4HYEA

Crystal structure of a response regulator spr1814 from streptococcus pneumoniae reveals unique interdomain contacts among narl family proteins
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
200
structure length
200
Chain Sequence
HMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the response regulator spr1814 from Streptococcus pneumoniae reveals unique interdomain contacts among NarL family proteins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription activator
molecule keywords Response regulator
total genus 83
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hyeA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hyeA01
3KP5A 2JPCA 3ZMZA 1MAVA 3LWFA 4ETIA 4BYYA 3MMNA 3EQLF 2ZNYA 4KK3A 1YS7A 1QGPA 3HVRA 1D2AA 2M1ZA 3U2RA 1DCFA 1BM9A 4FX4A 1DZ3A 1DJMA 3RI4A 1Z15A 2RNJA 4ETMA 4LJZF 4DNCA 2ZCWA 1YTYA 1J7KA 4RGRA 2L19A 3G1WA 1G3YA 1E2XA 4MR7A 2BEOA 2KIFA 1EV7A 1OPCA 3H6HA 3P9CA 3BJ6A 1R7JA 2V1DA 1M5TA 1B6AA 1IIBA 4OIQF 1ZH2A 3GA5A 4MS4B 5KC8A 4B8XA 2AXLA 1OMIA 4HLXA 4KN4X 3OQOA 1CEYA 3JAMZ 4UNOA 5TRDA 3H5TA 3FZVA 5ICEA 1SMYF 2F8SA 3HUUA 2ZJ2A 2MYUA 1M2FA 3R4KA 3ZMUA 3R0JA 2GX6A 4ZMSA 2OAZA 5IEJA 1MB3A 1ABFA 5L3CA 1XHEA 2MSKA 2EFWA 2A68F 4KRFA 5EWJA 3QU6A 2DW4A 3CHYA 4HF1A 4FX0A 3DEUA 4LLNA 2Z33A 2F5EA 5ICFA 3ZP5A 3TD9A 4G0MA 5DUIA 3M7GA 3L6UA 3CZ5A 3LA7A 2IP2A 3C18A 3G73A 1KRWA 4M9ZA 4XLNF 1HEYA 2B0LA 2PQ8A 5IT9Z 2PBIA 3P7NA 1AB6A 1Z2EA 2BGGA 3F21A 2RKHA 1C4WA 2WWYA 2LUOA 4KIGA 1YG2A 4YGXB 2P4WA 4BAYA 2VONA 1PDNC 4RDCA 1TLHB 4KICA 3JVIA 4AIJA 1RI7A 3RIRA 2DTRA 4Y17A 4U7DA 4A12A 2M98A 2K86A 1KQ8A 3LA3A 1S7AA 1EWVA 2Z3YA 2FLWA 1FSEA 4PZ0A 1HQCA 1WWXA 2L3DA 5L3FA 3HYIA 3REOA 1XGNA 3HRTA 1O3RA 4XAQA 2PUAA 2ZMEA 1RXIA 1IAWA 4D6XA 4MQVA 3C3MA 5KQMA 4Q5SF 4RZSA 2JCGA 5ILSA 2HKXA 3B2NA 3TO9A 2HWVA 2GAUA 3SFZA 5I4CA 1DP7P 2WC2A 3E3VA 3T1BA 3VB2A 2JRLA 3RH0A 2VK2A 2VT2A 3J7AO 1LBIA 3FM3A 4L5JA 4HW0A 4FB4A 4LMYA 3OLYA 2RGVA 5HVQC 3KP7A 3KCNA 6ABPA 3C3KA 3E6DA 1ZITA 2KRFA 2JSCA 3LUDA 2IPLA 5IC5A 4ON0A 1XSXA 3BPVA 2ID7A 3HOSA 3EQZA 1YS6A 4O1HA 1HW5A 4A5MA 2HFHA 2QYOA 1PUEE 1Z26A 1DPUA 2EA4A 2QUFA 1JH9A 1WSUA 3F73A 2WRZA 2F5DA 2WJWA 2Q8KA 2PL1A 2HS5A 3GZ5A 4LK0F 4EM1A 2Y0MA 3DXJF 4JQFA 3U9GA 1G3TA 4Z4CA 3I5AA 1NATA 3FHZA 3OMWA 1PNRA 4F7ZA 2HDCA 3VFZA 5DV5A 1IN4A 1IXSB 2O3FA 3R60A 3GEZA 1W9HA 2QXYA 2DK8A 2GA1A 2FOKA 3TDUC 4I98B 1JDPA 4KMRA 2JB9A 4P98A 2ESHA 1XB4A 4G0ZA 1BC7C 4EY3A 1B4AA 5JNVA 4WXMA 1IXCA 5CVJA 1P4AA 4RAZA 2HEOA 2E7WA 1ONVA 4YCSA 4LZLA 3DPLC 3QLTA 3MM4A 3FMSA 3LAJA 4MQFB 3JPYA 1QMPA 3CJNA 3KSMA 3TB6A 3D8UA 3IRRA 3DGFC 1ZG3A 1FBQA 5LEJA 4L0YB 1ZGJA 3O6BB 1U2PA 2A9QA 2BBYA 1SXHA 3O2JA 1ODDA 3CG4A 2FXIA 5JFRA 4JB0A 3GL9A 5FD5A 3LUAA 1M2EA 1OXKB 2PG4A 4LE2A 2HJ9A 2FN8A 1CYEA 2NAZA 4G0PA 3IWZA 1WETA 2FMLA 4WZZA 3GFIA 3UKJA 2ETHA 1VPWA 2G9WA 3O2PE 2HGCA 2H3HA 6PAXA 2EB7A 4IRGA 2FMKA 5DCLA 3COAC 1TM2A 2PUDA 1L5YA 5BS6A 8ABPA 2Z9OA 5CNIA 3JS5A 3JPWA 3O21A 2OA4A 1BI2A 3GWZA 1BAPA 5E3JA 4EGYA 1V4RA 2NUBA 3VNAA 2CW0F 3WTVC 3Q41A 3UUGA 3FMRA 4HOBA 4OMZA 1YO5C 3CTPA 3H3ZA 3S99A 2NRAC 4M6XA 2WJAA 3BDDA 2CWDA 4UUVA 3TKYA 2X7XA 1ZY2A 3FMVA 2R3SA 1STZA 3KTOA 4Z4HA 2FF4A 2V6CA 1QNLA 1Z12A 4NQRA 5ICCA 1Z25A 1S3JA 1CHNA 4I2OA 4JASB 2MC3A 3H1FA 1SD7A 2IT0A 2A3SA 4LE1A 3E6CC 4AIKA 4LDAA 3T38A 3LMKA 1EWTA 1ABEA 3WTUC 3EUHA 3O2QB 1GXPA 4Q48A 4RGUA 4MHGA 3OOPA 2EV5A 3IL2A 1XDSA 1LVAA 4EGSA 3SXYA 1BJAA 2GA2A 2XAGA 3E97A 4LD5A 1E6LA 4MS1A 4RAYA 4O5VA 2RJOA 1XWWA 2P9HA 2JVKA 3HHGA 4MTDA 2OU2A 3NHMA 1Z6TA 3HV2A 4D0PA 1EAYA 1QZYA 4EJVA 1USKA 3O74A 5DYMA 4F3TA 1YYVA 3C3WA 5L3DA 3U1DA 3K0LA 1ZDMA 3UK0A 3R0AA 1WRJA 2MD5A 3ML6A 4G0YA 2QVOA 4P9FA 3TOBA 1FNNA 5F64A 2GQQA 2IVMA 1U0SY 5CHYA 2JZYA 3MYYA 4IGAA 3SAJA 3H1EA 2CSOA 5FB2A 1P92A 2JTVA 1Z13A 3IKVA 2FEWB 5A2QK 1AOYA 3M9XA 3KKEA 1HKTA 4MAAA 4XXHA 3Q5FA 2L18A 3BJAA 4MGEA 3N0RA 2RDMA 3KE2A 3MZHA 3V7CA 1S7OA 4OMYA 2LPMA 1KYWA 1JDNA 4PICA 3EAFA 2YX4A 1BDHA 4GPAA 4HQEA 1FWZA 1GUDA 1FZPB 1IRGA 3HEBA 1B59A 1Z1DA 1SFUA 1YMVA 4HNQA 3QELA 5TQ0B 3QPTA 3E3MA 1DUXC 4LG0B 1C0EA 2M5WA 2PAFA 4N9IA 2EV0A 4EYOA 4ZH4F 4ETNA 1JHHA 4E7PA 4HYEA 4RK4A 1FFGA 4IRHA 4EJOA 3NRVA 2FBKA 2L02A 2ZBKA 4G0XA 2IKSA 3NNDA 4ZZLA 3CUOA 4N0BA 3RVQA 4P1ZA 3A3KA 1JX6A 5BRJA 1OYWA 2YSRA 2JVJA 2PUCA 3NBMA 3BRQA 3OLVA 3HRMA 3B73A 4RK6A 1OYIA 2XV4S 4ENJA 4IRXA 4M9SA 4I7HA 3D0SA 4RS8A 4LFUA 2OENG 3GLXA 1RPJA 1J75A 3GBPA 2GIVA 1FYMA 3CTAA 4KIBA 4S04A 1DBPA 4L9JA 2KIUA 4EYGA 1REPC 4TN5A 3CDHA 1ZG5A 3DLHA 4KNYA 2B1JA 4D6YA 1JF8A 1P6RA 2GZWA 2YPRA 3RKWA 5FFZA 3DZDA 1FX7A 3GBVA 4OTZA 3RTRA 4NICA 3OO0A 1FBUA 2F5CA 2QLZA 3L00A 4QYMA 2VBWA 5D8LB 2IPMA 2FNPA 3HDGA 2MLKA 1IN6A 3N8IA 3DFGA 3IRQA 2C6YA 3Q7TA 1QNTA 2GI4A 4RK1A 2FA5A 2PMUA 1YFHA 3TGNA 5CNKA 3GVAA 1SD5A 2JBAB 4ENKA 3H1GA 3CO7C 3I59A 1EWKA 3QOPA 3Q15C 1ISSA 4L4UA 3V8JA 5KQGA 2VUIB 5EWLA 4Q4ZF 1Z6RA 3HHHA 5DCMB 3NEUA 4H3KB 1CGPA 3DF8A 2DQLA 1UHMA 1BIBA 4G7ZF 3I59B 1HW1A 2P8TA 3DKWA 2MYPA 3WTZA 4F06A 5L3EA 1W5TA 1FP1D 2QU7A 3CUQA 3I09A 1G3WA 5H6QA 2BGCA 1SRRA 2Z99A 4DQ2A 3CZCA 1D8KA 