4HYEA

Crystal structure of a response regulator spr1814 from streptococcus pneumoniae reveals unique interdomain contacts among narl family proteins
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
200
structure length
200
Chain Sequence
HMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the response regulator spr1814 from Streptococcus pneumoniae reveals unique interdomain contacts among NarL family proteins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription activator
molecule keywords Response regulator
total genus 83
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hyeA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hyeA01
5LGUA 1D1PA 1T2KA 1FY7A 3NNDA 3P9IA 4IRXA 4LDZA 1G4DA 3KEOA 5IBQA 2ZXJA 3VEPA 5F6FA 5J8CA 3Q7RA 2OENG 1VTNC 3TQNA 3EQZA 3LFTA 3LKBA 1XDSA 3E97A 4FE4A 5J6XA 2MYUA 2EFOA 1XCVA 3LMKA 4G7OF 4HNSA 1BJAA 5J8FA 2MBFA 2CWEA 2QSJA 4UHKA 4EGYA 5BRJA 3HK2A 4KICA 1FFSA 2FF4A 1OXKB 2MSKA 3GF2A 2P8TA 4RS3A 1EH7A 4M9XA 4EGZA 1XGSA 7ABPA 2QENA 4RK5A 3FF5A 4EYQA 3FMRA 2OBPA 2F5EA 2OD5A 1TJYA 1TQIA 1G3TA 3ZMZA 4PCQA 1FSPA 3NQOA 2EWNA 4HX7A 1B6AA 4F11A 2ZNYA 2XV4S 4QLCU 3KS9A 2A5YB 1MIHA 3Q41A 4AVPA 1LDDA 2H0AA 1LJUA 4TLMB 2WC2A 4KYWA 3G1WA 2XAGA 2DPUA 4IJAA 1I6XA 3HIFA 4EM0B 4Z0NA 2ADUA 3LQQA 1JBEA 2GQQA 1EH6A 1RZRA 1HQCA 5D6EA 2GZWA 2KRFA 2P4UA 3MQ0A 4RB1A 5DYMA 1JDNA 1BI3A 3R60A 1JHZA 2FMKA 4Z2YA 1GXPA 1SD5A 4TN5A 2YX4A 2VK2A 4Q6WA 2CYYA 1APBA 4Z4FA 3F22A 1U6GA 4AIHA 4TLLB 1ZRCA 1D1QA 3O2JA 2DPDA 4QPJC 2VBZA 2FMLA 1DUXC 3LTEA 2QZ8A 1ULYA 2HQNA 1E6LA 5FD6A 3F8CA 1BIAA 1SAXA 3H5VA 4HQMA 3HOTA 4ZYEA 4A6EA 1UHMA 5KQGA 2V0NA 3IP6A 1K78A 5IULC 3GV0A 3QEMA 1DBPA 2RQPA 3CJNA 2YHBA 3HSYA 1B1BA 3T8YA 4IXAA 2M1BA 2LKPA 4MS3A 1S7AA 5JS2A 1BA2A 3LUHA 4FHTA 3L49A 2FXIA 4S05A 1J9IA 4YG2F 3FFXA 2PUFA 1DJMA 3ROTA 1CYEA 2IOYA 2YR2A 3T95A 1B9MA 2M5WA 5E1XA 5ILVA 1FFGA 2LP4Y 4WXEA 2G7UA 1T0FA 1ZDMA 5FWXA 3F3XA 4R8HA 1QQIA 4MPTA 3RVQA 4MR9B 3C3KA 1AWCA 1W25A 2LSOA 3HSRA 2IT0A 2IPNA 2WTEA 3DF8A 3A10A 1YK1A 3GYHX 2H6BA 1SFUA 3GT7A 5KI6A 4DQ2A 1B59A 1S29A 3E6MA 1JX6A 1IRFA 3VNAA 1BIBA 1ZLKA 2UXXA 3C6QA 3ISPA 3KLNA 3DPTA 2FXAA 5DCMB 2J5PA 4RAYA 5CVIA 1WKMA 3R4KA 1PEAA 1XWWA 3LAPA 5L3GA 2LUOA 2PLNA 4KQ9A 5PNTA 3WU0A 5EWJA 3WGGA 1E2BA 3FWEA 2H6CA 4ETSA 3IP7A 3GW2A 4ZMRA 2DTRA 1R1UA 1OR7A 4WK8F 3BRSA 3A3KA 1QBJA 3Q7SA 4KIGA 3IPCA 2XASA 2RGYA 1QO0A 4PYRA 1KRXA 2RKHA 2VUHB 3EULA 3I45A 3LKVA 2GA2A 2DK8A 5JNWA 1XGNA 2WJAA 1L5ZA 1H0MA 1NXXA 1GHCA 1YG2A 4RU1A 4JASB 4G97A 2ZJ2A 3O1HB 4P1ZA 3GYBA 3I58A 4EUKA 5C5CA 1GUDA 5D5VB 1QQAA 4RGSA 3QLVC 4RY9A 1C4WA 3N0WA 2MYNA 4HQEA 3OV8A 5TPZD 3K4HA 5E18F 5E8IA 2QQBA 3M8EA 5D8LB 4D6XA 5BPDA 4ON0A 2IA0A 1F5TA 3EJWA 3GFIA 3QX8A 2WRZA 4GCVA 4OMZA 4UVCA 5E17F 1DDNA 5BQTA 1XHFA 1CF7A 4KUMA 1S3JA 4KV7A 4HAMA 3SG0A 2CWDA 2MYTA 3I42A 3QU6A 4EJTA 2K4JA 3QK7A 3G73A 4M88A 1L3LA 1MJAA 1W7PA 1YW9A 2JVKA 3H3UA 2BYVE 4G0PA 4LDAA 2GXBA 3GA5A 3EDCA 2OQGA 3O74A 4MR8B 5IEBA 2HWVA 2X7XA 4S04A 1H9CA 4MEXF 5TQJA 1LNWA 1NXPA 2W84A 3KP2A 3M1EA 3R6SA 1XGOA 2NZVG 4Z99A 4GO1A 5DEQA 3ROUA 3H3ZA 3E6CC 2MSLA 3JTEA 1QP0A 4UNOA 2LF8A 2ZWMA 3CU5A 4Z4IA 3I4PA 4WWCA 5F1RA 4A0YA 2XAJA 3R0JA 2C6YA 3EQLF 5DUIA 1FYMA 1CF7B 1K78B 4B09A 3K0LA 5LBQA 2VN2A 4LRQA 2V1XA 4UHJA 4FX4A 2E4ZA 3RH0A 2STTA 4H60A 2QQAA 4IVNA 1VLZA 4NCBA 5CJ9A 3O6BB 3QP6A 5K1YA 2BEOA 3RPUA 2PMHA 1ZGJA 2BGGA 4BHBA 1REPC 1KQ8A 1Z2EA 3JY6A 4EM1A 3KETA 2HQBA 2EV0A 1CEYA 3SZPA 2IRFG 4KIFA 1TLFA 4KA4A 1YS6A 3LWFA 3R0AA 3FMSA 3OM0A 1IZ1A 2KYRA 2XKOA 3RPQA 4HZFA 4LE0A 2WMYA 2F5CA 2EFPA 2QXYA 4G7ZF 3H5LA 4IGAA 5EWLB 4H3HB 4B8XA 3N75A 4HNQA 4F8JA 3GWZA 3GLXA 4ZPJA 3F8FA 4L4UA 3KTOA 1BM9A 5BMZA 5H6RA 4XSZF 2A9RA 3L00A 1QKKA 4KIBA 5CNIA 1SRRA 3HHHA 4HOBA 3ZN1A 4JK1X 2H94A 2RJOA 3P9CA 2GIVA 3JPYA 5TQ2A 4EYOA 1U8TA 3U9GA 3TO6A 2WWYA 4CDGA 2XROA 1RUOA 5KWSA 4PEVA 1BI1A 5AONA 4OLAA 3LUJA 1U3EM 3IP9A 3UKJA 4CZZA 2E7XA 3L09A 3JSOA 3K2ZA 1X3UA 2MLKA 3OO1A 4RS8A 4PZ0A 1LDKB 1FC3A 5D6FA 2Q2EA 1NHAA 5TJJA 1AB6A 1WI9A 3RKXA 2H27A 4BH9A 5JHUA 3GZ6A 4MS1A 1Z13A 1J56A 4CBVA 1U5TC 3T8RA 5LEJA 2PL1A 3V4GA 3KP7A 4KNYA 1H9TA 1FQWA 2FMIA 4RY0A 4WXMA 1W7PD 1W9HA 1J2XA 3OQMA 3NRVA 4M73A 3TDUC 3BP8A 3OLZA 4MNUA 4EVRA 4ENJA 1FZPB 2K7LA 4YCSA 4PGHA 1VKRA 3RJPA 2NT3A 5TQ2B 3DLHA 1DZ3A 4XLNF 4HV6A 5LGTA 1LBHA 1KYZA 2W42A 2IDMA 3ZMDA 4HNRA 1BI0A 2VODA 5DCLA 4ESJA 1YMVA 6CHYA 4EVQA 1FP1D 1I27A 3CG4A 2K27A 3KKEA 4Y15A 1YVUA 3FGZA 1YTUA 2HFHA 4GYGA 1ZITA 2W24A 1DRJA 5JNVA 4OIRF 5ED4A 5KVRA 2ID9A 4R1HA 3BPVA 2BV6A 1FSHA 1XGMA 2LBPA 1AB5A 3F6OA 4WXDA 3HV2A 2Y48A 1RI7A 2AXLA 1U2WA 3E6BA 3Q9SA 4LLLA 2P7VB 1TNSA 2PQ8A 3KZYA 1DPRA 3KHTA 2ZCWA 1IIBA 1NXSA 1ZG1A 3L7WA 1YIOA 2GX6A 2QVOA 2PAFA 3EUHA 3BILA 2EFNA 2Y75A 4EJWA 3CS3A 1ABEA 3SZTA 3NHZA 1NXTA 4M6YA 1OXBB 4XXHA 4ZZLA 1IXSB 3REOA 1JDPA 1URPA 4H3KB 4XSXF 1ZARA 2HQRA 2VE9A 4HDVA 4DN6A 4AIJA 3EYIA 2A6HF 1JHFA 4A5MA 4WF2A 4UV9A 5I4CA 2VT2A 3JAMZ 2HYGD 3CTAA 4YR7A 4ZZDA 4MS1B 3I59B 1FWZA 4F7ZA 5K5OA 4OIOF 3M9AA 3RYPA 2XHKA 1MJ9A 4UVBA 5D5UB 3QRFF 1EV7A 3UUGA 4OBBA 