1OCOH

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
total genus 25
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1ocoH00
1OCRH 2ZXWH 2DYRH 1OCOH 1OCZH 2EIJH 3AG4H 3AG1H 3AG3H 5B3SH 3ABKH 2EINH 1OCCH 2OCCH 3AG2H 3X2QH 5B1BH 1V54H 3ASNH 5B1AH 2EIKH 3WG7H 2EILH 2Y69H 2EIMH 2DYSH 1V55H 3ABMH 3ABLH 5IY5H 3ASOH
chains in the Genus database with same CATH superfamily
3FXQA 4P9UA 1X4PA 2M0CA 4ZYEA 2XSDC 2JA5J 2HQRA 1FY7A 4BQNA 1S5LC 1FC3A 3O2PE 2CW7A 4IHXA 5TISC 1D0YA 1YW8A 2DXIA 2HNHA 3ZQGA 2IAIA 3TEDA 4UVBA 4RAZA 1ZR2A 1P9QC 3CDHA 4C3JJ 3BQZA 3W2AA 2LKSA 5CQGA 3JCUC 2CQXA 1NG6A 2VI6A 4XKCA 3SEZA 3HRSA 3P9KA 1ZN2A 2DT7B 3GEZA 4BXUA 3HRUA 3A1YA 3KP6A 2LRDA 3KETA 2PN6A 4GXOA 3PJRA 2KJCA 4QIWN 3DKYA 2R7TA 4CCLA 2EJRA 4ENJA 3FHNA 2A6EF 3EUAA 2DA1A 5LLQA 1LPQA 2NVUB 1SVLA 4HNUA 3MN2A 1MMSA 4N9IA 3LSTA 4R1HA 1LFBA 4NQWB 2HQNA 4BHBA 4XK4A 1U8BA 2M7BA 4Y7NJ 2E1MC 2LLKA 5DTDA 2HEOA 5CVRA 4ZDPA 3TO7A 1U0JA 1UJ8A 3CJTB 1FBQA 5DUIA 2PJRA 2E7XA 5K5OA 2HDCA 2IP2A 5DV5A 2O7OA 1A31A 1WJ5A 4HOBA 1OFCX 3V42A 1B8IB 5D8KB 2E35A 1PYVA 3REOA 5E3MA 5IT3A 1U2WA 3VPRA 1QQIA 3CUQC 1JJ8C 2L7ZA 2XRNA 1WGXA 3S16J 4ETSA 3W2VA 3AG2H 1YTYA 2Z9OA 2WAEA 2JRMA 2K3PA 5IP6A 2MG4A 2QBYA 3EUHA 3GZNB 4BJTA 4D7NA 5GAHJ 2M9HA 4PSXA 4U0WA 2VPLA 4CDGA 2QF7A 1HCRA 4HQMA 5BQTA 2COBA 2AQFA 2EB7A 1U6GA 3GFMA 1J5YA 5HODA 2IW5A 3ELKA 1QHHD 4ANJA 5FLMJ 3ZQCA 1ETYA 3T1BA 1FIPA 1K83J 2R5ZB 3BTCA 3LAPA 3S3NA 4LK1F 3CC7I 3BZ6A 1IDYA 1KONA 1XGNA 2BY3A 2VE9A 2FA5A 2OU2A 2RNGA 3Q5FA 4D0PA 5K5RA 1I39A 2RVCA 4KMFA 1YI2I 1N75A 5DS9A 2VJ4A 4G7OF 2MGQA 4CUGA 4B44A 3AKZA 1X3ZB 3BR6A 2HVRA 1HF0A 1N78A 5J6XA 2NNNA 3B02A 1YRNA 2XDVA 2DTZA 2OJED 4A0YA 1YJ9I 3HZJA 5L3GA 4HDUA 1USTA 4A5NA 1REPC 1DP7P 1DQUA 3R4KA 3KP3A 1WJAA 4CICA 3WE2A 4AC0A 1JKPC 2A6HF 2FNPA 3HPHA 4CHUA 4KA4A 1R5GA 3LSIA 5TGTA 5A2QK 1SAXA 3ZP5A 4A3CJ 3WTVC 1XMXA 1XPXA 4KISA 4M73A 1WH5A 2P7VB 5D4SA 1IUFA 2HWVA 1FOWA 2V4JC 4MFEA 2HXOA 5L3CA 3NWTA 4W1UA 3FXUA 4DNCA 4UUSB 2XAHA 1WJDA 1YLFA 3MZ8A 2XVCA 2RC4A 4KITB 4UB6C 5EDNA 3GFIA 5IOYA 1BJZA 4YFXF 3A01A 3HYIA 4G9YA 1KU9A 3ZQLA 1USSA 2F5FA 2RN7A 2EIMH 2EZIA 5H20A 1ZELA 2GQQA 2VBYA 3C1DA 1ETOA 4BACA 1AOYA 5J40A 3CTAA 4KDPA 3MEXA 3DF8A 1FBSA 1X1DA 1MMDA 3BWGA 2ISZA 2TDXA 4LMYA 2R7DA 2ZXIA 3RKQA 1P92A 4HLYA 2M7AA 3WTWC 3GTLJ 2WBMA 1HOMA 3HHGA 4OIQF 2F5DA 3NAUA 2GA1A 2VC1A 1PUFB 1J9IA 4Y4RA 1BN5A 3GZ6A 3LA7A 1TWFJ 2LH9A 4BY7J 1J75A 2L9NA 1V55H 2DU9A 4HX7A 3GTKJ 1QBJA 4E6KG 1UELB 4PZJA 2WADA 3HUGA 3IAM2 2JJ7A 2MSYA 2DQLA 1RIOH 2M8EA 3S15J 4MTDA 3BC8A 2GZWA 2VKDA 4GO1A 2KDZA 2VBZA 3ROUA 3QQAA 3FX3A 1OCCH 4QLCU 2VJ5A 4R79A 2PG4A 1GDTA 4WWCA 1T56A 3VSKA 1HC8A 1BC7C 3RJPA 5K5QA 3IC7A 5LGUA 3U9GA 1W7PD 3EYIA 4F3QA 1CQTA 2D45A 2E5NA 2VB6A 1LEBA 1FTZA 2RQPA 2Y2ZA 2GXBA 5ICGA 1PJRA 3JRGA 3JRAA 4G8XA 3ZGKA 3OYIA 5CVVA 2OC6A 3U1KA 3KP2A 2KLOA 3BOQA 4HW0A 4A93J 4P5OA 2P6TA 4XLFA 4L9NA 2BEOA 1D5YA 2P5VA 2DW4A 4FASD 4UB8C 4XKWA 1B72A 2OCEA 4L0ZB 1ZG3A 1AA7A 5IP9J 1I27A 3GW2A 4LG0A 3E1SA 2M87A 3DTEA 5FKNA 2WB1N 3HOSA 2VODA 2Y48A 2P5LC 2VOPA 3HOWJ 2NOGA 1K4TA 2B7EA 5L3BA 1LDDA 1YOVB 3UKGA 2WTEA 5CJ9A 1GXQA 5JI6A 2HTJA 3NEUA 2E1CA 1QHGA 1Z05A 2M5WA 1K4SA 3QAHA 2V9VA 2PJRB 5IT9K 2YPRA 5EYRA 1POGA 3HXLA 1YHQI 3I4NJ 2KP6A 3TL4X 1OYYA 1KA8A 3I3LA 5IP7J 2X48A 4LLGF 3CLQA 3J7AY 2ZJRF 3QU3A 4O6JA 2KIMA 3RKWA 5CKTA 3OMYA 3LQRA 4PGGA 2R93J 3PM1A 1X1BA 2NYXA 5F0HA 4DYQA 4AD9A 2XGDA 4GFBA 1HKTA 4XN3A 2BXZA 3HOYJ 2ZBKA 2QBYB 1MBHA 1K78A 2IBDA 3BG3A 3A0HC 4RM2A 3LSJA 4HRIA 4OMZA 4BAYA 3MMYB 2Z1DA 3BG5A 3JSOA 5M5XJ 1ZRFA 3TOBA 1MJBA 1I6XA 2JN6A 3UNGC 1GT0C 4CCKA 3U21A 1T0FC 5CYVA 2VT2A 3FM3A 4PJNA 2O6GE 1SVOA 3DTKA 2FUG2 1WQ2A 4M3GA 4EV0A 2PX9A 3WTZA 1RKTA 1TWCJ 2KIFA 2W84A 1D5VA 1W0TA 2XAGA 3BG6A 2O03A 2WWYA 3I71A 1UAAA 5IYCJ 1WWXA 2H8WA 2QM3A 1LKXA 2OF7A 4OWRB 3H0GJ 1TWHJ 9ANTA 2QSFX 1HSJA 4IRIA 2ZJQF 3CQZJ 4FHTA 1YRNB 1P6RA 4ON0A 3M1CA 1BA5A 3K1MA 3PSFA 5B5EC 4U87A 4YIIA 1YITI 1JGGA 4KNYA 3E5QA 4HX8A 3I53A 4A6DA 2QA4I 2IJLA 2IS6A 3O8GA 1MNMC 4M9ZA 2XAJA 1IC8A 4CCMA 2PBIA 3I58A 4EATA 4IHVA 4EJTA 2G9WA 4BE1A 2R7OA 4FT8A 1Z1DA 4BHPA 3U2RA 5HDNA 1WZ2A 3F8CA 3C18A 1HBXG 1I1GA 5DUKA 5TRDA 3CCYA 1IV8A 2A05A 3JRHA 3O8HA 1IN4A 2GAUA 2IRFG 3A01B 5FKOA 1W5TA 2DPDA 3QYBA 1KU3A 4RLFA 2FJ1A 1FOYA 1K61A 3GLLA 2E2HJ 3TQNA 4KIFA 2QUFA 2M34A 1IG7A 4IHWA 3I55I 4G94A 3CP2A 5HS9A 3FM5A 2X6OA 2VKVA 5F04A 4BDYA 3QP6A 5E20A 1IW7F 2R0QC 1MSEC 5JLXA 3O3KA 1RETA 1Z0XA 5HLIA 1H9GA 1HA8A 3VDXA 1OR7A 1T98A 4CSWA 4IQ4A 1TT5B 2V6CA 2RV8A 5EG0A 2IEKA 3ERED 2KQRA 5E1WA 4G6DA 2EV0A 2HOEA 3I54A 1ZRDA 1IRGA 1KZHA 1SFUA 3S1NJ 5LHGA 3HKZA 3F23A 2K40A 1R6RA 2GXAA 4RAFA 1SFEA 4OU0A 2W1OA 2IA1A 3SHFA 5IOZA 4XLPF 3E5UA 3QYEA 1FNNA 3FXRA 2XF7A 2FQ3A 2DDBA 4BY1J 4I02A 1SANA 2CQKA 3HUGB 2A5WA 4HQEA 1A6IA 2R3SA 2ZB9A 3GTJJ 1LEAA 1Y8QB 4JP0A 1LUJB 4F91B 3TP0A 1VQOI 1LVAA 4GCVA 4HSTA 3ISPA 4RB0A 1ITYA 2LBFA 2JK3A 3RKYA 5ICEA 2QWWA 3M07A 2R5YA 1SD5A 2O61A 2DAOA 2DFHA 2VQLA 1F43A 2JPCA 2CW8A 3UR3C 4C2TA 4O3MA 4FE4A 4A3LJ 2WA0A 1Y0UA 3OIQA 5HNFA 4EQQA 2NVXJ 1WHUA 2OA4A 4U0VA 2LDUA 2Z3YA 4M9SA 3EUHC 3EUKL 3LFUA 1WI9A 2LK2A 2PEXA 3VODA 1YG2A 3GXOA 2XB0X 3HBLA 2CUEA 2DODA 2BW3A 4ABZA 1I1SA 3ULQB 4CZZA 5F64A 3AG1H 1B72B 5KCMA 3J7AO 2JPBA 4NNJA 3LMMA 4PDKA 2EFPA 1SFXA 2CJJA 2BVMA 4M3FA 4LG0B 5FLXZ 1A35A 2UV1A 4NB5A 3TW7A 3F22A 4A3EJ 4RLQA 5GAGJ 4EEFG 3NQOA 4UHTA 2CWEA 2EZLA 1IN6A 3WG7H 2XUBA 2M2EA 5EJCA 1O3RA 2QVOA 3PIPF 3F21A 1WPKA 4BEHA 4ZYDA 5M3FJ 1GV5A 1YIOA 3CC4I 3WTYC 2CRGA 5J4VA 5H2FC 1ZR4A 4HNTA 1MSFC 2R7FA 1R00A 2DQRA 1ZHFA 2VXZA 1ZGWA 4EGYA 2F4IA 2EFWA 3FK6A 3C2BA 3JRIA 2A3SA 2JUGA 3HKZN 3QOPA 4OINF 5E3OA 1NHAA 5HVQC 4CH7A 3OYEA 5F6FA 1IZ1A 4PJJA 4P96A 1EH6A 2O5RA 1FX7A 2QZ8A 1MBGA 2GOXB 4I0BA 1HW1A 2O8KA 2TRTA 3I56I 1WVRA 2F4OB 2A69F 3ZMTA 2FNAA 1SVMA 2V7FA 2XPVA 5CVIA 1D8JA 3KZYA 2ZMEA 2M0MA 2O9LA 3GF2A 5E3NA 1Y1VJ 3RQ4A 4KIBA 1K78B 4HV5A 1O3QA 1ZK8A 4MTEA 1OMIA 3J80Z 3BDDA 1RRJA 2QENA 2K9NA 4LJZF 2DK8A 1F5TA 4QSHA 4WCGA 2KFDA 4XOTA 4I7HA 1E17A 1G6NA 4DYCA 1HW5A 1X1AA 2AXTC 4OIPF 4LK0F 1L3LA 3R0AA 4DBRA 2FBKA 1YW7A 3A0BC 2O8XA 