3CCVI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccvI00
1YJNI 1HC8A 1VQ8I 5DM7F 5GAGJ 3I56I 2E34A 1VQMI 1VQ7I 2JQ7A 1YJWI 2K3FA 4V19K 3CCRI 2NXNB 2QA4I 1VQPI 3CMEI 1FOYA 3J7ZI 3CC4I 1YITI 1VQOI 3DLLF 3CCJI 3G4SI 4IOCF 3J7YJ 1VQ5I 3CJTB 1MMSA 4UY8I 5GAHJ 3PIOF 2H8WA 3CC2I 5JVGF 2OTLI 3G71I 3CCEI 1S72I 1VQKI 3PIPF 1YIJI 1VQ4I 4IOAF 1FOWA 1YJ9I 3CF5F 1Y39A 1QA6A 2ZJQF 2E35A 2ZJPF 1VQNI 2E36A 3CCQI 3CMAI 3I55I 3CD6I 5GAEJ 1YI2I 3G6EI 3CCMI 2FOWA 1VQLI 3CC7I 3CCLI 3CCSI 4IO9F 1YHQI 5GADJ 2OTJI 2QEXI 5DM6F 1VQ6I 3CCUI 1FOXA 2ZJRF 1ACIA 1VQ9I 3CCVI
chains in the Genus database with same CATH superfamily
4XR6A 3HXLA 2GWRA 1OYWA 1ULYA 3OYJA 3HSEA 3OYCA 4BQAA 2LKPA 2GXGA 2LR8A 4LGWA 2H6CA 2KIFA 2GOMA 2GA2A 3KZZA 3CCRI 1N25A 5K7ZA 4BXFA 2UUZA 3ZMSA 5CVJA 4IF4A 3DPTA 4HG2A 4A6EA 2A68F 4AYBN 2XAJA 3F6OA 4CYDA 2Y0MA 2JRMA 1OISA 3W6VA 2DQLA 4U88A 5IT3A 4E7IA 4C2MJ 1WRJA 4IVNA 3DTKA 2D5VA 4RM3A 4WF2A 1XTAA 3OIPA 1MGTA 3HEFA 1MBHA 4GCVA 4A93J 1ETKA 1Z05A 2M7BA 4ESBA 4A3IJ 2NNYA 1A6QA 3LA2A 1WJ5A 3DV8A 4XOTA 2JA7J 1VZ0A 2VUMJ 1ZRCA 3ISPA 3G3ZA 3V8KA 3E7LA 1HBXG 2X85A 1ZK8A 2M8GX 2H8WA 1K78A 5E3MA 2DO7A 2HQAA 1G4DA 3KEOA 4L9TA 1R1UA 3GUDA 4PJNA 3TW7A 3GTLJ 4IOAF 2Z33A 3L09A 2CUJA 5F0HA 2LKXA 3A2KA 2PLYA 4XBFA 4J19A 3RTRA 1SEUA 3ZMDA 1Y39A 3GTKJ 4XORA 3N4MA 3I53A 1ZREA 4LG0A 2MC4A 4E7JA 1FOKA 1IC8A 3DQVC 4BEHB 1KQ8A 2E35A 4XSXF 4J01A 3QOEA 1Z0XA 4YG2F 2DPDA 3P7NA 1P2FA 1YI2I 1T8IA 1U0JA 1J59A 1ZR2A 1LE8A 2L9SA 3EDPA 2DA1A 2O03A 1FC3A 1SFKA 3JRIA 2M34A 5HLIA 1WH5A 5LGUA 3OWTA 3OYIA 2L9RA 4IO9F 4BJ5C 5J1RA 2M4KA 3U1DA 1HSJA 2G7HA 3J81Z 3CUOA 2VJ4A 4I2OA 4A69C 5FLXZ 2ZJ2A 3RSNA 4BKXA 4R79A 4CDGA 2LSOA 2Y0SN 2Y31A 3MKWB 3TOBA 1K6OA 3BQZA 1IDZA 2K9NA 3V7RA 4RGXA 1G2HA 4ZDPA 1ZG5A 2E60A 2X4HA 3ZQ7A 2VBZA 3TW6A 3BROA 2VQHA 3GTJJ 4ENMA 4IQJA 2DBBA 2K40A 1JXSA 4KIFA 2IA0A 5FRMA 2OQGA 3S32A 2DPUA 3K2AA 2K9LA 3CF2A 5J3LA 4N9IA 4E7ZA 1S3JA 4L9NA 1MBGA 4ZTFA 4LK1F 2CUEA 3WTZA 4F52A 2Y9ZA 2RQQA 1BI2A 2VKEA 3FXRA 2E1NA 1WVRA 1MSFC 3F8FA 5D4SA 3HKZA 1S7OA 2DA7A 1C0WA 4KJZA 1Y6IA 5F1JA 1MJ9A 2C6YA 1P4XA 1VQOI 1K78B 1FEXA 1SFXA 1AKHA 2H94A 3L2QA 3JAMK 2X6YA 5BPIA 2AS5F 3KE2A 1TQPA 1ZN2A 2VI6A 5HLGA 3VWBA 1G8XA 4CZCA 4LJZF 4E4HA 2KRCA 2P5KA 4BE2A 4UVCA 5EZHA 2FBHA 3VYRB 1S9HA 1RUOA 2PFBA 3A02A 1IN7A 3G1MA 3S8PA 4LIVA 3HOUJ 1I6XA 1TQIA 2KMUA 4ESFA 2H09A 5CVRA 1ETVA 2DFFA 4FX0A 4IZZA 2ZMEA 1QZYA 3I5UA 5BNGA 4LG0B 1D8KA 2ZO4A 3B73A 4LD5A 5EG0A 2Y30A 2FQ3A 1I3QJ 3WODF 1IV6A 3BLYA 5F27A 2FQ4A 4UNOA 1JGSA 5CVUA 5J1YA 2M30A 1DU6A 1LE8B 2R7RA 3FBIB 3I9V2 3GYHX 1YRNA 4BGDA 3HRTA 5DUIA 1BR4A 2RREA 4MFDA 3WG9A 4OAYA 2BOLA 4D7MA 2DOEA 2M2EA 1K79A 3ABLH 3CCMI 2MW8A 4A3MJ 3DFGA 3OYLA 2RN7A 2R7FA 2YU3A 3S16J 4R8HA 3DU6A 3C18A 3EPZA 2KZGA 2EV6A 4HV5A 2IW5A 2Q8KA 5L3GA 2AHQA 3LSJA 3TDZC 3T8RA 1WKMA 5E79C 1FBUA 3JREA 2DCEA 4U0WA 4AIKA 4M9ZA 4A0XA 5M5YJ 3B6AA 4G8XA 5ERIA 2IGKA 2IGNA 4PJLA 1T33A 2QQ9A 3BCAA 1BC7C 2HDCA 3V7CA 4WWCA 2HDDA 3WU0A 5L3BA 4X1EA 1TNTA 1V5EA 1XCBA 4PGHA 2XAFA 2FBIA 2IVMA 1X2MA 5IT9K 2E34A 4V2GA 3VB2A 1QGPA 3GW2A 1SAXA 1ODDA 1NG6A 3BG7A 3WTWC 3K70D 4C2UA 3NRVA 2A69F 3DEWA 4MQVA 1HLVA 2XVCA 2F5CA 1AKHB 3GMEA 1QPMA 1JUSA 2ELHA 3JSPA 2MD0A 3FMQA 4MEXF 4IXAA 2DN0A 2DTRA 1MMGA 1XD7A 3DLAA 1QBJA 4RB0A 1IUYA 2L7ZA 5L3DA 1WPKA 2BZTA 3F72A 5EGOA 3AL0B 2ZC2A 4CCJA 3TO7A 3BJ6A 5M5XJ 1Z6RA 3RPQA 1T38A 4XK4A 2ZMEB 2R7DA 3TQNA 2EZLA 2KFDA 1FT9A 1JI8A 2FBKA 2PX9A 5EG0B 2XSDC 2QM3A 1B9MA 1JTXA 2OCCH 4L9VA 1J2XA 4FCYA 3DKWA 5IP9J 1P7IA 2BY0A 3ABTA 1Y0NA 2RV8A 1X1PA 3WTVC 3I59A 3EETA 4O3MA 4HF1A 4UV9A 1W0TA 5LGTA 1OKRA 4EJVA 5FKLA 1HKQA 2DA5A 1YRNB 1G3SA 2CV2A 2WAFA 5IY5H 4I76A 3OYMA 1N77A 3AFHA 2FX0A 3RKWA 3SFZA 3BPVA 3LSRA 3HDDA 1F4KA 1FP1D 1MBFA 5EYRA 3IWFA 3JRCA 1WJDA 3QPHA 4B8XA 2WB1N 1BJZA 2Z1DA 4Y17A 5D6FA 1XDUA 2JMWA 4ASNA 1JJ8C 2D45A 2V26A 2LLKA 4JOMA 2HVSA 3KEQA 5ICEA 3DU5A 3CTAA 2L9NA 2E36A 3D0SA 2IT0A 3CCQI 1L3LA 5FKNA 1TWFJ 4LMYA 1YE9A 4PZJA 3RPUD 2KRHA 3J81K 2XRLA 3DCFA 2NS7A 4RGUA 5FLXK 3R4KA 1VQLI 1ITYA 2MD5A 2NOJB 1TP4A 2KKOA 4A3FJ 4U0VA 3JR9A 3EUHC 1SVOA 2HQRA 2P81A 2G7UA 4I01A 1H8AC 4GXOA 2G0EA 4KDPA 4Q5SF 5GADJ 1JTYA 3IKVA 5ED4A 2DI3A 1R5ID 2XASA 1A31A 3WGGA 4D5FA 2VJJA 3OOPA 2IRFG 3J7AO 2GBYA 4Y4RA 5DD4A 1IN4A 2KIQA 3FXJA 2KT0A 1R6RA 3K6GA 1HF0A 2V4JC 3HOSA 3M4OJ 1ZGWA 2BVLA 4CHUA 2ZFWA 3CP8A 1UG0A 2CQNA 1VQ8I 5AIPA 1S7EA 2IS6A 1J0RA 4C3IJ 3WTXC 1BI1A 2TDXA 1VQ7I 1PP7U 2PBIA 4OMYA 2DMNA 2BW3A 4UUVA 4G6TB 1W5CC 2MFZA 4KISA 1FSHA 3QOPA 3EUKL 4MNUA 5EGOB 5GPAA 2QA4I 2WAQN 2AXTC 1TL8A 1V55H 3TGNA 1OFCX 1BW5A 2HOAA 4RB2C 3H35A 1WSUA 3JTHA 5HNFA 3R0JA 3SXYA 2VXZA 4UVAA 1Y1VJ 2XAUA 4EM0B 1WJEA 3BQYA 2ZNZA 3I59B 1CQTA 4AU7A 3IKTA 3FKJA 5LGNA 4ZZDA 4XICA 2ZB9A 2BBYA 4RAGA 4Y15A 3TOAA 1CF7A 2DA6A 1S5LC 5IP6A 4KIBA 4B3XA 1IO2A 4ON0A 2NAZA 4IPAA 2ZXJA 2HKOA 2M9HA 2HDWA 3SJMA 1YX3A 2OTLI 4NC6A 5CKTA 3JRHA 2F5EA 2P6SA 2E1MB 2DW4A 5JFRA 1B9NA 4H0EA 2V1DA 1VQ4I 2AQEA 2L0KA 3CUQC 1A6IA 2L5QA 4RA2A 3ZN0A 2MG4A 1BI0A 3BOQA 1R00A 5CLSA 1ENHA 5B5EC 3H9QA 5H2FC 4D1QA 4N4NB 3H3VK 1Q1HA 1BBYA 1BW6A 3WGIA 1S6LA 2RVCA 4M3BA 4Y13A 3MVPA 2JWTA 4W97A 2JSCA 2VL8A 2Z99A 5JHUA 4LLGF 2M45A 2YPRA 2OU2A 5HS9A 1FWZA 1F43A 2PMZA 3CCSI 2VPRA 4G6QA 2FEZA 1IJWC 3FMSA 1HW1A 1ETXA 2FJ1A 4DBQA 4XNFA 2WADA 2ETHA 5C4JJ 1J09A 1S29A 1SD6A 3HGYA 3OL4A 2BW3B 4YFKF 3KP4A 2W82A 1IV8A 1USSA 2L01A 2QENA 3GO5A 1REPC 1V4RA 2Y69H 1ON2A 1YW9A 2F5FA 2ECBA 2WY8Q 2QZ8A 2EIJH 5DM7F 3I58A 2M0MA 4UHTA 2FUG2 2DYRH 2VJIA 4XM3A 1X4PA 2CUZA 5LD2C 1ZGAA 2KDZA 3A0BC 3ESWB 3ZRGA 1F5TA 3O6BB 3K1NA 4CCKA 1AWCA 1XSXA 5E1XA 2VQCA 2F4IA 2QKLB 2PG4A 4II2A 3RJPA 4HZFA 2JK3A 1CF7B 1UELB 1FJLA 1DU0A 2CGPA 3AAFA 4E7SA 3OYGA 3TDUC 3H0DA 2EFQA 4L0YB 5KVRA 1LEBA 3LOCA 1R1TA 1QZEA 2KIMA 2NS0A 4FE7A 1U8BA 2UXXA 5B3SH 4RAZA 3L2VA 4JP0A 2X1EA 1TWGJ 1RC9A 3L7WA 3FIWA 4AM3A 5GAHJ 3Q9VA 1B4AA 4IL6C 2WWYA 4E7KA 3QU6A 2KPMA 4WXHA 4P55A 9ANTA 2WTEA 4XLEA 5H6QA 2XGXA 2DA2A 3HYIA 1X3WB 1UAAA 1TW3A 2OUMA 1FLIA 1XDSA 2KHMA 2LG4A 3QP6A 5D6EA 4DW6A 2KQRA 4XRSG 1J7KA 4HA8A 3BG9A 2UXNA 4AD9A 1XMKA 1XN7A 1WZ2A 4L5EA 3ZQQA 4DZJA 2HKXA 3K4NA 3MD2A 1QNTA 3COAC 4E7HA 1IW7F 2JPBA 4M71A 2CV1A 2ECCA 2Q1ZB 1BN5A 4IHXA 4AWXB 3HBLA 2BVMA 4ZYAA 3JAMZ 3G6EI 1R36A 2DDBA 1X1CA 3ZOBA 5J40A 3LFUA 2A07F 2V1NA 1W7PD 1J5YA 