1OCOH

Bovine heart cytochrome c oxidase in carbon monoxide-bound state
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
b'YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 1998-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1ocoH00
1V54H 2EINH 2Y69H 3WG7H 3ABMH 3ABKH 3ASOH 1OCRH 2ZXWH 1OCZH 1OCCH 5B1AH 5B1BH 3AG1H 1V55H 2EILH 3AG3H 3AG4H 3ABLH 3AG2H 3X2QH 2DYRH 3ASNH 2EIMH 2OCCH 2EIJH 2EIKH 1OCOH 2DYSH 5B3SH 5IY5H
chains in the Genus database with same CATH superfamily
2B7EA 5F1JA 1FSEA 1F4KA 3GWZA 3COAC 1KA8A 2GBYA 1GLNA 2ZFUA 2H1LA 3CZ6A 4BJ5C 3SHFA 3NRVA 3FXOA 4A3JJ 4B44A 3GTMJ 1BC8C 2GQQA 2DMQA 1YOVB 1JHHA 4M3BA 3I64A 4IRIA 5IP6A 4EATA 4ZTFA 4EGYA 1PVEA 1HKQA 1ZH5A 3WGGA 2Y69H 3N4MA 2JA2A 3BTJA 3HKZA 3KZIC 2FJ1A 5A2QK 4FT8A 3OR1C 2HOTA 2ZMEC 5D5VB 2MD0A 3CC4I 2LKXA 2JRMA 5FFXA 2R93J 4JX4A 4C30A 2I10A 2CUFA 4UB6C 5LRSA 1K79A 4NDLA 2E1MB 4F91B 1OYYA 3H5AA 1TW2A 2FUG2 5FKOA 1OR7C 2FBKA 5BMZA 2DMNA 3CJQB 4M3DA 2PG4A 5CKTA 4EQQA 4ZTJA 2R7OA 1X3WB 3GTQJ 2IS2A 3M7GA 4CDGA 2JSPA 2Z9OA 4NQWB 5HLGA 3M4OJ 1LEAA 1KYWA 2NOGA 3H0DA 2DT5A 3LMMA 4CCOA 1VNDA 3L2UA 1J9IA 4AIHA 1HXDA 4L0YB 5FB2A 2A6TA 2DMUA 3OS0A 1SD4A 2FQ3A 2HEOA 3TDZC 4QWQA 3BZ6A 1FT9A 2XAGA 4BQOA 4XN3A 1QZEA 1WH5A 3BR5A 5HS7A 2ZSHB 4B43A 5A2QZ 3E6DA 5BQTA 3WGHA 3LAJA 1MNMC 2VBYA 3QYFA 4IJAA 5K7FA 4KT6A 2GOMA 5EG0B 1IN5A 2A05A 2W84A 2BW3A 4OU0A 2IA2A 2ZXJA 3KEYA 3QAHA 2WB1A 5H6RA 5KVRA 4ZYGA 4RB3C 3C7JA 4HF0A 2OA4A 2RDPA 3HHHA 1HBXG 5ILSA 5HNHA 1JKOC 4O6JA 4ESBA 1MSEC 3QRFF 5LEKA 2DA1A 3BQZA 4MQVA 1T2KA 1RC9A 5FRNA 2WY8Q 3IL2A 3ZQFA 1DPRA 2HQNA 4BE2A 1SC7A 1X3UA 4RLQA 1STZA 1R7JA 1VQ6I 2A69F 2GXBA 1QVTA 2LH9A 3WTUC 3LQRA 1YO5C 5DS9A 1BOAA 1ZGWA 1J7KA 2IW5A 3FXKA 3EUHC 2HYJA 2AXTC 3F23A 4EEFG 2PJRA 3HBLA 4EJOA 2M45A 4XOPA 1ETYA 3IH4A 3R4KA 4WX9A 3GMEA 4EJUA 4FX0A 2RAEA 1VTNC 5L3BA 3R6SA 2DXIA 1X2NA 2UXXA 3JTHA 2F48A 2H1KA 2K4JA 2LOOA 1LE8A 1ZELA 1G3SA 5GTHC 4FASD 2NS7A 2KT0A 2OPTA 3SEQA 1YG2A 3CDHA 4P5OA 2DPUA 1FIAA 1YS6A 2ZXWH 4XLCA 5D4RA 1LEBA 2IAIA 5E1ZB 4BHPA 3HKZN 2STWA 2CFOA 1E17A 4XR6A 4UB8C 4HZFA 3ZPLA 4G9YA 4P9FA 4BE0A 4B47A 3DWLE 1W7PA 1X3ZB 1BW5A 5CVJA 2HKXA 4C2UA 2JPCA 1YX3A 3LSGA 3QPTA 3FDYA 1P6RA 4Y52J 3I71A 1QBJA 3JSPA 1XGNA 3OSGA 1LNWA 2XB0X 1WCMJ 3KP7A 3CLQA 3JREA 5ICCA 5CVRA 2LDUA 2H8WA 3JW4A 3MKLA 1R1TA 1UMQA 3K1MA 4XBFA 1Z6RA 3O2PE 4IO9F 4BY7J 4MO7A 1EA3A 1K7AA 3CF5F 4KT5C 1EJ9A 4E7KA 2PQ8A 2NNNA 3P9CA 3ZMVA 4DBRA 3FISA 2H94A 4CYCB 1K4TA 4HF1A 1MH3A 3I58A 2WC2A 4F7ZA 1ON2A 2KIQA 1Z7UA 3ULQB 4RAZA 1D0XA 5BOXA 1ETQA 1LFBA 2WB1N 1MMSA 3MN2A 2M34A 1RETA 3HGGA 1XGSA 3HG9A 1I50J 2DDAA 2P81A 3KE2A 4RS8A 3BQYA 3GZ5A 1YJNI 1TNSA 4BXFA 1D1CA 2R7UA 3R60A 2M8EA 2VKEA 1PJRA 2K3PA 2XPVA 3ECHA 3P7NA 1MMAA 1D8KA 1OMIA 4RBOA 1OCOH 3GZNB 2E1MC 2GAUA 1GXQA 4XKBA 3I4MJ 2EINH 4A0ZA 3HOSA 2MH2A 3HC7A 4ZDLA 3LWFA 2H09A 1IRFA 3V42A 4HG2A 1MNDA 3KZYA 3TO7A 2DQLA 5E18F 3AKZA 2V1DA 2R7XA 4QLCU 1ZRDA 1ITYA 3DF8A 4CSWA 1N78A 2BY0A 1JJ6C 2BHZA 3HSEA 2GIVA 4U7DA 2ETHA 3G71I 1WZ2A 3LSRA 1IN4A 1Z91A 2FQ4A 2PX9A 2QBYA 1MKMA 3FF5A 3S3MA 2FF4A 2K4BA 2IRFG 2XPUA 1OCPA 1W7PD 2RGVA 4E7SA 4QIWN 3RCOA 1VQOI 3BJ6A 1D3YA 4JYKA 1CF7A 2QQBA 3QPSA 3KIOA 2VQCA 3Q5FA 1TWGJ 1NK2P 3M1EA 3JRHA 4BBRJ 1MNEA 3TW7A 2VQGA 4A3CJ 4U0YA 1SVOA 2JT1A 2JRTA 2DT6A 5DUKA 3TGNA 3K2AA 1PUFA 4ZJZA 4MIMA 3K1PA 2G7UA 2MH9A 2VASA 2V9PA 4XL9A 5DEQA 1WJDA 3OYNA 5JHUA 4L9NA 2IJLA 3GTGJ 2X9DA 1A35A 3MMYB 2X51A 1QO0D 4NC6A 1E0EA 2MLKA 4B4CA 1MD0A 2XAJA 2DA5A 4RAGA 4XRFA 4RDUA 4BEHA 3OSFA 3G1MA 2ZNYA 2L7KA 2ECBA 3DQVC 4FHTA 2EK5A 4M3EA 1R6RA 1W5TA 2L7FP 2ZB9A 3FM5A 3JRCA 2R7RA 1LB2A 4OMYA 4F92B 1BA5A 5DD4A 4HDUA 3IH2A 3BR6A 2A3SA 3G4SI 4KJZA 1JGGA 2VC1A 2MLGA 1Y56A 2PMZN 3E0JB 1QHHD 5FKLA 2EZHA 1AOYA 3DTIA 3OYGA 2O9LA 2NVYJ 3GLXA 4NHJA 3DU5A 3FX3A 3M8EA 1J75A 5GP9A 3HOTA 2P4WA 1LDDA 1BR4A 3E6BA 2BBYA 2IPQX 5LGUA 3GFLA 1ETKA 2O3FA 3CUOA 4S0HB 4D7MA 2DDBA 2EFWA 2BY2A 2O8KA 1Z67A 3ZQIA 3LL7A 2LF8A 2W85A 4M6XA 4C2TA 2ZO4A 4LK1F 1J09A 2E7XA 4L5JA 3CC7I 1MBKA 2ESHA 3KP3A 3CMAI 3RQIA 5K5OA 3S1MJ 1G3YA 4N4NB 2JA6J 3PQKA 4BS9A 1MBJA 2EPFA 3QODA 1W0TA 3C2BA 4KDPA 5FLMJ 3ABTA 2LK2A 5LFAA 4R1HA 5FD5A 4DQ2A 3A1YA 2IS4A 1FOKA 1FP2A 3S2HJ 3GXOA 3M9AA 3OYMA 2VKVA 2YX4A 5FLVA 3KZZA 5F0CA 3Q0VA 3RIRA 2C6YA 3L2CA 1DGWY 5F0FA 1UCRA 2HFHA 2N8GA 1CGPA 3JAMK 4BL0B 2HS5A 2M8GX 4C9YA 3MKYB 1FOYA 4UV8A 3DV8A 5BPDA 4UV9A 1IN8A 4KITB 2VT2A 3CDLA 3JSOA 2M87A 4GO1A 4KNYA 3PNTA 2L4MA 3HUGA 3WHCA 5DTDA 1XSXA 3PL8A 1B72B 3F6VA 2NYXA 3TP0A 1PP7U 1IZ1A 1O7FA 3DFGA 1XPXA 2DA7A 2DJNA 2KJCA 2QVOA 1ZG5A 4MNUA 2QSGX 4V2GA 3BR3A 4BKXA 4BH9A 4NB5A 4LLNA 2NVXJ 1DP3A 2CS3A 2NVUB 3KP5A 1UFMA 1IO2A 1YW7A 4R8HA 5HNFA 4BNCA 1SMYF 4BY1J 1HKTA 1QZZA 4ENNA 3VODA 1LUJB 2DO7A 4JX6A 4GFBA 4DIQA 2VOPA 2K85A 2ELKA 3JAMZ 2X6YA 2R7WA 2AHQA 2XF5A 5DYMA 1FTZA 2STTA 3JRGA 5KAIC 2L01A 3DKYA 2K40A 4MHGA 3GTPJ 3V7CA 4KFCA 4XIDA 4FQGA 3I4NJ 1R5ID 2RKHA 1PDNC 1V5EA 4H4KC 1O3TA 3UR3C 3HOUJ 3ERMA 2AO9A 1TZLA 1WPKA 3FKJA 2EQRA 2YS9A 1WI9A 4P9UA 2DAOA 2CUJA 4Y4RA 2L2OA 2LY1A 1K6OA 2WAQA 3I5UA 4AC0A 1J5YA 3DP7A 4E7LA 2VQHA 3KP2A 1RUOA 1O7LA 2E19A 1F1ZA 4MTDA 4DGWB 3ERED 2ACJA 3H36A 3CESA 1D1AA 3ZQHA 5IYDJ 2L7ZA 5L3GA 1T95A 3DPTA 4N9IA 4FX4A 1IC8A 2HXIA 1LFPA 3W2VA 3IRQA 3Q3SA 3VFZA 4LG0A 4NBQA 1ON1A 4YIFA 4HBLA 5IOYA 3I56I 2P6TA 1ETWA 4A3IJ 1D0YA 3DLLF 2LMDA 3VSLA 1DDNA 4AIKA 2DMPA 2XDVA 2UWMA 2VODA 2CV1A 3KCCA 1BI0A 4BQQA 4S05A 1TWFJ 3F22A 2FBIA 5E3OA 3P9IA 3S1RJ 2FBHA 1RR7A 2CYYA 2DOFA 3MZYA 3DLAA 4XRSG 3QOPA 4Z2YA 5TISC 2QM3A 4B3AA 2KP6A 5GADJ 1UJ8A 1U9NA 1LQ1A 1XSVA 4HNTA 2R5YB 5HDGA 3FK6A 5IY5H 4PK4A 3A4CA 3GCMA 4N4OB 4ZH4F 5JLWA 3TL4X 2XAFA 3GFIA 1OCRH 3WHBA 2L9NA 1FYLA 1UG2A 4AD9A 2FA5A 2ZSIB 3KYCB 4D5FA 3LQQA 4CZZA 5HLIA 1O57A 3G73A 3WGIA 3M8JA 2XGXA 2CFXA 3L7WA 3S32A 1R49A 2ISZA 4RAYA 3GTKJ 2ZNZA 3ZN1A 4BJTA 2DFEA 5EGOB 2OCCH 3GUDA 4EM0B 2XF6A 4F55A 1RR8C 2GXAA 3PUFA 3L2RA 1BR2A 3BY6A 2QKLB 2MYSA 3I3LA 3PO3J 1D1BA 2M7AA 2VI6A 4RGRA 3ZCOA 4Y7NJ 1ACIA 1F43A 3WU1B 1LKXA 3ML6A 1OQYA 4CCKA 3DEEA 4E6KG 1K6YA 1I27A 5EF6A 2I8DA 5GAGJ 1U5TA 2KKOA 3K70C 2ESNA 5F1RA 1B8IA 3HPHA 