2OTLI 1V5GA 2JZYA 2R7XA 2ZXJA 3ZQQA 1IRFA 2Z33A 3K4LA 4BL0B 2X6XA 2RDPA 3E6MA 1EV7A 2IS2A 2XGXA 3I4PA 4XBFA 1U78A 4LGWA 3RI4A 3CO6C 1Z67A 1MBJA 5F1RA 1T2KA 3VWBA 4IJAA 2VLAA 1V5EA 4AWXB 4B3XA 3BQYA 2CU7A 2GLOA 3QRFF 1S9HA 2H1LA 3G1MA 4W97A 3N4MA 5KK1A 4JOMA 3ZR8X 3HDDA 2BOLA 3O6BB 1RPWA 1AWCA 1G59A 5E1ZB 4LIUA 2MYSA 1ONVA 1FWZA 3I59A 4IHTA 3HRMA 2KJBA 2A5YB 2F48A 1U5TC 3LL7A 4WXDA 4I6ZA 3ABKH 2L9SA 3NRVA 2DPUA 3BG7A 5D6EA 3ML6A 1RR8C 1DPRA 2VASA 4ESBA 4XLNF 2MLGA 3G73A 3KE2A 1XD7A 2MA3A 1MMNA 2HU9A 3BR3A 2LMDA 3QPSA 1FPQA 1MZBA 1JJ6C 1R9TJ 1MIJA 3MQ0A 4M72A 2LF8A 4LFUA 4MQVA 4LLLA 4A3GJ 5CVUA 3KYLA 3H0DA 3FBNB 4XICA 4IO9F 2RKHA 2V1XA 5DDGA 1VZ0A 3JRFA 4M3BA 3CMAI 3TMOA 1B1BA 1L0OC 1TNSA 1UG0A 4XLHA 1R7JA 3TO9A 1OCPA 1R58A 4ASNA 2DOFA 3QOEA 5ILUA 2DOAA 4A3BJ 2VBWA 3KP7A 1XMAA 2MFZA 2XAUA 5EG0B 3K4CA 3MKYB 4PCQA 5ICFA 1DGWY 5CVJA 3OYNA 4LOCA 2Y9ZA 4XKBA 3F8NA 1VQPI 1P4XA 2RQQA 1XN7A 3S2DJ 1HQCA 2L3DA 3COAC 3HM5A 3AL0B 1YQAA 1RKWA 1E3PA 1Y56A 4S0HB 2DO7A 2FE3A 1RUOA 1X3WB 1UHWA 4II2A 2ZC2A 3R60A 3L2UA 4PJLA 1G3YA 1P7JA 2Y9YA 3RPUA 3QP5A 2JA2A 3ZMDA 4EVIA 2LBFB 3ZQFA 1SFKA 2W25A 1IN7A 2R7SA 2L4AA 3QODA 1IRXA 2EBIA 2GM4A 3ESWB 2R5YB 4NUBA 5F0FA 4J01A 2F2EA 2L01A 3R61A 3KEQA 1WI3A 1WH7A 1Z6RA 2UXXA 1OCTC 2JRTA 4U7DA 2IGMA 2KISA 1YJNI 1VTNC 2NOJB 3DLLF 1R4NB 2YS9A 5J8CA 4RGSA 2UXNA 4FQGA 1PUEE 1W36C 5HDKA 1U9OA 4A12A 1QGPA 5J8FA 3CLOA 1FP1D 2DA2A 4FE7A 1YFHA 3MKLA 2HKXA 4YRVA 2P81A 2BW3B 4PFOA 1LNWA 3GTGJ 2W57A 2XRLA 3LWFA 3CESA 2W7NA 1UCRA 3KP4A 2E19A 3SYTA 1EH8A 4PFPA 3ZMSA 2ZJ2A 4I0AA 3RPQA 2Y0SA 2BGCA 2YX7A 4KN4X 3Q9VA 1EF4A 4B09A 4E4HA 2AXLA 3WODF 1O4XA 3V8JA 3QU6A 4BEHB 1QZZA 2UWMA 2IS1A 4P55A 4IZZA 3K4KA 2FMLA 2Q1ZB 4RMNA 4F55A 3F0CA 1S72I 4M74A 1I3QJ 1OJLA 1TWAJ 3PUBA 5CQEA 5B66C 2WAFA 1OYIA 3WTTC 2HGCA 2LY9A 5LEKA 3P9IA 4OIOF 3P7NA 5E3LA 3TW6A 4C2UA 1MJ9A 4BH9A 2CV2A 1UHSA 3HTSB 1SMYF 2KHMA 3MVPA 2K7LA 2EZHA 2LF7A 5LBQA 1HSTA 4UVCA 2FRHA 3LSKA 3ZQ7A 5JHUA 2GIVA 3TP3A 2CV1A 3OYAA 1X2NA 1B6AA 1IXCA 1HKSA 3K1PA 3ZN1A 3M8JA 4M3EA 2ZMEB 3M3YJ 1Y0NA 4CYCA 2DK5A 3ZXSA 1SD4A 1X58A 4RM3A 1TNTA 3D1NI 1DU6A 3KX2A 2KT0A 3MD2A 2CQ7A 3CDLA 4BJ5C 2XROA 2K4JA 2DA3A 3JTGA 1B4AA 4GYIA 5JVTA 1D1BA 2ID6A 3M8EA 3V8LA 3PO3J 3KLNA 4MFDA 4IF4A 4BXXJ 2EWNA 3L2QA 2EINH 1ZARA 1DP3A 1SAUA 3BZKA 1ZLJA 2BBYA 1T95A 3DBLB 5ICCA 3MCZA 3PSIA 5LRSA 3KPHA 2DMQA 2JUCA 1A04A 1BI1A 1WCMJ 1X4OA 4YEJA 3MFKA 5EGOA 1MDMA 4Q5SF 1A5JA 4DQ2A 2VJJA 3BR2A 3IL2A 2STTA 4AIDA 3WHBA 3WHCA 3OYJA 3CCMI 1ZG5A 1JKRC 2R7RA 4WXHA 1OR7C 1XSVA 5FGMA 2JWTA 3BLYA 5E17F 3HC7A 4UV8A 4RA2A 3SXYA 2E1NA 3LQQA 2NXNB 4I09A 2XHKA 3W6KB 4R8HA 4WK8F 3KCCA 2L54A 3OYHA 3K1NA 2LOOA 1P4AA 4RS8A 4JBAA 1IDZA 2ZFWA 4Y33A 1U8RA 4RB2C 4XSXF 1W5CC 6PAXA 2I5UA 4M71A 3E7LA 2ELHA 2PMHA 2HYGD 2Y75A 4D7MA 4S04A 4BUPA 4V2FA 1IV6A 1ZH5A 3C2HA 3I59B 3WTSC 5L3FA 4KICA 2MD5A 3H5AA 5HS7A 3J81K 2ISYA 2VKHA 1IJWC 4ZTJA 4BDZA 2DOEA 5DEQA 5K1YA 1KYWA 4PUSA 3HOUJ 3CMYA 3QWLA 4DGWB 4B43A 4C30A 2MBFA 1K79A 3F6VA 2DTRA 1W36D 1Z7UA 2BYVE 5IYBJ 2GIZA 3A4CA 3HTUA 1YJWI 2IS4A 2RNJA 2B0LA 2VQCA 2ME6A 5LFAA 3V4GA 5GADJ 2X0LA 2DYSH 5FRMA 1R22A 4P1WA 3LOCA 2LD5A 5AIQA 3BR5A 3D5SC 4N9HA 3Q9SA 2X4HA 3CCUI 1R4MB 1JUPA 3ABUA 4XMYA 5BS6A 5HLGA 1X1PA 2VN2A 2LC2A 4NBQA 3GTOJ 2XPWA 3EYYA 3GLXA 4AIJA 2E34A 2ZNZA 4HZFA 2W82A 2LP0A 5B1BH 4PSWA 1QRYA 3KIOA 3S93A 1Y6IA 2E36A 4HNVA 1H88C 4JX4A 2V1DA 4L0YB 5FRNA 4C3IJ 2VE8A 3G71I 2BZTA 3CCEI 1TBXA 3VB2A 2K02A 3GTPJ 3JAMZ 1JHFA 4B3AA 4XNFA 2HYFA 3W3CA 2V1NA 2K5CA 2Y31A 3ZCOA 3S1RJ 3BTIA 2DYRH 2X51A 1ZTRA 1TP4A 3FDYA 2JVGA 2JA6J 2BXYA 4Z6YA 2OD5A 4G7HF 2HOSA 4HPQA 3L9FA 4XR6A 4DJAA 3RSNA 4TV7A 2VT3A 2MLKA 1IRZA 2NVQJ 4RBOA 3HSFA 1BR2A 2V1UA 3DLAA 4C2MJ 3OSGA 4IQJA 1SC7A 4IVNA 2EK5A 4MQ9F 4EM1A 4B8XA 4MHGA 1MBFA 3DXJF 3V7CA 4HEA2 2E71A 3LAJA 4L5JA 2M45A 3IRQA 5GP9A 2FOWA 3AG4H 3S17J 3HOTA 3AG3H 1T39A 2M4GA 2DI3A 2EV6A 2NS8A 1T08B 4CO8A 1FP2A 4I01A 4ZDOA 3JW4A 3BZCA 3VYTB 3K0LA 1STZA 3KLOA 1D0ZA 2IA2A 4F52A 4XL9A 1FMVA 4Z2YA 4HX4A 1YS7A 2ZNYA 1W0UA 2XASA 3LFKA 4I76A 2ZXWH 2H1KA 5ERIA 2CYYA 3DEWA 5KNLA 1R23A 3M8FA 4ITVA 1DU0A 1GLNA 1PP8F 1O3TA 2DA6A 3A03A 1JTYA 1YX5A 2DA7A 1NK3P 1ETKA 2FX0A 1Z21A 2F5EA 3P9CA 3K6GA 2F4MB 2IGNA 3L09A 2A07F 3FF5A 3JREA 1J2XA 2BY1A 5GTIC 1ZLKA 4G6TB 5AIPA 4ENNA 3LNQA 2GWRA 5FFXA 3OYCA 2OAZA 1JTXA 3VFZA 4HV6A 1HDPA 1ZAOA 2FMYA 5FD5A 2V9PA 3ZMUA 1BR4A 4DZPA 5EF6A 1YYVA 1OLTA 5K7HA 2DJIA 4BQQA 3ZMZA 3HHHA 2HZDA 5IYDJ 1VQ7I 5LGNA 4GDFA 2ZSHB 2DMTA 3E0JB 4E7HA 2NAZA 2UZKA 4ESJA 1W5SA 3PIOF 4H4KC 2HVQA 3BTLA 1WJCA 1VFCA 1TL8A 1Y39A 1T8IA 5J47A 4EJUA 3OWTA 4S05A 1WFXA 4CYCB 4E7JA 1MD0A 3N97A 1HKQA 2R92J 2EILH 3RKXA 2DJNA 2EA4A 2F6CA 3KEOA 4HF1A 4ZZLA 3TOAA 1B9NA 2XC7A 4B4CA 2K85A 4BJ6C 3L2RA 1ZQ3P 4BHCA 1GVJA 3FBIB 2ME0A 3E6CC 2PMZA 3S3OA 2K4BA 2LY1A 3CJRB 2VJIA 4XLAA 1BM9A 1OQYA 2VQGA 1D1CA 3AAFA 3VYSB 3V7RA 1MDMB 5EGOB 2STWA 2GA2A 2H6BA 2EV5A 4RAYA 2Y0MA 2PQ8A 4QPOA 2MH2A 4E7KA 2DLLA 4IL6C 2B9SA 5JLWA 1UG2A 1BIBA 2AQEA 3ZQHA 1S7AA 2ZFUA 4MGRA 3GTQJ 2HOAA 4AU7A 3DPTA 3CMMA 3I64A 3ZMVA 5J4YA 1FYMA 5IPAA 2CW0F 2XKOA 3GCMA 4DZJA 1XGSA 3OR2C 4LITA 2K86A 4J19A 4N4NB 5J1RA 3IWZA 3CUOA 1VQMI 1YS6A 1S7OA 4F92B 2DFEA 5DCMA 4XRSA 3G1OA 1FOXA 4MO7A 2C6YA 4OAYA 1LB2A 1S8NA 1ZREA 3HEFA 4M3DA 2IVMA 2QQ8A 4D9JA 5FKMA 3FXJA 1FYKA 2LFBA 1BI3A 2CFXA 4RGUA 3ASNH 4Y15A 5E8GA 1ORKA 5BPIA 2FU4A 2HR3A 3IP4B 2EZKA 1E0EA 1JI8A 3FHZA 1QPIA 1UZCA 4G7ZF 3Q0UA 5A2QZ 1KQ9A 3BTJA 1N25A 3OYLA 3CO7C 3B73A 1RUNA 3K4JA 1OCOH 3K4BA 1KU7A 2XGEA 1QZYA 4NC6A 4XN0A 2CGPA 1LJ9A 5D5VB 3S3MA 1J09A 1UB9A 3H9JA 3GYHX 3IV5A 1H89C 2JVHA 1NG7A 2ZSIB 2CO5A 2K3FA 2WAQA 3BJOA 2V6EA 5DYMA 2KIQA 4XLCA 3IRRA 3BROA 1LFUP 5ED4A 3EETA 3CCQI 2KRHA 4IX7A 1Q1HA 3KP5A 2K9SA 4LLNA 1P2FA 2XIGA 3PQKA 1Z7LA 1TZLA 3DEUA 1F36A 3U1DA 5HS8A 2GOMA 4Y3OA 5CLSA 5EEGA 2OQRA 2FBIA 3H3UA 5HNHA 3ERMA 3E5XA 3IHUA 1VF9A 3M1EA 4JX6A 3L00A 2LNBA 2LY2A 4HSRA 4OIRF 4AIKA 3GWZA 3H9QA 5HDGA 2R7QA 3QYFA 4UUTA 3RIRA 2VOOA 1O57A 1S3JA 2LYCA 1GUUA 3M4OJ 2D1VA 3ASOH 2HQ5A 2N8GA 3DTIA 3L7WA 3OL3A 4X1EA 5AONA 2QSGX 2WY7Q 4IPAA 3VSLA 2KRFA 2VKEA 