4LLNA

Crystal structure of s. aureus mepr-dna complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
137
structure length
137
Chain Sequence
FTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription/dna
molecule keywords MepR
total genus 50
structure length 137
sequence length 137
chains with identical sequence B, C, D, I, J
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4llnA00
5EEHA 2K4BA 2VE9A 3RJPA 2RDPA 1XN7A 1W7PB 4MEXF 2HYFA 4ZZLA 1F9NA 2F5DA 1P4WA 1MDMA 4L0ZB 1U5TC 4IJAA 5LHIA 1V4RA 1IZ1A 2VOPA 3ERED 3IRQA 5F1RA 2FQ3A 1QBJA 1GVJA 3RYRA 1HKTA 1R1TA 4L9TA 2EB7A 4OOIA 3G73A 5TRDA 3EYYA 1ZYRF 2A6EF 1HBXG 2STTA 3KP3A 2XAJA 1K78B 3U1DA 4MTDA 2FBHA 3QP5A 4L9NA 4ZYEA 2DI3A 3MZYA 3WTVC 4Y13A 2H6CA 3KFWX 4U0YA 3FXUA 1FLIA 4HF0A 4N0BA 3TO6A 2IRFG 5HOOA 4I02A 2EFQA 4KDPA 2OU2A 3F22A 3FX3A 3KP5A 3CUQC 1MDMB 3CTAA 2HEOA 2XKOA 2MA3A 4LB6B 3K1MA 4ENNA 1WWXA 1IF1A 1EH8A 2OA4A 4F7ZA 1BIAA 3I58A 3C7JA 4ENJA 4N9IA 2YU3A 2YX7A 4OIPF 1B6AA 5DCMB 3WTUC 2KIFA 3L00A 4G6QA 3ECOA 3GLXA 1D8JA 4S05A 3WU0A 3I4PA 5LRRA 4AIHA 4ASNA 4HQEA 2NNYA 1MZBA 4G6DA 2MLKA 4L0YB 3ZP5A 4M6YA 4LK1F 5FD5A 3BPXA 3H3UA 4M9XA 2HDCA 1BM9A 4BXUA 4G7HF 2DTRA 3IL2A 2D2WA 4Q5SF 3P9IA 2XROA 1XGNA 4KN4X 4L18B 1B4AA 1FBSA 3GFLA 5FLXK 4G7OF 1BC7C 3J80Z 3BWGA 2ELHA 1I1GA 1IRGA 3BJOA 2V9VA 2KRFA 4IRGA 5IT3A 3HRSA 1XGOA 2HQRA 2UWMA 3L9FA 3RKWA 2XGXA 2CFXA 1CF7B 3V8LA 5KVRA 3E6BA 3MWMA 2PN6A 1O7LA 5HDGA 1ON2A 1OMIA 3QPTA 1R22A 3I59B 4A5NA 2STWA 1HW5A 4R79A 5CVUA 4S04A 1ZG3A 1Z05A 4DQ2A 3EYIA 3FZVA 1SFUA 1I5ZA 5BPDA 3I0TA 1R7JA 1OPCA 4BHCA 2V1UA 3WGIA 1IUYA 4EGYA 2FRHA 4IF4A 3FM5A 1FC3A 3KZZA 1XB4A 1J75A 2XUBA 5ICFA 3I64A 1S3JA 2LNBA 1UFMA 2H09A 4IVNA 4KYWA 1YTYA 3FMRA 3VEPA 2PI0A 5J6XA 1XMKA 2QLZA 1J5YA 4LLGF 4GGGA 3F72A 2PMHA 3W6KB 2WTEA 4EVIA 5HLHA 2D45A 3CO6C 3KEQA 2XIGA 2A68F 1P92A 4WCGA 5K5RA 4LG0B 5FFXA 5E8GA 1S6LA 3O6BB 1XGMA 1UCRA 3TDUC 3E6DA 1G6NA 1KQ0A 2M1BA 2PJPA 3LAPA 2M87A 3TOAA 4DNCA 3O2PE 1AOYA 3GFJA 2ESHA 3I53A 5L3FA 5BPIA 3E3VA 1ZGJA 5ICEA 5K1YA 3B02A 2YSRA 4JQFA 5CYVA 3HOTA 4QWQA 3I71A 3P9CA 3F8CA 4E70A 2R7FA 4L5JA 3DV8A 1EH6A 2EV5A 4MTEA 2ZJ2A 4I98B 3R6SA 1BI3A 2L54A 4MNUA 4MHGA 4ZYGA 1LDKB 1FP2A 1ZAOA 3M7GA 1FT9A 2FNPA 2O6GE 3KP4A 4OMYA 1YW8A 3T8RA 4IHSA 3SZPA 4HX4A 4K2EA 2ZFWA 4U7BA 4YIIA 5D5WB 5LGUA 1K6OA 1IXSB 3CUQB 4U0WA 3IKTA 1J9IA 1PDNC 1HQCA 4BYYA 1FBQA 4RB2C 2A69F 3GZ5A 1KU3A 1X3UA 2W84A 5D4RA 2BBYA 2W25A 1ULYA 1BC8C 4BHBA 5E20A 3J80K 2ISYA 1J7KA 3U9GA 1R5GA 2O03A 2QBYB 2PEXA 4XSXF 3QAHA 2YX4A 3ISPA 1HSTA 5J8FA 1KU7A 4A2UA 2Y0MA 1YW9A 2HTSA 4WXCA 3E6CC 5L3GA 2E1CA 3B73A 4O5VA 3IWFA 1O3RA 4RGSA 4XRFA 2JTVA 1ZG1A 3LSTA 3TDZC 2QWWA 2QQAA 4M71A 2D1VA 2OAZA 4RGUA 1ZGAA 5CJ9A 4HAMA 1W7PA 1XSVA 1F4KA 2ZXJA 1Z1DA 2CG4A 3LA2A 3D5LA 2DFIA 3V4GA 3P9KA 5KK1A 5HLGA 2M30A 1R23A 4FHTA 1SFEA 2RQPA 5BOXA 3EQLF 3VFZA 1OR7A 1WRJA 3KE2A 2JPBA 4ESJA 5E1ZB 5CVJA 1T6SA 1SMYF 3IWZA 2MC3A 3GWZA 2DO7A 1YQAA 3ZMZA 4M9SA 4AVPA 1GXPA 1BOAA 4H0EA 4M6XA 2KIUA 5CVRA 5A2QZ 1S7AA 4GYGA 2VC1A 3F21A 3WGHA 2E7XA 4M72A 5E1WA 2Z99A 2Q2EA 3W6JB 4YIFA 2FBIA 4KMUX 5D8KB 2HQNA 3GZ6A 1LEBA 1BI0A 2JRTA 2V79A 5FD6A 5ERIA 3KETA 2FF4A 5ICCA 4A6EA 1TW2A 1R58A 4EGZA 3WU1B 1LDDA 4GXOA 1FZPB 5DEQA 4HQMA 2CYYA 1TTYA 2IP2A 2PBIA 3V7CA 1QPMA 4IRHA 2MH9A 3BPVA 3E5XA 4A12A 1U8RA 1HXDA 4GYIA 1IXCA 5BMZA 1BBYA 2VE8A 2HWVA 2M8EA 1SAXA 2YPRA 4OIQF 1I6XA 1IN4A 1J2XA 4GCVA 1E2XA 1TQPA 5H20A 1ZN2A 4MQVA 2A5YB 3SZTA 3DQVC 1YIOA 4A0YA 2E7WA 5L3DA 5D8LB 3COAC 1FPQA 1OYWA 1BIBA 5H6QA 3DP7A 4RB0A 3LAJA 1RUNA 5D6EA 3G3ZA 4BHPA 1O57A 3RPQA 3GUDA 4A0ZA 2MD5A 4N9HA 3DPLC 1IW7F 2OZ6A 1IN5A 2EK5A 1UHWA 1Z9CA 3BOQA 2G9WA 3M1EA 2HOEA 3VODA 4IPAA 2ZO4A 2DBBA 2XVCA 4LJZF 5DCFA 4LD5A 1D8KA 2XAGA 1W5TA 1RUOA 1QO0D 4HA8A 1KU2A 1R00A 4KIBA 5D4SA 1TQMA 5FGMA 3FWEA 3GO5A 3M8FA 1XSDA 2K86A 3HTUA 4BQAA 2G7UA 3RTRA 3GYHX 4MEYF 5D5XB 3F23A 2OZUA 5DD4A 3VB2A 4I09A 3HSFA 2FOKA 1R1UA 2KJBA 2EJRA 1FSEA 3Q5FA 3RDIA 2L4MA 2FNAA 2QM3A 1W5SA 2QENA 3CLOA 3F6OA 4EJUA 5TJJA 1W7PD 3KP6A 4ZYDA 3RYPA 2OQGA 2P7VB 2O61A 3GFMA 2G7HA 3DXJF 5LHGA 2RNJA 3M9AA 3ZQ7A 4P5OA 2LF7A 1MJ9A 3BJAA 3C1DA 1FYLA 3DEUA 4LB5A 2BGCA 5JVTA 2PLYA 1I1SA 2W57A 2JPCA 1HW1A 5ILVA 2FMYA 5LGNA 4UUVA 2EFPA 2KJCA 3KCCA 4HZFA 3AAFA 2VC0A 1V3FA 3HOSA 1CF7A 2BE5F 1O3QA 3HRTA 4ESBA 1T39A 3QU3A 3V8JA 2GWRA 1S7OA 3I5UA 3JAMZ 4IHTA 1ZRFA 4EJWA 2DQRA 2DW4A 1IXRC 2A3SA 4A0XA 1ZRCA 1FYKA 2OQRA 4WX9A 4CDGA 1TBXA 3R0JA 1B1BA 3IC7A 2K02A 2JZYA 2IA0A 4OMZA 1TNTA 1L3LA 2D1HA 3JAMK 2IT0A 4HF1A 1IRFA 2LF8A 4I2OA 1SD4A 1ZARA 2VBWA 2XHKA 3CJNA 4U0VA 3MCZA 1HKSA 1MD0A 5E8IA 3GW2A 3T1BA 2R7DA 2XASA 3EDPA 3P7NA 1A04A 1Z6RA 3R4KA 1VTNC 4B09A 2P7CB 3ABUA 4L9JA 1R1VA 2QBYA 2PQ8A 5HS7A 3KP7A 2OBPA 5ILSA 2VODA 2IVMA 2Y48A 5IT9Z 3MFKA 4HOBA 2L02A 1QNTA 2COMA 4XSZF 1ZHFA 3QU6A 2MBFA 3ELKA 1HW2A 1ONVA 2EV6A 3TKYA 4RGXA 1KA8A 2CWEA 2ADUA 2F5EA 4WK8F 3QP6A 3MEXA 5HDKA 3N97A 1Z91A 2XKPA 4P96A 1WI9A 1PP8F 1J59A 3ZN1A 4R1HA 5IT9K 2FSWA 3IRRA 2DQLA 1ZREA 2HKXA 2UXNA 4EM2A 4PCQA 1U3EM 1HKQA 3E97A 3HHHA 1FWZA 1YS6A 5CVIA 5F6FA 2NRAC 3WTYC 3BJ6A 1ZLJA 3DF8A 4HX7A 1LQ1A 3GEZA 4NHJA 3L09A 2BEOA 3DKWA 4M9ZA 1UHMA 3JTHA 1BI1A 1P4AA 1Q1HA 2EA4A 3T5XA 4ZZDA 3L2CA 5AIQA 1YW7A 1QZZA 4HF2A 3SHFA 3M8EA 4HBLA 1Z6TA 4FT8A 4O3MA 2QQ9A 2RV8A 2HTJA 4B8XA 1QQIA 2HKOA 2P8TA 3O3KA 3RPUA 5JFRA 3V7RA 3BROA 2V1XA 2XAQA 3LQQA 4ZH4F 3FM3A 1TW3A 1ZLKA 3HSEA 4MGRA 4P55A 1MJBA 5L3CA 4UVBA 2XAFA 2DK8A 2E1NA 3EETA 1P4XA 5FLXZ 1YO5C 3KP2A 2GXBA 4EV0A 4ENMA 4RGRA 3NEUA 4NQWA 1DUXC 3J7AO 3JTGA 4JK1X 1ODDA 4YG2F 5D5VB 2K27A 2AXLA 1RIOH 2QUFA 3FHZA 3OOPA 5AIPA 4EQQA 3E5QA 3CDHA 2UXXA 1B59A 1O3SA 5HLIA 2P5LC 2XV4S 2L01A 4RB1A 2WC2A 4ETSA 2FEZA 3WGGA 3NRVA 1JGSA 1OYYA 5LEKA 5F64A 5CLSA 5HS8A 4I0BA 1G3TA 1T0FA 4BAYA 2WWYA 2LDUA 3WTZA 5K5OA 1S8NA 3LWFA 2ZMEB 1REPC 4UV9A 4EMSA 4LLNA 2L4AA 4O6JA 4AIKA 3REOA 2H94A 3QPHA 4P9UA 4HV5A 4Y15A 2AS5F 2VOOA 3R0AA 3SXYA 2EWNA 1XCBA 5D6FA 1KYZA 1YLFA 2FXAA 1KU9A 4Q47A 3CO7C 2HGCA 3V7SA 2J5OA 3ML6A 4ESFA 3ABTA 5FB2A 3V8KA 3KEOA 3HSRA 2ZNYA 4PDKA 1L0OC 5L3EA 4U88A 5LRSA 4WXDA 2X4HA 3R60A 3MQ0A 1G4DA 4CHUA 2GA1A 3WG9A 4IRIA 1C0WA 1DP7P 2DK5A 1WKMA 4WF2A 3D0SA 3FXQA 1XDUA 2QZ8A 5E1XA 5LGTA 1IN6A 5LHHA 3ROUA 2NAZA 2ZMEA 1KQ8A 4AD9A 2VN2A 5DUKA 3KLNA 1JXSA 1XGSA 2GXGA 2RKHA 2ISZA 2IJLA 2ZBKA 3GF2A 4TV7A 2FU4A 4G9YA 1SD6A 2P5KA 1STZA 3NQOA 2FA5A 3PQJA 3FMSA 2VT2A 2ZNZA 3JSPA 1LEAA 4A5MA 2P4WA 3WE3A 3EUHA 4YFNF 3HUGA 2RGVA 1SMTA 3PFIA 2C6YA 3K0LA 2VBXA 1DPRA 1USTA 4I01A 1T2KA 1CGPA 5HDNA 2VONA 1IN7A 1GXQA 1J0RA 6PAXA 3TO9A 1W4MA 1JHHA 2YR2A 4UVAA 3TQNA 5ILUA 3ZMVA 2NS0A 3VOEA 3QOPA 2GQQA 1D5VA 1B9NA 1FNNA 3N4MA 3BP8A 2HZTA 1OYIA 2QYOA 4FX0A 1B9MA 3WTXC 2P6SA 2IPQX 1P2FA 1EH7A 2RN7A 2Z5UA 4PZJA 2K4JA 2BV6A 4CICA 4YFKF 2P6TA 4CXFA 2CO5A 2Z3YA 4Q4ZF 1USSA 5DCMA 5DD8A 3R61A 1BI2A 4OIOF 3WTTC 4A6DA 3F8BA 2FMLA 3C3WA 1UB9A 4EM0B 4PGGA 2PG4A 4KUMA 2XAHA 1D3YA 3K1PA 3I59A 4ON0A 4CYDA 4CGZA 3ZN0A 4OIRF 3WE2A 1QGPA 3E5UA 5H6RA 3MAJA 3F8NA 1TLHB 3GXOA 1HSJA 2UZKA 3LA7A 1MKMA 3ZMDA 1SD7A 2Z33A 1QZYA 2EFWA 5AONA 4U7DA 5DUIA 1KGSA 2O0YA 3GVAA 1JHFA 3HHGA 1AWCA 1R5HA 3JW4A 3Q9VA 2ACJA 1G3SA 5L3BA 5J8CA 1H0MA 3ECHA 3TOBA 1Z7UA 4WXHA 1E17A 4XBFA 1ZG5A 1K79A 4LFUA 1WQ2A 4HYEA 2NYXA 2PMUA 3FXRA 4HDVA 2TDXA 1DPUA 4AIJA 2V6CA 4QLCU 3F8FA 2VXZA 5LLQA 3DFGA 2B0LA 2Q0OA 5D5UB 2MH2A 2A61A 5DDGA 3ULQB 4JBAA 3E6MA 2RVCA 3RKXA 3SFZA 3WTWC 4Y17A 1I27A 2IA1A 1DDNA 1RI7A 2OD5A 4LMYA 3IHUA 4I0AA 5CVVA 2DPDA 2KKOA 1YYVA 1S29A 3TGNA 2M45A 2QVOA 4CO8A 2ZCWA 1LDJA 4KIGA 3T0YA 5BS6A 3GX4X 2IW5A 5DYMA 1GHCA 2Q8KA 5HS9A 4RS8A 1IAWA 2P5VA 4P9FA 1FP1D 5A2QK 3JSOA 4ZYHA 1FOKA 3K1NA 3J81K 4UNOA 4LLLA 5E17F 4Z2YA 1MJAA 4HDUA 3F6VA 4L9VA 2PFBA 1F5TA 4L5IA 3CUQA 5LEJA 3HIFA 2VBYA 3F3XA 2R3SA 5HVQC 1U6GA 3TO7A 4AWXB 4Q48A 2IA2A 2CQKA 1O3TA 1XCVA 3HRUA 5K5QA 1KQ9A 2H6BA 2O3FA 3K9TA 4KFCA 3J81Z 2DPUA 2RC4A 2MLGA 3HTSB 4LG0A 1MGTA 4UHTA 2ESNA 2GZWA 1FYMA 2FE3A 3T8TA 3LQRA 1U5TB 3KLOA 1RZ4A 4EJVA 1FY7A 2QQBA 1T98A 4KN7X 3S2WA 4G7ZF 1BN5A 1G3YA 5E18F 1LB2A 2JSCA 4XLNF 2LKPA 2ETHA 4YFXF 2O8XA 2K7LA 4LK0F 2V1DA 4HX8A 3ZMTA 3FF5A 4D0PA 3IKVA 2DLLA 2X0LA 3WODF 2F5FA 4G94A 2Y75A 1ZRDA 3H92A 2HS5A 2CGPA 1U2WA 2XRNA 3KZYA 3LA3A 2EFOA 2CSOA 1K7AA 1XD7A 2L3DA 4CZZA 2W85A 4XLPF 3BZ6A 3WTSC 1YS7A 1RNLA 4KIFA 2VT3A 3RI4A 1XMAA 3ZPLA 1JE8A 2NNNA 2VBZA 2DAOA 4IXAA 2M5WA 1PUEE 2HYGD 2CW0F 5DV5A 3F8MA 1P6RA 3K2ZA 1YFHA 1R36A 4M73A 4EJTA 3LFKA 4FX4A 4OINF 2EFNA 3DPTA 4GO1A 1H9GA 1LVAA 4NB5A 1TQIA 5JHUA 2BYVE 4R8HA 4EM1A 3BY6A 3MZHA 1K78A 4HLYA 2A6HF 4EJOA 1LJ9A 1EV7A 1G3WA 3CUOA 2JT1A 3HYIA 1O7FA 4KICA 1U78A 3HRMA 4M74A 4UXNA 3BDDA 2FBKA 2F2EA 1T38A 1LNWA 2EA2A 4KT5C 1ON1A 3OV8A 1BJAA 4WWCA 5JI6A 3FMQA 4UV8A 3QRFF 1H9TA 1XSXA 4RAYA 4RAZA 2W24A 4BNCA 3ZMUA 1KYWA 5FO5A 2LSOA 4HLXA 4G8XA 5LBQA 1SD5A 2DU9A 3I54A 2A07F 2HR3A 2HFHA 1F1ZA 4LGWA 3Q9SA 1U5TA 4HW0A 2ZKZA 1IN8A 3RIRA 3GFIA 1Y0UA 1SFXA 1ZH5A 2H27A 3RKYA 4PGHA 1PP7U 1WSUA 3H3ZA 1TNSA 4RB3C 2GAUA 4OU0A 4KMFA 5ED4A 3L7WA 3ZMSA 2DT5A 5ICGA 4HV6A 1NHAA 4ENKA 4KNYA 2GIVA 3C18A 4UVCA 1XDSA 1OKRA 2WV0A 3SQNA 5FFZA 2Z9OA 4BH9A 1FSHA 1FX7A 5BQTA 2GA2A 2KIMA 1FBUA 1YG2A 4MQ9F 5EEGA 4KA4A 2EV0A 4I7HA 5JR3A 3K69A 2F5CA 3PQKA 2J5PA 3U2RA
chains in the Genus database with same CATH superfamily
1H8AC 5B1AH 2LYCA 5EEHA 2CU7A 3D5SC 2K4BA 2IGMA 2VE9A 2IGNA 3RJPA 4Y7NJ 2KT0A 2RDPA 1WPKA 1XN7A 1W7PB 4MEXF 3JCUC 2HYFA 4ZZLA 1OISA 1LFPA 1SFKA 2DA5A 3EUHC 1F9NA 5DM7F 1N25A 2F5DA 1P4WA 1MDMA 3OYJA 1U5TC 4IJAA 4L0ZB 3BZCA 4A69C 5LHIA 2VB6A 3CJQB 1V4RA 4XNFA 3S2HJ 1IZ1A 2RAEA 2VOPA 3ERED 1MMSA 2LBFB 3IRQA 4IHWA 4A93J 3BG3A 4XQFA 3WHBA 5F1RA 4BJ6C 1X1BA 2FQ3A 1GVJA 1QBJA 3RYRA 1Z67A 3RPUD 1R1TA 1HKTA 5CPRB 2RREA 4L9TA 1IDYA 2EB7A 2LY9A 4OOIA 3K10A 4JX5A 4ZC3A 2BY2A 3G73A 5TRDA 3CD6I 4OAYA 3VWBA 1VF9A 2CQQA 3EYYA 1ZYRF 2ZB9A 2A6EF 1HBXG 1GV2A 2STTA 2ECCA 3S14J 3KP3A 2KHMA 1Y8RB 1OFCX 3OY9A 2KLOA 2XAJA 3HB9A 1K78B 3G2BA 3PUFA 2UUZA 4LITA 3U1DA 2HQAA 2X6YA 2HPMA 4MTDA 4XLAA 2FBHA 4I6ZA 3QP5A 4L9NA 4E7LA 1FMVA 4ZYEA 4ZYAA 5HLTA 3W2AA 4F91B 2DI3A 3ZR8X 4BE1A 2M3AA 3HM5A 3MZYA 2AQFA 3WTVC 4Y13A 4UUSB 1VQPI 1WH7A 2H6CA 4XLCA 3KFWX 4U0YA 3LOCA 1Z3YA 4NBQA 3C2GA 2Z2SB 3FXUA 2CS3A 3H9JA 1FLIA 2EZIA 2OV7A 3OR2C 2HYJA 4HF0A 3BT9A 3AG2H 1OCCH 2QSGX 4N0BA 2V9KA 3TO6A 3OWTA 2I10A 2XPUA 1E3PA 3S8PA 4I02A 5HOOA 2IRFG 2JVGA 3TP0A 2EFQA 4KDPA 3J7ZI 2F4IA 5F27A 2L9VA 2OU2A 3F22A 5GAHJ 2LD5A 2M9HA 3FX3A 3KP5A 3CUQC 1MDMB 4B1RA 1QRYA 3CTAA 4H4KC 1BW6A 2HEOA 2XKOA 2MA3A 4LB6B 3K1MA 4ENNA 1WWXA 4YIRX 4B44A 1VQOI 2ZMEC 5IP7J 2H8RA 5M5XJ 1IF1A 1EH8A 2OA4A 3I9V2 4PJNA 4F7ZA 1BIAA 3I58A 2JSPA 3KX2A 3C7JA 4ENJA 3A0BC 4N9IA 2NOGA 5C3EJ 3LSJA 1F36A 3K70C 1CQTA 2Q2EB 3FHNA 4BXFA 2YU3A 5F0FA 3TMOA 1YJ9I 1P7IA 2YX7A 3GCMA 1MMAA 2L2OA 3IAS2 3LL7A 4OIPF 1B6AA 5DCMB 3WTUC 3JRAA 4BU2A 1HCRA 2KIFA 2KP6A 3L00A 4G6QA 1YRNA 3ECOA 3GLXA 1A35A 1D8JA 4S05A 2DMNA 2HOTA 3GTKJ 3WU0A 3FXJA 3I4PA 4MO7A 5LRRA 4AIHA 4NUBA 4ASNA 4HQEA 5GTHC 1JUPA 3ZQQA 2NNYA 1D0XA 3HEFA 1UELB 1MZBA 4G6DA 4RAGA 4XLHA 4DOZA 2MLKA 4L0YB 2RQQA 3ZP5A 4M6YA 4LK1F 5FD5A 3BPXA 3H3UA 4M9XA 5GADJ 2LY1A 2CQ7A 2HDCA 4DBQA 1BM9A 4BXUA 4G7HF 2DTRA 3IL2A 2D2WA 4Q5SF 3P9IA 3W2VA 2XROA 1Z77A 1XGNA 4FTHA 1YOVB 1MBGA 3ZQLA 4KN4X 4L18B 3PNYA 3O8HA 3CC2I 1B4AA 1D1BA 4EEFG 1FBSA 4A3KJ 1O4XA 2JA5J 3PSIA 3GFLA 4F92B 1D1CA 4A3FJ 5FLXK 4EATA 4MIMA 5HNHA 5C4JJ 4G7OF 1BC7C 1F43A 3H9QA 3J80Z 3BWGA 2ELHA 1I1GA 1IRGA 3BJOA 2V9VA 3CCUI 3FXOA 2KRFA 1IRZA 4IRGA 5IT3A 1SC7A 3HRSA 2BY3A 1XGOA 1K4SA 