2LF7A 4E70A 2TCTA 4PFPA 5LBQA 4YELA 3QAHA 4GGGA 4ZH4F 1YHQI 4B4CA 2CQQA 1SMYF 1IXCA 1Y56A 5HDKA 1DPUA 5F0CA 3OYEA 4LOCA 1XPXA 1U5TC 1GLNA 2E5ZA 3BTJA 3E0JB 4ZC3A 2B63J 4CICA 1RR7A 4BQOA 3MMYB 4XLFA 5LEKA 4I6ZA 4BY1J 2LYCA 3AG1H 3GFIA 3D5LA 1BIAA 1U9NA 2EJRA 4L9JA 2JQ7A 1W7PA 2Z16A 4FHTA 5FD5A 4V19K 1XSDA 2PJPA 1MMAA 4FT8A 2CQ7A 2O8KA 3VOEA 1ZLJA 2CQKA 4F7ZA 1L0OC 4BAYA 2I10A 4A6DA 3CO7C 2V9KA 3OSFA 3DKXA 4DYRA 4F55A 1EH7A 1ZAOA 1JKPC 4EJOA 1YFHA 2VJ5A 4XSZF 4HYEA 3DWLE 5FROA 4I09A 5KK1A 2ESNA 3LA7A 4BJ6C 1B72A 3LSPA 4DOZA 4WX9A 2RAEA 3CDHA 1UJ8A 1H9TA 1E0EA 3BR5A 3HRUA 1JT0A 5B1AH 3HM5A 2IA1A 4XL9A 1WJBA 1LFBA 2ZSHB 1RZ4A 3PIOF 1FP2A 2FMYA 3CC2I 1T95A 1LEAA 1AOYA 1GV5A 3VEPA 5IT9Z 4HBLA 4EJWA 5ICFA 3F23A 2UWMA 3CMYA 3MKLA 3N05A 3PIPF 3OIOA 2GLOA 1XGSA 2IGOA 4A2UA 1MNEA 4Y33A 2EA4A 4A3BJ 2WBMA 5F08A 5DDGA 4MTDA 5JLXA 4C2TA 1PUEE 2ZJQF 2OPTA 2HR3A 4ZYHA 1G6NA 3ML6A 4MGRA 2CS3A 5L3EA 2MA3A 4CYCA 4BDZA 3MQ0A 1FMWA 5K5OA 2FA5A 3E5QA 2ME6A 4A0ZA 2G9WA 2J5OA 1VI0A 4RGSA 3E1SA 3BZKA 3PSIA 5H6RA 3GZ5A 3HZJA 3RKYA 4F92B 4N4OB 2E71A 3CCYA 4YIRX 2BEOA 1MIJA 1EV7A 3TL4X 2CYYA 2DAOA 2JPCA 5KNLA 2LOOA 3NWSA 1ZH5A 4BHBA 4JX5A 1KU2A 2FMLA 3BDDA 3MKYB 2PMUA 1GXPA 3HOVJ 5JVTA 5KAFC 2Q2EA 5EEAA 1ZRFA 2BXYA 2QF7A 2NVUB 4XONA 1W7PB 1PJRA 3ECOA 5AONA 4ZDOA 2BE5F 2V6CA 4HW0A 4XKBA 2VT3A 1FYKA 3QRFF 2GQQA 3TKYA 4EGZA 2DA3A 4BY7J 3V4GA 3I56I 5BPDA 3EQLF 2CSOA 3DPLC 1GVDA 1XC5A 1WHUA 2DU9A 4BS9A 2V7FA 3GXOA 3PQKA 2I8DA 1TWHJ 1VTNC 3G1OA 1MBJA 3PFIA 2EV0A 2LP0A 3MEXA 4N0BA 1B72B 3VPRA 2WC2A 5D5XB 2O61A 4DBRA 1O3TA 5DTDA 4HX4A 2O6GE 4RAFA 1X3UA 2VIXA 5GP9A 2QSGX 4UUTA 2O7OA 2QWWA 1XMXA 3DTIA 3BP8A 3PSFA 3CESA 4IHYA 3K4CA 4A5MA 2E1CA 4HF2A 3CCJI 2XKPA 5LHGA 2O5RA 3ZGKA 5ICCA 4L0ZB 2MBFA 4KMUX 3BTLA 1I3AA 5E3OA 2OQRA 3QYBA 2DT7B 1MZBA 3OIQA 4KN4X 3A1YA 4G9YA 1D5YA 2E19A 3AKZA 1SD5A 2W00A 4NDLA 1TT5B 3CP2A 3CLOA 2ADUA 4F3QA 2XPWA 2K3PA 2IPQX 2X1CA 3FKIJ 4O6JA 3TP3A 1YJ9I 3CF5F 4CYCB 2OC6A 1SMTA 1HA8A 4M3FA 3T0YA 2CH0A 2P8TA 5F6FA 5EEGA 1TLHB 2FSWA 1X1DA 3RZDJ 1MH4A 2V9VA 4AIDA 1R22A 4UB6C 3D5SC 1JUPA 4QIWN 4BXXJ 4HX7A 4EJUA 3HOTA 1X3ZB 4K2EA 3OS0A 4P96A 1Y8RB 2LK2A 5IYCJ 2Q2EB 4U7DA 3PUFA 5FKOA 2O0YA 4AUXA 2IA2A 3K2ZA 4I0AA 1UB9A 2PQ8A 1B8IA 1DP7P 2H8RA 2NVXJ 3CC7I 2IBDA 2M8EA 1V54H 1OCTC 3HKZN 2P5VA 2CG4A 1Z77A 4OWRB 4ABZA 1WH7A 1SD4A 1VQ6I 1BC8C 3TBIA 1JKOC 1F36A 4B44A 3RCOA 3GTMJ 1IAWA 2EBIA 2OJED 3MZ8A 3O3KA 4KN7X 3CCVI 1GUUA 1RUNA 3CDIA 5F04A 3ZXSA 2OZUA 3SZPA 2HGCA 2W7NA 1OMIA 5TGTA 2MLKA 3UKGA 1WGXA 1OCZH 4GYIA 4ENKA 2EQRA 4PJJA 1OJLA 3BR2A 4MO7A 2HZDA 3IL2A 2MC3A 2WAEA 1WWXA 4M74A 3ZCOA 1WCMJ 2J5PA 4Q48A 1R5GA 2UV1A 4XIDA 3F8MA 1MBEA 1DUXC 2ME0A 4BL0B 4Q4ZF 1BOBA 2BXZA 2LDUA 1HDDC 4W1UA 2ZBKA 3BR1A 2X9DA 3OS1A 1TWAJ 2V9PA 3NARA 1MD0A 2KZVA 2NYXA 2XUBA 5L3FA 2K9QA 4M72A 3G4SI 4G7ZF 3M8JA 3CQZJ 3KYDB 4IOCF 3S1MJ 4BQNA 4TV7A 5FLMJ 1WJCA 1Y8QB 5ICGA 2VC0A 2F2EA 1Z3XA 4ZYGA 2XSJC 4M9XA 2W57A 3T8TA 1S8NA 4KIGA 3BJOA 3S93A 3HSRA 2E2JJ 3TP0A 4X0GA 3BG6A 3P9CA 4D0PA 1LDKB 3CJRB 4Z2YA 2DODA 1XX5A 2FF4A 2MGQA 3BR3A 1ETQA 1IRZA 4Y3OA 5B1BH 4I0BA 1OCOH 1QZZA 1FX7A 5FFZA 4G7OF 1T39A 1XSVA 3LSHA 4RGRA 4XKWA 3NWTA 2XRNA 3FXUA 1QPIA 1B8IB 3FXOA 4IJAA 2VBXA 2HQNA 1JE8A 1JGGA 4EV0A 5M3MJ 3RYPA 4E6KG 4GDFA 1P92A 2DMTA 3L9FA 4EJTA 2CW0F 1XGNA 3CJNA 1LDDA 3K0LA 3PNYA 1VNDA 4CZZA 1AA7A 5HDGA 5E3NA 3A01A 3OYFA 4B1RA 1BR1A 3JTGA 3JRBA 1Z67A 1R4MB 4HDVA 3FX3A 3OYHA 3HJEA 1LB2A 3E6BA 3FZVA 3MZYA 2JTVA 3ZMVA 1T0FC 1G3WA 1UG2A 1IN8A 4ZZLA 4HPQA 3RDIA 3C3WA 1IZ1A 2CMPA 3F9KA 4IRGA 5K1YA 3KETA 3JRGA 4XRSA 2HTJA 5LRRA 5DEQA 2L02A 2F5DA 1X1BA 3IC7A 3SDGA 1GDTA 2DMUA 3GBGA 2CW7A 2NVYJ 1PP8F 1I1SA 3QYEA 3RIRA 3ULQB 1VF9A 3H92A 1R58A 4IHVA 3DXJF 2FNPA 2X6OA 1IDYA 3RI4A 1H0MA 4B3AA 2LY2A 2VT2A 5J4YA 5K5RA 2EPFA 4EGYA 3PO3J 3ZR8X 2NXNB 2XHKA 2XAHA 3TEDA 3QPTA 3BTCA 4BDYA 3U21A 3QPLA 4EATA 3QU3A 4LB5A 3CZ6A 3WG7H 3QP5A 4CSWA 4MIMA 1ZQ3P 4A3LJ 1X19A 1D5VA 1FOYA 1NG7A 2VLAA 4XOPA 1UHSA 2DT5A 1IUFA 2LFBA 1LKXA 3BR6A 3UR3C 2MABA 3FWEA 1RRJA 2IGMA 5AIQA 2ID3A 4KA4A 4XQFA 3DLLF 3J7AY 3LWFA 3PFYA 2H1KA 1O3RA 3S2WA 3T5XA 3IH3A 4A3CJ 3WU1B 1LJ9A 3LSMA 3IRQA 3S15J 1W36C 4M73A 2A5WA 2QQAA 2RKHA 5IOYA 5C3EJ 2XAQA 1FIAA 1K61A 3G71I 3K1PA 3S1NJ 3K7AJ 3CCEI 2QBYA 4EMSA 2HYJA 2A3SA 4YEJA 3OYKA 1IRFA 2X51A 4EVIA 2VKDA 2JT1A 1FBQA 3R0AA 1H89C 4HEA2 3FXKA 3TO9A 3E6DA 3D5RC 3AL0C 2EH3A 1JKRC 3AG4H 3IV5A 4BACA 3Q0WA 2QVOA 2ZMEC 1BIBA 4PJ0C 3S2DJ 3NEUA 2ID6A 3A01B 1QA6A 1KU7A 2B7EA 1P9QC 2Z9OA 4LIUA 2ZJPF 4OU0A 2P6TA 1RKWA 2IAIA 1XGOA 1YS7A 1Y1WJ 1ORKA 2MYSA 4Y52J 2VKVA 3MCZA 2LC2A 2BGCA 5HLHA 2ACJA 3H5AA 2K86A 3VYSB 1U2WA 1IXRC 1BL0A 1HDPA 4XKVA 2DQRA 2JA8J 3E3VA 2DT6A 1ZGJA 2QQBA 3HOXJ 1D0XA 1FNNA 2JA6J 3D1NI 2AXLA 3Q0UA 2W24A 3OR2C 5C44J 3DBRB 1O4XA 2IP2A 3C2GA 2M0CA 2I5UA 2DJIA 3W6JB 3KZYA 3GLXA 1NH3A 3M3YJ 1ZG1A 3BCBA 2EWNA 1U6GA 4BHPA 5FO5A 4MFEA 4RB3C 3LL7A 3E6CC 3ZN1A 2R5YA 4U0YA 3ASOH 1SVMA 1JKQC 5FKMA 2MH2A 4QTRA 3IH2A 1V5FA 3GX4X 5C4XJ 3V7SA 1SANA 4L5JA 1I6HJ 1ERDA 2ZXWH 3KX2A 1MDMA 3WTUC 2L4MA 2Y2ZA 3OYAA 3GZ6A 1APLC 2WA0A 1K4SA 1NHAA 2DLLA 2B9SA 3LNQA 4IEJA 2R92J 3KLOA 3LQQA 2BHYA 2LKSA 3H3UA 5E1WA 5BMZA 2QCOA 2GXBA 1YOVB 2HS5A 4PJMA 3J7ZI 1USTA 3CC4I 1FYLA 3OYDA 1YITI 2K9MA 5D5UB 3DTEA 2DK5A 3HPHA 5EEHA 4QWQA 1KQ9A 4RB1A 1E3HA 4IRHA 1SD7A 5CVVA 2VOPA 2XPUA 2QBYB 1YW7A 2ICWG 4BQQA 3ABUA 5HODA 1VQ5I 1RETA 3JSOA 4RS8A 3EYIA 4XMYA 3GTQJ 2JVHA 3SZTA 2NRAC 1Q1VA 2PMZN 3LFKA 5DV5A 2DFEA 3HG9A 3DEUA 4HQMA 4KICA 3HIFA 1BOAA 3K9TA 1KU3A 1E2XA 3GF2A 4BJTA 3R6SA 3WHBA 4ZJZA 3OYNA 1WJFA 2DTZA 4A3DJ 3IWZA 4CCMA 4UUSA 2HXIA 4IX7A 5DD8A 2FU4A 2MH9A 3K70C 2GIVA 2XDVA 4L18B 2K9SA 4M3DA 3GCMA 1LUJB 2QLZA 2EZHA 1UCRA 1R49A 5LHIA 2EZIA 2MLGA 3A03A 3OMYA 2RDPA 4BBSJ 4UVBA 4QSHA 1MKMA 2FD5A 1MJAA 4A5NA 3P5JA 2HI3A 4EEFG 3V42A 2N8GA 2PI0A 2Y9YA 4YIFA 5CQGA 3BG5A 1O7LA 3L2RA 2W85A 1J9IA 3L2CA 1O3QA 2DFHA 2FOWA 3SQNA 4DZPA 1TTYA 2W48A 4KUMA 2JVGA 1K6YA 1FTZA 5DYMA 2X6WA 3QWLA 1V3FA 1AHDP 2KISA 1FTTA 2DMQA 3FM3A 3HPGA 2BHZA 4HLXA 2CU7A 3CCUI 1R4NB 4M6XA 3F0CA 1B59A 2BY2A 2R5YB 5F0FA 2R7ZJ 1XS9A 4KYWA 2IXSA 1TW2A 4HDUA 3JRFA 5TRDA 3HSFA 1JHFA 1MBKA 1MDMB 3VYUB 1JUMA 2FOKA 5JLWA 3PQJA 3C2BA 1TZLA 4Q47A 1ZR4A 2EA2A 1RIOH 5GAGJ 3U2RA 2ISYA 4QPOA 2R7SA 5FRNA 4P9FA 2FXAA 2PEXA 4I7HA 3J80K 