3CCVI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccvI00
1YJWI 2E34A 3G4SI 1VQMI 1YI2I 1VQNI 2NXNB 2OTJI 1VQ9I 2JQ7A 5DM7F 3CMAI 1VQ4I 1FOWA 3CJTB 2K3FA 2ZJQF 1HC8A 1S72I 1FOYA 2H8WA 3CC4I 4IOCF 5GAHJ 2ZJPF 3CCLI 3J7YJ 3CCRI 1Y39A 3PIOF 1VQ7I 3CC2I 1YITI 1VQ5I 3CCQI 1YHQI 4V19K 3PIPF 2FOWA 3CD6I 5GADJ 3CCVI 2E35A 5GAEJ 3I56I 3DLLF 3G71I 3CCJI 1VQOI 3CCEI 1QA6A 5DM6F 4IO9F 1MMSA 1YIJI 3CCUI 5GAGJ 3CMEI 3CCSI 2E36A 3CF5F 1YJ9I 1VQLI 4UY8I 1ACIA 1FOXA 1VQKI 3I55I 4IOAF 2QA4I 1YJNI 3J7ZI 5JVGF 1VQ8I 3CC7I 2OTLI 3G6EI 1VQ6I 3CCMI 1VQPI 2ZJRF 2QEXI
chains in the Genus database with same CATH superfamily
2KZVA 1HKSA 2JN6A 3KP7A 3A2KA 5EEGA 3BLYA 2DA2A 3H3ZA 1JGGA 2TCTA 3BG7A 2F5FA 1H9TA 2DOAA 4ZYAA 2GOMA 2FOWA 4BHBA 2HI3A 2DDAA 3LQRA 3BR2A 4BEHB 1BIAA 2P81A 3KZIC 3ZMSA 4RB3C 4ENMA 5DV5A 1SVMA 3H9JA 4RGXA 4LB5A 5AONA 3HKZN 2M4KA 5HLHA 1K78A 3ZMTA 1Z7UA 3RCOA 4PFPA 3HOTA 3Q0WA 1LUJB 4KNYA 2VE9A 4ASNA 4R79A 2BYVE 4HX7A 4S05A 3CCRI 1FIPA 3QOEA 3GTGJ 2W57A 2R7OA 1GXQA 2LP0A 2PG4A 3K4CA 1P9QC 4ZTFA 5IY5H 3IC7A 3MZHA 4C2UA 2M8GX 4B4CA 3C2GA 2IS4A 1ZK8A 2LBFB 3V7CA 4A3BJ 2VOPA 4OIRF 3FISA 5LFAA 4CCLA 2YS9A 4DQ2A 4CH7A 3EQLF 2CH0A 3K4KA 3ELKA 2GBYA 3NWSA 1PUEE 2JPCA 1AOYA 3H35A 2EBIA 4ON0A 2E34A 3HOZJ 3QP6A 3U1DA 1VFCA 3HGGA 3J7AY 1PP8F 1JE8A 1ETWA 1BBYA 3IAM2 4HPQA 2XVCA 2GXAA 4BY7J 1XSDA 4EGZA 4UV8A 4KMFA 4RAFA 1XB4A 3JTGA 3BY6A 2VJJA 2XF7A 1TWAJ 5DD4A 4EJUA 3IH4A 4UUTA 1PUFB 2BE5F 3O8GA 2F2EA 2XAQA 5L3DA 3VSLA 5IYCJ 2AXTC 5FKKA 2JJ7A 4M71A 4NQWA 3CZ6A 2MYSA 1P4XA 4HA8A 3TW6A 4EM2A 4HX8A 2DA5A 1LB2A 5LRRA 1CF7A 1C0WA 3VEPA 2IA0A 4JQFA 1ZYRF 5F0FA 2EH3A 1G6NA 2IGOA 3F8FA 1YS6A 3QWLA 1IN4A 1MIJA 2DO7A 2DFIA 2O9LA 1DPUA 4UVBA 3KCCA 5D5UB 2E7WA 2P6TA 1XMXA 4OAZA 2ZXIA 3H36A 1DP7P 2V7FA 1EKEA 4EM0B 1WPKA 2HR3A 4BQNA 2XDVA 2OU2A 1PJRA 3EDPA 4JBAA 1BI3A 4WWCA 3I58A 3CF5F 3JAMZ 4IL6C 1O4XA 2FNPA 2FNAA 4PZJA 3L2VA 5HS7A 1D8JA 4JX5A 3OIQA 3FF5A 1YRNA 2DK5A 1F5TA 2QQAA 1IUFA 4Y7NJ 2JPBA 1VQ4I 1A6QA 1A6IA 5LEJA 4D5FA 3ECHA 4HNUA 5GAHJ 3IKVA 1FEXA 2LSOA 3E5UA 4M3FA 4QLCU 2JVHA 5E8GA 3WU2C 1FIAA 3CP2A 1T8IA 1U9NA 1SD7A 4NC6A 5EZHA 1JT6A 2QQBA 4WK8F 3FXLA 2QSFX 2H6BA 4DBRA 3FXRA 2L4MA 4PJMA 3OOUA 2R7TA 4CSWA 1RKTA 1P2FA 1YYVA 4IQ4A 3OYJA 2QQ9A 3F6OA 3WTZA 1K6OA 2LBFA 2LH9A 3P9IA 1ZELA 3FMSA 4HV6A 3EUKL 4WCGA 2DJNA 5A2QZ 2QENA 1XGSA 2RGVA 3BTIA 4G94A 1YW7A 2NVXJ 3MZ8A 4M6VA 2VQCA 5DS9A 3K9TA 3IHUA 1ETQA 1IXRC 3AL0B 2ESHA 3HKZA 2M8EA 2VN2A 4L0YB 3JRCA 1EA3A 4FX0A 3EYYA 4LG3A 4XIDA 3CJTB 3K6GA 2JA2A 4LITA 1QHHD 2H09A 3PSFA 4RGSA 1S8NA 2WAEA 3B02A 3CLOA 1VTNC 5FFZA 2OCEA 1MD0A 4C3HJ 3ZXSA 2QBYB 2ZNYA 2BY0A 2K9LA 1MH4A 2DA4A 1D8KA 2FEZA 3U21A 3QU6A 3D0SA 2O3FA 1HBXG 1W0TA 1ULYA 4MO7A 3RPUD 1Y56A 4ENNA 1FP2A 4XN3A 2CJJA 4XLNF 4I0AA 3H0GJ 4U0WA 3IWZA 5CVUA 5JFRA 4NC8A 5D4RA 4XKCA 3CC2I 2NS8A 1J75A 2Q2EB 4YFNF 4GRIA 3TDZC 2ZNZA 4V19K 1U9OA 3OIPA 4HG2A 2PN6A 2KISA 1FBUA 2JT1A 1SAXA 2KZGA 3ABTA 3H5NA 1Y1WJ 4PUSA 2ESNA 1WRJA 3HB9A 3G1LA 1SFXA 3KZYA 4UHTA 2K85A 1MJ9A 2NS7A 2LG4A 3M1EA 1R5ID 1VQMI 2NXNB 4LFUA 2AQEA 2PX9A 2K02A 3MWMA 3LWFA 4OINF 2HFHA 3LSHA 4IF4A 1DGRM 2BY3A 2FX0A 2P5VA 3GBGA 3ZOBA 4B3AA 3KYDB 2FU4A 1BR4A 5DEQA 3KETA 3GMEA 4XRFA 1Q1HA 1RPWA 1ETVA 3DBRB 4H4KC 4A0XA 3ZN0A 2VONA 1QVUA 3ZPLA 2L9SA 3QP5A 4RAZA 2HWVA 2CUEA 1NG7A 4XKWA 2OF7A 2KP6A 4I01A 2R3SA 4N4OB 4AVPA 3S2HJ 2EB7A 2EV0A 5JVTA 2YUSA 1OFCX 3AL0C 4ENJA 1ZR4A 2W84A 5FD6A 5DUKA 5C4JJ 4IOCF 1IN5A 3ZQFA 4KMUX 2IA1A 4KFCA 2VQGA 2ZKZA 2KIMA 1WCMJ 1XGMA 2DTRA 3M7GA 4EGYA 2RDPA 5F64A 1BI2A 1SANA 2EV6A 2TRTA 2BY2A 4BDYA 1VQLI 3UNGC 3CO6C 1U8RA 2GA1A 4Y52J 1JI8A 3HUGA 2VC1A 3RIRA 2JZYA 1KYZA 2L9NA 1W7PA 5C4XJ 3ECOA 3KFWX 1UB9A 3DXJF 2WC2A 2IGKA 2VASA 2XKOA 3O6BB 2OC6A 5CKTA 1I5ZA 3OYLA 5J1UA 3L2QA 4BQAA 2F4MB 3I71A 4S0HB 3S1MJ 1QGPA 5LD2C 3X2QH 1XDUA 4ZDOA 5BPDA 4OOIA 4XR6A 1GV2A 3DEWA 4CHUA 4ESJA 4OIPF 3OYKA 3TGNA 3DKXA 1FBSA 1RESA 4Y15A 3WE3A 4ZYHA 2CO5A 1F43A 1OYYA 4NBQA 2W4SA 3KIOA 3IH3A 3G3ZA 2ZMEA 1IRFA 5HDGA 2KPMA 4BY1J 2VBYA 3LA2A 5K5OA 3PIOF 1ZG5A 4XLEA 1SC7A 1ZRCA 2VBZA 1O7FA 1X2MA 2E7XA 4KN4X 1YOVB 4ETSA 4RAYA 3QPHA 3AKZA 3LSKA 2O0YA 4UUVA 4UY8I 1R1VA 4AYBN 3DCFA 3OYIA 4C2TA 1UJ8A 3IRQA 1VQ6I 2R7DA 1TWGJ 4BHPA 3BJ6A 2HGCA 1D1AA 1XC5A 2EINH 3HBLA 2IPQX 3KLNA 1IV8A 1RRJA 1USTA 1SEUA 3MZYA 3KP5A 4GGGA 4L5JA 2BEOA 3MEXA 5J1YA 4PSXA 1QQIA 4WXDA 4A3GJ 1ETKA 2K27A 1LE8A 3R4KA 4XSXF 1P7IA 3M3YJ 1FOXA 1B9MA 2O8XA 1GUUA 3GEZA 3VWBA 1X4PA 1KGSA 2MC4A 1NTCA 1O3RA 1REPC 5FLXZ 3CDIA 4LLNA 5ICEA 1LFPA 1RUOA 1TW3A 3DU5A 1V4RA 2K40A 1T0FA 3W2WA 1VQ7I 5EGOA 3BROA 1QZZA 3OS2A 3BG9A 4B44A 3F0CA 1T98A 3PIPF 3WODF 4MFDA 2GAUA 1JKOC 3RJPA 2DMTA 4AIHA 3HPGA 1KYWA 5HLGA 2IP2A 2WV1A 4DYCA 3S3MA 2IW5A 3DPLC 4BE1A 2CGPA 4LK1F 2QWWA 2CQQA 4E6KG 2W48A 1MMGA 1WH5A 3WGHA 2HQRA 4BE2A 1ENHA 1X4OA 1BJZA 2H27A 1E3OC 2KQRA 1OPCA 1J0RA 2V1UA 4BBRJ 3W2AA 1MJAA 3FM5A 1HLVA 4YIFA 1TQIA 2G9WA 1E17A 2L4AA 3I54A 3M8JA 4C3JJ 2JMWA 3EYIA 2KLOA 3CCEI 3BOQA 2R7UA 3GF2A 2XASA 3RKQA 1B9NA 2HU9A 3Q0UA 4PGGA 2OQRA 3M9AA 1K6YA 1WJEA 2DT5A 4QWQA 2F4OB 3FMQA 2UV1A 3OR1C 1FC3A 3V8KA 3OR2C 4L0ZB 2COBA 3H5AA 5E18F 2Z16A 3ASNH 2K9NA 3F8CA 3TO7A 3W6JB 3F8MA 5D5XB 4A3CJ 2DFFA 2QVOA 4BU2A 1FLIA 3JRAA 1JJ8C 2IS1A 3LSIA 1YITI 3CESA 3FXKA 2XGCA 1HKTA 3T8TA 2MD5A 3M8FA 3V8LA 1OLTA 2DA1A 3ESWB 4LG0A 3PFIA 1WJBA 1UCRA 3FXQA 4QTRA 3CMEI 3BCAA 2MH2A 1FMWA 1HSJA 2EA4A 2KIUA 3DEEA 3KPHA 3M07A 4K2EA 2L5QA 3JR9A 1APLC 2LKXA 3ZP5A 2R4GA 1HCRA 3Q0VA 1SVOA 5EJCA 3MCZA 4F92B 5LGUA 1AU7A 2X6OA 4MEYF 2ETHA 2RKHA 2EZKA 2A6HF 2HKXA 2FMLA 2E71A 3FBNB 5LRSA 2NVTJ 3RZDJ 1EH8A 4YG2F 5BPIA 4D9JA 4A12A 3ZQHA 1FZPB 3I53A 3MQ0A 3QRFF 3S1QJ 3S93A 2ELKA 3DTEA 3S15J 2PFBA 2VL8A 2Y48A 3E5QA 3HM5A 1MBHA 3K2ZA 1W5SA 5BNGA 3CCMI 4I76A 1JXSA 2O6GE 2QEXI 1HA8A 2R7XA 4G7HF 1VQ9I 4BUPA 2IEKA 2Z99A 5IT3A 4WX9A 4BKXA 5F08A 1HW1A 1K78B 5EF6A 4LLGF 1R1TA 4UUSA 5DCFA 5DD8A 1XPXA 4HSRA 1TWCJ 3A4CA 3ABUA 2BXYA 3I5UA 2FBIA 3VYTB 5F6FA 1KA8A 5CVJA 2K4BA 4OIQF 2W7NA 1WKMA 2CWEA 3GXOA 2R7QA 3CDHA 5DM7F 2QSGX 3BDDA 3L1PA 4IHXA 2BBYA 1XMKA 4HBLA 1VF9A 3JREA 3WTTC 2GOXB 4EJTA 5CQGA 5GADJ 2K9QA 1ZREA 2ISZA 1S7OA 4XNFA 4IO9F 2YU9J 1YJ9I 5DYMA 4PSWA 3O2PE 4KT5C 4XLHA 4BGDA 2E2IJ 2VI6A 3RSNA 5LBQA 3B73A 4B43A 3J81Z 2RQPA 1LDJA 2LMDA 3BT9A 1PYVA 2LR8A 2GXGA 