1SAXA

Three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci in complex with 25-bp ds-dna
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
120
structure length
120
Chain Sequence
NKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-d(GCTCCGATATTACAGTTGTAATTTT)-3'
publication title On the transcriptional regulation of methicillin resistance: MecI repressor in complex with its operator
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 38
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1saxA01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1saxA02
1F9NA 1TNTA 2O8XA 2MBFA 1UHMA 1KQ9A 4WX9A 5KVRA 2HR3A 3H3ZA 1KU9A 2VE8A 3P7NA 4I0AA 4CO8A 2IVMA 3KLNA 5DUIA 5D6FA 5LGUA 1FYMA 4Y15A 3COAC 2JSCA 5K5QA 2ZJ2A 3ZMVA 3Q9VA 1IN8A 3HUGA 2R7FA 1IN4A 4GYGA 3NRVA 4IHTA 3K2ZA 2CQKA 2VXZA 3QPTA 5CVUA 4EJWA 1XSXA 3ZQ7A 1ZGJA 3LA3A 4CDGA 1S7OA 3ABUA 3KEOA 3U2RA 1S29A 4FHTA 1ZH5A 5KK1A 2H6CA 1UCRA 3MZHA 2FBHA 1G3SA 2M87A 1T6SA 1H9TA 5D6EA 2LNBA 2MLGA 5DV5A 1ZAOA 2Y75A 1DDNA 1VTNC 3E5UA 1GVJA 3HRMA 4MEXF 3VFZA 3KP5A 2RN7A 2OA4A 2BEOA 4BH9A 3U1DA 4WK8F 3QU3A 1WRJA 1ZG5A 2J5PA 4S05A 2P8TA 4BXUA 4I2OA 3P9CA 4ESFA 5K5RA 2W25A 2W84A 4Z2YA 1YW7A 3KP2A 2CW0F 4LB5A 1J59A 5F64A 2BV6A 3E6DA 2NYXA 1C0WA 2XAQA 1T2KA 2XAFA 1W5TA 2RNJA 3RKYA 4ENMA 4CYDA 1Z7UA 3TGNA 1LQ1A 2D2WA 2V1DA 3WTWC 2P5KA 3SFZA 3ZMZA 1RNLA 1IXSB 3CUQC 4UVBA 2EB7A 4U7BA 2PN6A 3KCCA 4KIFA 3E6BA 3R0AA 1MDMA 2OZ6A 3BPVA 2YU3A 4M9XA 4OIOF 1E2XA 5EEHA 3GFJA 2ISYA 1JXSA 3I5UA 1XGNA 4CGZA 2HYGD 3ELKA 1MKMA 3WGIA 4KDPA 4YFNF 3GFIA 5HDGA 2HFHA 3GVAA 4AIHA 5ED4A 4YFKF 3N4MA 4QWQA 4RAYA 4BQAA 3D0SA 5JVTA 2B0LA 3JW4A 2ZBKA 1F1ZA 1G3TA 3CTAA 2WTEA 2CFXA 1ZN2A 1K78B 1BI1A 3JSOA 1IRFA 2HGCA 4HV5A 2F5FA 1QPMA 3T8TA 4EVIA 3L00A 3GZ6A 2DU9A 4KNYA 2IPQX 1HKQA 1STZA 1V4RA 4ENKA 1J5YA 1F5TA 1SFXA 3ML6A 3ROUA 4G7HF 2DK8A 4CHUA 2XASA 4HOBA 1G4DA 1O7LA 2UXXA 1ONVA 2L4MA 2WV0A 4U0YA 5FD5A 3VB2A 1U5TA 4LLGF 3K0LA 2KKOA 2MLKA 2CGPA 3V8LA 1OKRA 3U9GA 1P4AA 1BN5A 3J81K 2H27A 3FZVA 5CLSA 4P9UA 4A5NA 4KFCA 2GZWA 4HX8A 1V3FA 2A61A 4I01A 5ICCA 4Q4ZF 2ZKZA 4ETSA 2IP2A 3C1DA 4WCGA 1L3LA 4MGRA 2QUFA 3E5XA 3M8FA 2O03A 4QLCU 4L18B 3SZTA 3HRUA 2LF7A 4MNUA 3K1PA 2D1VA 1FOKA 2HWVA 1ZRFA 4AIJA 1EH8A 1CF7B 4R79A 1FYKA 3Q9SA 3P9IA 4I98B 5HS8A 1FBQA 2KJBA 1LJ9A 3R4KA 5D4RA 1X3UA 1YQAA 2PI0A 2COMA 3MCZA 1LDKB 2XUBA 2PQ8A 2Y48A 3BY6A 3K69A 4HLXA 3ZMDA 2XAJA 1WSUA 4KT5C 1JGSA 4A6DA 2YX4A 2A5YB 2VC1A 4XSXF 1G3YA 1W7PA 2V6CA 5D5XB 3L9FA 2YSRA 1J0RA 2OU2A 3HHHA 4ENNA 4I09A 1B4AA 2STWA 2HQRA 1R58A 2DFIA 1QQIA 2H94A 3FHZA 1J2XA 4A6EA 1KU7A 3HOSA 4BHBA 5DD4A 3SXYA 3RTRA 3RJPA 1U78A 3I4PA 1XMAA 2VT3A 2IJLA 1Z9CA 1QZYA 3IKVA 2FMLA 2Q8KA 4U0WA 3F8MA 1OYIA 5E18F 3RPQA 4EQQA 3KETA 3KZZA 1JE8A 1LNWA 4L9TA 1O7FA 2VOPA 1RIOH 2DAOA 2IRFG 2PMUA 2ZNYA 4UHTA 4ZYDA 2HDCA 5E1WA 3FXRA 4HAMA 4MQVA 4MEYF 3QP5A 4ENJA 4OMZA 1UFMA 5DYMA 5L3DA 4HDVA 5J8CA 1WI9A 2XKOA 2OAZA 1P4XA 4AWXB 2R7DA 1IRGA 1FBSA 1U5TC 2MH9A 2YR2A 2F2EA 1S8NA 2WC2A 5ILVA 2D1HA 3TDUC 2ZCWA 3RKXA 1WQ2A 3EETA 2XV4S 3W6KB 2VC0A 3WE2A 3CUQA 3GFMA 2LSOA 1R5GA 4E70A 3T1BA 4ZZLA 1RI7A 3M9AA 4OOIA 4LG0A 1B6AA 2ZMEA 2HQNA 4LK0F 2P6SA 3FMSA 1FPQA 5L3BA 5IT9K 2QM3A 2K4BA 3QU6A 1ZHFA 2DT5A 1MJ9A 3M1EA 1XGSA 5LEJA 4L9JA 4IHSA 3V7CA 3MAJA 4A12A 3PFIA 3LAPA 3L2CA 1IAWA 1FLIA 1ZG1A 2QBYA 5FO5A 3WTZA 1U2WA 2A69F 4L5JA 4I7HA 1DPUA 2PEXA 3SZPA 3V4GA 3BDDA 3EUHA 1O3TA 3IKTA 1SD4A 1U3EM 4CZZA 2GXGA 1LEAA 1DUXC 4HW0A 3ZPLA 2H09A 3J7AO 1ULYA 2AXLA 5DCMB 4FX0A 5CVVA 2XAGA 3I54A 3GW2A 2XHKA 1U8RA 4EJUA 2QYOA 2HKOA 1IXRC 1R5HA 3E3VA 3B02A 3E6CC 4BHPA 1P4WA 5HLIA 4P55A 3OV8A 2CG4A 3HSEA 2MD5A 4L0YB 1D3YA 3TKYA 2QLZA 1MJAA 2X0LA 2D45A 1GXPA 3GFLA 2XROA 2HS5A 3OOPA 1I1SA 2P7VB 1CGPA 4NQWA 4YG2F 1W7PD 4HX4A 3KP7A 3PQKA 2IA0A 5D5UB 2DPUA 1QO0D 4M73A 2Z3YA 2A07F 2GA2A 1T0FA 2M5WA 2HKXA 3WTTC 5JHUA 4L9VA 4UNOA 4I02A 5LHHA 3IHUA 3WTXC 2ESHA 4HQMA 3WE3A 4LJZF 2HTJA 4G94A 2ETHA 5LRRA 3IRRA 1Z6TA 2HOEA 3ECOA 3JAMK 4HV6A 5HS9A 3E5QA 4AD9A 1KU3A 2V1UA 3HRTA 2HZTA 2LDUA 4U7DA 4OINF 3ZN0A 1HW1A 3HOTA 5AIPA 3IL2A 3TOBA 3I53A 2EA2A 4FX4A 3CLOA 1P2FA 1HXDA 4JK1X 3ABTA 5BPIA 2DPDA 1O3RA 4N9IA 2LF8A 4P9FA 2DQLA 4KMUX 5HDNA 1LB2A 5DEQA 2A6EF 3FM5A 4Q5SF 3KP3A 2XGXA 1SFEA 4L5IA 4HX7A 1KGSA 2CO5A 3GEZA 3FXUA 3HTSB 4ZYEA 3K1NA 5JI6A 4KN7X 2FXAA 3REOA 3KLOA 4MHGA 3LA2A 2KJCA 2L54A 1WKMA 2JRTA 2CWEA 3TDZC 2RDPA 2FSWA 1FNNA 1GXQA 4LK1F 1XDUA 4ZYGA 3DV8A 3R0JA 2ZNZA 3F72A 3I58A 1A04A 1U5TB 2CYYA 4MTDA 4Q48A 2ELHA 4M9SA 5H6RA 2GA1A 4YFXF 3MWMA 3IWZA 1IZ1A 2V79A 5D8LB 5ILSA 4A0YA 3F22A 1R1UA 3KZYA 4PZJA 2XVCA 4RAZA 2G9WA 1E17A 5BQTA 5JR3A 1XMKA 2VT2A 5H20A 4YIFA 3B73A 4DQ2A 2EJRA 3JSPA 1BIAA 2FBKA 3MQ0A 3FX3A 4B09A 2EK5A 5CVRA 3F8BA 5FFZA 3GX4X 4UUVA 2EWNA 2EFWA 3QAHA 4ZYHA 3I59A 4WXDA 1J9IA 1R1VA 3TO7A 3V8KA 2P5LC 2GXBA 2TDXA 3BP8A 1I6XA 1XDSA 2MA3A 2A68F 3W6JB 2DO7A 4EV0A 1ZG3A 2BGCA 1OPCA 1LDDA 3KE2A 4RGXA 2QQ9A 1SD6A 3ZMTA 3MEXA 3C3WA 3G73A 2L02A 2K02A 5CYVA 2FE3A 2L3DA 5FD6A 1ON1A 1K78A 1S6LA 1IN7A 1JHHA 2QWWA 3F6OA 2HTSA 3WGGA 1YW8A 4CXFA 5AONA 2ZFWA 1OYWA 2F5EA 1ODDA 1BI2A 4RGSA 1FSEA 3DXJF 4Y17A 2FU4A 4O5VA 3DPLC 4M74A 2A3SA 5L3EA 4M9ZA 2FMYA 1YS6A 2W24A 4G7ZF 2PJPA 1SFUA 2E7WA 4BAYA 3O3KA 1OR7A 4LB6B 4ESBA 4AVPA 5LLQA 4S04A 2M30A 2IA2A 4WF2A 3JTGA 3J81Z 3GO5A 5ICFA 2ACJA 1QZZA 2EV0A 2UZKA 2V9VA 3KP6A 4UVAA 5LHIA 2DLLA 1YLFA 4B8XA 1S3JA 4PGHA 1Z05A 5ICGA 2ZO4A 2QZ8A 2UWMA 2JTVA 5L3FA 2HEOA 4UV8A 2DQRA 3RYPA 4R8HA 3ZMUA 3L7WA 2Z9OA 1EV7A 1CF7A 5F6FA 1I5ZA 3WTSC 5E20A 1MD0A 5K1YA 1HW5A 3H3UA 2EFPA 2X4HA 1TQPA 1YS7A 5L3CA 3Q5FA 1HSJA 2XKPA 1D8KA 1EH6A 3DF8A 3GXOA 4WXCA 4LFUA 1BM9A 2FRHA 2PBIA 1KYZA 1BI0A 5ERIA 3CUQB 3WTYC 2V1XA 1R7JA 4A5MA 3HYIA 4P5OA 4A0ZA 4LG0B 2ZMEB 3V7SA 2ADUA 3QP6A 2G7UA 3F8FA 3F3XA 5D8KB 3R61A 3EQLF 3VOEA 4IF4A 3FF5A 5CVIA 3RYRA 3IWFA 1PUEE 4IRHA 1Z6RA 3SQNA 2JPBA 2YPRA 4ASNA 5E8GA 3AAFA 2VBZA 3TQNA 3DQVC 4O6JA 4BHCA 3CDHA 2XIGA 5E1ZB 3VODA 5FGMA 1KYWA 1FWZA 4RGUA 1R00A 1BC8C 1XSVA 1HKSA 4HF2A 3NQOA 2PG4A 1G3WA 4M71A 2EV6A 1K6OA 2RGVA 5DUKA 2FNPA 1T98A 1J75A 2XAHA 4KICA 1ZREA 4KMFA 3HSRA 2DBBA 5HS7A 3BROA 2BE5F 2UXNA 1YFHA 2PFBA 3KP4A 2QQBA 3LWFA 1FZPB 2DTRA 2VBYA 4EM2A 5E1XA 1J7KA 4Y13A 1K79A 2K27A 2RV8A 3O2PE 1XSDA 3FMRA 5LGNA 1Q1HA 3EYYA 3HSFA 1UHWA 2GAUA 1FSHA 1BIBA 3HRSA 4IJAA 4KIBA 1NHAA 2OQGA 4G9YA 5D5VB 5FB2A 1HQCA 1TLHB 3MZYA 1G6NA 5LHGA 2EFNA 3WTVC 5F1RA 2CSOA 2VONA 1ZLJA 5BPDA 1TW2A 4G6DA 2E1CA 5E8IA 4EM1A 2ISZA 1I27A 4KA4A 1KU2A 4IPAA 4G8XA 3RDIA 3GUDA 4L0ZB 2E1NA 4EGZA 5FLXK 1ZRDA 2QQAA 1YO5C 1REPC 5LBQA 4U0VA 5IT9Z 4EGYA 3LSTA 4JQFA 1PP8F 4RB0A 3EDPA 2IA1A 2Z33A 4HDUA 2EV5A 2VODA 1YYVA 4HQEA 3P9KA 5L3GA 2KIFA 1IXCA 5BMZA 3E6MA 4OMYA 5TRDA 3WU0A 3WODF 4LGWA 2DI3A 1AOYA 1T39A 1BJAA 4BYYA 3KEQA 4ON0A 2OD5A 3ULQB 3CUOA 1PDNC 1XN7A 1HW2A 4G7OF 3KFWX 5DCMA 2P7CB 2XRNA 3BJ6A 4IXAA 4HF1A 1YTYA 2KIUA 1FT9A 2KRFA 2FEZA 2RC4A 3LAJA 1IUYA 1MDMB 3ZN1A 2M1BA 2AS5F 2NS0A 4R1HA 5FLXZ 4CICA 1R22A 5HDKA 4D0PA 1K7AA 4OIPF 2K86A 4A2UA 4LD5A 3K9TA 3I64A 2P6TA 6PAXA 2PMHA 1B9NA 5EEGA 3T0YA 1RUNA 4MTEA 3GLXA 4GYIA 2JPCA 3NEUA 2M45A 4OIQF 1BI3A 1USSA 3TOAA 3FM3A 5A2QK 1YIOA 2FQ3A 4HF0A 1TBXA 3CO7C 1FX7A 3R60A 2ESNA 2DK5A 3TO6A 2J5OA 2GIVA 5TJJA 1HKTA 4RB1A 4LLLA 2VE9A 4GGGA 3J80K 4IVNA 1MZBA 1D8JA 4EM0B 2O0YA 4RB3C 3M8EA 2Y0MA 3C18A 3LA7A 5BOXA 2YX7A 3JAMZ 1FY7A 1XD7A 3FXQA 3ZP5A 3FMQA 1I1GA 2STTA 3QOPA 3I0TA 3ECHA 3BWGA 4EJTA 2QENA 3I59B 1IN6A 3M7GA 5HVQC 1Z91A 5J8FA 4KIGA 1TTYA 2NNNA 3ZMSA 5D4SA 1FP2A 1L0OC 4G6QA 4UV9A 2NAZA 4ZH4F 3I71A 3CO6C 2GQQA 4BNCA 2KIMA 1HSTA 4RS8A 1H0MA 3WG9A 2VOOA 4PGGA 5A2QZ 1KA8A 2EA4A 2L01A 1OMIA 1P92A 4XLNF 4XLPF 4FT8A 1U6GA 2FNAA 4DNCA 1DP7P 4JBAA 4Q47A 5E17F 1BOAA 5CVJA 5HLGA 1RUOA 4OIRF 1BC7C 1O57A 4NB5A 3J80Z 3WU1B 5DD8A 4EMSA 3BZ6A 1TW3A 3DPTA 1KQ8A 4UVCA 1W5SA 2P5VA 4WXHA 2MC3A 3DP7A 2Z99A 4KN4X 2G7HA 1YG2A 1SMTA 2WWYA 2L4AA 1PP7U 1F4KA 4GO1A 5J6XA 1IF1A 2H6BA 4MQ9F 3F6VA 4GXOA 4HYEA 3HHGA 2E7XA 1R1TA 1D5VA 2BBYA 1B1BA 1W7PB 2OBPA 2K7LA 5JFRA 3WTUC 4A0XA 1TQIA 3S2WA 3LFKA 1QBJA 3QPHA 3IRQA 4KYWA 5ICEA 2FA5A 2O61A 5CJ9A 1JHFA 1XGOA 4ZZDA 1R23A 3MFKA 1XCBA 3H92A 2A6HF 2F5CA 2W85A 2M8EA 3N97A 2FF4A 3DFGA 1FBUA 2Q0OA 3C7JA 1ZYRF 2Q2EA 3DEUA 4GCVA 1TNSA 2JT1A 5HLHA 3DKWA 2EFQA 2W57A 4PDKA 4XRFA 1SD7A 4L9NA 4IRGA 2RVCA 3L09A 1HBXG 4YIIA 3F8CA 4ESJA 1ON2A 4HA8A 1MGTA 3T8RA 3ERED 1DPRA 4HZFA 4LLNA 1Z1DA 5AIQA 3FWEA 5LEKA 3V7RA 1ZGAA 2PLYA 3R6SA 1TQMA 1LEBA 3D5LA 5BS6A 3HIFA 5FFXA 1SAXA 3GWZA 3F21A 1RZ4A 5ILUA 3G3ZA 4H0EA 5DDGA 5K5OA 3GF2A 1SMYF 4HBLA 3PQJA 4M72A 1FYLA 1UB9A 1B59A 1IW7F 2BYVE 3GZ5A 1YW9A 1O3SA 4N0BA 4OU0A 1ZLKA 3JTHA 1LDJA 3F23A 1B9MA 2QVOA 1XB4A 5H6QA 2DW4A 3BJOA 3RPUA 4M6YA 4UXNA 4KUMA 1S7AA 3V8JA 5D5WB 4U88A 2F5DA 1FP1D 4TV7A 2NRAC 3VEPA 5HOOA 4O3MA 3T5XA 3RIRA 3RI4A 2RKHA 2VBWA 3BPXA 1MJBA 1SD5A 2VN2A 1BBYA 2NNYA 2C6YA 2VBXA 4F7ZA 2QBYB 2RQPA 1IN5A 1H9GA 1EH7A 1T38A 3O6BB 1ZARA 4XBFA 4K2EA 2FBIA 1KQ0A 1Y0UA 3BOQA 4I0BA 4XSZF 3K1MA 4RB2C 2OQRA 4N9HA 3ISPA 3CJNA 4P96A 4RGRA 4AIKA 3IC7A 1QNTA 4EJOA 3EYIA 2O6GE 2JZYA 2EFOA 1P6RA 1W4MA 4HLYA 2MH2A 3SHFA 4PCQA 3LQQA 4NHJA 2FOKA 1FC3A 3TO9A 4M6XA 2ZXJA 2GWRA 1XGMA 2O3FA 3WGHA 4LMYA 2HYFA 2IW5A 3RKWA 2IT0A 1WWXA 1LVAA 2OZUA 2R3SA 3BJAA 1ZRCA 1GHCA 1O3QA 2K4JA 1AWCA 2LKPA 3E97A 3HTUA 4WWCA 5LGTA 3GYHX 1R36A 1XCVA 3QRFF 1USTA 4IRIA 1OYYA 1QGPA 4EJVA 5DCFA 2P4WA 3F8NA 5IT3A 3LQRA 5LRSA 2Z5UA
chains in the Genus database with same CATH superfamily
2QKMB 1F9NA 1TNTA 3WU2C 2O8XA 3QPLA 2MSYA 2KP6A 2MBFA 1HLVA 4JX5A 1UHMA 2V9PA 3LSRA 1KQ9A 3S15J 4WX9A 3A03A 1PJRA 3VYTB 1UAAA 5KVRA 2LC2A 2HR3A 3H3ZA 3PUFA 1KU9A 4Z6YA 1R4NB 2VE8A 4FCYA 3P7NA 4I0AA 3FHNA 4CO8A 2IVMA 4RM2A 3KLNA 5DUIA 5D6FA 4II2A 5LGUA 1FYMA 2R4GA 2RNGA 4Y15A 3COAC 2V7FA 1TP4A 1EKEA 2FD5A 2JSCA 5K5QA 3CCEI 1YJ9I 2ZJ2A 3ZMVA 2IS1A 1O4XA 1GV2A 3Q9VA 1IN8A 1W36D 4BBRJ 3HUGA 2R7FA 1IN4A 5EGOB 1QZEA 2OCEA 4GYGA 3NRVA 1B72A 4IHTA 3K2ZA 3FXJA 3I4MJ 1G8XA 4RLFA 2CQKA 5LFAA 1YX5A 2VXZA 2XAUA 3QPTA 5CVUA 4PFOA 3K70C 4EJWA 1XSXA 3ZQ7A 1V5FA 1ZGJA 3LA3A 3K10A 4CDGA 1S7OA 3ABUA 2LY9A 5F27A 3L1PA 4XLCA 2O7OA 3L2RA 3LSMA 3KEOA 3U2RA 1S29A 4FHTA 1ZH5A 5KK1A 2H6CA 1UCRA 2DMPA 3MZHA 2FBHA 1G3SA 2M87A 1QU3A 1T6SA 5HNHA 3TL4X 4F3QA 4XR6A 1RRJA 2BY0A 1H9TA 5D6EA 2LNBA 4D1QA 2MLGA 1NH3A 5DV5A 1ZAOA 5J47A 2VIXA 2X1CA 2Y75A 3G1OA 3CF5F 1DDNA 1VTNC 1WZ2A 3E5UA 1GVJA 3HRMA 2XF6A 4MEXF 1W0UA 3VFZA 4II3A 1ETXA 1X1BA 3KP5A 2RN7A 2VKHA 1ACIA 2OA4A 3OYHA 3DBLB 1V54H 2BEOA 2X1DA 4BH9A 2B7EA 3DTIA 3U1DA 4WK8F 2KZVA 3QU3A 1WRJA 1BJZA 1SVLA 3QQAA 2WY8Q 2LKXA 1ZG5A 2J5PA 3X2QH 4S05A 2YS9A 3LFUA 2P8TA 2R92J 3HXLA 5CPRB 4BXUA 4I2OA 3P9CA 2CS3A 3U21A 2LBFB 4ESFA 4F55A 1QHHD 2W25A 2W84A 5K5RA 4Z2YA 2CMPA 1YW7A 1WJEA 3BR3A 3KP2A 3OYFA 2I8DA 2CW0F 2DA3A 1SAUA 4LB5A 1J59A 2IBDA 5F64A 2BV6A 3OOUA 3E6DA 1Y39A 1VQ6I 4CCNA 1IRXA 2NYXA 1C0WA 2XAQA 1T2KA 2XAFA 1W5TA 4XNFA 2RNJA 3RKYA 4ENMA 3K4CA 4F93B 1XTAA 5KHDA 4CYDA 2LP0A 1Z7UA 3DU5A 2K85A 4X0GA 3D1NI 3TGNA 2WB1A 2H1LA 1LQ1A 2DA4A 2D2WA 2RREA 3OSFA 2V1DA 3WTWC 3W6VA 3D5RC 2P5KA 3SFZA 3CQZJ 3SFIA 3ZMZA 4FETA 1RNLA 4E7JA 4HNUA 4I6ZA 1IXSB 2B9SA 3CUQC 4V19K 1UZCA 1OLTA 4UVBA 2KISA 4PJMA 1PUFA 3E0JB 3ZQHA 2EB7A 4U7BA 4N4NB 4UUSA 2PN6A 3KCCA 2JMWA 1WGXA 4KIFA 3E6BA 3R0AA 1MDMA 2OZ6A 3BPVA 2YU3A 2CUZA 4M9XA 1UELB 4OIOF 1MBKA 4PJNA 1E2XA 1NK2P 3BG9A 4QPQA 5EEHA 2W48A 3GFJA 2E1MB 4MFEA 2ISYA 2A6TA 2R7WA 2VASA 1JXSA 3I5UA 1IV6A 1YRNB 1XGNA 4CGZA 2L7KA 2HYGD 3ELKA 1YI2I 1MKMA 1ITYA 2CJJA 3WGIA 5M5XJ 4GRIA 4KDPA 3H5AA 1YJNI 