4LLNA

Crystal structure of s. aureus mepr-dna complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
137
structure length
137
Chain Sequence
FTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords MepR
publication title Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 50
structure length 137
sequence length 137
chains with identical sequence B, C, D, I, J
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4llnA00
4KIFA 2ZMEB 2MLGA 4Y15A 2HKXA 1ZRDA 1IAWA 1R58A 3KP5A 4U0WA 3IKVA 1Z05A 1FBQA 1FZPB 2M45A 3MFKA 5D8LB 5D5XB 3HSRA 2HEOA 1FYMA 2OA4A 2FBIA 1YS7A 3WU1B 1MJ9A 4LB6B 5TRDA 1J9IA 2UXXA 3QP6A 3REOA 4GYGA 3W6JB 2RVCA 3BWGA 5D6FA 2EB7A 1WKMA 1BI1A 3WU0A 3I59A 5HLHA 2CFXA 2HR3A 3I53A 1XMAA 3E6MA 5D4RA 1UCRA 1BI3A 1R5HA 2K4JA 4HDVA 2GZWA 3ROUA 1G6NA 1SD7A 3BP8A 3GWZA 5HS7A 3MZHA 5FFZA 2DPDA 2OU2A 4GO1A 1ZARA 2XAQA 3LFKA 1R5GA 2P7VB 2JSCA 4LFUA 1D8JA 4ZYHA 2A69F 4RB1A 2P5KA 2RKHA 3ABUA 1XSXA 4UVBA 4HQMA 5DCFA 1F9NA 2MH2A 2QENA 4QWQA 1BI0A 4Y13A 2QWWA 5CLSA 1IXSB 4KICA 3IL2A 2XRNA 2M5WA 4CYDA 4MEYF 2RC4A 3DEUA 4ZYEA 1JHFA 2QLZA 1BIAA 2HQNA 4RAYA 1ON1A 1IN6A 2PEXA 5E20A 2AXLA 3I0TA 2DPUA 1KYZA 5FFXA 4HOBA 1DPUA 3QP5A 3I64A 4Q4ZF 1H9TA 2NS0A 4EJTA 3D0SA 2E7WA 2KJCA 3IC7A 1FBUA 1QBJA 2XKPA 5JVTA 1E2XA 2GQQA 2Z3YA 3LAJA 3BY6A 2ISYA 4CICA 1K78B 1OPCA 3BZ6A 2ISZA 1S29A 4ASNA 3VEPA 2A68F 1XMKA 3ABTA 1R7JA 2KIFA 2DAOA 2L54A 1LDKB 4CHUA 4KDPA 3E6BA 2ZNYA 3CO6C 3GFJA 4RB0A 3IHUA 4M6XA 4H0EA 1KQ8A 3L00A 2MC3A 1B59A 3HOSA 3RKWA 2FNPA 4OINF 1IN8A 1SMYF 3GLXA 2O03A 2V6CA 3FMSA 3T0YA 4EV0A 5AIPA 3ZN1A 1RZ4A 2KKOA 2KRFA 4A6EA 4ZYDA 3M1EA 2FU4A 4HYEA 3KEOA 1YS6A 1KGSA 2XAFA 1BC8C 4NQWA 3E5XA 5L3EA 2VT2A 1KU3A 4YIIA 2JPBA 3TGNA 1TNSA 3ZN0A 1RIOH 5JHUA 1YG2A 4BH9A 3WGHA 3T8RA 2EFOA 3LA3A 1FWZA 2XAHA 4ENNA 3PQJA 3RPUA 3IWFA 2YU3A 1H0MA 1OKRA 2RQPA 2OBPA 1U2WA 1OMIA 2CG4A 3RKXA 1J7KA 1PDNC 2PBIA 1MDMA 3VB2A 5HVQC 3V8KA 3GW2A 1MZBA 4RAZA 3RKYA 1K79A 3NRVA 3HSFA 4ESJA 1U78A 1V3FA 2JZYA 5E1XA 1ZG5A 5FLXK 4M6YA 2COMA 4IJAA 3CUQB 3PQKA 3F8CA 2H94A 3P7NA 5EEHA 3QAHA 4LGWA 4M71A 2EV0A 3RIRA 1TW3A 4Z2YA 5BPDA 3BJ6A 1IUYA 4WXCA 1SFUA 4KYWA 4A6DA 3FMRA 2VBWA 3T8TA 3ECHA 4IHTA 3F72A 4AIJA 4RGRA 5KVRA 2QUFA 3K1PA 4OOIA 5CVIA 3T5XA 5JR3A 2B0LA 2STTA 5HDGA 1HKSA 2DLLA 5HOOA 1Z9CA 2DT5A 4U7DA 3WGGA 3M9AA 4M9XA 2ZJ2A 3HHGA 4PCQA 1STZA 4ZYGA 2V79A 5LGUA 1TQIA 3P9IA 3KEQA 1D8KA 1FY7A 4XLPF 1TQMA 1QPMA 2LNBA 1O7FA 5FD6A 5J6XA 4HAMA 4KFCA 2G7UA 1Z1DA 2V1UA 2MBFA 5D5WB 4O5VA 1TBXA 4XSZF 2FA5A 3HTSB 2L4AA 3WTWC 3KP4A 2L4MA 3ZMSA 5DD4A 2Z9OA 1FSEA 2ZNZA 4AWXB 1WRJA 2IJLA 4WWCA 2V1XA 3HSEA 5L3CA 1Z6RA 3J81K 5L3DA 4ZZDA 1FPQA 3ISPA 3GEZA 3S2WA 3RJPA 2XASA 1R1VA 2JPCA 4L9TA 3K0LA 1GVJA 4UHTA 1SMTA 2WV0A 1J5YA 4CGZA 2HYFA 2R7FA 1PP8F 5LRSA 4L0ZB 1I27A 1W7PB 3Q5FA 1NHAA 3WGIA 3RPQA 2W57A 5CVJA 2YSRA 3LA2A 4EM2A 1D5VA 1OR7A 1LNWA 2OZUA 4KIGA 1P4AA 2DQLA 2RN7A 4PDKA 4LG0A 2EFQA 1O3QA 5JFRA 3IKTA 2XAGA 3BDDA 2CSOA 3VFZA 1ZRFA 1CF7B 1FYLA 4U0YA 3ZP5A 1EH7A 1UB9A 1W5TA 1UHMA 4ZH4F 2XROA 2FMYA 1QQIA 1QGPA 3F8FA 4UVAA 5ICFA 3DFGA 4ENMA 3V8JA 4KNYA 4RB2C 1CGPA 4P96A 3VOEA 4HBLA 4GGGA 3GFMA 3F6OA 2VONA 2G9WA 2VBXA 3U2RA 3IRRA 2WC2A 4AD9A 3U1DA 1EV7A 2P8TA 3NQOA 3ZMZA 3QRFF 3KP2A 3HRUA 4EJWA 1UHWA 2H09A 1R22A 2IVMA 2Z99A 1G3TA 4GCVA 5IT3A 1ZLJA 5AONA 5ILVA 3F6VA 2P6TA 4HV5A 3GYHX 4XRFA 4L9JA 2H6BA 2EA4A 2ETHA 1LB2A 3HOTA 5D5VB 2RNJA 3GZ6A 4L9VA 3ZMUA 2FNAA 3I59B 1FBSA 4OMYA 1MD0A 5A2QZ 1XGMA 2D2WA 2Z33A 1RNLA 4G94A 3I5UA 2BV6A 4IXAA 4WX9A 3KE2A 4CXFA 4G7HF 3CTAA 3VODA 3CDHA 1SFXA 1HSTA 2M30A 5ICGA 1XCVA 3WE3A 3K2ZA 5ERIA 4HF2A 4LLLA 3WODF 3KZYA 1QZZA 4KA4A 3R0JA 3MQ0A 2KIMA 5L3FA 2CWEA 1W5SA 1IRFA 4FX4A 1PP7U 4LLNA 2O0YA 2PQ8A 4EVIA 5BMZA 3QOPA 2PJPA 4YFNF 2K4BA 4KUMA 1GHCA 4HDUA 3LQQA 4L9NA 3BPVA 4WCGA 3KP6A 1TQPA 5HS9A 3QU3A 4B8XA 1ZREA 4PGGA 5ICEA 4UV8A 3HYIA 4A12A 3M7GA 3GXOA 2M87A 4KN4X 3GVAA 2ACJA 2BYVE 5H6RA 2QQ9A 2OZ6A 4RGUA 2PMHA 2A6EF 5HLGA 4G8XA 5LBQA 2QQAA 1VTNC 3C7JA 1I1GA 3F3XA 1K6OA 2STWA 2BEOA 5DCMA 3K69A 4ENJA 5A2QK 4HX7A 5BOXA 2M8EA 1TTYA 1FNNA 2D1VA 4N9IA 1J0RA 3R0AA 1B6AA 1ZYRF 2BE5F 4WK8F 4O3MA 5FB2A 3MEXA 3J80Z 3HIFA 2JTVA 5LGTA 4GYIA 1XDUA 3I58A 2M1BA 4UXNA 1DUXC 4WXDA 4AIHA 3U9GA 3OOPA 1PUEE 1E17A 2DFIA 2K27A 2GWRA 1SD6A 2GA2A 3GFLA 1XGOA 1IW7F 3BJAA 4UV9A 1YLFA 3H92A 3C18A 2NRAC 2FRHA 3F8MA 4F7ZA 1ZRCA 3JSPA 1IXRC 1DPRA 5DV5A 1Y0UA 1WWXA 4EM1A 4OIPF 2FMLA 4BQAA 2K86A 3SFZA 3FXUA 4LK0F 1OYIA 4YFKF 3FXQA 4JQFA 1SD4A 1MDMB 3GZ5A 5FO5A 4HA8A 2L02A 4Q48A 2IRFG 4RGSA 4FX0A 5ILSA 4I0AA 3L9FA 4CDGA 2RGVA 4I7HA 3J80K 3WTUC 2DBBA 4EJOA 1KQ9A 2MH9A 4U0VA 2EFWA 1O3TA 2FQ3A 4HQEA 1ZG1A 4B09A 1YQAA 1U3EM 4IRHA 1HW2A 2HFHA 2F5EA 5CJ9A 4WXHA 2W85A 1RI7A 2VC1A 5HDNA 5L3BA 3KETA 4ESBA 3KP7A 2VE8A 3Q9SA 1LDJA 5L3GA 3JW4A 1OYWA 4IVNA 2XUBA 2RV8A 3HHHA 3F22A 2P7CB 1YW7A 1FOKA 1ZN2A 4MQ9F 6PAXA 1XSVA 1GXPA 3BROA 5E8GA 1U5TA 4RB3C 3P9KA 2QZ8A 2L01A 1HBXG 4L0YB 2KIUA 1WSUA 2GAUA 5ED4A 2D1HA 2ZCWA 3KLOA 3I4PA 1KU7A 2UZKA 3DQVC 2XVCA 1LEAA 3J7AO 2VBYA 1JE8A 1LEBA 1J75A 1FT9A 2DTRA 1USSA 1QO0D 4LD5A 3V4GA 2FBHA 2VN2A 2IA0A 3IRQA 2P5VA 2W84A 3DF8A 2F2EA 2HS5A 1O57A 1W7PD 3HRMA 1WI9A 3K9TA 4A5MA 3SXYA 3WTZA 2E1NA 3DXJF 4RS8A 4MNUA 4G9YA 3COAC 1BBYA 2FBKA 1DP7P 4A5NA 1U5TC 1ZHFA 1KU9A 3HRSA 4FT8A 5LEJA 3GFIA 1J59A 1EH6A 1YO5C 1XGNA 3IWZA 3LWFA 4I0BA 2PN6A 3V7CA 4I01A 2QQBA 1ON2A 3SHFA 3F8BA 1HQCA 1MJAA 1ULYA 2CGPA 5HLIA 2F5CA 4R79A 2IA2A 3TKYA 2ADUA 5F64A 2OD5A 2R7DA 4I98B 4EMSA 1L3LA 4G6QA 4HV6A 4P55A 2LDUA 4I2OA 2R3SA 5ICCA 4LB5A 4DQ2A 2EA2A 3ELKA 5IT9Z 4LG0B 5LHIA 2UWMA 2E1CA 3CJNA 3GO5A 3F8NA 1KA8A 1T38A 1ONVA 2Q0OA 1KU2A 2PFBA 3TO9A 1G3YA 2EJRA 1O3SA 3W6KB 4L5IA 2L3DA 3KCCA 1O7LA 4LJZF 2XV4S 4Q47A 3TDUC 3DKWA 2CW0F 2ESNA 1K7AA 3F23A 3LQRA 1HKTA 5D5UB 2GA1A 4OIQF 1W4MA 1RUNA 3E5UA 3MWMA 1MGTA 2HKOA 2HTSA 2QM3A 3L7WA 2OAZA 3V8LA 2HTJA 4M9ZA 4HF1A 2K02A 2G7HA 4NB5A 1YTYA 3MCZA 2H27A 2QBYA 4LK1F 4E70A 3B02A 1S7AA 1FP2A 2F5DA 2IP2A 3P9CA 3LSTA 3LAPA 2NNYA 3WTTC 3RYRA 3I71A 4HX8A 4Y17A 2VODA 1S7OA 5IT9K 3NEUA 1BI2A 4YIFA 2IW5A 2GXGA 4L18B 2YR2A 1RUOA 4P5OA 5DUIA 4ENKA 4Q5SF 1P4WA 4EGYA 2W25A 5DUKA 4G7OF 5CVRA 1LVAA 2PG4A 3ZPLA 5DEQA 1T0FA 2XGXA 4KIBA 3WTSC 5LHHA 5HDKA 2P6SA 2O61A 5CVVA 4MHGA 4L5JA 5LHGA 2ZFWA 1XD7A 3KP3A 5LGNA 3WTXC 3TOBA 1V4RA 4KMUX 2EFPA 3FX3A 2YPRA 1T2KA 3L2CA 5LEKA 4KT5C 3OV8A 2OQRA 3E6CC 1JHHA 4EQQA 3EQLF 4G7ZF 3O6BB 3RTRA 4ZZLA 4PZJA 2XAJA 2ZMEA 1DDNA 5TJJA 2LKPA 4G6DA 3WTYC 1U6GA 1JXSA 5KK1A 1IN5A 1XGSA 4QLCU 4HW0A 2W24A 1MJBA 3BPXA 4IHSA 5CYVA 3D5LA 2H6CA 1IZ1A 5BQTA 2LF7A 5DCMB 3ML6A 4R8HA 1R1TA 5H6QA 2Q8KA 3TOAA 1AOYA 1B1BA 2OQGA 2RDPA 1R1UA 2DK5A 4YG2F 1FX7A 2Y48A 2CQKA 4U88A 4ESFA 1USTA 3FXRA 2P5LC 1XCBA 3TDZC 4OMZA 3FMQA 2EV5A 5EEGA 1ZGAA 5F6FA 3T1BA 1P4XA 4XBFA 3DPLC 4YFXF 2D45A 2EK5A 2Z5UA 4LMYA 4UUVA 3M8EA 2HWVA 4M74A 3TQNA 2O8XA 3CO7C 3WTVC 3R60A 4MGRA 3B73A 4UNOA 3TO6A 1JGSA 3EETA 1HXDA 2DQRA 2HZTA 1X3UA 3E97A 3N97A 1IN7A 4R1HA 4P9UA 3GF2A 1F1ZA 4HZFA 2E7XA 1Z7UA 1S6LA 3I54A 4DNCA 4S05A 4OIOF 2CYYA 2NYXA 2ZBKA 3MAJA 4K2EA 3K1NA 2QYOA 4GXOA 3TO7A 1B9NA 1T39A 1IXCA 2KJBA 4P9FA 1LQ1A 4HF0A 2HDCA 4M73A 3G3ZA 3R6SA 1U8RA 1T98A 2NAZA 2ESHA 5FLXZ 3FHZA 1MKMA 2DI3A 3KLNA 4S04A 2BGCA 5E17F 2V1DA 2X4HA 1G3WA 3FM3A 2LF8A 3BOQA 4LLGF 2WTEA 1FSHA 2Q2EA 2PMUA 4IRGA 3Q9VA 3R61A 1K78A 3HTUA 2MLKA 2O6GE 3SZTA 2DU9A 4IRIA 4BAYA 2QVOA 2A6HF 3RDIA 4I09A 4HX4A 5FD5A 3FZVA 4BHCA 1U5TB 1F4KA 1ZGJA 4IPAA 2DO7A 3C3WA 4EJVA 4O6JA 3ULQB 1ODDA 4A0XA 1IF1A 2J5OA 3O2PE 4OIRF 2FF4A 1S8NA 5K5QA 2ZO4A 1KYWA 3EYYA 2FXAA 2IA1A 2VT3A 3DV8A 1BJAA 2IPQX 1EH8A 3ZMDA 5J8FA 3G73A 2XKOA 3LA7A 3KFWX 4EGZA 3BJOA 1L0OC 3CUOA 3M8FA 5CVUA 2FE3A 1FLIA 4M9SA 1XSDA 1KQ0A 3SZPA 4I02A 2HQRA 2ELHA 5DDGA 5JI6A 4MQVA 1B4AA 2PLYA 4FHTA 4EJUA 1YW8A 1R36A 1P92A 2FEZA 1I6XA 1FYKA 3AAFA 1QZYA 1XDSA 1T6SA 5LLQA 5D4SA 3V7SA 2K7LA 3WE2A 4OU0A 2A61A 3JAMZ 1O3RA 1LDDA 2ZXJA 5AIQA 4TV7A 5DD8A 3GUDA 2HYGD 1F5TA 1LJ9A 2XHKA 2NNNA 1ZH5A 4U7BA 4MEXF 3H3ZA 4EM0B 1P2FA 2UXNA 3JTHA 3J81Z 3GX4X 2VOOA 3O3KA 3QU6A 2WWYA 2VOPA 5D6EA 2EWNA 1BIBA 1YW9A 3CUQA 1ZAOA 4MTDA 4CZZA 4UVCA 3EYIA 2FOKA 3H3UA 4A0ZA 1BC7C 1FP1D 4BNCA 2FSWA 1A04A 4N0BA 1SFEA 1OYYA 3ZQ7A 1C0WA 3PFIA 1R00A 5F1RA 3EDPA 4M72A 3JTGA 1I1SA 2V9VA 1H9GA 1G4DA 2X0LA 1Z91A 1HKQA 1YYVA 3ECOA 1XB4A 2MD5A 4AVPA 3F21A 1ZG3A 3DP7A 3QPHA 4JK1X 3QPTA 1SAXA 1HSJA 2J5PA 5H20A 4HLYA 5E18F 2LSOA 3V7RA 3JAMK 2PI0A 5K5OA 2ZKZA 4BHBA 2GIVA 2HOEA 1BN5A 3ZMVA 3CUQC 3DPTA 2A07F 2CO5A 2IT0A 4KMFA 1HW5A 5DYMA 4JBAA 4IF4A 1SD5A 2A3SA 1S3JA 3FF5A 1QNTA 4N9HA 1Z6TA 2A5YB 3ERED 4ETSA 4AIKA 4RGXA 1GXQA 1HW1A 3ZMTA 2F5FA 3HRTA 3RI4A 1XN7A 3SQNA 4CO8A 1TNTA 5K1YA 2VE9A 2QBYB 2BBYA 1Q1HA 1R23A 3CLOA 4XSXF 1TLHB 1AWCA 5E1WA 1B9MA 1BM9A 2HGCA 5FGMA 4BHPA 2P4WA 5BS6A 2C6YA 2AS5F 3R4KA 4MTEA 1J2XA 2YX4A 2DW4A 2O3FA 3FWEA 4PGHA 2Y0MA 5J8CA 5LRRA 4ON0A 1WQ2A 3E5QA 2XIGA 3RYPA 3MZYA 1IN4A 4XLNF 3C1DA 4BXUA 1REPC 5D8KB 3JSOA 1IRGA 3KZZA 3HUGA 1W7PA 1YIOA 1FC3A 3E6DA 2TDXA 1I5ZA 4HLXA 4A2UA 1TW2A 5HS8A 2YX7A 2JRTA 2EFNA 2Y75A 3EUHA 2DK8A 2EV6A 2VBZA 1P6RA 4WF2A 1G3SA 1BOAA 5ILUA 1UFMA 2VXZA 4D0PA 5K5RA 4A0YA 5BPIA 1CF7A 4NHJA 3K1MA 3L09A 4KN7X 3WG9A 1YFHA 5E1ZB 3FM5A 2VC0A 2JT1A 4BYYA 3E3VA 1ZLKA 2MA3A 5E8IA 3N4MA 1D3YA 2GXBA
chains in the Genus database with same CATH superfamily
4KIFA 2ZMEB 2E5ZA 3EUKL 2MLGA 2QF7A 3TW7A 1WVRA 4F55A 4Y15A 2HKXA 1ZRDA 1IAWA 1R58A 3KP5A 1GT0C 1QVTA 2WADA 4U0WA 3CP8A 5C4XJ 1GLNA 4XK4A 3IKVA 3QOEA 1Z05A 1WI3A 1FBQA 2KDOA 1E3HA 3RZDJ 1FZPB 1SVOA 1TC3C 2BY3A 2M45A 1ZQ3P 3MFKA 4FQGA 3KX2A 4PJ0C 3QODA 5D8LB 4HG2A 3IV5A 5D5XB 3HSRA 1VNDA 2HEOA 1FYMA 2OA4A 2FBIA 5FKKA 2JA5J 1K6YA 1UMQA 1YS7A 3WU1B 3EUHC 1MJ9A 4BY7J 4LB6B 5TRDA 3H35A 4G12A 1J9IA 2X6YA 2UXXA 2M4KA 3QP6A 3JRBA 3REOA 2F4MB 3BTJA 5EDNA 4GYGA 3W6JB 1BR4A 2RVCA 1IV6A 3CCSI 3BWGA 3TEDA 1YHQI 3ZQGA 2XGEA 5D6FA 1MNEA 5FROA 3CJRB 2YU9J 3VWBA 1X2MA 2DA5A 2I5UA 2EB7A 1WKMA 1HDDC 3BZKA 1D1AA 1BI1A 3WU0A 5J47A 3I59A 5HLHA 2CFXA 2HR3A 3I53A 1XMAA 3E6MA 3OIOA 1UCRA 5D4RA 1BI3A 2COBA 4Y7NJ 1R5HA 2K4JA 4HDVA 1Y8RB 2GZWA 3ROUA 1G6NA 4MFDA 1SD7A 3BP8A 3GWZA 5HS7A 4EATA 5GTHC 2K9QA 3MN2A 5FFZA 3MZHA 3QYFA 1WPKA 2DPDA 2IGMA 2OU2A 1ENHA 3K4MA 1ZARA 2XAQA 4GO1A 5FJ8J 3RPUD 4UUSB 3LFKA 1R5GA 2P7VB 3GTMJ 3OYKA 4YRVA 2NVQJ 2JSCA 4LFUA 1CQTA 2QSHX 1D8JA 4ZYHA 2A69F 1OCTC 2VJIA 1P7JA 3HB9A 2X1CA 4RB1A 2P5KA 2RKHA 5EYRA 2HU9A 3ABUA 1XSXA 4UVBA 4PK4A 1X3ZB 2K3FA 3ESWB 3AL0B 1PYVA 4HQMA 5DCFA 1NG6A 2VKVA 1D0ZA 1F9NA 4OWRB 1YRNB 5TGTA 2MH2A 2QENA 3A0HC 4QWQA 1BI0A 2QWWA 4Y13A 3HOVJ 5CLSA 1IXSB 4KICA 3IL2A 2XRNA 2M5WA 5M5XJ 4IHXA 4CYDA 4MEYF 2RC4A 3DEUA 4ZYEA 1JHFA 2QLZA 4F92B 1BIAA 1X1PA 2F6CA 2HQNA 5F04A 4RAYA 1ON1A 2XSJC 1IN6A 2PEXA 5E20A 2FOWA 3MZ8A 3CQZJ 2W00A 1XG1A 2OC6A 2AXLA 5F0CA 1YITI 3I0TA 2DPUA 1KYZA 4YELA 5FFXA 2IGNA 4HOBA 1DPUA 3QP5A 1GV2A 4PJMA 3I64A 2MFZA 1T95A 4Q4ZF 3OYBA 1H9TA 2NS0A 1NTCA 3S1RJ 4EJTA 3WHCA 3D0SA 2E7WA 2KJCA 1ZR4A 4FISA 1W1WE 3CCMI 3TP3A 3ABKH 3IC7A 1FBUA 1QBJA 1RC9A 3M07A 2W4SA 3GTJJ 2XKPA 3K4NA 1MMGA 5JVTA 1E2XA 1OFCX 2GQQA 2Z3YA 3LAJA 3BY6A 3PSIA 2ISYA 2CV2A 2CMPA 2Q2EB 4CCMA 4CICA 1K78B 1OPCA 2HVQA 3K4LA 1X1BA 3BZ6A 2ISZA 1S29A 4ASNA 4XIDA 1I3QJ 2QKLB 3VEPA 2A68F 1XMKA 4IQJA 3ABTA 5IOYA 1R7JA 2KIFA 2DAOA 2L54A 1LDKB 4CHUA 3OR2C 4DZPA 4KDPA 3E6BA 2ZNYA 3CO6C 1F36A 2ZXIA 3PNVA 1MIJA 3GFJA 1T56A 2R5YA 4RB0A 4ZDOA 3IHUA 4M6XA 2XAUA 4PJJA 3OWTA 1G8XA 4H0EA 1KQ8A 1JT6A 3L00A 1YX3A 2MC3A 1B59A 3HOSA 3RKWA 2FNPA 3HOXJ 1JKRC 4OINF 1S72I 1IN8A 1SMYF 1POGA 