4HYEA

Crystal structure of a response regulator spr1814 from streptococcus pneumoniae reveals unique interdomain contacts among narl family proteins
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
200
structure length
200
Chain Sequence
HMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator
molecule keywords Response regulator
publication title Crystal structure of the response regulator spr1814 from Streptococcus pneumoniae reveals unique interdomain contacts among NarL family proteins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 83
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hyeA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hyeA01
2BYVE 3U2RA 3N8IA 3MIZA 3HDGA 2M45A 3HOTA 1FY7A 4MTEA 4G97A 5AIPA 3T1BA 3TO5A 1EWKA 2QBYA 2PL9A 2DT5A 5IUNC 1ZY2A 1P6QA 2LP4Y 2HQOA 1U8RA 3GZ5A 3RVSA 2NS0A 3KP5A 4PGHA 2VOPA 3A0RB 4AD9A 5JFRA 1HKSA 1MD0A 4HV5A 4EGSA 4PZ0A 2IA0A 3T38A 5FFZA 2QU7A 5ILSA 2COMA 4MS1B 4HDVA 1TNSA 2ZFWA 4NCBA 4OMYA 1QQAA 1ZRFA 1MDMA 3EODA 1ABFA 4HYEA 2PAFA 5DUIA 1IXRC 3VODA 5K5QA 3DEUA 2JBAB 1HQCA 3I59A 1U5TA 3TO9A 1JHFA 1EHCA 3I59B 4MR9A 1U5TB 5IT9Z 3P7NA 3QLVA 4IRIA 1TQMA 1TW3A 1FFSA 3HV2A 3IP6A 3E5XA 3BROA 3HOSA 1K68A 1SXIA 1ZYRF 4Y9TA 3EJWA 2A68F 2Q5CA 2VODA 1YIOA 2DW4A 4KN4X 1B00A 3J80K 3LA2A 2K27A 5H20A 2KJCA 4OINF 3Q7TA 3QELB 3OLVA 4PGGA 3B2NA 4BHPA 2VC0A 2A69F 4N9HA 4KQCA 3ABUA 3RTRA 3FFWA 7ABPA 2V9VA 1DCMA 2ACJA 4N41A 3H3ZA 3EGCA 3KP6A 4RAYA 1WQ2A 3RKYA 1ABEA 1LNWA 3N53A 2PL1A 2V1XA 5FWYA 2EK5A 3JTHA 3KJXA 1DZ3A 4EGZA 1LDJA 2DBBA 5DTEA 4Z9BA 4A0YA 2PBIA 3JW4A 4CDGA 1DBQA 2G7UA 3IPAA 3WGIA 2FW0A 1P4XA 1R22A 2YU3A 5DDGA 4QICA 3G3ZA 4ZH4F 1SFEA 3Q5FA 4M71A 1FBUA 5DEQA 3HHHA 5J8FA 5KVRA 2QR3A 3Q9VA 2FMLA 2MYPA 1ON1A 3MFKA 2KRFA 1DC8A 2QQAA 4KDPA 3KG2A 2VBWA 4Q47A 1PDNC 4JB2A 3O2SB 3F7NA 3F6CA 1W7PA 4N47A 1FP1D 1K7AA 2RV8A 1ISSA 2QQBA 4ZPJA 3FM3A 4H3HB 1XGMA 1I1SA 2FE3A 4MEYF 4EYQA 5D2CA 5EWMA 3EYYA 1H9TA 5ICGA 3HRSA 4ZMSA 1D2AA 2A9PA 1FOKA 3ECOA 2CSOA 3DPLC 1REPC 5FBKA 1MJAA 2BEOA 1GVJA 2H6CA 5E17F 5C5EA 4W5QA 4RSMA 3RVPA 1D8JA 3ULQB 5CVUA 4QYWA 5ILUA 3J81Z 1DRKA 1IN8A 1XB4A 4XARA 4UHTA 3ZN0A 1DCFA 2MYUA 1BAPA 1F51E 2RDMA 5F6FA 3JPYA 4O5AA 4RK0A 3CUQC 2ZCWA 1ZRDA 5CVJA 5LHIA 4QWQA 3CZCA 4OLBA 4YCSA 1RZRD 4MRMA 2JZYA 2FEWB 4MS4A 2L02A 4PICA 1JXSA 1YQAA 4HBLA 5EWJA 1J2XA 1QBJA 4S05A 3WTUC 3RQIA 5KQMA 1LJLA 3NHMA 2ZO4A 2VN2A 3ZMZA 3FMRA 4YR7A 1MZBA 2IPLA 2DAOA 4LG0B 1YYVA 4OTZA 1EFAA 4FX4A 3OLXA 9ABPA 4PZJA 3WTTC 2UXXA 1XCBA 4ASNA 3KE2A 2K4JA 4EJOA 3WTVC 3CJNA 3QLUA 4HV6A 2NUBA 5TQ0A 3C1DA 4XRFA 1OXKB 1X3UA 5TPWA 4YFXF 3DQVC 1H0MA 4ENMA 1VLZA 1Z7UA 1EH6A 3FFTA 2HQNA 2P6SA 4E7PA 4MTDA 4TLLB 4G0PA 1TNTA 3UK0A 1JDNA 4L9NA 1S6LA 5TE9A 1ZITA 3V8LA 2FMIA 2CWEA 2LBPA 2L3DA 4N9IA 2NNYA 4JASB 3TQNA 4HF2A 3QP5A 3GZ6A 3HZHA 1P4WA 5CVIA 3ZPLA 5BOXA 4WXMA 3R61A 2G9WA 2QW1A 4OATA 1R5GA 4RB2C 2WJWA 1O3SA 3RJPA 3TDUC 2Z3YA 1BI0A 3GW2A 4HLXA 3KSMA 4Q7EA 1AWCA 2YSRA 2VT2A 1PEAA 4IHSA 1TMYA 1IN7A 3J80Z 1LJUA 2L18A 4EV0A 4RK5A 2JB9A 4HZFA 1F4KA 4OIQF 1SMYF 1IIBA 3HM9A 2R3SA 1P6RA 2ZNZA 4XASA 3LKBA 4WWCA 4XBFA 4W5NA 1LQ1A 3KETA 2IOYA 4YS6A 1U5TC 1PP8F 4MGEA 3K69A 2QQ9A 1QGPA 3RKWA 2JT1A 3S2WA 1ZH4A 1NY5A 3DPTA 1MGTA 4FHTA 4LDAA 2HZTA 4O1HA 3JY6A 5DLEA 3BRQA 4PE5B 1M5UA 5CVRA 2FLKA 2ID9A 2TDXA 2ZKZA 4BQAA 1FFWA 1XSDA 4L5IA 2Y48A 3KLNA 3IWFA 1JYEA 3CU5A 3OM0A 4M9XA 1QNLA 1ZG3A 1HXDA 3IC7A 4MQFA 2D1VA 1J75A 4KNYA 1W4MA 3F8FA 2A07F 1H9CA 2XUBA 5CYVA 2E4WA 4D6YA 3RKXA 1PP7U 3GUDA 2QXYA 1FSEA 1Z05A 3LOPA 1EWVA 1FLIA 3DP7A 3E3MA 1PNRA 3GO5A 3EDCA 3HDVA 3GA5A 1NTRA 3IL2A 3ELKA 4I01A 1K78A 3F8NA 1LDDA 3FXQA 4L85A 5C5CA 1QO0D 4GPAA 4M9SA 3FMQA 2A61A 4KVFA 3ZP5A 3N75A 2VBZA 4GGGA 4W5OA 2RGVA 2XV4S 5IUKC 5J6XA 4ETIA 5DKFA 1ONVA 3BJOA 1ZLKA 4P55A 1SFXA 1IRGA 3H5LA 4QYMA 1UHMA 5FFXA 5CNJA 2YPRA 5FB2A 1NXVA 3NBMA 3D8UA 4ZYHA 1P92A 2D1HA 4OIPF 3KEOA 3JTGA 4WUTA 4WZZA 2HQBA 5KC8A 3I45A 1L5YA 4A0ZA 1M5TA 5HDNA 1ZHFA 2R7FA 3BZ6A 5FWXB 5JNTA 1A2OA 4XLNF 3ZQ7A 1UCRA 3T0YA 3LAPA 4GNRA 1KU7A 1BI1A 1YW7A 3H5WA 1U2PA 2Z99A 3N6VA 1DC7A 2KIFA 1KQ0A 1QZYA 1XHEA 2JPBA 1YMUA 1TBXA 2E7WA 4MPTA 2OA4A 5JS1A 1ZLJA 5BQTA 2E1CA 1V3FA 5BS6A 4A5MA 1CF7A 3JVIA 1XDSA 2HYFA 3L49A 2HGCA 4G0YA 1GUDA 3C6QA 2OBPA 4ZZDA 4PEVA 3HSFA 1Z13A 2FTKE 2NNNA 3MQ4A 1IN4A 2L2QA 3CRNA 2CYYA 3ML6A 3L09A 4IPAA 1QQIA 1ISRA 2ETHA 3O6BB 2EB7A 2MC3A 4G7OF 3H3UA 2ZNYA 5TJJA 5DCMB 2PUGA 2M8EA 4P96A 2ZWMA 1FP2A 5KC9A 3GWGA 5D4SA 4WCGA 3C18A 1XN7A 4L0YB 1Z2EA 1UHWA 4UVAA 1KRXA 5HVQC 2E4XA 5CNMA 2IW5A 5ERIA 1JL3A 3LAJA 3RVQA 1ZN2A 4RB1A 1Z25A 4LLGF 2CHEA 1YW8A 2NZUG 3ROUA 1JX6A 1HSJA 5LEJA 5F1RA 2JK1A 1U2WA 1UFMA 4I0BA 3H92A 3ZMTA 5DCFA 5DD8A 1G4DA 5FLXZ 4H3KB 1YO5C 4Z2YA 2VC1A 5BR1A 3F23A 1TW2A 2RC4A 3ILHA 2CQKA 3F73A 4N76A 2H3HA 1U8TA 1OKRA 2GX6A 5E1ZB 2MSWA 4LMYA 2IPQX 2FRHA 4DN6A 5KQLA 3I53A 1QNTA 4D74A 2ID7A 1A04A 2QLZA 2XAFA 4MYRA 4HX8A 1Z6RA 4Q48A 5CNKA 3SAJA 3RIRA 2V6CA 3E6DA 4AIJA 3BRSA 3O3KA 1HEYA 2HDCA 2FBIA 2BBYA 1XDUA 1KQ8A 4IHTA 2EFPA 4WXDA 4UV8A 3QEMA 4IRHA 3VNBA 2MD5A 