1OCOH

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 25
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1ocoH00
2DYSH 3ASNH 5B3SH 2EIKH 3X2QH 1V55H 3ABLH 2EILH 3ASOH 2EIMH 2EIJH 2DYRH 2ZXWH 2EINH 1OCCH 3ABMH 5B1AH 3AG2H 1V54H 1OCRH 1OCZH 2OCCH 3AG1H 2Y69H 3AG4H 5B1BH 1OCOH 5IY5H 3WG7H 3ABKH 3AG3H
chains in the Genus database with same CATH superfamily
2LFBA 2RNGA 3Q0UA 4ZDPA 2VJJA 2FUG2 3OYNA 2JA8J 3BZ6A 3OS1A 1YI2I 4XRFA 2HTSA 3E0JB 1P4AA 4IHVA 5IT9K 3HKZA 2EIJH 2FU4A 1HOMA 5F08A 5FKKA 5EGOA 4ITVA 4GO1A 1ZN2A 2LF8A 4MEYF 2V26A 4A3GJ 4WK8F 3ZQCA 4ZZDA 2F5DA 1X2NA 3ERMA 3W6JB 4A3JJ 1UMQA 3E5UA 2XV4S 3GCMA 4L9VA 2MW8A 5J47A 1A31A 3BQZA 5C44J 3CC4I 2K4BA 2VC0A 5IYDJ 4IOCF 4WXCA 3QRFF 1EH8A 3HHHA 3LSGA 3ZGKA 2VPLA 3QWLA 4U7DA 4DQ2A 4UVAA 5BPDA 1DP7P 1O3TA 5JHUA 4X6AJ 2MSYA 1BR2A 4AYBN 3BR3A 3ZCOA 3OS2A 1VQ8I 2DT7B 1JUSA 2W84A 1LPQA 1HCRA 3KLNA 2L2OA 3KFWX 2M3AA 4HEA2 4MQVA 5DCMB 1Y1VJ 4RAZA 4NHJA 1N78A 3I3LA 3VDXA 2KRFA 2EV6A 1VQ7I 1FP1D 1P4XA 2YUSA 3O6BB 3KEOA 4JYKA 4BQOA 5J1YA 4GYIA 5JR3A 3ZMSA 4C2UA 3CTAA 1FEXA 1JI8A 4Y33A 5KHDA 5IYCJ 4YELA 4D9JA 3ONQA 3J81K 1MW7A 3EYIA 3V8LA 4M3FA 4CA0A 4HDVA 4BE2A 4BBRJ 3FDYA 2VBZA 2R7SA 2NOJB 4AIJA 2E1CA 2XC7A 3J7YJ 2FJ1A 3KCCA 3W3CA 2GLOA 4A6EA 5H6RA 3UKGA 4CUGA 1KGSA 4D0PA 2D5VA 2QSHX 1R5ID 2CUZA 3K9TA 1OCOH 5DTDA 3S1RJ 2IEKA 2VJ4A 4M6YA 3SFIA 4OOIA 1IUFA 1KZHA 3RI4A 1B9NA 4LLLA 3WTTC 4E4HA 1YHQI 1XGOA 3NARA 2V79A 4BU2A 5HS9A 1GUUA 1U78A 1MMNA 2LKPA 4XKBA 3K70C 5M3FJ 4J00A 4BNCA 2NVTJ 2QENA 4DYQA 2V9VA 3GFLA 3JREA 4PDKA 1BW5A 3ZMDA 1DPRA 2EB7A 2EV0A 2K9MA 3VYUB 2ZKZA 2FNPA 3T5XA 5GTIC 4A3KJ 3REOA 5K5OA 5TISC 3HPHA 2Q2EB 2W1OA 4BE1A 5E1ZB 4XONA 1HQCA 2K7LA 3TP3A 1MNMC 4A3FJ 3PNVA 5E1XA 2JRTA 1KU3A 1MDMA 1FTTA 2DN0A 1ULYA 2H09A 1XSVA 5E8IA 2HOTA 2XDVA 4G94A 5CVIA 2DO7A 2X48A 1OCRH 2KPMA 2MA3A 3MEXA 4KN4X 1WI3A 3T8TA 2WV0A 2QCOA 4IHYA 3LA2A 3IC7A 1ZARA 4D7NA 2ISYA 1HSJA 1B8IA 3PIPF 2XVCA 4M3EA 3DEUA 2FMYA 2PG4A 3RSNA 1R49A 4ZC3A 2L7FP 1VQ5I 2IPQX 4EJOA 2DI3A 2EIMH 4D5CA 2IS2A 5ED4A 1IF1A 2BY0A 4BQQA 3KIOA 1YX3A 2V6EA 2O61A 3K0LA 2LY2A 2CYYA 2DMUA 4PSXA 3QQAA 4M3GA 4DYRA 3S16J 2OD5A 1FPQA 3OYLA 4G7OF 1SC7A 3GTKJ 1B6AA 2CQXA 1AHDP 1TQPA 3QPLA 2MG4A 2DU9A 1ORKA 3NQOA 2OZUA 3E5QA 3MQ0A 5B66C 2DA4A 1HBXG 2CQKA 3IH2A 3BPXA 3E97A 2DT6A 1A6IA 2W7NA 3VFZA 4Y13A 4AWXB 4E7KA 3RJPA 3L2UA 2DPDA 3JRAA 3P7NA 3A2KA 3WTUC 2W4SA 2E7XA 1MMSA 2LSOA 4IEJA 1T56A 2JSCA 3GTGJ 3CMYA 2B63J 3M3YJ 4M6XA 3RKYA 3C1DA 5F0CA 4M72A 5GAGJ 3OYHA 5AIQA 1W5SA 4GDFA 3V7CA 1O3RA 3TOBA 4GYGA 2EA2A 4A0YA 5HLHA 3SDBA 5M5WJ 3FWEA 3WODF 4XBFA 1UAAA 1ETKA 1ODDA 2R7WA 1SFOJ 1MBJA 2OCCH 4Y3OA 2WA0A 3ZMTA 5HODA 2N8GA 3VOEA 2O5RA 2JPBA 3MZHA 1NG6A 2ZFUA 4I99C 2R7UA 5CKTA 2ZXJA 1TQIA 1DGRM 2FF4A 4KISA 2RQPA 4D7MA 1AOYA 1R22A 1FMVA 1P92A 2KFDA 2JUCA 2IA2A 4L18B 2FXAA 1R1VA 1J0RA 5J1RA 1F5TA 3H36A 1V3FA 1T98A 5D5VB 1S7OA 3F6VA 1QZZA 2CMPA 1VFCA 4UNOA 1TWAJ 3K4BA 3ZMVA 5HDNA 3R61A 1W7PB 3EUAA 2M2EA 1VQOI 3LSIA 3CCQI 2R0QC 1NG7A 1IN7A 1TLHB 2P7VB 2B0LA 2DQRA 1B72B 1FOWA 4CXFA 2LBFA 1I1GA 2Y48A 3QOEA 3CESA 3IWZA 4EATA 1VZ0A 4HV5A 3Q5FA 1ZGWA 4CYCB 4L9TA 1SVOA 2XSJC 3W2WA 3GYHX 1ZG3A 1D0YA 1W36D 1EH6A 2KDZA 1YW8A 4ENMA 2X4HA 1ZRDA 5L3DA 5BNGA 3HOZJ 4YIIA 1UHSA 2D1VA 2W48A 5L3EA 4QIWN 2J5OA 1FMWA 1R5HA 4AIKA 4HLXA 3K10A 3JRBA 4BXFA 4E7SA 1ZR2A 1SMYF 3B73A 3FXQA 5CJ9A 5BPIA 2VJ5A 3HOSA 4ESBA 3HGYA 1P6RA 1MH3A 1FSHA 2V1DA 3HRMA 3D1NI 2MYSA 3F9KA 4UUSA 3IH4A 4A2UA 2LG4A 5BQTA 3HGGA 2L9SA 3SEZA 1N77A 3HYIA 1T33A 2JN6A 3L2VA 4U0YA 1R1TA 1ZR4A 2M1BA 3MZYA 1FJLA 2XAUA 2VOOA 3DEEA 3F3XA 1Z1DA 2FQ3A 5FKMA 3PQKA 1PJRA 2E34A 2IGMA 1P2FA 2GIZA 5H6QA 1ZRCA 2YPRA 3A4CA 2Y9ZA 2E7WA 3IRRA 4IXAA 4JX4A 3MKYB 2VC1A 2DOEA 2QF7A 2LR8A 1Z0XA 3EPZA 4CYDA 5EEHA 3MAJA 1BR1A 5HLIA 3O3KA 1WFXA 4MO7A 3KEQA 1FWZA 3MWMA 3Q9SA 4HZFA 1J5YA 2Z9OA 3GTOJ 3A0HC 4QWQA 1IJWC 1LFBA 4KMFA 2XKOA 4BGDA 4DIQA 3W6VA 1FYMA 4PGGA 1I50J 2PMZA 1T8IA 1BC8C 2XRNA 2P5LC 4LK1F 1SAUA 2CV0A 3OIQA 3E6CC 2K02A 2FE3A 5LHGA 3GZ6A 4AVPA 4LD5A 2WV1A 3OMYA 3E6BA 2CG4A 2XUBA 1B59A 4M6VA 1J09A 1OKRA 3PUFA 4XICA 5KK1A 3H5RA 3L1PA 2MH9A 4LB6B 1JHFA 3NEUA 3JAMK 4Y7NJ 3M8FA 2HQRA 5J1UA 1XSXA 2IGNA 4L5EA 2JQ7A 2E2JJ 1KYWA 3Q9VA 3HPGA 4PJMA 4AU7A 2NS7A 3FKJA 3OYIA 1JJ8C 2CUJA 2GZWA 1RC9A 4J01A 1YQAA 3HOUJ 4HNVA 1GVJA 1NK3P 4Y4RA 1IRZA 2XGDA 3AG1H 1QGPA 2UZKA 2GQQA 4S05A 3G4SI 1QZYA 2D2WA 1ACIA 1ZREA 1R6RA 1AA7A 4CH7A 4A6DA 2ID6A 2K3PA 2EK5A 4G9YA 1SFKA 2KZGA 2VE8A 3BROA 3IL2A 3RZOJ 4KMUX 2XGEA 1STZA 1LUJB 4KA4A 1OISA 2YX4A 2VKHA 1ZAOA 3GO5A 3G6EI 1FNNA 3FBIB 1WZ2A 2L02A 2L9NA 3DFGA 1JT0A 4PJNA 1XCBA 4KDPA 2Q2EA 1BR4A 5CVUA 4RGSA 5F0FA 3FXRA 2GXAA 2ZNZA 4J19A 2GM4A 2HKOA 2WAQN 1WJAA 1XB4A 4A0ZA 2IT0A 4A3DJ 2FMLA 1K4TA 4A69C 4OAYA 2DOAA 3Q3SA 2UWMA 3CUQA 3G71I 2FRHA 3H9JA 4M9ZA 4MHGA 2H6CA 3CCRI 1MZBA 3F8FA 2LLKA 3QPSA 2XPUA 1SANA 1FSEA 3OYBA 3BPVA 1VQPI 1BA5A 2QBYB 1FBUA 2BVMA 2FD5A 1RUNA 4MNUA 4B4CA 4M73A 1GLNA 3JSOA 1ON2A 2F6CA 4KIGA 3I0TA 4RMNA 2JVHA 2UXNA 3G3ZA 2BV6A 4FE4A 2BXZA 1FC3A 1RETA 4HX7A 4UB6C 5B3SH 4OIPF 3S2DJ 1BM9A 2L9RA 5TGTA 2ESNA 4BL0B 1FY7A 2TRTA 1D5YA 2QVOA 3KZIC 5E3LA 2YSRA 4BUPA 3ZQ7A 1FBQA 3DTEA 3DTIA 1QHGA 1RKWA 1RRJA 2XAJA 3HOTA 3TL4X 3TKYA 4DOZA 2M0MA 4FQGA 2EH3A 2V1XA 4BY7J 5GAEJ 1G6NA 2BW3B 3F23A 2DTZA 2CUEA 4EM2A 2IXSA 2X6OA 4KT6A 2DA3A 1TWHJ 3BP8A 4O5VA 2R7ZJ 2P6SA 3QP6A 3OYKA 1MNDA 2NNNA 2CGPA 3VYTB 2STWA 4DBRA 2IS1A 4FTHA 1TC3C 4MFDA 1YFHA 2CJJA 5LGTA 3PSFA 3OYDA 1E3OC 3COAC 5C3EJ 4RAYA 5LRSA 2ZJPF 3HOWJ 5ICCA 2X85A 1Z05A 5KNLA 2OF7A 4HX8A 2XPWA 4ENKA 3S14J 1KU9A 1N25A 5GPAA 2NRAC 1TBXA 4UVBA 1S7EA 1HW1A 4KIBA 2R5YB 3EUKL 3KP3A 2R7FA 3MFKA 4P9FA 1S72I 2H94A 1U3EM 4N9HA 2X51A 1W5TA 3C7JA 2VPRA 4LIUA 1RI7A 2OU2A 3I55I 5FFXA 3HUGB 4G8XA 2RQQA 4MIMA 3JTHA 2NVUB 5JVTA 2HEOA 5M5YJ 3AAFA 3GBGA 1CQTA 3GFIA 3QYBA 1I27A 1U6GA 4ZDLA 2CFOA 2FOWA 2LD5A 3LSPA 1AWCA 3A02A 1LDDA 1R23A 2P6TA 2HVSA 3DKWA 1HC8A 2W24A 4YG2F 4BY1J 2XAQA 4EEFG 3M1EA 2XRLA 2OC6A 4HQEA 1T95A 2QBYA 2O9LA 1Y8RB 1JT6A 2ZXIA 3F8CA 1UG2A 3PO2J 1ONVA 5E79C 1T2KA 2E2IJ 1B72A 2KP6A 1N75A 5C4XJ 2JT1A 