2K9NA 2HQRA 4PFOA 2JQ7A 2P0WA 3H0DA 2UWMA 3LSIA 5JVGF 3HZJA 4NC8A 2CW8A 3L9FA 3BR5A 1DU0A 5K7HA 1JI8A 2BXYA 3FISA 3RKWA 2XGXA 2ZFUA 1UAAA 3I4NJ 2CFXA 1CF7B 1RETA 1V5EA 2HDDA 3V8LA 1ETOA 1YIJI 5KVRA 4XLFA 3E6BA 3MWMA 4JX6A 4A3JJ 4DYCA 2PN6A 1O7LA 5HDGA 1M1EB 1ON2A 3CMMA 1GLNA 1OMIA 4PJLA 1SVOA 3QPTA 4C3IJ 3PFYA 2R7ZJ 1R22A 5EGOA 3I59B 1PYVA 4A5NA 2STWA 1HW5A 4J00A 3FK6A 2CFOA 4A3MJ 1ERDA 2CUZA 1VQ5I 4R79A 2B63J 3BG7A 5CVUA 4S04A 4CCMA 1ZG3A 1Z05A 2LRDA 3GTGJ 4KJZA 3TBIA 2M2EA 4DQ2A 4RM3A 5LD2C 3EYIA 3OYLA 1IV8A 3FZVA 1SFUA 1I5ZA 4CUGA 5BPDA 3I0TA 1R7JA 1OPCA 4BHCA 4CSWA 1OCOH 2V1UA 1W0UA 2X48A 3WGIA 4UUTA 1W36C 2LKSA 4DZJA 1IUYA 1WJAA 2W7NA 4EGYA 4CYCB 4XRSG 2FRHA 4IF4A 1POGA 3LSKA 3FM5A 2XB0X 1W0TA 1FC3A 2L7KA 3KZZA 5GAGJ 1BL0A 1XB4A 4BGDA 1J75A 2WB1N 4BBSJ 2XUBA 5ICFA 3I64A 3BQZA 4J19A 1S3JA 4XL9A 1ETXA 1QA6A 1Y6IA 2LNBA 4FASD 1UFMA 2EBIA 2ME0A 2H09A 2CMPA 4BJ5C 4MFEA 4IVNA 4KYWA 1YTYA 3SEZA 3FMRA 2DT6A 3VEPA 4XKVA 1E0EA 5KCMA 2PI0A 4XMYA 1NK3P 5J6XA 4ABZA 1Y56A 1XC5A 2JA6J 1SAUA 1XMKA 2QLZA 2M4KA 1J5YA 1YJNI 4D1QA 3JREA 4LLGF 2KPMA 2ZSIB 4GGGA 3F72A 2PMHA 2OTLI 3W6KB 2WTEA 4HSRA 4EVIA 2DJNA 1VQ9I 4M3EA 5HLHA 4GFBA 1YE9A 2D45A 3CO6C 2K3FA 3L2VA 5FRNA 1RESA 1RC9A 3KEQA 1E3OC 2XIGA 4E7ZA 1ACIA 2A68F 1P92A 4C2UA 1ZELA 4WCGA 1LFUP 3QWLA 5K5RA 2LTPA 4UUSA 1Y0NA 3MD2A 4A3EJ 4LG0B 4QPQA 1MNMC 5FFXA 1WGXA 3OS2A 5E8GA 1S6LA 3O6BB 4D7MA 2FUG2 1XGMA 3G4SI 1UCRA 3TDUC 3MMYB 3B6CA 3E6DA 1G6NA 1KQ0A 3K6GA 2M1BA 2Z16A 2PJPA 3S1MJ 3LAPA 1FTZA 2M87A 3FDYA 1LKXA 3TOAA 3O2PE 4DNCA 1UMQA 4ZJZA 1AOYA 3CCSI 3GFJA 2ESHA 3I53A 4X1EA 5L3FA 1SANA 2E5NA 5BPIA 4QSHA 3E3VA 3W6VA 1ZGJA 4ZTJA 5FROA 1MIJA 5ICEA 4NDLA 5K1YA 4X6AJ 4PFPA 3B02A 3D1NI 2YSRA 5GPAA 3L2RA 2XRLA 4JQFA 1JTYA 4CH7A 5CYVA 3HOTA 4QWQA 3DPUA 3I71A 3P9CA 3CC7I 3F8CA 2M0CA 4E70A 5IOYA 2R7FA 4L5JA 2JVHA 4JX4A 3DV8A 1EH6A 2EV5A 4MTEA 1TT0A 2FD5A 2ZJ2A 4I98B 3R6SA 1BI3A 2L54A 4E4HA 4MNUA 3BG6A 2LBFA 4X0GA 4MHGA 4ZYGA 1LDKB 1FP2A 1ZAOA 3M7GA 3LMMA 2QKMB 1FT9A 2FNPA 4HG2A 2O6GE 1HOMA 2KISA 3KP4A 2JA8J 2XAUA 2VJ4A 3VYSB 1YW8A 3T8RA 3FBNB 4OMYA 1FOWA 3BCBA 4IHSA 3SZPA 4HX4A 1T0FC 2ZFWA 4K2EA 4U7BA 2WV1A 2LLKA 3L2QA 4YIIA 2UV1A 1MBEA 5EEAA 1NG7A 5D5WB 5LGUA 1K6OA 1IXSB 5EDNA 2VQCA 1FMWA 3CUQB 1RR7A 3A03A 2Y0SN 4U0WA 3IKTA 1XS9A 2TCTA 3M3YJ 1J9IA 3Q0WA 1PDNC 1UZCA 1HQCA 4Y3OA 4BYYA 3BQYA 1B72B 1FBQA 1H88C 3E0JB 4RB2C 1ETQA 2Y30A 3GZ5A 2A69F 1KU3A 2IBDA 1X3UA 2W84A 5D4RA 2BBYA 2W25A 3MKLA 2LG4A 1ULYA 2M0MA 1BC8C 4BHBA 3AG3H 5E20A 3J80K 2HVQA 2MABA 2ISYA 2M4GA 1J7KA 5EGOB 4CCKA 3U9GA 1R5GA 2O03A 2R5YA 4LIVA 3G1OA 2QBYB 4DW6A 3OS1A 1U0JA 2PEXA 4XSXF 1KZHA 2YX4A 2JN6A 3QAHA 5IOZA 1JJ8C 3ISPA 1HSTA 3QOEA 4PSWA 5J8FA 1KU7A 3GTPJ 4A2UA 2Y0MA 1YW9A 2HTSA 4FISA 4WXCA 3E6CC 5L3GA 5F08A 2E1CA 3B73A 4O5VA 1JTXA 3IWFA 2HZDA 1TWAJ 1NG6A 1O3RA 2JUCA 4RGSA 2JA7J 2HPIA 4XRFA 1VQKI 2JTVA 2HQ5A 1ZG1A 3RZOJ 2YS9A 3HOXJ 4M3GA 3LSTA 2AXTC 4XN0A 3TDZC 2QWWA 2QQAA 4M71A 2D1VA 2OAZA 4IHXA 4RGUA 1ZGAA 3EPZA 3M07A 3C2BA 1W7PA 4HAMA 5CJ9A 1XSVA 5HODA 3H5RA 5J1UA 1F4KA 2ZXJA 1Z1DA 1RKWA 4C2MJ 2CG4A 5E3OA 1YX5A 4AYBA 4V19K 3LA2A 3D5LA 3CCMI 3TEDA 2DFIA 3V4GA 1FJLA 1I3QJ 1LVKA 2Z1DA 3P9KA 5KK1A 2M30A 5HLGA 1R23A 4B4CA 4LG3A 4FHTA 2K5CA 1SFEA 2RQPA 5F04A 5BOXA 2QCOA 3EQLF 3VFZA 3CP8A 3W2WA 4D9JA 1OR7A 1WRJA 3OMYA 3KE2A 2JPBA 4ESJA 1A5JA 3RQ4A 1LE8A 5E1ZB 5CVJA 3G1MA 3PIOF 1T6SA 1SMYF 2EIKH 3IWZA 2R7RA 1R4MB 1QVUA 2MC3A 3GWZA 2JWTA 2Y9ZA 2DO7A 3LNQA 1YQAA 2RNGA 2BY1A 4M9SA 3ZMZA 4AVPA 4B43A 1GXPA 1BOAA 3NAUA 1T56A 4H0EA 2X6WA 4M6XA 4A3DJ 2KIUA 5GAEJ 4UY8I 5CVRA 4AU7A 4BQOA 4C3HJ 5A2QZ 1S7AA 4GYGA 2VC1A 3OIQA 5J1RA 3F21A 3WGHA 1VQLI 2E7XA 2F6CA 5IPAA 3FKIJ 4M72A 5JLWA 1LUJB 5E1WA 2Z99A 2NS8A 2LKXA 2Q2EA 3W6JB 2X51A 2KIQA 4YIFA 2FBIA 1S5LC 4KMUX 4OWRB 2BXZA 2QF7A 3QYEA 5F0HA 5D8KB 5M3MJ 1BJZA 2HQNA 2Y2ZA 3WU2C 3VSKA 3S3NA 3GZ6A 1D1AA 3K4NA 1LEBA 4I99C 3MKWB 5IP9J 1BI0A 2JRTA 2V79A 3JRDA 5FD6A 5FKNA 5ERIA 1HC8A 2DYSH 3OYFA 1Y1WJ 3KETA 2FF4A 1DGWY 5ICCA 5F1JA 1ZR2A 4F93B 4A6EA 1TW2A 1R58A 2LMDA 4EGZA 3WU1B 1A31A 1LDDA 4GXOA 3H36A 1FZPB 5DEQA 2Y69H 1MMDA 2HU9A 4FE7A 3MN2A 4HQMA 3RQIA 2CYYA 1TTYA 2XPVA 2IP2A 2PBIA 3DKYA 3V7CA 3HPHA 1QPMA 2R7TA 2W4SA 4IRHA 2MH9A 3BPVA 1QPIA 3E5XA 4A12A 1U8RA 2CV0A 5H2FC 1HXDA 2E1MC 3DTKA 4CZCA 4GYIA 1IXCA 3PL8A 1IJWC 2HNHA 5BMZA 5DTDA 3P5JA 1BBYA 2JA2A 2V1NA 2VE8A 2HWVA 2M8EA 1SAXA 2VLAA 2YPRA 4AYBN 4OIQF 1I6XA 1IN4A 1J2XA 4GCVA 4D5FA 1E2XA 2E34A 2HI3A 3RCOA 3PO3J 1TQPA 5H20A 3JRHA 1UHSA 1BR2A 4PUSA 2R5ZB 4A3CJ 3SFIA 1IDZA 1ZN2A 2DOAA 4MQVA 1RRJA 2A5YB 3SZTA 3DQVC 1YIOA 1ZK8A 4A0YA 2E7WA 4BY7J 5L3DA 4HRIA 3OYHA 2DA7A 3S3OA 2PMZA 5D8LB 4AVZA 3COAC 1X4PA 1FPQA 3ZQHA 1OCTC 1OYWA 3HBLA 2DFFA 1BIBA 2COBA 2F4OB 4CCOA 3CDIA 1B72A 5H6QA 3HJEA 3DP7A 4RB0A 4GDFA 1U9NA 3LAJA 1RUNA 5D6EA 3G3ZA 4BHPA 4XN3A 2DDBA 3PNTA 4W97A 2MFZA 4IL6C 2VKHA 1O57A 2ZSHB 3RPQA 2NVQJ 3GUDA 4A0ZA 3EUAA 2MD5A 4N9HA 5KAFC 5B3SH 2ZXHA 5M5WJ 3DPLC 3OS0A 1IW7F 3D5RC 1S7EA 2K9QA 2OZ6A 2E2HJ 3CQZJ 2E35A 1IN5A 2EK5A 3GMEA 1Q1VA 2K85A 1UHWA 4BQQA 3BOQA 1Z9CA 2G9WA 3M1EA 3OIPA 3RKQA 4M3DA 1OCZH 3MKYB 2HOEA 3VODA 5M3FJ 4IPAA 2ZO4A 2DBBA 3DU6A 2XVCA 3HOVJ 2HDWA 2VQHA 1AKHB 4XR6A 4LJZF 1X1AA 5DCFA 2CUJA 4LD5A 1D8KA 2XF6A 2XAGA 3ZGKA 1W5TA 3M4OJ 4XM3A 1RUOA 2HOSA 1WZ2A 1QO0D 4HA8A 2PMZN 4Y4RA 3I56I 2DA4A 4FQGA 1KU2A 1R00A 4KIBA 5D4SA 1TQMA 5FGMA 3QQAA 4PJMA 3FWEA 4NC6A 4RAFA 3GTLJ 1FIPA 3GO5A 3M8FA 1XSDA 2K86A 3HTUA 1IG7A 4BQAA 2VI6A 3HC7A 3OYNA 2HOAA 1X1PA 2G7UA 2IXSA 3RTRA 3GYHX 2ID3A 4KITB 2N8GA 2E60A 3M1CA 4MEYF 3HDDA 2EZKA 5D5XB 3F23A 3A01B 2OZUA 5DD4A 3OYKA 1R9TJ 2X1EA 3VB2A 3HG9A 4IOCF 1B8IB 3BR1A 4I09A 3HSFA 2FOKA 1R1UA 2KJBA 2XB5A 2EJRA 1FSEA 1RR8C 5DM6F 3K4BA 3Q5FA 3RDIA 4E7KA 3BR3A 2L4MA 2FNAA 2QM3A 1W5SA 2QENA 3CLOA 3F6OA 2R93J 4EJUA 5TJJA 1W7PD 3L1PA 3KP6A 4ZYDA 4U87A 4AUXA 3BG9A 3RYPA 2QA4I 2VPRA 5JHFA 2OQGA 2P7VB 1TL8A 3K4CA 5CQEA 1X58A 4XOTA 3GFMA 2G7HA 5EG0A 3SJMA 3DXJF 2O61A 3CMAI 5KHDA 2FX0A 2KFDA 1QHHD 5LHGA 2RNJA 3M9AA 1MBHA 5HNFA 2H1KA 2OTJI 3MZ8A 4DYRA 1XG1A 3ZQ7A 4P5OA 3JRCA 1LE8B 1FIAA 4C3JJ 1R49A 2LF7A 2JMWA 1MJ9A 3BJAA 3C1DA 1FYLA 4D7NA 3DEUA 2FQ4A 3CCVI 1Z0XA 4LB5A 2BGCA 5JVTA 2PLYA 1I1SA 5B66C 2W57A 1BR4A 3PUBA 5E3NA 2JPCA 1HW1A 2WY7Q 3BC8A 5ILVA 3CMEI 2FMYA 3LSMA 5E3MA 5LGNA 4CYCA 4UUVA 2EFPA 1EJ9A 2NVYJ 1R6RA 4PJ0C 2EPFA 2KJCA 2EILH 3KCCA 4HZFA 4JYKA 3AAFA 2VC0A 1HDPA 1V3FA 3HOSA 1CF7A 1WVRA 2BE5F 3BTLA 2X1CA 2L9RA 1O3QA 1JKOC 1JUSA 1MNEA 3HRTA 1V54H 4BKXA 4ESBA 3X2QH 2GOXB 1T39A 3QU3A 4IHVA 3OYEA 3V8JA 2GWRA 4CA0A 1S7OA 3I5UA 4JP0A 3JAMZ 3OYAA 3OYIA 3L2UA 2KRHA 2DMQA 1TWCJ 2VQGA 3Q3SA 4IHTA 2W00A 2D5VA 4BE0A 1QVTA 1ZRFA 4EJWA 2DQRA 3I55I 1SEUA 4E6KG 3OYBA 1XTAA 2DW4A 4XKWA 1IXRC 2ECBA 2A3SA 2O5RA 4A0XA 2DMUA 1ZRCA 1FYKA 1V5FA 2KL4A 2OQRA 3CJRB 3DTIA 4WX9A 4BY1J 5FKKA 4CDGA 2GIZA 1TBXA 2L7FP 3R0JA 4F55A 1YHQI 1B1BA 3IC7A 2K02A 2JZYA 2IA0A 4BE2A 2E2IJ 4OMZA 1TNTA 5EG0B 2WB1A 3VDXA 1DQUA 3HUGB 1L3LA 2CH0A 2D1HA 3JAMK 2IT0A 2A05A 3DU5A 3CZ6A 1IRFA 2LF8A 1IUFA 4HF1A 4IKFA 1SD4A 1ZARA 2XHKA 2KRCA 2VBWA 3CJNA 4YRVA 4I2OA 4U0VA 3W3CA 3MCZA 1HKSA 1MD0A 2OCEA 5E8IA 3CP2A 4ZTFA 1QZEA 3GW2A 3T1BA 2H8WA 2R7DA 2NS7A 2XASA 3EDPA 3P7NA 3MKZA 1I6HJ 3HPGA 4A3IJ 1MSEC 5FLVA 1A04A 1Z6RA 2CV2A 3R4KA 5LFAA 3NWTA 1VTNC 2R4GA 4B09A 2P7CB 3ABUA 3ZOBA 4L9JA 3CCEI 1R1VA 2QBYA 3AKZA 2PQ8A 1X1CA 3FXLA 5HS7A 3CF2A 2ID6A 3KP7A 2OBPA 3IH4A 3M8JA 3UKGA 5ILSA 2VODA 2IVMA 5GTIC 2ZXIA 3KYLA 5B5EC 2Y48A 5IT9Z 3MFKA 4HOBA 2AHQA 3ASNH 2L02A 1QNTA 2COMA 4XSZF 2XC7A 1ZHFA 3QU6A 2MBFA 1DP3A 2EINH 3ELKA 2L5QA 1HW2A 1ONVA 2P81A 4XK4A 2EV6A 3S2DJ 2DT7B 3TKYA 2FOWA 3IAM2 3KYDB 4RGXA 2M34A 2DTZA 3KZIC 2MD0A 1KA8A 2CWEA 2ADUA 2F5EA 4WK8F 3ABLH 1PUFB 3QP6A 3ONQA 4IEJA 1RPWA 1YI2I 1HA8A 3MEXA 5HDKA 3N97A 3CCQI 4QTRA 1Z91A 2XKPA 1P9QC 4P96A 1WI9A 2A5WA 4I76A 3ZN1A 1PP8F 1J59A 1OQYA 4R1HA 5TISC 2KDZA 4N4OB 2FJ1A 5IT9K 2FSWA 1B8IA 4DYQA 3IRRA 2DQLA 3JRGA 1ZREA 3ZQCA 3DCFA 2HKXA 1T33A 9ANTA 3VSLA 5CKTA 2UXNA 4EM2A 4PCQA 1U3EM 5J3LA 1HKQA 3E97A 3H5AA 3HHHA 1FWZA 4M3FA 3ZXSA 1IO2A 4GRIA 4IZZA 1YS6A 5CVIA 5F6FA 2E2JJ 3WTYC 3BJ6A 2NRAC 1ZLJA 3DF8A 2L7MP 1MH4A 4HX7A 2CUEA 2OF7A 1K4TA 2XPWA 1LQ1A 3GEZA 4NHJA 3L09A 2BEOA 3G1LA 2O8KA 3DKWA 2R7UA 4M9ZA 5JLXA 1UHMA 2EZLA 3OYDA 3JTHA 1ZGWA 1BI1A 3HOWJ 4ZDOA 2ZJPF 3DKXA 1NTCA 1P4AA 1Q1HA 2VJ5A 2X6OA 5FJ8J 2EA4A 3T5XA 4ZZDA 3L2CA 4HNUA 1WHUA 5AIQA 3U1KA 2IS1A 1YW7A 1ZR4A 1QZZA 2LR8A 3DBRB 4HF2A 3SHFA 3M8EA 3HGYA 4HBLA 1Z6TA 3KYCB 4HNTA 4FT8A 4O3MA 4HNVA 2QQ9A 1VZ0A 2RV8A 5TGTA 3IV5A 2HTJA 4B8XA 1WJBA 1QQIA 2HKOA 2P8TA 3O3KA 3RPUA 5JFRA 2IS6A 3V7RA 3BROA 2V1XA 2XAQA 2R7XA 1WJDA 3O8GA 3S15J 3IH2A 1WI3A 3LQQA 4ZH4F 3K4KA 2MGQA 3FM3A 2K9MA 1TW3A 1ZLKA 3HSEA 4MGRA 4P55A 2CV1A 3ERMA 1MJBA 5L3CA 3A0HC 2XF5A 2W48A 1VQ7I 3HL2A 1E3HA 4UVBA 2XGDA 3JRFA 2XAFA 2A6TA 2DK8A 2E1NA 3EETA 1R71A 1P4XA 1GUUA 3S93A 5FLXZ 3K4LA 1YO5C 3FIWA 3KP2A 4EV0A 4ENMA 2GXBA 4RGRA 3NEUA 2NVTJ 4NQWA 1EF4A 1DUXC 1ITYA 1MBFA 1FTTA 2VIXA 3J7AO 2DODA 2DDAA 4E7HA 2GM4A 3JTGA 1G2HA 4JK1X 1ODDA 4YG2F 2E19A 5D5VB 5J1YA 3LFUA 5IYDJ 1D0YA 3OYMA 2K27A 2AXLA 1OR7C 1IC8A 2R7QA 2XSJC 3FBIB 1RIOH 4IQJA 1A6QA 1MNDA 3F9KA 2QUFA 3BG5A 3FHZA 3OOPA 2WAQA 5AIPA 1U9OA 2DOEA 2WBMA 3E5QA 4EQQA 1ETWA 3CDHA 4C9YA 1D5YA 2UXXA 4AM3A 1B59A 1O3SA 2F5VA 5HLIA 1N75A 2K3PA 2P5LC 2XV4S 2YU9J 2L01A 4RB1A 4A3LJ 2WC2A 4ETSA 2FEZA 3WGGA 3K70D 3NRVA 1SVLA 3OYGA 1Z21A 1JGSA 1OYYA 4CCNA 5LEKA 1GVDA 2K9SA 5F64A 5CLSA 5HS8A 1VQ8I 1JKPC 3PO2J 4I0BA 1G3TA 1T0FA 4BAYA 3E7LA 3IH3A 2WWYA 2LDUA 3HKZA 1X2NA 4OAZA 3WTZA 3OSGA 5K5OA 2L0KA 1YRNB 1AA7A 2DYRH 4RDUA 5F0CA 3S3MA 2L9NA 1S8NA 3H0GJ 4ITVA 4XIDA 3LWFA 4B3XA 4BEHA 5J47A 1WJEA 2ZMEB 1REPC 4UV9A 1ZTRA 4EMSA 1G59A 4LLNA 2L4AA 4O6JA 4AIKA 2GXAA 1T95A 2O7OA 4ZDPA 3REOA 2H94A 3QPHA 4P9UA 4RM2A 3GTMJ 4HV5A 1AKHA 3JRBA 2DJIA 4Y15A 3DBLB 2AS5F 2VOOA 3R0AA 3V42A 2QQ8A 3SXYA 2EWNA 1WCMJ 2I5UA 2VASA 1XCBA 5D6FA 3WG7H 1KYZA 1YLFA 2FXAA 1LPQA 1KU9A 4Q47A 3H1CA 2LREA 3CO7C 2HGCA 1WH5A 4BS9A 4BL0B 3V7SA 2J5OA 1I3AA 3ML6A 4ESFA 3ABTA 5FB2A 3BTCA 1JUMA 3V8KA 3TL4X 2QGUA 3KEOA 3BTJA 2ZNYA 3HSRA 4PDKA 1L0OC 5L3EA 3S16J 1R4NB 3CCYA 4U88A 5LRSA 4WXDA 2X4HA 5EZGA 2DN0A 5IP6A 4XKCA 2M7BA 2MG4A 2CW7A 3R60A 3MQ0A 1G4DA 4CHUA 3OIOA 2GA1A 3WG9A 4IO9F 4IRIA 1C0WA 1IRXA 1DP7P 2DK5A 2JJ7A 4PJJA 1WKMA 4WF2A 3D0SA 3FXQA 2CJJA 3CCJI 1XDUA 2ICWG 2QZ8A 5E1XA 5LGTA 1IN6A 1I50J 3GZNB 5LHHA 2K40A 3KEYA 3ROUA 5FLMJ 2B7EA 4DJAA 2NAZA 2EIJH 2ZMEA 3SYTA 1KQ8A 4AD9A 4BEHB 2VN2A 2DFEA 5DUKA 3KLNA 4NQWB 3CF5F 1ETYA 1JXSA 5FKLA 1XGSA 2EZHA 2GXGA 2RKHA 5KNLA 1PJRA 2ISZA 4Y33A 4AC0A 2IJLA 1APLC 4S0HB 5E79C 3VYTB 2X1DA 4HEA2 2ZBKA 2W82A 3CDLA 3GF2A 4QPOA 4TV7A 2BVLA 1MSFC 2FU4A 4G9YA 1SD6A 2P5KA 1XPXA 1STZA 2R7OA 3NQOA 3LSPA 2FA5A 2DA3A 3HXLA 3FMSA 3PQJA 2VT2A 2ZNZA 1QHGA 2CUFA 2WAFA 3AG1H 3JSPA 3TW7A 1LEAA 4A5MA 3PNVA 5K7FA 4J01A 2P4WA 1MBJA 2DCEA 2TRTA 4XKBA 3WE3A 3EUHA 4LIUA 1TWHJ 4YFNF 1JJ6C 1RKTA 1DU6A 3HUGA 2RGVA 1SMTA 2WAEA 3PFIA 2C6YA 3BCAA 1TC3C 3DWLE 3K0LA 1NK2P 2VBXA 1TZLA 1GV5A 3F0CA 1DPRA 4NNJA 2LP0A 1USTA 2MSYA 4I01A 1T2KA 4M3BA 1K6YA 3A02A 1CGPA 5HDNA 2VONA 5GPCA 1IN7A 1I39A 3K4JA 1D0ZA 1GXQA 2L9SA 1J0RA 3ZRGA 6PAXA 3TO9A 1W4MA 1NH3A 1A6IA 4II3A 1JHHA 2YR2A 4UVAA 3TQNA 2YUSA 5ILUA 3ESWB 3I3LA 2Y31A 4C30A 3ZMVA 2NS0A 3VOEA 3DEWA 3GTOJ 3OL3A 1UG2A 3QOPA 3AL0B 2WA0A 3NARA 2GQQA 2DA2A 3HOUJ 1MMGA 1D5VA 1B9NA 1FNNA 3N4MA 3BP8A 2HZTA 4XLEA 5GP9A 2NOJB 1OYIA 1WJ5A 3DTEA 2QYOA 4FX0A 1B9MA 3EUKL 2VUMJ 3WTXC 2P6SA 1X1DA 2IPQX 3CC4I 1P2FA 1EH7A 2RN7A 