1TWHJ 2DOFA 1E0EA 3ERED 3K2AA 1Z77A 4NQWB 2MW8A 4BE0A 1T39A 4KIGA 3J7YJ 2QYOA 5IYBJ 5D5WB 2FD5A 5J8CA 2EK5A 3S16J 3WU1B 1QPIA 4U88A 1ON1A 2VBWA 3QYEA 1KQ8A 5IYDJ 3C2HA 2XHKA 3E97A 2R0QC 2KDZA 4IHWA 5LHHA 4P55A 2RVCA 3O8HA 5E3LA 1ZG1A 3SZTA 2ZXWH 1P6RA 4HNTA 2X6XA 4M3DA 3V42A 3DKWA 4Y3OA 3VDXA 5DUIA 3BG6A 3E5XA 4E7IA 2V9KA 2HOTA 3OS0A 3V7RA 5IT9Z 1Y8QB 3CCLI 3HIFA 4CYDA 1IRZA 3FMRA 2NNNA 4IEJA 1J2XA 3LAJA 4IRGA 1YHQI 2ECCA 1RUNA 1IRXA 1MNEA 2JSPA 1O7LA 1X3ZB 1R5GA 3PNVA 3PL8A 2I10A 1TT5B 2MGQA 5H20A 1MMDA 2XSJC 4XM3A 2GLOA 3FX3A 1Z3XA 3HOXJ 4XONA 3VYSB 3TL4X 4RGUA 1SFEA 3Q3SA 1ETYA 3BC8A 2X51A 1B6AA 1XX5A 2Y0SA 3BJAA 1LQ1A 5J4YA 1JUSA 3R0AA 4HV5A 5EGOB 3JRHA 4Z2YA 4E7HA 2ZXJA 2M0MA 1BOBA 1OR7A 4HQEA 3WG7H 1GVJA 2H1KA 4FE4A 3RDIA 3CQZJ 3HJEA 2OJED 1W5TA 1ETOA 4IKFA 3CCJI 2E1OA 2M4GA 5H6QA 1MBJA 3JRFA 1JKQC 2L7FP 2M34A 1GDTA 1ZLJA 1TZLA 3FXUA 5F0HA 5JVGF 2OTLI 1EH7A 3GZ6A 2ZJ2A 3HG9A 1N25A 2L9RA 2VT2A 3ISPA 4XK4A 3P7NA 3I3LA 3WGGA 5K7HA 2R5YB 5M5WJ 2GM4A 2DMUA 2M9HA 2KFDA 2MH9A 4BXXJ 1ORKA 1ZHFA 2VLAA 3MN2A 2VJ5A 3S8PA 1G8XA 1JKPC 2CUFA 2FQ4A 3BG5A 3OYEA 1B59A 5K7ZA 3R0JA 2HQNA 2AXLA 1TP4A 3TOAA 4LGWA 4KA4A 4L9VA 2IRFG 1ZKGA 1YX5A 5KNLA 3AG2H 3AAFA 2XB5A 4A0YA 1EH6A 4KIBA 1XDSA 3ZMDA 2NOJB 4DGWB 2NNYA 2WY7Q 3E3VA 1AKHA 5GPAA 4M73A 4XRMA 2CQKA 3EUHA 1LDDA 2Y2ZA 1S7AA 3DPTA 4B3XA 3FHZA 5FO5A 4LG0B 3F8NA 3GTPJ 4AIJA 5C3EJ 2HS5A 1MDMB 3NEUA 1XCBA 2UXXA 2DT7B 4Q47A 3RYRA 4OMZA 5GP9A 4F52A 1IDYA 1UG0A 2LKSA 3EPZA 1LFUP 2EJRA 4JK1X 1MGTA 3V8JA 2ZMEB 1R4NB 3HEFA 1IXCA 4XN0A 3RYPA 1U2WA 4M9SA 3G4SI 4R8HA 3K70C 3GTMJ 2VOOA 3K4BA 1IN7A 1R22A 3CC4I 4L9TA 4CZZA 2Z33A 3OL4A 3H1CA 3BZKA 1TQPA 1DP3A 2FBHA 2I8DA 2VB6A 3H9GA 1R6RA 1Z67A 4O5VA 5DM6F 3E6MA 3V4GA 4HF1A 2JRTA 1V55H 2E36A 5KVRA 2PMUA 2B9SA 1OCTC 4CCNA 1N78A 2V79A 1VQPI 4Y4RA 2WB1A 3B6AA 2E2JJ 4UB6C 3REOA 1W4MA 1EV7A 4PJ0C 1DU6A 4CCOA 1KQ9A 5E17F 2P0WA 5CQEA 2Y9ZA 3WG9A 3Q9SA 3J80Z 4FCYA 2COMA 4FX4A 1DQUA 3HSRA 3F6VA 5HS9A 2A61A 2R5ZB 1CQTA 1YS7A 3BZ6A 2D1VA 5J3LA 4P9UA 1R4MB 3I56I 3OYDA 4PCQA 1S3JA 4DJAA 1OYIA 3KP3A 4I2OA 1LJ9A 4GO1A 1HXDA 5BOXA 4XSZF 3F9KA 2HTSA 1D3YA 2X6WA 5BQTA 4Q5SF 5EEHA 5IOZA 2OUMA 4B48A 3DBHB 4QSHA 3W6VA 2CUJA 1FOYA 1WQ2A 4HDUA 5TISC 3DU6A 3LFUA 3OYBA 2XRNA 1D0ZA 2HKOA 1F9NA 1WJDA 1ZGJA 2AHQA 2D45A 4YEJA 3CMYA 2ZO4A 5LEKA 1DDNA 2IA2A 3RKWA 4HQMA 4IRHA 2HDDA 1RC9A 1UHSA 3HHHA 3JSPA 3CCSI 4ZH4F 3LSGA 2LTPA 3OYFA 3BP8A 4IOAF 1V5GA 3S17J 1NH3A 4ZYGA 1XGOA 3QOPA 1R1UA 1WJ5A 4FETA 1YTYA 1L3LA 2R7ZJ 3S32A 1XG1A 4A6DA 1IN6A 5M5YJ 2VJIA 1FJLA 2M3AA 3CO7C 1IRGA 1V54H 1MW7A 1N77A 3I4NJ 1T6SA 2WADA 1XCVA 1RKWA 1WH7A 4DZJA 3TEDA 2CUZA 1D1CA 4BDZA 3SDGA 5IT9K 1XSXA 3GTLJ 1G3TA 1OQYA 1S6LA 4EJWA 1ZTRA 2UUZA 4BYYA 1IO2A 2XKPA 3ZR8X 5EYRA 4W97A 4ESFA 3CTAA 1WGXA 2L01A 3QPSA 5LLQA 3RI4A 1ZAOA 1UG2A 1STZA 1IZ1A 5ILSA 3V7SA 5M3FJ 4ZZLA 1OCCH 2EA2A 3LSMA 4ZC3A 4C9YA 1U8BA 1BJAA 2A69F 2FA5A 1V3FA 4LK0F 3FK6A 4C2MJ 4A2UA 3CUOA 4GXOA 4A5NA 5FRNA 3GFMA 3NAUA 1BW5A 5FKMA 3DTIA 2V4JC 2UWMA 1S9HA 2Y31A 4M3BA 3QODA 1JUPA 2X48A 2EFQA 1R49A 3A0HC 4GFBA 1EJ9A 2E19A 1X3WB 2IVMA 3SFZA 3SZGA 4F7ZA 1Z91A 2LLKA 5ICFA 4Q4ZF 5L3CA 2A5WA 2WWYA 1X1DA 1QVTA 1GHCA 2P6SA 2L0KA 2JUGA 3PO2J 4D7MA 9ANTA 3G1MA 3UKGA 2JA5J 3G71I 5L3GA 1MBKA 3RZOJ 3FKIJ 5EG0A 3D1NI 4FASD 3HGYA 2EPFA 4RB0A 2HVRA 3VYRB 1KU2A 1FSHA 5FLMJ 2FMYA 1SFOJ 4BS9A 3EUHC 4MHGA 4AYBA 4F55A 5D5VB 3SXYA 3OYGA 1IC8A 3UR3C 4N4NB 4A3MJ 2K3PA 3E0JB 5FKLA 1WWXA 5IPAA 1Q1VA 2QCOA 2XB0X 3NQOA 1UAAA 4F91B 1HOMA 3W6KB 4CO8A 1QZYA 2QQ8A 1D5VA 1I3QJ 1LVAA 2LFBA 2LYCA 2KKOA 1O3SA 4P96A 2JA6J 3DLLF 1IDZA 5FJ8J 4M3GA 4Y13A 1YFHA 1UFMA 3I64A 2X85A 1H0MA 2JTVA 1YW8A 2QKMB 3C3WA 2ECBA 5CLSA 1Y8RB 3HC7A 2F48A 4EJVA 4RA2A 4BBSJ 1QZEA 3H3UA 1YJWI 1OCZH 1MDMA 3BPXA 2D1HA 1F1ZA 3SYTA 1ZGWA 4IXAA 1AHDP 4XLCA 1RIOH 1D1BA 4UB8C 4F3QA 5IP6A 2EZHA 2DODA 1RETA 4F93B 4HYEA 4R1HA 1YE9A 2X4HA 3PM1A 1TLHB 4EMSA 4IHVA 2CG4A 3RKXA 1YO5C 2YR2A 3FWEA 4WXCA 3K10A 4A3FJ 1JJ6C 5HDNA 3GTOJ 1Z1DA 5FB2A 4LOCA 2BOLA 3KE2A 1K79A 2ISYA 4IVNA 2MLGA 3G2BA 2LD5A 4YFXF 2BVLA 2DU9A 2EFOA 2FRHA 2LKPA 2VJ4A 3WHBA 4RB1A 1XS9A 3F72A 3LSJA 4BACA 1FYMA 2M87A 1ODDA 3HZJA 5JHUA 4BJ6C 3CCQI 2STWA 2VBXA 4A93J 2DCEA 2DOEA 3PQKA 1WI3A 2EIJH 2EILH 2LC2A 2XGEA 2FBKA 4P1WA 2E1MB 2R5YA 1ACIA 2K9SA 3BR3A 1ZARA 1G4DA 5E1XA 2QZ8A 1I6HJ 4HSTA 2DMPA 3IH2A 1X1PA 4BHCA 5K5QA 1P92A 1Z9CA 2JQ7A 4CXFA 2KHMA 1KU9A 5B1AH 3WTYC 1QPMA 4ABZA 1HC8A 3H92A 3HOUJ 3DKYA 4M72A 1KZHA 3JAMK 1BW6A 4HDVA 2WAQA 3BTJA 4BQQA 1SD4A 3LL7A 2XPVA 1V5EA 4XQFA 2ZFWA 4HNVA 4O3MA 4M74A 1FY7A 2W82A 2XC7A 2HXIA 5IOYA 4KJZA 1H88C 3JTHA 3A01A 2E2HJ 4NB5A 1LE8B 3D5RC 4YFKF 4A5MA 2OA4A 3LSRA 4UNOA 4XRSA 5CVIA 2Y9YA 2WAFA 4LIUA 4PJLA 2GIVA 4EEFG 1IJWC 2L7KA 3FZVA 5LHGA 4L5IA 4IJAA 5K7FA 2GIZA 2VC0A 1TWFJ 3LAPA 4FHTA 5TJJA 3CDLA 2KDOA 3N4MA 2V9VA 4LB6B 3R61A 2ME6A 1E3HA 4LD5A 2DAOA 4KICA 3E1SA 1YG2A 5K1YA 3CF2A 3E6BA 4ZZDA 3I55I 4XKBA 1R71A 3CUQA 5EG0B 2UXNA 1HQCA 3VFZA 2FE3A 1VQNI 4I09A 2LNBA 2E60A 1KQ0A 4BXUA 3IP4B 1SMYF 1W36D 1O57A 2HDCA 4FTHA 2RREA 2HEOA 4OAYA 1LVKA 2WAQN 1E2XA 2HNHA 3TO9A 1BC8C 3O3KA 4D1QA 2MFZA 3KYCB 4P9FA 4RDUA 4MTEA 1X2NA 1Z0XA 3WGIA 2LRDA 4L9NA 3J7AO 1FP1D 1T56A 2OZ6A 1W1WE 4BJ5C 5HS8A 1MZBA 3QQAA 4G8XA 2PMZN 4W1UA 1X1CA 1RZ4A 5KK1A 2ZJRF 2R7SA 1H9GA 3JCUC 2KRHA 4BEHA 3ABLH 2XPUA 3HOWJ 2F6CA 2GQQA 1S72I 2Z9OA 2YSRA 2R92J 3P5JA 2FQ3A 3KP6A 4D0PA 4G9YA 3K70D 2X1DA 5LGNA 4A69C 1HW2A 1U5TB 3JRBA 1K61A 1HKQA 4B1RA 4FE7A 2MLKA 5FLVA 4WXHA 4CICA 1MNDA 4YRVA 3CC7I 4J00A 3GFIA 1A31A 2L7MP 2KMUA 1B72B 1J59A 4HRIA 5EEAA 4V2GA 5D6FA 1E3PA 1DUXC 4BJTA 2H8WA 2DA3A 2KRCA 5H6RA 1J09A 4LIVA 2XROA 4RLQA 1WSUA 1K83J 2DXIA 1XMAA 3DV8A 3NARA 5HLTA 1KU3A 1OCOH 1IN8A 4P5OA 2V6CA 4E7ZA 2IXSA 5GAEJ 3LNQA 2JA8J 2R93J 3PUFA 5ED4A 4MQVA 2MC3A 2DPUA 4EVIA 3BG3A 4XL9A 4BNCA 3T5XA 3ZMVA 2DT6A 3S2DJ 1LDKB 2Z2SB 5E20A 1TW2A 2G0EA 1Z6TA 2X0LA 5EZGA 2W00A 5L3BA 3GVAA 4RBOA 3C18A 4ITVA 3ASOH 4U7DA 3D5LA 3KP4A 4U87A 3KX2A 2VXZA 1WI9A 2IBDA 4S04A 2FUG2 3MVPA 3ABKH 4KT6A 3OIOA 2ICWG 2EWNA 3ZCOA 1BL0A 2EIKH 1UHMA 1R9TJ 3H3VK 2OZUA 2K9MA 4A3KJ 3VSKA 3OYNA 1VQKI 2XAFA 4MGRA 2D5VA 3BPVA 2BZTA 5LGTA 1HSTA 3L2WA 3H0DA 2Q2EA 4MQ9F 3SJMA 2JSCA 1OR7C 3PNYA 2CFOA 3S2WA 1QO0D 2KT0A 3I9V2 1EF4A 2DFHA 3I59A 4RM3A 3ZQIA 3VYUB 1FSEA 1BR1A 