1OCOH

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1ocoH00
1V54H 5B3SH 3WG7H 3X2QH 5IY5H 3ABMH 1OCCH 2OCCH 2EIMH 3ASNH 2EIJH 3ASOH 2DYSH 3AG3H 3AG2H 3AG1H 2EIKH 1V55H 2DYRH 2EILH 1OCZH 2ZXWH 1OCRH 3ABKH 3AG4H 5B1AH 3ABLH 5B1BH 2Y69H 2EINH 1OCOH
chains in the Genus database with same CATH superfamily
2E34A 2DXIA 2M34A 2BOLA 2LY1A 1VQ8I 2EJRA 1WI3A 3Q0VA 3TO6A 2W84A 3HXLA 1YS7A 3LFKA 5TJJA 5KK1A 1A31A 3F3XA 4JOMA 2ZXJA 4B48A 4UY8I 3JRGA 4NUBA 3DFGA 3SDBA 1T33A 2EK5A 3KZYA 3K1MA 3BQYA 1IV6A 4GGGA 3EUKL 4IHVA 2HXIA 3NQOA 2NS8A 2CUEA 2K9SA 2JA7J 4LG0A 2F4MB 1XG1A 3D5SC 3CCVI 1ZN2A 2O9LA 2BY3A 2Y31A 4DBQA 5LHGA 1ULYA 4YELA 4L0ZB 5HLHA 3RDIA 4M6XA 3BG6A 2OD5A 1ONVA 4RAGA 4XQFA 1KGSA 3MFKA 4BJTA 2GXAA 1TP4A 3FXQA 2QENA 3I4NJ 2VXDA 1IN6A 3LA3A 2NOJB 1O7FA 4HX7A 3B6AA 1Y56A 4OIPF 2LBFB 5J1UA 3PNYA 2ID3A 3BOQA 3H9GA 5HLIA 3U9GA 4IEJA 2DDAA 3V4GA 5M5WJ 1HF0A 2FMYA 2HDWA 1BR4A 2JRTA 4GDFA 2YUSA 3I55I 4CZZA 4IHTA 3Q0UA 1IDZA 4HA8A 5K7ZA 5LLQA 2BE5F 4BNCA 2RNGA 3GFIA 2VE9A 4FX4A 2KZVA 5FD5A 3BR1A 2W1OA 2JSCA 3RYRA 4UVBA 2AQFA 3K70D 3BT9A 3KFWX 3R0JA 4I0AA 3ECOA 2V6CA 3L2CA 1VZ0A 3JRIA 2X0LA 3JRDA 2O03A 2FX0A 1TW3A 3PSFA 4M3BA 3OS2A 5E1ZB 5E20A 2E1CA 3A01A 1V4RA 3WTSC 4OAYA 3VDXA 4AIJA 3GX4X 1MIJA 4Y4RA 1MNMC 3ML6A 4IZZA 4BBRJ 2ELJA 3I5UA 3H3ZA 1JKRC 1GHCA 3F8FA 3VYUB 3ZMTA 4AU7A 1ZAOA 1G2HA 4EATA 3QOPA 2GXGA 1WI9A 1WZ2A 3HOTA 1YOVB 2Y9ZA 4KFCA 4HNVA 4IXAA 2OAZA 4C9YA 5HLTA 1IN4A 2XPVA 2HZDA 5EF6A 2DLLA 1FJLA 2CUJA 1EJ9A 2BXZA 1ZR2A 4A3KJ 3IKTA 5CQGA 3W2WA 3DXJF 4F3QA 3BWGA 5CVVA 4FT8A 3M8FA 4NQWA 5F64A 4XRSG 3L2WA 1W5SA 4N4NB 2EFWA 3TDZC 3OYKA 3B6CA 4QLCU 5EJCA 4BBSJ 3SZTA 3A02A 3GTMJ 5HDKA 1R71A 4N0BA 4OIQF 2XPWA 3BZ6A 4ZYHA 5J1RA 1L3LA 2GIVA 4KDPA 3HOWJ 5FFZA 3FX3A 3M07A 3LSTA 4O6JA 2CFXA 2FSWA 3CF2A 1YJ9I 1FBSA 3FK6A 3MEXA 3QYBA 4NB5A 1PVEA 2CQ7A 1MJ9A 2AO9A 3SFZA 3JTGA 4UVAA 4BHCA 2X9DA 2E60A 2HR3A 3BROA 5D8KB 4BDZA 1SAXA 1FYLA 4IRIA 4MTDA 3F6OA 2M0CA 3I59A 1JUMA 3TMOA 2MBFA 3ABKH 1F43A 1YIOA 4HW0A 1ZRDA 2DT5A 3H35A 3LSPA 2FA5A 4M9SA 3AKZA 2FQ4A 2HOEA 2E5NA 1S7AA 4UXNA 1JUSA 1Y1VJ 2PMUA 3GF2A 1OR7C 2K7LA 3A4CA 4RGUA 2FNPA 2OUMA 1KYWA 2VOPA 1V5FA 4B8XA 2IS4A 1EV7A 1PJRA 2DOEA 2G7UA 3CCSI 4HF2A 1FP1D 1IXRC 4KT6A 2DMNA 4OIOF 3CQZJ 9ANTA 5A2QK 3LAJA 2EV0A 1U78A 2XASA 2EV5A 1ACIA 2XKPA 1FTZA 3CUQA 4LIVA 3ULQB 1J75A 4BEHA 3EUHA 2RGVA 3FK7A 2WWYA 1HOMA 4NHJA 3GVAA 5ICFA 3QWLA 4LGWA 4GYIA 3LWFA 3R6SA 4ESJA 3JSPA 4IVNA 4HLXA 2C6YA 1R22A 4BJ6C 1VF9A 3GFJA 4BQQA 2CUFA 2P0WA 1QA6A 3G6EI 4JK1X 5EEHA 1B8IA 3WE3A 2A69F 5FLXZ 2ZB9A 3CCQI 3K2AA 3VYSB 5E18F 1Y8RB 4RM3A 4XOTA 3LNQA 1W5TA 2GA1A 3OYHA 2X4HA 5KNLA 4CSWA 2L02A 3CJTB 4YRVA 2VE8A 1ON1A 2DA6A 2Y69H 5D5UB 3FXRA 3LSKA 4KYWA 2VQLA 4AUXA 4KNYA 4XKWA 1YE9A 4FE7A 4HX8A 2L7MP 5CPRB 2JPCA 1R23A 2AHQA 3BJOA 4M3EA 1R1VA 1VTNC 2O6GE 3C18A 1A6IA 5HNFA 2E36A 3FZVA 1BBYA 2HWVA 2XDVA 4GO1A 1FIPA 3H5RA 2BXYA 2I10A 2DTRA 2ZXWH 4CHUA 2VASA 1WJCA 3HIFA 2IS2A 5FFXA 2NNNA 4B44A 5TGTA 3EPZA 2VJJA 1T98A 4IOCF 4DBRA 3OYBA 2FE3A 1MNDA 3M8EA 2CQXA 1B72B 1X4OA 1E0EA 3QPSA 5K5RA 1OMIA 2BZTA 5EZGA 5D4SA 2LNBA 4UB8C 3I64A 3CP8A 2XIGA 3BPVA 4HOBA 1BL0A 2RDPA 2FJ1A 2VKDA 1O57A 4BKXA 3L2UA 3ZQGA 1JI8A 4LJZF 5FKNA 3I0TA 4QPQA 4BE2A 4YIIA 1CGPA 2TRTA 5D8LB 3WTWC 4BHPA 3HRMA 5F08A 4AC0A 2VODA 3A03A 3S1NJ 2YX7A 1FSHA 5GPAA 3PL8A 2B9SA 5LGNA 1H8AC 2NS7A 2JT1A 2LDUA 4UHTA 4G94A 4PSXA 2EZIA 2GM4A 1ZLJA 4ZTJA 3H9QA 4YFKF 3WGHA 2PBIA 1DU6A 1JHHA 4PJJA 4XR6A 3PUBA 2M7AA 3LL7A 3FWEA 5AIQA 1H88C 2K86A 1Z05A 1ITYA 4HF0A 1OLTA 2BY1A 2LREA 4ZYEA 1WSUA 4F91B 1O3RA 3TP3A 1PDNC 2VJ5A 4FETA 4N4OB 1Z91A 4MFEA 3UR3C 1ZQ3P 3DV8A 1PUEE 2P6TA 3OYGA 4AIHA 1BIBA 3BR2A 2QKMB 2EFOA 3AG3H 1ZRFA 1I6XA 2LBFA 3ZN1A 1D0ZA 2W00A 2DFEA 1IUFA 1E2XA 1J09A 4Y15A 2BEOA 2Y0SA 4AYBA 2KIUA 2EA4A 5L3EA 4WX9A 2K40A 4JX5A 3E3VA 2CUZA 3FXJA 4KMUX 3IL2A 3V7CA 4Q48A 5D5VB 4LG0B 1X19A 3A0BC 3KLNA 4PJLA 1HXDA 1QZYA 3OR2C 4BL0B 4CCJA 1YTYA 4NNJA 2NVQJ 1ZH5A 4LMYA 2W7NA 4F52A 4K2EA 1UZCA 3PIOF 3QPLA 1FOKA 1MJBA 1XPXA 1IUYA 1XX5A 2EH3A 4HYEA 3GTKJ 1GXPA 1ZG3A 3A2KA 1TBXA 1G8XA 3BJAA 3BTJA 4WK8F 4DZPA 1EH6A 4KIGA 3H36A 3M1EA 2VBWA 2DN0A 3WTUC 3FXMA 3BTIA 4A5NA 3MCZA 3BJ6A 5ILUA 2RAEA 3U1DA 3E6DA 1BC8C 2F5CA 2E1NA 3T5XA 1VNDA 1OYWA 2FNAA 3SEQA 2NRAC 3RPQA 3JR9A 4B47A 2KIMA 2QVOA 3ZOBA 1YS6A 5FGMA 3ZQ7A 1OFCX 2KIQA 1EH8A 2HU9A 4MEXF 4IRHA 1YO5C 5JVTA 1QNTA 2OCEA 4HEA2 2W25A 3DP7A 3KP6A 4TV7A 3R0AA 2HYJA 1KONA 1MJAA 2M0MA 2PJPA 2W48A 3WU2C 1FBUA 4AVPA 4KICA 2X51A 1Z21A 1LNWA 3FKJA 3F21A 4N9IA 3CO7C 2A5WA 2QWWA 2XF7A 2EFPA 4LLLA 1IJWC 1D1BA 3A01B 4B4CA 1LDDA 3E6MA 3Q0WA 3S3NA 2IRFG 2B7EA 2OTLI 5CQEA 3CDLA 4M9XA 2XAFA 5HDNA 2FD5A 3ELKA 1WJBA 3C2HA 3F8MA 2H6CA 3ECHA 1IC8A 1ZR4A 4L5IA 1JT0A 4M3GA 1QVTA 2EZHA 1HDPA 2WV0A 2Z2SB 1FBQA 4E7HA 1K4TA 1P6RA 4U0VA 5DV5A 1QZEA 3G1LA 2E7XA 2DDBA 4FX0A 3UNGC 1O3SA 4A2UA 2HQRA 4RAFA 1VI0A 2DQLA 2IA1A 2MH9A 1IZ1A 2OPTA 3HEFA 4NQWB 3OYCA 5K1YA 5ICEA 3OIQA 3DBHB 2TDXA 1BI2A 1JJ6C 4KJZA 3RCOA 3EUAA 3RIRA 1A36A 2RQPA 2V9VA 3HG9A 2DI3A 2M8GX 2BVMA 3P7NA 5H6QA 2JN6A 2OZUA 5AIPA 2DYSH 1MKMA 2FEZA 1X1PA 3JSOA 4J00A 2HVRA 1HW2A 1QBJA 1XSXA 1XD7A 1ZLKA 3CP2A 2EILH 2PEXA 1VQ9I 1ETYA 5K5OA 4I6ZA 4BXFA 5JLWA 1RI7A 2QQBA 1DQUA 4OIRF 1S72I 1OYIA 2R5YA 3RZOJ 3I59B 1XDUA 2K85A 2GIZA 5KAIC 3GZNB 4EM2A 3WU1B 4AWXB 1MMGA 3A0HC 2CU7A 1T39A 1G3TA 1V5GA 2NYXA 5IT9K 3KEQA 3Q3SA 1G3WA 4Y52J 1Z77A 2PG4A 4YFXF 2DK5A 1TQIA 4IQJA 3AG2H 1HLVA 4WXHA 5HVQC 4WXCA 3CCUI 1AHDP 3LSRA 1H89C 3ZQLA 1FP2A 1S8NA 3WTVC 4RDUA 1LE8B 2LKPA 2R7OA 1WJEA 4MQ9F 2E2IJ 3VSKA 4EVIA 4WWCA 1RNLA 1IN8A 3S93A 3VSLA 3KX2A 3HRTA 1Y1WJ 3IC7A 4UV9A 5K7FA 3CUQB 4A6EA 5LEJA 5FKMA 1GT0C 4ZYGA 3MAJA 2V1UA 3HSRA 5HS7A 2MABA 3AL0B 2L54A 1X58A 2DFIA 1R58A 2ZC2A 4HAMA 2NAZA 2K27A 3S2HJ 4JX4A 4XRSA 5F04A 1Z67A 3BG7A 3FDYA 1F5TA 1ZGJA 3C7JA 1ZK8A 3BCAA 3V7SA 4CYDA 4XIDA 1B8IB 4HSTA 1OPCA 2MC3A 1VQ4I 2IVMA 3MVPA 2R7WA 3WGGA 5B1BH 4RMNA 2D1VA 3JCUC 1IGNA 3E6CC 3MWMA 1R49A 3IH3A 3W2VA 3ZMZA 4HRIA 5F1RA 5IPAA 3MD2A 2K5CA 3CUQC 1VQMI 1XCVA 5EGOB 3OL3A 3EUHC 5J47A 1T8IA 4XLFA 3AL0C 2IEKA 