3U9GA

Crystal structure of the zinc finger antiviral protein
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
223
structure length
217
Chain Sequence
DPGVCCFITKILCAHGGRMTLEELLGEIRLPEAQLYELLETAGPDRFVLLETTRSVVATTRARVCRRKYCQRPCDSLHLCKLNLLGRCHYAQSQRNLCKYSHDVLSEQNFQILKNHELSGLNQEELACLLVQSDPFFLPEICKSYKGEGRKQTCGQPQPCERLHICEHFTRGNCSYLNCLRSHNLMDRKVLTIMREHGLSPDVVQNIQDICNNKHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of N-terminal domain of ZAP indicates how a zinc-finger protein recognizes complex RNA.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Antiviral protein
molecule keywords Zinc finger CCCH-type antiviral protein 1
total genus 70
structure length 217
sequence length 223
ec nomenclature
pdb deposition date 2011-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18606 HTH_53 Zap helix turn helix N-terminal domain
A PF18633 zf-CCCH_8 Zinc-finger antiviral protein (ZAP) zinc finger domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3u9gA01
1YW7A 3WTTC 3OOPA 1JXSA 4EM0B 4GYGA 3M8FA 1TQPA 1ODDA 3G73A 3FX3A 2Z9OA 2CWEA 2XGXA 1ZGJA 3BZ6A 1FP1D 3R0JA 1R00A 1MZBA 3R6SA 2JT1A 3ECHA 5BOXA 4G8XA 1SFEA 5HDKA 1SD6A 3E5XA 2P4WA 5CLSA 3ROUA 1ZRFA 1E2XA 1ONVA 5LRSA 2RNJA 4IXAA 3GWZA 5CVRA 1YS6A 2HWVA 1I6XA 2DQRA 1Y0UA 3HRUA 4KYWA 5F64A 2AS5F 3TDZC 1ZREA 1XB4A 1ZH5A 3GX4X 2ZO4A 4N9IA 1YLFA 4I0AA 2OAZA 1P4WA 4HQMA 5ICCA 2B0LA 1XGMA 3VODA 1W7PD 2VT3A 3HTSB 1DPUA 2HQNA 1MGTA 4L5JA 3C3WA 3HSRA 1TBXA 5IT9Z 1V3FA 4OIRF 3HRTA 5DCFA 3B73A 5L3CA 1K78B 1P2FA 4LMYA 2DK8A 2NYXA 2YX7A 3M8EA 4GGGA 4A5NA 1XCBA 4EQQA 3WTYC 1W4MA 2A68F 3FMQA 1HKQA 4I09A 2UXXA 1FSHA 4KIGA 1XGNA 4L9JA 2ZMEA 1UFMA 1LNWA 3CO6C 3MQ0A 3QPHA 2K27A 2ZBKA 4RAYA 3I53A 2EK5A 3WTUC 3RYPA 1U78A 2V6CA 2DPDA 2FNPA 1ZG1A 2Q2EA 4RS8A 2PFBA 1BI2A 3QU3A 1RUOA 3ZN1A 4EGYA 1OYIA 4IPAA 4EMSA 1QNTA 3RI4A 1UCRA 5DDGA 1RI7A 3K2ZA 4P5OA 5F6FA 5LGUA 1STZA 2ESNA 4HV6A 3TO9A 5FLXZ 4JK1X 4I98B 2Q8KA 2MH9A 4GYIA 2MD5A 3T0YA 4U7BA 3KCCA 4Y17A 3IWFA 1AWCA 4K2EA 2MLGA 3O2PE 3G3ZA 5DEQA 2MC3A 3SFZA 3K1MA 2H09A 3FHZA 2PJPA 2DLLA 5BMZA 3E6DA 3SXYA 3I4PA 2YX4A 1LEAA 1D5VA 2K7LA 3KZZA 5F1RA 1Z7UA 5LLQA 2HYGD 2R7DA 1U5TC 4GXOA 1G6NA 4MTDA 5KVRA 2DAOA 2F2EA 3ZP5A 3FMRA 4HQEA 5HLHA 1X3UA 4CO8A 3H3ZA 1XMKA 3BJOA 1TQMA 2L02A 5BQTA 1HSTA 1HW1A 3HHHA 3I0TA 1KU7A 2WV0A 4EJTA 2W25A 3IL2A 4HX7A 4ZYEA 2OQRA 3HHGA 2STTA 1WRJA 4MGRA 4BAYA 1ZLKA 4M74A 4BQAA 1FT9A 4JQFA 2YPRA 4PGGA 1ZG3A 3KE2A 4AWXB 3F8CA 2GXBA 4LFUA 3GO5A 2K4BA 3WTXC 2FSWA 5HS9A 3J81K 2MH2A 4XLPF 1O3QA 2CYYA 2RGVA 4UXNA 3I58A 3IC7A 2K02A 4N9HA 2CG4A 1GXPA 1FZPB 3M9AA 5DD8A 2EA4A 5JR3A 1MJBA 5CVJA 2FMYA 2ADUA 2A61A 4WK8F 2NS0A 3V7SA 3GW2A 5TRDA 1KU2A 4YFNF 5DCMB 3IRQA 3WTWC 2HKXA 1HSJA 5FLXK 2ZFWA 4KICA 3JTHA 3C7JA 3KP3A 2MBFA 3R61A 1IXSB 4ZYDA 2M87A 4U7DA 4HZFA 3FXRA 2L4MA 4D0PA 4YG2F 5LHGA 1YS7A 2F5EA 3JAMK 3RKYA 3TKYA 2RN7A 4G7OF 4XBFA 2PN6A 3RTRA 2HTJA 2EFWA 4N0BA 4KNYA 2DBBA 2IA1A 4UV9A 1EH6A 2P7CB 4MQ9F 2VN2A 4EJUA 3K1NA 3PFIA 2PEXA 3KETA 1FLIA 4EJOA 1MDMA 1G3WA 1BJAA 2QUFA 3TDUC 1P4XA 1O3TA 3ABUA 2NNNA 3WU1B 4WXCA 1BI1A 2G9WA 1BN5A 1FYMA 2AXLA 3MWMA 3U9GA 4WXDA 5FO5A 2C6YA 4RB1A 1U8RA 2A5YB 2HS5A 5ERIA 5J8CA 2STWA 4H0EA 4HV5A 5FFZA 1YQAA 1ZRDA 3FM5A 3J81Z 3ZQ7A 4ESFA 3ECOA 5K5QA 2F5FA 2P5VA 3C18A 1RNLA 3AAFA 3EYIA 3QP6A 4RB2C 1IXCA 1HKTA 4O3MA 4HF1A 2A3SA 2IA0A 1ZN2A 2M8EA 1B9MA 3GUDA 1USSA 5FGMA 2XKOA 4CHUA 2OQGA 4Q48A 3QU6A 3I64A 1HBXG 2VOOA 2OA4A 5CJ9A 2K86A 3DKWA 1S7AA 1QZZA 3R0AA 5D6FA 3B02A 4HA8A 4Q47A 1TW2A 4NQWA 1UB9A 2M5WA 3LA7A 4M9ZA 3LWFA 2VBXA 2KIFA 2P6TA 2H94A 1IN7A 2XAJA 3K1PA 3RDIA 2VC0A 3RKXA 2CO5A 2ZJ2A 2QLZA 3IRRA 1LEBA 1FC3A 3Q5FA 2D2WA 3BROA 1F4KA 3LQRA 4OU0A 1U3EM 5LGTA 4HF0A 2M45A 4UNOA 3IKTA 2GIVA 1YO5C 5BPDA 1K7AA 1U5TA 2V9VA 3EQLF 2V1DA 2L3DA 1XMAA 2JPCA 5D4SA 2DO7A 2EFOA 2M30A 1KYZA 3F6VA 5HLIA 2QZ8A 3K9TA 3V8JA 3SZPA 2CGPA 4IRGA 5J8FA 2YR2A 2EB7A 2ELHA 3KFWX 4L5IA 4PZJA 3TOBA 4E70A 3Q9SA 3DP7A 5E8GA 3RKWA 4M9SA 4A5MA 3GFMA 3LAPA 4B09A 1QZYA 3BJ6A 5CVUA 2VBYA 4HF2A 2IW5A 4WCGA 3V4GA 3MZYA 2HKOA 2XVCA 2GXGA 1J7KA 3I5UA 3L9FA 1FBSA 2ZKZA 4L0YB 4KN7X 1FOKA 3CO7C 1FBQA 5JI6A 2MA3A 1OPCA 3FWEA 1OR7A 2DFIA 4M6XA 2W24A 1HXDA 1XCVA 4MQVA 4FHTA 2LF8A 1R36A 3JW4A 1IN8A 4G7ZF 1XSVA 1YW9A 2P5LC 5ICEA 1D3YA 1QQIA 1XGSA 1IW7F 5CVIA 1R1UA 5HLGA 2W85A 1LJ9A 3TO6A 1FYLA 3MAJA 2HZTA 3TQNA 5E1WA 5LEKA 1Z91A 4FX4A 1T2KA 3F21A 2XKPA 3EUHA 3DF8A 4CDGA 1BIBA 1R23A 3WG9A 1IN5A 1XDUA 2OU2A 3BPVA 1RIOH 4KFCA 3BDDA 3ZMTA 1S7OA 1F5TA 2GWRA 3RPQA 3GXOA 1HW2A 3CJNA 3GZ5A 1TQIA 4OMYA 3FXQA 1DUXC 1XSDA 1OKRA 4YIIA 3SHFA 2A69F 2HOEA 4LG0A 2DW4A 1T6SA 1ZGAA 1R5GA 4XSZF 1IZ1A 3GZ6A 3N97A 3DV8A 3F8MA 5ILVA 2JRTA 1DDNA 4Y13A 4RGUA 1ZYRF 1J0RA 1SD4A 2E1NA 5CVVA 2WWYA 5E1XA 4LG0B 1G3SA 3BPXA 2V79A 2P6SA 4L9VA 1G4DA 5EEGA 4A6DA 3JAMZ 2R3SA 5CYVA 1UHMA 3H92A 4L9TA 1IAWA 4EJVA 2DPUA 3WTSC 4QLCU 5HVQC 3LSTA 1T39A 1SMYF 1E17A 3O3KA 2ZMEB 1KQ8A 1DP7P 4QWQA 1SAXA 3LA3A 3QOPA 3ELKA 1T38A 4WXHA 2DT5A 4G6DA 1SFXA 2QWWA 1QPMA 5HS7A 5E17F 2NAZA 4BHBA 1R5HA 1FY7A 3CLOA 4UV8A 4WWCA 4AIKA 4M72A 1ZAOA 4A0ZA 3HUGA 5LRRA 2FNAA 4TV7A 3GFJA 4P9FA 3L2CA 1B59A 2FRHA 4IVNA 4L9NA 3K0LA 1EV7A 2HYFA 4O6JA 2J5PA 4PCQA 5HOOA 4ENNA 2KJCA 3K69A 3GFIA 4EM2A 3P9KA 2OBPA 3OV8A 5ICFA 3J7AO 3QAHA 5L3BA 4Q4ZF 4KDPA 3KZYA 2GAUA 1D8JA 3DXJF 3LA2A 1Q1HA 3O6BB 2Z99A 4KA4A 1V4RA 1WQ2A 2X0LA 2D45A 4LLGF 1TTYA 2OD5A 1XN7A 2JTVA 1OMIA 3HOTA 1R1TA 3BJAA 1BM9A 3IKVA 3WTVC 3HRSA 2HTSA 1UHWA 1YTYA 2FA5A 3KP5A 4AVPA 1MKMA 3RPUA 2JZYA 2ACJA 3E5QA 2FBIA 2CQKA 1MDMB 2IRFG 2KJBA 2D1HA 5HDGA 4LGWA 5DUIA 2ESHA 3REOA 5K1YA 4IRIA 4ON0A 4ZYHA 1O3RA 3ZN0A 2LNBA 2XAFA 2MLKA 4HDVA 1G3YA 4M73A 3U1DA 2PLYA 5DCMA 4HW0A 4R8HA 1XSXA 1Z6RA 3ZPLA 2FE3A 1YFHA 4ZZDA 4HYEA 3DFGA 5D5XB 3COAC 1O57A 3WE3A 2BE5F 5H6RA 4ASNA 3GVAA 4P55A 4CICA 1QBJA 1YG2A 1RUNA 1PDNC 4UVAA 2EV0A 2BEOA 5LEJA 1F1ZA 1KU9A 3WGHA 2Z5UA 4OIPF 4EVIA 2P7VB 1I1GA 1O7FA 1PP8F 5L3GA 3E5UA 4UHTA 4KUMA 5DV5A 1QO0D 1S6LA 2EWNA 4UUVA 1U6GA 3BP8A 4G6QA 1Z6TA 2RVCA 1F9NA 4RB3C 3SZTA 2O61A 4U0YA 1JE8A 1P92A 1YW8A 1LQ1A 4U0VA 1R22A 3CUQB 2OZ6A 5D8LB 1YIOA 4LB5A 3RYRA 4MEXF 1ZARA 4ESBA 5JVTA 4S04A 2BGCA 2FQ3A 2H6CA 5FFXA 3VB2A 3NEUA 2XASA 1KYWA 3FMSA 4JBAA 2BYVE 1HKSA 4UVCA 2LSOA 2D1VA 4KT5C 3J80K 2Y0MA 1FYKA 1W5SA 3F72A 4L18B 4RB0A 3TOAA 4EGZA 4XRFA 2GQQA 5H20A 4IJAA 3CUQC 1C0WA 5E18F 1IN6A 3WE2A 2KIMA 2R7FA 3JTGA 4OINF 4DQ2A 5K5OA 5E8IA 4MHGA 5AONA 2QQ9A 4M6YA 2VC1A 1B4AA 2XRNA 2XUBA 1EH7A 2ZNZA 3DPLC 1L0OC 4RGSA 4LLLA 1KU3A 3I54A 3DQVC 2EFQA 1FP2A 2HEOA 3KP7A 2O0YA 2XAHA 2V1XA 1D8KA 3F6OA 2GZWA 1REPC 4IHSA 2CSOA 3E3VA 4KIFA 1K6OA 1YYVA 1H0MA 4G7HF 5BPIA 4BH9A 1IN4A 1ZG5A 1O7LA 3LFKA 2RC4A 1NHAA 4IHTA 2JSCA 4HX8A 3VFZA 1A04A 1EH8A 3L09A 3KP6A 1FWZA 5A2QZ 4I02A 2PQ8A 5E1ZB 5ILSA 2QBYA 1J9IA 3GYHX 1CF7A 2ZCWA 3IHUA 5ED4A 3HSEA 4RGXA 1CF7B 4P9UA 4UVBA 2WTEA 2VODA 1OYWA 2ZXJA 4G9YA 2DK5A 4YIFA 1XGOA 2BV6A 1J59A 4I7HA 3HYIA 1H9TA 3WGIA 2E7WA 3R4KA 1LDKB 2VE8A 2W57A 1S29A 3WU0A 3H3UA 1T98A 3VOEA 4Q5SF 1HQCA 3DEUA 3BY6A 1KGSA 3ULQB 1I27A 3CTAA 1BI0A 1LB2A 4R1HA 3HTUA 1HW5A 2KKOA 1IRGA 4CYDA 4U88A 4A6EA 4AIJA 1WI9A 2K4JA 1G3TA 4PDKA 1SD7A 1B1BA 3F8FA 3L00A 4FX0A 2UZKA 2LKPA 4O5VA 3FZVA 3FM3A 3ML6A 2P8TA 4ENJA 2RDPA 3E6CC 2XAQA 3TO7A 3L7WA 3KLOA 2L01A 3RIRA 1BC7C 4EJWA 2FOKA 3SQNA 2J5OA 3F23A 1FX7A 1Z9CA 2P5KA 4P96A 1TNTA 4HDUA 3I59B 2QM3A 1W5TA 3HSFA 3FF5A 5E20A 2NRAC 4Y15A 2YSRA 2KIUA 1PUEE 3MEXA 2LF7A 3BOQA 3P7NA 2OZUA 1BBYA 2FU4A 2Y48A 1B6AA 4KIBA 1T0FA 5HDNA 2RV8A 1GHCA 3ZMZA 3QRFF 4BYYA 4EV0A 2UXNA 4OOIA 2BBYA 2A07F 2LDUA 2TDXA 2XROA 2UWMA 1KQ9A 3F8NA 1L3LA 1PP7U 4M71A 4KMUX 3HOSA 5L3FA 5LHIA 1CGPA 5FD6A 4HAMA 3RJPA 2DI3A 2H6BA 4G94A 1FNNA 1TNSA 4ESJA 2VBWA 1LDDA 3KP4A 4OMZA 2G7HA 5A2QK 2HFHA 2DU9A 5KK1A 5FD5A 3W6KB 3LAJA 4LK1F 1WKMA 2EFPA 4AD9A 1TLHB 2QQBA 2VE9A 3D0SA 5JFRA 3NRVA 1IF1A 4L0ZB 5ICGA 3E6BA 1ULYA 4HLXA 1FSEA 2IP2A 3V7RA 1MD0A 3JSOA 2QVOA 2EV6A 1VTNC 3ABTA 1FPQA 1ON2A 1KQ0A 2COMA 2HGCA 2ISYA 1BC8C 2EFNA 2GA2A 2L54A 4A2UA 1Z1DA 1Z05A 2QENA 2FBKA 1LVAA 4LJZF 3ZMDA 1R7JA 5D5VB 3GEZA 3V8KA 3ZMVA 1ZHFA 2EA2A 1XD7A 4F7ZA 3Q9VA 1J2XA 1K79A 1P6RA 4WX9A 4ENMA 3ERED 4HBLA 2M1BA 3MZHA 4I01A 1P4AA 2E1CA 5AIPA 3R60A 1XDSA 3T8RA 5IT3A 3PQJA 1USTA 4CGZA 3KEQA 1AOYA 3MFKA 1DPRA 2XIGA 2WC2A 4ZYGA 3VEPA 3KEOA 3V7CA 4LK0F 3C1DA 4NHJA 1O3SA 3CUOA 1ZRCA 3LQQA 2F5CA 4DNCA 5AIQA 1J5YA 1JHHA 1ON1A 3EDPA 3M1EA 2ISZA 5K5RA 1SFUA 2O3FA 1B9NA 1SD5A 5IT9K 2DTRA 2A6EF 2FF4A 2EV5A 1ZLJA 4ENKA 5L3EA 4MTEA 5D4RA 2PBIA 3E97A 1W7PB 3P9IA 3P9CA 3V8LA 4A12A 3W6JB 2HQRA 1J75A 2W84A 2G7UA 3NQOA 2PMUA 4XLNF 2Z33A 1IUYA 3DPTA 4OIQF 2PG4A 1S8NA 1QGPA 4MEYF 3U2RA 5D5UB 2FBHA 1S3JA 3F3XA 2Y75A 1WWXA 5H6QA 1W7PA 2YU3A 2GA1A 3MCZA 2QQAA 3N4MA 2VONA 3HRMA 4I0BA 2O03A 1MJAA 4IF4A 3J80Z 1WSUA 1R58A 4CXFA 4BXUA 1IRFA 2A6HF 2IA2A 3ZMSA 2DQLA 5TJJA 5EEHA 1H9GA 2VBZA 4PGHA 2L4AA 4IRHA 3FXUA 1RZ4A 5DD4A 5ILUA 4FT8A 2FXAA 1GVJA 1I5ZA 1GXQA 4HOBA 2VXZA 4A0YA 2XAGA 4NB5A 3T5XA 4BHCA 2PI0A 4ETSA 4HX4A 3QPTA 4BNCA 3GLXA 1U2WA 4AIHA 1I1SA 1R1VA 2F5DA 2PMHA 3BWGA 4WF2A 4MNUA 2ZNYA 3GFLA 1U5TB 3WODF 2Z3YA 4M9XA 3QP5A 2RKHA 2O6GE 3F22A 2IT0A 1SMTA 4XSXF 2QYOA 2ETHA 4GCVA 1TW3A 4LB6B 4LD5A 5HS8A 2IJLA 2HR3A 3CUQA 1MJ9A 5DUKA 1BI3A 5D5WB 5D6EA 4Z2YA 3I71A 3ISPA 3EYYA 2CW0F 3I59A 3GF2A 3WGGA 5LBQA 4A0XA 2HDCA 2Q0OA 2V1UA 3T1BA 5BS6A 3E6MA 3JSPA 2IPQX 1IXRC 4R79A 3M7GA 4BHPA 1K78A 4YFXF 3CDHA 4ZZLA 4KN4X 2QBYB 2IVMA 4B8XA 1OYYA 3S2WA 4HLYA 2VT2A 2JPBA 2XV4S 3KLNA 5DYMA 5FB2A 3WTZA 3TGNA 5LGNA 2X4HA 4OIOF 2EJRA 4RAZA 3T8TA 3HIFA 1JGSA 1FBUA 2XHKA 1BIAA 3ZMUA 4ZH4F 3F8BA 5L3DA 4KMFA 5D8KB 1BOAA 1LDJA 2VOPA 2NNYA 4CZZA 4YFKF 2H27A 2CFXA 5LHHA 3D5LA 3IWZA 4S05A 2FEZA 4GO1A 3KP2A 3EETA 2E7XA 2O8XA 4LLNA 2FMLA 2RQPA 4U0WA 4RGRA 2KRFA 1JHFA 5J6XA 6PAXA 5JHUA 1KA8A 3PQKA 4I2OA 4EM1A
chains in the Genus database with same CATH superfamily