3A0HC 3IKVA 4RGUA 5B5EC 2AS5F 3EPZA 1BIAA 2RREA 1WFXA 3WTXC 5KNLA 1G6NA 2H6BA 2DI3A 1XC5A 4AVZA 1E2XA 1IN7A 1T6SA 2KJBA 3FWEA 1WKMA 4BDYA 2HQ5A 2P5VA 3T0YA 3ZMSA 3RKWA 3RKXA 2WAQN 3MD2A 1WJAA 3EYYA 3Q0WA 2K27A 1MMNA 2HPIA 1O4XA 4MFDA 1HQCA 1TBXA 4OINF 1S7AA 2WV0A 2XKPA 5E3LA 1LPQA 1VQLI 1X1CA 1T0FC 3HOVJ 4KIGA 3T5XA 3QYEA 5JVGF 4Q4ZF 3CCUI 1BI3A 1ETOA 1MMGA 3CQZJ 5M3FJ 3C2GA 4X0GA 1GVDA 4XLAA 2LD5A 2ZBKA 1VQ7I 1FMWA 2JA7J 3N97A 5C4JJ 4MTEA 5FKMA 3GF2A 1Z3YA 2W7NA 4XLNF 3JRBA 1FWZA 5ICEA 1JJ8C 2KLOA 1QPIA 2D2WA 2EWNA 2GIZA 2X6XA 1Z6TA 3BPXA 5HDNA 4HSRA 1DU6A 2WV1A 1VQ4I 4WXHA 3MKZA 4CICA 1S9HA 2KIUA 5FKNA 2IEKA 2XF7A 5IOZA 3JTGA 2Z2SB 1MDMB 2YUSA 5B3SH 2JSCA 1X2MA 2XGCA 2Q8KA 1W5SA 3F9KA 5D5UB 1VQ8I 3HDDA 4W97A 1ETXA 3J7AY 2CRGA 3WTVC 2YU9J 4KN4X 4BYYA 2LBFB 3V8KA 3HM5A 3DXJF 2ADUA 3IH3A 3GTLJ 5J4YA 3LA2A 5K7ZA 4IVNA 4PJLA 1IN6A 1FBUA 2W00A 1YRNB 4A3GJ 3BG6A 3S8PA 2VB6A 3CCYA 2Y30A 4RB2C 1TWHJ 3G3ZA 3OMYA 5EZHA 2R5ZA 4HV5A 4Y15A 1MJBA 4HX7A 1ZTRA 4XMYA 1S3JA 2HZDA 3QU3A 2HQRA 2O61A 5C3EJ 3VWBA 3H5RA 1QHGA 3HJEA 2JK3A 1FC3A 1WI3A 5E1WA 2J5OA 3L1PA 4KYWA 3QWLA 4I0BA 5FD6A 4XNFA 3CCSI 1B6AA 4XORA 1F5TA 3CTAA 5EG0A 1BC7C 3FXLA 2MSYA 2CO5A 1IV8A 2VXDA 3DTKA 3RPQA 2W4SA 2BZTA 1MBEA 1K78A 4OIRF 4KMFA 5EZGA 1SVLA 1ERDA 1G4DA 3PUBA 2P5LC 5F0HA 2UUZA 4JK1X 2M4KA 3FXJA 4EM1A 2LVSA 1TC3C 4R79A 3MVPA 1X1BA 2FSWA 3GVAA 1JUMA 1IJWC 3OYKA 4E7IA 1BI2A 1TQIA 3GBGA 2J5PA 2HNHA 1ZAOA 3ROUA 2KDZA 4WXCA 1JUSA 4N0BA 2LY2A 1XMAA 1R71A 1EF4A 4E7JA 2OU2A 2P6SA 4G6QA 4PFPA 4ENMA 2QQ8A 2TDXA 2DA6A 3A2KA 3CO7C 1Z3XA 3KFWX 5LHGA 2K5CA 4I98B 2E5ZA 4A3KJ 4PJJA 4YFNF 4CA0A 3I55I 3MZHA 4AM3A 4XQFA 1H88C 2A07F 2BY1A 1TL8A 2PFBA 2K86A 5E17F 5GAEJ 4EJWA 3E7LA 3HRMA 1N75A 4HLYA 1T08B 1QVUA 2XHKA 4HSTA 4OWRB 4LG3A 4PJMA 5DM7F 4HRIA 1DQUA 5LHHA 2OJED 2PI0A 2LYCA 2EBIA 2OC6A 2KL4A 4BHCA 4U7BA 2WAEA 2EILH 2V79A 2BHYA 2X4HA 3K4CA 5D8LB 2CJJA 2V7FA 3PSIA 2X0LA 2OV7A 2NVQJ 4RGXA 4G7ZF 1FP1D 3OL3A 4AU7A 3GFMA 2XASA 1EH8A 4A3DJ 3ISPA 1I5ZA 5EEAA 2FOWA 4GYGA 1R22A 4WF2A 2Y0MA 2IGKA 1OYIA 1Z1DA 4B1RA 2IP2A 4LD5A 5EEHA 3E6CC 2HDDA 1I6HJ 2BW3B 2VJJA 2A68F 2ELHA 3HRTA 1SAUA 3L2WA 1Z05A 5LD2C 1QGPA 1WJ5A 5F27A 5CPRB 1REPC 4IHXA 1Y1VJ 1P2FA 1R1VA 4GXOA 2XSDC 1IRZA 2V1NA 4HNVA 3IRRA 2CGPA 3HXLA 4IXAA 4OIPF 2WA0A 2X85A 3DBRB 4ZC3A 1LVAA 3OYCA 5E8IA 4ZYHA 1ZR2A 2HYGD 2DTZA 2K9NA 2X1EA 2XGEA 3CCVI 3LFUA 1RIOH 2EFQA 4V2FA 3ZQ7A 3LA7A 3VEPA 1TWAJ 2GA2A 3K4JA 2L5QA 4A3EJ 1NHAA 2COBA 1R00A 3ZXSA 2L3DA 5JHFA 3A01A 5D5WB 2CUZA 2HU9A 5F6FA 2PJRB 2G0EA 2F4IA 1RUNA 1DPUA 1JI8A 2QSFX 2L54A 2QGUA 2VIXA 2BYVE 1SEUA 4J00A 5BNGA 2E36A 3HIFA 3H0GJ 2HVRA 3DBLB 4HOBA 2OTJI 4JBAA 1UHSA 1LE8B 2E60A 2PMZA 5C44J 3K69A 1QA6A 2FOKA 3FMRA 4IEJA 2M4GA 1G8XA 3FHNA 1UZCA 4PSXA 5DCFA 4CZCA 2XAUA 2KDOA 2GWRA 1ZRFA 2VUMJ 2XROA 2ISYA 4I09A 4J19A 1OCZH 2CSOA 3IP4B 5K5QA 1JXSA 3LNQA 3IKTA 4A6EA 1HSTA 3BR2A 3ONQA 3LFKA 1W7PB 1OPCA 2WAFA 4Q48A 5JFRA 5E3MA 2V1XA 1EKEA 3L2QA 1GV2A 4CCJA 3V4GA 2VE9A 3SFZA 2VJ4A 4YFXF 1MMDA 4Y13A 1GUUA 1UG0A 1V54H 1N77A 4BGDA 4S04A 1YLFA 1IXCA 4KA4A 2R92J 2PLYA 2X48A 4BBSJ 1IAWA 3RZOJ 1ONVA 1PYVA 4B8XA 4AVPA 3OYEA 4HQEA 2LSOA 3S3NA 2EA2A 1XMKA 4UY8I 3S16J 2CQQA 4I7HA 3VYUB 4NNJA 2DCEA 2QWWA 4ON0A 4ASNA 1JGSA 2HQAA 2K7LA 3K4KA 5FKKA 1LDKB 1KQ8A 4KISA 1A6QA 4U88A 1A04A 4G7HF 4II3A 2F5DA 4KICA 9ANTA 2JUCA 1BBYA 3E5UA 2O03A 1VQ9I 3WE2A 2CUEA 4IHWA 2O0YA 2W82A 1B59A 2M3AA 5J40A 3VYSB 1T56A 1RRJA 1IUYA 5F08A 3PFYA 4YFKF 2W25A 4XSZF 3VOEA 1XCVA 3EUAA 3DEWA 3SQNA 2E34A 1H0MA 2VT3A 3H3ZA 4ZYEA 5KHDA 4Y3OA 1ZN2A 1WJFA 3ZMUA 2PN6A 1I1GA 2JWTA 1AKHA 2JVHA 3TKYA 1FX7A 3I59A 4EMSA 2XGDA 3H35A 3B6AA 4BACA 2VONA 2W24A 4LLGF 3PJRA 3FXUA 2BVLA 3IUOA 3V8LA 3HEFA 2PBIA 3LAPA 2VN2A 2HVSA 5ICGA 2PEXA 1S29A 1PP8F 4ENJA 2Y31A 1KQ9A 2D1HA 2OTLI 1OCTC 3L9FA 1S5LC 4TV7A 2KRFA 3EQLF 3TEDA 3JRDA 3MEXA 1R58A 2VLAA 3OYBA 2EB7A 3BTIA 4PCQA 5EDNA 2QBYB 2DFIA 4RMNA 3LSHA 1LFUP 2RNGA 4D9JA 3PIPF 2DA3A 1EH6A 1IXRC 3EETA 5D6EA 2A61A 2XUBA 1FPQA 4HX4A 2LR8A 3CCEI 3CUQA 1OLTA 3ZOBA 2HOSA 3QYBA 3GYHX 2Z3YA 3FXQA 3X2QH 1PUFB 5E8GA 2HPMA 5K5RA 2K3FA 1Y8QB 3FK7A 5GTIC 3WTTC 5M3MJ 2M30A 3U9GA 4J01A 1X1PA 2EIKH 3KYLA 2VC0A 1Y0UA 4U0VA 2FNAA 3HHGA 3KEQA 3ELKA 5ED4A 3LA3A 1B4AA 4D0PA 2OAZA 2R4GA 2DW4A 4FCYA 3SZGA 1OCCH 3RZDJ 3I4PA 3CCMI 2CQKA 4IKFA 1ZKGA 2VOOA 3DPLC 2M5WA 4C3HJ 3DU6A 1ZGAA 3RKYA 4UVAA 1CQTA 1BJZA 1V5GA 1ORKA 5IT3A 1ENHA 4PGGA 3L00A 3SJMA 3IAM2 3D1NI 1ZLJA 3F0CA 4CCLA 2HKOA 4UUSA 5TJJA 4YIRX 3QU6A 1Z0XA 4XONA 1FOXA 4ZYDA 3J80K 5FGMA 3WTZA 5J1UA 2A6EF 2ZXIA 1NG6A 3OYHA 3IV5A 2CU7A 4KMUX 1XX5A 3HOWJ 1D5VA 3I54A 2X1DA 5TGTA 4ANJA 5M5WJ 3ZQQA 2OD5A 1I6XA 4AUXA 1SAXA 4XRSA 2QUFA 2WTEA 5FROA 2NS8A 3A0BC 4YELA 4IOAF 1HOMA 3ABMH 3EUKL 1U9OA 1D8JA 2XB5A 3HRUA 3P5JA 1O3RA 4PUSA 1SVMA 3TW6A 3MCZA 2GA1A 3F8CA 1MBHA 2G7HA 2DJIA 2DTRA 2VQLA 2WY7Q 3H1CA 4LK0F 4A3FJ 2HVQA 2Y48A 5D8KB 4XSXF 3U1KA 2WADA 4ESJA 3PNYA 3BR1A 1YS7A 2MGQA 5F64A 1SFKA 3B6CA 4U87A 3E3VA 3J80Z 1YJ9I 4OAZA 1JTYA 2Y0SA 3MZ8A 4FE4A 2LP0A 2ZMEA 2COMA 4DZPA 3NQOA 2KZVA 3ABKH 3HUGB 3C3WA 4MFEA 2NXNB 3BJOA 1X1AA 2KHMA 4ZDOA 4WCGA 4DNCA 4C3IJ 4HA8A 2XKOA 4AIDA 3AG1H 5ERIA 1OR7A 3CD6I 5DUIA 2CW8A 5HDKA 4LIUA 1WSUA 1SFUA 1E3PA 4F93B 2MBFA 5IYBJ 4A69C 1YE9A 3J7ZI 3OYDA 1XG1A 3SYTA 1TT0A 1XDUA 2QA4I 4QPOA 3ZGKA 1HC8A 4KUMA 4LITA 5DDGA 3TMOA 4YEJA 4YIIA 3WG7H 4U0WA 2OF7A 2XRNA 2LLKA 2KRCA 3OIQA 1S6LA 2Y2ZA 5LGTA 4RA2A 1HW1A 1A5JA 3IHUA 1SFXA 2FMLA 1BW6A 1TNTA 3GO5A 2ZJQF 1BM9A 1FIPA 1HSJA 2QSHX 3ZMTA 2XC7A 3D5RC 4BJ6C 3KPHA 1YJWI 1MZBA 2JPBA 1W5CC 4GYIA 3V7RA 1O3SA 1VQKI 4PJ0C 2F5FA 3J81K 1WJCA 2RQQA 4KIBA 3M3YJ 3TDUC 2IA0A 5D4SA 5H2FC 2JTVA 2R7DA 2CV2A 1MW7A 1H89C 1USSA 4UHTA 2XAHA 4XLFA 4A0XA 1XGOA 3K10A 2ZXHA 4L0ZB 1WRJA 4NUBA 2K9LA 1FY7A 2QF7A 1XB4A 3E1SA 1WWXA 3K4NA 3RDIA 3ABLH 2YSRA 4N9HA 3BG9A 4QPQA 1ZG3A 4RB0A 2GLOA 2Q2EA 5EEGA 1TWCJ 3HGYA 4LG0B 2D5VA 3EUHA 2EJRA 3KYDB 3H3UA 3DPUA 3BC8A 2R7ZJ 1GDTA 2TCTA 1NH3A 2QQAA 2XRLA 4A12A 3ESWB 2XIGA 2AQFA 2DU9A 3R0AA 2FU4A 4XLEA 3HTSB 1Z7LA 1FOWA 2NS0A 1UHMA 4M9ZA 3F6OA 1DGRM 1UAAA 2O5RA 4EM2A 3J81Z 4BE1A 4OOIA 4I6ZA 