4ZH4F 4DIQA 4QPOA 1X1DA 3OS1A 1XGMA 3TW6A 4LD5A 1HKTA 1YRNA 4ASNA 2IPQX 4CCMA 1BN5A 2FBIA 3WTYC 3C2BA 3ZPLA 1IRFA 2HTSA 1BJAA 2NNYA 1SFOJ 2ELHA 1FOYA 5BPDA 3EQLF 2P6SA 3RKYA 2M1BA 4LLNA 3LSGA 2E1OA 3CDHA 1P9QC 1IRZA 1D0YA 2X1EA 2P7VB 3IHUA 4II3A 2IW5A 2A61A 5DM7F 3G4SI 2LG4A 2CH0A 2NVXJ 2VJIA 4L5JA 1RKTA 3HPGA 1WJ5A 4N9HA 1TTYA 2E2HJ 3OYLA 3FMQA 3KCCA 2KLOA 3K4LA 3R61A 5E3NA 4R79A 2EIKH 3N97A 3SHFA 3JRHA 2WTEA 3MZHA 5F0HA 4QIWN 3H3VK 4PSWA 5ILVA 4JP0A 2PI0A 4G6DA 3P5JA 5KHDA 3I71A 4G6QA 2YSRA 5DD8A 3K7AJ 3FXLA 2WY8Q 1K78A 2ECBA 4ESFA 4ENMA 3ZMUA 1KYZA 2J5OA 2VC1A 2DAOA 2ZBKA 3CCYA 3K0LA 2R7VA 1BI0A 2MFZA 2X6WA 1B4AA 3CJQB 4C3JJ 3KP4A 3FM5A 2OF7A 3E6BA 2O7OA 3F8CA 5C3EJ 2AXLA 5HDGA 4FISA 3TGNA 5J1YA 3DF8A 1GLNA 4I0BA 3S1QJ 2L0KA 4BJ5C 2VKHA 3V7RA 2HQAA 3M8JA 1DU0A 2QUFA 1B9MA 1T0FA 3ABMH 1RIOH 1XN7A 3TBIA 1STZA 3ASNH 2FF4A 1JTXA 4JQFA 4ZDPA 3BR3A 1UAAA 4XLPF 3RPUD 2H27A 3GEZA 2ZNZA 1OISA 2K9NA 3EYIA 1SANA 2R7FA 4A5MA 4A3LJ 3H5AA 3KYDB 3RSNA 4HDUA 3IUOA 5LD2C 1FZPB 4JBAA 2XHKA 3BTLA 4BY7J 4PJNA 1IW7F 1G3SA 2ACJA 1A35A 2BVLA 4A6DA 4E7JA 1X3UA 3PO3J 2JA8J 1TT5B 2KP6A 4L9TA 1I3AA 1R5GA 2XB0X 3HUGB 5C4JJ 3OYIA 4L9JA 3J7AY 2MW8A 2FU4A 4Y33A 1Y0NA 2JA2A 4XLNF 5IP9J 4JYKA 2DMTA 3MKZA 3HOZJ 3J80K 3GFLA 1KU9A 3OYAA 2VT2A 4RLQA 1HBXG 1XSVA 3CF5F 5FLMJ 3F22A 2JMWA 4WCGA 2GZWA 2R4GA 1FTTA 4XSXF 4RAZA 1P92A 1IG7A 3NWSA 3SDGA 2QGUA 3VPRA 4U7DA 4KUMA 2H94A 3H0DA 4XLHA 3AG4H 4RA2A 3SFIA 5M5XJ 3W3CA 1NH3A 2TCTA 4W97A 5FKOA 3Q9SA 3HOXJ 4HSRA 4Q5SF 1ZGWA 3EYYA 1A5JA 1Q1HA 1WJFA 4XSZF 3DLLF 2L9SA 3ERED 2D1HA 1JGSA 2V26A 3C2GA 3GUDA 4ZJZA 1IO2A 3HYIA 3K4JA 5D5WB 2A05A 4DNCA 2L4MA 2NVTJ 4FQGA 1JKOC 1AOYA 2XGEA 2FBKA 5JVGF 2ESNA 5J8CA 1CF7B 1W1WE 2ZCWA 2OU2A 2HPMA 1MSFC 3CTAA 5DCFA 1POGA 4GFBA 1V5EA 2VBZA 1ZREA 3FMSA 4EJTA 3RTRA 4X0GA 2V79A 1T38A 1MZBA 1QRYA 1TZLA 2P8TA 4BDYA 3ERMA 2IJLA 5CVIA 1ZHFA 2HNHA 2JWTA 2V4JC 3TOBA 2F4IA 3MMYB 3MQ0A 2L2OA 2W82A 1MSEC 2L5QA 2MSYA 3ZN0A 2VQGA 3GTQJ 2KHMA 3JW4A 2LD5A 2O8KA 2L7FP 1TW2A 3FKIJ 2LC2A 2BYVE 4C30A 1RUOA 3BTCA 5B3SH 3RKXA 4M6VA 2BGCA 3WG7H 1U3EM 2R7SA 1SD5A 2CGPA 5EZHA 4IKFA 2CW8A 3LAPA 3DCFA 1I1GA 4HDVA 3DTIA 1U9OA 4Y3OA 2R7TA 3QODA 5FLVA 2EFNA 3OOPA 1WH7A 2XV4S 3ONQA 3LQQA 3E5QA 3GFMA 3HGGA 3OYMA 3KE2A 2MLGA 1SFKA 3CZ6A 1TNSA 4MO7A 2XSJC 4IL6C 4F93B 1W4MA 2DU9A 2CW7A 2ZSIB 1KZHA 2NXNB 2XUBA 4DOZA 2KISA 4I2OA 3DEWA 1QZZA 2NOGA 1TC3C 1MBHA 4RB0A 1B6AA 1ETKA 1LE8A 2Z5UA 2EBIA 1KQ0A 4ITVA 2MD0A 5GAHJ 2VB6A 1KQ9A 5H20A 2MH2A 3GBGA 2E5ZA 2HZTA 3DEUA 5B1AH 4BE1A 3FBNB 3K69A 3E5XA 2RVCA 1J2XA 3RI4A 4ABZA 1S3JA 1YQAA 2UWMA 3CCEI 3J81K 2BHYA 3U21A 2Q1ZB 4G9YA 5J8FA 2HKOA 2QEXI 2FXAA 4OINF 2X48A 2R5YB 4XICA 5FRNA 2DFFA 4J01A 3JRBA 2ETHA 2RC4A 3K2ZA 1H0MA 3KPHA 2Y48A 3PNTA 2XGDA 3ZMVA 1P4AA 4A3GJ 3IAS2 1LFPA 4MFDA 2KT0A 4IQ4A 1FOXA 2E19A 2IGKA 2PQ8A 1BI3A 3BPXA 1Z1DA 4RS8A 1W7PA 4MTEA 4IO9F 1D0XA 1GXQA 3K4KA 3DKWA 2HOSA 1T2KA 2STWA 4ZC3A 5EGOA 4PGGA 5ED4A 1JHFA 1USSA 3H0GJ 4ZDOA 3G71I 1DGWY 2P5VA 2VOOA 2K3FA 2K02A 3F9KA 2CW0F 2CO5A 4II2A 3IV5A 3DU5A 4FASD 3BLYA 4I99C 3PSIA 1QU3A 1YX5A 5M3FJ 3ABTA 1T95A 2K3PA 3GZ5A 2O5RA 5A2QZ 2W24A 3CC7I 1Z3XA 3MKLA 2LRDA 4E4HA 5BOXA 3DWLE 3MN2A 4XORA 2HVSA 1O3QA 4AVZA 3ZR8X 3ABUA 1ZTRA 2GBYA 4RGSA 3WG9A 3QP5A 3ZXSA 4MQVA 3UKGA 2L01A 3ZQIA 2M45A 1HW1A 1OQYA 4CH7A 5DD4A 2RN7A 1FT9A 4S04A 4A3DJ 1T6SA 1ETWA 2CQKA 4WF2A 3OIPA 1ZGAA 1N25A 2BV6A 2QLZA 4CCNA 5J6XA 3SZGA 2H09A 2KJCA 1W5CC 1ETOA 1YRNB 2Y9YA 2PLYA 3VOEA 4G7OF 1U2WA 3F72A 4KISA 1ETQA 3LSIA 3TEDA 2ME6A 5H2FC 1G4DA 2HPIA 2EIMH 3SZPA 4F55A 1F1ZA 2PMZN 4M73A 5L3BA 1UG2A 4S0HB 4H0EA 1WRJA 4KITB 5JFRA 2HKXA 3LA2A 1WJDA 2P5KA 1HKQA 1Z0XA 3QAHA 4M72A 2XAUA 2QA4I 2UZKA 4G7HF 1AU7A 2CV2A 2LMDA 3NARA 1EF4A 5DTDA 1R7JA 1NHAA 4I98B 3OY9A 2HGCA 1VQ5I 3OS0A 2R7RA 2XRNA 1E3HA 3F23A 1OCOH 2L9NA 4U87A 4CXFA 1Y0UA 1D1CA 5FRMA 5FJ8J 2LH9A 2NVYJ 2OCCH 5CLSA 3EDPA 3WODF 1K78B 3GO5A 1LDKB 1D5VA 3HOUJ 4M71A 4EJOA 2JSPA 3K4CA 4MEYF 3BP8A 2R92J 2M7BA 2DW4A 4B43A 3CDIA 4BHBA 5IYBJ 1UHSA 2KQRA 3HUGA 3KETA 3HM5A 2I5UA 1YW9A 4BXUA 4D7MA 4E6KG 2XPUA 4A3CJ 2PJRA 4B3XA 5ERIA 3NEUA 4CO8A 4UUSB 4M3FA 1ZYRF 3PFIA 3ZMDA 4E7ZA 2A68F 3HRSA 4YFNF 2CV1A 1UHWA 4DQ2A 3ZCOA 2QBYA 5EG0A 1OCZH 1XGNA 2RKHA 3GWZA 2FBHA 3O6BB 3HOSA 1I6HJ 1N78A 1JKQC 1N77A 2A6HF 1Y8QB 3IWZA 1ENHA 3W6JB 4A0XA 1OJLA 4HNUA 3I4PA 3BR6A 3K4MA 2Z1DA 3VYRB 1MDMB 1D5YA 1FNNA 2STTA 4BY1J 2B63J 3GLXA 4IRGA 1JGGA 2GAUA 4YEJA 5BQTA 3NRVA 2LF8A 1GUUA 1EH7A 3PJRA 2IS6A 2A6EF 3JAMK 2KPMA 1T0FC 2V9PA 2YX4A 2VPLA 3HPHA 5DUIA 1K83J 1XMAA 1CF7A 4L18B 4GXOA 3ZP5A 3D5LA 4D7NA 1BI1A 3IAM2 5CKTA 3DLAA 5D6FA 2P7CB 2QCOA 5FKKA 4IPAA 4RGXA 5LRSA 1LUJB 1YW8A 2EZKA 2HDDA 3QRFF 2JA5J 1PP7U 3LA7A 4HQMA 2V1DA 2VKEA 4FE4A 4M9ZA 3ESWB 5D4RA 1BM9A 1RR8C 1JJ8C 1C0WA 1IF1A 2LVSA 4E70A 3CCJI 3DTKA 4KN7X 5EEAA 5HLGA 1XSDA 2ZXHA 1S9HA 4XLEA 2UV1A 4G8XA 1UMQA 2ADUA 2DMPA 4D1QA 3FMRA 3AAFA 2K4BA 3AG1H 3K4NA 2QSFX 4G12A 1E17A 1FX7A 3P9IA 2VPRA 1IXCA 1ZKGA 3R60A 2P81A 1KU2A 4BH9A 1FPQA 4RAYA 3GW2A 4P5OA 4ZZLA 3A1YA 1VQ7I 1FSEA 4HV5A 1JT6A 1FYMA 1IN7A 3KLOA 1CQTA 1T56A 4HNTA 3DKXA 2WB1N 3CMYA 2ZJRF 1RRJA 1P4XA 5C4XJ 5L3DA 4XN0A 1FLIA 5IP7J 1R5ID 4XL9A 5GTHC 2DA4A 3CC4I 1RPWA 2EWNA 3I56I 3E97A 4XBFA 1SD4A 1J0RA 2VJ4A 3OSGA 2HDCA 2GA2A 2DFHA 2R5ZA 3FIWA 3VEPA 2WC2A 4NC7A 1LVKA 3WU0A 2FOKA 5FO5A 5IP6A 3J7YJ 1MMDA 4P9UA 2MC4A 4R1HA 4O5VA 3L1PA 4RBOA 2M5WA 1Y6IA 4OU0A 2KJBA 3KEOA 5J4YA 1LFUP 4UVCA 3HDDA 2JTVA 3IRRA 4D9JA 4DYCA 1U5TB 4EQQA 2OV7A 3OOUA 1R1TA 3HKZN 3T1BA 5DUKA 3BR0A 5F1JA 1LEBA 1TLHB 3S14J 1D8KA 2GOMA 3MZYA 3TQNA 2HQ5A 1OCPA 5IY5H 5C44J 2DT7B 1V54H 5TISC 3H3UA 1SFXA 2F48A 3HHGA 3V8LA 3X2QH 2CFOA 4XKCA 3GTPJ 3RQ4A 1B59A 1K4SA 2R7UA 3G2BA 1WH5A 2GWRA 1FEXA 1TWFJ 1Z6RA 2M3AA 2NS0A 3BC8A 1UB9A 2JUGA 4A12A 5JR3A 1BR2A 1J9IA 4V2GA 5LEKA 5K7HA 4D5FA 3D5RC 2HI3A 2X1CA 2NVUB 4XKBA 3E5UA 5IYDJ 1TQMA 1WPKA 1U5TC 2V1NA 4NDLA 2JJ7A 2H8WA 3B73A 2VBXA 4XNFA 3C1DA 3HSEA 1TQPA 5CYVA 3GCMA 5BS6A 2EQRA 2QQ8A 2DK8A 4L9NA 3FHNA 4KT5C 1Y39A 1Z3YA 3CCRI 4AIDA 4I09A 3ROUA 4R8HA 4C2UA 1HDDC 4G7ZF 4AIKA 4GRIA 4B09A 3N4MA 