3U9GA

Crystal structure of the zinc finger antiviral protein
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
223
structure length
217
Chain Sequence
DPGVCCFITKILCAHGGRMTLEELLGEIRLPEAQLYELLETAGPDRFVLLETTRSVVATTRARVCRRKYCQRPCDSLHLCKLNLLGRCHYAQSQRNLCKYSHDVLSEQNFQILKNHELSGLNQEELACLLVQSDPFFLPEICKSYKGEGRKQTCGQPQPCERLHICEHFTRGNCSYLNCLRSHNLMDRKVLTIMREHGLSPDVVQNIQDICNNKHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein
molecule keywords Zinc finger CCCH-type antiviral protein 1
publication title Structure of N-terminal domain of ZAP indicates how a zinc-finger protein recognizes complex RNA.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 70
structure length 217
sequence length 223
ec nomenclature
pdb deposition date 2011-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18606 HTH_53 Zap helix turn helix N-terminal domain
A PF18633 zf-CCCH_8 Zinc-finger antiviral protein (ZAP) zinc finger domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3u9gA01
2L01A 2Z9OA 2KJBA 1L0OC 4MGRA 3F3XA 4RB3C 3TOBA 1YW7A 2BGCA 3MEXA 5LLQA 5K5OA 1ULYA 2IRFG 2EV0A 5DUKA 3HSEA 4YG2F 1OR7A 4WK8F 1TNSA 1XD7A 4BH9A 1ZGAA 1R58A 1P92A 5LEKA 2XUBA 3IHUA 2RQPA 2M45A 3WTWC 1CF7A 1DP7P 1S3JA 2DU9A 3GXOA 4I09A 1OYWA 1TTYA 4E70A 2O61A 2EFOA 2MA3A 2K7LA 4PCQA 2JPBA 3GLXA 1C0WA 3F8FA 2O03A 3FXUA 2VE9A 3WODF 4HYEA 3TOAA 1GXQA 4ASNA 2VT2A 1PP7U 4I0BA 4Q5SF 2LF8A 3IC7A 1TNTA 4XBFA 2NYXA 4ESFA 1J9IA 2VBWA 3L2CA 3DF8A 2STTA 3GF2A 3WTSC 2FEZA 4UV8A 4YFNF 1XB4A 5FB2A 3BDDA 1K7AA 2VE8A 5D4RA 3WGHA 2E1NA 4CXFA 1KU7A 1Z91A 4IRIA 2K02A 5A2QK 3QRFF 2WWYA 4UXNA 1LDDA 1ODDA 1YW9A 2L54A 4HF0A 3SFZA 3FZVA 3ECOA 2WTEA 4HBLA 2QLZA 1U8RA 3C7JA 4HLYA 1RUNA 3O6BB 3TO6A 2ZNZA 3L9FA 4GYGA 4L0ZB 2A61A 2DQRA 2QQ9A 2OQGA 5K1YA 3L09A 2XAQA 2Y75A 3ZMZA 3I58A 4HX7A 3TO9A 2DK8A 4I01A 4M6XA 3F22A 2MH2A 5E8GA 1DDNA 2JRTA 4IF4A 1MZBA 2VBYA 4NHJA 4XLPF 3U2RA 3I4PA 2BYVE 1XSVA 2HQNA 1E2XA 4ENJA 4KIFA 3WU1B 3TDUC 2ETHA 4G6QA 2L02A 5FLXK 5LRRA 4BXUA 1S6LA 3RKWA 4UHTA 2CQKA 3MFKA 4KMUX 1O3TA 2LF7A 2QUFA 5FGMA 1T0FA 3PQKA 5HS7A 3KETA 5K5QA 2QZ8A 3GVAA 3QPHA 3TQNA 4M9SA 1U2WA 1KU2A 1R5HA 2A68F 3IWFA 3FX3A 2IVMA 4YIIA 5DEQA 3RKYA 2KIFA 2C6YA 3I54A 2LNBA 3FM5A 3MCZA 4M71A 1T98A 1IAWA 2EFWA 2A69F 2A5YB 4CGZA 1B9MA 4EJWA 2EFQA 3L7WA 2GZWA 5HS8A 3WTVC 2EV5A 1IN7A 1IN8A 4UUVA 2HOEA 1MGTA 1YFHA 4LLLA 3KP4A 3JTHA 4A0YA 1BN5A 2IA1A 5HOOA 4U0YA 2EFNA 4AIHA 3T1BA 3J81K 1R7JA 3COAC 2DBBA 1FC3A 2STWA 2JSCA 4EJUA 4EGYA 2ESNA 1JGSA 1TQIA 4EM1A 3ROUA 2VONA 3GWZA 2P5KA 4ESJA 1JHHA 2HGCA 1P4AA 3GUDA 2GA2A 5LBQA 1LDJA 4XLNF 2DPDA 4B09A 3IRRA 3WTXC 1ZN2A 4KIGA 1WSUA 4GO1A 1J0RA 2COMA 1T6SA 1FBUA 3SXYA 5D5XB 3MWMA 2HR3A 4Q4ZF 4N0BA 1REPC 3WGGA 1DUXC 3RI4A 5CVRA 2KRFA 2RGVA 2P5LC 3FMQA 1P2FA 4CZZA 5DYMA 4WXDA 4G6DA 1IW7F 1GHCA 1LQ1A 1XMKA 3CTAA 1Z9CA 2VODA 4GYIA 2NNYA 3CDHA 4UNOA 3R0AA 3KLOA 1J75A 1S7AA 1BI2A 2VC0A 4CO8A 2IPQX 3EETA 2PMUA 3O3KA 1ZGJA 4MQ9F 4YFKF 1Z6RA 4ZYGA 2ADUA 5E1ZB 1TBXA 4P5OA 1RUOA 3KP5A 2V1XA 4R8HA 2FNAA 4KMFA 1RIOH 2GA1A 3RDIA 1R22A 2Z5UA 1TQMA 3BY6A 3M7GA 3C18A 4LJZF 1FSEA 3GEZA 3DPTA 1O3QA 5BPDA 3F72A 3LSTA 3IL2A 4OIOF 5DCMA 3DEUA 1H9TA 1QGPA 2V9VA 1KQ9A 2TDXA 3I5UA 1P6RA 5L3CA 3HOSA 5E17F 1U5TA 5HLIA 2A07F 5DD8A 4XSXF 4BHPA 2FBKA 2VBZA 4BHCA 2Q2EA 4Y17A 2ZJ2A 1JXSA 3K1NA 3KE2A 2HTJA 4DQ2A 3O2PE 3Q5FA 3WGIA 4UV9A 1KYWA 4XRFA 3P9KA 1WKMA 2DTRA 2F2EA 1YYVA 1BI0A 1QZYA 3JAMZ 1F1ZA 5IT9K 1B9NA 2P7VB 4ON0A 3HHGA 2F5CA 2M5WA 5HLGA 3CLOA 3M1EA 2UWMA 5HDGA 2EJRA 1MJAA 2YR2A 2QBYA 2E7XA 1SAXA 3H3ZA 1FWZA 4I02A 3S2WA 2FF4A 1IUYA 2XKOA 3CO7C 1FY7A 5HLHA 3ERED 2L4AA 3HIFA 3IRQA 1H0MA 5CLSA 2P6TA 3RYRA 2PJPA 3V7RA 2XROA 6PAXA 2CSOA 3ZMUA 3LA7A 3EUHA 1XDUA 5ED4A 1U5TC 5E20A 2W25A 1HKTA 1JHFA 2D1VA 2ZMEA 4HF2A 1TLHB 4QWQA 5DDGA 3RIRA 2VOPA 5ILSA 2VT3A 2H27A 3TO7A 1MDMB 4LLNA 2OQRA 1RNLA 3IKVA 1QPMA 1USSA 2PBIA 4G9YA 3ULQB 4CYDA 4F7ZA 2QYOA 2MLGA 3KZYA 3OV8A 3F8BA 3PQJA 3ECHA 4FX0A 3V8LA 4A5NA 1W5TA 3C3WA 4DNCA 3SZTA 3ZMSA 2OD5A 1KQ8A 5JR3A 3F21A 5J8CA 1XGSA 1R1UA 2VC1A 4ESBA 3I0TA 1YG2A 4M74A 4TV7A 5A2QZ 1W7PD 2M87A 3DXJF 2BEOA 4I7HA 5LRSA 2FRHA 3VOEA 4U7DA 1FYMA 2DI3A 4H0EA 1G3TA 1IRGA 4KFCA 1Z05A 3K1PA 4RGRA 3D5LA 1K78B 4KN7X 1D8KA 2DLLA 3ABUA 5D6EA 5ILUA 1J59A 2DFIA 2XRNA 3HRUA 2CG4A 1HKQA 1PP8F 1KU9A 3KZZA 3F8CA 2H6BA 3KEQA 2HYGD 1B1BA 3ABTA 2YSRA 2GAUA 1IF1A 4LFUA 3IKTA 1K79A 2BBYA 3F8NA 3HRMA 3RPUA 4L9JA 2YX4A 2RV8A 2HEOA 1EV7A 5D5VB 5FLXZ 3K0LA 1QO0D 2DK5A 2OZUA 3WE2A 1AWCA 5F64A 2EA4A 3HUGA 2YPRA 3E6DA 1XGNA 1EH6A 5JFRA 1XCVA 2PG4A 3LFKA 5BMZA 1EH8A 3E5UA 4GCVA 1IXRC 4Y15A 1YO5C 1ON2A 3J80K 4U0WA 1YQAA 3ZPLA 3T8RA 3FMRA 5JHUA 3H3UA 1HSTA 3KCCA 2Y48A 3Q9SA 3B73A 2XAHA 5BS6A 4IHTA 1BIBA 2IT0A 1FBQA 1GXPA 1OYYA 3VB2A 4B8XA 4M9ZA 2M8EA 2R7DA 1PDNC 2ISZA 1XDSA 3V7CA 1HQCA 1UCRA 1ZLJA 2DQLA 1IN6A 2RVCA 3GFLA 2V1UA 3LQRA 4U7BA 4HX8A 1KGSA 4HZFA 1FX7A 1D3YA 2HWVA 1YIOA 5DV5A 2JTVA 1FLIA 1R00A 3J81Z 4ZH4F 2NS0A 4MNUA 2Q8KA 3BPVA 4AVPA 1I1SA 1R1VA 3FHZA 2P7CB 4IXAA 1BBYA 2XGXA 2MD5A 2FOKA 3K1MA 1D5VA 2QWWA 1RZ4A 1R36A 5E1XA 2GQQA 3QU6A 2E7WA 3SQNA 2YX7A 1BM9A 1XN7A 3F23A 3K2ZA 3EYIA 4LK1F 2IP2A 1FYKA 4FHTA 3N97A 2B0LA 3I59B 3DV8A 1CGPA 3REOA 2W57A 5ILVA 5EEGA 2JT1A 1I5ZA 3I71A 2FMLA 4ENKA 1FT9A 1V3FA 3RTRA 1MD0A 2Z33A 5DD4A 2FE3A 3BJAA 4HOBA 1OKRA 3HHHA 1NHAA 3GYHX 4KT5C 2DPUA 2Z3YA 3FMSA 1XMAA 4YFXF 5J8FA 1SD5A 3FXQA 4IVNA 4RGSA 2ZFWA 4HDVA 2RNJA 1ZG5A 1ZREA 1IXCA 3GW2A 4NQWA 5ERIA 3ELKA 3EDPA 3WTTC 2IJLA 1SFXA 2Y0MA 4OMYA 4O5VA 1YW8A 3ZMTA 1JE8A 1W7PB 3BPXA 1IN4A 2XVCA 4L9TA 3GZ6A 5H20A 4KDPA 2A3SA 1U3EM 2K4JA 2XIGA 2ZKZA 2FBHA 2ZCWA 3HSRA 2BV6A 5HDNA 1TW3A 3DKWA 1SD6A 4LG0B 3E3VA 2G9WA 4FT8A 1SD7A 2DW4A 3MAJA 3QU3A 1Z1DA 1R5GA 3VEPA 4IPAA 4OIQF 2O8XA 1MJBA 4IJAA 4LMYA 1R23A 2FNPA 3JW4A 3NRVA 2HTSA 1QBJA 2OZ6A 4PZJA 4RAZA 1J5YA 1ZAOA 3ZMVA 4A0ZA 2A6HF 3PFIA 1BI3A 3EYYA 3ISPA 4EVIA 4WWCA 5L3BA 5DCFA 4LLGF 2AXLA 3E97A 2H09A 1W5SA 2PMHA 5CJ9A 3LA3A 3GO5A 5IT3A 2EA2A 4KIBA 3G3ZA 1FPQA 4G7HF 1ONVA 2K4BA 2HQRA 5IT9Z 1Q1HA 2O0YA 4AWXB 5LEJA 2WC2A 1I6XA 1WWXA 1DPRA 5F1RA 4UVBA 1ZG1A 1W4MA 3T0YA 2MH9A 4U0VA 3E5QA 1BC8C 5FD5A 1A04A 2QVOA 4RB0A 2CO5A 1LB2A 2DT5A 4KNYA 2NAZA 3CUQB 3RYPA 2XV4S 1U6GA 3GX4X 5ICFA 3TKYA 2J5OA 4EJOA 1Y0UA 4RGUA 1S8NA 1MJ9A 3DQVC 4R1HA 2H94A 3CUOA 3WTZA 1AOYA 1B4AA 2FXAA 1FP2A 1LVAA 3HRTA 2KJCA 1SFUA 5ICCA 3GFIA 2D45A 4A12A 1S7OA 2DAOA 1G6NA 1HSJA 1WQ2A 2BE5F 1LNWA 1H9GA 2UZKA 5HS9A 1I27A 4AIJA 4EM2A 4QLCU 3VODA 2VXZA 1HXDA 3JTGA 1Z6TA 1HW5A 5TJJA 2LKPA 4EJVA 4LK0F 4EQQA 2XKPA 3I53A 1K6OA 2GIVA 4HAMA 4N9HA 1D8JA 1SMTA 3H92A 2HKXA 2ZO4A 4L0YB 3IWZA 2A6EF 4OMZA 4S05A 2XHKA 5JVTA 4BNCA 4FX4A 1J2XA 5L3FA 3HTUA 4G8XA 5EEHA 1IZ1A 4RB1A 3QOPA 4I2OA 4HQMA 4PGHA 4NB5A 3KP7A 3WTUC 4RB2C 3FXRA 2NNNA 2X4HA 2G7UA 4S04A 4BQAA 1QQIA 5CVUA 2EFPA 3ZN1A 3I64A 1LEAA 2W84A 3RPQA 4L5IA 1BC7C 4O3MA 4BHBA 2KKOA 1T38A 4N9IA 1T39A 4A2UA 4Y13A 1SFEA 3R6SA 5LHIA 3J7AO 5D5UB 1CF7B 2NRAC 2KIMA 3SZPA 1LJ9A 2QENA 3QPTA 4A6DA 3MZHA 5FD6A 2GXGA 1MDMA 3FWEA 3DP7A 1O7FA 1X3UA 2DO7A 4HQEA 5ICEA 5E8IA 4KYWA 3VFZA 1ZARA 5L3GA 3J80Z 4G7ZF 3ZN0A 3U1DA 4OINF 1O3SA 4EJTA 5CVVA 5K5RA 4MEYF 1ON1A 2P6SA 1FYLA 3V8KA 5LHHA 1ZH5A 4HX4A 5E18F 1USTA 2GWRA 4PGGA 3C1DA 1GVJA 2P8TA 2K27A 4KN4X 3KLNA 2V79A 2MBFA 4Z2YA 3JSOA 4M72A 4Q47A 2ISYA 4HV5A 3Q9VA 1O7LA 3HSFA 1G4DA 3MZYA 3W6KB 3NQOA 4M9XA 2ZNYA 1K78A 4MEXF 2D2WA 2HKOA 4O6JA 3T8TA 3M9AA 5BQTA 5D5WB 4ENNA 4ENMA 2EK5A 2RN7A 5D8LB 1V4RA 4A0XA 1G3YA 5LGNA 2QM3A 4MTEA 5CYVA 2QQBA 3TDZC 2H6CA 1UHWA 1KU3A 1E17A 3E5XA 2ZXJA 2G7HA 1XSDA 3U9GA 2HZTA 5FFZA 4M6YA 2FQ3A 4IHSA 2OAZA 4ZZDA 4L5JA 3ZP5A 4OU0A 1O3RA 3GFMA 1UB9A 2RC4A 4ETSA 4L18B 3P9CA 3V4GA 4RS8A 5L3EA 3WU0A 3DPLC 1ZRDA 1SD4A 2OBPA 5AONA 2Q0OA 1IRFA 2ESHA 1FOKA 5AIPA 5BPIA 2IW5A 2CW0F 4L9VA 4HLXA 1YTYA 3E6MA 1ZRFA 1TQPA 2VOOA 2KIUA 3K69A 4KA4A 2W85A 2OU2A 3HYIA 3M8EA 3B02A 2WV0A 3JSPA 4YIFA 3G73A 2RDPA 2F5FA 2FU4A 3MQ0A 4LB5A 2UXXA 2E1CA 4EV0A 3WTYC 4UVAA 3CO6C 5F6FA 3GZ5A 2OA4A 1STZA 2L3DA 4A6EA 3F8MA 2RKHA 5ICGA 2V1DA 5HVQC 1BIAA 3LWFA 2ZBKA 3V8JA 5AIQA 4IRHA 3M8FA 1U78A 4GXOA 3AAFA 3KP3A 5TRDA 5CVIA 4WXHA 4P96A 4PDKA 4I0AA 2YU3A 4GGGA 4IRGA 2O6GE 3LA2A 1UHMA 3HRSA 4CICA 3F6OA 5CVJA 5D6FA 4HA8A 3BP8A 2FBIA 2VBXA 3ML6A 3I59A 4MHGA 1HW1A 3BJOA 3LAJA 3P9IA 1B59A 2CGPA 3R61A 1VTNC 3SHFA 2FA5A 2V6CA 2GXBA 2M1BA 1FNNA 1G3SA 4RAYA 2VN2A 4UVCA 1FSHA 2AS5F 3P7NA 1ZRCA 1TW2A 1XSXA 4WX9A 4KUMA 4CDGA 1UFMA 2ELHA 2FMYA 5DUIA 2PLYA 4ZZLA 1KQ0A 1F4KA 1WI9A 3QP5A 1HW2A 4R79A 1Z7UA 1L3LA 1YLFA 1IXSB 2MLKA 4RGXA 4P9FA 1F9NA 4EGZA 2P5VA 3FF5A 3CJNA 1BI1A 4WXCA 1ZLKA 3DFGA 1MKMA 5KVRA 4EMSA 4BYYA 5BOXA 4JQFA 2D1HA 1XGOA 1W7PA 3FM3A 4ZYEA 1XGMA 1SMYF 4JBAA 5H6RA 1ZG3A 2K86A 1FBSA 3BROA 3HOTA 5LGUA 3RJPA 1OMIA 4LG0A 5KK1A 1EH7A 2LDUA 3LQQA 3N4MA 1I1GA 1RI7A 4OIRF 3E6CC 5DCMB 4HF1A 1J7KA 3HTSB 1G3WA 3EQLF 3L00A 1XCBA 3V7SA 2F5EA 2W24A 2XAGA 2X0LA 1F5TA 3BWGA 1B6AA 3BZ6A 1S29A 1IN5A 2L4MA 4OOIA 4LB6B 4EM0B 1BJAA 2EWNA 2CFXA 4D0PA 1U5TB 4HDUA 1KYZA 4M73A 4MQVA 2PQ8A 1HBXG 1PUEE 1O57A 4WCGA 2R3SA 2XAFA 5FO5A 4A5MA 4I98B 4LD5A 5HDKA 1FP1D 3R4KA 4XSZF 5E1WA 3F6VA 4P55A 4ZYHA 3R60A 3KP2A 3RKXA 1YS7A 4K2EA 5L3DA 1BOAA 3KFWX 3NEUA 1LDKB 2FSWA 2J5PA 1P4WA 4Q48A 3LAPA 4HV6A 2EB7A 2QQAA 3CUQA 4G94A 2R7FA 3K9TA 2EV6A 4JK1X 4L9NA 3E6BA 1KA8A 5LGTA 2QBYB 4OIPF 1R1TA 2O3FA 3TGNA 2F5DA 4P9UA 3WG9A 4HW0A 2P4WA 4KICA 4CHUA 2IA2A 2CYYA 5D8KB 2CWEA 3BJ6A 3GFJA 2HYFA 5LHGA 2UXNA 4BAYA 3D0SA 4AD9A 2XAJA 2PFBA 2XASA 1ZHFA 3W6JB 2ZMEB 1YS6A 2JZYA 2M30A 2Z99A 4U88A 4MTDA 3QAHA 3R0JA 1WRJA 1P4XA 3KP6A 1DPUA 1LEBA 2HFHA 5FFXA 2MC3A 1ZYRF 2LSOA 2ACJA 3ZQ7A 2PEXA 2JPCA 4WF2A 3QP6A 1FZPB 4ZYDA 2HS5A 2PI0A 2PN6A 4AIKA 1QNTA 3CUQC 3WE3A 1QZZA 5J6XA 4LGWA 1T2KA 4G7OF 3KEOA 5JI6A 1OPCA 3ZMDA 2HDCA 3BOQA 1HKSA 1OYIA 2IA0A 3OOPA 3T5XA 5H6QA 3JAMK 5D4SA
chains in the Genus database with same CATH superfamily
