4LLNA

Crystal structure of s. aureus mepr-dna complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
137
structure length
137
Chain Sequence
FTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
molecule keywords MepR
total genus 50
structure length 137
sequence length 137
chains with identical sequence B, C, D, I, J
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4llnA00
1FT9A 2J5PA 5F64A 2GA1A 5FB2A 2XROA 4XLPF 3GYHX 2EFQA 1DDNA 5D6FA 2TDXA 2R7DA 1ZYRF 1XGSA 4ZH4F 1UCRA 2LF7A 1MJAA 2KJBA 4G9YA 2CW0F 2XAGA 1JHFA 3R61A 4RB2C 4WXDA 3I64A 1HXDA 4I7HA 1XSVA 2ZFWA 1MZBA 3AAFA 3IWZA 3V8LA 3OV8A 2RQPA 2P5VA 2GIVA 1SD7A 4JK1X 2K4BA 3KE2A 2FXAA 2L01A 2YX4A 3L09A 2VODA 3T0YA 3E5XA 2RV8A 1BIBA 2M45A 4AD9A 5F1RA 1D5VA 1JGSA 1QGPA 1LQ1A 2RNJA 2IA2A 2PMHA 2F5DA 1TQIA 2Y0MA 1B1BA 2DPUA 3KFWX 3JAMK 2DLLA 3HRSA 1XMKA 1GVJA 2E1NA 3I58A 2W24A 4EMSA 1RZ4A 2QZ8A 3Q5FA 4I0AA 1YG2A 2BE5F 1ZRDA 5L3EA 3K1PA 3ZMVA 4K2EA 2AXLA 1SD6A 2UZKA 2VT3A 2XKPA 1YO5C 3W6KB 1FC3A 3DXJF 2A68F 4FT8A 1AOYA 4HYEA 2RN7A 4LLGF 3MQ0A 2A5YB 1ZLKA 1QNTA 1T2KA 3B02A 1MDMA 3DF8A 2NYXA 2W57A 3I54A 4IXAA 1IRFA 1RI7A 4WXHA 4HX8A 2GA2A 4HF1A 1SMYF 2FRHA 3K1MA 1QBJA 3ELKA 1Z1DA 1GXPA 3HSFA 4G7HF 4OOIA 1Y0UA 3BZ6A 1T39A 2EA2A 4ENKA 1P6RA 3NEUA 4HLYA 2NAZA 1OYIA 3GW2A 1R36A 4LGWA 3RKYA 3FZVA 5HLIA 3OOPA 4M74A 1IXRC 4AIKA 1GHCA 3JSPA 1MKMA 2O3FA 2F5EA 2V1XA 3DP7A 3FWEA 2XHKA 3BJAA 3LQRA 3F8BA 5LHGA 2XIGA 4S05A 3MEXA 1R5HA 2XGXA 2A69F 4XRFA 4AIJA 1DPRA 1U5TB 3BROA 4BH9A 4IHTA 5FFZA 2Z99A 4R1HA 2OU2A 4HX7A 2ESNA 2Z33A 3FMQA 2FNPA 2DQRA 5BOXA 3F8MA 2VN2A 2VBXA 1P4AA 2IRFG 2ADUA 5J8FA 3J80Z 1YW8A 2P6SA 4EJOA 3F23A 2ISZA 4HBLA 3CO7C 4IJAA 4P55A 2LDUA 2GXGA 5DCMB 1XDSA 5ICCA 4KICA 3SFZA 2O0YA 4EGYA 2VOOA 1G3SA 2XUBA 3E6BA 3GXOA 2O8XA 4KIFA 2JRTA 5D6EA 4P9FA 4EJUA 2B0LA 2W85A 3F3XA 1HW5A 1IUYA 2IVMA 2VXZA 4XBFA 3WU1B 4HX4A 4I2OA 2H6CA 3L00A 5EEHA 3VOEA 4FX0A 5H6QA 3IRRA 4UV9A 3ZMDA 3GO5A 1YTYA 4RAZA 3DFGA 4M71A 3ECHA 1FBUA 3RYRA 2QBYA 4MQVA 2RDPA 4CHUA 4OMZA 3J81K 1BM9A 3P7NA 1OMIA 3K0LA 1KU2A 2UXNA 2IA0A 4ASNA 4G94A 5K1YA 3F72A 3GX4X 4PCQA 1SD5A 2WTEA 2LF8A 4LLLA 1U8RA 5J6XA 2EFNA 2KIUA 2DTRA 1G3YA 3DKWA 2STWA 1KU9A 4M9ZA 4F7ZA 3Q9SA 3BPVA 1J75A 3F8NA 1YQAA 3L9FA 3G3ZA 5LHIA 5FLXK 1R1UA 2J5OA 2PFBA 2FBKA 1IN7A 1O3SA 3HRTA 3F21A 4U88A 2CGPA 1S8NA 1O3TA 1DPUA 1IF1A 1QZYA 3E5UA 4WWCA 4MNUA 3SQNA 2Q8KA 4ENMA 5LEJA 4CGZA 3I5UA 3KP7A 3L2CA 2HQNA 2A07F 5ILVA 2ZXJA 1WQ2A 3ZPLA 2CO5A 5K5OA 1ZGAA 3D0SA 1W5SA 5HDGA 2WC2A 4ZZDA 1FP2A 2CWEA 2QM3A 4LG0A 3DQVC 3C7JA 2RGVA 2JTVA 1FNNA 1J2XA 2GWRA 3DPLC 5ICGA 3D5LA 1H0MA 3R0JA 2EJRA 3K69A 2HYGD 4L5JA 1U3EM 3K1NA 1PDNC 2RKHA 1J59A 2K02A 4ZYHA 2K27A 1G3WA 1I1SA 2BGCA 1KGSA 3TQNA 4P9UA 3WU0A 1IRGA 2DPDA 3NRVA 2DW4A 5DUIA 1SFUA 1J9IA 1H9TA 1SFXA 3CTAA 4RB1A 4HW0A 4BQAA 1FBSA 2FNAA 1WKMA 2YU3A 4OMYA 3ABTA 1P2FA 3P9IA 1B4AA 3O2PE 4EM2A 5LHHA 3H3UA 3RTRA 3KETA 2A3SA 2QUFA 4DNCA 3TO6A 3ML6A 1SD4A 3TOBA 1MD0A 3N97A 2IA1A 3KLOA 3WTZA 2QVOA 3TO7A 4U0YA 3REOA 1H9GA 1LNWA 3DEUA 5JVTA 1FSEA 4IRIA 4MGRA 5D5UB 1MDMB 4HLXA 3RKXA 2ETHA 2PLYA 3SHFA 3TDZC 3IKVA 3KP3A 2KIMA 2HZTA 3MAJA 1LJ9A 4LLNA 3PQKA 1HW2A 5FFXA 4QLCU 2ZNYA 3BY6A 3E5QA 1Z6RA 3HTUA 2EV0A 5E18F 4I0BA 1EH7A 3CUOA 1F5TA 1RIOH 1XGOA 1TQMA 1UB9A 2YSRA 1PP7U 1T6SA 2EFOA 1SAXA 3TOAA 3U9GA 3VB2A 4LFUA 5D8LB 5ERIA 4LK1F 1WWXA 3LWFA 3C1DA 2FMYA 4RGRA 3J7AO 3WTUC 3V7RA 3QP5A 5CVVA 2VC0A 5HLHA 4ZYEA 4A6EA 5JI6A 1QQIA 1FOKA 3T5XA 3I53A 1B59A 4M9XA 3GWZA 4O5VA 1KYWA 1LDDA 2XAFA 1K78B 2ZMEB 5AIQA 4EM1A 4G6QA 1BI3A 4E70A 4S04A 3FXRA 2FBHA 2QBYB 3FMSA 3J81Z 3BDDA 3FM5A 3IC7A 5LEKA 4KA4A 2JZYA 3EETA 3Q9VA 1FYKA 3IRQA 4RB0A 4GXOA 1R58A 2HGCA 2W25A 3CJNA 4BAYA 2KJCA 3HRMA 4AIHA 3E97A 4YFNF 4PGGA 3ZP5A 3WGHA 5LBQA 1FX7A 1R23A 1XGMA 1T38A 2H6BA 4NQWA 3HOSA 5E20A 4HDVA 1C0WA 3E6DA 3NQOA 3M9AA 2HDCA 4BYYA 2K86A 1EH8A 2IPQX 4Q47A 4TV7A 1LEBA 2EFWA 5ICEA 2X4HA 2HKXA 1TW2A 4KMUX 5KK1A 2M87A 3R60A 2RVCA 3B73A 4WXCA 3ZMSA 3QOPA 4G7OF 4G7ZF 2OQRA 1BOAA 2ELHA 3E3VA 1ZREA 2DT5A 4I98B 1XB4A 4A5MA 3HHHA 3CUQB 2FQ3A 3QU6A 2HEOA 2O03A 2P5LC 1IN4A 1R1TA 1ZARA 4WK8F 3V7SA 3WTWC 3IHUA 2GXBA 4R79A 2HYFA 3FF5A 1XSXA 2VC1A 2VE9A 5CVRA 5LGTA 3WTXC 1JHHA 5H6RA 2V6CA 1RUOA 2VE8A 4PDKA 3ZN1A 2Z9OA 2BBYA 3V4GA 4NB5A 4H0EA 3GUDA 3EYYA 2MLKA 3KLNA 1L0OC 3I71A 1S6LA 3LA3A 2VOPA 2FU4A 4L0ZB 5BPDA 4GYIA 4Q4ZF 4A5NA 1BJAA 2R7FA 3V8KA 2GQQA 2D1HA 2FEZA 4UVCA 1P92A 4MEXF 3O3KA 2PN6A 1CF7A 4KMFA 3HSEA 4IPAA 4CO8A 1PP8F 2A6EF 5L3FA 2H94A 4A0YA 2HFHA 5E1WA 1YLFA 4L9TA 1RNLA 2G7UA 1ZG3A 2P8TA 2OZUA 3GVAA 2JT1A 5TRDA 1OYWA 2UWMA 3LA2A 1G3TA 3KEOA 3JSOA 2EV5A 5DCMA 1QZZA 1KQ9A 4BXUA 2MH2A 5LRRA 4RAYA 3JW4A 2CFXA 2ACJA 2F5FA 3LSTA 1RUNA 4UHTA 1W4MA 1X3UA 4KT5C 4M72A 3RDIA 2P6TA 4A6DA 5IT3A 4WF2A 2BEOA 5D4RA 3S2WA 3MZHA 4CICA 2YPRA 1FY7A 3M1EA 4BHCA 3FM3A 3I59A 5HOOA 2MC3A 3ZQ7A 4FHTA 3SXYA 3E6CC 1GXQA 3PQJA 1S7OA 1OYYA 4KUMA 4RGXA 1YIOA 4L5IA 1FYLA 2QLZA 2WWYA 5BS6A 3K9TA 1OKRA 2O61A 4CXFA 4LMYA 1EV7A 5A2QK 3ULQB 4Q48A 1ZN2A 1FYMA 4CYDA 3BOQA 1T0FA 5JFRA 4Z2YA 4XSXF 1LB2A 1R1VA 2VBWA 1O57A 4EJTA 1U5TC 5F6FA 1TNTA 1J5YA 2QYOA 1G4DA 4UV8A 3HYIA 3GFMA 1B9MA 2AS5F 1W5TA 2XV4S 3P9CA 3IWFA 5LGUA 1STZA 2DFIA 4OIQF 4Y13A 1WI9A 2QQ9A 4YFXF 2LKPA 1SMTA 2PG4A 4KIBA 2XAHA 4YIFA 3LFKA 4U0WA 3RI4A 3T8RA 3KZZA 2L4MA 3WTYC 3CUQA 1I1GA 1XMAA 2FF4A 1IAWA 5H20A 3L7WA 6PAXA 3JTHA 4WCGA 2LSOA 4I09A 1BI1A 3FHZA 2E1CA 3R6SA 5HS8A 3I4PA 1W7PA 3GLXA 2ISYA 3WE3A 2UXXA 4KN4X 3VODA 1T98A 1CGPA 2V1DA 4GO1A 3FX3A 2ZO4A 5JR3A 5DEQA 4EQQA 3DPTA 3QPTA 5KVRA 1ZRFA 4UVAA 4FX4A 3RPQA 3ZMZA 4M6XA 4OIRF 1FP1D 1XDUA 3GFLA 4EVIA 3LA7A 4LG0B 4MTEA 2E7XA 5J8CA 3WGIA 3COAC 3LAJA 1P4WA 2L02A 1FLIA 1HSTA 5JHUA 3DV8A 3QRFF 4ETSA 4L18B 4U0VA 5IT9K 2FOKA 1BI2A 1I6XA 1JXSA 1YYVA 5FD5A 2HKOA 4RS8A 3I0TA 5D8KB 5D5VB 1WSUA 2KKOA 2XASA 2OBPA 4ESJA 3KP5A 2CSOA 4U7BA 3M7GA 4A2UA 1I5ZA 3FMRA 1XGNA 2MLGA 1HKTA 4HAMA 3BWGA 4PZJA 4ZZLA 1O3RA 5E1ZB 1W7PD 4JBAA 1MJBA 3KP4A 1IXSB 4M73A 3F8FA 5LGNA 3H3ZA 2C6YA 2K7LA 1XCVA 4OIPF 5CVIA 1O7FA 3TDUC 4EV0A 4KFCA 3KP2A 4MHGA 3GZ5A 2MH9A 1TQPA 2FSWA 2EWNA 4R8HA 2RC4A 2DK8A 1BC8C 1TNSA 5D5XB 4QWQA 3MCZA 3ZMUA 3LAPA 2Z3YA 1XN7A 2STTA 2ZBKA 4ESFA 2ESHA 1ZAOA 1V3FA 2EK5A 4YG2F 2XKOA 5FO5A 2MA3A 4Q5SF 1KA8A 2HR3A 5D5WB 2L54A 3EUHA 3H92A 4LJZF 2YX7A 1FSHA 4LD5A 2G7HA 3G73A 5E8GA 1HKSA 4WX9A 5HDNA 2COMA 4P96A 4NHJA 3F6VA 4HDUA 4L9VA 3T8TA 4O6JA 5FD6A 3GFIA 2HOEA 1A04A 2PBIA 4HF2A 1S29A 1L3LA 1QPMA 3V7CA 3C3WA 4L9JA 4BHPA 3I59B 4EJWA 3MFKA 1YW9A 2LNBA 1ON1A 1V4RA 2QQBA 1B6AA 1O7LA 4KN7X 2GAUA 2F5CA 3KEQA 1HQCA 2IJLA 3BPXA 3MZYA 5ICFA 4GYGA 4KNYA 4ON0A 4CDGA 4EM0B 4EGZA 3GZ6A 5CVJA 3SZPA 1K78A 2Y48A 3HIFA 4KDPA 3E6MA 2IW5A 3SZTA 4UNOA 4B09A 5L3GA 5DUKA 5DCFA 5AIPA 2QQAA 2L4AA 2Y75A 1USTA 3U1DA 2YR2A 3TKYA 4UUVA 2XAJA 4RGUA 5EEGA 3ZMTA 1YS6A 2VONA 4MTDA 4HQMA 2HTSA 5HS7A 4U7DA 3RJPA 4IVNA 5LLQA 3GF2A 2XRNA 1TTYA 2XVCA 2D45A 1KYZA 5A2QZ 4N0BA 2FE3A 2O6GE 1XD7A 2ZNZA 4IF4A 2PEXA 3BJ6A 2DO7A 2BYVE 5K5QA 2Z5UA 3EYIA 1KQ0A 1J0RA 5K5RA 4HF0A 1HSJA 4AWXB 2X0LA 3VFZA 3HTSB 1CF7B 4MEYF 4I01A 2PJPA 1R22A 1DP7P 2CYYA 1OPCA 2KRFA 5AONA 4ZYDA 5L3DA 1D3YA 1P4XA 1LEAA 1S7AA 2P7CB 1HW1A 3F22A 4A12A 3U2RA 5BPIA 4OU0A 1Z9CA 1D8JA 4DQ2A 1BN5A 1OR7A 3HUGA 1J7KA 1TW3A 3M8FA 1ON2A 5DD8A 2XAQA 2MBFA 4P5OA 3PFIA 3HHGA 2HS5A 2M5WA 1ZH5A 1AWCA 2HQRA 5IT9Z 1UHMA 1LDJA 5ILUA 2JPBA 3EDPA 3ABUA 2KIFA 1YS7A 4O3MA 1BI0A 3TO9A 4YFKF 2NRAC 1XSDA 2NS0A 3RYPA 2P4WA 1IN5A 1BIAA 2GZWA 2PMUA 1LDKB 1BBYA 5BMZA 3ISPA 4HOBA 2ZJ2A 4YIIA 1FPQA 3WTTC 5D4SA 4Y17A 1R5GA 2D2WA 2OA4A 3T1BA 3GFJA 2F2EA 4HQEA 2M30A 2JSCA 1ZGJA 1G6NA 3ECOA 3R0AA 3FXQA 2Q2EA 3WGGA 2DAOA 2HTJA 3HOTA 1IXCA 2CG4A 4N9HA 2HWVA 3C18A 3JAMZ 1U5TA 2P7VB 1DUXC 1U6GA 1ONVA 3WTSC 4ZYGA 3CLOA 4HV6A 2QWWA 1IZ1A 3HRUA 5DYMA 2DQLA 1JE8A 4ENJA 2FMLA 2DU9A 4A0ZA 4XSZF 3N4MA 1REPC 1Q1HA 2EB7A 1KU3A 5HVQC 1HKQA 3LQQA 1TBXA 3CUQC 3M8EA 2CQKA 1SFEA 3HSRA 3QP6A 3IKTA 5DDGA 5ILSA 1K79A 4IRHA 3RPUA 1ZHFA 1YW7A 2VT2A 3KP6A 5DD4A 2K4JA 5TJJA 4KIGA 4RB3C 1USSA 2V1UA 4JQFA 2E7WA 1ODDA 4M6YA 5ED4A 4M9SA 2A61A 4EJVA 1ZLJA 3FXUA 1ZG1A 5CJ9A 3ROUA 3CO6C 4D0PA 2ZKZA 2PI0A 4MQ9F 2R3SA 3RKWA 4OINF 5BQTA 1NHAA 4UVBA 2W84A 2OQGA 2V9VA 2ZCWA 5E8IA 4OIOF 5FGMA 3W6JB 1MJ9A 3QAHA 2IT0A 3QPHA 5L3BA 3F6OA 1F9NA 1LVAA 1F4KA 1YFHA 4GGGA 2EV6A 2L3DA 5L3CA 1EH6A 1IW7F 1Z05A 2OAZA 3BJOA 3QU3A 4HZFA 3GEZA 1IN8A 5CLSA 4UXNA 4A0XA 4G8XA 1UFMA 3ERED 2EFPA 4LB6B 1ZRCA 4BHBA 1U78A 3IL2A 1XCBA 4RGSA 1TLHB 4KYWA 3WG9A 3O6BB 1E2XA 1BC7C 1ULYA 1K7AA 4N9IA 3K2ZA 4L0YB 3KZYA 1D8KA 2OD5A 4CZZA 3WE2A 3P9KA 1MGTA 4AVPA 1FBQA 3V8JA 4GCVA 3F8CA 1S3JA 2JPCA 5E1XA 3WTVC 4ESBA 2DI3A 3TGNA 1F1ZA 4HV5A 4L9NA 3EQLF 5FLXZ 3ZN0A 1KU7A 5LRSA 2PQ8A 1Z7UA 1Z6TA 2EA4A 2VBZA 1Z91A 2VBYA 1HBXG 2G9WA 3J80K 2FA5A 1PUEE 1FZPB 2P5KA 1ZG5A 2DK5A 4BNCA 1WRJA 3BP8A 3MWMA 4I02A 5HS9A 3KCCA 2M1BA 1IN6A 1UHWA 4B8XA 2V79A 2A6HF 3R4KA 1KQ8A 4LK0F 1QO0D 1O3QA 4G6DA 2QENA 2MD5A 3JTGA 2H27A 3CDHA 4IHSA 1U2WA 5HLGA 5CVUA 2OZ6A 2Q0OA 1W7PB 1B9NA 2WV0A 2BV6A 2IP2A 1I27A 4HA8A 4Y15A 2D1VA 3RIRA 2DBBA 4PGHA 5CYVA 4LB5A 4ENNA 3VEPA 1E17A 4IRGA 5DV5A 5HDKA 1R7JA 2NNYA 2M8EA 2NNNA 1K6OA 1VTNC 1FWZA 2ZMEA 4XLNF 1R00A 2H09A 3WODF 5E17F 2FBIA
chains in the Genus database with same CATH superfamily
1UELB 1FT9A 3LMMA 2XPUA 1Z77A 2J5PA 5F64A 4YIRX 2BVMA 2GA1A 5FB2A 2XROA 2VJ5A 4XLPF 1A35A 3GYHX 4ZDOA 2K9LA 2EFQA 1WZ2A 1DDNA 2LOOA 5J1UA 4ZJZA 5D6FA 1W5CC 3VWBA 2TDXA 3BCBA 2R7DA 1ZYRF 3IAS2 3VYUB 1XGSA 4ZH4F 3RQIA 1PYVA 1WJAA 1N25A 4DZPA 3PJRA 4X1EA 3VYTB 1UCRA 2LF7A 1MJAA 3G71I 2MABA 2KJBA 3DCFA 3DTKA 3FXOA 4G9YA 4C3JJ 1AHDP 2CW0F 2XAGA 3BR5A 1JHFA 3R61A 5E3OA 4RB2C 2W82A 2K9NA 3K7AJ 4HNUA 4FTHA 4WXDA 4CH7A 3I64A 1HXDA 4I7HA 1XSVA 2ZFWA 2R5YA 1MZBA 3AAFA 4ZDPA 3IWZA 1RRJA 2R93J 1I6HJ 3V8LA 1SFKA 3OV8A 1JT6A 2RQPA 2X85A 4G12A 2V6EA 2P5VA 2DA5A 2VKHA 3IAM2 5IOYA 4J01A 1SD7A 2GIVA 1W36C 2JJ7A 3CJRB 4I6ZA 1R4NB 1Z21A 4JK1X 2K4BA 3E7LA 2L7MP 3WHBA 3KE2A 2FQ4A 2FXAA 2L01A 2X6XA 1UG2A 2KT0A 3BQZA 2WB1A 2IAIA 2YX4A 1RKTA 3L09A 2VODA 4HG2A 3T0YA 3E5XA 2RV8A 1WFXA 1BIBA 2M45A 4AD9A 5F1RA 4HSRA 1D5VA 1MMAA 1JGSA 3ZQLA 1QGPA 1LQ1A 3K4BA 2RNJA 2VJJA 1DGWY 4FCYA 3W2AA 1V5FA 1F43A 4OAYA 5GAGJ 2HVQA 1BW6A 2IA2A 4A3KJ 2KHMA 1A6QA 2BY3A 4BDYA 2PMHA 2QCOA 2F5DA 1R6RA 1TQIA 1TWGJ 1S5LC 4Y7NJ 4V2GA 1CQTA 2Y0MA 1B1BA 3S93A 2DPUA 2Z16A 3KFWX 1IDZA 1OCZH 3JAMK 2DLLA 3HRSA 2WY8Q 3BTJA 1YX5A 1XMKA 3CDLA 4PJMA 4PJLA 1GVJA 1A36A 2E1NA 3I58A 2W24A 4PFPA 4EMSA 1RZ4A 1KONA 2QZ8A 3Q5FA 4I0AA 3CCQI 3KYCB 1ETKA 2VXDA 3JRDA 1YG2A 5FROA 2BE5F 1ZRDA 2VQGA 5L3EA 1RPWA 3G2BA 3K4LA 2OTLI 3K1PA 2LP0A 3ZMVA 2WY7Q 4K2EA 5F1JA 2NVQJ 3HL2A 2AXLA 3RPUD 2LMDA 3OYAA 3S16J 2V26A 1SD6A 2UZKA 2VT3A 2XKPA 2ZXHA 1YO5C 3W6KB 2I8DA 1FC3A 3DXJF 3H9JA 2A68F 2PMZA 4FT8A 1AOYA 4HYEA 2RN7A 4LLGF 3MQ0A 4B43A 2A5YB 1ZKGA 1ZLKA 1QNTA 4DBRA 1T2KA 3PNTA 4I99C 3B02A 3H5RA 3DF8A 1MDMA 3OWTA 2QSGX 2NYXA 2W57A 4F52A 3I54A 4IXAA 4A69C 3FBIB 2X6YA 1IRFA 1RI7A 5E3MA 2X51A 4WXHA 4HX8A 3TL4X 2GA2A 4HF1A 3Q0WA 1SMYF 2FRHA 3K1MA 2V9KA 2DA3A 2WAEA 1I50J 1QBJA 5FKOA 3ELKA 1Z1DA 1GXPA 3HSFA 4G7HF 3OYLA 2LREA 2OTJI 2E19A 4OOIA 1Y0UA 3L2UA 3BZ6A 1T39A 2EA2A 4XKBA 3JRGA 2JVGA 4BDZA 4ENKA 1P6RA 3S2DJ 3NEUA 4HLYA 2NAZA 1WVRA 5B3SH 4JX5A 1OYIA 3GW2A 1R36A 4LGWA 1ERDA 3RKYA 4DBQA 4A3IJ 2ICWG 3U1KA 4EATA 3FZVA 3IUOA 2R4GA 5HLIA 3S1NJ 3OOPA 4M74A 1IXRC 3A4CA 2DT6A 4AIKA 1GHCA 1HCRA 2JA8J 3JSPA 1MKMA 2Y9ZA 2B9SA 3ASNH 1RR8C 2I10A 4XKVA 2O3FA 1MNMC 2F5EA 2V1XA 3GTGJ 3DP7A 3FWEA 3S1RJ 5M5YJ 