3CCVI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccvI00
1VQ6I 3I55I 2QEXI 3CMEI 2JQ7A 1FOWA 1VQPI 2OTLI 4UY8I 2NXNB 2E34A 3CCLI 1FOXA 1VQNI 3J7ZI 3CCRI 5DM6F 3CCMI 5GAHJ 2ZJQF 3DLLF 5JVGF 1YJWI 3PIOF 1YJ9I 4V19K 3G71I 2QA4I 3I56I 3CMAI 4IO9F 3CD6I 5GAGJ 5DM7F 3G4SI 2K3FA 1YHQI 3CCQI 1VQMI 5GAEJ 3CCVI 2ZJRF 3CC4I 1ACIA 2ZJPF 2OTJI 1YJNI 3CC2I 1VQ8I 3CJTB 1VQOI 3PIPF 1YIJI 3J7YJ 1VQKI 5GADJ 1FOYA 3CF5F 1VQ7I 1VQ9I 3CCEI 1QA6A 3CCUI 1S72I 3G6EI 2E36A 4IOAF 1MMSA 4IOCF 1Y39A 2E35A 3CCSI 1VQ4I 1YI2I 1VQLI 1HC8A 2H8WA 3CCJI 1VQ5I 3CC7I 2FOWA 1YITI
chains in the Genus database with same CATH superfamily
1BOBA 4A3EJ 3VSKA 1AOYA 3IAS2 3RQIA 3K6GA 2LTPA 5BQTA 5HNFA 1MJAA 5E79C 4N4OB 2RAEA 2DK5A 1ONVA 2L7FP 3R0AA 3MZ8A 1OQYA 2M1BA 4F7ZA 1YFHA 3A2KA 5J1UA 2K9LA 5JI6A 3CESA 1T98A 4PK4A 2XASA 1QHGA 4Y13A 2M3AA 1IAWA 4GCVA 4P96A 4L18B 1G3WA 1YRNB 4KISA 4HG2A 4ESJA 1B4AA 1ZREA 1BBYA 3CCRI 2YUSA 4RB3C 4ENNA 4HBLA 5TRDA 1SFOJ 3HOWJ 4FE4A 2VT3A 1A04A 2J5PA 1H9TA 2CMPA 4MEYF 2XAUA 1DP7P 2HYJA 5DD8A 2BVLA 2QA4I 3GO5A 2DA3A 4MO7A 1WI9A 2DDAA 4V2FA 3S32A 1O57A 3TOBA 3C2BA 2E60A 2MH2A 1IZ1A 3BTIA 2CO5A 2P4WA 3RPUA 4HPQA 5D6FA 4LG0A 3DTKA 3A4CA 3TW7A 2XAFA 3FXQA 2QWWA 4G6TB 3SYTA 1NK2P 1Z6RA 2LY9A 4C9YA 4YEJA 3E1SA 5EJCA 2X1EA 3WGHA 4WXHA 2MD5A 4CO8A 1IXRC 3W6VA 2IA0A 2FU4A 3NRVA 3GTGJ 3GFLA 2ISZA 2M4GA 2FE3A 2XGEA 3CJTB 3K70D 2BVMA 3IH4A 2OAZA 2ZC2A 4OU0A 4KN7X 3RKYA 3V8LA 4YIRX 3KIOA 5FJ8J 1TLHB 5LHGA 3OIPA 3MZYA 4K2EA 3GTMJ 2H1KA 3V7RA 3HRMA 3JSPA 4W1UA 1HW5A 5K7HA 1XMXA 2VKDA 3I54A 3DU6A 2KIMA 1VZ0A 2W00A 4U0VA 3G6EI 2O6GE 4Q5SF 4RB1A 4MIMA 4UNOA 1TQPA 2ZNZA 3ZXSA 1MJ9A 3E6CC 3VDXA 3PJRA 2HNHA 2OPTA 1P7IA 3M1CA 2XPUA 2VC1A 1LEBA 2EZLA 1U9OA 1B72A 3I4PA 1XSDA 1BJZA 4A3KJ 4JP0A 3DFGA 4IL6C 2GLOA 5M5YJ 4HDUA 2IRFG 2L02A 4HF0A 2X6XA 4E7HA 1ETQA 5E3OA 2FEZA 3CMEI 1WJBA 3CCYA 1M1EB 4XLHA 3FM5A 2LH9A 3ZR8X 3S1RJ 5JHUA 1U3EM 4EMSA 2ZBKA 3BPVA 3H5NA 4U7BA 3EUKL 3I4MJ 1YW8A 2Z16A 3CCLI 5EF6A 2E19A 4KIFA 4BBRJ 5HLHA 2M9HA 3OMYA 2V9VA 3PFYA 2Q8KA 2GOMA 1P4WA 4X0GA 3K4KA 3QYFA 2FQ4A 2K86A 4IXAA 3H0GJ 1TC3C 3HSFA 2HQRA 3SDBA 5DS9A 3HSRA 5JFRA 4PJ0C 3IAM2 4LLNA 2DBBA 2P8TA 1Z9CA 4YIIA 2EB7A 4CYDA 2JRTA 1XB4A 4FISA 4EJVA 2K9SA 4QPQA 1QGPA 3HOXJ 3AL0B 1BR1A 1LB2A 3VPRA 2RDPA 3ZQLA 2E7XA 3OYAA 4BQOA 1YYVA 2HZDA 2Q2EA 4EM1A 1X1AA 4XSXF 2VC0A 4B3AA 1YRNA 1O3TA 1LDKB 1IF1A 1UFMA 2F2EA 4A3CJ 5TGTA 3HUGA 2A69F 2R7XA 3JW4A 3WODF 2G7HA 3I71A 2YS9A 1K79A 3U21A 4ZZDA 5D5WB 4HDVA 1V5GA 4AYBA 2Z1DA 3AL0C 1A6IA 1ZG5A 3D0SA 2ADUA 2OZ6A 2EFPA 3H3ZA 4C3JJ 2E1CA 4CZZA 3BTLA 2EZKA 1K83J 2FQ3A 2ZKZA 3BCAA 4RGSA 3AAFA 1HOMA 5GTIC 3CF5F 2LF8A 4LGWA 4KT5C 3KP7A 1X2MA 1KYWA 1TT0A 1MSEC 2DODA 1IRGA 1HSTA 3W3CA 2O5RA 3GZNB 2CW8A 5EYRA 1ZAOA 2E36A 5H20A 5FB2A 4UHTA 2Z3YA 4DQ2A 3PSFA 3HEFA 3L2QA 1E3OC 1Y0NA 3MKZA 1VNDA 4DOZA 1VQLI 4A0XA 4RAFA 2UV1A 3WTZA 2JUGA 2CJJA 4BUPA 1T6SA 3BDDA 1NG6A 2JA8J 1G3SA 1VQ5I 3FBIB 3OYHA 3LAPA 2B0LA 4HF1A 2M7AA 3FXJA 1FPQA 5JLXA 4ZYDA 1S7EA 3ABMH 4YELA 1KQ8A 1FOKA 5AIQA 1YX3A 1O3RA 2LNBA 1FOWA 2IXSA 1JUSA 1VQPI 1XTAA 1RNLA 2M2EA 2WV1A 3KYDB 2V9PA 3BR5A 3JRIA 2R5YB 2E1MB 3S16J 4LB6B 2V9KA 1W36D 1FOXA 1TQIA 1RR7A 1BW5A 1J09A 1R49A 2OV7A 2DI3A 5BOXA 3BOQA 2RQPA 1E0EA 4HA8A 1WWXA 3ZP5A 2DA6A 2DOEA 3BROA 1AA7A 3DPTA 3FXUA 4MLOA 4BS9A 2HS5A 2L54A 5E8GA 1UG2A 5TISC 3KLNA 4IO9F 2LRDA 2QUFA 2K40A 5KHDA 4I98B 1WJDA 6PAXA 5J6XA 2PI0A 4A3FJ 2BY1A 5FLVA 4J00A 1OCTC 2ETHA 1FZPB 4AM3A 2DDBA 1OLTA 1W7PD 1YQAA 2L4MA 3LAJA 1I27A 1N25A 3WU2C 3OSFA 3AG2H 3NARA 1T39A 3JSOA 2R4GA 2UZKA 5DDGA 4WWCA 1S9HA 2LR8A 2O8XA 3DP7A 4R8HA 3CZ6A 1W5TA 4RB0A 3OOPA 4P9FA 2E2HJ 2XIGA 3TMOA 3CC2I 3SZPA 5D4RA 4U7DA 1FYMA 2DFEA 1JUPA 1R1VA 2IA1A 3K4MA 1JT0A 3DKYA 4HX8A 2Z9OA 1X58A 3X2QH 4D7NA 4BL0B 5B66C 1VQKI 3GTQJ 4YFKF 1P4XA 1T0FC 1I3QJ 4OMZA 3K4CA 2X48A 3HL2A 2FBKA 2P5KA 1GV5A 3M1EA 2VBYA 3BR0A 3FMSA 3MFKA 4H4KC 1S72I 1KU9A 4M6VA 5CVIA 2Z2SB 3P7NA 1XGOA 2F48A 4PDKA 4L5JA 3S2WA 1TNSA 2GZWA 3FMQA 5E3LA 4XQFA 2V1UA 2NNYA 3ZGKA 2VQGA 1MNMC 1Z7LA 3H9QA 5LFAA 2E5NA 4J19A 1Z7UA 1IGNA 2K9QA 4B8XA 1Y1VJ 3HRSA 2H27A 3CCJI 2KJCA 1LPQA 2V6CA 1YS7A 1STZA 2Y0SA 4DBRA 1YITI 1ZG1A 1WZ2A 4II3A 4CCOA 5LHIA 2MG4A 1HW2A 3S1QJ 1T56A 3WHCA 1OYIA 3TP3A 4EATA 4A3LJ 2F5FA 3VWBA 2WBMA 4FQGA 3PNVA 1FTZA 3F8FA 2JQ7A 2JA7J 3OR1C 3GF2A 2FF4A 3WE2A 1R23A 1W7PB 2LP0A 4O5VA 4AIDA 2ZCWA 1D5VA 2DA2A 4P9UA 2OTLI 1FLIA 1OCCH 2H6CA 4M6YA 5FRNA 3GTLJ 4ZYEA 2GXGA 2VQLA 2EFWA 2A5WA 1WJCA 3LFKA 3IRQA 1USTA 3FWEA 4D0PA 1X2NA 2ECBA 4UXNA 5EZGA 5DM6F 1F43A 2COBA 1FX7A 3TO9A 1PUFA 3C3WA 1DGWY 3EETA 2FNPA 5BPDA 4A5MA 1Z0XA 2A61A 3ISPA 3JAMZ 3O2PE 4AWXB 1U8BA 3ZMSA 1IC8A 1QPMA 2BV6A 2VJ5A 5H6QA 3G73A 3O8HA 4IX7A 4WK8F 4E7JA 2VXDA 1X1PA 3E97A 4OIRF 5J47A 3ZN1A 4EJWA 4BY1J 4BJ5C 3F6OA 2DK8A 3GFJA 4Z2YA 4RBOA 3KYLA 1PP8F 3FM3A 2E2IJ 1QU3A 1DPUA 3CCVI 3ABLH 2Y69H 1FY7A 2VBXA 2XGCA 4QSHA 2VKHA 2NS7A 2KISA 2R7VA 1QBJA 1OJLA 2LBFA 1MBGA 3B02A 3VB2A 3G1LA 4P5OA 1YJNI 1H9GA 3MVPA 4IF4A 4NDLA 1X3ZB 2E71A 3HB9A 2BHZA 1JJ8C 1ZRCA 3FDYA 5IP9J 1FYLA 2PJRA 3L00A 1T0FA 3I5UA 1G2HA 2OUMA 4XRSA 3ABKH 4OAYA 3S8PA 1ZRDA 3M3YJ 3K4JA 3S1MJ 1Q1VA 2PMHA 1P2FA 5B5EC 1ETVA 5K7ZA 1FNNA 1ZARA 3HKZN 1RR8C 4CCKA 1Z05A 2KLOA 1ERDA 2KQRA 4I02A 2BEOA 2MABA 1FBUA 4JX5A 4KUMA 5C3EJ 1Y39A 3W2AA 2WWYA 2PMZN 3HBLA 4W97A 5KK1A 2PFBA 4A3JJ 3QPTA 2IGMA 3F3XA 4HW0A 4F55A 4RAZA 4B48A 2EPFA 4JOMA 1EKEA 4HNVA 2OBPA 5E1XA 4E6KG 3K1MA 3CP8A 2QCOA 1MBKA 3RPUD 2HPMA 1QVUA 3HOSA 3BY6A 2MC3A 2VKVA 1QRYA 4GYGA 5HOOA 3NWSA 4EM0B 2ME6A 4B43A 1QQIA 2FMYA 1ZN2A 3OIQA 3RKQA 3FF5A 1BW6A 3OSGA 1IDZA 3KP6A 4UY8I 5F0HA 1ZYRF 1ZGWA 4NHJA 3NAUA 5ICEA 2F5VA 4I2OA 1RZ4A 5CVVA 3LSIA 3NQOA 2X6OA 4HNUA 4XONA 1OPCA 1UMQA 4L5IA 2XSJC 3IH3A 3F0CA 1UCRA 1ULYA 3DLAA 2CWEA 3DTIA 2XF7A 1XDSA 2JVHA 5E3MA 2R93J 1Z3YA 1YJ9I 2BE5F 2O3FA 4PFPA 5FROA 3LA3A 3SJMA 5F64A 1E3PA 5H6RA 3CD6I 2QKMB 3DEWA 3QPLA 4RGXA 1DU6A 1DGRM 2XUBA 5BNGA 3K4LA 3HGGA 3PL8A 4Y52J 1WJEA 1W1WE 3TEDA 1I6XA 1HLVA 3S2HJ 4L0ZB 4RLFA 4DNCA 2LF7A 2NVUB 2LDUA 5FKMA 1J7KA 3DEEA 2Y31A 3HC7A 4MQ9F 5J4VA 4BQAA 1ACIA 2OQRA 3KZIC 1MDMB 5EEAA 4E7ZA 2JT1A 3HOTA 1X3WB 2P7VB 4AIKA 1VQ8I 2DMUA 3HOUJ 4AVPA 2XVCA 3RKWA 2VASA 3VYRB 4F93B 1VQOI 4G94A 5CVJA 4EEFG 5K5OA 5GTHC 2HDCA 1GXQA 3RZDJ 2IAIA 4BJ6C 2NS8A 1P9QC 