4CCJA 2BY0A 2Z5UA 4PZJA 2K4JA 3FXKA 2VJIA 2BV6A 3LSHA 4CICA 1AHDP 4A3GJ 4YFKF 2E71A 3SDGA 1OCPA 2P6TA 3Q0UA 5DS9A 1Y8QB 4CXFA 4V2GA 2CO5A 2DMPA 2Z3YA 4Q4ZF 4FCYA 2IS4A 1USSA 3ABKH 1OJLA 4BDYA 5DCMA 1R5ID 1MH3A 3L2WA 2H1LA 2E1OA 3S1NJ 5DD8A 3R61A 1BI2A 4OIOF 3WTTC 4A6DA 3F8BA 2FMLA 2R92J 3C3WA 2WADA 1X4OA 1UB9A 3H5NA 4PGGA 3AG4H 4EM0B 5E3LA 1VNDA 2PG4A 3PSFA 4KUMA 4DBRA 1AU7A 1FOXA 2XAHA 3UR3C 5EJCA 1D3YA 3K1PA 3I59A 4ON0A 4CYDA 4G12A 4PK4A 4IHYA 3ZN0A 2BVMA 4OIRF 3WE2A 1QGPA 5EF6A 4CGZA 3E5UA 5H6RA 3H35A 3MAJA 3F8NA 3A2KA 1PVEA 1TLHB 1K83J 4ANJA 3GXOA 1HSJA 2UZKA 4Y52J 3TP3A 5J4VA 3LA7A 1MKMA 3ZMDA 1SD7A 2Z33A 1QZYA 3CLQA 2EFWA 5AONA 4U7DA 5DUIA 1KGSA 2HXIA 4LOCA 2O0YA 2K9LA 2V9PA 2HVSA 3GVAA 1JHFA 2VXDA 4JOMA 1ETVA 4UB6C 3HHGA 4XONA 4ZDLA 1R5HA 1VQMI 1JKQC 1AWCA 4UB8C 2IEKA 3JW4A 3Q9VA 3DLAA 1HLVA 1HDDC 1W5CC 2ACJA 1G3SA 4KISA 1DGRM 4D5CA 2BW3B 3QPLA 5L3BA 1JT6A 2AO9A 5J8CA 1H0MA 2O9LA 3PJRA 3IUOA 3ECHA 3OR1C 2Y9YA 3TOBA 1Z7UA 4WXHA 1ZKGA 2NXNB 2OJED 1VQNI 1E17A 4XBFA 1ZG5A 1K79A 1ENHA 4LFUA 1WQ2A 1JGGA 1Z7LA 4HYEA 2NYXA 2PMUA 3FXRA 4HDVA 2TDXA 4YEJA 3QYFA 2DA1A 2ELKA 4F52A 1J09A 3DEEA 4DIQA 4BQNA 4AIJA 1DPUA 2XSDC 2BZTA 2LFBA 2VJJA 1V5GA 2V6CA 4QLCU 2V7FA 3F8FA 3FK7A 2ZXWH 2VXZA 5LLQA 2R7WA 3DFGA 2B0LA 1W1WE 2E36A 2Q0OA 5EZHA 3E1SA 1ZQ3P 5D5UB 3KPHA 2MH2A 2A61A 5DDGA 3ULQB 3G6EI 2R7VA 4JBAA 1X3ZB 3E6MA 1FOYA 2KMUA 2RVCA 3RKXA 2V4JC 3SFZA 4G6TB 4XRSA 3WTWC 4Y17A 1I27A 2F4MB 5J4YA 2IA1A 1DDNA 2EH3A 1P7JA 1RI7A 2MYSA 3BLYA 2OUMA 3H9GA 5B1BH 2OD5A 4LMYA 2XGEA 3IHUA 3ABMH 1QU3A 3QYBA 3S32A 2PJRB 3ZCOA 1G8XA 4I0AA 1VQ6I 2VPLA 1X2MA 5IYBJ 5CVVA 4FE4A 2DPDA 1BA5A 2KKOA 1YYVA 1S29A 3TGNA 2M45A 4P1WA 5K7ZA 3CMYA 2QVOA 4CO8A 2ZCWA 1LDJA 5IY5H 4KIGA 3T0YA 2QKLB 1SVMA 5BS6A 2HXOA 3GX4X 2IW5A 2BW3A 5DYMA 4QIWN 2NVUB 4Z6YA 1GHCA 2Q8KA 5HS9A 4RS8A 1IAWA 3VYRB 2P5VA 3OYCA 4P9FA 1FP1D 5FRMA 5A2QK 2OC6A 4BJTA 2KDOA 3JSOA 1S72I 4ZYHA 2LH9A 3K1NA 1FOKA 3J81K 4UNOA 2DFHA 4LLLA 5E17F 4Z2YA 1MJAA 2X6XA 2LK2A 4HDUA 3F6VA 4L9VA 2PFBA 1F5TA 2Q1ZB 2L7ZA 4L5IA 4PSXA 3CUQA 3SDBA 5LEJA 2X85A 3HIFA 2ZJRF 1Y1VJ 3HKZN 3FKJA 2VKEA 1YX3A 2EIMH 2E5ZA 3JRIA 2VBYA 3F3XA 3S1RJ 3BZKA 2R3SA 3PM1A 1U6GA 3TO7A 3Q0VA 5HVQC 5C44J 3GLLA 4AWXB 1BW5A 4Q48A 2IA2A 2CQKA 1O3TA 1XCVA 4II2A 3HRUA 3K2AA 5K5QA 1KQ9A 2H6BA 2IGKA 2O3FA 3K9TA 3UNGC 4KFCA 3J81Z 2DPUA 2RC4A 2MLGA 3HTSB 2NVXJ 4LG0A 1MGTA 4UHTA 2PJRA 4XICA 1U8BA 3CESA 2XDVA 2ESNA 2GZWA 2MC4A 2OCCH 1FYMA 1N78A 2PX9A 2FE3A 3RSNA 2M7AA 3T8TA 3LQRA 1U5TB 3KLOA 1RZ4A 2WY8Q 1FY7A 4EJVA 2R5YB 3CCLI 2QQBA 5BNGA 1T98A 5EYRA 3LSGA 3BR0A 4KN7X 3S2WA 4G7ZF 1K61A 2HVRA 3S1QJ 1BN5A 2M8GX 1G3YA 5E18F 1Z3XA 1LB2A 2JSCA 4XLNF 4RA2A 2LKPA 3OL4A 4BBRJ 2ETHA 2MW8A 4YFXF 2O8XA 2K7LA 3FXMA 4LK0F 2DOFA 4YELA 2CRGA 2V1DA 4V2FA 1H89C 4HX8A 3ZMTA 3FF5A 4D0PA 3IKVA 1IGNA 2OPTA 1EA3A 2QSHX 2AQEA 1VFCA 3GTJJ 2DLLA 2X0LA 3WODF 2LY2A 4NC7A 2F5FA 4G94A 2Y75A 1ZRDA 3H92A 2HS5A 2CGPA 1U2WA 2XRNA 2Y0SA 4W1UA 2G0EA 2R7SA 3KZYA 3LA3A 3BR6A 3LSRA 2JK3A 1JKRC 2EFOA 1WFXA 3OOUA 2VL8A 2CSOA 1K7AA 1UG0A 1XD7A 2L3DA 1LFBA 4RBOA 4CZZA 1A36A 2W85A 4XLPF 3BZ6A 3WTSC 2JRMA 1YS7A 1RNLA 5C4XJ 4KIFA 2VT3A 4MLOA 1ETKA 2DA6A 3ZQIA 4IX7A 3QODA 1MBKA 3RI4A 1XMAA 4XOPA 3ZPLA 3CJTB 1GDTA 1JE8A 2KZGA 3J7AY 2NNNA 2VKVA 2VBZA 2DAOA 4IXAA 4BACA 1YITI 2M5WA 1PUEE 1VQ4I 2HYGD 4AIDA 3RZDJ 2CW0F 3K4MA 4B3AA 1HF0A 5DV5A 3F8MA 1P6RA 4XORA 4M6VA 1GT0C 3WHCA 3K2ZA 1YFHA 1TWFJ 1R36A 4M73A 4EJTA 3LFKA 4FX4A 4OINF 4HSTA 2EFNA 3GTQJ 3DPTA 4GO1A 4FETA 3TW6A 1H9GA 1LVAA 1VI0A 4NB5A 1T8IA 3J7YJ 1TQIA 1V55H 5JHUA 3CCRI 3SZGA 3U21A 2BYVE 4R8HA 1T08B 2BOLA 2CQNA 4HPQA 4L5EA 1MW7A 4EM1A 3BY6A 3H3VK 3MZHA 3S17J 1K78A 4RLQA 1UJ8A 4HLYA 2A6HF 4EJOA 1LJ9A 1EV7A 1G3WA 3CUOA 2X9DA 1OCRH 2JT1A 3HYIA 3A4CA 1O7FA 4KICA 1U78A 3HRMA 2GLOA 4M74A 4UXNA 3BDDA 2FBKA 1X19A 2F2EA 1T38A 2VQLA 2WAQN 2E1MB 2LC2A 5FKOA 2KZVA 1LNWA 3DLLF 2EA2A 2ME6A 3KIOA 1X3WB 4KT5C 1ON1A 3OV8A 1BJAA 3N05A 4WWCA 4BXXJ 5JI6A 1PUFA 3FMQA 4UV8A 3OSFA 3AFHA 3QRFF 1H9TA 1XSXA 4RAYA 2R0QC 4RAZA 2W24A 4BNCA 3ZMUA 1XX5A 1KYWA 3DBHB 3VPRA 2QEXI 3K7AJ 3QPSA 2LSOA 5FO5A 4HLXA 1TP4A 1MMNA 1BR1A 2B9SA 1W36D 4G8XA 2R5ZA 4C2TA 5LBQA 3GBGA 1SD5A 2GBYA 2ELJA 2DU9A 3I54A 5J40A 3HOZJ 2W1OA 2A07F 2HR3A 3JR9A 4KT6A 2HFHA 4DZPA 3BR2A 2IS2A 1F1ZA 3G71I 2KQRA 5FKMA 3ZQGA 4LGWA 2XF7A 3Q9SA 4B47A 3I4MJ 4MFDA 1U5TA 4IQ4A 4HW0A 1ORKA 2ZKZA 3MVPA 1WJCA 4B48A 1EKEA 1IN8A 3RIRA 2DXIA 2V26A 5CQGA 3HOYJ 3GFIA 1Y0UA 1SFXA 1JT0A 1ZH5A 2H27A 3RKYA 2EQRA 4RMNA 4PGHA 5M5YJ 1FEXA 1PP7U 2QSFX 1WSUA 4IOAF 1WJFA 3H3ZA 1TNSA 4RB3C 4RLFA 3VYUB 2GAUA 2V6EA 1SFOJ 1IV6A 4OU0A 4DGWB 1XMXA 3IP4B 3BTIA 1N77A 2ZC2A 4KMFA 4BDZA 5ED4A 3PIPF 2DMTA 3L7WA 4CCLA 3ZMSA 2DT5A 2F48A 4HV6A 5ICGA 1NHAA 1YJWI 4N4NB 2BHZA 2LOOA 5KAIC 4ENKA 2IGOA 4KNYA 2I8DA 4BUPA 2GIVA 3C18A 3AL0C 4UVCA 1XDSA 2ZJQF 2GOMA 1OKRA 2CQXA 2WV0A 3B6AA 4E7IA 3SQNA 5FFZA 2Z9OA 4BH9A 1KONA 1OLTA 2JUGA 3C2HA 5IYCJ 1FSHA 3ASOH 1FX7A 4F3QA 5BQTA 1BOBA 2GA2A 4XRMA 4E7JA 3A01A 2XGCA 2BHYA 1Y39A 2KIMA 1FBUA 3NWSA 1YG2A 4E7SA 2LVSA 4MQ9F 5EEGA 4KA4A 2EV0A 4I7HA 1TT5B 5JR3A 1S9HA 3HGGA 2IAIA 2VKDA 3A1YA 3K69A 2F5CA 3PQKA 3SEQA 4A3BJ 3ZQFA 2J5PA 3U2RA 1TWGJ
chains in the Genus database with same CATH topology
5EEHA 2K4BA 2VE9A 3RJPA 2RDPA 1XN7A 1W7PB 4MEXF 2HYFA 4ZZLA 1F9NA 2F5DA 1P4WA 1MDMA 4L0ZB 1U5TC 4IJAA 5LHIA 1V4RA 1IZ1A 2VOPA 3ERED 3IRQA 5F1RA 2FQ3A 1QBJA 1GVJA 3RYRA 1HKTA 1R1TA 4L9TA 2EB7A 4OOIA 3G73A 5TRDA 3EYYA 1ZYRF 2A6EF 1HBXG 2STTA 3KP3A 2XAJA 1K78B 3U1DA 4MTDA 2FBHA 3QP5A 4L9NA 4ZYEA 2DI3A 3MZYA 3WTVC 4Y13A 2H6CA 3KFWX 4U0YA 3FXUA 1FLIA 4HF0A 4N0BA 3TO6A 2IRFG 5HOOA 4I02A 2EFQA 4KDPA 2OU2A 3F22A 3FX3A 3KP5A 3CUQC 1MDMB 3CTAA 2HEOA 2XKOA 2MA3A 4LB6B 3K1MA 4ENNA 1WWXA 1IF1A 1EH8A 2OA4A 4F7ZA 1BIAA 3I58A 3C7JA 4ENJA 4N9IA 2YU3A 2YX7A 4OIPF 1B6AA 5DCMB 3WTUC 2KIFA 3L00A 4G6QA 3ECOA 3GLXA 1D8JA 4S05A 3WU0A 3I4PA 5LRRA 4AIHA 4ASNA 4HQEA 2NNYA 1MZBA 4G6DA 2MLKA 4L0YB 3ZP5A 4M6YA 4LK1F 5FD5A 3BPXA 3H3UA 4M9XA 2HDCA 1BM9A 4BXUA 4G7HF 2DTRA 3IL2A 2D2WA 4Q5SF 3P9IA 2XROA 1XGNA 4KN4X 4L18B 1B4AA 1FBSA 3GFLA 5FLXK 4G7OF 1BC7C 3J80Z 3BWGA 2ELHA 1I1GA 1IRGA 3BJOA 2V9VA 2KRFA 4IRGA 5IT3A 3HRSA 1XGOA 2HQRA 2UWMA 3L9FA 3RKWA 2XGXA 2CFXA 1CF7B 3V8LA 5KVRA 3E6BA 3MWMA 2PN6A 1O7LA 5HDGA 1ON2A 1OMIA 3QPTA 1R22A 3I59B 4A5NA 2STWA 1HW5A 4R79A 5CVUA 4S04A 1ZG3A 1Z05A 4DQ2A 3EYIA 3FZVA 1SFUA 1I5ZA 5BPDA 3I0TA 1R7JA 1OPCA 4BHCA 2V1UA 3WGIA 1IUYA 4EGYA 2FRHA 4IF4A 3FM5A 1FC3A 3KZZA 1XB4A 1J75A 2XUBA 5ICFA 3I64A 1S3JA 2LNBA 1UFMA 2H09A 4IVNA 4KYWA 1YTYA 3FMRA 3VEPA 2PI0A 5J6XA 1XMKA 2QLZA 1J5YA 4LLGF 4GGGA 3F72A 2PMHA 3W6KB 2WTEA 4EVIA 5HLHA 2D45A 3CO6C 3KEQA 2XIGA 2A68F 1P92A 4WCGA 5K5RA 4LG0B 5FFXA 5E8GA 1S6LA 3O6BB 1XGMA 1UCRA 3TDUC 3E6DA 1G6NA 1KQ0A 2M1BA 2PJPA 3LAPA 2M87A 3TOAA 4DNCA 3O2PE 1AOYA 3GFJA 2ESHA 3I53A 5L3FA 5BPIA 3E3VA 1ZGJA 5ICEA 5K1YA 3B02A 2YSRA 4JQFA 5CYVA 3HOTA 4QWQA 3I71A 3P9CA 3F8CA 4E70A 2R7FA 4L5JA 3DV8A 1EH6A 2EV5A 4MTEA 2ZJ2A 4I98B 3R6SA 1BI3A 2L54A 4MNUA 4MHGA 4ZYGA 1LDKB 1FP2A 1ZAOA 3M7GA 1FT9A 2FNPA 2O6GE 3KP4A 4OMYA 1YW8A 3T8RA 4IHSA 3SZPA 4HX4A 4K2EA 2ZFWA 4U7BA 4YIIA 5D5WB 5LGUA 1K6OA 1IXSB 3CUQB 4U0WA 3IKTA 1J9IA 1PDNC 1HQCA 4BYYA 1FBQA 4RB2C 2A69F 3GZ5A 1KU3A 1X3UA 2W84A 5D4RA 2BBYA 2W25A 1ULYA 1BC8C 4BHBA 5E20A 3J80K 2ISYA 1J7KA 3U9GA 1R5GA 2O03A 2QBYB 2PEXA 4XSXF 3QAHA 2YX4A 3ISPA 1HSTA 5J8FA 1KU7A 4A2UA 2Y0MA 1YW9A 2HTSA 4WXCA 3E6CC 5L3GA 2E1CA 3B73A 4O5VA 3IWFA 1O3RA 4RGSA 4XRFA 2JTVA 1ZG1A 3LSTA 3TDZC 2QWWA 2QQAA 4M71A 2D1VA 2OAZA 4RGUA 1ZGAA 5CJ9A 4HAMA 1W7PA 1XSVA 1F4KA 2ZXJA 1Z1DA 2CG4A 3LA2A 3D5LA 2DFIA 3V4GA 3P9KA 5KK1A 5HLGA 2M30A 1R23A 4FHTA 1SFEA 2RQPA 5BOXA 3EQLF 3VFZA 1OR7A 1WRJA 3KE2A 2JPBA 4ESJA 5E1ZB 5CVJA 1T6SA 1SMYF 3IWZA 2MC3A 3GWZA 2DO7A 1YQAA 3ZMZA 4M9SA 4AVPA 1GXPA 1BOAA 4H0EA 4M6XA 2KIUA 5CVRA 5A2QZ 1S7AA 4GYGA 2VC1A 3F21A 3WGHA 2E7XA 4M72A 5E1WA 2Z99A 2Q2EA 3W6JB 4YIFA 2FBIA 4KMUX 5D8KB 2HQNA 3GZ6A 1LEBA 1BI0A 2JRTA 2V79A 5FD6A 5ERIA 3KETA 2FF4A 5ICCA 4A6EA 1TW2A 1R58A 4EGZA 3WU1B 1LDDA 4GXOA 1FZPB 5DEQA 4HQMA 2CYYA 1TTYA 2IP2A 2PBIA 3V7CA 1QPMA 4IRHA 2MH9A 3BPVA 3E5XA 4A12A 1U8RA 1HXDA 4GYIA 1IXCA 5BMZA 1BBYA 2VE8A 2HWVA 2M8EA 1SAXA 2YPRA 4OIQF 1I6XA 1IN4A 1J2XA 4GCVA 1E2XA 1TQPA 5H20A 1ZN2A 4MQVA 2A5YB 3SZTA 3DQVC 1YIOA 4A0YA 2E7WA 5L3DA 5D8LB 3COAC 1FPQA 1OYWA 1BIBA 5H6QA 3DP7A 4RB0A 3LAJA 1RUNA 5D6EA 3G3ZA 4BHPA 1O57A 3RPQA 3GUDA 4A0ZA 2MD5A 4N9HA 3DPLC 1IW7F 2OZ6A 1IN5A 2EK5A 1UHWA 1Z9CA 3BOQA 2G9WA 3M1EA 2HOEA 3VODA 4IPAA 2ZO4A 2DBBA 2XVCA 4LJZF 5DCFA 4LD5A 1D8KA 2XAGA 1W5TA 1RUOA 1QO0D 4HA8A 1KU2A 1R00A 4KIBA 5D4SA 1TQMA 5FGMA 3FWEA 3GO5A 3M8FA 1XSDA 2K86A 3HTUA 4BQAA 2G7UA 3RTRA 3GYHX 4MEYF 5D5XB 3F23A 2OZUA 5DD4A 3VB2A 4I09A 3HSFA 2FOKA 1R1UA 2KJBA 2EJRA 1FSEA 3Q5FA 3RDIA 2L4MA 2FNAA 2QM3A 1W5SA 2QENA 3CLOA 3F6OA 4EJUA 5TJJA 1W7PD 3KP6A 4ZYDA 3RYPA 2OQGA 2P7VB 2O61A 3GFMA 2G7HA 3DXJF 5LHGA 2RNJA 3M9AA 3ZQ7A 4P5OA 2LF7A 1MJ9A 3BJAA 3C1DA 1FYLA 3DEUA 4LB5A 2BGCA 5JVTA 2PLYA 1I1SA 2W57A 2JPCA 1HW1A 5ILVA 2FMYA 5LGNA 4UUVA 2EFPA 2KJCA 3KCCA 4HZFA 3AAFA 2VC0A 1V3FA 3HOSA 1CF7A 2BE5F 1O3QA 3HRTA 4ESBA 1T39A 3QU3A 3V8JA 2GWRA 1S7OA 3I5UA 3JAMZ 4IHTA 1ZRFA 4EJWA 2DQRA 2DW4A 1IXRC 2A3SA 4A0XA 1ZRCA 1FYKA 2OQRA 4WX9A 4CDGA 1TBXA 3R0JA 1B1BA 3IC7A 2K02A 2JZYA 2IA0A 4OMZA 1TNTA 1L3LA 2D1HA 3JAMK 2IT0A 4HF1A 1IRFA 2LF8A 4I2OA 1SD4A 1ZARA 2VBWA 2XHKA 3CJNA 4U0VA 3MCZA 1HKSA 1MD0A 5E8IA 3GW2A 3T1BA 2R7DA 2XASA 3EDPA 3P7NA 1A04A 1Z6RA 3R4KA 1VTNC 4B09A 2P7CB 3ABUA 4L9JA 1R1VA 2QBYA 2PQ8A 5HS7A 3KP7A 2OBPA 5ILSA 2VODA 2IVMA 2Y48A 5IT9Z 3MFKA 4HOBA 2L02A 1QNTA 2COMA 4XSZF 1ZHFA 3QU6A 2MBFA 3ELKA 1HW2A 1ONVA 2EV6A 3TKYA 4RGXA 1KA8A 2CWEA 2ADUA 2F5EA 4WK8F 3QP6A 3MEXA 5HDKA 3N97A 1Z91A 2XKPA 4P96A 1WI9A 1PP8F 1J59A 3ZN1A 4R1HA 5IT9K 2FSWA 3IRRA 2DQLA 1ZREA 2HKXA 2UXNA 4EM2A 4PCQA 1U3EM 1HKQA 3E97A 3HHHA 1FWZA 1YS6A 5CVIA 5F6FA 2NRAC 3WTYC 3BJ6A 1ZLJA 3DF8A 4HX7A 1LQ1A 3GEZA 4NHJA 3L09A 2BEOA 3DKWA 4M9ZA 1UHMA 3JTHA 1BI1A 1P4AA 1Q1HA 2EA4A 3T5XA 4ZZDA 3L2CA 5AIQA 1YW7A 1QZZA 4HF2A 3SHFA 3M8EA 4HBLA 1Z6TA 4FT8A 4O3MA 2QQ9A 2RV8A 2HTJA 4B8XA 1QQIA 2HKOA 2P8TA 3O3KA 3RPUA 5JFRA 3V7RA 3BROA 2V1XA 2XAQA 3LQQA 4ZH4F 3FM3A 1TW3A 1ZLKA 3HSEA 4MGRA 4P55A 1MJBA 5L3CA 4UVBA 2XAFA 2DK8A 2E1NA 3EETA 1P4XA 5FLXZ 1YO5C 3KP2A 2GXBA 4EV0A 4ENMA 4RGRA 3NEUA 4NQWA 1DUXC 3J7AO 3JTGA 4JK1X 1ODDA 4YG2F 5D5VB 2K27A 2AXLA 1RIOH 2QUFA 3FHZA 3OOPA 5AIPA 4EQQA 3E5QA 3CDHA 2UXXA 1B59A 1O3SA 5HLIA 2P5LC 2XV4S 2L01A 4RB1A 2WC2A 4ETSA 2FEZA 3WGGA 3NRVA 1JGSA 1OYYA 5LEKA 5F64A 5CLSA 5HS8A 4I0BA 1G3TA 1T0FA 4BAYA 2WWYA 2LDUA 3WTZA 5K5OA 1S8NA 3LWFA 2ZMEB 1REPC 4UV9A 4EMSA 4LLNA 2L4AA 4O6JA 4AIKA 3REOA 2H94A 3QPHA 4P9UA 4HV5A 4Y15A 2AS5F 2VOOA 3R0AA 3SXYA 2EWNA 1XCBA 5D6FA 1KYZA 1YLFA 2FXAA 1KU9A 4Q47A 3CO7C 2HGCA 3V7SA 2J5OA 3ML6A 4ESFA 3ABTA 5FB2A 3V8KA 3KEOA 3HSRA 2ZNYA 4PDKA 1L0OC 5L3EA 4U88A 5LRSA 4WXDA 2X4HA 3R60A 3MQ0A 1G4DA 4CHUA 2GA1A 3WG9A 4IRIA 1C0WA 1DP7P 2DK5A 1WKMA 4WF2A 3D0SA 3FXQA 1XDUA 2QZ8A 5E1XA 5LGTA 1IN6A 5LHHA 3ROUA 2NAZA 2ZMEA 1KQ8A 4AD9A 2VN2A 5DUKA 3KLNA 1JXSA 1XGSA 2GXGA 2RKHA 2ISZA 2IJLA 2ZBKA 3GF2A 4TV7A 2FU4A 4G9YA 1SD6A 2P5KA 1STZA 3NQOA 2FA5A 3PQJA 3FMSA 2VT2A 2ZNZA 3JSPA 1LEAA 4A5MA 2P4WA 3WE3A 3EUHA 4YFNF 3HUGA 2RGVA 1SMTA 3PFIA 2C6YA 3K0LA 2VBXA 1DPRA 1USTA 4I01A 1T2KA 1CGPA 5HDNA 2VONA 1IN7A 1GXQA 1J0RA 6PAXA 3TO9A 1W4MA 1JHHA 2YR2A 4UVAA 3TQNA 5ILUA 3ZMVA 2NS0A 3VOEA 3QOPA 2GQQA 1D5VA 1B9NA 1FNNA 3N4MA 3BP8A 2HZTA 1OYIA 2QYOA 4FX0A 