2YUSA 4IOAF 3DKWA 3L1PA 5BPDA 2E1MB 3TDUC 3IKVA 3A02A 3CCSI 1GVDA 4EM2A 4EJWA 4HDVA 2DA4A 2FQ4A 1IO2A 2KKOA 1FZPB 3K2AA 3OOPA 1UMQA 2ECCA 1ETXA 1JGSA 5DD4A 1Z9CA 4CGZA 5KAFC 2VBXA 2M8GX 2W4SA 2H09A 1O7LA 4PK4A 3IAS2 4YFNF 4AVPA 1V4RA 5E1XA 3FISA 4EGZA 3WGGA 4A3MJ 4NC8A 3JRDA 4ZH4F 4A0XA 2ICWG 1OYWA 2E1OA 4NDLA 2IXSA 2V9KA 3WTUC 1VQ4I 3DWLE 4GGGA 1JUMA 3ZQIA 2KRCA 3OYMA 1KYZA 3I4MJ 5D6FA 2BHZA 2Q2EA 2V79A 2E2JJ 3OYBA 1MW7A 1MKMA 3KZIC 1F1ZA 5KAIC 3HPGA 1J0RA 2WAQN 2W85A 2V26A 3HSRA 3K7AJ 2DCEA 4IEJA 4ESFA 2H27A 1ZGAA 2FOKA 3E6DA 4FCYA 3RPUD 5GPCA 5F1JA 5LRRA 3FMSA 3VEPA 1GXPA 2NS0A 2X1CA 3RQIA 5LEJA 1BOAA 3VOEA 3LSPA 3W2WA 2QEXI 1OISA 4IXAA 5FROA 5IT9Z 2LR8A 3WU0A 3EQLF 2L0KA 4KN7X 5LGTA 1FTTA 1JUSA 3ECHA 4A5MA 1BR1A 2OV7A 1MMAA 1X3UA 2CS3A 4UNOA 2BVLA 3HRTA 3AFHA 1FBUA 4D1QA 1JKQC 4Q47A 1G3TA 2O0YA 3DP7A 1APLC 1SD7A 3QPLA 2OBPA 1MJAA 3Q0WA 1GHCA 2O3FA 2BV6A 2L7KA 4BU2A 5L3EA 4M6XA 3WGIA 4IRHA 2I8DA 2WC2A 3PQJA 3IH4A 4CYDA 3PL8A 3OY9A 3DU5A 4IHSA 4AYBA 2CUJA 5LHHA 5HLHA 4IHYA 2OTJI 1UFMA 3DQVC 2HQAA 3E97A 4H0EA 2YU9J 2JTVA 4ZTFA 4IRGA 1E2XA 1TTYA 2KZGA 4B1RA 1SFOJ 4U88A 1ETWA 4A3IJ 3I9V2 1TC3C 4RAGA 1I3AA 1ULYA 2L9RA 3K70D 2ADUA 2RGVA 4FTHA 1DGRM 4AIHA 4UV9A 2MC4A 3I0TA 3GFLA 4HAMA 2KMUA 5FO5A 2L7MP 2BE5F 4QWQA 2WV0A 5E8IA 1E3HA 4L18B 1ZG1A 3RYRA 5DCMB 3FK7A 3GO5A 5C4JJ 1IGNA 2D5VA 2OUMA 4MEYF 1G8XA 1JKOC 2E60A 2EFQA 4E7IA 1ZGJA 1RZ4A 3HB9A 5BNGA 2ECBA 4ZYAA 5B3SH 1BC8C 1AKHA 2R7ZJ 3A2KA 1XMKA 2KZVA 3LSHA 3CCLI 1RESA 3X2QH 5C3EJ 2VIXA 1VQ8I 4CCOA 2H94A 2MC3A 1G2HA 3IWFA 3CJQB 1K6OA 3HGGA 1FT9A 1MH4A 4BBSJ 1VQKI 1S7EA 2VXDA 4BKXA 3DBRB 2OQGA 3L2WA 1T38A 4KJZA 1LVKA 2ZKZA 1Y1WJ 2Y30A 1TWGJ 2HDWA 1H8AC 1G4DA 1KQ0A 5E79C 3KZZA 4KT5C 5JVGF 2NVTJ 3OV8A 4V2GA 4OOIA 1X2MA 1TT0A 4PGHA 3OYKA 2UUZA 1FMWA 3GMEA 3IH3A 3KYDB 1EJ9A 5C4XJ 4I99C 1D1AA 2L5QA 2DN0A 3R6SA 4XQFA 4AYBN 1FYLA 1PVEA 3QPHA 3VYRB 2A6TA 5LD2C 5J3LA 5J1UA 3F72A 4F93B 2HKOA 2FXAA 1J59A 1XSDA 1YE9A 3LA3A 5F0CA 1IF1A 3G2BA 1XX5A 3RDIA 2XB5A 2NVYJ 3DPLC 2HVSA 4II3A 3D5LA 3FIWA 3PFIA 3SFZA 2MABA 2RAEA 2M30A 1WSUA 1P7IA 2NNYA 1BIAA 2R7VA 2BY0A 4UVAA 3WE3A 1NTCA 2ZCWA 4P9FA 2ELJA 4EJVA 1TLHB 5D5WB 2F5CA 3WU2C 2X9DA 2VC0A 2K9MA 4XRSG 3DFGA 2LSOA 3T5XA 4I2OA 1MBKA 3MWMA 2ZO4A 1H0MA 3P5JA 1WRJA 5GAEJ 3RYPA 2JSPA 2DDAA 4ZYHA 3DBHB 5D8LB 3TBIA 3D0SA 1XCVA 2EQRA 2PMUA 1JE8A 2X1DA 3G4SI 4CXFA 1A36A 2Y69H 3BPXA 3G6EI 1YX3A 4XRFA 2AO9A 3S32A 4QTRA 1AU7A 1P4WA 1WJBA 2E5ZA 1ERDA 2JA7J 5M3MJ 4LB6B 2CH0A 3H5RA 5CPRB 4CCNA 1NK2P 2PFBA 2Q2EB 1B9MA 3IH2A 3OOUA 3HSEA 2D2WA 4Y17A 4BQOA 4L9TA 1YIJI 2TCTA 1A6QA 2EIJH 2HI3A 2PLYA 2BHYA 2D1HA 3MKZA 2BY2A 1K7AA 2W24A 3HIFA 1CF7A 5ILVA 2COMA 5TJJA 4F7ZA 3FXOA 3FWEA 4BE0A 2Y0SN 1V54H 5FLXK 3FMRA 2J5PA 3GX4X 5DD8A 5GTHC 1W1WE 3AL0C 2WB1A 1XC5A 2L2OA 3DKXA 4BXFA 4JYKA 1I6HJ 4V19K 3RTRA 1XG1A 3OIPA 1QZEA 3H1CA 1D8KA 4FISA 3JRCA 4WXCA 2OZ6A 1IN5A 2YSRA 5KHDA 4RDUA 3CF5F 2B63J 4BNCA 1ON2A 1H9TA 4HF2A 2JA8J 4A3DJ 3BCAA 2P6SA 4BE2A 1JHHA 4JX5A 1PP7U 2VUMJ 3BR1A 4E70A 1ODDA 3LSGA 1DUXC 2LVSA 4PJMA 3SZGA 1ACIA 4K2EA 3LSRA 4LIVA 4D5FA 5EZHA 2EFOA 2DT6A 3JSPA 5FFZA 1B59A 3OL4A 3GFJA 4XONA 3K9TA 1VQNI 3DEEA 4X0GA 1BL0A 1RR7A 1U5TA 3IUOA 3LSMA 4KIGA 2GXGA 3C3WA 4C9YA 1G3SA 4L5IA 3J80K 1MGTA 1MNDA 3M7GA 5GPAA 4L5EA 4U0YA 3ZOBA 4XKVA 3V8KA 3S2HJ 3FXLA 1Z91A 4AUXA 2EFNA 3F9KA 1O7FA 3Q0VA 4OAZA 3OYDA 4A69C 1XGMA 1M1EB 3KEYA 2QYOA 3ECOA 1IXSB 3L2CA 2QGUA 1GV2A 1I5ZA 5H6QA 1V3FA 5D5UB 3V7SA 2CUZA 2R4GA 2DBBA 2CV0A 2QQBA 4AVZA 2ETHA 2DMUA 5EZGA 1ZKGA 3PNYA 2CSOA 1MNEA 4XRMA 2FBHA 2G7HA 3SZTA 4JQFA 1MMGA 4YIFA 4FETA 4LD5A 3TO6A 2WY8Q 5F27A 1X1CA 2W48A 2M3AA 1HLVA 2M1BA 2NRAC 5FLVA 3BPVA 2H8RA 3FKJA 5K7FA 3T8TA 2LG4A 2P5KA 2R7UA 1UHMA 3H92A 3HJEA 1S29A 4HYEA 4CZCA 1AKHB 1BI2A 1VI0A 2OZUA 3H36A 2ZMEC 2M4KA 4UY8I 1RNLA 2E7WA 1MBEA 2Q0OA 4BYYA 2ESHA 3JTHA 3K69A 5JR3A 3IKTA 4CA0A 2HS5A 1BOBA 1Z3XA 4HLXA 4E7LA 4Y13A 1FIAA 2HXIA 2Z16A 4NC7A 1N77A 4KYWA 4M6YA 4HF0A 3SDBA 2XGCA 3CZ6A 5D4RA 1XGOA 3BR0A 2VL8A 2LKXA 3OIOA 2HFHA 4ENKA 1Z77A 3DPUA 3MZYA 2K27A 1OPCA 4ZZDA 1R71A 2Z2SB 2P7CB 5BMZA 1FSEA 3RZDJ 3CUQA 3K2ZA 3BT9A 4CCJA 2HZTA 4ZC3A 2ACJA 1WKMA 3HOZJ 3EDPA 4HG2A 4DOZA 5E18F 4A0ZA 1YO5C 1KGSA 1IXRC 3FXMA 2QQAA 3SDGA 5M5YJ 3B6CA 4L9VA 1W7PA 3F8FA 2HPMA 1R5ID 2FEZA 2OPTA 2KIUA 2X6YA 1V5FA 3OR1C 2IT0A 4LB5A 4KUMA 2XAQA 2YR2A 1XB4A 2IGOA 3R0JA 3CMEI 5D5XB 3HG9A 2IA0A 4OMYA 2ZJPF 1LFPA 3CJNA 1VQ9I 2H6CA 3OS2A 2HPIA 4QPQA 1YW9A 2QKLB 1K6YA 3F6OA 3Q3SA 1QO0D 4N0BA 3JR9A 1U9NA 1U3EM 3JRBA 1LQ1A 3NARA 2X1EA 2XV4S 4BGDA 1VQ5I 3ABTA 3F3XA 5DM7F 2QLZA 3G3ZA 4JK1X 2Z5UA 2EA2A 1XDUA 1EA3A 2HYJA 4KFCA 1KQ8A 3H35A 5LHIA 4XORA 3F8MA 1FOKA 4Y52J 1IUYA 4MIMA 3LA2A 3PNVA 4IKFA 2XPUA 3S14J 2XKPA 2KL4A 4PJ0C 4UXNA 4XSZF 3T0YA 3FZVA 4G12A 5ILSA 3RZOJ 1R49A 2EH3A 3SJMA 3S2WA 2Q8KA 1LE8A 2HDDA 3WGHA 1LDKB 3D5RC 5EEAA 2ID3A 4YG2F 3HOVJ 1JT0A 3WG9A 1ENHA 5JFRA 3PO2J 2YU3A 4EM0B 1VNDA 5FB2A 4AM3A 1CF7B 1ETVA 1BW5A 4XLEA 1FEXA 1BJAA 1FJLA 2FF4A 1X19A 2DFIA 3HL2A 2IGKA 4YFKF 5DM6F 1R1VA 1EKEA 5L3DA 2QSHX 3E3VA 4N4OB 2L7FP 3CDIA 4RGXA 4MLOA 5EEHA 1SEUA 1XTAA 2XSJC 5FKKA 3ZN0A 4EJOA 2A61A 3CCRI 3HOXJ 2QCOA 2FD5A 1IN8A 4FX0A 1Q1VA 4A2UA 5FJ8J 1BBYA 4ZJZA 1I50J 2L02A 3MZHA 2X85A 3FMQA 4M6VA 1WJEA 4YELA 4BBRJ 1VQLI 2FSWA 3CP8A 3FXKA 3KFWX 2F5VA 4NQWA 5HLTA 4L9JA 2PJPA 1KU2A 1R5HA 1D0XA 2JMWA 3ABLH 4BQAA 4NHJA 2Z99A 4B48A 1F4KA 1U5TB 3ZRGA 3MKWB 4A3FJ 3CF2A 2G7UA 4G6QA 2DMPA 2X6WA 3TGNA 1T6SA 1XDSA 2PMZN 1B8IA 2HOTA 2QQ9A 1QA6A 2J5OA 1BI0A 1JXSA 2HTSA 2YX4A 1IAWA 3WU1B 5B1AH 5M5WJ 2RREA 4ZDLA 3VYUB 1QU3A 3K4NA 4HBLA 3C2GA 1TW2A 3BP8A 3QPTA 1XS9A 1EH7A 2KPMA 3I5UA 1J7KA 2GBYA 3N05A 2CFOA 1QVTA 4UUVA 3M9AA 3J7ZI 4D5CA 2L9VA 3K70C 1PDNC 1QVUA 3BJAA 4MEXF 1G3WA 3G1LA 2VQHA 1DPUA 3OS1A 3CCJI 4EMSA 4IOCF 2VPRA 3CCVI 3RCOA 3OYGA 1R1TA 2MD0A 2CQNA 2R5ZA 1CGPA 2KDOA 2W00A 5C44J 2QKMB 3BJ6A 1JT6A 2XAFA 2ZXHA 3PUFA 1OKRA 1RC9A 4E7SA 3H5NA 3MAJA 3E6BA 2P4WA 3S8PA 1DDNA 2ESNA 5FD6A 3J81Z 1SMTA 3SZPA 1XSXA 3OYFA 3J7YJ 3SQNA 2PI0A 4DIQA 4A3KJ 3H3VK 2G0EA 5F08A 1LDJA 2LTPA 3H3ZA 3SFIA 4DYRA 1R36A 4XOPA 1TW3A 