4HYEA

Crystal structure of a response regulator spr1814 from streptococcus pneumoniae reveals unique interdomain contacts among narl family proteins
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
200
structure length
200
Chain Sequence
HMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Crystal structure of the response regulator spr1814 from Streptococcus pneumoniae reveals unique interdomain contacts among NarL family proteins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription activator
total genus 83
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hyeA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hyeA01
3D5LA 3TOAA 4KMFA 2DW4A 2EV5A 3KCNA 4KVFA 2P5KA 1RXEA 1OMIA 4UHJA 3IKTA 4LE2A 4S04A 1ABEA 2QU7A 1P6QA 3ULQB 1OYWA 4RXTA 4CZZA 3DPLC 2HZTA 3I5UA 2OZ6A 1FOKA 4P5OA 3TDUC 3N53A 1PUEE 2QENA 3RJPA 4OMYA 4OIRF 3BDDA 4JA2A 1F9NA 3Q5FA 3JS5A 5HDNA 3DXJF 4PZJA 3V4GA 3WTUC 3KFWX 4G0QA 1FPQA 2W85A 3HUTA 1ISRA 2HKXA 2RJOA 5H6QA 1XSVA 1L0OC 4MAAA 4JB0A 2PFBA 3RVLA 4Q47A 3OMXA 3I5AA 5LBQA 2XAFA 2YHAA 3ILHA 5CVIA 4RXUA 2EA2A 2A3SA 2IT0A 3HRTA 5BRJA 3FXQA 3T1BA 4EJOA 3QPHA 5ICGA 4RDCA 3RVPA 2RN7A 3GXOA 5JR3A 4MNUA 1RXIA 1YS6A 3E5XA 3TO9A 3HM9A 2MC3A 1DRJA 1TBXA 3N0WA 1J0RA 4YLEA 2KJBA 4RKQA 5E8GA 4KIFA 3ZN0A 2C6YA 1W5TA 3EUHA 3HSEA 2HQBA 4NQRA 3T5XA 4N9IA 1GLGA 1FT9A 2IPLA 3RTRA 3KEQA 2GAUA 2FN9A 3H1EA 3QLUC 4RV5A 1RUNA 4Q4ZF 2FQ3A 2VOPA 4I02A 3H92A 3E5UA 3LFKA 2L54A 5IEJA 3R6SA 1FFSA 1SD4A 3HZHA 2EFQA 4BQAA 4GYGA 2O6GE 1J7KA 3V8LA 3ERED 4LLLA 2QYOA 3CRNA 2HYGD 1QQAA 1C0EA 1JHHA 3LQRA 5TQ2B 1ZG1A 1LBIA 3J7AO 1ZGAA 3R0AA 2JVIA 2E4ZA 3HRSA 3VFZA 3E97A 4RU1A 3C7JA 3ZMZA 4XSZF 2DT5A 2FSWA 3MM4A 4Q6BA 1LEAA 3EQLF 2NT3A 5TQ2A 3TDZC 4XASA 2XAHA 4ESJA 2IOYA 3J81K 5JS2A 3K9TA 4HQMA 2CO5A 3G1WA 2DQRA 2CW0F 4A12A 3RPUA 3DBIA 4WXDA 2A69F 1T39A 3SY8A 1DP7P 1NTRA 2MSLA 3HSRA 1A0OA 3HJFA 1JDPA 4JP1A 5EWJB 2IPNA 3E6BA 4H60A 1FX7A 2COMA 4MRMB 4Y13A 1JDNA 3QEMA 4YR7A 5CLSA 2D1HA 5F64A 3HDVA 4G97A 4Z9BA 3WU0A 3I42A 4ETIA 4IRXA 1YMUA 2MYPA 4XSXF 3OV8A 3CTAA 1PP7U 4OIPF 4Q7EA 1ZITA 1S8NA 2EFNA 4EMSA 4O1HA 2Y75A 5FWYB 2V0NA 4ZYEA 3ROFA 2K4BA 4IRGA 3EYIA 3IP6A 4YO7A 1YG2A 2D45A 1ZG5A 5F1RA 4MQEB 1K78B 4KUMA 3C18A 4Q48A 5FB2A 1XMKA 4KV7A 3JSPA 1AB5A 4HV5A 2GA1A 3C3WA 4L9NA 3QX8A 1GUBA 2B0LA 1KU2A 2ETHA 1KMIY 3F6VA 3L09A 2FLWA 1EH6A 5FWYA 4YRZA 2ZAYA 4N47A 9ABPA 3EYYA 3SAJA 4ML3A 3SQNA 4IRIA 1K78A 5D6FA 1D1QA 3LUFA 4HX8A 3ECHA 3K1PA 4IHTA 5LRRA 4W5NA 2PUCA 1IN4A 2FTKE 1IXSB 4GGGA 3KCCA 3FM3A 3JAMK 4HNRA 4LB5A 4M71A 1EWKA 6CHYA 4UVBA 3RYRA 5AONA 3WU1B 2GQQA 4G0PA 4EJVA 4Z4FA 5D8KB 4JQFA 4KPYA 5DGCA 2V1DA 1P4WA 3WE2A 5FBKA 1YMVA 2CSOA 3N0RA 4QWQA 5BQ3A 1G3SA 2GKGA 2FEZA 3S2WA 3GFIA 2STWA 3CTPA 3JVDA 3VNBA 3TKYA 1NATA 3GX4X 1G6NA 4CGZA 4PZ0A 1ZH5A 4UNOA 2VC1A 2M1BA 2XAQA 4EVQA 3JTGA 5KI6A 2VOOA 2QZJA 1JYEA 5HQJA 5FBHA 1T0FA 1USSA 4PGGA 1Z18A 4IILA 2A9OA 3GYBA 1ZARA 4ZYLA 1U2PA 3I4PA 2G7UA 5ICEA 3P7NA 2RDMA 1H9TA 1ZGZA 3D02A 1E6KA 3ZMTA 4H3HB 1NXVA 1PEAA 2L18A 3KP3A 2VBZA 1B00A 2P8TA 4OIOF 3FXRA 4W5QA 3L00A 3TO7A 3ILYA 3QP6A 1J2XA 5TQ0B 2LUOA 2J5PA 4LDZA 3W6KB 2JPBA 5FWXA 1AWCA 3RH0A 4WX9A 5HLGA 1IF1A 1XWWA 1YVUA 3JVIA 4ETNA 3EQZA 2OAZA 4FB4A 3NNNA 4BAYA 5E1ZB 1HBXG 4OLBA 1KU7A 2Z5UA 1Z17A 3OLWA 4BNCA 2WWVD 2AYZA 4RB3C 5JNVA 2FOKA 2LBPA 3GZ5A 3MIZA 3HUGA 4EY3A 5TQ0A 2VC0A 3C3MA 2OA4A 3T8RA 2KIMA 3P9KA 4HLXA 3V7CA 3KYIB 5IEBA 1R00A 3HOSA 2DLLA 4LDAA 2DFIA 1MVOA 2R48A 1BI2A 4QYWA 3BWGA 3JAMZ 2ID7A 2FQXA 5KQMA 2B4AA 1P4XA 3LTEA 3LUAA 2F5DA 1IRGA 3F21A 3IP7A 1GCAA 5ABPA 3TO5A 2QUFA 1PEYA 2HS5A 1QPMA 1B4AA 5L3DA 1R1TA 1H0MA 4FE7A 3TO6A 1Z05A 3MCZA 1J75A 3WTWC 4G0YA 5E18F 3RVOA 3KS9A 2RQPA 4TLLB 1KQ9A 2DU9A 3LUHA 1TQPA 2KIUA 5D4SA 1WI9A 5LHGA 1SMTA 1G3WA 2GI4A 3G73A 3F6PA 1YFHA 5D5XB 3HO1A 4YFNF 3R4KA 4AD9A 4ZYHA 1OPCA 2XV4S 1MIHA 4MS4A 4UHKA 2F5EA 1RZRD 4WWCA 3LAPA 1QQBA 2WY2D 3T6KA 3TMYA 4RB1A 2OBPA 1F1ZA 4I0BA 4EV0A 2MSWA 3LMKA 1FC3A 3E3VA 3UK0A 4I0AA 3GYHX 4ETSA 4RKRA 3O21A 5BOXA 1WSUA 1Z6RA 2DK5A 4MR8B 4KN7X 2DPDA 3CS3A 2P5LC 1LNWA 4YP9A 1YYVA 2GXGA 3D0SA 1DZ3A 3EGCA 4D6XA 2JPCA 2PUBA 2QLZA 4FE4A 4KK4A 3GL9A 3KP7A 1B6AA 5DKFA 5D6EA 1XGSA 2ISYA 1USIA 4KNYA 4A6EA 3CUQA 5ILUA 3QEKA 2UXXA 2IKSA 2IPMA 3M9XA 2XGXA 3B02A 3GA5A 3NHZA 2FMHA 3BJAA 2DI3A 4KT5C 2E4XA 1DUXC 3OLXA 4MPTA 3KZYA 4I01A 4MR8A 5JNRA 5EEHA 2ACJA 2H0AA 2P9HA 4YFXF 5IULC 1P6RA 1GXQA 4RK4A 4BH9A 3F8MA 5KWSA 3N6VA 3BZ6A 4YG2F 2QBYB 3FMRA 5HLHA 2HDCA 5ERIA 2WWYA 5B3JA 2EK5A 3GFLA 3GRCA 3P9IA 3VEPA 2M30A 5L3EA 2FQYA 5GOTA 2JBAB 5FO5A 1T2KA 4N03A 5DD4A 4EJUA 4JOQA 1YO5C 1NXTA 2OENG 5CHYA 3GT7A 2IDMA 1BI3A 1MJ9A 3R60A 4NCAA 4U7DA 4ZYDA 4O3MA 4EM0B 1Z6TA 4PE5B 1YTYA 1FBSA 2UWMA 1R5HA 4OLAA 1OYYA 3HIFA 2WC2A 3MAJA 2A07F 4RAZA 3FF5A 5D8LB 2KYRA 1ZDMA 3GWGA 5D4RA 3N75A 2V79A 4GO1A 3L9FA 2QR3A 5DDGA 2PQ8A 3RIRA 3LA7A 3L6UA 4KMRA 2PUEA 3CNBA 2H09A 3OQNA 4R79A 1NXOA 5TPWA 2FNAA 2Q8KA 1NXWA 3H75A 1ZREA 3MZYA 3CKMA 2TDXA 2EJRA 4MS3B 1E17A 2A5YB 1CF7A 4LLNA 3EDPA 2E7XA 1SAXA 1FY7A 1T38A 4ASNA 1OXBB 2GWRA 