4CHUA 3O1IC 5E18F 4PYRA 4Q6WA 4ESBA 1P2FA 4IVNA 3CUQA 2J5OA 2BGGA 1D8KA 1XMAA 4P9UA 1R8JA 4RK6A 1XCVA 3ZMSA 5IEJA 1LK0A 2LNBA 2JPCA 4LJZF 4UV9A 3LUFA 2P7VB 2MLKA 1UDRA 3I09A 2PUCA 4YO7A 4HOBA 1TQIA 3SNKA 3A3KA 4LE2A 2WWYA 1BDHA 3CG0A 4L4UA 3HSYA 5LBQA 2LF7A 3T95A 3KLOA 3DV8A 1NXPA 2ZAYA 3NQOA 3CO7C 4LGWA 4KIFA 4KREA 5FD6A 3QPTA 2AXLA 4M73A 4RAZA 1DUXC 3Q41A 4O1IA 2HOEA 2PN6A 2LSOA 1K79A 1SD7A 3O2PE 3EYIA 2VYCA 2ISYA 4L5JA 3C3KA 4W5TA 4IXAA 1F4VA 1JWLA 1BN5A 6PAXA 1EV7A 1DG9A 2EFOA 1JFSA 1KYZA 2VE8A 4A0XA 5DD4A 2B0LA 3WTXC 2IYNA 4O3MA 1JH9A 2VE9A 3BJ6A 3B73A 4PCQA 5T7BA 2W84A 3UUGA 1ZVVA 1DBWA 1JFTA 2E1NA 5IUJC 2GA1A 4WK8F 1RUOA 1Z9CA 2A6HF 4KT5C 1P6UA 4ZYEA 3OLWA 3OO0A 2NYXA 3F3XA 1C0EA 1F9NA 4KIBA 2F5CA 3I54A 4M74A 4FE4A 5KWSA 1C4WA 5ICCA 4KYWA 4HQEA 2KIMA 1OMIA 1NXSA 4I7HA 3ZN1A 2D45A 4UVCA 4MS1A 2E4ZA 3AAFA 4YGXB 3N97A 3I5AA 3HSRA 3IP5A 3H5TA 4MQEB 1USSA 1I6XA 2V0NA 1G3YA 3RVKA 3MZYA 1JF8A 1RZ4A 4A12A 1S29A 2HR3A 3LUGA 4ZYDA 4RDCA 2XHKA 2JBAA 2R48A 3FMVA 2JVJA 1MB0A 3KFWX 1O7LA 2VBXA 2F5FA 4WT7A 2L19A 4KUMA 3GL9A 3OQMA 1KGSA 3W6KB 3R0AA 2Z33A 4IRGA 4TN5A 5HM6A 4F12A 4EGYA 2JRTA 2BE5F 2XKPA 3C7JA 3GX4X 2FMFA 2GWRA 4LB6B 4B8XA 1ZGJA 4XSZF 1T6SA 1FT9A 5ICEA 2FSWA 2D2WA 5IC5A 4EUKA 4U7DA 2GXGA 2OAZA 2MYTA 1U78A 3H1GA 4FB4A 3HK2A 5K1YA 3QELA 3FHZA 4GYIA 4HF1A 3EETA 2WY2D 2P4WA 3HHGA 3FXRA 2RVCA 1Z91A 1FSPA 3G85A 5TRDA 4KK3A 3HVRA 1OPCA 5AONA 4WXCA 2E4VA 1E6KA 3HRMA 3H1FA 1BI3A 2Q8KA 5T3YA 4G94A 2ESNA 4KFCA 1ZG1A 1OYWA 1WI9A 3D5LA 2HFHA 3ECHA 2TMYA 1KMIY 2OQGA 4HA8A 1FC3A 1F1ZA 4RK4A 3N0XA 1XD7A 1SD5A 5FD5A 4DNCA 3E6MA 2DRIA 2L4MA 2W85A 3J7AO 4OU0A 3DLBA 1S3JA 4JBAA 2LIVA 3OQNA 2HWVA 1OR7A 2X4HA 1QPMA 3HYIA 2JVKA 4HW0A 1B4AA 3NNNA 3QEKA 4RGRA 3L6UA 3DGFC 4FT8A 3MCZA 3IRQA 1FFGA 3HSEA 1USIA 3BP8A 3O75A 1MKMA 2PEXA 5BPIA 3CNBA 1SD4A 1ZHHA 4F8JA 4IGAA 3LMKA 3ISPA 4O6JA 3GXOA 4GYGA 3LA7A 5JR3A 2QV0A 5D4RA 3CTPA 4G0MA 3CS3A 5HQJA 3N0RA 5E8IA 2NT4A 2IA2A 1FX7A 1DP4A 2XAQA 3KZZA 5CVVA 2E7XA 3RPUA 4HX7A 4R79A 4Z4IA 2L01A 2FXAA 2UXNA 1R00A 2ZJ2A 1XGSA 2GXBA 3P9CA 4L0ZB 4KMFA 2XDYA 1USGA 4E7OA 2UZKA 3BBLA 3OLZA 3PFIA 3JTEA 1HKQA 3N4MA 2XROA 2PUBA 2R25B 1WKMA 2QYOA 4KMRA 1S7AA 3BY6A 3QPHA 2LPMA 4KICA 5KI6A 1NXWA 1QPZA 1AOYA 4RS8A 2F8SA 1STZA 2PKXA 2HSGA 4Z4GA 2RDPA 4L18B 2FEKA 3TX6A 1G6NA 4LG0A 4G0XA 5JVTA 2V1UA 3RVMA 2FA5A 1BI2A 3F72A 1ZGGA 5HDGA 2MSKA 4RB0A 1QQBA 2NZVG 3WTZA 2ESHA 4P98A 3SZPA 1TLHB 2E4UA 4F7ZA 1FZPB 1B1BA 3Q7RA 3HUTA 1VKRA 4TMYA 2KIUA 1NHAA 5AIQA 3IP7A 3MAJA 3HTUA 5LGUA 1XMKA 2WV0A 5E20A 4EVQA 3LKVA 4IMJB 2M30A 3C3WA 2CD7A 5BRJA 2VK2A 1MIHA 2Y0MA 2PI0A 1U0SY 5E8GA 2XGXA 4YP9A 4EYKA 2IP2A 1LEBA 3R6SA 4N03A 2P5KA 1LBIA 3TDZC 2G7HA 3KCNA 4WX9A 1JYFA 2Q0OA 3VB2A 1LB2A 1RUNA 1D4ZA 4P1ZA 5E1WA 2LDUA 1R1VA 1W9HA 4ZMRA 4M72A 1J59A 2MA3A 5HOOA 3WTWC 2A9RA 2RJOA 4RWEA 1KU9A 1GCAA 2HKXA 1WETA 4Z4FA 1TM2A 5TQ2B 3KP4A 1YW9A 1D1PA 3S99A 4KK4A 4CZZA 1IN6A 3EQZA 5FLXK 4HNQA 3JVDA 4CICA 2H0AA 1MVOA 4M9ZA 3H75A 2PMCA 4HX4A 1R36A 4EQQA 1IW7F 1XSXA 2FN9A 4U0WA 3GFIA 1Z12A 1LDKB 2IPMA 3C97A 1RZRA 1GLGA 1QP4A 4ZYGA 1O3QA 4TV7A 1RIOH 1FYKA 3Q15C 4U0VA 1P4AA 3E3VA 1JGSA 3RYPA 3TKYA 4KRFA 5ICFA 3IKVA 2YHAA 3SZTA 3RYRA 4RU1A 1U6GA 3IWZA 4G6QA 3MYYA 4NHJA 4G8XA 4LRQA 2ZBKA 3U9GA 1T38A 4KPYA 3O1JC 3QK7A 2Y75A 2PMHA 1B6AA 3GT7A 3K1NA 1D5WA 3T8YA 4XSXF 1YTYA 4BH9A 5ILVA 1O3RA 1FWZA 4Z0NA 2RKHA 3FFXA 3E6CC 5KK1A 4HLYA 3RVJA 4UUVA 2CO5A 2FEPA 3QX8A 4YRZA 3M1EA 4BNCA 2WC2A 1IUYA 1U2QA 3L2CA 1L0OC 2GZWA 5L3BA 2A6EF 4IF4A 3L7WA 4JAVC 4O5VA 2Z9OA 2FLWA 1FQWA 4F11A 2ISZA 1IAWA 2XAHA 3F6OA 1ZDMA 2IPAB 3K4HA 4F3TA 3LUDA 3H6GA 4ZZLA 2NAZA 1DP7P 2MYNA 1RPJA 2W57A 1FSHA 3CFYA 3HUGA 4W5RA 3I42A 2PG4A 3WU0A 2KKOA 2PQ8A 2FVYA 3FMSA 1TJYA 3HXMA 4CBVA 2B1JA 5D8LB 4BAYA 4TLMB 2DPUA 2QZ8A 5FWXA 2C6YA 3V7SA 1YTUA 2A3SA 4EY3A 1TQPA 1D5VA 5H6RA 2GA2A 1YK1A 5JS2A 2H94A 4KV7A 3T6KA 1OYYA 1DBPA 3IHUA 4RV5A 1OYIA 2EV6A 2O6GE 3BOQA 2M87A 4KIGA 2FXIA 4AWXB 2PUEA 1Q1HA 1I1GA 2ADUA 4R1HA 1GUBA 2ELHA 3BPXA 3BILA 3HO1A 1KU2A 3CDHA 1JBEA 5K5OA 1J5YA 4CXFA 5JNWA 1WSUA 1S7OA 3A10A 4OLAA 3JSOA 5DCMA 4Y17A 1Z2DA 2XASA 2O3FA 3FZVA 4GCVA 1QP7A 3E5UA 2W24A 3K2ZA 4OIOF 3URMA 1MJBA 1YS6A 5CHYA 4AVPA 2PUFA 1HKTA 2AS5F 1CYEA 3NNSA 2DQLA 1RNLA 3I71A 2M1BA 2EFWA 1T34A 2HKOA 4I02A 2EA2A 2HTSA 1O57A 3JAMK 4KMUX 3KS9A 3H5OA 1PHRA 2DK5A 3M6MD 3SQNA 1QO0A 1BDJA 2MH9A 3B02A 1XGNA 5E1XA 4RXMA 3V7CA 3NRVA 1ON2A 3KP3A 1RI7A 4EVIA 3V8JA 3T5XA 3LFKA 1ZREA 2AYZA 2FQXA 2LF8A 1R1UA 4NQRA 5EWLB 4G7HF 3ROTA 3GYHX 5IBQA 2DFIA 4LFUA 2QVOA 4ENNA 3HUUA 3H5VA 2PJUA 2FSPA 3CLOA 2X0LA 3WGHA 2JSCA 5DV5A 4XLTA 1S8NA 3WU1B 1LEAA 4A6EA 5HS9A 2FMKA 1GXPA 2FBHA 2MBFA 3M9XA 5L3DA 1QMPA 3I4PA 4JK1X 2MH2A 2YHBA 1VTNC 4UHJA 3L00A 2FMYA 5HS8A 3LFTA 5JNSA 3F8CA 3JSPA 4MR7B 4KA4A 4RKRA 1Z18A 2FBKA 5L3EA 3CKMA 1QP0A 2V79A 1GCGA 4RGXA 5GOTA 2QENA 5GQSA 1G3WA 2K4BA 4IILA 2XAGA 1XWWA 4GO1A 3QU3A 4MAAA 4G7ZF 4YIIA 3W6JB 3KP2A 1T2KA 4ESJA 3GWZA 1E2XA 2EFQA 3OM1A 4EJWA 1R58A 1C0WA 4AIKA 4RZSA 1JLKA 4Z99A 3E61A 4JB0A 4MGRA 4RGSA 1M2FA 3LUAA 1M2EA 2OU2A 