3BY6A 1RI7A 2EIKH 3DU6A 3GUDA 1D3YA 4GRIA 1MH3A 3W6JB 4GYGA 2JSCA 2XF5A 3CD6I 3EPZA 3FKIJ 2DFFA 1QNTA 2DA5A 3F8BA 1W4MA 3H9GA 4M9XA 5JHFA 3GVAA 3ONQA 4DBQA 5IY5H 3CUQB 3OSFA 5FKLA 2JQ7A 1FLIA 4RGRA 4B47A 2K9QA 4E7ZA 2AS5F 2XF6A 1TQIA 4XM3A 4RB3C 2MW8A 2CQQA 2DMNA 3DV8A 4U7BA 1BW6A 1TQPA 4A3JJ 4DW6A 4ENMA 1W7PB 4O5VA 4WF2A 1HDDC 2VONA 2JT1A 2CG4A 4UUSA 3KYCB 2E2IJ 4J00A 3B6AA 3HGYA 5BOXA 2K9LA 2A68F 3WTXC 2I10A 1T0FA 3JAMK 1FSHA 3W6VA 1OCRH 1ETQA 1WJFA 3C7JA 3CC2I 3OS0A 4RB1A 3SEQA 2R7WA 1Y8RB 1OCZH 2CMPA 1HXDA 1AHDP 1S6LA 1O3SA 2EPFA 3DCFA 1R1UA 2OCCH 5DCFA 5K7ZA 1HW2A 2DT5A 3TDZC 2IPQX 4XIDA 5H6RA 4YIRX 1XCBA 2MH9A 4A6EA 4MNUA 3S1MJ 1E3OC 3BCBA 3K4MA 2ELKA 1F9NA 2LKPA 3NWSA 1PUFA 3BG9A 1T33A 2P8TA 3PFYA 1Z3YA 1QPMA 4Q4ZF 4Q48A 2NS7A 4KT6A 3K10A 2L4MA 3TKYA 3S1QJ 4BS9A 1TQMA 1ZRCA 3GBGA 1ZYRF 4X6AJ 4FX4A 1Z6TA 2P0WA 3GZ5A 1ON1A 3GTMJ 5KVRA 1VQ6I 2AHQA 1LE8B 4I98B 1NH3A 3T8RA 5J1YA 1C0WA 3ZPLA 3L2VA 4ZYGA 4WX9A 2CUFA 4C3HJ 2WV1A 3PNTA 2LREA 1SD6A 4LG3A 3ABMH 4KMUX 5HOOA 4HA8A
chains in the Genus database with same CATH topology
1OCRH 2ZXWH 2DYRH 1OCOH 1OCZH 2EIJH 3AG4H 3AG1H 3AG3H 5B3SH 3ABKH 2EINH 1OCCH 2OCCH 3AG2H 3X2QH 5B1BH 1V54H 3ASNH 5B1AH 2EIKH 3WG7H 2EILH 2Y69H 2EIMH 2DYSH 1V55H 3ABMH 3ABLH 5IY5H 3ASOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR H;  2ZXW H;  2DYR H;  1OCO H;  1OCZ H;  2EIJ H;  3AG4 H;  3AG1 H;  3AG3 H;  5B3S H;  3ABK H;  2EIN H;  1OCC H;  2OCC H;  3AG2 H;  3X2Q H;  5B1B H;  1V54 H;  3ASN H;  5B1A H;  2EIK H;  3WG7 H;  2EIL H;  2Y69 H;  2EIM H;  2DYS H;  1V55 H;  3ABM H;  3ABL H;  5IY5 H;  3ASO H; 
#chains in the Genus database with same CATH topology
 3FXQ A;  4P9U A;  1X4P A;  2M0C A;  4ZYE A;  2XSD C;  2JA5 J;  2HQR A;  1FY7 A;  4BQN A;  1S5L C;  1FC3 A;  3O2P E;  2CW7 A;  4IHX A;  5TIS C;  1D0Y A;  1YW8 A;  2DXI A;  2HNH A;  3ZQG A;  2IAI A;  3TED A;  4UVB A;  4RAZ A;  1ZR2 A;  1P9Q C;  3CDH A;  4C3J J;  3BQZ A;  3W2A A;  2LKS A;  5CQG A;  3JCU C;  2CQX A;  1NG6 A;  2VI6 A;  4XKC A;  3SEZ A;  3HRS A;  3P9K A;  1ZN2 A;  2DT7 B;  3GEZ A;  4BXU A;  3HRU A;  3A1Y A;  3KP6 A;  2LRD A;  3KET A;  2PN6 A;  4GXO A;  3PJR A;  2KJC A;  4QIW N;  3DKY A;  2R7T A;  4CCL A;  2EJR A;  4ENJ A;  3FHN A;  2A6E F;  3EUA A;  2DA1 A;  5LLQ A;  1LPQ A;  2NVU B;  1SVL A;  4HNU A;  3MN2 A;  1MMS A;  4N9I A;  3LST A;  4R1H A;  1LFB A;  4NQW B;  2HQN A;  4BHB A;  4XK4 A;  1U8B A;  2M7B A;  4Y7N J;  2E1M C;  2LLK A;  5DTD A;  2HEO A;  5CVR A;  4ZDP A;  3TO7 A;  1U0J A;  1UJ8 A;  3CJT B;  1FBQ A;  5DUI A;  2PJR A;  2E7X A;  5K5O A;  2HDC A;  2IP2 A;  5DV5 A;  2O7O A;  1A31 A;  1WJ5 A;  4HOB A;  1OFC X;  3V42 A;  1B8I B;  5D8K B;  2E35 A;  1PYV A;  3REO A;  5E3M A;  5IT3 A;  1U2W A;  3VPR A;  1QQI A;  3CUQ C;  1JJ8 C;  2L7Z A;  2XRN A;  1WGX A;  3S16 J;  4ETS A;  3W2V A;  3AG2 H;  1YTY A;  2Z9O A;  2WAE A;  2JRM A;  2K3P A;  5IP6 A;  2MG4 A;  2QBY A;  3EUH A;  3GZN B;  4BJT A;  4D7N A;  5GAH J;  2M9H A;  4PSX A;  4U0W A;  2VPL A;  4CDG A;  2QF7 A;  1HCR A;  4HQM A;  5BQT A;  2COB A;  2AQF A;  2EB7 A;  1U6G A;  3GFM A;  1J5Y A;  5HOD A;  2IW5 A;  3ELK A;  1QHH D;  4ANJ A;  5FLM J;  3ZQC A;  1ETY A;  3T1B A;  1FIP A;  1K83 J;  2R5Z B;  3BTC A;  3LAP A;  3S3N A;  4LK1 F;  3CC7 I;  3BZ6 A;  1IDY A;  1KON A;  1XGN A;  2BY3 A;  2VE9 A;  2FA5 A;  2OU2 A;  2RNG A;  3Q5F A;  4D0P A;  5K5R A;  1I39 A;  2RVC A;  4KMF A;  1YI2 I;  1N75 A;  5DS9 A;  2VJ4 A;  4G7O F;  2MGQ A;  4CUG A;  4B44 A;  3AKZ A;  1X3Z B;  3BR6 A;  2HVR A;  1HF0 A;  1N78 A;  5J6X A;  2NNN A;  3B02 A;  1YRN A;  2XDV A;  2DTZ A;  2OJE D;  4A0Y A;  1YJ9 I;  3HZJ A;  5L3G A;  4HDU A;  1UST A;  4A5N A;  1REP C;  1DP7 P;  1DQU A;  3R4K A;  3KP3 A;  1WJA A;  4CIC A;  3WE2 A;  4AC0 A;  1JKP C;  2A6H F;  2FNP A;  3HPH A;  4CHU A;  4KA4 A;  1R5G A;  3LSI A;  5TGT A;  5A2Q K;  1SAX A;  3ZP5 A;  4A3C J;  3WTV C;  1XMX A;  1XPX A;  4KIS A;  4M73 A;  1WH5 A;  2P7V B;  5D4S A;  1IUF A;  2HWV A;  1FOW A;  2V4J C;  4MFE A;  2HXO A;  5L3C A;  3NWT A;  4W1U A;  3FXU A;  4DNC A;  4UUS B;  2XAH A;  1WJD A;  1YLF A;  3MZ8 A;  2XVC A;  2RC4 A;  4KIT B;  4UB6 C;  5EDN A;  3GFI A;  5IOY A;  1BJZ A;  4YFX F;  3A01 A;  3HYI A;  4G9Y A;  1KU9 A;  3ZQL A;  1USS A;  2F5F A;  2RN7 A;  2EIM H;  2EZI A;  5H20 A;  1ZEL A;  2GQQ A;  2VBY A;  3C1D A;  1ETO A;  4BAC A;  1AOY A;  5J40 A;  3CTA A;  4KDP A;  3MEX A;  3DF8 A;  1FBS A;  1X1D A;  1MMD A;  3BWG A;  2ISZ A;  2TDX A;  4LMY A;  2R7D A;  2ZXI A;  3RKQ A;  1P92 A;  4HLY A;  2M7A A;  3WTW C;  3GTL J;  2WBM A;  1HOM A;  3HHG A;  4OIQ F;  2F5D A;  3NAU A;  2GA1 A;  2VC1 A;  1PUF B;  1J9I A;  4Y4R A;  1BN5 A;  3GZ6 A;  3LA7 A;  1TWF J;  2LH9 A;  4BY7 J;  1J75 A;  2L9N A;  1V55 H;  2DU9 A;  4HX7 A;  3GTK J;  1QBJ A;  4E6K G;  1UEL B;  4PZJ A;  2WAD A;  3HUG A;  3IAM 2;  2JJ7 A;  2MSY A;  2DQL A;  1RIO H;  2M8E A;  3S15 J;  4MTD A;  3BC8 A;  2GZW A;  2VKD A;  4GO1 A;  2KDZ A;  2VBZ A;  3ROU A;  3QQA A;  3FX3 A;  1OCC H;  4QLC U;  2VJ5 A;  4R79 A;  2PG4 A;  1GDT A;  4WWC A;  1T56 A;  3VSK A;  1HC8 A;  1BC7 C;  3RJP A;  5K5Q A;  3IC7 A;  5LGU A;  3U9G A;  1W7P D;  3EYI A;  4F3Q A;  1CQT A;  2D45 A;  2E5N A;  2VB6 A;  1LEB A;  1FTZ A;  2RQP A;  2Y2Z A;  2GXB A;  5ICG A;  1PJR A;  3JRG A;  3JRA A;  4G8X A;  3ZGK A;  3OYI A;  5CVV A;  2OC6 A;  3U1K A;  3KP2 A;  2KLO A;  3BOQ A;  4HW0 A;  4A93 J;  4P5O A;  2P6T A;  4XLF A;  4L9N A;  2BEO A;  1D5Y A;  2P5V A;  2DW4 A;  4FAS D;  4UB8 C;  4XKW A;  1B72 A;  2OCE A;  4L0Z B;  1ZG3 A;  1AA7 A;  5IP9 J;  1I27 A;  3GW2 A;  4LG0 A;  3E1S A;  2M87 A;  3DTE A;  5FKN A;  2WB1 N;  3HOS A;  2VOD A;  2Y48 A;  2P5L C;  2VOP A;  3HOW J;  2NOG A;  1K4T A;  2B7E A;  5L3B A;  1LDD A;  1YOV B;  3UKG A;  2WTE A;  5CJ9 A;  1GXQ A;  5JI6 A;  2HTJ A;  3NEU A;  2E1C A;  1QHG A;  1Z05 A;  2M5W A;  1K4S A;  3QAH A;  2V9V A;  2PJR B;  5IT9 K;  2YPR A;  5EYR A;  1POG A;  3HXL A;  1YHQ I;  3I4N J;  2KP6 A;  3TL4 X;  1OYY A;  1KA8 A;  3I3L A;  5IP7 J;  2X48 A;  4LLG F;  3CLQ A;  3J7A Y;  2ZJR F;  3QU3 A;  4O6J A;  2KIM