1A35A 1R22A 5HS8A 3Q0UA 4KIGA 5IYCJ 3QU6A 2JA5J 4D9JA 1YX5A 1APLC 4M9ZA 1MNEA 2CUFA 2LY1A 3AG4H 2RNJA 1SFEA 1K78A 3KP4A 2HDDA 2EK5A 2YU9J 1ETYA 1JKOC 4IOAF 1Y8RB 3WE3A 2L7ZA 3SHFA 2JVGA 2AQEA 1WI3A 1XGSA 1X1CA 1WJ5A 1L0OC 1IUYA 4KIBA 1O4XA 4ZYGA 3R4KA 2HGCA 4DYRA 4KJZA 2KP6A 3E5UA 2EZHA 1DP3A 2DJIA 2HPIA 2ZJ2A 3C18A 3DTEA 1ITYA 4F52A 5BS6A 2VB6A 2ZFUA 1XD7A 2R7FA 1R9TJ 1ZGAA 3I0TA 4L5EA 3RYRA 2AXTC 2XB5A 1YS6A 3FBNB 5A2QK 4Q47A 1W0UA 5IT9K 2HOEA 3QAHA 4RGRA 9ANTA 2O9LA 3ZMVA 4HF2A 2BW3B 2ZXJA 2VOPA 4C2MJ 3F23A 3RZOJ 1JI8A 3KP5A 2NXNB 2HOSA 1JKQC 3ZOBA 1QPIA 4BE1A 3TQNA 1JUMA 2HQAA 1OYWA 4A12A 4MFDA 1O7FA 3Q9SA 4CYCA 1Q1HA 1IN5A 1BN5A 2M34A 4PSWA 5K1YA 1S7OA 2OC6A 2ZJQF 3H9GA 1SAXA 2IS6A 1XMAA 2CUZA 2VN2A 1OCRH 2H1LA 3V8KA 1R5GA 1KYZA 1WPKA 2EIKH 4QPOA 3HYIA 3G71I 3I56I 1MSFC 3BLYA 4LFUA 3SZGA 2M8EA 3CUQC 3BTJA 4XIDA 4BDYA 2XRNA 2CG4A 1I3AA 2GAUA 2LVSA 3RSNA 4XICA 3HGYA 2ELKA 1ETKA 2CV2A 2TRTA 1IG7A 4ESFA 3OS1A 3CMYA 1XG1A 3P9IA 4A69C 1U2WA 1BIBA 1PYVA 2N8GA 3J7AY 2HR3A 3DKWA 2XAQA 1TWCJ 2DU9A 1JJ6C 2KL4A 3DV8A 1R1UA 2HVRA 2XRLA 4YRVA 2KZGA 1NHAA 2K4BA 3LSHA 5EEGA 3HRUA 4G12A 1DUXC 1WRJA 2M30A 2PN6A 1FP2A 3Q0VA 5GADJ 5CVUA 3GTJJ 3S3NA 4N9IA 4CCMA 2V6EA 4OIPF 3ESWB 2A05A 2LK2A 5D8KB 3CTAA 4AIHA 1J5YA 3WGGA 1RESA 1VQ9I 2GXBA 2DTZA 2EFQA 4JK1X 1D8JA 3T1BA 4HV5A 3FMRA 1IUFA 4A0ZA 4IHYA 3OYBA 5HDNA 1AKHA 3JRAA 2M8GX 2DQLA 3PQKA 2CQNA 3WU0A 5DCMB 1IN7A 3HM5A 1IN4A 1ETOA 4NB5A 1T8IA 1HC8A 2CV1A 4BEHB 3F9KA 1Z6TA 3ABUA 2D2WA 2XAJA 2GWRA 2OTJI 4A93J 4BY7J 5JLWA 5D4SA 3KZYA 5FFZA 2PBIA 3ROUA 1VQ6I 4L9TA 2R7UA 4HQEA 2PLYA 3U1KA 2BXYA 3PO2J 2W57A 3L2UA 3HRTA 5IPAA 2NVTJ 2EJRA 2L5QA 5FD5A 1YIOA 3KZZA 4RB2C 1FWZA 1IRXA 1SD6A 2IJLA 2EFOA 1QZYA 3LA7A 2XKOA 2DMTA 1KU3A 3RQ4A 3RYPA 1PVEA 1WHUA 5E8IA 2FNAA 4A6EA 5M5XJ 4UUSB 1MMAA 2EA4A 2VL8A 3V7SA 5IP6A 3KETA 4KN4X 1HKQA 5D5UB 4OOIA 4V2GA 1H88C 3U2RA 5F0CA 2DFIA 1RIOH 4IQJA 3M7GA 3LSRA 4CZCA 3JRFA 3IH2A 4PGGA 5JVTA 1ZELA 3BR1A 1FMWA 3EPZA 4NC7A 2KIUA 4E4HA 3PUFA 1USSA 2R5ZB 1GXPA 4ESBA 3S1NJ 5BPIA 3OL3A 3CUQA 2VXZA 5GAGJ 1B59A 5DM7F 2O61A 2F5DA 1B9MA 4E7LA 3N05A 2LREA 2OZUA 2XPVA 1BR4A 4N0BA 5F6FA 3J7AO 3AG1H 4M6XA 2BYVE 3L2WA 3PUBA 1B8IA 3IRRA 3FISA 2NOJB 1A31A 3ZQGA 2W7NA 3ERED 1HF0A 1X1BA 1R36A 2X1DA 1J59A 1R1TA 2W48A 1WQ2A 3RIRA 3ZMUA 3WGIA 3H36A 3E7LA 1D5YA 4D7MA 1MGTA 4A3MJ 1SFXA 2E7WA 3L2CA 1GV2A 3PIPF 3J7YJ 1HQCA 3BR3A 1YTYA 4EJTA 5EG0B 5B3SH 1U8RA 1UG0A 3NEUA 2XGXA 5FKNA 5KAIC 1DPRA 2VJIA 3Q0WA 3BC8A 3CCUI 2NVXJ 3A0BC 2STWA 3FXOA 2LKPA 3IP4B 5IYBJ 3H35A 4KA4A 2PG4A 4OAZA 2W85A 1EH7A 5EZHA 3VSLA 4U0WA 1VQ4I 2X0LA 4XLNF 4BAYA 2VQCA 2HFHA 2ESHA 2P6TA 3ZQFA 4I0AA 1T08B 4M3GA 2IPQX 3GXOA 3LSPA 3T0YA 3JRBA 3BP8A 2Z33A 2GM4A 2Y30A 1Z1DA 4HZFA 3ZMZA 1WH5A 5CYVA 2EH3A 2Y75A 1SAUA 1MMNA 3LMMA 5KCMA 1YW9A 1V54H 5CKTA 4BHPA 4DGWB 1TBXA 3BCBA 1ZRFA 3ZQQA 2ZB9A 2ZNYA 4G7OF 2HZTA 3G1OA 3DPLC 4ZTFA 2JPCA 3QP6A 3OWTA 1FC3A 2WY8Q 3FX3A 1GLNA 3BG3A 3N4MA 3DPUA 3ZCOA 2XC7A 2JTVA 4HSTA 2MFZA 4XLCA 3GTKJ 5JVGF 2COMA 3HPGA 4BYYA 3LOCA 4A3IJ 1POGA 1JTXA 4IJAA 4UV9A 5LGNA 4C3HJ 2L9NA 2DW4A 4WXDA 3TO6A 3D1NI 5M3MJ 3CLQA 2XSDC 1RPWA 2DMPA 1OCPA 2JUCA 4B3XA 2L2OA 3LSJA 4R79A 4IZZA 3OYMA 1RUNA 5GAEJ 4KDPA 3T8RA 2PQ8A 4L9VA 3L2RA 3G1MA 4ENKA 2BHYA 3VYSB 2V1DA 2DAOA 1KZHA 1MW7A 2XROA 1XX5A 3GZ5A 3W6JB 2ID6A 2O0YA 4YIFA 5LRRA 3MMYB 2QBYB 4EV0A 2NVYJ 1WJAA 4XM3A 1LDJA 1WJFA 2FXAA 2MSYA 1YIJI 2XHKA 2DO7A 2B63J 2E1MC 3EQLF 2FBHA 2P5LC 1K4TA 3O8GA 2A68F 2W25A 2KIQA 1A5JA 5KNLA 2WB1A 1HXDA 3WHBA 1HA8A 4RGUA 4BGDA 3F21A 1CQTA 5FO5A 4A0YA 2BY3A 2CW0F 1MNDA 2YPRA 2DMNA 2KZVA 3AG3H 2R7QA 1U5TB 2DTRA 3JTHA 1D0YA 1FTTA 2JPBA 5ICGA 3MD2A 3F6VA 4ZH4F 1IXCA 4FT8A 1CF7B 1WFXA 1EH6A 1LE8B 2FOWA 2YU3A 2YX7A 1SEUA 1GVJA 1MBFA 3FK6A 3OYKA 1OYYA 2CGPA 2MLKA 1MIJA 1Z91A 1G3YA 3U9GA 1JHHA 3K9TA 1A6QA 3GYHX 2KDZA 3M8EA 4ZYHA 4R1HA 4DYQA 5L3EA 4FHTA 4ITVA 3PO3J 4XLAA 1J75A 1R7JA 4CCLA 2NVQJ 4MTEA 1S29A 1LFUP 1W5SA 2IP2A 1TWAJ 1FIPA 2NOGA 1OCZH 1GUUA 5CVRA 1Y6IA 3CCMI 3JR9A 5BMZA 2DOFA 1SFKA 3CLOA 2EV5A 4S05A 4ENMA 3WTYC 2HTSA 2WAQN 1LFPA 4HV6A 1J2XA 2ELJA 4EGYA 4V19K 2DQRA 2B7EA 3F8NA 2Y9ZA 1W36C 3OYJA 4AVZA 4PGHA 4JX6A 5CLSA 2GA2A 4RM2A 3C2GA 3DXJF 5DCFA 2YSRA 3A01B 3OS0A 4FTHA 3W6KB 4A2UA 3HDDA 4KNYA 1Z77A 2K85A 1TTYA 3F8BA 4HSRA 1ZGJA 3V4GA 4C3IJ 4XRFA 1IRFA 5ED4A 3T5XA 3H3UA 4XK4A 3IKTA 2FRHA 4BU2A 1JGSA 1FYKA 3F72A 1XMKA 5TJJA 3GUDA 4FCYA 3KEOA 4XLPF 3VEPA 3ZPLA 1D1CA 4LK1F 1LNWA 2H94A 2ZSIB 1OFCX 2CFOA 1OKRA 3PNTA 5CQGA 3EDPA 1D3YA 2XV4S 2EINH 4HLYA 5GPCA 4J01A 4MGRA 2QSFX 4G7ZF 3LSKA 1B6AA 2R5YA 2RV8A 1O3QA 1PP7U 1TNTA 4F92B 1HW1A 4OIQF 1ZKGA 3HOVJ 3A1YA 4M3BA 2Q1ZB 2FA5A 5K7FA 5CJ9A 4FETA 3FXRA 3D5RC 3IHUA 1QZZA 4BE0A 2DPDA 1FEXA 4X1EA 1KQ9A 3RTRA 2Y48A 5HLGA 5JHFA 5A2QZ 2H8WA 5IP7J 5LD2C 2QQBA 1FBQA 4UB6C 5IT9Z 3W2VA 3EYYA 3QQAA 2X85A 3KE2A 2HOAA 4U87A 5HNHA 4I99C 1Y56A 2LYCA 3N97A 1KA8A 3GCMA 3CQZJ 1SFUA 3IWFA 2R7TA 1FBSA 3A0HC 4C30A 1YG2A 3ABTA 3K1NA 4NQWB 4ANJA 1SC7A 1TW3A 3HHHA 5L3CA 4DBQA 2VODA 1XCBA 2K5CA 2BZTA 2JA2A 3OYNA 1PUEE 1IO2A 3IKVA 2P6SA 3LQQA 3PNYA 4XRMA 2VI6A 1W4MA 1HKTA 1DU0A 4XR6A 1P92A 4HX7A 5ILVA 3V42A 2M4KA 2QZ8A 4CXFA 3QRFF 2IS4A 2OJED 5E18F 4UB8C 3NWTA 2WV0A 4MEXF 1BL0A 4EJUA 2LFBA 1BI3A 3ZQHA 2OCCH 2A6EF 4M3FA 3SFZA 4LD5A 2W84A 4AU7A 3PIOF 1I6HJ 1S3JA 4PSXA 4OMYA 2IBDA 2DA5A 2FX0A 1SVOA 1XCVA 2HQNA 2FSWA 2HU9A 5FLXK 5ICCA 5EGOB 1FSHA 2DMQA 1RC9A 4RDUA 2RVCA 3BWGA 3BG7A 3BQYA 4MNUA 4IHTA 2IW5A 3TBIA 1WKMA 3LSTA 1R58A 1SMYF 1IV8A 1VQMI 2HTJA 4MFEA 3SEQA 2B9SA 3ELKA 4XN0A 2EA2A 2UWMA 5ERIA 1IN8A 1QHHD 2CU7A 4I01A 3JCUC 2V7FA 2R7RA 2H09A 2CQQA 3IC7A 1S7AA 3HTSB 2DT6A 3RKXA 2HYGD 5B1AH 1W7PA 5LHHA 2QF7A 2EIJH 1ZG3A 3OYDA 1I1SA 4TV7A 3A01A 3E5QA 4HQMA 1S6LA 4CA0A 3OOUA 2LLKA 3KP3A 3JRCA 4OINF 3IV5A 4P55A 3ZQIA 4ZTJA 2F4MB 2BGCA 1MD0A 4C2TA 3JRHA 3DBRB 1YLFA 2R7WA 4XKCA 3S3OA 4EVIA 5J8CA 3HKZA 1MH3A 4L9JA 1YE9A 1UB9A 2RGVA 4E70A 4XSZF 4S0HB 4IKFA 3GX4X 3DBHB 4IRGA 2QSHX 4LG0B 2JSPA 3ASNH 2PMZA 2EV0A 3KEQA 4ZZLA 3S2DJ 3DWLE 3U1DA 1R71A 2STTA 2A6HF 2VOOA 2QM3A 2VBWA 3K2AA 4UUTA 4B4CA 3QOEA 2VUMJ 4XORA 2L7MP 4E7IA 2L9RA 1VFCA 3C1DA 1SD5A 4LIVA 3OL4A 1FT9A 1JGGA 4ZDOA 1W0TA 5HLTA 3LQRA 1MZBA 4KICA 5HVQC 5LRSA 2HYFA 3ML6A 3OV8A 4XN3A 2HDWA 3FXMA 4LMYA 1G3TA 4LOCA 4AD9A 2M45A 2V79A 