3K7AJ 4C9YA 2LBFB 3MN2A 3CCLI 5J4YA 5LLQA 5FLVA 3I56I 2WB1A 3CJQB 5FLXZ 3P5JA 3EYYA 2VKEA 4WXHA 1Y39A 2PJRA 1YTYA 2XIGA 4MGRA 1GDTA 3U1DA 1A5JA 1QQIA 3WTWC 1XTAA 1IXSB 4P55A 4IHXA 3IAS2 4BDZA 3IRQA 4QTRA 1Z7LA 2E2HJ 1FBSA 2VJIA 3ELKA 2CU7A 1YJWI 1KU7A 3WTVC 2Y2ZA 3DBHB 5FJ8J 4XMYA 2A05A 2L0KA 3IP4B 4FASD 1X2MA 1YIOA 3K1PA 3RPQA 3H1CA 1IUYA 2ZMEB 4E7IA 4JBAA 3WE2A 2HGCA 3VSLA 1U9OA 4IQ4A 1KU2A 2HS5A 5FFZA 4PJJA 3ZQFA 3CQZJ 3FXKA 3K4NA 5FKLA 1IC8A 3JSPA 2LH9A 2KIUA 3CDHA 2F5FA 2PMZN 3HRSA 4XLFA 5DV5A 5EZHA 3CJNA 3UR3C 2R7RA 3I58A 3J7AO 2A6EF 3J7AY 1WCMJ 4RA2A 1W4MA 3FHNA 3ECHA 2ETHA 3WTZA 1UCRA 4E7LA 4MFEA 3R60A 3KPHA 3SZGA 3PL8A 3LSJA 4E7HA 3BG6A 4AC0A 1R58A 3P9KA 1K83J 4LK0F 4OWRB 2X1EA 3LFUA 1KQ0A 1IN8A 4G7ZF 4DGWB 1HDPA 3HUGA 1G3YA 3S17J 2A6TA 2TDXA 5J3LA 4AVZA 5DM7F 4RS8A 3HSRA 2QSFX 5EYRA 3FHZA 3E1SA 1DUXC 4AM3A 2DA7A 1MMGA 4M74A 2L3DA 3EDPA 3A1YA 3RTRA 4LG0B 3FIWA 3I53A 3WHCA 1IW7F 2ZBKA 1PDNC 3DF8A 2EZKA 3ZR8X 2CFXA 1MSEC 2YS9A 4RB1A 3FXJA 3PIOF 1OLTA 3S93A 3OR1C 3ROUA 4PJLA 1D1CA 4F3QA 1XS9A 4A3CJ 1R36A 4GRIA 3FXLA 4JX5A 1TTYA 3RDIA 3AL0C 2IA0A 4F52A 2R7VA 1E17A 4IRHA 1G3WA 1S6LA 3MMYB 2DFEA 1GXQA 2ZSIB 3LMMA 1RZ4A 3PJRA 4NUBA 2IJLA 5HOOA 3QPHA 2PEXA 2GBYA 3ML6A 5JLXA 1ZRFA 2E71A 1KQ9A 2G0EA 1OQYA 3TEDA 1V54H 5JI6A 2E36A 5E17F 3OWTA 4UB8C 3G1MA 4X1EA 1SD6A 3ESWB 1NH3A 3G1LA 3CCEI 3ZPLA 3O2PE 1WI9A 4F55A 2VLAA 1QPIA 5FGMA 2DDBA 2X1CA 3RKQA 2KHMA 2DFIA 2GXGA 3ZQHA 1SFXA 1MMDA 2XKPA 3TQNA 5K1YA 4XOPA 4R79A 2PJPA 1R4MB 3HSFA 1S29A 2R7XA 3RQIA 3ZN0A 4X0GA 3ISPA 2VB6A 1BBYA 1E3PA 1R7JA 1Y0UA 4PUSA 3KP2A 4EQQA 3WU1B 3OV8A 5JLWA 3BG7A 5KCMA 5EGOB 2JVGA 4BQAA 3GXOA 3KLOA 3HL2A 2QGUA 2ID3A 4UVCA 3E5XA 4BYYA 3M8JA 3JR9A 1YIJI 1FIAA 2OV7A 2ESHA 2VT3A 3HRUA 2L7MP 1V55H 2E5ZA 3ULQB 1WWXA 4XLEA 1ZH5A 3JRGA 5FRNA 1HSTA 1LQ1A 4E7JA 2OQGA 1EJ9A 4HF2A 4A5NA 2OA4A 3A0BC 3CCVI 5AIPA 3K2ZA 2ME6A 1S8NA 2K5CA 5H20A 2IW5A 5H2FC 2M30A 2B7EA 4HW0A 3V8KA 2QA4I 2P5VA 3FMQA 3BZKA 5E3OA 4IJAA 5LD2C 1HKSA 2RREA 1WJEA 5K5RA 3W2VA 3MZ8A 1Z6RA 4JOMA 4LB5A 1AKHB 2HPIA 2JA6J 3DPLC 3JAMZ 2V6CA 4JQFA 4W1UA 4PJ0C 3GMEA 3I4PA 3GUDA 5JFRA 4FISA 4YFXF 2M4GA 1QHHD 1T0FA 1YS7A 2EZIA 2VL8A 2LKXA 5IT3A 5FKOA 2GOMA 2XAHA 2XASA 4YFKF 2M0CA 1K7AA 1WJBA 3P9IA 5FLXK 4HPQA 5E8GA 3Q0VA 1QZEA 4B3AA 5D5WB 4ENNA 1JHHA 4UV9A 4OIRF 4A5MA 1YRNA 2VODA 4B47A 3BG5A 2CO5A 2WAQA 4HF0A 1JGGA 2DYSH 4BBSJ 4B09A 3LQRA 3ABLH 1AKHA 1D8JA 1Z67A 4XIDA 3O8GA 3TO9A 4B8XA 3A01A 2CV2A 2E60A 3GLLA 1TQMA 5CVVA 2GXBA 2M9HA 3DPTA 4OINF 1H9TA 1FX7A 5B1AH 1S3JA 5HNHA 1OYYA 1O7LA 1TNTA 4NC8A 3WU0A 2O8XA 5D6FA 1IO2A 4XKCA 1Z21A 1ETOA 1FIPA 1Y0NA 4KN7X 4WWCA 2EIKH 4DZJA 4Y52J 3OYJA 2WC2A 4KITB 2ZJQF 3TDZC 1QO0D 5TJJA 4P9UA 3NAUA 3E3VA 2VIXA 1JKPC 3QOPA 3C18A 1B1BA 2EFNA 1D0XA 2EINH 2CRGA 5GP9A 3DLLF 3OSFA 3QYEA 1UG0A 2YR2A 3OS0A 3EUHC 3LSRA 1X3ZB 4AIDA 4ESJA 2DQLA 2R92J 2EFWA 3CUOA 2LOOA 3FKIJ 3U1KA 2RV8A 1LFPA 4N4NB 3JRCA 5KAIC 1CF7A 2QSGX 3IAM2 4R1HA 1WJFA 4EMSA 2E35A 1MSFC 3S8PA 3S3OA 1DP3A 3MKZA 2E1OA 2L9VA 4QSHA 2R7TA 5HNFA 4XLCA 1T39A 4IX7A 1REPC 4KUMA 3BR5A 3I59B 3DP7A 2XHKA 3V8JA 4S04A 2FBHA 3CDIA 4EJUA 2R4GA 3V7SA 2XPVA 2CQQA 4II3A 3RPUD 3J7ZI 1KA8A 1QA6A 2GOXB 5E20A 1BW6A 1X58A 2W25A 1VF9A 5K5QA 1NTCA 3M1CA 4NC6A 4BEHB 2QZ8A 3HOVJ 2G9WA 4IVNA 3VWBA 2ZO4A 2IVMA 2RDPA 3HZJA 4L0YB 1PUEE 3U9GA 5HLGA 1RUOA 1BC7C 4BHPA 4ZJZA 3TP0A 4MTDA 3D5LA 1HA8A 2LC2A 3LOCA 3J80Z 4DW6A 1R9TJ 1ETXA 3OYAA 5IYBJ 1Z6TA 4GCVA 1HDDC 1X3WB 2WAEA 3GFMA 2UXXA 4G7HF 2K3FA 3DXJF 1BN5A 4EV0A 1D1AA 2I8DA 1RR7A 1OFCX 2L7ZA 3BG3A 1DPUA 2V1UA 3PSIA 3L2QA 1OMIA 1F9NA 4XNFA 1U9NA 1XCVA 3FZVA 5F27A 1Y8QB 4RB2C 1XC5A 5D6EA 1JKRC 2EPFA 4IPAA 3RPUA 4G6TB 2IS4A 3KYLA 2AO9A 3V4GA 1WJDA 5F1JA 4I6ZA 3BJOA 3TO7A 3L2RA 1ZG1A 2LY9A 3JCUC 5ILUA 4XLHA 4OU0A 1U5TA 3SQNA 1ZG5A 1TL8A 1RR8C 1SAXA 4E70A 1YLFA 2KT0A 4XR6A 2I10A 4EVIA 1HKTA 3LNQA 4A3MJ 1OYIA 3LSHA 5L3CA 2CV1A 5DS9A 1ZTRA 4I02A 4RGRA 3SDGA 4ZYEA 1I3QJ 3TO6A 4UV8A 4EGYA 1VQ9I 2P7CB 1POGA 4V2FA 4V19K 4UXNA 3H92A 1XD7A 3BCAA 3CP2A 4GXOA 4QLCU 5L3GA 3S1QJ 3HTUA 4RLQA 2CQNA 1LDJA 2BW3A 3K2AA 3VB2A 4HDUA 1GT0C 1R4NB 4Y17A 5DEQA 4DBQA 1CF7B 2BOLA 3PNYA 2E5NA 2ZNYA 4ANJA 2NVQJ 2DOFA 1JE8A 4QPOA 4M9XA 3NWSA 5E3NA 3BR2A 1X1BA 3WG7H 3CCMI 3SXYA 4L5IA 1J75A 2STTA 2VBWA 1XPXA 3PQJA 4KIFA 2LK2A 3QU3A 4ZH4F 2XF7A 2DK5A 1H8AC 2VQGA 2X6XA 4CHUA 1VQ4I 4XN3A 4FHTA 4XQFA 5D5UB 4WX9A 3CZ6A 1IN5A 3D5SC 1ZK8A 2I5UA 2K9LA 2F5EA 4FETA 3FK7A 5D4RA 2DJNA 2JSPA 2DTRA 4BQNA 2RAEA 3HC7A 2NS8A 4N0BA 2EA4A 4RM2A 4D1QA 2R7OA 1Y1WJ 1IDZA 4II2A 4DNCA 3VYSB 4CCKA 4BHBA 5EDNA 2HR3A 1WQ2A 4CYCA 2DMNA 3R0JA 1T38A 1EH7A 2CQ7A 3DV8A 2K9NA 3BTIA 3S2HJ 3HTSB 3LA3A 3VODA 2DYRH 4Z6YA 1Z91A 4XLAA 2CW7A 4I0AA 3F8NA 3QAHA 1FOKA 5FD6A 2BY3A 2BBYA 2VKVA 3C2HA 3SFZA 4CCOA 5K7HA 1FP2A 3PM1A 3QYFA 2H6BA 1RKTA 3C2BA 1U5TC 3KP6A 3V7RA 2ZC2A 4CICA 2EJRA 4NBQA 2RGVA 2AQEA 2E1NA 2EZHA 4WF2A 3N4MA 2M45A 2K9QA 2YU3A 2HDCA 4UHTA 4ZYDA 1XX5A 2JRMA 3ASOH 4CO8A 1T0FC 4B48A 1YJNI 2YU9J 2VXDA 5IOZA 3RYRA 3L00A 2O0YA 1IAWA 1U2WA 3SYTA 3M7GA 1FYLA 3H3VK 3LA7A 2DMQA 2A68F 2HPMA 5B1BH 2FSWA 2WB1N 2A6HF 3F8BA 2HXIA 3CCSI 4IF4A 2AXLA 1LE8A 1OR7A 5CQGA 2QM3A 1I6XA 3L2WA 4GGGA 4PCQA 3S32A 2NNYA 3C3WA 3QU6A 2LKSA 2FEZA 2VI6A 3RKXA 3OOUA 1OYWA 3WGGA 4FE7A 4CCJA 2KMUA 2Z99A 2JUGA 3LQQA 5BS6A 3BC8A 2VBYA 1U8RA 2ELKA 2H1LA 1RPWA 3ZQIA 4FCYA 2LVSA 1QPMA 2Y9YA 3EUHA 5CVRA 4C30A 5C4JJ 2ZMEA 3GWZA 5FD5A 3L7WA 3LL7A 1IXRC 3CP8A 5ERIA 2X6YA 5DCFA 1LVKA 4HAMA 3K4CA 2V1NA 4XRMA 5LGUA 1UZCA 4C2TA 2JPCA 5ILSA 1LE8B 1VQ6I 1R1UA 1BIBA 1T08B 2OUMA 4I76A 2HQAA 1SD7A 3VYRB 2A07F 2F4OB 2PMHA 2IGOA 2VOPA 1B9MA 1VQLI 5BMZA 1VQNI 2BHYA 2HWVA 1R5GA 4A3EJ 1ZYRF 4NQWA 1J7KA 2DDAA 2QKMB 2IGKA 4DJAA 4HLYA 1K78A 3BLYA 1O4XA 3OYEA 1KQ8A 1XDSA 1IRXA 3GEZA 2HVRA 3DWLE 3A01B 2NS0A 4OIOF 1V5FA 1O3SA 1HXDA 4IL6C 1MJBA 1X19A 2X9DA 4IRIA 4PZJA 1UHMA 1H9GA 2ZCWA 3QPTA 3RQ4A 2DW4A 3HRTA 4EJTA 4IRGA 3GVAA 3S2WA 1QNTA 3D5RC 1GHCA 3F0CA 3PO3J 2QLZA 2P0WA 1D1BA 4IHTA 2DA6A 2X0LA 1MMAA 1FOXA 1K78B 3BG9A 2V7FA 4A3LJ 2Z16A 1ZLKA 3BDDA 1Y56A 4M3BA 2PFBA 2FA5A 3ECOA 4XRSG 2FBIA 3K70D 