAM A;  1QQI A;  2ACJ A;  2PBI A;  3GYH X;  2Z3Y A;  4LMY A;  2K4B A;  5A2Q K;  1EH8 A;  1ZG5 A;  2V1U A;  1XN7 A;  2EFP A;  4G94 A;  1DPU A;  2VXZ A;  3BJO A;  2K7L A;  3GVA A;  3VB2 A;  3IKV A;  1IF1 A;  2P7V B;  3LST A;  1R1U A;  3KFW X;  4M9Z A;  2ETH A;  1XMA A;  1YS6 A;  5DUI A;  1FX7 A;  5ED4 A;  3ROU A;  2MA3 A;  3F21 A;  3WTX C;  3DQV C;  1R1T A;  4FT8 A;  2DO7 A;  2F5F A;  3IL2 A;  4M6Y A;  3Q5F A;  4R8H A;  3Q9S A;  3ZQ7 A;  2IW5 A;  4KIC A;  4Q5S F;  5J8C A;  5E17 F;  2UXN A;  2M30 A;  2P7C B;  4IPA A;  1R5G A;  4IJA A;  5H6R A;  2E7X A;  3EUH A;  3CUQ B;  1JHF A;  1MJB A;  3J80 Z;  5DCF A;  1O3Q A;  2ISY A;  3L00 A;  4CZZ A;  1SD7 A;  3K9T A;  3MCZ A;  3U1D A;  3QP6 A;  3K1M A;  2YPR A;  5KVR A;  1XMK A;  3QU3 A;  2H6C A;  2R7F A;  2UZK A;  2GWR A;  1IXC A;  2W84 A;  5D5U B;  4A12 A;  5F6F A;  3JTH A;  4Y13 A;  3NEU A;  1F9N A;  3EDP A;  2FOK A;  3P9K A;  1D3Y A;  1OR7 A;  4YG2 F;  5BPI A;  1U78 A;  3W6J B;  1U5T C;  4EGY A;  4M73 A;  2HGC A;  3O6B B;  4MQ9 F;  2BE5 F;  3GFI A;  4H0E A;  2P5V A;  1FBU A;  1KYW A;  3RI4 A;  1QBJ A;  3I59 A;  2BBY A;  1SD6 A;  1I6X A;  5CJ9 A;  2KIM A;  4IHS A;  1R22 A;  2CO5 A;  3WTT C;  4RGU A;  1FC3 A;  4UUV A;  4GCV A;  2NS0 A;  2Y75 A;  5FD5 A;  4D0P A;  5KK1 A;  3J81 Z;  2XAH A;  2FNA A;  2AS5 F;  4KIG A;  4NQW A;  3E5X A;  1REP C;  2STW A;  3F8B A;  2PMH A;  2HR3 A;  3QP5 A;  3HRM A;  2QLZ A;  2DPU A;  3ABU A;  5E1Z B;  2P6T A;  5CYV A;  2QEN A;  2RQP A;  1F4K A;  5D4R A;  3FXU A;  4MTE A;  1MZB A;  1KA8 A;  3C7J A;  4EM2 A;  3VOD A;  4A5M A;  3HHH A;  3JSO A;  1EH6 A;  3GX4 X;  2A61 A;  5JR3 A;  3HSE A;  1ZYR F;  3RDI A;  2DLL A;  4O6J A;  5TJJ A;  1ZRE A;  4S04 A;  4HF1 A;  3CLO A;  4FX0 A;  1XDU A;  4A5N A;  3HSR A;  1JHH A;  5E18 F;  3V8J A;  1ZLK A;  1YLF A;  2ZBK A;  4R1H A;  1RUO A;  2Y0M A;  3JTG A;  3FMQ A;  4IRH A;  2L4M A;  5A2Q Z;  1DPR A;  2VBW A;  3KE2 A;  5FB2 A;  2D1H A;  2NAZ A;  1HW1 A;  1YG2 A;  3FX3 A;  2EA2 A;  3ZMD A;  4LG0 B;  4M6X A;  3RKY A;  1GXP A;  3WG9 A;  3I71 A;  4XLN F;  3E6C C;  5LHH A;  2IP2 A;  2KJC A;  1HW2 A;  4CO8 A;  5LHG A;  4JK1 X;  4AWX B;  2O0Y A;  1MDM A;  3I54 A;  3HRT A;  1YW7 A;  2Z9O A;  5CLS A;  5D8L B;  2DBB A;  2VOO A;  1I1S A;  4CDG A;  1UHW A;  1B9M A;  5TRD A;  1JGS A;  3R0A A;  4S05 A;  3CO7 C;  5LGT A;  3F3X A;  3IRR A;  1ZLJ A;  1FZP B;  2MBF A;  5IT9 Z;  3S2W A;  1DDN A;  4UHT A;  3LQQ A;  3HTU A;  1F1Z A;  1O7L A;  5ILS A;  2QBY A;  2E7W A;  2UWM A;  1U5T B;  3F8C A;  3JAM Z;  1RI7 A;  1YTY A;  3O3K A;  3GZ5 A;  2M1B A;  3DV8 A;  1IUY A;  5BOX A;  4WXD A;  2LDU A;  2P6S A;  2C6Y A;  3TO7 A;  4L5I A;  2X0L A;  3F6V A;  1TNT A;  4KDP A;  4MGR A;  3PFI A;  4I2O A;  4JBA A;  1CF7 A;  4OU0 A;  2A68 F;  2GXG A;  1QZZ A;  3H3Z A;  1S3J A;  3KEQ A;  1W7P B;  2YX4 A;  4A0Y A;  3LAP A;  2EJR A;  3KZZ A;  3V7S A;  3K1N A;  2G7H A;  3DEU A;  4ENN A;  1FYK A;  1XSX A;  2ISZ A;  3DFG A;  1J59 A;  1SFE A;  2IA0 A;  1Z91 A;  3WGG A;  3REO A;  2G7U A;  2NYX A;  3HSF A;  1A04 A;  3L09 A;  2VC0 A;  2OZ6 A;  2D45 A;  3LAJ A;  3RPU A;  4DNC A;  1FBQ A;  5HVQ C;  3GEZ A;  1PP8 F;  1BOA A;  4MTD A;  4UVC A;  2GQQ A;  1ZRC A;  3DKW A;  5EEH A;  5AON A;  1PDN C;  1O3T A;  1Z6T A;  4ETS A;  4LD5 A;  2EB7 A;  1V3F A;  5JVT A;  2M87 A;  3KP6 A;  2VOD A;  4ZYD A;  3I64 A;  4GO1 A;  1YYV A;  3WTZ A;  1K78 A;  4ON0 A;  3LA2 A;  1AWC A;  4LB5 A;  4IXA A;  3JAM K;  2QWW A;  3KCC A;  1BI2 A;  2PFB A;  3COA C;  4MHG A;  3V7C A;  5L3C A;  1BI1 A;  3I4P A;  4HX8 A;  1ZAO A;  2JTV A;  2E1N A;  4GXO A;  2FNP A;  1LNW A;  3MAJ A;  4M9S A;  4GYG A;  2QM3 A;  1TTY A;  1H9G A;  1SAX A;  1IN7 A;  3GWZ A;  4WF2 A;  3F23 A;  2VN2 A;  2EK5 A;  2FE3 A;  1K7A A;  3TDZ C;  1HW5 A;  5H20 A;  2IJL A;  4G8X A;  4XBF A;  4A6D A;  4ASN A;  4AIJ A;  2P5L C;  2ZNZ A;  1ON2 A;  2HEO A;  1JE8 A;  5FLX K;  3K0L A;  4EJV A;  4HQE A;  1ZN2 A;  4A0Z A;  4UVA A;  2GZW A;  5JI6 A;  3T1B A;  4RB0 A;  5HS7 A;  1I5Z A;  2QQB A;  2XRN A;  3ZMV A;  4G7H F;  1T0F A;  1XCB A;  2OBP A;  3WE3 A;  4Z2Y A;  3ZMS A;  1IN8 A;  2JPB A;  3BZ6 A;  2XAG A;  2COM A;  3J80 K;  1LDJ A;  4RB1 A;  5L3F A;  2DI3 A;  2BYV E;  4YFX F;  1G3T A;  3ULQ B;  1V4R A;  4G7O F;  2K02 A;  1IN6 A;  4BQA A;  2H09 A;  1ZAR A;  1L3L A;  2ZME A;  5K1Y A;  3F22 A;  2RC4 A;  4HYE A;  2DK8 A;  4B8X A;  4ESB A;  4HBL A;  4P9U A;  1R1V A;  3ZPL A;  2W57 A;  4AD9 A;  4AVP A;  4WXH A;  3WTW C;  2CG4 A;  1BC7 C;  2B0L A;  3P9C A;  3EQL F;  4M74 A;  1YS7 A;  3BWG A;  5D6E A;  2H94 A;  1YIO A;  2JRT A;  1FSH A;  4EJW A;  2L54 A;  2GXB A;  3GXO A;  2IRF G;  2R3S A;  4OIQ F;  3P9I A;  1XGS A;  4M72 A;  2GA2 A;  2HYG D;  1E17 A;  1IN4 A;  1BIA A;  4EMS A;  1U3E M;  4AIK A;  2XGX A;  2OD5 A;  3NRV A;  5DCM A;  3QU6 A;  3ISP A;  1LDK B;  1FBS A;  1T6S A;  4LK1 F;  2QQA A;  3RKX A;  1G3S A;  1BM9 A;  3E5Q A;  1W5S A;  2EFQ A;  2A69 F;  2EFW A;  2GA1 A;  1Z1D A;  2ESN A;  4HDU A;  2BEO A;  3ZMT A;  3ZN0 A;  1FYM A;  4LLL A;  2FQ3 A;  4FX4 A;  1KQ8 A;  3CUQ C;  4WCG A;  3KP7 A;  1RZ4 A;  5D4S A;  5E8G A;  2O6G E;  5ICE A;  2FBI A;  1LJ9 A;  1B9N A;  2WC2 A;  4N0B A;  2VT2 A;  3TKY A;  4G9Y A;  1UHM A;  2FEZ A;  4WX9 A;  2PI0 A;  2ZKZ A;  1J7K A;  4KA4 A;  4L5J A;  3F8F A;  2M45 A;  1IXR C;  4P96 A;  2LKP A;  1ZRF A;  1IRG A;  2MH2 A;  3V4G A;  3QAH A;  2MD5 A;  2Q8K A;  4ZH4 F;  1P92 A;  2F5C A;  2RV8 A;  3CTA A;  1FLI A;  4UNO A;  1YQA A;  2PQ8 A;  3IRQ A;  1OKR A;  4RB2 C;  3FZV A;  4ESF A;  1GHC A;  4RB3 C;  1W4M A;  4KIF A;  2A5Y B;  2YX7 A;  2IPQ X;  1J2X A;  1FPQ A;  5F1R A;  4LJZ F;  2P4W A;  1WSU A;  3FMR A;  2KIU A;  1OPC A;  4DQ2 A;  3KP4 A;  2VE9 A;  3GLX A;  3MZY A;  4U0Y A;  4KMF A;  1FT9 A;  2O8X A;  4BHP A;  3MEX A;  5DCM B;  3F72 A;  2XAQ A;  3FHZ A;  5FFX A;  1LEB A;  3BJA A;  4GGG A;  4ZYH A;  4HX7 A;  4U7B A;  2DQR A;  2FBH A;  1HXD A;  2RDP A;  4M71 A;  2FRH A;  1MGT A;  5HLH A;  1SMT A;  1XGM A;  2XIG A;  1BJA A;  2CSO A;  1Z6R A;  3HHG A;  3IC7 A;  4ZYE A;  2OA4 A;  2P5K A;  3QPT A;  4I98 B;  5D5X B;  4UXN A;  3R6S A;  3DF8 A;  3QPH A;  3E3V A;  2RN7 A;  1J9I A;  1Q1H A;  3I0T A;  2Q0O A;  3E5U A;  2CGP A;  4ENK A;  4HF2 A;  1XDS A;  3MFK A;  2OQR A;  2ADU A;  1ZH5 A;  5HLI A;  4P9F A;  1UB9 A;  3ZN1 A;  4NB5 A;  4IHT A;  