3TX6A 4WXCA 4CICA 1YQAA 1MB3A 4G0ZA 2FNPA 3RYRA 4BYYA 3C3MA 1WSUA 1YO5C 3P9YA 1ZESA 3GX4X 5HDKA 3KCCA 5FLXZ 1HXDA 4U0WA 4IHTA 1XN7A 3V8KA 1M2FA 1M5TA 3KYJB 2IVMA 2PBIA 4ENNA 1SXGA 3V7RA 3NNSA 4HF2A 2QQ9A 4E7OA 4RB3C 5F64A 5ICGA 4RGXA 2HZTA 3JVIA 1ZYRF 1O3SA 4N47A 2IA1A 1MAVA 3OM1A 1ODDA 4M6XA 2D1VA 5BQ3A 2JVIA 1MGTA 2MSWA 3TB6A 3I5AA 3HO1A 1FOKA 3DQVC 2HR3A 4RK1A 3CO7C 3EQ2A 4HBLA 4EJOA 3J80Z 2KIMA 1E17A 3T5XA 1NTRA 4NCAA 4M71A 4RGRA 1GVJA 3EYYA 3I5UA 2VE8A 2ISYA 4ASNA 1M2EA 2P6SA 4RGUA 1RZRD 1SFEA 4U7BA 1ZGGA 4N0BA 2PUCA 3QX9A 2MC3A 4LB6B 4M72A 2A9OA 5ICEA 3I54A 1PUEE 1P6UA 2VBYA 3GXOA 5D5WB 1G3YA 2LPMA 5E3JA 5EWLA 2FN8A 3H6HA 4A0ZA 3TKYA 5HOOA 2K86A 5LHGA 3IWZA 4P5OA 1LB2A 2IPAB 3F6CA 3LUAA 1HKQA 3O1IC 4PE5B 3Q7TA 4ESFA 4KFCA 3WGHA 3N8IA 2KIFA 1ZLJA 2O20A 2YPRA 4BAYA 2IKSA 1S7OA 1KU7A 5T7BA 5JNSA 2L54A 3HVRA 2OZUA 2NNNA 3MQ4A 3CZCA 2JTVA 3GFJA 4MS4B 3FM5A 1KU9A 4XRFA 1EWTA 1J59A 3HTUA 5BRAA 2ZO4A 1ZG3A 2EV6A 2KIUA 3IKTA 1UCRA 3MWMA 1ZHFA 2JBAB 1T39A 4G0QA 3BJAA 3LSTA 4EMSA 1F4VA 2QWWA 2XAHA 5KQPA 2GXGA 3S2WA 2YHAA 1B9NA 1SMTA 1LDJA 1OYIA 2VUIB 1I3CA 3LUKA 1TQPA 4YRZA 1CGPA 1O3RA 3H5WA 1FYLA 2I6FA 4YIIA 2RV8A 2VBXA 3LOPA 3C7JA 1TLHB 4RK4A 4G94A 2R7FA 4MR9A 1NATA 1FSEA 1RNLA 1WQ2A 3FMVA 3OOPA 2VYCA 5BPIA 3H5IA 1WETA 2Z9OA 3F6PA 1DCFA 3IP5A 4YS6A 2GI4A 3RVRA 3RIRA 1ON1A 2ESHA 3KG2A 1D8KA 3GVAA 1Z26A 3RQIA 4RDCA 4RAZA 5A2QK 5KQMA 2A07F 5KQLA 1XCBA 4AIKA 4L5JA 2JRLA 1F4KA 2CQKA 5BR1A 1LJ9A 1LVAA 2OA4A 3D02A 2PJUA 3LAJA 1IN8A 2TDXA 3SNKA 3HRTA 1K68A 3HJFA 1FT9A 4OIQF 3M6MD 4O3MA 1XSDA 3GWGA 4QYMA 1Z05A 5E1ZB 1IN4A 2FBHA 2E7WA 2ELHA 2K4BA 2YSRA 1Z2DA 3K9CA 4Q7EA 1W5SA 5TPWA 3BZ6A 2FOKA 2MA3A 3N6VA 3B02A 2JRTA 1AOYA 3MA0A 1O7FA 4U0YA 5L3EA 4JAVC 1NXOA 3QLUA 5LEKA 1KYWA 4MRMB 3IWFA 2P4WA 5LHHA 1QZYA 2EJRA 3ZMVA 1SD4A 3RKWA 3T8TA 4KVFA 1Z18A 2A9PA 2NT4A 4CHUA 4W5RA 2M87A 3KEQA 3OMXA 4G0MA 3HDGA 4QYWA 2COMA 4IRHA 1NXVA 4HF1A 2QLZA 2DFIA 2JPBA 4IPAA 5C5EA 4RZSA 5BOXA 3QPHA 1JL3A 2L19A 3IDOA 4KMRA 3IPAA 2W25A 1USGA 1V4RA 2L02A 2FSPA 3CFYA 1NXWA 2W85A 2HQOA 2QM3A 3CLKA 2E4VA 4YFXF 5HDGA 5EEGA 3KP5A 4L0ZB 3M9WA 1E6KA 2FLWA 5TPZA 2HGCA 3RDIA 1J0RA 1BC7C 4HA8A 1DG9A 5FB2A 4IHSA 2WJWA 3O2SB 2GKGA 1MKMA 2EFWA 3KP3A 3LUFA 2F2EA 5CVRA 5HDNA 4I02A 1U2PA 5DUKA 2M1ZA 1ZHHA 3SY8A 2JSCA 3RVOA 4W5TA 3ML6A 2PUDA 1GCGA 5CNKA 2DLLA 4HX4A 3CLOA 3DBIA 2QUFA 3L2CA 2R25B 3GEZA 1HKSA 5H20A 1LQ1A 2OAZA 2A61A 4A2UA 2HPHA 2N9UA 4ZMSA 3EODA 1T38A 4MGEA 2QBYB 4EM2A 3MMNA 4W5NA 4MQ9F 3JAMK 3WTTC 3RI4A 4ZJPA 2HYFA 2XGXA 3V8LA 5E20A 2X0LA 4Z4HA 3N0XA 4RSMA 2QYOA 3MYYA 5DD4A 1V3FA 4LG0A 2J48A 1R1TA 1B00A 3ZMTA 4MQEB 2ZKZA 2QR3A 3F8NA 2O61A 4XAQA 4HLXA 4CYDA 3G85A 2G9WA 3E6DA 3RVPA 5TRDA 4YV7A 5LHIA 1XHEA 2A9QA 3T6KA 5D5XB 4CGZA 4PDKA 2FMYA 1LBIA 1PDNC 4HW0A 2F8TA 4LGWA 1Y0UA 1GUBA 5HS7A 3TOAA 1DC8A 2PJPA 4EJUA 1RUNA 3EETA 5ILUA 4MGRA 1H9GA 3C1DA 2MH2A 2JZYA 3HTSB 3CRNA 2D1HA 3EAFA 4H0EA 1R36A 1NY5A 4L85A 1LK0A 4UUVA 6ABPA 4BHPA 2FQXA 1WWXA 3PQJA 4Q47A 3WU1B 4L0YB 2RJNA 1ZH5A 2RNJA 4TMYA 4M9ZA 1A0OA 2HKXA 2PUAA 3CUQB 2E4XA 4BNCA 2P5VA 2OU2A 1HSTA 5AIQA 3KJXA 2CGPA 2ZBKA 5JS1A 4L9VA 4LK0F 3CUOA 1DCMA 1B4AA 1HBXG 2V1UA 4ZYDA 1MD0A 4RWEA 3O3KA 1P6RA 3KE2A 3H5OA 3W6JB 2EV5A 3RVJA 4AD9A 4ZYGA 2MH9A 3URMA 4ETMA 3DLBA 2ID7A 5TQ0A 4MQVA 3IRRA 3C3WA 1YK0A 3MZHA 2X4HA 3F73A 1HW2A 1J7KA 5IUNC 4BXUA 5LRSA 2JPCA 1J75A 5JFRA 3BROA 3N0RA 5HS8A 4IMJB 2M8EA 3I09A 1KQ0A 1P4WA 1JE8A 2DI3A 4EVIA 4LE1A 1ISSA 2ZNZA 4EYKA 4RY8A 4ML3A 2WV0A 3JTHA 1Y1LA 3QP5A 1UB9A 4HX8A 4N76A 1K66A 4KDPA 3MCZA 1XMAA 3DGFC 3H5TA 1YS7A 3WTYC 1P6QA 2JB9A 3F8BA 4JB0A 5FBKA 1K6OA 5TE9A 4HDUA 4Q5SF 1YYVA 5B3JC 1WRJA 1QGPA 1IXRC 4G8XA 3V7CA 1JH9A 4I2OA 1PHRA 1S8NA 4UXNA 2JVJA 1R22A 2XDYA 6PAXA 1YLFA 1O3TA 5DGCA 4N0PA 3SM9A 1Z25A 3QOPA 1ZVVA 4EY3A 3QU3A 3WODF 4OIPF 2AS5F 1UDRA 2B4AA 1Q1HA 4XLTA 2AYXA 1QP4A 1IN6A 3WTWC 2FVYA 2R7DA 2V1DA 5D2CA 4L5IA 3MIZA 3TOBA 3H1GA 3ABTA 2NRAC 3J7AO 1EHCA 4XFKA 2O0YA 1MZBA 1T98A 1USSA 5IUKC 1D5WA 4N0QA 1D3YA 2RGVA 3HRUA 4JQFA 3GBPA 2CFXA 2PI0A 8ABPA 3LQRA 3OQOA 3BRQA 4EV0A 5IUJC 4KK3A 2ZMEB 2PEXA 3O1JC 1EWVA 5DKFA 2A6EF 2GWRA 1XB4A 5ICFA 3LUDA 5JNUA 2R4QA 2Q0OA 1I1SA 3P7NA 3HRMA 1U04A 3I0TA 1KMIY 2FSWA 1Z1DA 2QV0A 3VODA 1RXEA 1BAPA 3H75A 3HUUA 1XMKA 3WE2A 3Q9VA 1TQMA 4I0AA 4O6JA 1TTYA 1F51E 4OMYA 3TO9A 4L9JA 1U78A 4WCGA 2FRHA 4MLCA 4ZYLA 3ZQ7A 3F7NA 1ONVA 1R23A 5FLXK 4MQEA 3GO5A 1M5UA 1KGSA 3F21A 3FDFA 2G7HA 2R3SA 4L18B 2ETHA 3BJ6A 4IMIB 1ZRFA 2FE3A 1SD7A 4K2EA 3JTGA 5EWJB 1G6NA 3N53A 1ZRDA 1IRGA 3NNNA 5L3DA 4G0XA 1D2AA 2FEPA 3HRSA 4EQQA 2V9VA 3GUDA 3HOSA 1GXQA 4LJZF 3KP4A 3BBLA 2DQRA 3OO0A 4MQFA 3VNBA 1QZZA 4YGXB 2IJLA 3HS3A 4WX9A 3W6KB 4ENMA 5DV5A 5CVVA 3IKVA 3JW4A 2P5LC 3KSMA 1R00A 3CDHA 2QW1A 2PE5A 1FP2A 1HKTA 2CHFA 1ZH2A 4YO7A 4OU0A 1GLGA 4ZH4F 4NICA 4UV8A 3D8UA 2PUBA 4KPYA 4G0OA 4U88A 2J5OA 4IILA 1P4XA 1TNTA 3N97A 1D5VA 3OLVA 3N4MA 3HM9A 2E4UA 4OTZA 2GBPA 1U5TA 3WGIA 1L0OC 2RDMA 3H1EA 3J80K 3MEXA 3HXMA 2FN9A 2IPMA 2VT3A 3OLWA 4AWXB 3IRQA 4FX0A 4OLBA 2PG4A 3OMWA 3TGNA 5DCMA 4G86A 3CG0A 3I59A 