3CO6C 4G6QA 1IG7A 3I4NJ 2E1MC 3DQVC 2HNHA 3O8HA 4XOTA 1Y6IA 3OYFA 1K6YA 1GV5A 1MIJA 2DODA 3BZCA 1BI3A 1Z3YA 2IA1A 4FX0A 3RCOA 2Z33A 2O8KA 2QEXI 4CCNA 3JRFA 1IZ1A 4XLNF 1NHAA 2M8GX 3ZQQA 2LNBA 1W1WE 3K4LA 4I2OA 3ZN1A 5J8FA 1FZPB 5HS7A 3OIOA 4BACA 2ECBA 4OMYA 4A3IJ 3GLXA 5D8LB 4EM1A 1D8KA 4KYWA 3CUQC 2LYCA 1W5CC 4BEHA 2VN2A 3BJ6A 4U7BA 3BR1A 1U0JA 2HYGD 2PBIA 1I1SA 4ASNA 5L3BA 2BY2A 1ZLJA 1IV8A 5DD4A 2GWRA 4YIFA 4R8HA 5HVQC 5FB2A 2HOAA 1K4SA 4IOAF 5IP6A 5DUKA 5LGNA 1JXSA 4BS9A 5LEJA 4LLNA 4NQWB 5A2QZ 2JA2A 3BTLA 1ZGAA 3HXLA 1MKMA 4L9NA 5J8CA 1CGPA 1TP4A 1USSA 4PFOA 3HG9A 2CWEA 3R0AA 5DM6F 2Y0SN 3S1MJ 2O3FA 2HDDA 4LITA 3CF2A 2VASA 5JHFA 2DAOA 2RKHA 1QVTA 1FYKA 2MGQA 3K4JA 4XORA 5M3MJ 2DA5A 2CSOA 2EWNA 1YG2A 4KT5C 2R5YA 4P5OA 1LFUP 4YIRX 2D1HA 3DBRB 5IOYA 3MD2A 1R71A 2CW8A 5IP7J 1TW3A 2KISA 2VONA 1HW2A 3ERED 1PYVA 3K4KA 4RBOA 2WWYA 4I98B 4RGXA 2O7OA 4E7ZA 2K4JA 3U2RA 2VE9A 3CMAI 4A93J 1WJ5A 3OR2C 3CUQB 3BJAA 4FX4A 1WPKA 1DGWY 3X2QH 2FOKA 2JJ7A 1OR7C 2MLGA 3TOAA 2W82A 4XLPF 4M9SA 4XK4A 1X1DA 1YOVB 3LSKA 2VQCA 4XKWA 1B8IB 4I0BA 3FK6A 2IS6A 1XGSA 1ETYA 2DMPA 1BI0A 3IKVA 4N9IA 2XROA 1Q1HA 4Q5SF 2QQAA 1MGTA 3N97A 2H1KA 2MD0A 1DQUA 1JTYA 1ETVA 4OIQF 2Z1DA 2LTPA 5K7ZA 4LLGF 2ME0A 1J59A 1BOAA 3BR0A 2UUZA 2D45A 1GXPA 2PJRB 2EFPA 4KNYA 3M8EA 2Q0OA 2H8RA 2VBXA 1ZELA 4EGZA 4HG2A 2W57A 2NOGA 1P4WA 3CC7I 2KRCA 1BI2A 3RYPA 1VQKI 4HF1A 3OYMA 2WY8Q 1JUMA 1UFMA 2NYXA 1OCZH 2RNJA 2XSDC 2F4IA 3BY6A 2CH0A 3LFKA 3BWGA 5GAHJ 2KIFA 3K1MA 1K79A 2P5KA 5HDKA 2KJCA 1ZQ3P 4C3HJ 4O6JA 2F48A 4KJZA 4Q47A 1ZHFA 1LEAA 3I5UA 1JKQC 2AQFA 2ZB9A 2Q8KA 1BIAA 1XSDA 3T1BA 2WAFA 1BI1A 4ENJA 1L3LA 3TBIA 2M7BA 3ZQGA 1Z9CA 1P7JA 2HYFA 3CO7C 3HSEA 2QWWA 5CQEA 3WG9A 3AG2H 1FTZA 1G2HA 5EZGA 2X1DA 3I71A 3IWFA 1P9QC 2Y69H 2HYJA 2XGCA 2F2EA 4U87A 5M5XJ 2COBA 1LNWA 3ZMZA 4RB3C 2A61A 3F22A 2EBIA 3JW4A 5KAFC 3TMOA 3ZMUA 3GF2A 2JTVA 2KQRA 2V9PA 3E6DA 1YJ9I 3BTJA 5IT9Z 2KRHA 2TCTA 2V9KA 4G12A 4JK1X 1JGSA 1YYVA 2VUMJ 3FBNB 1LVAA 9ANTA 2CUFA 3DTKA 3WTSC 2BHZA 4ZZLA 3H9QA 3OIPA 4HYEA 4UUSB 5DUIA 5IP9J 1D5VA 1F43A 3KE2A 4V2GA 2F5CA 3R6SA 4A3BJ 4K2EA 4LFUA 1JUPA 3KP7A 1BOBA 4W97A 3TDUC 1KONA 2MC4A 3G1OA 5FRMA 4B43A 4EJVA 3IKTA 2DFHA 1X3UA 4CGZA 1YW7A 4CCMA 1Z7UA 2PX9A 2X6WA 3I54A 2A3SA 1YITI 4ZDOA 2H8WA 4RAGA 1IV6A 4F93B 1UELB 2F4MB 1MJ9A 1HKQA 4FT8A 2QQ8A 2GIVA 4L0ZB 2R93J 4M71A 1QU3A 4EJWA 3FXMA 2MABA 5DD8A 3GZ5A 4RDUA 4MTEA 3BR6A 4LMYA 3G2BA 1EA3A 5DDGA 3ZQLA 3OY9A 2QUFA 5ILVA 5AONA 1A35A 5JVGF 1X1AA 2DK8A 2BVLA 4BJTA 2Y0SA 5TRDA 3F6OA 2HDWA 2R7QA 3ABUA 2Y30A 5CLSA 2YX7A 2LRDA 2GAUA 4IHWA 3MKWB 1H89C 1FT9A 3AL0B 1I6HJ 1TNSA 1Z77A 2EQRA 4RAFA 1ETQA 4N4OB 2LP0A 2NVXJ 2F5VA 1BJZA 1WHUA 2G7HA 4ON0A 2Z5UA 5EG0A 1R00A 1QRYA 3FF5A 2QQBA 1G59A 4ETSA 1EF4A 3WTXC 3B02A 5ICFA 5EEAA 4RM3A 3SHFA 1A36A 2A5WA 4OMZA 3L09A 2KKOA 2V4JC 1WH5A 2RN7A 2M5WA 3MVPA 5EJCA 5LFAA 1PUFA 2HOEA 4HNUA 2VKDA 1ETWA 2ELHA 2FX0A 2XB5A 4AYBA 4HNTA 1FOYA 1RESA 2WBMA 4EM0B 2J5PA 3ABMH 3QP5A 3KYCB 1LB2A 3EQLF 4F92B 4CDGA 2ISZA 3FXOA 3CLQA 3CCYA 4L5JA 1X1CA 1K6OA 3M9AA 1G8XA 4F91B 2R5ZB 4ZYGA 1JJ6C 4F7ZA 3FM5A 5FLMJ 1D0ZA 3W6KB 3CJRB 4PGHA 5E18F 4HOBA 3GTJJ 1UHWA 2HI3A 2PN6A 5J6XA 2K9SA 4HRIA 2W85A 4C3IJ 1VQMI 3DU5A 4ZTJA 2PQ8A 4BE0A 1TZLA 2DA2A 3CC2I 1YX5A 5F6FA 1PP8F 1QVUA 3T8RA 4B3XA 1X4PA 1HW5A 4IHSA 2K40A 1WH7A 2HQNA 3T0YA 4UUVA 3B6AA 1YO5C 4HSTA 4KICA 2IRFG 1YRNB 4DYCA 3OYCA 2Z3YA 2R5ZA 5HDGA 4BDYA 5F0HA 1IRGA 3DCFA 2LDUA 1LDKB 2DJIA 3L9FA 3WGHA 1SD5A 1WKMA 4MLOA 3SZTA 1SFUA 2E1MB 3A03A 1X1PA 2LF7A 1H88C 4BH9A 2VT2A 1TWCJ 5GPCA 2JZYA 4H4KC 1IDYA 2IAIA 3MKLA 3HEFA 1XDUA 2Q1ZB 3FXUA 1APLC 3BTCA 1M1EB 3WTYC 2ZMEC 5E3MA 3DKYA 1F36A 4RLFA 2ZSHB 3ABKH 1WSUA 1MH4A 2MD5A 3NRVA 3BCBA 1LKXA 3M07A 4U0VA 2DXIA 3I4MJ 3H3ZA 2VQHA 1KYZA 2DBBA 1O3QA 3TW7A 1UJ8A 5HLTA 3CLOA 3DKXA 3VSKA 1J9IA 4H0EA 2RVCA 4HV6A 5DCMA 2QKLB 5FKNA 4MQ9F 3S3NA 2K86A 4XSXF 1BL0A 2KL4A 2MH2A 4HSRA 3AG4H 2ZXHA 4UUTA 5ICEA 1GVDA 3WU2C 1OPCA 2OJED 3QODA 1UB9A 1S5LC 2C6YA 4RGUA 1PUFB 1XMXA 1IN4A 2KIMA 2HXOA 4XKVA 2L54A 3M4OJ 4U88A 2MFZA 2NAZA 4S0HB 3DLAA 2XF5A 1SD4A 4P96A 4JX6A 2HU9A 3H0GJ 1ENHA 2EV5A 2HFHA 3I59A 1AU7A 2ZFWA 3F72A 1XMAA 3JRIA 4L9JA 2DLLA 3PUBA 5CPRB 5L3FA 2XAGA 2HKXA 4NDLA 3TW6A 2LY1A 4C2MJ 1QBJA 3AG3H 3HDDA 3ASNH 2MBFA 4LJZF 2EZLA 5BOXA 1A6QA 4MEXF 2EILH 1T6SA 3F8MA 4WCGA 3GTQJ 2ZXWH 4QPQA 4LOCA 3KX2A 6PAXA 2FBKA 3DPUA 2HZDA 2XF6A 4ABZA 3KP5A 1TT0A 2FQ4A 3CCUI 2Z2SB 3LWFA 1J2XA 5J40A 1Z3XA 4ESFA 3PFYA 2OQRA 4HX4A 3H35A 2E19A 1RNLA 3FMSA 4CZCA 3DU6A 5F04A 2DFFA 1VNDA 4Z2YA 1MDMB 5CVJA 1JTXA 2IP2A 1G4DA 3CF5F 1MBFA 2P81A 3PFIA 5F1RA 4BHCA 3H0DA 2DT5A 4A0XA 3OSGA 1EKEA 1G3SA 2ZJRF 2ACJA 2RC4A 1PP7U 2FNAA 1TWFJ 4BJ5C 4YRVA 3KP4A 3S1NJ 1LEBA 1V5EA 1XGNA 3OYGA 2L5QA 3L2CA 3I64A 3G73A 1MBKA 1IRFA 1WJCA 2EFQA 5ICGA 3CCJI 3E7LA 5D5XB 2BEOA 2OAZA 5K7FA 2ICWG 5EEGA 2DA1A 3K69A 1WRJA 4P1WA 3K4MA 5CYVA 1LJ9A 2BY1A 3F21A 1NK2P 3GFJA 4PFPA 3RIRA 2AXTC 3HJEA 2OZ6A 3HHGA 2UV1A 2OTJI 1YW9A 4XL9A 2WTEA 4B1RA 3WHBA 2KIQA 1W36C 1IXCA 1U5TB 1F1ZA 2CW0F 4CSWA 2K27A 1U8BA 1XGMA 3BT9A 2KLOA 1V4RA 2Y75A 3IV5A 3BOQA 3DEWA 2ECCA 5GADJ 1S9HA 4BXXJ 5FO5A 4KFCA 4RB0A 2H27A 1OCTC 3S3MA 3CMEI 2IBDA 4YFNF 2L7KA 3ZP5A 2KDOA 3V42A 1O57A 4Q48A 4WXDA 5IY5H 2XB0X 1B4AA 2PMUA 2Y31A 3HOXJ 1ZKGA 3HB9A 4LIVA 1HLVA 4TV7A 2XAFA 1TWGJ 1W0TA 2Y0MA 2JA5J 1I5ZA 2BE5F 3AFHA 4Y15A 4Q4ZF 4AIHA 4LG3A 3TGNA 4HQMA 4M3DA 4XRSA 1D3YA 4ZTFA 3RKWA 5E1WA 2OTLI 2JA7J 2JWTA 3HIFA 2HTJA 1E2XA 1C0WA 2JK3A 3FM3A 2EFOA 2QYOA 1F4KA 1MD0A 3KZZA 1ITYA 3HOYJ 3B6CA 2M4KA 3H9GA 4BJ6C 2DCEA 1HF0A 1DDNA 3OL4A 1YS6A 3KEYA 4XSZF 2LREA 4LG0A 5D8KB 2NVYJ 2BYVE 1WGXA 5GTHC 2P8TA 2PI0A 5J4VA 3JRDA 3GX4X 2BZTA 3HM5A 1DU6A 3ZXSA 5LHHA 1TT5B 3IHUA 2M34A 4B44A 5EF6A 4GFBA 1USTA 1X4OA 4BKXA 1PVEA 4CCLA 4IQJA 4HA8A 1E3HA 3HBLA 5F64A 3VPRA 2L4AA 5EG0B 3C2GA 3WE3A 3ZRGA 5B5EC 1SEUA 3KZYA 3H3UA 3KYDB 1W7PD 3U21A 1K61A 2GA2A 4G6DA 4XN0A 5D4SA 3I9V2 1TW2A 1XMKA 3SEQA 1H0MA 1OJLA 5DYMA 2OCEA 2AHQA 4LGWA 4PK4A 2WY7Q 3JTGA 3WGIA 2PLYA 3ZOBA 1IGNA 4NB5A 2COMA 3K6GA 1MBGA 3J80K 2JMWA 1EV7A 4IO9F 3JRHA 4A12A 4I01A 2DPUA 