4HYEA

Crystal structure of a response regulator spr1814 from streptococcus pneumoniae reveals unique interdomain contacts among narl family proteins
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
200
structure length
200
Chain Sequence
HMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the response regulator spr1814 from Streptococcus pneumoniae reveals unique interdomain contacts among NarL family proteins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription activator
molecule keywords Response regulator
total genus 83
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hyeA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hyeA01
2HQRA 3JS5A 1JFTA 3RKYA 3RVRA 1K6OA 1IRGA 3VNAA 2ZMEB 4P1ZA 1KRXA 4ETNA 1LNWA 4KMRA 1U2PA 3E97A 4R8HA 4RGXA 2STWA 4G7OF 2LIVA 5BR1A 2FU4A 3BRSA 4WXEA 1T39A 4QYWA 1CEYA 1FOKA 4MTEA 2OQGA 1KU7A 1TVMA 1PDNC 4XBFA 1TNTA 2CWEA 3E5XA 4XAQA 1J75A 1NXSA 4LDAA 5IEJA 3QELA 5TQ2B 1W4MA 4KZKA 3IWFA 2HOEA 5EWJB 1USIA 3OLYA 5CVRA 2DLLA 2P5LC 5LGUA 3NNDA 2JZYA 3DGFC 5L3DA 4ZMRA 4N0QA 5D4RA 3GLXA 3CUQB 1TQPA 5D4SA 4O5AA 3L09A 1IXSB 3BZ6A 3WU0A 2WWYA 4OBBA 4FE7A 3L9FA 4H0EA 3O2QB 4ZZLA 3F7NA 4LLLA 2FMFA 1W7PB 3H3UA 4TV7A 4MLDA 3TO6A 4PEVA 1XCVA 5DCMA 3O1JC 4PZ0A 4EUKA 4PCQA 4K2EA 5LHIA 2MLKA 2CGPA 2QM3A 2E4UA 3FMVA 4HQEA 2HQNA 3WGGA 3KKEA 2FMKA 2V9VA 1KGSA 2IYNA 3I71A 4O5VA 1O3TA 1FFWA 3LAJA 1DCMA 4IHTA 4U7DA 5IEBA 4YIFA 5L3FA 4U7BA 5FBHA 1OYYA 2Z99A 2W85A 2ZNYA 2COMA 3M8EA 5TQJA 1A04A 4HZFA 1K66A 2XVCA 4D6YA 3QEKA 4KIBA 3CKMA 4KN4X 3UKJA 4OATA 4MR8B 1ZH5A 4NQRA 2DK8A 3DEUA 3EUHA 3SHFA 1WI9A 2R48A 4N41A 4Z4GA 1CHNA 2GQQA 5JNUA 4LGWA 4UV9A 3CG4A 4CDGA 4HDUA 4ASNA 1ISRA 1OXBB 1FBSA 2PUDA 1ULYA 1J7KA 2RVCA 4KMFA 3ECOA 2FVYA 3LFTA 4L5JA 3QP6A 3JTEA 4U0YA 4HNSA 1X3UA 4G0OA 1LBHA 2G9WA 4XARA 2CWDA 1XDUA 2F2EA 2PL9A 2A07F 3RKWA 2DPUA 4UUVA 1GUDA 4WT7A 2FEPA 1FYLA 3IRQA 3TB6A 2XASA 2A61A 4N0BA 3F22A 3QEMA 5HQJA 2ZMEA 2W57A 2F5EA 3WTUC 4EYGA 4L5IA 3TKYA 2QLZA 3MEXA 3DQVC 4U0VA 1D5VA 1I3CA 1VRVA 3IP7A 1QGPA 4OIRF 2QU7A 2QXYA 1P6QA 3HUUA 3I58A 1B59A 4HNRA 3R0AA 3F6PA 1YW7A 2K02A 5I4CA 4LX8A 5LRRA 3WTTC 3OLXA 3F6OA 2OZUA 2MYNA 3ELKA 3KP3A 5IULC 2A9OA 3ZMDA 1DZ3A 1P4XA 2FRHA 3BREA 2HYGD 2HEOA 2XROA 1W5TA 1D4ZA 5FLXZ 4UV8A 3WTXC 4BHCA 4Z4HA 2JTVA 3NRVA 5GOTA 1TW3A 4IJAA 4NICA 3ZN0A 3R60A 3DV8A 2RJOA 3D0SA 1P6UA 3A0RB 3LA3A 3I09A 3D02A 4NCBA 5E8IA 3EQ2A 1WETA 1XHFA 3E6MA 4AD9A 1TTYA 2LSOA 4WWCA 2WJAA 3H75A 3P9YA 2O3FA 2F5DA 1TW2A 2WTEA 3BDDA 2LUOA 2PL1A 1EV7A 1F51E 4L0ZB 1R00A 1JHZA 2STTA 3I59A 5D5XB 1ZAOA 4Z4CA 4UHKA 3BOQA 1FZPB 5C5EA 4L9TA 4BH9A 1SRRA 2H27A 5LHHA 4LDZA 5TE9A 3HOTA 3JW4A 4I02A 1HSJA 2W84A 4JBAA 5HS8A 4WZZA 3RVOA 1FLIA 2ZCWA 2MYUA 1LDDA 2NZUG 2M87A 3ECHA 2NT4A 3O1HB 2M45A 2L01A 3NQOA 1R58A 4MR8A 3N97A 4A5MA 4BHPA 3K1MA 1HBXG 2PLYA 3T95A 1F9NA 3TX6A 5DGCA 3OLZA 5KQMA 1QBJA 1R8JA 5JVTA 4KMUX 3CDHA 2BBYA 4Y17A 3IKVA 1Z2EA 2VE8A 5IT9K 3RQIA 2DU9A 3RVLA 3IKTA 1NATA 4G97A 1T34A 3M9XA 2M1BA 3J80Z 2IJLA 4IHSA 4RXMA 1QP7A 3WGIA 3CLKA 3EDPA 1USGA 3CFYA 3ZP5A 1USTA 3QAHA 3WTWC 2DI3A 4N0PA 4MEXF 5L3EA 3IRRA 1FSEA 4A2UA 2OA4A 4RB0A 3OOPA 2JBAA 2VYCA 1JHHA 2CD7A 5IUJC 2LKPA 1AB5A 4OMYA 2CQKA 1LEBA 1PP7U 1F4KA 5B3JC 2FEZA 3GXOA 3R61A 3J81Z 3TOAA 2RJNA 4IF4A 2EV5A 5CNIA 4KV7A 3PQKA 3FMRA 2MC3A 2O8XA 1RUNA 3I0TA 1IN4A 2QZ8A 3OM1A 1ZN2A 2HTJA 1EH7A 1YLFA 1E6MA 2A6EF 2RGVA 2R3SA 2M98A 1USSA 3C18A 1SD6A 2Y48A 3H6HA 3ML6A 3O74A 4JAVC 3EYYA 3LUDA 3HCWA 1YYVA 5JNTA 4IVNA 1FP2A 3FFTA 4CBVA 3D8UA 4IMJB 4L4UA 3GFJA 2I6FA 1QPZA 3S2WA 2ID9A 3M6MD 3E61A 4Q7EA 3CTAA 3FFXA 1KRWA 4EGSA 4OIPF 4AIHA 4M88A 4O1HA 4KDPA 1D8JA 4WCGA 2DQLA 3GWGA 1T38A 2JCGA 3N0XA 3QOPA 4RAZA 3F73A 3QU3A 4F3TA 3TGNA 1P92A 2QQ9A 4I0AA 1PNRA 4L9JA 5FLXK 3ILYA 4E70A 1EWVA 1Z15A 1K79A 4YRZA 4HV6A 2GZWA 3RYRA 5TPZA 2A68F 3GVAA 3JTHA 4N76A 1XHEA 3ERED 4MAAA 2QWWA 4PGHA 3LWFA 2YHAA 4RB1A 5HDGA 4CGZA 4IRHA 1MD0A 1U0SY 1L5ZA 3RKXA 2L2QA 4KICA 4ENKA 3GA5A 1LJ9A 3B02A 2RGYA 3HTSB 4M9ZA 4EJVA 4IRIA 1DJMA 4XLNF 1Z6RA 5LLQA 2HR3A 2OZ6A 2XAGA 5ERIA 4RDCA 4KNYA 3TD9A 2D1HA 3CU5A 1MJ9A 3G73A 2IW5A 1R1TA 1ZRCA 4KK3A 4UHJA 5E1ZB 3T5XA 4GXOA 1B1BA 3MZYA 1TLFA 3KEQA 4TLLB 3JVDA 3SZTA 2FOKA 2E1NA 2EV6A 3HUGA 5LBQA 1UHWA 3GZ6A 3QP5A 3TO7A 1H0MA 3DLHA 1XD7A 2F5FA 4EMSA 4I09A 4KA4A 5LRSA 1QQIA 4WWHA 4HX4A 2UWMA 2P5KA 1SAXA 3T1BA 2PJUA 5EWLA 1IN7A 5KC9A 2FSPA 1GHCA 2FMLA 4HX7A 1KQ8A 3ISPA 1RUOA 1MZBA 3K9TA 1ON2A 3V7RA 4RY0A 3HRTA 2O03A 5KQGA 2YX4A 3HRMA 1UCRA 2RV8A 3M7GA 5TPWB 2FBIA 4UXNA 1TLHB 3D5LA 1K7AA 2IPQX 4WK8F 4MR7A 3OMWA 4G0XA 2WMYA 3IWZA 2P6SA 4LLNA 1JF8A 2H3HA 5D8KB 2MSKA 1JE8A 4BAYA 1O3QA 3H5OA 1RZRD 3GYBA 4GO1A 2PI0A 1YTUA 3JVIA 3FMSA 4R1HA 5D5WB 2XV4S 2OD5A 3J81K 1YFHA 3O2PE 3GBVA 1HXDA 2RQPA 1D1PA 4KT5C 5HLGA 1HW1A 2EFOA 2UXNA 2K4BA 1BDJA 5J6XA 4JA2A 2HKXA 4Y15A 4BHBA 2E7WA 5EWMB 3H5WA 1SXIA 4DQDA 3KP7A 2JPBA 2L54A 2XDYA 2CFXA 4LJZF 2JPCA 1BVHA 4KQ9A 1S3JA 3QX9A 2NYXA 4HAMA 6ABPA 4LK1F 1V3FA 1YO5C 2BYVE 2LPMA 1D5WA 2O6GE 2LNBA 3OO0A 4D74A 1BI1A 5BRAA 2OAZA 4YR7A 3NNSA 