3RTRA 1IG7A 2ID3A 3M8EA 2F5CA 1WJAA 3HRUA 2Y30A 2BGCA 2NVQJ 3QYFA 5DCMA 4ESBA 3I4MJ 1SMTA 1ITYA 3KP2A 3DFGA 3G6EI 1W0UA 3D5SC 1U78A 2MSYA 1J7KA 2G7HA 1LEBA 4GYGA 3L2RA 3FM3A 3PSIA 2ZB9A 2P5LC 3JRGA 5FGMA 1VNDA 2AS5F 4A0ZA 4AIDA 2XAJA 2IS6A 3LOCA 3L00A 1QU3A 3BR0A 4A3IJ 1BM9A 4JYKA 2Z1DA 2GA2A 2HYJA 1VQ8I 1PDNC 2JVGA 4G6TB 2M0CA 3HDDA 2ZSIB 2DA7A 3BQYA 4OU0A 2EQRA 3BR5A 3F23A 4UUSB 2OD5A 2ZXHA 4E7KA 3DWLE 2A6TA 2A3SA 2O8KA 1AA7A 1TT0A 2DQRA 3GTJJ 2EIMH 1NK2P 2A5YB 4H0EA 3HRSA 1R58A 3VB2A 1T33A 2RNJA 4DYQA 2KJCA 3CCYA 3HTSB 4NDLA 4U0YA 2DYSH 1K4TA 4IHYA 3TDUC 2V6EA 3ROUA 1TQMA 2VKDA 5CJ9A 5AIPA 1FYLA 2KRFA 1DU0A 1S5LC 1ZN2A 3ZGKA 4L9JA 1GT0C 3OWTA 3T8RA 5JR3A 2W85A 3A1YA 1J5YA 1IGNA 2L54A 4DIQA 2E5NA 4AVZA 5HLIA 2FSWA 1ON2A 3R60A 5FFXA 3NWTA 3L09A 2IGMA 1T0FC 3OYHA 4Y17A 5ILVA 5J8FA 2LK2A 3TKYA 3SEZA 4ZYEA 2Q0OA 1LPQA 4FT8A 1MBFA 4KN7X 1BC7C 1Y0NA 2RQQA 2F5DA 5F27A 2Q1ZB 4MTDA 3TP0A 2GXBA 2IT0A 1MMSA 2I5UA 3IRRA 2EV5A 2LY1A 3BTCA 2CW0F 3K0LA 2CSOA 2DTZA 2JWTA 3CJNA 3WU0A 3HHGA 1BR2A 2DN0A 5CVVA 1U5TC 5DCMB 5M5XJ 3ZQCA 5E3NA 1D0YA 1JT0A 2CU7A 3H5RA 1G3SA 4V2FA 2C6YA 3M4OJ 1JTXA 2HOEA 3I4PA 2DA6A 2XGDA 3NRVA 4I7HA 2GWRA 5JI6A 3KEYA 3ZMUA 4RGRA 4IX7A 4AU7A 1FTTA 2CS3A 1FX7A 2WB1N 5H2FC 1TTYA 4IPAA 3GWZA 2PQ8A 2DW4A 2NS0A 2STTA 2Y69H 4X6AJ 4RLFA 1FBQA 2E1CA 4A3DJ 3ZQGA 2OPTA 4UVAA 3ML6A 1XN7A 1WJCA 1U5TA 2CFXA 2JRMA 5F1RA 2XUBA 4IQJA 2KJBA 4PJNA 4CA0A 2HTJA 3T1BA 2L9VA 4OMYA 3AFHA 1Y6IA 3RPUA 5GAGJ 4JOMA 3OY9A 3OSGA 4XORA 3A02A 2R5ZA 2F4IA 1XSVA 1DGWY 2YX4A 2A68F 4HLYA 3DF8A 3QAHA 2HVSA 3PFYA 2HQ5A 2NVYJ 4HEA2 4RM2A 2MA3A 5HDKA 5D8LB 3P9CA 4HF0A 1SFUA 1S7EA 4M3EA 4E7JA 1A36A 3BJOA 1BA5A 1W5CC 5ERIA 3A0BC 4AWXB 1O3QA 3AG3H 2KIFA 3FIWA 1JGSA 2MABA 4Y33A 4U0VA 4MEXF 3GTQJ 1W7PD 2VPRA 1YLFA 1UMQA 1YQAA 1GLNA 2J5OA 3TBIA 2M1BA 1ZGAA 3PQJA 4PK4A 4KISA 2DI3A 3JRDA 4DNCA 1IW7F 1JHFA 3MKYB 3ZRGA 2JA7J 1V5FA 3PJRA 3WE2A 4G12A 4X1EA 3M1CA 5KAIC 2VKEA 3VPRA 4I02A 3A01B 2P7CB 3L7WA 3OYCA 2B0LA 3BZCA 4GDFA 1TNTA 4RAGA 3TW7A 3QPTA 4M6XA 4D5CA 2EZLA 5ILUA 3SEQA 2CQXA 3ONQA 3MKWB 3HOYJ 5KHDA 1POGA 1GV5A 4LLLA 4A3LJ 4G7ZF 1F4KA 1P4WA 3DPUA 5HOOA 3CJQB 2DJIA 4A3EJ 1BN5A 2KL4A 4RMNA 4UXNA 1G59A 5E3OA 5JLXA 2LY2A 4I98B 1AKHB 3OYMA 4E7SA 4KYWA 2ID6A 4DW6A 5FKNA 1LFBA 1I50J 3OSFA 1HDDC 1JTYA 1JUMA 2L02A 2XAGA 4DZPA 3J81K 3FBIB 4FISA 3K1MA 4XOTA 5GTHC 3F21A 2JUCA 1YX3A 2P7VB 1QHGA 2E1NA 3LFKA 5IP9J 2VODA 4XLPF 5LHIA 3S3NA 3T0YA 1MMNA 2WV0A 1QNTA 4YIRX 5B1BH 2O61A 2K4JA 2R7FA 4ZYDA 2PI0A 3S14J 5E8IA 3OV8A 4CCKA 1A35A 5L3FA 1NK3P 4HOBA 2VKHA 1YIJI 3CCUI 3WTSC 2VIXA 2OBPA 2NAZA 4HZFA 3WTWC 2J5PA 3OL3A 1TC3C 3COAC 1S29A 4U7BA 1HW5A 1M1EB 1MMAA 3U1KA 3IUOA 2HVQA 4OIOF 2ZCWA 3GZNB 3ERMA 2BHZA 2M5WA 5L3EA 2EZIA 2VKVA 3N05A 1B8IA 2LY9A 2Y0MA 3CP8A 1IV6A 2Z3YA 4DYRA 2PJPA 2PMHA 4XMYA 1T95A 3WTUC 3K4LA 2QLZA 1ZR2A 3HSEA 2LVSA 2XRLA 2QM3A 1H8AC 2O5RA 4ANJA 4FQGA 4AC0A 1NHAA 4E7LA 2AQFA 5BMZA 1PUFA 4AM3A 3LSPA 2NOGA 3VODA 2DMQA 2DBBA 4Q48A 3QU3A 2LF7A 3PO3J 2A05A 2W25A 5J6XA 2BV6A 2YX7A 3B6CA 1FMVA 3GZ5A 1TNSA 4XLAA 4CCJA 5B5EC 4CZCA 3GLLA 5CYVA 2W24A 4AIKA 2H8RA 1PP7U 1MKMA 2BW3B 4UV9A 3SFIA 4DBQA 3OYAA 5BS6A 1ONVA 2PEXA 3AG4H 1I27A 3BWGA 4XOPA 3E6CC 4EATA 3WHCA 2N8GA 2DFEA 2RN7A 4HLXA 1GVDA 2ELJA 4XLFA 1ZRFA 5D6EA 4HW0A 1TBXA 1CGPA 1R23A 4HAMA 1QBJA 1X58A 4M9ZA 4B09A 3ZQ7A 2ELHA 2KIQA 1LNWA 1BOAA 2QKLB 4JX6A 3WTXC 4A6EA 1I3AA 3RQIA 2OTJI 3C2BA 1X19A 2E1MC 3KYLA 3K7AJ 3S1RJ 1K4SA 1MNMC 1ZH5A 4QPOA 1WFXA 2K7LA 1SAUA 3F3XA 5F04A 3MAJA 4LMYA 5F0CA 3HUGB 4C3IJ 1VQOI 1FTZA 1F36A 1BI0A 5GPCA 2V1NA 2TDXA 3RKYA 2CV1A 5TGTA 3EUAA 2VUMJ 2DQLA 3JRIA 4JX4A 1FT9A 3FHNA 1R5HA 2MBFA 1JKRC 4M9XA 1ZQ3P 2V26A 2NRAC 3GLXA 2NYXA 4GYIA 1HF0A 2XSDC 3HXLA 1Y1VJ 1WHUA 4BH9A 2ME0A 5F1JA 5DDGA 4CGZA 1W36C 2QSHX 2VPLA 2ADUA 5M3MJ 4II3A 2OQGA 4ZTJA 1R36A 3KZZA 1OCRH 5JLWA 3EETA 5TRDA 2XAHA 2AO9A 3W2VA 4M6YA 4KUMA 4XRSG 5ICGA 3ZN1A 4CYCB 1O3TA 3C1DA 3KLOA 4E70A 1T2KA 1FYKA 3DQVC 2DMNA 2FJ1A 2R7RA 2RNGA 3GCMA 2CV2A 2O7OA 3L2CA 3ZQQA 2M45A 2XPWA 4PJJA 2ZJQF 2ZMEC 3PUBA 2LF8A 3BR6A 3HL2A 1G2HA 1OCPA 4NUBA 1IAWA 3CJRB 3LQQA 3IAS2 3E6DA 1LKXA 1VQ5I 2HYFA 2PMZA 3MMYB 4ZDPA 2L2OA 1I1GA 3HSFA 4N0BA 1DPRA 4HX4A 2HQAA 4NNJA 5K5RA 1MSFC 3GFLA 2CQ7A 3HOVJ 1KONA 3TQNA 3MFKA 2QA4I 4L5EA 4IRIA 2LDUA 2HOSA 4B8XA 2R7VA 4I99C 1T38A 1XGNA 4YELA 3ABMH 3JSOA 4C30A 2DPDA 2XF5A 4KDPA 3CMAI 2R7WA 1VI0A 2PBIA 1AWCA 3LA7A 5KAFC 3HYIA 2WA0A 3FXJA 2A07F 1YRNB 2ZBKA 2QUFA 1BIBA 2HDWA 4D7NA 4XICA 1D0XA 3JW4A 2F5VA 3L2UA 2K86A 2RV8A 1H89C 5D8KB 2IS2A 4NC7A 3GFJA 3IL2A 2DDBA 5IP7J 2FOKA 2BVMA 3K1NA 1SVLA 4IHSA 3LMMA 4PGHA 1RNLA 1A5JA 1FOWA 5KCMA 4I0BA 4YIIA 3IWFA 1B1BA 1Y39A 2X6YA 1K7AA 1N75A 5FROA 4KITB 1Z21A 5B3SH 1ZRDA 2QF7A 2CRGA 2M7AA 3LSTA 2PJRA 4UVCA 2D2WA 3MKZA 2HOAA 4I6ZA 1UELB 2VXDA 1WVRA 3BTLA 4KIFA 2IAIA 1YI2I 3MD2A 4X0GA 4XKVA 2G7UA 2LOOA 2ZC2A 5CVRA 1B4AA 1G3WA 1IUYA 3Q5FA 1L0OC 1B8IB 2RC4A 1UHWA 2P5KA 1UZCA 4J19A 1MH3A 5E1WA 3CCVI 3VOEA 6PAXA 2HPIA 3BQZA 2Y0SN 4ENKA 2JK3A 5J40A 4IHTA 2HXOA 2CYYA 2MG4A 2DYRH 2VE8A 1MSEC 2RAEA 2CW7A 2H94A 2BXZA 2YU3A 3N97A 1OISA 1ZG3A 2Y75A 3K4JA 5HNFA 2BY1A 3FDYA 2X1EA 1T08B 3SDBA 3C7JA 3ULQB 2ZFUA 5FD5A 4BL0B 1QRYA 3SZPA 4AUXA 3W3CA 2HPMA 3KEOA 3RQ4A 1W7PB 4BQOA 4EQQA 1LEAA 1FOKA 1X3UA 2OV7A 1USSA 1X1AA 3DLAA 5AIQA 3MKLA 3GUDA 4ZDLA 1ETXA 4TV7A 2VT3A 4WF2A 3GYHX 2M2EA 1ZLKA 4NHJA 3Q9VA 2V1XA 3TP3A 4ZJZA 1OKRA 1TL8A 1R00A 4CDGA 3H9QA 1G3YA 5HVQC 1Z3YA 1FPQA 3OMYA 1RR8C 3GO5A 2X9DA 1IXSB 3ZMZA 2IGNA 2L3DA 1RI7A 2HZDA 1CF7B 1MBGA 2B63J 1YW9A 3SQNA 1MBEA 5FLXK 1WJFA 2FF4A 4CUGA 4GCVA 2ACJA 1HDPA 2IJLA 1XD7A 5HNHA 5C44J 3HOSA 2YPRA 2EFPA 1QA6A 2L7ZA 1IF1A 1YIOA 2BHYA 3FK7A 1U3EM 3LA3A 3GTKJ 3GX4X 2Z5UA 5FKOA 2A6EF 3P9KA 4G7OF 5JHFA 4MLOA 2CW8A 2XIGA 3K1PA 2E5ZA 3HTUA 4MFEA 3CUQC 4Z6YA 5DTDA 1FNNA 1U6GA 5E79C 2M7BA 2ZJPF 3K69A 2OCCH 3DBLB 2CMPA 3FKJA 4PDKA 3TO6A 4XBFA 4B47A 5FRMA 2V9PA 5J47A 1I1SA 4QIWN 5B66C 1I6XA 1PVEA 4A3JJ 2CV0A 1P4AA 1I39A 2O03A 4MIMA 5A2QK 2WTEA 4RS8A 2XGXA 3PNTA 2H1LA 2WY8Q 2P8TA 4II2A 4LJZF 2MD0A 2UZKA 2XV4S 2W1OA 3FXMA 2V1DA 4DOZA 1RR7A 4CCMA 1VZ0A 1X1BA 1Z6RA 3U2RA 1BI1A 3DP7A 3TOBA 2HYGD 1A04A 3S1NJ 4BAYA 3R6SA 1D5YA 3A03A 3K4MA 5D4SA 4IZZA 4G6QA 1J9IA 4N9HA 1Z05A 2EFNA 3I0TA 4RB2C 3QYBA 4EJOA 1WZ2A 2ZSHB 3J7ZI 3S3OA 2PJRB 1OMIA 2P4WA 5EDNA 3GW2A 4OWRB 1SD6A 2EFWA 3J80K 4PFOA 3K4NA 2VQLA 3QPLA 3FXOA 5HODA 4CYCA 4EM1A 2PLYA 2H6CA 3U9GA 4MNUA 2QBYA 3F8BA 4AD9A 3G1OA 2HZTA 3HRTA 3KEQA 5J1RA 3CD6I 2F5EA 1SD5A 3BR1A 3HRMA 3CLQA 3IV5A 3WTVC 5E3MA 3TMOA 1FWZA 2XAUA 1Z7LA 2B7EA 4QPQA 4J01A 2XF6A 3OS1A 3AG1H 3RPQA 3SHFA 1KU7A 2GZWA 1YJNI 1NG6A 1XTAA 3L9FA 3F22A 2LREA 2NVUB 1ERDA 2K5CA 1SFKA 2OAZA 4BXFA 4EV0A 5CPRB 1JHHA 3DEUA 3HPHA 1U0JA 2K3FA 2X1CA 1MJBA 4L18B 5ICCA 3IKTA 2M30A 3CMMA 3E7LA 3OOPA 5J4VA 5E1ZB 4N9IA 2DLLA 3BCBA 3CUQB 3G73A 4E4HA 2E35A 2DK8A 1Y0UA 4G6DA 1R7JA 4HF2A 3I59B 5GTIC 3ZQLA 2BW3A 3DTKA 1B72A 2FXAA 2VQHA 2Q8KA 1OYWA 2CQNA 2WBMA 1OJLA 2QGUA 1P7JA 4O6JA 4JP0A 1GXPA