2XAS A;  2XRO A;  4LLG F;  3ABT A;  5DDG A;  1P2F A;  1S8N A;  4HX4 A;  5D6F A;  2L4A A;  4G6Q A;  3F8N A;  4Y17 A;  1UST A;  2JPC A;  4I01 A;  5HLG A;  3PQK A;  2KIF A;  1SMY F;  1TQI A;  1RNL A;  2XVC A;  3HTS B;  2MLG A;  4U0W A;  1XD7 A;  2QUF A;  5ERI A;  3EET A;  1WKM A;  3MZH A;  3LA7 A;  2V9V A;  5BMZ A;  3HYI A;  3BPX A;  5AIP A;  5LBQ A;  1FSE A;  4AIH A;  5LLQ A;  2HYF A;  3BOQ A;  1P4X A;  3DPL C;  2L01 A;  1FP2 A;  2W24 A;  3KEO A;  4L18 B;  1XGN A;  3H3U A;  4BH9 A;  5HDN A;  4RGR A;  3WTU C;  4EM1 A;  1S7O A;  3GO5 A;  3U2R A;  2A6E F;  3KP3 A;  2CW0 F;  2XAJ A;  1XCV A;  3T5X A;  1MJ9 A;  3WTS C;  3T8T A;  3QRF F;  4ZZL A;  2FU4 A;  3K1P A;  2Z99 A;  3RKW A;  2YU3 A;  2V1X A;  1HBX G;  2LF8 A;  3FF5 A;  2QQ9 A;  3ERE D;  1ON1 A;  3KP5 A;  1XGO A;  3GUD A;  2DTR A;  3I59 B;  3SZP A;  1TNS A;  4LGW A;  2F5E A;  3ZMZ A;  1RIO H;  4YFN F;  2QYO A;  3SQN A;  2RVC A;  6PAX A;  3F8M A;  4U7D A;  1LDD A;  1KQ9 A;  1B1B A;  4RGS A;  2PJP A;  1TLH B;  2DPD A;  4KYW A;  2WV0 A;  4BNC A;  1HKT A;  3D5L A;  3IKT A;  1U8R A;  2O03 A;  5D8K B;  3L7W A;  1CGP A;  4Y15 A;  2H6B A;  1WRJ A;  2HTJ A;  4G7Z F;  2GIV A;  1OYI A;  1J0R A;  5L3E A;  3E6D A;  3M8E A;  4K2E A;  2EA4 A;  2FML A;  1GVJ A;  3W6K B;  2D1V A;  2PMU A;  4OOI A;  3M8F A;  4HV6 A;  5FLX Z;  2ZXJ A;  1CF7 B;  2TDX A;  3C18 A;  3P7N A;  2A6H F;  1D5V A;  1KGS A;  2OU2 A;  1TQM A;  2VT3 A;  5DD8 A;  2RKH A;  5CVU A;  4ENJ A;  1LVA A;  1LB2 A;  2L3D A;  1KU9 A;  4HW0 A;  3BY6 A;  1W7P A;  2O61 A;  1QGP A;  2RNJ A;  3MWM A;  2VOP A;  2DFI A;  2A07 F;  1ZHF A;  2OAZ A;  3IWF A;  4JQF A;  2EWN A;  3TO9 A;  4P55 A;  3R60 A;  1OYY A;  3FMS A;  3RIR A;  4MEX F;  3NQO A;  3M9A A;  2HQR A;  2HQN A;  5JFR A;  4UV9 A;  1FYL A;  2F5D A;  2YR2 A;  4L9N A;  1FNN A;  3EYY A;  5FGM A;  2FMY A;  4EJT A;  4EJU A;  4OIR F;  3ML6 A;  1U2W A;  3F6O A;  5K5Q A;  1K79 A;  5DYM A;  4YII A;  2VC1 A;  2NRA C;  2IT0 A;  4L9T A;  4G6D A;  1MDM B;  3WE2 A;  2QVO A;  1NHA A;  1P4A A;  3H92 A;  4M9X A;  2XHK A;  4MQV A;  3I5U A;  5HS8 A;  2RGV A;  1X3U A;  1JXS A;  2HTS A;  4ZYG A;  2OZU A;  2PN6 A;  3WGH A;  4L9V A;  1I27 A;  4RGX A;  2KJB A;  1Z7U A;  2HZT A;  3I58 A;  2PEX A;  2HS5 A;  2Y48 A;  2EV6 A;  1ULY A;  2HKO A;  3GZ6 A;  4N9I A;  2D2W A;  3HUG A;  4EQQ A;  3JW4 A;  1W7P D;  2W25 A;  3E6B A;  4O5V A;  4HOB A;  1K6O A;  3QOP A;  1XSD A;  1G3W A;  4WK8 F;  3V8K A;  1BC8 C;  3HOT A;  1ODD A;  5K5O A;  3C1D A;  3RYR A;  3CO6 C;  2BV6 A;  4Q4Z F;  3I53 A;  2Z5U A;  4EV0 A;  2G9W A;  2ELH A;  2K4J A;  3BDD A;  4ESJ A; 
#chains in the Genus database with same CATH topology
 4G12 A;  4BYY A;  2ZXI A;  3OYI A;  2PX9 A;  3OYF A;  2R5Y A;  3M1E A;  1YX3 A;  3EPZ A;  3RQ4 A;  5M5Y J;  3M7G A;  4JOM A;  4OMZ A;  1C0W A;  3WU2 C;  4XSZ F;  2MG4 A;  3A01 A;  1XB4 A;  1RKW A;  5DUK A;  3BCA A;  4ZZD A;  1MSF C;  1ETY A;  4IHY A;  2DAO A;  3GFL A;  1D1C A;  3ZP5 A;  3RPQ A;  2XV4 S;  4FHT A;  5LHI A;  2JZY A;  2MH9 A;  2W85 A;  5CVV A;  5L3D A;  2AQE A;  3NAU A;  2AXL A;  4NDL A;  5IY5 H;  5K7H A;  3BLY A;  4HV5 A;  4XMY A;  1P4W A;  2VPR A;  2DK5 A;  4N9H A;  3TP3 A;  3CDH A;  2Z1D A;  2VB6 A;  2VQH A;  1I1G A;  1BL0 A;  2LFB A;  3E97 A;  1G4D A;  3DP7 A;  1TT0 A;  4XOT A;  5FO5 A;  4B4C A;  1STZ A;  3KZI C;  1A5J A;  1ZG3 A;  3VFZ A;  3TDU C;  4XR6 A;  4RS8 A;  3KX2 A;  3OV8 A;  2XB0 X;  3CUO A;  3Q3S A;  3FM5 A;  1O4X A;  4BE2 A;  2H27 A;  2F2E A;  4CCN A;  1HKQ A;  3WOD F;  3WHB A;  2Q1Z B;  5ICC A;  3WGI A;  1FJL A;  1X4O A;  2IA1 A;  2HDD A;  3IAM 2;  4Q48 A;  3J7A O;  3OIO A;  1JT0 A;  4JX6 A;  2P8T A;  3SEZ A;  5FRO A;  4RMN A;  1R7J A;  3DXJ F;  3VOE A;  1S9H A;  3OSG A;  1B59 A;  2GOM A;  2ZME B;  4CYC A;  3R4K A;  3V8L A;  3WTV C;  1QPI A;  1YFH A;  4L9J A;  4BJT A;  2NVU B;  1H0M A;  4KNY A;  2EQR A;  1S6L A;  1OLT A;  2V79 A;  1SD4 A;  3K4C A;  2DOA A;  5J6X A;  5EG0 B;  1YW9 A;  4CYC B;  4R79 A;  4LB6 B;  1JKO C;  4F3Q A;  1B4A A;  1Z7L A;  2LF7 A;  4BS9 A;  2HDC A;  5E8I A;  3OOP A;  1X3W B;  3BG9 A;  2PLY A;  5IYB J;  3PJR A;  4UV8 A;  4I7H A;  5CQE A;  4KN7 X;  3ZOB A;  4BHB A;  3T8R A;  2E5Z A;  2BGC A;  5BPD A;  1BBY A;  2A3S A;  1Z9C A;  3S1R J;  5DEQ A;  3E7L A;  5EGO B;  1W1W E;  3FK7 A;  2DOD A;  1I50 J;  2JT1 A;  2HFH A;  2KZV A;  1TWC J;  3IUO A;  3NWT A;  5E1W A;  4FCY A;  4ENM A;  4A6E A;  4Q47 A;  4CA0 A;  5K7Z A;  1R23 A;  3V7R A;  4EM0 B;  1TBX A;  1X1A A;  2M2E A;  3JSP A;  4I99 C;  2KRH A;  1PYV A;  1U6G A;  1XC5 A;  2KKO A;  2LBF A;  1BOB A;  3G71 I;  2LD5 A;  2OCE A;  4NQW B;  3K2Z A;  4XSX F;  3FXM A;  3BPV A;  4MLO A;  2Y31 A;  1R9T J;  1QA6 A;  2D5V A;  3CJN A;  2AXT C;  5GAE J;  2DW4 A;  1WVR A;  3HJE A;  3KP2 A;  1WJD A;  2X4H A;  3WTY C;  2R5Z A;  1RPW A;  3GFJ A;  3A2K A;  1XPX A;  1N78 A;  1T38 A;  1O7F A;  3RPU D;  2JWT A;  3S1Q J;  1S7A A;  1IN5 A;  4KN4 X;  3TW6 A;  2VE8 A;  4S0H B;  3LA3 A;  1EV7 A;  5DV5 A;  2ECB A;  2M34 A;  5LEJ A;  3U9G A;  1IZ1 A;  3PQJ A;  4IVN A;  2R5Y B;  3S1M J;  1ZGJ A;  4LLN A;  1CQT A;  3G73 A;  2TCT A;  2DCE A;  4RAZ A;  3IHU A;  2W00 A;  4PCQ A;  2XKP A;  3FM3 A;  3RKQ A;  1VTN C;  2OTJ I;  2NNN A;  5BQT A;  1IW7 F;  4YIF A;  5HOD A;  4M3G A;  3BG3 A;  1IDZ A;  3B02 A;  5E79 C;  3LSR A;  3LOC A;  1J5Y A;  3J81 K;  4PZJ A;  4P5O A;  3BC8 A;  1E0E A;  3W2A A;  1S72 I;  4HLX A;  2MLK A;  1O57 A;  4BAY A;  1JUS A;  1KU2 A;  3ASO H;  3GF2 A;  2KMU A;  3JCU C;  2IA2 A;  2LG4 A;  3TOA A;  1YI2 I;  1X2N A;  2ZFW A;  1O3S A;  1WQ2 A;  3W2W A;  1FOK A;  1H9T A;  2DT5 A;  5ILV A;  1W5T A;  1IG7 A;  4KMU X;  1ZKG A;  2WB1 N;  1TC3 C;  1TWF J;  1UFM A;  4E7J A;  1FWZ A;  2LNB A;  1OJL A;  1ONV A;  1KQ0 A;  4LK0 F;  1D8J A;  5LGU A;  3C2H A;  3ZMU A;  1KU7 A;  3SHF A;  4YFK F;  2DU9 A;  2GAU A;  4BGD A;  3TOB A;  5B1A H;  2LY2 A;  4U88 A;  3S16 J;  1R00 A;  2XUB A;  2CFX A;  1KON A;  4OIP F;  2PG4 A;  1XTA A;  1B8I B;  2DXI A;  2E1C A;  1Z3X A;  3HZJ A;  4KT5 C;  3FXO A;  1VQ9 I;  1IXS B;  2VJ5 A;  5HDG A;  3CUQ A;  1BIB A;  2XF6 A;  5F64 A;  3RJP A;  1KU3 A;  1Z3Y A;  1Y39 A;  3A02 A;  2F48 A;  1WH5 A;  2M4G A;  2B7E A;  2KDO A;  3LSG A;  3BR2 A;  1K78 B;  2CQX A;  2R7Q A;  4IRG A;  1G6N A;  4C3H J;  5J47 A;  1MH4 A;  2ICW G;  1WJA A;  5EEA A;  