4HYEA

Crystal structure of a response regulator spr1814 from streptococcus pneumoniae reveals unique interdomain contacts among narl family proteins
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
200
structure length
200
Chain Sequence
HMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Crystal structure of the response regulator spr1814 from Streptococcus pneumoniae reveals unique interdomain contacts among NarL family proteins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription activator
total genus 83
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hyeA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hyeA01
2DPUA 4WF2A 3GZ5A 3IPCA 3LQRA 3Q9VA 4LLNA 4P9UA 1DRKA 5JNTA 4I01A 1DPUA 1WETA 1SFEA 2FLWA 3BREA 4KMFA 2XAHA 1W7PD 4KT5C 3IPAA 2YX4A 2M8EA 3TO5A 5ICCA 1E17A 3GFJA 2A69F 4EYKA 4UHTA 5EWMA 2F8TA 3LUJA 1UHMA 2H94A 3Q9SA 2HQOA 3A0UA 3JTGA 3E3VA 5KQGA 3HV2A 3JY6A 1KQ9A 2QQAA 3BJ6A 3M6MD 4EVQA 1IRFA 4EYOA 5ILSA 1F1ZA 3G3ZA 2HWVA 2CQKA 4A2UA 1LJLA 1NXVA 2GA1A 4RGSA 4RB3C 3ZPLA 3ROFA 1FBSA 4M72A 2XV4S 2FTKE 1H9CA 3K2ZA 2MYTA 5DEQA 5HLIA 3IP9A 9ABPA 5BPIA 2Y75A 1G3WA 1HSTA 2ZJ2A 1I3CA 4R79A 2QLZA 4RSMA 5JNSA 2J5OA 4HYEA 2XVCA 4EJOA 3H5WA 4MAAA 3F3XA 3WTUC 2H6BA 3DGFC 5LEJA 4Q4ZF 1SD7A 3D0SA 3T1BA 3V8KA 4OLAA 5CJ9A 4HV5A 2QXYA 5CNJA 2LF7A 1DC7A 2FMHA 2MC3A 1NHAA 2GZWA 3C3WA 3FMQA 3I59A 5IT9K 1O7LA 2W57A 4TLMB 2W85A 3LUCA 1W9HA 2DAOA 3LAJA 3JTHA 2FQXA 1A04A 2PEXA 4P5OA 1ABEA 3WGIA 1XDSA 2ETHA 3A0RB 1JLKA 5KK1A 4LJZF 4O1HA 3HOSA 4OIPF 2FBIA 1ZESA 4UV9A 2CSOA 2GXBA 2L02A 1IUYA 3HYIA 3V7SA 1FSEA 2ZAYA 4RK7A 1Z16A 3I4PA 3ZQ7A 4RDCA 2EK5A 2IA0A 1P6UA 4MTDA 2GKGA 1GUDA 1GCAA 2VBWA 2J5PA 2JVJA 1WKMA 1Z12A 3JTEA 2P8TA 4WWHA 1U8RA 4RB0A 2VUHB 2L19A 2ACJA 1ZGAA 2NAZA 2WWVD 3G1WA 3BJOA 1QBJA 1BVHA 5C5EA 2HQRA 1XMKA 1XGMA 3O74A 3EQZA 2RDPA 2PFBA 4Y15A 4L0YB 3H5LA 3QELA 5EWJA 4XSXF 4KICA 3MQ4A 3BZ6A 1OYYA 2XGXA 1NXXA 2VC0A 6ABPA 2RGVA 4LD5A 1BN5A 3EAFA 1RZRD 1T34A 1IW7F 1YW8A 4PYRA 2I6FA 2PE5A 1D5VA 4RK0A 1SD5A 2PUBA 1P92A 1D2AA 2NYXA 2VXZA 1C4WA 1ZVVA 3EULA 2X7XA 1L3LA 3KYJB 2FEZA 2DW4A 2AS5F 3JAMZ 4O5AA 1HQCA 3T5XA 1MDMA 2V1XA 2O03A 5IULC 1FLIA 3QRFF 4FX0A 1FYKA 3GL9A 3BROA 4HAMA 2JB9A 1IN5A 1FBUA 1MZBA 3F22A 1CF7A 1UCRA 4EGYA 3BP8A 3F72A 3J80K 2JBAA 4AD9A 2LDUA 1MJ9A 4NB5A 4UVCA 1WSUA 3J81Z 3IKTA 5PNTA 2DFIA 4DADA 2QWWA 2GXGA 3HEBA 1Q1HA 4D0PA 1P4AA 4JB0A 4WXEA 1R00A 3T8RA 2PLNA 4L4UA 1QZYA 4ON0A 3EGCA 4YLEA 2HZTA 2COMA 1H0MA 1MB3A 2RVCA 4LDAA 3LUFA 2JSCA 2CGPA 1HEYA 4PGHA 1ZGZA 1QO0D 5LLQA 3HSRA 2DTRA 5B3JA 4CYDA 3GA5A 1R1UA 4W5TA 4TMYA 1DZ3A 3MFKA 5BRJA 3K1PA 5EWLB 1MKMA 2Q5CA 2O6GE 3U1DA 3R4KA 5BR1A 4Z9AA 1BIBA 2DU9A 4RY9A 3F8MA 3EDPA 3RKYA 4KYWA 4CBVA 4XARA 2F5DA 1LB2A 1YQAA 3FXQA 1JL3A 4ZYLA 3SZTA 3ULQB 4LFUA 4RXUA 3IWFA 1BI3A 2G9WA 3MMNA 2ZKZA 2WJAA 5TRDA 5E8IA 3J80Z 3MA0A 5JNUA 4AIKA 1ZHFA 2M1BA 1O7FA 5ERIA 3E97A 4RS8A 3PQJA 1BJAA 3CLKA 4G7ZF 4KPYA 3TKYA 3QPTA 4ZYGA 1BI0A 4EMSA 3O2QB 3OQMA 2VBXA 4WXDA 4OIRF 2BYVE 2MYUA 4U7DA 5T7BA 5KQLA 2FQ3A 3KZYA 4I0BA 3M9AA 5E17F 4PDKA 2HQBA 2P5KA 3IHUA 1GXPA 4LB5A 1LJUA 3VNBA 3IP5A 3LA2A 3CUOA 3R60A 1U2PA 1BC8C 5HOOA 4G0YA 2A9OA 3N75A 2B0LA 5CVUA 2YHBA 3M9WA 4RKRA 1I1GA 4IPAA 4DQ2A 3LUAA 5E3JA 1QPMA 2O61A 3CHYA 4HX4A 2A5YB 1DG9A 3ABTA 3WGHA 2HSGA 3W9SA 4GCVA 4QYWA 3LOPA 4KIGA 3O3KA 1X3UA 5L3BA 1OKRA 1ZGJA 3OLWA 1U5TC 3HSYA 3IKVA 1SXIA 1FYMA 5D5UB 2LUOA 4M71A 1TM2A 5E1WA 4OIQF 3B02A 2CW0F 3L2CA 5TQ0B 1R58A 2K7LA 1RNLA 2FEWB 1T6SA 2EA2A 2RGYA 3MZYA 1PDNC 1BM9A 6PAXA 4MQFA 3F23A 1G3SA 3H92A 4O5VA 4ZZDA 1HBXG 1I5ZA 5FGMA 2KKOA 1HKSA 4ZJPA 3RKXA 1TQIA 4BYYA 3FFWA 4ETNA 2PUDA 1U2WA 3I54A 1BC7C 3IWZA 3T8TA 3F21A 3QLUA 2FN9A 1JXSA 1REPC 3WU1B 1RUNA 3KP6A 4CICA 1QPZA 4P96A 1JGSA 2G7HA 3S2WA 1YO5C 2LPMA 4OATA 2BE5F 2FNAA 5TQ2A 2FMFA 3TX6A 3C97A 1IRGA 5HDKA 4MPTA 3RVNA 3TB6A 1D5WA 3O75A 3CO6C 3ZP5A 1R5GA 4Y9TA 1LNWA 3ISPA 3HOTA 3L7WA 4MHGA 1RI7A 1J7KA 5CVRA 1F4VA 4HDUA 4FE4A 3F8BA 2IPMA 2NT4A 3V8LA 3EQLF 3EODA 1L5YA 4RB1A 2RDMA 1QQAA 2E4ZA 4JOQA 4MYRA 1LEAA 2EB7A 2F2EA 4ZYDA 3HSEA 1AOYA 2FBKA 1G6NA 1JDNA 1D8KA 2IA2A 2B4AA 4OMZA 5HQJA 4B8XA 5LRSA 2DBBA 3E3MA 3MCZA 1NXOA 4MS1A 3OMWA 2W24A 1BIAA 2EJRA 3IP6A 5IBQA 3HJFA 4Y13A 5FBHA 4ESBA 4BQAA 1ISSA 5IUNC 3HUTA 3WTSC 5LGNA 3WU0A 3OLYA 3ROTA 3ECHA 3RJPA 3RQIA 4ZYHA 1YMVA 5KQPA 5FFXA 1ZG3A 5FWYA 1FP1D 1D3YA 3T0YA 2MH2A 3HTUA 1U5TB 1YG2A 2QBYB 1AB6A 2HKOA 2M30A 8ABPA 3C7JA 1PHRA 1JBEA 4IRIA 2FMIA 3TGNA 1JFVA 3ZMTA 5JI6A 5AIQA 2K27A 2KIUA 2PJPA 4H60A 2DT5A 2LP4Y 5JNRA 5KQMA 1LK0A 4S04A 1WI9A 4OMYA 5HS8A 4N0QA 4IILA 1DC8A 7ABPA 1IXCA 1FP2A 1XCVA 2ZMEA 4QLCU 2FBHA 2PAFA 3KSMA 4UVBA 3SXYA 4MGRA 3TD9A 5CLSA 3FDFA 1JHFA 2M1ZA 5DTEA 1FFWA 2L54A 3U9GA 1W5TA 3DPTA 2EFPA 2R47A 3OLVA 1NTRA 2XASA 1PEYA 4Q5SF 2R7DA 4RY8A 4MR9B 1S8NA 4YS6A 1YS6A 2KJCA 4G0MA 2WTEA 4HQMA 2Q8KA 3Q7TA 1MB0A 5K5RA 1OMIA 1P4XA 3SQNA 4KV7A 3KKEA 2IJLA 3RVRA 2MYNA 3CKMA 4GGGA 3M8FA 3CG0A 3HUUA 1K78A 2KJBA 1ZITA 2ZNYA 3ZMVA 4LK1F 5D5XB 4MRMA 3EYIA 3C3MA 4MR7B 2Q0OA 3BJAA 1XGNA 3DLBA 1QP4A 