4CSWA 1YW7A 3WTTC 2JVHA 3BR2A 3OOPA 1XS9A 3K7AJ 2RNGA 3EUHC 4EM0B 1JXSA 4GYGA 3M8FA 1OLTA 1TQPA 5GAEJ 3BCAA 1A36A 2KFDA 3O8HA 1ODDA 3G73A 2XGEA 3X2QH 3FX3A 2Z9OA 2CWEA 2XGXA 1ZGJA 3L2VA 1YJNI 1DGRM 3BZ6A 1FP1D 3R0JA 1R00A 4RA2A 2TCTA 1MZBA 2HDWA 3R6SA 3K70D 2JT1A 3G4SI 2VPRA 3ECHA 3OIQA 5BOXA 5DM7F 4G8XA 1SFEA 5HDKA 3CCJI 1SD6A 3E5XA 2CH0A 2HU9A 1LFUP 1JI8A 2ZSHB 2P4WA 5CLSA 3ROUA 3VYRB 2LP0A 4BEHB 4Y33A 2BOLA 3VYSB 2DA6A 4BDYA 1ZRFA 1G8XA 5K7HA 1E2XA 2R4GA 1ONVA 5LRSA 2RNJA 1T8IA 2BY2A 2X1EA 3DLAA 4IXAA 3GWZA 5CVRA 1ORKA 2OCEA 1YS6A 2HWVA 2KDOA 5KAFC 4Z6YA 1TL8A 4A3DJ 2JA2A 2R7TA 1I6XA 2GLOA 5IYBJ 2DQRA 2L9RA 1Y0UA 3HRUA 4KYWA 5F64A 2AS5F 2DMPA 3RSNA 3TDZC 1ZREA 1XB4A 2KHMA 1ZH5A 1GT0C 3PIOF 3GX4X 2DCEA 2ZO4A 4N9IA 1YLFA 1OCTC 4I0AA 2OAZA 1P4WA 3E0JB 2H1KA 1JTYA 2JRMA 4HQMA 5ICCA 3RCOA 2B0LA 1XGMA 3VODA 2DMQA 1W7PD 1JKQC 4QPOA 3CC7I 2VT3A 3HTSB 1DPUA 1MH3A 2HQNA 1MGTA 3TL4X 2ECBA 2B63J 4L5JA 3OOUA 3C3WA 3HSRA 3PFYA 1TBXA 5IT9Z 1V3FA 2BY3A 1YX5A 4OIRF 3MN2A 3FDYA 2L9VA 3SEQA 4XLHA 4H4KC 3HRTA 5DCFA 5F0HA 3B73A 3JR9A 5L3CA 1K78B 1P2FA 4LMYA 2DK8A 3BTIA 3TP0A 4GFBA 4FTHA 1JUMA 1NG7A 2NYXA 4FISA 5TGTA 2YX7A 3M8EA 3G1MA 1TWHJ 2DMNA 1R49A 3SJMA 4GGGA 2V9PA 3OYLA 3LMMA 4A5NA 1XCBA 3OSGA 4EQQA 3WTYC 1ENHA 1W4MA 2A68F 4IX7A 2LREA 3FMQA 1HKQA 1X2NA 5KAIC 4I09A 2UXXA 4QTRA 3FXMA 1FSHA 4KIGA 1XGNA 4L9JA 3JRAA 5EG0A 2ZMEA 1UFMA 4A3FJ 2IGOA 1LNWA 3VPRA 3CO6C 3MQ0A 3QPHA 2K27A 2ZBKA 5IP9J 4RAYA 4Y7NJ 5GPAA 1FTTA 3I53A 4IL6C 1UZCA 2EK5A 3WTUC 2NVTJ 3RYPA 1U78A 2V6CA 2DPDA 1JUSA 2FNPA 1ZG1A 3S2HJ 2Q2EA 4W97A 4RS8A 2BY0A 2PFBA 1BI2A 5F1JA 4XOPA 3QU3A 4XM3A 1RUOA 3A1YA 3HB9A 3ZN1A 3BT9A 4EGYA 1WVRA 2LKSA 3H5AA 1OYIA 4IPAA 4OAYA 2Z16A 4EMSA 2LY9A 1QNTA 1DU0A 3RI4A 1UCRA 5DDGA 1RI7A 3K2ZA 1JGGA 4P5OA 5F6FA 1ZK8A 5LGUA 1STZA 1SC7A 2ESNA 4HV6A 1YITI 3TO9A 5FLXZ 4B44A 4JK1X 4A3GJ 4RM2A 3GTPJ 3BR0A 4I98B 2Q8KA 2IEKA 2VJIA 2MH9A 4GYIA 2MD5A 3T0YA 1QVTA 1RR8C 4U7BA 3CDLA 3KCCA 4Y17A 3IWFA 1AWCA 4HSTA 1VF9A 2V1NA 2DJNA 2R7UA 4K2EA 2MLGA 2L5QA 5J3LA 3O2PE 3G3ZA 5DEQA 2MC3A 1ETYA 3SFZA 3K1MA 1CQTA 2H09A 4F91B 3FHZA 1UJ8A 4DYQA 1VZ0A 2PJPA 5J40A 2DLLA 5BMZA 2JWTA 3E6DA 3SXYA 3I4PA 1W0TA 2MSYA 1X4OA 2IXSA 2YX4A 2EZIA 3OYBA 1Y1WJ 2XPWA 2AO9A 1LEAA 2WY7Q 1D5VA 2K7LA 3KZZA 3TW7A 3J7ZI 2O7OA 1Z7UA 3CP2A 5F1RA 1KONA 4MFDA 3O8GA 1NK3P 4Y4RA 2HYGD 3K4JA 5LLQA 2R7DA 1Y56A 1U5TC 2FQ4A 4GXOA 1G6NA 3PO2J 1OCPA 4MTDA 1IV8A 4NDLA 2CW8A 2B9SA 2DFFA 2DAOA 5KVRA 1TWAJ 2D5VA 1U9NA 2A5WA 2F2EA 4UB6C 4CUGA 3ZP5A 3FMRA 2IGMA 3CZ6A 4HQEA 1BJZA 3VYUB 5HLHA 1X3UA 4CO8A 4C2UA 3H3ZA 1XMKA 3BJOA 2Y9ZA 2F4OB 3L2WA 2H8WA 3JRHA 3AL0B 5DS9A 3L2QA 3GZNB 1TQMA 2L02A 5BQTA 1UG2A 2HDDA 2JJ7A 1W5CC 3ZCOA 1HSTA 4AIDA 1HW1A 3CESA 3HHHA 3RQIA 3UR3C 1FJLA 2EBIA 2PMZA 3I0TA 3QOEA 1KU7A 2WV0A 2LKXA 4JYKA 5C4XJ 1ETWA 4EJTA 2W25A 3D5SC 3IL2A 5JVGF 4M3FA 4QIWN 4EATA 4HX7A 1A5JA 4ZYEA 2OQRA 3S8PA 3HHGA 1WRJA 2STTA 4MGRA 4D5CA 3PJRA 2DYRH 4A93J 2L7FP 3BLYA 4XR6A 3DTEA 4BAYA 2IBDA 3RZOJ 4MIMA 1ZLKA 4M74A 1D0ZA 4BQAA 3BG3A 1FT9A 4JQFA 2YPRA 4PGGA 1ZG3A 3KE2A 2OC6A 2RREA 4AWXB 3F8CA 2XC7A 4YRVA 3D1NI 2GXBA 3OS1A 4LFUA 2L2OA 3GO5A 4ABZA 2K4BA 3WU2C 4XRMA 2JA7J 3WTXC 1E0EA 2FSWA 5EG0B 2NS8A 5HS9A 3J81K 1SEUA 3EPZA 1MBEA 3CCQI 3MKLA 2MH2A 3K70C 2M4KA 4XLPF 2CQNA 2NS7A 2AHQA 3QQAA 1SANA 1O3QA 2CYYA 2F4IA 5EGOB 2RGVA 4UXNA 3I58A 3ERMA 3IC7A 2K02A 4DYCA 3RZDJ 4ZJZA 1ERDA 1MBJA 1OR7C 4N9HA 3OYAA 1Z0XA 2CG4A 1GXPA 2VKVA 3BR1A 4NC8A 2AQEA 1FZPB 3ZQHA 4DBQA 2K3PA 1RKWA 1U8BA 3M9AA 3GTJJ 5DD8A 2R5ZB 3M8JA 4BS9A 2EA4A 5JR3A 4FE4A 1MJBA 3MKWB 5CVJA 3CD6I 3BZKA 2FMYA 2ADUA 1VQOI 4E7ZA 1O4XA 5LFAA 2XSJC 2E19A 2A61A 4WK8F 2NS0A 3PNYA 3V7SA 3GTGJ 1HC8A 1X1AA 2ZFUA 3GW2A 5TRDA 4CH7A 4XIDA 1KU2A 4YFNF 3J7YJ 5GAGJ 1H88C 5DCMB 1IDYA 1W1WE 3IRQA 3WTWC 2HKXA 1HSJA 1R4MB 2FOWA 2HOAA 5FLXK 3H35A 2ZFWA 4KICA 3JTHA 3H9JA 3C7JA 1TWFJ 1HLVA 3KP3A 2MBFA 3R61A 1Y6IA 1IXSB 1WCMJ 4ZYDA 1HF0A 2M87A 4U7DA 2LVSA 4HZFA 3FXRA 5K7ZA 3FISA 1H89C 2L4MA 1MIJA 2OJED 4II2A 4D0PA 3DU5A 4YG2F 5LHGA 1MBKA 1YS7A 2F5EA 5F0FA 2ELJA 3JAMK 2VUMJ 5FKLA 2JA5J 3RKYA 2ICWG 3ESWB 5K7FA 3TKYA 2RN7A 4G7OF 4XBFA 3ZQIA 4JOMA 1NTCA 4XLFA 2PN6A 3RTRA 2HTJA 2EFWA 3QPSA 1WZ2A 4N0BA 4KNYA 3QYEA 1W0UA 2DBBA 3TEDA 1B8IA 2KP6A 2IA1A 4UV9A 2HOTA 1EH6A 4KJZA 2P7CB 3BQZA 2BW3A 5CPRB 2VN2A 4MQ9F 1I6HJ 4HRIA 4IQJA 4EJUA 2VXDA 3K1NA 1VQ9I 3PFIA 2PEXA 3KETA 2R7ZJ 1FLIA 4EJOA 4DIQA 1MDMA 1G3WA 1GUUA 1BJAA 3JRDA 2QUFA 1Z7LA 3TDUC 1P4XA 2K9NA 1O3TA 3P5JA 3H36A 5EZHA 1OFCX 3ABUA 4RM3A 3L2UA 2NNNA 3WU1B 3L1PA 4I99C 4WXCA 1BI1A 2ZXWH 3F0CA 2G9WA 3HPGA 1BN5A 1FYMA 2AXLA 1GV5A 2RAEA 3MWMA 5F27A 3U9GA 3F9KA 3PL8A 4WXDA 5FO5A 1SFOJ 2C6YA 3H9GA 2K9LA 2WAFA 2NVUB 1IV6A 4RB1A 1U8RA 4XK4A 3K4LA 2A5YB 2HS5A 2ME0A 5ERIA 5J8CA 2EIMH 4H0EA 2STWA 5CQGA 3ZXSA 4XMYA 3FKJA 2HPIA 4HV5A 5FFZA 1YQAA 1M1EB 1ZRDA 3FM5A 1IC8A 3J81Z 3OWTA 3ZQ7A 1GVDA 3DBHB 4ESFA 3ECOA 1OCOH 2BHZA 3CJTB 2F5FA 2P5VA 3C18A 5K5QA 2P81A 1RNLA 3AAFA 3EYIA 3QP6A 3CJRB 1MW7A 1YI2I 4RB2C 1IXCA 1HKTA 3FK6A 3TMOA 3M07A 3NAUA 4O3MA 4HF1A 2A3SA 5EEAA 2IA0A 2W00A 3WG7H 4BKXA 1ZN2A 2M8EA 3S1NJ 3AKZA 1B9MA 2K5CA 1VQLI 3GUDA 1T56A 4D7NA 2BVMA 1USSA 5FGMA 2L7KA 2VIXA 2XKOA 4FETA 4CHUA 2OQGA 4Q48A 3QU6A 3M4OJ 3I64A 2V26A 1BOBA 1HBXG 2VOOA 2OA4A 5CJ9A 4UUSA 2K86A 3DKWA 2PJRA 4DW6A 1S7AA 4II3A 2JQ7A 4CCKA 2CQQA 1D0XA 1LUJB 1IUFA 1QZZA 3R0AA 5D6FA 4LIUA 3B02A 1Y0NA 1VQ5I 2UV1A 3OYEA 3LL7A 4HA8A 4J19A 2M34A 4Q47A 1TW2A 4YEJA 3ZQCA 5TISC 4NQWA 1UB9A 2GOMA 1AA7A 2XGDA 2M5WA 1HDDC 2X6YA 3LA7A 4M9ZA 3LWFA 1EJ9A 2VBXA 2KIFA 1VQKI 1QPIA 1UELB 1UMQA 2P6TA 3C2HA 3CF2A 2H94A 4B47A 2HXIA 3SYTA 4FASD 1DP3A 1IN7A 2XAJA 2W82A 3A4CA 3LSMA 3OR1C 3K1PA 3RDIA 1E3PA 2VC0A 3IP4B 2XDVA 3RKXA 2CO5A 2X85A 3QYFA 2ZJ2A 3CCRI 2Y9YA 1ACIA 2QLZA 4AYBN 2E35A 3IRRA 1LEBA 1FC3A 3Q5FA 5C3EJ 2D2WA 1T0FC 2LRDA 1BR1A 3BROA 2KRCA 2R7OA 1F4KA 1OCRH 2MYSA 3LQRA 4OU0A 2E2HJ 5DTDA 1U3EM 4AVZA 5LGTA 4X6AJ 2WAEA 4HF0A 2HOSA 1POGA 2E5ZA 2M45A 2OF7A 4M3EA 4UNOA 2Y0SA 3IKTA 2GIVA 1YO5C 4FQGA 5BPDA 3GTLJ 1K7AA 3VSLA 2MGQA 1U5TA 2V9VA 3EQLF 2WAQN 1QZEA 2V1DA 1TZLA 2L3DA 4M3DA 1XMAA 1ETVA 2JPCA 3BG5A 5D4SA 4CYCA 4JP0A 1W36D 2DO7A 2EFOA 2M30A 1JKOC 3NWTA 4IHVA 1KYZA 3F6VA 2E2JJ 5HLIA 5GP9A 4B43A 2QZ8A 3K9TA 1D0YA 3V8JA 3SZPA 1MNDA 4IRGA 2CGPA 2K3FA 3RQ4A 1OQYA 5GADJ 5J8FA 2COBA 4BQNA 2YR2A 2EB7A 5M5XJ 2ELHA 3BTCA 3KFWX 4KITB 4L5IA 4PZJA 3TOBA 4E70A 4DYRA 3Q9SA 3DP7A 5E8GA 1LFPA 3RKWA 3I55I 1A6IA 4M9SA 4A5MA 1ITYA 3MVPA 4JX4A 3GFMA 3LAPA 4B09A 1QZYA 3BJ6A 3CMMA 5JLWA 5CVUA 2VBYA 3KYLA 4HF2A 2IW5A 2V7FA 3OYNA 4WCGA 3JREA 5FRNA 3V4GA 2EZLA 3MZYA 2HKOA 2XVCA 3S32A 2GXGA 1J7KA 2F5VA 3I5UA 2E5NA 3L9FA 4N4NB 4LITA 3FKIJ 2LC2A 4DGWB 4U87A 5FRMA 1FBSA 2ZKZA 4L0YB 4KN7X 3LOCA 1FOKA 1WJEA 2Z1DA 5EJCA 3CJQB 1FBQA 5JI6A 2MA3A 3CO7C 3BTLA 1OPCA 1FOXA 3FWEA 1OR7A 2DFIA 1Y39A 2DMTA 2JUCA 4GRIA 4DOZA 2MD0A 1QHGA 4M6XA 2W24A 1HXDA 1XCVA 2K9QA 4MQVA 1UAAA 4XRSA 3GCMA 2OTLI 4FHTA 1WJFA 2LF8A 2WY8Q 1R36A 3JW4A 1IN8A 4BJ5C 4G7ZF 1MBFA 1XSVA 1YW9A 2P5LC 4BE1A 5ICEA 1D3YA 1QQIA 4C2TA 1XGSA 1IW7F 5CVIA 1R1UA 4XKCA 5HLGA 2W85A 4IEJA 1LJ9A 1UG0A 3TO6A 1FYLA 3MAJA 3PM1A 2HZTA 4D9JA 3G1LA 3TQNA 5B5EC 1W36C 4IHWA 5E1WA 1VQNI 5LEKA 1Z91A 4FX4A 3FXJA 3VSKA 1T2KA 1XPXA 1G2HA 3F21A 3EUHA 2MFZA 2XF7A 2XKPA 3DF8A 2Y30A 4CDGA 3BG7A 1BIBA 1R23A 3CCEI 3SZGA 3GLLA 2EINH 1N75A 3WG9A 1IN5A 2LH9A 1XDUA 2OU2A 4ITVA 3BPVA 1RIOH 4KFCA 3BDDA 3S3NA 3W3CA 4M3BA 4YELA 3ZMTA 4XNFA 3CP8A 1S7OA 3DKYA 2QF7A 1F5TA 2GWRA 3RPQA 2V4JC 1IG7A 3GXOA 3ZQLA 1MSFC 2IS6A 2P0WA 1HW2A 5FKOA 3CJNA 3GZ5A 1TQIA 3FXQA 1DUXC 2PX9A 5KCMA 1XSDA 4OMYA 1OKRA 5EZGA 4YIIA 2HOEA 2A69F 4LG0A 3SHFA 2DW4A 5J47A 1T6SA 1ZGAA 1R5GA 4XSZF 1IZ1A 1G59A 1DU6A 2VQCA 2DOFA 3FBNB 3GZ6A 3N97A 3DV8A 3F8MA 3GTOJ 5ILVA 2JRTA 2NOJB 1DDNA 4CCOA 1BR2A 4Y13A 4RGUA 1ZYRF 1E3HA 1J0RA 1SD4A 3DCFA 2E1NA 4RLQA 5E3NA 3MMYB 4PUSA 5CVVA 2M9HA 4XLCA 2WWYA 2DDAA 5E1XA 1GV2A 4E7KA 1UHSA 2WBMA 3W6VA 4LG0B 3CDIA 2R92J 1G3SA 3BPXA 3WHCA 2V79A 2P6SA 4L9VA 5EEGA 4A6DA 1G4DA 3JAMZ 2H1LA 2R3SA 4P1WA 4Y52J 5CYVA 1UHMA 3H92A 4L9TA 1F36A 4D7MA 2L9NA 5IYDJ 1IAWA 4M3GA 4EJVA 5FLMJ 4XLAA 2L9SA 5FKMA 2DPUA 2KISA 3WTSC 4XORA 4HNUA 4QLCU 5HVQC 2R7SA 2ZC2A 1MMAA 3LSTA 1LE8A 4A3KJ 2LD5A 3CC2I 3PSIA 3FXKA 1T39A 1SMYF 1E17A 3K6GA 2MG4A 3O3KA 2ZMEB 1KQ8A 1DP7P 4QWQA 1SAXA 2O9LA 1VFCA 1ZELA 2XF5A 3LA3A 2E1MC 3QOPA 3ELKA 2KPMA 1PYVA 1T38A 4E6KG 4F93B 4WXHA 5IP6A 4X0GA 2DT5A 1JKPC 4G6DA 1SFXA 4DZJA 2QWWA 5IOYA 3C2GA 1K4TA 1QPMA 5HS7A 5E17F 1FIAA 5J4VA 4PSXA 2NAZA 4BHBA 3IH4A 5E3OA 3SDBA 1R5HA 4UB8C 5LD2C 1FY7A 2IS2A 3CLOA 4UV8A 3HZJA 4WWCA 3QYBA 4AIKA 4M72A 1GLNA 3CLQA 3CCLI 2VASA 2XRLA 1ZAOA 4A0ZA 1N78A 3HUGA 5LRRA 2FNAA 1QVUA 3HM5A 1E3OC 3S17J 4TV7A 1IO2A 1TWGJ 2E36A 3GFJA 4P9FA 3L2CA 1B59A 3OYJA 2FRHA 4IVNA 4L9NA 3K0LA 2FX0A 2HYJA 2I10A 1ZQ3P 2LTPA 1EV7A 5E3MA 2HYFA 4O6JA 2J5PA 1VQ6I 3TW6A 5J1RA 4PCQA 1MBHA 4BY1J 2BXYA 5HNFA 5HOOA 4HNVA 3KYCB 4ENNA 4DJAA 2KJCA 3K69A 2R7XA 3GFIA 4EM2A 3P9KA 3I3LA 3A0HC 2E60A 4JX6A 2OBPA 3RKQA 3OV8A 5E79C 5ICFA 3HL2A 3J7AO 3S15J 3QAHA 4BL0B 5L3BA 4BY7J 4Q4ZF 4KDPA 2BZTA 3KZYA 3Q0WA 2GAUA 2L7MP 4NC6A 1D8JA 3DXJF 2ZXHA 3K10A 3LA2A 1Q1HA 2CS3A 2QSFX 4IOAF 2KZVA 3O6BB 1PVEA 1A31A 1V5FA 2OCCH 1JT6A 2KL4A 2Z99A 4XKBA 3SEZA 3JRCA 5FKKA 4KA4A 1V4RA 1WQ2A 2NVYJ 2X0LA 2D45A 4LLGF 4HEA2 2O5RA 1TTYA 2OD5A 1XN7A 2JTVA 1OMIA 3HOTA 1R1TA 3BJAA 1BM9A 2LBFB 2DXIA 3IKVA 3WTVC 3HRSA 2HTSA 3CCSI 2W1OA 1UHWA 1YTYA 4C3IJ 5EF6A 3QPLA 2FA5A 2X51A 3KP5A 3Q0VA 1P7IA 2DA2A 4GDFA 4PFPA 4AVPA 1B72A 4F55A 1QA6A 1MKMA 3RPUA 3IAS2 2JZYA 1OISA 2ACJA 2LY2A 4LIVA 3SDGA 3E5QA 2FBIA 1A6QA 3TBIA 2CQKA 2M7AA 3BR6A 1MDMB 2IRFG 2KJBA 2RQQA 3GTMJ 3CMAI 4A3CJ 2D1HA 2ID6A 5HDGA 4LGWA 2KQRA 5DUIA 2ESHA 3ZRGA 5J4YA 1U9OA 3REOA 5K1YA 2QEXI 4IRIA 2XF6A 1PUFA 4ON0A 5C4JJ 4ZYHA 1VQPI 1O3RA 4RMNA 4XL9A 1P7JA 1RETA 3ZN0A 2LNBA 3KPHA 4JX5A 4B4CA 2XAFA 4LG3A 4A3LJ 4IZZA 1SVOA 2MLKA 4N4OB 1TT5B 4HDVA 3HOVJ 1G3YA 3OS0A 4M73A 3U1DA 3ZQQA 4C2MJ 5DCMA 2PLYA 3CMYA 2JA6J 4HW0A 4R8HA 1XSXA 1Z6RA 2M0CA 3ZPLA 2FE3A 2KIQA 4UY8I 1K4SA 2VKEA 1YFHA 4ZZDA 3A2KA 4HYEA 3DFGA 5D5XB 3COAC 2EQRA 1O57A 3WE3A 2BE5F 5H6RA 5CKTA 4ASNA 3AG2H 3GVAA 2VJ5A 3OL3A 4P55A 4CICA 2MABA 1QBJA 1YG2A 2LG4A 1RUNA 1PDNC 4UVAA 2O8KA 2EV0A 2DT6A 3I4NJ 2BEOA 2XB5A 4BU2A 5LEJA 3IV5A 1OCZH 1OCCH 1YOVB 1OJLA 1F1ZA 2JN6A 1BW6A 4XRSG 2XSDC 3MKZA 1KU9A 3IH3A 3WGHA 3CCVI 2Z5UA 1X3ZB 1AU7A 2CMPA 4OIPF 4EVIA 2P7VB 1I1GA 1O7FA 1PP8F 4UUSB 2QGUA 5L3GA 3E5UA 4UHTA 4BDZA 4KUMA 2LYCA 1YJWI 1XX5A 1TWCJ 2X6WA 4BXXJ 5DV5A 1QO0D 1S6LA 2DA4A 2EWNA 3OL4A 4UUVA 1U6GA 3BP8A 4G6QA 2ZJPF 2M8GX 3G2BA 1LPQA 1RESA 1R6RA 1Z6TA 2ID3A 1FEXA 3DBLB 3NARA 5B1BH 2RVCA 2XB0X 1I39A 4A3IJ 1F43A 1F9NA 4RB3C 2HZDA 3SZTA 2O61A 2R5ZA 1XG1A 4A3EJ 4U0YA 4EEFG 4YIRX 2Y69H 1JE8A 1P92A 1YW8A 1LQ1A 3CF5F 2DA3A 4U0VA 1R22A 5M3FJ 3WHBA 2ZJQF 1Z77A 1X58A 2EILH 2CUEA 4PJLA 3FK7A 3CUQB 2OZ6A 4A3JJ 5D8LB 1JTXA 1YIOA 3DWLE 4LB5A 3RYRA 4MEXF 4F3QA 2HVRA 1S9HA 1ZARA 1WI3A 1KZHA 4ESBA 2JSPA 1YRNB 9ANTA 5JVTA 4S04A 2BGCA 2WAQA 2FQ3A 3OY9A 2H6CA 5FFXA 2YUSA 2DOEA 2M0MA 3VB2A 3NEUA 4ZTFA 3LSKA 2XASA 3H1CA 3AG3H 1KYWA 3FMSA 4JBAA 3FHNA 2BYVE 1WFXA 1HKSA 4UVCA 4RDUA 3LSJA 5E3LA 2LSOA 1R9TJ 2D1VA 4PJMA 1YJ9I 2FJ1A 2ZSIB 4CZCA 1Z3XA 4KT5C 3J80K 5F04A 2Y0MA 3OS2A 1FYKA 1W5SA 1JJ8C 3F72A 4NQWB 4L18B 4RB0A 3TOAA 3LSRA 4XRFA 4EGZA 2BVLA 3DKXA 4QSHA 2CFOA 3GTQJ 2GQQA 3S1RJ 2DFEA 1R4NB 5H20A 4IJAA 3CUQC 4J01A 2NOGA 1C0WA 2X1DA 4BJTA 5E18F 3OMYA 1IN6A 3ABLH 3PNTA 3WE2A 2KIMA 1K61A 2PJRB 2R7FA 4BJ6C 2JK3A 3JTGA 3ASNH 1FIPA 4OINF 4ZC3A 1U0JA 4QPQA 4DQ2A 4D1QA 4E7JA 5J1YA 4KT6A 5K5OA 4XICA 3I9V2 2QKMB 1LFBA 5E8IA 4MHGA 5AONA 2QQ9A 3N05A 3V42A 1NK2P 4M6YA 3MZ8A 4I6ZA 3ZOBA 2ELKA 3Q3SA 2VC1A 4PFOA 2XUBA 2XRNA 1B4AA 1EH7A 4CCMA 1ETKA 2ZB9A 4IKFA 2DA1A 3DPUA 2ZNZA 1NH3A 3DPLC 1L0OC 4RGSA 4LLLA 3G1OA 1KU3A 4E7SA 3I54A 3DQVC 2HPMA 2EFQA 1FP2A 2HEOA 2OPTA 1J09A 3KP7A 3G71I 2O0YA 2XAHA 4ANJA 2V1XA 1T08B 1D8KA 3F6OA 4BXFA 1K6YA 2GZWA 1REPC 4IHSA 2DA7A 3DTIA 1FOYA 3G6EI 3JRFA 2CSOA 4G12A 3E3VA 2V9KA 3EUKL 2R5YA 4KIFA 4XOTA 3OYMA 1K6OA 1YYVA 1H0MA 4G7HF 5BPIA 4BH9A 1IN4A 1ZG5A 1O7LA 2OUMA 2JVGA 3LSPA 5IOZA 3LFKA 2RC4A 1NHAA 4IHTA 1TC3C 2DN0A 2JSCA 2W48A 2LR8A 5GAHJ 4HX8A 3VFZA 2KRHA 5F0CA 1A04A 1TP4A 1X3WB 3DLLF 1RRJA 2DJIA 2E2IJ 1EH8A 2IS4A 3L09A 2HXOA 3OIOA 3KP6A 1FWZA 5A2QZ 1K83J 1SFKA 4I02A 2PQ8A 2KDZA 4BEHA 4BGDA 5E1ZB 3OR2C 2QKLB 2OV7A 3GMEA 5ILSA 4B3XA 5FLVA 3K4KA 2CV2A 2QBYA 3BG9A 5KNLA 1J9IA 3GYHX 1X4PA 3CCUI 2WB1N 4C30A 4AC0A 3B6CA 4E4HA 3FIWA 1S5LC 2K40A 1CF7A 1XTAA 1QU3A 1YRNA 2ZCWA 1WHUA 3IHUA 5ED4A 3HSEA 3KYDB 4RGXA 3CCMI 1CF7B 4P9UA 4UVBA 2WTEA 2W7NA 3W2AA 2VODA 3TP3A 1IRXA 1IRZA 2GBYA 1OYWA 2QQ8A 1SVMA 2ZXJA 4G9YA 2DK5A 3MKYB 4YIFA 1B72B 1XGOA 3A01B 2BV6A 2LK2A 1ZR4A 1J59A 4I7HA 3HYIA 4BBSJ 1MMSA 1H9TA 2VLAA 2L7ZA 3WGIA 2E7WA 3BR3A 3R4KA 5FKNA 5BNGA 1LDKB 2VE8A 2ZJRF 2W57A 1S29A 3WU0A 3H3UA 1T98A 2WV1A 2K9MA 2HVQA 3VOEA 4Q5SF 1H8AC 1HQCA 2GOXB 1N77A 3BCBA 3DEUA 3BY6A 4D5FA 3IH2A 2Q1ZB 1KGSA 5M5WJ 3ULQB 1I27A 3CTAA 1BI0A 3ZQGA 1LB2A 3QWLA 4R1HA 3HTUA 1WJDA 1HW5A 1YX3A 1LVKA 3H0DA 1D1BA 2KKOA 1IRGA 4CYDA 1WJAA 4U88A 2KT0A 1BR4A 3K4CA 4A6EA 4AIJA 1S7EA 1LKXA 2FUG2 2XPVA 3H9QA 3M3YJ 2VI6A 1WI9A 1ZR2A 3LNQA 2X6OA 1SVLA 1QRYA 2K4JA 2E1MB 2CQ7A 1G3TA 2VB6A 3OYFA 