1B9MA 3WTXC 2P6SA 2IPQX 1P2FA 1EH7A 2RN7A 2Z5UA 4PZJA 2K4JA 2BV6A 4CICA 4YFKF 2P6TA 4CXFA 2CO5A 2Z3YA 4Q4ZF 1USSA 5DCMA 5DD8A 3R61A 1BI2A 4OIOF 3WTTC 4A6DA 3F8BA 2FMLA 3C3WA 1UB9A 4EM0B 4PGGA 2PG4A 4KUMA 2XAHA 1D3YA 3K1PA 3I59A 4ON0A 4CYDA 4CGZA 3ZN0A 4OIRF 3WE2A 1QGPA 3E5UA 5H6RA 3MAJA 3F8NA 1TLHB 3GXOA 1HSJA 2UZKA 3LA7A 1MKMA 3ZMDA 1SD7A 2Z33A 1QZYA 2EFWA 5AONA 4U7DA 5DUIA 1KGSA 2O0YA 3GVAA 1JHFA 3HHGA 1AWCA 1R5HA 3JW4A 3Q9VA 2ACJA 1G3SA 5L3BA 5J8CA 1H0MA 3ECHA 3TOBA 1Z7UA 4WXHA 1E17A 4XBFA 1ZG5A 1K79A 4LFUA 1WQ2A 4HYEA 2NYXA 2PMUA 3FXRA 4HDVA 2TDXA 1DPUA 4AIJA 2V6CA 4QLCU 3F8FA 2VXZA 5LLQA 3DFGA 2B0LA 2Q0OA 5D5UB 2MH2A 2A61A 5DDGA 3ULQB 4JBAA 3E6MA 2RVCA 3RKXA 3SFZA 3WTWC 4Y17A 1I27A 2IA1A 1DDNA 1RI7A 2OD5A 4LMYA 3IHUA 4I0AA 5CVVA 2DPDA 2KKOA 1YYVA 1S29A 3TGNA 2M45A 2QVOA 4CO8A 2ZCWA 1LDJA 4KIGA 3T0YA 5BS6A 3GX4X 2IW5A 5DYMA 1GHCA 2Q8KA 5HS9A 4RS8A 1IAWA 2P5VA 4P9FA 1FP1D 5A2QK 3JSOA 4ZYHA 1FOKA 3K1NA 3J81K 4UNOA 4LLLA 5E17F 4Z2YA 1MJAA 4HDUA 3F6VA 4L9VA 2PFBA 1F5TA 4L5IA 3CUQA 5LEJA 3HIFA 2VBYA 3F3XA 2R3SA 5HVQC 1U6GA 3TO7A 4AWXB 4Q48A 2IA2A 2CQKA 1O3TA 1XCVA 3HRUA 5K5QA 1KQ9A 2H6BA 2O3FA 3K9TA 4KFCA 3J81Z 2DPUA 2RC4A 2MLGA 3HTSB 4LG0A 1MGTA 4UHTA 2ESNA 2GZWA 1FYMA 2FE3A 3T8TA 3LQRA 1U5TB 3KLOA 1RZ4A 4EJVA 1FY7A 2QQBA 1T98A 4KN7X 3S2WA 4G7ZF 1BN5A 1G3YA 5E18F 1LB2A 2JSCA 4XLNF 2LKPA 2ETHA 4YFXF 2O8XA 2K7LA 4LK0F 2V1DA 4HX8A 3ZMTA 3FF5A 4D0PA 3IKVA 2DLLA 2X0LA 3WODF 2F5FA 4G94A 2Y75A 1ZRDA 3H92A 2HS5A 2CGPA 1U2WA 2XRNA 3KZYA 3LA3A 2EFOA 2CSOA 1K7AA 1XD7A 2L3DA 4CZZA 2W85A 4XLPF 3BZ6A 3WTSC 1YS7A 1RNLA 4KIFA 2VT3A 3RI4A 1XMAA 3ZPLA 1JE8A 2NNNA 2VBZA 2DAOA 4IXAA 2M5WA 1PUEE 2HYGD 2CW0F 5DV5A 3F8MA 1P6RA 3K2ZA 1YFHA 1R36A 4M73A 4EJTA 3LFKA 4FX4A 4OINF 2EFNA 3DPTA 4GO1A 1H9GA 1LVAA 4NB5A 1TQIA 5JHUA 2BYVE 4R8HA 4EM1A 3BY6A 3MZHA 1K78A 4HLYA 2A6HF 4EJOA 1LJ9A 1EV7A 1G3WA 3CUOA 2JT1A 3HYIA 1O7FA 4KICA 1U78A 3HRMA 4M74A 4UXNA 3BDDA 2FBKA 2F2EA 1T38A 1LNWA 2EA2A 4KT5C 1ON1A 3OV8A 1BJAA 4WWCA 5JI6A 3FMQA 4UV8A 3QRFF 1H9TA 1XSXA 4RAYA 4RAZA 2W24A 4BNCA 3ZMUA 1KYWA 5FO5A 2LSOA 4HLXA 4G8XA 5LBQA 1SD5A 2DU9A 3I54A 2A07F 2HR3A 2HFHA 1F1ZA 4LGWA 3Q9SA 1U5TA 4HW0A 2ZKZA 1IN8A 3RIRA 3GFIA 1Y0UA 1SFXA 1ZH5A 2H27A 3RKYA 4PGHA 1PP7U 1WSUA 3H3ZA 1TNSA 4RB3C 2GAUA 4OU0A 4KMFA 5ED4A 3L7WA 3ZMSA 2DT5A 5ICGA 4HV6A 1NHAA 4ENKA 4KNYA 2GIVA 3C18A 4UVCA 1XDSA 1OKRA 2WV0A 3SQNA 5FFZA 2Z9OA 4BH9A 1FSHA 1FX7A 5BQTA 2GA2A 2KIMA 1FBUA 1YG2A 4MQ9F 5EEGA 4KA4A 2EV0A 4I7HA 5JR3A 3K69A 2F5CA 3PQKA 2J5PA 3U2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EEH A;  2K4B A;  2VE9 A;  3RJP A;  2RDP A;  1XN7 A;  1W7P B;  4MEX F;  2HYF A;  4ZZL A;  1F9N A;  2F5D A;  1P4W A;  1MDM A;  4L0Z B;  1U5T C;  4IJA A;  5LHI A;  1V4R A;  1IZ1 A;  2VOP A;  3ERE D;  3IRQ A;  5F1R A;  2FQ3 A;  1QBJ A;  1GVJ A;  3RYR A;  1HKT A;  1R1T A;  4L9T A;  2EB7 A;  4OOI A;  3G73 A;  5TRD A;  3EYY A;  1ZYR F;  2A6E F;  1HBX G;  2STT A;  3KP3 A;  2XAJ A;  1K78 B;  3U1D A;  4MTD A;  2FBH A;  3QP5 A;  4L9N A;  4ZYE A;  2DI3 A;  3MZY A;  3WTV C;  4Y13 A;  2H6C A;  3KFW X;  4U0Y A;  3FXU A;  1FLI A;  4HF0 A;  4N0B A;  3TO6 A;  2IRF G;  5HOO A;  4I02 A;  2EFQ A;  4KDP A;  2OU2 A;  3F22 A;  3FX3 A;  3KP5 A;  3CUQ C;  1MDM B;  3CTA A;  2HEO A;  2XKO A;  2MA3 A;  4LB6 B;  3K1M A;  4ENN A;  1WWX A;  1IF1 A;  1EH8 A;  2OA4 A;  4F7Z A;  1BIA A;  3I58 A;  3C7J A;  4ENJ A;  4N9I A;  2YU3 A;  2YX7 A;  4OIP F;  1B6A A;  5DCM B;  3WTU C;  2KIF A;  3L00 A;  4G6Q A;  3ECO A;  3GLX A;  1D8J A;  4S05 A;  3WU0 A;  3I4P A;  5LRR A;  4AIH A;  4ASN A;  4HQE A;  2NNY A;  1MZB A;  4G6D A;  2MLK A;  4L0Y B;  3ZP5 A;  4M6Y A;  4LK1 F;  5FD5 A;  3BPX A;  3H3U A;  4M9X A;  2HDC A;  1BM9 A;  4BXU A;  4G7H F;  2DTR A;  3IL2 A;  2D2W A;  4Q5S F;  3P9I A;  2XRO A;  1XGN A;  4KN4 X;  4L18 B;  1B4A A;  1FBS A;  3GFL A;  5FLX K;  4G7O F;  1BC7 C;  3J80 Z;  3BWG A;  2ELH A;  1I1G A;  1IRG A;  3BJO A;  2V9V A;  2KRF A;  4IRG A;  5IT3 A;  3HRS A;  1XGO A;  2HQR A;  2UWM A;  3L9F A;  3RKW A;  2XGX A;  2CFX A;  1CF7 B;  3V8L A;  5KVR A;  3E6B A;  3MWM A;  2PN6 A;  1O7L A;  5HDG A;  1ON2 A;  1OMI A;  3QPT A;  1R22 A;  3I59 B;  4A5N A;  2STW A;  1HW5 A;  4R79 A;  5CVU A;  4S04 A;  1ZG3 A;  1Z05 A;  4DQ2 A;  3EYI A;  3FZV A;  1SFU A;  1I5Z A;  5BPD A;  3I0T A;  1R7J A;  1OPC A;  4BHC A;  2V1U A;  3WGI A;  1IUY A;  4EGY A;  2FRH A;  4IF4 A;  3FM5 A;  1FC3 A;  3KZZ A;  1XB4 A;  1J75 A;  2XUB A;  5ICF A;  3I64 A;  1S3J A;  2LNB A;  1UFM A;  2H09 A;  4IVN A;  4KYW A;  1YTY A;  3FMR A;  3VEP A;  2PI0 A;  5J6X A;  1XMK A;  2QLZ A;  1J5Y A;  4LLG F;  4GGG A;  3F72 A;  2PMH A;  3W6K B;  2WTE A;  4EVI A;  5HLH A;  2D45 A;  3CO6 C;  3KEQ A;  2XIG A;  2A68 F;  1P92 A;  4WCG A;  5K5R A;  4LG0 B;  5FFX A;  5E8G A;  1S6L A;  3O6B B;  1XGM A;  1UCR A;  3TDU C;  3E6D A;  1G6N A;  1KQ0 A;  2M1B A;  2PJP A;  3LAP A;  2M87 A;  3TOA A;  4DNC A;  3O2P E;  1AOY A;  3GFJ A;  2ESH A;  3I53 A;  5L3F A;  5BPI A;  3E3V A;  1ZGJ A;  5ICE A;  5K1Y A;  3B02 A;  2YSR A;  4JQF A;  5CYV A;  3HOT A;  4QWQ A;  3I71 A;  3P9C A;  3F8C A;  4E70 A;  2R7F A;  4L5J A;  3DV8 A;  1EH6 A;  2EV5 A;  4MTE A;  2ZJ2 A;  4I98 B;  3R6S A;  1BI3 A;  2L54 A;  4MNU A;  4MHG A;  4ZYG A;  1LDK B;  1FP2 A;  1ZAO A;  3M7G A;  1FT9 A;  2FNP A;  2O6G E;  3KP4 A;  4OMY A;  1YW8 A;  3T8R A;  4IHS A;  3SZP A;  4HX4 A;  4K2E A;  2ZFW A;  4U7B A;  4YII A;  5D5W B;  5LGU A;  1K6O A;  1IXS B;  3CUQ B;  4U0W A;  3IKT A;  1J9I A;  1PDN C;  1HQC A;  4BYY A;  1FBQ A;  4RB2 C;  2A69 F;  3GZ5 A;  1KU3 A;  1X3U A;  2W84 A;  5D4R A;  2BBY A;  2W25 A;  1ULY A;  1BC8 C;  4BHB A;  5E20 A;  3J80 K;  2ISY A;  1J7K A;  3U9G A;  1R5G A;  2O03 A;  2QBY B;  2PEX A;  4XSX F;  3QAH A;  2YX4 A;  3ISP A;  1HST A;  5J8F A;  1KU7 A;  4A2U A;  2Y0M A;  1YW9 A;  2HTS A;  4WXC A;  3E6C C;  5L3G A;  2E1C A;  3B73 A;  4O5V A;  3IWF A;  1O3R A;  4RGS A;  4XRF A;  2JTV A;  1ZG1 A;  3LST A;  3TDZ C;  2QWW A;  2QQA A;  4M71 A;  2D1V A;  2OAZ A;  4RGU A;  1ZGA A;  5CJ9 A;  4HAM A;  1W7P A;  1XSV A;  1F4K A;  2ZXJ A;  1Z1D A;  2CG4 A;  3LA2 A;  3D5L A;  2DFI A;  3V4G A;  3P9K A;  5KK1 A;  5HLG A;  2M30 A;  1R23 A;  4FHT A;  1SFE A;  2RQP A;  5BOX A;  3EQL F;  3VFZ A;  1OR7 A;  1WRJ A;  3KE2 A;  2JPB A;  4ESJ A;  5E1Z B;  5CVJ A;  1T6S A;  1SMY F;  3IWZ A;  2MC3 A;  3GWZ A;  2DO7 A;  1YQA A;  3ZMZ A;  4M9S A;  4AVP A;  1GXP A;  1BOA A;  4H0E A;  4M6X A;  2KIU A;  5CVR A;  5A2Q Z;  1S7A A;  4GYG A;  2VC1 A;  3F21 A;  3WGH A;  2E7X A;  4M72 A;  5E1W A;  2Z99 A;  2Q2E A;  3W6J B;  4YIF A;  2FBI A;  4KMU X;  5D8K B;  2HQN A;  3GZ6 A;  1LEB A;  1BI0 A;  2JRT A;  2V79 A;  5FD6 A;  5ERI A;  3KET A;  2FF4 A;  5ICC A;  4A6E A;  1TW2 A;  1R58 A;  4EGZ A;  3WU1 B;  1LDD A;  4GXO A;  1FZP B;  5DEQ A;  4HQM A;  2CYY A;  1TTY A;  2IP2 A;  2PBI A;  3V7C A;  1QPM A;  4IRH A;  2MH9 A;  3BPV A;  3E5X A;  4A12 A;  1U8R A;  1HXD A;  4GYI A;  1IXC A;  5BMZ A;  1BBY A;  2VE8 A;  2HWV A;  2M8E A;  1SAX A;  2YPR A;  4OIQ F;  1I6X A;  1IN4 A;  1J2X A;  4GCV A;  1E2X A;  1TQP A;  5H20 A;  1ZN2 A;  4MQV A;  2A5Y B;  3SZT A;  3DQV C;  1YIO A;  4A0Y A;  2E7W A;  5L3D A;  5D8L B;  3COA C;  1FPQ A;  1OYW A;  1BIB A;  5H6Q A;  3DP7 A;  4RB0 A;  3LAJ A;  1RUN A;  5D6E A;  3G3Z A;  4BHP A;  1O57 A;  3RPQ A;  3GUD A;  4A0Z A;  2MD5 A;  4N9H A;  3DPL C;  1IW7 F;  2OZ6 A;  1IN5 A;  2EK5 A;  1UHW A;  1Z9C A;  3BOQ A;  2G9W A;  3M1E A;  2HOE A;  3VOD A;  4IPA A;  2ZO4 A;  2DBB A;  2XVC A;  4LJZ F;  5DCF A;  4LD5 A;  1D8K A;  2XAG A;  1W5T A;  1RUO A;  1QO0 D;  4HA8 A;  1KU2 A;  1R00 A;  4KIB A;  5D4S A;  1TQM A;  5FGM A;  3FWE A;  3GO5 A;  3M8F A;  1XSD A;  2K86 A;  3HTU A;  4BQA A;  2G7U A;  3RTR A;  3GYH X;  4MEY F;  5D5X B;  3F23 A;  2OZU A;  5DD4 A;  3VB2 A;  4I09 A;  3HSF A;  2FOK A;  1R1U A;  2KJB A;  2EJR A;  1FSE A;  3Q5F A;  3RDI A;  2L4M A;  2FNA A;  2QM3 A;  1W5S A;  2QEN A;  3CLO A;  3F6O A;  4EJU A;  5TJJ A;  1W7P D;  3KP6 A;  4ZYD A;  3RYP A;  2OQG A;  2P7V B;  2O61 A;  3GFM A;  2G7H A;  3DXJ F;  5LHG A;  2RNJ A;  3M9A A;  3ZQ7 A;  4P5O A;  2LF7 A;  1MJ9 A;  3BJA A;  3C1D A;  1FYL A;  3DEU A;  4LB5 A;  2BGC A;  5JVT A;  2PLY A;  1I1S A;  2W57 A;  2JPC A;  1HW1 A;  5ILV A;  2FMY A;  5LGN A;  4UUV A;  2EFP A;  2KJC A;  3KCC A;  4HZF A;  3AAF A;  2VC0 A;  1V3F A;  3HOS A;  1CF7 A;  2BE5 F;  1O3Q A;  3HRT A;  4ESB A;  1T39 A;  3QU3 A;  3V8J A;  2GWR A;  1S7O A;  3I5U A;  3JAM Z;  4IHT A;  1ZRF A;  4EJW A;  2DQR A;  2DW4 A;  1IXR C;  2A3S A;  4A0X A;  1ZRC A;  1FYK A;  2OQR A;  4WX9 A;  4CDG A;  1TBX A;  3R0J A;  1B1B A;  3IC7 A;  2K02 A;  2JZY A;  2IA0 A;  4OMZ A;  1TNT A;  1L3L A;  2D1H A;  3JAM K;  2IT0 A;  4HF1 A;  1IRF A;  2LF8 A;  4I2O A;  1SD4 A;  1ZAR A;  2VBW A;  2XHK A;  3CJN A;  4U0V A;  3MCZ A;  1HKS A;  1MD0 A;  5E8I A;  3GW2 A;  3T1B A;  2R7D A;  2XAS A;  3EDP A;  3P7N A;  1A04 A;  1Z6R A;  3R4K A;  1VTN C;  4B09 A;  2P7C B;  3ABU A;  4L9J A;  1R1V A;  2QBY A;  2PQ8 A;  5HS7 A;  3KP7 A;  2OBP A;  5ILS A;  2VOD A;  2IVM A;  2Y48 A;  5IT9 Z;  3MFK A;  4HOB A;  2L02 A;  1QNT A;  2COM A;  4XSZ F;  1ZHF A;  3QU6 A;  2MBF A;  3ELK A;  1HW2 A;  1ONV A;  2EV6 A;  3TKY A;  4RGX A;  1KA8 A;  2CWE A;  2ADU A;  2F5E A;  4WK8 F;  3QP6 A;  3MEX A;  5HDK A;  3N97 A;  1Z91 A;  2XKP A;  4P96 A;  1WI9 A;  1PP8 F;  1J59 A;  3ZN1 A;  4R1H A;  5IT9 K;  2FSW A;  3IRR A;  2DQL A;  1ZRE A;  2HKX A;  2UXN A;  4EM2 A;  4PCQ A;  1U3E M;  1HKQ A;  3E97 A;  3HHH A;  1FWZ A;  1YS6 A;  5CVI A;  5F6F A;  2NRA C;  3WTY C;  3BJ6 A;  1ZLJ A;  3DF8 A;  4HX7 A;  1LQ1 A;  3GEZ A;  4NHJ A;  3L09 A;  2BEO A;  3DKW A;  4M9Z A;  1UHM A;  3JTH A;  1BI1 A;  1P4A A;  1Q1H A;  2EA4 A;  3T5X A;  4ZZD A;  3L2C A;  5AIQ A;  1YW7 A;  1QZZ A;  4HF2 A;  3SHF A;  3M8E A;  4HBL A;  1Z6T A;  4FT8 A;  4O3M A;  2QQ9 A;  2RV8 A;  2HTJ A;  4B8X A;  1QQI A;  2HKO A;  2P8T A;  3O3K A;  3RPU A;  5JFR A;  3V7R A;  3BRO A;  2V1X A;  2XAQ A;  3LQQ A;  4ZH4 F;  3FM3 A;  1TW3 A;  1ZLK A;  3HSE A;  4MGR A;  4P55 A;  1MJB A;  5L3C A;  4UVB A;  2XAF A;  2DK8 A;  2E1N A;  3EET A;  1P4X A;  5FLX Z;  1YO5 C;  3KP2 A;  2GXB A;  4EV0 A;  4ENM A;  4RGR A;  3NEU A;  4NQW A;  1DUX C;  3J7A O;  3JTG A;  4JK1 X;  1ODD A;  4YG2 F;  5D5V B;  2K27 A;  2AXL A;  1RIO H;  2QUF A;  3FHZ A;  3OOP A;  5AIP A;  4EQQ A;  3E5Q A;  3CDH A;  2UXX A;  1B59 A;  1O3S A;  5HLI A;  2P5L C;  2XV4 S;  2L01 A;  4RB1 A;  2WC2 A;  4ETS A;  2FEZ A;  3WGG A;  3NRV A;  1JGS A;  1OYY A;  5LEK A;  5F64 A;  5CLS A;  5HS8 A;  4I0B A;  1G3T A;  1T0F A;  4BAY A;  2WWY A;  2LDU A;  3WTZ A;  5K5O A;  1S8N A;  3LWF A;  2ZME B;  1REP C;  4UV9 A;  4EMS A;  4LLN A;  2L4A A;  4O6J A;  4AIK A;  3REO A;  2H94 A;  3QPH A;  4P9U A;  4HV5 A;  4Y15 A;  2AS5 F;  2VOO A;  3R0A A;  3SXY A;  2EWN A;  1XCB A;  5D6F A;  1KYZ A;  1YLF A;  2FXA A;  1KU9 A;  4Q47 A;  3CO7 C;  2HGC A;  3V7S A;  2J5O A;  3ML6 A;  4ESF A;  3ABT A;  5FB2 A;  3V8K A;  3KEO A;  3HSR A;  2ZNY A;  4PDK A;  1L0O C;  5L3E A;  4U88 A;  5LRS A;  4WXD A;  2X4H A;  3R60 A;  3MQ0 A;  1G4D A;  4CHU A;  2GA1 A;  3WG9 A;  4IRI A;  1C0W A;  1DP7 P;  2DK5 A;  1WKM A;  4WF2 A;  3D0S A;  3FXQ A;  1XDU A;  2QZ8 A;  5E1X A;  5LGT A;  1IN6 A;  5LHH A;  3ROU A;  2NAZ A;  2ZME A;  1KQ8 A;  4AD9 A;  2VN2 A;  5DUK A;  3KLN A;  1JXS A;  1XGS A;  2GXG A;  2RKH A;  2ISZ A;  2IJL A;  2ZBK A;  3GF2 A;  4TV7 A;  2FU4 A;  4G9Y A;  1SD6 A;  2P5K A;  1STZ A;  3NQO A;  2FA5 A;  