3GLXA 2O03A 2PJRA 2V6CA 3VYUB 1LFBA 1ZTRA 3FMSA 3T0YA 4EV0A 2EZKA 5AIPA 3ZN1A 1RZ4A 3HKZA 2KKOA 4XRSA 1X2NA 2KRFA 4A6EA 1APLC 4ZYDA 3M1EA 2FU4A 4HYEA 3KEOA 3UNGC 1NH3A 2VPRA 1YS6A 4GDFA 1KGSA 2XAFA 1TL8A 2R7SA 1BC8C 4NQWA 3E5XA 5L3EA 2IXSA 1KU3A 2VT2A 4BDYA 1NK2P 4YIIA 3GTOJ 2JPBA 1H88C 3TGNA 2DMUA 3W2AA 4A3DJ 2KPMA 1TNSA 3ONQA 3ZN0A 2E1MC 1RIOH 1WJFA 2KDZA 2VKHA 5JHUA 1YG2A 4BH9A 2WA0A 3T8RA 3WGHA 2EFOA 3H0DA 3LA3A 1FWZA 2XAHA 3BR5A 3PQJA 4ENNA 3RPUA 2ID3A 2X9DA 1H89C 3IWFA 2YU3A 1XS9A 2XF5A 1H0MA 1TZLA 1OKRA 2RQPA 1SVLA 1U2WA 2OBPA 1OMIA 3CC4I 2CG4A 3RKXA 4XQFA 1J7KA 1R9TJ 3LNQA 4RAFA 3H5RA 2W82A 1PDNC 2PBIA 4ABZA 1PVEA 1MDMA 3VB2A 4C9YA 5HVQC 2DFHA 1X3WB 2JQ7A 3V8KA 5FKOA 2VI6A 4NBQA 3GW2A 1SEUA 1MNDA 4A3EJ 2CJJA 1K61A 1MZBA 3D5SC 3IH3A 4RAZA 4V2FA 3VYTB 3RKYA 4CCLA 1SC7A 1K79A 3NRVA 1IDZA 1A6QA 3HSFA 4ESJA 1U78A 1V3FA 2LTPA 2JZYA 4PUSA 2HOSA 3K4CA 5E1XA 1A35A 4DBQA 1YJWI 1ZG5A 4B3AA 2EIMH 2KT0A 5FLXK 2DFFA 1N75A 4HPQA 4M6YA 1AKHA 5DM6F 2COMA 4IJAA 3CUQB 4X0GA 3PQKA 1OQYA 2E2JJ 5IYDJ 2EH3A 2K85A 3S2DJ 1YX5A 3F8CA 1H8AC 3ABMH 2DOFA 1DGWY 1ETXA 2H94A 2GM4A 2O7OA 3P7NA 5EEHA 4XLFA 3GTPJ 3QAHA 3HG9A 4LGWA 4M71A 2EV0A 4XKVA 3RIRA 1TW3A 3ZXSA 5M5WJ 2LKXA 4Z2YA 5BPDA 2L9SA 2XPUA 3BJ6A 1IUYA 2KRHA 4WXCA 1SFUA 4Y52J 2ID6A 4KYWA 2MABA 4A6DA 1R71A 3FMRA 2VBWA 2HVRA 4LOCA 3T8TA 5LD2C 3ECHA 2Z2SB 4IHTA 2NVUB 3F72A 4AIJA 3MKLA 1Y1WJ 4RGRA 5KVRA 2QUFA 3K1PA 2E71A 3L2VA 5IPAA 5GPAA 3LSIA 4OOIA 2R7VA 5CVIA 3T5XA 5JR3A 3CD6I 3Q0VA 2B0LA 5M3FJ 2STTA 5HNFA 3ZOBA 5HDGA 1HKSA 2DLLA 4IEJA 5HOOA 1Z9CA 4KISA 2MD0A 2DT5A 4U7DA 3WGGA 4AC0A 3M9AA 4M9XA 1ZK8A 2ZJ2A 2CQ7A 2V9PA 3HHGA 1OLTA 2R92J 2DYRH 4PCQA 1STZA 3U1KA 2V6EA 4ZYGA 2V79A 5LGUA 2LOOA 5KAIC 1TQIA 1V5EA 3P9IA 4A3CJ 2UUZA 3KEQA 1D8KA 3HKZN 2QKMB 1FY7A 2M7BA 5C44J 1MBKA 3AG1H 2QCOA 3I55I 4XLPF 1TQMA 3BG3A 2GBYA 3BLYA 3P5JA 3DTIA 1QPMA 2LNBA 1O7FA 2XSDC 5FD6A 4M6VA 5J6XA 4BS9A 4HAMA 3PUBA 4D7MA 4KFCA 2G7UA 3OYHA 1Z1DA 2V1UA 2MBFA 5D5WB 4XKCA 2BOLA 2NOJB 4O5VA 2YUSA 1GUUA 1TBXA 1TT5B 4XSZF 1K83J 2FA5A 2HI3A 3HTSB 1R6RA 2HZDA 3G1LA 2L4AA 1R4NB 2VQCA 1NG7A 1IJWC 5B3SH 3HM5A 3W2WA 3WTWC 3KP4A 3OYDA 2L4MA 3ZMSA 1ETQA 2LY2A 1V55H 5DD4A 2Z9OA 1I3AA 1FSEA 3A1YA 2ZNZA 4BXXJ 2LR8A 4AWXB 1WRJA 2IJLA 3A02A 2A05A 2PMZA 2V1XA 4WWCA 3HSEA 3FXLA 3ZQIA 2DOAA 2M0CA 3IP4B 5IY5H 5L3CA 1Z6RA 3J81K 1DGRM 1SVMA 2CQQA 2ECCA 5L3DA 4ZZDA 3S3MA 1FPQA 4JX5A 3ISPA 2XF6A 2CQNA 3OYFA 2Y0SA 3GEZA 2XPWA 2R93J 1Z77A 3S2WA 3RJPA 2XASA 2E2IJ 1BR2A 1R1VA 2JPCA 3LSRA 4L9TA 3K0LA 4H4KC 3OSGA 2FJ1A 1GVJA 4UHTA 2M8GX 1SMTA 4E7HA 1SAUA 3S1MJ 2KLOA 2WV0A 1J5YA 2ELKA 2FUG2 4CGZA 1AU7A 2HYFA 1EF4A 3E7LA 2R7FA 4XORA 1HA8A 1QZEA 1PP8F 5LRSA 2OJED 4BQNA 4L0ZB 1I27A 3S1NJ 3M1CA 4A3BJ 1QA6A 1U9NA 3HUGB 1W7PB 3Q5FA 4XL9A 1NHAA 3WGIA 3HDDA 3RPQA 2W57A 1V5GA 2BW3B 5CVJA 2YSRA 2LKSA 3LA2A 4EM2A 3UKGA 1D5VA 4U87A 3H5NA 4CYCB 3FK7A 3G6EI 3MKYB 1HOMA 4CH7A 1OR7A 1LNWA 2OZUA 4KIGA 1P4AA 2BXZA 2DQLA 2RN7A 4PDKA 2JWTA 3E1SA 3BR0A 1WH7A 3GTLJ 2LLKA 2X6WA 3QPSA 4LG0A 2EFQA 3O8HA 1O3QA 5JFRA 5IP9J 3IKTA 2XAGA 3BDDA 3J7AY 2Y30A 1ETYA 1T33A 1ETOA 1Y8QB 3DLLF 1A6IA 1W0TA 1IV8A 4CCKA 2CSOA 4MLOA 3VFZA 1ZRFA 1CF7B 3HC7A 1R4MB 1FYLA 3CCQI 2AXTC 4U0YA 1QPIA 2VASA 4BY1J 5EG0A 1EH7A 3ZP5A 3PNTA 1WJEA 1RPWA 2K9SA 1UB9A 2X85A 2IGOA 1W5TA 3ASNH 1KONA 1UHMA 4ZH4F 1R49A 3MKWB 2XROA 2FMYA 1QQIA 4D5FA 5GAGJ 2XB0X 5CQGA 1QGPA 3F8FA 3K4KA 3BCAA 4GFBA 2OV7A 4PJNA 2G0EA 4UVAA 5ICFA 5J4YA 3DFGA 4BU2A 1T8IA 4C3JJ 4ENMA 1ZGWA 1LE8A 3V8JA 3VYRB 3J7YJ 4KNYA 3DBRB 5B66C 2LYCA 4RB2C 1CGPA 3W2VA 4P96A 2M34A 3VOEA 1N78A 4HBLA 3CMYA 4GGGA 3GFMA 4HSRA 3BG7A 3F6OA 2VONA 2G9WA 2VBXA 3U2RA 3IRRA 2WC2A 3E0JB 3U1DA 4AD9A 4E7JA 1EV7A 2P8TA 3NQOA 3ZMZA 3QRFF 1JI8A 2OUMA 3KP2A 4HNVA 3HRUA 4G6TB 4J00A 4KITB 3HBLA 4EJWA 3K4BA 1UHWA 2H09A 4J01A 1R22A 3B6CA 1YIJI 2IVMA 1TWAJ 2Z99A 1E0EA 1QHHD 1OR7C 3ZRGA 1G3TA 4GCVA 3OL3A 5IT3A 4X6AJ 2KQRA 5F27A 1ZLJA 2O9LA 5AONA 5ILVA 3F6VA 2P6TA 4HV5A 3GYHX 4M3DA 2AHQA 1HF0A 4XRFA 3FXJA 2CUEA 5JHFA 2FX0A 3G4SI 5IYCJ 5K7HA 4L9JA 4UB6C 2H6BA 4XLAA 2PMZN 2CW8A 2EA4A 2ETHA 1LB2A 3SDBA 3HOTA 1X1CA 1SANA 5D5VB 4XNFA 2RNJA 3GZ6A 3G71I 2NVTJ 4L9VA 3ZMUA 2R7XA 3W6VA 2FNAA 3I59B 1I50J 1FBSA 4RA2A 2DXIA 2Y0SN 1MD0A 2V7FA 4OMYA 2KHMA 3DTKA 1XPXA 5A2QZ 1XGMA 2D2WA 2Z33A 1RNLA 4G94A 3I5UA 4FE7A 2BV6A 4IXAA 4WX9A 3KE2A 2X51A 2ME0A 2MYSA 4CXFA 3OS2A 4G7HF 4B4CA 2XGDA 4RLFA 3CTAA 3QYBA 3VODA 3MKZA 2HPMA 3CDHA 1SFXA 3TBIA 1HSTA 2M30A 4N4OB 5ICGA 4AVZA 1XCVA 3WE3A 3K2ZA 5ERIA 4HF2A 4LLLA 1JKOC 3FKJA 3WODF 3A03A 4BJTA 1VQ9I 3KZYA 2VQGA 4A3MJ 1QZZA 3K7AJ 2KZGA 4BDZA 4B3XA 3JRFA 4KA4A 4XOTA 4B1RA 3R0JA 4W1UA 3MQ0A 2R7RA 2AQEA 2KIMA 5L3FA 3K10A 2CWEA 4QPQA 2NOGA 1W5SA 2DFEA 1IRFA 4EEFG 4FX4A 1I6HJ 3BQZA 4ZDPA 1VQ4I 2LY9A 3H9JA 1PP7U 1YJ9I 4LLNA 2LP0A 2O0YA 2PQ8A 4EVIA 4BGDA 5BMZA 3QOPA 3QWLA 2PJPA 2RREA 4FTHA 4YFNF 2K4BA 4KUMA 1GHCA 2LRDA 4HDUA 3D5RC 1JJ6C 3LQQA 3MMYB 4L9NA 3BPVA 2R7ZJ 2WBMA 2ZXHA 5EGOA 4WCGA 3KP6A 1TQPA 4NDLA 4X1EA 5HS9A 3QU3A 1X1AA 2NVYJ 2BVMA 4B43A 4B8XA 1ZREA 5FKMA 4PGGA 3J7ZI 1JUPA 5ICEA 4UV8A 3HYIA 1FOWA 3K4JA 5F0FA 4CUGA 4A12A 2HQAA 3M7GA 1BL0A 3GXOA 2M87A 4KN4X 3GVAA 2ACJA 2BYVE 5EF6A 5H6RA 1YJNI 2QQ9A 2OZ6A 4RGUA 3HOYJ 3CC2I 2OCEA 5B1BH 4AM3A 2PMHA 3JREA 2A6EF 4QSHA 4NUBA 2QEXI 2KRCA 1OJLA 4NC7A 5HLGA 4BJ6C 4DGWB 4G8XA 1IDYA 5LBQA 2QQAA 5J40A 1VTNC 3C7JA 3FK6A 1MH4A 1I1GA 2R7OA 3F3XA 2HNHA 3PO2J 4A69C 1N25A 3JR9A 5JVGF 1K6OA 2STWA 2WAQA 4XLCA 4HNUA 2BEOA 5DCMA 3BTIA 4AIDA 2L9RA 3K69A 3PIOF 4ENJA 5A2QK 4HX7A 5BOXA 4ZTJA 4DYQA 2M8EA 1TTYA 2Y31A 3BTLA 1FNNA 2D1VA 2DJIA 1WJBA 4N9IA 1JKQC 4LIUA 1J0RA 2CUJA 2E5NA 3R0AA 4MO7A 4NNJA 1B6AA 1ZYRF 2BE5F 2JMWA 4RM2A 4WK8F 2ZJQF 3OOUA 4O3MA 1Z3XA 1IC8A 5FB2A 3CCYA 3MEXA 3OMYA 2R5YB 2EBIA 3J80Z 3HIFA 2DDAA 3BR3A 4IOCF 4IHYA 3S3OA 3M4OJ 5GP9A 1IUFA 2JTVA 5GTIC 1S7EA 5LGTA 4GYIA 1XDUA 3I58A 4DJAA 1ZR2A 2M1BA 3PIPF 2V4JC 4UXNA 5K7ZA 1DUXC 4WXDA 5IOZA 4AIHA 4V2GA 3U9GA 4Z6YA 3OOPA 3WU2C 1PUEE 3HPGA 2PJRB 1E17A 2DFIA 2Q1ZB 4A3JJ 2X1DA 4QIWN 2IBDA 1QU3A 2K27A 5H2FC 1SFOJ 2GWRA 3AG2H 1SD6A 2VQLA 2DA1A 2OPTA 2GA2A 1WH5A 3GFLA 1XGOA 1LKXA 5E3LA 1LPQA 4XKBA 3HZJA 1IW7F 3A01A 4NQWB 3BJAA 4BBRJ 4XOPA 4UV9A 1YLFA 4CA0A 3H92A 4LG3A 3BG6A 1BOBA 3C18A 2NRAC 2EZHA 2FRHA 2MG4A 4UB8C 3F8MA 4RDUA 3S15J 4F7ZA 4XMYA 1UELB 2ZXWH 3PFYA 3A0BC 4JX6A 1ZRCA 2M4GA 3JSPA 2VJJA 1IXRC 1DPRA 1WCMJ 4L5EA 2ZJRF 2MW8A 2ICWG 5DV5A 1Y0UA 1WWXA 4EM1A 3Q3SA 3DTEA 4OIPF 4CCNA 2FMLA 4BQAA 2V26A 3FXOA 3BTCA 2K86A 3GTGJ 3SFZA 3FXUA 3H0GJ 4BQOA 4LK0F 4UUTA 1OYIA 3Q0UA 4YFKF 3BCBA 3FXQA 1W36C 4JQFA 4Y4RA 4FASD 3SZGA 1SD4A 3OYMA 2HDDA 1MDMB 3GZ5A 5FO5A 4HA8A 2L02A 4Q48A 4HNTA 2MC4A 1PUFA 2IRFG 3I9V2 4RGSA 2JRMA 1D0XA 4FX0A 5ILSA 4RLQA 4I0AA 3L9FA 4CDGA 2RGVA 3CZ6A 4I7HA 3FBIB 2DBBA 2JVHA 3J80K 3WTUC 1TWCJ 3CCEI 4EJOA 3OSFA 1KQ9A 3HGGA 2MH9A 4U0VA 2EFWA 1O3TA 3PO3J 2FQ3A 3VSKA 4HQEA 1ZG1A 2TRTA 3DEWA 5EJCA 4B09A 1AKHB 1YQAA 2VUMJ 4N4NB 3SEQA 2KMUA 1U3EM 1Z21A 4IRHA 3OYEA 2QSGX 3WG7H 4BUPA 1HW2A 3NARA 2HFHA 2F5EA 2FD5A 5CJ9A 1VQLI 4WXHA 2W85A 3DLAA 2DA4A 2P81A 1RI7A 1B72A 2VC1A 2GIZA 5HDNA 5CKTA 3GTQJ 3W3CA 4ZYAA 4ZJZA 3CCUI 1VQ8I 3EUAA 5L3BA 3KETA 4XN0A 4ESBA 3KP7A 2XPVA 3FXMA 2VE8A 3Q9SA 2L7FP 3HXLA 3KYLA 3N05A 1LDJA 5L3GA 3JW4A 1OYWA 4IVNA 3V42A 2ELJA 2XUBA 3KYDB 2RV8A 3X2QH 3HHHA 2VKEA 3F22A 2P7CB 1YW7A 3H36A 1FOKA 1ZN2A 2WV1A 4MQ9F 6PAXA 4ZDLA 1XSVA 1GXPA 5GAHJ 1BA5A 3BROA 1LFUP 1ETVA 3HEFA 4XN3A 1U5TA 2DMQA 5E8GA 3P9KA 4RB3C 1MNMC 2CV0A 2QZ8A 2NS8A 2L01A 2WY7Q 1HBXG 4RAGA 2KIUA 4L0YB 1W0UA 1WSUA 1X1DA 1AA7A 2X1EA 3C2HA 4MFEA 2GAUA 2NVXJ 1XMXA 2D1HA 2ZCWA 3KLOA 5ED4A 1HC8A 3I4PA 5FKLA 4XRSG 2A5WA 2DCEA 2KISA 1KU7A 5GPCA 2UZKA 2DT6A 3DQVC 3EPZA 5FRMA 2TCTA 2XVCA 4E7KA 1LEAA 3J7AO 2VBYA 1JE8A 1LEBA 2R5ZA 3LMMA 4I76A 1J75A 1FT9A 4XR6A 1JTYA 2DTRA 3HPHA 1U0JA 2EILH 2WY8Q 1USSA 3F9KA 1WJDA 1QO0D 2CH0A 4LD5A 4BKXA 3RZOJ 3V4GA 2FBHA 3OYLA 2VN2A 1WZ2A 1P7IA 2IA0A 3IRQA 4BQQA 4V19K 2P5VA 2W84A 3ZQCA 2LREA 2CUFA 3GCMA 4IHWA 3DF8A 3LSHA 3FDYA 2F2EA 2HS5A 1O57A 1W7PD 3HRMA 1WI9A 3HGYA 3K9TA 4A5MA 3RKQA 3LSJA 2L2OA 3SXYA 3OYJA 4ZTFA 3WTZA 2VXDA 2E1NA 4DYCA 3DXJF 1QRYA 4RS8A 2AO9A 3B6AA 4MNUA 4A3FJ 2DT7B 4G9YA 3COAC 1BBYA 1ACIA 2FBKA 2RAEA 4E4HA 1DP7P 2WAEA 2E60A 3ABLH 2JJ7A 4A5NA 1U5TC 3S1QJ 1ZHFA 3BC8A 3HJEA 4IHVA 1KU9A 3KIOA 2K9NA 1MBHA 3HRSA 2DYSH 4FT8A 5LEJA 3SEZA 4A3KJ 3GFIA 2DMNA 3JRIA 1J59A 1EH6A 1YO5C 3OR1C 4HRIA 1XGNA 3IWZA 1FEXA 5IP7J 3LWFA 3SJMA 2I10A 4I0BA 5TISC 3OYAA 2PN6A 1X19A 3AFHA 1RR7A 3V7CA 3RQIA 3NWTA 4PSXA 4I01A 4BEHA 2L9VA 2QQBA 2ZJPF 4B47A 2ECBA 2LVSA 1FJLA 1ON2A 1DU6A 3SHFA 3F8BA 1HQCA 1MJAA 1WJ5A 1YI2I 5HODA 1ULYA 2CGPA 4BE2A 4E7ZA 4A93J 5HLIA 2H8WA 4IOAF 2F5CA 3NWSA 4R79A 2IA2A 2W48A 3TKYA 2ADUA 5F64A 2OD5A 2R7DA 1IG7A 4I98B 4EMSA 1L3LA 4G6QA 1VQ7I 4HV6A 2X6OA 1VQ6I 1ZKGA 4P55A 1GVDA 1TWGJ 1UG0A 1W5CC 2LDUA 5F08A 2MSYA 3FKIJ 4I2OA 2R3SA 5ICCA 4LB5A 4DQ2A 2EA2A 3ELKA 5GAEJ 3BQYA 5IT9Z 3CDIA 1UJ8A 4LG0B 4F3QA 5LHIA 2UWMA 2HYJA 2CS3A 2W1OA 2E1CA 3CJNA 3GO5A 4MIMA 1JUSA 2CU7A 3F8NA 3OYNA 1KA8A 1T38A 1ONVA 2Q0OA 2YS9A 1KU2A 2HPIA 2PFBA 3PJRA 3DU6A 3TO9A 1G3YA 3CDLA 5EG0B 2EJRA 2F4OB 2H8RA 1O3SA 3QQAA 4Y33A 3W6KB 3PSFA 4L5IA 3CMAI 4XRMA 2L3DA 1FIPA 4QPOA 3KCCA 2DMPA 1O7LA 2XF7A 3VDXA 4LJZF 2OTLI 3IH2A 2XV4S 3BG9A 4E6KG 5IP6A 4I99C 1WFXA 4Q47A 1MH3A 4XONA 3TDUC 1LE8B 3DKWA 2LBFA 1RR8C 2CW0F 1YOVB 2ESNA 1K7AA 3F23A 2E36A 3LQRA 2R7TA 1FOXA 1HKTA 1A31A 5D5UB 2GA1A 4A3GJ 3DKXA 5DS9A 4OIQF 1X4PA 1W4MA 1RUNA 3OYIA 3E5UA 3TW6A 3DKYA 2JUCA 3MWMA 1MGTA 3AG4H 2E2HJ 2GXAA 2HKOA 2HTSA 2XGCA 2EIJH 2QM3A 2DA7A 3L7WA 1D0YA 1TWHJ 2OAZA 4HSTA 2XC7A 2R7QA 2EIKH 4CCJA 2JA8J 3G1OA 3V8LA 2HTJA 4M9ZA 4YEJA 2FQ4A 2JK3A 2Y9YA 4HF1A 2K02A 1D5YA 2G7HA 4NB5A 1YTYA 3MCZA 5J1RA 2H27A 1MW7A 1B8IA 2QBYA 3CLQA 3HOZJ 4B44A 3HOUJ 4LK1F 4E70A 2VB6A 2K5CA 3B02A 4M3GA 1S7AA 2JUGA 3IAS2 1FP2A 2F5DA 2IP2A 5E3MA 3H9QA 4PFOA 3P9CA 3LSTA 3LAPA 1VQKI 4D9JA 2NNYA 3UR3C 3WTTC 3RYRA 3I71A 3PL8A 1OCCH 4HX8A 1DP3A 4Y17A 2VODA 1S7OA 5IT9K 1Y0NA 3NEUA 1BI2A 3RQ4A 4YIFA 2IW5A 4F91B 2GXGA 4XLEA 4L18B 2YR2A 1RUOA 4P5OA 2GLOA 2W7NA 1D1CA 5E79C 2JA6J 5DUIA 3I4MJ 3ZQFA 4ENKA 5FRNA 4Q5SF 3DBLB 1P4WA 2B63J 4EGYA 2W25A 3BR1A 5DUKA 1MMSA 4KJZA 3ZQQA 4G7OF 3A2KA 1D1BA 4S0HB 5CVRA 3CF2A 2HDWA 1LVAA 1IGNA 1WHUA 2PG4A 3TMOA 3ZPLA 2HOTA 3DPUA 5DEQA 3K70D 3OS1A 1T0FA 4DIQA 4I6ZA 2M2EA 2XGXA 3BR6A 4KIBA 3PM1A 5B1AH 3WTSC 5LHHA 1DU0A 3CC7I 5HDKA 2P6SA 2O61A 1S9HA 3L2UA 5CVVA 1FTZA 4MHGA 4DYRA 4L5JA 2VPLA 2CRGA 4ZC3A 5LHGA 2XB5A 2ZFWA 3JRAA 1G59A 1XD7A 3KP3A 2L7KA 4IQ4A 5LGNA 3WTXC 1S5LC 3TOBA 1V4RA 2P0WA 5FLVA 2OCCH 1DQUA 1TP4A 1U9OA 5HLTA 4KMUX 2EFPA 5C4JJ 3FX3A 2YPRA 3M8JA 1T2KA 5EGOB 3L2CA 5LEKA 1R5ID 1QVUA 1JKPC 4KT5C 1TWFJ 3OV8A 3FIWA 3H1CA 2OQRA 3E6CC 4BACA 1JHHA 1O4XA 4EQQA 3DCFA 2DDBA 2DTZA 3EQLF 4G7ZF 2LFBA 2WB1A 3O6BB 3RTRA 4ZZLA 3CCRI 1ORKA 4C30A 1AHDP 1NK3P 4PZJA 2R4GA 4IL6C 3AKZA 2XAJA 2ZMEA 1DDNA 3U21A 5TJJA 2LKPA 4G6DA 1X58A 2GOXB 3WTYC 1U6GA 2E1OA 4C2MJ 2JN6A 4F93B 1JXSA 5KK1A 3OIQA 2RNGA 1IN5A 3FBNB 1XGSA 4QLCU 4HW0A 3G2BA 2IGKA 1MJBA 2W24A 3BPXA 3VSLA 1RKTA 4IHSA 5CQEA 2VKDA 5CYVA 3D1NI 3D5LA 4JP0A 1OCZH 2H6CA 1IZ1A 4C3HJ 5BQTA 2LF7A 5DCMB 1T0FC 3DEEA 3ML6A 2K3PA 3CCVI 3LSGA 4R8HA 1R1TA 4YIRX 2VLAA 3I4NJ 4Y3OA 5H6QA 4IX7A 2Q8KA 3TOAA 1AOYA 3BG5A 1B1BA 2F48A 2OQGA 1ERDA 2HOAA 1WJAA 2HXIA 2KFDA 2RDPA 4D1QA 1R1UA 2DK5A 1A36A 4YG2F 5B5EC 1FX7A 2Y48A 2CQKA 4U88A 3BR2A 4PSWA 1BR1A 3OYCA 1Y6IA 4ESFA 1JTXA 1USTA 3FXRA 2M7AA 2P5LC 1XCBA 3TDZC 2K9MA 4II2A 3GTKJ 