A;  3RKW A;  5CKT A;  3OMY A;  3LQR A;  4PGG A;  2R93 J;  3PM1 A;  1X1B A;  2NYX A;  5F0H A;  4DYQ A;  4AD9 A;  2XGD A;  4GFB A;  1HKT A;  4XN3 A;  2BXZ A;  3HOY J;  2ZBK A;  2QBY B;  1MBH A;  1K78 A;  2IBD A;  3BG3 A;  3A0H C;  4RM2 A;  3LSJ A;  4HRI A;  4OMZ A;  4BAY A;  3MMY B;  2Z1D A;  3BG5 A;  3JSO A;  5M5X J;  1ZRF A;  3TOB A;  1MJB A;  1I6X A;  2JN6 A;  3UNG C;  1GT0 C;  4CCK A;  3U21 A;  1T0F C;  5CYV A;  2VT2 A;  3FM3 A;  4PJN A;  2O6G E;  1SVO A;  3DTK A;  2FUG 2;  1WQ2 A;  4M3G A;  4EV0 A;  2PX9 A;  3WTZ A;  1RKT A;  1TWC J;  2KIF A;  2W84 A;  1D5V A;  1W0T A;  2XAG A;  3BG6 A;  2O03 A;  2WWY A;  3I71 A;  1UAA A;  5IYC J;  1WWX A;  2H8W A;  2QM3 A;  1LKX A;  2OF7 A;  4OWR B;  3H0G J;  1TWH J;  9ANT A;  2QSF X;  1HSJ A;  4IRI A;  2ZJQ F;  3CQZ J;  4FHT A;  1YRN B;  1P6R A;  4ON0 A;  3M1C A;  1BA5 A;  3K1M A;  3PSF A;  5B5E C;  4U87 A;  4YII A;  1YIT I;  1JGG A;  4KNY A;  3E5Q A;  4HX8 A;  3I53 A;  4A6D A;  2QA4 I;  2IJL A;  2IS6 A;  3O8G A;  1MNM C;  4M9Z A;  2XAJ A;  1IC8 A;  4CCM A;  2PBI A;  3I58 A;  4EAT A;  4IHV A;  4EJT A;  2G9W A;  4BE1 A;  2R7O A;  4FT8 A;  1Z1D A;  4BHP A;  3U2R A;  5HDN A;  1WZ2 A;  3F8C A;  3C18 A;  1HBX G;  1I1G A;  5DUK A;  5TRD A;  3CCY A;  1IV8 A;  2A05 A;  3JRH A;  3O8H A;  1IN4 A;  2GAU A;  2IRF G;  3A01 B;  5FKO A;  1W5T A;  2DPD A;  3QYB A;  1KU3 A;  4RLF A;  2FJ1 A;  1FOY A;  1K61 A;  3GLL A;  2E2H J;  3TQN A;  4KIF A;  2QUF A;  2M34 A;  1IG7 A;  4IHW A;  3I55 I;  4G94 A;  3CP2 A;  5HS9 A;  3FM5 A;  2X6O A;  2VKV A;  5F04 A;  4BDY A;  3QP6 A;  5E20 A;  1IW7 F;  2R0Q C;  1MSE C;  5JLX A;  3O3K A;  1RET A;  1Z0X A;  5HLI A;  1H9G A;  1HA8 A;  3VDX A;  1OR7 A;  1T98 A;  4CSW A;  4IQ4 A;  1TT5 B;  2V6C A;  2RV8 A;  5EG0 A;  2IEK A;  3ERE D;  2KQR A;  5E1W A;  4G6D A;  2EV0 A;  2HOE A;  3I54 A;  1ZRD A;  1IRG A;  1KZH A;  1SFU A;  3S1N J;  5LHG A;  3HKZ A;  3F23 A;  2K40 A;  1R6R A;  2GXA A;  4RAF A;  1SFE A;  4OU0 A;  2W1O A;  2IA1 A;  3SHF A;  5IOZ A;  4XLP F;  3E5U A;  3QYE A;  1FNN A;  3FXR A;  2XF7 A;  2FQ3 A;  2DDB A;  4BY1 J;  4I02 A;  1SAN A;  2CQK A;  3HUG B;  2A5W A;  4HQE A;  1A6I A;  2R3S A;  2ZB9 A;  3GTJ J;  1LEA A;  1Y8Q B;  4JP0 A;  1LUJ B;  4F91 B;  3TP0 A;  1VQO I;  1LVA A;  4GCV A;  4HST A;  3ISP A;  4RB0 A;  1ITY A;  2LBF A;  2JK3 A;  3RKY A;  5ICE A;  2QWW A;  3M07 A;  2R5Y A;  1SD5 A;  2O61 A;  2DAO A;  2DFH A;  2VQL A;  1F43 A;  2JPC A;  2CW8 A;  3UR3 C;  4C2T A;  4O3M A;  4FE4 A;  4A3L J;  2WA0 A;  1Y0U A;  3OIQ A;  5HNF A;  4EQQ A;  2NVX J;  1WHU A;  2OA4 A;  4U0V A;  2LDU A;  2Z3Y A;  4M9S A;  3EUH C;  3EUK L;  3LFU A;  1WI9 A;  2LK2 A;  2PEX A;  3VOD A;  1YG2 A;  3GXO A;  2XB0 X;  3HBL A;  2CUE A;  2DOD A;  2BW3 A;  4ABZ A;  1I1S A;  3ULQ B;  4CZZ A;  5F64 A;  3AG1 H;  1B72 B;  5KCM A;  3J7A O;  2JPB A;  4NNJ A;  3LMM A;  4PDK A;  2EFP A;  1SFX A;  2CJJ A;  2BVM A;  4M3F A;  4LG0 B;  5FLX Z;  1A35 A;  2UV1 A;  4NB5 A;  3TW7 A;  3F22 A;  4A3E J;  4RLQ A;  5GAG J;  4EEF G;  3NQO A;  4UHT A;  2CWE A;  2EZL A;  1IN6 A;  3WG7 H;  2XUB A;  2M2E A;  5EJC A;  1O3R A;  2QVO A;  3PIP F;  3F21 A;  1WPK A;  4BEH A;  4ZYD A;  5M3F J;  1GV5 A;  1YIO A;  3CC4 I;  3WTY C;  2CRG A;  5J4V A;  5H2F C;  1ZR4 A;  4HNT A;  1MSF C;  2R7F A;  1R00 A;  2DQR A;  1ZHF A;  2VXZ A;  1ZGW A;  4EGY A;  2F4I A;  2EFW A;  3FK6 A;  3C2B A;  3JRI A;  2A3S A;  2JUG A;  3HKZ N;  3QOP A;  4OIN F;  5E3O A;  1NHA A;  5HVQ C;  4CH7 A;  3OYE A;  5F6F A;  1IZ1 A;  4PJJ A;  4P96 A;  1EH6 A;  2O5R A;  1FX7 A;  2QZ8 A;  1MBG A;  2GOX B;  4I0B A;  1HW1 A;  2O8K A;  2TRT A;  3I56 I;  1WVR A;  2F4O B;  2A69 F;  3ZMT A;  2FNA A;  1SVM A;  2V7F A;  2XPV A;  5CVI A;  1D8J A;  3KZY A;  2ZME A;  2M0M A;  2O9L A;  3GF2 A;  5E3N A;  1Y1V J;  3RQ4 A;  4KIB A;  1K78 B;  4HV5 A;  1O3Q A;  1ZK8 A;  4MTE A;  1OMI A;  3J80 Z;  3BDD A;  1RRJ A;  2QEN A;  2K9N A;  4LJZ F;  2DK8 A;  1F5T A;  4QSH A;  4WCG A;  2KFD A;  4XOT A;  4I7H A;  1E17 A;  1G6N A;  4DYC A;  1HW5 A;  1X1A A;  2AXT C;  4OIP F;  4LK0 F;  1L3L A;  3R0A A;  4DBR A;  2FBK A;  1YW7 A;  3A0B C;  2O8X A;  2OTL I;  1V5G A;  2JZY A;  2R7X A;  2ZXJ A;  3ZQQ A;  1IRF A;  2Z33 A;  3K4L A;  4BL0 B;  2X6X A;  2RDP A;  3E6M A;  1EV7 A;  2IS2 A;  2XGX A;  3I4P A;  4XBF A;  1U78 A;  4LGW A;  3RI4 A;  3CO6 C;  1Z67 A;  1MBJ A;  5F1R A;  1T2K A;  3VWB A;  4IJA A;  2VLA A;  1V5E A;  4AWX B;  4B3X A;  3BQY A;  2CU7 A;  2GLO A;  3QRF F;  1S9H A;  2H1L A;  3G1M A;  4W97 A;  3N4M A;  5KK1 A;  4JOM A;  3ZR8 X;  3HDD A;  2BOL A;  3O6B B;  1RPW A;  1AWC A;  1G59 A;  5E1Z B;  4LIU A;  2MYS A;  1ONV A;  1FWZ A;  3I59 A;  4IHT A;  3HRM A;  2KJB A;  2A5Y B;  2F48 A;  1U5T C;  3LL7 A;  4WXD A;  4I6Z A;  3ABK H;  2L9S A;  3NRV A;  2DPU A;  3BG7 A;  5D6E A;  3ML6 A;  1RR8 C;  1DPR A;  2VAS A;  4ESB A;  4XLN F;  2MLG A;  3G73 A;  3KE2 A;  1XD7 A;  2MA3 A;  1MMN A;  2HU9 A;  3BR3 A;  2LMD A;  3QPS A;  1FPQ A;  1MZB A;  1JJ6 C;  1R9T J;  1MIJ A;  3MQ0 A;  4M72 A;  2LF8 A;  4LFU A;  4MQV A;  4LLL A;  4A3G J;  5CVU A;  3KYL A;  3H0D A;  3FBN B;  4XIC A;  4IO9 F;  2RKH A;  2V1X A;  5DDG A;  1VZ0 A;  3JRF A;  4M3B A;  3CMA I;  3TMO A;  1B1B A;  1L0O C;  1TNS A;  1UG0 A;  4XLH A;  1R7J A;  3TO9 A;  1OCP A;  1R58 A;  4ASN A;  2DOF A;  3QOE A;  5ILU A;  2DOA A;  4A3B J;  2VBW A;  3KP7 A;  1XMA A;  2MFZ A;  2XAU A;  5EG0 B;  3K4C A;  3MKY B;  4PCQ A;  5ICF A;  1DGW Y;  5CVJ A;  3OYN A;  4LOC A;  2Y9Z A;  4XKB A;  3F8N A;  1VQP I;  1P4X A;  2RQQ A;  1XN7 A;  3S2D J;  1HQC A;  2L3D A;  3COA C;  3HM5 A;  3AL0 B;  1YQA A;  1RKW A;  1E3P A;  1Y56 A;  4S0H B;  2DO7 A;  2FE3 A;  1RUO A;  1X3W B;  1UHW A;  4II2 A;  2ZC2 A;  3R60 A;  3L2U A;  4PJL A;  1G3Y A;  1P7J A;  2Y9Y A;  3RPU A;  3QP5 A;  2JA2 A;  3ZMD A;  4EVI A;  2LBF B;  3ZQF A;  1SFK A;  2W25 A;  1IN7 A;  2R7S A;  2L4A A;  3QOD A;  1IRX A;  2EBI A;  2GM4 A;  3ESW B;  2R5Y B;  4NUB A;  5F0F A;  4J01 A;  2F2E A;  2L01 A;  3R61 A;  3KEQ A;  1WI3 A;  1WH7 A;  1Z6R A;  2UXX A;  1OCT C;  2JRT A;  4U7D A;  2IGM A;  2KIS A;  1YJN