4PDKA 3HOUJ 1SD7A 3A01A 2R93J 1B1BA 5HODA 3F8FA 3L00A 3LFUA 4FX0A 2LKPA 3EUAA 4O5VA 4BQOA 2UZKA 1R71A 3FZVA 3FM3A 2ECCA 3S16J 2CJJA 3ML6A 2P8TA 4ENJA 1Z3YA 3I4MJ 5B3SH 2RDPA 3E6CC 3BQYA 2XAQA 3ABKH 3OYHA 3TO7A 2KLOA 3L7WA 1V54H 3KLOA 1NG6A 1PJRA 2L01A 3RIRA 5F08A 1BC7C 4EJWA 3AG1H 5GTIC 2FOKA 3SQNA 1FOWA 1T95A 3IUOA 4BQQA 3ASOH 3PO3J 2J5OA 2M7BA 3F23A 2EZHA 1FX7A 2AQFA 1RC9A 3HJEA 1Z9CA 2P5KA 4I76A 2LBFA 5B1AH 4P96A 1TNTA 2YS9A 2HQ5A 4HDUA 3I59B 2QM3A 1W5TA 3HSFA 2GXAA 3PUFA 2DOAA 1VQ7I 3NWSA 1AKHA 3FF5A 5E20A 3CCYA 2NRAC 3CQZJ 3ZGKA 4Y15A 4OAZA 5J1UA 5KHDA 4V2FA 2YSRA 2R7VA 1QHHD 2KIUA 1PUEE 2V6EA 3MEXA 2BY1A 1I50J 3BOQA 2LF7A 2IGKA 3P7NA 1WH5A 1Z21A 2OZUA 1D1CA 5EDNA 1BBYA 2MC4A 2EH3A 2FU4A 2NVXJ 2Y48A 3HPHA 2WADA 1B6AA 4KIBA 1T0FA 5HDNA 2B7EA 2EPFA 2CV1A 2RV8A 1GHCA 4A69C 3S1QJ 3ZMZA 1YE9A 1AHDP 3QRFF 4BYYA 4EV0A 2UXNA 2DDBA 3K4NA 4OOIA 2BBYA 3B6AA 4C9YA 2R5YB 3BC8A 5GPCA 2A07F 2LDUA 1XMXA 2TDXA 3IAM2 3W2WA 5M3MJ 2XROA 2JA8J 3D5RC 2UWMA 1KQ9A 3A0BC 4B1RA 1WPKA 5EYRA 4V2GA 4IHXA 2BHYA 1Z67A 2YU9J 3F8NA 2CUFA 2QSGX 4CCJA 4FCYA 2K9SA 1L3LA 1WJBA 1PP7U 4M71A 3QODA 4KMUX 4M6VA 3HOSA 4XN3A 5L3FA 5LHIA 5FD6A 3S3OA 1CGPA 4HAMA 3RJPA 2DI3A 2KMUA 2KZGA 3JRIA 4V19K 2H6BA 1YHQI 1N25A 4G94A 2GM4A 1FNNA 1TNSA 4ESJA 1HCRA 2EZKA 1APLC 2VBWA 1LDDA 2F6CA 2XPUA 3KP4A 4OMZA 4IHYA 2G7HA 2VPLA 1JKRC 3PNVA 2ZMEC 3Q0UA 5A2QK 2HFHA 2DU9A 1T33A 4NNJA 5KK1A 3MD2A 1ETXA 1Y8RB 1V5GA 5FD5A 4BACA 1A35A 3W6KB 1MBGA 3LSIA 3BG6A 4DBRA 1VI0A 2LMDA 2XAUA 3U21A 2VQLA 3DBRB 3LAJA 4XKVA 4W1UA 4LK1F 3K2AA 1WKMA 2EFPA 4C3JJ 4AD9A 1TLHB 2QQBA 2IAIA 2VE9A 3D0SA 1Y1VJ 2DMUA 1DGWY 4PK4A 1ETOA 3NRVA 2CRGA 5JFRA 1IF1A 2L0KA 2HVSA 4L0ZB 5JHFA 2CUJA 3BZCA 3RPUD 5ICGA 3E6BA 1ULYA 3HG9A 5FROA 2Y0SN 4HLXA 3C2BA 5IP7J 1FSEA 2IP2A 3V7RA 2TRTA 1MD0A 3JSOA 1JUPA 1MNMC 2QVOA 2EV6A 4NBQA 3HDDA 1VTNC 3ABTA 1FPQA 3AL0C 1ON2A 3JRBA 1HOMA 1KQ0A 1D5YA 2M2EA 2COMA 2HGCA 5FJ8J 1EF4A 2ISYA 3JRGA 1BC8C 4XLEA 3ABMH 2EFNA 2GA2A 5JLXA 2QSHX 2L54A 4FE7A 3A03A 4A2UA 1Z1DA 3E7LA 3HOXJ 1Z05A 1RPWA 3J7AY 2XGCA 1PUFB 1V55H 2QENA 5GTHC 4A3BJ 1WJ5A 3FBIB 2FBKA 1LVAA 3HOYJ 3H5NA 2F48A 3HBLA 4LJZF 4RAFA 2VJJA 3KEYA 1RR7A 1ZKGA 3S14J 3ZMDA 4BE0A 1R7JA 5D5VB 3GEZA 3V8KA 3ZMVA 1ZHFA 2DT7B 2BXZA 2EA2A 2I5UA 1SAUA 1XD7A 3VDXA 4F7ZA 2X6XA 3Q9VA 3OYDA 1J2XA 1MH4A 1K79A 4E7LA 4AYBA 5DM6F 1P6RA 3L2RA 4WX9A 4ENMA 3ERED 4HBLA 2M1BA 2Z2SB 3MZHA 1P9QC 2CW7A 5CQEA 4OWRB 4I01A 1P4AA 2E1CA 5AIPA 2X1CA 3R60A 2E1OA 2CUZA 1XDSA 3T8RA 5IT3A 3PQJA 1Q1VA 1USTA 4CGZA 3H0GJ 3HKZN 5B66C 2LY1A 3KEQA 4UUTA 5IPAA 1AOYA 3MFKA 3PIPF 1DPRA 2XIGA 2PMZN 2UUZA 2WC2A 3CMEI 4MO7A 4ZYGA 3VEPA 3KEOA 4E7IA 1D1AA 4X1EA 4C3HJ 3V7CA 4LK0F 3C1DA 4NHJA 1X1CA 1O3SA 3CUOA 1ZRCA 3LQQA 2F5CA 4DNCA 5AIQA 3LSGA 1MSEC 4L5EA 3ZQFA 1J5YA 4G6TB 1VQ8I 2CQXA 1JHHA 2R7QA 4AUXA 1ON1A 3EDPA 3M1EA 5HLTA 4BBRJ 2ISZA 3UNGC 5K5RA 4CCLA 1SFUA 1EA3A 2ME6A 4B48A 3OYGA 2O3FA 1B9NA 1ZGWA 1SD5A 1S72I 5IT9K 2DTRA 2A6EF 2FF4A 2EV5A 4PJJA 1ZLJA 5M5YJ 4ENKA 4HPQA 5L3EA 2W4SA 1X1BA 2VJ4A 4MTEA 2PBIA 5D4RA 4B3AA 3E97A 1W7PB 3P9IA 3P9CA 3V8LA 4A12A 3W6JB 2HQRA 1J75A 3HEFA 2W84A 3A02A 3HKZA 2M3AA 1R5ID 3AG4H 2N8GA 2VQGA 2G7UA 4LOCA 3NQOA 2PMUA 1IJWC 5C44J 1MMDA 4HSRA 4XLNF 4S0HB 1JJ6C 1MMNA 1WGXA 2Z33A 1X1DA 1IUYA 1I3AA 3DPTA 4OIQF 1V5EA 2PG4A 1S8NA 1QGPA 4MEYF 3U2RA 5IY5H 5D5UB 1X19A 2FBHA 3S3MA 3DU6A 1S3JA 3F3XA 3I56I 2Y75A 1WWXA 5H6QA 2IGNA 1I3QJ 1BW5A 1W7PA 4ZTJA 2YU3A 2GA1A 1AKHB 3MCZA 2AXTC 2CU7A 2QQAA 3N4MA 2VONA 1FMVA 3OYCA 3HRMA 4IOCF 2BW3B 2G0EA 3SFIA 2VKHA 4I0BA 1TT0A 2NVQJ 2R7RA 2O03A 1MJAA 4IF4A 2CV0A 3J80Z 2H8RA 1WSUA 4HNTA 1R58A 1WJCA 4CXFA 2HI3A 5HNHA 4BXUA 1IRFA 2WB1A 2A6HF 2MW8A 2IA2A 3ZMSA 3H5RA 4IO9F 2DQLA 2DYSH 5TJJA 5EEHA 3AFHA 1H9GA 2VBZA 4PGHA 2L4AA 4IRHA 3FXUA 3HOWJ 4F92B 1RZ4A 5DD4A 5ILUA 4FT8A 2FXAA 1IDZA 1GVJA 1I5ZA 1GXQA 4DZPA 3LSHA 2IS1A 4BE2A 2NXNB 4HOBA 2VXZA 1GDTA 3ONQA 3CC4I 3GTKJ 4A0YA 2XAGA 2VKDA 4NB5A 2K85A 4PJ0C 5H2FC 3T5XA 4BHCA 2PI0A 4ETSA 5IYCJ 4HX4A 3QPTA 3VYTB 4BNCA 3DTKA 1U2WA 3GLXA 2ZXIA 2Y2ZA 3HXLA 2LOOA 4AIHA 1I1SA 1R1VA 4J00A 2F5DA 1HDPA 4XONA 3BR5A 2PMHA 3BWGA 4WF2A 4XQFA 4E7HA 2R0QC 1EKEA 4MNUA 2HNHA 4CA0A 2ZNYA 2X48A 3GFLA 3VWBA 2QA4I 2HQAA 1U5TB 3WODF 2JMWA 2Z3YA 4ZDPA 2DA5A 4M9XA 3QP5A 4BUPA 4IQ4A 4PJNA 2RKHA 4XKWA 2Q2EB 4CYCB 2O6GE 3F22A 2IT0A 1SMTA 3KZIC 4XSXF 1VQMI 2QYOA 4MLOA 2ETHA 4GCVA 2M4GA 1TW3A 3BTJA 4LB6B 3S1MJ 4LD5A 2EIKH 5HS8A 4MFEA 4RLFA 1MNEA 2EIJH 4CCNA 2IJLA 1BL0A 2HR3A 3CUQA 1MJ9A 5DUKA 1BI3A 1B8IB 5EGOA 5D5WB 2QCOA 3HC7A 5D6EA 4Z2YA 3I71A 3ISPA 3EYYA 2CW0F 3OIPA 1FMWA 3I59A 3GF2A 3ZR8X 1YIJI 3WGGA 3M1CA 4Y3OA 4KISA 4ZDOA 5LBQA 4A0XA 1FTZA 2HDCA 2Q0OA 2F4MB 3T1BA 4HG2A 3PUBA 5BS6A 1LE8B 2V1UA 3E6MA 2E71A 3FXOA 3JSPA 2IPQX 3JCUC 1IXRC 3KX2A 2E34A 4R79A 2LLKA 1WH7A 3M7GA 4BHPA 1K78A 3HGYA 2DFHA 4YFXF 3CDHA 4ZZLA 4KN4X 1JT0A 1BA5A 2QBYB 4NUBA 2IVMA 3DEWA 3HOZJ 3K4BA 4B8XA 2DTZA 1OYYA 3W2VA 3S2WA 4HLYA 1X2MA 4ZDLA 2VT2A 2WA0A 2GIZA 2JPBA 2FD5A 3E1SA 2LFBA 2XV4S 3KLNA 3OYIA 5DYMA 3KIOA 4NC7A 4F52A 5FB2A 2A05A 3WTZA 3OYKA 4XN0A 3OSFA 3TGNA 5LGNA 1MMGA 2X4HA 4OIOF 2R7WA 2EJRA 4RAZA 1ZTRA 3S93A 3T8TA 3HIFA 4AM3A 2VQHA 1JGSA 4RBOA 4A3MJ 1FBUA 2XHKA 1BIAA 3ZMUA 1IGNA 1ETQA 1RKTA 4ZH4F 3F8BA 5L3DA 4KMFA 2X9DA 3DEEA 1HA8A 5D8KB 2JUGA 1BOAA 1LDJA 2VOPA 2I8DA 4PSWA 2NNYA 4CZZA 3PSFA 4YFKF 2H27A 2CFXA 5LHHA 3D5LA 3IWZA 4S05A 2FEZA 1XC5A 3U1KA 3HGGA 3KP2A 4GO1A 3EETA 2VL8A 4ZYAA 1VNDA 2DODA 2E7XA 2O8XA 4LLNA 2FMLA 2RQPA 3H3VK 2OTJI 3K4MA 4U0WA 4AU7A 4RGRA 2KRFA 1DQUA 2Y31A 1VQ4I 4RAGA 3HUGB 1X1PA 3FXLA 3GBGA 3UKGA 1JHFA 2A6TA 1Y8QB 5J6XA 6PAXA 5JHUA 1KA8A 3PQKA 3S2DJ 4I2OA 4EM1A
chains in the Genus database with same CATH topology
1YW7A 3WTTC 3OOPA 1JXSA 4EM0B 4GYGA 3M8FA 1TQPA 1ODDA 3G73A 3FX3A 2Z9OA 2CWEA 2XGXA 1ZGJA 3BZ6A 1FP1D 3R0JA 1R00A 1MZBA 3R6SA 2JT1A 3ECHA 5BOXA 4G8XA 1SFEA 5HDKA 1SD6A 3E5XA 2P4WA 5CLSA 3ROUA 1ZRFA 1E2XA 1ONVA 5LRSA 2RNJA 4IXAA 3GWZA 5CVRA 1YS6A 2HWVA 1I6XA 2DQRA 1Y0UA 3HRUA 4KYWA 5F64A 2AS5F 3TDZC 1ZREA 1XB4A 1ZH5A 3GX4X 2ZO4A 4N9IA 1YLFA 4I0AA 2OAZA 1P4WA 4HQMA 5ICCA 2B0LA 1XGMA 3VODA 1W7PD 2VT3A 3HTSB 1DPUA 2HQNA 1MGTA 4L5JA 3C3WA 3HSRA 1TBXA 5IT9Z 1V3FA 4OIRF 3HRTA 5DCFA 3B73A 5L3CA 1K78B 1P2FA 4LMYA 2DK8A 2NYXA 2YX7A 3M8EA 4GGGA 4A5NA 1XCBA 4EQQA 3WTYC 1W4MA 2A68F 3FMQA 1HKQA 4I09A 2UXXA 1FSHA 4KIGA 1XGNA 4L9JA 2ZMEA 1UFMA 1LNWA 3CO6C 3MQ0A 3QPHA 2K27A 2ZBKA 4RAYA 3I53A 2EK5A 3WTUC 3RYPA 1U78A 2V6CA 2DPDA 2FNPA 1ZG1A 2Q2EA 4RS8A 2PFBA 1BI2A 3QU3A 1RUOA 3ZN1A 4EGYA 1OYIA 4IPAA 4EMSA 1QNTA 3RI4A 1UCRA 5DDGA 1RI7A 3K2ZA 4P5OA 5F6FA 5LGUA 1STZA 2ESNA 4HV6A 3TO9A 5FLXZ 4JK1X 4I98B 2Q8KA 2MH9A 4GYIA 2MD5A 3T0YA 4U7BA 3KCCA 4Y17A 3IWFA 1AWCA 4K2EA 2MLGA 3O2PE 3G3ZA 5DEQA 2MC3A 3SFZA 3K1MA 2H09A 3FHZA 2PJPA 2DLLA 5BMZA 3E6DA 3SXYA 3I4PA 2YX4A 1LEAA 1D5VA 2K7LA 3KZZA 5F1RA 1Z7UA 5LLQA 2HYGD 2R7DA 1U5TC 4GXOA 1G6NA 4MTDA 5KVRA 2DAOA 2F2EA 3ZP5A 3FMRA 4HQEA 5HLHA 1X3UA 4CO8A 3H3ZA 1XMKA 3BJOA 1TQMA 2L02A 5BQTA 1HSTA 1HW1A 3HHHA 3I0TA 1KU7A 2WV0A 4EJTA 2W25A 3IL2A 4HX7A 4ZYEA 2OQRA 3HHGA 2STTA 1WRJA 4MGRA 4BAYA 1ZLKA 4M74A 4BQAA 1FT9A 4JQFA 2YPRA 4PGGA 1ZG3A 3KE2A 4AWXB 3F8CA 2GXBA 4LFUA 3GO5A 2K4BA 3WTXC 2FSWA 5HS9A 3J81K 2MH2A 4XLPF 1O3QA 2CYYA 2RGVA 4UXNA 3I58A 3IC7A 2K02A 4N9HA 2CG4A 1GXPA 1FZPB 3M9AA 5DD8A 2EA4A 5JR3A 1MJBA 5CVJA 2FMYA 2ADUA 2A61A 4WK8F 2NS0A 3V7SA 3GW2A 5TRDA 1KU2A 4YFNF 5DCMB 3IRQA 3WTWC 2HKXA 1HSJA 5FLXK 2ZFWA 4KICA 3JTHA 3C7JA 3KP3A 2MBFA 3R61A 1IXSB 4ZYDA 2M87A 4U7DA 4HZFA 3FXRA 2L4MA 4D0PA 4YG2F 5LHGA 1YS7A 2F5EA 3JAMK 3RKYA 3TKYA 2RN7A 4G7OF 4XBFA 2PN6A 3RTRA 2HTJA 2EFWA 4N0BA 4KNYA 2DBBA 2IA1A 4UV9A 1EH6A 2P7CB 4MQ9F 2VN2A 4EJUA 3K1NA 3PFIA 2PEXA 3KETA 1FLIA 4EJOA 1MDMA 1G3WA 1BJAA 2QUFA 3TDUC 1P4XA 1O3TA 3ABUA 2NNNA 3WU1B 4WXCA 1BI1A 2G9WA 1BN5A 1FYMA 2AXLA 3MWMA 3U9GA 4WXDA 5FO5A 2C6YA 4RB1A 1U8RA 2A5YB 2HS5A 5ERIA 5J8CA 2STWA 4H0EA 4HV5A 5FFZA 1YQAA 1ZRDA 3FM5A 3J81Z 3ZQ7A 4ESFA 3ECOA 5K5QA 2F5FA 2P5VA 3C18A 1RNLA 3AAFA 3EYIA 3QP6A 4RB2C 1IXCA 1HKTA 4O3MA 4HF1A 2A3SA 2IA0A 1ZN2A 2M8EA 1B9MA 3GUDA 1USSA 5FGMA 2XKOA 4CHUA 2OQGA 4Q48A 3QU6A 3I64A 1HBXG 2VOOA 2OA4A 5CJ9A 2K86A 3DKWA 1S7AA 1QZZA 3R0AA 5D6FA 3B02A 4HA8A 4Q47A 1TW2A 4NQWA 1UB9A 2M5WA 3LA7A 4M9ZA 3LWFA 2VBXA 2KIFA 2P6TA 2H94A 1IN7A 2XAJA 3K1PA 3RDIA 2VC0A 3RKXA 2CO5A 2ZJ2A 2QLZA 3IRRA 1LEBA 1FC3A 3Q5FA 2D2WA 3BROA 1F4KA 3LQRA 4OU0A 1U3EM 5LGTA 4HF0A 2M45A 4UNOA 3IKTA 2GIVA 1YO5C 5BPDA 1K7AA 1U5TA 2V9VA 3EQLF 2V1DA 2L3DA 1XMAA 2JPCA 5D4SA 2DO7A 2EFOA 2M30A 1KYZA 3F6VA 5HLIA 2QZ8A 3K9TA 3V8JA 3SZPA 2CGPA 4IRGA 5J8FA 2YR2A 2EB7A 2ELHA 3KFWX 4L5IA 4PZJA 3TOBA 4E70A 3Q9SA 3DP7A 5E8GA 3RKWA 4M9SA 4A5MA 3GFMA 3LAPA 4B09A 1QZYA 3BJ6A 5CVUA 2VBYA 4HF2A 2IW5A 4WCGA 3V4GA 3MZYA 2HKOA 2XVCA 2GXGA 1J7KA 3I5UA 3L9FA 1FBSA 2ZKZA 4L0YB 4KN7X 1FOKA 3CO7C 1FBQA 5JI6A 2MA3A 1OPCA 3FWEA 1OR7A 2DFIA 4M6XA 2W24A 1HXDA 1XCVA 4MQVA 4FHTA 2LF8A 1R36A 3JW4A 1IN8A 4G7ZF 1XSVA 1YW9A 2P5LC 5ICEA 1D3YA 1QQIA 1XGSA 1IW7F 5CVIA 1R1UA 5HLGA 2W85A 1LJ9A 3TO6A 1FYLA 3MAJA 2HZTA 3TQNA 5E1WA 5LEKA 1Z91A 4FX4A 1T2KA 3F21A 2XKPA 3EUHA 3DF8A 4CDGA 1BIBA 1R23A 3WG9A 1IN5A 1XDUA 2OU2A 3BPVA 1RIOH 4KFCA 3BDDA 3ZMTA 1S7OA 1F5TA 2GWRA 3RPQA 3GXOA 1HW2A 3CJNA 3GZ5A 1TQIA 4OMYA 3FXQA 1DUXC 1XSDA 1OKRA 4YIIA 3SHFA 2A69F 2HOEA 4LG0A 2DW4A 1T6SA 1ZGAA 1R5GA 4XSZF 1IZ1A 3GZ6A 3N97A 3DV8A 3F8MA 5ILVA 2JRTA 1DDNA 4Y13A 4RGUA 1ZYRF 1J0RA 1SD4A 2E1NA 5CVVA 2WWYA 5E1XA 4LG0B 1G3SA 3BPXA 2V79A 2P6SA 4L9VA 1G4DA 5EEGA 4A6DA 3JAMZ 2R3SA 5CYVA 1UHMA 3H92A 4L9TA 1IAWA 4EJVA 2DPUA 3WTSC 4QLCU 5HVQC 3LSTA 1T39A 1SMYF 1E17A 3O3KA 2ZMEB 1KQ8A 1DP7P 4QWQA 1SAXA 3LA3A 3QOPA 3ELKA 1T38A 4WXHA 2DT5A 4G6DA 1SFXA 2QWWA 1QPMA 5HS7A 5E17F 2NAZA 4BHBA 1R5HA 1FY7A 3CLOA 4UV8A 4WWCA 4AIKA 4M72A 1ZAOA 4A0ZA 3HUGA 5LRRA 2FNAA 4TV7A 3GFJA 4P9FA 3L2CA 1B59A 2FRHA 4IVNA 4L9NA 3K0LA 1EV7A 2HYFA 4O6JA 2J5PA 4PCQA 5HOOA 4ENNA 2KJCA 3K69A 3GFIA 4EM2A 3P9KA 2OBPA 3OV8A 5ICFA 3J7AO 3QAHA 5L3BA 4Q4ZF 4KDPA 3KZYA 2GAUA 1D8JA 3DXJF 3LA2A 1Q1HA 3O6BB 2Z99A 4KA4A 1V4RA 1WQ2A 2X0LA 2D45A 4LLGF 1TTYA 2OD5A 1XN7A 2JTVA 1OMIA 3HOTA 1R1TA 3BJAA 1BM9A 3IKVA 3WTVC 3HRSA 2HTSA 1UHWA 1YTYA 2FA5A 3KP5A 4AVPA 1MKMA 3RPUA 2JZYA 2ACJA 3E5QA 2FBIA 2CQKA 1MDMB 2IRFG 2KJBA 2D1HA 5HDGA 4LGWA 5DUIA 2ESHA 3REOA 5K1YA 4IRIA 4ON0A 4ZYHA 1O3RA 3ZN0A 2LNBA 2XAFA 2MLKA 4HDVA 1G3YA 4M73A 3U1DA 2PLYA 5DCMA 4HW0A 4R8HA 1XSXA 1Z6RA 3ZPLA 2FE3A 1YFHA 4ZZDA 4HYEA 3DFGA 5D5XB 3COAC 1O57A 3WE3A 2BE5F 5H6RA 4ASNA 3GVAA 4P55A 4CICA 1QBJA 1YG2A 1RUNA 1PDNC 4UVAA 2EV0A 2BEOA 5LEJA 1F1ZA 1KU9A 3WGHA 2Z5UA 4OIPF 4EVIA 2P7VB 1I1GA 1O7FA 1PP8F 5L3GA 3E5UA 4UHTA 4KUMA 5DV5A 1QO0D 1S6LA 2EWNA 4UUVA 1U6GA 3BP8A 4G6QA 1Z6TA 2RVCA 1F9NA 4RB3C 3SZTA 2O61A 4U0YA 1JE8A 1P92A 1YW8A 1LQ1A 4U0VA 1R22A 3CUQB 2OZ6A 5D8LB 1YIOA 4LB5A 3RYRA 4MEXF 1ZARA 4ESBA 5JVTA 4S04A 2BGCA 2FQ3A 2H6CA 5FFXA 3VB2A 3NEUA 2XASA 1KYWA 3FMSA 4JBAA 2BYVE 1HKSA 4UVCA 2LSOA 2D1VA 4KT5C 3J80K 2Y0MA 1FYKA 1W5SA 3F72A 4L18B 4RB0A 3TOAA 4EGZA 4XRFA 2GQQA 5H20A 4IJAA 3CUQC 1C0WA 5E18F 1IN6A 3WE2A 2KIMA 2R7FA 3JTGA 4OINF 4DQ2A 5K5OA 5E8IA 4MHGA 5AONA 2QQ9A 4M6YA 2VC1A 1B4AA 2XRNA 2XUBA 1EH7A 2ZNZA 3DPLC 1L0OC 4RGSA 4LLLA 1KU3A 3I54A 3DQVC 2EFQA 1FP2A 2HEOA 3KP7A 2O0YA 2XAHA 2V1XA 1D8KA 3F6OA 2GZWA 1REPC 4IHSA 2CSOA 3E3VA 4KIFA 1K6OA 1YYVA 1H0MA 4G7HF 5BPIA 4BH9A 1IN4A 1ZG5A 1O7LA 3LFKA 2RC4A 1NHAA 4IHTA 2JSCA 4HX8A 3VFZA 1A04A 1EH8A 3L09A 3KP6A 1FWZA 5A2QZ 4I02A 2PQ8A 5E1ZB 5ILSA 2QBYA 1J9IA 3GYHX 1CF7A 2ZCWA 3IHUA 5ED4A 3HSEA 4RGXA 1CF7B 4P9UA 4UVBA 2WTEA 2VODA 1OYWA 2ZXJA 4G9YA 2DK5A 4YIFA 1XGOA 