3U2RA 3QEMB 2IT0A 1D1PA 4ZMSA 1R1VA 4EVRA 1XDUA 1OXBB 5F64A 3HTSB 4UHJA 3HRMA 1NY5A 4YO7A 4D74A 3LFTA 2IVMA 2KRFA 4EJVA 1XSDA 3HUGA 4G9YA 5AONA 2JVIA 5LEKA 1TQMA 4A12A 4NCAA 3E6MA 4MEYF 2FXIA 1QP7A 1LVAA 2VYCA 1KMIY 1MVOA 5ILVA 3Q15C 1R1TA 4PZJA 2P6TA 4KN4X 2PL1A 5FWXA 3JPYA 3FX3A 1HSJA 4ETSA 3I58A 2D1HA 1FFSA 4Q6WA 3QPHA 3JS5A 1YYVA 3O1HB 4A0ZA 1ZG1A 3ZMZA 4N76A 4LK0F 5LGUA 4HBLA 4Z0NA 3P7NA 3FFXA 3WE3A 4KDPA 3DGEC 5KVRA 2R25B 3EJWA 4MS3B 4EM1A 3CO7C 2VBZA 1YS7A 3O1JC 5ABPA 3HO1A 5DCMB 1UHWA 2P9HA 4YWHA 2PN6A 3KHTA 4W5OA 1P4WA 2VE9A 5FB2A 3BDDA 3OOPA 4N41A 2MSWA 3IRRA 2WRZA 5GQSA 2LSOA 1I6XA 3SFZA 4AWXB 2EFQA 1W7PA 1FT9A 1KU2A 1EV7A 2KIMA 4KUMA 2JT1A 1FPQA 2A9RA 2QSJA 4G0ZA 2MSKA 1SFUA 1B4AA 3BRQA 4Z4IA 2FRHA 3H3UA 3GFLA 3ILHA 2QW1A 2OBPA 3QLVC 1R36A 2FE3A 3SHFA 2Z5UA 4G0OA 4L9TA 4HNSA 1ZREA 3KJXA 2WB4A 4ZH4F 1ZAYA 1QNTA 1T98A 2XUBA 4UUVA 5D4SA 1D8JA 1TW2A 4AVPA 4U7BA 1BI2A 4IRXA 2IYNA 5LHHA 2E4YA 3N97A 1ABFA 3ELKA 2CYYA 1RXEA 4I02A 3H5TA 1GVJA 5D4RA 4M88A 5DUKA 1E2XA 2JVKA 4E70A 4KIBA 2C6YA 3R6SA 4IVNA 4U88A 3H1FA 5IEJA 3JPWA 1FQWA 4KRFA 2HDCA 4E7PA 3AAFA 1GCGA 1L0OC 4M74A 2PUAA 3FWEA 1IN7A 5BS6A 4A5NA 5IUKC 1SFXA 2YHAA 2RN7A 1IN8A 3PFIA 2FQYA 1DJMA 1K66A 6CHYA 4GYIA 4ML3A 3OM0A 3KG2A 3Q41A 5CVVA 3BBLA 3L9FA 4H3KB 1ZH4A 2IRFG 3WTWC 2NS0A 2LIVA 4G94A 3H1EA 5LRRA 5FBKA 3BWGA 3JVDA 1QZZA 2JPCA 4L9JA 4Z99A 3H75A 1U3EM 1ON1A 1DCMA 3SY8A 5HVQC 1WWXA 1O3QA 1Z18A 2PBIA 4BH9A 3BOQA 3VNAA 3SNKA 3I53A 4BHPA 3JAMK 2GAUA 1PP7U 2NZUG 1XHFA 1TW3A 4CHUA 2HGCA 4HX8A 5L3DA 2WY2D 3GWZA 5DUIA 3GV0A 1UB9A 1FX7A 5CHYA 2HYFA 1DRJA 1ZDMA 5D8LB 2NT3A 2BEOA 4RU1A 1S7AA 3QU6A 5JR3A 4M9SA 5D8KB 2MA3A 1U78A 3J81K 3BRSA 4W5RA 3KP2A 1TVMA 2L17A 4L85A 4KMUX 5DCLA 2VN2A 4MQEA 2DLLA 3F8CA 2HFHA 2JPBA 1Z15A 4YP9A 5KWSA 3R0AA 5FD6A 4RWEA 1YK1A 4O1IA 4KFCA 1RZRA 3ROUA 1JYEA 5D5VB 4UVAA 4A0YA 2A07F 4ASNA 4WCGA 4ENMA 4YRZA 2GX6A 5CNIA 1PNRA 3QLTA 1KU3A 2A9PA 3L6UA 1FNNA 5L3GA 1IXSB 4MGEA 5JS1A 4F11A 5TPZD 2HS5A 2E7WA 5IC5A 2OQRA 2YU3A 4UXNA 3CU5A 2XAFA 2PQ8A 2PI0A 4HZFA 4MR8A 2M87A 1A2OA 2OENG 5EWLA 3GT7A 3CS3A 2FQWA 1NXTA 3C6QA 1SRRA 2IKSA 1YFHA 2QZJA 3CRNA 1QO0A 3QELB 5EWJB 3VODA 4LLGF 4HLYA 4MS4A 1APBA 3H5VA 3LWFA 1Z2EA 1CHNA 4LE0A 2CWDA 3FF5A 4ZPJA 4IF4A 2FMYA 2CD7A 3T38A 2DO7A 4RGRA 4M6XA 5LHGA 2B1JA 4TN5A 4Y17A 2PUFA 4IRGA 2MBFA 2ZBKA 5LGTA 4Z4FA 3WTTC 2H6CA 4EV0A 1ZRDA 2H27A 2KYRA 1ZARA 2VE8A 3CUQA 3MEXA 4EGSA 1FBQA 4LE2A 4QWQA 5FD5A 4RK5A 2OD5A 3NNSA 4I7HA 4NV3A 2VT3A 3CDHA 4UV8A 4YFNF 2FMLA 3KE2A 1CF7B 4CO8A 4L5IA 2UXXA 2D2WA 3ABUA 3HZHA 3FM3A 4XFKA 2YX7A 3I0TA 5TPWA 3QX9A 1I27A 5I4CA 4XSZF 2NNNA 3Q7RA 2DK5A 4N9IA 2L18A 1QQIA 4WUTA 4Q6BA 3QLUC 2Q2EA 4CXFA 2WJWA 3I64A 3I71A 5IX8A 3HK2A 3E5QA 1ZHHA 1C0WA 3BPVA 1VLZA 2XAQA 2UWMA 5BQTA 4FB4A 5F6FA 5TQ0A 1UDRA 5DKFA 4L0ZB 5HKOA 1DPRA 2IPLA 4E7OA 1EH6A 2JZYA 5BRAA 4IRHA 4G8XA 1B9MA 1NXWA 2HOEA 2W84A 4RXTA 1S7OA 1USIA 4LB6B 4RAZA 4N0PA 5CNMA 1BOAA 4M6YA 2M98A 4G0QA 2FXAA 3ZN0A 4RB2C 3IRQA 1Y1LA 1XWWA 3KZZA 1QGPA 5JNWA 4UNOA 4I0AA 3ZMDA 4QPJC 2BBYA 2UXNA 1QMPA 1VPWA 2O20A 4ESFA 2EV6A 1DCFA 3KLNA 1FY7A 4OBBA 2VOPA 1FSHA 2PUCA 1DBQA 4EJUA 2TDXA 3TDZC 3ZMSA 4PZ0A 1C0EA 4BHBA 1R23A 4A0XA 1LBIA 1QQBA 2P5VA 3FMSA 1ZG5A 1AB5A 4OG2A 1R5HA 5F1RA 4G6DA 2PL9A 4HF0A 1R7JA 3P9CA 1YW7A 2G7UA 2LNBA 3M8EA 5JS2A 2STWA 3KCNA 2EV0A 3DF8A 3NHMA 1EWKA 4YCSA 3LAPA 2AXLA 4O3MA 3EUHA 3REOA 1U6GA 3RVPA 4G0XA 2HTSA 3RYRA 3H1GA 1OYWA 3DP7A 5DCFA 3HHHA 5HDNA 2F8SA 2GQQA 4K2EA 3E6CC 1VKRA 5DYMA 4LGWA 4Z2YA 4LRQA 3LKBA 3SAJA 4G0PA 1ZAOA 3P9IA 1BAPA 1ZH2A 4YIIA 2MLGA 1Z17A 5JHUA 1EWTA 1Z05A 3IDOA 4U0WA 4TLLB 2OU2A 5DD4A 3OO0A 3GFMA 3WE2A 2PKXA 4LE1A 4EJTA 2CHFA 2A6HF 3FZVA 2F5EA 4ZYEA 2RQPA 3FGZA 1Z6RA 3UKJA 3C3KA 3KFWX 5CVIA 1TBXA 1V4RA 3LUKA 2XROA 3IP7A 3N4MA 4WT7A 1G4DA 1W5SA 3KLOA 3VOEA 5D6FA 1KYWA 1I1SA 1LDKB 2QBYA 1KRWA 1QNLA 3NNDA 1CEYA 4N0BA 2E4WA 4EY3A 1XN7A 1YTYA 1TLFA 1P6RA 3RPQA 1IIBA 5TQ2B 4KZKA 3O2PE 1JFTA 4F8JA 2P7CB 1B1BA 2EWNA 1USSA 3RDIA 2IDMA 3T95A 3KP4A 2L4AA 5HS7A 3G73A 2MYPA 1H9GA 5D5WB 4XLTA 2IW5A 1GLGA 2HQNA 2MD5A 2XKOA 2Z33A 2R4QA 1G3TA 2VOOA 2PUEA 3M1EA 5HLHA 1ZGGA 4DNCA 1ON2A 3ML6A 2A9QA 1IAWA 3W6JB 3GXOA 4XLNF 4JAVC 4KIFA 2A3SA 3GX4X 1ZRCA 1QP0A 4N03A 2QVGA 1YTUA 3QX8A 3HRSA 3KCCA 4HDVA 2OQGA 4MLCA 4MS1B 5ED4A 3FMRA 3R0JA 2ZXJA 4RXMA 3UK0A 3M9XA 4PEVA 1MJAA 1B59A 1JH9A 3OO1A 3HSFA 3RVSA 4MTEA 3GVAA 1D1QA 4G7OF 3MM4A 5D6EA 3HVRA 1EWVA 5ICEA 3GW2A 4PGGA 1JWLA 3RVQA 1RUOA 1T39A 3SM9A 2FN8A 3TO6A 4CGZA 3QEMA 1F9NA 5HM6A 5C5CA 3O21A 2FMKA 4L18B 1V3FA 2V0NA 4PCQA 3O2JA 3HXMA 2FOKA 4ETMA 2E7XA 3DBIA 4UHKA 1BDJA 1FOKA 1PUEE 4O6JA 3TDUC 5L3CA 5FFZA 4KVFA 2NNYA 1Z9CA 1HW5A 2CO5A 4EYQA 5DLEA 2AYXA 2L4MA 1IZ1A 4JA2A 4YFKF 2LF8A 3ZN1A 4ENKA 3NBMA 4H0EA 4IMIB 3VFZA 4CZZA 4LG0B 1U0SY 3K1MA 3KETA 1PUXA 5L3EA 4U0YA 1O3TA 3COAC 3D5LA 4QICA 2Z9OA 1EHCA 4GYGA 1ZLJA 5J8FA 1NXPA 2KIFA 2D1VA 4F7ZA 4MS3A 2JTVA 2Y48A 2F5FA 1TJYA 1MD0A 1HW2A 4U0VA 5DCMA 3F6CA 4JASB 3N53A 3N0WA 4M9ZA 1ZY2A 2CG4A 3B73A 1TQPA 1JDPA 4RV5A 1Z26A 1RZ4A 5BMZA 5JNVA 4W5NA 