1PUXA 4ON0A 3TOAA 4UVBA 4HF0A 5B3JC 2JRLA 4OG2A 4XLPF 5KQGA 4Y15A 1HW1A 1YLFA 3G1WA 2DU9A 3TMYA 3ZMVA 2I6FA 3FF5A 3DZDA 2EA4A 3VNAA 3DXJF 4YFKF 4Z4EA 2PLNA 4MNUA 2IDMA 4E70A 4MR8B 3EAFA 3DFGA 3KKEA 2MLGA 1HBXG 3WTSC 3RDIA 4D0PA 4MQEA 2VONA 3MMNA 4RS3A 5CJ9A 2PE5A 1H9GA 4N0PA 2V1DA 2HYGD 3OV8A 2QBYB 2RQPA 2DK8A 1W7PD 3TGNA 2WB4A 1KA8A 3KEQA 4AIHA 4A2UA 2PJPA 2CWDA 1XHFA 3TB6A 2O8XA 4RXUA 2A9OA 3RVRA 1BOAA 3PQJA 1BM9A 3TO6A 1KRWA 1Z17A 2GI4A 4RY0A 4Z4CA 1R1TA 3RVOA 1WRJA 4BHCA 3ZMUA 3MWMA 5JI6A 1MDMB 4DQDA 1KYWA 3F22A 4EJTA 5LGNA 4Q4ZF 1GXQA 2BGCA 3CLKA 4XFKA 1FYMA 1FPQA 3SM9A 1CEYA 4HQMA 5D5WB 3GBVA 4DADA 1FBQA 4OMZA 1DRJA 1MB3A 1Z1DA 3G73A 4MR9B 2GQQA 2IT0A 4LX8A 3JAMZ 2ZMEA 4ZJPA 3GBPA 3NEUA 1NXXA 2ZMEB 4RKQA 1IRFA 4Y13A 2R47A 4G9YA 5H6QA 2IVMA 2J5PA 4I98B 2IKSA 1RXIA 1IN5A 1Y0UA 2DPDA 2P5LC 4WXEA 4ETMA 2L4AA 3DKWA 1DCKA 1DJMA 3WG9A 1YMVA 1SAXA 5BPDA 1FBSA 3LA3A 1ULYA 4EYGA 5D6FA 3F8BA 4Q5SF 3GVAA 2WWVD 2R4QA 2CG4A 3NNDA 3KZYA 4K2EA 4YFNF 5D5VB 1V4RA 2FN8A 5FWYB 3OMWA 1O7FA 4UHKA 1USKA 2PUDA 2FEZA 2VUHB 3BREA 1BVHA 2CGPA 1ZG5A 4KZKA 5DGCA 5HDKA 2EV5A 1MJ9A 4KQ9A 5HLHA 3GFLA 1B9MA 4KN7X 1B9NA 1T39A 2FQYA 3EDPA 3TD9A 5D8KB 5E3JA 1APBA 2BV6A 5LEKA 2FOKA 4IMIB 1CGPA 4XXHA 4OOIA 5LRRA 3O2JA 3O74A 2EFNA 3MA0A 5JNUA 3MEXA 1W7PB 5IEBA 1Z16A 3N0WA 1SXHA 4LK1F 2P6TA 3HEBA 1NXTA 2IJLA 2OQRA 3O1HB 1U3EM 3BJAA 2FNAA 1VPWA 2FU4A 3OOPA 5EWMB 4QPJC 3MQ0A 3OLYA 3MF4A 1O3TA 3QOPA 5L3GA 1PNTA 2KJBA 3C3MA 1D3YA 3U1DA 3PQKA 3HRUA 3QLTA 4MEXF 3QRFF 1XGOA 3QAHA 2P8TA 3WGGA 3GFJA 2MSLA 3MM4A 3FX3A 3QU6A 2YX4A 3E6BA 4P9FA 1XSVA 5LRSA 3IP9A 2H27A 1Z15A 1CHNA 4EM2A 2QZJA 3F8MA 4Q6BA 4OIRF 1DDNA 2HTJA 2K86A 3QX9A 3VEPA 5LHHA 4Z9AA 1G3TA 4RK1A 3FM5A 1LBHA 4XAQA 5JNRA 4MRMB 4LDZA 1EWTA 4FX0A 4MS4B 2DTRA 2QWWA 4M6YA 3R4KA 5EWJB 1FYLA 4QLCU 5TQJA 2CFXA 4ESFA 4ENKA 2P5VA 1JFVA 4FE7A 3JS5A 3FWEA 2HJ9A 3CUOA 4G0ZA 1DPUA 3LSTA 2YX7A 4RK7A 5LGTA 4RB3C 3BDDA 1J9IA 4EJVA 1KQ9A 4LZLA 2QSJA 3QP6A 1JE8A 3P9IA 2OD5A 4BYYA 4MHGA 2Z5UA 4ENJA 4WF2A 3M8EA 5L3FA 3OO1A 2FMHA 3WE2A 2H09A 4GXOA 4MQVA 5LLQA 2F8TA 1Z6TA 3OMXA 2RGYA 2R7DA 5DYMA 5TQ0B 1WWXA 2FKAA 5TPWB 1W5SA 1K6OA 3OQOA 3I0TA 1SMTA 4EYOA 2XIGA 3T8RA 3F21A 3FDFA 3KYIB 4N0BA 1ZGZA 2L54A 4EVRA 2P9HA 1Y1LA 2XVCA 2X7XA 3CG4A 3KCCA 5TQ2A 5EEGA 4PDKA 2JVIA 2VBYA 5HSGA 1R23A 4NQWA 4IRXA 5D5XB 4JP1A 4NB5A 3K9CA 3GFMA 1ZARA 1L5ZA 3GRCA 4R8HA 3RVLA 2K02A 3MZHA 5BMZA 4I09A 1A0OA 1E6MA 3CTAA 3I64A 4EM0B 4HNSA 5FGMA 5J8CA 3D02A 4G86A 2RNJA 4BXUA 1ZAYA 3V4GA 4EJUA 1HSTA 3DGEC 3WE3A 3HTSB 3Q7SA 3K9TA 2CW0F 3RPQA 2NT3A 1BBYA 2DO7A 5K5RA 4RY8A 1URPA 3EULA 2DI3A 1NATA 5F64A 1E2BA 5CNIA 3ZMDA 3KP7A 3QLVC 3RI4A 4LE0A 5DCLA 5BQ3A 1I3CA 1TTYA 3KHTA 3F6VA 2EV0A 4L9JA 2W25A 2O61A 5KQPA 3K1MA 3P9KA 1VRVA 2F5DA 4BHBA 1HW5A 3GV0A 2OZ6A 3E5QA 2M5WA 5ED4A 2VXZA 1FNNA 5B3JA 4I2OA 4MQFB 2WJAA 3SY8A 5EEHA 2WMYA 3L9FA 5HLIA 1SD6A 2GAUA 3GLXA 2KYRA 3DF8A 2EJRA 4ETSA 2W42A 3JPWA 4A6DA 3GEZA 2JTVA 1RXEA 2AYXA 1IF1A 2HQRA 4MLCA 2GBPA 3UKJA 3A0UA 4F06A 3O2QB 4M6XA 4MS3A 1JHHA 5PNTA 4WXHA 5DUKA 1T0FA 1K66A 4MS3B 4G0QA 4U7BA 1BA2A 2L17A 1F5TA 5A2QK 3SHFA 8ABPA 1K78B 3BWGA 5HS7A 4L9TA 1ZH2A 2Q2EA 3SG0A 5IULC 1BJAA 2PLYA 3H1EA 3ILYA 2B4AA 2QUFA 1IXSB 3IPCA 1G3SA 4H60A 2PUAA 2IA1A 5JHUA 3DLHA 2STWA 3W9SA 3K1PA 3EQ2A 3FXUA 1SFUA 3IDOA 4UNOA 2F2EA 2ZXJA 2FQWA 1U04A 1USTA 4CO8A 4HDUA 4RGUA 3REOA 2O03A 1LJ9A 2XKOA 4LD5A 2RJNA 3D0SA 1YS7A 2H6BA 5FBHA 2STTA 1J0RA 4LB5A 1LVAA 2K7LA 4IJAA 1EAYA 3TOBA 2QVCA 3BPVA 3EQLF 3E97A 2A9QA 3LUJA 4Z4HA 5LHGA 2N9UA 3IKTA 3CHYA 3H6HA 3SXYA 3T8TA 1PEYA 2GIVA 1AB5A 2PMUA 2OZUA 1BC8C 5TPZD 4LE1A 3R0JA 3M7GA 2EWNA 1CF7B 1T98A 3LWFA 2WRZA 5HKOA 4ETNA 4YV7A 1ODDA 3K0LA 2XAJA 1JHZA 1BIBA 4MQ9F 2HEOA 2E4YA 4U88A 5IT3A 3EUHA 5CLSA 6ABPA 5IT9K 2YR2A 1SRRA 4S04A 2GKGA 1QKKA 3I58A 4YLEA 3WTYC 2CHFA 3M8FA 4ML3A 4YIFA 3ABTA 3V7RA 4NV3A 3HS3A 3CO6C 3RVNA 5BRAA 3F6PA 4LLLA 1D1QA 1R7JA 1QZZA 4YG2F 1BIAA 2A5YB 1ZGAA 4UXNA 3GYBA 3NHZA 3QLUC 1YG2A 4DQ2A 3LTEA 2UWMA 2WTEA 2FNPA 3RH0A 4I0AA 3ROFA 2DLLA 2LKPA 5EWLA 4CYDA 4G6DA 4LLNA 2O0YA 4NICA 3HCWA 1YK0A 4OBBA 1ZRCA 2F5EA 2FF4A 1ZESA 4LK0F 1TLFA 4HNRA 2VUIB 5JNVA 2IPNA 1MAVA 1NXOA 1P8AA 1R5HA 1EH7A 1SXGA 1KU3A 4RY9A 2P7CB 4JA2A 1BC7C 1OXBB 1B59A 1IZ1A 1YVUA 5L3CA 3TO7A 1GHCA 4H0EA 3LQQA 5HLGA 1ZH5A 4JOQA 1PUEE 4D6XA 3WODF 3KTOA 1IXCA 2VOOA 3GF2A 1W25A 3SFZA 3DBIA 4EM1A 4NCAA 4JQFA 4M88A 1J7KA 6CHYA 2QVGA 3CZ5A 4MR7A 4P5OA 2O20A 1W5TA 4A5NA 1DPRA 1I27A 2XRNA 3I5UA 2OENG 4YWHA 1E17A 1I5ZA 4HAMA 4L9VA 3M9WA 3HJFA 3QEMB 3HRTA 3LUHA 2DQRA 2M98A 2PFBA 3M9AA 1YFHA 3Q9SA 4EVSA 5D5UB 3CUQB 1JDPA 5TPZA 1E6LA 3ERED 2RN7A 3R60A 4G0OA 3FGZA 4MLDA 5IX8A 2FQ3A 3VOEA 4B09A 2IRFG 3P9YA 1ZAOA 3COAC 1J56A 2HS5A 4N0QA 1BDIA 3KYJB 3LUKA 2VT3A 2LUOA 4CGZA 3J81K 2JCGA 3H5IA 1EH8A 3HIFA 1HW2A 3LQRA 5A2QZ 4ZYLA 2NRAC 3VFZA 4U0YA 4EMSA 5FO5A 4WWHA 4RXTA 2M1ZA 2P4UA 1UB9A 3O21A 2QM3A 3LUCA 3IRRA 1AB6A 5ABPA 3V8KA 5D6EA 1Z26A 4MR8A 1TVMA 1L3LA 5I4CA 2J48A 2HPHA
chains in the Genus database with same CATH superfamily