4OMZA 4E7SA 3FMQA 2KL4A 2EV5A 4UY8I 3G1MA 3ASOH 5M3MJ 1HCRA 2E1MB 2DA2A 5EEGA 3OIPA 1ZGAA 5F6FA 1RETA 2DA6A 3IUOA 2CW7A 1M1EB 3T1BA 2OF7A 2D5VA 1P4XA 2X48A 1MSFC 5FLMJ 2ZMEC 4XBFA 3DPLC 4YFXF 2H1KA 1RESA 1K4SA 2D45A 2B7EA 3L2WA 3CMMA 2AQFA 2EK5A 2Z5UA 5LFAA 4LMYA 4AYBA 3OS0A 2Z1DA 4UUVA 3M8EA 3SFIA 3A01B 1MMNA 4UUSA 2HWVA 4M74A 3TQNA 2O8XA 3CO7C 3WTVC 2E34A 3R60A 4MGRA 3B73A 2MGQA 2V9KA 2CV1A 3O8GA 4UNOA 4A3LJ 2XDVA 3TO6A 1JGSA 2ZFUA 4AUXA 4BE1A 3S2HJ 1EKEA 2M3AA 4M3BA 3EETA 1HXDA 2DQRA 2HZTA 1BW6A 2KIQA 1X3UA 3QPLA 3M3YJ 1ZELA 4DOZA 1YRNA 3E97A 3K6GA 3ZGKA 3N97A 1IO2A 1IN7A 4R1HA 3VPRA 4P9UA 1JT0A 2E19A 2CFOA 3GF2A 1F1ZA 3KZIC 2VQHA 4HZFA 2E7XA 1Z7UA 3CF5F 2IS6A 1S6LA 2VL8A 3I54A 2LH9A 4DNCA 1VQPI 3CCLI 4S05A 4LIVA 4OIOF 2CYYA 2NYXA 2ZBKA 3TL4X 3FHNA 2X6XA 4DBRA 3JCUC 2BY1A 3MAJA 1PUFB 3GMEA 2V1NA 4K2EA 3ERMA 3K1NA 2QYOA 4GXOA 2K9LA 3TO7A 2BZTA 4NC6A 1B9NA 2R7UA 9ANTA 3KEYA 1MSEC 2M0MA 1T39A 1IXCA 2Z16A 2KJBA 4P9FA 1LQ1A 5IYBJ 2DJNA 4HF0A 2HDCA 4M73A 3G3ZA 4JX4A 2WB1N 3R6SA 3CJQB 5DTDA 3KYCB 1U8RA 1T98A 1JUMA 3BT9A 1T08B 2NAZA 2HQ5A 2ESHA 5FLXZ 3FHZA 1MKMA 2KP6A 2DI3A 2CQXA 3KLNA 4S04A 2BGCA 3LL7A 2V1DA 5E17F 2X4HA 1G3WA 4OAYA 3FM3A 2LF8A 3BOQA 5JLXA 1WGXA 2H1LA 2WTEA 3PNYA 4LLGF 1B72B 1EJ9A 2HVSA 1FSHA 2Q2EA 2JA7J 2PMUA 4IRGA 3Q9VA 3R61A 5DM7F 1K78A 4IO9F 1N77A 3HTUA 2IS2A 2MLKA 5CPRB 2O6GE 1OCOH 3SZTA 2DU9A 3AL0C 4IRIA 4GRIA 4ITVA 4BAYA 2QVOA 1VF9A 2A6HF 3RDIA 3MD2A 1KZHA 5E3NA 3K70C 3S3NA 4I09A 4HX4A 2N8GA 1XTAA 3OY9A 4M3FA 5FD5A 3FZVA 2ZSHB 3ZR8X 4BHCA 1U5TB 4XLHA 1F4KA 1ZGJA 4IPAA 2XRLA 2DO7A 2EPFA 2L7ZA 3C3WA 3BZCA 4EJVA 1Y1VJ 3S16J 4O6JA 4D5CA 3ULQB 1VQOI 1ODDA 4A0XA 1IF1A 3HOWJ 5M5YJ 2J5OA 1HLVA 3O2PE 4OIRF 2FF4A 1S8NA 2WAQN 4OAZA 5K5QA 2ZO4A 1KYWA 4BE0A 2BHZA 3EYYA 2FXAA 2DOEA 1OCPA 1Q1VA 2IA1A 3NAUA 2E35A 2VT3A 3I3LA 2R5ZB 3DV8A 5J3LA 3H9GA 1BJAA 2BY2A 1EH8A 2IPQX 4RMNA 1RRJA 3ZMDA 2O8KA 5J8FA 3I56I 3G73A 2XKOA 1G2HA 3LA7A 3KFWX 4EGZA 3BJOA 1L0OC 3CUOA 1VI0A 3H3VK 3M8FA 4AYBN 5CVUA 2IEKA 4CZCA 2FE3A 1FLIA 5BNGA 4M9SA 1XSDA 1KQ0A 3SZPA 5HNHA 4I02A 2HQRA 1GDTA 3HL2A 2ELHA 5DDGA 5J1YA 5JI6A 4MQVA 1B4AA 2PLYA 3S17J 4FHTA 2L5QA 4EJUA 3JRGA 1F43A 1YW8A 3L2QA 1R36A 1P92A 2FEZA 3C2GA 1GV5A 1I6XA 1FYKA 2A6TA 2O5RA 3AAFA 1QZYA 1XDSA 1T6SA 2LMDA 5D4SA 5LLQA 3V7SA 3WHBA 4DW6A 3L1PA 2F5VA 3CJTB 4CSWA 2K7LA 4ANJA 4FETA 4RBOA 3SYTA 3WE2A 4OU0A 2A61A 3JAMZ 1IRXA 2OTJI 4AU7A 1O3RA 1Y39A 1LDDA 2ZXJA 5AIQA 4TV7A 5DD8A 3GUDA 2HYGD 1F5TA 3JRCA 5FKNA 3GLLA 1LJ9A 1VQNI 2EZIA 2XHKA 2NNNA 4E7LA 1ZH5A 1Y56A 4U7BA 1LVKA 1OISA 3H3ZA 4MEXF 5F0HA 4EM0B 1P2FA 1FMVA 2L9NA 2UXNA 3JTHA 3OYGA 3J81Z 3GX4X 2VOOA 1YE9A 3O3KA 3QU6A 2WWYA 4W97A 2ZC2A 2VOPA 5D6EA 2EWNA 2BXYA 1Z7LA 4F52A 1FIAA 1BIBA 1YW9A 1U8BA 2I8DA 4BEHB 2GOMA 3A4CA 3CUQA 4C2UA 4DZJA 1ZAOA 4MTDA 5C3EJ 4NC8A 4BL0B 1FTTA 4CZZA 2PX9A 4UVCA 3EYIA 4XKWA 2FOKA 3H3UA 4A0ZA 1BC7C 1FP1D 5JLWA 1VZ0A 4BNCA 3AG3H 2FSWA 1A04A 1V54H 2F4IA 2NXNB 3LSMA 4N0BA 1SFEA 3F0CA 2DA3A 1OYYA 3S8PA 3ZQ7A 1C0WA 3PFIA 1R00A 3LFUA 4C3IJ 5F1RA 3MVPA 3EDPA 4BBSJ 3FXKA 2IS1A 4M72A 3JTGA 1I1SA 3RSNA 1ITYA 1MBGA 2V9VA 2Y2ZA 1X4OA 1Z0XA 1H9GA 3DWLE 1G4DA 2X0LA 1Z91A 3GBGA 1HKQA 2IS4A 5E3OA 1YYVA 3C2BA 3ECOA 1XB4A 2MD5A 4AVPA 3F21A 1VQ5I 4D7NA 1Z67A 1ZG3A 3DP7A 3QPHA 4M3EA 1EA3A 4II3A 4E7IA 3H5AA 4JK1X 1UZCA 3FISA 3QPTA 1SAXA 1HSJA 3IH4A 2J5PA 3DU5A 2VIXA 5H20A 1FOYA 5KAFC 3GZNB 4HLYA 3RCOA 5E18F 2LSOA 3V7RA 3JAMK 1VQMI 2PI0A 3ZCOA 5K5OA 1BJZA 2JVGA 5EEAA 2ZKZA 3KPHA 4BJ5C 4BXFA 4BHBA 2GIVA 3S93A 2VJ4A 2LY1A 4IKFA 3JRHA 2HOEA 1BN5A 3ZMVA 3CUQC 5KHDA 3DPTA 1UHSA 2A07F 2CO5A 2LBFB 2IT0A 4KMFA 1RKWA 1ETWA 1SFKA 1HW5A 3DBHB 5DYMA 4JBAA 4J19A 4IF4A 2QA4I 1SD5A 1V5FA 4QTRA 1JJ8C 4FE4A 2A3SA 2DODA 1S3JA 3FF5A 1QNTA 4N9HA 1Z6TA 4CCOA 2A5YB 3ERED 4ETSA 1P9QC 4IZZA 1A5JA 3K2AA 1MBFA 2L7MP 4AIKA 2CUZA 3CESA 5GADJ 4RGXA 2DMTA 1GXQA 1HW1A 2BY0A 3ZMTA 2JA2A 2F5FA 3HRTA 1E3PA 3S32A 4XICA 1XN7A 3RI4A 2ZSIB 2BHYA 1MBEA 1TNTA 3SQNA 4CO8A 5K1YA 5KNLA 2VE9A 2LC2A 3JRDA 2QGUA 1B8IB 4B48A 2QBYB 1PJRA 2BBYA 1Q1HA 1MBJA 1JGGA 4A3IJ 1XX5A 1R23A 2M9HA 4LITA 2K40A 3CLOA 4PFPA 4XSXF 2EZLA 1TLHB 1UG2A 2Y9ZA 1AWCA 5E1WA 5KCMA 1B9MA 3LSKA 1UAAA 3IAM2 1BM9A 2IAIA 2HGCA 5FGMA 4BHPA 3L2RA 2P4WA 1XC5A 2LK2A 2QQ8A 4P1WA 2VJ5A 2DN0A 5BS6A 2C6YA 3PUFA 1QHGA 1ETKA 2AS5F 3R4KA 5J4VA 4MTEA 3TP0A 1J2XA 4FCYA 2HXOA 3LSPA 2YX4A 2DW4A 1FMWA 2LD5A 1E3OC 2O3FA 1OCRH 3FWEA 4PGHA 2Y0MA 5J8CA 5LRRA 1MMDA 1WQ2A 4ON0A 3E5QA 2XIGA 2ME6A 2R7WA 3RYPA 3MZYA 1IN4A 4XLNF 3SDGA 3C1DA 4BXUA 1REPC 5D8KB 3JSOA 2RQQA 4RM3A 1IRGA 3CMEI 4PJLA 3KZZA 3HUGA 1W7PA 2UV1A 4HEA2 1YIOA 2ZB9A 1FC3A 3E6DA 3CCJI 2TDXA 1J09A 1I5ZA 2EQRA 2BW3A 2Y69H 5F1JA 4HLXA 3Q0WA 1VFCA 3OL4A 4A2UA 1TW2A 5HS8A 1LUJB 1TT0A 4CYCA 2YX7A 5EZGA 2LG4A 2WAFA 4XM3A 1BW5A 2JRTA 5EZHA 2EFNA 2Y75A 1HDPA 3CP2A 2B9SA 3EUHA 1LFPA 2KZVA 2DK8A 2EV6A 2VBZA 4JYKA 3VYSB 1P6RA 4WF2A 3ZQHA 1Z3YA 1G3SA 1BOAA 2L0KA 2BVLA 5ILUA 1UFMA 2VXZA 5J1UA 3ZQLA 4D0PA 1WJCA 1I39A 2NS7A 5K5RA 4A0YA 5BPIA 1CF7A 4NHJA 3K1MA 3L09A 4KN7X 3WG9A 1MMAA 3LOCA 5E1ZB 1YFHA 3FM5A 2VC0A 2JSPA 2JT1A 1W36D 4BYYA 3QYEA 4JOMA 4KT6A 1K4TA 3E3VA 2QSFX 4C2TA 1IRZA 5K7FA 1ZLKA 2MA3A 5E8IA 2R0QC 3N4MA 3S14J 1D3YA 2GXBA 2EINH
chains in the Genus database with same CATH topology
4KIFA 2ZMEB 2MLGA 4Y15A 2HKXA 1ZRDA 1IAWA 1R58A 3KP5A 4U0WA 3IKVA 1Z05A 1FBQA 1FZPB 2M45A 3MFKA 5D8LB 5D5XB 3HSRA 2HEOA 1FYMA 2OA4A 2FBIA 1YS7A 3WU1B 1MJ9A 4LB6B 5TRDA 1J9IA 2UXXA 3QP6A 3REOA 4GYGA 3W6JB 2RVCA 3BWGA 5D6FA 2EB7A 1WKMA 1BI1A 3WU0A 3I59A 5HLHA 2CFXA 2HR3A 3I53A 1XMAA 3E6MA 5D4RA 1UCRA 1BI3A 1R5HA 2K4JA 4HDVA 2GZWA 3ROUA 1G6NA 1SD7A 3BP8A 3GWZA 5HS7A 3MZHA 5FFZA 2DPDA 2OU2A 4GO1A 1ZARA 2XAQA 3LFKA 1R5GA 2P7VB 2JSCA 4LFUA 1D8JA 4ZYHA 2A69F 4RB1A 2P5KA 2RKHA 3ABUA 1XSXA 4UVBA 4HQMA 5DCFA 1F9NA 2MH2A 2QENA 4QWQA 1BI0A 4Y13A 2QWWA 5CLSA 1IXSB 4KICA 3IL2A 2XRNA 2M5WA 4CYDA 4MEYF 2RC4A 3DEUA 4ZYEA 1JHFA 2QLZA 1BIAA 2HQNA 4RAYA 1ON1A 1IN6A 2PEXA 5E20A 2AXLA 3I0TA 2DPUA 1KYZA 5FFXA 4HOBA 1DPUA 3QP5A 3I64A 4Q4ZF 1H9TA 2NS0A 4EJTA 3D0SA 2E7WA 2KJCA 3IC7A 1FBUA 1QBJA 2XKPA 5JVTA 1E2XA 2GQQA 2Z3YA 3LAJA 3BY6A 2ISYA 4CICA 1K78B 1OPCA 3BZ6A 2ISZA 1S29A 4ASNA 3VEPA 2A68F 1XMKA 3ABTA 1R7JA 2KIFA 2DAOA 2L54A 1LDKB 4CHUA 4KDPA 3E6BA 2ZNYA 3CO6C 3GFJA 4RB0A 3IHUA 4M6XA 4H0EA 1KQ8A 3L00A 2MC3A 1B59A 3HOSA 3RKWA 2FNPA 4OINF 1IN8A 1SMYF 3GLXA 2O03A 2V6CA 3FMSA 3T0YA 4EV0A 5AIPA 3ZN1A 1RZ4A 2KKOA 2KRFA 4A6EA 4ZYDA 3M1EA 2FU4A 4HYEA 3KEOA 1YS6A 1KGSA 2XAFA 1BC8C 4NQWA 3E5XA 5L3EA 2VT2A 1KU3A 4YIIA 2JPBA 3TGNA 1TNSA 3ZN0A 1RIOH 5JHUA 1YG2A 4BH9A 3WGHA 3T8RA 2EFOA 3LA3A 1FWZA 2XAHA 4ENNA 3PQJA 3RPUA 3IWFA 2YU3A 1H0MA 1OKRA 2RQPA 2OBPA 1U2WA 1OMIA 2CG4A 3RKXA 1J7KA 1PDNC 2PBIA 1MDMA 3VB2A 5HVQC 3V8KA 3GW2A 1MZBA 4RAZA 3RKYA 1K79A 3NRVA 3HSFA 4ESJA 1U78A 1V3FA 2JZYA 5E1XA 1ZG5A 5FLXK 4M6YA 2COMA 4IJAA 3CUQB 3PQKA 3F8CA 2H94A 3P7NA 5EEHA 3QAHA 4LGWA 4M71A 2EV0A 3RIRA 1TW3A 4Z2YA 5BPDA 3BJ6A 1IUYA 4WXCA 1SFUA 4KYWA 4A6DA 3FMRA 2VBWA 3T8TA 3ECHA 4IHTA 3F72A 4AIJA 4RGRA 5KVRA 2QUFA 3K1PA 4OOIA 5CVIA 3T5XA 5JR3A 2B0LA 2STTA 5HDGA 1HKSA 2DLLA 5HOOA 1Z9CA 2DT5A 4U7DA 3WGGA 3M9AA 4M9XA 2ZJ2A 3HHGA 4PCQA 1STZA 4ZYGA 2V79A 5LGUA 1TQIA 3P9IA 3KEQA 1D8KA 1FY7A 4XLPF 1TQMA 1QPMA 2LNBA 1O7FA 5FD6A 5J6XA 4HAMA 4KFCA 2G7UA 1Z1DA 2V1UA 2MBFA 5D5WB 4O5VA 1TBXA 4XSZF 2FA5A 3HTSB 2L4AA 3WTWC 3KP4A 2L4MA 3ZMSA 5DD4A 2Z9OA 1FSEA 2ZNZA 4AWXB 1WRJA 2IJLA 4WWCA 2V1XA 3HSEA 5L3CA 1Z6RA 3J81K 5L3DA 4ZZDA 1FPQA 3ISPA 3GEZA 3S2WA 3RJPA 2XASA 1R1VA 2JPCA 4L9TA 3K0LA 1GVJA 4UHTA 1SMTA 2WV0A 1J5YA 4CGZA 2HYFA 2R7FA 1PP8F 5LRSA 4L0ZB 1I27A 1W7PB 3Q5FA 1NHAA 3WGIA 3RPQA 2W57A 5CVJA 2YSRA 3LA2A 4EM2A 1D5VA 1OR7A 1LNWA 2OZUA 4KIGA 1P4AA 2DQLA 2RN7A 4PDKA 4LG0A 2EFQA 1O3QA 5JFRA 3IKTA 2XAGA 3BDDA 2CSOA 3VFZA 1ZRFA 1CF7B 1FYLA 4U0YA 3ZP5A 1EH7A 1UB9A 1W5TA 1UHMA 4ZH4F 2XROA 2FMYA 1QQIA 1QGPA 3F8FA 4UVAA 5ICFA 3DFGA 4ENMA 3V8JA 4KNYA 4RB2C 1CGPA 4P96A 3VOEA 4HBLA 4GGGA 3GFMA 3F6OA 2VONA 2G9WA 2VBXA 3U2RA 3IRRA 2WC2A 4AD9A 3U1DA 1EV7A 2P8TA 3NQOA 3ZMZA 3QRFF 3KP2A 3HRUA 4EJWA 1UHWA 2H09A 1R22A 2IVMA 2Z99A 1G3TA 4GCVA 5IT3A 1ZLJA 5AONA 5ILVA 3F6VA 2P6TA 4HV5A 3GYHX 4XRFA 4L9JA 2H6BA 2EA4A 2ETHA 1LB2A 3HOTA 5D5VB 2RNJA 3GZ6A 4L9VA 3ZMUA 2FNAA 3I59B 1FBSA 4OMYA 1MD0A 5A2QZ 1XGMA 2D2WA 2Z33A 1RNLA 4G94A 3I5UA 2BV6A 4IXAA 4WX9A 3KE2A 4CXFA 4G7HF 3CTAA 3VODA 3CDHA 1SFXA 1HSTA 2M30A 5ICGA 1XCVA 3WE3A 3K2ZA 5ERIA 4HF2A 4LLLA 3WODF 3KZYA 1QZZA 4KA4A 3R0JA 3MQ0A 2KIMA 5L3FA 2CWEA 1W5SA 1IRFA 4FX4A 1PP7U 4LLNA 2O0YA 2PQ8A 4EVIA 5BMZA 3QOPA 2PJPA 4YFNF 2K4BA 4KUMA 1GHCA 4HDUA 3LQQA 4L9NA 3BPVA 4WCGA 3KP6A 1TQPA 5HS9A 3QU3A 4B8XA 1ZREA 4PGGA 5ICEA 4UV8A 3HYIA 4A12A 3M7GA 3GXOA 2M87A 4KN4X 3GVAA 2ACJA 2BYVE 5H6RA 2QQ9A 2OZ6A 4RGUA 2PMHA 2A6EF 5HLGA 4G8XA 5LBQA 2QQAA 1VTNC 3C7JA 1I1GA 3F3XA 1K6OA 2STWA 2BEOA 5DCMA 3K69A 4ENJA 5A2QK 4HX7A 5BOXA 2M8EA 1TTYA 1FNNA 2D1VA 4N9IA 1J0RA 3R0AA 1B6AA 1ZYRF 2BE5F 4WK8F 4O3MA 5FB2A 3MEXA 3J80Z 3HIFA 2JTVA 5LGTA 4GYIA 1XDUA 3I58A 2M1BA 4UXNA 1DUXC 4WXDA 4AIHA 3U9GA 3OOPA 1PUEE 1E17A 2DFIA 2K27A 2GWRA 1SD6A 2GA2A 3GFLA 1XGOA 1IW7F 3BJAA 4UV9A 1YLFA 3H92A 3C18A 2NRAC 2FRHA 3F8MA 4F7ZA 1ZRCA 3JSPA 1IXRC 1DPRA 5DV5A 1Y0UA 1WWXA 4EM1A 4OIPF 2FMLA 4BQAA 2K86A 3SFZA 3FXUA 4LK0F 1OYIA 4YFKF 3FXQA 4JQFA 1SD4A 1MDMB 3GZ5A 5FO5A 4HA8A 2L02A 4Q48A 2IRFG 4RGSA 4FX0A 5ILSA 4I0AA 3L9FA 4CDGA 2RGVA 4I7HA 3J80K 3WTUC 2DBBA 4EJOA 1KQ9A 2MH9A 4U0VA 2EFWA 1O3TA 2FQ3A 4HQEA 1ZG1A 4B09A 1YQAA 1U3EM 4IRHA 1HW2A 2HFHA 2F5EA 5CJ9A 4WXHA 2W85A 1RI7A 2VC1A 5HDNA 5L3BA 3KETA 4ESBA 3KP7A 2VE8A 3Q9SA 1LDJA 5L3GA 3JW4A 1OYWA 4IVNA 2XUBA 2RV8A 3HHHA 3F22A 2P7CB 1YW7A 1FOKA 1ZN2A 4MQ9F 6PAXA 1XSVA 1GXPA 3BROA 5E8GA 1U5TA 4RB3C 3P9KA 2QZ8A 2L01A 1HBXG 4L0YB 2KIUA 1WSUA 2GAUA 5ED4A 2D1HA 2ZCWA 3KLOA 3I4PA 1KU7A 2UZKA 3DQVC 2XVCA 1LEAA 3J7AO 2VBYA 1JE8A 1LEBA 1J75A 1FT9A 2DTRA 1USSA 1QO0D 4LD5A 3V4GA 2FBHA 2VN2A 2IA0A 3IRQA 2P5VA 2W84A 3DF8A 2F2EA 2HS5A 1O57A 1W7PD 3HRMA 1WI9A 3K9TA 4A5MA 3SXYA 3WTZA 2E1NA 3DXJF 4RS8A 4MNUA 4G9YA 3COAC 1BBYA 2FBKA 1DP7P 4A5NA 1U5TC 1ZHFA 1KU9A 3HRSA 4FT8A 5LEJA 3GFIA 1J59A 1EH6A 1YO5C 1XGNA 3IWZA 3LWFA 4I0BA 2PN6A 3V7CA 4I01A 2QQBA 1ON2A 3SHFA 3F8BA 1HQCA 1MJAA 1ULYA 2CGPA 5HLIA 2F5CA 4R79A 2IA2A 3TKYA 2ADUA 5F64A 2OD5A 2R7DA 4I98B 4EMSA 1L3LA 4G6QA 4HV6A 4P55A 2LDUA 4I2OA 2R3SA 5ICCA 4LB5A 4DQ2A 2EA2A 3ELKA 5IT9Z 4LG0B 5LHIA 2UWMA 2E1CA 3CJNA 3GO5A 3F8NA 1KA8A 1T38A 1ONVA 2Q0OA 1KU2A 2PFBA 3TO9A 1G3YA 2EJRA 1O3SA 3W6KB 4L5IA 2L3DA 3KCCA 1O7LA 4LJZF 2XV4S 4Q47A 3TDUC 3DKWA 2CW0F 2ESNA 1K7AA 3F23A 3LQRA 1HKTA 5D5UB 2GA1A 4OIQF 1W4MA 1RUNA 3E5UA 3MWMA 1MGTA 2HKOA 2HTSA 2QM3A 3L7WA 2OAZA 3V8LA 2HTJA 4M9ZA 4HF1A 2K02A 2G7HA 4NB5A 1YTYA 3MCZA 2H27A 2QBYA 4LK1F 4E70A 3B02A 1S7AA 1FP2A 2F5DA 2IP2A 3P9CA 3LSTA 3LAPA 2NNYA 3WTTC 3RYRA 3I71A 4HX8A 4Y17A 2VODA 1S7OA 5IT9K 3NEUA 1BI2A 4YIFA 2IW5A 2GXGA 4L18B 2YR2A 1RUOA 4P5OA 5DUIA 4ENKA 4Q5SF 1P4WA 4EGYA 2W25A 5DUKA 4G7OF 5CVRA 1LVAA 2PG4A 3ZPLA 5DEQA 1T0FA 2XGXA 4KIBA 3WTSC 5LHHA 5HDKA 2P6SA 2O61A 5CVVA 4MHGA 4L5JA 5LHGA 2ZFWA 1XD7A 3KP3A 5LGNA 3WTXC 3TOBA 1V4RA 4KMUX 2EFPA 3FX3A 2YPRA 1T2KA 3L2CA 5LEKA 4KT5C 3OV8A 2OQRA 3E6CC 1JHHA 4EQQA 3EQLF 4G7ZF 3O6BB 3RTRA 4ZZLA 4PZJA 2XAJA 2ZMEA 1DDNA 5TJJA 2LKPA 4G6DA 3WTYC 1U6GA 1JXSA 5KK1A 1IN5A 1XGSA 4QLCU 4HW0A 2W24A 1MJBA 3BPXA 4IHSA 5CYVA 3D5LA 2H6CA 1IZ1A 5BQTA 2LF7A 5DCMB 3ML6A 4R8HA 1R1TA 5H6QA 2Q8KA 3TOAA 1AOYA 1B1BA 2OQGA 2RDPA 1R1UA 2DK5A 4YG2F 1FX7A 2Y48A 2CQKA 4U88A 4ESFA 1USTA 3FXRA 