1MKMA 5TQ2A 1F1ZA 1Z9CA 3H3ZA 1P6RA 1BM9A 5HDNA 2XAFA 2ZO4A 5TRDA 1H9TA 5FWYB 2A3SA 4RY9A 2GKGA 3HXMA 2ACJA 1W9HA 1OXKB 4LG0A 3SFZA 3L00A 2P6TA 4MQ9F 3I5AA 3T6KA 3BWGA 4S04A 4N03A 5TQ0A 5K5RA 1LJLA 2FQYA 4HDVA 1QPMA 3ROUA 3QRFF 3GZ5A 4M6YA 3DKWA 1TBXA 1ZGAA 3H1FA 1V4RA 1EH6A 3HRUA 1TM2A 4Z4FA 1XSVA 4ESFA 2B1JA 3HTUA 1OPCA 1O3RA 2BEOA 1U6GA 1I1GA 5FGMA 3DXJF 1NTRA 2H94A 4XRFA 3TOBA 3LUJA 4LZLA 4LB5A 2ESNA 3MQ4A 5CVIA 2A69F 4LLGF 4Y9TA 3WTZA 5JNVA 3HSYA 3OMXA 3J80K 1Z6TA 3R6SA 4LMYA 4CHUA 2DQRA 5KI6A 4EYQA 2JBAB 2IA0A 4MGRA 1B9NA 1ZLKA 2ELHA 1XB4A 1JHFA 3I5UA 4CYDA 1JDNA 4H3HB 4JQFA 4HQMA 2P7CB 4QPJC 1JLKA 1B6AA 1K78B 4YS6A 1D1QA 1MB0A 1U8TA 1KA8A 5E1WA 1W7PD 2CG4A 5E3JA 3KG2A 1HKTA 1KU9A 2WRZA 1BA2A 2E1CA 2FEKA 3DZDA 2KIUA 4RS8A 4ESJA 2PUEA 2YX7A 2HSGA 3GL9A 4XSXF 4L85A 3KSMA 3P9IA 2KJCA 4OTZA 1DG9A 1JWLA 1IUYA 1FQWA 2M8EA 5B3JA 1NHAA 1XN7A 3BJOA 4I7HA 4RAYA 4RXTA 5FFXA 1JDPA 2HQOA 1J56A 2PUGA 2QQBA 4Q4ZF 1LQ1A 2F8SA 5KQLA 4WXMA 2VC1A 5L3GA 4ZYGA 1ZESA 3DF8A 3MMNA 3QPHA 1Z12A 4DADA 2G7UA 4HV5A 1ZLJA 4Q5SF 3KLNA 4TN5A 4MQFB 2RC4A 1O3SA 1OYWA 3CLOA 1M2EA 1DP7P 5IBQA 1YS7A 4Z99A 1O7FA 2XUBA 5JNWA 1B9MA 3G85A 4NB5A 1F5TA 2GI4A 1XGSA 5JHUA 3Q5FA 2DT5A 4L9NA 1ZG3A 3M8FA 2M5WA 4ZYHA 1B4AA 1IAWA 3ZMZA 3WE2A 4BXUA 2WV0A 3LSTA 2HPHA 5T3YA 4DQ2A 5FWXB 4ENNA 4HA8A 4RGSA 1JX6A 3GV0A 4I98B 1LDJA 4YG2F 3M9AA 3WE3A 1FBQA 4HW0A 1WKMA 3FDFA 3FWEA 2FN9A 2IVMA 2A6HF 1U5TC 2ZBKA 3N8IA 4MS3A 4N9IA 4EQQA 3W6JB 3CZCA 4U0WA 1RXEA 1I6XA 3LUGA 3OO1A 3RVJA 3ROFA 3URMA 5BOXA 3LQRA 2HQBA 3L6UA 4MS4B 2P5VA 1Z13A 5KC8A 3OQNA 1JH9A 4QLCU 1JFSA 3RTRA 2PE5A 1DP4A 4HF2A 4LE2A 4MTDA 1BI2A 5IC5A 1O57A 2X4HA 4LG0B 1P2FA 2V6CA 5CVUA 4XSZF 1IXCA 2CYYA 2R4QA 1XGOA 2EJRA 3F21A 3C97A 3IP5A 4EVIA 4NQWA 3ULQB 1ZG5A 5ILVA 1J59A 3P9CA 1GUBA 2FXIA 2NRAC 3U9GA 3TQNA 3KZYA 1ON1A 1K68A 3F8BA 1ONVA 1HKSA 3EJWA 1C4WA 4F8JA 3IP6A 4MPTA 2PKXA 4LE1A 1WSUA 1KQ9A 2JVIA 3P7NA 2DW4A 4ENJA 1LEAA 3F6CA 4EJOA 1R23A 1ZRFA 2DPDA 4LK0F 3MM4A 1R5GA 1KYZA 1ZVVA 2BV6A 4EM2A 1AB6A 5CLSA 5ICCA 5JNSA 3FX3A 4CICA 5D5UB 1AOYA 3I54A 4RY8A 1S6LA 2CO5A 1HKQA 5IX8A 3CG0A 2LP4Y 3RDIA 2RDPA 2CW0F 4EJTA 3T8TA 1T0FA 4GPAA 5DKFA 3LKVA 1ZGZA 4IGAA 7ABPA 4EJUA 1Z2DA 4I0BA 1DPRA 4G0PA 2MA3A 5KVRA 4KPYA 2CHFA 1T2KA 3ROTA 3OQMA 4RK5A 1E6LA 2ZWMA 3BPXA 2Y75A 1U2WA 3BROA 2E4XA 3KETA 2K27A 1Y0UA 3A10A 3QLTA 2QBYB 2Z9OA 1XMKA 1NXWA 5DDGA 1OYIA 2EV0A 4UVCA 1C0EA 1MIHA 1BIBA 1BAPA 2QUFA 5FWXA 3HDGA 3H5LA 2YHBA 3DBIA 1W7PA 3HJFA 2GXBA 5JS2A 4UHTA 4GYIA 4A0XA 2W25A 5F64A 2LBPA 4P9UA 3O75A 1Z16A 3C1DA 1QNTA 1DCFA 3LA7A 4MQFA 3IC7A 4M72A 4BNCA 1SFXA 3RYPA 4OIOF 4BQAA 2VE9A 3KP2A 4WXDA 3Q41A 3EODA 2IA2A 2JB9A 1QP0A 3DPLC 1LVAA 3FGZA 5LEJA 3FM3A 1CF7A 1QKKA 4OIQF 1OR7A 2L4MA 4Q6WA 1M5UA 2BGCA 3HIFA 3K69A 5LHGA 4PDKA 1HEYA 1P4AA 3H5TA 4YIIA 4F11A 2P9HA 2H09A 3HK2A 4RSMA 5FBKA 2KKOA 2FE3A 3MWMA 3FXRA 1ZY2A 5K1YA 4WXCA 1E2BA 5D5VB 1DC8A 2IOYA 4P9FA 2FMIA 1IRFA 3GEZA 3Q9SA 2ETHA 5BMZA 3HUTA 3PFIA 4AIKA 1G6NA 1S7OA 4WXHA 4LFUA 1YW8A 3MA0A 5ICEA 2VK2A 1LJUA 1T6SA 3KZZA 3H5VA 3MAJA 1A0OA 2F5CA 3ZPLA 2W42A 4BYYA 1Q1HA 4RKRA 1FY7A 2KIFA 5IUKC 3CNBA 1B00A 2H6BA 3FF5A 3WTVC 2ID7A 4ZZDA 4S05A 1KQ0A 1SFEA 2VXZA 3REOA 2JK1A 3F72A 4YFXF 4F7ZA 3T38A 1UB9A 1IF1A 3JSPA 1FWZA 3RVSA 5CNJA 4IMIB 4P5OA 3KYJB 4HLXA 1H9CA 3GWZA 2A9PA 5TJJA 1SFUA 3CO7C 3H6GA 1BI3A 1QZYA 3NBMA 1Z25A 1YTYA 3V8KA 2D45A 2ADUA 4OINF 3QU6A 2XRNA 2DO7A 3EGCA 2WJWA 2LF7A 1AWCA 4XFKA 2PAFA 1BI0A 1GXPA 3TO9A 4Y13A 3O2SB 2YSRA 4L9VA 3LUHA 1O7LA 4G0ZA 3FZVA 2BGGA 3U1DA 2PLNA 1HSTA 1G3WA 2ISZA 2L19A 4G0QA 5BS6A 2V1UA 3N53A 2IRFG 3JSOA 2RNJA 3V7CA 2FQXA 1DC7A 1YVUA 4MR9A 3DFGA 1BC8C 2O20A 3GUDA 1REPC 4MGEA 1IW7F 3LUCA 4Q6BA 4ZJPA 1S8NA 3K0LA 1EH8A 1NXVA 4RZSA 1MJAA 2UXXA 3ZQ7A 1APBA 3NEUA 1DUXC 3MZHA 1PEAA 4RK6A 4MR9B 3JPWA 1NY5A 1U04A 2EA2A 1P4WA 5KK1A 3EQLF 1BN5A 4CXFA 2E4ZA 2FQWA 2NT3A 4M9SA 2OBPA 4KREA 1J5YA 3F3XA 2WB4A 4KIGA 4MQEA 4ZYLA 2JRLA 3BP8A 4FB4A 3UUGA 3FMQA 4Z4IA 1MJBA 1QQBA 2YU3A 4LB6B 3KHTA 1IZ1A 5E18F 5E17F 1FFGA 2DRIA 3M9WA 3WTYC 1D8KA 2GWRA 3CS3A 5DUIA 5AIPA 3E3VA 3ZMVA 5DEQA 2RN7A 4B8XA 5FWYA 4MEYF 4B09A 5DLEA 3GYHX 3Q7RA 1EAYA 1XWWA 3MQ0A 2RKHA 3QK7A 2OU2A 2FTKE 1PEYA 4IILA 4EV0A 2KYRA 4IRXA 4E7OA 1IN8A 1XGMA 3P9KA 1D3YA 3KP6A 1CF7B 5BPDA 5BPIA 2A9QA 3GFIA 2FEWB 2J5OA 2R7FA 2IKSA 1M5TA 3V7SA 3V8LA 3LUAA 4KQCA 1J0RA 2IP2A 5JFRA 2LF8A 4KVFA 2WWVD 2PJPA 5T7BA 2PUCA 2DK5A 3JAMZ 4DNCA 4ESBA 3EAFA 3LOPA 4G6QA 1FSHA 1DPUA 4G0YA 3KTOA 4FX4A 2IPLA 3DGEC 3IL2A 2J48A 4JASB 1Z91A 1ZHFA 3F6VA 5IT9Z 1MGTA 2DTRA 9ABPA 4JB0A 5BRJA 5AIQA 1UFMA 1TNSA 2MD5A 2PFBA 4KN7X 3MIZA 2DAOA 4G8XA 3I45A 3CUOA 1ZARA 2QVOA 4HF0A 1BDHA 5HS9A 3RVNA 1QO0A 3L2CA 1MB3A 4H3KB 4YP9A 3I42A 2DBBA 5HVQC 4NCAA 3K9CA 1IN5A 2C6YA 3FHZA 3F23A 2QR3A 1Z18A 3QX8A 4RU1A 3UK0A 4EY3A 5LEKA 3SQNA 1U8RA 5FD5A 5GQSA 3CUQC 3CTPA 3RPQA 2Z5UA 3WTSC 3HSFA 1ZDMA 4YWHA 1MDMA 3OM0A 2EB7A 2FSWA 4LE0A 2R25B 3BILA 3HEBA 3Q7TA 3RI4A 1U78A 1Y1LA 2HFHA 3QLUC 5D8LB 1H9GA 4R79A 3QELB 2O61A 1R1VA 2GAUA 5HM6A 3RH0A 3PQJA 4MHGA 5EWMA 4F06A 4G94A 