2CQKA 4HDVA 1IZ1A 1U78A 5TQJA 1R58A 4AIJA 2VT3A 2VN2A 3C97A 1B1BA 1IN6A 7ABPA 1H9GA 5H20A 3JPYA 2JK1A 1I1SA 3HRUA 3O2PE 2XIGA 4JBAA 4WXHA 1Q1HA 2K86A 4EJTA 4RAYA 3V8JA 3JTEA 3EULA 1NXSA 4Z4IA 2QVCA 4WK8F 1BDJA 1USKA 1WKMA 2P6SA 2IRFG 1NHAA 5LRSA 1XDSA 3I54A 5IBQA 2A6EF 2O8XA 2X0LA 4RY8A 4TV7A 4O6JA 1BBYA 1D8KA 1RZRA 5C5CA 4IVNA 2YX4A 4EYGA 3HXMA 4YIIA 2P7CB 3HTSB 4KICA 3OQOA 2F5FA 3K69A 4RSMA 1BDIA 3OLVA 1ONVA 4G9YA 1ZRCA 1STZA 1GCGA 5IX8A 5HLIA 3HSFA 3KEOA 2PL9A 2JT1A 2Z33A 3BPVA 3ZPLA 2FU4A 4PDKA 5DUKA 3KTOA 1ZYRF 2WMYA 3IRQA 1W9HA 5TPZD 1WWXA 1TJYA 2Z3YA 3BRSA 1SXIA 1VPWA 2ELHA 1Z7UA 3NEUA 1Y1LA 4N41A 4L9VA 3OM1A 3FMQA 4W5TA 2VYCA 1D8JA 2VBXA 5TRDA 1YIOA 2QQ9A 3DKWA 3K0LA 4YS6A 4IF4A 5FFZA 4B8XA 4L9JA 3O6BB 3U2RA 3GBPA 2BGCA 1NXXA 1BC7C 2OD5A 4XBFA 4NHJA 1Z1DA 4XFKA 1YK1A 3LA2A 2W84A 2O61A 5ILSA 2M98A 5KQPA 3CUQC 3T8TA 2PE5A 3KKEA 1DPRA 3LWFA 4MEYF 1FP2A 2BE5F 2RNJA 5DLEA 1ZESA 1JWLA 2MLGA 1HSJA 4KK3A 1IAWA 4O1IA 5TE9A 3CO6C 5JNUA 2PN6A 2FQWA 2L17A 5JI6A 2E4VA 1FBUA 4AVPA 4EUKA 1E2BA 2PMUA 5B3JC 1O3QA 4M9XA 3H6HA 2MLKA 3I0TA 1I6XA 4R8HA 1TW2A 3I45A 1ZAYA 1B9MA 2MH9A 4Y15A 2KJCA 4EQQA 2IA0A 4G0ZA 5T7BA 2E4WA 4WWHA 3JTHA 3H1GA 3GV0A 3ML6A 2MYUA 4O5AA 4RB2C 2K02A 3RYPA 5PNTA 2XAJA 2GX6A 5AIQA 5D5WB 2R3SA 1EV7A 2H3HA 5LLQA 2ZMEA 1EFAA 1ISSA 1CYEA 4ZH4F 2MH2A 4NQWA 4L0ZB 1Z9CA 4EJWA 5E20A 5CVUA 1YTUA 1EWVA 4YGXB 4ZZLA 4KZKA 4KN4X 3QEMB 3SFZA 3F23A 4LE0A 2YX7A 1QNLA 1TLFA 2JCGA 1V3FA 1Z91A 2E1NA 3KJXA 1G3TA 2K27A 5TJJA 4HOBA 1FP1D 4U0YA 2EFWA 4Z9AA 4N0QA 5FD5A 1MB0A 1HW1A 4LD5A 5E8IA 3N97A 3H3UA 3T0YA 2LF8A 4YFKF 4LG0A 1ZH4A 4UXNA 3F8FA 1LDDA 3ROTA 1DCMA 3KETA 1J5YA 2P5VA 2XUBA 3GFJA 3QELA 4MLCA 1DC8A 1LBHA 3KLOA 2STTA 4KQCA 3OO1A 3SM9A 2BV6A 4MQ9F 2IJLA 4XAQA 4IMIB 2P6TA 5L3CA 4MTDA 3DGEC 4P1ZA 4MQFB 4XLNF 3LQQA 2VT2A 3DEUA 2RC4A 5L3FA 1M5TA 3IWZA 3U9GA 1HKQA 2HQRA 4G94A 3LKBA 2HFHA 1BM9A 1YS7A 2HEOA 2FMIA 3SZPA 3JW4A 3SXYA 1T34A 4Z99A 4MS1A 1U5TA 4OU0A 1EWTA 1JL3A 3TQNA 3V8KA 4UUVA 4P55A 4YV7A 4MQFA 3BPXA 3F73A 4FT8A 5HS8A 4IJAA 4A5NA 2OZUA 3WGGA 2NUBA 2FMYA 3FDFA 3FZVA 3EETA 2RGVA 3Q7TA 2ADUA 3LKVA 1I3CA 1K68A 1U8RA 1JFSA 4RK6A 5JS1A 2E1CA 2EB7A 1AOYA 5TPZA 5BPIA 1YQAA 2FMLA 1W4MA 2H94A 2A61A 1AB6A 4RXMA 2QSJA 1R1UA 3LFTA 4N9HA 3LAJA 1KQ8A 2PBIA 1KYZA 3Q9SA 1QP0A 3KHTA 1XCVA 1BOAA 5A2QZ 2M1ZA 3DPTA 3ABTA 3L7WA 5BRAA 2PUAA 3EAFA 4MTEA 1K66A 2P4UA 2BBYA 1BN5A 4L85A 2MD5A 3NQOA 4LGWA 4EGSA 2ZKZA 3DZDA 2QM3A 4CO8A 3WGIA 1PNRA 2CWEA 1W5SA 3FMSA 5EEGA 1XMAA 1KRXA 2M5WA 4IRHA 3O1JC 1TTYA 2H6CA 3F6OA 1E6MA 3BILA 5FWXB 4G8XA 2HR3A 2RKHA 3PQKA 1G3YA 4JAVC 2XASA 5BS6A 4RGUA 1F51E 4D0PA 3F8CA 2IP2A 1HXDA 4LE1A 4PYRA 1SFUA 1HQCA 3KYJB 4E7PA 4GXOA 3CG0A 1RZ4A 1LJUA 4W5RA 4PCQA 2XRNA 3D8UA 5L3GA 4GNRA 1OR7A 2NAZA 5CVJA 3A3KA 3M9AA 4NCBA 3CJNA 4W5OA 4ENJA 3VB2A 4QLCU 3GFMA 2PI0A 4G6QA 2FXIA 1V4RA 3QX9A 3CLOA 2PJUA 4LX8A 4PEVA 3R61A 2PKXA 1HKTA 1UFMA 3GVAA 1ZH2A 5IC5A 1XCBA 3FM5A 3G85A 4D74A 4RS8A 2H27A 1USTA 3WTZA 3GUDA 1QQIA 4IMJB 3EQ2A 4ETMA 2XAGA 4M72A 4BHPA 3HTUA 2QVOA 5K1YA 4HF1A 3QRFF 3KP6A 3ROUA 1IXRC 2IA2A 4ZZDA 2R25B 3IPCA 2QQAA 3OOPA 3DP7A 1FYMA 5CNKA 3IKVA 4PICA 3QAHA 4F11A 2JRTA 1R5GA 1QO0D 4RK1A 2FE3A 2QWWA 3BY6A 4MHGA 3W9SA 2HOEA 2CGPA 1LEBA 1NXPA 2F8SA 4I09A 3H5VA 2W24A 1U2QA 4RK5A 4MS4B 3M1EA 1M2FA 1R8JA 5KC9A 3KE2A 4RGXA 3ZP5A 3HHGA 3O75A 1NY5A 2GBPA 2EV6A 2V9VA 3M6MD 4HW0A 1KU3A 2L4AA 3CDHA 4CBVA 4WUTA 2F5CA 5FGMA 4XLTA 4U0VA 2FVYA 3DFGA 4F7ZA 5LEKA 4G0OA 1F5TA 1YW9A 4ZMSA 4RB0A 1U2WA 4HLYA 2PMCA 4B09A 4DQDA 3WE3A 5J8CA 2IW5A 1C0WA 2V1UA 2A9QA 4ESBA 1UHWA 5FFXA 3HEBA 4Z4GA 3CUOA 5L3BA 1ZRDA 1XD7A 3Q7SA 3IWFA 1JX6A 5IUKC 1QGPA 1H9CA 3LUKA 3C3KA 2HPHA 2FF4A 3CUQB 3BP8A 3P9YA 1ZLKA 1DC7A 2VXZA 4G0XA 2OQGA 5JNSA 3FFXA 4KYWA 2FLKA 3F6CA 4JASB 2JVJA 3PFIA 1FZPB 3QP5A 3IDOA 1R1VA 2GA2A 1LJLA 2L19A 5JHUA 3CFYA 2HWVA 1JF8A 1ABFA 1S7OA 3MFKA 4I7HA 1FFGA 4EM1A 4G7OF 3FFWA 3SZTA 5HS7A 3FFTA 3HYIA 2ZCWA 1Y0UA 1QBJA 2RGYA 1J9IA 5EWMA 2L01A 4UV8A 4Z4HA 4WF2A 1S3JA 2FKAA 3H5WA 1SXGA 1RNLA 2E7WA 3DQVC 3ISPA 4RGSA 5D5VB 3IP5A 2UZKA 3O2QB 3L49A 4P9UA 2LKPA 2H6BA 3A10A 2OU2A 1BC8C 1YK0A 3HDGA 3H3ZA 5FLXZ 2DQLA 3IC7A 4QPJC 1HEYA 2FBIA 3VNAA 1TMYA 4NICA 3RKXA 2BYVE 4L0YB 2LP4Y 4HV6A 3HK2A 3QPTA 1WRJA 3I59B 3WTVC 1Z15A 2ZO4A 2A6HF 1SXHA 1WQ2A 3FMVA 2IVMA 3I09A 1R36A 4A0ZA 2CWDA 1FQWA 3K1NA 1EH7A 4M9ZA 5TPWB 3SG0A 4Z0NA 3H1FA 1W7PD 3F72A 1JFTA 4CXFA 2LDUA 4G7ZF 4KA4A 3QLVA 3T8YA 1JFVA 3GEZA 1CF7B 3QU6A 1ULYA 3I59A 2FSPA 2D1VA 5DTEA 2YSRA 4MR9B 2M45A 1LDJA 2EFPA 3QU3A 2HKOA 2DPUA 3CZCA 3LUJA 3NNDA 2M8EA 1GHCA 4HYEA 3FWEA 1FSPA 2GIVA 3DV8A 3E6MA 1O3SA 2DAOA 1C4WA 1D2AA 4E70A 4MGEA 1J59A 1TNTA 1B59A 2J48A 3MYYA 2NNNA 2QV0A 1T98A 2WJAA 3RVQA 5BQTA 2R7FA 6PAXA 2G7HA 3WTYC 2MYTA 3TGNA 4MR9A 1TM2A 1QO0A 2PEXA 1P4AA 1DCFA 2MSKA 1R7JA 2XKOA 1UB9A 4M74A 5IUJC 2VBWA 1Z25A 2ZJ2A 5JVTA 3M9WA 1K6OA 4RGRA 2A9RA 2X7XA 3REOA 3WG9A 2DRIA 5K5QA 8ABPA 4S05A 3OQMA 3KG2A 4IPAA 1P8AA 2ESNA 2JZYA 4YWHA 4OINF 1KU9A 5DV5A 1GUDA 1XHEA 5E3JA 3TX6A 4Y9TA 4GYIA 2NZVG 1FYKA 3JSOA 2XROA 