4YFNF 2LRDA 4UB6C 3GFIA 3AFHA 5HDGA 1NTCA 2HFHA 1WI3A 2LTPA 4XOPA 3GVAA 2OTLI 2L9VA 4AIHA 3UKGA 5ED4A 4YFKF 2Z16A 2LD5A 3N4MA 4QWQA 4RAYA 2WAFA 3BC8A 3DBRB 4BQAA 3D0SA 5JVTA 2B0LA 3H9QA 3JW4A 2ZBKA 3MKWB 1F1ZA 2X6YA 3BTJA 3EUAA 4XK4A 4KT6A 1G3TA 1RPWA 3E1SA 2XSDC 3CTAA 2WTEA 2CFXA 5GAEJ 1ZN2A 1K78B 1BI1A 2OF7A 3JSOA 2NVTJ 1IRFA 2R93J 3N05A 1HF0A 2HGCA 4HV5A 2F5FA 1QPMA 3T8TA 4EVIA 2R7ZJ 3SJMA 3W2VA 3O8HA 5DS9A 1S7EA 3L00A 3GMEA 3TP0A 3GZ6A 2DU9A 4KNYA 2IPQX 1HKQA 1STZA 1V4RA 2E1OA 3FIWA 3AL0B 4ENKA 1J5YA 1F5TA 4ZDLA 1SFXA 1TWFJ 2JN6A 3ML6A 3Q0WA 3ROUA 4G7HF 2DK8A 2X9DA 1T8IA 2DXIA 2XASA 4HOBA 3JRFA 4CHUA 2MG4A 2LFBA 1G4DA 3BQYA 5B3SH 4I76A 4CCMA 3M4OJ 1O7LA 2UXXA 1FIAA 4BJTA 2CQQA 1ONVA 3PL8A 2L4MA 3FBIB 3PIPF 2VLAA 2WV0A 4U0YA 2E34A 1T56A 4V2FA 1VNDA 5FD5A 1U5TA 3VB2A 1ETQA 4LLGF 3K0LA 2KKOA 2MLKA 1D0YA 2EQRA 3V8LA 2CGPA 2QSHX 1K83J 2BY1A 3G1MA 1OKRA 3U9GA 2W1OA 1P4AA 4MFDA 2VPLA 1BN5A 3J81K 2H27A 3FZVA 2DJNA 5CLSA 4XKVA 4P9UA 2HU9A 3A4CA 4A5NA 4KFCA 2JA7J 2CQNA 2Q2EB 2GZWA 4HX8A 1V3FA 4C30A 5IYCJ 1T95A 2WB1N 2A61A 3CCLI 4I01A 5ICCA 5IPAA 4Q4ZF 4JP0A 2CU7A 2ZKZA 1F36A 2ME0A 2BVLA 2R7RA 4ZC3A 4ETSA 3H5RA 1VQPI 5KAIC 2IP2A 3C1DA 4WCGA 1MNDA 1L3LA 4MGRA 1ETVA 2QUFA 3E5XA 3M8FA 1S5LC 3K4BA 1HDDC 3A01A 2Y2ZA 2O03A 4QLCU 4L18B 1GV5A 3SZTA 3S32A 4IZZA 3ZGKA 4BBSJ 3HRUA 2LF7A 2K5CA 4MNUA 4HEA2 2COBA 3K1PA 3HM5A 3HZJA 1TT0A 2D1VA 1FOKA 2HWVA 2BVMA 4XLHA 2ZXHA 1BL0A 1ZRFA 4AIJA 4F91B 1EH8A 1CF7B 4R79A 1FYKA 3Q9SA 2O9LA 2VQHA 3P9IA 4OWRB 4I98B 1YE9A 2ZXIA 2M7AA 5HS8A 1FBQA 2ME6A 2KJBA 1LJ9A 3R4KA 3C2GA 5D4RA 3W2AA 1X3UA 1YQAA 2PI0A 4NDLA 1P9QC 2COMA 4A3CJ 3MCZA 1MSEC 1LDKB 3GTOJ 2XUBA 3DEEA 2PQ8A 2Y48A 3BY6A 3K69A 4HLXA 4XORA 3ZMDA 2XC7A 2XAJA 3ABLH 1WSUA 5E3MA 4KT5C 1JGSA 4A6DA 4D5CA 2BW3B 2YX4A 3PUBA 3OYDA 3A2KA 3GTQJ 4AC0A 2A5YB 2VC1A 4XSXF 3I4NJ 3B6CA 2K3FA 1G3YA 1W7PA 2V6CA 3A0HC 5D5XB 3L9FA 3OYAA 3S14J 3L2WA 5J1YA 2LG4A 2YSRA 1J0RA 2OU2A 2BXYA 5K7HA 3HHHA 1WJCA 4BY1J 4W97A 2NOJB 4ENNA 2EH3A 4I09A 3GTJJ 5F0CA 1B4AA 1VQKI 4E7ZA 3LSHA 2STWA 1IC8A 2HQRA 1R58A 2UV1A 4HG2A 3LSKA 1QVUA 3BG5A 2DFIA 1QQIA 1BOBA 2H94A 3FHZA 1J2XA 4A6EA 1KU7A 3HOSA 4ZDOA 5B66C 4BHBA 4CUGA 1FTZA 1VFCA 5DD4A 3SXYA 3RTRA 3RJPA 1U78A 3I4PA 1XMAA 3CCUI 2DMUA 5J3LA 3HB9A 2VT3A 2IJLA 1FOYA 1Z9CA 3OYJA 2DMQA 1K4TA 3HPGA 5F1JA 2NVQJ 1QZYA 3IKVA 2FMLA 2Q8KA 1A6QA 4U0WA 3IV5A 1R9TJ 2ECBA 3F8MA 1UG0A 3D5SC 1OYIA 5E18F 3RPQA 4EQQA 3KETA 3KZZA 1JE8A 1LNWA 3OL3A 2E60A 4L9TA 1O7FA 4V2GA 2VOPA 1RIOH 2DAOA 4C3HJ 3GTGJ 2IRFG 2DN0A 3MD2A 2PMUA 2ZNYA 4UHTA 5EDNA 1MMSA 1LFUP 2EILH 4ZYDA 2EBIA 1MMDA 3CDIA 2HDCA 2F4IA 2M2EA 2CV2A 3PFYA 2JSPA 5E1WA 3GTLJ 2LKSA 2UUZA 5TGTA 3FXRA 1DQUA 3GZNB 4HAMA 4MQVA 3VPRA 2JVHA 4A3DJ 4B44A 4MEYF 2Z1DA 2X6OA 3QP5A 4ENJA 4CZCA 3E7LA 4OMZA 5J4VA 1UFMA 5DYMA 5L3DA 2KQRA 4HDVA 3HOUJ 5J8CA 4G12A 4DZPA 1WI9A 2XKOA 1JTXA 5M5YJ 2AHQA 1NK3P 2OAZA 1P4XA 9ANTA 1SFOJ 4J19A 3AG4H 4AWXB 1JKOC 2R7DA 2GM4A 3MVPA 5F0HA 5C44J 3VSLA 1IRGA 1AA7A 1FBSA 1U5TC 2MH9A 2YR2A 4RM3A 2F2EA 4PJLA 1S8NA 2JA6J 3P5JA 2WC2A 2HXIA 5ILVA 5EG0A 3ZRGA 2D1HA 2WBMA 3TDUC 2ZCWA 3BR2A 1DP3A 1WCMJ 2LR8A 3RKXA 1WQ2A 3EETA 4NC8A 2XV4S 1XS9A 2HYJA 2MD0A 4HNTA 1ZR4A 1IGNA 2LREA 3W6KB 2VC0A 3WE2A 1A36A 1Y56A 1T33A 2IEKA 3GTMJ 2IXSA 3CUQA 3GFMA 2LSOA 1R5GA 2L9NA 4E70A 2BZTA 3T1BA 4ZZLA 1RI7A 2QQ8A 4ABZA 3WHBA 3M9AA 4OOIA 4LG0A 1B6AA 3S2DJ 2ZMEA 3S93A 4IHXA 3H5NA 5CKTA 2HQNA 2LK2A 5CQGA 4LK0F 3OS2A 2P6SA 3FMSA 1FPQA 5L3BA 5IT9K 2QM3A 4X6AJ 2K4BA 3I9V2 4XN0A 1MSFC 1T08B 4CCKA 1JT0A 3QU6A 2ELJA 3RCOA 3AKZA 4GDFA 3BT9A 1ZHFA 5M3FJ 3OYCA 2DT5A 1XG1A 1MJ9A 1B8IA 3M1EA 1XGSA 5LEJA 4L9JA 5F04A 4IHSA 3V7CA 4NUBA 2HVQA 3A1YA 3MAJA 4A12A 3FK6A 3PFIA 3LAPA 3L2CA 1IAWA 5IP7J 1FLIA 3Q3SA 1ZG1A 4BEHA 3CCRI 2QBYA 3RQ4A 5FO5A 1JJ8C 1Z77A 3WTZA 5J40A 1U2WA 2A69F 4L5JA 4BJ6C 4I7HA 3HGYA 1A31A 3W3CA 1VQ5I 1DPUA 1GUUA 4IQJA 5C3EJ 2NVYJ 2PEXA 1EF4A 3SZPA 3V4GA 3BDDA 3HUGB 3DCFA 3EUHA 1O3TA 3IKTA 1YX3A 1X3ZB 1KZHA 3DU6A 3VYRB 2ZSHB 1SD4A 1U3EM 4CZZA 1H88C 3M07A 3RZOJ 2GXGA 3IAS2 2X51A 1VQ9I 4B3AA 1LEAA 1Y6IA 2EIMH 1DUXC 4A3KJ 2DFFA 4HW0A 1VQ8I 3ZPLA 2X6XA 2VKEA 4E7KA 2H09A 4BU2A 3J7ZI 3S1RJ 2KFDA 1N77A 3J7AO 1ULYA 4B3XA 2LY2A 4BDZA 2AXLA 3SDGA 1GT0C 5DCMB 4FX0A 5DTDA 5CVVA 2XAGA 3I54A 2HOSA 3GW2A 2NVUB 3WG7H 2XHKA 3HOZJ 4AUXA 3H0DA 3JRHA 1Y1VJ 1U8RA 1MBHA 1VQ7I 4A69C 2E36A 1Z21A 4EJUA 2QYOA 4XOTA 2HKOA 3PJRA 5LD2C 2V4JC 3FXOA 1V5GA 1IXRC 1R5HA 3ESWB 2DCEA 3KZIC 3DTKA 4AM3A 3E3VA 3CJTB 3U1KA 3S3NA 3B02A 4IOAF 3E6CC 1R4MB 4BHPA 4B47A 1AKHA 1P4WA 5HLIA 2ZC2A 4P55A 4XICA 3OV8A 2CG4A 3BR1A 2X6WA 3HSEA 2MD5A 4QIWN 2CW7A 4XRSA 3FXLA 2G0EA 4L0YB 2K9LA 2K9QA 2ID6A 1D3YA 3TKYA 3J7AY 1A6IA 2QLZA 4CYCA 1MJAA 2X0LA 2D45A 1GXPA 1OQYA 3GFLA 1IG7A 2FX0A 2QCOA 2XROA 3FK7A 2HPMA 2DDBA 2HS5A 3OOPA 2FOWA 3NWSA 4BUPA 1I1SA 3HKZA 2P7VB 1CGPA 4NQWA 1I6HJ 1ZKGA 4XM3A 3BG7A 3OYEA 4M3BA 4YG2F 4RA2A 1Y0NA 4YEJA 5FKNA 4AIDA 1W7PD 4HX4A 3KP7A 3PQKA 2IA0A 5D5UB 2DPUA 1QO0D 4M73A 4Y4RA 2XB5A 4CSWA 2F6CA 2Z3YA 2LH9A 4XKBA 2A07F 4BQQA 2GA2A 1T0FA 2M5WA 2HKXA 4C3JJ 4FTHA 1UG2A 3WTTC 2JUGA 5JHUA 1H89C 2KDOA 4L9VA 4UNOA 1XX5A 2BOLA 3WHCA 3MN2A 1ORKA 4I02A 5LHHA 3IHUA 3WTXC 3IH3A 2ESHA 4HQMA 4CCJA 3WE3A 1RC9A 4LJZF 3S16J 2HTJA 2EZLA 2CQXA 3H9JA 4G94A 2ETHA 4AVZA 5LRRA 3IRRA 3JRCA 1PUFB 5JLXA 1Z6TA 1P7IA 1Q1VA 2DYSH 2HOEA 3ECOA 3MZ8A 5GAHJ 1BW6A 3JAMK 4HV6A 5HS9A 3E5QA 4AD9A 1R5ID 3K70D 2V9KA 3QYBA 4BQOA 1KU3A 1SEUA 2R0QC 1D1CA 1QVTA 4F52A 1MMAA 1RETA 2V1UA 4Y7NJ 1IV8A 3HRTA 5EGOA 2IAIA 4BY7J 3JRDA 3Q0VA 4JOMA 2HZTA 4EATA 4BS9A 3FKJA 2LDUA 5C4JJ 4U7DA 4OINF 3ZN0A 4IHWA 5H2FC 4XIDA 1HW1A 3G71I 1LUJB 3BR6A 5AIPA 3HOTA 3ZQGA 2M4KA 2BY2A 3IL2A 2JJ7A 2ZJPF 3TOBA 3I53A 2EA2A 4FX4A 3CLOA 5HNFA 1MMNA 1P2FA 1HXDA 4JK1X 2H8WA 4KITB 3MKZA 3OYMA 2M8GX 2P81A 3RPUD 3ABTA 1TWCJ 1WJFA 5BPIA 2DPDA 4ANJA 1O3RA 1X2NA 1RR7A 3LSPA 4N9IA 4NC6A 2HNHA 1X1PA 4BE0A 2LF8A 2XB0X 3ONQA 3CZ6A 2ZMEC 1U8BA 4PSXA 4P9FA 3CCSI 1M1EB 2DQLA 2M3AA 4A93J 4KMUX 3PSIA 5HDNA 1LB2A 5DEQA 1D0XA 2A6EF 2P0WA 3FM5A 4Q5SF 3KP3A 3VSKA 2ZB9A 2XGXA 4FISA 4UB8C 4DYRA 1SFEA 2DT7B 1D5YA 4L5IA 2OC6A 4HX7A 1KGSA 2CO5A 3GEZA 4HNVA 3QPSA 3FXUA 1N78A 1U9OA 4ZJZA 2O5RA 4ZYEA 3HTSB 3K1NA 3TW6A 5JI6A 2LBFA 4KN7X 5E3OA 2FXAA 3REOA 2XRLA 2ECCA 4Y3OA 3KLOA 4MHGA 3MMYB 3SEQA 3LA2A 2KJCA 4M3FA 2L54A 1HC8A 3H1CA 3H36A 1WKMA 2JRTA 2CWEA 3TDZC 2RDPA 1FEXA 2FSWA 1FNNA 1CQTA 3K7AJ 1GXQA 1MMGA 4LK1F 1XDUA 4ZYGA 2X1EA 2V26A 3DV8A 3R0JA 2VQLA 3EUHC 2ZNZA 5IYBJ 5EZGA 3F72A 1X19A 4IX7A 3I58A 1IUFA 3QOEA 1A04A 4E7IA 3HKZN 2OTJI 1U5TB 2CYYA 2A5WA 4MTDA 2VB6A 4Q48A 2GOXB 2ELHA 5JVGF 2HVRA 3M8JA 4M9SA 1Z3YA 2DFEA 1A5JA 5H6RA 3HPHA 2GA1A 4YFXF 3MWMA 3IWZA 5E3NA 1QPIA 2QSGX 1IZ1A 2V79A 2KZGA 5D8LB 5ILSA 4A0YA 3FBNB 3JCUC 2XGCA 3QYEA 2CUEA 1X4PA 2PJRA 3F22A 1R1UA 3KZYA 2YUSA 4PZJA 2XVCA 4RAZA 2G9WA 3PO3J 1E17A 5BQTA 4C2MJ 2WAQA 2NS7A 1I50J 5B5EC 1XMKA 2VT2A 1VZ0A 5JR3A 5H20A 4YIFA 2E5ZA 3B73A 5FKOA 4DQ2A 3KX2A 2EJRA 3CCMI 1AHDP 3VYSB 1Y8QB 3H0GJ 3JSPA 1W1WE 2HQ5A 1BIAA 4ZTJA 2FBKA 2DTZA 3MQ0A 2ICWG 3BCAA 3FX3A 4B09A 4X1EA 2EK5A 5CVRA 3A01B 3SZGA 3S8PA 3F8BA 5FFZA 3GX4X 4UUVA 2EWNA 2EFWA 1YRNA 1ZGWA 3QAHA 4ZYHA 3OIOA 3OMYA 3I59A 4XKWA 1PYVA 3L2UA 4WXDA 1J9IA 1V5EA 1JGGA 1R1VA 1OCRH 2HPIA 3TO7A 3V8KA 2KDZA 2P5LC 2GXBA 2TDXA 3BP8A 1I6XA 2GIZA 1XDSA 2AQFA 2MA3A 2A68F 3W6JB 2DO7A 1U0JA 3H3VK 4EV0A 3LNQA 1ZG3A 2BGCA 3CCVI 1OPCA 1LDDA 2VJ4A 3KE2A 4RGXA 2V6EA 2R7SA 2QQ9A 1SD6A 1T0FC 3ZMTA 3MEXA 3C3WA 3G73A 2L02A 2K02A 1TZLA 1GLNA 5CYVA 5IOYA 5KNLA 1DU0A 2FE3A 2L3DA 3CP2A 5FD6A 2BY3A 1ON1A 1XPXA 1K78A 1S6LA 4P1WA 1IN7A 1UHSA 1JHHA 2QWWA 3NWTA 4C3IJ 3F6OA 2HTSA 2IGKA 3GBGA 3WGGA 1YW8A 4CXFA 5AONA 2ZFWA 3I56I 1OYWA 1UMQA 2F5EA 1ODDA 1BI2A 4RGSA 1FSEA 3DXJF 4Y17A 3S3MA 5FRNA 4IHVA 2FJ1A 2FU4A 1Z0XA 2MGQA 1S9HA 2ZXWH 1HCRA 3HC7A 4O5VA 3DPLC 4M74A 2A3SA 5L3EA 4M9ZA 2FMYA 2DOEA 1YS6A 2VPRA 2W24A 3BLYA 5EYRA 3IH4A 4G7ZF 2PJPA 2VXDA 1SFUA 2I10A 5FKMA 2E7WA 2KL4A 4BAYA 3O3KA 3KYLA 2MC4A 1OR7A 5EF6A 2WAEA 4LB6B 1VF9A 4ESBA 4ZTFA 4AVPA 5LLQA 4S04A 2YU9J 3W2WA 3OYBA 2M30A 5TISC 1E3PA 2HXOA 2QA4I 2IA2A 4WF2A 2RAEA 3RSNA 3GTPJ 3JTGA 3J81Z 3CC2I 3HGGA 4B43A 3GO5A 5ICFA 3HG9A 2K9NA 2PMZA 2Q1ZB 1W0TA 2ACJA 1D0ZA 1R71A 2JA8J 1QZZA 2EV0A 2UZKA 4A3BJ 2ZFUA 2V9VA 4DOZA 1OJLA 2M0MA 3KP6A 4UVAA 5LHIA 2DLLA 1YLFA 4B8XA 4BL0B 2GXAA 1X1CA 3G4SI 1S3JA 3CCJI 3LOCA 2JUCA 4PGHA 2F48A 1ETOA 5M5WJ 2WAQN 3CLQA 3FXMA 1YJWI 3CJQB 3K4KA 1Z05A 4D5FA 4DJAA 5ICGA 5B1AH 2ZO4A 2QZ8A 4DBQA 3OYGA 2UWMA 2JTVA 5L3FA 4S0HB 2R5YB 4FE4A 2HEOA 4C9YA 4UV8A 2DQRA 3RYPA 2R5ZB 2VI6A 4R8HA 3K2AA 4QSHA 4UUTA 3ZMUA 3L7WA 4BGDA 2Z9OA 1EV7A 1CF7A 5F6FA 2OUMA 1I5ZA 3WTSC 3CD6I 2HQAA 4W1UA 5E20A 1MD0A 5K1YA 1HW5A 3H3UA 2EFPA 2X4HA 2DMNA 1ETYA 1TQPA 4CH7A 1YS7A 3HEFA 2CV1A 1KONA 4A3LJ 3B6AA 5L3CA 1WJDA 1OFCX 3Q5FA 1HSJA 2XKPA 2VQGA 3KIOA 3ZR8X 2MW8A 2DA1A 1D8KA 1GDTA 2E2IJ 1EH6A 3JREA 1MBJA 3DF8A 1MH3A 1TWHJ 2AXTC 3EUKL 3GXOA 2NOGA 4WXCA 4LFUA 3AG1H 1SC7A 1PVEA 3OYNA 5IOZA 1BM9A 2KIQA 2FRHA 2PBIA 1KYZA 1BI0A 5ERIA 3CUQB 2NVXJ 1ZK8A 1K4SA 3I3LA 3WTYC 1WH5A 2V1XA 1R7JA 4A3MJ 4A5MA 3HYIA 4P5OA 4KJZA 4A0ZA 4LG0B 2ZMEB 3V7SA 2DT6A 2ADUA 2L5QA 3S1MJ 3QP6A 2G7UA 3F8FA 4PSWA 4U87A 3F3XA 2JQ7A 2R7XA 5D8KB 4DIQA 3R61A 3EQLF 3VOEA 2IGMA 2Z2SB 4IF4A 4XN3A 3FF5A 2RQQA 2E1MC 5CVIA 3RYRA 3IWFA 1PUEE 4IRHA 2KPMA 1G59A 1Z6RA 3SQNA 2JPBA 3K4JA 2YPRA 4ASNA 5BNGA 5E8GA 4IKFA 3AAFA 2XGEA 1OCCH 1LKXA 2VBZA 3TQNA 3DQVC 4D7NA 4O6JA 4BHCA 4NNJA 3MKYB 2JRMA 3TBIA 3CDHA 2MABA 3S2HJ 2XIGA 5E1ZB 3VODA 5FGMA 1KYWA 5GP9A 1WVRA 1FWZA 1N25A 4LIUA 3HOYJ 2IS2A 1OCZH 2HVSA 1EA3A 4RGUA 1R00A 3K6GA 1F43A 1BC8C 1XSVA 1HKSA 4HF2A 3OIQA 5K7ZA 3NQOA 2PG4A 4IL6C 2L7FP 4D9JA 1G3WA 4BXXJ 4M71A 2EV6A 1K6OA 2RGVA 2PMZN 5DUKA 4XONA 2FNPA 1T98A 1J75A 2R7UA 2JK3A 2XAHA 4KICA 1SANA 1ZREA 4KMFA 3HSRA 3CMYA 2DBBA 5FJ8J 2OV7A 3RZDJ 2LMDA 1ZQ3P 5IP9J 3SDBA 5HS7A 3BROA 2BE5F 3DTEA 3LMMA 4IOCF 3NARA 2UXNA 1YFHA 2PFBA 3KP4A 2AQEA 3AL0C 2QQBA 3LWFA 1LE8A 1FZPB 2DTRA 3HJEA 2VBYA 4EM2A 5E1XA 1J7KA 3BG6A 1H8AC 4Y13A 1K79A 4E7HA 3JRGA 1MBFA 2K27A 1POGA 2WA0A 3CCYA 2RV8A 4FE7A 3O2PE 3OWTA 1XSDA 3FMRA 5LGNA 3L2QA 1YOVB 1AKHB 3H35A 3S3OA 1Q1HA 1ZTRA 2FQ4A 2M4GA 5FRMA 3BQZA 3EYYA 3HSFA 1UHWA 2GAUA 1B72B 1OR7C 1WFXA 1FSHA 1BIBA 3HRSA 4HRIA 4IJAA 2K9MA 3LSGA 2IGNA 4KIBA 1MBEA 3OS1A 1NHAA 2OQGA 4G9YA 3G1LA 5D5VB 5FB2A 1W36C 3ASNH 1HQCA 1TLHB 2IGOA 1VQLI 2TRTA 2HOAA 3MZYA 1G6NA 3UNGC 3AG3H 5LHGA 2EFNA 4NQWB 2K9SA 1UJ8A 2F5VA 5F1RA 3WTVC 2CSOA 3OYKA 2VKVA 3ABKH 2VONA 2XGDA 1ZLJA 5BPDA 5C4XJ 1TW2A 2R7OA 4G6DA 2E1CA 3VYUB 5E8IA 4EM1A 2ISZA 3CF2A 1JKRC 1I27A 4KA4A 1KU2A 3ABMH 1Y1WJ 5FROA 3HDDA 2XDVA 4XLFA 4IPAA 2B63J 4G8XA 3RDIA 3GUDA 1JT6A 1Z7LA 2E1NA 4L0ZB 2X48A 1ZELA 4I99C 4EGZA 5FLXK 1ZRDA 2QQAA 2L2OA 1YO5C 1REPC 5LBQA 3S1NJ 2X85A 4HSRA 4U0VA 5IT9Z 2Y0SA 3LSTA 4EGYA 4JQFA 1PP8F 3MKLA 4RB0A 3PNYA 1JUPA 3EDPA 4E6KG 2IA1A 2Z33A 4HDUA 2H8RA 2EV5A 2VODA 4RAGA 5KCMA 1Z67A 3Q0UA 1LPQA 1YYVA 4HQEA 2CUFA 3P9KA 2DOFA 5L3GA 2KIFA 1IXCA 5BMZA 3E6MA 4OMYA 4HPQA 3JRIA 4EEFG 1JUSA 5TRDA 1YHQI 2CQ7A 2EIJH 3WU0A 3WODF 3ZXSA 4LGWA 2DODA 2DI3A 3BR5A 2LY1A 4XL9A 1APLC 1AOYA 2DA7A 1TWGJ 1FMWA 2WADA 3KPHA 1T39A 1XC5A 1NG7A 1BJAA 4BYYA 3KEQA 5GTHC 4ON0A 1P7JA 2OD5A 3ULQB 3CUOA 1PDNC 1XN7A 1HW2A 2XPVA 3F9KA 4G7OF 1GVDA 4PJ0C 3KFWX 1TC3C 5DCMA 2P7CB 1ETWA 2XF7A 2XRNA 3BJ6A 4IXAA 1JTYA 2D5VA 4HF1A 1IDZA 1JKPC 4IEJA 1YTYA 3OR1C 2KIUA 1FT9A 2KRFA 4UUSB 1DGRM 1K6YA 2FEZA 1A35A 2A05A 2RC4A 3EPZA 3LAJA 1IUYA 3CMMA 3OL4A 1MDMB 1VI0A 3ZN1A 2M1BA 2AS5F 4XLAA 5CQEA 2NS0A 4R1HA 