4IEIA 2ET6A 4W82A 3PS9A 5F27A 1AV6A 3CQ9A 5A4KA 3PHIA 3OM8A 2AWNA 2YYYA 1X7ZA 4QBTA 1O96B 2CSUA 5I47A 2FF5A 4C03A 1KJ9A 5EY5B 1AGYA 1Q0QA 3KBOA 3JD2A 2R7OA 1C1XA 4GLOA 5DWVA 3P9XA 3K1ZA 1FW6A 1IMOA 3IUJA 4Y2PA 4HYEA 1GPUA 4YAUA 1QGOA 1CQJB 3P94A 3I59B 4LGCA 1TW3A 3VDMA 2IY9A 1I5RA 1OWOA 3GRFA 2X0JA 4K9LA 3RR2A 1SKAA 4NAVA 4N9HA 4KQCA 3C8ZA 3FFWA 2AWOA 1V6SA 3L6EA 2V1XA 4OP3A 1D2HA 4PWZA 2XC7A 4TTRA 5A3VA 4U7FA 4NE7A 2DR2A 4LOIA 4H6WA 2QY9A 1E4YA 2HHAA 2NX2A 4GX1A 3ZQUA 4AJ1A 1GDDA 2PMZA 1TK2A 3KR2A 4D57A 2KRFA 4FD3A 5MDHA 2G1UA 2ZB9A 3UHOA 2ZTSA 2P2GA 3FOAA 5JZSA 2MABA 1G8FA 3CZQA 3FLBA 1AZLA 5DYIA 3NRJA 4Y9SA 2KZVA 2EFGA 2CSOA 2BI7A 1VPEA 1XD9A 1RZUA 2PRIA 3K2EA 2VRWA 3RVPA 1K5DA 4QYWA 5EJ8A 4P82A 1DRKA 1JS1X 4G01B 1FYDA 4DDMA 2P75A 2X7JA 4EFDA 1NSYA 1AMOA 4JBIA 2Q29A 4EJSA 3PE3A 1XU9A 2H5LA 3VZSA 3S8PA 1YR8A 2WFMA 4DNFA 3HJGA 1MNAA 1MHPA 4GYYA 3IO3A 4D79A 1WQ4A 1ZIPA 2VNIA 2IU0A 1G5QA 1OXKB 1KR2A 1W4CA 4MQ5A 3AJRA 2P6SA 2JWTA 3UHAA 1JDNA 1DEHA 5EJAA 1FNBA 3BR5A 5JYEA 2DOEA 4CIVA 1O6BA 4UFPA 3QEBZ 1NJ6A 4Q15A 3IMGA 1Y6GA 1CK4A 5KCZA 3KSMA 4Q7EA 2C7RA 1M10A 3QE2A 1UPCA 1TMYA 2EKQA 3NRCA 2C4TA 1KQNA 2XIQA 2V96A 5LIRA 1XDDA 1W7AA 2NVWA 3KAJA 4UAVA 1B3RA 1LQ1A 2QQGA 4YS6A 1IH8A 1F6WA 3GJYA 3I0MA 2C99A 4F7DA 4FC7A 1CIVA 1MRNA 3TAXA 2WG0A 2M0CA 4MUMA 3LHKA 5T5QA 2ZI5A 3CF0A 1R9TJ 2TDXA 1QB8A 3ZKAA 1M34E 4BGEA 1P4JA 3ULKA 3PPIA 2QUJA 2WVJA 5B7GA 1JXMA 1Z68A 3W6OA 3F8FA 3LSHA 4BJ3A 3ZHRA 4P4SB 1X1DA 3ZVKA 4J8PA 3G2LA 3HWX1 1J06A 4MGKR 1ZRNA 3JQ7B 1QONA 5LB4A 3DP7A 1IM5A 1UAYA 4CF6A 3EDCA 4ZYYA 3RFTA 3IL2A 4C4AA 1L8OA 4AZTA 1OR7C 3HR8A 1T4DA 2P81A 5AI8A 4WECA 1JUDA 4O4JB 4W1SA 4IZ6A 1GAJA 1A9XA 3NV9A 2DG2A 4XTCS 6PFKA 3Q2IA 4JQOA 3D8BA 1CJBA 3PIRA 3NBMA 1DARA 1ZK3A 2QKYA 3HB4X 4WN9B 1B26A 2X0NA 4M1ZA 5F2KA 4F2DA 3T0YA 1KPHA 4LHWA 2PA3A 2ZWOA 1ZZGA 1B73A 3G8YA 3KPUA 2FUKA 4N5LA 3V42A 3SIWA 1XHEA 2AOXA 3QPCA 4GYJA 3I37X 4G5GA 4UUNA 1MSEC 2C83A 5A4FS 1A7JA 1U0HC 5K7FA 2HVQA 2CHUA 2PRSA 4Y8VA 1VQOI 3GJ5A 5C51B 3WE7A 4UUSA 3RKUA 3I8OA 1IN4A 5C34B 2KQUA 1B0UA 1XVLA 1JUMA 1X86B 2DHEA 2BFCB 4G0WA 3T4PA 2AJBA 3BK1A 4NF2A 3UAGA 2ZWMA 4BNGA 3T3GA 1KK2A 3L9WA 1XD8A 2NU7B 3GEDA 1F20A 4L0YB 1FTTA 2KQRA 1W8IA 3URKA 3QA3E 2V4MA 3LAJA 3SYMA 1YW8A 2JK1A 4I0BA 4A6PA 3QW2A 3DZJA 3OZIA 3ZWCA 3MJTA 1MDBA 4X3PA 4PTLA 3UT0A 1XL1A 2G7MC 4JJFA 2J3JA 4RIIA 4GZ5A 1U7HA 3LPMA 2MSWA 1F7UA 2Q6VA 1Z6XA 2VQ3A 4POOA 5EJ7A 1L5NA 3AF3A 3WAJA 4Q48A 3LVRE 4IRMA 3NH9A 1KHHA 1KI9A 4DLVA 2XT6A 2G5PA 5BQOA 1DAIA 4IRHA 2MD5A 2PPLA 4LRTB 4BMCA 5BSKA 3AL0B 4R8RA 4IY1A 1RPAA 1V4NA 2FPSA 3D31A 1KMHA 1RKQA 2G0TA 1TKAA 2C7OA 3S2DJ 2R7XA 3SNKA 1P61B 4QUBA 1CHDA 4K6HA 2XNSA 4B45A 4AS3A 4G84A 2R8RA 5A02A 2YL2A 5BV7A 4DY4A 2LSOA 1SD7A 1WDKA 3KOOA 4Q4JB 1QM5A 1OY1A 4HEJA 3ZNOA 1TQ4A 3IH2A 1EV7A 1CZNA 1OCRH 1RCUA 4FILA 2R60A 2FH5B 1H2ZA 5LKRA 4R51A 4JVLA 1SAYA 4ZQCB 4B79A 5EMJA 4DV7B 3BVPA 1Z9CA 2O8NA 3ETGA 4JLKA 1R9MA 3CLTC 1K8QA 2EVWX 1LPQA 1BN6A 3D4OA 5KWSA 4JL5A 1RXSA 1M8PA 3LA8A 4MOWA 3D6NB 3ZN1A 3E9ZA 3WRXA 3R74A 2F62A 3NGMA 3OFKA 4UNRA 1TWHJ 3E58A 4EM6A 4A3SA 1MB0A 4GSKA 2OESA 3EQ9A 2H48A 3F3KA 1UC9A 2QMZA 2VDQB 3BA1A 1OV4A 3Q5DA 4OAOA 4NPAA 4AJKA 3VXKA 5D01A 1OAAA 5IC5A 3EBLA 3ROPA 3SSAA 4NMHA 4BNVA 1KYVA 2XRLA 1F5NA 1WG8A 3ZE6A 3GIWA 2BY0A 9GPBA 2Q5JA 4GKBA 1Z91A 2QMOA 5TRDA 1CDDA 4FFBA 2R00A 4N3BA 4O4HF 5L3QA 4XJVA 4BB6A 4BC0A 2XMBA 2ZQYA 4MUIA 2PWPA 4GR9A 1J2UA 4KR2A 3GUHA 1S2OA 2YN2A 3J7AO 2GBCA 5EAIA 3NUZA 1R6VA 3BE4A 3U7HB 2DVMA 3GK3A 1ZEMA 1N0WA 2FW6A 2ZB3A 1SD4A 1W36D 4URZR 2JFFA 4JIGA 3E81A 4YUXA 2P69A 4OU5A 5GAGJ 5BSRA 5HRCA 2VDNB 3ZGKA 4Z53A 2Q1ZB 5FHQA 1PZMA 5C1OA 4Z0HO 2FAXA 3OX4A 3I61A 4IZZA 4L0ZB 3IVMA 3ML1A 3G17A 4M1MA 1FNDA 2P9YA 4O2BB 2Q62A 4ZU1X 2HI3A 1VMEA 1JJ7A 3O93A 3DKKA 2P67A 4MVYA 4PLTA 3RZOJ 5AK3A 3W78A 3P9QA 5JY1A 4JC4A 2CXHA 3L2UA 4PQEA 1WMFA 2IA5A 1KH3A 3PPVA 5I7VA 2NU8A 5AW9A 3KZKA 2I7VA 2GJ9A 1QQBA 3A06A 1VBNA 3BSSA 1P80A 3L1JA 5EIBC 1YAJA 3F5MA 2WYWA 3C85A 4HO1X 4MB6A 3PNPA 1H94A 5LGUA 1NUAA 3B52X 1CBUA 2KLOA 2GO7A 2N0SA 2G76A 2PS1A 2VZ9A 3WLHA 4RTPA 4DG8A 4D3XA 1QRRA 1PX0A 4ZCIA 4HQFA 1RZVA 3AW9A 1E32A 2DP4E 1PG0A 4L78A 3MNFA 4IIDA 1XOIA 2ATIA 5HP4A 2YS6A 1R6UA 2RJOA 1CRZA 1GCAA 2JA6J 3PWSA 4F0JA 2WIGA 1GSIA 4KK4A 4B3MB 1BMQA 4OHRA 2FK8A 4CICA 3ZIDA 3LT2A 4F3QA 1JTYA 4BFLA 1R6XA 2CXQA 1VP3A 1R36A 3GFIA 1SG9A 3CRZA 2ZBDA 2Q4OA 2CHVA 2BEVA 1FZTA 4M1QA 4XNFA 2REBA 3TTXA 5DRYA 3C5CA 3A36A 3UM9A 2JCSA 2LP0A 3IMFA 4HVTA 1B6AA 4DSOA 3PDIA 2OAGA 3PZRA 5CXQA 4L1KA 4Z0NA 1U3VA 4LJLA 1GZHB 1E9SA 2FEPA 5JH7A 2IYOA 3PNLA 2G9ZA 5KOIA 2AGVA 3O8QB 4MVJI 3QXHA 4F46A 3BHJA 1UOEA 2NQTA 2QA5A 2ZJAA 2QCOA 2Q5HA 4PXAA 3TRFA 5AUNB 5C52B 1LS1A 3R7WB 3DCFA 4AN4A 4BFTA 3AV0B 4CDRA 3OL3A 2GYUA 3FMSA 5BWOA 4BAYA 1IIRA 2L69A 4PFPA 2QZ8A 2XB9A 4TTIA 5D1NA 2XB8A 1PUFA 1K7XB 3FJYA 5H6RA 8ATCA 1Y3IA 1Q0RA 5IN4A 5AHOA 3UT5B 5LP6B 2EV6A 4C43A 1NY6A 1QK4A 1Q1HA 3AIOA 3Q3IA 3R41A 3K2IA 3AM4A 2X77A 1GSOA 5FA6A 3U44A 3WHBA 2HFKA 1UMCA 3H04A 1XMJA 3TNLA 4BBJA 2CNWA 2Y31A 1NVXQ 3HGMA 1JAZA 2P9EA 4EJFA 1Z0DA 2NLOA 2DPGA 