3OLYA 2ZBKA 1ZHHA 5DEQA 1HW2A 1U6GA 1DBWA 4TN5A 3KP2A 4N76A 1OKRA 2PL1A 3PQJA 3BOQA 3I53A 1E2XA 3IP9A 1FYLA 1BIBA 4U7BA 4A2UA 1TW3A 5JFRA 3NBMA 1BJAA 2HTJA 3ECOA 2FBHA 5KVRA 2ID9A 3DLBA 5IT3A 5E1XA 3M8FA 4HDUA 3I58A 3B2NA 2NNYA 3AAFA 4EVIA 1SFEA 2Q2EA 2QW1A 2VUIB 1JGSA 2MA3A 1F4KA 1U04A 2DTRA 3M7GA 4H3KB 4UHTA 1RUOA 3HCWA 3RI4A 3BROA 1QNTA 2WRZA 4WXMA 1XSXA 2LIVA 1CEYA 1QPZA 3GF2A 4M9SA 1I27A 5E1WA 4MR7B 4WCGA 4I98B 1Z16A 4N0PA 4OATA 1L3LA 1IXCA 2YPRA 3G3ZA 3LSTA 1TQMA 3BJOA 4KMUX 2YHBA 3HSYA 2XDYA 4KREA 2GZWA 1MB3A 3Q7RA 5DYMA 4HNQA 1Z12A 2HQOA 3QOPA 3A0UA 2FMKA 5IT9Z 5CNJA 1OYIA 1S7AA 4CDGA 4EM2A 1W7PB 3IHUA 4YIFA 3ELKA 2F8TA 4JK1X 1ON1A 3O2JA 4MGRA 4XRFA 1MZBA 1D4ZA 4MR7A 1JXSA 5BR1A 3O74A 4P98A 4M6XA 1ZGJA 2DK8A 5T3YA 4EVSA 2ZMEB 1MAVA 1LJ9A 1XSDA 4WT7A 2IA1A 3H5LA 1MJAA 5LHIA 3J80K 4L5IA 2JTVA 3E6CC 2L02A 2Z99A 3RVSA 4L9TA 1M5UA 2VBYA 4L5JA 1W7PA 3E6DA 5J6XA 2B1JA 3CU5A 1JHZA 5D5UB 1M2EA 3WODF 1ZRFA 3I71A 1QZYA 3E61A 3N0XA 2D2WA 4HF2A 2QVGA 1JLKA 4HZFA 1MGTA 2YR2A 1I1GA 1PDNC 2XHKA 3SHFA 1W25A 3WTXC 4LG0B 3GLXA 3KP4A 5JNWA 2ISZA 2CG4A 2GXBA 1MKMA 3QLVC 3GW2A 2X4HA 1QZZA 3QELB 1FBQA 2RVCA 2KKOA 3COAC 4UVAA 2WB4A 1MJBA 5I4CA 5A2QK 4UVCA 3Q41A 3KLNA 1P2FA 3F3XA 1K7AA 2F2EA 1L5YA 3F7NA 3BBLA 4LJZF 2PG4A 3HVRA 2HTSA 4F06A 2EV0A 4P96A 3RPQA 5ILVA 3RDIA 2E4UA 3F8NA 1DRKA 2KIFA 3HUUA 5GQSA 1MDMB 4Z4CA 2P4WA 5HDKA 1DCKA 1ODDA 2VODA 3BREA 3IL2A 2Q5CA 2HJ9A 3T95A 1IW7F 4CYDA 4H0EA 3OLZA 4XARA 1D1PA 2PUDA 2I6FA 3DGFC 4MS1B 1GVJA 1BAPA 1U5TB 5K5OA 3H5OA 4WXEA 4ON0A 3K9CA 4KIGA 2L2QA 1XDUA 3HHHA 4CICA 2QZ8A 2MBFA 4IHSA 5F6FA 5D2CA 4KIBA 1Z26A 1MDMA 3MF4A 1HSTA 1VLZA 4HX4A 2VUHB 1RPJA 1LDKB 3GZ6A 3WGHA 4LK0F 2LSOA 4UV9A 3KP5A 2WTEA 1QP7A 4NV3A 2J5OA 1Z2EA 2V1XA 5CNIA 3V7RA 2CHFA 1LQ1A 3GWZA 3J80Z 3L2CA 5DCMB 2ESHA 1FSHA 3O1IC 1P92A 2G9WA 4G86A 4F8JA 4LMYA 3CG4A 3ZQ7A 4HBLA 4LRQA 1O7FA 4Q6WA 5EWJA 3LUCA 5KK1A 3DF8A 4MRMA 2ZXJA 2PLYA 3T38A 5LEJA 3RKWA 1SRRA 5ICFA 2N9UA 2PMHA 4KFCA 3IPAA 4ENNA 3TB6A 2EWNA 1U8TA 2AXLA 5KC8A 4EYOA 5KQLA 5DCMA 3RVMA 2LNBA 2FW0A 3SNKA 3S99A 1IN7A 5E17F 1EAYA 1UCRA 3C1DA 3H6GA 1FSEA 2FBKA 2O3FA 2IYNA 2EA4A 4HQEA 4FX0A 4U88A 3CLKA 1HKSA 1KGSA 1KQ0A 3K2ZA 1J56A 2L4MA 3ZMUA 2FN8A 4MQEA 4RWEA 2HQNA 1MD0A 1USGA 3HRMA 1R23A 5J8FA 3LA3A 1LK0A 1DDNA 2XKPA 5CJ9A 3O1HB 3RQIA 4QYMA 1FWZA 3UKJA 2RDPA 2R7DA 3ZMDA 2NZUG 2ZFWA 1SD7A 3U1DA 2IPAB 3NNSA 3J81Z 5BMZA 2FEKA 4OTZA 3TD9A 2W25A 4FX4A 1QMPA 1IN5A 4R1HA 5C5EA 2ZNZA 2CD7A 2O20A 2FNPA 3RKYA 3GBVA 3RVNA 4ZPJA 3V7SA 2K7LA 1ZGGA 5HDGA 3KSMA 3IRRA 4OG2A 2CFXA 1SD5A 4CHUA 3URMA 1XGNA 3E3MA 4M6YA 1ZVVA 2O0YA 3EDCA 1BI1A 1D3YA 4WXCA 4EYKA 4L4UA 1ZG3A 2RJNA 3VOEA 2R47A 2K4JA 1TNSA 1REPC 1JH9A 1LVAA 4NB5A 1IIBA 4XLPF 1SFXA 5LGTA 3H5IA 1BIAA 3O3KA 1YW8A 4LB6B 5H6RA 1JBEA 2PAFA 4YCSA 1GXPA 3JY6A 2VK2A 1UHMA 2JSCA 5FD6A 4E7OA 1RI7A 3BJ6A 3MWMA 4ESFA 1F4VA 3C6QA 4EVRA 4F3TA 5LGNA 1XGOA 1BVHA 3ZN1A 3FHZA 1D5WA 1ZN2A 1G4DA 3I64A 2LPMA 2A9PA 2P7VB 1PHRA 3DLHA 1RIOH 2JRLA 3NRVA 2R4QA 1UDRA 3MZHA 5FLXK 2AS5F 4DN6A 1X3UA 4RZSA 1O57A 4KDPA 4EGYA 4BHCA 1QKKA 5HS9A 2PLNA 4KRFA 3EODA 1BDHA 5HM6A 3WTTC 3O2SB 3RVKA 3P9CA 4RS3A 2O03A 4LZLA 2JB9A 2PUGA 5DUIA 1DBPA 5ED4A 2FXAA 4GCVA 2WV0A 2A68F 4OIQF 1IUYA 1O3RA 1DP4A 1ZHFA 1Z2DA 4U0WA 4F12A 3FX3A 1ZLJA 1KRWA 5LGUA 2Y0MA 5LHHA 3QLTA 4A0XA 4DQ2A 4KQ9A 2FEPA 4L18B 2FMFA 1E6LA 1ON2A 2ZWMA 3LOPA 1R22A 4FHTA 4G0MA 1YW7A 4LLGF 1DBQA 3RVRA 2NS0A 5EWMB 4DADA 4G6DA 4A6DA 1U0SY 1U5TC 2BEOA 4HX7A 3TOBA 1FLIA 2MYNA 3M8EA 1PUXA 2QQBA 4DNCA 4O5VA 2V6CA 2ZNYA 5HOOA 4PGHA 4BXUA 5JNTA 5CYVA 2VE9A 1EH8A 4BHBA 2W57A 1Z13A 3ZMSA 5HSGA 1PNTA 2VONA 1ZAOA 1KA8A 4OMZA 4P9FA 2WJWA 3WTSC 3MQ0A 2HSGA 1XN7A 1A04A 3HOTA 1QP4A 3KZZA 1VRVA 3F8BA 2PUFA 3ZMVA 1EHCA 1U3EM 4TMYA 4M73A 4EGZA 3F22A 4MYRA 1SMYF 2RV8A 4G7HF 3FGZA 1O7LA 2FEWB 5CVVA 5EWLB 2FRHA 6ABPA 5KQGA 2BGGA 2TMYA 3CHYA 1L5ZA 3K1MA 1SD6A 1TLHB 4MLDA 1YLFA 2NT4A 4HF0A 4BYYA 4IGAA 2DO7A 2L3DA 2KRFA 5HVQC 3R0JA 1I5ZA 4ZYGA 3H5TA 4I2OA 4RY0A 3QK7A 2EFOA 5CVRA 4M88A 3QLUA 3CO7C 1URPA 1PP8F 5IUNC 5AIPA 1XGMA 4HNSA 2PJPA 1BI0A 2NYXA 3W6JB 4K2EA 3CZ5A 1B9NA 3HS3A 4RY9A 5EWLA 1S29A 3LUDA 5DCFA 5DCLA 3NHMA 4A5MA 4AIKA 1DJMA 2VE8A 1S6LA 2Q0OA 4Z2YA 4Y17A 2XVCA 4HA8A 1JE8A 1FFWA 1VKRA 1VTNC 4QICA 4WZZA 3OMWA 2QXYA 1WETA 4ENMA 1ZY2A 1LB2A 1DG9A 4AWXB 3E5QA 2QBYA 2AYXA 5DD8A 2UXNA 2JVKA 2M87A 3VODA 1A2OA 1HW5A 2E4YA 3Q9VA 1IRFA 2CHEA 1O3TA 2FA5A 2HYFA 4ZMRA 4AIHA 1IN8A 2CYYA 2JBAA 1FNNA 1JHFA 4EYQA 3MQ4A 1TVMA 3LUGA 4GPAA 3N8IA 4LK1F 4OBBA 5K5RA 4ENKA 3A0RB 3K4HA 1APBA 3JPWA 5IT9K 2LF7A 4HAMA 3GO5A 2OQRA 3Q15C 2DBBA 3MEXA 3MMNA 3ABUA 4MQVA 3B73A 3FXUA 3BRQA 3OM0A 4D6YA 4IXAA 2Z9OA 1D5VA 1OXKB 3N4MA 1BA2A 4JB2A 1CGPA 1CHNA 3MA0A 2IPQX 2W42A 4Z4EA 4RK0A 4MEXF 3OO0A 4TLMB 1T6SA 1KYWA 1XHFA 2NRAC 1TQIA 2HGCA 5BPDA 1K79A 1XB4A 3HV2A 2YU3A 3UUGA 5HKOA 2Y48A 5ICCA 3RVJA 4N0BA 1JYFA 3EJWA 4OOIA 4ZJPA 1P6UA 4MS3A 4A0YA 4XXHA 4RK7A 5CNMA 4Q5SF 4LFUA 1DPUA
chains in the Genus database with same CATH superfamily