2BV6A 1J59A 4I7HA 3HYIA 1H9TA 3WGIA 2E7WA 3R4KA 1LDKB 2VE8A 2W57A 1S29A 3WU0A 3H3UA 1T98A 3VOEA 4Q5SF 1HQCA 3DEUA 3BY6A 1KGSA 3ULQB 1I27A 3CTAA 1BI0A 1LB2A 4R1HA 3HTUA 1HW5A 2KKOA 1IRGA 4CYDA 4U88A 4A6EA 4AIJA 1WI9A 2K4JA 1G3TA 4PDKA 1SD7A 1B1BA 3F8FA 3L00A 4FX0A 2UZKA 2LKPA 4O5VA 3FZVA 3FM3A 3ML6A 2P8TA 4ENJA 2RDPA 3E6CC 2XAQA 3TO7A 3L7WA 3KLOA 2L01A 3RIRA 1BC7C 4EJWA 2FOKA 3SQNA 2J5OA 3F23A 1FX7A 1Z9CA 2P5KA 4P96A 1TNTA 4HDUA 3I59B 2QM3A 1W5TA 3HSFA 3FF5A 5E20A 2NRAC 4Y15A 2YSRA 2KIUA 1PUEE 3MEXA 2LF7A 3BOQA 3P7NA 2OZUA 1BBYA 2FU4A 2Y48A 1B6AA 4KIBA 1T0FA 5HDNA 2RV8A 1GHCA 3ZMZA 3QRFF 4BYYA 4EV0A 2UXNA 4OOIA 2BBYA 2A07F 2LDUA 2TDXA 2XROA 2UWMA 1KQ9A 3F8NA 1L3LA 1PP7U 4M71A 4KMUX 3HOSA 5L3FA 5LHIA 1CGPA 5FD6A 4HAMA 3RJPA 2DI3A 2H6BA 4G94A 1FNNA 1TNSA 4ESJA 2VBWA 1LDDA 3KP4A 4OMZA 2G7HA 5A2QK 2HFHA 2DU9A 5KK1A 5FD5A 3W6KB 3LAJA 4LK1F 1WKMA 2EFPA 4AD9A 1TLHB 2QQBA 2VE9A 3D0SA 5JFRA 3NRVA 1IF1A 4L0ZB 5ICGA 3E6BA 1ULYA 4HLXA 1FSEA 2IP2A 3V7RA 1MD0A 3JSOA 2QVOA 2EV6A 1VTNC 3ABTA 1FPQA 1ON2A 1KQ0A 2COMA 2HGCA 2ISYA 1BC8C 2EFNA 2GA2A 2L54A 4A2UA 1Z1DA 1Z05A 2QENA 2FBKA 1LVAA 4LJZF 3ZMDA 1R7JA 5D5VB 3GEZA 3V8KA 3ZMVA 1ZHFA 2EA2A 1XD7A 4F7ZA 3Q9VA 1J2XA 1K79A 1P6RA 4WX9A 4ENMA 3ERED 4HBLA 2M1BA 3MZHA 4I01A 1P4AA 2E1CA 5AIPA 3R60A 1XDSA 3T8RA 5IT3A 3PQJA 1USTA 4CGZA 3KEQA 1AOYA 3MFKA 1DPRA 2XIGA 2WC2A 4ZYGA 3VEPA 3KEOA 3V7CA 4LK0F 3C1DA 4NHJA 1O3SA 3CUOA 1ZRCA 3LQQA 2F5CA 4DNCA 5AIQA 1J5YA 1JHHA 1ON1A 3EDPA 3M1EA 2ISZA 5K5RA 1SFUA 2O3FA 1B9NA 1SD5A 5IT9K 2DTRA 2A6EF 2FF4A 2EV5A 1ZLJA 4ENKA 5L3EA 4MTEA 5D4RA 2PBIA 3E97A 1W7PB 3P9IA 3P9CA 3V8LA 4A12A 3W6JB 2HQRA 1J75A 2W84A 2G7UA 3NQOA 2PMUA 4XLNF 2Z33A 1IUYA 3DPTA 4OIQF 2PG4A 1S8NA 1QGPA 4MEYF 3U2RA 5D5UB 2FBHA 1S3JA 3F3XA 2Y75A 1WWXA 5H6QA 1W7PA 2YU3A 2GA1A 3MCZA 2QQAA 3N4MA 2VONA 3HRMA 4I0BA 2O03A 1MJAA 4IF4A 3J80Z 1WSUA 1R58A 4CXFA 4BXUA 1IRFA 2A6HF 2IA2A 3ZMSA 2DQLA 5TJJA 5EEHA 1H9GA 2VBZA 4PGHA 2L4AA 4IRHA 3FXUA 1RZ4A 5DD4A 5ILUA 4FT8A 2FXAA 1GVJA 1I5ZA 1GXQA 4HOBA 2VXZA 4A0YA 2XAGA 4NB5A 3T5XA 4BHCA 2PI0A 4ETSA 4HX4A 3QPTA 4BNCA 3GLXA 1U2WA 4AIHA 1I1SA 1R1VA 2F5DA 2PMHA 3BWGA 4WF2A 4MNUA 2ZNYA 3GFLA 1U5TB 3WODF 2Z3YA 4M9XA 3QP5A 2RKHA 2O6GE 3F22A 2IT0A 1SMTA 4XSXF 2QYOA 2ETHA 4GCVA 1TW3A 4LB6B 4LD5A 5HS8A 2IJLA 2HR3A 3CUQA 1MJ9A 5DUKA 1BI3A 5D5WB 5D6EA 4Z2YA 3I71A 3ISPA 3EYYA 2CW0F 3I59A 3GF2A 3WGGA 5LBQA 4A0XA 2HDCA 2Q0OA 2V1UA 3T1BA 5BS6A 3E6MA 3JSPA 2IPQX 1IXRC 4R79A 3M7GA 4BHPA 1K78A 4YFXF 3CDHA 4ZZLA 4KN4X 2QBYB 2IVMA 4B8XA 1OYYA 3S2WA 4HLYA 2VT2A 2JPBA 2XV4S 3KLNA 5DYMA 5FB2A 3WTZA 3TGNA 5LGNA 2X4HA 4OIOF 2EJRA 4RAZA 3T8TA 3HIFA 1JGSA 1FBUA 2XHKA 1BIAA 3ZMUA 4ZH4F 3F8BA 5L3DA 4KMFA 5D8KB 1BOAA 1LDJA 2VOPA 2NNYA 4CZZA 4YFKF 2H27A 2CFXA 5LHHA 3D5LA 3IWZA 4S05A 2FEZA 4GO1A 3KP2A 3EETA 2E7XA 2O8XA 4LLNA 2FMLA 2RQPA 4U0WA 4RGRA 2KRFA 1JHFA 5J6XA 6PAXA 5JHUA 1KA8A 3PQKA 4I2OA 4EM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW7 A;  3WTT C;  3OOP A;  1JXS A;  4EM0 B;  4GYG A;  3M8F A;  1TQP A;  1ODD A;  3G73 A;  3FX3 A;  2Z9O A;  2CWE A;  2XGX A;  1ZGJ A;  3BZ6 A;  1FP1 D;  3R0J A;  1R00 A;  1MZB A;  3R6S A;  2JT1 A;  3ECH A;  5BOX A;  4G8X A;  1SFE A;  5HDK A;  1SD6 A;  3E5X A;  2P4W A;  5CLS A;  3ROU A;  1ZRF A;  1E2X A;  1ONV A;  5LRS A;  2RNJ A;  4IXA A;  3GWZ A;  5CVR A;  1YS6 A;  2HWV A;  1I6X A;  2DQR A;  1Y0U A;  3HRU A;  4KYW A;  5F64 A;  2AS5 F;  3TDZ C;  1ZRE A;  1XB4 A;  1ZH5 A;  3GX4 X;  2ZO4 A;  4N9I A;  1YLF A;  4I0A A;  2OAZ A;  1P4W A;  4HQM A;  5ICC A;  2B0L A;  1XGM A;  3VOD A;  1W7P D;  2VT3 A;  3HTS B;  1DPU A;  2HQN A;  1MGT A;  4L5J A;  3C3W A;  3HSR A;  1TBX A;  5IT9 Z;  1V3F A;  4OIR F;  3HRT A;  5DCF A;  3B73 A;  5L3C A;  1K78 B;  1P2F A;  4LMY A;  2DK8 A;  2NYX A;  2YX7 A;  3M8E A;  4GGG A;  4A5N A;  1XCB A;  4EQQ A;  3WTY C;  1W4M A;  2A68 F;  3FMQ A;  1HKQ A;  4I09 A;  2UXX A;  1FSH A;  4KIG A;  1XGN A;  4L9J A;  2ZME A;  1UFM A;  1LNW A;  3CO6 C;  3MQ0 A;  3QPH A;  2K27 A;  2ZBK A;  4RAY A;  3I53 A;  2EK5 A;  3WTU C;  3RYP A;  1U78 A;  2V6C A;  2DPD A;  2FNP A;  1ZG1 A;  2Q2E A;  4RS8 A;  2PFB A;  1BI2 A;  3QU3 A;  1RUO A;  3ZN1 A;  4EGY A;  1OYI A;  4IPA A;  4EMS A;  1QNT A;  3RI4 A;  1UCR A;  5DDG A;  1RI7 A;  3K2Z A;  4P5O A;  5F6F A;  5LGU A;  1STZ A;  2ESN A;  4HV6 A;  3TO9 A;  5FLX Z;  4JK1 X;  4I98 B;  2Q8K A;  2MH9 A;  4GYI A;  2MD5 A;  3T0Y A;  4U7B A;  3KCC A;  4Y17 A;  3IWF A;  1AWC A;  4K2E A;  2MLG A;  3O2P E;  3G3Z A;  5DEQ A;  2MC3 A;  3SFZ A;  3K1M A;  2H09 A;  3FHZ A;  2PJP A;  2DLL A;  5BMZ A;  3E6D A;  3SXY A;  3I4P A;  2YX4 A;  1LEA A;  1D5V A;  2K7L A;  3KZZ A;  5F1R A;  1Z7U A;  5LLQ A;  2HYG D;  2R7D A;  1U5T C;  4GXO A;  1G6N A;  4MTD A;  5KVR A;  2DAO A;  2F2E A;  3ZP5 A;  3FMR A;  4HQE A;  5HLH A;  1X3U A;  4CO8 A;  3H3Z A;  1XMK A;  3BJO A;  1TQM A;  2L02 A;  5BQT A;  1HST A;  1HW1 A;  3HHH A;  3I0T A;  1KU7 A;  2WV0 A;  4EJT A;  2W25 A;  3IL2 A;  4HX7 A;  4ZYE A;  2OQR A;  3HHG A;  2STT A;  1WRJ A;  4MGR A;  4BAY A;  1ZLK A;  4M74 A;  4BQA A;  1FT9 A;  4JQF A;  2YPR A;  4PGG A;  1ZG3 A;  3KE2 A;  4AWX B;  3F8C A;  2GXB A;  4LFU A;  3GO5 A;  2K4B A;  3WTX C;  2FSW A;  5HS9 A;  3J81 K;  2MH2 A;  4XLP F;  1O3Q A;  2CYY A;  2RGV A;  4UXN A;  3I58 A;  3IC7 A;  2K02 A;  4N9H A;  2CG4 A;  1GXP A;  1FZP B;  3M9A A;  5DD8 A;  2EA4 A;  5JR3 A;  1MJB A;  5CVJ A;  2FMY A;  2ADU A;  2A61 A;  4WK8 F;  2NS0 A;  3V7S A;  3GW2 A;  5TRD A;  1KU2 A;  4YFN F;  5DCM B;  3IRQ A;  3WTW C;  2HKX A;  1HSJ A;  5FLX K;  2ZFW A;  4KIC A;  3JTH A;  3C7J A;  3KP3 A;  2MBF A;  3R61 A;  1IXS B;  4ZYD A;  2M87 A;  4U7D A;  4HZF A;  3FXR A;  2L4M A;  4D0P A;  4YG2 F;  5LHG A;  1YS7 A;  2F5E A;  3JAM K;  3RKY A;  3TKY A;  2RN7 A;  4G7O F;  4XBF A;  2PN6 A;  3RTR A;  2HTJ A;  2EFW A;  4N0B A;  4KNY A;  2DBB A;  2IA1 A;  4UV9 A;  1EH6 A;  2P7C B;  4MQ9 F;  2VN2 A;  4EJU A;  3K1N A;  3PFI A;  2PEX A;  3KET A;  1FLI A;  4EJO A;  1MDM A;  1G3W A;  1BJA A;  2QUF A;  3TDU C;  1P4X A;  1O3T A;  3ABU A;  2NNN A;  3WU1 B;  4WXC A;  1BI1 A;  2G9W A;  1BN5 A;  1FYM A;  2AXL A;  3MWM A;  3U9G A;  4WXD A;  5FO5 A;  2C6Y A;  4RB1 A;  1U8R A;  2A5Y B;  2HS5 A;  5ERI A;  5J8C A;  2STW A;  4H0E A;  4HV5 A;  5FFZ A;  1YQA A;  1ZRD A;  3FM5 A;  3J81 Z;  3ZQ7 A;  4ESF A;  3ECO A;  5K5Q A;  2F5F A;  2P5V A;  3C18 A;  1RNL A;  3AAF A;  3EYI A;  3QP6 A;  4RB2 C;  1IXC A;  1HKT A;  4O3M A;  4HF1 A;  2A3S A;  2IA0 A;  1ZN2 A;  2M8E A;  1B9M A;  3GUD A;  1USS A;  5FGM A;  2XKO A;  4CHU A;  2OQG A;  4Q48 A;  3QU6 A;  3I64 A;  1HBX G;  2VOO A;  2OA4 A;  5CJ9 A;  2K86 A;  3DKW A;  1S7A A;  1QZZ A;  3R0A A;  5D6F A;  3B02 A;  4HA8 A;  4Q47 A;  1TW2 A;  4NQW A;  1UB9 A;  2M5W A;  3LA7 A;  4M9Z A;  3LWF A;  2VBX A;  2KIF A;  2P6T A;  2H94 A;  1IN7 A;  2XAJ A;  3K1P A;  3RDI A;  2VC0 A;  3RKX A;  2CO5 A;  2ZJ2 A;  2QLZ A;  3IRR A;  1LEB A;  1FC3 A;  3Q5F A;  2D2W A;  3BRO A;  1F4K A;  3LQR A;  4OU0 A;  1U3E M;  5LGT A;  4HF0 A;  2M45 A;  4UNO A;  3IKT A;  2GIV A;  1YO5 C;  5BPD A;  1K7A A;  1U5T A;  2V9V A;  3EQL F;  2V1D A;  2L3D A;  1XMA A;  2JPC A;  5D4S A;  2DO7 A;  2EFO A;  2M30 A;  1KYZ A;  3F6V A;  5HLI A;  2QZ8 A;  3K9T A;  3V8J A;  3SZP A;  2CGP A;  4IRG A;  5J8F A;  2YR2 A;  2EB7 A;  2ELH A;  3KFW X;  4L5I A;  4PZJ A;  3TOB A;  4E70 A;  3Q9S A;  3DP7 A;  5E8G A;  3RKW A;  4M9S A;  4A5M A;  3GFM A;  3LAP A;  4B09 A;  1QZY A;  3BJ6 A;  5CVU A;  2VBY A;  4HF2 A;  2IW5 A;  4WCG A;  3V4G A;  3MZY A;  2HKO A;  2XVC A;  2GXG A;  1J7K A;  3I5U A;  3L9F A;  1FBS A;  2ZKZ A;  4L0Y B;  4KN7 X;  1FOK A;  3CO7 C;  1FBQ A;  5JI6 A;  2MA3 A;  1OPC A;  3FWE A;  1OR7 A;  2DFI A;  4M6X A;  2W24 A;  1HXD A;  1XCV A;  4MQV A;  4FHT A;  2LF8 A;  1R36 A;  3JW4 A;  1IN8 A;  4G7Z F;  1XSV A;  1YW9 A;  2P5L C;  5ICE A;  1D3Y A;  1QQI A;  1XGS A;  1IW7 F;  5CVI A;  1R1U A;  5HLG A;  2W85 A;  1LJ9 A;  3TO6 A;  1FYL A;  3MAJ A;  2HZT A;  3TQN A;  5E1W A;  5LEK A;  1Z91 A;  4FX4 A;  1T2K A;  3F21 A;  2XKP A;  3EUH A;  3DF8 A;  4CDG A;  1BIB A;  1R23 A;  3WG9 A;  1IN5 A;  1XDU A;  2OU2 A;  3BPV A;  1RIO H;  4KFC A;  3BDD A;  3ZMT A;  1S7O A;  1F5T A;  2GWR A;  3RPQ A;  3GXO A;  1HW2 A;  3CJN A;  3GZ5 A;  1TQI A;  4OMY A;  3FXQ A;  1DUX C;  1XSD A;  1OKR A;  4YII A;  3SHF A;  2A69 F;  2HOE A;  4LG0 A;  2DW4 A;  1T6S A;  1ZGA A;  1R5G A;  4XSZ F;  1IZ1 A;  3GZ6 A;  3N97 A;  3DV8 A;  3F8M A;  5ILV A;  2JRT A;  1DDN A;  4Y13 A;  4RGU A;  1ZYR F;  1J0R A;  1SD4 A;  2E1N A;  5CVV A;  2WWY A;  5E1X A;  4LG0 B;  1G3S A;  3BPX A;  2V79 A;  2P6S A;  4L9V A;  1G4D A;  5EEG A;  4A6D A;  3JAM Z;  2R3S A;  5CYV A;  1UHM A;  3H92 A;  4L9T A;  1IAW A;  4EJV A;  2DPU A;  3WTS C;  4QLC U;  5HVQ C;  3LST A;  1T39 A;  1SMY F;  1E17 A;  3O3K A;  2ZME B;  1KQ8 A;  1DP7 P;  4QWQ A;  1SAX A;  3LA3 A;  3QOP A;  3ELK A;  1T38 A;  4WXH A;  2DT5 A;  4G6D A;  1SFX A;  2QWW A;  1QPM A;  5HS7 A;  5E17 F;  2NAZ A;  4BHB A;  1R5H A;  1FY7 A;  3CLO A;  4UV8 A;  4WWC A;  4AIK A;  4M72 A;  1ZAO A;  4A0Z A;  3HUG A;  5LRR A;  2FNA A;  4TV7 A;  3GFJ A;  4P9F A;  3L2C A;  1B59 A;  2FRH A;  4IVN A;  4L9N A;  3K0L A;  1EV7 A;  2HYF A;  4O6J A;  2J5P A;  4PCQ A;  5HOO A;  4ENN A;  2KJC A;  3K69 A;  3GFI A;  4EM2 A;  3P9K A;  2OBP A;  3OV8 A;  5ICF A;  3J7A O;  3QAH A;  5L3B A;  4Q4Z F;  4KDP A;  3KZY A;  2GAU A;  1D8J A;  3DXJ F;  3LA2 A;  1Q1H A;  3O6B B;  2Z99 A;  4KA4 A;  1V4R A;  1WQ2 A;  2X0L A;  2D45 A;  4LLG F;  1TTY A;  2OD5 A;  1XN7 A;  2JTV A;  1OMI A;  3HOT A;  1R1T A;  3BJA A;  1BM9 A;  3IKV A;  3WTV C;  3HRS A;  2HTS A;  1UHW A;  1YTY A;  2FA5 A;  3KP5 A;  4AVP A;  1MKM A;  3RPU A;  2JZY A;  2ACJ A;  3E5Q A;  2FBI A;  2CQK A;  1MDM B;  2IRF G;  2KJB A;  2D1H A;  5HDG A;  4LGW A;  5DUI A;  2ESH A;  3REO A;  5K1Y A;  4IRI A;  4ON0 A;  4ZYH A;  1O3R A;  3ZN0 A;  2LNB A;  2XAF A;  2MLK A;  4HDV A;  1G3Y A;  4M73 A;  3U1D A;  2PLY A;  5DCM A;  4HW0 A;  4R8H A;  1XSX A;  1Z6R A;  3ZPL A;  2FE3 A;  1YFH A;  4ZZD A;  4HYE A;  3DFG A;  5D5X B;  3COA C;  1O57 A;  3WE3 A;  2BE5 F;  5H6R A;  4ASN A;  3GVA A;  4P55 A;  4CIC A;  1QBJ A;  1YG2 A;  1RUN A;  1PDN C;  4UVA A;  2EV0 A;  2BEO A;  5LEJ A;  1F1Z A;  1KU9 A;  3WGH A;  2Z5U A;  4OIP F;  4EVI A;  2P7V B;  1I1G A;  1O7F A;  1PP8 F;  5L3G A;  3E5U A;  4UHT A;  4KUM A;  5DV5 A;  1QO0 D;  1S6L A;  2EWN A;  4UUV A;  1U6G A;  3BP8 A;  4G6Q A;  1Z6T A;  2RVC A;  1F9N A;  4RB3 C;  3SZT A;  2O61 A;  4U0Y A;  1JE8 A;  1P92 A;  1YW8 A;  1LQ1 A;  4U0V A;  1R22 A;  3CUQ B;  2OZ6 A;  5D8L B;  1YIO A;  4LB5 A;  3RYR A;  4MEX F;  1ZAR A;  4ESB A;  5JVT A;  4S04 A;  2BGC A;  2FQ3 A;  2H6C A;  5FFX A;  3VB2 A;  3NEU A;  2XAS A;  1KYW A;  3FMS A;  4JBA A;  2BYV E;  1HKS A;  4UVC A;  2LSO A;  2D1V A;  4KT5 C;  3J80 K;  2Y0M A;  1FYK A;  1W5S A;  3F72 A;  4L18 B;  4RB0 A;  3TOA A;  4EGZ A;  4XRF A;  2GQQ A;  5H20 A;  4IJA A;  3CUQ C;  1C0W A;  5E18 F;  1IN6 A;  3WE2 A;  2KIM A;  2R7F A;  3JTG A;  4OIN F;  4DQ2 A;  5K5O A;  5E8I A;  4MHG A;  5AON A;  2QQ9 A;  4M6Y A;  2VC1 A;  1B4A A;  2XRN A;  2XUB A;  1EH7 A;  2ZNZ A;  3DPL C;  1L0O C;  4RGS A;  4LLL A;  1KU3 A;  3I54 A;  3DQV C;  2EFQ A;  1FP2 A;  2HEO A;  3KP7 A;  2O0Y A;  2XAH A;  2V1X A;  1D8K A;  3F6O A;  2GZW A;  1REP C;  4IHS A;  2CSO A;  3E3V A;  4KIF A;  1K6O A;  1YYV A;  1H0M A;  4G7H F;  5BPI A;  4BH9 A;  1IN4 A;  1ZG5 A;  1O7L A;  3LFK A;  2RC4 A;  1NHA A;  4IHT A;  2JSC A;  4HX8 A;  3VFZ A;  1A04 A;  1EH8 A;  3L09 A;  3KP6 A;  1FWZ A;  5A2Q Z;  4I02 A;  2PQ8 