5FLXZ 3HOVJ 4CICA 1R22A 1WJAA 5HDKA 3PNVA 4E4HA 4D0PA 1K7AA 3K4MA 1QRYA 4OIPF 2K86A 2R7QA 4A2UA 4L5EA 5J4YA 1TL8A 4LD5A 3K9TA 4IO9F 3I64A 5HLTA 2P6TA 6PAXA 1LFPA 2HDDA 2PMHA 1RKWA 4BXFA 1B9NA 5EEGA 3T0YA 1HA8A 2EIKH 1RUNA 4MTEA 3GLXA 4GFBA 3LSJA 4GYIA 4C2TA 4A3IJ 2JPCA 1I3QJ 2E19A 3CJRB 2Y9ZA 2ZSIB 3NEUA 3KEYA 2M45A 4YELA 3ZQLA 1HDPA 4OIQF 1BI3A 1USSA 4RAFA 3TOAA 2XPUA 3FM3A 5A2QK 4RBOA 1YIOA 4Y52J 2FQ3A 4HF0A 1TBXA 3CO7C 3FKIJ 1ZR2A 1MNEA 2NXNB 1FX7A 3BCBA 3R60A 2R7VA 2ESNA 5K7FA 4PFPA 4CCOA 2DK5A 2OPTA 2ZJQF 3TO6A 4A3GJ 2J5OA 2GIVA 5TJJA 1HKTA 3QYFA 2KRHA 3ZCOA 4LLLA 3ZQFA 4RB1A 1N75A 3F0CA 1WJ5A 2VE9A 3CP8A 4GGGA 4M3DA 3J80K 2XSJC 2R7TA 1TT5B 5E79C 4IVNA 3V42A 2L7ZA 2PJRB 1MZBA 1MBGA 3CMAI 1R6RA 4PUSA 1D8JA 4AYBA 4EM0B 2O0YA 4RB3C 3FISA 3M8EA 2Y0SN 2Y0MA 1WHUA 2LYCA 3C18A 3DKXA 4ZDPA 1U9NA 3LA7A 5BOXA 5GPCA 2LVSA 2ELKA 1I39A 2MFZA 2YX7A 2QSFX 3JAMZ 1FY7A 1MW7A 3ZQIA 2CH0A 1R49A 3LL7A 1XD7A 3CCQI 3OIPA 1W5CC 3FXQA 3ZP5A 3FMQA 1I1GA 3JRAA 4A3JJ 4HSTA 4DYQA 2STTA 2M9HA 4RMNA 3GTKJ 3QOPA 3CC4I 3I0TA 4M3GA 3ECHA 3BWGA 3IP4B 5E3LA 4EJTA 2QENA 5GTIC 2KRCA 3I59B 1IN6A 3M7GA 5HVQC 1Z91A 2DYRH 2DFHA 5J8FA 4KIGA 2HZDA 1TTYA 2EINH 2NNNA 3ZMSA 2DJIA 5D4SA 2CFOA 1FP2A 2CRGA 3DWLE 1L0OC 4G6QA 5M3MJ 4UV9A 2NAZA 5HODA 1FOXA 1G2HA 4ZH4F 4XRSG 3I71A 4XLEA 3CO6C 3M3YJ 2GQQA 1K61A 4D7MA 3QODA 1IDYA 2KIMA 4BNCA 1HSTA 3CDLA 4RS8A 1H0MA 3WG9A 2VOOA 4PGGA 2V1NA 5A2QZ 1KA8A 2EA4A 2L01A 1OMIA 3CESA 1P92A 4XLNF 4XLPF 3KYDB 4FT8A 1U6GA 1NG6A 2FNAA 4DNCA 1DP7P 4JBAA 3IUOA 4Q47A 5E17F 2QGUA 5DM7F 4B4CA 1BOAA 3L2VA 5CVJA 5HLGA 5JLWA 1RUOA 4OIRF 1BC7C 1O57A 2JA2A 3S1QJ 3VDXA 3BG3A 2CW8A 4NB5A 1DU6A 3JRBA 3J80Z 1QHGA 3WU1B 3TW7A 5DD8A 4EMSA 3BZ6A 1FIPA 1TW3A 3DPTA 1KQ8A 2EPFA 3LSIA 4UVCA 2DA2A 4MLOA 1W5SA 2WV1A 4LOCA 4N4OB 4BKXA 2P5VA 4WXHA 3HOWJ 2MC3A 2JVGA 3DP7A 3GLLA 3SYTA 3GCMA 2Z99A 4KN4X 1BR4A 2G7HA 4FQGA 5FLVA 1YG2A 3S17J 1SMTA 1I3AA 2WWYA 2L4AA 3J7YJ 1PP7U 1F4KA 3OS0A 2BHZA 1YITI 4GO1A 3DBHB 5J6XA 1IF1A 5JHFA 2H6BA 4MQ9F 1BR1A 3F6VA 4GXOA 4HYEA 3K4LA 4F92B 1ETKA 1OCOH 4BE2A 2W82A 3HHGA 2E7XA 1FJLA 2EZIA 2EZHA 1R1TA 1D5VA 4E7SA 2BBYA 2Y31A 1B1BA 1SVOA 1AU7A 1W7PB 3ZQQA 2TCTA 2OBPA 2K7LA 5JFRA 4YIRX 1X3WB 2BHYA 2KLOA 3WTUC 4A0XA 1TQIA 3S2WA 2L7MP 3LFKA 1E3HA 5J1UA 5DM6F 1Z3XA 1ERDA 2IS6A 1FOWA 1OISA 1QBJA 3QPHA 3IRQA 2I5UA 4LITA 5F08A 4KYWA 5ICEA 4PK4A 4OAYA 3UR3C 2VL8A 4AYBN 1E3OC 4BACA 2FA5A 2O61A 3IH2A 2EZKA 3HBLA 3OYIA 5CJ9A 1JHFA 1XGOA 4XKCA 4ZZDA 1R23A 1MIJA 5GADJ 3MFKA 1XCBA 1V55H 4DGWB 3H92A 2A6HF 2F5CA 1VQ4I 4BDYA 2KMUA 2M7BA 2W85A 2M8EA 4DYCA 3N97A 2FF4A 3G2BA 3DFGA 1RESA 1FBUA 2M0CA 2Q0OA 3TEDA 4MO7A 1X58A 4IQ4A 3C7JA 1ZYRF 2E71A 1FMVA 2Q2EA 1TNSA 3DEUA 4GCVA 4J00A 2JT1A 2MYSA 2AO9A 5HLHA 3DKWA 2EFQA 2W57A 4PDKA 4XRFA 3I55I 1SD7A 2M34A 1IO2A 4L9NA 4MIMA 4IRGA 2RVCA 3JR9A 2IS4A 3RKQA 1VQNI 2L9RA 4DZJA 1IJWC 3BR0A 3PM1A 2XF5A 4YRVA 2W7NA 3L09A 1HBXG 4YIIA 3C2HA 3F8CA 2E5NA 4ESJA 1OCTC 3BZKA 1ON2A 4Y33A 4PJJA 3BTCA 4HA8A 1LVKA 1MGTA 2CUJA 3FDYA 3T8RA 3ERED 1DPRA 4HZFA 4LLNA 4RLQA 1Z1DA 1OCPA 3AG2H 4J01A 5AIQA 3FWEA 5LEKA 5GAGJ 3V7RA 1DGWY 1XMXA 1ZGAA 1RR8C 2PLYA 3R6SA 3TP3A 1TQMA 1LEBA 4NBQA 3D5LA 1SVMA 5BS6A 5J1RA 3HIFA 5FFXA 2FUG2 3OSGA 1JI8A 1ENHA 1SAXA 1Y8RB 2JA5J 3GWZA 4NC7A 2NS8A 3F21A 1RZ4A 1HOMA 5FKKA 1X2MA 4BJ5C 1RKTA 4XMYA 2E35A 4XRMA 2F4OB 5ILUA 3G3ZA 2HDWA 1MH4A 5EZHA 4H0EA 5DDGA 5K5OA 4M6VA 3GF2A 1SMYF 1WPKA 2CV0A 4A3FJ 2W00A 2VJJA 3BTIA 3HL2A 4JX4A 1JJ6C 2VJ5A 4HBLA 5EG0B 4IHYA 3PQJA 4M72A 2GLOA 2BW3A 4KISA 3BTLA 5IP6A 1BR2A 1FYLA 5IY5H 5FLMJ 1UB9A 1B59A 1IW7F 2BYVE 5KAFC 3GZ5A 3NAUA 1YW9A 3TMOA 1O3SA 1BW5A 4N0BA 4B1RA 1JKQC 5GPAA 2OCCH 2OJED 2E2JJ 4BQNA 4OU0A 1ZLKA 3JTHA 1LDJA 3F23A 4BE1A 1B9MA 2QVOA 1XB4A 3QWLA 5H6QA 2DW4A 3BJOA 3RPUA 4M6YA 3H9GA 4UXNA 4KUMA 1S7AA 1VQMI 2DDAA 5F0FA 3V8JA 5D5WB 4U88A 2F5DA 1FP1D 4TV7A 2NRAC 4JYKA 3O8GA 2QF7A 3VEPA 5HOOA 4O3MA 2Y30A 2DOAA 4LIVA 2QEXI 2R5YA 1X1DA 3T5XA 3KYCB 3RIRA 3PNTA 1B8IB 3RI4A 2RKHA 2R5ZA 2XPWA 2VBWA 3BPXA 3ZQCA 4E7LA 2GBYA 1MJBA 1SD5A 1LE8B 4UY8I 4DBRA 2VN2A 2WY7Q 1BBYA 2NNYA 2C6YA 3IAM2 2VBXA 4BEHB 4F7ZA 2QBYB 3FXKA 2RQPA 1IN5A 1WJBA 3DLAA 1FTTA 3A02A 1D1AA 1H9GA 3OYLA 1EH7A 1T38A 3O6BB 3CC7I 2BXZA 4CA0A 4JX6A 1ZARA 5B1BH 1D1BA 4XBFA 1TWAJ 4K2EA 4CCLA 5EEAA 4QTRA 3C2BA 4ZYAA 4XQFA 3DEWA 3DPUA 1SFKA 2FBIA 2K3PA 2VUMJ 4OAZA 1KQ0A 1Y0UA 2QKLB 3VWBA 1VQOI 3BOQA 4I0BA 4XSZF 1S72I 3K1MA 4RB2C 3PSFA 1MNMC 2OQRA 4N9HA 2VJIA 1J09A 3ISPA 3OY9A 1LFBA 1QA6A 3CJNA 2N8GA 2KHMA 2L0KA 3PO2J 4P96A 4RGRA 1WH7A 4AIKA 3IC7A 1E0EA 1QNTA 3DKYA 4EJOA 3EYIA 2O6GE 2PX9A 2JZYA 2EFOA 1P6RA 1W4MA 4HLYA 2MH2A 2L9SA 3ZOBA 3SHFA 4PCQA 4G6TB 1EJ9A 2DA5A 1BA5A 2KT0A 4AU7A 3LQQA 4NHJA 2Y9YA 2FOKA 1JUMA 1FC3A 3TO9A 4M6XA 2ZXJA 3A0BC 4H4KC 2VQCA 2GWRA 1XGMA 2K40A 2O3FA 3SEZA 3WGHA 4LMYA 2DA6A 2LLKA 2ID3A 4RDUA 2HI3A 5IYDJ 2GOMA 2HYFA 3K4NA 3RQIA 3G6EI 4DW6A 4ITVA 2IW5A 3RKWA 2IT0A 2O8KA 1WWXA 1LVAA 2OZUA 2R3SA 3BJAA 4B48A 2H1KA 2E2HJ 1ZRCA 1GHCA 2JWTA 4C2UA 1O3QA 3ERMA 2K4JA 2DMTA 3DLLF 1AWCA 4CYCB 2LKPA 3E97A 3HTUA 2W4SA 4WWCA 5LGTA 2ZJRF 3GYHX 1R36A 3CMEI 2Y69H 1XCVA 4QPOA 3QRFF 2LOOA 2VKDA 1USTA 2HOTA 4IRIA 1OYYA 1QGPA 4EJVA 5DCFA 2P4WA 3F8NA 3OR2C 4FASD 1X4OA 1YIJI 5IT3A 5FKLA 4A3EJ 2F4MB 1IRZA 1X1AA 3LQRA 3BZCA 3PIOF 4LG3A 5LRSA 3ASOH 4M3EA 3HOXJ 2Z5UA 5EJCA 3M1CA
chains in the Genus database with same CATH topology
1F9NA 1TNTA 2O8XA 2MBFA 1UHMA 1KQ9A 4WX9A 5KVRA 2HR3A 3H3ZA 1KU9A 2VE8A 3P7NA 4I0AA 4CO8A 2IVMA 3KLNA 5DUIA 5D6FA 5LGUA 1FYMA 4Y15A 3COAC 2JSCA 5K5QA 2ZJ2A 3ZMVA 3Q9VA 1IN8A 3HUGA 2R7FA 1IN4A 4GYGA 3NRVA 4IHTA 3K2ZA 2CQKA 2VXZA 3QPTA 5CVUA 4EJWA 1XSXA 3ZQ7A 1ZGJA 3LA3A 4CDGA 1S7OA 3ABUA 3KEOA 3U2RA 1S29A 4FHTA 1ZH5A 5KK1A 2H6CA 1UCRA 3MZHA 2FBHA 1G3SA 2M87A 1T6SA 1H9TA 5D6EA 2LNBA 2MLGA 5DV5A 1ZAOA 2Y75A 1DDNA 1VTNC 3E5UA 1GVJA 3HRMA 4MEXF 3VFZA 3KP5A 2RN7A 2OA4A 2BEOA 4BH9A 3U1DA 4WK8F 3QU3A 1WRJA 1ZG5A 2J5PA 4S05A 2P8TA 4BXUA 4I2OA 3P9CA 4ESFA 5K5RA 2W25A 2W84A 4Z2YA 1YW7A 3KP2A 2CW0F 4LB5A 1J59A 5F64A 2BV6A 3E6DA 2NYXA 1C0WA 2XAQA 1T2KA 2XAFA 1W5TA 2RNJA 3RKYA 4ENMA 4CYDA 1Z7UA 3TGNA 1LQ1A 2D2WA 2V1DA 3WTWC 2P5KA 3SFZA 3ZMZA 1RNLA 1IXSB 3CUQC 4UVBA 2EB7A 4U7BA 2PN6A 3KCCA 4KIFA 3E6BA 3R0AA 1MDMA 2OZ6A 3BPVA 2YU3A 4M9XA 4OIOF 1E2XA 5EEHA 3GFJA 2ISYA 1JXSA 3I5UA 1XGNA 4CGZA 2HYGD 3ELKA 1MKMA 3WGIA 4KDPA 4YFNF 3GFIA 5HDGA 2HFHA 3GVAA 4AIHA 5ED4A 4YFKF 3N4MA 4QWQA 4RAYA 4BQAA 3D0SA 5JVTA 2B0LA 3JW4A 2ZBKA 1F1ZA 1G3TA 3CTAA 2WTEA 2CFXA 1ZN2A 1K78B 1BI1A 3JSOA 1IRFA 2HGCA 4HV5A 2F5FA 1QPMA 3T8TA 4EVIA 3L00A 3GZ6A 2DU9A 4KNYA 2IPQX 1HKQA 1STZA 1V4RA 4ENKA 1J5YA 1F5TA 1SFXA 3ML6A 3ROUA 4G7HF 2DK8A 4CHUA 2XASA 4HOBA 1G4DA 1O7LA 2UXXA 1ONVA 2L4MA 2WV0A 4U0YA 5FD5A 3VB2A 1U5TA 4LLGF 3K0LA 2KKOA 2MLKA 2CGPA 3V8LA 1OKRA 3U9GA 1P4AA 1BN5A 3J81K 2H27A 3FZVA 5CLSA 4P9UA 4A5NA 4KFCA 2GZWA 4HX8A 1V3FA 2A61A 4I01A 5ICCA 4Q4ZF 2ZKZA 4ETSA 2IP2A 3C1DA 4WCGA 1L3LA 4MGRA 2QUFA 3E5XA 3M8FA 2O03A 4QLCU 4L18B 3SZTA 3HRUA 2LF7A 4MNUA 3K1PA 2D1VA 1FOKA 2HWVA 1ZRFA 4AIJA 1EH8A 1CF7B 4R79A 1FYKA 3Q9SA 3P9IA 4I98B 5HS8A 1FBQA 2KJBA 1LJ9A 3R4KA 5D4RA 1X3UA 1YQAA 2PI0A 2COMA 3MCZA 1LDKB 2XUBA 2PQ8A 2Y48A 3BY6A 3K69A 4HLXA 3ZMDA 2XAJA 1WSUA 4KT5C 1JGSA 4A6DA 2YX4A 2A5YB 2VC1A 4XSXF 1G3YA 1W7PA 2V6CA 5D5XB 3L9FA 2YSRA 1J0RA 2OU2A 3HHHA 4ENNA 4I09A 1B4AA 2STWA 2HQRA 1R58A 2DFIA 1QQIA 2H94A 3FHZA 1J2XA 4A6EA 1KU7A 3HOSA 4BHBA 5DD4A 3SXYA 3RTRA 3RJPA 1U78A 3I4PA 1XMAA 2VT3A 2IJLA 1Z9CA 1QZYA 3IKVA 2FMLA 2Q8KA 4U0WA 3F8MA 1OYIA 5E18F 3RPQA 4EQQA 3KETA 3KZZA 1JE8A 1LNWA 4L9TA 1O7FA 2VOPA 1RIOH 2DAOA 2IRFG 2PMUA 2ZNYA 4UHTA 4ZYDA 2HDCA 5E1WA 3FXRA 4HAMA 4MQVA 4MEYF 3QP5A 4ENJA 4OMZA 1UFMA 5DYMA 5L3DA 4HDVA 5J8CA 1WI9A 2XKOA 2OAZA 1P4XA 4AWXB 2R7DA 1IRGA 1FBSA 1U5TC 2MH9A 2YR2A 2F2EA 1S8NA 2WC2A 5ILVA 2D1HA 3TDUC 2ZCWA 3RKXA 1WQ2A 3EETA 2XV4S 3W6KB 2VC0A 3WE2A 3CUQA 3GFMA 2LSOA 1R5GA 4E70A 3T1BA 4ZZLA 1RI7A 3M9AA 4OOIA 4LG0A 1B6AA 2ZMEA 2HQNA 4LK0F 2P6SA 3FMSA 1FPQA 5L3BA 5IT9K 2QM3A 2K4BA 3QU6A 1ZHFA 2DT5A 1MJ9A 3M1EA 1XGSA 5LEJA 4L9JA 4IHSA 3V7CA 3MAJA 4A12A 3PFIA 3LAPA 3L2CA 1IAWA 1FLIA 1ZG1A 2QBYA 5FO5A 3WTZA 1U2WA 2A69F 4L5JA 4I7HA 1DPUA 2PEXA 3SZPA 3V4GA 3BDDA 3EUHA 1O3TA 3IKTA 1SD4A 1U3EM 4CZZA 2GXGA 1LEAA 1DUXC 4HW0A 3ZPLA 2H09A 3J7AO 1ULYA 2AXLA 5DCMB 4FX0A 5CVVA 2XAGA 3I54A 3GW2A 2XHKA 1U8RA 4EJUA 2QYOA 2HKOA 1IXRC 1R5HA 3E3VA 3B02A 3E6CC 4BHPA 1P4WA 5HLIA 4P55A 3OV8A 2CG4A 3HSEA 2MD5A 4L0YB 1D3YA 3TKYA 2QLZA 1MJAA 2X0LA 2D45A 1GXPA 3GFLA 2XROA 2HS5A 3OOPA 1I1SA 2P7VB 1CGPA 4NQWA 4YG2F 1W7PD 4HX4A 3KP7A 3PQKA 2IA0A 5D5UB 2DPUA 1QO0D 4M73A 2Z3YA 2A07F 2GA2A 1T0FA 2M5WA 2HKXA 3WTTC 5JHUA 4L9VA 4UNOA 4I02A 5LHHA 3IHUA 3WTXC 2ESHA 4HQMA 3WE3A 4LJZF 2HTJA 4G94A 2ETHA 5LRRA 3IRRA 1Z6TA 2HOEA 3ECOA 3JAMK 4HV6A 5HS9A 3E5QA 4AD9A 1KU3A 2V1UA 3HRTA 2HZTA 2LDUA 4U7DA 4OINF 3ZN0A 1HW1A 3HOTA 5AIPA 3IL2A 3TOBA 3I53A 2EA2A 4FX4A 3CLOA 1P2FA 1HXDA 4JK1X 3ABTA 5BPIA 2DPDA 1O3RA 4N9IA 2LF8A 4P9FA 2DQLA 4KMUX 5HDNA 1LB2A 5DEQA 2A6EF 3FM5A 4Q5SF 3KP3A 2XGXA 1SFEA 4L5IA 4HX7A 1KGSA 2CO5A 3GEZA 3FXUA 3HTSB 4ZYEA 3K1NA 5JI6A 4KN7X 2FXAA 3REOA 3KLOA 4MHGA 3LA2A 2KJCA 2L54A 1WKMA 2JRTA 2CWEA 3TDZC 2RDPA 2FSWA 1FNNA 1GXQA 4LK1F 1XDUA 4ZYGA 3DV8A 3R0JA 2ZNZA 3F72A 3I58A 1A04A 1U5TB 2CYYA 4MTDA 4Q48A 2ELHA 4M9SA 5H6RA 2GA1A 4YFXF 3MWMA 3IWZA 1IZ1A 2V79A 5D8LB 5ILSA 4A0YA 3F22A 1R1UA 3KZYA 4PZJA 2XVCA 4RAZA 2G9WA 1E17A 5BQTA 5JR3A 1XMKA 2VT2A 5H20A 4YIFA 3B73A 4DQ2A 2EJRA 3JSPA 1BIAA 2FBKA 3MQ0A 3FX3A 4B09A 2EK5A 5CVRA 3F8BA 5FFZA 3GX4X 4UUVA 2EWNA 2EFWA 3QAHA 4ZYHA 3I59A 4WXDA 1J9IA 1R1VA 3TO7A 3V8KA 2P5LC 2GXBA 2TDXA 3BP8A 1I6XA 1XDSA 2MA3A 2A68F 3W6JB 2DO7A 4EV0A 1ZG3A 2BGCA 1OPCA 1LDDA 3KE2A 4RGXA 2QQ9A 1SD6A 3ZMTA 3MEXA 3C3WA 3G73A 2L02A 2K02A 5CYVA 2FE3A 2L3DA 5FD6A 1ON1A 1K78A 1S6LA 1IN7A 1JHHA 2QWWA 3F6OA 2HTSA 3WGGA 1YW8A 4CXFA 5AONA 2ZFWA 1OYWA 2F5EA 1ODDA 1BI2A 4RGSA 1FSEA 3DXJF 4Y17A 2FU4A 4O5VA 3DPLC 4M74A 2A3SA 5L3EA 4M9ZA 2FMYA 1YS6A 2W24A 4G7ZF 2PJPA 1SFUA 2E7WA 4BAYA 3O3KA 1OR7A 4LB6B 4ESBA 4AVPA 5LLQA 4S04A 2M30A 2IA2A 4WF2A 3JTGA 3J81Z 3GO5A 5ICFA 2ACJA 1QZZA 2EV0A 2UZKA 2V9VA 3KP6A 4UVAA 5LHIA 2DLLA 1YLFA 4B8XA 1S3JA 4PGHA 1Z05A 5ICGA 2ZO4A 2QZ8A 2UWMA 2JTVA 5L3FA 2HEOA 4UV8A 2DQRA 3RYPA 4R8HA 3ZMUA 3L7WA 2Z9OA 1EV7A 1CF7A 5F6FA 1I5ZA 3WTSC 5E20A 1MD0A 5K1YA 1HW5A 3H3UA 2EFPA 2X4HA 1TQPA 1YS7A 5L3CA 3Q5FA 1HSJA 2XKPA 1D8KA 1EH6A 3DF8A 3GXOA 4WXCA 4LFUA 1BM9A 2FRHA 2PBIA 1KYZA 1BI0A 5ERIA 3CUQB 3WTYC 2V1XA 1R7JA 4A5MA 3HYIA 4P5OA 4A0ZA 4LG0B 2ZMEB 3V7SA 2ADUA 3QP6A 2G7UA 3F8FA 3F3XA 5D8KB 3R61A 3EQLF 3VOEA 4IF4A 3FF5A 5CVIA 3RYRA 3IWFA 1PUEE 4IRHA 1Z6RA 3SQNA 2JPBA 2YPRA 4ASNA 5E8GA 3AAFA 2VBZA 3TQNA 3DQVC 4O6JA 4BHCA 3CDHA 2XIGA 5E1ZB 3VODA 5FGMA 1KYWA 1FWZA 4RGUA 1R00A 1BC8C 1XSVA 1HKSA 4HF2A 3NQOA 2PG4A 1G3WA 4M71A 2EV6A 1K6OA 2RGVA 5DUKA 2FNPA 1T98A 1J75A 2XAHA 4KICA 1ZREA 4KMFA 3HSRA 2DBBA 5HS7A 3BROA 2BE5F 2UXNA 1YFHA 2PFBA 3KP4A 2QQBA 3LWFA 1FZPB 2DTRA 2VBYA 4EM2A 5E1XA 1J7KA 4Y13A 1K79A 2K27A 2RV8A 3O2PE 1XSDA 3FMRA 5LGNA 1Q1HA 3EYYA 3HSFA 1UHWA 2GAUA 1FSHA 1BIBA 3HRSA 4IJAA 4KIBA 1NHAA 2OQGA 4G9YA 5D5VB 5FB2A 1HQCA 1TLHB 3MZYA 1G6NA 5LHGA 2EFNA 3WTVC 5F1RA 2CSOA 2VONA 1ZLJA 5BPDA 1TW2A 4G6DA 2E1CA 5E8IA 4EM1A 2ISZA 1I27A 4KA4A 1KU2A 4IPAA 4G8XA 3RDIA 3GUDA 4L0ZB 2E1NA 4EGZA 5FLXK 1ZRDA 2QQAA 1YO5C 1REPC 5LBQA 4U0VA 5IT9Z 4EGYA 3LSTA 4JQFA 1PP8F 4RB0A 3EDPA 2IA1A 2Z33A 4HDUA 2EV5A 2VODA 1YYVA 4HQEA 3P9KA 5L3GA 2KIFA 1IXCA 5BMZA 3E6MA 4OMYA 5TRDA 3WU0A 3WODF 4LGWA 2DI3A 1AOYA 1T39A 