4LLNA

Crystal structure of s. aureus mepr-dna complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
137
structure length
137
Chain Sequence
FTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MepR
publication title Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
total genus 50
structure length 137
sequence length 137
chains with identical sequence B, C, D, I, J
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4llnA00
1FNNA 2XVCA 2Z5UA 4ZYEA 1YQAA 4HAMA 2IA1A 4M72A 1XCBA 1F9NA 4HOBA 2A6HF 1G4DA 2ZBKA 2DK8A 2D45A 3W6KB 2A69F 3HTSB 1K79A 2XAQA 1OPCA 3QP6A 1MJBA 2VBYA 1S7OA 2RGVA 1O3RA 3SZTA 2F5DA 3I58A 2P7VB 4KYWA 3WU0A 1RZ4A 4A0YA 3JSPA 2STTA 1IXRC 1WI9A 1R00A 3GFIA 4QLCU 3WTYC 1FYMA 2A6EF 2E7WA 1HSTA 4EJOA 3ZMSA 4YFXF 3E3VA 2HOEA 3CO6C 1XGSA 2MC3A 3ZMTA 4LG0B 1STZA 3B73A 3GYHX 2PJPA 3E6BA 4HBLA 3E6CC 4U7BA 4HF1A 2NNYA 3HTUA 4I01A 4Y17A 2F5FA 4PCQA 4L5IA 5DCMA 3BROA 1RI7A 3VODA 4KIFA 4MEYF 4LK0F 3F3XA 4IVNA 1DP7P 4LB6B 2VE8A 5LGTA 4CDGA 3GLXA 4AIKA 3M9AA 3DP7A 3E5QA 1YIOA 4A6DA 4RAZA 4EJWA 3SXYA 3FM5A 1J59A 2STWA 5H6QA 2EFNA 4KN7X 2ELHA 1USTA 5DDGA 3J7AO 3DPTA 1KA8A 5BQTA 2BGCA 4KIBA 4Q48A 1IF1A 2L01A 3E5UA 2V6CA 2VC1A 3QU3A 3HHGA 4L0YB 3RI4A 2V1XA 1MZBA 1QZYA 4WF2A 5J6XA 4KMFA 2H09A 2FBKA 1KYWA 5D5WB 2EV5A 2VXZA 5ILUA 5E8GA 3DXJF 2CO5A 3WTSC 4EMSA 2IRFG 1QO0D 5CYVA 4N9IA 1IRGA 2WTEA 4ASNA 4LJZF 1ZRDA 5E1XA 1MD0A 3LWFA 2ZXJA 1PDNC 5BS6A 4ENMA 2VN2A 2FE3A 3KLNA 4I09A 1J0RA 4HLYA 2HGCA 3KLOA 2XHKA 3TOAA 2VT3A 4O6JA 1R22A 5DUIA 4D0PA 1FSEA 2OD5A 3LAPA 3ZN1A 5E17F 3KP5A 3REOA 3F8BA 1HBXG 1OMIA 2F5CA 5CVIA 4JQFA 1OYWA 5CVUA 2J5PA 1D8JA 2GAUA 3IC7A 4EGYA 2O3FA 1IN6A 5JR3A 1OYYA 2DU9A 3MFKA 1GHCA 1ULYA 2IVMA 2A3SA 3HRSA 2C6YA 2EB7A 3WTUC 2Y75A 2Y0MA 1FPQA 2VC0A 3T1BA 2M87A 3L9FA 2L4AA 5H6RA 2W84A 3GX4X 2PQ8A 5LHGA 5FLXZ 2ZMEA 1XSVA 5HDKA 1SFUA 2MLGA 2GA1A 4M73A 4P9FA 5FD5A 4EV0A 1XGNA 1T2KA 1F4KA 1O7FA 3DEUA 1LEBA 2IA2A 1SD6A 3ZQ7A 3TDUC 4MGRA 1LJ9A 1W7PD 1YG2A 2P5VA 3F22A 1BI1A 2YSRA 4M71A 3EYYA 4UVAA 1SAXA 5JI6A 5CVJA 4GXOA 3L7WA 2DW4A 3GFJA 2OZ6A 2LKPA 1DPUA 1R7JA 3T8RA 3IRRA 5HVQC 4M74A 3COAC 4PDKA 4S05A 5HS9A 4GGGA 3H3ZA 1H9GA 2MH9A 4LMYA 2NRAC 5H20A 2PMUA 1I27A 2FNPA 1P92A 1Q1HA 1XSDA 1F5TA 2EV0A 2HR3A 2XAFA 3HRMA 4L18B 2HYGD 4OIQF 2YX4A 2OQRA 2DPDA 5F6FA 1BIBA 2RV8A 2Z3YA 4R79A 4LGWA 2VOOA 1IUYA 1BI2A 1IXSB 2K7LA 3IWFA 3KEQA 4HX7A 5K5RA 2YR2A 4ESJA 1R36A 3F21A 1ZYRF 3O6BB 2QBYA 5LBQA 3K1NA 3I59A 2GA2A 2QM3A 1QBJA 3P9IA 2HQNA 2CW0F 3CTAA 1S7AA 4YFKF 1FZPB 2UZKA 1P2FA 2E1CA 1K78A 5BMZA 5KVRA 1ZRFA 2O6GE 1P4XA 4RB1A 5FFXA 1GVJA 3HUGA 4RB3C 4I02A 4UV9A 1FBSA 3G3ZA 3OV8A 2WV0A 1IN7A 5BPDA 1FBQA 3M8FA 5LRRA 5IT3A 3RKXA 3ECOA 1ZARA 4FX4A 3I59B 1WRJA 1KYZA 1FY7A 3GXOA 1JXSA 4RB0A 4OINF 3WTVC 4XSXF 1XN7A 4AWXB 1R1VA 1A04A 1MKMA 3E5XA 2K02A 4UXNA 2HDCA 3GZ5A 1XD7A 2G9WA 4LLGF 4A0ZA 2BBYA 4ZZLA 3QOPA 1IXCA 2HZTA 1U5TC 1B6AA 3GWZA 3ABUA 1XDSA 2XIGA 1BC8C 3GUDA 3DFGA 3LA7A 3RIRA 1HKTA 1R58A 4MEXF 3QPHA 3ULQB 1T38A 2QENA 4DNCA 3JAMK 1IZ1A 2H6CA 4EJTA 3KCCA 1B1BA 3TDZC 3G73A 1FT9A 2HFHA 1Z9CA 1PP7U 2GIVA 4MNUA 1BM9A 4ON0A 3V7CA 4HX8A 5LLQA 3FF5A 3O2PE 2CSOA 2NAZA 5LEKA 1UFMA 3GW2A 1YW8A 2F2EA 4G6DA 4M9SA 2DK5A 1HSJA 1SD5A 1U78A 1LNWA 2MH2A 2O0YA 3R0JA 4MTDA 2RN7A 2XV4S 1ZRCA 3U2RA 3Q9VA 1SD4A 1ZGJA 4G94A 2DLLA 1R5GA 1JHHA 5D6EA 3IWZA 4ENKA 3KETA 1I1SA 1SD7A 4HQEA 3HIFA 1DDNA 1YO5C 2FQ3A 1O57A 4IF4A 1ZN2A 3F6OA 1B9MA 1U3EM 2VBXA 2KIMA 1S29A 3RPQA 1MJ9A 5ILSA 4LG0A 4TV7A 1G3YA 3HOSA 3ZMUA 2UWMA 4YIIA 3FMRA 1U8RA 2P5LC 4P55A 1B9NA 3CJNA 5CVVA 2QLZA 2CFXA 4UV8A 4OIOF 5E1WA 4M6XA 1HW2A 3I0TA 4GO1A 2ESHA 3ECHA 1TQPA 4FT8A 2JTVA 2HEOA 1IN5A 3M7GA 2EA2A 5EEGA 3VEPA 1QZZA 5ICEA 2QWWA 1XGOA 4Z2YA 3WGHA 5ICFA 1LB2A 4IJAA 3H3UA 2O8XA 2QZ8A 2DBBA 2XKOA 2CQKA 3V8LA 4HV6A 1FSHA 2Y48A 1H9TA 2KRFA 3HHHA 2IW5A 2R7DA 4CYDA 3EQLF 4HX4A 2MLKA 3JAMZ 2GZWA 3C18A 2BEOA 5F64A 4UUVA 3K69A 1BJAA 1W7PB 5D4SA 3CUOA 4CICA 4RGSA 4R1HA 4L9JA 4HF2A 2XAHA 3KZZA 1USSA 2ESNA 1I1GA 4G6QA 3V8KA 2RDPA 5HS8A 2EK5A 5CVRA 1LDDA 1T39A 3ABTA 2GXBA 3BDDA 3R6SA 3QPTA 5A2QZ 2ADUA 1XB4A 2V1UA 1MDMB 4XBFA 3JTGA 4S04A 2CGPA 4BHPA 1P6RA 4IPAA 3E97A 3U1DA 4AVPA 2LDUA 1ZH5A 5HLIA 2MA3A 4EQQA 4EM1A 3RYPA 2PBIA 3PQKA 4N9HA 1ON1A 2FXAA 5FLXK 2RNJA 1EH6A 4MQVA 3SHFA 3CDHA 4BNCA 1FOKA 3OOPA 3WE3A 3WGGA 2FBHA 1F1ZA 4EJUA 2L3DA 1FC3A 4KT5C 1XMAA 5FD6A 1BOAA 3BOQA 1KGSA 5HLHA 4UVCA 2F5EA 3I4PA 4U7DA 2HTJA 1UHWA 1TTYA 5J8FA 1ONVA 2K4BA 5L3CA 5LEJA 4NHJA 1R5HA 4I7HA 4Y15A 5FO5A 2XAJA 3I53A 4HDVA 1IN4A 2FMLA 2IT0A 3HSRA 3FXQA 3WG9A 2PG4A 4U0WA 2Q0OA 3W6JB 2KJCA 1U5TB 4E70A 2VT2A 4I98B 1VTNC 4Y13A 4CXFA 4WK8F 1J9IA 2R7FA 4BXUA 4HA8A 2K86A 1ZHFA 5KK1A 2DQRA 3F72A 1EH7A 4G8XA 3EYIA 3WGIA 2QYOA 1FWZA 5DUKA 4N0BA 1JGSA 1JE8A 2O03A 1MGTA 2D1VA 4XRFA 4ZH4F 3LA3A 5L3DA 1HW5A 2QQAA 1TBXA 2XKPA 4IRHA 3R0AA 4A0XA 4JBAA 4KFCA 4WXHA 3C7JA 2L02A 3SQNA 5L3EA 4ZYGA 1I6XA 1UHMA 1O3QA 3V4GA 3F8MA 5ED4A 1V4RA 2CYYA 3QAHA 3KZYA 4EM0B 1ZLJA 4G7OF 2D1HA 5D5XB 1FP1D 1TQIA 4RS8A 1SFXA 5FB2A 2XGXA 1DUXC 4IHTA 1K7AA 1GXPA 5K5OA 5HDGA 3V8JA 5LRSA 3SFZA 4B09A 4L9NA 2HS5A 2DQLA 5L3FA 4ETSA 2QVOA 1QNTA 4BH9A 4JK1X 4IRIA 4IHSA 4RGUA 4LLNA 4H0EA 2ZJ2A 1W5SA 5TRDA 3VFZA 4HZFA 1BC7C 3MEXA 4EM2A 4EVIA 3HSEA 2Z99A 2ZNZA 2MD5A 1PP8F 3GFLA 2DPUA 3VB2A 1LDKB 1KQ9A 5D5VB 2OAZA 4KMUX 1PUEE 3RJPA 1U6GA 5AONA 2OBPA 4CZZA 1B4AA 3RYRA 1KU3A 4DQ2A 1BI3A 3DKWA 3FX3A 3TO7A 3GZ6A 4ZYDA 1YS7A 3FXRA 3F23A 2BE5F 3O3KA 2A61A 4ESFA 3ZMZA 1KU2A 5DYMA 5DD8A 2JZYA 3FWEA 2OZUA 2EWNA 3I5UA 1LVAA 4KDPA 3TOBA 5TJJA 4AIJA 1E2XA 1G3SA 1ZAOA 1Z6TA 2W57A 2ISYA 3BWGA 1XGMA 5LGNA 3R60A 1X3UA 4OIRF 4A12A 4OMZA 2VBZA 3WTWC 4QWQA 5ERIA 2UXNA 2HYFA 4BYYA 2WC2A 1O3SA 2PMHA 3ZMVA 3MCZA 1BBYA 4P5OA 3CUQB 1HQCA 4P96A 4NB5A 5JHUA 1R23A 4A5MA 1QPMA 2G7HA 3FHZA 4L0ZB 2V79A 3E6DA 2VBWA 1D3YA 2Z33A 4HLXA 3WE2A 3BJ6A 1BIAA 3J80Z 2ISZA 4LB5A 1ZG1A 4KUMA 1XDUA 4MHGA 4OMYA 2PLYA 4UHTA 3H92A 2FA5A 3LQQA 1L3LA 4UVBA 1WKMA 3LFKA 3DV8A 1G3TA 1FYLA 2EV6A 3MWMA 2ZNYA 2QUFA 3ZMDA 4HDUA 5D6FA 3LSTA 2JRTA 4EGZA 5IT9Z 3V7SA 4G7ZF 1ON2A 2VOPA 4WX9A 3BY6A 4PGHA 2M5WA 2EA4A 4BHBA 4ENNA 3WTTC 2FMYA 2D2WA 3F6VA 5J8CA 1YW7A 5HDNA 1LQ1A 1D5VA 2A5YB 2HQRA 1CGPA 4XSZF 3N4MA 5D4RA 4HQMA 1HW1A 4A6EA 4I0BA 5A2QK 1ZG5A 2BV6A 3GFMA 1FLIA 2V9VA 2K4JA 3V7RA 1B59A 2KIFA 5JVTA 2VODA 2IPQX 4Q5SF 3M8EA 1ZGAA 1G3WA 3P9KA 4I2OA 1YLFA 3ROUA 2P7CB 1AOYA 2FSWA 1FBUA 3BPVA 3J81Z 3MZYA 5FGMA 1T6SA 1S6LA 2GQQA 2LSOA 1Z1DA 2P4WA 2X0LA 3HRTA 3PFIA 1W7PA 1P4WA 3HRUA 1SMTA 3TKYA 4MQ9F 5F1RA 2JT1A 1S3JA 1BI0A 2P6SA 3T0YA 4AD9A 1UCRA 2OA4A 3D0SA 4L5JA 2XRNA 4CGZA 2UXXA 3BJAA 1ZLKA 4U0YA 1TLHB 4L9VA 4WCGA 1MDMA 2Q2EA 3JW4A 3I54A 1ODDA 4WXDA 1RIOH 1RUOA 2HTSA 5L3BA 4KIGA 3ZN0A 1RUNA 3K1MA 2LF8A 1YFHA 4KNYA 1L0OC 2QQ9A 5DEQA 2EFOA 3QP5A 4BAYA 3BPXA 2BYVE 5AIQA 1V3FA 1WWXA 1IN8A 1CF7B 1OKRA 4OOIA 2HKXA 3C3WA 5HOOA 2YPRA 1HXDA 2V1DA 2PFBA 5K1YA 3GO5A 2XROA 2B0LA 2ACJA 4LD5A 1YS6A 4CO8A 2H94A 3FZVA 2M8EA 3B02A 1YYVA 2X4HA 2YU3A 5JFRA 4I0AA 2EFWA 3WODF 3K0LA 1U2WA 4A5NA 4ENJA 3RDIA 2IJLA 3I64A 1T0FA 5D5UB 5LGUA 4KN4X 1Y0UA 2G7UA 1TW3A 3WU1B 2QQBA 4RB2C 3CUQC 4FX0A 3ZP5A 5K5QA 3CLOA 1U5TA 2DO7A 3T5XA 5HS7A 3F8FA 5E20A 3EDPA 1W5TA 4YIFA 3EETA 3ZPLA 2LNBA 3FMSA 2NS0A 3I71A 1O7LA 2DFIA 3MZHA 5D8LB 1C0WA 5CJ9A 4OU0A 2IA0A 1K6OA 2P6TA 3PQJA 3VOEA 1BN5A 3KP4A 2E1NA 5DCMB 3ELKA 3R4KA 5ICGA 2RVCA 2VONA 3LA2A 4HV5A 2R3SA 2JPBA 4P9UA 4UNOA 3KP7A 2A07F 3RKYA 1LEAA 1HKSA 5E1ZB 4LFUA 2HKOA 4F7ZA 4RAYA 2PEXA 2RC4A 1XCVA 1EH8A 5ICCA 4KA4A 2K27A 5E8IA 2H6BA 1KU9A 4ZZDA 1UB9A 3S2WA 3SZPA 3LQRA 3U9GA 2H27A 2RKHA 4O5VA 4AIHA 2CWEA 3IKVA 3KE2A 3WTZA 2XUBA 4L9TA 2J5OA 3MQ0A 1E17A 2P5KA 1REPC 2GXGA 2ZKZA 1J7KA 3GF2A 1IAWA 1Z6RA 2W85A 2KKOA 1I5ZA 4K2EA 4IXAA 2HWVA 4Q4ZF 2ZO4A 3BJOA 1R1TA 3P9CA 5FFZA 2A68F 3BP8A 3IRQA 2ZFWA 1QGPA 1ZG3A 3K2ZA 4ESBA 3QU6A 1YW9A 3C1DA 4B8XA 2EJRA 3FM3A 3CO7C 2PI0A 3IL2A 2JSCA 3T8TA 1DPRA 4XLNF 4BHCA 1HKQA 1FP2A 1WSUA 3RKWA 2OQGA 4O3MA 1TQMA 2WWYA 1KQ8A 1JHFA 4Q47A 4BQAA 3TQNA 2VE9A 3J80K 2P8TA 2CG4A 3E6MA 2XAGA 4YG2F 4PZJA 3L2CA 2KIUA 3NQOA 1J75A 5DD4A 2DT5A 3Q5FA 3MAJA 3BZ6A 4WXCA 3IKTA 3JSOA 2O61A 2IP2A 5IT9K 2ZMEB 1H0MA 1Z91A 3L00A 4GYIA 1FYKA 4YFNF 5E18F 3CUQA 1IRFA 4HF0A 4GCVA 3KP2A 2FU4A 4FHTA 3ERED 1YTYA 4HW0A 6PAXA 2L54A 4WWCA 3TO6A 4G9YA 1G6NA 5EEHA 2Z9OA 2FBIA 3P7NA 2NYXA 1EV7A 1S8NA 1ZREA 1J2XA 3EUHA 1SFEA 3Q9SA 3N97A 3JTHA 3FXUA 1MJAA 3KP6A 5ILVA 4OIPF 3ML6A 3L09A 3KFWX 2EFPA 1OYIA 1QQIA 2FF4A 1WQ2A 5D8KB 2NNNA 3HYIA 5L3GA 3RTRA 3KEOA 3HSFA 1XMKA 3TGNA 2TDXA 2FRHA 3FMQA 2KJBA 2M30A 4KICA 3DF8A 4R8HA 2XASA 1Z05A 4M9XA 2RQPA 3DQVC 3J81K 4M6YA 2GWRA 2Q8KA 1T98A 1W4MA 2E7XA 1J5YA 1XSXA 1GXQA 3GEZA 4MTEA 2JPCA 2AS5F 4GYGA 2DAOA 1KU7A 2FNAA 3IHUA 1KQ0A 1TNSA 1OR7A 2W25A 4PGGA 2QBYB 1TW2A 5DV5A 3HOTA 4ZYHA 1TNTA 3RPUA 5BOXA 1AWCA 2FOKA 3TO9A 4LK1F 2YX7A 3GVAA 3LAJA 3M1EA 1K78B 3F8NA 5AIPA 5LHIA 1SMYF 4G7HF 2DTRA 2W24A 2MBFA 2ZCWA 4CHUA 1Z7UA 4U88A 1LDJA 3WTXC 5LHHA 2COMA 4HYEA 3D5LA 4A2UA 2ETHA 2AXLA 4XLPF 4LLLA 1IW7F 5CLSA 4RGRA 3ISPA 1NHAA 2L4MA 2OU2A 1RNLA 3K9TA 2M45A 4NQWA 1O3TA 3NEUA 2M1BA 5HLGA 4RGXA 2EFQA 3QRFF 3KP3A 3F8CA 1R1UA 4M9ZA 2DI3A 2LF7A 3K1PA 3AAFA 1P4AA 4EJVA 3NRVA 5BPIA 5DCFA 4IRGA 1CF7A 3R61A 2PN6A 1D8KA 3DPLC 2FEZA 1FX7A 4U0VA
chains in the Genus database with same CATH superfamily
1FNNA 2WADA 2IGMA 2XVCA 4XLCA 1SVOA 2LBFA 4G6TB 5M5XJ 2Z5UA 3PL8A 1MMNA 4ZYEA 1YQAA 3C2HA 4Z6YA 4QPQA 4HAMA 2B7EA 2IA1A 4M72A 1XCBA 4XL9A 1F9NA 2RREA 4HOBA 4XLEA 4ZTJA 2A6HF 3BCAA 1G4DA 2ZBKA 1B72A 5EGOB 2DK8A 4RLFA 3K2AA 2K40A 3DBRB 2D45A 2I8DA 4I6ZA 3W6KB 3CCEI 2A69F 2KMUA 4FQGA 3HTSB 1K79A 2XAQA 1OPCA 2BY1A 3QP6A 2UUZA 2HYJA 2K5CA 1TWGJ 1MJBA 2VBYA 1S7OA 3CCYA 3MVPA 4NUBA 4IOCF 2RGVA 4UB6C 1O3RA 2XPVA 2BY3A 2K9LA 2ZMEC 4N4NB 3SZTA 3CC4I 2F5DA 2NOJB 3HC7A 3I58A 1VQ5I 4BQOA 1WJBA 2P7VB 4KYWA 4YRVA 2JJ7A 1MSFC 5IP6A 2OPTA 3WU0A 1N25A 1RZ4A 1Z7LA 2V7FA 4A0YA 3JSPA 3S17J 2STTA 1IXRC 1JKRC 1WI9A 3L2VA 1R00A 3GFIA 3S2HJ 1I3AA 4QLCU 2O8KA 2VKHA 3WTYC 1FYMA 4YIRX 2LOOA 2A6EF 2Y69H 1WJCA 2E60A 2E7WA 1HSTA 3IAS2 4EJOA 3ZMSA 4MLOA 4YFXF 3ZXSA 3E3VA 1UMQA 2EZHA 2HOEA 1E3PA 5F08A 3CO6C 5JHFA 1XGSA 2MC3A 3ZMTA 4LG0B 3HPGA 1STZA 3B73A 2VJJA 1X2MA 2LVSA 1P7IA 3GYHX 2PJPA 3D5RC 3E6BA 3MZ8A 4HBLA 3E6CC 1VQ7I 4U7BA 5FRNA 4NDLA 4HF1A 1FOWA 4Y3OA 2NNYA 3HTUA 4I01A 4Y17A 5CQGA 2F5FA 2L9SA 4PCQA 4L5IA 4JX4A 1UJ8A 2E5ZA 5DCMA 3BROA 1RI7A 4QPOA 3VODA 2OF7A 2PX9A 4KIFA 3S1QJ 4MEYF 4LK0F 3KYCB 3F3XA 4IVNA 5HNHA 1DP7P 4LB6B 1Y6IA 2VE8A 4DBQA 5LGTA 2HNHA 3KEYA 3CMEI 3H0GJ 3GLXA 3ZQIA 4CDGA 3OYEA 4AIKA 1XS9A 3CLQA 2JVHA 2KISA 3M9AA 1WVRA 5FKNA 1X1AA 2KLOA 3CCRI 3DP7A 3A01A 1ORKA 3E5QA 1YIOA 3ABKH 4A6DA 1W1WE 2I5UA 4RAZA 4EJWA 2HQ5A 4HRIA 3SXYA 2Y31A 3FM5A 4N4OB 1J59A 2YUSA 4CCKA 2E36A 5F27A 5H6QA 2STWA 3OYMA 2IS2A 2EFNA 4KN7X 2ELHA 1USTA 3HEFA 5DDGA 3J7AO 2WAQN 3DPTA 3DKXA 2EIJH 2DOAA 1KA8A 3A1YA 2BGCA 5BQTA 2HZDA 4KIBA 2YS9A 1VQNI 4Q48A 1IF1A 2L01A 1OQYA 3E5UA 2V6CA 3OOUA 2VC1A 2DODA 3QU3A 3S8PA 4G12A 3HHGA 4L0YB 3RI4A 1YX5A 2V1XA 3HM5A 4LITA 4BY7J 1MZBA 1QZYA 2AXTC 3GZNB 3I4NJ 4WF2A 3OL3A 5J6XA 3TP0A 4KMFA 2H09A 2FBKA 2ZXWH 1KYWA 3BG7A 4ZYAA 2O9LA 5D5WB 3FK7A 2EV5A 1QA6A 2VXZA 5ILUA 4IL6C 5E8GA 3LFUA 3DXJF 2CO5A 2DA3A 3WTSC 3TBIA 4EMSA 3PUFA 2IRFG 2EZLA 1QO0D 5CYVA 4N9IA 1IRGA 1TL8A 2WTEA 3S16J 4ASNA 1VQKI 4LJZF 1ZRDA 2BHZA 5CPRB 5E1XA 1UG2A 1MD0A 3LWFA 2ZXJA 4B43A 1PDNC 5BS6A 3BC8A 4ENMA 4CA0A 1QRYA 2W82A 3PIOF 2HPMA 2VN2A 2DYRH 2FE3A 1MH4A 2R0QC 3KLNA 2MYSA 4I09A 1J0RA 2BVMA 4HLYA 