5F0HA 2XHKA 3BJAA 1PUFB 3LQRA 3F8BA 5LHGA 2CH0A 2XIGA 4S05A 3MEXA 1R5HA 4IEJA 4DOZA 2XGXA 2E1MC 2F4MB 2A69F 4XRFA 3HOXJ 4AIJA 5EGOB 1DPRA 1U5TB 2VASA 3BROA 1Y8QB 4BH9A 4IHTA 5FFZA 4EEFG 2IBDA 2Z99A 4R1HA 4XIDA 2OU2A 1BJZA 3ABKH 5M5WJ 4HX7A 2LY1A 2ESNA 2Z33A 3FMQA 4XL9A 2FNPA 3FHNA 2DQRA 5BOXA 2M8GX 1MNDA 5FLVA 3FXMA 3F8MA 2VN2A 2VBXA 1P4AA 2IRFG 2ADUA 5J8FA 2CMPA 1Y56A 4RM2A 2H1LA 3RCOA 1VQKI 3J80Z 1YW8A 1ZQ3P 2P6SA 4EJOA 3F23A 2ISZA 2XF5A 3DBRB 4PSXA 1P9QC 1U0JA 4HBLA 2DCEA 3CO7C 4M3DA 4IJAA 4P55A 2LDUA 2GXGA 1WI3A 5DCMB 3IH2A 1XDSA 2DODA 5ICCA 1Z0XA 2CW7A 1FJLA 4KICA 3SFZA 2O0YA 3S32A 4XRSG 4EGYA 4H4KC 5KHDA 2VOOA 1G3SA 2XUBA 3E6BA 2WV1A 3I55I 3GXOA 2O8XA 1WJEA 4KIFA 1HDPA 2BZTA 2JRTA 1G59A 5D6EA 4P9FA 1V5EA 2E35A 4EJUA 2B0LA 2W85A 1LFPA 1MSEC 3F3XA 4IOAF 1HW5A 1TL8A 1IUYA 2IVMA 2VXZA 4XBFA 4BEHB 1O4XA 3WU1B 4HX4A 4E7HA 2AQEA 1Z67A 2H6CA 2HXIA 4I2OA 1QVUA 1YITI 3L00A 2W4SA 5EEHA 3VOEA 4FX0A 4RLQA 5E3LA 2DDAA 5H6QA 3IRRA 4UV9A 2GLOA 3ZMDA 3GO5A 1YTYA 5GAHJ 4RAZA 3DFGA 4AVZA 2CV2A 3AG2H 3ECHA 4M71A 1R49A 1FIAA 1FBUA 3RYRA 2QBYA 1TZLA 2L7KA 2A6TA 2ZB9A 3GTOJ 4MQVA 2RDPA 4CHUA 5FKKA 4OMZA 4AYBA 3J81K 3CCMI 3M4OJ 4XLEA 4RM3A 1BM9A 9ANTA 3P7NA 1OMIA 3K0LA 1KU2A 2UXNA 1G8XA 2KZGA 2IA0A 4II3A 4ASNA 1UJ8A 3K10A 2DN0A 4G94A 5K1YA 3F72A 2O7OA 2K3FA 2XF7A 3GX4X 3CCSI 4PCQA 1SD5A 5C44J 2WTEA 2LF8A 1UMQA 4LLLA 1U8RA 4HNVA 2G0EA 5J6XA 2EFNA 1FOXA 2KIUA 4DYRA 2DTRA 1SEUA 4HRIA 2LLKA 2BW3B 1T95A 1G3YA 3A2KA 3DKWA 4A3JJ 2STWA 1KU9A 3F0CA 4M9ZA 4F7ZA 3Q9SA 3LSMA 3K6GA 2NS7A 1ETXA 3BPVA 3O8HA 1J75A 5FJ8J 2E1OA 3F8NA 1YQAA 3L9FA 3OIQA 2DMUA 3G3ZA 5LHIA 3S1QJ 5FLXK 1R1UA 2J5OA 5CPRB 1ITYA 2PFBA 2X48A 3DBHB 1E3PA 2HOSA 2FBKA 1IN7A 4IHVA 2QF7A 3LSHA 1O3SA 1A6IA 2KIQA 1RKWA 3HRTA 3F21A 2GOXB 4U88A 1IC8A 2KL4A 3B6AA 3LSGA 2WA0A 1KZHA 3PUFA 3UR3C 4XONA 2CGPA 2VKDA 1S8NA 1O3TA 1DPUA 2OPTA 3H9GA 1IF1A 1QZYA 1PUFA 3E5UA 4WWCA 4MNUA 3SQNA 2Q8KA 4ENMA 2ID3A 5LEJA 4CGZA 2DA7A 3PUBA 5FKLA 3I5UA 3K4MA 3KP7A 3HBLA 2Q1ZB 3L2CA 1GVDA 2HQNA 2A07F 4AIDA 5ILVA 2ZXJA 1WQ2A 1SFOJ 2CO5A 3ZPLA 3FK7A 5K5OA 1ZGAA 3D5RC 2NVYJ 3D0SA 1W5SA 5HDGA 2WC2A 4ZZDA 1FP2A 2CWEA 5EEAA 1JUSA 2QM3A 4QIWN 4LG0A 3DQVC 2EIKH 3C7JA 3TW6A 2RGVA 5B1BH 2IXSA 4E6KG 2JTVA 1FNNA 1J2XA 3CLQA 5IP6A 2GWRA 4BGDA 3DPLC 5ICGA 3D5LA 1B8IB 1H0MA 3R0JA 2DYSH 1DP3A 2X1CA 2M0MA 2EJRA 3K69A 2MYSA 2HYGD 4L5JA 1U3EM 3ZQCA 3OYHA 3K1NA 3H0GJ 2E2IJ 4I76A 1MBEA 2E34A 1T33A 5EGOA 1PDNC 2RKHA 3LSJA 1J59A 2ZXIA 4JYKA 4BJ5C 2K02A 4ZYHA 1SVLA 2K27A 4II2A 1D1BA 5GAEJ 4A93J 1Y8RB 4JP0A 1G3WA 1NH3A 1I1SA 1EJ9A 1XPXA 2BGCA 1KGSA 3TQNA 4E7KA 4P9UA 3VYRB 4E7LA 3BQYA 3WU0A 1IRGA 2EZIA 2DPDA 3NRVA 2LKXA 2DW4A 2K85A 5DUIA 2DJIA 1SFUA 5LFAA 3LL7A 1J9IA 4E7ZA 1H9TA 3H9QA 2LH9A 1SFXA 3CTAA 4RB1A 3JRHA 3H0DA 4HW0A 2CV0A 4CZCA 4BQAA 4UB8C 2PMZN 1SAUA 1FBSA 1YHQI 1K4TA 2FNAA 1WKMA 2YU3A 4OMYA 3ABTA 1FOYA 1P2FA 1B4AA 3P9IA 3O2PE 4EM2A 5LHHA 3H3UA 3RTRA 3KETA 2A3SA 2CJJA 3OS0A 2QUFA 2JN6A 1H8AC 4DNCA 3J7AY 3TO6A 3ML6A 1SD4A 3TOBA 4AYBN 1YJ9I 1MD0A 3ZXSA 3N97A 2IA1A 2GM4A 3KLOA 3WTZA 3S3NA 2QVOA 3TO7A 3CMEI 1B72A 1V54H 5H2FC 4U0YA 4JOMA 1VQ4I 3REOA 1H9GA 1LNWA 3CP8A 3DEUA 1FSEA 5JVTA 1K61A 1W0TA 1MIJA 4IRIA 4MGRA 2V4JC 2XRLA 5D5UB 4XLCA 3BTCA 1MDMB 4HLXA 2XGCA 2L9VA 3LNQA 2CUEA 3KYDB 2R7ZJ 3RKXA 2ETHA 2CFOA 2JQ7A 1NK2P 2PLYA 3HKZA 3SHFA 3TDZC 2AXTC 3IKVA 3KP3A 2KIMA 2HZTA 3MAJA 1VQ8I 5FLMJ 1OLTA 1LJ9A 4Y33A 4LLNA 3PQKA 1HW2A 2HOTA 3BR1A 5FFXA 4QLCU 3WG7H 2LKSA 2ZNYA 2GBYA 3JRBA 3BY6A 5IYDJ 2MGQA 3E5QA 5K7HA 1Z6RA 3HTUA 4C2TA 1BL0A 2EV0A 5E18F 4I0BA 3RQ4A 1EH7A 3JR9A 1BW5A 1ETVA 3CUOA 1RIOH 1F5TA 4F3QA 1XGOA 1TQMA 1UB9A 1U8BA 2R5ZA 3N05A 2YSRA 1JKPC 1PP7U 1T6SA 2EFOA 4QPQA 1SAXA 1X1AA 3TOAA 3U9GA 1MBFA 4CCNA 3VB2A 1MBHA 3Q3SA 4C2MJ 2BOLA 1PJRA 2K40A 4LFUA 5D8LB 4QPOA 1VFCA 5ERIA 2DA4A 4LK1F 1WWXA 1JTYA 3LWFA 4BACA 2E2HJ 2TRTA 3SDGA 3AL0B 3C1DA 1QVTA 2DMTA 2FMYA 4RGRA 4PK4A 3J7AO 1TWHJ 3WTUC 3V7RA 3QP5A 3DEEA 5CVVA 2VC0A 5HLHA 2DMPA 2AQFA 4ZC3A 4HPQA 4B48A 4ZYEA 2BY1A 3QYEA 4A6EA 2JA6J 3OR2C 5JI6A 2RREA 2W1OA 1QQIA 2W00A 3T5XA 1FOKA 3I53A 1B59A 1XC5A 4M9XA 3GWZA 1JKOC 4O5VA 1KYWA 1LDDA 5J47A 2XAFA 1K78B 2ZMEB 5AIQA 3OYBA 1TP4A 4EM1A 3RZDJ 4G6QA 2HVRA 1BI3A 1K6YA 1MMNA 3C2BA 4E70A 5IYBJ 4S04A 3FXRA 2FBHA 2QBYB 2O9LA 4IO9F 3FMSA 3CC4I 3J81Z 4BE1A 2R7SA 1DGRM 3BDDA 4BY7J 3FM5A 3IC7A 4X6AJ 4F55A 5LEKA 1QZEA 2JZYA 4KA4A 1VQMI 3EETA 3Q9VA 4DIQA 1FYKA 4PJJA 3IRQA 4RB0A 1Q1VA 4GXOA 1D0XA 1R58A 2W25A 1ETYA 2HGCA 1Y1VJ 1MSFC 3CJNA 4BAYA 2KJCA 3HRMA 4AIHA 1R5ID 3E97A 4YFNF 4PGGA 5K7ZA 3ZP5A 2VB6A 3WGHA 5LBQA 1FX7A 1R23A 1XGMA 1T38A 2H6BA 2VPLA 1I3QJ 4NQWA 3PM1A 3HOSA 5E20A 2VIXA 3L2RA 2IS2A 4HDVA 1C0WA 4RLFA 3E6DA 4S0HB 3NQOA 3OYFA 1WJ5A 5DS9A 2JA2A 3CCYA 3M9AA 2HDCA 2DOEA 2M7AA 2K86A 3KPHA 4BYYA 1Z3YA 1EH8A 3A01A 2IPQX 3O8GA 4Q47A 4TV7A 1LEBA 2EFWA 2DYRH 3HOZJ 4KISA 5ICEA 2X4HA 2HKXA 1TW2A 2M4GA 4KMUX 2M87A 5KK1A 3R60A 2RVCA 2NS8A 4AM3A 4XNFA 3AG4H 2HDDA 3B73A 2VI6A 4BQOA 4WXCA 3VDXA 2ZJRF 3ZMSA 3QOPA 1IG7A 4G7OF 1FIPA 2LVSA 2LYCA 4G7ZF 1Y6IA 2OQRA 1ZR2A 1BOAA 3KEYA 2H8RA 2AHQA 2ELHA 3E3VA 3RZOJ 1WH5A 3PIPF 3VSLA 2HI3A 1ZREA 3D1NI 2DT5A 2KP6A 1XB4A 4I98B 4A3CJ 3Q0UA 2NOGA 4A5MA 2JUGA 3OL4A 5IYCJ 3HHHA 3CUQB 2FQ3A 3QU6A 2HEOA 2O03A 2P5LC 2E60A 3LFUA 1IN4A 1GT0C 2L9RA 1R1TA 4PJ0C 1ZARA 4NC8A 4WK8F 3V7SA 1X1PA 1P7JA 2XGEA 3WTWC 2XSDC 1VQLI 1MMSA 2YS9A 3IHUA 1R71A 2L7FP 2XDVA 1ETQA 3BTIA 3DKYA 1TC3C 1X2MA 2ZMEC 5C3EJ 1GDTA 2GXBA 4D7MA 3K70C 4R79A 4A3DJ 2HYFA 3FF5A 1XSXA 2RNGA 1TT0A 2VC1A 2VE9A 5CVRA 2R7QA 3K2AA 1QU3A 3KIOA 1WGXA 1K83J 2OF7A 5LGTA 3WTXC 4A3GJ 1JHHA 2UV1A 5H6RA 3GLLA 2QA4I 1T56A 3HB9A 5F08A 2V6CA 2X1DA 1RUOA 3NWTA 4D5CA 2VE8A 4MFDA 4PDKA 5EZGA 3SFIA 1GV5A 3ZN1A 2Z9OA 2BBYA 3GTLJ 2ELJA 3NARA 3V4GA 3CCRI 4NB5A 3MKLA 2R7VA 3DTEA 4H0EA 3GUDA 3EYYA 3W2VA 4IX7A 3CC2I 2F4OB 2MLKA 3KLNA 3TBIA 1L0OC 3I71A 3DU5A 3M8JA 1S6LA 3LA3A 2VOPA 1P7IA 2FU4A 3CJQB 4L0ZB 3BR2A 5BPDA 1X1DA 2IEKA 3DPUA 3OYKA 5IPAA 5J3LA 4GYIA 4ZTFA 4Q4ZF 2KZVA 4A5NA 2P81A 3S1MJ 4XR6A 2M34A 1IRZA 1YJNI 4BU2A 1BJAA 2R7FA 4XN3A 1D5YA 1D0ZA 5JLWA 5C4JJ 1T8IA 3V8KA 2B63J 1A5JA 2V7FA 2GQQA 2KLOA 2ZJPF 2E5ZA 2D1HA 2FEZA 3CMMA 1P92A 4UVCA 4MEXF 3O3KA 1U9NA 2PN6A 1CF7A 1U9OA 4KMFA 2KISA 3HSEA 4IPAA 4CO8A 1XG1A 1PP8F 4DYQA 2A6EF 5L3FA 1N78A 2H94A 4DYCA 2JVHA 1BR4A 4A0YA 2HFHA 2WB1N 5E1WA 4BEHA 1YLFA 4A3FJ 5IP9J 4L9TA 1UAAA 1RNLA 2L9SA 2XF6A 2G7UA 2W48A 3A02A 1APLC 1IGNA 3CCEI 1ZG3A 2KQRA 1ACIA 1IO2A 2KPMA 2P8TA 2OZUA 4CCOA 3GVAA 4X0GA 1MMGA 3HJEA 2JT1A 5TRDA 1OYWA 2E71A 1VQPI 2R0QC 5EF6A 4CCJA 2UWMA 3LA2A 1G3TA 1QHGA 3G1MA 3KEOA 4DZJA 3JSOA 1JKRC 1YRNA 5TGTA 1XTAA 2EV5A 4NC6A 2DFEA 5DCMA 1SVMA 1QZZA 1WJCA 3EUKL 2X9DA 2VPRA 1KQ9A 4BXUA 2MH2A 4JX4A 5LRRA 2X6WA 2BXZA 3WU2C 3MKWB 3FKJA 3GTJJ 2FD5A 2O5RA 3JW4A 4RAYA 2CFXA 2ACJA 4XLFA 2LY9A 4M3FA 5M3FJ 2F5FA 2PX9A 1ENHA 3LSTA 1RUNA 4BE2A 4M3BA 4UHTA 1W4MA 1X3UA 3S17J 2HZDA 4KT5C 4DJAA 2QKMB 2H1KA 3VPRA 4M72A 2DA2A 2WADA 3RDIA 2P6TA 4A6DA 2Y69H 3I4NJ 5IT3A 1WH7A 3SDBA 3SEQA 2IGOA 4V19K 4WF2A 3K4JA 2BEOA 1AKHA 4AC0A 2FX0A 4HNTA 5D4RA 5DM7F 3S2WA 2DXIA 5FRNA 1EKEA 3MZHA 4CICA 2YPRA 3PNYA 1UZCA 3GBGA 1FY7A 5BNGA 4BQQA 2BXYA 4PUSA 1X1CA 3M1EA 3OYGA 4BHCA 3FM3A 2HQ5A 3I59A 5HOOA 2MC3A 4BBSJ 2IS1A 3ZQ7A 3CP2A 2KDZA 3HOYJ 2H8WA 4FHTA 3SXYA 2CV1A 2YU9J 3E6CC 5F27A 1ZGWA 1GXQA 3PQJA 2ME6A 1S7OA 5CKTA 1OYYA 2M0CA 3BZKA 3ZR8X 4KUMA 2R7RA 1DU6A 2RAEA 1S7EA 4JX6A 1YIOA 4RGXA 4L5IA 1FYLA 1UHSA 2QLZA 2JMWA 4D1QA 4XOTA 2WWYA 5BS6A 4LOCA 3C2GA 3ASOH 3K9TA 1OKRA 3DU6A 2O61A 4Y3OA 2NOJB 3HOVJ 4CXFA 3DWLE 4IQ4A 3BR3A 4LMYA 2D5VA 1EV7A 5A2QK 5M5XJ 3I4MJ 3HM5A 3ULQB 1Z3XA 2V9PA 1ZN2A 4Q48A 4CYDA 1FYMA 1YJWI 2TCTA 3BOQA 3HOWJ 1SVOA 1T0FA 5M3MJ 2ECCA 2OJED 3QPSA 4Z2YA 5JFRA 4XSXF 4BJ6C 1LB2A 1R1VA 2VBWA 1O57A 4EJTA 1U5TC 2BHYA 5F6FA 3K70D 1TNTA 1J5YA 2L0KA 2QYOA 2ME0A 5EYRA 1Y0NA 2I5UA 5J40A 2F48A 3CD6I 4E4HA 1G4DA 4UV8A 3HKZN 1YIJI 2OC6A 4BKXA 2GOMA 3HYIA 3GFMA 1B9MA 3UNGC 2AS5F 1FEXA 2ELKA 3W6VA 1W5TA 2XV4S 3P9CA 1JT0A 5J4YA 3IWFA 5LGUA 3ZQQA 4A3MJ 1STZA 2A5WA 2DFIA 4OIQF 4D7NA 4Y13A 1WI9A 2QQ9A 4YFXF 2HU9A 2W7NA 2LKPA 1SMTA 2PG4A 3MVPA 4KIBA 1QPIA 3QQAA 3PIOF 5CQEA 2XAHA 1IRXA 3AFHA 3SEZA 2IS4A 2F6CA 3AG1H 5GP9A 4C30A 4YIFA 4F92B 3LFKA 5EDNA 4U0WA 3RI4A 1AKHB 3OIOA 3T8RA 3KZZA 2L4MA 3WTYC 4XMYA 4XLAA 2HYJA 1N75A 5HODA 3CUQA 5TISC 1I1GA 1XMAA 5GPAA 2FF4A 1HLVA 1IAWA 1MMDA 5H20A 3L7WA 3JRFA 4C9YA 1JJ8C 1V5GA 6PAXA 1ZTRA 3JTHA 2LSOA 3QYFA 4WCGA 5EG0A 4P1WA 2CU7A 4I09A 2NVUB 1BI1A 3ZQIA 3FHZA 4L5EA 2E1CA 2GXAA 1WJBA 3L2WA 3R6SA 5HS8A 3I4PA 1OFCX 1W7PA 3HGYA 3GLXA 1MH4A 2ISYA 2HPIA 3WE3A 4ABZA 3DEWA 2ZFUA 2UXXA 4KN4X 3VODA 1T98A 1VZ0A 2V1DA 4GO1A 3FX3A 1CGPA 4Y52J 2CUFA 2ZO4A 5JR3A 2X6OA 5DEQA 2VQCA 4EQQA 3DPTA 3QPTA 5KVRA 1OJLA 3MN2A 4UVAA 1ZRFA 4FX4A 3RPQA 4ZTJA 3ZMZA 4M6XA 2F5VA 3A03A 3L2QA 3LSRA 4OIRF 1FP1D 3GTQJ 1XDUA 2DMQA 3GFLA 4EVIA 4IOCF 4MO7A 2EZHA 3A0BC 4XICA 3LA7A 4LG0B 2L2OA 4UY8I 4MTEA 2E7XA 5J8CA 3WGIA 3COAC 3LAJA 1DQUA 1P4WA 1RESA 2JA5J 1VQ6I 3BTLA 2L02A 2R7UA 1FLIA 5F0CA 3KYLA 1HSTA 5JHUA 1GV2A 4XLHA 2JK3A 3JRCA 3DV8A 3QRFF 3DKXA 2VQLA 3ZRGA 2Y9YA 4ETSA 4L18B 3OSFA 4U0VA 5IT9K 3D5SC 3OMYA 2FOKA 2MC4A 1BI2A 1VQ9I 1I6XA 1JXSA 1YYVA 1JKQC 5IOZA 5FD5A 2HKOA 1BR2A 4RS8A 1GLNA 3I0TA 5GTHC 5D8KB 5D5VB 1WSUA 2EIMH 2KKOA 2XASA 2OBPA 3FBNB 4ESJA 2HXOA 3MMYB 3KP5A 3W2WA 2CSOA 1WJFA 3HUGB 3EUAA 2LY2A 4U7BA 2E36A 3M7GA 4A2UA 1I5ZA 3TEDA 3FMRA 2DA1A 1XGNA 2MLGA 1HKTA 4HAMA 4FETA 2JWTA 3BWGA 4PZJA 4V2FA 4ZZLA 1O3RA 3LOCA 1GUUA 5E1ZB 3TP3A 3HDDA 1W7PD 2XPWA 3BLYA 4JBAA 1MJBA 3KP4A 1IXSB 1NG7A 4M73A 4CYCB 3F8FA 3OYNA 4MFEA 4NQWB 5LGNA 1YE9A 3H3ZA 4LIUA 1LUJB 2C6YA 1JUPA 2LRDA 2K7LA 3OOUA 1XCVA 4OIPF 5B5EC 3S15J 5CVIA 1E3HA 1O7FA 3TDUC 4BE0A 4EV0A 3BT9A 3MD2A 4KFCA 3KP2A 4MHGA 2BHZA 3GZ5A 2MH9A 2LC2A 1TQPA 2FSWA 2EWNA 4R8HA 1ETOA 4A3LJ 2RC4A 3CCLI 2DK8A 1BC8C 3CCVI 1TNSA 5D5XB 3HG9A 2EILH 3CQZJ 2P0WA 4QWQA 3MCZA 3ZMUA 3LAPA 5E3NA 4RDUA 2Z3YA 1XN7A 3CJTB 4UB6C 1D0YA 2STTA 2ZBKA 4ESFA 5J1YA 2ESHA 3RSNA 1ZAOA 2R7OA 5EG0B 1V3FA 2EK5A 4YG2F 2Z2SB 3V42A 3HPHA 5FKMA 2K9SA 1YI2I 2XKOA 1H89C 5FO5A 2MA3A 4Q5SF 1KA8A 1RETA 4PSWA 2LBFB 1VQ7I 2HR3A 5D5WB 2L54A 3EUHA 2R5ZB 3H92A 2QSHX 3CC7I 3S14J 3ZOBA 3HXLA 2PJRA 4YRVA 2M4KA 4LJZF 3K4NA 2DJNA 4UUSA 3RKQA 2R7XA 3TW7A 2YX7A 3CF5F 1FSHA 1FMWA 4C3HJ 4LD5A 2JUCA 2G7HA 4N4NB 3G73A 5E8GA 4LG3A 4RMNA 4CCLA 1XMXA 4B47A 1HKSA 4WX9A 5HDNA 3PO3J 3OYDA 2COMA 5JVGF 4ZYAA 3P5JA 4P96A 5IY5H 3JRIA 4NHJA 3F6VA 3IV5A 4HDUA 4L9VA 1MH3A 3T8TA 1YOVB 4O6JA 5GTIC 3I9V2 2JRMA 3W3CA 5FD6A 5KCMA 3I3LA 2HOEA 4QSHA 3GFIA 1LE8A 2HNHA 1A04A 4B4CA 1LVKA 2L7ZA 2PBIA 4HF2A 1S29A 2CQQA 3CDIA 1L3LA 2QGUA 1QPMA 3V7CA 4U87A 3C3WA 3OYEA 4L9JA 5IP7J 4BHPA 2DA6A 3I59B 4EJWA 2CQNA 1S9HA 1YW9A 2CS3A 2LNBA 3MFKA 1ON1A 4Y4RA 1SC7A 5B66C 2FUG2 1V4RA 1WJDA 1H88C 5J1RA 2QQBA 4AUXA 3E0JB 1K4SA 3U21A 1B6AA 1O7LA 1WHUA 4KN7X 2GAUA 1F36A 2F5CA 4RAFA 3KEQA 1LE8B 3FDYA 1HQCA 2IJLA 4NNJA 1QRYA 3BPXA 3NWSA 3MZYA 5ICFA 2LTPA 4GYGA 5LD2C 3QODA 3SJMA 4KNYA 4ON0A 4NBQA 1LKXA 1E0EA 3LSPA 4CDGA 3ZGKA 4XQFA 3CZ6A 4EM0B 4EGZA 2ZSIB 3TP0A 1ZK8A 2X1EA 3GZ6A 3DLAA 4FE4A 4NUBA 5CVJA 1BA5A 2CRGA 2KRCA 1ORKA 2B7EA 1D1CA 4FISA 2E5NA 2IGKA 3SZPA 1K78A 2ECBA 3GTPJ 2Y48A 2LK2A 3HIFA 4RBOA 4KDPA 3E6MA 3JRAA 5FRMA 2IW5A 3SZGA 3SZTA 1MNEA 4UNOA 2VLAA 2ZXWH 4B09A 5L3GA 4N4OB 5HLTA 1EF4A 5DUKA 5K7FA 5DCFA 2K3PA 2Y0SA 2QKLB 5AIPA 2QQAA 2L4AA 4BJTA 1S72I 2Y75A 1USTA 3U1DA 2YR2A 5C4XJ 3OY9A 3BR6A 3TKYA 4UUVA 5HNHA 2XAJA 1SANA 4RGUA 2VKVA 5EEGA 3ZMTA 