2RDPA

The structure of a marr family protein from bacillus stearothermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
140
Chain Sequence
AMNERTVAELEKLLRYIAANLKQRGREILTNYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDEHVVRIRLLEKGERIIEEVIEKRQRDLANVLESFSDEEIVVFERCLRKLHQEMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords putative transcriptional regulator MarR
publication title The structure of a MarR family protein from Bacillus stearothermophilus.
rcsb
source organism Geobacillus stearothermophilus
total genus 48
structure length 140
sequence length 143
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rdpA00
1USTA 1G3SA 4XSZF 5TRDA 2RDPA 2CWEA 1BC8C 4GGGA 4OINF 3S2WA 3FZVA 1DPRA 2M87A 2IVMA 1B9MA 4I7HA 4RAYA 3ZQ7A 1QGPA 4HV6A 4ZYGA 1KU7A 4EV0A 3MFKA 2NS0A 5CVIA 2AS5F 4I01A 1QBJA 2A5YB 3TKYA 3DV8A 5DCFA 3TQNA 1JGSA 2XAFA 1BBYA 1ONVA 2XUBA 4A5NA 2XKPA 4HA8A 4CO8A 1J59A 3V8LA 2P7CB 2W25A 4AIKA 5TJJA 3K1PA 1ZRCA 2EFNA 3ISPA 4ENMA 1XDSA 4G8XA 4B09A 1LVAA 1R36A 4KIFA 1QZZA 5D6FA 1FYLA 1XSXA 3KZZA 2JZYA 4B8XA 1Z9CA 3FX3A 2QM3A 1YW8A 1XDUA 3SFZA 2Q2EA 2P5KA 3QPTA 3B02A 1NHAA 2UXXA 2Y0MA 3CO7C 2HFHA 2NAZA 3CDHA 2ZFWA 3RPUA 2EV0A 5ED4A 1U5TC 5E8GA 2NNNA 3HTUA 3T0YA 1IRGA 4LK1F 5FD5A 4LG0B 1R22A 1PUEE 3JAMZ 2NYXA 4LG0A 5F64A 1K78B 4HF0A 3K0LA 4HOBA 1YS7A 1K78A 1W4MA 4G6QA 2DAOA 3LAJA 4YG2F 2F5DA 2R7FA 4A5MA 2ZMEB 4PDKA 4KYWA 2ZMEA 3RYPA 4HDUA 1LB2A 4GCVA 2ISYA 3KP3A 4N9HA 5LRRA 3BPXA 5CVUA 5LHIA 3AAFA 4ZYDA 3CO6C 1MD0A 4Y17A 3G73A 2KKOA 4WCGA 3H92A 2XAJA 4OIRF 3KETA 3C18A 5J6XA 2EV6A 2GA2A 1RIOH 4YIFA 3LA2A 3TO7A 3L00A 3J81K 2CW0F 4CHUA 4IRHA 1FP2A 1QQIA 4M71A 1MJBA 2XVCA 3HTSB 2GXGA 1BN5A 2PMHA 3B73A 3WGHA 4I2OA 5IT3A 1YW7A 3F8FA 4AD9A 3J80K 1IZ1A 2ISZA 1EH8A 2L01A 5E8IA 1DP7P 3DPLC 2PMUA 3RYRA 1SD5A 2GZWA 2FXAA 2UXNA 3JTGA 4UXNA 5LRSA 1J9IA 3V7SA 1J2XA 2M45A 1U78A 1YG2A 3BJAA 4UHTA 2VBWA 3GXOA 2OZUA 2GWRA 4MQ9F 4HLYA 5LLQA 1S3JA 2FF4A 1B6AA 3ULQB 1IUYA 5E1WA 2XRNA 1BI1A 2ZXJA 1TLHB 2BBYA 3W6JB 4UVBA 4LB6B 1XGNA 1KGSA 1XGMA 1B9NA 3FXRA 1ZHFA 2VBYA 2HWVA 3TGNA 4HX4A 1ZYRF 1R1TA 2KIUA 3L9FA 2MBFA 2QENA 3L09A 3HHHA 4HQMA 1W5SA 1I5ZA 5CYVA 3RI4A 4WF2A 1IXRC 1WWXA 3U1DA 1LEAA 2ZNZA 4BAYA 2HQRA 5L3DA 1BI2A 2DK8A 3FM5A 3WGIA 2VE8A 5E20A 3REOA 3ABUA 2CQKA 1PDNC 2ZKZA 4L9NA 4HX8A 1O7LA 2VONA 5ICFA 4G7HF 4WX9A 5K5QA 3M7GA 3I59B 5L3EA 3I59A 2Z3YA 5ICCA 4ZZLA 1ZGAA 3V4GA 2BV6A 1ON1A 1HKSA 3CUOA 3E5XA 3F6OA 1LDDA 4BNCA 2COMA 3R6SA 5D4SA 2IW5A 1L0OC 5DUIA 4CZZA 2O61A 5JI6A 2HKOA 2DU9A 2HS5A 3K69A 4CICA 3HSEA 2JRTA 2VT2A 3LA3A 5ICEA 1G3TA 3EDPA 2MC3A 3D5LA 3WTTC 1HKTA 2KRFA 4EM1A 2XIGA 4Q47A 3LQQA 2A69F 4R79A 2G7UA 1Z7UA 2IPQX 5A2QK 3DEUA 3EQLF 2PJPA 5IT9Z 2E1CA 4UNOA 4M73A 2XHKA 3RTRA 2DQLA 4CYDA 4ENJA 1GXPA 3I53A 4OIQF 1TBXA 3WGGA 1HBXG 3FWEA 4E70A 4G6DA 1U8RA 4UV9A 2DLLA 4RGSA 2D1VA 4A6EA 3KFWX 2XKOA 2FBHA 5H6QA 3Q9VA 4RB0A 5J8FA 3O6BB 3I0TA 2W57A 4Q4ZF 3N4MA 5EEHA 3BJOA 3GWZA 2RN7A 4O3MA 4LD5A 4WXDA 5LBQA 1F4KA 1U5TB 2D2WA 4NQWA 1P4AA 1U5TA 1R58A 5BMZA 3EYIA 4FX4A 1AWCA 1YFHA 4A0YA 4OMZA 3F3XA 1FSHA 3KP6A 1LNWA 1Y0UA 2V1XA 3K1MA 4G7OF 3SZTA 1J75A 3E5UA 2MH9A 5FLXK 2BE5F 4EGZA 3P9IA 1G4DA 2K27A 3NEUA 3R4KA 3ABTA 2OZ6A 2P5LC 4K2EA 2DW4A 3GFJA 5FGMA 2FNAA 3HHGA 1R1UA 2HZTA 2M5WA 2DPDA 1B59A 1FT9A 3LQRA 2FMLA 4AIHA 1EH7A 2HOEA 2HYGD 3KLOA 3WE3A 1BC7C 1XN7A 4EM0B 2DI3A 1KQ8A 3WE2A 1TW2A 3HRUA 2R3SA 4BYYA 5D5XB 4XLPF 4CDGA 4A6DA 1R5GA 2STTA 2NRAC 2OU2A 3R61A 1J7KA 1JHHA 4N9IA 2DFIA 1KU2A 3GF2A 4RAZA 4N0BA 3GO5A 4R1HA 2XAQA 2K7LA 5D6EA 4F7ZA 5FB2A 2V1UA 1W5TA 2FBIA 5DYMA 1YW9A 3GZ5A 4L5IA 5K5RA 4U0YA 3F8CA 2QBYB 4MHGA 3ZMVA 2QBYA 2WWYA 4ENKA 1IF1A 4BH9A 5HOOA 4IPAA 3P7NA 2VBZA 2A61A 1IAWA 2Z9OA 1YQAA 2VBXA 2EB7A 1H9GA 4MGRA 2V79A 2IP2A 1KA8A 4KN7X 3VFZA 4S04A 1SAXA 1TQIA 4EJTA 3VOEA 2FEZA 3IL2A 4ESBA 3OOPA 4KT5C 2IA0A 3V8JA 1Z05A 3ZMZA 1RNLA 4L9VA 4KMUX 4XBFA 5D4RA 1G6NA 2Y75A 4BXUA 2FBKA 3FMQA 3C7JA 2OD5A 1BIAA 3K1NA 2HYFA 5LEKA 2IA1A 4IHTA 3I58A 3GZ6A 5ICGA 1WKMA 2O6GE 3IWFA 5FFZA 2HR3A 1HSJA 1GVJA 4M9SA 2DQRA 2ZNYA 4MTEA 2G9WA 4HAMA 1LEBA 1MZBA 2Z99A 3W6KB 2DK5A 1YIOA 4PGGA 5BOXA 2KIMA 4DQ2A 2YX7A 2A68F 4KMFA 3QPHA 4LK0F 2EA2A 1O3TA 2MH2A 3ZP5A 2EFWA 3KZYA 3I71A 1HW1A 1KQ9A 2ESHA 3TO6A 4M74A 1QNTA 1XGOA 1Z6TA 1KYZA 3HIFA 4M9ZA 2XROA 1BJAA 2WV0A 1O3QA 3BOQA 1U3EM 3KP4A 4M72A 5E1XA 2P6SA 3RIRA 3CUQA 1EV7A 2GQQA 1ZG5A 1R1VA 1S7AA 3I54A 4DNCA 3ML6A 3QP5A 3SXYA 2E7XA 1T0FA 1IN5A 1OR7A 2HGCA 2BYVE 2P6TA 2XASA 4EGYA 2YR2A 1IXCA 1T39A 4M9XA 4YFKF 1S29A 3F8MA 1CF7B 2H6CA 4L18B 3DFGA 4P96A 1CF7A 4EJWA 4JK1X 4EJVA 3HRMA 1E17A 4HQEA 2EFPA 4H0EA 4I09A 4OIPF 1O3RA 4LJZF 1WI9A 3ZMUA 1BM9A 3M9AA 1XMAA 1CGPA 1DUXC 5JFRA 1XSVA 3IKTA 2CGPA 3H3ZA 2Y48A 1DPUA 1XMKA 2R7DA 3C1DA 3F23A 4M6XA 3KP2A 3FF5A 1MKMA 3I5UA 4KDPA 2OQGA 4I0AA 4A0ZA 3DXJF 3C3WA 2Z33A 4MTDA 3MQ0A 1UFMA 2QZ8A 4ZYHA 4UUVA 2IJLA 2V6CA 2J5PA 2BGCA 2JTVA 2XAHA 1K79A 4GYIA 1IN8A 1QZYA 1T98A 1LJ9A 5ILVA 4LLGF 4RB1A 3QRFF 1Z6RA 1RZ4A 2GIVA 5CVVA 5BPDA 4U7BA 4RS8A 5HDKA 4MQVA 3J80Z 1FY7A 1STZA 3P9CA 2JPBA 4IJAA 1JXSA 5K5OA 3GEZA 2ADUA 3FXUA 4WXHA 4QWQA 5HLHA 2HDCA 2ZJ2A 1MJAA 1USSA 4AWXB 2VXZA 3M8EA 3QOPA 1SD7A 1XCBA 3ELKA 3JSOA 3QU6A 4ETSA 1ZGJA 2O3FA 4Q5SF 3DP7A 4KICA 5AIPA 4JBAA 1K6OA 3RJPA 6PAXA 2EJRA 3TO9A 3ZMSA 4GYGA 2OBPA 1SFXA 3O3KA 4HBLA 5LGTA 4LB5A 3HYIA 5BS6A 2P5VA 1P6RA 3FXQA 2D1HA 3WU1B 1ZLKA 2M30A 2GAUA 4OMYA 3QU3A 5F1RA 2P4WA 2QLZA 4HYEA 2PEXA 4P55A 4G9YA 2EWNA 2PBIA 1ZG3A 2RGVA 3T5XA 5L3GA 2LF8A 1REPC 3TOBA 3CUQC 2MA3A 1FYKA 4HX7A 2QVOA 1T6SA 4KUMA 2ZCWA 1F5TA 5ERIA 1LDJA 4TV7A 2UZKA 4L9JA 1I27A 2OQRA 1D5VA 2QWWA 1D8KA 2DT5A 3HRTA 3U9GA 3E6CC 1FSEA 2W85A 2IRFG 1HW2A 5HS9A 1V3FA 5BPIA 1UHWA 4HV5A 1C0WA 2YU3A 2A3SA 2VN2A 3SHFA 1IN6A 1OYYA 2CYYA 5HS7A 1QPMA 2H6BA 1YTYA 3KCCA 3TDZC 2X4HA 1O7FA 2VOPA 3JW4A 5L3CA 3GFIA 3G3ZA 2VT3A 5D5WB 2DO7A 2EFQA 2A07F 2B0LA 2E7WA 5ILUA 5E17F 5FO5A 4L5JA 3HSRA 2A6EF 2OA4A 3ERED 3F21A 4L0YB 1I6XA 2OAZA 2J5OA 5LGUA 4AIJA 3HUGA 3DQVC 3IKVA 1ZRDA 2KIFA 1OPCA 4HDVA 1MDMB 2IT0A 5A2QZ 1MDMA 4A2UA 4U0VA 3LAPA 3FM3A 5FFXA 3CJNA 5DD8A 3I4PA 3P9KA 2JPCA 3COAC 4BHCA 2IA2A 3T1BA 2UWMA 4CGZA 1OKRA 2O0YA 2FNPA 4OIOF 4MEYF 5F6FA 3SQNA 4O6JA 2L4AA 4IHSA 4LGWA 4XRFA 1R5HA 1T2KA 1OMIA 1D8JA 2M1BA 1UB9A 3F6VA 1Z91A 2HTJA 3GVAA 1Z1DA 4FHTA 2A6HF 4YFNF 5DCMB 5DCMA 4HW0A 4ESFA 3RKXA 3M8FA 3PFIA 2W84A 4AVPA 4EQQA 2FA5A 1FBSA 3ECOA 3MEXA 2RNJA 2WTEA 2Q8KA 1ZG1A 3WTXC 1RUNA 5FLXZ 5D5VB 1FBQA 3JSPA 1SFEA 4P9UA 3NRVA 1XGSA 1H0MA 4EJOA 4KIBA 5HLIA 4LMYA 1TNTA 1ZN2A 3IRQA 1X3UA 2BEOA 2RKHA 2PQ8A 4ENNA 4WWCA 2VC0A 1D3YA 4P5OA 3WTUC 2M8EA 4I98B 1O57A 3J7AO 3OV8A 2PI0A 3RPQA 4S05A 5DD4A 4XSXF 1FOKA 1SD4A 2HTSA 4I0BA 1P4XA 3IC7A 2PG4A 2LSOA 2V9VA 3K9TA 4WK8F 1H9TA 3DPTA 4YIIA 1WSUA 1WQ2A 1KQ0A 5AONA 2KJBA 1HKQA 3GFLA 2NNYA 4HF1A 1IN4A 1MJ9A 1KU9A 1IW7F 5HVQC 3GFMA 4L0ZB 3JAMK 1W7PB 1W7PA 2QQBA 3WTYC 4FX0A 1R23A 2D45A 3V7CA 5JHUA 3WODF 5ILSA 4CXFA 3FHZA 3GX4X 1ULYA 3BPVA 1TNSA 3R0JA 3R0AA 3KEOA 3WTSC 1QO0D 