2QSGX 3OV8A 2DPUA 3HB9A 4HBLA 1U8BA 1R6RA 2AXTC 4RLFA 3REOA 4XONA 3S15J 2M9HA 3M9AA 4ZZDA 3I58A 5KCMA 1EA3A 1MMAA 2IA0A 3EETA 3GTJJ 1SFUA 1J59A 4B1RA 1UJ8A 4EM0B 3HC7A 1E3PA 3V8KA 1S7OA 4A3EJ 3S16J 1J7KA 1W7PB 5CVUA 1J5YA 3FF5A 1B9NA 3MKYB 3QQAA 3JRCA 3LSJA 1VQKI 2ZNYA 1YYVA 4OOIA 2QZ8A 2ZKZA 3WTZA 2WBMA 1KA8A 2PN6A 3VODA 4DGWB 1G3YA 4GCVA 5FB2A 2D2WA 5IT9Z 3TO9A 1SD7A 4HPQA 3TDUC 4RB2C 2H6BA 2DT6A 2VXZA 1D3YA 4CICA 1RETA 2E2JJ 4EGZA 2DODA 2IXSA 1X3ZB 3WHCA 2XRLA 3S3OA 3PQJA 4HV6A 1UHMA 1S7EA 1YW7A 1R36A 2DA1A 1U0JA 1ON2A 2DJIA 3FXOA 4CUGA 1Z7UA 4U7BA 3L2VA 3I9V2 1P4WA 1XGSA 2CYYA 4P1WA 4PFOA 1SMYF 1TT0A 1TNTA 2X6XA 3ASOH 4RGRA 1ZARA 2LK2A 2YS9A 2P5LC 3KP7A 2OZ6A 3F6VA 5LGTA 5LGUA 1XDSA 4EEFG 1FMVA 2RNJA 5LHIA 3PNVA 4Y17A 2XVCA 2ID6A 2KDOA 2Z33A 1YITI 3C3WA 5E79C 5HNHA 3PQKA 1XMXA 2LYCA 2DPDA 3MZ8A 5IOZA 2DA5A 1TWGJ 2FOWA 2H8RA 1LQ1A 3G1MA 1T08B 1NK2P 4XOPA 3S8PA 3VB2A 3E1SA 4ESBA 5BNGA 1OCCH 1W0UA 4IHXA 2EA2A 3CMEI 2L7KA 4D0PA 1FOWA 4NC6A 3ZMSA 4PUSA 4IHWA 4MNUA 2HVQA 4V2FA 2XGXA 4MIMA 1SVLA 2O8XA 4DYRA 3CCLI 3CC2I 1WVRA 2WA0A 4UUSA 1SVMA 1BR1A 3OYEA 2DCEA 3S2DJ 1DPRA 2RV8A 3ZQFA 5DM6F 3HTUA 1APLC 5K5QA 1RZ4A 2VIXA 4BE0A 3G3ZA 4XM3A 2W4SA 1S29A 4L5EA 4BGDA 3WTXC 1IN5A 1G6NA 1R5HA 4A3BJ 2G0EA 2O3FA 1M1EB 4C2MJ 4EGYA 2ZJPF 5GAGJ 3COAC 2LP0A 5J3LA 1P7JA 4XLAA 2ZO4A 1VQPI 4EJWA 4LFUA 1MDMA 2CG4A 2HYFA 3VYTB 1D1AA 1BJZA 2HS5A 3H9JA 2UUZA 2WADA 1ORKA 1QPMA 3CUOA 5F0FA 1QO0D 4KIFA 4ENKA 2A07F 2PJRB 4HLYA 2M30A 2E1MB 1FWZA 3V8JA 1X3WB 1ETVA 3JTHA 3K70C 3SXYA 4UUVA 1K6YA 2FRHA 2VQHA 2L9VA 2DA7A 2JA6J 3V42A 2N8GA 1JKPC 4UNOA 2R93J 2QBYB 5EG0B 3BR5A 5E3LA 4BQNA 3E7LA 4IX7A 4WXDA 1DGRM 3HTSB 2BHZA 3PFYA 3JRAA 5M3MJ 3HRUA 5LBQA 1WGXA 2DA3A 3D0SA 2K4JA 4IF4A 2KIFA 2ICWG 4PFPA 3L2QA 2DA2A 1YHQI 3QOEA 3HGYA 4HQEA 2A3SA 2E1MC 2L7ZA 3E0JB 4UB6C 5FD6A 1HSTA 2WAQA 3HJEA 3S3MA 1SEUA 1FYKA 4J19A 4F7ZA 2X6YA 2F2EA 5L3CA 3P9CA 1PUFB 1EKEA 2VONA 1RESA 3O8GA 1LDJA 3KZZA 5CVJA 3AFHA 1UFMA 3K6GA 2R7XA 1MH4A 4U0WA 1DUXC 2LY2A 2ZFUA 4MGRA 3TOAA 3KP5A 3OYNA 4XLCA 3T0YA 2UXNA 1RR7A 2Y30A 3J80Z 2KDZA 4Y7NJ 3OSFA 2IGNA 2M2EA 4YIRX 2AS5F 1VQLI 1QQIA 3P9KA 4IOAF 2CSOA 4LK0F 1LJ9A 2XAGA 1GVDA 2L9RA 3FBIB 3ABLH 2A5YB 3H1CA 1BOAA 3CD6I 4KN4X 3SQNA 3RQIA 1YFHA 2ZMEA 4CYCB 5BMZA 2DMQA 1AA7A 4LIUA 2VKVA 1MGTA 3FXKA 1D8JA 2A6TA 2EIJH 2H1LA 3LMMA 3OYFA 1QGPA 2QYOA 4BS9A 1WCMJ 3OWTA 1U5TA 2K9LA 2O61A 5JHFA 1LVAA 2CWEA 1BC7C 3ZQCA 2CV0A 4E7SA 2WY7Q 1ZRCA 2YU9J 1MH3A 4A0YA 2IS1A 4XK4A 4BAYA 5E8IA 5F0CA 2VN2A 5E1WA 2JVHA 2R0QC 1R9TJ 3KYCB 1SC7A 3I53A 2GQQA 1JXSA 1LFBA 4FCYA 2D5VA 2R5ZB 1U9NA 5FLXK 5D6EA 4BU2A 2HQNA 2GOXB 3K1NA 1SD6A 2CQQA 4P96A 3KEYA 4ZYDA 2ELKA 3U2RA 2LKXA 5GAEJ 2M87A 2MYSA 5EYRA 2DQRA 4CZCA 3ZQHA 2WAFA 3WTTC 5LFAA 3W2AA 1JUPA 4C3IJ 4RM2A 4BACA 2ZFWA 1YI2I 2OBPA 1R4MB 1N75A 2EB7A 2JK3A 1FY7A 1MW7A 3DPTA 5IYCJ 5L3GA 4A3FJ 3M1CA 2Q0OA 4ETSA 2RREA 3CJNA 1NTCA 3K9TA 1K61A 1LPQA 4LB6B 1REPC 4CDGA 4YG2F 2LSOA 3DPLC 4KMFA 2F5FA 3HBLA 2EFQA 1FC3A 4BQAA 2XF5A 4QSHA 2XSDC 3KP2A 3CLQA 1ZG5A 3S17J 2HOAA 2CQNA 1MBFA 1GV2A 1DPUA 2Q2EB 1S6LA 2MLKA 2KRCA 2XKOA 1MBGA 3IWFA 4A3MJ 3QU3A 3GLLA 2RQQA 2R3SA 3RKWA 2BW3A 2EV6A 1IXSB 5B66C 1VQOI 2VBYA 4M6YA 1SVOA 1HQCA 2PFBA 4FTHA 4Z6YA 4ZYAA 1R1UA 2K9MA 3BCBA 3H92A 3QPHA 4D5CA 4U0YA 1NK3P 3GTGJ 3RKQA 5AONA 2VC0A 4EM1A 4X1EA 2EPFA 2R7ZJ 2P4WA 1LB2A 1AWCA 1YIJI 5E17F 3I3LA 4PJ0C 4OMYA 4CCLA 2ZSHB 4XKVA 3K10A 4E7LA 1KQ8A 4BQOA 4DZJA 2Y0SN 4AYBN 1X4PA 2CRGA 2IGOA 4HZFA 3B02A 4PJMA 5GP9A 4ON0A 3D1NI 2XAQA 3S32A 2HXOA 3J81Z 3I4MJ 2Y0MA 3S1MJ 2YPRA 2MD5A 3RPUA 1NG7A 2KRHA 4Q4ZF 3BY6A 3G73A 3FISA 3K1PA 4XN3A 1AKHA 3HOYJ 2JQ7A 2DJNA 4HF1A 3J7ZI 5JLXA 3BG5A 4XRFA 4A93J 1I3QJ 3L2RA 5DEQA 2E7WA 1B1BA 2V1XA 2JZYA 1UCRA 1I50J 2BY2A 1F4KA 5E1XA 2KMUA 1QVUA 4A69C 3TP0A 1QPIA 2M8EA 1U8RA 2QF7A 5GTIC 4ZDLA 2QQAA 5F6FA 1DP7P 4QWQA 4EV0A 3M4OJ 1Q1VA 1WKMA 2LTPA 4M3DA 5M5YJ 3OMYA 1F36A 4PK4A 2FQ3A 4ANJA 1Z6TA 4U88A 1WHUA 3O3KA 2W57A 2GLOA 2Z16A 3DPUA 4LITA 5CJ9A 1IDYA 3O8HA 3KIOA 5IT3A 4DYQA 3O2PE 3CO6C 2G7HA 2V7FA 4M74A 1IV8A 4FHTA 2JRMA 4A3JJ 3LQRA 5DCMB 3T8RA 2VUMJ 2ESHA 4HG2A 1A04A 4B3AA 1MBJA 2K9QA 1MBKA 1RKWA 3W6VA 3BQZA 3M3YJ 2O0YA 2IT0A 4I01A 3IRQA 2Z99A 1I5ZA 1YG2A 1WWXA 2OQRA 1XC5A 1BIAA 5KAFC 2DOFA 1W36C 1OKRA 4P9FA 3GXOA 4S05A 1YX3A 1X2MA 2Y75A 4IJAA 3CLOA 1MBEA 4F92B 3F8NA 5DDGA 1JTYA 4MHGA 3WGIA 3DKYA 1R00A 3BZCA 1V3FA 2PMHA 2VI6A 5LHHA 3J7AO 4DW6A 3BG9A 1RC9A 2VT3A 1K7AA 1QHGA 3SYTA 3QPTA 5ICGA 1HSJA 4PDKA 3BZKA 3I54A 3GTLJ 2CMPA 4RB1A 3KZIC 2DBBA 1UG0A 4O3MA 2FMLA 3DBLB 2M4GA 4PGHA 4Z2YA 3S2WA 1Z9CA 3T8TA 1W36D 4G6TB 2DYRH 5H6RA 1FIAA 1PUFA 4ENJA 2OC6A 4HX4A 1PYVA 2Z3YA 4BYYA 3DQVC 5GADJ 1K6OA 2EINH 2W85A 2BY0A 5DS9A 1XCBA 2PMZA 4LOCA 4IHSA 1XTAA 3DTEA 2XC7A 1LKXA 5D5XB 2PX9A 2R7QA 1TWAJ 2F6CA 5EEGA 2DMUA 3ZRGA 3WHBA 2LR8A 2XB5A 4XRMA 2OQGA 4UUTA 3OYJA 3DU6A 2DO7A 3RZDJ 1VQNI 1HA8A 1KU3A 2WAEA 3GZ6A 4LLGF 2ZJ2A 4ZTFA 3G1OA 3OIOA 1FMWA 2XAJA 4W1UA 1O4XA 4DJAA 4GYGA 3LOCA 1X2NA 4CYCA 1DP3A 3PUFA 4EJUA 1W0TA 4Y13A 4AD9A 1OYYA 3ZGKA 1K79A 3TO7A 3KYLA 1UELB 1IAWA 3GMEA 2ISZA 1BA5A 1I27A 1E3OC 5KVRA 4L0YB 2G9WA 2KFDA 4NC8A 3RYPA 4LG3A 2EZLA 3SEZA 2KL4A 3NAUA 1HKSA 1I1SA 1S5LC 4XMYA 3GTOJ 2XROA 3L9FA 1NG6A 2I8DA 2E71A 1OR7A 2ME0A 3JAMZ 1OCRH 4L9VA 1H9TA 3S1RJ 2VQCA 2FUG2 2ZXIA 2IGMA 2KKOA 3DBRB 2F5VA 3L7WA 5HS9A 2MG4A 2XF6A 1IRXA 2DTZA 1A6QA 2J5PA 5E3OA 1BOBA 2ZMEB 5TRDA 1MMSA 1WQ2A 4UV8A 1MMNA 2COMA 3ZQQA 2LY9A 4E7IA 1VFCA 1O7LA 1RUNA 2CS3A 3IH2A 4I7HA 1X1CA 2X85A 1X1BA 5HODA 3QYEA 2HTJA 1MNEA 2JPBA 3RJPA 3JRFA 1HW5A 3HL2A 3MKWB 5LRRA 2UXXA 1LEAA 3OL4A 1YJNI 1OCTC 3FM3A 2XGCA 5E3MA 4A3IJ 4I76A 1SFEA 2KRFA 2QM3A 3GYHX 5J40A 3VFZA 1ZELA 2ZMEC 3LSMA 2WV1A 3CJRB 3VWBA 3HZJA 5GPCA 2DOAA 3QP6A 2COBA 1P2FA 3N05A 3PO2J 3HSFA 1V55H 2QSHX 2M4KA 4EMSA 2ISYA 2CJJA 4PZJA 3IH4A 2JVGA 5B5EC 4CCOA 5HS8A 2Q2EA 1WFXA 2LF7A 3PIPF 2HOTA 3IKVA 4KIBA 5HOOA 1XS9A 2V9KA 1HCRA 1IRGA 1VQ6I 3CESA 3QU6A 2LLKA 3Q5FA 1YJWI 5IOYA 1BW5A 2HEOA 5ICCA 2V6EA 3HOVJ 3BG3A 2L4AA 4CCKA 3SJMA 2YR2A 4LK1F 4X6AJ 2Y2ZA 2X6OA 2LFBA 1TWCJ 5DYMA 3M7GA 