3F3XA 3FK6A 4UXNA 1O57A 5E1ZB 2ZSIB 1P4WA 2EIMH 3MN2A 5EF6A 3R60A 4ZYDA 5K5QA 2YSRA 3BZ6A 4HV6A 1LQ1A 2EFWA 4BE1A 3OS2A 1ZRDA 2ZXIA 1UHMA 2OBPA 3T1BA 2CW8A 4CUGA 1W5TA 2W4SA 3ZMTA 2A6TA 4BYYA 5E8IA 3DPUA 3KP3A 1RKTA 1R1VA 3I0TA 3OYBA 1GT0C 4WXDA 3I4MJ 3J7YJ 2L2OA 4EM2A 4XLHA 4DQ2A 4G7HF 2DXIA 1FBSA 2XF7A 4LG3A 3M7GA 1EH6A 5E3LA 4UUSB 3IHUA 2RC4A 2EFOA 3ZPLA 3OOUA 2L3DA 3QPSA 4PGGA 5FGMA 5TJJA 3RZOJ 2VBYA 3VDXA 4P5OA 1ZKGA 1ZLKA 4ETSA 3ZQFA 4CCNA 3HTSB 3F8BA 4BU2A 2M4GA 2KIUA 2F5VA 4AYBA 1ZELA 1FMVA 1OCCH 1Z91A 2XAGA 3A4CA 1N75A 2HOEA 4HNTA 2XGCA 4J00A 4BHCA 3FK7A 3H9GA 2R0QC 2GZWA 5LRSA 2EV5A 4GYGA 5JHFA 3I55I 5FD6A 4NQWA 2JN6A 4PSWA 2CO5A 1YG2A 2Q0OA 3W6KB 4RLFA 4HNVA 2WV1A 3KEYA 2PMHA 3GFMA 1D3YA 2EINH 3N97A 1TC3C 4AC0A 1IG7A 1GVJA 2JA5J 2M5WA 1ON1A 4A3JJ 4KFCA 6PAXA 2FRHA 3FHNA 2QEXI 2P5LC 2FNAA 2X1DA 4DGWB 4MHGA 2ZFUA 2VE8A 4LK0F 2VPLA 2FE3A 2X6XA 4KNYA 3DP7A 2EK5A 1WI3A 3HUGA 1QO0D 4A3EJ 1YJNI 3H36A 4C3HJ 2NVQJ 3H9JA 2HVQA 4DNCA 2JJ7A 2LNBA 2HNHA 2DFIA 1I39A 2JUCA 2KLOA 4CGZA 3ZQIA 5KCMA 5KHDA 1P7JA 4PCQA 5D5WB 4IHTA 3ELKA 1RPWA 2E5NA 5EJCA 4HSTA 3ROUA 3IAS2 4M6VA 1DP3A 3UNGC 3PUBA 2R7QA 1LVAA 5FFXA 4XKCA 3H5RA 2A61A 5IPAA 3ECHA 3I71A 3LSTA 5ILUA 3I4NJ 1HKSA 3FXQA 4U7BA 3CMEI 4NNJA 5HS8A 3PNVA 3S3MA 4CA0A 5J47A 5TISC 2QYOA 2DOAA 4MLOA 3R61A 2IS4A 2ELKA 3F6VA 2EILH 3GTPJ 3IUOA 5GTHC 1RESA 1X4OA 2H1LA 3M07A 2V1UA 2Y0SA 1MSEC 1BM9A 2HYGD 3FBNB 4E7LA 4IQ4A 1I27A 3K4JA 3OSGA 2VQGA 3JCUC 4OIQF 1HKTA 1IGNA 4LLLA 1PVEA 5ILVA 2LVSA 3FXLA 3RKXA 3RYRA 2VOOA 3K10A 4ESJA 4XLPF 1T0FA 1UHWA 3ERED 4A3KJ 1S72I 1OR7C 1YIJI 3SEQA 3RQIA 1P6RA 1TNSA 3H0GJ 4FQGA 4MQ9F 4HRIA 3E97A 2O3FA 5J8CA 1RNLA 1JHHA 3ZQGA 2LD5A 2M7AA 4DJAA 2PJRA 1E3PA 2KL4A 2VKHA 1I50J 3IRRA 1EH8A 2OZ6A 4NQWB 3Q5FA 4XRMA 3GTOJ 4IHSA 5B66C 2W84A 1VQNI 2HPMA 4FASD 4Y7NJ 4HAMA 2CQXA 1W36D 3FMRA 3EUHA 4BUPA 4LLNA 4JX4A 3KPHA 5HS7A 5EDNA 1JT6A 4G94A 1WFXA 5GAEJ 5IP7J 5CQEA 1KYWA 4A12A 1QU3A 1E17A 2P4WA 3MWMA 3HGGA 1W1WE 4UB8C 3WGHA 2VN2A 1IRGA 3OR1C 3I64A 3HUGB 3RQ4A 3ABKH 3OL3A 4NC8A 3L2UA 2OTJI 2R7WA 1XMAA 5M5WJ 1DQUA 4QLCU 1DPRA 2STWA 3B02A 2R5ZA 1TQMA 2DDAA 2OAZA 4AIJA 4OOIA 3K69A 2VC1A 4NC7A 1K7AA 3AG3H 1VQ9I 1ETYA 1MH3A 2O8XA 1MMDA 3FISA 1FSEA 1OCPA 3E6MA 3GFLA 2HTSA 2R7UA 2OF7A 2E7WA 3AG2H 3B6CA 1RI7A 1MJBA 3LAPA 2PN6A 5FB2A 1MNMC 3K1MA 4HQEA 3M9AA 2W1OA 2XB0X 4XRFA 3CDLA 1POGA 1LNWA 1HW5A 2XIGA 2HPIA 3SEZA 2K3FA 1H9GA 3PNTA 1YJWI 5IYBJ 2COMA 2D1HA 3BZCA 5FJ8J 1SFOJ 5BS6A 2X48A 3KIOA 4U87A 3LQRA 3C7JA 1KYZA 3DF8A 2NNNA 4JQFA 4PUSA 4P1WA 1AU7A 2HEOA 3WTYC 4X6AJ 5E18F 3P9KA 5D8LB 3O2PE 4F91B 2R7VA 3MFKA 1VQPI 3ZP5A 3I54A 2WY7Q 3ZMZA 1A36A 4C30A 3H1CA 4FE4A 3WTSC 2XC7A 1RR8C 2B0LA 1Z9CA 2KRFA 4AVZA 3CMMA 3O8HA 3E5UA 4O5VA 3HRMA 1MMSA 3CUQA 4N9HA 1JJ6C 3MAJA 3L1PA 1BA5A 1I5ZA 2DYSH 4YIIA 1SFUA 1GXQA 3HTUA 2PJRB 5CJ9A 1TWCJ 5E20A 2K7LA 3GEZA 4BBRJ 2A5YB 3EUAA 1D1CA 4ENJA 1HOMA 1IN6A 1GV2A 2RNJA 4B47A 1UFMA 2E7XA 1LFPA 2F4MB 3WU2C 2CUFA 1G3TA 4NB5A 4M3GA 2XGDA 3HL2A 5E17F 3KCCA 1SFEA 1ZHFA 2ESHA 4M9SA 5D5VB 3QODA 2HVRA 1XCVA 1STZA 2R7XA 4ANJA 2STTA 4IHWA 1A5JA 1XG1A 3FDYA 3OY9A 1U8RA 2XV4S 2VBWA 3FHZA 4PSXA 3CMAI 1H88C 1OYIA 1DDNA 2CV0A 2BY1A 4WCGA 2RNGA 1R71A 1ZYRF 4WXCA 1E3OC 2K4BA 3KP5A 3CLQA 1HCRA 3HOZJ 3DBHB 3E5XA 4CO8A 4FETA 5J1UA 4KMFA 2R5ZB 4KT5C 2HWVA 2OV7A 1Y0UA 2OCEA 2CFXA 3M8FA 3KP6A 3CCLI 2R3SA 3TO6A 2BY3A 1IF1A 4B43A 1I1GA 2V1XA 3I4PA 2R93J 3PJRA 1EA3A 5GPCA 3MZHA 1D0ZA 1T6SA 3HHHA 3F22A 3K4KA 3WTTC 3PM1A 3HOWJ 2H6BA 4H4KC 4JYKA 3PL8A 2WB1A 3DEEA 2GA1A 4D9JA 1HC8A 1QVTA 4XN3A 4P9UA 1OLTA 3M1EA 3BG3A 3U1KA 1FY7A 3KFWX 1VFCA 1T98A 2YUSA 4RDUA 5GTIC 2VB6A 1S7AA 1B1BA 2YX4A 3KYLA 3G73A 1OPCA 4BXUA 1NK2P 5M3FJ 2QUFA 3K4BA 4RM2A 3A0HC 1BI3A 5A2QZ 2DMPA 4S05A 4OINF 2UZKA 1J75A 1T08B 2EFNA 3CUQB 5FKKA 4I98B 3X2QH 1T2KA 4HLYA 3LSKA 2OD5A 1WJAA 3DKYA 1PYVA 4DIQA 5DUKA 1PUFA 2P0WA 2HOSA 1DGWY 3M8EA 4NHJA 2NVTJ 3CO6C 1B6AA 3REOA 3H3ZA 4JBAA 4A0YA 1X58A 5CPRB 2W25A 4YFXF 4UY8I 1F9NA 1G59A 4I99C 1X1AA 3HRSA 1Z3YA 1YX5A 2P7VB 2NOGA 2DOFA 2QSFX 1V5GA 3ABMH 2KJBA 4DYQA 4LITA 2AO9A 4IRIA 1DGRM 3TMOA 5JR3A 3HC7A 4XLNF 1VQKI 1FYMA 4BNCA 2HOTA 1F1ZA 1SVLA 4HX8A 3VSKA 5JI6A 1G3YA 4QPQA 3J80Z 4PDKA 2VASA 1Z6TA 2EFPA 3GWZA 1NTCA 2XF6A 3G2BA 3VODA 2WAQA 3W3CA 2ZCWA 3KP7A 2L4AA 3CJQB 5LLQA 2YU9J 4XLCA 5CYVA 3ZQLA 4JK1X 3BTIA 3M1CA 5IOZA 3BWGA 3C1DA 3HB9A 1R23A 5DCFA 3L00A 2Z3YA 3SZGA 2A6EF 4BH9A 5HVQC 1EJ9A 2JSPA 3V8LA 2HYFA 2D2WA 3U9GA 2MSYA 3GZNB 1LPQA 2VONA 3RPUA 2JRTA 4EQQA 5K7FA 1U3EM 3JRAA 2Y48A 1Z21A 1YIOA 3GLLA 3ASNH 5E8GA 2EZKA 1U5TA 2H27A 3OV8A 4PFOA 5F1RA 1KA8A 4DYCA 5DM6F 3S2HJ 2IEKA 2JUGA 1QRYA 5ILSA 1IRXA 1W0UA 1FOXA 3DBLB 3GVAA 3VSLA 4LB6B 4KITB 2YS9A 3ONQA 2GIZA 1LVKA 5BOXA 1HW2A 3BPXA 4RAYA 1QVUA 2QGUA 5HOOA 5LEJA 2V6EA 1WQ2A 2F4OB 1UMQA 2XKOA 1YLFA 4XN0A 4ZYEA 4FTHA 1KU9A 4BE0A 2EB7A 1VQMI 3KZIC 1ETOA 2Y75A 4I02A 4GFBA 3JRDA 2L54A 4ZTJA 3RKQA 2M87A 3W2WA 1ZARA 2COBA 2QSHX 3F8CA 1PUFB 2DA4A 3Q0VA 1SC7A 1YQAA 2HXOA 2K02A 1XB4A 1A35A 2ISZA 3S17J 4OAZA 2LY1A 4M3EA 2GAUA 3P9IA 1ONVA 4ITVA 2O9LA 2BV6A 4AVPA 2RGVA 1MMNA 4Z6YA 3LSIA 3WE2A 4C3JJ 2ZXHA 2L7KA 3K4LA 1U78A 2DJNA 4RLQA 4NBQA 3QQAA 2L7MP 2L7FP 2EIKH 5HLTA 2E1OA 3O8GA 1NK3P 4KT6A 1W4MA 3QYFA 5K7HA 4YFNF 3PO2J 5H20A 1TT0A 5JVGF 3LAJA 3Q3SA 2HU9A 2A05A 2ZNYA 3C2HA 2GOXB 1D0YA 2HFHA 4M6YA 1FPQA 2LREA 2CWEA 4JX6A 3ZQCA 2CFOA 5J6XA 3FM5A 2XGEA 1FOWA 1YYVA 1MNDA 2GXAA 2HZTA 5LHHA 2QQ8A 1EKEA 5J8FA 1HSTA 3LMMA 3S1RJ 4CCOA 2ELJA 4MTEA 1GHCA 4XLAA 4LFUA 2L9VA 4ENNA 2WV0A 4MEYF 2E2HJ 3MKZA 4RMNA 5BQTA 4YRVA 2CRGA 1O3SA 2R7OA 3SFIA 4WK8F 3BR0A 4S0HB 1U5TB 2LH9A 2LF8A 1K83J 1W5SA 3ERMA 3FF5A 2IS1A 2KJCA 1D1BA 5D8KB 4S04A 2YX7A 4NUBA 3F21A 1LFUP 1ETWA 1YO5C 2LBFA 2LMDA 2IJLA 4HF0A 3NQOA 3ZMUA 4C9YA 4CH7A 1LDJA 2VE9A 3GTGJ 1KZHA 1FZPB 5DCMA 1K4TA 3KYCB 1SAUA 2K5CA 2X0LA 2K85A 4FX4A 2VXDA 3BJAA 3I3LA 3L2WA 1R7JA 2V79A 4F93B 4HNUA 4HOBA 2XF5A 3IAM2 1QHGA 2HQ5A 1YS6A 5LFAA 4L5IA 3S1QJ 4OMZA 2E1MC 4HSRA 2M1BA 3FXMA 3IH4A 4AIHA 4CCLA 5A2QK 1ZG3A 1R5HA 3NAUA 3LA3A 1OR7A 4OIRF 3WE3A 5DS9A 2AQFA 3S14J 3JW4A 4G12A 3F8NA 3KLNA 2A6HF 1BJAA 4FISA 4ZDLA 2NS8A 3H5NA 1X2NA 1OYYA 3VFZA 3S3NA 2LTPA 2Z5UA 5KAIC 1UZCA 4IKFA 3V8JA 1TBXA 1D1AA 1A04A 5D4RA 3BY6A 3SDBA 5HDNA 2ZKZA 3KP2A 1Z7UA 1YW8A 3LSGA 4CXFA 4PK4A 1PDNC 1KONA 3HHGA 3SHFA 3CJTB 1U9OA 2K4JA 1N78A 1M1EB 1IXSB 2BYVE 2F48A 5CVIA 2TRTA 4RBOA 5FLVA 1FIPA 1IN5A 1QHHD 1Z7LA 2LY9A 4D5CA 2M3AA 3W2VA 1EF4A 2VQLA 3EYYA 4OIPF 5HNHA 3HOYJ 2F6CA 4GRIA 3S3OA 2XB5A 1KQ0A 3K4MA 4OIOF 2VODA 2JZYA 1OQYA 2D1VA 2XPVA 4V2FA 5IYDJ 2CJJA 3BT9A 2R4GA 2LBFB 2RQPA 4II3A 3VYTB 2KDOA 2LRDA 1HXDA 2JA2A 1HQCA 4B09A 2K27A 3CD6I 5DCMB 3GFJA 2E2IJ 3Q9SA 1MW7A 1R9TJ 2OA4A 2DK8A 1Z1DA 4A3GJ 4BEHA 2IS2A 5EZGA 4R1HA 3W2AA 2QKMB 5L3CA 4D7NA 1OCRH 1XGMA 3BC8A 2KP6A 5F64A 1T56A 4GO1A 4UV8A 1CGPA 2R7TA 1BR2A 2GM4A 3IP4B 1ZTRA 3SYTA 4B48A 1KGSA 5J4VA 1QQIA 4G6DA 3ZQHA 2P7CB 4EM1A 2YR2A 3G1LA 1D8JA 1YTYA 2XROA 1WI9A 2ZJRF 1ACIA 3WHCA 2Z2SB 1P4AA 1O7FA