4FT8A 2MLGA 3QPTA 2O3FA 1P8AA 1IN5A 3K1MA 2R47A 4Y17A 1QQBA 1ZREA 4HV5A 5D4RA 4BHCA 5HLIA 2QVCA 1P2FA 3K1PA 2RVCA 1E2XA 5LGNA 4JA2A 3I53A 4MR7A 4WZZA 4D0PA 5HQJA 4F06A 3CUQC 1XSXA 3TDZC 2FW0A 1JYEA 3D5LA 2Z3YA 5K5QA 3L6UA 2FEKA 3JPWA 2W57A 4RV5A 3NBMA 3E5XA 4JBAA 4ETNA 4KRFA 3TMYA 1MVOA 2IPQX 3IL2A 1IXCA 3O21A 4R79A 5JNRA 1IUYA 5IT9K 4P98A 1E6MA 3EGCA 2FA5A 5E1WA 4ENKA 3FHZA 1FX7A 3J81K 5KC8A 5FWYA 1PUXA 1QPMA 2DK5A 3PQKA 4GPAA 2PN6A 2FQYA 1TM2A 2PL9A 3HUGA 3ULQB 3E5QA 1ZG5A 3RVKA 5HSGA 2LNBA 1KU2A 4P55A 2B0LA 1P4AA 2F5FA 3F23A 2HKOA 2UZKA 1P92A 4MR7B 4EJVA 5HLHA 1Z12A 2DU9A 2VC1A 2A3SA 4D74A 1BVHA 4JP1A 1KQ9A 2M98A 4XBFA 4Q48A 4YIFA 3FFTA 2IA2A 1JFVA 4YFKF 5L3FA 3CZ5A 1ZN2A 2EA4A 5H6QA 4IF4A 4LX8A 3MZYA 4GNRA 4DQDA 5JI6A 1MDMB 2QBYA 2GA1A 4Z9AA 2M30A 3B73A 5JNTA 3U1DA 4KT5C 2D2WA 4JOQA 5HKOA 3MF4A 4G0YA 1TW3A 2GAUA 4PICA 1YW7A 2L2QA 2PKXA 3OLYA 4MHGA 2FEWB 2P5KA 3GBVA 2HDCA 3FXRA 3V7SA 2O03A 3V8JA 4O5VA 3UK0A 4PGGA 2CD7A 2XIGA 2M45A 1OMIA 3Q5FA 4DNCA 5FBHA 1DPUA 1DC7A 5LLQA 2VBWA 3FM3A 2ZFWA 2AYZA 2IPLA 1BOAA 3NHMA 2DBBA 3ZN0A 5KK1A 4FE7A 2BGCA 3H1FA 4MS4A 1DBWA 1UHWA 3QLTA 5CNJA 4RKQA 1RPJA 4E7PA 2B1JA 1O3QA 3B2NA 4UVAA 2MD5A 4NB5A 1FYKA 2DO7A 1R5GA 1R1VA 4Q4ZF 2XAQA 5CLSA 3T0YA 4Z4EA 2DQLA 2YU3A 1W5TA 4RXTA 1TBXA 2YX7A 3LA3A 2KJBA 1UFMA 2L18A 3SHFA 3DPLC 3JS5A 1R7JA 1LEBA 3LA7A 4GGGA 4WUTA 4EYGA 1Z7UA 2VC0A 4GXOA 4L9NA 1EWKA 2L4AA 2Z5UA 2FTKE 2ZMEA 3FXQA 3HDVA 4A6DA 4L9TA 4G7HF 5FD5A 4A0XA 4ESBA 1U0SY 5AIPA 2NAZA 1A04A 1SD6A 3EDPA 1ZY2A 4TV7A 1C0WA 5B3JA 1YTYA 4Z4CA 2JT1A 1TVMA 4KMFA 4MS3B 5IT9Z 4U0VA 3FX3A 1OYWA 4Y9TA 3L9FA 3VFZA 1ISRA 2CO5A 3ERED 1CHNA 2V79A 1I1GA 4NQWA 1RXIA 1C0EA 1R5HA 3ZP5A 1XDUA 3NEUA 3F8MA 4Z4GA 1VPWA 3LFKA 3H92A 2PMUA 1Z9CA 4KZKA 1R8JA 1IN7A 1PP7U 3E3MA 4P9UA 5CNMA 1BI2A 3D0SA 1STZA 5KC9A 1FPQA 2L17A 4D6YA 1PNRA 3SAJA 4MRMA 3QELA 5ERIA 5EWMA 4N41A 4KMUX 3TO7A 4N9IA 3K1NA 4M74A 4I0BA 2E1CA 3FMQA 3FZVA 5E8GA 2CG4A 2RN7A 4YFNF 3QEMB 2LDUA 4RKRA 1IF1A 1QO0D 2CHEA 4EVSA 1G3WA 3ECOA 1SXHA 4NV3A 4RK6A 2NS0A 3BREA 1OPCA 2HSGA 2FQ3A 5FO5A 5FFXA 4KREA 2Z99A 3ECHA 3OLXA 4A12A 1Z15A 2V6CA 3QAHA 1FNNA 1DBQA 3MM4A 4LZLA 4UHTA 3HCWA 1FBSA 3GL9A 2IW5A 1OKRA 3IHUA 5D4SA 3O2PE 3MAJA 4DADA 3CUQA 4LLGF 3WTXC 2WB4A 2E1NA 3Q15C 4IRIA 3SXYA 5JVTA 3HEBA 4KQCA 1ZGZA 1EFAA 2KJCA 3COAC 1FBQA 2F5DA 3HHGA 4G6DA 4A5NA 1LEAA 1K79A 4MTEA 4MYRA 4RK0A 1JHHA 3CTPA 3BJOA 1I5ZA 3F72A 4YP9A 2VOOA 2NZUG 5DLEA 3WTVC 1TW2A 4QWQA 5FFZA 2UWMA 3I64A 1ON2A 2MYPA 2QU7A 1BDHA 5IX8A 2KKOA 1Z6RA 1LJLA 2PUEA 1F9NA 1G3SA 1HW5A 2JK1A 3M9XA 2Y0MA 2FNAA 4LG0B 1GCAA 2O6GE 2OZ6A 4MLDA 1W4MA 4RB0A 3ROFA 1U2QA 1KU3A 4JB2A 1K7AA 4WT7A 3GFLA 4LMYA 2NNYA 3CNBA 2A69F 3O2QB 3DV8A 1Z91A 2WWVD 1D8JA 2QVGA 3T38A 2IP2A 1BDJA 3HYIA 4W5OA 3QLVA 2BE5F 4I09A 4MR8A 2HS5A 3U2RA 4E70A 4OINF 3KCNA 1Z6TA 3WTSC 1USTA 1SFXA 3BOQA 3GFMA 5ICCA 4U7DA 1USKA 3R61A 2EFQA 3ZMUA 1Z16A 2PLYA 3K9TA 3OQNA 1VRVA 1KRWA 4KN7X 3JSPA 2FKAA 2QZJA 5TPWB 5ILSA 4LD5A 1OYYA 5DDGA 4RK7A 1J5YA 5GOTA 2L4MA 1S6LA 3BPXA 3RVNA 2EB7A 1MDMA 1JFSA 1FBUA 1FFWA 3CKMA 3E61A 3FFWA 2XRNA 3KFWX 2A68F 1D4ZA 1MB0A 2VONA 4RXUA 1HSJA 2DT5A 4Y13A 3HZHA 5IC5A 2EK5A 1JFTA 1F1ZA 1ZH4A 2JCGA 1JF8A 2OQRA 2Q8KA 4EGSA 2P7CB 3DFGA 4OATA 2WY2D 3P9KA 4F3TA 4NHJA 3ILYA 3VOEA 4MAAA 5D8KB 3DGEC 4Q6BA 3ZPLA 4HF0A 4XLPF 2TMYA 1W7PB 5K5RA 3WTUC 4F12A 5L3BA 5CVUA 1IAWA 2E4WA 4MQFB 4I98B 1DP7P 4IRGA 5DCFA 2HTJA 4I01A 2FMHA 5T3YA 3KYIB 3QEKA 2FU4A 2FQWA 1RZ4A 3C18A 2NUBA 5EWMB 4CXFA 1JLKA 4LE2A 3HSFA 1DRKA 2STWA 1DCKA 1L5YA 4N03A 3DXJF 1MJBA 3S99A 2DRIA 5EEHA 4G6QA 1TMYA 1R58A 5HLGA 1JWLA 5DTEA 1PNTA 5JR3A 1QNLA 2XAFA 2P9HA 2F8SA 3DP7A 4ZYHA 3KZZA 2XUBA 3SFZA 5HVQC 1RIOH 5FGMA 3M7GA 2D45A 2H09A 1QNTA 1U5TB 3JVDA 2RC4A 4OG2A 3ELKA 2ESNA 3LA2A 3WTZA 3ZMSA 3FXUA 4XARA 2ACJA 1JGSA 1PEYA 4RB2C 3F6VA 2VOPA 1JXSA 3O75A 1HW1A 4W5QA 4HYEA 2R48A 4LLNA 4Z9BA 1ZAYA 4LFUA 2LF7A 3SQNA 3T1BA 1O57A 1BDIA 2JBAA 5IEJA 3M8FA 3WG9A 3KP6A 3LUGA 1YW8A 3VB2A 5A2QZ 4MEYF 1T34A 3PFIA 5GQSA 3RKYA 1ZAOA 5CHYA 3KLOA 3LUCA 1SMYF 1YFHA 3C97A 4OOIA 3IC7A 5ABPA 1HEYA 2LIVA 9ABPA 1FLIA 2ISZA 2P6TA 4RXMA 4M9SA 1QMPA 4QICA 3TD9A 4I7HA 3H6GA 1PP8F 1BC8C 3GRCA 4FB4A 1Z17A 3WE3A 3DEUA 3QLUC 4G9YA 3BDDA 1DP4A 1QPZA 2HEOA 5CVJA 2FMFA 1XD7A 5BS6A 2DAOA 2K02A 4KK4A 3QELB 4O1IA 2E4YA 2CW0F 2L3DA 5L3CA 2VXZA 1ABFA 5FWYB 3DZDA 1A2OA 4PZJA 3ILHA 1YMUA 1KA8A 3RTRA 2PUGA 5DD8A 4N9HA 2XVCA 4LK1F 2L01A 3HSEA 3W9SA 2PFBA 1SXIA 2PMCA 2IYNA 3A0RB 2RDPA 3E5UA 2BBYA 3CO6C 4O1HA 3G3ZA 2HJ9A 2Z33A 4LB5A 4P9FA 2EA2A 3AAFA 2XKPA 4KN4X 3RVLA 3J81Z 4WXHA 2Q5CA 2CSOA 1BBYA 4YWHA 3BY6A 5LRRA 1IW7F 1BN5A 5HS9A 3A0UA 2FEZA 2FBIA 2HTSA 3RVMA 3MFKA 3ABUA 4BQAA 3HUTA 1XSVA 1EAYA 4HLYA 2HOEA 5FWXB 1USIA 1T6SA 2ZAYA 3DKWA 4GYIA 3CHYA 1ZGAA 2O8XA 3E3VA 4XASA 2FBKA 2UXNA 3RVSA 4P96A 4YLEA 4CO8A 4WWHA 2FLKA 2DW4A 5CYVA 1QP7A 2H3HA 4NQRA 3TO5A 1EH8A 4ETIA 3BWGA 4O5AA 1O7LA 1JYFA 3K69A 2NYXA 3GZ5A 5IT3A 5TQ0B 3I71A 1U8RA 5HM6A 4MTDA
chains in the Genus database with same CATH superfamily