4F93B 3EPZA 5KAIC 4B3XA 1YS6A 2VONA 4CSWA 4MTDA 1OCOH 4HQMA 2HTSA 1X58A 3CCUI 2K9MA 4NDLA 4B44A 5HS7A 4U7DA 3PSIA 2ZC2A 1E3OC 2LD5A 3RJPA 3BG7A 2OV7A 4IVNA 5LLQA 3GF2A 3EUHC 4KT6A 2XRNA 2CUZA 1TTYA 2XVCA 4HEA2 4IL6C 3OL3A 4XRMA 4UUSB 2D45A 1FTTA 1KYZA 5A2QZ 4N0BA 1M1EB 3FK6A 3LSKA 3CMYA 2FE3A 2O6GE 1XD7A 2ZNZA 4IF4A 3AG3H 1X3ZB 2HDWA 2PEXA 3BJ6A 1R4MB 1UG0A 1VQNI 2DO7A 2BYVE 5K5QA 2N8GA 2CQ7A 2RQQA 2Z5UA 1KQ0A 5K5RA 1J0RA 2KFDA 3EYIA 4HF0A 1HSJA 1OQYA 4AWXB 4FASD 2X0LA 3VFZA 3HTSB 1CF7B 4MEYF 4MIMA 1TWAJ 4I01A 2PJPA 1R22A 4UUTA 3QWLA 1DP7P 2CYYA 5FKNA 4CCKA 3X2QH 3VSKA 2BW3A 2XC7A 1OPCA 2KRFA 2BY0A 2UUZA 2LFBA 4XM3A 5AONA 4ZYDA 4FQGA 1HA8A 5L3DA 1D3YA 1P4XA 5EZHA 1LEAA 1S7AA 2K5CA 5DTDA 2P7CB 3TMOA 1HW1A 1J09A 3F22A 4KITB 4A12A 3U2RA 3KZIC 1AU7A 3AKZA 1OCTC 5BPIA 4OU0A 1Z9CA 1XS9A 1D8JA 2QSFX 4DQ2A 5HNFA 1R9TJ 1BN5A 1OR7A 3HUGA 1JGGA 1J7KA 5CQGA 3IH4A 1TW3A 1IV6A 3JCUC 3LSIA 3M8FA 1ON2A 4IQJA 3PO2J 3HEFA 3FXLA 3AL0C 1IJWC 4RA2A 5DD8A 2XAQA 5B1AH 3MKZA 2OCCH 2MBFA 4D5FA 2EQRA 3PFIA 4P5OA 5JLXA 4XORA 3OSGA 2KDOA 3HHGA 1OCPA 3B6CA 5J4VA 2DDBA 2HS5A 2M5WA 4BS9A 1ZH5A 2FOWA 3BG6A 1AWCA 2HQRA 5IT9Z 1UHMA 1LDJA 4A3BJ 5ILUA 2JPBA 4KJZA 3PFYA 3EDPA 3S3MA 4GRIA 4E7SA 3ABUA 3OYCA 2KIFA 4E7JA 1HOMA 1YS7A 2LR8A 3QOEA 3FXKA 4O3MA 1BI0A 3TO9A 3IH3A 3UKGA 4YFKF 2OCEA 2R5YB 2NRAC 1FOWA 3K4KA 1XSDA 4OWRB 2NS0A 3RYPA 1VI0A 4GFBA 2P4WA 3H1CA 3OYIA 1IN5A 1BIAA 2GZWA 2PMUA 3GTMJ 4B1RA 1LDKB 2Z1DA 4BQNA 1BBYA 2KRHA 2M2EA 1HF0A 5BMZA 2CW8A 3ISPA 4HOBA 2ZJ2A 4YIIA 2XB5A 1FPQA 3GMEA 3WTTC 1ZELA 2EPFA 1Y1WJ 4IHYA 3BC8A 5D4SA 2NXNB 1N77A 4Y17A 2R92J 1R5GA 2D2WA 2OA4A 3T1BA 3GFJA 2XAUA 4YEJA 4M3GA 3CMAI 3QYBA 2F2EA 4HQEA 2M30A 2JSCA 2E1MB 1ZGJA 4CYCA 2CQXA 1G6NA 3ECOA 3R0AA 3FXQA 2Q2EA 2OUMA 4XN0A 2EZLA 3WGGA 4XKWA 2M7BA 2DAOA 2VL8A 1JTXA 2HTJA 2F4IA 3HOTA 4ITVA 1X2NA 2WAQA 2IGNA 1IXCA 2CG4A 4N9HA 2HWVA 3C18A 3JAMZ 1U5TA 2P7VB 1DUXC 4C2UA 1U6GA 4M6VA 1LFBA 4CUGA 1ONVA 4F91B 3S8PA 4BL0B 3WTSC 3IP4B 4ZYGA 1IV8A 3CLOA 3H35A 4Z6YA 4IHXA 1W36D 4HV6A 2QWWA 1IZ1A 1W0UA 1X3WB 3OR1C 4PFOA 3HRUA 3M07A 2R7TA 5DYMA 2DQLA 1A31A 3I56I 4ENJA 2FMLA 1JE8A 4CCMA 2DU9A 4A0ZA 1X1BA 3K4CA 4XSZF 3N4MA 2YUSA 3GTKJ 2EZKA 1REPC 1Q1HA 3CF2A 2EB7A 1D1AA 3G1OA 1MBJA 1POGA 1VNDA 1KU3A 1RC9A 3ONQA 5HVQC 2XPVA 2XSJC 1W1WE 1HKQA 3LQQA 1TBXA 3CUQC 2DT7B 2EBIA 1FMVA 3M8EA 2CQKA 1SFEA 4J19A 4IHWA 3HSRA 3E1SA 2VJ4A 3C2HA 3BZCA 1OISA 3QP6A 4XOPA 2Y31A 3IKTA 1NK3P 5DDGA 5ILSA 1K79A 3J7ZI 2DMNA 4AU7A 1DU0A 4IRHA 3RPUA 1ZHFA 1YW7A 4PJNA 1TWCJ 2VT2A 4CA0A 1ETWA 5GPCA 3KP6A 1RR7A 5DD4A 4XK4A 2K4JA 5TJJA 2WAFA 4DW6A 4KIGA 4RB3C 3MKYB 3CCJI 3S3OA 1HC8A 1USSA 3GZNB 1B8IA 2V1UA 4BXFA 4JQFA 2DTZA 2E7WA 1ODDA 4M6YA 5ED4A 2JSPA 2WAQN 4M9SA 2A61A 2DFHA 4EJVA 1ZLJA 3H3VK 3FXUA 1ZG1A 2COBA 5CJ9A 4DGWB 3ROUA 2CUJA 3CO6C 4D0PA 2ZKZA 3OS2A 2PI0A 4IZZA 4MQ9F 2R3SA 3RKWA 2IGMA 2M9HA 4OINF 5F04A 5BQTA 4BXXJ 1NHAA 3HZJA 4E7IA 1T08B 2ID6A 1HDDC 3OYJA 4UVBA 3G4SI 2MW8A 2Y2ZA 3S2HJ 2W84A 2E2JJ 2EH3A 3H36A 2OQGA 2V9VA 2HOAA 5GADJ 2ZCWA 5E8IA 5FGMA 3W6JB 3NAUA 4OIOF 1MJ9A 3QAHA 2IT0A 3QPHA 2HQAA 5DM6F 1BOBA 2V1NA 1VF9A 5L3BA 3F6OA 4FE7A 1F9NA 1LVAA 1F4KA 1IDYA 3M1CA 1YFHA 3GCMA 4GGGA 2EV6A 2L3DA 4W1UA 4XRSA 2LG4A 1Y39A 3FIWA 3VYSB 3OS1A 5L3CA 1EH6A 2A05A 2PJRB 1IW7F 1Z05A 2OAZA 2HPMA 3BJOA 3QU3A 4BUPA 2BY2A 4M3EA 1BR1A 3BG3A 4HZFA 1X4OA 3GEZA 4IKFA 1IN8A 5CLSA 1VQ5I 1MBKA 4UXNA 4A0XA 4G8XA 1XX5A 3OIPA 5F0FA 1B72B 3JREA 4XKCA 1G2HA 2MD0A 2Y0SN 3PNVA 1UFMA 3SYTA 4D9JA 3ERED 2EFPA 2IS6A 4LB6B 1ZRCA 3J7YJ 3DTIA 1Z7LA 4G6TB 4OAZA 4BHBA 1U78A 4YELA 3IL2A 1XCBA 4RGSA 4ANJA 1TLHB 2KMUA 3BG9A 2FJ1A 3ERMA 3WG9A 4KYWA 3G1LA 2JA7J 4J00A 3O6BB 1E2XA 1BC7C 3BCAA 1YRNB 1ULYA 1K7AA 4N9IA 3K2ZA 1QHHD 4L0YB 3KZYA 4ZDLA 1PVEA 1D8KA 2VQHA 2NVTJ 1TWFJ 2OD5A 4CZZA 3WE2A 4C3IJ 1TT5B 3P9KA 2XGDA 1MGTA 3H5NA 4AVPA 2MG4A 1FBQA 3V8JA 1I39A 4GCVA 3F8CA 1S3JA 3Q0VA 5KNLA 1IUFA 3HPGA 4NC7A 2JPCA 2AO9A 2MSYA 3CESA 3ZQFA 1YX3A 2HVSA 5E1XA 3L2VA 4LITA 4QTRA 2L9NA 4A3EJ 3WTVC 2ZJQF 4ESBA 3HC7A 1LPQA 5KAFC 2DI3A 3TGNA 1JJ6C 4GDFA 2BVLA 3M3YJ 2O8KA 1F1ZA 2LBFA 1JI8A 2VJIA 4HV5A 4L9NA 3EQLF 5FLXZ 1OCCH 3ZN0A 1KU7A 5LRSA 3PL8A 3WHCA 2PQ8A 1Z7UA 1OR7C 2XB0X 3ZCOA 3OYMA 1Z6TA 2EA4A 2VBZA 1Z91A 4BY1J 2VBYA 3MZ8A 1HBXG 3L1PA 2G9WA 3J80K 3BR0A 2FA5A 1I3AA 1PUEE 3FKIJ 1FZPB 2P5KA 3PSFA 1ZR4A 5E79C 4BBRJ 1ZG5A 2DK5A 2ZSHB 4BNCA 1WRJA 1V55H 3BP8A 3MWMA 1NTCA 4I02A 2L5QA 5HS9A 3DLLF 2VKEA 3KCCA 5JHFA 3ZQHA 2M1BA 1IN6A 3F9KA 1UHWA 3ESWB 1WPKA 4B8XA 2NVXJ 2V79A 2A6HF 3R4KA 1EA3A 3HOUJ 1LFUP 3KX2A 2VUMJ 1KQ8A 4LK0F 2DFFA 1QO0D 3A0HC 1MW7A 2EINH 4G6DA 2QENA 1O3QA 2MD5A 3ZQGA 3JTGA 2H27A 2DOAA 2WBMA 3CDHA 3DBLB 4IHSA 3ABLH 2Q2EB 1U2WA 5HLGA 3BG5A 4LIVA 2M3AA 1NG6A 3FXJA 5CVUA 2QQ8A 4MLOA 2OZ6A 2Q0OA 3ABMH 4RAGA 1QA6A 3FISA 1T0FC 1W7PB 1B9NA 2WV0A 2BV6A 2IP2A 2MFZA 1I27A 4HA8A 4Y15A 2D1VA 1OCRH 3A1YA 1AA7A 3RIRA 2GIZA 2DBBA 4PGHA 5CYVA 2Y30A 5EJCA 4LB5A 4ENNA 3VEPA 3HGGA 1E17A 4IRGA 1MBGA 2DOFA 5DV5A 1X4PA 5HDKA 3A01B 1R7JA 1VQOI 3H5AA 2R7WA 2NNYA 2K9QA 2M8EA 2QEXI 2NNNA 1K6OA 1VTNC 1FWZA 1FTZA 2ZMEA 1WCMJ 1X19A 3QPLA 4B3AA 3G6EI 4XLNF 1R00A 2H09A 1JUMA 2EIJH 4HSTA 3WODF 4W97A 5E17F 2FBIA
chains in the Genus database with same CATH topology
1FT9A 2J5PA 5F64A 2GA1A 5FB2A 2XROA 4XLPF 3GYHX 2EFQA 1DDNA 5D6FA 2TDXA 2R7DA 1ZYRF 1XGSA 4ZH4F 1UCRA 2LF7A 1MJAA 2KJBA 4G9YA 2CW0F 2XAGA 1JHFA 3R61A 4RB2C 4WXDA 3I64A 1HXDA 4I7HA 1XSVA 2ZFWA 1MZBA 3AAFA 3IWZA 3V8LA 3OV8A 2RQPA 2P5VA 2GIVA 1SD7A 4JK1X 2K4BA 3KE2A 2FXAA 2L01A 2YX4A 3L09A 2VODA 3T0YA 3E5XA 2RV8A 1BIBA 2M45A 4AD9A 5F1RA 1D5VA 1JGSA 1QGPA 1LQ1A 2RNJA 2IA2A 2PMHA 2F5DA 1TQIA 2Y0MA 1B1BA 2DPUA 3KFWX 3JAMK 2DLLA 3HRSA 1XMKA 1GVJA 2E1NA 3I58A 2W24A 4EMSA 1RZ4A 2QZ8A 3Q5FA 4I0AA 1YG2A 2BE5F 1ZRDA 5L3EA 3K1PA 3ZMVA 4K2EA 2AXLA 1SD6A 2UZKA 2VT3A 2XKPA 1YO5C 3W6KB 1FC3A 3DXJF 2A68F 4FT8A 1AOYA 4HYEA 2RN7A 4LLGF 3MQ0A 2A5YB 1ZLKA 1QNTA 1T2KA 3B02A 1MDMA 3DF8A 2NYXA 2W57A 3I54A 4IXAA 1IRFA 1RI7A 4WXHA 4HX8A 2GA2A 4HF1A 1SMYF 2FRHA 3K1MA 1QBJA 3ELKA 1Z1DA 1GXPA 3HSFA 4G7HF 4OOIA 1Y0UA 3BZ6A 1T39A 2EA2A 4ENKA 1P6RA 3NEUA 4HLYA 2NAZA 1OYIA 3GW2A 1R36A 4LGWA 3RKYA 3FZVA 5HLIA 3OOPA 4M74A 1IXRC 4AIKA 1GHCA 3JSPA 1MKMA 2O3FA 2F5EA 2V1XA 3DP7A 3FWEA 2XHKA 3BJAA 3LQRA 3F8BA 5LHGA 2XIGA 4S05A 3MEXA 1R5HA 2XGXA 2A69F 4XRFA 4AIJA 1DPRA 1U5TB 3BROA 4BH9A 4IHTA 5FFZA 2Z99A 4R1HA 2OU2A 4HX7A 2ESNA 2Z33A 3FMQA 2FNPA 2DQRA 5BOXA 3F8MA 2VN2A 2VBXA 1P4AA 2IRFG 2ADUA 5J8FA 3J80Z 1YW8A 2P6SA 4EJOA 3F23A 2ISZA 4HBLA 3CO7C 4IJAA 4P55A 2LDUA 2GXGA 5DCMB 1XDSA 5ICCA 4KICA 3SFZA 2O0YA 4EGYA 2VOOA 1G3SA 2XUBA 3E6BA 3GXOA 2O8XA 4KIFA 2JRTA 5D6EA 4P9FA 4EJUA 2B0LA 2W85A 3F3XA 1HW5A 1IUYA 2IVMA 2VXZA 4XBFA 3WU1B 4HX4A 4I2OA 2H6CA 3L00A 5EEHA 3VOEA 4FX0A 5H6QA 3IRRA 4UV9A 3ZMDA 3GO5A 1YTYA 4RAZA 3DFGA 4M71A 3ECHA 1FBUA 3RYRA 2QBYA 4MQVA 2RDPA 4CHUA 4OMZA 3J81K 1BM9A 3P7NA 1OMIA 3K0LA 1KU2A 2UXNA 2IA0A 4ASNA 4G94A 5K1YA 3F72A 3GX4X 4PCQA 1SD5A 2WTEA 2LF8A 4LLLA 1U8RA 5J6XA 2EFNA 2KIUA 2DTRA 1G3YA 3DKWA 2STWA 1KU9A 4M9ZA 4F7ZA 3Q9SA 3BPVA 1J75A 3F8NA 1YQAA 3L9FA 3G3ZA 5LHIA 5FLXK 1R1UA 2J5OA 2PFBA 2FBKA 1IN7A 1O3SA 3HRTA 3F21A 4U88A 2CGPA 1S8NA 1O3TA 1DPUA 1IF1A 1QZYA 3E5UA 4WWCA 4MNUA 3SQNA 2Q8KA 4ENMA 5LEJA 4CGZA 3I5UA 3KP7A 3L2CA 2HQNA 2A07F 5ILVA 2ZXJA 1WQ2A 3ZPLA 2CO5A 5K5OA 1ZGAA 3D0SA 1W5SA 5HDGA 2WC2A 4ZZDA 1FP2A 2CWEA 2QM3A 4LG0A 3DQVC 3C7JA 2RGVA 2JTVA 1FNNA 1J2XA 2GWRA 3DPLC 5ICGA 3D5LA 1H0MA 3R0JA 2EJRA 3K69A 2HYGD 4L5JA 1U3EM 3K1NA 1PDNC 2RKHA 1J59A 2K02A 4ZYHA 2K27A 1G3WA 1I1SA 2BGCA 1KGSA 3TQNA 4P9UA 3WU0A 1IRGA 2DPDA 3NRVA 2DW4A 5DUIA 1SFUA 1J9IA 1H9TA 1SFXA 3CTAA 4RB1A 4HW0A 4BQAA 1FBSA 2FNAA 1WKMA 2YU3A 4OMYA 3ABTA 1P2FA 3P9IA 1B4AA 3O2PE 4EM2A 5LHHA 3H3UA 3RTRA 3KETA 2A3SA 2QUFA 4DNCA 3TO6A 3ML6A 1SD4A 3TOBA 1MD0A 3N97A 2IA1A 3KLOA 3WTZA 2QVOA 3TO7A 4U0YA 3REOA 1H9GA 1LNWA 3DEUA 5JVTA 1FSEA 4IRIA 4MGRA 5D5UB 1MDMB 4HLXA 3RKXA 2ETHA 2PLYA 3SHFA 3TDZC 3IKVA 3KP3A 2KIMA 2HZTA 3MAJA 1LJ9A 4LLNA 3PQKA 1HW2A 5FFXA 4QLCU 2ZNYA 3BY6A 3E5QA 1Z6RA 3HTUA 2EV0A 5E18F 4I0BA 1EH7A 3CUOA 1F5TA 1RIOH 1XGOA 1TQMA 1UB9A 2YSRA 1PP7U 1T6SA 2EFOA 1SAXA 3TOAA 3U9GA 3VB2A 4LFUA 5D8LB 5ERIA 4LK1F 1WWXA 3LWFA 3C1DA 2FMYA 4RGRA 3J7AO 3WTUC 3V7RA 3QP5A 5CVVA 2VC0A 5HLHA 4ZYEA 4A6EA 5JI6A 1QQIA 1FOKA 3T5XA 3I53A 1B59A 4M9XA 3GWZA 4O5VA 1KYWA 1LDDA 2XAFA 1K78B 2ZMEB 5AIQA 4EM1A 4G6QA 1BI3A 4E70A 4S04A 3FXRA 2FBHA 2QBYB 3FMSA 3J81Z 3BDDA 3FM5A 3IC7A 5LEKA 4KA4A 2JZYA 3EETA 3Q9VA 1FYKA 3IRQA 4RB0A 4GXOA 1R58A 2HGCA 2W25A 3CJNA 4BAYA 2KJCA 3HRMA 4AIHA 3E97A 4YFNF 4PGGA 3ZP5A 3WGHA 5LBQA 1FX7A 1R23A 1XGMA 1T38A 2H6BA 4NQWA 3HOSA 5E20A 4HDVA 1C0WA 3E6DA 3NQOA 3M9AA 2HDCA 4BYYA 2K86A 1EH8A 2IPQX 4Q47A 4TV7A 1LEBA 2EFWA 5ICEA 2X4HA 2HKXA 1TW2A 4KMUX 5KK1A 2M87A 3R60A 2RVCA 3B73A 4WXCA 3ZMSA 3QOPA 4G7OF 4G7ZF 2OQRA 1BOAA 2ELHA 3E3VA 1ZREA 2DT5A 4I98B 1XB4A 4A5MA 3HHHA 3CUQB 2FQ3A 3QU6A 2HEOA 2O03A 2P5LC 1IN4A 1R1TA 1ZARA 4WK8F 3V7SA 3WTWC 3IHUA 2GXBA 4R79A 2HYFA 3FF5A 1XSXA 2VC1A 2VE9A 5CVRA 5LGTA 3WTXC 1JHHA 5H6RA 2V6CA 1RUOA 2VE8A 4PDKA 3ZN1A 2Z9OA 2BBYA 3V4GA 4NB5A 4H0EA 3GUDA 3EYYA 2MLKA 3KLNA 1L0OC 3I71A 1S6LA 3LA3A 2VOPA 2FU4A 4L0ZB 5BPDA 4GYIA 4Q4ZF 4A5NA 1BJAA 2R7FA 3V8KA 2GQQA 2D1HA 2FEZA 4UVCA 1P92A 4MEXF 3O3KA 2PN6A 1CF7A 4KMFA 3HSEA 4IPAA 4CO8A 1PP8F 2A6EF 5L3FA 2H94A 4A0YA 2HFHA 5E1WA 1YLFA 4L9TA 1RNLA 2G7UA 1ZG3A 2P8TA 2OZUA 3GVAA 2JT1A 5TRDA 1OYWA 2UWMA 3LA2A 1G3TA 3KEOA 3JSOA 2EV5A 5DCMA 1QZZA 1KQ9A 4BXUA 2MH2A 5LRRA 4RAYA 3JW4A 2CFXA 2ACJA 2F5FA 3LSTA 1RUNA 4UHTA 1W4MA 1X3UA 4KT5C 4M72A 3RDIA 2P6TA 4A6DA 5IT3A 4WF2A 2BEOA 5D4RA 3S2WA 3MZHA 4CICA 2YPRA 1FY7A 3M1EA 4BHCA 3FM3A 3I59A 5HOOA 2MC3A 3ZQ7A 4FHTA 3SXYA 3E6CC 1GXQA 3PQJA 1S7OA 1OYYA 4KUMA 4RGXA 1YIOA 4L5IA 1FYLA 2QLZA 2WWYA 5BS6A 3K9TA 1OKRA 2O61A 4CXFA 4LMYA 1EV7A 5A2QK 3ULQB 4Q48A 1ZN2A 1FYMA 4CYDA 3BOQA 1T0FA 5JFRA 4Z2YA 4XSXF 1LB2A 1R1VA 2VBWA 1O57A 4EJTA 1U5TC 5F6FA 1TNTA 1J5YA 2QYOA 1G4DA 4UV8A 3HYIA 3GFMA 1B9MA 2AS5F 1W5TA 2XV4S 3P9CA 3IWFA 5LGUA 1STZA 2DFIA 4OIQF 4Y13A 1WI9A 2QQ9A 4YFXF 2LKPA 1SMTA 2PG4A 4KIBA 2XAHA 4YIFA 3LFKA 4U0WA 3RI4A 3T8RA 3KZZA 2L4MA 3WTYC 3CUQA 1I1GA 1XMAA 2FF4A 1IAWA 5H20A 3L7WA 6PAXA 3JTHA 4WCGA 2LSOA 4I09A 1BI1A 3FHZA 2E1CA 3R6SA 5HS8A 3I4PA 1W7PA 3GLXA 2ISYA 3WE3A 2UXXA 4KN4X 3VODA 1T98A 1CGPA 2V1DA 4GO1A 3FX3A 2ZO4A 5JR3A 5DEQA 4EQQA 3DPTA 3QPTA 5KVRA 1ZRFA 4UVAA 4FX4A 3RPQA 3ZMZA 4M6XA 4OIRF 1FP1D 1XDUA 3GFLA 4EVIA 3LA7A 4LG0B 4MTEA 2E7XA 5J8CA 3WGIA 3COAC 3LAJA 1P4WA 2L02A 1FLIA 1HSTA 5JHUA 3DV8A 3QRFF 4ETSA 4L18B 4U0VA 5IT9K 2FOKA 1BI2A 1I6XA 1JXSA 1YYVA 5FD5A 2HKOA 4RS8A 3I0TA 5D8KB 5D5VB 1WSUA 2KKOA 2XASA 2OBPA 4ESJA 3KP5A 2CSOA 4U7BA 3M7GA 4A2UA 1I5ZA 3FMRA 1XGNA 2MLGA 1HKTA 4HAMA 3BWGA 4PZJA 4ZZLA 1O3RA 5E1ZB 1W7PD 4JBAA 1MJBA 3KP4A 1IXSB 4M73A 3F8FA 5LGNA 3H3ZA 2C6YA 2K7LA 1XCVA 4OIPF 5CVIA 1O7FA 3TDUC 4EV0A 4KFCA 3KP2A 4MHGA 3GZ5A 2MH9A 1TQPA 2FSWA 2EWNA 4R8HA 2RC4A 2DK8A 1BC8C 1TNSA 5D5XB 4QWQA 3MCZA 3ZMUA 3LAPA 2Z3YA 1XN7A 2STTA 2ZBKA 4ESFA 2ESHA 1ZAOA 1V3FA 2EK5A 4YG2F 2XKOA 5FO5A 2MA3A 4Q5SF 1KA8A 2HR3A 5D5WB 2L54A 3EUHA 3H92A 4LJZF 2YX7A 1FSHA 4LD5A 2G7HA 3G73A 5E8GA 1HKSA 4WX9A 5HDNA 2COMA 4P96A 4NHJA 3F6VA 4HDUA 4L9VA 3T8TA 4O6JA 5FD6A 3GFIA 2HOEA 1A04A 2PBIA 4HF2A 1S29A 1L3LA 1QPMA 3V7CA 3C3WA 4L9JA 4BHPA 3I59B 4EJWA 3MFKA 1YW9A 2LNBA 1ON1A 1V4RA 2QQBA 1B6AA 1O7LA 4KN7X 2GAUA 2F5CA 3KEQA 1HQCA 2IJLA 3BPXA 3MZYA 5ICFA 4GYGA 4KNYA 4ON0A 4CDGA 4EM0B 4EGZA 3GZ6A 5CVJA 3SZPA 1K78A 2Y48A 3HIFA 