2V9VA 1KU7A 4F12A 4BAYA 4OLBA 1BDIA 5DD8A 2M5WA 3A10A 1JHZA 4IHSA 4R1HA 3E61A 3QP6A 1OPCA 3RPUA 2PMCA 2ZO4A 4Z4GA 1HKTA 5H20A 5EEHA 4LMYA 3DLHA 4RAYA 3NNNA 1DUXC 4I98B 1E6MA 4MEXF 3V7CA 4JQFA 3R61A 3MF4A 1URPA 3RH0A 3LUHA 3GRCA 3D8UA 3GLXA 2NRAC 4EM0B 1XCBA 2QUFA 3F8FA 1J0RA 3RVKA 3GWGA 2CFXA 2HEOA 1AWCA 2K02A 3OLXA 5TQJA 5FWXB 3QU3A 2EFWA 2XDYA 5K1YA 4GNRA 4D6YA 1KRXA 1ONVA 3DQVC 3CZCA 1LQ1A 1S6LA 5E1ZB 2W42A 4F06A 1Z13A 1J2XA 1WRJA 5HS9A 1E6LA 3ERED 3HRTA 5BQ3A 2E4UA 2PG4A 3GUDA 3FMVA 2ID7A 2VC1A 2DI3A 3FHZA 1IN4A 1T38A 2XAGA 3RYPA 1VTNC 3C1DA 1KQ8A 1XSVA 3N0XA 1F5TA 3LSTA 4IXAA 3HS3A 2FSPA 2RKHA 3P9YA 4B09A 4BHCA 1LDJA 3NHZA 2QU7A 1RIOH 4WZZA 3T6KA 2K4JA 4WX9A 1QKKA 2R48A 4Z9BA 2FEPA 3ECOA 3N0RA 2E1NA 4HX7A 3WG9A 2PJUA 5HSGA 1W7PB 3BPXA 5A2QK 2EFNA 2X0LA 3QP5A 4Q47A 3Q7SA 4PE5B 4P1ZA 1VRVA 4XASA 2ADUA 1TTYA 1XB4A 2ESNA 2BGCA 2FEKA 3KYIB 3FM5A 5KC9A 5EWMB 5H6QA 4HF1A 1OYIA 5J6XA 1USTA 3QEKA 4WXMA 2DRIA 3GBVA 5IT3A 3K1NA 4RK6A 3WTZA 2ZWMA 3NQOA 2GBPA 1ZN2A 2FLKA 1EAYA 1STZA 2ZNZA 2R7FA 1M5UA 2XKPA 3TOBA 5E20A 1XHEA 4WWCA 1DDNA 1O57A 3K9TA 2EV5A 1D4ZA 1JYFA 3QLVA 1J9IA 2K4BA 3KTOA 2FF4A 1IXRC 1J75A 1S29A 2GWRA 1T2KA 3I09A 3HIFA 2O3FA 4G86A 3K69A 5A2QZ 1BDHA 2WC2A 1K79A 4GO1A 3O6BB 3RVJA 4L9VA 4OU0A 2QENA 3H6GA 1OR7A 3GF2A 2IPAB 3EYYA 3I59B 3WTYC 4D6XA 1KA8A 3QOPA 1GHCA 4YV7A 3RVMA 2RC4A 3A3KA 4XXHA 2IP2A 3URMA 1F4KA 4EVIA 5B3JC 3E6DA 3TMYA 2PUGA 1KGSA 4KNYA 4YR7A 2IPQX 4ETIA 1UFMA 4KQ9A 3RTRA 2DPDA 3HHGA 1U2QA 3B2NA 2F5CA 2JRTA 3C18A 3CUQC 2L2QA 5IT9Z 4OIOF 2HKXA 5TPZA 3DPLC 4Z4HA 1RPJA 1Z7UA 4JK1X 5IUJC 4OOIA 4HNQA 5BPDA 4G97A 4H3HB 1SXGA 5T3YA 1HXDA 4HW0A 3EDCA 5CVJA 3GYBA 1KYZA 1DBWA 3DV8A 2XAJA 2QR3A 4YIFA 1DP4A 4KK3A 1SD6A 3LA7A 4L5JA 2GI4A 1DP7P 4MQEB 3WGGA 1XD7A 2MLKA 3SZPA 5KC8A 4P9FA 1O3RA 3MQ0A 1TNTA 2VODA 1EFAA 4Z4CA 5K5OA 3WTVC 3CTPA 3ILYA 4S05A 4HLXA 3F6PA 3OM1A 3HCWA 1YVUA 2ELHA 2BGGA 4EM2A 2XIGA 1J5YA 2FKAA 4TV7A 1M2FA 2P7VB 1MDMB 2X4HA 3OQOA 1FFGA 1KQ0A 3TOAA 1JE8A 5KI6A 4XRFA 4CDGA 3G85A 1Z2DA 4MR8B 4AIJA 3RVOA 3FXRA 2JBAB 2FU4A 2BV6A 1YLFA 3HDGA 5TE9A 1XGSA 4NHJA 3D02A 3IC7A 3MWMA 4EJWA 1TMYA 3LUGA 1P6QA 1K7AA 4MQVA 2DQLA 3BILA 3LFKA 1HW1A 4MS4B 2WV0A 2QV0A 1ISRA 2RV8A 3KP3A 2CHEA 3MYYA 2A61A 4OTZA 2NZVG 4MLDA 3BY6A 5ICGA 1IN6A 2VK2A 5D2CA 2VUIB 3V8JA 2V79A 5IEBA 3I45A 1SXHA 4Q48A 1ZRFA 3CUQB 2STTA 4YFXF 3GBPA 4RGUA 3OV8A 4LZLA 2V1DA 2P5LC 2DQRA 3LUDA 4EGZA 3KS9A 3H6HA 1NXSA 2H09A 2HTJA 1FZPB 3LMKA 5JFRA 3RKWA 2OA4A 2Z3YA 2HJ9A 2MSLA 4KREA 4RZSA 2XHKA 5TPWB 1IF1A 1XGOA 4MNUA 1USGA 4IMJB 2QVCA 4A6DA 4M73A 3E5UA 3LTEA 4EYGA 3F6VA 2VONA 4FE7A 5E1XA 2R3SA 2H0AA 3M7GA 1BA2A 2A68F 3RIRA 3UUGA 2IA1A 2YR2A 1EH7A 3GEZA 1R22A 3DEUA 1G3YA 3DFGA 4OINF 3HM9A 3F73A 1Z1DA 3E5XA 4F3TA 4G7HF 1KU9A 3HRUA 1YW9A 3OMXA 3PQKA 1U04A 4KA4A 4AIHA 4BXUA 1JHHA 1XSXA 2Y0MA 4I09A 3K4HA 2EA4A 1SAXA 1ZH5A 4LLLA 1F51E 1Z6TA 5E8GA 2H3HA 3L09A 4XLPF 1TNSA 3TO7A 5H6RA 2ZCWA 3F7NA 1ULYA 4W5QA 4MQ9F 1W4MA 2FSWA 1FYLA 2FVYA 4MQFB 3TO9A 4ESJA 2O0YA 2QZ8A 1B00A 2J48A 4NICA 4HNRA 2ISYA 3KP7A 3Q5FA 3JSPA 3QK7A 1PNTA 3CTAA 2JRLA 2P4UA 4P55A 3KEQA 5CYVA 1U5TA 4RKQA 4P98A 4G6QA 2LKPA 3TQNA 3H5IA 4JP1A 1MIHA 2PMHA 2HPHA 3IL2A 1DCKA 1SMYF 3LQQA 2NUBA 4M9XA 3ZMUA 2E1CA 3I42A 3S99A 2QVOA 2DK8A 4NQWA 1H9TA 5E18F 1YMUA 2ID9A 3V4GA 1USKA 2QQBA 4EUKA 4YGXB 3P9KA 5FLXK 4HA8A 2VT2A 3GZ6A 5J8CA 1P2FA 1Z25A 5BOXA 4GXOA 3FFTA 1K68A 2OAZA 3O2SB 4XBFA 1J59A 3VEPA 3WTXC 4JBAA 2VBYA 1FSPA 2L01A 2IOYA 4MR9A 2EFOA 1LBHA 1T0FA 1JF8A 2GA2A 4EVSA 4XAQA 1S3JA 3HDVA 3J7AO 2RJNA 3GO5A 2O8XA 2AYZA 3I5UA 5HDGA 2V6CA 1MAVA 3DXJF 3H3ZA 1E2BA 1BBYA 1Y0UA 5DDGA 5K5QA 3CFYA 1JX6A 5EEGA 4BNCA 1M5TA 4RK1A 2OZUA 5FO5A 3H5OA 3LA3A 5FWYB 1PP8F 2WWYA 5JVTA 3I5AA 4L9NA 4MR7A 1LEBA 4IGAA 3OQNA 3DZDA 1NATA 4WXHA 4ZMRA 3CG4A 2K86A 5FLXZ 5DGCA 2UZKA 5CNKA 4LG0A 1GXQA 2OZ6A 4FX4A 3CZ5A 3K9CA 4JB2A 2TMYA 4R8HA 3QAHA 3WODF 4KK4A 4N47A 2A6EF 3CLOA 2LBPA 2PLYA 2FW0A 2L3DA 3F8NA 4WK8F 3MIZA 3W6KB 5LBQA 5AIPA 4KN7X 2D45A 1L5ZA 1M2EA 3F6OA 1WQ2A 2ISZA 2MH9A 2V1UA 2CWEA 1PEAA 3KEOA 1O3SA 2JK1A 2ZMEB 4IJAA 4LX8A 1ZLKA 2YPRA 5ILUA 2GIVA 1E6KA 3N8IA 4ZZLA 2JCGA 1SD4A 4A5MA 3MAJA 4GPAA 5LHIA 4KQCA 2P6SA 4RGXA 4RY0A 3JW4A 3OLZA 1Z91A 4IHTA 1TLHB 5DV5A 4NQRA 3V7RA 4N9HA 2FNPA 4HQEA 1K6OA 3GFIA 3DKWA 2QQ9A 1FWZA 3CJNA 3KP5A 3JSOA 4FT8A 3MZHA 1P8AA 5L3FA 3JVIA 5HLGA 1MJBA 2HR3A 1BI1A 3L00A 2IPNA 4HOBA 1LDDA 4QYMA 4FHTA 4YG2F 1OXKB 2Z99A 2E4VA 1A0OA 4ENNA 1XMAA 1K78B 4PICA 1ZYRF 3N6VA 2HYGD 3O1IC 3EETA 1YK0A 3GYHX 2YSRA 3LKVA 4MRMB 1JFSA 1DBPA 4RK4A 2QM3A 1CGPA 3K0LA 4LDZA 4NCBA 1YIOA 1HKQA 4Z4EA 3FXUA 5GOTA 1FC3A 1CYEA 1EH8A 1SMTA 3EQ2A 3VB2A 2P4WA 1B6AA 4A6EA 2W25A 2N9UA 4I2OA 4HV6A 4Q7EA 3CNBA 2WMYA 3NEUA 3RI4A 4HF2A 1MGTA 2RNJA 1RXIA 3SG0A 4DQDA 1B9NA 2PMUA 2E4XA 3T8YA 1U8TA 4DN6A 1W25A 1LJ9A 4WXCA 5ICFA 1R8JA 4RS3A 2XRNA 5TJJA 1ODDA 4KMRA 3L49A 2FA5A 1GUBA 3RVLA 2ESHA 2QYOA 3NRVA 4EQQA 4ENJA 1J56A 2M45A 2ZFWA 3E6BA 2RJOA
chains in the Genus database with same CATH superfamily