3KEQA 3QAHA 3E6MA 2F5CA 5CJ9A 3R60A 1GHCA 4IXAA 5KK1A 4HF2A 2ACJA 1BI0A 2ESNA 4MEXF 4G94A 2FSWA 2CSOA 1I1SA 3JTHA 5JR3A 2YSRA 5D8LB 3F72A 3KE2A 5E18F 3BROA 1BOAA 4ZH4F 2EV5A 3DKWA 1KYWA 1ZRFA 1IXSB 3HOTA 5D5UB 1P92A 3CUQB 3T8RA 1A04A 2P7VB 1UCRA 5BQTA 1J0RA 1PP8F 1HXDA 3KP7A 1FP1D 5HDGA 2O03A 4Z2YA 3ZMTA 1SFUA 4EMSA 3E6DA 3E5QA 4G7ZF 2QQ9A 1YYVA 2ZBKA 4GXOA 1S6LA 5LHHA 2V1DA 5LHGA 3MZYA 2FRHA 3NQOA 3PQKA 5AIQA 3BP8A 1BI3A 1UHMA 2CG4A 4RGUA 3FMSA 5JVTA 2LDUA 3GLXA 1TQMA 4EVIA 3V8KA 2K02A 3WTWC 1J5YA 2GA1A 3BY6A 1JE8A 1SMYF 2Q0OA 2AXLA 2K4JA 4ESJA 2MLGA 2LNBA 4U0WA 1ON2A 1R7JA 1TTYA 2VOOA 4M6YA 4KFCA 1RI7A 3ROUA 2FE3A 4D0PA 1U6GA 4BHBA 1OYWA 3EETA 4YFXF 3E3VA 2RQPA 3HOSA 2K86A 3MCZA 1DDNA 5DUKA 1AOYA 3IHUA 3RKYA 3J81Z 3O2PE 2GXBA 3BWGA 2FQ3A 1SD6A 5L3BA 3IRRA 2EFOA 4Y13A 3VB2A 1B1BA 1KU3A 2L4MA 1S7OA 1T38A 3ZPLA 3HSFA 4LFUA 5DEQA 2P8TA 4U88A 3WTZA 4ZZDA 4RB3C 4LLNA 4BHPA 1G3YA 4KA4A 2G7HA 2YPRA 3VEPA 4GO1A 5KVRA 3F22A 1W7PD 2L54A 1LQ1A 2W24A 1YS6A 4NHJA 1YLFA 3RDIA 1VTNC 5HLGA 4PCQA 1ODDA 4RGXA 1TW3A 2FMYA 3U2RA 4U7DA 2L02A 4WXCA 1PP7U 3HRSA 1Q1HA 1FBUA 4IRIA 1F1ZA 2MD5A 3D0SA 2PFBA 3CTAA 4IRGA 4UVCA 4ASNA 5K1YA 1ZLJA 3L2CA 3TDUC 5IT9K 4RGRA 1HSTA 1MGTA 2H09A 2L3DA 4UV8A 2HKXA 4EM2A 3VODA 1R00A 2EA4A 4L9TA 4HLXA 1B4AA 4UVAA 2O8XA 2XV4S 1FLIA 1I1GA 1P4WA 2XGXA 2F5EA 3F8BA 1FPQA 1GXQA 2F2EA 3BJ6A 1ZARA 3M1EA 1XB4A 3MAJA 1LDKB 1BIBA 3L7WA 3CLOA 1FZPB 4QLCU 3E97A 2DTRA 4MNUA 3ZMDA 2Z5UA 2HQNA 3DF8A 3MWMA 3WU0A 3BDDA 2QQAA 4FT8A 2VC1A 5CLSA 3F8NA 1FNNA 4Q48A 1G3WA 1ZH5A 3FMRA 2EK5A 1IRFA 1FWZA 2RC4A 3WTVC 2HEOA 5H6RA 4A0XA 3N97A 1YO5C 3GUDA 5HS8A 2ZO4A 2ETHA 1OYIA 4KN4X 3QP6A 3LWFA 5J8CA 1XD7A 2X0LA 4ZYEA 2H27A 1F9NA 2CO5A 2FOKA 4IF4A 4O5VA 3EUHA 1ZAOA 5H20A 1HW5A 3K2ZA 3LA7A 3MZHA 2JT1A 2FU4A 4HZFA 4LLLA 2CFXA 1FX7A 3V7RA 4EJUA 2RV8A 3LFKA 2E1NA 3TOAA 4PZJA 3I64A 5EEGA 4R8HA 3LSTA 2WC2A 3EYYA 3ECHA 5L3FA 1ZREA 2STWA 3Q9SA 5HDNA 1S8NA 2VE9A 3PQJA 1V4RA 4ON0A 1TQPA 1K7AA 5D8KB 5FD6A 1E2XA 5CVRA 3GYHX 1FC3A 4P9FA 2JSCA 1U2WA 3T8TA 5LGNA 2F5FA 5E1ZB 4XLNF 3KLNA 4I02A 1HQCA 4PGHA 4KIGA 2RVCA 4KNYA 2DPUA 2PN6A 3ZN0A 4Y15A 2QYOA 2PLYA 5DDGA 4OOIA 4OU0A 2QUFA 2MLKA 2VODA 3Q5FA 1SMTA 4BQAA 1JHFA 2DBBA 3GW2A 4JQFA 3IWZA 4A12A 2XAGA 2TDXA 2ELHA 2H94A 2YX4A 3WG9A 1EH6A 1O3SA 1XCVA 4NB5A 2C6YA 5CVJA 1P2FA 3SZPA 1L3LA 1IN7A 3KP5A 3RKWA 3ZN1A 2LKPA 3E6BA 5LEJA 1XSDA 1RUOA 4IVNA 5DV5A 2KJCA 1FYMA 3H3UA 2K4BA 2LF7A 1WRJA 4RB2C 3BZ6A
chains in the Genus database with same CATH superfamily
1USTA 1G3SA 1P9QC 4XSZF 5TRDA 2RDPA 2CWEA 4XNFA 4BGDA 1BC8C 2KHMA 1WJCA 3IAM2 3AG4H 3K4LA 3CJQB 4GGGA 4OINF 1J09A 3FZVA 3HB9A 3S2WA 4BY1J 1DPRA 2M87A 3CC7I 2IVMA 1B9MA 4I7HA 4HNVA 4RAYA 3DTEA 2H8WA 3S3MA 3PNYA 3ZQ7A 1QGPA 3GZNB 4HV6A 4ZYGA 4XK4A 4ZC3A 1IUFA 3H0GJ 2JVHA 1OCTC 4XRMA 4EV0A 1KU7A 3MFKA 1POGA 4AM3A 2NS0A 5CVIA 2AS5F 1VNDA 4I01A 1QBJA 1SANA 3K70D 1ZR4A 3K70C 2A5YB 3TKYA 5M5XJ 3DV8A 5DCFA 3TQNA 1JGSA 1VQ6I 2GBYA 2XAFA 1BBYA 5JLWA 2X1DA 2FUG2 1ONVA 4DW6A 1DU6A 2YUSA 2XUBA 4A5NA 2PMZA 2XKPA 1Y0NA 3FXLA 3PSIA 2GOMA 5GPAA 4HA8A 4CO8A 1J59A 2R7OA 3MVPA 3V8LA 2P7CB 2W25A 4F3QA 4AIKA 3L2WA 4OWRB 5TJJA 3K1PA 1ZRCA 2EFNA 3ISPA 2HVQA 2M0MA 3DLAA 4ENMA 3C2BA 1XDSA 1CQTA 4G8XA 4B09A 1LVAA 3EUHC 1R36A 4KIFA 1QZZA 1X2NA 4HSRA 1QU3A 5EJCA 1X58A 5D6FA 1FYLA 1XSXA 1M1EB 1VQ7I 4Y52J 2EILH 3PFYA 3KZZA 2JZYA 2PJRB 2NVXJ 3TW6A 4B8XA 4MLOA 1Z9CA 4A3CJ 5J40A 2PJRA 3FX3A 1SFKA 4NDLA 1ZQ3P 5IYDJ 3B6CA 1R71A 2L0KA 2QM3A 5TGTA 2O9LA 2Q2EB 1YW8A 2WADA 1XDUA 1AKHB 3SFZA 2Q2EA 2ZSIB 4PFOA 1AKHA 3JRBA 2P5KA 2VIXA 1QVTA 3B02A 1UMQA 3QPTA 1NHAA 2LD5A 3JR9A 2UXXA 4D9JA 4II3A 4BJ5C 2Y0MA 1N77A 4DJAA 3CO7C 2F5VA 2HFHA 5IP9J 2NAZA 4Y33A 3CDHA 2VKDA 2MC4A 1VQ5I 2ZFWA 3ZQHA 3RPUA 3SJMA 4BQQA 1S7EA 2EV0A 5ED4A 3D1NI 3IH2A 2DJIA 3IP4B 2RQQA 1U5TC 3S15J 3HG9A 5J1UA 5E8GA 2NNNA 2ZJQF 1YJWI 3HTUA 2R7ZJ 4CCOA 3T0YA 4XN3A 1VFCA 3SDBA 2KP6A 3RSNA 3G71I 1IRGA 3RZOJ 3FKIJ 1YJNI 4NC7A 1LFUP 3MZ8A 1SAUA 3JRGA 4LK1F 5FD5A 4LG0B 4RAGA 1R22A 1PUEE 3JAMZ 2NYXA 4LG0A 1YIJI 5F64A 1K78B 1Z0XA 4B3AA 3RQIA 4HF0A 3K0LA 4HOBA 1YS7A 1K78A 1XG1A 5E3LA 1W4MA 4G6QA 2DAOA 3LAJA 3OYCA 4YG2F 3G1OA 2DA4A 2F5DA 2B9SA 2VI6A 3KX2A 2R7FA 3KPHA 4A5MA 2ZMEB 4H4KC 4PDKA 2E2JJ 5GAEJ 4KYWA 2ZMEA 1OCZH 2ICWG 3G1MA 2ME6A 3RYPA 4HDUA 1LB2A 3GTMJ 3Q0WA 2ISYA 4GCVA 4XLHA 1B8IB 4IOAF 2BHYA 3ZGKA 1B8IA 3KP3A 5IOYA 2KLOA 2EBIA 4N9HA 5LRRA 3BPXA 2LC2A 2HPIA 2ZXHA 5CVUA 1VQKI 2L9RA 3HZJA 5LHIA 2TRTA 5EDNA 4ITVA 3AAFA 4IO9F 4ZYDA 3K4MA 3CO6C 3I3LA 1MD0A 2ZB9A 4Y17A 3G73A 2KKOA 4WCGA 3H92A 2XAJA 4V2GA 5FJ8J 3W6VA 4OIRF 5LD2C 3FKJA 1H88C 3KETA 3C18A 2KDOA 2EV6A 5J6XA 2GA2A 4DBQA 3S1RJ 1RIOH 4YIFA 3ZR8X 4A3DJ 3LA2A 1APLC 3TO7A 3L00A 3J81K 4CCJA 2LY1A 2CW0F 1YX3A 3CCVI 1A36A 4CHUA 1E3OC 4IRHA 1FP2A 1TZLA 1QQIA 4M71A 3JRCA 3DTIA 4ZJZA 1MJBA 3GMEA 2R5YB 2WV1A 2LREA 3K6GA 2XVCA 3HTSB 4BQOA 3LNQA 2GXGA 2HXOA 3NAUA 2R5YA 1BN5A 2PMHA 4UB8C 2AXTC 5IPAA 3A4CA 1NG6A 1SC7A 4CUGA 3B73A 3WGHA 4I2OA 4PK4A 5IT3A 3O8GA 1YW7A 3F9KA 3F8FA 4AD9A 2ZXWH 3HBLA 1BR2A 1UG2A 3J80K 3CCYA 1D0YA 1IZ1A 2ISZA 1EH8A 2L01A 5E8IA 1DP7P 5E3MA 2RNGA 2HOSA 3DPLC 2HQAA 2PMUA 2X48A 3RYRA 2QF7A 3H5AA 1SD5A 2GZWA 2UXNA 2FXAA 3CP8A 3HGGA 3JTGA 4UXNA 5LRSA 1J9IA 1V5FA 3V7SA 1J2XA 2M45A 1VQMI 1U78A 3W2WA 1YG2A 3BJAA 4UHTA 2FJ1A 2VBWA 3GXOA 2OZUA 2DXIA 2GWRA 4I99C 4MQ9F 4EATA 4HLYA 5LLQA 3TEDA 1S3JA 2FF4A 3GTQJ 1B6AA 3ULQB 3CMYA 3C2GA 1IUYA 2XRNA 5E1WA 3ZOBA 1BI1A 2ZXJA 2XGCA 4JX5A 1TLHB 1V54H 2BBYA 3W6JB 4UVBA 4LB6B 4DYQA 1Z3XA 2LFBA 1ERDA 1XGNA 1KGSA 2NXNB 5E3NA 2IS6A 2B7EA 1XGMA 1B9NA 2R7VA 3FXRA 1ZHFA 1K83J 3FIWA 2VBYA 3CJTB 2HWVA 3TGNA 5GTIC 4HX4A 3O8HA 4J01A 2W82A 1ZYRF 3QPLA 1R1TA 5J1YA 2KIUA 3L9FA 3IH3A 1PUFB 3K4JA 2UV1A 2MBFA 2XF7A 1OJLA 1A31A 1OCRH 2F6CA 2M34A 2QENA 1PUFA 3L09A 3HHHA 2ID3A 4HQMA 4UB6C 1W5SA 2KRCA 1I5ZA 4AC0A 5CYVA 3RI4A 3SEZA 1Y6IA 1LUJB 2M9HA 3E7LA 4WF2A 4B4CA 1IXRC 1WWXA 3U1DA 1LEAA 2E71A 2ZNZA 4BAYA 4DOZA 3S2HJ 1O4XA 2HQRA 3JRIA 3N05A 5L3DA 1Y39A 1BI2A 3OYEA 2DK8A 3ZCOA 3FM5A 3PNVA 2VE8A 5E20A 3WGIA 1BL0A 3REOA 1WJEA 4GFBA 2BY2A 2EQRA 3ABUA 2CQKA 1VQNI 1PDNC 5GAHJ 1F36A 2ZKZA 4L9NA 4NNJA 1X1BA 4HX8A 1ETKA 1U9OA 1O7LA 3RPUD 2VONA 2QQ8A 3RZDJ 2X1CA 5ICFA 2XC7A 2E36A 4G7HF 1MSFC 4XRSA 4XLFA 4WX9A 5K5QA 3HL2A 5CQGA 3M7GA 3I59B 5L3EA 5FRNA 2FX0A 3I59A 2Z3YA 4NUBA 2X6OA 1JKPC 3VYSB 4XN0A 5ICCA 1MBGA 5DS9A 3JRHA 4ZZLA 1SVOA 1WI3A 1UAAA 1ZGAA 3V4GA 2BV6A 3LSKA 4BXFA 2E5NA 1ON1A 1HKSA 3CUOA 3E5XA 3F6OA 1IG7A 2CV0A 4ABZA 1VQ9I 1RESA 4PSWA 5EF6A 2V4JC 1LDDA 4BNCA 2COMA 3R6SA 3DEEA 5D4SA 1QA6A 2IW5A 1L0OC 3CCSI 5DUIA 2HOAA 2XDVA 3DPUA 4CZZA 5JI6A 5KAFC 2O61A 5JVGF 1TWFJ 2HKOA 3MKWB 2DU9A 2HS5A 3K69A 4PJNA 4E7HA 5DM7F 2Y69H 4CICA 1MMDA 3HSEA 2JRTA 4V2FA 3CCRI 2VT2A 4M3GA 1Z3YA 4RAFA 1TC3C 1X3WB 4MFDA 3LA3A 1JT0A 1XS9A 2NOGA 5ICEA 5IP6A 1G3TA 1V55H 2JJ7A 3A01B 2ME0A 3EDPA 2MC3A 3D5LA 3WTTC 3A01A 1HKTA 1ITYA 2CW8A 2KRFA 4EM1A 2L9VA 2XIGA 4Q47A 5HLTA 2DA2A 3LQQA 3GTLJ 4HNUA 2ELKA 1TT5B 4OAYA 1T0FC 2A69F 4R79A 