3U4QB 2GAAA 4PHTA 4GOOD 3E1KA 3ZQUA 3CWQA 3ZI4A 2ME6A 1P6QA 2OLKA 4Y30A 1K6XA 5G1OA 3RAJA 4CZZA 1MU0A 4CZ2A 1WM1A 2G36A 4M0EA 3SHVA 3U40A 3OF3A 5F7XA 5FTLA 2PGJA 3CRQA 2YU9J 1UZLA 1JLLA 4F2GA 4G0QA 1X4PA 2RJOA 3VNQA 1L0OC 1D2HA 2DLCX 4N3AA 2MSEB 3NS7A 4II3A 4D02A 5J23A 2R0QC 3SHOA 3I5XA 5ALEA 4EJOA 1KVQA 5JSUA 1QGED 4MH0R 2RBKA 3OC0A 1K7CA 1KK0A 3F6SA 5IM4F 2VWPA 4QDXA 4XMYA 2DA6A 1UMDA 1Z4IA 4QOIA 1W5TA 4Z7JA 2D3TA 3SS7X 1S2OA 4G56A 4AZTA 4LYGA 1H05A 2Z6AA 2JRMA 2CFOA 3F8WA 1HTBA 3HCRA 1H8ED 3ZZ0A 3ASVA 4M9RA 1ULAA 3BDIA 1OZFA 1QVZA 1SD4A 4N49A 3RSLA 3KDSE 4DY6A 2C4WA 3VGJA 4FDTA 2GDJA 4DCVA 1LK5A 4MUYA 3S3TA 4J90A 3L8MA 4RPJA 4OQLA 3GP8A 1ZG1A 3W5SA 5EP1A 3HJTA 4L9AA 4MKXA 4AYXA 4LQLA 4S3MA 4HR7A 1GSIA 3ZMZA 4MQUA 5AW0A 2IYOA 4XSZF 3CVUA 2BI7A 4BLRA 3CVYA 3B7WA 1V37A 1BL0A 2FPIB 1NSYA 3TBKA 4D8YA 2PRYA 1TU3A 1SCIA 3HJFA 2D7JA 3E6BA 2NUPA 2EERA 4CHTA 4PBTA 1M2HA 4LXUA 5F2EA 1SR8A 1JBKA 4LDQA 4P0TA 5D1HA 1PZXA 3HQ4O 1MAWA 2OL4A 1S8NA 1V2GA 3JQ9C 1LUAA 2NU8B 4BKPA 5T3UA 5ETJA 5H3HA 4B4OA 4Y2JA 3K6RA 2QMEA 2I78A 3LHFA 2IYTA 1ONOA 4QM6A 5FB2A 4Z1OA 2ZI3A 4LDPA 5DM2A 2QLNA 3F49S 4G1UC 1Y63A 2ZG6A 3EYYA 5KTMA 5BMVA 3EIFA 4CEJA 1NJSA 4NL4H 3VR4A 4IRIA 3X1XA 5JASA 2O54A 1M6EX 1MC8A 2OBBA 4LVNA 4YV0A 5K0EA 3E48A 4GGGA 3GFQA 1U81A 2B6HA 3S1RJ 1L7MA 3H2SA 1OX5A 2P9BA 3PI6A 4J94A 3LVBA 3MUNA 2Y0EA 2R86A 2IPXA 3DTVD 1QF6A 3HGGA 2R93J 3ZWDA 2RGCA 3IBSA 3T1OA 1IJEA 5U1PA 1RJGA 5EOVA 1W0UA 1JILA 1XJ0A 4PZ0A 4Y6GB 4XGNA 3IMKA 1E9RA 4LRXA 2AKYA 1UBFA 1Z18A 4GIBA 5ADHA 3GYBA 1ACMA 3JYOA 3H2IA 1U2PA 3NEYA 2ZJBA 3RFCA 1PEAA 4WUVA 2XWPA 1QAMA 3L00A 1VJDA 3RJZA 4G89A 3KJZA 3QVTA 5JMTA 3RH0A 4F6RA 5JHFA 1EHYA 4BQRA 4HAWA 1KOJA 3EG9B 4RE6A 3T54A 2GYVA 2ATCA 2GK3A 3UBMA 2AZTA 3V1UA 4QFBA 2HU7A 1PL8A 3FZYA 2FOKA 4H4CA 1P2VA 2C2GA 1NI4A 3N05A 2YOHA 3RLIA 2OA4A 4HLXA 1ZGBA 1ZI6A 2IVZA 3OOSA 1S3IA 5L3QB 1TUEA 2W8BA 5B4UA 2W2QA 1WE2A 1T9DA 5CFPA 5ABPA 1W46A 4QFMA 3A6GA 1OHHD 3ASUA 3BWXA 3G02A 3H9UA 2CYCA 1G8AA 2CNOA 3HBLA 3NBFA 2VTBB 1IPFA 1X13A 4XOTA 2G77B 1OPCA 4MS4A 4UHKA 1RZRD 2GJ8A 1G6Q1 4RVOA 2HPMA 2MSWA 4YREA 2R6ZA 1L5MA 2DWQA 3AEZA 3KUKA 4M1ZA 5JZMA 1RYNA 2JEZA 3PSHA 4MO2A 4OH7A 4Q21A 1GZ6A 4NJOA 3EDOA 1Y33E 2VYNA 2YL2A 1U0OC 2O1XA 1DZ3A 2X48A 2PUBA 1ZCJA 3FAZA 3H65A 5HTKA 1II0A 1Y48E 4AJJA 3D4LA 4KE8A 2ZE6A 4TM8A 3QEKA 2IPMA 4G5XA 4JUIA 2G4LA 3OLXA 3OIGA 4KWEA 5JT1A 2ACJA 1GXQA 4ITVA 1RZVA 1YQQA 3H9JA 4NMMA 4YAGA 1LUJB 1AGRA 4INJA 5L4NA 2WSLA 2EBHX 1JMKC 1U0JA 3T5MA 5LXTB 2GZHA 1JDZA 2FSIA 1OYYA 4HNUA 4OQXA 2WC2A 5GINE 4IHQA 2O8DA 2XWSA 3CUUA 1RAHA 3OIUA 3EASA 5KVQA 4A73A 4P3PA 3M4JA 4RFLA 1SZDA 3GRVA 2EKPA 3JRFA 4R79A 2ZJ1A 1Y9AA 3AUFA 3GQBA 2ZAMA 2XADA 2X2FA 4JROA 2EJRA 1QAQA 4MYCA 2O1EA 4KH1A 3BYZA 2Q6KA 1DKRA 1XZBA 3NETA 4B74A 5EMJA 3MTIA 1U78A 2WWTA 1IATA 2B36A 5JQGF 7ABPA 4YDHB 3UJPA 4OIFA 4P8RA 3ML1A 2CF5A 1Y39A 5DTJA 3BG3A 4BVJA 2K86A 4Z8YA 3V7YA 4AY3A 3GEMA 5HNHA 4MTLA 4ZAGA 4R84A 2BE7A 2XNSA 4BX0A 3M9LA 4MRNA 2HCBA 1HDYA 2WSYB 5BSKA 3TIXB 3HVIA 5C4JJ 1Z56C 1BR1A 2AXTC 3K69A 4XKWA 3DOIA 2HPAA 3N8KA 1PT6A 4WLEA 1QH0A 4DQLA 3VU3A 3KLBA 4J3FA 1LF5A 4LITA 1E3OC 5JHHB 1FS4A 1KP2A 3SZ3A 1OCRH 2I34A 3CBGA 2ICWG 4TV9B 1PT7A 2AN3A 1UJ6A 3VTAA 5KX5F 5EJGA 5FFFA 3WGJA 3UJNA 2JANA 3RV3A 3R3ZA 1XROA 5FOUA 1DV2A 2FR8C 4M1YA 4QXMA 4XFKA 2CVFA 4QDKA 1ULSA 3LSKA 2XNCA 1UDCA 2ZYAA 3LWFA 1VMKA 1XYYA 5BN1A 1L4YA 5SICE 2WU1A 5B66C 1GCOA 3FFAA 3R3SA 1THGA 2IVFA 5AVTA 1I6WA 2I4IA 4LF7B 3H6HA 3TDMA 1V39A 2E2WA 4R9RA 3WYDA 3GGPA 2JCXA 3EZ6A 3ML6A 4O5AA 1NJ1A 4C0AC 5L3SA 4ZH4F 2XGEA 5AK0A 1UP6A 5EXEA 3ONEA 2BCJQ 4V3BA 1SCAA 4OJTA 1XF1A 1SCUA 1DAKA 1REQA 4FFOA 3PVSA 1NJFA 2QE6A 2IYZA 3NDRA 3S2ZA 4UQLA 4D9IA 1BCRB 2WIGA 4Q15A 4N0QA 1VGRA 2HIMA 3O4IA 3OYEA 4PQGA 1UBLS 3G17A 3NGMA 1DKLA 3JASA 2P5SA 1EXWA 3PHIA 4FD2A 3GFJA 2RB4A 2HVRA 2BV6A 4XSVA 3HBFA 5EDNA 4EEKA 1R27A 2VPPA 3QUBA 3THXB 3QENA 3JW4A 3KKQA 5C1BA 5BN4A 1DBIA 3DZCA 1C80A 2GJKA 4OHMA 1E94E 2EATA 4CYCA 5ALZA 3TN7A 3NYQA 2V4MA 2BGRA 2ZZKA 2L9SA 3CE9A 1ILWA 3PHJA 3RT1A 1B93A 3SLRA 2RGVA 3CVJA 3LKVA 1NF2A 3HN2A 3L0YA 4W7HA 1MQAA 2AJBA 3RCBA 2O2EA 4CM4A 4G1FA 3ZZNA 3MSCA 3KHTA 3QVWA 2ATEA 1N0VC 4RVUA 1ZCAA 1NAHA 5BRAA 1NVFA 2ZTVA 2CL0X 1TTHA 2LTAA 3EISA 4AYBA 4KTTE 4NBLA 1NJ6A 3K0EA 4AY2A 4TTSA 1TTYA 3KOXA 4X20A 5DF1A 5AIBA 2XF8A 3ZCSA 1D5YA 5K0GA 2GZ1A 2WB2A 3B1YA 4YJKA 2AG8A 2BSAA 1YI0A 4RA2A 1OR7A 2NAZA 1R0ZA 2W90A 2WT9A 2C5FA 4ZFNA 1FTSA 1VA4A 1X19A 4BBRJ 3WLNA 4H15A 4AZ3B 1BRTA 3GROA 3LVRE 4PEVA 2PKXA 1RRPA 1HKTA 3FM5A 4LTDA 3K1AB 5KJEA 2CS3A 2DWCA 3UYKA 2AFHA 1OXXK 2WM9B 2BW3A 5KJCA 3F2IA 5BV7A 3E5MA 5ADWA 1IWBB 3NHFA 4FC6A 2IA2A 3OQ1A 2VDQB 2F8MA 4LG3A 2B7BA 4J4TA 4E51A 3W9SA 1DADA 3C3PA 1E2MA 3F46A 3D31A 1I39A 4BDTA 1PNQA 3W3AA 2QQGA 5KC9A 3HC7A 1RTKA 4EQZA 2IUEA 4NIMA 4CEHA 2WUDA 2F3UA 2OHJA 2JH8A 3MHTA 1C4XA 1E2DA 4XLTA 4UHHA 4UEWA 3UHAA 4HLYA 2XDQB 4OI0A 4MV0A 1C0WA 4HEA6 5IVPA 2X2OA 1EK0A 1F5SA 4I4TA 4BFVA 1ZRDA 1PEKE 3Q87B 5JZVA 4C3VA 1OJLA 2FI1A 4UC0A 3NJ4A 5E3OA 1EXNA 3BTVA 4CXMA 3PNSA 4ISBA 5EZHA 1R1VA 1TT5A 4GOJA 5EE9A 1S7OA 1N4DA 3HACA 3LLVA 