3NHZA 2VOOA 4EJWA 1L5YA 5CJ9A 1P8AA 4YV7A 4Z0NA 4MQEB 4ETIA 4WX9A 4O3MA 5E20A 3T8RA 3C3MA 5CVVA 1ZHHA 1RNLA 2PG4A 3QLVA 1NXPA 2ZJ2A 4EVSA 1UHMA 2H0AA 5D6EA 3ZMTA 1PP8F 1BDIA 3E3MA 2IA1A 2K86A 1GCAA 5DCMB 3DP7A 5K5OA 2K7LA 3A0UA 1KU2A 3RPUA 2V0NA 3HOSA 1JYFA 3GBPA 2VUIB 2JT1A 3BRQA 2RDMA 2MSWA 1USKA 3WODF 1G3TA 2YPRA 3U2RA 1QP4A 2PUAA 4FHTA 1L0OC 5F1RA 1DRJA 4EVRA 1YIOA 1ISSA 1EFAA 3K1PA 4MS1A 2ZKZA 1E17A 3O2JA 2TDXA 1L3LA 2L3DA 5DD4A 3DLBA 2EWNA 3LFKA 1EWTA 3IHUA 1YK1A 4RK1A 5EWLB 3E6DA 2VONA 2A5YB 4MS4A 1JXSA 1ODDA 4A12A 3K1NA 1YMVA 1KU3A 4W5OA 4PGGA 5IUNC 2Q2EA 1ZRDA 3I4PA 4IXAA 1JFVA 2NS0A 1FFSA 4OG2A 3FXUA 6PAXA 3B2NA 4O6JA 4G0MA 4WUTA 2L18A 2VUHB 4W5NA 4O1IA 2O0YA 3F8FA 4AIJA 4XLPF 4MQVA 2P4UA 1SD4A 1FP1D 5E8GA 2Q8KA 4RGUA 3VNBA 3BY6A 2HZTA 4KRFA 1Z1DA 3KE2A 1PUXA 3KJXA 3HHGA 2QYOA 1QO0D 3E5QA 3LKBA 2IPNA 1OMIA 3K4HA 3WGHA 4A0ZA 1VKRA 3SZPA 3KYIB 1JGSA 3I64A 1K78A 5HDKA 2QW1A 2FBKA 2CSOA 3HDVA 3LTEA 3MF4A 4ZH4F 3SXYA 2HKOA 3GO5A 1S29A 2GBPA 3TMYA 5L3BA 2FXAA 3N4MA 1LBIA 3L7WA 2E4YA 3NHMA 4KK4A 2EFWA 2PEXA 5H20A 1C0WA 5BQ3A 5HLIA 4WF2A 4ZYDA 3E6CC 5DUKA 1KMIY 3Q9VA 1ZGJA 1R1UA 4JOQA 3OLVA 2OQRA 3GT7A 3QLVC 1ZYRF 1DDNA 5TPZD 4AWXB 3T8YA 3K2ZA 4A5NA 2GA2A 3C6QA 2EFQA 3LUFA 3EYIA 4OLBA 3T0YA 2IT0A 2GA1A 1R22A 1BBYA 4YFNF 3O3KA 2MH9A 5DV5A 3HRSA 3EULA 3EDCA 3GFMA 5CNKA 3SY8A 4NV3A 3JY6A 5AONA 3WU1B 1HW5A 2NAZA 3OLWA 2NNYA 2P4WA 4M73A 1G3YA 5L3CA 3HVRA 4HOBA 2PMUA 2QVCA 2FBHA 1MDMB 2MSLA 1RZRA 3R4KA 4KIFA 3EQZA 2VBWA 4OOIA 4Z4EA 2FF4A 5TQ0B 1DBWA 4AVPA 2ZAYA 3KFWX 3I59B 2E4VA 4PYRA 2HJ9A 2VC0A 4MYRA 1SXGA 4W5QA 2V1DA 2Z33A 2R7DA 5EEHA 3H1GA 4MS1B 3N0RA 5J8CA 3W6KB 1ZREA 5J8FA 5JS1A 3ILHA 3GFLA 2AXLA 2E7XA 1BIAA 1MAVA 4HBLA 1Z26A 1RXIA 1SXHA 1YK0A 1YQAA 2AYZA 5IT3A 4EVQA 3FM5A 2Q5CA 3TDUC 3LUKA 2G7HA 4NHJA 3RVQA 1DRKA 4M6XA 4L18B 1UDRA 3O6BB 3GF2A 1DBQA 1DBPA 3RJPA 1WWXA 3MFKA 1TQMA 5ILUA 3VODA 3MCZA 3FXQA 2FKAA 2KIMA 4TMYA 1CYEA 1YS6A 3HZHA 1CGPA 2GIVA 3BJ6A 3OQOA 4Q48A 4XXHA 2TMYA 1WQ2A 5H6RA 5TPWA 2XIGA 3WG9A 2HDCA 3G3ZA 1D2AA 4G86A 3KP5A 3DPTA 1JBEA 4RB3C 2QVGA 3IP9A 5ED4A 2MBFA 2Q0OA 2H6CA 4MRMA 5JNRA 2VBZA 2XKOA 3LAPA 1VTNC 3ZN1A 2Y0MA 5HSGA 4EGYA 1XGNA 2XAHA 2LDUA 3ABUA 4EYKA 3CZ5A 5LGNA 3SNKA 1G3SA 2F8TA 5KWSA 1LB2A 3QEMB 3HSRA 4GNRA 4M71A 4LRQA 2QQAA 2VBYA 5HKOA 4IPAA 2AYXA 3HO1A 3ABTA 3E5UA 4I2OA 4EYOA 4D6XA 4RK7A 6CHYA 4A0YA 2A9RA 2ISYA 5D6FA 4ZPJA 3HV2A 4D0PA 1J9IA 4G6DA 5DD8A 2PUBA 5FFZA 2QZJA 3LQQA 3HS3A 2FMYA 1HW2A 5CHYA 4QICA 5JI6A 2PUFA 1XSDA 1ABEA 1NXOA 4YCSA 2QENA 1BC7C 1FBUA 1ZH2A 2FNAA 2GXGA 4JP1A 3S99A 2MH2A 1FSPA 4M74A 1YG2A 3V8JA 1SMTA 4QWQA 2IPAB 1JL3A 5ILSA 4M9XA 1FYMA 4F12A 1XCBA 2MLGA 1STZA 2YR2A 3Q7SA 4IRGA 5E1XA 2MYTA 1IIBA 1YW9A 5DCFA 4XASA 3IPAA 5C5CA 3BBLA 4HF1A 2D2WA 5JR3A 5DCLA 5KQPA 2QSJA 1FNNA 4GGGA 5DYMA 5BQTA 1R7JA 1ZAYA 2PQ8A 3GW2A 1NXTA 4RK0A 2X0LA 3JAMK 4YFKF 5EWJA 1OKRA 2L17A 1W5SA 1QNLA 4Z9AA 1R36A 3B73A 2QV0A 4EM1A 8ABPA 1FYKA 4A6EA 4RXUA 3SG0A 5D2CA 2W24A 3FFWA 5H6QA 3H92A 1ZG1A 1LDKB 2Z3YA 1I27A 2P7VB 2NUBA 4FE4A 4JK1X 2FN8A 3L49A 5CYVA 4ZMSA 2FLWA 1ZITA 4DN6A 1FPQA 3BJAA 2ZXJA 2E4WA 2XAJA 2V1XA 3RVKA 2VT3A 1U2QA 2ZNZA 3QLUA 2JRTA 4PZJA 2EFNA 2AS5F 1GLGA 2L4AA 2HS5A 1RIOH 1GCGA 4GCVA 4W5TA 2HWVA 4RB2C 3COAC 1J2XA 2VODA 1QQAA 4MR7B 1HQCA 4CO8A 2N9UA 2MYPA 3A3KA 1Z05A 3SAJA 3F8NA 3LMKA 3OV8A 4HYEA 1TMYA 1BOAA 3CJNA 3HM9A 4H60A 1IN6A 4Q47A 4JB2A 4PICA 4E7PA 3E6BA 4ON0A 1U5TB 3H5IA 1M2FA 2M1ZA 4N9HA 4YGXB 1A2OA 2CHEA 4RKQA 2D1VA 5HOOA 4N47A 1R5HA 1EWKA 4MRMB 3N6VA 4RK4A 4RWEA 2FW0A 1G4DA 3V4GA 3IPCA 1PUEE 2BE5F 2QBYA 3VEPA 3KCNA 4ML3A 1XMAA 2XGXA 4UVBA 3GRCA 3HYIA 1ABFA 1VPWA 2FQ3A 4RGRA 2PN6A 3CO6C 1NXXA 3C3WA 3HHHA 4OLAA 4G9YA 3ZMSA 4KYWA 2VN2A 2PMCA 4ETMA 3KLOA 2R47A 3SM9A 3F8MA 2HTSA 1GXQA 2HYFA 2WC2A 1TQIA 4W5RA 1I5ZA 5ICFA 2EK5A 1QMPA 2IDMA 3C7JA 1KYWA 3G1WA 3HSEA 1XDSA 4P98A 4KUMA 2JVJA 3NNNA 4EGZA 3RIRA 3JPYA 1WRJA 2M30A 1DCKA 1JYEA 2UZKA 1QZZA 3H1EA 3N75A 4Z9BA 5DTEA 4MS3B 2L02A 2V79A 4KFCA 4Z2YA 4G7HF 2PMHA 1IXRC 2GX6A 1SD7A 4PE5B 1T98A 2NZVG 4G7ZF 4UNOA 3IDOA 1LK0A 4YO7A 1F4VA 3LA2A 1GVJA 1PNTA 1VLZA 3MYYA 4QYMA 1FT9A 3J7AO 4CZZA 2XHKA 4MNUA 3CUQA 4FX0A 2ESHA 3VFZA 2NNNA 3F8CA 5HS7A 4HNQA 3O21A 3Q15C 3KEOA 4A6DA 1TJYA 2FA5A 4RV5A 2XAQA 1FX7A 2J5PA 4OMZA 2FMHA 1FC3A 4TLMB 4L0YB 4U88A 2EFPA 4ZYEA 4EM0B 1EHCA 2HGCA 5LGTA 3TDZC 4ENMA 3KCCA 4XLTA 2VT2A 2EA4A 3GX4X 2KRFA 4MLCA 4LD5A 5ICGA 1RPJA 1RI7A 4UVAA 1RZ4A 3KP4A 4ETSA 2OENG 1W25A 3BPVA 2JVKA 1ZH4A 2DFIA 1Z17A 5F6FA 4P96A 2P8TA 4I01A 2PBIA 3RVPA 3VOEA 3JTGA 1MVOA 2X7XA 3QPTA 2K4JA 5PNTA 4HLYA 2XKPA 3I53A 4HX8A 5FD6A 2B0LA 3CHYA 2WY2D 2VBXA 5FO5A 3R0JA 1SD5A 2VOPA 3O1IC 2FNPA 5HLHA 5CNMA 5K5QA 1BJAA 1E2XA 3AAFA 3W9SA 5A2QK 3TO5A 3ZMUA 3VB2A 1YMUA 2ZFWA 4YLEA 3EETA 1XSXA 5CVJA 4FT8A 3C3KA 1Z7UA 5ABPA 4OU0A 3CRNA 1SMYF 2IPMA 3M1EA 3RVMA 1URPA 2FLKA 3N0WA 4RS3A 1ZGGA 1S7AA 1I1SA 4P55A 1U3EM 2B4AA 2KJBA 1E6KA 4GYGA 1PHRA 2JSCA 1U5TA 3KS9A 5A2QZ 5FB2A 5EEGA
chains in the Genus database with same CATH superfamily