3I53A 5FWXB 2O20A 4FHTA 4E7OA 2ZWMA 4IHSA 5CVUA 3NQOA 3GF2A 1A0OA 2N9UA 2EFOA 2PJUA 2IA1A 1I6XA 2CWEA 4WWCA 1D3YA 2PMHA 4NV3A 1FYLA 4WXEA 1U2WA 2HPHA 3O2SB 1P6QA 1K78B 3I64A 2LBPA 4EJTA 1XSVA 3MFKA 2IPNA 5DCFA 3KG2A 4RB1A 3QK7A 2E7XA 3OLXA 1NXTA 2VODA 1XGSA 1HBXG 2W25A 3MQ4A 1I1SA 1W4MA 4YR7A 1KU7A 1QPZA 1LJUA 4OATA 4NB5A 3ERED 1IUYA 1EFAA 2L2QA 1VLZA 4KDPA 2A69F 4WXDA 3F8MA 2HQOA 1PP8F 4ML3A 2L01A 4I0AA 4W5TA 2V1XA 1XN7A 4XARA 4GYIA 2YR2A 4EVRA 5EWMA 2CHFA 1JFVA 4Y9TA 4MEYF 1PNTA 3GYHX 3I0TA 2WB4A 4F8JA 1GLGA 4MLCA 1ZGAA 4Q6WA 3RVNA 4L18B 3OM0A 2Y48A 3MAJA 1QQBA 4CO8A 2W57A 3FM5A 3FFWA 2FEZA 2OQRA 4KT5C 4ZYEA 4CBVA 3G85A 3MCZA 5FFXA 1FSHA 3MEXA 4FE7A 2MSWA 1EHCA 3CUQB 3CKMA 4I02A 3HUTA 3ECHA 3LKVA 3DP7A 3JSOA 4OBBA 4MTEA 3DGEC 3QLVA 1YMUA 3O1IC 2P5VA 3F22A 1P2FA 3SNKA 1Z9CA 1HW2A 1E6KA 1G6NA 4OG2A 4PDKA 2EA2A 1IXRC 3WTTC 3FXQA 3G3ZA 2RJNA 4U88A 4G97A 4N0QA 3M1EA 4HV5A 2QV0A 4RKQA 5BQ3A 4HNSA 3QEMA 1W5SA 4KA4A 2QM3A 2EK5A 1LQ1A 3LKBA 1K66A 2RV8A 3CNBA 1HKSA 1HSJA 4Z4FA 3T8TA 1U6GA 2Q5CA 4UHJA 2QVGA 4ETSA 4LB6B 1I1GA 3EETA 3WG9A 4RXMA 3RVMA 2E1NA 5CVVA 4M72A 1DDNA 1DRJA 3T0YA 1XSDA 2MLGA 2YU3A 5HS8A 3I5UA 3F6VA 5DEQA 2GKGA 4YIIA 1C0WA 1URPA 2H27A 4NCAA 5TPWB 5KQPA 3WTXC 1PEYA 1O3QA 4U0VA 1J9IA 3F6CA 3T8RA 1J59A 1R36A 1BC8C 1BDIA 3P9YA 4YWHA 3A10A 3IPCA 2P7VB 4ESJA 3E5QA 1K6OA 5E1WA 3SM9A 1R23A 2RQPA 2ACJA 5J8FA 1W7PA 5IEBA 3LUJA 1Y0UA 5DTEA 3TOAA 1R8JA 3ILYA 1MB0A 1I5ZA 3JW4A 2H94A 4MPTA 5T7BA 3QPHA 2VT3A 1IN7A 1T38A 1NY5A 2TDXA 4UXNA 4G7OF 4HF2A 1JL3A 5EEGA 1LDJA 4NCBA 1FBSA 1J56A 2QQ9A 2JT1A 3D02A 3QLUC 2XAFA 1R5HA 5FBKA 3FFTA 3GRCA 5KC9A 3WTSC 4ENNA 1F51E 4OIRF 3SZPA 1U5TC 3ZMDA 4O1IA 2VE8A 4GXOA 1T98A 3O75A 1JXSA 1D8JA 2QW1A 2ELHA 3J81Z 4KVFA 2XVCA 9ABPA 2XDYA 5KWSA 2GXGA 1R5GA 5K1YA 1P4XA 4RU1A 2PN6A 5HDKA 2EFPA 2XHKA 3GYBA 2BV6A 1SXGA 3LAPA 5DCMA 3SQNA 2G7HA 3ULQB 2H09A 1ZVVA 3KZZA 4EJUA 1QBJA 1SXIA 4XBFA 5HS9A 1U5TB 2K4JA 2W85A 4G0OA 2FSPA 5H20A 4IRIA 5JHUA 4OOIA 1DG9A 3IDOA 4H60A 5JNRA 2VOOA 5ICGA 1YW7A 4Q6BA 5LHIA 4KN7X 1MDMA 4L5IA 3HRSA 4PYRA 2E4WA 5BMZA 4LE0A 2O8XA 1YTUA 1GCGA 2Z5UA 2VC1A 4N76A 3LQQA 4RGXA 1O3SA 4M74A 4HF0A 1ON2A 5AONA 1Z91A 2FN9A 1LK0A 3OMXA 1ZH5A 5BQTA 2FU4A 3WGGA 3H6GA 5J6XA 2ZAYA 1P6UA 4D74A 3MA0A 4W5QA 5FWXA 5GQSA 3CG0A 2HYGD 3HZHA 2ISYA 3N0WA 4KREA 4CDGA 4R1HA 4P9UA 2OZ6A 2IDMA 1VRVA 1B1BA 4MEXF 3T6KA 3WTYC 4XLPF 2M8EA 2O03A 3EGCA 2E4ZA 2DI3A 4EYQA 1E17A 3C97A 1XCVA 4G8XA 5FGMA 3E6BA 5TPZA 2F8TA 2XAJA 3N4MA 2FEPA 4ZPJA 3LSTA 3E61A 4KZKA 5HLGA 3ZMVA 4ESFA 1ZGZA 3K2ZA 2YX7A 3EJWA 2IOYA 4RXUA 4L9NA 4K2EA 5LHGA 3KP6A 1TNTA 1FPQA 4ENMA 4IHTA 4IMJB 5FWYA 5D8KB 1CF7A 2K27A 2LKPA 3L9FA 3BBLA 3MWMA 4H3HB 5BR1A 5ILVA 3T5XA 3LA2A 5LRRA 4JK1X 1XGOA 5BOXA 4ZJPA 2HQRA 4YP9A 3C6QA 5E1ZB 3KEOA 3RVRA 1IN8A 3TO6A 1TLFA 4TMYA 1XD7A 4DN6A 3V7SA 4O6JA 2CD7A 5LGUA 4BNCA 1O7LA 3EDCA 3PFIA 2K4BA 2PFBA 2ZNZA 1WI9A 3CLOA 5TPZD 1W25A 1MDMB 2STWA 2ZO4A 4RK7A 3RYRA 3HM9A 2PJPA 3SZTA 4WUTA 5JNUA 4AIHA 1U5TA 1YW8A 1ZRDA 1P8AA 3BY6A 4HAMA 3K1PA 4EM0B 4Z4IA 4MQFA 1R1UA 2CYYA 2HZTA 3P9IA 1S8NA 4LGWA 2V1UA 2NS0A 4R8HA 2CO5A 1JGSA 3MIZA 1IZ1A 4PEVA 1KMIY 4L85A 4HDVA 4QWQA 4LLLA 4FT8A 2JBAA 2R7FA 5D4RA 2ZKZA 3V7RA 1L0OC 4EM2A 5K5OA 1ZESA 2FLKA 1E2BA 1QPMA 3VODA 5HLHA 1U8RA 4A0ZA 2QVCA 3RVPA 4F11A 3GFJA 5K5QA 1DP4A 4TV7A 1KRXA 4YV7A 4AWXB 1NXOA 3KFWX 2PEXA 5CNMA 4XRFA 5TJJA 3TO5A 2DAOA 3MZYA 4PGGA 5TQJA 4Z99A 5IUJC 2DPDA 4WXHA 4JB2A 3M8EA 2COMA 2HOEA 1O57A 3F6OA 2CG4A 3QP6A 1A2OA 4YLEA 1NTRA 1TW2A 2OZUA 3HUGA 1TBXA 4KK4A 1IN5A 1KQ9A 3ZMSA 3LUHA 3LUFA 4MQEA 5IUNC 3A0RB 1F4VA 4O5AA 4YG2F 4MGRA 4EQQA 3I58A 3OLZA 3F72A 4CHUA 1RZRD 1B9MA 1U04A 1W7PB 1F4KA 4IPAA 1JYFA 4TLMB 4XFKA 5A2QZ 2P6TA 2XROA 2DQRA 3FGZA 4GYGA 1JE8A 3CO6C 1SMTA 2VC0A 3RPQA 1YLFA 4U0YA 5JS1A 1KA8A 4UHTA 2UWMA 2HYFA 1NXSA 1YK1A 3R6SA 5FO5A 3QAHA 3C1DA 3JTEA 2FBIA 2E4UA 3H5OA 2LDUA 4NHJA 3BJOA 5IX8A 3ROTA 4KFCA 1RUOA 2F2EA 1R1TA 4E70A 2FKAA 5BRAA 1FC3A 1R58A 1HXDA 4KUMA 5HS7A 2XASA 2P6SA 3VNBA 1ULYA 4Q47A 4UV8A 1FY7A 3C7JA 4OIPF 3GFMA 1JHZA 2QSJA 3EDPA 2KYRA 3F23A 1FFWA 1B9NA 2FQWA 3EULA 3Q7RA 5C5CA 3PQJA 2K7LA 2FQXA 1EH8A 3HRUA 1YIOA 2JK1A 1GVJA 2DBBA 4HA8A 1T39A 2PUEA 3F8NA 4N0PA 5IULC 2LF7A 1T34A 2X4HA 3OO1A 2DPUA 3S2WA 1QQAA 4HQMA 3W9SA 4EJWA 4WT7A 2FMHA 3DQVC 4RSMA 2PUFA 3TDZC 1MVOA 2VBZA 1UCRA 4A2UA 2D1HA 2LP4Y 1UDRA 3KP3A 1Z16A 4EVQA 3CU5A 2RDPA 1M5UA 3TMYA 2FSWA 4EUKA 5IT9K 1FLIA 3SG0A 4GGGA 4I0BA 1DC8A 4OLAA 3OQMA 2A9RA 4RY8A 2IRFG 1MJ9A 1MKMA 3ABUA 2I6FA 4EVIA 4L0ZB 4IF4A 5AIPA 2TMYA 2E4VA 1Z18A 2J5OA 4RS3A 2WWVD 3HO1A 1DCKA 2PKXA 2DLLA 3GO5A 2QWWA 3IP7A 4HNRA 2R47A 3NNSA 4JBAA 2WMYA 3ZN0A 1UHWA 3F8CA 3GWGA 2E1CA 5CNJA 4RB0A 5JS2A 4W5RA 2FMFA 1EH7A 3OV8A 5BPDA 1NXWA 4YFXF 1K68A 2QBYB 1U78A 4KQ9A 4CICA 1PP7U 1LBHA 3SHFA 4BHBA 1IRFA 2XGXA 2M45A 3HS3A 4LB5A 2VYCA 3RQIA 2W84A 4UHKA 5L3BA 1WKMA 5DUKA 1SFXA 5HDNA 3QRFF 4U0WA 3J80K 2FNAA 2QQAA 2W24A 1KU2A 4UVAA 4LG0A 1K7AA 1FOKA 5E8IA 5F6FA 2PLYA 4MNUA 1XMKA 2NNNA 2YHBA 3GT7A 4M88A 4BH9A 3ILHA 1PEAA 4KQCA 4PGHA 3CFYA 4RWEA 4G7HF 