2P5LC 1XCBA 3TDZC 4OMZA 3FMQA 2EV5A 5EEGA 1ZGAA 5F6FA 3T1BA 1P4XA 4XBFA 3DPLC 4YFXF 2D45A 2EK5A 2Z5UA 4LMYA 4UUVA 3M8EA 2HWVA 4M74A 3TQNA 2O8XA 3CO7C 3WTVC 3R60A 4MGRA 3B73A 4UNOA 3TO6A 1JGSA 3EETA 1HXDA 2DQRA 2HZTA 1X3UA 3E97A 3N97A 1IN7A 4R1HA 4P9UA 3GF2A 1F1ZA 4HZFA 2E7XA 1Z7UA 1S6LA 3I54A 4DNCA 4S05A 4OIOF 2CYYA 2NYXA 2ZBKA 3MAJA 4K2EA 3K1NA 2QYOA 4GXOA 3TO7A 1B9NA 1T39A 1IXCA 2KJBA 4P9FA 1LQ1A 4HF0A 2HDCA 4M73A 3G3ZA 3R6SA 1U8RA 1T98A 2NAZA 2ESHA 5FLXZ 3FHZA 1MKMA 2DI3A 3KLNA 4S04A 2BGCA 5E17F 2V1DA 2X4HA 1G3WA 3FM3A 2LF8A 3BOQA 4LLGF 2WTEA 1FSHA 2Q2EA 2PMUA 4IRGA 3Q9VA 3R61A 1K78A 3HTUA 2MLKA 2O6GE 3SZTA 2DU9A 4IRIA 4BAYA 2QVOA 2A6HF 3RDIA 4I09A 4HX4A 5FD5A 3FZVA 4BHCA 1U5TB 1F4KA 1ZGJA 4IPAA 2DO7A 3C3WA 4EJVA 4O6JA 3ULQB 1ODDA 4A0XA 1IF1A 2J5OA 3O2PE 4OIRF 2FF4A 1S8NA 5K5QA 2ZO4A 1KYWA 3EYYA 2FXAA 2IA1A 2VT3A 3DV8A 1BJAA 2IPQX 1EH8A 3ZMDA 5J8FA 3G73A 2XKOA 3LA7A 3KFWX 4EGZA 3BJOA 1L0OC 3CUOA 3M8FA 5CVUA 2FE3A 1FLIA 4M9SA 1XSDA 1KQ0A 3SZPA 4I02A 2HQRA 2ELHA 5DDGA 5JI6A 4MQVA 1B4AA 2PLYA 4FHTA 4EJUA 1YW8A 1R36A 1P92A 2FEZA 1I6XA 1FYKA 3AAFA 1QZYA 1XDSA 1T6SA 5LLQA 5D4SA 3V7SA 2K7LA 3WE2A 4OU0A 2A61A 3JAMZ 1O3RA 1LDDA 2ZXJA 5AIQA 4TV7A 5DD8A 3GUDA 2HYGD 1F5TA 1LJ9A 2XHKA 2NNNA 1ZH5A 4U7BA 4MEXF 3H3ZA 4EM0B 1P2FA 2UXNA 3JTHA 3J81Z 3GX4X 2VOOA 3O3KA 3QU6A 2WWYA 2VOPA 5D6EA 2EWNA 1BIBA 1YW9A 3CUQA 1ZAOA 4MTDA 4CZZA 4UVCA 3EYIA 2FOKA 3H3UA 4A0ZA 1BC7C 1FP1D 4BNCA 2FSWA 1A04A 4N0BA 1SFEA 1OYYA 3ZQ7A 1C0WA 3PFIA 1R00A 5F1RA 3EDPA 4M72A 3JTGA 1I1SA 2V9VA 1H9GA 1G4DA 2X0LA 1Z91A 1HKQA 1YYVA 3ECOA 1XB4A 2MD5A 4AVPA 3F21A 1ZG3A 3DP7A 3QPHA 4JK1X 3QPTA 1SAXA 1HSJA 2J5PA 5H20A 4HLYA 5E18F 2LSOA 3V7RA 3JAMK 2PI0A 5K5OA 2ZKZA 4BHBA 2GIVA 2HOEA 1BN5A 3ZMVA 3CUQC 3DPTA 2A07F 2CO5A 2IT0A 4KMFA 1HW5A 5DYMA 4JBAA 4IF4A 1SD5A 2A3SA 1S3JA 3FF5A 1QNTA 4N9HA 1Z6TA 2A5YB 3ERED 4ETSA 4AIKA 4RGXA 1GXQA 1HW1A 3ZMTA 2F5FA 3HRTA 3RI4A 1XN7A 3SQNA 4CO8A 1TNTA 5K1YA 2VE9A 2QBYB 2BBYA 1Q1HA 1R23A 3CLOA 4XSXF 1TLHB 1AWCA 5E1WA 1B9MA 1BM9A 2HGCA 5FGMA 4BHPA 2P4WA 5BS6A 2C6YA 2AS5F 3R4KA 4MTEA 1J2XA 2YX4A 2DW4A 2O3FA 3FWEA 4PGHA 2Y0MA 5J8CA 5LRRA 4ON0A 1WQ2A 3E5QA 2XIGA 3RYPA 3MZYA 1IN4A 4XLNF 3C1DA 4BXUA 1REPC 5D8KB 3JSOA 1IRGA 3KZZA 3HUGA 1W7PA 1YIOA 1FC3A 3E6DA 2TDXA 1I5ZA 4HLXA 4A2UA 1TW2A 5HS8A 2YX7A 2JRTA 2EFNA 2Y75A 3EUHA 2DK8A 2EV6A 2VBZA 1P6RA 4WF2A 1G3SA 1BOAA 5ILUA 1UFMA 2VXZA 4D0PA 5K5RA 4A0YA 5BPIA 1CF7A 4NHJA 3K1MA 3L09A 4KN7X 3WG9A 1YFHA 5E1ZB 3FM5A 2VC0A 2JT1A 4BYYA 3E3VA 1ZLKA 2MA3A 5E8IA 3N4MA 1D3YA 2GXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KIF A;  2ZME B;  2MLG A;  4Y15 A;  2HKX A;  1ZRD A;  1IAW A;  1R58 A;  3KP5 A;  4U0W A;  3IKV A;  1Z05 A;  1FBQ A;  1FZP B;  2M45 A;  3MFK A;  5D8L B;  5D5X B;  3HSR A;  2HEO A;  1FYM A;  2OA4 A;  2FBI A;  1YS7 A;  3WU1 B;  1MJ9 A;  4LB6 B;  5TRD A;  1J9I A;  2UXX A;  3QP6 A;  3REO A;  4GYG A;  3W6J B;  2RVC A;  3BWG A;  5D6F A;  2EB7 A;  1WKM A;  1BI1 A;  3WU0 A;  3I59 A;  5HLH A;  2CFX A;  2HR3 A;  3I53 A;  1XMA A;  3E6M A;  5D4R A;  1UCR A;  1BI3 A;  1R5H A;  2K4J A;  4HDV A;  2GZW A;  3ROU A;  1G6N A;  1SD7 A;  3BP8 A;  3GWZ A;  5HS7 A;  3MZH A;  5FFZ A;  2DPD A;  2OU2 A;  4GO1 A;  1ZAR A;  2XAQ A;  3LFK A;  1R5G A;  2P7V B;  2JSC A;  4LFU A;  1D8J A;  4ZYH A;  2A69 F;  4RB1 A;  2P5K A;  2RKH A;  3ABU A;  1XSX A;  4UVB A;  4HQM A;  5DCF A;  1F9N A;  2MH2 A;  2QEN A;  4QWQ A;  1BI0 A;  4Y13 A;  2QWW A;  5CLS A;  1IXS B;  4KIC A;  3IL2 A;  2XRN A;  2M5W A;  4CYD A;  4MEY F;  2RC4 A;  3DEU A;  4ZYE A;  1JHF A;  2QLZ A;  1BIA A;  2HQN A;  4RAY A;  1ON1 A;  1IN6 A;  2PEX A;  5E20 A;  2AXL A;  3I0T A;  2DPU A;  1KYZ A;  5FFX A;  4HOB A;  1DPU A;  3QP5 A;  3I64 A;  4Q4Z F;  1H9T A;  2NS0 A;  4EJT A;  3D0S A;  2E7W A;  2KJC A;  3IC7 A;  1FBU A;  1QBJ A;  2XKP A;  5JVT A;  1E2X A;  2GQQ A;  2Z3Y A;  3LAJ A;  3BY6 A;  2ISY A;  4CIC A;  1K78 B;  1OPC A;  3BZ6 A;  2ISZ A;  1S29 A;  4ASN A;  3VEP A;  2A68 F;  1XMK A;  3ABT A;  1R7J A;  2KIF A;  2DAO A;  2L54 A;  1LDK B;  4CHU A;  4KDP A;  3E6B A;  2ZNY A;  3CO6 C;  3GFJ A;  4RB0 A;  3IHU A;  4M6X A;  4H0E A;  1KQ8 A;  3L00 A;  2MC3 A;  1B59 A;  3HOS A;  3RKW A;  2FNP A;  4OIN F;  1IN8 A;  1SMY F;  3GLX A;  2O03 A;  2V6C A;  3FMS A;  3T0Y A;  4EV0 A;  5AIP A;  3ZN1 A;  1RZ4 A;  2KKO A;  2KRF A;  4A6E A;  4ZYD A;  3M1E A;  2FU4 A;  4HYE A;  3KEO A;  1YS6 A;  1KGS A;  2XAF A;  1BC8 C;  4NQW A;  3E5X A;  5L3E A;  2VT2 A;  1KU3 A;  4YII A;  2JPB A;  3TGN A;  1TNS A;  3ZN0 A;  1RIO H;  5JHU A;  1YG2 A;  4BH9 A;  3WGH A;  3T8R A;  2EFO A;  3LA3 A;  1FWZ A;  2XAH A;  4ENN A;  3PQJ A;  3RPU A;  3IWF A;  2YU3 A;  1H0M A;  1OKR A;  2RQP A;  2OBP A;  1U2W A;  1OMI A;  2CG4 A;  3RKX A;  1J7K A;  1PDN C;  2PBI A;  1MDM A;  3VB2 A;  5HVQ C;  3V8K A;  3GW2 A;  1MZB A;  4RAZ A;  3RKY A;  1K79 A;  3NRV A;  3HSF A;  4ESJ A;  1U78 A;  1V3F A;  2JZY A;  5E1X A;  1ZG5 A;  5FLX K;  4M6Y A;  2COM A;  4IJA A;  3CUQ B;  3PQK A;  3F8C A;  2H94 A;  3P7N A;  5EEH A;  3QAH A;  4LGW A;  4M71 A;  2EV0 A;  3RIR A;  1TW3 A;  4Z2Y A;  5BPD A;  3BJ6 A;  1IUY A;  4WXC A;  1SFU A;  4KYW A;  4A6D A;  3FMR A;  2VBW A;  3T8T A;  3ECH A;  4IHT A;  3F72 A;  4AIJ A;  4RGR A;  5KVR A;  2QUF A;  3K1P A;  4OOI A;  5CVI A;  3T5X A;  5JR3 A;  2B0L A;  2STT A;  5HDG A;  1HKS A;  2DLL A;  5HOO A;  1Z9C A;  2DT5 A;  4U7D A;  3WGG A;  3M9A A;  4M9X A;  2ZJ2 A;  3HHG A;  4PCQ A;  1STZ A;  4ZYG A;  2V79 A;  5LGU A;  1TQI A;  3P9I A;  3KEQ A;  1D8K A;  1FY7 A;  4XLP F;  1TQM A;  1QPM A;  2LNB A;  1O7F A;  5FD6 A;  5J6X A;  4HAM A;  4KFC A;  2G7U A;  1Z1D A;  2V1U A;  2MBF A;  5D5W B;  4O5V A;  1TBX A;  4XSZ F;  2FA5 A;  3HTS B;  2L4A A;  3WTW C;  3KP4 A;  2L4M A;  3ZMS A;  5DD4 A;  2Z9O A;  1FSE A;  2ZNZ A;  4AWX B;  1WRJ A;  2IJL A;  4WWC A;  2V1X A;  3HSE A;  5L3C A;  1Z6R A;  3J81 K;  5L3D A;  4ZZD A;  1FPQ A;  3ISP A;  3GEZ A;  3S2W A;  3RJP A;  2XAS A;  1R1V A;  2JPC A;  4L9T A;  3K0L A;  1GVJ A;  4UHT A;  1SMT A;  2WV0 A;  1J5Y A;  4CGZ A;  2HYF A;  2R7F A;  1PP8 F;  5LRS A;  4L0Z B;  1I27 A;  1W7P B;  3Q5F A;  1NHA A;  3WGI A;  3RPQ A;  2W57 A;  5CVJ A;  2YSR A;  3LA2 A;  4EM2 A;  1D5V A;  1OR7 A;  1LNW A;  2OZU A;  4KIG A;  1P4A A;  2DQL A;  2RN7 A;  4PDK A;  4LG0 A;  2EFQ A;  1O3Q A;  5JFR A;  3IKT A;  2XAG A;  3BDD A;  2CSO A;  3VFZ A;  1ZRF A;  1CF7 B;  1FYL A;  4U0Y A;  3ZP5 A;  1EH7 A;  1UB9 A;  1W5T A;  1UHM A;  4ZH4 F;  2XRO A;  2FMY A;  1QQI A;  1QGP A;  3F8F A;  4UVA A;  5ICF A;  3DFG A;  4ENM A;  3V8J A;  4KNY A;  4RB2 C;  1CGP A;  4P96 A;  3VOE A;  4HBL A;  4GGG A;  3GFM A;  3F6O A;  2VON A;  2G9W A;  2VBX A;  3U2R A;  3IRR A;  2WC2 A;  4AD9 A;  3U1D A;  1EV7 A;  2P8T A;  3NQO A;  3ZMZ A;  3QRF F;  3KP2 A;  3HRU A;  4EJW A;  1UHW A;  2H09 A;  1R22 A;  2IVM A;  2Z99 A;  1G3T A;  4GCV A;  5IT3 A;  1ZLJ A;  5AON A;  5ILV A;  3F6V A;  2P6T A;  4HV5 A;  3GYH X;  4XRF A;  4L9J A;  2H6B A;  2EA4 A;  2ETH A;  1LB2 A;  3HOT A;  5D5V B;  2RNJ A;  3GZ6 A;  4L9V A;  3ZMU A;  2FNA A;  3I59 B;  1FBS A;  4OMY A;  1MD0 A;  5A2Q Z;  1XGM A;  2D2W A;  2Z33 A;  1RNL A;  4G94 A;  3I5U A;  2BV6 A;  4IXA A;  4WX9 A;  3KE2 A;  4CXF A;  4G7H F;  3CTA A;  3VOD A;  3CDH A;  1SFX A;  1HST A;  2M30 A;  5ICG A;  1XCV A;  3WE3 A;  3K2Z A;  5ERI A;  4HF2 A;  4LLL A;  3WOD F;  3KZY A;  1QZZ A;  4KA4 A;  3R0J A;  3MQ0 A;  2KIM A;  5L3F A;  2CWE A;  1W5S A;  1IRF A;  4FX4 A;  1PP7 U;  4LLN A;  2O0Y A;  2PQ8 A;  4EVI A;  5BMZ A;  3QOP A;  2PJP A;  4YFN F;  2K4B A;  4KUM A;  1GHC A;  4HDU A;  3LQQ A;  4L9N A;  3BPV A;  4WCG A;  3KP6 A;  1TQP A;  5HS9 A;  3QU3 A;  4B8X A;  1ZRE A;  4PGG A;  5ICE A;  4UV8 A;  3HYI A;  4A12 A;  3M7G A;  3GXO A;  2M87 A;  4KN4 X;  3GVA A;  2ACJ A;  2BYV E;  5H6R A;  2QQ9 A;  2OZ6 A;  4RGU A;  2PMH A;  2A6E F;  5HLG A;  4G8X A;  5LBQ A;  2QQA A;  1VTN C;  3C7J A;  1I1G A;  3F3X A;  1K6O A;  2STW A;  2BEO A;  5DCM A;  3K69 A;  4ENJ A;  5A2Q K;  4HX7 A;  5BOX A;  2M8E A;  1TTY A;  1FNN A;  2D1V A;  4N9I A;  1J0R A;  3R0A A;  1B6A A;  1ZYR F;  2BE5 F;  4WK8 F;  4O3M A;  5FB2 A;  3MEX A;  3J80 Z;  3HIF A;  2JTV A;  5LGT A;  4GYI A;  1XDU A;  3I58 A;  2M1B A;  4UXN A;  1DUX C;  4WXD A;  4AIH A;  3U9G A;  3OOP A;  1PUE E;  1E17 A;  2DFI A;  2K27 A;  2GWR A;  1SD6 A;  2GA2 A;  3GFL A;  1XGO A;  1IW7 F;  3BJA A;  4UV9 A;  1YLF A;  3H92 A;  3C18 A;  2NRA C;  2FRH A;  3F8M A;  4F7Z A;  1ZRC A;  3JSP A;  1IXR C;  1DPR A;  5DV5 A;  1Y0U A;  1WWX A;  4EM1 A;  4OIP F;  2FML A;  4BQA A;  2K86 A;  3SFZ A;  3FXU A;  4LK0 F;  1OYI A;  4YFK F;  3FXQ A;  4JQF A;  1SD4 A;  1MDM B;  3GZ5 A;  5FO5 A;  4HA8 A;  2L02 A;  4Q48 A;  2IRF G;  4RGS A;  4FX0 A;  5ILS A;  4I0A A;  3L9F A;  4CDG A;  2RGV A;  4I7H A;  3J80 K;  3WTU C;  2DBB A;  4EJO A;  1KQ9 A;  2MH9 A;  4U0V A;  2EFW A;  1O3T A;  2FQ3 A;  4HQE A;  1ZG1 A;  4B09 A;  1YQA A;  1U3E M;  4IRH A;  1HW2 A;  2HFH A;  2F5E A;  5CJ9 A;  4WXH A;  2W85 A;  1RI7 A;  2VC1 A;  5HDN A;  5L3B A;  3KET A;  4ESB A;  3KP7 A;  2VE8 A;  3Q9S A;  1LDJ A;  5L3G A;  3JW4 A;  1OYW A;  4IVN A;  2XUB A;  2RV8 A;  3HHH A;  3F22 A;  2P7C B;  1YW7 A;  1FOK A;  1ZN2 A;  4MQ9 F;  6PAX A;  1XSV A;  1GXP A;  3BRO A;  5E8G A;  1U5T A;  4RB3 C;  3P9K A;  2QZ8 A;  2L01 A;  1HBX G;  4L0Y B;  2KIU A;  1WSU A;  2GAU A;  5ED4 A;  2D1H A;  2ZCW A;  3KLO A;  3I4P A;  1KU7 A;  2UZK A;  3DQV C;  2XVC A;  1LEA A;  3J7A O;  2VBY A;  1JE8 A;  1LEB A;  1J75 A;  1FT9 A;  2DTR A;  1USS A;  1QO0 D;  4LD5 A;  3V4G A;  2FBH A;  2VN2 A;  2IA0 A;  3IRQ A;  2P5V A;  2W84 A;  3DF8 A;  2F2E A;  2HS5 A;  1O57 A;  1W7P D;  3HRM A;  1WI9 A;  3K9T A;  4A5M A;  3SXY A;  3WTZ A;  2E1N A;  3DXJ F;  4RS8 A;  4MNU A;  4G9Y A;  3COA C;  1BBY A;  2FBK A;  1DP7 P;  4A5N A;  1U5T C;  1ZHF A;  1KU9 A;  3HRS A;  4FT8 A;  5LEJ A;  3GFI A;  1J59 A;  1EH6 A;  1YO5 C;  1XGN A;  3IWZ A;  3LWF A;  4I0B A;  2PN6 A;  3V7C A;  4I01 A;  2QQB A;  1ON2 A;  3SHF A;  3F8B A;  1HQC A;  1MJA A;  1ULY A;  2CGP A;  5HLI A;  2F5C A;  4R79 A;  2IA2 A;  3TKY A;  2ADU A;  5F64 A;  2OD5 A;  2R7D A;  4I98 B;  4EMS A;  1L3L A;  4G6Q A;  4HV6 A;  4P55 A;  2LDU A;  4I2O A;  2R3S A;  5ICC A;  4LB5 A;  4DQ2 A;  2EA2 A;  3ELK A;  5IT9 Z;  4LG0 B;  5LHI A;  2UWM A;  2E1C A;  3CJN A;  3GO5 A;  3F8N A;  1KA8 A;  1T38 A;  1ONV A;  2Q0O A;  1KU2 A;  2PFB A;  3TO9 A;  1G3Y A;  2EJR A;  1O3S A;  3W6K B;  4L5I A;  2L3D A;  3KCC A;  1O7L A;  4LJZ F;  2XV4 S;  4Q47 A;  3TDU C;  3DKW A;  2CW0 F;  2ESN A;  1K7A A;  3F23 A;  3LQR A;  1HKT A;  5D5U B;  2GA1 A;  4OIQ F;  1W4M A;  1RUN A;  3E5U A;  3MWM A;  1MGT A;  2HKO A;  2HTS A;  2QM3 A;  3L7W A;  2OAZ A;  3V8L A;  2HTJ A;  4M9Z A;  4HF1 A;  2K02 A;  2G7H A;  4NB5 A;  1YTY A;  3MCZ A;  2H27 A;  2QBY A;  4LK1 F;  4E70 A;  3B02 A;  1S7A A;  1FP2 A;  2F5D A;  2IP2 A;  3P9C A;  3LST A;  3LAP A;  2NNY A;  3WTT C;  3RYR A;  3I71 A;  4HX8 A;  4Y17 A;  2VOD A;  1S7O A;  5IT9 K;  3NEU A;  1BI2 A;  4YIF A;  2IW5 A;  2GXG A;  4L18 B;  2YR2 A;  1RUO A;  4P5O A;  5DUI A;  4ENK A;  4Q5S F;  1P4W A;  4EGY A;  2W25 A;  5DUK A;  4G7O F;  5CVR A;  1LVA A;  2PG4 A;  3ZPL A;  5DEQ A;  1T0F A;  2XGX A;  4KIB A;  3WTS C;  5LHH A;  5HDK A;  2P6S A;  2O61 A;  5CVV A;  4MHG A;  4L5J A;  5LHG A;  2ZFW A;  1XD7 A;  3KP3 A;  5LGN A;  3WTX C;  3TOB A;  1V4R A;  4KMU X;  2EFP A;  3FX3 A;  2YPR A;  1T2K A;  3L2C A;  5LEK A;  4KT5 C;  3OV8 A;  2OQR A;  3E6C C;  1JHH A;  4EQQ A;  3EQL F;  4G7Z F;  