2L01A 4A3DJ 2Z9OA 2KJBA 1L0OC 2Z1DA 4ZYAA 4MGRA 3F3XA 4N4NB 4RB3C 3TOBA 1YW7A 2BGCA 5EF6A 1ZELA 3MEXA 2LBFB 5K7HA 5LLQA 5K5OA 2R7VA 3W3CA 1ULYA 3FBNB 1D1AA 2EV0A 5DUKA 3HSEA 2IRFG 4YG2F 1OR7A 4WK8F 2LK2A 1TNSA 1OCPA 1XD7A 2V4JC 2HDWA 4BH9A 1ZGAA 1SC7A 3OYBA 1OLTA 1R58A 2DOEA 4UUSA 3D5RC 1P92A 5LEKA 4RAFA 2XUBA 3IHUA 2RQPA 2YU9J 2M45A 3WTWC 4KISA 1B72A 3CJQB 1CF7A 1DP7P 1S3JA 2DU9A 5IYBJ 1WVRA 3GXOA 4GRIA 2R7TA 4I09A 1OYWA 1V5EA 3H5NA 1TTYA 2VPRA 2O9LA 4CH7A 2MYSA 3EUKL 2F4MB 4E70A 2O61A 3P5JA 1K4TA 2HOSA 2XRLA 5IPAA 2DFFA 2EFOA 2EZHA 2N8GA 2MA3A 2K7LA 1AA7A 4PCQA 1O4XA 2JPBA 3GLXA 3BT9A 1C0WA 3F8FA 4YEJA 2O03A 2DA7A 1AKHA 1VQ5I 2K5CA 3DBHB 3FXUA 3JRGA 3WODF 2VE9A 4HYEA 3TOAA 1GXQA 1LVKA 4ASNA 4M3DA 1RPWA 1T56A 2VT2A 5FROA 3NWSA 4Y7NJ 4FCYA 4I0BA 1PP7U 3OMYA 4NNJA 3HDDA 4Q5SF 4N4OB 2LF8A 3IC7A 2H8RA 1TNTA 3LNQA 5H2FC 5BNGA 5EJCA 3HUGB 3PNYA 4XBFA 2NYXA 3FK7A 4ESFA 5HODA 1OISA 1J9IA 1UHSA 4D9JA 2VBWA 3L2CA 1T8IA 3DF8A 4DW6A 3S93A 2WA0A 2STTA 5F27A 1A6QA 1Y56A 3GF2A 2DA6A 2XPVA 3WTSC 4E7LA 5IP7J 2FEZA 4UV8A 4YFNF 1XB4A 5FB2A 2ME6A 3BDDA 2AO9A 1K7AA 2EIKH 2VE8A 1OR7C 1TT0A 3PJRA 3AFHA 3H1CA 5D4RA 3WGHA 3OL4A 4RDUA 1RR8C 2CW8A 1VQ7I 2E1NA 2KPMA 2OCEA 2QF7A 3A0HC 1MBGA 4M3FA 2B63J 4CXFA 2DDBA 1YX3A 2I10A 1KU7A 1Z91A 3VPRA 3GZNB 4IRIA 3HKZA 2DFEA 2K02A 3DTIA 2DA1A 5A2QK 2E1OA 3QRFF 4PFPA 5EZGA 1H89C 3H9JA 4AUXA 1VNDA 4UXNA 2WWYA 2DJNA 2M0CA 3DU6A 4BEHA 1LDDA 2EINH 3BQZA 2BOLA 3U21A 1ZTRA 3C2GA 1GT0C 2VL8A 1ODDA 1YW9A 2L54A 4HF0A 3SFZA 3FZVA 3ECOA 2WTEA 1TWFJ 2QLZA 4HBLA 1R9TJ 4JX5A 1U8RA 3C7JA 4XLCA 4HLYA 1RUNA 2OPTA 3O6BB 1LPQA 3TO6A 1OJLA 2ZNZA 2QSHX 3L9FA 4GYGA 4L0ZB 2A61A 1RC9A 3BR2A 2DQRA 2QQ9A 2K85A 2OQGA 4LIVA 5K1YA 2DMUA 3L09A 1TWGJ 4II2A 4PJJA 2XAQA 5F0FA 2JSPA 1WH7A 2Y75A 3ZMZA 2KP6A 3I58A 1NK3P 4HX7A 1YIJI 3HPGA 5GTHC 3TO9A 2DK8A 3BQYA 4I01A 4M6XA 1ZK8A 2MH2A 3F22A 5M3FJ 5E8GA 3HGYA 1DDNA 2JRTA 2JA6J 4B4CA 4IF4A 1MZBA 2VBYA 4NHJA 3GTOJ 3VWBA 1IUFA 3EUAA 2X1EA 1WCMJ 4XLPF 3U2RA 4ZDLA 3I4PA 2BYVE 5TGTA 1XSVA 2HQNA 1E2XA 5KHDA 4ENJA 3RKQA 4IEJA 4KIFA 3BTIA 3WU1B 3OYFA 2EZKA 4HNUA 3TDUC 4RLQA 2ETHA 2ID3A 2W4SA 4IL6C 4G6QA 1HDDC 2L02A 3WG7H 5FLXK 1N75A 5LRRA 4BXUA 4AYBN 1S6LA 3RKWA 2EBIA 4UHTA 2CQKA 2DYRH 3E0JB 3MFKA 4KMUX 2K9LA 1O3TA 2LF7A 5B3SH 2QUFA 4IHYA 5FGMA 2OUMA 1T0FA 2VKDA 3AL0B 3PQKA 2WB1A 3L2QA 5HS7A 1HCRA 2R92J 3KETA 5K5QA 1LFBA 2QZ8A 3GVAA 3QPHA 2CQQA 3TP3A 3TQNA 5C4JJ 3JRCA 1ZQ3P 4M9SA 1X3ZB 1U2WA 1KU2A 1R5HA 3OYGA 2A68F 3IWFA 3FX3A 2IVMA 3VSLA 3IH3A 5B66C 3WU2C 3GCMA 4JP0A 4YIIA 5DEQA 2JUGA 2M4GA 5E79C 3RKYA 2AHQA 2KIFA 4GDFA 3CP8A 5CKTA 2KISA 2C6YA 3I54A 3QWLA 2NVQJ 2LNBA 2LY2A 3FM5A 3MCZA 3LSIA 4M71A 1T98A 4KJZA 3DBLB 1HA8A 5FKMA 3E7LA 1IAWA 2EFWA 2TRTA 3BCAA 2LC2A 3AG2H 4NQWB 4XLEA 2A69F 5F0HA 1HF0A 2A5YB 2VASA 4CGZA 1QHGA 1B9MA 4EJWA 1OCRH 2EFQA 5C4XJ 3L7WA 9ANTA 2JVGA 4B3XA 2GZWA 2XGCA 4D1QA 2FQ4A 1WGXA 3DLLF 3D5SC 5HS8A 1V5GA 3WTVC 2ICWG 2EV5A 1IN7A 3PSIA 1IN8A 4UUVA 2HOEA 4B3AA 1FMWA 1MGTA 1YFHA 1VQKI 4LLLA 3CC2I 3KP4A 3JTHA 4A0YA 1BN5A 2IA1A 2KDOA 1QPIA 5HOOA 4NC7A 2BHZA 2LKXA 2KRCA 5CQGA 1X2MA 4U0YA 2EFNA 1GDTA 1Z21A 3T1BA 2LG4A 4AIHA 1R7JA 3J81K 3COAC 4E7HA 2DBBA 1YHQI 1FC3A 2HYJA 2ME0A 2STWA 2JSCA 3MKLA 4EJUA 4EGYA 2ESNA 2HQAA 1JGSA 1TQIA 2BW3B 1WPKA 5GAEJ 4XIDA 4EM1A 2XF6A 1T0FC 2BVLA 1POGA 3ROUA 4XKWA 2VONA 3GWZA 4DBRA 2P5KA 2MFZA 4ESJA 1JHHA 2HGCA 1P4AA 5H6RA 3GUDA 2CQXA 2GA2A 3HZJA 5LBQA 1LDJA 3I4MJ 1GVDA 4XLNF 2ZXWH 3VYSB 4A93J 2DPDA 2E5NA 4B09A 3IRRA 3WTXC 5LD2C 1ZN2A 4KIGA 1WSUA 1A6IA 2IGOA 4GO1A 1DU6A 3GMEA 4PFOA 1J0RA 4CUGA 1VFCA 2COMA 1T6SA 5J1YA 1RRJA 3PIPF 3JRFA 1FBUA 4HSTA 3PO3J 3SXYA 5D5XB 3MWMA 2HR3A 4Q4ZF 2FJ1A 4PJLA 2ECCA 2VIXA 4N0BA 1MSEC 1WJDA 1REPC 3QYEA 1RETA 3WGGA 1DUXC 2NS8A 3RI4A 3HEFA 5CVRA 5F1JA 2KRFA 2RGVA 3F0CA 2P5LC 3FMQA 1P2FA 4CZZA 5DYMA 3KZIC 3ONQA 4WXDA 3V42A 4G12A 1SAUA 4G6DA 1IW7F 1OFCX 1GHCA 3K4JA 2AQFA 4DIQA 1LQ1A 1XMKA 3BG5A 3CTAA 2DTZA 1JUMA 2DA2A 1NH3A 1S7EA 1Z9CA 3AKZA 1SEUA 3FXMA 2VODA 4GYIA 3ABMH 2NNYA 2IS6A 3CDHA 1AHDP 4NC6A 2EIMH 2LR8A 4UNOA 2NVUB 2A6TA 3R0AA 3KLOA 1J75A 1S7AA 1BI2A 2VC0A 1JKOC 4RM3A 3PO2J 4BL0B 4XRMA 3GTLJ 4BQOA 2RNGA 2IPQX 2PMUA 3EETA 3O3KA 4XLAA 2CS3A 4CO8A 1ZGJA 1HDPA 4MQ9F 2H1KA 2O8KA 1EF4A 4YFKF 5HLTA 1K4SA 1Z6RA 4ZYGA 3DEWA 5KAIC 4IHXA 2ADUA 3SDGA 3UNGC 1Z3YA 5E1ZB 1TBXA 4P5OA 2L7MP 1RUOA 1ETYA 2WAQA 3KP5A 2V1XA 3IP4B 4R8HA 2FNAA 4KMFA 2JRMA 1W36D 2HVSA 3CCRI 1RIOH 2GA1A 3DCFA 3CDLA 1ZR4A 3RDIA 1D1BA 4HPQA 2VKHA 2B9SA 1JUPA 3F9KA 1K6YA 1R22A 2Z5UA 4Y3OA 3BR0A 3K4LA 5F04A 1TQMA 3BG6A 3BY6A 1RESA 3M7GA 4E7JA 3C18A 3HOXJ 2LFBA 4A3MJ 4LJZF 4RBOA 1FSEA 3GEZA 1YI2I 3DPTA 1VQMI 2H8WA 1O3QA 5BPDA 3F72A 3BZKA 3LSTA 3IL2A 2M9HA 2CQNA 4OIOF 5DCMA 3LSJA 3DEUA 4FETA 2KRHA 2AXTC 1H9TA 1QGPA 3CCJI 2V9VA 1KQ9A 2TDXA 5KCMA 3ZCOA 4Z6YA 3I5UA 3ZOBA 1P6RA 3HOVJ 5L3CA 1PYVA 3HOSA 3A0BC 1V5FA 2VI6A 1JKPC 1Y8QB 3LFUA 5DM6F 3OYMA 2YS9A 1R5ID 5E17F 2CQ7A 1U5TA 3HOUJ 5HLIA 3CCMI 2EH3A 4LIUA 2A07F 5DD8A 5FJ8J 2MD0A 4XSXF 1Y1WJ 4BHPA 3LSRA 2FBKA 2VBZA 4PSWA 4BHCA 2Q2EA 4Y17A 1MMSA 3QQAA 2BXZA 2ZJ2A 2EZIA 4C3JJ 3ZQFA 1JXSA 1FIPA 3QPSA 2IGMA 3JRDA 3K1NA 3K70C 3KE2A 2HTJA 4DQ2A 2R5ZA 3O2PE 1IV8A 1V55H 3Q5FA 3G4SI 3WGIA 2E1MB 4UV9A 1KYWA 4XRFA 3P9KA 1WKMA 2XB0X 2DTRA 2F2EA 3H5RA 2JK3A 4YELA 1YYVA 5EGOA 1BI0A 1QZYA 3S1MJ 4Y52J 3J7ZI 3JAMZ 1F1ZA 2L2OA 4IO9F 5IT9K 3G1LA 3MN2A 1B9NA 2P7VB 4ON0A 2CH0A 3TW6A 2W48A 3HHGA 2R93J 1OCZH 2F5CA 2VJIA 4HG2A 2M5WA 3GLLA 5HLGA 2A05A 3OIQA 3QYFA 3CLOA 4X0GA 1P9QC 3CJTB 3M1EA 2UWMA 3FIWA 5HDGA 1YE9A 2EJRA 2JVHA 3ZR8X 4F52A 3JRAA 4V19K 1MJAA 4E6KG 2YR2A 2QBYA 3OR1C 2E7XA 2DMNA 1QZEA 1SAXA 3H3ZA 1UJ8A 1IDZA 3L2UA 3OIOA 1FWZA 4I02A 3S2WA 4UY8I 1X4PA 3S3NA 2FF4A 2Y0SN 1IUYA 2XKOA 4DYQA 3CLQA 3CO7C 1FY7A 5HLHA 3ERED 2L4AA 2ZXHA 3HIFA 3IRQA 1H0MA 3A01A 5CLSA 1D1CA 2P6TA 3RYRA 1R4NB 5B5EC 1VQ8I 2PJPA 4BQQA 4B47A 3V7RA 1G2HA 2XROA 4IOCF 6PAXA 2OTJI 2CSOA 3ZMUA 3LA7A 3EUHA 1NK2P 5IP9J 1XDUA 3DLAA 2DT7B 5ED4A 3ESWB 1U5TC 5E20A 2W25A 1HKTA 4A3KJ 1JHFA 2D1VA 2ZMEA 4HF2A 1TLHB 4QWQA 3OYNA 2JN6A 2EPFA 5DDGA 3RIRA 2VLAA 2VOPA 5ILSA 3O8HA 3DTEA 1A36A 2VT3A 1A31A 2H27A 3TO7A 2VQLA 1MDMB 1WJCA 4MLOA 2VQGA 4LLNA 2OQRA 1RNLA 2BXYA 3IKVA 1QPMA 5C44J 1QHHD 1USSA 2MC4A 2PBIA 4G9YA 4BKXA 3ULQB 3JR9A 2X6YA 4CYDA 1GV5A 1SFOJ 4F7ZA 2QYOA 4PSXA 1MBKA 2MLGA 3KZYA 3OV8A 3F8BA 3PQJA 5GAHJ 3ECHA 1Y0NA 4FX0A 4I99C 3V8LA 3KYCB 2JA5J 1EA3A 3K4BA 4ZC3A 4A5NA 3IH2A 2KT0A 1W5TA 3CMEI 3C3WA 5J1UA 1MBJA 1F36A 4DNCA 3SZTA 3ZMSA 2OD5A 1KQ8A 3Q0VA 1N25A 1OCTC 2DMQA 5JR3A 2E35A 3F21A 3TMOA 5J8CA 3K6GA 4AU7A 1P7JA 1XGSA 1R1UA 2LP0A 2GIZA 4MFEA 2VC1A 4ESBA 3I0TA 1YG2A 4J19A 3M3YJ 4M74A 4TV7A 2GOMA 5A2QZ 1W7PD 2M87A 1ERDA 3DXJF 1KZHA 3EPZA 1J09A 1G8XA 2BEOA 4I7HA 1Z3XA 2ECBA 2K40A 5LRSA 3CCQI 3BTJA 2FRHA 1U0JA 3JREA 2R5YB 4JX6A 1M1EB 3VOEA 4U7DA 3OL3A 1FYMA 2LBFA 2DI3A 4H0EA 1G3TA 2KMUA 3EUHC 2HXOA 1SVOA 4KFCA 1IRGA 1Z05A 3K1PA 4RGRA 4C30A 3D5LA 1K78B 4D7NA 4F3QA 4FISA 4ZDOA 2RREA 4J01A 4KN7X 3DKYA 3I4NJ 3ERMA 4CYCB 3QPLA 2ZMEC 4XQFA 1D8KA 3CQZJ 2E2HJ 3CC4I 2IBDA 3BG3A 4DYRA 3LSKA 2DLLA 3ABUA 5D6EA 5ILUA 1JKRC 2E36A 1J59A 2DFIA 2XRNA 3CMYA 5K7FA 2PJRB 3HRUA 2CG4A 1YRNB 2R4GA 2FD5A 3G1OA 1HKQA 1BW6A 3KPHA 1PP8F 1KU9A 1FJLA 4QPOA 3HM5A 3KZZA 3BTLA 3F8CA 2H6BA 3KEQA 2HYGD 1B1BA 3ABTA 3RCOA 1ZGWA 1K61A 3BLYA 2YSRA 3LL7A 2GAUA 1IF1A 4LFUA 3IKTA 1K79A 2BBYA 2CJJA 3TW7A 1E3OC 3M4OJ 3F8NA 3RSNA 2FOWA 3SEZA 3HOWJ 2BHYA 4CYCA 1EJ9A 3HRMA 3RPUA 2MGQA 4L9JA 2GOXB 1TWCJ 2RV8A 2YX4A 3CF5F 2HEOA 3CF2A 3NWTA 1EV7A 5D5VB 1TT5B 5FLXZ 3K0LA 1QO0D 2DK5A 2OZUA 3WE2A 1AWCA 4C2TA 5F64A 2EA4A 3HUGA 2YPRA 2Y2ZA 3E6DA 2K9SA 1XGNA 1EH6A 5JFRA 1XCVA 2PG4A 3W6VA 3LFKA 2GXAA 2DOFA 1XG1A 1XS9A 2L5QA 5BMZA 1ETQA 2CV1A 1EH8A 3DTKA 1JJ8C 3E5UA 3SYTA 4GCVA 1IXRC 1SVMA 3A4CA 5FRNA 3HXLA 4Y15A 2IS1A 1YO5C 1ON2A 4CA0A 4E4HA 4QTRA 3J80K 4U0WA 4EATA 1MBHA 1YQAA 1OQYA 5DTDA 4XOTA 3T8RA 3ZPLA 5EG0B 3ZGKA 3CCLI 3FMRA 5JHUA 3H3UA 1AU7A 2IXSA 1VQLI 1HSTA 1ENHA 3BG9A 1TP4A 2HI3A 3KCCA 2ELKA 2OC6A 1U9OA 2Y48A 1IC8A 3Q9SA 3B73A 5M3MJ 3E1SA 2XAHA 1WH5A 4W1UA 5BS6A 3CD6I 1Y39A 4IHTA 1BIBA 2IT0A 4XKCA 2OV7A 1FBQA 3S8PA 1GXPA 1OYYA 1UZCA 3VB2A 4B8XA 1T33A 4M9ZA 2M8EA 2R7DA 1PDNC 1FMVA 1XDSA 3V7CA 2ISZA 1FTZA 1HQCA 3HL2A 1UCRA 1ZLJA 3GTGJ 4C3HJ 3OYJA 1BL0A 2DQLA 3A1YA 2VJJA 1IN6A 4PK4A 1EKEA 2RVCA 4ANJA 3GFLA 2V1UA 4E7SA 3LQRA 4U7BA 3W2WA 1TL8A 4HX8A 5CQEA 2M34A 3Q0WA 2M8GX 1Y1VJ 2WY8Q 3K4CA 1KGSA 5EEAA 3IUOA 2EILH 4HZFA 4AYBA 4RMNA 2EIJH 1NG6A 3VYTB 1LKXA 1FX7A 1D3YA 3FKJA 2HWVA 2DOAA 1YIOA 2HQ5A 5DV5A 3ZQCA 3JCUC 3LOCA 1JTYA 2JTVA 1FLIA 1R00A 3J81Z 4ZH4F 2NS0A 4MNUA 4BBSJ 2Q8KA 2F4OB 3BPVA 4AVPA 1I1SA 1R1VA 3FHZA 2P7CB 4IXAA 3H9QA 4IX7A 3K4MA 1BBYA 2XGXA 3BZCA 3OS1A 2MD5A 4BGDA 2FOKA 3K1MA 1D5VA 5IOZA 1LE8B 2V1NA 2QWWA 1RZ4A 1R36A 5E1XA 2X6OA 2GQQA 3QU6A 4HNTA 3S16J 5IP6A 1X1AA 3CCYA 2IGKA 2E7WA 3QODA 3SQNA 4BACA 2YX7A 3KEYA 5E3MA 1BM9A 1WHUA 3AG1H 1XN7A 3F23A 3K2ZA 3QYBA 3EYIA 4LK1F 2IP2A 1FYKA 4FHTA 3N97A 4XONA 2B0LA 3I59B 3GTPJ 4RLFA 1XC5A 3DV8A 5KAFC 1MNEA 1CGPA 2NVTJ 3REOA 2W57A 2ELJA 2COBA 4B44A 2R7OA 2BY1A 5ILVA 5EEGA 2JT1A 2K9MA 1I5ZA 3I71A 2FMLA 4ENKA 3D1NI 1FT9A 1V3FA 3RTRA 5KNLA 1MD0A 2X48A 4A3CJ 1ETKA 2Z33A 5DD4A 2X6WA 4QPQA 1IJWC 2FE3A 2DN0A 1BR1A 3BJAA 3SZGA 4C3IJ 2CUFA 4HOBA 1OKRA 3G1MA 5JLXA 1JI8A 3HHHA 1HOMA 1NHAA 3GYHX 4KT5C 2DPUA 2Z3YA 4HRIA 3FMSA 2QA4I 1XMAA 1UG2A 2XSDC 5J40A 4YFXF 1DGWY 5J8FA 1K83J 1SD5A 3FXQA 4M3BA 4IVNA 2K3PA 1XX5A 4RGSA 2DXIA 1JT0A 1LUJB 2V7FA 2ZFWA 4A3BJ 4HDVA 3JRHA 3DU5A 2RNJA 1ZG5A 1ZREA 1IXCA 3GW2A 2UV1A 4B48A 4HNVA 3JRBA 1MH4A 2GM4A 4NQWA 2QSGX 2AQEA 5ERIA 3ELKA 3S17J 2MG4A 4CCMA 4S0HB 3EDPA 3WTTC 4V2FA 4JX4A 1X4OA 3UR3C 2IJLA 1SFXA 2E71A 2Y0MA 3HJEA 4OMYA 3HGGA 4XN0A 1JKQC 3FXLA 4O5VA 1YW8A 1PUFB 5LFAA 3ZMTA 1JE8A 1W7PB 3CCEI 3BPXA 4IKFA 1IN4A 2XVCA 4L9TA 3GZ6A 5H20A 4DZJA 1VQ9I 4KDPA 2F5VA 2A3SA 1U3EM 2Z2SB 2Y9ZA 4XN3A 1X3WB 2K4JA 4XMYA 1IRZA 3KX2A 2XIGA 2GBYA 2ZKZA 4BXFA 2FBHA 2ZCWA 3HSRA 2BV6A 2BW3A 5HDNA 1TW3A 3DKWA 2ZSHB 1PVEA 1SD6A 4BS9A 1RR7A 2E2JJ 2FUG2 2HZDA 2NVYJ 3E3VA 2G9WA 4FT8A 4QIWN 1SD7A 2DW4A 4LG0B 3MAJA 3AL0C 3QU3A 4FE7A 1Z1DA 4YRVA 1R5GA 4NC8A 5B1AH 2PMZA 3ASOH 3VEPA 3ZXSA 4BQNA 3MKWB 4IPAA 2XGDA 5J4VA 4OIQF 2O8XA 2RAEA 4F92B 3DPUA 1MJBA 4IJAA 3DWLE 2XGEA 3G6EI 1R71A 4A3JJ 3LSHA 1Z7LA 4LMYA 5B1BH 1R23A 4II3A 2L9VA 3VYRB 2VXDA 1R4MB 3BC8A 4NDLA 3G71I 1GV2A 2FNPA 2KZVA 3JW4A 4MO7A 3NRVA 2HTSA 3GTJJ 1QBJA 4OWRB 2OZ6A 3A2KA 4PZJA 4RAZA 1A5JA 4E7IA 1J5YA 5E3NA 1ZAOA 3ZMVA 2XB5A 4A0ZA 2A6HF 2W82A 3IV5A 1RKWA 2M2EA 3PFIA 1BI3A 3EYYA 5JHFA 3OS2A 3ISPA 1QVTA 4EVIA 5L3BA 4WWCA 3TEDA 2R7SA 5DCFA 3GBGA 1V54H 2CUEA 2M7BA 4LLGF 2HPIA 1ORKA 2AXLA 2I5UA 3E97A 3I55I 2HPMA 2H09A 4C2MJ 1W5SA 2PMHA 5CJ9A 2QGUA 3OYHA 3LA3A 2P0WA 3GO5A 3FXKA 5IT3A 3S1RJ 2Y31A 3FK6A 3FKIJ 3KYLA 2NVXJ 4J00A 4AVZA 2EA2A 4KIBA 3G3ZA 1FPQA 4G7HF 1ONVA 2K4BA 2HQRA 4DZPA 3FXJA 5IT9Z 3OWTA 1Q1HA 2O0YA 4AWXB 3J7YJ 4A3IJ 4ZTJA 5LEJA 2XDVA 3S3MA 2WC2A 1I6XA 1WWXA 1DPRA 5F1RA 4UVBA 4A3EJ 1ZG1A 1W4MA 3T0YA 2MH9A 1YITI 4U0VA 3E5QA 3O8GA 3L2WA 2E60A 1BC8C 5FD5A 3KIOA 1FEXA 1A04A 3B6CA 2QVOA 4RB0A 2ZB9A 2GLOA 2CO5A 1MNDA 1LB2A 2DT5A 4KNYA 2R7XA 2NAZA 2MSYA 3CUQB 5EZHA 3RYPA 2XV4S 1U6GA 2V9KA 1TC3C 3GX4X 5ICFA 3TKYA 2J5OA 2QCOA 4EJOA 1Y0UA 4RGUA 1S8NA 2MABA 1MJ9A 1FOXA 4B1RA 1YJNI 2EQRA 2KIQA 2LY9A 3DQVC 4R1HA 4IHWA 2H94A 4OAZA 4XOPA 2CU7A 5M5XJ 3CUOA 3WTZA 4BJTA 3DEEA 1AOYA 4KT6A 3BG7A 1A35A 1B4AA 4UUTA 1MMGA 2DDAA 1YX5A 1MIJA 1UG0A 1X2NA 2FXAA 1JTXA 1FP2A 2KLOA 1QVUA 1LVAA 5EYRA 1W0UA 3HRTA 2KJCA 5IYCJ 3I56I 1SFUA 5ICCA 3S3OA 4FTHA 3GFIA 3AG4H 3C2HA 2D45A 4A12A 2KL4A 1S7OA 2DAOA 3PUFA 1G6NA 3M8JA 1HSJA 1WQ2A 2BE5F 1BW5A 1LNWA 2Y9YA 5E3OA 1H9GA 2UZKA 2K9QA 5F08A 2D5VA 4FQGA 5HS9A 1I27A 2IGNA 1IGNA 4AIJA 3BR5A 4EM2A 3A03A 4QLCU 3VODA 3VDXA 1UAAA 4XR6A 2VXZA 1HXDA 5CPRB 3OY9A 2CW7A 1MBEA 3JTGA 1Z6TA 1HW5A 1B8IB 2L7FP 1ZKGA 1X19A 5TJJA 2LKPA 3FISA 2CUJA 4LK0F 4EJVA 2LYCA 4EQQA 1MNMC 4D5CA 2XKPA 2L7ZA 3I53A 1K6OA 2GIVA 2VQHA 4HAMA 4N9HA 2HVRA 1D8JA 1SMTA 3H92A 2HKXA 4UB8C 2ZO4A 4L0YB 2QQ8A 2Y0SA 3X2QH 1TZLA 3HC7A 3AG3H 3IWZA 5GADJ 2M7AA 2A6EF 4OMZA 4S05A 4C2UA 2DA5A 3ZQGA 2XHKA 1WJEA 2OTLI 3J7AY 5JVTA 2CV2A 2NXNB 4XLHA 4BNCA 2ZJRF 2KZGA 4CCKA 4FX4A 1J2XA 5L3FA 3CCUI 3HBLA 3HTUA 1S72I 1R6RA 4G8XA 5EEHA 5GTIC 1IZ1A 4RB1A 1WFXA 4ITVA 3H35A 3QOPA 4I2OA 1BR2A 4HQMA 4PGHA 4NB5A 2XAUA 3KP7A 3WTUC 4RB2C 2LH9A 2NNNA 3FXRA 4BDYA 3FDYA 4G6TB 2X4HA 2G7UA 4S04A 4BQAA 1QQIA 2VJ5A 5CVUA 2EFPA 3VSKA 3ZN1A 3I64A 1I6HJ 1LEAA 3NAUA 2LVSA 2VPLA 1TWHJ 2W84A 3RPQA 4L5IA 5M5YJ 1BC7C 4O3MA 5J4YA 2V9PA 1GLNA 2DFHA 4BHBA 3LSMA 2KKOA 1T38A 1I3QJ 1D0ZA 4N9IA 1T39A 3CZ6A 4UUSB 4A2UA 4Y13A 1SFEA 3R6SA 5LHIA 2M4KA 3J7AO 1VQOI 3LSPA 4L5EA 3L2VA 4A3FJ 1B72B 1BA5A 5D5UB 1CF7B 2BY3A 1OCOH 3SDBA 2NOJB 2NRAC 2KIMA 3SZPA 1LJ9A 1MMAA 3N05A 2QENA 3QPTA 1LFPA 2OCCH 4A3LJ 1E0EA 4XL9A 4A6DA 3MZHA 2ZJQF 3MD2A 1I50J 5FD6A 1ETWA 2L7KA 4D5FA 5J3LA 2GXGA 1IDYA 4XICA 1MDMA 2VUMJ 3FWEA 1AKHB 3DP7A 4MFDA 1FIAA 2E1MC 2UUZA 1O7FA 4IZZA 1X3UA 2DO7A 3SEQA 5FKOA 5ICEA 4HQEA 3RZDJ 5E8IA 1OCCH 3K7AJ 3SFIA 2JA8J 4KYWA 2Z16A 4LOCA 4Y4RA 2ID6A 4W97A 3VFZA 1WJ5A 1NG7A 2DT6A 1ZARA 5L3GA 1YJWI 3DBRB 3J80Z 3CMAI 4G7ZF 3ZN0A 3HB9A 3U1DA 4OINF 1O3SA 4EJTA 5CVVA 1JUSA 2BY0A 2W00A 5K5RA 4MEYF 