2V6C A;  3CD6 I;  4E7Z A;  2ESH A;  2KP6 A;  1RUN A;  4KIS A;  1R5H A;  2CWE A;  1IAW A;  1Z21 A;  2DQL A;  4I76 A;  4IRI A;  5FKO A;  1WJF A;  4CCL A;  1X1C A;  4XRS G;  3VEP A;  1IRF A;  2JA7 J;  1QNT A;  1WWX A;  1U5T A;  4PGH A;  5E1X A;  4BEH B;  1EH7 A;  4CH7 A;  4L0Y B;  3DLL F;  3CJR B;  3HIF A;  3RYP A;  3HKZ N;  1MMD A;  4QPQ A;  4HQM A;  4V2G A;  3BQZ A;  3HOS A;  5FD6 A;  1DU6 A;  2R4G A;  1PUE E;  1ITY A;  3A03 A;  1NK3 P;  4CGZ A;  3OYM A;  4MNU A;  2EIN H;  2ZFU A;  2V1D A;  1FIA A;  3ZGK A;  5LGN A;  1K61 A;  5AIQ A;  2I8D A;  2WY7 Q;  2COB A;  5FKM A;  4B09 A;  1TQP A;  2EIM H;  3KLO A;  1PP7 U;  3BRO A;  4HDV A;  2ZNY A;  1Z05 A;  2UXX A;  3U1K A;  1LEA A;  1V5F A;  5L3G A;  3ZQI A;  2GXA A;  1DUX C;  3G4S I;  1L0O C;  1D8K A;  1W36 C;  3TP0 A;  3ZQF A;  3GFM A;  2WTE A;  2XB5 A;  4BQQ A;  1LFU P;  1BI3 A;  2M0C A;  4CYD A;  2BHZ A;  3EYI A;  1BN5 A;  4BHC A;  5L3B A;  1SFU A;  2HXO A;  2NVT J;  2E5N A;  3RTR A;  3DTE A;  4NC7 A;  4BE1 A;  2BHY A;  2VPL A;  3KET A;  4DYQ A;  1WI9 A;  1FMW A;  4FIS A;  1KZH A;  4BJ6 C;  4M3F A;  1QO0 D;  2ZC2 A;  5HS9 A;  1A31 A;  3RSN A;  3HOW J;  4XM3 A;  5DTD A;  4UVB A;  4HZF A;  3M4O J;  1FP1 D;  1UZC A;  1V54 H;  2P0W A;  3H9G A;  5LEK A;  5IT9 K;  4AYB A;  4EVI A;  1TW3 A;  3BJ6 A;  4N4N B;  5ICF A;  2M0M A;  2VBY A;  3IH3 A;  1JKP C;  2VON A;  1BI0 A;  2ZXW H;  4HSR A;  1HF0 A;  2ELK A;  1JKQ C;  3Q9V A;  1OCP A;  2W7N A;  1HSJ A;  1LQ1 A;  1JJ8 C;  2K27 A;  3VPR A;  2XAF A;  2OPT A;  2WWY A;  3DU6 A;  2MD0 A;  1ZK8 A;  4C3J J;  2CH0 A;  1OYW A;  3O2P E;  1S29 A;  3TGN A;  1HQC A;  4A2U A;  3N4M A;  1VQL I;  5ILU A;  2LR8 A;  2E19 A;  2JSC A;  3SFZ A;  3R61 A;  1BR4 A;  2OC6 A;  1MJA A;  1TWG J;  3SZT A;  3L2W A;  4XRF A;  1WFX A;  4AC0 A;  1G3Y A;  2LC2 A;  3PNY A;  2JUC A;  2HKX A;  3OR2 C;  1E2X A;  1T39 A;  3WU1 B;  4PJM A;  2EIJ H;  3LSJ A;  4KUM A;  2CV2 A;  2OQG A;  5ICG A;  1TP4 A;  2M8E A;  3DTI A;  3FXR A;  1PUF B;  4NHJ A;  3T0Y A;  4RAY A;  2K86 A;  1KYZ A;  2FSW A;  3IAS 2;  3HRU A;  3B73 A;  4LFU A;  3SZG A;  4DBR A;  1Y0U A;  2WAE A;  2AQF A;  2VKH A;  3CCL I;  1T08 B;  1F5T A;  1HST A;  4KFC A;  2Z33 A;  2J5O A;  2VI6 A;  2JJ7 A;  2Y69 H;  2X6W A;  3ELK A;  1TW2 A;  3GLL A;  3IWZ A;  3L9F A;  4P1W A;  4A3I J;  2L9V A;  4C2M J;  4A3K J;  3JRF A;  5EEG A;  2GIZ A;  2HOE A;  3HEF A;  3SDG A;  1NG7 A;  1JTY A;  1YW8 A;  2TRT A;  5CVJ A;  3K69 A;  2QCO A;  1TL8 A;  5EF6 A;  2QZ8 A;  1QVU A;  2DA2 A;  3LQR A;  5C3E J;  2ZME C;  3L2C A;  4I0B A;  2QSG X;  4ANJ A;  2B63 J;  2VJJ A;  2CYY A;  2QKM B;  5DM7 F;  4WXC A;  4OIO F;  1AOY A;  3I3L A;  1P6R A;  3D0S A;  3AG1 H;  3A0B C;  1MBE A;  3FHN A;  4RAG A;  5BS6 A;  5D5W B;  4IF4 A;  1W36 D;  2EFO A;  2HOS A;  3QOD A;  3E1S A;  4O3M A;  1UCR A;  5M5X J;  4A3J J;  5HNF A;  3CCV I;  1O3R A;  3KEY A;  1T98 A;  3AAF A;  1MNE A;  4ZYA A;  2ZJQ F;  2CV1 A;  2DMU A;  2L7M P;  3TQN A;  3MKY B;  3TED A;  1A36 A;  1SFX A;  2K5C A;  4N4O B;  3E6M A;  4CXF A;  5HNH A;  4EGZ A;  4L0Z B;  4A0X A;  5J4Y A;  4I09 A;  4GYI A;  1J75 A;  3CF2 A;  5E20 A;  5M5W J;  4MEY F;  4CIC A;  2QBY B;  4ZDO A;  1MD0 A;  3H0D A;  3S93 A;  3OYH A;  5KCM A;  3ZR8 X;  2EZH A;  3FWE A;  2N8G A;  5E3O A;  2BY2 A;  4I02 A;  1OCT C;  3RCO A;  2VBX A;  1JGG A;  4QLC U;  1QRY A;  3I9V 2;  4EJO A;  1ZGA A;  2ZCW A;  3PIO F;  1X1B A;  2R7R A;  4MIM A;  3GW2 A;  3KIO A;  4F7Z A;  4HA8 A;  2FBK A;  4HF0 A;  5CVI A;  3MQ0 A;  1QZY A;  2BOL A;  5CVR A;  5DD4 A;  3FIS A;  1EF4 A;  2HU9 A;  1R36 A;  2DFE A;  5J3L A;  4E4H A;  2R5Z B;  3RZO J;  1OCR H;  2KT0 A;  1V5E A;  1V5G A;  3TW7 A;  1FIP A;  2PJR A;  3N97 A;  3MMY B;  3H0G J;  2Q2E A;  5JHU A;  3CF5 F;  2NS7 A;  4U0V A;  2QSF X;  2LSO A;  2LRD A;  2BZT A;  2VBZ A;  1QPM A;  2H1L A;  1ZRD A;  4HNV A;  2FXA A;  4PFP A;  3MKZ A;  3FBN B;  3TO6 A;  2E60 A;  2X6X A;  4RBO A;  1UAA A;  3TMO A;  5D5V B;  4NC6 A;  1MND A;  2F5V A;  4PGG A;  1D0X A;  3BQY A;  3WU0 A;  2NNY A;  4HEA 2;  2CQK A;  2EV0 A;  2L02 A;  3BTI A;  1ZG1 A;  1ZR4 A;  3OYB A;  3ECO A;  1USS A;  1HKS A;  4B47 A;  2EBI A;  5HOO A;  4OIN F;  3N05 A;  1SD5 A;  3DKY A;  2ZJR F;  2CUZ A;  3ECH A;  4I0A A;  3BZC A;  3KLN A;  3LWF A;  4KIB A;  4C3I J;  4LG0 A;  5HDK A;  3F9K A;  1B6A A;  3FXQ A;  5K5R A;  2E36 A;  2HWV A;  3FK6 A;  1HLV A;  5J8F A;  2R7S A;  3PL8 A;  2XKO A;  5IOY A;  4WWC A;  3R0J A;  1FY7 A;  3QQA A;  4C30 A;  5E3L A;  4QWQ A;  4LIU A;  3HRS A;  3BP8 A;  2STT A;  4CHU A;  2Y0S N;  1YO5 C;  4OMY A;  2ZSH B;  5K7F A;  3C3W A;  2M3A A;  4TV7 A;  1VQ4 I;  2CU7 A;  4DJA A;  2EFN A;  5LRR A;  4PJL A;  3JRA A;  5FFZ A;  2KRC A;  1R58 A;  1T2K A;  4E70 A;  2ZJP F;  4BXU A;  4PDK A;  2KZG A;  1J09 A;  1DP7 P;  3OOU A;  3SXY A;  2IGO A;  2IVM A;  2EV5 A;  2J5P A;  4Y4R A;  5IT3 A;  3OL3 A;  2YSR A;  5KHD A;  4BAC A;  2FA5 A;  4AID A;  2F6C A;  2MC3 A;  3KZY A;  1OMI A;  3LFK A;  1MNM C;  3WHC A;  4HLY A;  2DDB A;  3BZK A;  5LRS A;  2M5W A;  4ZDP A;  1D5Y A;  1MIJ A;  2XPV A;  2O3F A;  5F27 A;  1GXQ A;  2KRF A;  2XPU A;  1PUF A;  3AG3 H;  3LSM A;  2FF4 A;  3AKZ A;  2R7D A;  2ZJ2 A;  3DPT A;  3G3Z A;  1XSV A;  2HVR A;  4LIV A;  3HOY J;  1B72 B;  1MKM A;  4FTH A;  1YJ9 I;  2ZO4 A;  2V4J C;  5H6Q A;  4XLP F;  1IC8 A;  4HAM A;  1QQI A;  4M3E A;  3BR0 A;  5HLT A;  4XRS A;  2ACJ A;  1T95 A;  2PBI A;  3GYH X;  2Z3Y A;  4LMY A;  2K4B A;  5A2Q K;  2WB1 A;  3HUG B;  1WJB A;  2LP0 A;  1EH8 A;  1ZG5 A;  2V1U A;  1XN7 A;  2EFP A;  4G94 A;  5GAD J;  2VXZ A;  1DPU A;  3WG7 H;  3BJO A;  2K7L A;  3S1N J;  3GVA A;  3VB2 A;  2Y9Y A;  3IKV A;  1IF1 A;  1U8B A;  1N77 A;  1YRN B;  2P7V B;  4IX7 A;  3IH4 A;  5GAG J;  3LST A;  1R1U A;  3AFH A;  3JRH A;  1ZEL A;  3A4C A;  3KFW X;  4M9Z A;  2X9D A;  2ETH A;  1HDP A;  1XMA A;  1R4N B;  3OWT A;  5IP9 J;  1VFC A;  3PFY A;  3QYF A;  1YS6 A;  3PNT A;  3UR3 C;  3OIQ A;  5DUI A;  1FX7 A;  4DOZ A;  5ED4 A;  1FOX A;  3HGG A;  4XRM A;  1ZQ3 P;  3ROU A;  4CZC A;  2JVH A;  2MA3 A;  4MO7 A;  2E34 A;  3OL4 A;  3WTX C;  3F21 A;  3DQV C;  1R1T A;  2Y0S A;  4FT8 A;  1VQK I;  4II2 A;  2DO7 A;  2F5F A;  3IL2 A;  1PJR A;  4M6Y A;  3Q5F A;  4UB8 C;  4ZTJ A;  4R8H A;  3Q9S A;  3ZQ7 A;  3PUF A;  3KPH A;  2IW5 A;  4KIC A;  4Q5S F;  4BL0 B;  1T8I A;  