1OR7C 2JMWA 3UKGA 4PJLA 2G7UA 1Z7UA 2IPQX 2Y30A 5A2QK 3DEUA 3EQLF 3U1KA 3BR0A 4XORA 4DZJA 3KYLA 2PJPA 5IT9Z 2NVYJ 2E1CA 4XOTA 4UNOA 2WAFA 4M73A 2XHKA 3RTRA 3MKZA 2DQLA 5HODA 4CYDA 4ENJA 4A93J 1GXPA 3I53A 1ZK8A 1TBXA 4OIQF 1MMSA 4BEHB 3WGGA 4A3MJ 1HBXG 4BE1A 5F08A 2OPTA 3QODA 3FWEA 4E70A 1W36C 1DP3A 4G6DA 4XMYA 4XONA 1JT6A 2DA5A 2VQLA 2IGMA 1Z21A 1U8RA 4E7JA 2NOJB 2R4GA 4UV9A 2CUZA 2DLLA 4RGSA 4X1EA 2D1VA 4A6EA 3KFWX 1P7IA 4ZDLA 1DU0A 2XKOA 2W4SA 5HNHA 5DM6F 2FBHA 5H6QA 3OY9A 2V7FA 1JJ6C 3JRDA 3GCMA 4BY7J 3Q9VA 4RB0A 5J8FA 3O6BB 2ID6A 3I0TA 2W57A 2CUFA 1JI8A 4Q4ZF 3N4MA 5EEHA 1NK3P 3BJOA 3GWZA 2RN7A 2K9SA 1Y56A 4X0GA 4O3MA 1R4MB 4A3JJ 4LD5A 4NQWB 5FLMJ 4WXDA 5LBQA 1F4KA 1U5TB 2D2WA 4NQWA 3PIOF 1P4AA 5C3EJ 1U5TA 3HEFA 3CCEI 1PJRA 1R58A 5BMZA 3EYIA 4FX4A 3D5SC 1AWCA 1YFHA 3OYJA 2XF6A 4A0YA 4OMZA 3G4SI 3F3XA 2XPUA 4CZCA 1GLNA 1FSHA 3KP6A 1YHQI 1T95A 1LNWA 1Y0UA 2V1XA 3K1MA 2R93J 4G7OF 2WA0A 3SZTA 1J75A 2NS7A 5KAIC 1W0UA 2W1OA 3GTJJ 2W00A 3E5UA 2MH9A 4FETA 3HXLA 5F0FA 5FLXK 2BE5F 4EGZA 1MNEA 1XPXA 2ZJRF 1XMXA 3SDGA 3P9IA 4BDZA 2JRMA 2E1OA 1G4DA 2K27A 3NEUA 4BBSJ 3R4KA 3ABTA 2OZ6A 2WY8Q 2P5LC 4C3IJ 1U8BA 3M07A 4K2EA 1TWCJ 2DOAA 2DW4A 3GFJA 5FGMA 2FNAA 2X85A 3HHGA 2KQRA 4B1RA 2GLOA 1R1UA 2HZTA 2QA4I 2UUZA 2M5WA 4M3FA 3TMOA 3DWLE 2KFDA 4CCKA 3HKZA 1Y8RB 2DPDA 3HGYA 1B59A 1FT9A 3LQRA 2FMLA 3G2BA 4AIHA 1FOXA 1EH7A 1OCPA 2HOEA 2HYGD 3KLOA 3WE3A 3ZQQA 5B3SH 2VB6A 2FD5A 1BC7C 1XN7A 4EM0B 2DI3A 2Y0SA 2CRGA 5J3LA 1KQ8A 1HF0A 2IS4A 3WE2A 1TW2A 1GV5A 4W1UA 2DN0A 3HRUA 3OYNA 2R3SA 4BYYA 1Y1WJ 1WJBA 3I56I 4BQNA 2VKEA 1KONA 2WAEA 5D5XB 3I4MJ 4XLPF 3S32A 2JWTA 1NG7A 2I5UA 4CDGA 1T33A 1MNMC 1S5LC 4A6DA 1R5GA 3VSKA 4BL0B 1EJ9A 1MBHA 2STTA 2NRAC 4NC8A 2OU2A 3R61A 2QSHX 1ETYA 1J7KA 2ZJPF 3IH4A 1QZEA 4JX4A 1YE9A 1JHHA 4UUTA 4N9IA 2DFIA 1KU2A 3GF2A 4RAZA 1U0JA 3K4NA 4N0BA 3TP3A 3GO5A 1T56A 1T8IA 4R1HA 2XAQA 3DBHB 3OMYA 2K7LA 5D6EA 4F7ZA 5FB2A 2V1UA 1W5TA 2FBIA 5DYMA 4RLFA 2JA5J 3S3OA 1YW9A 3GZ5A 4L5IA 3ERMA 5K5RA 5C4JJ 1ETQA 2BY3A 5FROA 4U0YA 5EEAA 3F8CA 2QBYB 1D0XA 4MHGA 3ZMVA 4BE0A 2QBYA 1IC8A 2WWYA 4ENKA 1IF1A 4BH9A 3DTKA 2GOXB 4IPAA 5F04A 5HOOA 3KZIC 3P7NA 1VQPI 3EUAA 4DYCA 2VBZA 3BTJA 2A61A 1IAWA 3DLLF 1JKRC 3WG7H 4D7MA 1ZR2A 2Z9OA 2VQCA 4BDYA 4AU7A 1FMWA 4HRIA 1YQAA 2YS9A 2VBXA 4IKFA 2EB7A 3KIOA 3GBGA 1H9GA 4MGRA 4AUXA 2CUEA 2CV2A 2EZLA 2IP2A 1KA8A 2V79A 3BR2A 4KN7X 2IXSA 3VFZA 4S04A 1SAXA 1TQIA 4EJTA 3BTCA 3VOEA 2V6EA 1UG0A 2FEZA 4ZTFA 5TISC 1K4SA 3CLQA 3IL2A 1I50J 4ESBA 3TW7A 5EZGA 3OOPA 4KT5C 1T08B 2IA0A 3CESA 3FHNA 2IS2A 3V8JA 1K4TA 1Z05A 3ZMZA 1EA3A 1RNLA 2L2OA 4KMUX 4L9VA 5B1AH 2OC6A 3HDDA 4XBFA 2W7NA 5D4RA 1G6NA 2Y75A 2ZSHB 4BXUA 4A3LJ 2R0QC 2FBKA 3FMQA 3QYEA 3C7JA 3BZKA 1VQOI 2WAQN 4HG2A 2IBDA 2OD5A 1BIAA 3K1NA 3DBLB 4M3DA 2HYFA 3OOUA 2YU9J 4I6ZA 5LEKA 2IA1A 2M2EA 2EIJH 3I58A 4IHTA 1YJ9I 3GZ6A 3H5RA 3VYTB 5ICGA 3LFUA 1WKMA 5CQEA 4CCMA 4XQFA 5EGOB 2O6GE 3IWFA 4PUSA 5FFZA 5EGOA 2HR3A 1SEUA 1HSJA 1GVJA 4M9SA 2DQRA 1I6HJ 3TBIA 1I3QJ 2ZNYA 2LBFA 3ZQLA 4MTEA 2KRHA 2G9WA 1P7JA 2BHZA 3NWSA 4RLQA 4XLAA 4HAMA 2XB0X 3VPRA 2HDDA 3GTGJ 1YOVB 3OYIA 1LEBA 1MZBA 2Z99A 3BQZA 1EKEA 4A3GJ 3W6KB 3OYKA 4N4OB 2DK5A 1YIOA 2HDWA 4PGGA 5BOXA 2KIMA 4XICA 4DQ2A 2XF5A 2JSPA 2YX7A 2A68F 2EIKH 4DBRA 1ZKGA 5EZHA 4KMFA 4XRSG 2L7MP 1IDYA 3QPHA 2DYSH 4LK0F 2EA2A 3IV5A 1O3TA 2MH2A 3ZP5A 1FEXA 2EFWA 3KZYA 3I71A 1WZ2A 1HW1A 1KQ9A 3ONQA 2ESHA 3TO6A 4M74A 1X2MA 1QNTA 1XGOA 1Z6TA 1UZCA 1KYZA 1YITI 2DJNA 3HIFA 4M9ZA 1WCMJ 2XROA 1UHSA 3BC8A 2LH9A 1BJAA 2M7BA 4XL9A 3TL4X 2DT6A 2WV0A 1O3QA 1LVKA 3BOQA 1U3EM 3KP4A 3WHBA 3BG7A 4M72A 4MFEA 4DZPA 5E1XA 3OWTA 1NTCA 2BZTA 3HOUJ 2P6SA 3RIRA 3LOCA 3CQZJ 3CUQA 1EV7A 2PMZN 2GQQA 4NC6A 1ZG5A 5B1BH 5IY5H 3OR2C 4MIMA 1R1VA 1S7AA 3I54A 2R7TA 3OYLA 1WJAA 3ML6A 3QP5A 4DNCA 3SXYA 3CD6I 2E7XA 4PJJA 2H1KA 3ESWB 3CCMI 1T0FA 1IN5A 4FCYA 1OR7A 1R6RA 5J4YA 3J7YJ 4QTRA 1WVRA 2HGCA 2BYVE 2P6TA 2XASA 4Y4RA 4EGYA 1IV6A 2YR2A 3HPHA 3H5NA 3LSMA 2LG4A 4E7KA 2M0CA 4Y3OA 1IXCA 3NWTA 2F48A 1T39A 4M9XA 4YFKF 3OYGA 1S29A 3F8MA 1CF7B 2H6CA 4L18B 3DFGA 4P96A 4RMNA 1CF7A 4EJWA 4JK1X 3DKYA 4EJVA 4LIVA 3OSFA 3HRMA 4V19K 2W48A 1E17A 4HQEA 2EFPA 1JJ8C 4H0EA 2VJIA 4I09A 4OIPF 1SVLA 4U87A 1VI0A 1O3RA 4LJZF 5M3MJ 1WHUA 3CP2A 1R5ID 1WI9A 3ZMUA 4PSXA 1BM9A 1GV2A 3M9AA 1XMAA 1CGPA 1DUXC 2VUMJ 3W3CA 2HPMA 5JFRA 1XSVA 1V5GA 3FBNB 4QSHA 4D1QA 3IKTA 2AHQA 2CGPA 3H3ZA 4CCLA 1ETVA 2Y48A 3FISA 1DPUA 3ZQCA 1XMKA 4BJTA 5B5EC 4F92B 2R7DA 1GVDA 3C1DA 3F23A 4A3FJ 5J4VA 2CS3A 4M6XA 3KP2A 4JP0A 3FF5A 1MKMA 1E3HA 3HJEA 3I5UA 4KDPA 4NBQA 2OQGA 4IHVA 4I0AA 4YELA 3OYDA 1KZHA 3M8JA 4A0ZA 3DXJF 1WJ5A 2VL8A 3C3WA 2Z33A 1VQ8I 3VYRB 4MTDA 3MQ0A 1QVUA 1RR8C 4MO7A 3SYTA 2BY1A 1UFMA 2E19A 2QZ8A 4ZYHA 3FXOA 4UUVA 2MABA 1E3PA 2HQ5A 3H36A 2IJLA 2V6CA 2J5PA 2BGCA 2JTVA 2XAHA 3LMMA 3ZRGA 1NK2P 2DOEA 1K79A 4GYIA 1IN8A 2VPRA 1DGRM 3DU6A 3CCJI 3OL4A 1QZYA 1T98A 1LJ9A 3BR3A 3K4CA 5ILVA 4LLGF 4RB1A 1F43A 3QRFF 1Z6RA 1EF4A 1PYVA 5E79C 1RZ4A 1MW7A 3OL3A 1HOMA 2K9LA 2E2IJ 1G59A 2GIVA 5CVVA 2DMTA 5BPDA 2Y31A 5FKLA 4U7BA 4RS8A 5HDKA 4RM2A 4MQVA 4ZTJA 4C2TA 3J80Z 5BNGA 1FY7A 3I4NJ 1MH3A 1ZELA 1STZA 2IS1A 3OS0A 3P9CA 2JPBA 3ASNH 4IJAA 1ETXA 5J47A 1JXSA 3S1QJ 1BJZA 1I3AA 5K5OA 2DFEA 3GEZA 2ADUA 3FXUA 4KJZA 4WXHA 3OIPA 5FKNA 2Q1ZB 2NVUB 2Z1DA 4QWQA 2O7OA 3AFHA 3X2QH 3I55I 5HLHA 2HDCA 4A3KJ 3DKXA 1SFOJ 1X3ZB 2IGOA 2ZJ2A 2D5VA 1MJAA 1USSA 4AWXB 2VXZA 3M8EA 3QOPA 1SD7A 1XCBA 2XRLA 2A5WA 4AIDA 5B66C 4UY8I 3ELKA 3GTOJ 3ZQIA 4CA0A 3JSOA 3QU6A 4ETSA 3FXKA 2RAEA 2DFHA 4G12A 1IGNA 1ZGJA 2O3FA 4Q5SF 3DP7A 3G1LA 4F91B 3OYBA 4KICA 5AIPA 4JBAA 2XPWA 1K6OA 3RJPA 6PAXA 1TWHJ 1VQ4I 2EJRA 2K9NA 1GUUA 3TO9A 3ZMSA 4GYGA 2OBPA 1SFXA 2BW3B 3O3KA 2HI3A 2JUGA 4HBLA 2XGDA 5IYCJ 2BW3A 5LGTA 3OIQA 3NARA 4RDUA 4GRIA 2DA3A 4LB5A 3HYIA 5BS6A 3LL7A 2GM4A 2P5VA 3RKQA 1P6RA 2LY9A 3FXQA 1D0ZA 2D1HA 4JOMA 3WU1B 1ZLKA 3HOZJ 2M30A 2GAUA 4ZDPA 1ETOA 3P5JA 4OMYA 3QU3A 5F1RA 3H9JA 4FASD 2P4WA 2AO9A 2QLZA 4HYEA 2PEXA 4P55A 3RCOA 2L7ZA 4G9YA 2EWNA 2PBIA 1ZG3A 2RGVA 3T5XA 5L3GA 1JUSA 2LF8A 1REPC 3TOBA 3CUQC 3K4KA 2MA3A 1FYKA 3VSLA 1W1WE 5KHDA 2DMUA 4HX7A 2R7QA 2QVOA 3SZGA 3AG3H 1T6SA 4KUMA 4FTHA 3A02A 2MGQA 2HOTA 3HOYJ 1MBEA 2ZCWA 1F5TA 3MMYB 5ERIA 2XGEA 4UUSB 1LDJA 4TV7A 5GPCA 4BACA 2UZKA 4L9JA 1I27A 2LTPA 4UUSA 3H9GA 2CQXA 3ZQGA 2OQRA 1D5VA 2QWWA 1D8KA 2DT5A 3HRTA 3U9GA 2E1MC 3E6CC 1FSEA 2W85A 2IRFG 2EZKA 3QQAA 5HS9A 1HW2A 1V3FA 3ABLH 5BPIA 1UHWA 4B47A 2OV7A 4AYBA 4HV5A 1C0WA 2YU3A 2A3SA 1DGWY 2VN2A 1TT0A 4FQGA 3SHFA 1VQLI 2Y9YA 1IN6A 1OYYA 2M4KA 2CYYA 5HS7A 1QPMA 2DA7A 4XM3A 2CW7A 2H6BA 1YTYA 3AL0C 4LG3A 1JTXA 1LE8B 5EYRA 1W36D 3KCCA 2HVRA 4IHYA 1LE8A 1JTYA 3TDZC 2X4HA 3V42A 4S0HB 5JHFA 1O7FA 2P81A 2VOPA 3JW4A 5L3CA 3GFIA 3G3ZA 2VT3A 1OFCX 3A2KA 1A5JA 5D5WB 3CJRB 2A6TA 2DO7A 2EFQA 2MG4A 1RC9A 1SVMA 3PNTA 2A07F 2B0LA 2E7WA 2DMNA 2K5CA 2MD0A 3OIOA 5ILUA 1G8XA 5E17F 5FO5A 4L5JA 3EUKL 2JQ7A 3HSRA 2A6EF 2OA4A 3ERED 3F21A 4L0YB 1I6XA 3HOWJ 2OAZA 2WB1A 2J5OA 2NVTJ 1IRZA 2K40A 3HUGB 2DA6A 5LGUA 4AIJA 