4RB3C 5EDNA 4CA0A 2OTJI 4JX6A 2R7DA 2IAIA 3TL4X 1KU7A 4V19K 1SMTA 5ILSA 1ETXA 5FROA 2JUCA 3F8BA 1WJAA 4A0ZA 3R4KA 1H9GA 2VL8A 1GVJA 1BW6A 2IP2A 3CMAI 4BEHB 1U6GA 4Q47A 4BXXJ 3NWTA 2BBYA 2WB1A 4OWRB 2OA4A 5L3FA 1ODDA 1SAUA 4E7KA 4CGZA 1XB4A 4KA4A 3LSHA 3OYDA 1QHHD 1R4NB 2ECCA 2F5EA 3OR1C 3CCMI 1JE8A 3U1KA 4QTRA 5BPIA 2BW3B 3FHZA 5E8GA 2Z9OA 1Z7LA 4IHYA 2QKLB 3TW7A 1GV5A 3BDDA 2MA3A 1B72A 5JHUA 4BUPA 4EJVA 3K4BA 2E35A 4OAZA 4NBQA 3H5NA 1USTA 2H1KA 6PAXA 4OMZA 3L00A 4MLOA 2F5DA 2HFHA 2LOOA 2HYGD 4P55A 5JI6A 5J4VA 3CMMA 3HKZA 1HC8A 1TL8A 5FKLA 3KP3A 4C2TA 3FXUA 2YU3A 2ZJQF 1XGOA 1GDTA 4I02A 1P7IA 1L0OC 2LKSA 3L09A 3W6KB 1TWHJ 1G59A 4ENNA 4C3HJ 1ZG1A 2KZGA 2IA2A 1AKHB 2OJED 4LB5A 3ISPA 5CVRA 4AM3A 3TKYA 3Q9VA 3WE2A 1O3TA 1DDNA 2F4OB 3PM1A 5F27A 2D45A 1YLFA 1XMKA 3IP4B 4YIFA 5DCMA 1F9NA 3DEEA 2L3DA 3F0CA 3QYFA 1PP8F 2AQEA 2QQ9A 2B0LA 1ERDA 4PCQA 3LFUA 1W7PD 3JREA 3HHHA 4H4KC 2GXBA 2MGQA 2Q8KA 1I39A 2VLAA 1MD0A 2IBDA 2WAQN 2X1DA 2XAHA 1X1AA
chains in the Genus database with same CATH topology
1V54H 5B3SH 3WG7H 3X2QH 5IY5H 3ABMH 1OCCH 2OCCH 2EIMH 3ASNH 2EIJH 3ASOH 2DYSH 3AG3H 3AG2H 3AG1H 2EIKH 1V55H 2DYRH 2EILH 1OCZH 2ZXWH 1OCRH 3ABKH 3AG4H 5B1AH 3ABLH 5B1BH 2Y69H 2EINH 1OCOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 H;  5B3S H;  3WG7 H;  3X2Q H;  5IY5 H;  3ABM H;  1OCC H;  2OCC H;  2EIM H;  3ASN H;  2EIJ H;  3ASO H;  2DYS H;  3AG3 H;  3AG2 H;  3AG1 H;  2EIK H;  1V55 H;  2DYR H;  2EIL H;  1OCZ H;  2ZXW H;  1OCR H;  3ABK H;  3AG4 H;  5B1A H;  3ABL H;  5B1B H;  2Y69 H;  2EIN H;  1OCO H; 
#chains in the Genus database with same CATH topology
 2E34 A;  2DXI A;  2M34 A;  2BOL A;  2LY1 A;  1VQ8 I;  2EJR A;  1WI3 A;  3Q0V A;  3TO6 A;  2W84 A;  3HXL A;  1YS7 A;  3LFK A;  5TJJ A;  5KK1 A;  1A31 A;  3F3X A;  4JOM A;  2ZXJ A;  4B48 A;  4UY8 I;  3JRG A;  4NUB A;  3DFG A;  3SDB A;  1T33 A;  2EK5 A;  3KZY A;  3K1M A;  3BQY A;  1IV6 A;  4GGG A;  3EUK L;  4IHV A;  2HXI A;  3NQO A;  2NS8 A;  2CUE A;  2K9S A;  2JA7 J;  4LG0 A;  2F4M B;  1XG1 A;  3D5S C;  3CCV I;  1ZN2 A;  2O9L A;  2BY3 A;  2Y31 A;  4DBQ A;  5LHG A;  1ULY A;  4YEL A;  4L0Z B;  5HLH A;  3RDI A;  4M6X A;  3BG6 A;  2OD5 A;  1ONV A;  4RAG A;  4XQF A;  1KGS A;  3MFK A;  4BJT A;  2GXA A;  1TP4 A;  3FXQ A;  2QEN A;  3I4N J;  2VXD A;  1IN6 A;  3LA3 A;  2NOJ B;  1O7F A;  4HX7 A;  3B6A A;  1Y56 A;  4OIP F;  2LBF B;  5J1U A;  3PNY A;  2ID3 A;  3BOQ A;  3H9G A;  5HLI A;  3U9G A;  4IEJ A;  2DDA A;  3V4G A;  5M5W J;  1HF0 A;  2FMY A;  2HDW A;  1BR4 A;  2JRT A;  4GDF A;  2YUS A;  3I55 I;  4CZZ A;  4IHT A;  3Q0U A;  1IDZ A;  4HA8 A;  5K7Z A;  5LLQ A;  2BE5 F;  4BNC A;  2RNG A;  3GFI A;  2VE9 A;  4FX4 A;  2KZV A;  5FD5 A;  3BR1 A;  2W1O A;  2JSC A;  3RYR A;  4UVB A;  2AQF A;  3K70 D;  3BT9 A;  3KFW X;  3R0J A;  4I0A A;  3ECO A;  2V6C A;  3L2C A;  1VZ0 A;  3JRI A;  2X0L A;  3JRD A;  2O03 A;  2FX0 A;  1TW3 A;  3PSF A;  4M3B A;  3OS2 A;  5E1Z B;  5E20 A;  2E1C A;  3A01 A;  1V4R A;  3WTS C;  4OAY A;  3VDX A;  4AIJ A;  3GX4 X;  1MIJ A;  4Y4R A;  1MNM C;  3ML6 A;  4IZZ A;  4BBR J;  2ELJ A;  3I5U A;  3H3Z A;  1JKR C;  1GHC A;  3F8F A;  3VYU B;  3ZMT A;  4AU7 A;  1ZAO A;  1G2H A;  4EAT A;  3QOP A;  2GXG A;  1WI9 A;  1WZ2 A;  3HOT A;  1YOV B;  2Y9Z A;  4KFC A;  4HNV A;  4IXA A;  2OAZ A;  4C9Y A;  5HLT A;  1IN4 A;  2XPV A;  2HZD A;  5EF6 A;  2DLL A;  1FJL A;  2CUJ A;  1EJ9 A;  2BXZ A;  1ZR2 A;  4A3K J;  3IKT A;  5CQG A;  3W2W A;  3DXJ F;  4F3Q A;  3BWG A;  5CVV A;  4FT8 A;  3M8F A;  4NQW A;  5F64 A;  4XRS G;  3L2W A;  1W5S A;  4N4N B;  2EFW A;  3TDZ C;  3OYK A;  3B6C A;  4QLC U;  5EJC A;  4BBS J;  3SZT A;  3A02 A;  3GTM J;  5HDK A;  1R71 A;  4N0B A;  4OIQ F;  2XPW A;  3BZ6 A;  4ZYH A;  5J1R A;  1L3L A;  2GIV A;  4KDP A;  3HOW J;  5FFZ A;  3FX3 A;  3M07 A;  3LST A;  4O6J A;  2CFX A;  2FSW A;  3CF2 A;  1YJ9 I;  1FBS A;  3FK6 A;  3MEX A;  3QYB A;  4NB5 A;  1PVE A;  2CQ7 A;  1MJ9 A;  2AO9 A;  3SFZ A;  3JTG A;  4UVA A;  4BHC A;  2X9D A;  2E60 A;  2HR3 A;  3BRO A;  5D8K B;  4BDZ A;  1SAX A;  1FYL A;  4IRI A;  4MTD A;  3F6O A;  2M0C A;  3I59 A;  1JUM A;  3TMO A;  2MBF A;  3ABK H;  1F43 A;  1YIO A;  4HW0 A;  1ZRD A;  2DT5 A;  3H35 A;  3LSP A;  2FA5 A;  4M9S A;  3AKZ A;  2FQ4 A;  2HOE A;  2E5N A;  1S7A A;  4UXN A;  1JUS A;  1Y1V J;  2PMU A;  3GF2 A;  1OR7 C;  2K7L A;  3A4C A;  4RGU A;  2FNP A;  2OUM A;  1KYW A;  2VOP A;  1V5F A;  4B8X A;  2IS4 A;  1EV7 A;  1PJR A;  2DOE A;  2G7U A;  3CCS I;  4HF2 A;  1FP1 D;  1IXR C;  4KT6 A;  2DMN A;  4OIO F;  3CQZ J;  9ANT A;  5A2Q K;  3LAJ A;  2EV0 A;  1U78 A;  2XAS A;  2EV5 A;  1ACI A;  2XKP A;  1FTZ A;  3CUQ A;  4LIV A;  3ULQ B;  1J75 A;  4BEH A;  3EUH A;  2RGV A;  3FK7 A;  2WWY A;  1HOM A;  4NHJ A;  3GVA A;  5ICF A;  3QWL A;  4LGW A;  4GYI A;  3LWF A;  3R6S A;  4ESJ A;  3JSP A;  4IVN A;  4HLX A;  2C6Y A;  1R22 A;  4BJ6 C;  1VF9 A;  3GFJ A;  4BQQ A;  2CUF A;  2P0W A;  1QA6 A;  3G6E I;  4JK1 X;  5EEH A;  1B8I A;  3WE3 A;  2A69 F;  5FLX Z;  2ZB9 A;  3CCQ I;  3K2A A;  3VYS B;  5E18 F;  1Y8R B;  4RM3 A;  4XOT A;  3LNQ A;  1W5T A;  2GA1 A;  3OYH A;  2X4H A;  5KNL A;  4CSW A;  2L02 A;  3CJT B;  4YRV A;  2VE8 A;  1ON1 A;  2DA6 A;  2Y69 H;  5D5U B;  3FXR A;  3LSK A;  4KYW A;  2VQL A;  4AUX A;  4KNY A;  4XKW A;  1YE9 A;  4FE7 A;  4HX8 A;  2L7M P;  5CPR B;  2JPC A;  1R23 A;  2AHQ A;  3BJO A;  4M3E A;  1R1V A;  1VTN C;  2O6G E;  3C18 A;  1A6I A;  5HNF A;  2E36 A;  3FZV A;  1BBY A;  2HWV A;  2XDV A;  4GO1 A;  1FIP A;  3H5R A;  2BXY A;  2I10 A;  2DTR A;  2ZXW H;  4CHU A;  2VAS A;  1WJC A;  3HIF A;  2IS2 A;  5FFX A;  2NNN A;  4B44 A;  5TGT A;  3EPZ A;  2VJJ A;  1T98 A;  4IOC F;  4DBR A;  3OYB A;  2FE3 A;  1MND A;  3M8E A;  2CQX A;  1B72 B;  1X4O A;  1E0E A;  3QPS A;  5K5R A;  1OMI A;  2BZT A;  5EZG A;  5D4S A;  2LNB A;  4UB8 C;  3I64 A;  3CP8 A;  2XIG A;  3BPV A;  4HOB A;  1BL0 A;  2RDP A;  2FJ1 A;  2VKD A;  1O57 A;  4BKX A;  3L2U A;  3ZQG A;  1JI8 A;  4LJZ F;  5FKN A;  3I0T A;  4QPQ A;  4BE2 A;  4YII A;  1CGP A;  2TRT A;  5D8L B;  3WTW C;  4BHP A;  3HRM A;  