3DBR B;  5J8C A;  2H1K A;  4B48 A;  2IS1 A;  5E17 F;  2UXN A;  2CFO A;  3OYA A;  2M30 A;  2FUG 2;  2P7C B;  4IPA A;  1R5G A;  4A3D J;  4QPO A;  4YIR X;  2XAU A;  4IJA A;  5CKT A;  9ANT A;  1G8X A;  5H6R A;  3D5S C;  1E3O C;  2EZI A;  2X85 A;  2E7X A;  3EUH A;  4F52 A;  3CUQ B;  1JHF A;  1XX5 A;  2HYJ A;  4OAZ A;  1MJB A;  3J80 Z;  5DCF A;  3K7A J;  1O3Q A;  2PJR B;  2ISY A;  1OFC X;  3L00 A;  4CZZ A;  1SD7 A;  3K9T A;  3MCZ A;  3DTK A;  1VQ7 I;  1E3P A;  1R4M B;  4IHW A;  4PK4 A;  4FAS D;  3U1D A;  3HC7 A;  4BJ5 C;  3QP6 A;  3K1M A;  2YPR A;  1A35 A;  4RM3 A;  3H36 A;  5KVR A;  1XMK A;  4KJZ A;  2WAD A;  3QU3 A;  2BW3 A;  2DA3 A;  2H6C A;  3M3Y J;  2R7F A;  2EPF A;  1AKH B;  2UZK A;  2GWR A;  4E7I A;  3Q0U A;  1IXC A;  3CCM I;  2IGK A;  2W84 A;  1LPQ A;  2O5R A;  5D5U B;  4A12 A;  3DBH B;  5F6F A;  3JTH A;  3VYU B;  1F36 A;  3PO2 J;  4Y13 A;  3NEU A;  4GFB A;  3CCR I;  2DA1 A;  3G1L A;  2W4S A;  1F9N A;  2V9K A;  3FKJ A;  4RLQ A;  3EDP A;  2QKL B;  2FOK A;  3P9K A;  3L2Q A;  1D3Y A;  1QZE A;  1OR7 A;  3PSI A;  3AG4 H;  2DOF A;  3ONQ A;  4YG2 F;  3MVP A;  3GME A;  5BPI A;  2HPM A;  1U78 A;  3W6J B;  1U5T C;  4EGY A;  4M73 A;  3I4N J;  2FJ1 A;  2HGC A;  3O6B B;  4MQ9 F;  1SVL A;  2BE5 F;  3OYD A;  5B66 C;  5EDN A;  3GFI A;  4H0E A;  2P5V A;  1FBU A;  1KYW A;  3RI4 A;  2LYC A;  1QBJ A;  2R7Z J;  3I59 A;  1AU7 A;  2BBY A;  2L7K A;  1SD6 A;  3VSK A;  1I6X A;  3IH2 A;  3HGY A;  5CJ9 A;  4CCJ A;  3CQZ J;  4F55 A;  4IZZ A;  5LFA A;  2KIM A;  2FX0 A;  3BR5 A;  1DGW Y;  5KAI C;  4IHS A;  1R22 A;  3L2U A;  1T56 A;  2CO5 A;  4X1E A;  3WTT C;  4XKV A;  4RGU A;  1FC3 A;  1I6H J;  2M8G X;  4UUV A;  4D1Q A;  4GCV A;  2HQA A;  2NS0 A;  2Y75 A;  2HQ5 A;  1UHS A;  3LSH A;  5FD5 A;  4D0P A;  5KK1 A;  3J81 Z;  2XAH A;  2FNA A;  2AS5 F;  4RM2 A;  4C2T A;  4OAY A;  5FJ8 J;  5IYC J;  1IRZ A;  4KIG A;  4NQW A;  3E5X A;  1REP C;  5JLW A;  2STW A;  3F8B A;  3H3V K;  2E2J J;  2PMH A;  4B44 A;  4DW6 A;  2HR3 A;  1WI3 A;  3BR1 A;  4A3F J;  3AL0 C;  3QP5 A;  3HRM A;  3K4L A;  1T33 A;  2WAQ N;  2QLZ A;  5EZG A;  2DPU A;  3BTL A;  3ABU A;  5E1Z B;  2P6T A;  5CYV A;  3CJQ B;  2LTP A;  2M7A A;  2QEN A;  2RQP A;  1F4K A;  1RR8 C;  4A3M J;  5D4R A;  1G59 A;  1Y56 A;  3UNG C;  4Y33 A;  3FXU A;  4XN0 A;  4MTE A;  1MZB A;  1KA8 A;  3C7J A;  4EM2 A;  5GP9 A;  2YS9 A;  3VOD A;  3CC7 I;  4A5M A;  3K4M A;  3HHH A;  3JRB A;  3JSO A;  2DA7 A;  3K4K A;  1EH6 A;  3GX4 X;  3HPH A;  2A61 A;  2VJ4 A;  5JR3 A;  3HSE A;  1ZYR F;  4D5C A;  3DLA A;  3RDI A;  3M07 A;  1X58 A;  4UUS A;  2DLL A;  4O6J A;  1MMG A;  3LSI A;  5TJJ A;  1ZRE A;  3D5R C;  2GLO A;  4S04 A;  4V2F A;  4HF1 A;  3CLO A;  4FX0 A;  1XDU A;  4A5N A;  3HSR A;  5EJC A;  3FKI J;  1JHH A;  2K3F A;  5E18 F;  3JRD A;  1APL C;  3V8J A;  1ZLK A;  1YLF A;  2K9S A;  2ZBK A;  4D5F A;  2JA2 A;  3ZQH A;  4CCO A;  4R1H A;  1RUO A;  2Y0M A;  1WZ2 A;  3JTG A;  2E2I J;  1QHH D;  1BW5 A;  3FXL A;  4ZJZ A;  3FMQ A;  5FKN A;  1Y8Q B;  4IRH A;  1YIJ I;  4II3 A;  2L4M A;  4FE7 A;  5A2Q Z;  5B5E C;  3OYC A;  1DPR A;  2VBW A;  3CCY A;  3OIP A;  2WV1 A;  3BTC A;  3KE2 A;  4AVZ A;  5FB2 A;  5FRN A;  2CQN A;  2D1H A;  2NAZ A;  3QPS A;  2X48 A;  4RA2 A;  1HW1 A;  1WGX A;  1YG2 A;  3FX3 A;  2EA2 A;  3ZMD A;  4LG0 B;  4M6X A;  3RKY A;  1GXP A;  3S3M A;  3WG9 A;  3K70 C;  4BXF A;  3I71 A;  1ZR2 A;  4XLN F;  1IO2 A;  3GTL J;  3QYB A;  2KFD A;  3OR1 C;  4B43 A;  3E6C C;  5LHH A;  3GBG A;  4HRI A;  2IP2 A;  1ETX A;  2KJC A;  1HW2 A;  4CO8 A;  3DWL E;  4A3B J;  5LHG A;  2KHM A;  4JK1 X;  4AWX B;  4JP0 A;  2O0Y A;  2WA0 A;  1MDM A;  2VIX A;  1U0J A;  3HRT A;  3I54 A;  2PMZ A;  4BQO A;  3JRE A;  1YW7 A;  2Z9O A;  2K3P A;  2LKS A;  5CLS A;  1OR7 C;  1VQM I;  1VQ5 I;  2L9S A;  5D8L B;  2DBB A;  2VOO A;  1I1S A;  2KIS A;  2R7X A;  2CMP A;  2HOT A;  4L5E A;  1UG0 A;  4CDG A;  3A0H C;  1UHW A;  1B9M A;  4D9J A;  5TRD A;  4F93 B;  1JGS A;  3R0A A;  3CME I;  2X6Y A;  4S05 A;  3L2V A;  3CO7 C;  1NG6 A;  3HB9 A;  3SJM A;  2GOX B;  5LGT A;  1SEU A;  5E3N A;  3VSL A;  4XOR A;  3F3X A;  3IRR A;  1ZLJ A;  3G6E I;  2RNG A;  3CDL A;  1FZP B;  1LUJ B;  2R7O A;  2MBF A;  5IT9 Z;  3S2W A;  2JRM A;  1DDN A;  4UHT A;  2E1M B;  2BY3 A;  3LQQ A;  3HTU A;  2IGN A;  4HG2 A;  3CCS I;  1F1Z A;  1O7L A;  5ILS A;  4CSW A;  4DIQ A;  3OS0 A;  2QBY A;  2E7W A;  2UWM A;  1U5T B;  3F8C A;  3JAM Z;  3X2Q H;  1RI7 A;  3CC2 I;  3JR9 A;  4FQG A;  3O3K A;  1YTY A;  1MBJ A;  3GZ5 A;  2M1B A;  3DV8 A;  1MSE C;  1IUY A;  2LY1 A;  5BOX A;  1UJ8 A;  4WXD A;  2LDU A;  3PSF A;  1NTC A;  3K4N A;  2P6S A;  2C6Y A;  3TO7 A;  1TT5 B;  2K9N A;  2NXN B;  2OJE D;  4L5I A;  3HOZ J;  2X0L A;  3F6V A;  5J1U A;  1W0U A;  3G1O A;  4UY8 I;  1TNT A;  4KDP A;  4MGR A;  3PFI A;  4J01 A;  4I2O A;  4JBA A;  1CF7 A;  4OU0 A;  2A68 F;  2X1D A;  2CUJ A;  3LL7 A;  2GXG A;  1QZZ A;  3H3Z A;  1LFB A;  1S3J A;  4UB6 C;  3AG2 H;  2R7U A;  3GTJ J;  3KEQ A;  1W7P B;  2RRE A;  2YX4 A;  1VI0 A;  4A0Y A;  2H8W A;  3LAP A;  4BY7 J;  2EJR A;  3KZZ A;  4BKX A;  3V7S A;  4XN3 A;  1VQN I;  3K1N A;  2G7H A;  4DZJ A;  3PIP F;  3DEU A;  4ENN A;  2M4K A;  1OCZ H;  4XLF A;  2QQ8 A;  5EYR A;  1FYK A;  1XSX A;  5BNG A;  2ISZ A;  2JSP A;  3DFG A;  1SFE A;  2IA0 A;  1J59 A;  1WPK A;  1Z91 A;  4JYK A;  1ZGW A;  3S2D J;  3WGG A;  2I10 A;  3REO A;  2G7U A;  2NYX A;  3HSF A;  4PSX A;  2VUM J;  3BR3 A;  3MD2 A;  5KAF C;  2JMW A;  1A04 A;  3HBL A;  3L09 A;  2VC0 A;  4XLH A;  1MMA A;  1GDT A;  2OZ6 A;  2ZB9 A;  2D45 A;  1V55 H;  3LAJ A;  1FOY A;  1ORK A;  2F4M B;  4F92 B;  3HL2 A;  2JQ7 A;  3RPU A;  1R6R A;  2XF7 A;  4DNC A;  5E3M A;  1G2H A;  4IHX A;  1FBQ A;  2EZL A;  5HVQ C;  3GEZ A;  2Z16 A;  4E7K A;  1PP8 F;  2GM4 A;  2NVX J;  1BOA A;  3CLQ A;  4MTD A;  3V42 A;  2IBD A;  4UVC A;  3CCU I;  2GQQ A;  1UMQ A;  1ZRC A;  3DKW A;  5EEH A;  5AON A;  5M3M J;  1PDN C;  4G6T B;  1EA3 A;  4E7S A;  1O3T A;  2PMZ N;  1Z6T A;  4ETS A;  2DA4 A;  2EB7 A;  4LD5 A;  1V3F A;  5CQG A;  5JVT A;  1Y6I A;  2DN0 A;  2M87 A;  3KP6 A;  2OF7 A;  3K2A A;  2VOD A;  4ZYD A;  3I64 A;  4GO1 A;  3W2V A;  3OS1 A;  1YYV A;  2DMT A;  3WTZ A;  1K78 A;  3QYE A;  2VXD A;  2X6O A;  4ON0 A;  3LA2 A;  1AWC A;  4LB5 A;  4IXA A;  2DT6 A;  2IS6 A;  3JAM K;  2QWW A;  3KCC A;  1BI2 A;  2PFB A;  