3O6B B;  3RTR A;  4ZZL A;  4PZJ A;  2XAJ A;  2ZME A;  1DDN A;  5TJJ A;  2LKP A;  4G6D A;  3WTY C;  1U6G A;  1JXS A;  5KK1 A;  1IN5 A;  1XGS A;  4QLC U;  4HW0 A;  2W24 A;  1MJB A;  3BPX A;  4IHS A;  5CYV A;  3D5L A;  2H6C A;  1IZ1 A;  5BQT A;  2LF7 A;  5DCM B;  3ML6 A;  4R8H A;  1R1T A;  5H6Q A;  2Q8K A;  3TOA A;  1AOY A;  1B1B A;  2OQG A;  2RDP A;  1R1U A;  2DK5 A;  4YG2 F;  1FX7 A;  2Y48 A;  2CQK A;  4U88 A;  4ESF A;  1UST A;  3FXR A;  2P5L C;  1XCB A;  3TDZ C;  4OMZ A;  3FMQ A;  2EV5 A;  5EEG A;  1ZGA A;  5F6F A;  3T1B A;  1P4X A;  4XBF A;  3DPL C;  4YFX F;  2D45 A;  2EK5 A;  2Z5U A;  4LMY A;  4UUV A;  3M8E A;  2HWV A;  4M74 A;  3TQN A;  2O8X A;  3CO7 C;  3WTV C;  3R60 A;  4MGR A;  3B73 A;  4UNO A;  3TO6 A;  1JGS A;  3EET A;  1HXD A;  2DQR A;  2HZT A;  1X3U A;  3E97 A;  3N97 A;  1IN7 A;  4R1H A;  4P9U A;  3GF2 A;  1F1Z A;  4HZF A;  2E7X A;  1Z7U A;  1S6L A;  3I54 A;  4DNC A;  4S05 A;  4OIO F;  2CYY A;  2NYX A;  2ZBK A;  3MAJ A;  4K2E A;  3K1N A;  2QYO A;  4GXO A;  3TO7 A;  1B9N A;  1T39 A;  1IXC A;  2KJB A;  4P9F A;  1LQ1 A;  4HF0 A;  2HDC A;  4M73 A;  3G3Z A;  3R6S A;  1U8R A;  1T98 A;  2NAZ A;  2ESH A;  5FLX Z;  3FHZ A;  1MKM A;  2DI3 A;  3KLN A;  4S04 A;  2BGC A;  5E17 F;  2V1D A;  2X4H A;  1G3W A;  3FM3 A;  2LF8 A;  3BOQ A;  4LLG F;  2WTE A;  1FSH A;  2Q2E A;  2PMU A;  4IRG A;  3Q9V A;  3R61 A;  1K78 A;  3HTU A;  2MLK A;  2O6G E;  3SZT A;  2DU9 A;  4IRI A;  4BAY A;  2QVO A;  2A6H F;  3RDI A;  4I09 A;  4HX4 A;  5FD5 A;  3FZV A;  4BHC A;  1U5T B;  1F4K A;  1ZGJ A;  4IPA A;  2DO7 A;  3C3W A;  4EJV A;  4O6J A;  3ULQ B;  1ODD A;  4A0X A;  1IF1 A;  2J5O A;  3O2P E;  4OIR F;  2FF4 A;  1S8N A;  5K5Q A;  2ZO4 A;  1KYW A;  3EYY A;  2FXA A;  2IA1 A;  2VT3 A;  3DV8 A;  1BJA A;  2IPQ X;  1EH8 A;  3ZMD A;  5J8F A;  3G73 A;  2XKO A;  3LA7 A;  3KFW X;  4EGZ A;  3BJO A;  1L0O C;  3CUO A;  3M8F A;  5CVU A;  2FE3 A;  1FLI A;  4M9S A;  1XSD A;  1KQ0 A;  3SZP A;  4I02 A;  2HQR A;  2ELH A;  5DDG A;  5JI6 A;  4MQV A;  1B4A A;  2PLY A;  4FHT A;  4EJU A;  1YW8 A;  1R36 A;  1P92 A;  2FEZ A;  1I6X A;  1FYK A;  3AAF A;  1QZY A;  1XDS A;  1T6S A;  5LLQ A;  5D4S A;  3V7S A;  2K7L A;  3WE2 A;  4OU0 A;  2A61 A;  3JAM Z;  1O3R A;  1LDD A;  2ZXJ A;  5AIQ A;  4TV7 A;  5DD8 A;  3GUD A;  2HYG D;  1F5T A;  1LJ9 A;  2XHK A;  2NNN A;  1ZH5 A;  4U7B A;  4MEX F;  3H3Z A;  4EM0 B;  1P2F A;  2UXN A;  3JTH A;  3J81 Z;  3GX4 X;  2VOO A;  3O3K A;  3QU6 A;  2WWY A;  2VOP A;  5D6E A;  2EWN A;  1BIB A;  1YW9 A;  3CUQ A;  1ZAO A;  4MTD A;  4CZZ A;  4UVC A;  3EYI A;  2FOK A;  3H3U A;  4A0Z A;  1BC7 C;  1FP1 D;  4BNC A;  2FSW A;  1A04 A;  4N0B A;  1SFE A;  1OYY A;  3ZQ7 A;  1C0W A;  3PFI A;  1R00 A;  5F1R A;  3EDP A;  4M72 A;  3JTG A;  1I1S A;  2V9V A;  1H9G A;  1G4D A;  2X0L A;  1Z91 A;  1HKQ A;  1YYV A;  3ECO A;  1XB4 A;  2MD5 A;  4AVP A;  3F21 A;  1ZG3 A;  3DP7 A;  3QPH A;  4JK1 X;  3QPT A;  1SAX A;  1HSJ A;  2J5P A;  5H20 A;  4HLY A;  5E18 F;  2LSO A;  3V7R A;  3JAM K;  2PI0 A;  5K5O A;  2ZKZ A;  4BHB A;  2GIV A;  2HOE A;  1BN5 A;  3ZMV A;  3CUQ C;  3DPT A;  2A07 F;  2CO5 A;  2IT0 A;  4KMF A;  1HW5 A;  5DYM A;  4JBA A;  4IF4 A;  1SD5 A;  2A3S A;  1S3J A;  3FF5 A;  1QNT A;  4N9H A;  1Z6T A;  2A5Y B;  3ERE D;  4ETS A;  4AIK A;  4RGX A;  1GXQ A;  1HW1 A;  3ZMT A;  2F5F A;  3HRT A;  3RI4 A;  1XN7 A;  3SQN A;  4CO8 A;  1TNT A;  5K1Y A;  2VE9 A;  2QBY B;  2BBY A;  1Q1H A;  1R23 A;  3CLO A;  4XSX F;  1TLH B;  1AWC A;  5E1W A;  1B9M A;  1BM9 A;  2HGC A;  5FGM A;  4BHP A;  2P4W A;  5BS6 A;  2C6Y A;  2AS5 F;  3R4K A;  4MTE A;  1J2X A;  2YX4 A;  2DW4 A;  2O3F A;  3FWE A;  4PGH A;  2Y0M A;  5J8C A;  5LRR A;  4ON0 A;  1WQ2 A;  3E5Q A;  2XIG A;  3RYP A;  3MZY A;  1IN4 A;  4XLN F;  3C1D A;  4BXU A;  1REP C;  5D8K B;  3JSO A;  1IRG A;  3KZZ A;  3HUG A;  1W7P A;  1YIO A;  1FC3 A;  3E6D A;  2TDX A;  1I5Z A;  4HLX A;  4A2U A;  1TW2 A;  5HS8 A;  2YX7 A;  2JRT A;  2EFN A;  2Y75 A;  3EUH A;  2DK8 A;  2EV6 A;  2VBZ A;  1P6R A;  4WF2 A;  1G3S A;  1BOA A;  5ILU A;  1UFM A;  2VXZ A;  4D0P A;  5K5R A;  4A0Y A;  5BPI A;  1CF7 A;  4NHJ A;  3K1M A;  3L09 A;  4KN7 X;  3WG9 A;  1YFH A;  5E1Z B;  3FM5 A;  2VC0 A;  2JT1 A;  4BYY A;  3E3V A;  1ZLK A;  2MA3 A;  5E8I A;  3N4M A;  1D3Y A;  2GXB A; 
#chains in the Genus database with same CATH topology
 4KIF A;  2ZME B;  2E5Z A;  3EUK L;  2MLG A;  2QF7 A;  3TW7 A;  1WVR A;  4F55 A;  4Y15 A;  2HKX A;  1ZRD A;  1IAW A;  1R58 A;  3KP5 A;  1GT0 C;  1QVT A;  2WAD A;  4U0W A;  3CP8 A;  5C4X J;  1GLN A;  4XK4 A;  3IKV A;  3QOE A;  1Z05 A;  1WI3 A;  1FBQ A;  2KDO A;  1E3H A;  3RZD J;  1FZP B;  1SVO A;  1TC3 C;  2BY3 A;  2M45 A;  1ZQ3 P;  3MFK A;  4FQG A;  3KX2 A;  4PJ0 C;  3QOD A;  5D8L B;  4HG2 A;  3IV5 A;  5D5X B;  3HSR A;  1VND A;  2HEO A;  1FYM A;  2OA4 A;  2FBI A;  5FKK A;  2JA5 J;  1K6Y A;  1UMQ A;  1YS7 A;  3WU1 B;  3EUH C;  1MJ9 A;  4BY7 J;  4LB6 B;  5TRD A;  3H35 A;  4G12 A;  1J9I A;  2X6Y A;  2UXX A;  2M4K A;  3QP6 A;  3JRB A;  3REO A;  2F4M B;  3BTJ A;  5EDN A;  4GYG A;  3W6J B;  1BR4 A;  2RVC A;  1IV6 A;  3CCS I;  3BWG A;  3TED A;  1YHQ I;  3ZQG A;  2XGE A;  5D6F A;  1MNE A;  5FRO A;  3CJR B;  2YU9 J;  3VWB A;  1X2M A;  2DA5 A;  2I5U A;  2EB7 A;  1WKM A;  1HDD C;  3BZK A;  1D1A A;  1BI1 A;  3WU0 A;  5J47 A;  3I59 A;  5HLH A;  2CFX A;  2HR3 A;  3I53 A;  1XMA A;  3E6M A;  3OIO A;  1UCR A;  5D4R A;  1BI3 A;  2COB A;  4Y7N J;  1R5H A;  2K4J A;  4HDV A;  1Y8R B;  2GZW A;  3ROU A;  1G6N A;  4MFD A;  1SD7 A;  3BP8 A;  3GWZ A;  5HS7 A;  4EAT A;  5GTH C;  2K9Q A;  3MN2 A;  5FFZ A;  3MZH A;  3QYF A;  1WPK A;  2DPD A;  2IGM A;  2OU2 A;  1ENH A;  3K4M A;  1ZAR A;  2XAQ A;  4GO1 A;  5FJ8 J;  3RPU D;  4UUS B;  3LFK A;  1R5G A;  2P7V B;  3GTM J;  3OYK A;  4YRV A;  2NVQ J;  2JSC A;  4LFU A;  1CQT A;  2QSH X;  1D8J A;  4ZYH A;  2A69 F;  1OCT C;  2VJI A;  1P7J A;  3HB9 A;  2X1C A;  4RB1 A;  2P5K A;  2RKH A;  5EYR A;  2HU9 A;  3ABU A;  1XSX A;  4UVB A;  4PK4 A;  1X3Z B;  2K3F A;  3ESW B;  3AL0 B;  1PYV A;  4HQM A;  5DCF A;  1NG6 A;  2VKV A;  1D0Z A;  1F9N A;  4OWR B;  1YRN B;  5TGT A;  2MH2 A;  2QEN A;  3A0H C;  4QWQ A;  1BI0 A;  2QWW A;  4Y13 A;  3HOV J;  5CLS A;  1IXS B;  4KIC A;  3IL2 A;  2XRN A;  2M5W A;  5M5X J;  4IHX A;  4CYD A;  4MEY F;  2RC4 A;  3DEU A;  4ZYE A;  1JHF A;  2QLZ A;  4F92 B;  1BIA A;  1X1P A;  2F6C A;  2HQN A;  5F04 A;  4RAY A;  1ON1 A;  2XSJ C;  1IN6 A;  2PEX A;  5E20 A;  2FOW A;  3MZ8 A;  3CQZ J;  2W00 A;  1XG1 A;  2OC6 A;  2AXL A;  5F0C A;  1YIT I;  3I0T A;  2DPU A;  1KYZ A;  4YEL A;  5FFX A;  2IGN A;  4HOB A;  1DPU A;  3QP5 A;  1GV2 A;  4PJM A;  3I64 A;  2MFZ A;  1T95 A;  4Q4Z F;  3OYB A;  1H9T A;  2NS0 A;  1NTC A;  3S1R J;  4EJT A;  3WHC A;  3D0S A;  2E7W A;  2KJC A;  1ZR4 A;  4FIS A;  1W1W E;  3CCM I;  3TP3 A;  3ABK H;  3IC7 A;  1FBU A;  1QBJ A;  1RC9 A;  3M07 A;  2W4S A;  3GTJ J;  2XKP A;  3K4N A;  1MMG A;  5JVT A;  1E2X A;  1OFC X;  2GQQ A;  2Z3Y A;  3LAJ A;  3BY6 A;  3PSI A;  2ISY A;  2CV2 A;  2CMP A;  2Q2E B;  4CCM A;  4CIC A;  1K78 B;  1OPC A;  2HVQ A;  3K4L A;  1X1B A;  3BZ6 A;  2ISZ A;  1S29 A;  4ASN A;  4XID A;  1I3Q J;  2QKL B;  3VEP A;  2A68 F;  1XMK A;  4IQJ A;  3ABT A;  5IOY A;  1R7J A;  2KIF A;  2DAO A;  2L54 A;  1LDK B;  4CHU A;  3OR2 C;  4DZP A;  4KDP A;  3E6B A;  2ZNY A;  3CO6 C;  1F36 A;  2ZXI A;  3PNV A;  1MIJ A;  3GFJ A;  1T56 A;  2R5Y A;  4RB0 A;  4ZDO A;  3IHU A;  4M6X A;  2XAU A;  4PJJ A;  3OWT A;  1G8X A;  4H0E A;  1KQ8 A;  1JT6 A;  3L00 A;  1YX3 A;  2MC3 A;  1B59 A;  3HOS A;  3RKW A;  2FNP A;  3HOX J;  1JKR C;  4OIN F;  1S72 I;  1IN8 A;  1SMY F;  1POG A;  3GLX A;  2O03 A;  2PJR A;  2V6C A;  3VYU B;  1LFB A;  1ZTR A;  3FMS A;  3T0Y A;  4EV0 A;  2EZK A;  5AIP A;  3ZN1 A;  1RZ4 A;  3HKZ A;  2KKO A;  4XRS A;  1X2N A;  2KRF A;  4A6E A;  1APL C;  4ZYD A;  3M1E A;  2FU4 A;  4HYE A;  3KEO A;  3UNG C;  1NH3 A;  2VPR A;  1YS6 A;  4GDF A;  1KGS A;  2XAF A;  1TL8 A;  2R7S A;  1BC8 C;  4NQW A;  3E5X A;  5L3E A;  2IXS A;  1KU3 A;  2VT2 A;  4BDY A;  1NK2 P;  4YII A;  3GTO J;  2JPB A;  1H88 C;  3TGN A;  2DMU A;  3W2A A;  4A3D J;  2KPM A;  1TNS A;  3ONQ A;  3ZN0 A;  2E1M C;  1RIO H;  1WJF A;  2KDZ A;  2VKH A;  5JHU A;  1YG2 A;  4BH9 A;  2WA0 A;  3T8R A;  3WGH A;  2EFO A;  3H0D A;  3LA3 A;  1FWZ A;  2XAH A;  3BR5 A;  3PQJ A;  4ENN A;  3RPU A;  2ID3 A;  2X9D A;  1H89 C;  3IWF A;  2YU3 A;  1XS9 A;  2XF5 A;  1H0M A;  1TZL A;  1OKR A;  2RQP A;  1SVL A;  1U2W A;  2OBP A;  1OMI A;  3CC4 I;  2CG4 A;  3RKX A;  4XQF A;  1J7K A;  1R9T J;  3LNQ A;  4RAF A;  3H5R A;  2W82 A;  1PDN C;  2PBI A;  4ABZ A;  1PVE A;  1MDM A;  3VB2 A;  4C9Y A;  5HVQ C;  2DFH A;  1X3W B;  2JQ7 A;  3V8K A;  5FKO A;  2VI6 A;  4NBQ A;  3GW2 A;  1SEU A;  1MND A;  4A3E J;  2CJJ A;  1K61 A;  1MZB A;  3D5S C;  3IH3 A;  4RAZ A;  4V2F A;  3VYT B;  3RKY A;  4CCL A;  1SC7 A;  1K79 A;  3NRV A;  1IDZ A;  1A6Q A;  3HSF A;  4ESJ A;  1U78 A;  1V3F A;  2LTP A;  2JZY A;  4PUS A;  2HOS A;  3K4C A;  5E1X A;  1A35 A;  4DBQ A;  1YJW I;  1ZG5 A;  4B3A A;  2EIM H;  2KT0 A;  5FLX K;  2DFF A;  1N75 A;  4HPQ A;  4M6Y A;  1AKH A;  5DM6 F;  2COM A;  4IJA A;  3CUQ B;  4X0G A;  3PQK A;  1OQY A;  2E2J J;  5IYD J;  2EH3 A;  2K85 A;  3S2D J;  1YX5 A;  3F8C A;  1H8A C;  3ABM H;  2DOF A;  1DGW Y;  1ETX A;  2H94 A;  2GM4 A;  2O7O A;  3P7N A;  5EEH A;  4XLF A;  3GTP J;  3QAH A;  3HG9 A;  4LGW A;  4M71 A;  2EV0 A;  4XKV A;  3RIR A;  1TW3 A;  3ZXS A;  5M5W J;  2LKX A;  4Z2Y A;  5BPD A;  2L9S A;  2XPU A;  3BJ6 A;  1IUY A;  2KRH A;  4WXC A;  1SFU A;  4Y52 J;  2ID6 A;  4KYW A;  2MAB A;  4A6D A;  1R71 A;  3FMR A;  2VBW A;  2HVR A;  4LOC A;  3T8T A;  5LD2 C;  3ECH A;  2Z2S B;  4IHT A;  2NVU B;  3F72 A;  4AIJ A;  3MKL A;  1Y1W J;  4RGR A;  5KVR A;  2QUF A;  3K1P A;  2E71 A;  3L2V A;  5IPA A;  5GPA A;  3LSI A;  4OOI A;  2R7V A;  5CVI A;  3T5X A;  5JR3 A;  3CD6 I;  3Q0V A;  2B0L A;  5M3F J;  2STT A;  5HNF A;  3ZOB A;  5HDG A;  1HKS A;  2DLL A;  4IEJ A;  5HOO A;  1Z9C A;  4KIS A;  2MD0 A;  2DT5 A;  4U7D A;  3WGG A;  4AC0 A;  3M9A A;  4M9X A;  1ZK8 A;  2ZJ2 A;  2CQ7 A;  2V9P A;  3HHG A;  1OLT A;  2R92 J;  2DYR H;  4PCQ A;  1STZ A;  3U1K A;  2V6E A;  4ZYG A;  2V79 A;  5LGU A;  2LOO A;  5KAI C;  1TQI A;  1V5E A;  3P9I A;  4A3C J;  2UUZ A;  3KEQ A;  1D8K A;  3HKZ N;  2QKM B;  1FY7 A;  2M7B A;  5C44 J;  1MBK A;  3AG1 H;  2QCO A;  3I55 I;  4XLP F;  1TQM A;  3BG3 A;  2GBY A;  3BLY A;  3P5J A;  3DTI A;  1QPM A;  2LNB A;  1O7F A;  2XSD C;  5FD6 A;  4M6V A;  5J6X A;  4BS9 A;  4HAM A;  3PUB A;  4D7M A;  4KFC A;  2G7U A;  3OYH A;  1Z1D A;  2V1U A;  2MBF A;  5D5W B;  4XKC A;  2BOL A;  2NOJ B;  4O5V A;  2YUS A;  1GUU A;  1TBX A;  1TT5 B;  4XSZ F;  1K83 J;  2FA5 A;  2HI3 A;  3HTS B;  1R6R A;  2HZD A;  3G1L A;  2L4A A;  1R4N B;  2VQC A;  1NG7 A;  1IJW C;  5B3S H;  3HM5 A;  3W2W A;  3WTW C;  3KP4 A;  3OYD A;  2L4M A;  3ZMS A;  1ETQ A;  2LY2 A;  1V55 H;  5DD4 A;  2Z9O A;  1I3A A;  1FSE A;  3A1Y A;  2ZNZ A;  4BXX J;  2LR8 A;  4AWX B;  1WRJ A;  2IJL A;  3A02 A;  2A05 A;  2PMZ A;  2V1X A;  4WWC A;  3HSE A;  3FXL A;  3ZQI A;  2DOA A;  2M0C A;  3IP4 B;  5IY5 H;  5L3C A;  1Z6R A;  3J81 K;  1DGR M;  1SVM A;  2CQQ A;  2ECC A;  5L3D A;  4ZZD A;  3S3M A;  1FPQ A;  4JX5 A;  3ISP A;  2XF6 A;  2CQN A;  3OYF A;  2Y0S A;  3GEZ A;  2XPW A;  2R93 J;  1Z77 A;  3S2W A;  3RJP A;  2XAS A;  2E2I J;  1BR2 A;  1R1V A;  2JPC A;  3LSR A;  4L9T A;  3K0L A;  4H4K C;  3OSG A;  2FJ1 A;  1GVJ A;  4UHT A;  2M8G X;  