5LGUA 3L82B 4FIDA 1UWCA 1FY7A 1PYVA 1Z38A 4G4SP 1RBZA 5DEIA 5KHLB 2PGJA 3QOEA 4UHFA 4IRXA 3E9EA 3L02A 4HMPA 3W8EA 5C1DA 2XE6A 1VI0A 5T8KC 3R7WB 4DPKA 3EARA 3P9XA 3DLPX 1X4OA 3VHRA 1NQOA 4CKBA 5K8UA 2YRWA 4KPGA 4NFYA 4KZPA 4BUPA 3ESCA 2GHQA 1ORTA 4RF5A 4Z1MD 2A1UA 3A4YA 4FISA 3H0DA 1C1YA 4PZYA 4TTTS 4L5EA 4AZ3A 4YB8A 1JJVA 3JQAA 4BVHA 3SC2B 5IKXA 1YKGA 2OCBA 3EZ9A 2GHTA 3EYAA 4HH4A 3QNUA 4MB6A 3WAKA 5F3WB 2PWBA 2IEKA 4KVGA 5F6FA 5J8CA 5JYCA 3T9BA 2XOEA 3LTNC 3MEQA 1VTNC 1ZSYA 3TQNA 1VKZA 3ZD9A 1EVEA 5FKLA 2OQ2A 4XKWA 1VBNA 1GPNA 3IVRA 4TT8A 4BEHB 2GFHA 4I50B 5T4HA 2WLSA 2EFOA 4RETA 5EMKA 4NV1A 4B84A 4ER3A 3P0JA 3KQNA 3DCFA 4DYRA 1Q1EA 2C0PA 2RK6A 4AYWA 5J8FA 1T5BA 3CEAA 3NBUA 4XEUA 5AIAA 5BRJA 2FX2A 1FFSA 2FF4A 1W47A 2Y67A 4LBVA 5AWFC 4CV2A 3MHPA 4MUMA 4Q37A 5F2KA 2P8TA 3C8DA 3PQFA 3BFKA 4M9XA 2IH4A 4RA6B 1EUYA 1MBFA 2QENA 1XC7A 2G67A 2K6GA 4RK5A 2WVJA 3QY0A 3ZI7A 4CLRA 1LPBB 2OBPA 3CVUA 1X86B 2ZI9A 4B3RB 1YR8A 3VNRA 3OZRA 3Q5DA 3GTGJ 2OD5A 4ER5A 1TJYA 3A03A 3S2FA 4BQNA 2BDEA 1G3TA 3NHRA 4BFCA 4CMIB 3ZMZA 1MMAA 2O0HA 1VF9A 3K53A 2G72A 3NLLA 2ZTMA 3NQOA 1PJ3A 3NG1A 4YAGA 2XV4S 1T0IA 1GNRA 2P62A 5BO5A 4PUSA 3SS9X 1T1RA 2XTAA 2DR0A 2D6FA 4DHEA 4U6QA 3OQIA 1CEQA 3AF4A 3TW4A 1OI7A 4IHYA 4AVPA 2NPFA 2P27A 2W6OA 3D5TA 1VZ3A 2WC2A 3RO7A 5DE3A 2XCRB 4KYWA 1H85A 9MHTA 3LCVB 2Y05A 1O58A 1T6BY 4JLSA 2ROQA 4IJAA 5M3MJ 1V2HE 3EXEB 4U9UA 2MR5A 1TWCJ 1JPJA 2P35A 2ZJOA 4TGLA 5CH3A 3LDHA 1EFRD 2O2YA 4WE3A 3E81A 5B1EA 3LO8A 4MCJA 1FYWA 5BNFA 5JXHA 2NVOA 4PCUA 1U2SA 3KPVA 4RMJA 1H89C 1UPXA 3OWHA 2QY9A 3OYLA 4FSXA 1JBEA 1E1MA 2GQQA 3GCXA 3FMGA 4J07A 4P4LA 2BHZA 1E92A 5COQA 1T10A 2EW2A 4D25A 3MQ0A 1NUPA 2LK2A 2IXDA 2XCSB 5C8XA 5FV4A 3D6MA 2FUCA 1Q12A 5DYMA 2GSDA 4G07A 3GUVA 3RIMA 1JDNA 1VLMA 1ZJ4A 1Z5ZA 3EB9A 4JI5B 2W2KA 2FMKA 4Z2YA 3H5NA 3HB9A 2DA2A 4XQ0A 4Y3UA 5EESA 5DM2A 5H4HA 4LOKA 2HA2A 2E5ZA 3E4DA 1K63A 2GWHA 4JI7B 3NM6B 3W5CA 3H3VK 3PT9A 3V7UA 2KLHA 1NI4A 4GI7A 4U2CA 4X3PA 3TW7A 1L7NA 4GOLD 2NO5A 4RVHA 1II0A 3R6WA 2HMVA 2G80A 4ZOAA 4CKWA 2XXAB 1GJRA 1NU8A 2FMLA 1QK4A 2W98A 4YJ3B 5LA6A 4U6SA 1YS2X 4B8ZA 5H80A 5E7JA 1DMRA 2XV1A 4PG7A 4PSVA 1E1QD 4E7JA 3MJFA 2OXRA 2I29A 1SAXA 4IW3B 4RTLA 3M33A 1E99A 2NQTA 5ADUS 3MRXA 1YKFA 4HQMA 3HOTA 2RHJA 3CSUA 3IXLA 1CB7A 2F9FA 3CBQA 3IMCA 4QQRA 4A6EA 1Y82A 2WU3A 2QRKA 3A6LA 4HVAA 1KEUA 1KJYA 1UHMA 2F43B 4FC6A 2V0NA 3BWVA 2GN4A 3TKLA 4O2BF 1Y5LA 3CF4A 5KSYA 1XT6A 1V39A 2P1RA 3EDQA 1ACIA 1R9TJ 3EZ7A 3GZNA 4KSCA 4HV4A 1W0UA 4Y2PA 4HAWA 2RQPA 4OQFA 4OHYA 3CJNA 3HSYA 1PVVA 1B1BA 3L2RA 2O3RA 4MYCA 4C4AA 4DYVA 3R7AA 4P0PB 3OH8A 2D54A 2O8BA 1LW6E 4L57A 1F2DA 3K4CA 1BHSA 1DX6A 4DMGA 3FAKA 2LKPA 1GAQA 1RC8A 1XD2A 4PIMA 1YQDA 5KTSA 2ZWIA 1OLTA 1HY3A 1LSJA 1GGMA 1AQNA 2CT8A 1JFLA 4FHTA 1I2DA 2ONYA 4YI5A 5E0OA 4BO9A 2Y1XA 1KNQA 1ZGCA 4S05A 2FXIA 3FH0A 3R3UA 4YG2F 1DOHA 1OLXB 2AJLI 4LC9A 4MB0A 4IHWA 1A7UA 1GNLA 1QS0A 1CZLA 1I1NA 1QGZA 5DNVA 3TTYA 3R9XA 3HDJA 2VPYA 4RADA 2RHRA 3B6KA 3BMOB 3OC0A 2QQEA 4RX1A 4AJ4A 3G59A 5HDBB 3UHAA 2CQXA 1F2TB 4OMDA 1Z8DA 4BMZA 1K98A 1SC9A 5IM5A 1U0JA 2F3QA 4DCJA 2IT1A 2LP4Y 4HBZA 1M3SA 4WXEA 4EG1A 2G7UA 2FDRA 4J8PA 1SO8A 2LW7A 1NVDA 2YNMC 3ZJTA 4UULA 1T0FA 1AKYA 3F3XA 5IANA 1V4NA 1X2EA 3EOAI 2C94A 2Y0EA 1PNVA 1E1NA 3HOUJ 2BTQB 1QVRA 3SEZA 1NKTA 2NXEA 4I46A 3JQFC 3ETCA 1JQ5A 4R9UC 3RKUA 3WIEA 4LOCA 4NAVA 4DCUA 2LSOA 5TDHA 1N2CE 2PS3A 2IT0A 3WA6A 3CF5F 3HU5A 1UK8A 4L02A 1GV2A 4RA6A 1EWRA 3CCMI 3IH5A 4G4GA 4IEIA 3UWSA 5C3MA 4ESVA 2H6BA 1SFUA 2D4HA 4L78A 3GT7A 4QBTA 4TLCA 1I7LA 4V1CB 3KDAA 5KOHA 1VL2A 3L8FA 3S8YA 3ANXA 1ATIA 3NDJA 2DEUA 5C44J 4YEDA 4EQ6B 5K0JA 5HUQA 3FUWA 4J6EA 5LQKA 1B59A 4ZOLB 2ZJAA 1SR8A 1HOMA 3E6MA 1TYAE 2GSWA 2YNMA 3QVJA 4R2MA 1JX6A 4RPHA 2PA0A 4ZT4A 1PW5A 3ZJUA 3PXAA 2DJIA 1IYZA 2V5UA 1FMTA 3GUYA 3H0KA 3Q7EA 4X5OA 4PLYA 3S7TA 3SIXA 5TVGA 2LCIA 4M1QA 3PXGA 1N7JA 3ELWA 3TLZA 2Y9YA 3B3QA 3T7KA 3KWMA 2ZAGA 3BIWA 3HO6A 1WKMA 1ORDA 1PEAA 4ZWNA 2R2GA 4HUJA 2V6FA 2EEPA 4G5YA 5H59A 5L3GA 5PNTA 1FU7A 3EVFA 5EWJA 3G2BA 2GK4A 1GKYA 3LSRA 2G7ZA 2FFQA 1LE8A 1VQ1A 2VDOB 2V6GA 2J6IA 3E5RA 3FDZB 4BQFA 4XN0A 3TG2A 1JDJA 5IT9A 3UFXB 3TQRA 1P9QC 4C87A 1SHJA 3AQ4A 4CT0A 5EAIA 1R1UA 1ZUNB 4UXIA 4CDNA 3BRSA 5AI4A 1QBJA 1Z3CA 1IULA 2C97A 2ODTX 3BHJA 2FDXA 3H13A 3OY7A 4N7JA 5LUBA 2XASA 3B7WA 1QO0A 2C9BA 2F48A 1Y1PA 4QUAA 1M6HA 2Q1TA 3QV1A 3VJKA 1KRXA 3VNUA 121PA 3MZ0A 2RKHA 2XTMA 4C9BA 1OWPA 2GUGA 4EEZA 2HK7A 2XNJA 5EE0A 4KITB 4L3OA 1DDGA 1JGGA 2DK8A 1V1RB 5EJFA 3O5AA 3KUDA 1GAWA 1CQIA 4HDNB 3P27A 5ESXA 4CEHB 3H3FA 4KXYA 1H0MA 3T7SA 4YMUA 3BR1A 2B3TA 5SY9A 1YG2A 1E58A 4JASB 1UM8A 4JBIA 1NSYA 4N9QA 5EIAA 4F4CA 1ISGA 3NIDB 2FZ5A 2P7IA 4DPMA 2ZVDA 1O7JA 1YZTA 3RS3A 2P77A 3AY0A 4PRLA 4EUKA 1GUDA 3R8CA 1E7RA 2JA2A 1UFVA 4N4OB 1E7QA 2ZRLA 4X54A 4X95A 3AV3A 4RGSA 3EIEA 3U1VA 3DQQA 4I1RA 2I78A 4HN2A 5BUQA 3EPJA 4I1OA 5L95A 3KYLA 4HQEA 1M5RA 1XBTA 2WZQA 3W34A 5TPZD 1KYYA 5E18F 4NYJR 5IP5A 5A4FS 3CEPB 4JYZA 3M8EA 1RAEA 1US8B 1F36A 5CAEA 5D8LB 5LSAA 4FTHA 5HM8A 1Q0RA 1Z4OA 3U44A 4UDOA 2TYSB 4ON0A 4ZO4A 2IA0A 4IO9F 3BFXA 1CR6A 2GAAA 1IZ0A 1VJGA 4N6OA 