4JYKA 3WHBA 4DJAA 3PNVA 1ON1A 4BDZA 1ETVA 2P6SA 1FYLA 3V8KA 2JWTA 2W1OA 5LHHA 1ZH5A 3K70D 2WY7Q 2ZJPF 4HX4A 1Z0XA 1MH3A 1DQUA 5E18F 2LTPA 2DJIA 1USTA 3H0DA 2QSFX 4X6AJ 2GWRA 1VQPI 4PGGA 3C1DA 1GVJA 2P8TA 2K27A 4KN4X 4LITA 3KLNA 2V79A 2MBFA 4BE2A 1X1BA 4Z2YA 3JSOA 4M72A 1VQNI 2VB6A 3RZOJ 4Q47A 2R5YA 4M3EA 2ISYA 4HV5A 3Q9VA 1O7LA 3HSFA 1G4DA 3MZYA 3W6KB 2VKVA 4E7ZA 1VQ6I 3NQOA 2HNHA 1WI3A 3NARA 4M9XA 2WADA 2ZNYA 1K78A 2R7RA 4MEXF 3OIPA 4BEHB 4F55A 2D2WA 2HKOA 2RQQA 4NUBA 4O6JA 3T8TA 4XRSA 1W5CC 3M9AA 2LREA 5BQTA 5D5WB 2IAIA 4ENNA 3WHCA 2EK5A 2RN7A 4ENMA 1SANA 5D8LB 2WV1A 2IEKA 2IS4A 1V4RA 1HLVA 2OJED 5M5WJ 4A0XA 1Y6IA 1G3YA 3CDIA 5LGNA 2JQ7A 2PJRA 1X1CA 3OSFA 3OYLA 1YRNA 4E7KA 3FBIB 2Y30A 3PFYA 1JGGA 2QM3A 4MTEA 5CYVA 4X1EA 1VQ4I 3K10A 4BXXJ 2QQBA 3TDZC 4F93B 2H6CA 1UHWA 1XTAA 1KU3A 1E17A 3E5XA 3OYIA 4ABZA 2ZXJA 3I9V2 2G7HA 1XSDA 4PJMA 3VYUB 3U9GA 2ZXIA 2HZTA 3ASNH 3HKZN 5FFZA 4M6YA 2CV0A 1I39A 2I8DA 4U87A 2FQ3A 4IHSA 2OAZA 4ZZDA 1GUUA 2P81A 4YIRX 4L5JA 3ZP5A 4OU0A 3OS0A 4BE0A 1O3RA 3GFMA 1UB9A 1U9NA 2RC4A 4ETSA 2QKLB 4L18B 3P9CA 3V4GA 5C3EJ 1UELB 4XKBA 4RS8A 1JT6A 5L3EA 3PSFA 3GTMJ 4CCJA 1WJAA 3DPLC 3WU0A 1Y8RB 1ZRDA 2LOOA 1SD4A 4QSHA 1FTTA 2E5ZA 4XORA 2OBPA 4RA2A 5AONA 1MSFC 2L0KA 2Q0OA 1IRFA 2EZLA 1ETXA 2ESHA 3H5AA 5AIPA 1FOKA 5BPIA 2IW5A 2JJ7A 3HOYJ 2CUZA 1TWAJ 2CW0F 4L9VA 4HLXA 4FASD 2L9NA 1YTYA 2BVMA 3TP0A 2L9RA 1T95A 3G2BA 3E6MA 5EG0A 3B6AA 1ZRFA 1TQPA 2VOOA 3BR3A 2R0QC 2KIUA 3W2VA 2LD5A 3K69A 4KA4A 2JMWA 1MMDA 2W85A 2OU2A 3LSGA 2TCTA 3PNTA 2K3FA 1PJRA 1E3PA 2ZSIB 3HYIA 3M8EA 3B02A 3GTQJ 3S2HJ 4HEA2 2WV0A 3JSPA 4YIFA 3G73A 3H36A 1D0XA 2RDPA 2F5FA 2FU4A 3MQ0A 4LB5A 2QEXI 1XMXA 2UXXA 2LKSA 1KONA 3S14J 2E1CA 2B7EA 4EV0A 4LG3A 2L9SA 2W7NA 3WTYC 4UVAA 2HOAA 5F6FA 3CO6C 3GZ5A 2Q1ZB 3C2BA 4BY1J 2OA4A 5HNHA 2DCEA 1STZA 2L3DA 4A6EA 3MKZA 2F6CA 3F8MA 1IRXA 2RKHA 5ICGA 5FKNA 4D7MA 2V1DA 5HVQC 1BIAA 3RQIA 4XRSG 3OYDA 3LWFA 4I6ZA 2ZBKA 3V8JA 5AIQA 1LFUP 4IRHA 3M8FA 1U78A 5FLVA 4GXOA 3LMMA 5FKKA 2V6EA 2WB1N 4JOMA 3AAFA 3KP3A 5TRDA 5CVIA 2M3AA 3OR2C 4WXHA 4P96A 3RQ4A 1W36C 3ABKH 5EDNA 5DS9A 4PDKA 4I0AA 2YU3A 4GGGA 2DMPA 4IRGA 2O6GE 3S32A 3PM1A 3LA2A 1G59A 4IHVA 1UHMA 2E2IJ 3HRSA 1LE8A 4CICA 1FOWA 1DU0A 3F6OA 2R7UA 3ABLH 5CVJA 5IY5H 5D6FA 5K7ZA 4HA8A 1UMQA 3BP8A 2FBIA 1U8BA 1T08B 2VBXA 3M07A 3ML6A 3I59A 4MHGA 2ZFUA 1HW1A 3BJOA 2LRDA 3TBIA 3LAJA 3P9IA 1CQTA 1B59A 2XSJC 2CGPA 1HC8A 4BU2A 3R61A 2BY2A 3SHFA 1VTNC 2FA5A 3FHNA 2V6CA 2GXBA 2M1BA 1FNNA 1G3SA 2LY1A 4RAYA 2VN2A 2JA2A 4UVCA 1FSHA 2AS5F 2MW8A 2WAFA 3JRIA 3P7NA 2X6XA 3CP2A 1H88C 1ZRCA 1DP3A 1H8AC 1TW2A 1XSXA 2A5WA 5F0CA 4WX9A 1N77A 2QKMB 3UKGA 4BE1A 1IV6A 3Q3SA 1E3HA 4KUMA 1W1WE 4CDGA 3CC7I 5FKLA 1UFMA 2E34A 1I3AA 2ELHA 1Z77A 1X1DA 2FMYA 3L1PA 1VI0A 5DUIA 4GFBA 2X1DA 3JAMK 2PLYA 4ZZLA 1Z67A 1KQ0A 4UB6C 5IYDJ 1F4KA 1WI9A 1IO2A 2HU9A 3GTKJ 3QP5A 1HW2A 4R79A 1Z7UA 1L3LA 1YLFA 2KHMA 4PUSA 3S1NJ 1IXSB 2MLKA 4RGXA 4RM2A 3M1CA 4P9FA 5FLMJ 3I3LA 2M0MA 2G0EA 1F9NA 4EGZA 2P5VA 3FF5A 1ZR2A 2KDZA 4CCNA 5DM7F 4B43A 3CJNA 2XPUA 1BI1A 3MMYB 4WXCA 1ZLKA 3A02A 3DFGA 1MKMA 4P1WA 5KVRA 4EMSA 5TISC 2R7WA 3MZ8A 4BYYA 3HG9A 3HPHA 1SFKA 4BJ6C 5BOXA 1BR4A 2V26A 4DGWB 4JQFA 2D1HA 1XGOA 3IH4A 2WAEA 1FOYA 4I76A 1PUFA 5GPCA 1W7PA 3RPUD 1QA6A 3FM3A 4ZYEA 1WJFA 4BBRJ 2NS7A 1SMYF 1XGMA 2R7QA 4JBAA 4Y33A 3CJRB 4M6VA 2CRGA 1ZG3A 4XK4A 2K86A 2CFOA 4AC0A 1FBSA 2PMZN 3BROA 1SVLA 3HOTA 2DA3A 4RAGA 5LGUA 3RJPA 1YJ9I 4M3GA 2VJ4A 1OMIA 3W2AA 4DOZA 4LG0A 4CZCA 5KK1A 2LLKA 1X1PA 3QOEA 2X85A 2VQCA 1EH7A 2X1CA 2LDUA 3LQQA 3N4MA 1I1GA 1RI7A 4OIRF 2WBMA 3E6CC 5DCMB 2DA4A 1J7KA 5HNFA 4HF1A 3HTSB 1G3WA 3EQLF 3L00A 1VZ0A 1XCBA 3V7SA 4XLFA 1BJZA 2F5EA 2W24A 2XAGA 1XPXA 2X0LA 4DYCA 1APLC 1F5TA 3BWGA 2O7OA 3ZQQA 2CMPA 1B6AA 3BZ6A 3OYCA 1R49A 1S29A 1IN5A 3BR1A 2PX9A 2L4MA 4OOIA 2F48A 1IG7A 2WAQN 4LB6B 3FXOA 2HOTA 3PL8A 3Q0UA 3H0GJ 1D0YA 1NTCA 4EM0B 1BJAA 1DGRM 2EWNA 2CFXA 4D0PA 5GAGJ 1U5TB 3OYAA 4HDUA 1KYZA 4M73A 4MQVA 3S1QJ 4BY7J 3K2AA 2PQ8A 1HBXG 1PUEE 1O57A 4WCGA 2ZC2A 1F43A 2R3SA 2XAFA 4A3GJ 2Q2EB 1QRYA 5FO5A 3TL4X 4A5MA 4I98B 2XC7A 4LD5A 2BZTA 3CCSI 2OF7A 4MIMA 5HDKA 1FP1D 3R4KA 4XSZF 5E1WA 4CSWA 2JA7J 2H1LA 3F6VA 4P55A 4ZYHA 4IQJA 2IS2A 3BTCA 2R5ZB 2FX0A 3SJMA 5GP9A 4AIDA 3R60A 4H4KC 3KP2A 4V2GA 3RKXA 1YS7A 4K2EA 5L3DA 1ITYA 5EGOB 2DYSH 5GPAA 1BOAA 3ZQIA 1ETOA 3KFWX 3NEUA 2NOGA 1LDKB 2FSWA 2O5RA 2Y69H 2J5PA 4BJ5C 4ZJZA 1P4WA 4Q48A 3LAPA 2XF7A 5FRMA 5IOYA 3S2DJ 4HV6A 2X9DA 2EB7A 4DBQA 4BUPA 2QQAA 3CUQA 4G94A 4PJ0C 4F91B 4C9YA 2R7FA 1BOBA 5J47A 1JJ6C 3K9TA 2EV6A 4JK1X 4L9NA 2DMTA 3E6BA 3ZQHA 3CCVI 4IOAF 1KA8A 4ZDPA 2KQRA 5LGTA 3U1KA 2QBYB 3CESA 1S5LC 4OIPF 1R1TA 2O3FA 3TGNA 3CMMA 3HOZJ 2F5DA 4P9UA 2R7ZJ 3MKYB 3WG9A 4HW0A 1S9HA 4CCOA 2P4WA 4KICA 4XNFA 4CHUA 3KYDB 3ZRGA 3K4NA 3OYEA 1P7IA 2IA2A 2X51A 3A01B 2CYYA 4FE4A 4PJNA 1X58A 2JUCA 2K9NA 5D8KB 2CWEA 3BJ6A 3H3VK 3GFJA 2HYFA 2E19A 5LHGA 2HDDA 1MMNA 2UXNA 4XKVA 4BAYA 3D0SA 3PIOF 4OAYA 4AD9A 2XAJA 3IAS2 2PFBA 2XASA 2DODA 1ZHFA 1WJBA 3W6JB 2ZMEB 1YS6A 2JZYA 2M30A 2Z99A 3H9GA 4U88A 2XPWA 2F4IA 4MTDA 3QAHA 3OSGA 3PUBA 3R0JA 4CCLA 4A69C 1WRJA 3OOUA 5JLWA 2VKEA 4AM3A 1P4XA 4HSRA 3KP6A 3L2RA 1WZ2A 1DPUA 1Q1VA 2HFHA 1LEBA 5FFXA 2KFDA 1B8IA 2MC3A 1ZYRF 2LSOA 5E3LA 4EEFG 2ACJA 2HXIA 3ZQ7A 2PEXA 2JPCA 4WF2A 1RKTA 3QP6A 1FZPB 4ZTFA 2YUSA 4ZYDA 2HS5A 3OYKA 3ZQLA 2PI0A 2PN6A 3IAM2 2LMDA 3BR6A 1VF9A 4AIKA 1QNTA 1D5YA 3CUQC 3WE3A 1QZZA 4NBQA 3BCBA 5J6XA 1W0TA 2XF5A 2HVQA 4LGWA 4XM3A 1YOVB 1T2KA 5JVGF 4G7OF 3K4KA 1N78A 3KEOA 5JI6A 3S15J 4IQ4A 1OPCA 3ZMDA 2HDCA 3BOQA 1QU3A 3DKXA 1HKSA 1ACIA 1MBFA 1OYIA 2IA0A 3MVPA 3OOPA 3T5XA 5H6QA 5J1RA 1MW7A 4KITB 5D4SA
chains in the Genus database with same CATH topology
2L01A 2Z9OA 2KJBA 1L0OC 4MGRA 3F3XA 4RB3C 3TOBA 1YW7A 2BGCA 3MEXA 5LLQA 5K5OA 1ULYA 2IRFG 2EV0A 5DUKA 3HSEA 4YG2F 1OR7A 4WK8F 1TNSA 1XD7A 4BH9A 1ZGAA 1R58A 1P92A 5LEKA 2XUBA 3IHUA 2RQPA 2M45A 3WTWC 1CF7A 1DP7P 1S3JA 2DU9A 3GXOA 4I09A 1OYWA 1TTYA 4E70A 2O61A 2EFOA 2MA3A 2K7LA 4PCQA 2JPBA 3GLXA 1C0WA 3F8FA 2O03A 3FXUA 2VE9A 3WODF 4HYEA 3TOAA 1GXQA 4ASNA 2VT2A 1PP7U 4I0BA 4Q5SF 2LF8A 3IC7A 1TNTA 4XBFA 2NYXA 4ESFA 1J9IA 2VBWA 3L2CA 3DF8A 2STTA 3GF2A 3WTSC 2FEZA 4UV8A 4YFNF 1XB4A 5FB2A 3BDDA 1K7AA 2VE8A 5D4RA 3WGHA 2E1NA 4CXFA 1KU7A 1Z91A 4IRIA 2K02A 5A2QK 3QRFF 2WWYA 4UXNA 1LDDA 1ODDA 1YW9A 2L54A 4HF0A 3SFZA 3FZVA 3ECOA 2WTEA 4HBLA 2QLZA 1U8RA 3C7JA 4HLYA 1RUNA 3O6BB 3TO6A 2ZNZA 3L9FA 4GYGA 4L0ZB 2A61A 2DQRA 2QQ9A 2OQGA 5K1YA 3L09A 2XAQA 2Y75A 3ZMZA 3I58A 4HX7A 3TO9A 2DK8A 4I01A 4M6XA 3F22A 2MH2A 5E8GA 1DDNA 2JRTA 4IF4A 1MZBA 2VBYA 4NHJA 4XLPF 3U2RA 3I4PA 2BYVE 1XSVA 2HQNA 1E2XA 4ENJA 4KIFA 3WU1B 3TDUC 2ETHA 4G6QA 2L02A 5FLXK 5LRRA 4BXUA 1S6LA 3RKWA 4UHTA 2CQKA 3MFKA 4KMUX 1O3TA 2LF7A 2QUFA 5FGMA 1T0FA 3PQKA 5HS7A 3KETA 5K5QA 2QZ8A 3GVAA 3QPHA 3TQNA 4M9SA 1U2WA 1KU2A 1R5HA 2A68F 3IWFA 3FX3A 2IVMA 4YIIA 5DEQA 3RKYA 2KIFA 2C6YA 3I54A 2LNBA 3FM5A 3MCZA 4M71A 1T98A 1IAWA 2EFWA 2A69F 2A5YB 4CGZA 1B9MA 4EJWA 2EFQA 3L7WA 2GZWA 5HS8A 3WTVC 2EV5A 1IN7A 1IN8A 4UUVA 2HOEA 1MGTA 1YFHA 4LLLA 3KP4A 3JTHA 4A0YA 1BN5A 2IA1A 5HOOA 4U0YA 2EFNA 4AIHA 3T1BA 3J81K 1R7JA 3COAC 2DBBA 1FC3A 2STWA 2JSCA 4EJUA 4EGYA 2ESNA 1JGSA 1TQIA 4EM1A 3ROUA 2VONA 3GWZA 2P5KA 4ESJA 1JHHA 2HGCA 1P4AA 3GUDA 2GA2A 5LBQA 1LDJA 4XLNF 2DPDA 4B09A 3IRRA 3WTXC 1ZN2A 4KIGA 1WSUA 4GO1A 1J0RA 2COMA 1T6SA 1FBUA 3SXYA 5D5XB 3MWMA 2HR3A 4Q4ZF 4N0BA 1REPC 3WGGA 1DUXC 3RI4A 5CVRA 2KRFA 2RGVA 2P5LC 3FMQA 1P2FA 4CZZA 5DYMA 4WXDA 4G6DA 1IW7F 1GHCA 1LQ1A 1XMKA 3CTAA 1Z9CA 2VODA 4GYIA 2NNYA 3CDHA 4UNOA 3R0AA 3KLOA 1J75A 1S7AA 1BI2A 2VC0A 4CO8A 2IPQX 3EETA 2PMUA 3O3KA 1ZGJA 4MQ9F 4YFKF 1Z6RA 4ZYGA 2ADUA 5E1ZB 1TBXA 4P5OA 1RUOA 3KP5A 2V1XA 4R8HA 2FNAA 4KMFA 1RIOH 2GA1A 3RDIA 1R22A 2Z5UA 1TQMA 3BY6A 3M7GA 3C18A 4LJZF 1FSEA 3GEZA 3DPTA 1O3QA 5BPDA 3F72A 3LSTA 3IL2A 4OIOF 5DCMA 3DEUA 1H9TA 1QGPA 2V9VA 1KQ9A 2TDXA 3I5UA 1P6RA 5L3CA 3HOSA 5E17F 1U5TA 5HLIA 2A07F 5DD8A 4XSXF 4BHPA 2FBKA 2VBZA 4BHCA 2Q2EA 4Y17A 2ZJ2A 1JXSA 3K1NA 3KE2A 2HTJA 4DQ2A 3O2PE 3Q5FA 3WGIA 4UV9A 1KYWA 4XRFA 3P9KA 1WKMA 2DTRA 2F2EA 1YYVA 1BI0A 1QZYA 3JAMZ 1F1ZA 5IT9K 1B9NA 2P7VB 4ON0A 3HHGA 2F5CA 2M5WA 5HLGA 3CLOA 3M1EA 2UWMA 5HDGA 2EJRA 1MJAA 2YR2A 2QBYA 2E7XA 1SAXA 3H3ZA 1FWZA 4I02A 3S2WA 2FF4A 1IUYA 2XKOA 3CO7C 1FY7A 5HLHA 3ERED 2L4AA 3HIFA 3IRQA 1H0MA 5CLSA 2P6TA 3RYRA 2PJPA 3V7RA 2XROA 6PAXA 2CSOA 3ZMUA 3LA7A 3EUHA 1XDUA 5ED4A 1U5TC 5E20A 2W25A 1HKTA 1JHFA 2D1VA 2ZMEA 4HF2A 1TLHB 4QWQA 5DDGA 3RIRA 2VOPA 5ILSA 2VT3A 2H27A 3TO7A 1MDMB 4LLNA 2OQRA 1RNLA 3IKVA 1QPMA 1USSA 2PBIA 4G9YA 3ULQB 4CYDA 4F7ZA 2QYOA 2MLGA 3KZYA 3OV8A 3F8BA 3PQJA 3ECHA 4FX0A 3V8LA 4A5NA 1W5TA 3C3WA 4DNCA 3SZTA 3ZMSA 2OD5A 1KQ8A 5JR3A 3F21A 5J8CA 1XGSA 1R1UA 2VC1A 4ESBA 3I0TA 1YG2A 4M74A 4TV7A 5A2QZ 1W7PD 2M87A 3DXJF 2BEOA 4I7HA 5LRSA 2FRHA 3VOEA 4U7DA 1FYMA 2DI3A 4H0EA 1G3TA 1IRGA 4KFCA 1Z05A 3K1PA 4RGRA 3D5LA 1K78B 4KN7X 1D8KA 2DLLA 3ABUA 5D6EA 5ILUA 1J59A 2DFIA 2XRNA 3HRUA 2CG4A 1HKQA 1PP8F 1KU9A 3KZZA 3F8CA 2H6BA 3KEQA 2HYGD 1B1BA 3ABTA 2YSRA 2GAUA 1IF1A 4LFUA 3IKTA 1K79A 2BBYA 3F8NA 3HRMA 3RPUA 4L9JA 2YX4A 2RV8A 2HEOA 1EV7A 5D5VB 5FLXZ 3K0LA 1QO0D 2DK5A 2OZUA 3WE2A 1AWCA 5F64A 2EA4A 3HUGA 2YPRA 3E6DA 1XGNA 1EH6A 5JFRA 1XCVA 2PG4A 3LFKA 5BMZA 1EH8A 3E5UA 4GCVA 1IXRC 4Y15A 1YO5C 1ON2A 3J80K 4U0WA 1YQAA 3ZPLA 3T8RA 3FMRA 5JHUA 3H3UA 1HSTA 3KCCA 2Y48A 3Q9SA 3B73A 2XAHA 5BS6A 4IHTA 1BIBA 2IT0A 1FBQA 1GXPA 1OYYA 3VB2A 4B8XA 4M9ZA 2M8EA 2R7DA 1PDNC 2ISZA 1XDSA 3V7CA 1HQCA 1UCRA 1ZLJA 2DQLA 1IN6A 2RVCA 3GFLA 2V1UA 3LQRA 4U7BA 4HX8A 1KGSA 4HZFA 1FX7A 1D3YA 2HWVA 1YIOA 5DV5A 2JTVA 1FLIA 1R00A 3J81Z 4ZH4F 2NS0A 4MNUA 2Q8KA 3BPVA 4AVPA 1I1SA 1R1VA 3FHZA 2P7CB 4IXAA 1BBYA 2XGXA 2MD5A 2FOKA 3K1MA 1D5VA 2QWWA 1RZ4A 1R36A 5E1XA 2GQQA 3QU6A 2E7WA 3SQNA 2YX7A 1BM9A 1XN7A 3F23A 3K2ZA 3EYIA 4LK1F 2IP2A 1FYKA 4FHTA 3N97A 2B0LA 3I59B 3DV8A 1CGPA 3REOA 2W57A 5ILVA 5EEGA 2JT1A 1I5ZA 3I71A 2FMLA 4ENKA 1FT9A 1V3FA 3RTRA 1MD0A 2Z33A 5DD4A 2FE3A 3BJAA 4HOBA 1OKRA 3HHHA 1NHAA 3GYHX 4KT5C 2DPUA 2Z3YA 3FMSA 1XMAA 4YFXF 5J8FA 1SD5A 3FXQA 4IVNA 4RGSA 2ZFWA 4HDVA 2RNJA 1ZG5A 1ZREA 1IXCA 3GW2A 4NQWA 5ERIA 3ELKA 3EDPA 3WTTC 2IJLA 1SFXA 2Y0MA 4OMYA 4O5VA 1YW8A 3ZMTA 1JE8A 1W7PB 3BPXA 1IN4A 2XVCA 4L9TA 3GZ6A 5H20A 4KDPA 2A3SA 1U3EM 2K4JA 2XIGA 2ZKZA 2FBHA 2ZCWA 3HSRA 2BV6A 5HDNA 1TW3A 3DKWA 1SD6A 4LG0B 3E3VA 2G9WA 4FT8A 1SD7A 2DW4A 3MAJA 3QU3A 1Z1DA 1R5GA 3VEPA 4IPAA 4OIQF 2O8XA 1MJBA 4IJAA 4LMYA 1R23A 2FNPA 3JW4A 3NRVA 2HTSA 1QBJA 2OZ6A 4PZJA 4RAZA 1J5YA 1ZAOA 3ZMVA 4A0ZA 2A6HF 3PFIA 1BI3A 3EYYA 3ISPA 4EVIA 4WWCA 5L3BA 5DCFA 4LLGF 2AXLA 3E97A 2H09A 1W5SA 2PMHA 5CJ9A 3LA3A 3GO5A 5IT3A 2EA2A 4KIBA 3G3ZA 1FPQA 4G7HF 1ONVA 2K4BA 2HQRA 5IT9Z 1Q1HA 2O0YA 4AWXB 5LEJA 2WC2A 1I6XA 1WWXA 1DPRA 5F1RA 4UVBA 1ZG1A 1W4MA 3T0YA 2MH9A 4U0VA 3E5QA 1BC8C 5FD5A 1A04A 2QVOA 4RB0A 2CO5A 1LB2A 2DT5A 4KNYA 2NAZA 3CUQB 3RYPA 2XV4S 1U6GA 3GX4X 5ICFA 3TKYA 2J5OA 4EJOA 1Y0UA 4RGUA 1S8NA 1MJ9A 3DQVC 4R1HA 2H94A 3CUOA 3WTZA 1AOYA 1B4AA 2FXAA 1FP2A 1LVAA 3HRTA 2KJCA 1SFUA 5ICCA 3GFIA 2D45A 4A12A 1S7OA 2DAOA 1G6NA 1HSJA 1WQ2A 2BE5F 1LNWA 1H9GA 2UZKA 5HS9A 1I27A 4AIJA 4EM2A 4QLCU 3VODA 2VXZA 1HXDA 3JTGA 1Z6TA 1HW5A 5TJJA 2LKPA 4EJVA 4LK0F 4EQQA 2XKPA 3I53A 1K6OA 2GIVA 4HAMA 4N9HA 1D8JA 1SMTA 3H92A 2HKXA 2ZO4A 4L0YB 3IWZA 2A6EF 4OMZA 4S05A 2XHKA 5JVTA 4BNCA 4FX4A 1J2XA 5L3FA 3HTUA 4G8XA 5EEHA 1IZ1A 4RB1A 3QOPA 4I2OA 4HQMA 4PGHA 4NB5A 3KP7A 3WTUC 4RB2C 3FXRA 2NNNA 2X4HA 2G7UA 4S04A 4BQAA 1QQIA 5CVUA 2EFPA 3ZN1A 3I64A 1LEAA 2W84A 3RPQA 4L5IA 1BC7C 4O3MA 4BHBA 2KKOA 1T38A 4N9IA 1T39A 4A2UA 4Y13A 1SFEA 