1FIAA 1PVEA 1D0XA 3QPLA 5BNGA 2HGCA 3KLOA 5B66C 2XHKA 3TOAA 2E35A 2VT3A 4O6JA 2R7TA 1R22A 5DUIA 4D0PA 2Y30A 2Y9YA 1I6HJ 1FSEA 2OD5A 4V19K 3LAPA 1U9OA 4XK4A 3ZN1A 5E17F 3S1NJ 3PNYA 1JI8A 3KP5A 3REOA 3F8BA 1HBXG 1OMIA 2F5CA 5CVIA 2L9NA 4JQFA 1OYWA 4GDFA 5CVUA 2Z2SB 2ID6A 2E1MC 2J5PA 1NG7A 1D8JA 2GAUA 3DCFA 3IC7A 4EGYA 2L7FP 2O3FA 1TP4A 1IN6A 5JR3A 1OYYA 2DU9A 5J3LA 1QVTA 1ULYA 2IVMA 3MFKA 1GHCA 2A3SA 4LIVA 3HRSA 2C6YA 3I9V2 2HU9A 3GTKJ 2EB7A 3WTUC 2Y75A 3ABLH 4BL0B 2JA5J 2Y0MA 1FPQA 2VC0A 3T1BA 2ME0A 3OYFA 2W7NA 2M87A 2R7XA 3L9FA 2L4AA 1GV2A 2VJ4A 2WAFA 5H6RA 2X1EA 2W84A 4LOCA 3GX4X 2PQ8A 3NAUA 1MW7A 3OL4A 4W1UA 5LHGA 3KYLA 2ZXIA 5FLXZ 2ZMEA 3WU2C 1XSVA 1MBHA 5HDKA 1ETKA 2BY2A 3MN2A 3A2KA 1SFUA 2MLGA 2GA1A 2M34A 4M73A 4P9FA 5FD5A 4RBOA 4EV0A 1XGNA 1T2KA 4RM3A 1F4KA 1O7FA 1DU0A 3DEUA 2PMZN 1LEBA 2IA2A 1SD6A 3ZQ7A 3TDUC 1RRJA 5GAEJ 4MGRA 1K61A 4FISA 1MBJA 2G0EA 2O7OA 1LJ9A 1W7PD 1YG2A 2P5VA 1SFKA 3F22A 5E79C 2X48A 4BKXA 2QF7A 4I99C 2XSDC 4Y7NJ 1BI1A 2YSRA 2ZSHB 3W2WA 4M71A 2R93J 3EYYA 4UVAA 2X51A 2JUGA 1SAXA 3I55I 5JI6A 1MNDA 1YHQI 2RNGA 5CVJA 4GXOA 1DQUA 3L7WA 2DW4A 3DWLE 1RPWA 1XTAA 3GFJA 4BJTA 5K7FA 2OZ6A 1U8BA 4X1EA 3RQIA 2LKPA 2WB1N 3UKGA 3HOXJ 1U0JA 1DPUA 5JLWA 1R7JA 3T8RA 3VDXA 4ZDOA 1K4TA 3ZQLA 3GCMA 3IRRA 5HVQC 4M74A 2R7QA 3C2GA 3COAC 4PDKA 3ZQFA 4S05A 2L2OA 5HS9A 3BG9A 1I39A 4BE0A 4GGGA 3H3ZA 4HPQA 1H9GA 2MH9A 4BS9A 2CW8A 4LMYA 3OIOA 2NRAC 3X2QH 3W3CA 4D5CA 5H20A 5KNLA 2PMUA 1I27A 2FNPA 1P92A 2VKEA 2DXIA 3ABMH 1Q1HA 1XSDA 1FIPA 4KT6A 1VF9A 5GTHC 3QYBA 2VPRA 1F5TA 4XKWA 2EV0A 2HR3A 2XAFA 4BACA 3HRMA 2VXDA 4L18B 1TZLA 4MO7A 4HNTA 2HYGD 4OIQF 3MKYB 1W5CC 1AKHB 2VI6A 3E0JB 1VQPI 2YX4A 2OQRA 2DPDA 4AIDA 5F6FA 2L9VA 1BIBA 3ZR8X 3OWTA 3RZOJ 2RV8A 3L2UA 4KISA 2Z3YA 4R79A 4LGWA 3HKZN 2VOOA 1IUYA 1BI2A 1IXSB 2BVLA 3LL7A 4C2UA 2K7LA 3IWFA 3M3YJ 3BZCA 2GIZA 4F93B 5M5WJ 2M0MA 3KEQA 4HX7A 1Z77A 1T08B 5K7HA 5K5RA 3VPRA 3HOZJ 3HXLA 3SDGA 2K9SA 3FIWA 4AC0A 2YR2A 4ESJA 1R36A 4E6KG 2E1OA 2XAUA 3F21A 1ZYRF 2KZVA 1BR4A 3O6BB 2QBYA 5LBQA 3K1NA 3I59A 2GA2A 1V5EA 5C4JJ 3IUOA 2QM3A 3HDDA 4DYCA 3E1SA 1QBJA 3P9IA 1WH7A 5J1UA 2HQNA 2HI3A 4A3JJ 4E7HA 2CW0F 4IHYA 3CTAA 1S7AA 2QCOA 3BQZA 4YFKF 1FZPB 2BHYA 2UZKA 1F36A 1P2FA 1XC5A 1S5LC 2E1CA 2DMNA 2HDDA 1I50J 2L7MP 2FUG2 3G4SI 3K4NA 1K78A 5BMZA 2ZC2A 5KVRA 3H5AA 3VYRB 1ZRFA 2O6GE 1P4XA 2DJIA 3PNTA 4RB1A 5FFXA 1GVJA 3HUGA 4ANJA 4RB3C 4C30A 2LKXA 4I02A 2HXOA 4UV9A 1FBSA 2DA4A 3G3ZA 3OV8A 1VNDA 4CZCA 2WV0A 1IN7A 3OYLA 5KHDA 3OYCA 3WG7H 5EZGA 4M6VA 5BPDA 4UUTA 1HA8A 1FBQA 1PYVA 2H1KA 3M8FA 3OYHA 5LRRA 5IT3A 3RKXA 2CMPA 2AO9A 3ECOA 1HOMA 1ZARA 4FX4A 3FHNA 3I59B 1WRJA 4C2MJ 1KYZA 1U9NA 1FY7A 3ERMA 3GXOA 4RB0A 4OINF 4E7IA 1JXSA 4XOPA 3WTVC 3FDYA 4XSXF 1XN7A 4AWXB 4AU7A 1R1VA 3LSGA 1A04A 1RETA 1D1AA 1MKMA 3E5XA 2K02A 1D0YA 2XPWA 1N78A 1D5YA 4UXNA 1Y8RB 2ME6A 1UELB 1S7EA 2HDCA 3OSFA 3GZ5A 1XD7A 4E7JA 2G9WA 3ASNH 4LLGF 3OYIA 4A0ZA 2BBYA 2P0WA 4ZZLA 1A35A 3QOPA 5EF6A 1IXCA 1JJ8C 2DYSH 1R9TJ 2V9KA 2LY1A 2HZTA 3OYDA 1U5TC 1B6AA 5J1YA 3GWZA 1P9QC 4B3XA 3G1LA 3ABUA 3MD2A 1XDSA 3PUBA 2XIGA 1BC8C 2LTPA 3GUDA 1BW6A 3DFGA 3LA7A 3TW7A 3RIRA 4ZJZA 1HKTA 5M3MJ 1R58A 2V9PA 3BR2A 4MEXF 3UR3C 1YRNB 3QPHA 1OCTC 2XPUA 3ULQB 1PUFB 1T38A 2QENA 4DNCA 3MKWB 2M0CA 4II3A 3JAMK 1IZ1A 2H6CA 4YEJA 3L2RA 4EJTA 2CUFA 4OAZA 3KCCA 4PJLA 4IHXA 2BZTA 2E2IJ 1B1BA 3TDZC 3G73A 1FT9A 2HFHA 1Z9CA 1PP7U 1JT6A 2QEXI 4XLAA 2GIVA 2Y9ZA 4MNUA 5EGOA 4RM2A 3TL4X 4GRIA 3CF2A 1BM9A 4ON0A 3V7CA 5B5EC 2X85A 4HX8A 5LLQA 3FF5A 2B63J 3O2PE 2CSOA 2JRMA 2NAZA 1HF0A 2R7VA 2LRDA 2K9MA 5LEKA 1UFMA 3GW2A 1YW8A 2R7OA 3EUAA 3K10A 2F2EA 1WH5A 2HOAA 4PJNA 2Z1DA 4G6DA 4M9SA 2DK5A 3ZGKA 1HSJA 1SD5A 4CYCB 1GT0C 1U78A 1OLTA 1LNWA 1LUJB 2MH2A 2O0YA 3R0JA 4HSTA 2HVQA 2RN7A 1ETOA 4MTDA 2XV4S 1ZRCA 3U2RA 1MSEC 3Q9VA 2NS7A 1SD4A 3SJMA 1ZGJA 4G94A 2DLLA 1R5GA 1JHHA 5D6EA 3IWZA 4ENKA 3KETA 1I1SA 1SD7A 2XGDA 4HQEA 2X1CA 3HIFA 5KAFC 5EZHA 1LPQA 1DDNA 1YO5C 1IUFA 2FQ3A 1I3QJ 1O57A 4IF4A 3NARA 1JT0A 1ZN2A 3F6OA 1B9MA 1K4SA 4P1WA 1U3EM 2VBXA 1MH3A 2KIMA 1S29A 2LD5A 2JA8J 3RPQA 1MJ9A 5ILSA 4LG0A 4TV7A 1G3YA 3HOSA 2H1LA 3ZMUA 2UWMA 4YIIA 2OC6A 3FMRA 2X6YA 1U8RA 4A3BJ 2P5LC 3PSIA 4P55A 4BQNA 5M5YJ 2JA2A 3LSHA 1B9NA 3L2QA 3WHCA 3CJNA 5CVVA 2QLZA 2CFXA 2M4KA 4UV8A 4OIOF 5E1WA 4M6XA 1HW2A 3I0TA 1H88C 4GO1A 2BXZA 2ESHA 2VB6A 3ECHA 1TQPA 5GAGJ 4FT8A 2DA1A 2JTVA 2ZJQF 2HEOA 2JWTA 1IN5A 3M7GA 2EA2A 1OCRH 5EEGA 3VEPA 1QZZA 5ICEA 3BT9A 2QWWA 1XGOA 4RA2A 2DA5A 1T8IA 3QPSA 2L7ZA 3SYTA 4CSWA 4Z2YA 3WGHA 4Y33A 5ICFA 1LB2A 3GLLA 5DS9A 2FX0A 4IJAA 5E3NA 1OCOH 5EJCA 3H3UA 3CF5F 3AKZA 1IRZA 3OIPA 2O8XA 2QZ8A 2DBBA 4MFEA 2XKOA 2LLKA 2EPFA 1IDYA 2CQKA 3AG2H 3V8LA 3DU5A 4HV6A 1FSHA 2Y48A 1H9TA 2KRFA 1Y1WJ 2V6EA 4BXXJ 1ETWA 2DTZA 3HHHA 2IW5A 2R7DA 4RAGA 4CYDA 2JMWA 3EQLF 4HX4A 2MLKA 4A3DJ 5C4XJ 3M1CA 3JAMZ 1AU7A 2GZWA 2R4GA 3C18A 2BEOA 5F64A 4UUVA 2EIMH 4XRSA 1BR2A 3K69A 1FMWA 1V5GA 1BJZA 1BJAA 1W7PB 5D4SA 3CUOA 4M3EA 4CICA 2OJED 4RGSA 4R1HA 4L9JA 4HF2A 2XAHA 3KZZA 2F4OB 1USSA 2ESNA 1I1GA 4G6QA 4Y4RA 2RDPA 2AQFA 3UNGC 2EK5A 3V8KA 5HS8A 5CVRA 1LDDA 1T39A 3ABTA 2GXBA 1MNMC 3BDDA 4JYKA 4DBRA 3PFYA 2KFDA 3F9KA 3LSMA 3R6SA 3QPTA 2ADUA 1XB4A 5A2QZ 2V1UA 4E7ZA 4A3MJ 2Q2EB 1MMDA 2XF7A 1MDMB 4XBFA 3JTGA 4S04A 4NC8A 2CGPA 1P6RA 4IPAA 4BHPA 5E3MA 3E97A 2JA6J 3U1DA 4AVPA 2LDUA 1ZH5A 4D9JA 5HLIA 3DU6A 2ZB9A 2MA3A 3CCLI 4BE2A 4CUGA 4U87A 4EQQA 2BXYA 3OY9A 4EM1A 3RYPA 1NK3P 2PBIA 3PQKA 2XGCA 4N9HA 1ON1A 2FXAA 1FJLA 5FLXK 3QYEA 2RNJA 1N77A 2XB0X 1EH6A 2EZIA 4MQVA 4XIDA 2IS1A 1J09A 3SHFA 3CDHA 4BNCA 3LSKA 1FOKA 3OOPA 2R5YB 3WE3A 4XN0A 3WGGA 3DBHB 4J01A 2FBHA 1ZKGA 1F1ZA 4EJUA 3M4OJ 3BTIA 2L3DA 2L9RA 5JLXA 3CDLA 4IQJA 3S3OA 1FC3A 2XGEA 1WPKA 4KT5C 2HPIA 3RZDJ 1ETVA 1XMAA 5FD6A 3CCSI 1BOAA 4IQ4A 3J7ZI 3BOQA 3MMYB 1KGSA 5HLHA 4UVCA 2F5EA 3I4PA 4U7DA 2HTJA 3Q0WA 1UHWA 1O4XA 4AYBN 2EBIA 3DTEA 1TTYA 1IV8A 5J8FA 2E2HJ 1ONVA 4F3QA 2LKSA 5IYBJ 2DMQA 1WI3A 2GOMA 2K4BA 5L3CA 1W0TA 4IOAF 5LEJA 4NHJA 1R5HA 3RPUD 3ZOBA 4X0GA 3JRBA 1TWAJ 4I7HA 4CCNA 4Y15A 5FO5A 4BJ5C 2IGOA 2XAJA 3I53A 4HDVA 2XRLA 1IN4A 1YITI 3IH4A 1OJLA 4H4KC 2FMLA 1XMXA 2XF6A 3HZJA 1ETXA 1ERDA 1G2HA 2IT0A 3HSRA 4QSHA 3FXQA 3WG9A 2PG4A 3P5JA 2K85A 4BGDA 3BR5A 2VIXA 4U0WA 3L2WA 3DLAA 3EUKL 3G71I 2KP6A 3CJRB 1LKXA 2DMPA 2Q0OA 1LE8B 4D7MA 3SEQA 3JRAA 3W6JB 2KJCA 4DW6A 4HNVA 1U5TB 4E70A 4EATA 2VT2A 4I98B 1VTNC 2FJ1A 4Y13A 2NVXJ 3PNVA 1WJEA 3AG3H 3V42A 4CXFA 4WK8F 2E2JJ 1J9IA 1HC8A 2R7FA 4BXUA 4HA8A 4F92B 4UUSB 2LREA 1K6YA 2K86A 1ZHFA 3LSJA 5C3EJ 1F43A 5KK1A 2ZXHA 4A3GJ 2DQRA 3S14J 2CQ7A 4XLFA 3F72A 2WAEA 1SC7A 1OCPA 1EH7A 4G8XA 3TMOA 5DM7F 3OS2A 2CFOA 3EYIA 3WGIA 3HOVJ 2QYOA 1FWZA 2MFZA 3OYNA 1T56A 5DUKA 4N0BA 4OAYA 2R5ZB 1JGSA 1W0UA 3RCOA 2QKMB 3M8JA 4DIQA 1JE8A 2O03A 1MGTA 2D1VA 3K4LA 4XRFA 1VFCA 4ZH4F 3LA3A 5L3DA 1HW5A 1FEXA 2QQAA 1TBXA 2M8GX 2YU9J 2XKPA 3HOWJ 3JR9A 2CV1A 4IRHA 3MKZA 3R0AA 4A0XA 4JBAA 1YJ9I 1HDPA 4KFCA 3FXKA 2Y0SA 3K4JA 2DOEA 4WXHA 3JRFA 2A6TA 1GV5A 3C7JA 2L02A 2WY8Q 3VSLA 3SQNA 1Y56A 3AG4H 4F52A 2R7ZJ 4IZZA 5L3EA 4ZYGA 3ZQCA 2ICWG 1I6XA 1UHMA 1O3QA 1YJNI 3V4GA 3F8MA 3Q3SA 2W48A 5ED4A 1V4RA 2CYYA 1OCZH 1ITYA 3QAHA 4E7SA 1JGGA 3S1MJ 5JVGF 3KZYA 4EM0B 1A5JA 2QA4I 1ZLJA 4G7OF 3FXMA 2D1HA 5D5XB 1FP1D 3I3LA 1TQIA 3Q0UA 4PSXA 4RS8A 1SFXA 2XB5A 5FB2A 1ENHA 2XGXA 1DUXC 4IHWA 4IHTA 4C3IJ 1K7AA 2MSYA 1AKHA 3HPHA 1GXPA 4PJ0C 5LD2C 5K5OA 3K70D 2A5WA 1JUMA 5HDGA 2HOSA 4RLQA 3V8JA 3EPZA 5LRSA 1UHSA 2NVYJ 3SFZA 2R92J 3FXLA 4B09A 1Z21A 4L9NA 2HS5A 3KX2A 3E7LA 3G6EI 1JJ6C 2DQLA 5L3FA 4ETSA 2QVOA 1QNTA 3HJEA 4BH9A 1FMVA 4JK1X 4IRIA 4IHSA 4BJ6C 4RGUA 1IRXA 4LLNA 1TC3C 4H0EA 3ESWB 3VWBA 5HLTA 1IJWC 2ZJ2A 1W5SA 2R7UA 1D1CA 5TRDA 3VFZA 4HZFA 2ELJA 4S0HB 1BC7C 3MEXA 4EM2A 4EVIA 3HSEA 1BOBA 2Z99A 3G1MA 2KHMA 2ZNZA 1Y1VJ 1TT5B 3MKLA 2MD5A 1PP8F 3GTJJ 3GFLA 1FTTA 1MIJA 2DPUA 3VB2A 1LDKB 4NC7A 1MBKA 1KQ9A 2X9DA 5GTIC 4BDZA 2R7WA 3TW6A 5LFAA 5D5VB 3W2AA 3A4CA 2OAZA 4KMUX 1PUEE 3RJPA 1U6GA 1Z3XA 5AONA 4B47A 2JK3A 2OBPA 4CZZA 1B4AA 4UY8I 3RYRA 1KU3A 4DQ2A 1BI3A 1D0ZA 3DKWA 4C9YA 4V2FA 2VQHA 2M3AA 3FX3A 1OCCH 2DFFA 3TO7A 2VLAA 4ZDPA 3GZ6A 4ZYDA 1YS7A 3FXRA 3F23A 2OTJI 1E3HA 2BE5F 1R49A 1EA3A 9ANTA 3O3KA 1AHDP 2A61A 2DDBA 4ESFA 2MGQA 3ZMZA 4AVZA 1KU2A 2LMDA 1JUSA 5DYMA 5DD8A 2IGNA 3U1KA 3SZGA 3HG9A 2ECCA 2JZYA 3FWEA 4F55A 2OZUA 3BG6A 2MABA 4BEHB 2EWNA 5FROA 3I5UA 1LVAA 3IAM2 4KDPA 3TOBA 5TJJA 4AIJA 2WA0A 2DA2A 4D1QA 2A05A 1W36D 1E2XA 3Q0VA 1G3SA 1ZAOA 2WY7Q 1Z6TA 2W57A 2ISYA 2DA7A 3BWGA 1ACIA 1XGMA 2EH3A 5LGNA 4L5EA 3R60A 2NVQJ 2BW3B 2LG4A 4DJAA 3IP4B 4XORA 1X3UA 1QVUA 2L0KA 4OIRF 5DM6F 1X1CA 4IKFA 5B1AH 1NK2P 3GTLJ 4OWRB 5F0FA 4A12A 2D5VA 4OMZA 2ZJPF 2B9SA 2VBZA 5IP7J 3A0HC 3ZQGA 3WTWC 4ABZA 4QWQA 4ZDLA 5ERIA 2UXNA 4BUPA 1H89C 1ETQA 2HYFA 4BYYA 2WC2A 1O3SA 2X6OA 2PMHA 4RAFA 1TWHJ 3MCZA 2KRHA 3ZMVA 2CV2A 1BBYA 4P5OA 1V54H 2IS6A 1UAAA 3CUQB 1HQCA 4P96A 5EYRA 2DJNA 5GAHJ 2KT0A 4NB5A 1SEUA 5JHUA 3CCJI 1R23A 2IBDA 3CQZJ 4PUSA 4A5MA 3OYAA 2FQ4A 2Z16A 4M3DA 1QPMA 2G7HA 5DTDA 1YRNA 2IXSA 3AFHA 3FHZA 4L0ZB 5FJ8J 4JP0A 2V79A 2M9HA 4IEJA 1XG1A 2CW7A 3FKJA 5J1RA 1PUFA 5FKKA 3E6DA 5FKOA 2VBWA 1YOVB 1D3YA 3DPUA 2Z33A 4HLXA 3RKQA 2M2EA 4XRMA 3WE2A 3BJ6A 1BIAA 3J80Z 1VQ9I 2ISZA 4LB5A 1ZG1A 4BDYA 2MD0A 1XDUA 4KUMA 1WZ2A 2DDAA 2VKVA 4MHGA 4OMYA 2PLYA 4UHTA 3H92A 2OCCH 2H8RA 2KIQA 3G1OA 2FA5A 3LQQA 1T0FC 1L3LA 1MMSA 4XONA 4UVBA 1WKMA 3LFKA 3PJRA 2EZKA 4XN3A 3DV8A 1G3TA 4PJJA 1FYLA 2EV6A 3MWMA 2ZNYA 3H3VK 2QUFA 3BR6A 3ZMDA 4HDUA 2RAEA 5D6FA 1X1BA 3LSTA 4V2GA 4QTRA 2Q1ZB 2JRTA 4EGZA 1TT0A 4CYCA 2HOTA 5EG0B 3SEZA 5IT9Z 3V7SA 4G7ZF 1ON2A 3K4CA 4KJZA 2VOPA 4WX9A 1LVKA 1RKTA 3BY6A 4PGHA 2DCEA 2EA4A 2M5WA 3TP3A 5GADJ 4BHBA 1SVMA 2DT6A 4A3FJ 1JTXA 4ENNA 3LMMA 3WTTC 5H2FC 5J47A 5GPCA 4GFBA 3S3MA 2FMYA 4D7NA 2D2WA 3F6VA 5J8CA 2LH9A 1YW7A 3CJQB 1N75A 3I56I 5HDNA 3S2DJ 1LQ1A 1SAUA 1D5VA 4IHVA 3GBGA 1SANA 2A5YB 1S72I 2QSGX 3A02A 2HQRA 4CH7A 2WAQA 1YI2I 1X4PA 2MW8A 2IEKA 4J00A 1CGPA 3LSRA 2PJRB 4XSZF 3N4MA 5D4RA 2WBMA 4HQMA 5B1BH 1VI0A 1HW1A 4A6EA 4I0BA 1UZCA 2GLOA 3GMEA 5A2QK 1GLNA 2GBYA 4AYBA 5CKTA 1ZG5A 2BV6A 1X19A 3OYKA 3GFMA 3OSGA 1FLIA 2LY9A 1KZHA 4FE7A 3S15J 2V9VA 2W00A 3VYSB 2K4JA 2R7SA 3QODA 1B59A 2KIFA 3V7RA 3LOCA 3O8HA 5JVTA 2VODA 2IPQX 1X4OA 3H1CA 3M8EA 1ZGAA 1G3WA 4Q5SF 2LR8A 3P9KA 4I2OA 4A69C 4C2TA 1ZR4A 4C3HJ 1YLFA 3ROUA 2CS3A 1QHGA 2P7CB 3FXOA 1AOYA 2FSWA 5FRMA 1FBUA 3BPVA 1PJRA 1ZTRA 3J81Z 3MZYA 5FGMA 1G59A 1APLC 1MNEA 1T6SA 3CP2A 1S6LA 2GQQA 2LSOA 3BG5A 2UV1A 1Z1DA 2P4WA 2X0LA 1JTYA 1RESA 2NOGA 1VQ6I 2ZFUA 2F6CA 3HRTA 3BR3A 1X2NA 1DGRM 2W1OA 3PFIA 4DZJA 1W7PA 1CQTA 3CCQI 1P4WA 2JQ7A 1OISA 3HRUA 1SMTA 2DFEA 3TKYA 5J4YA 2CUJA 4MQ9F 5F1RA 2JT1A 1S3JA 4NNJA 1BI0A 3RSNA 4KITB 2P6SA 3T0YA 4AD9A 4NQWB 1UCRA 2OA4A 3D0SA 4L5JA 3VYTB 2XRNA 4CGZA 2UXXA 2HDWA 3BJAA 2XC7A 1ZLKA 4BBSJ 4U0YA 1TLHB 4L9VA 4XRSG 4WCGA 4QIWN 2VL8A 1MDMA 2Q2EA 2OV7A 2RQQA 3JW4A 2NVUB 3I54A 1ODDA 1SFOJ 3L1PA 3IH3A 2LP0A 1VQ4I 1RKWA 4WXDA 1RIOH 1RUOA 3AL0B 2HTSA 5L3BA 4MFDA 3GTQJ 4KIGA 3ZN0A 3J7YJ 1RUNA 4IO9F 3K1MA 3OR2C 2LF8A 1YFHA 4KNYA 1L0OC 2CRGA 2QQ9A 5DEQA 2EFOA 5C44J 3QP5A 4BAYA 3HL2A 3BPXA 2BYVE 5AIQA 5E3OA 2E71A 1V3FA 1WWXA 3KZIC 1IN8A 1CF7B 1T95A 2R5YA 4A93J 1OKRA 4FE4A 4BY1J 3OMYA 4OOIA 2HKXA 3C3WA 1BR1A 2CQXA 5HOOA 2MC4A 2YPRA 1HXDA 2HXIA 2PFBA 2V1DA 5K1YA 3S32A 3GO5A 2XROA 2B0LA 2X1DA 2LBFB 2ACJA 2O5RA 2OCEA 4LD5A 4JX5A 1YS6A 3BZKA 4PFPA 3NWSA 1JKPC 1AA7A 2K9NA 2CUEA 4CO8A 4FASD 2H94A 2PMZA 3FZVA 2LFBA 1ETYA 2M8EA 3B02A 1YYVA 1IV6A 1VQMI 2X4HA 3FBIB 5IOYA 2WV1A 2YU3A 5JFRA 