2NXNB 4CZZA 4D5FA 4DZPA 5HS8A 3UNGC 3W2AA 1MJAA 4PSWA 4IKFA 1E0EA 4OAZA 2ELJA 2HVQA 3AKZA 1ERDA 2LMDA 3LSTA 1ON1A 2L01A 2QQ9A 3E6MA 3SZPA 1SVLA 2R3SA 3ABTA 3Q0WA 1WVRA 3SJMA 3CDLA 4BXUA 4BAYA 1L0OC 2AS5F 5LBQA 2A69F 3IUOA 5KVRA 5LEKA 2BXYA 3FX3A 2G7UA 3DBLB 5A2QK 2W00A 2VXZA 5IPAA 4I09A 3GW2A 2B9SA 1OCCH 3GTMJ 2CS3A 1YE9A 5LHIA 1W7PA 3K1NA 1XG1A 1G3TA 1MNEA 2BGCA 3LAJA 1I3AA 3PNTA 1VTNC 3P9CA 4JP0A 1JKOC 1SVMA 2MC3A 3H5AA 4NC7A 1ZGJA 4ZYHA 1SFEA 2XGXA 3OOPA 4NNJA 1S7AA 3CD6I 1W0UA 4HBLA 4ZYAA 4C3JJ 4XM3A 4IZZA 3MCZA 1VI0A 3HKZN 4O3MA 3N05A 1MBEA 2M87A 2OPTA 3GTLJ 2ZJ2A 4I7HA 1Q1VA 4UY8I 3KETA 1A04A 1FLIA 3GTPJ 1P7IA 1XN7A 4E6KG 3CMMA 2KZVA 1O7FA 2DMTA 4YEJA 2M8EA 3OL3A 1SMTA 1IN6A 1V5GA 3D0SA 2A5YB 1OCPA 2L4MA 2O6GE 1I39A 3FMRA 2GA1A 4U0WA 2MLKA 3RZDJ 2P4WA 2KJBA 2VQLA 3GZNB 2WADA 3CJTB 2OBPA 3BQYA 3FISA 3LSMA 5LRRA 2HZTA 3LAPA 3IH3A 3R4KA 4AUXA 3S15J 5FROA 2K85A 1BJAA 4AD9A 1DU0A 1MBHA 2ADUA 3NWTA 2HOSA 3VEPA 2O03A 1RIOH 3J81Z 2M7AA 1GV2A 2HQ5A 2R7DA 3H5NA 3EETA
chains in the Genus database with same CATH topology
2DYSH 3ASNH 5B3SH 2EIKH 3X2QH 1V55H 3ABLH 2EILH 3ASOH 2EIMH 2EIJH 2DYRH 2ZXWH 2EINH 1OCCH 3ABMH 5B1AH 3AG2H 1V54H 1OCRH 1OCZH 2OCCH 3AG1H 2Y69H 3AG4H 5B1BH 1OCOH 5IY5H 3WG7H 3ABKH 3AG3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYS H;  3ASN H;  5B3S H;  2EIK H;  3X2Q H;  1V55 H;  3ABL H;  2EIL H;  3ASO H;  2EIM H;  2EIJ H;  2DYR H;  2ZXW H;  2EIN H;  1OCC H;  3ABM H;  5B1A H;  3AG2 H;  1V54 H;  1OCR H;  1OCZ H;  2OCC H;  3AG1 H;  2Y69 H;  3AG4 H;  5B1B H;  1OCO H;  5IY5 H;  3WG7 H;  3ABK H;  3AG3 H; 
#chains in the Genus database with same CATH topology
 2LFB A;  2RNG A;  3Q0U A;  4ZDP A;  2VJJ A;  2FUG 2;  3OYN A;  2JA8 J;  3BZ6 A;  3OS1 A;  1YI2 I;  4XRF A;  2HTS A;  3E0J B;  1P4A A;  4IHV A;  5IT9 K;  3HKZ A;  2EIJ H;  2FU4 A;  1HOM A;  5F08 A;  5FKK A;  5EGO A;  4ITV A;  4GO1 A;  1ZN2 A;  2LF8 A;  4MEY F;  2V26 A;  4A3G J;  4WK8 F;  3ZQC A;  4ZZD A;  2F5D A;  1X2N A;  3ERM A;  3W6J B;  4A3J J;  1UMQ A;  3E5U A;  2XV4 S;  3GCM A;  4L9V A;  2MW8 A;  5J47 A;  1A31 A;  3BQZ A;  5C44 J;  3CC4 I;  2K4B A;  2VC0 A;  5IYD J;  4IOC F;  4WXC A;  3QRF F;  1EH8 A;  3HHH A;  3LSG A;  3ZGK A;  2VPL A;  3QWL A;  4U7D A;  4DQ2 A;  4UVA A;  5BPD A;  1DP7 P;  1O3T A;  5JHU A;  4X6A J;  2MSY A;  1BR2 A;  4AYB N;  3BR3 A;  3ZCO A;  3OS2 A;  1VQ8 I;  2DT7 B;  1JUS A;  2W84 A;  1LPQ A;  1HCR A;  3KLN A;  2L2O A;  3KFW X;  2M3A A;  4HEA 2;  4MQV A;  5DCM B;  1Y1V J;  4RAZ A;  4NHJ A;  1N78 A;  3I3L A;  3VDX A;  2KRF A;  2EV6 A;  1VQ7 I;  1FP1 D;  1P4X A;  2YUS A;  3O6B B;  3KEO A;  4JYK A;  4BQO A;  5J1Y A;  4GYI A;  5JR3 A;  3ZMS A;  4C2U A;  3CTA A;  1FEX A;  1JI8 A;  4Y33 A;  5KHD A;  5IYC J;  4YEL A;  4D9J A;  3ONQ A;  3J81 K;  1MW7 A;  3EYI A;  3V8L A;  4M3F A;  4CA0 A;  4HDV A;  4BE2 A;  4BBR J;  3FDY A;  2VBZ A;  2R7S A;  2NOJ B;  4AIJ A;  2E1C A;  2XC7 A;  3J7Y J;  2FJ1 A;  3KCC A;  3W3C A;  2GLO A;  4A6E A;  5H6R A;  3UKG A;  4CUG A;  1KGS A;  4D0P A;  2D5V A;  2QSH X;  1R5I D;  2CUZ A;  3K9T A;  1OCO H;  5DTD A;  3S1R J;  2IEK A;  2VJ4 A;  4M6Y A;  3SFI A;  4OOI A;  1IUF A;  1KZH A;  3RI4 A;  1B9N A;  4LLL A;  3WTT C;  4E4H A;  1YHQ I;  1XGO A;  3NAR A;  2V79 A;  4BU2 A;  5HS9 A;  1GUU A;  1U78 A;  1MMN A;  2LKP A;  4XKB A;  3K70 C;  5M3F J;  4J00 A;  4BNC A;  2NVT J;  2QEN A;  4DYQ A;  2V9V A;  3GFL A;  3JRE A;  4PDK A;  1BW5 A;  3ZMD A;  1DPR A;  2EB7 A;  2EV0 A;  2K9M A;  3VYU B;  2ZKZ A;  2FNP A;  3T5X A;  5GTI C;  4A3K J;  3REO A;  5K5O A;  5TIS C;  3HPH A;  2Q2E B;  2W1O A;  4BE1 A;  5E1Z B;  4XON A;  1HQC A;  2K7L A;  3TP3 A;  1MNM C;  4A3F J;  3PNV A;  5E1X A;  2JRT A;  1KU3 A;  1MDM A;  1FTT A;  2DN0 A;  1ULY A;  2H09 A;  1XSV A;  5E8I A;  2HOT A;  2XDV A;  4G94 A;  5CVI A;  2DO7 A;  2X48 A;  1OCR H;  2KPM A;  2MA3 A;  3MEX A;  4KN4 X;  1WI3 A;  3T8T A;  2WV0 A;  2QCO A;  4IHY A;  3LA2 A;  3IC7 A;  1ZAR A;  4D7N A;  2ISY A;  1HSJ A;  1B8I A;  3PIP F;  2XVC A;  4M3E A;  3DEU A;  2FMY A;  2PG4 A;  3RSN A;  1R49 A;  4ZC3 A;  2L7F P;  1VQ5 I;  2IPQ X;  4EJO A;  2DI3 A;  2EIM H;  4D5C A;  2IS2 A;  5ED4 A;  1IF1 A;  2BY0 A;  4BQQ A;  3KIO A;  1YX3 A;  2V6E A;  2O61 A;  3K0L A;  2LY2 A;  2CYY A;  2DMU A;  4PSX A;  3QQA A;  4M3G A;  4DYR A;  3S16 J;  2OD5 A;  1FPQ A;  3OYL A;  4G7O F;  1SC7 A;  3GTK J;  1B6A A;  2CQX A;  1AHD P;  1TQP A;  3QPL A;  2MG4 A;  2DU9 A;  1ORK A;  3NQO A;  2OZU A;  3E5Q A;  3MQ0 A;  5B66 C;  2DA4 A;  1HBX G;  2CQK A;  3IH2 A;  3BPX A;  3E97 A;  2DT6 A;  1A6I A;  2W7N A;  3VFZ A;  4Y13 A;  4AWX B;  4E7K A;  3RJP A;  3L2U A;  2DPD A;  3JRA A;  3P7N A;  3A2K A;  3WTU C;  2W4S A;  2E7X A;  1MMS A;  2LSO A;  4IEJ A;  1T56 A;  2JSC A;  3GTG J;  3CMY A;  2B63 J;  3M3Y J;  4M6X A;  3RKY A;  3C1D A;  5F0C A;  4M72 A;  5GAG J;  3OYH A;  5AIQ A;  1W5S A;  4GDF A;  3V7C A;  1O3R A;  3TOB A;  4GYG A;  2EA2 A;  4A0Y A;  5HLH A;  3SDB A;  5M5W J;  3FWE A;  3WOD F;  4XBF A;  1UAA A;  1ETK A;  1ODD A;  2R7W A;  1SFO J;  1MBJ A;  2OCC H;  4Y3O A;  2WA0 A;  3ZMT A;  5HOD A;  2N8G A;  3VOE A;  2O5R A;  2JPB A;  3MZH A;  1NG6 A;  2ZFU A;  4I99 C;  2R7U A;  5CKT A;  2ZXJ A;  1TQI A;  1DGR M;  2FF4 A;  4KIS A;  2RQP A;  4D7M A;  1AOY A;  1R22 A;  1FMV A;  1P92 A;  2KFD A;  2JUC A;  2IA2 A;  4L18 B;  2FXA A;  1R1V A;  1J0R A;  5J1R A;  1F5T A;  3H36 A;  1V3F A;  1T98 A;  5D5V B;  1S7O A;  3F6V A;  1QZZ A;  2CMP A;  1VFC A;  4UNO A;  1TWA J;  3K4B A;  3ZMV A;  5HDN A;  3R61 A;  1W7P B;  3EUA A;  2M2E A;  1VQO I;  3LSI A;  3CCQ I;  2R0Q C;  1NG7 A;  1IN7 A;  1TLH B;  2P7V B;  2B0L A;  2DQR A;  1B72 B;  1FOW A;  4CXF A;  2LBF A;  1I1G A;  2Y48 A;  3QOE A;  3CES A;  3IWZ A;  4EAT A;  1VZ0 A;  4HV5 A;  3Q5F A;  1ZGW A;  4CYC B;  4L9T A;  1SVO A;  2XSJ C;  3W2W A;  3GYH X;  1ZG3 A;  1D0Y A;  1W36 D;  1EH6 A;  2KDZ A;  1YW8 A;  4ENM A;  2X4H A;  1ZRD A;  5L3D A;  5BNG A;  3HOZ J;  4YII A;  1UHS A;  2D1V A;  2W48 A;  5L3E A;  4QIW N;  2J5O A;  1FMW A;  1R5H A;  4AIK A;  4HLX A;  3K10 A;  3JRB A;  