5F08 A;  4AC0 A;  2VOD A;  3A03 A;  3S1N J;  2YX7 A;  1FSH A;  5GPA A;  3PL8 A;  2B9S A;  5LGN A;  1H8A C;  2NS7 A;  2JT1 A;  2LDU A;  4UHT A;  4G94 A;  4PSX A;  2EZI A;  2GM4 A;  1ZLJ A;  4ZTJ A;  3H9Q A;  4YFK F;  3WGH A;  2PBI A;  1DU6 A;  1JHH A;  4PJJ A;  4XR6 A;  3PUB A;  2M7A A;  3LL7 A;  3FWE A;  5AIQ A;  1H88 C;  2K86 A;  1Z05 A;  1ITY A;  4HF0 A;  1OLT A;  2BY1 A;  2LRE A;  4ZYE A;  1WSU A;  4F91 B;  1O3R A;  3TP3 A;  1PDN C;  2VJ5 A;  4FET A;  4N4O B;  1Z91 A;  4MFE A;  3UR3 C;  1ZQ3 P;  3DV8 A;  1PUE E;  2P6T A;  3OYG A;  4AIH A;  1BIB A;  3BR2 A;  2QKM B;  2EFO A;  3AG3 H;  1ZRF A;  1I6X A;  2LBF A;  3ZN1 A;  1D0Z A;  2W00 A;  2DFE A;  1IUF A;  1E2X A;  1J09 A;  4Y15 A;  2BEO A;  2Y0S A;  4AYB A;  2KIU A;  2EA4 A;  5L3E A;  4WX9 A;  2K40 A;  4JX5 A;  3E3V A;  2CUZ A;  3FXJ A;  4KMU X;  3IL2 A;  3V7C A;  4Q48 A;  5D5V B;  4LG0 B;  1X19 A;  3A0B C;  3KLN A;  4PJL A;  1HXD A;  1QZY A;  3OR2 C;  4BL0 B;  4CCJ A;  1YTY A;  4NNJ A;  2NVQ J;  1ZH5 A;  4LMY A;  2W7N A;  4F52 A;  4K2E A;  1UZC A;  3PIO F;  3QPL A;  1FOK A;  1MJB A;  1XPX A;  1IUY A;  1XX5 A;  2EH3 A;  4HYE A;  3GTK J;  1GXP A;  1ZG3 A;  3A2K A;  1TBX A;  1G8X A;  3BJA A;  3BTJ A;  4WK8 F;  4DZP A;  1EH6 A;  4KIG A;  3H36 A;  3M1E A;  2VBW A;  2DN0 A;  3WTU C;  3FXM A;  3BTI A;  4A5N A;  3MCZ A;  3BJ6 A;  5ILU A;  2RAE A;  3U1D A;  3E6D A;  1BC8 C;  2F5C A;  2E1N A;  3T5X A;  1VND A;  1OYW A;  2FNA A;  3SEQ A;  2NRA C;  3RPQ A;  3JR9 A;  4B47 A;  2KIM A;  2QVO A;  3ZOB A;  1YS6 A;  5FGM A;  3ZQ7 A;  1OFC X;  2KIQ A;  1EH8 A;  2HU9 A;  4MEX F;  4IRH A;  1YO5 C;  5JVT A;  1QNT A;  2OCE A;  4HEA 2;  2W25 A;  3DP7 A;  3KP6 A;  4TV7 A;  3R0A A;  2HYJ A;  1KON A;  1MJA A;  2M0M A;  2PJP A;  2W48 A;  3WU2 C;  1FBU A;  4AVP A;  4KIC A;  2X51 A;  1Z21 A;  1LNW A;  3FKJ A;  3F21 A;  4N9I A;  3CO7 C;  2A5W A;  2QWW A;  2XF7 A;  2EFP A;  4LLL A;  1IJW C;  1D1B A;  3A01 B;  4B4C A;  1LDD A;  3E6M A;  3Q0W A;  3S3N A;  2IRF G;  2B7E A;  2OTL I;  5CQE A;  3CDL A;  4M9X A;  2XAF A;  5HDN A;  2FD5 A;  3ELK A;  1WJB A;  3C2H A;  3F8M A;  2H6C A;  3ECH A;  1IC8 A;  1ZR4 A;  4L5I A;  1JT0 A;  4M3G A;  1QVT A;  2EZH A;  1HDP A;  2WV0 A;  2Z2S B;  1FBQ A;  4E7H A;  1K4T A;  1P6R A;  4U0V A;  5DV5 A;  1QZE A;  3G1L A;  2E7X A;  2DDB A;  4FX0 A;  3UNG C;  1O3S A;  4A2U A;  2HQR A;  4RAF A;  1VI0 A;  2DQL A;  2IA1 A;  2MH9 A;  1IZ1 A;  2OPT A;  3HEF A;  4NQW B;  3OYC A;  5K1Y A;  5ICE A;  3OIQ A;  3DBH B;  2TDX A;  1BI2 A;  1JJ6 C;  4KJZ A;  3RCO A;  3EUA A;  3RIR A;  1A36 A;  2RQP A;  2V9V A;  3HG9 A;  2DI3 A;  2M8G X;  2BVM A;  3P7N A;  5H6Q A;  2JN6 A;  2OZU A;  5AIP A;  2DYS H;  1MKM A;  2FEZ A;  1X1P A;  3JSO A;  4J00 A;  2HVR A;  1HW2 A;  1QBJ A;  1XSX A;  1XD7 A;  1ZLK A;  3CP2 A;  2EIL H;  2PEX A;  1VQ9 I;  1ETY A;  5K5O A;  4I6Z A;  4BXF A;  5JLW A;  1RI7 A;  2QQB A;  1DQU A;  4OIR F;  1S72 I;  1OYI A;  2R5Y A;  3RZO J;  3I59 B;  1XDU A;  2K85 A;  2GIZ A;  5KAI C;  3GZN B;  4EM2 A;  3WU1 B;  4AWX B;  1MMG A;  3A0H C;  2CU7 A;  1T39 A;  1G3T A;  1V5G A;  2NYX A;  5IT9 K;  3KEQ A;  3Q3S A;  1G3W A;  4Y52 J;  1Z77 A;  2PG4 A;  4YFX F;  2DK5 A;  1TQI A;  4IQJ A;  3AG2 H;  1HLV A;  4WXH A;  5HVQ C;  4WXC A;  3CCU I;  1AHD P;  3LSR A;  1H89 C;  3ZQL A;  1FP2 A;  1S8N A;  3WTV C;  4RDU A;  1LE8 B;  2LKP A;  2R7O A;  1WJE A;  4MQ9 F;  2E2I J;  3VSK A;  4EVI A;  4WWC A;  1RNL A;  1IN8 A;  3S93 A;  3VSL A;  3KX2 A;  3HRT A;  1Y1W J;  3IC7 A;  4UV9 A;  5K7F A;  3CUQ B;  4A6E A;  5LEJ A;  5FKM A;  1GT0 C;  4ZYG A;  3MAJ A;  2V1U A;  3HSR A;  5HS7 A;  2MAB A;  3AL0 B;  2L54 A;  1X58 A;  2DFI A;  1R58 A;  2ZC2 A;  4HAM A;  2NAZ A;  2K27 A;  3S2H J;  4JX4 A;  4XRS A;  5F04 A;  1Z67 A;  3BG7 A;  3FDY A;  1F5T A;  1ZGJ A;  3C7J A;  1ZK8 A;  3BCA A;  3V7S A;  4CYD A;  4XID A;  1B8I B;  4HST A;  1OPC A;  2MC3 A;  1VQ4 I;  2IVM A;  3MVP A;  2R7W A;  3WGG A;  5B1B H;  4RMN A;  2D1V A;  3JCU C;  1IGN A;  3E6C C;  3MWM A;  1R49 A;  3IH3 A;  3W2V A;  3ZMZ A;  4HRI A;  5F1R A;  5IPA A;  3MD2 A;  2K5C A;  3CUQ C;  1VQM I;  1XCV A;  5EGO B;  3OL3 A;  3EUH C;  5J47 A;  1T8I A;  4XLF A;  3AL0 C;  2IEK A;  4ZH4 F;  4DIQ A;  4QPO A;  1X1D A;  3OS1 A;  1XGM A;  3TW6 A;  4LD5 A;  1HKT A;  1YRN A;  4ASN A;  2IPQ X;  4CCM A;  1BN5 A;  2FBI A;  3WTY C;  3C2B A;  3ZPL A;  1IRF A;  2HTS A;  1BJA A;  2NNY A;  1SFO J;  2ELH A;  1FOY A;  5BPD A;  3EQL F;  2P6S A;  3RKY A;  2M1B A;  4LLN A;  3LSG A;  2E1O A;  3CDH A;  1P9Q C;  1IRZ A;  1D0Y A;  2X1E A;  2P7V B;  3IHU A;  4II3 A;  2IW5 A;  2A61 A;  5DM7 F;  3G4S I;  2LG4 A;  2CH0 A;  2NVX J;  2VJI A;  4L5J A;  1RKT A;  3HPG A;  1WJ5 A;  4N9H A;  1TTY A;  2E2H J;  3OYL A;  3FMQ A;  3KCC A;  2KLO A;  3K4L A;  3R61 A;  5E3N A;  4R79 A;  2EIK H;  3N97 A;  3SHF A;  3JRH A;  2WTE A;  3MZH A;  5F0H A;  4QIW N;  3H3V K;  4PSW A;  5ILV A;  4JP0 A;  2PI0 A;  4G6D A;  3P5J A;  5KHD A;  3I71 A;  4G6Q A;  2YSR A;  5DD8 A;  3K7A J;  3FXL A;  2WY8 Q;  1K78 A;  2ECB A;  4ESF A;  4ENM A;  3ZMU A;  1KYZ A;  2J5O A;  2VC1 A;  2DAO A;  2ZBK A;  3CCY A;  3K0L A;  2R7V A;  1BI0 A;  2MFZ A;  2X6W A;  1B4A A;  3CJQ B;  4C3J J;  3KP4 A;  3FM5 A;  2OF7 A;  3E6B A;  2O7O A;  3F8C A;  5C3E J;  2AXL A;  5HDG A;  4FIS A;  3TGN A;  5J1Y A;  3DF8 A;  1GLN A;  4I0B A;  3S1Q J;  2L0K A;  4BJ5 C;  2VKH A;  3V7R A;  2HQA A;  3M8J A;  1DU0 A;  2QUF A;  1B9M A;  1T0F A;  3ABM H;  1RIO H;  1XN7 A;  3TBI A;  1STZ A;  3ASN H;  2FF4 A;  1JTX A;  4JQF A;  4ZDP A;  3BR3 A;  1UAA A;  4XLP F;  3RPU D;  2H27 A;  3GEZ A;  2ZNZ A;  1OIS A;  2K9N A;  3EYI A;  1SAN A;  2R7F A;  4A5M A;  4A3L J;  3H5A A;  3KYD B;  3RSN A;  4HDU A;  3IUO A;  5LD2 C;  1FZP B;  4JBA A;  2XHK A;  3BTL A;  4BY7 J;  4PJN A;  1IW7 F;  1G3S A;  2ACJ A;  1A35 A;  2BVL A;  4A6D A;  4E7J A;  1X3U A;  3PO3 J;  2JA8 J;  1TT5 B;  2KP6 A;  4L9T A;  1I3A A;  1R5G A;  2XB0 X;  3HUG B;  5C4J J;  3OYI A;  4L9J A;  3J7A Y;  2MW8 A;  2FU4 A;  4Y33 A;  1Y0N A;  2JA2 A;  4XLN F;  5IP9 J;  4JYK A;  2DMT A;  3MKZ A;  3HOZ J;  3J80 