5CHYA 4DNOA 1O0CA 3CE6A 3MJDA 1IDYA 3C3JA 3C41J 3CC4I 1QF9A 2E49A 5C7OO 3CIOA 4KMUX 5KTTA 4QFDA 4YRSA 5ITSA 1ISPA 4XQ0A 1SD1A 3VU1A 3GGDA 3F5QA 4UM8B 3LC7O 2JAQA 1O97D 5EKDA 1F0YA 4NQRA 3EW9A 5TQVA 1JQ5A 1TRHA 1YU6A 3HUUA 2L7KA 3ZH2A 4KDFA 1EFPA 3LQKA 1KSHA 1ZFNA 4Q3BA 5FPTA 4AJ2A 2BFAA 2AFHE 2WIBA 2FBHA 2MBFA 3RANA 3OQ6A 4DPKA 1FX0B 1XRMA 3MWGA 1TAUA 4RABA 2FMYA 1BKYA 5CPBA 4G5FA 4KHZA 4YEDA 3EVAA 3IH4A 4JL8A 2KW5A 3FPEA 5JI2E 4KR0A 4UBOA 4YRMA 4GE0A 4IIHA 4MAAA 2CLHB 1CLEA 1Q1GA 2J3MA 3N8KA 1R58A 1ZW1A 3F1LA 3SBXA 5LJIA 4N7BA 3EVEA 4QATA 1P73A 3INRA 1RU3A 4HN2A 3IEVA 1TL8A 4PCLA 3R44A 2BW0A 3NHPA 3B9PA 4C2BA 4E12A 1KO8A 3AL3A 4U5XA 1ONNA 5ECGC 2BOLA 5AWFC 3W5VA 3RDIA 3WRWA 1ACIA 2A0YA 4ZYZA 4ZOLA 2XGCA 3L01A 2R7RA 4JN6B 4DR2B 1N2EA 1J2RA 3LC0A 4URYR 5BURA 2XODA 2IP1A 2OT3B 5SYAA 5EZHA 1WUYA 1YJ9I 2JLQA 2NZWA 4QGGA 1KRWA 1Z17A 4U1RA 2M6RA 1A3CA 2JLRA 1N6PA 1KZ6A 3LKDA 1E6EA 2AC4A 4XR4A 3T3HA 1K86A 3C8MA 2LBFA 3R7NA 1DKOA 2GYVA 3SZUA 2J4FA 4KZPA 3L8DA 2YXBA 1SIUA 2ZMEA 1II9A 3EWIA 1NXXA 2ZRAA 2R47A 4CCMA 2EC5A 5ALXA 2R2AA 4C7JA 2B7CA 2DPDA 3BICA 5CURA 1DJMA 2H1HA 1TMGE 3T7TA 5HDQA 3CF6R 3LQYA 4BLTA 4Q3EA 3F8BA 2R8EA 1M54A 1R74A 3B6KA 1VQ1A 5D3KA 3HKEA 5FCDA 4QKQA 4A3KJ 3RRXA 3NC1C 3D0QA 2GSDA 3IVCA 4WJZA 3HXPA 1U2DC 5HF5A 1DO2A 3PC8A 2J0QA 1UK7A 4GKVA 1T39A 2BIFA 1E3TA 2ZOSA 1FMCA 1N1EA 1HDZA 1SVNA 3I9V2 2BONA 3CD6I 1T5TA 3C39A 3LCMA 2R1VA 1B8NA 2DHDA 4L6CA 4S35A 2OGTA 3OX1A 5B4TA 5AM3A 4LA4A 1SXHA 5L3SB 1H2HA 2PSJA 5CA1A 2E5LB 1RWPA 4TWZA 3GJ0A 4B9EA 4QPJC 4JI8B 3GLQA 4ZANA 5CVTA 2KJBA 3WDSA 3UMMA 3U1DA 3OIPA 1K88A 5AI4A 4EELA 1HDGO 1KY4A 2P8TA 3B6AA 3KQSA 3EWNA 4XKJA 1K4YA 4K8OA 2H27A 3BFPA 3ER9A 3M4JA 3G0HA 4CU2A 5LHHA 3WDMA 4IIFA 3P4YA 3BZBA 3Q8WA 3HXQA 5JATA 5KNCD 4LDZA 1Q15A 2ZSIA 1V3QE 5ICMA 2FZGA 2D1TA 2FPMA 2CFXA 3ZLTA 3JS5A 2HJ9A 4FHGA 2R87A 4MVJE 1X1TA 3AXTA 2MINB 4YB8A 3MTJA 4NCIA 2JASA 3USES 2XJ9A 4HBGA 2BR4A 4GXOA 5A2QA 4GLJA 2A4KA 2O8VA 3DZFA 5TQ0B 3TZ6A 4C0SA 4AO7A 1JDBC 4Q3CA 2CLIB 4EYOA 4B81A 1Y9AA 1M34B 5G1NA 4HTFA 4EQZA 1PP4A 4OBEA 4BFWA 3FHCB 2VBYA 4NQWA 1OU4A 1J8VA 3AI7A 4TVBA 1CRLA 3SCZA 3PGMA 3EPZA 2HNAA 1X87A 2CDRA 2G08A 3BL8A 3A2LA 3U3RA 5ALWA 1JWAB 3KJQA 3GEMA 3M4YA 2W00A 3FJ1A 1D5CA 4FGSA 1U11A 2CMHA 3DBHA 1NATA 3GIDA 4JYBA 3WVNA 3KVOA 2WF5A 1D7OA 3BRWA 3OS1A 1XTUA 1Q17A 3NTUA 4M7OA 5GZ3A 2NUTA 1NUUA 1E3HA 3WLNA 3ZTYA 3GPDG 1GNSA 1JKRC 1RM4A 2EBUA 3DWFA 3O4JA 4X5OA 4MICA 2IS4A 4X1IA 3A6ZA 1BEUB 1HZZC 3L4EA 2LY2A 1VQ8I 2DA7A 2IZ1A 1KXZA 5H8WA 4YI5A 4LZAA 1RYHA 4RDIA 4J16C 4DMMA 4QFBA 3EG5A 2E89A 4BNNA 1QGAA 1Z5WA 4WXHA 2NO5A 1SUIA 4PC3A 4K6GA 3S1QJ 1T2NA 4A1FA 4XIFA 4ANJA 3FPHA 3KXDA 5DFAA 1YOVA 3EGXB 2RI1A 4EO7A 4DA6A 2ZYHA 3SF0A 1JPJA 3FW1A 5BOVA 5J4KA 2J9XB 2GEJA 4BQFA 1PO7A 3B38A 1UPBA 4NOKA 1EVYA 4IJAA 3T3IA 3TOBA 2ZULA 1VCOA 4NV0A 2QHXA 3DL7A 1S7GA 1OIXA 2OZUA 2X40A 4ID9A 2WT4A 3GX1A 2GZHA 4B3TB 2EWNA 3VKFA 4BE0A 1FP7A 2WRZA 4XCQA 4HDCA 2XAJA 2ZTLA 3SEFA 3LQ4A 4KACA 1SOWA 3W2GA 2VCEA 3OQBA 5JO0A 1N5RA 5IYZB 5FBZA 4LRWA 3WFIA 4YIHA 3RVNA 4LLLA 1QIIA 2W43A 5FUVA 5K8TA 1R8XA 4AIRA 3GLFA 3GLSA 2CFSA 2X9VA 1NI4B 1GPKA 4OA8A 4QEZA 3QSYA 1OTHA 3R3UA 1N9ZA 4GPTA 1HFJA 3OF5A 3GFFA 5AHWA 2GRAA 3W8RA 4X64B 4S2EA 2MSYA 1G16A 1NU6A 1E9CA 1DO8A 4LDNA 3PXGA 2D3WA 5HVNA 3DE7X 1J7KA 1CV2A 1LNZA 2RIRA 2VO1A 4PONA 5ALMA 1ZQ1A 1J5PA 3QE4A 1SJ9A 2EKLA 4XX1A 1OE0A 1RS0A 3KOXA 3QEMB 2BISA 2YWHA 5LZ2A 2M98A 1YC5A 2NUAB 3FCAA 4R5MA 4BLRA 3VVCA 2TYSB 1XTKA 4K6OA 2O8CA 4H1WA 2QZ4A 4HLDA 4JUIA 1HTBA 4A10A 1UMDB 2DR0A 4UASA 3U9TA 3AEUB 2GCGA 1T0IA 1SXJE 3A11A 3K8YA 2CKMA 2ZIAA 1G2OA 3VRHA 2F6CA 4WMLA 5KNDA 1T8WA 1LB1B 4L2IB 5AW8A 1KERA 4XCVA 3CX8A 3IPRA 1LE8A 4PCVA 1LDGA 1Z67A 4LSZA 2ZT8A 1XZ8A 1NRWA 5AIPA 2I29A 5BQFA 5BN1A 2NYUA 1LK7A 2PFSA 3G1UA 4CTMA 2R7KA 4II2A 1HDPA 1T2EA 1HKSA 4EGSA 5GAEJ 3CC7I 2BR3A 2H85A 3A4YA 2K2WA 4TL7A 2ZVPX 2DMNA 2M7AA 1U0EA 5JVDB 4REOA 4GMDA 4WXRA 4J2HA 2V6JA 4FNGA 1X9HA 3WLFA 1UIMA 3BROA 5I7EA 3NVDA 3ICWA 4G0UA 4FONA 4REQB 4GVPA 4OUDB 3Q7TA 1FSFA 4MUJA 3FCOA 3T41A 1O94C 1QAOA 3OZGA 1TLLA 4KU4A 4F1JA 3RTRA 2HYDA 1QOPB 4M99A 4ZYVA 4ADSG 2Q3LA 3EGCA 1PL0A 2JHAA 4G37A 2JD0A 5T6BA 4B47A 3DUFA 2GTHA 4G4JA 2C4WA 3E82A 3JW4A 2OBYA 3HABA 3I2GA 4QQ8A 4GYWA 4GBJA 4CKBB 1E2UA 4C7OB 3CESA 4AS2A 4B17A 2QD3A 4GBMA 1TU4A 1U2TA 3MOSA 4WFKA 3DEJA 4AUXA 4ITUA 1E5TA 3O2SB 2K9LA 3F6CA 4Y33A 5CIYA 3STYA 1RFGE 1ORTA 1UM9A 5JFOA 4AUNA 3NEYA 5DHAA 3EDRA 1NC1A 1MB4A 2YINC 1DT5A 1UXHA 3I9LA 2MGQA 2PBLA 1M73E 2X9DA 2ORWA 4O2AA 3HCPA 4BMNA 4MIMA 4WCFC 4ZAZA 2YDYA 5H9WA 1P31A 4G9GA 1YKSA 3I6YA 1M75A 1XB4A 4U0JA 2I2BA 2ZCWA 2AS0A 3QUQA 4QWQA 4NCHA 4NMMA 2RHJA 2NYAA 3EDQA 3AHFA 4E03A 1MBKA 4HY3A 2YTZA 1N6KA 4AI6A 2BYTA 2JG3A 2P6MA 3A2NA 2UXXA 2D5BA 2EBHX 2C8JA 1W2HA 1ETXA 4X20B 5AI6A 1Z4MA 2E2JJ 5K3FB 4EAAA 1MO2A 2ZRJA 2YWGA 2LBPA 3M1IA 5C0OE 4N12A 4HF2A 3IODA 2Q0HA 1ZN7A 2PBRA 3RRYA 2Z3YA 2Q07A 5JCJA 2E48A 2WZBA 3H0KA 3J80Z 3TZKA 2B7BA 3JASB 3THYB 2VH1A 4LC1A 1F4KA 1O8BA 3WWDA 5KYXA 3G5AA 2FPLA 3E9EA 4H2DA 4DEVA 2XVAA 1PJQA 5I48A 1QF6A 