1ESZA 1QF7A 2XXJA 1HF0A 1E9EA 4OH1A 3BD9A 5ES3A 5BSTA 2P6NA 2UVPA 3RYFB 2V7QD 3RNLA 4I01A 2OFXA 3LSPA 2P69A 1HT3A 2Z5FA 1SAUA 4EYKA 1CUFA 3CJQB 4A16A 3S7ZA 5EIBD 2ZSIA 3M6MD 1XL1A 4LXGA 2JI4A 2VS1A 5ES4B 3W2EA 4XUEA 3ZWMA 3IIKA 3TZEA 1E3LA 3LQKA 2G4VA 5EG0B 1JHQA 3U7QA 1MA0A 3FVRA 4R79A 4ZVNA 5E9AA 3CW9A 2HRRA 2NYAA 2YHUA 3F3XA 2JIMA 3OJWA 4JP5A 2Q1UA 4ZAWA 2IGMA 1JKXA 4BP8A 1MC5A 3HCDA 3FMQA 4M76B 2IBTA 1OAOA 3R9IA 1KFEB 1D2MA 4PC1A 4XKVA 2ARKA 5DCYA 4A8HA 6PFKA 2MCFA 4DMHA 2PX5A 3D3NA 2CSOA 1Z68A 2BGLA 1G8PA 2P5TB 4HS4A 1JDJA 2OFPA 3I4PA 3ZQ7A 1YB7A 1FJHA 2XDQA 3MTIA 2IZ0A 1GUDA 2I3BA 5CW1A 4XNFA 3QVOA 1WKMA 1KBZA 2H2AA 3HGQA 1SUDA 1BVHA 4UCFA 4C4OA 2ZCJA 3K73O 1P77A 4EJSA 4AULA 1EKEA 1WDLA 3AIMA 3A2KA 2W8ZA 2XGXA 1O1YA 5ITZB 4X61A 4EH1A 1IW7F 1D5VA 2XVZA 2FV8A 5A5FA 2X7XA 5TJHA 3MZ0A 5HF5A 3JAMZ 5G0TA 5TISC 3PA6A 4YRGA 4L2IB 3K5IA 1FYKA 3U16A 3QKSB 1HYGA 3IHWA 3L3BA 1BO6A 4JR2A 4JQYA 4TS1A 3J81Z 3LV8A 1W4RA 2OHXA 4M0EA 1YGYA 3A14A 3TL2A 4DT1B 2W7NA 1H0KA 3ORHA 3LXUX 2PCLA 4QOGA 4Q00A 1M7HA 4X7BA 1XMVA 3GA5A 1UM8A 2IH2A 3MFKA 1T4BA 5FOUA 2HU8A 1WA5A 1FLAA 4XX0A 1E1RD 4FHZA 3OSFA 4UD2A 3A0HC 2R6R1 4EY8A 4BZWA 1NRWA 2JS7A 4B17A 5KU7A 1LB1B 5BOSA 4A8JA 2HW8A 1UM9A 3J80Z 2M1BA 5E3LA 1CQPA 4JLKA 5ERIA 4XSHA 3U3KA 4S1NA 1I7QB 4OVKA 1N5IA 1AV6A 4A0QA 3FD8A 1L6RA 4IVRA 4N3NA 3AJ8A 3GBSA 3GJ0A 2PFSA 3F6SA 3C6KA 3QVLA 4RJKA 3ZHYA 5D5HA 3GOHA 2QTMA 1WJAA 1ISJA 3RIYA 2HSGA 1BJZA 3K2BA 2QX4A 4CCMA 4G5XA 1HEIA 3B1XA 2RGUA 3EFOB 4M7WA 3IH5A 1YRWA 1RABA 1Z36A 5BSUA 1FP6A 2XVMA 2ZR0A 3H92A 4O5VA 5AUPB 5M34A 1RWXA 1U28A 3I73A 3S8PA 3E9EA 2FKNA 1BC7C 4YJKA 2B8WA 4AURA 2BW3A 1Q83A 5MHTA 3V6MA 1YDWA 2WA0A 4HDRA 3F97A 3LSGA 4BQQA 1P2UA 4ROSA 4PQEA 4AQYB 2EV9A 4CLEA 4OQDA 1LK5A 1R5GA 3AXTA 2QW8A 5EKTA 3VOTA 3ISPA 4FM9A 1DU4A 2E21A 3KZVA 2Y69H 3C2HA 5KHOC 1VDMA 4DUGD 1SUWA 4JOQA 1WVRA 3LT1A 2A9VA 3AVWA 4OMZA 1LKXA 1E9RA 2X0KA 5HQJA 2VZEA 2HU2A 4EUNA 2W24A 1DADA 4NBNA 4DV2B 2FPSA 3IUYA 3VDNB 4D82A 2PGIA 4C2MJ 3IUOA 1UMBA 3FYUB 3F9RA 4Y3UA 4JB8A 2DSNA 4YROA 3ZW9A 1KI6B 4CT0A 2B99A 2J9GA 1UJMA 2ST1A 1W0CA 4TLDA 5D84A 5EE9A 5BN4B 3WP1B 1TU3A 1Y4AE 4RA9B 1G8MA 2QP9X 1J6UA 1JBEA 3JWJA 2FMIA 1K5HA 3HU3A 4B31A 4NQWB 1J1ZA 1EUYA 1QIMA 2ZYVX 3EGVA 3I2HA 1LNSA 1X1AA 2Y1KA 2X85A 5DB4A 3WK6A 5EL0A 1NTRA 5E7MA 1P0PA 5KNDD 4JEUA 3R7AA 1S8NA 3FLBA 3VOSA 3OLQA 3D2LA 4J3JA 1E5VA 1NQTA 1VIVA 1JSCA 2VF8A 3OYHA 3C1AA 2IJLA 2XZLA 3QPBA 3S27A 3HUUA 2GXQA 3AVUA 2QRQA 5BSMA 4DIUA 3R0IA 4CCWA 3OHSX 4MRMA 3L2QA 2QGNA 2HRCA 3DLPX 3P2MA 2IT0A 3N8HA 3OI7A 2QTCA 3HPHA 4CM4B 3MWDA 3AEUA 3LDUA 1NY5A 3A36A 1PKXA 2DCUA 2R4UA 5AONA 1BJKA 3JQRA 4A12A 2WSYB 4NCAA 3PSAA 4MEYF 1DDGA 1O5IA 3RJMA 1T2DA 3RFXA 4DMFA 1T35A 4GYWA 3SEZA 3DVLA 1T5TA 4CKEA 3I58A 5BSRA 2EFCB 4PR3A 1QIHA 2CMHA 3I37X 4XTRA 3GTKJ 3SC6A 4AG3A 4OLHA 2W6ZA 1ZZEA 4OSPA 1X7YA 4LZNA 5J1YA 4OQPA 4EM1A 1JUDA 3ZY2A 2GYYA 4HZGA 4DWOA 2ZRJA 3BQMB 2EDCA 4OLJA 4ZICA 3K32A 3SXUB 3MJDA 3UG6A 1GPJA 5EJAA 4UUSA 3JASA 1O54A 4MV9A 5CCBA 1JXAA 2BELA 1N0HA 5DISB 4LISA 4CG0A 4YP7A 4REQB 2JLSA 3GFLA 3W2VA 4BY1J 3GPLA 1Z6YA 3AVPA 4LZAA 1RETA 3K6KA 4CW7A 3ENQA 2ZSEA 1PL7A 5AJHA 3I9V1 3K6SA 1JR3A 1WMEA 2V03A 2X0JA 3W9YA 1FMTA 4HX2A 5DUKA 1ESEA 1Q0SA 4YEJA 1KY4A 7AT1A 4J0KA 2CLOB 2HDDA 4F56A 4MYDA 2V4MA 4YMIA 1WH7A 3L9WA 4FEGA 1ODTC 2V26A 2UZAA 4DNOA 5IT5A 2F1IA 4E5DA 1G0NA 1GV2A 2MOKA 4BU2A 5A03A 4XM3A 5A7GA 5CVVA 3BBLA 2G8NA 2PT6A 2NS0A 2C8JA 2FP4B 5AT1A 5T4HA 1VPDA 4V0KA 2XXAA 2FGJA 1L5HB 5FR1A 4QPNA 4ZYWA 4IGIA 1BDBA 2W6CX 4Q39A 4YT5A 1Q1VA 1DIGA 4DMKA 4QBHA 4ZC3A 2GAUA 1PP7U 2PYDA 1R0YA 5FOXA 2YZ7A 4RU1A 1QR2A 1UBTS 4NC9A 1DHRA 4LC1A 4QASA 1Y8QB 3NVAA 2MA3A 1MAHA 2GBCA 4HLQB 3WLLA 3B60A 2ZQZA 1FYDA 5DX1A 4MQEA 2CXOA 3P0FA 3VZPA 1Z15A 3WNVA 5AIBA 4WN9B 4HLCA 2DODA 4C76A 4K9PA 4GP6A 5IFLA 1Z06A 3L7MA 4RBOA 3H0DA 2Q7XA 2QAIA 1YZ3A 2PMKA 1R66A 3T99A 1XMSA 4OP2A 2HS5A 3L2VA 1RR7A 3T06B 2GBFA 2ON6A 1X7ZB 2JJ8A 5SYMA 3PIIA 4BIMA 1PJSA 1YJ9I 3TB4A 5ESDA 3HEMA 3KB6A 4MDYA 1UZCA 3E5HA 2XGJA 1JVBA 2PO5A 4XKJA 2JHGA 4MS4A 4ZANA 1TTQB 1UWLA 5K4GA 4XR6A 4XSVA 4W1PA 2O7OA 2B1JA 4IHJB 4JZYA 1LFUP 1BQ3A 3BQYA 2HPAA 4DLRA 3CINA 2JIZA 5ALIA 2HXSA 4EV0A 1ZRDA 2FWIA 2EH3A 4A23A 3EMVA 4YHHB 1U1CA 2NV2B 3QVWA 5C81A 2BE7A 3ZEAA 4JDUA 2BR5A 3PGA1 3I0TA 3WLEA 2ZU6A 4KMSA 4XSZF 2NNNA 3L8EA 4NBQA 1K4KA 4N9IA 5GP1A 1EH5A 3PUZA 1QQIA 4LS3A 4WUTA 2I4LA 4Q6BA 2CFOA 1PJ2A 3NTUA 3H11B 2ID8A 1NTCA 1ORVA 4JBXA 3WYEA 1ULZA 3JRWA 3WJAA 5REQB 4KLNA 1BVUA 2H4JA 2AE1A 1WXXA 3DE7X 5DW0A 1DAPA 1EH6A 3TRHA 3ZY3A 1I1HA 1T8SA 3JQ7A 2IE0A 4IH4A 3BMOB 3BSSA 3PI7A 3C6ZA 4M6YA 4DRZA 3IRQA 2HNHA 1Y1LA 5JNWA 4HWPA 1H4SA 4XFDA 5K3FA 1UANA 4OBBA 3CNLA 4IO1A 1X8JA 1OGIA 2J5KA 2H3EA 5J59A 3FMOB 4OG2A 4FHEA 3ND8A 4OLFA 5B5SA 3M8EA 2QHXA 4J0DA 3PPIA 4KXFB 2XIJA 1RWOA 1RWQA 1DBIA 1E79A 2PS0A 5JWOA 3TBKA 3H1GA 2CLCX 2NU8A 1C7JA 4Z2YA 2DLCX 4L8YA 1T9GR 2VDVE 1QA6A 1CD5A 4PZZA 4LF5B 2AFHB 2GTHA 1PZHA 3NPAA 1TMGE 3ASVA 3QMWA 3DU5A 3LX8A 3LS2A 5B1HA 2UYQA 4C0BA 2WC1A 3CKYA 1OSNA 3CB2A 1V1MB 2FWMX 4PWZA 5TQ2B 1I7DA 3HFJA 1E96A 3T9BA 1IE3A 3M70A 1FJLA 