4I0AA 2EFWA 1B72B 1R4NB 3DEWA 2NS8A 2VJ5A 4UB8C 2CUZA 1X1PA 3OS1A 3WODF 3HB9A 1Y39A 3K0LA 1D1BA 2KRCA 1U2WA 5F04A 4A5NA 4MIMA 1YJWI 1XPXA 4ENJA 3BQYA 3RDIA 2IJLA 3I64A 1MBEA 1T0FA 4CCOA 2JA7J 3SDBA 2ZSIB 2WB1A 3S1RJ 4A3KJ 5D5UB 5LGUA 5IYDJ 4KN4X 1Y0UA 2G7UA 2K3PA 4DZPA 1TW3A 3WU1B 2QQBA 5EEAA 4HNUA 1GDTA 3CD6I 4RB2C 1LE8A 3QYFA 3CUQC 2VJIA 4FX0A 3ZP5A 1NH3A 5K5QA 3CLOA 1U5TA 2E34A 2DO7A 1R6RA 2TCTA 3T5XA 4DGWB 2JUCA 5HS7A 2MG4A 3F8FA 5E20A 2OTLI 3ASOH 3EDPA 3VYUB 4XKVA 1W5TA 4YIFA 5B3SH 1WHUA 3EETA 2M4GA 2LNBA 3FISA 2NS0A 3FMSA 5EDNA 4UUSA 3ZPLA 1E0EA 3H36A 3I71A 1O7LA 2F48A 1ZELA 2DFIA 2FD5A 3MZHA 2OUMA 1R5ID 5D8LB 2LC2A 1C0WA 3GTGJ 3EUHC 5CJ9A 2X6WA 2VUMJ 4OU0A 2F5VA 5KAIC 3CMYA 3C2BA 2IA0A 4E7LA 1QU3A 2DMTA 1K6OA 2P6TA 2V1NA 4ITVA 3PO3J 2R5ZA 3PQJA 3VOEA 4AUXA 3JREA 4XNFA 1BN5A 3HKZA 3KP4A 4ZC3A 4B3AA 3B6AA 2E1NA 3N05A 2L7KA 1WJ5A 5DCMB 3ELKA 3R4KA 2KQRA 5ICGA 2RVCA 2HVRA 2VONA 3LA2A 2KDOA 4HV5A 2V4JC 2N8GA 2AQEA 2R3SA 3O8GA 3H35A 3PIPF 3H9GA 1YX3A 1P7JA 2JPBA 3FKIJ 2NXNB 4P9UA 5TISC 1HDDC 4UNOA 2DN0A 3KP7A 2A07F 2CJJA 4FCYA 3RKYA 1LEAA 1HKSA 4A3IJ 5E1ZB 3HOUJ 1A6QA 4PFOA 4LFUA 2HKOA 4F7ZA 5HODA 4RAYA 2PEXA 4XQFA 2RC4A 1RC9A 3JRHA 1XCVA 3PO2J 2JVGA 3A01B 1EH8A 5ICCA 4KA4A 1Z0XA 1IDZA 2AHQA 2K27A 5E8IA 2H6BA 1KU9A 4ZZDA 1UB9A 3S2WA 3JRGA 3SZPA 4J19A 1S9HA 3LQRA 5E3LA 3U9GA 3JCUC 4B44A 4XR6A 2H27A 3CMAI 2EQRA 2RKHA 4BE1A 3CESA 4O5VA 4AIHA 2CWEA 3IKVA 3KE2A 3KYDB 3WTZA 2XUBA 3BR1A 4L9TA 4PSWA 2J5OA 3MQ0A 1E17A 3S93A 2P5KA 3G2BA 1G8XA 3K7AJ 4LIUA 4B4CA 2BY0A 1OR7C 1REPC 2GXGA 1X3WB 1TWFJ 4FTHA 3B6CA 1X3ZB 2ZKZA 1J7KA 3GF2A 1IAWA 3KPHA 1Z6RA 2W85A 2CH0A 2KKOA 4XOTA 1I5ZA 4K2EA 1RR8C 4IXAA 3H0DA 2VASA 3A03A 2KDZA 2HWVA 4Q4ZF 2ZO4A 3BJOA 3U21A 4PJMA 1R1TA 3P9CA 4ZTFA 5J40A 1BA5A 5FFZA 1BW5A 2A68F 3BP8A 3HOYJ 3IRQA 2LYCA 2ZFWA 1QGPA 1JKQC 1ZG3A 3K2ZA 4ESBA 3QU6A 1YW9A 1WJDA 3C1DA 4B8XA 2V26A 2EJRA 3FM3A 3BTJA 2DFHA 3DEEA 4DYRA 3CO7C 1EJ9A 3CC2I 2PI0A 3IL2A 5GPAA 5IOZA 3AG1H 4D5FA 2KL4A 2JSCA 3F0CA 1DPRA 3T8TA 2HVSA 1Z3YA 4HEA2 4XLNF 1IG7A 4BHCA 1HKQA 1R71A 1FP2A 3D1NI 1BL0A 1WSUA 3RKWA 2QQ8A 1HCRA 2OQGA 1VQ8I 3WHBA 3K6GA 3FXJA 4F91B 4O3MA 3IV5A 1WFXA 1JKOC 1TQMA 1GVDA 3DLLF 2EINH 2IAIA 3CJTB 2K9QA 2WWYA 4EEFG 1KQ8A 3PM1A 1JHFA 2GXAA 4Q47A 2KZGA 4BQAA 3TQNA 2VQCA 4A3LJ 3K4BA 5IPAA 1KONA 1ZK8A 3CCUI 1M1EB 2E19A 4RDUA 2VE9A 3J80K 1WGXA 3S3NA 2ELKA 4BEHA 4BXFA 2P8TA 5J4VA 2CG4A 3JRCA 2CV0A 3E6MA 1A36A 3I4MJ 2XAGA 1Q1VA 3K4KA 4YG2F 4PZJA 3L2CA 3AL0C 2KIUA 3NQOA 5TGTA 1J75A 5DD4A 1FOYA 4DYQA 2DT5A 2BW3A 3Q5FA 3QWLA 3MAJA 3TEDA 3BZ6A 1VZ0A 2VPLA 5K7ZA 4WXCA 1NG6A 2GM4A 4M3GA 3IKTA 3JSOA 2O61A 2IP2A 1WJAA 1DP3A 2VQGA 3JRIA 2ZMEB 5IT9K 1H0MA 1Z91A 2L5QA 4XLHA 3L00A 4GYIA 5FKMA 1FYKA 3H5NA 2GOXB 4YFNF 2QSHX 2NVTJ 5E18F 1FTZA 3CUQA 1IRFA 1Y8QB 1ZQ3P 1MMAA 4BU2A 4HF0A 4GCVA 3KP2A 2FU4A 4FHTA 3ZQQA 4CCMA 5KCMA 4NC6A 4CCJA 1MBGA 3ERED 3CZ6A 3CDIA 4A3CJ 3GTMJ 1ZGWA 3K70C 1YTYA 4HW0A 6PAXA 2DMUA 1A31A 3CMMA 2L54A 3J7AY 4WWCA 2K3FA 1MBFA 1RR7A 3TO6A 4G9YA 1G6NA 4XKBA 5EEHA 2Z9OA 1T33A 2FBIA 3P7NA 2NYXA 1E3OC 4II2A 1EV7A 1S8NA 1WCMJ 1ZREA 3OR1C 1J2XA 3EUHA 1SFEA 2CQNA 3Q9SA 2XDVA 3OYGA 1B8IA 2I10A 3ONQA 1IO2A 3RQ4A 3N97A 3JTHA 1JUPA 2JSPA 4M3FA 3FXUA 2QGUA 1MJAA 3H5RA 3KP6A 3FK6A 5ILVA 4OIPF 1Z67A 4YELA 2H8WA 2LY2A 2XSJC 3LSPA 3ML6A 3L09A 3KFWX 5CQEA 2EFPA 1VQLI 1OYIA 1QQIA 2FF4A 2VQLA 3KIOA 1YE9A 1WQ2A 3CC7I 2M7AA 5IYCJ 4BQQA 2JN6A 3FBNB 5D8KB 5EG0A 2NNNA 3HYIA 5L3GA 1LFPA 3KEOA 3RTRA 4XM3A 4IX7A 3QQAA 3W2VA 1POGA 2DT7B 3HSFA 3BTLA 1XMKA 3TGNA 2TDXA 2FRHA 3FMQA 1X58A 3GTPJ 2KJBA 2M30A 4KICA 5F0HA 2P81A 3DF8A 4R8HA 4PK4A 3CCMI 2XASA 3OIQA 1Z05A 2Y2ZA 4M9XA 3OYJA 3CCVI 2RQPA 3DQVC 3J81K 4BBRJ 4M6YA 2GWRA 2Q8KA 3DBLB 5IP9J 2EILH 1T98A 1W4MA 3H9JA 2KPMA 2E7XA 3LNQA 3JRDA 1J5YA 4JOMA 5FKLA 3A0BC 1XSXA 1GXQA 3DKYA 3GEZA 4MTEA 2JPCA 2F4MB 2AS5F 4GYGA 2DAOA 1KU7A 4A3EJ 5FLVA 2M7BA 2ECBA 3BTCA 1HLVA 1ZR2A 1B8IB 2FNAA 2QSFX 3IHUA 1KQ0A 1TWCJ 4AM3A 3W6VA 1TNSA 2PJRA 2Y0SN 3NWTA 2DA6A 1OR7A 2W25A 1W36C 3IH2A 1EKEA 1GUUA 4PGGA 4CCLA 1LFUP 2QBYB 1V55H 3M07A 1TW2A 3K4MA 5DV5A 1V5FA 4LG3A 4ZYHA 3BCBA 3HOTA 1TNTA 3RPUA 4HSRA 5BOXA 1AWCA 4DOZA 2LK2A 1QZEA 2ID3A 4XKCA 3ZQHA 4XMYA 2FOKA 3TO9A 4LK1F 2YX7A 3GVAA 2IS4A 4RMNA 3LAJA 1QHHD 3M1EA 4FETA 2W4SA 1K78B 3F8NA 2FOWA 5AIPA 5LHIA 3ZCOA 1SMYF 2DOFA 4G7HF 4B1RA 5F0CA 2DTRA 2W24A 5F1JA 3PSFA 2TRTA 4B48A 3VSKA 2MBFA 4JX6A 3HUGB 2ZCWA 4CHUA 1Z7UA 2HQAA 4U88A 1LDJA 1H8AC 3WTXC 4E7KA 3HGYA 5LHHA 3DTIA 2COMA 2E5NA 2EIKH 4HYEA 4W97A 3HGGA 3D5LA 3BR0A 4A2UA 3SFIA 2ETHA 1NTCA 2AXLA 4C3JJ 1K83J 4LLLA 1IW7F 4XLPF 5CLSA 1UG0A 1XX5A 5HNFA 4I76A 5GP9A 1YIJI 3DTKA 4RGRA 1Y0NA 2BOLA 2IGKA 3GTOJ 3ISPA 1A6IA 3LSIA 1NHAA 2X6XA 2L4MA 4NBQA 2OU2A 1RNLA 5IY5H 3K9TA 1IGNA 2M45A 3ZRGA 4NQWA 1DGWY 1O3TA 4Y52J 2E1MB 3BLYA 3BG3A 3NEUA 2M1BA 4E4HA 5HLGA 3D5SC 4RGXA 4X6AJ 1WJFA 2EFQA 4XICA 1MMGA 3QRFF 3KP3A 1VQOI 3F8CA 1R1UA 5M3FJ 3OS0A 2ZJRF 4M9ZA 2DI3A 2XF5A 5FLMJ 4HG2A 2LF7A 3K1PA 3AAFA 1P4AA 2F4IA 4M3BA 4EJVA 3OYBA 1R4MB 1EF4A 3NRVA 5BPIA 3CP8A 5DCFA 3QOEA 1FOXA 1X1DA 4IRGA 1CF7A 3R61A 2VKDA 3HBLA 1LFBA 2PN6A 1D8KA 3H9QA 3DPLC 2COBA 2FEZA 1QPIA 2CQQA 1DU6A 1FX7A 2QKLB 1SVLA 2CU7A 4U0VA 1IC8A 2R7RA 1OFCX
chains in the Genus database with same CATH topology
1FNNA 2XVCA 2Z5UA 4ZYEA 1YQAA 4HAMA 2IA1A 4M72A 1XCBA 1F9NA 4HOBA 2A6HF 1G4DA 2ZBKA 2DK8A 2D45A 3W6KB 2A69F 3HTSB 1K79A 2XAQA 1OPCA 3QP6A 1MJBA 2VBYA 1S7OA 2RGVA 1O3RA 3SZTA 2F5DA 3I58A 2P7VB 4KYWA 3WU0A 1RZ4A 4A0YA 3JSPA 2STTA 1IXRC 1WI9A 1R00A 3GFIA 4QLCU 3WTYC 1FYMA 2A6EF 2E7WA 1HSTA 4EJOA 3ZMSA 4YFXF 3E3VA 2HOEA 3CO6C 1XGSA 2MC3A 3ZMTA 4LG0B 1STZA 3B73A 3GYHX 2PJPA 3E6BA 4HBLA 3E6CC 4U7BA 4HF1A 2NNYA 3HTUA 4I01A 4Y17A 2F5FA 4PCQA 4L5IA 5DCMA 3BROA 1RI7A 3VODA 4KIFA 4MEYF 4LK0F 3F3XA 4IVNA 1DP7P 4LB6B 2VE8A 5LGTA 4CDGA 3GLXA 4AIKA 3M9AA 3DP7A 3E5QA 1YIOA 4A6DA 4RAZA 4EJWA 3SXYA 3FM5A 1J59A 2STWA 5H6QA 2EFNA 4KN7X 2ELHA 1USTA 5DDGA 3J7AO 3DPTA 1KA8A 5BQTA 2BGCA 4KIBA 4Q48A 1IF1A 2L01A 3E5UA 2V6CA 2VC1A 3QU3A 3HHGA 4L0YB 3RI4A 2V1XA 1MZBA 1QZYA 4WF2A 5J6XA 4KMFA 2H09A 2FBKA 1KYWA 5D5WB 2EV5A 2VXZA 5ILUA 5E8GA 3DXJF 2CO5A 3WTSC 4EMSA 2IRFG 1QO0D 5CYVA 4N9IA 1IRGA 2WTEA 4ASNA 4LJZF 1ZRDA 5E1XA 1MD0A 3LWFA 2ZXJA 1PDNC 5BS6A 4ENMA 2VN2A 2FE3A 3KLNA 4I09A 1J0RA 4HLYA 2HGCA 3KLOA 2XHKA 3TOAA 2VT3A 4O6JA 1R22A 5DUIA 4D0PA 1FSEA 2OD5A 3LAPA 3ZN1A 5E17F 3KP5A 3REOA 3F8BA 1HBXG 1OMIA 2F5CA 5CVIA 4JQFA 1OYWA 5CVUA 2J5PA 1D8JA 2GAUA 3IC7A 4EGYA 2O3FA 1IN6A 5JR3A 1OYYA 2DU9A 3MFKA 1GHCA 1ULYA 2IVMA 2A3SA 3HRSA 2C6YA 2EB7A 3WTUC 2Y75A 2Y0MA 1FPQA 2VC0A 3T1BA 2M87A 3L9FA 2L4AA 5H6RA 2W84A 3GX4X 2PQ8A 5LHGA 5FLXZ 2ZMEA 1XSVA 5HDKA 1SFUA 2MLGA 2GA1A 4M73A 4P9FA 5FD5A 4EV0A 1XGNA 1T2KA 1F4KA 1O7FA 3DEUA 1LEBA 2IA2A 1SD6A 3ZQ7A 3TDUC 4MGRA 1LJ9A 1W7PD 1YG2A 2P5VA 3F22A 1BI1A 2YSRA 4M71A 3EYYA 4UVAA 1SAXA 5JI6A 5CVJA 4GXOA 3L7WA 2DW4A 3GFJA 2OZ6A 2LKPA 1DPUA 1R7JA 3T8RA 3IRRA 5HVQC 4M74A 3COAC 4PDKA 4S05A 5HS9A 4GGGA 3H3ZA 1H9GA 2MH9A 4LMYA 2NRAC 5H20A 2PMUA 1I27A 2FNPA 1P92A 1Q1HA 1XSDA 1F5TA 2EV0A 2HR3A 2XAFA 3HRMA 4L18B 2HYGD 4OIQF 2YX4A 2OQRA 2DPDA 5F6FA 1BIBA 2RV8A 2Z3YA 4R79A 4LGWA 2VOOA 1IUYA 1BI2A 1IXSB 2K7LA 3IWFA 3KEQA 4HX7A 5K5RA 2YR2A 4ESJA 1R36A 3F21A 1ZYRF 3O6BB 2QBYA 5LBQA 3K1NA 3I59A 2GA2A 2QM3A 1QBJA 3P9IA 2HQNA 2CW0F 3CTAA 1S7AA 4YFKF 1FZPB 2UZKA 1P2FA 2E1CA 1K78A 5BMZA 5KVRA 1ZRFA 2O6GE 1P4XA 4RB1A 5FFXA 1GVJA 3HUGA 4RB3C 4I02A 4UV9A 1FBSA 3G3ZA 3OV8A 2WV0A 1IN7A 5BPDA 1FBQA 3M8FA 5LRRA 5IT3A 3RKXA 3ECOA 1ZARA 4FX4A 3I59B 1WRJA 1KYZA 1FY7A 3GXOA 1JXSA 4RB0A 4OINF 3WTVC 4XSXF 1XN7A 4AWXB 1R1VA 1A04A 1MKMA 3E5XA 2K02A 4UXNA 2HDCA 3GZ5A 1XD7A 2G9WA 4LLGF 4A0ZA 2BBYA 4ZZLA 3QOPA 1IXCA 2HZTA 1U5TC 1B6AA 3GWZA 3ABUA 1XDSA 2XIGA 1BC8C 3GUDA 3DFGA 3LA7A 3RIRA 1HKTA 1R58A 4MEXF 3QPHA 3ULQB 1T38A 2QENA 4DNCA 3JAMK 1IZ1A 2H6CA 4EJTA 3KCCA 1B1BA 3TDZC 3G73A 1FT9A 2HFHA 1Z9CA 1PP7U 2GIVA 4MNUA 1BM9A 4ON0A 3V7CA 4HX8A 5LLQA 3FF5A 3O2PE 2CSOA 2NAZA 5LEKA 1UFMA 3GW2A 1YW8A 2F2EA 4G6DA 4M9SA 2DK5A 1HSJA 1SD5A 1U78A 1LNWA 2MH2A 2O0YA 3R0JA 4MTDA 2RN7A 2XV4S 1ZRCA 3U2RA 3Q9VA 1SD4A 1ZGJA 4G94A 2DLLA 1R5GA 1JHHA 5D6EA 3IWZA 4ENKA 3KETA 1I1SA 1SD7A 4HQEA 3HIFA 1DDNA 1YO5C 2FQ3A 1O57A 4IF4A 1ZN2A 3F6OA 1B9MA 1U3EM 2VBXA 2KIMA 1S29A 3RPQA 1MJ9A 5ILSA 4LG0A 4TV7A 1G3YA 3HOSA 3ZMUA 2UWMA 4YIIA 3FMRA 1U8RA 2P5LC 4P55A 1B9NA 3CJNA 5CVVA 2QLZA 2CFXA 4UV8A 4OIOF 5E1WA 4M6XA 1HW2A 3I0TA 4GO1A 2ESHA 3ECHA 1TQPA 4FT8A 2JTVA 2HEOA 1IN5A 3M7GA 2EA2A 5EEGA 3VEPA 1QZZA 5ICEA 2QWWA 1XGOA 4Z2YA 3WGHA 5ICFA 1LB2A 4IJAA 3H3UA 2O8XA 2QZ8A 2DBBA 2XKOA 2CQKA 3V8LA 4HV6A 1FSHA 2Y48A 1H9TA 2KRFA 3HHHA 2IW5A 2R7DA 4CYDA 3EQLF 4HX4A 2MLKA 3JAMZ 2GZWA 3C18A 2BEOA 5F64A 4UUVA 3K69A 1BJAA 1W7PB 5D4SA 3CUOA 4CICA 4RGSA 4R1HA 4L9JA 4HF2A 2XAHA 3KZZA 1USSA 2ESNA 1I1GA 4G6QA 3V8KA 2RDPA 5HS8A 2EK5A 5CVRA 1LDDA 1T39A 3ABTA 2GXBA 3BDDA 3R6SA 3QPTA 5A2QZ 2ADUA 1XB4A 2V1UA 1MDMB 4XBFA 3JTGA 4S04A 2CGPA 4BHPA 1P6RA 4IPAA 3E97A 3U1DA 4AVPA 2LDUA 1ZH5A 5HLIA 2MA3A 4EQQA 4EM1A 3RYPA 2PBIA 3PQKA 4N9HA 1ON1A 2FXAA 5FLXK 2RNJA 1EH6A 4MQVA 3SHFA 3CDHA 4BNCA 1FOKA 3OOPA 3WE3A 3WGGA 2FBHA 1F1ZA 4EJUA 2L3DA 1FC3A 4KT5C 1XMAA 5FD6A 1BOAA 3BOQA 1KGSA 5HLHA 4UVCA 2F5EA 3I4PA 4U7DA 2HTJA 1UHWA 1TTYA 5J8FA 1ONVA 2K4BA 5L3CA 5LEJA 4NHJA 1R5HA 4I7HA 4Y15A 5FO5A 2XAJA 3I53A 4HDVA 1IN4A 2FMLA 2IT0A 3HSRA 3FXQA 3WG9A 2PG4A 4U0WA 2Q0OA 3W6JB 2KJCA 1U5TB 4E70A 2VT2A 4I98B 1VTNC 4Y13A 4CXFA 4WK8F 1J9IA 2R7FA 4BXUA 4HA8A 2K86A 1ZHFA 5KK1A 2DQRA 3F72A 1EH7A 4G8XA 3EYIA 3WGIA 2QYOA 1FWZA 5DUKA 4N0BA 1JGSA 1JE8A 2O03A 1MGTA 2D1VA 4XRFA 4ZH4F 3LA3A 5L3DA 1HW5A 2QQAA 1TBXA 2XKPA 4IRHA 3R0AA 4A0XA 4JBAA 4KFCA 4WXHA 3C7JA 2L02A 3SQNA 5L3EA 4ZYGA 1I6XA 1UHMA 1O3QA 3V4GA 3F8MA 5ED4A 1V4RA 2CYYA 3QAHA 3KZYA 4EM0B 1ZLJA 4G7OF 2D1HA 5D5XB 1FP1D 1TQIA 4RS8A 1SFXA 5FB2A 2XGXA 1DUXC 4IHTA 1K7AA 1GXPA 5K5OA 5HDGA 3V8JA 5LRSA 3SFZA 4B09A 4L9NA 2HS5A 2DQLA 5L3FA 4ETSA 2QVOA 1QNTA 4BH9A 4JK1X 4IRIA 4IHSA 4RGUA 4LLNA 4H0EA 2ZJ2A 1W5SA 5TRDA 3VFZA 4HZFA 1BC7C 3MEXA 4EM2A 4EVIA 3HSEA 2Z99A 2ZNZA 2MD5A 1PP8F 3GFLA 2DPUA 3VB2A 1LDKB 1KQ9A 5D5VB 2OAZA 4KMUX 1PUEE 3RJPA 1U6GA 5AONA 2OBPA 4CZZA 1B4AA 3RYRA 1KU3A 4DQ2A 1BI3A 3DKWA 3FX3A 3TO7A 3GZ6A 4ZYDA 1YS7A 3FXRA 3F23A 2BE5F 3O3KA 2A61A 4ESFA 3ZMZA 1KU2A 5DYMA 5DD8A 2JZYA 3FWEA 2OZUA 2EWNA 3I5UA 1LVAA 4KDPA 3TOBA 5TJJA 4AIJA 1E2XA 1G3SA 1ZAOA 1Z6TA 2W57A 2ISYA 3BWGA 1XGMA 5LGNA 3R60A 1X3UA 4OIRF 4A12A 4OMZA 2VBZA 3WTWC 4QWQA 5ERIA 2UXNA 2HYFA 4BYYA 2WC2A 1O3SA 2PMHA 3ZMVA 3MCZA 1BBYA 4P5OA 3CUQB 1HQCA 4P96A 4NB5A 5JHUA 1R23A 4A5MA 1QPMA 2G7HA 3FHZA 4L0ZB 2V79A 3E6DA 2VBWA 1D3YA 2Z33A 4HLXA 3WE2A 3BJ6A 1BIAA 3J80Z 2ISZA 4LB5A 1ZG1A 4KUMA 1XDUA 4MHGA 4OMYA 2PLYA 4UHTA 3H92A 2FA5A 3LQQA 1L3LA 4UVBA 1WKMA 3LFKA 3DV8A 1G3TA 1FYLA 2EV6A 3MWMA 2ZNYA 2QUFA 3ZMDA 4HDUA 5D6FA 3LSTA 2JRTA 4EGZA 5IT9Z 3V7SA 4G7ZF 1ON2A 2VOPA 4WX9A 3BY6A 4PGHA 2M5WA 2EA4A 4BHBA 4ENNA 3WTTC 2FMYA 2D2WA 3F6VA 5J8CA 1YW7A 5HDNA 1LQ1A 1D5VA 2A5YB 2HQRA 1CGPA 4XSZF 3N4MA 5D4RA 4HQMA 1HW1A 4A6EA 4I0BA 5A2QK 1ZG5A 2BV6A 3GFMA 1FLIA 2V9VA 2K4JA 3V7RA 1B59A 2KIFA 5JVTA 2VODA 2IPQX 4Q5SF 3M8EA 1ZGAA 1G3WA 3P9KA 4I2OA 1YLFA 3ROUA 2P7CB 1AOYA 2FSWA 1FBUA 3BPVA 3J81Z 3MZYA 5FGMA 1T6SA 1S6LA 2GQQA 2LSOA 1Z1DA 2P4WA 2X0LA 3HRTA 3PFIA 1W7PA 1P4WA 3HRUA 1SMTA 3TKYA 4MQ9F 5F1RA 2JT1A 1S3JA 1BI0A 2P6SA 3T0YA 4AD9A 1UCRA 2OA4A 3D0SA 4L5JA 2XRNA 4CGZA 2UXXA 3BJAA 1ZLKA 4U0YA 1TLHB 4L9VA 4WCGA 1MDMA 2Q2EA 3JW4A 3I54A 1ODDA 4WXDA 1RIOH 1RUOA 2HTSA 