4V03A 1GVHA 2G70A 1E2PA 3BMQB 4BL0B 1KQGA 3CMEI 3OP1A 1Q77A 4GCVA 1S2GA 1VMDA 4OMZA 2IOHA 1MIJA 3RS5A 1WCWA 3UEOA 4DIUA 3F8TA 1XHFA 3ADOA 4KUMA 3AG6A 1GPJA 4KV7A 5AM4A 4EY4A 4A1OA 5A5VA 3DW1X 1SD2A 3R4VA 4QLOA 3SG0A 2MYTA 3I42A 3QU6A 4EJTA 2K4JA 3ZOZA 3G73A 1SOUA 1YRWA 1EXDA 2B30A 1R4NB 1CR2A 2A84A 4YRFA 4YMTA 1OB2A 2VJ5A 3V3KA 1M6YA 3IT0A 1VSVA 1NM5A 1W44A 4CCKA 3GTPJ 1W7PA 3I32A 2H1OA 1B1AA 1GVDA 5EIHA 2Y1FA 1DC6A 3H3UA 2BYVE 3BG7A 4EATA 1Q14A 2B8TA 3GARA 4G81A 4Y18A 5FXMA 3GA5A 4TVOA 5G1PA 1N5RA 3DQPA 3QPBA 2Z6UA 2FPKA 5LU8A 2CV2A 1WL8A 1WAMA 3FLMA 1A9YA 3A6PC 3HR7A 3LSHA 2HWVA 3D3KA 3M8KA 4OQEA 3VI4B 3V4FA 2B9EA 2UDPA 2DHDA 3TN7A 3N3AC 4BRWA 1Y1QA 2IUUA 1HT1E 5K4AA 1UOEA 3PUKA 4AYBN 2OO5C 3H2SA 1M1NB 4KXNA 5LNK6 1QSGA 1YUMA 1DFIA 1T8TA 4HN9A 3CONA 5BSMA 3GZ4A 1KQOA 4Q0MA 1XTUA 4FGUA 2Q6OA 2Q5QA 1QG0A 2OJED 3PE4A 2Y9ZA 1YMQA 3I2GA 2D1SA 2XJ9A 4G8DA 4IIFA 3ULKA 3KP2A 3R6SA 5IN4A 4C3UA 2Z04A 4HQ0A 2ODEA 1IOLA 1QHIA 1LRJA 2NV6A 3ROUA 3E6CC 3JTEA 1E1DA 1I9CA 3EUEA 1QP0A 2XPUA 3PRYA 3CU5A 3GLVA 3HJNA 2HDOA 4EGFA 1JEJA 4HRXA 1J90A 3I4PA 1XCOA 2ZCUA 4J76A 3V32A 5CG1A 2VNJA 1R8XA 4FFSA 5JDCC 2ZR7A 1M6VB 1XI2A 3KU4A 3VZQA 4DM4A 4WWCA 2TRTA 4A0YA 2C6YA 3IQFA 1G20E 2WF8A 4WAUA 3BAZA 1K78B 1CDDA 3RTEA 2PLRA 3RROA 4B6QA 4NR0A 3UHJA 2E1PA 5LBQA 2E85A 5EKSA 4CG3A 2CYCA 2DMTA 2EF0A 1GSIA 1J20A 5DTIA 4BVKA 2R7KA 4RAQA 1L1QA 2LZ0A 1BGWA 3AX6A 4QODA 3VVMA 3BH7A 3U7QB 3RH0A 3WYAA 2HPZA 3IXQA 4KQKA 4XKVA 1N6PA 3I73A 2GMWA 3LKZA 4W8HA 5LLDA 4NCBA 4C0XA 3O6BB 2NZJA 3HXQA 3QP6A 1BOBA 2BEOA 3BG9A 5JSYA 4AUMA 2BGGA 5L4LA 1Z47A 4NZOA 2ZSHB 4BHBA 4B46A 4ESOA 3UTCA 1Z2EA 2GBIA 3JRHA 2BFCA 4OHFA 2JHFA 2DYSH 4L1KA 2LGJA 4JCOA 1WVRA 4EM1A 16PKA 3KETA 1ZISA 2BMDA 2HQBA 3NYQA 4UZSA 3I1FA 3UV3A 3VHQA 3DTTA 5LYYA 2H54A 1RJWA 3ICOA 4KXFB 4B8WA 5MN5A 2BFFB 4RTOA 2IRFG 2JH8A 3EFHA 3CMAI 3ZHOA 3G2NA 3QLJA 4Y1FA 2I80A 2XMGA 1KMCA 2ERYA 2B0JA 2IELA 4NAUA 2FEMA 5FQNA 3PQ5A 4AJKA 3LSKA 2RGWA 2JGFA 1J9ZA 4BLUA 1SKQA 1NJ5A 3IT3A 4MUXA 4YJFB 5HF9A 1D6MA 3ZVLA 2I2AA 1IZ1A 2J3DA 1E61A 2VQDA 3AUXA 1IDYA 1GTVA 4GWLA 4OHXA 3LT4A 2QQFA 3GDGA 1K7CA 4LE0A 2D4AA 4QNRA 4N5IX 1M2KA 2C5AA 2EFPA 3O8QB 2H5EA 1GL9B 2QXYA 3OFSA 3F1LA 1H93A 2HCFA 3OZ7A 2I3GA 2WUDA 5F3RA 5REQA 3SOPA 4DFDA 3S29A 1MXFA 2B8EA 3K0AB 4GI3A 5IM4F 1U3CA 3EIUA 4IGAA 5EWLB 5GONB 3IDZA 1MABB 5FROA 1IVNA 2QOEA 1FPMA 3I6QA 4G01B 3UW3A 4PQGA 1BR4A 2XWQA 3JSXA 4F04A 3FBTA 1FRQA 1PFGA 1VXOA 1ZXBA 1JQ3A 2QQ0A 2HADA 4I55F 3GWZA 1BGVA 3FNGA 5FTLA 5EOVA 4L4UA 2YJ6A 3JR7A 2QJOA 2G3YA 2I6XA 4O08A 2O9LA 1HNNA 2ZROA 3DLTA 4LY0A 2HXSA 2IBMA 2C57A 2FPRA 3HC7A 1G5PA 1K7XB 3SEAA 5IH7A 5KYUB 1MJFA 4G5XA 5HNFA 1NW8A 4HOBA 1YITI 2PVCA 3GRAA 3HADA 3BR5A 2RJOA 3O84A 4MITA 5E1MA 9ANTA 1FFDA 3TIVA 3VOTA 3TECE 2Z95A 2Q6VA 4RWZA 4Q1VA 3VPFA 3O8OB 1U8TA 3S0JA 3Q6IA 3OCXA 3TO6A 2JAUA 4CDGA 2J9YB 4IJVA 4JS0A 1CUYA 4JLJA 3GLGA 1AUXA 5KWSA 2F4NA 4PEVA 2QMUA 2QRMA 1E79A 2FFHA 3E0XA 3WX0A 5K2OA 4OLAA 1I4DD 1U2ZA 2BY3A 3IA2A 1U3EM 4AY5A 3PICA 4LXUA 4PYOA 5F7ZA 3UKJA 3VH3A 2A6TA 3PCRB 1I7PA 2AMLA 4UCWA 1WPKA 4LDQA 1I0LA 1LRKA 1D2MA 2AN5A 4E6PA 4Z5XA 1I7SB 2DA5A 5LQNA 1V7CA 1J9EA 2QLNA 3THRA 3ZVMA 3EGVA 3G1MA 5BR8B 4I1SA 1A96A 1FMCA 2HFKA 1GLNA 4NBKA 2AX4A 4MVJP 4QNMA 4M49A 3EDMA 4U7TB 1RYFA 4MIOA 5E3OA 1E3DA 3C39A 2Q2EA 5GTHC 1LI7A 1XWIA 2GLUA 5TJJA 2GD2A 1TF5A 2N42A 2NTNA 3JW8A 5G40A 3ZNNA 2FPGA 4NFLA 1SANA 3IOEA 4DXDA 1DNPA 4JX4A 2X0KA 4HEHA 2QS9A 4MS1A 1DAIA 4ZREA 3UFBA 2C4WA 3V34A 2CL0X 4L0QA 2K5CA 1EJ6A 1E2DA 2D7DA 1JG4A 1JYSA 4JVSB 2HU8A 1Y3BE 3N2GA 3V6LA 3UJ6A 2XMRA 2VZ0A 1WW8A 3RGGA 3AVYA 4PHHA 1QLHA 3GLTA 2Z2KA 1RD4A 1JMKC 2ZZKA 1KJQA 3IAM2 1Y3AA 5DYWA 4RULA 4FI3F 3BD8A 3MB8A 1P75A 1WHTB 5DF1A 4A8TA 1DELA 1SC1A 2B6HA 1Q19A 4IQ8A 1MTOA 1I30A 1ULBA 3UMGA 2DVMA 4MLOA 4C2BA 1Z2PX 2HA6A 3LLUA 1LF0A 4KEAA 4M21A 4QBIA 3ASVA 2VZ8A 5F1KA 1IGNA 5CD1A 2EWVA 2X6RA 4ER0A 4F9GA 2EVWX 1MNMC 4JP2A 4LYDA 3UJ9A 4ALLA 3HNRA 3KLBA 5E6UA 3VOBA 4YRGA 4XI9A 3ABIA 1WPQA 5GZ3A 4Y30A 2QX7A 4M9QA 1VQ6I 2R6R1 3SYKA 3OLZA 4RQTA 1Q0TA 1MEOA 2DHRA 4YCSA 4GL4A 1TD9A 1JTEA 1OFUX 3DDOA 3X1DA 3OYHA 3U13A 5JYEA 2HZDA 3UN1A 3F9KA 4U0JA 2OWDA 4OBXA 5KJ1A 1RE1A 2XMCA 3DP9A 4GOND 4P81A 4Z7NB 3KSUA 4PU0A 5LVAA 4JMLA 4HV6A 4W9RA 1YGPA 3NCTA 1KYZA 1GL3A 1QHHA 2IDMA 2Z43A 1ODLA 2DN0A 3IO3A 1BFUA 3M6FA 3CY6A 3R0VA 4HNRA 3W06A 4QJ3A 5DCLA 3I4MJ 2VXCA 5DCYA 4GYWA 3HM2A 4K26A 4EG4A 5HMMA 3TPZA 4EVQA 4YRQA 5JCZA 2NAPA 2PMDA 4KYIB 3Q8LA 1E7SA 4Y15A 3HXLA 3NWSA 1OZAA 3AHJA 1WPGA 1YTUA 3NBXX 4YBRA 4GYGA 1N1EA 2A0YA 3CMMA 4J4BA 4YTEA 1WD7A 1LS1A 4U4AA 9LDTA 1Q92A 3NBQA 2BJVA 3H05A 3NWBA 3MINB 4IHAA 5KVRA 5H16A 2R6ZA 4N7MA 5JBIA 2JFHA 1TKBA 5IXJA 4D1YA 1XNGA 1ZMOA 1R71A 2XEDA 4NL4H 3VPHA 4X94A 4ZTUB 3HWX1 1LSUA 3TSZA 3ZLVA 1DV1A 1L7XA 3HVHA 3VBCA 4BRZA 5KOJA 3HKBB 4UY8I 1BU5A 1ZK8A 1C8BA 1LDNA 2AFVA 2H2IA 4JLUA 2DB3A 1EX1A 4B6GA 4NC6A 4HHEA 3EHDA 1OC2A 4UXJA 4BCCA 3GEDA 4U2BA 5M34A 2FWPA 2WSSD 4Y7DA 2MT9A 3I9JA 5IJ0A 1AQ6A 2IZ7A 2QVBA 2GN9A 3L40A 2WA2A 1P61B 3K1AB 2JJYA 4NMLA 5ADHA 4CETA 5I7WA 5K8LA 