4KDPA 3E6MA 2IW5A 3SZTA 4UNOA 4B09A 5L3GA 5DUKA 5DCFA 5AIPA 2QQAA 2L4AA 2Y75A 1USTA 3U1DA 2YR2A 3TKYA 4UUVA 2XAJA 4RGUA 5EEGA 3ZMTA 1YS6A 2VONA 4MTDA 4HQMA 2HTSA 5HS7A 4U7DA 3RJPA 4IVNA 5LLQA 3GF2A 2XRNA 1TTYA 2XVCA 2D45A 1KYZA 5A2QZ 4N0BA 2FE3A 2O6GE 1XD7A 2ZNZA 4IF4A 2PEXA 3BJ6A 2DO7A 2BYVE 5K5QA 2Z5UA 3EYIA 1KQ0A 1J0RA 5K5RA 4HF0A 1HSJA 4AWXB 2X0LA 3VFZA 3HTSB 1CF7B 4MEYF 4I01A 2PJPA 1R22A 1DP7P 2CYYA 1OPCA 2KRFA 5AONA 4ZYDA 5L3DA 1D3YA 1P4XA 1LEAA 1S7AA 2P7CB 1HW1A 3F22A 4A12A 3U2RA 5BPIA 4OU0A 1Z9CA 1D8JA 4DQ2A 1BN5A 1OR7A 3HUGA 1J7KA 1TW3A 3M8FA 1ON2A 5DD8A 2XAQA 2MBFA 4P5OA 3PFIA 3HHGA 2HS5A 2M5WA 1ZH5A 1AWCA 2HQRA 5IT9Z 1UHMA 1LDJA 5ILUA 2JPBA 3EDPA 3ABUA 2KIFA 1YS7A 4O3MA 1BI0A 3TO9A 4YFKF 2NRAC 1XSDA 2NS0A 3RYPA 2P4WA 1IN5A 1BIAA 2GZWA 2PMUA 1LDKB 1BBYA 5BMZA 3ISPA 4HOBA 2ZJ2A 4YIIA 1FPQA 3WTTC 5D4SA 4Y17A 1R5GA 2D2WA 2OA4A 3T1BA 3GFJA 2F2EA 4HQEA 2M30A 2JSCA 1ZGJA 1G6NA 3ECOA 3R0AA 3FXQA 2Q2EA 3WGGA 2DAOA 2HTJA 3HOTA 1IXCA 2CG4A 4N9HA 2HWVA 3C18A 3JAMZ 1U5TA 2P7VB 1DUXC 1U6GA 1ONVA 3WTSC 4ZYGA 3CLOA 4HV6A 2QWWA 1IZ1A 3HRUA 5DYMA 2DQLA 1JE8A 4ENJA 2FMLA 2DU9A 4A0ZA 4XSZF 3N4MA 1REPC 1Q1HA 2EB7A 1KU3A 5HVQC 1HKQA 3LQQA 1TBXA 3CUQC 3M8EA 2CQKA 1SFEA 3HSRA 3QP6A 3IKTA 5DDGA 5ILSA 1K79A 4IRHA 3RPUA 1ZHFA 1YW7A 2VT2A 3KP6A 5DD4A 2K4JA 5TJJA 4KIGA 4RB3C 1USSA 2V1UA 4JQFA 2E7WA 1ODDA 4M6YA 5ED4A 4M9SA 2A61A 4EJVA 1ZLJA 3FXUA 1ZG1A 5CJ9A 3ROUA 3CO6C 4D0PA 2ZKZA 2PI0A 4MQ9F 2R3SA 3RKWA 4OINF 5BQTA 1NHAA 4UVBA 2W84A 2OQGA 2V9VA 2ZCWA 5E8IA 4OIOF 5FGMA 3W6JB 1MJ9A 3QAHA 2IT0A 3QPHA 5L3BA 3F6OA 1F9NA 1LVAA 1F4KA 1YFHA 4GGGA 2EV6A 2L3DA 5L3CA 1EH6A 1IW7F 1Z05A 2OAZA 3BJOA 3QU3A 4HZFA 3GEZA 1IN8A 5CLSA 4UXNA 4A0XA 4G8XA 1UFMA 3ERED 2EFPA 4LB6B 1ZRCA 4BHBA 1U78A 3IL2A 1XCBA 4RGSA 1TLHB 4KYWA 3WG9A 3O6BB 1E2XA 1BC7C 1ULYA 1K7AA 4N9IA 3K2ZA 4L0YB 3KZYA 1D8KA 2OD5A 4CZZA 3WE2A 3P9KA 1MGTA 4AVPA 1FBQA 3V8JA 4GCVA 3F8CA 1S3JA 2JPCA 5E1XA 3WTVC 4ESBA 2DI3A 3TGNA 1F1ZA 4HV5A 4L9NA 3EQLF 5FLXZ 3ZN0A 1KU7A 5LRSA 2PQ8A 1Z7UA 1Z6TA 2EA4A 2VBZA 1Z91A 2VBYA 1HBXG 2G9WA 3J80K 2FA5A 1PUEE 1FZPB 2P5KA 1ZG5A 2DK5A 4BNCA 1WRJA 3BP8A 3MWMA 4I02A 5HS9A 3KCCA 2M1BA 1IN6A 1UHWA 4B8XA 2V79A 2A6HF 3R4KA 1KQ8A 4LK0F 1QO0D 1O3QA 4G6DA 2QENA 2MD5A 3JTGA 2H27A 3CDHA 4IHSA 1U2WA 5HLGA 5CVUA 2OZ6A 2Q0OA 1W7PB 1B9NA 2WV0A 2BV6A 2IP2A 1I27A 4HA8A 4Y15A 2D1VA 3RIRA 2DBBA 4PGHA 5CYVA 4LB5A 4ENNA 3VEPA 1E17A 4IRGA 5DV5A 5HDKA 1R7JA 2NNYA 2M8EA 2NNNA 1K6OA 1VTNC 1FWZA 2ZMEA 4XLNF 1R00A 2H09A 3WODF 5E17F 2FBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FT9 A;  2J5P A;  5F64 A;  2GA1 A;  5FB2 A;  2XRO A;  4XLP F;  3GYH X;  2EFQ A;  1DDN A;  5D6F A;  2TDX A;  2R7D A;  1ZYR F;  1XGS A;  4ZH4 F;  1UCR A;  2LF7 A;  1MJA A;  2KJB A;  4G9Y A;  2CW0 F;  2XAG A;  1JHF A;  3R61 A;  4RB2 C;  4WXD A;  3I64 A;  1HXD A;  4I7H A;  1XSV A;  2ZFW A;  1MZB A;  3AAF A;  3IWZ A;  3V8L A;  3OV8 A;  2RQP A;  2P5V A;  2GIV A;  1SD7 A;  4JK1 X;  2K4B A;  3KE2 A;  2FXA A;  2L01 A;  2YX4 A;  3L09 A;  2VOD A;  3T0Y A;  3E5X A;  2RV8 A;  1BIB A;  2M45 A;  4AD9 A;  5F1R A;  1D5V A;  1JGS A;  1QGP A;  1LQ1 A;  2RNJ A;  2IA2 A;  2PMH A;  2F5D A;  1TQI A;  2Y0M A;  1B1B A;  2DPU A;  3KFW X;  3JAM K;  2DLL A;  3HRS A;  1XMK A;  1GVJ A;  2E1N A;  3I58 A;  2W24 A;  4EMS A;  1RZ4 A;  2QZ8 A;  3Q5F A;  4I0A A;  1YG2 A;  2BE5 F;  1ZRD A;  5L3E A;  3K1P A;  3ZMV A;  4K2E A;  2AXL A;  1SD6 A;  2UZK A;  2VT3 A;  2XKP A;  1YO5 C;  3W6K B;  1FC3 A;  3DXJ F;  2A68 F;  4FT8 A;  1AOY A;  4HYE A;  2RN7 A;  4LLG F;  3MQ0 A;  2A5Y B;  1ZLK A;  1QNT A;  1T2K A;  3B02 A;  1MDM A;  3DF8 A;  2NYX A;  2W57 A;  3I54 A;  4IXA A;  1IRF A;  1RI7 A;  4WXH A;  4HX8 A;  2GA2 A;  4HF1 A;  1SMY F;  2FRH A;  3K1M A;  1QBJ A;  3ELK A;  1Z1D A;  1GXP A;  3HSF A;  4G7H F;  4OOI A;  1Y0U A;  3BZ6 A;  1T39 A;  2EA2 A;  4ENK A;  1P6R A;  3NEU A;  4HLY A;  2NAZ A;  1OYI A;  3GW2 A;  1R36 A;  4LGW A;  3RKY A;  3FZV A;  5HLI A;  3OOP A;  4M74 A;  1IXR C;  4AIK A;  1GHC A;  3JSP A;  1MKM A;  2O3F A;  2F5E A;  2V1X A;  3DP7 A;  3FWE A;  2XHK A;  3BJA A;  3LQR A;  3F8B A;  5LHG A;  2XIG A;  4S05 A;  3MEX A;  1R5H A;  2XGX A;  2A69 F;  4XRF A;  4AIJ A;  1DPR A;  1U5T B;  3BRO A;  4BH9 A;  4IHT A;  5FFZ A;  2Z99 A;  4R1H A;  2OU2 A;  4HX7 A;  2ESN A;  2Z33 A;  3FMQ A;  2FNP A;  2DQR A;  5BOX A;  3F8M A;  2VN2 A;  2VBX A;  1P4A A;  2IRF G;  2ADU A;  5J8F A;  3J80 Z;  1YW8 A;  2P6S A;  4EJO A;  3F23 A;  2ISZ A;  4HBL A;  3CO7 C;  4IJA A;  4P55 A;  2LDU A;  2GXG A;  5DCM B;  1XDS A;  5ICC A;  4KIC A;  3SFZ A;  2O0Y A;  4EGY A;  2VOO A;  1G3S A;  2XUB A;  3E6B A;  3GXO A;  2O8X A;  4KIF A;  2JRT A;  5D6E A;  4P9F A;  4EJU A;  2B0L A;  2W85 A;  3F3X A;  1HW5 A;  1IUY A;  2IVM A;  2VXZ A;  4XBF A;  3WU1 B;  4HX4 A;  4I2O A;  2H6C A;  3L00 A;  5EEH A;  3VOE A;  4FX0 A;  5H6Q A;  3IRR A;  4UV9 A;  3ZMD A;  3GO5 A;  1YTY A;  4RAZ A;  3DFG A;  4M71 A;  3ECH A;  1FBU A;  3RYR A;  2QBY A;  4MQV A;  2RDP A;  4CHU A;  4OMZ A;  3J81 K;  1BM9 A;  3P7N A;  1OMI A;  3K0L A;  1KU2 A;  2UXN A;  2IA0 A;  4ASN A;  4G94 A;  5K1Y A;  3F72 A;  3GX4 X;  4PCQ A;  1SD5 A;  2WTE A;  2LF8 A;  4LLL A;  1U8R A;  5J6X A;  2EFN A;  2KIU A;  2DTR A;  1G3Y A;  3DKW A;  2STW A;  1KU9 A;  4M9Z A;  4F7Z A;  3Q9S A;  3BPV A;  1J75 A;  3F8N A;  1YQA A;  3L9F A;  3G3Z A;  5LHI A;  5FLX K;  1R1U A;  2J5O A;  2PFB A;  2FBK A;  1IN7 A;  1O3S A;  3HRT A;  3F21 A;  4U88 A;  2CGP A;  1S8N A;  1O3T A;  1DPU A;  1IF1 A;  1QZY A;  3E5U A;  4WWC A;  4MNU A;  3SQN A;  2Q8K A;  4ENM A;  5LEJ A;  4CGZ A;  3I5U A;  3KP7 A;  3L2C A;  2HQN A;  2A07 F;  5ILV A;  2ZXJ A;  1WQ2 A;  3ZPL A;  2CO5 A;  5K5O A;  1ZGA A;  3D0S A;  1W5S A;  5HDG A;  2WC2 A;  4ZZD A;  1FP2 A;  2CWE A;  2QM3 A;  4LG0 A;  3DQV C;  3C7J A;  2RGV A;  2JTV A;  1FNN A;  1J2X A;  2GWR A;  3DPL C;  5ICG A;  3D5L A;  1H0M A;  3R0J A;  2EJR A;  3K69 A;  2HYG D;  4L5J A;  1U3E M;  3K1N A;  1PDN C;  2RKH A;  1J59 A;  2K02 A;  4ZYH A;  2K27 A;  1G3W A;  1I1S A;  2BGC A;  1KGS A;  3TQN A;  4P9U A;  3WU0 A;  1IRG A;  2DPD A;  3NRV A;  2DW4 A;  5DUI A;  1SFU A;  1J9I A;  1H9T A;  1SFX A;  3CTA A;  4RB1 A;  4HW0 A;  4BQA A;  1FBS A;  2FNA A;  1WKM A;  2YU3 A;  4OMY A;  3ABT A;  1P2F A;  3P9I A;  1B4A A;  3O2P E;  4EM2 A;  5LHH A;  3H3U A;  3RTR A;  3KET A;  2A3S A;  2QUF A;  4DNC A;  3TO6 A;  3ML6 A;  1SD4 A;  3TOB A;  1MD0 A;  3N97 A;  2IA1 A;  3KLO A;  3WTZ A;  2QVO A;  3TO7 A;  4U0Y A;  3REO A;  1H9G A;  1LNW A;  3DEU A;  5JVT A;  1FSE A;  4IRI A;  4MGR A;  5D5U B;  1MDM B;  4HLX A;  3RKX A;  2ETH A;  2PLY A;  3SHF A;  3TDZ C;  3IKV A;  3KP3 A;  2KIM A;  2HZT A;  3MAJ A;  1LJ9 A;  4LLN A;  3PQK A;  1HW2 A;  5FFX A;  4QLC U;  2ZNY A;  3BY6 A;  3E5Q A;  1Z6R A;  3HTU A;  2EV0 A;  5E18 F;  4I0B A;  1EH7 A;  3CUO A;  1F5T A;  1RIO H;  1XGO A;  1TQM A;  1UB9 A;  2YSR A;  1PP7 U;  1T6S A;  2EFO A;  1SAX A;  3TOA A;  3U9G A;  3VB2 A;  4LFU A;  5D8L B;  5ERI A;  4LK1 F;  1WWX A;  3LWF A;  3C1D A;  2FMY A;  4RGR A;  3J7A O;  3WTU C;  3V7R A;  3QP5 A;  5CVV A;  2VC0 A;  5HLH A;  4ZYE A;  4A6E A;  5JI6 A;  1QQI A;  1FOK A;  3T5X A;  3I53 A;  1B59 A;  4M9X A;  3GWZ A;  4O5V A;  1KYW A;  1LDD A;  2XAF A;  1K78 B;  2ZME B;  5AIQ A;  4EM1 A;  4G6Q A;  1BI3 A;  4E70 A;  4S04 A;  3FXR A;  2FBH A;  2QBY B;  3FMS A;  3J81 Z;  3BDD A;  3FM5 A;  3IC7 A;  5LEK A;  4KA4 A;  2JZY A;  3EET A;  3Q9V A;  1FYK A;  3IRQ A;  4RB0 A;  4GXO A;  1R58 A;  2HGC A;  2W25 A;  3CJN A;  4BAY A;  2KJC A;  3HRM A;  4AIH A;  3E97 A;  4YFN F;  4PGG A;  3ZP5 A;  3WGH A;  5LBQ A;  1FX7 A;  1R23 A;  1XGM A;  1T38 A;  2H6B A;  4NQW A;  3HOS A;  5E20 A;  4HDV A;  1C0W A;  3E6D A;  3NQO A;  3M9A A;  2HDC A;  4BYY A;  2K86 A;  1EH8 A;  2IPQ X;  4Q47 A;  4TV7 A;  1LEB A;  2EFW A;  5ICE A;  2X4H A;  2HKX A;  1TW2 A;  4KMU X;  5KK1 A;  2M87 A;  3R60 A;  2RVC A;  3B73 A;  4WXC A;  3ZMS A;  3QOP A;  4G7O F;  4G7Z F;  2OQR A;  1BOA A;  2ELH A;  3E3V A;  1ZRE A;  2DT5 A;  4I98 B;  1XB4 A;  4A5M A;  3HHH A;  3CUQ B;  2FQ3 A;  3QU6 A;  2HEO A;  2O03 A;  2P5L C;  1IN4 A;  1R1T A;  1ZAR A;  4WK8 F;  3V7S A;  3WTW C;  3IHU A;  2GXB A;  4R79 A;  2HYF A;  3FF5 A;  1XSX A;  2VC1 A;  2VE9 A;  5CVR A;  5LGT A;  3WTX C;  1JHH A;  5H6R A;  2V6C A;  1RUO A;  2VE8 A;  4PDK A;  3ZN1 A;  2Z9O A;  2BBY A;  3V4G A;  4NB5 A;  4H0E A;  3GUD A;  3EYY A;  2MLK A;  3KLN A;  1L0O C;  3I71 A;  1S6L A;  3LA3 A;  2VOP A;  2FU4 A;  4L0Z B;  5BPD A;  4GYI A;  4Q4Z F;  4A5N A;  1BJA A;  2R7F A;  3V8K A;  2GQQ A;  2D1H A;  2FEZ A;  4UVC A;  1P92 A;  4MEX F;  3O3K A;  2PN6 A;  1CF7 A;  4KMF A;  3HSE A;  4IPA A;  4CO8 A;  1PP8 F;  2A6E F;  5L3F A;  2H94 A;  4A0Y A;  2HFH A;  5E1W A;  1YLF A;  4L9T A;  1RNL A;  2G7U A;  1ZG3 A;  2P8T A;  2OZU A;  3GVA A;  2JT1 A;  5TRD A;  1OYW A;  2UWM A;  3LA2 A;  1G3T A;  3KEO A;  3JSO A;  2EV5 A;  5DCM A;  1QZZ A;  1KQ9 A;  4BXU A;  2MH2 A;  5LRR A;  4RAY A;  3JW4 A;  2CFX A;  2ACJ A;  2F5F A;  3LST A;  1RUN A;  4UHT A;  1W4M A;  1X3U A;  4KT5 C;  4M72 A;  3RDI A;  2P6T A;  4A6D A;  5IT3 A;  4WF2 A;  2BEO A;  5D4R A;  3S2W A;  3MZH A;  4CIC A;  2YPR A;  1FY7 A;  3M1E A;  4BHC A;  3FM3 A;  3I59 A;  5HOO A;  2MC3 A;  3ZQ7 A;  4FHT A;  3SXY A;  3E6C C;  1GXQ A;  3PQJ A;  1S7O A;  1OYY A;  4KUM A;  4RGX A;  1YIO A;  4L5I A;  1FYL A;  2QLZ A;  2WWY A;  5BS6 A;  3K9T A;  1OKR A;  2O61 A;  4CXF A;  4LMY A;  1EV7 A;  5A2Q K;  3ULQ B;  4Q48 A;  1ZN2 A;  1FYM A;  4CYD A;  3BOQ A;  1T0F A;  5JFR A;  4Z2Y A;  4XSX F;  1LB2 A;  1R1V A;  2VBW A;  1O57 A;  4EJT A;  1U5T C;  5F6F A;  1TNT A;  1J5Y A;  2QYO A;  1G4D A;  4UV8 A;  3HYI A;  3GFM A;  1B9M A;  2AS5 F;  1W5T A;  2XV4 S;  3P9C A;  3IWF A;  5LGU A;  1STZ A;  2DFI A;  4OIQ F;  4Y13 A;  1WI9 A;  2QQ9 A;  4YFX F;  2LKP A;  1SMT A;  2PG4 A;  4KIB A;  2XAH A;  4YIF A;  3LFK A;  4U0W A;  3RI4 A;  3T8R A;  3KZZ A;  2L4M A;  3WTY C;  3CUQ A;  1I1G A;  1XMA A;  2FF4 A;  1IAW A;  5H20 A;  3L7W A;  6PAX A;  3JTH A;  4WCG A;  2LSO A;  4I09 A;  1BI1 A;  3FHZ A;  2E1C A;  3R6S A;  5HS8 A;  3I4P A;  1W7P A;  3GLX A;  2ISY A;  3WE3 A;  2UXX A;  4KN4 X;  3VOD A;  1T98 A;  1CGP A;  2V1D A;  4GO1 A;  3FX3 A;  2ZO4 A;  5JR3 A;  5DEQ A;  4EQQ A;  3DPT A;  3QPT A;  5KVR A;  1ZRF A;  4UVA A;  4FX4 A;  3RPQ A;  3ZMZ A;  4M6X A;  4OIR F;  1FP1 D;  1XDU A;  3GFL A;  4EVI A;  3LA7 A;  4LG0 B;  4MTE A;  2E7X A;  5J8C A;  3WGI A;  3COA C;  3LAJ A;  1P4W A;  2L02 A;  1FLI A;  1HST A;  5JHU A;  3DV8 A;  3QRF F;  4ETS A;  4L18 B;  4U0V A;  5IT9 K;  2FOK A;  1BI2 A;  1I6X A;  1JXS A;  1YYV A;  5FD5 A;  2HKO A;  4RS8 A;  3I0T A;  5D8K B;  5D5V B;  1WSU A;  2KKO A;  2XAS A;  2OBP A;  4ESJ A;  3KP5 A;  2CSO A;  4U7B A;  3M7G A;  4A2U A;  1I5Z A;  3FMR A;  1XGN A;  2MLG A;  1HKT A;  4HAM A;  3BWG A;  4PZJ A;  4ZZL A;  1O3R A;  5E1Z B;  1W7P D;  4JBA A;  1MJB A;  3KP4 A;  1IXS B;  4M73 A;  3F8F A;  5LGN A;  3H3Z A;  2C6Y A;  2K7L A;  1XCV A;  4OIP F;  5CVI A;  1O7F A;  3TDU C;  4EV0 A;  4KFC A;  3KP2 A;  4MHG A;  3GZ5 A;  2MH9 A;  1TQP A;  2FSW A;  2EWN A;  4R8H A;  2RC4 A;  2DK8 A;  1BC8 C;  1TNS A;  5D5X B;  4QWQ A;  3MCZ A;  3ZMU A;  3LAP A;  2Z3Y A;  1XN7 A;  2STT A;  2ZBK A;  4ESF A;  2ESH A;  1ZAO A;  1V3F A;  2EK5 A;  4YG2 F;  2XKO A;  5FO5 A;  2MA3 A;  4Q5S F;  1KA8 A;  2HR3 A;  5D5W B;  2L54 A;  3EUH A;  3H92 A;  4LJZ F;  2YX7 A;  1FSH A;  4LD5 A;  2G7H A;  3G73 A;  5E8G A;  1HKS A;  4WX9 A;  5HDN A;  2COM A;  4P96 