1BJAA 4BYYA 3KEQA 4ON0A 2OD5A 3ULQB 3CUOA 1PDNC 1XN7A 1HW2A 4G7OF 3KFWX 5DCMA 2P7CB 2XRNA 3BJ6A 4IXAA 4HF1A 1YTYA 2KIUA 1FT9A 2KRFA 2FEZA 2RC4A 3LAJA 1IUYA 1MDMB 3ZN1A 2M1BA 2AS5F 2NS0A 4R1HA 5FLXZ 4CICA 1R22A 5HDKA 4D0PA 1K7AA 4OIPF 2K86A 4A2UA 4LD5A 3K9TA 3I64A 2P6TA 6PAXA 2PMHA 1B9NA 5EEGA 3T0YA 1RUNA 4MTEA 3GLXA 4GYIA 2JPCA 3NEUA 2M45A 4OIQF 1BI3A 1USSA 3TOAA 3FM3A 5A2QK 1YIOA 2FQ3A 4HF0A 1TBXA 3CO7C 1FX7A 3R60A 2ESNA 2DK5A 3TO6A 2J5OA 2GIVA 5TJJA 1HKTA 4RB1A 4LLLA 2VE9A 4GGGA 3J80K 4IVNA 1MZBA 1D8JA 4EM0B 2O0YA 4RB3C 3M8EA 2Y0MA 3C18A 3LA7A 5BOXA 2YX7A 3JAMZ 1FY7A 1XD7A 3FXQA 3ZP5A 3FMQA 1I1GA 2STTA 3QOPA 3I0TA 3ECHA 3BWGA 4EJTA 2QENA 3I59B 1IN6A 3M7GA 5HVQC 1Z91A 5J8FA 4KIGA 1TTYA 2NNNA 3ZMSA 5D4SA 1FP2A 1L0OC 4G6QA 4UV9A 2NAZA 4ZH4F 3I71A 3CO6C 2GQQA 4BNCA 2KIMA 1HSTA 4RS8A 1H0MA 3WG9A 2VOOA 4PGGA 5A2QZ 1KA8A 2EA4A 2L01A 1OMIA 1P92A 4XLNF 4XLPF 4FT8A 1U6GA 2FNAA 4DNCA 1DP7P 4JBAA 4Q47A 5E17F 1BOAA 5CVJA 5HLGA 1RUOA 4OIRF 1BC7C 1O57A 4NB5A 3J80Z 3WU1B 5DD8A 4EMSA 3BZ6A 1TW3A 3DPTA 1KQ8A 4UVCA 1W5SA 2P5VA 4WXHA 2MC3A 3DP7A 2Z99A 4KN4X 2G7HA 1YG2A 1SMTA 2WWYA 2L4AA 1PP7U 1F4KA 4GO1A 5J6XA 1IF1A 2H6BA 4MQ9F 3F6VA 4GXOA 4HYEA 3HHGA 2E7XA 1R1TA 1D5VA 2BBYA 1B1BA 1W7PB 2OBPA 2K7LA 5JFRA 3WTUC 4A0XA 1TQIA 3S2WA 3LFKA 1QBJA 3QPHA 3IRQA 4KYWA 5ICEA 2FA5A 2O61A 5CJ9A 1JHFA 1XGOA 4ZZDA 1R23A 3MFKA 1XCBA 3H92A 2A6HF 2F5CA 2W85A 2M8EA 3N97A 2FF4A 3DFGA 1FBUA 2Q0OA 3C7JA 1ZYRF 2Q2EA 3DEUA 4GCVA 1TNSA 2JT1A 5HLHA 3DKWA 2EFQA 2W57A 4PDKA 4XRFA 1SD7A 4L9NA 4IRGA 2RVCA 3L09A 1HBXG 4YIIA 3F8CA 4ESJA 1ON2A 4HA8A 1MGTA 3T8RA 3ERED 1DPRA 4HZFA 4LLNA 1Z1DA 5AIQA 3FWEA 5LEKA 3V7RA 1ZGAA 2PLYA 3R6SA 1TQMA 1LEBA 3D5LA 5BS6A 3HIFA 5FFXA 1SAXA 3GWZA 3F21A 1RZ4A 5ILUA 3G3ZA 4H0EA 5DDGA 5K5OA 3GF2A 1SMYF 4HBLA 3PQJA 4M72A 1FYLA 1UB9A 1B59A 1IW7F 2BYVE 3GZ5A 1YW9A 1O3SA 4N0BA 4OU0A 1ZLKA 3JTHA 1LDJA 3F23A 1B9MA 2QVOA 1XB4A 5H6QA 2DW4A 3BJOA 3RPUA 4M6YA 4UXNA 4KUMA 1S7AA 3V8JA 5D5WB 4U88A 2F5DA 1FP1D 4TV7A 2NRAC 3VEPA 5HOOA 4O3MA 3T5XA 3RIRA 3RI4A 2RKHA 2VBWA 3BPXA 1MJBA 1SD5A 2VN2A 1BBYA 2NNYA 2C6YA 2VBXA 4F7ZA 2QBYB 2RQPA 1IN5A 1H9GA 1EH7A 1T38A 3O6BB 1ZARA 4XBFA 4K2EA 2FBIA 1KQ0A 1Y0UA 3BOQA 4I0BA 4XSZF 3K1MA 4RB2C 2OQRA 4N9HA 3ISPA 3CJNA 4P96A 4RGRA 4AIKA 3IC7A 1QNTA 4EJOA 3EYIA 2O6GE 2JZYA 2EFOA 1P6RA 1W4MA 4HLYA 2MH2A 3SHFA 4PCQA 3LQQA 4NHJA 2FOKA 1FC3A 3TO9A 4M6XA 2ZXJA 2GWRA 1XGMA 2O3FA 3WGHA 4LMYA 2HYFA 2IW5A 3RKWA 2IT0A 1WWXA 1LVAA 2OZUA 2R3SA 3BJAA 1ZRCA 1GHCA 1O3QA 2K4JA 1AWCA 2LKPA 3E97A 3HTUA 4WWCA 5LGTA 3GYHX 1R36A 1XCVA 3QRFF 1USTA 4IRIA 1OYYA 1QGPA 4EJVA 5DCFA 2P4WA 3F8NA 5IT3A 3LQRA 5LRSA 2Z5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9N A;  1TNT A;  2O8X A;  2MBF A;  1UHM A;  1KQ9 A;  4WX9 A;  5KVR A;  2HR3 A;  3H3Z A;  1KU9 A;  2VE8 A;  3P7N A;  4I0A A;  4CO8 A;  2IVM A;  3KLN A;  5DUI A;  5D6F A;  5LGU A;  1FYM A;  4Y15 A;  3COA C;  2JSC A;  5K5Q A;  2ZJ2 A;  3ZMV A;  3Q9V A;  1IN8 A;  3HUG A;  2R7F A;  1IN4 A;  4GYG A;  3NRV A;  4IHT A;  3K2Z A;  2CQK A;  2VXZ A;  3QPT A;  5CVU A;  4EJW A;  1XSX A;  3ZQ7 A;  1ZGJ A;  3LA3 A;  4CDG A;  1S7O A;  3ABU A;  3KEO A;  3U2R A;  1S29 A;  4FHT A;  1ZH5 A;  5KK1 A;  2H6C A;  1UCR A;  3MZH A;  2FBH A;  1G3S A;  2M87 A;  1T6S A;  1H9T A;  5D6E A;  2LNB A;  2MLG A;  5DV5 A;  1ZAO A;  2Y75 A;  1DDN A;  1VTN C;  3E5U A;  1GVJ A;  3HRM A;  4MEX F;  3VFZ A;  3KP5 A;  2RN7 A;  2OA4 A;  2BEO A;  4BH9 A;  3U1D A;  4WK8 F;  3QU3 A;  1WRJ A;  1ZG5 A;  2J5P A;  4S05 A;  2P8T A;  4BXU A;  4I2O A;  3P9C A;  4ESF A;  5K5R A;  2W25 A;  2W84 A;  4Z2Y A;  1YW7 A;  3KP2 A;  2CW0 F;  4LB5 A;  1J59 A;  5F64 A;  2BV6 A;  3E6D A;  2NYX A;  1C0W A;  2XAQ A;  1T2K A;  2XAF A;  1W5T A;  2RNJ A;  3RKY A;  4ENM A;  4CYD A;  1Z7U A;  3TGN A;  1LQ1 A;  2D2W A;  2V1D A;  3WTW C;  2P5K A;  3SFZ A;  3ZMZ A;  1RNL A;  1IXS B;  3CUQ C;  4UVB A;  2EB7 A;  4U7B A;  2PN6 A;  3KCC A;  4KIF A;  3E6B A;  3R0A A;  1MDM A;  2OZ6 A;  3BPV A;  2YU3 A;  4M9X A;  4OIO F;  1E2X A;  5EEH A;  3GFJ A;  2ISY A;  1JXS A;  3I5U A;  1XGN A;  4CGZ A;  2HYG D;  3ELK A;  1MKM A;  3WGI A;  4KDP A;  4YFN F;  3GFI A;  5HDG A;  2HFH A;  3GVA A;  4AIH A;  5ED4 A;  4YFK F;  3N4M A;  4QWQ A;  4RAY A;  4BQA A;  3D0S A;  5JVT A;  2B0L A;  3JW4 A;  2ZBK A;  1F1Z A;  1G3T A;  3CTA A;  2WTE A;  2CFX A;  1ZN2 A;  1K78 B;  1BI1 A;  3JSO A;  1IRF A;  2HGC A;  4HV5 A;  2F5F A;  1QPM A;  3T8T A;  4EVI A;  3L00 A;  3GZ6 A;  2DU9 A;  4KNY A;  2IPQ X;  1HKQ A;  1STZ A;  1V4R A;  4ENK A;  1J5Y A;  1F5T A;  1SFX A;  3ML6 A;  3ROU A;  4G7H F;  2DK8 A;  4CHU A;  2XAS A;  4HOB A;  1G4D A;  1O7L A;  2UXX A;  1ONV A;  2L4M A;  2WV0 A;  4U0Y A;  5FD5 A;  3VB2 A;  1U5T A;  4LLG F;  3K0L A;  2KKO A;  2MLK A;  2CGP A;  3V8L A;  1OKR A;  3U9G A;  1P4A A;  1BN5 A;  3J81 K;  2H27 A;  3FZV A;  5CLS A;  4P9U A;  4A5N A;  4KFC A;  2GZW A;  4HX8 A;  1V3F A;  2A61 A;  4I01 A;  5ICC A;  4Q4Z F;  2ZKZ A;  4ETS A;  2IP2 A;  3C1D A;  4WCG A;  1L3L A;  4MGR A;  2QUF A;  3E5X A;  3M8F A;  2O03 A;  4QLC U;  4L18 B;  3SZT A;  3HRU A;  2LF7 A;  4MNU A;  3K1P A;  2D1V A;  1FOK A;  2HWV A;  1ZRF A;  4AIJ A;  1EH8 A;  1CF7 B;  4R79 A;  1FYK A;  3Q9S A;  3P9I A;  4I98 B;  5HS8 A;  1FBQ A;  2KJB A;  1LJ9 A;  3R4K A;  5D4R A;  1X3U A;  1YQA A;  2PI0 A;  2COM A;  3MCZ A;  1LDK B;  2XUB A;  2PQ8 A;  2Y48 A;  3BY6 A;  3K69 A;  4HLX A;  3ZMD A;  2XAJ A;  1WSU A;  4KT5 C;  1JGS A;  4A6D A;  2YX4 A;  2A5Y B;  2VC1 A;  4XSX F;  1G3Y A;  1W7P A;  2V6C A;  5D5X B;  3L9F A;  2YSR A;  1J0R A;  2OU2 A;  3HHH A;  4ENN A;  4I09 A;  1B4A A;  2STW A;  2HQR A;  1R58 A;  2DFI A;  1QQI A;  2H94 A;  3FHZ A;  1J2X A;  4A6E A;  1KU7 A;  3HOS A;  4BHB A;  5DD4 A;  3SXY A;  3RTR A;  3RJP A;  1U78 A;  3I4P A;  1XMA A;  2VT3 A;  2IJL A;  1Z9C A;  1QZY A;  3IKV A;  2FML A;  2Q8K A;  4U0W A;  3F8M A;  1OYI A;  5E18 F;  3RPQ A;  4EQQ A;  3KET A;  3KZZ A;  1JE8 A;  1LNW A;  4L9T A;  1O7F A;  2VOP A;  1RIO H;  2DAO A;  2IRF G;  2PMU A;  2ZNY A;  4UHT A;  4ZYD A;  2HDC A;  5E1W A;  3FXR A;  4HAM A;  4MQV A;  4MEY F;  3QP5 A;  4ENJ A;  4OMZ A;  1UFM A;  5DYM A;  5L3D A;  4HDV A;  5J8C A;  1WI9 A;  2XKO A;  2OAZ A;  1P4X A;  4AWX B;  2R7D A;  1IRG A;  1FBS A;  1U5T C;  2MH9 A;  2YR2 A;  2F2E A;  1S8N A;  2WC2 A;  5ILV A;  2D1H A;  3TDU C;  2ZCW A;  3RKX A;  1WQ2 A;  3EET A;  2XV4 S;  3W6K B;  2VC0 A;  3WE2 A;  3CUQ A;  3GFM A;  2LSO A;  1R5G A;  4E70 A;  3T1B A;  4ZZL A;  1RI7 A;  3M9A A;  4OOI A;  4LG0 A;  1B6A A;  2ZME A;  2HQN A;  4LK0 F;  2P6S A;  3FMS A;  1FPQ A;  5L3B A;  5IT9 K;  2QM3 A;  2K4B A;  3QU6 A;  1ZHF A;  2DT5 A;  1MJ9 A;  3M1E A;  1XGS A;  5LEJ A;  4L9J A;  4IHS A;  3V7C A;  3MAJ A;  4A12 A;  3PFI A;  3LAP A;  3L2C A;  1IAW A;  1FLI A;  1ZG1 A;  2QBY A;  5FO5 A;  3WTZ A;  1U2W A;  2A69 F;  4L5J A;  4I7H A;  1DPU A;  2PEX A;  3SZP A;  3V4G A;  3BDD A;  3EUH A;  1O3T A;  3IKT A;  1SD4 A;  1U3E M;  4CZZ A;  2GXG A;  1LEA A;  1DUX C;  4HW0 A;  3ZPL A;  2H09 A;  3J7A O;  1ULY A;  2AXL A;  5DCM B;  4FX0 A;  5CVV A;  2XAG A;  3I54 A;  3GW2 A;  2XHK A;  1U8R A;  4EJU A;  2QYO A;  2HKO A;  1IXR C;  1R5H A;  3E3V A;  3B02 A;  3E6C C;  4BHP A;  1P4W A;  5HLI A;  4P55 A;  3OV8 A;  2CG4 A;  3HSE A;  2MD5 A;  4L0Y B;  1D3Y A;  3TKY A;  2QLZ A;  1MJA A;  2X0L A;  2D45 A;  1GXP A;  3GFL A;  2XRO A;  2HS5 A;  3OOP A;  1I1S A;  2P7V B;  1CGP A;  4NQW A;  4YG2 F;  1W7P D;  4HX4 A;  3KP7 A;  3PQK A;  2IA0 A;  5D5U B;  2DPU A;  1QO0 D;  4M73 A;  2Z3Y A;  2A07 F;  2GA2 A;  1T0F A;  2M5W A;  2HKX A;  3WTT C;  5JHU A;  4L9V A;  4UNO A;  4I02 A;  5LHH A;  3IHU A;  3WTX C;  2ESH A;  4HQM A;  3WE3 A;  4LJZ F;  2HTJ A;  4G94 A;  2ETH A;  5LRR A;  3IRR A;  1Z6T A;  2HOE A;  3ECO A;  3JAM K;  4HV6 A;  5HS9 A;  3E5Q A;  4AD9 A;  1KU3 A;  2V1U A;  3HRT A;  2HZT A;  2LDU A;  4U7D A;  4OIN F;  3ZN0 A;  1HW1 A;  3HOT A;  5AIP A;  3IL2 A;  3TOB A;  3I53 A;  2EA2 A;  4FX4 A;  3CLO A;  1P2F A;  1HXD A;  4JK1 X;  3ABT A;  5BPI A;  2DPD A;  1O3R A;  4N9I A;  2LF8 A;  4P9F A;  2DQL A;  4KMU X;  5HDN A;  1LB2 A;  5DEQ A;  2A6E F;  3FM5 A;  4Q5S F;  3KP3 A;  2XGX A;  1SFE A;  4L5I A;  4HX7 A;  1KGS A;  2CO5 A;  3GEZ A;  3FXU A;  3HTS B;  4ZYE A;  3K1N A;  5JI6 A;  4KN7 X;  2FXA A;  3REO A;  3KLO A;  4MHG A;  3LA2 A;  2KJC A;  2L54 A;  1WKM A;  2JRT A;  2CWE A;  3TDZ C;  2RDP A;  2FSW A;  1FNN A;  1GXQ A;  4LK1 F;  1XDU A;  4ZYG A;  3DV8 A;  3R0J A;  2ZNZ A;  3F72 A;  3I58 A;  1A04 A;  1U5T B;  2CYY A;  4MTD A;  4Q48 A;  2ELH A;  4M9S A;  5H6R A;  2GA1 A;  4YFX F;  3MWM A;  3IWZ A;  1IZ1 A;  2V79 A;  5D8L B;  5ILS A;  4A0Y A;  3F22 A;  1R1U A;  3KZY A;  4PZJ A;  2XVC A;  4RAZ A;  2G9W A;  1E17 A;  5BQT A;  5JR3 A;  1XMK A;  2VT2 A;  5H20 A;  4YIF A;  3B73 A;  4DQ2 A;  2EJR A;  3JSP A;  1BIA A;  2FBK A;  3MQ0 A;  3FX3 A;  4B09 A;  2EK5 A;  5CVR A;  3F8B A;  5FFZ A;  3GX4 X;  4UUV A;  2EWN A;  2EFW A;  3QAH A;  4ZYH A;  3I59 A;  4WXD A;  1J9I A;  1R1V A;  3TO7 A;  3V8K A;  2P5L C;  2GXB A;  2TDX A;  3BP8 A;  1I6X A;  1XDS A;  2MA3 A;  2A68 F;  3W6J B;  2DO7 A;  4EV0 A;  1ZG3 A;  2BGC A;  1OPC A;  1LDD A;  3KE2 A;  4RGX A;  2QQ9 A;  1SD6 A;  3ZMT A;  3MEX A;  3C3W A;  3G73 A;  2L02 A;  2K02 A;  5CYV A;  2FE3 A;  2L3D A;  5FD6 A;  1ON1 A;  1K78 A;  1S6L A;  1IN7 A;  1JHH A;  2QWW A;  3F6O A;  2HTS A;  3WGG A;  1YW8 A;  4CXF A;  5AON A;  2ZFW A;  1OYW A;  2F5E A;  1ODD A;  1BI2 A;  4RGS A;  1FSE A;  3DXJ F;  4Y17 A;  2FU4 A;  4O5V A;  3DPL C;  4M74 A;  2A3S A;  5L3E A;  4M9Z A;  2FMY A;  1YS6 A;  2W24 A;  4G7Z F;  2PJP A;  1SFU A;  2E7W A;  4BAY A;  3O3K A;  1OR7 A;  4LB6 B;  4ESB A;  4AVP A;  5LLQ A;  4S04 A;  2M30 A;  2IA2 A;  4WF2 A;  3JTG A;  3J81 Z;  3GO5 A;  5ICF A;  2ACJ A;  1QZZ A;  2EV0 A;  2UZK A;  2V9V A;  3KP6 A;  4UVA A;  5LHI A;  2DLL A;  1YLF A;  4B8X A;  1S3J A;  4PGH A;  1Z05 A;  5ICG A;  2ZO4 A;  2QZ8 A;  2UWM A;  2JTV A;  5L3F A;  2HEO A;  4UV8 A;  2DQR A;  3RYP A;  4R8H A;  3ZMU A;  3L7W A;  2Z9O A;  1EV7 A;  1CF7 A;  5F6F A;  1I5Z A;  3WTS C;  5E20 A;  1MD0 A;  5K1Y A;  1HW5 A;  3H3U A;  2EFP A;  2X4H A;  1TQP A;  1YS7 A;  5L3C A;  3Q5F A;  1HSJ A;  2XKP A;  1D8K A;  1EH6 A;  3DF8 A;  3GXO A;  4WXC A;  4LFU A;  1BM9 A;  2FRH A;  2PBI A;  1KYZ A;  1BI0 A;  5ERI A;  3CUQ B;  3WTY C;  2V1X A;  1R7J A;  4A5M A;  3HYI A;  4P5O A;  4A0Z A;  4LG0 B;  2ZME B;  3V7S A;  2ADU A;  3QP6 A;  2G7U A;  3F8F A;  3F3X A;  5D8K B;  3R61 A;  3EQL F;  3VOE A;  4IF4 A;  3FF5 A;  5CVI A;  3RYR A;  3IWF A;  1PUE E;  4IRH A;  1Z6R A;  3SQN A;  2JPB A;  2YPR A;  4ASN A;  5E8G A;  3AAF A;  2VBZ A;  3TQN A;  3DQV C;  4O6J A;  4BHC A;  3CDH A;  2XIG A;  5E1Z B;  3VOD A;  5FGM A;  1KYW A;  1FWZ A;  4RGU A;  1R00 A;  1BC8 C;  1XSV A;  1HKS A;  4HF2 A;  3NQO A;  2PG4 A;  1G3W A;  4M71 A;  2EV6 A;  1K6O A;  2RGV A;  5DUK A;  2FNP A;  1T98 A;  1J75 A;  2XAH A;  4KIC A;  1ZRE A;  4KMF A;  3HSR A;  2DBB A;  5HS7 A;  3BRO A;  2BE5 F;  2UXN A;  1YFH A;  2PFB A;  3KP4 A;  2QQB A;  3LWF A;  1FZP B;  2DTR A;  2VBY A;  4EM2 A;  5E1X A;  1J7K A;  4Y13 A;  1K79 A;  2K27 A;  2RV8 A;  3O2P E;  1XSD A;  3FMR A;  5LGN A;  1Q1H A;  3EYY A;  3HSF A;  1UHW A;  2GAU A;  1FSH A;  1BIB A;  3HRS A;  4IJA A;  4KIB A;  1NHA A;  2OQG A;  4G9Y A;  5D5V B;  5FB2 A;  1HQC A;  1TLH B;  3MZY A;  1G6N A;  5LHG A;  2EFN A;  3WTV C;  5F1R A;  2CSO A;  2VON A;  1ZLJ A;  5BPD A;  1TW2 A;  4G6D A;  2E1C A;  5E8I A;  4EM1 A;  2ISZ A;  1I27 A;  4KA4 A;  1KU2 A;  4IPA