2I99A 1RPWA 3HI4A 1M6VB 4HSGA 2V3CC 3P2YA 3DBLA 1TGVA 4AUMA 4YAGA 3RRXA 1C9EA 3U7HB 4UUOA 2HIGA 4AN0A 2J5XA 1R4MB 5KKCA 4ZVVA 2IS4A 1NI4B 1UBJS 1LC0A 4C3JJ 4X1YA 2ZTUA 5JNLA 5F98A 1F0YA 3NWJA 1TK9A 4F3QA 5IJWA 3OYJA 1K1EA 3ZCRA 3QPSA 4DLWA 4PTYA 4FGKA 3GPIA 3ZHCA 3PNOA 2QTNA 2XCOA 3E8MA 2MG4A 1YHZA 1FOKA 1BW9A 2WABA 2WWRA 3D6JA 2ZB7A 4ONEA 3ZDAA 4MKRA 2VUUA 3IMKA 3TOZA 4RF3A 1GPBA 1DEOA 1JDBB 2FG6C 4DHEA 2ZYGA 3PL5A 4IIHA 4KX3A 1VE9A 4U0YA 3H86A 3FE2A 1X19A 3P96A 5FADA 2YHIA 1QH9A 1NXPA 2A1TR 3AR3A 2IGKA 5E3NA 4RCVA 3ZHOA 4J7XA 1TJYA 3Q6NA 1XE3A 1RQ2A 2LCIA 1POXA 4RY2A 3JQPA 1KP9A 2GPYA 4GMFA 3B12A 4XIFA 2PXXA 3BT7A 4DNXA 3LC1O 3E61A 3CUTA 1G2PA 2L9VA 4EEZA 1ECBA 2F1RA 5KAFC 2XUGA 3ZCUA 1XSEA 1C50A 2W2QA 4GXQA 4MEXF 3MF4A 2RG1A 2WUVA 3L2WA 4TWBA 3IT2A 1MHTA 5CX1B 3ZU6A 1AWCA 4MJ3A 4MUMA 3IE1A 1ZU4A 2QT1A 4C88A 3NCTA 2EYUA 4BLQA 4M7OA 2XMRA 4DZZA 2CVQA 1F8FA 4RVGA 5GPBA 3HRTA 4DNQA 4QOJA 5ALTA 2PG4A 1L7QA 3FMVA 1YI2I 2BGKA 3EGDA 4OHUA 4DDKA 4QJBA 4ZI7F 3KV1A 3R0XA 1Q2XA 2R7MA 1CZKA 2PGNA 4IX9A 4TYWA 5JC1A 4DRXB 2K4JA 1EWQA 1E1QA 1L5NA 3N0RA 1D8AA 2XNJA 3OIFA 2GVDC 2VUMJ 1KOJA 4U87A 1Z5GA 3OY9A 1CQJB 3DR3A 4O8CA 1J0XO 2DA2A 2WK1A 1JI3A 3S7TA 4FQ7A 5BWMA 2ZTSA 3RJ5A 4BV8A 1MPTA 3OFKA 4F86A 5CM8B 5EGNA 3EUEA 5G3ZA 1WQ3A 2VHUA 1IV8A 1IONA 2Q2NA 4HAVA 4D8YA 4CH7A 1KFJB 1WXIA 2EV5A 4LCBA 3JYPA 3GF4A 4YXWA 1BDHA 2AUMA 4RZUA 3RVJA 1CF2O 1ZUNA 2DPGA 3EYYA 4POAA 2R00C 1CR1A 1O89A 2IIPA 1YQXA 4XQCA 2RC4A 1VE6A 1FMCA 2AF3C 1GUUA 4OJKA 3WA6A 3U4QA 4FZJA 3AZOA 1AF7A 4EDFA 1RYYA 3F5FA 4QYXA 3GROA 3UT0A 1KK0A 4TS3A 4C0AC 1E62A 1ZFNA 2VJDA 2K9NA 2Y1FA 3RQSA 4N65A 2A1UB 3O8LA 3U9SA 4AAYA 4JH0A 2C4MA 1GV1A 2REOA 1IHUA 3O84A 2WFLB 3IIEA 4Z9XA 1HLPA 2XCQA 4KK3A 1PFUA 4M83A 5HNHA 4LQLA 2Z83A 3GAAA 1F4LA 2IXTA 1ZJWA 3O7WA 1WCIA 3EZYA 4WBSA 3HOXJ 4HDSA 1UKVY 1H8HA 1FDRA 1JZTA 1Q6YA 3P5BA 1TXGA 2I7DA 4YUZA 1NRXA 1AK1A 3QVXA 1RMTA 2D59A 1DWUA 2H18A 1CE8A 3DOUA 4CDGA 4ZC1A 1T3LA 4XWWA 3WLOA 3FXRA 1MBZA 1NJGA 4YTEA 5L95A 4OHOA 3IEPA 4NHJA 2C0CA 2ZSDA 3T35A 4NATA 3S2DJ 3D54D 2AUTA 3DVQX 2D5LA 2DECA 2X14A 3VYVA 3EUWA 4RPCA 2A61A 4M3NA 3WRYC 2O48X 1XZMA 2CLSA 4MB2A 3ONEA 5TSDA 4LOLA 3AFHA 5G41A 1IG0A 3W90A 4YDHB 4NXNB 1LZKA 4J0JA 3KZKA 1FZPB 1NAIA 1GPH1 1P7JA 4JJ4A 5C1PA 3VYTB 1ZONA 3TVYA 4KREA 3G5UA 2Q28A 3N7UA 2RI0A 3CGGA 3OZDA 1XGOA 4ZTUB 1U8AA 3LTEA 4M89A 3OTWA 2IY8A 2RI1A 2NPOA 3TSZA 3A70A 3K6GA 2W90A 2Y9PB 3EY4A 3FZEA 3ETLA 4WFKA 1BXZA 5D7NA 4LRSB 1FW6A 1V3TA 1DOZA 4HH0A 1QLJA 3TTWA 2UUAB 1VDZA 4JI3B 3VH4A 2Z2SB 1CQXA 1UBHS 4G5QA 5FL7D 2GEKA 5JPIA 2EIJH 4C22A 4AZTA 3EZXA 1A88A 4CLHA 2KPOA 5DHRA 1ZZGA 1G9SA 2ZCWA 1LX6A 2WOJA 4W5QA 2HEGA 1NQWA 1EG2A 4YAWA 1V8FA 3Q5EA 2D2FA 4I4CA 4BPBA 1L7OA 2QJRA 3VNSA 4LFBB 1QVRA 5K1ZA 1FCJA 5C31A 3PJDA 2J3IA 3QU7A 2Z58A 4M49A 3ZJVA 2WU1A 2CQQA 4EB3A 4EFNA 2JAPA 3VV3A 2AOTB 2EEPA 1R0CA 1PWEA 2ID9A 2NO5A 1HURA 3GZ6A 2F6RA 1A6IA 1FTQA 1JQKA 2XUFA 4YDSA 4LC9A 4CKZA 3H0KA 3ROEA 4XBFA 1ADBA 2Y68A 4PINA 1JF8A 3PP8A 1YQGA 2OZLA 5K4AA 1UK7A 1NW6A 2BN4A 2C20A 2VJBA 1R6UA 2HRDA 1EDEA 2P41A 1RXWA 1DDOA 1MAVA 4H4EA 1GD1O 1HZZC 1AMOA 4R1QA 5BUSA 1SVKA 4QGGA 4RHFA 2PX2A 5FO5A 4PLWA 1CUBA 3NKVA 3O4JA 2CMPA 4JVLA 1X80B 2WIBA 5EKXA 2OZ6A 3GLGB 4KN7X 3QODA 4C43A 3F6OA 2K7ZA 5JBQA 5FKOA 1G9XA 1TT7A 2ZRHA 2R4TA 5K9ZA 1RKXA 5F1OA 5C0OE 1XKLA 3L7NA 1J8MF 1WU8A 3C3XA 4ZZLA 1KYQA 3I05A 4FYIA 4KX5A 3X1XA 4MGIR 3IB3A 4S0ZA 3G2QA 4NQRA 1T2UA 2QLMA 3THXA 1SKAA 1E77A 1MO5A 4P82A 5M04A 1TO1E 2X5JO 4RAQA 2ZRPA 5HTOA 1TM1E 4DL9A 4MJLA 2DOAA 4CCYA 4DSTA 2AOVA 5IU6A 4FHTA 2Z99A 1NYRA 2PWZA 1N7JA 4LJKA 4PICA 1K63A 2J0EA 1RI3A 1YK0A 1YQDA 2VTBA 1JFSA 1DBPA 2QT9A 4QARA 1OD6A 1YIOA 3K70B 4BE2A 4RFVA 1LPOA 5GOTA 4CHGA 1CYEA 4MHTA 2ELKA 2JARA 1GGFA 4REOA 4ER6A 2EIXA 4XUDA 3EWIA 4HZUB 2BMVA 3ZLJA 1MGTA 2B98A 2H85A 2Y1LA 4C0HA 1U8TA 1LVKA 2PHZA 3FI0A 1R8JA 2M6KA 2VK4A 1ODDA 3L49A 3Q1LA 2ESHA 3NRVA 2FPIA 1JA1A 2MMGA 5HXAA 5I9BA 2LRDA 4HEA1 2DBQA 3L5KA 1LA2A 4KN6A 5AI6A 4A03A 5DM6F 1GL3A 1X42A 4DANA 3PL1A 4ESVA 1LLCA 4BAUA 4ARSA 4TZ0A 4F3CA 5KUTA 4W1RA 3RKQA 4EG3A 4JVNA 2P4SA 4XW2A 4NZNA 2CNLA 2B25A 1HBJA 4BVFA 1QO7A 3STYA 3G79A 1R7RA 3OZ7A 4Q12A 3IBTA 3H8SA 4KXLA 2J5OA 1IQ0A 3FK7A 4WNYA 4EJOA 5LIRA 2HV9A 4D8VA 1SD7A 3ZQ6A 1NKSA 3FVVA 1D03A 3LLVA 2JEOA 2MC3A 1S72I 4OIMA 1FSZA 2ZDHA 3F3MA 4KOAA 2ZJFA 4URVR 3M8KA 2QSZA 5JO9A 3R5TA 4P5OA 2BR4A 2YVUA 4YCAA 4WEOA 4EPRA 2AN9A 1KMHA 2BDUA 1VPTA 4WY5A 4OYHA 4ZHQB 1P6UA 3CKKA 4LVCA 4I6ZA 2WSSA 3IR5A 1C9MA 2J08A 3PEUA 3ETGA 2CUTA 2VUHB 3F2VA 5COAA 5H3CA 3L4BC 3JD1A 4NC7A 4F46A 1BOOA 1XMKA 2PFBA 1KGDA 4KXNA 4A1FA 2FW9A 1AK2A 4MIEA 4PIMA 4XONA 5B7GA 1R6BX 4WHMA 3MTAA 2KM1A 3FYSA 1E2KA 5JQGB 1B8PA 2AQIA 3AY6A 4I46A 1YZQA 4YO8A 3EG9A 2I87A 4QBKA 4UTZA 5FR2A 4GZMA 1YCHA 3A1FA 2RNGA 3GL9A 3G2HA 4I66A 4UW9A 3AFMA 3F72A 1U0NA 1AA6A 4L9SA 5AHRA 3G1UA 1EVZA 1K61A 4WXEA 4Q24A 4ON0A 1ZO8A 2HZTA 1X94A 2R00A 3I9MA 5TIIA 1X8KA 1JG2A 3AEQA 2Y1XA 3D6FA 2P7IA 1RRGA 1CUGA 3A6PC 1K8ZB 2GPTA 1ZM4A 2V54A 4H0CA 3H8WA 1KFKB 4K03A 5AW7A 2FI1A 4GOKA 3DG9A 