K;  3GFL A;  1KU9 A;  3OYA A;  2VT2 A;  4RLQ A;  1HBX G;  1XSV A;  3CF5 F;  5FLM J;  3F22 A;  2JMW A;  4WCG A;  2GZW A;  2R4G A;  1FTT A;  4XSX F;  4RAZ A;  1P92 A;  1IG7 A;  3NWS A;  3SDG A;  2QGU A;  3VPR A;  4U7D A;  4KUM A;  2H94 A;  3H0D A;  4XLH A;  3AG4 H;  4RA2 A;  3SFI A;  5M5X J;  3W3C A;  1NH3 A;  2TCT A;  4W97 A;  5FKO A;  3Q9S A;  3HOX J;  4HSR A;  4Q5S F;  1ZGW A;  3EYY A;  1A5J A;  1Q1H A;  1WJF A;  4XSZ F;  3DLL F;  2L9S A;  3ERE D;  2D1H A;  1JGS A;  2V26 A;  3C2G A;  3GUD A;  4ZJZ A;  1IO2 A;  3HYI A;  3K4J A;  5D5W B;  2A05 A;  4DNC A;  2L4M A;  2NVT J;  4FQG A;  1JKO C;  1AOY A;  2XGE A;  2FBK A;  5JVG F;  2ESN A;  5J8C A;  1CF7 B;  1W1W E;  2ZCW A;  2OU2 A;  2HPM A;  1MSF C;  3CTA A;  5DCF A;  1POG A;  4GFB A;  1V5E A;  2VBZ A;  1ZRE A;  3FMS A;  4EJT A;  3RTR A;  4X0G A;  2V79 A;  1T38 A;  1MZB A;  1QRY A;  1TZL A;  2P8T A;  4BDY A;  3ERM A;  2IJL A;  5CVI A;  1ZHF A;  2HNH A;  2JWT A;  2V4J C;  3TOB A;  2F4I A;  3MMY B;  3MQ0 A;  2L2O A;  2W82 A;  1MSE C;  2L5Q A;  2MSY A;  3ZN0 A;  2VQG A;  3GTQ J;  2KHM A;  3JW4 A;  2LD5 A;  2O8K A;  2L7F P;  1TW2 A;  3FKI J;  2LC2 A;  2BYV E;  4C30 A;  1RUO A;  3BTC A;  5B3S H;  3RKX A;  4M6V A;  2BGC A;  3WG7 H;  1U3E M;  2R7S A;  1SD5 A;  2CGP A;  5EZH A;  4IKF A;  2CW8 A;  3LAP A;  3DCF A;  1I1G A;  4HDV A;  3DTI A;  1U9O A;  4Y3O A;  2R7T A;  3QOD A;  5FLV A;  2EFN A;  3OOP A;  1WH7 A;  2XV4 S;  3ONQ A;  3LQQ A;  3E5Q A;  3GFM A;  3HGG A;  3OYM A;  3KE2 A;  2MLG A;  1SFK A;  3CZ6 A;  1TNS A;  4MO7 A;  2XSJ C;  4IL6 C;  4F93 B;  1W4M A;  2DU9 A;  2CW7 A;  2ZSI B;  1KZH A;  2NXN B;  2XUB A;  4DOZ A;  2KIS A;  4I2O A;  3DEW A;  1QZZ A;  2NOG A;  1TC3 C;  1MBH A;  4RB0 A;  1B6A A;  1ETK A;  1LE8 A;  2Z5U A;  2EBI A;  1KQ0 A;  4ITV A;  2MD0 A;  5GAH J;  2VB6 A;  1KQ9 A;  5H20 A;  2MH2 A;  3GBG A;  2E5Z A;  2HZT A;  3DEU A;  5B1A H;  4BE1 A;  3FBN B;  3K69 A;  3E5X A;  2RVC A;  1J2X A;  3RI4 A;  4ABZ A;  1S3J A;  1YQA A;  2UWM A;  3CCE I;  3J81 K;  2BHY A;  3U21 A;  2Q1Z B;  4G9Y A;  5J8F A;  2HKO A;  2QEX I;  2FXA A;  4OIN F;  2X48 A;  2R5Y B;  4XIC A;  5FRN A;  2DFF A;  4J01 A;  3JRB A;  2ETH A;  2RC4 A;  3K2Z A;  1H0M A;  3KPH A;  2Y48 A;  3PNT A;  2XGD A;  3ZMV A;  1P4A A;  4A3G J;  3IAS 2;  1LFP A;  4MFD A;  2KT0 A;  4IQ4 A;  1FOX A;  2E19 A;  2IGK A;  2PQ8 A;  1BI3 A;  3BPX A;  1Z1D A;  4RS8 A;  1W7P A;  4MTE A;  4IO9 F;  1D0X A;  1GXQ A;  3K4K A;  3DKW A;  2HOS A;  1T2K A;  2STW A;  4ZC3 A;  5EGO A;  4PGG A;  5ED4 A;  1JHF A;  1USS A;  3H0G J;  4ZDO A;  3G71 I;  1DGW Y;  2P5V A;  2VOO A;  2K3F A;  2K02 A;  3F9K A;  2CW0 F;  2CO5 A;  4II2 A;  3IV5 A;  3DU5 A;  4FAS D;  3BLY A;  4I99 C;  3PSI A;  1QU3 A;  1YX5 A;  5M3F J;  3ABT A;  1T95 A;  2K3P A;  3GZ5 A;  2O5R A;  5A2Q Z;  2W24 A;  3CC7 I;  1Z3X A;  3MKL A;  2LRD A;  4E4H A;  5BOX A;  3DWL E;  3MN2 A;  4XOR A;  2HVS A;  1O3Q A;  4AVZ A;  3ZR8 X;  3ABU A;  1ZTR A;  2GBY A;  4RGS A;  3WG9 A;  3QP5 A;  3ZXS A;  4MQV A;  3UKG A;  2L01 A;  3ZQI A;  2M45 A;  1HW1 A;  1OQY A;  4CH7 A;  5DD4 A;  2RN7 A;  1FT9 A;  4S04 A;  4A3D J;  1T6S A;  1ETW A;  2CQK A;  4WF2 A;  3OIP A;  1ZGA A;  1N25 A;  2BV6 A;  2QLZ A;  4CCN A;  5J6X A;  3SZG A;  2H09 A;  2KJC A;  1W5C C;  1ETO A;  1YRN B;  2Y9Y A;  2PLY A;  3VOE A;  4G7O F;  1U2W A;  3F72 A;  4KIS A;  1ETQ A;  3LSI A;  3TED A;  2ME6 A;  5H2F C;  1G4D A;  2HPI A;  2EIM H;  3SZP A;  4F55 A;  1F1Z A;  2PMZ N;  4M73 A;  5L3B A;  1UG2 A;  4S0H B;  4H0E A;  1WRJ A;  4KIT B;  5JFR A;  2HKX A;  3LA2 A;  1WJD A;  2P5K A;  1HKQ A;  1Z0X A;  3QAH A;  4M72 A;  2XAU A;  2QA4 I;  2UZK A;  4G7H F;  1AU7 A;  2CV2 A;  2LMD A;  3NAR A;  1EF4 A;  5DTD A;  1R7J A;  1NHA A;  4I98 B;  3OY9 A;  2HGC A;  1VQ5 I;  3OS0 A;  2R7R A;  2XRN A;  1E3H A;  3F23 A;  1OCO H;  2L9N A;  4U87 A;  4CXF A;  1Y0U A;  1D1C A;  5FRM A;  5FJ8 J;  2LH9 A;  2NVY J;  2OCC H;  5CLS A;  3EDP A;  3WOD F;  1K78 B;  3GO5 A;  1LDK B;  1D5V A;  3HOU J;  4M71 A;  4EJO A;  2JSP A;  3K4C A;  4MEY F;  3BP8 A;  2R92 J;  2M7B A;  2DW4 A;  4B43 A;  3CDI A;  4BHB A;  5IYB J;  1UHS A;  2KQR A;  3HUG A;  3KET A;  3HM5 A;  2I5U A;  1YW9 A;  4BXU A;  4D7M A;  4E6K G;  2XPU A;  4A3C J;  2PJR A;  4B3X A;  5ERI A;  3NEU A;  4CO8 A;  4UUS B;  4M3F A;  1ZYR F;  3PFI A;  3ZMD A;  4E7Z A;  2A68 F;  3HRS A;  4YFN F;  2CV1 A;  1UHW A;  4DQ2 A;  3ZCO A;  2QBY A;  5EG0 A;  1OCZ H;  1XGN A;  2RKH A;  3GWZ A;  2FBH A;  3O6B B;  3HOS A;  1I6H J;  1N78 A;  1JKQ C;  1N77 A;  2A6H F;  1Y8Q B;  3IWZ A;  1ENH A;  3W6J B;  4A0X A;  1OJL A;  4HNU A;  3I4P A;  3BR6 A;  3K4M A;  2Z1D A;  3VYR B;  1MDM B;  1D5Y A;  1FNN A;  2STT A;  4BY1 J;  2B63 J;  3GLX A;  4IRG A;  1JGG A;  2GAU A;  4YEJ A;  5BQT A;  3NRV A;  2LF8 A;  1GUU A;  1EH7 A;  3PJR A;  2IS6 A;  2A6E F;  3JAM K;  2KPM A;  1T0F C;  2V9P A;  2YX4 A;  2VPL A;  3HPH A;  5DUI A;  1K83 J;  1XMA A;  1CF7 A;  4L18 B;  4GXO A;  3ZP5 A;  3D5L A;  4D7N A;  1BI1 A;  3IAM 2;  5CKT A;  3DLA A;  5D6F A;  2P7C B;  2QCO A;  5FKK A;  4IPA A;  4RGX A;  5LRS A;  1LUJ B;  1YW8 A;  2EZK A;  2HDD A;  3QRF F;  2JA5 J;  1PP7 U;  3LA7 A;  4HQM A;  2V1D A;  2VKE A;  4FE4 A;  4M9Z A;  3ESW B;  5D4R A;  1BM9 A;  1RR8 C;  1JJ8 C;  1C0W A;  1IF1 A;  2LVS A;  4E70 A;  3CCJ I;  3DTK A;  4KN7 X;  5EEA A;  5HLG A;  1XSD A;  2ZXH A;  1S9H A;  4XLE A;  2UV1 A;  4G8X A;  1UMQ A;  2ADU A;  2DMP A;  4D1Q A;  3FMR A;  3AAF A;  2K4B A;  3AG1 H;  3K4N A;  2QSF X;  4G12 A;  1E17 A;  1FX7 A;  3P9I A;  2VPR A;  1IXC A;  1ZKG A;  3R60 A;  2P81 A;  1KU2 A;  4BH9 A;  1FPQ A;  4RAY A;  3GW2 A;  4P5O A;  4ZZL A;  3A1Y A;  1VQ7 I;  1FSE A;  4HV5 A;  1JT6 A;  1FYM A;  1IN7 A;  3KLO A;  1CQT A;  1T56 A;  4HNT A;  3DKX A;  2WB1 N;  3CMY A;  2ZJR F;  1RRJ A;  1P4X A;  5C4X J;  5L3D A;  4XN0 A;  1FLI A;  5IP7 J;  1R5I D;  4XL9 A;  5GTH C;  2DA4 A;  3CC4 I;  1RPW A;  2EWN A;  3I56 I;  3E97 A;  4XBF A;  1SD4 A;  1J0R A;  2VJ4 A;  3OSG A;  2HDC A;  2GA2 A;  2DFH A;  2R5Z A;  3FIW A;  3VEP A;  2WC2 A;  4NC7 A;  1LVK A;  3WU0 A;  2FOK