2YV3A 1LVGA 3DCNA 2R5FA 3JS5A 4MV5A 3RKYA 1J21A 3RVRA 1K6OA 2E21A 3VNAA 2ZMEB 1ZO8A 4P1ZA 1QRAA 2GWHA 1LNWA 1FYWA 5E3HA 5JS8A 2PSDA 1U2PA 4D4KA 4AF8A 4FXOA 2XUOA 2C04A 2CLLB 4DA9A 2WU3A 1M2WA 3EN0A 3GD5A 1GPBA 1EQUA 4YH1A 4XD7D 1GTRA 1NMEA 3GLFE 2GZSA 3JQDA 3KLMX 4DOMA 4C89A 4NU6A 3BD7A 4R2JA 4JSTA 5CFRA 1QB8A 1S96A 2QVZX 4WXEA 2XSDC 2IELA 5FOSA 1Z7LA 2CXNA 3IAFA 2A0UA 1VQMI 1EK1A 4TYWA 1FOKA 4AZ3B 4D96A 4QBFA 2HGZA 3VPCA 1TVMA 2OQGA 2ZE7A 3IERA 1TNTA 2CWEA 1GY8A 1WUHS 2P35A 3P0RA 4XAQA 2EZTA 2Q2VA 4LDAA 2JDIA 1IMJA 1BYUA 4OKSA 5ALFA 2O2JA 3U2QA 2X5JO 1W4MA 3VR5A 3TNYA 4G1BA 1ZLXA 1C7EA 1E59A 4GDMA 1ADFA 4P3XA 2DLNA 1Q12A 2IWHA 3UV3A 1D2NA 4O02B 2HOEA 1IULA 4I50B 5ERGB 4BJ5A 4RY2A 2O2DA 1EUZA 4AS3A 1P19A 3QJ5A 3LSPA 3ITNA 4N0QA 4P81A 4N54A 4IDNA 5DB4A 4ROTA 3I3LA 3TZBA 4AKEA 3M8JA 3CUQB 2X9GA 2D1QA 3EQ9A 4E3WA 1K6EA 5D4SA 4IXDA 4P22A 1RWPA 1YJ5A 3L09A 5HDQA 2WLSA 3LE8A 3N2EA 3HN6A 4KP7A 4DT1A 3BZ6A 4KR3A 4MZDA 3I62A 4LZJA 4PSUA 3WKAA 4Y0NA 3LX8A 3W2IA 4CCMA 4UTNA 3MGGA 1Q0TA 4ZZLA 3ZRGA 5C5IA 4S1VA 2W4SA 3JR9A 1NQTA 3KYBA 2ZM6B 2QORA 1ZMRA 2F4NA 2DFVA 4UU1A 4TV8F 3EQ8A 5AM5A 4BNDB 3TO6A 1PDOA 2WB1N 3BBPA 5JASA 5DCMA 4A9AA 4PCQA 4LITA 5LHIA 4E31A 1KDOA 2VOEA 3WAJA 2B1QA 1CEEA 4DQUA 1P45A 2MLKA 2CGPA 1TM7E 4KI7A 5DSXA 5GJCA 5LB2A 4A1FA 2E4UA 3LXMA 3H1BA 1C9JA 1B76A 3QFFA 3MT0A 4FDUA 3V8MA 3TOSA 3CV3A 5DYTA 5DE3A 1XZFA 3ZJ5A 2ME6A 1MC1A 2VDMB 1SXJA 4HFJA 3S3MA 2CXRA 1O58A 3I71A 3E58A 1O3TA 1V1JA 1RAEA 3HCBA 1XQ6A 1RT9A 2JGDA 5CLIA 2VTDA 2ATVA 1P7ZA 5LLSA 3RC1A 2P6OA 1KZHA 1DCMA 1RQRA 4OKIA 3TJMA 4AO7A 1BVRA 3DVRX 2YMLA 3BIJA 4PSVA 5EYPA 1ELOA 1EXDA 4FFRA 2DWCA 1WJDA 1KVQA 5L3FA 3N59A 4RTRA 1GTSA 5KTOA 4M99A 5BYAA 3AUAA 2XKBA 4OHWA 4Q4HA 2W85A 3KYDB 4KE6A 2ZNYA 1RPWA 1JKJA 1UMKA 1A04A 4I4CA 4RLQA 2NYRA 2RH4A 1K66A 1M74A 2JIBA 3ZUPA 4A6XA 2VZ8A 4P80A 4BMYA 4BV8A 5C1DA 5JNLA 4KN4X 1L5KA 2UYHA 2FSUA 2I4OA 2V7QA 4ZGWA 4W9RA 4GP6A 1MAWA 2H7YA 2BHRA 3H11A 3LP8A 3HY6A 2ZG6A 4C0KA 4N0MA 1XMJA 1JAIA 3HUFA 3EUHA 3OIQA 3I92A 2QVLA 4MV0A 4PC7A 2E4AA 4U39A 3ZD9A 1BW9A 3KXPA 3E22B 2R48A 2IOQA 1CUHA 4Z4GA 1CHNA 4U9IS 4OX9Y 1MF7A 3K8ZA 3PFCA 1ORWA 2Q49A 5L3SA 4PZEA 1MRSA 1G2HA 1BIFA 2PX4A 2V45A 3BFXA 1HTBA 3RTEA 4NYMR 2JJ1D 1SN7A 4WJZA 1IUOA 3TOVA 2ATEA 4QLAA 2FX0A 2ZUBA 2RVCA 1HEIA 4II2A 3MGBA 1QCCA 2GPJA 3W3AD 4Y3OA 4XOPA 4ZC3A 1PT9A 1ZIYA 5BUQA 3QP6A 2Q0XA 3B9RA 1KA9H 3CC7I 4M3EA 3PX2A 5DM60 4M1KA 2KMLA 4ZV4A 2FDCA 3IJEB 1CUYA 1Y8RB 2FJUA 3SR0A 1XZLA 2ZI6A 2ZIVB 3G8AA 3BIXA 4KODA 4XGKA 1DEXA 1FP6A 4Y1RA 2XUFA 4N8SA 4A0FA 2OBMA 2V5VA 1XDUA 4E46A 4FD3A 2F2EA 4QFCA 1VGVA 2A07F 4BO2A 2FJ1A 4BEBA 1USUA 1GUDA 3QIVA 2AHOA 5AOCA 2ZSDA 4X24A 4AWAA 3C5WP 1P0MA 4JLVA 1T26A 1PI3A 1VI6A 2IYUA 3BJZA 3VSDA 1FTGA 4E0BA 4MWDA 4RHYA 3F22A 4J7AA 3LG2A 3PD7A 1W0UA 1DCTA 2ZMEA 2W57A 1OTYA 1U2SA 3EXHB 4EYGA 1O95C 4YQZA 1FMJA 4RM3A 1UFVA 2INGX 2J3JA 1F1BA 4WK0B 5B58C 5IOZA 1I4OA 1M1YA 1YRNB 3D4PA 3OZXA 1BOBA 3OQ6A 3TMAA 3EAGA 1D5VA 2GARA 2R7LA 1EHYA 1N5LA 3OC0A 3RYCA 1UINA 1QGPA 3ZDDA 2QXYA 3DAGA 3JQGA 2C7OA 2SKDA 1KH3A 1PHPA 1FS4A 1II8B 3JQFC 4NG4A 3UMMA 1B59A 4HNRA 2VJNA 3KUXA 4K8OA 4NL4H 4RE5A 2WUVA 2K02A 1BTOA 4CCYA 2DJNA 3K0EA 3WGZA 1DQNA 4LX8A 1NSYA 1S7GA 1YE8A 3CNEA 1PJ4A 4FQ8A 1WCIB 2GS9A 4LAFA 5A4MS 1LV7A 3UJDA 3L06A 4IJVA 1RACA 3H2JA 3WMWA 2CXUA 1E2IA 5C4MA 5IMBA 3F2VA 2Y6UA 2XCSB 3DONA 1JKMA 3PGMA 1XD9A 1P4XA 4Q24A 4WY2A 2FRHA 1IEXA 2UKDA 4DMLA 3NVKI 3VR3D 3TDKA 1NLZA 2K9SA 2OJED 3SJAA 1W5TA 3DOHA 2ANCA 1D4ZA 5DCYA 5FLXZ 1BXRA 4UV8A 5LUBA 3SSOA 1VYVA 2H5LA 4EPYA 5H16A 3M0EA 3T5AA 1E1NA 4BHCA 4HGNA 1FUKA 1Z7BA 2CF6A 2X2PA 1GR0A 5C37A 1T08B 2VJ5A 1HFKA 2UV8A 4WEOA 3PNKA 5G1NA 2DPHA 1M72A 3YASA 1VHJA 4XTRA 4C0XA 5GAEJ 5FA8A 1NOJA 5DCWA 4XJSA 4EUFA 1OH6A 5BQXA 3MC1A 4EARA 1EB8A 1Y7IA 2RBGA 3PR3A 4GICA 4M3NA 1NN0A 1Q6ZA 1ODSA 1R3DA 2QR2A 1BG6A 3BSWA 4G6TB 1XHFA 3R5JA 3HDTA 4CU2A 4YDSA 4AD9A 2PO5A 4CUJA 3H75A 2ZS8A 3P9YA 1AZTA 1FVHA 2V74B 2YWBA 2Q9AA 1Z4PX 2C2WA 2QVYX 2RHCA 3B53X 2QJTA 2WTEA 2FH5B 2PBLA 5THQA 2XGEA 3C85A 4CM4A 4RGQA 4CKBA 2BEKA 2RREA 1F51E 1J5PA 1FUYB 2AV6A 2I6GA 2J32A 1R00A 1UXIA 2RK6A 2WM3A 1V54H 3I59A 2ZJ6A 3JRWA 1MJFA 1DOAA 1ZAOA 1VYUA 3L1UA 4DNOA 1FZPB 1E3QA 2KQRA 3LS2A 2M6KA 4L9TA 4E07A 5KVQA 3I2HA 4K6HA 4UXIA 3UAOA 2A6PA 3D4BA 4K1XA 3K4KA 4YP0A 2FWBA 4PLGA 5TE9A 1EUYA 4K9MA 2YYAA 1U11A 3JW4A 3FGOA 3O94A 2VSFA 4I6GA 4X6UA 3CC2I 1FFEA 4JBAA 4M7OA 4HGYA 1FMTA 2NOGA 1FLIA 5AJTA 3UXMA 4U2EA 3W4JA 3PGKA 2QGNA 3KHUA 4RF3A 2MIIA 3ECHA 1DO2A 1X3WB 3Q7IA 2QUHA 1E60A 3K4PA 4C07A 3SEZA 1RWQA 3HMKA 3AJEA 4CCOA 1R58A 1RBQA 2EAUA 3FKJA 2VRCD 2NSHA 3FROA 1I13A 4I66A 3QWAA 1BS1A 3A1VA 3IVCA 3NUZA 2ZIXA 3TDNA 5FPPA 3TTTA 2B2XA 1HBXG 5FTWA 3F3SA 2BMWA 3QYEA 3VKHA 2GAFA 4AM8A 4AT1A 3E3NA 1J8MF 1KORA 3GTOJ 4L2IA 2AFIB 5A2GA 2GUGA 1N6NA 1WDMA 1LXCA 1A4UA 2W2NA 1OWPA 2OOKA 1BCRA 2BBYA 3NDRA 4OQNA 1NDQA 2PZLA 3GJSA 3HB0A 2ONZA 2YUTA 4Q9JA 3S2YA 5CFLA 2VE8A 4AJHA 4AQDA 5J1UA 2K87A 4HDQB 2DU9A 1JAHA 1UBNA 2Y2ZA 3TTUA 3WJ2A 3L8HA 2YVUA 1KS9A 3U49A 2FPRA 4CTKA 2M1BA 3J80Z 2IHYA 2IJLA 3WK4A 3GLGA 3LK7A 4FYXA 