chains in the Genus database with same CATH topology
1YJNI 1HC8A 1VQ8I 5DM7F 5GAGJ 3I56I 2E34A 1VQMI 1VQ7I 2JQ7A 1YJWI 2K3FA 4V19K 3CCRI 2NXNB 2QA4I 1VQPI 3CMEI 1FOYA 3J7ZI 3CC4I 1YITI 1VQOI 3DLLF 3CCJI 3G4SI 4IOCF 3J7YJ 1VQ5I 3CJTB 1MMSA 4UY8I 5GAHJ 3PIOF 2H8WA 3CC2I 5JVGF 2OTLI 3G71I 3CCEI 1S72I 1VQKI 3PIPF 1YIJI 1VQ4I 4IOAF 1FOWA 1YJ9I 3CF5F 1Y39A 1QA6A 2ZJQF 2E35A 2ZJPF 1VQNI 2E36A 3CCQI 3CMAI 3I55I 3CD6I 5GAEJ 1YI2I 3G6EI 3CCMI 2FOWA 1VQLI 3CC7I 3CCLI 3CCSI 4IO9F 1YHQI 5GADJ 2OTJI 2QEXI 5DM6F 1VQ6I 3CCUI 1FOXA 2ZJRF 1ACIA 1VQ9I 3CCVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN I;  1HC8 A;  1VQ8 I;  5DM7 F;  5GAG J;  3I56 I;  2E34 A;  1VQM I;  1VQ7 I;  2JQ7 A;  1YJW I;  2K3F A;  4V19 K;  3CCR I;  2NXN B;  2QA4 I;  1VQP I;  3CME I;  1FOY A;  3J7Z I;  3CC4 I;  1YIT I;  1VQO I;  3DLL F;  3CCJ I;  3G4S I;  4IOC F;  3J7Y J;  1VQ5 I;  3CJT B;  1MMS A;  4UY8 I;  5GAH J;  3PIO F;  2H8W A;  3CC2 I;  5JVG F;  2OTL I;  3G71 I;  3CCE I;  1S72 I;  1VQK I;  3PIP F;  1YIJ I;  1VQ4 I;  4IOA F;  1FOW A;  1YJ9 I;  3CF5 F;  1Y39 A;  1QA6 A;  2ZJQ F;  2E35 A;  2ZJP F;  1VQN I;  2E36 A;  3CCQ I;  3CMA I;  3I55 I;  3CD6 I;  5GAE J;  1YI2 I;  3G6E I;  3CCM I;  2FOW A;  1VQL I;  3CC7 I;  3CCL I;  3CCS I;  4IO9 F;  1YHQ I;  5GAD J;  2OTJ I;  2QEX I;  5DM6 F;  1VQ6 I;  3CCU I;  1FOX A;  2ZJR F;  1ACI A;  1VQ9 I;  3CCV I; 
#chains in the Genus database with same CATH topology
 4XR6 A;  3HXL A;  2GWR A;  1OYW A;  1ULY A;  3OYJ A;  3HSE A;  3OYC A;  4BQA A;  2LKP A;  2GXG A;  2LR8 A;  4LGW A;  2H6C A;  2KIF A;  2GOM A;  2GA2 A;  3KZZ A;  3CCR I;  1N25 A;  5K7Z A;  4BXF A;  2UUZ A;  3ZMS A;  5CVJ A;  4IF4 A;  3DPT A;  4HG2 A;  4A6E A;  2A68 F;  4AYB N;  2XAJ A;  3F6O A;  4CYD A;  2Y0M A;  2JRM A;  1OIS A;  3W6V A;  2DQL A;  4U88 A;  5IT3 A;  4E7I A;  4C2M J;  1WRJ A;  4IVN A;  3DTK A;  2D5V A;  4RM3 A;  4WF2 A;  1XTA A;  3OIP A;  1MGT A;  3HEF A;  1MBH A;  4GCV A;  4A93 J;  1ETK A;  1Z05 A;  2M7B A;  4ESB A;  4A3I J;  2NNY A;  1A6Q A;  3LA2 A;  1WJ5 A;  3DV8 A;  4XOT A;  2JA7 J;  1VZ0 A;  2VUM J;  1ZRC A;  3ISP A;  3G3Z A;  3V8K A;  3E7L A;  1HBX G;  2X85 A;  1ZK8 A;  2M8G X;  2H8W A;  1K78 A;  5E3M A;  2DO7 A;  2HQA A;  1G4D A;  3KEO A;  4L9T A;  1R1U A;  3GUD A;  4PJN A;  3TW7 A;  3GTL J;  4IOA F;  2Z33 A;  3L09 A;  2CUJ A;  5F0H A;  2LKX A;  3A2K A;  2PLY A;  4XBF A;  4J19 A;  3RTR A;  1SEU A;  3ZMD A;  1Y39 A;  3GTK J;  4XOR A;  3N4M A;  3I53 A;  1ZRE A;  4LG0 A;  2MC4 A;  4E7J A;  1FOK A;  1IC8 A;  3DQV C;  4BEH B;  1KQ8 A;  2E35 A;  4XSX F;  4J01 A;  3QOE A;  1Z0X A;  4YG2 F;  2DPD A;  3P7N A;  1P2F A;  1YI2 I;  1T8I A;  1U0J A;  1J59 A;  1ZR2 A;  1LE8 A;  2L9S A;  3EDP A;  2DA1 A;  2O03 A;  1FC3 A;  1SFK A;  3JRI A;  2M34 A;  5HLI A;  1WH5 A;  5LGU A;  3OWT A;  3OYI A;  2L9R A;  4IO9 F;  4BJ5 C;  5J1R A;  2M4K A;  3U1D A;  1HSJ A;  2G7H A;  3J81 Z;  3CUO A;  2VJ4 A;  4I2O A;  4A69 C;  5FLX Z;  2ZJ2 A;  3RSN A;  4BKX A;  4R79 A;  4CDG A;  2LSO A;  2Y0S N;  2Y31 A;  3MKW B;  3TOB A;  1K6O A;  3BQZ A;  1IDZ A;  2K9N A;  3V7R A;  4RGX A;  1G2H A;  4ZDP A;  1ZG5 A;  2E60 A;  2X4H A;  3ZQ7 A;  2VBZ A;  3TW6 A;  3BRO A;  2VQH A;  3GTJ J;  4ENM A;  4IQJ A;  2DBB A;  2K40 A;  1JXS A;  4KIF A;  2IA0 A;  5FRM A;  2OQG A;  3S32 A;  2DPU A;  3K2A A;  2K9L A;  3CF2 A;  5J3L A;  4N9I A;  4E7Z A;  1S3J A;  4L9N A;  1MBG A;  4ZTF A;  4LK1 F;  2CUE A;  3WTZ A;  4F52 A;  2Y9Z A;  2RQQ A;  1BI2 A;  2VKE A;  3FXR A;  2E1N A;  1WVR A;  1MSF C;  3F8F A;  5D4S A;  3HKZ A;  1S7O A;  2DA7 A;  1C0W A;  4KJZ A;  1Y6I A;  5F1J A;  1MJ9 A;  2C6Y A;  1P4X A;  1VQO I;  1K78 B;  1FEX A;  1SFX A;  1AKH A;  2H94 A;  3L2Q A;  3JAM K;  2X6Y A;  5BPI A;  2AS5 F;  3KE2 A;  1TQP A;  1ZN2 A;  2VI6 A;  5HLG A;  3VWB A;  1G8X A;  4CZC A;  4LJZ F;  4E4H A;  2KRC A;  2P5K A;  4BE2 A;  4UVC A;  5EZH A;  2FBH A;  3VYR B;  1S9H A;  1RUO A;  2PFB A;  3A02 A;  1IN7 A;  3G1M A;  3S8P A;  4LIV A;  3HOU J;  1I6X A;  1TQI A;  2KMU A;  4ESF A;  2H09 A;  5CVR A;  1ETV A;  2DFF A;  4FX0 A;  4IZZ A;  2ZME A;  1QZY A;  3I5U A;  5BNG A;  4LG0 B;  1D8K A;  2ZO4 A;  3B73 A;  4LD5 A;  5EG0 A;  2Y30 A;  2FQ3 A;  1I3Q J;  3WOD F;  1IV6 A;  3BLY A;  5F27 A;  2FQ4 A;  4UNO A;  1JGS A;  5CVU A;  5J1Y A;  2M30 A;  1DU6 A;  1LE8 B;  2R7R A;  3FBI B;  3I9V 2;  3GYH X;  1YRN A;  4BGD A;  3HRT A;  5DUI A;  1BR4 A;  2RRE A;  4MFD A;  3WG9 A;  4OAY A;  2BOL A;  4D7M A;  2DOE A;  2M2E A;  1K79 A;  3ABL H;  3CCM I;  2MW8 A;  4A3M J;  3DFG A;  3OYL A;  2RN7 A;  2R7F A;  2YU3 A;  3S16 J;  4R8H A;  3DU6 A;  3C18 A;  3EPZ A;  2KZG A;  2EV6 A;  4HV5 A;  2IW5 A;  2Q8K A;  5L3G A;  2AHQ A;  3LSJ A;  3TDZ C;  3T8R A;  1WKM A;  5E79 C;  1FBU A;  3JRE A;  2DCE A;  4U0W A;  4AIK A;  4M9Z A;  4A0X A;  5M5Y J;  3B6A A;  4G8X A;  5ERI A;  2IGK A;  2IGN A;  4PJL A;  1T33 A;  2QQ9 A;  3BCA A;  1BC7 C;  2HDC A;  3V7C A;  4WWC A;  2HDD A;  3WU0 A;  5L3B A;  4X1E A;  1TNT A;  1V5E A;  1XCB A;  4PGH A;  2XAF A;  2FBI A;  2IVM A;  1X2M A;  5IT9 K;  2E34 A;  4V2G A;  3VB2 A;  1QGP A;  3GW2 A;  1SAX A;  1ODD A;  1NG6 A;  3BG7 A;  3WTW C;  3K70 D;  4C2U A;  3NRV A;  2A69 F;  3DEW A;  4MQV A;  1HLV A;  2XVC A;  2F5C A;  1AKH B;  3GME A;  1QPM A;  1JUS A;  2ELH A;  3JSP A;  2MD0 A;  3FMQ A;  4MEX F;  4IXA A;  2DN0 A;  2DTR A;  1MMG A;  1XD7 A;  3DLA A;  1QBJ A;  4RB0 A;  1IUY A;  2L7Z A;  5L3D A;  1WPK A;  2BZT A;  3F72 A;  5EGO A;  3AL0 B;  2ZC2 A;  4CCJ A;  3TO7 A;  3BJ6 A;  5M5X J;  1Z6R A;  3RPQ A;  1T38 A;  4XK4 A;  2ZME B;  2R7D