2ZCWA 1IIBA 1XAHA 2EKPA 4KQMA 4QXMA 4J3NA 2FX5A 4QDOA 2ECBA 1C0KA 2GX6A 2PZBA 2QVOA 2GOXB 3TR5A 1JW9B 1KA9H 5B2FA 5JJBA 2RB4A 1LX6A 1L1RA 4ALIA 2DJNA 2ZRGA 5E6SA 3V00A 3G71I 1UT5A 3TSYA 4N40A 1TU4A 3MLEA 1T6ZA 4MRNA 1PZMA 1ABEA 3VPSA 4J19A 5CYFA 3DFKA 4ZRMA 5ALRA 1NV8A 4NVRA 1THGA 3QUAA 4DNPA 5BMOA 4M0FA 3A70A 3I52A 1IAQA 2RGDA 2V03A 2VQHA 1EJ9A 5TMPA 2UXDB 1O6CA 4UE3S 1UINA 2DPXA 2O23A 4H3KB 5BW8A 4PF1A 3QE9Y 1ZRSA 2VE9A 1IAVA 2G5GX 3AIIA 4JCCA 3K9FC 3AY6A 3KV1A 4FDMA 1WCIA 4AAYA 1S3FA 1X2NA 3ZDBA 1OHHA 5BW4A 3FKJA 2LP0A 4UV9A 1LVKA 3JAMZ 4RY2A 5I4CA 2VTBB 2W6JD 1NG1A 1Y8CA 2GXUA 2I4IA 5ELMA 4NKRA 3R5XA 4KE9A 1DEXA 2WVGA 2LXNA 4X1YB 2WF5A 4ZZDA 2I2XB 2I34A 1KKMA 4E4RA 1V45E 2HIMA 4DNQA 3WKDA 4C76A 3M9AA 3RYPA 4I3GA 1N33B 2E35A 2CU7A 1ISMA 3HN6A 3OIPA 5AKIA 4PQEA 1ZW6A 4ZA2A 3E70C 3L9XA 5EXEA 1OCZH 1I4OA 2VWQA 5FDFA 5AVUA 4BB6A 2OCDA 3F9RA 1QHXA 4PJLA 4CICA 4WEQA 2W2OA 4V0KA 1WXGA 5CVTA 2SNIE 2HSDA 2OA0A 3EVCA 5C9ZA 1TJ3A 4DMMA 5FKNA 3TD6A 3PNPA 4E94A 1WSUA 1ELOA 4YCJA 4HFJA 4D9MA 3Q9LA 1PR3A 3GX4X 3E0JB 1XTIA 5HDKA 5EERA 2DP4E 2GPTA 4WKOA 4OBWA 2ELKA 3DVQX 4Z2AA 1RI5A 4KN9S 3NQ41 2ZJBA 4D8VA 2V26A 3V8KA 1Z0UA 2BFOA 2G5CA 3ETNA 4YWJA 1T1IA 5HA5A 4DWWA 2OV4A 2ZJQF 3O8DA 4EJ2A 4BVFA 1DFHA 4TRRA 2IXBA 1XELA 3PRKE 3KEYA 1QRAA 3NNSA 4HF2A 3CX3A 3H9BA 4X8LA 3CP2A 1LPPA 3R09A 3ZK8A 4RS4A 4UNIA 4RB3C 3AIMA 1K6EA 2DMRA 3DTVB 4RGXA 3T7TA 3U26A 4MRPA 2GCOA 1ETXA 4I8XA 4N47A 4EFKA 4HLUC 2IV3A 3WISA 3DEKA 1N2OA 3V46A 4CODB 3JRCA 1MU0A 1X7YA 2XCQA 3TD2A 2BW3A 1E1QA 2PWPA 3FKSD 3CBGA 4BDTA 2DCUA 1MGTA 2E71A 1T0PA 1T2FA 1F6DA 1UUFA 4MP3A 1W581 1VKJA 3SQMA 1ML3A 1W73A 2ID3A 2DKOA 1C3OB 4DDVA 3KOMA 3TUZC 1H22A 1V5FA 4BEBA 5FQOA 3RU3A 4L50A 1V5WA 2YH2A 4L51A 1M2NA 4RK1A 2R62A 4YFVA 5A9SB 1EHYA 3J80Z 3JRGA 2IDZA 4TZKA 1E17A 4G6TB 5G4LA 4WEOA 2XMPA 2VEOA 2AI1A 4O4JF 1NTRA 5KVCA 2C7QA 2GBLA 4IVQA 2XUDA 1B0AA 3VPXA 1KS2A 3AHFA 3KFXA 5D84A 2L9VA 5KVAA 2MC4A 1VI2A 5CK5A 3CO0S 3I5UA 1X7ZA 4OQPA 1I6LA 2ISYA 3M6AA 5J58A 3ZOKA 5C1OA 1OLSA 1WO8A 3QEOA 3UMJA 4M0DA 4WOPA 2OV3A 2F9LA 4GBJA 1SFEA 2RHWA 4N0BA 2AL7A 2CXHA 3FGNA 1PSWA 3V4ZA 5M04A 3N5KA 3BDVA 2MC3A 4LB6B 3EAGA 2XTZA 3O8QA 3RWMB 4GSKA 3Q7PA 2XYGA 5CBPA 4UQLA 3ZHCA 2XA9A 4E5PA 2WWXA 1WOYA 2VBYA 1FS5A 2Q62A 3Q3EA 1OZFA 1BCSB 1W52X 3EPZA 1ZN9A 4RF2A 2LPMA 1PSDA 3OS1A 5E3JA 5EJMA 5EWLA 1THMA 3W5BA 5I4IA 4X6UA 2WMNB 3ONDA 3BFVA 3EW7A 4KT6A 2RGNA 3GAFA 3TKYA 4L4YA 3AOEA 2K86A 1N8SA 3E53A 3H84A 4HDRA 4G2NA 4DLWA 4EO9A 4XVQA 1K5GA 3OPNA 1TTTA 2H2FA 3LW7A 1F7UA 3JWHA 2O2ZA 2OD2A 3COPA 3EXG2 1NQAO 1AXGA 3F6CA 1NG6A 2CHUA 3LUAA 1NF3A 1UQTA 5AQEA 1UBCA 3LL7A 1B8IB 3J7AC 3C6YA 1FDIA 4XLLA 1XALA 3N8IA 4KQ6A 1QC5A 1PT7A 2VDPB 1ZIYA 3ABLH 2ADOA 2ZDQA 3G8DA 2YPRA 4BAYA 3M5WA 4CNQA 2A9FA 5T7BA 1PZHA 2VAPA 3HP7A 4LHYA 4OFWA 1XP5A 3C74A 3V4LA 1RWNA 1BXZA 1KF0A 1UXGA 1E2EA 2QJRA 4WADA 1BFDA 3FB4A 1RYMA 2J5BA 5AJHA 4YRJA 3CZCA 4TVSA 4TYQA 2JLWA 1NURA 3C6BA 1IQ0A 4II2A 1P7CA 3EVGA 3SIPA 3HTUA 1RQNA 2D3TA 2KE5A 2HJHA 5IM4A 1F4PA 2NUPB 5FL3A 3IJPA 3OKAA 2ZO4A 4YROA 2KIUA 5LQUA 2YWGA 2ASVA 4YPVA 4ZDIA 1Z77A 4JX6A 3S17J 4F52A 4KW7A 1KQNA 4YUWA 3VU8A 1XP8A 2APJA 1Q44A 1YNSA 2QRVB 4FYWA 2HCJB 4I55A 5EJ9A 4G26A 1HLGA 3O92A 1R49A 3LC1O 2O05A 3RADC 2CMPA 5AK6A 2UZ0A 1TXGA 3CVVA 1L8QA 2F3UA 5LMCA 5KQPA 2EKZA 4F3KA 1CRZA 1RU3A 3BMNB 3D2LA 4H17A 3VO1A 5FTKA 1LZLA 1LDJA 2DQ4A 2RHTA 3L7CA 4XYEA 1OYIA 2GVDC 4MJXA 4DA7A 2B1QA 4XRGA 2NX2A 1BKYA 4BB5A 2O4UX 4HEA1 5DSZA 3UNGC 4JVOA 1CGPA 2OT3B 2P4SA 4ZI7A 1HK7A 4D3DA 5KHAA 1KMHA 2A4KA 5TF4A 3P5SA 2VEDA 1NQ5A 4LZWA 3WL7A 3HCNA 5LOVF 1YKSA 2VBXA 3PNTA 3LOPA 1TLHB 4NJMA 4G5FA 2Z5VA 2FWRA 3MUNA 3LOCA 2CXRA 3K4JA 1FSEA 1RNLA 1JJ6C 4NMHA 3U16A 1T6XA 3FMVA 4P3NA 2PMZN 4N49A 4V0NA 2ZJ1A 1GRRA 2NOAA 3H5IA 3JQRA 4V0RA 5CTAA 3G2LA 4KHPB 3RYIB 1BSVA 1G0OA 1K6MA 2GEJA 3TR0A 3X1KA 1IUNA 4HAOA 3M6XA 4YS6A 3RVRA 3RIRA 3LA8A 3C7AA 3U4HA 4A3KJ 3UWOA 5L6MB 2QTAA 3HOVJ 5KYVA 1E5XA 4Z1MA 4NXNB 2ZSAA 1EVLA 1J8FA 5EXTA 2D2IA 2QN1A 2QJTA 5DM6F 2C8JA 1JQAA 2HC9A 2OAGA 2JGEA 2OXEA 4RAZA 2QLLA 2FZEA 5D6NA 3ZE6A 1JKQC 4EFMA 4AIKA 2J3IA 2JKYA 4DG9A 1EGVB 1KK1A 3N0VA 1TQDA 1RIIA 3WGZA 2DX7A 3WI7A 5F98A 2LYCA 1AU7A 2R2AA 3WBKA 4IH9A 4HXEB 4FD2A 4WDRA 1W4AA 3DBOB 1UZLA 1N77A 4G1CA 1O94D 3DHYA 5C8ZA 2O5EA 1IN8A 2X8LA 4RYDA 5EMNA 1K68A 2UZ4A 1VE1A 4PN3A 2XH8A 1JI3A 3HJFA 3CW2A 1FT9A 4JBHA 4WLEA 1TO6A 2E2WA 4OIQF 3PNLA 4NDNE 1EQAA 2FQ1A 4QZVA 2VN8A 1RI2A 5A9SA 1U1GA 5E1ZB 1U3TA 4XDGA 3S1SA 1IN4A 2YSRA 3LZCA 3KLMX 1SMKA 3T3NA 2KLOA 3K05A 3L6CA 1RLOA 1S4QA 2H17A 4FC7A 2I6GA 3ELYA 2K87A 3S68A 4BVJA 4UAGA 3Q72A 1AA9A 3QXCA 3BZ6A 2MA3A 4NZMA 4MQ4A 3RRNA 1MZVA 4B0OA 4WBXC 2C9ZA 1R9NA 1V48A 2YHUA 3KC2A 3MTAA 3HCEA 5TMEA 1V16A 2RH5A 1OGIA 4IZIA 2E37A 3PENA 4M55A 1ETKA 1VFPA 3VPBA 3IGFA 3KTAB 4JWKA 1LV7A 3QLUA 5LEKA 2ZUFA 4P2BA 4MRMB 4PZDA 3NFRA 3TXXA 4R9NA 1VMKA 4LGVA 5B3AA 2MD0A 4LWOA 2WHPA 4YYEA 4CWAA 4O4LB 3D59A 2C7VA 3C1AA 4AMGA 2EJRA 1YB4A 1KVRA 3K5IA 2YUIA 1SD4A 2P9YA 4W5RA 1RLIA 2A9PA 1FIAA 3KEQA 2AOUB 3B38A 4G0MA 4U7GA 2J32A 1P0IA 5E8JA 