2EHDA 2ODTX 4IS3A 3QI7A 3NHRA 2XMSA 3UWDA 4AROA 3WGIA 4B6EA 5ALZA 1ZH8A 3CJTA 1USGA 4BGDA 1XP5A 1KVRA 3HFSA 5JO9A 4F1JA 1T3LA 1USTA 4WZAE 2C5GA 1JJFA 5F9MA 3SQXA 3QAHA 2BEVA 1KQPA 3G5TA 4JYBA 4OYLA 3QPWA 2XQGA 2QMQA 1O97D 3FSGD 4DNFA 4RB0A 3UJAA 1WSDA 2OECA 4NCNA 3OOPA 2VYCA 5FULA 5IXJA 2CD7A 2YWCA 2Z2SB 4HAIA 1D0YA 5KAPA 5T4EA 1H0HA 5IUJC 5HEKA 9MHTA 3ZCSA 1Z5WA 5BUCA 2NYUA 1IV8A 2D5VA 1HDIA 1WFXA 3DTIA 4WOJA 2YZMA 5AI0A 1PJBA 6AT1A 3WICA 2ZRHA 4UUNA 2WJVA 1UANA 1ACIA 1HDYA 1T4BA 1W94A 1Z39A 8GPBA 1F8GA 2RJNA 1U8CB 3ZXUB 5CNIA 1R4MB 1UXKA 1IZZA 3NBFA 5AIBA 3EYAA 3PQKA 1N2EA 1OT5A 4P4TA 2PD3A 2OAP1 2MC3A 2DWQA 3EGVA 4MSUA 4OA5A 5FOWA 3SEQA 3I0TA 4Q4JA 1FK8A 3F46A 4YJDA 1DZIA 5JRDS 1BD4A 3WJ7A 5LZ2A 2XUKA 5HFNA 3QPLA 1EK5A 2PFGA 3OM1A 3R0QA 1RYFA 3WSVA 4Q7KA 1DWQA 3A1CA 3BD8A 3W05A 5LD2B 3HJCA 3GVIA 3X1MA 2V9PA 4J0HA 3K1TA 3W5AA 3EZ9A 1YHZA 2C5FA 4BUCA 1T2EA 3AHCA 1W36D 4TSRA 5B1DA 1X38A 1R6TA 4CV1A 3ML6A 3FHNA 1YIDA 1UXGA 1ZD3A 1WXHA 4Q00A 1YFJA 2OSVA 4DYCA 1GL6A 4HV4A 2NZ8A 3SCZA 1UOPA 2DR0A 4P2GA 4D0RA 1W4CA 5A5DA 4GOJA 3UMFA 4QPZA 4GEGA 5JNTA 1EUCB 1P5HA 3DLTA 2GOXB 2E1PA 1FP2A 2FFRA 1TZCA 2PGOA 3IE0A 2FPMA 3D8UA 4DC1A 4ZARA 1WPQA 4IMJB 3X2EA 4EF6A 3M6MD 3W5UA 5BW4A 2OBBA 5AW1A 3IAS1 5DNDA 3DXFA 3OIOA 3I3SR 4JHXA 2LP0A 3U7IA 4BX8A 4JI5B 4RKEA 4XL9A 2EDAA 3VUFA 5AUNB 5B53A 3BZCA 1M0SA 4AIHA 4O1HA 2Q5IA 3RO7A 1KE1A 1C0KA 4WCGA 1EH5A 1CUFA 1PRYA 2X6TA 1BR4A 2F00A 3LNTA 4UFOA 1KK2A 4LFBB 2P68A 3D5EA 3N6RA 5K4AA 2F43A 3F73A 4ZQCB 1OVMA 3QNWA 4HVAA 3TGNA 1P92A 3RRXA 2IH5A 4OHYA 4P83A 1SVOA 4FJ0A 3M49A 1II8A 4DJ5X 1PNRA 5EJCA 1J2RA 4MJLA 1SA0A 3ILYA 1OZAA 2YIVX 3WWEA 2VB6A 4NXNB 3PTAA 1LWNA 2W2MA 3TD6A 3UMVA 4QFBA 3CO0S 4RVCA 3UJ8A 1UQUA 1HV8A 2AR7A 3UAYA 4C5BA 3VAYA 2WHRA 4QUBA 4F6CA 1HR0B 3NIDB 3EY9A 3HL0A 1DQYA 1XHEA 1PYOA 1HMYA 3IQFA 3ERED 3M70A 3T7DA 4A0RA 4CZ2A 5KUTA 2QWWA 1TI7A 4M3BA 1E79D 4PGHA 4TTPA 3TS1A 3KDSE 3PNLA 3RS8A 1ZN7A 3U7FB 4F1WA 4JSYA 1HE3A 4PINA 5EFOA 3DLCA 4IRHA 1MD0A 2Q45A 5TY0A 3SYRA 2VJMB 3AM4A 3RKXA 1EQAA 4P3OA 3U5ZB 2GJ9A 4M0EA 3QPAA 2IYLD 1VJTA 2NNLD 3PPVA 4PHTA 3B02A 2AXEA 2VJOA 3ONEA 2EP5A 1MPTA 2GYVA 3HTSB 5EE1A 1VSBA 5DM0A 4M6WB 4EUHA 1J99A 1OJ7A 2RH8A 4M53A 4XLNF 2P0AA 2H1WA 2HR3A 1HGXA 4JYKA 4ZQFA 2IH2A 3FX2A 1IHOA 3QVGA 3WRWA 2ACVA 3HB7A 3LSYA 5K3EA 5AK6A 2EDCA 3ZLVA 4BUZA 3PUBA 4A4DA 1G98A 1C3XA 1GYQA 4B3FX 4KQ6A 1UL1X 3BR3A 3H9GA 1K9SA 2A3NA 4LIVA 2IEAA 3W04A 1TJ3A 1MJ9A 3G73A 3TGPA 1Q57A 4FDLA 1B4DA 4ZCQA 2EFDB 1VMEA 2VPLA 2SKEA 3IE2A 1C50A 1C41A 1QK4A 4B31A 4TWIA 4DCMA 4GXOA 5FJ8J 3J7ZI 3MZYA 1G55A 1Q3TA 2HJWA 2OFPA 1NVGA 1QPGA 2OFWA 3ICQB 4TLLB 1YTLA 1FLDA 2FOKA 3C6XA 4XQFA 4G07A 1KBOA 3U0VA 1PZHA 3ZEAA 1A5JA 1XX5A 1ZMBA 2Z2KA 4COOA 2YIJA 2E55A 5AJUA 3L02A 1X70A 1Z37A 1UHWA 2WY7Q 5TEWA 1NBME 5AKZA 4DF3A 3QP5A 3TO7A 1D1TA 4FFWA 4JN6B 5FQOA 3MRXA 1ZD1A 4IL6C 1XEWY 1XD7A 4DW6A 1RRKA 1WP4A 2O23A 1YDHA 1KZ1A 3DAPA 3OMLA 4EMSA 4CI0B 5KNDA 1ARZA 5JXIA 3GLTA 5TV2A 4BLOA 3KTAA 1L8LA 2EQRA 2O7SA 4MQBA 1OBVA 3GTKJ 4DYVA 2UWMA 4XX0B 3MUFA 1MMDA 4YASA 3W34A 4JDPA 2FQ4A 1Z4OA 3H05A 2FSPA 3ZBUA 3F67A 1CB0A 1JAYA 1I39A 4UUSB 1QC5B 3BTSA 1P75A 1RUOA 3DS8A 4MV3A 1A96A 1MZBA 5EZGA 3IOCA 2A0XA 3DBVO 3F4LA 2XUPA 3BMCA 1Z3YA 4IQGA 2NO9A 4KBGA 3RQSA 4M87A 5KQGA 4RKYA 1ONBA 5AVYA 2Z8YA 1HQYE 4HQRA 4IIJA 2RGUA 1NGSA 4Z6KA 4AO8A 2Z9CA 1P60A 1TLHB 1KI8A 1O0SA 1SZJG 1THZA 1K7AA 1Y1PA 2PSFA 1FUIA 3ZDFA 4LV6A 2C9ZA 2IPQX 1HF0A 2LDBA 3HA3A 4I5DA 2V8BA 3ZY5A 4H9GA 4E2ZA 5IP6A 5DP2A 1XQYA 3I1IA 2IBSA 4M1WA 1O96B 2WMNB 3RSGA 3GLGB 1N2CA 6Q21A 4XH9B 4XRMA 1DT5A 1XZJA 4LLNA 3BHIA 4Y1EA 5D8KB 1EJ2A 1UWCA 3OAAD 4QJ3A 1KS2A 2ODQA 2OTLI 2QZZA 5FAXA 3MNFA 3O4GA 5I9TA 3UW1A 2QPLA 5HTOA 4IZIA 1LTKA 5ALEA 5IKPA 4OL9A 1E3WB 2DH6A 4U63A 5JAHA 4RAFA 1NVBA 4DFDA 2JIDA 3FDZA 2VHWA 1Z35A 4JUDX 1C9KA 3AJ8A 4QYIB 4AQ7A 1K0FA 3MMXA 2Q1XA 5D5WB 2CXQA 3D0QA 4ID3A 4U2BA 4UQOA 1JEQA 2OD5A 1FBNA 2B4KA 3J81K 1MO3A 3KQTA 1GIAA 4JEHA 4HUTA 2KSQA 1KQGA 4PPQA 2NQ2C 2IGNA 3GEGA 4GXNA 4BE9A 1GGVA 2AQHA 2V6EA 4QXQA 3LHFA 5GM1A 1EA3A 5DRTA 4QIHA 2HPMA 1NG6A 2Z57A 4JOBA 4NULA 2EFOA 4TL6A 3X1YA 3T5PA 1FTQA 5DHRA 1FTNA 4WASA 3TW7A 4N4NB 2IYEA 4MIYA 4V39A 1U99A 4K5QA 5FNVB 4Y15A 5EWMB 5BSTA 3TQQA 2H31A 3USCS 4LCBA 4C2BA 1AKMA 1YDFA 2IPXA 4X1KB 3UJ3X 1GNQA 1THMA 2B4TO 3FNHA 2IEZA 4XKBA 2NVQJ 3AJ9A 3Q7QA 4NEGA 5CLLA 2BBWA 3ZY2A 4DQDA 4EDHA 5I7SA 2L54A 4MHSA 2A58A 2KIQA 3NWOA 2G0EA 1PT7A 2B4RO 2X58A 4TT3A 4ISCA 5FI5A 3SIXA 1I94B 3V3TA 2CFXA 1XPJA 5DK6A 1N1EA 4R40A 5CDGA 2JPCA 3PEFA 3CNHA 3CN7A 1UDWA 4KH1A 3K9GA 3KE8A 1RS0A 1XTQA 4ZKEA 3F9IA 4PSCA 3AHGA 4KQ9A 4PZCA 2C7QA 3ZXIA 3HCOA 4S1OA 4UE2A 1S3JA 3HN2A 2NYXA 4MUBA 2J0EA 2OYCA 3F7MA 4J4TA 5EJMA 5KNLA 2ABWA 3A01A 3ANYB 2HPIA 1SXJC 2QZPA 4NUBA 5CCDA 1A6IA 3COWA 4K9DA 3TLMA 1KJ9A 4MDEA 3DTVB 1UC8A 2IOFK 2LPMA 2G08A 1PJZA 4D41A 3ZHOA 2QW0X 1E5QA 4KXMA 5LP6C 3WYBA 2C9OA 1L6IA 4WK4B 4B17A 3HY3A 1K2WA 2HNBA 2G71A 1GVNB 8ADHA 4F6RA 1D1CA 1MKMA 1XRLA 4FR0A 2VKDA 5C46F 3H3ZA 5HQ3A 2O7RA 2BYTA 1P6RA 3OIWA 1U9IC 4OJNA 4BKQA 4BVJA 