1PU2A 3H87A 1OZFA 3ONQA 3S1NJ 3HACA 4F4UA 4HD8A 3BQZA 4BFCA 2GN0A 4LXHA 3CLKA 4DR6B 3GTMJ 1CUSA 2VF5X 1BMFD 3BIJA 4DKXA 1Z4IA 5DI3A 3D3WA 4I3FA 2DYRH 1GAXA 1VHLA 3IHUA 1CY1A 5B53A 1FF9A 3ZJTA 1M6NA 2YHBA 4ZZIA 1JU9A 2BGNA 2CYBA 3CSDA 3OF5A 4IX1A 1YRYE 2K2QB 1S4MA 4RJLA 4BX3A 4OIQF 5TQ0B 1R58A 4ON9A 3UICA 5AVVA 4GQIA 1M74A 1Q0LA 4BN4A 4ZU3A 4K81B 1HBXG 5BSHA 2JGDB 5JY1A 4V24A 4HWKA 2YWRA 3CSUA 4PLHA 4AO6A 2NZ2A 2NG1A 2I3AA 1BGVA 1AKRA 2BGMA 4RCYA 1DGWY 3EXAA 2QSFX 2BE5F 4Y6OA 1G4HA 3R3WA 2ZKIA 4WNCA 4CI9A 2C42A 5EG5A 1TC3C 3TB6A 4BUPA 3ODGA 1GLVA 3RUAA 1XMIA 5M5BA 1M75A 4WCFA 5FRMA 1WCMJ 1XGKA 4RTLA 3BL5A 2CV2A 4F8EA 4FBMA 2WYOA 3UTDA 5HE9A 3P7MA 3BEDA 2O14A 4AXXA 3RU7A 3GFSA 3IBYA 1N2CE 4ZTJA 1WHSA 3H3VK 3RSFA 1SA0A 2F2TA 5CBPA 4DEXA 3M7IA 4CCNA 1DEHA 4L50A 2X8JB 3TDMA 2Q6KA 2M30A 2Q4OA 2QUAA 4CFSA 1A8SA 1QV6A 2PJPA 5LFAA 3CMYA 5KQMA 3ME5A 3E15A 5TEWA 4XB2A 1AY0A 3G2JA 2B5OA 4RHYA 2I4TA 3CPJB 3A11A 1H93A 3TJZA 4JJ7A 3U9GA 2HM7A 1KY3A 5DASA 4YRPA 4QO7A 3P52A 3CF4G 1S2MA 1NG7A 2HZDA 3KXLA 2X0DA 2JI7A 4GX0A 4NIMA 3CKMA 3CG0A 3PF8A 4HNAA 2IBDA 4TQGA 1Q1EA 4RSGA 1NKTA 4BXOA 4Q7MB 2LBFA 2ZYTX 3GJ7A 5DSZA 3IKMB 3IV5A 3AIOA 1XGNA 3B6EA 4BO4A 4DM4A 2VYVD 1NMYA 5CCXA 3EZFA 1F3LA 5F64A 1FTWA 2J6HA 3NGMA 1PFYA 4FCTA 5I51A 4XWAA 2ONKA 2ZAMA 4LDPA 3Q15C 3SK0A 1U8YA 3HL2A 5DBOA 3FX3A 1IOWA 3CF6R 5LKAA 4Q9IA 3QPHA 3JS5A 2WINI 1ND5A 4LZJA 2GEJA 3IUSA 3TE7A 1CIJA 1PS0A 2F3TA 3PXDA 2O3SA 3S1AA 1L3IA 4MS3B 1GQSA 5BQXA 4IHAA 3IEXA 1KERA 2GVZC 4M4SA 3Q98A 2WU8A 3BDDA 3V1TC 3AG5A 4ZEXA 2WRZA 4DYRA 1I6XA 1O58A 3VJLA 2ZIAA 3TL3A 3JAWA 3I1IA 2ALJA 1QTRA 3HXTA 3T0GA 5DBEX 2VC2B 3MGBA 4AZSA 3ZGVA 1RR8C 5F1JA 4COOA 1OAOC 2VIIA 4X6UA 1F1BA 5KS2A 1A9YA 3KL4A 4RSRA 4QPOA 4XRSA 3RFUA 1A72A 1DAKA 4MMYB 5BP7A 3AHGA 5CQGA 2ZSKA 4AVPA 5J40A 1JDVA 1NSFA 2ZJBA 1W47A 3DNFA 1A76A 3DDWA 3EDYA 2VF2A 4M88A 2ONZA 2JVKA 4G1UC 5AJVB 1NW8A 2CMKA 1UKBA 3R44A 4UEJA 2EZ8A 2OWDA 1DKRA 2ZI4A 3IJPA 1VQOI 1L8OA 3O8NA 1ZTRA 2H17A 4WXPA 3OY2A 2RN7A 5FF9A 3MILA 3PZBA 2ONJA 5CITA 4IF6A 5KSPA 2GJKA 1JIJA 4X5OA 1IMOA 2ANCA 1E1YA 4IFIA 3PXAA 3CC2I 3H75A 1YH3A 1U3EM 1P5ZB 1ON1A 3GLLA 1TKCA 4BRUA 3AR6A 2WAAA 4ND8A 2XQIA 3I53A 2QSUA 4E88A 1G9TA 2W43A 1CSEE 1XHFA 2HWYA 4R2JA 3AR5A 2H2HA 1A35A 4NMWA 4DLKA 1V8BA 2R1VB 2DLLA 3H18A 3CV3A 1GGVA 3KQNA 4B80A 3WFIA 5FHQA 4FGJA 2C5LA 4NYJQ 1AQUA 4CMCA 4E1VA 3R6DA 5DTMA 3KR2A 3B36A 4NYIR 4F6RB 3OIUA 1GEGA 5DFAA 1IXSB 4DLYA 4R9VA 2R7XA 3QTTA 3QQPA 3ANMA 4A8JC 3BMNB 3LHFA 4DCUA 4MR8A 3PX2A 1ONPA 3GLGE 1V4VA 4EW1A 2P7HA 1A5TA 5HQ3A 1SRRA 1V35A 4RVDA 2Q45A 2FH5B 1YFHA 2QZJA 5H83A 3N9IA 4OAQA 3S3NA 4MUXA 5AJYA 4LLGF 1SM4A 2P91A 3FXMA 3L84A 2CWDA 1JGTA 1YHNA 2CD7A 1QG0A 4NWIA 1FFEA 4HRXA 4NMMA 3QNMA 5J4LA 5SYAA 3QYAA 5KNCD 2ZXHA 2D2EA 1OH6A 2VBCA 5CIYA 3LJKA 3CDHA 4H7FA 3JYOA 4CO8A 4L5IA 2UXXA 3AEKB 1WJEA 4PX3A 1CQTA 3EMBA 1B76A 4KIJA 1BXRB 4KH0A 1XEXA 4KZPA 4C5AA 1GU0A 1JLLA 2VAWA 3VHRA 1BCSA 4CXFA 2MSDB 3P71T 4MRAA 2PKQO 2AVNA 1OFHA 4UE2A 5BURA 4XWOA 4MV0A 4P0TA 4OYYA 4ZAVA 2C57A 1WBJB 4MPPA 1DPRA 5EESA 3GNSA 4E03A 1MFPA 4ZK6A 1PUJA 5KX5F 2WJ4A 4O0LA 4RAZA 3Q8KA 3NT4A 3WGNA 3ZOKA 4RB2C 4B7CA 4TVOA 1DLIA 4RCZA 2ZTLA 1XRMA 3FHCB 4MVJH 2Q46A 3AWIA 1C0EA 3H1PA 2WILA 3HGGA 2OO7A 1GGNA 1DU0A 3PM1A 4G6DA 3QX3A 1UKYA 5K0JA 2LNBA 2HU9A 4YECA 2ZB8A 1L8LA 1UXKA 4IZIA 3LAPA 5EIOA 2AXLA 2CHVA 4CHTA 3BG9A 3BKXA 1JI8A 2HTSA 4Z4QA 1JG3A 1KHTA 1KVTA 1CT9A 4LRQA 2BM8A 3MJSA 4IS2A 1C7QA 4XJSA 1Z17A 2X5KO 1XQXA 1M1NB 3G6WA 4EJ0A 6ADHA 4XKCA 2IOHA 3LUKA 1GNPA 4OA5A 1OFUX 4N5IX 2J3JA 5D6FA 1Y6IA 1M6YA 1OXVA 4XLFA 1OR8A 5CDHA 2GCIA 2ISQA 2XWJI 1TLFA 3A37A 2RH9B 5F9MA 4D92A 1YU6A 4BC1A 3FWKA 2R4QA 1BG6A 1J00A 3ANLA 3WMWA 4JLUA 2IHBA 4Y2VA 4WCVA 4TWRA 1E7QA 3V1YA 1RPZA 1C9YA 3DTKA 3TOCA 1VLLA 3R0ZA 3VHLB 2IH4A 1PLLA 2IXDA 2J4FA 4MS1B 1S9DA 2ZUDA 2HFJA 2GM3A 1OV6A 2KHMA 2EX4A 3RRJA 1OT3A 4MV6A 2C88A 4B6SA 4ARUA 2XHEA 1A3CA 2QQ0A 2QRUA 1NVDA 5C5CA 4BU0A 5IKMA 1J2RA 3PNMA 2OM6A 4BYGA 3ETDA 4FYHA 2OAGA 1NX9A 1PUEE 2W0MA 3NALA 2ZW9A 3PEWA 5KHLB 3MELA 4G65A 2LF8A 5KAIC 3TXYA 3NBMA 3NTRA 4X3PA 4QLOA 4JWTA 3CVJA 1ZNWA 3B3FA 3RB8A 2JTVA 4O4JB 5BSGA 4HDKA 3CXRA 2X58A 2VDLB 5DP1A 2QTVA 2OO3A 1SCNE 4OLBA 1ESMA 4A3FJ 2M5WA 5ITVA 3T52A 2R60A 4N8SA 2QD2A 3AM5A 4Q34A 2GKSA 3LVRE 1S1CA 3GR6A 2Q5JA 3T4PA 4JQFA 1EPUA 1UPFA 1UOEA 5LOVF 2RAPA 2IOQA 3HYCA 1VPLA 2V7VA 2GYVA 5FWXB 1KRXA 2FUCA 3ZDBA 2I7VA 3TP0A 3GZ4A 5HS9A 4HDNA 3O95A 1ENHA 1C8BA 4L5CA 4XDZA 3F47A 5JAIA 3FHZA 1T38A 2PR2A 3CCQI 4RTJA 1H9BA 3VAAA 3N0XA 3G8DA 1ZIOA 4UNPA 4B09A 1LDJA 3FCYA 4S2UA 4B8ZA 2V6FA 1EDBA 2P9QA 1X7HA 2X0LA 2PQMA 4YHBA 1F14A 3K4QA 1I4LD 1P2BA 3LXMA 1TCVA 4GFDA 2REQA 1RI5A 3R9XA 5LUBA 3X3HA 1OYIA 1BRTA 4X85A 4D9GA 3VAYA 4WXMA 4BJHB 4DV6B 2O3RA 4C7OB 1LC3A 4P4UA 1UJ2A 1QIIA 1MB2A 5EZYB 1PGOA 1XHEA 1U63A 2YZGA 4V39A 2AIRA 3USES 5LOVA 2FN7A 4OU0A 4V1CB 3ZZ1A 3EVDA 1E1NA 2Y0PA 4YV7A 2YICA 3RVMA 4MA0A 2HDNB 1HL7A 1DXHA 3HA7A 1KJNA 3L06A 3WB9A 5PGMA 1Q22A 1OPRA 3G23A 4UPVA 2O5CA 2UZ3A 1RFGE 3T7EA 5DEIA 1WLYA 2WUGA 5BPDA 4FOTA 3FF4A 