1Z3XA 2EQRA 1NH3A 3E6DA 1H8AC 3ZMTA 3FZVA 3TGNA 2LMDA 1VQNI 1K6OA 1U0JA 3CUOA 1S5LC 3E6BA 1OCOH 5CPRB 1BC8C 3R61A 1QZEA 3KLOA 1SD7A 3LNQA 5F1JA 1IXSB 2VLAA 4EQQA 2X9DA 4HYEA 2ID3A 1UHSA 4ASNA 4EM2A 4PJJA 3BJ6A 5D5VB 4IRIA 3HHGA 1PDNC 2IS1A 1OR7C 3W2WA 3CMAI 5E1ZB 2IEKA 5JR3A 2LG4A 1QO0D 5EDNA 1B72B 1KQ0A 4CGZA 2L7KA 2CS3A 1XPXA 2M7BA 3GTOJ 1EH8A 3BG6A 2WTEA 3MKYB 3OR2C 2MLGA 3BR6A 5FLMJ 4Y33A 3VOEA 1MMDA 4RMNA 1JT6A 2MYSA 1UHWA 3OYCA 2ZXHA 1XDUA 3Q5FA 1MH4A 1XGNA 4LIUA 2KIFA 3DKXA 1T95A 4A3DJ 3LSMA 1WSUA 2HWVA 3COAC 1O3SA 1JTYA 3SQNA 3CF2A 2MGQA 4GRIA 3I53A 2O8KA 2OQGA 1ON2A 4GDFA 4RLQA 1ETWA 4CHUA 1XSXA 3CDLA 5FRMA 3BG5A 2GXAA 2D1HA 3VYTB 1TP4A 4S04A 4NNJA 2VBZA 3JRDA 4BE2A 2K27A 3O6BB 3TO7A 3F22A 1RETA 2VE9A 3TDZC 5LLQA 3MZHA 1TWGJ 3SEZA 4M73A 4G6QA 4IRHA 2L9SA 2QQAA 3ZN0A 2L0KA 2H8RA 3GWZA 3BR2A 1TW2A 3LA2A 1MMSA 3O3KA 4PZJA 1L3LA 2JSCA 1U78A 4HLXA 2Q2EB 4F3QA 5FD6A 5J1YA 4BQNA 1YI2I 3GLLA 4A6DA 1C0WA 2QSGX 3FIWA 1W5CC 2TCTA 2LOOA 3FHNA 2RC4A 5ILUA 4O6JA 4BACA 3M9AA 2KRFA 2KHMA 3CC7I 3HUGB 3BZKA 4DZJA 3PFIA 2HKOA 3F8CA 2GIVA 2D5VA 2VPLA 2MD0A 3I58A 2LY2A 3FXLA 2MW8A 4X6AJ 4JBAA 4Y15A 4KMFA 1BI0A 4G8XA 1QNTA 1V5FA 2F4OB 1F9NA 2BY0A 4KT6A 1HKSA 1TWFJ 4GO1A 3MWMA 5LEJA 1X19A 4BXFA 2HQ5A 3AFHA 1MDMA 3ERMA 3KCCA 1B9NA 1I1GA 4HEA2 2E34A 3HPHA 3VFZA 1K4SA 3K4BA 4RS8A 2BBYA 5E3NA 3J80K 3FHZA 5DEQA 1NK3P 4UVAA 4FE7A 3LL7A 4PJLA 5AONA 5E17F 2IA2A 1WH7A 5GP9A 1JHFA 1SANA 3C7JA 2V1XA 4BJTA 1LUJB 1E2XA 2K4JA 2CUEA 4M9SA 2CW7A 4XOPA 2WC2A 2HVSA 3H3VK 4II2A 1NTCA 1Y8QB 2KRHA 1OR7A 2QQ9A 3GW2A 3K4NA 1BI1A 5M3FJ 3BZCA 3HIFA 1G59A 2Y2ZA 1TZLA 1K7AA 5C4XJ 1U9NA 3E6MA 5IT3A 4U0YA 2RN7A 4Z6YA 2ZXIA 3CCQI 5DYMA 3HTUA 4ZDLA 3V7CA 1UHMA 2EWNA 2CYYA 3HJEA 4I0BA 1ZR2A 1N77A 4M71A 4ZDPA 3CC4I 2ZJPF 2PMUA 4AC0A 4OWRB 4AYBN 5C44J 1Y1WJ 4M3EA 2LD5A 1VF9A 4RAYA 4CICA 2RQQA 3CMMA 5J40A 4BKXA 2BW3A 1R00A 4MQVA 2G9WA 3IL2A 3S93A 1LJ9A 2AHQA 3R60A 4I09A 1P6RA 3L1PA 1ENHA 3QYEA 1VQ7I 2OCEA 1X4PA 3K0LA 2HEOA 2TDXA 3OIOA 4Q4ZF 3PM1A 4CCJA 5D8LB 3FKJA 1WGXA 3OYGA 1LFBA 2XF6A 3TL4X 5J1RA 4DYCA 4IOCF 4ON0A 2EZIA 1XN7A 2FD5A 2YR2A 4JQFA 4HAMA 3DEUA 4G6DA 1D8KA 1EF4A 1J9IA 2OU2A 2KKOA 5KAFC 4G7HF 2ZSHB 4IEJA 2IS2A 3CDHA 1BJAA 2VE8A 3OY9A 2W4SA 4PJMA 3S17J 4FX0A 2R92J 4RM3A 2A5YB 3VODA 3A02A 3GFIA 4XBFA 1KONA 3K1PA 1FMVA 1R5ID 2L01A 2VIXA 1IDYA 2QEXI 1H0MA 3QODA 2JZYA 2X6WA 2OD5A 3J81K 3K70C 3E5XA 4B1RA 2P5VA 2QLZA 4XLEA 2A3SA 1J0RA 2Z99A 4E7KA 4HRIA 2DLLA 2E5ZA 1MBJA 2LSOA 3WTTC 3B73A 2KJBA 3PQJA 5FGMA 3OYFA 4WCGA 2AO9A 1EA3A 4CUGA 2HVQA 3KP2A 2NYXA 5L3DA 3CO7C 2DXIA 4IQ4A 1U6GA 2X1CA 1A36A 1G4DA 3DLLF 4FASD 4ZYAA 1UJ8A 5HDKA 1T2KA 1JE8A 5DD4A 4B09A 2JMWA 1VI0A 3QYBA 1D1AA 2RREA 5L3GA 3BJOA 3H1CA 3TDUC 4ABZA 2J5OA 2CV0A 3OYLA 3H9JA 3BT9A 1T38A 2A6TA 5F08A 2K7LA 5DCMA 1QVTA 2W1OA 4XNFA 4XKWA 2WB1N 1KU7A 1YOVB 1BM9A 2R3SA 3DF8A 5L3FA 4Y7NJ 3MEXA 4BEHA 2ZFWA 1KGSA 4KITB 3RDIA 4KMUX 4QWQA 3KFWX 3HSEA 2DFFA 2Q0OA 1HBXG 3S3MA 3QPSA 1E3HA 3P9CA 1G6NA 3KYCB 1WCMJ 2C6YA 4IVNA 2ZMEB 3WG7H 3WTWC 2HKXA 1LVKA 4I76A 2JN6A 5IY5H 4XKBA 4Y17A 4HOBA 1DQUA 3MN2A 3JTGA 3RJPA 2DN0A 3M07A 4UUSA 4BNCA 2DFHA 3ONQA 1PUFB 1TWHJ 3IUOA 4XMYA 1LVAA 4M9XA 4I6ZA 4JYKA 3REOA 3TKYA 2V1NA 2VQHA 1QA6A 1AU7A 1DDNA 3LFUA 4MTDA 1RKTA 1XSVA 4YFXF 2CRGA 4G9YA 1RRJA 3L09A 3SDGA 2L3DA 5F27A 1MKMA 2I5UA 3K7AJ 5J8FA 1LQ1A 3VYUB 3TP0A 1AHDP 5H2FC 1O7LA 1ZTRA 2XF5A 2Y0SN 2ZMEC 4XKVA 2R5ZA 3OS2A 4P1WA 1V5EA 2LKSA 2X51A 3ECHA 4FX4A 2O7OA 4BH9A 3FKIJ 1N78A 5CQEA 1AWCA 2QENA 3S14J 2CH0A 1YO5C 2ELHA 1IRZA 2JWTA 2LBFB 3I55I 1BI2A 2KRCA 5GPAA 4QIWN 2MH9A 2MA3A 4LB5A 4E7SA 3JREA 3E0JB 3GVAA 2R7DA 2XPWA 1MJBA 2XGDA 4DW6A 3QWLA 4PCQA 2K9MA 2PJRB 4BBSJ 3MKWB 3H5AA 4DJAA 3BZ6A 3MAJA 1SD4A 4EJOA 4NUBA 4A3GJ 4XOTA 1K61A 3OYIA 2EIMH 2W82A 4QLCU 2VPRA 1Y0UA 2GA1A 2QQ8A 4CH7A 3I9V2 3J7ZI 3GZ6A 2BOLA 5EG0A 3EUAA 5FKKA 5FLXZ 3RI4A 2GOXB 1SVLA 3D5LA 2WY7Q 4UUVA 1LDDA 1FP1D 4Y4RA 2IT0A 2IGKA 3MKLA 2AXLA 1F36A 4LLGF 2LKXA 4N9HA 3WG9A 1VTNC 4ZJZA 1BC7C 2EILH 4BDZA 4C2UA 3H5RA 3G4SI 1FIAA 2KFDA 4AIJA 1YHQI 1I50J 2IGOA 4LITA 1U5TC 2XAHA 1XS9A 4D5CA 1H89C 2E2JJ 4WF2A 3TW6A 5D6EA 2DPUA 3A03A 5AIPA 1T33A 2VONA 1V55H 3MQ0A 2IGNA 1EJ9A 1IN6A 3L9FA 2MBFA 2OA4A 1UELB 1V3FA 4M74A 2HOTA 2JK3A 1YW7A 2XAGA 1R4MB 3FK7A 1BIAA 4A5NA 3DU5A 4YG2F 4B47A 4ETSA 1ZQ3P 4PFOA 2GBYA 2VJ4A 1GHCA 2NNNA 1TT5B 1ZR4A 4Q48A 1EV7A 3QOPA 4XRSG 5LEKA 3L2VA 1ZLKA 3FXKA 4UVCA 3KX2A 2Y0MA 4ENJA 2XDVA 2IVMA 2ZO4A 3HOYJ 5ILSA 5K5QA 4UV8A 3CCEI 1G8XA 4RA2A 3K10A 2E35A 3R6SA 1XGMA 3C2HA 3CCSI 4F91B 2DCEA 3CJNA 5J3LA 4AUXA 5LGUA 4WXCA 1ETXA 1FSEA 1RKWA 2DYRH 2HXIA 3Q9VA 4PJNA 2ZMEA 2JA6J 2H6BA 5L3BA 1B1BA 2JRMA 2DT5A 2FMLA 3GLXA 5HODA 3S15J 3HZJA 4M3DA 2VJJA 3CJQB 5DUKA 2F6CA 2D1VA 3QP5A 2CFXA 1MBHA 2OF7A 2UXXA 3L7WA 4ZC3A 1I5ZA 4BHCA 3M8JA 1K6YA 3EYIA 2EFNA 3V8JA 1XC5A 2R7SA 1OISA 1Z67A 2M87A 2X4HA 4XL9A 5IOYA 2K3PA 4I7HA 3I4NJ 3BPXA 2DOAA 5FKLA 3KPHA 2QBYA 3OYEA 4CCNA 1ZHFA 3DBLB 2ZXWH 1KU2A 2ISYA 2P81A 2CSOA 2MC4A 3GMEA 2I10A 1LEAA 2FUG2 1K78B 3EUHC 3P9KA 1REPC 4U88A 4A3BJ 1BR2A 2CQ7A 1HCRA 1X4OA 2GQQA 2L9VA 5HS9A 3F8MA 4PUSA 2K02A 2KDOA 1WVRA 2ECCA 1ZH5A 2VT2A 5LGTA 2E1NA 2NAZA 3Q3SA 2X6YA 2WAQA 1SMTA 2DA7A 3B6CA 3ECOA 3I59B 2BY2A 4MHGA 2A07F 3ZQ7A 1S8NA 1JXSA 2HXOA 3TOAA 1D0ZA 1U5TA 3DQVC 1D0XA 5KVRA 4NC6A 1X3UA 4UVBA 5B1BH 3CP2A 2LC2A 1X1DA 2CQKA 1CF7A 5C4JJ 1LE8A 2DT7B 2ZJRF 2E1OA 2ME0A 2CUJA 3G3ZA 2P7CB 2V4JC 1UAAA 3K2ZA 1BA5A 5FKOA 2WA0A 4LJZF 3GTPJ 5DUIA 4JX4A 5FFXA 1D1BA 2NS0A 4DIQA 3H92A 2FBIA 2WAEA 4H0EA 1BOAA 4LLLA 1IJWC 1IV6A 4KFCA 4Y3OA 5F1RA 4CYCB 2ESNA 1FOYA 5EEHA 2W24A 5D5XB 2F5EA 2O03A 1OMIA 2KMUA 1JKPC 3M4OJ 3BTCA 5K5RA 1RUOA 2DA4A 2F4IA 1MMGA 2YX4A 2QGUA 2Z5UA 4N4NB 3CO6C 2UXNA 3ZRGA 2R0QC 5DV5A 1I39A 2QVOA 3QPHA 2XB0X 1F5TA 3WU1B 1JKRC 3WTVC 2ACJA 4GFBA 1P7JA 5F04A 1UZCA 4L9NA 1CGPA 4LK0F 2KT0A 3UKGA 5E1WA 5ICFA 4D5FA 5IOZA 3SZTA 5DTDA 1R4NB 1TQMA 3G2BA 2RKHA 3ZQCA 3M8FA 1GVDA 3ZMDA 2VKEA 1N75A 5E20A 2D45A 4M72A 4CSWA 3J80Z 1F1ZA 3ASOH 2DJNA 3MCZA 4NC8A 1PJRA 3T8TA 3HOZJ 2EV6A 2WAFA 3P5JA 4XLFA 3RPQA 5LBQA 3HXLA 2UUZA 3LSGA 4GYIA 2PJPA 2RNGA 2QYOA 2Y9YA 2PX9A 1HDDC 2GIZA 1TL8A 2PEXA 1ZLJA 4DZPA 4QTRA 3BJAA 3E3VA 3BG9A 3DCFA 3WTUC 2G7UA 2I8DA 5HLIA 2ICWG 3EUHA 3LWFA 1LKXA 5GAHJ 2FOKA 4IHVA 2WADA 3WTSC 2QKLB 5HDGA 1YJWI 1AKHB 5HS7A 4EGZA 3I64A 2XKPA 4B44A 2R7ZJ 4GXOA 1MBEA 2V26A 4GGGA 4D1QA 3KEYA 4RAGA 3CJRB 3RCOA 4O3MA 1R5HA 2AQFA 3UNGC 2K3FA 1ZK8A 2F5CA 3JAMK 1P4AA 3CDIA 2FJ1A 3H0DA 5M5WJ 1NG7A 1ON1A 4IHWA 4IHXA 4WX9A 2JJ7A 3QU3A 2DA1A 1GDTA 3R0JA 3D5SC 3UR3C 4KYWA 2DYSH 4IPAA 3GBGA 3ULQB 4LG3A 3B6AA 1R6RA 2P0WA 4NQWA 2R7OA 2HI3A 5IYDJ 5J4YA 3I3LA 1FJLA 3GEZA 3PSIA 3I59A 4HX4A 2G0EA 2AS5F 4OIOF 4L0YB 1IW7F 4BHBA 1HSJA 3BQZA 2M0MA 2M5WA 1E17A 4IHSA 4YFNF 2NRAC 2KPMA 1Z21A 4HNTA 3IWZA 3AKZA 3SXYA 2CQXA 3GFMA 1F4KA 1V4RA 5F0FA 4BQQA 3SFIA 1RI7A 1ODDA 2K9NA 2EBIA 3CUQB 4NBQA 1ORKA 3WTXC 2L4AA 4BXUA 2BXZA 4BXXJ 3JRGA 4CDGA 1SVMA 1HDPA 3K69A 5EGOA 1GT0C 3J81Z 1B8IB 2M0CA 3HG9A