3GGSA 3H9BA 1LBEA 1N5JA 4JA0A 3VQTA 3ZZTA 4IZ6A 4F8YA 4UTVA 2GKGA 4GQBA 2ACJA 2AR9A 1W9HA 2HU7A 1OXKB 3SFZA 4DGSA 4NV1A 5CDHA 4RIFA 4BRWA 3UG6A 1VJDA 4MQ9F 3RWOA 5FKLA 2F5VA 3GMDA 4D6PA 4XWWA 3WZMA 1JHDA 3RS0A 4LOCA 2CJFA 3LT0A 1ZC3A 4YDHB 4RA9A 4Z3OA 2PMZA 2WU0A 3T12A 3BWGA 4TRMA 3NUQA 4AIDA 3I9MA 4P32A 4IXTA 4R6XA 3IMKA 2Q5HA 2RHLA 1T2DA 1XRPA 2FPIA 1SBTA 4DLUA 3BSSA 4X3PA 1MGPA 1PFUA 4EB6B 1TBXA 2CU7A 3CCSI 4DW8A 3JD0A 4GH5A 1ZK1A 1JI3A 1V4RA 2XLCA 1EH6A 1PJ8A 2HOQA 4ESFA 5C80A 2BOLA 2XXAB 1KYVA 1Z7WA 1U6GA 4E4HA 1JG6A 1UZNA 2NSLA 2OBNA 3DTVD 4INAA 5H5JA 3B1KA 1ZUIA 3A1WA 4D46A 1G5RA 3JRHA 5FGMA 5FTMA 3DXJF 4BIIA 1NTRA 2GM3A 3DZKA 3KSUA 3O9ZA 3GTMJ 2EZLA 4WV3A 4XRFA 3NV9A 3PPIA 5LMCA 2VXOA 4YAWA 2B78A 1AKWA 4D3XA 5LA6F 4GM4A 3KXLA 2D1SA 2ESNA 2E0IA 2EP7A 2LR0A 5CVIA 4BMDA 1UFRA 2WR8A 5BN5B 3RTCA 2ZB4A 1BJKA 4LTNA 2XOKD 5ALSA 4LLGF 2GHIA 3AI1A 1MU0A 3E2IA 4OUDB 2VP0A 5IVIA 3FI0A 2IRWA 2BEUB 3QVVA 4YMLA 1VSTA 2IXFA 2Y1GA 1DIAA 1QR2A 4PVDA 1PG0A 1RPAA 2GVZC 4JR1A 4M0MA 4LYGA 4YRPA 3GPCA 2R8BA 4UNPA 4ZK6A 3VX4A 4JJAA 2AXQA 2DA5A 4QNRA 3CNOA 5TRTA 3E84A 3BMQA 1OA1A 2BL4A 3A6PC 1B9NA 2GCGA 4DEXA 4QTTB 3THYB 1X58A 1TKBA 3PYXA 3PEEA 2VDNB 2FPSA 3I5UA 1U7TA 3GG9A 1JDTA 1JDNA 2JKYA 4D9FA 2P7CB 2O0MA 2ZSJA 2XDVA 4QPJC 4REQA 4UBKA 4HNGA 5BQPA 4AIRA 1B6AA 1GTL1 1SVSA 3E0XA 3ESDA 3KVVA 4FBLA 4XIYA 4YS6A 5CIYA 3QRWA 4FWBA 4YAFA 2YU9J 5EE9A 5K0EA 3D81A 5B6IA 2WIDA 2WYWA 1XT6A 1U8TA 1KA8A 5E1WA 2XUIA 1SUSA 3K9BA 3KZCA 2I6XA 3OAAA 4YFVA 3ITKA 5JAQA 3FNQA 5BSEA 4QXMA 1P5JA 1H0KA 1ODKA 2WRZA 4ZC8A 3JD1A 3RPEA 3AM5A 3D6UA 2BVLA 3GUZA 1BA2A 1GZHB 3G9UA 5DBHX 3TL2A 1CRQA 4IOCF 3ZK9A 2AR0A 2PWBA 1BEZA 3GFTA 2L82A 2QRVA 3JWIA 3PQ4A 2H4WA 3DMHA 1HYQA 3A2NA 4UOZA 2JIQA 2IFTA 4TLBA 5LZ7A 1Y34E 5FKOA 1YX3A 4JX6A 1YJWI 1SKYE 3P9IA 4L85A 3WP1B 3LHSA 5KX5B 2KJCA 4DABA 3K8YA 1FQWA 2D2VA 4G37A 4KRYA 4M8NE 1AG9A 4YAJA 1NSTA 1R4NA 2EYUA 1Q44A 1XTKA 5E3LA 1JDPA 2HQOA 2B4YA 2I4RA 2QAGB 1L2TA 4I1RA 3WLHA 4HEHA 3SXUB 2PXXA 4UM9D 3TIVA 2PUGA 5KYTA 3B13B 5A1TA 1A9XB 2QQBA 2ID6A 4YJGB 4A91A 5M3MJ 1Z2PX 4H18A 4MIKA 1VM6A 4EJ0A 4LOIA 3DEIA 1NT2A 3B5EA 4IOMA 2H8WA 1T9KA 3HWX1 3HB1A 3O90A 3ZWYA 4Q02A 4KCGA 1FOXA 1J70A 3HJRA 1Y37A 1YRBA 3KR0A 4QASA 5B1BH 1QZ3A 4XVQA 1ZRHA 4C1BA 4DIUA 2G7UA 5KTRA 2I29A 1QP8A 2A6TA 1ECLA 4LY3A 5AOVA 5ULLA 4F55A 4U6NA 2GEFA 5DN6A 2PJDA 3A0BC 2GBYA 4G0VA 4XYMA 4YCNA 2RGBA 4O8CA 2V5UA 3B85A 3AFIA 1OYWA 4GU5A 2G9RA 1UR5A 1V8FA 3SR4A 4JYAB 1OXXK 2O8VA 4Z99A 3IDZA 3U5TA 2BMDA 2W2LD 2L5QA 1O7FA 4FIDA 5FWAA 4B0OA 2ZR8A 4IJWA 1G8PA 5JPCA 1GVHA 5IAAA 3INNA 1K5HA 3AH8A 3L9XA 1KMQA 3OL3A 4NCJA 3AJAA 1VKOA 2YN0A 1ZOIA 1G8MA 1IG0A 3ZJ4A 1U9OA 1ML3A 2GI4A 1JG7A 4LSGA 4KO8A 4ZT5A 3DH0A 3VAZA 2Z3WA 2KB0A 3Q5FA 1BOOA 1QHHA 2JK0A 1GO2A 1YBMA 3P71T 4HGQA 4MAMA 2ASEA 1QONA 1NM5A 1ZG3A 5JVDA 3FI9A 5JQWA 2AD1A 1NBOA 5CA0B 4L3OA 4X1KA 1BVYF 3HB4X 2HPHA 5J2TB 1SQ5A 6PFKA 4D92A 4IEJA 3OT4A 1AN9A 1R6BX 5L3VA 1OASA 1PGJA 3KCQA 4TZ6A 3GPDG 4JC4A 4N7JA 1PBTA 5IAOA 2P62A 5CVDA 2JCSA 5CURA 1RHRA 3LWNA 3MD0A 1VG1A 5ES3A 5A0FA 1LDJA 3M9AA 3KZMA 3MQ2A 4EYSA 2XUQA 2W6IA 3WE3A 1C9DB 3QE2A 1E8DA 2C9MA 2SBTA 2XQKA 4AMVA 5DIZA 1YQWA 2VL7A 1WKMA 1QH9A 3B6JA 3MT7A 5DI3A 1K61A 2A94A 3QYJA 4S0XA 4KISA 4ZAFA 4TWAA 1CUVA 2IVMA 3IFSA 1MH4A 1U5TC 3N8IA 3ADBA 1R0WA 4JQSA 1KTIA 1DC6A 1M8FA 1G3MA 5J63A 3F74A 5FNZA 1AO3A 2YYZA 3DB2A 1RXEA 4LSZA 1SUEA 2X14A 5DTJA 3RVJA 2DR2A 3IAM6 1ADGA 1CG6A 1JZQA 5F76A 2QJRA 3ROFA 1II0A 1KY4A 2CYBA 1KK3A 2CE7A 2GR9A 4GYYA 4I76A 4MS4B 2IUYA 4J19A 1WB6A 3HKBA 3IXMA 1KK0A 3R09A 3RTRA 4D3SA 4D7MA 1E2UA 1YOVA 1ZX1A 1FYVA 3FRIA 3I9KA 3JAWA 1DP4A 3OVMA 4BL5A 4HF2A 3SYMA 5AW3A 4MTDA 4MUMA 1RWKA 5AW0A 1OHHD 5DHFA 2DWOA 5IC5A 4DNXA 3ZC3A 3S1LA 2YL2A 1XN4A 3PZRA 4FMDB 1KE2A 3MHTA 4XSZF 4KWHA 3J81k 1IXCA 1GPNA 2IYXA 1LPBB 3Q0VA 2JGJA 5CLJA 4IQ4A 4BZQA 2EJRA 2H18A 2XT6A 3C97A 3CUEF 3J7TA 1XZ8A 1QANA 4NZPA 1W0TA 3ULQB 2WG0A 1MJNA 4LXYA 1JLLB 2QDXA 2V7EA 4G9BA 5JCXA 4YB8A 4ESVA 1MW8X 3OP4A 2NRAC 4BVFA 3VZPA 4CM1A 3O4RA 4EBBA 2C1ZA 4L9WA 2ZYUX 3H2BA 3OI7A 2JA6J 4AQYB 5IDQA 1UMCA 2C2MA 1WLYA 2PQ6A 3OZGA 4JWKA 1F7VA 1BROA 3NHLA 1QS0A 2GRUA 2CVZA 3UYLA 5KNBD 2RKWA 1HKSA 1A98A 4FYMA 3DWEX 5CT5A 1RRGA 1W46A 1G20B 1MH3A 3E23A 1A77A 3I56I 1J25A 1DRUA 1V39A 3DYIA 1WZ2A 5AKHA 5J2TF 3P0JA 1XXHE 3IDQA 5SZJA 2BY2A 1CY2A 2ZR7A 1SKAA 9GPBA 4YQEA 2WQ7A 2P81A 1LLFA 1HETA 2HIHA 3A6EA 3EEYA 3RS2A 4B4KA 3L4JA 1PVOA 4HS9A 2V0CA 3WQQA 2PX3A 3F6CA 1LEAA 1UG2A 1GZ7A 1NOIA 2PO7A 3GNQA 3BDIA 4KFTA 2UVPA 4G1FA 2DPDA 1C0LA 1H1TA 4NZNA 4PPNA 4H35A 4CEJA 1IQUA 4GE0A 3EZYA 3NETA 3W3ZB 1KYZA 4Z2AA 4O63O 2BV6A 4EM2A 3GGCA 4JI8B 1PJAA 4P0PB 4P31A 5D6OA 5DLQC 2OD9A 4RWZA 3MVPA 5DI9A 5B1EA 1POXA 3HHEA 1R6AA 3BHJA 3FCEA 5ITVA 5GJBA 4QREA 3UNGC 1AOYA 3I54A 2Q29A 2HOTA 1ISMA 1GTMA 2GFHA 3HNPA 1HKQA 3AB8A 1X7WA 4PM4A 2HIGA 2PMZN 3RC9A 4ABYA 4LPKA 1RADA 4OQFA 1P44A 2G0TA 1NMXA 3RDIA 1TECE 2X1MA 3KZKA 4REQB 3T5TA 2ZVPX 1KBZA 1VA4A 3EK2A 3ISTA 3KFXA 2CW0F 3HPGA 2AZ4A 3BTLA 4EJTA 3V33A 4X1YB 1J8FA 3PIDA 3BK7A 1T0FA 3GRVA 1CLEA 