3VH4A 5HOQA 3IELA 3KETA 5ALDA 1U5TC 1DWOA 3QXJA 2QQ9A 4AKSA 1T8SA 1QGPA 2IHVA 2JT1A 1ZH4A 1Z7WA 3PK0A 1XRSB 3ANTA 1KEKA 3OYIA 2HZTA 3KHUA 4CCSA 4YNBA 4KMSA 1E98A 1Z37A 3ET4A 4H7FA 2HDDA 2CJWA 2D1VA 4KQFA 5KTOA 4RENA 2OF7A 1AD2A 2ZYTX 4QLBA 1ZIYA 1PP7U 4QOSA 1FRVA 1FLIA 1J42A 4RTQA 1ACMA 1LPOA 5CYOA 4D7NA 2DQ4A 4I50B 3CQZJ 1VYTA 3FPFA 3QKTA 4RLQA 3QVSA 3E7FA 3L1KA 1QDLB 3OOHA 1RPWA 2QT1A 3F8SA 1U9JA 1WLSA 5BSWA 3BTVA 1P92A 4YCBA 2HQBA 3VZBA 4LGMA 1TOAA 3VPGA 3OZXA 3H9QA 3AKEA 2PLAA 4IDHA 4E88A 2Y93A 1OROA 1IOLA 4MEAA 4JQZA 1L7VC 1TADA 5CEJA 2JLAA 1TYZA 4Q3NA 2SECE 1BG6A 5HE8A 4IIJA 3D7MA 4A4DA 2OBPA 1T1RA 2L2QA 1G5IA 3KR0A 4XKCA 2ZNYA 2AFHB 2PUGA 4YVFA 4LDJA 2NZYA 4FMBB 1DO0A 2WUFA 4ZVMA 4F86A 3S2ZA 5FORA 2I2XB 1TIPA 3FPBA 1Y33E 1HT0A 4JBYA 4I9GA 1VE5A 3D3QA 2KL4A 1JN0A 5LQCA 1QV6A 1WXWA 1JA1A 1GQRA 5FQOA 3HU3A 4UE3S 1E3IA 5EF6A 3GT4A 4JYMA 5K3OA 3PEYA 1ARZA 2JN6A 4KYUA 1TW2A 2RC4A 1ZN9A 2C8LA 1C4OA 5C32A 1OLUA 5B64A 5FD8A 3P0JA 1IUNA 3C2QA 1QNTA 2C2BA 2WFAA 4JX8A 2C0CA 3PR2B 3WLKX 1H89C 3BRSA 1GL6A 2HDCA 4W1PA 2BBYA 4D56A 1CETA 5LD2C 3TL3A 3ZXIA 3P9PA 5K05A 2K6GA 3BR1A 2B83A 2EX0A 4QTRA 4DNPA 4BNYA 3GQBA 1LQUA 5IEJA 4UMDA 3LUFA 4M9RA 4KAAA 4LYGA 1V3TA 4M6VA 5DI3B 3VYUB 3HJHA 1D6NA 3DUWA 3DV8A 3EOZA 1NXPA 2QRLA 2D1YA 1EM8A 4HMOA 1BN7A 2Z6VA 3HKZA 5ENDA 3QPTA 4EF4A 1XI2A 2CS3A 4F1KA 3BULA 1EEXB 1X8LA 2WK1A 5FRMA 3P20A 2FSFA 1I0LA 1GAQA 2AF3C 1KEPA 4EPWA 2O8FA 1F9EA 3BN3A 2RH8A 1OOEA 1CD5A 2KS6A 3BB4A 3IVRA 2QVLA 4NBWA 4BUCA 1KA9H 1T4GA 1E6UA 4I55A 4R41A 5FI3A 1TF5A 5J59A 4UW9A 3NAUA 4LJAA 2Q9BA 2XE4A 4ESVA 3NTRA 2H1WA 4QVIA 4RF4A 4RDCA 3OU2A 4EZIA 4KXNA 4MV5A 3U56A 4H7DA 1SCKA 1O7LA 1SHKA 3GEEA 1CDZA 2RG1A 4XVCA 4HQ0A 2JRTA 5EUCA 1E5VA 2AI3A 3TDMA 1G3UA 3JQEA 5CCDA 1YCHA 3SEQA 2GPAA 2C9OA 4HRIA 4LKRA 1ILEA 1E9DA 4IOMA 1X39A 4UM9B 5B6IA 3HVRA 1VJ1A 1E6KA 4BBZA 1LBSA 4G94A 2ESNA 2CQXA 1NR5A 1GYPA 5JYBA 2JH9A 1Z2PX 1F1ZA 1RHUA 4RK4A 1I24A 3O82A 2XZPA 2PFGA 3BH6A 1WKBA 1YU9A 3CN9A 2X4HA 4DT1B 3GUYA 1UMQA 4P7GA 1OXTA 3H4TA 4N39A 5CGZA 1MBZA 4PHCA 5ITZA 1HT1E 5T4FA 2JJ7A 5BSTA 4ER3A 5GMOA 2ERYA 5FP0A 3KFLA 3LCVB 1DEOA 5E8IA 2IA2A 5J4LA 3EIWA 3B13B 4OAPA 1C9DB 1KBQA 1NU8A 5JXGA 2GXBA 1E2NA 2XUHA 3ECCA 1KFBB 4LYEA 1CR6A 2B2CA 2BY4A 3MMPA 4ZK2A 1KJZA 5EJCA 2J9RA 1GQSA 1OCZH 2IIVA 2YY7A 4RVOA 1PJBA 4R7TA 2O7VA 2A1IA 2I2FA 4BU2A 2Q4BA 2DMQA 2G88A 3D81A 2XPWA 5JD5A 4R9UC 5JSFA 2CD9A 4CT5A 4CLRA 3RVMA 2BP7B 1ESNA 1JH8A 4NS4A 1YJBA 2E4UA 2X86A 2HEIA 1KDYA 1S2IA 4E7JA 4WBNB 4UOZA 1K9SA 1MC4A 1F38A 3MINB 5LIPA 1EVKA 2F43B 3GJ3A 2HPZA 2VK2A 1GUAA 4C4PA 1VECA 2XD9A 3FX2A 4RPJA 2BVLA 3KCNA 2EATA 2RGGA 2HTFA 2QWXA 4EH1A 3TL4X 1W9HA 2LE0A 4CM8B 1W29A 2E1OA 1F4LA 1TYCA 3WTWC 1NBAA 2ZBVA 1TL7C 3TXAA 2GZ1A 1K98A 4FZ3A 3T9BA 1KI2A 2J9FA 4RGVA 2JA1A 1JSCA 2JD2A 2VAVA 4HX4A 4JSRA 5EUQB 5DW0A 4CKYA 1Y6JA 5J4VA 2HLPA 1S4QA 2DDBA 1ULZA 4AX8A 2G0AA 3ELUA 5B4UA 2YHAA 3RYRA 4G6QA 1GG8A 5KYYB 3IUPA 2GOMA 2UYOA 3IAM1 3N8DA 1WPRA 1Y82A 1D1AA 1LSSA 4LFAB 2PMHA 3TXYA 3FTNA 2O2HA 3L7NA 1SQ6A 1JU4A 3PL5A 2XCIA 2XUOA 3SZ3A 1NXQA 3F1KA 4ZO8A 2WC2A 5H80A 4I6ZA 3F67A 3NKLA 1DHTA 3O92A 3BWDD 2D62A 1FPMA 4K6CA 1VDMA 2OHGA 2W0MA 1FSSA 1X1QA 3PNYA 4NTZA 3SP1A 1MX9A 2UZ0A 1QLWA 4P08A 3OM9A 3I42A 3FGOA 4BX8A 3GVPA 2TS1A 3PITA 5AKYA 4HDKA 1YUMA 4HATA 3RSSA 1N4DA 3T7IA 1H8HD 3ZWPA 3JARB 3QVXA 2V1NA 1E3MA 3NMUF 1ERDA 1SUFA 3S93A 4RZQA 1R6TA 5SV2A 3E9YA 5BSEA 5DGHA 4BVEA 1I1GA 4HUTA 3IDZA 2Z04A 3SS8A 3D64A 4JLBA 2SKCA 2EHJA 2P91A 1M6HA 1R27A 4HOYA 4JJZA 2DSNA 3ENZA 3ZDRA 3EZGA 4QGSA 1J9ZA 3E0JB 3K2ZA 3JVUA 3SYLA 4AVPA 2VRNA 1PFUA 5CAEB 2XKBA 3ESZA 3CF2A 1T34A 3OJ0A 1XLVA 1AE1A 3H5OA 1QYDA 3M6WA 1OXSC 1NK3P 2PZJA 2EZTA 2FPGA 4FEAA 3TSZA 5EJ9A 3PNTA 1RI7A 2C1ZA 3D2BA 4U5QA 3LLMA 4MUYA 3IVGA 4YMTA 1FUEA 1H2FA 2AYZA 2NXEA 3QVKA 1R1UA 2Q2VA 4P7JA 4WKOA 4DMLA 4HH4A 3B3AA 4JP0A 2OGSA 1GG5A 5IW8A 1D6SA 3B7GA 4BO6A 4HX5A 1SXJB 1WABA 5EE9A 3VBCA 1S8NA 3KAPA 4IOLA 3WYEA 1ISGA 2RGWA 2A1UB 3M9XA 1PT6A 4PZPA 4JH0A 5J2TF 3VJLA 1ZGCA 1VYUA 2E21A 1CG6A 3EA0A 3IXMA 3JQFA 1K63A 2ASEA 5DYWA 3B6ZA 3GZNA 4MMXB 1JFLA 5CCEA 1HNWB 1LF0A 3PX3A 4WUVA 2WY8Q 4XD7D 3T9FA 5BNZA 2ZATA 4WASA 2Q7OE 4UBLA 3TSAA 5EQTA 2FDCA 4IILA 2XAGA 5KTNA 4B8WA 4RA6B 1N3IA 4KYVA 1GYRA 4AZSA 1G2PA 2G28A 2CRGA 5LMUB 3N7TA 3UTDA 3GLKA 3MLAA 1PR9A 3GWZA 4A3MJ 3K9HA 5DK4A 5DHSA 1ORKA 3IQFA 5HKKD 4Y9RA 2YX1A 4EEFG 2PSFA 4ON0A 3DTVB 3DOFA 3QPAA 4BWGA 1J5XA 4LZJA 4LITA 3HCRA 3H5AA 2C7QA 3W8DA 2ZUCA 1GQYA 1PT9A 2IDMA 4MR8B 2X3UA 1UDAA 4ZI7A 3KKEA 5TDHA 3ZD7A 4ONEA 1G98A 4KUGA 2R66A 3Q3EA 1H42A 3G5MA 1V47A 5D7BA 4RM2A 3CUUA 1CXZA 4EW6A 2VXDA 1A77A 3ZWBA 3FNRA 1E9RA 1D0IA 2F67A 1YFZA 2Z3VA 4YRTA 4UB8C 2IV7A 1V54H 1KYWA 5FJ8J 4OGFA 3AUKA 3X44A 3DKXA 3G4SI 1NE7A 1IEQA 1Z22A 1H2XA 3R9XB 2A86A 3HC7A 4DR7B 3QWIA 1DOHA 2GD6A 4ZDLA 5HJ2A 1RXIA 1JKMA 3MKZA 2Z5FA 5AOBA 4IIGA 4CMEC 2C3UA 4NFYA 1YMVA 2JFZA 1P29A 1J8FA 4F5ZA 1MABB 5DYGA 3JQ9A 4B8YA 2OBFA 1VC2A 3V1KA 3SR4A 4RVUA 3VVLA 2XQJA 1NJ2A 3B1JA 3W2WA 3KOWA 4LYHA 1YS2X 2OD7A 1CKEA 4RZUA 3HEAA 2X6XA 2DAPA 2YHIA 