4XLA A;  2L7F P;  3COA C;  4MHG A;  2XF5 A;  4IO9 F;  4XL9 A;  3V7C A;  3H5N A;  5L3C A;  1BI1 A;  1BR2 A;  4UUT A;  3I4P A;  1X1D A;  5EGO A;  4HX8 A;  3M1C A;  1BJZ A;  2A5W A;  1SVM A;  1ZAO A;  3JRG A;  2JK3 A;  2LVS A;  2JTV A;  1Y0N A;  2E1N A;  4GXO A;  4X6A J;  3CZ6 A;  2FNP A;  1LNW A;  2ID3 A;  2A6T A;  3MAJ A;  1K4S A;  5JHF A;  4M9S A;  4GYG A;  2QM3 A;  1TTY A;  2VLA A;  1H9G A;  1SAX A;  2E2H J;  1IN7 A;  3GWZ A;  4WF2 A;  3F23 A;  2VN2 A;  2EK5 A;  2FE3 A;  1K7A A;  4Z6Y A;  3SFI A;  3TDZ C;  2BVM A;  2VKV A;  1HW5 A;  5H20 A;  2DMP A;  2DT7 B;  2IJL A;  4G8X A;  4XBF A;  4A6D A;  4ASN A;  4AIJ A;  2O7O A;  2P5L C;  2ZNZ A;  1IGN A;  1ON2 A;  2HEO A;  4PSW A;  1JE8 A;  3J7A Y;  5FLX K;  3K0L A;  2IS4 A;  4EJV A;  4HQE A;  1ZN2 A;  4QSH A;  1VQ8 I;  3F0C A;  2DOE A;  3OMY A;  4A0Z A;  1IUF A;  4UVA A;  2Z2S B;  4PJ0 C;  4YRV A;  2GZW A;  5JI6 A;  1Y1W J;  3T1B A;  2XGC A;  4RB0 A;  5HS7 A;  2V26 A;  1I5Z A;  2QQB A;  2XRN A;  3ZMV A;  3EUK L;  2E1M C;  2DYS H;  3H5R A;  3K4J A;  4NUB A;  3J7Y J;  4G7H F;  1T0F A;  1XCB A;  4D7M A;  2OBP A;  3WE3 A;  4Z2Y A;  4W97 A;  4KIT B;  3ZMS A;  1IN8 A;  1QU3 A;  2JPB A;  3BZ6 A;  2XAG A;  2W48 A;  2COM A;  2KL4 A;  2VAS A;  4B3X A;  3J80 K;  1LDJ A;  4BEH A;  4RB1 A;  3HKZ A;  5L3F A;  2HI3 A;  4BBR J;  2DI3 A;  1SVO A;  2JN6 A;  4A3E J;  1YX5 A;  2BYV E;  3ZQC A;  3S3N A;  3G1M A;  3CDI A;  4YFX F;  1G3T A;  3OS2 A;  3ULQ B;  3VWB A;  1V4R A;  4IKF A;  3G2B A;  1QVT A;  4G7O F;  2LLK A;  3HDD A;  4HPQ A;  2K02 A;  3FBI B;  1IN6 A;  4BQA A;  3BR6 A;  4XQF A;  2H09 A;  4EEF G;  1ZAR A;  2W82 A;  4I6Z A;  2RAE A;  1UG2 A;  1IDY A;  3MZ8 A;  3L2R A;  5GTH C;  4XON A;  1L3L A;  2ZME A;  5J1R A;  5K1Y A;  1A6I A;  2F4O B;  3F22 A;  2RC4 A;  4HYE A;  2WAQ A;  2DK8 A;  2NOJ B;  4B8X A;  1TWA J;  3B6A A;  4ESB A;  4HBL A;  4JX5 A;  1VQ6 I;  1E3H A;  2NOG A;  4LOC A;  4P9U A;  1XMX A;  1H88 C;  1R1V A;  3ZCO A;  3M8J A;  1GUU A;  3ERM A;  3ZPL A;  2W57 A;  5JVG F;  4AD9 A;  4FE4 A;  1MBH A;  1OCC H;  4XID A;  2MAB A;  1YIT I;  4AVP A;  1U9O A;  2Y30 A;  4C2U A;  4WXH A;  3WTW C;  2CG4 A;  3GZN B;  1BC7 C;  2B0L A;  3P9C A;  4XIC A;  3EQL F;  4M74 A;  2M7B A;  1YS7 A;  4PUS A;  3NWS A;  3BWG A;  2FD5 A;  2VJI A;  2H94 A;  2VKE A;  5D6E A;  1YIO A;  2EZK A;  3BG6 A;  2LKX A;  2JRT A;  3L1P A;  1FSH A;  1PVE A;  4EJW A;  2L54 A;  2GXB A;  3GXO A;  1H8A C;  2IRF G;  1QHG A;  2R3S A;  3ABL H;  4OIQ F;  3P9I A;  1XGS A;  4M72 A;  2DA5 A;  2DDA A;  3CMY A;  2GA2 A;  2CUF A;  2HYG D;  2XSJ C;  1E17 A;  1IN4 A;  3H1C A;  4UUS B;  2DFF A;  1BIA A;  4EMS A;  2HVS A;  1U3E M;  3CCQ I;  4AIK A;  2XGX A;  4JX4 A;  1FTZ A;  2OD5 A;  3NRV A;  5DCM A;  2ZXH A;  5IOZ A;  3QU6 A;  2O8K A;  3ISP A;  3O8H A;  2NVY J;  5F1J A;  3S3O A;  2XSD C;  1LDK B;  1FBS A;  4QIW N;  2XDV A;  2X1C A;  1T6S A;  3SDB A;  4LK1 F;  5C44 J;  1DGR M;  2OV7 A;  2V7F A;  2QQA A;  1HA8 A;  3RKX A;  2CRG A;  5F0C A;  1G3S A;  4Y7N J;  1BM9 A;  2LOO A;  2LBF B;  2Y2Z A;  3E5Q A;  1NK2 P;  1W5S A;  1DP3 A;  2EFQ A;  2L7Z A;  2A69 F;  2FQ4 A;  1SFK A;  2DMN A;  3E0J B;  2GA1 A;  2EFW A;  2BXY A;  1Z1D A;  2ESN A;  3SYT A;  1SAU A;  4HDU A;  1YHQ I;  2BXZ A;  1Z67 A;  2BEO A;  1H89 C;  2QGU A;  3ZQL A;  3ZMT A;  1JI8 A;  3ZN0 A;  1FYM A;  4LLL A;  2FQ3 A;  4FX4 A;  1XG1 A;  1KQ8 A;  2KPM A;  3CUQ C;  1I3Q J;  4WCG A;  1NH3 A;  3KP7 A;  2O9L A;  2GBY A;  1BA5 A;  1RZ4 A;  4OWR B;  1WJC A;  2CV0 A;  1AKH A;  5H2F C;  3AL0 B;  1ETQ A;  5D4S A;  5E8G A;  2O6G E;  4GRI A;  3OY9 A;  5ICE A;  2FBI A;  4J19 A;  2K9M A;  1LJ9 A;  4ABZ A;  2UUZ A;  1B9N A;  2WC2 A;  4B1R A;  2CQ7 A;  1R71 A;  3PM1 A;  3GTQ J;  4N0B A;  2VT2 A;  3TKY A;  3FDY A;  4G9Y A;  5J4V A;  1UHM A;  1X19 A;  3EUA A;  2FEZ A;  2F4I A;  1U9N A;  1TWH J;  4WX9 A;  2PI0 A;  2ZKZ A;  1J7K A;  5C4J J;  4KA4 A;  4L5J A;  3F8F A;  2M45 A;  1YRN A;  3CJT B;  3MKL A;  1IXR C;  4P96 A;  2LKP A;  4KT6 A;  4DBQ A;  1ZRF A;  4GDF A;  4PFO A;  4BE0 A;  1IRG A;  2MH2 A;  2V1N A;  3V4G A;  4BDZ A;  2CUE A;  1M1E B;  3QAH A;  2MD5 A;  1TZL A;  2Q8K A;  3VYT B;  1RET A;  1MW7 A;  2ELJ A;  2HZD A;  4ZH4 F;  3CMA I;  1P92 A;  1OIS A;  2DA6 A;  2MFZ A;  2LH9 A;  2F5C A;  5B1B H;  2RV8 A;  2MYS A;  3CTA A;  4E7L A;  1SFO J;  1FLI A;  2R93 J;  4UNO A;  2R7T A;  3OYL A;  1YQA A;  2PQ8 A;  3W3C A;  4IEJ A;  5FRM A;  1K6Y A;  3IRQ A;  3CP2 A;  1OKR A;  2BW3 B;  4RB2 C;  4IQ4 A;  2L5Q A;  2VQG A;  2KDZ A;  3FZV A;  4ESF A;  1GHC A;  1AA7 A;  4RB3 C;  1W4M A;  4KIF A;  1K4T A;  2A5Y B;  1BW6 A;  2YX7 A;  2IPQ X;  1J2X A;  5M3F J;  1FPQ A;  5F1R A;  2JVG A;  1S5L C;  1ACI A;  5GTI C;  4LJZ F;  3I56 I;  4NNJ A;  2P4W A;  1WSU A;  3FMR A;  1RES A;  1WCM J;  2KIU A;  5IP7 J;  1LE8 A;  1N25 A;  1OPC A;  4DQ2 A;  1A6Q A;  2HNH A;  3KP4 A;  2MGQ A;  2VE9 A;  1JUM A;  3GLX A;  4BUP A;  4ITV A;  3MZY A;  4U0Y A;  4KMF A;  3OYG A;  1FT9 A;  4HST A;  1T0F C;  3CC4 I;  4AM3 A;  3I4M J;  3C2G A;  2O8X A;  2BY0 A;  1RR7 A;  4BHP A;  2IS2 A;  3MEX A;  5DCM B;  2DFH A;  3F72 A;  2XAQ A;  3FHZ A;  5GPC A;  3BG7 A;  5FFX A;  4ZTF A;  1LEB A;  3BJA A;  4GGG A;  1I39 A;  1W0T A;  3FIW A;  4BU2 A;  2W1O A;  4AUX A;  2CW7 A;  4ZYH A;  4IOA F;  3QWL A;  3RZD J;  2IGM A;  5JLX A;  3KYL A;  4HX7 A;  4U7B A;  3S17 J;  2DQR A;  1MBK A;  1HXD A;  2FBH A;  2RDP A;  5J40 A;  4M71 A;  1Z0X A;  1MGT A;  2FRH A;  5HLH A;  1SMT A;  1X2M A;  1SAN A;  1XGM A;  2XIG A;  3VDX A;  1BJA A;  3U21 A;  2DMQ A;  1AHD P;  2VQL A;  2CSO A;  5KNL A;  5B3S H;  1OCO H;  1Z6R A;  2KQR A;  3KYC B;  2BVL A;  3HHG A;  3IC7 A;  4ZYE A;  3Q0W A;  2OA4 A;  2P5K A;  3QPT A;  4I98 B;  1VQP I;  5D5X B;  4UXN A;  3ZXS A;  5EZH A;  1W5C C;  2DTZ A;  2K40 A;  3R6S A;  1D1A A;  1I3A A;  2VL8 A;  2L9R A;  3DF8 A;  3QPH A;  3E3V A;  1IJW C;  2RN7 A;  3HXL A;  3UKG A;  1YJW I;  1Z77 A;  1B8I A;  4M3B A;  1J9I A;  1Q1H A;  3I0T A;  3H5A A;  2Q0O A;  4DYR A;  4DYC A;  3JRI A;  4BQN A;  4E7H A;  3E5U A;  3FXJ A;  4DGW B;  2RQQ A;  1R5I D;  2CGP A;  1WJE A;  3BG5 A;  1N75 A;  2Q2E B;  2I5U A;  1LVK A;  1P7J A;  3ESW B;  3P5J A;  3OYK A;  4Y3O A;  4FET A;  2DJI A;  3ZQG A;  4ENK A;  3ABM H;  3GCM A;  4HF2 A;  2NVQ J;  3GTP J;  1XDS A;  4M6V A;  2UV1 A;  2LMD A;  4NBQ A;  