1U3VA 1PW5A 2RGYA 1DEOA 3W2GA 1ZHOA 5J2TF 4L0DA 5JC1A 5TC4A 4TKUA 2YDYA 1SXGA 1G3RA 5CM8B 3KZKA 2XEXA 2WJJA 4TZ0A 5BORA 1ZXBA 4UXHA 2X0JA 1VHTA 4ZI7A 3EXIB 5GZ3A 3OYIA 2NYUA 3VNAA 2WKRA 3DDCA 4DV3B 1N4AA 1ILEA 4A3LJ 1NX9A 2BCEA 3O9VA 3VV3A 4D41A 3UAXA 5J1RA 5I9IA 3SYMA 1XNHA 3SKXA 4H7PA 2RHOA 1N5DA 3LQ2A 5IW8A 4IIEA 1XSEA 5LA6B 2V9ZA 4MR9B 2HKOA 3OFVA 4MV6A 5IT0A 2CV2A 1DBRA 1GHCA 4HYEA 1FSPA 4GBJA 4YDRA 3I2GA 3W2AA 4OJNA 3CONA 2JUGA 1S89A 3HWWA 1IG3A 2WJAA 4EJSA 3T1VA 1CEQA 2G7HA 5AHWA 2JLZA 3IE1A 4QUAA 1LVUA 3DKPA 4BPBA 5G2OA 2JAXA 4PAGA 2GNAA 1TKBA 3NWSA 3P4XA 1EUYA 3ZDEA 8ABPA 3OQMA 1SC3A 2I4TA 2WUWE 2SKCA 2XIQA 2BDUA 3TX6A 3I1YA 3RI3A 4TWZA 4B7UA 3LX8A 3GY0A 2PFKA 3SC2A 1NUTA 1KYIA 3G9XA 3OKCA 5AVXA 1W34A 5IKXA 2YY5A 4DLBA 2M32A 2GTIA 4TV8F 1TUBA 2HJRA 2BHNA 1NM5C 2BEWB 5E1XA 3CW9A 1G1MA 2G0NA 1ZD8A 3BGIA 4X1IB 1QFZA 1YAHA 2RH4A 4CKWA 4F85A 5BOSA 2G9UA 1JKOC 1NE7A 1G8FA 3C2HA 4D9KA 3OYHA 4REQA 2X2EA 5LD2C 2B8JA 2X0FA 2VZEA 2R7AA 2AF3C 4KMUX 3QU7A 1G5FA 4UFNA 1TAUA 3OOUA 2PXXA 2V7XA 1B4DA 4HAVA 3IUNA 5HGXA 2RBEA 2FMKA 2H57A 5KKAA 2HLDA 3HTXA 1PLLA 3KAJA 2G7MC 1PX0A 4LWQA 3IIEA 2HMVA 2BGLA 3GX1A 1ORHA 1QFSA 3VPDA 4QYXA 4L5YA 4HDMA 1TQ4A 2QM7A 5CLIA 1DT3A 3PEUA 5B3KA 1JHZA 2BGWA 2HREA 4FZRA 2VL8A 4YRLA 1D1BA 5AHRA 4LZNA 4RELA 5B37A 1Z45A 1DAIA 2BBWA 1FRZA 2I1VB 4URYR 4OI1A 3VZBA 2C2KA 1PE0A 1HDIA 1RKBA 1TQHA 4BL0B 4QUIA 3WGVA 4WW0A 4BKQA 1YE8A 4OUDA 5AI6A 2VJDA 1I2DA 1KZ4A 3QUSA 1CJCA 3OAAD 1EM8B 1NP3A 3U4CA 4CV0A 2IE8A 1VB5A 1FP4B 3BC1A 1EFCA 1DAHA 4BZXA 3F74A 1Y7LA 3PL1A 1Z6QA 4CL3A 2BRUA 4BE7B 4Y2VA 2PUDA 2QTBA 3ICWA 5BNTA 4LSWA 4MS1B 1BAPA 1KZ6A 3WLJA 2H8RA 4IZHA 3TW6A 4M1SA 4IXTA 3CW8X 4UBKA 2WY8Q 2ZJ4A 1J25A 2ZB4A 3R20A 4O2BB 2OK7A 4HUTA 2FPWA 2OC4A 3QKUA 1STOA 1K63A 2V1XA 1JU9A 4N3GA 3U4GA 4RDUA 1GTMA 3MAGA 1FTNA 3NTRA 2ESHA 3ZWQA 2VAMA 3NHAA 1Q1QA 6GPBA 4CF3A 3DWEX 4KQXA 5KK1A 4WBSA 2Z30A 5LP6C 3IHWA 1VDMA 3IPAA 5EZYF 2EINH 4NBKA 1YBAA 1T4GA 5M3MJ 3NI2A 5DCMA 2O50A 4E6PA 3P2YA 1ZA2A 1BXKA 2ZU6A 2Q2OA 9LDTA 1TYEB 4HQEA 2ELKA 3PX2A 2YBEA 4P4TA 4MQEA 1XU9A 1R23A 3O1HB 4FILA 4HXYA 3UKJA 3ZMDA 2XUQA 1N36B 4F7WA 3JD3A 3C1AA 4ZVLA 3ZQ6A 3FOZA 4BVKA 4JJEA 3CX8A 1QMPA 4TS9A 4DUGD 1VHJA 4M55A 4F3YA 1II8A 3RKYA 1ZPDA 3PUZA 4BUZA 3WZLA 3L06A 2C9OA 4AUEA 4M0DA 2NVTJ 2W6OA 3C3AA 1YZLA 4DCOA 2R47A 3GPBA 4IIJA 2YFHA 3ILVA 1XNGA 3E5RA 5CH8A 4A3JJ 1VG0B 4MYDA 3O92A 4YI3A 1QH1A 2WSIA 1VXOA 4Y1FA 5JQWA 1HTTA 2PD3A 5L95A 1F4VA 4EVRA 5DP2A 3HSSA 4XWWA 1DJPA 4D97A 3S55A 2NVUB 2HYDA 3VKGA 4OP1A 3GOHA 1KFEB 4N65A 4Y6PA 4NPHA 4R6XA 4RZSA 3AG2H 2ZS9A 4WZAB 5IBRA 4QIWN 2XF6A 1CP3A 2HQAA 4ITUA 3B9QA 4QSHA 5AHOA 4M99A 3LFHA 1BH6A 1PNOA 3FUTA 3IFSA 2G3YA 3SQWA 3CUTA 2OXIA 3X2EA 4H0CA 1K92A 2KQRA 1YKFA 4G0MA 4ZCMA 2NS0A 4A6DA 2YWBA 1R4MB 2I4MA 2QU8A 2RMKA 4DNCA 4BFZA 3R9WA 4YP5A 2BISA 3BB3A 3RUHA 4F7DA 1YR9A 2JLRA 3EZXA 1V3QE 1E9AA 5ITZB 3G2KA 1U1IA 2BF7A 3HOTA 1VRVA 5TNXA 2Z2YA 4YMLA 1N1GA 1VSQA 2G9NA 3A1YA 1EHCA 4M73A 1Z4QA 4HUQA 1J0AA 3EQ9A 3E6AA 4EHKA 1UHSA 4R40A 2H1LA 4HGZA 5C7IO 5HE9A 4DR3B 3DHWC 3EZLA 4M88A 3STUA 3Q6IA 1G4AE 3P9NA 1YJCA 1KQFA 1WVRA 4UTPA 5KZMB 2XRYA 1FMLA 4FIZA 2JASA 1F4LA 1DIGA 4W9NA 4CQMA 3BTCA 5I9TA 4HA8A 1Y4SA 1GZDA 3D6MA 3EMKA 4YMIA 4CM3A 1AXRA 3IEPA 2YV3A 2YXDA 2M87A 3VODA 4W9MC 2NXNA 3MT8A 2H1HA 1C7FA 1RM0A 4CWAA 3O4VA 1M6VB 4FBGA 5GM2A 1S3FA 3B82A 2GPSA 2GD6A 1I7LA 3CT6A 2GWHA 4UUNA 2I4NA 3NORA 4YJ3B 5I7EA 5JS8A 1APBA 2D1FA 4HB4A 3OJXA 4RORA 1AD2A 3X1DA 3U21A 4P6VF 1DFHA 2BY1A 3SOPA 3VOTA 1F36A 3AF5A 5LQAA 1YACA 1NQWA 3ZNNA 1FUEA 1R88A 1CUXA 1GR0A 1SCNE 4I1RA 4UXIA 4RC9A 1Z0ZA 2YU3A 3EC2A 4H1UA 4P08A 4O25A 1OV6A 3ESDA 1D4OA 3RSOA 4EKYA 3ABKH 4IJWA 1H6AA 1RXEA 3MT9A 3CNOA 1ABEA 5C3UA 2EX1A 5DLQC 4QPOA 3I5UA 1KI4A 4WY5A 4PM4A 1YDMA 3LSPA 3NM6B 1Q95A 4BP8A 3RJPA 4G84A 4OV6B 4BFWA 4OIRF 3PT5A 1PGPA 4UU8A 1KORA 2H9AA 1D1AA 3L0PA 4NDAA 3L8DA 3MCUA 3ERMA 5I9BA 4CTKA 1NP6A 5H6QA 2WE8A 2P40A 2G5CA 3OWTA 1O1YA 3RVLA 1X1SA 3PGJA 2YJTD 2NTNA 4RABA 1GRCA 3ILHA 3GZNB 2A3SA 3F5DA 3C6XA 2H4ZA 1IGNA 3TK1A 4ES6A 3FPGA 2GFQA 1P1RA 2G06A 1F8YA 5EJ5A 1G6OA 4DM7A 1JDJA 1LKXA 5E8GA 2W6NA 4CNBA 5LYJA 1WABA 2XTZA 2HRCA 3ZLTA 1QK4A 3S1SA 2H54A 1KIMA 2KBFA 2GAUA 2ZTLA 2FCAA 4I02A 2ZJFA 2PX0A 3ONWA 4P7FA 3NDBB 4I8IA 5DHPA 1DHRA 1M34B 1JJ6C 5ALXA 1C0EA 3HO8A 1LLFA 4DQXA 4V1CI 1J1UA 1RHMA 3N2GA 4B3FX 1RD4A 5DGTA 2C9YA 2WF8A 3G9QA 3VISA 1Z6XA 1B6GA 4QQ8A 4K81B 5I47A 4DPMA 5GAJA 4GOMD 4M1QA 3ESBA 3X0DA 5B1DA 1PR1A 1XTUA 3MUEA 1SANA 4KJZA 1P81A 2Z6QA 4PK4A 4HX5A 2DTXA 2VHCA 1CF9A 2XOEA 5LZ4A 1ATIA 1WSAA 2HBZA 1KH1A 1TT7A 4FS3A 1J2RA 2XWJI 4PFJA 1LV8A 3R7LA 3ZPXA 3KQNA 3UMJA 4L1KA 3GCXA 1ODIA 3SJCA 2JFUA 3ROFA 3LDUA 5BWNA 2ZB2A 4ZVQA 3U60B 1U9JA 2DBRA 3FHJA 1EWYA 3FTQA 1AQJA 4HDAA 3OJCA 4JC8A 2QPTA 3CZMA 3OX2A 1OFGA 3VR6H 5TT1A 1R7RA 3CBQA 1Z68A 5LDHA 2O3RA 2XQIA 4QA9A 4U4AA 3NP9A 5ES4B 1I5EA 2Q7OE 3KCCA 3NT2A 1HT2E 4M71A 2GHRA 1M67A 6CHYA 1M2GA 3FGNA 1BA3A 1UAYA 4J75A 2KL4A 5DGCA 1YMVA 2V7GA 4C2AA 4DMRA 3GUVA 1GADO 3NJ8A 1T8IA 4B3BA 3FX2A 4OOEA 4BDSA 5J47A 