5L3BA 4KIGA 3ZN0A 1RUNA 3K1MA 2LF8A 1YFHA 4KNYA 1L0OC 2QQ9A 5DEQA 2EFOA 3QP5A 4BAYA 3BPXA 2BYVE 5AIQA 1V3FA 1WWXA 1IN8A 1CF7B 1OKRA 4OOIA 2HKXA 3C3WA 5HOOA 2YPRA 1HXDA 2V1DA 2PFBA 5K1YA 3GO5A 2XROA 2B0LA 2ACJA 4LD5A 1YS6A 4CO8A 2H94A 3FZVA 2M8EA 3B02A 1YYVA 2X4HA 2YU3A 5JFRA 4I0AA 2EFWA 3WODF 3K0LA 1U2WA 4A5NA 4ENJA 3RDIA 2IJLA 3I64A 1T0FA 5D5UB 5LGUA 4KN4X 1Y0UA 2G7UA 1TW3A 3WU1B 2QQBA 4RB2C 3CUQC 4FX0A 3ZP5A 5K5QA 3CLOA 1U5TA 2DO7A 3T5XA 5HS7A 3F8FA 5E20A 3EDPA 1W5TA 4YIFA 3EETA 3ZPLA 2LNBA 3FMSA 2NS0A 3I71A 1O7LA 2DFIA 3MZHA 5D8LB 1C0WA 5CJ9A 4OU0A 2IA0A 1K6OA 2P6TA 3PQJA 3VOEA 1BN5A 3KP4A 2E1NA 5DCMB 3ELKA 3R4KA 5ICGA 2RVCA 2VONA 3LA2A 4HV5A 2R3SA 2JPBA 4P9UA 4UNOA 3KP7A 2A07F 3RKYA 1LEAA 1HKSA 5E1ZB 4LFUA 2HKOA 4F7ZA 4RAYA 2PEXA 2RC4A 1XCVA 1EH8A 5ICCA 4KA4A 2K27A 5E8IA 2H6BA 1KU9A 4ZZDA 1UB9A 3S2WA 3SZPA 3LQRA 3U9GA 2H27A 2RKHA 4O5VA 4AIHA 2CWEA 3IKVA 3KE2A 3WTZA 2XUBA 4L9TA 2J5OA 3MQ0A 1E17A 2P5KA 1REPC 2GXGA 2ZKZA 1J7KA 3GF2A 1IAWA 1Z6RA 2W85A 2KKOA 1I5ZA 4K2EA 4IXAA 2HWVA 4Q4ZF 2ZO4A 3BJOA 1R1TA 3P9CA 5FFZA 2A68F 3BP8A 3IRQA 2ZFWA 1QGPA 1ZG3A 3K2ZA 4ESBA 3QU6A 1YW9A 3C1DA 4B8XA 2EJRA 3FM3A 3CO7C 2PI0A 3IL2A 2JSCA 3T8TA 1DPRA 4XLNF 4BHCA 1HKQA 1FP2A 1WSUA 3RKWA 2OQGA 4O3MA 1TQMA 2WWYA 1KQ8A 1JHFA 4Q47A 4BQAA 3TQNA 2VE9A 3J80K 2P8TA 2CG4A 3E6MA 2XAGA 4YG2F 4PZJA 3L2CA 2KIUA 3NQOA 1J75A 5DD4A 2DT5A 3Q5FA 3MAJA 3BZ6A 4WXCA 3IKTA 3JSOA 2O61A 2IP2A 5IT9K 2ZMEB 1H0MA 1Z91A 3L00A 4GYIA 1FYKA 4YFNF 5E18F 3CUQA 1IRFA 4HF0A 4GCVA 3KP2A 2FU4A 4FHTA 3ERED 1YTYA 4HW0A 6PAXA 2L54A 4WWCA 3TO6A 4G9YA 1G6NA 5EEHA 2Z9OA 2FBIA 3P7NA 2NYXA 1EV7A 1S8NA 1ZREA 1J2XA 3EUHA 1SFEA 3Q9SA 3N97A 3JTHA 3FXUA 1MJAA 3KP6A 5ILVA 4OIPF 3ML6A 3L09A 3KFWX 2EFPA 1OYIA 1QQIA 2FF4A 1WQ2A 5D8KB 2NNNA 3HYIA 5L3GA 3RTRA 3KEOA 3HSFA 1XMKA 3TGNA 2TDXA 2FRHA 3FMQA 2KJBA 2M30A 4KICA 3DF8A 4R8HA 2XASA 1Z05A 4M9XA 2RQPA 3DQVC 3J81K 4M6YA 2GWRA 2Q8KA 1T98A 1W4MA 2E7XA 1J5YA 1XSXA 1GXQA 3GEZA 4MTEA 2JPCA 2AS5F 4GYGA 2DAOA 1KU7A 2FNAA 3IHUA 1KQ0A 1TNSA 1OR7A 2W25A 4PGGA 2QBYB 1TW2A 5DV5A 3HOTA 4ZYHA 1TNTA 3RPUA 5BOXA 1AWCA 2FOKA 3TO9A 4LK1F 2YX7A 3GVAA 3LAJA 3M1EA 1K78B 3F8NA 5AIPA 5LHIA 1SMYF 4G7HF 2DTRA 2W24A 2MBFA 2ZCWA 4CHUA 1Z7UA 4U88A 1LDJA 3WTXC 5LHHA 2COMA 4HYEA 3D5LA 4A2UA 2ETHA 2AXLA 4XLPF 4LLLA 1IW7F 5CLSA 4RGRA 3ISPA 1NHAA 2L4MA 2OU2A 1RNLA 3K9TA 2M45A 4NQWA 1O3TA 3NEUA 2M1BA 5HLGA 4RGXA 2EFQA 3QRFF 3KP3A 3F8CA 1R1UA 4M9ZA 2DI3A 2LF7A 3K1PA 3AAFA 1P4AA 4EJVA 3NRVA 5BPIA 5DCFA 4IRGA 1CF7A 3R61A 2PN6A 1D8KA 3DPLC 2FEZA 1FX7A 4U0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNN A;  2XVC A;  2Z5U A;  4ZYE A;  1YQA A;  4HAM A;  2IA1 A;  4M72 A;  1XCB A;  1F9N A;  4HOB A;  2A6H F;  1G4D A;  2ZBK A;  2DK8 A;  2D45 A;  3W6K B;  2A69 F;  3HTS B;  1K79 A;  2XAQ A;  1OPC A;  3QP6 A;  1MJB A;  2VBY A;  1S7O A;  2RGV A;  1O3R A;  3SZT A;  2F5D A;  3I58 A;  2P7V B;  4KYW A;  3WU0 A;  1RZ4 A;  4A0Y A;  3JSP A;  2STT A;  1IXR C;  1WI9 A;  1R00 A;  3GFI A;  4QLC U;  3WTY C;  1FYM A;  2A6E F;  2E7W A;  1HST A;  4EJO A;  3ZMS A;  4YFX F;  3E3V A;  2HOE A;  3CO6 C;  1XGS A;  2MC3 A;  3ZMT A;  4LG0 B;  1STZ A;  3B73 A;  3GYH X;  2PJP A;  3E6B A;  4HBL A;  3E6C C;  4U7B A;  4HF1 A;  2NNY A;  3HTU A;  4I01 A;  4Y17 A;  2F5F A;  4PCQ A;  4L5I A;  5DCM A;  3BRO A;  1RI7 A;  3VOD A;  4KIF A;  4MEY F;  4LK0 F;  3F3X A;  4IVN A;  1DP7 P;  4LB6 B;  2VE8 A;  5LGT A;  4CDG A;  3GLX A;  4AIK A;  3M9A A;  3DP7 A;  3E5Q A;  1YIO A;  4A6D A;  4RAZ A;  4EJW A;  3SXY A;  3FM5 A;  1J59 A;  2STW A;  5H6Q A;  2EFN A;  4KN7 X;  2ELH A;  1UST A;  5DDG A;  3J7A O;  3DPT A;  1KA8 A;  5BQT A;  2BGC A;  4KIB A;  4Q48 A;  1IF1 A;  2L01 A;  3E5U A;  2V6C A;  2VC1 A;  3QU3 A;  3HHG A;  4L0Y B;  3RI4 A;  2V1X A;  1MZB A;  1QZY A;  4WF2 A;  5J6X A;  4KMF A;  2H09 A;  2FBK A;  1KYW A;  5D5W B;  2EV5 A;  2VXZ A;  5ILU A;  5E8G A;  3DXJ F;  2CO5 A;  3WTS C;  4EMS A;  2IRF G;  1QO0 D;  5CYV A;  4N9I A;  1IRG A;  2WTE A;  4ASN A;  4LJZ F;  1ZRD A;  5E1X A;  1MD0 A;  3LWF A;  2ZXJ A;  1PDN C;  5BS6 A;  4ENM A;  2VN2 A;  2FE3 A;  3KLN A;  4I09 A;  1J0R A;  4HLY A;  2HGC A;  3KLO A;  2XHK A;  3TOA A;  2VT3 A;  4O6J A;  1R22 A;  5DUI A;  4D0P A;  1FSE A;  2OD5 A;  3LAP A;  3ZN1 A;  5E17 F;  3KP5 A;  3REO A;  3F8B A;  1HBX G;  1OMI A;  2F5C A;  5CVI A;  4JQF A;  1OYW A;  5CVU A;  2J5P A;  1D8J A;  2GAU A;  3IC7 A;  4EGY A;  2O3F A;  1IN6 A;  5JR3 A;  1OYY A;  2DU9 A;  3MFK A;  1GHC A;  1ULY A;  2IVM A;  2A3S A;  3HRS A;  2C6Y A;  2EB7 A;  3WTU C;  2Y75 A;  2Y0M A;  1FPQ A;  2VC0 A;  3T1B A;  2M87 A;  3L9F A;  2L4A A;  5H6R A;  2W84 A;  3GX4 X;  2PQ8 A;  5LHG A;  5FLX Z;  2ZME A;  1XSV A;  5HDK A;  1SFU A;  2MLG A;  2GA1 A;  4M73 A;  4P9F A;  5FD5 A;  4EV0 A;  1XGN A;  1T2K A;  1F4K A;  1O7F A;  3DEU A;  1LEB A;  2IA2 A;  1SD6 A;  3ZQ7 A;  3TDU C;  4MGR A;  1LJ9 A;  1W7P D;  1YG2 A;  2P5V A;  3F22 A;  1BI1 A;  2YSR A;  4M71 A;  3EYY A;  4UVA A;  1SAX A;  5JI6 A;  5CVJ A;  4GXO A;  3L7W A;  2DW4 A;  3GFJ A;  2OZ6 A;  2LKP A;  1DPU A;  1R7J A;  3T8R A;  3IRR A;  5HVQ C;  4M74 A;  3COA C;  4PDK A;  4S05 A;  5HS9 A;  4GGG A;  3H3Z A;  1H9G A;  2MH9 A;  4LMY A;  2NRA C;  5H20 A;  2PMU A;  1I27 A;  2FNP A;  1P92 A;  1Q1H A;  1XSD A;  1F5T A;  2EV0 A;  2HR3 A;  2XAF A;  3HRM A;  4L18 B;  2HYG D;  4OIQ F;  2YX4 A;  2OQR A;  2DPD A;  5F6F A;  1BIB A;  2RV8 A;  2Z3Y A;  4R79 A;  4LGW A;  2VOO A;  1IUY A;  1BI2 A;  1IXS B;  2K7L A;  3IWF A;  3KEQ A;  4HX7 A;  5K5R A;  2YR2 A;  4ESJ A;  1R36 A;  3F21 A;  1ZYR F;  3O6B B;  2QBY A;  5LBQ A;  3K1N A;  3I59 A;  2GA2 A;  2QM3 A;  1QBJ A;  3P9I A;  2HQN A;  2CW0 F;  3CTA A;  1S7A A;  4YFK F;  1FZP B;  2UZK A;  1P2F A;  2E1C A;  1K78 A;  5BMZ A;  5KVR A;  1ZRF A;  2O6G E;  1P4X A;  4RB1 A;  5FFX A;  1GVJ A;  3HUG A;  4RB3 C;  4I02 A;  4UV9 A;  1FBS A;  3G3Z A;  3OV8 A;  2WV0 A;  1IN7 A;  5BPD A;  1FBQ A;  3M8F A;  5LRR A;  5IT3 A;  3RKX A;  3ECO A;  1ZAR A;  4FX4 A;  3I59 B;  1WRJ A;  1KYZ A;  1FY7 A;  3GXO A;  1JXS A;  4RB0 A;  4OIN F;  3WTV C;  4XSX F;  1XN7 A;  4AWX B;  1R1V A;  1A04 A;  1MKM A;  3E5X A;  2K02 A;  4UXN A;  2HDC A;  3GZ5 A;  1XD7 A;  2G9W A;  4LLG F;  4A0Z A;  2BBY A;  4ZZL A;  3QOP A;  1IXC A;  2HZT A;  1U5T C;  1B6A A;  3GWZ A;  3ABU A;  1XDS A;  2XIG A;  1BC8 C;  3GUD A;  3DFG A;  3LA7 A;  3RIR A;  1HKT A;  1R58 A;  4MEX F;  3QPH A;  3ULQ B;  1T38 A;  2QEN A;  4DNC A;  3JAM K;  1IZ1 A;  2H6C A;  4EJT A;  3KCC A;  1B1B A;  3TDZ C;  3G73 A;  1FT9 A;  2HFH A;  1Z9C A;  1PP7 U;  2GIV A;  4MNU A;  1BM9 A;  4ON0 A;  3V7C A;  4HX8 A;  5LLQ A;  3FF5 A;  3O2P E;  2CSO A;  2NAZ A;  5LEK A;  1UFM A;  3GW2 A;  1YW8 A;  2F2E A;  4G6D A;  4M9S A;  2DK5 A;  1HSJ A;  1SD5 A;  1U78 A;  1LNW A;  2MH2 A;  2O0Y A;  3R0J A;  4MTD A;  2RN7 A;  2XV4 S;  1ZRC A;  3U2R A;  3Q9V A;  1SD4 A;  1ZGJ A;  4G94 A;  2DLL A;  1R5G A;  1JHH A;  5D6E A;  3IWZ A;  4ENK A;  3KET A;  1I1S A;  1SD7 A;  4HQE A;  3HIF A;  1DDN A;  1YO5 C;  2FQ3 A;  1O57 A;  4IF4 A;  1ZN2 A;  3F6O A;  1B9M A;  1U3E M;  2VBX A;  2KIM A;  1S29 A;  3RPQ A;  1MJ9 A;  5ILS A;  4LG0 A;  4TV7 A;  1G3Y A;  3HOS A;  3ZMU A;  2UWM A;  4YII A;  3FMR A;  1U8R A;  2P5L C;  4P55 A;  1B9N A;  3CJN A;  5CVV A;  2QLZ A;  2CFX A;  4UV8 A;  4OIO F;  5E1W A;  4M6X A;  1HW2 A;  3I0T A;  4GO1 A;  2ESH A;  3ECH A;  1TQP A;  4FT8 A;  2JTV A;  2HEO A;  1IN5 A;  3M7G A;  2EA2 A;  5EEG A;  3VEP A;  1QZZ A;  5ICE A;  2QWW A;  1XGO A;  4Z2Y A;  3WGH A;  5ICF A;  1LB2 A;  4IJA A;  3H3U A;  2O8X A;  2QZ8 A;  2DBB A;  2XKO A;  2CQK A;  3V8L A;  4HV6 A;  1FSH A;  2Y48 A;  1H9T A;  2KRF A;  3HHH A;  2IW5 A;  2R7D A;  4CYD A;  3EQL F;  4HX4 A;  2MLK A;  3JAM Z;  2GZW A;  3C18 A;  2BEO A;  5F64 A;  4UUV A;  3K69 A;  1BJA A;  1W7P B;  5D4S A;  3CUO A;  4CIC A;  4RGS A;  4R1H A;  4L9J A;  4HF2 A;  2XAH A;  3KZZ A;  1USS A;  2ESN A;  1I1G A;  4G6Q A;  3V8K A;  2RDP A;  5HS8 A;  2EK5 A;  5CVR A;  1LDD A;  1T39 A;  3ABT A;  2GXB A;  3BDD A;  3R6S A;  3QPT A;  5A2Q Z;  2ADU A;  1XB4 A;  2V1U A;  1MDM B;  4XBF A;  3JTG A;  4S04 A;  2CGP A;  4BHP A;  1P6R A;  4IPA A;  3E97 A;  3U1D A;  4AVP A;  2LDU A;  1ZH5 A;  5HLI A;  2MA3 A;  4EQQ A;  4EM1 A;  3RYP A;  2PBI A;  3PQK A;  4N9H A;  1ON1 A;  2FXA A;  5FLX K;  2RNJ A;  1EH6 A;  4MQV A;  3SHF A;  3CDH A;  4BNC A;  1FOK A;  3OOP A;  3WE3 A;  3WGG A;  2FBH A;  1F1Z A;  4EJU A;  2L3D A;  1FC3 A;  4KT5 C;  1XMA A;  5FD6 A;  1BOA A;  3BOQ A;  1KGS A;  5HLH A;  4UVC A;  2F5E A;  3I4P A;  4U7D A;  2HTJ A;  1UHW A;  1TTY A;  5J8F A;  1ONV A;  2K4B A;  5L3C A;  5LEJ A;  4NHJ A;  1R5H A;  4I7H A;  4Y15 A;  5FO5 A;  2XAJ A;  3I53 A;  4HDV A;  1IN4 A;  2FML A;  2IT0 A;  3HSR A;  3FXQ A;  3WG9 A;  2PG4 A;  4U0W A;  2Q0O A;  3W6J B;  2KJC A;  1U5T B;  4E70 A;  2VT2 A;  4I98 B;  1VTN C;  4Y13 A;  4CXF A;  4WK8 F;  1J9I A;  2R7F A;  4BXU A;  4HA8 A;  2K86 A;  1ZHF A;  5KK1 A;  2DQR A;  3F72 A;  1EH7 A;  4G8X A;  3EYI A;  3WGI A;  2QYO A;  1FWZ A;  5DUK A;  4N0B A;  1JGS A;  1JE8 A;  2O03 A;  1MGT A;  2D1V A;  4XRF A;  4ZH4 F;  3LA3 A;  5L3D A;  1HW5 A;  2QQA A;  1TBX A;  2XKP A;  4IRH A;  3R0A A;  4A0X A;  4JBA A;  4KFC A;  4WXH A;  3C7J A;  2L02 A;  3SQN A;  5L3E A;  4ZYG A;  1I6X A;  1UHM A;  1O3Q A;  3V4G A;  3F8M A;  5ED4 A;  1V4R A;  2CYY A;  3QAH A;  3KZY A;  4EM0 B;  1ZLJ A;  4G7O F;  2D1H A;  5D5X B;  1FP1 D;  1TQI A;  4RS8 A;  1SFX A;  5FB2 A;  2XGX A;  1DUX C;  4IHT A;  1K7A A;  1GXP A;  5K5O A;  5HDG A;  3V8J A;  5LRS A;  3SFZ A;  4B09 A;  4L9N A;  2HS5 A;  2DQL A;  5L3F A;  4ETS A;  2QVO A;  1QNT A;  4BH9 A;  4JK1 X;  4IRI A;  4IHS A;  4RGU A;  4LLN A;  4H0E A;  2ZJ2 A;  1W5S A;  5TRD A;  3VFZ A;  4HZF A;  1BC7 C;  3MEX A;  4EM2 A;  4EVI A;  3HSE A;  2Z99 A;  2ZNZ A;  2MD5 A;  1PP8 F;  3GFL A;  2DPU A;  3VB2 A;  1LDK B;  1KQ9 A;  5D5V B;  2OAZ A;  4KMU X;  1PUE E;  3RJP A;  1U6G A;  5AON A;  2OBP A;  4CZZ A;  1B4A A;  3RYR A;  1KU3 A;  4DQ2 A;  1BI3 A;  3DKW A;  3FX3 A;  3TO7 A;  3GZ6 A;  4ZYD A;  1YS7 A;  3FXR A;  3F23 A;  2BE5 F;  3O3K A;  2A61 A;  4ESF A;  3ZMZ A;  1KU2 A;  5DYM A;  5DD8 A;  2JZY A;  3FWE A;  2OZU A;  2EWN A;  3I5U A;  1LVA A;  4KDP A;  3TOB A;  5TJJ A;  4AIJ A;  1E2X A;  1G3S A;  1ZAO A;  1Z6T A;  2W57 A;  2ISY A;  3BWG A;  1XGM A;  5LGN A;  3R60 A;  1X3U A;  4OIR F;  4A12 A;  4OMZ A;  2VBZ A;  3WTW C;  4QWQ A;  5ERI A;  2UXN A;  2HYF A;  4BYY A;  2WC2 A;  1O3S A;  2PMH A;  3ZMV A;  3MCZ A;  1BBY A;  4P5O A;  3CUQ B;  1HQC A;  4P96 A;  4NB5 A;  5JHU A;  1R23 A;  4A5M A;  1QPM A;  2G7H A;  3FHZ A;  4L0Z B;  2V79 A;  3E6D A;  2VBW A;  1D3Y A;  2Z33 A;  4HLX A;  3WE2 A;  3BJ6 A;  1BIA A;  3J80 Z;  2ISZ A;  4LB5 A;  1ZG1 A;  4KUM A;  1XDU A;  4MHG A;  4OMY A;  2PLY A;  4UHT A;  3H92 A;  2FA5 A;  3LQQ A;  1L3L A;  4UVB A;  1WKM A;  3LFK A;  3DV8 A;  1G3T A;  1FYL A;  2EV6 A;  3MWM A;  2ZNY A;  2QUF A;  3ZMD A;  4HDU A;  5D6F A;  3LST A;  2JRT A;  4EGZ A;  5IT9 Z;  3V7S A;  4G7Z F;  1ON2 A;  2VOP A;  4WX9 A;  3BY6 A;  4PGH A;  2M5W A;  2EA4 A;  4BHB A;  4ENN A;  3WTT C;  2FMY A;  2D2W A;  3F6V A;  5J8C A;  1YW7 A;  5HDN A;  1LQ1 A;  1D5V A;  2A5Y B;  2HQR A;  1CGP A;  4XSZ F;  3N4M A;  5D4R A;  4HQM A;  1HW1 A;  4A6E A;  4I0B A;  5A2Q K;  1ZG5 A;  2BV6 A;  3GFM A;  1FLI A;  2V9V A;  2K4J A;  3V7R A;  1B59 A;  2KIF A;  5JVT A;  2VOD A;  2IPQ X;  4Q5S F;  3M8E A;  1ZGA A;  1G3W A;  3P9K A;  4I2O A;  1YLF A;  3ROU A;  2P7C B;  1AOY A;  2FSW A;  1FBU