3R6SA 5LHIA 3J7AO 5D5UB 1CF7B 2NRAC 2KIMA 3SZPA 1LJ9A 2QENA 3QPTA 4A6DA 3MZHA 5FD6A 2GXGA 1MDMA 3FWEA 3DP7A 1O7FA 1X3UA 2DO7A 4HQEA 5ICEA 5E8IA 4KYWA 3VFZA 1ZARA 5L3GA 3J80Z 4G7ZF 3ZN0A 3U1DA 4OINF 1O3SA 4EJTA 5CVVA 5K5RA 4MEYF 1ON1A 2P6SA 1FYLA 3V8KA 5LHHA 1ZH5A 4HX4A 5E18F 1USTA 2GWRA 4PGGA 3C1DA 1GVJA 2P8TA 2K27A 4KN4X 3KLNA 2V79A 2MBFA 4Z2YA 3JSOA 4M72A 4Q47A 2ISYA 4HV5A 3Q9VA 1O7LA 3HSFA 1G4DA 3MZYA 3W6KB 3NQOA 4M9XA 2ZNYA 1K78A 4MEXF 2D2WA 2HKOA 4O6JA 3T8TA 3M9AA 5BQTA 5D5WB 4ENNA 4ENMA 2EK5A 2RN7A 5D8LB 1V4RA 4A0XA 1G3YA 5LGNA 2QM3A 4MTEA 5CYVA 2QQBA 3TDZC 2H6CA 1UHWA 1KU3A 1E17A 3E5XA 2ZXJA 2G7HA 1XSDA 3U9GA 2HZTA 5FFZA 4M6YA 2FQ3A 4IHSA 2OAZA 4ZZDA 4L5JA 3ZP5A 4OU0A 1O3RA 3GFMA 1UB9A 2RC4A 4ETSA 4L18B 3P9CA 3V4GA 4RS8A 5L3EA 3WU0A 3DPLC 1ZRDA 1SD4A 2OBPA 5AONA 2Q0OA 1IRFA 2ESHA 1FOKA 5AIPA 5BPIA 2IW5A 2CW0F 4L9VA 4HLXA 1YTYA 3E6MA 1ZRFA 1TQPA 2VOOA 2KIUA 3K69A 4KA4A 2W85A 2OU2A 3HYIA 3M8EA 3B02A 2WV0A 3JSPA 4YIFA 3G73A 2RDPA 2F5FA 2FU4A 3MQ0A 4LB5A 2UXXA 2E1CA 4EV0A 3WTYC 4UVAA 3CO6C 5F6FA 3GZ5A 2OA4A 1STZA 2L3DA 4A6EA 3F8MA 2RKHA 5ICGA 2V1DA 5HVQC 1BIAA 3LWFA 2ZBKA 3V8JA 5AIQA 4IRHA 3M8FA 1U78A 4GXOA 3AAFA 3KP3A 5TRDA 5CVIA 4WXHA 4P96A 4PDKA 4I0AA 2YU3A 4GGGA 4IRGA 2O6GE 3LA2A 1UHMA 3HRSA 4CICA 3F6OA 5CVJA 5D6FA 4HA8A 3BP8A 2FBIA 2VBXA 3ML6A 3I59A 4MHGA 1HW1A 3BJOA 3LAJA 3P9IA 1B59A 2CGPA 3R61A 1VTNC 3SHFA 2FA5A 2V6CA 2GXBA 2M1BA 1FNNA 1G3SA 4RAYA 2VN2A 4UVCA 1FSHA 2AS5F 3P7NA 1ZRCA 1TW2A 1XSXA 4WX9A 4KUMA 4CDGA 1UFMA 2ELHA 2FMYA 5DUIA 2PLYA 4ZZLA 1KQ0A 1F4KA 1WI9A 3QP5A 1HW2A 4R79A 1Z7UA 1L3LA 1YLFA 1IXSB 2MLKA 4RGXA 4P9FA 1F9NA 4EGZA 2P5VA 3FF5A 3CJNA 1BI1A 4WXCA 1ZLKA 3DFGA 1MKMA 5KVRA 4EMSA 4BYYA 5BOXA 4JQFA 2D1HA 1XGOA 1W7PA 3FM3A 4ZYEA 1XGMA 1SMYF 4JBAA 5H6RA 1ZG3A 2K86A 1FBSA 3BROA 3HOTA 5LGUA 3RJPA 1OMIA 4LG0A 5KK1A 1EH7A 2LDUA 3LQQA 3N4MA 1I1GA 1RI7A 4OIRF 3E6CC 5DCMB 4HF1A 1J7KA 3HTSB 1G3WA 3EQLF 3L00A 1XCBA 3V7SA 2F5EA 2W24A 2XAGA 2X0LA 1F5TA 3BWGA 1B6AA 3BZ6A 1S29A 1IN5A 2L4MA 4OOIA 4LB6B 4EM0B 1BJAA 2EWNA 2CFXA 4D0PA 1U5TB 4HDUA 1KYZA 4M73A 4MQVA 2PQ8A 1HBXG 1PUEE 1O57A 4WCGA 2R3SA 2XAFA 5FO5A 4A5MA 4I98B 4LD5A 5HDKA 1FP1D 3R4KA 4XSZF 5E1WA 3F6VA 4P55A 4ZYHA 3R60A 3KP2A 3RKXA 1YS7A 4K2EA 5L3DA 1BOAA 3KFWX 3NEUA 1LDKB 2FSWA 2J5PA 1P4WA 4Q48A 3LAPA 4HV6A 2EB7A 2QQAA 3CUQA 4G94A 2R7FA 3K9TA 2EV6A 4JK1X 4L9NA 3E6BA 1KA8A 5LGTA 2QBYB 4OIPF 1R1TA 2O3FA 3TGNA 2F5DA 4P9UA 3WG9A 4HW0A 2P4WA 4KICA 4CHUA 2IA2A 2CYYA 5D8KB 2CWEA 3BJ6A 3GFJA 2HYFA 5LHGA 2UXNA 4BAYA 3D0SA 4AD9A 2XAJA 2PFBA 2XASA 1ZHFA 3W6JB 2ZMEB 1YS6A 2JZYA 2M30A 2Z99A 4U88A 4MTDA 3QAHA 3R0JA 1WRJA 1P4XA 3KP6A 1DPUA 1LEBA 2HFHA 5FFXA 2MC3A 1ZYRF 2LSOA 2ACJA 3ZQ7A 2PEXA 2JPCA 4WF2A 3QP6A 1FZPB 4ZYDA 2HS5A 2PI0A 2PN6A 4AIKA 1QNTA 3CUQC 3WE3A 1QZZA 5J6XA 4LGWA 1T2KA 4G7OF 3KEOA 5JI6A 1OPCA 3ZMDA 2HDCA 3BOQA 1HKSA 1OYIA 2IA0A 3OOPA 3T5XA 5H6QA 3JAMK 5D4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L01 A;  2Z9O A;  2KJB A;  1L0O C;  4MGR A;  3F3X A;  4RB3 C;  3TOB A;  1YW7 A;  2BGC A;  3MEX A;  5LLQ A;  5K5O A;  1ULY A;  2IRF G;  2EV0 A;  5DUK A;  3HSE A;  4YG2 F;  1OR7 A;  4WK8 F;  1TNS A;  1XD7 A;  4BH9 A;  1ZGA A;  1R58 A;  1P92 A;  5LEK A;  2XUB A;  3IHU A;  2RQP A;  2M45 A;  3WTW C;  1CF7 A;  1DP7 P;  1S3J A;  2DU9 A;  3GXO A;  4I09 A;  1OYW A;  1TTY A;  4E70 A;  2O61 A;  2EFO A;  2MA3 A;  2K7L A;  4PCQ A;  2JPB A;  3GLX A;  1C0W A;  3F8F A;  2O03 A;  3FXU A;  2VE9 A;  3WOD F;  4HYE A;  3TOA A;  1GXQ A;  4ASN A;  2VT2 A;  1PP7 U;  4I0B A;  4Q5S F;  2LF8 A;  3IC7 A;  1TNT A;  4XBF A;  2NYX A;  4ESF A;  1J9I A;  2VBW A;  3L2C A;  3DF8 A;  2STT A;  3GF2 A;  3WTS C;  2FEZ A;  4UV8 A;  4YFN F;  1XB4 A;  5FB2 A;  3BDD A;  1K7A A;  2VE8 A;  5D4R A;  3WGH A;  2E1N A;  4CXF A;  1KU7 A;  1Z91 A;  4IRI A;  2K02 A;  5A2Q K;  3QRF F;  2WWY A;  4UXN A;  1LDD A;  1ODD A;  1YW9 A;  2L54 A;  4HF0 A;  3SFZ A;  3FZV A;  3ECO A;  2WTE A;  4HBL A;  2QLZ A;  1U8R A;  3C7J A;  4HLY A;  1RUN A;  3O6B B;  3TO6 A;  2ZNZ A;  3L9F A;  4GYG A;  4L0Z B;  2A61 A;  2DQR A;  2QQ9 A;  2OQG A;  5K1Y A;  3L09 A;  2XAQ A;  2Y75 A;  3ZMZ A;  3I58 A;  4HX7 A;  3TO9 A;  2DK8 A;  4I01 A;  4M6X A;  3F22 A;  2MH2 A;  5E8G A;  1DDN A;  2JRT A;  4IF4 A;  1MZB A;  2VBY A;  4NHJ A;  4XLP F;  3U2R A;  3I4P A;  2BYV E;  1XSV A;  2HQN A;  1E2X A;  4ENJ A;  4KIF A;  3WU1 B;  3TDU C;  2ETH A;  4G6Q A;  2L02 A;  5FLX K;  5LRR A;  4BXU A;  1S6L A;  3RKW A;  4UHT A;  2CQK A;  3MFK A;  4KMU X;  1O3T A;  2LF7 A;  2QUF A;  5FGM A;  1T0F A;  3PQK A;  5HS7 A;  3KET A;  5K5Q A;  2QZ8 A;  3GVA A;  3QPH A;  3TQN A;  4M9S A;  1U2W A;  1KU2 A;  1R5H A;  2A68 F;  3IWF A;  3FX3 A;  2IVM A;  4YII A;  5DEQ A;  3RKY A;  2KIF A;  2C6Y A;  3I54 A;  2LNB A;  3FM5 A;  3MCZ A;  4M71 A;  1T98 A;  1IAW A;  2EFW A;  2A69 F;  2A5Y B;  4CGZ A;  1B9M A;  4EJW A;  2EFQ A;  3L7W A;  2GZW A;  5HS8 A;  3WTV C;  2EV5 A;  1IN7 A;  1IN8 A;  4UUV A;  2HOE A;  1MGT A;  1YFH A;  4LLL A;  3KP4 A;  3JTH A;  4A0Y A;  1BN5 A;  2IA1 A;  5HOO A;  4U0Y A;  2EFN A;  4AIH A;  3T1B A;  3J81 K;  1R7J A;  3COA C;  2DBB A;  1FC3 A;  2STW A;  2JSC A;  4EJU A;  4EGY A;  2ESN A;  1JGS A;  1TQI A;  4EM1 A;  3ROU A;  2VON A;  3GWZ A;  2P5K A;  4ESJ A;  1JHH A;  2HGC A;  1P4A A;  3GUD A;  2GA2 A;  5LBQ A;  1LDJ A;  4XLN F;  2DPD A;  4B09 A;  3IRR A;  3WTX C;  1ZN2 A;  4KIG A;  1WSU A;  4GO1 A;  1J0R A;  2COM A;  1T6S A;  1FBU A;  3SXY A;  5D5X B;  3MWM A;  2HR3 A;  4Q4Z F;  4N0B A;  1REP C;  3WGG A;  1DUX C;  3RI4 A;  5CVR A;  2KRF A;  2RGV A;  2P5L C;  3FMQ A;  1P2F A;  4CZZ A;  5DYM A;  4WXD A;  4G6D A;  1IW7 F;  1GHC A;  1LQ1 A;  1XMK A;  3CTA A;  1Z9C A;  2VOD A;  4GYI A;  2NNY A;  3CDH A;  4UNO A;  3R0A A;  3KLO A;  1J75 A;  1S7A A;  1BI2 A;  2VC0 A;  4CO8 A;  2IPQ X;  3EET A;  2PMU A;  3O3K A;  1ZGJ A;  4MQ9 F;  4YFK F;  1Z6R A;  4ZYG A;  2ADU A;  5E1Z B;  1TBX A;  4P5O A;  1RUO A;  3KP5 A;  2V1X A;  4R8H A;  2FNA A;  4KMF A;  1RIO H;  2GA1 A;  3RDI A;  1R22 A;  2Z5U A;  1TQM A;  3BY6 A;  3M7G A;  3C18 A;  4LJZ F;  1FSE A;  3GEZ A;  3DPT A;  1O3Q A;  5BPD A;  3F72 A;  3LST A;  3IL2 A;  4OIO F;  5DCM A;  3DEU A;  1H9T A;  1QGP A;  2V9V A;  1KQ9 A;  2TDX A;  3I5U A;  1P6R A;  5L3C A;  3HOS A;  5E17 F;  1U5T A;  5HLI A;  2A07 F;  5DD8 A;  4XSX F;  4BHP A;  2FBK A;  2VBZ A;  4BHC A;  2Q2E A;  4Y17 A;  2ZJ2 A;  1JXS A;  3K1N A;  3KE2 A;  2HTJ A;  4DQ2 A;  3O2P E;  3Q5F A;  3WGI A;  4UV9 A;  1KYW A;  4XRF A;  3P9K A;  1WKM A;  2DTR A;  2F2E A;  1YYV A;  1BI0 A;  1QZY A;  3JAM Z;  1F1Z A;  5IT9 K;  1B9N A;  2P7V B;  4ON0 A;  3HHG A;  2F5C A;  2M5W A;  5HLG A;  3CLO A;  3M1E A;  2UWM A;  5HDG A;  2EJR A;  1MJA A;  2YR2 A;  2QBY A;  2E7X A;  1SAX A;  3H3Z A;  1FWZ A;  4I02 A;  3S2W A;  2FF4 A;  1IUY A;  2XKO A;  3CO7 C;  1FY7 A;  5HLH A;  3ERE D;  2L4A A;  3HIF A;  3IRQ A;  1H0M A;  5CLS A;  2P6T A;  3RYR A;  2PJP A;  3V7R A;  2XRO A;  6PAX A;  2CSO A;  3ZMU A;  3LA7 A;  3EUH A;  1XDU A;  5ED4 A;  1U5T C;  5E20 A;  2W25 A;  1HKT A;  1JHF A;  2D1V A;  2ZME A;  4HF2 A;  1TLH B;  4QWQ A;  5DDG A;  3RIR A;  2VOP A;  5ILS A;  2VT3 A;  2H27 A;  3TO7 A;  1MDM B;  4LLN A;  2OQR A;  1RNL A;  3IKV A;  1QPM A;  1USS A;  2PBI A;  4G9Y A;  3ULQ B;  4CYD A;  4F7Z A;  2QYO A;  2MLG A;  3KZY A;  3OV8 A;  3F8B A;  3PQJ A;  3ECH A;  4FX0 A;  3V8L A;  4A5N A;  1W5T A;  3C3W A;  4DNC A;  3SZT A;  3ZMS A;  2OD5 A;  1KQ8 A;  5JR3 A;  3F21 A;  5J8C A;  1XGS A;  1R1U A;  2VC1 A;  4ESB A;  3I0T A;  1YG2 A;  4M74 A;  4TV7 A;  5A2Q Z;  1W7P D;  2M87 A;  3DXJ F;  2BEO A;  4I7H A;  5LRS A;  2FRH A;  3VOE A;  4U7D A;  1FYM A;  2DI3 A;  4H0E A;  1G3T A;  1IRG A;  4KFC A;  1Z05 A;  3K1P A;  4RGR A;  3D5L A;  1K78 B;  4KN7 X;  1D8K A;  2DLL A;  3ABU A;  5D6E A;  5ILU A;  1J59 A;  2DFI A;  2XRN A;  3HRU A;  2CG4 A;  1HKQ A;  1PP8 F;  1KU9 A;  3KZZ A;  3F8C A;  2H6B A;  3KEQ A;  2HYG D;  1B1B A;  3ABT A;  2YSR A;  2GAU A;  1IF1 A;  4LFU A;  3IKT A;  1K79 A;  2BBY A;  3F8N A;  3HRM A;  3RPU A;  4L9J A;  2YX4 A;  2RV8 A;  2HEO A;  1EV7 A;  5D5V B;  5FLX Z;  3K0L A;  1QO0 D;  2DK5 A;  2OZU A;  3WE2 A;  1AWC A;  5F64 A;  2EA4 A;  3HUG A;  2YPR A;  3E6D A;  1XGN A;  1EH6 A;  5JFR A;  1XCV A;  2PG4 A;  3LFK A;  5BMZ A;  1EH8 A;  3E5U A;  4GCV A;  1IXR C;  4Y15 A;  1YO5 C;  1ON2 A;  3J80 K;  4U0W A;  1YQA A;  3ZPL A;  3T8R A;  3FMR A;  5JHU A;  3H3U A;  1HST A;  3KCC A;  2Y48 A;  3Q9S A;  3B73 A;  2XAH A;  5BS6 A;  4IHT A;  1BIB A;  2IT0 A;  1FBQ A;  1GXP A;  1OYY A;  3VB2 A;  4B8X A;  4M9Z A;  2M8E A;  2R7D A;  1PDN C;  2ISZ A;  1XDS A;  3V7C A;  1HQC A;  1UCR A;  1ZLJ A;  2DQL A;  1IN6 A;  2RVC A;  3GFL A;  2V1U A;  3LQR A;  4U7B A;  4HX8 A;  1KGS A;  4HZF A;  1FX7 A;  1D3Y A;  2HWV A;  1YIO A;  5DV5 A;  2JTV A;  1FLI A;  1R00 A;  3J81 Z;  4ZH4 F;  2NS0 A;  4MNU A;  2Q8K A;  3BPV A;  4AVP A;  1I1S A;  1R1V A;  3FHZ A;  2P7C B;  4IXA A;  1BBY A;  2XGX A;  2MD5 A;  2FOK A;  3K1M A;  1D5V A;  2QWW A;  1RZ4 A;  1R36 A;  5E1X A;  2GQQ A;  3QU6 A;  2E7W A;  3SQN A;  2YX7 A;  1BM9 A;  1XN7 A;  3F23 A;  3K2Z A;  3EYI A;  4LK1 F;  2IP2 A;  1FYK A;  4FHT A;  3N97 A;  2B0L A;  3I59 B;  3DV8 A;  1CGP A;  3REO A;  2W57 A;  5ILV A;  5EEG A;  2JT1 A;  1I5Z A;  3I71 A;  2FML A;  4ENK A;  1FT9 A;  1V3F A;  3RTR A;  1MD0 A;  2Z33 A;  5DD4 A;  2FE3 A;  3BJA A;  4HOB A;  1OKR A;  3HHH A;  1NHA A;  3GYH X;  4KT5 C;  2DPU A;  2Z3Y A;  3FMS A;  1XMA A;  4YFX F;  5J8F A;  1SD5 A;  3FXQ A;  4IVN A;  4RGS A;  2ZFW A;  4HDV A;  2RNJ A;  1ZG5 A;  1ZRE A;  1IXC A;  3GW2 A;  4NQW A;  5ERI A;  3ELK A;  3EDP A;  3WTT C;  2IJL A;  1SFX A;  2Y0M A;  4OMY A;  4O5V A;  1YW8 A;  3ZMT A;  1JE8 A;  1W7P B;  3BPX A;  1IN4 A;  2XVC A;  4L9T A;  3GZ6 A;  5H20 A;  4KDP A;  2A3S A;  1U3E M;  2K4J A;  2XIG A;  2ZKZ A;  2FBH A;  2ZCW A;  3HSR A;  2BV6 A;  5HDN A;  1TW3 A;  3DKW A;  1SD6 A;  4LG0 B;  3E3V A;  2G9W A;  4FT8 A;  1SD7 A;  2DW4 A;  3MAJ A;  3QU3 A;  1Z1D A;  1R5G A;  3VEP A;  4IPA A;  4OIQ F;  2O8X A;  1MJB A;  4IJA A;  4LMY A;  1R23 A;  2FNP A;  3JW4 A;  3NRV A;  2HTS A;  1QBJ A;  2OZ6 A;  4PZJ A;  4RAZ A;  1J5Y A;  1ZAO A;  3ZMV A;  4A0Z A;  2A6H F;  3PFI A;  1BI3 A;  3EYY A;  3ISP A;  4EVI A;  4WWC A;  5L3B A;  5DCF A;  4LLG F;  2AXL A;  3E97 A;  2H09 A;  1W5S A;  2PMH A;  5CJ9 A;  3LA3 A;  3GO5 A;  5IT3 A;  2EA2 A;  4KIB A;  3G3Z A;  1FPQ A;  4G7H F;  1ONV A;  2K4B A;  2HQR A;  5IT9 Z;  1Q1H A;  2O0Y A;  4AWX B;  5LEJ A;  2WC2 A;  1I6X A;  1WWX A;  1DPR A;  5F1R A;  4UVB A;  1ZG1 A;  1W4M A;  3T0Y A;  2MH9 A;  4U0V A;  3E5Q A;  1BC8 C;  5FD5 A;  1A04 A;  2QVO A;  4RB0 A;  2CO5 A;  1LB2 A;  2DT5 A;  4KNY A;  2NAZ A;  3CUQ B;  3RYP A;  2XV4 S;  1U6G A;  3GX4 X;  5ICF A;  3TKY A;  2J5O A;  4EJO A;  1Y0U A;  4RGU A;  1S8N A;  1MJ9 A;  3DQV C;  4R1H A;  2H94 A;  3CUO A;  3WTZ A;  1AOY A;  1B4A A;  2FXA A;  1FP2 A;  1LVA A;  3HRT A;  2KJC A;  1SFU A;  5ICC A;  3GFI A;  2D45 A;  4A12 A;  1S7O A;  2DAO A;  1G6N A;  1HSJ A;  1WQ2 A;  2BE5 F;  1LNW A;  1H9G A;  2UZK A;  5HS9 A;  1I27 A;  4AIJ A;  4EM2 A;  4QLC U;  3VOD A;  2VXZ A;  1HXD A;  3JTG A;  1Z6T A;  1HW5 A;  5TJJ A;  2LKP A;  4EJV A;  4LK0 F;  4EQQ A;  2XKP A;  3I53 A;  1K6O A;  2GIV A;  4HAM A;  4N9H A;  1D8J A;  1SMT A;  3H92 A;  2HKX A;  2ZO4 A;  4L0Y B;  3IWZ A;  2A6E F;  4OMZ A;  4S05 A;  2XHK A;  5JVT A;  4BNC A;  4FX4 A;  1J2X A;  5L3F A;  3HTU A;  4G8X A;  5EEH A;  1IZ1 A;  4RB1 A;  3QOP A;  4I2O A;  4HQM A;  4PGH A;  4NB5 A;  3KP7 A;  3WTU C;  4RB2 C;  3FXR A;  2NNN A;  2X4H