1YQAA 3F3XA 4IRHA 1XN7A 1B9NA 4O5VA 4XICA 3RQ4A 3CMYA 3WG9A 4ABZA 3MAJA 2KIFA 2IXSA 2JZYA 5L3EA 1X4PA 2Y0SN 4CUGA 1IRGA 5C4XJ 1J2XA 5HODA 3SFIA 4XOTA 3OIPA 1IDYA 1A6IA 3Q9VA 1T39A 1JE8A 3LSIA 2ZKZA 1IW7F 3VYTB 5HS9A 5F04A 1MJ9A 1VQ5I 3FM3A 5HVQC 4A3MJ 2KZGA 4IHTA 2Z16A 3AG2H 1XSDA 4Q47A 4UUTA 4ZZDA 4F52A 1FYMA 1NTCA 2DK8A 3BR0A 4Q5SF 2TRTA 3CMMA 2HDCA 3S15J 4X1EA 4E7HA 5BS6A 3ABUA 3W2AA 2OZ6A 5DCMA 3PO2J 2YPRA 5LRRA 4E70A 4OIQF 4ESFA 4QSHA 1KU2A 2MABA 1GHCA 3BZKA 2ME6A 2FEZA 2QLZA 1SFEA 1U5TB 5LBQA 1R5HA 2W48A 2RVCA 5E79C 1X4OA 1VQPI 2L7MP 5J47A 1B8IB 2LY9A 4ITVA 2VE8A 1E3HA 3E6MA 3SDGA 1TP4A 2UXNA 1AU7A 3RI4A 4G6DA 4EGZA 3ASNH 4IHSA 2Q0OA 3WTSC 2HYFA 1R4NB 5HS8A 5FO5A 3UNGC 4M6VA 2QCOA 2P0WA 4G7OF 3S2DJ 3CCJI 1VI0A 1SFOJ 1W0UA 2P7VB 3V7SA 2NVTJ 2X1CA 3BZCA 3JCUC 1JKPC 4RAFA 5B1BH 2KPMA 5FFZA 3CC2I 4CCMA 1WQ2A 4P1WA 1U3EM 2GM4A 3S93A 4A5NA 2V4JC 1AHDP 2W57A 2MC3A 3L2VA 1GXPA 2XVCA 2EIJH 3G1OA 1U8RA 4DOZA 2B63J 2E1OA 3KLNA 3PNVA 3W6VA 3A03A 3FXMA 5K1YA 2F5CA 4L9VA 4NQWA 3C2HA 1RESA 2HWVA 1P4XA 3I9V2 1Q1VA 1R36A 2FX0A 2JN6A 4D7NA 4XLHA 2QQ9A 2KMUA 5CYVA 1OFCX 1C0WA 1EH7A 2JA8J 3PFIA 5BPIA 3ZQLA 1P9QC 2VJIA 1YITI 1V4RA 1X58A 2R7SA 2L02A 1E3OC 5CQGA 1G3TA 1AWCA 2ECCA 4HEA2 1HLVA 3BROA 1LDJA 3RSNA 4IPAA 2CQNA 4HV6A 4I99C 3SDBA 1HF0A 1MH4A 5EJCA 1T38A 3D5LA 5KCMA 2Y75A 3CJRB 3U1DA 3G1LA 1Y8RB 3S17J 4I2OA 3CCRI 1S7EA 1GT0C 2K02A 3WU0A 4IF4A 3RJPA 3TP3A 4EJTA 3P9KA 4JQFA 1S72I 3ZQGA 3SXYA 4DZJA 3E5XA 2KRHA 5J1YA 3QOEA 4A93J 1O3QA 1ETVA 3CJTB 2PMHA 2IA1A 2R5ZB 4UUVA 1YW9A 4G8XA 1ZREA 3U21A 3TO6A 1Y1WJ 2F4OB 2HTJA 1XD7A 1JKQC 3HSRA 1P7IA 3TOAA 3WTYC 1R4MB 3F8FA 3PQJA 1I1SA 2IT0A 1MGTA 4UVCA 3BTCA 4E4HA 4D1QA 2FRHA 5FLXK 1WH7A 3CP2A 3S1NJ 2BGCA 2E2IJ 4CCNA 1SD7A 2BEOA 4C2MJ 4L18B 3CO6C 4HYEA 3W3CA 2QYOA 2M0CA 4HX8A 3WU2C 1XGMA 2RC4A 3G2BA 1UELB 1IXSB 1B9MA 1DUXC 3OV8A 2M1BA 2CWEA 1XS9A 3ECOA 4LMYA 2D45A 1K78B 3FMSA 4OAYA 4XKCA 3VSKA 1ODDA 2O7OA 3MFKA 4P55A 5H20A 1Z9CA 3A02A 2GOXB 4DYRA 2HTSA 2ZJPF 5GAHJ 1BR1A 4LIVA 3IWZA 3M8FA 4CYDA 1JUPA 2CW0F 2ZFWA 3BP8A 4GRIA 3B73A 4F3QA 4I0AA 2QZ8A 3BOQA 4UNOA 3W6JB 2ID6A 4CXFA 1GVJA 1ZK8A 4HPQA 1KU7A 1FMVA 1OKRA 1QNTA 3E5QA 5JVTA 5FLXZ 1U2WA 3OYAA 2OQRA 2LF7A 5B66C 1YX5A 5ILUA 2JA5J 2EH3A 3EDPA 3FXRA 1Y39A 3DKWA 2V9VA 3BTLA 4XM3A 4DBQA 1JT6A 4X6AJ 4GCVA 2EZIA 4A5MA 2KFDA 1WGXA 1USTA 2XV4S 1VQNI 3C18A 1U5TC 3VPRA 1QU3A 1F36A 2X6WA 2Z1DA 4LOCA 2ICWG 1P92A 2EV5A 3I53A 4HF2A 3S14J 1U8BA 1MBFA 3H9JA 3K4BA 4M71A 4L5EA 1TW3A 4LFUA 4CYCA 3GX4X 1OJLA 5J3LA 2CH0A 4H0EA 3HOYJ 2P8TA 2JQ7A 2CW7A 1KU3A 2MFZA 5KK1A 1D5YA 1QPMA 2D1VA 1HDPA 2FNPA 3GTOJ 4M72A 4G6TB 5L3FA 2HR3A 4M9XA 1NG7A 3CCLI 3AG4H 3ZR8X 1TQPA 3ZQCA 4A0YA 2V26A 5FJ8J 2E7WA 2EIMH 3T1BA 3CLOA 4XLPF 3HPGA 3PSFA 4NC8A 3ZP5A 4XN0A 3H9QA 4FTHA 3TO9A 3HRSA 3BWGA 1FEXA 1P7JA 2MG4A 5GPCA 3ASOH 2CQ7A 5H6QA 3G6EI 1KU9A 1QZYA 4WXDA 3TOBA 1ZR4A 1Z21A 4A2UA 3FMQA 2MC4A 3NAUA 3CJNA 4HNUA 1UB9A 4DJAA 3K2ZA 5IYCJ 4IHVA 4I01A 3HSFA 4RLFA 4A3BJ 2IS1A 3R61A 1H9GA 2XAQA 3DKXA 4JOMA 3HOXJ 3BG3A 3WE3A 2LKSA 3KETA 1BIBA 2KISA 2R7TA 4FETA 3KX2A 3KP4A 2P5KA 1QRYA 3A01B 1ZRCA 4XRMA 1JKRC 1V3FA 2ZC2A 4KN7X 4P96A 3JRAA 1W1WE 3BJAA 2R0QC 1VF9A 5J6XA 1G2HA 1HCRA 3CF2A 1R1UA 4PZJA 5E20A 5FRMA 1BN5A 3SZPA 1IG7A 3VB2A 1V5FA 4BHBA 2Z99A 1FSHA 1YFHA 2DYSH 1TQMA 2IVMA 4ETSA 2HDWA 4IQJA 1BL0A 2VKHA 4L5IA 1XTAA 3WODF 2UV1A 2BXYA 3R0JA 2RN7A 3GLLA 3BCAA 1Y6IA 1FNNA 3JRFA 4HAMA 4DW6A 2DK5A 3J7YJ 4IZZA 4RGSA 4W1UA 3IAS2 4PFOA 1W36D 3NARA 4C3JJ 3LSKA 5LHIA 1RZ4A 2OCEA 2BE5F 1AA7A 1WHUA 1B1BA 3RYPA 2KQRA 3VYRB 3J7AO 3EYIA 2DQRA 4MEYF 1KZHA 5M5XJ 1XDSA 4MQ9F 3OR2C 4MLOA 2K9QA 1POGA 5CVIA 2Y9ZA 1U0JA 3HL2A 2LRDA 2EV6A 3C1DA 1A36A 2EV0A 4MGRA 3DEUA 3TQNA 2WBMA 3RKQA 3Q0UA 4BXXJ 5TRDA 4HQMA 1SMTA 4G12A 3Q9SA 2VBWA 5ILVA 1ZQ3P 3D0SA 2VBZA 5HLTA 3BT9A 3GFJA 3CP8A 2PMUA 5K7HA 1HA8A 3FKIJ 5J1RA 3I0TA 1BOBA 1J59A 1IUFA 2ID3A 4Y33A 3AAFA 4IRGA 3BCBA 2HZTA 3O8GA 4HLXA 1CF7B 2B0LA 2O8XA 3OY9A 3GEZA 5B1AH 3F8BA 3E97A 3IWFA 1BJAA 1YTYA 1OISA 1S7OA 3JR9A 2XSJC 2Z33A 3M07A 5E1XA 1TLHB 2GZWA 4E7ZA 2E2JJ 3BG5A 1AKHB 3H3VK 1I3AA 2ZJ2A 3NWSA 2EZLA 4UXNA 3I59B 3JRIA 3DCFA 3FBNB 3IC7A 4GDFA 1ZGJA 2VPLA 5AONA 1MIJA 3REOA 1IF1A 2F4MB 2OBPA 5JI6A 5GPAA 3ZRGA 2DOEA 2E2HJ 2M9HA 4PSWA 3WTWC 2E1CA 4ZYAA 4XK4A 3FZVA 1K4SA 4XKWA 5E3NA 3O3KA 1SD6A 4BEHB 1B72A 1FJLA 4ENKA 3BLYA 4LJZF 1V55H 4DYCA 5D6FA 4BQAA 1ULYA 3ZMZA 2V9KA 2EZKA 1T0FA 3AG3H 3OL4A 2HXOA 3K1NA 1JTXA 2KIMA 3LSTA 3F8MA 2LKPA 4LGWA 1HW2A 4BXUA 1DU0A 2VJ5A 2ELJA 5CVVA 5JLXA 2NRAC 5EYRA 4AIJA 2IGNA 2F2EA 3HZJA 2G9WA 3KP6A 3QPLA 4RB1A 4HDVA 3RYRA 2DFHA 4CH7A 2VXZA 3CMEI 4M73A 1TTYA 2MA3A 3CUQB 2YX7A 3K6GA 4B09A 3K4LA 2FE3A 2LTPA 1T98A 4B3XA 5D5XB 1D0ZA 4EVIA 3KLOA 3DTEA 2L4AA 4YRVA 4Z6YA 2LNBA 1MSFC 3LSPA 2RNJA 4L9TA 1IRXA 2HGCA 2JMWA 3TBIA 3BDDA 5AIQA 4ZDPA 1HKSA 2FXAA 3D5SC 2L0KA 1Y0NA 3OOUA 1ZLKA 2ZJRF 1I3QJ 3OYFA 3K70D 4IL6C 3MWMA 3F72A 1W36C 4NC7A 5CVUA 2O6GE 2DLLA 2DFFA 2HI3A 2DN0A 3OWTA 3T8RA 3S2WA 1YI2I 2V1UA 2QENA 3ZMDA 2HOAA 2EA4A 2RV8A 3AL0B 2P7CB 4OIOF 2EFPA 1P4AA 1EV7A 3ZN0A 3K7AJ 1VZ0A 1T33A 4UVBA 2X6OA 1VFCA 2OUMA 2DPDA 2QKMB 3AFHA 3HYIA 1YIJI 4UUSB 2ME0A 4G94A 1PUEE 2IBDA 3QP6A 2E5NA 4PJNA 1W4MA 3GW2A 3OS1A 3LSMA 1M1EB 3GTJJ 2NNYA 2ZCWA 1R23A 2FMYA 1L3LA 1HDDC 3NWTA 3HB9A 2A6HF 2R7FA 1K61A 1K83J 2IGMA 3CDIA 4QTRA 5DD8A 1RKTA 3S1QJ 5DV5A 2R5YA 4LB5A 2AXLA 3RPUA 2PJPA 3MQ0A 1F9NA 4FISA 1FZPB 4K2EA 2H8RA 1J0RA 1IDZA 4IOCF 4EJVA 2V6EA 2F5EA 1MBGA 4M74A 2M7BA 1OYWA 4BDZA 1GV5A 3QPHA 3SZTA 1JHFA 3OYLA 5J8CA 1SANA 1HW5A 1P4WA 2DMTA 3K4MA 2DA2A 3OOPA 3PIOF 2R7VA 4B48A 2E35A 3O8HA 1X1DA 2CV0A 1RKWA 4XKVA 1I39A 5IP7J 1ZYRF 1T8IA 1ZG1A 3U2RA 1G3WA 2MW8A 5EGOA 2DOAA 2L9SA 3W2WA 5L3CA 4KIFA 3K0LA 2ZMEB 3FHZA 3N05A 5ICFA 2L9VA 2K9SA 4JP0A 3NEUA 2YU3A 2LG4A 5LGNA 1ZARA 4I76A 1BI1A 2JVGA 1YHQI 1JT0A 2OZUA 4V19K 1WJBA 4PGHA 2YR2A 3H9GA 1N25A 3OS2A 1RI7A 2Y9YA 2UZKA 2EFNA 2BXZA 3HOZJ 4WWCA 2M2EA 1IGNA 1WVRA 5HLHA 3QP5A 3W6KB 1A31A 4M3FA 4IHYA 4RM2A 1YIOA 1QQIA 3S3OA 1YYVA 3OYJA 2VBXA 2VPRA 2HOEA 3H5NA 2FD5A 4AYBA 2I5UA 1UHWA 4A3LJ 5CJ9A 1DP7P 2K9MA 3M1CA 3F8NA 