A;  3TQN A;  2EZL A;  2KFD A;  1FT9 A;  1JI8 A;  2FBK A;  2PX9 A;  5EG0 B;  2XSD C;  2QM3 A;  1B9M A;  1JTX A;  2OCC H;  4L9V A;  1J2X A;  4FCY A;  3DKW A;  5IP9 J;  1P7I A;  2BY0 A;  3ABT A;  1Y0N A;  2RV8 A;  1X1P A;  3WTV C;  3I59 A;  3EET A;  4O3M A;  4HF1 A;  4UV9 A;  1W0T A;  5LGT A;  1OKR A;  4EJV A;  5FKL A;  1HKQ A;  2DA5 A;  1YRN B;  1G3S A;  2CV2 A;  2WAF A;  5IY5 H;  4I76 A;  3OYM A;  1N77 A;  3AFH A;  2FX0 A;  3RKW A;  3SFZ A;  3BPV A;  3LSR A;  3HDD A;  1F4K A;  1FP1 D;  1MBF A;  5EYR A;  3IWF A;  3JRC A;  1WJD A;  3QPH A;  4B8X A;  2WB1 N;  1BJZ A;  2Z1D A;  4Y17 A;  5D6F A;  1XDU A;  2JMW A;  4ASN A;  1JJ8 C;  2D45 A;  2V26 A;  2LLK A;  4JOM A;  2HVS A;  3KEQ A;  5ICE A;  3DU5 A;  3CTA A;  2L9N A;  2E36 A;  3D0S A;  2IT0 A;  3CCQ I;  1L3L A;  5FKN A;  1TWF J;  4LMY A;  1YE9 A;  4PZJ A;  3RPU D;  2KRH A;  3J81 K;  2XRL A;  3DCF A;  2NS7 A;  4RGU A;  5FLX K;  3R4K A;  1VQL I;  1ITY A;  2MD5 A;  2NOJ B;  1TP4 A;  2KKO A;  4A3F J;  4U0V A;  3JR9 A;  3EUH C;  1SVO A;  2HQR A;  2P81 A;  2G7U A;  4I01 A;  1H8A C;  4GXO A;  2G0E A;  4KDP A;  4Q5S F;  5GAD J;  1JTY A;  3IKV A;  5ED4 A;  2DI3 A;  1R5I D;  2XAS A;  1A31 A;  3WGG A;  4D5F A;  2VJJ A;  3OOP A;  2IRF G;  3J7A O;  2GBY A;  4Y4R A;  5DD4 A;  1IN4 A;  2KIQ A;  3FXJ A;  2KT0 A;  1R6R A;  3K6G A;  1HF0 A;  2V4J C;  3HOS A;  3M4O J;  1ZGW A;  2BVL A;  4CHU A;  2ZFW A;  3CP8 A;  1UG0 A;  2CQN A;  1VQ8 I;  5AIP A;  1S7E A;  2IS6 A;  1J0R A;  4C3I J;  3WTX C;  1BI1 A;  2TDX A;  1VQ7 I;  1PP7 U;  2PBI A;  4OMY A;  2DMN A;  2BW3 A;  4UUV A;  4G6T B;  1W5C C;  2MFZ A;  4KIS A;  1FSH A;  3QOP A;  3EUK L;  4MNU A;  5EGO B;  5GPA A;  2QA4 I;  2WAQ N;  2AXT C;  1TL8 A;  1V55 H;  3TGN A;  1OFC X;  1BW5 A;  2HOA A;  4RB2 C;  3H35 A;  1WSU A;  3JTH A;  5HNF A;  3R0J A;  3SXY A;  2VXZ A;  4UVA A;  1Y1V J;  2XAU A;  4EM0 B;  1WJE A;  3BQY A;  2ZNZ A;  3I59 B;  1CQT A;  4AU7 A;  3IKT A;  3FKJ A;  5LGN A;  4ZZD A;  4XIC A;  2ZB9 A;  2BBY A;  4RAG A;  4Y15 A;  3TOA A;  1CF7 A;  2DA6 A;  1S5L C;  5IP6 A;  4KIB A;  4B3X A;  1IO2 A;  4ON0 A;  2NAZ A;  4IPA A;  2ZXJ A;  2HKO A;  2M9H A;  2HDW A;  3SJM A;  1YX3 A;  2OTL I;  4NC6 A;  5CKT A;  3JRH A;  2F5E A;  2P6S A;  2E1M B;  2DW4 A;  5JFR A;  1B9N A;  4H0E A;  2V1D A;  1VQ4 I;  2AQE A;  2L0K A;  3CUQ C;  1A6I A;  2L5Q A;  4RA2 A;  3ZN0 A;  2MG4 A;  1BI0 A;  3BOQ A;  1R00 A;  5CLS A;  1ENH A;  5B5E C;  3H9Q A;  5H2F C;  4D1Q A;  4N4N B;  3H3V K;  1Q1H A;  1BBY A;  1BW6 A;  3WGI A;  1S6L A;  2RVC A;  4M3B A;  4Y13 A;  3MVP A;  2JWT A;  4W97 A;  2JSC A;  2VL8 A;  2Z99 A;  5JHU A;  4LLG F;  2M45 A;  2YPR A;  2OU2 A;  5HS9 A;  1FWZ A;  1F43 A;  2PMZ A;  3CCS I;  2VPR A;  4G6Q A;  2FEZ A;  1IJW C;  3FMS A;  1HW1 A;  1ETX A;  2FJ1 A;  4DBQ A;  4XNF A;  2WAD A;  2ETH A;  5C4J J;  1J09 A;  1S29 A;  1SD6 A;  3HGY A;  3OL4 A;  2BW3 B;  4YFK F;  3KP4 A;  2W82 A;  1IV8 A;  1USS A;  2L01 A;  2QEN A;  3GO5 A;  1REP C;  1V4R A;  2Y69 H;  1ON2 A;  1YW9 A;  2F5F A;  2ECB A;  2WY8 Q;  2QZ8 A;  2EIJ H;  5DM7 F;  3I58 A;  2M0M A;  4UHT A;  2FUG 2;  2DYR H;  2VJI A;  4XM3 A;  1X4P A;  2CUZ A;  5LD2 C;  1ZGA A;  2KDZ A;  3A0B C;  3ESW B;  3ZRG A;  1F5T A;  3O6B B;  3K1N A;  4CCK A;  1AWC A;  1XSX A;  5E1X A;  2VQC A;  2F4I A;  2QKL B;  2PG4 A;  4II2 A;  3RJP A;  4HZF A;  2JK3 A;  1CF7 B;  1UEL B;  1FJL A;  1DU0 A;  2CGP A;  3AAF A;  4E7S A;  3OYG A;  3TDU C;  3H0D A;  2EFQ A;  4L0Y B;  5KVR A;  1LEB A;  3LOC A;  1R1T A;  1QZE A;  2KIM A;  2NS0 A;  4FE7 A;  1U8B A;  2UXX A;  5B3S H;  4RAZ A;  3L2V A;  4JP0 A;  2X1E A;  1TWG J;  1RC9 A;  3L7W A;  3FIW A;  4AM3 A;  5GAH J;  3Q9V A;  1B4A A;  4IL6 C;  2WWY A;  4E7K A;  3QU6 A;  2KPM A;  4WXH A;  4P55 A;  9ANT A;  2WTE A;  4XLE A;  5H6Q A;  2XGX A;  2DA2 A;  3HYI A;  1X3W B;  1UAA A;  1TW3 A;  2OUM A;  1FLI A;  1XDS A;  2KHM A;  2LG4 A;  3QP6 A;  5D6E A;  4DW6 A;  2KQR A;  4XRS G;  1J7K A;  4HA8 A;  3BG9 A;  2UXN A;  4AD9 A;  1XMK A;  1XN7 A;  1WZ2 A;  4L5E A;  3ZQQ A;  4DZJ A;  2HKX A;  3K4N A;  3MD2 A;  1QNT A;  3COA C;  4E7H A;  1IW7 F;  2JPB A;  4M71 A;  2CV1 A;  2ECC A;  2Q1Z B;  1BN5 A;  4IHX A;  4AWX B;  3HBL A;  2BVM A;  4ZYA A;  3JAM Z;  3G6E I;  1R36 A;  2DDB A;  1X1C A;  3ZOB A;  5J40 A;  3LFU A;  2A07 F;  2V1N A;  1W7P D;  1J5Y A;  2LF7 A;  4E70 A;  2TCT A;  4PFP A;  5LBQ A;  4YEL A;  3QAH A;  4GGG A;  4ZH4 F;  1YHQ I;  4B4C A;  2CQQ A;  1SMY F;  1IXC A;  1Y56 A;  5HDK A;  1DPU A;  5F0C A;  3OYE A;  4LOC A;  1XPX A;  1U5T C;  1GLN A;  2E5Z A;  3BTJ A;  3E0J B;  4ZC3 A;  2B63 J;  4CIC A;  1RR7 A;  4BQO A;  3MMY B;  4XLF A;  5LEK A;  4I6Z A;  4BY1 J;  2LYC A;  3AG1 H;  3GFI A;  3D5L A;  1BIA A;  1U9N A;  2EJR A;  4L9J A;  2JQ7 A;  1W7P A;  2Z16 A;  4FHT A;  5FD5 A;  4V19 K;  1XSD A;  2PJP A;  1MMA A;  4FT8 A;  2CQ7 A;  2O8K A;  3VOE A;  1ZLJ A;  2CQK A;  4F7Z A;  1L0O C;  4BAY A;  2I10 A;  4A6D A;  3CO7 C;  2V9K A;  3OSF A;  3DKX A;  4DYR A;  4F55 A;  1EH7 A;  1ZAO A;  1JKP C;  4EJO A;  1YFH A;  2VJ5 A;  4XSZ F;  4HYE A;  3DWL E;  5FRO A;  4I09 A;  5KK1 A;  2ESN A;  3LA7 A;  4BJ6 C;  1B72 A;  3LSP A;  4DOZ A;  4WX9 A;  2RAE A;  3CDH A;  1UJ8 A;  1H9T A;  1E0E A;  3BR5 A;  3HRU A;  1JT0 A;  5B1A H;  3HM5 A;  2IA1 A;  4XL9 A;  1WJB A;  1LFB A;  2ZSH B;  1RZ4 A;  3PIO F;  1FP2 A;  2FMY A;  3CC2 I;  1T95 A;  1LEA A;  1AOY A;  1GV5 A;  3VEP A;  5IT9 Z;  4HBL A;  4EJW A;  5ICF A;  3F23 A;  2UWM A;  3CMY A;  3MKL A;  3N05 A;  3PIP F;  3OIO A;  2GLO A;  1XGS A;  2IGO A;  4A2U A;  1MNE A;  4Y33 A;  2EA4 A;  4A3B J;  2WBM A;  5F08 A;  5DDG A;  4MTD A;  5JLX A;  4C2T A;  1PUE E;  2ZJQ F;  2OPT A;  2HR3 A;  4ZYH A;  1G6N A;  3ML6 A;  4MGR A;  2CS3 A;  5L3E A;  2MA3 A;  4CYC A;  4BDZ A;  3MQ0 A;  1FMW A;  5K5O A;  2FA5 A;  3E5Q A;  2ME6 A;  4A0Z A;  2G9W A;  2J5O A;  1VI0 A;  4RGS A;  3E1S A;  3BZK A;  3PSI A;  5H6R A;  3GZ5 A;  3HZJ A;  3RKY A;  4F92 B;  4N4O B;  2E71 A;  3CCY A;  4YIR X;  2BEO A;  1MIJ A;  1EV7 A;  3TL4 X;  2CYY A;  2DAO A;  2JPC A;  5KNL A;  2LOO A;  3NWS A;  1ZH5 A;  4BHB A;  4JX5 A;  1KU2 A;  2FML A;  3BDD A;  3MKY B;  2PMU A;  1GXP A;  3HOV J;  5JVT A;  5KAF C;  2Q2E A;  5EEA A;  1ZRF A;  2BXY A;  2QF7 A;  2NVU B;  4XON A;  1W7P B;  1PJR A;  3ECO