2ECBA 3HUGA 4YEJA 3DQVC 3IKVA 1ZRDA 2IAIA 2KIFA 1X1AA 1OPCA 4HDVA 3IUOA 4EEFG 1MDMB 2IT0A 5A2QZ 1MDMA 4A2UA 1N78A 4L5EA 2R7XA 4U0VA 3LAPA 3FM3A 5FFXA 3CJNA 4BBRJ 1ORKA 5DD8A 1W0TA 3I4PA 1R49A 1IDZA 3BT9A 3P9KA 2JPCA 2JN6A 2LLKA 3DU5A 3LSIA 3COAC 1MH4A 4C9YA 4BHCA 3OYHA 2IA2A 3T1BA 2UWMA 2LY2A 2BXYA 4QIWN 2V9KA 4CGZA 2V9PA 1OKRA 1UELB 2O0YA 2FNPA 4HEA2 4MEYF 3Q0UA 2LVSA 5F6FA 1XTAA 3SQNA 4OIOF 1ACIA 3BTIA 4O6JA 2L4AA 4IHSA 4LGWA 4XRFA 1R5HA 3S2DJ 2G0EA 1T2KA 4IOCF 4LOCA 4RA2A 3H1CA 5F0CA 4DYRA 1OMIA 2O8KA 1D8JA 2M1BA 2X9DA 1UB9A 3BTLA 2NS8A 3F6VA 1Z91A 2HTJA 2M8GX 3GVAA 1S72I 1TWGJ 1HC8A 3M4OJ 1Z1DA 2FQ4A 4FHTA 2CMPA 2A6HF 1TP4A 4YFNF 4DIQA 2VJ4A 1Z77A 4XOPA 5DTDA 5DCMB 4KISA 3KEYA 1VF9A 3MD2A 5DCMA 3AG2H 4HW0A 4ESFA 2B63J 1FIPA 3RKXA 4IL6C 3M8FA 1I39A 3PFIA 2W84A 4AVPA 3S16J 3TP0A 1RKTA 3B6AA 4EQQA 1TL8A 4YIRX 1K61A 2F4OB 2FA5A 1FBSA 3ECOA 3MEXA 2I8DA 2RNJA 2WTEA 4F55A 2Q8KA 1ZG1A 2VJ5A 4C30A 3WTXC 2QGUA 4IHWA 1IJWC 1RUNA 5FLXZ 5D5VB 1YRNB 2Y2ZA 1FBQA 3GLLA 3CC4I 4BJ6C 1YRNA 3JSPA 1SFEA 2AQFA 3NRVA 4P9UA 1XGSA 1H0MA 2CH0A 4EJOA 4KIBA 3J7AY 5HLIA 4LMYA 4JYKA 2A05A 1HA8A 1TNTA 1ZN2A 3IRQA 2RKHA 1X3UA 3BR1A 2BEOA 2LKSA 2PQ8A 4ENNA 4WWCA 3L2VA 2VC0A 1D3YA 2F4MB 1HDPA 2VKHA 2L5QA 4BE2A 4P5OA 3WTUC 2OJED 2M8EA 3BG6A 1RR7A 3GTPJ 4I98B 1O57A 1HLVA 3C2HA 3J7AO 5KCMA 1RETA 3OV8A 2PI0A 3RPQA 1QHGA 4S05A 5DD4A 4XSXF 1FOKA 1SD4A 2HTSA 4I0BA 2QKMB 1P4XA 3CMAI 3IC7A 2VPLA 2PG4A 3CMMA 4II2A 2LSOA 2V9VA 4AVZA 3K9TA 4WK8F 1MBJA 9ANTA 1HDDC 2VJJA 4YRVA 1MSEC 3WHCA 2XSDC 1H9TA 4D7NA 3DPTA 4YIIA 1WSUA 1WQ2A 1BR1A 1KQ0A 4PFPA 5AONA 2AQEA 1ZGWA 1X1DA 2KJBA 3HKZN 5C44J 2JA8J 1BW6A 1HKQA 1MMGA 3MKLA 3CCQI 4XLCA 1LFBA 3GFLA 4PJMA 1HCRA 2NNYA 4HF1A 2Y0SN 3AG1H 1IN4A 1MJ9A 1KU9A 1IW7F 3FK7A 3KYCB 4P1WA 2DODA 5HVQC 3GFMA 4HSTA 4LIUA 4L0ZB 3CF2A 3JAMK 1W7PB 1VZ0A 4ZDOA 3WU2C 3L2QA 1W7PA 2QQBA 2O5RA 1N75A 1QPIA 3WTYC 4FX0A 1R23A 2D45A 3PIPF 2DTZA 4W97A 3V7CA 3PO3J 1MIJA 5JHUA 1X4PA 3WODF 5ILSA 2GIZA 3K4BA 2HNHA 2LBFB 4CXFA 5C4XJ 4XIDA 3FHZA 3GX4X 1ULYA 3FXJA 2MYSA 4A3EJ 5CPRB 3BPVA 2PX9A 1TNSA 5LFAA 3S1NJ 3R0JA 3R0AA 3KEOA 3WTSC 1QO0D 3KEQA 3QAHA 3QWLA 2X6XA 5J1RA 3E6MA 2F5CA 5CJ9A 3R60A 4LITA 4E7SA 1GHCA 4IXAA 5KK1A 4D5FA 4PJ0C 2CFOA 2K3FA 4A3BJ 4HPQA 4HF2A 2L7KA 3Q0VA 2M7AA 1FOWA 3OYFA 2K3PA 4XKVA 2ACJA 1BI0A 2ESNA 4B48A 4MEXF 4G94A 2QKLB 1D1CA 2FSWA 2KZGA 1WH5A 4E4HA 3QOEA 5K7FA 2CSOA 1I1SA 3VDXA 3JTHA 3K7AJ 5JR3A 2YSRA 1GDTA 1X4OA 2OTJI 1ETWA 5D8LB 3F72A 3KE2A 5E18F 3BROA 1BOAA 1D5YA 5KNLA 1BR4A 4ZH4F 3PO2J 2EV5A 4FE7A 3DKWA 1KYWA 1ZRFA 1IXSB 3HOTA 3QYBA 1H8AC 2JUCA 4F52A 5D5UB 5FRMA 2E35A 1P92A 3CUQB 2VQHA 3T8RA 2R7WA 1A04A 1FOYA 2P7VB 2LOOA 4C2UA 1UCRA 5BQTA 3A03A 1WGXA 1J0RA 3HC7A 1MNDA 3A0HC 2KL4A 2DYRH 1PP8F 1HXDA 3KP7A 2E5ZA 4XKBA 2ELJA 3S93A 3HOVJ 1W5CC 2DT7B 1FP1D 1IO2A 1TWAJ 5HDGA 2O03A 4Z2YA 2LMDA 1Q1VA 3ZMTA 2HXIA 1K6YA 2E1MB 1SFUA 4N4NB 4EMSA 3E6DA 1A6IA 1Y8QB 3E5QA 2JVGA 4G7ZF 2QQ9A 5GP9A 1YYVA 2ZBKA 1X1PA 5F27A 2KISA 4GXOA 4Y7NJ 1S6LA 5LHHA 2V1DA 5LHGA 4QPQA 4BKXA 3MZYA 1R9TJ 2FRHA 3NQOA 3PQKA 3BCAA 4IHXA 3DCFA 5AIQA 3L1PA 3BP8A 4XKCA 1BI3A 1UHMA 2CG4A 3AL0B 2P0WA 4RGUA 4M6VA 3FMSA 2KMUA 5JVTA 2LDUA 3GLXA 1A35A 3ABKH 1FTTA 1TQMA 4EVIA 1S9HA 2NVQJ 3V8KA 1PVEA 4B43A 3CC2I 3VWBA 2TCTA 2K02A 2XSJC 3WTWC 3KYDB 2KIQA 1J5YA 2N8GA 2GA1A 1N25A 3BY6A 2LRDA 2L9SA 1JE8A 1SMYF 1Y1VJ 2ZFUA 1LFPA 2AXLA 2Q0OA 3CMEI 3ASOH 2K4JA 2DCEA 4X6AJ 5M5YJ 2KT0A 4ESJA 2DDAA 3MKYB 4J19A 2MLGA 2JK3A 2LNBA 4U0WA 1MBKA 3FDYA 1ON2A 1R7JA 1TTYA 2GXAA 1JGGA 2VOOA 4M6YA 4CSWA 3LSHA 5IP7J 4KFCA 1RI7A 3ROUA 2FE3A 1WFXA 4IEJA 4D0PA 1U6GA 3VYUB 4BHBA 1OYWA 3EETA 2M3AA 2VKVA 4YFXF 2M4GA 1RRJA 3LSJA 1OCCH 3E3VA 2RQPA 3HOSA 2V1NA 3DEWA 3JRFA 5K7ZA 4OAZA 2K86A 3MCZA 1DDNA 2XPVA 5DUKA 2KPMA 4ANJA 1AOYA 3S1MJ 3IHUA 3RKYA 3RQ4A 3J81Z 2JA6J 3O2PE 1LKXA 2GXBA 3BWGA 2FQ3A 1XX5A 1SD6A 5L3BA 1UJ8A 2OUMA 3IRRA 3EPZA 4E7ZA 2EFOA 1DQUA 2BVLA 5EG0B 5FKMA 4Y13A 3VB2A 5FLVA 5EG0A 2F4IA 2BXZA 4Z6YA 2CQNA 1B1BA 1KU3A 2L4MA 1S7OA 3L2RA 2DFFA 1T38A 3ZPLA 3HSFA 4LFUA 5DEQA 2P8TA 4U88A 3FXMA 3WTZA 4ZZDA 4RB3C 3H9QA 4LLNA 2Y9ZA 5F0HA 3L2UA 2QCOA 4BHPA 2DMQA 3ZXSA 1G3YA 2IEKA 4KA4A 2G7HA 1OCOH 2YPRA 3VEPA 4GO1A 5KVRA 3F22A 2H8RA 3U21A 4B3XA 1MMAA 3HOXJ 2EINH 1W7PD 1OQYA 2L54A 2QSGX 3M1CA 1LQ1A 3G6EI 1YI2I 5IOZA 2W24A 2EZIA 4BU2A 1Z67A 1YS6A 4NHJA 3ZQFA 4CYCB 1YLFA 3RDIA 1VTNC 2X6WA 4CYCA 5M3FJ 5HLGA 2EPFA 4PCQA 1ODDA 4RGXA 1TW3A 3PUFA 2BOLA 4F93B 2XAUA 2FMYA 3LSGA 3U2RA 4U7DA 2JA7J 1YX5A 4KITB 2L02A 5E3OA 4WXCA 1PP7U 1MMNA 1WJDA 3K10A 1X19A 1Z7LA 3HRSA 3Q3SA 1Q1HA 3SEQA 4B44A 1GT0C 5K7HA 1B72B 1FBUA 4IRIA 1F1ZA 2MD5A 1JUMA 1B72A 3D0SA 4BUPA 2MSYA 2PFBA 3CTAA 2K9QA 4IRGA 4UVCA 4ASNA 5K1YA 1ZLJA 1D1AA 2DDBA 2LK2A 1AA7A 1IV8A 3L2CA 3UR3C 3F0CA 3H35A 3TDUC 3JRAA 3M3YJ 3S14J 5IT9K 2K9MA 4RGRA 1HSTA 1MGTA 5CKTA 2H09A 2L3DA 2R7RA 4UV8A 3PJRA 2VQGA 2HKXA 4EM2A 2QSFX 3VODA 1R00A 2EA4A 1RKWA 4L9TA 2E60A 4HLXA 1B4AA 4UVAA 1R4NB 2O8XA 3FBIB 4ZYAA 1OISA 2LYCA 2BVMA 2XV4S 1FTZA 4C3HJ 3PM1A 1FLIA 1IRXA 1I1GA 1P4WA 3PSFA 3OYMA 2XGXA 2F5EA 3F8BA 1FPQA 1GXQA 3LSRA 2F2EA 3BJ6A 1ZARA 3M1EA 1XB4A 3MAJA 1NH3A 1LDKB 1BA5A 2MW8A 3S17J 4XR6A 1BIBA 3L7WA 3CLOA 1FZPB 4QLCU 2CV1A 3E97A 2DTRA 1OLTA 4MNUA 3ZMDA 3BR5A 2Z5UA 2HQNA 3DF8A 3MWMA 2ZMEC 3WU0A 3BDDA 2QQAA 3GTKJ 1FMVA 4FT8A 1JKOC 1QHHD 2VC1A 3OS2A 3BG9A 1FIAA 3FK6A 1H89C 1WJFA 2ZXIA 5CLSA 3F8NA 1FNNA 3QPSA 3CCLI 4Q48A 1G2HA 2X51A 5FKOA 3OSGA 1G3WA 1WPKA 2OCCH 1ZH5A 2EZHA 3FMRA 2EK5A 3I9V2 2ECCA 1IRFA 1FWZA 2RC4A 3WTVC 2HEOA 5H6RA 4A0XA 3N97A 5GAGJ 1YO5C 3GUDA 3BCBA 4JX6A 3IAS2 2LR8A 5HS8A 2EH3A 4E7LA 2ZO4A 2ETHA 4J00A 5HNFA 1OYIA 4KN4X 2KDZA 3QP6A 3LWFA 2ZC2A 5J8CA 1XD7A 2X0LA 4ZYEA 2H27A 2KZVA 1F9NA 2CO5A 2FOKA 4IF4A 3H0DA 5M5WJ 2JA2A 2FOWA 4O5VA 4GDFA 3EUHA 3PL8A 2DMPA 2XB5A 3K2AA 3BZCA 1ZAOA 2RREA 2X6YA 5H20A 4BEHA 2WY7Q 1RPWA 1BOBA 2OTLI 1HW5A 3K2ZA 3LA7A 5H2FC 1ENHA 3MZHA 1ZTRA 4XKWA 5F1JA 5GTHC 4A3IJ 5JLXA 2JT1A 2FU4A 4HZFA 4LLLA 2CFXA 1FX7A 2CU7A 3V7RA 4EJUA 1BW5A 2RV8A 3LFKA 2OF7A 2E1NA 1D1BA 3TOAA 4PZJA 3I64A 5IYBJ 2DOFA 3D5RC 2EIMH 5EEGA 1U9NA 4R8HA 4A69C 3BQYA 3LSTA 2WC2A 1LPQA 2CJJA 3EYYA 3BR6A 2DA1A 3ECHA 4M3BA 1QRYA 1E0EA 3E1SA 2HZDA 3BG3A 1AU7A 3CF5F 4FE4A 3J7ZI 5L3FA 2R7UA 1ZREA 3W2AA 2STWA 3JCUC 3Q9SA 5HDNA 1S8NA 2VE9A 2COBA 3PQJA 1V4RA 4ON0A 5FKKA 2HYJA 3A1YA 4HNTA 1TQPA 1K7AA 5D8KB 4I76A 5FD6A 2LKXA 1E2XA 3CDLA 5CVRA 3E0JB 3GYHX 2R7SA 3CDIA 1FC3A 2L9NA 4P9FA 3S3NA 4M3EA 2JSCA 5GADJ 4IZZA 3W2VA 4AYBN 4C2MJ 3QYFA 1U2WA 3T8TA 1FJLA 4DGWB 5LGNA 2F5FA 1V5EA 4FISA 5E1ZB 4XLNF 3KLNA 2I10A 4I02A 4E6KG 2WBMA 1HQCA 4PGHA 2HVSA 2MFZA 3HPGA 3S8PA 4BXXJ 4KIGA 2RVCA 2CQQA 4KNYA 2DPUA 2LP0A 3OS1A 2PN6A 3ZN0A 2R5ZB 4RBOA 4Y15A 2R5ZA 2QYOA 4IQ4A 2H1LA 2PLYA 5DDGA 2IGNA 4OOIA 4OU0A 2QUFA 2VLAA 3CZ6A 2R92J 2IGKA 3AKZA 3OYAA 2Z2SB 2MLKA 2BY0A 2VODA 3Q5FA 3HM5A 1JUPA 1MBFA 2L7FP 1SMTA 2VXDA 4BQAA 1JHFA 3PUBA 4RM3A 2DBBA 2E2HJ 2WAQA 3GW2A 4JQFA 2XAGA 2Z16A 2TDXA 3IWZA 4CCNA 4A12A 2ELHA 2H94A 1AHDP 4QPOA 2YX4A 3WG9A 1EH6A 2WB1N 1O3SA 3BLYA 1XCVA 4NB5A 1A6QA 2E34A 5CVJA 1X1CA 2C6YA 2CUJA 1P2FA 2K85A 3CCUI 4E7IA 4XLEA 3SZPA 1L3LA 4BS9A 1IN7A 2CQ7A 2OCEA 2X1EA 3JREA 2HU9A 3DBRB 4G6TB 1JKQC 3SFIA 3KP5A 3RKWA 3ZN1A 3UNGC 2VASA 2LKPA 3E6BA 5LEJA 3MN2A 4CH7A 1XC5A 1XSDA 3BG5A 4C3JJ 1RUOA 2V26A 3OR1C 4IVNA 4IQJA 3A0BC 4KT6A 5DV5A 2KJCA 2QEXI 1FYMA 3ABMH 3H3UA 2K4BA 4D5CA 2LF7A 4IX7A 3LSPA 3H3VK 1WH7A 1WRJA 4RB2C 3BZ6A