chains in the Genus database with same CATH topology
1VQ6I 3I55I 2QEXI 3CMEI 2JQ7A 1FOWA 1VQPI 2OTLI 4UY8I 2NXNB 2E34A 3CCLI 1FOXA 1VQNI 3J7ZI 3CCRI 5DM6F 3CCMI 5GAHJ 2ZJQF 3DLLF 5JVGF 1YJWI 3PIOF 1YJ9I 4V19K 3G71I 2QA4I 3I56I 3CMAI 4IO9F 3CD6I 5GAGJ 5DM7F 3G4SI 2K3FA 1YHQI 3CCQI 1VQMI 5GAEJ 3CCVI 2ZJRF 3CC4I 1ACIA 2ZJPF 2OTJI 1YJNI 3CC2I 1VQ8I 3CJTB 1VQOI 3PIPF 1YIJI 3J7YJ 1VQKI 5GADJ 1FOYA 3CF5F 1VQ7I 1VQ9I 3CCEI 1QA6A 3CCUI 1S72I 3G6EI 2E36A 4IOAF 1MMSA 4IOCF 1Y39A 2E35A 3CCSI 1VQ4I 1YI2I 1VQLI 1HC8A 2H8WA 3CCJI 1VQ5I 3CC7I 2FOWA 1YITI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 I;  3I55 I;  2QEX I;  3CME I;  2JQ7 A;  1FOW A;  1VQP I;  2OTL I;  4UY8 I;  2NXN B;  2E34 A;  3CCL I;  1FOX A;  1VQN I;  3J7Z I;  3CCR I;  5DM6 F;  3CCM I;  5GAH J;  2ZJQ F;  3DLL F;  5JVG F;  1YJW I;  3PIO F;  1YJ9 I;  4V19 K;  3G71 I;  2QA4 I;  3I56 I;  3CMA I;  4IO9 F;  3CD6 I;  5GAG J;  5DM7 F;  3G4S I;  2K3F A;  1YHQ I;  3CCQ I;  1VQM I;  5GAE J;  3CCV I;  2ZJR F;  3CC4 I;  1ACI A;  2ZJP F;  2OTJ I;  1YJN I;  3CC2 I;  1VQ8 I;  3CJT B;  1VQO I;  3PIP F;  1YIJ I;  3J7Y J;  1VQK I;  5GAD J;  1FOY A;  3CF5 F;  1VQ7 I;  1VQ9 I;  3CCE I;  1QA6 A;  3CCU I;  1S72 I;  3G6E I;  2E36 A;  4IOA F;  1MMS A;  4IOC F;  1Y39 A;  2E35 A;  3CCS I;  1VQ4 I;  1YI2 I;  1VQL I;  1HC8 A;  2H8W A;  3CCJ I;  1VQ5 I;  3CC7 I;  2FOW A;  1YIT I; 
#chains in the Genus database with same CATH topology
 1BOB A;  4A3E J;  3VSK A;  1AOY A;  3IAS 2;  3RQI A;  3K6G A;  2LTP A;  5BQT A;  5HNF A;  1MJA A;  5E79 C;  4N4O B;  2RAE A;  2DK5 A;  1ONV A;  2L7F P;  3R0A A;  3MZ8 A;  1OQY A;  2M1B A;  4F7Z A;  1YFH A;  3A2K A;  5J1U A;  2K9L A;  5JI6 A;  3CES A;  1T98 A;  4PK4 A;  2XAS A;  1QHG A;  4Y13 A;  2M3A A;  1IAW A;  4GCV A;  4P96 A;  4L18 B;  1G3W A;  1YRN B;  4KIS A;  4HG2 A;  4ESJ A;  1B4A A;  1ZRE A;  1BBY A;  3CCR I;  2YUS A;  4RB3 C;  4ENN A;  4HBL A;  5TRD A;  1SFO J;  3HOW J;  4FE4 A;  2VT3 A;  1A04 A;  2J5P A;  1H9T A;  2CMP A;  4MEY F;  2XAU A;  1DP7 P;  2HYJ A;  5DD8 A;  2BVL A;  2QA4 I;  3GO5 A;  2DA3 A;  4MO7 A;  1WI9 A;  2DDA A;  4V2F A;  3S32 A;  1O57 A;  3TOB A;  3C2B A;  2E60 A;  2MH2 A;  1IZ1 A;  3BTI A;  2CO5 A;  2P4W A;  3RPU A;  4HPQ A;  5D6F A;  4LG0 A;  3DTK A;  3A4C A;  3TW7 A;  2XAF A;  3FXQ A;  2QWW A;  4G6T B;  3SYT A;  1NK2 P;  1Z6R A;  2LY9 A;  4C9Y A;  4YEJ A;  3E1S A;  5EJC A;  2X1E A;  3WGH A;  4WXH A;  2MD5 A;  4CO8 A;  1IXR C;  3W6V A;  2IA0 A;  2FU4 A;  3NRV A;  3GTG J;  3GFL A;  2ISZ A;  2M4G A;  2FE3 A;  2XGE A;  3CJT B;  3K70 D;  2BVM A;  3IH4 A;  2OAZ A;  2ZC2 A;  4OU0 A;  4KN7 X;  3RKY A;  3V8L A;  4YIR X;  3KIO A;  5FJ8 J;  1TLH B;  5LHG A;  3OIP A;  3MZY A;  4K2E A;  3GTM J;  2H1K A;  3V7R A;  3HRM A;  3JSP A;  4W1U A;  1HW5 A;  5K7H A;  1XMX A;  2VKD A;  3I54 A;  3DU6 A;  2KIM A;  1VZ0 A;  2W00 A;  4U0V A;  3G6E I;  2O6G E;  4Q5S F;  4RB1 A;  4MIM A;  4UNO A;  1TQP A;  2ZNZ A;  3ZXS A;  1MJ9 A;  3E6C C;  3VDX A;  3PJR A;  2HNH A;  2OPT A;  1P7I A;  3M1C A;  2XPU A;  2VC1 A;  1LEB A;  2EZL A;  1U9O A;  1B72 A;  3I4P A;  1XSD A;  1BJZ A;  4A3K J;  4JP0 A;  3DFG A;  4IL6 C;  2GLO A;  5M5Y J;  4HDU A;  2IRF G;  2L02 A;  4HF0 A;  2X6X A;  4E7H A;  1ETQ A;  5E3O A;  2FEZ A;  3CME I;  1WJB A;  3CCY A;  1M1E B;  4XLH A;  3FM5 A;  2LH9 A;  3ZR8 X;  3S1R J;  5JHU A;  1U3E M;  4EMS A;  2ZBK A;  3BPV A;  3H5N A;  4U7B A;  3EUK L;  3I4M J;  1YW8 A;  2Z16 A;  3CCL I;  5EF6 A;  2E19 A;  4KIF A;  4BBR J;  5HLH A;  2M9H A;  3OMY A;  2V9V A;  3PFY A;  2Q8K A;  2GOM A;  1P4W A;  4X0G A;  3K4K A;  3QYF A;  2FQ4 A;  2K86 A;  4IXA A;  3H0G J;  1TC3 C;  3HSF A;  2HQR A;  3SDB A;  5DS9 A;  3HSR A;  5JFR A;  4PJ0 C;  3IAM 2;  4LLN A;  2DBB A;  2P8T A;  1Z9C A;  4YII A;  2EB7 A;  4CYD A;  2JRT A;  1XB4 A;  4FIS A;  4EJV A;  2K9S A;  4QPQ A;  1QGP A;  3HOX J;  3AL0 B;  1BR1 A;  1LB2 A;  3VPR A;  2RDP A;  3ZQL A;  2E7X A;  3OYA A;  4BQO A;  1YYV A;  2HZD A;  2Q2E A;  4EM1 A;  1X1A A;  4XSX F;  2VC0 A;  4B3A A;  1YRN A;  1O3T A;  1LDK B;  1IF1 A;  1UFM A;  2F2E A;  4A3C J;  5TGT A;  3HUG A;  2A69 F;  2R7X A;  3JW4 A;  3WOD F;  2G7H A;  3I71 A;  2YS9 A;  1K79 A;  3U21 A;  4ZZD A;  5D5W B;  4HDV A;  1V5G A;  4AYB A;  2Z1D A;  3AL0 C;  1A6I A;  1ZG5 A;  3D0S A;  2ADU A;  2OZ6 A;  2EFP A;  3H3Z A;  4C3J J;  2E1C A;  4CZZ A;  3BTL A;  2EZK A;  1K83 J;  2FQ3 A;  2ZKZ A;  3BCA A;  4RGS A;  3AAF A;  1HOM A;  5GTI C;  3CF5 F;  2LF8 A;  4LGW A;  4KT5 C;  3KP7 A;  1X2M A;  1KYW A;  1TT0 A;  1MSE C;  2DOD A;  1IRG A;  1HST A;  3W3C A;  2O5R A;  3GZN B;  2CW8 A;  5EYR A;  1ZAO A;  2E36 A;  5H20 A;  5FB2 A;  4UHT A;  2Z3Y A;  4DQ2 A;  3PSF A;  3HEF A;  3L2Q A;  1E3O C;  1Y0N A;  3MKZ A;  1VND A;  4DOZ A;  1VQL I;  4A0X A;  4RAF A;  2UV1 A;  3WTZ A;  2JUG A;  2CJJ A;  4BUP A;  1T6S A;  3BDD A;  1NG6 A;  2JA8 J;  1G3S A;  1VQ5 I;  3FBI B;  3OYH A;  3LAP A;  2B0L A;  4HF1 A;  2M7A A;  3FXJ A;  1FPQ A;  5JLX A;  4ZYD A;  1S7E A;  3ABM H;  4YEL A;  1KQ8 A;  1FOK A;  5AIQ A;  1YX3 A;  1O3R A;  2LNB A;  1FOW A;  2IXS A;  1JUS A;  1VQP I;  1XTA A;  1RNL A;  2M2E A;  2WV1 A;  3KYD B;  2V9P A;  3BR5 A;  3JRI A;  2R5Y B;  2E1M B;  3S16 J;  4LB6 B;  2V9K A;  1W36 D;  1FOX A;  1TQI A;  1RR7 A;  1BW5 A;  1J09 A;  1R49 A;  2OV7 A;  2DI3 A;  5BOX A;  3BOQ A;  2RQP A;  1E0E A;  4HA8 A;  1WWX A;  3ZP5 A;  2DA6 A;  2DOE A;  3BRO A;  1AA7 A;  3DPT A;  3FXU A;  4MLO A;  4BS9 A;  2HS5 A;  2L54 A;  5E8G A;  1UG2 A;  5TIS C;  3KLN A;  4IO9 F;  2LRD A;  2QUF A;  2K40 A;  5KHD A;  4I98 B;  1WJD