4BXF A;  4E7S A;  1ZR2 A;  1SMY F;  3B73 A;  3FXQ A;  5CJ9 A;  5BPI A;  2VJ5 A;  3HOS A;  4ESB A;  3HGY A;  1P6R A;  1MH3 A;  1FSH A;  2V1D A;  3HRM A;  3D1N I;  2MYS A;  3F9K A;  4UUS A;  3IH4 A;  4A2U A;  2LG4 A;  5BQT A;  3HGG A;  2L9S A;  3SEZ A;  1N77 A;  3HYI A;  1T33 A;  2JN6 A;  3L2V A;  4U0Y A;  1R1T A;  1ZR4 A;  2M1B A;  3MZY A;  1FJL A;  2XAU A;  2VOO A;  3DEE A;  3F3X A;  1Z1D A;  2FQ3 A;  5FKM A;  3PQK A;  1PJR A;  2E34 A;  2IGM A;  1P2F A;  2GIZ A;  5H6Q A;  1ZRC A;  2YPR A;  3A4C A;  2Y9Z A;  2E7W A;  3IRR A;  4IXA A;  4JX4 A;  3MKY B;  2VC1 A;  2DOE A;  2QF7 A;  2LR8 A;  1Z0X A;  3EPZ A;  4CYD A;  5EEH A;  3MAJ A;  1BR1 A;  5HLI A;  3O3K A;  1WFX A;  4MO7 A;  3KEQ A;  1FWZ A;  3MWM A;  3Q9S A;  4HZF A;  1J5Y A;  2Z9O A;  3GTO J;  3A0H C;  4QWQ A;  1IJW C;  1LFB A;  4KMF A;  2XKO A;  4BGD A;  4DIQ A;  3W6V A;  1FYM A;  4PGG A;  1I50 J;  2PMZ A;  1T8I A;  1BC8 C;  2XRN A;  2P5L C;  4LK1 F;  1SAU A;  2CV0 A;  3OIQ A;  3E6C C;  2K02 A;  2FE3 A;  5LHG A;  3GZ6 A;  4AVP A;  4LD5 A;  2WV1 A;  3OMY A;  3E6B A;  2CG4 A;  2XUB A;  1B59 A;  4M6V A;  1J09 A;  1OKR A;  3PUF A;  4XIC A;  5KK1 A;  3H5R A;  3L1P A;  2MH9 A;  4LB6 B;  1JHF A;  3NEU A;  3JAM K;  4Y7N J;  3M8F A;  2HQR A;  5J1U A;  1XSX A;  2IGN A;  4L5E A;  2JQ7 A;  2E2J J;  1KYW A;  3Q9V A;  3HPG A;  4PJM A;  4AU7 A;  2NS7 A;  3FKJ A;  3OYI A;  1JJ8 C;  2CUJ A;  2GZW A;  1RC9 A;  4J01 A;  1YQA A;  3HOU J;  4HNV A;  1GVJ A;  1NK3 P;  4Y4R A;  1IRZ A;  2XGD A;  3AG1 H;  1QGP A;  2UZK A;  2GQQ A;  4S05 A;  3G4S I;  1QZY A;  2D2W A;  1ACI A;  1ZRE A;  1R6R A;  1AA7 A;  4CH7 A;  4A6D A;  2ID6 A;  2K3P A;  2EK5 A;  4G9Y A;  1SFK A;  2KZG A;  2VE8 A;  3BRO A;  3IL2 A;  3RZO J;  4KMU X;  2XGE A;  1STZ A;  1LUJ B;  4KA4 A;  1OIS A;  2YX4 A;  2VKH A;  1ZAO A;  3GO5 A;  3G6E I;  1FNN A;  3FBI B;  1WZ2 A;  2L02 A;  2L9N A;  3DFG A;  1JT0 A;  4PJN A;  1XCB A;  4KDP A;  2Q2E A;  1BR4 A;  5CVU A;  4RGS A;  5F0F A;  3FXR A;  2GXA A;  2ZNZ A;  4J19 A;  2GM4 A;  2HKO A;  2WAQ N;  1WJA A;  1XB4 A;  4A0Z A;  2IT0 A;  4A3D J;  2FML A;  1K4T A;  4A69 C;  4OAY A;  2DOA A;  3Q3S A;  2UWM A;  3CUQ A;  3G71 I;  2FRH A;  3H9J A;  4M9Z A;  4MHG A;  2H6C A;  3CCR I;  1MZB A;  3F8F A;  2LLK A;  3QPS A;  2XPU A;  1SAN A;  1FSE A;  3OYB A;  3BPV A;  1VQP I;  1BA5 A;  2QBY B;  1FBU A;  2BVM A;  2FD5 A;  1RUN A;  4MNU A;  4B4C A;  4M73 A;  1GLN A;  3JSO A;  1ON2 A;  2F6C A;  4KIG A;  3I0T A;  4RMN A;  2JVH A;  2UXN A;  3G3Z A;  2BV6 A;  4FE4 A;  2BXZ A;  1FC3 A;  1RET A;  4HX7 A;  4UB6 C;  5B3S H;  4OIP F;  3S2D J;  1BM9 A;  2L9R A;  5TGT A;  2ESN A;  4BL0 B;  1FY7 A;  2TRT A;  1D5Y A;  2QVO A;  3KZI C;  5E3L A;  2YSR A;  4BUP A;  3ZQ7 A;  1FBQ A;  3DTE A;  3DTI A;  1QHG A;  1RKW A;  1RRJ A;  2XAJ A;  3HOT A;  3TL4 X;  3TKY A;  4DOZ A;  2M0M A;  4FQG A;  2EH3 A;  2V1X A;  4BY7 J;  5GAE J;  1G6N A;  2BW3 B;  3F23 A;  2DTZ A;  2CUE A;  4EM2 A;  2IXS A;  2X6O A;  4KT6 A;  2DA3 A;  1TWH J;  3BP8 A;  4O5V A;  2R7Z J;  2P6S A;  3QP6 A;  3OYK A;  1MND A;  2NNN A;  2CGP A;  3VYT B;  2STW A;  4DBR A;  2IS1 A;  4FTH A;  1TC3 C;  4MFD A;  1YFH A;  2CJJ A;  5LGT A;  3PSF A;  3OYD A;  1E3O C;  3COA C;  5C3E J;  4RAY A;  5LRS A;  2ZJP F;  3HOW J;  5ICC A;  2X85 A;  1Z05 A;  5KNL A;  2OF7 A;  4HX8 A;  2XPW A;  4ENK A;  3S14 J;  1KU9 A;  1N25 A;  5GPA A;  2NRA C;  1TBX A;  4UVB A;  1S7E A;  1HW1 A;  4KIB A;  2R5Y B;  3EUK L;  3KP3 A;  2R7F A;  3MFK A;  4P9F A;  1S72 I;  2H94 A;  1U3E M;  4N9H A;  2X51 A;  1W5T A;  3C7J A;  2VPR A;  4LIU A;  1RI7 A;  2OU2 A;  3I55 I;  5FFX A;  3HUG B;  4G8X A;  2RQQ A;  4MIM A;  3JTH A;  2NVU B;  5JVT A;  2HEO A;  5M5Y J;  3AAF A;  3GBG A;  1CQT A;  3GFI A;  3QYB A;  1I27 A;  1U6G A;  4ZDL A;  2CFO A;  2FOW A;  2LD5 A;  3LSP A;  1AWC A;  3A02 A;  1LDD A;  1R23 A;  2P6T A;  2HVS A;  3DKW A;  1HC8 A;  2W24 A;  4YG2 F;  4BY1 J;  2XAQ A;  4EEF G;  3M1E A;  2XRL A;  2OC6 A;  4HQE A;  1T95 A;  2QBY A;  2O9L A;  1Y8R B;  1JT6 A;  2ZXI A;  3F8C A;  1UG2 A;  3PO2 J;  1ONV A;  5E79 C;  1T2K A;  2E2I J;  1B72 A;  2KP6 A;  1N75 A;  5C4X J;  2JT1 A;  3K7A J;  4C9Y A;  2LBF B;  3MN2 A;  3CCL I;  5J4Y A;  5LLQ A;  5FLV A;  3I56 I;  2WB1 A;  3CJQ B;  5FLX Z;  3P5J A;  3EYY A;  2VKE A;  4WXH A;  1Y39 A;  2PJR A;  1YTY A;  2XIG A;  4MGR A;  1GDT A;  3U1D A;  1A5J A;  1QQI A;  3WTW C;  1XTA A;  1IXS B;  4P55 A;  4IHX A;  3IAS 2;  4BDZ A;  3IRQ A;  4QTR A;  1Z7L A;  2E2H J;  1FBS A;  2VJI A;  3ELK A;  2CU7 A;  1YJW I;  1KU7 A;  3WTV C;  2Y2Z A;  3DBH B;  5FJ8 J;  4XMY A;  2A05 A;  2L0K A;  3IP4 B;  4FAS D;  1X2M A;  1YIO A;  3K1P A;  3RPQ A;  3H1C A;  1IUY A;  2ZME B;  4E7I A;  4JBA A;  3WE2 A;  2HGC A;  3VSL A;  1U9O A;  4IQ4 A;  1KU2 A;  2HS5 A;  5FFZ A;  4PJJ A;  3ZQF A;  3CQZ J;  3FXK A;  3K4N A;  5FKL A;  1IC8 A;  3JSP A;  2LH9 A;  2KIU A;  3CDH A;  2F5F A;  2PMZ N;  3HRS A;  4XLF A;  5DV5 A;  5EZH A;  3CJN A;  3UR3 C;  2R7R A;  3I58 A;  3J7A O;  2A6E F;  3J7A Y;  1WCM J;  4RA2 A;  1W4M A;  3FHN A;  3ECH A;  2ETH A;  3WTZ A;  1UCR A;  4E7L A;  4MFE A;  3R60 A;  3KPH A;  3SZG A;  3PL8 A;  3LSJ A;  4E7H A;  3BG6 A;  4AC0 A;  1R58 A;  3P9K A;  1K83 J;  4LK0 F;  4OWR B;  2X1E A;  3LFU A;  1KQ0 A;  1IN8 A;  4G7Z F;  4DGW B;  1HDP A;  3HUG A;  1G3Y A;  3S17 J;  2A6T A;  2TDX A;  5J3L A;  4AVZ A;  5DM7 F;  4RS8 A;  3HSR A;  2QSF X;  5EYR A;  3FHZ A;  3E1S A;  1DUX C;  4AM3 A;  2DA7 A;  1MMG A;  4M74 A;  2L3D A;  3EDP A;  3A1Y A;  3RTR A;  4LG0 B;  3FIW A;  3I53 A;  3WHC A;  1IW7 F;  2ZBK A;  1PDN C;  3DF8 A;  2EZK A;  3ZR8 X;  2CFX A;  1MSE C;  2YS9 A;  4RB1 A;  3FXJ A;  3PIO F;  1OLT A;  3S93 A;  3OR1 C;  3ROU A;  4PJL A;  1D1C A;  4F3Q A;  1XS9 A;  4A3C J;  1R36 A;  4GRI A;  3FXL A;  4JX5 A;  1TTY A;  3RDI A;  3AL0 C;  2IA0 A;  4F52 A;  2R7V A;  1E17 A;  4IRH A;  1G3W A;  1S6L A;  3MMY B;  2DFE A;  1GXQ A;  2ZSI B;  3LMM A;  1RZ4 A;  3PJR A;  4NUB A;  2IJL A;  5HOO A;  3QPH A;  2PEX A;  2GBY A;  3ML6 A;  5JLX A;  1ZRF A;  2E71 A;  1KQ9 A;  2G0E A;  1OQY A;  3TED A;  1V54 H;  