A;  5AON A;  4ZDO A;  2BE5 F;  2V6C A;  4HW0 A;  4XKB A;  2VT3 A;  1FYK A;  3QRF F;  2GQQ A;  3TKY A;  4EGZ A;  2DA3 A;  4BY7 J;  3V4G A;  3I56 I;  5BPD A;  3EQL F;  2CSO A;  3DPL C;  1GVD A;  1XC5 A;  1WHU A;  2DU9 A;  4BS9 A;  2V7F A;  3GXO A;  3PQK A;  2I8D A;  1TWH J;  1VTN C;  3G1O A;  1MBJ A;  3PFI A;  2EV0 A;  2LP0 A;  3MEX A;  4N0B A;  1B72 B;  3VPR A;  2WC2 A;  5D5X B;  2O61 A;  4DBR A;  1O3T A;  5DTD A;  4HX4 A;  2O6G E;  4RAF A;  1X3U A;  2VIX A;  5GP9 A;  2QSG X;  4UUT A;  2O7O A;  2QWW A;  1XMX A;  3DTI A;  3BP8 A;  3PSF A;  3CES A;  4IHY A;  3K4C A;  4A5M A;  2E1C A;  4HF2 A;  3CCJ I;  2XKP A;  5LHG A;  2O5R A;  3ZGK A;  5ICC A;  4L0Z B;  2MBF A;  4KMU X;  3BTL A;  1I3A A;  5E3O A;  2OQR A;  3QYB A;  2DT7 B;  1MZB A;  3OIQ A;  4KN4 X;  3A1Y A;  4G9Y A;  1D5Y A;  2E19 A;  3AKZ A;  1SD5 A;  2W00 A;  4NDL A;  1TT5 B;  3CP2 A;  3CLO A;  2ADU A;  4F3Q A;  2XPW A;  2K3P A;  2IPQ X;  2X1C A;  3FKI J;  4O6J A;  3TP3 A;  1YJ9 I;  3CF5 F;  4CYC B;  2OC6 A;  1SMT A;  1HA8 A;  4M3F A;  3T0Y A;  2CH0 A;  2P8T A;  5F6F A;  5EEG A;  1TLH B;  2FSW A;  1X1D A;  3RZD J;  1MH4 A;  2V9V A;  4AID A;  1R22 A;  4UB6 C;  3D5S C;  1JUP A;  4QIW N;  4BXX J;  4HX7 A;  4EJU A;  3HOT A;  1X3Z B;  4K2E A;  3OS0 A;  4P96 A;  1Y8R B;  2LK2 A;  5IYC J;  2Q2E B;  4U7D A;  3PUF A;  5FKO A;  2O0Y A;  4AUX A;  2IA2 A;  3K2Z A;  4I0A A;  1UB9 A;  2PQ8 A;  1B8I A;  1DP7 P;  2H8R A;  2NVX J;  3CC7 I;  2IBD A;  2M8E A;  1V54 H;  1OCT C;  3HKZ N;  2P5V A;  2CG4 A;  1Z77 A;  4OWR B;  4ABZ A;  1WH7 A;  1SD4 A;  1VQ6 I;  1BC8 C;  3TBI A;  1JKO C;  1F36 A;  4B44 A;  3RCO A;  3GTM J;  1IAW A;  2EBI A;  2OJE D;  3MZ8 A;  3O3K A;  4KN7 X;  3CCV I;  1GUU A;  1RUN A;  3CDI A;  5F04 A;  3ZXS A;  2OZU A;  3SZP A;  2HGC A;  2W7N A;  1OMI A;  5TGT A;  2MLK A;  3UKG A;  1WGX A;  1OCZ H;  4GYI A;  4ENK A;  2EQR A;  4PJJ A;  1OJL A;  3BR2 A;  4MO7 A;  2HZD A;  3IL2 A;  2MC3 A;  2WAE A;  1WWX A;  4M74 A;  3ZCO A;  1WCM J;  2J5P A;  4Q48 A;  1R5G A;  2UV1 A;  4XID A;  3F8M A;  1MBE A;  1DUX C;  2ME0 A;  4BL0 B;  4Q4Z F;  1BOB A;  2BXZ A;  2LDU A;  1HDD C;  4W1U A;  2ZBK A;  3BR1 A;  2X9D A;  3OS1 A;  1TWA J;  2V9P A;  3NAR A;  1MD0 A;  2KZV A;  2NYX A;  2XUB A;  5L3F A;  2K9Q A;  4M72 A;  3G4S I;  4G7Z F;  3M8J A;  3CQZ J;  3KYD B;  4IOC F;  3S1M J;  4BQN A;  4TV7 A;  5FLM J;  1WJC A;  1Y8Q B;  5ICG A;  2VC0 A;  2F2E A;  1Z3X A;  4ZYG A;  2XSJ C;  4M9X A;  2W57 A;  3T8T A;  1S8N A;  4KIG A;  3BJO A;  3S93 A;  3HSR A;  2E2J J;  3TP0 A;  4X0G A;  3BG6 A;  3P9C A;  4D0P A;  1LDK B;  3CJR B;  4Z2Y A;  2DOD A;  1XX5 A;  2FF4 A;  2MGQ A;  3BR3 A;  1ETQ A;  1IRZ A;  4Y3O A;  5B1B H;  4I0B A;  1OCO H;  1QZZ A;  1FX7 A;  5FFZ A;  4G7O F;  1T39 A;  1XSV A;  3LSH A;  4RGR A;  4XKW A;  3NWT A;  2XRN A;  3FXU A;  1QPI A;  1B8I B;  3FXO A;  4IJA A;  2VBX A;  2HQN A;  1JE8 A;  1JGG A;  4EV0 A;  5M3M J;  3RYP A;  4E6K G;  4GDF A;  1P92 A;  2DMT A;  3L9F A;  4EJT A;  2CW0 F;  1XGN A;  3CJN A;  1LDD A;  3K0L A;  3PNY A;  1VND A;  4CZZ A;  1AA7 A;  5HDG A;  5E3N A;  3A01 A;  3OYF A;  4B1R A;  1BR1 A;  3JTG A;  3JRB A;  1Z67 A;  1R4M B;  4HDV A;  3FX3 A;  3OYH A;  3HJE A;  1LB2 A;  3E6B A;  3FZV A;  3MZY A;  2JTV A;  3ZMV A;  1T0F C;  1G3W A;  1UG2 A;  1IN8 A;  4ZZL A;  4HPQ A;  3RDI A;  3C3W A;  1IZ1 A;  2CMP A;  3F9K A;  4IRG A;  5K1Y A;  3KET A;  3JRG A;  4XRS A;  2HTJ A;  5LRR A;  5DEQ A;  2L02 A;  2F5D A;  1X1B A;  3IC7 A;  3SDG A;  1GDT A;  2DMU A;  3GBG A;  2CW7 A;  2NVY J;  1PP8 F;  1I1S A;  3QYE A;  3RIR A;  3ULQ B;  1VF9 A;  3H92 A;  1R58 A;  4IHV A;  3DXJ F;  2FNP A;  2X6O A;  1IDY A;  3RI4 A;  1H0M A;  4B3A A;  2LY2 A;  2VT2 A;  5J4Y A;  5K5R A;  2EPF A;  4EGY A;  3PO3 J;  3ZR8 X;  2NXN B;  2XHK A;  2XAH A;  3TED A;  3QPT A;  3BTC A;  4BDY A;  3U21 A;  3QPL A;  4EAT A;  3QU3 A;  4LB5 A;  3CZ6 A;  3WG7 H;  3QP5 A;  4CSW A;  4MIM A;  1ZQ3 P;  4A3L J;  1X19 A;  1D5V A;  1FOY A;  1NG7 A;  2VLA A;  4XOP A;  1UHS A;  2DT5 A;  1IUF A;  2LFB A;  1LKX A;  3BR6 A;  3UR3 C;  2MAB A;  3FWE A;  1RRJ A;  2IGM A;  5AIQ A;  2ID3 A;  4KA4 A;  4XQF A;  3DLL F;  3J7A Y;  3LWF A;  3PFY A;  2H1K A;  1O3R A;  3S2W A;  3T5X A;  3IH3 A;  4A3C J;  3WU1 B;  1LJ9 A;  3LSM A;  3IRQ A;  3S15 J;  1W36 C;  4M73 A;  2A5W A;  2QQA A;  2RKH A;  5IOY A;  5C3E J;  2XAQ A;  1FIA A;  1K61 A;  3G71 I;  3K1P A;  3S1N J;  3K7A J;  3CCE I;  2QBY A;  4EMS A;  2HYJ A;  2A3S A;  4YEJ A;  3OYK A;  1IRF A;  2X51 A;  4EVI A;  2VKD A;  2JT1 A;  1FBQ A;  3R0A A;  1H89 C;  4HEA 2;  3FXK A;  3TO9 A;  3E6D A;  3D5R C;  3AL0 C;  2EH3 A;  1JKR C;  3AG4 H;  3IV5 A;  4BAC A;  3Q0W A;  2QVO A;  2ZME C;  1BIB A;  4PJ0 C;  3S2D J;  3NEU A;  2ID6 A;  3A01 B;  1QA6 A;  1KU7 A;  2B7E A;  1P9Q C;  2Z9O A;  4LIU A;  2ZJP F;  4OU0 A;  2P6T A;  1RKW A;  2IAI A;  1XGO A;  1YS7 A;  1Y1W J;  1ORK A;  2MYS A;  4Y52 J;  2VKV A;  3MCZ A;  2LC2 A;  2BGC A;  5HLH A;  2ACJ A;  3H5A A;  2K86 A;  3VYS B;  1U2W A;  1IXR C;  1BL0 A;  1HDP A;  4XKV A;  2DQR A;  2JA8 J;  3E3V A;  2DT6 A;  1ZGJ A;  2QQB A;  3HOX J;  1D0X A;  1FNN A;  2JA6 J;  3D1N I;  2AXL A;  3Q0U A;  2W24 A;  3OR2 C;  5C44 J;  3DBR B;  1O4X A;  2IP2 A;  3C2G A;  2M0C A;  2I5U A;  2DJI A;  3W6J B;  3KZY A;  3GLX A;  1NH3 A;  3M3Y J;  1ZG1 A;  3BCB A;  2EWN A;  1U6G A;  4BHP A;  5FO5 A;  4MFE A;  4RB3 C;  3LL7 A;  3E6C C;  3ZN1 A;  2R5Y A;  4U0Y A;  3ASO H;  1SVM A;  1JKQ C;  5FKM A;  2MH2 A;  4QTR A;  3IH2 A;  1V5F A;  3GX4 X;  5C4X J;  3V7S A;  1SAN A;  4L5J A;  1I6H J;  1ERD A;  2ZXW H;  3KX2 A;  1MDM A;  3WTU C;  2L4M A;  2Y2Z A;  3OYA A;  3GZ6 A;  1APL C;  2WA0 A;  1K4S A;  1NHA A;  2DLL A;  2B9S A;  3LNQ A;  4IEJ A;  2R92 J;  3KLO A;  3LQQ A;  2BHY A;  2LKS A;  3H3U A;  5E1W A;  5BMZ A;  2QCO A;  2GXB A;  1YOV B;  2HS5 A;  4PJM A;  3J7Z I;  1UST A;  3CC4 I;  1FYL A;  3OYD A;  1YIT I;  2K9M A;  5D5U B;  3DTE A;  2DK5 A;  3HPH A;  5EEH A;  4QWQ A;  1KQ9 A;  4RB1 A;  1E3H A;  4IRH A;  1SD7 A;  5CVV A;  2VOP A;  2XPU A;  2QBY B;  1YW7 A;  2ICW G;  4BQQ A;  3ABU A;  5HOD A;  1VQ5 I;  1RET A;  3JSO A;  4RS8 A;  3EYI A;  4XMY A;  3GTQ J;  2JVH A;  3SZT A;  2NRA C;  1Q1V A;  2PMZ N;  3LFK A;  5DV5 A;  2DFE A;  3HG9 A;  3DEU A;  4HQM A;  4KIC A;  3HIF A;  