3RKXA 1BBYA 1Z05A 3KETA 4HLYA 1RNLA 1JWLA 2J48A 3KLOA 4HX7A 1H9TA 2FE3A 1NXVA 1DBWA 3QEMB 1MD0A 1Z7UA 2A9OA 3L7WA 2DO7A 1BIAA 2R7DA 4G0QA 4A0YA 1APBA 2MH9A 1USIA 3BOQA 4QPJC 1UFMA 3DLBA 3JAMK 2QENA 4RY0A 3GV0A 4QICA 3RVSA 3IWFA 5BPIA 5F1RA 5E17F 1JFTA 1A04A 4HX4A 2P5LC 4EMSA 2PE5A 4AVPA 3F3XA 1UB9A 5L3GA 3O3KA 1F5TA 5FLXK 2H6BA 4Y13A 4W5OA 1T0FA 2CGPA 5EWJB 3T8YA 4GNRA 5CJ9A 4I01A 2UXNA 5DLEA 5JNWA 3CUQC 5JR3A 4RB2C 3ZQ7A 1R22A 2M87A 2DK5A 4BQAA 3LUKA 4KMUX 5D5UB 3JSPA 5ERIA 2X0LA 5TQ2B 1BDJA 2R48A 5HKOA 2XAHA 1QP0A 1QO0A 3OM1A 2GWRA 3KYIB 1JHFA 3RJPA 5J8CA 3H3UA 5GOTA 2PI0A 2HTSA 2UXXA 4IVNA 3H75A 4HBLA 1O7FA 2NT3A 3WU0A 3PQKA 3B02A 4MR7B 1D5WA 5HSGA 1MGTA 3F7NA 3E5UA 2ZXJA 5KI6A 3RKYA 3A0UA 4B09A 1OKRA 5B3JA 5D5XB 3IP9A 3I54A 2A07F 4MR9A 3JY6A 3RPUA 6CHYA 3BRSA 4LDZA 3WGIA 4MQEB 3M9AA 1S6LA 4GCVA 1H9CA 1G4DA 3VOEA 1LJ9A 2IA2A 2P5KA 5K5RA 3CRNA 2WTEA 1KU3A 4ZYDA 5E20A 4G6DA 4Z9AA 4P55A 1KU9A 2FEKA 3SY8A 3IPAA 3WE3A 1QZZA 2MSLA 2MYTA 1RXEA 4MQ9F 5HM6A 1U8TA 4XSZF 1QQIA 2VOPA 3DBIA 5LBQA 4MR8A 5D4SA 2V9VA 2H0AA 2QZJA 1RZRA 4WCGA 3V8KA 1T2KA 1XMAA 4AD9A 2KJBA 4HZFA 2E4YA 4Z4GA 3R61A 3NNNA 2R25B 2CHEA 3WODF 3FWEA 5C5EA 2DU9A 5DGCA 3ROFA 2DT5A 4PZJA 3QLVC 2D1VA 4RXTA 1D1QA 1YK0A 5JNSA 2O6GE 3H5WA 2VE9A 4IXAA 4MR9B 2FQ3A 2XAQA 2A6HF 1JLKA 4YRZA 2L17A 2IA0A 3FF5A 2JRTA 2Q2EA 2GBPA 3GUDA 4ESBA 1TW3A 5LRSA 3NHZA 4ZZDA 3QU3A 4RKRA 5IUKC 2ESNA 4Z9BA 3W6KB 2ADUA 4Y15A 1YVUA 2PLNA 3GXOA 4H0EA 2PUGA 3FXUA 3FXRA 4WX9A 3IHUA 2O0YA 5JI6A 2ZMEB 4N03A 1DPRA 2XKOA 3HTUA 2NT4A 1ZN2A 3BP8A 3LUCA 2NYXA 1O3TA 2P7CB 1NXPA 3ROUA 3BPXA 4IILA 3JVDA 1P4WA 2E4XA 3ZPLA 2J5PA 2RGYA 2VBXA 3ELKA 5KQLA 2M30A 3F8BA 5TE9A 2IJLA 2W42A 1ZRCA 3EQ2A 5FD6A 1D4ZA 4EYKA 1ZREA 1V3FA 4ZYGA 3FDFA 4PE5B 2EFNA 1YQAA 1BOAA 4WWHA 1RIOH 3L09A 3URMA 4I09A 2DFIA 2YHAA 3WE2A 1RUNA 1J2XA 4MRMB 5B3JC 4CGZA 4Q7EA 3M6MD 3MF4A 3BZ6A 2FBHA 1IW7F 2PMCA 1QKKA 2HQBA 2V0NA 4M9XA 2ZFWA 4UVBA 3KJXA 4A5NA 4ASNA 2WY2D 1D1PA 4JOQA 1FSPA 3RVLA 3LQRA 5D6EA 2EJRA 1ZGGA 1FQWA 4Z0NA 3HJFA 2FRHA 1ZG1A 5CYVA 2STTA 3LFKA 4P96A 4RK5A 1TTYA 3Q7SA 3KZYA 2VBYA 1OYYA 2D2WA 2VUHB 4RV5A 2EWNA 5ED4A 2O61A 2RC4A 2H6CA 4WXCA 1YW9A 2EV6A 2HQNA 4LLGF 3V4GA 5FWYB 1FP2A 1BVHA 2FW0A 3HSEA 3OQNA 2HR3A 1JBEA 1OXBB 3TX6A 1FT9A 3OLWA 5LEKA 1CF7B 5LHHA 1Q1HA 2MA3A 1NXXA 1LDKB 1ZRFA 2FMIA 3VEPA 1GXQA 4W5NA 1F1ZA 3K1MA 4N47A 2OD5A 1WQ2A 4BHPA 3KCCA 1ZLJA 4QLCU 1GHCA 5DD4A 1ZARA 1TVMA 1USTA 3RVOA 2VXZA 3ZN1A 5H6RA 3J81K 3FX3A 3ISPA 4A0XA 4F12A 3KS9A 3TO7A 1F9NA 4CYDA 5DD8A 4JAVC 2M1BA 3HSYA 2LF8A 4N41A 5FLXZ 3H5IA 1HKQA 1AWCA 1TNSA 1I3CA 5CLSA 2FXAA 3L49A 3QX8A 3K9TA 1LNWA 4G6QA 2EFQA 1Y1LA 4LX8A 1H9GA 1USGA 3ABTA 3HSFA 2NNYA 5KVRA 3KLNA 3BROA 2XKPA 2A6EF 3RYPA 3BWGA 2G7UA 4OINF 4M73A 1Z2DA 4YFKF 5E18F 4LK1F 2B4AA 5LGTA 1L5ZA 3J80Z 2MBFA 2IYNA 4XLTA 3GX4X 1MZBA 3GFLA 1LEAA 3IC7A 5ILUA 5JVTA 1SFEA 1L3LA 4MS4A 3HTSB 1TMYA 1E6MA 5LGNA 5LLQA 3E5XA 2UZKA 3Q9VA 1K79A 4MS3B 1VKRA 3EODA 4JA2A 4MS3A 1PHRA 4DQDA 1ZLKA 1MIHA 4ZYHA 1SAXA 1S29A 3JTHA 3KHTA 3LOPA 4HDUA 4LRQA 3N6VA 2IPAB 2LNBA 3QLUA 1SD6A 1T6SA 3O1HB 4KMFA 1EH6A 3RVKA 4OIOF 1K78A 2FTKE 4Z4EA 1DRKA 5HOOA 1BN5A 4RY9A 1DC7A 1TQPA 4NQWA 1TQIA 3BILA 5DKFA 5CVRA 2HKOA 4L9TA 2Y75A 3EYYA 3WTWC 3LTEA 1BI1A 1KYZA 3F6PA 1ISRA 1DCMA 3P9KA 3TQNA 4BHCA 2P4UA 1ZH4A 3HK2A 5EWMB 4R79A 4EGZA 2AS5F 2KJCA 5PNTA 2GXBA 4YIFA 2QBYA 1BI3A 2XUBA 3QX9A 3HCWA 3LUGA 3K1NA 2R4QA 4EVSA 5JNTA 3H92A 3BREA 2L4MA 3EYIA 2NZUG 4A6EA 3K9CA 3FFXA 3KP2A 1G3SA 4N9HA 2IW5A 2MH2A 2D45A 1U2QA 1R1VA 3KP4A 5HDGA 5E8GA 5CVIA 2RVCA 4XSXF 5EWLB 3QEKA 4XASA 2PUBA 3IP5A 4RK0A 1GCAA 3H5VA 1USSA 2L4AA 2MYNA 3IKTA 3L2CA 2PL9A 3ZMTA 1OR7A 5HLIA 4UV9A 1ZHFA 4JP1A 1RZ4A 2WV0A 2BYVE 3KEQA 2ID9A 2JVIA 3CS3A 3QP5A 1LB2A 4MYRA 3WU1B 1H0MA 5D2CA 2HSGA 3CLKA 5TPWA 4ZMRA 3Q9SA 3WGHA 3FMQA 1MJAA 4Z2YA 5FBHA 2AYXA 1FYKA 4YO7A 4S05A 5AIQA 3I71A 2HTJA 1DBQA 3JTGA 1J5YA 2Q0OA 2BE5F 4CXFA 4L9VA 1R00A 1BA2A 3M8FA 2OQGA 5D5WB 2QR3A 3HIFA 4FE4A 1Z17A 4CZZA 1JFSA 1ZAOA 2NZVG 3N53A 4TLLB 1ON1A 4KYWA 4MLDA 7ABPA 1QP7A 3GZ6A 5D5VB 1XGMA 3E6MA 2JPBA 3HXMA 5HQJA 1I27A 4BXUA 3HDVA 4YFNF 3LFTA 3O1JC 4PCQA 3I42A 1AB5A 4OLBA 1ZYRF 4IJAA 2IPQX 4HV6A 5DDGA 1LEBA 1B00A 2RN7A 3H5LA 1VTNC 2L54A 5D6FA 1JYEA 4YS6A 3F8FA 3I4PA 2ISZA 4G86A 2CQKA 5E1XA 4MS1B 2A9PA 5ABPA 1GUBA 4U7BA 1IF1A 4G94A 4RB3C 3MQ0A 1BI0A 3KYJB 3W6JB 2QZ8A 2V79A 3QELB 5TQ0A 2FQYA 4RGSA 5IBQA 1SD4A 2XIGA 4A6DA 3IP6A 2QQBA 4GO1A 4IMIB 1W7PD 3N0XA 4EV0A 4OU0A 5EEHA 2A61A 2LIVA 1QO0D 4WK8F 1LDDA 1X3UA 3DV8A 1ZHHA 2K02A 3RDIA 4MRMA 2FMYA 3DPTA 3K69A 1XHFA 5T3YA 4KV7A 4ZYLA 1TQMA 1XDUA 4M6YA 4O3MA 2XRNA 1MJBA 1FFSA 2KKOA 2KIMA 4P5OA 3N97A 1KGSA 5KK1A 3HSRA 2LSOA 1NHAA 2OBPA 2AYZA 1D5VA 3K4HA 4G9YA 4UVCA 3I45A 3RVJA 1LJLA 1ZAYA 3N75A 3AAFA 2CFXA 4DADA 3GW2A 2A5YB 4MR8B 2F5FA 1QP4A 1KQ0A 5IT3A 3HOTA 2FVYA 5TQ2A 4KPYA 3ECOA 4WF2A 3M9WA 4KIFA 3T95A 1J0RA 3D5LA 4QYWA 2VN2A 4HX8A 1TJYA 1PUXA 2DRIA 3V8LA 1XCBA 1U3EM 1HSTA 4M71A
chains in the Genus database with same CATH superfamily