3PQJ A;  3FMS A;  2VT2 A;  2ZNZ A;  3JSP A;  1LEA A;  4A5M A;  2P4W A;  3WE3 A;  3EUH A;  4YFN F;  3HUG A;  2RGV A;  1SMT A;  3PFI A;  2C6Y A;  3K0L A;  2VBX A;  1DPR A;  1UST A;  4I01 A;  1T2K A;  1CGP A;  5HDN A;  2VON A;  1IN7 A;  1GXQ A;  1J0R A;  6PAX A;  3TO9 A;  1W4M A;  1JHH A;  2YR2 A;  4UVA A;  3TQN A;  5ILU A;  3ZMV A;  2NS0 A;  3VOE A;  3QOP A;  2GQQ A;  1D5V A;  1B9N A;  1FNN A;  3N4M A;  3BP8 A;  2HZT A;  1OYI A;  2QYO A;  4FX0 A;  1B9M A;  3WTX C;  2P6S A;  2IPQ X;  1P2F A;  1EH7 A;  2RN7 A;  2Z5U A;  4PZJ A;  2K4J A;  2BV6 A;  4CIC A;  4YFK F;  2P6T A;  4CXF A;  2CO5 A;  2Z3Y A;  4Q4Z F;  1USS A;  5DCM A;  5DD8 A;  3R61 A;  1BI2 A;  4OIO F;  3WTT C;  4A6D A;  3F8B A;  2FML A;  3C3W A;  1UB9 A;  4EM0 B;  4PGG A;  2PG4 A;  4KUM A;  2XAH A;  1D3Y A;  3K1P A;  3I59 A;  4ON0 A;  4CYD A;  4CGZ A;  3ZN0 A;  4OIR F;  3WE2 A;  1QGP A;  3E5U A;  5H6R A;  3MAJ A;  3F8N A;  1TLH B;  3GXO A;  1HSJ A;  2UZK A;  3LA7 A;  1MKM A;  3ZMD A;  1SD7 A;  2Z33 A;  1QZY A;  2EFW A;  5AON A;  4U7D A;  5DUI A;  1KGS A;  2O0Y A;  3GVA A;  1JHF A;  3HHG A;  1AWC A;  1R5H A;  3JW4 A;  3Q9V A;  2ACJ A;  1G3S A;  5L3B A;  5J8C A;  1H0M A;  3ECH A;  3TOB A;  1Z7U A;  4WXH A;  1E17 A;  4XBF A;  1ZG5 A;  1K79 A;  4LFU A;  1WQ2 A;  4HYE A;  2NYX A;  2PMU A;  3FXR A;  4HDV A;  2TDX A;  1DPU A;  4AIJ A;  2V6C A;  4QLC U;  3F8F A;  2VXZ A;  5LLQ A;  3DFG A;  2B0L A;  2Q0O A;  5D5U B;  2MH2 A;  2A61 A;  5DDG A;  3ULQ B;  4JBA A;  3E6M A;  2RVC A;  3RKX A;  3SFZ A;  3WTW C;  4Y17 A;  1I27 A;  2IA1 A;  1DDN A;  1RI7 A;  2OD5 A;  4LMY A;  3IHU A;  4I0A A;  5CVV A;  2DPD A;  2KKO A;  1YYV A;  1S29 A;  3TGN A;  2M45 A;  2QVO A;  4CO8 A;  2ZCW A;  1LDJ A;  4KIG A;  3T0Y A;  5BS6 A;  3GX4 X;  2IW5 A;  5DYM A;  1GHC A;  2Q8K A;  5HS9 A;  4RS8 A;  1IAW A;  2P5V A;  4P9F A;  1FP1 D;  5A2Q K;  3JSO A;  4ZYH A;  1FOK A;  3K1N A;  3J81 K;  4UNO A;  4LLL A;  5E17 F;  4Z2Y A;  1MJA A;  4HDU A;  3F6V A;  4L9V A;  2PFB A;  1F5T A;  4L5I A;  3CUQ A;  5LEJ A;  3HIF A;  2VBY A;  3F3X A;  2R3S A;  5HVQ C;  1U6G A;  3TO7 A;  4AWX B;  4Q48 A;  2IA2 A;  2CQK A;  1O3T A;  1XCV A;  3HRU A;  5K5Q A;  1KQ9 A;  2H6B A;  2O3F A;  3K9T A;  4KFC A;  3J81 Z;  2DPU A;  2RC4 A;  2MLG A;  3HTS B;  4LG0 A;  1MGT A;  4UHT A;  2ESN A;  2GZW A;  1FYM A;  2FE3 A;  3T8T A;  3LQR A;  1U5T B;  3KLO A;  1RZ4 A;  4EJV A;  1FY7 A;  2QQB A;  1T98 A;  4KN7 X;  3S2W A;  4G7Z F;  1BN5 A;  1G3Y A;  5E18 F;  1LB2 A;  2JSC A;  4XLN F;  2LKP A;  2ETH A;  4YFX F;  2O8X A;  2K7L A;  4LK0 F;  2V1D A;  4HX8 A;  3ZMT A;  3FF5 A;  4D0P A;  3IKV A;  2DLL A;  2X0L A;  3WOD F;  2F5F A;  4G94 A;  2Y75 A;  1ZRD A;  3H92 A;  2HS5 A;  2CGP A;  1U2W A;  2XRN A;  3KZY A;  3LA3 A;  2EFO A;  2CSO A;  1K7A A;  1XD7 A;  2L3D A;  4CZZ A;  2W85 A;  4XLP F;  3BZ6 A;  3WTS C;  1YS7 A;  1RNL A;  4KIF A;  2VT3 A;  3RI4 A;  1XMA A;  3ZPL A;  1JE8 A;  2NNN A;  2VBZ A;  2DAO A;  4IXA A;  2M5W A;  1PUE E;  2HYG D;  2CW0 F;  5DV5 A;  3F8M A;  1P6R A;  3K2Z A;  1YFH A;  1R36 A;  4M73 A;  4EJT A;  3LFK A;  4FX4 A;  4OIN F;  2EFN A;  3DPT A;  4GO1 A;  1H9G A;  1LVA A;  4NB5 A;  1TQI A;  5JHU A;  2BYV E;  4R8H A;  4EM1 A;  3BY6 A;  3MZH A;  1K78 A;  4HLY A;  2A6H F;  4EJO A;  1LJ9 A;  1EV7 A;  1G3W A;  3CUO A;  2JT1 A;  3HYI A;  1O7F A;  4KIC A;  1U78 A;  3HRM A;  4M74 A;  4UXN A;  3BDD A;  2FBK A;  2F2E A;  1T38 A;  1LNW A;  2EA2 A;  4KT5 C;  1ON1 A;  3OV8 A;  1BJA A;  4WWC A;  5JI6 A;  3FMQ A;  4UV8 A;  3QRF F;  1H9T A;  1XSX A;  4RAY A;  4RAZ A;  2W24 A;  4BNC A;  3ZMU A;  1KYW A;  5FO5 A;  2LSO A;  4HLX A;  4G8X A;  5LBQ A;  1SD5 A;  2DU9 A;  3I54 A;  2A07 F;  2HR3 A;  2HFH A;  1F1Z A;  4LGW A;  3Q9S A;  1U5T A;  4HW0 A;  2ZKZ A;  1IN8 A;  3RIR A;  3GFI A;  1Y0U A;  1SFX A;  1ZH5 A;  2H27 A;  3RKY A;  4PGH A;  1PP7 U;  1WSU A;  3H3Z A;  1TNS A;  4RB3 C;  2GAU A;  4OU0 A;  4KMF A;  5ED4 A;  3L7W A;  3ZMS A;  2DT5 A;  5ICG A;  4HV6 A;  1NHA A;  4ENK A;  4KNY A;  2GIV A;  3C18 A;  4UVC A;  1XDS A;  1OKR A;  2WV0 A;  3SQN A;  5FFZ A;  2Z9O A;  4BH9 A;  1FSH A;  1FX7 A;  5BQT A;  2GA2 A;  2KIM A;  1FBU A;  1YG2 A;  4MQ9 F;  5EEG A;  4KA4 A;  2EV0 A;  4I7H A;  5JR3 A;  3K69 A;  2F5C A;  3PQK A;  2J5P A;  3U2R A; 
#chains in the Genus database with same CATH topology
 1H8A C;  5B1A H;  2LYC A;  5EEH A;  2CU7 A;  3D5S C;  2K4B A;  2IGM A;  2VE9 A;  2IGN A;  3RJP A;  4Y7N J;  2KT0 A;  2RDP A;  1WPK A;  1XN7 A;  1W7P B;  4MEX F;  3JCU C;  2HYF A;  4ZZL A;  1OIS A;  1LFP A;  1SFK A;  2DA5 A;  3EUH C;  1F9N A;  5DM7 F;  1N25 A;  2F5D A;  1P4W A;  1MDM A;  3OYJ A;  1U5T C;  4IJA A;  4L0Z B;  3BZC A;  4A69 C;  5LHI A;  2VB6 A;  3CJQ B;  1V4R A;  4XNF A;  3S2H J;  1IZ1 A;  2RAE A;  2VOP A;  3ERE D;  1MMS A;  2LBF B;  3IRQ A;  4IHW A;  4A93 J;  3BG3 A;  4XQF A;  3WHB A;  5F1R A;  4BJ6 C;  1X1B A;  2FQ3 A;  1GVJ A;  1QBJ A;  3RYR A;  1Z67 A;  3RPU D;  1R1T A;  1HKT A;  5CPR B;  2RRE A;  4L9T A;  1IDY A;  2EB7 A;  2LY9 A;  4OOI A;  3K10 A;  4JX5 A;  4ZC3 A;  2BY2 A;  3G73 A;  5TRD A;  3CD6 I;  4OAY A;  3VWB A;  1VF9 A;  2CQQ A;  3EYY A;  1ZYR F;  2ZB9 A;  2A6E F;  1HBX G;  1GV2 A;  2STT A;  2ECC A;  3S14 J;  3KP3 A;  2KHM A;  1Y8R B;  1OFC X;  3OY9 A;  2KLO A;  2XAJ A;  3HB9 A;  1K78 B;  3G2B A;  3PUF A;  2UUZ A;  4LIT A;  3U1D A;  2HQA A;  2X6Y A;  2HPM A;  4MTD A;  4XLA A;  2FBH A;  4I6Z A;  3QP5 A;  4L9N A;  4E7L A;  1FMV A;  4ZYE A;  4ZYA A;  5HLT A;  3W2A A;  4F91 B;  2DI3 A;  3ZR8 X;  4BE1 A;  2M3A A;  3HM5 A;  3MZY A;  2AQF A;  3WTV C;  4Y13 A;  4UUS B;  1VQP I;  1WH7 A;  2H6C A;  4XLC A;  3KFW X;  4U0Y A;  3LOC A;  1Z3Y A;  4NBQ A;  3C2G A;  2Z2S B;  3FXU A;  2CS3 A;  3H9J A;  1FLI A;  2EZI A;  2OV7 A;  3OR2 C;  2HYJ A;  4HF0 A;  3BT9 A;  3AG2 H;  1OCC H;  2QSG X;  4N0B A;  2V9K A;  3TO6 A;  3OWT A;  2I10 A;  2XPU A;  1E3P A;  3S8P A;  4I02 A;  5HOO A;  2IRF G;  2JVG A;  3TP0 A;  2EFQ A;  4KDP A;  3J7Z I;  2F4I A;  5F27 A;  2L9V A;  2OU2 A;  3F22 A;  5GAH J;  2LD5 A;  2M9H A;  3FX3 A;  3KP5 A;  3CUQ C;  1MDM B;  4B1R A;  1QRY A;  3CTA A;  4H4K C;  1BW6 A;  2HEO A;  2XKO A;  2MA3 A;  4LB6 B;  3K1M A;  4ENN A;  1WWX A;  4YIR X;  4B44 A;  1VQO I;  2ZME C;  5IP7 J;  2H8R A;  5M5X J;  1IF1 A;  1EH8 A;  2OA4 A;  3I9V 2;  4PJN A;  4F7Z A;  1BIA A;  3I58 A;  2JSP A;  3KX2 A;  3C7J A;  4ENJ A;  3A0B C;  4N9I A;  2NOG A;  5C3E J;  3LSJ A;  1F36 A;  3K70 C;  1CQT A;  2Q2E B;  3FHN A;  4BXF A;  2YU3 A;  5F0F A;  3TMO A;  1YJ9 I;  1P7I A;  2YX7 A;  3GCM A;  1MMA A;  2L2O A;  3IAS 2;  3LL7 A;  4OIP F;  1B6A A;  5DCM B;  3WTU C;  3JRA A;  4BU2 A;  1HCR A;  2KIF A;  2KP6 A;  3L00 A;  4G6Q A;  1YRN A;  3ECO A;  3GLX A;  1A35 A;  1D8J A;  4S05 A;  2DMN A;  2HOT A;  3GTK J;  3WU0 A;  3FXJ A;  3I4P A;  4MO7 A;  5LRR A;  4AIH A;  4NUB A;  4ASN A;  4HQE A;  5GTH C;  1JUP A;  3ZQQ A;  2NNY A;  1D0X A;  3HEF A;  1UEL B;  1MZB A;  4G6D A;  4RAG A;  4XLH A;  4DOZ A;  2MLK A;  4L0Y B;  2RQQ A;  3ZP5 A;  4M6Y A;  4LK1 F;  5FD5 A;  3BPX A;  3H3U A;  4M9X A;  5GAD J;  2LY1 A;  2CQ7 A;  2HDC A;  4DBQ A;  1BM9 A;  4BXU A;  4G7H F;  2DTR A;  3IL2 A;  2D2W A;  4Q5S F;  3P9I A;  3W2V A;  2XRO A;  1Z77 A;  1XGN A;  4FTH A;  1YOV B;  1MBG A;  3ZQL A;  4KN4 X;  4L18 B;  3PNY A;  3O8H A;  3CC2 I;  1B4A A;  1D1B A;  4EEF G;  1FBS A;  4A3K J;  1O4X A;  2JA5 J;  3PSI A;  3GFL A;  4F92 B;  1D1C A;  4A3F J;  5FLX K;  4EAT A;  4MIM A;  5HNH A;  5C4J J;  4G7O F;  1BC7 C;  1F43 A;  3H9Q A;  3J80 Z;  3BWG A;  2ELH A;  1I1G A;  1IRG A;  3BJO A;  2V9V A;  3CCU I;  3FXO A;  2KRF A;  1IRZ A;  4IRG A;  5IT3 A;  1SC7 A;  3HRS A;  2BY3 A;  1XGO A;  1K4S A;  2K9N A;  2HQR A;  4PFO A;  2JQ7 A;  2P0W A;  3H0D A;  2UWM A;  3LSI A;  5JVG F;  3HZJ A;  4NC8 A;  2CW8 A;  3L9F A;  3BR5 A;  1DU0 A;  5K7H A;  1JI8 A;  2BXY A;  3FIS A;  3RKW A;  2XGX A;  2ZFU A;  1UAA A;  3I4N J;  2CFX A;  1CF7 B;  1RET A;  1V5E A;  2HDD A;  3V8L A;  1ETO A;  1YIJ I;  5KVR A;  4XLF A;  3E6B A;  3MWM A;  4JX6 A;  4A3J J;  4DYC A;  2PN6 A;  1O7L A;  5HDG A;  1M1E B;  1ON2 A;  3CMM A;  1GLN A;  1OMI A;  4PJL A;  1SVO A;  3QPT A;  4C3I J;  3PFY A;  2R7Z J;  1R22 A;  5EGO A;  3I59 B;  1PYV A;  4A5N A;  2STW A;  1HW5 A;  4J00 A;  3FK6 A;  2CFO A;  4A3M J;  1ERD A;  2CUZ A;  1VQ5 I;  4R79 A;  2B63 J;  3BG7 A;  5CVU A;  4S04 A;  4CCM A;  1ZG3 A;  1Z05 A;  2LRD A;  3GTG J;  4KJZ A;  3TBI A;  2M2E A;  4DQ2 A;  4RM3 A;  5LD2 C;  3EYI A;  3OYL A;  1IV8 A;  3FZV A;  1SFU A;  1I5Z A;  4CUG A;  5BPD A;  3I0T A;  1R7J A;  1OPC A;  4BHC A;  4CSW A;  1OCO H;  2V1U A;  1W0U A;  2X48 A;  3WGI A;  4UUT A;  1W36 C;  2LKS A;  4DZJ A;  1IUY A;  1WJA A;  2W7N A;  4EGY A;  4CYC B;  4XRS G;  2FRH A;  4IF4 A;  1POG A;  3LSK A;  3FM5 A;  2XB0 X;  1W0T A;  1FC3 A;  2L7K A;  3KZZ A;  5GAG J;  1BL0 A;  1XB4 A;  4BGD A;  1J75 A;  2WB1 N;  4BBS J;  2XUB A;  5ICF A;  3I64 A;  3BQZ A;  4J19 A;  1S3J A;  4XL9 A;  1ETX A;  1QA6 A;  1Y6I A;  2LNB A;  4FAS D;  1UFM A;  2EBI A;  2ME0 A;  2H09 A;  2CMP A;  4BJ5 C;  4MFE A;  4IVN A;  4KYW A;  1YTY A;  3SEZ A;  3FMR A;  2DT6 A;  3VEP A;  4XKV A;  1E0E A;  5KCM A;  2PI0 A;  4XMY A;  1NK3 P;  5J6X A;  4ABZ A;  1Y56 A;  1XC5 A;  2JA6 J;  1SAU A;  1XMK A;  2QLZ A;  2M4K A;  1J5Y A;  1YJN I;  4D1Q A;  3JRE A;  4LLG F;  2KPM A;  2ZSI B;  4GGG A;  3F72 A;  2PMH A;  2OTL I;  3W6K B;  2WTE A;  4HSR A;  4EVI A;  2DJN A;  1VQ9 I;  4M3E A;  5HLH A;  4GFB A;  1YE9 A;  2D45 A;  3CO6 C;  2K3F A;  3L2V A;  5FRN A;  1RES A;  1RC9 A;  3KEQ A;  1E3O C;  2XIG A;  4E7Z A;  1ACI A;  2A68 F;  1P92 A;  4C2U A;  1ZEL A;  4WCG A;  1LFU P;  3QWL A;  5K5R A;  2LTP A;  4UUS A;  1Y0N A;  3MD2 A;  4A3E J;  4LG0 B;  4QPQ A;  1MNM C;  5FFX A;  1WGX A;  3OS2 A;  5E8G A;  1S6L A;  3O6B B;  4D7M A;  2FUG 2;  1XGM A;  3G4S I;  1UCR A;  3TDU C;  3MMY B;  3B6C A;  3E6D A;  1G6N A;  1KQ0 A;  3K6G A;  2M1B A;  2Z16 A;  2PJP A;  3S1M J;  3LAP A;  1FTZ A;  2M87 A;  3FDY A;  1LKX A;  3TOA A;  3O2P E;  4DNC A;  1UMQ A;  4ZJZ A;  1AOY A;  3CCS I;  3GFJ A;  2ESH A;  3I53 A;  4X1E A;  5L3F A;  1SAN A;  2E5N A;  5BPI A;  4QSH A;  3E3V A;  3W6V A;  1ZGJ A;  4ZTJ A;  5FRO A;  1MIJ A;  5ICE A;  4NDL A;  5K1Y A;  4X6A J;  4PFP A;  3B02 A;  3D1N I;  2YSR A;  5GPA A;  3L2R A;  2XRL A;  4JQF A;  1JTY A;  4CH7 A;  5CYV A;  3HOT A;  4QWQ A;  3DPU A;  3I71 A;  3P9C A;  3CC7 I;  3F8C A;  2M0C A;  4E70 A;  5IOY A;  2R7F A;  4L5J A;  2JVH A;  4JX4 A;  3DV8 A;  1EH6 A;  2EV5 A;  4MTE A;  1TT0 A;  2FD5 A;  2ZJ2 A;  4I98 B;  3R6S A;  1BI3 A;  2L54 A;  4E4H A;  4MNU A;  3BG6 A;  2LBF A;  4X0G A;  4MHG A;  4ZYG A;  1LDK B;  1FP2 A;  1ZAO A;  3M7G A;  3LMM A;  2QKM B;  1FT9 A;  2FNP A;  4HG2 A;  2O6G E;  1HOM A;  2KIS A;  3KP4 A;  2JA8 J;  2XAU A;  2VJ4 A;  3VYS B;  1YW8 A;  3T8R A;  3FBN B;  4OMY A;  1FOW A;  3BCB A;  4IHS A;  3SZP A;  4HX4 A;  1T0F C;  2ZFW A;  4K2E A;  4U7B A;  2WV1 A;  2LLK A;  3L2Q A;  4YII A;  2UV1 A;  1MBE A;  5EEA A;  1NG7 A;  5D5W B;  5LGU A;  1K6O A;  1IXS B;  5EDN A;  2VQC A;  1FMW A;  3CUQ B;  1RR7 A;  3A03 A;  2Y0S N;  4U0W A;  3IKT A;  1XS9 A;  2TCT A;  3M3Y J;  1J9I A;  3Q0W A;  1PDN C;  1UZC A;  1HQC A;  4Y3O A;  4BYY A;  3BQY A;  1B72 B;  1FBQ A;  1H88 C;  3E0J B;  4RB2 C;  1ETQ A;  2Y30 A;  3GZ5 A;  2A69 F;  1KU3 A;  2IBD A;  1X3U A;  2W84 A;  5D4R A;  2BBY A;  2W25 A;  3MKL A;  2LG4 A;  1ULY A;  2M0M A;  1BC8 C;  4BHB A;  3AG3 H;  5E20 A;  3J80 K;  2HVQ A;  2MAB A;  2ISY A;  2M4G A;  1J7K