A;  4NHJ A;  3F6V A;  4HDU A;  4L9V A;  3T8T A;  4O6J A;  5FD6 A;  3GFI A;  2HOE A;  1A04 A;  2PBI A;  4HF2 A;  1S29 A;  1L3L A;  1QPM A;  3V7C A;  3C3W A;  4L9J A;  4BHP A;  3I59 B;  4EJW A;  3MFK A;  1YW9 A;  2LNB A;  1ON1 A;  1V4R A;  2QQB A;  1B6A A;  1O7L A;  4KN7 X;  2GAU A;  2F5C A;  3KEQ A;  1HQC A;  2IJL A;  3BPX A;  3MZY A;  5ICF A;  4GYG A;  4KNY A;  4ON0 A;  4CDG A;  4EM0 B;  4EGZ A;  3GZ6 A;  5CVJ A;  3SZP A;  1K78 A;  2Y48 A;  3HIF A;  4KDP A;  3E6M A;  2IW5 A;  3SZT A;  4UNO A;  4B09 A;  5L3G A;  5DUK A;  5DCF A;  5AIP A;  2QQA A;  2L4A A;  2Y75 A;  1UST A;  3U1D A;  2YR2 A;  3TKY A;  4UUV A;  2XAJ A;  4RGU A;  5EEG A;  3ZMT A;  1YS6 A;  2VON A;  4MTD A;  4HQM A;  2HTS A;  5HS7 A;  4U7D A;  3RJP A;  4IVN A;  5LLQ A;  3GF2 A;  2XRN A;  1TTY A;  2XVC A;  2D45 A;  1KYZ A;  5A2Q Z;  4N0B A;  2FE3 A;  2O6G E;  1XD7 A;  2ZNZ A;  4IF4 A;  2PEX A;  3BJ6 A;  2DO7 A;  2BYV E;  5K5Q A;  2Z5U A;  3EYI A;  1KQ0 A;  1J0R A;  5K5R A;  4HF0 A;  1HSJ A;  4AWX B;  2X0L A;  3VFZ A;  3HTS B;  1CF7 B;  4MEY F;  4I01 A;  2PJP A;  1R22 A;  1DP7 P;  2CYY A;  1OPC A;  2KRF A;  5AON A;  4ZYD A;  5L3D A;  1D3Y A;  1P4X A;  1LEA A;  1S7A A;  2P7C B;  1HW1 A;  3F22 A;  4A12 A;  3U2R A;  5BPI A;  4OU0 A;  1Z9C A;  1D8J A;  4DQ2 A;  1BN5 A;  1OR7 A;  3HUG A;  1J7K A;  1TW3 A;  3M8F A;  1ON2 A;  5DD8 A;  2XAQ A;  2MBF A;  4P5O A;  3PFI A;  3HHG A;  2HS5 A;  2M5W A;  1ZH5 A;  1AWC A;  2HQR A;  5IT9 Z;  1UHM A;  1LDJ A;  5ILU A;  2JPB A;  3EDP A;  3ABU A;  2KIF A;  1YS7 A;  4O3M A;  1BI0 A;  3TO9 A;  4YFK F;  2NRA C;  1XSD A;  2NS0 A;  3RYP A;  2P4W A;  1IN5 A;  1BIA A;  2GZW A;  2PMU A;  1LDK B;  1BBY A;  5BMZ A;  3ISP A;  4HOB A;  2ZJ2 A;  4YII A;  1FPQ A;  3WTT C;  5D4S A;  4Y17 A;  1R5G A;  2D2W A;  2OA4 A;  3T1B A;  3GFJ A;  2F2E A;  4HQE A;  2M30 A;  2JSC A;  1ZGJ A;  1G6N A;  3ECO A;  3R0A A;  3FXQ A;  2Q2E A;  3WGG A;  2DAO A;  2HTJ A;  3HOT A;  1IXC A;  2CG4 A;  4N9H A;  2HWV A;  3C18 A;  3JAM Z;  1U5T A;  2P7V B;  1DUX C;  1U6G A;  1ONV A;  3WTS C;  4ZYG A;  3CLO A;  4HV6 A;  2QWW A;  1IZ1 A;  3HRU A;  5DYM A;  2DQL A;  1JE8 A;  4ENJ A;  2FML A;  2DU9 A;  4A0Z A;  4XSZ F;  3N4M A;  1REP C;  1Q1H A;  2EB7 A;  1KU3 A;  5HVQ C;  1HKQ A;  3LQQ A;  1TBX A;  3CUQ C;  3M8E A;  2CQK A;  1SFE A;  3HSR A;  3QP6 A;  3IKT A;  5DDG A;  5ILS A;  1K79 A;  4IRH A;  3RPU A;  1ZHF A;  1YW7 A;  2VT2 A;  3KP6 A;  5DD4 A;  2K4J A;  5TJJ A;  4KIG A;  4RB3 C;  1USS A;  2V1U A;  4JQF A;  2E7W A;  1ODD A;  4M6Y A;  5ED4 A;  4M9S A;  2A61 A;  4EJV A;  1ZLJ A;  3FXU A;  1ZG1 A;  5CJ9 A;  3ROU A;  3CO6 C;  4D0P A;  2ZKZ A;  2PI0 A;  4MQ9 F;  2R3S A;  3RKW A;  4OIN F;  5BQT A;  1NHA A;  4UVB A;  2W84 A;  2OQG A;  2V9V A;  2ZCW A;  5E8I A;  4OIO F;  5FGM A;  3W6J B;  1MJ9 A;  3QAH A;  2IT0 A;  3QPH A;  5L3B A;  3F6O A;  1F9N A;  1LVA A;  1F4K A;  1YFH A;  4GGG A;  2EV6 A;  2L3D A;  5L3C A;  1EH6 A;  1IW7 F;  1Z05 A;  2OAZ A;  3BJO A;  3QU3 A;  4HZF A;  3GEZ A;  1IN8 A;  5CLS A;  4UXN A;  4A0X A;  4G8X A;  1UFM A;  3ERE D;  2EFP A;  4LB6 B;  1ZRC A;  4BHB A;  1U78 A;  3IL2 A;  1XCB A;  4RGS A;  1TLH B;  4KYW A;  3WG9 A;  3O6B B;  1E2X A;  1BC7 C;  1ULY A;  1K7A A;  4N9I A;  3K2Z A;  4L0Y B;  3KZY A;  1D8K A;  2OD5 A;  4CZZ A;  3WE2 A;  3P9K A;  1MGT A;  4AVP A;  1FBQ A;  3V8J A;  4GCV A;  3F8C A;  1S3J A;  2JPC A;  5E1X A;  3WTV C;  4ESB A;  2DI3 A;  3TGN A;  1F1Z A;  4HV5 A;  4L9N A;  3EQL F;  5FLX Z;  3ZN0 A;  1KU7 A;  5LRS A;  2PQ8 A;  1Z7U A;  1Z6T A;  2EA4 A;  2VBZ A;  1Z91 A;  2VBY A;  1HBX G;  2G9W A;  3J80 K;  2FA5 A;  1PUE E;  1FZP B;  2P5K A;  1ZG5 A;  2DK5 A;  4BNC A;  1WRJ A;  3BP8 A;  3MWM A;  4I02 A;  5HS9 A;  3KCC A;  2M1B A;  1IN6 A;  1UHW A;  4B8X A;  2V79 A;  2A6H F;  3R4K A;  1KQ8 A;  4LK0 F;  1QO0 D;  1O3Q A;  4G6D A;  2QEN A;  2MD5 A;  3JTG A;  2H27 A;  3CDH A;  4IHS A;  1U2W A;  5HLG A;  5CVU A;  2OZ6 A;  2Q0O A;  1W7P B;  1B9N A;  2WV0 A;  2BV6 A;  2IP2 A;  1I27 A;  4HA8 A;  4Y15 A;  2D1V A;  3RIR A;  2DBB A;  4PGH A;  5CYV A;  4LB5 A;  4ENN A;  3VEP A;  1E17 A;  4IRG A;  5DV5 A;  5HDK A;  1R7J A;  2NNY A;  2M8E A;  2NNN A;  1K6O A;  1VTN C;  1FWZ A;  2ZME A;  4XLN F;  1R00 A;  2H09 A;  3WOD F;  5E17 F;  2FBI A; 
#chains in the Genus database with same CATH topology
 1UEL B;  1FT9 A;  3LMM A;  2XPU A;  1Z77 A;  2J5P A;  5F64 A;  4YIR X;  2BVM A;  2GA1 A;  5FB2 A;  2XRO A;  2VJ5 A;  4XLP F;  1A35 A;  3GYH X;  4ZDO A;  2K9L A;  2EFQ A;  1WZ2 A;  1DDN A;  2LOO A;  5J1U A;  4ZJZ A;  5D6F A;  1W5C C;  3VWB A;  2TDX A;  3BCB A;  2R7D A;  1ZYR F;  3IAS 2;  3VYU B;  1XGS A;  4ZH4 F;  3RQI A;  1PYV A;  1WJA A;  1N25 A;  4DZP A;  3PJR A;  4X1E A;  3VYT B;  1UCR A;  2LF7 A;  1MJA A;  3G71 I;  2MAB A;  2KJB A;  3DCF A;  3DTK A;  3FXO A;  4G9Y A;  4C3J J;  1AHD P;  2CW0 F;  2XAG A;  3BR5 A;  1JHF A;  3R61 A;  5E3O A;  4RB2 C;  2W82 A;  2K9N A;  3K7A J;  4HNU A;  4FTH A;  4WXD A;  4CH7 A;  3I64 A;  1HXD A;  4I7H A;  1XSV A;  2ZFW A;  2R5Y A;  1MZB A;  3AAF A;  4ZDP A;  3IWZ A;  1RRJ A;  2R93 J;  1I6H J;  3V8L A;  1SFK A;  3OV8 A;  1JT6 A;  2RQP A;  2X85 A;  4G12 A;  2V6E A;  2P5V A;  2DA5 A;  2VKH A;  3IAM 2;  5IOY A;  4J01 A;  1SD7 A;  2GIV A;  1W36 C;  2JJ7 A;  3CJR B;  4I6Z A;  1R4N B;  1Z21 A;  4JK1 X;  2K4B A;  3E7L A;  2L7M P;  3WHB A;  3KE2 A;  2FQ4 A;  2FXA A;  2L01 A;  2X6X A;  1UG2 A;  2KT0 A;  3BQZ A;  2WB1 A;  2IAI A;  2YX4 A;  1RKT A;  3L09 A;  2VOD A;  4HG2 A;  3T0Y A;  3E5X A;  2RV8 A;  1WFX A;  1BIB A;  2M45 A;  4AD9 A;  5F1R A;  4HSR A;  1D5V A;  1MMA A;  1JGS A;  3ZQL A;  1QGP A;  1LQ1 A;  3K4B A;  2RNJ A;  2VJJ A;  1DGW Y;  4FCY A;  3W2A A;  1V5F A;  1F43 A;  4OAY A;  5GAG J;  2HVQ A;  1BW6 A;  2IA2 A;  4A3K J;  2KHM A;  1A6Q A;  2BY3 A;  4BDY A;  2PMH A;  2QCO A;  2F5D A;  1R6R A;  1TQI A;  1TWG J;  1S5L C;  4Y7N J;  4V2G A;  1CQT A;  2Y0M A;  1B1B A;  3S93 A;  2DPU A;  2Z16 A;  3KFW X;  1IDZ A;  1OCZ H;  3JAM K;  2DLL A;  3HRS A;  2WY8 Q;  3BTJ A;  1YX5 A;  1XMK A;  3CDL A;  4PJM A;  4PJL A;  1GVJ A;  1A36 A;  2E1N A;  3I58 A;  2W24 A;  4PFP A;  4EMS A;  1RZ4 A;  1KON A;  2QZ8 A;  3Q5F A;  4I0A A;  3CCQ I;  3KYC B;  1ETK A;  2VXD A;  3JRD A;  1YG2 A;  5FRO A;  2BE5 F;  1ZRD A;  2VQG A;  5L3E A;  1RPW A;  3G2B A;  3K4L A;  2OTL I;  3K1P A;  2LP0 A;  3ZMV A;  2WY7 Q;  4K2E A;  5F1J A;  2NVQ J;  3HL2 A;  2AXL A;  3RPU D;  2LMD A;  3OYA A;  3S16 J;  2V26 A;  1SD6 A;  2UZK A;  2VT3 A;  2XKP A;  2ZXH A;  1YO5 C;  3W6K B;  2I8D A;  1FC3 A;  3DXJ F;  3H9J A;  2A68 F;  2PMZ A;  4FT8 A;  1AOY A;  4HYE A;  2RN7 A;  4LLG F;  3MQ0 A;  4B43 A;  2A5Y B;  1ZKG A;  1ZLK A;  1QNT A;  4DBR A;  1T2K A;  3PNT A;  4I99 C;  3B02 A;  3H5R A;  3DF8 A;  1MDM A;  3OWT A;  2QSG X;  2NYX A;  2W57 A;  4F52 A;  3I54 A;  4IXA A;  4A69 C;  3FBI B;  2X6Y A;  1IRF A;  1RI7 A;  5E3M A;  2X51 A;  4WXH A;  4HX8 A;  3TL4 X;  2GA2 A;  4HF1 A;  3Q0W A;  1SMY F;  2FRH A;  3K1M A;  2V9K A;  2DA3 A;  2WAE A;  1I50 J;  1QBJ A;  5FKO A;  3ELK A;  1Z1D A;  1GXP A;  3HSF A;  4G7H F;  3OYL A;  2LRE A;  2OTJ I;  2E19 A;  4OOI A;  1Y0U A;  3L2U A;  3BZ6 A;  1T39 A;  2EA2 A;  4XKB A;  3JRG A;  2JVG A;  4BDZ A;  4ENK A;  1P6R A;  3S2D J;  3NEU A;  4HLY A;  2NAZ A;  1WVR A;  5B3S H;  4JX5 A;  1OYI A;  3GW2 A;  1R36 A;  4LGW A;  1ERD A;  3RKY A;  4DBQ A;  4A3I J;  2ICW G;  3U1K A;  4EAT A;  3FZV A;  3IUO A;  2R4G A;  5HLI A;  3S1N J;  3OOP A;  4M74 A;  1IXR C;  3A4C A;  2DT6 A;  4AIK A;  1GHC A;  1HCR A;  2JA8 J;  3JSP A;  1MKM A;  2Y9Z A;  2B9S A;  3ASN H;  1RR8 C;  2I10 A;  4XKV A;  2O3F A;  1MNM C;  2F5E A;  2V1X A;  3GTG J;  3DP7 A;  3FWE A;  3S1R J;  5M5Y J;  5F0H A;  2XHK A;  3BJA A;  1PUF B;  3LQR A;  3F8B A;  5LHG A;  2CH0 A;  2XIG A;  4S05 A;  3MEX A;  1R5H A;  4IEJ A;  4DOZ A;  2XGX A;  2E1M C;  2F4M B;  2A69 F;  4XRF A;  3HOX J;  4AIJ A;  5EGO B;  1DPR A;  1U5T B;  2VAS A;  3BRO A;  1Y8Q B;  4BH9 A;  4IHT A;  5FFZ A;  4EEF G;  2IBD A;  2Z99 A;  4R1H A;  4XID A;  2OU2 A;  1BJZ A;  3ABK H;  5M5W J;  4HX7 A;  2LY1 A;  2ESN A;  2Z33 A;  3FMQ A;  4XL9 A;  2FNP A;  3FHN A;  2DQR A;  5BOX A;  2M8G X;  1MND A;  5FLV A;  3FXM A;  3F8M A;  2VN2 A;  2VBX A;  1P4A A;  2IRF G;  2ADU A;  5J8F A;  2CMP A;  1Y56 A;  4RM2 A;  2H1L A;  3RCO A;  1VQK I;  3J80 Z;  1YW8 A;  1ZQ3 P;  2P6S A;  4EJO A;  3F23 A;  2ISZ A;  2XF5 A;  3DBR B;  4PSX A;  1P9Q C;  1U0J A;  4HBL A;  2DCE A;  3CO7 C;  4M3D A;  4IJA A;  4P55 A;  2LDU A;  2GXG A;  1WI3 A;  5DCM B;  3IH2 A;  1XDS A;  2DOD A;  5ICC A;  1Z0X A;  2CW7 A;  1FJL A;  4KIC A;  3SFZ A;  2O0Y A;  3S32 A;  4XRS G;  4EGY A;  4H4K C;  5KHD A;  2VOO A;  1G3S A;  2XUB A;  3E6B A;  2WV1 A;  3I55 I;  3GXO A;  2O8X A;  1WJE A;  4KIF A;  1HDP A;  2BZT A;  2JRT A;  1G59 A;  5D6E A;  4P9F A;  1V5E A;  2E35 A;  4EJU A;  2B0L A;  2W85 A;  1LFP A;  1MSE C;  3F3X A;  4IOA F;  1HW5 A;  1TL8 A;  1IUY A;  2IVM A;  2VXZ A;  4XBF A;  4BEH B;  1O4X A;  3WU1 B;  4HX4 A;  4E7H A;  2AQE A;  1Z67 A;  2H6C A;  2HXI A;  4I2O A;  1QVU A;  1YIT I;  3L00 A;  2W4S A;  5EEH A;  3VOE A;  4FX0 A;  4RLQ A;  5E3L A;  2DDA A;  5H6Q A;  3IRR A;  4UV9 A;  2GLO A;  3ZMD A;  3GO5 A;  1YTY A;  5GAH J;  4RAZ A;  3DFG A;  4AVZ A;  2CV2 A;  3AG2 H;  3ECH A;  4M71 A;  1R49 A;  1FIA A;  1FBU A;  3RYR A;  2QBY A;  1TZL A;  2L7K A;  2A6T A;  2ZB9 A;  3GTO J;  4MQV A;  2RDP A;  4CHU A;  5FKK A;  4OMZ A;  4AYB A;  3J81 K;  3CCM I;  3M4O J;  4XLE A;  4RM3 A;  1BM9 A;  9ANT A;  3P7N A;  1OMI A;  3K0L A;  1KU2 A;  2UXN A;  1G8X A;  2KZG A;  2IA0 A;  4II3 A;  4ASN A;  1UJ8 A;  3K10 A;  2DN0 A;  4G94 A;  5K1Y A;  3F72 A;  2O7O A;  2K3F A;  2XF7 A;  3GX4 X;  3CCS I;  4PCQ A;  1SD5 A;  5C44 J;  2WTE A;  2LF8 A;  1UMQ A;  4LLL A;  1U8R A;  4HNV A;  2G0E A;  5J6X A;  2EFN A;  1FOX A;  2KIU A;  4DYR A;  2DTR A;  1SEU A;  4HRI A;  2LLK A;  2BW3 B;  1T95 A;  1G3Y A;  3A2K A;  3DKW A;  4A3J J;  2STW A;  1KU9 A;  3F0C A;  4M9Z A;  4F7Z A;  3Q9S A;  3LSM A;  3K6G A;  2NS7 A;  1ETX A;  3BPV A;  3O8H A;  1J75 A;  5FJ8 J;  2E1O A;  3F8N A;  1YQA A;  3L9F A;  3OIQ A;  2DMU A;  3G3Z A;  5LHI A;  3S1Q J;  5FLX K;  1R1U A;  2J5O A;  5CPR B;  1ITY A;  2PFB A;  2X48 A;  3DBH B;  1E3P A;  2HOS A;  2FBK A;  1IN7 A;  4IHV A;  2QF7 A;  3LSH A;  1O3S A;  1A6I A;  2KIQ A;  1RKW A;  3HRT A;  3F21 A;  2GOX B;  4U88 A;  1IC8 A;  2KL4 A;  3B6A A;  3LSG A;  2WA0 A;  1KZH A;  3PUF A;  3UR3 C;  4XON A;  2CGP A;  2VKD A;  1S8N A;  1O3T A;  1DPU A;  2OPT A;  3H9G A;  1IF1 A;  1QZY A;  1PUF A;  3E5U A;  4WWC A;  4MNU A;  3SQN A;  2Q8K A;  4ENM A;  2ID3 A;  5LEJ A;  4CGZ A;  2DA7 A;  3PUB A;  5FKL A;  3I5U A;  3K4M A;  3KP7 A;  3HBL A;  2Q1Z B;  3L2C A;  1GVD A;  2HQN A;  2A07 F;  4AID A;  5ILV A;  2ZXJ A;  1WQ2 A;  1SFO J;  2CO5 A;  3ZPL A;  3FK7 A;  5K5O A;  1ZGA A;  3D5R C;  2NVY J;  3D0S A;  1W5S A;  5HDG A;  2WC2 A;  4ZZD A;  1FP2 A;  2CWE A;  5EEA A;  1JUS A;  2QM3 A;  4QIW N;  4LG0 A;  3DQV C;  2EIK H;  3C7J A;  3TW6 A;  2RGV A;  5B1B H;  2IXS A;  4E6K G;  2JTV A;  1FNN A;  1J2X A;  3CLQ A;  5IP6 A;  2GWR A;  4BGD A;  3DPL C;  5ICG A;  3D5L A;  1B8I B;  1H0M A;  3R0J A;  2DYS H;  1DP3 A;  2X1C A;  2M0M A;  2EJR A;  3K69 A;  2MYS A;  2HYG D;  4L5J A;  1U3E M;  3ZQC A;  3OYH A;  3K1N A;  3H0G J;  2E2I J;  4I76 A;  1MBE A;  2E34 A;  1T33 A;  5EGO A;  1PDN C;  2RKH A;  3LSJ A;  1J59 A;  2ZXI A;  4JYK A;  4BJ5 C;  2K02 A;  4ZYH A;  1SVL A;  2K27 A;  4II2 A;  1D1B A;  5GAE J;  4A93 J;  