A;  5FO5 A;  5IP6 A;  3J7Y J;  1MMD A;  4P9U A;  2MC4 A;  4R1H A;  4O5V A;  3L1P A;  4RBO A;  2M5W A;  1Y6I A;  4OU0 A;  2KJB A;  3KEO A;  5J4Y A;  1LFU P;  4UVC A;  3HDD A;  2JTV A;  3IRR A;  4D9J A;  4DYC A;  1U5T B;  4EQQ A;  2OV7 A;  3OOU A;  1R1T A;  3HKZ N;  3T1B A;  5DUK A;  3BR0 A;  5F1J A;  1LEB A;  1TLH B;  3S14 J;  1D8K A;  2GOM A;  3MZY A;  3TQN A;  2HQ5 A;  1OCP A;  5IY5 H;  5C44 J;  2DT7 B;  1V54 H;  5TIS C;  3H3U A;  1SFX A;  2F48 A;  3HHG A;  3V8L A;  3X2Q H;  2CFO A;  4XKC A;  3GTP J;  3RQ4 A;  1B59 A;  1K4S A;  2R7U A;  3G2B A;  1WH5 A;  2GWR A;  1FEX A;  1TWF J;  1Z6R A;  2M3A A;  2NS0 A;  3BC8 A;  1UB9 A;  2JUG A;  4A12 A;  5JR3 A;  1BR2 A;  1J9I A;  4V2G A;  5LEK A;  5K7H A;  4D5F A;  3D5R C;  2HI3 A;  2X1C A;  2NVU B;  4XKB A;  3E5U A;  5IYD J;  1TQM A;  1WPK A;  1U5T C;  2V1N A;  4NDL A;  2JJ7 A;  2H8W A;  3B73 A;  2VBX A;  4XNF A;  3C1D A;  3HSE A;  1TQP A;  5CYV A;  3GCM A;  5BS6 A;  2EQR A;  2QQ8 A;  2DK8 A;  4L9N A;  3FHN A;  4KT5 C;  1Y39 A;  1Z3Y A;  3CCR I;  4AID A;  4I09 A;  3ROU A;  4R8H A;  4C2U A;  1HDD C;  4G7Z F;  4AIK A;  4GRI A;  4B09 A;  3N4M A;  2QSG X;  3OV8 A;  2DPU A;  3HB9 A;  4HBL A;  1U8B A;  1R6R A;  2AXT C;  4RLF A;  3REO A;  4XON A;  3S15 J;  2M9H A;  3M9A A;  4ZZD A;  3I58 A;  5KCM A;  1EA3 A;  1MMA A;  2IA0 A;  3EET A;  3GTJ J;  1SFU A;  1J59 A;  4B1R A;  1UJ8 A;  4EM0 B;  3HC7 A;  1E3P A;  3V8K A;  1S7O A;  4A3E J;  3S16 J;  1J7K A;  1W7P B;  5CVU A;  1J5Y A;  3FF5 A;  1B9N A;  3MKY B;  3QQA A;  3JRC A;  3LSJ A;  1VQK I;  2ZNY A;  1YYV A;  4OOI A;  2QZ8 A;  2ZKZ A;  3WTZ A;  2WBM A;  1KA8 A;  2PN6 A;  3VOD A;  4DGW B;  1G3Y A;  4GCV A;  5FB2 A;  2D2W A;  5IT9 Z;  3TO9 A;  1SD7 A;  4HPQ A;  3TDU C;  4RB2 C;  2H6B A;  2DT6 A;  2VXZ A;  1D3Y A;  4CIC A;  1RET A;  2E2J J;  4EGZ A;  2DOD A;  2IXS A;  1X3Z B;  3WHC A;  2XRL A;  3S3O A;  3PQJ A;  4HV6 A;  1UHM A;  1S7E A;  1YW7 A;  1R36 A;  2DA1 A;  1U0J A;  1ON2 A;  2DJI A;  3FXO A;  4CUG A;  1Z7U A;  4U7B A;  3L2V A;  3I9V 2;  1P4W A;  1XGS A;  2CYY A;  4P1W A;  4PFO A;  1SMY F;  1TT0 A;  1TNT A;  2X6X A;  3ASO H;  4RGR A;  1ZAR A;  2LK2 A;  2YS9 A;  2P5L C;  3KP7 A;  2OZ6 A;  3F6V A;  5LGT A;  5LGU A;  1XDS A;  4EEF G;  1FMV A;  2RNJ A;  5LHI A;  3PNV A;  4Y17 A;  2XVC A;  2ID6 A;  2KDO A;  2Z33 A;  1YIT I;  3C3W A;  5E79 C;  5HNH A;  3PQK A;  1XMX A;  2LYC A;  2DPD A;  3MZ8 A;  5IOZ A;  2DA5 A;  1TWG J;  2FOW A;  2H8R A;  1LQ1 A;  3G1M A;  1T08 B;  1NK2 P;  4XOP A;  3S8P A;  3VB2 A;  3E1S A;  4ESB A;  5BNG A;  1OCC H;  1W0U A;  4IHX A;  2EA2 A;  3CME I;  2L7K A;  4D0P A;  1FOW A;  4NC6 A;  3ZMS A;  4PUS A;  4IHW A;  4MNU A;  2HVQ A;  4V2F A;  2XGX A;  4MIM A;  1SVL A;  2O8X A;  4DYR A;  3CCL I;  3CC2 I;  1WVR A;  2WA0 A;  4UUS A;  1SVM A;  1BR1 A;  3OYE A;  2DCE A;  3S2D J;  1DPR A;  2RV8 A;  3ZQF A;  5DM6 F;  3HTU A;  1APL C;  5K5Q A;  1RZ4 A;  2VIX A;  4BE0 A;  3G3Z A;  4XM3 A;  2W4S A;  1S29 A;  4L5E A;  4BGD A;  3WTX C;  1IN5 A;  1G6N A;  1R5H A;  4A3B J;  2G0E A;  2O3F A;  1M1E B;  4C2M J;  4EGY A;  2ZJP F;  5GAG J;  3COA C;  2LP0 A;  5J3L A;  1P7J A;  4XLA A;  2ZO4 A;  1VQP I;  4EJW A;  4LFU A;  1MDM A;  2CG4 A;  2HYF A;  3VYT B;  1D1A A;  1BJZ A;  2HS5 A;  3H9J A;  2UUZ A;  2WAD A;  1ORK A;  1QPM A;  3CUO A;  5F0F A;  1QO0 D;  4KIF A;  4ENK A;  2A07 F;  2PJR B;  4HLY A;  2M30 A;  2E1M B;  1FWZ A;  3V8J A;  1X3W B;  1ETV A;  3JTH A;  3K70 C;  3SXY A;  4UUV A;  1K6Y A;  2FRH A;  2VQH A;  2L9V A;  2DA7 A;  2JA6 J;  3V42 A;  2N8G A;  1JKP C;  4UNO A;  2R93 J;  2QBY B;  5EG0 B;  3BR5 A;  5E3L A;  4BQN A;  3E7L A;  4IX7 A;  4WXD A;  1DGR M;  3HTS B;  2BHZ A;  3PFY A;  3JRA A;  5M3M J;  3HRU A;  5LBQ A;  1WGX A;  2DA3 A;  3D0S A;  2K4J A;  4IF4 A;  2KIF A;  2ICW G;  4PFP A;  3L2Q A;  2DA2 A;  1YHQ I;  3QOE A;  3HGY A;  4HQE A;  2A3S A;  2E1M C;  2L7Z A;  3E0J B;  4UB6 C;  5FD6 A;  1HST A;  2WAQ A;  3HJE A;  3S3M A;  1SEU A;  1FYK A;  4J19 A;  4F7Z A;  2X6Y A;  2F2E A;  5L3C A;  3P9C A;  1PUF B;  1EKE A;  2VON A;  1RES A;  3O8G A;  1LDJ A;  3KZZ A;  5CVJ A;  3AFH A;  1UFM A;  3K6G A;  2R7X A;  1MH4 A;  4U0W A;  1DUX C;  2LY2 A;  2ZFU A;  4MGR A;  3TOA A;  3KP5 A;  3OYN A;  4XLC A;  3T0Y A;  2UXN A;  1RR7 A;  2Y30 A;  3J80 Z;  2KDZ A;  4Y7N J;  3OSF A;  2IGN A;  2M2E A;  4YIR X;  2AS5 F;  1VQL I;  1QQI A;  3P9K A;  4IOA F;  2CSO A;  4LK0 F;  1LJ9 A;  2XAG A;  1GVD A;  2L9R A;  3FBI B;  3ABL H;  2A5Y B;  3H1C A;  1BOA A;  3CD6 I;  4KN4 X;  3SQN A;  3RQI A;  1YFH A;  2ZME A;  4CYC B;  5BMZ A;  2DMQ A;  1AA7 A;  4LIU A;  2VKV A;  1MGT A;  3FXK A;  1D8J A;  2A6T A;  2EIJ H;  2H1L A;  3LMM A;  3OYF A;  1QGP A;  2QYO A;  4BS9 A;  1WCM J;  3OWT A;  1U5T A;  2K9L A;  2O61 A;  5JHF A;  1LVA A;  2CWE A;  1BC7 C;  3ZQC A;  2CV0 A;  4E7S A;  2WY7 Q;  1ZRC A;  2YU9 J;  1MH3 A;  4A0Y A;  2IS1 A;  4XK4 A;  4BAY A;  5E8I A;  5F0C A;  2VN2 A;  5E1W A;  2JVH A;  2R0Q C;  1R9T J;  3KYC B;  1SC7 A;  3I53 A;  2GQQ A;  1JXS A;  1LFB A;  4FCY A;  2D5V A;  2R5Z B;  1U9N A;  5FLX K;  5D6E A;  4BU2 A;  2HQN A;  2GOX B;  3K1N A;  1SD6 A;  2CQQ A;  4P96 A;  3KEY A;  4ZYD A;  2ELK A;  3U2R A;  2LKX A;  5GAE J;  2M87 A;  2MYS A;  5EYR A;  2DQR A;  4CZC A;  3ZQH A;  2WAF A;  3WTT C;  5LFA A;  3W2A A;  1JUP A;  4C3I J;  4RM2 A;  4BAC A;  2ZFW A;  1YI2 I;  2OBP A;  1R4M B;  1N75 A;  2EB7 A;  2JK3 A;  1FY7 A;  1MW7 A;  3DPT A;  5IYC J;  5L3G A;  4A3F J;  3M1C A;  2Q0O A;  4ETS A;  2RRE A;  3CJN A;  1NTC A;  3K9T A;  1K61 A;  1LPQ A;  4LB6 B;  1REP C;  4CDG A;  4YG2 F;  2LSO A;  3DPL C;  4KMF A;  2F5F A;  3HBL A;  2EFQ A;  1FC3 A;  4BQA A;  2XF5 A;  4QSH A;  2XSD C;  3KP2 A;  3CLQ A;  1ZG5 A;  3S17 J;  2HOA A;  2CQN A;  1MBF A;  1GV2 A;  1DPU A;  2Q2E B;  1S6L A;  2MLK A;  2KRC A;  2XKO A;  1MBG A;  3IWF A;  4A3M J;  3QU3 A;  3GLL A;  2RQQ A;  2R3S A;  3RKW A;  2BW3 A;  2EV6 A;  1IXS B;  5B66 C;  1VQO I;  2VBY A;  4M6Y A;  1SVO A;  1HQC A;  2PFB A;  4FTH A;  4Z6Y A;  4ZYA A;  1R1U A;  2K9M A;  3BCB A;  3H92 A;  3QPH A;  4D5C A;  4U0Y