A;  5EGO B;  4CCK A;  3U9G A;  1R5G A;  2O03 A;  2R5Y A;  4LIV A;  3G1O A;  2QBY B;  4DW6 A;  3OS1 A;  1U0J A;  2PEX A;  4XSX F;  1KZH A;  2YX4 A;  2JN6 A;  3QAH A;  5IOZ A;  1JJ8 C;  3ISP A;  1HST A;  3QOE A;  4PSW A;  5J8F A;  1KU7 A;  3GTP J;  4A2U A;  2Y0M A;  1YW9 A;  2HTS A;  4FIS A;  4WXC A;  3E6C C;  5L3G A;  5F08 A;  2E1C A;  3B73 A;  4O5V A;  1JTX A;  3IWF A;  2HZD A;  1TWA J;  1NG6 A;  1O3R A;  2JUC A;  4RGS A;  2JA7 J;  2HPI A;  4XRF A;  1VQK I;  2JTV A;  2HQ5 A;  1ZG1 A;  3RZO J;  2YS9 A;  3HOX J;  4M3G A;  3LST A;  2AXT C;  4XN0 A;  3TDZ C;  2QWW A;  2QQA A;  4M71 A;  2D1V A;  2OAZ A;  4IHX A;  4RGU A;  1ZGA A;  3EPZ A;  3M07 A;  3C2B A;  1W7P A;  4HAM A;  5CJ9 A;  1XSV A;  5HOD A;  3H5R A;  5J1U A;  1F4K A;  2ZXJ A;  1Z1D A;  1RKW A;  4C2M J;  2CG4 A;  5E3O A;  1YX5 A;  4AYB A;  4V19 K;  3LA2 A;  3D5L A;  3CCM I;  3TED A;  2DFI A;  3V4G A;  1FJL A;  1I3Q J;  1LVK A;  2Z1D A;  3P9K A;  5KK1 A;  2M30 A;  5HLG A;  1R23 A;  4B4C A;  4LG3 A;  4FHT A;  2K5C A;  1SFE A;  2RQP A;  5F04 A;  5BOX A;  2QCO A;  3EQL F;  3VFZ A;  3CP8 A;  3W2W A;  4D9J A;  1OR7 A;  1WRJ A;  3OMY A;  3KE2 A;  2JPB A;  4ESJ A;  1A5J A;  3RQ4 A;  1LE8 A;  5E1Z B;  5CVJ A;  3G1M A;  3PIO F;  1T6S A;  1SMY F;  2EIK H;  3IWZ A;  2R7R A;  1R4M B;  1QVU A;  2MC3 A;  3GWZ A;  2JWT A;  2Y9Z A;  2DO7 A;  3LNQ A;  1YQA A;  2RNG A;  2BY1 A;  4M9S A;  3ZMZ A;  4AVP A;  4B43 A;  1GXP A;  1BOA A;  3NAU A;  1T56 A;  4H0E A;  2X6W A;  4M6X A;  4A3D J;  2KIU A;  5GAE J;  4UY8 I;  5CVR A;  4AU7 A;  4BQO A;  4C3H J;  5A2Q Z;  1S7A A;  4GYG A;  2VC1 A;  3OIQ A;  5J1R A;  3F21 A;  3WGH A;  1VQL I;  2E7X A;  2F6C A;  5IPA A;  3FKI J;  4M72 A;  5JLW A;  1LUJ B;  5E1W A;  2Z99 A;  2NS8 A;  2LKX A;  2Q2E A;  3W6J B;  2X51 A;  2KIQ A;  4YIF A;  2FBI A;  1S5L C;  4KMU X;  4OWR B;  2BXZ A;  2QF7 A;  3QYE A;  5F0H A;  5D8K B;  5M3M J;  1BJZ A;  2HQN A;  2Y2Z A;  3WU2 C;  3VSK A;  3S3N A;  3GZ6 A;  1D1A A;  3K4N A;  1LEB A;  4I99 C;  3MKW B;  5IP9 J;  1BI0 A;  2JRT A;  2V79 A;  3JRD A;  5FD6 A;  5FKN A;  5ERI A;  1HC8 A;  2DYS H;  3OYF A;  1Y1W J;  3KET A;  2FF4 A;  1DGW Y;  5ICC A;  5F1J A;  1ZR2 A;  4F93 B;  4A6E A;  1TW2 A;  1R58 A;  2LMD A;  4EGZ A;  3WU1 B;  1A31 A;  1LDD A;  4GXO A;  3H36 A;  1FZP B;  5DEQ A;  2Y69 H;  1MMD A;  2HU9 A;  4FE7 A;  3MN2 A;  4HQM A;  3RQI A;  2CYY A;  1TTY A;  2XPV A;  2IP2 A;  2PBI A;  3DKY A;  3V7C A;  3HPH A;  1QPM A;  2R7T A;  2W4S A;  4IRH A;  2MH9 A;  3BPV A;  1QPI A;  3E5X A;  4A12 A;  1U8R A;  2CV0 A;  5H2F C;  1HXD A;  2E1M C;  3DTK A;  4CZC A;  4GYI A;  1IXC A;  3PL8 A;  1IJW C;  2HNH A;  5BMZ A;  5DTD A;  3P5J A;  1BBY A;  2JA2 A;  2V1N A;  2VE8 A;  2HWV A;  2M8E A;  1SAX A;  2VLA A;  2YPR A;  4AYB N;  4OIQ F;  1I6X A;  1IN4 A;  1J2X A;  4GCV A;  4D5F A;  1E2X A;  2E34 A;  2HI3 A;  3RCO A;  3PO3 J;  1TQP A;  5H20 A;  3JRH A;  1UHS A;  1BR2 A;  4PUS A;  2R5Z B;  4A3C J;  3SFI A;  1IDZ A;  1ZN2 A;  2DOA A;  4MQV A;  1RRJ A;  2A5Y B;  3SZT A;  3DQV C;  1YIO A;  1ZK8 A;  4A0Y A;  2E7W A;  4BY7 J;  5L3D A;  4HRI A;  3OYH A;  2DA7 A;  3S3O A;  2PMZ A;  5D8L B;  4AVZ A;  3COA C;  1X4P A;  1FPQ A;  3ZQH A;  1OCT C;  1OYW A;  3HBL A;  2DFF A;  1BIB A;  2COB A;  2F4O B;  4CCO A;  3CDI A;  1B72 A;  5H6Q A;  3HJE A;  3DP7 A;  4RB0 A;  4GDF A;  1U9N A;  3LAJ A;  1RUN A;  5D6E A;  3G3Z A;  4BHP A;  4XN3 A;  2DDB A;  3PNT A;  4W97 A;  2MFZ A;  4IL6 C;  2VKH A;  1O57 A;  2ZSH B;  3RPQ A;  2NVQ J;  3GUD A;  4A0Z A;  3EUA A;  2MD5 A;  4N9H A;  5KAF C;  5B3S H;  2ZXH A;  5M5W J;  3DPL C;  3OS0 A;  1IW7 F;  3D5R C;  1S7E A;  2K9Q A;  2OZ6 A;  2E2H J;  3CQZ J;  2E35 A;  1IN5 A;  2EK5 A;  3GME A;  1Q1V A;  2K85 A;  1UHW A;  4BQQ A;  3BOQ A;  1Z9C A;  2G9W A;  3M1E A;  3OIP A;  3RKQ A;  4M3D A;  1OCZ H;  3MKY B;  2HOE A;  3VOD A;  5M3F J;  4IPA A;  2ZO4 A;  2DBB A;  3DU6 A;  2XVC A;  3HOV J;  2HDW A;  2VQH A;  1AKH B;  4XR6 A;  4LJZ F;  1X1A A;  5DCF A;  2CUJ A;  4LD5 A;  1D8K A;  2XF6 A;  2XAG A;  3ZGK A;  1W5T A;  3M4O J;  4XM3 A;  1RUO A;  2HOS A;  1WZ2 A;  1QO0 D;  4HA8 A;  2PMZ N;  4Y4R A;  3I56 I;  2DA4 A;  4FQG A;  1KU2 A;  1R00 A;  4KIB A;  5D4S A;  1TQM A;  5FGM A;  3QQA A;  4PJM A;  3FWE A;  4NC6 A;  4RAF A;  3GTL J;  1FIP A;  3GO5 A;  3M8F A;  1XSD A;  2K86 A;  3HTU A;  1IG7 A;  4BQA A;  2VI6 A;  3HC7 A;  3OYN A;  2HOA A;  1X1P A;  2G7U A;  2IXS A;  3RTR A;  3GYH X;  2ID3 A;  4KIT B;  2N8G A;  2E60 A;  3M1C A;  4MEY F;  3HDD A;  2EZK A;  5D5X B;  3F23 A;  3A01 B;  2OZU A;  5DD4 A;  3OYK A;  1R9T J;  2X1E A;  3VB2 A;  3HG9 A;  4IOC F;  1B8I B;  3BR1 A;  4I09 A;  3HSF A;  2FOK A;  1R1U A;  2KJB A;  2XB5 A;  2EJR A;  1FSE A;  1RR8 C;  5DM6 F;  3K4B A;  3Q5F A;  3RDI A;  4E7K A;  3BR3 A;  2L4M A;  2FNA A;  2QM3 A;  1W5S A;  2QEN A;  3CLO A;  3F6O A;  2R93 J;  4EJU A;  5TJJ A;  1W7P D;  3L1P A;  3KP6 A;  4ZYD A;  4U87 A;  4AUX A;  3BG9 A;  3RYP A;  2QA4 I;  2VPR A;  5JHF A;  2OQG A;  2P7V B;  1TL8 A;  3K4C A;  5CQE A;  1X58 A;  4XOT A;  3GFM A;  2G7H A;  5EG0 A;  3SJM A;  3DXJ F;  2O61 A;  3CMA I;  5KHD A;  2FX0 A;  2KFD A;  1QHH D;  5LHG A;  2RNJ A;  3M9A A;  1MBH A;  5HNF A;  2H1K A;  2OTJ I;  3MZ8 A;  4DYR A;  1XG1 A;  3ZQ7 A;  4P5O A;  3JRC A;  1LE8 B;  1FIA A;  4C3J J;  1R49 A;  2LF7 A;  2JMW A;  1MJ9 A;  3BJA A;  3C1D A;  1FYL A;  4D7N A;  3DEU A;  2FQ4 A;  3CCV I;  1Z0X A;  4LB5 A;  2BGC A;  5JVT A;  2PLY A;  1I1S A;  5B66 C;  2W57 A;  1BR4 A;  3PUB A;  5E3N A;  2JPC A;  1HW1 A;  2WY7 Q;  3BC8 A;  5ILV A;  3CME I;  2FMY A;  3LSM A;  5E3M A;  5LGN A;  4CYC A;  4UUV A;  2EFP A;  1EJ9 A;  2NVY J;  1R6R A;  4PJ0 C;  2EPF A;  2KJC A;  2EIL H;  3KCC A;  4HZF A;  4JYK A;  3AAF A;  2VC0 A;  1HDP A;  1V3F A;  3HOS A;  1CF7 A;  1WVR A;  2BE5 F;  3BTL A;  2X1C A;  2L9R A;  1O3Q A;  1JKO C;  1JUS A;  1MNE A;  3HRT A;  1V54 H;  4BKX A;  4ESB A;  3X2Q H;  2GOX B;  1T39 A;  3QU3 A;  4IHV A;  3OYE A;  3V8J A;  2GWR A;  4CA0 A;  1S7O A;  3I5U A;  4JP0 A;  3JAM Z;  3OYA A;  3OYI A;  3L2U A;  2KRH A;  2DMQ A;  1TWC J;  2VQG A;  3Q3S A;  4IHT A;  2W00 A;  2D5V A;  4BE0 A;  1QVT A;  1ZRF A;  4EJW A;  2DQR A;  3I55 I;  1SEU A;  4E6K G;  3OYB A;  1XTA A;  2DW4 A;  4XKW A;  1IXR C;  2ECB A;  2A3S A;  2O5R A;  4A0X A;  2DMU A;  1ZRC A;  1FYK A;  1V5F A;  2KL4 A;  2OQR A;  3CJR B;  3DTI A;  4WX9 A;  4BY1 J;  5FKK A;  4CDG A;  2GIZ A;  1TBX A;  2L7F P;  3R0J A;  4F55 A;  1YHQ I;  1B1B A;  3IC7 A;  2K02 A;  2JZY A;  2IA0 A;  4BE2 A;  2E2I J;  4OMZ A;  1TNT A;  5EG0 B;  2WB1 A;  3VDX A;  1DQU A;  3HUG B;  1L3L A;  2CH0 A;  2D1H A;  3JAM K;  2IT0 A;  2A05 A;  3DU5 A;  3CZ6 A;  1IRF A;  2LF8 A;  1IUF A;  4HF1 A;  4IKF A;  1SD4 A;  1ZAR A;  2XHK A;  2KRC A;  2VBW A;  3CJN A;  4YRV A;  4I2O A;  4U0V A;  3W3C A;  3MCZ A;  1HKS A;  1MD0 A;  2OCE A;  5E8I A;  3CP2 A;  4ZTF A;  1QZE A;  3GW2 A;  3T1B A;  2H8W A;  2R7D A;  2NS7 A;  2XAS A;  3EDP A;  3P7N A;  3MKZ A;  1I6H J;  3HPG A;  4A3I J;  1MSE C;  5FLV A;  1A04 A;  1Z6R A;  2CV2 A;  3R4K A;  5LFA A;  3NWT A;  1VTN C;  2R4G A;  4B09 A;  2P7C B;  3ABU A;  3ZOB A;  4L9J A;  3CCE I;  1R1V A;  2QBY A;  3AKZ A;  2PQ8 A;  1X1C A;  3FXL A;  5HS7 A;  3CF2 A;  2ID6 A;  3KP7 A;  2OBP A;  3IH4 A;  3M8J A;  3UKG A;  5ILS A;  2VOD A;  2IVM A;  5GTI C;  2ZXI A;  3KYL A;  5B5E C;  2Y48 A;  5IT9 Z;  3MFK A;  4HOB A;  2AHQ A;  3ASN H;  2L02 A;  1QNT A;  2COM A;  4XSZ F;  2XC7 A;  1ZHF A;  3QU6 A;  2MBF A;  1DP3 A;  2EIN H;  3ELK A;  2L5Q A;  1HW2 A;  1ONV A;  2P81 A;  4XK4 A;  2EV6 A;  3S2D J;  2DT7 B;  3TKY A;  2FOW A;  3IAM 2;  3KYD B;  4RGX A;  2M34 A;  2DTZ A;  3KZI C;  2MD0 A;  1KA8 A;  2CWE A;  2ADU A;  2F5E A;  4WK8 F;  3ABL H;  1PUF B;  3QP6 A;  3ONQ A;  4IEJ A;  1RPW A;  1YI2 I;  1HA8 A;  3MEX A;  5HDK A;  3N97 A;  3CCQ I;  4QTR A;  1Z91 A;  2XKP A;  1P9Q C;  4P96 A;  1WI9 A;  2A5W A;  4I76 A;  3ZN1 A;  1PP8 F;  1J59 A;  1OQY A;  4R1H A;  5TIS C;  2KDZ A;  4N4O B;  2FJ1 A;  5IT9 K;  2FSW A;  1B8I A;  4DYQ A;  3IRR A;  2DQL A;  3JRG A;  1ZRE A;  3ZQC A;  3DCF A;  2HKX A;  1T33 A;  9ANT A;  3VSL A;  5CKT A;  2UXN A;  4EM2 A;  4PCQ A;  1U3E M;  5J3L A;  1HKQ A;  3E97 A;  3H5A A;  3HHH A;  1FWZ A;  4M3F A;  3ZXS A;  1IO2 A;  4GRI A;  4IZZ A;  1YS6 A;  5CVI A;  5F6F A;  2E2J J;  3WTY C;  3BJ6 A;  2NRA C;  1ZLJ A;  3DF8 A;  2L7M P;  1MH4 A;  4HX7 A;  2CUE A;  2OF7 A;  1K4T A;  2XPW A;  1LQ1 A;  3GEZ A;  4NHJ A;  3L09 A;  2BEO A;  3G1L A;  2O8K A;  3DKW A;  2R7U A;  4M9Z A;  5JLX A;  1UHM A;  2EZL A;  3OYD A;  3JTH A;  1ZGW A;  1BI1 A;  3HOW J;  4ZDO A;  2ZJP F;  3DKX A;  1NTC A;  1P4A A;  1Q1H A;  2VJ5 A;  2X6O A;  5FJ8 J;  2EA4 A;  3T5X A;  4ZZD A;  3L2C A;  4HNU A;  1WHU A;  5AIQ A;  3U1K A;  2IS1 A;  1YW7 A;  1ZR4 A;  1QZZ A;  2LR8 A;  3DBR B;  4HF2 A;  3SHF A;  3M8E A;  3HGY A;  4HBL A;  1Z6T A;  3KYC B;  4HNT A;  4FT8 A;  4O3M A;  4HNV A;  2QQ9 A;  1VZ0 A;  2RV8 A;  5TGT A;  3IV5 A;  2HTJ A;  4B8X A;  1WJB A;  1QQI A;  2HKO A;  2P8T A;  3O3K A;  3RPU A;  5JFR A;  2IS6 A;  3V7R A;  3BRO A;  2V1X A;  2XAQ A;  2R7X A;  1WJD A;  3O8G A;  3S15 J;  3IH2 A;  1WI3 A;  3LQQ A;  4ZH4 F;  3K4K A;  2MGQ A;  3FM3 A;  2K9M A;  1TW3 A;  1ZLK A;  3HSE A;  4MGR A;  4P55 A;  2CV1 A;  3ERM A;  1MJB A;  5L3C A;  3A0H C;  2XF5 A;  2W48 A;  1VQ7 I;  3HL2 A;  1E3H A;  4UVB A;  2XGD A;  3JRF A;  2XAF A;  2A6T A;  2DK8 A;  2E1N A;  3EET A;  1R71 A;  1P4X A;  1GUU A;  3S93 A;  5FLX Z;  3K4L A;  1YO5 C;  3FIW A;  3KP2 A;  4EV0 A;  4ENM A;  2GXB A;  4RGR A;  3NEU A;  2NVT J;  4NQW A;  1EF4 A;  1DUX C;  1ITY A;  1MBF A;  1FTT A;  2VIX A;  3J7A O;  2DOD A;  2DDA A;  4E7H A;  2GM4 A;  3JTG A;  1G2H A;  4JK1 X;  1ODD A;  4YG2 F;  2E19 A;  5D5V B;  5J1Y A;  3LFU A;  5IYD J;  1D0Y A;  3OYM A;  2K27 A;  2AXL A;  1OR7 C;  1IC8 A;  2R7Q A;  2XSJ C;  3FBI B;  1RIO H;  4IQJ A;  1A6Q A;  1MND A;  3F9K A;  2QUF A;  3BG5 A;  3FHZ A;  3OOP A;  2WAQ A;  5AIP A;  1U9O A;  2DOE A;  2WBM A;  3E5Q A;  4EQQ A;  1ETW A;  3CDH A;  4C9Y A;  1D5Y A;  2UXX A;  4AM3 A;  1B59 A;  1O3S A;  2F5V A;  5HLI A;  1N75 A;  2K3P A;  2P5L C;  2XV4 S;  2YU9 J;  2L01 A;  4RB1 A;  4A3L J;  2WC2 A;  4ETS A;  2FEZ A;  3WGG A;  3K70 D;  3NRV A;  1SVL A;  3OYG A;  1Z21 A;  1JGS A;  1OYY A;  4CCN A;  5LEK A;  1GVD A;  2K9S A;  5F64 A;  5CLS A;  5HS8 A;  1VQ8 I;  1JKP C;  3PO2 J;  4I0B A;  1G3T A;  1T0F A;  4BAY A;  3E7L A;  3IH3 A;  2WWY A;  2LDU A;  3HKZ A;  1X2N A;  4OAZ A;  3WTZ A;  3OSG A;  5K5O A;  2L0K A;  1YRN B;  1AA7 A;  2DYR H;  4RDU A;  5F0C A;  3S3M A;  2L9N A;  1S8N A;  3H0G J;  4ITV A;  4XID A;  3LWF A;  4B3X A;  4BEH A;  5J47 A;  1WJE A;  2ZME B;  1REP C;  4UV9 A;  1ZTR A;  4EMS A;  1G59 A;  4LLN A;  2L4A A;  4O6J A;  4AIK A;  2GXA A;  1T95 A;  2O7O A;  4ZDP A;  3REO A;  2H94 A;  3QPH A;  4P9U A;  4RM2 A;  3GTM J;  4HV5 A;  1AKH A;  3JRB A;  2DJI A;  4Y15 A;  3DBL B;  2AS5 F;  2VOO A;  3R0A A;  3V42 A;  2QQ8 A;  3SXY A;  2EWN A;  1WCM J;  2I5U A;  2VAS A;  1XCB A;  5D6F A;  3WG7 H;  1KYZ A;  1YLF A;  2FXA A;  1LPQ A;  1KU9 A;  4Q47 A;  3H1C A;  2LRE A;  3CO7 C;  2HGC A;  1WH5 A;  4BS9 A;  4BL0 B;  3V7S A;  2J5O A;  1I3A A;  3ML6 A;  4ESF A;  3ABT A;  5FB2 A;  3BTC A;  1JUM A;  3V8K A;  3TL4 X;  2QGU A;  3KEO A;  3BTJ A;  2ZNY A;  3HSR A;  4PDK A;  1L0O C;  5L3E A;  3S16 J;  1R4N B;  3CCY A;  4U88 A;  5LRS A;  4WXD A;  2X4H A;  5EZG A;  2DN0 A;  5IP6 A;  4XKC A;  2M7B A;  2MG4 A;  2CW7 A;  3R60 A;  3MQ0 A;  1G4D A;  4CHU A;  