1IV8 A;  1VZ0 A;  3MFK A;  2QF7 A;  3K70 D;  2OQR A;  2ADU A;  4XKB A;  1ZH5 A;  1WJ5 A;  3S8P A;  2V9P A;  5HLI A;  4P9F A;  1UB9 A;  3Q0V A;  3ZN1 A;  3DEW A;  4NB5 A;  4IHT A;  2R0Q C;  1HCR A;  1SC7 A;  2XAS A;  2XRO A;  4LLG F;  2QSH X;  2ME6 A;  3ABT A;  1GV5 A;  5DDG A;  2XGE A;  1P2F A;  1S8N A;  3MN2 A;  5IP6 A;  4HX4 A;  5D6F A;  2L4A A;  1K83 J;  3LSK A;  2ECC A;  3LNQ A;  4G6Q A;  3F8N A;  2JUG A;  4EAT A;  1R49 A;  2LY9 A;  4YEJ A;  4Y17 A;  2EIL H;  1UST A;  2JPC A;  1FEX A;  3B6C A;  4A93 J;  4IHV A;  4BXX J;  4I01 A;  5HLG A;  2E1O A;  3PO3 J;  1ENH A;  3PQK A;  2KIF A;  2XVC A;  1SMY F;  1TQI A;  1RNL A;  3DPU A;  2L9N A;  2MLG A;  3K6G A;  2HDW A;  3HTS B;  1HC8 A;  4U0W A;  3SEQ A;  1XD7 A;  2QUF A;  5ERI A;  3EET A;  4PJJ A;  1WKM A;  3MZH A;  3LA7 A;  2B9S A;  2V9V A;  5BMZ A;  4F91 B;  1B72 A;  3S14 J;  2K9Q A;  3HYI A;  3BPX A;  5AIP A;  4BDY A;  5LBQ A;  1GVD A;  2ZSI B;  5F04 A;  1FSE A;  2E71 A;  2IXS A;  5GAH J;  4AIH A;  5LLQ A;  1Y8R B;  2HYF A;  3BOQ A;  3K4B A;  1P4X A;  3DPL C;  2JA6 J;  3ASN H;  4Y52 J;  3VYR B;  2L01 A;  4XK4 A;  1FP2 A;  2W24 A;  3KEO A;  4L18 B;  3QPL A;  1XGN A;  3H3U A;  1VF9 A;  4BH9 A;  5HDN A;  3OYN A;  2Y9Z A;  1VQO I;  4BBS J;  4RGR A;  1JT6 A;  3WTU C;  4EM1 A;  3CCJ I;  1S7O A;  3ABK H;  1LE8 B;  3GO5 A;  1EKE A;  3U2R A;  2A6E F;  2R7W A;  2P81 A;  3KP3 A;  5LD2 C;  2CW0 F;  2EIK H;  1ETV A;  4A3G J;  2XAJ A;  1XCV A;  2CS3 A;  1X1P A;  4ZC3 A;  3T5X A;  1YE9 A;  1MJ9 A;  3WTS C;  3T8T A;  3QRF F;  5GPA A;  5FLV A;  4ZZL A;  2FU4 A;  3K1P A;  3DCF A;  3LSP A;  2Z99 A;  3RKW A;  1ETO A;  2YU3 A;  2EH3 A;  2E35 A;  3HM5 A;  4U87 A;  2V1X A;  3LFU A;  3BCB A;  1FOW A;  3GTM J;  1HBX G;  4ZDL A;  4B3A A;  2LF8 A;  3FF5 A;  2QQ9 A;  2CQQ A;  3ERE D;  2LK2 A;  3PNV A;  1ON1 A;  3KP5 A;  1XGO A;  5FKK A;  3OYE A;  3GUD A;  1GT0 C;  2VKD A;  3HPG A;  4XLE A;  5F08 A;  2DTR A;  3I59 B;  5J1Y A;  4X0G A;  1Q1V A;  3W6V A;  4AYB N;  3SZP A;  1TNS A;  4LGW A;  2OCC H;  3FXK A;  4H4K C;  2F5E A;  4J00 A;  1JTX A;  2L0K A;  3ZMZ A;  5EG0 A;  1RIO H;  2AO9 A;  2ME0 A;  1ERD A;  2XGD A;  3HOV J;  3H35 A;  4YFN F;  2QYO A;  2BY1 A;  5CPR B;  3SQN A;  1WHU A;  2RVC A;  6PAX A;  2YUS A;  4YEL A;  3F8M A;  4U7D A;  1LDD A;  2G0E A;  5TGT A;  1KQ9 A;  1B1B A;  3O8G A;  4RGS A;  2PJP A;  1TLH B;  2JA5 J;  3PUB A;  4XOP A;  2DPD A;  2WV0 A;  4BNC A;  1X4P A;  4KYW A;  1MMN A;  1HDD C;  4HNT A;  1HKT A;  3D5L A;  3IKT A;  4C9Y A;  2CW8 A;  1S7E A;  1U8R A;  2YU9 J;  1RC9 A;  2O03 A;  5D8K B;  3L7W A;  2WAF A;  1JJ6 C;  1CGP A;  4Y15 A;  2H6B A;  1WRJ A;  2R92 J;  4CCM A;  2A05 A;  2HXI A;  2HTJ A;  1UEL B;  2GIV A;  4G7Z F;  4A69 C;  3IV5 A;  1DU0 A;  1OYI A;  2X1E A;  1J0R A;  4PJN A;  5L3E A;  1D0Z A;  3NAR A;  2OUM A;  3E6D A;  3M8E A;  4K2E A;  2EA4 A;  2FML A;  1GVJ A;  3W6K B;  2D1V A;  2PMU A;  4OOI A;  2HOA A;  1FTT A;  3M8F A;  1GV2 A;  2WY8 Q;  3A1Y A;  3DKX A;  4HV6 A;  5FLX Z;  2ZXJ A;  1F43 A;  4M3D A;  1CF7 B;  2TDX A;  3C18 A;  3P7N A;  2A6H F;  1D5V A;  1KGS A;  1GLN A;  1TQM A;  2OU2 A;  5F0H A;  3A01 B;  3MKW B;  3HOU J;  2VT3 A;  5DD8 A;  2RKH A;  5CVU A;  4ENJ A;  2DJN A;  1LVA A;  2DYR H;  1LB2 A;  3QOE A;  2V6E A;  2L3D A;  1KU9 A;  1MBF A;  4MFD A;  4HW0 A;  1YOV B;  3BY6 A;  1W7P A;  2AHQ A;  2LRE A;  5IPA A;  2K85 A;  2O61 A;  4A3C J;  2MC4 A;  1QGP A;  2K9L A;  2RNJ A;  3MWM A;  4XKC A;  4NC8 A;  2VOP A;  4IL6 C;  2DFI A;  2A07 F;  1ZHF A;  3CCE I;  5DM6 F;  2OAZ A;  4XKW A;  1JKR C;  3S15 J;  3I55 I;  3IWF A;  3S2H J;  4JQF A;  4RLF A;  4DZP A;  1POG A;  2EWN A;  4LIT A;  1IV6 A;  1BR1 A;  5TIS C;  3TO9 A;  4P55 A;  3CP8 A;  3R60 A;  3IP4 B;  3TL4 X;  4RDU A;  1OYY A;  3FMS A;  2NS8 A;  2QA4 I;  3DBL B;  1WH7 A;  3RIR A;  4MEX F;  1P9Q C;  3NQO A;  3M9A A;  1D0Y A;  3DU5 A;  3ZQQ A;  3GTG J;  4CUG A;  2HQR A;  2HQN A;  2HPI A;  5JFR A;  4UV9 A;  2FOW A;  3K10 A;  2OTL I;  1MBG A;  1FYL A;  4XNF A;  5DS9 A;  3H9Q A;  2F5D A;  3HOX J;  2YR2 A;  3ZRG A;  2H8R A;  3DEE A;  4L9N A;  1FNN A;  4W1U A;  3EYY A;  5FGM A;  1XS9 A;  2FMY A;  1YJN I;  2QEX I;  2CJJ A;  4EJT A;  3S32 A;  4EJU A;  4OIR F;  4HNU A;  3ML6 A;  1U2W A;  2XRL A;  3TBI A;  3F6O A;  5K5Q A;  1K79 A;  5DYM A;  1RKT A;  3OYJ A;  1FMV A;  4RAF A;  4YII A;  1VND A;  2VC1 A;  3RQI A;  2IT0 A;  2NRA C;  4L9T A;  3BTJ A;  4G6D A;  2XPW A;  1MDM B;  3WE2 A;  1EJ9 A;  2QVO A;  1NHA A;  1P4A A;  1OQY A;  4IOC F;  3H92 A;  4M9X A;  2XHK A;  4V19 K;  3EUH C;  3D1N I;  2X51 A;  4MQV A;  3JRC A;  3CMM A;  2HVQ A;  3I5U A;  4BY1 J;  1JUP A;  1P7I A;  1LKX A;  1RRJ A;  5HS8 A;  2RGV A;  3GTK J;  3GTO J;  1X3U A;  4D7N A;  1JXS A;  3VYS B;  2KIQ A;  2HTS A;  4ZYG A;  2OZU A;  2WBM A;  4A3L J;  1ETK A;  2PN6 A;  3WGH A;  1LFP A;  2ID6 A;  4L9V A;  1I27 A;  2KLO A;  4RGX A;  2KJB A;  2XC7 A;  1Z7U A;  2HZT A;  3I58 A;  1IRX A;  4MFE A;  3HG9 A;  5FLM J;  4QTR A;  1ZTR A;  5FKL A;  3OSF A;  2PEX A;  2HS5 A;  2Y48 A;  2EV6 A;  1ULY A;  2HKO A;  3GZ6 A;  2R7V A;  4N9I A;  2JA8 J;  3J7Z I;  2D2W A;  1D1B A;  1X3Z B;  3HUG A;  4EQQ A;  3JW4 A;  1W7P D;  2W25 A;  3E6B A;  4O5V A;  4XLC A;  1MH3 A;  4HOB A;  1K6O A;  3QOP A;  5F0F A;  1MMS A;  1XSD A;  1G3W A;  4WK8 F;  3V8K A;  2VQC A;  1BC8 C;  3HOT A;  2MSY A;  1ODD A;  2IEK A;  5K5O A;  3C1D A;  2L2O A;  3BT9 A;  3RYR A;  3CO6 C;  2BV6 A;  4Q4Z F;  3LMM A;  1Y1V J;  2M9H A;  4IQJ A;  3CES A;  3I53 A;  3KYD B;  2Z5U A;  2G9W A;  4EV0 A;  5IYD J;  2ELH A;  2K4J A;  2MW8 A;  3BDD A;  2IAI A;  3H9J A;  5C4X J;  1ETW A;  4AU7 A;  3C2B A;  4E6K G;  4ESJ A;  1HOM A;  4LG3 A;  4CCK A;  1DQU A; 
#chains in the Genus database with same CATH homology