A;  2G7U A;  4S04 A;  4BQA A;  1QQI A;  5CVU A;  2EFP A;  3ZN1 A;  3I64 A;  1LEA A;  2W84 A;  3RPQ A;  4L5I A;  1BC7 C;  4O3M A;  4BHB A;  2KKO A;  1T38 A;  4N9I A;  1T39 A;  4A2U A;  4Y13 A;  1SFE A;  3R6S A;  5LHI A;  3J7A O;  5D5U B;  1CF7 B;  2NRA C;  2KIM A;  3SZP A;  1LJ9 A;  2QEN A;  3QPT A;  4A6D A;  3MZH A;  5FD6 A;  2GXG A;  1MDM A;  3FWE A;  3DP7 A;  1O7F A;  1X3U A;  2DO7 A;  4HQE A;  5ICE A;  5E8I A;  4KYW A;  3VFZ A;  1ZAR A;  5L3G A;  3J80 Z;  4G7Z F;  3ZN0 A;  3U1D A;  4OIN F;  1O3S A;  4EJT A;  5CVV A;  5K5R A;  4MEY F;  1ON1 A;  2P6S A;  1FYL A;  3V8K A;  5LHH A;  1ZH5 A;  4HX4 A;  5E18 F;  1UST A;  2GWR A;  4PGG A;  3C1D A;  1GVJ A;  2P8T A;  2K27 A;  4KN4 X;  3KLN A;  2V79 A;  2MBF A;  4Z2Y A;  3JSO A;  4M72 A;  4Q47 A;  2ISY A;  4HV5 A;  3Q9V A;  1O7L A;  3HSF A;  1G4D A;  3MZY A;  3W6K B;  3NQO A;  4M9X A;  2ZNY A;  1K78 A;  4MEX F;  2D2W A;  2HKO A;  4O6J A;  3T8T A;  3M9A A;  5BQT A;  5D5W B;  4ENN A;  4ENM A;  2EK5 A;  2RN7 A;  5D8L B;  1V4R A;  4A0X A;  1G3Y A;  5LGN A;  2QM3 A;  4MTE A;  5CYV A;  2QQB A;  3TDZ C;  2H6C A;  1UHW A;  1KU3 A;  1E17 A;  3E5X A;  2ZXJ A;  2G7H A;  1XSD A;  3U9G A;  2HZT A;  5FFZ A;  4M6Y A;  2FQ3 A;  4IHS A;  2OAZ A;  4ZZD A;  4L5J A;  3ZP5 A;  4OU0 A;  1O3R A;  3GFM A;  1UB9 A;  2RC4 A;  4ETS A;  4L18 B;  3P9C A;  3V4G A;  4RS8 A;  5L3E A;  3WU0 A;  3DPL C;  1ZRD A;  1SD4 A;  2OBP A;  5AON A;  2Q0O A;  1IRF A;  2ESH A;  1FOK A;  5AIP A;  5BPI A;  2IW5 A;  2CW0 F;  4L9V A;  4HLX A;  1YTY A;  3E6M A;  1ZRF A;  1TQP A;  2VOO A;  2KIU A;  3K69 A;  4KA4 A;  2W85 A;  2OU2 A;  3HYI A;  3M8E A;  3B02 A;  2WV0 A;  3JSP A;  4YIF A;  3G73 A;  2RDP A;  2F5F A;  2FU4 A;  3MQ0 A;  4LB5 A;  2UXX A;  2E1C A;  4EV0 A;  3WTY C;  4UVA A;  3CO6 C;  5F6F A;  3GZ5 A;  2OA4 A;  1STZ A;  2L3D A;  4A6E A;  3F8M A;  2RKH A;  5ICG A;  2V1D A;  5HVQ C;  1BIA A;  3LWF A;  2ZBK A;  3V8J A;  5AIQ A;  4IRH A;  3M8F A;  1U78 A;  4GXO A;  3AAF A;  3KP3 A;  5TRD A;  5CVI A;  4WXH A;  4P96 A;  4PDK A;  4I0A A;  2YU3 A;  4GGG A;  4IRG A;  2O6G E;  3LA2 A;  1UHM A;  3HRS A;  4CIC A;  3F6O A;  5CVJ A;  5D6F A;  4HA8 A;  3BP8 A;  2FBI A;  2VBX A;  3ML6 A;  3I59 A;  4MHG A;  1HW1 A;  3BJO A;  3LAJ A;  3P9I A;  1B59 A;  2CGP A;  3R61 A;  1VTN C;  3SHF A;  2FA5 A;  2V6C A;  2GXB A;  2M1B A;  1FNN A;  1G3S A;  4RAY A;  2VN2 A;  4UVC A;  1FSH A;  2AS5 F;  3P7N A;  1ZRC A;  1TW2 A;  1XSX A;  4WX9 A;  4KUM A;  4CDG A;  1UFM A;  2ELH A;  2FMY A;  5DUI A;  2PLY A;  4ZZL A;  1KQ0 A;  1F4K A;  1WI9 A;  3QP5 A;  1HW2 A;  4R79 A;  1Z7U A;  1L3L A;  1YLF A;  1IXS B;  2MLK A;  4RGX A;  4P9F A;  1F9N A;  4EGZ A;  2P5V A;  3FF5 A;  3CJN A;  1BI1 A;  4WXC A;  1ZLK A;  3DFG A;  1MKM A;  5KVR A;  4EMS A;  4BYY A;  5BOX A;  4JQF A;  2D1H A;  1XGO A;  1W7P A;  3FM3 A;  4ZYE A;  1XGM A;  1SMY F;  4JBA A;  5H6R A;  1ZG3 A;  2K86 A;  1FBS A;  3BRO A;  3HOT A;  5LGU A;  3RJP A;  1OMI A;  4LG0 A;  5KK1 A;  1EH7 A;  2LDU A;  3LQQ A;  3N4M A;  1I1G A;  1RI7 A;  4OIR F;  3E6C C;  5DCM B;  4HF1 A;  1J7K A;  3HTS B;  1G3W A;  3EQL F;  3L00 A;  1XCB A;  3V7S A;  2F5E A;  2W24 A;  2XAG A;  2X0L A;  1F5T A;  3BWG A;  1B6A A;  3BZ6 A;  1S29 A;  1IN5 A;  2L4M A;  4OOI A;  4LB6 B;  4EM0 B;  1BJA A;  2EWN A;  2CFX A;  4D0P A;  1U5T B;  4HDU A;  1KYZ A;  4M73 A;  4MQV A;  2PQ8 A;  1HBX G;  1PUE E;  1O57 A;  4WCG A;  2R3S A;  2XAF A;  5FO5 A;  4A5M A;  4I98 B;  4LD5 A;  5HDK A;  1FP1 D;  3R4K A;  4XSZ F;  5E1W A;  3F6V A;  4P55 A;  4ZYH A;  3R60 A;  3KP2 A;  3RKX A;  1YS7 A;  4K2E A;  5L3D A;  1BOA A;  3KFW X;  3NEU A;  1LDK B;  2FSW A;  2J5P A;  1P4W A;  4Q48 A;  3LAP A;  4HV6 A;  2EB7 A;  2QQA A;  3CUQ A;  4G94 A;  2R7F A;  3K9T A;  2EV6 A;  4JK1 X;  4L9N A;  3E6B A;  1KA8 A;  5LGT A;  2QBY B;  4OIP F;  1R1T A;  2O3F A;  3TGN A;  2F5D A;  4P9U A;  3WG9 A;  4HW0 A;  2P4W A;  4KIC A;  4CHU A;  2IA2 A;  2CYY A;  5D8K B;  2CWE A;  3BJ6 A;  3GFJ A;  2HYF A;  5LHG A;  2UXN A;  4BAY A;  3D0S A;  4AD9 A;  2XAJ A;  2PFB A;  2XAS A;  1ZHF A;  3W6J B;  2ZME B;  1YS6 A;  2JZY A;  2M30 A;  2Z99 A;  4U88 A;  4MTD A;  3QAH A;  3R0J A;  1WRJ A;  1P4X A;  3KP6 A;  1DPU A;  1LEB A;  2HFH A;  5FFX A;  2MC3 A;  1ZYR F;  2LSO A;  2ACJ A;  3ZQ7 A;  2PEX A;  2JPC A;  4WF2 A;  3QP6 A;  1FZP B;  4ZYD A;  2HS5 A;  2PI0 A;  2PN6 A;  4AIK A;  1QNT A;  3CUQ C;  3WE3 A;  1QZZ A;  5J6X A;  4LGW A;  1T2K A;  4G7O F;  3KEO A;  5JI6 A;  1OPC A;  3ZMD A;  2HDC A;  3BOQ A;  1HKS A;  1OYI A;  2IA0 A;  3OOP A;  3T5X A;  5H6Q A;  3JAM K;  5D4S A; 
#chains in the Genus database with same CATH topology
 2L01 A;  4A3D J;  2Z9O A;  2KJB A;  1L0O C;  2Z1D A;  4ZYA A;  4MGR A;  3F3X A;  4N4N B;  4RB3 C;  3TOB A;  1YW7 A;  2BGC A;  5EF6 A;  1ZEL A;  3MEX A;  2LBF B;  5K7H A;  5LLQ A;  5K5O A;  2R7V A;  3W3C A;  1ULY A;  3FBN B;  1D1A A;  2EV0 A;  5DUK A;  3HSE A;  2IRF G;  4YG2 F;  1OR7 A;  4WK8 F;  2LK2 A;  1TNS A;  1OCP A;  1XD7 A;  2V4J C;  2HDW A;  4BH9 A;  1ZGA A;  1SC7 A;  3OYB A;  1OLT A;  1R58 A;  2DOE A;  4UUS A;  3D5R C;  1P92 A;  5LEK A;  4RAF A;  2XUB A;  3IHU A;  2RQP A;  2YU9 J;  2M45 A;  3WTW C;  4KIS A;  1B72 A;  3CJQ B;  1CF7 A;  1DP7 P;  1S3J A;  2DU9 A;  5IYB J;  1WVR A;  3GXO A;  4GRI A;  2R7T A;  4I09 A;  1OYW A;  1V5E A;  3H5N A;  1TTY A;  2VPR A;  2O9L A;  4CH7 A;  2MYS A;  3EUK L;  2F4M B;  4E70 A;  2O61 A;  3P5J A;  1K4T A;  2HOS A;  2XRL A;  5IPA A;  2DFF A;  2EFO A;  2EZH A;  2N8G A;  2MA3 A;  2K7L A;  1AA7 A;  4PCQ A;  1O4X A;  2JPB A;  3GLX A;  3BT9 A;  1C0W A;  3F8F A;  4YEJ A;  2O03 A;  2DA7 A;  1AKH A;  1VQ5 I;  2K5C A;  3DBH B;  3FXU A;  3JRG A;  3WOD F;  2VE9 A;  4HYE A;  3TOA A;  1GXQ A;  1LVK A;  4ASN A;  4M3D A;  1RPW A;  1T56 A;  2VT2 A;  5FRO A;  3NWS A;  4Y7N J;  4FCY A;  4I0B A;  1PP7 U;  3OMY A;  4NNJ A;  3HDD A;  4Q5S F;  4N4O B;  2LF8 A;  3IC7 A;  2H8R A;  1TNT A;  3LNQ A;  5H2F C;  5BNG A;  5EJC A;  3HUG B;  3PNY A;  4XBF A;  2NYX A;  3FK7 A;  4ESF A;  5HOD A;  1OIS A;  1J9I A;  1UHS A;  4D9J A;  2VBW A;  3L2C A;  1T8I A;  3DF8 A;  4DW6 A;  3S93 A;  2WA0 A;  2STT A;  5F27 A;  1A6Q A;  1Y56 A;  3GF2 A;  2DA6 A;  2XPV A;  3WTS C;  4E7L A;  5IP7 J;  2FEZ A;  4UV8 A;  4YFN F;  1XB4 A;  5FB2 A;  2ME6 A;  3BDD A;  2AO9 A;  1K7A A;  2EIK H;  2VE8 A;  1OR7 C;  1TT0 A;  3PJR A;  3AFH A;  3H1C A;  5D4R A;  3WGH A;  3OL4 A;  4RDU A;  1RR8 C;  2CW8 A;  1VQ7 I;  2E1N A;  2KPM A;  2OCE A;  2QF7 A;  3A0H C;  1MBG A;  4M3F A;  2B63 J;  4CXF A;  2DDB A;  1YX3 A;  2I10 A;  1KU7 A;  1Z91 A;  3VPR A;  3GZN B;  4IRI A;  3HKZ A;  2DFE A;  2K02 A;  3DTI A;  2DA1 A;  5A2Q K;  2E1O A;  3QRF F;  4PFP A;  5EZG A;  1H89 C;  3H9J A;  4AUX A;  1VND A;  4UXN A;  2WWY A;  2DJN A;  2M0C A;  3DU6 A;  4BEH A;  1LDD A;  2EIN H;  3BQZ A;  2BOL A;  3U21 A;  1ZTR A;  3C2G A;  1GT0 C;  2VL8 A;  1ODD A;  1YW9 A;  2L54 A;  4HF0 A;  3SFZ A;  3FZV A;  3ECO A;  2WTE A;  1TWF J;  2QLZ A;  4HBL A;  1R9T J;  4JX5 A;  1U8R A;  3C7J A;  4XLC A;  4HLY A;  1RUN A;  2OPT A;  3O6B B;  1LPQ A;  3TO6 A;  1OJL A;  2ZNZ A;  2QSH X;  3L9F A;  4GYG A;  4L0Z B;  2A61 A;  1RC9 A;  3BR2 A;  2DQR A;  2QQ9 A;  2K85 A;  2OQG A;  4LIV A;  5K1Y A;  2DMU A;  3L09 A;  1TWG J;  4II2 A;  4PJJ A;  2XAQ A;  5F0F A;  2JSP A;  1WH7 A;  2Y75 A;  3ZMZ A;  2KP6 A;  3I58 A;  1NK3 P;  4HX7 A;  1YIJ I;  3HPG A;  5GTH C;  3TO9 A;  2DK8 A;  3BQY A;  4I01 A;  4M6X A;  1ZK8 A;  2MH2 A;  3F22 A;  5M3F J;  5E8G A;  3HGY A;  1DDN A;  2JRT A;  2JA6 J;  4B4C A;  4IF4 A;  1MZB A;  2VBY A;  4NHJ A;  3GTO J;  3VWB A;  1IUF A;  3EUA A;  2X1E A;  1WCM J;  4XLP F;  3U2R A;  4ZDL A;  3I4P A;  2BYV E;  5TGT A;  1XSV A;  2HQN A;  1E2X A;  5KHD A;  4ENJ A;  3RKQ A;  4IEJ A;  4KIF A;  3BTI A;  3WU1 B;  3OYF A;  2EZK A;  4HNU A;  3TDU C;  4RLQ A;  2ETH A;  2ID3 A;  2W4S A;  4IL6 C;  4G6Q A;  1HDD C;  2L02 A;  3WG7 H;  5FLX K;  1N75 A;  5LRR A;  4BXU A;  4AYB N;  1S6L A;  3RKW A;  2EBI A;  4UHT A;  2CQK A;  2DYR H;  3E0J B;  3MFK A;  4KMU X;  2K9L A;  1O3T A;  2LF7 A;  5B3S H;  2QUF A;  4IHY A;  5FGM A;  2OUM A;  1T0F A;  2VKD A;  3AL0 B;  3PQK A;  2WB1 A;  3L2Q A;  5HS7 A;  1HCR A;  2R92 J;  3KET A;  5K5Q A;  1LFB A;  2QZ8 A;  3GVA A;  3QPH A;  2CQQ A;  3TP3 A;  3TQN A;  5C4J J;  3JRC A;  1ZQ3 P;  4M9S A;  1X3Z B;  1U2W A;  1KU2 A;  1R5H A;  3OYG A;  2A68 F;  3IWF A;  3FX3 A;  2IVM A;  3VSL A;  3IH3 A;  5B66 C;  3WU2 C;  3GCM A;  4JP0 A;  4YII A;  5DEQ A;  2JUG A;  2M4G A;  5E79 C;  3RKY A;  2AHQ A;  2KIF A;  4GDF A;  3CP8 A;  5CKT A;  2KIS A;  2C6Y A;  3I54 A;  3QWL A;  2NVQ J;  2LNB A;  2LY2 A;  3FM5 A;  3MCZ A;  3LSI A;  4M71 A;  1T98 A;  4KJZ A;  3DBL B;  1HA8 A;  5FKM A;  3E7L A;  1IAW A;  2EFW A;  2TRT A;  3BCA A;  2LC2 A;  3AG2 H;  4NQW B;  4XLE A;  2A69 F;  5F0H A;  1HF0 A;  2A5Y B;  2VAS A;  4CGZ A;  1QHG A;  1B9M A;  4EJW A;  1OCR H;  2EFQ A;  5C4X J;  3L7W A;  9ANT A;  2JVG A;  4B3X A;  2GZW A;  2XGC A;  4D1Q A;  2FQ4 A;  1WGX A;  3DLL F;  3D5S C;  5HS8 A;  1V5G A;  3WTV C;  2ICW G;  2EV5 A;  1IN7 A;  3PSI A;  1IN8 A;  4UUV A;  2HOE A;  4B3A A;  1FMW A;  1MGT A;  1YFH A;  1VQK I;  4LLL A;  3CC2 I;  3KP4 A;  3JTH A;  4A0Y A;  1BN5 A;  2IA1 A;  2KDO A;  1QPI A;  5HOO A;  4NC7 A;  2BHZ A;  2LKX A;  2KRC A;  5CQG A;  1X2M A;  4U0Y A;  2EFN A;  1GDT A;  1Z21 A;  3T1B A;  2LG4 A;  4AIH A;  1R7J A;  3J81 K;  3COA C;  4E7H A;  2DBB A;  1YHQ I;  1FC3 A;  2HYJ A;  2ME0 A;  2STW A;  2JSC A;  3MKL A;  4EJU A;  4EGY A;  2ESN A;  2HQA A;  1JGS A;  1TQI A;  2BW3 B;  1WPK A;  5GAE J;  4XID A;  4EM1 A;  2XF6 A;  1T0F C;  2BVL A;  1POG A;  3ROU A;  4XKW A;  2VON A;  3GWZ A;  4DBR A;  2P5K A;  2MFZ A;  4ESJ A;  1JHH A;  2HGC A;  1P4A A;  5H6R A;  3GUD A;  2CQX A;  2GA2 A;  3HZJ A;  5LBQ A;  1LDJ A;  3I4M J;  1GVD A;  4XLN F;  2ZXW H;  3VYS B;  4A93 J;  2DPD A;  2E5N A;  4B09 A;  3IRR A;  3WTX C;  5LD2 C;  1ZN2 A;  4KIG A;  1WSU A;  1A6I A;  2IGO A;  4GO1 A;  1DU6 A;  3GME A;  4PFO A;  1J0R A;  4CUG A;  1VFC A;  2COM A;  1T6S A;  5J1Y A;  1RRJ A;  3PIP F;  3JRF A;  1FBU A;  4HST A;  3PO3 J;  3SXY A;  5D5X B;  3MWM A;  2HR3 A;  4Q4Z F;  2FJ1 A;  4PJL A;  2ECC A;  2VIX A;  4N0B A;  1MSE C;  1WJD A;  1REP C;  3QYE A;  1RET A;  3WGG A;  1DUX C;  2NS8 A;  3RI4 A;  3HEF A;  5CVR A;  5F1J A;  2KRF A;  2RGV A;  3F0C A;  2P5L C;  3FMQ A;  1P2F A;  4CZZ A;  5DYM A;  3KZI C;  3ONQ A;  4WXD A;  3V42 A;  4G12 A;  1SAU A;  4G6D A;  1IW7 F;  1OFC X;  1GHC A;  3K4J A;  2AQF A;  4DIQ A;  1LQ1 A;  1XMK A;  3BG5 A;  3CTA A;  2DTZ A;  1JUM A;  2DA2 A;  1NH3 A;  1S7E A;  1Z9C A;  3AKZ A;  1SEU A;  3FXM A;  2VOD A;  4GYI A;  3ABM H;  2NNY A;  2IS6 A;  3CDH A;  1AHD P;  4NC6 A;  2EIM H;  2LR8 A;  4UNO A;  2NVU B;  2A6T A;  3R0A A;  3KLO A;  1J75 A;  1S7A A;  1BI2 A;  2VC0 A;  1JKO C;  4RM3 A;  3PO2 J;  4BL0 B;  4XRM A;  3GTL J;  4BQO A;  2RNG A;  2IPQ X;  2PMU A;  3EET A;  3O3K A;  4XLA A;  2CS3 A;  4CO8 A;  1ZGJ A;  1HDP A;  4MQ9 F;  2H1K A;  2O8K A;  1EF4 A;  4YFK F;  5HLT A;  1K4S A;  1Z6R A;  4ZYG A;  3DEW A;  5KAI C;  4IHX A;  2ADU A;  3SDG A;  3UNG C;  1Z3Y A;  5E1Z B;  1TBX A;  4P5O A;  2L7M P;  1RUO A;  1ETY A;  2WAQ A;  3KP5 A;  2V1X A;  3IP4 B;  4R8H A;  2FNA A;  4KMF A;  2JRM A;  1W36 D;  2HVS A;  3CCR I;  1RIO H;  2GA1 A;  3DCF A;  3CDL A;  1ZR4 A;  3RDI A;  1D1B A;  4HPQ A;  2VKH A;  2B9S A;  1JUP A;  3F9K A;  1K6Y A;  1R22 A;  2Z5U A;  4Y3O A;  3BR0 A;  3K4L A;  5F04 A;  1TQM A;  3BG6 A;  3BY6 A;  1RES A;  3M7G A;  4E7J A;  3C18 A;  3HOX J;  2LFB A;  4A3M J;  4LJZ F;  4RBO A;  