A;  3BPV A;  3J81 Z;  3MZY A;  5FGM A;  1T6S A;  1S6L A;  2GQQ A;  2LSO A;  1Z1D A;  2P4W A;  2X0L A;  3HRT A;  3PFI A;  1W7P A;  1P4W A;  3HRU A;  1SMT A;  3TKY A;  4MQ9 F;  5F1R A;  2JT1 A;  1S3J A;  1BI0 A;  2P6S A;  3T0Y A;  4AD9 A;  1UCR A;  2OA4 A;  3D0S A;  4L5J A;  2XRN A;  4CGZ A;  2UXX A;  3BJA A;  1ZLK A;  4U0Y A;  1TLH B;  4L9V A;  4WCG A;  1MDM A;  2Q2E A;  3JW4 A;  3I54 A;  1ODD A;  4WXD A;  1RIO H;  1RUO A;  2HTS A;  5L3B A;  4KIG A;  3ZN0 A;  1RUN A;  3K1M A;  2LF8 A;  1YFH A;  4KNY A;  1L0O C;  2QQ9 A;  5DEQ A;  2EFO A;  3QP5 A;  4BAY A;  3BPX A;  2BYV E;  5AIQ A;  1V3F A;  1WWX A;  1IN8 A;  1CF7 B;  1OKR A;  4OOI A;  2HKX A;  3C3W A;  5HOO A;  2YPR A;  1HXD A;  2V1D A;  2PFB A;  5K1Y A;  3GO5 A;  2XRO A;  2B0L A;  2ACJ A;  4LD5 A;  1YS6 A;  4CO8 A;  2H94 A;  3FZV A;  2M8E A;  3B02 A;  1YYV A;  2X4H A;  2YU3 A;  5JFR A;  4I0A A;  2EFW A;  3WOD F;  3K0L A;  1U2W A;  4A5N A;  4ENJ A;  3RDI A;  2IJL A;  3I64 A;  1T0F A;  5D5U B;  5LGU A;  4KN4 X;  1Y0U A;  2G7U A;  1TW3 A;  3WU1 B;  2QQB A;  4RB2 C;  3CUQ C;  4FX0 A;  3ZP5 A;  5K5Q A;  3CLO A;  1U5T A;  2DO7 A;  3T5X A;  5HS7 A;  3F8F A;  5E20 A;  3EDP A;  1W5T A;  4YIF A;  3EET A;  3ZPL A;  2LNB A;  3FMS A;  2NS0 A;  3I71 A;  1O7L A;  2DFI A;  3MZH A;  5D8L B;  1C0W A;  5CJ9 A;  4OU0 A;  2IA0 A;  1K6O A;  2P6T A;  3PQJ A;  3VOE A;  1BN5 A;  3KP4 A;  2E1N A;  5DCM B;  3ELK A;  3R4K A;  5ICG A;  2RVC A;  2VON A;  3LA2 A;  4HV5 A;  2R3S A;  2JPB A;  4P9U A;  4UNO A;  3KP7 A;  2A07 F;  3RKY A;  1LEA A;  1HKS A;  5E1Z B;  4LFU A;  2HKO A;  4F7Z A;  4RAY A;  2PEX A;  2RC4 A;  1XCV A;  1EH8 A;  5ICC A;  4KA4 A;  2K27 A;  5E8I A;  2H6B A;  1KU9 A;  4ZZD A;  1UB9 A;  3S2W A;  3SZP A;  3LQR A;  3U9G A;  2H27 A;  2RKH A;  4O5V A;  4AIH A;  2CWE A;  3IKV A;  3KE2 A;  3WTZ A;  2XUB A;  4L9T A;  2J5O A;  3MQ0 A;  1E17 A;  2P5K A;  1REP C;  2GXG A;  2ZKZ A;  1J7K A;  3GF2 A;  1IAW A;  1Z6R A;  2W85 A;  2KKO A;  1I5Z A;  4K2E A;  4IXA A;  2HWV A;  4Q4Z F;  2ZO4 A;  3BJO A;  1R1T A;  3P9C A;  5FFZ A;  2A68 F;  3BP8 A;  3IRQ A;  2ZFW A;  1QGP A;  1ZG3 A;  3K2Z A;  4ESB A;  3QU6 A;  1YW9 A;  3C1D A;  4B8X A;  2EJR A;  3FM3 A;  3CO7 C;  2PI0 A;  3IL2 A;  2JSC A;  3T8T A;  1DPR A;  4XLN F;  4BHC A;  1HKQ A;  1FP2 A;  1WSU A;  3RKW A;  2OQG A;  4O3M A;  1TQM A;  2WWY A;  1KQ8 A;  1JHF A;  4Q47 A;  4BQA A;  3TQN A;  2VE9 A;  3J80 K;  2P8T A;  2CG4 A;  3E6M A;  2XAG A;  4YG2 F;  4PZJ A;  3L2C A;  2KIU A;  3NQO A;  1J75 A;  5DD4 A;  2DT5 A;  3Q5F A;  3MAJ A;  3BZ6 A;  4WXC A;  3IKT A;  3JSO A;  2O61 A;  2IP2 A;  5IT9 K;  2ZME B;  1H0M A;  1Z91 A;  3L00 A;  4GYI A;  1FYK A;  4YFN F;  5E18 F;  3CUQ A;  1IRF A;  4HF0 A;  4GCV A;  3KP2 A;  2FU4 A;  4FHT A;  3ERE D;  1YTY A;  4HW0 A;  6PAX A;  2L54 A;  4WWC A;  3TO6 A;  4G9Y A;  1G6N A;  5EEH A;  2Z9O A;  2FBI A;  3P7N A;  2NYX A;  1EV7 A;  1S8N A;  1ZRE A;  1J2X A;  3EUH A;  1SFE A;  3Q9S A;  3N97 A;  3JTH A;  3FXU A;  1MJA A;  3KP6 A;  5ILV A;  4OIP F;  3ML6 A;  3L09 A;  3KFW X;  2EFP A;  1OYI A;  1QQI A;  2FF4 A;  1WQ2 A;  5D8K B;  2NNN A;  3HYI A;  5L3G A;  3RTR A;  3KEO A;  3HSF A;  1XMK A;  3TGN A;  2TDX A;  2FRH A;  3FMQ A;  2KJB A;  2M30 A;  4KIC A;  3DF8 A;  4R8H A;  2XAS A;  1Z05 A;  4M9X A;  2RQP A;  3DQV C;  3J81 K;  4M6Y A;  2GWR A;  2Q8K A;  1T98 A;  1W4M A;  2E7X A;  1J5Y A;  1XSX A;  1GXQ A;  3GEZ A;  4MTE A;  2JPC A;  2AS5 F;  4GYG A;  2DAO A;  1KU7 A;  2FNA A;  3IHU A;  1KQ0 A;  1TNS A;  1OR7 A;  2W25 A;  4PGG A;  2QBY B;  1TW2 A;  5DV5 A;  3HOT A;  4ZYH A;  1TNT A;  3RPU A;  5BOX A;  1AWC A;  2FOK A;  3TO9 A;  4LK1 F;  2YX7 A;  3GVA A;  3LAJ A;  3M1E A;  1K78 B;  3F8N A;  5AIP A;  5LHI A;  1SMY F;  4G7H F;  2DTR A;  2W24 A;  2MBF A;  2ZCW A;  4CHU A;  1Z7U A;  4U88 A;  1LDJ A;  3WTX C;  5LHH A;  2COM A;  4HYE A;  3D5L A;  4A2U A;  2ETH A;  2AXL A;  4XLP F;  4LLL A;  1IW7 F;  5CLS A;  4RGR A;  3ISP A;  1NHA A;  2L4M A;  2OU2 A;  1RNL A;  3K9T A;  2M45 A;  4NQW A;  1O3T A;  3NEU A;  2M1B A;  5HLG A;  4RGX A;  2EFQ A;  3QRF F;  3KP3 A;  3F8C A;  1R1U A;  4M9Z A;  2DI3 A;  2LF7 A;  3K1P A;  3AAF A;  1P4A A;  4EJV A;  3NRV A;  5BPI A;  5DCF A;  4IRG A;  1CF7 A;  3R61 A;  2PN6 A;  1D8K A;  3DPL C;  2FEZ A;  1FX7 A;  4U0V A; 
#chains in the Genus database with same CATH topology
 1FNN A;  2WAD A;  2IGM A;  2XVC A;  4XLC A;  1SVO A;  2LBF A;  4G6T B;  5M5X J;  2Z5U A;  3PL8 A;  1MMN A;  4ZYE A;  1YQA A;  3C2H A;  4Z6Y A;  4QPQ A;  4HAM A;  2B7E A;  2IA1 A;  4M72 A;  1XCB A;  4XL9 A;  1F9N A;  2RRE A;  4HOB A;  4XLE A;  4ZTJ A;  2A6H F;  3BCA A;  1G4D A;  2ZBK A;  1B72 A;  5EGO B;  2DK8 A;  4RLF A;  3K2A A;  2K40 A;  3DBR B;  2D45 A;  2I8D A;  4I6Z A;  3W6K B;  3CCE I;  2A69 F;  2KMU A;  4FQG A;  3HTS B;  1K79 A;  2XAQ A;  1OPC A;  2BY1 A;  3QP6 A;  2UUZ A;  2HYJ A;  2K5C A;  1TWG J;  1MJB A;  2VBY A;  1S7O A;  3CCY A;  3MVP A;  4NUB A;  4IOC F;  2RGV A;  4UB6 C;  1O3R A;  2XPV A;  2BY3 A;  2K9L A;  2ZME C;  4N4N B;  3SZT A;  3CC4 I;  2F5D A;  2NOJ B;  3HC7 A;  3I58 A;  1VQ5 I;  4BQO A;  1WJB A;  2P7V B;  4KYW A;  4YRV A;  2JJ7 A;  1MSF C;  5IP6 A;  2OPT A;  3WU0 A;  1N25 A;  1RZ4 A;  1Z7L A;  2V7F A;  4A0Y A;  3JSP A;  3S17 J;  2STT A;  1IXR C;  1JKR C;  1WI9 A;  3L2V A;  1R00 A;  3GFI A;  3S2H J;  1I3A A;  4QLC U;  2O8K A;  2VKH A;  3WTY C;  1FYM A;  4YIR X;  2LOO A;  2A6E F;  2Y69 H;  1WJC A;  2E60 A;  2E7W A;  1HST A;  3IAS 2;  4EJO A;  3ZMS A;  4MLO A;  4YFX F;  3ZXS A;  3E3V A;  1UMQ A;  2EZH A;  2HOE A;  1E3P A;  5F08 A;  3CO6 C;  5JHF A;  1XGS A;  2MC3 A;  3ZMT A;  4LG0 B;  3HPG A;  1STZ A;  3B73 A;  2VJJ A;  1X2M A;  2LVS A;  1P7I A;  3GYH X;  2PJP A;  3D5R C;  3E6B A;  3MZ8 A;  4HBL A;  3E6C C;  1VQ7 I;  4U7B A;  5FRN A;  4NDL A;  4HF1 A;  1FOW A;  4Y3O A;  2NNY A;  3HTU A;  4I01 A;  4Y17 A;  5CQG A;  2F5F A;  2L9S A;  4PCQ A;  4L5I A;  4JX4 A;  1UJ8 A;  2E5Z A;  5DCM A;  3BRO A;  1RI7 A;  4QPO A;  3VOD A;  2OF7 A;  2PX9 A;  4KIF A;  3S1Q J;  4MEY F;  4LK0 F;  3KYC B;  3F3X A;  4IVN A;  5HNH A;  1DP7 P;  4LB6 B;  1Y6I A;  2VE8 A;  4DBQ A;  5LGT A;  2HNH A;  3KEY A;  3CME I;  3H0G J;  3GLX A;  3ZQI A;  4CDG A;  3OYE A;  4AIK A;  1XS9 A;  3CLQ A;  2JVH A;  2KIS A;  3M9A A;  1WVR A;  5FKN A;  1X1A A;  2KLO A;  3CCR I;  3DP7 A;  3A01 A;  1ORK A;  3E5Q A;  1YIO A;  3ABK H;  4A6D A;  1W1W E;  2I5U A;  4RAZ A;  4EJW A;  2HQ5 A;  4HRI A;  3SXY A;  2Y31 A;  3FM5 A;  4N4O B;  1J59 A;  2YUS A;  4CCK A;  2E36 A;  5F27 A;  5H6Q A;  2STW A;  3OYM A;  2IS2 A;  2EFN A;  4KN7 X;  2ELH A;  1UST A;  3HEF A;  5DDG A;  3J7A O;  2WAQ N;  3DPT A;  3DKX A;  2EIJ H;  2DOA A;  1KA8 A;  3A1Y A;  2BGC A;  5BQT A;  2HZD A;  4KIB A;  2YS9 A;  1VQN I;  4Q48 A;  1IF1 A;  2L01 A;  1OQY A;  3E5U A;  2V6C A;  3OOU A;  2VC1 A;  2DOD A;  3QU3 A;  3S8P A;  4G12 A;  3HHG A;  4L0Y B;  3RI4 A;  1YX5 A;  2V1X A;  3HM5 A;  4LIT A;  4BY7 J;  1MZB A;  1QZY A;  2AXT C;  3GZN B;  3I4N J;  4WF2 A;  3OL3 A;  5J6X A;  3TP0 A;  4KMF A;  2H09 A;  2FBK A;  2ZXW H;  1KYW A;  3BG7 A;  4ZYA A;  2O9L A;  5D5W B;  3FK7 A;  2EV5 A;  1QA6 A;  2VXZ A;  5ILU A;  4IL6 C;  5E8G A;  3LFU A;  3DXJ F;  2CO5 A;  2DA3 A;  3WTS C;  3TBI A;  4EMS A;  3PUF A;  2IRF G;  2EZL A;  1QO0 D;  5CYV A;  4N9I A;  1IRG A;  1TL8 A;  2WTE A;  3S16 J;  4ASN A;  1VQK I;  4LJZ F;  1ZRD A;  2BHZ A;  5CPR B;  5E1X A;  1UG2 A;  1MD0 A;  3LWF A;  2ZXJ A;  4B43 A;  1PDN C;  5BS6 A;  3BC8 A;  4ENM A;  4CA0 A;  1QRY A;  2W82 A;  3PIO F;  2HPM A;  2VN2 A;  2DYR H;  2FE3 A;  1MH4 A;  2R0Q C;  3KLN A;  2MYS A;  4I09 A;  1J0R A;  2BVM A;  4HLY A;  1FIA A;  1PVE A;  1D0X A;  3QPL A;  5BNG A;  2HGC A;  3KLO A;  5B66 C;  2XHK A;  3TOA A;  2E35 A;  2VT3 A;  4O6J A;  2R7T A;  1R22 A;  5DUI A;  4D0P A;  2Y30 A;  2Y9Y A;  1I6H J;  1FSE A;  2OD5 A;  4V19 K;  3LAP A;  1U9O A;  4XK4 A;  3ZN1 A;  5E17 F;  3S1N J;  3PNY A;  1JI8 A;  3KP5 A;  3REO A;  3F8B A;  1HBX G;  1OMI A;  2F5C A;  5CVI A;  2L9N A;  4JQF A;  1OYW A;  4GDF A;  5CVU A;  2Z2S B;  2ID6 A;  2E1M C;  2J5P A;  1NG7 A;  1D8J A;  2GAU A;  3DCF A;  3IC7 A;  4EGY A;  2L7F P;  2O3F A;  1TP4 A;  1IN6 A;  5JR3 A;  1OYY A;  2DU9 A;  5J3L A;  1QVT A;  1ULY A;  2IVM A;  3MFK A;  1GHC A;  2A3S A;  4LIV A;  3HRS A;  2C6Y A;  3I9V 2;  2HU9 A;  3GTK J;  2EB7 A;  3WTU C;  2Y75 A;  3ABL H;  4BL0 B;  2JA5 J;  2Y0M A;  1FPQ A;  2VC0 A;  3T1B A;  2ME0 A;  3OYF A;  2W7N A;  2M87 A;  2R7X A;  3L9F A;  2L4A A;  1GV2 A;  2VJ4 A;  2WAF A;  5H6R A;  2X1E A;  2W84 A;  4LOC A;  3GX4 X;  2PQ8 A;  3NAU A;  1MW7 A;  3OL4 A;  4W1U A;  5LHG A;  3KYL A;  2ZXI A;  5FLX Z;  2ZME A;  3WU2 C;  1XSV A;  1MBH A;  5HDK A;  1ETK A;  2BY2 A;  3MN2 A;  3A2K A;  1SFU A;  2MLG A;  2GA1 A;  2M34 A;  4M73 A;  4P9F A;  5FD5 A;  4RBO A;  4EV0 A;  1XGN A;  1T2K A;  4RM3 A;  1F4K A;  1O7F A;  1DU0 A;  3DEU A;  2PMZ N;  1LEB A;  2IA2 A;  1SD6 A;  3ZQ7 A;  3TDU C;  1RRJ A;  5GAE J;  4MGR A;  1K61 A;  4FIS A;  1MBJ A;  2G0E A;  2O7O A;  1LJ9 A;  1W7P D;  1YG2 A;  2P5V A;  1SFK A;  3F22 A;  5E79 C;  2X48 A;  4BKX A;  2QF7 A;  4I99 C;  2XSD C;  4Y7N J;  1BI1 A;  2YSR A;  2ZSH B;  3W2W A;  4M71 A;  2R93 J;  3EYY A;  4UVA A;  2X51 A;  2JUG A;  1SAX A;  3I55 I;  5JI6 A;  1MND A;  1YHQ I;  2RNG A;  5CVJ A;  4GXO A;  1DQU A;  3L7W A;  2DW4 A;  3DWL E;  1RPW A;  1XTA A;  3GFJ A;  4BJT A;  5K7F A;  2OZ6 A;  1U8B A;  4X1E A;  3RQI A;  2LKP A;  2WB1 N;  3UKG A;  3HOX J;  1U0J A;  1DPU A;  5JLW A;  1R7J A;  3T8R A;  3VDX A;  4ZDO A;  1K4T A;  3ZQL A;  3GCM A;  3IRR A;  5HVQ C;  4M74 A;  2R7Q A;  3C2G A;  3COA C;  4PDK A;  3ZQF A;  4S05 A;  2L2O A;  5HS9 A;  3BG9 A;  1I39 A;  4BE0 A;  4GGG A;  3H3Z A;  4HPQ A;  1H9G A;  2MH9 A;  4BS9 A;  2CW8 A;  4LMY A;  3OIO A;  2NRA C;  3X2Q H;  3W3C A;  4D5C A;  5H20 A;  5KNL A;  2PMU A;  1I27 A;  2FNP A;  1P92 A;  2VKE A;  2DXI A;  3ABM H;  1Q1H A;  1XSD A;  1FIP A;  4KT6 A;  1VF9 A;  5GTH C;  3QYB A;  2VPR A;  1F5T A;  4XKW A;  2EV0 A;  2HR3 A;  2XAF A;  4BAC A;  3HRM A;  2VXD A;  4L18 B;  1TZL A;  4MO7 A;  4HNT A;  2HYG D;  4OIQ F;  3MKY B;  1W5C C;  1AKH B;  2VI6 A;  3E0J B;  1VQP I;  2YX4 A;  2OQR A;  2DPD A;  4AID A;  5F6F A;  2L9V A;  1BIB A;  3ZR8 X;  3OWT A;  3RZO J;  2RV8 A;  3L2U A;  4KIS A;  2Z3Y A;  4R79 A;  4LGW A;  3HKZ N;  2VOO A;  1IUY A;  1BI2 A;  1IXS B;  2BVL A;  3LL7 A;  4C2U A;  2K7L A;  3IWF A;  3M3Y J;  3BZC A;  2GIZ A;  4F93 B;  5M5W J;  2M0M A;  3KEQ A;  4HX7 A;  1Z77 A;  1T08 B;  5K7H A;  5K5R A;  3VPR A;  3HOZ J;  3HXL A;  3SDG A;  2K9S A;  3FIW A;  4AC0 A;  2YR2 A;  4ESJ A;  1R36 A;  4E6K G;  2E1O A;  2XAU A;  3F21 A;  1ZYR F;  2KZV A;  1BR4 A;  3O6B B;  2QBY A;  5LBQ A;  3K1N A;  3I59 A;  2GA2 A;  1V5E A;  5C4J J;  3IUO A;  2QM3 A;  3HDD A;  4DYC A;  3E1S A;  1QBJ A;  3P9I A;  1WH7 A;  5J1U A;  2HQN A;  2HI3 A;  4A3J J;  4E7H A;  2CW0 F;  4IHY A;  3CTA A;  1S7A A;  2QCO A;  3BQZ A;  4YFK F;  1FZP B;  2BHY A;  2UZK A;  1F36 A;  1P2F A;  1XC5 A;  1S5L C;  2E1C A;  2DMN A;  2HDD A;  1I50 J;  2L7M P;  2FUG 2;  3G4S I;  3K4N A;  1K78 A;  5BMZ A;  2ZC2 A;  5KVR A;  3H5A A;  3VYR B;  1ZRF A;  2O6G E;  1P4X A;  2DJI A;  3PNT A;  4RB1 A;  5FFX A;  1GVJ A;  3HUG A;  4ANJ A;  4RB3 C;  4C30 A;  2LKX A;  4I02 A;  2HXO A;  4UV9 A;  1FBS A;  2DA4 A;  3G3Z A;  3OV8 A;  1VND A;  4CZC A;  2WV0 A;  1IN7 A;  3OYL A;  5KHD A;  3OYC A;  3WG7 H;  5EZG A;  4M6V A;  5BPD A;  4UUT A;  1HA8 A;  1FBQ A;  1PYV A;  2H1K A;  3M8F A;  3OYH A;  