 4BYY A;  3M1E A;  3M7G A;  4OMZ A;  1C0W A;  4XSZ F;  1XB4 A;  5DUK A;  4ZZD A;  2DAO A;  3GFL A;  3ZP5 A;  3RPQ A;  2XV4 S;  4FHT A;  5LHI A;  2JZY A;  2MH9 A;  2W85 A;  5CVV A;  5L3D A;  2AXL A;  4HV5 A;  1P4W A;  2DK5 A;  4N9H A;  3CDH A;  1I1G A;  3E97 A;  1G4D A;  3DP7 A;  5FO5 A;  1STZ A;  1ZG3 A;  3VFZ A;  3TDU C;  4RS8 A;  3OV8 A;  3CUO A;  3FM5 A;  2H27 A;  2F2E A;  1HKQ A;  3WOD F;  5ICC A;  3WGI A;  2IA1 A;  4Q48 A;  3J7A O;  2P8T A;  1R7J A;  3DXJ F;  3VOE A;  1B59 A;  2ZME B;  3R4K A;  3V8L A;  3WTV C;  1YFH A;  4L9J A;  1H0M A;  4KNY A;  1S6L A;  2V79 A;  1SD4 A;  5J6X A;  1YW9 A;  4R79 A;  4LB6 B;  1B4A A;  2LF7 A;  2HDC A;  5E8I A;  3OOP A;  2PLY A;  4UV8 A;  4I7H A;  4KN7 X;  4BHB A;  3T8R A;  2BGC A;  5BPD A;  1BBY A;  2A3S A;  1Z9C A;  5DEQ A;  4ENM A;  2JT1 A;  2HFH A;  5E1W A;  4A6E A;  4Q47 A;  1R23 A;  3V7R A;  4EM0 B;  1TBX A;  3JSP A;  1U6G A;  2KKO A;  3K2Z A;  4XSX F;  3BPV A;  3CJN A;  2DW4 A;  3KP2 A;  2X4H A;  3WTY C;  3GFJ A;  1T38 A;  1O7F A;  1S7A A;  1IN5 A;  4KN4 X;  2VE8 A;  3LA3 A;  1EV7 A;  5DV5 A;  5LEJ A;  3U9G A;  1IZ1 A;  3PQJ A;  4IVN A;  1ZGJ A;  4LLN A;  3G73 A;  4RAZ A;  3IHU A;  4PCQ A;  2XKP A;  3FM3 A;  1VTN C;  2NNN A;  5BQT A;  1IW7 F;  4YIF A;  3B02 A;  1J5Y A;  3J81 K;  4PZJ A;  4P5O A;  4HLX A;  2MLK A;  1O57 A;  4BAY A;  1KU2 A;  3GF2 A;  2IA2 A;  3TOA A;  2ZFW A;  1O3S A;  1WQ2 A;  1FOK A;  1H9T A;  2DT5 A;  5ILV A;  1W5T A;  4KMU X;  1UFM A;  1FWZ A;  2LNB A;  4LK0 F;  1ONV A;  1KQ0 A;  1D8J A;  5LGU A;  3ZMU A;  1KU7 A;  3SHF A;  4YFK F;  2DU9 A;  2GAU A;  3TOB A;  4U88 A;  1R00 A;  2XUB A;  2CFX A;  4OIP F;  2PG4 A;  2E1C A;  4KT5 C;  1IXS B;  5HDG A;  1BIB A;  3CUQ A;  3RJP A;  5F64 A;  1KU3 A;  1K78 B;  4IRG A;  1G6N A;  2V6C A;  2ESH A;  1RUN A;  1R5H A;  2CWE A;  1IAW A;  2DQL A;  4IRI A;  3VEP A;  1IRF A;  1QNT A;  1WWX A;  1U5T A;  4PGH A;  5E1X A;  1EH7 A;  4L0Y B;  3RYP A;  3HIF A;  4HQM A;  3HOS A;  5FD6 A;  1PUE E;  4CGZ A;  4MNU A;  2V1D A;  5LGN A;  5AIQ A;  4B09 A;  1TQP A;  3KLO A;  1PP7 U;  3BRO A;  4HDV A;  2ZNY A;  1Z05 A;  2UXX A;  1LEA A;  5L3G A;  1DUX C;  1L0O C;  1D8K A;  3GFM A;  2WTE A;  1BI3 A;  4CYD A;  3EYI A;  1BN5 A;  4BHC A;  5L3B A;  1SFU A;  3RTR A;  3KET A;  1WI9 A;  1QO0 D;  5HS9 A;  4UVB A;  4HZF A;  1FP1 D;  5IT9 K;  5LEK A;  4EVI A;  1TW3 A;  3BJ6 A;  5ICF A;  2VBY A;  2VON A;  1BI0 A;  3Q9V A;  1LQ1 A;  1HSJ A;  2K27 A;  2XAF A;  2WWY A;  3O2P E;  1OYW A;  1S29 A;  3TGN A;  1HQC A;  4A2U A;  3N4M A;  5ILU A;  2JSC A;  3SFZ A;  3R61 A;  1MJA A;  3SZT A;  4XRF A;  1G3Y A;  2HKX A;  1E2X A;  1T39 A;  3WU1 B;  4KUM A;  2OQG A;  5ICG A;  2M8E A;  3FXR A;  4NHJ A;  3T0Y A;  4RAY A;  2K86 A;  1KYZ A;  2FSW A;  3HRU A;  3B73 A;  4LFU A;  1Y0U A;  1F5T A;  1HST A;  4KFC A;  2Z33 A;  2J5O A;  3IWZ A;  3L9F A;  3ELK A;  1TW2 A;  5EEG A;  2HOE A;  1YW8 A;  5CVJ A;  3K69 A;  2QZ8 A;  3LQR A;  3L2C A;  4I0B A;  2CYY A;  4WXC A;  4OIO F;  1AOY A;  1P6R A;  3D0S A;  5BS6 A;  5D5W B;  4IF4 A;  2EFO A;  4O3M A;  1UCR A;  1O3R A;  1T98 A;  3AAF A;  3TQN A;  1SFX A;  4CXF A;  3E6M A;  4EGZ A;  4L0Z B;  4A0X A;  1J75 A;  4I09 A;  4GYI A;  5E20 A;  4MEY F;  4CIC A;  2QBY B;  1MD0 A;  3FWE A;  4I02 A;  2VBX A;  4QLC U;  4EJO A;  1ZGA A;  2ZCW A;  3GW2 A;  4F7Z A;  4HA8 A;  2FBK A;  4HF0 A;  5CVI A;  3MQ0 A;  1QZY A;  5CVR A;  5DD4 A;  1R36 A;  3N97 A;  2Q2E A;  5JHU A;  4U0V A;  2LSO A;  2VBZ A;  1QPM A;  1ZRD A;  2FXA A;  3TO6 A;  5D5V B;  4PGG A;  3WU0 A;  2NNY A;  2CQK A;  2EV0 A;  2L02 A;  1ZG1 A;  3ECO A;  1USS A;  1HKS A;  5HOO A;  4OIN F;  1SD5 A;  3ECH A;  4I0A A;  3KLN A;  3LWF A;  4KIB A;  4LG0 A;  5HDK A;  1B6A A;  3FXQ A;  5K5R A;  2HWV A;  5J8F A;  2XKO A;  4WWC A;  3R0J A;  1FY7 A;  4QWQ A;  3HRS A;  3BP8 A;  2STT A;  4CHU A;  4OMY A;  1YO5 C;  3C3W A;  4TV7 A;  2EFN A;  5LRR A;  5FFZ A;  1T2K A;  1R58 A;  4E70 A;  4BXU A;  4PDK A;  1DP7 P;  3SXY A;  5IT3 A;  2IVM A;  2EV5 A;  2J5P A;  2YSR A;  2FA5 A;  2MC3 A;  3KZY A;  1OMI A;  3LFK A;  4HLY A;  5LRS A;  2M5W A;  2O3F A;  1GXQ A;  2KRF A;  2FF4 A;  2R7D A;  2ZJ2 A;  3DPT A;  3G3Z A;  1XSV A;  1MKM A;  2ZO4 A;  5H6Q A;  4XLP F;  4HAM A;  1QQI A;  2ACJ A;  2PBI A;  3GYH X;  2Z3Y A;  4LMY A;  2K4B A;  5A2Q K;  1EH8 A;  1ZG5 A;  2V1U A;  1XN7 A;  2EFP A;  4G94 A;  1DPU A;  2VXZ A;  3BJO A;  2K7L A;  3GVA A;  3VB2 A;  3IKV A;  1IF1 A;  2P7V B;  3LST A;  1R1U A;  3KFW X;  4M9Z A;  2ETH A;  1XMA A;  1YS6 A;  5DUI A;  1FX7 A;  5ED4 A;  3ROU A;  2MA3 A;  3F21 A;  3WTX C;  3DQV C;  1R1T A;  4FT8 A;  2DO7 A;  2F5F A;  3IL2 A;  4M6Y A;  3Q5F A;  4R8H A;  3Q9S A;  3ZQ7 A;  2IW5 A;  4KIC A;  4Q5S F;  5J8C A;  5E17 F;  2UXN A;  2M30 A;  2P7C B;  4IPA A;  1R5G A;  4IJA A;  5H6R A;  2E7X A;  3EUH A;  3CUQ B;  1JHF A;  1MJB A;  3J80 Z;  5DCF A;  1O3Q A;  2ISY A;  3L00 A;  4CZZ A;  1SD7 A;  3K9T A;  3MCZ A;  3U1D A;  3QP6 A;  3K1M A;  2YPR A;  5KVR A;  1XMK A;  3QU3 A;  2H6C A;  2R7F A;  2UZK A;  2GWR A;  1IXC A;  2W84 A;  5D5U B;  4A12 A;  5F6F A;  3JTH A;  4Y13 A;  3NEU A;  1F9N A;  3EDP A;  2FOK A;  3P9K A;  1D3Y A;  1OR7 A;  4YG2 F;  5BPI A;  1U78 A;  3W6J B;  1U5T C;  4EGY A;  4M73 A;  2HGC A;  3O6B B;  4MQ9 F;  2BE5 F;  3GFI A;  4H0E A;  2P5V A;  1FBU A;  1KYW A;  3RI4 A;  1QBJ A;  3I59 A;  2BBY A;  1SD6 A;  1I6X A;  5CJ9 A;  2KIM A;  4IHS A;  1R22 A;  2CO5 A;  3WTT C;  4RGU A;  1FC3 A;  4UUV A;  4GCV A;  2NS0 A;  2Y75 A;  5FD5 A;  4D0P A;  5KK1 A;  3J81 Z;  2XAH A;  2FNA A;  2AS5 F;  4KIG A;  4NQW A;  3E5X A;  1REP C;  2STW A;  3F8B A;  2PMH A;  2HR3 A;  3QP5 A;  3HRM A;  2QLZ A;  2DPU A;  3ABU A;  5E1Z B;  2P6T A;  5CYV A;  2QEN A;  2RQP A;  1F4K A;  5D4R A;  3FXU A;  4MTE A;  1MZB A;  1KA8 A;  3C7J A;  4EM2 A;  3VOD A;  4A5M A;  3HHH A;  3JSO A;  1EH6 A;  3GX4 X;  2A61 A;  5JR3 A;  3HSE A;  1ZYR F;  3RDI A;  2DLL A;  4O6J A;  5TJJ A;  1ZRE A;  4S04 A;  4HF1 A;  3CLO A;  4FX0 A;  1XDU A;  4A5N A;  3HSR A;  1JHH A;  5E18 F;  3V8J A;  1ZLK A;  1YLF A;  2ZBK A;  4R1H A;  1RUO A;  2Y0M A;  3JTG A;  3FMQ A;  4IRH A;  2L4M A;  5A2Q Z;  1DPR A;  2VBW A;  3KE2 A;  5FB2 A;  2D1H A;  2NAZ A;  1HW1 A;  1YG2 A;  3FX3 A;  2EA2 A;  3ZMD A;  4LG0 B;  4M6X A;  3RKY A;  1GXP A;  3WG9 A;  3I71 A;  4XLN F;  3E6C C;  5LHH A;  2IP2 A;  2KJC A;  1HW2 A;  4CO8 A;  5LHG A;  4JK1 X;  4AWX B;  2O0Y A;  1MDM A;  3I54 A;  3HRT A;  1YW7 A;  2Z9O A;  5CLS A;  5D8L B;  2DBB A;  2VOO A;  1I1S A;  4CDG A;  1UHW A;  1B9M A;  5TRD A;  1JGS A;  3R0A A;  4S05 A;  3CO7 C;  5LGT A;  3F3X A;  3IRR A;  1ZLJ A;  1FZP B;  2MBF A;  5IT9 Z;  3S2W A;  1DDN A;  4UHT A;  3LQQ A;  3HTU A;  1F1Z A;  1O7L A;  5ILS A;  2QBY A;  2E7W A;  2UWM A;  1U5T B;  3F8C A;  3JAM Z;  1RI7 A;  1YTY A;  3O3K A;  3GZ5 A;  2M1B A;  3DV8 A;  1IUY A;  5BOX A;  4WXD A;  2LDU A;  2P6S A;  2C6Y A;  3TO7 A;  4L5I