1BWQA 2DPMA 2ID8A 1TO1E 4I1IA 4XXHA 1ULUA 2M9HA 5BSVA 1P7WA 1Q11A 4WOBA 3TLMA 5CQGA 3HEBA 1FJHA 4ZODA 3A3YA 4G9BA 1U3EM 2XRFA 3BD8A 2BZ0A 3MQ0A 2ZE8A 3OFSA 3QOPA 3VSLA 4MEXF 1ZK8A 3ZGVA 2ES4A 3MM4A 1XSVA 5LRSA 4A3JJ 3GTKJ 1YHNA 1IUOA 1K2VN 3O83A 3OEED 3GQVA 2JPDA 1EZ4A 3TBIA 1Z6ZA 1OBVA 3L1UA 4YRVA 2IS1A 1IG0A 4Y6SA 2DODA 1P0MA 4C7VA 1L5SA 1FYLA 4ESFA 3G6WA 3UFXB 3E9CA 1MB9A 3KOYA 3DZHA 2ZVJA 3HXKA 1OGYA 3I39X 5LBIA 1N5IA 1OT3A 4J1QA 4EYEA 3QP6A 2MDTA 3OIVA 1AF4A 1SFRA 2NXJA 1EE9A 3HWWA 1EGVB 3QI2A 2H09A 1WXQA 2HHJA 1WWXA 5TPWB 1KETA 1PR2A 4Z0PA 5IG2A 5EZYB 4II7A 3HLKA 4RPKA 5ERYA 5K01A 1GPWB 2P9HA 3H18A 2PWZA 4JI1B 4NH0A 2BHYA 3T12A 5CB4B 3AHDA 4G86A 3V4GA 2E34A 1R4MA 5HPYB 5DTJA 4CHGA 4LY6A 4QPOA 1A8PA 1HBJA 2FB9A 5ISMA 5FV4A 3AFIA 5DCLA 2C97A 5LOVB 3PFCA 1TTYA 2J6CA 2ZRNA 5DNYB 1FYXA 4EEZA 3K9FC 4A3GJ 1D8TA 1PWYE 4MZXA 2MR6A 3VSDA 4EB6B 4DMGA 2YH2A 2WM8A 2VXZA 2X5NA 1C9YA 1Q84A 2ACWA 4RLHA 1VZ2A 5EEHA 4OK5A 1SY7A 1GUUA 4A91A 4L8GA 1T9GR 3FVQA 1I94B 1HE5A 1SURA 1PGNA 3LO5A 1C0KA 5JI3E 4G0QA 4KFSA 4CKEB 2BM9A 2CCGA 1PJRA 2XE8A 3F8TA 2JLWA 4I9FA 2I9PA 2QROA 3K1AA 4RADA 2L7ZA 4C4XA 4X1KB 4FFOA 5D85A 2ALJA 4W7IA 1TECE 2F2EA 3BXZA 3PGLA 3RC3A 4E5MA 1TMOA 4CT0A 4M0EA 1J0RA 4IYJA 3E97A 1JJBA 4HZUA 1CQPA 1ZLYA 1E99A 3TMOA 4J2TA 1MG5A 3M7GA 1T3SA 3LWFA 1MGOA 4Q4DA 1QWOA 4E6PA 4X3CA 4QDOA 1GCOA 1F2TB 2VDKB 2FN3A 3DJFA 1G5PA 5IT9K 1C7ZA 2FFQA 3A3NA 5JCXA 4QDJA 2FSUA 1H6DA 1U1IA 4KWEA 1YMQA 4GR4A 3HVUA 1X7YA 4BLUA 4NHOA 2HREA 3JD1A 2ZZNA 3L0BA 2BGWA 3BTSA 1UJ8A 4EA7A 1SB9A 2XQGA 2YNMC 2GN4A 4CEJB 1SOVA 4TXLA 2LKPA 4NICA 4KWCA 1MQ9A 4QE3A 4EX6A 1DHRA 4L5BA 4BKMA 4JEIA 4MCAA 4LHSA 1L5KA 2M9MA 3UGKA 4JOQA 3R76A 4U6SA 1CPYA 2GXUA 2PJRA 3AR6A 3IBTA 1X8XA 3G71I 4P5OA 3PCXA 1Z0UA 2YWEA 5K0CA 2R5ZA 1UOOA 3T9DA 2PKRA 1EGAA 5IVIA 1EXNA 1EPUA 1VPVA 1YFHA 4KPUB 1WX1A 2V7VA 2WNHA 3ABZA 3W4IA 5BSHA 2Z83A 3LMMA 3JW8A 3ILVA 3WRYC 3P9YA 3HFJA 3ROEA 1XJWA 5CG1A 3TE7A 1BEZA 3ZWXA 3RSHA 3LQRA 3FI9A 2C84A 2HXSA 3ZHZA 2P9FA 4XN3A 5K1ZA 1TUGA 1J39A 1Z9BA 3QM1A 4KL8S 1V1RB 1RLOA 1UB9A 3LDHA 1AB6A 3OZRA 2WTMA 5IJXA 3SBDA 1I1OA 2J48A 1S3SA 1XXHE 1ESDA 3FSEA 4RD2A 1Z0KA 2JGDB 4G89A 3OJEA 4KLNA 3QPDA 3S29A 1XKTA 4QQNA 5F7JA 1NNI1 1HDRA 5AW2A 3CUTA 3AFGA 4CIYA 4KXQA 2YC4C 4HAIA 4QGBA 4UQPA 5JFRA 1ND6A 2QM8A 4NY1A 2HO4A 3IO5A 3PXDA 1EEHA 4EUHA 2CXSA 3OHMA 2ZI6A 3OZTA 1DAGA 4AUEA 1TD1A 4ABYA 5TEWA 1ZH0A 1ZRFA 4M37A 2Y9MB 1X7GA 3DLAA 1HL7A 1ABFA 4AY4A 3ZZMA 1DXOA 5JSHA 2GYYA 4EG6A 5AVXA 2NZXA 4IG4A 3SDBA 1G8MA 1ZS9A 2BZGA 4HNVA 1SEPA 2PGNA 4YX9A 2E35A 3AGPA 4LYDA 5CT9A 1YIOA 5AHRA 1KIMA 2Z57A 2NSDA 3IBFA 1RKUA 3SDGA 1EXMA 3R5HA 2K9SA 5GGYA 1Y3CE 4I1RA 3ABUA 1I2ZA 3SI7A 2WLSA 2J3LA 2AO9A 3Q3CA 4HL6A 4N41A 2WP0A 4OXNA 1FP4B 1L6RA 5ALEA 1A1VA 2WQZA 4A0YA 3D6UA 2AQIA 1DBQA 4GLFA 1D2RA 4K8RB 2YU3A 3KYDB 4HZIA 4ISCA 1AQLA 4QICA 4ZN6A 1UP7A 1R66A 1RBMA 1RLIA 2ECPA 4CM6A 4BY7J 2V74B 4KDPA 1CS0B 5EXDA 1CEXA 4U7WA 3PA6A 5BN3B 2F3RA 2XCRB 4ZO4A 1RP7A 3RHZA 3F5DA 3BMCA 4M0KA 3AB3A 3TCKA 2FE3A 1UJBA 4EYQA 4MW4A 2XCSB 1SBZA 5FLXA 3EYYA 1VLJA 2ZJOA 1UT8A 2YICA 3UAWA 1U02A 1DTWA 4MHOA 4WLFA 2ZSEA 5KVVA 1YE9A 4QGAA 5KOJB 3L0DA 1QH0A 4QSHA 3WJAA 2QT9A 3NWPA 4YELA 2IPOA 3VFDA 4X1OA 4REMA 2VK1A 4IAOA 3HP1A 4KLZA 1PGPA 5ED0A 3R3HA 4PICA 4CV1A 1PYDA 1WIWA 2A33A 4C3OB 3A14A 1P77A 1IC6A 5KQMA 1KMNA 2AE2A 3ZMZA 5I7SA 4MDYA 2G8LA 3KVRA 3NATA 1HLGA 1JIQA 3RKRA 5CDSA 2K4JA 3G88A 3K4JA 1T8RA 5JXJA 4IX9A 1V55H 2BVMA 5EKXA 4BB5A 4A93J 4YJ3A 1EAMA 5CDTA 1S6LA 4EBFA 1G8PA 5J2UA 4RYLA 2GJ4A 1L3CA 2ECFA 3VKVA 3Q0WA 1YRQA 2DMRA 1V8DA 1JPVA 1ICIA 2PKCA 5I9BA 3H4MA 4F9FA 5L4LA 1IN7A 3BE5A 3V2UA 5F9MA 1KAQA 4WWCA 4MW6A 3FWYA 1JAIA 2AVDA 2O3RA 3CGGA 4YECA 5AKIA 3DB1A 3FCXA 2B3DA 2Y05A 3OYEA 4UU7A 1C3OB 1D7AA 3EA5A 2N1MA 4FXOA 4LYFA 5KNCA 1ESMA 5DLEA 2VTKA 1M5UA 4L4ZA 4G1CA 1Z8HA 3W2FA 3UAZA 4DJ5X 5DULA 1WSBA 1Q7TA 3DMNA 4YLYA 1NUQA 5KYUA 3IC7A 2Z8XA 1ZNWA 4TV8A 1Y9DA 5DPMA 2XUBA 5CYVA 2WU4A 1JWBB 1Z05A 4MUKA 4S1VA 4BECA 1TCVA 2ID6A 3OKFA 4URUR 4V2UA 4YP5A 3RUCA 2Z56A 3MQFA 4RPLA 2ZSJA 1TLTA 1Q1QA 2QV7A 1AMNA 1M67A 5J6XA 4ETIA 5DKFA 3HUGB 3HCCA 1P1BA 2I4LA 4U9UA 1I14A 2F55A 1L5YA 1ZHFA 4BIIA 2XPUA 1SBIA 1A2QA 1HXHA 1E64A 4X6XA 4XIGS 2LZ0A 1Z0AA 4OJQA 2VSXA 3MERA 2QA4I 4A5MA 1V7PC 3U3DA 2REQA 2HGCA 1ZUNB 1T5OA 4I2VA 3NTOA 1I6LA 1NPTO 3BWYA 4ZZDA 1Z13A 1UBFA 4ZZ2A 4BOYA 1QCZA 2YVQA 2CYYA 5CB6A 5LYJF 2K7FA 1GZVA 2IBDA 1DI0A 2AF4C 2ZUSA 5CRIA 1U8EA 2SCUA 5KC9A 3GFPA 3GWGA 2EFHB 3IYLW 1PR6A 4XVHA 3VYWA 1WP9A 4RS4A 5LPNA 3PFFA 5ERIA 2FPKA 3O8RA 3OC0A 2WKSA 2NZUG 1Q19A 1X3WB 4ZJYA 3OVMA 3T5BA 1HSJA 3AQ4A 4U2FA 5EXEA 1T3TA 4HFNA 4AUKA 5JWRA 4Z2YA 2O7QA 3F73A 2LC2A 3HBAA 2V5UA 2H3HA 5IDXA 1OZHA 5M5WJ 2ZAMA 3RSZA 5ADWA 1KAOA 1YBHA 2FRHA 1WW3A 4XX0B 4P9NA 4Q24A 3OTHA 4X93A 4OHOA 4E46A 1J20A 1WQ1R 1I7QB 1XDUA 1AA7A 4IXMA 3F5FA 4UV8A 2V6FA 5FNVA 1HDXA 2RGCA 3PSFA 4BJ5C 1E2KA 4Q00A 1UDRA 2PUCA 4XLEA 4ARBA 4I1UA 4E0BA 2BTQA 4K81B 1AA9A 5L3ZA 4Q4HB 2XF2A 3EVNA 3FUXA 2AFIE 3L77A 4JC0A 1AZWA 3HCOA 4YP0A 1CE8B 3S70A 2B4YA 3VDQA 2WHPB 1OF1A 