1FSE A;  3GEZ A;  1YI2 I;  3DPT A;  1VQM I;  2H8W A;  1O3Q A;  5BPD A;  3F72 A;  3BZK A;  3LST A;  3IL2 A;  2M9H A;  2CQN A;  4OIO F;  5DCM A;  3LSJ A;  3DEU A;  4FET A;  2KRH A;  2AXT C;  1H9T A;  1QGP A;  3CCJ I;  2V9V A;  1KQ9 A;  2TDX A;  5KCM A;  3ZCO A;  4Z6Y A;  3I5U A;  3ZOB A;  1P6R A;  3HOV J;  5L3C A;  1PYV A;  3HOS A;  3A0B C;  1V5F A;  2VI6 A;  1JKP C;  1Y8Q B;  3LFU A;  5DM6 F;  3OYM A;  2YS9 A;  1R5I D;  5E17 F;  2CQ7 A;  1U5T A;  3HOU J;  5HLI A;  3CCM I;  2EH3 A;  4LIU A;  2A07 F;  5DD8 A;  5FJ8 J;  2MD0 A;  4XSX F;  1Y1W J;  4BHP A;  3LSR A;  2FBK A;  2VBZ A;  4PSW A;  4BHC A;  2Q2E A;  4Y17 A;  1MMS A;  3QQA A;  2BXZ A;  2ZJ2 A;  2EZI A;  4C3J J;  3ZQF A;  1JXS A;  1FIP A;  3QPS A;  2IGM A;  3JRD A;  3K1N A;  3K70 C;  3KE2 A;  2HTJ A;  4DQ2 A;  2R5Z A;  3O2P E;  1IV8 A;  1V55 H;  3Q5F A;  3G4S I;  3WGI A;  2E1M B;  4UV9 A;  1KYW A;  4XRF A;  3P9K A;  1WKM A;  2XB0 X;  2DTR A;  2F2E A;  3H5R A;  2JK3 A;  4YEL A;  1YYV A;  5EGO A;  1BI0 A;  1QZY A;  3S1M J;  4Y52 J;  3J7Z I;  3JAM Z;  1F1Z A;  2L2O A;  4IO9 F;  5IT9 K;  3G1L A;  3MN2 A;  1B9N A;  2P7V B;  4ON0 A;  2CH0 A;  3TW6 A;  2W48 A;  3HHG A;  2R93 J;  1OCZ H;  2F5C A;  2VJI A;  4HG2 A;  2M5W A;  3GLL A;  5HLG A;  2A05 A;  3OIQ A;  3QYF A;  3CLO A;  4X0G A;  1P9Q C;  3CJT B;  3M1E A;  2UWM A;  3FIW A;  5HDG A;  1YE9 A;  2EJR A;  2JVH A;  3ZR8 X;  4F52 A;  3JRA A;  4V19 K;  1MJA A;  4E6K G;  2YR2 A;  2QBY A;  3OR1 C;  2E7X A;  2DMN A;  1QZE A;  1SAX A;  3H3Z A;  1UJ8 A;  1IDZ A;  3L2U A;  3OIO A;  1FWZ A;  4I02 A;  3S2W A;  4UY8 I;  1X4P A;  3S3N A;  2FF4 A;  2Y0S N;  1IUY A;  2XKO A;  4DYQ A;  3CLQ A;  3CO7 C;  1FY7 A;  5HLH A;  3ERE D;  2L4A A;  2ZXH A;  3HIF A;  3IRQ A;  1H0M A;  3A01 A;  5CLS A;  1D1C A;  2P6T A;  3RYR A;  1R4N B;  5B5E C;  1VQ8 I;  2PJP A;  4BQQ A;  4B47 A;  3V7R A;  1G2H A;  2XRO A;  4IOC F;  6PAX A;  2OTJ I;  2CSO A;  3ZMU A;  3LA7 A;  3EUH A;  1NK2 P;  5IP9 J;  1XDU A;  3DLA A;  2DT7 B;  5ED4 A;  3ESW B;  1U5T C;  5E20 A;  2W25 A;  1HKT A;  4A3K J;  1JHF A;  2D1V A;  2ZME A;  4HF2 A;  1TLH B;  4QWQ A;  3OYN A;  2JN6 A;  2EPF A;  5DDG A;  3RIR A;  2VLA A;  2VOP A;  5ILS A;  3O8H A;  3DTE A;  1A36 A;  2VT3 A;  1A31 A;  2H27 A;  3TO7 A;  2VQL A;  1MDM B;  1WJC A;  4MLO A;  2VQG A;  4LLN A;  2OQR A;  1RNL A;  2BXY A;  3IKV A;  1QPM A;  5C44 J;  1QHH D;  1USS A;  2MC4 A;  2PBI A;  4G9Y A;  4BKX A;  3ULQ B;  3JR9 A;  2X6Y A;  4CYD A;  1GV5 A;  1SFO J;  4F7Z A;  2QYO A;  4PSX A;  1MBK A;  2MLG A;  3KZY A;  3OV8 A;  3F8B A;  3PQJ A;  5GAH J;  3ECH A;  1Y0N A;  4FX0 A;  4I99 C;  3V8L A;  3KYC B;  2JA5 J;  1EA3 A;  3K4B A;  4ZC3 A;  4A5N A;  3IH2 A;  2KT0 A;  1W5T A;  3CME I;  3C3W A;  5J1U A;  1MBJ A;  1F36 A;  4DNC A;  3SZT A;  3ZMS A;  2OD5 A;  1KQ8 A;  3Q0V A;  1N25 A;  1OCT C;  2DMQ A;  5JR3 A;  2E35 A;  3F21 A;  3TMO A;  5J8C A;  3K6G A;  4AU7 A;  1P7J A;  1XGS A;  1R1U A;  2LP0 A;  2GIZ A;  4MFE A;  2VC1 A;  4ESB A;  3I0T A;  1YG2 A;  4J19 A;  3M3Y J;  4M74 A;  4TV7 A;  2GOM A;  5A2Q Z;  1W7P D;  2M87 A;  1ERD A;  3DXJ F;  1KZH A;  3EPZ A;  1J09 A;  1G8X A;  2BEO A;  4I7H A;  1Z3X A;  2ECB A;  2K40 A;  5LRS A;  3CCQ I;  3BTJ A;  2FRH A;  1U0J A;  3JRE A;  2R5Y B;  4JX6 A;  1M1E B;  3VOE A;  4U7D A;  3OL3 A;  1FYM A;  2LBF A;  2DI3 A;  4H0E A;  1G3T A;  2KMU A;  3EUH C;  2HXO A;  1SVO A;  4KFC A;  1IRG A;  1Z05 A;  3K1P A;  4RGR A;  4C30 A;  3D5L A;  1K78 B;  4D7N A;  4F3Q A;  4FIS A;  4ZDO A;  2RRE A;  4J01 A;  4KN7 X;  3DKY A;  3I4N J;  3ERM A;  4CYC B;  3QPL A;  2ZME C;  4XQF A;  1D8K A;  3CQZ J;  2E2H J;  3CC4 I;  2IBD A;  3BG3 A;  4DYR A;  3LSK A;  2DLL A;  3ABU A;  5D6E A;  5ILU A;  1JKR C;  2E36 A;  1J59 A;  2DFI A;  2XRN A;  3CMY A;  5K7F A;  2PJR B;  3HRU A;  2CG4 A;  1YRN B;  2R4G A;  2FD5 A;  3G1O A;  1HKQ A;  1BW6 A;  3KPH A;  1PP8 F;  1KU9 A;  1FJL A;  4QPO A;  3HM5 A;  3KZZ A;  3BTL A;  3F8C A;  2H6B A;  3KEQ A;  2HYG D;  1B1B A;  3ABT A;  3RCO A;  1ZGW A;  1K61 A;  3BLY A;  2YSR A;  3LL7 A;  2GAU A;  1IF1 A;  4LFU A;  3IKT A;  1K79 A;  2BBY A;  2CJJ A;  3TW7 A;  1E3O C;  3M4O J;  3F8N A;  3RSN A;  2FOW A;  3SEZ A;  3HOW J;  2BHY A;  4CYC A;  1EJ9 A;  3HRM A;  3RPU A;  2MGQ A;  4L9J A;  2GOX B;  1TWC J;  2RV8 A;  2YX4 A;  3CF5 F;  2HEO A;  3CF2 A;  3NWT A;  1EV7 A;  5D5V B;  1TT5 B;  5FLX Z;  3K0L A;  1QO0 D;  2DK5 A;  2OZU A;  3WE2 A;  1AWC A;  4C2T A;  5F64 A;  2EA4 A;  3HUG A;  2YPR A;  2Y2Z A;  3E6D A;  2K9S A;  1XGN A;  1EH6 A;  5JFR A;  1XCV A;  2PG4 A;  3W6V A;  3LFK A;  2GXA A;  2DOF A;  1XG1 A;  1XS9 A;  2L5Q A;  5BMZ A;  1ETQ A;  2CV1 A;  1EH8 A;  3DTK A;  1JJ8 C;  3E5U A;  3SYT A;  4GCV A;  1IXR C;  1SVM A;  3A4C A;  5FRN A;  3HXL A;  4Y15 A;  2IS1 A;  1YO5 C;  1ON2 A;  4CA0 A;  4E4H A;  4QTR A;  3J80 K;  4U0W A;  4EAT A;  1MBH A;  1YQA A;  1OQY A;  5DTD A;  4XOT A;  3T8R A;  3ZPL A;  5EG0 B;  3ZGK A;  3CCL I;  3FMR A;  5JHU A;  3H3U A;  1AU7 A;  2IXS A;  1VQL I;  1HST A;  1ENH A;  3BG9 A;  1TP4 A;  2HI3 A;  3KCC A;  2ELK A;  2OC6 A;  1U9O A;  2Y48 A;  1IC8 A;  3Q9S A;  3B73 A;  5M3M J;  3E1S A;  2XAH A;  1WH5 A;  4W1U A;  5BS6 A;  3CD6 I;  1Y39 A;  4IHT A;  1BIB A;  2IT0 A;  4XKC A;  2OV7 A;  1FBQ A;  3S8P A;  1GXP A;  1OYY A;  1UZC A;  3VB2 A;  4B8X A;  1T33 A;  4M9Z A;  2M8E A;  2R7D A;  1PDN C;  1FMV A;  1XDS A;  3V7C A;  2ISZ A;  1FTZ A;  1HQC A;  3HL2 A;  1UCR A;  1ZLJ A;  3GTG J;  4C3H J;  3OYJ A;  1BL0 A;  2DQL A;  3A1Y A;  2VJJ A;  1IN6 A;  4PK4 A;  1EKE A;  2RVC A;  4ANJ A;  3GFL A;  2V1U A;  4E7S A;  3LQR A;  4U7B A;  3W2W A;  1TL8 A;  4HX8 A;  5CQE A;  2M34 A;  3Q0W A;  2M8G X;  1Y1V J;  2WY8 Q;  3K4C A;  1KGS A;  5EEA A;  3IUO A;  2EIL H;  4HZF A;  4AYB A;  4RMN A;  2EIJ H;  1NG6 A;  3VYT B;  1LKX A;  1FX7 A;  1D3Y A;  3FKJ A;  2HWV A;  2DOA A;  1YIO A;  2HQ5 A;  5DV5 A;  3ZQC A;  3JCU C;  3LOC A;  1JTY A;  2JTV A;  1FLI A;  1R00 A;  3J81 Z;  4ZH4 F;  2NS0 A;  4MNU A;  4BBS J;  2Q8K A;  2F4O B;  3BPV A;  4AVP A;  1I1S A;  1R1V A;  3FHZ A;  2P7C B;  4IXA A;  3H9Q A;  4IX7 A;  3K4M A;  1BBY A;  2XGX A;  3BZC A;  3OS1 A;  2MD5 A;  4BGD A;  2FOK A;  3K1M A;  1D5V A;  5IOZ A;  1LE8 B;  2V1N A;  2QWW A;  1RZ4 A;  1R36 A;  5E1X A;  2X6O A;  2GQQ A;  3QU6 A;  4HNT A;  3S16 J;  5IP6 A;  1X1A A;  3CCY A;  2IGK A;  2E7W A;  3QOD A;  3SQN A;  4BAC A;  2YX7 A;  3KEY A;  5E3M A;  1BM9 A;  1WHU A;  3AG1 H;  1XN7 A;  3F23 A;  3K2Z A;  3QYB A;  3EYI A;  4LK1 F;  2IP2 A;  1FYK A;  4FHT A;  3N97 A;  4XON A;  2B0L A;  3I59 B;  3GTP J;  4RLF A;  1XC5 A;  3DV8 A;  5KAF C;  1MNE A;  1CGP A;  2NVT J;  3REO A;  2W57 A;  2ELJ A;  2COB A;  4B44 A;  2R7O A;  2BY1 A;  5ILV A;  5EEG A;  2JT1 A;  2K9M A;  1I5Z A;  3I71 A;  2FML A;  4ENK A;  3D1N I;  1FT9 A;  1V3F A;  3RTR A;  5KNL A;  1MD0 A;  2X48 A;  4A3C J;  1ETK A;  2Z33 A;  5DD4 A;  2X6W A;  4QPQ A;  1IJW C;  2FE3 A;  2DN0 A;  1BR1 A;  3BJA A;  3SZG A;  4C3I J;  2CUF A;  4HOB A;  1OKR A;  3G1M A;  5JLX A;  1JI8 A;  3HHH A;  1HOM A;  1NHA A;  3GYH X;  4KT5 C;  2DPU A;  2Z3Y A;  4HRI A;  3FMS A;  2QA4 I;  1XMA A;  1UG2 A;  2XSD C;  5J40 A;  4YFX F;  1DGW Y;  5J8F A;  1K83 J;  1SD5 A;  3FXQ A;  4M3B A;  4IVN A;  2K3P A;  1XX5 A;  4RGS A;  2DXI A;  1JT0 A;  1LUJ B;  2V7F A;  2ZFW A;  4A3B J;  4HDV A;  3JRH A;  3DU5 A;  2RNJ A;  1ZG5 A;  1ZRE A;  1IXC A;  3GW2 A;  2UV1 A;  4B48 A;  4HNV A;  3JRB A;  1MH4 A;  2GM4 A;  4NQW A;  2QSG X;  2AQE A;  5ERI A;  3ELK A;  3S17 J;  2MG4 A;  4CCM A;  4S0H B;  3EDP A;  3WTT C;  4V2F A;  4JX4 A;  1X4O A;  3UR3 C;  2IJL A;  1SFX A;  2E71 A;  2Y0M A;  3HJE A;  4OMY A;  3HGG A;  4XN0 A;  1JKQ C;  3FXL A;  4O5V A;  1YW8 A;  1PUF B;  5LFA A;  3ZMT A;  1JE8 A;  1W7P B;  3CCE I;  3BPX A;  4IKF A;  1IN4 A;  2XVC A;  4L9T A;  3GZ6 A;  5H20 A;  4DZJ A;  1VQ9 I;  4KDP A;  2F5V A;  2A3S A;  1U3E M;  2Z2S B;  2Y9Z A;  4XN3 A;  1X3W B;  2K4J A;  4XMY A;  1IRZ A;  3KX2 A;  2XIG A;  2GBY A;  2ZKZ A;  4BXF A;  2FBH A;  2ZCW A;  3HSR A;  2BV6 A;  2BW3 A;  5HDN A;  1TW3 A;  3DKW A;  2ZSH B;  1PVE A;  1SD6 A;  4BS9 A;  1RR7 A;  2E2J J;  2FUG 2;  2HZD A;  2NVY J;  3E3V A;  2G9W A;  4FT8 A;  4QIW N;  1SD7 A;  2DW4 A;  4LG0 B;  3MAJ A;  3AL0 C;  3QU3 A;  4FE7 A;  1Z1D A;  4YRV A;  1R5G A;  4NC8 A;  5B1A H;  2PMZ A;  3ASO H;  3VEP A;  3ZXS A;  4BQN A;  3MKW B;  4IPA A;  2XGD A;  5J4V A;  4OIQ F;  2O8X A;  2RAE A;  4F92 B;  3DPU A;  1MJB A;  4IJA A;  3DWL E;  2XGE A;  3G6E I;  1R71 A;  4A3J J;  3LSH A;  1Z7L A;  4LMY A;  5B1B H;  1R23 A;  4II3 A;  2L9V A;  3VYR B;  2VXD A;  1R4M B;  3BC8 A;  4NDL A;  3G71 I;  1GV2 A;  2FNP A;  2KZV A;  3JW4 A;  4MO7 A;  3NRV A;  2HTS A;  3GTJ J;  1QBJ A;  4OWR B;  2OZ6 A;  3A2K A;  4PZJ A;  4RAZ A;  1A5J A;  4E7I A;  1J5Y A;  5E3N A;  1ZAO A;  3ZMV A;  2XB5 A;  4A0Z A;  2A6H F;  2W82 A;  3IV5 A;  1RKW A;  2M2E A;  3PFI A;  1BI3 A;  3EYY A;  5JHF A;  3OS2 A;  3ISP A;  1QVT A;  4EVI A;  5L3B A;  4WWC A;  3TED A;  2R7S A;  5DCF A;  3GBG A;  1V54 H;  2CUE A;  2M7B A;  4LLG F;  2HPI A;  1ORK A;  2AXL A;  2I5U A;  3E97 A;  3I55 I;  2HPM A;  2H09 A;  4C2M J;  1W5S A;  2PMH A;  5CJ9 A;  2QGU A;  3OYH A;  3LA3 A;  2P0W A;  3GO5 A;  3FXK A;  5IT3 A;  3S1R J;  2Y31 A;  3FK6 A;  3FKI J;  3KYL A;  2NVX J;  4J00 A;  4AVZ A;  2EA2 A;  4KIB A;  3G3Z A;  1FPQ A;  4G7H F;  1ONV A;  2K4B A;  2HQR A;  4DZP A;  3FXJ A;  5IT9 Z;  3OWT A;  1Q1H A;  2O0Y A;  4AWX B;  3J7Y J;  4A3I J;  4ZTJ A;  5LEJ A;  2XDV A;  3S3M A;  2WC2 A;  1I6X A;  1WWX A;  1DPR A;  5F1R A;  4UVB A;  4A3E J;  1ZG1 A;  1W4M A;  3T0Y A;  2MH9 A;  1YIT I;  4U0V A;  3E5Q A;  3O8G A;  3L2W A;  2E60 A;  1BC8 C;  5FD5 A;  3KIO A;  1FEX A;  1A04 A;  3B6C A;  2QVO A;  4RB0 A;  2ZB9 A;  2GLO A;  2CO5 A;  1MND A;  1LB2 A;  2DT5 A;  4KNY A;  2R7X A;  2NAZ A;  2MSY A;  3CUQ B;  5EZH A;  3RYP A;  2XV4 S;  1U6G A;  2V9K A;  1TC3 C;  3GX4 X;  5ICF A;  3TKY A;  2J5O A;  2QCO A;  4EJO A;  1Y0U A;  4RGU A;  1S8N A;  2MAB A;  1MJ9 A;  1FOX A;  4B1R A;  1YJN I;  2EQR A;  2KIQ A;  2LY9 A;  3DQV C;  4R1H A;  4IHW A;  2H94 A;  4OAZ A;  4XOP A;  2CU7 A;  5M5X J;  3CUO A;  3WTZ A;  4BJT A;  3DEE A;  1AOY A;  4KT6 A;  3BG7 A;  1A35 A;  1B4A A;  4UUT A;  1MMG A;  2DDA A;  1YX5 A;  1MIJ A;  1UG0 A;  1X2N A;  2FXA A;  1JTX A;  1FP2 A;  2KLO A;  1QVU A;  1LVA A;  5EYR A;  1W0U A;  3HRT A;  2KJC A;  5IYC J;  3I56 I;  1SFU A;  5ICC A;  3S3O A;  4FTH A;  3GFI A;  3AG4 H;  3C2H A;  2D45 A;  4A12 A;  2KL4 A;  1S7O A;  2DAO A;  3PUF A;  1G6N A;  3M8J A;  1HSJ A;  1WQ2 A;  2BE5 F;  1BW5 A;  1LNW A;  2Y9Y A;  5E3O A;  1H9G A;  2UZK A;  2K9Q A;  5F08 A;  2D5V A;  4FQG A;  5HS9 A;  1I27 A;  2IGN A;  1IGN A;  4AIJ A;  3BR5 A;  4EM2 A;  3A03 A;  4QLC U;  3VOD A;  3VDX A;  1UAA A;  4XR6 A;  2VXZ A;  1HXD A;  5CPR B;  3OY9 A;  2CW7 A;  1MBE A;  3JTG A;  1Z6T A;  1HW5 A;  1B8I B;  2L7F P;  1ZKG A;  1X19 A;  5TJJ A;  2LKP A;  3FIS A;  2CUJ A;  4LK0 F;  4EJV A;  2LYC A;  4EQQ A;  1MNM C;  4D5C A;  2XKP A;  2L7Z A;  3I53 A;  1K6O A;  2GIV A;  2VQH A;  4HAM A;  4N9H A;  2HVR A;  1D8J A;  1SMT A;  3H92 A;  2HKX A;  4UB8 C;  2ZO4 A;  4L0Y B;  2QQ8 A;  2Y0S A;  3X2Q H;  1TZL A;  3HC7 A;  3AG3 H;  3IWZ A;  5GAD J;  2M7A A;  2A6E F;  4OMZ A;  4S05 A;  4C2U A;  2DA5 A;  3ZQG A;  2XHK A;  1WJE A;  2OTL I;  3J7A Y;  5JVT A;  2CV2 A;  2NXN B;  4XLH A;  4BNC A;  2ZJR F;  2KZG A;  4CCK A;  4FX4 A;  1J2X A;  5L3F A;  3CCU I;  3HBL A;  3HTU A;  1S72 I;  1R6R A;  4G8X A;  5EEH A;  5GTI C;  1IZ1 A;  4RB1 A;  1WFX A;  4ITV A;  3H35 A;  3QOP A;  4I2O A;  1BR2 A;  