1Y8R B;  4JP0 A;  1G3W A;  1NH3 A;  1I1S A;  1EJ9 A;  1XPX A;  2BGC A;  1KGS A;  3TQN A;  4E7K A;  4P9U A;  3VYR B;  4E7L A;  3BQY A;  3WU0 A;  1IRG A;  2EZI A;  2DPD A;  3NRV A;  2LKX A;  2DW4 A;  2K85 A;  5DUI A;  2DJI A;  1SFU A;  5LFA A;  3LL7 A;  1J9I A;  4E7Z A;  1H9T A;  3H9Q A;  2LH9 A;  1SFX A;  3CTA A;  4RB1 A;  3JRH A;  3H0D A;  4HW0 A;  2CV0 A;  4CZC A;  4BQA A;  4UB8 C;  2PMZ N;  1SAU A;  1FBS A;  1YHQ I;  1K4T A;  2FNA A;  1WKM A;  2YU3 A;  4OMY A;  3ABT A;  1FOY A;  1P2F A;  1B4A A;  3P9I A;  3O2P E;  4EM2 A;  5LHH A;  3H3U A;  3RTR A;  3KET A;  2A3S A;  2CJJ A;  3OS0 A;  2QUF A;  2JN6 A;  1H8A C;  4DNC A;  3J7A Y;  3TO6 A;  3ML6 A;  1SD4 A;  3TOB A;  4AYB N;  1YJ9 I;  1MD0 A;  3ZXS A;  3N97 A;  2IA1 A;  2GM4 A;  3KLO A;  3WTZ A;  3S3N A;  2QVO A;  3TO7 A;  3CME I;  1B72 A;  1V54 H;  5H2F C;  4U0Y A;  4JOM A;  1VQ4 I;  3REO A;  1H9G A;  1LNW A;  3CP8 A;  3DEU A;  1FSE A;  5JVT A;  1K61 A;  1W0T A;  1MIJ A;  4IRI A;  4MGR A;  2V4J C;  2XRL A;  5D5U B;  4XLC A;  3BTC A;  1MDM B;  4HLX A;  2XGC A;  2L9V A;  3LNQ A;  2CUE A;  3KYD B;  2R7Z J;  3RKX A;  2ETH A;  2CFO A;  2JQ7 A;  1NK2 P;  2PLY A;  3HKZ A;  3SHF A;  3TDZ C;  2AXT C;  3IKV A;  3KP3 A;  2KIM A;  2HZT A;  3MAJ A;  1VQ8 I;  5FLM J;  1OLT A;  1LJ9 A;  4Y33 A;  4LLN A;  3PQK A;  1HW2 A;  2HOT A;  3BR1 A;  5FFX A;  4QLC U;  3WG7 H;  2LKS A;  2ZNY A;  2GBY A;  3JRB A;  3BY6 A;  5IYD J;  2MGQ A;  3E5Q A;  5K7H A;  1Z6R A;  3HTU A;  4C2T A;  1BL0 A;  2EV0 A;  5E18 F;  4I0B A;  3RQ4 A;  1EH7 A;  3JR9 A;  1BW5 A;  1ETV A;  3CUO A;  1RIO H;  1F5T A;  4F3Q A;  1XGO A;  1TQM A;  1UB9 A;  1U8B A;  2R5Z A;  3N05 A;  2YSR A;  1JKP C;  1PP7 U;  1T6S A;  2EFO A;  4QPQ A;  1SAX A;  1X1A A;  3TOA A;  3U9G A;  1MBF A;  4CCN A;  3VB2 A;  1MBH A;  3Q3S A;  4C2M J;  2BOL A;  1PJR A;  2K40 A;  4LFU A;  5D8L B;  4QPO A;  1VFC A;  5ERI A;  2DA4 A;  4LK1 F;  1WWX A;  1JTY A;  3LWF A;  4BAC A;  2E2H J;  2TRT A;  3SDG A;  3AL0 B;  3C1D A;  1QVT A;  2DMT A;  2FMY A;  4RGR A;  4PK4 A;  3J7A O;  1TWH J;  3WTU C;  3V7R A;  3QP5 A;  3DEE A;  5CVV A;  2VC0 A;  5HLH A;  2DMP A;  2AQF A;  4ZC3 A;  4HPQ A;  4B48 A;  4ZYE A;  2BY1 A;  3QYE A;  4A6E A;  2JA6 J;  3OR2 C;  5JI6 A;  2RRE A;  2W1O A;  1QQI A;  2W00 A;  3T5X A;  1FOK A;  3I53 A;  1B59 A;  1XC5 A;  4M9X A;  3GWZ A;  1JKO C;  4O5V A;  1KYW A;  1LDD A;  5J47 A;  2XAF A;  1K78 B;  2ZME B;  5AIQ A;  3OYB A;  1TP4 A;  4EM1 A;  3RZD J;  4G6Q A;  2HVR A;  1BI3 A;  1K6Y A;  1MMN A;  3C2B A;  4E70 A;  5IYB J;  4S04 A;  3FXR A;  2FBH A;  2QBY B;  2O9L A;  4IO9 F;  3FMS A;  3CC4 I;  3J81 Z;  4BE1 A;  2R7S A;  1DGR M;  3BDD A;  4BY7 J;  3FM5 A;  3IC7 A;  4X6A J;  4F55 A;  5LEK A;  1QZE A;  2JZY A;  4KA4 A;  1VQM I;  3EET A;  3Q9V A;  4DIQ A;  1FYK A;  4PJJ A;  3IRQ A;  4RB0 A;  1Q1V A;  4GXO A;  1D0X A;  1R58 A;  2W25 A;  1ETY A;  2HGC A;  1Y1V J;  1MSF C;  3CJN A;  4BAY A;  2KJC A;  3HRM A;  4AIH A;  1R5I D;  3E97 A;  4YFN F;  4PGG A;  5K7Z A;  3ZP5 A;  2VB6 A;  3WGH A;  5LBQ A;  1FX7 A;  1R23 A;  1XGM A;  1T38 A;  2H6B A;  2VPL A;  1I3Q J;  4NQW A;  3PM1 A;  3HOS A;  5E20 A;  2VIX A;  3L2R A;  2IS2 A;  4HDV A;  1C0W A;  4RLF A;  3E6D A;  4S0H B;  3NQO A;  3OYF A;  1WJ5 A;  5DS9 A;  2JA2 A;  3CCY A;  3M9A A;  2HDC A;  2DOE A;  2M7A A;  2K86 A;  3KPH A;  4BYY A;  1Z3Y A;  1EH8 A;  3A01 A;  2IPQ X;  3O8G A;  4Q47 A;  4TV7 A;  1LEB A;  2EFW A;  2DYR H;  3HOZ J;  4KIS A;  5ICE A;  2X4H A;  2HKX A;  1TW2 A;  2M4G A;  4KMU X;  2M87 A;  5KK1 A;  3R60 A;  2RVC A;  2NS8 A;  4AM3 A;  4XNF A;  3AG4 H;  2HDD A;  3B73 A;  2VI6 A;  4BQO A;  4WXC A;  3VDX A;  2ZJR F;  3ZMS A;  3QOP A;  1IG7 A;  4G7O F;  1FIP A;  2LVS A;  2LYC A;  4G7Z F;  1Y6I A;  2OQR A;  1ZR2 A;  1BOA A;  3KEY A;  2H8R A;  2AHQ A;  2ELH A;  3E3V A;  3RZO J;  1WH5 A;  3PIP F;  3VSL A;  2HI3 A;  1ZRE A;  3D1N I;  2DT5 A;  2KP6 A;  1XB4 A;  4I98 B;  4A3C J;  3Q0U A;  2NOG A;  4A5M A;  2JUG A;  3OL4 A;  5IYC J;  3HHH A;  3CUQ B;  2FQ3 A;  3QU6 A;  2HEO A;  2O03 A;  2P5L C;  2E60 A;  3LFU A;  1IN4 A;  1GT0 C;  2L9R A;  1R1T A;  4PJ0 C;  1ZAR A;  4NC8 A;  4WK8 F;  3V7S A;  1X1P A;  1P7J A;  2XGE A;  3WTW C;  2XSD C;  1VQL I;  1MMS A;  2YS9 A;  3IHU A;  1R71 A;  2L7F P;  2XDV A;  1ETQ A;  3BTI A;  3DKY A;  1TC3 C;  1X2M A;  2ZME C;  5C3E J;  1GDT A;  2GXB A;  4D7M A;  3K70 C;  4R79 A;  4A3D J;  2HYF A;  3FF5 A;  1XSX A;  2RNG A;  1TT0 A;  2VC1 A;  2VE9 A;  5CVR A;  2R7Q A;  3K2A A;  1QU3 A;  3KIO A;  1WGX A;  1K83 J;  2OF7 A;  5LGT A;  3WTX C;  4A3G J;  1JHH A;  2UV1 A;  5H6R A;  3GLL A;  2QA4 I;  1T56 A;  3HB9 A;  5F08 A;  2V6C A;  2X1D A;  1RUO A;  3NWT A;  4D5C A;  2VE8 A;  4MFD A;  4PDK A;  5EZG A;  3SFI A;  1GV5 A;  3ZN1 A;  2Z9O A;  2BBY A;  3GTL J;  2ELJ A;  3NAR A;  3V4G A;  3CCR I;  4NB5 A;  3MKL A;  2R7V A;  3DTE A;  4H0E A;  3GUD A;  3EYY A;  3W2V A;  4IX7 A;  3CC2 I;  2F4O B;  2MLK A;  3KLN A;  3TBI A;  1L0O C;  3I71 A;  3DU5 A;  3M8J A;  1S6L A;  3LA3 A;  2VOP A;  1P7I A;  2FU4 A;  3CJQ B;  4L0Z B;  3BR2 A;  5BPD A;  1X1D A;  2IEK A;  3DPU A;  3OYK A;  5IPA A;  5J3L A;  4GYI A;  4ZTF A;  4Q4Z F;  2KZV A;  4A5N A;  2P81 A;  3S1M J;  4XR6 A;  2M34 A;  1IRZ A;  1YJN I;  4BU2 A;  1BJA A;  2R7F A;  4XN3 A;  1D5Y A;  1D0Z A;  5JLW A;  5C4J J;  1T8I A;  3V8K A;  2B63 J;  1A5J A;  2V7F A;  2GQQ A;  2KLO A;  2ZJP F;  2E5Z A;  2D1H A;  2FEZ A;  3CMM A;  1P92 A;  4UVC A;  4MEX F;  3O3K A;  1U9N A;  2PN6 A;  1CF7 A;  1U9O A;  4KMF A;  2KIS A;  3HSE A;  4IPA A;  4CO8 A;  1XG1 A;  1PP8 F;  4DYQ A;  2A6E F;  5L3F A;  1N78 A;  2H94 A;  4DYC A;  2JVH A;  1BR4 A;  4A0Y A;  2HFH A;  2WB1 N;  5E1W A;  4BEH A;  1YLF A;  4A3F J;  5IP9 J;  4L9T A;  1UAA A;  1RNL A;  2L9S A;  2XF6 A;  2G7U A;  2W48 A;  3A02 A;  1APL C;  1IGN A;  3CCE I;  1ZG3 A;  2KQR A;  1ACI A;  1IO2 A;  2KPM A;  2P8T A;  2OZU A;  4CCO A;  3GVA A;  4X0G A;  1MMG A;  3HJE A;  2JT1 A;  5TRD A;  1OYW A;  2E71 A;  1VQP I;  2R0Q C;  5EF6 A;  4CCJ A;  2UWM A;  3LA2 A;  1G3T A;  1QHG A;  3G1M A;  3KEO A;  4DZJ A;  3JSO A;  1JKR C;  1YRN A;  5TGT A;  1XTA A;  2EV5 A;  4NC6 A;  2DFE A;  5DCM A;  1SVM A;  1QZZ A;  1WJC A;  3EUK L;  2X9D A;  2VPR A;  1KQ9 A;  4BXU A;  2MH2 A;  4JX4 A;  5LRR A;  2X6W A;  2BXZ A;  3WU2 C;  3MKW B;  3FKJ A;  3GTJ J;  2FD5 A;  2O5R A;  3JW4 A;  4RAY A;  2CFX A;  2ACJ A;  4XLF A;  2LY9 A;  4M3F A;  5M3F J;  2F5F A;  2PX9 A;  1ENH A;  3LST A;  1RUN A;  4BE2 A;  4M3B A;  4UHT A;  1W4M A;  1X3U A;  3S17 J;  2HZD A;  4KT5 C;  4DJA A;  2QKM B;  2H1K A;  3VPR A;  4M72 A;  2DA2 A;  2WAD A;  3RDI A;  2P6T A;  4A6D A;  2Y69 H;  3I4N J;  5IT3 A;  1WH7 A;  3SDB A;  3SEQ A;  2IGO A;  4V19 K;  4WF2 A;  3K4J A;  2BEO A;  1AKH A;  4AC0 A;  2FX0 A;  4HNT A;  5D4R A;  5DM7 F;  3S2W A;  2DXI A;  5FRN A;  1EKE A;  3MZH A;  4CIC A;  2YPR A;  3PNY A;  1UZC A;  3GBG A;  1FY7 A;  5BNG A;  4BQQ A;  2BXY A;  4PUS A;  1X1C A;  3M1E A;  3OYG A;  4BHC A;  3FM3 A;  2HQ5 A;  3I59 A;  5HOO A;  2MC3 A;  4BBS J;  2IS1 A;  3ZQ7 A;  3CP2 A;  2KDZ A;  3HOY J;  2H8W A;  4FHT A;  3SXY A;  2CV1 A;  2YU9 J;  3E6C C;  5F27 A;  1ZGW A;  1GXQ A;  3PQJ A;  2ME6 A;  1S7O A;  5CKT A;  1OYY A;  2M0C A;  3BZK A;  3ZR8 X;  4KUM A;  2R7R A;  1DU6 A;  2RAE A;  1S7E A;  4JX6 A;  1YIO A;  4RGX A;  4L5I A;  1FYL A;  1UHS A;  2QLZ A;  2JMW A;  4D1Q A;  4XOT A;  2WWY A;  5BS6 A;  4LOC A;  3C2G A;  3ASO H;  3K9T A;  1OKR A;  3DU6 A;  2O61 A;  4Y3O A;  2NOJ B;  3HOV J;  4CXF A;  3DWL E;  4IQ4 A;  3BR3 A;  4LMY A;  2D5V A;  1EV7 A;  5A2Q K;  5M5X J;  3I4M J;  3HM5 A;  3ULQ B;  1Z3X A;  2V9P A;  1ZN2 A;  4Q48 A;  4CYD A;  1FYM A;  1YJW I;  2TCT A;  3BOQ A;  3HOW J;  1SVO A;  1T0F A;  5M3M J;  2ECC A;  2OJE D;  3QPS A;  4Z2Y A;  5JFR A;  4XSX F;  4BJ6 C;  1LB2 A;  1R1V A;  2VBW A;  1O57 A;  4EJT A;  1U5T C;  2BHY A;  5F6F A;  3K70 D;  1TNT A;  1J5Y A;  2L0K A;  2QYO A;  2ME0 A;  5EYR A;  1Y0N A;  2I5U A;  5J40 A;  2F48 A;  3CD6 I;  4E4H A;  1G4D A;  4UV8 A;  3HKZ N;  1YIJ I;  2OC6 A;  4BKX A;  2GOM A;  3HYI A;  3GFM A;  1B9M A;  3UNG C;  2AS5 F;  1FEX A;  2ELK A;  3W6V A;  1W5T A;  2XV4 S;  3P9C A;  1JT0 A;  5J4Y A;  3IWF A;  5LGU A;  3ZQQ A;  4A3M J;  1STZ A;  2A5W A;  2DFI A;  4OIQ F;  4D7N A;  4Y13 A;  1WI9 A;  2QQ9 A;  4YFX F;  2HU9 A;  2W7N A;  2LKP A;  1SMT A;  2PG4 A;  3MVP A;  4KIB A;  1QPI A;  3QQA A;  3PIO F;  5CQE A;  2XAH A;  1IRX A;  3AFH A;  3SEZ A;  2IS4 A;  2F6C A;  3AG1 H;  5GP9 A;  4C30 A;  4YIF A;  4F92 B;  3LFK A;  5EDN A;  4U0W A;  3RI4 A;  1AKH B;  3OIO A;  3T8R A;  3KZZ A;  2L4M A;  3WTY C;  4XMY A;  4XLA A;  2HYJ A;  1N75 A;  5HOD A;  3CUQ A;  5TIS C;  1I1G A;  1XMA A;  5GPA A;  2FF4 A;  1HLV A;  1IAW A;  1MMD A;  5H20 A;  3L7W A;  3JRF A;  4C9Y A;  1JJ8 C;  1V5G A;  6PAX A;  1ZTR A;  3JTH A;  2LSO A;  3QYF A;  4WCG A;  5EG0 A;  4P1W A;  2CU7 A;  4I09 A;  2NVU B;  1BI1 A;  3ZQI A;  3FHZ A;  4L5E A;  2E1C A;  2GXA A;  1WJB A;  3L2W A;  3R6S A;  5HS8 A;  3I4P A;  1OFC X;  1W7P A;  3HGY A;  3GLX A;  1MH4 A;  2ISY A;  2HPI A;  3WE3 A;  4ABZ A;  3DEW A;  2ZFU A;  2UXX A;  4KN4 X;  3VOD A;  1T98 A;  1VZ0 A;  2V1D A;  4GO1 A;  3FX3 A;  1CGP A;  4Y52 J;  2CUF A;  2ZO4 A;  5JR3 A;  2X6O A;  5DEQ A;  2VQC A;  4EQQ A;  3DPT A;  3QPT A;  5KVR A;  1OJL A;  3MN2 A;  4UVA A;  1ZRF A;  4FX4 A;  3RPQ A;  4ZTJ A;  3ZMZ A;  4M6X A;  2F5V A;  3A03 A;  3L2Q A;  3LSR A;  4OIR F;  1FP1 D;  3GTQ J;  1XDU A;  2DMQ A;  3GFL A;  4EVI A;  4IOC F;  4MO7 A;  2EZH A;  3A0B C;  4XIC A;  3LA7 A;  4LG0 B;  2L2O A;  4UY8 I;  4MTE A;  2E7X A;  5J8C A;  3WGI A;  3COA C;  3LAJ A;  1DQU A;  1P4W A;  1RES A;  2JA5 J;  1VQ6 I;  3BTL A;  2L02 A;  2R7U A;  1FLI A;  5F0C A;  3KYL A;  1HST A;  5JHU A;  1GV2 A;  4XLH A;  2JK3 A;  3JRC A;  3DV8 A;  3QRF F;  3DKX A;  2VQL A;  3ZRG A;  2Y9Y A;  4ETS A;  4L18 B;  3OSF A;  4U0V A;  5IT9 K;  3D5S C;  3OMY A;  2FOK A;  2MC4 A;  1BI2 A;  1VQ9 I;  1I6X A;  1JXS A;  1YYV A;  1JKQ C;  5IOZ A;  5FD5 A;  2HKO A;  1BR2 A;  4RS8 A;  1GLN A;  3I0T A;  5GTH C;  5D8K B;  5D5V B;  1WSU A;  2EIM H;  2KKO A;  2XAS A;  2OBP A;  3FBN B;  4ESJ A;  2HXO A;  3MMY B;  3KP5 A;  3W2W A;  2CSO A;  1WJF A;  3HUG B;  3EUA A;  2LY2 A;  4U7B A;  2E36 A;  3M7G A;  4A2U A;  1I5Z A;  3TED A;  3FMR A;  2DA1 A;  1XGN A;  2MLG A;  1HKT A;  4HAM A;  4FET A;  2JWT A;  3BWG A;  4PZJ A;  4V2F A;  4ZZL A;  1O3R A;  3LOC A;  1GUU A;  5E1Z B;  3TP3 A;  3HDD A;  1W7P D;  2XPW A;  3BLY A;  4JBA A;  1MJB A;  3KP4 A;  1IXS B;  1NG7 A;  4M73 A;  4CYC B;  3F8F A;  3OYN A;  4MFE A;  4NQW B;  5LGN A;  1YE9 A;  3H3Z A;  4LIU A;  1LUJ B;  2C6Y A;  1JUP A;  2LRD A;  2K7L A;  3OOU A;  1XCV A;  4OIP F;  5B5E C;  3S15 J;  5CVI A;  1E3H A;  1O7F A;  3TDU C;  4BE0 A;  4EV0 A;  3BT9 A;  3MD2 A;  4KFC A;  3KP2 A;  4MHG A;  2BHZ A;  3GZ5 A;  2MH9 A;  2LC2 A;  1TQP A;  2FSW A;  2EWN A;  4R8H A;  1ETO A;  4A3L J;  2RC4 A;  3CCL I;  2DK8 A;  1BC8 C;  3CCV I;  1TNS A;  5D5X B;  3HG9 A;  2EIL H;  3CQZ J;  2P0W A;  4QWQ A;  3MCZ A;  3ZMU A;  3LAP A;  5E3N A;  4RDU A;  2Z3Y A;  1XN7 A;  3CJT B;  4UB6 C;  1D0Y A;  2STT A;  2ZBK A;  4ESF A;  5J1Y A;  2ESH A;  3RSN A;  1ZAO A;  2R7O A;  5EG0 B;  1V3F A;  2EK5 A;  4YG2 F;  2Z2S B;  3V42 A;  3HPH A;  5FKM A;  2K9S A;  1YI2 I;  2XKO A;  1H89 C;  5FO5 A;  2MA3 A;  4Q5S F;  1KA8 A;  1RET A;  4PSW A;  2LBF B;  1VQ7 I;  2HR3 A;  5D5W B;  2L54 A;  3EUH A;  2R5Z B;  3H92 A;  2QSH X;  3CC7 I;  3S14 J;  3ZOB A;  3HXL A;  2PJR