3IH5A 3TIFA 1CPYA 1FRZA 4FGKA 3DQQA 3UHPA 4LYJA 1JXAA 3FDJA 4BGEA 5B12A 4BLVA 5A0TA 2WZBA 2C84A 3AUYA 3C5CA 2AKEA 3E9CA 4GZ5A 4Z6KA 1TKCA 1EE9A 5FH9A 1MLDA 3FPEA 3HUEA 5LBTA 4BL0B 2AFIE 3A03A 4YRLA 4WKOA 1EFRD 1DCFA 3CC4I 2GVZC 5CX1A 4BKRA 5ITSA 2IXBA 1YQXA 3H99A 3PWZA 2WF9A 2IZ6A 4R3NA 4Q1BA 1B6GA 2BDUA 4YJFB 5BPHA 4FX4A 3DVAB 5DTQA 4UBKA 1Y6ZA 3DDUA 3N86A 1H1TA 3EA0A 2OA0A 4HDCA 2E7ZA 3H0KA 1F2TB 1FF9A 1NIPA 2Y76A 3ZDZB 5C0OE 1A3CA 1E9CA 4JXJA 1Z88A 4L76A 4TTJA 4URFA 4HV4A 4P84A 4RTQA 1JG4A 4A91A 1YTYA 5JW6A 2WOOA 3C3XA 3LM8A 4PWZA 3AR5A 2GNPA 1UJ8A 5EZGA 2L19A 5EIFA 3OT1B 4RJLA 3TSWA 3USCS 2PQ0A 3QA3E 4IIGA 4RF4A 2KIFA 2HJSA 3OYHA 3VDNB 1XZQA 1XHLA 5E9JA 4E88A 4PFPA 3VJLA 2NZJA 1R7JA 1RZ3A 3QF4A 3M4XA 4RTJA 2FX2A 1PR4A 1E77A 3I0MA 1ZH2A 2PQ6A 1X87A 4MS4B 5KC8A 4HLXA 1OMIA 4KN4X 2LKXA 1RHJA 1YRHA 1MJHA 3ORFA 4I9GA 1GQSA 3OQOA 4PZLA 4UNOA 1MB4A 3VPFA 1DRVA 3RIHA 3W1VA 1AQJA 1KEWA 4ND5A 1X7XB 5EJEA 2G17A 1AKYA 1PLLA 1IWOA 2A88A 1M6VB 3UJPA 4KISA 2P9JA 3GTOJ 3HUUA 2MYUA 5CITA 1E60A 4YFYA 3UJ7A 1QRDA 4ZMSA 5DN6D 5AI0A 4NU8X 4Q9NA 4JS0A 2DBQA 2HHCA 3OYAA 2G09A 3HEAA 3P9RA 3O8HA 4DLUA 4NK5A 4C43A 8ADHA 2C5LA 3AKYA 4NI5A 4KMSA 5DNYB 2I29A 2NXNA 1FUEA 2EFCB 4L6CA 1R64A 4DSTA 1T25A 4DSAA 3QU6A 1KKMA 2Q3DA 3OFKA 1RAEA 2DW4A 4KXXA 3TRFA 3HKCB 1Y8ZA 1OXTA 5AVXA 4OQDA 4LLNA 2Z33A 5ICFA 1LU9A 3EZ9A 4MITA 2DTEA 4PZEA 4ZVLA 3TD9A 3IGFA 3O91A 2ZYIA 1QZEA 3L1PA 1BL0A 3L8MA 3CZ5A 4E32A 2C3OA 2HZ7A 4I1SA 3LA7A 5THKA 2XCSB 3IEMA 3OL4A 5EAIA 2ZWOA 4TXHA 1KRWA 1GEEA 2IOFK 4LJ9A 3H2JA 3D54D 1EU1A 2MR6A 4RZIA 3SJCA 4ZI7A 3K4MA 1MMSA 5IT9Z 3ZE1B 1VIMA 3U9TA 2V8OA 1L1RA 1W93A 2CLHB 4NY1A 2O1EA 1U8AA 2VXYA 3IMCA 3FHOA 1QQ5A 3H3JA 4RFSA 4RKFA 2VIXA 2Q5JA 1NF8A 3G6EI 3MWGA 4FCCA 4MGHA 4CMEA 2WUWE 2FX0A 3HCAA 3OIOA 3L6BA 2E2HJ 5JZVA 1C4WA 5LSAA 1A50B 1ZJJA 2UVDA 4JNCA 1CB7A 3E23A 3GJ5A 1OWNA 2XUAA 3CNNA 1YG2A 2QJOA 4YGXB 4BEJA 2P4WA 2H16A 1RKUA 4JLAA 5KTPA 2XB4A 5EHQA 3RABA 3ZS8A 4OHCA 3TMOA 3OE5A 4ZGWA 1CSEE 4AIJA 3FH0A 3WYGA 1N3IA 3LOQA 1E2UA 3RIRA 4FLMA 4GLJA 4BP3A 4EZIA 5J2TB 4J16C 3RUHA 2GLUA 4BFYA 4XDZA 5TNXA 2ZDQA 1DTSA 2DQSA 4A12A 5J4HA 4NE9A 3CDIA 1NF2A 3OZGA 5KUTA 1PJQA 1RPAA 4FFLA 4E7SA 4Y0NA 5AFSA 1YQQA 3LA3A 5L3SB 1VDMA 5AJVB 1S7AA 1VCNA 2JFNA 2PRJA 2VL8A 3F8TA 1P5JA 2XVZA 3EE6A 1CRLA 3X1XA 1P80A 4DEVA 4F3YA 5HIAA 2Y05A 3L7NA 3LQYA 4LF4B 2KQUA 1HQCA 1OBOA 1O5IA 2BT4A 1RZVA 2L3DA 2HKIA 2X8JB 2XYPA 4F5YA 4PINA 1DU4A 3FLBA 4KBYA 2SKEA 3IXLA 3ZWCA 4B8WA 2IUEA 3LX4A 3REOA 3OR2C 1XGNA 1UK6A 5G40A 3P0IA 4INZA 1IZ8A 3QUBA 2H54A 4KWTA 2PUAA 4EKIA 3FYUA 3B1ZA 3V80A 2QXUA 1S1MA 3C2HA 2B4QA 5DDIP 3GCWA 3UUFA 2BMDA 1UDXA 1PR6A 1Z77A 2DCUA 2JCGA 1QX3A 2V4ZA 1TGVA 1U0RA 3FN4A 4FN5A 5ILSA 5I48A 2UZ4A 4H0CA 3B2NA 2XXJA 1UELB 2GAUA 4EEFG 4IICA 1DHTA 1EGHA 1FDIA 2DVMA 3VB2A 4IIJA 2JRLA 4B33A 5CEEA 4K2AA 4FYIA 2QKLB 5AI9A 2QNIA 2VT2A 2JH9A 2Z8ZA 5DK4A 5AW7A 2HU5A 1XCOA 1I9CA 3BD6A 2W6MA 1Q17A 2EZ9A 3MJ4A 4FHFA 3LKZA 4ZP1A 4LMYA 2GD6A 3U62A 2EBWA 3TE7A 4CDNA 2XYVA 6ABPA 3C3KA 2FSFA 3Q8MA 3ZXUB 1OE0A 4FZRA 2JSCA 3A6DA 3T9EA 4C6RA 3VR2D 2WUVA 2HT1A 4RFLA 4AMZA 1Q84A 3WFIA 4WLNA 1G5QA 2FVXA 4MWZA 4MVXA 1HDZA 1S7CA 2PD6A 2PPVA 1YS6A 2Q4RA 3EQZA 4Q00A 5LCXA 5T4EA 2E2JJ 2WM2A 3NHLA 3ETDA 2AKYA 3Q12A 4NAUA 3CNLA 2JFUA 2NPFA 3CX8A 1GUYA 1HEUA 2DHQA 2HFHA 1GU0A 1Z26A 3EFOA 2Z1DA 3Q3EA 2C7RA 1KC3A 4X6AJ 1SOMA 4UTOA 5JSFA 1GVDA 2RHRA 2YNMA 4UUSB 3EDYA 4JJGA 1J8MF 4LMBA 3UHFA 1DI0A 1UKBA 3F73A 4NULA 2FRVA 2F5DA 5I9BA 3QE2A 3E1KA 5KINB 1N3LA 1B2RA 2YN4A 4JBXA 1RQ2A 1N1GA 3S5JA 1NF3A 1VL1A 4RM3A 2EKDA 3KPUA 4DCTA 1YBAA 2GPTA 2Y0MA 2GVDC 3OTGA 4BWVA 4YRKA 5JJ5A 3A28A 1I3MA 3KT8A 1N25A 4AC0A 4RTKA 2DEUA 2DN0A 5TS2A 3U9GA 1G3TA 1CS4C 4PQEA 5JJBA 4BJ5C 2J45A 1DEHA 5KWVA 3RZDJ 1PNQA 1Y89A 2XADA 3BMQA 3CCFA 4S1TA 2R96A 4B73A 5B5SA 3VVMA 1NVKA 5C80A 1WV0A 3FIUA 4IFTA 4AQ7A 3OTHA 1IN4A 1DC5A 2CJJA 2QXYA 1S3IA 2B4TO 3DKYA 5C31A 1X77A 2C82A 3BGDA 2X9DA 2FOKA 3I9NA 4BX9A 1MJ5A 2CDBA 3FOAA 1GGFA 3K0EA 4OYRA 2ECFA 2NUPA 3CCRI 4NYIR 4J0FA 4RD3A 4RVUA 2IU0A 1J22A 1XB4A 2AG6A 2JGLA 3BVPA 3K4PA 3L8YA 1WD5A 3L9WA 2L7ZA 3L5KA 1RWBA 4LOKA 4YAFA 1NT2A 1IXCA 4JBHA 4YRSA 1OHHD 3H2GA 3PYLA 3IPRA 1FU8A 1HA8A 3UV6A 1KARA 5CVJA 1X0XA 2IX9A 3G8YA 4O2BA 4XCQA 4XZ3A 2WQZA 3RF6A 2HEOA 4U00A 3TPZA 4CLDA 1D2HA 1NQVA 2PTGA 4CQMA 2E7WA 2OK7A 1O7JA 2VDPB 3N0TA 1SU7A 4MWOA 1MW8X 3C3BA 1DINA 3L4SO 1TC2A 1W2GA 2ZI7A 4YLYA 1AS3A 4JNKA 1JR3D 4MQFB 1T3SA 3ZJVA 3N2GB 1QMPA 1QR2A 5CFRA 3N3BC 5HOQA 1COWD 2R6AA 5EMMA 5KYNA 3D8UA 1CR0A 4C4AA 3NUZA 1EEXB 1E3HA 2VJMA 1QRYA 1Z0FA 4LIPD 5DNCA 4RDXA 1EM6A 2A9QA 2WD9A 3LLCA 4PLCA 1H8HD 3K1JA 2EQ5A 3GUUA 3EGOA 5GIOE 1QAOA 4UUTA 3IJRA 3OIGA 4W7HA 1K7YA 4MIEA 5BYBA 4ZDIA 5FD5A 2GD2A 1M2EA 2C54A 5AXCA 1WCWA 2QRHA 5EE3A 4QWMA 3JRWA 3QLJA 1SH7A 4HRYA 3ZDRA 3GLVA 4M87A 4ZO7A 1YBMA 4A8JC 4WXYB 4AZWA 5CB0A 2B30A 3KVRA 1WETA 4B3XA 2WWXA 1WMDA 1Y0BA 2CDNA 4PG6A 5CG1A 3ZHTA 3CC7I 6PAXA 4GX2A 2EB7A 3JWHA 3K6JA 3ZI0A 2VJLA 2HMTA 4D9GA 1AO3A 3JATA 5C4GB 4IRGA 1GJRA 4EFMA 3VH1A 3L7YA 4QUHA 1KU0A 5DCLA 2OXIA 2E2IJ 2NPIA 4YV2A 4CH7A 1T3GA 