chains in the Genus database with same CATH topology
1USTA 1G3SA 4XSZF 5TRDA 2RDPA 2CWEA 1BC8C 4GGGA 4OINF 3S2WA 3FZVA 1DPRA 2M87A 2IVMA 1B9MA 4I7HA 4RAYA 3ZQ7A 1QGPA 4HV6A 4ZYGA 1KU7A 4EV0A 3MFKA 2NS0A 5CVIA 2AS5F 4I01A 1QBJA 2A5YB 3TKYA 3DV8A 5DCFA 3TQNA 1JGSA 2XAFA 1BBYA 1ONVA 2XUBA 4A5NA 2XKPA 4HA8A 4CO8A 1J59A 3V8LA 2P7CB 2W25A 4AIKA 5TJJA 3K1PA 1ZRCA 2EFNA 3ISPA 4ENMA 1XDSA 4G8XA 4B09A 1LVAA 1R36A 4KIFA 1QZZA 5D6FA 1FYLA 1XSXA 3KZZA 2JZYA 4B8XA 1Z9CA 3FX3A 2QM3A 1YW8A 1XDUA 3SFZA 2Q2EA 2P5KA 3QPTA 3B02A 1NHAA 2UXXA 2Y0MA 3CO7C 2HFHA 2NAZA 3CDHA 2ZFWA 3RPUA 2EV0A 5ED4A 1U5TC 5E8GA 2NNNA 3HTUA 3T0YA 1IRGA 4LK1F 5FD5A 4LG0B 1R22A 1PUEE 3JAMZ 2NYXA 4LG0A 5F64A 1K78B 4HF0A 3K0LA 4HOBA 1YS7A 1K78A 1W4MA 4G6QA 2DAOA 3LAJA 4YG2F 2F5DA 2R7FA 4A5MA 2ZMEB 4PDKA 4KYWA 2ZMEA 3RYPA 4HDUA 1LB2A 4GCVA 2ISYA 3KP3A 4N9HA 5LRRA 3BPXA 5CVUA 5LHIA 3AAFA 4ZYDA 3CO6C 1MD0A 4Y17A 3G73A 2KKOA 4WCGA 3H92A 2XAJA 4OIRF 3KETA 3C18A 5J6XA 2EV6A 2GA2A 1RIOH 4YIFA 3LA2A 3TO7A 3L00A 3J81K 2CW0F 4CHUA 4IRHA 1FP2A 1QQIA 4M71A 1MJBA 2XVCA 3HTSB 2GXGA 1BN5A 2PMHA 3B73A 3WGHA 4I2OA 5IT3A 1YW7A 3F8FA 4AD9A 3J80K 1IZ1A 2ISZA 1EH8A 2L01A 5E8IA 1DP7P 3DPLC 2PMUA 3RYRA 1SD5A 2GZWA 2FXAA 2UXNA 3JTGA 4UXNA 5LRSA 1J9IA 3V7SA 1J2XA 2M45A 1U78A 1YG2A 3BJAA 4UHTA 2VBWA 3GXOA 2OZUA 2GWRA 4MQ9F 4HLYA 5LLQA 1S3JA 2FF4A 1B6AA 3ULQB 1IUYA 5E1WA 2XRNA 1BI1A 2ZXJA 1TLHB 2BBYA 3W6JB 4UVBA 4LB6B 1XGNA 1KGSA 1XGMA 1B9NA 3FXRA 1ZHFA 2VBYA 2HWVA 3TGNA 4HX4A 1ZYRF 1R1TA 2KIUA 3L9FA 2MBFA 2QENA 3L09A 3HHHA 4HQMA 1W5SA 1I5ZA 5CYVA 3RI4A 4WF2A 1IXRC 1WWXA 3U1DA 1LEAA 2ZNZA 4BAYA 2HQRA 5L3DA 1BI2A 2DK8A 3FM5A 3WGIA 2VE8A 5E20A 3REOA 3ABUA 2CQKA 1PDNC 2ZKZA 4L9NA 4HX8A 1O7LA 2VONA 5ICFA 4G7HF 4WX9A 5K5QA 3M7GA 3I59B 5L3EA 3I59A 2Z3YA 5ICCA 4ZZLA 1ZGAA 3V4GA 2BV6A 1ON1A 1HKSA 3CUOA 3E5XA 3F6OA 1LDDA 4BNCA 2COMA 3R6SA 5D4SA 2IW5A 1L0OC 5DUIA 4CZZA 2O61A 5JI6A 2HKOA 2DU9A 2HS5A 3K69A 4CICA 3HSEA 2JRTA 2VT2A 3LA3A 5ICEA 1G3TA 3EDPA 2MC3A 3D5LA 3WTTC 1HKTA 2KRFA 4EM1A 2XIGA 4Q47A 3LQQA 2A69F 4R79A 2G7UA 1Z7UA 2IPQX 5A2QK 3DEUA 3EQLF 2PJPA 5IT9Z 2E1CA 4UNOA 4M73A 2XHKA 3RTRA 2DQLA 4CYDA 4ENJA 1GXPA 3I53A 4OIQF 1TBXA 3WGGA 1HBXG 3FWEA 4E70A 4G6DA 1U8RA 4UV9A 2DLLA 4RGSA 2D1VA 4A6EA 3KFWX 2XKOA 2FBHA 5H6QA 3Q9VA 4RB0A 5J8FA 3O6BB 3I0TA 2W57A 4Q4ZF 3N4MA 5EEHA 3BJOA 3GWZA 2RN7A 4O3MA 4LD5A 4WXDA 5LBQA 1F4KA 1U5TB 2D2WA 4NQWA 1P4AA 1U5TA 1R58A 5BMZA 3EYIA 4FX4A 1AWCA 1YFHA 4A0YA 4OMZA 3F3XA 1FSHA 3KP6A 1LNWA 1Y0UA 2V1XA 3K1MA 4G7OF 3SZTA 1J75A 3E5UA 2MH9A 5FLXK 2BE5F 4EGZA 3P9IA 1G4DA 2K27A 3NEUA 3R4KA 3ABTA 2OZ6A 2P5LC 4K2EA 2DW4A 3GFJA 5FGMA 2FNAA 3HHGA 1R1UA 2HZTA 2M5WA 2DPDA 1B59A 1FT9A 3LQRA 2FMLA 4AIHA 1EH7A 2HOEA 2HYGD 3KLOA 3WE3A 1BC7C 1XN7A 4EM0B 2DI3A 1KQ8A 3WE2A 1TW2A 3HRUA 2R3SA 4BYYA 5D5XB 4XLPF 4CDGA 4A6DA 1R5GA 2STTA 2NRAC 2OU2A 3R61A 1J7KA 1JHHA 4N9IA 2DFIA 1KU2A 3GF2A 4RAZA 4N0BA 3GO5A 4R1HA 2XAQA 2K7LA 5D6EA 4F7ZA 5FB2A 2V1UA 1W5TA 2FBIA 5DYMA 1YW9A 3GZ5A 4L5IA 5K5RA 4U0YA 3F8CA 2QBYB 4MHGA 3ZMVA 2QBYA 2WWYA 4ENKA 1IF1A 4BH9A 5HOOA 4IPAA 3P7NA 2VBZA 2A61A 1IAWA 2Z9OA 1YQAA 2VBXA 2EB7A 1H9GA 4MGRA 2V79A 2IP2A 1KA8A 4KN7X 3VFZA 4S04A 1SAXA 1TQIA 4EJTA 3VOEA 2FEZA 3IL2A 4ESBA 3OOPA 4KT5C 2IA0A 3V8JA 1Z05A 3ZMZA 1RNLA 4L9VA 4KMUX 4XBFA 5D4RA 1G6NA 2Y75A 4BXUA 2FBKA 3FMQA 3C7JA 2OD5A 1BIAA 3K1NA 2HYFA 5LEKA 2IA1A 4IHTA 3I58A 3GZ6A 5ICGA 1WKMA 2O6GE 3IWFA 5FFZA 2HR3A 1HSJA 1GVJA 4M9SA 2DQRA 2ZNYA 4MTEA 2G9WA 4HAMA 1LEBA 1MZBA 2Z99A 3W6KB 2DK5A 1YIOA 4PGGA 5BOXA 2KIMA 4DQ2A 2YX7A 2A68F 4KMFA 3QPHA 4LK0F 2EA2A 1O3TA 2MH2A 3ZP5A 2EFWA 3KZYA 3I71A 1HW1A 1KQ9A 2ESHA 3TO6A 4M74A 1QNTA 1XGOA 1Z6TA 1KYZA 3HIFA 4M9ZA 2XROA 1BJAA 2WV0A 1O3QA 3BOQA 1U3EM 3KP4A 4M72A 5E1XA 2P6SA 3RIRA 3CUQA 1EV7A 2GQQA 1ZG5A 1R1VA 1S7AA 3I54A 4DNCA 3ML6A 3QP5A 3SXYA 2E7XA 1T0FA 1IN5A 1OR7A 2HGCA 2BYVE 2P6TA 2XASA 4EGYA 2YR2A 1IXCA 1T39A 4M9XA 4YFKF 1S29A 3F8MA 1CF7B 2H6CA 4L18B 3DFGA 4P96A 1CF7A 4EJWA 4JK1X 4EJVA 3HRMA 1E17A 4HQEA 2EFPA 4H0EA 4I09A 4OIPF 1O3RA 4LJZF 1WI9A 3ZMUA 1BM9A 3M9AA 1XMAA 1CGPA 1DUXC 5JFRA 1XSVA 3IKTA 2CGPA 3H3ZA 2Y48A 1DPUA 1XMKA 2R7DA 3C1DA 3F23A 4M6XA 3KP2A 3FF5A 1MKMA 3I5UA 4KDPA 2OQGA 4I0AA 4A0ZA 3DXJF 3C3WA 2Z33A 4MTDA 3MQ0A 1UFMA 2QZ8A 4ZYHA 4UUVA 2IJLA 2V6CA 2J5PA 2BGCA 2JTVA 2XAHA 1K79A 4GYIA 1IN8A 1QZYA 1T98A 1LJ9A 5ILVA 4LLGF 4RB1A 3QRFF 1Z6RA 1RZ4A 2GIVA 5CVVA 5BPDA 4U7BA 4RS8A 5HDKA 4MQVA 3J80Z 1FY7A 1STZA 3P9CA 2JPBA 4IJAA 1JXSA 5K5OA 3GEZA 2ADUA 3FXUA 4WXHA 4QWQA 5HLHA 2HDCA 2ZJ2A 1MJAA 1USSA 4AWXB 2VXZA 3M8EA 3QOPA 1SD7A 1XCBA 3ELKA 3JSOA 3QU6A 4ETSA 1ZGJA 2O3FA 4Q5SF 3DP7A 4KICA 5AIPA 4JBAA 1K6OA 3RJPA 6PAXA 2EJRA 3TO9A 3ZMSA 4GYGA 2OBPA 1SFXA 3O3KA 4HBLA 5LGTA 4LB5A 3HYIA 5BS6A 2P5VA 1P6RA 3FXQA 2D1HA 3WU1B 1ZLKA 2M30A 2GAUA 4OMYA 3QU3A 5F1RA 2P4WA 2QLZA 4HYEA 2PEXA 4P55A 4G9YA 2EWNA 2PBIA 1ZG3A 2RGVA 3T5XA 5L3GA 2LF8A 1REPC 3TOBA 3CUQC 2MA3A 1FYKA 4HX7A 2QVOA 1T6SA 4KUMA 2ZCWA 1F5TA 5ERIA 1LDJA 4TV7A 2UZKA 4L9JA 1I27A 2OQRA 1D5VA 2QWWA 1D8KA 2DT5A 3HRTA 3U9GA 3E6CC 1FSEA 2W85A 2IRFG 1HW2A 5HS9A 1V3FA 5BPIA 1UHWA 4HV5A 1C0WA 2YU3A 2A3SA 2VN2A 3SHFA 1IN6A 1OYYA 2CYYA 5HS7A 1QPMA 2H6BA 1YTYA 3KCCA 3TDZC 2X4HA 1O7FA 2VOPA 3JW4A 5L3CA 3GFIA 3G3ZA 2VT3A 5D5WB 2DO7A 2EFQA 2A07F 2B0LA 2E7WA 5ILUA 5E17F 5FO5A 4L5JA 3HSRA 2A6EF 2OA4A 3ERED 3F21A 4L0YB 1I6XA 2OAZA 2J5OA 5LGUA 4AIJA 3HUGA 3DQVC 3IKVA 1ZRDA 2KIFA 1OPCA 4HDVA 1MDMB 2IT0A 5A2QZ 1MDMA 4A2UA 4U0VA 3LAPA 3FM3A 5FFXA 3CJNA 5DD8A 3I4PA 3P9KA 2JPCA 3COAC 4BHCA 2IA2A 3T1BA 2UWMA 4CGZA 1OKRA 2O0YA 2FNPA 4OIOF 4MEYF 5F6FA 3SQNA 4O6JA 2L4AA 4IHSA 4LGWA 4XRFA 1R5HA 1T2KA 1OMIA 1D8JA 2M1BA 1UB9A 3F6VA 1Z91A 2HTJA 3GVAA 1Z1DA 4FHTA 2A6HF 4YFNF 5DCMB 5DCMA 4HW0A 4ESFA 3RKXA 3M8FA 3PFIA 2W84A 4AVPA 4EQQA 2FA5A 1FBSA 3ECOA 3MEXA 2RNJA 2WTEA 2Q8KA 1ZG1A 3WTXC 1RUNA 5FLXZ 5D5VB 1FBQA 3JSPA 1SFEA 4P9UA 3NRVA 1XGSA 1H0MA 4EJOA 4KIBA 5HLIA 4LMYA 1TNTA 1ZN2A 3IRQA 1X3UA 2BEOA 2RKHA 2PQ8A 4ENNA 4WWCA 2VC0A 1D3YA 4P5OA 3WTUC 2M8EA 4I98B 1O57A 3J7AO 3OV8A 2PI0A 3RPQA 4S05A 5DD4A 4XSXF 1FOKA 1SD4A 2HTSA 4I0BA 1P4XA 3IC7A 2PG4A 2LSOA 2V9VA 3K9TA 4WK8F 1H9TA 3DPTA 4YIIA 1WSUA 1WQ2A 1KQ0A 5AONA 2KJBA 1HKQA 3GFLA 2NNYA 4HF1A 1IN4A 1MJ9A 1KU9A 1IW7F 5HVQC 3GFMA 4L0ZB 3JAMK 1W7PB 1W7PA 2QQBA 3WTYC 4FX0A 1R23A 2D45A 3V7CA 5JHUA 3WODF 5ILSA 4CXFA 3FHZA 3GX4X 1ULYA 3BPVA 1TNSA 3R0JA 3R0AA 3KEOA 3WTSC 1QO0D 3KEQA 3QAHA 3E6MA 2F5CA 5CJ9A 3R60A 1GHCA 4IXAA 5KK1A 4HF2A 2ACJA 1BI0A 2ESNA 4MEXF 4G94A 2FSWA 2CSOA 1I1SA 3JTHA 5JR3A 2YSRA 5D8LB 3F72A 3KE2A 5E18F 3BROA 1BOAA 4ZH4F 2EV5A 3DKWA 1KYWA 