2EFOA 4IQ4A 1IV6A 1U6GA 4WK8F 2LFBA 1Q1HA 2W1OA 3FIWA 4BU2A 3BPVA 2MD5A 5JR3A 1KONA 1RPWA 5AIPA 1R9TJ 1NK3P 5CLSA 4Y17A 1LVKA 2CG4A 1KQ0A 2GXGA 2DA4A 3V8JA 2BY3A 2CMPA 5IT9K 1X19A 2IS6A 2BV6A 3H92A 4JX5A 3HTUA 1VQMI 2E71A 3LSJA 1FBQA 1SD5A 3L09A 5DM6F 3VDXA 4L9JA 3BG7A 4LB6B 1MJAA 4HW0A 5KAFC 2NOJB 2H6CA 3RPUD 4IX7A 3DBHB 5LLQA 3LOCA 1RNLA 6PAXA 4D5CA 3PM1A 4M6YA 2DODA 3F21A 3KEOA 4II2A 5J8FA 2Q1ZB 1KYZA 3MKWB 2DYRH 3K9TA 4FE7A 5J4VA 2QEXI 1H9TA 4LLLA 2B9SA 3CUQC 2A5WA 2IGOA 2L9RA 4M9SA 2Q2EB 5CQEA 4CGZA 1L0OC 2BVMA 2F6CA 2VL8A 1MDMA 4BAYA 1U78A 1R5GA 2V6CA 5IPAA 2JUGA 4BQNA 4O3MA 4RM3A 5IT9Z 3B02A 2CQXA 1S8NA 1YW8A 1XMXA 2F5VA 5HOOA 4A6DA 2WWYA 2LBFA 2R7QA 4DYQA 2VKDA 4YG2F 4I02A 1APLC 3CCQI 3FBIB 4EV0A 1YRNA 1KGSA 2LC2A 2M0MA 1XCBA 2LREA 5LEJA 4MEXF 2RQPA 4ZZLA 1TT5B 2R3SA 3T8TA 2DBBA 3GZ6A 3SEZA 1FYKA 3AL0C 2Z5UA 2XPWA 2H27A 3UKGA 1H8AC 4AWXB 1FBSA 3OIOA 2AQEA 2BOLA 2E1NA 4PDKA 2OQGA 3OYIA 5IP9J 2NAZA 3O6BB 3RTRA 4CO8A 1G59A 4CHUA 5L3DA 1FTTA 1Z77A 2DT7B 2A5YB 1FLIA 1WJEA 1LJ9A 5M5YJ 4M3GA 3QQAA 4OMZA 4GGGA 2JJ7A 4BUPA 5DCMB 1ZHFA 4AYBN
chains in the Genus database with same CATH topology
1V54H 2EINH 2Y69H 3WG7H 3ABMH 3ABKH 3ASOH 1OCRH 2ZXWH 1OCZH 1OCCH 5B1AH 5B1BH 3AG1H 1V55H 2EILH 3AG3H 3AG4H 3ABLH 3AG2H 3X2QH 2DYRH 3ASNH 2EIMH 2OCCH 2EIJH 2EIKH 1OCOH 2DYSH 5B3SH 5IY5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 H;  2EIN H;  2Y69 H;  3WG7 H;  3ABM H;  3ABK H;  3ASO H;  1OCR H;  2ZXW H;  1OCZ H;  1OCC H;  5B1A H;  5B1B H;  3AG1 H;  1V55 H;  2EIL H;  3AG3 H;  3AG4 H;  3ABL H;  3AG2 H;  3X2Q H;  2DYR H;  3ASN H;  2EIM H;  2OCC H;  2EIJ H;  2EIK H;  1OCO H;  2DYS H;  5B3S H;  5IY5 H; 
#chains in the Genus database with same CATH topology
 2B7E A;  5F1J A;  1FSE A;  1F4K A;  3GWZ A;  3COA C;  1KA8 A;  2GBY A;  1GLN A;  2ZFU A;  2H1L A;  3CZ6 A;  4BJ5 C;  3SHF A;  3NRV A;  3FXO A;  4A3J J;  4B44 A;  3GTM J;  1BC8 C;  2GQQ A;  2DMQ A;  1YOV B;  1JHH A;  4M3B A;  3I64 A;  4IRI A;  5IP6 A;  4EAT A;  4ZTF A;  4EGY A;  1PVE A;  1HKQ A;  1ZH5 A;  3WGG A;  2Y69 H;  3N4M A;  2JA2 A;  3BTJ A;  3HKZ A;  3KZI C;  2FJ1 A;  5A2Q K;  4FT8 A;  3OR1 C;  2HOT A;  2ZME C;  5D5V B;  2MD0 A;  3CC4 I;  2LKX A;  2JRM A;  5FFX A;  2R93 J;  4JX4 A;  4C30 A;  2I10 A;  2CUF A;  4UB6 C;  5LRS A;  1K79 A;  4NDL A;  2E1M B;  4F91 B;  1OYY A;  3H5A A;  1TW2 A;  2FUG 2;  5FKO A;  1OR7 C;  2FBK A;  5BMZ A;  2DMN A;  3CJQ B;  4M3D A;  2PG4 A;  5CKT A;  4EQQ A;  4ZTJ A;  2R7O A;  1X3W B;  3GTQ J;  2IS2 A;  3M7G A;  4CDG A;  2JSP A;  2Z9O A;  4NQW B;  5HLG A;  3M4O J;  1LEA A;  1KYW A;  2NOG A;  3H0D A;  2DT5 A;  3LMM A;  4CCO A;  1VND A;  3L2U A;  1J9I A;  4AIH A;  1HXD A;  4L0Y B;  5FB2 A;  2A6T A;  2DMU A;  3OS0 A;  1SD4 A;  2FQ3 A;  2HEO A;  3TDZ C;  4QWQ A;  3BZ6 A;  1FT9 A;  2XAG A;  4BQO A;  4XN3 A;  1QZE A;  1WH5 A;  3BR5 A;  5HS7 A;  2ZSH B;  4B43 A;  5A2Q Z;  3E6D A;  5BQT A;  3WGH A;  3LAJ A;  1MNM C;  2VBY A;  3QYF A;  4IJA A;  5K7F A;  4KT6 A;  2GOM A;  5EG0 B;  1IN5 A;  2A05 A;  2W84 A;  2BW3 A;  4OU0 A;  2IA2 A;  2ZXJ A;  3KEY A;  3QAH A;  2WB1 A;  5H6R A;  5KVR A;  4ZYG A;  4RB3 C;  3C7J A;  4HF0 A;  2OA4 A;  2RDP A;  3HHH A;  1HBX G;  5ILS A;  5HNH A;  1JKO C;  4O6J A;  4ESB A;  1MSE C;  3QRF F;  5LEK A;  2DA1 A;  3BQZ A;  4MQV A;  1T2K A;  1RC9 A;  5FRN A;  2WY8 Q;  3IL2 A;  3ZQF A;  1DPR A;  2HQN A;  4BE2 A;  1SC7 A;  1X3U A;  4RLQ A;  1STZ A;  1R7J A;  1VQ6 I;  2A69 F;  2GXB A;  1QVT A;  2LH9 A;  3WTU C;  3LQR A;  1YO5 C;  5DS9 A;  1BOA A;  1ZGW A;  1J7K A;  2IW5 A;  3FXK A;  3EUH C;  2HYJ A;  2AXT C;  3F23 A;  4EEF G;  2PJR A;  3HBL A;  4EJO A;  2M45 A;  4XOP A;  1ETY A;  3IH4 A;  3R4K A;  4WX9 A;  3GME A;  4EJU A;  4FX0 A;  2RAE A;  1VTN C;  5L3B A;  3R6S A;  2DXI A;  1X2N A;  2UXX A;  3JTH A;  2F48 A;  2H1K A;  2K4J A;  2LOO A;  1LE8 A;  1ZEL A;  1G3S A;  5GTH C;  4FAS D;  2NS7 A;  2KT0 A;  2OPT A;  3SEQ A;  1YG2 A;  3CDH A;  4P5O A;  2DPU A;  1FIA A;  1YS6 A;  2ZXW H;  4XLC A;  5D4R A;  1LEB A;  2IAI A;  5E1Z B;  4BHP A;  3HKZ N;  2STW A;  2CFO A;  1E17 A;  4XR6 A;  4UB8 C;  4HZF A;  3ZPL A;  4G9Y A;  4P9F A;  4BE0 A;  4B47 A;  3DWL E;  1W7P A;  1X3Z B;  1BW5 A;  5CVJ A;  2HKX A;  4C2U A;  2JPC A;  1YX3 A;  3LSG A;  3QPT A;  3FDY A;  1P6R A;  4Y52 J;  3I71 A;  1QBJ A;  3JSP A;  1XGN A;  3OSG A;  1LNW A;  2XB0 X;  1WCM J;  3KP7 A;  3CLQ A;  3JRE A;  5ICC A;  5CVR A;  2LDU A;  2H8W A;  3JW4 A;  3MKL A;  1R1T A;  1UMQ A;  3K1M A;  4XBF A;  1Z6R A;  3O2P E;  4IO9 F;  4BY7 J;  4MO7 A;  1EA3 A;  1K7A A;  3CF5 F;  4KT5 C;  1EJ9 A;  4E7K A;  2PQ8 A;  2NNN A;  3P9C A;  3ZMV A;  4DBR A;  3FIS A;  2H94 A;  4CYC B;  1K4T A;  4HF1 A;  1MH3 A;  3I58 A;  2WC2 A;  4F7Z A;  1ON2 A;  2KIQ A;  1Z7U A;  3ULQ B;  4RAZ A;  1D0X A;  5BOX A;  1ETQ A;  1LFB A;  2WB1 N;  1MMS A;  3MN2 A;  2M34 A;  1RET A;  3HGG A;  1XGS A;  3HG9 A;  1I50 J;  2DDA A;  2P81 A;  3KE2 A;  4RS8 A;  3BQY A;  3GZ5 A;  1YJN I;  1TNS A;  4BXF A;  1D1C A;  2R7U A;  3R60 A;  2M8E A;  2VKE A;  1PJR A;  2K3P A;  2XPV A;  3ECH A;  3P7N A;  1MMA A;  1D8K A;  1OMI A;  4RBO A;  1OCO H;  3GZN B;  2E1M C;  2GAU A;  1GXQ A;  4XKB A;  3I4M J;  2EIN H;  4A0Z A;  3HOS A;  2MH2 A;  3HC7 A;  4ZDL A;  3LWF A;  2H09 A;  1IRF A;  3V42 A;  4HG2 A;  1MND A;  3KZY A;  3TO7 A;  2DQL A;  5E18 F;  3AKZ A;  2V1D A;  2R7X A;  4QLC U;  1ZRD A;  1ITY A;  3DF8 A;  4CSW A;  1N78 A;  2BY0 A;  1JJ6 C;  2BHZ A;  3HSE A;  2GIV A;  4U7D A;  2ETH A;  3G71 I;  1WZ2 A;  3LSR A;  1IN4 A;  1Z91 A;  2FQ4 A;  2PX9 A;  2QBY A;  1MKM A;  3FF5 A;  3S3M A;  2FF4 A;  2K4B A;  2IRF G;  2XPU A;  1OCP A;  1W7P D;  2RGV A;  4E7S A;  4QIW N;  3RCO A;  1VQO I;  3BJ6 A;  1D3Y A;  4JYK A;  1CF7 A;  2QQB A;  3QPS A;  3KIO A;  2VQC A;  3Q5F A;  1TWG J;  1NK2 P;  3M1E A;  3JRH A;  4BBR J;  1MNE A;  3TW7 A;  2VQG A;  4A3C J;  4U0Y A;  1SVO A;  2JT1 A;  2JRT A;  2DT6 A;  5DUK A;  3TGN A;  3K2A A;  1PUF A;  4ZJZ A;  4MIM A;  3K1P A;  2G7U A;  2MH9 A;  2VAS A;  2V9P A;  4XL9 A;  5DEQ A;  1WJD A;  3OYN A;  5JHU A;  4L9N A;  2IJL A;  