3OIO A;  2GA1 A;  3WG9 A;  4IO9 F;  4IRI A;  1C0W A;  1IRX A;  1DP7 P;  2DK5 A;  2JJ7 A;  4PJJ A;  1WKM A;  4WF2 A;  3D0S A;  3FXQ A;  2CJJ A;  3CCJ I;  1XDU A;  2ICW G;  2QZ8 A;  5E1X A;  5LGT A;  1IN6 A;  1I50 J;  3GZN B;  5LHH A;  2K40 A;  3KEY A;  3ROU A;  5FLM J;  2B7E A;  4DJA A;  2NAZ A;  2EIJ H;  2ZME A;  3SYT A;  1KQ8 A;  4AD9 A;  4BEH B;  2VN2 A;  2DFE A;  5DUK A;  3KLN A;  4NQW B;  3CF5 F;  1ETY A;  1JXS A;  5FKL A;  1XGS A;  2EZH A;  2GXG A;  2RKH A;  5KNL A;  1PJR A;  2ISZ A;  4Y33 A;  4AC0 A;  2IJL A;  1APL C;  4S0H B;  5E79 C;  3VYT B;  2X1D A;  4HEA 2;  2ZBK A;  2W82 A;  3CDL A;  3GF2 A;  4QPO A;  4TV7 A;  2BVL A;  1MSF C;  2FU4 A;  4G9Y A;  1SD6 A;  2P5K A;  1XPX A;  1STZ A;  2R7O A;  3NQO A;  3LSP A;  2FA5 A;  2DA3 A;  3HXL A;  3FMS A;  3PQJ A;  2VT2 A;  2ZNZ A;  1QHG A;  2CUF A;  2WAF A;  3AG1 H;  3JSP A;  3TW7 A;  1LEA A;  4A5M A;  3PNV A;  5K7F A;  4J01 A;  2P4W A;  1MBJ A;  2DCE A;  2TRT A;  4XKB A;  3WE3 A;  3EUH A;  4LIU A;  1TWH J;  4YFN F;  1JJ6 C;  1RKT A;  1DU6 A;  3HUG A;  2RGV A;  1SMT A;  2WAE A;  3PFI A;  2C6Y A;  3BCA A;  1TC3 C;  3DWL E;  3K0L A;  1NK2 P;  2VBX A;  1TZL A;  1GV5 A;  3F0C A;  1DPR A;  4NNJ A;  2LP0 A;  1UST A;  2MSY A;  4I01 A;  1T2K A;  4M3B A;  1K6Y A;  3A02 A;  1CGP A;  5HDN A;  2VON A;  5GPC A;  1IN7 A;  1I39 A;  3K4J A;  1D0Z A;  1GXQ A;  2L9S A;  1J0R A;  3ZRG A;  6PAX A;  3TO9 A;  1W4M A;  1NH3 A;  1A6I A;  4II3 A;  1JHH A;  2YR2 A;  4UVA A;  3TQN A;  2YUS A;  5ILU A;  3ESW B;  3I3L A;  2Y31 A;  4C30 A;  3ZMV A;  2NS0 A;  3VOE A;  3DEW A;  3GTO J;  3OL3 A;  1UG2 A;  3QOP A;  3AL0 B;  2WA0 A;  3NAR A;  2GQQ A;  2DA2 A;  3HOU J;  1MMG A;  1D5V A;  1B9N A;  1FNN A;  3N4M A;  3BP8 A;  2HZT A;  4XLE A;  5GP9 A;  2NOJ B;  1OYI A;  1WJ5 A;  3DTE A;  2QYO A;  4FX0 A;  1B9M A;  3EUK L;  2VUM J;  3WTX C;  2P6S A;  1X1D A;  2IPQ X;  3CC4 I;  1P2F A;  1EH7 A;  2RN7 A;  4CCJ A;  2BY0 A;  2Z5U A;  4PZJ A;  2K4J A;  3FXK A;  2VJI A;  2BV6 A;  3LSH A;  4CIC A;  1AHD P;  4A3G J;  4YFK F;  2E71 A;  3SDG A;  1OCP A;  2P6T A;  3Q0U A;  5DS9 A;  1Y8Q B;  4CXF A;  4V2G A;  2CO5 A;  2DMP A;  2Z3Y A;  4Q4Z F;  4FCY A;  2IS4 A;  1USS A;  3ABK H;  1OJL A;  4BDY A;  5DCM A;  1R5I D;  1MH3 A;  3L2W A;  2H1L A;  2E1O A;  3S1N J;  5DD8 A;  3R61 A;  1BI2 A;  4OIO F;  3WTT C;  4A6D A;  3F8B A;  2FML A;  2R92 J;  3C3W A;  2WAD A;  1X4O A;  1UB9 A;  3H5N A;  4PGG A;  3AG4 H;  4EM0 B;  5E3L A;  1VND A;  2PG4 A;  3PSF A;  4KUM A;  4DBR A;  1AU7 A;  1FOX A;  2XAH A;  3UR3 C;  5EJC A;  1D3Y A;  3K1P A;  3I59 A;  4ON0 A;  4CYD A;  4G12 A;  4PK4 A;  4IHY A;  3ZN0 A;  2BVM A;  4OIR F;  3WE2 A;  1QGP A;  5EF6 A;  4CGZ A;  3E5U A;  5H6R A;  3H35 A;  3MAJ A;  3F8N A;  3A2K A;  1PVE A;  1TLH B;  1K83 J;  4ANJ A;  3GXO A;  1HSJ A;  2UZK A;  4Y52 J;  3TP3 A;  5J4V A;  3LA7 A;  1MKM A;  3ZMD A;  1SD7 A;  2Z33 A;  1QZY A;  3CLQ A;  2EFW A;  5AON A;  4U7D A;  5DUI A;  1KGS A;  2HXI A;  4LOC A;  2O0Y A;  2K9L A;  2V9P A;  2HVS A;  3GVA A;  1JHF A;  2VXD A;  4JOM A;  1ETV A;  4UB6 C;  3HHG A;  4XON A;  4ZDL A;  1R5H A;  1VQM I;  1JKQ C;  1AWC A;  4UB8 C;  2IEK A;  3JW4 A;  3Q9V A;  3DLA A;  1HLV A;  1HDD C;  1W5C C;  2ACJ A;  1G3S A;  4KIS A;  1DGR M;  4D5C A;  2BW3 B;  3QPL A;  5L3B A;  1JT6 A;  2AO9 A;  5J8C A;  1H0M A;  2O9L A;  3PJR A;  3IUO A;  3ECH A;  3OR1 C;  2Y9Y A;  3TOB A;  1Z7U A;  4WXH A;  1ZKG A;  2NXN B;  2OJE D;  1VQN I;  1E17 A;  4XBF A;  1ZG5 A;  1K79 A;  1ENH A;  4LFU A;  1WQ2 A;  1JGG A;  1Z7L A;  4HYE A;  2NYX A;  2PMU A;  3FXR A;  4HDV A;  2TDX A;  4YEJ A;  3QYF A;  2DA1 A;  2ELK A;  4F52 A;  1J09 A;  3DEE A;  4DIQ A;  4BQN A;  4AIJ A;  1DPU A;  2XSD C;  2BZT A;  2LFB A;  2VJJ A;  1V5G A;  2V6C A;  4QLC U;  2V7F A;  3F8F A;  3FK7 A;  2ZXW H;  2VXZ A;  5LLQ A;  2R7W A;  3DFG A;  2B0L A;  1W1W E;  2E36 A;  2Q0O A;  5EZH A;  3E1S A;  1ZQ3 P;  5D5U B;  3KPH A;  2MH2 A;  2A61 A;  5DDG A;  3ULQ B;  3G6E I;  2R7V A;  4JBA A;  1X3Z B;  3E6M A;  1FOY A;  2KMU A;  2RVC A;  3RKX A;  2V4J C;  3SFZ A;  4G6T B;  4XRS A;  3WTW C;  4Y17 A;  1I27 A;  2F4M B;  5J4Y A;  2IA1 A;  1DDN A;  2EH3 A;  1P7J A;  1RI7 A;  2MYS A;  3BLY A;  2OUM A;  3H9G A;  5B1B H;  2OD5 A;  4LMY A;  2XGE A;  3IHU A;  3ABM H;  1QU3 A;  3QYB A;  3S32 A;  2PJR B;  3ZCO A;  1G8X A;  4I0A A;  1VQ6 I;  2VPL A;  1X2M A;  5IYB J;  5CVV A;  4FE4 A;  2DPD A;  1BA5 A;  2KKO A;  1YYV A;  1S29 A;  3TGN A;  2M45 A;  4P1W A;  5K7Z A;  3CMY A;  2QVO A;  4CO8 A;  2ZCW A;  1LDJ A;  5IY5 H;  4KIG A;  3T0Y A;  2QKL B;  1SVM A;  5BS6 A;  2HXO A;  3GX4 X;  2IW5 A;  2BW3 A;  5DYM A;  4QIW N;  2NVU B;  4Z6Y A;  1GHC A;  2Q8K A;  5HS9 A;  4RS8 A;  1IAW A;  3VYR B;  2P5V A;  3OYC A;  4P9F A;  1FP1 D;  5FRM A;  5A2Q K;  2OC6 A;  4BJT A;  2KDO A;  3JSO A;  1S72 I;  4ZYH A;  2LH9 A;  3K1N A;  1FOK A;  3J81 K;  4UNO A;  2DFH A;  4LLL A;  5E17 F;  4Z2Y A;  1MJA A;  2X6X A;  2LK2 A;  4HDU A;  3F6V A;  4L9V A;  2PFB A;  1F5T A;  2Q1Z B;  2L7Z A;  4L5I A;  4PSX A;  3CUQ A;  3SDB A;  5LEJ A;  2X85 A;  3HIF A;  2ZJR F;  1Y1V J;  3HKZ N;  3FKJ A;  2VKE A;  1YX3 A;  2EIM H;  2E5Z A;  3JRI A;  2VBY A;  3F3X A;  3S1R J;  3BZK A;  2R3S A;  3PM1 A;  1U6G A;  3TO7 A;  3Q0V A;  5HVQ C;  5C44 J;  3GLL A;  4AWX B;  1BW5 A;  4Q48 A;  2IA2 A;  2CQK A;  1O3T A;  1XCV A;  4II2 A;  3HRU A;  3K2A A;  5K5Q A;  1KQ9 A;  2H6B A;  2IGK A;  2O3F A;  3K9T A;  3UNG C;  4KFC A;  3J81 Z;  2DPU A;  2RC4 A;  2MLG A;  3HTS B;  2NVX J;  4LG0 A;  1MGT A;  4UHT A;  2PJR A;  4XIC A;  1U8B A;  3CES A;  2XDV A;  2ESN A;  2GZW A;  2MC4 A;  2OCC H;  1FYM A;  1N78 A;  2PX9 A;  2FE3 A;  3RSN A;  2M7A A;  3T8T A;  3LQR A;  1U5T B;  3KLO A;  1RZ4 A;  2WY8 Q;  1FY7 A;  4EJV A;  2R5Y B;  3CCL I;  2QQB A;  5BNG A;  1T98 A;  5EYR A;  3LSG A;  3BR0 A;  4KN7 X;  3S2W A;  4G7Z F;  1K61 A;  2HVR A;  3S1Q J;  1BN5 A;  2M8G X;  1G3Y A;  5E18 F;  1Z3X A;  1LB2 A;  2JSC A;  4XLN F;  4RA2 A;  2LKP A;  3OL4 A;  4BBR J;  2ETH A;  2MW8 A;  4YFX F;  2O8X A;  2K7L A;  3FXM A;  4LK0 F;  2DOF A;  4YEL A;  2CRG A;  2V1D A;  4V2F A;  1H89 C;  4HX8 A;  3ZMT A;  3FF5 A;  4D0P A;  3IKV A;  1IGN A;  2OPT A;  1EA3 A;  2QSH X;  2AQE A;  1VFC A;  3GTJ J;  2DLL A;  2X0L A;  3WOD F;  2LY2 A;  4NC7 A;  2F5F A;  4G94 A;  2Y75 A;  1ZRD A;  3H92 A;  2HS5 A;  2CGP A;  1U2W A;  2XRN A;  2Y0S A;  4W1U A;  2G0E A;  2R7S A;  3KZY A;  3LA3 A;  3BR6 A;  3LSR A;  2JK3 A;  1JKR C;  2EFO A;  1WFX A;  3OOU A;  2VL8 A;  2CSO A;  1K7A A;  1UG0 A;  1XD7 A;  2L3D A;  1LFB A;  4RBO A;  4CZZ A;  1A36 A;  2W85 A;  4XLP F;  3BZ6 A;  3WTS C;  2JRM A;  1YS7 A;  1RNL A;  5C4X J;  4KIF A;  2VT3 A;  4MLO A;  1ETK A;  2DA6 A;  3ZQI A;  4IX7 A;  3QOD A;  1MBK A;  3RI4 A;  1XMA A;  4XOP A;  3ZPL A;  3CJT B;  1GDT A;  1JE8 A;  2KZG A;  3J7A Y;  2NNN A;  2VKV A;  2VBZ A;  2DAO A;  4IXA A;  4BAC A;  1YIT I;  2M5W A;  1PUE E;  1VQ4 I;  2HYG D;  4AID A;  3RZD J;  2CW0 F;  3K4M A;  4B3A A;  1HF0 A;  5DV5 A;  3F8M A;  1P6R A;  4XOR A;  4M6V A;  1GT0 C;  3WHC A;  3K2Z A;  1YFH A;  1TWF J;  1R36 A;  4M73 A;  4EJT A;  3LFK A;  4FX4 A;  4OIN F;  4HST A;  2EFN A;  3GTQ J;  3DPT A;  4GO1 A;  4FET A;  3TW6 A;  1H9G A;  1LVA A;  1VI0 A;  4NB5 A;  1T8I A;  3J7Y J;  1TQI A;  1V55 H;  5JHU A;  3CCR I;  3SZG A;  3U21 A;  2BYV E;  4R8H A;  1T08 B;  2BOL A;  2CQN A;  4HPQ A;  4L5E A;  1MW7 A;  4EM1 A;  3BY6 A;  3H3V K;  3MZH A;  3S17 J;  1K78 A;  4RLQ A;  1UJ8 A;  4HLY A;  2A6H F;  4EJO A;  1LJ9 A;  1EV7 A;  1G3W A;  3CUO A;  2X9D A;  1OCR H;  2JT1 A;  3HYI A;  3A4C A;  1O7F A;  4KIC A;  1U78 A;  3HRM A;  2GLO A;  4M74 A;  4UXN A;  3BDD A;  2FBK A;  1X19 A;  2F2E A;  1T38 A;  2VQL A;  2WAQ N;  2E1M B;  2LC2 A;  5FKO A;  2KZV A;  1LNW A;  3DLL F;  2EA2 A;  2ME6 A;  3KIO A;  1X3W B;  4KT5 C;  1ON1 A;  3OV8 A;  1BJA A;  3N05 A;  4WWC A;  4BXX J;  5JI6 A;  1PUF A;  3FMQ A;  4UV8 A;  3OSF A;  3AFH A;  3QRF F;  1H9T A;  1XSX A;  4RAY A;  2R0Q C;  4RAZ A;  2W24 A;  4BNC A;  3ZMU A;  1XX5 A;  1KYW A;  3DBH B;  3VPR A;  2QEX I;  3K7A J;  3QPS A;  2LSO A;  5FO5 A;  4HLX A;  1TP4 A;  1MMN A;  1BR1 A;  2B9S A;  1W36 D;  4G8X A;  2R5Z A;  4C2T A;  5LBQ A;  3GBG A;  1SD5 A;  2GBY A;  2ELJ A;  2DU9 A;  3I54 A;  5J40 A;  3HOZ J;  2W1O A;  2A07 F;  2HR3 A;  3JR9 A;  4KT6 A;  2HFH A;  4DZP A;  3BR2 A;  2IS2 A;  1F1Z A;  3G71 I;  2KQR A;  5FKM A;  3ZQG A;  4LGW A;  2XF7 A;  3Q9S A;  4B47 A;  3I4M J;  4MFD A;  1U5T A;  4IQ4 A;  4HW0 A;  1ORK A;  2ZKZ A;  3MVP A;  1WJC A;  4B48 A;  1EKE A;  1IN8 A;  3RIR A;  2DXI A;  2V26 A;  5CQG A;  3HOY J;  3GFI A;  1Y0U A;  1SFX A;  1JT0 A;  1ZH5 A;  2H27 A;  3RKY A;  2EQR A;  4RMN A;  4PGH A;  5M5Y J;  1FEX A;  1PP7 U;  2QSF X;  1WSU A;  4IOA F;  1WJF A;  3H3Z A;  1TNS A;  4RB3 C;  4RLF A;  3VYU B;  2GAU A;  2V6E A;  1SFO J;  1IV6 A;  4OU0 A;  4DGW B;  1XMX A;  3IP4 B;  3BTI A;  1N77 A;  2ZC2 A;  4KMF A;  4BDZ A;  5ED4 A;  3PIP F;  2DMT A;  3L7W A;  4CCL A;  3ZMS A;  2DT5 A;  2F48 A;  4HV6 A;  5ICG A;  1NHA A;  1YJW I;  4N4N B;  2BHZ A;  2LOO A;  5KAI C;  4ENK A;  2IGO A;  4KNY A;  2I8D A;  4BUP A;  2GIV A;  3C18 A;  3AL0 C;  4UVC A;  1XDS A;  2ZJQ F;  2GOM A;  1OKR A;  2CQX A;  2WV0 A;  3B6A A;  4E7I A;  3SQN A;  5FFZ A;  2Z9O A;  4BH9 A;  1KON A;  1OLT A;  2JUG A;  3C2H A;  5IYC J;  1FSH A;  3ASO H;  1FX7 A;  4F3Q A;  5BQT A;  1BOB A;  2GA2 A;  4XRM A;  4E7J A;  3A01 A;  2XGC A;  2BHY A;  1Y39 A;  2KIM A;  1FBU A;  3NWS A;  1YG2 A;  4E7S A;  2LVS A;  4MQ9 F;  5EEG A;  4KA4 A;  2EV0 A;  4I7H A;  1TT5 B;  5JR3 A;  1S9H A;  3HGG A;  2IAI A;  2VKD A;  3A1Y A;  3K69 A;  2F5C A;  3PQK A;  3SEQ A;  4A3B J;  3ZQF A;  2J5P A;  3U2R A;  1TWG J; 
#chains in the Genus database with same CATH homology
 5EEH A;  2K4B A;  2VE9 A;  3RJP A;  2RDP A;  1XN7 A;  1W7P B;  4MEX F;  2HYF A;  4ZZL A;  1F9N A;  2F5D A;  1P4W A;  1MDM A;  4L0Z B;  1U5T C;  4IJA A;  5LHI A;  1V4R A;  1IZ1 A;  2VOP A;  3ERE D;  3IRQ A;  5F1R A;  2FQ3 A;  1QBJ A;  1GVJ A;  3RYR A;  1HKT A;  1R1T A;  4L9T A;  2EB7 A;  4OOI A;  3G73 A;  5TRD A;  3EYY A;  1ZYR F;  2A6E F;  1HBX G;  2STT A;  3KP3 A;  2XAJ A;  1K78 B;  3U1D A;  4MTD A;  2FBH A;  3QP5 A;  4L9N A;  4ZYE A;  2DI3 A;  3MZY A;  3WTV C;  4Y13 A;  2H6C A;  3KFW X;  4U0Y A;  3FXU A;  1FLI A;  4HF0 A;  4N0B A;  3TO6 A;  2IRF G;  5HOO A;  4I02 A;  2EFQ A;  4KDP A;  2OU2 A;  3F22 A;  3FX3 A;  3KP5 A;  3CUQ C;  1MDM B;  3CTA A;  2HEO A;  2XKO A;  2MA3 A;  4LB6 B;  3K1M A;  4ENN A;  1WWX A;  1IF1 A;  1EH8 A;  2OA4 A;  4F7Z A;  1BIA A;  3I58 A;  3C7J A;  4ENJ A;  4N9I A;  2YU3 A;  2YX7 A;  4OIP F;  1B6A A;  5DCM B;  3WTU C;  2KIF A;  3L00 A;  4G6Q A;  3ECO A;  3GLX A;  1D8J A;  4S05 A;  3WU0 A;  3I4P A;  5LRR A;  4AIH A;  4ASN A;  4HQE A;  2NNY A;  1MZB A;  4G6D A;  2MLK A;  4L0Y B;  3ZP5 A;  4M6Y A;  4LK1 F;  5FD5 A;  3BPX A;  3H3U A;  4M9X A;  2HDC A;  1BM9 A;  4BXU A;  4G7H F;  2DTR A;  3IL2 A;  2D2W A;  4Q5S F;  3P9I A;  2XRO A;  1XGN A;  4KN4 X;  4L18 B;  1B4A A;  1FBS A;  3GFL A;  5FLX K;  4G7O F;  1BC7 C;  3J80 Z;  3BWG A;  2ELH A;  1I1G A;  1IRG A;  3BJO A;  2V9V A;  2KRF A;  4IRG A;  5IT3 A;  3HRS A;  1XGO A;  2HQR A;  2UWM A;  3L9F A;  3RKW A;  2XGX A;  2CFX A;  1CF7 B;  3V8L A;  5KVR A;  3E6B A;  3MWM A;  2PN6 A;  1O7L A;  5HDG A;  1ON2 A;  1OMI A;  3QPT A;  1R22 A;  3I59 B;  4A5N A;  2STW A;  1HW5 A;  4R79 A;  5CVU A;  4S04 A;  1ZG3 A;  1Z05 A;  4DQ2 A;  3EYI A;  3FZV A;  1SFU A;  1I5Z A;  5BPD A;  3I0T A;  