1ZRFA 1IXSB 3HOTA 5D5UB 1P92A 3CUQB 3T8RA 1A04A 2P7VB 1UCRA 5BQTA 1J0RA 1PP8F 1HXDA 3KP7A 1FP1D 5HDGA 2O03A 4Z2YA 3ZMTA 1SFUA 4EMSA 3E6DA 3E5QA 4G7ZF 2QQ9A 1YYVA 2ZBKA 4GXOA 1S6LA 5LHHA 2V1DA 5LHGA 3MZYA 2FRHA 3NQOA 3PQKA 5AIQA 3BP8A 1BI3A 1UHMA 2CG4A 4RGUA 3FMSA 5JVTA 2LDUA 3GLXA 1TQMA 4EVIA 3V8KA 2K02A 3WTWC 1J5YA 2GA1A 3BY6A 1JE8A 1SMYF 2Q0OA 2AXLA 2K4JA 4ESJA 2MLGA 2LNBA 4U0WA 1ON2A 1R7JA 1TTYA 2VOOA 4M6YA 4KFCA 1RI7A 3ROUA 2FE3A 4D0PA 1U6GA 4BHBA 1OYWA 3EETA 4YFXF 3E3VA 2RQPA 3HOSA 2K86A 3MCZA 1DDNA 5DUKA 1AOYA 3IHUA 3RKYA 3J81Z 3O2PE 2GXBA 3BWGA 2FQ3A 1SD6A 5L3BA 3IRRA 2EFOA 4Y13A 3VB2A 1B1BA 1KU3A 2L4MA 1S7OA 1T38A 3ZPLA 3HSFA 4LFUA 5DEQA 2P8TA 4U88A 3WTZA 4ZZDA 4RB3C 4LLNA 4BHPA 1G3YA 4KA4A 2G7HA 2YPRA 3VEPA 4GO1A 5KVRA 3F22A 1W7PD 2L54A 1LQ1A 2W24A 1YS6A 4NHJA 1YLFA 3RDIA 1VTNC 5HLGA 4PCQA 1ODDA 4RGXA 1TW3A 2FMYA 3U2RA 4U7DA 2L02A 4WXCA 1PP7U 3HRSA 1Q1HA 1FBUA 4IRIA 1F1ZA 2MD5A 3D0SA 2PFBA 3CTAA 4IRGA 4UVCA 4ASNA 5K1YA 1ZLJA 3L2CA 3TDUC 5IT9K 4RGRA 1HSTA 1MGTA 2H09A 2L3DA 4UV8A 2HKXA 4EM2A 3VODA 1R00A 2EA4A 4L9TA 4HLXA 1B4AA 4UVAA 2O8XA 2XV4S 1FLIA 1I1GA 1P4WA 2XGXA 2F5EA 3F8BA 1FPQA 1GXQA 2F2EA 3BJ6A 1ZARA 3M1EA 1XB4A 3MAJA 1LDKB 1BIBA 3L7WA 3CLOA 1FZPB 4QLCU 3E97A 2DTRA 4MNUA 3ZMDA 2Z5UA 2HQNA 3DF8A 3MWMA 3WU0A 3BDDA 2QQAA 4FT8A 2VC1A 5CLSA 3F8NA 1FNNA 4Q48A 1G3WA 1ZH5A 3FMRA 2EK5A 1IRFA 1FWZA 2RC4A 3WTVC 2HEOA 5H6RA 4A0XA 3N97A 1YO5C 3GUDA 5HS8A 2ZO4A 2ETHA 1OYIA 4KN4X 3QP6A 3LWFA 5J8CA 1XD7A 2X0LA 4ZYEA 2H27A 1F9NA 2CO5A 2FOKA 4IF4A 4O5VA 3EUHA 1ZAOA 5H20A 1HW5A 3K2ZA 3LA7A 3MZHA 2JT1A 2FU4A 4HZFA 4LLLA 2CFXA 1FX7A 3V7RA 4EJUA 2RV8A 3LFKA 2E1NA 3TOAA 4PZJA 3I64A 5EEGA 4R8HA 3LSTA 2WC2A 3EYYA 3ECHA 5L3FA 1ZREA 2STWA 3Q9SA 5HDNA 1S8NA 2VE9A 3PQJA 1V4RA 4ON0A 1TQPA 1K7AA 5D8KB 5FD6A 1E2XA 5CVRA 3GYHX 1FC3A 4P9FA 2JSCA 1U2WA 3T8TA 5LGNA 2F5FA 5E1ZB 4XLNF 3KLNA 4I02A 1HQCA 4PGHA 4KIGA 2RVCA 4KNYA 2DPUA 2PN6A 3ZN0A 4Y15A 2QYOA 2PLYA 5DDGA 4OOIA 4OU0A 2QUFA 2MLKA 2VODA 3Q5FA 1SMTA 4BQAA 1JHFA 2DBBA 3GW2A 4JQFA 3IWZA 4A12A 2XAGA 2TDXA 2ELHA 2H94A 2YX4A 3WG9A 1EH6A 1O3SA 1XCVA 4NB5A 2C6YA 5CVJA 1P2FA 3SZPA 1L3LA 1IN7A 3KP5A 3RKWA 3ZN1A 2LKPA 3E6BA 5LEJA 1XSDA 1RUOA 4IVNA 5DV5A 2KJCA 1FYMA 3H3UA 2K4BA 2LF7A 1WRJA 4RB2C 3BZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UST A;  1G3S A;  4XSZ F;  5TRD A;  2RDP A;  2CWE A;  1BC8 C;  4GGG A;  4OIN F;  3S2W A;  3FZV A;  1DPR A;  2M87 A;  2IVM A;  1B9M A;  4I7H A;  4RAY A;  3ZQ7 A;  1QGP A;  4HV6 A;  4ZYG A;  1KU7 A;  4EV0 A;  3MFK A;  2NS0 A;  5CVI A;  2AS5 F;  4I01 A;  1QBJ A;  2A5Y B;  3TKY A;  3DV8 A;  5DCF A;  3TQN A;  1JGS A;  2XAF A;  1BBY A;  1ONV A;  2XUB A;  4A5N A;  2XKP A;  4HA8 A;  4CO8 A;  1J59 A;  3V8L A;  2P7C B;  2W25 A;  4AIK A;  5TJJ A;  3K1P A;  1ZRC A;  2EFN A;  3ISP A;  4ENM A;  1XDS A;  4G8X A;  4B09 A;  1LVA A;  1R36 A;  4KIF A;  1QZZ A;  5D6F A;  1FYL A;  1XSX A;  3KZZ A;  2JZY A;  4B8X A;  1Z9C A;  3FX3 A;  2QM3 A;  1YW8 A;  1XDU A;  3SFZ A;  2Q2E A;  2P5K A;  3QPT A;  3B02 A;  1NHA A;  2UXX A;  2Y0M A;  3CO7 C;  2HFH A;  2NAZ A;  3CDH A;  2ZFW A;  3RPU A;  2EV0 A;  5ED4 A;  1U5T C;  5E8G A;  2NNN A;  3HTU A;  3T0Y A;  1IRG A;  4LK1 F;  5FD5 A;  4LG0 B;  1R22 A;  1PUE E;  3JAM Z;  2NYX A;  4LG0 A;  5F64 A;  1K78 B;  4HF0 A;  3K0L A;  4HOB A;  1YS7 A;  1K78 A;  1W4M A;  4G6Q A;  2DAO A;  3LAJ A;  4YG2 F;  2F5D A;  2R7F A;  4A5M A;  2ZME B;  4PDK A;  4KYW A;  2ZME A;  3RYP A;  4HDU A;  1LB2 A;  4GCV A;  2ISY A;  3KP3 A;  4N9H A;  5LRR A;  3BPX A;  5CVU A;  5LHI A;  3AAF A;  4ZYD A;  3CO6 C;  1MD0 A;  4Y17 A;  3G73 A;  2KKO A;  4WCG A;  3H92 A;  2XAJ A;  4OIR F;  3KET A;  3C18 A;  5J6X A;  2EV6 A;  2GA2 A;  1RIO H;  4YIF A;  3LA2 A;  3TO7 A;  3L00 A;  3J81 K;  2CW0 F;  4CHU A;  4IRH A;  1FP2 A;  1QQI A;  4M71 A;  1MJB A;  2XVC A;  3HTS B;  2GXG A;  1BN5 A;  2PMH A;  3B73 A;  3WGH A;  4I2O A;  5IT3 A;  1YW7 A;  3F8F A;  4AD9 A;  3J80 K;  1IZ1 A;  2ISZ A;  1EH8 A;  2L01 A;  5E8I A;  1DP7 P;  3DPL C;  2PMU A;  3RYR A;  1SD5 A;  2GZW A;  2FXA A;  2UXN A;  3JTG A;  4UXN A;  5LRS A;  1J9I A;  3V7S A;  1J2X A;  2M45 A;  1U78 A;  1YG2 A;  3BJA A;  4UHT A;  2VBW A;  3GXO A;  2OZU A;  2GWR A;  4MQ9 F;  4HLY A;  5LLQ A;  1S3J A;  2FF4 A;  1B6A A;  3ULQ B;  1IUY A;  5E1W A;  2XRN A;  1BI1 A;  2ZXJ A;  1TLH B;  2BBY A;  3W6J B;  4UVB A;  4LB6 B;  1XGN A;  1KGS A;  1XGM A;  1B9N A;  3FXR A;  1ZHF A;  2VBY A;  2HWV A;  3TGN A;  4HX4 A;  1ZYR F;  1R1T A;  2KIU A;  3L9F A;  2MBF A;  2QEN A;  3L09 A;  3HHH A;  4HQM A;  1W5S A;  1I5Z A;  5CYV A;  3RI4 A;  4WF2 A;  1IXR C;  1WWX A;  3U1D A;  1LEA A;  2ZNZ A;  4BAY A;  2HQR A;  5L3D A;  1BI2 A;  2DK8 A;  3FM5 A;  3WGI A;  2VE8 A;  5E20 A;  3REO A;  3ABU A;  2CQK A;  1PDN C;  2ZKZ A;  4L9N A;  4HX8 A;  1O7L A;  2VON A;  5ICF A;  4G7H F;  4WX9 A;  5K5Q A;  3M7G A;  3I59 B;  5L3E A;  3I59 A;  2Z3Y A;  5ICC A;  4ZZL A;  1ZGA A;  3V4G A;  2BV6 A;  1ON1 A;  1HKS A;  3CUO A;  3E5X A;  3F6O A;  1LDD A;  4BNC A;  2COM A;  3R6S A;  5D4S A;  2IW5 A;  1L0O C;  5DUI A;  4CZZ A;  2O61 A;  5JI6 A;  2HKO A;  2DU9 A;  2HS5 A;  3K69 A;  4CIC A;  3HSE A;  2JRT A;  2VT2 A;  3LA3 A;  5ICE A;  1G3T A;  3EDP A;  2MC3 A;  3D5L A;  3WTT C;  1HKT A;  2KRF A;  4EM1 A;  2XIG A;  4Q47 A;  3LQQ A;  2A69 F;  4R79 A;  2G7U A;  1Z7U A;  2IPQ X;  5A2Q K;  3DEU A;  3EQL F;  2PJP A;  5IT9 Z;  2E1C A;  4UNO A;  4M73 A;  2XHK A;  3RTR A;  2DQL A;  4CYD A;  4ENJ A;  1GXP A;  3I53 A;  4OIQ F;  1TBX A;  3WGG A;  1HBX G;  3FWE A;  4E70 A;  4G6D A;  1U8R A;  4UV9 A;  2DLL A;  4RGS A;  2D1V A;  4A6E A;  3KFW X;  2XKO A;  2FBH A;  5H6Q A;  3Q9V A;  4RB0 A;  5J8F A;  3O6B B;  3I0T A;  2W57 A;  4Q4Z F;  3N4M A;  5EEH A;  3BJO A;  3GWZ A;  2RN7 A;  4O3M A;  4LD5 A;  4WXD A;  5LBQ A;  1F4K A;  1U5T B;  2D2W A;  4NQW A;  1P4A A;  1U5T A;  1R58 A;  5BMZ A;  3EYI A;  4FX4 A;  1AWC A;  1YFH A;  4A0Y A;  4OMZ A;  3F3X A;  1FSH A;  3KP6 A;  1LNW A;  1Y0U A;  2V1X A;  3K1M A;  4G7O F;  3SZT A;  1J75 A;  3E5U A;  2MH9 A;  5FLX K;  2BE5 F;  4EGZ A;  3P9I A;  1G4D A;  2K27 A;  3NEU A;  3R4K A;  3ABT A;  2OZ6 A;  2P5L C;  4K2E A;  2DW4 A;  3GFJ A;  5FGM A;  2FNA A;  3HHG A;  1R1U A;  2HZT A;  2M5W A;  2DPD A;  1B59 A;  1FT9 A;  3LQR A;  2FML A;  4AIH A;  1EH7 A;  2HOE A;  2HYG D;  3KLO A;  3WE3 A;  1BC7 C;  1XN7 A;  4EM0 B;  2DI3 A;  1KQ8 A;  3WE2 A;  1TW2 A;  3HRU A;  2R3S A;  4BYY A;  5D5X B;  4XLP F;  4CDG A;  4A6D A;  1R5G A;  2STT A;  2NRA C;  2OU2 A;  3R61 A;  1J7K A;  1JHH A;  4N9I A;  2DFI A;  1KU2 A;  3GF2 A;  4RAZ A;  4N0B A;  3GO5 A;  4R1H A;  2XAQ A;  2K7L A;  5D6E A;  4F7Z A;  5FB2 A;  2V1U A;  1W5T A;  2FBI A;  5DYM A;  1YW9 A;  3GZ5 A;  4L5I A;  5K5R A;  4U0Y A;  3F8C A;  2QBY B;  4MHG A;  3ZMV A;  2QBY A;  2WWY A;  4ENK A;  1IF1 A;  4BH9 A;  5HOO A;  4IPA A;  3P7N A;  2VBZ A;  2A61 A;  1IAW A;  2Z9O A;  1YQA A;  2VBX A;  2EB7 A;  1H9G A;  4MGR A;  2V79 A;  2IP2 A;  1KA8 A;  4KN7 X;  3VFZ A;  4S04 