4HQM A;  4PGH A;  4NB5 A;  2XAU A;  3KP7 A;  3WTU C;  4RB2 C;  2LH9 A;  2NNN A;  3FXR A;  4BDY A;  3FDY A;  4G6T B;  2X4H A;  2G7U A;  4S04 A;  4BQA A;  1QQI A;  2VJ5 A;  5CVU A;  2EFP A;  3VSK A;  3ZN1 A;  3I64 A;  1I6H J;  1LEA A;  3NAU A;  2LVS A;  2VPL A;  1TWH J;  2W84 A;  3RPQ A;  4L5I A;  5M5Y J;  1BC7 C;  4O3M A;  5J4Y A;  2V9P A;  1GLN A;  2DFH A;  4BHB A;  3LSM A;  2KKO A;  1T38 A;  1I3Q J;  1D0Z A;  4N9I A;  1T39 A;  3CZ6 A;  4UUS B;  4A2U A;  4Y13 A;  1SFE A;  3R6S A;  5LHI A;  2M4K A;  3J7A O;  1VQO I;  3LSP A;  4L5E A;  3L2V A;  4A3F J;  1B72 B;  1BA5 A;  5D5U B;  1CF7 B;  2BY3 A;  1OCO H;  3SDB A;  2NOJ B;  2NRA C;  2KIM A;  3SZP A;  1LJ9 A;  1MMA A;  3N05 A;  2QEN A;  3QPT A;  1LFP A;  2OCC H;  4A3L J;  1E0E A;  4XL9 A;  4A6D A;  3MZH A;  2ZJQ F;  3MD2 A;  1I50 J;  5FD6 A;  1ETW A;  2L7K A;  4D5F A;  5J3L A;  2GXG A;  1IDY A;  4XIC A;  1MDM A;  2VUM J;  3FWE A;  1AKH B;  3DP7 A;  4MFD A;  1FIA A;  2E1M C;  2UUZ A;  1O7F A;  4IZZ A;  1X3U A;  2DO7 A;  3SEQ A;  5FKO A;  5ICE A;  4HQE A;  3RZD J;  5E8I A;  1OCC H;  3K7A J;  3SFI A;  2JA8 J;  4KYW A;  2Z16 A;  4LOC A;  4Y4R A;  2ID6 A;  4W97 A;  3VFZ A;  1WJ5 A;  1NG7 A;  2DT6 A;  1ZAR A;  5L3G A;  1YJW I;  3DBR B;  3J80 Z;  3CMA I;  4G7Z F;  3ZN0 A;  3HB9 A;  3U1D A;  4OIN F;  1O3S A;  4EJT A;  5CVV A;  1JUS A;  2BY0 A;  2W00 A;  5K5R A;  4MEY F;  4JYK A;  3WHB A;  4DJA A;  3PNV A;  1ON1 A;  4BDZ A;  1ETV A;  2P6S A;  1FYL A;  3V8K A;  2JWT A;  2W1O A;  5LHH A;  1ZH5 A;  3K70 D;  2WY7 Q;  2ZJP F;  4HX4 A;  1Z0X A;  1MH3 A;  1DQU A;  5E18 F;  2LTP A;  2DJI A;  1UST A;  3H0D A;  2QSF X;  4X6A J;  2GWR A;  1VQP I;  4PGG A;  3C1D A;  1GVJ A;  2P8T A;  2K27 A;  4KN4 X;  4LIT A;  3KLN A;  2V79 A;  2MBF A;  4BE2 A;  1X1B A;  4Z2Y A;  3JSO A;  4M72 A;  1VQN I;  2VB6 A;  3RZO J;  4Q47 A;  2R5Y A;  4M3E A;  2ISY A;  4HV5 A;  3Q9V A;  1O7L A;  3HSF A;  1G4D A;  3MZY A;  3W6K B;  2VKV A;  4E7Z A;  1VQ6 I;  3NQO A;  2HNH A;  1WI3 A;  3NAR A;  4M9X A;  2WAD A;  2ZNY A;  1K78 A;  2R7R A;  4MEX F;  3OIP A;  4BEH B;  4F55 A;  2D2W A;  2HKO A;  2RQQ A;  4NUB A;  4O6J A;  3T8T A;  4XRS A;  1W5C C;  3M9A A;  2LRE A;  5BQT A;  5D5W B;  2IAI A;  4ENN A;  3WHC A;  2EK5 A;  2RN7 A;  4ENM A;  1SAN A;  5D8L B;  2WV1 A;  2IEK A;  2IS4 A;  1V4R A;  1HLV A;  2OJE D;  5M5W J;  4A0X A;  1Y6I A;  1G3Y A;  3CDI A;  5LGN A;  2JQ7 A;  2PJR A;  1X1C A;  3OSF A;  3OYL A;  1YRN A;  4E7K A;  3FBI B;  2Y30 A;  3PFY A;  1JGG A;  2QM3 A;  4MTE A;  5CYV A;  4X1E A;  1VQ4 I;  3K10 A;  4BXX J;  2QQB A;  3TDZ C;  4F93 B;  2H6C A;  1UHW A;  1XTA A;  1KU3 A;  1E17 A;  3E5X A;  3OYI A;  4ABZ A;  2ZXJ A;  3I9V 2;  2G7H A;  1XSD A;  4PJM A;  3VYU B;  3U9G A;  2ZXI A;  2HZT A;  3ASN H;  3HKZ N;  5FFZ A;  4M6Y A;  2CV0 A;  1I39 A;  2I8D A;  4U87 A;  2FQ3 A;  4IHS A;  2OAZ A;  4ZZD A;  1GUU A;  2P81 A;  4YIR X;  4L5J A;  3ZP5 A;  4OU0 A;  3OS0 A;  4BE0 A;  1O3R A;  3GFM A;  1UB9 A;  1U9N A;  2RC4 A;  4ETS A;  2QKL B;  4L18 B;  3P9C A;  3V4G A;  5C3E J;  1UEL B;  4XKB A;  4RS8 A;  1JT6 A;  5L3E A;  3PSF A;  3GTM J;  4CCJ A;  1WJA A;  3DPL C;  3WU0 A;  1Y8R B;  1ZRD A;  2LOO A;  1SD4 A;  4QSH A;  1FTT A;  2E5Z A;  4XOR A;  2OBP A;  4RA2 A;  5AON A;  1MSF C;  2L0K A;  2Q0O A;  1IRF A;  2EZL A;  1ETX A;  2ESH A;  3H5A A;  5AIP A;  1FOK A;  5BPI A;  2IW5 A;  2JJ7 A;  3HOY J;  2CUZ A;  1TWA J;  2CW0 F;  4L9V A;  4HLX A;  4FAS D;  2L9N A;  1YTY A;  2BVM A;  3TP0 A;  2L9R A;  1T95 A;  3G2B A;  3E6M A;  5EG0 A;  3B6A A;  1ZRF A;  1TQP A;  2VOO A;  3BR3 A;  2R0Q C;  2KIU A;  3W2V A;  2LD5 A;  3K69 A;  4KA4 A;  2JMW A;  1MMD A;  2W85 A;  2OU2 A;  3LSG A;  2TCT A;  3PNT A;  2K3F A;  1PJR A;  1E3P A;  2ZSI B;  3HYI A;  3M8E A;  3B02 A;  3GTQ J;  3S2H J;  4HEA 2;  2WV0 A;  3JSP A;  4YIF A;  3G73 A;  3H36 A;  1D0X A;  2RDP A;  2F5F A;  2FU4 A;  3MQ0 A;  4LB5 A;  2QEX I;  1XMX A;  2UXX A;  2LKS A;  1KON A;  3S14 J;  2E1C A;  2B7E A;  4EV0 A;  4LG3 A;  2L9S A;  2W7N A;  3WTY C;  4UVA A;  2HOA A;  5F6F A;  3CO6 C;  3GZ5 A;  2Q1Z B;  3C2B A;  4BY1 J;  2OA4 A;  5HNH A;  2DCE A;  1STZ A;  2L3D A;  4A6E A;  3MKZ A;  2F6C A;  3F8M A;  1IRX A;  2RKH A;  5ICG A;  5FKN A;  4D7M A;  2V1D A;  5HVQ C;  1BIA A;  3RQI A;  4XRS G;  3OYD A;  3LWF A;  4I6Z A;  2ZBK A;  3V8J A;  5AIQ A;  1LFU P;  4IRH A;  3M8F A;  1U78 A;  5FLV A;  4GXO A;  3LMM A;  5FKK A;  2V6E A;  2WB1 N;  4JOM A;  3AAF A;  3KP3 A;  5TRD A;  5CVI A;  2M3A A;  3OR2 C;  4WXH A;  4P96 A;  3RQ4 A;  1W36 C;  3ABK H;  5EDN A;  5DS9 A;  4PDK A;  4I0A A;  2YU3 A;  4GGG A;  2DMP A;  4IRG A;  2O6G E;  3S32 A;  3PM1 A;  3LA2 A;  1G59 A;  4IHV A;  1UHM A;  2E2I J;  3HRS A;  1LE8 A;  4CIC A;  1FOW A;  1DU0 A;  3F6O A;  2R7U A;  3ABL H;  5CVJ A;  5IY5 H;  5D6F A;  5K7Z A;  4HA8 A;  1UMQ A;  3BP8 A;  2FBI A;  1U8B A;  1T08 B;  2VBX A;  3M07 A;  3ML6 A;  3I59 A;  4MHG A;  2ZFU A;  1HW1 A;  3BJO A;  2LRD A;  3TBI A;  3LAJ A;  3P9I A;  1CQT A;  1B59 A;  2XSJ C;  2CGP A;  1HC8 A;  4BU2 A;  3R61 A;  2BY2 A;  3SHF A;  1VTN C;  2FA5 A;  3FHN A;  2V6C A;  2GXB A;  2M1B A;  1FNN A;  1G3S A;  2LY1 A;  4RAY A;  2VN2 A;  2JA2 A;  4UVC A;  1FSH A;  2AS5 F;  2MW8 A;  2WAF A;  3JRI A;  3P7N A;  2X6X A;  3CP2 A;  1H88 C;  1ZRC A;  1DP3 A;  1H8A C;  1TW2 A;  1XSX A;  2A5W A;  5F0C A;  4WX9 A;  1N77 A;  2QKM B;  3UKG A;  4BE1 A;  1IV6 A;  3Q3S A;  1E3H A;  4KUM A;  1W1W E;  4CDG A;  3CC7 I;  5FKL A;  1UFM A;  2E34 A;  1I3A A;  2ELH A;  1Z77 A;  1X1D A;  2FMY A;  3L1P A;  1VI0 A;  5DUI A;  4GFB A;  2X1D A;  3JAM K;  2PLY A;  4ZZL A;  1Z67 A;  1KQ0 A;  4UB6 C;  5IYD J;  1F4K A;  1WI9 A;  1IO2 A;  2HU9 A;  3GTK J;  3QP5 A;  1HW2 A;  4R79 A;  1Z7U A;  1L3L A;  1YLF A;  2KHM A;  4PUS A;  3S1N J;  1IXS B;  2MLK A;  4RGX A;  4RM2 A;  3M1C A;  4P9F A;  5FLM J;  3I3L A;  2M0M A;  2G0E A;  1F9N A;  4EGZ A;  2P5V A;  3FF5 A;  1ZR2 A;  2KDZ A;  4CCN A;  5DM7 F;  4B43 A;  3CJN A;  2XPU A;  1BI1 A;  3MMY B;  4WXC A;  1ZLK A;  3A02 A;  3DFG A;  1MKM A;  4P1W A;  5KVR A;  4EMS A;  5TIS C;  2R7W A;  3MZ8 A;  4BYY A;  3HG9 A;  3HPH A;  1SFK A;  4BJ6 C;  5BOX A;  1BR4 A;  2V26 A;  4DGW B;  4JQF A;  2D1H A;  1XGO A;  3IH4 A;  2WAE A;  1FOY A;  4I76 A;  1PUF A;  5GPC A;  1W7P A;  3RPU D;  1QA6 A;  3FM3 A;  4ZYE A;  1WJF A;  4BBR J;  2NS7 A;  1SMY F;  1XGM A;  2R7Q A;  4JBA A;  4Y33 A;  3CJR B;  4M6V A;  2CRG A;  1ZG3 A;  4XK4 A;  2K86 A;  2CFO A;  4AC0 A;  1FBS A;  2PMZ N;  3BRO A;  1SVL A;  3HOT A;  2DA3 A;  4RAG A;  5LGU A;  3RJP A;  1YJ9 I;  4M3G A;  2VJ4 A;  1OMI A;  3W2A A;  4DOZ A;  4LG0 A;  4CZC A;  5KK1 A;  2LLK A;  1X1P A;  3QOE A;  2X85 A;  2VQC A;  1EH7 A;  2X1C A;  2LDU A;  3LQQ A;  3N4M A;  1I1G A;  1RI7 A;  4OIR F;  2WBM A;  3E6C C;  5DCM B;  2DA4 A;  1J7K A;  5HNF A;  4HF1 A;  3HTS B;  1G3W A;  3EQL F;  3L00 A;  1VZ0 A;  1XCB A;  3V7S A;  4XLF A;  1BJZ A;  2F5E A;  2W24 A;  2XAG A;  1XPX A;  2X0L A;  4DYC A;  1APL C;  1F5T A;  3BWG A;  2O7O A;  3ZQQ A;  2CMP A;  1B6A A;  3BZ6 A;  3OYC A;  1R49 A;  1S29 A;  1IN5 A;  3BR1 A;  2PX9 A;  2L4M A;  4OOI A;  2F48 A;  1IG7 A;  2WAQ N;  4LB6 B;  3FXO A;  2HOT A;  3PL8 A;  3Q0U A;  3H0G J;  1D0Y A;  1NTC A;  4EM0 B;  1BJA A;  1DGR M;  2EWN A;  2CFX A;  4D0P A;  5GAG J;  1U5T B;  3OYA A;  4HDU A;  1KYZ A;  4M73 A;  4MQV A;  3S1Q J;  4BY7 J;  3K2A A;  2PQ8 A;  1HBX G;  1PUE E;  1O57 A;  4WCG A;  2ZC2 A;  1F43 A;  2R3S A;  2XAF A;  4A3G J;  2Q2E B;  1QRY A;  5FO5 A;  3TL4 X;  4A5M A;  4I98 B;  2XC7 A;  4LD5 A;  2BZT A;  3CCS I;  2OF7 A;  4MIM A;  5HDK A;  1FP1 D;  3R4K A;  4XSZ F;  5E1W A;  4CSW A;  2JA7 J;  2H1L A;  3F6V A;  4P55 A;  4ZYH A;  4IQJ A;  2IS2 A;  3BTC A;  2R5Z B;  2FX0 A;  3SJM A;  5GP9 A;  4AID A;  3R60 A;  4H4K C;  3KP2 A;  4V2G A;  3RKX A;  1YS7 A;  4K2E A;  5L3D A;  1ITY A;  5EGO B;  2DYS H;  5GPA A;  1BOA A;  3ZQI A;  1ETO A;  3KFW X;  3NEU A;  2NOG A;  1LDK B;  2FSW A;  2O5R A;  2Y69 H;  2J5P A;  4BJ5 C;  4ZJZ A;  1P4W A;  4Q48 A;  3LAP A;  2XF7 A;  5FRM A;  5IOY A;  3S2D J;  4HV6 A;  2X9D A;  2EB7 A;  4DBQ A;  4BUP A;  2QQA A;  3CUQ A;  4G94 A;  4PJ0 C;  4F91 B;  4C9Y A;  2R7F A;  1BOB A;  5J47 A;  1JJ6 C;  3K9T A;  2EV6 A;  4JK1 X;  4L9N A;  2DMT A;  3E6B A;  3ZQH A;  3CCV I;  4IOA F;  1KA8 A;  4ZDP A;  2KQR A;  5LGT A;  3U1K A;  2QBY B;  3CES A;  1S5L C;  4OIP F;  1R1T A;  2O3F A;  3TGN A;  3CMM A;  3HOZ J;  2F5D A;  4P9U A;  2R7Z J;  3MKY B;  3WG9 A;  4HW0 A;  1S9H A;  4CCO A;  2P4W A;  4KIC A;  4XNF A;  4CHU A;  3KYD B;  3ZRG A;  3K4N A;  3OYE A;  1P7I A;  2IA2 A;  2X51 A;  3A01 B;  2CYY A;  4FE4 A;  4PJN A;  1X58 A;  2JUC A;  2K9N A;  5D8K B;  2CWE A;  3BJ6 A;  3H3V K;  3GFJ A;  2HYF A;  2E19 A;  5LHG A;  2HDD A;  1MMN A;  2UXN A;  4XKV A;  4BAY A;  3D0S A;  3PIO F;  4OAY A;  4AD9 A;  2XAJ A;  3IAS 2;  2PFB A;  2XAS A;  2DOD A;  1ZHF A;  1WJB A;  3W6J B;  2ZME B;  1YS6 A;  2JZY A;  2M30 A;  2Z99 A;  3H9G A;  4U88 A;  2XPW A;  2F4I A;  4MTD A;  3QAH A;  3OSG A;  3PUB A;  3R0J A;  4CCL A;  4A69 C;  1WRJ A;  3OOU A;  5JLW A;  2VKE A;  4AM3 A;  1P4X A;  4HSR A;  3KP6 A;  3L2R A;  1WZ2 A;  1DPU A;  1Q1V A;  2HFH A;  1LEB A;  5FFX A;  2KFD A;  1B8I A;  2MC3 A;  1ZYR F;  2LSO A;  5E3L A;  4EEF G;  2ACJ A;  2HXI A;  3ZQ7 A;  2PEX A;  2JPC A;  4WF2 A;  1RKT A;  3QP6 A;  1FZP B;  4ZTF A;  2YUS A;  4ZYD A;  2HS5 A;  3OYK A;  3ZQL A;  2PI0 A;  2PN6 A;  3IAM 2;  2LMD A;  3BR6 A;  1VF9 A;  4AIK A;  1QNT A;  1D5Y A;  3CUQ C;  3WE3 A;  1QZZ A;  4NBQ A;  3BCB A;  5J6X A;  1W0T A;  2XF5 A;  2HVQ A;  4LGW A;  4XM3 A;  1YOV B;  1T2K A;  5JVG F;  4G7O F;  3K4K A;  1N78 A;  3KEO A;  5JI6 A;  3S15 J;  4IQ4 A;  1OPC A;  3ZMD A;  2HDC A;  3BOQ A;  1QU3 A;  3DKX A;  1HKS A;  1ACI A;  1MBF A;  1OYI A;  2IA0 A;  3MVP A;  3OOP A;  3T5X A;  5H6Q A;  5J1R A;  1MW7 A;  4KIT B;  5D4S A; 
#chains in the Genus database with same CATH homology