chains in the Genus database with same CATH topology
1YJWI 2E34A 3G4SI 1VQMI 1YI2I 1VQNI 2NXNB 2OTJI 1VQ9I 2JQ7A 5DM7F 3CMAI 1VQ4I 1FOWA 3CJTB 2K3FA 2ZJQF 1HC8A 1S72I 1FOYA 2H8WA 3CC4I 4IOCF 5GAHJ 2ZJPF 3CCLI 3J7YJ 3CCRI 1Y39A 3PIOF 1VQ7I 3CC2I 1YITI 1VQ5I 3CCQI 1YHQI 4V19K 3PIPF 2FOWA 3CD6I 5GADJ 3CCVI 2E35A 5GAEJ 3I56I 3DLLF 3G71I 3CCJI 1VQOI 3CCEI 1QA6A 5DM6F 4IO9F 1MMSA 1YIJI 3CCUI 5GAGJ 3CMEI 3CCSI 2E36A 3CF5F 1YJ9I 1VQLI 4UY8I 1ACIA 1FOXA 1VQKI 3I55I 4IOAF 2QA4I 1YJNI 3J7ZI 5JVGF 1VQ8I 3CC7I 2OTLI 3G6EI 1VQ6I 3CCMI 1VQPI 2ZJRF 2QEXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW I;  2E34 A;  3G4S I;  1VQM I;  1YI2 I;  1VQN I;  2NXN B;  2OTJ I;  1VQ9 I;  2JQ7 A;  5DM7 F;  3CMA I;  1VQ4 I;  1FOW A;  3CJT B;  2K3F A;  2ZJQ F;  1HC8 A;  1S72 I;  1FOY A;  2H8W A;  3CC4 I;  4IOC F;  5GAH J;  2ZJP F;  3CCL I;  3J7Y J;  3CCR I;  1Y39 A;  3PIO F;  1VQ7 I;  3CC2 I;  1YIT I;  1VQ5 I;  3CCQ I;  1YHQ I;  4V19 K;  3PIP F;  2FOW A;  3CD6 I;  5GAD J;  3CCV I;  2E35 A;  5GAE J;  3I56 I;  3DLL F;  3G71 I;  3CCJ I;  1VQO I;  3CCE I;  1QA6 A;  5DM6 F;  4IO9 F;  1MMS A;  1YIJ I;  3CCU I;  5GAG J;  3CME I;  3CCS I;  2E36 A;  3CF5 F;  1YJ9 I;  1VQL I;  4UY8 I;  1ACI A;  1FOX A;  1VQK I;  3I55 I;  4IOA F;  2QA4 I;  1YJN I;  3J7Z I;  5JVG F;  1VQ8 I;  3CC7 I;  2OTL I;  3G6E I;  1VQ6 I;  3CCM I;  1VQP I;  2ZJR F;  2QEX I; 
#chains in the Genus database with same CATH topology
 2KZV A;  1HKS A;  2JN6 A;  3KP7 A;  3A2K A;  5EEG A;  3BLY A;  2DA2 A;  3H3Z A;  1JGG A;  2TCT A;  3BG7 A;  2F5F A;  1H9T A;  2DOA A;  4ZYA A;  2GOM A;  2FOW A;  4BHB A;  2HI3 A;  2DDA A;  3LQR A;  3BR2 A;  4BEH B;  1BIA A;  2P81 A;  3KZI C;  3ZMS A;  4RB3 C;  4ENM A;  5DV5 A;  1SVM A;  3H9J A;  4RGX A;  4LB5 A;  5AON A;  3HKZ N;  2M4K A;  5HLH A;  1K78 A;  3ZMT A;  1Z7U A;  3RCO A;  4PFP A;  3HOT A;  3Q0W A;  1LUJ B;  4KNY A;  2VE9 A;  4ASN A;  4R79 A;  2BYV E;  4HX7 A;  4S05 A;  3CCR I;  1FIP A;  3QOE A;  3GTG J;  2W57 A;  2R7O A;  1GXQ A;  2LP0 A;  2PG4 A;  3K4C A;  1P9Q C;  4ZTF A;  5IY5 H;  3IC7 A;  3MZH A;  4C2U A;  2M8G X;  4B4C A;  3C2G A;  2IS4 A;  1ZK8 A;  2LBF B;  3V7C A;  4A3B J;  2VOP A;  4OIR F;  3FIS A;  5LFA A;  4CCL A;  2YS9 A;  4DQ2 A;  4CH7 A;  3EQL F;  2CH0 A;  3K4K A;  3ELK A;  2GBY A;  3NWS A;  1PUE E;  2JPC A;  1AOY A;  3H35 A;  2EBI A;  4ON0 A;  2E34 A;  3HOZ J;  3QP6 A;  3U1D A;  1VFC A;  3HGG A;  3J7A Y;  1PP8 F;  1JE8 A;  1ETW A;  1BBY A;  3IAM 2;  4HPQ A;  2XVC A;  2GXA A;  4BY7 J;  1XSD A;  4EGZ A;  4UV8 A;  4KMF A;  4RAF A;  1XB4 A;  3JTG A;  3BY6 A;  2VJJ A;  2XF7 A;  1TWA J;  5DD4 A;  4EJU A;  3IH4 A;  4UUT A;  1PUF B;  2BE5 F;  3O8G A;  2F2E A;  2XAQ A;  5L3D A;  3VSL A;  5IYC J;  2AXT C;  5FKK A;  2JJ7 A;  4M71 A;  4NQW A;  3CZ6 A;  2MYS A;  1P4X A;  4HA8 A;  3TW6 A;  4EM2 A;  4HX8 A;  2DA5 A;  1LB2 A;  5LRR A;  1CF7 A;  1C0W A;  3VEP A;  2IA0 A;  4JQF A;  1ZYR F;  5F0F A;  2EH3 A;  1G6N A;  2IGO A;  3F8F A;  1YS6 A;  3QWL A;  1IN4 A;  1MIJ A;  2DO7 A;  2DFI A;  2O9L A;  1DPU A;  4UVB A;  3KCC A;  5D5U B;  2E7W A;  2P6T A;  1XMX A;  4OAZ A;  2ZXI A;  3H36 A;  1DP7 P;  2V7F A;  1EKE A;  4EM0 B;  1WPK A;  2HR3 A;  4BQN A;  2XDV A;  2OU2 A;  1PJR A;  3EDP A;  4JBA A;  1BI3 A;  4WWC A;  3I58 A;  3CF5 F;  3JAM Z;  4IL6 C;  1O4X A;  2FNP A;  2FNA A;  4PZJ A;  3L2V A;  5HS7 A;  1D8J A;  4JX5 A;  3OIQ A;  3FF5 A;  1YRN A;  2DK5 A;  1F5T A;  2QQA A;  1IUF A;  4Y7N J;  2JPB A;  1VQ4 I;  1A6Q A;  1A6I A;  5LEJ A;  4D5F A;  3ECH A;  4HNU A;  5GAH J;  3IKV A;  1FEX A;  2LSO A;  3E5U A;  4M3F A;  4QLC U;  2JVH A;  5E8G A;  3WU2 C;  1FIA A;  3CP2 A;  1T8I A;  1U9N A;  1SD7 A;  4NC6 A;  5EZH A;  1JT6 A;  2QQB A;  4WK8 F;  3FXL A;  2QSF X;  2H6B A;  4DBR A;  3FXR A;  2L4M A;  4PJM A;  3OOU A;  2R7T A;  4CSW A;  1RKT A;  1P2F A;  1YYV A;  4IQ4 A;  3OYJ A;  2QQ9 A;  3F6O A;  3WTZ A;  1K6O A;  2LBF A;  2LH9 A;  3P9I A;  1ZEL A;  3FMS A;  4HV6 A;  3EUK L;  4WCG A;  2DJN A;  5A2Q Z;  2QEN A;  1XGS A;  2RGV A;  3BTI A;  4G94 A;  1YW7 A;  2NVX J;  3MZ8 A;  4M6V A;  2VQC A;  5DS9 A;  3K9T A;  3IHU A;  1ETQ A;  1IXR C;  3AL0 B;  2ESH A;  3HKZ A;  2M8E A;  2VN2 A;  4L0Y B;  3JRC A;  1EA3 A;  4FX0 A;  3EYY A;  4LG3 A;  4XID A;  3CJT B;  3K6G A;  2JA2 A;  4LIT A;  1QHH D;  2H09 A;  3PSF A;  4RGS A;  1S8N A;  2WAE A;  3B02 A;  3CLO A;  1VTN C;  5FFZ A;  2OCE A;  1MD0 A;  4C3H J;  3ZXS A;  2QBY B;  2ZNY A;  2BY0 A;  2K9L A;  1MH4 A;  2DA4 A;  1D8K A;  2FEZ A;  3U21 A;  3QU6 A;  3D0S A;  2O3F A;  1HBX G;  1W0T A;  1ULY A;  4MO7 A;  3RPU D;  1Y56 A;  4ENN A;  1FP2 A;  4XN3 A;  2CJJ A;  4XLN F;  4I0A A;  3H0G J;  4U0W A;  3IWZ A;  5CVU A;  5JFR A;  4NC8 A;  5D4R A;  4XKC A;  3CC2 I;  2NS8 A;  1J75 A;  2Q2E B;  4YFN F;  4GRI A;  3TDZ C;  2ZNZ A;  4V19 K;  1U9O A;  3OIP A;  4HG2 A;  2PN6 A;  2KIS A;  1FBU A;  2JT1 A;  1SAX A;  2KZG A;  3ABT A;  3H5N A;  1Y1W J;  4PUS A;  2ESN A;  1WRJ A;  3HB9 A;  3G1L A;  1SFX A;  3KZY A;  4UHT A;  2K85 A;  1MJ9 A;  2NS7 A;  2LG4 A;  3M1E A;  1R5I D;  1VQM I;  2NXN B;  4LFU A;  2AQE A;  2PX9 A;  2K02 A;  3MWM A;  3LWF A;  4OIN F;  2HFH A;  3LSH A;  4IF4 A;  1DGR M;  2BY3 A;  2FX0 A;  2P5V A;  3GBG A;  3ZOB A;  4B3A A;  3KYD B;  2FU4 A;  1BR4 A;  5DEQ A;  3KET A;  3GME A;  4XRF A;  1Q1H A;  1RPW A;  1ETV A;  3DBR B;  4H4K C;  4A0X A;  3ZN0 A;  2VON A;  1QVU A;  3ZPL A;  2L9S A;  3QP5 A;  4RAZ A;  2HWV A;  2CUE A;  1NG7 A;  4XKW A;  2OF7 A;  2KP6 A;  4I01 A;  2R3S A;  4N4O B;  4AVP A;  3S2H J;  2EB7 A;  2EV0 A;  5JVT A;  2YUS A;  1OFC