1UDCA 3CCCA 4UD6A 3VHXB 3WGTA 3SLGA 4FT2A 5GPBA 3W5IA 4I0BA 1FL9A 2LD4A 1GU0A 2MA3A 5IWAB 1YJAA 3CCFA 3IPRA 2RH5A 3PHGA 4QDOA 1SRQA 1UMBA 1OJLA 4DQLA 2DBRA 5EMKA 3OQMA 2GNOA 5J5CA 4LV5B 4Y2JA 3W5VA 4QBIA 3WL8A 421PA 2E37A 3WHBA 1QG2A 1WU8A 3P5BA 4F7DA 5LFAA 2BHNA 3I2FA 3NKFA 3DAFA 1UBLS 1U2WA 3BROA 5CFNA 1TF5A 2BUAA 3NIBA 5FBLB 1UXOA 4B4DA 1ISFA 3A0HC 4BX3A 2Z9OA 3NBUA 2OWDA 1WH7A 1G5QA 2H1FA 5DDGA 2JKZA 1OYIA 3G2QA 3PRKE 3WMGA 1F12A 4FCYA 4V1CB 1OCEA 1LNSA 2GTPA 4UVCA 2FN4A 4Z49A 3LQ2A 2O4CA 2F1HA 2I4IA 5G4KA 3IA2A 2R4GA 1BAPA 2YASA 4R7ZA 4UMFA 4AJ4A 3QFTA 4TGLA 3C6MA 1M0TA 1BE8A 2CDCA 3Q0UA 4K9LA 1F6WA 3DBIA 4FPXA 1Y3FE 3AERB 1RWWA 3ER6A 1QIKA 4RCZA 1ZHOA 4TZ0A 4EG4A 3PPWA 3UA4A 5GTIC 1V1RB 1EAMA 1OPRA 4YCBA 4GLBA 4P9UA 1Z16A 3BZKA 4LZNA 4HMPA 3ZW8A 2XCOA 1SFXA 1GLVA 3RYPA 1UBKS 1G9XA 3CC4I 1ZONA 2NXNA 3KP2A 3A7DA 4KO1S 1TMGE 1A35A 1O7JA 1WZEA 2WYVA 2ZLBA 1IXZA 1VE9A 2CXSA 3JQFA 3Q41A 4HAOA 2O6LA 4JBHA 5ALDA 2OLEA 2IA2A 1L7OA 1OXMA 2IDZA 1HT2E 1DGWY 1CRWG 2ZB7A 3GW8A 2JB9A 4MPDA 5IT5A 4JXXA 5DLPA 4DTCA 3DPLC 1JDSA 1I24A 3W5CA 2XC7A 5LEJA 2YWHA 3GRYA 3RVDA 4P4SA 3JWGA 4HGRA 2Q3CA 5JSZB 2PY6A 3PDJA 5J47A 5JI2E 4I50F 4OMFG 1M5UA 2DJIA 4G85A 4HDRA 4LW8A 4D2IA 4ER0A 3OF5A 5LDHA 1KOLA 3GA0A 3BFVA 2A9FA 3FPHA 1U9ZA 4MP6A 2DPXA 2WLTA 1IUPA 4PDKA 4PC3A 3TLCA 2HHLA 4HB4A 1BEEA 3VYWA 2WAEA 1C3OB 1LX6A 4M38A 4DJDC 2NPOA 4PSXA 2Q21A 2O57A 2P9HA 3FA2A 3GMTA 3B6AA 4ECEA 2P3QA 3BK2A 2G88A 2FE3A 3F96A 1MV5A 1TCCA 4ID9A 5CYPA 5E3NA 2P65A 3WQSB 4DB2A 2Z0MA 5K1YA 4LRTB 2GBCA 3M4JA 5D5VB 3NTUA 2COEA 3CWZA 5H70A 4BNLA 5B57C 1RBMA 3HDYA 3OEED 4OL0A 3O4HA 4JLOA 3A26A 1SMKA 3VAAA 4FMCB 1M67A 3K73O 1IRFA 3HGYA 4B9AA 1IY2A 3GFFA 3PYMA 3AUJB 2ETHA 5BMZA 5DI3B 2WJGA 3QOFA 4UVDA 3RUIA 1U1CA 3L8MA 5LXTF 2H1OA 2G06A 1SELA 2OCLA 2ZJ5A 1LJ8A 1G6NA 4WXHA 1CX9B 2XOKA 3FYCA 1YW8A 1N2CE 3E8XA 5ICEA 1U3DA 1RESA 1FJ2A 2QP3A 2NVUA 1QK3A 5MDHA 1G3RA 1EESA 1BHQ1 3MAJA 2R85A 5E79C 1UJNA 4O2AA 1G8SA 3KELA 3RIHA 4C0QC 1KTVA 4DA0A 2BFDB 2JJ2D 5BVHA 2Z8ZA 3CF5F 4BP3A 3QVWA 3KT8A 3D31A 1LB1B 1D0IA 3GJ5A 4KAJA 4O4IB 3X43A 5I7OA 2B2NA 2OV2A 4AJEA 5BN1A 4RKRA 9LDTA 3DE6X 1FY7A 5GPCA 2ONKA 3I04M 4MWSA 4PRLA 4Q01A 3RSOA 4KMOA 5IUKC 1QRSA 1L0BA 4CEJB 4EWLA 2VR1A 3KP1A 2HA2A 3P0HA 4JLWA 3VR2A 2Z9DA 4UJ3A 3VZBA 3QTLA 2VYQA 3CH5A 4ER7A 2JLXA 2ECKA 2BXYA 1G7RA 2HF7A 2Q2WA 4BGUA 4MYCA 5EF6A 3IJRA 4WJLA 1OHHA 3RIMA 2YZNA 4G0UA 2R6GA 1YZFA 4JCCA 1ZQ3P 1PKXA 1RRMA 3LO8A 4S05A 4BTLA 2O8DB 4AKGA 2UU9B 1OLOA 4RTLA 3LSRA 4NMXB 2WUDA 3PCXA 4KE8A 4J03A 1IF1A 1I33A 3L18A 3I83A 4F5YA 2WWIA 2WA2A 3E9CA 3QKUA 1YQUA 1XXHA 2KLBA 4UFNA 5CNJA 3V7WA 3WV4A 3JR3A 4NC9A 5KWEA 4MV7A 4XB6B 2Q28A 4CKZA 3MZ8A 1ST2A 1UPXA 1L9KA 4Q82A 4LWPA 5F5XA 4DCSA 4DY6A 2ZREA 3BH7A 1ENHA 3GWZA 1LE8B 2A9PA 2N3ZA 2IYPA 5JXJA 3ON5A 3I8SA 3H6GA 5L95A 2FX3A 2E1MC 4YT5A 4XR6A 1W4AA 2D1FA 1IJWC 3JSAA 1MNAA 4OINF 1RIFA 2J07A 4M60A 4NE7A 5A06A 1V5FA 1CWUA 2QLTA 5A7HA 4EBFA 5IX8A 1YB7A 2OTCA 3EGCA 3L6OO 3JYLA 3A7EA 2NPFA 1PZGA 4MO2A 1AWCA 1ID8A 5FRDA 2PGAA 2VSYA 2PAFA 3LRPA 4AB1A 2W37A 4JI1B 4ZCIA 3O2SB 3R5XA 3EVBA 5FKJA 4L4XA 1ENYA 1L7EA 1QTRA 3DC7A 3MUEA 4BMCA 2AZXA 3PA6A 1Z6XA 3LUHA 4TTJA 1Z4NA 2CVFA 1AKTA 3OJ0A 3P9XA 1ZK4A 4G0ZA 3NDBB 4BKPA 3FZVA 1LPPA 6LDHA 3WWPA 2ORVA 4YV2A 3ZXYA 3FF4A 1MP0A 4CDNA 1TA4A 1R8SA 2UZ4A 4XM1A 1Z83A 1V55H 1EZ4A 1SVKA 3GDFA 1JG2A 1U3WA 2P40A 3N74A 4KNWA 3OKFA 4DR3B 2BXZA 3Q5EA 2CL5A 2D8AA 5HVNA 2ZR0A 2V1UA 3I34X 4YMIA 3TFQA 2A9KA 4KL8S 4Y6GB 1G7CA 5IYBJ 3W5JA 5IFLA 4WBXC 3BEOA 3GCGA 3V7CA 2FU5C 3BTUA 4E2FA 4PC6A 1YVUA 4DBQA 4MR9A 3H7AA 4NPHA 1S2MA 4R9UC 3UIEA 4HP8A 1E7WA 4I50A 1B0AA 4TXHA 1D0ZA 1B73A 1RE1A 1SOAA 1TVKA 2M2IA 2Q5QA 2YMQA 3LPLA 5LKRA 2Q8QA 3Q3HA 5EGSA 5CCXA 3LUCA 2BDTA 3IEMA 3PUFA 3OY9A 1R71A 3EOZA 4I2VA 4PNHA 5BSRA 3K0LA 4KX5A 4XQCA 1MC8A 1ZLYA 3IO3A 5IZCC 4RZSA 1IRZA 4A93J 3QLJA 3SI7A 3ZY6A 4XRSA 2C4TA 4O4HB 2EIJH 5IYZA 4RTOA 4TTIA 4KOEC 5KTTA 3FOCA 1LVKA 5HKKA 5CLQA 3NEUA 3DZGA 3RSQA 3O8QB 2GO7A 1TVEA 2PRKA 3JASA 1JI8A 1SC6A 4MPRA 3ESAA 3O8HA 1U04A 2RFLA 5EN4A 5BWLA 1I4LD 2BMAA 4HDRB 2ZYAA 3LY7A 1BN5A 2Y0BA 4BBJA 2FQWA 2W22A 3LWZA 4JJIA 2NT3A 2OBPA 5DW3A 1K7CA 4C7OB 4UZEA 3MTQA 4B7UA 2WB4A 3P96A 4I5IA 4MQEA 4V0NA 4E2YA 3B1YA 1RTKA 5HCNA 3KR9A 1Z67A 1FJLA 2BEJA 4URUR 3RZDJ 1VQ6I 1KMHA 4LHWA 4QWMA 2OXTA 3BXHA 3KHTA 1Y89A 3FLMA 2AG5A 5E18F 1SBHA 2VDRB 3CLVA 2DRIA 1NHGA 3G0BA 3O0TA 4D3DA 3CF2A 1T1GA 4BRSA 3PIOF 3GLVA 3N2ZB 2GWRA 1IMOA 2R6AA 5JROA 4LCJA 5AIPA 3PUZA 5AHOA 3AG2H 1NFRA 3WI7A 4Y9SA 4LJRA 4ZEXA 4BXFA 4B4VA 1DNPA 1KI6B 2RN7A 2QXTA 2Z6VA 3OJXA 4GUAA 4B09A 4XSHA 1I3MA 3UHPA 3VX3A 1UP6A 1LEHA 1OMOA 4ZZ3A 2PV0A 3GYHX 4WEQA 3UUEA 4F3CA 1GT91 2VH5R 1BJZA 3MQ0A 2RKHA 3QK7A 4JIGA 3D3JA 1W9MA 3W2EA 2VJMA 1JKJB 3RFCA 4P4UA 5TIIA 2RIRA 1PEYA 1J4AA 4I5EA 3UBTA 2RHGB 5DGHA 4DXHA 1KC3A 3TNJA 4RTNA 4QVGA 3FFBA 4D98A 5FYDA 3SLKA 4D5EA 4E7OA 3EC7A 1QIDA 1JDUA 2AHRA 1A71A 2X8LA 2RD2A 1F60A 3OYLA 3X0DA 3JQ9A 4CM5A 4ISBA 3WLPA 4XYLA 5I4KA 2R4UA 2E5NA 3IPLA 3ELYA 4R1SA 5ARDA 5A4AA 4RSHA 4BQPA 5EKTA 2JEYA 