5JI6 A;  2E36 A;  5E17 F;  3OWT A;  4UB8 C;  3G1M A;  4X1E A;  1SD6 A;  3ESW B;  1NH3 A;  3G1L A;  3CCE I;  3ZPL A;  3O2P E;  1WI9 A;  4F55 A;  2VLA A;  1QPI A;  5FGM A;  2DDB A;  2X1C A;  3RKQ A;  2KHM A;  2DFI A;  2GXG A;  3ZQH A;  1SFX A;  1MMD A;  2XKP A;  3TQN A;  5K1Y A;  4XOP A;  4R79 A;  2PJP A;  1R4M B;  3HSF A;  1S29 A;  2R7X A;  3RQI A;  3ZN0 A;  4X0G A;  3ISP A;  2VB6 A;  1BBY A;  1E3P A;  1R7J A;  1Y0U A;  4PUS A;  3KP2 A;  4EQQ A;  3WU1 B;  3OV8 A;  5JLW A;  3BG7 A;  5KCM A;  5EGO B;  2JVG A;  4BQA A;  3GXO A;  3KLO A;  3HL2 A;  2QGU A;  2ID3 A;  4UVC A;  3E5X A;  4BYY A;  3M8J A;  3JR9 A;  1YIJ I;  1FIA A;  2OV7 A;  2ESH A;  2VT3 A;  3HRU A;  2L7M P;  1V55 H;  2E5Z A;  3ULQ B;  1WWX A;  4XLE A;  1ZH5 A;  3JRG A;  5FRN A;  1HST A;  1LQ1 A;  4E7J A;  2OQG A;  1EJ9 A;  4HF2 A;  4A5N A;  2OA4 A;  3A0B C;  3CCV I;  5AIP A;  3K2Z A;  2ME6 A;  1S8N A;  2K5C A;  5H20 A;  2IW5 A;  5H2F C;  2M30 A;  2B7E A;  4HW0 A;  3V8K A;  2QA4 I;  2P5V A;  3FMQ A;  3BZK A;  5E3O A;  4IJA A;  5LD2 C;  1HKS A;  2RRE A;  1WJE A;  5K5R A;  3W2V A;  3MZ8 A;  1Z6R A;  4JOM A;  4LB5 A;  1AKH B;  2HPI A;  2JA6 J;  3DPL C;  3JAM Z;  2V6C A;  4JQF A;  4W1U A;  4PJ0 C;  3GME A;  3I4P A;  3GUD A;  5JFR A;  4FIS A;  4YFX F;  2M4G A;  1QHH D;  1T0F A;  1YS7 A;  2EZI A;  2VL8 A;  2LKX A;  5IT3 A;  5FKO A;  2GOM A;  2XAH A;  2XAS A;  4YFK F;  2M0C A;  1K7A A;  1WJB A;  3P9I A;  5FLX K;  4HPQ A;  5E8G A;  3Q0V A;  1QZE A;  4B3A A;  5D5W B;  4ENN A;  1JHH A;  4UV9 A;  4OIR F;  4A5M A;  1YRN A;  2VOD A;  4B47 A;  3BG5 A;  2CO5 A;  2WAQ A;  4HF0 A;  1JGG A;  2DYS H;  4BBS J;  4B09 A;  3LQR A;  3ABL H;  1AKH A;  1D8J A;  1Z67 A;  4XID A;  3O8G A;  3TO9 A;  4B8X A;  3A01 A;  2CV2 A;  2E60 A;  3GLL A;  1TQM A;  5CVV A;  2GXB A;  2M9H A;  3DPT A;  4OIN F;  1H9T A;  1FX7 A;  5B1A H;  1S3J A;  5HNH A;  1OYY A;  1O7L A;  1TNT A;  4NC8 A;  3WU0 A;  2O8X A;  5D6F A;  1IO2 A;  4XKC A;  1Z21 A;  1ETO A;  1FIP A;  1Y0N A;  4KN7 X;  4WWC A;  2EIK H;  4DZJ A;  4Y52 J;  3OYJ A;  2WC2 A;  4KIT B;  2ZJQ F;  3TDZ C;  1QO0 D;  5TJJ A;  4P9U A;  3NAU A;  3E3V A;  2VIX A;  1JKP C;  3QOP A;  3C18 A;  1B1B A;  2EFN A;  1D0X A;  2EIN H;  2CRG A;  5GP9 A;  3DLL F;  3OSF A;  3QYE A;  1UG0 A;  2YR2 A;  3OS0 A;  3EUH C;  3LSR A;  1X3Z B;  4AID A;  4ESJ A;  2DQL A;  2R92 J;  2EFW A;  3CUO A;  2LOO A;  3FKI J;  3U1K A;  2RV8 A;  1LFP A;  4N4N B;  3JRC A;  5KAI C;  1CF7 A;  2QSG X;  3IAM 2;  4R1H A;  1WJF A;  4EMS A;  2E35 A;  1MSF C;  3S8P A;  3S3O A;  1DP3 A;  3MKZ A;  2E1O A;  2L9V A;  4QSH A;  2R7T A;  5HNF A;  4XLC A;  1T39 A;  4IX7 A;  1REP C;  4KUM A;  3BR5 A;  3I59 B;  3DP7 A;  2XHK A;  3V8J A;  4S04 A;  2FBH A;  3CDI A;  4EJU A;  2R4G A;  3V7S A;  2XPV A;  2CQQ A;  4II3 A;  3RPU D;  3J7Z I;  1KA8 A;  1QA6 A;  2GOX B;  5E20 A;  1BW6 A;  1X58 A;  2W25 A;  1VF9 A;  5K5Q A;  1NTC A;  3M1C A;  4NC6 A;  4BEH B;  2QZ8 A;  3HOV J;  2G9W A;  4IVN A;  3VWB A;  2ZO4 A;  2IVM A;  2RDP A;  3HZJ A;  4L0Y B;  1PUE E;  3U9G A;  5HLG A;  1RUO A;  1BC7 C;  4BHP A;  4ZJZ A;  3TP0 A;  4MTD A;  3D5L A;  1HA8 A;  2LC2 A;  3LOC A;  3J80 Z;  4DW6 A;  1R9T J;  1ETX A;  3OYA A;  5IYB J;  1Z6T A;  4GCV A;  1HDD C;  1X3W B;  2WAE A;  3GFM A;  2UXX A;  4G7H F;  2K3F A;  3DXJ F;  1BN5 A;  4EV0 A;  1D1A A;  2I8D A;  1RR7 A;  1OFC X;  2L7Z A;  3BG3 A;  1DPU A;  2V1U A;  3PSI A;  3L2Q A;  1OMI A;  1F9N A;  4XNF A;  1U9N A;  1XCV A;  3FZV A;  5F27 A;  1Y8Q B;  4RB2 C;  1XC5 A;  5D6E A;  1JKR C;  2EPF A;  4IPA A;  3RPU A;  4G6T B;  2IS4 A;  3KYL A;  2AO9 A;  3V4G A;  1WJD A;  5F1J A;  4I6Z A;  3BJO A;  3TO7 A;  3L2R A;  1ZG1 A;  2LY9 A;  3JCU C;  5ILU A;  4XLH A;  4OU0 A;  1U5T A;  3SQN A;  1ZG5 A;  1TL8 A;  1RR8 C;  1SAX A;  4E70 A;  1YLF A;  2KT0 A;  4XR6 A;  2I10 A;  4EVI A;  1HKT A;  3LNQ A;  4A3M J;  1OYI A;  3LSH A;  5L3C A;  2CV1 A;  5DS9 A;  1ZTR A;  4I02 A;  4RGR A;  3SDG A;  4ZYE A;  1I3Q J;  3TO6 A;  4UV8 A;  4EGY A;  1VQ9 I;  2P7C B;  1POG A;  4V2F A;  4V19 K;  4UXN A;  3H92 A;  1XD7 A;  3BCA A;  3CP2 A;  4GXO A;  4QLC U;  5L3G A;  3S1Q J;  3HTU A;  4RLQ A;  2CQN A;  1LDJ A;  2BW3 A;  3K2A A;  3VB2 A;  4HDU A;  1GT0 C;  1R4N B;  4Y17 A;  5DEQ A;  4DBQ A;  1CF7 B;  2BOL A;  3PNY A;  2E5N A;  2ZNY A;  4ANJ A;  2NVQ J;  2DOF A;  1JE8 A;  4QPO A;  4M9X A;  3NWS A;  5E3N A;  3BR2 A;  1X1B A;  3WG7 H;  3CCM I;  3SXY A;  4L5I A;  1J75 A;  2STT A;  2VBW A;  1XPX A;  3PQJ A;  4KIF A;  2LK2 A;  3QU3 A;  4ZH4 F;  2XF7 A;  2DK5 A;  1H8A C;  2VQG A;  2X6X A;  4CHU A;  1VQ4 I;  4XN3 A;  4FHT A;  4XQF A;  5D5U B;  4WX9 A;  3CZ6 A;  1IN5 A;  3D5S C;  1ZK8 A;  2I5U A;  2K9L A;  2F5E A;  4FET A;  3FK7 A;  5D4R A;  2DJN A;  2JSP A;  2DTR A;  4BQN A;  2RAE A;  3HC7 A;  2NS8 A;  4N0B A;  2EA4 A;  4RM2 A;  4D1Q A;  2R7O A;  1Y1W J;  1IDZ A;  4II2 A;  4DNC A;  3VYS B;  4CCK A;  4BHB A;  5EDN A;  2HR3 A;  1WQ2 A;  4CYC A;  2DMN A;  3R0J A;  1T38 A;  1EH7 A;  2CQ7 A;  3DV8 A;  2K9N A;  3BTI A;  3S2H J;  3HTS B;  3LA3 A;  3VOD A;  2DYR H;  4Z6Y A;  1Z91 A;  4XLA A;  2CW7 A;  4I0A A;  3F8N A;  3QAH A;  1FOK A;  5FD6 A;  2BY3 A;  2BBY A;  2VKV A;  3C2H A;  3SFZ A;  4CCO A;  5K7H A;  1FP2 A;  3PM1 A;  3QYF A;  2H6B A;  1RKT A;  3C2B A;  1U5T C;  3KP6 A;  3V7R A;  2ZC2 A;  4CIC A;  2EJR A;  4NBQ A;  2RGV A;  2AQE A;  2E1N A;  2EZH A;  4WF2 A;  3N4M A;  2M45 A;  2K9Q A;  2YU3 A;  2HDC A;  4UHT A;  4ZYD A;  1XX5 A;  2JRM A;  3ASO H;  4CO8 A;  1T0F C;  4B48 A;  1YJN I;  2YU9 J;  2VXD A;  5IOZ A;  3RYR A;  3L00 A;  2O0Y A;  1IAW A;  1U2W A;  3SYT A;  3M7G A;  1FYL A;  3H3V K;  3LA7 A;  2DMQ A;  2A68 F;  2HPM A;  5B1B H;  2FSW A;  2WB1 N;  2A6H F;  3F8B A;  2HXI A;  3CCS I;  4IF4 A;  2AXL A;  1LE8 A;  1OR7 A;  5CQG A;  2QM3 A;  1I6X A;  3L2W A;  4GGG A;  4PCQ A;  3S32 A;  2NNY A;  3C3W A;  3QU6 A;  2LKS A;  2FEZ A;  2VI6 A;  3RKX A;  3OOU A;  1OYW A;  3WGG A;  4FE7 A;  4CCJ A;  2KMU A;  2Z99 A;  2JUG A;  3LQQ A;  5BS6 A;  3BC8 A;  2VBY A;  1U8R A;  2ELK A;  2H1L A;  1RPW A;  3ZQI A;  4FCY A;  2LVS A;  1QPM A;  