A;  5E1Z B;  5ILS A;  2QBY A;  1J9I A;  3GYH X;  1CF7 A;  2ZCW A;  3IHU A;  5ED4 A;  3HSE A;  4RGX A;  1CF7 B;  4P9U A;  4UVB A;  2WTE A;  2VOD A;  1OYW A;  2ZXJ A;  4G9Y A;  2DK5 A;  4YIF A;  1XGO A;  2BV6 A;  1J59 A;  4I7H A;  3HYI A;  1H9T A;  3WGI A;  2E7W A;  3R4K A;  1LDK B;  2VE8 A;  2W57 A;  1S29 A;  3WU0 A;  3H3U A;  1T98 A;  3VOE A;  4Q5S F;  1HQC A;  3DEU A;  3BY6 A;  1KGS A;  3ULQ B;  1I27 A;  3CTA A;  1BI0 A;  1LB2 A;  4R1H A;  3HTU A;  1HW5 A;  2KKO A;  1IRG A;  4CYD A;  4U88 A;  4A6E A;  4AIJ A;  1WI9 A;  2K4J A;  1G3T A;  4PDK A;  1SD7 A;  1B1B A;  3F8F A;  3L00 A;  4FX0 A;  2UZK A;  2LKP A;  4O5V A;  3FZV A;  3FM3 A;  3ML6 A;  2P8T A;  4ENJ A;  2RDP A;  3E6C C;  2XAQ A;  3TO7 A;  3L7W A;  3KLO A;  2L01 A;  3RIR A;  1BC7 C;  4EJW A;  2FOK A;  3SQN A;  2J5O A;  3F23 A;  1FX7 A;  1Z9C A;  2P5K A;  4P96 A;  1TNT A;  4HDU A;  3I59 B;  2QM3 A;  1W5T A;  3HSF A;  3FF5 A;  5E20 A;  2NRA C;  4Y15 A;  2YSR A;  2KIU A;  1PUE E;  3MEX A;  2LF7 A;  3BOQ A;  3P7N A;  2OZU A;  1BBY A;  2FU4 A;  2Y48 A;  1B6A A;  4KIB A;  1T0F A;  5HDN A;  2RV8 A;  1GHC A;  3ZMZ A;  3QRF F;  4BYY A;  4EV0 A;  2UXN A;  4OOI A;  2BBY A;  2A07 F;  2LDU A;  2TDX A;  2XRO A;  2UWM A;  1KQ9 A;  3F8N A;  1L3L A;  1PP7 U;  4M71 A;  4KMU X;  3HOS A;  5L3F A;  5LHI A;  1CGP A;  5FD6 A;  4HAM A;  3RJP A;  2DI3 A;  2H6B A;  4G94 A;  1FNN A;  1TNS A;  4ESJ A;  2VBW A;  1LDD A;  3KP4 A;  4OMZ A;  2G7H A;  5A2Q K;  2HFH A;  2DU9 A;  5KK1 A;  5FD5 A;  3W6K B;  3LAJ A;  4LK1 F;  1WKM A;  2EFP A;  4AD9 A;  1TLH B;  2QQB A;  2VE9 A;  3D0S A;  5JFR A;  3NRV A;  1IF1 A;  4L0Z B;  5ICG A;  3E6B A;  1ULY A;  4HLX A;  1FSE A;  2IP2 A;  3V7R A;  1MD0 A;  3JSO A;  2QVO A;  2EV6 A;  1VTN C;  3ABT A;  1FPQ A;  1ON2 A;  1KQ0 A;  2COM A;  2HGC A;  2ISY A;  1BC8 C;  2EFN A;  2GA2 A;  2L54 A;  4A2U A;  1Z1D A;  1Z05 A;  2QEN A;  2FBK A;  1LVA A;  4LJZ F;  3ZMD A;  1R7J A;  5D5V B;  3GEZ A;  3V8K A;  3ZMV A;  1ZHF A;  2EA2 A;  1XD7 A;  4F7Z A;  3Q9V A;  1J2X A;  1K79 A;  1P6R A;  4WX9 A;  4ENM A;  3ERE D;  4HBL A;  2M1B A;  3MZH A;  4I01 A;  1P4A A;  2E1C A;  5AIP A;  3R60 A;  1XDS A;  3T8R A;  5IT3 A;  3PQJ A;  1UST A;  4CGZ A;  3KEQ A;  1AOY A;  3MFK A;  1DPR A;  2XIG A;  2WC2 A;  4ZYG A;  3VEP A;  3KEO A;  3V7C A;  4LK0 F;  3C1D A;  4NHJ A;  1O3S A;  3CUO A;  1ZRC A;  3LQQ A;  2F5C A;  4DNC A;  5AIQ A;  1J5Y A;  1JHH A;  1ON1 A;  3EDP A;  3M1E A;  2ISZ A;  5K5R A;  1SFU A;  2O3F A;  1B9N A;  1SD5 A;  5IT9 K;  2DTR A;  2A6E F;  2FF4 A;  2EV5 A;  1ZLJ A;  4ENK A;  5L3E A;  4MTE A;  5D4R A;  2PBI A;  3E97 A;  1W7P B;  3P9I A;  3P9C A;  3V8L A;  4A12 A;  3W6J B;  2HQR A;  1J75 A;  2W84 A;  2G7U A;  3NQO A;  2PMU A;  4XLN F;  2Z33 A;  1IUY A;  3DPT A;  4OIQ F;  2PG4 A;  1S8N A;  1QGP A;  4MEY F;  3U2R A;  5D5U B;  2FBH A;  1S3J A;  3F3X A;  2Y75 A;  1WWX A;  5H6Q A;  1W7P A;  2YU3 A;  2GA1 A;  3MCZ A;  2QQA A;  3N4M A;  2VON A;  3HRM A;  4I0B A;  2O03 A;  1MJA A;  4IF4 A;  3J80 Z;  1WSU A;  1R58 A;  4CXF A;  4BXU A;  1IRF A;  2A6H F;  2IA2 A;  3ZMS A;  2DQL A;  5TJJ A;  5EEH A;  1H9G A;  2VBZ A;  4PGH A;  2L4A A;  4IRH A;  3FXU A;  1RZ4 A;  5DD4 A;  5ILU A;  4FT8 A;  2FXA A;  1GVJ A;  1I5Z A;  1GXQ A;  4HOB A;  2VXZ A;  4A0Y A;  2XAG A;  4NB5 A;  3T5X A;  4BHC A;  2PI0 A;  4ETS A;  4HX4 A;  3QPT A;  4BNC A;  3GLX A;  1U2W A;  4AIH A;  1I1S A;  1R1V A;  2F5D A;  2PMH A;  3BWG A;  4WF2 A;  4MNU A;  2ZNY A;  3GFL A;  1U5T B;  3WOD F;  2Z3Y A;  4M9X A;  3QP5 A;  2RKH A;  2O6G E;  3F22 A;  2IT0 A;  1SMT A;  4XSX F;  2QYO A;  2ETH A;  4GCV A;  1TW3 A;  4LB6 B;  4LD5 A;  5HS8 A;  2IJL A;  2HR3 A;  3CUQ A;  1MJ9 A;  5DUK A;  1BI3 A;  5D5W B;  5D6E A;  4Z2Y A;  3I71 A;  3ISP A;  3EYY A;  2CW0 F;  3I59 A;  3GF2 A;  3WGG A;  5LBQ A;  4A0X A;  2HDC A;  2Q0O A;  2V1U A;  3T1B A;  5BS6 A;  3E6M A;  3JSP A;  2IPQ X;  1IXR C;  4R79 A;  3M7G A;  4BHP A;  1K78 A;  4YFX F;  3CDH A;  4ZZL A;  4KN4 X;  2QBY B;  2IVM A;  4B8X A;  1OYY A;  3S2W A;  4HLY A;  2VT2 A;  2JPB A;  2XV4 S;  3KLN A;  5DYM A;  5FB2 A;  3WTZ A;  3TGN A;  5LGN A;  2X4H A;  4OIO F;  2EJR A;  4RAZ A;  3T8T A;  3HIF A;  1JGS A;  1FBU A;  2XHK A;  1BIA A;  3ZMU A;  4ZH4 F;  3F8B A;  5L3D A;  4KMF A;  5D8K B;  1BOA A;  1LDJ A;  2VOP A;  2NNY A;  4CZZ A;  4YFK F;  2H27 A;  2CFX A;  5LHH A;  3D5L A;  3IWZ A;  4S05 A;  2FEZ A;  4GO1 A;  3KP2 A;  3EET A;  2E7X A;  2O8X A;  4LLN A;  2FML A;  2RQP A;  4U0W A;  4RGR A;  2KRF A;  1JHF A;  5J6X A;  6PAX A;  5JHU A;  1KA8 A;  3PQK A;  4I2O A;  4EM1 A; 
#chains in the Genus database with same CATH topology
 4CSW A;  1YW7 A;  3WTT C;  2JVH A;  3BR2 A;  3OOP A;  1XS9 A;  3K7A J;  2RNG A;  3EUH C;  4EM0 B;  1JXS A;  4GYG A;  3M8F A;  1OLT A;  1TQP A;  5GAE J;  3BCA A;  1A36 A;  2KFD A;  3O8H A;  1ODD A;  3G73 A;  2XGE A;  3X2Q H;  3FX3 A;  2Z9O A;  2CWE A;  2XGX A;  1ZGJ A;  3L2V A;  1YJN I;  1DGR M;  3BZ6 A;  1FP1 D;  3R0J A;  1R00 A;  4RA2 A;  2TCT A;  1MZB A;  2HDW A;  3R6S A;  3K70 D;  2JT1 A;  3G4S I;  2VPR A;  3ECH A;  3OIQ A;  5BOX A;  5DM7 F;  4G8X A;  1SFE A;  5HDK A;  3CCJ I;  1SD6 A;  3E5X A;  2CH0 A;  2HU9 A;  1LFU P;  1JI8 A;  2ZSH B;  2P4W A;  5CLS A;  3ROU A;  3VYR B;  2LP0 A;  4BEH B;  4Y33 A;  2BOL A;  3VYS B;  2DA6 A;  4BDY A;  1ZRF A;  1G8X A;  5K7H A;  1E2X A;  2R4G A;  1ONV A;  5LRS A;  2RNJ A;  1T8I A;  2BY2 A;  2X1E A;  3DLA A;  4IXA A;  3GWZ A;  5CVR A;  1ORK A;  2OCE A;  1YS6 A;  2HWV A;  2KDO A;  5KAF C;  4Z6Y A;  1TL8 A;  4A3D J;  2JA2 A;  2R7T A;  1I6X A;  2GLO A;  5IYB J;  2DQR A;  2L9R A;  1Y0U A;  3HRU A;  4KYW A;  5F64 A;  2AS5 F;  2DMP A;  3RSN A;  3TDZ C;  1ZRE A;  1XB4 A;  2KHM A;  1ZH5 A;  1GT0 C;  3PIO F;  3GX4 X;  2DCE A;  2ZO4 A;  4N9I A;  1YLF A;  1OCT C;  4I0A A;  2OAZ A;  1P4W A;  3E0J B;  2H1K A;  1JTY A;  2JRM A;  4HQM A;  5ICC A;  3RCO A;  2B0L A;  1XGM A;  3VOD A;  2DMQ A;  1W7P D;  1JKQ C;  4QPO A;  3CC7 I;  2VT3 A;  3HTS B;  1DPU A;  1MH3 A;  2HQN A;  1MGT A;  3TL4 X;  2ECB A;  2B63 J;  4L5J A;  3OOU A;  3C3W A;  3HSR A;  3PFY A;  1TBX A;  5IT9 Z;  1V3F A;  2BY3 A;  1YX5 A;  4OIR F;  3MN2 A;  3FDY A;  2L9V A;  3SEQ A;  4XLH A;  4H4K C;  3HRT A;  5DCF A;  5F0H A;  3B73 A;  3JR9 A;  5L3C A;  1K78 B;  1P2F A;  4LMY A;  2DK8 A;  3BTI A;  3TP0 A;  4GFB A;  4FTH A;  1JUM A;  1NG7 A;  2NYX A;  4FIS A;  5TGT A;  2YX7 A;  3M8E A;  3G1M A;  1TWH J;  2DMN A;  1R49 A;  3SJM A;  4GGG A;  2V9P A;  3OYL A;  3LMM A;  4A5N A;  1XCB A;  3OSG A;  4EQQ A;  3WTY C;  1ENH A;  1W4M A;  2A68 F;  4IX7 A;  2LRE A;  3FMQ A;  1HKQ A;  1X2N A;  5KAI C;  4I09 A;  2UXX A;  4QTR A;  3FXM A;  1FSH A;  4KIG A;  1XGN A;  4L9J A;  3JRA A;  5EG0 A;  2ZME A;  1UFM A;  4A3F J;  2IGO A;  1LNW A;  3VPR A;  3CO6 C;  3MQ0 A;  3QPH A;  2K27 A;  2ZBK A;  5IP9 J;  4RAY A;  4Y7N J;  5GPA A;  1FTT A;  3I53 A;  4IL6 C;  1UZC A;  2EK5 A;  3WTU C;  2NVT J;  3RYP A;  1U78 A;  2V6C A;  2DPD A;  1JUS A;  2FNP A;  1ZG1 A;  3S2H J;  2Q2E A;  4W97 A;  4RS8 A;  2BY0 A;  2PFB A;  1BI2 A;  5F1J A;  4XOP A;  3QU3 A;  4XM3 A;  1RUO A;  3A1Y A;  3HB9 A;  3ZN1 A;  3BT9 A;  4EGY A;  1WVR A;  2LKS A;  3H5A A;  1OYI A;  4IPA A;  4OAY A;  2Z16 A;  4EMS A;  2LY9 A;  1QNT A;  1DU0 A;  3RI4 A;  1UCR A;  5DDG A;  1RI7 A;  3K2Z A;  1JGG A;  4P5O A;  5F6F A;  1ZK8 A;  5LGU A;  1STZ A;  1SC7 A;  2ESN A;  4HV6 A;  1YIT I;  3TO9 A;  5FLX Z;  4B44 A;  4JK1 X;  4A3G J;  4RM2 A;  3GTP J;  3BR0 A;  4I98 B;  2Q8K A;  2IEK A;  2VJI A;  2MH9 A;  4GYI A;  2MD5 A;  3T0Y A;  1QVT A;  1RR8 C;  4U7B A;  3CDL A;  3KCC A;  4Y17 A;  3IWF A;  1AWC A;  4HST A;  1VF9 A;  2V1N A;  2DJN A;  2R7U A;  4K2E A;  2MLG A;  2L5Q A;  5J3L A;  3O2P E;  3G3Z A;  5DEQ A;  2MC3 A;  1ETY A;  3SFZ A;  3K1M A;  1CQT A;  2H09 A;  4F91 B;  3FHZ A;  1UJ8 A;  4DYQ A;  1VZ0 A;  2PJP A;  5J40 A;  2DLL A;  5BMZ A;  2JWT A;  3E6D A;  3SXY A;  3I4P A;  1W0T A;  2MSY A;  1X4O A;  2IXS A;  2YX4 A;  2EZI A;  3OYB A;  1Y1W J;  2XPW A;  2AO9 A;  1LEA A;  2WY7 Q;  1D5V A;  2K7L A;  3KZZ A;  3TW7 A;  3J7Z I;  2O7O A;  1Z7U A;  3CP2 A;  5F1R A;  1KON A;  4MFD A;  3O8G A;  1NK3 P;  4Y4R A;  2HYG D;  3K4J A;  5LLQ A;  2R7D A;  1Y56 A;  1U5T C;  2FQ4 A;  4GXO A;  1G6N A;  3PO2 J;  1OCP A;  4MTD A;  1IV8 A;  4NDL A;  2CW8 A;  2B9S A;  2DFF A;  2DAO A;  5KVR A;  1TWA J;  2D5V A;  1U9N A;  2A5W A;  2F2E A;  4UB6 C;  4CUG A;  3ZP5 A;  3FMR A;  2IGM A;  3CZ6 A;  4HQE A;  1BJZ A;  3VYU B;  5HLH A;  1X3U A;  4CO8 A;  4C2U A;  3H3Z A;  1XMK A;  3BJO A;  2Y9Z A;  2F4O B;  3L2W A;  2H8W A;  3JRH A;  3AL0 B;  5DS9 A;  3L2Q A;  3GZN B;  1TQM A;  2L02 A;  5BQT A;  1UG2 A;  2HDD A;  2JJ7 A;  1W5C C;  3ZCO A;  1HST A;  4AID A;  1HW1 A;  3CES A;  3HHH A;  3RQI A;  3UR3 C;  1FJL A;  2EBI A;  2PMZ A;  3I0T A;  3QOE A;  1KU7 A;  2WV0 A;  2LKX A;  4JYK A;  5C4X J;  1ETW A;  4EJT A;  2W25 A;  3D5S C;  3IL2 A;  5JVG F;  4M3F A;  4QIW N;  4EAT A;  4HX7 A;  1A5J A;  4ZYE A;  2OQR A;  3S8P A;  3HHG A;  1WRJ A;  2STT A;  4MGR A;  4D5C A;  3PJR A;  2DYR H;  4A93 J;  2L7F P;  3BLY A;  4XR6 A;  3DTE A;  4BAY A;  2IBD A;  3RZO J;  4MIM A;  1ZLK A;  4M74 A;  1D0Z A;  4BQA A;  3BG3 A;  1FT9 A;  4JQF A;  2YPR A;  4PGG A;  1ZG3 A;  3KE2 A;  2OC6 A;  2RRE A;  4AWX B;  3F8C A;  2XC7 A;  4YRV A;  3D1N I;  2GXB A;  3OS1 A;  4LFU A;  2L2O A;  3GO5 A;  4ABZ A;  2K4B A;  3WU2 C;  4XRM A;  2JA7 J;  3WTX C;  1E0E A;  2FSW A;  5EG0 B;  2NS8 A;  5HS9 A;  3J81 K;  1SEU A;  3EPZ A;  1MBE A;  3CCQ I;  3MKL A;  2MH2 A;  3K70 C;  2M4K A;  4XLP F;  2CQN A;  2NS7 A;  2AHQ A;  3QQA A;  1SAN A;  1O3Q A;  2CYY A;  2F4I A;  5EGO B;  2RGV A;  4UXN A;  3I58 A;  3ERM A;  3IC7 A;  2K02 A;  4DYC A;  3RZD J;  4ZJZ A;  1ERD A;  1MBJ A;  1OR7 C;  4N9H A;  3OYA A;  1Z0X A;  2CG4 A;  1GXP A;  2VKV A;  3BR1 A;  4NC8 A;  2AQE A;  1FZP B;  3ZQH A;  4DBQ A;  2K3P A;  1RKW A;  1U8B A;  3M9A A;  3GTJ J;  5DD8 A;  2R5Z B;  3M8J A;  4BS9 A;  2EA4 A;  5JR3 A;  4FE4 A;  1MJB A;  3MKW B;  5CVJ A;  3CD6 I;  3BZK A;  2FMY A;  2ADU A;  1VQO I;  4E7Z A;  1O4X A;  5LFA A;  2XSJ C;  2E19 A;  2A61 A;  4WK8 F;  2NS0 A;  3PNY A;  3V7S A;  3GTG J;  1HC8 A;  1X1A A;  2ZFU A;  3GW2 A;  5TRD A;  4CH7 A;  4XID A;  1KU2 A;  4YFN F;  3J7Y J;  5GAG J;  1H88 C;  5DCM B;  1IDY A;  1W1W E;  3IRQ A;  3WTW C;  2HKX A;  1HSJ A;  1R4M B;  2FOW A;  2HOA A;  5FLX K;  3H35 A;  2ZFW A;  4KIC A;  3JTH A;  3H9J A;  3C7J A;  1TWF J;  1HLV A;  3KP3 A;  2MBF A;  3R61 A;  1Y6I A;  1IXS B;  1WCM J;  4ZYD A;  1HF0 A;  2M87 A;  4U7D A;  2LVS A;  4HZF A;  3FXR A;  5K7Z A;  3FIS A;  1H89 C;  2L4M A;  1MIJ A;  2OJE D;  4II2 A;  4D0P A;  3DU5 A;  4YG2 F;  5LHG A;  1MBK A;  1YS7 A;  2F5E A;  5F0F A;  2ELJ A;  3JAM K;  2VUM J;  5FKL A;  2JA5 J;  3RKY A;  2ICW G;  3ESW B;  5K7F A;  3TKY A;  2RN7 A;  4G7O F;  4XBF A;  3ZQI A;  4JOM A;  1NTC A;  4XLF A;  2PN6 A;  3RTR A;  2HTJ A;  2EFW A;  3QPS A;  1WZ2 A;  4N0B A;  4KNY A;  3QYE A;  1W0U A;  2DBB A;  3TED A;  1B8I A;  2KP6 A;  2IA1 A;  4UV9 A;  2HOT A;  1EH6 A;  4KJZ A;  2P7C B;  3BQZ A;  2BW3 A;  5CPR B;  2VN2 A;  4MQ9 F;  1I6H J;  4HRI A;  4IQJ A;  4EJU A;  2VXD A;  3K1N A;  1VQ9 I;  3PFI A;  2PEX A;  3KET A;  2R7Z J;  1FLI A;  4EJO A;  4DIQ A;  1MDM A;  1G3W A;  1GUU A;  1BJA A;  3JRD A;  2QUF A;  1Z7L A;  3TDU C;  1P4X A;  2K9N A;  1O3T A;  3P5J A;  3H36 A;  5EZH A;  1OFC X;  3ABU A;  4RM3 A;  3L2U A;  2NNN A;  3WU1 B;  3L1P A;  4I99 C;  4WXC A;  1BI1 A;  2ZXW H;  3F0C A;  2G9W A;  3HPG A;  1BN5 A;  1FYM A;  2AXL A;  1GV5 A;  2RAE A;  3MWM A;  5F27 A;  3U9G