A;  1SAX A;  1TQI A;  4EJT A;  3VOE A;  2FEZ A;  3IL2 A;  4ESB A;  3OOP A;  4KT5 C;  2IA0 A;  3V8J A;  1Z05 A;  3ZMZ A;  1RNL A;  4L9V A;  4KMU X;  4XBF A;  5D4R A;  1G6N A;  2Y75 A;  4BXU A;  2FBK A;  3FMQ A;  3C7J A;  2OD5 A;  1BIA A;  3K1N A;  2HYF A;  5LEK A;  2IA1 A;  4IHT A;  3I58 A;  3GZ6 A;  5ICG A;  1WKM A;  2O6G E;  3IWF A;  5FFZ A;  2HR3 A;  1HSJ A;  1GVJ A;  4M9S A;  2DQR A;  2ZNY A;  4MTE A;  2G9W A;  4HAM A;  1LEB A;  1MZB A;  2Z99 A;  3W6K B;  2DK5 A;  1YIO A;  4PGG A;  5BOX A;  2KIM A;  4DQ2 A;  2YX7 A;  2A68 F;  4KMF A;  3QPH A;  4LK0 F;  2EA2 A;  1O3T A;  2MH2 A;  3ZP5 A;  2EFW A;  3KZY A;  3I71 A;  1HW1 A;  1KQ9 A;  2ESH A;  3TO6 A;  4M74 A;  1QNT A;  1XGO A;  1Z6T A;  1KYZ A;  3HIF A;  4M9Z A;  2XRO A;  1BJA A;  2WV0 A;  1O3Q A;  3BOQ A;  1U3E M;  3KP4 A;  4M72 A;  5E1X A;  2P6S A;  3RIR A;  3CUQ A;  1EV7 A;  2GQQ A;  1ZG5 A;  1R1V A;  1S7A A;  3I54 A;  4DNC A;  3ML6 A;  3QP5 A;  3SXY A;  2E7X A;  1T0F A;  1IN5 A;  1OR7 A;  2HGC A;  2BYV E;  2P6T A;  2XAS A;  4EGY A;  2YR2 A;  1IXC A;  1T39 A;  4M9X A;  4YFK F;  1S29 A;  3F8M A;  1CF7 B;  2H6C A;  4L18 B;  3DFG A;  4P96 A;  1CF7 A;  4EJW A;  4JK1 X;  4EJV A;  3HRM A;  1E17 A;  4HQE A;  2EFP A;  4H0E A;  4I09 A;  4OIP F;  1O3R A;  4LJZ F;  1WI9 A;  3ZMU A;  1BM9 A;  3M9A A;  1XMA A;  1CGP A;  1DUX C;  5JFR A;  1XSV A;  3IKT A;  2CGP A;  3H3Z A;  2Y48 A;  1DPU A;  1XMK A;  2R7D A;  3C1D A;  3F23 A;  4M6X A;  3KP2 A;  3FF5 A;  1MKM A;  3I5U A;  4KDP A;  2OQG A;  4I0A A;  4A0Z A;  3DXJ F;  3C3W A;  2Z33 A;  4MTD A;  3MQ0 A;  1UFM A;  2QZ8 A;  4ZYH A;  4UUV A;  2IJL A;  2V6C A;  2J5P A;  2BGC A;  2JTV A;  2XAH A;  1K79 A;  4GYI A;  1IN8 A;  1QZY A;  1T98 A;  1LJ9 A;  5ILV A;  4LLG F;  4RB1 A;  3QRF F;  1Z6R A;  1RZ4 A;  2GIV A;  5CVV A;  5BPD A;  4U7B A;  4RS8 A;  5HDK A;  4MQV A;  3J80 Z;  1FY7 A;  1STZ A;  3P9C A;  2JPB A;  4IJA A;  1JXS A;  5K5O A;  3GEZ A;  2ADU A;  3FXU A;  4WXH A;  4QWQ A;  5HLH A;  2HDC A;  2ZJ2 A;  1MJA A;  1USS A;  4AWX B;  2VXZ A;  3M8E A;  3QOP A;  1SD7 A;  1XCB A;  3ELK A;  3JSO A;  3QU6 A;  4ETS A;  1ZGJ A;  2O3F A;  4Q5S F;  3DP7 A;  4KIC A;  5AIP A;  4JBA A;  1K6O A;  3RJP A;  6PAX A;  2EJR A;  3TO9 A;  3ZMS A;  4GYG A;  2OBP A;  1SFX A;  3O3K A;  4HBL A;  5LGT A;  4LB5 A;  3HYI A;  5BS6 A;  2P5V A;  1P6R A;  3FXQ A;  2D1H A;  3WU1 B;  1ZLK A;  2M30 A;  2GAU A;  4OMY A;  3QU3 A;  5F1R A;  2P4W A;  2QLZ A;  4HYE A;  2PEX A;  4P55 A;  4G9Y A;  2EWN A;  2PBI A;  1ZG3 A;  2RGV A;  3T5X A;  5L3G A;  2LF8 A;  1REP C;  3TOB A;  3CUQ C;  2MA3 A;  1FYK A;  4HX7 A;  2QVO A;  1T6S A;  4KUM A;  2ZCW A;  1F5T A;  5ERI A;  1LDJ A;  4TV7 A;  2UZK A;  4L9J A;  1I27 A;  2OQR A;  1D5V A;  2QWW A;  1D8K A;  2DT5 A;  3HRT A;  3U9G A;  3E6C C;  1FSE A;  2W85 A;  2IRF G;  1HW2 A;  5HS9 A;  1V3F A;  5BPI A;  1UHW A;  4HV5 A;  1C0W A;  2YU3 A;  2A3S A;  2VN2 A;  3SHF A;  1IN6 A;  1OYY A;  2CYY A;  5HS7 A;  1QPM A;  2H6B A;  1YTY A;  3KCC A;  3TDZ C;  2X4H A;  1O7F A;  2VOP A;  3JW4 A;  5L3C A;  3GFI A;  3G3Z A;  2VT3 A;  5D5W B;  2DO7 A;  2EFQ A;  2A07 F;  2B0L A;  2E7W A;  5ILU A;  5E17 F;  5FO5 A;  4L5J A;  3HSR A;  2A6E F;  2OA4 A;  3ERE D;  3F21 A;  4L0Y B;  1I6X A;  2OAZ A;  2J5O A;  5LGU A;  4AIJ A;  3HUG A;  3DQV C;  3IKV A;  1ZRD A;  2KIF A;  1OPC A;  4HDV A;  1MDM B;  2IT0 A;  5A2Q Z;  1MDM A;  4A2U A;  4U0V A;  3LAP A;  3FM3 A;  5FFX A;  3CJN A;  5DD8 A;  3I4P A;  3P9K A;  2JPC A;  3COA C;  4BHC A;  2IA2 A;  3T1B A;  2UWM A;  4CGZ A;  1OKR A;  2O0Y A;  2FNP A;  4OIO F;  4MEY F;  5F6F A;  3SQN A;  4O6J A;  2L4A A;  4IHS A;  4LGW A;  4XRF A;  1R5H A;  1T2K A;  1OMI A;  1D8J A;  2M1B A;  1UB9 A;  3F6V A;  1Z91 A;  2HTJ A;  3GVA A;  1Z1D A;  4FHT A;  2A6H F;  4YFN F;  5DCM B;  5DCM A;  4HW0 A;  4ESF A;  3RKX A;  3M8F A;  3PFI A;  2W84 A;  4AVP A;  4EQQ A;  2FA5 A;  1FBS A;  3ECO A;  3MEX A;  2RNJ A;  2WTE A;  2Q8K A;  1ZG1 A;  3WTX C;  1RUN A;  5FLX Z;  5D5V B;  1FBQ A;  3JSP A;  1SFE A;  4P9U A;  3NRV A;  1XGS A;  1H0M A;  4EJO A;  4KIB A;  5HLI A;  4LMY A;  1TNT A;  1ZN2 A;  3IRQ A;  1X3U A;  2BEO A;  2RKH A;  2PQ8 A;  4ENN A;  4WWC A;  2VC0 A;  1D3Y A;  4P5O A;  3WTU C;  2M8E A;  4I98 B;  1O57 A;  3J7A O;  3OV8 A;  2PI0 A;  3RPQ A;  4S05 A;  5DD4 A;  4XSX F;  1FOK A;  1SD4 A;  2HTS A;  4I0B A;  1P4X A;  3IC7 A;  2PG4 A;  2LSO A;  2V9V A;  3K9T A;  4WK8 F;  1H9T A;  3DPT A;  4YII A;  1WSU A;  1WQ2 A;  1KQ0 A;  5AON A;  2KJB A;  1HKQ A;  3GFL A;  2NNY A;  4HF1 A;  1IN4 A;  1MJ9 A;  1KU9 A;  1IW7 F;  5HVQ C;  3GFM A;  4L0Z B;  3JAM K;  1W7P B;  1W7P A;  2QQB A;  3WTY C;  4FX0 A;  1R23 A;  2D45 A;  3V7C A;  5JHU A;  3WOD F;  5ILS A;  4CXF A;  3FHZ A;  3GX4 X;  1ULY A;  3BPV A;  1TNS A;  3R0J A;  3R0A A;  3KEO A;  3WTS C;  1QO0 D;  3KEQ A;  3QAH A;  3E6M A;  2F5C A;  5CJ9 A;  3R60 A;  1GHC A;  4IXA A;  5KK1 A;  4HF2 A;  2ACJ A;  1BI0 A;  2ESN A;  4MEX F;  4G94 A;  2FSW A;  2CSO A;  1I1S A;  3JTH A;  5JR3 A;  2YSR A;  5D8L B;  3F72 A;  3KE2 A;  5E18 F;  3BRO A;  1BOA A;  4ZH4 F;  2EV5 A;  3DKW A;  1KYW A;  1ZRF A;  1IXS B;  3HOT A;  5D5U B;  1P92 A;  3CUQ B;  3T8R A;  1A04 A;  2P7V B;  1UCR A;  5BQT A;  1J0R A;  1PP8 F;  1HXD A;  3KP7 A;  1FP1 D;  5HDG A;  2O03 A;  4Z2Y A;  3ZMT A;  1SFU A;  4EMS A;  3E6D A;  3E5Q A;  4G7Z F;  2QQ9 A;  1YYV A;  2ZBK A;  4GXO A;  1S6L A;  5LHH A;  2V1D A;  5LHG A;  3MZY A;  2FRH A;  3NQO A;  3PQK A;  5AIQ A;  3BP8 A;  1BI3 A;  1UHM A;  2CG4 A;  4RGU A;  3FMS A;  5JVT A;  2LDU A;  3GLX A;  1TQM A;  4EVI A;  3V8K A;  2K02 A;  3WTW C;  1J5Y A;  2GA1 A;  3BY6 A;  1JE8 A;  1SMY F;  2Q0O A;  2AXL A;  2K4J A;  4ESJ A;  2MLG A;  2LNB A;  4U0W A;  1ON2 A;  1R7J A;  1TTY A;  2VOO A;  4M6Y A;  4KFC A;  1RI7 A;  3ROU A;  2FE3 A;  4D0P A;  1U6G A;  4BHB A;  1OYW A;  3EET A;  4YFX F;  3E3V A;  2RQP A;  3HOS A;  2K86 A;  3MCZ A;  1DDN A;  5DUK A;  1AOY A;  3IHU A;  3RKY A;  3J81 Z;  3O2P E;  2GXB A;  3BWG A;  2FQ3 A;  1SD6 A;  5L3B A;  3IRR A;  2EFO A;  4Y13 A;  3VB2 A;  1B1B A;  1KU3 A;  2L4M A;  1S7O A;  1T38 A;  3ZPL A;  3HSF A;  4LFU A;  5DEQ A;  2P8T A;  4U88 A;  3WTZ A;  4ZZD A;  4RB3 C;  4LLN A;  4BHP A;  1G3Y A;  4KA4 A;  2G7H A;  2YPR A;  3VEP A;  4GO1 A;  5KVR A;  3F22 A;  1W7P D;  2L54 A;  1LQ1 A;  2W24 A;  1YS6 A;  4NHJ A;  1YLF A;  3RDI A;  1VTN C;  5HLG A;  4PCQ A;  1ODD A;  4RGX A;  1TW3 A;  2FMY A;  3U2R A;  4U7D A;  2L02 A;  4WXC A;  1PP7 U;  3HRS A;  1Q1H A;  1FBU A;  4IRI A;  1F1Z A;  2MD5 A;  3D0S A;  2PFB A;  3CTA A;  4IRG A;  4UVC A;  4ASN A;  5K1Y A;  1ZLJ A;  3L2C A;  3TDU C;  5IT9 K;  4RGR A;  1HST A;  1MGT A;  2H09 A;  2L3D A;  4UV8 A;  2HKX A;  4EM2 A;  3VOD A;  1R00 A;  2EA4 A;  4L9T A;  4HLX A;  1B4A A;  4UVA A;  2O8X A;  2XV4 S;  1FLI A;  1I1G A;  1P4W A;  2XGX A;  2F5E A;  3F8B A;  1FPQ A;  1GXQ A;  2F2E A;  3BJ6 A;  1ZAR A;  3M1E A;  1XB4 A;  3MAJ A;  1LDK B;  1BIB A;  3L7W A;  3CLO A;  1FZP B;  4QLC U;  3E97 A;  2DTR A;  4MNU A;  3ZMD