2DMTA 1L5YA 1U7PA 3OJOA 4BBJA 1GTL1 1P72A 3KQVA 2Z9OA 5FUWA 3R8XA 3SD7A 3TIVA 3JS5A 2K9LA 4ABZA 3WWOA 4ALNA 1T4CA 1O94D 1LC3A 3L02A 3GWZA 4HQKA 3S7ZA 2WB2A 5EJAA 4EGYA 2A9JA 1QF9A 2J8ZA 1IJFA 3GNLA 2CV2A 1DUVG 4F3KA 3FCCA 1NNEA 4DBZA 1VKJA 4ZQEA 5I4BA 1C81A 3KB1A 4Y18A 1XDGA 3WTVC 1A8UA 1SBCA 4D7MA 4JP2A 1EVZA 2R5YA 3HVHA 4MP6A 4OQMA 5G4KA 3FMRA 5LP6A 3I1IA 4PPNA 4B7AA 4DDTA 5JO0A 5LQJA 3LY8A 3UF0A 3EQ7A 3AJDA 1TU4A 2O1SA 3PGKA 2CDAA 3S99A 2P6NA 4YT8A 4Q66C 1PV2A 1PJSA 2P11A 4P32A 3MW8A 1A82A 4M6XA 5BV0A 4XQCA 1RMQA 2GEVA 5KVAA 2QQ5A 3L8FA 2R3SA 1E1LA 4F3QA 1PL8A 1V7QA 5K3SA 2ODNA 3WLHA 4NQRA 4JEUA 4ESHA 2FWNA 3IERA 4EF6A 1H3EA 3AQ4A 1T2VA 4JASB 3I01M 3H1FA 1U7DA 4GUDA 2HI0A 4LE1A 5IHPA 2DUUA 3P0HA 4LDAA 3T38A 2CUFA 2E60A 3FXKA 1KP9A 3LMKA 3CZ6A 3WTUC 3W2HA 2B4RO 4B9AA 1UC9A 5LJIA 3O2QB 1GXPA 3G02A 4Q48A 2LWIA 3VDXA 2UUPA 4GM4A 1LS6A 4AKSA 3HNOA 3STTA 3ZVKA 4JUIA 2I0FA 4WJKB 4YB8A 3D43A 4TV9A 5CH8A 3HOZJ 3OJXA 3FUTA 5CH3A 1LVAA 1IY2A 2EZTA 4KN5A 4EGSA 1E6LA 2XAGA 1T43A 1YXMA 2IZ0A 4NG5A 3VGPA 1N6HA 1C8BA 1IULA 2I5UA 1R9TJ 4WK6A 4BASA 3V3TA 5AUNB 3FVWA 5K2OA 4KLZA 1IVYA 2DKFA 3OEEA 3I73A 1OH5A 1EP1B 2WFLB 1Q2UA 3HV2A 1WCIA 2JJQA 1U28C 1G60A 2IVFA 1MAWA 1NTOA 2SICE 3ESZA 2X6WA 3TNDA 5LLDA 2LD5A 1Y9DA 4EJVA 4LF9B 1USKA 3O74A 1YYVA 3SJAA 5C4JJ 2IEDA 3N2ZB 3WKEA 2FUG2 3X2QH 1V71A 3U1DA 1NBMD 2OGUA 3AJRA 4LJYA 1SBQA 5EVCA 4IUDS 1H4QA 4GC5A 1DQUA 1EIZA 3CX6A 4F4HA 1RXCA 2BW3B 4IDDA 1BKDR 1I2MA 2ATVA 3OX3A 4K9KA 5GTDA 1OH7A 2GAOA 1C30A 1NQWA 2OZLB 1NYLA 1Y4UA 2CC2A 2DA3A 1ZHOA 4ZT7A 5BXQC 3C2BA 3TOBA 2WWFA 3MUFA 2P2GA 4ND2A 4WUVA 5JARA 1XMJA 2Q9AA 4GT1A 4IX1A 3EXHA 3L0OA 1G4UR 1Z4KA 1HE4A 3IMFA 3KP1A 3LHFA 2R8PA 1VECA 3MYYA 1WJDA 4IGAA 4JZKA 1XMOB 2EFDB 1UANA 1PG5A 1TB4A 2VKVA 1VB5A 2CSOA 2PWZA 5FB2A 2X5KO 3Q3VA 4DZRA 2Z6UA 1WOMA 2OD7A 1XZFA 3ANXA 4IIXA 4O4JB 4UULA 1FCJA 3D4NA 3ZEIA 3E03A 5A2QK 1AOYA 4A4DA 1FIAA 1OR8A 3T1QA 1ISHA 2OO7A 4B4VA 2ZXIA 2WSSA 3G5AA 1KAGA 1LPOA 4KAAA 4MAAA 1MIOA 5FL3A 4ZYWA 5CFPA 3BMOA 3LC7O 3IUJA 4AYWA 2L18A 5EGSA 2UVQA 4K6MA 2RDMA 1E6CA 3MZHA 4Y0AA 2XMSA 1M34B 4UHBA 4BE1A 3K0BA 1QQ6A 1JQEA 1PFGA 1XBTA 3MXTA 3RODA 2VJYA 2X9QA 2YJ3A 2C83A 4RJ2A 1OLXA 3EIEA 2C3YA 1KH2A 1ULTA 3I3OA 2GJAA 2EZIA 4Y0VA 2YX4A 2P90A 3QXJA 4AULA 1DIRA 4GPAA 2IEYA 1ZPDA 3UWPA 3LPMA 5IFKA 2DU8A 4IIHA 4TSFD 2F3SA 2GLOA 3HY3A 5EIHA 2DETA 3FSJX 4X6YA 4EMBA 4HQEA 2B5VA 1AK2A 4MW1A 3TLYA 1FZPB 3ZQCA 2C2WA 2IU4A 1CZKA 1KO7A 3AQIA 3HEMA 3KRTA 5HF6A 3PC2A 2WHQA 1USVA 1CXZA 1NN3A 2BP7A 4ZQBA 5JFTA 4HNQA 1AHIA 2NSJA 1FDTA 2XSZD 3RLFA 4MWTA 3R7WA 3E82A 3WOVA 2Q0HA 4B3HA 2M5WA 3KXDA 3DVQX 5DJ5A 4Q9DA 2K2QB 4H1UA 3IEPA 4N9IA 3Q2IA 2KW5A 4KIUA 2II6A 3L06A 5IVKA 3NEPX 3NHKA 4TSRA 5HF5A 4PK4A 4OHWA 2JEYA 1LPSA 4X85A 2R1ZA 2PUWA 3OEWA 1EWRA 4IW3B 3R7DA 3BZUA 5JYCA 3D9QX 1FFGA 2C94A 3UYKA 1NTCA 2D74A 3K0CC 1DAKA 4JBNA 3D59A 3EZXA 5E2IA 5F2KA 3T54A 3P9ZA 4E1VA 1YDWA 1X2MA 1OLUB 2IODA 3JATB 2VHEA 5JAUA 1YZLA 2BRUC 3ZE7A 2F3QA 3RROA 1XFAA 4DYCA 2L02A 2QRJA 1FMCA 1GZ5A 1PT5A 2IOQA 3AJ8A 1PFVA 2ZBKA 1DEXA 2WTXA 4N9WA 4WMLA 4M1QA 4AZ0A 3WYAA 3EVBA 2X2EA 1Q50A 4P1ZA 4DB4A 4J0JA 1OYWA 1VLMA 4LC9A 3HJGA 3K2EA 2H9YA 3LJKA 1W4BA 2JVJA 2Q5OA 3GEPA 4QHSA 2HLDA 4US1R 3V8NA 1QTNA 3V9PA 4Y3OA 5E2AA 4B6JA 2DKNA 1FOXA 3NBMA 3M1IA 3CSSA 5AI6A 1T1EA 1YDFA 3KEYA 1PLJA 3B73A 4O4HF 3UENA 1VC2A 3CCBA 1OD6A 4YPOA 3OLCX 1ZEJA 1HA3A 4RS8A 4LFUA 1NA5A 4UUNA 4ZO4A 3TE6A 4DW6A 2SNIE 3LBAA 1GUZA 1KS9A 2WJHA 3IC5A 5GP9A 1FYMA 2A1UA 3VSCA 2FPWA 3VQTA 3TUIC 5JPDA 1SIBE 4G1CA 2QZ4A 1PNVA 4QYIB 5HMMA 2J59A 3O9MA 2X51A 2F1RA 2FSIA 4H7IA 2A7QA 1FDWA 1ZG5A 4DJJA 1DGWY 4KNYA 1KDTA 2YVKA 3ILVA 1JF8A 1XVVA 2A5JA 2OFXA 3M4JA 1KVUA 4K9RA 2RJ3A 3DZDA 3LYAA 5DBGA 3JWPA 5EUBA 4EAAA 2RAPA 2DFTA 4LYYA 1PIWA 1YB5A 2XWBF 2W2MA 3GLIB 1Q1GA 3RSZA 2BKLA 4DQKA 2ZYVX 4B3FX 4ADSG 1ESMA 1N2BA 3K32A 3LNQA 3IOCA 5FA6A 2ZGVA 2ZIFA 5A3QA 1M66A 5J23A 1E0AA 5FTKA 4WDQA 5IJ0A 1NKVA 3G2MA 4TWRA 3DU6A 2VJCA 3NAQA 3FF1A 4B3JA 1GU7A 4RAFA 4JLUA 4UC0A 2FNPA 1L7MA 1M8KA 2Q3HA 4E07A 5D1HA 1MB2A 3U7GA 4KIJA 3PXBA 4RAOA 3QV2A 3KSBC 4KGVA 3AYXB 3TQTA 4HHEA 3IRQA 4HO1X 3LSRA 1JU9A 1NFRA 2H4HA 2JFOA 1GEGA 1U3UA 4RADA 3STHA 2HMVA 3C43A 4RK1A 1IO2A 2PMUA 1YB2A 3TEDA 2BHNA 3PD0A 3FPGA 2CXNA 2NO0A 2YMLA 4HNHA 1H1LB 4JFAA 4OHUA 5CNKA 1DWOA 3GVAA 3VTAA 3PD7A 3JQQA 3QH4A 1OV4A 2D13A 4TLCA 1K4YA 2EXXA 1CHDA 2OXRA 2XNDD 1X4OA 4S1PA 2XF7A 2XSDC 2P9YA 3MJDA 3O8OA 1IQRA 1I51A 1MR3F 3HG7A 3CO7C 1VG0B 5DV9A 3PPWA 4UM8B 5AJXA 5B53A 4WL0A 4BB5A 4CDMA 5ALFA 1CQIA 3V8JA 2PLWA 1Z5WA 3G9TA 3WC4A 4C6SA 5KQGA 1ZM4A 1EFRA 1KDOA 4Q4ZF 2VTVA 1R1DA 2I2DA 3A1SA 4DNXA 5KU1A 2YWDA 3ROGA 2GPSA 2ZE8A 3E81A 4H3KB 4AKHA 4P2BA 5DLYA 2MW8A 3DF8A 2R7TA 3ZNOA 2WR8A 4QM7A 1L4MA 2DQLA 1E6WA 4DCUA 1XTJA 3BR6A 4MGYR 2CW8A 5KYUA 3PHJA 5J1RA 4G7ZF 1V3TA 3EZLA 5CA0F 2JJ7A 2IZ5A 4Y98A 5JVDA 2P8TA 1D8TA 1YJ8A 2Y77A 4EWLA 1VQ9I 2MYPA 4QREA 1Z56C 1AN9A 1B8IA 5JYEA 1CW2B 1K3TA 1RWWA 1CQZA 4CTJA 2Y3IA 3CUQA 1E3WA 1I1HA 3PYXA 2M2EA 2HNHA 2PUTA 3AJAA 4ZQHA 2P1DA 5EZ6B 4ZZ2A 4ZV4A 3KIPA 