X;  3AL0 C;  4ENJ A;  1ZR4 A;  2W84 A;  5FD6 A;  5DUK A;  5C4J J;  4IOC F;  1IN5 A;  3ZQF A;  4KMU X;  2IA1 A;  4KFC A;  2VQG A;  2ZKZ A;  2KIM A;  1WCM J;  1XGM A;  2DTR A;  3M7G A;  4EGY A;  2RDP A;  5F64 A;  1BI2 A;  1SAN A;  2EV6 A;  2TRT A;  2BY2 A;  4BDY A;  1VQL I;  3UNG C;  3CO6 C;  1U8R A;  2GA1 A;  4Y52 J;  1JI8 A;  3HUG A;  2VC1 A;  3RIR A;  2JZY A;  1KYZ A;  2L9N A;  1W7P A;  5C4X J;  3ECO A;  3KFW X;  1UB9 A;  3DXJ F;  2WC2 A;  2IGK A;  2VAS A;  2XKO A;  3O6B B;  2OC6 A;  5CKT A;  1I5Z A;  3OYL A;  5J1U A;  3L2Q A;  4BQA A;  2F4M B;  3I71 A;  4S0H B;  3S1M J;  1QGP A;  5LD2 C;  3X2Q H;  1XDU A;  4ZDO A;  5BPD A;  4OOI A;  4XR6 A;  1GV2 A;  3DEW A;  4CHU A;  4ESJ A;  4OIP F;  3OYK A;  3TGN A;  3DKX A;  1FBS A;  1RES A;  4Y15 A;  3WE3 A;  4ZYH A;  2CO5 A;  1F43 A;  1OYY A;  4NBQ A;  2W4S A;  3KIO A;  3IH3 A;  3G3Z A;  2ZME A;  1IRF A;  5HDG A;  2KPM A;  4BY1 J;  2VBY A;  3LA2 A;  5K5O A;  3PIO F;  1ZG5 A;  4XLE A;  1SC7 A;  1ZRC A;  2VBZ A;  1O7F A;  1X2M A;  2E7X A;  4KN4 X;  1YOV B;  4ETS A;  4RAY A;  3QPH A;  3AKZ A;  3LSK A;  2O0Y A;  4UUV A;  4UY8 I;  1R1V A;  4AYB N;  3DCF A;  3OYI A;  4C2T A;  1UJ8 A;  3IRQ A;  1VQ6 I;  2R7D A;  1TWG J;  4BHP A;  3BJ6 A;  2HGC A;  1D1A A;  1XC5 A;  2EIN H;  3HBL A;  2IPQ X;  3KLN A;  1IV8 A;  1RRJ A;  1UST A;  1SEU A;  3MZY A;  3KP5 A;  4GGG A;  4L5J A;  2BEO A;  3MEX A;  5J1Y A;  4PSX A;  1QQI A;  4WXD A;  4A3G J;  1ETK A;  2K27 A;  1LE8 A;  3R4K A;  4XSX F;  1P7I A;  3M3Y J;  1FOX A;  1B9M A;  2O8X A;  1GUU A;  3GEZ A;  3VWB A;  1X4P A;  1KGS A;  2MC4 A;  1NTC A;  1O3R A;  1REP C;  5FLX Z;  3CDI A;  4LLN A;  5ICE A;  1LFP A;  1RUO A;  1TW3 A;  3DU5 A;  1V4R A;  2K40 A;  1T0F A;  3W2W A;  1VQ7 I;  5EGO A;  3BRO A;  1QZZ A;  3OS2 A;  3BG9 A;  4B44 A;  3F0C A;  1T98 A;  3PIP F;  3WOD F;  4MFD A;  2GAU A;  1JKO C;  3RJP A;  2DMT A;  4AIH A;  3HPG A;  1KYW A;  5HLG A;  2IP2 A;  2WV1 A;  4DYC A;  3S3M A;  2IW5 A;  3DPL C;  4BE1 A;  2CGP A;  4LK1 F;  2QWW A;  2CQQ A;  4E6K G;  2W48 A;  1MMG A;  1WH5 A;  3WGH A;  2HQR A;  4BE2 A;  1ENH A;  1X4O A;  1BJZ A;  2H27 A;  1E3O C;  2KQR A;  1OPC A;  1J0R A;  2V1U A;  4BBR J;  3W2A A;  1MJA A;  3FM5 A;  1HLV A;  4YIF A;  1TQI A;  2G9W A;  1E17 A;  2L4A A;  3I54 A;  3M8J A;  4C3J J;  2JMW A;  3EYI A;  2KLO A;  3CCE I;  3BOQ A;  2R7U A;  3GF2 A;  2XAS A;  3RKQ A;  1B9N A;  2HU9 A;  3Q0U A;  4PGG A;  2OQR A;  3M9A A;  1K6Y A;  1WJE A;  2DT5 A;  4QWQ A;  2F4O B;  3FMQ A;  2UV1 A;  3OR1 C;  1FC3 A;  3V8K A;  3OR2 C;  4L0Z B;  2COB A;  3H5A A;  5E18 F;  2Z16 A;  3ASN H;  2K9N A;  3F8C A;  3TO7 A;  3W6J B;  3F8M A;  5D5X B;  4A3C J;  2DFF A;  2QVO A;  4BU2 A;  1FLI A;  3JRA A;  1JJ8 C;  2IS1 A;  3LSI A;  1YIT I;  3CES A;  3FXK A;  2XGC A;  1HKT A;  3T8T A;  2MD5 A;  3M8F A;  3V8L A;  1OLT A;  2DA1 A;  3ESW B;  4LG0 A;  3PFI A;  1WJB A;  1UCR A;  3FXQ A;  4QTR A;  3CME I;  3BCA A;  2MH2 A;  1FMW A;  1HSJ A;  2EA4 A;  2KIU A;  3DEE A;  3KPH A;  3M07 A;  4K2E A;  2L5Q A;  3JR9 A;  1APL C;  2LKX A;  3ZP5 A;  2R4G A;  1HCR A;  3Q0V A;  1SVO A;  5EJC A;  3MCZ A;  4F92 B;  5LGU A;  1AU7 A;  2X6O A;  4MEY F;  2ETH A;  2RKH A;  2EZK A;  2A6H F;  2HKX A;  2FML A;  2E71 A;  3FBN B;  5LRS A;  2NVT J;  3RZD J;  1EH8 A;  4YG2 F;  5BPI A;  4D9J A;  4A12 A;  3ZQH A;  1FZP B;  3I53 A;  3MQ0 A;  3QRF F;  3S1Q J;  3S93 A;  2ELK A;  3DTE A;  3S15 J;  2PFB A;  2VL8 A;  2Y48 A;  3E5Q A;  3HM5 A;  1MBH A;  3K2Z A;  1W5S A;  5BNG A;  3CCM I;  4I76 A;  1JXS A;  2O6G E;  2QEX I;  1HA8 A;  2R7X A;  4G7H F;  1VQ9 I;  4BUP A;  2IEK A;  2Z99 A;  5IT3 A;  4WX9 A;  4BKX A;  5F08 A;  1HW1 A;  1K78 B;  5EF6 A;  4LLG F;  1R1T A;  4UUS A;  5DCF A;  5DD8 A;  1XPX A;  4HSR A;  1TWC J;  3A4C A;  3ABU A;  2BXY A;  3I5U A;  2FBI A;  3VYT B;  5F6F A;  1KA8 A;  5CVJ A;  2K4B A;  4OIQ F;  2W7N A;  1WKM A;  2CWE A;  3GXO A;  2R7Q A;  3CDH A;  5DM7 F;  2QSG X;  3BDD A;  3L1P A;  4IHX A;  2BBY A;  1XMK A;  4HBL A;  1VF9 A;  3JRE A;  3WTT C;  2GOX B;  4EJT A;  5CQG A;  5GAD J;  2K9Q A;  1ZRE A;  2ISZ A;  1S7O A;  4XNF A;  4IO9 F;  2YU9 J;  1YJ9 I;  5DYM A;  4PSW A;  3O2P E;  4KT5 C;  4XLH A;  4BGD A;  2E2I J;  2VI6 A;  3RSN A;  5LBQ A;  3B73 A;  4B43 A;  3J81 Z;  2RQP A;  1LDJ A;  2LMD A;  3BT9 A;  1PYV A;  2LR8 A;  2GXG A;  1TWH J;  2DOF A;  1E0E A;  3ERE D;  3K2A A;  1Z77 A;  4NQW B;  2MW8 A;  4BE0 A;  1T39 A;  4KIG A;  3J7Y J;  2QYO A;  5IYB J;  5D5W B;  2FD5 A;  5J8C A;  2EK5 A;  3S16 J;  3WU1 B;  1QPI A;  4U88 A;  1ON1 A;  2VBW A;  3QYE A;  1KQ8 A;  5IYD J;  3C2H A;  2XHK A;  3E97 A;  2R0Q C;  2KDZ A;  4IHW A;  5LHH A;  4P55 A;  2RVC A;  3O8H A;  5E3L A;  1ZG1 A;  3SZT A;  2ZXW H;  1P6R A;  4HNT A;  2X6X A;  4M3D A;  3V42 A;  3DKW A;  4Y3O A;  3VDX A;  5DUI A;  3BG6 A;  3E5X A;  4E7I A;  2V9K A;  2HOT A;  3OS0 A;  3V7R A;  5IT9 Z;  1Y8Q B;  3CCL I;  3HIF A;  4CYD A;  1IRZ A;  3FMR A;  2NNN A;  4IEJ A;  1J2X A;  3LAJ A;  4IRG A;  1YHQ I;  2ECC A;  1RUN A;  1IRX A;  1MNE A;  2JSP A;  1O7L A;  1X3Z B;  1R5G A;  3PNV A;  3PL8 A;  2I10 A;  1TT5 B;  2MGQ A;  5H20 A;  1MMD A;  2XSJ C;  4XM3 A;  2GLO A;  3FX3 A;  1Z3X A;  3HOX J;  4XON A;  3VYS B;  3TL4 X;  4RGU A;  1SFE A;  3Q3S A;  1ETY A;  3BC8 A;  2X51 A;  1B6A A;  1XX5 A;  2Y0S A;  3BJA A;  1LQ1 A;  5J4Y A;  1JUS A;  3R0A A;  4HV5 A;  5EGO B;  3JRH A;  4Z2Y A;  4E7H A;  2ZXJ A;  2M0M A;  1BOB A;  1OR7 A;  4HQE A;  3WG7 H;  1GVJ A;  2H1K A;  4FE4 A;  3RDI A;  3CQZ J;  3HJE A;  2OJE D;  1W5T A;  1ETO A;  4IKF A;  3CCJ I;  2E1O A;  2M4G A;  5H6Q A;  1MBJ A;  3JRF A;  1JKQ C;  2L7F P;  2M34 A;  1GDT A;  1ZLJ A;  1TZL A;  3FXU A;  5F0H A;  5JVG F;  2OTL I;  1EH7 A;  3GZ6 A;  2ZJ2 A;  3HG9 A;  1N25 A;  2L9R A;  2VT2 A;  3ISP A;  4XK4 A;  3P7N A;  3I3L A;  3WGG A;  5K7H A;  2R5Y B;  5M5W J;  2GM4 A;  2DMU A;  2M9H A;  2KFD A;  2MH9 A;  4BXX J;  1ORK A;  1ZHF A;  2VLA A;  3MN2 A;  2VJ5 A;  3S8P A;  1G8X A;  1JKP C;  2CUF A;  2FQ4 A;  3BG5 A;  3OYE A;  1B59 A;  5K7Z A;  3R0J A;  2HQN A;  2AXL A;  1TP4 A;  3TOA A;  4LGW A;  4KA4 A;  4L9V A;  2IRF G;  1ZKG A;  1YX5 A;  5KNL A;  3AG2 H;  3AAF A;  2XB5 A;  4A0Y A;  1EH6 A;  4KIB A;  1XDS A;  3ZMD A;  2NOJ B;  4DGW B;  2NNY A;  2WY7 Q;  3E3V A;  1AKH A;  5GPA