I;  1VTN C;  2NOJ B;  3DLL F;  1R4N B;  2YS9 A;  5J8C A;  4RGS A;  2UXN A;  4FQG A;  1PUE E;  1W36 C;  5HDK A;  1U9O A;  4A12 A;  1QGP A;  5J8F A;  3CLO A;  1FP1 D;  2DA2 A;  4FE7 A;  1YFH A;  3MKL A;  2HKX A;  4YRV A;  2P81 A;  2BW3 B;  4PFO A;  1LNW A;  3GTG J;  2W57 A;  2XRL A;  3LWF A;  3CES A;  2W7N A;  1UCR A;  3KP4 A;  2E19 A;  3SYT A;  1EH8 A;  4PFP A;  3ZMS A;  2ZJ2 A;  4I0A A;  3RPQ A;  2Y0S A;  2BGC A;  2YX7 A;  4KN4 X;  3Q9V A;  1EF4 A;  4B09 A;  4E4H A;  2AXL A;  3WOD F;  1O4X A;  3V8J A;  3QU6 A;  4BEH B;  1QZZ A;  2UWM A;  2IS1 A;  4P55 A;  4IZZ A;  3K4K A;  2FML A;  2Q1Z B;  4RMN A;  4F55 A;  3F0C A;  1S72 I;  4M74 A;  1I3Q J;  1OJL A;  1TWA J;  3PUB A;  5CQE A;  5B66 C;  2WAF A;  1OYI A;  3WTT C;  2HGC A;  2LY9 A;  5LEK A;  3P9I A;  4OIO F;  3P7N A;  5E3L A;  3TW6 A;  4C2U A;  1MJ9 A;  4BH9 A;  2CV2 A;  1UHS A;  3HTS B;  1SMY F;  2KHM A;  3MVP A;  2K7L A;  2EZH A;  2LF7 A;  5LBQ A;  1HST A;  4UVC A;  2FRH A;  3LSK A;  3ZQ7 A;  5JHU A;  2GIV A;  3TP3 A;  2CV1 A;  3OYA A;  1X2N A;  1B6A A;  1IXC A;  1HKS A;  3K1P A;  3ZN1 A;  3M8J A;  4M3E A;  2ZME B;  3M3Y J;  1Y0N A;  4CYC A;  2DK5 A;  3ZXS A;  1SD4 A;  1X58 A;  4RM3 A;  1TNT A;  3D1N I;  1DU6 A;  3KX2 A;  2KT0 A;  3MD2 A;  2CQ7 A;  3CDL A;  4BJ5 C;  2XRO A;  2K4J A;  2DA3 A;  3JTG A;  1B4A A;  4GYI A;  5JVT A;  1D1B A;  2ID6 A;  3M8E A;  3V8L A;  3PO3 J;  3KLN A;  4MFD A;  4IF4 A;  4BXX J;  2EWN A;  3L2Q A;  2EIN H;  1ZAR A;  1DP3 A;  1SAU A;  3BZK A;  1ZLJ A;  2BBY A;  1T95 A;  3DBL B;  5ICC A;  3MCZ A;  3PSI A;  5LRS A;  3KPH A;  2DMQ A;  2JUC A;  1A04 A;  1BI1 A;  1WCM J;  1X4O A;  4YEJ A;  3MFK A;  5EGO A;  1MDM A;  4Q5S F;  1A5J A;  4DQ2 A;  2VJJ A;  3BR2 A;  3IL2 A;  2STT A;  4AID A;  3WHB A;  3WHC A;  3OYJ A;  3CCM I;  1ZG5 A;  1JKR C;  2R7R A;  4WXH A;  1OR7 C;  1XSV A;  5FGM A;  2JWT A;  3BLY A;  5E17 F;  3HC7 A;  4UV8 A;  4RA2 A;  3SXY A;  2E1N A;  3LQQ A;  2NXN B;  4I09 A;  2XHK A;  3W6K B;  4R8H A;  4WK8 F;  3KCC A;  2L54 A;  3OYH A;  3K1N A;  2LOO A;  1P4A A;  4RS8 A;  4JBA A;  1IDZ A;  2ZFW A;  4Y33 A;  1U8R A;  4RB2 C;  4XSX F;  1W5C C;  6PAX A;  2I5U A;  4M71 A;  3E7L A;  2ELH A;  2PMH A;  2HYG D;  2Y75 A;  4D7M A;  4S04 A;  4BUP A;  4V2F A;  1IV6 A;  1ZH5 A;  3C2H A;  3I59 B;  3WTS C;  5L3F A;  4KIC A;  2MD5 A;  3H5A A;  5HS7 A;  3J81 K;  2ISY A;  2VKH A;  1IJW C;  4ZTJ A;  4BDZ A;  2DOE A;  5DEQ A;  5K1Y A;  1KYW A;  4PUS A;  3HOU J;  3CMY A;  3QWL A;  4DGW B;  4B43 A;  4C30 A;  2MBF A;  1K79 A;  3F6V A;  2DTR A;  1W36 D;  1Z7U A;  2BYV E;  5IYB J;  2GIZ A;  3A4C A;  3HTU A;  1YJW I;  2IS4 A;  2RNJ A;  2B0L A;  2VQC A;  2ME6 A;  5LFA A;  3V4G A;  5GAD J;  2X0L A;  2DYS H;  5FRM A;  1R22 A;  4P1W A;  3LOC A;  2LD5 A;  5AIQ A;  3BR5 A;  3D5S C;  4N9H A;  3Q9S A;  2X4H A;  3CCU I;  1R4M B;  1JUP A;  3ABU A;  4XMY A;  5BS6 A;  5HLG A;  1X1P A;  2VN2 A;  2LC2 A;  4NBQ A;  3GTO J;  2XPW A;  3EYY A;  3GLX A;  4AIJ A;  2E34 A;  2ZNZ A;  4HZF A;  2W82 A;  2LP0 A;  5B1B H;  4PSW A;  1QRY A;  3KIO A;  3S93 A;  1Y6I A;  2E36 A;  4HNV A;  1H88 C;  4JX4 A;  2V1D A;  4L0Y B;  5FRN A;  4C3I J;  2VE8 A;  3G71 I;  2BZT A;  3CCE I;  1TBX A;  3VB2 A;  2K02 A;  3GTP J;  3JAM Z;  1JHF A;  4B3A A;  4XNF A;  2HYF A;  3W3C A;  2V1N A;  2K5C A;  2Y31 A;  3ZCO A;  3S1R J;  3BTI A;  2DYR H;  2X51 A;  1ZTR A;  1TP4 A;  3FDY A;  2JVG A;  2JA6 J;  2BXY A;  4Z6Y A;  2OD5 A;  4G7H F;  2HOS A;  4HPQ A;  3L9F A;  4XR6 A;  4DJA A;  3RSN A;  4TV7 A;  2VT3 A;  2MLK A;  1IRZ A;  2NVQ J;  4RBO A;  3HSF A;  1BR2 A;  2V1U A;  3DLA A;  4C2M J;  3OSG A;  4IQJ A;  1SC7 A;  4IVN A;  2EK5 A;  4MQ9 F;  4EM1 A;  4B8X A;  4MHG A;  1MBF A;  3DXJ F;  3V7C A;  4HEA 2;  2E71 A;  3LAJ A;  4L5J A;  2M45 A;  3IRQ A;  5GP9 A;  2FOW A;  3AG4 H;  3S17 J;  3HOT A;  3AG3 H;  1T39 A;  2M4G A;  2DI3 A;  2EV6 A;  2NS8 A;  1T08 B;  4CO8 A;  1FP2 A;  4I01 A;  4ZDO A;  3JW4 A;  3BZC A;  3VYT B;  3K0L A;  1STZ A;  3KLO A;  1D0Z A;  2IA2 A;  4F52 A;  4XL9 A;  1FMV A;  4Z2Y A;  4HX4 A;  1YS7 A;  2ZNY A;  1W0U A;  2XAS A;  3LFK A;  4I76 A;  2ZXW H;  2H1K A;  5ERI A;  2CYY A;  3DEW A;  5KNL A;  1R23 A;  3M8F A;  4ITV A;  1DU0 A;  1GLN A;  1PP8 F;  1O3T A;  2DA6 A;  3A03 A;  1JTY A;  1YX5 A;  2DA7 A;  1NK3 P;  1ETK A;  2FX0 A;  1Z21 A;  2F5E A;  3P9C A;  3K6G A;  2F4M B;  2IGN A;  3L09 A;  2A07 F;  3FF5 A;  3JRE A;  1J2X A;  2BY1 A;  5GTI C;  1ZLK A;  4G6T B;  5AIP A;  4ENN A;  3LNQ A;  2GWR A;  5FFX A;  3OYC A;  2OAZ A;  1JTX A;  3VFZ A;  4HV6 A;  1HDP A;  1ZAO A;  2FMY A;  5FD5 A;  2V9P A;  3ZMU A;  1BR4 A;  4DZP A;  5EF6 A;  1YYV A;  1OLT A;  5K7H A;  2DJI A;  4BQQ A;  3ZMZ A;  3HHH A;  2HZD A;  5IYD J;  1VQ7 I;  5LGN A;  4GDF A;  2ZSH B;  2DMT A;  3E0J B;  4E7H A;  2NAZ A;  2UZK A;  4ESJ A;  1W5S A;  3PIO F;  4H4K C;  2HVQ A;  3BTL A;  1WJC A;  1VFC A;  1TL8 A;  1Y39 A;  1T8I A;  5J47 A;  4EJU A;  3OWT A;  4S05 A;  1WFX A;  4CYC B;  4E7J A;  1MD0 A;  3N97 A;  1HKQ A;  2R92 J;  2EIL H;  3RKX A;  2DJN A;  2EA4 A;  2F6C A;  3KEO A;  4HF1 A;  4ZZL A;  3TOA A;  1B9N A;  2XC7 A;  4B4C A;  2K85 A;  4BJ6 C;  3L2R A;  1ZQ3 P;  4BHC A;  1GVJ A;  3FBI B;  2ME0 A;  3E6C C;  2PMZ A;  3S3O A;  2K4B A;  2LY1 A;  3CJR B;  2VJI A;  4XLA A;  1BM9 A;  1OQY A;  2VQG A;  1D1C A;  3AAF A;  3VYS B;  3V7R A;  1MDM B;  5EGO B;  2STW A;  2GA2 A;  2H6B A;  2EV5 A;  4RAY A;  2Y0M A;  2PQ8 A;  4QPO A;  2MH2 A;  4E7K A;  2DLL A;  4IL6 C;  2B9S A;  5JLW A;  1UG2 A;  1BIB A;  2AQE A;  3ZQH A;  1S7A A;  2ZFU A;  4MGR A;  3GTQ J;  2HOA A;  4AU7 A;  3DPT A;  3CMM A;  3I64 A;  3ZMV A;  5J4Y A;  1FYM A;  5IPA A;  2CW0 F;  2XKO A;  3GCM A;  4DZJ A;  1XGS A;  3OR2 C;  4LIT A;  2K86 A;  4J19 A;  4N4N B;  5J1R A;  3IWZ A;  3CUO A;  1VQM I;  1YS6 A;  1S7O A;  4F92 B;  2DFE A;  5DCM A;  4XRS A;  3G1O A;  1FOX A;  4MO7 A;  2C6Y A;  4OAY A;  1LB2 A;  1S8N A;  1ZRE A;  3HEF A;  4M3D A;  2IVM A;  2QQ8 A;  4D9J A;  5FKM A;  3FXJ A;  1FYK A;  2LFB A;  1BI3 A;  2CFX A;  4RGU A;  3ASN H;  4Y15 A;  5E8G A;  1ORK A;  5BPI A;  2FU4 A;  2HR3 