1R7J A;  1OPC A;  4BHC A;  2V1U A;  3WGI A;  1IUY A;  4EGY A;  2FRH A;  4IF4 A;  3FM5 A;  1FC3 A;  3KZZ A;  1XB4 A;  1J75 A;  2XUB A;  5ICF A;  3I64 A;  1S3J A;  2LNB A;  1UFM A;  2H09 A;  4IVN A;  4KYW A;  1YTY A;  3FMR A;  3VEP A;  2PI0 A;  5J6X A;  1XMK A;  2QLZ A;  1J5Y A;  4LLG F;  4GGG A;  3F72 A;  2PMH A;  3W6K B;  2WTE A;  4EVI A;  5HLH A;  2D45 A;  3CO6 C;  3KEQ A;  2XIG A;  2A68 F;  1P92 A;  4WCG A;  5K5R A;  4LG0 B;  5FFX A;  5E8G A;  1S6L A;  3O6B B;  1XGM A;  1UCR A;  3TDU C;  3E6D A;  1G6N A;  1KQ0 A;  2M1B A;  2PJP A;  3LAP A;  2M87 A;  3TOA A;  4DNC A;  3O2P E;  1AOY A;  3GFJ A;  2ESH A;  3I53 A;  5L3F A;  5BPI A;  3E3V A;  1ZGJ A;  5ICE A;  5K1Y A;  3B02 A;  2YSR A;  4JQF A;  5CYV A;  3HOT A;  4QWQ A;  3I71 A;  3P9C A;  3F8C A;  4E70 A;  2R7F A;  4L5J A;  3DV8 A;  1EH6 A;  2EV5 A;  4MTE A;  2ZJ2 A;  4I98 B;  3R6S A;  1BI3 A;  2L54 A;  4MNU A;  4MHG A;  4ZYG A;  1LDK B;  1FP2 A;  1ZAO A;  3M7G A;  1FT9 A;  2FNP A;  2O6G E;  3KP4 A;  4OMY A;  1YW8 A;  3T8R A;  4IHS A;  3SZP A;  4HX4 A;  4K2E A;  2ZFW A;  4U7B A;  4YII A;  5D5W B;  5LGU A;  1K6O A;  1IXS B;  3CUQ B;  4U0W A;  3IKT A;  1J9I A;  1PDN C;  1HQC A;  4BYY A;  1FBQ A;  4RB2 C;  2A69 F;  3GZ5 A;  1KU3 A;  1X3U A;  2W84 A;  5D4R A;  2BBY A;  2W25 A;  1ULY A;  1BC8 C;  4BHB A;  5E20 A;  3J80 K;  2ISY A;  1J7K A;  3U9G A;  1R5G A;  2O03 A;  2QBY B;  2PEX A;  4XSX F;  3QAH A;  2YX4 A;  3ISP A;  1HST A;  5J8F A;  1KU7 A;  4A2U A;  2Y0M A;  1YW9 A;  2HTS A;  4WXC A;  3E6C C;  5L3G A;  2E1C A;  3B73 A;  4O5V A;  3IWF A;  1O3R A;  4RGS A;  4XRF A;  2JTV A;  1ZG1 A;  3LST A;  3TDZ C;  2QWW A;  2QQA A;  4M71 A;  2D1V A;  2OAZ A;  4RGU A;  1ZGA A;  5CJ9 A;  4HAM A;  1W7P A;  1XSV A;  1F4K A;  2ZXJ A;  1Z1D A;  2CG4 A;  3LA2 A;  3D5L A;  2DFI A;  3V4G A;  3P9K A;  5KK1 A;  5HLG A;  2M30 A;  1R23 A;  4FHT A;  1SFE A;  2RQP A;  5BOX A;  3EQL F;  3VFZ A;  1OR7 A;  1WRJ A;  3KE2 A;  2JPB A;  4ESJ A;  5E1Z B;  5CVJ A;  1T6S A;  1SMY F;  3IWZ A;  2MC3 A;  3GWZ A;  2DO7 A;  1YQA A;  3ZMZ A;  4M9S A;  4AVP A;  1GXP A;  1BOA A;  4H0E A;  4M6X A;  2KIU A;  5CVR A;  5A2Q Z;  1S7A A;  4GYG A;  2VC1 A;  3F21 A;  3WGH A;  2E7X A;  4M72 A;  5E1W A;  2Z99 A;  2Q2E A;  3W6J B;  4YIF A;  2FBI A;  4KMU X;  5D8K B;  2HQN A;  3GZ6 A;  1LEB A;  1BI0 A;  2JRT A;  2V79 A;  5FD6 A;  5ERI A;  3KET A;  2FF4 A;  5ICC A;  4A6E A;  1TW2 A;  1R58 A;  4EGZ A;  3WU1 B;  1LDD A;  4GXO A;  1FZP B;  5DEQ A;  4HQM A;  2CYY A;  1TTY A;  2IP2 A;  2PBI A;  3V7C A;  1QPM A;  4IRH A;  2MH9 A;  3BPV A;  3E5X A;  4A12 A;  1U8R A;  1HXD A;  4GYI A;  1IXC A;  5BMZ A;  1BBY A;  2VE8 A;  2HWV A;  2M8E A;  1SAX A;  2YPR A;  4OIQ F;  1I6X A;  1IN4 A;  1J2X A;  4GCV A;  1E2X A;  1TQP A;  5H20 A;  1ZN2 A;  4MQV A;  2A5Y B;  3SZT A;  3DQV C;  1YIO A;  4A0Y A;  2E7W A;  5L3D A;  5D8L B;  3COA C;  1FPQ A;  1OYW A;  1BIB A;  5H6Q A;  3DP7 A;  4RB0 A;  3LAJ A;  1RUN A;  5D6E A;  3G3Z A;  4BHP A;  1O57 A;  3RPQ A;  3GUD A;  4A0Z A;  2MD5 A;  4N9H A;  3DPL C;  1IW7 F;  2OZ6 A;  1IN5 A;  2EK5 A;  1UHW A;  1Z9C A;  3BOQ A;  2G9W A;  3M1E A;  2HOE A;  3VOD A;  4IPA A;  2ZO4 A;  2DBB A;  2XVC A;  4LJZ F;  5DCF A;  4LD5 A;  1D8K A;  2XAG A;  1W5T A;  1RUO A;  1QO0 D;  4HA8 A;  1KU2 A;  1R00 A;  4KIB A;  5D4S A;  1TQM A;  5FGM A;  3FWE A;  3GO5 A;  3M8F A;  1XSD A;  2K86 A;  3HTU A;  4BQA A;  2G7U A;  3RTR A;  3GYH X;  4MEY F;  5D5X B;  3F23 A;  2OZU A;  5DD4 A;  3VB2 A;  4I09 A;  3HSF A;  2FOK A;  1R1U A;  2KJB A;  2EJR A;  1FSE A;  3Q5F A;  3RDI A;  2L4M A;  2FNA A;  2QM3 A;  1W5S A;  2QEN A;  3CLO A;  3F6O A;  4EJU A;  5TJJ A;  1W7P D;  3KP6 A;  4ZYD A;  3RYP A;  2OQG A;  2P7V B;  2O61 A;  3GFM A;  2G7H A;  3DXJ F;  5LHG A;  2RNJ A;  3M9A A;  3ZQ7 A;  4P5O A;  2LF7 A;  1MJ9 A;  3BJA A;  3C1D A;  1FYL A;  3DEU A;  4LB5 A;  2BGC A;  5JVT A;  2PLY A;  1I1S A;  2W57 A;  2JPC A;  1HW1 A;  5ILV A;  2FMY A;  5LGN A;  4UUV A;  2EFP A;  2KJC A;  3KCC A;  4HZF A;  3AAF A;  2VC0 A;  1V3F A;  3HOS A;  1CF7 A;  2BE5 F;  1O3Q A;  3HRT A;  4ESB A;  1T39 A;  3QU3 A;  3V8J A;  2GWR A;  1S7O A;  3I5U A;  3JAM Z;  4IHT A;  1ZRF A;  4EJW A;  2DQR A;  2DW4 A;  1IXR C;  2A3S A;  4A0X A;  1ZRC A;  1FYK A;  2OQR A;  4WX9 A;  4CDG A;  1TBX A;  3R0J A;  1B1B A;  3IC7 A;  2K02 A;  2JZY A;  2IA0 A;  4OMZ A;  1TNT A;  1L3L A;  2D1H A;  3JAM K;  2IT0 A;  4HF1 A;  1IRF A;  2LF8 A;  4I2O A;  1SD4 A;  1ZAR A;  2VBW A;  2XHK A;  3CJN A;  4U0V A;  3MCZ A;  1HKS A;  1MD0 A;  5E8I A;  3GW2 A;  3T1B A;  2R7D A;  2XAS A;  3EDP A;  3P7N A;  1A04 A;  1Z6R A;  3R4K A;  1VTN C;  4B09 A;  2P7C B;  3ABU A;  4L9J A;  1R1V A;  2QBY A;  2PQ8 A;  5HS7 A;  3KP7 A;  2OBP A;  5ILS A;  2VOD A;  2IVM A;  2Y48 A;  5IT9 Z;  3MFK A;  4HOB A;  2L02 A;  1QNT A;  2COM A;  4XSZ F;  1ZHF A;  3QU6 A;  2MBF A;  3ELK A;  1HW2 A;  1ONV A;  2EV6 A;  3TKY A;  4RGX A;  1KA8 A;  2CWE A;  2ADU A;  2F5E A;  4WK8 F;  3QP6 A;  3MEX A;  5HDK A;  3N97 A;  1Z91 A;  2XKP A;  4P96 A;  1WI9 A;  1PP8 F;  1J59 A;  3ZN1 A;  4R1H A;  5IT9 K;  2FSW A;  3IRR A;  2DQL A;  1ZRE A;  2HKX A;  2UXN A;  4EM2 A;  4PCQ A;  1U3E M;  1HKQ A;  3E97 A;  3HHH A;  1FWZ A;  1YS6 A;  5CVI A;  5F6F A;  2NRA C;  3WTY C;  3BJ6 A;  1ZLJ A;  3DF8 A;  4HX7 A;  1LQ1 A;  3GEZ A;  4NHJ A;  3L09 A;  2BEO A;  3DKW A;  4M9Z A;  1UHM A;  3JTH A;  1BI1 A;  1P4A A;  1Q1H A;  2EA4 A;  3T5X A;  4ZZD A;  3L2C A;  5AIQ A;  1YW7 A;  1QZZ A;  4HF2 A;  3SHF A;  3M8E A;  4HBL A;  1Z6T A;  4FT8 A;  4O3M A;  2QQ9 A;  2RV8 A;  2HTJ A;  4B8X A;  1QQI A;  2HKO A;  2P8T A;  3O3K A;  3RPU A;  5JFR A;  3V7R A;  3BRO A;  2V1X A;  2XAQ A;  3LQQ A;  4ZH4 F;  3FM3 A;  1TW3 A;  1ZLK A;  3HSE A;  4MGR A;  4P55 A;  1MJB A;  5L3C A;  4UVB A;  2XAF A;  2DK8 A;  2E1N A;  3EET A;  1P4X A;  5FLX Z;  1YO5 C;  3KP2 A;  2GXB A;  4EV0 A;  4ENM A;  4RGR A;  3NEU A;  4NQW A;  1DUX C;  3J7A O;  3JTG A;  4JK1 X;  1ODD A;  4YG2 F;  5D5V B;  2K27 A;  2AXL A;  1RIO H;  2QUF A;  3FHZ A;  3OOP A;  5AIP A;  4EQQ A;  3E5Q A;  3CDH A;  2UXX A;  1B59 A;  1O3S A;  5HLI A;  2P5L C;  2XV4 S;  2L01 A;  4RB1 A;  2WC2 A;  4ETS A;  2FEZ A;  3WGG A;  3NRV A;  1JGS A;  1OYY A;  5LEK A;  5F64 A;  5CLS A;  5HS8 A;  4I0B A;  1G3T A;  1T0F A;  4BAY A;  2WWY A;  2LDU A;  3WTZ A;  5K5O A;  1S8N A;  3LWF A;  2ZME B;  1REP C;  4UV9 A;  4EMS A;  4LLN A;  2L4A A;  4O6J A;  4AIK A;  3REO A;  2H94 A;  3QPH A;  4P9U A;  4HV5 A;  4Y15 A;  2AS5 F;  2VOO A;  3R0A A;  3SXY A;  2EWN A;  1XCB A;  5D6F A;  1KYZ A;  1YLF A;  2FXA A;  1KU9 A;  4Q47 A;  3CO7 C;  2HGC A;  3V7S A;  2J5O A;  3ML6 A;  4ESF A;  3ABT A;  5FB2 A;  3V8K A;  3KEO A;  3HSR A;  2ZNY A;  4PDK A;  1L0O C;  5L3E A;  4U88 A;  5LRS A;  4WXD A;  2X4H A;  3R60 A;  3MQ0 A;  1G4D A;  4CHU A;  2GA1 A;  3WG9 A;  4IRI A;  1C0W A;  1DP7 P;  2DK5 A;  1WKM A;  4WF2 A;  3D0S A;  3FXQ A;  1XDU A;  2QZ8 A;  5E1X A;  5LGT A;  1IN6 A;  5LHH A;  3ROU A;  2NAZ A;  2ZME A;  1KQ8 A;  4AD9 A;  2VN2 A;  5DUK A;  3KLN A;  1JXS A;  1XGS A;  2GXG A;  2RKH A;  2ISZ A;  2IJL A;  2ZBK A;  3GF2 A;  4TV7 A;  2FU4 A;  4G9Y A;  1SD6 A;  2P5K A;  1STZ A;  3NQO A;  2FA5 A;  3PQJ A;  3FMS A;  2VT2 A;  2ZNZ A;  3JSP A;  1LEA A;  4A5M A;  2P4W A;  3WE3 A;  3EUH A;  4YFN F;  3HUG A;  2RGV A;  1SMT A;  3PFI A;  2C6Y A;  3K0L A;  2VBX A;  1DPR A;  1UST A;  4I01 A;  1T2K A;  1CGP A;  5HDN A;  2VON A;  1IN7 A;  1GXQ A;  1J0R A;  6PAX A;  3TO9 A;  1W4M A;  1JHH A;  2YR2 A;  4UVA A;  3TQN A;  5ILU A;  3ZMV A;  2NS0 A;  3VOE A;  3QOP A;  2GQQ A;  1D5V A;  1B9N A;  1FNN A;  3N4M A;  3BP8 A;  2HZT A;  1OYI A;  2QYO A;  4FX0 A;  1B9M A;  3WTX C;  2P6S A;  2IPQ X;  1P2F A;  1EH7 A;  2RN7 A;  2Z5U A;  4PZJ A;  2K4J A;  2BV6 A;  4CIC A;  4YFK F;  2P6T A;  4CXF A;  2CO5 A;  2Z3Y A;  4Q4Z F;  1USS A;  5DCM A;  5DD8 A;  3R61 A;  1BI2 A;  4OIO F;  3WTT C;  4A6D A;  3F8B A;  2FML A;  3C3W A;  1UB9 A;  4EM0 B;  4PGG A;  2PG4 A;  4KUM A;  2XAH A;  1D3Y A;  3K1P A;  3I59 A;  4ON0 A;  4CYD A;  4CGZ A;  3ZN0 A;  4OIR F;  3WE2 A;  1QGP A;  3E5U A;  5H6R A;  3MAJ A;  3F8N A;  1TLH B;  3GXO A;  1HSJ A;  2UZK A;  3LA7 A;  1MKM A;  3ZMD A;  1SD7 A;  2Z33 A;  1QZY A;  2EFW A;  5AON A;  4U7D A;  5DUI A;  1KGS A;  2O0Y A;  3GVA A;  1JHF A;  3HHG A;  1AWC A;  1R5H A;  3JW4 A;  3Q9V A;  2ACJ A;  1G3S A;  5L3B A;  5J8C A;  1H0M A;  3ECH A;  3TOB A;  1Z7U A;  4WXH A;  1E17 A;  4XBF A;  1ZG5 A;  1K79 A;  4LFU A;  1WQ2 A;  4HYE A;  2NYX A;  2PMU A;  3FXR A;  4HDV A;  2TDX A;  1DPU A;  4AIJ A;  2V6C A;  4QLC U;  3F8F A;  2VXZ A;  5LLQ A;  3DFG A;  2B0L A;  2Q0O A;  5D5U B;  2MH2 A;  2A61 A;  5DDG A;  3ULQ B;  4JBA A;  3E6M A;  2RVC A;  3RKX A;  3SFZ A;  3WTW C;  4Y17 A;  1I27 A;  2IA1 A;  1DDN A;  1RI7 A;  2OD5 A;  4LMY A;  3IHU A;  4I0A A;  5CVV A;  2DPD A;  2KKO A;  1YYV A;  1S29 A;  3TGN A;  2M45 A;  2QVO A;  4CO8 A;  2ZCW A;  1LDJ A;  4KIG A;  3T0Y A;  5BS6 A;  3GX4 X;  2IW5 A;  5DYM A;  1GHC A;  2Q8K A;  5HS9 A;  4RS8 A;  1IAW A;  2P5V A;  4P9F A;  1FP1 D;  5A2Q K;  3JSO A;  4ZYH A;  1FOK A;  3K1N A;  3J81 K;  4UNO A;  4LLL A;  5E17 F;  4Z2Y A;  1MJA A;  4HDU A;  3F6V A;  4L9V A;  2PFB A;  1F5T A;  4L5I A;  3CUQ A;  5LEJ A;  3HIF A;  2VBY A;  3F3X A;  2R3S A;  5HVQ C;  1U6G A;  3TO7 A;  4AWX B;  4Q48 A;  2IA2 A;  2CQK A;  1O3T A;  1XCV A;  3HRU A;  5K5Q A;  1KQ9 A;  2H6B A;  2O3F A;  3K9T A;  4KFC A;  3J81 Z;  2DPU A;  2RC4 A;  2MLG A;  3HTS B;  4LG0 A;  1MGT A;  4UHT A;  2ESN A;  2GZW A;  1FYM A;  2FE3 A;  3T8T A;  3LQR A;  1U5T B;  3KLO A;  1RZ4 A;  4EJV A;  1FY7 A;  2QQB A;  1T98 A;  4KN7 X;  3S2W A;  4G7Z F;  1BN5 A;  1G3Y A;  5E18 F;  1LB2 A;  2JSC A;  4XLN F;  2LKP A;  2ETH A;  4YFX F;  2O8X A;  2K7L A;  4LK0 F;  2V1D A;  4HX8 A;  3ZMT A;  3FF5 A;  4D0P A;  3IKV A;  2DLL A;  2X0L A;  3WOD F;  2F5F A;  4G94 A;  2Y75 A;  1ZRD A;  3H92 A;  2HS5 A;  2CGP A;  1U2W A;  2XRN A;  3KZY A;  3LA3 A;  2EFO A;  2CSO A;  1K7A A;  1XD7 A;  2L3D A;  4CZZ A;  2W85 A;  4XLP F;  3BZ6 A;  3WTS C;  1YS7 A;  1RNL A;  4KIF A;  2VT3 A;  3RI4 A;  1XMA A;  3ZPL A;  1JE8 A;  2NNN A;  2VBZ A;  2DAO A;  4IXA A;  2M5W A;  1PUE E;  2HYG D;  2CW0 F;  5DV5 A;  3F8M A;  1P6R A;  3K2Z A;  1YFH A;  1R36 A;  4M73 A;  4EJT A;  3LFK A;  4FX4 A;  4OIN F;  2EFN A;  3DPT A;  4GO1 A;  1H9G A;  1LVA A;  4NB5 A;  1TQI A;  5JHU A;  2BYV E;  4R8H A;  4EM1 A;  3BY6 A;  3MZH A;  1K78 A;  4HLY A;  2A6H F;  4EJO A;  1LJ9 A;  1EV7 A;  1G3W A;  3CUO A;  2JT1 A;  3HYI A;  1O7F A;  4KIC A;  1U78 A;  3HRM A;  4M74 A;  4UXN A;  3BDD A;  2FBK A;  2F2E A;  1T38 A;  1LNW A;  2EA2 A;  4KT5 C;  1ON1 A;  3OV8 A;  1BJA A;  4WWC A;  5JI6 A;  3FMQ A;  4UV8 A;  3QRF F;  1H9T A;  1XSX A;  4RAY A;  4RAZ A;  2W24 A;  4BNC A;  3ZMU A;  1KYW A;  5FO5 A;  2LSO A;  4HLX A;  4G8X A;  5LBQ A;  1SD5 A;  2DU9 A;  3I54 A;  2A07 F;  2HR3 A;  2HFH A;  1F1Z A;  4LGW A;  3Q9S A;  1U5T A;  4HW0 A;  2ZKZ A;  1IN8 A;  3RIR A;  3GFI A;  1Y0U A;  1SFX A;  1ZH5 A;  2H27 A;  3RKY A;  4PGH A;  1PP7 U;  1WSU A;  3H3Z A;  1TNS A;  4RB3 C;  2GAU A;  4OU0 A;  4KMF A;  5ED4 A;  3L7W A;  3ZMS A;  2DT5 A;  5ICG A;  4HV6 A;  1NHA A;  4ENK A;  4KNY A;  2GIV A;  3C18 A;  4UVC A;  1XDS A;  1OKR A;  2WV0 A;  3SQN A;  5FFZ A;  2Z9O A;  4BH9 A;  1FSH A;  1FX7 A;  5BQT A;  2GA2 A;  2KIM A;  1FBU A;  1YG2 A;  4MQ9 F;  5EEG A;  4KA4 A;  2EV0 A;  4I7H A;  5JR3 A;  3K69 A;  2F5C A;  3PQK A;  2J5P A;  3U2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...