A;  4M73 A;  4XRM A;  2CQK A;  3EUH A;  1LDD A;  2Y2Z A;  1S7A A;  3DPT A;  4B3X A;  3FHZ A;  5FO5 A;  4LG0 B;  3F8N A;  3GTP J;  4AIJ A;  5C3E J;  2HS5 A;  1MDM B;  3NEU A;  1XCB A;  2UXX A;  2DT7 B;  4Q47 A;  3RYR A;  4OMZ A;  5GP9 A;  4F52 A;  1IDY A;  1UG0 A;  2LKS A;  3EPZ A;  1LFU P;  2EJR A;  4JK1 X;  1MGT A;  3V8J A;  2ZME B;  1R4N B;  3HEF A;  1IXC A;  4XN0 A;  3RYP A;  1U2W A;  4M9S A;  3G4S I;  4R8H A;  3K70 C;  3GTM J;  2VOO A;  3K4B A;  1IN7 A;  1R22 A;  3CC4 I;  4L9T A;  4CZZ A;  2Z33 A;  3OL4 A;  3H1C A;  3BZK A;  1TQP A;  1DP3 A;  2FBH A;  2I8D A;  2VB6 A;  3H9G A;  1R6R A;  1Z67 A;  4O5V A;  5DM6 F;  3E6M A;  3V4G A;  4HF1 A;  2JRT A;  1V55 H;  2E36 A;  5KVR A;  2PMU A;  2B9S A;  1OCT C;  4CCN A;  1N78 A;  2V79 A;  1VQP I;  4Y4R A;  2WB1 A;  3B6A A;  2E2J J;  4UB6 C;  3REO A;  1W4M A;  1EV7 A;  4PJ0 C;  1DU6 A;  4CCO A;  1KQ9 A;  5E17 F;  2P0W A;  5CQE A;  2Y9Z A;  3WG9 A;  3Q9S A;  3J80 Z;  4FCY A;  2COM A;  4FX4 A;  1DQU A;  3HSR A;  3F6V A;  5HS9 A;  2A61 A;  2R5Z B;  1CQT A;  1YS7 A;  3BZ6 A;  2D1V A;  5J3L A;  4P9U A;  1R4M B;  3I56 I;  3OYD A;  4PCQ A;  1S3J A;  4DJA A;  1OYI A;  3KP3 A;  4I2O A;  1LJ9 A;  4GO1 A;  1HXD A;  5BOX A;  4XSZ F;  3F9K A;  2HTS A;  1D3Y A;  2X6W A;  5BQT A;  4Q5S F;  5EEH A;  5IOZ A;  2OUM A;  4B48 A;  3DBH B;  4QSH A;  3W6V A;  2CUJ A;  1FOY A;  1WQ2 A;  4HDU A;  5TIS C;  3DU6 A;  3LFU A;  3OYB A;  2XRN A;  1D0Z A;  2HKO A;  1F9N A;  1WJD A;  1ZGJ A;  2AHQ A;  2D45 A;  4YEJ A;  3CMY A;  2ZO4 A;  5LEK A;  1DDN A;  2IA2 A;  3RKW A;  4HQM A;  4IRH A;  2HDD A;  1RC9 A;  1UHS A;  3HHH A;  3JSP A;  3CCS I;  4ZH4 F;  3LSG A;  2LTP A;  3OYF A;  3BP8 A;  4IOA F;  1V5G A;  3S17 J;  1NH3 A;  4ZYG A;  1XGO A;  3QOP A;  1R1U A;  1WJ5 A;  4FET A;  1YTY A;  1L3L A;  2R7Z J;  3S32 A;  1XG1 A;  4A6D A;  1IN6 A;  5M5Y J;  2VJI A;  1FJL A;  2M3A A;  3CO7 C;  1IRG A;  1V54 H;  1MW7 A;  1N77 A;  3I4N J;  1T6S A;  2WAD A;  1XCV A;  1RKW A;  1WH7 A;  4DZJ A;  3TED A;  2CUZ A;  1D1C A;  4BDZ A;  3SDG A;  5IT9 K;  1XSX A;  3GTL J;  1G3T A;  1OQY A;  1S6L A;  4EJW A;  1ZTR A;  2UUZ A;  4BYY A;  1IO2 A;  2XKP A;  3ZR8 X;  5EYR A;  4W97 A;  4ESF A;  3CTA A;  1WGX A;  2L01 A;  3QPS A;  5LLQ A;  3RI4 A;  1ZAO A;  1UG2 A;  1STZ A;  1IZ1 A;  5ILS A;  3V7S A;  5M3F J;  4ZZL A;  1OCC H;  2EA2 A;  3LSM A;  4ZC3 A;  4C9Y A;  1U8B A;  1BJA A;  2A69 F;  2FA5 A;  1V3F A;  4LK0 F;  3FK6 A;  4C2M J;  4A2U A;  3CUO A;  4GXO A;  4A5N A;  5FRN A;  3GFM A;  3NAU A;  1BW5 A;  5FKM A;  3DTI A;  2V4J C;  2UWM A;  1S9H A;  2Y31 A;  4M3B A;  3QOD A;  1JUP A;  2X48 A;  2EFQ A;  1R49 A;  3A0H C;  4GFB A;  1EJ9 A;  2E19 A;  1X3W B;  2IVM A;  3SFZ A;  3SZG A;  4F7Z A;  1Z91 A;  2LLK A;  5ICF A;  4Q4Z F;  5L3C A;  2A5W A;  2WWY A;  1X1D A;  1QVT A;  1GHC A;  2P6S A;  2L0K A;  2JUG A;  3PO2 J;  4D7M A;  9ANT A;  3G1M A;  3UKG A;  2JA5 J;  3G71 I;  5L3G A;  1MBK A;  3RZO J;  3FKI J;  5EG0 A;  3D1N I;  4FAS D;  3HGY A;  2EPF A;  4RB0 A;  2HVR A;  3VYR B;  1KU2 A;  1FSH A;  5FLM J;  2FMY A;  1SFO J;  4BS9 A;  3EUH C;  4MHG A;  4AYB A;  4F55 A;  5D5V B;  3SXY A;  3OYG A;  1IC8 A;  3UR3 C;  4N4N B;  4A3M J;  2K3P A;  3E0J B;  5FKL A;  1WWX A;  5IPA A;  1Q1V A;  2QCO A;  2XB0 X;  3NQO A;  1UAA A;  4F91 B;  1HOM A;  3W6K B;  4CO8 A;  1QZY A;  2QQ8 A;  1D5V A;  1I3Q J;  1LVA A;  2LFB A;  2LYC A;  2KKO A;  1O3S A;  4P96 A;  2JA6 J;  3DLL F;  1IDZ A;  5FJ8 J;  4M3G A;  4Y13 A;  1YFH A;  1UFM A;  3I64 A;  2X85 A;  1H0M A;  2JTV A;  1YW8 A;  2QKM B;  3C3W A;  2ECB A;  5CLS A;  1Y8R B;  3HC7 A;  2F48 A;  4EJV A;  4RA2 A;  4BBS J;  1QZE A;  3H3U A;  1YJW I;  1OCZ H;  1MDM A;  3BPX A;  2D1H A;  1F1Z A;  3SYT A;  1ZGW A;  4IXA A;  1AHD P;  4XLC A;  1RIO H;  1D1B A;  4UB8 C;  4F3Q A;  5IP6 A;  2EZH A;  2DOD A;  1RET A;  4F93 B;  4HYE A;  4R1H A;  1YE9 A;  2X4H A;  3PM1 A;  1TLH B;  4EMS A;  4IHV A;  2CG4 A;  3RKX A;  1YO5 C;  2YR2 A;  3FWE A;  4WXC A;  3K10 A;  4A3F J;  1JJ6 C;  5HDN A;  3GTO J;  1Z1D A;  5FB2 A;  4LOC A;  2BOL A;  3KE2 A;  1K79 A;  2ISY A;  4IVN A;  2MLG A;  3G2B A;  2LD5 A;  4YFX F;  2BVL A;  2DU9 A;  2EFO A;  2FRH A;  2LKP A;  2VJ4 A;  3WHB A;  4RB1 A;  1XS9 A;  3F72 A;  3LSJ A;  4BAC A;  1FYM A;  2M87 A;  1ODD A;  3HZJ A;  5JHU A;  4BJ6 C;  3CCQ I;  2STW A;  2VBX A;  4A93 J;  2DCE A;  2DOE A;  3PQK A;  1WI3 A;  2EIJ H;  2EIL H;  2LC2 A;  2XGE A;  2FBK A;  4P1W A;  2E1M B;  2R5Y A;  1ACI A;  2K9S A;  3BR3 A;  1ZAR A;  1G4D A;  5E1X A;  2QZ8 A;  1I6H J;  4HST A;  2DMP A;  3IH2 A;  1X1P A;  4BHC A;  5K5Q A;  1P92 A;  1Z9C A;  2JQ7 A;  4CXF A;  2KHM A;  1KU9 A;  5B1A H;  3WTY C;  1QPM A;  4ABZ A;  1HC8 A;  3H92 A;  3HOU J;  3DKY A;  4M72 A;  1KZH A;  3JAM K;  1BW6 A;  4HDV A;  2WAQ A;  3BTJ A;  4BQQ A;  1SD4 A;  3LL7 A;  2XPV A;  1V5E A;  4XQF A;  2ZFW A;  4HNV A;  4O3M A;  4M74 A;  1FY7 A;  2W82 A;  2XC7 A;  2HXI A;  5IOY A;  4KJZ A;  1H88 C;  3JTH A;  3A01 A;  2E2H J;  4NB5 A;  1LE8 B;  3D5R C;  4YFK F;  4A5M A;  2OA4 A;  3LSR A;  4UNO A;  4XRS A;  5CVI A;  2Y9Y A;  2WAF A;  4LIU A;  4PJL A;  2GIV A;  4EEF G;  1IJW C;  2L7K A;  3FZV A;  5LHG A;  4L5I A;  4IJA A;  5K7F A;  2GIZ A;  2VC0 A;  1TWF J;  3LAP A;  4FHT A;  5TJJ A;  3CDL A;  2KDO A;  3N4M A;  2V9V A;  4LB6 B;  3R61 A;  2ME6 A;  1E3H A;  4LD5 A;  2DAO A;  4KIC A;  3E1S A;  1YG2 A;  5K1Y A;  3CF2 A;  3E6B A;  4ZZD A;  3I55 I;  4XKB A;  1R71 A;  3CUQ A;  5EG0 B;  2UXN A;  1HQC A;  3VFZ A;  2FE3 A;  1VQN I;  4I09 A;  2LNB A;  2E60 A;  1KQ0 A;  4BXU A;  3IP4 B;  1SMY F;  1W36 D;  1O57 A;  2HDC A;  4FTH A;  2RRE A;  2HEO A;  4OAY A;  1LVK A;  2WAQ N;  1E2X A;  2HNH A;  3TO9 A;  1BC8 C;  3O3K A;  4D1Q A;  2MFZ A;  3KYC B;  4P9F A;  4RDU A;  4MTE A;  1X2N A;  1Z0X A;  3WGI A;  2LRD A;  4L9N A;  3J7A O;  1FP1 D;  1T56 A;  2OZ6 A;  1W1W E;  4BJ5 C;  5HS8 A;  1MZB A;  3QQA A;  4G8X A;  2PMZ N;  4W1U A;  1X1C A;  1RZ4 A;  5KK1 A;  2ZJR F;  2R7S A;  1H9G A;  3JCU C;  2KRH A;  4BEH A;  3ABL H;  2XPU A;  3HOW J;  2F6C A;  2GQQ A;  1S72 I;  2Z9O A;  2YSR A;  2R92 J;  3P5J A;  2FQ3 A;  3KP6 A;  4D0P A;  4G9Y A;  3K70 D;  2X1D A;  5LGN A;  4A69 C;  1HW2 A;  1U5T B;  3JRB A;  1K61 A;  1HKQ A;  4B1R A;  4FE7 A;  2MLK A;  5FLV A;  4WXH A;  4CIC A;  