A;  3F9K A;  3PL8 A;  4WXD A;  5FO5 A;  1SFO J;  2C6Y A;  3H9G A;  2K9L A;  2WAF A;  2NVU B;  1IV6 A;  4RB1 A;  1U8R A;  4XK4 A;  3K4L A;  2A5Y B;  2HS5 A;  2ME0 A;  5ERI A;  5J8C A;  2EIM H;  4H0E A;  2STW A;  5CQG A;  3ZXS A;  4XMY A;  3FKJ A;  2HPI A;  4HV5 A;  5FFZ A;  1YQA A;  1M1E B;  1ZRD A;  3FM5 A;  1IC8 A;  3J81 Z;  3OWT A;  3ZQ7 A;  1GVD A;  3DBH B;  4ESF A;  3ECO A;  1OCO H;  2BHZ A;  3CJT B;  2F5F A;  2P5V A;  3C18 A;  5K5Q A;  2P81 A;  1RNL A;  3AAF A;  3EYI A;  3QP6 A;  3CJR B;  1MW7 A;  1YI2 I;  4RB2 C;  1IXC A;  1HKT A;  3FK6 A;  3TMO A;  3M07 A;  3NAU A;  4O3M A;  4HF1 A;  2A3S A;  5EEA A;  2IA0 A;  2W00 A;  3WG7 H;  4BKX A;  1ZN2 A;  2M8E A;  3S1N J;  3AKZ A;  1B9M A;  2K5C A;  1VQL I;  3GUD A;  1T56 A;  4D7N A;  2BVM A;  1USS A;  5FGM A;  2L7K A;  2VIX A;  2XKO A;  4FET A;  4CHU A;  2OQG A;  4Q48 A;  3QU6 A;  3M4O J;  3I64 A;  2V26 A;  1BOB A;  1HBX G;  2VOO A;  2OA4 A;  5CJ9 A;  4UUS A;  2K86 A;  3DKW A;  2PJR A;  4DW6 A;  1S7A A;  4II3 A;  2JQ7 A;  4CCK A;  2CQQ A;  1D0X A;  1LUJ B;  1IUF A;  1QZZ A;  3R0A A;  5D6F A;  4LIU A;  3B02 A;  1Y0N A;  1VQ5 I;  2UV1 A;  3OYE A;  3LL7 A;  4HA8 A;  4J19 A;  2M34 A;  4Q47 A;  1TW2 A;  4YEJ A;  3ZQC A;  5TIS C;  4NQW A;  1UB9 A;  2GOM A;  1AA7 A;  2XGD A;  2M5W A;  1HDD C;  2X6Y A;  3LA7 A;  4M9Z A;  3LWF A;  1EJ9 A;  2VBX A;  2KIF A;  1VQK I;  1QPI A;  1UEL B;  1UMQ A;  2P6T A;  3C2H A;  3CF2 A;  2H94 A;  4B47 A;  2HXI A;  3SYT A;  4FAS D;  1DP3 A;  1IN7 A;  2XAJ A;  2W82 A;  3A4C A;  3LSM A;  3OR1 C;  3K1P A;  3RDI A;  1E3P A;  2VC0 A;  3IP4 B;  2XDV A;  3RKX A;  2CO5 A;  2X85 A;  3QYF A;  2ZJ2 A;  3CCR I;  2Y9Y A;  1ACI A;  2QLZ A;  4AYB N;  2E35 A;  3IRR A;  1LEB A;  1FC3 A;  3Q5F A;  5C3E J;  2D2W A;  1T0F C;  2LRD A;  1BR1 A;  3BRO A;  2KRC A;  2R7O A;  1F4K A;  1OCR H;  2MYS A;  3LQR A;  4OU0 A;  2E2H J;  5DTD A;  1U3E M;  4AVZ A;  5LGT A;  4X6A J;  2WAE A;  4HF0 A;  2HOS A;  1POG A;  2E5Z A;  2M45 A;  2OF7 A;  4M3E A;  4UNO A;  2Y0S A;  3IKT A;  2GIV A;  1YO5 C;  4FQG A;  5BPD A;  3GTL J;  1K7A A;  3VSL A;  2MGQ A;  1U5T A;  2V9V A;  3EQL F;  2WAQ N;  1QZE A;  2V1D A;  1TZL A;  2L3D A;  4M3D A;  1XMA A;  1ETV A;  2JPC A;  3BG5 A;  5D4S A;  4CYC A;  4JP0 A;  1W36 D;  2DO7 A;  2EFO A;  2M30 A;  1JKO C;  3NWT A;  4IHV A;  1KYZ A;  3F6V A;  2E2J J;  5HLI A;  5GP9 A;  4B43 A;  2QZ8 A;  3K9T A;  1D0Y A;  3V8J A;  3SZP A;  1MND A;  4IRG A;  2CGP A;  2K3F A;  3RQ4 A;  1OQY A;  5GAD J;  5J8F A;  2COB A;  4BQN A;  2YR2 A;  2EB7 A;  5M5X J;  2ELH A;  3BTC A;  3KFW X;  4KIT B;  4L5I A;  4PZJ A;  3TOB A;  4E70 A;  4DYR A;  3Q9S A;  3DP7 A;  5E8G A;  1LFP A;  3RKW A;  3I55 I;  1A6I A;  4M9S A;  4A5M A;  1ITY A;  3MVP A;  4JX4 A;  3GFM A;  3LAP A;  4B09 A;  1QZY A;  3BJ6 A;  3CMM A;  5JLW A;  5CVU A;  2VBY A;  3KYL A;  4HF2 A;  2IW5 A;  2V7F A;  3OYN A;  4WCG A;  3JRE A;  5FRN A;  3V4G A;  2EZL A;  3MZY A;  2HKO A;  2XVC A;  3S32 A;  2GXG A;  1J7K A;  2F5V A;  3I5U A;  2E5N A;  3L9F A;  4N4N B;  4LIT A;  3FKI J;  2LC2 A;  4DGW B;  4U87 A;  5FRM A;  1FBS A;  2ZKZ A;  4L0Y B;  4KN7 X;  3LOC A;  1FOK A;  1WJE A;  2Z1D A;  5EJC A;  3CJQ B;  1FBQ A;  5JI6 A;  2MA3 A;  3CO7 C;  3BTL A;  1OPC A;  1FOX A;  3FWE A;  1OR7 A;  2DFI A;  1Y39 A;  2DMT A;  2JUC A;  4GRI A;  4DOZ A;  2MD0 A;  1QHG A;  4M6X A;  2W24 A;  1HXD A;  1XCV A;  2K9Q A;  4MQV A;  1UAA A;  4XRS A;  3GCM A;  2OTL I;  4FHT A;  1WJF A;  2LF8 A;  2WY8 Q;  1R36 A;  3JW4 A;  1IN8 A;  4BJ5 C;  4G7Z F;  1MBF A;  1XSV A;  1YW9 A;  2P5L C;  4BE1 A;  5ICE A;  1D3Y A;  1QQI A;  4C2T A;  1XGS A;  1IW7 F;  5CVI A;  1R1U A;  4XKC A;  5HLG A;  2W85 A;  4IEJ A;  1LJ9 A;  1UG0 A;  3TO6 A;  1FYL A;  3MAJ A;  3PM1 A;  2HZT A;  4D9J A;  3G1L A;  3TQN A;  5B5E C;  1W36 C;  4IHW A;  5E1W A;  1VQN I;  5LEK A;  1Z91 A;  4FX4 A;  3FXJ A;  3VSK A;  1T2K A;  1XPX A;  1G2H A;  3F21 A;  3EUH A;  2MFZ A;  2XF7 A;  2XKP A;  3DF8 A;  2Y30 A;  4CDG A;  3BG7 A;  1BIB A;  1R23 A;  3CCE I;  3SZG A;  3GLL A;  2EIN H;  1N75 A;  3WG9 A;  1IN5 A;  2LH9 A;  1XDU A;  2OU2 A;  4ITV A;  3BPV A;  1RIO H;  4KFC A;  3BDD A;  3S3N A;  3W3C A;  4M3B A;  4YEL A;  3ZMT A;  4XNF A;  3CP8 A;  1S7O A;  3DKY A;  2QF7 A;  1F5T A;  2GWR A;  3RPQ A;  2V4J C;  1IG7 A;  3GXO A;  3ZQL A;  1MSF C;  2IS6 A;  2P0W A;  1HW2 A;  5FKO A;  3CJN A;  3GZ5 A;  1TQI A;  3FXQ A;  1DUX C;  2PX9 A;  5KCM A;  1XSD A;  4OMY A;  1OKR A;  5EZG A;  4YII A;  2HOE A;  2A69 F;  4LG0 A;  3SHF A;  2DW4 A;  5J47 A;  1T6S A;  1ZGA A;  1R5G A;  4XSZ F;  1IZ1 A;  1G59 A;  1DU6 A;  2VQC A;  2DOF A;  3FBN B;  3GZ6 A;  3N97 A;  3DV8 A;  3F8M A;  3GTO J;  5ILV A;  2JRT A;  2NOJ B;  1DDN A;  4CCO A;  1BR2 A;  4Y13 A;  4RGU A;  1ZYR F;  1E3H A;  1J0R A;  1SD4 A;  3DCF A;  2E1N A;  4RLQ A;  5E3N A;  3MMY B;  4PUS A;  5CVV A;  2M9H A;  4XLC A;  2WWY A;  2DDA A;  5E1X A;  1GV2 A;  4E7K A;  1UHS A;  2WBM A;  3W6V A;  4LG0 B;  3CDI A;  2R92 J;  1G3S A;  3BPX A;  3WHC A;  2V79 A;  2P6S A;  4L9V A;  5EEG A;  4A6D A;  1G4D A;  3JAM Z;  2H1L A;  2R3S A;  4P1W A;  4Y52 J;  5CYV A;  1UHM A;  3H92 A;  4L9T A;  1F36 A;  4D7M A;  2L9N A;  5IYD J;  1IAW A;  4M3G A;  4EJV A;  5FLM J;  4XLA A;  2L9S A;  5FKM A;  2DPU A;  2KIS A;  3WTS C;  4XOR A;  4HNU A;  4QLC U;  5HVQ C;  2R7S A;  2ZC2 A;  1MMA A;  3LST A;  1LE8 A;  4A3K J;  2LD5 A;  3CC2 I;  3PSI A;  3FXK A;  1T39 A;  1SMY F;  1E17 A;  3K6G A;  2MG4 A;  3O3K A;  2ZME B;  1KQ8 A;  1DP7 P;  4QWQ A;  1SAX A;  2O9L A;  1VFC A;  1ZEL A;  2XF5 A;  3LA3 A;  2E1M C;  3QOP A;  3ELK A;  2KPM A;  1PYV A;  1T38 A;  4E6K G;  4F93 B;  4WXH A;  5IP6 A;  4X0G A;  2DT5 A;  1JKP C;  4G6D A;  1SFX A;  4DZJ A;  2QWW A;  5IOY A;  3C2G A;  1K4T A;  1QPM A;  5HS7 A;  5E17 F;  1FIA A;  5J4V A;  4PSX A;  2NAZ A;  4BHB A;  3IH4 A;  5E3O A;  3SDB A;  1R5H A;  4UB8 C;  5LD2 C;  1FY7 A;  2IS2 A;  3CLO A;  4UV8 A;  3HZJ A;  4WWC A;  3QYB A;  4AIK A;  4M72 A;  1GLN A;  3CLQ A;  3CCL I;  2VAS A;  2XRL A;  1ZAO A;  4A0Z A;  1N78 A;  3HUG A;  5LRR A;  2FNA A;  1QVU A;  3HM5 A;  1E3O C;  3S17 J;  4TV7 A;  1IO2 A;  1TWG J;  2E36 A;  3GFJ A;  4P9F A;  3L2C A;  1B59 A;  3OYJ A;  2FRH A;  4IVN A;  4L9N A;  3K0L A;  2FX0 A;  2HYJ A;  2I10 A;  1ZQ3 P;  2LTP A;  1EV7 A;  5E3M A;  2HYF A;  4O6J A;  2J5P A;  1VQ6 I;  3TW6 A;  5J1R A;  4PCQ A;  1MBH A;  4BY1 J;  2BXY A;  5HNF A;  5HOO A;  4HNV A;  3KYC B;  4ENN A;  4DJA A;  2KJC A;  3K69 A;  2R7X A;  3GFI A;  4EM2 A;  3P9K A;  3I3L A;  3A0H C;  2E60 A;  4JX6 A;  2OBP A;  3RKQ A;  3OV8 A;  5E79 C;  5ICF A;  3HL2 A;  3J7A O;  3S15 J;  3QAH A;  4BL0 B;  5L3B A;  4BY7 J;  4Q4Z F;  4KDP A;  2BZT A;  3KZY A;  3Q0W A;  2GAU A;  2L7M P;  4NC6 A;  1D8J A;  3DXJ F;  2ZXH A;  3K10 A;  3LA2 A;  1Q1H A;  2CS3 A;  2QSF X;  4IOA F;  2KZV A;  3O6B B;  1PVE A;  1A31 A;  1V5F A;  2OCC H;  1JT6 A;  2KL4 A;  2Z99 A;  4XKB A;  3SEZ A;  3JRC A;  5FKK A;  4KA4 A;  1V4R A;  1WQ2 A;  2NVY J;  2X0L A;  2D45 A;  4LLG F;  4HEA 2;  2O5R A;  1TTY A;  2OD5 A;  1XN7 A;  2JTV A;  1OMI A;  3HOT A;  1R1T A;  3BJA A;  1BM9 A;  2LBF B;  2DXI A;  3IKV A;  3WTV C;  3HRS A;  2HTS A;  3CCS I;  2W1O A;  1UHW A;  1YTY A;  4C3I J;  5EF6 A;  3QPL A;  2FA5 A;  2X51 A;  3KP5 A;  3Q0V A;  1P7I A;  2DA2 A;  4GDF A;  4PFP A;  4AVP A;  1B72 A;  4F55 A;  1QA6 A;  1MKM A;  3RPU A;  3IAS 2;  2JZY A;  1OIS A;  2ACJ A;  2LY2 A;  4LIV A;  3SDG A;  3E5Q A;  2FBI A;  1A6Q A;  3TBI A;  2CQK A;  2M7A A;  3BR6 A;  1MDM B;  2IRF G;  2KJB A;  2RQQ A;  3GTM J;  3CMA I;  4A3C J;  2D1H A;  2ID6 A;  5HDG A;  4LGW A;  2KQR A;  5DUI A;  2ESH A;  3ZRG A;  5J4Y A;  1U9O A;  3REO A;  5K1Y A;  2QEX I;  4IRI A;  2XF6 A;  1PUF A;  4ON0 A;  5C4J J;  4ZYH A;  1VQP I;  1O3R A;  4RMN A;  4XL9 A;  1P7J A;  1RET A;  3ZN0 A;  2LNB A;  3KPH A;  4JX5 A;  4B4C A;  2XAF A;  4LG3 A;  4A3L J;  4IZZ A;  1SVO A;  2MLK A;  4N4O B;  1TT5 B;  4HDV A;  3HOV J;  1G3Y A;  3OS0 A;  4M73 A;  3U1D A;  3ZQQ A;  4C2M J;  5DCM A;  2PLY A;  3CMY A;  2JA6 J;  4HW0 A;  4R8H A;  1XSX A;  1Z6R A;  2M0C A;  3ZPL A;  2FE3 A;  2KIQ A;  4UY8 I;  1K4S A;  2VKE A;  1YFH A;  4ZZD A;  3A2K A;  4HYE A;  3DFG A;  5D5X B;  3COA C;  2EQR A;  1O57 A;  3WE3 A;  2BE5 F;  5H6R A;  5CKT A;  4ASN A;  3AG2 H;  3GVA A;  2VJ5 A;  3OL3 A;  4P55 A;  4CIC A;  2MAB A;  1QBJ A;  1YG2 A;  2LG4 A;  1RUN A;  1PDN C;  4UVA A;  2O8K A;  2EV0 A;  2DT6 A;  3I4N J;  2BEO A;  2XB5 A;  4BU2 A;  5LEJ A;  3IV5 A;  1OCZ H;  1OCC H;  1YOV B;  1OJL A;  1F1Z A;  2JN6 A;  1BW6 A;  4XRS G;  2XSD C;  3MKZ A;  1KU9 A;  3IH3 A;  3WGH A;  3CCV I;  2Z5U A;  1X3Z B;  1AU7 A;  2CMP A;  4OIP F;  4EVI A;  2P7V B;  1I1G A;  1O7F A;  1PP8 F;  4UUS B;  2QGU A;  5L3G A;  3E5U A;  4UHT A;  4BDZ A;  4KUM A;  2LYC A;  1YJW I;  1XX5 A;  1TWC J;  2X6W A;  4BXX J;  5DV5 A;  1QO0 D;  1S6L A;  2DA4 A;  2EWN A;  3OL4 A;  4UUV A;  1U6G A;  3BP8 A;  4G6Q A;  2ZJP F;  2M8G X;  3G2B A;  1LPQ A;  1RES A;  1R6R A;  1Z6T A;  2ID3 A;  1FEX A;  3DBL B;  3NAR A;  5B1B H;  2RVC A;  2XB0 X;  1I39 A;  4A3I J;  1F43 A;  1F9N A;  4RB3 C;  2HZD A;  3SZT A;  2O61 A;  2R5Z A;  1XG1 A;  4A3E J;  4U0Y A;  4EEF G;  4YIR X;  2Y69 H;  1JE8 A;  1P92 A;  1YW8 A;  1LQ1 A;  3CF5 F;  2DA3 A;  4U0V A;  1R22 A;  5M3F J;  3WHB A;  2ZJQ F;  1Z77 A;  1X58 A;  2EIL H;  2CUE A;  4PJL A;  3FK7 A;  3CUQ B;  2OZ6 A;  4A3J J;  5D8L B;  1JTX A;  1YIO A;  3DWL E;  4LB5 A;  3RYR A;  4MEX F;  4F3Q A;  2HVR A;  1S9H A;  1ZAR A;  1WI3 A;  1KZH A;  4ESB A;  2JSP A;  1YRN B;  9ANT A;  5JVT A;  4S04 A;  2BGC A;  2WAQ A;  2FQ3 A;  3OY9 A;  2H6C A;  5FFX A;  2YUS A;  2DOE A;  2M0M A;  3VB2 A;  3NEU A;  4ZTF A;  3LSK A;  2XAS A;  3H1C A;  3AG3 H;  1KYW A;  3FMS A;  4JBA A;  3FHN A;  2BYV E;  1WFX A;  1HKS A;  4UVC A;  4RDU A;  3LSJ A;  5E3L A;  2LSO A;  1R9T J;  2D1V A;  4PJM A;  1YJ9 I;  2FJ1 A;  2ZSI B;  4CZC A;  1Z3X A;  4KT5 C;  3J80 K;  5F04 A;  2Y0M A;  3OS2 A;  1FYK A;  1W5S A;  1JJ8 C;  3F72 A;  4NQW B;  4L18 B;  4RB0 A;  3TOA A;  3LSR A;  4XRF A;  4EGZ A;  2BVL A;  3DKX A;  4QSH A;  2CFO A;  3GTQ J;  2GQQ A;  3S1R J;  2DFE A;  1R4N B;  5H20 A;  4IJA A;  3CUQ C;  4J01 A;  2NOG A;  1C0W A;  2X1D A;  4BJT A;  5E18 F;  3OMY A;  1IN6 A;  3ABL H;  3PNT A;  3WE2 A;  2KIM A;  1K61 A;  2PJR B;  2R7F A;  4BJ6 C;  2JK3 A;  3JTG A;  3ASN H;  1FIP A;  4OIN F;  4ZC3 A;  1U0J A;  4QPQ A;  4DQ2 A;  4D1Q A;  4E7J A;  5J1Y A;  4KT6 A;  5K5O A;  4XIC A;  3I9V 2;  2QKM B;  1LFB A;  5E8I A;  4MHG A;  5AON A;  2QQ9 A;  3N05 A;  3V42 A;  1NK2 P;  4M6Y A;  3MZ8 A;  4I6Z A;  3ZOB A;  2ELK A;  3Q3S A;  2VC1 A;  4PFO A;  2XUB A;  2XRN A;  1B4A A;  1EH7 A;  4CCM A;  1ETK A;  2ZB9 A;  4IKF A;  2DA1 A;  3DPU A;  2ZNZ A;  1NH3 A;  3DPL C;  1L0O C;  4RGS A;  4LLL A;  3G1O A;  1KU3 A;  4E7S A;  3I54 A;  3DQV C;  2HPM A;  2EFQ A;  1FP2 A;  2HEO A;  2OPT A;  1J09 A;  3KP7 A;  3G71 I;  2O0Y A;  2XAH A;  4ANJ A;  2V1X A;  1T08 B;  1D8K A;  3F6O A;  4BXF A;  1K6Y A;  2GZW A;  1REP C;  4IHS A;  2DA7 A;  3DTI A;  1FOY A;  3G6E I;  3JRF A;  2CSO A;  4G12 A;  3E3V A;  2V9K A;  3EUK L;  2R5Y A;  4KIF A;  4XOT A;  3OYM A;  1K6O A;  1YYV A;  1H0M A;  4G7H F;  5BPI A;  4BH9 A;  1IN4 A;  1ZG5 A;  1O7L A;  2OUM A;  2JVG A;  3LSP A;  5IOZ A;  3LFK A;  2RC4 A;  1NHA A;  4IHT A;  1TC3 C;  2DN0 A;  2JSC A;  2W48 A;  2LR8 A;  5GAH J;  4HX8 A;  3VFZ A;  2KRH A;  5F0C A;  1A04 A;  1TP4 A;  1X3W B;  3DLL F;  1RRJ A;  2DJI A;  2E2I J;  1EH8 A;  2IS4 A;  3L09 A;  2HXO A;  3OIO A;  3KP6 A;  1FWZ A;  5A2Q Z;  1K83 J;  1SFK A;  4I02 A;  2PQ8 A;  