1BOA A;  3K9T A;  1KU3 A;  1E2X A;  3GF2 A;  4BJT A;  3R6S A;  3WHB A;  4ZJZ A;  3OYN A;  1WJF A;  2DTZ A;  4A3D J;  3IWZ A;  4CCM A;  4UUS A;  2HXI A;  4IX7 A;  5DD8 A;  2FU4 A;  2MH9 A;  3K70 C;  2GIV A;  2XDV A;  4L18 B;  2K9S A;  4M3D A;  3GCM A;  1LUJ B;  2QLZ A;  2EZH A;  1UCR A;  1R49 A;  5LHI A;  2EZI A;  2MLG A;  3A03 A;  3OMY A;  2RDP A;  4BBS J;  4UVB A;  4QSH A;  1MKM A;  2FD5 A;  1MJA A;  4A5N A;  3P5J A;  2HI3 A;  4EEF G;  3V42 A;  2N8G A;  2PI0 A;  2Y9Y A;  4YIF A;  5CQG A;  3BG5 A;  1O7L A;  3L2R A;  2W85 A;  1J9I A;  3L2C A;  1O3Q A;  2DFH A;  2FOW A;  3SQN A;  4DZP A;  1TTY A;  2W48 A;  4KUM A;  2JVG A;  1K6Y A;  1FTZ A;  5DYM A;  2X6W A;  3QWL A;  1V3F A;  1AHD P;  2KIS A;  1FTT A;  2DMQ A;  3FM3 A;  3HPG A;  2BHZ A;  4HLX A;  2CU7 A;  3CCU I;  1R4N B;  4M6X A;  3F0C A;  1B59 A;  2BY2 A;  2R5Y B;  5F0F A;  2R7Z J;  1XS9 A;  4KYW A;  2IXS A;  1TW2 A;  4HDU A;  3JRF A;  5TRD A;  3HSF A;  1JHF A;  1MBK A;  1MDM B;  3VYU B;  1JUM A;  2FOK A;  5JLW A;  3PQJ A;  3C2B A;  1TZL A;  4Q47 A;  1ZR4 A;  2EA2 A;  1RIO H;  5GAG J;  3U2R A;  2ISY A;  4QPO A;  2R7S A;  5FRN A;  4P9F A;  2FXA A;  2PEX A;  4I7H A;  3J80 K;  3F3X A;  3FK6 A;  4UXN A;  1O57 A;  5E1Z B;  2ZSI B;  1P4W A;  2EIM H;  3MN2 A;  5EF6 A;  3R60 A;  4ZYD A;  5K5Q A;  2YSR A;  3BZ6 A;  4HV6 A;  1LQ1 A;  2EFW A;  4BE1 A;  3OS2 A;  1ZRD A;  2ZXI A;  1UHM A;  2OBP A;  3T1B A;  2CW8 A;  4CUG A;  1W5T A;  2W4S A;  3ZMT A;  2A6T A;  4BYY A;  5E8I A;  3DPU A;  3KP3 A;  1RKT A;  1R1V A;  3I0T A;  3OYB A;  1GT0 C;  4WXD A;  3I4M J;  3J7Y J;  2L2O A;  4EM2 A;  4XLH A;  4DQ2 A;  4G7H F;  2DXI A;  1FBS A;  2XF7 A;  4LG3 A;  3M7G A;  1EH6 A;  5E3L A;  4UUS B;  3IHU A;  2RC4 A;  2EFO A;  3ZPL A;  3OOU A;  2L3D A;  3QPS A;  4PGG A;  5FGM A;  5TJJ A;  3RZO J;  2VBY A;  3VDX A;  4P5O A;  1ZKG A;  1ZLK A;  4ETS A;  3ZQF A;  4CCN A;  3HTS B;  3F8B A;  4BU2 A;  2M4G A;  2KIU A;  2F5V A;  4AYB A;  1ZEL A;  1FMV A;  1OCC H;  1Z91 A;  2XAG A;  3A4C A;  1N75 A;  2HOE A;  4HNT A;  2XGC A;  4J00 A;  4BHC A;  3FK7 A;  3H9G A;  2R0Q C;  2GZW A;  5LRS A;  2EV5 A;  4GYG A;  5JHF A;  3I55 I;  5FD6 A;  4NQW A;  2JN6 A;  4PSW A;  2CO5 A;  1YG2 A;  2Q0O A;  3W6K B;  4RLF A;  4HNV A;  2WV1 A;  3KEY A;  2PMH A;  3GFM A;  1D3Y A;  2EIN H;  3N97 A;  1TC3 C;  4AC0 A;  1IG7 A;  1GVJ A;  2JA5 J;  2M5W A;  1ON1 A;  4A3J J;  4KFC A;  6PAX A;  2FRH A;  3FHN A;  2QEX I;  2P5L C;  2FNA A;  2X1D A;  4DGW B;  4MHG A;  2ZFU A;  2VE8 A;  4LK0 F;  2VPL A;  2FE3 A;  2X6X A;  4KNY A;  3DP7 A;  2EK5 A;  1WI3 A;  3HUG A;  1QO0 D;  4A3E J;  1YJN I;  3H36 A;  4C3H J;  2NVQ J;  3H9J A;  2HVQ A;  4DNC A;  2JJ7 A;  2LNB A;  2HNH A;  2DFI A;  1I39 A;  2JUC A;  2KLO A;  4CGZ A;  3ZQI A;  5KCM A;  5KHD A;  1P7J A;  4PCQ A;  5D5W B;  4IHT A;  3ELK A;  1RPW A;  2E5N A;  5EJC A;  4HST A;  3ROU A;  3IAS 2;  4M6V A;  1DP3 A;  3UNG C;  3PUB A;  2R7Q A;  1LVA A;  5FFX A;  4XKC A;  3H5R A;  2A61 A;  5IPA A;  3ECH A;  3I71 A;  3LST A;  5ILU A;  3I4N J;  1HKS A;  3FXQ A;  4U7B A;  3CME I;  4NNJ A;  5HS8 A;  3PNV A;  3S3M A;  4CA0 A;  5J47 A;  5TIS C;  2QYO A;  2DOA A;  4MLO A;  3R61 A;  2IS4 A;  2ELK A;  3F6V A;  2EIL H;  3GTP J;  3IUO A;  5GTH C;  1RES A;  1X4O A;  2H1L A;  3M07 A;  2V1U A;  2Y0S A;  1MSE C;  1BM9 A;  2HYG D;  3FBN B;  4E7L A;  4IQ4 A;  1I27 A;  3K4J A;  3OSG A;  2VQG A;  3JCU C;  4OIQ F;  1HKT A;  1IGN A;  4LLL A;  1PVE A;  5ILV A;  2LVS A;  3FXL A;  3RKX A;  3RYR A;  2VOO A;  3K10 A;  4ESJ A;  4XLP F;  1T0F A;  1UHW A;  3ERE D;  4A3K J;  1S72 I;  1OR7 C;  1YIJ I;  3SEQ A;  3RQI A;  1P6R A;  1TNS A;  3H0G J;  4FQG A;  4MQ9 F;  4HRI A;  3E97 A;  2O3F A;  5J8C A;  1RNL A;  1JHH A;  3ZQG A;  2LD5 A;  2M7A A;  4DJA A;  2PJR A;  1E3P A;  2KL4 A;  2VKH A;  1I50 J;  3IRR A;  1EH8 A;  2OZ6 A;  4NQW B;  3Q5F A;  4XRM A;  3GTO J;  4IHS A;  5B66 C;  2W84 A;  1VQN I;  2HPM A;  4FAS D;  4Y7N J;  4HAM A;  2CQX A;  1W36 D;  3FMR A;  3EUH A;  4BUP A;  4LLN A;  4JX4 A;  3KPH A;  5HS7 A;  5EDN A;  1JT6 A;  4G94 A;  1WFX A;  5GAE J;  5IP7 J;  5CQE A;  1KYW A;  4A12 A;  1QU3 A;  1E17 A;  2P4W A;  3MWM A;  3HGG A;  1W1W E;  4UB8 C;  3WGH A;  2VN2 A;  1IRG A;  3OR1 C;  3I64 A;  3HUG B;  3RQ4 A;  3ABK H;  3OL3 A;  4NC8 A;  3L2U A;  2OTJ I;  2R7W A;  1XMA A;  5M5W J;  1DQU A;  4QLC U;  1DPR A;  2STW A;  3B02 A;  2R5Z A;  1TQM A;  2DDA A;  2OAZ A;  4AIJ A;  4OOI A;  3K69 A;  2VC1 A;  4NC7 A;  1K7A A;  3AG3 H;  1VQ9 I;  1ETY A;  1MH3 A;  2O8X A;  1MMD A;  3FIS A;  1FSE A;  1OCP A;  3E6M A;  3GFL A;  2HTS A;  2R7U A;  2OF7 A;  2E7W A;  3AG2 H;  3B6C A;  1RI7 A;  1MJB A;  3LAP A;  2PN6 A;  5FB2 A;  1MNM C;  3K1M A;  4HQE A;  3M9A A;  2W1O A;  2XB0 X;  4XRF A;  3CDL A;  1POG A;  1LNW A;  1HW5 A;  2XIG A;  2HPI A;  3SEZ A;  2K3F A;  1H9G A;  3PNT A;  1YJW I;  5IYB J;  2COM A;  2D1H A;  3BZC A;  5FJ8 J;  1SFO J;  5BS6 A;  2X48 A;  3KIO A;  4U87 A;  3LQR A;  3C7J A;  1KYZ A;  3DF8 A;  2NNN A;  4JQF A;  4PUS A;  4P1W A;  1AU7 A;  2HEO A;  3WTY C;  4X6A J;  5E18 F;  3P9K A;  5D8L B;  3O2P E;  4F91 B;  2R7V A;  3MFK A;  1VQP I;  3ZP5 A;  3I54 A;  2WY7 Q;  3ZMZ A;  1A36 A;  4C30 A;  3H1C A;  4FE4 A;  3WTS C;  2XC7 A;  1RR8 C;  2B0L A;  1Z9C A;  2KRF A;  4AVZ A;  3CMM A;  3O8H A;  3E5U A;  4O5V A;  3HRM A;  1MMS A;  3CUQ A;  4N9H A;  1JJ6 C;  3MAJ A;  3L1P A;  1BA5 A;  1I5Z A;  2DYS H;  4YII A;  1SFU A;  1GXQ A;  3HTU A;  2PJR B;  5CJ9 A;  1TWC J;  5E20 A;  2K7L A;  3GEZ A;  4BBR J;  2A5Y B;  3EUA A;  1D1C A;  4ENJ A;  1HOM A;  1IN6 A;  1GV2 A;  2RNJ A;  4B47 A;  1UFM A;  2E7X A;  1LFP A;  2F4M B;  3WU2 C;  2CUF A;  1G3T A;  4NB5 A;  4M3G A;  2XGD A;  3HL2 A;  5E17 F;  3KCC A;  1SFE A;  1ZHF A;  2ESH A;  4M9S A;  5D5V B;  3QOD A;  2HVR A;  1XCV A;  1STZ A;  2R7X A;  4ANJ A;  2STT A;  4IHW A;  1A5J A;  1XG1 A;  3FDY A;  3OY9 A;  1U8R A;  2XV4 S;  2VBW A;  3FHZ A;  4PSX A;  3CMA I;  1H88 C;  1OYI A;  1DDN A;  2CV0 A;  2BY1 A;  4WCG A;  2RNG A;  1R71 A;  1ZYR F;  4WXC A;  1E3O C;  2K4B A;  3KP5 A;  3CLQ A;  1HCR A;  3HOZ J;  3DBH B;  3E5X A;  4CO8 A;  4FET A;  5J1U A;  4KMF A;  2R5Z B;  4KT5 C;  2HWV A;  2OV7 A;  1Y0U A;  2OCE A;  2CFX A;  3M8F A;  3KP6 A;  3CCL I;  2R3S A;  3TO6 A;  2BY3 A;  1IF1 A;  4B43 