1SMT A;  4E7H A;  1SAU A;  3S1M J;  2KLO A;  2WV0 A;  1J5Y A;  2ELK A;  2FUG 2;  4CGZ A;  1AU7 A;  2HYF A;  1EF4 A;  3E7L A;  2R7F A;  4XOR A;  1HA8 A;  1QZE A;  1PP8 F;  5LRS A;  2OJE D;  4BQN A;  4L0Z B;  1I27 A;  3S1N J;  3M1C A;  4A3B J;  1QA6 A;  1U9N A;  3HUG B;  1W7P B;  3Q5F A;  4XL9 A;  1NHA A;  3WGI A;  3HDD A;  3RPQ A;  2W57 A;  1V5G A;  2BW3 B;  5CVJ A;  2YSR A;  2LKS A;  3LA2 A;  4EM2 A;  3UKG A;  1D5V A;  4U87 A;  3H5N A;  4CYC B;  3FK7 A;  3G6E I;  3MKY B;  1HOM A;  4CH7 A;  1OR7 A;  1LNW A;  2OZU A;  4KIG A;  1P4A A;  2BXZ A;  2DQL A;  2RN7 A;  4PDK A;  2JWT A;  3E1S A;  3BR0 A;  1WH7 A;  3GTL J;  2LLK A;  2X6W A;  3QPS A;  4LG0 A;  2EFQ A;  3O8H A;  1O3Q A;  5JFR A;  5IP9 J;  3IKT A;  2XAG A;  3BDD A;  3J7A Y;  2Y30 A;  1ETY A;  1T33 A;  1ETO A;  1Y8Q B;  3DLL F;  1A6I A;  1W0T A;  1IV8 A;  4CCK A;  2CSO A;  4MLO A;  3VFZ A;  1ZRF A;  1CF7 B;  3HC7 A;  1R4M B;  1FYL A;  3CCQ I;  2AXT C;  4U0Y A;  1QPI A;  2VAS A;  4BY1 J;  5EG0 A;  1EH7 A;  3ZP5 A;  3PNT A;  1WJE A;  1RPW A;  2K9S A;  1UB9 A;  2X85 A;  2IGO A;  1W5T A;  3ASN H;  1KON A;  1UHM A;  4ZH4 F;  1R49 A;  3MKW B;  2XRO A;  2FMY A;  1QQI A;  4D5F A;  5GAG J;  2XB0 X;  5CQG A;  1QGP A;  3F8F A;  3K4K A;  3BCA A;  4GFB A;  2OV7 A;  4PJN A;  2G0E A;  4UVA A;  5ICF A;  5J4Y A;  3DFG A;  4BU2 A;  1T8I A;  4C3J J;  4ENM A;  1ZGW A;  1LE8 A;  3V8J A;  3VYR B;  3J7Y J;  4KNY A;  3DBR B;  5B66 C;  2LYC A;  4RB2 C;  1CGP A;  3W2V A;  4P96 A;  2M34 A;  3VOE A;  1N78 A;  4HBL A;  3CMY A;  4GGG A;  3GFM A;  4HSR A;  3BG7 A;  3F6O A;  2VON A;  2G9W A;  2VBX A;  3U2R A;  3IRR A;  2WC2 A;  3E0J B;  3U1D A;  4AD9 A;  4E7J A;  1EV7 A;  2P8T A;  3NQO A;  3ZMZ A;  3QRF F;  1JI8 A;  2OUM A;  3KP2 A;  4HNV A;  3HRU A;  4G6T B;  4J00 A;  4KIT B;  3HBL A;  4EJW A;  3K4B A;  1UHW A;  2H09 A;  4J01 A;  1R22 A;  3B6C A;  1YIJ I;  2IVM A;  1TWA J;  2Z99 A;  1E0E A;  1QHH D;  1OR7 C;  3ZRG A;  1G3T A;  4GCV A;  3OL3 A;  5IT3 A;  4X6A J;  2KQR A;  5F27 A;  1ZLJ A;  2O9L A;  5AON A;  5ILV A;  3F6V A;  2P6T A;  4HV5 A;  3GYH X;  4M3D A;  2AHQ A;  1HF0 A;  4XRF A;  3FXJ A;  2CUE A;  5JHF A;  2FX0 A;  3G4S I;  5IYC J;  5K7H A;  4L9J A;  4UB6 C;  2H6B A;  4XLA A;  2PMZ N;  2CW8 A;  2EA4 A;  2ETH A;  1LB2 A;  3SDB A;  3HOT A;  1X1C A;  1SAN A;  5D5V B;  4XNF A;  2RNJ A;  3GZ6 A;  3G71 I;  2NVT J;  4L9V A;  3ZMU A;  2R7X A;  3W6V A;  2FNA A;  3I59 B;  1I50 J;  1FBS A;  4RA2 A;  2DXI A;  2Y0S N;  1MD0 A;  2V7F A;  4OMY A;  2KHM A;  3DTK A;  1XPX A;  5A2Q Z;  1XGM A;  2D2W A;  2Z33 A;  1RNL A;  4G94 A;  3I5U A;  4FE7 A;  2BV6 A;  4IXA A;  4WX9 A;  3KE2 A;  2X51 A;  2ME0 A;  2MYS A;  4CXF A;  3OS2 A;  4G7H F;  4B4C A;  2XGD A;  4RLF A;  3CTA A;  3QYB A;  3VOD A;  3MKZ A;  2HPM A;  3CDH A;  1SFX A;  3TBI A;  1HST A;  2M30 A;  4N4O B;  5ICG A;  4AVZ A;  1XCV A;  3WE3 A;  3K2Z A;  5ERI A;  4HF2 A;  4LLL A;  1JKO C;  3FKJ A;  3WOD F;  3A03 A;  4BJT A;  1VQ9 I;  3KZY A;  2VQG A;  4A3M J;  1QZZ A;  3K7A J;  2KZG A;  4BDZ A;  4B3X A;  3JRF A;  4KA4 A;  4XOT A;  4B1R A;  3R0J A;  4W1U A;  3MQ0 A;  2R7R A;  2AQE A;  2KIM A;  5L3F A;  3K10 A;  2CWE A;  4QPQ A;  2NOG A;  1W5S A;  2DFE A;  1IRF A;  4EEF G;  4FX4 A;  1I6H J;  3BQZ A;  4ZDP A;  1VQ4 I;  2LY9 A;  3H9J A;  1PP7 U;  1YJ9 I;  4LLN A;  2LP0 A;  2O0Y A;  2PQ8 A;  4EVI A;  4BGD A;  5BMZ A;  3QOP A;  3QWL A;  2PJP A;  2RRE A;  4FTH A;  4YFN F;  2K4B A;  4KUM A;  1GHC A;  2LRD A;  4HDU A;  3D5R C;  1JJ6 C;  3LQQ A;  3MMY B;  4L9N A;  3BPV A;  2R7Z J;  2WBM A;  2ZXH A;  5EGO A;  4WCG A;  3KP6 A;  1TQP A;  4NDL A;  4X1E A;  5HS9 A;  3QU3 A;  1X1A A;  2NVY J;  2BVM A;  4B43 A;  4B8X A;  1ZRE A;  5FKM A;  4PGG A;  3J7Z I;  1JUP A;  5ICE A;  4UV8 A;  3HYI A;  1FOW A;  3K4J A;  5F0F A;  4CUG A;  4A12 A;  2HQA A;  3M7G A;  1BL0 A;  3GXO A;  2M87 A;  4KN4 X;  3GVA A;  2ACJ A;  2BYV E;  5EF6 A;  5H6R A;  1YJN I;  2QQ9 A;  2OZ6 A;  4RGU A;  3HOY J;  3CC2 I;  2OCE A;  5B1B H;  4AM3 A;  2PMH A;  3JRE A;  2A6E F;  4QSH A;  4NUB A;  2QEX I;  2KRC A;  1OJL A;  4NC7 A;  5HLG A;  4BJ6 C;  4DGW B;  4G8X A;  1IDY A;  5LBQ A;  2QQA A;  5J40 A;  1VTN C;  3C7J A;  3FK6 A;  1MH4 A;  1I1G A;  2R7O A;  3F3X A;  2HNH A;  3PO2 J;  4A69 C;  1N25 A;  3JR9 A;  5JVG F;  1K6O A;  2STW A;  2WAQ A;  4XLC A;  4HNU A;  2BEO A;  5DCM A;  3BTI A;  4AID A;  2L9R A;  3K69 A;  3PIO F;  4ENJ A;  5A2Q K;  4HX7 A;  5BOX A;  4ZTJ A;  4DYQ A;  2M8E A;  1TTY A;  2Y31 A;  3BTL A;  1FNN A;  2D1V A;  2DJI A;  1WJB A;  4N9I A;  1JKQ C;  4LIU A;  1J0R A;  2CUJ A;  2E5N A;  3R0A A;  4MO7 A;  4NNJ A;  1B6A A;  1ZYR F;  2BE5 F;  2JMW A;  4RM2 A;  4WK8 F;  2ZJQ F;  3OOU A;  4O3M A;  1Z3X A;  1IC8 A;  5FB2 A;  3CCY A;  3MEX A;  3OMY A;  2R5Y B;  2EBI A;  3J80 Z;  3HIF A;  2DDA A;  3BR3 A;  4IOC F;  4IHY A;  3S3O A;  3M4O J;  5GP9 A;  1IUF A;  2JTV A;  5GTI C;  1S7E A;  5LGT A;  4GYI A;  1XDU A;  3I58 A;  4DJA A;  1ZR2 A;  2M1B A;  3PIP F;  2V4J C;  4UXN A;  5K7Z A;  1DUX C;  4WXD A;  5IOZ A;  4AIH A;  4V2G A;  3U9G A;  4Z6Y A;  3OOP A;  3WU2 C;  1PUE E;  3HPG A;  2PJR B;  1E17 A;  2DFI A;  2Q1Z B;  4A3J J;  2X1D A;  4QIW N;  2IBD A;  1QU3 A;  2K27 A;  5H2F C;  1SFO J;  2GWR A;  3AG2 H;  1SD6 A;  2VQL A;  2DA1 A;  2OPT A;  2GA2 A;  1WH5 A;  3GFL A;  1XGO A;  1LKX A;  5E3L A;  1LPQ A;  4XKB A;  3HZJ A;  1IW7 F;  3A01 A;  4NQW B;  3BJA A;  4BBR J;  4XOP A;  4UV9 A;  1YLF A;  4CA0 A;  3H92 A;  4LG3 A;  3BG6 A;  1BOB A;  3C18 A;  2NRA C;  2EZH A;  2FRH A;  2MG4 A;  4UB8 C;  3F8M A;  4RDU A;  3S15 J;  4F7Z A;  4XMY A;  1UEL B;  2ZXW H;  3PFY A;  3A0B C;  4JX6 A;  1ZRC A;  2M4G A;  3JSP A;  2VJJ A;  1IXR C;  1DPR A;  1WCM J;  4L5E A;  2ZJR F;  2MW8 A;  2ICW G;  5DV5 A;  1Y0U A;  1WWX A;  4EM1 A;  3Q3S A;  3DTE A;  4OIP F;  4CCN A;  2FML A;  4BQA A;  2V26 A;  3FXO A;  3BTC A;  2K86 A;  3GTG J;  3SFZ A;  3FXU A;  3H0G J;  4BQO A;  4LK0 F;  4UUT A;  1OYI A;  3Q0U A;  4YFK F;  3BCB A;  3FXQ A;  1W36 C;  4JQF A;  4Y4R A;  4FAS D;  3SZG A;  1SD4 A;  3OYM A;  2HDD A;  1MDM B;  3GZ5 A;  5FO5 A;  4HA8 A;  2L02 A;  4Q48 A;  4HNT A;  2MC4 A;  1PUF A;  2IRF G;  3I9V 2;  4RGS A;  2JRM A;  1D0X A;  4FX0 A;  5ILS A;  4RLQ A;  4I0A A;  3L9F A;  4CDG A;  2RGV A;  3CZ6 A;  4I7H A;  3FBI B;  2DBB A;  2JVH A;  3J80 K;  3WTU C;  1TWC J;  3CCE I;  4EJO A;  3OSF A;  1KQ9 A;  3HGG A;  2MH9 A;  4U0V A;  2EFW A;  1O3T A;  3PO3 J;  2FQ3 A;  3VSK A;  4HQE A;  1ZG1 A;  2TRT A;  3DEW A;  5EJC A;  4B09 A;  1AKH B;  1YQA A;  2VUM J;  4N4N B;  3SEQ A;  2KMU A;  1U3E M;  1Z21 A;  4IRH A;  3OYE A;  2QSG X;  3WG7 H;  4BUP A;  1HW2 A;  3NAR A;  2HFH A;  2F5E A;  2FD5 A;  5CJ9 A;  1VQL I;  4WXH A;  2W85 A;  3DLA A;  2DA4 A;  2P81 A;  1RI7 A;  1B72 A;  2VC1 A;  2GIZ A;  5HDN A;  5CKT A;  3GTQ J;  3W3C A;  4ZYA A;  4ZJZ A;  3CCU I;  1VQ8 I;  3EUA A;  5L3B A;  3KET A;  4XN0 A;  4ESB A;  3KP7 A;  2XPV A;  3FXM A;  2VE8 A;  3Q9S A;  2L7F P;  3HXL A;  3KYL A;  3N05 A;  1LDJ A;  5L3G A;  3JW4 A;  1OYW A;  4IVN A;  3V42 A;  2ELJ A;  2XUB A;  3KYD B;  2RV8 A;  3X2Q H;  3HHH A;  2VKE A;  3F22 A;  2P7C B;  1YW7 A;  3H36 A;  1FOK A;  1ZN2 A;  2WV1 A;  4MQ9 F;  6PAX A;  4ZDL A;  1XSV A;  1GXP A;  5GAH J;  1BA5 A;  3BRO A;  1LFU P;  1ETV A;  3HEF A;  4XN3 A;  1U5T A;  2DMQ A;  5E8G A;  3P9K A;  4RB3 C;  1MNM C;  2CV0 A;  2QZ8 A;  2NS8 A;  2L01 A;  2WY7 Q;  1HBX G;  4RAG A;  2KIU A;  4L0Y B;  1W0U A;  1WSU A;  1X1D A;  1AA7 A;  2X1E A;  3C2H A;  4MFE A;  2GAU A;  2NVX J;  1XMX A;  2D1H A;  2ZCW A;  3KLO A;  5ED4 A;  1HC8 A;  3I4P A;  5FKL A;  4XRS G;  2A5W A;  2DCE A;  2KIS A;  1KU7 A;  5GPC A;  2UZK A;  2DT6 A;  3DQV C;  3EPZ A;  5FRM A;  2TCT A;  2XVC A;  4E7K A;  1LEA A;  3J7A O;  2VBY A;  1JE8 A;  1LEB A;  2R5Z A;  3LMM A;  4I76 A;  1J75 A;  1FT9 A;  4XR6 A;  1JTY A;  2DTR A;  3HPH A;  1U0J A;  2EIL H;  2WY8 Q;  1USS A;  3F9K A;  1WJD A;  1QO0 D;  2CH0 A;  4LD5 A;  4BKX A;  3RZO J;  3V4G A;  2FBH A;  3OYL A;  2VN2 A;  1WZ2 A;  1P7I A;  2IA0 A;  3IRQ A;  4BQQ A;  4V19 K;  2P5V A;  2W84 A;  3ZQC A;  2LRE A;  2CUF A;  3GCM A;  4IHW A;  3DF8 A;  3LSH A;  3FDY A;  2F2E A;  2HS5 A;  1O57 A;  1W7P D;  3HRM A;  1WI9 A;  3HGY A;  3K9T A;  4A5M A;  3RKQ A;  3LSJ A;  2L2O A;  3SXY A;  3OYJ A;  4ZTF A;  3WTZ A;  2VXD A;  2E1N A;  4DYC A;  3DXJ F;  1QRY A;  4RS8 A;  2AO9 A;  3B6A A;  4MNU A;  4A3F J;  2DT7 B;  4G9Y A;  3COA C;  1BBY A;  1ACI A;  2FBK A;  2RAE A;  4E4H A;  1DP7 P;  2WAE A;  2E60 A;  3ABL H;  2JJ7 A;  4A5N A;  1U5T C;  3S1Q J;  1ZHF A;  3BC8 A;  3HJE A;  4IHV A;  1KU9 A;  3KIO A;  2K9N A;  1MBH A;  3HRS A;  2DYS H;  4FT8 A;  5LEJ A;  3SEZ A;  4A3K J;  3GFI A;  2DMN A;  3JRI A;  1J59 A;  1EH6 A;  1YO5 C;  3OR1 C;  4HRI A;  1XGN A;  3IWZ A;  1FEX A;  5IP7 J;  3LWF A;  3SJM A;  2I10 A;  4I0B A;  5TIS C;  3OYA A;  2PN6 A;  1X19 A;  3AFH A;  1RR7 A;  3V7C A;  3RQI A;  3NWT A;  4PSX A;  4I01 A;  4BEH A;  2L9V A;  2QQB A;  2ZJP F;  4B47 A;  2ECB A;  2LVS A;  1FJL A;  1ON2 A;  1DU6 A;  3SHF A;  3F8B A;  1HQC A;  1MJA A;  1WJ5 A;  1YI2 I;  5HOD A;  1ULY A;  2CGP A;  4BE2 A;  4E7Z A;  4A93 J;  5HLI A;  2H8W A;  4IOA F;  2F5C A;  3NWS A;  4R79 A;  2IA2 A;  2W48 A;  3TKY A;  2ADU A;  5F64 A;  2OD5 A;  2R7D A;  1IG7 A;  4I98 B;  4EMS A;  1L3L A;  4G6Q A;  1VQ7 I;  4HV6 A;  2X6O A;  1VQ6 I;  1ZKG A;  4P55 A;  1GVD A;  1TWG J;  1UG0 A;  1W5C C;  2LDU A;  5F08 A;  2MSY A;  3FKI J;  4I2O A;  2R3S A;  5ICC A;  4LB5 A;  4DQ2 A;  2EA2 A;  3ELK A;  5GAE J;  3BQY A;  5IT9 Z;  3CDI A;  1UJ8 A;  4LG0 B;  4F3Q A;  5LHI A;  2UWM A;  2HYJ A;  2CS3 A;  2W1O A;  2E1C A;  3CJN A;  3GO5 A;  4MIM A;  1JUS A;  2CU7 A;  3F8N A;  3OYN A;  1KA8 A;  1T38 A;  1ONV A;  2Q0O A;  2YS9 A;  1KU2 A;  2HPI A;  2PFB A;  3PJR A;  3DU6 A;  3TO9 A;  1G3Y A;  3CDL A;  5EG0 B;  2EJR A;  2F4O B;  2H8R A;  1O3S A;  3QQA A;  4Y33 A;  3W6K B;  3PSF A;  4L5I A;  3CMA I;  4XRM A;  2L3D A;  1FIP A;  4QPO A;  3KCC A;  2DMP A;  1O7L A;  2XF7 A;  3VDX A;  4LJZ F;  2OTL I;  3IH2 A;  2XV4 S;  3BG9 A;  4E6K G;  5IP6 A;  4I99 C;  1WFX A;  4Q47 A;  1MH3 A;  4XON A;  3TDU C;  1LE8 B;  3DKW A;  2LBF A;  1RR8 C;  2CW0 F;  1YOV B;  2ESN A;  1K7A A;  3F23 A;  2E36 A;  3LQR A;  2R7T A;  1FOX A;  1HKT A;  1A31 A;  5D5U B;  2GA1 A;  4A3G J;  3DKX A;  5DS9 A;  4OIQ F;  1X4P A;  1W4M A;  1RUN A;  3OYI A;  3E5U A;  3TW6 A;  3DKY A;  2JUC A;  3MWM A;  1MGT A;  3AG4 H;  2E2H J;  2GXA A;  2HKO A;  2HTS A;  2XGC A;  2EIJ H;  2QM3 A;  2DA7 A;  3L7W A;  1D0Y A;  1TWH J;  2OAZ A;  4HST A;  2XC7 A;  2R7Q A;  2EIK H;  4CCJ A;  2JA8 J;  3G1O A;  3V8L A;  2HTJ A;  4M9Z A;  4YEJ A;  2FQ4 A;  2JK3 A;  2Y9Y A;  4HF1 A;  2K02 A;  1D5Y A;  2G7H A;  4NB5 A;  1YTY A;  3MCZ A;  5J1R A;  2H27 A;  1MW7 A;  1B8I A;  2QBY A;  3CLQ A;  3HOZ J;  4B44 A;  3HOU J;  4LK1 F;  4E70 A;  2VB6 A;  2K5C A;  3B02 A;  4M3G A;  1S7A A;  2JUG A;  3IAS 2;  1FP2 A;  2F5D A;  2IP2 A;  5E3M A;  3H9Q A;  4PFO A;  3P9C A;  3LST A;  3LAP A;  1VQK I;  4D9J A;  2NNY A;  3UR3 C;  3WTT C;  3RYR A;  3I71 A;  3PL8 A;  1OCC H;  4HX8 A;  1DP3 A;  4Y17 A;  2VOD A;  1S7O A;  5IT9 K;  1Y0N A;  3NEU A;  1BI2 A;  3RQ4 A;  4YIF A;  2IW5 A;  4F91 B;  2GXG A;  4XLE A;  4L18 B;  2YR2 A;  1RUO A;  4P5O A;  2GLO A;  2W7N A;  1D1C A;  5E79 C;  2JA6 J;  5DUI A;  3I4M J;  3ZQF A;  4ENK A;  5FRN A;  4Q5S F;  3DBL B;  1P4W A;  2B63 J;  4EGY A;  2W25 A;  3BR1 A;  5DUK A;  1MMS A;  4KJZ A;  3ZQQ A;  4G7O F;  3A2K A;  1D1B A;  4S0H B;  5CVR A;  