2ZYVX 1M7BA 2ZB4A 1MXHA 4X8HA 2O7QA 1JKFA 1K88A 2HY7A 4RPKA 2XF6A 1NXVA 4UUMA 3CNOA 2GTHA 3NTQA 5DK6A 2Y99A 4G63A 4UUNA 1LLCA 3P26A 4HF1A 3QMWA 2M1XA 2VDWA 3ESDA 4H4CA 4HGPA 4OMUA 3EVEA 5IZCA 3O26A 2J33A 2DFIA 4QG7A 1W4LA 3DM5A 4RZSA 2HBZA 2OE2A 4TL6A 4LQLA 1JJ7A 3A26A 4NESA 2XE4A 3GDHA 3GJ8A 3IDOA 3IPAA 4YCAA 1H2XA 4RPJA 4J43A 5DT9A 3ONQA 1ZC3A 2YVKA 3FETA 3Q12A 1QHNA 5CDFE 4UNSA 4IVPA 1FX0B 4B7XA 4GWGA 4IICA 4YFXF 2P8JA 5FPPA 4RCYA 5AJVB 5FWAA 1FVXA 1KR5A 4B3FX 4CF4A 3D5SC 3IBCA 4MI6A 4GVXA 2VCYA 1ZKMA 5CB4B 1RXWA 4Q3NA 5IOYA 1VLLA 2CEKA 1E6KA 2FLWA 5TPZA 4ATNA 3ZD7A 1MH9A 1RRGA 4MICA 3DL4A 1IEQA 1G59A 4K86A 5CM8B 4ZQHA 3ZKAA 4DB4A 3BM5A 1DG9A 5FB2A 5J1UA 4PFOA 2I3ZA 1DP3A 2FW6A 1Z83A 2ZVQX 3KUCA 2DHCA 3MJHA 4FGLA 3DTVA 1C9DB 4YMIA 4YMHA 2V7GA 2XZDA 3JQ8B 3HUEA 5JVDF 2ZXFA 4DLZA 2EFWA 3Q0IA 3KP3A 1ZJ6A 2F2EA 4JLBA 1H05A 3BJRA 4UZFA 1RWXA 4C0KA 1PFUA 1U2PA 3ZWYA 4C7OB 5EZYF 3OHPA 1SOAA 1LQTA 1HEIA 2WJJA 1UAGA 1LUAA 2FP3A 4NENB 1T15A 1VE5A 4UBNA 4E11A 1SOMA 4CM3A 4YX9A 1XEWX 4E5DA 4F60A 4XWWA 3T9EA 2DWUA 3O8LA 2NN3C 4O25A 1SY7A 4A2WA 1NPDA 2QUFA 2BW0A 3L8GA 3WBBA 2AF3C 1YQEA 3GEZA 1HKSA 3SXUB 2H7VA 2BE9A 5KSZA 2CVFA 2A61A 1FDOA 2HPHA 1NG7A 2Q1SA 4OX9Y 1R0RE 1VQ5I 1FL9A 3QVVA 3U3KA 2JLRA 3MSCA 3WZMA 4A3GJ 3TVTA 4MQ9F 3VO9A 2PSHA 4ETWA 5A4JA 3JD3A 4JIGA 3FAZA 4BNNA 4NHOA 4ALMA 2HYFA 4YT5A 2XGXA 3VR4A 2QXTA 2X9DA 3AU9A 2X0LA 3PQ4A 1M8JA 1G8SA 4BVLA 3N0XA 2AO9A 1F2UB 2LCFA 3DONA 3JRXA 4RSMA 4DIEA 4EHHA 2G9RA 2ZSFA 4KGDA 1YOVA 2UYYA 4LG0A 3PC2A 3ZHYA 1R1TA 2H8GA 1B00A 1FDTA 3PSFA 3VC3A 3NHFA 2ZKZA 2QR3A 3G3EA 3OJEA 1FEXA 4JUFA 3BTVA 3PC4A 2VA8A 4LIPD 5DHUA 1OIWA 2A5DA 1EDDA 2JAHA 5P8WA 1BHO1 3T7JA 3VU3A 3E15A 5C35A 5IH3A 5J4KA 3KQHA 3LP5A 1I7DA 1K9VF 2Q1UA 2EKBA 4HX2A 4LKRA 4PDKA 5AKKA 3T6KA 4AXXA 1T5TA 1JHXA 1V5EA 4UVIA 3MGCA 4TTQA 4JVLA 1K08A 2JEYA 5GGXA 1WZCA 3A6GA 4QJIA 2F8TA 2CMKA 1L3CA 4YCCA 2O8DA 5HS7A 3Q9UA 5LDGA 2MABA 1DO8A 3TOAA 3MTQA 2PFSA 4IRUB 4TLBA 4GM0A 4D9NA 1T3GA 4Q9AA 3CRZA 2E55A 3L0OA 5DMXA 2MYSA 1XYVA 1H9GA 3C1DA 4MQLA 3ZGNA 3JQGB 4MP8A 2DOKA 3PC7A 5TGDA 3UAYA 3RUAA 5KTYA 1IWBB 2QN9A 2QRQA 2LY2A 4H0EA 1R36A 4L85A 2VBCA 5BVHB 4XDYA 5FWNA 3HUDA 3BAFA 4FASD 4FS8A 4CCSA 4JX8A 4F2GA 1C1HA 1G8KA 1JEYA 2UXBB 1T08B 1BN7A 3B70A 2BTQA 5T4BA 1TEXA 3V1LA 2BZ1A 4KIJA 4L0YB 4QPPA 2X9VA 4MPDA 2XXAA 1U9OA 2NUAA 1TCAA 2P0AA 4M9ZA 1L0BA 4L7VA 4ND8A 3S2EA 3KP1A 6LDHA 4KXXA 2HKXA 2R6FA 3OOYA 4ZYLA 5GADl 2C7PA 3KHKA 1XB2A 2PL3A 2B34A 1BA5A 3DB2A 4WINA 3PIRA 1X94A 3FHCB 3RU2A 3I01M 1TB4A 2QU8A 5CX1A 3NBFA 2OFWA 4P36A 4FBGA 5AIQA 3KZ1E 4P34A 1A5TA 3KJXA 4PS1A 2J87A 1YU9A 1UMKA 4QDKA 4ASUD 4F9TA 5G0UA 2WHPB 2BFBA 5DN9A 4LK0F 3BZKA 3CUOA 4RBOA 1CP2A 2QMZA 1DCMA 1WMEA 3FHJA 1BJTA 3DTYA 3FPCA 2V1UA 3DMPA 4PX5A 3W7VA 2V54A 4QUHA 4NK4A 4ID9A 4QTUB 4RFLA 1NNEA 5IXSA 2RFLA 3W6JB 2PJRB 4XM0A 2EV5A 5HF5A 1NUAA 4B4OA 4I5DA 1G6Q1 4ZYGA 1I1HA 4MKHA 4PAQA 4V0ME 4LGYA 3CMYA 1Z45A 1SQSA 2V6JA 3EXFA 4RJTA 2ID7A 2YVAA 2COEA 2D5BA 1QANA 4MQVA 2B6NA 2Z9DA 2VP0A 3H0EA 2HF9A 3KB2A 3Q0TA 4BFXA 3KVVA 5GJBA 4XGKA 4R6XA 1Z0IA 2VDMB 3TQSA 4RORA 2OAEA 3GEBA 4ABYA 3BIOA 3EYWA 1QYDA 3MTJA 1KEKA 3SJZA 1SCDA 4EJSC 2VHJA 2L69A 1J7KA 3AOEC 3P20A 3RBZA 3TI7A 5IUNC 2OOSA 4QVGA 3OPYB 3W4JA 5ITWA 3EPLA 1R0WA 4U7PB 4H3SA 5A3JA 1FDSA 1PI3A 2JPCA 1J75A 1X8KA 2AQIA 5IY5H 5JFRA 4O2AF 3VKHA 3BROA 3N0RA 1GQOA 4R1OA 3FFBA 3ZTYA 1BMQA 1ULAA 2A3NA 1J0XO 3E3NA 1T0FC 1KQ0A 3Q1LA 1K8ZB 2GJ4A 4KN5A 4LJSA 2QNBA 4PAGA 3CD6I 1Z22A 2VFAA 3JQ8A 1T3TA 3N6RA 2DI3A 4EVIA 1QGUA 2WU4A 1B6GA 3HKCA 4ZEMA 1WS6A 2IF0A 1PGJA 2ZNZA 1DIRA 5F4BA 4EYKA 4NOKA 3C6XA 4GEGA 1C4KA 4ML3A 4NULA 3O4RA 2X15A 3DEHA 4UU7A 1A95A 2I4RA 4HX8A 2NU8A 2F2TA 1XTVA 4CQMA 1K66A 1BJKA 3ILSA 3KEMA 4DY6A 4GL2A 3UHOA 1S5LC 1HDGO 1S02A 4MVJG 5EZHA 1T1JA 3RYHB 3SBEA 2HR1A 1IUPA 1YS7A 3WTYC 1P6QA 4KMMA 1X8LA 2BTOA 1TWHJ 3LPDA 3LX6A 2E2IJ 2QB5A 5IVIA 1KS9A 2QL9A 3LQ2A 4I0WB 1GTRA 2P4QA 3PPIA 4QYIB 4MCIA 3WADA 2UUAB 2WJIA 4B3MB 1W2WB 1KSHA 2JLSA 5GAHJ 1K6OA 1JQEA 5TE9A 5GIPE 1NJGA 2ZI4A 5IKPA 4FCYA 4EY7A 1M8FA 1WRJA 2WB1N 1WJEA 1X8JA 2Z5GA 3GMTA 3RG8A 1QGPA 1KP2A 4BE1A 1JH9A 1GGFA 4I2OA 1JG1A 2YWJA 4I99A 4WJLA 1YCGA 2MSYA 2AZTA 2DY1A 5TGTA 5LQSA 1R22A 2H6EA 1MC8A 3HBMA 3ZBUA 5KTPA 6PAXA 2AMFA 5JYBA 1W59A 3EG5A 3QTTA 4PPQA 4QQNA 3K30A 3MWLA 2IF2A 3E1GA 4O4LA 3CCEI 4KGZA 4E7IA 3MLBA 2WJ4A 3EGXA 4Q1FA 4MZDA 3QU3A 3WODF 2RHGB 1ZVVA 2FK7A 4KWTA 1G5IA 4JI6B 3FVVA 2X2OA 4M7WA 4R51A 5DXAA 2VXDA 2HN9A 1VYHA 2RK3A 4KTVE 1L7PA 4FB5A 1P62B 2WR8A 2YASA 4XLTA 5LQCA 1JT2A 4WZBA 3TI9A 2RI0A 5FOQA 4ZC3A 3W0LB 1QB8A 1YB1A 2FPMA 3G1OA 2VDWB 2V1DA 2D5LA 4K40A 3DEIA 1TLLA 3RTBA 3KWFA 3TAHA 9GPBA 5JZSA 5DLPA 1EVYA 4FX2A 5BXYA 1KK2A 4PIPA 2RARA 1Z08A 1ZICA 1UBGA 3I6ZA 3D7SA 5HMLA 1I13A 1VHLA 1XPUA 2HV8A 1S7EA 4XFKA 5ILOA 2V7BA 4Q93A 3GOHA 4RVFA 3ZDYB 1L9KA 3M70A 4X85A 2XB4A 1I2MA 3ABRB 1E7YA 3ASZA 4YA6A 4DR6B 4MWCA 2YU9J 4RMHA 3PNMA 1MQ8B 2W2NA 3H65A 3MCAA 3SPXA 2CD9A 3OWOA 3LT2A 4OIFA 3GLFE 3HRUA 4PR0A 4GGPA 4EPRA 1NLMA 2OGUA 2CFXA 2PI0A 3QXGA 1GRCA 4A2QA 1TZLA 