A;  6PAX A;  5J6X A;  2PI0 A;  4A3F J;  2BY1 A;  5FLV A;  4J00 A;  1OCT C;  2ETH A;  1FZP B;  4AM3 A;  2DDB A;  1OLT A;  1W7P D;  1YQA A;  2L4M A;  3LAJ A;  1I27 A;  1N25 A;  3WU2 C;  3OSF A;  3AG2 H;  3NAR A;  1T39 A;  3JSO A;  2R4G A;  2UZK A;  5DDG A;  4WWC A;  1S9H A;  2LR8 A;  2O8X A;  3DP7 A;  4R8H A;  3CZ6 A;  1W5T A;  4RB0 A;  3OOP A;  4P9F A;  2E2H J;  2XIG A;  3TMO A;  3CC2 I;  3SZP A;  5D4R A;  4U7D A;  1FYM A;  2DFE A;  1JUP A;  1R1V A;  2IA1 A;  3K4M A;  1JT0 A;  3DKY A;  4HX8 A;  2Z9O A;  1X58 A;  3X2Q H;  4D7N A;  4BL0 B;  5B66 C;  1VQK I;  3GTQ J;  4YFK F;  1P4X A;  1T0F C;  1I3Q J;  4OMZ A;  3K4C A;  2X48 A;  3HL2 A;  2FBK A;  2P5K A;  1GV5 A;  3M1E A;  2VBY A;  3BR0 A;  3FMS A;  3MFK A;  4H4K C;  1S72 I;  1KU9 A;  4M6V A;  5CVI A;  2Z2S B;  3P7N A;  1XGO A;  2F48 A;  4PDK A;  4L5J A;  3S2W A;  1TNS A;  2GZW A;  3FMQ A;  5E3L A;  4XQF A;  2V1U A;  2NNY A;  3ZGK A;  2VQG A;  1MNM C;  1Z7L A;  3H9Q A;  5LFA A;  2E5N A;  4J19 A;  1Z7U A;  1IGN A;  2K9Q A;  4B8X A;  1Y1V J;  3HRS A;  2H27 A;  3CCJ I;  2KJC A;  1LPQ A;  2V6C A;  1YS7 A;  1STZ A;  2Y0S A;  4DBR A;  1YIT I;  1ZG1 A;  1WZ2 A;  4II3 A;  4CCO A;  5LHI A;  2MG4 A;  1HW2 A;  3S1Q J;  1T56 A;  3WHC A;  1OYI A;  3TP3 A;  4EAT A;  4A3L J;  2F5F A;  3VWB A;  2WBM A;  4FQG A;  3PNV A;  1FTZ A;  3F8F A;  2JQ7 A;  2JA7 J;  3OR1 C;  3GF2 A;  2FF4 A;  3WE2 A;  1R23 A;  1W7P B;  2LP0 A;  4O5V A;  4AID A;  2ZCW A;  1D5V A;  2DA2 A;  4P9U A;  2OTL I;  1FLI A;  1OCC H;  2H6C A;  4M6Y A;  5FRN A;  3GTL J;  4ZYE A;  2GXG A;  2VQL A;  2EFW A;  2A5W A;  1WJC A;  3LFK A;  3IRQ A;  1UST A;  3FWE A;  4D0P A;  1X2N A;  2ECB A;  4UXN A;  5EZG A;  5DM6 F;  1F43 A;  2COB A;  1FX7 A;  3TO9 A;  1PUF A;  3C3W A;  1DGW Y;  3EET A;  2FNP A;  5BPD A;  4A5M A;  1Z0X A;  2A61 A;  3ISP A;  3JAM Z;  3O2P E;  4AWX B;  1U8B A;  3ZMS A;  1IC8 A;  1QPM A;  2BV6 A;  2VJ5 A;  5H6Q A;  3G73 A;  3O8H A;  4IX7 A;  4WK8 F;  4E7J A;  2VXD A;  1X1P A;  3E97 A;  4OIR F;  5J47 A;  3ZN1 A;  4EJW A;  4BY1 J;  4BJ5 C;  3F6O A;  2DK8 A;  3GFJ A;  4Z2Y A;  4RBO A;  3KYL A;  1PP8 F;  3FM3 A;  2E2I J;  1QU3 A;  1DPU A;  3CCV I;  3ABL H;  2Y69 H;  1FY7 A;  2VBX A;  2XGC A;  4QSH A;  2VKH A;  2NS7 A;  2KIS A;  2R7V A;  1QBJ A;  1OJL A;  2LBF A;  1MBG A;  3B02 A;  3VB2 A;  3G1L A;  4P5O A;  1YJN I;  1H9G A;  3MVP A;  4IF4 A;  4NDL A;  1X3Z B;  2E71 A;  3HB9 A;  2BHZ A;  1JJ8 C;  1ZRC A;  3FDY A;  5IP9 J;  1FYL A;  2PJR A;  3L00 A;  1T0F A;  3I5U A;  1G2H A;  2OUM A;  4XRS A;  3ABK H;  4OAY A;  3S8P A;  1ZRD A;  3M3Y J;  3K4J A;  3S1M J;  1Q1V A;  2PMH A;  1P2F A;  5B5E C;  1ETV A;  5K7Z A;  1FNN A;  1ZAR A;  3HKZ N;  1RR8 C;  4CCK A;  1Z05 A;  2KLO A;  1ERD A;  2KQR A;  4I02 A;  2BEO A;  2MAB A;  1FBU A;  4JX5 A;  4KUM A;  5C3E J;  1Y39 A;  3W2A A;  2WWY A;  2PMZ N;  3HBL A;  4W97 A;  5KK1 A;  2PFB A;  4A3J J;  3QPT A;  2IGM A;  3F3X A;  4HW0 A;  4F55 A;  4RAZ A;  4B48 A;  2EPF A;  4JOM A;  1EKE A;  4HNV A;  2OBP A;  5E1X A;  4E6K G;  3K1M A;  3CP8 A;  2QCO A;  1MBK A;  3RPU D;  2HPM A;  1QVU A;  3HOS A;  3BY6 A;  2MC3 A;  2VKV A;  1QRY A;  4GYG A;  5HOO A;  3NWS A;  4EM0 B;  2ME6 A;  4B43 A;  1QQI A;  2FMY A;  1ZN2 A;  3OIQ A;  3RKQ A;  3FF5 A;  1BW6 A;  3OSG A;  1IDZ A;  3KP6 A;  4UY8 I;  5F0H A;  1ZYR F;  1ZGW A;  4NHJ A;  3NAU A;  5ICE A;  2F5V A;  4I2O A;  1RZ4 A;  5CVV A;  3LSI A;  3NQO A;  2X6O A;  4HNU A;  4XON A;  1OPC A;  1UMQ A;  4L5I A;  2XSJ C;  3IH3 A;  3F0C A;  1UCR A;  1ULY A;  3DLA A;  2CWE A;  3DTI A;  2XF7 A;  1XDS A;  2JVH A;  5E3M A;  2R93 J;  1Z3Y A;  1YJ9 I;  2BE5 F;  2O3F A;  4PFP A;  5FRO A;  3LA3 A;  3SJM A;  5F64 A;  1E3P A;  5H6R A;  3CD6 I;  2QKM B;  3DEW A;  3QPL A;  4RGX A;  1DU6 A;  1DGR M;  2XUB A;  5BNG A;  3K4L A;  3HGG A;  3PL8 A;  4Y52 J;  1WJE A;  1W1W E;  3TED A;  1I6X A;  1HLV A;  3S2H J;  4L0Z B;  4RLF A;  4DNC A;  2LF7 A;  2NVU B;  2LDU A;  5FKM A;  1J7K A;  3DEE A;  2Y31 A;  3HC7 A;  4MQ9 F;  5J4V A;  4BQA A;  1ACI A;  2OQR A;  3KZI C;  1MDM B;  5EEA A;  4E7Z A;  2JT1 A;  3HOT A;  1X3W B;  2P7V B;  4AIK A;  1VQ8 I;  2DMU A;  3HOU J;  4AVP A;  2XVC A;  3RKW A;  2VAS A;  3VYR B;  4F93 B;  1VQO I;  4G94 A;  5CVJ A;  4EEF G;  5K5O A;  5GTH C;  2HDC A;  1GXQ A;  3RZD J;  2IAI A;  4BJ6 C;  2NS8 A;  1P9Q C;  1A35 A;  1R22 A;  5HS8 A;  3Q0U A;  4KIG A;  5IYC J;  3QU6 A;  2JA5 J;  4D9J A;  1YX5 A;  1APL C;  4M9Z A;  1MNE A;  2CUF A;  2LY1 A;  3AG4 H;  2RNJ A;  1SFE A;  1K78 A;  3KP4 A;  2HDD A;  2EK5 A;  2YU9 J;  1ETY A;  1JKO C;  4IOA F;  1Y8R B;  3WE3 A;  2L7Z A;  3SHF A;  2JVG A;  2AQE A;  1WI3 A;  1XGS A;  1X1C A;  1WJ5 A;  1L0O C;  1IUY A;  4KIB A;  1O4X A;  4ZYG A;  3R4K A;  2HGC A;  4DYR A;  4KJZ A;  2KP6 A;  3E5U A;  2EZH A;  1DP3 A;  2DJI A;  2HPI A;  2ZJ2 A;  3C18 A;  3DTE A;  1ITY A;  4F52 A;  5BS6 A;  2VB6 A;  2ZFU A;  1XD7 A;  2R7F A;  1R9T J;  1ZGA A;  3I0T A;  4L5E A;  3RYR A;  2AXT C;  2XB5 A;  1YS6 A;  3FBN B;  5A2Q K;  4Q47 A;  1W0U A;  5IT9 K;  2HOE A;  3QAH A;  4RGR A;  9ANT A;  2O9L A;  3ZMV A;  4HF2 A;  2BW3 B;  2ZXJ A;  2VOP A;  4C2M J;  3F23 A;  3RZO J;  1JI8 A;  3KP5 A;  2NXN B;  2HOS A;  1JKQ C;  3ZOB A;  1QPI A;  4BE1 A;  3TQN A;  1JUM A;  2HQA A;  1OYW A;  4A12 A;  4MFD A;  1O7F A;  3Q9S A;  4CYC A;  1Q1H A;  1IN5 A;  1BN5 A;  2M34 A;  4PSW A;  5K1Y A;  1S7O A;  2OC6 A;  2ZJQ F;  3H9G A;  1SAX A;  2IS6 A;  1XMA A;  2CUZ A;  2VN2 A;  1OCR H;  2H1L A;  3V8K A;  1R5G A;  1KYZ A;  1WPK A;  2EIK H;  4QPO A;  3HYI A;  3G71 I;  3I56 I;  1MSF C;  3BLY A;  4LFU A;  3SZG A;  2M8E A;  3CUQ C;  3BTJ A;  4XID A;  4BDY A;  2XRN A;  2CG4 A;  1I3A A;  2GAU A;  2LVS A;  3RSN A;  4XIC A;  3HGY A;  2ELK A;  1ETK A;  2CV2 A;  2TRT A;  1IG7 A;  4ESF A;  3OS1 A;  3CMY A;  1XG1 A;  3P9I A;  4A69 C;  1U2W A;  1BIB A;  1PYV A;  2N8G A;  3J7A Y;  2HR3 A;  3DKW A;  2XAQ A;  1TWC J;  2DU9 A;  1JJ6 C;  2KL4 A;  3DV8 A;  1R1U A;  2HVR A;  2XRL A;  4YRV A;  2KZG A;  1NHA A;  2K4B A;  3LSH A;  5EEG A;  3HRU A;  4G12 A;  1DUX C;  1WRJ A;  2M30 A;  2PN6 A;  1FP2 A;  3Q0V A;  5GAD J;  5CVU A;  3GTJ J;  3S3N A;  4N9I A;  4CCM A;  2V6E A;  4OIP F;  3ESW B;  2A05 A;  2LK2 A;  5D8K B;  3CTA A;  4AIH A;  1J5Y A;  3WGG A;  1RES A;  1VQ9 I;  2GXB