A;  4G8X A;  3RDI A;  3GUD A;  4L0Z B;  2E1N A;  4EGZ A;  5FLX K;  1ZRD A;  2QQA A;  1YO5 C;  1REP C;  5LBQ A;  4U0V A;  5IT9 Z;  4EGY A;  3LST A;  4JQF A;  1PP8 F;  4RB0 A;  3EDP A;  2IA1 A;  2Z33 A;  4HDU A;  2EV5 A;  2VOD A;  1YYV A;  4HQE A;  3P9K A;  5L3G A;  2KIF A;  1IXC A;  5BMZ A;  3E6M A;  4OMY A;  5TRD A;  3WU0 A;  3WOD F;  4LGW A;  2DI3 A;  1AOY A;  1T39 A;  1BJA A;  4BYY A;  3KEQ A;  4ON0 A;  2OD5 A;  3ULQ B;  3CUO A;  1PDN C;  1XN7 A;  1HW2 A;  4G7O F;  3KFW X;  5DCM A;  2P7C B;  2XRN A;  3BJ6 A;  4IXA A;  4HF1 A;  1YTY A;  2KIU A;  1FT9 A;  2KRF A;  2FEZ A;  2RC4 A;  3LAJ A;  1IUY A;  1MDM B;  3ZN1 A;  2M1B A;  2AS5 F;  2NS0 A;  4R1H A;  5FLX Z;  4CIC A;  1R22 A;  5HDK A;  4D0P A;  1K7A A;  4OIP F;  2K86 A;  4A2U A;  4LD5 A;  3K9T A;  3I64 A;  2P6T A;  6PAX A;  2PMH A;  1B9N A;  5EEG A;  3T0Y A;  1RUN A;  4MTE A;  3GLX A;  4GYI A;  2JPC A;  3NEU A;  2M45 A;  4OIQ F;  1BI3 A;  1USS A;  3TOA A;  3FM3 A;  5A2Q K;  1YIO A;  2FQ3 A;  4HF0 A;  1TBX A;  3CO7 C;  1FX7 A;  3R60 A;  2ESN A;  2DK5 A;  3TO6 A;  2J5O A;  2GIV A;  5TJJ A;  1HKT A;  4RB1 A;  4LLL A;  2VE9 A;  4GGG A;  3J80 K;  4IVN A;  1MZB A;  1D8J A;  4EM0 B;  2O0Y A;  4RB3 C;  3M8E A;  2Y0M A;  3C18 A;  3LA7 A;  5BOX A;  2YX7 A;  3JAM Z;  1FY7 A;  1XD7 A;  3FXQ A;  3ZP5 A;  3FMQ A;  1I1G A;  2STT A;  3QOP A;  3I0T A;  3ECH A;  3BWG A;  4EJT A;  2QEN A;  3I59 B;  1IN6 A;  3M7G A;  5HVQ C;  1Z91 A;  5J8F A;  4KIG A;  1TTY A;  2NNN A;  3ZMS A;  5D4S A;  1FP2 A;  1L0O C;  4G6Q A;  4UV9 A;  2NAZ A;  4ZH4 F;  3I71 A;  3CO6 C;  2GQQ A;  4BNC A;  2KIM A;  1HST A;  4RS8 A;  1H0M A;  3WG9 A;  2VOO A;  4PGG A;  5A2Q Z;  1KA8 A;  2EA4 A;  2L01 A;  1OMI A;  1P92 A;  4XLN F;  4XLP F;  4FT8 A;  1U6G A;  2FNA A;  4DNC A;  1DP7 P;  4JBA A;  4Q47 A;  5E17 F;  1BOA A;  5CVJ A;  5HLG A;  1RUO A;  4OIR F;  1BC7 C;  1O57 A;  4NB5 A;  3J80 Z;  3WU1 B;  5DD8 A;  4EMS A;  3BZ6 A;  1TW3 A;  3DPT A;  1KQ8 A;  4UVC A;  1W5S A;  2P5V A;  4WXH A;  2MC3 A;  3DP7 A;  2Z99 A;  4KN4 X;  2G7H A;  1YG2 A;  1SMT A;  2WWY A;  2L4A A;  1PP7 U;  1F4K A;  4GO1 A;  5J6X A;  1IF1 A;  2H6B A;  4MQ9 F;  3F6V A;  4GXO A;  4HYE A;  3HHG A;  2E7X A;  1R1T A;  1D5V A;  2BBY A;  1B1B A;  1W7P B;  2OBP A;  2K7L A;  5JFR A;  3WTU C;  4A0X A;  1TQI A;  3S2W A;  3LFK A;  1QBJ A;  3QPH A;  3IRQ A;  4KYW A;  5ICE A;  2FA5 A;  2O61 A;  5CJ9 A;  1JHF A;  1XGO A;  4ZZD A;  1R23 A;  3MFK A;  1XCB A;  3H92 A;  2A6H F;  2F5C A;  2W85 A;  2M8E A;  3N97 A;  2FF4 A;  3DFG A;  1FBU A;  2Q0O A;  3C7J A;  1ZYR F;  2Q2E A;  3DEU A;  4GCV A;  1TNS A;  2JT1 A;  5HLH A;  3DKW A;  2EFQ A;  2W57 A;  4PDK A;  4XRF A;  1SD7 A;  4L9N A;  4IRG A;  2RVC A;  3L09 A;  1HBX G;  4YII A;  3F8C A;  4ESJ A;  1ON2 A;  4HA8 A;  1MGT A;  3T8R A;  3ERE D;  1DPR A;  4HZF A;  4LLN A;  1Z1D A;  5AIQ A;  3FWE A;  5LEK A;  3V7R A;  1ZGA A;  2PLY A;  3R6S A;  1TQM A;  1LEB A;  3D5L A;  5BS6 A;  3HIF A;  5FFX A;  1SAX A;  3GWZ A;  3F21 A;  1RZ4 A;  5ILU A;  3G3Z A;  4H0E A;  5DDG A;  5K5O A;  3GF2 A;  1SMY F;  4HBL A;  3PQJ A;  4M72 A;  1FYL A;  1UB9 A;  1B59 A;  1IW7 F;  2BYV E;  3GZ5 A;  1YW9 A;  1O3S A;  4N0B A;  4OU0 A;  1ZLK A;  3JTH A;  1LDJ A;  3F23 A;  1B9M A;  2QVO A;  1XB4 A;  5H6Q A;  2DW4 A;  3BJO A;  3RPU A;  4M6Y A;  4UXN A;  4KUM A;  1S7A A;  3V8J A;  5D5W B;  4U88 A;  2F5D A;  1FP1 D;  4TV7 A;  2NRA C;  3VEP A;  5HOO A;  4O3M A;  3T5X A;  3RIR A;  3RI4 A;  2RKH A;  2VBW A;  3BPX A;  1MJB A;  1SD5 A;  2VN2 A;  1BBY A;  2NNY A;  2C6Y A;  2VBX A;  4F7Z A;  2QBY B;  2RQP A;  1IN5 A;  1H9G A;  1EH7 A;  1T38 A;  3O6B B;  1ZAR A;  4XBF A;  4K2E A;  2FBI A;  1KQ0 A;  1Y0U A;  3BOQ A;  4I0B A;  4XSZ F;  3K1M A;  4RB2 C;  2OQR A;  4N9H A;  3ISP A;  3CJN A;  4P96 A;  4RGR A;  4AIK A;  3IC7 A;  1QNT A;  4EJO A;  3EYI A;  2O6G E;  2JZY A;  2EFO A;  1P6R A;  1W4M A;  4HLY A;  2MH2 A;  3SHF A;  4PCQ A;  3LQQ A;  4NHJ A;  2FOK A;  1FC3 A;  3TO9 A;  4M6X A;  2ZXJ A;  2GWR A;  1XGM A;  2O3F A;  3WGH A;  4LMY A;  2HYF A;  2IW5 A;  3RKW A;  2IT0 A;  1WWX A;  1LVA A;  2OZU A;  2R3S A;  3BJA A;  1ZRC A;  1GHC A;  1O3Q A;  2K4J A;  1AWC A;  2LKP A;  3E97 A;  3HTU A;  4WWC A;  5LGT A;  3GYH X;  1R36 A;  1XCV A;  3QRF F;  1UST A;  4IRI A;  1OYY A;  1QGP A;  4EJV A;  5DCF A;  2P4W A;  3F8N A;  5IT3 A;  3LQR A;  5LRS A;  2Z5U A; 
#chains in the Genus database with same CATH topology
 2QKM B;  1F9N A;  1TNT A;  3WU2 C;  2O8X A;  3QPL A;  2MSY A;  2KP6 A;  2MBF A;  1HLV A;  4JX5 A;  1UHM A;  2V9P A;  3LSR A;  1KQ9 A;  3S15 J;  4WX9 A;  3A03 A;  1PJR A;  3VYT B;  1UAA A;  5KVR A;  2LC2 A;  2HR3 A;  3H3Z A;  3PUF A;  1KU9 A;  4Z6Y A;  1R4N B;  2VE8 A;  4FCY A;  3P7N A;  4I0A A;  3FHN A;  4CO8 A;  2IVM A;  4RM2 A;  3KLN A;  5DUI A;  5D6F A;  4II2 A;  5LGU A;  1FYM A;  2R4G A;  2RNG A;  4Y15 A;  3COA C;  2V7F A;  1TP4 A;  1EKE A;  2FD5 A;  2JSC A;  5K5Q A;  3CCE I;  1YJ9 I;  2ZJ2 A;  3ZMV A;  2IS1 A;  1O4X A;  1GV2 A;  3Q9V A;  1IN8 A;  1W36 D;  4BBR J;  3HUG A;  2R7F A;  1IN4 A;  5EGO B;  1QZE A;  2OCE A;  4GYG A;  3NRV A;  1B72 A;  4IHT A;  3K2Z A;  3FXJ A;  3I4M J;  1G8X A;  4RLF A;  2CQK A;  5LFA A;  1YX5 A;  2VXZ A;  2XAU A;  3QPT A;  5CVU A;  4PFO A;  3K70 C;  4EJW A;  1XSX A;  3ZQ7 A;  1V5F A;  1ZGJ A;  3LA3 A;  3K10 A;  4CDG A;  1S7O A;  3ABU A;  2LY9 A;  5F27 A;  3L1P A;  4XLC A;  2O7O A;  3L2R A;  3LSM A;  3KEO A;  3U2R A;  1S29 A;  4FHT A;  1ZH5 A;  5KK1 A;  2H6C A;  1UCR A;  2DMP A;  3MZH A;  2FBH A;  1G3S A;  2M87 A;  1QU3 A;  1T6S A;  5HNH A;  3TL4 X;  4F3Q A;  4XR6 A;  1RRJ A;  2BY0 A;  1H9T A;  5D6E A;  2LNB A;  4D1Q A;  2MLG A;  1NH3 A;  5DV5 A;  1ZAO A;  5J47 A;  2VIX A;  2X1C A;  2Y75 A;  3G1O A;  3CF5 F;  1DDN A;  1VTN C;  1WZ2 A;  3E5U A;  1GVJ A;  3HRM A;  2XF6 A;  4MEX F;  1W0U A;  3VFZ A;  4II3 A;  1ETX A;  1X1B A;  3KP5 A;  2RN7 A;  2VKH A;  1ACI A;  2OA4 A;  3OYH A;  3DBL B;  1V54 H;  2BEO A;  2X1D A;  4BH9 A;  2B7E A;  3DTI A;  3U1D A;  4WK8 F;  2KZV A;  3QU3 A;  1WRJ A;  1BJZ A;  1SVL A;  3QQA A;  2WY8 Q;  2LKX A;  1ZG5 A;  2J5P A;  3X2Q H;  4S05 A;  2YS9 A;  3LFU A;  2P8T A;  2R92 J;  3HXL A;  5CPR B;  4BXU A;  4I2O A;  3P9C A;  2CS3 A;  3U21 A;  2LBF B;  4ESF A;  4F55 A;  1QHH D;  2W25 A;  2W84 A;  5K5R A;  4Z2Y A;  2CMP A;  1YW7 A;  1WJE A;  3BR3 A;  3KP2 A;  3OYF A;  2I8D A;  2CW0 F;  2DA3 A;  1SAU A;  4LB5 A;  1J59 A;  2IBD A;  5F64 A;  2BV6 A;  3OOU A;  3E6D A;  1Y39 A;  1VQ6 I;  4CCN A;  1IRX A;  2NYX A;  1C0W A;  2XAQ A;  1T2K A;  2XAF A;  1W5T A;  4XNF A;  2RNJ A;  3RKY A;  4ENM A;  3K4C A;  4F93 B;  1XTA A;  5KHD A;  4CYD A;  2LP0 A;  1Z7U A;  3DU5 A;  2K85 A;  4X0G A;  3D1N I;  3TGN A;  2WB1 A;  2H1L A;  1LQ1 A;  2DA4 A;  2D2W A;  2RRE A;  3OSF A;  2V1D A;  3WTW C;  3W6V A;  3D5R C;  2P5K A;  3SFZ A;  3CQZ J;  3SFI A;  3ZMZ A;  4FET A;  1RNL A;  4E7J A;  4HNU A;  4I6Z A;  1IXS B;  2B9S A;  3CUQ C;  4V19 K;  1UZC A;  1OLT A;  4UVB A;  2KIS A;  4PJM A;  1PUF A;  3E0J B;  3ZQH A;  2EB7 A;  4U7B A;  4N4N B;  4UUS A;  2PN6 A;  3KCC A;  2JMW A;  1WGX A;  4KIF A;  3E6B A;  3R0A A;  1MDM A;  2OZ6 A;  3BPV A;  2YU3 A;  2CUZ A;  4M9X A;  1UEL B;  4OIO F;  1MBK A;  4PJN A;  1E2X A;  1NK2 P;  3BG9 A;  4QPQ A;  5EEH A;  2W48 A;  3GFJ A;  2E1M B;  4MFE A;  2ISY A;  2A6T A;  2R7W A;  2VAS A;  1JXS A;  3I5U A;  1IV6 A;  1YRN B;  1XGN A;  4CGZ A;  2L7K A;  2HYG D;  3ELK A;  1YI2 I;  1MKM A;  1ITY A;  2CJJ A;  3WGI A;  5M5X J;  4GRI A;  4KDP A;  3H5A A;  1YJN I;  4YFN F;  2LRD A;  4UB6 C;  3GFI A;  3AFH A;  5HDG A;  1NTC A;  2HFH A;  1WI3 A;  2LTP A;  4XOP A;  3GVA A;  2OTL I;  2L9V A;  4AIH A;  3UKG A;  5ED4 A;  4YFK F;  2Z16 A;  2LD5 A;  3N4M A;  4QWQ A;  4RAY A;  2WAF A;  3BC8 A;  3DBR B;  4BQA A;  3D0S A;  5JVT A;  2B0L A;  3H9Q A;  3JW4 A;  2ZBK A;  3MKW B;  1F1Z A;  2X6Y A;  3BTJ A;  3EUA A;  4XK4 A;  4KT6 A;  1G3T A;  1RPW A;  3E1S A;  2XSD C;  3CTA A;  2WTE A;  2CFX A;  5GAE J;  1ZN2 A;  1K78 B;  1BI1 A;  2OF7 A;  3JSO A;  2NVT J;  1IRF A;  2R93 J;  3N05 A;  1HF0 A;  2HGC A;  4HV5 A;  2F5F A;  1QPM A;  3T8T A;  4EVI A;  2R7Z J;  3SJM A;  3W2V A;  3O8H A;  5DS9 A;  1S7E A;  3L00 A;  3GME A;  3TP0 A;  3GZ6 A;  2DU9 A;  4KNY A;  2IPQ X;  1HKQ A;  1STZ A;  1V4R A;  2E1O A;  3FIW A;  3AL0 B;  4ENK A;  1J5Y A;  1F5T A;  4ZDL A;  1SFX A;  1TWF J;  2JN6 A;  3ML6 A;  3Q0W A;  3ROU A;  4G7H F;  2DK8 A;  2X9D A;  1T8I A;  2DXI A;  2XAS A;  4HOB A;  3JRF A;  4CHU A;  2MG4 A;  2LFB A;  1G4D A;  3BQY A;  5B3S H;  4I76 A;  4CCM A;  3M4O J;  1O7L A;  2UXX A;  1FIA A;  4BJT A;  2CQQ A;  1ONV A;  3PL8 A;  2L4M A;  3FBI B;  3PIP F;  2VLA A;  2WV0 A;  4U0Y A;  2E34 A;  1T56 A;  4V2F A;  1VND A;  5FD5 A;  1U5T A;  3VB2 A;  1ETQ A;  4LLG F;  3K0L A;  2KKO A;  2MLK A;  1D0Y A;  2EQR A;  3V8L A;  2CGP A;  2QSH X;  1K83 J;  2BY1 A;  3G1M A;  1OKR A;  3U9G A;  2W1O A;  1P4A A;  4MFD A;  2VPL A;  1BN5 A;  3J81 K;  2H27 A;  3FZV A;  2DJN A;  5CLS A;  4XKV A;  4P9U A;  2HU9 A;  3A4C A;  4A5N A;  4KFC A;  2JA7 J;  2CQN A;  2Q2E B;  2GZW A;  4HX8 A;  1V3F A;  4C30 A;  5IYC J;  1T95 A;  2WB1 N;  2A61 A;  3CCL I;  4I01 A;  5ICC A;  5IPA A;  4Q4Z F;  4JP0 A;  2CU7 A;  2ZKZ A;  1F36 A;  2ME0 A;  2BVL A;  2R7R A;  4ZC3 A;  4ETS A;  3H5R A;  1VQP I;  5KAI C;  2IP2 A;  3C1D A;  4WCG A;  1MND A;  1L3L A;  4MGR A;  1ETV A;  2QUF A;  3E5X A;  3M8F A;  1S5L C;  3K4B A;  1HDD C;  3A01 A;  2Y2Z A;  2O03 A;  4QLC U;  4L18 B;  1GV5 A;  3SZT A;  3S32 A;  4IZZ A;  3ZGK A;  4BBS J;  3HRU A;  2LF7 A;  2K5C A;  4MNU A;  4HEA 2;  2COB A;  3K1P A;  3HM5 A;  3HZJ A;  1TT0 A;  2D1V A;  1FOK A;  2HWV A;  2BVM A;  4XLH A;  2ZXH A;  1BL0 A;  1ZRF A;  4AIJ A;  4F91 B;  1EH8 A;  1CF7 B;  4R79 A;  1FYK A;  3Q9S A;  2O9L A;  2VQH A;  3P9I A;  4OWR B;  4I98 B;  1YE9 A;  2ZXI A;  2M7A A;  5HS8 A;  1FBQ A;  2ME6 A;  2KJB A;  1LJ9 A;  3R4K A;  3C2G A;  5D4R A;  3W2A A;  1X3U A;  1YQA A;  2PI0 A;  4NDL A;  1P9Q C;  2COM A;  4A3C J;  3MCZ A;  1MSE C;  1LDK B;  3GTO J;  2XUB A;  3DEE A;  2PQ8 A;  2Y48 A;  3BY6 A;  3K69 A;  4HLX A;  4XOR A;  3ZMD A;  2XC7 A;  2XAJ A;  3ABL H;  1WSU A;  5E3M A;  4KT5 C;  1JGS A;  4A6D A;  4D5C A;  2BW3 B;  2YX4 A;  3PUB A;  3OYD A;  3A2K A;  3GTQ J;  4AC0 A;  2A5Y B;  2VC1 A;  4XSX F;  3I4N J;  3B6C A;  2K3F A;  1G3Y A;  1W7P A;  2V6C A;  3A0H C;  5D5X B;  3L9F A;  3OYA A;  3S14 J;  3L2W A;  5J1Y A;  2LG4 A;  2YSR A;  1J0R A;  2OU2 A;  2BXY A;  5K7H A;  3HHH A;  1WJC A;  4BY1 J;  4W97 A;  2NOJ B;  4ENN A;  2EH3 A;  4I09 A;  3GTJ J;  5F0C A;  1B4A A;  1VQK I;  4E7Z A;  3LSH A;  2STW A;  1IC8 A;  2HQR A;  1R58 A;  2UV1 A;  4HG2 A;  3LSK A;  1QVU A;  3BG5 A;  2DFI A;  1QQI A;  1BOB A;  2H94 A;  3FHZ A;  1J2X A;  4A6E A;  1KU7 A;  3HOS A;  4ZDO A;  5B66 C;  4BHB A;  4CUG A;  1FTZ A;  1VFC A;  5DD4 A;  3SXY A;  3RTR A;  3RJP A;  1U78 A;  3I4P A;  1XMA A;  3CCU I;  2DMU A;  5J3L A;  3HB9 A;  2VT3 A;  2IJL A;  1FOY A;  1Z9C A;  3OYJ A;  2DMQ A;  1K4T A;  3HPG A;  5F1J A;  2NVQ J;  1QZY A;  3IKV A;  2FML A;  2Q8K A;  1A6Q A;  4U0W A;  3IV5 A;  1R9T J;  2ECB A;  3F8M A;  1UG0 A;  3D5S C;  1OYI A;  5E18 F;  3RPQ A;  4EQQ A;  3KET A;  3KZZ A;  1JE8 A;  1LNW A;  3OL3 A;  2E60 A;  4L9T A;  1O7F A;  4V2G A;  2VOP A;  1RIO H;  2DAO A;  4C3H J;  3GTG J;  2IRF G;  2DN0 A;  3MD2 A;  2PMU A;  2ZNY A;  4UHT A;  5EDN A;  1MMS A;  1LFU P;  2EIL H;  4ZYD A;  2EBI A;  1MMD A;  3CDI A;  2HDC A;  2F4I A;  2M2E A;  2CV2 A;  3PFY A;  2JSP A;  5E1W A;  3GTL J;  2LKS A;  