A;  4YRV A;  2M4K A;  4LJZ F;  3K4N A;  2DJN A;  4UUS A;  3RKQ A;  2R7X A;  3TW7 A;  2YX7 A;  3CF5 F;  1FSH A;  1FMW A;  4C3H J;  4LD5 A;  2JUC A;  2G7H A;  4N4N B;  3G73 A;  5E8G A;  4LG3 A;  4RMN A;  4CCL A;  1XMX A;  4B47 A;  1HKS A;  4WX9 A;  5HDN A;  3PO3 J;  3OYD A;  2COM A;  5JVG F;  4ZYA A;  3P5J A;  4P96 A;  5IY5 H;  3JRI A;  4NHJ A;  3F6V A;  3IV5 A;  4HDU A;  4L9V A;  1MH3 A;  3T8T A;  1YOV B;  4O6J A;  5GTI C;  3I9V 2;  2JRM A;  3W3C A;  5FD6 A;  5KCM A;  3I3L A;  2HOE A;  4QSH A;  3GFI A;  1LE8 A;  2HNH A;  1A04 A;  4B4C A;  1LVK A;  2L7Z A;  2PBI A;  4HF2 A;  1S29 A;  2CQQ A;  3CDI A;  1L3L A;  2QGU A;  1QPM A;  3V7C A;  4U87 A;  3C3W A;  3OYE A;  4L9J A;  5IP7 J;  4BHP A;  2DA6 A;  3I59 B;  4EJW A;  2CQN A;  1S9H A;  1YW9 A;  2CS3 A;  2LNB A;  3MFK A;  1ON1 A;  4Y4R A;  1SC7 A;  5B66 C;  2FUG 2;  1V4R A;  1WJD A;  1H88 C;  5J1R A;  2QQB A;  4AUX A;  3E0J B;  1K4S A;  3U21 A;  1B6A A;  1O7L A;  1WHU A;  4KN7 X;  2GAU A;  1F36 A;  2F5C A;  4RAF A;  3KEQ A;  1LE8 B;  3FDY A;  1HQC A;  2IJL A;  4NNJ A;  1QRY A;  3BPX A;  3NWS A;  3MZY A;  5ICF A;  2LTP A;  4GYG A;  5LD2 C;  3QOD A;  3SJM A;  4KNY A;  4ON0 A;  4NBQ A;  1LKX A;  1E0E A;  3LSP A;  4CDG A;  3ZGK A;  4XQF A;  3CZ6 A;  4EM0 B;  4EGZ A;  2ZSI B;  3TP0 A;  1ZK8 A;  2X1E A;  3GZ6 A;  3DLA A;  4FE4 A;  4NUB A;  5CVJ A;  1BA5 A;  2CRG A;  2KRC A;  1ORK A;  2B7E A;  1D1C A;  4FIS A;  2E5N A;  2IGK A;  3SZP A;  1K78 A;  2ECB A;  3GTP J;  2Y48 A;  2LK2 A;  3HIF A;  4RBO A;  4KDP A;  3E6M A;  3JRA A;  5FRM A;  2IW5 A;  3SZG A;  3SZT A;  1MNE A;  4UNO A;  2VLA A;  2ZXW H;  4B09 A;  5L3G A;  4N4O B;  5HLT A;  1EF4 A;  5DUK A;  5K7F A;  5DCF A;  2K3P A;  2Y0S A;  2QKL B;  5AIP A;  2QQA A;  2L4A A;  4BJT A;  1S72 I;  2Y75 A;  1UST A;  3U1D A;  2YR2 A;  5C4X J;  3OY9 A;  3BR6 A;  3TKY A;  4UUV A;  5HNH A;  2XAJ A;  1SAN A;  4RGU A;  2VKV A;  5EEG A;  3ZMT A;  4F93 B;  3EPZ A;  5KAI C;  4B3X A;  1YS6 A;  2VON A;  4CSW A;  4MTD A;  1OCO H;  4HQM A;  2HTS A;  1X58 A;  3CCU I;  2K9M A;  4NDL A;  4B44 A;  5HS7 A;  4U7D A;  3PSI A;  2ZC2 A;  1E3O C;  2LD5 A;  3RJP A;  3BG7 A;  2OV7 A;  4IVN A;  5LLQ A;  3GF2 A;  3EUH C;  4KT6 A;  2XRN A;  2CUZ A;  1TTY A;  2XVC A;  4HEA 2;  4IL6 C;  3OL3 A;  4XRM A;  4UUS B;  2D45 A;  1FTT A;  1KYZ A;  5A2Q Z;  4N0B A;  1M1E B;  3FK6 A;  3LSK A;  3CMY A;  2FE3 A;  2O6G E;  1XD7 A;  2ZNZ A;  4IF4 A;  3AG3 H;  1X3Z B;  2HDW A;  2PEX A;  3BJ6 A;  1R4M B;  1UG0 A;  1VQN I;  2DO7 A;  2BYV E;  5K5Q A;  2N8G A;  2CQ7 A;  2RQQ A;  2Z5U A;  1KQ0 A;  5K5R A;  1J0R A;  2KFD A;  3EYI A;  4HF0 A;  1HSJ A;  1OQY A;  4AWX B;  4FAS D;  2X0L A;  3VFZ A;  3HTS B;  1CF7 B;  4MEY F;  4MIM A;  1TWA J;  4I01 A;  2PJP A;  1R22 A;  4UUT A;  3QWL A;  1DP7 P;  2CYY A;  5FKN A;  4CCK A;  3X2Q H;  3VSK A;  2BW3 A;  2XC7 A;  1OPC A;  2KRF A;  2BY0 A;  2UUZ A;  2LFB A;  4XM3 A;  5AON A;  4ZYD A;  4FQG A;  1HA8 A;  5L3D A;  1D3Y A;  1P4X A;  5EZH A;  1LEA A;  1S7A A;  2K5C A;  5DTD A;  2P7C B;  3TMO A;  1HW1 A;  1J09 A;  3F22 A;  4KIT B;  4A12 A;  3U2R A;  3KZI C;  1AU7 A;  3AKZ A;  1OCT C;  5BPI A;  4OU0 A;  1Z9C A;  1XS9 A;  1D8J A;  2QSF X;  4DQ2 A;  5HNF A;  1R9T J;  1BN5 A;  1OR7 A;  3HUG A;  1JGG A;  1J7K A;  5CQG A;  3IH4 A;  1TW3 A;  1IV6 A;  3JCU C;  3LSI A;  3M8F A;  1ON2 A;  4IQJ A;  3PO2 J;  3HEF A;  3FXL A;  3AL0 C;  1IJW C;  4RA2 A;  5DD8 A;  2XAQ A;  5B1A H;  3MKZ A;  2OCC H;  2MBF A;  4D5F A;  2EQR A;  3PFI A;  4P5O A;  5JLX A;  4XOR A;  3OSG A;  2KDO A;  3HHG A;  1OCP A;  3B6C A;  5J4V A;  2DDB A;  2HS5 A;  2M5W A;  4BS9 A;  1ZH5 A;  2FOW A;  3BG6 A;  1AWC A;  2HQR A;  5IT9 Z;  1UHM A;  1LDJ A;  4A3B J;  5ILU A;  2JPB A;  4KJZ A;  3PFY A;  3EDP A;  3S3M A;  4GRI A;  4E7S A;  3ABU A;  3OYC A;  2KIF A;  4E7J A;  1HOM A;  1YS7 A;  2LR8 A;  3QOE A;  3FXK A;  4O3M A;  1BI0 A;  3TO9 A;  3IH3 A;  3UKG A;  4YFK F;  2OCE A;  2R5Y B;  2NRA C;  1FOW A;  3K4K A;  1XSD A;  4OWR B;  2NS0 A;  3RYP A;  1VI0 A;  4GFB A;  2P4W A;  3H1C A;  3OYI A;  1IN5 A;  1BIA A;  2GZW A;  2PMU A;  3GTM J;  4B1R A;  1LDK B;  2Z1D A;  4BQN A;  1BBY A;  2KRH A;  2M2E A;  1HF0 A;  5BMZ A;  2CW8 A;  3ISP A;  4HOB A;  2ZJ2 A;  4YII A;  2XB5 A;  1FPQ A;  3GME A;  3WTT C;  1ZEL A;  2EPF A;  1Y1W J;  4IHY A;  3BC8 A;  5D4S A;  2NXN B;  1N77 A;  4Y17 A;  2R92 J;  1R5G A;  2D2W A;  2OA4 A;  3T1B A;  3GFJ A;  2XAU A;  4YEJ A;  4M3G A;  3CMA I;  3QYB A;  2F2E A;  4HQE A;  2M30 A;  2JSC A;  2E1M B;  1ZGJ A;  4CYC A;  2CQX A;  1G6N A;  3ECO A;  3R0A A;  3FXQ A;  2Q2E A;  2OUM A;  4XN0 A;  2EZL A;  3WGG A;  4XKW A;  2M7B A;  2DAO A;  2VL8 A;  1JTX A;  2HTJ A;  2F4I A;  3HOT A;  4ITV A;  1X2N A;  2WAQ A;  2IGN A;  1IXC A;  2CG4 A;  4N9H A;  2HWV A;  3C18 A;  3JAM Z;  1U5T A;  2P7V B;  1DUX C;  4C2U A;  1U6G A;  4M6V A;  1LFB A;  4CUG A;  1ONV A;  4F91 B;  3S8P A;  4BL0 B;  3WTS C;  3IP4 B;  4ZYG A;  1IV8 A;  3CLO A;  3H35 A;  4Z6Y A;  4IHX A;  1W36 D;  4HV6 A;  2QWW A;  1IZ1 A;  1W0U A;  1X3W B;  3OR1 C;  4PFO A;  3HRU A;  3M07 A;  2R7T A;  5DYM A;  2DQL A;  1A31 A;  3I56 I;  4ENJ A;  2FML A;  1JE8 A;  4CCM A;  2DU9 A;  4A0Z A;  1X1B A;  3K4C A;  4XSZ F;  3N4M A;  2YUS A;  3GTK J;  2EZK A;  1REP C;  1Q1H A;  3CF2 A;  2EB7 A;  1D1A A;  3G1O A;  1MBJ A;  1POG A;  1VND A;  1KU3 A;  1RC9 A;  3ONQ A;  5HVQ C;  2XPV A;  2XSJ C;  1W1W E;  1HKQ A;  3LQQ A;  1TBX A;  3CUQ C;  2DT7 B;  2EBI A;  1FMV A;  3M8E A;  2CQK A;  1SFE A;  4J19 A;  4IHW A;  3HSR A;  3E1S A;  2VJ4 A;  3C2H A;  3BZC A;  1OIS A;  3QP6 A;  4XOP A;  2Y31 A;  3IKT A;  1NK3 P;  5DDG A;  5ILS A;  1K79 A;  3J7Z I;  2DMN A;  4AU7 A;  1DU0 A;  4IRH A;  3RPU A;  1ZHF A;  1YW7 A;  4PJN A;  1TWC J;  2VT2 A;  4CA0 A;  1ETW A;  5GPC A;  3KP6 A;  1RR7 A;  5DD4 A;  4XK4 A;  2K4J A;  5TJJ A;  2WAF A;  4DW6 A;  4KIG A;  4RB3 C;  3MKY B;  3CCJ I;  3S3O A;  1HC8 A;  1USS A;  3GZN B;  1B8I A;  2V1U A;  4BXF A;  4JQF A;  2DTZ A;  2E7W A;  1ODD A;  4M6Y A;  5ED4 A;  2JSP A;  2WAQ N;  4M9S A;  2A61 A;  2DFH A;  4EJV A;  1ZLJ A;  3H3V K;  3FXU A;  1ZG1 A;  2COB A;  5CJ9 A;  4DGW B;  3ROU A;  2CUJ A;  3CO6 C;  4D0P A;  2ZKZ A;  3OS2 A;  2PI0 A;  4IZZ A;  4MQ9 F;  2R3S A;  3RKW A;  2IGM A;  2M9H A;  4OIN F;  5F04 A;  5BQT A;  4BXX J;  1NHA A;  3HZJ A;  4E7I A;  1T08 B;  2ID6 A;  1HDD C;  3OYJ A;  4UVB A;  3G4S I;  2MW8 A;  2Y2Z A;  3S2H J;  2W84 A;  2E2J J;  2EH3 A;  3H36 A;  2OQG A;  2V9V A;  2HOA A;  5GAD J;  2ZCW A;  5E8I A;  5FGM A;  3W6J B;  3NAU A;  4OIO F;  1MJ9 A;  3QAH A;  2IT0 A;  3QPH A;  2HQA A;  5DM6 F;  1BOB A;  2V1N A;  1VF9 A;  5L3B A;  3F6O A;  4FE7 A;  1F9N A;  1LVA A;  1F4K A;  1IDY A;  3M1C A;  1YFH A;  3GCM A;  4GGG A;  2EV6 A;  2L3D A;  4W1U A;  4XRS A;  2LG4 A;  1Y39 A;  3FIW A;  3VYS B;  3OS1 A;  5L3C A;  1EH6 A;  2A05 A;  2PJR B;  1IW7 F;  1Z05 A;  2OAZ A;  2HPM A;  3BJO A;  3QU3 A;  4BUP A;  2BY2 A;  4M3E A;  1BR1 A;  3BG3 A;  4HZF A;  1X4O A;  3GEZ A;  4IKF A;  1IN8 A;  5CLS A;  1VQ5 I;  1MBK A;  4UXN A;  4A0X A;  4G8X A;  1XX5 A;  3OIP A;  5F0F A;  1B72 B;  3JRE A;  4XKC A;  1G2H A;  2MD0 A;  2Y0S N;  3PNV A;  1UFM A;  3SYT A;  4D9J A;  3ERE D;  2EFP A;  2IS6 A;  4LB6 B;  1ZRC A;  3J7Y J;  3DTI A;  1Z7L A;  4G6T B;  4OAZ A;  4BHB A;  1U78 A;  4YEL A;  3IL2 A;  1XCB A;  4RGS A;  4ANJ A;  1TLH B;  2KMU A;  3BG9 A;  2FJ1 A;  3ERM A;  3WG9 A;  4KYW A;  3G1L A;  2JA7 J;  4J00 A;  3O6B B;  1E2X A;  1BC7 C;  3BCA A;  1YRN B;  1ULY A;  1K7A A;  4N9I A;  3K2Z A;  1QHH D;  4L0Y B;  3KZY A;  4ZDL A;  1PVE A;  1D8K A;  2VQH A;  2NVT J;  1TWF J;  2OD5 A;  4CZZ A;  3WE2 A;  4C3I J;  1TT5 B;  3P9K A;  2XGD A;  1MGT A;  3H5N A;  4AVP A;  2MG4 A;  1FBQ A;  3V8J A;  1I39 A;  4GCV A;  3F8C A;  1S3J A;  3Q0V A;  5KNL A;  1IUF A;  3HPG A;  4NC7 A;  2JPC A;  2AO9 A;  2MSY A;  3CES A;  3ZQF A;  1YX3 A;  2HVS A;  5E1X A;  3L2V A;  4LIT A;  4QTR A;  2L9N A;  4A3E J;  3WTV C;  2ZJQ F;  4ESB A;  3HC7 A;  1LPQ A;  5KAF C;  2DI3 A;  3TGN A;  1JJ6 C;  4GDF A;  2BVL A;  3M3Y J;  2O8K A;  1F1Z A;  2LBF A;  1JI8 A;  2VJI A;  4HV5 A;  4L9N A;  3EQL F;  5FLX Z;  1OCC H;  3ZN0 A;  1KU7 A;  5LRS A;  3PL8 A;  3WHC A;  2PQ8 A;  1Z7U A;  1OR7 C;  2XB0 X;  3ZCO A;  3OYM A;  1Z6T A;  2EA4 A;  2VBZ A;  1Z91 A;  4BY1 J;  2VBY A;  3MZ8 A;  1HBX G;  3L1P A;  2G9W A;  3J80 K;  3BR0 A;  2FA5 A;  1I3A A;  1PUE E;  3FKI J;  1FZP B;  2P5K A;  3PSF A;  1ZR4 A;  5E79 C;  4BBR J;  1ZG5 A;  2DK5 A;  2ZSH B;  4BNC A;  1WRJ A;  1V55 H;  3BP8 A;  3MWM A;  1NTC A;  4I02 A;  2L5Q A;  5HS9 A;  3DLL F;  2VKE A;  3KCC A;  5JHF A;  3ZQH A;  2M1B A;  1IN6 A;  3F9K A;  1UHW A;  3ESW B;  1WPK A;  4B8X A;  2NVX J;  2V79 A;  2A6H F;  3R4K A;  1EA3 A;  3HOU J;  1LFU P;  3KX2 A;  2VUM J;  1KQ8 A;  4LK0 F;  2DFF A;  1QO0 D;  3A0H C;  1MW7 A;  2EIN H;  4G6D A;  2QEN A;  1O3Q A;  2MD5 A;  3ZQG A;  3JTG A;  2H27 A;  2DOA A;  2WBM A;  3CDH A;  3DBL B;  4IHS A;  3ABL H;  2Q2E B;  1U2W A;  5HLG A;  3BG5 A;  4LIV A;  2M3A A;  1NG6 A;  3FXJ A;  5CVU A;  2QQ8 A;  4MLO A;  2OZ6 A;  2Q0O A;  3ABM H;  4RAG A;  1QA6 A;  3FIS A;  1T0F C;  1W7P B;  1B9N A;  2WV0 A;  2BV6 A;  2IP2 A;  2MFZ A;  1I27 A;  4HA8 A;  4Y15 A;  2D1V A;  1OCR H;  3A1Y A;  1AA7 A;  3RIR A;  2GIZ A;  2DBB A;  4PGH A;  5CYV A;  2Y30 A;  5EJC A;  4LB5 A;  4ENN A;  3VEP A;  3HGG A;  1E17 A;  4IRG A;  1MBG A;  2DOF A;  5DV5 A;  1X4P A;  5HDK A;  3A01 B;  1R7J A;  1VQO I;  3H5A A;  2R7W A;  2NNY A;  2K9Q A;  2M8E A;  2QEX I;  2NNN A;  1K6O A;  1VTN C;  1FWZ A;  1FTZ A;  2ZME A;  1WCM J;  1X19 A;  3QPL A;  4B3A A;  3G6E I;  4XLN F;  1R00 A;  2H09 A;  1JUM A;  2EIJ H;  4HST A;  3WOD F;  4W97 A;  5E17 F;  2FBI A; 
#chains in the Genus database with same CATH homology
 1FT9 A;  2J5P A;  5F64 A;  2GA1 A;  5FB2 A;  2XRO A;  4XLP F;  3GYH X;  2EFQ A;  1DDN A;  5D6F A;  2TDX A;  2R7D A;  1ZYR F;  1XGS A;  4ZH4 F;  1UCR A;  2LF7 A;  1MJA A;  2KJB A;  4G9Y A;  2CW0 F;  2XAG A;  1JHF A;  3R61 A;  4RB2 C;  4WXD A;  3I64 A;  1HXD A;  4I7H A;  1XSV A;  2ZFW A;  1MZB A;  3AAF A;  3IWZ A;  3V8L A;  3OV8 A;  2RQP A;  2P5V A;  2GIV A;  1SD7 A;  4JK1 X;  2K4B A;  3KE2 A;  2FXA A;  2L01 A;  2YX4 A;  3L09 A;  2VOD A;  3T0Y A;  3E5X A;  2RV8 A;  1BIB A;  2M45 A;  4AD9 A;  5F1R A;  1D5V A;  1JGS A;  1QGP A;  1LQ1 A;  2RNJ A;  2IA2 A;  2PMH A;  2F5D A;  1TQI A;  2Y0M A;  1B1B A;  2DPU A;  3KFW X;  3JAM K;  2DLL A;  3HRS A;  1XMK A;  1GVJ A;  2E1N A;  3I58 A;  2W24 A;  4EMS A;  1RZ4 A;  2QZ8 A;  3Q5F A;  4I0A A;  1YG2 A;  2BE5 F;  1ZRD A;  5L3E A;  3K1P A;  3ZMV A;  4K2E A;  2AXL A;  1SD6 A;  2UZK A;  2VT3 A;  2XKP A;  1YO5 C;  3W6K B;  1FC3 A;  3DXJ F;  2A68 F;  4FT8 A;  1AOY A;  4HYE A;  2RN7 A;  4LLG F;  3MQ0 A;  2A5Y B;  1ZLK A;  1QNT A;  1T2K A;  3B02 A;  1MDM A;  3DF8 A;  2NYX A;  2W57 A;  3I54 A;  4IXA A;  1IRF A;  1RI7 A;  4WXH A;  4HX8 A;  2GA2 A;  4HF1 A;  1SMY F;  2FRH A;  3K1M A;  1QBJ A;  3ELK A;  1Z1D A;  1GXP A;  3HSF A;  4G7H F;  4OOI A;  1Y0U A;  3BZ6 A;  1T39 A;  2EA2 A;  4ENK A;  1P6R A;  3NEU A;  4HLY A;  2NAZ A;  1OYI A;  3GW2 A;  1R36 A;  4LGW A;  3RKY A;  3FZV A;  5HLI A;  3OOP A;  4M74 A;  1IXR C;  4AIK A;  1GHC A;  3JSP A;  1MKM A;  2O3F A;  2F5E A;  2V1X A;  3DP7 A;  3FWE A;  2XHK A;  3BJA A;  3LQR A;  3F8B A;  5LHG A;  2XIG A;  4S05 A;  3MEX A;  1R5H A;  2XGX A;  2A69 F;  4XRF A;  4AIJ A;  1DPR A;  1U5T B;  3BRO A;  4BH9 A;  4IHT A;  5FFZ A;  2Z99 A;  4R1H A;  2OU2 A;  4HX7 A;  2ESN A;  2Z33 A;  