3CF2 A;  2HDW A;  1LVA A;  1IGN A;  1WHU A;  2PG4 A;  3TMO A;  3ZPL A;  2HOT A;  3DPU A;  5DEQ A;  3K70 D;  3OS1 A;  1T0F A;  4DIQ A;  4I6Z A;  2M2E A;  2XGX A;  3BR6 A;  4KIB A;  3PM1 A;  5B1A H;  3WTS C;  5LHH A;  1DU0 A;  3CC7 I;  5HDK A;  2P6S A;  2O61 A;  1S9H A;  3L2U A;  5CVV A;  1FTZ A;  4MHG A;  4DYR A;  4L5J A;  2VPL A;  2CRG A;  4ZC3 A;  5LHG A;  2XB5 A;  2ZFW A;  3JRA A;  1G59 A;  1XD7 A;  3KP3 A;  2L7K A;  4IQ4 A;  5LGN A;  3WTX C;  1S5L C;  3TOB A;  1V4R A;  2P0W A;  5FLV A;  2OCC H;  1DQU A;  1TP4 A;  1U9O A;  5HLT A;  4KMU X;  2EFP A;  5C4J J;  3FX3 A;  2YPR A;  3M8J A;  1T2K A;  5EGO B;  3L2C A;  5LEK A;  1R5I D;  1QVU A;  1JKP C;  4KT5 C;  1TWF J;  3OV8 A;  3FIW A;  3H1C A;  2OQR A;  3E6C C;  4BAC A;  1JHH A;  1O4X A;  4EQQ A;  3DCF A;  2DDB A;  2DTZ A;  3EQL F;  4G7Z F;  2LFB A;  2WB1 A;  3O6B B;  3RTR A;  4ZZL A;  3CCR I;  1ORK A;  4C30 A;  1AHD P;  1NK3 P;  4PZJ A;  2R4G A;  4IL6 C;  3AKZ A;  2XAJ A;  2ZME A;  1DDN A;  3U21 A;  5TJJ A;  2LKP A;  4G6D A;  1X58 A;  2GOX B;  3WTY C;  1U6G A;  2E1O A;  4C2M J;  2JN6 A;  4F93 B;  1JXS A;  5KK1 A;  3OIQ A;  2RNG A;  1IN5 A;  3FBN B;  1XGS A;  4QLC U;  4HW0 A;  3G2B A;  2IGK A;  1MJB A;  2W24 A;  3BPX A;  3VSL A;  1RKT A;  4IHS A;  5CQE A;  2VKD A;  5CYV A;  3D1N I;  3D5L A;  4JP0 A;  1OCZ H;  2H6C A;  1IZ1 A;  4C3H J;  5BQT A;  2LF7 A;  5DCM B;  1T0F C;  3DEE A;  3ML6 A;  2K3P A;  3CCV I;  3LSG A;  4R8H A;  1R1T A;  4YIR X;  2VLA A;  3I4N J;  4Y3O A;  5H6Q A;  4IX7 A;  2Q8K A;  3TOA A;  1AOY A;  3BG5 A;  1B1B A;  2F48 A;  2OQG A;  1ERD A;  2HOA A;  1WJA A;  2HXI A;  2KFD A;  2RDP A;  4D1Q A;  1R1U A;  2DK5 A;  1A36 A;  4YG2 F;  5B5E C;  1FX7 A;  2Y48 A;  2CQK A;  4U88 A;  3BR2 A;  4PSW A;  1BR1 A;  3OYC A;  1Y6I A;  4ESF A;  1JTX A;  1UST A;  3FXR A;  2M7A A;  2P5L C;  1XCB A;  3TDZ C;  2K9M A;  4II2 A;  3GTK J;  4OMZ A;  4E7S A;  3FMQ A;  2KL4 A;  2EV5 A;  4UY8 I;  3G1M A;  3ASO H;  5M3M J;  1HCR A;  2E1M B;  2DA2 A;  5EEG A;  3OIP A;  1ZGA A;  5F6F A;  1RET A;  2DA6 A;  3IUO A;  2CW7 A;  1M1E B;  3T1B A;  2OF7 A;  2D5V A;  1P4X A;  2X48 A;  1MSF C;  5FLM J;  2ZME C;  4XBF A;  3DPL C;  4YFX F;  2H1K A;  1RES A;  1K4S A;  2D45 A;  2B7E A;  3L2W A;  3CMM A;  2AQF A;  2EK5 A;  2Z5U A;  5LFA A;  4LMY A;  4AYB A;  3OS0 A;  2Z1D A;  4UUV A;  3M8E A;  3SFI A;  3A01 B;  1MMN A;  4UUS A;  2HWV A;  4M74 A;  3TQN A;  2O8X A;  3CO7 C;  3WTV C;  2E34 A;  3R60 A;  4MGR A;  3B73 A;  2MGQ A;  2V9K A;  2CV1 A;  3O8G A;  4UNO A;  4A3L J;  2XDV A;  3TO6 A;  1JGS A;  2ZFU A;  4AUX A;  4BE1 A;  3S2H J;  1EKE A;  2M3A A;  4M3B A;  3EET A;  1HXD A;  2DQR A;  2HZT A;  1BW6 A;  2KIQ A;  1X3U A;  3QPL A;  3M3Y J;  1ZEL A;  4DOZ A;  1YRN A;  3E97 A;  3K6G A;  3ZGK A;  3N97 A;  1IO2 A;  1IN7 A;  4R1H A;  3VPR A;  4P9U A;  1JT0 A;  2E19 A;  2CFO A;  3GF2 A;  1F1Z A;  3KZI C;  2VQH A;  4HZF A;  2E7X A;  1Z7U A;  3CF5 F;  2IS6 A;  1S6L A;  2VL8 A;  3I54 A;  2LH9 A;  4DNC A;  1VQP I;  3CCL I;  4S05 A;  4LIV A;  4OIO F;  2CYY A;  2NYX A;  2ZBK A;  3TL4 X;  3FHN A;  2X6X A;  4DBR A;  3JCU C;  2BY1 A;  3MAJ A;  1PUF B;  3GME A;  2V1N A;  4K2E A;  3ERM A;  3K1N A;  2QYO A;  4GXO A;  2K9L A;  3TO7 A;  2BZT A;  4NC6 A;  1B9N A;  2R7U A;  9ANT A;  3KEY A;  1MSE C;  2M0M A;  1T39 A;  1IXC A;  2Z16 A;  2KJB A;  4P9F A;  1LQ1 A;  5IYB J;  2DJN A;  4HF0 A;  2HDC A;  4M73 A;  3G3Z A;  4JX4 A;  2WB1 N;  3R6S A;  3CJQ B;  5DTD A;  3KYC B;  1U8R A;  1T98 A;  1JUM A;  3BT9 A;  1T08 B;  2NAZ A;  2HQ5 A;  2ESH A;  5FLX Z;  3FHZ A;  1MKM A;  2KP6 A;  2DI3 A;  2CQX A;  3KLN A;  4S04 A;  2BGC A;  3LL7 A;  2V1D A;  5E17 F;  2X4H A;  1G3W A;  4OAY A;  3FM3 A;  2LF8 A;  3BOQ A;  5JLX A;  1WGX A;  2H1L A;  2WTE A;  3PNY A;  4LLG F;  1B72 B;  1EJ9 A;  2HVS A;  1FSH A;  2Q2E A;  2JA7 J;  2PMU A;  4IRG A;  3Q9V A;  3R61 A;  5DM7 F;  1K78 A;  4IO9 F;  1N77 A;  3HTU A;  2IS2 A;  2MLK A;  5CPR B;  2O6G E;  1OCO H;  3SZT A;  2DU9 A;  3AL0 C;  4IRI A;  4GRI A;  4ITV A;  4BAY A;  2QVO A;  1VF9 A;  2A6H F;  3RDI A;  3MD2 A;  1KZH A;  5E3N A;  3K70 C;  3S3N A;  4I09 A;  4HX4 A;  2N8G A;  1XTA A;  3OY9 A;  4M3F A;  5FD5 A;  3FZV A;  2ZSH B;  3ZR8 X;  4BHC A;  1U5T B;  4XLH A;  1F4K A;  1ZGJ A;  4IPA A;  2XRL A;  2DO7 A;  2EPF A;  2L7Z A;  3C3W A;  3BZC A;  4EJV A;  1Y1V J;  3S16 J;  4O6J A;  4D5C A;  3ULQ B;  1VQO I;  1ODD A;  4A0X A;  1IF1 A;  3HOW J;  5M5Y J;  2J5O A;  1HLV A;  3O2P E;  4OIR F;  2FF4 A;  1S8N A;  2WAQ N;  4OAZ A;  5K5Q A;  2ZO4 A;  1KYW A;  4BE0 A;  2BHZ A;  3EYY A;  2FXA A;  2DOE A;  1OCP A;  1Q1V A;  2IA1 A;  3NAU A;  2E35 A;  2VT3 A;  3I3L A;  2R5Z B;  3DV8 A;  5J3L A;  3H9G A;  1BJA A;  2BY2 A;  1EH8 A;  2IPQ X;  4RMN A;  1RRJ A;  3ZMD A;  2O8K A;  5J8F A;  3I56 I;  3G73 A;  2XKO A;  1G2H A;  3LA7 A;  3KFW X;  4EGZ A;  3BJO A;  1L0O C;  3CUO A;  1VI0 A;  3H3V K;  3M8F A;  4AYB N;  5CVU A;  2IEK A;  4CZC A;  2FE3 A;  1FLI A;  5BNG A;  4M9S A;  1XSD A;  1KQ0 A;  3SZP A;  5HNH A;  4I02 A;  2HQR A;  1GDT A;  3HL2 A;  2ELH A;  5DDG A;  5J1Y A;  5JI6 A;  4MQV A;  1B4A A;  2PLY A;  3S17 J;  4FHT A;  2L5Q A;  4EJU A;  3JRG A;  1F43 A;  1YW8 A;  3L2Q A;  1R36 A;  1P92 A;  2FEZ A;  3C2G A;  1GV5 A;  1I6X A;  1FYK A;  2A6T A;  2O5R A;  3AAF A;  1QZY A;  1XDS A;  1T6S A;  2LMD A;  5D4S A;  5LLQ A;  3V7S A;  3WHB A;  4DW6 A;  3L1P A;  2F5V A;  3CJT B;  4CSW A;  2K7L A;  4ANJ A;  4FET A;  4RBO A;  3SYT A;  3WE2 A;  4OU0 A;  2A61 A;  3JAM Z;  1IRX A;  2OTJ I;  4AU7 A;  1O3R A;  1Y39 A;  1LDD A;  2ZXJ A;  5AIQ A;  4TV7 A;  5DD8 A;  3GUD A;  2HYG D;  1F5T A;  3JRC A;  5FKN A;  3GLL A;  1LJ9 A;  1VQN I;  2EZI A;  2XHK A;  2NNN A;  4E7L A;  1ZH5 A;  1Y56 A;  4U7B A;  1LVK A;  1OIS A;  3H3Z A;  4MEX F;  5F0H A;  4EM0 B;  1P2F A;  1FMV A;  2L9N A;  2UXN A;  3JTH A;  3OYG A;  3J81 Z;  3GX4 X;  2VOO A;  1YE9 A;  3O3K A;  3QU6 A;  2WWY A;  4W97 A;  2ZC2 A;  2VOP A;  5D6E A;  2EWN A;  2BXY A;  1Z7L A;  4F52 A;  1FIA A;  1BIB A;  1YW9 A;  1U8B A;  2I8D A;  4BEH B;  2GOM A;  3A4C A;  3CUQ A;  4C2U A;  4DZJ A;  1ZAO A;  4MTD A;  5C3E J;  4NC8 A;  4BL0 B;  1FTT A;  4CZZ A;  2PX9 A;  4UVC A;  3EYI A;  4XKW A;  2FOK A;  3H3U A;  4A0Z A;  1BC7 C;  1FP1 D;  5JLW A;  1VZ0 A;  4BNC A;  3AG3 H;  2FSW A;  1A04 A;  1V54 H;  2F4I A;  2NXN B;  3LSM A;  4N0B A;  1SFE A;  3F0C A;  2DA3 A;  1OYY A;  3S8P A;  3ZQ7 A;  1C0W A;  3PFI A;  1R00 A;  3LFU A;  4C3I J;  5F1R A;  3MVP A;  3EDP A;  4BBS J;  3FXK A;  2IS1 A;  4M72 A;  3JTG A;  1I1S A;  3RSN A;  1ITY A;  1MBG A;  2V9V A;  2Y2Z A;  1X4O A;  1Z0X A;  1H9G A;  3DWL E;  1G4D A;  2X0L A;  1Z91 A;  3GBG A;  1HKQ A;  2IS4 A;  5E3O A;  1YYV A;  3C2B A;  3ECO A;  1XB4 A;  2MD5 A;  4AVP A;  3F21 A;  1VQ5 I;  4D7N A;  1Z67 A;  1ZG3 A;  3DP7 A;  3QPH A;  4M3E A;  1EA3 A;  4II3 A;  4E7I A;  3H5A A;  4JK1 X;  1UZC A;  3FIS A;  3QPT A;  1SAX A;  1HSJ A;  3IH4 A;  2J5P A;  3DU5 A;  2VIX A;  5H20 A;  1FOY A;  5KAF C;  3GZN B;  4HLY A;  3RCO A;  5E18 F;  2LSO A;  3V7R A;  3JAM K;  1VQM I;  2PI0 A;  3ZCO A;  5K5O A;  1BJZ A;  2JVG A;  5EEA A;  2ZKZ A;  3KPH A;  4BJ5 C;  4BXF A;  4BHB A;  2GIV A;  3S93 A;  2VJ4 A;  2LY1 A;  4IKF A;  3JRH A;  2HOE A;  1BN5 A;  3ZMV A;  3CUQ C;  5KHD A;  3DPT A;  1UHS A;  2A07 F;  2CO5 A;  2LBF B;  2IT0 A;  4KMF A;  1RKW A;  1ETW A;  1SFK A;  1HW5 A;  3DBH B;  5DYM A;  4JBA A;  4J19 A;  4IF4 A;  2QA4 I;  1SD5 A;  1V5F A;  4QTR A;  1JJ8 C;  4FE4 A;  2A3S A;  2DOD A;  1S3J A;  3FF5 A;  1QNT A;  4N9H A;  1Z6T A;  4CCO A;  2A5Y B;  3ERE D;  4ETS A;  1P9Q C;  4IZZ A;  1A5J A;  3K2A A;  1MBF A;  2L7M P;  4AIK A;  2CUZ A;  3CES A;  5GAD J;  4RGX A;  2DMT A;  1GXQ A;  1HW1 A;  2BY0 A;  3ZMT A;  2JA2 A;  2F5F A;  3HRT A;  1E3P A;  3S32 A;  4XIC A;  1XN7 A;  3RI4 A;  2ZSI B;  2BHY A;  1MBE A;  1TNT A;  3SQN A;  4CO8 A;  5K1Y A;  5KNL A;  2VE9 A;  2LC2 A;  3JRD A;  2QGU A;  1B8I B;  4B48 A;  2QBY B;  1PJR A;  2BBY A;  1Q1H A;  1MBJ A;  1JGG A;  4A3I J;  1XX5 A;  1R23 A;  2M9H A;  4LIT A;  2K40 A;  3CLO A;  4PFP A;  4XSX F;  2EZL A;  1TLH B;  1UG2 A;  2Y9Z A;  1AWC A;  5E1W A;  5KCM A;  1B9M A;  3LSK A;  1UAA A;  3IAM 2;  1BM9 A;  2IAI A;  2HGC A;  5FGM A;  4BHP A;  3L2R A;  2P4W A;  1XC5 A;  2LK2 A;  2QQ8 A;  4P1W A;  2VJ5 A;  2DN0 A;  5BS6 A;  2C6Y A;  3PUF A;  1QHG A;  1ETK A;  2AS5 F;  3R4K A;  5J4V A;  4MTE A;  3TP0 A;  1J2X A;  4FCY A;  2HXO A;  3LSP A;  2YX4 A;  2DW4 A;  1FMW A;  2LD5 A;  1E3O C;  2O3F A;  1OCR H;  3FWE A;  4PGH A;  2Y0M A;  5J8C A;  5LRR A;  1MMD A;  1WQ2 A;  4ON0 A;  3E5Q A;  2XIG A;  2ME6 A;  2R7W A;  3RYP A;  3MZY A;  1IN4 A;  4XLN F;  3SDG A;  3C1D A;  4BXU A;  1REP C;  5D8K B;  3JSO A;  2RQQ A;  4RM3 A;  1IRG A;  3CME I;  4PJL A;  3KZZ A;  3HUG A;  1W7P A;  2UV1 A;  4HEA 2;  1YIO A;  2ZB9 A;  1FC3 A;  3E6D A;  3CCJ I;  2TDX A;  1J09 A;  1I5Z A;  2EQR A;  2BW3 A;  2Y69 H;  5F1J A;  4HLX A;  3Q0W A;  1VFC A;  3OL4 A;  4A2U A;  1TW2 A;  5HS8 A;  1LUJ B;  1TT0 A;  4CYC A;  2YX7 A;  5EZG A;  2LG4 A;  2WAF A;  4XM3 A;  1BW5 A;  2JRT A;  5EZH A;  2EFN A;  2Y75 A;  1HDP A;  3CP2 A;  2B9S A;  3EUH A;  1LFP A;  2KZV A;  2DK8 A;  2EV6 A;  2VBZ A;  4JYK A;  3VYS B;  1P6R A;  4WF2 A;  3ZQH A;  1Z3Y A;  1G3S A;  1BOA A;  2L0K A;  2BVL A;  5ILU A;  1UFM A;  2VXZ A;  5J1U A;  3ZQL A;  4D0P A;  1WJC A;  1I39 A;  2NS7 A;  5K5R A;  4A0Y A;  5BPI A;  1CF7 A;  4NHJ A;  3K1M A;  3L09 A;  4KN7 X;  3WG9 A;  1MMA A;  3LOC A;  5E1Z B;  1YFH A;  3FM5 A;  2VC0 A;  2JSP A;  2JT1 A;  1W36 D;  4BYY A;  3QYE A;  4JOM A;  4KT6 A;  1K4T A;  3E3V A;  2QSF X;  4C2T A;  1IRZ A;  5K7F A;  1ZLK A;  2MA3 A;  5E8I A;  2R0Q C;  3N4M A;  3S14 J;  1D3Y A;  2GXB A;  2EIN H; 
#chains in the Genus database with same CATH homology
 4KIF A;  2ZME B;  2MLG A;  4Y15 A;  2HKX A;  1ZRD A;  1IAW A;  1R58 A;  3KP5 A;  4U0W A;  3IKV A;  1Z05 A;  1FBQ A;  1FZP B;  2M45 A;  3MFK A;  5D8L B;  5D5X B;  3HSR A;  2HEO A;  1FYM A;  2OA4 A;  2FBI A;  1YS7 A;  3WU1 B;  1MJ9 A;  4LB6 B;  5TRD A;  1J9I A;  2UXX A;  3QP6 A;  3REO A;  4GYG A;  3W6J B;  2RVC A;  3BWG A;  5D6F A;  2EB7 A;  1WKM A;  1BI1 A;  3WU0 A;  3I59 A;  5HLH A;  2CFX A;  2HR3 A;  3I53 A;  1XMA A;  3E6M A;  5D4R A;  1UCR A;  1BI3 A;  1R5H A;  2K4J A;  4HDV A;  2GZW A;  3ROU A;  1G6N A;  1SD7 A;  3BP8 A;  3GWZ A;  5HS7 A;  3MZH A;  5FFZ A;  2DPD A;  2OU2 A;  4GO1 A;  1ZAR A;  2XAQ A;  3LFK A;  1R5G A;  2P7V B;  2JSC A;  4LFU A;  1D8J A;  4ZYH A;  2A69 F;  4RB1 A;  2P5K A;  2RKH A;  3ABU A;  1XSX A;  4UVB A;  4HQM A;  5DCF A;  1F9N A;  2MH2 A;  2QEN A;  4QWQ A;  1BI0 A;  4Y13 A;  2QWW A;  5CLS A;  1IXS B;  4KIC A;  3IL2 A;  2XRN A;  2M5W A;  4CYD A;  4MEY F;  2RC4 A;  3DEU A;  4ZYE A;  1JHF A;  2QLZ A;  1BIA A;  2HQN A;  4RAY A;  1ON1 A;  1IN6 A;  2PEX A;  5E20 A;  2AXL A;  3I0T A;  2DPU A;  1KYZ A;  5FFX A;  4HOB A;  1DPU A;  3QP5 A;  3I64 A;  4Q4Z F;  1H9T A;  2NS0 A;  4EJT A;  3D0S A;  2E7W A;  2KJC A;  3IC7 A;  1FBU A;  1QBJ A;  2XKP A;  5JVT A;  1E2X A;  2GQQ A;  2Z3Y A;  3LAJ A;  3BY6 A;  2ISY A;  4CIC A;  1K78 B;  1OPC A;  3BZ6 A;  2ISZ A;  1S29 A;  4ASN A;  3VEP A;  2A68 F;  1XMK A;  3ABT A;  1R7J A;  2KIF A;  2DAO A;  2L54 A;  1LDK B;  4CHU A;  4KDP A;  3E6B A;  2ZNY A;  3CO6 C;  3GFJ A;  4RB0 A;  3IHU A;  4M6X A;  4H0E A;  1KQ8 A;  3L00 A;  2MC3 A;  1B59 A;  3HOS A;  3RKW A;  2FNP A;  4OIN F;  1IN8 A;  1SMY F;  3GLX A;  2O03 A;  2V6C A;  3FMS A;  3T0Y A;  4EV0 A;  5AIP A;  3ZN1 A;  1RZ4 A;  2KKO A;  2KRF