2UUZ A;  5TGT A;  3FXR A;  1DQU A;  3GZN B;  4HAM A;  4MQV A;  3VPR A;  2JVH A;  4A3D J;  4B44 A;  4MEY F;  2Z1D A;  2X6O A;  3QP5 A;  4ENJ A;  4CZC A;  3E7L A;  4OMZ A;  5J4V A;  1UFM A;  5DYM A;  5L3D A;  2KQR A;  4HDV A;  3HOU J;  5J8C A;  4G12 A;  4DZP A;  1WI9 A;  2XKO A;  1JTX A;  5M5Y J;  2AHQ A;  1NK3 P;  2OAZ A;  1P4X A;  9ANT A;  1SFO J;  4J19 A;  3AG4 H;  4AWX B;  1JKO C;  2R7D A;  2GM4 A;  3MVP A;  5F0H A;  5C44 J;  3VSL A;  1IRG A;  1AA7 A;  1FBS A;  1U5T C;  2MH9 A;  2YR2 A;  4RM3 A;  2F2E A;  4PJL A;  1S8N A;  2JA6 J;  3P5J A;  2WC2 A;  2HXI A;  5ILV A;  5EG0 A;  3ZRG A;  2D1H A;  2WBM A;  3TDU C;  2ZCW A;  3BR2 A;  1DP3 A;  1WCM J;  2LR8 A;  3RKX A;  1WQ2 A;  3EET A;  4NC8 A;  2XV4 S;  1XS9 A;  2HYJ A;  2MD0 A;  4HNT A;  1ZR4 A;  1IGN A;  2LRE A;  3W6K B;  2VC0 A;  3WE2 A;  1A36 A;  1Y56 A;  1T33 A;  2IEK A;  3GTM J;  2IXS A;  3CUQ A;  3GFM A;  2LSO A;  1R5G A;  2L9N A;  4E70 A;  2BZT A;  3T1B A;  4ZZL A;  1RI7 A;  2QQ8 A;  4ABZ A;  3WHB A;  3M9A A;  4OOI A;  4LG0 A;  1B6A A;  3S2D J;  2ZME A;  3S93 A;  4IHX A;  3H5N A;  5CKT A;  2HQN A;  2LK2 A;  5CQG A;  4LK0 F;  3OS2 A;  2P6S A;  3FMS A;  1FPQ A;  5L3B A;  5IT9 K;  2QM3 A;  4X6A J;  2K4B A;  3I9V 2;  4XN0 A;  1MSF C;  1T08 B;  4CCK A;  1JT0 A;  3QU6 A;  2ELJ A;  3RCO A;  3AKZ A;  4GDF A;  3BT9 A;  1ZHF A;  5M3F J;  3OYC A;  2DT5 A;  1XG1 A;  1MJ9 A;  1B8I A;  3M1E A;  1XGS A;  5LEJ A;  4L9J A;  5F04 A;  4IHS A;  3V7C A;  4NUB A;  2HVQ A;  3A1Y A;  3MAJ A;  4A12 A;  3FK6 A;  3PFI A;  3LAP A;  3L2C A;  1IAW A;  5IP7 J;  1FLI A;  3Q3S A;  1ZG1 A;  4BEH A;  3CCR I;  2QBY A;  3RQ4 A;  5FO5 A;  1JJ8 C;  1Z77 A;  3WTZ A;  5J40 A;  1U2W A;  2A69 F;  4L5J A;  4BJ6 C;  4I7H A;  3HGY A;  1A31 A;  3W3C A;  1VQ5 I;  1DPU A;  1GUU A;  4IQJ A;  5C3E J;  2NVY J;  2PEX A;  1EF4 A;  3SZP A;  3V4G A;  3BDD A;  3HUG B;  3DCF A;  3EUH A;  1O3T A;  3IKT A;  1YX3 A;  1X3Z B;  1KZH A;  3DU6 A;  3VYR B;  2ZSH B;  1SD4 A;  1U3E M;  4CZZ A;  1H88 C;  3M07 A;  3RZO J;  2GXG A;  3IAS 2;  2X51 A;  1VQ9 I;  4B3A A;  1LEA A;  1Y6I A;  2EIM H;  1DUX C;  4A3K J;  2DFF A;  4HW0 A;  1VQ8 I;  3ZPL A;  2X6X A;  2VKE A;  4E7K A;  2H09 A;  4BU2 A;  3J7Z I;  3S1R J;  2KFD A;  1N77 A;  3J7A O;  1ULY A;  4B3X A;  2LY2 A;  4BDZ A;  2AXL A;  3SDG A;  1GT0 C;  5DCM B;  4FX0 A;  5DTD A;  5CVV A;  2XAG A;  3I54 A;  2HOS A;  3GW2 A;  2NVU B;  3WG7 H;  2XHK A;  3HOZ J;  4AUX A;  3H0D A;  3JRH A;  1Y1V J;  1U8R A;  1MBH A;  1VQ7 I;  4A69 C;  2E36 A;  1Z21 A;  4EJU A;  2QYO A;  4XOT A;  2HKO A;  3PJR A;  5LD2 C;  2V4J C;  3FXO A;  1V5G A;  1IXR C;  1R5H A;  3ESW B;  2DCE A;  3KZI C;  3DTK A;  4AM3 A;  3E3V A;  3CJT B;  3U1K A;  3S3N A;  3B02 A;  4IOA F;  3E6C C;  1R4M B;  4BHP A;  4B47 A;  1AKH A;  1P4W A;  5HLI A;  2ZC2 A;  4P55 A;  4XIC A;  3OV8 A;  2CG4 A;  3BR1 A;  2X6W A;  3HSE A;  2MD5 A;  4QIW N;  2CW7 A;  4XRS A;  3FXL A;  2G0E A;  4L0Y B;  2K9L A;  2K9Q A;  2ID6 A;  1D3Y A;  3TKY A;  3J7A Y;  1A6I A;  2QLZ A;  4CYC A;  1MJA A;  2X0L A;  2D45 A;  1GXP A;  1OQY A;  3GFL A;  1IG7 A;  2FX0 A;  2QCO A;  2XRO A;  3FK7 A;  2HPM A;  2DDB A;  2HS5 A;  3OOP A;  2FOW A;  3NWS A;  4BUP A;  1I1S A;  3HKZ A;  2P7V B;  1CGP A;  4NQW A;  1I6H J;  1ZKG A;  4XM3 A;  3BG7 A;  3OYE A;  4M3B A;  4YG2 F;  4RA2 A;  1Y0N A;  4YEJ A;  5FKN A;  4AID A;  1W7P D;  4HX4 A;  3KP7 A;  3PQK A;  2IA0 A;  5D5U B;  2DPU A;  1QO0 D;  4M73 A;  4Y4R A;  2XB5 A;  4CSW A;  2F6C A;  2Z3Y A;  2LH9 A;  4XKB A;  2A07 F;  4BQQ A;  2GA2 A;  1T0F A;  2M5W A;  2HKX A;  4C3J J;  4FTH A;  1UG2 A;  3WTT C;  2JUG A;  5JHU A;  1H89 C;  2KDO A;  4L9V A;  4UNO A;  1XX5 A;  2BOL A;  3WHC A;  3MN2 A;  1ORK A;  4I02 A;  5LHH A;  3IHU A;  3WTX C;  3IH3 A;  2ESH A;  4HQM A;  4CCJ A;  3WE3 A;  1RC9 A;  4LJZ F;  3S16 J;  2HTJ A;  2EZL A;  2CQX A;  3H9J A;  4G94 A;  2ETH A;  4AVZ A;  5LRR A;  3IRR A;  3JRC A;  1PUF B;  5JLX A;  1Z6T A;  1P7I A;  1Q1V A;  2DYS H;  2HOE A;  3ECO A;  3MZ8 A;  5GAH J;  1BW6 A;  3JAM K;  4HV6 A;  5HS9 A;  3E5Q A;  4AD9 A;  1R5I D;  3K70 D;  2V9K A;  3QYB A;  4BQO A;  1KU3 A;  1SEU A;  2R0Q C;  1D1C A;  1QVT A;  4F52 A;  1MMA A;  1RET A;  2V1U A;  4Y7N J;  1IV8 A;  3HRT A;  5EGO A;  2IAI A;  4BY7 J;  3JRD A;  3Q0V A;  4JOM A;  2HZT A;  4EAT A;  4BS9 A;  3FKJ A;  2LDU A;  5C4J J;  4U7D A;  4OIN F;  3ZN0 A;  4IHW A;  5H2F C;  4XID A;  1HW1 A;  3G71 I;  1LUJ B;  3BR6 A;  5AIP A;  3HOT A;  3ZQG A;  2M4K A;  2BY2 A;  3IL2 A;  2JJ7 A;  2ZJP F;  3TOB A;  3I53 A;  2EA2 A;  4FX4 A;  3CLO A;  5HNF A;  1MMN A;  1P2F A;  1HXD A;  4JK1 X;  2H8W A;  4KIT B;  3MKZ A;  3OYM A;  2M8G X;  2P81 A;  3RPU D;  3ABT A;  1TWC J;  1WJF A;  5BPI A;  2DPD A;  4ANJ A;  1O3R A;  1X2N A;  1RR7 A;  3LSP A;  4N9I A;  4NC6 A;  2HNH A;  1X1P A;  4BE0 A;  2LF8 A;  2XB0 X;  3ONQ A;  3CZ6 A;  2ZME C;  1U8B A;  4PSX A;  4P9F A;  3CCS I;  1M1E B;  2DQL A;  2M3A A;  4A93 J;  4KMU X;  3PSI A;  5HDN A;  1LB2 A;  5DEQ A;  1D0X A;  2A6E F;  2P0W A;  3FM5 A;  4Q5S F;  3KP3 A;  3VSK A;  2ZB9 A;  2XGX A;  4FIS A;  4UB8 C;  4DYR A;  1SFE A;  2DT7 B;  1D5Y A;  4L5I A;  2OC6 A;  4HX7 A;  1KGS A;  2CO5 A;  3GEZ A;  4HNV A;  3QPS A;  3FXU A;  1N78 A;  1U9O A;  4ZJZ A;  2O5R A;  4ZYE A;  3HTS B;  3K1N A;  3TW6 A;  5JI6 A;  2LBF A;  4KN7 X;  5E3O A;  2FXA A;  3REO A;  2XRL A;  2ECC A;  4Y3O A;  3KLO A;  4MHG A;  3MMY B;  3SEQ A;  3LA2 A;  2KJC A;  4M3F A;  2L54 A;  1HC8 A;  3H1C A;  3H36 A;  1WKM A;  2JRT A;  2CWE A;  3TDZ C;  2RDP A;  1FEX A;  2FSW A;  1FNN A;  1CQT A;  3K7A J;  1GXQ A;  1MMG A;  4LK1 F;  1XDU A;  4ZYG A;  2X1E A;  2V26 A;  3DV8 A;  3R0J A;  2VQL A;  3EUH C;  2ZNZ A;  5IYB J;  5EZG A;  3F72 A;  1X19 A;  4IX7 A;  3I58 A;  1IUF A;  3QOE A;  1A04 A;  4E7I A;  3HKZ N;  2OTJ I;  1U5T B;  2CYY A;  2A5W A;  4MTD A;  2VB6 A;  4Q48 A;  2GOX B;  2ELH A;  5JVG F;  2HVR A;  3M8J A;  4M9S A;  1Z3Y A;  2DFE A;  1A5J A;  5H6R A;  3HPH A;  2GA1 A;  4YFX F;  3MWM A;  3IWZ A;  5E3N A;  1QPI A;  2QSG X;  1IZ1 A;  2V79 A;  2KZG A;  5D8L B;  5ILS A;  4A0Y A;  3FBN B;  3JCU C;  2XGC A;  3QYE A;  2CUE A;  1X4P A;  2PJR A;  3F22 A;  1R1U A;  3KZY A;  2YUS A;  4PZJ A;  2XVC A;  4RAZ A;  2G9W A;  3PO3 J;  1E17 A;  5BQT A;  4C2M J;  2WAQ A;  2NS7 A;  1I50 J;  5B5E C;  1XMK A;  2VT2 A;  1VZ0 A;  5JR3 A;  5H20 A;  4YIF A;  2E5Z A;  3B73 A;  5FKO A;  4DQ2 A;  3KX2 A;  2EJR A;  3CCM I;  1AHD P;  3VYS B;  1Y8Q B;  3H0G J;  3JSP A;  1W1W E;  2HQ5 A;  1BIA A;  4ZTJ A;  2FBK A;  2DTZ A;  3MQ0 A;  2ICW G;  3BCA A;  3FX3 A;  4B09 A;  4X1E A;  2EK5 A;  5CVR A;  3A01 B;  3SZG A;  3S8P A;  3F8B A;  5FFZ A;  3GX4 X;  4UUV A;  2EWN A;  2EFW A;  1YRN A;  1ZGW A;  3QAH A;  4ZYH A;  3OIO A;  3OMY A;  3I59 A;  4XKW A;  1PYV A;  3L2U A;  4WXD A;  1J9I A;  1V5E A;  1JGG A;  1R1V A;  1OCR H;  2HPI A;  3TO7 A;  3V8K A;  2KDZ A;  2P5L C;  2GXB A;  2TDX A;  3BP8 A;  1I6X A;  2GIZ A;  1XDS A;  2AQF A;  2MA3 A;  2A68 F;  3W6J B;  2DO7 A;  1U0J A;  3H3V K;  4EV0 A;  3LNQ A;  1ZG3 A;  2BGC A;  3CCV I;  1OPC A;  1LDD A;  2VJ4 A;  3KE2 A;  4RGX A;  2V6E A;  2R7S A;  2QQ9 A;  1SD6 A;  1T0F C;  3ZMT A;  3MEX A;  3C3W A;  3G73 A;  2L02 A;  2K02 A;  1TZL A;  1GLN A;  5CYV A;  5IOY A;  5KNL A;  1DU0 A;  2FE3 A;  2L3D A;  3CP2 A;  5FD6 A;  2BY3 A;  1ON1 A;  1XPX A;  1K78 A;  1S6L A;  4P1W A;  1IN7 A;  1UHS A;  1JHH A;  2QWW A;  3NWT A;  4C3I J;  3F6O A;  2HTS A;  2IGK A;  3GBG A;  3WGG A;  1YW8 A;  4CXF A;  5AON A;  2ZFW A;  3I56 I;  1OYW A;  1UMQ A;  2F5E A;  1ODD A;  1BI2 A;  4RGS A;  1FSE A;  3DXJ F;  4Y17 A;  3S3M A;  5FRN A;  4IHV A;  2FJ1 A;  2FU4 A;  1Z0X A;  2MGQ A;  1S9H A;  2ZXW H;  1HCR A;  3HC7 A;  4O5V A;  3DPL C;  4M74 A;  2A3S A;  5L3E A;  4M9Z A;  2FMY A;  2DOE A;  1YS6 A;  2VPR A;  2W24 A;  3BLY A;  5EYR A;  3IH4 A;  4G7Z F;  2PJP A;  2VXD A;  1SFU A;  2I10 A;  5FKM A;  2E7W A;  2KL4 A;  4BAY A;  3O3K A;  3KYL A;  2MC4 A;  1OR7 A;  5EF6 A;  2WAE A;  4LB6 B;  1VF9 A;  4ESB A;  4ZTF A;  4AVP A;  5LLQ A;  4S04 A;  2YU9 J;  3W2W A;  3OYB A;  2M30 A;  5TIS C;  1E3P A;  2HXO A;  2QA4 I;  2IA2 A;  4WF2 A;  2RAE A;  3RSN A;  3GTP J;  3JTG A;  3J81 Z;  3CC2 I;  3HGG A;  4B43 A;  3GO5 A;  5ICF A;  3HG9 A;  2K9N A;  2PMZ A;  2Q1Z B;  1W0T A;  2ACJ A;  1D0Z A;  1R71 A;  2JA8 J;  1QZZ A;  2EV0 A;  2UZK A;  4A3B J;  2ZFU A;  2V9V A;  4DOZ A;  1OJL A;  2M0M A;  3KP6 A;  4UVA A;  5LHI A;  2DLL A;  1YLF A;  4B8X A;  4BL0 B;  2GXA A;  1X1C A;  3G4S I;  1S3J A;  3CCJ I;  3LOC A;  2JUC A;  4PGH A;  2F48 A;  1ETO A;  5M5W J;  2WAQ N;  3CLQ A;  3FXM A;  1YJW I;  3CJQ B;  3K4K A;  1Z05 A;  4D5F A;  4DJA A;  5ICG A;  5B1A H;  2ZO4 A;  2QZ8 A;  4DBQ A;  3OYG A;  2UWM A;  2JTV A;  5L3F A;  4S0H B;  2R5Y B;  4FE4 A;  2HEO A;  4C9Y A;  4UV8 A;  2DQR A;  3RYP A;  2R5Z B;  2VI6 A;  4R8H A;  3K2A A;  4QSH A;  4UUT A;  3ZMU A;  3L7W A;  4BGD A;  2Z9O A;  1EV7 A;  1CF7 A;  5F6F A;  2OUM A;  1I5Z A;  3WTS C;  3CD6 I;  2HQA A;  4W1U A;  5E20 A;  1MD0 A;  5K1Y A;  1HW5 A;  3H3U A;  2EFP A;  2X4H A;  2DMN A;  1ETY A;  1TQP A;  4CH7 A;  1YS7 A;  3HEF A;  2CV1 A;  1KON A;  4A3L J;  3B6A A;  5L3C A;  1WJD A;  1OFC X;  3Q5F A;  1HSJ A;  2XKP A;  2VQG A;  3KIO A;  3ZR8 X;  2MW8 A;  2DA1 A;  1D8K A;  1GDT A;  2E2I J;  1EH6 A;  3JRE A;  1MBJ A;  3DF8 A;  1MH3 A;  1TWH J;  2AXT C;  3EUK L;  3GXO A;  2NOG A;  4WXC A;  4LFU A;  3AG1 H;  1SC7 A;  1PVE A;  3OYN A;  5IOZ A;  1BM9 A;  2KIQ A;  2FRH A;  2PBI A;  1KYZ A;  1BI0 A;  5ERI A;  3CUQ B;  2NVX J;  1ZK8 A;  1K4S A;  3I3L A;  3WTY C;  1WH5 A;  2V1X A;  1R7J A;  4A3M J;  4A5M A;  3HYI A;  4P5O A;  4KJZ A;  4A0Z A;  4LG0 B;  2ZME B;  3V7S A;  2DT6 A;  2ADU A;  2L5Q A;  3S1M J;  3QP6 A;  2G7U A;  3F8F A;  4PSW A;  4U87 A;  3F3X A;  2JQ7 A;  2R7X A;  5D8K B;  4DIQ A;  3R61 A;  3EQL F;  3VOE A;  2IGM A;  2Z2S B;  4IF4 A;  4XN3 A;  3FF5 A;  2RQQ A;  2E1M C;  5CVI A;  3RYR A;  3IWF A;  1PUE E;  4IRH A;  2KPM A;  1G59 A;  1Z6R A;  3SQN A;  2JPB A;  3K4J A;  2YPR A;  4ASN A;  5BNG A;  5E8G A;  4IKF A;  3AAF A;  2XGE A;  1OCC H;  1LKX A;  2VBZ A;  3TQN A;  3DQV C;  4D7N A;  4O6J A;  4BHC A;  4NNJ A;  3MKY B;  2JRM A;  3TBI A;  3CDH A;  2MAB A;  3S2H J;  2XIG A;  5E1Z B;  3VOD A;  5FGM A;  1KYW A;  5GP9 A;  1WVR A;  1FWZ A;  1N25 A;  4LIU A;  3HOY J;  2IS2 A;  1OCZ H;  2HVS A;  1EA3 A;  4RGU A;  1R00 A;  3K6G A;  1F43 A;  1BC8 C;  1XSV A;  1HKS A;  4HF2 A;  3OIQ A;  5K7Z A;  3NQO A;  2PG4 A;  4IL6 C;  2L7F P;  4D9J A;  1G3W A;  4BXX J;  4M71 A;  2EV6 A;  1K6O A;  2RGV A;  2PMZ N;  5DUK A;  4XON A;  2FNP A;  1T98 A;  1J75 A;  2R7U A;  2JK3 A;  2XAH A;  4KIC A;  1SAN A;  1ZRE A;  4KMF A;  3HSR A;  3CMY A;  2DBB A;  5FJ8 J;  2OV7 A;  3RZD J;  2LMD A;  1ZQ3 P;  5IP9 J;  3SDB A;  5HS7 A;  3BRO A;  2BE5 F;  3DTE A;  3LMM A;  4IOC F;  3NAR A;  2UXN A;  1YFH A;  2PFB A;  3KP4 A;  2AQE A;  3AL0 C;  2QQB A;  3LWF A;  1LE8 A;  1FZP B;  2DTR A;  3HJE A;  2VBY A;  4EM2 A;  5E1X A;  1J7K A;  3BG6 A;  1H8A C;  4Y13 A;  1K79 A;  4E7H A;  3JRG A;  1MBF A;  2K27 A;  1POG A;  2WA0 A;  3CCY A;  2RV8 A;  4FE7 A;  3O2P E;  3OWT A;  1XSD A;  3FMR A;  5LGN A;  3L2Q A;  1YOV B;  1AKH B;  3H35 A;  3S3O A;  1Q1H A;  1ZTR A;  2FQ4 A;  2M4G A;  5FRM A;  3BQZ A;  3EYY A;  3HSF A;  1UHW A;  2GAU A;  1B72 B;  1OR7 C;  1WFX A;  1FSH A;  1BIB A;  3HRS A;  4HRI A;  4IJA A;  2K9M A;  3LSG A;  2IGN A;  4KIB A;  1MBE A;  3OS1 A;  1NHA A;  2OQG A;  4G9Y A;  3G1L A;  5D5V B;  5FB2 A;  1W36 C;  3ASN H;  1HQC A;  1TLH B;  