3GTG J;  2X9D A;  1A35 A;  3MMY B;  2X51 A;  1QO0 D;  4NC6 A;  1E0E A;  2MLK A;  4B4C A;  1MD0 A;  2XAJ A;  2DA5 A;  4RAG A;  4XRF A;  4RDU A;  4BEH A;  3OSF A;  3G1M A;  2ZNY A;  2L7K A;  2ECB A;  3DQV C;  4FHT A;  2EK5 A;  4M3E A;  1R6R A;  1W5T A;  2L7F P;  2ZB9 A;  3FM5 A;  3JRC A;  2R7R A;  1LB2 A;  4OMY A;  4F92 B;  1BA5 A;  5DD4 A;  4HDU A;  3IH2 A;  3BR6 A;  2A3S A;  3G4S I;  4KJZ A;  1JGG A;  2VC1 A;  2MLG A;  1Y56 A;  2PMZ N;  3E0J B;  1QHH D;  5FKL A;  2EZH A;  1AOY A;  3DTI A;  3OYG A;  2O9L A;  2NVY J;  3GLX A;  4NHJ A;  3DU5 A;  3FX3 A;  3M8E A;  1J75 A;  5GP9 A;  3HOT A;  2P4W A;  1LDD A;  1BR4 A;  3E6B A;  2BBY A;  2IPQ X;  5LGU A;  3GFL A;  1ETK A;  2O3F A;  3CUO A;  4S0H B;  4D7M A;  2DDB A;  2EFW A;  2BY2 A;  2O8K A;  1Z67 A;  3ZQI A;  3LL7 A;  2LF8 A;  2W85 A;  4M6X A;  4C2T A;  2ZO4 A;  4LK1 F;  1J09 A;  2E7X A;  4L5J A;  3CC7 I;  1MBK A;  2ESH A;  3KP3 A;  3CMA I;  3RQI A;  5K5O A;  3S1M J;  1G3Y A;  4N4N B;  2JA6 J;  3PQK A;  4BS9 A;  1MBJ A;  2EPF A;  3QOD A;  1W0T A;  3C2B A;  4KDP A;  5FLM J;  3ABT A;  2LK2 A;  5LFA A;  4R1H A;  5FD5 A;  4DQ2 A;  3A1Y A;  2IS4 A;  1FOK A;  1FP2 A;  3S2H J;  3GXO A;  3M9A A;  3OYM A;  2VKV A;  2YX4 A;  5FLV A;  3KZZ A;  5F0C A;  3Q0V A;  3RIR A;  2C6Y A;  3L2C A;  1DGW Y;  5F0F A;  1UCR A;  2HFH A;  2N8G A;  1CGP A;  3JAM K;  4BL0 B;  2HS5 A;  2M8G X;  4C9Y A;  3MKY B;  1FOY A;  4UV8 A;  3DV8 A;  5BPD A;  4UV9 A;  1IN8 A;  4KIT B;  2VT2 A;  3CDL A;  3JSO A;  2M87 A;  4GO1 A;  4KNY A;  3PNT A;  2L4M A;  3HUG A;  3WHC A;  5DTD A;  1XSX A;  3PL8 A;  1B72 B;  3F6V A;  2NYX A;  3TP0 A;  1PP7 U;  1IZ1 A;  1O7F A;  3DFG A;  1XPX A;  2DA7 A;  2DJN A;  2KJC A;  2QVO A;  1ZG5 A;  4MNU A;  2QSG X;  4V2G A;  3BR3 A;  4BKX A;  4BH9 A;  4NB5 A;  4LLN A;  2NVX J;  1DP3 A;  2CS3 A;  2NVU B;  3KP5 A;  1UFM A;  1IO2 A;  1YW7 A;  4R8H A;  5HNF A;  4BNC A;  1SMY F;  4BY1 J;  1HKT A;  1QZZ A;  4ENN A;  3VOD A;  1LUJ B;  2DO7 A;  4JX6 A;  4GFB A;  4DIQ A;  2VOP A;  2K85 A;  2ELK A;  3JAM Z;  2X6Y A;  2R7W A;  2AHQ A;  2XF5 A;  5DYM A;  1FTZ A;  2STT A;  3JRG A;  5KAI C;  2L01 A;  3DKY A;  2K40 A;  4MHG A;  3GTP J;  3V7C A;  4KFC A;  4XID A;  4FQG A;  3I4N J;  1R5I D;  2RKH A;  1PDN C;  1V5E A;  4H4K C;  1O3T A;  3UR3 C;  3HOU J;  3ERM A;  2AO9 A;  1TZL A;  1WPK A;  3FKJ A;  2EQR A;  2YS9 A;  1WI9 A;  4P9U A;  2DAO A;  2CUJ A;  4Y4R A;  2L2O A;  2LY1 A;  1K6O A;  2WAQ A;  3I5U A;  4AC0 A;  1J5Y A;  3DP7 A;  4E7L A;  2VQH A;  3KP2 A;  1RUO A;  1O7L A;  2E19 A;  1F1Z A;  4MTD A;  4DGW B;  3ERE D;  2ACJ A;  3H36 A;  3CES A;  1D1A A;  3ZQH A;  5IYD J;  2L7Z A;  5L3G A;  1T95 A;  3DPT A;  4N9I A;  4FX4 A;  1IC8 A;  2HXI A;  1LFP A;  3W2V A;  3IRQ A;  3Q3S A;  3VFZ A;  4LG0 A;  4NBQ A;  1ON1 A;  4YIF A;  4HBL A;  5IOY A;  3I56 I;  2P6T A;  1ETW A;  4A3I J;  1D0Y A;  3DLL F;  2LMD A;  3VSL A;  1DDN A;  4AIK A;  2DMP A;  2XDV A;  2UWM A;  2VOD A;  2CV1 A;  3KCC A;  1BI0 A;  4BQQ A;  4S05 A;  1TWF J;  3F22 A;  2FBI A;  5E3O A;  3P9I A;  3S1R J;  2FBH A;  1RR7 A;  2CYY A;  2DOF A;  3MZY A;  3DLA A;  4XRS G;  3QOP A;  4Z2Y A;  5TIS C;  2QM3 A;  4B3A A;  2KP6 A;  5GAD J;  1UJ8 A;  1U9N A;  1LQ1 A;  1XSV A;  4HNT A;  2R5Y B;  5HDG A;  3FK6 A;  5IY5 H;  4PK4 A;  3A4C A;  3GCM A;  4N4O B;  4ZH4 F;  5JLW A;  3TL4 X;  2XAF A;  3GFI A;  1OCR H;  3WHB A;  2L9N A;  1FYL A;  1UG2 A;  4AD9 A;  2FA5 A;  2ZSI B;  3KYC B;  4D5F A;  3LQQ A;  4CZZ A;  5HLI A;  1O57 A;  3G73 A;  3WGI A;  3M8J A;  2XGX A;  2CFX A;  3L7W A;  3S32 A;  1R49 A;  2ISZ A;  4RAY A;  3GTK J;  2ZNZ A;  3ZN1 A;  4BJT A;  2DFE A;  5EGO B;  2OCC H;  3GUD A;  4EM0 B;  2XF6 A;  4F55 A;  1RR8 C;  2GXA A;  3PUF A;  3L2R A;  1BR2 A;  3BY6 A;  2QKL B;  2MYS A;  3I3L A;  3PO3 J;  1D1B A;  2M7A A;  2VI6 A;  4RGR A;  3ZCO A;  4Y7N J;  1ACI A;  1F43 A;  3WU1 B;  1LKX A;  3ML6 A;  1OQY A;  4CCK A;  3DEE A;  4E6K G;  1K6Y A;  1I27 A;  5EF6 A;  2I8D A;  5GAG J;  1U5T A;  2KKO A;  3K70 C;  2ESN A;  5F1R A;  1B8I A;  3HPH A;  3A0H C;  3IKV A;  4RGU A;  5B5E C;  2AS5 F;  3EPZ A;  1BIA A;  2RRE A;  1WFX A;  3WTX C;  5KNL A;  1G6N A;  2H6B A;  2DI3 A;  1XC5 A;  4AVZ A;  1E2X A;  1IN7 A;  1T6S A;  2KJB A;  3FWE A;  1WKM A;  4BDY A;  2HQ5 A;  2P5V A;  3T0Y A;  3ZMS A;  3RKW A;  3RKX A;  2WAQ N;  3MD2 A;  1WJA A;  3EYY A;  3Q0W A;  2K27 A;  1MMN A;  2HPI A;  1O4X A;  4MFD A;  1HQC A;  1TBX A;  4OIN F;  1S7A A;  2WV0 A;  2XKP A;  5E3L A;  1LPQ A;  1VQL I;  1X1C A;  1T0F C;  3HOV J;  4KIG A;  3T5X A;  3QYE A;  5JVG F;  4Q4Z F;  3CCU I;  1BI3 A;  1ETO A;  1MMG A;  3CQZ J;  5M3F J;  3C2G A;  4X0G A;  1GVD A;  4XLA A;  2LD5 A;  2ZBK A;  1VQ7 I;  1FMW A;  2JA7 J;  3N97 A;  5C4J J;  4MTE A;  5FKM A;  3GF2 A;  1Z3Y A;  2W7N A;  4XLN F;  3JRB A;  1FWZ A;  5ICE A;  1JJ8 C;  2KLO A;  1QPI A;  2D2W A;  2EWN A;  2GIZ A;  2X6X A;  1Z6T A;  3BPX A;  5HDN A;  4HSR A;  1DU6 A;  2WV1 A;  1VQ4 I;  4WXH A;  3MKZ A;  4CIC A;  1S9H A;  2KIU A;  5FKN A;  2IEK A;  2XF7 A;  5IOZ A;  3JTG A;  2Z2S B;  1MDM B;  2YUS A;  5B3S H;  2JSC A;  1X2M A;  2XGC A;  2Q8K A;  1W5S A;  3F9K A;  5D5U B;  1VQ8 I;  3HDD A;  4W97 A;  1ETX A;  3J7A Y;  2CRG A;  3WTV C;  2YU9 J;  4KN4 X;  4BYY A;  2LBF B;  3V8K A;  3HM5 A;  3DXJ F;  2ADU A;  3IH3 A;  3GTL J;  5J4Y A;  3LA2 A;  5K7Z A;  4IVN A;  4PJL A;  1IN6 A;  1FBU A;  2W00 A;  1YRN B;  4A3G J;  3BG6 A;  3S8P A;  2VB6 A;  3CCY A;  2Y30 A;  4RB2 C;  1TWH J;  3G3Z A;  3OMY A;  5EZH A;  2R5Z A;  4HV5 A;  4Y15 A;  1MJB A;  4HX7 A;  1ZTR A;  4XMY A;  1S3J A;  2HZD A;  3QU3 A;  2HQR A;  2O61 A;  5C3E J;  3VWB A;  3H5R A;  1QHG A;  3HJE A;  2JK3 A;  1FC3 A;  1WI3 A;  5E1W A;  2J5O A;  3L1P A;  4KYW A;  3QWL A;  4I0B A;  5FD6 A;  4XNF A;  3CCS I;  1B6A A;  4XOR A;  1F5T A;  3CTA A;  5EG0 A;  1BC7 C;  3FXL A;  2MSY A;  2CO5 A;  1IV8 A;  2VXD A;  3DTK A;  3RPQ A;  2W4S A;  2BZT A;  1MBE A;  1K78 A;  4OIR F;  4KMF A;  5EZG A;  1SVL A;  1ERD A;  1G4D A;  3PUB A;  2P5L C;  5F0H A;  2UUZ A;  4JK1 X;  2M4K A;  3FXJ A;  4EM1 A;  2LVS A;  1TC3 C;  4R79 A;  3MVP A;  1X1B A;  