A;  3IP4 B;  2EZK A;  1E0E A;  1JI8 A;  3FHZ A;  1QPI A;  1UZC A;  4G7Z F;  3Q0U A;  5A2Q Z;  1KQ9 A;  3BTJ A;  1N25 A;  3OYL A;  3CO7 C;  3B73 A;  1RUN A;  3K4J A;  1OCO H;  3K4B A;  1KU7 A;  2XGE A;  1QZY A;  4NC6 A;  4XN0 A;  2CGP A;  1LJ9 A;  5D5V B;  3S3M A;  1J09 A;  1UB9 A;  3H9J A;  3GYH X;  3IV5 A;  1H89 C;  2JVH A;  1NG7 A;  2ZSI B;  2CO5 A;  2K3F A;  2WAQ A;  3BJO A;  2V6E A;  5DYM A;  2KIQ A;  4XLC A;  3IRR A;  3BRO A;  1LFU P;  5ED4 A;  3EET A;  3CCQ I;  2KRH A;  4IX7 A;  1Q1H A;  3KP5 A;  2K9S A;  4LLN A;  1P2F A;  2XIG A;  3PQK A;  1Z7L A;  1TZL A;  3DEU A;  1F36 A;  3U1D A;  5HS8 A;  2GOM A;  4Y3O A;  5CLS A;  5EEG A;  2OQR A;  2FBI A;  3H3U A;  5HNH A;  3ERM A;  3E5X A;  3IHU A;  1VF9 A;  3M1E A;  4JX6 A;  3L00 A;  2LNB A;  2LY2 A;  4HSR A;  4OIR F;  4AIK A;  3GWZ A;  3H9Q A;  5HDG A;  2R7Q A;  3QYF A;  4UUT A;  3RIR A;  2VOO A;  1O57 A;  1S3J A;  2LYC A;  1GUU A;  3M4O J;  2D1V A;  3ASO H;  2HQ5 A;  2N8G A;  3DTI A;  3L7W A;  3OL3 A;  4X1E A;  5AON A;  2QSG X;  2WY7 Q;  4IPA A;  3VSL A;  2KRF A;  2VKE A;  2YUS A;  4IOA F;  3DKW A;  3L1P A;  5BPD A;  2E1M B;  3TDU C;  3IKV A;  3A02 A;  3CCS I;  1GVD A;  4EM2 A;  4EJW A;  4HDV A;  2DA4 A;  2FQ4 A;  1IO2 A;  2KKO A;  1FZP B;  3K2A A;  3OOP A;  1UMQ A;  2ECC A;  1ETX A;  1JGS A;  5DD4 A;  1Z9C A;  4CGZ A;  5KAF C;  2VBX A;  2M8G X;  2W4S A;  2H09 A;  1O7L A;  4PK4 A;  3IAS 2;  4YFN F;  4AVP A;  1V4R A;  5E1X A;  3FIS A;  4EGZ A;  3WGG A;  4A3M J;  4NC8 A;  3JRD A;  4ZH4 F;  4A0X A;  2ICW G;  1OYW A;  2E1O A;  4NDL A;  2IXS A;  2V9K A;  3WTU C;  1VQ4 I;  3DWL E;  4GGG A;  1JUM A;  3ZQI A;  2KRC A;  3OYM A;  1KYZ A;  3I4M J;  5D6F A;  2BHZ A;  2Q2E A;  2V79 A;  2E2J J;  3OYB A;  1MW7 A;  1MKM A;  3KZI C;  1F1Z A;  5KAI C;  3HPG A;  1J0R A;  2WAQ N;  2W85 A;  2V26 A;  3HSR A;  3K7A J;  2DCE A;  4IEJ A;  4ESF A;  2H27 A;  1ZGA A;  2FOK A;  3E6D A;  4FCY A;  3RPU D;  5GPC A;  5F1J A;  5LRR A;  3FMS A;  3VEP A;  1GXP A;  2NS0 A;  2X1C A;  3RQI A;  5LEJ A;  1BOA A;  3VOE A;  3LSP A;  3W2W A;  2QEX I;  1OIS A;  4IXA A;  5FRO A;  5IT9 Z;  2LR8 A;  3WU0 A;  3EQL F;  2L0K A;  4KN7 X;  5LGT A;  1FTT A;  1JUS A;  3ECH A;  4A5M A;  1BR1 A;  2OV7 A;  1MMA A;  1X3U A;  2CS3 A;  4UNO A;  2BVL A;  3HRT A;  3AFH A;  1FBU A;  4D1Q A;  1JKQ C;  4Q47 A;  1G3T A;  2O0Y A;  3DP7 A;  1APL C;  1SD7 A;  3QPL A;  2OBP A;  1MJA A;  3Q0W A;  1GHC A;  2O3F A;  2BV6 A;  2L7K A;  4BU2 A;  5L3E A;  4M6X A;  3WGI A;  4IRH A;  2I8D A;  2WC2 A;  3PQJ A;  3IH4 A;  4CYD A;  3PL8 A;  3OY9 A;  3DU5 A;  4IHS A;  4AYB A;  2CUJ A;  5LHH A;  5HLH A;  4IHY A;  2OTJ I;  1UFM A;  3DQV C;  2HQA A;  3E97 A;  4H0E A;  2YU9 J;  2JTV A;  4ZTF A;  4IRG A;  1E2X A;  1TTY A;  2KZG A;  4B1R A;  1SFO J;  4U88 A;  1ETW A;  4A3I J;  3I9V 2;  1TC3 C;  4RAG A;  1I3A A;  1ULY A;  2L9R A;  3K70 D;  2ADU A;  2RGV A;  4FTH A;  1DGR M;  4AIH A;  4UV9 A;  2MC4 A;  3I0T A;  3GFL A;  4HAM A;  2KMU A;  5FO5 A;  2L7M P;  2BE5 F;  4QWQ A;  2WV0 A;  5E8I A;  1E3H A;  4L18 B;  1ZG1 A;  3RYR A;  5DCM B;  3FK7 A;  3GO5 A;  5C4J J;  1IGN A;  2D5V A;  2OUM A;  4MEY F;  1G8X A;  1JKO C;  2E60 A;  2EFQ A;  4E7I A;  1ZGJ A;  1RZ4 A;  3HB9 A;  5BNG A;  2ECB A;  4ZYA A;  5B3S H;  1BC8 C;  1AKH A;  2R7Z J;  3A2K A;  1XMK A;  2KZV A;  3LSH A;  3CCL I;  1RES A;  3X2Q H;  5C3E J;  2VIX A;  1VQ8 I;  4CCO A;  2H94 A;  2MC3 A;  1G2H A;  3IWF A;  3CJQ B;  1K6O A;  3HGG A;  1FT9 A;  1MH4 A;  4BBS J;  1VQK I;  1S7E A;  2VXD A;  4BKX A;  3DBR B;  2OQG A;  3L2W A;  1T38 A;  4KJZ A;  1LVK A;  2ZKZ A;  1Y1W J;  2Y30 A;  1TWG J;  2HDW A;  1H8A C;  1G4D A;  1KQ0 A;  5E79 C;  3KZZ A;  4KT5 C;  5JVG F;  2NVT J;  3OV8 A;  4V2G A;  4OOI A;  1X2M A;  1TT0 A;  4PGH A;  3OYK A;  2UUZ A;  1FMW A;  3GME A;  3IH3 A;  3KYD B;  1EJ9 A;  5C4X J;  4I99 C;  1D1A A;  2L5Q A;  2DN0 A;  3R6S A;  4XQF A;  4AYB N;  1FYL A;  1PVE A;  3QPH A;  3VYR B;  2A6T A;  5LD2 C;  5J3L A;  5J1U A;  3F72 A;  4F93 B;  2HKO A;  2FXA A;  1J59 A;  1XSD A;  1YE9 A;  3LA3 A;  5F0C A;  1IF1 A;  3G2B A;  1XX5 A;  3RDI A;  2XB5 A;  2NVY J;  3DPL C;  2HVS A;  4II3 A;  3D5L A;  3FIW A;  3PFI A;  3SFZ A;  2MAB A;  2RAE A;  2M30 A;  1WSU A;  1P7I A;  2NNY A;  1BIA A;  2R7V A;  2BY0 A;  4UVA A;  3WE3 A;  1NTC A;  2ZCW A;  4P9F A;  2ELJ A;  4EJV A;  1TLH B;  5D5W B;  2F5C A;  3WU2 C;  2X9D A;  2VC0 A;  2K9M A;  4XRS G;  3DFG A;  2LSO A;  3T5X A;  4I2O A;  1MBK A;  3MWM A;  2ZO4 A;  1H0M A;  3P5J A;  1WRJ A;  5GAE J;  3RYP A;  2JSP A;  2DDA A;  4ZYH A;  3DBH B;  5D8L B;  3TBI A;  3D0S A;  1XCV A;  2EQR A;  2PMU A;  1JE8 A;  2X1D A;  3G4S I;  4CXF A;  1A36 A;  2Y69 H;  3BPX A;  3G6E I;  1YX3 A;  4XRF A;  2AO9 A;  3S32 A;  4QTR A;  1AU7 A;  1P4W A;  1WJB A;  2E5Z A;  1ERD A;  2JA7 J;  5M3M J;  4LB6 B;  2CH0 A;  3H5R A;  5CPR B;  4CCN A;  1NK2 P;  2PFB A;  2Q2E B;  1B9M A;  3IH2 A;  3OOU A;  3HSE A;  2D2W A;  4Y17 A;  4BQO A;  4L9T A;  1YIJ I;  2TCT A;  1A6Q A;  2EIJ H;  2HI3 A;  2PLY A;  2BHY A;  2D1H A;  3MKZ A;  2BY2 A;  1K7A A;  2W24 A;  3HIF A;  1CF7 A;  5ILV A;  2COM A;  5TJJ A;  4F7Z A;  3FXO A;  3FWE A;  4BE0 A;  2Y0S N;  1V54 H;  5FLX K;  3FMR A;  2J5P A;  3GX4 X;  5DD8 A;  5GTH C;  1W1W E;  3AL0 C;  2WB1 A;  1XC5 A;  2L2O A;  3DKX A;  4BXF A;  4JYK A;  1I6H J;  4V19 K;  3RTR A;  1XG1 A;  3OIP A;  1QZE A;  3H1C A;  1D8K A;  4FIS A;  3JRC A;  4WXC A;  2OZ6 A;  1IN5 A;  2YSR A;  5KHD A;  4RDU A;  3CF5 F;  2B63 J;  4BNC A;  1ON2 A;  1H9T A;  4HF2 A;  2JA8 J;  4A3D J;  3BCA A;  2P6S A;  4BE2 A;  1JHH A;  4JX5 A;  1PP7 U;  2VUM J;  3BR1 A;  4E70 A;  1ODD A;  3LSG A;  1DUX C;  2LVS A;  4PJM A;  3SZG A;  1ACI A;  4K2E A;  3LSR A;  4LIV A;  4D5F A;  5EZH A;  2EFO A;  2DT6 A;  3JSP A;  5FFZ A;  1B59 A;  3OL4 A;  3GFJ A;  4XON A;  3K9T A;  1VQN I;  3DEE A;  4X0G A;  1BL0 A;  1RR7 A;  1U5T A;  3IUO A;  3LSM A;  4KIG A;  2GXG A;  3C3W A;  4C9Y A;  1G3S A;  4L5I A;  3J80 K;  1MGT A;  1MND A;  3M7G A;  5GPA A;  4L5E A;  4U0Y A;  3ZOB A;  4XKV A;  3V8K A;  3S2H J;  3FXL A;  1Z91 A;  4AUX A;  2EFN