2FUKA 4R5HA 2EZ9A 1G6NA 1IBLB 3JAWB 4JT8A 3TWOA 1DB3A 2HRBA 2FDXA 1L4EA 1U1DA 2QZJA 3VPFA 4AO8A 4B3TB 5FBHA 1XJQA 1ZMBA 1E5XA 1YJ8A 4ND3A 1FX1A 3L0ZA 1S2GA 2YKGA 3BH0A 4YR9A 4O4IA 5BSWA 4RLQA 3CUVA 3HUGB 4M3BA 1G4HA 2J5PA 2KLHA 5FWXA 5SZHB 5IT9A 3NYWA 1AWCA 1XWWA 3QOWA 3SZMA 4BZWA 4RACA 3UJBA 2A1UB 1BFUA 4XN0A 1MRZA 1KU7A 4A27A 2PKEA 2NZ2A 3GZ5A 4XUGB 2PKWA 4EKEA 1V45E 1B73A 2NTVA 4QQNA 1WZEA 1RWVA 3HOSA 4UUOA 4AJLA 1PG2A 1KJ8A 4WCVA 4NENB 3MTEA 5LWHA 4WCFA 4X8LA 1CUUA 2F5DA 3FWPA 3IP7A 1E8DA 3KL4A 1SCKA 3OE5A 1KI3A 5CEFA 4IEFB 1HFEL 1H0MA 3F6YA 2C8VA 2V7VA 1TCAA 4Y4RA 1E3LA 4RD1A 5KBYA 1JB9A 4KZPA 1QVAA 1U8ZA 3P2KA 3A05A 2RI1A 3LLCA 4BO7A 1AKUA 4IF6A 3RKQA 1ETOA 1ZUNA 3RNLA 4AD9A 4BFTA 2QN2A 5DBOA 3HWRA 3WO0A 5FRMA 3GW8A 6YASA 2GOXB 5KREA 2OOSA 3KYDB 2FV8A 4AAYA 1JAIA 4EG3A 3O95A 3U49A 1V25A 3T3DA 1P8JA 3QKRA 3HA3A 2A0FA 3D3NA 4AKHA 2XSZA 1AKHB 4YV1A 1A9YA 4E6KG 3NOVA 4JOSA 2JLQA 4OYHA 3ACCA 3HFSA 5LB2A 3KZYA 4Z0PA 3PIDA 3GELA 1WAMA 1H89C 3N6VA 3AERA 4A3KJ 4K9OA 2PX6A 4NF2A 3U7JA 2YV1A 4ZCRA 2PT9A 1ZD2P 1MX3A 2WWYA 3D43A 5D3KA 2IU0A 2FQYA 1FYVA 1P4SA 4M9CA 2CEAA 2JI7A 1DKQA 2JHPA 2YTZA 2BV3A 3R60A 2REQB 4IBOA 4XKJA 5BQOA 3BWVA 1U7DA 1JEOA 2PLRA 4UHEA 3HIFA 4UUSA 3NUGA 2A07F 3VSKA 3IQXA 4C5CA 3U1VA 2V79A 1Z4OA 3FYHA 3L9FA 3RUDA 2R62A 2VXBA 4WJKB 5FLEX 2C0CA 2QE7A 4TZTA 1YRAA 5TPWA 2FNAA 5JISA 3F1KA 4P4SA 3W79A 1Z0IA 2Q2VA 3CH4B 5TR9A 2E7XA 2PO7A 3WB1A 4DLZA 3TZEA 4WNYA 5DW0A 1YRNB 1C2YA 2VT3A 1QIEA 3C97A 4LWZA 1H9GA 5H20A 5CX1B 4E2FA 3LK7A 3MRSA 3HUEA 4NCIA 2DPMA 3GRYA 4YT5A 4X00A 3I0MA 4IHJB 2X0LA 1XMIA 4JLVA 1JHYA 2ZRQA 3KV3O 1L6RA 3IH3A 3PYLA 2NXJA 4ZOLB 1HURA 4A3DJ 1X8XA 2EQAA 3K30A 4HAOA 4ZCQA 3VXKA 1FW6A 5DTDA 2W37A 2Y27A 3H9CA 3JAMA 1A95A 2B82A 3R8CA 3K1YA 3RROA 3SZLA 4WBNA 1PJZA 2UYQA 1TC2A 5DWQA 3W5UA 4C21A 4O5OA 1PGJA 1Z7UA 5JALA 2IFTA 1YIOA 2OXTA 3E3OA 2D2XA 4S1OA 2N47A 4ZZ2A 1RPNA 2VHEA 1PWYE 4EG7A 3PRHA 1MH4A 3DBLB 2X8AA 4C14A 4QJ3A 1CHDA 3KU1A 3BRWA 2YRFA 2JF0A 3VPCA 4JBXA 2X5OA 5DLEA 2RH8A 4GX1A 3ZGXA 2MLGA 3NANA 4US1R 3N87A 3FB4A 5D00A 1E69A 2DPGA 1E2BA 1B2LA 1C3EA 4R2IA 2G5GX 1DWQA 2I2BA 5CQEA 2ZSIB 1NV9A 4WFQA 1Y42X 1QGAA 4OBEA 4ZVOA 5J2UA 1ISSA 1BVUA 5E20A 1RYEA 3KJHA 2A1TS 3AVTA 3C15C 4YMWA 4AU7A 1SUIA 4DQKA 4CKXA 1WXHA 5J1UA 3AESB 3ZOKA 2CNKA 2A0KA 4ZRMA 3L8EA 1TJPB 3EK2A 1TP4A 4M8NE 5EUMA 2QTLA 4DDMA 5TLSA 3M34A 4MQBA 3ZWKA 4M60A 4DMGA 3SXUA 2P6TA 2JCVA 5TS3A 1QYCA 3AFIA 4NMWA 3DEUA 5BQFA 1B6RA 3ADKA 2LBFB 3THYA 4DYQA 2W2KA 1KJJA 3CRRA 1C9MA 1YR2A 3CLRC 4G94A 1ZK1A 2HNHA 3VHQA 3RJTA 3SZPA 2OSVA 3JZFA 1BROA 2O2ZA 4GEKA 2YJGA 2PU5A 2X19A 5BN3A 1FEXA 3GPIA 2IBDA 4L0QA 1P7CA 3ISVA 3NTQA 3VYRB 3OL3A 4IDPA 3ICQB 1RR6A 2OF7A 2WFAA 4MX8A 4BCDA 3HJAA 1KQ8A 2JAHA 4GGOA 4LEIA 5EIOA 2C8JA 1B8PA 1Y6RA 2YC4C 2ECBA 1QFXA 2GFIA 3FFBA 3L7WA 2QI9C 4DXAA 1ISJA 1GTSA 4FZ3A 2DMRA 5KYWA 3IT3A 3MLAA 1O97C 2GJ9A 3F3MA 5M29A 3BH7A 5T4BA 4V3CA 1MRNA 3HDTA 2QUZA 3R8XA 2NXEA 4XCQA 4XR9A 3R4VA 1G8GA 3DVAB 4HAIA 1DUSA 3IO5A 4NEHB 1TU0A 2AOUA 3T9CA 1RZ4A 1CSEE 3HUFA 2D2IA 4AF8A 3TP3A 4U2BA 5CK5A 3GVAA 5AW7A 2QLFA 3I5YA 2K87A 2ATVA 4X66B 1CR2A 1Q44A 3ST7A 4BQPA 3EQ2A 5J4YA 1MB2A 1YSCA 2QVOA 5KWEA 5HKBA 4L15A 3MLBA 3LCUA 1JFFB 1DO0A 2V65A 2EJTA 1EWQA 1CLEA 3K9FC 1CLUA 2GYWA 3H5VA 3VH3A 3H2JA 3L6RA 3ZHSA 2BVLA 1R8JA 3K4CA 5KS2A 3TLJA 4ZEMA 2W93A 4L8WB 5AICA 5J3JA 2OCBA 1SG9A 3HKCB 2CSUA 3S7ZA 3AY3A 1FP7A 4I3FA 2WA0A 4OP2A 2OO7A 1X2EA 3WHLA 2GXAA 3Q3SA 2IZ7A 3GNTA 5HTOA 5TJ9A 1Z29A 4WERA 4E30A 3AIMA 4ESBA 5FFXA 2H8GA 4FHDA 4Y9RA 3AO0B 2H92A 5CB4A 2INGX 2G70A 2JIOA 4LN1A 4C04A 2QX7A 2VLAA 3S68A 4CIDA 4HATA 4G0XA 2HBYA 3FFXA 2MHCA 5DULA 1VQOI 3AP2A 2R7ZJ 3YASA 4F4FA 4Q1BA 3AJEA 1WZNA 1GDHA 3G5AA 5AHKA 1GPKA 5HS7A 1ZIPA 3MB8A 4PAMA 3PDUA 4YCCA 4WF2A 1XTTA 5BV1A 1PYDA 1MMGA 3HB7A 2G80A 3RWMB 3RIXA 7ADHA 1GZ7A 3JQGA 1FDIA 2LWIA 1LS6A 1KMHA 1E3QA 2YCBA 4X0EA 2BUAA 2P11A 4M8KA 3SKYA 3VZRA 1A7UA 3BGOS 4CXFA 5L51A 5FYQA 3WK4A 8OHMA 3GEZA 1I1NA 5EXDA 1MABA 1ULBA 1G21A 2JIBA 2COUA 2RHTA 1KEUA 1OR7C 3ROPA 2M8EA 2E71A 5IF3A 2FOXA 3F6BX 4OKSA 3LHDA 4HWSA 3G1LA 1BW9A 1KYTA 1E6CA 3DOFA 3O8QA 4LHSA 2BM0A 3MYYA 1VFPA 4K3UA 2QZ9A 3PUBA 1E7YA 3HEAA 4YMHA 1EMDA 4MROA 3WTYC 4A3EJ 1HLPA 1DCFA 3TAXA 5EL0A 2KE5A 3VU9A 4CLXA 2QRUA 3OIOA 4E15A 2QOEA 3RGWS 1Z25A 3CCJI 3ETDA 4MPJA 3KTAA 2HDNB 1GPAA 2FE1A 4PIPA 5MFZA 3K31A 2NVXJ 4OINF 4URVR 1KI6A 1V0JA 5DM4A 4PAQA 2XXAB 3JR3A 4CCNA 1V1RB 2PZFA 3FVRA 3ED1A 3R23A 2QTRA 3DEWA 3T7RA 2BSQA 1MW9X 4XD7A 1TW3A 5JFRA 3Q9LA 2FBHA 3W78A 4XYLA 2IDZA 1KO1A 4KR7A 4KUEA 3BA1A 1OU4A 2ZDHA 4RLSA 3AR7A 4LRWA 1N2CA 4D9GA 2G71A 2GPTA 5LMZA 3GF2A 5E3MA 4H9GA 4W7SA 5TT0A 1Z16A 1QOQB 4WNIA 1K0FA 1TQMA 1HCRA 3AGPA 3AMVA 4JR1A 1T36A 2EG9A 5JNLA 3EYWA 4LY9A 2O7QA 3FVVA 3ZWYA 4B6JA 1RQXA 2MWMA 1GGMA 4CQLA 5IN5A 1KQ3A 3V1LA 5IYBJ 2QD3A 2QIPA 2IIVA 3ZHOA 5IP6A 5AVZA 2IA1A 2WJZB 1V8ZA 3OIPA 4QEZA 4NEQA 4KI0A 3RFFA 3N59A 1A3CA 1QF7A 3KRTA 1ZRFA 4N40A 2IYAA 2B4RO 2M9MA 3OCCA 4O08A 3FSJX 2KIQA 4D8UA 4XYMA 2QP4A 3FAKA 4MP3A 4MW0A 4DSAA 1H2RS 5H68A 1P9LA 3TSYA 