2KDZ A;  4BEH A;  4BGD A;  5E1Z B;  3OR2 C;  2QKL B;  2OV7 A;  3GME A;  5ILS A;  4B3X A;  5FLV A;  3K4K A;  2CV2 A;  2QBY A;  3BG9 A;  5KNL A;  1J9I A;  3GYH X;  1X4P A;  3CCU I;  2WB1 N;  4C30 A;  4AC0 A;  3B6C A;  4E4H A;  3FIW A;  1S5L C;  2K40 A;  1CF7 A;  1XTA A;  1QU3 A;  1YRN A;  2ZCW A;  1WHU A;  3IHU A;  5ED4 A;  3HSE A;  3KYD B;  4RGX A;  3CCM I;  1CF7 B;  4P9U A;  4UVB A;  2WTE A;  2W7N A;  3W2A A;  2VOD A;  3TP3 A;  1IRX A;  1IRZ A;  2GBY A;  1OYW A;  2QQ8 A;  1SVM A;  2ZXJ A;  4G9Y A;  2DK5 A;  3MKY B;  4YIF A;  1B72 B;  1XGO A;  3A01 B;  2BV6 A;  2LK2 A;  1ZR4 A;  1J59 A;  4I7H A;  3HYI A;  4BBS J;  1MMS A;  1H9T A;  2VLA A;  2L7Z A;  3WGI A;  2E7W A;  3BR3 A;  3R4K A;  5FKN A;  5BNG A;  1LDK B;  2VE8 A;  2ZJR F;  2W57 A;  1S29 A;  3WU0 A;  3H3U A;  1T98 A;  2WV1 A;  2K9M A;  2HVQ A;  3VOE A;  4Q5S F;  1H8A C;  1HQC A;  2GOX B;  1N77 A;  3BCB A;  3DEU A;  3BY6 A;  4D5F A;  3IH2 A;  2Q1Z B;  1KGS A;  5M5W J;  3ULQ B;  1I27 A;  3CTA A;  1BI0 A;  3ZQG A;  1LB2 A;  3QWL A;  4R1H A;  3HTU A;  1WJD A;  1HW5 A;  1YX3 A;  1LVK A;  3H0D A;  1D1B A;  2KKO A;  1IRG A;  4CYD A;  1WJA A;  4U88 A;  2KT0 A;  1BR4 A;  3K4C A;  4A6E A;  4AIJ A;  1S7E A;  1LKX A;  2FUG 2;  2XPV A;  3H9Q A;  3M3Y J;  2VI6 A;  1WI9 A;  1ZR2 A;  3LNQ A;  2X6O A;  1SVL A;  1QRY A;  2K4J A;  2E1M B;  2CQ7 A;  1G3T A;  2VB6 A;  3OYF A;  4PDK A;  3HOU J;  1SD7 A;  3A01 A;  2R93 J;  1B1B A;  5HOD A;  3F8F A;  3L00 A;  3LFU A;  4FX0 A;  2LKP A;  3EUA A;  4O5V A;  4BQO A;  2UZK A;  1R71 A;  3FZV A;  3FM3 A;  2ECC A;  3S16 J;  2CJJ A;  3ML6 A;  2P8T A;  4ENJ A;  1Z3Y A;  3I4M J;  5B3S H;  2RDP A;  3E6C C;  3BQY A;  2XAQ A;  3ABK H;  3OYH A;  3TO7 A;  2KLO A;  3L7W A;  1V54 H;  3KLO A;  1NG6 A;  1PJR A;  2L01 A;  3RIR A;  5F08 A;  1BC7 C;  4EJW A;  3AG1 H;  5GTI C;  2FOK A;  3SQN A;  1FOW A;  1T95 A;  3IUO A;  4BQQ A;  3ASO H;  3PO3 J;  2J5O A;  2M7B A;  3F23 A;  2EZH A;  1FX7 A;  2AQF A;  1RC9 A;  3HJE A;  1Z9C A;  2P5K A;  4I76 A;  2LBF A;  5B1A H;  4P96 A;  1TNT A;  2YS9 A;  2HQ5 A;  4HDU A;  3I59 B;  2QM3 A;  1W5T A;  3HSF A;  2GXA A;  3PUF A;  2DOA A;  1VQ7 I;  3NWS A;  1AKH A;  3FF5 A;  5E20 A;  3CCY A;  2NRA C;  3CQZ J;  3ZGK A;  4Y15 A;  4OAZ A;  5J1U A;  5KHD A;  4V2F A;  2YSR A;  2R7V A;  1QHH D;  2KIU A;  1PUE E;  2V6E A;  3MEX A;  2BY1 A;  1I50 J;  3BOQ A;  2LF7 A;  2IGK A;  3P7N A;  1WH5 A;  1Z21 A;  2OZU A;  1D1C A;  5EDN A;  1BBY A;  2MC4 A;  2EH3 A;  2FU4 A;  2NVX J;  2Y48 A;  3HPH A;  2WAD A;  1B6A A;  4KIB A;  1T0F A;  5HDN A;  2B7E A;  2EPF A;  2CV1 A;  2RV8 A;  1GHC A;  4A69 C;  3S1Q J;  3ZMZ A;  1YE9 A;  1AHD P;  3QRF F;  4BYY A;  4EV0 A;  2UXN A;  2DDB A;  3K4N A;  4OOI A;  2BBY A;  3B6A A;  4C9Y A;  2R5Y B;  3BC8 A;  5GPC A;  2A07 F;  2LDU A;  1XMX A;  2TDX A;  3IAM 2;  3W2W A;  5M3M J;  2XRO A;  2JA8 J;  3D5R C;  2UWM A;  1KQ9 A;  3A0B C;  4B1R A;  1WPK A;  5EYR A;  4V2G A;  4IHX A;  2BHY A;  1Z67 A;  2YU9 J;  3F8N A;  2CUF A;  2QSG X;  4CCJ A;  4FCY A;  2K9S A;  1L3L A;  1WJB A;  1PP7 U;  4M71 A;  3QOD A;  4KMU X;  4M6V A;  3HOS A;  4XN3 A;  5L3F A;  5LHI A;  5FD6 A;  3S3O A;  1CGP A;  4HAM A;  3RJP A;  2DI3 A;  2KMU A;  2KZG A;  3JRI A;  4V19 K;  2H6B A;  1YHQ I;  1N25 A;  4G94 A;  2GM4 A;  1FNN A;  1TNS A;  4ESJ A;  1HCR A;  2EZK A;  1APL C;  2VBW A;  1LDD A;  2F6C A;  2XPU A;  3KP4 A;  4OMZ A;  4IHY A;  2G7H A;  2VPL A;  1JKR C;  3PNV A;  2ZME C;  3Q0U A;  5A2Q K;  2HFH A;  2DU9 A;  1T33 A;  4NNJ A;  5KK1 A;  3MD2 A;  1ETX A;  1Y8R B;  1V5G A;  5FD5 A;  4BAC A;  1A35 A;  3W6K B;  1MBG A;  3LSI A;  3BG6 A;  4DBR A;  1VI0 A;  2LMD A;  2XAU A;  3U21 A;  2VQL A;  3DBR B;  3LAJ A;  4XKV A;  4W1U A;  4LK1 F;  3K2A A;  1WKM A;  2EFP A;  4C3J J;  4AD9 A;  1TLH B;  2QQB A;  2IAI A;  2VE9 A;  3D0S A;  1Y1V J;  2DMU A;  1DGW Y;  4PK4 A;  1ETO A;  3NRV A;  2CRG A;  5JFR A;  1IF1 A;  2L0K A;  2HVS A;  4L0Z B;  5JHF A;  2CUJ A;  3BZC A;  3RPU D;  5ICG A;  3E6B A;  1ULY A;  3HG9 A;  5FRO A;  2Y0S N;  4HLX A;  3C2B A;  5IP7 J;  1FSE A;  2IP2 A;  3V7R A;  2TRT A;  1MD0 A;  3JSO A;  1JUP A;  1MNM C;  2QVO A;  2EV6 A;  4NBQ A;  3HDD A;  1VTN C;  3ABT A;  1FPQ A;  3AL0 C;  1ON2 A;  3JRB A;  1HOM A;  1KQ0 A;  1D5Y A;  2M2E A;  2COM A;  2HGC A;  5FJ8 J;  1EF4 A;  2ISY A;  3JRG A;  1BC8 C;  4XLE A;  3ABM H;  2EFN A;  2GA2 A;  5JLX A;  2QSH X;  2L54 A;  4FE7 A;  3A03 A;  4A2U A;  1Z1D A;  3E7L A;  3HOX J;  1Z05 A;  1RPW A;  3J7A Y;  2XGC A;  1PUF B;  1V55 H;  2QEN A;  5GTH C;  4A3B J;  1WJ5 A;  3FBI B;  2FBK A;  1LVA A;  3HOY J;  3H5N A;  2F48 A;  3HBL A;  4LJZ F;  4RAF A;  2VJJ A;  3KEY A;  1RR7 A;  1ZKG A;  3S14 J;  3ZMD A;  4BE0 A;  1R7J A;  5D5V B;  3GEZ A;  3V8K A;  3ZMV A;  1ZHF A;  2DT7 B;  2BXZ A;  2EA2 A;  2I5U A;  1SAU A;  1XD7 A;  3VDX A;  4F7Z A;  2X6X A;  3Q9V A;  3OYD A;  1J2X A;  1MH4 A;  1K79 A;  4E7L A;  4AYB A;  5DM6 F;  1P6R A;  3L2R A;  4WX9 A;  4ENM A;  3ERE D;  4HBL A;  2M1B A;  2Z2S B;  3MZH A;  1P9Q C;  2CW7 A;  5CQE A;  4OWR B;  4I01 A;  1P4A A;  2E1C A;  5AIP A;  2X1C A;  3R60 A;  2E1O A;  2CUZ A;  1XDS A;  3T8R A;  5IT3 A;  3PQJ A;  1Q1V A;  1UST A;  4CGZ A;  3H0G J;  3HKZ N;  5B66 C;  2LY1 A;  3KEQ A;  4UUT A;  5IPA A;  1AOY A;  3MFK A;  3PIP F;  1DPR A;  2XIG A;  2PMZ N;  2UUZ A;  2WC2 A;  3CME I;  4MO7 A;  4ZYG A;  3VEP A;  3KEO A;  4E7I A;  1D1A A;  4X1E A;  4C3H J;  3V7C A;  4LK0 F;  3C1D A;  4NHJ A;  1X1C A;  1O3S A;  3CUO A;  1ZRC A;  3LQQ A;  2F5C A;  4DNC A;  5AIQ A;  3LSG A;  1MSE C;  4L5E A;  3ZQF A;  1J5Y A;  4G6T B;  1VQ8 I;  2CQX A;  1JHH A;  2R7Q A;  4AUX A;  1ON1 A;  3EDP A;  3M1E A;  5HLT A;  4BBR J;  2ISZ A;  3UNG C;  5K5R A;  4CCL A;  1SFU A;  1EA3 A;  2ME6 A;  4B48 A;  3OYG A;  2O3F A;  1B9N A;  1ZGW A;  1SD5 A;  1S72 I;  5IT9 K;  2DTR A;  2A6E F;  2FF4 A;  2EV5 A;  4PJJ A;  1ZLJ A;  5M5Y J;  4ENK A;  4HPQ A;  5L3E A;  2W4S A;  1X1B A;  2VJ4 A;  4MTE A;  2PBI A;  5D4R A;  4B3A A;  3E97 A;  1W7P B;  3P9I A;  3P9C A;  3V8L A;  4A12 A;  3W6J B;  2HQR A;  1J75 A;  3HEF A;  2W84 A;  3A02 A;  3HKZ A;  2M3A A;  1R5I D;  3AG4 H;  2N8G A;  2VQG A;  2G7U A;  4LOC A;  3NQO A;  2PMU A;  1IJW C;  5C44 J;  1MMD A;  4HSR A;  4XLN F;  4S0H B;  1JJ6 C;  1MMN A;  1WGX A;  2Z33 A;  1X1D A;  1IUY A;  1I3A A;  3DPT A;  4OIQ F;  1V5E A;  2PG4 A;  1S8N A;  1QGP A;  4MEY F;  3U2R A;  5IY5 H;  5D5U B;  1X19 A;  2FBH A;  3S3M A;  3DU6 A;  1S3J A;  3F3X A;  3I56 I;  2Y75 A;  1WWX A;  5H6Q A;  2IGN A;  1I3Q J;  1BW5 A;  1W7P A;  4ZTJ A;  2YU3 A;  2GA1 A;  1AKH B;  3MCZ A;  2AXT C;  2CU7 A;  2QQA A;  3N4M A;  2VON A;  1FMV A;  3OYC A;  3HRM A;  4IOC F;  2BW3 B;  2G0E A;  3SFI A;  2VKH A;  4I0B A;  1TT0 A;  2NVQ J;  2R7R A;  2O03 A;  1MJA A;  4IF4 A;  2CV0 A;  3J80 Z;  2H8R A;  1WSU A;  4HNT A;  1R58 A;  1WJC A;  4CXF A;  2HI3 A;  5HNH A;  4BXU A;  1IRF A;  2WB1 A;  2A6H F;  2MW8 A;  2IA2 A;  3ZMS A;  3H5R A;  4IO9 F;  2DQL A;  2DYS H;  5TJJ A;  5EEH A;  3AFH A;  1H9G A;  2VBZ A;  4PGH A;  2L4A A;  4IRH A;  3FXU A;  3HOW J;  4F92 B;  1RZ4 A;  5DD4 A;  5ILU A;  4FT8 A;  2FXA A;  1IDZ A;  1GVJ A;  1I5Z A;  1GXQ A;  4DZP A;  3LSH A;  2IS1 A;  4BE2 A;  2NXN B;  4HOB A;  2VXZ A;  1GDT A;  3ONQ A;  3CC4 I;  3GTK J;  4A0Y A;  2XAG A;  2VKD A;  4NB5 A;  2K85 A;  4PJ0 C;  5H2F C;  3T5X A;  4BHC A;  2PI0 A;  4ETS A;  5IYC J;  4HX4 A;  3QPT A;  3VYT B;  4BNC A;  3DTK A;  1U2W A;  3GLX A;  2ZXI A;  2Y2Z A;  3HXL A;  2LOO A;  4AIH A;  1I1S A;  1R1V A;  4J00 A;  2F5D A;  1HDP A;  4XON A;  3BR5 A;  2PMH A;  3BWG A;  4WF2 A;  4XQF A;  4E7H A;  2R0Q C;  1EKE A;  4MNU A;  2HNH A;  4CA0 A;  2ZNY A;  2X48 A;  3GFL A;  3VWB A;  2QA4 I;  2HQA A;  1U5T B;  3WOD F;  2JMW A;  2Z3Y A;  4ZDP A;  2DA5 A;  4M9X A;  3QP5 A;  4BUP A;  4IQ4 A;  4PJN A;  2RKH A;  4XKW A;  2Q2E B;  4CYC B;  2O6G E;  3F22 A;  2IT0 A;  1SMT A;  3KZI C;  4XSX F;  1VQM I;  2QYO A;  4MLO A;  2ETH A;  4GCV A;  2M4G A;  1TW3 A;  3BTJ A;  4LB6 B;  3S1M J;  4LD5 A;  2EIK H;  5HS8 A;  4MFE A;  4RLF A;  1MNE A;  2EIJ H;  4CCN A;  2IJL A;  1BL0 A;  2HR3 A;  3CUQ A;  1MJ9 A;  5DUK A;  1BI3 A;  1B8I B;  5EGO A;  5D5W B;  2QCO A;  3HC7 A;  5D6E A;  4Z2Y A;  3I71 A;  3ISP A;  3EYY A;  2CW0 F;  3OIP A;  1FMW A;  3I59 A;  3GF2 A;  3ZR8 X;  1YIJ I;  3WGG A;  3M1C A;  4Y3O A;  4KIS A;  4ZDO A;  5LBQ A;  4A0X A;  1FTZ A;  2HDC A;  2Q0O A;  2F4M B;  3T1B A;  4HG2 A;  3PUB A;  5BS6 A;  1LE8 B;  2V1U A;  3E6M A;  2E71 A;  3FXO A;  3JSP A;  2IPQ X;  3JCU C;  1IXR C;  3KX2 A;  2E34 A;  4R79 A;  2LLK A;  1WH7 A;  3M7G A;  4BHP A;  1K78 A;  3HGY A;  2DFH A;  4YFX F;  3CDH A;  4ZZL A;  4KN4 X;  1JT0 A;  1BA5 A;  2QBY B;  4NUB A;  2IVM A;  3DEW A;  3HOZ J;  3K4B A;  4B8X A;  2DTZ A;  1OYY A;  3W2V A;  3S2W A;  4HLY A;  1X2M A;  4ZDL A;  2VT2 A;  2WA0 A;  2GIZ A;  2JPB A;  2FD5 A;  3E1S A;  2LFB A;  2XV4 S;  3KLN A;  3OYI A;  5DYM A;  3KIO A;  4NC7 A;  4F52 A;  5FB2 A;  2A05 A;  3WTZ A;  3OYK A;  4XN0 A;  3OSF A;  3TGN A;  5LGN A;  1MMG A;  2X4H A;  4OIO F;  2R7W A;  2EJR A;  4RAZ A;  1ZTR A;  3S93 A;  3T8T A;  3HIF A;  4AM3 A;  2VQH A;  1JGS A;  4RBO A;  4A3M J;  1FBU A;  2XHK A;  1BIA A;  3ZMU A;  1IGN A;  1ETQ A;  1RKT A;  4ZH4 F;  3F8B A;  5L3D A;  4KMF A;  2X9D A;  3DEE A;  1HA8 A;  5D8K B;  2JUG A;  1BOA A;  1LDJ A;  2VOP A;  2I8D A;  4PSW A;  2NNY A;  4CZZ A;  3PSF A;  4YFK F;  2H27 A;  2CFX A;  5LHH A;  3D5L A;  3IWZ A;  4S05 A;  2FEZ A;  1XC5 A;  3U1K A;  3HGG A;  3KP2 A;  4GO1 A;  3EET A;  2VL8 A;  4ZYA A;  1VND A;  2DOD A;  2E7X A;  2O8X A;  4LLN A;  2FML A;  2RQP A;  3H3V K;  2OTJ I;  3K4M A;  4U0W A;  4AU7 A;  4RGR A;  2KRF A;  1DQU A;  2Y31 A;  1VQ4 I;  4RAG A;  3HUG B;  1X1P A;  3FXL A;  3GBG A;  3UKG A;  1JHF A;  2A6T A;  1Y8Q B;  5J6X A;  6PAX A;  5JHU A;  1KA8 A;  3PQK A;  3S2D J;  4I2O A;  4EM1 A; 
#chains in the Genus database with same CATH homology