5LRR A;  5IT3 A;  3RKX A;  2CMP A;  2AO9 A;  3ECO A;  1HOM A;  1ZAR A;  4FX4 A;  3FHN A;  3I59 B;  1WRJ A;  4C2M J;  1KYZ A;  1U9N A;  1FY7 A;  3ERM A;  3GXO A;  4RB0 A;  4OIN F;  4E7I A;  1JXS A;  4XOP A;  3WTV C;  3FDY A;  4XSX F;  1XN7 A;  4AWX B;  4AU7 A;  1R1V A;  3LSG A;  1A04 A;  1RET A;  1D1A A;  1MKM A;  3E5X A;  2K02 A;  1D0Y A;  2XPW A;  1N78 A;  1D5Y A;  4UXN A;  1Y8R B;  2ME6 A;  1UEL B;  1S7E A;  2HDC A;  3OSF A;  3GZ5 A;  1XD7 A;  4E7J A;  2G9W A;  3ASN H;  4LLG F;  3OYI A;  4A0Z A;  2BBY A;  2P0W A;  4ZZL A;  1A35 A;  3QOP A;  5EF6 A;  1IXC A;  1JJ8 C;  2DYS H;  1R9T J;  2V9K A;  2LY1 A;  2HZT A;  3OYD A;  1U5T C;  1B6A A;  5J1Y A;  3GWZ A;  1P9Q C;  4B3X A;  3G1L A;  3ABU A;  3MD2 A;  1XDS A;  3PUB A;  2XIG A;  1BC8 C;  2LTP A;  3GUD A;  1BW6 A;  3DFG A;  3LA7 A;  3TW7 A;  3RIR A;  4ZJZ A;  1HKT A;  5M3M J;  1R58 A;  2V9P A;  3BR2 A;  4MEX F;  3UR3 C;  1YRN B;  3QPH A;  1OCT C;  2XPU A;  3ULQ B;  1PUF B;  1T38 A;  2QEN A;  4DNC A;  3MKW B;  2M0C A;  4II3 A;  3JAM K;  1IZ1 A;  2H6C A;  4YEJ A;  3L2R A;  4EJT A;  2CUF A;  4OAZ A;  3KCC A;  4PJL A;  4IHX A;  2BZT A;  2E2I J;  1B1B A;  3TDZ C;  3G73 A;  1FT9 A;  2HFH A;  1Z9C A;  1PP7 U;  1JT6 A;  2QEX I;  4XLA A;  2GIV A;  2Y9Z A;  4MNU A;  5EGO A;  4RM2 A;  3TL4 X;  4GRI A;  3CF2 A;  1BM9 A;  4ON0 A;  3V7C A;  5B5E C;  2X85 A;  4HX8 A;  5LLQ A;  3FF5 A;  2B63 J;  3O2P E;  2CSO A;  2JRM A;  2NAZ A;  1HF0 A;  2R7V A;  2LRD A;  2K9M A;  5LEK A;  1UFM A;  3GW2 A;  1YW8 A;  2R7O A;  3EUA A;  3K10 A;  2F2E A;  1WH5 A;  2HOA A;  4PJN A;  2Z1D A;  4G6D A;  4M9S A;  2DK5 A;  3ZGK A;  1HSJ A;  1SD5 A;  4CYC B;  1GT0 C;  1U78 A;  1OLT A;  1LNW A;  1LUJ B;  2MH2 A;  2O0Y A;  3R0J A;  4HST A;  2HVQ A;  2RN7 A;  1ETO A;  4MTD A;  2XV4 S;  1ZRC A;  3U2R A;  1MSE C;  3Q9V A;  2NS7 A;  1SD4 A;  3SJM A;  1ZGJ A;  4G94 A;  2DLL A;  1R5G A;  1JHH A;  5D6E A;  3IWZ A;  4ENK A;  3KET A;  1I1S A;  1SD7 A;  2XGD A;  4HQE A;  2X1C A;  3HIF A;  5KAF C;  5EZH A;  1LPQ A;  1DDN A;  1YO5 C;  1IUF A;  2FQ3 A;  1I3Q J;  1O57 A;  4IF4 A;  3NAR A;  1JT0 A;  1ZN2 A;  3F6O A;  1B9M A;  1K4S A;  4P1W A;  1U3E M;  2VBX A;  1MH3 A;  2KIM A;  1S29 A;  2LD5 A;  2JA8 J;  3RPQ A;  1MJ9 A;  5ILS A;  4LG0 A;  4TV7 A;  1G3Y A;  3HOS A;  2H1L A;  3ZMU A;  2UWM A;  4YII A;  2OC6 A;  3FMR A;  2X6Y A;  1U8R A;  4A3B J;  2P5L C;  3PSI A;  4P55 A;  4BQN A;  5M5Y J;  2JA2 A;  3LSH A;  1B9N A;  3L2Q A;  3WHC A;  3CJN A;  5CVV A;  2QLZ A;  2CFX A;  2M4K A;  4UV8 A;  4OIO F;  5E1W A;  4M6X A;  1HW2 A;  3I0T A;  1H88 C;  4GO1 A;  2BXZ A;  2ESH A;  2VB6 A;  3ECH A;  1TQP A;  5GAG J;  4FT8 A;  2DA1 A;  2JTV A;  2ZJQ F;  2HEO A;  2JWT A;  1IN5 A;  3M7G A;  2EA2 A;  1OCR H;  5EEG A;  3VEP A;  1QZZ A;  5ICE A;  3BT9 A;  2QWW A;  1XGO A;  4RA2 A;  2DA5 A;  1T8I A;  3QPS A;  2L7Z A;  3SYT A;  4CSW A;  4Z2Y A;  3WGH A;  4Y33 A;  5ICF A;  1LB2 A;  3GLL A;  5DS9 A;  2FX0 A;  4IJA A;  5E3N A;  1OCO H;  5EJC A;  3H3U A;  3CF5 F;  3AKZ A;  1IRZ A;  3OIP A;  2O8X A;  2QZ8 A;  2DBB A;  4MFE A;  2XKO A;  2LLK A;  2EPF A;  1IDY A;  2CQK A;  3AG2 H;  3V8L A;  3DU5 A;  4HV6 A;  1FSH A;  2Y48 A;  1H9T A;  2KRF A;  1Y1W J;  2V6E A;  4BXX J;  1ETW A;  2DTZ A;  3HHH A;  2IW5 A;  2R7D A;  4RAG A;  4CYD A;  2JMW A;  3EQL F;  4HX4 A;  2MLK A;  4A3D J;  5C4X J;  3M1C A;  3JAM Z;  1AU7 A;  2GZW A;  2R4G A;  3C18 A;  2BEO A;  5F64 A;  4UUV A;  2EIM H;  4XRS A;  1BR2 A;  3K69 A;  1FMW A;  1V5G A;  1BJZ A;  1BJA A;  1W7P B;  5D4S A;  3CUO A;  4M3E A;  4CIC A;  2OJE D;  4RGS A;  4R1H A;  4L9J A;  4HF2 A;  2XAH A;  3KZZ A;  2F4O B;  1USS A;  2ESN A;  1I1G A;  4G6Q A;  4Y4R A;  2RDP A;  2AQF A;  3UNG C;  2EK5 A;  3V8K A;  5HS8 A;  5CVR A;  1LDD A;  1T39 A;  3ABT A;  2GXB A;  1MNM C;  3BDD A;  4JYK A;  4DBR A;  3PFY A;  2KFD A;  3F9K A;  3LSM A;  3R6S A;  3QPT A;  2ADU A;  1XB4 A;  5A2Q Z;  2V1U A;  4E7Z A;  4A3M J;  2Q2E B;  1MMD A;  2XF7 A;  1MDM B;  4XBF A;  3JTG A;  4S04 A;  4NC8 A;  2CGP A;  1P6R A;  4IPA A;  4BHP A;  5E3M A;  3E97 A;  2JA6 J;  3U1D A;  4AVP A;  2LDU A;  1ZH5 A;  4D9J A;  5HLI A;  3DU6 A;  2ZB9 A;  2MA3 A;  3CCL I;  4BE2 A;  4CUG A;  4U87 A;  4EQQ A;  2BXY A;  3OY9 A;  4EM1 A;  3RYP A;  1NK3 P;  2PBI A;  3PQK A;  2XGC A;  4N9H A;  1ON1 A;  2FXA A;  1FJL A;  5FLX K;  3QYE A;  2RNJ A;  1N77 A;  2XB0 X;  1EH6 A;  2EZI A;  4MQV A;  4XID A;  2IS1 A;  1J09 A;  3SHF A;  3CDH A;  4BNC A;  3LSK A;  1FOK A;  3OOP A;  2R5Y B;  3WE3 A;  4XN0 A;  3WGG A;  3DBH B;  4J01 A;  2FBH A;  1ZKG A;  1F1Z A;  4EJU A;  3M4O J;  3BTI A;  2L3D A;  2L9R A;  5JLX A;  3CDL A;  4IQJ A;  3S3O A;  1FC3 A;  2XGE A;  1WPK A;  4KT5 C;  2HPI A;  3RZD J;  1ETV A;  1XMA A;  5FD6 A;  3CCS I;  1BOA A;  4IQ4 A;  3J7Z I;  3BOQ A;  3MMY B;  1KGS A;  5HLH A;  4UVC A;  2F5E A;  3I4P A;  4U7D A;  2HTJ A;  3Q0W A;  1UHW A;  1O4X A;  4AYB N;  2EBI A;  3DTE A;  1TTY A;  1IV8 A;  5J8F A;  2E2H J;  1ONV A;  4F3Q A;  2LKS A;  5IYB J;  2DMQ A;  1WI3 A;  2GOM A;  2K4B A;  5L3C A;  1W0T A;  4IOA F;  5LEJ A;  4NHJ A;  1R5H A;  3RPU D;  3ZOB A;  4X0G A;  3JRB A;  1TWA J;  4I7H A;  4CCN A;  4Y15 A;  5FO5 A;  4BJ5 C;  2IGO A;  2XAJ A;  3I53 A;  4HDV A;  2XRL A;  1IN4 A;  1YIT I;  3IH4 A;  1OJL A;  4H4K C;  2FML A;  1XMX A;  2XF6 A;  3HZJ A;  1ETX A;  1ERD A;  1G2H A;  2IT0 A;  3HSR A;  4QSH A;  3FXQ A;  3WG9 A;  2PG4 A;  3P5J A;  2K85 A;  4BGD A;  3BR5 A;  2VIX A;  4U0W A;  3L2W A;  3DLA A;  3EUK L;  3G71 I;  2KP6 A;  3CJR B;  1LKX A;  2DMP A;  2Q0O A;  1LE8 B;  4D7M A;  3SEQ A;  3JRA A;  3W6J B;  2KJC A;  4DW6 A;  4HNV A;  1U5T B;  4E70 A;  4EAT A;  2VT2 A;  4I98 B;  1VTN C;  2FJ1 A;  4Y13 A;  2NVX J;  3PNV A;  1WJE A;  3AG3 H;  3V42 A;  4CXF A;  4WK8 F;  2E2J J;  1J9I A;  1HC8 A;  2R7F A;  4BXU A;  4HA8 A;  4F92 B;  4UUS B;  2LRE A;  1K6Y A;  2K86 A;  1ZHF A;  3LSJ A;  5C3E J;  1F43 A;  5KK1 A;  2ZXH A;  4A3G J;  2DQR A;  3S14 J;  2CQ7 A;  4XLF A;  3F72 A;  2WAE A;  1SC7 A;  1OCP A;  1EH7 A;  4G8X A;  3TMO A;  5DM7 F;  3OS2 A;  2CFO A;  3EYI A;  3WGI A;  3HOV J;  2QYO A;  1FWZ A;  2MFZ A;  3OYN A;  1T56 A;  5DUK A;  4N0B A;  4OAY A;  2R5Z B;  1JGS A;  1W0U A;  3RCO A;  2QKM B;  3M8J A;  4DIQ A;  1JE8 A;  2O03 A;  1MGT A;  2D1V A;  3K4L A;  4XRF A;  1VFC A;  4ZH4 F;  3LA3 A;  5L3D A;  1HW5 A;  1FEX A;  2QQA A;  1TBX A;  2M8G X;  2YU9 J;  2XKP A;  3HOW J;  3JR9 A;  2CV1 A;  4IRH A;  3MKZ A;  3R0A A;  4A0X A;  4JBA A;  1YJ9 I;  1HDP A;  4KFC A;  3FXK A;  2Y0S A;  3K4J A;  2DOE A;  4WXH A;  3JRF A;  2A6T A;  1GV5 A;  3C7J A;  2L02 A;  2WY8 Q;  3VSL A;  3SQN A;  1Y56 A;  3AG4 H;  4F52 A;  2R7Z J;  4IZZ A;  5L3E A;  4ZYG A;  3ZQC A;  2ICW G;  1I6X A;  1UHM A;  1O3Q A;  1YJN I;  3V4G A;  3F8M A;  3Q3S A;  2W48 A;  5ED4 A;  1V4R A;  2CYY A;  1OCZ H;  1ITY A;  3QAH A;  4E7S A;  1JGG A;  3S1M J;  5JVG F;  3KZY A;  4EM0 B;  1A5J A;  2QA4 I;  1ZLJ A;  4G7O F;  3FXM A;  2D1H A;  5D5X B;  1FP1 D;  3I3L A;  1TQI A;  3Q0U A;  4PSX A;  4RS8 A;  1SFX A;  2XB5 A;  5FB2 A;  1ENH A;  2XGX A;  1DUX C;  4IHW A;  4IHT A;  4C3I J;  1K7A A;  2MSY A;  1AKH A;  3HPH A;  1GXP A;  4PJ0 C;  5LD2 C;  5K5O A;  3K70 D;  2A5W A;  1JUM A;  5HDG A;  2HOS A;  4RLQ A;  3V8J A;  3EPZ A;  5LRS A;  1UHS A;  2NVY J;  3SFZ A;  2R92 J;  3FXL A;  4B09 A;  1Z21 A;  4L9N A;  2HS5 A;  3KX2 A;  3E7L A;  3G6E I;  1JJ6 C;  2DQL A;  5L3F A;  4ETS A;  2QVO A;  1QNT A;  3HJE A;  4BH9 A;  1FMV A;  4JK1 X;  4IRI A;  4IHS A;  4BJ6 C;  4RGU A;  1IRX A;  4LLN A;  1TC3 C;  4H0E A;  3ESW B;  3VWB A;  5HLT A;  1IJW C;  2ZJ2 A;  1W5S A;  2R7U A;  1D1C A;  5TRD A;  3VFZ A;  4HZF A;  2ELJ A;  4S0H B;  1BC7 C;  3MEX A;  4EM2 A;  4EVI A;  3HSE A;  1BOB A;  2Z99 A;  3G1M A;  2KHM A;  2ZNZ A;  1Y1V J;  1TT5 B;  3MKL A;  2MD5 A;  1PP8 F;  3GTJ J;  3GFL A;  1FTT A;  1MIJ A;  2DPU A;  3VB2 A;  1LDK B;  4NC7 A;  1MBK A;  1KQ9 A;  2X9D A;  5GTI C;  4BDZ A;  2R7W A;  3TW6 A;  5LFA A;  5D5V B;  3W2A A;  3A4C A;  2OAZ A;  4KMU X;  1PUE E;  3RJP A;  1U6G A;  1Z3X A;  5AON A;  4B47 A;  2JK3 A;  2OBP A;  4CZZ A;  1B4A A;  4UY8 I;  3RYR A;  1KU3 A;  4DQ2 A;  1BI3 A;  1D0Z A;  3DKW A;  4C9Y A;  4V2F A;  2VQH A;  2M3A A;  3FX3 A;  1OCC H;  2DFF A;  3TO7 A;  2VLA A;  4ZDP A;  3GZ6 A;  4ZYD A;  1YS7 A;  3FXR A;  3F23 A;  2OTJ I;  1E3H A;  2BE5 F;  1R49 A;  1EA3 A;  9ANT A;  3O3K A;  1AHD P;  2A61 A;  2DDB A;  4ESF A;  2MGQ A;  3ZMZ A;  4AVZ A;  1KU2 A;  2LMD A;  1JUS A;  5DYM A;  5DD8 A;  2IGN A;  3U1K A;  3SZG A;  3HG9 A;  2ECC A;  2JZY A;  3FWE A;  4F55 A;  2OZU A;  3BG6 A;  2MAB A;  4BEH B;  2EWN A;  5FRO A;  3I5U A;  1LVA A;  3IAM 2;  4KDP A;  3TOB A;  5TJJ A;  4AIJ A;  2WA0 A;  2DA2 A;  4D1Q A;  2A05 A;  1W36 D;  1E2X A;  3Q0V A;  1G3S A;  1ZAO A;  2WY7 Q;  1Z6T A;  2W57 A;  2ISY A;  2DA7 A;  3BWG A;  1ACI A;  1XGM A;  2EH3 A;  5LGN A;  4L5E A;  3R60 A;  2NVQ J;  2BW3 B;  2LG4 A;  4DJA A;  3IP4 B;  4XOR A;  1X3U A;  1QVU A;  2L0K A;  4OIR F;  5DM6 F;  1X1C A;  4IKF A;  5B1A H;  1NK2 P;  3GTL J;  4OWR B;  5F0F A;  4A12 A;  2D5V A;  4OMZ A;  2ZJP F;  2B9S A;  2VBZ A;  5IP7 J;  3A0H C;  3ZQG A;  3WTW C;  4ABZ A;  4QWQ A;  4ZDL A;  5ERI A;  2UXN A;  4BUP A;  1H89 C;  1ETQ A;  2HYF A;  4BYY A;  2WC2 A;  1O3S A;  2X6O A;  2PMH A;  4RAF A;  1TWH J;  3MCZ A;  2KRH A;  3ZMV A;  2CV2 A;  1BBY A;  4P5O A;  1V54 H;  2IS6 A;  1UAA A;  3CUQ B;  1HQC A;  4P96 A;  5EYR A;  2DJN A;  5GAH J;  2KT0 A;  4NB5 A;  1SEU A;  5JHU A;  3CCJ I;  1R23 A;  2IBD A;  3CQZ J;  4PUS A;  4A5M A;  3OYA A;  2FQ4 A;  2Z16 A;  4M3D A;  1QPM A;  2G7H A;  5DTD A;  1YRN A;  2IXS A;  3AFH A;  3FHZ A;  4L0Z B;  5FJ8 J;  4JP0 A;  2V79 A;  2M9H A;  4IEJ A;  1XG1 A;  2CW7 A;  3FKJ A;  5J1R A;  1PUF A;  5FKK A;  3E6D A;  5FKO A;  2VBW A;  1YOV B;  1D3Y A;  3DPU A;  2Z33 A;  4HLX A;  3RKQ A;  2M2E A;  4XRM A;  3WE2 A;  3BJ6 A;  1BIA A;  3J80 Z;  1VQ9 I;  2ISZ A;  4LB5 A;  1ZG1 A;  4BDY A;  2MD0 A;  1XDU A;  4KUM A;  1WZ2 A;  2DDA A;  2VKV A;  4MHG A;  4OMY A;  2PLY A;  4UHT A;  3H92 A;  2OCC H;  2H8R A;  2KIQ A;  3G1O A;  2FA5 A;  3LQQ A;  1T0F C;  1L3L A;  1MMS A;  4XON A;  4UVB A;  1WKM A;  3LFK A;  3PJR A;  2EZK A;  4XN3 A;  3DV8 A;  1G3T A;  4PJJ A;  1FYL A;  2EV6 A;  3MWM A;  2ZNY A;  3H3V K;  2QUF A;  3BR6 A;  3ZMD A;  4HDU A;  2RAE A;  5D6F A;  1X1B A;  3LST A;  4V2G A;  4QTR A;  2Q1Z B;  2JRT A;  4EGZ A;  1TT0 A;  4CYC A;  2HOT A;  5EG0 B;  3SEZ A;  5IT9 Z;  3V7S A;  4G7Z F;  1ON2 A;  3K4C A;  4KJZ A;  2VOP A;  4WX9 A;  1LVK A;  1RKT A;  3BY6 A;  4PGH A;  2DCE A;  2EA4 A;  2M5W A;  3TP3 A;  5GAD J;  4BHB A;  1SVM A;  2DT6 A;  4A3F J;  1JTX A;  4ENN A;  3LMM A;  3WTT C;  5H2F C;  5J47 A;  5GPC A;  4GFB A;  3S3M A;  2FMY A;  4D7N A;  2D2W A;  3F6V A;  5J8C A;  2LH9 A;  1YW7 A;  3CJQ B;  1N75 A;  3I56 I;  5HDN A;  3S2D J;  1LQ1 A;  1SAU A;  1D5V A;  4IHV A;  3GBG A;  1SAN A;  2A5Y B;  1S72 I;  2QSG X;  3A02 A;  2HQR A;  4CH7 A;  2WAQ A;  1YI2 I;  1X4P A;  2MW8 A;  2IEK A;  4J00 A;  1CGP A;  3LSR A;  2PJR B;  4XSZ F;  3N4M A;  5D4R A;  2WBM A;  4HQM A;  5B1B H;  1VI0 A;  1HW1 A;  4A6E A;  4I0B A;  1UZC A;  2GLO A;  3GME A;  5A2Q K;  1GLN A;  2GBY A;  4AYB A;  5CKT A;  1ZG5 A;  2BV6 A;  1X19 A;  3OYK A;  3GFM A;  3OSG A;  1FLI A;  2LY9 A;  1KZH A;  4FE7 A;  3S15 J;  2V9V A;  2W00 A;  3VYS B;  2K4J A;  2R7S A;  3QOD A;  1B59 A;  2KIF A;  3V7R A;  3LOC A;  3O8H A;  5JVT A;  2VOD A;  2IPQ X;  1X4O A;  3H1C A;  3M8E A;  1ZGA A;  1G3W A;  4Q5S F;  2LR8 A;  