2FSW A;  3GVA A;  1JUM A;  1IJW C;  3OYK A;  4E7I A;  1BI2 A;  1TQI A;  3GBG A;  2J5P A;  2HNH A;  1ZAO A;  3ROU A;  2KDZ A;  4WXC A;  1JUS A;  4N0B A;  2LY2 A;  1XMA A;  1R71 A;  1EF4 A;  4E7J A;  2OU2 A;  2P6S A;  4G6Q A;  4PFP A;  4ENM A;  2QQ8 A;  2TDX A;  2DA6 A;  3A2K A;  3CO7 C;  1Z3X A;  3KFW X;  5LHG A;  2K5C A;  4I98 B;  2E5Z A;  4A3K J;  4PJJ A;  4YFN F;  4CA0 A;  3I55 I;  3MZH A;  4AM3 A;  4XQF A;  1H88 C;  2A07 F;  2BY1 A;  1TL8 A;  2PFB A;  2K86 A;  5E17 F;  5GAE J;  4EJW A;  3E7L A;  3HRM A;  1N75 A;  4HLY A;  1T08 B;  1QVU A;  2XHK A;  4HST A;  4OWR B;  4LG3 A;  4PJM A;  5DM7 F;  4HRI A;  1DQU A;  5LHH A;  2OJE D;  2PI0 A;  2LYC A;  2EBI A;  2OC6 A;  2KL4 A;  4BHC A;  4U7B A;  2WAE A;  2EIL H;  2V79 A;  2BHY A;  2X4H A;  3K4C A;  5D8L B;  2CJJ A;  2V7F A;  3PSI A;  2X0L A;  2OV7 A;  2NVQ J;  4RGX A;  4G7Z F;  1FP1 D;  3OL3 A;  4AU7 A;  3GFM A;  2XAS A;  1EH8 A;  4A3D J;  3ISP A;  1I5Z A;  5EEA A;  2FOW A;  4GYG A;  1R22 A;  4WF2 A;  2Y0M A;  2IGK A;  1OYI A;  1Z1D A;  4B1R A;  2IP2 A;  4LD5 A;  5EEH A;  3E6C C;  2HDD A;  1I6H J;  2BW3 B;  2VJJ A;  2A68 F;  2ELH A;  3HRT A;  1SAU A;  3L2W A;  1Z05 A;  5LD2 C;  1QGP A;  1WJ5 A;  5F27 A;  5CPR B;  1REP C;  4IHX A;  1Y1V J;  1P2F A;  1R1V A;  4GXO A;  2XSD C;  1IRZ A;  2V1N A;  4HNV A;  3IRR A;  2CGP A;  3HXL A;  4IXA A;  4OIP F;  2WA0 A;  2X85 A;  3DBR B;  4ZC3 A;  1LVA A;  3OYC A;  5E8I A;  4ZYH A;  1ZR2 A;  2HYG D;  2DTZ A;  2K9N A;  2X1E A;  2XGE A;  3CCV I;  3LFU A;  1RIO H;  2EFQ A;  4V2F A;  3ZQ7 A;  3LA7 A;  3VEP A;  1TWA J;  2GA2 A;  3K4J A;  2L5Q A;  4A3E J;  1NHA A;  2COB A;  1R00 A;  3ZXS A;  2L3D A;  5JHF A;  3A01 A;  5D5W B;  2CUZ A;  2HU9 A;  5F6F A;  2PJR B;  2G0E A;  2F4I A;  1RUN A;  1DPU A;  1JI8 A;  2QSF X;  2L54 A;  2QGU A;  2VIX A;  2BYV E;  1SEU A;  4J00 A;  5BNG A;  2E36 A;  3HIF A;  3H0G J;  2HVR A;  3DBL B;  4HOB A;  2OTJ I;  4JBA A;  1UHS A;  1LE8 B;  2E60 A;  2PMZ A;  5C44 J;  3K69 A;  1QA6 A;  2FOK A;  3FMR A;  4IEJ A;  2M4G A;  1G8X A;  3FHN A;  1UZC A;  4PSX A;  5DCF A;  4CZC A;  2XAU A;  2KDO A;  2GWR A;  1ZRF A;  2VUM J;  2XRO A;  2ISY A;  4I09 A;  4J19 A;  1OCZ H;  2CSO A;  3IP4 B;  5K5Q A;  1JXS A;  3LNQ A;  3IKT A;  4A6E A;  1HST A;  3BR2 A;  3ONQ A;  3LFK A;  1W7P B;  1OPC A;  2WAF A;  4Q48 A;  5JFR A;  5E3M A;  2V1X A;  1EKE A;  3L2Q A;  1GV2 A;  4CCJ A;  3V4G A;  2VE9 A;  3SFZ A;  2VJ4 A;  4YFX F;  1MMD A;  4Y13 A;  1GUU A;  1UG0 A;  1V54 H;  1N77 A;  4BGD A;  4S04 A;  1YLF A;  1IXC A;  4KA4 A;  2R92 J;  2PLY A;  2X48 A;  4BBS J;  1IAW A;  3RZO J;  1ONV A;  1PYV A;  4B8X A;  4AVP A;  3OYE A;  4HQE A;  2LSO A;  3S3N A;  2EA2 A;  1XMK A;  4UY8 I;  3S16 J;  2CQQ A;  4I7H A;  3VYU B;  4NNJ A;  2DCE A;  2QWW A;  4ON0 A;  4ASN A;  1JGS A;  2HQA A;  2K7L A;  3K4K A;  5FKK A;  1LDK B;  1KQ8 A;  4KIS A;  1A6Q A;  4U88 A;  1A04 A;  4G7H F;  4II3 A;  2F5D A;  4KIC A;  9ANT A;  2JUC A;  1BBY A;  3E5U A;  2O03 A;  1VQ9 I;  3WE2 A;  2CUE A;  4IHW A;  2O0Y A;  2W82 A;  1B59 A;  2M3A A;  5J40 A;  3VYS B;  1T56 A;  1RRJ A;  1IUY A;  5F08 A;  3PFY A;  4YFK F;  2W25 A;  4XSZ F;  3VOE A;  1XCV A;  3EUA A;  3DEW A;  3SQN A;  2E34 A;  1H0M A;  2VT3 A;  3H3Z A;  4ZYE A;  5KHD A;  4Y3O A;  1ZN2 A;  1WJF A;  3ZMU A;  2PN6 A;  1I1G A;  2JWT A;  1AKH A;  2JVH A;  3TKY A;  1FX7 A;  3I59 A;  4EMS A;  2XGD A;  3H35 A;  3B6A A;  4BAC A;  2VON A;  2W24 A;  4LLG F;  3PJR A;  3FXU A;  2BVL A;  3IUO A;  3V8L A;  3HEF A;  2PBI A;  3LAP A;  2VN2 A;  2HVS A;  5ICG A;  2PEX A;  1S29 A;  1PP8 F;  4ENJ A;  2Y31 A;  1KQ9 A;  2D1H A;  2OTL I;  1OCT C;  3L9F A;  1S5L C;  4TV7 A;  2KRF A;  3EQL F;  3TED A;  3JRD A;  3MEX A;  1R58 A;  2VLA A;  3OYB A;  2EB7 A;  3BTI A;  4PCQ A;  5EDN A;  2QBY B;  2DFI A;  4RMN A;  3LSH A;  1LFU P;  2RNG A;  4D9J A;  3PIP F;  2DA3 A;  1EH6 A;  1IXR C;  3EET A;  5D6E A;  2A61 A;  2XUB A;  1FPQ A;  4HX4 A;  2LR8 A;  3CCE I;  3CUQ A;  1OLT A;  3ZOB A;  2HOS A;  3QYB A;  3GYH X;  2Z3Y A;  3FXQ A;  3X2Q H;  1PUF B;  5E8G A;  2HPM A;  5K5R A;  2K3F A;  1Y8Q B;  3FK7 A;  5GTI C;  3WTT C;  5M3M J;  2M30 A;  3U9G A;  4J01 A;  1X1P A;  2EIK H;  3KYL A;  2VC0 A;  1Y0U A;  4U0V A;  2FNA A;  3HHG A;  3KEQ A;  3ELK A;  5ED4 A;  3LA3 A;  1B4A A;  4D0P A;  2OAZ A;  2R4G A;  2DW4 A;  4FCY A;  3SZG A;  1OCC H;  3RZD J;  3I4P A;  3CCM I;  2CQK A;  4IKF A;  1ZKG A;  2VOO A;  3DPL C;  2M5W A;  4C3H J;  3DU6 A;  1ZGA A;  3RKY A;  4UVA A;  1CQT A;  1BJZ A;  1V5G A;  1ORK A;  5IT3 A;  1ENH A;  4PGG A;  3L00 A;  3SJM A;  3IAM 2;  3D1N I;  1ZLJ A;  3F0C A;  4CCL A;  2HKO A;  4UUS A;  5TJJ A;  4YIR X;  3QU6 A;  1Z0X A;  4XON A;  1FOX A;  4ZYD A;  3J80 K;  5FGM A;  3WTZ A;  5J1U A;  2A6E F;  2ZXI A;  1NG6 A;  3OYH A;  3IV5 A;  2CU7 A;  4KMU X;  1XX5 A;  3HOW J;  1D5V A;  3I54 A;  2X1D A;  5TGT A;  4ANJ A;  5M5W J;  3ZQQ A;  2OD5 A;  1I6X A;  4AUX A;  1SAX A;  4XRS A;  2QUF A;  2WTE A;  5FRO A;  2NS8 A;  3A0B C;  4YEL A;  4IOA F;  1HOM A;  3ABM H;  3EUK L;  1U9O A;  1D8J A;  2XB5 A;  3HRU A;  3P5J A;  1O3R A;  4PUS A;  1SVM A;  3TW6 A;  3MCZ A;  2GA1 A;  3F8C A;  1MBH A;  2G7H A;  2DJI A;  2DTR A;  2VQL A;  2WY7 Q;  3H1C A;  4LK0 F;  4A3F J;  2HVQ A;  2Y48 A;  5D8K B;  4XSX F;  3U1K A;  2WAD A;  4ESJ A;  3PNY A;  3BR1 A;  1YS7 A;  2MGQ A;  5F64 A;  1SFK A;  3B6C A;  4U87 A;  3E3V A;  3J80 Z;  1YJ9 I;  4OAZ A;  1JTY A;  2Y0S A;  3MZ8 A;  4FE4 A;  2LP0 A;  2ZME A;  2COM A;  4DZP A;  3NQO A;  2KZV A;  3ABK H;  3HUG B;  3C3W A;  4MFE A;  2NXN B;  3BJO A;  1X1A A;  2KHM A;  4ZDO A;  4WCG A;  4DNC A;  4C3I J;  4HA8 A;  2XKO A;  4AID A;  3AG1 H;  5ERI A;  1OR7 A;  3CD6 I;  5DUI A;  2CW8 A;  5HDK A;  4LIU A;  1WSU A;  1SFU A;  1E3P A;  4F93 B;  2MBF A;  5IYB J;  4A69 C;  1YE9 A;  3J7Z I;  3OYD A;  1XG1 A;  3SYT A;  1TT0 A;  1XDU A;  2QA4 I;  4QPO A;  3ZGK A;  1HC8 A;  4KUM A;  4LIT A;  5DDG A;  3TMO A;  4YEJ A;  4YII A;  3WG7 H;  4U0W A;  2OF7 A;  2XRN A;  2LLK A;  2KRC A;  3OIQ A;  1S6L A;  2Y2Z A;  5LGT A;  4RA2 A;  1HW1 A;  1A5J A;  3IHU A;  1SFX A;  2FML A;  1BW6 