3UMBA 5IAOA 1KSHA 2M4GA 4ARAA 4UXIA 4YRFA 1ZD5A 2C92A 3O4JA 2VDUE 2H0RA 4G0VA 4DANA 4E22A 4OHVA 3ZVRA 4KR3A 2Y27A 4PC6A 4E7OA 5FUVA 3ZCPA 2ZWMA 1TQ2A 4IHSA 1QK3A 2I5PO 4L27A 5I9SA 4LZJA 3SLGA 2DOEA 4R1MA 1TT5A 3MCWA 4MSUA 3UJ6A 1TK3A 2R60A 2VTKA 1VE5A 3GUHA 4IZOA 4LYGA 2BI7A 4O2RA 1HDDC 4DCOA 4F72A 2N9UA 1NIJA 2EFOA 2PJUA 1KERA 1PZXA 5HW0A 2DGDA 1WBJB 1WUJS 3VPRA 3T3HA 5JAIA 5DGDA 3IAM6 4KQEA 1SAYA 4WWCA 1D3YA 3AV3A 2H3EA 1TM7E 2LR0A 4BEVA 3NH6A 1ENOA 4E3WA 1IHDA 4IBOA 4J9VA 4CM9A 4Y6GB 5TRTA 4YDRA 2XUHA 2FG6C 3AOEA 1EBFA 1JU3A 5F04A 2AMFA 2DUNA 2GWHA 2QVBA 1Z5UA 2Y1DA 2HPHA 3KKLA 4N54A 1EEHA 1RDFA 3V00A 3HGTA 3AF4A 3IIEA 4MHOA 3ZE8A 2YL2A 1P6QA 5B66C 1PTKA 1K78B 2VPPA 3TFOA 2BBWA 2LBPA 3LP5A 3ZUPA 1C7ZA 2I6XA 3ED1A 5G53C 3ZTTA 2O05A 3NHYA 1H9CA 1K0FA 3JRIA 2FJ1A 1R49A 5DW0A 3DO5A 3GVXA 1UAAA 5DTIA 4RB1A 1GILA 2IYXA 4Y1GA 3OLXA 1NXTA 5LQCA 3CMMA 1BS9A 2EBUA 1DAGA 2GEUA 3DBOB 1II0A 3L1JA 3GGSA 1I10A 1ZJWA 1ZO8A 4BBRJ 1SD1A 2CVZA 4GBGA 1CDOA 2CMHA 4IG9A 4AJ1A 1PKEA 4FJ2A 2F3UA 3ESAA 4QD3A 1I1SA 1V41E 4CEHA 4M7WA 1KU7A 1H2WA 2ATXA 2BM9A 4HMPA 1LJUA 1BMFA 1ZX1A 3FWKA 3PDIB 2AXTC 4HGRA 5F0FA 4OATA 5TGDA 2COKA 3B7PA 3P71T 3NUQA 2AG0A 3KQSA 5IZCC 1EFAA 2E19A 1VLZA 1XALA 2JLWA 3WLQA 1SVOA 1R3DA 2JJ2A 1HOTA 2HQOA 1WRBA 2OAGA 3QUAA 5FOUA 3WLNA 4ML3A 2LZ0A 2D06A 2NXCA 1H65A 3C5HA 2JGFA 1CYDA 1MX9A 2H2DA 2LDBA 1B8OA 4O4IB 4A8TA 4CMKA 1Z4IA 1XN7A 2R8XA 1U8YA 2GEKA 4L3WA 4XARA 2FCRA 5B58T 4MK4A 4BVAA 4EKDA 3M6WA 1QYIA 4OAPA 4A3FJ 1U7UA 3GCGA 4GR9A 4PTYA 4YA6A 2QPOA 2C98A 2Y4NA 1YNSA 2GGSA 2XUQA 5CX4A 3CONA 1P2TA 1XUOA 5JH7F 2GTPA 3W3AA 4MCJA 4Q6WA 3RGWS 1Y5RA 3E7LA 1IQUA 1ZRSA 2IFTA 3RU3A 1PFYA 1WKVA 1Z3YA 1VSVA 3MAJA 4RETA 1DAMA 3LBHA 2W57A 1R0LA 3K6RA 2ZAOA 1HSOA 4HLUA 4PXYA 2ODQA 3UJBA 3WFJA 4KT5C 4ZYEA 2P78A 2EJTA 1S2OA 1SBTA 3B1KA 3KOMA 2P9BA 3V97A 5FFXA 3BWXA 4JYPA 5A4FS 4FNGA 4YC7A 2MSWA 3WGNA 1GYRA 3QZUA 3AEKA 5B4TA 4OREX 1V6AA 3CUQB 1MUUA 1MT0A 1I2CA 1MOPA 3ECHA 2Q5FA 4NYJQ 3RK0A 1R8QA 4CSWA 3JSOA 1GNTA 4F4IA 4MTEA 2ZWPA 3DGEC 4BNGA 3ELYA 3V6LA 1PFWA 4MUYA 2O8FA 5F0CA 1YMUA 3A3NA 4NC7A 5IKXA 2P5VA 3RRFA 1P2FA 3VFDA 3SNKA 4V2GA 3BB1A 3AF1A 2XGGA 4DPLA 5IDWA 4D8UA 1V16B 1K4MA 1SBHA 4XRMA 5BO5A 5KVSA 5U4QA 1YUMA 2OHVA 3IAHA 5HG0A 4LA4A 1ZD8A 4OG2A 1NQTA 2VJOA 2P6PA 3ZV5A 4B81A 4B76A 2AHOA 4RDIA 1U0GA 2OCLA 4U6QA 1OC4A 3I2YX 4B87A 3K9HA 1G6HA 2ORED 3IMEA 4LJSA 2Q6VA 4G97A 3HEFA 5IWCA 3M1EA 5F2NA 4HV5A 5KAFC 4J19A 5FNZA 3OU6A 3SZ3A 2G08A 4F5DA 2IBTA 4GSKA 3AEYA 3VR2A 4JUFA 4HNSA 4OJNA 5KNDH 1PUIA 2W7TA 2DPLA 1LQ1A 4HUQA 4JVLA 2C4WA 2HU8A 1XD2B 2VJKA 5B7QA 1HKSA 4KXVA 3T8TA 2FQ4A 3EGWA 4RA6B 2A5WA 2A0XA 2Q5CA 3K94A 3A4CA 3KZ1E 5I51A 3UUWA 1RJ9A 1WHSA 3ZE9A 2Z6AA 1BE6A 3E4CA 4MFDA 1VKZA 1DDNA 1E5TA 2AFHB 2DAPA 3PVCA 1P61B 1XSDA 5KYKA 3GN2A 3ADCA 4Z53A 3PPYA 4FS8A 2HWXA 4JXKA 2HQ1A 3Q5GA 4I08A 1WEHA 3F6VA 4QPOA 1BG6A 2GKGA 4YIIA 2DTZA 1KJWA 4GI1A 4K0RA 4BO9A 4DWJA 5MGBA 3TGPA 5K51A 1P4HA 1SD2A 2VRNA 1TYCA 3C6XA 2RGAA 3CUWA 2GJ8A 2ZIVB 4UASA 1PUFA 1O3QA 1LE8A 1C3JA 5EIOA 2OK8A 521PA 2H07A 1FYFA 1WA5A 3CLUC 3T8RA 3FLEA 3KU4A 4HLNA 4A0RA 3O2NA 3BICA 4PQYA 2BH9A 3ICOA 4ZA2A 1C3EA 5JSHA 1BC8C 1FPMA 2B9EA 1UH5A 1BDIA 3WAKA 5K8VA 2DJNA 4ZC3A 4GNKA 3A10A 4TROA 3ZOKA 3RGGA 1GTSA 3GMDA 4KPFC 4WBNF 4GWLA 1Z0IA 3JD1A 4AC9A 5CB4A 4KQ2A 4GP6A 3DBVO 2NSDA 2PNFA 2Q3EA 3DF7A 3P1JA 2B9SA 2BRUA 5EKTA 3SM9A 4Y30A 2R65A 3VUFA 5EY5B 1B16A 5J8FA 3ZGXA 5JEEA 4ZXPA 4P5EA 1U7OA 2EGHA 4PSAA 2EKLA 4DY6A 2NU6B 5DTRA 5DH9A 5IEBA 4M1TA 3T3DA 2AR9A 5TB5A 1E5VA 2XEDA 2NOJB 3STVA 5LDDC 3AM3A 4RL4A 4E33A 2D3WA 2ZS8A 1UJ5A 2KWIA 1I4OA 4GZ6A 2QZ9A 4I5DA 2X9GA 1I5ZA 4P7FA 3NYRA 4TL7A 4FCVA 4V0ME 1UBUS 2QYSA 3MRSA 2H94A 1JIKA 3GA7A 4H35A 4QFMA 4J0QA 3QPHA 2QPAA 4L0QA 4L73A 4XWAA 4DZPA 4AX8A 5BNIA 1IN7A 4EO7A 3GMEA 1PZEA 1YZYA 3I56I 1RIIA 1MJGA 4UXNA 4F04A 5C18A 1XO1A 2CUKA 5JXJA 4D82A 4F2HA 5L7WA 3BTJA 4HF2A 1JL3A 1M6EX 3CCQI 4UTRA 2BKXA 1V55H 3GJ8A 5TEVA 3CNHA 1AZLA 3AKDA 1J56A 1K3FA 1NRJB 3QJ5A 4U0JA 4JVMA 3DDHA 3EG9B 4YCDA 5B1IA 2Y1FA 3DNPA 3X44A 2JT1A 1A27A 1TA0A 2VDKB 4ZAZA 5KWJA 3HJTA 4KE7A 1B93A 4LCEA 3T4PA 4XVCA 4E4RA 4RTRA 3D02A 2VT6A 3COPA 3QLUC 4PQGA 1FXWF 1H2HA 1PYOA 2D1TA 2JLSA 3DKRA 4V19K 4NOJA 4EY4A 2WQ6A 4ZDOA 2ZT8A 2KJQA 3SZOA 2HVRA 5KYWB 2R8OA 1FW6A 2ZBRA 2RGUA 2XB0X 2Q8NA 1TPYA 1KTVA 2VUSA 1A9TA 1MAUA 1JTYA 1JVSA 3HOUJ 4ENNA 1F51E 3HJEA 2HZBA 1M2GA 4OIRF 2JLRA 3GJ3A 1Z4NA 3TCNA 1NMEA 3UANA 1U5TC 1XG1A 3E7PA 1WAMA 3P5JA 1Y8RB 1F3OA 1NLMA 1EVYA 2BMVA 2XQKA 3D6VA 3IQWA 1QG0A 2ID6A 2P2SA 2Q3CA 3VAAA 1T98A 3HVIA 4QNMA 1D8JA 3T94A 4EG0A 1R4AA 3OQ1A 2C5HA 4QPQA 1FUKA 1LA2A 1TKRA 3RADC 1U4OA 2MSCB 1IE3A 3OYFA 1JWAB 4D9EA 5DHUA 3HOYJ 2PLRA 4HAOA 1U5AA 1VPVA 1TWFJ 3PXEA 1RI3A 1T2FA 5E95A 2BGKA 4GR4A 4YAIA 4JGBA 1P4XA 3R5XA 2ZSFA 3ZGVA 4QU0A 3HXPA 1I3NA 4DA0A 1SQ0A 2PN6A 1VBFA 2HMAA 2JH3A 1ND5A 2BSXA 3R3YA 1MBZA 3S3NA 2XZLA 1SXGA 3E7DA 4IOJA 3LAPA 3EVAA 4KWIA 4PVDA 5DB4A 5C8ZA 5I8ZA 1HKHA 1BSVA 3DLPX 4E5YA 2KT0A 3A1CA 3ZGZA 5GONF 3B70A 1DC3A 4IMRA 1E1CA 4MJLA 5BMVB 3WNDA 1ODLA 4URVR 