A;  2DTZ A;  2EFQ A;  4JK1 X;  1D8J A;  3T1B A;  4HV5 A;  3FMR A;  1IUF A;  4A0Z A;  4IHY A;  3OYB A;  5HDN A;  1AKH A;  3JRA A;  2M8G X;  2DQL A;  3PQK A;  2CQN A;  3WU0 A;  5DCM B;  1IN7 A;  3HM5 A;  1IN4 A;  1ETO A;  4NB5 A;  1T8I A;  1HC8 A;  2CV1 A;  4BEH B;  3F9K A;  1Z6T A;  3ABU A;  2D2W A;  2XAJ A;  2GWR A;  2OTJ I;  4A93 J;  4BY7 J;  5JLW A;  5D4S A;  3KZY A;  5FFZ A;  2PBI A;  3ROU A;  1VQ6 I;  4L9T A;  2R7U A;  4HQE A;  2PLY A;  3U1K A;  2BXY A;  3PO2 J;  2W57 A;  3L2U A;  3HRT A;  5IPA A;  2NVT J;  2EJR A;  2L5Q A;  5FD5 A;  1YIO A;  3KZZ A;  4RB2 C;  1FWZ A;  1IRX A;  1SD6 A;  2IJL A;  2EFO A;  1QZY A;  3LA7 A;  2XKO A;  2DMT A;  1KU3 A;  3RQ4 A;  3RYP A;  1PVE A;  1WHU A;  5E8I A;  2FNA A;  4A6E A;  5M5X J;  4UUS B;  1MMA A;  2EA4 A;  2VL8 A;  3V7S A;  5IP6 A;  3KET A;  4KN4 X;  1HKQ A;  5D5U B;  4OOI A;  4V2G A;  1H88 C;  3U2R A;  5F0C A;  2DFI A;  1RIO H;  4IQJ A;  3M7G A;  3LSR A;  4CZC A;  3JRF A;  3IH2 A;  4PGG A;  5JVT A;  1ZEL A;  3BR1 A;  1FMW A;  3EPZ A;  4NC7 A;  2KIU A;  4E4H A;  3PUF A;  1USS A;  2R5Z B;  1GXP A;  4ESB A;  3S1N J;  5BPI A;  3OL3 A;  3CUQ A;  2VXZ A;  5GAG J;  1B59 A;  5DM7 F;  2O61 A;  2F5D A;  1B9M A;  4E7L A;  3N05 A;  2LRE A;  2OZU A;  2XPV A;  1BR4 A;  4N0B A;  5F6F A;  3J7A O;  3AG1 H;  4M6X A;  2BYV E;  3L2W A;  3PUB A;  1B8I A;  3IRR A;  3FIS A;  2NOJ B;  1A31 A;  3ZQG A;  2W7N A;  3ERE D;  1HF0 A;  1X1B A;  1R36 A;  2X1D A;  1J59 A;  1R1T A;  2W48 A;  1WQ2 A;  3RIR A;  3ZMU A;  3WGI A;  3H36 A;  3E7L A;  1D5Y A;  4D7M A;  1MGT A;  4A3M J;  1SFX A;  2E7W A;  3L2C A;  1GV2 A;  3PIP F;  3J7Y J;  1HQC A;  3BR3 A;  1YTY A;  4EJT A;  5EG0 B;  5B3S H;  1U8R A;  1UG0 A;  3NEU A;  2XGX A;  5FKN A;  5KAI C;  1DPR A;  2VJI A;  3Q0W A;  3BC8 A;  3CCU I;  2NVX J;  3A0B C;  2STW A;  3FXO A;  2LKP A;  3IP4 B;  5IYB J;  3H35 A;  4KA4 A;  2PG4 A;  4OAZ A;  2W85 A;  1EH7 A;  5EZH A;  3VSL A;  4U0W A;  1VQ4 I;  2X0L A;  4XLN F;  4BAY A;  2VQC A;  2HFH A;  2ESH A;  2P6T A;  3ZQF A;  4I0A A;  1T08 B;  4M3G A;  2IPQ X;  3GXO A;  3LSP A;  3T0Y A;  3JRB A;  3BP8 A;  2Z33 A;  2GM4 A;  2Y30 A;  1Z1D A;  4HZF A;  3ZMZ A;  1WH5 A;  5CYV A;  2EH3 A;  2Y75 A;  1SAU A;  1MMN A;  3LMM A;  5KCM A;  1YW9 A;  1V54 H;  5CKT A;  4BHP A;  4DGW B;  1TBX A;  3BCB A;  1ZRF A;  3ZQQ A;  2ZB9 A;  2ZNY A;  4G7O F;  2HZT A;  3G1O A;  3DPL C;  4ZTF A;  2JPC A;  3QP6 A;  3OWT A;  1FC3 A;  2WY8 Q;  3FX3 A;  1GLN A;  3BG3 A;  3N4M A;  3DPU A;  3ZCO A;  2XC7 A;  2JTV A;  4HST A;  2MFZ A;  4XLC A;  3GTK J;  5JVG F;  2COM A;  3HPG A;  4BYY A;  3LOC A;  4A3I J;  1POG A;  1JTX A;  4IJA A;  4UV9 A;  5LGN A;  4C3H J;  2L9N A;  2DW4 A;  4WXD A;  3TO6 A;  3D1N I;  5M3M J;  3CLQ A;  2XSD C;  1RPW A;  2DMP A;  1OCP A;  2JUC A;  4B3X A;  2L2O A;  3LSJ A;  4R79 A;  4IZZ A;  3OYM A;  1RUN A;  5GAE J;  4KDP A;  3T8R A;  2PQ8 A;  4L9V A;  3L2R A;  3G1M A;  4ENK A;  2BHY A;  3VYS B;  2V1D A;  2DAO A;  1KZH A;  1MW7 A;  2XRO A;  1XX5 A;  3GZ5 A;  3W6J B;  2ID6 A;  2O0Y A;  4YIF A;  5LRR A;  3MMY B;  2QBY B;  4EV0 A;  2NVY J;  1WJA A;  4XM3 A;  1LDJ A;  1WJF A;  2FXA A;  2MSY A;  1YIJ I;  2XHK A;  2DO7 A;  2B63 J;  2E1M C;  3EQL F;  2FBH A;  2P5L C;  1K4T A;  3O8G A;  2A68 F;  2W25 A;  2KIQ A;  1A5J A;  5KNL A;  2WB1 A;  1HXD A;  3WHB A;  1HA8 A;  4RGU A;  4BGD A;  3F21 A;  1CQT A;  5FO5 A;  4A0Y A;  2BY3 A;  2CW0 F;  1MND A;  2YPR A;  2DMN A;  2KZV A;  3AG3 H;  2R7Q A;  1U5T B;  2DTR A;  3JTH A;  1D0Y A;  1FTT A;  2JPB A;  5ICG A;  3MD2 A;  3F6V A;  4ZH4 F;  1IXC A;  4FT8 A;  1CF7 B;  1WFX A;  1EH6 A;  1LE8 B;  2FOW A;  2YU3 A;  2YX7 A;  1SEU A;  1GVJ A;  1MBF A;  3FK6 A;  3OYK A;  1OYY A;  2CGP A;  2MLK A;  1MIJ A;  1Z91 A;  1G3Y A;  3U9G A;  1JHH A;  3K9T A;  1A6Q A;  3GYH X;  2KDZ A;  3M8E A;  4ZYH A;  4R1H A;  4DYQ A;  5L3E A;  4FHT A;  4ITV A;  3PO3 J;  4XLA A;  1J75 A;  1R7J A;  4CCL A;  2NVQ J;  4MTE A;  1S29 A;  1LFU P;  1W5S A;  2IP2 A;  1TWA J;  1FIP A;  2NOG A;  1OCZ H;  1GUU A;  5CVR A;  1Y6I A;  3CCM I;  3JR9 A;  5BMZ A;  2DOF A;  1SFK A;  3CLO A;  2EV5 A;  4S05 A;  4ENM A;  3WTY C;  2HTS A;  2WAQ N;  1LFP A;  4HV6 A;  1J2X A;  2ELJ A;  4EGY A;  4V19 K;  2DQR A;  2B7E A;  3F8N A;  2Y9Z A;  1W36 C;  3OYJ A;  4AVZ A;  4PGH A;  4JX6 A;  5CLS A;  2GA2 A;  4RM2 A;  3C2G A;  3DXJ F;  5DCF A;  2YSR A;  3A01 B;  3OS0 A;  4FTH A;  3W6K B;  4A2U A;  3HDD A;  4KNY A;  1Z77 A;  2K85 A;  1TTY A;  3F8B A;  4HSR A;  1ZGJ A;  3V4G A;  4C3I J;  4XRF A;  1IRF A;  5ED4 A;  3T5X A;  3H3U A;  4XK4 A;  3IKT A;  2FRH A;  4BU2 A;  1JGS A;  1FYK A;  3F72 A;  1XMK A;  5TJJ A;  3GUD A;  4FCY A;  3KEO A;  4XLP F;  3VEP A;  3ZPL A;  1D1C A;  4LK1 F;  1LNW A;  2H94 A;  2ZSI B;  1OFC X;  2CFO A;  1OKR A;  3PNT A;  5CQG A;  3EDP A;  1D3Y A;  2XV4 S;  2EIN H;  4HLY A;  5GPC A;  4J01 A;  4MGR A;  2QSF X;  4G7Z F;  3LSK A;  1B6A A;  2R5Y A;  2RV8 A;  1O3Q A;  1PP7 U;  1TNT A;  4F92 B;  1HW1 A;  4OIQ F;  1ZKG A;  3HOV J;  3A1Y A;  4M3B A;  2Q1Z B;  2FA5 A;  5K7F A;  5CJ9 A;  4FET A;  3FXR A;  3D5R C;  3IHU A;  1QZZ A;  4BE0 A;  2DPD A;  1FEX A;  4X1E A;  1KQ9 A;  3RTR A;  2Y48 A;  5HLG A;  5JHF A;  5A2Q Z;  2H8W A;  5IP7 J;  5LD2 C;  2QQB A;  1FBQ A;  4UB6 C;  5IT9 Z;  3W2V A;  3EYY A;  3QQA A;  2X85 A;  3KE2 A;  2HOA A;  4U87 A;  5HNH A;  4I99 C;  1Y56 A;  2LYC A;  3N97 A;  1KA8 A;  3GCM A;  3CQZ J;  1SFU A;  3IWF A;  2R7T A;  1FBS A;  3A0H C;  4C30 A;  1YG2 A;  3ABT A;  3K1N A;  4NQW B;  4ANJ A;  1SC7 A;  1TW3 A;  3HHH A;  5L3C A;  4DBQ A;  2VOD A;  1XCB A;  2K5C A;  2BZT A;  2JA2 A;  3OYN A;  1PUE E;  1IO2 A;  3IKV A;  2P6S A;  3LQQ A;  3PNY A;  4XRM A;  2VI6 A;  1W4M A;  1HKT A;  1DU0 A;  4XR6 A;  1P92 A;  4HX7 A;  5ILV A;  3V42 A;  2M4K A;  2QZ8 A;  4CXF A;  3QRF F;  2IS4 A;  2OJE D;  5E18 F;  4UB8 C;  3NWT A;  2WV0 A;  4MEX F;  1BL0 A;  4EJU A;  2LFB A;  1BI3 A;  3ZQH A;  2OCC H;  2A6E F;  4M3F A;  3SFZ A;  4LD5 A;  2W84 A;  4AU7 A;  3PIO F;  1I6H J;  1S3J A;  4PSX A;  4OMY A;  2IBD A;  2DA5 A;  2FX0 A;  1SVO A;  1XCV A;  2HQN A;  2FSW A;  2HU9 A;  5FLX K;  5ICC A;  5EGO B;  1FSH A;  2DMQ A;  1RC9 A;  4RDU A;  2RVC A;  3BWG A;  3BG7 A;  3BQY A;  4MNU A;  4IHT A;  2IW5 A;  3TBI A;  1WKM A;  3LST A;  1R58 A;  1SMY F;  