2IGO A;  1VQL I;  2TRT A;  2HOA A;  3MZY A;  1G6N A;  3UNG C;  3AG3 H;  5LHG A;  2EFN A;  4NQW B;  2K9S A;  1UJ8 A;  2F5V A;  5F1R A;  3WTV C;  2CSO A;  3OYK A;  2VKV A;  3ABK H;  2VON A;  2XGD A;  1ZLJ A;  5BPD A;  5C4X J;  1TW2 A;  2R7O A;  4G6D A;  2E1C A;  3VYU B;  5E8I A;  4EM1 A;  2ISZ A;  3CF2 A;  1JKR C;  1I27 A;  4KA4 A;  1KU2 A;  3ABM H;  1Y1W J;  5FRO A;  3HDD A;  2XDV A;  4XLF A;  4IPA A;  2B63 J;  4G8X A;  3RDI A;  3GUD A;  1JT6 A;  1Z7L A;  2E1N A;  4L0Z B;  2X48 A;  1ZEL A;  4I99 C;  4EGZ A;  5FLX K;  1ZRD A;  2QQA A;  2L2O A;  1YO5 C;  1REP C;  5LBQ A;  3S1N J;  2X85 A;  4HSR A;  4U0V A;  5IT9 Z;  2Y0S A;  3LST A;  4EGY A;  4JQF A;  1PP8 F;  3MKL A;  4RB0 A;  3PNY A;  1JUP A;  3EDP A;  4E6K G;  2IA1 A;  2Z33 A;  4HDU A;  2H8R A;  2EV5 A;  2VOD A;  4RAG A;  5KCM A;  1Z67 A;  3Q0U A;  1LPQ A;  1YYV A;  4HQE A;  2CUF A;  3P9K A;  2DOF A;  5L3G A;  2KIF A;  1IXC A;  5BMZ A;  3E6M A;  4OMY A;  4HPQ A;  3JRI A;  4EEF G;  1JUS A;  5TRD A;  1YHQ I;  2CQ7 A;  2EIJ H;  3WU0 A;  3WOD F;  3ZXS A;  4LGW A;  2DOD A;  2DI3 A;  3BR5 A;  2LY1 A;  4XL9 A;  1APL C;  1AOY A;  2DA7 A;  1TWG J;  1FMW A;  2WAD A;  3KPH A;  1T39 A;  1XC5 A;  1NG7 A;  1BJA A;  4BYY A;  3KEQ A;  5GTH C;  4ON0 A;  1P7J A;  2OD5 A;  3ULQ B;  3CUO A;  1PDN C;  1XN7 A;  1HW2 A;  2XPV A;  3F9K A;  4G7O F;  1GVD A;  4PJ0 C;  3KFW X;  1TC3 C;  5DCM A;  2P7C B;  1ETW A;  2XF7 A;  2XRN A;  3BJ6 A;  4IXA A;  1JTY A;  2D5V A;  4HF1 A;  1IDZ A;  1JKP C;  4IEJ A;  1YTY A;  3OR1 C;  2KIU A;  1FT9 A;  2KRF A;  4UUS B;  1DGR M;  1K6Y A;  2FEZ A;  1A35 A;  2A05 A;  2RC4 A;  3EPZ A;  3LAJ A;  1IUY A;  3CMM A;  3OL4 A;  1MDM B;  1VI0 A;  3ZN1 A;  2M1B A;  2AS5 F;  4XLA A;  5CQE A;  2NS0 A;  4R1H A;  5FLX Z;  3HOV J;  4CIC A;  1R22 A;  1WJA A;  5HDK A;  3PNV A;  4E4H A;  4D0P A;  1K7A A;  3K4M A;  1QRY A;  4OIP F;  2K86 A;  2R7Q A;  4A2U A;  4L5E A;  5J4Y A;  1TL8 A;  4LD5 A;  3K9T A;  4IO9 F;  3I64 A;  5HLT A;  2P6T A;  6PAX A;  1LFP A;  2HDD A;  2PMH A;  1RKW A;  4BXF A;  1B9N A;  5EEG A;  3T0Y A;  1HA8 A;  2EIK H;  1RUN A;  4MTE A;  3GLX A;  4GFB A;  3LSJ A;  4GYI A;  4C2T A;  4A3I J;  2JPC A;  1I3Q J;  2E19 A;  3CJR B;  2Y9Z A;  2ZSI B;  3NEU A;  3KEY A;  2M45 A;  4YEL A;  3ZQL A;  1HDP A;  4OIQ F;  1BI3 A;  1USS A;  4RAF A;  3TOA A;  2XPU A;  3FM3 A;  5A2Q K;  4RBO A;  1YIO A;  4Y52 J;  2FQ3 A;  4HF0 A;  1TBX A;  3CO7 C;  3FKI J;  1ZR2 A;  1MNE A;  2NXN B;  1FX7 A;  3BCB A;  3R60 A;  2R7V A;  2ESN A;  5K7F A;  4PFP A;  4CCO A;  2DK5 A;  2OPT A;  2ZJQ F;  3TO6 A;  4A3G J;  2J5O A;  2GIV A;  5TJJ A;  1HKT A;  3QYF A;  2KRH A;  3ZCO A;  4LLL A;  3ZQF A;  4RB1 A;  1N75 A;  3F0C A;  1WJ5 A;  2VE9 A;  3CP8 A;  4GGG A;  4M3D A;  3J80 K;  2XSJ C;  2R7T A;  1TT5 B;  5E79 C;  4IVN A;  3V42 A;  2L7Z A;  2PJR B;  1MZB A;  1MBG A;  3CMA I;  1R6R A;  4PUS A;  1D8J A;  4AYB A;  4EM0 B;  2O0Y A;  4RB3 C;  3FIS A;  3M8E A;  2Y0S N;  2Y0M A;  1WHU A;  2LYC A;  3C18 A;  3DKX A;  4ZDP A;  1U9N A;  3LA7 A;  5BOX A;  5GPC A;  2LVS A;  2ELK A;  1I39 A;  2MFZ A;  2YX7 A;  2QSF X;  3JAM Z;  1FY7 A;  1MW7 A;  3ZQI A;  2CH0 A;  1R49 A;  3LL7 A;  1XD7 A;  3CCQ I;  3OIP A;  1W5C C;  3FXQ A;  3ZP5 A;  3FMQ A;  1I1G A;  3JRA A;  4A3J J;  4HST A;  4DYQ A;  2STT A;  2M9H A;  4RMN A;  3GTK J;  3QOP A;  3CC4 I;  3I0T A;  4M3G A;  3ECH A;  3BWG A;  3IP4 B;  5E3L A;  4EJT A;  2QEN A;  5GTI C;  2KRC A;  3I59 B;  1IN6 A;  3M7G A;  5HVQ C;  1Z91 A;  2DYR H;  2DFH A;  5J8F A;  4KIG A;  2HZD A;  1TTY A;  2EIN H;  2NNN A;  3ZMS A;  2DJI A;  5D4S A;  2CFO A;  1FP2 A;  2CRG A;  3DWL E;  1L0O C;  4G6Q A;  5M3M J;  4UV9 A;  2NAZ A;  5HOD A;  1FOX A;  1G2H A;  4ZH4 F;  4XRS G;  3I71 A;  4XLE A;  3CO6 C;  3M3Y J;  2GQQ A;  1K61 A;  4D7M A;  3QOD A;  1IDY A;  2KIM A;  4BNC A;  1HST A;  3CDL A;  4RS8 A;  1H0M A;  3WG9 A;  2VOO A;  4PGG A;  2V1N A;  5A2Q Z;  1KA8 A;  2EA4 A;  2L01 A;  1OMI A;  3CES A;  1P92 A;  4XLN F;  4XLP F;  3KYD B;  4FT8 A;  1U6G A;  1NG6 A;  2FNA A;  4DNC A;  1DP7 P;  4JBA A;  3IUO A;  4Q47 A;  5E17 F;  2QGU A;  5DM7 F;  4B4C A;  1BOA A;  3L2V A;  5CVJ A;  5HLG A;  5JLW A;  1RUO A;  4OIR F;  1BC7 C;  1O57 A;  2JA2 A;  3S1Q J;  3VDX A;  3BG3 A;  2CW8 A;  4NB5 A;  1DU6 A;  3JRB A;  3J80 Z;  1QHG A;  3WU1 B;  3TW7 A;  5DD8 A;  4EMS A;  3BZ6 A;  1FIP A;  1TW3 A;  3DPT A;  1KQ8 A;  2EPF A;  3LSI A;  4UVC A;  2DA2 A;  4MLO A;  1W5S A;  2WV1 A;  4LOC A;  4N4O B;  4BKX A;  2P5V A;  4WXH A;  3HOW J;  2MC3 A;  2JVG A;  3DP7 A;  3GLL A;  3SYT A;  3GCM A;  2Z99 A;  4KN4 X;  1BR4 A;  2G7H A;  4FQG A;  5FLV A;  1YG2 A;  3S17 J;  1SMT A;  1I3A A;  2WWY A;  2L4A A;  3J7Y J;  1PP7 U;  1F4K A;  3OS0 A;  2BHZ A;  1YIT I;  4GO1 A;  3DBH B;  5J6X A;  1IF1 A;  5JHF A;  2H6B A;  4MQ9 F;  1BR1 A;  3F6V A;  4GXO A;  4HYE A;  3K4L A;  4F92 B;  1ETK A;  1OCO H;  4BE2 A;  2W82 A;  3HHG A;  2E7X A;  1FJL A;  2EZI A;  2EZH A;  1R1T A;  1D5V A;  4E7S A;  2BBY A;  2Y31 A;  1B1B A;  1SVO A;  1AU7 A;  1W7P B;  3ZQQ A;  2TCT A;  2OBP A;  2K7L A;  5JFR A;  4YIR X;  1X3W B;  2BHY A;  2KLO A;  3WTU C;  4A0X A;  1TQI A;  3S2W A;  2L7M P;  3LFK A;  1E3H A;  5J1U A;  5DM6 F;  1Z3X A;  1ERD A;  2IS6 A;  1FOW A;  1OIS A;  1QBJ A;  3QPH A;  3IRQ A;  2I5U A;  4LIT A;  5F08 A;  4KYW A;  5ICE A;  4PK4 A;  4OAY A;  3UR3 C;  2VL8 A;  4AYB N;  1E3O C;  4BAC A;  2FA5 A;  2O61 A;  3IH2 A;  2EZK A;  3HBL A;  3OYI A;  5CJ9 A;  1JHF A;  1XGO A;  4XKC A;  4ZZD A;  1R23 A;  1MIJ A;  5GAD J;  3MFK A;  1XCB A;  1V55 H;  4DGW B;  3H92 A;  2A6H F;  2F5C A;  1VQ4 I;  4BDY A;  2KMU A;  2M7B A;  2W85 A;  2M8E A;  4DYC A;  3N97 A;  2FF4 A;  3G2B A;  3DFG A;  1RES A;  1FBU A;  2M0C A;  2Q0O A;  3TED A;  4MO7 A;  1X58 A;  4IQ4 A;  3C7J A;  1ZYR F;  2E71 A;  1FMV A;  2Q2E A;  1TNS A;  3DEU A;  4GCV A;  4J00 A;  2JT1 A;  2MYS A;  2AO9 A;  5HLH A;  3DKW A;  2EFQ A;  2W57 A;  4PDK A;  4XRF A;  3I55 I;  1SD7 A;  2M34 A;  1IO2 A;  4L9N A;  4MIM A;  4IRG A;  2RVC A;  3JR9 A;  2IS4 A;  3RKQ A;  1VQN I;  2L9R A;  4DZJ A;  1IJW C;  3BR0 A;  3PM1 A;  2XF5 A;  4YRV A;  2W7N A;  3L09 A;  1HBX G;  4YII A;  3C2H A;  3F8C A;  2E5N A;  4ESJ A;  1OCT C;  3BZK A;  1ON2 A;  4Y33 A;  4PJJ A;  3BTC A;  4HA8 A;  1LVK A;  1MGT A;  2CUJ A;  3FDY A;  3T8R A;  3ERE D;  1DPR A;  4HZF A;  4LLN A;  4RLQ A;  1Z1D A;  1OCP A;  3AG2 H;  4J01 A;  5AIQ A;  3FWE A;  5LEK A;  5GAG J;  3V7R A;  1DGW Y;  1XMX A;  1ZGA A;  1RR8 C;  2PLY A;  3R6S A;  3TP3 A;  1TQM A;  1LEB A;  4NBQ A;  3D5L A;  1SVM A;  5BS6 A;  5J1R A;  3HIF A;  5FFX A;  2FUG 2;  3OSG A;  1JI8 A;  1ENH A;  1SAX A;  1Y8R B;  2JA5 J;  3GWZ A;  4NC7 A;  2NS8 A;  3F21 A;  1RZ4 A;  1HOM A;  5FKK A;  1X2M A;  4BJ5 C;  1RKT A;  4XMY A;  2E35 A;  4XRM A;  2F4O B;  5ILU A;  3G3Z A;  2HDW A;  1MH4 A;  5EZH A;  4H0E A;  5DDG A;  5K5O A;  4M6V A;  3GF2 A;  1SMY F;  1WPK A;  2CV0 A;  4A3F J;  2W00 A;  2VJJ A;  3BTI A;  3HL2 A;  4JX4 A;  1JJ6 C;  2VJ5 A;  4HBL A;  5EG0 B;  4IHY A;  3PQJ A;  4M72 A;  2GLO A;  2BW3 A;  4KIS A;  3BTL A;  5IP6 A;  1BR2 A;  1FYL A;  5IY5 H;  5FLM J;  1UB9 A;  1B59 A;  1IW7 F;  2BYV E;  5KAF C;  3GZ5 A;  3NAU A;  1YW9 A;  3TMO A;  1O3S A;  1BW5 A;  4N0B A;  4B1R A;  1JKQ C;  5GPA A;  2OCC H;  2OJE D;  2E2J J;  4BQN A;  4OU0 A;  1ZLK A;  3JTH A;  1LDJ A;  3F23 A;  4BE1 A;  1B9M A;  2QVO A;  1XB4 A;  3QWL A;  5H6Q A;  2DW4 A;  3BJO A;  3RPU A;  4M6Y A;  3H9G A;  4UXN A;  4KUM A;  1S7A A;  1VQM I;  2DDA A;  5F0F A;  3V8J A;  5D5W B;  4U88 A;  2F5D A;  1FP1 D;  4TV7 A;  2NRA C;  4JYK A;  3O8G A;  2QF7 A;  3VEP A;  5HOO A;  4O3M A;  2Y30 A;  2DOA A;  4LIV A;  2QEX I;  2R5Y A;  1X1D A;  3T5X A;  3KYC B;  3RIR A;  3PNT A;  1B8I B;  3RI4 A;  2RKH A;  2R5Z A;  2XPW A;  2VBW A;  3BPX A;  3ZQC A;  4E7L A;  2GBY A;  1MJB A;  1SD5 A;  1LE8 B;  4UY8 I;  4DBR A;  2VN2 A;  2WY7 Q;  1BBY A;  2NNY A;  2C6Y A;  3IAM 2;  2VBX A;  4BEH B;  4F7Z A;  2QBY B;  3FXK A;  2RQP A;  1IN5 A;  1WJB A;  3DLA A;  1FTT A;  3A02 A;  1D1A A;  1H9G A;  3OYL A;  1EH7 A;  1T38 A;  3O6B B;  3CC7 I;  2BXZ A;  4CA0 A;  4JX6 A;  1ZAR A;  5B1B H;  1D1B A;  4XBF A;  1TWA J;  4K2E A;  4CCL A;  5EEA A;  4QTR A;  3C2B A;  4ZYA A;  4XQF A;  3DEW A;  3DPU A;  1SFK A;  2FBI A;  2K3P A;  2VUM J;  4OAZ A;  1KQ0 A;  1Y0U A;  2QKL B;  3VWB A;  1VQO I;  3BOQ A;  4I0B A;  4XSZ F;  1S72 I;  3K1M A;  4RB2 C;  3PSF A;  1MNM C;  2OQR A;  4N9H A;  2VJI A;  1J09 A;  3ISP A;  3OY9 A;  1LFB A;  1QA6 A;  3CJN A;  2N8G A;  2KHM A;  2L0K A;  3PO2 J;  4P96 A;  4RGR A;  1WH7 A;  4AIK A;  3IC7 A;  1E0E A;  1QNT A;  3DKY A;  4EJO A;  3EYI A;  2O6G E;  2PX9 A;  2JZY A;  2EFO A;  1P6R A;  1W4M A;  4HLY A;  2MH2 A;  2L9S A;  3ZOB A;  3SHF A;  4PCQ A;  4G6T B;  1EJ9 A;  2DA5 A;  1BA5 A;  2KT0 A;  4AU7 A;  3LQQ A;  4NHJ A;  2Y9Y A;  2FOK A;  1JUM A;  1FC3 A;  3TO9 A;  4M6X A;  2ZXJ A;  3A0B C;  4H4K C;  2VQC A;  2GWR A;  1XGM A;  2K40 A;  2O3F A;  3SEZ A;  3WGH A;  4LMY A;  2DA6 A;  2LLK A;  2ID3 A;  4RDU A;  2HI3 A;  5IYD J;  2GOM A;  2HYF A;  3K4N A;  3RQI A;  3G6E I;  4DW6 A;  4ITV A;  2IW5 A;  3RKW A;  2IT0 A;  2O8K A;  1WWX A;  1LVA A;  2OZU A;  2R3S A;  3BJA A;  4B48 A;  2H1K A;  2E2H J;  1ZRC A;  1GHC A;  2JWT A;  4C2U A;  1O3Q A;  3ERM A;  2K4J A;  2DMT A;  3DLL F;  1AWC A;  4CYC B;  2LKP A;  3E97 A;  3HTU A;  2W4S A;  4WWC A;  5LGT A;  2ZJR F;  3GYH X;  1R36 A;  3CME I;  2Y69 H;  1XCV A;  4QPO A;  3QRF F;  2LOO A;  2VKD A;  1UST A;  2HOT A;  4IRI A;  1OYY A;  1QGP A;  4EJV A;  5DCF A;  2P4W A;  3F8N A;  3OR2 C;  4FAS D;  1X4O A;  1YIJ I;  5IT3 A;  5FKL A;  4A3E J;  2F4M B;  1IRZ A;  1X1A A;  3LQR A;  3BZC A;  3PIO F;  4LG3 A;  5LRS A;  3ASO H;  4M3E A;  3HOX J;  2Z5U A;  5EJC A;  3M1C A; 
#chains in the Genus database with same CATH homology