3PQ2A 2HV9A 1G1AA 4R8VA 3BGSA 4JT8A 1Y5IA 4MRPA 2ADMA 2DFFA 4XBFA 2C0CA 5HS9A 3DDSA 1SZDA 2W85A 1WB4A 4HVCA 2PS1A 1DWQA 1Z83A 4HSTA 1LW7A 2D7DA 1K3UB 2HT6A 1H42A 2RIPA 4IRIA 3J7AY 4PJNA 5JHUA 4OOIA 2X5JO 4ZQCB 5FYQA 4DRXA 2BW0A 4YALA 1WPXA 1P3Y1 2J0QA 4HB2A 3INGA 1QZ3A 3E27A 3NH9A 5B1BH 1O77A 2I6QA 1MDMA 4KCGA 2LBFA 5AUPB 4Q19A 1DKLA 2X8AA 5K6AC 2PFGA 2J85A 4CKCB 3WZMA 1YJ5A 4PAGA 1NX6A 3OESA 4GW3A 4LE0A 5MF6A 5CLJA 1HE3A 4B34A 3BM5A 1YTUA 1Y4SA 1I1QB 4XRGA 2EZHA 4RA2A 3DE3X 3LS2A 4BIIA 2E0IA 4NZZA 4RGXA 3UB3A 5LVAA 3EC7A 4UEKA 3CUYA 1VZ2A 3A04A 1Z91A 4QUGA 3TFWA 3OUTA 3EPHA 1ZH5A 1FRNA 1GRRA 1YDMA 4R3UC 4NOMA 3NKFA 1P9WA 1RP1A 3CN7A 5JBIA 3H6GA 3KFVA 4OA5A 1BIFA 2H9AA 1Z2NX 3SYRA 2B35A 3SHVA 1D0IA 1MRNA 4I5FA 3VSAA 1IPEA 3MA0A 5GONB 5GQSA 3NLLA 4L8YA 3HJUA 5C8YB 2ISYA 5K6TA 1V26A 3HJAA 5D7NA 1RTTA 3CX7A 4RHYA 4GEGA 5SICE 4YMIA 5EXPA 4OXXA 2QTVA 2VKEA 3UNXA 4EG6A 5IDXA 2QMYA 3PFNA 2OYCA 3ZQQA 2EZ8A 4R1HA 4KQHA 1N57A 3R5SA 4NXNB 1FU4A 1P7CA 3TZLA 5BVHA 4CLEA 5HJ2A 4MEXF 3T6KA 4F45A 4F3NA 1POXA 3OFNA 3WTYC 4PNHA 2M8EA 1E4EA 4QRHA 4S12A 2E4ZA 2WWRA 4MKZA 4TRMA 4Q7LA 3BG9A 3CUUA 4DLPA 3OPYI 3PG5A 4V0OA 3J80A 1D2EA 5MN6A 4Z0PA 1E17A 1Z29A 2VK8A 3BTUA 3FSGA 4URUR 3ST7A 4BX8A 4E7ZA 3E6BA 1IC6A 2LD4A 5C7OO 1YX5A 3EF1A 2GARA 3LSTA 3M8JA 4KZKA 3BZBA 3FDIA 4W7IA 4XKJA 3JRXA 5EUCA 4MWSA 4PYIA 3EMDA 5T4HA 1SGWA 4MAMA 3K2ZA 4RHCA 4CIAA 3EFEA 3GTQJ 1P5HA 2FZGA 3AKCA 3I0NA 4K2EA 2P9ZA 2R6JA 3IRVA 3P4XA 4FVTA 3KP6A 1GPKA 4BO6A 4ENMA 2ZT6A 3B7WA 5E7JA 3ESCA 5FWYA 5D8KB 3GVPA 1ZBDA 5AUQA 2K27A 4RD0A 4F4DA 1QPIA 2LKPA 2PL5A 2QJFA 1R2QA 1BQ4A 2BCEA 2ZJZA 1KVQA 3MJCA 1PSDA 2C7QA 1NR7A 3K2BA 2LY2A 5IVHA 3HABA 3TH5A 3PIDA 3Q2OA 5KMGA 5JXIA 3SS9X 1XGOA 1E2GA 1L3CA 1T24A 3FTCA 1Q0UA 4IEFB 2ZJ7A 4PV7A 3CF2A 1VL5A 4HAVA 4MQ6A 1W96A 3TR6A 3FKJA 1JPUA 3C6QA 1R9JA 4O2AB 1WR8A 3QVLA 4A15A 2HVQA 2F9LA 2BC9A 4Z0TA 1E1QD 1IQPA 4JP5A 1HZZA 2XB5A 2LRDA 4X9XA 3FHCB 1W0TA 3WNVA 4KPGA 1S2NA 3AHGA 4JBWA 1XD7A 2QUAA 4LDQA 4DN6A 3I9V2 4O6JA 1I30A 4LNHA 3N8DA 1O7LA 1MX5A 1Z74A 1VGVA 1Q0SA 3DD1A 3LCCA 3EA4A 4KVAA 4XR9A 2HDNB 4TTAA 5HBGA 4Q1DA 3CLOA 1T0IA 3UAGA 1ODTC 5TPZD 3VMMA 3CKYA 5M7EA 5BV8A 3Q9NA 1IHUA 3IT3A 4A3SA 4YCMA 4C29A 3GRFA 1MDMB 3ABZA 2PGXA 4C5CA 2J7KA 4HWTA 4JROA 1VKNA 5ITZB 1K7CA 1APLC 3WHCA 1GSAA 1Q20A 4GPIB 4GVXA 2I4TA 2P0EA 4IJVA 4LWZA 3TUZC 1HDYA 2CF6A 3GD7A 3PUWA 5KU7A 3PXXA 4KR9A 1UWCA 1EVJA 5AVOA 1YW8A 1ZRDA 1L5QA 2CUEA 1WNTA 4HAMA 3K1PA 2OTJI 2WLSA 1UWKA 2GLXA 2D62A 2Z8YA 3EB9A 3DDZX 3NRCA 2XNHA 2JATA 3DCJA 2FZVA 4MQFA 1R1UA 4LGWA 2COEA 1XU7A 2IDKA 2TCTA 3B89A 2NS0A 3EC2A 1E1CB 3ISVA 3QWLA 4HH1A 4IQ8A 3GFOA 1LKZA 5HRCA 2GYYA 5D5QA 3OF5A 4NJEA 3C3YA 2DG2A 2VLAA 4PEVA 4W8GA 1KMIY 5KNCH 4O2BB 4YMLA 4KSYA 2WZQA 5EZQA 1B8PA 5BQ5A 4QWQA 4N8SA 3I5XA 3PGXA 1UQTA 2JBAA 4N01A 2PMWB 2R7FA 5EPOA 1KOJA 2OV3A 4ZHQB 1Q1VA 2EILH 3BEOA 3IAAA 1WSDA 3I8XA 2NUPB 3A1VA 4BNZA 4KDRA 1D6MA 1YRAA 3RT7A 4F21A 5EJ9A 3DCIA 4EM2A 1J0CA 1V7CA 1UDAA 2FLKA 2IHJA 3RJZA 4BDSA 1E2BA 4V0SA 3MERA 1KK1A 2JHPA 4FEAA 4KX3A 5E4JA 2A59A 5HLHA 2OBBA 1UEJA 4OFWA 4CM1A 5JS7A 4LMPA 1E4OA 1O4WA 1XTPA 3MWFA 4F11A 4YK7A 5GADl 4IDEA 5ALEA 1XX6A 1L5VA 1Q0QA 3N76A 1UAYA 4R0VA 4YV7A 1TCVA 5ELLA 4DIDA 4O0MA 3CCJI 2A1TS 5DOZA 3VKUA 2PEXA 3EPKA 5CNMA 2BHSA 3H19A 2QTLA 4XRFA 3KYBA 4B43A 2QEQA 2V6GA 2O8CA 2EQAA 5EA2A 4O3FA 3WQBA 5SY4A 3MZYA 1YACA 3UK2A 1Y8AA 3W4KA 2EPFA 2ZS7A 3P0RA 5K0CA 4Z99A 1ZP6A 2BP7B 3ICWA 1GPYA 4JB2A 1AZSC 3M8EA 2JCSA 2GF9A 1GNVA 2C95A 2HOEA 3OIWA 2ESRA 4BC1A 4PZDA 4CHTA 2FPLA 5IBPA 3VH3A 4XORA 3F6OA 3K4KA 4QGHA 3MZ0A 2DQKA 3BK2A 3V4ZA 4LGMA 5ILOA 1RYBA 1ZELA 4LK2A 2EWVA 3VZSA 5JY1A 2OZUA 1IG3A 3G2LA 5H82A 4YUYA 1G8HA 3ADBA 2Q4BA 1KQ9A 4GKKB 1PDOA 4TLAA 4MQEA 4IMPA 1FS6A 3JX9A 3F74A 2OUKA 3VSBA 4RAGA 4AKIA 4RY2A 1V7PC 2WHPB 2K5UA 1E3IA 1NFFA 3GOHA 4ANFA 5AW8A 4UUMA 1A5JA 5JMPA 3UW1A 3E48A 3OLZA 2VWGA 4BUZA 5MGNA 2HV8A 4CHUA 1GYQA 4QXAA 1RZRD 2QLTA 4LHVA 2NU8B 4AY5A 2AOUB 5LZ5A 1F4KA 1IYZA 3A02A 2CRGA 1JYFA 1S01A 1Y1QA 3DV9A 3G49A 4TLMB 1QFXA 5GMOA 3RRZA 2V8BA 3RWOA 4C08A 1XRJA 4OBBA 2ZBQA 5BSFA 5HRUA 3L6CA 4M3EA 4YACA 4LF7B 4O4JA 4EF5A 4WBXC 5BYJA 3VYTB 1K6EA 2WADA 1D7OA 1Z5VA 2FZWA 3SDBA 3EH2A 1JPVA 4GYGA 1W48A 4AP9A 1F7VA 4W9MC 3NHPA 1NKSA 2ODWA 4HDAA 5F7JA 2BJVA 3CO6C 1WIWA 5CLFA 2ZJ0A 5JAPA 1OZGA 1DQPA 1RR6A 4LRXA 4Y6OA 3CJRB 3RPQA 1GKUB 3MG9A 4G01B 5EUMA 4D96A 1NBME 2YUTA 2DZDA 3FR7A 4QBIA 1N0UA 4RMGA 4AQYB 3LY9A 3WV4A 2APJA 4JYAB 1T6NA 1Q0PA 2XX3A 1YK1A 1EFKA 4ILEA 5I7SA 4FMPA 3C48A 4LF6B 3T5AA 3UT6A 3ZE2B 3WLPA 2E49A 3LY5A 3C1DA 4UOQA 5G3ZA 2E4UA 1RHMA 2W98A 3PTZA 3U17A 4QU5A 3N70A 1O89A 1QCYA 1TMGE 4PQFA 1VJGA 1CZLA 5FOTA 4IOAF 4X1IA 4MW4A 3V1LA 1T3LA 4KXYA 1EFPB 2HK9A 3ITNA 4M0LA 3DM5A 2C99A 1AIPA 2WY8Q 2R7ZJ 4E70A 4NQWB 2FKAA 2QLLA 2V96A 4TQGA 5FUXA 5BRAA 4DWVA 1R58A 1VQ8I 2AXQA 1ICIA 1YGPA 1C1HA 4MDFA 2ZDGA 2I8AA 4JSTA 1Z3XA 2XASA 2IBMA 3I92A 3MJFA 4IINA 3WB0A 2BGWA 2P6SA 3NV9A 3VNBA 2GCOB 5EZ5A 1GTRA 2MCFA 3AF0A 1Z8HA 4JUAA 4NZPA 4Q47A 2W48A 2FX3A 1FY7A 3C7JA 1ZA1A 2K9SA 4PG8A 