A;  1I1G A;  2V1X A;  3I4P A;  2R93 J;  3PJR A;  1EA3 A;  5GPC A;  3MZH A;  1D0Z A;  1T6S A;  3HHH A;  3F22 A;  3K4K A;  3WTT C;  3PM1 A;  3HOW J;  2H6B A;  4H4K C;  4JYK A;  3PL8 A;  2WB1 A;  3DEE A;  2GA1 A;  4D9J A;  1HC8 A;  1QVT A;  4XN3 A;  4P9U A;  1OLT A;  3M1E A;  3BG3 A;  3U1K A;  1FY7 A;  3KFW X;  1VFC A;  1T98 A;  2YUS A;  4RDU A;  5GTI C;  2VB6 A;  1S7A A;  1B1B A;  2YX4 A;  3KYL A;  3G73 A;  1OPC A;  4BXU A;  1NK2 P;  5M3F J;  2QUF A;  3K4B A;  4RM2 A;  3A0H C;  1BI3 A;  5A2Q Z;  2DMP A;  4S05 A;  4OIN F;  2UZK A;  1J75 A;  1T08 B;  2EFN A;  3CUQ B;  5FKK A;  4I98 B;  3X2Q H;  1T2K A;  4HLY A;  3LSK A;  2OD5 A;  1WJA A;  3DKY A;  1PYV A;  4DIQ A;  5DUK A;  1PUF A;  2P0W A;  2HOS A;  1DGW Y;  3M8E A;  4NHJ A;  2NVT J;  3CO6 C;  1B6A A;  3REO A;  3H3Z A;  4JBA A;  4A0Y A;  1X58 A;  5CPR B;  2W25 A;  4YFX F;  4UY8 I;  1F9N A;  1G59 A;  4I99 C;  1X1A A;  3HRS A;  1Z3Y A;  1YX5 A;  2P7V B;  2NOG A;  2DOF A;  2QSF X;  1V5G A;  3ABM H;  2KJB A;  4DYQ A;  4LIT A;  2AO9 A;  4IRI A;  1DGR M;  3TMO A;  5JR3 A;  3HC7 A;  4XLN F;  1VQK I;  1FYM A;  4BNC A;  2HOT A;  1F1Z A;  1SVL A;  4HX8 A;  3VSK A;  5JI6 A;  1G3Y A;  4QPQ A;  3J80 Z;  4PDK A;  2VAS A;  1Z6T A;  2EFP A;  3GWZ A;  1NTC A;  2XF6 A;  3G2B A;  3VOD A;  2WAQ A;  3W3C A;  2ZCW A;  3KP7 A;  2L4A A;  3CJQ B;  5LLQ A;  2YU9 J;  4XLC A;  5CYV A;  3ZQL A;  4JK1 X;  3BTI A;  3M1C A;  5IOZ A;  3BWG A;  3C1D A;  3HB9 A;  1R23 A;  5DCF A;  3L00 A;  2Z3Y A;  3SZG A;  2A6E F;  4BH9 A;  5HVQ C;  1EJ9 A;  2JSP A;  3V8L A;  2HYF A;  2D2W A;  3U9G A;  2MSY A;  3GZN B;  1LPQ A;  2VON A;  3RPU A;  2JRT A;  4EQQ A;  5K7F A;  1U3E M;  3JRA A;  2Y48 A;  1Z21 A;  1YIO A;  3GLL A;  3ASN H;  5E8G A;  2EZK A;  1U5T A;  2H27 A;  3OV8 A;  4PFO A;  5F1R A;  1KA8 A;  4DYC A;  5DM6 F;  3S2H J;  2IEK A;  2JUG A;  1QRY A;  5ILS A;  1IRX A;  1W0U A;  1FOX A;  3DBL B;  3GVA A;  3VSL A;  4LB6 B;  4KIT B;  2YS9 A;  3ONQ A;  2GIZ A;  1LVK A;  5BOX A;  1HW2 A;  3BPX A;  4RAY A;  1QVU A;  2QGU A;  5HOO A;  5LEJ A;  2V6E A;  1WQ2 A;  2F4O B;  1UMQ A;  2XKO A;  1YLF A;  4XN0 A;  4ZYE A;  4FTH A;  1KU9 A;  4BE0 A;  2EB7 A;  1VQM I;  3KZI C;  1ETO A;  2Y75 A;  4I02 A;  4GFB A;  3JRD A;  2L54 A;  4ZTJ A;  3RKQ A;  2M87 A;  3W2W A;  1ZAR A;  2COB A;  2QSH X;  3F8C A;  1PUF B;  2DA4 A;  3Q0V A;  1SC7 A;  1YQA A;  2HXO A;  2K02 A;  1XB4 A;  1A35 A;  2ISZ A;  3S17 J;  4OAZ A;  2LY1 A;  4M3E A;  2GAU A;  3P9I A;  1ONV A;  4ITV A;  2O9L A;  2BV6 A;  4AVP A;  2RGV A;  1MMN A;  4Z6Y A;  3LSI A;  3WE2 A;  4C3J J;  2ZXH A;  2L7K A;  3K4L A;  1U78 A;  2DJN A;  4RLQ A;  4NBQ A;  3QQA A;  2L7M P;  2L7F P;  2EIK H;  5HLT A;  2E1O A;  3O8G A;  1NK3 P;  4KT6 A;  1W4M A;  3QYF A;  5K7H A;  4YFN F;  3PO2 J;  5H20 A;  1TT0 A;  5JVG F;  3LAJ A;  3Q3S A;  2HU9 A;  2A05 A;  2ZNY A;  3C2H A;  2GOX B;  1D0Y A;  2HFH A;  4M6Y A;  1FPQ A;  2LRE A;  2CWE A;  4JX6 A;  3ZQC A;  2CFO A;  5J6X A;  3FM5 A;  2XGE A;  1FOW A;  1YYV A;  1MND A;  2GXA A;  2HZT A;  5LHH A;  2QQ8 A;  1EKE A;  5J8F A;  1HST A;  3LMM A;  3S1R J;  4CCO A;  2ELJ A;  4MTE A;  1GHC A;  4XLA A;  4LFU A;  2L9V A;  4ENN A;  2WV0 A;  4MEY F;  2E2H J;  3MKZ A;  4RMN A;  5BQT A;  4YRV A;  2CRG A;  1O3S A;  2R7O A;  3SFI A;  4WK8 F;  3BR0 A;  4S0H B;  1U5T B;  2LH9 A;  2LF8 A;  1K83 J;  1W5S A;  3ERM A;  3FF5 A;  2IS1 A;  2KJC A;  1D1B A;  5D8K B;  4S04 A;  2YX7 A;  4NUB A;  3F21 A;  1LFU P;  1ETW A;  1YO5 C;  2LBF A;  2LMD A;  2IJL A;  4HF0 A;  3NQO A;  3ZMU A;  4C9Y A;  4CH7 A;  1LDJ A;  2VE9 A;  3GTG J;  1KZH A;  1FZP B;  5DCM A;  1K4T A;  3KYC B;  1SAU A;  2K5C A;  2X0L A;  2K85 A;  4FX4 A;  2VXD A;  3BJA A;  3I3L A;  3L2W A;  1R7J A;  2V79 A;  4F93 B;  4HNU A;  4HOB A;  2XF5 A;  3IAM 2;  1QHG A;  2HQ5 A;  1YS6 A;  5LFA A;  4L5I A;  3S1Q J;  4OMZ A;  2E1M C;  4HSR A;  2M1B A;  3FXM A;  3IH4 A;  4AIH A;  4CCL A;  5A2Q K;  1ZG3 A;  1R5H A;  3NAU A;  3LA3 A;  1OR7 A;  4OIR F;  3WE3 A;  5DS9 A;  2AQF A;  3S14 J;  3JW4 A;  4G12 A;  3F8N A;  3KLN A;  2A6H F;  1BJA A;  4FIS A;  4ZDL A;  2NS8 A;  3H5N A;  1X2N A;  1OYY A;  3VFZ A;  3S3N A;  2LTP A;  2Z5U A;  5KAI C;  1UZC A;  4IKF A;  3V8J A;  1TBX A;  1D1A A;  1A04 A;  5D4R A;  3BY6 A;  3SDB A;  5HDN A;  2ZKZ A;  3KP2 A;  1Z7U A;  1YW8 A;  3LSG A;  4CXF A;  4PK4 A;  1PDN C;  1KON A;  3HHG A;  3SHF A;  3CJT B;  1U9O A;  2K4J A;  1N78 A;  1M1E B;  1IXS B;  2BYV E;  2F48 A;  5CVI A;  2TRT A;  4RBO A;  5FLV A;  1FIP A;  1IN5 A;  1QHH D;  1Z7L A;  2LY9 A;  4D5C A;  2M3A A;  3W2V A;  1EF4 A;  2VQL A;  3EYY A;  4OIP F;  5HNH A;  3HOY J;  2F6C A;  4GRI A;  3S3O A;  2XB5 A;  1KQ0 A;  3K4M A;  4OIO F;  2VOD A;  2JZY A;  1OQY A;  2D1V A;  2XPV A;  4V2F A;  5IYD J;  2CJJ A;  3BT9 A;  2R4G A;  2LBF B;  2RQP A;  4II3 A;  3VYT B;  2KDO A;  2LRD A;  1HXD A;  2JA2 A;  1HQC A;  4B09 A;  2K27 A;  3CD6 I;  5DCM B;  3GFJ A;  2E2I J;  3Q9S A;  1MW7 A;  1R9T J;  2OA4 A;  2DK8 A;  1Z1D A;  4A3G J;  4BEH A;  2IS2 A;  5EZG A;  4R1H A;  3W2A A;  2QKM B;  5L3C A;  4D7N A;  1OCR H;  1XGM A;  3BC8 A;  2KP6 A;  5F64 A;  1T56 A;  4GO1 A;  4UV8 A;  1CGP A;  2R7T A;  1BR2 A;  2GM4 A;  3IP4 B;  1ZTR A;  3SYT A;  4B48 A;  1KGS A;  5J4V A;  1QQI A;  4G6D A;  3ZQH A;  2P7C B;  4EM1 A;  2YR2 A;  3G1L A;  1D8J A;  1YTY A;  2XRO A;  1WI9 A;  2ZJR F;  1ACI A;  3WHC A;  2Z2S B;  1P4A A;  1O7F A; 
#chains in the Genus database with same CATH homology
 1YJN I;  1HC8 A;  1VQ8 I;  5DM7 F;  5GAG J;  3I56 I;  2E34 A;  1VQM I;  1VQ7 I;  2JQ7 A;  1YJW I;  2K3F A;  4V19 K;  3CCR I;  2NXN B;  2QA4 I;  1VQP I;  3CME I;  1FOY A;  3J7Z I;  3CC4 I;  1YIT I;  1VQO I;  3DLL F;  3CCJ I;  3G4S I;  4IOC F;  3J7Y J;  1VQ5 I;  3CJT B;  1MMS A;  4UY8 I;  5GAH J;  3PIO F;  2H8W A;  3CC2 I;  5JVG F;  2OTL I;  3G71 I;  3CCE I;  1S72 I;  1VQK I;  3PIP F;  1YIJ I;  1VQ4 I;  4IOA F;  1FOW A;  1YJ9 I;  3CF5 F;  1Y39 A;  1QA6 A;  2ZJQ F;  2E35 A;  2ZJP F;  1VQN I;  2E36 A;  3CCQ I;  3CMA I;  3I55 I;  3CD6 I;  5GAE J;  1YI2 I;  3G6E I;  3CCM I;  2FOW A;  1VQL I;  3CC7 I;  3CCL I;  3CCS I;  4IO9 F;  1YHQ I;  5GAD J;  2OTJ I;  2QEX I;  5DM6 F;  1VQ6 I;  3CCU I;  1FOX A;  2ZJR F;  1ACI A;  1VQ9 I;  3CCV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...