 1F9N A;  1TNT A;  2O8X A;  2MBF A;  1UHM A;  1KQ9 A;  4WX9 A;  5KVR A;  2HR3 A;  3H3Z A;  1KU9 A;  2VE8 A;  3P7N A;  4I0A A;  4CO8 A;  2IVM A;  3KLN A;  5DUI A;  5D6F A;  5LGU A;  1FYM A;  4Y15 A;  3COA C;  2JSC A;  5K5Q A;  2ZJ2 A;  3ZMV A;  3Q9V A;  1IN8 A;  3HUG A;  2R7F A;  1IN4 A;  4GYG A;  3NRV A;  4IHT A;  3K2Z A;  2CQK A;  2VXZ A;  3QPT A;  5CVU A;  4EJW A;  1XSX A;  3ZQ7 A;  1ZGJ A;  3LA3 A;  4CDG A;  1S7O A;  3ABU A;  3KEO A;  3U2R A;  1S29 A;  4FHT A;  1ZH5 A;  5KK1 A;  2H6C A;  1UCR A;  3MZH A;  2FBH A;  1G3S A;  2M87 A;  1T6S A;  1H9T A;  5D6E A;  2LNB A;  2MLG A;  5DV5 A;  1ZAO A;  2Y75 A;  1DDN A;  1VTN C;  3E5U A;  1GVJ A;  3HRM A;  4MEX F;  3VFZ A;  3KP5 A;  2RN7 A;  2OA4 A;  2BEO A;  4BH9 A;  3U1D A;  4WK8 F;  3QU3 A;  1WRJ A;  1ZG5 A;  2J5P A;  4S05 A;  2P8T A;  4BXU A;  4I2O A;  3P9C A;  4ESF A;  5K5R A;  2W25 A;  2W84 A;  4Z2Y A;  1YW7 A;  3KP2 A;  2CW0 F;  4LB5 A;  1J59 A;  5F64 A;  2BV6 A;  3E6D A;  2NYX A;  1C0W A;  2XAQ A;  1T2K A;  2XAF A;  1W5T A;  2RNJ A;  3RKY A;  4ENM A;  4CYD A;  1Z7U A;  3TGN A;  1LQ1 A;  2D2W A;  2V1D A;  3WTW C;  2P5K A;  3SFZ A;  3ZMZ A;  1RNL A;  1IXS B;  3CUQ C;  4UVB A;  2EB7 A;  4U7B A;  2PN6 A;  3KCC A;  4KIF A;  3E6B A;  3R0A A;  1MDM A;  2OZ6 A;  3BPV A;  2YU3 A;  4M9X A;  4OIO F;  1E2X A;  5EEH A;  3GFJ A;  2ISY A;  1JXS A;  3I5U A;  1XGN A;  4CGZ A;  2HYG D;  3ELK A;  1MKM A;  3WGI A;  4KDP A;  4YFN F;  3GFI A;  5HDG A;  2HFH A;  3GVA A;  4AIH A;  5ED4 A;  4YFK F;  3N4M A;  4QWQ A;  4RAY A;  4BQA A;  3D0S A;  5JVT A;  2B0L A;  3JW4 A;  2ZBK A;  1F1Z A;  1G3T A;  3CTA A;  2WTE A;  2CFX A;  1ZN2 A;  1K78 B;  1BI1 A;  3JSO A;  1IRF A;  2HGC A;  4HV5 A;  2F5F A;  1QPM A;  3T8T A;  4EVI A;  3L00 A;  3GZ6 A;  2DU9 A;  4KNY A;  2IPQ X;  1HKQ A;  1STZ A;  1V4R A;  4ENK A;  1J5Y A;  1F5T A;  1SFX A;  3ML6 A;  3ROU A;  4G7H F;  2DK8 A;  4CHU A;  2XAS A;  4HOB A;  1G4D A;  1O7L A;  2UXX A;  1ONV A;  2L4M A;  2WV0 A;  4U0Y A;  5FD5 A;  3VB2 A;  1U5T A;  4LLG F;  3K0L A;  2KKO A;  2MLK A;  2CGP A;  3V8L A;  1OKR A;  3U9G A;  1P4A A;  1BN5 A;  3J81 K;  2H27 A;  3FZV A;  5CLS A;  4P9U A;  4A5N A;  4KFC A;  2GZW A;  4HX8 A;  1V3F A;  2A61 A;  4I01 A;  5ICC A;  4Q4Z F;  2ZKZ A;  4ETS A;  2IP2 A;  3C1D A;  4WCG A;  1L3L A;  4MGR A;  2QUF A;  3E5X A;  3M8F A;  2O03 A;  4QLC U;  4L18 B;  3SZT A;  3HRU A;  2LF7 A;  4MNU A;  3K1P A;  2D1V A;  1FOK A;  2HWV A;  1ZRF A;  4AIJ A;  1EH8 A;  1CF7 B;  4R79 A;  1FYK A;  3Q9S A;  3P9I A;  4I98 B;  5HS8 A;  1FBQ A;  2KJB A;  1LJ9 A;  3R4K A;  5D4R A;  1X3U A;  1YQA A;  2PI0 A;  2COM A;  3MCZ A;  1LDK B;  2XUB A;  2PQ8 A;  2Y48 A;  3BY6 A;  3K69 A;  4HLX A;  3ZMD A;  2XAJ A;  1WSU A;  4KT5 C;  1JGS A;  4A6D A;  2YX4 A;  2A5Y B;  2VC1 A;  4XSX F;  1G3Y A;  1W7P A;  2V6C A;  5D5X B;  3L9F A;  2YSR A;  1J0R A;  2OU2 A;  3HHH A;  4ENN A;  4I09 A;  1B4A A;  2STW A;  2HQR A;  1R58 A;  2DFI A;  1QQI A;  2H94 A;  3FHZ A;  1J2X A;  4A6E A;  1KU7 A;  3HOS A;  4BHB A;  5DD4 A;  3SXY A;  3RTR A;  3RJP A;  1U78 A;  3I4P A;  1XMA A;  2VT3 A;  2IJL A;  1Z9C A;  1QZY A;  3IKV A;  2FML A;  2Q8K A;  4U0W A;  3F8M A;  1OYI A;  5E18 F;  3RPQ A;  4EQQ A;  3KET A;  3KZZ A;  1JE8 A;  1LNW A;  4L9T A;  1O7F A;  2VOP A;  1RIO H;  2DAO A;  2IRF G;  2PMU A;  2ZNY A;  4UHT A;  4ZYD A;  2HDC A;  5E1W A;  3FXR A;  4HAM A;  4MQV A;  4MEY F;  3QP5 A;  4ENJ A;  4OMZ A;  1UFM A;  5DYM A;  5L3D A;  4HDV A;  5J8C A;  1WI9 A;  2XKO A;  2OAZ A;  1P4X A;  4AWX B;  2R7D A;  1IRG A;  1FBS A;  1U5T C;  2MH9 A;  2YR2 A;  2F2E A;  1S8N A;  2WC2 A;  5ILV A;  2D1H A;  3TDU C;  2ZCW A;  3RKX A;  1WQ2 A;  3EET A;  2XV4 S;  3W6K B;  2VC0 A;  3WE2 A;  3CUQ A;  3GFM A;  2LSO A;  1R5G A;  4E70 A;  3T1B A;  4ZZL A;  1RI7 A;  3M9A A;  4OOI A;  4LG0 A;  1B6A A;  2ZME A;  2HQN A;  4LK0 F;  2P6S A;  3FMS A;  1FPQ A;  5L3B A;  5IT9 K;  2QM3 A;  2K4B A;  3QU6 A;  1ZHF A;  2DT5 A;  1MJ9 A;  3M1E A;  1XGS A;  5LEJ A;  4L9J A;  4IHS A;  3V7C A;  3MAJ A;  4A12 A;  3PFI A;  3LAP A;  3L2C A;  1IAW A;  1FLI A;  1ZG1 A;  2QBY A;  5FO5 A;  3WTZ A;  1U2W A;  2A69 F;  4L5J A;  4I7H A;  1DPU A;  2PEX A;  3SZP A;  3V4G A;  3BDD A;  3EUH A;  1O3T A;  3IKT A;  1SD4 A;  1U3E M;  4CZZ A;  2GXG A;  1LEA A;  1DUX C;  4HW0 A;  3ZPL A;  2H09 A;  3J7A O;  1ULY A;  2AXL A;  5DCM B;  4FX0 A;  5CVV A;  2XAG A;  3I54 A;  3GW2 A;  2XHK A;  1U8R A;  4EJU A;  2QYO A;  2HKO A;  1IXR C;  1R5H A;  3E3V A;  3B02 A;  3E6C C;  4BHP A;  1P4W A;  5HLI A;  4P55 A;  3OV8 A;  2CG4 A;  3HSE A;  2MD5 A;  4L0Y B;  1D3Y A;  3TKY A;  2QLZ A;  1MJA A;  2X0L A;  2D45 A;  1GXP A;  3GFL A;  2XRO A;  2HS5 A;  3OOP A;  1I1S A;  2P7V B;  1CGP A;  4NQW A;  4YG2 F;  1W7P D;  4HX4 A;  3KP7 A;  3PQK A;  2IA0 A;  5D5U B;  2DPU A;  1QO0 D;  4M73 A;  2Z3Y A;  2A07 F;  2GA2 A;  1T0F A;  2M5W A;  2HKX A;  3WTT C;  5JHU A;  4L9V A;  4UNO A;  4I02 A;  5LHH A;  3IHU A;  3WTX C;  2ESH A;  4HQM A;  3WE3 A;  4LJZ F;  2HTJ A;  4G94 A;  2ETH A;  5LRR A;  3IRR A;  1Z6T A;  2HOE A;  3ECO A;  3JAM K;  4HV6 A;  5HS9 A;  3E5Q A;  4AD9 A;  1KU3 A;  2V1U A;  3HRT A;  2HZT A;  2LDU A;  4U7D A;  4OIN F;  3ZN0 A;  1HW1 A;  3HOT A;  5AIP A;  3IL2 A;  3TOB A;  3I53 A;  2EA2 A;  4FX4 A;  3CLO A;  1P2F A;  1HXD A;  4JK1 X;  3ABT A;  5BPI A;  2DPD A;  1O3R A;  4N9I A;  2LF8 A;  4P9F A;  2DQL A;  4KMU X;  5HDN A;  1LB2 A;  5DEQ A;  2A6E F;  3FM5 A;  4Q5S F;  3KP3 A;  2XGX A;  1SFE A;  4L5I A;  4HX7 A;  1KGS A;  2CO5 A;  3GEZ A;  3FXU A;  3HTS B;  4ZYE A;  3K1N A;  5JI6 A;  4KN7 X;  2FXA A;  3REO A;  3KLO A;  4MHG A;  3LA2 A;  2KJC A;  2L54 A;  1WKM A;  2JRT A;  2CWE A;  3TDZ C;  2RDP A;  2FSW A;  1FNN A;  1GXQ A;  4LK1 F;  1XDU A;  4ZYG A;  3DV8 A;  3R0J A;  2ZNZ A;  3F72 A;  3I58 A;  1A04 A;  1U5T B;  2CYY A;  4MTD A;  4Q48 A;  2ELH A;  4M9S A;  5H6R A;  2GA1 A;  4YFX F;  3MWM A;  3IWZ A;  1IZ1 A;  2V79 A;  5D8L B;  5ILS A;  4A0Y A;  3F22 A;  1R1U A;  3KZY A;  4PZJ A;  2XVC A;  4RAZ A;  2G9W A;  1E17 A;  5BQT A;  5JR3 A;  1XMK A;  2VT2 A;  5H20 A;  4YIF A;  3B73 A;  4DQ2 A;  2EJR A;  3JSP A;  1BIA A;  2FBK A;  3MQ0 A;  3FX3 A;  4B09 A;  2EK5 A;  5CVR A;  3F8B A;  5FFZ A;  3GX4 X;  4UUV A;  2EWN A;  2EFW A;  3QAH A;  4ZYH A;  3I59 A;  4WXD A;  1J9I A;  1R1V A;  3TO7 A;  3V8K A;  2P5L C;  2GXB A;  2TDX A;  3BP8 A;  1I6X A;  1XDS A;  2MA3 A;  2A68 F;  3W6J B;  2DO7 A;  4EV0 A;  1ZG3 A;  2BGC A;  1OPC A;  1LDD A;  3KE2 A;  4RGX A;  2QQ9 A;  1SD6 A;  3ZMT A;  3MEX A;  3C3W A;  3G73 A;  2L02 A;  2K02 A;  5CYV A;  2FE3 A;  2L3D A;  5FD6 A;  1ON1 A;  1K78 A;  1S6L A;  1IN7 A;  1JHH A;  2QWW A;  3F6O A;  2HTS A;  3WGG A;  1YW8 A;  4CXF A;  5AON A;  2ZFW A;  1OYW A;  2F5E A;  1ODD A;  1BI2 A;  4RGS A;  1FSE A;  3DXJ F;  4Y17 A;  2FU4 A;  4O5V A;  3DPL C;  4M74 A;  2A3S A;  5L3E A;  4M9Z A;  2FMY A;  1YS6 A;  2W24 A;  4G7Z F;  2PJP A;  1SFU A;  2E7W A;  4BAY A;  3O3K A;  1OR7 A;  4LB6 B;  4ESB A;  4AVP A;  5LLQ A;  4S04 A;  2M30 A;  2IA2 A;  4WF2 A;  3JTG A;  3J81 Z;  3GO5 A;  5ICF A;  2ACJ A;  1QZZ A;  2EV0 A;  2UZK A;  2V9V A;  3KP6 A;  4UVA A;  5LHI A;  2DLL A;  1YLF A;  4B8X A;  1S3J A;  4PGH A;  1Z05 A;  5ICG A;  2ZO4 A;  2QZ8 A;  2UWM A;  2JTV A;  5L3F A;  2HEO A;  4UV8 A;  2DQR A;  3RYP A;  4R8H A;  3ZMU A;  3L7W A;  2Z9O A;  1EV7 A;  1CF7 A;  5F6F A;  1I5Z A;  3WTS C;  5E20 A;  1MD0 A;  5K1Y A;  1HW5 A;  3H3U A;  2EFP A;  2X4H A;  1TQP A;  1YS7 A;  5L3C A;  3Q5F A;  1HSJ A;  2XKP A;  1D8K A;  1EH6 A;  3DF8 A;  3GXO A;  4WXC A;  4LFU A;  1BM9 A;  2FRH A;  2PBI A;  1KYZ A;  1BI0 A;  5ERI A;  3CUQ B;  3WTY C;  2V1X A;  1R7J A;  4A5M A;  3HYI A;  4P5O A;  4A0Z A;  4LG0 B;  2ZME B;  3V7S A;  2ADU A;  3QP6 A;  2G7U A;  3F8F A;  3F3X A;  5D8K B;  3R61 A;  3EQL F;  3VOE A;  4IF4 A;  3FF5 A;  5CVI A;  3RYR A;  3IWF A;  1PUE E;  4IRH A;  1Z6R A;  3SQN A;  2JPB A;  2YPR A;  4ASN A;  5E8G A;  3AAF A;  2VBZ A;  3TQN A;  3DQV C;  4O6J A;  4BHC A;  3CDH A;  2XIG A;  5E1Z B;  3VOD A;  5FGM A;  1KYW A;  1FWZ A;  4RGU A;  1R00 A;  1BC8 C;  1XSV A;  1HKS A;  4HF2 A;  3NQO A;  2PG4 A;  1G3W A;  4M71 A;  2EV6 A;  1K6O A;  2RGV A;  5DUK A;  2FNP A;  1T98 A;  1J75 A;  2XAH A;  4KIC A;  1ZRE A;  4KMF A;  3HSR A;  2DBB A;  5HS7 A;  3BRO A;  2BE5 F;  2UXN A;  1YFH A;  2PFB A;  3KP4 A;  2QQB A;  3LWF A;  1FZP B;  2DTR A;  2VBY A;  4EM2 A;  5E1X A;  1J7K A;  4Y13 A;  1K79 A;  2K27 A;  2RV8 A;  3O2P E;  1XSD A;  3FMR A;  5LGN A;  1Q1H A;  3EYY A;  3HSF A;  1UHW A;  2GAU A;  1FSH A;  1BIB A;  3HRS A;  4IJA A;  4KIB A;  1NHA A;  2OQG A;  4G9Y A;  5D5V B;  5FB2 A;  1HQC A;  1TLH B;  3MZY A;  1G6N A;  5LHG A;  2EFN A;  3WTV C;  5F1R A;  2CSO A;  2VON A;  1ZLJ A;  5BPD A;  1TW2 A;  4G6D A;  2E1C A;  5E8I A;  4EM1 A;  2ISZ A;  1I27 A;  4KA4 A;  1KU2 A;  4IPA A;  4G8X A;  3RDI A;  3GUD A;  4L0Z B;  2E1N A;  4EGZ A;  5FLX K;  1ZRD A;  2QQA A;  1YO5 C;  1REP C;  5LBQ A;  4U0V A;  5IT9 Z;  4EGY A;  3LST A;  4JQF A;  1PP8 F;  4RB0 A;  3EDP A;  2IA1 A;  2Z33 A;  4HDU A;  2EV5 A;  2VOD A;  1YYV A;  4HQE A;  3P9K A;  5L3G A;  2KIF A;  1IXC A;  5BMZ A;  3E6M A;  4OMY A;  5TRD A;  3WU0 A;  3WOD F;  4LGW A;  2DI3 A;  1AOY A;  1T39 A;  1BJA A;  4BYY A;  3KEQ A;  4ON0 A;  2OD5 A;  3ULQ B;  3CUO A;  1PDN C;  1XN7 A;  1HW2 A;  4G7O F;  3KFW X;  5DCM A;  2P7C B;  2XRN A;  3BJ6 A;  4IXA A;  4HF1 A;  1YTY A;  2KIU A;  1FT9 A;  2KRF A;  2FEZ A;  2RC4 A;  3LAJ A;  1IUY A;  1MDM B;  3ZN1 A;  2M1B A;  2AS5 F;  2NS0 A;  4R1H A;  5FLX Z;  4CIC A;  1R22 A;  5HDK A;  4D0P A;  1K7A A;  4OIP F;  2K86 A;  4A2U A;  4LD5 A;  3K9T A;  3I64 A;  2P6T A;  6PAX A;  2PMH A;  1B9N A;  5EEG A;  3T0Y A;  1RUN A;  4MTE A;  3GLX A;  4GYI A;  2JPC A;  3NEU A;  2M45 A;  4OIQ F;  1BI3 A;  1USS A;  3TOA A;  3FM3 A;  5A2Q K;  1YIO A;  2FQ3 A;  4HF0 A;  1TBX A;  3CO7 C;  1FX7 A;  3R60 A;  2ESN A;  2DK5 A;  3TO6 A;  2J5O A;  2GIV A;  5TJJ A;  1HKT A;  4RB1 A;  4LLL A;  2VE9 A;  4GGG A;  3J80 K;  4IVN A;  1MZB A;  1D8J A;  4EM0 B;  2O0Y A;  4RB3 C;  3M8E A;  2Y0M A;  3C18 A;  3LA7 A;  5BOX A;  2YX7 A;  3JAM Z;  1FY7 A;  1XD7 A;  3FXQ A;  3ZP5 A;  3FMQ A;  1I1G A;  2STT A;  3QOP A;  3I0T A;  3ECH A;  3BWG A;  4EJT A;  2QEN A;  3I59 B;  1IN6 A;  3M7G A;  5HVQ C;  1Z91 A;  5J8F A;  4KIG A;  1TTY A;  2NNN A;  3ZMS A;  5D4S A;  1FP2 A;  1L0O C;  4G6Q A;  4UV9 A;  2NAZ A;  4ZH4 F;  3I71 A;  3CO6 C;  2GQQ A;  4BNC A;  2KIM A;  1HST A;  4RS8 A;  1H0M A;  3WG9 A;  2VOO A;  4PGG A;  5A2Q Z;  1KA8 A;  2EA4 A;  2L01 A;  1OMI A;  1P92 A;  4XLN F;  4XLP F;  4FT8 A;  1U6G A;  2FNA A;  4DNC A;  1DP7 P;  4JBA A;  4Q47 A;  5E17 F;  1BOA A;  5CVJ A;  5HLG A;  1RUO A;  4OIR F;  1BC7 C;  1O57 A;  4NB5 A;  3J80 Z;  3WU1 B;  5DD8 A;  4EMS A;  3BZ6 A;  1TW3 A;  3DPT A;  1KQ8 A;  4UVC A;  1W5S A;  2P5V A;  4WXH A;  2MC3 A;  3DP7 A;  2Z99 A;  4KN4 X;  2G7H A;  1YG2 A;  1SMT A;  2WWY A;  2L4A A;  1PP7 U;  1F4K A;  4GO1 A;  5J6X A;  1IF1 A;  2H6B A;  4MQ9 F;  3F6V A;  4GXO A;  4HYE A;  3HHG A;  2E7X A;  1R1T A;  1D5V A;  2BBY A;  1B1B A;  1W7P B;  2OBP A;  2K7L A;  5JFR A;  3WTU C;  4A0X A;  1TQI A;  3S2W A;  3LFK A;  1QBJ A;  3QPH A;  3IRQ A;  4KYW A;  5ICE A;  2FA5 A;  2O61 A;  5CJ9 A;  1JHF A;  1XGO A;  4ZZD A;  1R23 A;  3MFK A;  1XCB A;  3H92 A;  2A6H F;  2F5C A;  2W85 A;  2M8E A;  3N97 A;  2FF4 A;  3DFG A;  1FBU A;  2Q0O A;  3C7J A;  1ZYR F;  2Q2E A;  3DEU A;  4GCV A;  1TNS A;  2JT1 A;  5HLH A;  3DKW A;  2EFQ A;  2W57 A;  4PDK A;  4XRF A;  1SD7 A;  4L9N A;  4IRG A;  2RVC A;  3L09 A;  1HBX G;  4YII A;  3F8C A;  4ESJ A;  1ON2 A;  4HA8 A;  1MGT A;  3T8R A;  3ERE D;  1DPR A;  4HZF A;  4LLN A;  1Z1D A;  5AIQ A;  3FWE A;  5LEK A;  3V7R A;  1ZGA A;  2PLY A;  3R6S A;  1TQM A;  1LEB A;  3D5L A;  5BS6 A;  3HIF A;  5FFX A;  1SAX A;  3GWZ A;  3F21 A;  1RZ4 A;  5ILU A;  3G3Z A;  4H0E A;  5DDG A;  5K5O A;  3GF2 A;  1SMY F;  4HBL A;  3PQJ A;  4M72 A;  1FYL A;  1UB9 A;  1B59 A;  1IW7 F;  2BYV E;  3GZ5 A;  1YW9 A;  1O3S A;  4N0B A;  4OU0 A;  1ZLK A;  3JTH A;  1LDJ A;  3F23 A;  1B9M A;  2QVO A;  1XB4 A;  5H6Q A;  2DW4 A;  3BJO A;  3RPU A;  4M6Y A;  4UXN A;  4KUM A;  1S7A A;  3V8J A;  5D5W B;  4U88 A;  2F5D A;  1FP1 D;  4TV7 A;  2NRA C;  3VEP A;  5HOO A;  4O3M A;  3T5X A;  3RIR A;  3RI4 A;  2RKH A;  2VBW A;  3BPX A;  1MJB A;  1SD5 A;  2VN2 A;  1BBY A;  2NNY A;  2C6Y A;  2VBX A;  4F7Z A;  2QBY B;  2RQP A;  1IN5 A;  1H9G A;  1EH7 A;  1T38 A;  3O6B B;  1ZAR A;  4XBF A;  4K2E A;  2FBI A;  1KQ0 A;  1Y0U A;  3BOQ A;  4I0B A;  4XSZ F;  3K1M A;  4RB2 C;  2OQR A;  4N9H A;  3ISP A;  3CJN A;  4P96 A;  4RGR A;  4AIK A;  3IC7 A;  1QNT A;  4EJO A;  3EYI A;  2O6G E;  2JZY A;  2EFO A;  1P6R A;  1W4M A;  4HLY A;  2MH2 A;  3SHF A;  4PCQ A;  3LQQ A;  4NHJ A;  2FOK A;  1FC3 A;  3TO9 A;  4M6X A;  2ZXJ A;  2GWR A;  1XGM A;  2O3F A;  3WGH A;  4LMY A;  2HYF A;  2IW5 A;  3RKW A;  2IT0 A;  1WWX A;  1LVA A;  2OZU A;  2R3S A;  3BJA A;  1ZRC A;  1GHC A;  1O3Q A;  2K4J A;  1AWC A;  2LKP A;  3E97 A;  3HTU A;  4WWC A;  5LGT A;  3GYH X;  1R36 A;  1XCV A;  3QRF F;  1UST A;  4IRI A;  1OYY A;  1QGP A;  4EJV A;  5DCF A;  2P4W A;  3F8N A;  5IT3 A;  3LQR A;  5LRS A;  2Z5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...