1MND A;  4YRV A;  3CC7 I;  4J00 A;  3GFI A;  1A31 A;  2L7M P;  2KMU A;  1B72 B;  1J59 A;  4HRI A;  5EEA A;  4V2G A;  5D6F A;  1E3P A;  1DUX C;  4BJT A;  2H8W A;  2DA3 A;  2KRC A;  5H6R A;  1J09 A;  4LIV A;  2XRO A;  4RLQ A;  1WSU A;  1K83 J;  2DXI A;  1XMA A;  3DV8 A;  3NAR A;  5HLT A;  1KU3 A;  1OCO H;  1IN8 A;  4P5O A;  2V6C A;  4E7Z A;  2IXS A;  5GAE J;  3LNQ A;  2JA8 J;  2R93 J;  3PUF A;  5ED4 A;  4MQV A;  2MC3 A;  2DPU A;  4EVI A;  3BG3 A;  4XL9 A;  4BNC A;  3T5X A;  3ZMV A;  2DT6 A;  3S2D J;  1LDK B;  2Z2S B;  5E20 A;  1TW2 A;  2G0E A;  1Z6T A;  2X0L A;  5EZG A;  2W00 A;  5L3B A;  3GVA A;  4RBO A;  3C18 A;  4ITV A;  3ASO H;  4U7D A;  3D5L A;  3KP4 A;  4U87 A;  3KX2 A;  2VXZ A;  1WI9 A;  2IBD A;  4S04 A;  2FUG 2;  3MVP A;  3ABK H;  4KT6 A;  3OIO A;  2ICW G;  2EWN A;  3ZCO A;  1BL0 A;  2EIK H;  1UHM A;  1R9T J;  3H3V K;  2OZU A;  2K9M A;  4A3K J;  3VSK A;  3OYN A;  1VQK I;  2XAF A;  4MGR A;  2D5V A;  3BPV A;  2BZT A;  5LGT A;  1HST A;  3L2W A;  3H0D A;  2Q2E A;  4MQ9 F;  3SJM A;  2JSC A;  1OR7 C;  3PNY A;  2CFO A;  3S2W A;  1QO0 D;  2KT0 A;  3I9V 2;  1EF4 A;  2DFH A;  3I59 A;  4RM3 A;  3ZQI A;  3VYU B;  1FSE A;  1BR1 A;  3RTR A;  1IG7 A;  2ID3 A;  3M8E A;  2F5C A;  1WJA A;  3HRU A;  2Y30 A;  2BGC A;  2NVQ J;  3QYF A;  5DCM A;  4ESB A;  3I4M J;  1SMT A;  1ITY A;  3KP2 A;  3DFG A;  3G6E I;  1W0U A;  3D5S C;  1U78 A;  2MSY A;  1J7K A;  2G7H A;  1LEB A;  4GYG A;  3L2R A;  3FM3 A;  3PSI A;  2ZB9 A;  2P5L C;  3JRG A;  5FGM A;  1VND A;  2AS5 F;  4A0Z A;  4AID A;  2XAJ A;  2IS6 A;  3LOC A;  3L00 A;  1QU3 A;  3BR0 A;  4A3I J;  1BM9 A;  4JYK A;  2Z1D A;  2GA2 A;  2HYJ A;  1VQ8 I;  1PDN C;  2JVG A;  4G6T B;  2M0C A;  3HDD A;  2ZSI B;  2DA7 A;  3BQY A;  4OU0 A;  2EQR A;  3BR5 A;  3F23 A;  4UUS B;  2OD5 A;  2ZXH A;  4E7K A;  3DWL E;  2A6T A;  2A3S A;  2O8K A;  1AA7 A;  1TT0 A;  2DQR A;  3GTJ J;  2EIM H;  1NK2 P;  2A5Y B;  4H0E A;  3HRS A;  1R58 A;  3VB2 A;  1T33 A;  2RNJ A;  4DYQ A;  2KJC A;  3CCY A;  3HTS B;  4NDL A;  4U0Y A;  2DYS H;  1K4T A;  4IHY A;  3TDU C;  2V6E A;  3ROU A;  1TQM A;  2VKD A;  5CJ9 A;  5AIP A;  1FYL A;  2KRF A;  1DU0 A;  1S5L C;  1ZN2 A;  3ZGK A;  4L9J A;  1GT0 C;  3OWT A;  3T8R A;  5JR3 A;  2W85 A;  3A1Y A;  1J5Y A;  1IGN A;  2L54 A;  4DIQ A;  2E5N A;  4AVZ A;  5HLI A;  2FSW A;  1ON2 A;  3R60 A;  5FFX A;  3NWT A;  3L09 A;  2IGM A;  1T0F C;  3OYH A;  4Y17 A;  5ILV A;  5J8F A;  2LK2 A;  3TKY A;  3SEZ A;  4ZYE A;  2Q0O A;  1LPQ A;  4FT8 A;  1MBF A;  4KN7 X;  1BC7 C;  1Y0N A;  2RQQ A;  2F5D A;  5F27 A;  2Q1Z B;  4MTD A;  3TP0 A;  2GXB A;  2IT0 A;  1MMS A;  2I5U A;  3IRR A;  2EV5 A;  2LY1 A;  3BTC A;  2CW0 F;  3K0L A;  2CSO A;  2DTZ A;  2JWT A;  3CJN A;  3WU0 A;  3HHG A;  1BR2 A;  2DN0 A;  5CVV A;  1U5T C;  5DCM B;  5M5X J;  3ZQC A;  5E3N A;  1D0Y A;  1JT0 A;  2CU7 A;  3H5R A;  1G3S A;  4V2F A;  2C6Y A;  3M4O J;  1JTX A;  2HOE A;  3I4P A;  2DA6 A;  2XGD A;  3NRV A;  4I7H A;  2GWR A;  5JI6 A;  3KEY A;  3ZMU A;  4RGR A;  4IX7 A;  4AU7 A;  1FTT A;  2CS3 A;  1FX7 A;  2WB1 N;  5H2F C;  1TTY A;  4IPA A;  3GWZ A;  2PQ8 A;  2DW4 A;  2NS0 A;  2STT A;  2Y69 H;  4X6A J;  4RLF A;  1FBQ A;  2E1C A;  4A3D J;  3ZQG A;  2OPT A;  4UVA A;  3ML6 A;  1XN7 A;  1WJC A;  1U5T A;  2CFX A;  2JRM A;  5F1R A;  2XUB A;  4IQJ A;  2KJB A;  4PJN A;  4CA0 A;  2HTJ A;  3T1B A;  2L9V A;  4OMY A;  3AFH A;  1Y6I A;  3RPU A;  5GAG J;  4JOM A;  3OY9 A;  3OSG A;  4XOR A;  3A02 A;  2R5Z A;  2F4I A;  1XSV A;  1DGW Y;  2YX4 A;  2A68 F;  4HLY A;  3DF8 A;  3QAH A;  2HVS A;  3PFY A;  2HQ5 A;  2NVY J;  4HEA 2;  4RM2 A;  2MA3 A;  5HDK A;  5D8L B;  3P9C A;  4HF0 A;  1SFU A;  1S7E A;  4M3E A;  4E7J A;  1A36 A;  3BJO A;  1BA5 A;  1W5C C;  5ERI A;  3A0B C;  4AWX B;  1O3Q A;  3AG3 H;  2KIF A;  3FIW A;  1JGS A;  2MAB A;  4Y33 A;  4U0V A;  4MEX F;  3GTQ J;  1W7P D;  2VPR A;  1YLF A;  1UMQ A;  1YQA A;  1GLN A;  2J5O A;  3TBI A;  2M1B A;  1ZGA A;  3PQJ A;  4PK4 A;  4KIS A;  2DI3 A;  3JRD A;  4DNC A;  1IW7 F;  1JHF A;  3MKY B;  3ZRG A;  2JA7 J;  1V5F A;  3PJR A;  3WE2 A;  4G12 A;  4X1E A;  3M1C A;  5KAI C;  2VKE A;  3VPR A;  4I02 A;  3A01 B;  2P7C B;  3L7W A;  3OYC A;  2B0L A;  3BZC A;  4GDF A;  1TNT A;  4RAG A;  3TW7 A;  3QPT A;  4M6X A;  4D5C A;  2EZL A;  5ILU A;  3SEQ A;  2CQX A;  3ONQ A;  3MKW B;  3HOY J;  5KHD A;  1POG A;  1GV5 A;  4LLL A;  4A3L J;  4G7Z F;  1F4K A;  1P4W A;  3DPU A;  5HOO A;  3CJQ B;  2DJI A;  4A3E J;  1BN5 A;  2KL4 A;  4RMN A;  4UXN A;  1G59 A;  5E3O A;  5JLX A;  2LY2 A;  4I98 B;  1AKH B;  3OYM A;  4E7S A;  4KYW A;  2ID6 A;  4DW6 A;  5FKN A;  1LFB A;  1I50 J;  3OSF A;  1HDD C;  1JTY A;  1JUM A;  2L02 A;  2XAG A;  4DZP A;  3J81 K;  3FBI B;  4FIS A;  3K1M A;  4XOT A;  5GTH C;  3F21 A;  2JUC A;  1YX3 A;  2P7V B;  1QHG A;  2E1N A;  3LFK A;  5IP9 J;  2VOD A;  4XLP F;  5LHI A;  3S3N A;  3T0Y A;  1MMN A;  2WV0 A;  1QNT A;  4YIR X;  5B1B H;  2O61 A;  2K4J A;  2R7F A;  4ZYD A;  2PI0 A;  3S14 J;  5E8I A;  3OV8 A;  4CCK A;  1A35 A;  5L3F A;  1NK3 P;  4HOB A;  2VKH A;  1YIJ I;  3CCU I;  3WTS C;  2VIX A;  2OBP A;  2NAZ A;  4HZF A;  3WTW C;  2J5P A;  3OL3 A;  1TC3 C;  3COA C;  1S29 A;  4U7B A;  1HW5 A;  1M1E B;  1MMA A;  3U1K A;  3IUO A;  2HVQ A;  4OIO F;  2ZCW A;  3GZN B;  3ERM A;  2BHZ A;  2M5W A;  5L3E A;  2EZI A;  2VKV A;  3N05 A;  1B8I A;  2LY9 A;  2Y0M A;  3CP8 A;  1IV6 A;  2Z3Y A;  4DYR A;  2PJP A;  2PMH A;  4XMY A;  1T95 A;  3WTU C;  3K4L A;  2QLZ A;  1ZR2 A;  3HSE A;  2LVS A;  2XRL A;  2QM3 A;  1H8A C;  2O5R A;  4ANJ A;  4FQG A;  4AC0 A;  1NHA A;  4E7L A;  2AQF A;  5BMZ A;  1PUF A;  4AM3 A;  3LSP A;  2NOG A;  3VOD A;  2DMQ A;  2DBB A;  4Q48 A;  3QU3 A;  2LF7 A;  3PO3 J;  2A05 A;  2W25 A;  5J6X A;  2BV6 A;  2YX7 A;  3B6C A;  1FMV A;  3GZ5 A;  1TNS A;  4XLA A;  4CCJ A;  5B5E C;  4CZC A;  3GLL A;  5CYV A;  2W24 A;  4AIK A;  2H8R A;  1PP7 U;  1MKM A;  2BW3 B;  4UV9 A;  3SFI A;  4DBQ A;  3OYA A;  5BS6 A;  1ONV A;  2PEX A;  3AG4 H;  1I27 A;  3BWG A;  4XOP A;  3E6C C;  4EAT A;  3WHC A;  2N8G A;  2DFE A;  2RN7 A;  4HLX A;  1GVD A;  2ELJ A;  4XLF A;  1ZRF A;  5D6E A;  4HW0 A;  1TBX A;  1CGP A;  1R23 A;  4HAM A;  1QBJ A;  1X58 A;  4M9Z A;  4B09 A;  3ZQ7 A;  2ELH A;  2KIQ A;  1LNW A;  1BOA A;  2QKL B;  4JX6 A;  3WTX C;  4A6E