3H36A 3GFIA 1KH1A 2FEWB 5E6UB 3NANA 1WXQA 1M5TA 1LDBA 3ESRA 3V8LA 3M89A 3A9UA 1UUFA 1ULAA 4LIUA 2C8KA 5DWVA 5B4TA 1K4YA 2Y9YA 4QLBA 2AOTA 2IXDA 1GGFA 1N5RA 1Q17A 1U2TA 2AJLI 2CJXA 3K0FB 3L2OB 3OQPA 1YL7A 4UXHA 1WKVA 5C1IA 3ZNOA 3Q7EA 4CEIB 5T7BA 4BL0B 1V1MB 2DK5A 4XNFA 2E85A 2R2AA 2WT9A 1AY0A 1XI2A 3FPJA 1TPZA 4H7JA 3BH0A 1LC0A 1YWGO 5IP9J 3JWPA 1FSHA 2VG8A 3TTWA 1XZNA 1SIWA 2QXUA 3BB1A 3S1QJ 1UXJA 4Y0VA 1EXWA 1EXNA 1GG9A 1CY0A 1VHWA 2OFXA 1CNEA 3A4TA 3EWAA 4Q1FA 5BSWA 2J48A 2ZXWH 1KFKB 3WG7H 1GGNA 2YC4C 3D4LA 1F8YA 2O3TA 3QWFA 4JASB 1E0KA 1SHTX 2VJJA 1Z91A 3UBMA 3PDCA 5JLXA 5IT9Z 1Z2NX 1IZYA 3EW7A 4DLVA 4LRUA 2FW8A 5F33A 3WDLA 4ED9A 4LZPA 4YMSA 2D00A 3SHQA 4B74A 4D9IA 1GKIA 1DG1G 1GQYA 4PAMA 4MIOA 4UUSA 1Q1QA 3U19A 5DFAA 4RV4A 5EEAA 4DZJA 1EMDA 2DDBA 3OU6A 1T13A 4LJ4A 5FPQA 2FPKA 5ALPA 3FYUB 4IIHA 1Z34A 4QEKA 4F52A 3I45A 1QWSA 2ZPUA 1VLQA 2EJCA 2ZIAA 4MUNA 4HF0A 1WMSA 2OCXA 3H18A 5HS9A 3RVNA 2ODNA 2KDOA 1OREA 2Q8NA 5KNCD 4W97A 5HCUA 3FMFA 3ZKAA 3DFIA 1B14A 3DBHB 1O6FA 1RE0A 1PR9A 1QHHD 1FDSA 2VP2A 3BR6A 3D4NA 4QUEA 3S2EA 4CLEA 3EPKA 1K89A 4H3KB 2RAUA 2QRZA 3OF2A 2YZ2A 1MX9A 2DTZA 3MTBA 3PFKA 3EY4A 5D7BA 4YP9A 2VDLB 2B8EA 2Y4OA 3UCEA 2D6FA 1GHTA 3F3MA 2C6YA 4L1KA 3F23A 1A8QA 1C0IA 1S7CA 2WFZA 2VJ4A 2IY9A 1Z18A 2QR3A 2WD9A 3O3OB 3PIPF 3QX8A 1LX7A 2VHEA 4LNUA 4RU1A 3UK0A 3GZ4A 3RSLA 2VK1A 1FUUA 3JV7A 2FMXA 3IMCA 5BOSA 3SQNA 2MYSA 5FD5A 1J00A 2UZ1B 4DYRA 3KJQA 5A1JA 4WZBE 3DAYA 3J7YJ 5K3OA 3DLIA 4EL0A 4D0GA 4NJMB 4H4KC 1L9XA 1UWKA 1ND6A 1ZDMA 3OM0A 1NQVA 3RS3A 4JI7B 1NNLA 1FNBA 3RDPA 3IT1A 1O2DA 4LSMA 3BILA 4KT6A 1E1CB 3Q10A 4I19A 4AKHA 3HEBA 1YRLA 2I54A 2QRQA 1TJPB 1U78A 4HDSB 3TJRA 3QELB 5KOYA 2O61A 4I1PA 4G5FA 5G0WA 1ZGWA 1G2PA 2F1IA 3J81A 1KAGA 2GAUA 4WESB 2UUBB 3D0OA 5PGMA 4A69C 2BY4A 3DDUA 4GSLA 3RH0A 2ID8A 5EJ5A 1Y3IA 1JDJA 5EWMA 1LFAA 2TSYB 3DEZA 3NHZA 7REQB 2WY8Q 3NTRA 2RHWA 4GDFA 1PDWA 1QF9A 2WAYA 2FWRA 3BGOS 2NUPB 3KUCA 4TQAA 3F49S 1P72A 2GXUA 4LJLA 3LLUA 4DANA 4KPUB 1WHSA 3L3BA 2YV5A 3PC6A 4D0LB 3HY4A 4OAZA 2HRCA 3S1SA 5JSZA 5CT4A 1JQBA 1YCDA 1NXPA 1J6UA 1OXVA 2H1HA 3KUDA 2EX4A 5DXFA 3U3JA 2BZSA 4EHDA 1UPBA 4BQQA 2XA9A 2YFQA 1E6UA 4MQ6A 4MLZA 3T7TA 5HYVA 2XWBF 1K88A 4EEKA 2DOKA 4TPKA 3E3MA 1TCAA 1WJ5A 4IZOA 3HVUA 2J3MA 2XDAA 4G09A 3V7FA 4WXRA 3A0UA 3GLHE 4YA6A 4A26A 3FRHA 1U02A 2PZGA 3J7AY 4B8ZA 3OCWA 4LRSB 5J1SB 2VUIB 2F6RA 4EG0A 2JT1A 2HMSA 3PWKA 1YJ9I 1N5OX 1NVWQ 3C7AA 4TMXA 5K4HA 2FETA 2FMTA 1QBGA 1U2DC 3QITA 5DSZA 2LTPA 1G3TA 3DOUA 5JLAA 2YPRA 4IHQA 1SXQA 2R7TA 2WADA 4KN5A 3N0VA 3M83A 3KE9A 4XGRA 2PKEA 5JCZA 1YIOA 5LNK1 1ISSA 2H2DA 3D5SC 2IODA 5J2UA 1I9GA 1R18A 5E0OA 1P0CA 1GG2A 2J85A 3E7XA 3K1PA 4HEA2 3I2JA 1X13A 1JBKA 2PS1A 2XE4A 1OCPA 1CD5A 3GFPA 1Z33A 2HEIA 5DBIA 5B5EC 5B1SA 1XAJA 1K4SA 5FL7D 3L5OA 1BMQA 1U1IA 2ANBA 5JYBA 1E4EA 1Q19A 1PUFA 3C6YA 2Q99A 2X85A 1H2YA 4KRGA 5D01A 5FROA 4HPXB 2YFYA 3AHIA 1CUEA 1EWTA 3IHUA 3DUFB 3LDFA 2P2ZA 2G76A 4FBMA 4KXUA 3R0ZA 4RK1A 4EW2A 2VONA 1LLCA 2A5YB 1VHTA 2VWGA 1RAIA 5C3UA 5I8WA 1E4YA 1VBFA 2ZRAA 1F8UA 3K1NA 3H0DA 3S2SA 1DJQA 5GONF 2GERA 2A1IA 2ZAMA 1L1RA 1QRTA 1ZD4A 4Z53A 2EC5A 4OQEA 3QSYA 1X80B 2NS0A 3FXUA 1IEWA 5EXTA 3ER8A 3B2NA 3ZJUA 1KEPA 3JQPA 4WPGA 4O6JA 1X77A 2FE1A 4FC6A 3H5AA 3U48A 1B72A 4XWYA 4Q1DA 5JALA 3K0HA 4JLJA 4WINA 1TAGA 3GFGA 2EZKA 4WL0A 5K0NA 5E7MA 3PYLA 1EE1A 3NHUA 3CZ6A 4GMXA 4XRRA 2Y8EA 4OFXA 4R2LA 3K16A 1UIRA 2M0CA 3Q72A 3GEIA 2DB3A 2GAIA 1Q91A 3LT1A 4Y30A 4AIJA 3DVAB 3IUJA 4R2IA 1JKRC 1VLLA 3DWLE 2X8JA 1HLDA 3VTFA 4I46A 4R8VA 4HB0A 2HCJB 5E8GA 4FMPA 5FFMA 5TDHA 1BX0A 1Z1DA 2ZSKA 5AM1A 4HRAA 3PU6A 4LS3A 3GGDA 2M9HA 3TBHA 2XVXA 1SU8A 2QHXA 1O87A 4BX9A 1CEXA 2V55B 3O8GA 2EW1A 1FU4A 1CV2A 4PQEA 4F8JA 1NURA 1U0HC 1QO0D 5HF5A 5FTKA 1XN1A 1EJ9A 1IY8A 2X1HA 4GOOD 3K4HA 4KOAA 4L4YA 4NENB 4PN7A 3PJDA 3BDVA 3V80A 1KZ9A 2R5ZA 1VKRA 3H0EA 3NYRA 3CNQS 2P9EA 1JGSA 2W0MA 3C6KA 2PH1A 1PYDA 4LBVA 3RBVA 1JKIA 5HDKA 2QW1A 3V7YA 4JLUA 3HDVA 2V26A 2QRMA 3LTEA 4LWZA 4OI4A 1GRRA 4ZH4F 1S2OA 3GZJA 5FADA 1M76A 2HPZA 5LDGA 1AKHB 2VQHA 4O0MA 2VYFA 3VC3A 1P3JA 2WUEA 3TMYA 1VJCA 1M6HA 4QDXA 4U00A 4FGLA 3N4MA 1LBIA 4Q15A 5IJXA 4A1OA 3FOEC 1SXJE 2XPVA 1U8XX 3CZPA 1C0WA 5BQ3A 1QRDA 1QQTA 4DSTA 4HNHA 1IOWA 2M6SA 3RIYA 5JJBA 4F56A 3FSEA 3JZAA 1KMIY 3Q9VA 3A05A 3EMBA 3ISJA 4LF6B 4HDSA 4RQTA 4JOQA 2OCPA 2IGOA 2F3UA 1JFRA 1QIIA 1T0IA 2BGMA 3GT7A 3PZBA 1QHNA 4LVCA 2NUAB 5IK2D 1RYMA 2ZJ0A 1VI0A 2PN1A 3BORA 5KYWA 1UJ8A 1Y1QA 1ZGHA 2WFAA 5TPZD 4YV1A 2NU8B 1I5RA 4A5NA 3NT5A 4E1AA 1OI2A 3C6QA 4WZAA 1J0DA 1WW2A 1A5AB 2KX7A 2MWMA 3BGVA 2QL9A 3AFGA 2J5BA 3IHTA 2DT6A 2ZRJA 2DYRH 1LSSA 3R41A 3T0YA 3IKMB 1T9AA 3RJZA 2GA1A 1R22A 2C59A 3ANTA 4YFNF 3RS9A 3SSMA 5DN6D 4DB4A 5DV5A 2O8EB 4K9QA 2I2DA 2XV1A 4HBZA 4QUAA 1B74A 3EULA 3IBSA 2Y93A 4MUGA 4CQLA 4PNEA 1W88B 3EDCA 1IBSA 1WD5A 1Z22A 2JFVA 3G9TA 1RRVA 3SY8A 3QOEA 2FX2A 3JY6A 4NV3A 4J8PA 5AW2A 2ZT5A 3EEQA 2V7XA 3EPZA 1ZIPA 3WLQA 2ODAA 4GMHA 4IUCS 1UK6A 1M66A 4OWRB 4RKWA 1X9GA 3TTVA 3F7TA 4DIEA 3AF3A 2QWXA 1C8KA 1WIWA 2XADA 5FNVF 1G3YA 1OFVA 4AULA 4A3IJ 3DWGA 5L3CA