3QELB 1MJBA 1P2FA 3CNQS 1IY2A 3P26A 1PL6A 4BE0A 4BKUA 4YAFA 2I54A 4R0NA 4P0PB 5ILOA 4EJSC 3OLZA 5M3BA 3SC6A 2I6FA 3KC2A 4GSKA 2Q0QA 4BLUA 4IHSA 4KIBA 3D0KA 5BNWA 3VMFA 1W36D 2ZYDA 4E3ZA 4LK0F 3RAFC 3BTUA 3NT4A 2PUHA 5A4FS 1P92A 1Z2NX 2G6TA 3LT4A 1O7FA 3AW8A 4PW0A 2F6RA 3A3NA 1KI8A 2OSBA 3D1JA 4WOCA 1YS1X 2OOKA 1CUIA 3S2GA 3S99A 1DDIA 5EYRA 2CNBA 3PIRA 2QUBA 3PFHA 2EA4A 5IARA 5CIQA 1CFJA 1WSWA 4KNWA 1AMNA 4JBGA 1KGSA 1RYDA 4MGYR 2EPFA 1XQWA 1AH2A 4OBXA 1SKQA 2TCTA 3LPNA 4U2FA 3ZU6A 1T6NA 3IAXA 1PHPA 2ZT5A 4FOSA 2RDPA 5CBPB 4LYFA 2RK4A 3U1DA 4X3CA 3NNSA 1VCMA 1VHLA 1BHO1 4NCJA 5JI2E 3WIUA 4KX3A 4LBYA 3B12A 3SJBA 2H0RA 3PUKA 4CT4B 4R1HA 2HIHA 2WSSA 3UA4A 3R5JA 5HDGA 3G8DA 2CFXA 4R6WA 2HJGA 2LK2A 1IZ7A 1D3YA 1E2IA 2YIDA 3M6XA 4BJHB 4D43A 4Z86A 2LD5A 4PSDA 2F4IA 4MMYB 2QPAA 2YWFA 1MAUA 2BXZA 2PY6A 1SELA 4F5EA 3NM5A 4E7OA 4UPDA 1T3ZA 2QN9A 2D7DA 2H1OA 1ZN2A 1D0VA 4B71A 2V6JA 4YRKA 2BFCB 3LRPA 2OAEA 4P5PA 2PWPA 4DLKA 1RIOH 3IXQA 4DIOA 3KUDA 4V02A 4ZV4A 5IXJA 1ZRSA 2FN4A 1X7XA 3IUEA 4C4XA 3E35A 4RS3A 4U5QA 4MEAA 2BRUC 3D4NA 2PUGA 3S1AA 2WYWA 4CKBB 4GCVA 1Q16A 3IV5A 1A2QA 3RB8A 1T5BA 3ZW7A 3O9MA 2FEPA 2KW5A 4MB0A 1QBGA 2FMFA 2PL3A 1DU4A 2P75A 2FG5A 4OGGA 1ACLA 2X1VA 1K3FA 4F46A 4OHCA 4MW1A 4U2EA 4JJAA 3QKWA 1OSNA 1VBFA 2J33A 4F5DA 1FOXA 4PGHA 3NONA 1USWA 4AKGA 3AIOA 3AB7A 2VONA 1KA8A 2QSUA 4TWAA 5CAEB 3WTSC 4I9FA 2BLNA 2H31A 2VJKA 2AOWA 1C30A 1WXWA 1VLQA 2FEWB 5CVVA 3JQAA 6ABPA 1SAYA 4EO7A 2G0EA 2KRFA 1IZ8A 1OT5A 1HH4A 4CM6A 4JLBA 2F55A 3QLUA 2V03A 1ESEA 4OM7A 2DA7A 3HU3A 1ZVKA 4D4MA 4LC9A 3GFGA 3I04M 3QOFA 1L5OA 5DCFA 2NV6A 4HXFB 4LZPA 3LIIA 1DJMA 2GZMA 2Q0OA 2R751 5HS4A 1TK3A 4Y17A 3MRXA 1EX7A 3ZLUA 1KY3A 3REGA 4DLVA 2C8KA 4S24A 5JE8A 2IXEA 4ZQFA 2PKYX 3Q9VA 5IZ4A 3H8JA 4R7TA 2CHEA 2XCLA 3IDAA 5BSTA 2VOJA 2NUTA 1T0HB 3TQIA 1T4MA 2GZSA 2Z2SB 5HHTA 4EYQA 1RYBA 4TS1A 3MQ4A 2BEJA 4LYEA 1M8FA 1PUIA 5K5RA 4YJHA 2JFZA 1XCLA 3EPPA 3H2HA 3D3WA 4A69C 2JCSA 3CYFA 3TTYA 4FB5A 3FXUA 1H1LA 3GEHA 2CXNA 4B3XA 1WY5A 2HDDA 4KAXA 2FPPA 5DOVA 3AFGA 2GNOA 4QFDA 1WJGA 2R1UA 4WD3A 1K27A 2D1RA 1O96B 4AN4A 1I3OA 4P0QB 2Y48A 4KGXA 1VMEA 4N0BA 1KYQA 2FCRA 2QY6A 1BW5A 4YHHB 4V0MA 3TOAA 1N5IA 4RTQA 4DEXA 4YCJA 2HW8A 1B7GO 3NMUF 2QU7A 1VPLA 4O4HB 1IHUA 2WTBA 2I8AA 2ODAA 3QBJA 3G8YA 3FK6A 2OCGA 2PRZA 1GKIA 1MOQA 4CCJA 4J00A 2HT6A 3DXJF 3ZGKA 2ZITA 3VPSA 3TG2A 4EY7A 2HUPA 1I14A 5I7SA 4PG8A 4MAAA 3GLHB 1TAQA 4OJQA 2H2HA 4DCTA 1QE0A 1U5AA 3OMXA 3NAQA 1U7ZA 1CNMA 1P80A 4BGIA 1UXIA 3FXQA 3GLFE 2NSLA 3QKSB 4MNUA 1TPZA 4ZV7A 2J5KA 2GN0A 5HXAA 1P2SA 3G2PA 3P0EA 2OUKA 5JAOA 2PX3A 4Y2UA 1NVVR 3HSEA 2HQBA 2W4QA 4N9IA 3L77A 4TSFD 1BKSB 5AJZA 2E2IJ 2QD1A 4F60A 1FTQA 3ADCA 1H65A 2FFAA 4FYYA 5CXSA 1X2MA 3H4MA 4XDHA 2ZIXB 3JQFA 2XW6A 4LXHA 4LYDA 2X0NA 2VDPB 2QYOA 4W9NC 1JJAA 4MWSA 3JWGA 3WK6A 1I7PA 4BCBA 1KEPA 2JVIA 3LCRA 3OX4A 4HDCA 4RU1A 4F4IA 2XA9A 1WCXA 1B42A 2ZI6A 1G8KA 4OAPA 4MTCA 1M1YE 2PXCA 4QLBA 4F9FA 4R0MA 4LJSA 3W5VA 4MKRA 4AF6A 2B92A 3RASA 2QW8A 2II6A 1NMQA 1LFPA 4ESJA 2I6SA 4S1PA 3BIOA 1JGGA 1KQPA 3A4MA 1C9YA 1Z5UA 1DP7P 3ZY4A 1NTRA 2AKAB 1SU6A 4MRMB 4DRZA 3N70A 1KZ9A 4AUNA 3D3QA 3ESRA 3HDVA 4EGFA 2DR3A 2Q4EA 4QQFA 3IAAA 1YMUA 2MYPA 3D1NI 4BVHA 1AHIA 4LJ5A 3VAZA 3WGZA 1O0SA 2DHRA 4XTCS 4YRVA 3S8MA 4Q48A 2AFVA 4CCOA 3KBOA 1YCFA 3L40A 1QONA 3LWBA 5FWYA 5EMKA 3FDZA 3BBPA 3EE6A 4QXAA 4PLPA 5HJEA 3FF1A 3B1XA 1XK7A 1Q17A 1EFKA 3DEJA 3PRKE 5FWNA 3WRWA 5FT9A 1EWKA 1R9TJ 1PUJA 4JWTA 3WHCA 4D4HA 4X62B 4R05A 1PUFA 3H8SA 2HSDA 2EKLA 2GVDC 1OQAA 3LY5A 2XPWA 2GT1A 1NK3P 3N8DA 4IVQA 1Z0SA 2STWA 4QO7A 4PJJA 2ZOSA 2C5BA 2VC1A 1GKUB 2ZRIA 4PPFA 4DMHA 1B74A 2L7MP 5K3FA 5T5QA 2W6JD 1NLYA 3CPJB 2WKPA 4MVJP 5BT8A 5ICEA 4C0BA 2XB5A 2I2WA 3S17J 2Q1TA 2X15A 3J7YJ 1G42A 3H0GJ 5AM4A 3O7MA 1WVMA 1NUSA 3W6KB 4E7ZA 4BVBA 1KZYC 1G2QA 2G88A 2J0UB 3NHUA 5CW2A 3D54D 4EPXA 3STHA 5TQ0A 2HEGA 2F9MA 1FQOA 3PU6A 2FZ4A 4IO1A 1BE6A 3LDAA 4AMVA 3O9ZA 4RIEA 1MJGM 1R71A 2ID7A 3JWHA 2NVOA 4C1NA 1P4XA 2VXCA 4NK5A 4NYJQ 4CM8B 4MQ6A 3K35A 1RHRA 2ZE5A 3OPVA 4BNWA 4GMXA 5DTQA 1KZ1A 3NYIA 2X6WA 3EBPA 2I65A 3V48A 5KHAA 2NQ8A 3GD5A 1Y3HA 4QPDA 1Z74A 1WI9A 2C77A 1VQ6I 2DT7B 2M9HA 2R6GA 3ZCTA 4LX0A 1N6KA 4C0JA 3WG7H 4NPCA 3PTAA 5CW1A 1VQ5I 2J0SA 4GI7A 1YZ3A 4IO9F 3UK0A 3DM5A 1Z4LA 3GLIA 2QLTA 1SQ6A 1WSUA 4AWBA 3Q3VA 4DEYA 1R3DA 1J90A 2FJ1A 3CS3A 5HNKA 1CT9A 1GRRA 2Z8ZA 3ZDFA 2YMLA 1SXJE 1G5HA 3JRAA 4CV3A 5H2FC 4ZPXA 1ICEA 4X1YB 5F0HA 1C8KA 3LX6A 3GL9A 1XGSA 4G9BA 2Z5GA 2UXCB 2Q4RA 4OYYA 3EFHA 4C0QC 3TUJC 4ED9A 1R0WA 3KELA 4OL9A 4I01A 4BO3A 5B7QA 3OTIA 4RCYA 1NVKA 2Y1EA 4RJLA 1CUDA 1AX9A 4TUYF 5IDXA 3M1IA 4QU5A 4U2CA 2JFNA 1WNTA 1ZM2A 1XRQA 1QU3A 3S1MJ 1JIJA 4OXXA 3P9IA 4FFBB 2A9FA 4N03A 3CRMA 1RMQA 3MXTA 1ZK4A 1MJ9A 1A69A 2CFSA 2QD4A 1LFDB 1R5HA 3NBAA 2EHJA 1H4VB 4AJKA 2FZLA 5KVSA 3LRXA 3Q0WA 3QFSA 2WHRA 2IDKA 1RDFA 2IIBA 1T43A 2NS8A 3J81A 4MZXA 4J1QA 3FIJA 3K4MA 3AR4A 5E79C 5BP7A 1S2DA 1C1DA 3OYNA 3IALA 3PHBE 2GTHA 3L43A 2CLKB 1N2BA 4MULA 3RKUA 1E2NA 1FRNA 1SUPA 1YFKA 4GI3A 3I9KA 1BH2A 2ECQA 2CXOA 3GLGE 3OCWA 4MAFA 5IPFA 3INYA 3B3FA 