4YRSA 2WDPA 4WK4B 2WTXA 5CVJA 3R3YA 4ALIA 2XF6A 5IHXA 3ZVNA 3W2FA 2XAJA 2WWTA 4UHEA 5BV8A 4KBGA 2PLAA 4DC9A 1TJPB 5U4XA 5DNUA 5CB0A 2NLOA 1W59A 2DP4E 3CT6A 3CTPA 2L0XA 4C0JA 4HS9A 4QHYA 2BGGA 1J5YA 1NF2A 2ZKLA 3TOAA 1G1MA 4N54A 1JE8A 3ZDZB 3BE6A 4MWGA 2WEKA 1JILA 1VZ0A 3QA3E 4DBZA 4MVJP 4P1WA 1X74A 3B9RA 5BV1A 1KEEB 1XGSA 1YJCA 3LUGA 1P6QA 1RRMA 1LPPA 1L4FA 4CM9A 2E1MB 1Y81A 3IAS6 5E7IA 2HF9A 4JITA 1FUKA 4IQ4A 1AC5A 1YRLA 2VUIB 3KX2A 4PO3X 1I33A 1PJRA 4AS1A 4Q48A 1EB8A 4WJZA 1IVNA 3ZJ5A 2XRFA 1WR8A 2VG8A 3LUDA 3OFND 2BVLA 3OCWA 2XMZA 3RREA 5KNBA 5LMZA 1H05A 2XUHA 2IA5A 4D8WA 2AJ8A 2A68F 1EH7A 1G3YA 3EC1A 3HM9A 5G4LA 4IIDA 5L3VA 4ADSG 4BTLA 3W5SA 4I09A 1K97A 3FDJA 2YW9A 1UZLA 4GVLA 1LY1A 4PVDA 1M8PA 4GXTA 4MROA 1WJ5A 3W5UA 3P9SA 2IZ6A 2PBRA 4OGWA 1CB7A 4U0KA 3SDGA 4FD2A 4IHWA 4QPZA 2ISYA 2DJNA 2VJ5A 2R93J 2E34A 2QRMA 4J6FA 4ND5A 2V7FA 4UUTA 2E19A 5D51S 3Q87B 5AJTA 3ZJYA 3D6AA 2QL6A 2E1CA 4CTJA 1X1BA 3CCEI 1UHSA 3BEOA 2X7HA 4BN0A 2DMQA 2C61A 5FLXK 1BN6A 3O6VA 4NBWA 3UWKA 1JAZA 1P2FA 4JXKA 2FETA 4A73A 1O8CA 3FTEA 4FSXA 3O8CA 4EW6A 3W3ZB 1EQUA 2QDXA 3CPEA 2A67A 1ZD5A 2XCLA 4MKIA 1SEUA 3VR4D 4YI5A 3V1MA 4DREA 4C87A 2FX3A 1QIEA 1EVIA 3GRFA 3L8CA 3BRWA 4NNPA 3IEVA 3RRBA 5EEGA 1U9ZA 1M5TA 1GZ3A 2OZUA 2XA2A 4Q4JB 3OZTA 4BE0A 4UTVA 1UFOA 4Y2JA 1CIPA 2M9MA 3K30A 421PA 5G40A 3TLEA 4GNKA 3L7DA 3FSGA 3GVXA 4Q82A 2ISZA 5GVSA 2VLIA 4D9NA 1QANA 4LG3A 1U8BA 3KVNA 1Z4LA 1C8LA 3IB6A 1J2TA 4MPJA 5DYIA 3SBDA 4DBLC 3OLZA 1MNDA 5EUQB 1LI4A 4N9HA 4Q16A 3TN7A 2FNPA 2GSWA 1UAYA 4ZEMA 5DNWA 2HSJA 4FDMA 1NAHA 2HMTA 3BWXA 1QHHB 2IIBA 4JJEA 3NWEA 1EA3A 1JQLB 2FQ1A 3SZMA 1LBSA 1TA4A 4B3JA 3BHNA 2FR1A 1TYBE 1WCXA 1MQSA 2A59A 2ABWA 4AZ0A 4B44A 3ZGYA 4CDRA 3I9JA 2PMWB 3SIXA 1L1RA 2Y0SN 2ASVA 4XJVA 3HJRA 1E6WA 5ARDA 1ZRNA 3AI1A 1GCIA 2WMYA 3ZQGA 3NEUA 1HE3A 4IDFA 1XKXA 3RIXA 1ZJJA 3B1YA 1LJ9A 4Q7QA 2EZ9A 3OM9A 1U0OC 3S6JA 1BKDR 3ENKA 3T1VA 2RJOA 2CE2X 3FOFC 4LOKA 4YUWA 2ZRLA 1QH8A 4JT8A 3MK31 2ZS8A 5DIFA 2IFTA 5HX7A 2GZMA 3IPAA 5IP7J 1H0SA 4MVJI 1SNYA 3R24A 3T15A 3EQ6A 2F8TA 4EO4A 3C24A 5TGDA 2GEUA 1XU4A 3HCCA 3E3VA 5A9SB 3EXIA 2O57A 5ILSA 3BK2A 4I8IA 4RB3C 1FVXA 3ZPLA 3ESCA 1JG4A 1H9CA 3CZ4A 3HJGA 2E5NA 3A4MA 1VQ6I 4LY0A 2E37A 1AZLA 2YS7A 4KDFA 3ZD8A 5C4IA 2PUHA 2ZYDA 3V8KA 4OLAA 5CJ9A 2O05A 3VKFA 3KXDA 1DC7A 4PPYA 1LE8B 5DS9A 3LQ1A 2KL4A 2DFFA 4LWPA 2FDXA 4MPRA 1KIAA 4UD6A 2NPFA 3EF1A 2W71A 1A04A 3ESWB 3C2QA 3I83A 2XTZA 4O2AB 1ZESA 1RC9A 1JEYA 3KV3O 5FRNA 5AJWA 2E5LB 5JO0A 2VHCA 4K2HA 2J0UA 2W2KA 5E1DA 3I4LA 1ZLXA 2X3YA 2I4MA 2W6MA 1F8YA 1Z12A 3STTA 3KKLA 5GWXA 3HBMA 3PQ8A 5DNDA 1ZGAA 2NAZA 3C5HA 3IP8A 1MJNA 3I12A 1SC6A 1OI4A 1R8QA 1N25A 2WHPB 1OXUA 4L0YB 1TCAA 4P31A 4IH9A 6ABPA 2PRSA 3DTVD 1X1PA 2Z5GA 3DW3X 1D2AA 5I7UA 1JT0A 2XZOA 1FRNA 1K5PA 1R6TA 5JBIA 4B6PA 2H63A 4XLLA 2QEXI 3BROA 5AM4A 1V2HE 5L7TA 4AD9A 1H2XA 1ZQ1A 5PNTA 4R41A 1PTKA 5DXJA 4MYTA 1MBGA 1T5SA 2QWXA 1BCRB 4GOMD 4QXRA 2C9DA 2JSCA 4TL8A 1XCGB 1QO0D 5LLQA 2IOFA 3BS4A 3GLFA 2WYUA 1L5SA 3ZDQA 1O4VA 3PLAE 4U2BA 3K1PA 4HATA 3DM9B 3R4KA 4UTOA 1SQFA 4Z9AA 5JRDS 2HJGA 5KJ1A 1LQUA 3GD5A 5IM4F 1YHYA 1N8NA 2BKXA 1BI3A 1K8RA 2WNSA 3U4AA 2G9WA 4KQKA 2WJAA 2EJTA 1RLJA 3K7AJ 1E3SA 3N2NA 3WGMA 4RORA 1UC5B 3OPYI 4LQDA 3CCBA 2AW5A 4IZ6A 1SBZA 3O8HA 1PSZA 3NBZC 2ZJ4A 1N2ZA 2OCYC 3FXLA 4WY2A 3SF8B 2VATA 4Z5XA 1BC8C 2M1XA 2WYVA 4AY4A 5HDQA 4IIXA 1MHPA 1PGPA 2HJRA 3AIIA 3EZNA 3DHVA 2AOWA 4AX4A 2NZXA 4PAQA 3VPDA 2FEWB 3NPMA 1S0UA 1NC3A 5DLDA 1V5WA 5KINB 5GZ6A 1I5ZA 1WUIS 3BHIA 5DX8A 4KQ1A 2PUDA 4ZCIA 1HMPA 1RYHA 3WU1B 1QPZA 3KP6A 3ZXIA 3U48A 2COUA 2YU9J 4BGVA 4FSHA 4KGDA 3A9TA 4EIWA 3VSKA 3VNVA 4L8FA 2QIPA 4D26A 3W3AD 2Y0DA 1J99A 5DF1A 2W2VA 1F4VA 4HDUA 2WMOB 3EODA 4C4SA 3DCNA 5IMSA 3OOUA 1YR9A 4YRRA 2GJ9A 4BN5A 3REGA 1P6XA 4EG0A 2EARA 2DB3A 3MCZA 4BE9A 1VLQA 4CM8B 3HU5A 5M7EA 1YULA 4GUAA 2NTEA 3UXEA 1I32A 5TT1A 3U1BA 1NURA 1NL3A 1YMVA 4RVSA 3M33A 4M8SA 3DWEX 3U3XA 3E27A 3L93A 4QGBA 3FB1A 1Y8RB 3W2GA 3KKKA 2JJQA 2NNLD 2E6KA 4ZAYA 4BFLA 2GBLA 2EIMH 2VR1A 3MAGA 2Y93A 2YDXA 3LDFA 3OYNA 1G8AA 4WW0A 2Q5EA 2YMPA 2MYSA 1A1VA 5I9TA 3QEBZ 1LD3A 4YRFA 1R8YA 1F7VA 2QTTA 4KYTA 4TMXA 3KYCA 3DEIA 2UXBB 3SYTA 2WSMA 4RD6A 5LD2B 4Q5SF 4A1OA 4BNGA 3HOZJ 5FPPA 1EBUA 4EELA 4D98A 4YAOA 5AK6A 1S7EA 1G2QA 2QG9A 4RVNA 3K9GA 1EVEA 4KV7A 3SE7A 4BDYA 1H3EA 2M9HA 1GPLA 1T1RA 1ILWA 1U3DA 2OD7A 5DM2A 3MFYA 2XGSA 1TJ5A 5D5XB 4PSCA 3C3MA 4ZYUA 1TFUA 2GZ1A 4C7BA 5C52B 5JY6A 4UREA 1R1VA 1UP7A 4V3CA 1YIJI 3UY4A 3HTSB 4YQFA 1Z8HA 3LFTA 3JQ9C 4RDHA 3ZQUA 1HKUA 3QY9A 4CKWB 1JTEA 3HB4X 4IUCS 2BIFA 4NENA 1GGMA 4YP6A 1AKMA 2Q3JA 4TKLA 4TXJA 4CQNA 1WCWA 3O1HB 3ANNA 1ZG1A 2WHEA 4HBLA 3TTUA 4RO0A 3WE3A 1U3VA 1WUHS 2BGJA 2R25B 1DKPA 1CUJA 1XXHA 3HWSA 2ZSJA 3BD8A 3NW9A 4IHQA 4EF6A 3LHDA 1TQ8A 4LNHA 4HGNA 3LHIA 3PNKA 4E4TA 1EDOA 2A3RA 4KUEA 3BRQA 1PX2A 2JLQA 3ILHA 5BRNA 2WB4A 3B6ZA 3V48A 1U9OA 2ZYSA 1J4AA 3IT0A 4I02A 2H1SA 3EZ2A 3U1TA 4HAOA 4U9HS 4QUBA 2BBSA 5IKXA 1LPMA 2X9LA 2BMAA 5EP4A 3V5NA 3NM5A 4KODA 3TH5A 1GZ7A 3RUPA 2A58A 1D07A 3ND5A 1CS4C 4OJQA 4MXDA 2D8AA 2X4LA 1VL8A 