A;  1TNT A;  3GO5 A;  2ZJQ F;  1BM9 A;  1FIP A;  1HSJ A;  2QSH X;  3ZMT A;  2XC7 A;  3D5R C;  4BJ6 C;  3KPH A;  1YJW I;  1MZB A;  2JPB A;  1W5C C;  4GYI A;  3V7R A;  1O3S A;  1VQK I;  4PJ0 C;  2F5F A;  3J81 K;  1WJC A;  2RQQ A;  4KIB A;  3M3Y J;  3TDU C;  2IA0 A;  5D4S A;  5H2F C;  2JTV A;  2R7D A;  2CV2 A;  1MW7 A;  1H89 C;  1USS A;  4UHT A;  2XAH A;  4XLF A;  4A0X A;  1XGO A;  3K10 A;  2ZXH A;  4L0Z B;  1WRJ A;  4NUB A;  2K9L A;  1FY7 A;  2QF7 A;  1XB4 A;  3E1S A;  1WWX A;  3K4N A;  3RDI A;  3ABL H;  2YSR A;  4N9H A;  3BG9 A;  4QPQ A;  1ZG3 A;  4RB0 A;  2GLO A;  2Q2E A;  5EEG A;  1TWC J;  3HGY A;  4LG0 B;  2D5V A;  3EUH A;  2EJR A;  3KYD B;  3H3U A;  3DPU A;  3BC8 A;  2R7Z J;  1GDT A;  2TCT A;  1NH3 A;  2QQA A;  2XRL A;  4A12 A;  3ESW B;  2XIG A;  2AQF A;  2DU9 A;  3R0A A;  2FU4 A;  4XLE A;  3HTS B;  1Z7L A;  1FOW A;  2NS0 A;  1UHM A;  4M9Z A;  3F6O A;  1DGR M;  1UAA A;  2O5R A;  4EM2 A;  3J81 Z;  4BE1 A;  4OOI A;  4I6Z A;  1YQA A;  3F3X A;  4IRH A;  1XN7 A;  1B9N A;  4O5V A;  4XIC A;  3RQ4 A;  3CMY A;  3WG9 A;  4ABZ A;  3MAJ A;  2KIF A;  2IXS A;  2JZY A;  5L3E A;  1X4P A;  2Y0S N;  4CUG A;  1IRG A;  5C4X J;  1J2X A;  5HOD A;  3SFI A;  4XOT A;  3OIP A;  1IDY A;  1A6I A;  3Q9V A;  1T39 A;  1JE8 A;  3LSI A;  2ZKZ A;  1IW7 F;  3VYT B;  5HS9 A;  5F04 A;  1MJ9 A;  1VQ5 I;  3FM3 A;  5HVQ C;  4A3M J;  2KZG A;  4IHT A;  2Z16 A;  3AG2 H;  1XSD A;  4Q47 A;  4UUT A;  4ZZD A;  4F52 A;  1FYM A;  1NTC A;  2DK8 A;  3BR0 A;  4Q5S F;  2TRT A;  3CMM A;  2HDC A;  3S15 J;  4X1E A;  4E7H A;  5BS6 A;  3ABU A;  3W2A A;  2OZ6 A;  5DCM A;  3PO2 J;  2YPR A;  5LRR A;  4E70 A;  4OIQ F;  4ESF A;  4QSH A;  1KU2 A;  2MAB A;  1GHC A;  3BZK A;  2ME6 A;  2FEZ A;  2QLZ A;  1SFE A;  1U5T B;  5LBQ A;  1R5H A;  2W48 A;  2RVC A;  5E79 C;  1X4O A;  1VQP I;  2L7M P;  5J47 A;  1B8I B;  2LY9 A;  4ITV A;  2VE8 A;  1E3H A;  3E6M A;  3SDG A;  1TP4 A;  2UXN A;  1AU7 A;  3RI4 A;  4G6D A;  4EGZ A;  3ASN H;  4IHS A;  2Q0O A;  3WTS C;  2HYF A;  1R4N B;  5HS8 A;  5FO5 A;  3UNG C;  4M6V A;  2QCO A;  2P0W A;  4G7O F;  3S2D J;  3CCJ I;  1VI0 A;  1SFO J;  1W0U A;  2P7V B;  3V7S A;  2NVT J;  2X1C A;  3BZC A;  3JCU C;  1JKP C;  4RAF A;  5B1B H;  2KPM A;  5FFZ A;  3CC2 I;  4CCM A;  1WQ2 A;  4P1W A;  1U3E M;  2GM4 A;  3S93 A;  4A5N A;  2V4J C;  1AHD P;  2W57 A;  2MC3 A;  3L2V A;  1GXP A;  2XVC A;  2EIJ H;  3G1O A;  1U8R A;  4DOZ A;  2B63 J;  2E1O A;  3KLN A;  3PNV A;  3W6V A;  3A03 A;  3FXM A;  5K1Y A;  2F5C A;  4L9V A;  4NQW A;  3C2H A;  1RES A;  2HWV A;  1P4X A;  3I9V 2;  1Q1V A;  1R36 A;  2FX0 A;  2JN6 A;  4D7N A;  4XLH A;  2QQ9 A;  2KMU A;  5CYV A;  1OFC X;  1C0W A;  1EH7 A;  2JA8 J;  3PFI A;  5BPI A;  3ZQL A;  1P9Q C;  2VJI A;  1YIT I;  1V4R A;  1X58 A;  2R7S A;  2L02 A;  1E3O C;  5CQG A;  1G3T A;  1AWC A;  2ECC A;  4HEA 2;  1HLV A;  3BRO A;  1LDJ A;  3RSN A;  4IPA A;  2CQN A;  4HV6 A;  4I99 C;  3SDB A;  1HF0 A;  1MH4 A;  5EJC A;  1T38 A;  3D5L A;  5KCM A;  2Y75 A;  3CJR B;  3U1D A;  3G1L A;  1Y8R B;  3S17 J;  4I2O A;  3CCR I;  1S7E A;  1GT0 C;  2K02 A;  3WU0 A;  4IF4 A;  3RJP A;  3TP3 A;  4EJT A;  3P9K A;  4JQF A;  1S72 I;  3ZQG A;  3SXY A;  4DZJ A;  3E5X A;  2KRH A;  5J1Y A;  3QOE A;  4A93 J;  1O3Q A;  1ETV A;  3CJT B;  2PMH A;  2IA1 A;  2R5Z B;  4UUV A;  1YW9 A;  4G8X A;  1ZRE A;  3U21 A;  3TO6 A;  1Y1W J;  2F4O B;  2HTJ A;  1XD7 A;  1JKQ C;  3HSR A;  1P7I A;  3TOA A;  3WTY C;  1R4M B;  3F8F A;  3PQJ A;  1I1S A;  2IT0 A;  1MGT A;  4UVC A;  3BTC A;  4E4H A;  4D1Q A;  2FRH A;  5FLX K;  1WH7 A;  3CP2 A;  3S1N J;  2BGC A;  2E2I J;  4CCN A;  1SD7 A;  2BEO A;  4C2M J;  4L18 B;  3CO6 C;  4HYE A;  3W3C A;  2QYO A;  2M0C A;  4HX8 A;  3WU2 C;  1XGM A;  2RC4 A;  3G2B A;  1UEL B;  1IXS B;  1B9M A;  1DUX C;  3OV8 A;  2M1B A;  2CWE A;  1XS9 A;  3ECO A;  4LMY A;  2D45 A;  1K78 B;  3FMS A;  4OAY A;  4XKC A;  3VSK A;  1ODD A;  2O7O A;  3MFK A;  4P55 A;  5H20 A;  1Z9C A;  3A02 A;  2GOX B;  4DYR A;  2HTS A;  2ZJP F;  5GAH J;  1BR1 A;  4LIV A;  3IWZ A;  3M8F A;  4CYD A;  1JUP A;  2CW0 F;  2ZFW A;  3BP8 A;  4GRI A;  3B73 A;  4F3Q A;  4I0A A;  2QZ8 A;  3BOQ A;  4UNO A;  3W6J B;  2ID6 A;  4CXF A;  1GVJ A;  1ZK8 A;  4HPQ A;  1KU7 A;  1FMV A;  1OKR A;  1QNT A;  3E5Q A;  5JVT A;  5FLX Z;  1U2W A;  3OYA A;  2OQR A;  2LF7 A;  5B66 C;  1YX5 A;  5ILU A;  2JA5 J;  2EH3 A;  3EDP A;  3FXR A;  1Y39 A;  3DKW A;  2V9V A;  3BTL A;  4XM3 A;  4DBQ A;  1JT6 A;  4X6A J;  4GCV A;  2EZI A;  4A5M A;  2KFD A;  1WGX A;  1UST A;  2XV4 S;  1VQN I;  3C18 A;  1U5T C;  3VPR A;  1QU3 A;  1F36 A;  2X6W A;  2Z1D A;  4LOC A;  2ICW G;  1P92 A;  2EV5 A;  3I53 A;  4HF2 A;  3S14 J;  1U8B A;  1MBF A;  3H9J A;  3K4B A;  4M71 A;  4L5E A;  1TW3 A;  4LFU A;  4CYC A;  3GX4 X;  1OJL A;  5J3L A;  2CH0 A;  4H0E A;  3HOY J;  2P8T A;  2JQ7 A;  2CW7 A;  1KU3 A;  2MFZ A;  5KK1 A;  1D5Y A;  1QPM A;  2D1V A;  1HDP A;  2FNP A;  3GTO J;  4M72 A;  4G6T B;  5L3F A;  2HR3 A;  4M9X A;  1NG7 A;  3CCL I;  3AG4 H;  3ZR8 X;  1TQP A;  3ZQC A;  4A0Y A;  2V26 A;  5FJ8 J;  2E7W A;  2EIM H;  3T1B A;  3CLO A;  4XLP F;  3HPG A;  3PSF A;  4NC8 A;  3ZP5 A;  4XN0 A;  3H9Q A;  4FTH A;  3TO9 A;  3HRS A;  3BWG A;  1FEX A;  1P7J A;  2MG4 A;  5GPC A;  3ASO H;  2CQ7 A;  5H6Q A;  3G6E I;  1KU9 A;  1QZY A;  4WXD A;  3TOB A;  1ZR4 A;  1Z21 A;  4A2U A;  3FMQ A;  2MC4 A;  3NAU A;  3CJN A;  4HNU A;  1UB9 A;  4DJA A;  3K2Z A;  5IYC J;  4IHV A;  4I01 A;  3HSF A;  4RLF A;  4A3B J;  2IS1 A;  3R61 A;  1H9G A;  2XAQ A;  3DKX A;  4JOM A;  3HOX J;  3BG3 A;  3WE3 A;  2LKS A;  3KET A;  1BIB A;  2KIS A;  2R7T A;  4FET A;  3KX2 A;  3KP4 A;  2P5K A;  1QRY A;  3A01 B;  1ZRC A;  4XRM A;  1JKR C;  1V3F A;  2ZC2 A;  4KN7 X;  4P96 A;  3JRA A;  1W1W E;  3BJA A;  2R0Q C;  1VF9 A;  5J6X A;  1G2H A;  1HCR A;  3CF2 A;  1R1U A;  4PZJ A;  5E20 A;  5FRM A;  1BN5 A;  3SZP A;  1IG7 A;  3VB2 A;  1V5F A;  4BHB A;  2Z99 A;  1FSH A;  1YFH A;  2DYS H;  1TQM A;  2IVM A;  4ETS A;  2HDW A;  4IQJ A;  1BL0 A;  2VKH A;  4L5I A;  1XTA A;  3WOD F;  2UV1 A;  2BXY A;  3R0J A;  2RN7 A;  3GLL A;  3BCA A;  1Y6I A;  