4WCFC 1ANKA 2CMHA 1ZNYA 4DIEA 4CM9D 2P6SA 3I54A 4E22A 3A25A 5FBLB 4D45A 3C3XA 3Q9UA 2EIHA 2ENWA 2FPGA 1MIOB 3WLSA 4EYGA 1QB7A 3HXMA 1QYDA 2E48A 4CDMA 4YB8A 3OLVA 3PC2A 1ZRCA 4X24A 3HP7A 3IUQA 4J9UE 2JT1A 4EOGA 5DNEA 2YFQA 2CMDA 2Q5JA 1M33A 4M8SA 1X2NA 3GP5A 4REOA 3LL4A 4FLFA 3NC0C 1SBCA 3BMNB 1Y34E 4AQ7A 2XWBF 1X7ZA 4JJZA 1BC7C 4XVHA 5F9FA 4NHJA 5KYKA 2PUVA 3THSA 3KKEA 4X84A 1CY6A 1QIIA 4MKZA 3U0VA 1A8HA 4KVAA 5J4LA 2P6RA 2E87A 4IZIA 2SBTA 2ACEA 1T5TA 5CQGA 4L0MA 1KYXA 2QYTA 3HUDA 3CDIA 4JITA 4EUKA 2MLKA 2Z56A 3R41A 4KR3A 3D0QA 1EE2A 2KJCA 4L9WA 5B55A 2DCMA 4U2KA 4Q12A 3FCEA 5DM6F 2DYSH 3RYPA 3IKMB 3CE6A 1EV7A 3SYNA 1V7ZA 2HN9A 1YBVA 5ALOA 4MUIA 6Q21A 3IH2A 5DHFA 1M2OB 1QG2A 3T0FA 1D1CA 4KZKA 2YX7A 1P6XA 2Z2ZA 4RDIA 3V1MA 5FHQA 1JVSA 4F1JA 4ZJUA 2R5YA 1PGNA 1W87A 1DU0A 1LBSA 4AXBA 4WLOA 1R1DA 5LQNA 1VJ5A 3UZUA 2GF2A 5FOVA 4MLCA 1EUDA 3BD7A 1M0SA 1UXHA 4RF2A 2HA4A 1T1GA 2CHUA 4EL5A 3S4YA 4PU0A 2R8BA 5FBRB 3LPAA 3J81k 2JFYA 3OPXA 3NXSA 2ZSUA 3PFNA 1YASA 1XJCA 4B3GA 1MFPA 2L5QA 1YQWA 1PJBA 2O9JA 1PQPA 3E0XA 3GLUA 3T3EA 5GOZA 1PZEA 4KR0A 2WPNA 1CETA 3ZN2A 1NW4A 2DMQA 4FT8A 4DWJA 4GL4A 2ZE8A 3UKOA 2Y69H 1W0KA 4L78A 5CUQA 1WV1A 1FDUA 4YH1A 5TPZA 2FMLA 3A4TA 4WZBE 1AB6A 2B1GA 4JZYA 2QUHA 4RXMA 4BB0A 4BAGA 4N9HA 4IPTA 2G0TA 3Q9SA 5ELXA 3LBYA 5A2QZ 2Q5QA 3DPTA 4PR0A 3U6KA 3VPRA 3EAFA 3WLHA 1WMFA 4C2BA 2MU1A 1JSRA 4UCWA 3HZRA 2C1ZA 1MIJA 3QPAA 4P7BA 3AR5A 1W4LA 1FMFA 4YIKA 2FVXA 2GEFA 5KJ6A 2G25A 1DC6A 1AS0A 2H1VA 4O4LA 2IP2A 2XYQA 2A58A 3RC9A 3H2YA 4ND4A 1NJGA 1N0WA 4LJ7A 1PP4A 3LLUA 1T5OA 4KXWA 5FQOA 4GNRA 3HCBA 3S32A 2HGSA 4Q93A 1LB1B 4P81A 4KKXB 3DAOA 3AHCA 3NG1A 1X7YB 1NW7A 3B38A 1XNJA 1G3IA 1IXKA 1VI2A 1ZH2A 3RQ4A 4FKBA 1SKYE 1E2EA 3K1ZA 4Q9JA 1QORA 5AFSA 2C3UA 4EB8A 4HF1A 3QRFF 3GUHA 3ZDRA 1E7WA 1XEAA 1J0DA 2VBGA 2QTHA 2F3QA 4ZYXA 2HT1A 4RK1A 2QWWA 5C3EJ 4PY2A 1Q11A 1BCSB 4BX9A 2HJWA 1LVKA 1PVDA 4Z4QA 4QXPA 1AA7A 3JYQA 3ZP5A 1P5FA 4CF7A 2P3SA 2H4WA 2GBPA 3LY7A 3ZW9A 2EV6A 4U0VA 4G0OA 3ZIAD 1EIZA 3NTLA 1Y89A 3F97A 1QCYA 2KMLA 2W4MA 4OHKA 1ZJJA 2ARKA 1ZK2A 5CMLA 4CPDA 1TRHA 1YZUA 3SYTA 4FNOA 3WDKA 3F96A 1FOYA 1QZXA 2RCYA 4FIDA 3CUQB 3H2BA 1OFUA 4M86A 1GTVA 1EYZA 3QWAA 2KSQA 2CC2A 1U2DA 3FTCA 3G1OA 1SCQA 4L75A 5AKXA 1DDGA 4EW1A 1OF1A 3SZTA 3DE1X 5IRCD 2C29D 3CJRA 5C8YF 1J9IA 5L7YA 1XA4A 4M83A 2BP7B 1CJSA 3DQVC 5C5DA 4PPGA 2YC2C 1FNDA 2IDJA 3E7WA 3EGIA 4HLDA 1XMOB 3H3ZA 2Y2ZA 3IP4B 4Q9NA 2GUWA 5AK3A 4M21A 2I3BA 1I7NA 2V7EA 4KYVA 3BEOA 4JN6B 3I59B 4IHWA 3I09A 3S8YA 4XQFA 4K9NA 3FY4A 3WWZA 4HO1X 1XRSB 2DFKB 2VDRB 2IW1A 2YBDA 3A1WA 2WD7A 1HDXA 2QS9A 4HG2A 3MWEA 2A92A 1CF7B 2D1VA 3ZR8X 2M45A 1YJ5A 5ALGA 4I46A 3UT6A 1JVBA 1X3SA 3D0RA 3KTDA 2L0KA 1V26A 1PT5A 4LSMA 2BJHA 3MRTA 3OY9A 3TQHA 3NWBA 4KE6A 4AJIA 2CLFB 6PAXA 5J58A 3BQ9A 4S2EA 4YT8A 4KQEA 2VJYA 4Q4DA 4TTAA 2VDWB 2HF7A 3QVXA 1CC1S 2RQQA 2EVWX 3VR0A 4MV9A 4ALNA 1OWNA 4IPAA 1MV8A 4Q4HB 2O8BB 2ZBPA 1LH0A 1TKCA 1KU9A 3H42B 4R9UC 2P90A 4GYIA 1JZTA 3HKEA 5IY5H 4US0R 4NFYA 5CVCA 1XGKA 3Q8XB 1FRQA 3S5JA 1SK9A 3H1CA 1L4LA 3GTOJ 3V5NA 2F67A 3NC1C 3ECOA 4HDUA 4IV0A 4DNFA 3ZWVA 3LSRA 2QW1A 3JRHA 1GO2A 4GKBA 2MYSA 4E21A 1RM3A 1RKXA 3IAS6 4OQ4A 4GPBA 4UHTA 3AM1A 3MJFA 3DBHA 4HDRB 1QNTA 1KZHA 3RABA 2CMPA 1ZN7A 3L7NA 1CEYA 4HNAA 1WOYA 4WOPA 4WY2A 2CXPA 1Y9JA 3UQYS 3LYLA 2JGEA 3NFYA 2LREA 5EY5B 2GZWA 3B3JA 1T9KA 1JW9B 2ODTX 3WAJA 2JNWA 2J7PD 1Q7BA 4CDGA 1JQKA 1DIRA 3BQNB 3TLAA 3ABQB 1KC1A 2D5AA 5BR1A 2UVPA 3P71T 1LJ9A 4FCWA 1G4UR 4PTZA 1I3NA 5LHIA 4NAHA 5AVRA 4X8MA 3LDHA 4L5IA 1YB7A 2L02A 2CD9A 3FLBA 4EG8A 3IQEA 1RCTE 1BVYF 2J9FB 3DQQA 5BURA 2D2WA 2OHHA 3CH6A 5EP3A 4ZAWA 1ZLXA 3SHFA 3DFZA 3RJ5A 3WKDA 2DU8A 3EMBA 1ZOLA 4D0NA 1T5IA 2EKDA 2X8BA 3PLRA 2MINA 3DKKA 4UVCA 1K7AA 3H5RA 4LJZF 3HVRA 3L6OO 2R7XA 1MDMB 2NO4A 5LMUB 4PSUA 3IVMA 5TGDA 1OLXB 1ODDA 2ILTA 1E1CA 4MARA 3RYTC 1IW7F 1IBMB 1AQNA 3I1IA 3BL8A 1UC8A 1U5TB 1HDPA 1H9AA 4A92A 1UP7A 2YWCA 3BM5A 1CQTA 2ORYA 2JFHA 2QZ8A 2VRNA 5JXJA 5FAXA 2JFGA 4MKIA 5AW6A 3PXAA 1W4RA 4R2WA 2JIZA 3BXGA 1FSHA 2G9WA 4N5IX 1TDJA 2KM1A 2LGJA 2R5WA 4DOZA 4KL8S 3OKFA 5T6BA 2GVNA 2IKQA 2XCIA 3LECA 3R9KA 3ODPA 5H1YA 3BLYA 3CLVA 3BWCA 2R4UA 3CTMA 3H6KA 4FCTA 3GGDA 3BAFA 3H4IA 1P1FA 1OTHA 1ULZA 3ICEA 5JQGB 4U88A 1KQ0A 1QVVA 4ZMBA 3HRMA 3S15J 4UZFA 4LFBB 1LSOA 3HB1A 4KO4S 3T35A 3TIFA 1DC4A 4ZYWA 3TD9A 2W25A 4QDUA 2VSYA 4FSDA 1DS6A 1IN5A 1CULC 5ENDA 2Z9DA 5C5EA 3MZ8A 3OPYB 1X1EA 3B1VA 3BJZA 1A4UA 3EXFB 2IPOA 4MIMA 2WPDA 3BMOB 1BZYA 4YK7A 3EDCA 3E9YA 3GAZA 4MNTA 3KVYA 5MGNA 2K4JA 3IPXA 2ID3A 3HP1A 2GMWA 1SVOA 4GZLA 1W96A 1GPDG 4X41A 2WQ6A 4D7MA 4P58A 1GZSA 4BKRA 5KX5B 4IMPA 2BGTA 2R1ZA 1XTRA 3O4RA 4OJMX 3M7IA 3FNFA 1Z62A 1YQ9A 2H9YA 1J1IA 4IOJA 4E1BA 1YDHA 4WA7A 2WJGA 1UPXA 1XZHA 3UW1A 3WLTA 2Q4BA 2R4QA 4YAKA 3HMKA 2EBFX 3PL5A 3HBNA 4Y2YA 5J5VA 3ROEA 3AETA 2H1KA 4Q3CA 3RVKA 5B3LA 4QOEA 1WDMA 2R2AA 4RULA 1IEWA 3JCUC 5FV7A 2XNKA 5B2ZA 5ED4A 3HNOA 1IUYA 3AUXA 4RNDB 1DP4A 5L4LA 4U0WA 1QV9A 3AZQA 3NAZA 1QH9A 1ZLJA 2XH8A 1E66A 2GEKA 1TD9A 3FXJA 3Q3EA 5DBGA 4FFRA 3INGA 2Z2JA 1V11A 2OGZA 1E96A