3P9K A;  4I2O A;  4A69 C;  4C2T A;  1ZR4 A;  4C3H J;  1YLF A;  3ROU A;  2CS3 A;  1QHG A;  2P7C B;  3FXO A;  1AOY A;  2FSW A;  5FRM A;  1FBU A;  3BPV A;  1PJR A;  1ZTR A;  3J81 Z;  3MZY A;  5FGM A;  1G59 A;  1APL C;  1MNE A;  1T6S A;  3CP2 A;  1S6L A;  2GQQ A;  2LSO A;  3BG5 A;  2UV1 A;  1Z1D A;  2P4W A;  2X0L A;  1JTY A;  1RES A;  2NOG A;  1VQ6 I;  2ZFU A;  2F6C A;  3HRT A;  3BR3 A;  1X2N A;  1DGR M;  2W1O A;  3PFI A;  4DZJ A;  1W7P A;  1CQT A;  3CCQ I;  1P4W A;  2JQ7 A;  1OIS A;  3HRU A;  1SMT A;  2DFE A;  3TKY A;  5J4Y A;  2CUJ A;  4MQ9 F;  5F1R A;  2JT1 A;  1S3J A;  4NNJ A;  1BI0 A;  3RSN A;  4KIT B;  2P6S A;  3T0Y A;  4AD9 A;  4NQW B;  1UCR A;  2OA4 A;  3D0S A;  4L5J A;  3VYT B;  2XRN A;  4CGZ A;  2UXX A;  2HDW A;  3BJA A;  2XC7 A;  1ZLK A;  4BBS J;  4U0Y A;  1TLH B;  4L9V A;  4XRS G;  4WCG A;  4QIW N;  2VL8 A;  1MDM A;  2Q2E A;  2OV7 A;  2RQQ A;  3JW4 A;  2NVU B;  3I54 A;  1ODD A;  1SFO J;  3L1P A;  3IH3 A;  2LP0 A;  1VQ4 I;  1RKW A;  4WXD A;  1RIO H;  1RUO A;  3AL0 B;  2HTS A;  5L3B A;  4MFD A;  3GTQ J;  4KIG A;  3ZN0 A;  3J7Y J;  1RUN A;  4IO9 F;  3K1M A;  3OR2 C;  2LF8 A;  1YFH A;  4KNY A;  1L0O C;  2CRG A;  2QQ9 A;  5DEQ A;  2EFO A;  5C44 J;  3QP5 A;  4BAY A;  3HL2 A;  3BPX A;  2BYV E;  5AIQ A;  5E3O A;  2E71 A;  1V3F A;  1WWX A;  3KZI C;  1IN8 A;  1CF7 B;  1T95 A;  2R5Y A;  4A93 J;  1OKR A;  4FE4 A;  4BY1 J;  3OMY A;  4OOI A;  2HKX A;  3C3W A;  1BR1 A;  2CQX A;  5HOO A;  2MC4 A;  2YPR A;  1HXD A;  2HXI A;  2PFB A;  2V1D A;  5K1Y A;  3S32 A;  3GO5 A;  2XRO A;  2B0L A;  2X1D A;  2LBF B;  2ACJ A;  2O5R A;  2OCE A;  4LD5 A;  4JX5 A;  1YS6 A;  3BZK A;  4PFP A;  3NWS A;  1JKP C;  1AA7 A;  2K9N A;  2CUE A;  4CO8 A;  4FAS D;  2H94 A;  2PMZ A;  3FZV A;  2LFB A;  1ETY A;  2M8E A;  3B02 A;  1YYV A;  1IV6 A;  1VQM I;  2X4H A;  3FBI B;  5IOY A;  2WV1 A;  2YU3 A;  5JFR A;  4I0A A;  2EFW A;  1B72 B;  1R4N B;  3DEW A;  2NS8 A;  2VJ5 A;  4UB8 C;  2CUZ A;  1X1P A;  3OS1 A;  3WOD F;  3HB9 A;  1Y39 A;  3K0L A;  1D1B A;  2KRC A;  1U2W A;  5F04 A;  4A5N A;  4MIM A;  1YJW I;  1XPX A;  4ENJ A;  3BQY A;  3RDI A;  2IJL A;  3I64 A;  1MBE A;  1T0F A;  4CCO A;  2JA7 J;  3SDB A;  2ZSI B;  2WB1 A;  3S1R J;  4A3K J;  5D5U B;  5LGU A;  5IYD J;  4KN4 X;  1Y0U A;  2G7U A;  2K3P A;  4DZP A;  1TW3 A;  3WU1 B;  2QQB A;  5EEA A;  4HNU A;  1GDT A;  3CD6 I;  4RB2 C;  1LE8 A;  3QYF A;  3CUQ C;  2VJI A;  4FX0 A;  3ZP5 A;  1NH3 A;  5K5Q A;  3CLO A;  1U5T A;  2E34 A;  2DO7 A;  1R6R A;  2TCT A;  3T5X A;  4DGW B;  2JUC A;  5HS7 A;  2MG4 A;  3F8F A;  5E20 A;  2OTL I;  3ASO H;  3EDP A;  3VYU B;  4XKV A;  1W5T A;  4YIF A;  5B3S H;  1WHU A;  3EET A;  2M4G A;  2LNB A;  3FIS A;  2NS0 A;  3FMS A;  5EDN A;  4UUS A;  3ZPL A;  1E0E A;  3H36 A;  3I71 A;  1O7L A;  2F48 A;  1ZEL A;  2DFI A;  2FD5 A;  3MZH A;  2OUM A;  1R5I D;  5D8L B;  2LC2 A;  1C0W A;  3GTG J;  3EUH C;  5CJ9 A;  2X6W A;  2VUM J;  4OU0 A;  2F5V A;  5KAI C;  3CMY A;  3C2B A;  2IA0 A;  4E7L A;  1QU3 A;  2DMT A;  1K6O A;  2P6T A;  2V1N A;  4ITV A;  3PO3 J;  2R5Z A;  3PQJ A;  3VOE A;  4AUX A;  3JRE A;  4XNF A;  1BN5 A;  3HKZ A;  3KP4 A;  4ZC3 A;  4B3A A;  3B6A A;  2E1N A;  3N05 A;  2L7K A;  1WJ5 A;  5DCM B;  3ELK A;  3R4K A;  2KQR A;  5ICG A;  2RVC A;  2HVR A;  2VON A;  3LA2 A;  2KDO A;  4HV5 A;  2V4J C;  2N8G A;  2AQE A;  2R3S A;  3O8G A;  3H35 A;  3PIP F;  3H9G A;  1YX3 A;  1P7J A;  2JPB A;  3FKI J;  2NXN B;  4P9U A;  5TIS C;  1HDD C;  4UNO A;  2DN0 A;  3KP7 A;  2A07 F;  2CJJ A;  4FCY A;  3RKY A;  1LEA A;  1HKS A;  4A3I J;  5E1Z B;  3HOU J;  1A6Q A;  4PFO A;  4LFU A;  2HKO A;  4F7Z A;  5HOD A;  4RAY A;  2PEX A;  4XQF A;  2RC4 A;  1RC9 A;  3JRH A;  1XCV A;  3PO2 J;  2JVG A;  3A01 B;  1EH8 A;  5ICC A;  4KA4 A;  1Z0X A;  1IDZ A;  2AHQ A;  2K27 A;  5E8I A;  2H6B A;  1KU9 A;  4ZZD A;  1UB9 A;  3S2W A;  3JRG A;  3SZP A;  4J19 A;  1S9H A;  3LQR A;  5E3L A;  3U9G A;  3JCU C;  4B44 A;  4XR6 A;  2H27 A;  3CMA I;  2EQR A;  2RKH A;  4BE1 A;  3CES A;  4O5V A;  4AIH A;  2CWE A;  3IKV A;  3KE2 A;  3KYD B;  3WTZ A;  2XUB A;  3BR1 A;  4L9T A;  4PSW A;  2J5O A;  3MQ0 A;  1E17 A;  3S93 A;  2P5K A;  3G2B A;  1G8X A;  3K7A J;  4LIU A;  4B4C A;  2BY0 A;  1OR7 C;  1REP C;  2GXG A;  1X3W B;  1TWF J;  4FTH A;  3B6C A;  1X3Z B;  2ZKZ A;  1J7K A;  3GF2 A;  1IAW A;  3KPH A;  1Z6R A;  2W85 A;  2CH0 A;  2KKO A;  4XOT A;  1I5Z A;  4K2E A;  1RR8 C;  4IXA A;  3H0D A;  2VAS A;  3A03 A;  2KDZ A;  2HWV A;  4Q4Z F;  2ZO4 A;  3BJO A;  3U21 A;  4PJM A;  1R1T A;  3P9C A;  4ZTF A;  5J40 A;  1BA5 A;  5FFZ A;  1BW5 A;  2A68 F;  3BP8 A;  3HOY J;  3IRQ A;  2LYC A;  2ZFW A;  1QGP A;  1JKQ C;  1ZG3 A;  3K2Z A;  4ESB A;  3QU6 A;  1YW9 A;  1WJD A;  3C1D A;  4B8X A;  2V26 A;  2EJR A;  3FM3 A;  3BTJ A;  2DFH A;  3DEE A;  4DYR A;  3CO7 C;  1EJ9 A;  3CC2 I;  2PI0 A;  3IL2 A;  5GPA A;  5IOZ A;  3AG1 H;  4D5F A;  2KL4 A;  2JSC A;  3F0C A;  1DPR A;  3T8T A;  2HVS A;  1Z3Y A;  4HEA 2;  4XLN F;  1IG7 A;  4BHC A;  1HKQ A;  1R71 A;  1FP2 A;  3D1N I;  1BL0 A;  1WSU A;  3RKW A;  2QQ8 A;  1HCR A;  2OQG A;  1VQ8 I;  3WHB A;  3K6G A;  3FXJ A;  4F91 B;  4O3M A;  3IV5 A;  1WFX A;  1JKO C;  1TQM A;  1GVD A;  3DLL F;  2EIN H;  2IAI A;  3CJT B;  2K9Q A;  2WWY A;  4EEF G;  1KQ8 A;  3PM1 A;  1JHF A;  2GXA A;  4Q47 A;  2KZG A;  4BQA A;  3TQN A;  2VQC A;  4A3L J;  3K4B A;  5IPA A;  1KON A;  1ZK8 A;  3CCU I;  1M1E B;  2E19 A;  4RDU A;  2VE9 A;  3J80 K;  1WGX A;  3S3N A;  2ELK A;  4BEH A;  4BXF A;  2P8T A;  5J4V A;  2CG4 A;  3JRC A;  2CV0 A;  3E6M A;  1A36 A;  3I4M J;  2XAG A;  1Q1V A;  3K4K A;  4YG2 F;  4PZJ A;  3L2C A;  3AL0 C;  2KIU A;  3NQO A;  5TGT A;  1J75 A;  5DD4 A;  1FOY A;  4DYQ A;  2DT5 A;  2BW3 A;  3Q5F A;  3QWL A;  3MAJ A;  3TED A;  3BZ6 A;  1VZ0 A;  2VPL A;  5K7Z A;  4WXC A;  1NG6 A;  2GM4 A;  4M3G A;  3IKT A;  3JSO A;  2O61 A;  2IP2 A;  1WJA A;  1DP3 A;  2VQG A;  3JRI A;  2ZME B;  5IT9 K;  1H0M A;  1Z91 A;  2L5Q A;  4XLH A;  3L00 A;  4GYI A;  5FKM A;  1FYK A;  3H5N A;  2GOX B;  4YFN F;  2QSH X;  2NVT J;  5E18 F;  1FTZ A;  3CUQ A;  1IRF A;  1Y8Q B;  1ZQ3 P;  1MMA A;  4BU2 A;  4HF0 A;  4GCV A;  3KP2 A;  2FU4 A;  4FHT A;  3ZQQ A;  4CCM A;  5KCM A;  4NC6 A;  4CCJ A;  1MBG A;  3ERE D;  3CZ6 A;  3CDI A;  4A3C J;  3GTM J;  1ZGW A;  3K70 C;  1YTY A;  4HW0 A;  6PAX A;  2DMU A;  1A31 A;  3CMM A;  2L54 A;  3J7A Y;  4WWC A;  2K3F A;  1MBF A;  1RR7 A;  3TO6 A;  4G9Y A;  1G6N A;  4XKB A;  5EEH A;  2Z9O A;  1T33 A;  2FBI A;  3P7N A;  2NYX A;  1E3O C;  4II2 A;  1EV7 A;  1S8N A;  1WCM J;  1ZRE A;  3OR1 C;  1J2X A;  3EUH A;  1SFE A;  2CQN A;  3Q9S A;  2XDV A;  3OYG A;  1B8I A;  2I10 A;  3ONQ A;  1IO2 A;  3RQ4 A;  3N97 A;  3JTH A;  1JUP A;  2JSP A;  4M3F A;  3FXU A;  2QGU A;  1MJA A;  3H5R A;  3KP6 A;  3FK6 A;  5ILV A;  4OIP F;  1Z67 A;  4YEL A;  2H8W A;  2LY2 A;  2XSJ C;  3LSP A;  3ML6 A;  3L09 A;  3KFW X;  5CQE A;  2EFP A;  1VQL I;  1OYI A;  1QQI A;  2FF4 A;  2VQL A;  3KIO A;  1YE9 A;  1WQ2 A;  3CC7 I;  2M7A A;  5IYC J;  4BQQ A;  2JN6 A;  3FBN B;  5D8K B;  5EG0 A;  2NNN A;  3HYI A;  5L3G A;  1LFP A;  3KEO A;  3RTR A;  4XM3 A;  4IX7 A;  3QQA A;  3W2V A;  1POG A;  2DT7 B;  3HSF A;  3BTL A;  1XMK A;  3TGN A;  2TDX A;  2FRH A;  3FMQ A;  1X58 A;  3GTP J;  2KJB A;  2M30 A;  4KIC A;  5F0H A;  2P81 A;  3DF8 A;  4R8H A;  4PK4 A;  3CCM I;  2XAS A;  3OIQ A;  1Z05 A;  2Y2Z A;  4M9X A;  3OYJ A;  3CCV I;  2RQP A;  3DQV C;  3J81 K;  4BBR J;  4M6Y A;  2GWR A;  2Q8K A;  3DBL B;  5IP9 J;  2EIL H;  1T98 A;  1W4M A;  3H9J A;  2KPM A;  2E7X A;  3LNQ A;  3JRD A;  1J5Y A;  4JOM A;  5FKL A;  3A0B C;  1XSX A;  1GXQ A;  3DKY A;  3GEZ A;  4MTE A;  2JPC A;  2F4M B;  2AS5 F;  4GYG A;  2DAO A;  1KU7 A;  4A3E J;  5FLV A;  2M7B A;  2ECB A;  3BTC A;  1HLV A;  1ZR2 A;  1B8I B;  2FNA A;  2QSF X;  3IHU A;  1KQ0 A;  1TWC J;  4AM3 A;  3W6V A;  1TNS A;  2PJR A;  2Y0S N;  3NWT A;  2DA6 A;  1OR7 A;  2W25 A;  1W36 C;  3IH2 A;  1EKE A;  1GUU A;  4PGG A;  4CCL A;  1LFU P;  2QBY B;  1V55 H;  3M07 A;  1TW2 A;  3K4M A;  5DV5 A;  1V5F A;  4LG3 A;  4ZYH A;  3BCB A;  3HOT A;  1TNT A;  3RPU A;  4HSR A;  5BOX A;  1AWC A;  4DOZ A;  2LK2 A;  1QZE A;  2ID3 A;  4XKC A;  3ZQH A;  4XMY A;  2FOK A;  3TO9 A;  4LK1 F;  2YX7 A;  3GVA A;  2IS4 A;  4RMN A;  3LAJ A;  1QHH D;  3M1E A;  4FET A;  2W4S A;  1K78 B;  3F8N A;  2FOW A;  5AIP A;  5LHI A;  3ZCO A;  1SMY F;  2DOF A;  4G7H F;  4B1R A;  5F0C A;  2DTR A;  2W24 A;  5F1J A;  3PSF A;  2TRT A;  4B48 A;  3VSK A;  2MBF A;  4JX6 A;  3HUG B;  2ZCW A;  4CHU A;  1Z7U A;  2HQA A;  4U88 A;  1LDJ A;  1H8A C;  3WTX C;  4E7K A;  3HGY A;  5LHH A;  3DTI A;  2COM A;  2E5N A;  2EIK H;  4HYE A;  4W97 A;  3HGG A;  3D5L A;  3BR0 A;  4A2U A;  3SFI A;  2ETH A;  1NTC A;  2AXL A;  4C3J J;  1K83 J;  4LLL A;  1IW7 F;  4XLP F;  5CLS A;  1UG0 A;  1XX5 A;  5HNF A;  4I76 A;  5GP9 A;  1YIJ I;  3DTK A;  4RGR A;  1Y0N A;  2BOL A;  2IGK A;  3GTO J;  3ISP A;  1A6I A;  3LSI A;  1NHA A;  2X6X A;  2L4M A;  4NBQ A;  2OU2 A;  1RNL A;  5IY5 H;  3K9T A;  1IGN A;  2M45 A;  3ZRG A;  4NQW A;  1DGW Y;  1O3T A;  4Y52 J;  2E1M B;  3BLY A;  3BG3 A;  3NEU A;  2M1B A;  4E4H A;  5HLG A;  3D5S C;  4RGX A;  4X6A J;  1WJF A;  2EFQ A;  4XIC A;  1MMG A;  3QRF F;  3KP3 A;  1VQO I;  3F8C A;  1R1U A;  5M3F J;  3OS0 A;  2ZJR F;  4M9Z A;  2DI3 A;  2XF5 A;  5FLM J;  4HG2 A;  2LF7 A;  3K1P A;  3AAF A;  1P4A A;  2F4I A;  4M3B A;  4EJV A;  3OYB A;  1R4M B;  1EF4 A;  3NRV A;  5BPI A;  3CP8 A;  5DCF A;  3QOE A;  1FOX A;  1X1D A;  4IRG A;  1CF7 A;  3R61 A;  2VKD A;  3HBL A;  1LFB A;  2PN6 A;  1D8K A;  3H9Q A;  3DPL C;  2COB A;  2FEZ A;  1QPI A;  2CQQ A;  1DU6 A;  1FX7 A;  2QKL B;  1SVL A;  2CU7 A;  4U0V A;  1IC8 A;  2R7R A;  1OFC X; 
#chains in the Genus database with same CATH homology
 1FNN A;  2XVC A;  2Z5U A;  4ZYE A;  1YQA A;  4HAM A;  2IA1 A;  4M72 A;  1XCB A;  1F9N A;  4HOB A;  2A6H F;  1G4D A;  2ZBK A;  2DK8 A;  2D45 A;  3W6K B;  2A69 F;  3HTS B;  1K79 A;  2XAQ A;  1OPC A;  3QP6 A;  1MJB A;  2VBY A;  1S7O A;  2RGV A;  1O3R A;  3SZT A;  2F5D A;  3I58 A;  2P7V B;  4KYW A;  3WU0 A;  1RZ4 A;  4A0Y A;  3JSP A;  2STT A;  1IXR C;  1WI9 A;  1R00 A;  3GFI A;  4QLC U;  3WTY C;  1FYM A;  2A6E F;  2E7W A;  1HST A;  4EJO A;  3ZMS A;  4YFX F;  3E3V A;  2HOE A;  3CO6 C;  1XGS A;  2MC3 A;  3ZMT A;  4LG0 B;  1STZ A;  3B73 A;  3GYH X;  2PJP A;  3E6B A;  4HBL A;  3E6C C;  4U7B A;  4HF1 A;  2NNY A;  3HTU A;  4I01 A;  4Y17 A;  2F5F A;  4PCQ A;  4L5I A;  5DCM A;  3BRO A;  1RI7 A;  3VOD A;  4KIF A;  4MEY F;  4LK0 F;  3F3X A;  4IVN A;  1DP7 P;  4LB6 B;  2VE8 A;  5LGT A;  4CDG A;  3GLX A;  4AIK A;  3M9A A;  3DP7 A;  3E5Q A;  1YIO A;  4A6D A;  4RAZ A;  4EJW A;  3SXY A;  3FM5 A;  1J59 A;  2STW A;  5H6Q A;  2EFN A;  4KN7 X;  2ELH A;  1UST A;  5DDG A;  3J7A O;  3DPT A;  1KA8 A;  5BQT A;  2BGC A;  4KIB A;  4Q48 A;  1IF1 A;  2L01 A;  3E5U A;  2V6C A;  2VC1 A;  3QU3 A;  3HHG A;  4L0Y B;  3RI4 A;  2V1X A;  1MZB A;  1QZY A;  4WF2 A;  5J6X A;  4KMF A;  2H09 A;  2FBK A;  1KYW A;  5D5W B;  2EV5 A;  2VXZ A;  5ILU A;  5E8G A;  3DXJ F;  2CO5 A;  3WTS C;  4EMS A;  2IRF G;  1QO0 D;  5CYV A;  4N9I A;  1IRG A;  2WTE A;  4ASN A;  4LJZ F;  1ZRD A;  5E1X A;  1MD0 A;  3LWF A;  2ZXJ A;  1PDN C;  5BS6 A;  4ENM A;  2VN2 A;  2FE3 A;  3KLN A;  4I09 A;  1J0R A;  4HLY A;  2HGC A;  3KLO A;  2XHK A;  3TOA A;  2VT3 A;  4O6J A;  1R22 A;  5DUI A;  4D0P A;  1FSE A;  2OD5 A;  3LAP A;  3ZN1 A;  5E17 F;  3KP5 A;  3REO A;  3F8B A;  1HBX G;  1OMI A;  2F5C A;  5CVI A;  