A;  3F9K A;  1O7F A;  3Q0V A;  4OAZ A;  3OYD A;  4A69 C;  1XGM A;  1M1E B;  3KEY A;  2QYO A;  3ECO A;  1IXS B;  3L2C A;  2QGU A;  1GV2 A;  1I5Z A;  5H6Q A;  1V3F A;  5D5U B;  3V7S A;  2CUZ A;  2R4G A;  2DBB A;  2CV0 A;  2QQB A;  4AVZ A;  2ETH A;  2DMU A;  5EZG A;  1ZKG A;  3PNY A;  2CSO A;  1MNE A;  4XRM A;  2FBH A;  2G7H A;  3SZT A;  4JQF A;  1MMG A;  4YIF A;  4FET A;  4LD5 A;  3TO6 A;  2WY8 Q;  5F27 A;  1X1C A;  2W48 A;  2M3A A;  1HLV A;  2M1B A;  2NRA C;  5FLV A;  3BPV A;  2H8R A;  3FKJ A;  5K7F A;  3T8T A;  2LG4 A;  2P5K A;  2R7U A;  1UHM A;  3H92 A;  3HJE A;  1S29 A;  4HYE A;  4CZC A;  1AKH B;  1BI2 A;  1VI0 A;  2OZU A;  3H36 A;  2ZME C;  2M4K A;  4UY8 I;  1RNL A;  2E7W A;  1MBE A;  2Q0O A;  4BYY A;  2ESH A;  3JTH A;  3K69 A;  5JR3 A;  3IKT A;  4CA0 A;  2HS5 A;  1BOB A;  1Z3X A;  4HLX A;  4E7L A;  4Y13 A;  1FIA A;  2HXI A;  2Z16 A;  4NC7 A;  1N77 A;  4KYW A;  4M6Y A;  4HF0 A;  3SDB A;  2XGC A;  3CZ6 A;  5D4R A;  1XGO A;  3BR0 A;  2VL8 A;  2LKX A;  3OIO A;  2HFH A;  4ENK A;  1Z77 A;  3DPU A;  3MZY A;  2K27 A;  1OPC A;  4ZZD A;  1R71 A;  2Z2S B;  2P7C B;  5BMZ A;  1FSE A;  3RZD J;  3CUQ A;  3K2Z A;  3BT9 A;  4CCJ A;  2HZT A;  4ZC3 A;  2ACJ A;  1WKM A;  3HOZ J;  3EDP A;  4HG2 A;  4DOZ A;  5E18 F;  4A0Z A;  1YO5 C;  1KGS A;  1IXR C;  3FXM A;  2QQA A;  3SDG A;  5M5Y J;  3B6C A;  4L9V A;  1W7P A;  3F8F A;  2HPM A;  1R5I D;  2FEZ A;  2OPT A;  2KIU A;  2X6Y A;  1V5F A;  3OR1 C;  2IT0 A;  4LB5 A;  4KUM A;  2XAQ A;  2YR2 A;  1XB4 A;  2IGO A;  3R0J A;  3CME I;  5D5X B;  3HG9 A;  2IA0 A;  4OMY A;  2ZJP F;  1LFP A;  3CJN A;  1VQ9 I;  2H6C A;  3OS2 A;  2HPI A;  4QPQ A;  1YW9 A;  2QKL B;  1K6Y A;  3F6O A;  3Q3S A;  1QO0 D;  4N0B A;  3JR9 A;  1U9N A;  1U3E M;  3JRB A;  1LQ1 A;  3NAR A;  2X1E A;  2XV4 S;  4BGD A;  1VQ5 I;  3ABT A;  3F3X A;  5DM7 F;  2QLZ A;  3G3Z A;  4JK1 X;  2Z5U A;  2EA2 A;  1XDU A;  1EA3 A;  2HYJ A;  4KFC A;  1KQ8 A;  3H35 A;  5LHI A;  4XOR A;  3F8M A;  1FOK A;  4Y52 J;  1IUY A;  4MIM A;  3LA2 A;  3PNV A;  4IKF A;  2XPU A;  3S14 J;  2XKP A;  2KL4 A;  4PJ0 C;  4UXN A;  4XSZ F;  3T0Y A;  3FZV A;  4G12 A;  5ILS A;  3RZO J;  1R49 A;  2EH3 A;  3SJM A;  3S2W A;  2Q8K A;  1LE8 A;  2HDD A;  3WGH A;  1LDK B;  3D5R C;  5EEA A;  2ID3 A;  4YG2 F;  3HOV J;  1JT0 A;  3WG9 A;  1ENH A;  5JFR A;  3PO2 J;  2YU3 A;  4EM0 B;  1VND A;  5FB2 A;  4AM3 A;  1CF7 B;  1ETV A;  1BW5 A;  4XLE A;  1FEX A;  1BJA A;  1FJL A;  2FF4 A;  1X19 A;  2DFI A;  3HL2 A;  2IGK A;  4YFK F;  5DM6 F;  1R1V A;  1EKE A;  5L3D A;  2QSH X;  3E3V A;  4N4O B;  2L7F P;  3CDI A;  4RGX A;  4MLO A;  5EEH A;  1SEU A;  1XTA A;  2XSJ C;  5FKK A;  3ZN0 A;  4EJO A;  2A61 A;  3CCR I;  3HOX J;  2QCO A;  2FD5 A;  1IN8 A;  4FX0 A;  1Q1V A;  4A2U A;  5FJ8 J;  1BBY A;  4ZJZ A;  1I50 J;  2L02 A;  3MZH A;  2X85 A;  3FMQ A;  4M6V A;  1WJE A;  4YEL A;  4BBR J;  1VQL I;  2FSW A;  3CP8 A;  3FXK A;  3KFW X;  2F5V A;  4NQW A;  5HLT A;  4L9J A;  2PJP A;  1KU2 A;  1R5H A;  1D0X A;  2JMW A;  3ABL H;  4BQA A;  4NHJ A;  2Z99 A;  4B48 A;  1F4K A;  1U5T B;  3ZRG A;  3MKW B;  4A3F J;  3CF2 A;  2G7U A;  4G6Q A;  2DMP A;  2X6W A;  3TGN A;  1T6S A;  1XDS A;  2PMZ N;  1B8I A;  2HOT A;  2QQ9 A;  1QA6 A;  2J5O A;  1BI0 A;  1JXS A;  2HTS A;  2YX4 A;  1IAW A;  3WU1 B;  5B1A H;  5M5W J;  2RRE A;  4ZDL A;  3VYU B;  1QU3 A;  3K4N A;  4HBL A;  3C2G A;  1TW2 A;  3BP8 A;  3QPT A;  1XS9 A;  1EH7 A;  2KPM A;  3I5U A;  1J7K A;  2GBY A;  3N05 A;  2CFO A;  1QVT A;  4UUV A;  3M9A A;  3J7Z I;  4D5C A;  2L9V A;  3K70 C;  1PDN C;  1QVU A;  3BJA A;  4MEX F;  1G3W A;  3G1L A;  2VQH A;  1DPU A;  3OS1 A;  3CCJ I;  4EMS A;  4IOC F;  2VPR A;  3CCV I;  3RCO A;  3OYG A;  1R1T A;  2MD0 A;  2CQN A;  2R5Z A;  1CGP A;  2KDO A;  2W00 A;  5C44 J;  2QKM B;  3BJ6 A;  1JT6 A;  2XAF A;  2ZXH A;  3PUF A;  1OKR A;  1RC9 A;  4E7S A;  3H5N A;  3MAJ A;  3E6B A;  2P4W A;  3S8P A;  1DDN A;  2ESN A;  5FD6 A;  3J81 Z;  1SMT A;  3SZP A;  1XSX A;  3OYF A;  3J7Y J;  3SQN A;  2PI0 A;  4DIQ A;  4A3K J;  3H3V K;  2G0E A;  5F08 A;  1LDJ A;  2LTP A;  3H3Z A;  3SFI A;  4DYR A;  1R36 A;  4XOP A;  1TW3 A;  3BY6 A;  1RI7 A;  2EIK H;  3DU6 A;  3GUD A;  1D3Y A;  4GRI A;  1MH3 A;  3W6J B;  4GYG A;  2JSC A;  2XF5 A;  3CD6 I;  3EPZ A;  3FKI J;  2DFF A;  1QNT A;  2DA5 A;  3F8B A;  1W4M A;  3H9G A;  4M9X A;  5JHF A;  3GVA A;  3ONQ A;  4DBQ A;  5IY5 H;  3CUQ B;  3OSF A;  5FKL A;  2JQ7 A;  1FLI A;  4RGR A;  4B47 A;  2K9Q A;  4E7Z A;  2AS5 F;  2XF6 A;  1TQI A;  4XM3 A;  4RB3 C;  2MW8 A;  2CQQ A;  2DMN A;  3DV8 A;  4U7B A;  1BW6 A;  1TQP A;  4A3J J;  4DW6 A;  4ENM A;  1W7P B;  4O5V A;  4WF2 A;  1HDD C;  2VON A;  2JT1 A;  2CG4 A;  4UUS A;  3KYC B;  2E2I J;  4J00 A;  3B6A A;  3HGY A;  5BOX A;  2K9L A;  2A68 F;  3WTX C;  2I10 A;  1T0F A;  3JAM K;  1FSH A;  3W6V A;  1OCR H;  1ETQ A;  1WJF A;  3C7J A;  3CC2 I;  3OS0 A;  4RB1 A;  3SEQ A;  2R7W A;  1Y8R B;  1OCZ H;  2CMP A;  1HXD A;  1AHD P;  1S6L A;  1O3S A;  2EPF A;  3DCF A;  1R1U A;  2OCC H;  5DCF A;  5K7Z A;  1HW2 A;  2DT5 A;  3TDZ C;  2IPQ X;  4XID A;  5H6R A;  4YIR X;  1XCB A;  2MH9 A;  4A6E A;  4MNU A;  3S1M J;  1E3O C;  3BCB A;  3K4M A;  2ELK A;  1F9N A;  2LKP A;  3NWS A;  1PUF A;  3BG9 A;  1T33 A;  2P8T A;  3PFY A;  1Z3Y A;  1QPM A;  4Q4Z F;  4Q48 A;  2NS7 A;  4KT6 A;  3K10 A;  2L4M A;  3TKY A;  3S1Q J;  4BS9 A;  1TQM A;  1ZRC A;  3GBG A;  1ZYR F;  4X6A J;  4FX4 A;  1Z6T A;  2P0W A;  3GZ5 A;  1ON1 A;  3GTM J;  5KVR A;  1VQ6 I;  2AHQ A;  1LE8 B;  4I98 B;  1NH3 A;  3T8R A;  5J1Y A;  1C0W A;  3ZPL A;  3L2V A;  4ZYG A;  4WX9 A;  2CUF A;  4C3H J;  2WV1 A;  3PNT A;  2LRE A;  1SD6 A;  4LG3 A;  3ABM H;  4KMU X;  5HOO A;  4HA8 A; 
#chains in the Genus database with same CATH homology
 1OCR H;  2ZXW H;  2DYR H;  1OCO H;  1OCZ H;  2EIJ H;  3AG4 H;  3AG1 H;  3AG3 H;  5B3S H;  3ABK H;  2EIN H;  1OCC H;  2OCC H;  3AG2 H;  3X2Q H;  5B1B H;  1V54 H;  3ASN H;  5B1A H;  2EIK H;  3WG7 H;  2EIL H;  2Y69 H;  2EIM H;  2DYS H;  1V55 H;  3ABM H;  3ABL H;  5IY5 H;  3ASO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...