1YULA 4MUGA 2PN1A 2VAPA 3KFXA 2HOQA 1JHZA 3WRXA 5C32A 1N4DA 2WJVA 5KYUB 3JYLA 4M3BA 1X1QA 1QUEA 1XMSA 3HLYA 4RQAA 4RZQA 1JE1A 1Z8NA 2P2CA 4GGPA 4G9EA 1Y3AA 4PR3A 2VNIA 1DX4A 1ID1A 2BFBB 3EULA 2H2GA 4JJEA 3A2NA 3N87A 3OIQA 1PW7A 2GD1O 3OUUA 3ZLTA 4GPBA 4LFAB 1EH8A 2WDZA 3HRUA 4NNPA 2N46A 5IXSA 1QM5A 1W6UA 4MEBA 4J90A 3OS2A 4IM7A 1G3UA 1TIPA 5A2QA 5D7BA 5KTOA 3EVEA 4W6QA 5EZYA 2PUEA 3F8NA 3DEAA 2RK3A 5IULC 3WI7A 1P2VA 3T1TA 1ZKGA 1GPNA 2LV8A 5A4KA 1T34A 3VH4A 1F9AA 1XRRA 3E53A 3SZGA 3L8HA 3MLEA 4LEIA 1ZBQA 2QORA 3G2IA 4M54A 4CCYB 2D8AA 4S1OA 1NG9A 1B42A 2QQFA 1P1HA 3AIKA 2R87A 3OO1A 1XYGA 1I39A 5AO9A 1RKBA 1VJ1A 1M5RA 1W73A 4J4TA 4Y7CA 3ZDQA 2QT1A 4FR2A 1U3FA 4J0DA 5JYDA 3AEZA 3OIUA 5CP8A 5KYTA 3U13A 1F0YA 2N47A 3IYLW 2CXHA 4QPNA 3U4MA 3FHNA 1ZOOA 3ADPA 2XVXA 4WT7A 4OP3A 3WLSA 4DIUA 2HNBA 1RQNA 1FP4B 3KOYA 4KXNA 3TFQA 1YS2X 2PUFA 1PVVA 3HJBA 3D7KA 5FBWB 5K03A 5C1PA 3HB9A 1U5BB 1M1UA 2PD4A 2PMKA 2VBZA 2XMPA 1UCRA 1WF6A 3EMKA 3P52A 4RD6A 4U2FA 4A2UA 4C14A 4DLNA 3DHEA 3DCYA 3UGKA 5IC4A 2V03A 1A9RA 1QGOA 4HEQA 4PSDA 4XUCA 4D4GA 3MJHA 4EVQA 4JT9A 4LJAA 4RW0A 3DBHB 4Y3UA 2EH3A 2AEMA 4Z9YA 3TAXA 4A8HA 3NWTA 5K7ZA 3TMYA 4AIRA 5ESWA 2LK2A 1CIVA 2HD4A 1SZPA 3ZHCA 3QEAZ 2ORVA 3BDAA 4D8TA 4BBZA 2GCIA 3CPJB 1ZU4A 3O84A 4RABA 4UUBA 4BTVA 2DP4E 5B55A 4TYNA 3LC2O 1K08A 5JFGA 2W4IA 3DMFA 4HDQB 1I1NA 1W30A 1ISMA 2IEAA 4E7KA 3IAFA 1DO8A 2J0VA 3FWHA 3ME5A 2P35A 4CU5A 1OISA 4CQLB 1Q14A 1KEZA 2F3TA 3B6ZA 3ONNA 4LHSA 4MI3A 3LWBA 4C4OA 2REXB 1QHEA 4D92A 2PBZA 2WTMA 2QNRA 1GT91 3FJ1A 2Q99A 4GFDA 4IF4A 2WWVD 1Z18A 2VWPA 2E21A 4RS3A 3HO1A 3KAKA 1RPZA 3L6DA 2PKXA 3ZV7A 3GO5A 5GGXA 5D51S 4ZICA 2BXZA 3DMRA 3AEXA 3PWSA 4G65A 1AY0A 5ELMA 3OCVA 2PJRB 1CR1A 3BE8A 3HQ4O 1L5SA 4YJ2B 4BE2A 1T8PA 5HQ3B 1QYRA 3KD2A 3RFVA 3ZWQA 3LCMA 5TT0A 3G1MA 4DMFA 1BW9B 3GXBA 4G6TB 1C7IA 1RXUA 1XKQA 3LMMA 2RH5A 3F8CA 2Z5GA 2B7CA 3FFBA 1GGEA 3MCAA 4IZIA 2NLOA 2FWRA 1PQ4A 3D1VA 4WKPA 1BXGA 5JS2A 3U6KA 5JEDA 4W5RA 1XQ1A 5KZMB 2CJWB 1AHPA 1THGA 3EISA 5FQOA 2QY9A 2XCRB 1CY4A 5CG2A 3R9XA 2L5QA 3GP3A 5HUQA 4YFXF 1IATA 3SBDA 4F9GA 4JP0A 3BK1A 1U78A 1ONPA 4CICA 1PP7U 1J0DA 2BKVA 3BRWD 4BEBA 5TV2A 1B2LA 1G5HA 1KNQA 3E2IA 3M1LA 3KSRA 3WL4A 2A78A 1QH8B 3ETJA 3OYKA 4QTYA 4N49A 5GADJ 1JGGA 4FYVA 1QCCA 5EXTA 1X3ZB 5DIFA 4I5IA 2G9VA 4G4SP 2IGTA 2W84A 4ZV9A 2JRMA 3HKBB 3PIPF 1C1XB 1V1RA 2OBMA 1Q7RA 2Q2WA 2QYTA 1B14A 3N7AA 2ATCA 3ZZNA 1WM1A 2F1OA 2Z8YM 3QRFF 1MAHA 3EYWA 2FK8A 5TX7A 1NVWQ 1SIWA 4E03A 3OWHA 1QVUA 2DPYA 2XQGA 4MNTA 1TC3C 3WIBA 5E8IA 5F6FA 2PLYA 3Q6NA 1TE2A 4D3FA 4M88A 4K9MA 4BX0A 2YX1A 5DOVA 2WFMA 2ZAIA 5J1TB 3CM0A 4WIAA 1G3MA 4G2NA 3CFYA 3OPMA 1G4HA 1L8AA 4Y2QA 4A7PA 4DB2A 3FVRA 2GNAA 2QSHX 5CT8A 3ZQJA 4HPWA 1BBYA 2JAHA 3R9XB 4L5YA 3CZRA 4ZT4A 5DASA 1YS4A 3PIOF 1P0QA 3OE1A 4C2BA 5AK0A 4E6PA 1JWLA 3QOXA 3DAGA 1QVVA 5DT9A 5E6RA 4YEJA 1A6QA 2WHRA 1YR6A 2HF2A 3A2LA 1Z7UA 3I52A 5IN5A 4KRGA 2W4SA 1EM8A 3T9FA 1ILWA 4H7PA 5DBOA 3M3HA 5K2MA 1S8OA 1BW9A 4MH0R 5EFOA 3VPGA 4UY8I 2ODTX 2Y0PA 3U3OA 1ADFA 2GXSA 3PZBA 1XROA 2R7DA 1TU0A 3HKEA 4G0QA 4HP8A 4PLTA 4TSKA 4ZC1A 2NVOA 1J6UA 5K3OA 5KNDA 3BOQA 3HZZA 3BWVA 1U9IA 3JAMK 1JT9A 3B12A 2X1CA 3WKCA 3QSYA 5JAHA 2WNIA 1TM5E 3TQOA 1KZ6A 2PYZA 5F9HA 3GROA 3OKCA 1G20A 2QD2A 4OJQA 4BQIA 5BPIA 4H1VA 2HOSA 4KOAA 3TLXA 1UJ4A 2KL4A 2P5LC 2XRMA 1GFWA 1VSUA 2FW1A 4EMSA 2HJHA 3NM4A 5CT5A 9ATCA 1K5PA 7GPBA 2NO5A 3GARA 3V7NA 4RORA 3M5WA 1Q7CA 3DEEA 2BGNA 5L3GA 2WM8A 3O3KA 1GPBA 2YFKA 4HGOA 2DBZA 1F5TA 2K9NA 2Q6IA 5ECYA 3W5CA 3O7WA 5FO1A 3BTIA 2VIIA 3TZBA 1A5AB 3AFMA 3S4YA 4QXQA 4AJKA 3ECAA 4HF7A 1F0NA 1U6KA 5EWJB 3RUAA 1KJQA 3WE7A 2PFSA 1LBEA 7REQB 3AJEA 4I6JA 3TNFA 5E4FA 1MX1A 3LAWA 1B8UA 2A92A 4PCVA 4R71A 4DBVO 5EIBD 3GPIA 4M98A 2IJGX 1T13A 5DLEA 1NT4A 1AQUA 1A4IA 1H2YA 5JNWA 3CUQC 2ZIWB 3WA7A 4CEIA 1RJDA 3BR2A 3AETB 5DEOA 2M87A 3QXXA 4PYLA 3UMCA 5LKAA 2H11A 2L7KA 1ZL0A 5HXAA 4G81A 4B3MB 1FXSA 3ZRGA 2X6XA 1CDZA 1GPUA 1R8SA 1SXJE 2GHQA 4L4RA 5F1KA 5HMLA 2X0LA 1Q6ZA 1SUPA 2PCJA 3QNUA 4D81A 1U1EA 3O8DA 5I7WA 4WHMA 2JCYA 2VZ0A 1GADO 1R6BX 1XDZA 3VX3A 4K0KB 3IESA 2GJSA 1VIDA 5GOTA 2Q3BA 2I4LA 3LXRA 3WLKX 2W00A 1C9MA 1HZJA 4IVNA 1O95D 4FFVA 4D0LB 2EWMA 4ZVNA 4UD6A 1CUFA 1FBNA 3H36A 2RGWA 2VRCA 4E14A 2NT3A 4ZKDA 4D9JA 2CT8A 3PQKA 4MR7B 4R05A 4G0UA 3FAZA 5HSGA 2B7BA 3BQ9A 4E2YA 4ZI3A 3ULKA 3IQIX 1Z08A 2QN1A 3E5UA 5LZ8A 2OCPA 3TINA 3OP1A 3QQPA 4O8ZA 3RKYA 4JX8A 1WJEA 4B09A 3JYNA 3Q72A 2W58A 4YRRA 3SYMA 2BCGY 5JJLA 2NSYA 1K61A 4UCXA 4BO1A 1AKTA 3ZTWA 1C3OB 4NKRA 5ARDA 3ZU2A 2JI9A 4LY9A 1ZR4A 1HDPA 3UA4A 1E3SA 4RH1A 3JY6A 1TJ4A 4MUEA 4Q4HA 1T8RA 3BJEA 2DX7A 5EL0A 4N4NB 1X39A 3B85A 5GM1A 2X23A 2TSYB 1EGAA 1I6MA 1PTJC 2CMDA 2CB0A 1V8BA 3ONFA 2P5KA 1Q3HA 1UOQA 4E4HA 1Z2OX 2DTDA 2VSYA 1I3OA 4GKVA 4EKYA 3JQPA 3VAYA 5CT4A 4NBVA 2WTEA 2FA9A 1OXUA 1PJTA 2MU1A 4N7RA 4JYMA 4P6VF 1XNRB 4D5GA 2P2ZA 3P5SA 4G6DA 2UAGA 4ZAVA 3SSOA 3C6BA 2JHGA 4YXFA 1NI5A 5ECWA 2REBA 3DT9A 4OGGA 4O2AA 4LBWA 3TQQA 5GAHJ 1UZLA 5B1DA 1B7GO 1BMQA 1P4RA 4J7AA 5F52A 3DT6A 1MENA 1N1EA 2MSLA 3R74A 5KQRA 5F9FA 4JLVA 3ENQA 3DE4X