2QSYA 4L8GA 4WUVA 4JHLA 3TVDA 1MMSA 3V33A 8ABPA 1QTQA 3Q0WA 1Y89A 1K7SN 4KQ1A 1V54H 1R9JA 4EV0A 4PW0A 3DZBA 1R0LA 4KIWA 4CLDA 2C00A 4R8LA 3NHYA 2PEXA 1JLSA 4NNOA 5LDDC 5H7XA 2XGCA 3VZBA 3O1JC 1MAWA 2GN0A 4ZFNA 3ZQCA 3NXSA 4LC1A 4BEVA 1SB8A 1XB4A 2QLJA 2QNIA 1VRCA 3A9UA 5A2QA 2TMDA 1EB9A 5K8CA 4Q39A 2R4QA 4CSWA 3AWDA 3HRMA 1E4YA 1RQPA 1ZOIA 1KMIY 2QVXX 3ENNA 3V1YA 721PA 3OBIA 3GEPA 1CY6A 3KZOA 1XCLA 5E3MA 2HMSA 3W2FA 3GLFA 2C3MA 3W9UA 3VODA 2OLJA 4NE9A 3ZE2B 2XOKD 1RXEA 1K92A 4H1TA 3ND5A 3N2KB 1XMKA 3OPXA 1QFXA 3Q9VA 1TQMA 1XLTA 3DDSA 4I0AA 1GV0A 4RHXA 3WGKA 4QM6A 5MGNA 1NYTA 1HZZA 2RGBA 5EUMA 2IYQA 1G6OA 1JQLB 4PYQA 2DDBA 4L9JA 3OD5A 5DTQA 3SJUA 1EVZA 3DEJA 2GASA 2WM9B 2I91A 2Q3LA 3M9LA 3Q6NA 5JVGF 1A2QA 4MLCA 3WAGA 4Q21A 3ZQ7A 5AM2A 2Y0PA 3KFVA 1R23A 3B36A 2ZU6A 1FQOA 3DOUA 3AIKA 5FLXK 4GC9A 4FDAA 2QTNA 5B53A 1FYDA 1A2KC 1M5UA 4FFLA 2EZ8A 3F21A 2G7HA 2R3SA 3EXIA 4D0RA 2AXTC 4BFWA 3ABZA 5H3HA 5CLJA 4TL7A 5L3QB 1VLHA 2H1VA 3A25A 5FR2A 2Q0SA 3C48A 1RR6A 2JIPA 2QN6A 2X9LA 4PLWA 4JZYA 1M74A 1G6NA 1ZNQO 4FSDA 4MIMA 2A33A 3DV9A 1ZD8A 1ZRDA 1I2ZA 2JFBA 5AUQA 1GZUA 2G0AA 3L77A 3ROZA 5L3DA 1WCV1 1JXMA 4G0XA 4IWNA 1NFQA 1WSDA 1ODKA 1B2LA 3KB1A 3W6PA 4YHHB 1V37A 1J0AA 4EQQA 4M60A 2WJ3A 4A26A 1IVYA 5LZ7A 1SBCA 4I8IA 4GX2A 3VVCA 4RCZA 1GXQA 2W58A 3KP4A 3BRWA 3UT6A 2JDID 3B1YA 2DQRA 1QZTA 5J4VA 3ZVKA 1M6EX 4HNHA 1R4MA 2IOFK 1YR6A 3OZBA 4EHBA 1Q1ZA 1Y1SA 1OVGA 1K5DA 1E3HA 2PO5A 4EA6A 1M73E 4YY3B 1RAIA 1H5UA 5JALA 2DHEA 5ECYA 3QE4A 2QMEA 1EIWA 3IKVA 1GDDA 3JW4A 2P5LC 2JGMA 2W2TA 3W9BA 3CDHA 2E2HJ 4GSYA 1CUFA 3NBAA 5HQ3A 2X0IA 1FP2A 3IX7A 3HR8A 3S1AB 3LUBA 2AZXA 1OB5A 4LMPA 5H5JA 2A92A 2R00A 2JVHA 3FYHA 3SBDA 4PLHA 3KPWA 1BYUA 1GLGA 1OYVA 2B99A 3GGPA 1DKQA 1G20B 2VPRA 3NWTA 1RP1A 2R8OA 1D03A 1LFAA 2JRCA 4FHFA 4F2HA 2Y9PB 5CXQA 2G06A 1LJ8A 2GPNA 4CG1A 2IGOA 2G9NA 1VQMI 1R37A 3EGXB 1EH5A 1UC9A 3V7FA 1L5SA 4QOFA 3FE2A 2W0MA 1RKTA 4ER7A 5IKOA 3N97A 3T3MB 1D5VA 3TLGA 4M53A 2IS1A 1BL0A 3KQVA 4GWKA 2IHTA 3RS7A 4DWOA 5JMTA 4NMXB 4DVJA 1I3KA 2P78A 2R7LA 4YUVA 4QULA 1ST2A 1BVYF 4YV1A 3LIPA 5KYWA 1N9GA 1U5TA 4JJ4A 2RHLA 4LXYA 2ANBA 4UQPA 1M33A 5KJFA 5GADJ 1MZPA 2RDMA 1E8NA 3EIOA 3ME5A 2FPPA 5FBWB 4G5QA 3I6MA 4Y2QA 3HXMA 1FC0A 2M34A 2IPMA 1H2FA 3DMRA 4G5GA 4X92A 2GN2A 3UMVA 4OLBA 5AVJA 4ZHQA 1XPOA 2PG4A 3OMWA 1OH6A 1ENPA 1Z3XA 1P1RA 5FD8A 3OF5A 4Q18A 4IIEA 1QJ4A 2VI6A 2MLGA 2R1VB 3AY3A 4QQ8A 2L0XA 3N70A 3U49A 3QVGB 3JYPA 3ZV3A 2R47A 3F6BX 4BYGA 1FVOA 3NIWA 1UJBA 4JFAA 1QQBA 1ERDA 1ZREA 2JWTA 3HU1A 2REQA 4TKZA 1POGA 2NS7A 3FSRA 4HV5A 3T06B 1BRMA 3OWXA 1UPCA 5HLIA 1KL7A 3P2OA 2VTKA 3HCDA 3N7TA 1OISA 3PS9A 3I55I 5DP2A 1KIAA 2K9LA 2I3AA 2J7PD 4B2IA 5FIUA 1DTEA 1ZKDA 3HKCB 4JA2A 2O8FA 4HSRA 1KHTA 2CLHB 5DGHA 4YIHA 4HTAA 2XEXA 3CX6A 4LYAA 4RO0A 3GF4A 4Q3KA 5I5GA 3CUQC 5DW0A 1NNUA 4Y33A 1KEVA 3EEFA 3OQ1A 3KKNA 3KSBC 1JLMA 4ESEA 5KX5B 1MB4A 1QPIA 3JD1A 2IOQA 1T2UA 3KB8A 5F0FA 3C14C 3L6UA 3ZJ4A 3PP8A 3A1WA 2XUKA 2QLTA 2FB9A 1QV7A 4P53A 3CJQA 5K9ZA 2WWTA 4FWBA 4O0MA 2Q2OA 5ALZA 2M6RA 3E5XA 2H92A 2B25A 5A7HA 1NBIA 3D2CA 2OFXA 2PX9A 1SUCA 4OY3A 2QM0A 4A82A 1B42A 2EGHA 2PVPA 4ITUA 2REOA 2QIPA 2VUTA 3AEQB 1MVOA 3BQ9A 3DBLA 3DVAB 3GAMA 3IL2A 3I6BA 3V6MA 4R79A 5KWIA 2O2GA 1E9SA 2WILA 4DA9A 4E4TA 3W4KA 1VSUA 1Y7HA 7REQA 3BORA 9LDBA 1CRWG 3EGCA 3KBBA 1K2WA 1GKLA 4MVXA 4AB1A 1XMIA 1LNQA 1U9YA 2EG9A 1TEZA 2J6CA 3V8NA 4DW6A 4JWTA 2I76A 1SWWA 4IQGA 3FHZA 3SJMA 3VYWA 1G60A 4C3OB 4GSLA 2LNDA 2SICE 1CCWA 1OT5A 5IAAA 3WJAA 4BC0A 4Y2SA 5F5LA 2VDJA 1WUKS 3KVYA 4TXJA 3TE6A 4JYCA 3A6DA 4W7HA 1HI9A 1XZNA 3KKMA 2KFDA 1MAHA 1QVTA 3JRNA 2H9IA 3L6DA 1PJ2A 3P2YA 5DISB 1FFYA 3HUGA 1PT9A 3E5QA 3D31A 2JJ7A 3LYUA 3RVKA 1KU2A 3DU6A 2AFIA 1P33A 3GCMA 2G9ZA 1P4AA 1GN9A 1XO1A 2Y4NA 3HRIA 4HLDA 2HKOA 4ZYTA 1JBQA 2XB9A 3NZEA 4L0CA 4YMVA 2XF7A 4FZJA 3QYAA 5EMMA 2NTVA 4N7RA 5FCDA 2WT9A 2FGKA 1SBQA 4H9GA 5HLHA 2M7AA 1KI4A 1RYZA 1SVWA 3VMMA 2JLUA 1OLXA 2X3UA 3MC1A 2ECKA 4LDPA 1FJLA 3T1NA 3T9AA 3NHWA 4GZ6A 1SPXA 4YT2A 4DRXA 2WJ6A 3DWIA 3MKZA 4URHA 2GHRA 1KQ9A 4DQUA 3CRMA 2OD7A 1CUAA 3CLRD 1PQPA 4CMCA 2ZTSA 3JRDA 3MGAA 3G7SA 4H27A 3PNKA 4HYYA 1OU4A 3FFTA 4S1VA 2IA2A 3TAUA 5EJ7A 4YFKF 3E4CA 3UXEA 5AXDA 5H6QA 4XVCA 1L5NA 5LIRA 4LX8A 3MZYA 1O95A 2VNHA 1KP9A 2AG8A 3HU3A 2AFIE 4OF4A 4OP3A 3VZSA 3SHOA 4QM7A 2G6TA 4BFYA 3GLGE 3HABA 1YE8A 3L92A 3U1DA 4KT5C 3NETA 4PK4A 2FG7C 1Z35A 3RT1A 4BBZA 4WCVA 4BMNA 1TW3A 2GAUA 1Q0HA 3R5HA 5JXIA 3S1AA 1A5AB 2IBDA 4V38A 3BSYA 4A92A 4AULA 2A59A 2L2QA 1JQBA 2PKXA 4D45A 2D0IA 4OYYA 5JXJA 4IXNA 1ZGWA 3MGGA 3CJRA 3T1QA 4PPYA 2P5KA 1X13A 2ENUA 3A8TA 3GBVA 4PVDA 3URKA 4P92A 2HDCA 3FXRA 3HCPA 1D1CA 3V7SA 1KO4A 2D1QA 3RYCA 3BGVA 3LSPA 2JFUA 3TCKA 1O9HA 2I7TA 3U9TA 1O6FA 4F4DA 3OETA 3K4BA 5EGNA 4MPTA 3F0TA 3R0QA 5CT8A 2HWKA 1O6GA 4ZVMA 4ZOLA 3WQHA 2BF4A 1OMIA 5M3FJ 1X1CA 2J0VA 1WABA 2BV3A 3AHEA 4O2LA 4JEIA 1TMKA 2PLWA 4DV2B 4OXNA 3N2KA 1V1JA 5EQDA 4R0MA 1CEXA 3IO5A 4BNGA 4DLNA 2AYZA 1KSJA 3O8CA 3GJ6A 2DBBA 3ET4A 3OM9A 4FU0A 4J1TC 1M1EB 4HFNA 2O8BB 3H0GJ 1DARA 2VT7A 1O4XA 4W4TA 2BGCA 1VMIA 3BB1A 5K1ZA