4JQF A;  1OYW A;  5CVU A;  2J5P A;  1D8J A;  2GAU A;  3IC7 A;  4EGY A;  2O3F A;  1IN6 A;  5JR3 A;  1OYY A;  2DU9 A;  3MFK A;  1GHC A;  1ULY A;  2IVM A;  2A3S A;  3HRS A;  2C6Y A;  2EB7 A;  3WTU C;  2Y75 A;  2Y0M A;  1FPQ A;  2VC0 A;  3T1B A;  2M87 A;  3L9F A;  2L4A A;  5H6R A;  2W84 A;  3GX4 X;  2PQ8 A;  5LHG A;  5FLX Z;  2ZME A;  1XSV A;  5HDK A;  1SFU A;  2MLG A;  2GA1 A;  4M73 A;  4P9F A;  5FD5 A;  4EV0 A;  1XGN A;  1T2K A;  1F4K A;  1O7F A;  3DEU A;  1LEB A;  2IA2 A;  1SD6 A;  3ZQ7 A;  3TDU C;  4MGR A;  1LJ9 A;  1W7P D;  1YG2 A;  2P5V A;  3F22 A;  1BI1 A;  2YSR A;  4M71 A;  3EYY A;  4UVA A;  1SAX A;  5JI6 A;  5CVJ A;  4GXO A;  3L7W A;  2DW4 A;  3GFJ A;  2OZ6 A;  2LKP A;  1DPU A;  1R7J A;  3T8R A;  3IRR A;  5HVQ C;  4M74 A;  3COA C;  4PDK A;  4S05 A;  5HS9 A;  4GGG A;  3H3Z A;  1H9G A;  2MH9 A;  4LMY A;  2NRA C;  5H20 A;  2PMU A;  1I27 A;  2FNP A;  1P92 A;  1Q1H A;  1XSD A;  1F5T A;  2EV0 A;  2HR3 A;  2XAF A;  3HRM A;  4L18 B;  2HYG D;  4OIQ F;  2YX4 A;  2OQR A;  2DPD A;  5F6F A;  1BIB A;  2RV8 A;  2Z3Y A;  4R79 A;  4LGW A;  2VOO A;  1IUY A;  1BI2 A;  1IXS B;  2K7L A;  3IWF A;  3KEQ A;  4HX7 A;  5K5R A;  2YR2 A;  4ESJ A;  1R36 A;  3F21 A;  1ZYR F;  3O6B B;  2QBY A;  5LBQ A;  3K1N A;  3I59 A;  2GA2 A;  2QM3 A;  1QBJ A;  3P9I A;  2HQN A;  2CW0 F;  3CTA A;  1S7A A;  4YFK F;  1FZP B;  2UZK A;  1P2F A;  2E1C A;  1K78 A;  5BMZ A;  5KVR A;  1ZRF A;  2O6G E;  1P4X A;  4RB1 A;  5FFX A;  1GVJ A;  3HUG A;  4RB3 C;  4I02 A;  4UV9 A;  1FBS A;  3G3Z A;  3OV8 A;  2WV0 A;  1IN7 A;  5BPD A;  1FBQ A;  3M8F A;  5LRR A;  5IT3 A;  3RKX A;  3ECO A;  1ZAR A;  4FX4 A;  3I59 B;  1WRJ A;  1KYZ A;  1FY7 A;  3GXO A;  1JXS A;  4RB0 A;  4OIN F;  3WTV C;  4XSX F;  1XN7 A;  4AWX B;  1R1V A;  1A04 A;  1MKM A;  3E5X A;  2K02 A;  4UXN A;  2HDC A;  3GZ5 A;  1XD7 A;  2G9W A;  4LLG F;  4A0Z A;  2BBY A;  4ZZL A;  3QOP A;  1IXC A;  2HZT A;  1U5T C;  1B6A A;  3GWZ A;  3ABU A;  1XDS A;  2XIG A;  1BC8 C;  3GUD A;  3DFG A;  3LA7 A;  3RIR A;  1HKT A;  1R58 A;  4MEX F;  3QPH A;  3ULQ B;  1T38 A;  2QEN A;  4DNC A;  3JAM K;  1IZ1 A;  2H6C A;  4EJT A;  3KCC A;  1B1B A;  3TDZ C;  3G73 A;  1FT9 A;  2HFH A;  1Z9C A;  1PP7 U;  2GIV A;  4MNU A;  1BM9 A;  4ON0 A;  3V7C A;  4HX8 A;  5LLQ A;  3FF5 A;  3O2P E;  2CSO A;  2NAZ A;  5LEK A;  1UFM A;  3GW2 A;  1YW8 A;  2F2E A;  4G6D A;  4M9S A;  2DK5 A;  1HSJ A;  1SD5 A;  1U78 A;  1LNW A;  2MH2 A;  2O0Y A;  3R0J A;  4MTD A;  2RN7 A;  2XV4 S;  1ZRC A;  3U2R A;  3Q9V A;  1SD4 A;  1ZGJ A;  4G94 A;  2DLL A;  1R5G A;  1JHH A;  5D6E A;  3IWZ A;  4ENK A;  3KET A;  1I1S A;  1SD7 A;  4HQE A;  3HIF A;  1DDN A;  1YO5 C;  2FQ3 A;  1O57 A;  4IF4 A;  1ZN2 A;  3F6O A;  1B9M A;  1U3E M;  2VBX A;  2KIM A;  1S29 A;  3RPQ A;  1MJ9 A;  5ILS A;  4LG0 A;  4TV7 A;  1G3Y A;  3HOS A;  3ZMU A;  2UWM A;  4YII A;  3FMR A;  1U8R A;  2P5L C;  4P55 A;  1B9N A;  3CJN A;  5CVV A;  2QLZ A;  2CFX A;  4UV8 A;  4OIO F;  5E1W A;  4M6X A;  1HW2 A;  3I0T A;  4GO1 A;  2ESH A;  3ECH A;  1TQP A;  4FT8 A;  2JTV A;  2HEO A;  1IN5 A;  3M7G A;  2EA2 A;  5EEG A;  3VEP A;  1QZZ A;  5ICE A;  2QWW A;  1XGO A;  4Z2Y A;  3WGH A;  5ICF A;  1LB2 A;  4IJA A;  3H3U A;  2O8X A;  2QZ8 A;  2DBB A;  2XKO A;  2CQK A;  3V8L A;  4HV6 A;  1FSH A;  2Y48 A;  1H9T A;  2KRF A;  3HHH A;  2IW5 A;  2R7D A;  4CYD A;  3EQL F;  4HX4 A;  2MLK A;  3JAM Z;  2GZW A;  3C18 A;  2BEO A;  5F64 A;  4UUV A;  3K69 A;  1BJA A;  1W7P B;  5D4S A;  3CUO A;  4CIC A;  4RGS A;  4R1H A;  4L9J A;  4HF2 A;  2XAH A;  3KZZ A;  1USS A;  2ESN A;  1I1G A;  4G6Q A;  3V8K A;  2RDP A;  5HS8 A;  2EK5 A;  5CVR A;  1LDD A;  1T39 A;  3ABT A;  2GXB A;  3BDD A;  3R6S A;  3QPT A;  5A2Q Z;  2ADU A;  1XB4 A;  2V1U A;  1MDM B;  4XBF A;  3JTG A;  4S04 A;  2CGP A;  4BHP A;  1P6R A;  4IPA A;  3E97 A;  3U1D A;  4AVP A;  2LDU A;  1ZH5 A;  5HLI A;  2MA3 A;  4EQQ A;  4EM1 A;  3RYP A;  2PBI A;  3PQK A;  4N9H A;  1ON1 A;  2FXA A;  5FLX K;  2RNJ A;  1EH6 A;  4MQV A;  3SHF A;  3CDH A;  4BNC A;  1FOK A;  3OOP A;  3WE3 A;  3WGG A;  2FBH A;  1F1Z A;  4EJU A;  2L3D A;  1FC3 A;  4KT5 C;  1XMA A;  5FD6 A;  1BOA A;  3BOQ A;  1KGS A;  5HLH A;  4UVC A;  2F5E A;  3I4P A;  4U7D A;  2HTJ A;  1UHW A;  1TTY A;  5J8F A;  1ONV A;  2K4B A;  5L3C A;  5LEJ A;  4NHJ A;  1R5H A;  4I7H A;  4Y15 A;  5FO5 A;  2XAJ A;  3I53 A;  4HDV A;  1IN4 A;  2FML A;  2IT0 A;  3HSR A;  3FXQ A;  3WG9 A;  2PG4 A;  4U0W A;  2Q0O A;  3W6J B;  2KJC A;  1U5T B;  4E70 A;  2VT2 A;  4I98 B;  1VTN C;  4Y13 A;  4CXF A;  4WK8 F;  1J9I A;  2R7F A;  4BXU A;  4HA8 A;  2K86 A;  1ZHF A;  5KK1 A;  2DQR A;  3F72 A;  1EH7 A;  4G8X A;  3EYI A;  3WGI A;  2QYO A;  1FWZ A;  5DUK A;  4N0B A;  1JGS A;  1JE8 A;  2O03 A;  1MGT A;  2D1V A;  4XRF A;  4ZH4 F;  3LA3 A;  5L3D A;  1HW5 A;  2QQA A;  1TBX A;  2XKP A;  4IRH A;  3R0A A;  4A0X A;  4JBA A;  4KFC A;  4WXH A;  3C7J A;  2L02 A;  3SQN A;  5L3E A;  4ZYG A;  1I6X A;  1UHM A;  1O3Q A;  3V4G A;  3F8M A;  5ED4 A;  1V4R A;  2CYY A;  3QAH A;  3KZY A;  4EM0 B;  1ZLJ A;  4G7O F;  2D1H A;  5D5X B;  1FP1 D;  1TQI A;  4RS8 A;  1SFX A;  5FB2 A;  2XGX A;  1DUX C;  4IHT A;  1K7A A;  1GXP A;  5K5O A;  5HDG A;  3V8J A;  5LRS A;  3SFZ A;  4B09 A;  4L9N A;  2HS5 A;  2DQL A;  5L3F A;  4ETS A;  2QVO A;  1QNT A;  4BH9 A;  4JK1 X;  4IRI A;  4IHS A;  4RGU A;  4LLN A;  4H0E A;  2ZJ2 A;  1W5S A;  5TRD A;  3VFZ A;  4HZF A;  1BC7 C;  3MEX A;  4EM2 A;  4EVI A;  3HSE A;  2Z99 A;  2ZNZ A;  2MD5 A;  1PP8 F;  3GFL A;  2DPU A;  3VB2 A;  1LDK B;  1KQ9 A;  5D5V B;  2OAZ A;  4KMU X;  1PUE E;  3RJP A;  1U6G A;  5AON A;  2OBP A;  4CZZ A;  1B4A A;  3RYR A;  1KU3 A;  4DQ2 A;  1BI3 A;  3DKW A;  3FX3 A;  3TO7 A;  3GZ6 A;  4ZYD A;  1YS7 A;  3FXR A;  3F23 A;  2BE5 F;  3O3K A;  2A61 A;  4ESF A;  3ZMZ A;  1KU2 A;  5DYM A;  5DD8 A;  2JZY A;  3FWE A;  2OZU A;  2EWN A;  3I5U A;  1LVA A;  4KDP A;  3TOB A;  5TJJ A;  4AIJ A;  1E2X A;  1G3S A;  1ZAO A;  1Z6T A;  2W57 A;  2ISY A;  3BWG A;  1XGM A;  5LGN A;  3R60 A;  1X3U A;  4OIR F;  4A12 A;  4OMZ A;  2VBZ A;  3WTW C;  4QWQ A;  5ERI A;  2UXN A;  2HYF A;  4BYY A;  2WC2 A;  1O3S A;  2PMH A;  3ZMV A;  3MCZ A;  1BBY A;  4P5O A;  3CUQ B;  1HQC A;  4P96 A;  4NB5 A;  5JHU A;  1R23 A;  4A5M A;  1QPM A;  2G7H A;  3FHZ A;  4L0Z B;  2V79 A;  3E6D A;  2VBW A;  1D3Y A;  2Z33 A;  4HLX A;  3WE2 A;  3BJ6 A;  1BIA A;  3J80 Z;  2ISZ A;  4LB5 A;  1ZG1 A;  4KUM A;  1XDU A;  4MHG A;  4OMY A;  2PLY A;  4UHT A;  3H92 A;  2FA5 A;  3LQQ A;  1L3L A;  4UVB A;  1WKM A;  3LFK A;  3DV8 A;  1G3T A;  1FYL A;  2EV6 A;  3MWM A;  2ZNY A;  2QUF A;  3ZMD A;  4HDU A;  5D6F A;  3LST A;  2JRT A;  4EGZ A;  5IT9 Z;  3V7S A;  4G7Z F;  1ON2 A;  2VOP A;  4WX9 A;  3BY6 A;  4PGH A;  2M5W A;  2EA4 A;  4BHB A;  4ENN A;  3WTT C;  2FMY A;  2D2W A;  3F6V A;  5J8C A;  1YW7 A;  5HDN A;  1LQ1 A;  1D5V A;  2A5Y B;  2HQR A;  1CGP A;  4XSZ F;  3N4M A;  5D4R A;  4HQM A;  1HW1 A;  4A6E A;  4I0B A;  5A2Q K;  1ZG5 A;  2BV6 A;  3GFM A;  1FLI A;  2V9V A;  2K4J A;  3V7R A;  1B59 A;  2KIF A;  5JVT A;  2VOD A;  2IPQ X;  4Q5S F;  3M8E A;  1ZGA A;  1G3W A;  3P9K A;  4I2O A;  1YLF A;  3ROU A;  2P7C B;  1AOY A;  2FSW A;  1FBU A;  3BPV A;  3J81 Z;  3MZY A;  5FGM A;  1T6S A;  1S6L A;  2GQQ A;  2LSO A;  1Z1D A;  2P4W A;  2X0L A;  3HRT A;  3PFI A;  1W7P A;  1P4W A;  3HRU A;  1SMT A;  3TKY A;  4MQ9 F;  5F1R A;  2JT1 A;  1S3J A;  1BI0 A;  2P6S A;  3T0Y A;  4AD9 A;  1UCR A;  2OA4 A;  3D0S A;  4L5J A;  2XRN A;  4CGZ A;  2UXX A;  3BJA A;  1ZLK A;  4U0Y A;  1TLH B;  4L9V A;  4WCG A;  1MDM A;  2Q2E A;  3JW4 A;  3I54 A;  1ODD A;  4WXD A;  1RIO H;  1RUO A;  2HTS A;  5L3B A;  4KIG A;  3ZN0 A;  1RUN A;  3K1M A;  2LF8 A;  1YFH A;  4KNY A;  1L0O C;  2QQ9 A;  5DEQ A;  2EFO A;  3QP5 A;  4BAY A;  3BPX A;  2BYV E;  5AIQ A;  1V3F A;  1WWX A;  1IN8 A;  1CF7 B;  1OKR A;  4OOI A;  2HKX A;  3C3W A;  5HOO A;  2YPR A;  1HXD A;  2V1D A;  2PFB A;  5K1Y A;  3GO5 A;  2XRO A;  2B0L A;  2ACJ A;  4LD5 A;  1YS6 A;  4CO8 A;  2H94 A;  3FZV A;  2M8E A;  3B02 A;  1YYV A;  2X4H A;  2YU3 A;  5JFR A;  4I0A A;  2EFW A;  3WOD F;  3K0L A;  1U2W A;  4A5N A;  4ENJ A;  3RDI A;  2IJL A;  3I64 A;  1T0F A;  5D5U B;  5LGU A;  4KN4 X;  1Y0U A;  2G7U A;  1TW3 A;  3WU1 B;  2QQB A;  4RB2 C;  3CUQ C;  4FX0 A;  3ZP5 A;  5K5Q A;  3CLO A;  1U5T A;  2DO7 A;  3T5X A;  5HS7 A;  3F8F A;  5E20 A;  3EDP A;  1W5T A;  4YIF A;  3EET A;  3ZPL A;  2LNB A;  3FMS A;  2NS0 A;  3I71 A;  1O7L A;  2DFI A;  3MZH A;  5D8L B;  1C0W A;  5CJ9 A;  4OU0 A;  2IA0 A;  1K6O A;  2P6T A;  3PQJ A;  3VOE A;  1BN5 A;  3KP4 A;  2E1N A;  5DCM B;  3ELK A;  3R4K A;  5ICG A;  2RVC A;  2VON A;  3LA2 A;  4HV5 A;  2R3S A;  2JPB A;  4P9U A;  4UNO A;  3KP7 A;  2A07 F;  3RKY A;  1LEA A;  1HKS A;  5E1Z B;  4LFU A;  2HKO A;  4F7Z A;  4RAY A;  2PEX A;  2RC4 A;  1XCV A;  1EH8 A;  5ICC A;  4KA4 A;  2K27 A;  5E8I A;  2H6B A;  1KU9 A;  4ZZD A;  1UB9 A;  3S2W A;  3SZP A;  3LQR A;  3U9G A;  2H27 A;  2RKH A;  4O5V A;  4AIH A;  2CWE A;  3IKV A;  3KE2 A;  3WTZ A;  2XUB A;  4L9T A;  2J5O A;  3MQ0 A;  1E17 A;  2P5K A;  1REP C;  2GXG A;  2ZKZ A;  1J7K A;  3GF2 A;  1IAW A;  1Z6R A;  2W85 A;  2KKO A;  1I5Z A;  4K2E A;  4IXA A;  2HWV A;  4Q4Z F;  2ZO4 A;  3BJO A;  1R1T A;  3P9C A;  5FFZ A;  2A68 F;  3BP8 A;  3IRQ A;  2ZFW A;  1QGP A;  1ZG3 A;  3K2Z A;  4ESB A;  3QU6 A;  1YW9 A;  3C1D A;  4B8X A;  2EJR A;  3FM3 A;  3CO7 C;  2PI0 A;  3IL2 A;  2JSC A;  3T8T A;  1DPR A;  4XLN F;  4BHC A;  1HKQ A;  1FP2 A;  1WSU A;  3RKW A;  2OQG A;  4O3M A;  1TQM A;  2WWY A;  1KQ8 A;  1JHF A;  4Q47 A;  4BQA A;  3TQN A;  2VE9 A;  3J80 K;  2P8T A;  2CG4 A;  3E6M A;  2XAG A;  4YG2 F;  4PZJ A;  3L2C A;  2KIU A;  3NQO A;  1J75 A;  5DD4 A;  2DT5 A;  3Q5F A;  3MAJ A;  3BZ6 A;  4WXC A;  3IKT A;  3JSO A;  2O61 A;  2IP2 A;  5IT9 K;  2ZME B;  1H0M A;  1Z91 A;  3L00 A;  4GYI A;  1FYK A;  4YFN F;  5E18 F;  3CUQ A;  1IRF A;  4HF0 A;  4GCV A;  3KP2 A;  2FU4 A;  4FHT A;  3ERE D;  1YTY A;  4HW0 A;  6PAX A;  2L54 A;  4WWC A;  3TO6 A;  4G9Y A;  1G6N A;  5EEH A;  2Z9O A;  2FBI A;  3P7N A;  2NYX A;  1EV7 A;  1S8N A;  1ZRE A;  1J2X A;  3EUH A;  1SFE A;  3Q9S A;  3N97 A;  3JTH A;  3FXU A;  1MJA A;  3KP6 A;  5ILV A;  4OIP F;  3ML6 A;  3L09 A;  3KFW X;  2EFP A;  1OYI A;  1QQI A;  2FF4 A;  1WQ2 A;  5D8K B;  2NNN A;  3HYI A;  5L3G A;  3RTR A;  3KEO A;  3HSF A;  1XMK A;  3TGN A;  2TDX A;  2FRH A;  3FMQ A;  2KJB A;  2M30 A;  4KIC A;  3DF8 A;  4R8H A;  2XAS A;  1Z05 A;  4M9X A;  2RQP A;  3DQV C;  3J81 K;  4M6Y A;  2GWR A;  2Q8K A;  1T98 A;  1W4M A;  2E7X A;  1J5Y A;  1XSX A;  1GXQ A;  3GEZ A;  4MTE A;  2JPC A;  2AS5 F;  4GYG A;  2DAO A;  1KU7 A;  2FNA A;  3IHU A;  1KQ0 A;  1TNS A;  1OR7 A;  2W25 A;  4PGG A;  2QBY B;  1TW2 A;  5DV5 A;  3HOT A;  4ZYH A;  1TNT A;  3RPU A;  5BOX A;  1AWC A;  2FOK A;  3TO9 A;  4LK1 F;  2YX7 A;  3GVA A;  3LAJ A;  3M1E A;  1K78 B;  3F8N A;  5AIP A;  5LHI A;  1SMY F;  4G7H F;  2DTR A;  2W24 A;  2MBF A;  2ZCW A;  4CHU A;  1Z7U A;  4U88 A;  1LDJ A;  3WTX C;  5LHH A;  2COM A;  4HYE A;  3D5L A;  4A2U A;  2ETH A;  2AXL A;  4XLP F;  4LLL A;  1IW7 F;  5CLS A;  4RGR A;  3ISP A;  1NHA A;  2L4M A;  2OU2 A;  1RNL A;  3K9T A;  2M45 A;  4NQW A;  1O3T A;  3NEU A;  2M1B A;  5HLG A;  4RGX A;  2EFQ A;  3QRF F;  3KP3 A;  3F8C A;  1R1U A;  4M9Z A;  2DI3 A;  2LF7 A;  3K1P A;  3AAF A;  1P4A A;  4EJV A;  3NRV A;  5BPI A;  5DCF A;  4IRG A;  1CF7 A;  3R61 A;  2PN6 A;  1D8K A;  3DPL C;  2FEZ A;  1FX7 A;  4U0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...