1CY4A 3WGUA 5F1PA 1E66A 1Q1GA 5FLMJ 1Q0ZA 3OIVA 2JIRA 1WKCA 3CVXA 3ROMA 4QM6A 1YBFA 5BMVF 2HGCA 4HX8A 4M0KA 4HB3A 2VQLA 2NT3A 1VECA 1KDOA 4Q1BA 3K8YA 5CDSA 2DLNA 4JJKA 2CLLB 4FIDA 4BNJA 1P9OA 3KJZA 4D96A 3R0AA 4RWEA 5AVZA 3W2AA 1QHFA 2GFQA 2FPOA 3NAGA 1T6BY 2PGDA 3UNXA 4V0SA 1QQ5A 4E4HA 3I2KA 2HIMA 4ZI7A 3TNDA 4PZCA 4PJMA 4CMAA 4MV8A 3TLGA 3OYBA 2PG3A 5LXTB 2AJBA 3A3OA 1ORIA 4F1KA 2VKTA 2B78A 2PSJA 1Y7TA 5EE0A 2I03A 4FNMA 1K5GA 4PCAA 2XF8A 5T3UA 3S2YA 3MWFA 2LWIA 4J1NA 3A1EA 3DO5A 4NDZA 2X4IA 3N8NA 5EUCA 1DQRA 4LRTB 3SS8A 2VWHA 1PD0A 1AU7A 3ROQA 3GN2A 2VE8A 3TIIA 5FLKA 4I7HA 4NV3A 5TB5A 3PDWA 3HZHA 1ZCZA 4X0EA 3CMEI 3THSA 4MMZB 2Y3IA 3OYKA 1Q50A 4ND2A 1DTWB 1BGXT 4UPDA 3EBOA 1GCUA 3V7NA 3GCGA 1IBCA 3G5MA 4HQ6A 3I64A 3I71A 1ZHHA 3P32A 8ATCA 3ICEA 2BGIA 3UC5A 5LYYA 3HKZN 4MVJD 2W4SA 4DCCA 1ZKDA 1VG0B 3LI2A 2KDOA 4OV6B 3OQ1A 4Z49A 4LRXA 2BEJA 4JJIA 3ZDFA 1OLXA 2E85A 1BOAA 4FS8A 5I7OA 4DYQA 3QITA 3AERA 4WCFC 5EIEA 1T1IA 1XALA 4ESFA 1XC7A 4UATA 1B6GA 4FFRA 4BZPA 1L5FA 5AKGA 4I1RA 4JX6A 2X1LA 1KF0A 4ES6A 2YQ5A 4FCCA 1LWNA 4EM6A 4EI8A 2BHYA 3R74A 4TXMA 3USCS 5E0KB 1TLTA 4AQ7A 2X8AA 3L2OB 3OE7A 4EHKA 5J58A 4B6GA 4BWFB 4AWAA 2CVPA 4ARAA 1W36B 3SAJA 1U8XX 5I5GA 1ENPA 4BVKA 1HOXA 4FHCA 1NVXQ 3NOXA 3C8ZA 2F5EA 2V6GA 3M5WA 4Y0VA 1T6YA 4OL9A 5J1SB 1SZJG 4UQOA 3DMGA 2O9LA 2DHCA 3SX2A 3KLOA 4F93B 1RAEA 2Q3LA 5KTPA 2UV1A 3LM8A 5LP6F 4G9EA 4EQZA 3AG2H 4CLRA 5D5WB 2E1OA 3BTSA 2WW8A 5L7WA 1J8YF 2B34A 1ZGGA 1GU7A 3CUSA 1PVEA 1J0CA 1HDRA 4NJMA 2IJGX 4EHHA 3R20A 2J41A 2AKAB 3U60B 1VXOA 4C6TA 1T5HX 2Q6OA 1S1MA 1Q7RA 4HY3A 4YB8A 1OLUB 1N5OX 5GTIC 3SQWA 3ZCVA 2XQFA 3VM6A 2ZUBA 3VTZA 1N5RA 1EWVA 2CW5A 3IAM6 3BZKA 3RVQA 1ZYUA 3UK2A 5SICE 2VHTA 4YV1A 3A4LA 3RHTA 3RSQA 1FNDA 4QOIA 4QULA 4NSNA 3RWBA 1BJTA 5EKDA 1GSAA 3S81A 2DFNA 2FZKA 3ASOH 4F5ZA 3GCDA 4MW1A 4IIJB 4YRJA 1L9XA 1DXQA 3D3JA 3O8QA 3ICCA 1DIHA 2J4DA 3KPUA 4GYGA 4GR4A 4AQDA 5E4YA 2BFCB 1LUJB 3KAJA 3SEAA 2GA9A 3N53A 2NUPA 2OD9A 4L3OA 1IRZA 5JNVA 3DQPA 4G63A 3RLIA 3PPWA 4BAYA 4ZOEA 1I01A 1QNFA 1V9CA 3DDNA 1P5HA 4DA9A 1IV6A 2ZO4A 2VPQA 4Z4GA 2DA6A 3NUZA 5F77A 3FOZA 5H20A 2RG7A 5IRCD 1YR2A 1H2EA 5ESWA 4ZI3A 4TTJA 1DO8A 3RH0A 1FZQA 3EISA 5LM3A 5BPFA 1Z3IX 1Y1QA 3OLXA 3A1UA 2WU0A 4GNRA 4MWBA 1G5RA 2PGJA 1SHUX 2DN0A 1N5DA 4Y2GA 3IS3A 3NBUA 1LTHR 1SC1A 3BG6A 4LSGA 1FIUA 1N4AA 2QP4A 2E4UA 2XZTA 3JQ9A 4KWCA 2GZ3A 2C5SA 2DQYA 4E13A 3U2QA 3P9YA 1SZCA 3N8KA 4BHCA 2DH6A 2F9MA 1V6CA 4OJNA 3ECOA 2E1NA 4PQGA 5A2QK 1B72A 5U4QA 5F7ZA 4Q3DA 4F5EA 2E2HJ 4X65B 4HQNA 4IOCF 1RYEA 4CIVA 3DUWA 4FW9A 3MCWA 2AFHE 2PKQP 4PC7A 5J6XA 4XVRA 4MRNA 4B6JA 1T91A 3GJXC 3CDLA 3H19A 2XMCA 5IT3A 1XAIA 4B3IA 1FXSA 2X6RA 3TOBA 1CYDA 2Q6IA 5E20A 3E82A 4BATA 3K9TA 4Q9DA 4OPMA 4JXJA 4ZREA 2AC2A 1VLJA 3RSNA 4YV0A 5AD1A 1L4YA 1TL8A 1TT5A 2QENA 4IGEA 1QHNA 2O7QA 4O4IF 3FTFA 1REQA 1IWOA 3WKAA 1B74A 1E92A 4OOEA 4XOTA 2BY3A 1GXSA 3K20A 1EFLA 3W6VA 4HBZA 4KQ9A 3CE6A 1U2QA 5HOEA 5FKJA 3JVVA 1DJNA 3BBPA 3AI2A 3JQEA 5KHDA 3MT9A 5TPZA 4P36A 3TRIA 2W00A 1S3SA 1AMUA 5IZCC 3C15C 2GVNA 3AF2A 3OWTA 3L05A 1X92A 1ZH6A 2A6PA 3DV8A 4KLZA 1L9KA 2G67A 1A5JA 3D5RC 1PFQA 2LDBA 1RKVA 3RNOA 2AF4C 1W85B 1NBME 1XTJA 2Y6VA 4XUGB 4B82A 1MC8A 1EFRD 1JIUA 3CH5A 1G64A 1ODJA 1V7ZA 2ICWG 2PS3A 1GR1A 4FOPA 3CBGA 3MAAC 2ZUUA 4CIWA 3Q7EA 4E7SA 4QVIA 4CMIB 2ZUFA 3GLIA 5DTJA 1KQ0A 2HHLA 4JODA 2XT0A 4UM5A 4KOEC 3SKYA 2F4MB 2A5FA 4NV1A 5CT6A 2ZSBA 3I3LA 3IXQA 3AR9A 1NW3A 3VR2D 3LWNA 1PWXA 2R7UA 2G9NA 4O4IA 2E49A 4X90A 4I9NA 2RV8A 4YCDA 5IJ0B 3VU9B 4N39A 5IDWA 2Z2ZA 4D2IA 1CNMA 1OZ0A 4DABA 3H65A 5IS2A 3T61A 2VK8A 2WBLC 4E5SA 1XT6A 4YIRX 4KLCA 2DBZA 3QVGB 2BY0A 4N3AA 1Y3HA 2MC4A 4GBED 1Z07A 5E6UA 3U3DA 2YN4A 3HV0A 2HMYB 3TIGA 3B85A 5HZGA 3ZHSA 2PUTA 3K16A 3MZ8A 2VT7A 3W7BA 2WT4A 4FXPA 4DCSA 4DYHA 4K9QA 2FSIA 1HT1E 1EK1A 3QKUA 4AJHA 1NI5A 2YWCA 3RT9A 3EVBA 4F3TA 1IC6A 4G7HF 4M87A 1PNOA 1JHHA 2R6CA 2BY4A 5HFJA 3JW8A 1U02A 3BOSA 2XNDD 5BW6B 1JLSA 2EA4A 3QYPA 3KCQA 2Z6UA 2YXPX 1OOEA 2XQGA 2HYIC 3DLTA 2X76A 2R1TA 4AC0A 4PHCA 1T15A 2FVYA 1NU8A 3TO9A 2H11A 2R5YA 3H9BA 1ZOSA 2VP4A 3N2ZB 1A9TA 1T8UA 3QF7A 1UXGA 3KEQA 4RKQA 3AM3A 2ZJOA 4D4IA 3ZH9B 1ZK3A 2DCEA 1YZGA 2WUEA 2ZPAA 1H23A 3NBQA 2WE8A 2HMWA 4JC0A 2POQX 4U63A 5B3SH 3HJHA 4OUDB 3V4PB 1DC6A 1PTJA 3ANYB 2AL7A 2FOIA 4F2GA 4CYMA 5J8CA 4Z0TA 4DLTA 5DLQC 5C8YB 4DWJA 4YACA 4P35A 2HNBA 2XY4A 3WTXC 3D8RA 2EFOA 3STHA 4DA7A 1E5QA 3FDIA 2Q3EA 3UAWA 1I3OA 3WB0A 5F23A 2QORA 4F4HA 5AW1A 1Q0QA 1WB5A 4GLLA 1QE0A 1BBYA 1VKHA 2XBUA 4WNIA 1XAHA 3EIFA 3MTDA 1JEJA 1HX7A 4UHHA 2WD7B 5C4JJ 2RARA 2HK8A 4QEZA 5M5XJ 1CRQA 1X13A 1NATA 3C87A 3NJ4A 1IN1A 2YV1A 4R8HA 3KQQA 1QUEA 4DWVA 1JN0A 2I67A 1T56A 4ZRDA 2Q7DA 1L8QA 3PHGA 2TMGA 4GZ6A 5HDBB 5HMMA 4NY1A 4LX8A 4K0RA 4C3OB 3OYGA 4G4GA 4ANJA 2WZBA 3W1VA 2P27A 2YJZA 2P6SA 1EFPB 3QMPA 4IHTA 2AMLA 4FX5A 3FNRA 2VAPA 3TFQA 1KE1A 1X1EA 3C8UA 3GJ8A 2P79A 2QQ9A 2XUPA 3CJNA 2B2CA 2X2PA 3DEAA 1PBNA 5BNWA 1SOMA 3BCUA 1G4AE 2DMRA 3CWZA 2WT8A 1Q1AA 1V3UA 2H0RA 3GYHX 5IN4A 3LKVA 4QEDA 1O4WA 4GX2A 3FNQA 1MX1A 1ZN9A 3P9ZA 4P4LA 3NTXA 3I5XA