1IV8 A;  1VQM I;  2HTJ A;  4MFE A;  3SEQ A;  2B9S A;  3ELK A;  4XN0 A;  2EA2 A;  2UWM A;  5ERI A;  1IN8 A;  1QHH D;  2CU7 A;  4I01 A;  3JCU C;  2V7F A;  2R7R A;  2H09 A;  2CQQ A;  3IC7 A;  1S7A A;  3HTS B;  2DT6 A;  3RKX A;  2HYG D;  5B1A H;  1W7P A;  5LHH A;  2QF7 A;  2EIJ H;  1ZG3 A;  3OYD A;  1I1S A;  4TV7 A;  3A01 A;  3E5Q A;  4HQM A;  1S6L A;  4CA0 A;  3OOU A;  2LLK A;  3KP3 A;  3JRC A;  4OIN F;  3IV5 A;  4P55 A;  3ZQI A;  4ZTJ A;  2F4M B;  2BGC A;  1MD0 A;  4C2T A;  3JRH A;  3DBR B;  1YLF A;  2R7W A;  4XKC A;  3S3O A;  4EVI A;  5J8C A;  3HKZ A;  1MH3 A;  4L9J A;  1YE9 A;  1UB9 A;  2RGV A;  4E70 A;  4XSZ F;  4S0H B;  4IKF A;  3GX4 X;  3DBH B;  4IRG A;  2QSH X;  4LG0 B;  2JSP A;  3ASN H;  2PMZ A;  2EV0 A;  3KEQ A;  4ZZL A;  3S2D J;  3DWL E;  3U1D A;  1R71 A;  2STT A;  2A6H F;  2VOO A;  2QM3 A;  2VBW A;  3K2A A;  4UUT A;  4B4C A;  3QOE A;  2VUM J;  4XOR A;  2L7M P;  4E7I A;  2L9R A;  1VFC A;  3C1D A;  1SD5 A;  4LIV A;  3OL4 A;  1FT9 A;  1JGG A;  4ZDO A;  1W0T A;  5HLT A;  3LQR A;  1MZB A;  4KIC A;  5HVQ C;  5LRS A;  2HYF A;  3ML6 A;  3OV8 A;  4XN3 A;  2HDW A;  3FXM A;  4LMY A;  1G3T A;  4LOC A;  4AD9 A;  2M45 A;  2V79 A;  1Z3X A;  2EQR A;  1NH3 A;  3E6D A;  1H8A C;  3ZMT A;  3FZV A;  3TGN A;  2LMD A;  1VQN I;  1K6O A;  1U0J A;  3CUO A;  1S5L C;  3E6B A;  1OCO H;  5CPR B;  1BC8 C;  3R61 A;  1QZE A;  3KLO A;  1SD7 A;  3LNQ A;  5F1J A;  1IXS B;  2VLA A;  4EQQ A;  2X9D A;  4HYE A;  2ID3 A;  1UHS A;  4ASN A;  4EM2 A;  4PJJ A;  3BJ6 A;  5D5V B;  4IRI A;  3HHG A;  1PDN C;  2IS1 A;  1OR7 C;  3W2W A;  3CMA I;  5E1Z B;  2IEK A;  5JR3 A;  2LG4 A;  1QO0 D;  5EDN A;  1B72 B;  1KQ0 A;  4CGZ A;  2L7K A;  2CS3 A;  1XPX A;  2M7B A;  3GTO J;  1EH8 A;  3BG6 A;  2WTE A;  3MKY B;  3OR2 C;  2MLG A;  3BR6 A;  5FLM J;  4Y33 A;  3VOE A;  1MMD A;  4RMN A;  1JT6 A;  2MYS A;  1UHW A;  3OYC A;  2ZXH A;  1XDU A;  3Q5F A;  1MH4 A;  1XGN A;  4LIU A;  2KIF A;  3DKX A;  1T95 A;  4A3D J;  3LSM A;  1WSU A;  2HWV A;  3COA C;  1O3S A;  1JTY A;  3SQN A;  3CF2 A;  2MGQ A;  4GRI A;  3I53 A;  2O8K A;  2OQG A;  1ON2 A;  4GDF A;  4RLQ A;  1ETW A;  4CHU A;  1XSX A;  3CDL A;  5FRM A;  3BG5 A;  2GXA A;  2D1H A;  3VYT B;  1TP4 A;  4S04 A;  4NNJ A;  2VBZ A;  3JRD A;  4BE2 A;  2K27 A;  3O6B B;  3TO7 A;  3F22 A;  1RET A;  2VE9 A;  3TDZ C;  5LLQ A;  3MZH A;  1TWG J;  3SEZ A;  4M73 A;  4G6Q A;  4IRH A;  2L9S A;  2QQA A;  3ZN0 A;  2L0K A;  2H8R A;  3GWZ A;  3BR2 A;  1TW2 A;  3LA2 A;  1MMS A;  3O3K A;  4PZJ A;  1L3L A;  2JSC A;  1U78 A;  4HLX A;  2Q2E B;  4F3Q A;  5FD6 A;  5J1Y A;  4BQN A;  1YI2 I;  3GLL A;  4A6D A;  1C0W A;  2QSG X;  3FIW A;  1W5C C;  2TCT A;  2LOO A;  3FHN A;  2RC4 A;  5ILU A;  4O6J A;  4BAC A;  3M9A A;  2KRF A;  2KHM A;  3CC7 I;  3HUG B;  3BZK A;  4DZJ A;  3PFI A;  2HKO A;  3F8C A;  2GIV A;  2D5V A;  2VPL A;  2MD0 A;  3I58 A;  2LY2 A;  3FXL A;  2MW8 A;  4X6A J;  4JBA A;  4Y15 A;  4KMF A;  1BI0 A;  4G8X A;  1QNT A;  1V5F A;  2F4O B;  1F9N A;  2BY0 A;  4KT6 A;  1HKS A;  1TWF J;  4GO1 A;  3MWM A;  5LEJ A;  1X19 A;  4BXF A;  2HQ5 A;  3AFH A;  1MDM A;  3ERM A;  3KCC A;  1B9N A;  1I1G A;  4HEA 2;  2E34 A;  3HPH A;  3VFZ A;  1K4S A;  3K4B A;  4RS8 A;  2BBY A;  5E3N A;  3J80 K;  3FHZ A;  5DEQ A;  1NK3 P;  4UVA A;  4FE7 A;  3LL7 A;  4PJL A;  5AON A;  5E17 F;  2IA2 A;  1WH7 A;  5GP9 A;  1JHF A;  1SAN A;  3C7J A;  2V1X A;  4BJT A;  1LUJ B;  1E2X A;  2K4J A;  2CUE A;  4M9S A;  2CW7 A;  4XOP A;  2WC2 A;  2HVS A;  3H3V K;  4II2 A;  1NTC A;  1Y8Q B;  2KRH A;  1OR7 A;  2QQ9 A;  3GW2 A;  3K4N A;  1BI1 A;  5M3F J;  3BZC A;  3HIF A;  1G59 A;  2Y2Z A;  1TZL A;  1K7A A;  5C4X J;  1U9N A;  3E6M A;  5IT3 A;  4U0Y A;  2RN7 A;  4Z6Y A;  2ZXI A;  3CCQ I;  5DYM A;  3HTU A;  4ZDL A;  3V7C A;  1UHM A;  2EWN A;  2CYY A;  3HJE A;  4I0B A;  1ZR2 A;  1N77 A;  4M71 A;  4ZDP A;  3CC4 I;  2ZJP F;  2PMU A;  4AC0 A;  4OWR B;  4AYB N;  5C44 J;  1Y1W J;  4M3E A;  2LD5 A;  1VF9 A;  4RAY A;  4CIC A;  2RQQ A;  3CMM A;  5J40 A;  4BKX A;  2BW3 A;  1R00 A;  4MQV A;  2G9W A;  3IL2 A;  3S93 A;  1LJ9 A;  2AHQ A;  3R60 A;  4I09 A;  1P6R A;  3L1P A;  1ENH A;  3QYE A;  1VQ7 I;  2OCE A;  1X4P A;  3K0L A;  2HEO A;  2TDX A;  3OIO A;  4Q4Z F;  3PM1 A;  4CCJ A;  5D8L B;  3FKJ A;  1WGX A;  3OYG A;  1LFB A;  2XF6 A;  3TL4 X;  5J1R A;  4DYC A;  4IOC F;  4ON0 A;  2EZI A;  1XN7 A;  2FD5 A;  2YR2 A;  4JQF A;  4HAM A;  3DEU A;  4G6D A;  1D8K A;  1EF4 A;  1J9I A;  2OU2 A;  2KKO A;  5KAF C;  4G7H F;  2ZSH B;  4IEJ A;  2IS2 A;  3CDH A;  1BJA A;  2VE8 A;  3OY9 A;  2W4S A;  4PJM A;  3S17 J;  4FX0 A;  2R92 J;  4RM3 A;  2A5Y B;  3VOD A;  3A02 A;  3GFI A;  4XBF A;  1KON A;  3K1P A;  1FMV A;  1R5I D;  2L01 A;  2VIX A;  1IDY A;  2QEX I;  1H0M A;  3QOD A;  2JZY A;  2X6W A;  2OD5 A;  3J81 K;  3K70 C;  3E5X A;  4B1R A;  2P5V A;  2QLZ A;  4XLE A;  2A3S A;  1J0R A;  2Z99 A;  4E7K A;  4HRI A;  2DLL A;  2E5Z A;  1MBJ A;  2LSO A;  3WTT C;  3B73 A;  2KJB A;  3PQJ A;  5FGM A;  3OYF A;  4WCG A;  2AO9 A;  1EA3 A;  4CUG A;  2HVQ A;  3KP2 A;  2NYX A;  5L3D A;  3CO7 C;  2DXI A;  4IQ4 A;  1U6G A;  2X1C A;  1A36 A;  1G4D A;  3DLL F;  4FAS D;  4ZYA A;  1UJ8 A;  5HDK A;  1T2K A;  1JE8 A;  5DD4 A;  4B09 A;  2JMW A;  1VI0 A;  3QYB A;  1D1A A;  2RRE A;  5L3G A;  3BJO A;  3H1C A;  3TDU C;  4ABZ A;  2J5O A;  2CV0 A;  3OYL A;  3H9J A;  3BT9 A;  1T38 A;  2A6T A;  5F08 A;  2K7L A;  5DCM A;  1QVT A;  2W1O A;  4XNF A;  4XKW A;  2WB1 N;  1KU7 A;  1YOV B;  1BM9 A;  2R3S A;  3DF8 A;  5L3F A;  4Y7N J;  3MEX A;  4BEH A;  2ZFW A;  1KGS A;  4KIT B;  3RDI A;  4KMU X;  4QWQ A;  3KFW X;  3HSE A;  2DFF A;  2Q0O A;  1HBX G;  3S3M A;  3QPS A;  1E3H A;  3P9C A;  1G6N A;  3KYC B;  1WCM J;  2C6Y A;  4IVN A;  2ZME B;  3WG7 H;  3WTW C;  2HKX A;  1LVK A;  4I76 A;  2JN6 A;  5IY5 H;  4XKB A;  4Y17 A;  4HOB A;  1DQU A;  3MN2 A;  3JTG A;  3RJP A;  2DN0 A;  3M07 A;  4UUS A;  4BNC A;  2DFH A;  3ONQ A;  1PUF B;  1TWH J;  3IUO A;  4XMY A;  1LVA A;  4M9X A;  4I6Z A;  4JYK A;  3REO A;  3TKY A;  2V1N A;  2VQH A;  1QA6 A;  1AU7 A;  1DDN A;  3LFU A;  4MTD A;  1RKT A;  1XSV A;  4YFX F;  2CRG A;  4G9Y A;  1RRJ A;  3L09 A;  3SDG A;  2L3D A;  5F27 A;  1MKM A;  2I5U A;  3K7A J;  5J8F A;  1LQ1 A;  3VYU B;  3TP0 A;  1AHD P;  5H2F C;  1O7L A;  1ZTR A;  2XF5 