1FNN A;  3JRF A;  4HAM A;  4DW6 A;  2DK5 A;  3J7Y J;  4IZZ A;  4RGS A;  4W1U A;  3IAS 2;  4PFO A;  1W36 D;  3NAR A;  4C3J J;  3LSK A;  5LHI A;  1RZ4 A;  2OCE A;  2BE5 F;  1AA7 A;  1WHU A;  1B1B A;  3RYP A;  2KQR A;  3VYR B;  3J7A O;  3EYI A;  2DQR A;  4MEY F;  1KZH A;  5M5X J;  1XDS A;  4MQ9 F;  3OR2 C;  4MLO A;  2K9Q A;  1POG A;  5CVI A;  2Y9Z A;  1U0J A;  3HL2 A;  2LRD A;  2EV6 A;  3C1D A;  1A36 A;  2EV0 A;  4MGR A;  3DEU A;  3TQN A;  2WBM A;  3RKQ A;  3Q0U A;  4BXX J;  5TRD A;  4HQM A;  1SMT A;  4G12 A;  3Q9S A;  2VBW A;  5ILV A;  1ZQ3 P;  3D0S A;  2VBZ A;  5HLT A;  3BT9 A;  3GFJ A;  3CP8 A;  2PMU A;  5K7H A;  1HA8 A;  3FKI J;  5J1R A;  3I0T A;  1BOB A;  1J59 A;  1IUF A;  2ID3 A;  4Y33 A;  3AAF A;  4IRG A;  3BCB A;  2HZT A;  3O8G A;  4HLX A;  1CF7 B;  2B0L A;  2O8X A;  3OY9 A;  3GEZ A;  5B1A H;  3F8B A;  3E97 A;  3IWF A;  1BJA A;  1YTY A;  1OIS A;  1S7O A;  3JR9 A;  2XSJ C;  2Z33 A;  3M07 A;  5E1X A;  1TLH B;  2GZW A;  4E7Z A;  2E2J J;  3BG5 A;  1AKH B;  3H3V K;  1I3A A;  2ZJ2 A;  3NWS A;  2EZL A;  4UXN A;  3I59 B;  3JRI A;  3DCF A;  3FBN B;  3IC7 A;  4GDF A;  1ZGJ A;  2VPL A;  5AON A;  1MIJ A;  3REO A;  1IF1 A;  2F4M B;  2OBP A;  5JI6 A;  5GPA A;  3ZRG A;  2DOE A;  2E2H J;  2M9H A;  4PSW A;  3WTW C;  2E1C A;  4ZYA A;  4XK4 A;  3FZV A;  1K4S A;  4XKW A;  5E3N A;  3O3K A;  1SD6 A;  4BEH B;  1B72 A;  1FJL A;  4ENK A;  3BLY A;  4LJZ F;  1V55 H;  4DYC A;  5D6F A;  4BQA A;  1ULY A;  3ZMZ A;  2V9K A;  2EZK A;  1T0F A;  3AG3 H;  3OL4 A;  2HXO A;  3K1N A;  1JTX A;  2KIM A;  3LST A;  3F8M A;  2LKP A;  4LGW A;  1HW2 A;  4BXU A;  1DU0 A;  2VJ5 A;  2ELJ A;  5CVV A;  5JLX A;  2NRA C;  5EYR A;  4AIJ A;  2IGN A;  2F2E A;  3HZJ A;  2G9W A;  3KP6 A;  3QPL A;  4RB1 A;  4HDV A;  3RYR A;  2DFH A;  4CH7 A;  2VXZ A;  3CME I;  4M73 A;  1TTY A;  2MA3 A;  3CUQ B;  2YX7 A;  3K6G A;  4B09 A;  3K4L A;  2FE3 A;  2LTP A;  1T98 A;  4B3X A;  5D5X B;  1D0Z A;  4EVI A;  3KLO A;  3DTE A;  2L4A A;  4YRV A;  4Z6Y A;  2LNB A;  1MSF C;  3LSP A;  2RNJ A;  4L9T A;  1IRX A;  2HGC A;  2JMW A;  3TBI A;  3BDD A;  5AIQ A;  4ZDP A;  1HKS A;  2FXA A;  3D5S C;  2L0K A;  1Y0N A;  3OOU A;  1ZLK A;  2ZJR F;  1I3Q J;  3OYF A;  3K70 D;  4IL6 C;  3MWM A;  3F72 A;  1W36 C;  4NC7 A;  5CVU A;  2O6G E;  2DLL A;  2DFF A;  2HI3 A;  2DN0 A;  3OWT A;  3T8R A;  3S2W A;  1YI2 I;  2V1U A;  2QEN A;  3ZMD A;  2HOA A;  2EA4 A;  2RV8 A;  3AL0 B;  2P7C B;  4OIO F;  2EFP A;  1P4A A;  1EV7 A;  3ZN0 A;  3K7A J;  1VZ0 A;  1T33 A;  4UVB A;  2X6O A;  1VFC A;  2OUM A;  2DPD A;  2QKM B;  3AFH A;  3HYI A;  1YIJ I;  4UUS B;  2ME0 A;  4G94 A;  1PUE E;  2IBD A;  3QP6 A;  2E5N A;  4PJN A;  1W4M A;  3GW2 A;  3OS1 A;  3LSM A;  1M1E B;  3GTJ J;  2NNY A;  2ZCW A;  1R23 A;  2FMY A;  1L3L A;  1HDD C;  3NWT A;  3HB9 A;  2A6H F;  2R7F A;  1K61 A;  1K83 J;  2IGM A;  3CDI A;  4QTR A;  5DD8 A;  1RKT A;  3S1Q J;  5DV5 A;  2R5Y A;  4LB5 A;  2AXL A;  3RPU A;  2PJP A;  3MQ0 A;  1F9N A;  4FIS A;  1FZP B;  4K2E A;  2H8R A;  1J0R A;  1IDZ A;  4IOC F;  4EJV A;  2V6E A;  2F5E A;  1MBG A;  4M74 A;  2M7B A;  1OYW A;  4BDZ A;  1GV5 A;  3QPH A;  3SZT A;  1JHF A;  3OYL A;  5J8C A;  1SAN A;  1HW5 A;  1P4W A;  2DMT A;  3K4M A;  2DA2 A;  3OOP A;  3PIO F;  2R7V A;  4B48 A;  2E35 A;  3O8H A;  1X1D A;  2CV0 A;  1RKW A;  4XKV A;  1I39 A;  5IP7 J;  1ZYR F;  1T8I A;  1ZG1 A;  3U2R A;  1G3W A;  2MW8 A;  5EGO A;  2DOA A;  2L9S A;  3W2W A;  5L3C A;  4KIF A;  3K0L A;  2ZME B;  3FHZ A;  3N05 A;  5ICF A;  2L9V A;  2K9S A;  4JP0 A;  3NEU A;  2YU3 A;  2LG4 A;  5LGN A;  1ZAR A;  4I76 A;  1BI1 A;  2JVG A;  1YHQ I;  1JT0 A;  2OZU A;  4V19 K;  1WJB A;  4PGH A;  2YR2 A;  3H9G A;  1N25 A;  3OS2 A;  1RI7 A;  2Y9Y A;  2UZK A;  2EFN A;  2BXZ A;  3HOZ J;  4WWC A;  2M2E A;  1IGN A;  1WVR A;  5HLH A;  3QP5 A;  3W6K B;  1A31 A;  4M3F A;  4IHY A;  4RM2 A;  1YIO A;  1QQI A;  3S3O A;  1YYV A;  3OYJ A;  2VBX A;  2VPR A;  2HOE A;  3H5N A;  2FD5 A;  4AYB A;  2I5U A;  1UHW A;  4A3L J;  5CJ9 A;  1DP7 P;  2K9M A;  3M1C A;  3F8N A;  2EFO A;  4IQ4 A;  1IV6 A;  1U6G A;  4WK8 F;  2LFB A;  1Q1H A;  2W1O A;  3FIW A;  4BU2 A;  3BPV A;  2MD5 A;  5JR3 A;  1KON A;  1RPW A;  5AIP A;  1R9T J;  1NK3 P;  5CLS A;  4Y17 A;  1LVK A;  2CG4 A;  1KQ0 A;  2GXG A;  2DA4 A;  3V8J A;  2BY3 A;  2CMP A;  5IT9 K;  1X19 A;  2IS6 A;  2BV6 A;  3H92 A;  4JX5 A;  3HTU A;  1VQM I;  2E71 A;  3LSJ A;  1FBQ A;  1SD5 A;  3L09 A;  5DM6 F;  3VDX A;  4L9J A;  3BG7 A;  4LB6 B;  1MJA A;  4HW0 A;  5KAF C;  2NOJ B;  2H6C A;  3RPU D;  4IX7 A;  3DBH B;  5LLQ A;  3LOC A;  1RNL A;  6PAX A;  4D5C A;  3PM1 A;  4M6Y A;  2DOD A;  3F21 A;  3KEO A;  4II2 A;  5J8F A;  2Q1Z B;  1KYZ A;  3MKW B;  2DYR H;  3K9T A;  4FE7 A;  5J4V A;  2QEX I;  1H9T A;  4LLL A;  2B9S A;  3CUQ C;  2A5W A;  2IGO A;  2L9R A;  4M9S A;  2Q2E B;  5CQE A;  4CGZ A;  1L0O C;  2BVM A;  2F6C A;  2VL8 A;  1MDM A;  4BAY A;  1U78 A;  1R5G A;  2V6C A;  5IPA A;  2JUG A;  4BQN A;  4O3M A;  4RM3 A;  5IT9 Z;  3B02 A;  2CQX A;  1S8N A;  1YW8 A;  1XMX A;  2F5V A;  5HOO A;  4A6D A;  2WWY A;  2LBF A;  2R7Q A;  4DYQ A;  2VKD A;  4YG2 F;  4I02 A;  1APL C;  3CCQ I;  3FBI B;  4EV0 A;  1YRN A;  1KGS A;  2LC2 A;  2M0M A;  1XCB A;  2LRE A;  5LEJ A;  4MEX F;  2RQP A;  4ZZL A;  1TT5 B;  2R3S A;  3T8T A;  2DBB A;  3GZ6 A;  3SEZ A;  1FYK A;  3AL0 C;  2Z5U A;  2XPW A;  2H27 A;  3UKG A;  1H8A C;  4AWX B;  1FBS A;  3OIO A;  2AQE A;  2BOL A;  2E1N A;  4PDK A;  2OQG A;  3OYI A;  5IP9 J;  2NAZ A;  3O6B B;  3RTR A;  4CO8 A;  1G59 A;  4CHU A;  5L3D A;  1FTT A;  1Z77 A;  2DT7 B;  2A5Y B;  1FLI A;  1WJE A;  1LJ9 A;  5M5Y J;  4M3G A;  3QQA A;  4OMZ A;  4GGG A;  2JJ7 A;  4BUP A;  5DCM B;  1ZHF A;  4AYB N; 
#chains in the Genus database with same CATH homology
 1V54 H;  2EIN H;  2Y69 H;  3WG7 H;  3ABM H;  3ABK H;  3ASO H;  1OCR H;  2ZXW H;  1OCZ H;  1OCC H;  5B1A H;  5B1B H;  3AG1 H;  1V55 H;  2EIL H;  3AG3 H;  3AG4 H;  3ABL H;  3AG2 H;  3X2Q H;  2DYR H;  3ASN H;  2EIM H;  2OCC H;  2EIJ H;  2EIK H;  1OCO H;  2DYS H;  5B3S H;  5IY5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...