2Y9Y A;  3EUH A;  5CVR A;  4C30 A;  5C4J J;  2ZME A;  3GWZ A;  5FD5 A;  3L7W A;  3LL7 A;  1IXR C;  3CP8 A;  5ERI A;  2X6Y A;  5DCF A;  1LVK A;  4HAM A;  3K4C A;  2V1N A;  4XRM A;  5LGU A;  1UZC A;  4C2T A;  2JPC A;  5ILS A;  1LE8 B;  1VQ6 I;  1R1U A;  1BIB A;  1T08 B;  2OUM A;  4I76 A;  2HQA A;  1SD7 A;  3VYR B;  2A07 F;  2F4O B;  2PMH A;  2IGO A;  2VOP A;  1B9M A;  1VQL I;  5BMZ A;  1VQN I;  2BHY A;  2HWV A;  1R5G A;  4A3E J;  1ZYR F;  4NQW A;  1J7K A;  2DDA A;  2QKM B;  2IGK A;  4DJA A;  4HLY A;  1K78 A;  3BLY A;  1O4X A;  3OYE A;  1KQ8 A;  1XDS A;  1IRX A;  3GEZ A;  2HVR A;  3DWL E;  3A01 B;  2NS0 A;  4OIO F;  1V5F A;  1O3S A;  1HXD A;  4IL6 C;  1MJB A;  1X19 A;  2X9D A;  4IRI A;  4PZJ A;  1UHM A;  1H9G A;  2ZCW A;  3QPT A;  3RQ4 A;  2DW4 A;  3HRT A;  4EJT A;  4IRG A;  3GVA A;  3S2W A;  1QNT A;  3D5R C;  1GHC A;  3F0C A;  3PO3 J;  2QLZ A;  2P0W A;  1D1B A;  4IHT A;  2DA6 A;  2X0L A;  1MMA A;  1FOX A;  1K78 B;  3BG9 A;  2V7F A;  4A3L J;  2Z16 A;  1ZLK A;  3BDD A;  1Y56 A;  4M3B A;  2PFB A;  2FA5 A;  3ECO A;  4XRS G;  2FBI A;  3K70 D;  3CO6 C;  4G6Q A;  1IG7 A;  3I4N J;  2E1M C;  3DQV C;  2HNH A;  3O8H A;  4XOT A;  1Y6I A;  3OYF A;  1K6Y A;  1GV5 A;  1MIJ A;  2DOD A;  3BZC A;  1BI3 A;  1Z3Y A;  2IA1 A;  4FX0 A;  3RCO A;  2Z33 A;  2O8K A;  2QEX I;  4CCN A;  3JRF A;  1IZ1 A;  4XLN F;  1NHA A;  2M8G X;  3ZQQ A;  2LNB A;  1W1W E;  3K4L A;  4I2O A;  3ZN1 A;  5J8F A;  1FZP B;  5HS7 A;  3OIO A;  4BAC A;  2ECB A;  4OMY A;  4A3I J;  3GLX A;  5D8L B;  4EM1 A;  1D8K A;  4KYW A;  3CUQ C;  2LYC A;  1W5C C;  4BEH A;  2VN2 A;  3BJ6 A;  4U7B A;  3BR1 A;  1U0J A;  2HYG D;  2PBI A;  1I1S A;  4ASN A;  5L3B A;  2BY2 A;  1ZLJ A;  1IV8 A;  5DD4 A;  2GWR A;  4YIF A;  4R8H A;  5HVQ C;  5FB2 A;  2HOA A;  1K4S A;  4IOA F;  5IP6 A;  5DUK A;  5LGN A;  1JXS A;  4BS9 A;  5LEJ A;  4LLN A;  4NQW B;  5A2Q Z;  2JA2 A;  3BTL A;  1ZGA A;  3HXL A;  1MKM A;  4L9N A;  5J8C A;  1CGP A;  1TP4 A;  1USS A;  4PFO A;  3HG9 A;  2CWE A;  3R0A A;  5DM6 F;  2Y0S N;  3S1M J;  2O3F A;  2HDD A;  4LIT A;  3CF2 A;  2VAS A;  5JHF A;  2DAO A;  2RKH A;  1QVT A;  1FYK A;  2MGQ A;  3K4J A;  4XOR A;  5M3M J;  2DA5 A;  2CSO A;  2EWN A;  1YG2 A;  4KT5 C;  2R5Y A;  4P5O A;  1LFU P;  4YIR X;  2D1H A;  3DBR B;  5IOY A;  3MD2 A;  1R71 A;  2CW8 A;  5IP7 J;  1TW3 A;  2KIS A;  2VON A;  1HW2 A;  3ERE D;  1PYV A;  3K4K A;  4RBO A;  2WWY A;  4I98 B;  4RGX A;  2O7O A;  4E7Z A;  2K4J A;  3U2R A;  2VE9 A;  3CMA I;  4A93 J;  1WJ5 A;  3OR2 C;  3CUQ B;  3BJA A;  4FX4 A;  1WPK A;  1DGW Y;  3X2Q H;  2FOK A;  2JJ7 A;  1OR7 C;  2MLG A;  3TOA A;  2W82 A;  4XLP F;  4M9S A;  4XK4 A;  1X1D A;  1YOV B;  3LSK A;  2VQC A;  4XKW A;  1B8I B;  4I0B A;  3FK6 A;  2IS6 A;  1XGS A;  1ETY A;  2DMP A;  1BI0 A;  3IKV A;  4N9I A;  2XRO A;  1Q1H A;  4Q5S F;  2QQA A;  1MGT A;  3N97 A;  2H1K A;  2MD0 A;  1DQU A;  1JTY A;  1ETV A;  4OIQ F;  2Z1D A;  2LTP A;  5K7Z A;  4LLG F;  2ME0 A;  1J59 A;  1BOA A;  3BR0 A;  2UUZ A;  2D45 A;  1GXP A;  2PJR B;  2EFP A;  4KNY A;  3M8E A;  2Q0O A;  2H8R A;  2VBX A;  1ZEL A;  4EGZ A;  4HG2 A;  2W57 A;  2NOG A;  1P4W A;  3CC7 I;  2KRC A;  1BI2 A;  3RYP A;  1VQK I;  4HF1 A;  3OYM A;  2WY8 Q;  1JUM A;  1UFM A;  2NYX A;  1OCZ H;  2RNJ A;  2XSD C;  2F4I A;  3BY6 A;  2CH0 A;  3LFK A;  3BWG A;  5GAH J;  2KIF A;  3K1M A;  1K79 A;  2P5K A;  5HDK A;  2KJC A;  1ZQ3 P;  4C3H J;  4O6J A;  2F48 A;  4KJZ A;  4Q47 A;  1ZHF A;  1LEA A;  3I5U A;  1JKQ C;  2AQF A;  2ZB9 A;  2Q8K A;  1BIA A;  1XSD A;  3T1B A;  2WAF A;  1BI1 A;  4ENJ A;  1L3L A;  3TBI A;  2M7B A;  3ZQG A;  1Z9C A;  1P7J A;  2HYF A;  3CO7 C;  3HSE A;  2QWW A;  5CQE A;  3WG9 A;  3AG2 H;  1FTZ A;  1G2H A;  5EZG A;  2X1D A;  3I71 A;  3IWF A;  1P9Q C;  2Y69 H;  2HYJ A;  2XGC A;  2F2E A;  4U87 A;  5M5X J;  2COB A;  1LNW A;  3ZMZ A;  4RB3 C;  2A61 A;  3F22 A;  2EBI A;  3JW4 A;  5KAF C;  3TMO A;  3ZMU A;  3GF2 A;  2JTV A;  2KQR A;  2V9P A;  3E6D A;  1YJ9 I;  3BTJ A;  5IT9 Z;  2KRH A;  2TCT A;  2V9K A;  4G12 A;  4JK1 X;  1JGS A;  1YYV A;  2VUM J;  3FBN B;  1LVA A;  9ANT A;  2CUF A;  3DTK A;  3WTS C;  2BHZ A;  4ZZL A;  3H9Q A;  3OIP A;  4HYE A;  4UUS B;  5DUI A;  5IP9 J;  1D5V A;  1F43 A;  3KE2 A;  4V2G A;  2F5C A;  3R6S A;  4A3B J;  4K2E A;  4LFU A;  1JUP A;  3KP7 A;  1BOB A;  4W97 A;  3TDU C;  1KON A;  2MC4 A;  3G1O A;  5FRM A;  4B43 A;  4EJV A;  3IKT A;  2DFH A;  1X3U A;  4CGZ A;  1YW7 A;  4CCM A;  1Z7U A;  2PX9 A;  2X6W A;  3I54 A;  2A3S A;  1YIT I;  4ZDO A;  2H8W A;  4RAG A;  1IV6 A;  4F93 B;  1UEL B;  2F4M B;  1MJ9 A;  1HKQ A;  4FT8 A;  2QQ8 A;  2GIV A;  4L0Z B;  2R93 J;  4M71 A;  1QU3 A;  4EJW A;  3FXM A;  2MAB A;  5DD8 A;  3GZ5 A;  4RDU A;  4MTE A;  3BR6 A;  4LMY A;  3G2B A;  1EA3 A;  5DDG A;  3ZQL A;  3OY9 A;  2QUF A;  5ILV A;  5AON A;  1A35 A;  5JVG F;  1X1A A;  2DK8 A;  2BVL A;  4BJT A;  2Y0S A;  5TRD A;  3F6O A;  2HDW A;  2R7Q A;  3ABU A;  2Y30 A;  5CLS A;  2YX7 A;  2LRD A;  2GAU A;  4IHW A;  3MKW B;  1H89 C;  1FT9 A;  3AL0 B;  1I6H J;  1TNS A;  1Z77 A;  2EQR A;  4RAF A;  1ETQ A;  4N4O B;  2LP0 A;  2NVX J;  2F5V A;  1BJZ A;  1WHU A;  2G7H A;  4ON0 A;  2Z5U A;  5EG0 A;  1R00 A;  1QRY A;  3FF5 A;  2QQB A;  1G59 A;  4ETS A;  1EF4 A;  3WTX C;  3B02 A;  5ICF A;  5EEA A;  4RM3 A;  3SHF A;  1A36 A;  2A5W A;  4OMZ A;  3L09 A;  2KKO A;  2V4J C;  1WH5 A;  2RN7 A;  2M5W A;  3MVP A;  5EJC A;  5LFA A;  1PUF A;  2HOE A;  4HNU A;  2VKD A;  1ETW A;  2ELH A;  2FX0 A;  2XB5 A;  4AYB A;  4HNT A;  1FOY A;  1RES A;  2WBM A;  4EM0 B;  2J5P A;  3ABM H;  3QP5 A;  3KYC B;  1LB2 A;  3EQL F;  4F92 B;  4CDG A;  2ISZ A;  3FXO A;  3CLQ A;  3CCY A;  4L5J A;  1X1C A;  1K6O A;  3M9A A;  1G8X A;  4F91 B;  2R5Z B;  4ZYG A;  1JJ6 C;  4F7Z A;  3FM5 A;  5FLM J;  1D0Z A;  3W6K B;  3CJR B;  4PGH A;  5E18 F;  4HOB A;  3GTJ J;  1UHW A;  2HI3 A;  2PN6 A;  5J6X A;  2K9S A;  4HRI A;  2W85 A;  4C3I J;  1VQM I;  3DU5 A;  4ZTJ A;  2PQ8 A;  4BE0 A;  1TZL A;  2DA2 A;  3CC2 I;  1YX5 A;  5F6F A;  1PP8 F;  1QVU A;  3T8R A;  4B3X A;  1X4P A;  1HW5 A;  4IHS A;  2K40 A;  1WH7 A;  