A;  2Y0S N;  2ZME C;  4XKV A;  2R5Z A;  3OS2 A;  4P1W A;  1V5E A;  2LKS A;  2X51 A;  3ECH A;  4FX4 A;  2O7O A;  4BH9 A;  3FKI J;  1N78 A;  5CQE A;  1AWC A;  2QEN A;  3S14 J;  2CH0 A;  1YO5 C;  2ELH A;  1IRZ A;  2JWT A;  2LBF B;  3I55 I;  1BI2 A;  2KRC A;  5GPA A;  4QIW N;  2MH9 A;  2MA3 A;  4LB5 A;  4E7S A;  3JRE A;  3E0J B;  3GVA A;  2R7D A;  2XPW A;  1MJB A;  2XGD A;  4DW6 A;  3QWL A;  4PCQ A;  2K9M A;  2PJR B;  4BBS J;  3MKW B;  3H5A A;  4DJA A;  3BZ6 A;  3MAJ A;  1SD4 A;  4EJO A;  4NUB A;  4A3G J;  4XOT A;  1K61 A;  3OYI A;  2EIM H;  2W82 A;  4QLC U;  2VPR A;  1Y0U A;  2GA1 A;  2QQ8 A;  4CH7 A;  3I9V 2;  3J7Z I;  3GZ6 A;  2BOL A;  5EG0 A;  3EUA A;  5FKK A;  5FLX Z;  3RI4 A;  2GOX B;  1SVL A;  3D5L A;  2WY7 Q;  4UUV A;  1LDD A;  1FP1 D;  4Y4R A;  2IT0 A;  2IGK A;  3MKL A;  2AXL A;  1F36 A;  4LLG F;  2LKX A;  4N9H A;  3WG9 A;  1VTN C;  4ZJZ A;  1BC7 C;  2EIL H;  4BDZ A;  4C2U A;  3H5R A;  3G4S I;  1FIA A;  2KFD A;  4AIJ A;  1YHQ I;  1I50 J;  2IGO A;  4LIT A;  1U5T C;  2XAH A;  1XS9 A;  4D5C A;  1H89 C;  2E2J J;  4WF2 A;  3TW6 A;  5D6E A;  2DPU A;  3A03 A;  5AIP A;  1T33 A;  2VON A;  1V55 H;  3MQ0 A;  2IGN A;  1EJ9 A;  1IN6 A;  3L9F A;  2MBF A;  2OA4 A;  1UEL B;  1V3F A;  4M74 A;  2HOT A;  2JK3 A;  1YW7 A;  2XAG A;  1R4M B;  3FK7 A;  1BIA A;  4A5N A;  3DU5 A;  4YG2 F;  4B47 A;  4ETS A;  1ZQ3 P;  4PFO A;  2GBY A;  2VJ4 A;  1GHC A;  2NNN A;  1TT5 B;  1ZR4 A;  4Q48 A;  1EV7 A;  3QOP A;  4XRS G;  5LEK A;  3L2V A;  1ZLK A;  3FXK A;  4UVC A;  3KX2 A;  2Y0M A;  4ENJ A;  2XDV A;  2IVM A;  2ZO4 A;  3HOY J;  5ILS A;  5K5Q A;  4UV8 A;  3CCE I;  1G8X A;  4RA2 A;  3K10 A;  2E35 A;  3R6S A;  1XGM A;  3C2H A;  3CCS I;  4F91 B;  2DCE A;  3CJN A;  5J3L A;  4AUX A;  5LGU A;  4WXC A;  1ETX A;  1FSE A;  1RKW A;  2DYR H;  2HXI A;  3Q9V A;  4PJN A;  2ZME A;  2JA6 J;  2H6B A;  5L3B A;  1B1B A;  2JRM A;  2DT5 A;  2FML A;  3GLX A;  5HOD A;  3S15 J;  3HZJ A;  4M3D A;  2VJJ A;  3CJQ B;  5DUK A;  2F6C A;  2D1V A;  3QP5 A;  2CFX A;  1MBH A;  2OF7 A;  2UXX A;  3L7W A;  4ZC3 A;  1I5Z A;  4BHC A;  3M8J A;  1K6Y A;  3EYI A;  2EFN A;  3V8J A;  1XC5 A;  2R7S A;  1OIS A;  1Z67 A;  2M87 A;  2X4H A;  4XL9 A;  5IOY A;  2K3P A;  4I7H A;  3I4N J;  3BPX A;  2DOA A;  5FKL A;  3KPH A;  2QBY A;  3OYE A;  4CCN A;  1ZHF A;  3DBL B;  2ZXW H;  1KU2 A;  2ISY A;  2P81 A;  2CSO A;  2MC4 A;  3GME A;  2I10 A;  1LEA A;  2FUG 2;  1K78 B;  3EUH C;  3P9K A;  1REP C;  4U88 A;  4A3B J;  1BR2 A;  2CQ7 A;  1HCR A;  1X4O A;  2GQQ A;  2L9V A;  5HS9 A;  3F8M A;  4PUS A;  2K02 A;  2KDO A;  1WVR A;  2ECC A;  1ZH5 A;  2VT2 A;  5LGT A;  2E1N A;  2NAZ A;  3Q3S A;  2X6Y A;  2WAQ A;  1SMT A;  2DA7 A;  3B6C A;  3ECO A;  3I59 B;  2BY2 A;  4MHG A;  2A07 F;  3ZQ7 A;  1S8N A;  1JXS A;  2HXO A;  3TOA A;  1D0Z A;  1U5T A;  3DQV C;  1D0X A;  5KVR A;  4NC6 A;  1X3U A;  4UVB A;  5B1B H;  3CP2 A;  2LC2 A;  1X1D A;  2CQK A;  1CF7 A;  5C4J J;  1LE8 A;  2DT7 B;  2ZJR F;  2E1O A;  2ME0 A;  2CUJ A;  3G3Z A;  2P7C B;  2V4J C;  1UAA A;  3K2Z A;  1BA5 A;  5FKO A;  2WA0 A;  4LJZ F;  3GTP J;  5DUI A;  4JX4 A;  5FFX A;  1D1B A;  2NS0 A;  4DIQ A;  3H92 A;  2FBI A;  2WAE A;  4H0E A;  1BOA A;  4LLL A;  1IJW C;  1IV6 A;  4KFC A;  4Y3O A;  5F1R A;  4CYC B;  2ESN A;  1FOY A;  5EEH A;  2W24 A;  5D5X B;  2F5E A;  2O03 A;  1OMI A;  2KMU A;  1JKP C;  3M4O J;  3BTC A;  5K5R A;  1RUO A;  2DA4 A;  2F4I A;  1MMG A;  2YX4 A;  2QGU A;  2Z5U A;  4N4N B;  3CO6 C;  2UXN A;  3ZRG A;  2R0Q C;  5DV5 A;  1I39 A;  2QVO A;  3QPH A;  2XB0 X;  1F5T A;  3WU1 B;  1JKR C;  3WTV C;  2ACJ A;  4GFB A;  1P7J A;  5F04 A;  1UZC A;  4L9N A;  1CGP A;  4LK0 F;  2KT0 A;  3UKG A;  5E1W A;  5ICF A;  4D5F A;  5IOZ A;  3SZT A;  5DTD A;  1R4N B;  1TQM A;  3G2B A;  2RKH A;  3ZQC A;  3M8F A;  1GVD A;  3ZMD A;  2VKE A;  1N75 A;  5E20 A;  2D45 A;  4M72 A;  4CSW A;  3J80 Z;  1F1Z A;  3ASO H;  2DJN A;  3MCZ A;  4NC8 A;  1PJR A;  3T8T A;  3HOZ J;  2EV6 A;  2WAF A;  3P5J A;  4XLF A;  3RPQ A;  5LBQ A;  3HXL A;  2UUZ A;  3LSG A;  4GYI A;  2PJP A;  2RNG A;  2QYO A;  2Y9Y A;  2PX9 A;  1HDD C;  2GIZ A;  1TL8 A;  2PEX A;  1ZLJ A;  4DZP A;  4QTR A;  3BJA A;  3E3V A;  3BG9 A;  3DCF A;  3WTU C;  2G7U A;  2I8D A;  5HLI A;  2ICW G;  3EUH A;  3LWF A;  1LKX A;  5GAH J;  2FOK A;  4IHV A;  2WAD A;  3WTS C;  2QKL B;  5HDG A;  1YJW I;  1AKH B;  5HS7 A;  4EGZ A;  3I64 A;  2XKP A;  4B44 A;  2R7Z J;  4GXO A;  1MBE A;  2V26 A;  4GGG A;  4D1Q A;  3KEY A;  4RAG A;  3CJR B;  3RCO A;  4O3M A;  1R5H A;  2AQF A;  3UNG C;  2K3F A;  1ZK8 A;  2F5C A;  3JAM K;  1P4A A;  3CDI A;  2FJ1 A;  3H0D A;  5M5W J;  1NG7 A;  1ON1 A;  4IHW A;  4IHX A;  4WX9 A;  2JJ7 A;  3QU3 A;  2DA1 A;  1GDT A;  3R0J A;  3D5S C;  3UR3 C;  4KYW A;  2DYS H;  4IPA A;  3GBG A;  3ULQ B;  4LG3 A;  3B6A A;  1R6R A;  2P0W A;  4NQW A;  2R7O A;  2HI3 A;  5IYD J;  5J4Y A;  3I3L A;  1FJL A;  3GEZ A;  3PSI A;  3I59 A;  4HX4 A;  2G0E A;  2AS5 F;  4OIO F;  4L0Y B;  1IW7 F;  4BHB A;  1HSJ A;  3BQZ A;  2M0M A;  2M5W A;  1E17 A;  4IHS A;  4YFN F;  2NRA C;  2KPM A;  1Z21 A;  4HNT A;  3IWZ A;  3AKZ A;  3SXY A;  2CQX A;  3GFM A;  1F4K A;  1V4R A;  5F0F A;  4BQQ A;  3SFI A;  1RI7 A;  1ODD A;  2K9N A;  2EBI A;  3CUQ B;  4NBQ A;  1ORK A;  3WTX C;  2L4A A;  4BXU A;  2BXZ A;  4BXX J;  3JRG A;  4CDG A;  1SVM A;  1HDP A;  3K69 A;  5EGO A;  1GT0 C;  3J81 Z;  1B8I B;  2M0C A;  3HG9 A; 
#chains in the Genus database with same CATH homology
 1VQ6 I;  3I55 I;  2QEX I;  3CME I;  2JQ7 A;  1FOW A;  1VQP I;  2OTL I;  4UY8 I;  2NXN B;  2E34 A;  3CCL I;  1FOX A;  1VQN I;  3J7Z I;  3CCR I;  5DM6 F;  3CCM I;  5GAH J;  2ZJQ F;  3DLL F;  5JVG F;  1YJW I;  3PIO F;  1YJ9 I;  4V19 K;  3G71 I;  2QA4 I;  3I56 I;  3CMA I;  4IO9 F;  3CD6 I;  5GAG J;  5DM7 F;  3G4S I;  2K3F A;  1YHQ I;  3CCQ I;  1VQM I;  5GAE J;  3CCV I;  2ZJR F;  3CC4 I;  1ACI A;  2ZJP F;  2OTJ I;  1YJN I;  3CC2 I;  1VQ8 I;  3CJT B;  1VQO I;  3PIP F;  1YIJ I;  3J7Y J;  1VQK I;  5GAD J;  1FOY A;  3CF5 F;  1VQ7 I;  1VQ9 I;  3CCE I;  1QA6 A;  3CCU I;  1S72 I;  3G6E I;  2E36 A;  4IOA F;  1MMS A;  4IOC F;  1Y39 A;  2E35 A;  3CCS I;  1VQ4 I;  1YI2 I;  1VQL I;  1HC8 A;  2H8W A;  3CCJ I;  1VQ5 I;  3CC7 I;  2FOW A;  1YIT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...