3FMQ A;  2FNP A;  2DQR A;  5BOX A;  3F8M A;  2VN2 A;  2VBX A;  1P4A A;  2IRF G;  2ADU A;  5J8F A;  3J80 Z;  1YW8 A;  2P6S A;  4EJO A;  3F23 A;  2ISZ A;  4HBL A;  3CO7 C;  4IJA A;  4P55 A;  2LDU A;  2GXG A;  5DCM B;  1XDS A;  5ICC A;  4KIC A;  3SFZ A;  2O0Y A;  4EGY A;  2VOO A;  1G3S A;  2XUB A;  3E6B A;  3GXO A;  2O8X A;  4KIF A;  2JRT A;  5D6E A;  4P9F A;  4EJU A;  2B0L A;  2W85 A;  3F3X A;  1HW5 A;  1IUY A;  2IVM A;  2VXZ A;  4XBF A;  3WU1 B;  4HX4 A;  4I2O A;  2H6C A;  3L00 A;  5EEH A;  3VOE A;  4FX0 A;  5H6Q A;  3IRR A;  4UV9 A;  3ZMD A;  3GO5 A;  1YTY A;  4RAZ A;  3DFG A;  4M71 A;  3ECH A;  1FBU A;  3RYR A;  2QBY A;  4MQV A;  2RDP A;  4CHU A;  4OMZ A;  3J81 K;  1BM9 A;  3P7N A;  1OMI A;  3K0L A;  1KU2 A;  2UXN A;  2IA0 A;  4ASN A;  4G94 A;  5K1Y A;  3F72 A;  3GX4 X;  4PCQ A;  1SD5 A;  2WTE A;  2LF8 A;  4LLL A;  1U8R A;  5J6X A;  2EFN A;  2KIU A;  2DTR A;  1G3Y A;  3DKW A;  2STW A;  1KU9 A;  4M9Z A;  4F7Z A;  3Q9S A;  3BPV A;  1J75 A;  3F8N A;  1YQA A;  3L9F A;  3G3Z A;  5LHI A;  5FLX K;  1R1U A;  2J5O A;  2PFB A;  2FBK A;  1IN7 A;  1O3S A;  3HRT A;  3F21 A;  4U88 A;  2CGP A;  1S8N A;  1O3T A;  1DPU A;  1IF1 A;  1QZY A;  3E5U A;  4WWC A;  4MNU A;  3SQN A;  2Q8K A;  4ENM A;  5LEJ A;  4CGZ A;  3I5U A;  3KP7 A;  3L2C A;  2HQN A;  2A07 F;  5ILV A;  2ZXJ A;  1WQ2 A;  3ZPL A;  2CO5 A;  5K5O A;  1ZGA A;  3D0S A;  1W5S A;  5HDG A;  2WC2 A;  4ZZD A;  1FP2 A;  2CWE A;  2QM3 A;  4LG0 A;  3DQV C;  3C7J A;  2RGV A;  2JTV A;  1FNN A;  1J2X A;  2GWR A;  3DPL C;  5ICG A;  3D5L A;  1H0M A;  3R0J A;  2EJR A;  3K69 A;  2HYG D;  4L5J A;  1U3E M;  3K1N A;  1PDN C;  2RKH A;  1J59 A;  2K02 A;  4ZYH A;  2K27 A;  1G3W A;  1I1S A;  2BGC A;  1KGS A;  3TQN A;  4P9U A;  3WU0 A;  1IRG A;  2DPD A;  3NRV A;  2DW4 A;  5DUI A;  1SFU A;  1J9I A;  1H9T A;  1SFX A;  3CTA A;  4RB1 A;  4HW0 A;  4BQA A;  1FBS A;  2FNA A;  1WKM A;  2YU3 A;  4OMY A;  3ABT A;  1P2F A;  3P9I A;  1B4A A;  3O2P E;  4EM2 A;  5LHH A;  3H3U A;  3RTR A;  3KET A;  2A3S A;  2QUF A;  4DNC A;  3TO6 A;  3ML6 A;  1SD4 A;  3TOB A;  1MD0 A;  3N97 A;  2IA1 A;  3KLO A;  3WTZ A;  2QVO A;  3TO7 A;  4U0Y A;  3REO A;  1H9G A;  1LNW A;  3DEU A;  5JVT A;  1FSE A;  4IRI A;  4MGR A;  5D5U B;  1MDM B;  4HLX A;  3RKX A;  2ETH A;  2PLY A;  3SHF A;  3TDZ C;  3IKV A;  3KP3 A;  2KIM A;  2HZT A;  3MAJ A;  1LJ9 A;  4LLN A;  3PQK A;  1HW2 A;  5FFX A;  4QLC U;  2ZNY A;  3BY6 A;  3E5Q A;  1Z6R A;  3HTU A;  2EV0 A;  5E18 F;  4I0B A;  1EH7 A;  3CUO A;  1F5T A;  1RIO H;  1XGO A;  1TQM A;  1UB9 A;  2YSR A;  1PP7 U;  1T6S A;  2EFO A;  1SAX A;  3TOA A;  3U9G A;  3VB2 A;  4LFU A;  5D8L B;  5ERI A;  4LK1 F;  1WWX A;  3LWF A;  3C1D A;  2FMY A;  4RGR A;  3J7A O;  3WTU C;  3V7R A;  3QP5 A;  5CVV A;  2VC0 A;  5HLH A;  4ZYE A;  4A6E A;  5JI6 A;  1QQI A;  1FOK A;  3T5X A;  3I53 A;  1B59 A;  4M9X A;  3GWZ A;  4O5V A;  1KYW A;  1LDD A;  2XAF A;  1K78 B;  2ZME B;  5AIQ A;  4EM1 A;  4G6Q A;  1BI3 A;  4E70 A;  4S04 A;  3FXR A;  2FBH A;  2QBY B;  3FMS A;  3J81 Z;  3BDD A;  3FM5 A;  3IC7 A;  5LEK A;  4KA4 A;  2JZY A;  3EET A;  3Q9V A;  1FYK A;  3IRQ A;  4RB0 A;  4GXO A;  1R58 A;  2HGC A;  2W25 A;  3CJN A;  4BAY A;  2KJC A;  3HRM A;  4AIH A;  3E97 A;  4YFN F;  4PGG A;  3ZP5 A;  3WGH A;  5LBQ A;  1FX7 A;  1R23 A;  1XGM A;  1T38 A;  2H6B A;  4NQW A;  3HOS A;  5E20 A;  4HDV A;  1C0W A;  3E6D A;  3NQO A;  3M9A A;  2HDC A;  4BYY A;  2K86 A;  1EH8 A;  2IPQ X;  4Q47 A;  4TV7 A;  1LEB A;  2EFW A;  5ICE A;  2X4H A;  2HKX A;  1TW2 A;  4KMU X;  5KK1 A;  2M87 A;  3R60 A;  2RVC A;  3B73 A;  4WXC A;  3ZMS A;  3QOP A;  4G7O F;  4G7Z F;  2OQR A;  1BOA A;  2ELH A;  3E3V A;  1ZRE A;  2DT5 A;  4I98 B;  1XB4 A;  4A5M A;  3HHH A;  3CUQ B;  2FQ3 A;  3QU6 A;  2HEO A;  2O03 A;  2P5L C;  1IN4 A;  1R1T A;  1ZAR A;  4WK8 F;  3V7S A;  3WTW C;  3IHU A;  2GXB A;  4R79 A;  2HYF A;  3FF5 A;  1XSX A;  2VC1 A;  2VE9 A;  5CVR A;  5LGT A;  3WTX C;  1JHH A;  5H6R A;  2V6C A;  1RUO A;  2VE8 A;  4PDK A;  3ZN1 A;  2Z9O A;  2BBY A;  3V4G A;  4NB5 A;  4H0E A;  3GUD A;  3EYY A;  2MLK A;  3KLN A;  1L0O C;  3I71 A;  1S6L A;  3LA3 A;  2VOP A;  2FU4 A;  4L0Z B;  5BPD A;  4GYI A;  4Q4Z F;  4A5N A;  1BJA A;  2R7F A;  3V8K A;  2GQQ A;  2D1H A;  2FEZ A;  4UVC A;  1P92 A;  4MEX F;  3O3K A;  2PN6 A;  1CF7 A;  4KMF A;  3HSE A;  4IPA A;  4CO8 A;  1PP8 F;  2A6E F;  5L3F A;  2H94 A;  4A0Y A;  2HFH A;  5E1W A;  1YLF A;  4L9T A;  1RNL A;  2G7U A;  1ZG3 A;  2P8T A;  2OZU A;  3GVA A;  2JT1 A;  5TRD A;  1OYW A;  2UWM A;  3LA2 A;  1G3T A;  3KEO A;  3JSO A;  2EV5 A;  5DCM A;  1QZZ A;  1KQ9 A;  4BXU A;  2MH2 A;  5LRR A;  4RAY A;  3JW4 A;  2CFX A;  2ACJ A;  2F5F A;  3LST A;  1RUN A;  4UHT A;  1W4M A;  1X3U A;  4KT5 C;  4M72 A;  3RDI A;  2P6T A;  4A6D A;  5IT3 A;  4WF2 A;  2BEO A;  5D4R A;  3S2W A;  3MZH A;  4CIC A;  2YPR A;  1FY7 A;  3M1E A;  4BHC A;  3FM3 A;  3I59 A;  5HOO A;  2MC3 A;  3ZQ7 A;  4FHT A;  3SXY A;  3E6C C;  1GXQ A;  3PQJ A;  1S7O A;  1OYY A;  4KUM A;  4RGX A;  1YIO A;  4L5I A;  1FYL A;  2QLZ A;  2WWY A;  5BS6 A;  3K9T A;  1OKR A;  2O61 A;  4CXF A;  4LMY A;  1EV7 A;  5A2Q K;  3ULQ B;  4Q48 A;  1ZN2 A;  1FYM A;  4CYD A;  3BOQ A;  1T0F A;  5JFR A;  4Z2Y A;  4XSX F;  1LB2 A;  1R1V A;  2VBW A;  1O57 A;  4EJT A;  1U5T C;  5F6F A;  1TNT A;  1J5Y A;  2QYO A;  1G4D A;  4UV8 A;  3HYI A;  3GFM A;  1B9M A;  2AS5 F;  1W5T A;  2XV4 S;  3P9C A;  3IWF A;  5LGU A;  1STZ A;  2DFI A;  4OIQ F;  4Y13 A;  1WI9 A;  2QQ9 A;  4YFX F;  2LKP A;  1SMT A;  2PG4 A;  4KIB A;  2XAH A;  4YIF A;  3LFK A;  4U0W A;  3RI4 A;  3T8R A;  3KZZ A;  2L4M A;  3WTY C;  3CUQ A;  1I1G A;  1XMA A;  2FF4 A;  1IAW A;  5H20 A;  3L7W A;  6PAX A;  3JTH A;  4WCG A;  2LSO A;  4I09 A;  1BI1 A;  3FHZ A;  2E1C A;  3R6S A;  5HS8 A;  3I4P A;  1W7P A;  3GLX A;  2ISY A;  3WE3 A;  2UXX A;  4KN4 X;  3VOD A;  1T98 A;  1CGP A;  2V1D A;  4GO1 A;  3FX3 A;  2ZO4 A;  5JR3 A;  5DEQ A;  4EQQ A;  3DPT A;  3QPT A;  5KVR A;  1ZRF A;  4UVA A;  4FX4 A;  3RPQ A;  3ZMZ A;  4M6X A;  4OIR F;  1FP1 D;  1XDU A;  3GFL A;  4EVI A;  3LA7 A;  4LG0 B;  4MTE A;  2E7X A;  5J8C A;  3WGI A;  3COA C;  3LAJ A;  1P4W A;  2L02 A;  1FLI A;  1HST A;  5JHU A;  3DV8 A;  3QRF F;  4ETS A;  4L18 B;  4U0V A;  5IT9 K;  2FOK A;  1BI2 A;  1I6X A;  1JXS A;  1YYV A;  5FD5 A;  2HKO A;  4RS8 A;  3I0T A;  5D8K B;  5D5V B;  1WSU A;  2KKO A;  2XAS A;  2OBP A;  4ESJ A;  3KP5 A;  2CSO A;  4U7B A;  3M7G A;  4A2U A;  1I5Z A;  3FMR A;  1XGN A;  2MLG A;  1HKT A;  4HAM A;  3BWG A;  4PZJ A;  4ZZL A;  1O3R A;  5E1Z B;  1W7P D;  4JBA A;  1MJB A;  3KP4 A;  1IXS B;  4M73 A;  3F8F A;  5LGN A;  3H3Z A;  2C6Y A;  2K7L A;  1XCV A;  4OIP F;  5CVI A;  1O7F A;  3TDU C;  4EV0 A;  4KFC A;  3KP2 A;  4MHG A;  3GZ5 A;  2MH9 A;  1TQP A;  2FSW A;  2EWN A;  4R8H A;  2RC4 A;  2DK8 A;  1BC8 C;  1TNS A;  5D5X B;  4QWQ A;  3MCZ A;  3ZMU A;  3LAP A;  2Z3Y A;  1XN7 A;  2STT A;  2ZBK A;  4ESF A;  2ESH A;  1ZAO A;  1V3F A;  2EK5 A;  4YG2 F;  2XKO A;  5FO5 A;  2MA3 A;  4Q5S F;  1KA8 A;  2HR3 A;  5D5W B;  2L54 A;  3EUH A;  3H92 A;  4LJZ F;  2YX7 A;  1FSH A;  4LD5 A;  2G7H A;  3G73 A;  5E8G A;  1HKS A;  4WX9 A;  5HDN A;  2COM A;  4P96 A;  4NHJ A;  3F6V A;  4HDU A;  4L9V A;  3T8T A;  4O6J A;  5FD6 A;  3GFI A;  2HOE A;  1A04 A;  2PBI A;  4HF2 A;  1S29 A;  1L3L A;  1QPM A;  3V7C A;  3C3W A;  4L9J A;  4BHP A;  3I59 B;  4EJW A;  3MFK A;  1YW9 A;  2LNB A;  1ON1 A;  1V4R A;  2QQB A;  1B6A A;  1O7L A;  4KN7 X;  2GAU A;  2F5C A;  3KEQ A;  1HQC A;  2IJL A;  3BPX A;  3MZY A;  5ICF A;  4GYG A;  4KNY A;  4ON0 A;  4CDG A;  4EM0 B;  4EGZ A;  3GZ6 A;  5CVJ A;  3SZP A;  1K78 A;  2Y48 A;  3HIF A;  4KDP A;  3E6M A;  2IW5 A;  3SZT A;  4UNO A;  4B09 A;  5L3G A;  5DUK A;  5DCF A;  5AIP A;  2QQA A;  2L4A A;  2Y75 A;  1UST A;  3U1D A;  2YR2 A;  3TKY A;  4UUV A;  2XAJ A;  4RGU A;  5EEG A;  3ZMT A;  1YS6 A;  2VON A;  4MTD A;  4HQM A;  2HTS A;  5HS7 A;  4U7D A;  3RJP A;  4IVN A;  5LLQ A;  3GF2 A;  2XRN A;  1TTY A;  2XVC A;  2D45 A;  1KYZ A;  5A2Q Z;  4N0B A;  2FE3 A;  2O6G E;  1XD7 A;  2ZNZ A;  4IF4 A;  2PEX A;  3BJ6 A;  2DO7 A;  2BYV E;  5K5Q A;  2Z5U A;  3EYI A;  1KQ0 A;  1J0R A;  5K5R A;  4HF0 A;  1HSJ A;  4AWX B;  2X0L A;  3VFZ A;  3HTS B;  1CF7 B;  4MEY F;  4I01 A;  2PJP A;  1R22 A;  1DP7 P;  2CYY A;  1OPC A;  2KRF A;  5AON A;  4ZYD A;  5L3D A;  1D3Y A;  1P4X A;  1LEA A;  1S7A A;  2P7C B;  1HW1 A;  3F22 A;  4A12 A;  3U2R A;  5BPI A;  4OU0 A;  1Z9C A;  1D8J A;  4DQ2 A;  1BN5 A;  1OR7 A;  3HUG A;  1J7K A;  1TW3 A;  3M8F A;  1ON2 A;  5DD8 A;  2XAQ A;  2MBF A;  4P5O A;  3PFI A;  3HHG A;  2HS5 A;  2M5W A;  1ZH5 A;  1AWC A;  2HQR A;  5IT9 Z;  1UHM A;  1LDJ A;  5ILU A;  2JPB A;  3EDP A;  3ABU A;  2KIF A;  1YS7 A;  4O3M A;  1BI0 A;  3TO9 A;  4YFK F;  2NRA C;  1XSD A;  2NS0 A;  3RYP A;  2P4W A;  1IN5 A;  1BIA A;  2GZW A;  2PMU A;  1LDK B;  1BBY A;  5BMZ A;  3ISP A;  4HOB A;  2ZJ2 A;  4YII A;  1FPQ A;  3WTT C;  5D4S A;  4Y17 A;  1R5G A;  2D2W A;  2OA4 A;  3T1B A;  3GFJ A;  2F2E A;  4HQE A;  2M30 A;  2JSC A;  1ZGJ A;  1G6N A;  3ECO A;  3R0A A;  3FXQ A;  2Q2E A;  3WGG A;  2DAO A;  2HTJ A;  3HOT A;  1IXC A;  2CG4 A;  4N9H A;  2HWV A;  3C18 A;  3JAM Z;  1U5T A;  2P7V B;  1DUX C;  1U6G A;  1ONV A;  3WTS C;  4ZYG A;  3CLO A;  4HV6 A;  2QWW A;  1IZ1 A;  3HRU A;  5DYM A;  2DQL A;  1JE8 A;  4ENJ A;  2FML A;  2DU9 A;  4A0Z A;  4XSZ F;  3N4M A;  1REP C;  1Q1H A;  2EB7 A;  1KU3 A;  5HVQ C;  1HKQ A;  3LQQ A;  1TBX A;  3CUQ C;  3M8E A;  2CQK A;  1SFE A;  3HSR A;  3QP6 A;  3IKT A;  5DDG A;  5ILS A;  1K79 A;  4IRH A;  3RPU A;  1ZHF A;  1YW7 A;  2VT2 A;  3KP6 A;  5DD4 A;  2K4J A;  5TJJ A;  4KIG A;  4RB3 C;  1USS A;  2V1U A;  4JQF A;  2E7W A;  1ODD A;  4M6Y A;  5ED4 A;  4M9S A;  2A61 A;  4EJV A;  1ZLJ A;  3FXU A;  1ZG1 A;  5CJ9 A;  3ROU A;  3CO6 C;  4D0P A;  2ZKZ A;  2PI0 A;  4MQ9 F;  2R3S A;  3RKW A;  4OIN F;  5BQT A;  1NHA A;  4UVB A;  2W84 A;  2OQG A;  2V9V A;  2ZCW A;  5E8I A;  4OIO F;  5FGM A;  3W6J B;  1MJ9 A;  3QAH A;  2IT0 A;  3QPH A;  5L3B A;  3F6O A;  1F9N A;  1LVA A;  1F4K A;  1YFH A;  4GGG A;  2EV6 A;  2L3D A;  5L3C A;  1EH6 A;  1IW7 F;  1Z05 A;  2OAZ A;  3BJO A;  3QU3 A;  4HZF A;  3GEZ A;  1IN8 A;  5CLS A;  4UXN A;  4A0X A;  4G8X A;  1UFM A;  3ERE D;  2EFP A;  4LB6 B;  1ZRC A;  4BHB A;  1U78 A;  3IL2 A;  1XCB A;  4RGS A;  1TLH B;  4KYW A;  3WG9 A;  3O6B B;  1E2X A;  1BC7 C;  1ULY A;  1K7A A;  4N9I A;  3K2Z A;  4L0Y B;  3KZY A;  1D8K A;  2OD5 A;  4CZZ A;  3WE2 A;  3P9K A;  1MGT A;  4AVP A;  1FBQ A;  3V8J A;  4GCV A;  3F8C A;  1S3J A;  2JPC A;  5E1X A;  3WTV C;  4ESB A;  2DI3 A;  3TGN A;  1F1Z A;  4HV5 A;  4L9N A;  3EQL F;  5FLX Z;  3ZN0 A;  1KU7 A;  5LRS A;  2PQ8 A;  1Z7U A;  1Z6T A;  2EA4 A;  2VBZ A;  1Z91 A;  2VBY A;  1HBX G;  2G9W A;  3J80 K;  2FA5 A;  1PUE E;  1FZP B;  2P5K A;  1ZG5 A;  2DK5 A;  4BNC A;  1WRJ A;  3BP8 A;  3MWM A;  4I02 A;  5HS9 A;  3KCC A;  2M1B A;  1IN6 A;  1UHW A;  4B8X A;  2V79 A;  2A6H F;  3R4K A;  1KQ8 A;  4LK0 F;  1QO0 D;  1O3Q A;  4G6D A;  2QEN A;  2MD5 A;  3JTG A;  2H27 A;  3CDH A;  4IHS A;  1U2W A;  5HLG A;  5CVU A;  2OZ6 A;  2Q0O A;  1W7P B;  1B9N A;  2WV0 A;  2BV6 A;  2IP2 A;  1I27 A;  4HA8 A;  4Y15 A;  2D1V A;  3RIR A;  2DBB A;  4PGH A;  5CYV A;  4LB5 A;  4ENN A;  3VEP A;  1E17 A;  4IRG A;  5DV5 A;  5HDK A;  1R7J A;  2NNY A;  2M8E A;  2NNN A;  1K6O A;  1VTN C;  1FWZ A;  2ZME A;  4XLN F;  1R00 A;  2H09 A;  3WOD F;  5E17 F;  2FBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...