 1YW7 A;  3WTT C;  3OOP A;  1JXS A;  4EM0 B;  4GYG A;  3M8F A;  1TQP A;  1ODD A;  3G73 A;  3FX3 A;  2Z9O A;  2CWE A;  2XGX A;  1ZGJ A;  3BZ6 A;  1FP1 D;  3R0J A;  1R00 A;  1MZB A;  3R6S A;  2JT1 A;  3ECH A;  5BOX A;  4G8X A;  1SFE A;  5HDK A;  1SD6 A;  3E5X A;  2P4W A;  5CLS A;  3ROU A;  1ZRF A;  1E2X A;  1ONV A;  5LRS A;  2RNJ A;  4IXA A;  3GWZ A;  5CVR A;  1YS6 A;  2HWV A;  1I6X A;  2DQR A;  1Y0U A;  3HRU A;  4KYW A;  5F64 A;  2AS5 F;  3TDZ C;  1ZRE A;  1XB4 A;  1ZH5 A;  3GX4 X;  2ZO4 A;  4N9I A;  1YLF A;  4I0A A;  2OAZ A;  1P4W A;  4HQM A;  5ICC A;  2B0L A;  1XGM A;  3VOD A;  1W7P D;  2VT3 A;  3HTS B;  1DPU A;  2HQN A;  1MGT A;  4L5J A;  3C3W A;  3HSR A;  1TBX A;  5IT9 Z;  1V3F A;  4OIR F;  3HRT A;  5DCF A;  3B73 A;  5L3C A;  1K78 B;  1P2F A;  4LMY A;  2DK8 A;  2NYX A;  2YX7 A;  3M8E A;  4GGG A;  4A5N A;  1XCB A;  4EQQ A;  3WTY C;  1W4M A;  2A68 F;  3FMQ A;  1HKQ A;  4I09 A;  2UXX A;  1FSH A;  4KIG A;  1XGN A;  4L9J A;  2ZME A;  1UFM A;  1LNW A;  3CO6 C;  3MQ0 A;  3QPH A;  2K27 A;  2ZBK A;  4RAY A;  3I53 A;  2EK5 A;  3WTU C;  3RYP A;  1U78 A;  2V6C A;  2DPD A;  2FNP A;  1ZG1 A;  2Q2E A;  4RS8 A;  2PFB A;  1BI2 A;  3QU3 A;  1RUO A;  3ZN1 A;  4EGY A;  1OYI A;  4IPA A;  4EMS A;  1QNT A;  3RI4 A;  1UCR A;  5DDG A;  1RI7 A;  3K2Z A;  4P5O A;  5F6F A;  5LGU A;  1STZ A;  2ESN A;  4HV6 A;  3TO9 A;  5FLX Z;  4JK1 X;  4I98 B;  2Q8K A;  2MH9 A;  4GYI A;  2MD5 A;  3T0Y A;  4U7B A;  3KCC A;  4Y17 A;  3IWF A;  1AWC A;  4K2E A;  2MLG A;  3O2P E;  3G3Z A;  5DEQ A;  2MC3 A;  3SFZ A;  3K1M A;  2H09 A;  3FHZ A;  2PJP A;  2DLL A;  5BMZ A;  3E6D A;  3SXY A;  3I4P A;  2YX4 A;  1LEA A;  1D5V A;  2K7L A;  3KZZ A;  5F1R A;  1Z7U A;  5LLQ A;  2HYG D;  2R7D A;  1U5T C;  4GXO A;  1G6N A;  4MTD A;  5KVR A;  2DAO A;  2F2E A;  3ZP5 A;  3FMR A;  4HQE A;  5HLH A;  1X3U A;  4CO8 A;  3H3Z A;  1XMK A;  3BJO A;  1TQM A;  2L02 A;  5BQT A;  1HST A;  1HW1 A;  3HHH A;  3I0T A;  1KU7 A;  2WV0 A;  4EJT A;  2W25 A;  3IL2 A;  4HX7 A;  4ZYE A;  2OQR A;  3HHG A;  2STT A;  1WRJ A;  4MGR A;  4BAY A;  1ZLK A;  4M74 A;  4BQA A;  1FT9 A;  4JQF A;  2YPR A;  4PGG A;  1ZG3 A;  3KE2 A;  4AWX B;  3F8C A;  2GXB A;  4LFU A;  3GO5 A;  2K4B A;  3WTX C;  2FSW A;  5HS9 A;  3J81 K;  2MH2 A;  4XLP F;  1O3Q A;  2CYY A;  2RGV A;  4UXN A;  3I58 A;  3IC7 A;  2K02 A;  4N9H A;  2CG4 A;  1GXP A;  1FZP B;  3M9A A;  5DD8 A;  2EA4 A;  5JR3 A;  1MJB A;  5CVJ A;  2FMY A;  2ADU A;  2A61 A;  4WK8 F;  2NS0 A;  3V7S A;  3GW2 A;  5TRD A;  1KU2 A;  4YFN F;  5DCM B;  3IRQ A;  3WTW C;  2HKX A;  1HSJ A;  5FLX K;  2ZFW A;  4KIC A;  3JTH A;  3C7J A;  3KP3 A;  2MBF A;  3R61 A;  1IXS B;  4ZYD A;  2M87 A;  4U7D A;  4HZF A;  3FXR A;  2L4M A;  4D0P A;  4YG2 F;  5LHG A;  1YS7 A;  2F5E A;  3JAM K;  3RKY A;  3TKY A;  2RN7 A;  4G7O F;  4XBF A;  2PN6 A;  3RTR A;  2HTJ A;  2EFW A;  4N0B A;  4KNY A;  2DBB A;  2IA1 A;  4UV9 A;  1EH6 A;  2P7C B;  4MQ9 F;  2VN2 A;  4EJU A;  3K1N A;  3PFI A;  2PEX A;  3KET A;  1FLI A;  4EJO A;  1MDM A;  1G3W A;  1BJA A;  2QUF A;  3TDU C;  1P4X A;  1O3T A;  3ABU A;  2NNN A;  3WU1 B;  4WXC A;  1BI1 A;  2G9W A;  1BN5 A;  1FYM A;  2AXL A;  3MWM A;  3U9G A;  4WXD A;  5FO5 A;  2C6Y A;  4RB1 A;  1U8R A;  2A5Y B;  2HS5 A;  5ERI A;  5J8C A;  2STW A;  4H0E A;  4HV5 A;  5FFZ A;  1YQA A;  1ZRD A;  3FM5 A;  3J81 Z;  3ZQ7 A;  4ESF A;  3ECO A;  5K5Q A;  2F5F A;  2P5V A;  3C18 A;  1RNL A;  3AAF A;  3EYI A;  3QP6 A;  4RB2 C;  1IXC A;  1HKT A;  4O3M A;  4HF1 A;  2A3S A;  2IA0 A;  1ZN2 A;  2M8E A;  1B9M A;  3GUD A;  1USS A;  5FGM A;  2XKO A;  4CHU A;  2OQG A;  4Q48 A;  3QU6 A;  3I64 A;  1HBX G;  2VOO A;  2OA4 A;  5CJ9 A;  2K86 A;  3DKW A;  1S7A A;  1QZZ A;  3R0A A;  5D6F A;  3B02 A;  4HA8 A;  4Q47 A;  1TW2 A;  4NQW A;  1UB9 A;  2M5W A;  3LA7 A;  4M9Z A;  3LWF A;  2VBX A;  2KIF A;  2P6T A;  2H94 A;  1IN7 A;  2XAJ A;  3K1P A;  3RDI A;  2VC0 A;  3RKX A;  2CO5 A;  2ZJ2 A;  2QLZ A;  3IRR A;  1LEB A;  1FC3 A;  3Q5F A;  2D2W A;  3BRO A;  1F4K A;  3LQR A;  4OU0 A;  1U3E M;  5LGT A;  4HF0 A;  2M45 A;  4UNO A;  3IKT A;  2GIV A;  1YO5 C;  5BPD A;  1K7A A;  1U5T A;  2V9V A;  3EQL F;  2V1D A;  2L3D A;  1XMA A;  2JPC A;  5D4S A;  2DO7 A;  2EFO A;  2M30 A;  1KYZ A;  3F6V A;  5HLI A;  2QZ8 A;  3K9T A;  3V8J A;  3SZP A;  2CGP A;  4IRG A;  5J8F A;  2YR2 A;  2EB7 A;  2ELH A;  3KFW X;  4L5I A;  4PZJ A;  3TOB A;  4E70 A;  3Q9S A;  3DP7 A;  5E8G A;  3RKW A;  4M9S A;  4A5M A;  3GFM A;  3LAP A;  4B09 A;  1QZY A;  3BJ6 A;  5CVU A;  2VBY A;  4HF2 A;  2IW5 A;  4WCG A;  3V4G A;  3MZY A;  2HKO A;  2XVC A;  2GXG A;  1J7K A;  3I5U A;  3L9F A;  1FBS A;  2ZKZ A;  4L0Y B;  4KN7 X;  1FOK A;  3CO7 C;  1FBQ A;  5JI6 A;  2MA3 A;  1OPC A;  3FWE A;  1OR7 A;  2DFI A;  4M6X A;  2W24 A;  1HXD A;  1XCV A;  4MQV A;  4FHT A;  2LF8 A;  1R36 A;  3JW4 A;  1IN8 A;  4G7Z F;  1XSV A;  1YW9 A;  2P5L C;  5ICE A;  1D3Y A;  1QQI A;  1XGS A;  1IW7 F;  5CVI A;  1R1U A;  5HLG A;  2W85 A;  1LJ9 A;  3TO6 A;  1FYL A;  3MAJ A;  2HZT A;  3TQN A;  5E1W A;  5LEK A;  1Z91 A;  4FX4 A;  1T2K A;  3F21 A;  2XKP A;  3EUH A;  3DF8 A;  4CDG A;  1BIB A;  1R23 A;  3WG9 A;  1IN5 A;  1XDU A;  2OU2 A;  3BPV A;  1RIO H;  4KFC A;  3BDD A;  3ZMT A;  1S7O A;  1F5T A;  2GWR A;  3RPQ A;  3GXO A;  1HW2 A;  3CJN A;  3GZ5 A;  1TQI A;  4OMY A;  3FXQ A;  1DUX C;  1XSD A;  1OKR A;  4YII A;  3SHF A;  2A69 F;  2HOE A;  4LG0 A;  2DW4 A;  1T6S A;  1ZGA A;  1R5G A;  4XSZ F;  1IZ1 A;  3GZ6 A;  3N97 A;  3DV8 A;  3F8M A;  5ILV A;  2JRT A;  1DDN A;  4Y13 A;  4RGU A;  1ZYR F;  1J0R A;  1SD4 A;  2E1N A;  5CVV A;  2WWY A;  5E1X A;  4LG0 B;  1G3S A;  3BPX A;  2V79 A;  2P6S A;  4L9V A;  1G4D A;  5EEG A;  4A6D A;  3JAM Z;  2R3S A;  5CYV A;  1UHM A;  3H92 A;  4L9T A;  1IAW A;  4EJV A;  2DPU A;  3WTS C;  4QLC U;  5HVQ C;  3LST A;  1T39 A;  1SMY F;  1E17 A;  3O3K A;  2ZME B;  1KQ8 A;  1DP7 P;  4QWQ A;  1SAX A;  3LA3 A;  3QOP A;  3ELK A;  1T38 A;  4WXH A;  2DT5 A;  4G6D A;  1SFX A;  2QWW A;  1QPM A;  5HS7 A;  5E17 F;  2NAZ A;  4BHB A;  1R5H A;  1FY7 A;  3CLO A;  4UV8 A;  4WWC A;  4AIK A;  4M72 A;  1ZAO A;  4A0Z A;  3HUG A;  5LRR A;  2FNA A;  4TV7 A;  3GFJ A;  4P9F A;  3L2C A;  1B59 A;  2FRH A;  4IVN A;  4L9N A;  3K0L A;  1EV7 A;  2HYF A;  4O6J A;  2J5P A;  4PCQ A;  5HOO A;  4ENN A;  2KJC A;  3K69 A;  3GFI A;  4EM2 A;  3P9K A;  2OBP A;  3OV8 A;  5ICF A;  3J7A O;  3QAH A;  5L3B A;  4Q4Z F;  4KDP A;  3KZY A;  2GAU A;  1D8J A;  3DXJ F;  3LA2 A;  1Q1H A;  3O6B B;  2Z99 A;  4KA4 A;  1V4R A;  1WQ2 A;  2X0L A;  2D45 A;  4LLG F;  1TTY A;  2OD5 A;  1XN7 A;  2JTV A;  1OMI A;  3HOT A;  1R1T A;  3BJA A;  1BM9 A;  3IKV A;  3WTV C;  3HRS A;  2HTS A;  1UHW A;  1YTY A;  2FA5 A;  3KP5 A;  4AVP A;  1MKM A;  3RPU A;  2JZY A;  2ACJ A;  3E5Q A;  2FBI A;  2CQK A;  1MDM B;  2IRF G;  2KJB A;  2D1H A;  5HDG A;  4LGW A;  5DUI A;  2ESH A;  3REO A;  5K1Y A;  4IRI A;  4ON0 A;  4ZYH A;  1O3R A;  3ZN0 A;  2LNB A;  2XAF A;  2MLK A;  4HDV A;  1G3Y A;  4M73 A;  3U1D A;  2PLY A;  5DCM A;  4HW0 A;  4R8H A;  1XSX A;  1Z6R A;  3ZPL A;  2FE3 A;  1YFH A;  4ZZD A;  4HYE A;  3DFG A;  5D5X B;  3COA C;  1O57 A;  3WE3 A;  2BE5 F;  5H6R A;  4ASN A;  3GVA A;  4P55 A;  4CIC A;  1QBJ A;  1YG2 A;  1RUN A;  1PDN C;  4UVA A;  2EV0 A;  2BEO A;  5LEJ A;  1F1Z A;  1KU9 A;  3WGH A;  2Z5U A;  4OIP F;  4EVI A;  2P7V B;  1I1G A;  1O7F A;  1PP8 F;  5L3G A;  3E5U A;  4UHT A;  4KUM A;  5DV5 A;  1QO0 D;  1S6L A;  2EWN A;  4UUV A;  1U6G A;  3BP8 A;  4G6Q A;  1Z6T A;  2RVC A;  1F9N A;  4RB3 C;  3SZT A;  2O61 A;  4U0Y A;  1JE8 A;  1P92 A;  1YW8 A;  1LQ1 A;  4U0V A;  1R22 A;  3CUQ B;  2OZ6 A;  5D8L B;  1YIO A;  4LB5 A;  3RYR A;  4MEX F;  1ZAR A;  4ESB A;  5JVT A;  4S04 A;  2BGC A;  2FQ3 A;  2H6C A;  5FFX A;  3VB2 A;  3NEU A;  2XAS A;  1KYW A;  3FMS A;  4JBA A;  2BYV E;  1HKS A;  4UVC A;  2LSO A;  2D1V A;  4KT5 C;  3J80 K;  2Y0M A;  1FYK A;  1W5S A;  3F72 A;  4L18 B;  4RB0 A;  3TOA A;  4EGZ A;  4XRF A;  2GQQ A;  5H20 A;  4IJA A;  3CUQ C;  1C0W A;  5E18 F;  1IN6 A;  3WE2 A;  2KIM A;  2R7F A;  3JTG A;  4OIN F;  4DQ2 A;  5K5O A;  5E8I A;  4MHG A;  5AON A;  2QQ9 A;  4M6Y A;  2VC1 A;  1B4A A;  2XRN A;  2XUB A;  1EH7 A;  2ZNZ A;  3DPL C;  1L0O C;  4RGS A;  4LLL A;  1KU3 A;  3I54 A;  3DQV C;  2EFQ A;  1FP2 A;  2HEO A;  3KP7 A;  2O0Y A;  2XAH A;  2V1X A;  1D8K A;  3F6O A;  2GZW A;  1REP C;  4IHS A;  2CSO A;  3E3V A;  4KIF A;  1K6O A;  1YYV A;  1H0M A;  4G7H F;  5BPI A;  4BH9 A;  1IN4 A;  1ZG5 A;  1O7L A;  3LFK A;  2RC4 A;  1NHA A;  4IHT A;  2JSC A;  4HX8 A;  3VFZ A;  1A04 A;  1EH8 A;  3L09 A;  3KP6 A;  1FWZ A;  5A2Q Z;  4I02 A;  2PQ8 A;  5E1Z B;  5ILS A;  2QBY A;  1J9I A;  3GYH X;  1CF7 A;  2ZCW A;  3IHU A;  5ED4 A;  3HSE A;  4RGX A;  1CF7 B;  4P9U A;  4UVB A;  2WTE A;  2VOD A;  1OYW A;  2ZXJ A;  4G9Y A;  2DK5 A;  4YIF A;  1XGO A;  2BV6 A;  1J59 A;  4I7H A;  3HYI A;  1H9T A;  3WGI A;  2E7W A;  3R4K A;  1LDK B;  2VE8 A;  2W57 A;  1S29 A;  3WU0 A;  3H3U A;  1T98 A;  3VOE A;  4Q5S F;  1HQC A;  3DEU A;  3BY6 A;  1KGS A;  3ULQ B;  1I27 A;  3CTA A;  1BI0 A;  1LB2 A;  4R1H A;  3HTU A;  1HW5 A;  2KKO A;  1IRG A;  4CYD A;  4U88 A;  4A6E A;  4AIJ A;  1WI9 A;  2K4J A;  1G3T A;  4PDK A;  1SD7 A;  1B1B A;  3F8F A;  3L00 A;  4FX0 A;  2UZK A;  2LKP A;  4O5V A;  3FZV A;  3FM3 A;  3ML6 A;  2P8T A;  4ENJ A;  2RDP A;  3E6C C;  2XAQ A;  3TO7 A;  3L7W A;  3KLO A;  2L01 A;  3RIR A;  1BC7 C;  4EJW A;  2FOK A;  3SQN A;  2J5O A;  3F23 A;  1FX7 A;  1Z9C A;  2P5K A;  4P96 A;  1TNT A;  4HDU A;  3I59 B;  2QM3 A;  1W5T A;  3HSF A;  3FF5 A;  5E20 A;  2NRA C;  4Y15 A;  2YSR A;  2KIU A;  1PUE E;  3MEX A;  2LF7 A;  3BOQ A;  3P7N A;  2OZU A;  1BBY A;  2FU4 A;  2Y48 A;  1B6A A;  4KIB A;  1T0F A;  5HDN A;  2RV8 A;  1GHC A;  3ZMZ A;  3QRF F;  4BYY A;  4EV0 A;  2UXN A;  4OOI A;  2BBY A;  2A07 F;  2LDU A;  2TDX A;  2XRO A;  2UWM A;  1KQ9 A;  3F8N A;  1L3L A;  1PP7 U;  4M71 A;  4KMU X;  3HOS A;  5L3F A;  5LHI A;  1CGP A;  5FD6 A;  4HAM A;  3RJP A;  2DI3 A;  2H6B A;  4G94 A;  1FNN A;  1TNS A;  4ESJ A;  2VBW A;  1LDD A;  3KP4 A;  4OMZ A;  2G7H A;  5A2Q K;  2HFH A;  2DU9 A;  5KK1 A;  5FD5 A;  3W6K B;  3LAJ A;  4LK1 F;  1WKM A;  2EFP A;  4AD9 A;  1TLH B;  2QQB A;  2VE9 A;  3D0S A;  5JFR A;  3NRV A;  1IF1 A;  4L0Z B;  5ICG A;  3E6B A;  1ULY A;  4HLX A;  1FSE A;  2IP2 A;  3V7R A;  1MD0 A;  3JSO A;  2QVO A;  2EV6 A;  1VTN C;  3ABT A;  1FPQ A;  1ON2 A;  1KQ0 A;  2COM A;  2HGC A;  2ISY A;  1BC8 C;  2EFN A;  2GA2 A;  2L54 A;  4A2U A;  1Z1D A;  1Z05 A;  2QEN A;  2FBK A;  1LVA A;  4LJZ F;  3ZMD A;  1R7J A;  5D5V B;  3GEZ A;  3V8K A;  3ZMV A;  1ZHF A;  2EA2 A;  1XD7 A;  4F7Z A;  3Q9V A;  1J2X A;  1K79 A;  1P6R A;  4WX9 A;  4ENM A;  3ERE D;  4HBL A;  2M1B A;  3MZH A;  4I01 A;  1P4A A;  2E1C A;  5AIP A;  3R60 A;  1XDS A;  3T8R A;  5IT3 A;  3PQJ A;  1UST A;  4CGZ A;  3KEQ A;  1AOY A;  3MFK A;  1DPR A;  2XIG A;  2WC2 A;  4ZYG A;  3VEP A;  3KEO A;  3V7C A;  4LK0 F;  3C1D A;  4NHJ A;  1O3S A;  3CUO A;  1ZRC A;  3LQQ A;  2F5C A;  4DNC A;  5AIQ A;  1J5Y A;  1JHH A;  1ON1 A;  3EDP A;  3M1E A;  2ISZ A;  5K5R A;  1SFU A;  2O3F A;  1B9N A;  1SD5 A;  5IT9 K;  2DTR A;  2A6E F;  2FF4 A;  2EV5 A;  1ZLJ A;  4ENK A;  5L3E A;  4MTE A;  5D4R A;  2PBI A;  3E97 A;  1W7P B;  3P9I A;  3P9C A;  3V8L A;  4A12 A;  3W6J B;  2HQR A;  1J75 A;  2W84 A;  2G7U A;  3NQO A;  2PMU A;  4XLN F;  2Z33 A;  1IUY A;  3DPT A;  4OIQ F;  2PG4 A;  1S8N A;  1QGP A;  4MEY F;  3U2R A;  5D5U B;  2FBH A;  1S3J A;  3F3X A;  2Y75 A;  1WWX A;  5H6Q A;  1W7P A;  2YU3 A;  2GA1 A;  3MCZ A;  2QQA A;  3N4M A;  2VON A;  3HRM A;  4I0B A;  2O03 A;  1MJA A;  4IF4 A;  3J80 Z;  1WSU A;  1R58 A;  4CXF A;  4BXU A;  1IRF A;  2A6H F;  2IA2 A;  3ZMS A;  2DQL A;  5TJJ A;  5EEH A;  1H9G A;  2VBZ A;  4PGH A;  2L4A A;  4IRH A;  3FXU A;  1RZ4 A;  5DD4 A;  5ILU A;  4FT8 A;  2FXA A;  1GVJ A;  1I5Z A;  1GXQ A;  4HOB A;  2VXZ A;  4A0Y A;  2XAG A;  4NB5 A;  3T5X A;  4BHC A;  2PI0 A;  4ETS A;  4HX4 A;  3QPT A;  4BNC A;  3GLX A;  1U2W A;  4AIH A;  1I1S A;  1R1V A;  2F5D A;  2PMH A;  3BWG A;  4WF2 A;  4MNU A;  2ZNY A;  3GFL A;  1U5T B;  3WOD F;  2Z3Y A;  4M9X A;  3QP5 A;  2RKH A;  2O6G E;  3F22 A;  2IT0 A;  1SMT A;  4XSX F;  2QYO A;  2ETH A;  4GCV A;  1TW3 A;  4LB6 B;  4LD5 A;  5HS8 A;  2IJL A;  2HR3 A;  3CUQ A;  1MJ9 A;  5DUK A;  1BI3 A;  5D5W B;  5D6E A;  4Z2Y A;  3I71 A;  3ISP A;  3EYY A;  2CW0 F;  3I59 A;  3GF2 A;  3WGG A;  5LBQ A;  4A0X A;  2HDC A;  2Q0O A;  2V1U A;  3T1B A;  5BS6 A;  3E6M A;  3JSP A;  2IPQ X;  1IXR C;  4R79 A;  3M7G A;  4BHP A;  1K78 A;  4YFX F;  3CDH A;  4ZZL A;  4KN4 X;  2QBY B;  2IVM A;  4B8X A;  1OYY A;  3S2W A;  4HLY A;  2VT2 A;  2JPB A;  2XV4 S;  3KLN A;  5DYM A;  5FB2 A;  3WTZ A;  3TGN A;  5LGN A;  2X4H A;  4OIO F;  2EJR A;  4RAZ A;  3T8T A;  3HIF A;  1JGS A;  1FBU A;  2XHK A;  1BIA A;  3ZMU A;  4ZH4 F;  3F8B A;  5L3D A;  4KMF A;  5D8K B;  1BOA A;  1LDJ A;  2VOP A;  2NNY A;  4CZZ A;  4YFK F;  2H27 A;  2CFX A;  5LHH A;  3D5L A;  3IWZ A;  4S05 A;  2FEZ A;  4GO1 A;  3KP2 A;  3EET A;  2E7X A;  2O8X A;  4LLN A;  2FML A;  2RQP A;  4U0W A;  4RGR A;  2KRF A;  1JHF A;  5J6X A;  6PAX A;  5JHU A;  1KA8 A;  3PQK A;  4I2O A;  4EM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...