A;  4A6E A;  4ZYD A;  3M1E A;  2FU4 A;  4HYE A;  3KEO A;  1YS6 A;  1KGS A;  2XAF A;  1BC8 C;  4NQW A;  3E5X A;  5L3E A;  2VT2 A;  1KU3 A;  4YII A;  2JPB A;  3TGN A;  1TNS A;  3ZN0 A;  1RIO H;  5JHU A;  1YG2 A;  4BH9 A;  3WGH A;  3T8R A;  2EFO A;  3LA3 A;  1FWZ A;  2XAH A;  4ENN A;  3PQJ A;  3RPU A;  3IWF A;  2YU3 A;  1H0M A;  1OKR A;  2RQP A;  2OBP A;  1U2W A;  1OMI A;  2CG4 A;  3RKX A;  1J7K A;  1PDN C;  2PBI A;  1MDM A;  3VB2 A;  5HVQ C;  3V8K A;  3GW2 A;  1MZB A;  4RAZ A;  3RKY A;  1K79 A;  3NRV A;  3HSF A;  4ESJ A;  1U78 A;  1V3F A;  2JZY A;  5E1X A;  1ZG5 A;  5FLX K;  4M6Y A;  2COM A;  4IJA A;  3CUQ B;  3PQK A;  3F8C A;  2H94 A;  3P7N A;  5EEH A;  3QAH A;  4LGW A;  4M71 A;  2EV0 A;  3RIR A;  1TW3 A;  4Z2Y A;  5BPD A;  3BJ6 A;  1IUY A;  4WXC A;  1SFU A;  4KYW A;  4A6D A;  3FMR A;  2VBW A;  3T8T A;  3ECH A;  4IHT A;  3F72 A;  4AIJ A;  4RGR A;  5KVR A;  2QUF A;  3K1P A;  4OOI A;  5CVI A;  3T5X A;  5JR3 A;  2B0L A;  2STT A;  5HDG A;  1HKS A;  2DLL A;  5HOO A;  1Z9C A;  2DT5 A;  4U7D A;  3WGG A;  3M9A A;  4M9X A;  2ZJ2 A;  3HHG A;  4PCQ A;  1STZ A;  4ZYG A;  2V79 A;  5LGU A;  1TQI A;  3P9I A;  3KEQ A;  1D8K A;  1FY7 A;  4XLP F;  1TQM A;  1QPM A;  2LNB A;  1O7F A;  5FD6 A;  5J6X A;  4HAM A;  4KFC A;  2G7U A;  1Z1D A;  2V1U A;  2MBF A;  5D5W B;  4O5V A;  1TBX A;  4XSZ F;  2FA5 A;  3HTS B;  2L4A A;  3WTW C;  3KP4 A;  2L4M A;  3ZMS A;  5DD4 A;  2Z9O A;  1FSE A;  2ZNZ A;  4AWX B;  1WRJ A;  2IJL A;  4WWC A;  2V1X A;  3HSE A;  5L3C A;  1Z6R A;  3J81 K;  5L3D A;  4ZZD A;  1FPQ A;  3ISP A;  3GEZ A;  3S2W A;  3RJP A;  2XAS A;  1R1V A;  2JPC A;  4L9T A;  3K0L A;  1GVJ A;  4UHT A;  1SMT A;  2WV0 A;  1J5Y A;  4CGZ A;  2HYF A;  2R7F A;  1PP8 F;  5LRS A;  4L0Z B;  1I27 A;  1W7P B;  3Q5F A;  1NHA A;  3WGI A;  3RPQ A;  2W57 A;  5CVJ A;  2YSR A;  3LA2 A;  4EM2 A;  1D5V A;  1OR7 A;  1LNW A;  2OZU A;  4KIG A;  1P4A A;  2DQL A;  2RN7 A;  4PDK A;  4LG0 A;  2EFQ A;  1O3Q A;  5JFR A;  3IKT A;  2XAG A;  3BDD A;  2CSO A;  3VFZ A;  1ZRF A;  1CF7 B;  1FYL A;  4U0Y A;  3ZP5 A;  1EH7 A;  1UB9 A;  1W5T A;  1UHM A;  4ZH4 F;  2XRO A;  2FMY A;  1QQI A;  1QGP A;  3F8F A;  4UVA A;  5ICF A;  3DFG A;  4ENM A;  3V8J A;  4KNY A;  4RB2 C;  1CGP A;  4P96 A;  3VOE A;  4HBL A;  4GGG A;  3GFM A;  3F6O A;  2VON A;  2G9W A;  2VBX A;  3U2R A;  3IRR A;  2WC2 A;  4AD9 A;  3U1D A;  1EV7 A;  2P8T A;  3NQO A;  3ZMZ A;  3QRF F;  3KP2 A;  3HRU A;  4EJW A;  1UHW A;  2H09 A;  1R22 A;  2IVM A;  2Z99 A;  1G3T A;  4GCV A;  5IT3 A;  1ZLJ A;  5AON A;  5ILV A;  3F6V A;  2P6T A;  4HV5 A;  3GYH X;  4XRF A;  4L9J A;  2H6B A;  2EA4 A;  2ETH A;  1LB2 A;  3HOT A;  5D5V B;  2RNJ A;  3GZ6 A;  4L9V A;  3ZMU A;  2FNA A;  3I59 B;  1FBS A;  4OMY A;  1MD0 A;  5A2Q Z;  1XGM A;  2D2W A;  2Z33 A;  1RNL A;  4G94 A;  3I5U A;  2BV6 A;  4IXA A;  4WX9 A;  3KE2 A;  4CXF A;  4G7H F;  3CTA A;  3VOD A;  3CDH A;  1SFX A;  1HST A;  2M30 A;  5ICG A;  1XCV A;  3WE3 A;  3K2Z A;  5ERI A;  4HF2 A;  4LLL A;  3WOD F;  3KZY A;  1QZZ A;  4KA4 A;  3R0J A;  3MQ0 A;  2KIM A;  5L3F A;  2CWE A;  1W5S A;  1IRF A;  4FX4 A;  1PP7 U;  4LLN A;  2O0Y A;  2PQ8 A;  4EVI A;  5BMZ A;  3QOP A;  2PJP A;  4YFN F;  2K4B A;  4KUM A;  1GHC A;  4HDU A;  3LQQ A;  4L9N A;  3BPV A;  4WCG A;  3KP6 A;  1TQP A;  5HS9 A;  3QU3 A;  4B8X A;  1ZRE A;  4PGG A;  5ICE A;  4UV8 A;  3HYI A;  4A12 A;  3M7G A;  3GXO A;  2M87 A;  4KN4 X;  3GVA A;  2ACJ A;  2BYV E;  5H6R A;  2QQ9 A;  2OZ6 A;  4RGU A;  2PMH A;  2A6E F;  5HLG A;  4G8X A;  5LBQ A;  2QQA A;  1VTN C;  3C7J A;  1I1G A;  3F3X A;  1K6O A;  2STW A;  2BEO A;  5DCM A;  3K69 A;  4ENJ A;  5A2Q K;  4HX7 A;  5BOX A;  2M8E A;  1TTY A;  1FNN A;  2D1V A;  4N9I A;  1J0R A;  3R0A A;  1B6A A;  1ZYR F;  2BE5 F;  4WK8 F;  4O3M A;  5FB2 A;  3MEX A;  3J80 Z;  3HIF A;  2JTV A;  5LGT A;  4GYI A;  1XDU A;  3I58 A;  2M1B A;  4UXN A;  1DUX C;  4WXD A;  4AIH A;  3U9G A;  3OOP A;  1PUE E;  1E17 A;  2DFI A;  2K27 A;  2GWR A;  1SD6 A;  2GA2 A;  3GFL A;  1XGO A;  1IW7 F;  3BJA A;  4UV9 A;  1YLF A;  3H92 A;  3C18 A;  2NRA C;  2FRH A;  3F8M A;  4F7Z A;  1ZRC A;  3JSP A;  1IXR C;  1DPR A;  5DV5 A;  1Y0U A;  1WWX A;  4EM1 A;  4OIP F;  2FML A;  4BQA A;  2K86 A;  3SFZ A;  3FXU A;  4LK0 F;  1OYI A;  4YFK F;  3FXQ A;  4JQF A;  1SD4 A;  1MDM B;  3GZ5 A;  5FO5 A;  4HA8 A;  2L02 A;  4Q48 A;  2IRF G;  4RGS A;  4FX0 A;  5ILS A;  4I0A A;  3L9F A;  4CDG A;  2RGV A;  4I7H A;  3J80 K;  3WTU C;  2DBB A;  4EJO A;  1KQ9 A;  2MH9 A;  4U0V A;  2EFW A;  1O3T A;  2FQ3 A;  4HQE A;  1ZG1 A;  4B09 A;  1YQA A;  1U3E M;  4IRH A;  1HW2 A;  2HFH A;  2F5E A;  5CJ9 A;  4WXH A;  2W85 A;  1RI7 A;  2VC1 A;  5HDN A;  5L3B A;  3KET A;  4ESB A;  3KP7 A;  2VE8 A;  3Q9S A;  1LDJ A;  5L3G A;  3JW4 A;  1OYW A;  4IVN A;  2XUB A;  2RV8 A;  3HHH A;  3F22 A;  2P7C B;  1YW7 A;  1FOK A;  1ZN2 A;  4MQ9 F;  6PAX A;  1XSV A;  1GXP A;  3BRO A;  5E8G A;  1U5T A;  4RB3 C;  3P9K A;  2QZ8 A;  2L01 A;  1HBX G;  4L0Y B;  2KIU A;  1WSU A;  2GAU A;  5ED4 A;  2D1H A;  2ZCW A;  3KLO A;  3I4P A;  1KU7 A;  2UZK A;  3DQV C;  2XVC A;  1LEA A;  3J7A O;  2VBY A;  1JE8 A;  1LEB A;  1J75 A;  1FT9 A;  2DTR A;  1USS A;  1QO0 D;  4LD5 A;  3V4G A;  2FBH A;  2VN2 A;  2IA0 A;  3IRQ A;  2P5V A;  2W84 A;  3DF8 A;  2F2E A;  2HS5 A;  1O57 A;  1W7P D;  3HRM A;  1WI9 A;  3K9T A;  4A5M A;  3SXY A;  3WTZ A;  2E1N A;  3DXJ F;  4RS8 A;  4MNU A;  4G9Y A;  3COA C;  1BBY A;  2FBK A;  1DP7 P;  4A5N A;  1U5T C;  1ZHF A;  1KU9 A;  3HRS A;  4FT8 A;  5LEJ A;  3GFI A;  1J59 A;  1EH6 A;  1YO5 C;  1XGN A;  3IWZ A;  3LWF A;  4I0B A;  2PN6 A;  3V7C A;  4I01 A;  2QQB A;  1ON2 A;  3SHF A;  3F8B A;  1HQC A;  1MJA A;  1ULY A;  2CGP A;  5HLI A;  2F5C A;  4R79 A;  2IA2 A;  3TKY A;  2ADU A;  5F64 A;  2OD5 A;  2R7D A;  4I98 B;  4EMS A;  1L3L A;  4G6Q A;  4HV6 A;  4P55 A;  2LDU A;  4I2O A;  2R3S A;  5ICC A;  4LB5 A;  4DQ2 A;  2EA2 A;  3ELK A;  5IT9 Z;  4LG0 B;  5LHI A;  2UWM A;  2E1C A;  3CJN A;  3GO5 A;  3F8N A;  1KA8 A;  1T38 A;  1ONV A;  2Q0O A;  1KU2 A;  2PFB A;  3TO9 A;  1G3Y A;  2EJR A;  1O3S A;  3W6K B;  4L5I A;  2L3D A;  3KCC A;  1O7L A;  4LJZ F;  2XV4 S;  4Q47 A;  3TDU C;  3DKW A;  2CW0 F;  2ESN A;  1K7A A;  3F23 A;  3LQR A;  1HKT A;  5D5U B;  2GA1 A;  4OIQ F;  1W4M A;  1RUN A;  3E5U A;  3MWM A;  1MGT A;  2HKO A;  2HTS A;  2QM3 A;  3L7W A;  2OAZ A;  3V8L A;  2HTJ A;  4M9Z A;  4HF1 A;  2K02 A;  2G7H A;  4NB5 A;  1YTY A;  3MCZ A;  2H27 A;  2QBY A;  4LK1 F;  4E70 A;  3B02 A;  1S7A A;  1FP2 A;  2F5D A;  2IP2 A;  3P9C A;  3LST A;  3LAP A;  2NNY A;  3WTT C;  3RYR A;  3I71 A;  4HX8 A;  4Y17 A;  2VOD A;  1S7O A;  5IT9 K;  3NEU A;  1BI2 A;  4YIF A;  2IW5 A;  2GXG A;  4L18 B;  2YR2 A;  1RUO A;  4P5O A;  5DUI A;  4ENK A;  4Q5S F;  1P4W A;  4EGY A;  2W25 A;  5DUK A;  4G7O F;  5CVR A;  1LVA A;  2PG4 A;  3ZPL A;  5DEQ A;  1T0F A;  2XGX A;  4KIB A;  3WTS C;  5LHH A;  5HDK A;  2P6S A;  2O61 A;  5CVV A;  4MHG A;  4L5J A;  5LHG A;  2ZFW A;  1XD7 A;  3KP3 A;  5LGN A;  3WTX C;  3TOB A;  1V4R A;  4KMU X;  2EFP A;  3FX3 A;  2YPR A;  1T2K A;  3L2C A;  5LEK A;  4KT5 C;  3OV8 A;  2OQR A;  3E6C C;  1JHH A;  4EQQ A;  3EQL F;  4G7Z F;  3O6B B;  3RTR A;  4ZZL A;  4PZJ A;  2XAJ A;  2ZME A;  1DDN A;  5TJJ A;  2LKP A;  4G6D A;  3WTY C;  1U6G A;  1JXS A;  5KK1 A;  1IN5 A;  1XGS A;  4QLC U;  4HW0 A;  2W24 A;  1MJB A;  3BPX A;  4IHS A;  5CYV A;  3D5L A;  2H6C A;  1IZ1 A;  5BQT A;  2LF7 A;  5DCM B;  3ML6 A;  4R8H A;  1R1T A;  5H6Q A;  2Q8K A;  3TOA A;  1AOY A;  1B1B A;  2OQG A;  2RDP A;  1R1U A;  2DK5 A;  4YG2 F;  1FX7 A;  2Y48 A;  2CQK A;  4U88 A;  4ESF A;  1UST A;  3FXR A;  2P5L C;  1XCB A;  3TDZ C;  4OMZ A;  3FMQ A;  2EV5 A;  5EEG A;  1ZGA A;  5F6F A;  3T1B A;  1P4X A;  4XBF A;  3DPL C;  4YFX F;  2D45 A;  2EK5 A;  2Z5U A;  4LMY A;  4UUV A;  3M8E A;  2HWV A;  4M74 A;  3TQN A;  2O8X A;  3CO7 C;  3WTV C;  3R60 A;  4MGR A;  3B73 A;  4UNO A;  3TO6 A;  1JGS A;  3EET A;  1HXD A;  2DQR A;  2HZT A;  1X3U A;  3E97 A;  3N97 A;  1IN7 A;  4R1H A;  4P9U A;  3GF2 A;  1F1Z A;  4HZF A;  2E7X A;  1Z7U A;  1S6L A;  3I54 A;  4DNC A;  4S05 A;  4OIO F;  2CYY A;  2NYX A;  2ZBK A;  3MAJ A;  4K2E A;  3K1N A;  2QYO A;  4GXO A;  3TO7 A;  1B9N A;  1T39 A;  1IXC A;  2KJB A;  4P9F A;  1LQ1 A;  4HF0 A;  2HDC A;  4M73 A;  3G3Z A;  3R6S A;  1U8R A;  1T98 A;  2NAZ A;  2ESH A;  5FLX Z;  3FHZ A;  1MKM A;  2DI3 A;  3KLN A;  4S04 A;  2BGC A;  5E17 F;  2V1D A;  2X4H A;  1G3W A;  3FM3 A;  2LF8 A;  3BOQ A;  4LLG F;  2WTE A;  1FSH A;  2Q2E A;  2PMU A;  4IRG A;  3Q9V A;  3R61 A;  1K78 A;  3HTU A;  2MLK A;  2O6G E;  3SZT A;  2DU9 A;  4IRI A;  4BAY A;  2QVO A;  2A6H F;  3RDI A;  4I09 A;  4HX4 A;  5FD5 A;  3FZV A;  4BHC A;  1U5T B;  1F4K A;  1ZGJ A;  4IPA A;  2DO7 A;  3C3W A;  4EJV A;  4O6J A;  3ULQ B;  1ODD A;  4A0X A;  1IF1 A;  2J5O A;  3O2P E;  4OIR F;  2FF4 A;  1S8N A;  5K5Q A;  2ZO4 A;  1KYW A;  3EYY A;  2FXA A;  2IA1 A;  2VT3 A;  3DV8 A;  1BJA A;  2IPQ X;  1EH8 A;  3ZMD A;  5J8F A;  3G73 A;  2XKO A;  3LA7 A;  3KFW X;  4EGZ A;  3BJO A;  1L0O C;  3CUO A;  3M8F A;  5CVU A;  2FE3 A;  1FLI A;  4M9S A;  1XSD A;  1KQ0 A;  3SZP A;  4I02 A;  2HQR A;  2ELH A;  5DDG A;  5JI6 A;  4MQV A;  1B4A A;  2PLY A;  4FHT A;  4EJU A;  1YW8 A;  1R36 A;  1P92 A;  2FEZ A;  1I6X A;  1FYK A;  3AAF A;  1QZY A;  1XDS A;  1T6S A;  5LLQ A;  5D4S A;  3V7S A;  2K7L A;  3WE2 A;  4OU0 A;  2A61 A;  3JAM Z;  1O3R A;  1LDD A;  2ZXJ A;  5AIQ A;  4TV7 A;  5DD8 A;  3GUD A;  2HYG D;  1F5T A;  1LJ9 A;  2XHK A;  2NNN A;  1ZH5 A;  4U7B A;  4MEX F;  3H3Z A;  4EM0 B;  1P2F A;  2UXN A;  3JTH A;  3J81 Z;  3GX4 X;  2VOO A;  3O3K A;  3QU6 A;  2WWY A;  2VOP A;  5D6E A;  2EWN A;  1BIB A;  1YW9 A;  3CUQ A;  1ZAO A;  4MTD A;  4CZZ A;  4UVC A;  3EYI A;  2FOK A;  3H3U A;  4A0Z A;  1BC7 C;  1FP1 D;  4BNC A;  2FSW A;  1A04 A;  4N0B A;  1SFE A;  1OYY A;  3ZQ7 A;  1C0W A;  3PFI A;  1R00 A;  5F1R A;  3EDP A;  4M72 A;  3JTG A;  1I1S A;  2V9V A;  1H9G A;  1G4D A;  2X0L A;  1Z91 A;  1HKQ A;  1YYV A;  3ECO A;  1XB4 A;  2MD5 A;  4AVP A;  3F21 A;  1ZG3 A;  3DP7 A;  3QPH A;  4JK1 X;  3QPT A;  1SAX A;  1HSJ A;  2J5P A;  5H20 A;  4HLY A;  5E18 F;  2LSO A;  3V7R A;  3JAM K;  2PI0 A;  5K5O A;  2ZKZ A;  4BHB A;  2GIV A;  2HOE A;  1BN5 A;  3ZMV A;  3CUQ C;  3DPT A;  2A07 F;  2CO5 A;  2IT0 A;  4KMF A;  1HW5 A;  5DYM A;  4JBA A;  4IF4 A;  1SD5 A;  2A3S A;  1S3J A;  3FF5 A;  1QNT A;  4N9H A;  1Z6T A;  2A5Y B;  3ERE D;  4ETS A;  4AIK A;  4RGX A;  1GXQ A;  1HW1 A;  3ZMT A;  2F5F A;  3HRT A;  3RI4 A;  1XN7 A;  3SQN A;  4CO8 A;  1TNT A;  5K1Y A;  2VE9 A;  2QBY B;  2BBY A;  1Q1H A;  1R23 A;  3CLO A;  4XSX F;  1TLH B;  1AWC A;  5E1W A;  1B9M A;  1BM9 A;  2HGC A;  5FGM A;  4BHP A;  2P4W A;  5BS6 A;  2C6Y A;  2AS5 F;  3R4K A;  4MTE A;  1J2X A;  2YX4 A;  2DW4 A;  2O3F A;  3FWE A;  4PGH A;  2Y0M A;  5J8C A;  5LRR A;  4ON0 A;  1WQ2 A;  3E5Q A;  2XIG A;  3RYP A;  3MZY A;  1IN4 A;  4XLN F;  3C1D A;  4BXU A;  1REP C;  5D8K B;  3JSO A;  1IRG A;  3KZZ A;  3HUG A;  1W7P A;  1YIO A;  1FC3 A;  3E6D A;  2TDX A;  1I5Z A;  4HLX A;  4A2U A;  1TW2 A;  5HS8 A;  2YX7 A;  2JRT A;  2EFN A;  2Y75 A;  3EUH A;  2DK8 A;  2EV6 A;  2VBZ A;  1P6R A;  4WF2 A;  1G3S A;  1BOA A;  5ILU A;  1UFM A;  2VXZ A;  4D0P A;  5K5R A;  4A0Y A;  5BPI A;  1CF7 A;  4NHJ A;  3K1M A;  3L09 A;  4KN7 X;  3WG9 A;  1YFH A;  5E1Z B;  3FM5 A;  2VC0 A;  2JT1 A;  4BYY A;  3E3V A;  1ZLK A;  2MA3 A;  5E8I A;  3N4M A;  1D3Y A;  2GXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...