A;  1I3A A;  3RQI A;  2OTJ I;  3C2B A;  1X19 A;  2E1M C;  3KYL A;  3K7A J;  3S1R J;  1K4S A;  1MNM C;  1ZH5 A;  4QPO A;  1WFX A;  2K7L A;  1SAU A;  3F3X A;  5F04 A;  3MAJ A;  4LMY A;  5F0C A;  3HUG B;  4C3I J;  1VQO I;  1FTZ A;  1F36 A;  1BI0 A;  5GPC A;  2V1N A;  2TDX A;  3RKY A;  2CV1 A;  5TGT A;  3EUA A;  2VUM J;  2DQL A;  3JRI A;  4JX4 A;  1FT9 A;  3FHN A;  1R5H A;  2MBF A;  1JKR C;  4M9X A;  1ZQ3 P;  2V26 A;  2NRA C;  3GLX A;  2NYX A;  4GYI A;  1HF0 A;  2XSD C;  3HXL A;  1Y1V J;  1WHU A;  4BH9 A;  2ME0 A;  5F1J A;  5DDG A;  4CGZ A;  1W36 C;  2QSH X;  2VPL A;  2ADU A;  5M3M J;  4II3 A;  2OQG A;  4ZTJ A;  1R36 A;  3KZZ A;  1OCR H;  5JLW A;  3EET A;  5TRD A;  2XAH A;  2AO9 A;  3W2V A;  4M6Y A;  4KUM A;  4XRS G;  5ICG A;  3ZN1 A;  4CYC B;  1O3T A;  3C1D A;  3KLO A;  4E70 A;  1T2K A;  1FYK A;  3DQV C;  2DMN A;  2FJ1 A;  2R7R A;  2RNG A;  3GCM A;  2CV2 A;  2O7O A;  3L2C A;  3ZQQ A;  2M45 A;  2XPW A;  4PJJ A;  2ZJQ F;  2ZME C;  3PUB A;  2LF8 A;  3BR6 A;  3HL2 A;  1G2H A;  1OCP A;  4NUB A;  1IAW A;  3CJR B;  3LQQ A;  3IAS 2;  3E6D A;  1LKX A;  1VQ5 I;  2HYF A;  2PMZ A;  3MMY B;  4ZDP A;  2L2O A;  1I1G A;  3HSF A;  4N0B A;  1DPR A;  4HX4 A;  2HQA A;  4NNJ A;  5K5R A;  1MSF C;  3GFL A;  2CQ7 A;  3HOV J;  1KON A;  3TQN A;  3MFK A;  2QA4 I;  4L5E A;  4IRI A;  2LDU A;  2HOS A;  4B8X A;  2R7V A;  4I99 C;  1T38 A;  1XGN A;  4YEL A;  3ABM H;  3JSO A;  4C30 A;  2DPD A;  2XF5 A;  4KDP A;  3CMA I;  2R7W A;  1VI0 A;  2PBI A;  1AWC A;  3LA7 A;  5KAF C;  3HYI A;  2WA0 A;  3FXJ A;  2A07 F;  1YRN B;  2ZBK A;  2QUF A;  1BIB A;  2HDW A;  4D7N A;  4XIC A;  1D0X A;  3JW4 A;  2F5V A;  3L2U A;  2K86 A;  2RV8 A;  1H89 C;  5D8K B;  2IS2 A;  4NC7 A;  3GFJ A;  3IL2 A;  2DDB A;  5IP7 J;  2FOK A;  2BVM A;  3K1N A;  1SVL A;  4IHS A;  3LMM A;  4PGH A;  1RNL A;  1A5J A;  1FOW A;  5KCM A;  4I0B A;  4YII A;  3IWF A;  1B1B A;  1Y39 A;  2X6Y A;  1K7A A;  1N75 A;  5FRO A;  4KIT B;  1Z21 A;  5B3S H;  1ZRD A;  2QF7 A;  2CRG A;  2M7A A;  3LST A;  2PJR A;  4UVC A;  2D2W A;  3MKZ A;  2HOA A;  4I6Z A;  1UEL B;  2VXD A;  1WVR A;  3BTL A;  4KIF A;  2IAI A;  1YI2 I;  3MD2 A;  4X0G A;  4XKV A;  2G7U A;  2LOO A;  2ZC2 A;  5CVR A;  1B4A A;  1G3W A;  1IUY A;  3Q5F A;  1L0O C;  1B8I B;  2RC4 A;  1UHW A;  2P5K A;  1UZC A;  4J19 A;  1MH3 A;  5E1W A;  3CCV I;  3VOE A;  6PAX A;  2HPI A;  3BQZ A;  2Y0S N;  4ENK A;  2JK3 A;  5J40 A;  4IHT A;  2HXO A;  2CYY A;  2MG4 A;  2DYR H;  2VE8 A;  1MSE C;  2RAE A;  2CW7 A;  2H94 A;  2BXZ A;  2YU3 A;  3N97 A;  1OIS A;  1ZG3 A;  2Y75 A;  3K4J A;  5HNF A;  2BY1 A;  3FDY A;  2X1E A;  1T08 B;  3SDB A;  3C7J A;  3ULQ B;  2ZFU A;  5FD5 A;  4BL0 B;  1QRY A;  3SZP A;  4AUX A;  3W3C A;  2HPM A;  3KEO A;  3RQ4 A;  1W7P B;  4BQO A;  4EQQ A;  1LEA A;  1FOK A;  1X3U A;  2OV7 A;  1USS A;  1X1A A;  3DLA A;  5AIQ A;  3MKL A;  3GUD A;  4ZDL A;  1ETX A;  4TV7 A;  2VT3 A;  4WF2 A;  3GYH X;  2M2E A;  1ZLK A;  4NHJ A;  3Q9V A;  2V1X A;  3TP3 A;  4ZJZ A;  1OKR A;  1TL8 A;  1R00 A;  4CDG A;  3H9Q A;  1G3Y A;  5HVQ C;  1Z3Y A;  1FPQ A;  3OMY A;  1RR8 C;  3GO5 A;  2X9D A;  1IXS B;  3ZMZ A;  2IGN A;  2L3D A;  1RI7 A;  2HZD A;  1CF7 B;  1MBG A;  2B63 J;  1YW9 A;  3SQN A;  1MBE A;  5FLX K;  1WJF A;  2FF4 A;  4CUG A;  4GCV A;  2ACJ A;  1HDP A;  2IJL A;  1XD7 A;  5HNH A;  5C44 J;  3HOS A;  2YPR A;  2EFP A;  1QA6 A;  2L7Z A;  1IF1 A;  1YIO A;  2BHY A;  3FK7 A;  1U3E M;  3LA3 A;  3GTK J;  3GX4 X;  2Z5U A;  5FKO A;  2A6E F;  3P9K A;  4G7O F;  5JHF A;  4MLO A;  2CW8 A;  2XIG A;  3K1P A;  2E5Z A;  3HTU A;  4MFE A;  3CUQ C;  4Z6Y A;  5DTD A;  1FNN A;  1U6G A;  5E79 C;  2M7B A;  2ZJP F;  3K69 A;  2OCC H;  3DBL B;  2CMP A;  3FKJ A;  4PDK A;  3TO6 A;  4XBF A;  4B47 A;  5FRM A;  2V9P A;  5J47 A;  1I1S A;  4QIW N;  5B66 C;  1I6X A;  1PVE A;  4A3J J;  2CV0 A;  1P4A A;  1I39 A;  2O03 A;  4MIM A;  5A2Q K;  2WTE A;  4RS8 A;  2XGX A;  3PNT A;  2H1L A;  2WY8 Q;  2P8T A;  4II2 A;  4LJZ F;  2MD0 A;  2UZK A;  2XV4 S;  2W1O A;  3FXM A;  2V1D A;  4DOZ A;  1RR7 A;  4CCM A;  1VZ0 A;  1X1B A;  1Z6R A;  3U2R A;  1BI1 A;  3DP7 A;  3TOB A;  2HYG D;  1A04 A;  3S1N J;  4BAY A;  3R6S A;  1D5Y A;  3A03 A;  3K4M A;  5D4S A;  4IZZ A;  4G6Q A;  1J9I A;  4N9H A;  1Z05 A;  2EFN A;  3I0T A;  4RB2 C;  3QYB A;  4EJO A;  1WZ2 A;  2ZSH B;  3J7Z I;  3S3O A;  2PJR B;  1OMI A;  2P4W A;  5EDN A;  3GW2 A;  4OWR B;  1SD6 A;  2EFW A;  3J80 K;  4PFO A;  3K4N A;  2VQL A;  3QPL A;  3FXO A;  5HOD A;  4CYC A;  4EM1 A;  2PLY A;  2H6C A;  3U9G A;  4MNU A;  2QBY A;  3F8B A;  4AD9 A;  3G1O A;  2HZT A;  3HRT A;  3KEQ A;  5J1R A;  3CD6 I;  2F5E A;  1SD5 A;  3BR1 A;  3HRM A;  3CLQ A;  3IV5 A;  3WTV C;  5E3M A;  3TMO A;  1FWZ A;  2XAU A;  1Z7L A;  2B7E A;  4QPQ A;  4J01 A;  2XF6 A;  3OS1 A;  3AG1 H;  3RPQ A;  3SHF A;  1KU7 A;  2GZW A;  1YJN I;  1NG6 A;  1XTA A;  3L9F A;  3F22 A;  2LRE A;  2NVU B;  1ERD A;  2K5C A;  1SFK A;  2OAZ A;  4BXF A;  4EV0 A;  5CPR B;  1JHH A;  3DEU A;  3HPH A;  1U0J A;  2K3F A;  2X1C A;  1MJB A;  4L18 B;  5ICC A;  3IKT A;  2M30 A;  3CMM A;  3E7L A;  3OOP A;  5J4V A;  5E1Z B;  4N9I A;  2DLL A;  3BCB A;  3CUQ B;  3G73 A;  4E4H A;  2E35 A;  2DK8 A;  1Y0U A;  4G6D A;  1R7J A;  4HF2 A;  3I59 B;  5GTI C;  3ZQL A;  2BW3 A;  3DTK A;  1B72 A;  2FXA A;  2VQH A;  2Q8K A;  1OYW A;  2CQN A;  2WBM A;  1OJL A;  2QGU A;  1P7J A;  4O6J A;  4JP0 A;  1GXP A; 
#chains in the Genus database with same CATH homology
 1YJW I;  2E34 A;  3G4S I;  1VQM I;  1YI2 I;  1VQN I;  2NXN B;  2OTJ I;  1VQ9 I;  2JQ7 A;  5DM7 F;  3CMA I;  1VQ4 I;  1FOW A;  3CJT B;  2K3F A;  2ZJQ F;  1HC8 A;  1S72 I;  1FOY A;  2H8W A;  3CC4 I;  4IOC F;  5GAH J;  2ZJP F;  3CCL I;  3J7Y J;  3CCR I;  1Y39 A;  3PIO F;  1VQ7 I;  3CC2 I;  1YIT I;  1VQ5 I;  3CCQ I;  1YHQ I;  4V19 K;  3PIP F;  2FOW A;  3CD6 I;  5GAD J;  3CCV I;  2E35 A;  5GAE J;  3I56 I;  3DLL F;  3G71 I;  3CCJ I;  1VQO I;  3CCE I;  1QA6 A;  5DM6 F;  4IO9 F;  1MMS A;  1YIJ I;  3CCU I;  5GAG J;  3CME I;  3CCS I;  2E36 A;  3CF5 F;  1YJ9 I;  1VQL I;  4UY8 I;  1ACI A;  1FOX A;  1VQK I;  3I55 I;  4IOA F;  2QA4 I;  1YJN I;  3J7Z I;  5JVG F;  1VQ8 I;  3CC7 I;  2OTL I;  3G6E I;  1VQ6 I;  3CCM I;  1VQP I;  2ZJR F;  2QEX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...