A;  2X0L A;  3F6V A;  1TNT A;  4KDP A;  4MGR A;  3PFI A;  4I2O A;  4JBA A;  1CF7 A;  4OU0 A;  2A68 F;  2GXG A;  1QZZ A;  3H3Z A;  1S3J A;  3KEQ A;  1W7P B;  2YX4 A;  4A0Y A;  3LAP A;  2EJR A;  3KZZ A;  3V7S A;  3K1N A;  2G7H A;  3DEU A;  4ENN A;  1FYK A;  1XSX A;  2ISZ A;  3DFG A;  1J59 A;  1SFE A;  2IA0 A;  1Z91 A;  3WGG A;  3REO A;  2G7U A;  2NYX A;  3HSF A;  1A04 A;  3L09 A;  2VC0 A;  2OZ6 A;  2D45 A;  3LAJ A;  3RPU A;  4DNC A;  1FBQ A;  5HVQ C;  3GEZ A;  1PP8 F;  1BOA A;  4MTD A;  4UVC A;  2GQQ A;  1ZRC A;  3DKW A;  5EEH A;  5AON A;  1PDN C;  1O3T A;  1Z6T A;  4ETS A;  4LD5 A;  2EB7 A;  1V3F A;  5JVT A;  2M87 A;  3KP6 A;  2VOD A;  4ZYD A;  3I64 A;  4GO1 A;  1YYV A;  3WTZ A;  1K78 A;  4ON0 A;  3LA2 A;  1AWC A;  4LB5 A;  4IXA A;  3JAM K;  2QWW A;  3KCC A;  1BI2 A;  2PFB A;  3COA C;  4MHG A;  3V7C A;  5L3C A;  1BI1 A;  3I4P A;  4HX8 A;  1ZAO A;  2JTV A;  2E1N A;  4GXO A;  2FNP A;  1LNW A;  3MAJ A;  4M9S A;  4GYG A;  2QM3 A;  1TTY A;  1H9G A;  1SAX A;  1IN7 A;  3GWZ A;  4WF2 A;  3F23 A;  2VN2 A;  2EK5 A;  2FE3 A;  1K7A A;  3TDZ C;  1HW5 A;  5H20 A;  2IJL A;  4G8X A;  4XBF A;  4A6D A;  4ASN A;  4AIJ A;  2P5L C;  2ZNZ A;  1ON2 A;  2HEO A;  1JE8 A;  5FLX K;  3K0L A;  4EJV A;  4HQE A;  1ZN2 A;  4A0Z A;  4UVA A;  2GZW A;  5JI6 A;  3T1B A;  4RB0 A;  5HS7 A;  1I5Z A;  2QQB A;  2XRN A;  3ZMV A;  4G7H F;  1T0F A;  1XCB A;  2OBP A;  3WE3 A;  4Z2Y A;  3ZMS A;  1IN8 A;  2JPB A;  3BZ6 A;  2XAG A;  2COM A;  3J80 K;  1LDJ A;  4RB1 A;  5L3F A;  2DI3 A;  2BYV E;  4YFX F;  1G3T A;  3ULQ B;  1V4R A;  4G7O F;  2K02 A;  1IN6 A;  4BQA A;  2H09 A;  1ZAR A;  1L3L A;  2ZME A;  5K1Y A;  3F22 A;  2RC4 A;  4HYE A;  2DK8 A;  4B8X A;  4ESB A;  4HBL A;  4P9U A;  1R1V A;  3ZPL A;  2W57 A;  4AD9 A;  4AVP A;  4WXH A;  3WTW C;  2CG4 A;  1BC7 C;  2B0L A;  3P9C A;  3EQL F;  4M74 A;  1YS7 A;  3BWG A;  5D6E A;  2H94 A;  1YIO A;  2JRT A;  1FSH A;  4EJW A;  2L54 A;  2GXB A;  3GXO A;  2IRF G;  2R3S A;  4OIQ F;  3P9I A;  1XGS A;  4M72 A;  2GA2 A;  2HYG D;  1E17 A;  1IN4 A;  1BIA A;  4EMS A;  1U3E M;  4AIK A;  2XGX A;  2OD5 A;  3NRV A;  5DCM A;  3QU6 A;  3ISP A;  1LDK B;  1FBS A;  1T6S A;  4LK1 F;  2QQA A;  3RKX A;  1G3S A;  1BM9 A;  3E5Q A;  1W5S A;  2EFQ A;  2A69 F;  2EFW A;  2GA1 A;  1Z1D A;  2ESN A;  4HDU A;  2BEO A;  3ZMT A;  3ZN0 A;  1FYM A;  4LLL A;  2FQ3 A;  4FX4 A;  1KQ8 A;  3CUQ C;  4WCG A;  3KP7 A;  1RZ4 A;  5D4S A;  5E8G A;  2O6G E;  5ICE A;  2FBI A;  1LJ9 A;  1B9N A;  2WC2 A;  4N0B A;  2VT2 A;  3TKY A;  4G9Y A;  1UHM A;  2FEZ A;  4WX9 A;  2PI0 A;  2ZKZ A;  1J7K A;  4KA4 A;  4L5J A;  3F8F A;  2M45 A;  1IXR C;  4P96 A;  2LKP A;  1ZRF A;  1IRG A;  2MH2 A;  3V4G A;  3QAH A;  2MD5 A;  2Q8K A;  4ZH4 F;  1P92 A;  2F5C A;  2RV8 A;  3CTA A;  1FLI A;  4UNO A;  1YQA A;  2PQ8 A;  3IRQ A;  1OKR A;  4RB2 C;  3FZV A;  4ESF A;  1GHC A;  4RB3 C;  1W4M A;  4KIF A;  2A5Y B;  2YX7 A;  2IPQ X;  1J2X A;  1FPQ A;  5F1R A;  4LJZ F;  2P4W A;  1WSU A;  3FMR A;  2KIU A;  1OPC A;  4DQ2 A;  3KP4 A;  2VE9 A;  3GLX A;  3MZY A;  4U0Y A;  4KMF A;  1FT9 A;  2O8X A;  4BHP A;  3MEX A;  5DCM B;  3F72 A;  2XAQ A;  3FHZ A;  5FFX A;  1LEB A;  3BJA A;  4GGG A;  4ZYH A;  4HX7 A;  4U7B A;  2DQR A;  2FBH A;  1HXD A;  2RDP A;  4M71 A;  2FRH A;  1MGT A;  5HLH A;  1SMT A;  1XGM A;  2XIG A;  1BJA A;  2CSO A;  1Z6R A;  3HHG A;  3IC7 A;  4ZYE A;  2OA4 A;  2P5K A;  3QPT A;  4I98 B;  5D5X B;  4UXN A;  3R6S A;  3DF8 A;  3QPH A;  3E3V A;  2RN7 A;  1J9I A;  1Q1H A;  3I0T A;  2Q0O A;  3E5U A;  2CGP A;  4ENK A;  4HF2 A;  1XDS A;  3MFK A;  2OQR A;  2ADU A;  1ZH5 A;  5HLI A;  4P9F A;  1UB9 A;  3ZN1 A;  4NB5 A;  4IHT A;  2XAS A;  2XRO A;  4LLG F;  3ABT A;  5DDG A;  1P2F A;  1S8N A;  4HX4 A;  5D6F A;  2L4A A;  4G6Q A;  3F8N A;  4Y17 A;  1UST A;  2JPC A;  4I01 A;  5HLG A;  3PQK A;  2KIF A;  1SMY F;  1TQI A;  1RNL A;  2XVC A;  3HTS B;  2MLG A;  4U0W A;  1XD7 A;  2QUF A;  5ERI A;  3EET A;  1WKM A;  3MZH A;  3LA7 A;  2V9V A;  5BMZ A;  3HYI A;  3BPX A;  5AIP A;  5LBQ A;  1FSE A;  4AIH A;  5LLQ A;  2HYF A;  3BOQ A;  1P4X A;  3DPL C;  2L01 A;  1FP2 A;  2W24 A;  3KEO A;  4L18 B;  1XGN A;  3H3U A;  4BH9 A;  5HDN A;  4RGR A;  3WTU C;  4EM1 A;  1S7O A;  3GO5 A;  3U2R A;  2A6E F;  3KP3 A;  2CW0 F;  2XAJ A;  1XCV A;  3T5X A;  1MJ9 A;  3WTS C;  3T8T A;  3QRF F;  4ZZL A;  2FU4 A;  3K1P A;  2Z99 A;  3RKW A;  2YU3 A;  2V1X A;  1HBX G;  2LF8 A;  3FF5 A;  2QQ9 A;  3ERE D;  1ON1 A;  3KP5 A;  1XGO A;  3GUD A;  2DTR A;  3I59 B;  3SZP A;  1TNS A;  4LGW A;  2F5E A;  3ZMZ A;  1RIO H;  4YFN F;  2QYO A;  3SQN A;  2RVC A;  6PAX A;  3F8M A;  4U7D A;  1LDD A;  1KQ9 A;  1B1B A;  4RGS A;  2PJP A;  1TLH B;  2DPD A;  4KYW A;  2WV0 A;  4BNC A;  1HKT A;  3D5L A;  3IKT A;  1U8R A;  2O03 A;  5D8K B;  3L7W A;  1CGP A;  4Y15 A;  2H6B A;  1WRJ A;  2HTJ A;  4G7Z F;  2GIV A;  1OYI A;  1J0R A;  5L3E A;  3E6D A;  3M8E A;  4K2E A;  2EA4 A;  2FML A;  1GVJ A;  3W6K B;  2D1V A;  2PMU A;  4OOI A;  3M8F A;  4HV6 A;  5FLX Z;  2ZXJ A;  1CF7 B;  2TDX A;  3C18 A;  3P7N A;  2A6H F;  1D5V A;  1KGS A;  2OU2 A;  1TQM A;  2VT3 A;  5DD8 A;  2RKH A;  5CVU A;  4ENJ A;  1LVA A;  1LB2 A;  2L3D A;  1KU9 A;  4HW0 A;  3BY6 A;  1W7P A;  2O61 A;  1QGP A;  2RNJ A;  3MWM A;  2VOP A;  2DFI A;  2A07 F;  1ZHF A;  2OAZ A;  3IWF A;  4JQF A;  2EWN A;  3TO9 A;  4P55 A;  3R60 A;  1OYY A;  3FMS A;  3RIR A;  4MEX F;  3NQO A;  3M9A A;  2HQR A;  2HQN A;  5JFR A;  4UV9 A;  1FYL A;  2F5D A;  2YR2 A;  4L9N A;  1FNN A;  3EYY A;  5FGM A;  2FMY A;  4EJT A;  4EJU A;  4OIR F;  3ML6 A;  1U2W A;  3F6O A;  5K5Q A;  1K79 A;  5DYM A;  4YII A;  2VC1 A;  2NRA C;  2IT0 A;  4L9T A;  4G6D A;  1MDM B;  3WE2 A;  2QVO A;  1NHA A;  1P4A A;  3H92 A;  4M9X A;  2XHK A;  4MQV A;  3I5U A;  5HS8 A;  2RGV A;  1X3U A;  1JXS A;  2HTS A;  4ZYG A;  2OZU A;  2PN6 A;  3WGH A;  4L9V A;  1I27 A;  4RGX A;  2KJB A;  1Z7U A;  2HZT A;  3I58 A;  2PEX A;  2HS5 A;  2Y48 A;  2EV6 A;  1ULY A;  2HKO A;  3GZ6 A;  4N9I A;  2D2W A;  3HUG A;  4EQQ A;  3JW4 A;  1W7P D;  2W25 A;  3E6B A;  4O5V A;  4HOB A;  1K6O A;  3QOP A;  1XSD A;  1G3W A;  4WK8 F;  3V8K A;  1BC8 C;  3HOT A;  1ODD A;  5K5O A;  3C1D A;  3RYR A;  3CO6 C;  2BV6 A;  4Q4Z F;  3I53 A;  2Z5U A;  4EV0 A;  2G9W A;  2ELH A;  2K4J A;  3BDD A;  4ESJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...