 2L01 A;  2Z9O A;  2KJB A;  1L0O C;  4MGR A;  3F3X A;  4RB3 C;  3TOB A;  1YW7 A;  2BGC A;  3MEX A;  5LLQ A;  5K5O A;  1ULY A;  2IRF G;  2EV0 A;  5DUK A;  3HSE A;  4YG2 F;  1OR7 A;  4WK8 F;  1TNS A;  1XD7 A;  4BH9 A;  1ZGA A;  1R58 A;  1P92 A;  5LEK A;  2XUB A;  3IHU A;  2RQP A;  2M45 A;  3WTW C;  1CF7 A;  1DP7 P;  1S3J A;  2DU9 A;  3GXO A;  4I09 A;  1OYW A;  1TTY A;  4E70 A;  2O61 A;  2EFO A;  2MA3 A;  2K7L A;  4PCQ A;  2JPB A;  3GLX A;  1C0W A;  3F8F A;  2O03 A;  3FXU A;  2VE9 A;  3WOD F;  4HYE A;  3TOA A;  1GXQ A;  4ASN A;  2VT2 A;  1PP7 U;  4I0B A;  4Q5S F;  2LF8 A;  3IC7 A;  1TNT A;  4XBF A;  2NYX A;  4ESF A;  1J9I A;  2VBW A;  3L2C A;  3DF8 A;  2STT A;  3GF2 A;  3WTS C;  2FEZ A;  4UV8 A;  4YFN F;  1XB4 A;  5FB2 A;  3BDD A;  1K7A A;  2VE8 A;  5D4R A;  3WGH A;  2E1N A;  4CXF A;  1KU7 A;  1Z91 A;  4IRI A;  2K02 A;  5A2Q K;  3QRF F;  2WWY A;  4UXN A;  1LDD A;  1ODD A;  1YW9 A;  2L54 A;  4HF0 A;  3SFZ A;  3FZV A;  3ECO A;  2WTE A;  4HBL A;  2QLZ A;  1U8R A;  3C7J A;  4HLY A;  1RUN A;  3O6B B;  3TO6 A;  2ZNZ A;  3L9F A;  4GYG A;  4L0Z B;  2A61 A;  2DQR A;  2QQ9 A;  2OQG A;  5K1Y A;  3L09 A;  2XAQ A;  2Y75 A;  3ZMZ A;  3I58 A;  4HX7 A;  3TO9 A;  2DK8 A;  4I01 A;  4M6X A;  3F22 A;  2MH2 A;  5E8G A;  1DDN A;  2JRT A;  4IF4 A;  1MZB A;  2VBY A;  4NHJ A;  4XLP F;  3U2R A;  3I4P A;  2BYV E;  1XSV A;  2HQN A;  1E2X A;  4ENJ A;  4KIF A;  3WU1 B;  3TDU C;  2ETH A;  4G6Q A;  2L02 A;  5FLX K;  5LRR A;  4BXU A;  1S6L A;  3RKW A;  4UHT A;  2CQK A;  3MFK A;  4KMU X;  1O3T A;  2LF7 A;  2QUF A;  5FGM A;  1T0F A;  3PQK A;  5HS7 A;  3KET A;  5K5Q A;  2QZ8 A;  3GVA A;  3QPH A;  3TQN A;  4M9S A;  1U2W A;  1KU2 A;  1R5H A;  2A68 F;  3IWF A;  3FX3 A;  2IVM A;  4YII A;  5DEQ A;  3RKY A;  2KIF A;  2C6Y A;  3I54 A;  2LNB A;  3FM5 A;  3MCZ A;  4M71 A;  1T98 A;  1IAW A;  2EFW A;  2A69 F;  2A5Y B;  4CGZ A;  1B9M A;  4EJW A;  2EFQ A;  3L7W A;  2GZW A;  5HS8 A;  3WTV C;  2EV5 A;  1IN7 A;  1IN8 A;  4UUV A;  2HOE A;  1MGT A;  1YFH A;  4LLL A;  3KP4 A;  3JTH A;  4A0Y A;  1BN5 A;  2IA1 A;  5HOO A;  4U0Y A;  2EFN A;  4AIH A;  3T1B A;  3J81 K;  1R7J A;  3COA C;  2DBB A;  1FC3 A;  2STW A;  2JSC A;  4EJU A;  4EGY A;  2ESN A;  1JGS A;  1TQI A;  4EM1 A;  3ROU A;  2VON A;  3GWZ A;  2P5K A;  4ESJ A;  1JHH A;  2HGC A;  1P4A A;  3GUD A;  2GA2 A;  5LBQ A;  1LDJ A;  4XLN F;  2DPD A;  4B09 A;  3IRR A;  3WTX C;  1ZN2 A;  4KIG A;  1WSU A;  4GO1 A;  1J0R A;  2COM A;  1T6S A;  1FBU A;  3SXY A;  5D5X B;  3MWM A;  2HR3 A;  4Q4Z F;  4N0B A;  1REP C;  3WGG A;  1DUX C;  3RI4 A;  5CVR A;  2KRF A;  2RGV A;  2P5L C;  3FMQ A;  1P2F A;  4CZZ A;  5DYM A;  4WXD A;  4G6D A;  1IW7 F;  1GHC A;  1LQ1 A;  1XMK A;  3CTA A;  1Z9C A;  2VOD A;  4GYI A;  2NNY A;  3CDH A;  4UNO A;  3R0A A;  3KLO A;  1J75 A;  1S7A A;  1BI2 A;  2VC0 A;  4CO8 A;  2IPQ X;  3EET A;  2PMU A;  3O3K A;  1ZGJ A;  4MQ9 F;  4YFK F;  1Z6R A;  4ZYG A;  2ADU A;  5E1Z B;  1TBX A;  4P5O A;  1RUO A;  3KP5 A;  2V1X A;  4R8H A;  2FNA A;  4KMF A;  1RIO H;  2GA1 A;  3RDI A;  1R22 A;  2Z5U A;  1TQM A;  3BY6 A;  3M7G A;  3C18 A;  4LJZ F;  1FSE A;  3GEZ A;  3DPT A;  1O3Q A;  5BPD A;  3F72 A;  3LST A;  3IL2 A;  4OIO F;  5DCM A;  3DEU A;  1H9T A;  1QGP A;  2V9V A;  1KQ9 A;  2TDX A;  3I5U A;  1P6R A;  5L3C A;  3HOS A;  5E17 F;  1U5T A;  5HLI A;  2A07 F;  5DD8 A;  4XSX F;  4BHP A;  2FBK A;  2VBZ A;  4BHC A;  2Q2E A;  4Y17 A;  2ZJ2 A;  1JXS A;  3K1N A;  3KE2 A;  2HTJ A;  4DQ2 A;  3O2P E;  3Q5F A;  3WGI A;  4UV9 A;  1KYW A;  4XRF A;  3P9K A;  1WKM A;  2DTR A;  2F2E A;  1YYV A;  1BI0 A;  1QZY A;  3JAM Z;  1F1Z A;  5IT9 K;  1B9N A;  2P7V B;  4ON0 A;  3HHG A;  2F5C A;  2M5W A;  5HLG A;  3CLO A;  3M1E A;  2UWM A;  5HDG A;  2EJR A;  1MJA A;  2YR2 A;  2QBY A;  2E7X A;  1SAX A;  3H3Z A;  1FWZ A;  4I02 A;  3S2W A;  2FF4 A;  1IUY A;  2XKO A;  3CO7 C;  1FY7 A;  5HLH A;  3ERE D;  2L4A A;  3HIF A;  3IRQ A;  1H0M A;  5CLS A;  2P6T A;  3RYR A;  2PJP A;  3V7R A;  2XRO A;  6PAX A;  2CSO A;  3ZMU A;  3LA7 A;  3EUH A;  1XDU A;  5ED4 A;  1U5T C;  5E20 A;  2W25 A;  1HKT A;  1JHF A;  2D1V A;  2ZME A;  4HF2 A;  1TLH B;  4QWQ A;  5DDG A;  3RIR A;  2VOP A;  5ILS A;  2VT3 A;  2H27 A;  3TO7 A;  1MDM B;  4LLN A;  2OQR A;  1RNL A;  3IKV A;  1QPM A;  1USS A;  2PBI A;  4G9Y A;  3ULQ B;  4CYD A;  4F7Z A;  2QYO A;  2MLG A;  3KZY A;  3OV8 A;  3F8B A;  3PQJ A;  3ECH A;  4FX0 A;  3V8L A;  4A5N A;  1W5T A;  3C3W A;  4DNC A;  3SZT A;  3ZMS A;  2OD5 A;  1KQ8 A;  5JR3 A;  3F21 A;  5J8C A;  1XGS A;  1R1U A;  2VC1 A;  4ESB A;  3I0T A;  1YG2 A;  4M74 A;  4TV7 A;  5A2Q Z;  1W7P D;  2M87 A;  3DXJ F;  2BEO A;  4I7H A;  5LRS A;  2FRH A;  3VOE A;  4U7D A;  1FYM A;  2DI3 A;  4H0E A;  1G3T A;  1IRG A;  4KFC A;  1Z05 A;  3K1P A;  4RGR A;  3D5L A;  1K78 B;  4KN7 X;  1D8K A;  2DLL A;  3ABU A;  5D6E A;  5ILU A;  1J59 A;  2DFI A;  2XRN A;  3HRU A;  2CG4 A;  1HKQ A;  1PP8 F;  1KU9 A;  3KZZ A;  3F8C A;  2H6B A;  3KEQ A;  2HYG D;  1B1B A;  3ABT A;  2YSR A;  2GAU A;  1IF1 A;  4LFU A;  3IKT A;  1K79 A;  2BBY A;  3F8N A;  3HRM A;  3RPU A;  4L9J A;  2YX4 A;  2RV8 A;  2HEO A;  1EV7 A;  5D5V B;  5FLX Z;  3K0L A;  1QO0 D;  2DK5 A;  2OZU A;  3WE2 A;  1AWC A;  5F64 A;  2EA4 A;  3HUG A;  2YPR A;  3E6D A;  1XGN A;  1EH6 A;  5JFR A;  1XCV A;  2PG4 A;  3LFK A;  5BMZ A;  1EH8 A;  3E5U A;  4GCV A;  1IXR C;  4Y15 A;  1YO5 C;  1ON2 A;  3J80 K;  4U0W A;  1YQA A;  3ZPL A;  3T8R A;  3FMR A;  5JHU A;  3H3U A;  1HST A;  3KCC A;  2Y48 A;  3Q9S A;  3B73 A;  2XAH A;  5BS6 A;  4IHT A;  1BIB A;  2IT0 A;  1FBQ A;  1GXP A;  1OYY A;  3VB2 A;  4B8X A;  4M9Z A;  2M8E A;  2R7D A;  1PDN C;  2ISZ A;  1XDS A;  3V7C A;  1HQC A;  1UCR A;  1ZLJ A;  2DQL A;  1IN6 A;  2RVC A;  3GFL A;  2V1U A;  3LQR A;  4U7B A;  4HX8 A;  1KGS A;  4HZF A;  1FX7 A;  1D3Y A;  2HWV A;  1YIO A;  5DV5 A;  2JTV A;  1FLI A;  1R00 A;  3J81 Z;  4ZH4 F;  2NS0 A;  4MNU A;  2Q8K A;  3BPV A;  4AVP A;  1I1S A;  1R1V A;  3FHZ A;  2P7C B;  4IXA A;  1BBY A;  2XGX A;  2MD5 A;  2FOK A;  3K1M A;  1D5V A;  2QWW A;  1RZ4 A;  1R36 A;  5E1X A;  2GQQ A;  3QU6 A;  2E7W A;  3SQN A;  2YX7 A;  1BM9 A;  1XN7 A;  3F23 A;  3K2Z A;  3EYI A;  4LK1 F;  2IP2 A;  1FYK A;  4FHT A;  3N97 A;  2B0L A;  3I59 B;  3DV8 A;  1CGP A;  3REO A;  2W57 A;  5ILV A;  5EEG A;  2JT1 A;  1I5Z A;  3I71 A;  2FML A;  4ENK A;  1FT9 A;  1V3F A;  3RTR A;  1MD0 A;  2Z33 A;  5DD4 A;  2FE3 A;  3BJA A;  4HOB A;  1OKR A;  3HHH A;  1NHA A;  3GYH X;  4KT5 C;  2DPU A;  2Z3Y A;  3FMS A;  1XMA A;  4YFX F;  5J8F A;  1SD5 A;  3FXQ A;  4IVN A;  4RGS A;  2ZFW A;  4HDV A;  2RNJ A;  1ZG5 A;  1ZRE A;  1IXC A;  3GW2 A;  4NQW A;  5ERI A;  3ELK A;  3EDP A;  3WTT C;  2IJL A;  1SFX A;  2Y0M A;  4OMY A;  4O5V A;  1YW8 A;  3ZMT A;  1JE8 A;  1W7P B;  3BPX A;  1IN4 A;  2XVC A;  4L9T A;  3GZ6 A;  5H20 A;  4KDP A;  2A3S A;  1U3E M;  2K4J A;  2XIG A;  2ZKZ A;  2FBH A;  2ZCW A;  3HSR A;  2BV6 A;  5HDN A;  1TW3 A;  3DKW A;  1SD6 A;  4LG0 B;  3E3V A;  2G9W A;  4FT8 A;  1SD7 A;  2DW4 A;  3MAJ A;  3QU3 A;  1Z1D A;  1R5G A;  3VEP A;  4IPA A;  4OIQ F;  2O8X A;  1MJB A;  4IJA A;  4LMY A;  1R23 A;  2FNP A;  3JW4 A;  3NRV A;  2HTS A;  1QBJ A;  2OZ6 A;  4PZJ A;  4RAZ A;  1J5Y A;  1ZAO A;  3ZMV A;  4A0Z A;  2A6H F;  3PFI A;  1BI3 A;  3EYY A;  3ISP A;  4EVI A;  4WWC A;  5L3B A;  5DCF A;  4LLG F;  2AXL A;  3E97 A;  2H09 A;  1W5S A;  2PMH A;  5CJ9 A;  3LA3 A;  3GO5 A;  5IT3 A;  2EA2 A;  4KIB A;  3G3Z A;  1FPQ A;  4G7H F;  1ONV A;  2K4B A;  2HQR A;  5IT9 Z;  1Q1H A;  2O0Y A;  4AWX B;  5LEJ A;  2WC2 A;  1I6X A;  1WWX A;  1DPR A;  5F1R A;  4UVB A;  1ZG1 A;  1W4M A;  3T0Y A;  2MH9 A;  4U0V A;  3E5Q A;  1BC8 C;  5FD5 A;  1A04 A;  2QVO A;  4RB0 A;  2CO5 A;  1LB2 A;  2DT5 A;  4KNY A;  2NAZ A;  3CUQ B;  3RYP A;  2XV4 S;  1U6G A;  3GX4 X;  5ICF A;  3TKY A;  2J5O A;  4EJO A;  1Y0U A;  4RGU A;  1S8N A;  1MJ9 A;  3DQV C;  4R1H A;  2H94 A;  3CUO A;  3WTZ A;  1AOY A;  1B4A A;  2FXA A;  1FP2 A;  1LVA A;  3HRT A;  2KJC A;  1SFU A;  5ICC A;  3GFI A;  2D45 A;  4A12 A;  1S7O A;  2DAO A;  1G6N A;  1HSJ A;  1WQ2 A;  2BE5 F;  1LNW A;  1H9G A;  2UZK A;  5HS9 A;  1I27 A;  4AIJ A;  4EM2 A;  4QLC U;  3VOD A;  2VXZ A;  1HXD A;  3JTG A;  1Z6T A;  1HW5 A;  5TJJ A;  2LKP A;  4EJV A;  4LK0 F;  4EQQ A;  2XKP A;  3I53 A;  1K6O A;  2GIV A;  4HAM A;  4N9H A;  1D8J A;  1SMT A;  3H92 A;  2HKX A;  2ZO4 A;  4L0Y B;  3IWZ A;  2A6E F;  4OMZ A;  4S05 A;  2XHK A;  5JVT A;  4BNC A;  4FX4 A;  1J2X A;  5L3F A;  3HTU A;  4G8X A;  5EEH A;  1IZ1 A;  4RB1 A;  3QOP A;  4I2O A;  4HQM A;  4PGH A;  4NB5 A;  3KP7 A;  3WTU C;  4RB2 C;  3FXR A;  2NNN A;  2X4H A;  2G7U A;  4S04 A;  4BQA A;  1QQI A;  5CVU A;  2EFP A;  3ZN1 A;  3I64 A;  1LEA A;  2W84 A;  3RPQ A;  4L5I A;  1BC7 C;  4O3M A;  4BHB A;  2KKO A;  1T38 A;  4N9I A;  1T39 A;  4A2U A;  4Y13 A;  1SFE A;  3R6S A;  5LHI A;  3J7A O;  5D5U B;  1CF7 B;  2NRA C;  2KIM A;  3SZP A;  1LJ9 A;  2QEN A;  3QPT A;  4A6D A;  3MZH A;  5FD6 A;  2GXG A;  1MDM A;  3FWE A;  3DP7 A;  1O7F A;  1X3U A;  2DO7 A;  4HQE A;  5ICE A;  5E8I A;  4KYW A;  3VFZ A;  1ZAR A;  5L3G A;  3J80 Z;  4G7Z F;  3ZN0 A;  3U1D A;  4OIN F;  1O3S A;  4EJT A;  5CVV A;  5K5R A;  4MEY F;  1ON1 A;  2P6S A;  1FYL A;  3V8K A;  5LHH A;  1ZH5 A;  4HX4 A;  5E18 F;  1UST A;  2GWR A;  4PGG A;  3C1D A;  1GVJ A;  2P8T A;  2K27 A;  4KN4 X;  3KLN A;  2V79 A;  2MBF A;  4Z2Y A;  3JSO A;  4M72 A;  4Q47 A;  2ISY A;  4HV5 A;  3Q9V A;  1O7L A;  3HSF A;  1G4D A;  3MZY A;  3W6K B;  3NQO A;  4M9X A;  2ZNY A;  1K78 A;  4MEX F;  2D2W A;  2HKO A;  4O6J A;  3T8T A;  3M9A A;  5BQT A;  5D5W B;  4ENN A;  4ENM A;  2EK5 A;  2RN7 A;  5D8L B;  1V4R A;  4A0X A;  1G3Y A;  5LGN A;  2QM3 A;  4MTE A;  5CYV A;  2QQB A;  3TDZ C;  2H6C A;  1UHW A;  1KU3 A;  1E17 A;  3E5X A;  2ZXJ A;  2G7H A;  1XSD A;  3U9G A;  2HZT A;  5FFZ A;  4M6Y A;  2FQ3 A;  4IHS A;  2OAZ A;  4ZZD A;  4L5J A;  3ZP5 A;  4OU0 A;  1O3R A;  3GFM A;  1UB9 A;  2RC4 A;  4ETS A;  4L18 B;  3P9C A;  3V4G A;  4RS8 A;  5L3E A;  3WU0 A;  3DPL C;  1ZRD A;  1SD4 A;  2OBP A;  5AON A;  2Q0O A;  1IRF A;  2ESH A;  1FOK A;  5AIP A;  5BPI A;  2IW5 A;  2CW0 F;  4L9V A;  4HLX A;  1YTY A;  3E6M A;  1ZRF A;  1TQP A;  2VOO A;  2KIU A;  3K69 A;  4KA4 A;  2W85 A;  2OU2 A;  3HYI A;  3M8E A;  3B02 A;  2WV0 A;  3JSP A;  4YIF A;  3G73 A;  2RDP A;  2F5F A;  2FU4 A;  3MQ0 A;  4LB5 A;  2UXX A;  2E1C A;  4EV0 A;  3WTY C;  4UVA A;  3CO6 C;  5F6F A;  3GZ5 A;  2OA4 A;  1STZ A;  2L3D A;  4A6E A;  3F8M A;  2RKH A;  5ICG A;  2V1D A;  5HVQ C;  1BIA A;  3LWF A;  2ZBK A;  3V8J A;  5AIQ A;  4IRH A;  3M8F A;  1U78 A;  4GXO A;  3AAF A;  3KP3 A;  5TRD A;  5CVI A;  4WXH A;  4P96 A;  4PDK A;  4I0A A;  2YU3 A;  4GGG A;  4IRG A;  2O6G E;  3LA2 A;  1UHM A;  3HRS A;  4CIC A;  3F6O A;  5CVJ A;  5D6F A;  4HA8 A;  3BP8 A;  2FBI A;  2VBX A;  3ML6 A;  3I59 A;  4MHG A;  1HW1 A;  3BJO A;  3LAJ A;  3P9I A;  1B59 A;  2CGP A;  3R61 A;  1VTN C;  3SHF A;  2FA5 A;  2V6C A;  2GXB A;  2M1B A;  1FNN A;  1G3S A;  4RAY A;  2VN2 A;  4UVC A;  1FSH A;  2AS5 F;  3P7N A;  1ZRC A;  1TW2 A;  1XSX A;  4WX9 A;  4KUM A;  4CDG A;  1UFM A;  2ELH A;  2FMY A;  5DUI A;  2PLY A;  4ZZL A;  1KQ0 A;  1F4K A;  1WI9 A;  3QP5 A;  1HW2 A;  4R79 A;  1Z7U A;  1L3L A;  1YLF A;  1IXS B;  2MLK A;  4RGX A;  4P9F A;  1F9N A;  4EGZ A;  2P5V A;  3FF5 A;  3CJN A;  1BI1 A;  4WXC A;  1ZLK A;  3DFG A;  1MKM A;  5KVR A;  4EMS A;  4BYY A;  5BOX A;  4JQF A;  2D1H A;  1XGO A;  1W7P A;  3FM3 A;  4ZYE A;  1XGM A;  1SMY F;  4JBA A;  5H6R A;  1ZG3 A;  2K86 A;  1FBS A;  3BRO A;  3HOT A;  5LGU A;  3RJP A;  1OMI A;  4LG0 A;  5KK1 A;  1EH7 A;  2LDU A;  3LQQ A;  3N4M A;  1I1G A;  1RI7 A;  4OIR F;  3E6C C;  5DCM B;  4HF1 A;  1J7K A;  3HTS B;  1G3W A;  3EQL F;  3L00 A;  1XCB A;  3V7S A;  2F5E A;  2W24 A;  2XAG A;  2X0L A;  1F5T A;  3BWG A;  1B6A A;  3BZ6 A;  1S29 A;  1IN5 A;  2L4M A;  4OOI A;  4LB6 B;  4EM0 B;  1BJA A;  2EWN A;  2CFX A;  4D0P A;  1U5T B;  4HDU A;  1KYZ A;  4M73 A;  4MQV A;  2PQ8 A;  1HBX G;  1PUE E;  1O57 A;  4WCG A;  2R3S A;  2XAF A;  5FO5 A;  4A5M A;  4I98 B;  4LD5 A;  5HDK A;  1FP1 D;  3R4K A;  4XSZ F;  5E1W A;  3F6V A;  4P55 A;  4ZYH A;  3R60 A;  3KP2 A;  3RKX A;  1YS7 A;  4K2E A;  5L3D A;  1BOA A;  3KFW X;  3NEU A;  1LDK B;  2FSW A;  2J5P A;  1P4W A;  4Q48 A;  3LAP A;  4HV6 A;  2EB7 A;  2QQA A;  3CUQ A;  4G94 A;  2R7F A;  3K9T A;  2EV6 A;  4JK1 X;  4L9N A;  3E6B A;  1KA8 A;  5LGT A;  2QBY B;  4OIP F;  1R1T A;  2O3F A;  3TGN A;  2F5D A;  4P9U A;  3WG9 A;  4HW0 A;  2P4W A;  4KIC A;  4CHU A;  2IA2 A;  2CYY A;  5D8K B;  2CWE A;  3BJ6 A;  3GFJ A;  2HYF A;  5LHG A;  2UXN A;  4BAY A;  3D0S A;  4AD9 A;  2XAJ A;  2PFB A;  2XAS A;  1ZHF A;  3W6J B;  2ZME B;  1YS6 A;  2JZY A;  2M30 A;  2Z99 A;  4U88 A;  4MTD A;  3QAH A;  3R0J A;  1WRJ A;  1P4X A;  3KP6 A;  1DPU A;  1LEB A;  2HFH A;  5FFX A;  2MC3 A;  1ZYR F;  2LSO A;  2ACJ A;  3ZQ7 A;  2PEX A;  2JPC A;  4WF2 A;  3QP6 A;  1FZP B;  4ZYD A;  2HS5 A;  2PI0 A;  2PN6 A;  4AIK A;  1QNT A;  3CUQ C;  3WE3 A;  1QZZ A;  5J6X A;  4LGW A;  1T2K A;  4G7O F;  3KEO A;  5JI6 A;  1OPC A;  3ZMD A;  2HDC A;  3BOQ A;  1HKS A;  1OYI A;  2IA0 A;  3OOP A;  3T5X A;  5H6Q A;  3JAM K;  5D4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...