2HQN A;  3T0Y A;  4UUV A;  3B6A A;  1YO5 C;  4HST A;  4KIC A;  2IRF G;  1YRN B;  4DYC A;  3OYC A;  2Z3Y A;  2R5Z A;  5HDG A;  4BDY A;  5F0H A;  1IRG A;  3DCF A;  2LDU A;  1LDK B;  2DJI A;  3L9F A;  3WGH A;  1SD5 A;  1WKM A;  4MLO A;  3SZT A;  1SFU A;  2E1M B;  3A03 A;  1X1P A;  2LF7 A;  1H88 C;  4BH9 A;  2VT2 A;  1TWC J;  5GPC A;  2JZY A;  4H4K C;  1IDY A;  2IAI A;  3MKL A;  3HEF A;  1XDU A;  2Q1Z B;  3FXU A;  1APL C;  3BTC A;  1M1E B;  3WTY C;  2ZME C;  5E3M A;  3DKY A;  1F36 A;  4RLF A;  2ZSH B;  3ABK H;  1WSU A;  1MH4 A;  2MD5 A;  3NRV A;  3BCB A;  1LKX A;  3M07 A;  4U0V A;  2DXI A;  3I4M J;  3H3Z A;  2VQH A;  1KYZ A;  2DBB A;  1O3Q A;  3TW7 A;  1UJ8 A;  5HLT A;  3CLO A;  3DKX A;  3VSK A;  1J9I A;  4H0E A;  2RVC A;  4HV6 A;  5DCM A;  2QKL B;  5FKN A;  4MQ9 F;  3S3N A;  2K86 A;  4XSX F;  1BL0 A;  2KL4 A;  2MH2 A;  4HSR A;  3AG4 H;  2ZXH A;  4UUT A;  5ICE A;  1GVD A;  3WU2 C;  1OPC A;  2OJE D;  3QOD A;  1UB9 A;  1S5L C;  2C6Y A;  4RGU A;  1PUF B;  1XMX A;  1IN4 A;  2KIM A;  2HXO A;  4XKV A;  2L54 A;  3M4O J;  4U88 A;  2MFZ A;  2NAZ A;  4S0H B;  3DLA A;  2XF5 A;  1SD4 A;  4P96 A;  4JX6 A;  2HU9 A;  3H0G J;  1ENH A;  2EV5 A;  2HFH A;  3I59 A;  1AU7 A;  2ZFW A;  3F72 A;  1XMA A;  3JRI A;  4L9J A;  2DLL A;  3PUB A;  5CPR B;  5L3F A;  2XAG A;  2HKX A;  4NDL A;  3TW6 A;  2LY1 A;  4C2M J;  1QBJ A;  3AG3 H;  3HDD A;  3ASN H;  2MBF A;  4LJZ F;  2EZL A;  5BOX A;  1A6Q A;  4MEX F;  2EIL H;  1T6S A;  3F8M A;  4WCG A;  3GTQ J;  2ZXW H;  4QPQ A;  4LOC A;  3KX2 A;  6PAX A;  2FBK A;  3DPU A;  2HZD A;  2XF6 A;  4ABZ A;  3KP5 A;  1TT0 A;  2FQ4 A;  3CCU I;  2Z2S B;  3LWF A;  1J2X A;  5J40 A;  1Z3X A;  4ESF A;  3PFY A;  2OQR A;  4HX4 A;  3H35 A;  2E19 A;  1RNL A;  3FMS A;  4CZC A;  3DU6 A;  5F04 A;  2DFF A;  1VND A;  4Z2Y A;  1MDM B;  5CVJ A;  1JTX A;  2IP2 A;  1G4D A;  3CF5 F;  1MBF A;  2P81 A;  3PFI A;  5F1R A;  4BHC A;  3H0D A;  2DT5 A;  4A0X A;  3OSG A;  1EKE A;  1G3S A;  2ZJR F;  2ACJ A;  2RC4 A;  1PP7 U;  2FNA A;  1TWF J;  4BJ5 C;  4YRV A;  3KP4 A;  3S1N J;  1LEB A;  1V5E A;  1XGN A;  3OYG A;  2L5Q A;  3L2C A;  3I64 A;  3G73 A;  1MBK A;  1IRF A;  1WJC A;  2EFQ A;  5ICG A;  3CCJ I;  3E7L A;  5D5X B;  2BEO A;  2OAZ A;  5K7F A;  2ICW G;  5EEG A;  2DA1 A;  3K69 A;  1WRJ A;  4P1W A;  3K4M A;  5CYV A;  1LJ9 A;  2BY1 A;  3F21 A;  1NK2 P;  3GFJ A;  4PFP A;  3RIR A;  2AXT C;  3HJE A;  2OZ6 A;  3HHG A;  2UV1 A;  2OTJ I;  1YW9 A;  4XL9 A;  2WTE A;  4B1R A;  3WHB A;  2KIQ A;  1W36 C;  1IXC A;  1U5T B;  1F1Z A;  2CW0 F;  4CSW A;  2K27 A;  1U8B A;  1XGM A;  3BT9 A;  2KLO A;  1V4R A;  2Y75 A;  3IV5 A;  3BOQ A;  3DEW A;  2ECC A;  5GAD J;  1S9H A;  4BXX J;  5FO5 A;  4KFC A;  4RB0 A;  2H27 A;  1OCT C;  3S3M A;  3CME I;  2IBD A;  4YFN F;  2L7K A;  3ZP5 A;  2KDO A;  3V42 A;  1O57 A;  4Q48 A;  4WXD A;  5IY5 H;  2XB0 X;  1B4A A;  2PMU A;  2Y31 A;  3HOX J;  1ZKG A;  3HB9 A;  4LIV A;  1HLV A;  4TV7 A;  2XAF A;  1TWG J;  1W0T A;  2Y0M A;  2JA5 J;  1I5Z A;  2BE5 F;  3AFH A;  4Y15 A;  4Q4Z F;  4AIH A;  4LG3 A;  3TGN A;  4HQM A;  4M3D A;  4XRS A;  1D3Y A;  4ZTF A;  3RKW A;  5E1W A;  2OTL I;  2JA7 J;  2JWT A;  3HIF A;  2HTJ A;  1E2X A;  1C0W A;  2JK3 A;  3FM3 A;  2EFO A;  2QYO A;  1F4K A;  1MD0 A;  3KZZ A;  1ITY A;  3HOY J;  3B6C A;  2M4K A;  3H9G A;  4BJ6 C;  2DCE A;  1HF0 A;  1DDN A;  3OL4 A;  1YS6 A;  3KEY A;  4XSZ F;  2LRE A;  4LG0 A;  5D8K B;  2NVY J;  2BYV E;  1WGX A;  5GTH C;  2P8T A;  2PI0 A;  5J4V A;  3JRD A;  3GX4 X;  2BZT A;  3HM5 A;  1DU6 A;  3ZXS A;  5LHH A;  1TT5 B;  3IHU A;  2M34 A;  4B44 A;  5EF6 A;  4GFB A;  1UST A;  1X4O A;  4BKX A;  1PVE A;  4CCL A;  4IQJ A;  4HA8 A;  1E3H A;  3HBL A;  5F64 A;  3VPR A;  2L4A A;  5EG0 B;  3C2G A;  3WE3 A;  3ZRG A;  5B5E C;  1SEU A;  3KZY A;  3H3U A;  3KYD B;  1W7P D;  3U21 A;  1K61 A;  2GA2 A;  4G6D A;  4XN0 A;  5D4S A;  3I9V 2;  1TW2 A;  1XMK A;  3SEQ A;  1H0M A;  1OJL A;  5DYM A;  2OCE A;  2AHQ A;  4LGW A;  4PK4 A;  2WY7 Q;  3JTG A;  3WGI A;  2PLY A;  3ZOB A;  1IGN A;  4NB5 A;  2COM A;  3K6G A;  1MBG A;  3J80 K;  2JMW A;  1EV7 A;  4IO9 F;  3JRH A;  4A12 A;  4I01 A;  2DPU A;  2NXN B;  4CZZ A;  4D5F A;  4DZP A;  5HS8 A;  3UNG C;  3W2A A;  1MJA A;  4PSW A;  4IKF A;  1E0E A;  4OAZ A;  2ELJ A;  2HVQ A;  3AKZ A;  1ERD A;  2LMD A;  3LST A;  1ON1 A;  2L01 A;  2QQ9 A;  3E6M A;  3SZP A;  1SVL A;  2R3S A;  3ABT A;  3Q0W A;  1WVR A;  3SJM A;  3CDL A;  4BXU A;  4BAY A;  1L0O C;  2AS5 F;  5LBQ A;  2A69 F;  3IUO A;  5KVR A;  5LEK A;  2BXY A;  3FX3 A;  2G7U A;  3DBL B;  5A2Q K;  2W00 A;  2VXZ A;  5IPA A;  4I09 A;  3GW2 A;  2B9S A;  1OCC H;  3GTM J;  2CS3 A;  1YE9 A;  5LHI A;  1W7P A;  3K1N A;  1XG1 A;  1G3T A;  1MNE A;  2BGC A;  3LAJ A;  1I3A A;  3PNT A;  1VTN C;  3P9C A;  4JP0 A;  1JKO C;  1SVM A;  2MC3 A;  3H5A A;  4NC7 A;  1ZGJ A;  4ZYH A;  1SFE A;  2XGX A;  3OOP A;  4NNJ A;  1S7A A;  3CD6 I;  1W0U A;  4HBL A;  4ZYA A;  4C3J J;  4XM3 A;  4IZZ A;  3MCZ A;  1VI0 A;  3HKZ N;  4O3M A;  3N05 A;  1MBE A;  2M87 A;  2OPT A;  3GTL J;  2ZJ2 A;  4I7H A;  1Q1V A;  4UY8 I;  3KET A;  1A04 A;  1FLI A;  3GTP J;  1P7I A;  1XN7 A;  4E6K G;  3CMM A;  2KZV A;  1O7F A;  2DMT A;  4YEJ A;  2M8E A;  3OL3 A;  1SMT A;  1IN6 A;  1V5G A;  3D0S A;  2A5Y B;  1OCP A;  2L4M A;  2O6G E;  1I39 A;  3FMR A;  2GA1 A;  4U0W A;  2MLK A;  3RZD J;  2P4W A;  2KJB A;  2VQL A;  3GZN B;  2WAD A;  3CJT B;  2OBP A;  3BQY A;  3FIS A;  3LSM A;  5LRR A;  2HZT A;  3LAP A;  3IH3 A;  3R4K A;  4AUX A;  3S15 J;  5FRO A;  2K85 A;  1BJA A;  4AD9 A;  1DU0 A;  1MBH A;  2ADU A;  3NWT A;  2HOS A;  3VEP A;  2O03 A;  1RIO H;  3J81 Z;  2M7A A;  1GV2 A;  2HQ5 A;  2R7D A;  3H5N A;  3EET A; 
#chains in the Genus database with same CATH homology
 2DYS H;  3ASN H;  5B3S H;  2EIK H;  3X2Q H;  1V55 H;  3ABL H;  2EIL H;  3ASO H;  2EIM H;  2EIJ H;  2DYR H;  2ZXW H;  2EIN H;  1OCC H;  3ABM H;  5B1A H;  3AG2 H;  1V54 H;  1OCR H;  1OCZ H;  2OCC H;  3AG1 H;  2Y69 H;  3AG4 H;  5B1B H;  1OCO H;  5IY5 H;  3WG7 H;  3ABK H;  3AG3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...