A;  1NK3 P;  3GTG J;  3RKQ A;  5AON A;  2VC0 A;  4EM1 A;  4X1E A;  2EPF A;  2R7Z J;  2P4W A;  1LB2 A;  1AWC A;  1YIJ I;  5E17 F;  3I3L A;  4PJ0 C;  4OMY A;  4CCL A;  2ZSH B;  4XKV A;  3K10 A;  4E7L A;  1KQ8 A;  4BQO A;  4DZJ A;  2Y0S N;  4AYB N;  1X4P A;  2CRG A;  2IGO A;  4HZF A;  3B02 A;  4PJM A;  5GP9 A;  4ON0 A;  3D1N I;  2XAQ A;  3S32 A;  2HXO A;  3J81 Z;  3I4M J;  2Y0M A;  3S1M J;  2YPR A;  2MD5 A;  3RPU A;  1NG7 A;  2KRH A;  4Q4Z F;  3BY6 A;  3G73 A;  3FIS A;  3K1P A;  4XN3 A;  1AKH A;  3HOY J;  2JQ7 A;  2DJN A;  4HF1 A;  3J7Z I;  5JLX A;  3BG5 A;  4XRF A;  4A93 J;  1I3Q J;  3L2R A;  5DEQ A;  2E7W A;  1B1B A;  2V1X A;  2JZY A;  1UCR A;  1I50 J;  2BY2 A;  1F4K A;  5E1X A;  2KMU A;  1QVU A;  4A69 C;  3TP0 A;  1QPI A;  2M8E A;  1U8R A;  2QF7 A;  5GTI C;  4ZDL A;  2QQA A;  5F6F A;  1DP7 P;  4QWQ A;  4EV0 A;  3M4O J;  1Q1V A;  1WKM A;  2LTP A;  4M3D A;  5M5Y J;  3OMY A;  1F36 A;  4PK4 A;  2FQ3 A;  4ANJ A;  1Z6T A;  4U88 A;  1WHU A;  3O3K A;  2W57 A;  2GLO A;  2Z16 A;  3DPU A;  4LIT A;  5CJ9 A;  1IDY A;  3O8H A;  3KIO A;  5IT3 A;  4DYQ A;  3O2P E;  3CO6 C;  2G7H A;  2V7F A;  4M74 A;  1IV8 A;  4FHT A;  2JRM A;  4A3J J;  3LQR A;  5DCM B;  3T8R A;  2VUM J;  2ESH A;  4HG2 A;  1A04 A;  4B3A A;  1MBJ A;  2K9Q A;  1MBK A;  1RKW A;  3W6V A;  3BQZ A;  3M3Y J;  2O0Y A;  2IT0 A;  4I01 A;  3IRQ A;  2Z99 A;  1I5Z A;  1YG2 A;  1WWX A;  2OQR A;  1XC5 A;  1BIA A;  5KAF C;  2DOF A;  1W36 C;  1OKR A;  4P9F A;  3GXO A;  4S05 A;  1YX3 A;  1X2M A;  2Y75 A;  4IJA A;  3CLO A;  1MBE A;  4F92 B;  3F8N A;  5DDG A;  1JTY A;  4MHG A;  3WGI A;  3DKY A;  1R00 A;  3BZC A;  1V3F A;  2PMH A;  2VI6 A;  5LHH A;  3J7A O;  4DW6 A;  3BG9 A;  1RC9 A;  2VT3 A;  1K7A A;  1QHG A;  3SYT A;  3QPT A;  5ICG A;  1HSJ A;  4PDK A;  3BZK A;  3I54 A;  3GTL J;  2CMP A;  4RB1 A;  3KZI C;  2DBB A;  1UG0 A;  4O3M A;  2FML A;  3DBL B;  2M4G A;  4PGH A;  4Z2Y A;  3S2W A;  1Z9C A;  3T8T A;  1W36 D;  4G6T B;  2DYR H;  5H6R A;  1FIA A;  1PUF A;  4ENJ A;  2OC6 A;  4HX4 A;  1PYV A;  2Z3Y A;  4BYY A;  3DQV C;  5GAD J;  1K6O A;  2EIN H;  2W85 A;  2BY0 A;  5DS9 A;  1XCB A;  2PMZ A;  4LOC A;  4IHS A;  1XTA A;  3DTE A;  2XC7 A;  1LKX A;  5D5X B;  2PX9 A;  2R7Q A;  1TWA J;  2F6C A;  5EEG A;  2DMU A;  3ZRG A;  3WHB A;  2LR8 A;  2XB5 A;  4XRM A;  2OQG A;  4UUT A;  3OYJ A;  3DU6 A;  2DO7 A;  3RZD J;  1VQN I;  1HA8 A;  1KU3 A;  2WAE A;  3GZ6 A;  4LLG F;  2ZJ2 A;  4ZTF A;  3G1O A;  3OIO A;  1FMW A;  2XAJ A;  4W1U A;  1O4X A;  4DJA A;  4GYG A;  3LOC A;  1X2N A;  4CYC A;  1DP3 A;  3PUF A;  4EJU A;  1W0T A;  4Y13 A;  4AD9 A;  1OYY A;  3ZGK A;  1K79 A;  3TO7 A;  3KYL A;  1UEL B;  1IAW A;  3GME A;  2ISZ A;  1BA5 A;  1I27 A;  1E3O C;  5KVR A;  4L0Y B;  2G9W A;  2KFD A;  4NC8 A;  3RYP A;  4LG3 A;  2EZL A;  3SEZ A;  2KL4 A;  3NAU A;  1HKS A;  1I1S A;  1S5L C;  4XMY A;  3GTO J;  2XRO A;  3L9F A;  1NG6 A;  2I8D A;  2E71 A;  1OR7 A;  2ME0 A;  3JAM Z;  1OCR H;  4L9V A;  1H9T A;  3S1R J;  2VQC A;  2FUG 2;  2ZXI A;  2IGM A;  2KKO A;  3DBR B;  2F5V A;  3L7W A;  5HS9 A;  2MG4 A;  2XF6 A;  1IRX A;  2DTZ A;  1A6Q A;  2J5P A;  5E3O A;  1BOB A;  2ZME B;  5TRD A;  1MMS A;  1WQ2 A;  4UV8 A;  1MMN A;  2COM A;  3ZQQ A;  2LY9 A;  4E7I A;  1VFC A;  1O7L A;  1RUN A;  2CS3 A;  3IH2 A;  4I7H A;  1X1C A;  2X85 A;  1X1B A;  5HOD A;  3QYE A;  2HTJ A;  1MNE A;  2JPB A;  3RJP A;  3JRF A;  1HW5 A;  3HL2 A;  3MKW B;  5LRR A;  2UXX A;  1LEA A;  3OL4 A;  1YJN I;  1OCT C;  3FM3 A;  2XGC A;  5E3M A;  4A3I J;  4I76 A;  1SFE A;  2KRF A;  2QM3 A;  3GYH X;  5J40 A;  3VFZ A;  1ZEL A;  2ZME C;  3LSM A;  2WV1 A;  3CJR B;  3VWB A;  3HZJ A;  5GPC A;  2DOA A;  3QP6 A;  2COB A;  1P2F A;  3N05 A;  3PO2 J;  3HSF A;  1V55 H;  2QSH X;  2M4K A;  4EMS A;  2ISY A;  2CJJ A;  4PZJ A;  3IH4 A;  2JVG A;  5B5E C;  4CCO A;  5HS8 A;  2Q2E A;  1WFX A;  2LF7 A;  3PIP F;  2HOT A;  3IKV A;  4KIB A;  5HOO A;  1XS9 A;  2V9K A;  1HCR A;  1IRG A;  1VQ6 I;  3CES A;  3QU6 A;  2LLK A;  3Q5F A;  1YJW I;  5IOY A;  1BW5 A;  2HEO A;  5ICC A;  2V6E A;  3HOV J;  3BG3 A;  2L4A A;  4CCK A;  3SJM A;  2YR2 A;  4LK1 F;  4X6A J;  2Y2Z A;  2X6O A;  2LFB A;  1TWC J;  5DYM A;  3M7G A;  4RB3 C;  5EDN A;  4CA0 A;  2OTJ I;  4JX6 A;  2R7D A;  2IAI A;  3TL4 X;  1KU7 A;  4V19 K;  1SMT A;  5ILS A;  1ETX A;  5FRO A;  2JUC A;  3F8B A;  1WJA A;  4A0Z A;  3R4K A;  1H9G A;  2VL8 A;  1GVJ A;  1BW6 A;  2IP2 A;  3CMA I;  4BEH B;  1U6G A;  4Q47 A;  4BXX J;  3NWT A;  2BBY A;  2WB1 A;  4OWR B;  2OA4 A;  5L3F A;  1ODD A;  1SAU A;  4E7K A;  4CGZ A;  1XB4 A;  4KA4 A;  3LSH A;  3OYD A;  1QHH D;  1R4N B;  2ECC A;  2F5E A;  3OR1 C;  3CCM I;  1JE8 A;  3U1K A;  4QTR A;  5BPI A;  2BW3 B;  3FHZ A;  5E8G A;  2Z9O A;  1Z7L A;  4IHY A;  2QKL B;  3TW7 A;  1GV5 A;  3BDD A;  2MA3 A;  1B72 A;  5JHU A;  4BUP A;  4EJV A;  3K4B A;  2E35 A;  4OAZ A;  4NBQ A;  3H5N A;  1UST A;  2H1K A;  6PAX A;  4OMZ A;  3L00 A;  4MLO A;  2F5D A;  2HFH A;  2LOO A;  2HYG D;  4P55 A;  5JI6 A;  5J4V A;  3CMM A;  3HKZ A;  1HC8 A;  1TL8 A;  5FKL A;  3KP3 A;  4C2T A;  3FXU A;  2YU3 A;  2ZJQ F;  1XGO A;  1GDT A;  4I02 A;  1P7I A;  1L0O C;  2LKS A;  3L09 A;  3W6K B;  1TWH J;  1G59 A;  4ENN A;  4C3H J;  1ZG1 A;  2KZG A;  2IA2 A;  1AKH B;  2OJE D;  4LB5 A;  3ISP A;  5CVR A;  4AM3 A;  3TKY A;  3Q9V A;  3WE2 A;  1O3T A;  1DDN A;  2F4O B;  3PM1 A;  5F27 A;  2D45 A;  1YLF A;  1XMK A;  3IP4 B;  4YIF A;  5DCM A;  1F9N A;  3DEE A;  2L3D A;  3F0C A;  3QYF A;  1PP8 F;  2AQE A;  2QQ9 A;  2B0L A;  1ERD A;  4PCQ A;  3LFU A;  1W7P D;  3JRE A;  3HHH A;  4H4K C;  2GXB A;  2MGQ A;  2Q8K A;  1I39 A;  2VLA A;  1MD0 A;  2IBD A;  2WAQ N;  2X1D A;  2XAH A;  1X1A A; 
#chains in the Genus database with same CATH homology
 1V54 H;  5B3S H;  3WG7 H;  3X2Q H;  5IY5 H;  3ABM H;  1OCC H;  2OCC H;  2EIM H;  3ASN H;  2EIJ H;  3ASO H;  2DYS H;  3AG3 H;  3AG2 H;  3AG1 H;  2EIK H;  1V55 H;  2DYR H;  2EIL H;  1OCZ H;  2ZXW H;  1OCR H;  3ABK H;  3AG4 H;  5B1A H;  3ABL H;  5B1B H;  2Y69 H;  2EIN H;  1OCO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...