5C4MA 1DS6A 5KTKA 1IEWA 2HRRA 3GRVA 1JH9A 3AEKA 4RM3A 1XA4A 1E9FA 3L6BA 1OU0A 1U28A 3QF4B 4MLPA 1TGVA 3DZ8A 4PGMA 3AUAA 2G9UA 4MVJM 3K8ZA 1C4WA 4HNHA 3KQLA 4I7HA 3OA2A 2CB9A 3H5TA 1XPJA 4YMLA 3HZJA 1E0EA 2GTPA 2PXAA 3ZU4A 1BMFD 3IAS2 2QTGA 1T3GA 2Z8ZA 3C7JA 2GWRA 1GTZA 3CW9A 3G2PA 4C3UA 1P3Y1 5K1YA 2P2ZA 1PAUA 3EETA 3PXUA 2ZE6A 3HHGA 5TJ9A 4FD2A 1VZ0A 5LZ8A 2V9KA 5ALLA 5AJHA 2NVYJ 2R93J 4NBNA 3GD7A 3FFAA 5I7AA 5I3ZA 1E58A 1M1NB 3PKJA 4J1TA 1ZP6A 5SZKB 1KMIY 1M1EB 1DMSA 4WGGA 2ZQ5A 3I28A 2ZUBA 4KODA 3AM5A 1XJQA 3A4LA 5DRTA 4CM9A 2QN1A 1FMVA 2FV8A 4LVOA 1S7CA 3U49A 5ALKA 4BTLA 2ZR0A 3QUAA 1Z7BA 1UC4B 1CEQA 1JIJA 4A9AA 4GDFA 1W0TA 5DMHA 2W6OA 3RT9A 3ZIAD 3PL8A 2XBMA 2NT4A 2A0FA 2IWRA 2QQEA 1OCCH 1QPIA 3AI2A 2E7XA 2HMSA 5D5PA 2UUAB 3GRRA 4OXKA 2QG6A 4IUDS 4DLKA 2BE7A 4KMFA 1M33A 4OJTA 1QYWA 1UBTS 4WK2B 1M76A 5JXWA 2I1VB 2R25B 3JD4A 1U9IA 1US8B 2PUVA 2AW3A 3QPHA 2NN3C 4IHKA 1BCSA 4GWGA 3OSZA 3ZY4A 5KSWB 4PYIA 5K0BA 4D4JA 1H05A 1JMVA 3MBIA 3CVOA 4PLPA 4L18B 4MB0A 1G6NA 4IDNA 3GCMA 5L95A 3QMPA 1XFAA 4ENWA 2BKAA 3DT9A 4ZTUB 4U7PB 3CV3A 2VNSA 4OQYA 5BV1A 3SZPA 3OBBA 3TFWA 1J2JA 1JHMA 3O8BA 4TLEA 5KNLA 2O4CA 4EVQA 5B2FA 3LKVA 1KNQA 2QJOA 4K9MA 1B72A 2IXFA 4R68A 2AEFA 4CIAA 1VKOA 3V4SA 4B44A 4BBRJ 3TIIA 1R1VA 5CM8B 1Z6PA 2BFBA 1LI4A 4NBSA 5JCZA 1D1TA 4FP9A 4QL3A 3GCWA 3KP4A 3MZ0A 2MHCA 3ZHOA 1IN6A 4ZO9A 1ATZA 1HURA 3JVDA 2DN0A 1KZ1A 2R44A 4M9ZA 3DC7A 4TUYA 4E2XA 2JEYA 4UE2A 1MOZA 3ENNA 1L7EA 1GN9A 3MEQA 4Q7LA 2AVNA 1R4ZA 3TB4A 1MAWA 1GLGA 2OCDA 2UZ3A 3AG5A 5LU9A 4FGUA 4QA9A 4F3YA 2ZYRA 1EIWA 4Q9NA 1Z5UA 4OIMA 5FXMA 2IKQA 4IWXA 4A0RA 4LRQA 3O94A 3P4XA 1DDIA 1B0PA 1Q3KA 3FXMA 4WW0A 4KXFB 1Y37A 1JEQA 2OBBA 1DUVG 4HAOA 5K0LA 3M1EA 3VPRA 3H99A 5DK6A 3K6JA 2V7UA 3UJ3X 5L3BA 5EPUA 4NV1A 1NMZA 4NYMQ 2HT1A 5JAPA 1IOZA 4WSOA 3HI4A 2JGFA 1CIPA 3AEQA 1K08A 1FSHA 1K61A 2R5YB 2VK4A 2WFLA 4EUEA 3DXFA 1NMSA 1XCLA 2Y1EA 4OQQA 5CIQA 2DT6A 1WSDA 3EFEA 5ARBA 2VP3A 4KAJA 4ZT2A 4YT8A 3TGWA 1I13A 4Q7QA 1FXWF 1M0EA 1V9CA 1JAXA 4B46A 2OPHA 3V4FA 3WXBA 3ZK7A 2C5HA 5ESWA 3HNOA 3OH8A 3B89A 4BGUA 2QP9X 4BCBA 3TJZA 3CPJB 3GRKA 4CN9A 5KHLB 4MFDA 3GO4A 3FMPB 4CW7A 1J5YA 4HLQB 5F73A 1HGXA 2TCTA 2N3ZA 5HNFA 1QO9A 2LR0A 5CJ2A 4PO3X 2P6NA 2VCYA 4Y17A 2OHOA 2PX8A 3K9GA 2Q8QA 3HBNA 1L3IA 4EATA 1CDEA 2ANBA 3HKDA 4DDWA 4HQNA 4RTOA 1CYEA 2CKDA 3C3CA 3NNSA 1RNLA 3LX5A 2M1BA 2GK4A 2HOQA 5HKAA 4TRRA 2QRGA 3RYIA 1WJFA 1S3FA 1YZHA 1C14A 1T6YA 1SU6A 1SWWA 1JR3D 2PX3A 2IXAA 3KP3A 2OO3A 3HNRA 3SKXA 3TIFA 2FWAA 4CMIB 1MEOA 4RF5A 3E53A 4I4TF 1FVOA 3ANSA 3EK2A 4Y7CA 4LSGA 5EWLB 4HAUA 3DBLA 1E20A 4LFUA 4C0QC 2PWYA 4IP0A 4HV4A 3WBFA 2A1TS 4HPQA 2H1FA 3F9IA 2F4OB 5CT5A 1PYOA 1X80A 1L4YA 4JJ8A 5L3DA 1E0JA 2AQKA 2Q0SA 4JK1X 2F7SA 4LX0A 2Q3BA 2VC2B 4CV0A 3EBPA 3TPZA 1LQTA 5AKEA 2IIBA 1WJAA 1Z18A 3CKMA 3O91A 4JLJA 4O4IB 2DQZA 5F2NA 3IQHX 1DKPA 4UEJA 4YPFA 4B6PA 2V9CA 1LLFA 3VAAA 3MTDA 4LJ4A 3PSIA 4BLVA 1QANA 3JQAD 3W2TA 4FYWA 1C0WA 2HWYA 5TGTA 2PU7A 2FRDA 3GP8A 1M2EA 3D43A 1TZKA 4JDPA 3TOAA 4W9NC 4YJKA 4JYKA 2JRLA 5KQGA 2H5IA 4CFYA 2OHVA 1VG1A 2DTXA 3RC8A 3I4MJ 3ZU2A 3CJQB 4O63O 4YRKA 4Z4EA 2ZT7A 2QTRA 3DOJA 3EAFA 3UYLA 4X61A 3E1SA 4B2IA 3H7IA 5I5EA 2I78A 1OPXA 2RHRA 2NWQA 4ZVQA 1U8XX 3MS2A 5EERA 3ZGXA 2VPWA 5B4VA 2QUZA 2J3EA 3THXA 4A2UA 4X84A 4BNZA 3AUJB 4YAOA 3QPLA 3PQJA 3X1DA 5EZ6B 3IJPA 4DYVA 2IOHA 4OHWA 4BFYA 2Q3HA 3TSCA 1TK3A 3GJZA 2VFAA 3C87A 4YR9A 1FYMA 2Y69H 2BRUA 4ZQHA 3HJNA 3OCJA 5K0TA 3QU7A 2B99A 4UVIA 3SC2B 3WLTA 2AKEA 3GBPA 3H2YA 3L8HA 4XM2A 4LDRA 5H6QA 5BV0A 2OLJA 3RK0A 4I6EA 4Y1GA 1ZXLA 5FPKA 2RQQA 3B7PA 2I87A 4HP8A 1DCKA 4DILA 2CVOA 2CXTA 1VHLA 4EFKA 2Y1KA 3I73A 3OKAA 4BKOA 4XWKA 1H69A 1FTQA 4A8HA 1B8IA 1FF9A 4NC6A 1EB8A 3EXHA 1CFJA 1RJ9B 2O2SA 3NWBA 1MJ9A 3BQYA 5AO9A 3BR0A 1YZ3A 4G1VA 4DIDA 3EH2A 4KQ1A 3KR9A 4D92A 5J9FA 3WLPA 2IQ5A 1U2SA 1X94A 3V2HA 5CR9A 3O74A 4PF1A 3O2JA 2B5WA 4DJAA 4N7JA 3ICCA 4IWYA 2RAEA 2DQKA 4HDQB 1ZQ3P 1HDYA 1EDOA 2RHWA 1DADA 3OJCA 1IUFA 3U7QB 3S2EA 2G63A 4KJXA 3TR5A 4LGYA 4O4LA 2PZLA 1D3YA 3SOPA 3OWHA 4ZAWA 1YGYA 2MSLA 5HJEA 3QU6A 4QREA 2JIBA 1YI1A 4YBZA 3I4LA 2XB4A 4QUAA 5JXHA 2V59A 5ULLA 5B55A 4GHWA 5K8JB 5H3LA 4QECA 4FHFA 2ODAA 4X94A 2ZJZA 5PGMA 3ZVLA 3FWEA 3X1ZA 5EJFA 1CQWA 5K3AA 3PHCA 3RYFB 4RK7A 5CDUA 4PLFA 1A2KC 4CR6A 2CXNA 2B25A 2PUHA 3CRQA 4J4TA 4KE7A 4BYYA 2QX8A 4EAQA 3AZOA 3FYSA 1GA4A 4UUOA 1DAMA 1VG0B 5LLQA 5DYMA 4P58A 4ZC1A 4AL4A 1WTCA 3OCXA 3PFHA 3F21A 1IU9A 2OTCA 3ISTA 3M1YA 2XE7A 3DEAA 5EEGA 4Y2RA 1R23A 5C1DA 4IRXA 1CIJA 4FSXA 4IR7A 4PJLA 5K8VA 4F21A 3ZE1B 3V8MA 3ADDA 5IAEA 2H5EA 1KY2A 4LJ5A 5FH9A 1FB5A 4DV2B 1QIHA 3DGEC 1R2QA 2P2CA 3CNEA 1OX4A 3Q3JB 3K9TA 4GGOA 4PHHA 4ZQBA 1R0SA 1HUQA 3AJ9A 4HGNA 5EIOA 3B3JA 1V8ZA 3CCMI 4FBLA 4WJKB 4AX4A 1SHTX 3QGMA 4BJ6C 4FHCA 3P9KA 3A0BC 1V2HE 4XLCA 4FXPA 4HQRA 5HODA 5AQEA 2JGKA 3IUEA 1H4TA 2UVDA 3CCYA 1D3AA 4INOA 3SY8A 2WMDA 3RC9A 5HLIA 2D7CA 1REQB 3HYCA 5A5VA 2AV6A 2O9LA 3RSQA 4QPQA 3STTA 3ROMA 4MLCA 4BO3A 2KHZA 1N78A 2JS7A 1Z7GA 5GV7A 5CLHA 3T7JA 4EPTA 3L2RA 3SLGA 4L9AA 3AWDA 4O59O 3H1EA 3JQ6A 3AW8A 4PVDA 1N9GB <