A;  2Z5U A;  2HQN A;  3DF8 A;  3MWM A;  3WU0 A;  3BDD A;  2QQA A;  4FT8 A;  2VC1 A;  5CLS A;  3F8N A;  1FNN A;  4Q48 A;  1G3W A;  1ZH5 A;  3FMR A;  2EK5 A;  1IRF A;  1FWZ A;  2RC4 A;  3WTV C;  2HEO A;  5H6R A;  4A0X A;  3N97 A;  1YO5 C;  3GUD A;  5HS8 A;  2ZO4 A;  2ETH A;  1OYI A;  4KN4 X;  3QP6 A;  3LWF A;  5J8C A;  1XD7 A;  2X0L A;  4ZYE A;  2H27 A;  1F9N A;  2CO5 A;  2FOK A;  4IF4 A;  4O5V A;  3EUH A;  1ZAO A;  5H20 A;  1HW5 A;  3K2Z A;  3LA7 A;  3MZH A;  2JT1 A;  2FU4 A;  4HZF A;  4LLL A;  2CFX A;  1FX7 A;  3V7R A;  4EJU A;  2RV8 A;  3LFK A;  2E1N A;  3TOA A;  4PZJ A;  3I64 A;  5EEG A;  4R8H A;  3LST A;  2WC2 A;  3EYY A;  3ECH A;  5L3F A;  1ZRE A;  2STW A;  3Q9S A;  5HDN A;  1S8N A;  2VE9 A;  3PQJ A;  1V4R A;  4ON0 A;  1TQP A;  1K7A A;  5D8K B;  5FD6 A;  1E2X A;  5CVR A;  3GYH X;  1FC3 A;  4P9F A;  2JSC A;  1U2W A;  3T8T A;  5LGN A;  2F5F A;  5E1Z B;  4XLN F;  3KLN A;  4I02 A;  1HQC A;  4PGH A;  4KIG A;  2RVC A;  4KNY A;  2DPU A;  2PN6 A;  3ZN0 A;  4Y15 A;  2QYO A;  2PLY A;  5DDG A;  4OOI A;  4OU0 A;  2QUF A;  2MLK A;  2VOD A;  3Q5F A;  1SMT A;  4BQA A;  1JHF A;  2DBB A;  3GW2 A;  4JQF A;  3IWZ A;  4A12 A;  2XAG A;  2TDX A;  2ELH A;  2H94 A;  2YX4 A;  3WG9 A;  1EH6 A;  1O3S A;  1XCV A;  4NB5 A;  2C6Y A;  5CVJ A;  1P2F A;  3SZP A;  1L3L A;  1IN7 A;  3KP5 A;  3RKW A;  3ZN1 A;  2LKP A;  3E6B A;  5LEJ A;  1XSD A;  1RUO A;  4IVN A;  5DV5 A;  2KJC A;  1FYM A;  3H3U A;  2K4B A;  2LF7 A;  1WRJ A;  4RB2 C;  3BZ6 A; 
#chains in the Genus database with same CATH topology
 1UST A;  1G3S A;  1P9Q C;  4XSZ F;  5TRD A;  2RDP A;  2CWE A;  4XNF A;  4BGD A;  1BC8 C;  2KHM A;  1WJC A;  3IAM 2;  3AG4 H;  3K4L A;  3CJQ B;  4GGG A;  4OIN F;  1J09 A;  3FZV A;  3HB9 A;  3S2W A;  4BY1 J;  1DPR A;  2M87 A;  3CC7 I;  2IVM A;  1B9M A;  4I7H A;  4HNV A;  4RAY A;  3DTE A;  2H8W A;  3S3M A;  3PNY A;  3ZQ7 A;  1QGP A;  3GZN B;  4HV6 A;  4ZYG A;  4XK4 A;  4ZC3 A;  1IUF A;  3H0G J;  2JVH A;  1OCT C;  4XRM A;  4EV0 A;  1KU7 A;  3MFK A;  1POG A;  4AM3 A;  2NS0 A;  5CVI A;  2AS5 F;  1VND A;  4I01 A;  1QBJ A;  1SAN A;  3K70 D;  1ZR4 A;  3K70 C;  2A5Y B;  3TKY A;  5M5X J;  3DV8 A;  5DCF A;  3TQN A;  1JGS A;  1VQ6 I;  2GBY A;  2XAF A;  1BBY A;  5JLW A;  2X1D A;  2FUG 2;  1ONV A;  4DW6 A;  1DU6 A;  2YUS A;  2XUB A;  4A5N A;  2PMZ A;  2XKP A;  1Y0N A;  3FXL A;  3PSI A;  2GOM A;  5GPA A;  4HA8 A;  4CO8 A;  1J59 A;  2R7O A;  3MVP A;  3V8L A;  2P7C B;  2W25 A;  4F3Q A;  4AIK A;  3L2W A;  4OWR B;  5TJJ A;  3K1P A;  1ZRC A;  2EFN A;  3ISP A;  2HVQ A;  2M0M A;  3DLA A;  4ENM A;  3C2B A;  1XDS A;  1CQT A;  4G8X A;  4B09 A;  1LVA A;  3EUH C;  1R36 A;  4KIF A;  1QZZ A;  1X2N A;  4HSR A;  1QU3 A;  5EJC A;  1X58 A;  5D6F A;  1FYL A;  1XSX A;  1M1E B;  1VQ7 I;  4Y52 J;  2EIL H;  3PFY A;  3KZZ A;  2JZY A;  2PJR B;  2NVX J;  3TW6 A;  4B8X A;  4MLO A;  1Z9C A;  4A3C J;  5J40 A;  2PJR A;  3FX3 A;  1SFK A;  4NDL A;  1ZQ3 P;  5IYD J;  3B6C A;  1R71 A;  2L0K A;  2QM3 A;  5TGT A;  2O9L A;  2Q2E B;  1YW8 A;  2WAD A;  1XDU A;  1AKH B;  3SFZ A;  2Q2E A;  2ZSI B;  4PFO A;  1AKH A;  3JRB A;  2P5K A;  2VIX A;  1QVT A;  3B02 A;  1UMQ A;  3QPT A;  1NHA A;  2LD5 A;  3JR9 A;  2UXX A;  4D9J A;  4II3 A;  4BJ5 C;  2Y0M A;  1N77 A;  4DJA A;  3CO7 C;  2F5V A;  2HFH A;  5IP9 J;  2NAZ A;  4Y33 A;  3CDH A;  2VKD A;  2MC4 A;  1VQ5 I;  2ZFW A;  3ZQH A;  3RPU A;  3SJM A;  4BQQ A;  1S7E A;  2EV0 A;  5ED4 A;  3D1N I;  3IH2 A;  2DJI A;  3IP4 B;  2RQQ A;  1U5T C;  3S15 J;  3HG9 A;  5J1U A;  5E8G A;  2NNN A;  2ZJQ F;  1YJW I;  3HTU A;  2R7Z J;  4CCO A;  3T0Y A;  4XN3 A;  1VFC A;  3SDB A;  2KP6 A;  3RSN A;  3G71 I;  1IRG A;  3RZO J;  3FKI J;  1YJN I;  4NC7 A;  1LFU P;  3MZ8 A;  1SAU A;  3JRG A;  4LK1 F;  5FD5 A;  4LG0 B;  4RAG A;  1R22 A;  1PUE E;  3JAM Z;  2NYX A;  4LG0 A;  1YIJ I;  5F64 A;  1K78 B;  1Z0X A;  4B3A A;  3RQI A;  4HF0 A;  3K0L A;  4HOB A;  1YS7 A;  1K78 A;  1XG1 A;  5E3L A;  1W4M A;  4G6Q A;  2DAO A;  3LAJ A;  3OYC A;  4YG2 F;  3G1O A;  2DA4 A;  2F5D A;  2B9S A;  2VI6 A;  3KX2 A;  2R7F A;  3KPH A;  4A5M A;  2ZME B;  4H4K C;  4PDK A;  2E2J J;  5GAE J;  4KYW A;  2ZME A;  1OCZ H;  2ICW G;  3G1M A;  2ME6 A;  3RYP A;  4HDU A;  1LB2 A;  3GTM J;  3Q0W A;  2ISY A;  4GCV A;  4XLH A;  1B8I B;  4IOA F;  2BHY A;  3ZGK A;  1B8I A;  3KP3 A;  5IOY A;  2KLO A;  2EBI A;  4N9H A;  5LRR A;  3BPX A;  2LC2 A;  2HPI A;  2ZXH A;  5CVU A;  1VQK I;  2L9R A;  3HZJ A;  5LHI A;  2TRT A;  5EDN A;  4ITV A;  3AAF A;  4IO9 F;  4ZYD A;  3K4M A;  3CO6 C;  3I3L A;  1MD0 A;  2ZB9 A;  4Y17 A;  3G73 A;  2KKO A;  4WCG A;  3H92 A;  2XAJ A;  4V2G A;  5FJ8 J;  3W6V A;  4OIR F;  5LD2 C;  3FKJ A;  1H88 C;  3KET A;  3C18 A;  2KDO A;  2EV6 A;  5J6X A;  2GA2 A;  4DBQ A;  3S1R J;  1RIO H;  4YIF A;  3ZR8 X;  4A3D J;  3LA2 A;  1APL C;  3TO7 A;  3L00 A;  3J81 K;  4CCJ A;  2LY1 A;  2CW0 F;  1YX3 A;  3CCV I;  1A36 A;  4CHU A;  1E3O C;  4IRH A;  1FP2 A;  1TZL A;  1QQI A;  4M71 A;  3JRC A;  3DTI A;  4ZJZ A;  1MJB A;  3GME A;  2R5Y B;  2WV1 A;  2LRE A;  3K6G A;  2XVC A;  3HTS B;  4BQO A;  3LNQ A;  2GXG A;  2HXO A;  3NAU A;  2R5Y A;  1BN5 A;  2PMH A;  4UB8 C;  2AXT C;  5IPA A;  3A4C A;  1NG6 A;  1SC7 A;  4CUG A;  3B73 A;  3WGH A;  4I2O A;  4PK4 A;  5IT3 A;  3O8G A;  1YW7 A;  3F9K A;  3F8F A;  4AD9 A;  2ZXW H;  3HBL A;  1BR2 A;  1UG2 A;  3J80 K;  3CCY A;  1D0Y A;  1IZ1 A;  2ISZ A;  1EH8 A;  2L01 A;  5E8I A;  1DP7 P;  5E3M A;  2RNG A;  2HOS A;  3DPL C;  2HQA A;  2PMU A;  2X48 A;  3RYR A;  2QF7 A;  3H5A A;  1SD5 A;  2GZW A;  2UXN A;  2FXA A;  3CP8 A;  3HGG A;  3JTG A;  4UXN A;  5LRS A;  1J9I A;  1V5F A;  3V7S A;  1J2X A;  2M45 A;  1VQM I;  1U78 A;  3W2W A;  1YG2 A;  3BJA A;  4UHT A;  2FJ1 A;  2VBW A;  3GXO A;  2OZU A;  2DXI A;  2GWR A;  4I99 C;  4MQ9 F;  4EAT A;  4HLY A;  5LLQ A;  3TED A;  1S3J A;  2FF4 A;  3GTQ J;  1B6A A;  3ULQ B;  3CMY A;  3C2G A;  1IUY A;  2XRN A;  5E1W A;  3ZOB A;  1BI1 A;  2ZXJ A;  2XGC A;  4JX5 A;  1TLH B;  1V54 H;  2BBY A;  3W6J B;  4UVB A;  4LB6 B;  4DYQ A;  1Z3X A;  2LFB A;  1ERD A;  1XGN A;  1KGS A;  2NXN B;  5E3N A;  2IS6 A;  2B7E A;  1XGM A;  1B9N A;  2R7V A;  3FXR A;  1ZHF A;  1K83 J;  3FIW A;  2VBY A;  3CJT B;  2HWV A;  3TGN A;  5GTI C;  4HX4 A;  3O8H A;  4J01 A;  2W82 A;  1ZYR F;  3QPL A;  1R1T A;  5J1Y A;  2KIU A;  3L9F A;  3IH3 A;  1PUF B;  3K4J A;  2UV1 A;  2MBF A;  2XF7 A;  1OJL A;  1A31 A;  1OCR H;  2F6C A;  2M34 A;  2QEN A;  1PUF A;  3L09 A;  3HHH A;  2ID3 A;  4HQM A;  4UB6 C;  1W5S A;  2KRC A;  1I5Z A;  4AC0 A;  5CYV A;  3RI4 A;  3SEZ A;  1Y6I A;  1LUJ B;  2M9H A;  3E7L A;  4WF2 A;  4B4C A;  1IXR C;  1WWX A;  3U1D A;  1LEA A;  2E71 A;  2ZNZ A;  4BAY A;  4DOZ A;  3S2H J;  1O4X A;  2HQR A;  3JRI A;  3N05 A;  5L3D A;  1Y39 A;  1BI2 A;  3OYE A;  2DK8 A;  3ZCO A;  3FM5 A;  3PNV A;  2VE8 A;  5E20 A;  3WGI A;  1BL0 A;  3REO A;  1WJE A;  4GFB A;  2BY2 A;  2EQR A;  3ABU A;  2CQK A;  1VQN I;  1PDN C;  5GAH J;  1F36 A;  2ZKZ A;  4L9N A;  4NNJ A;  1X1B A;  4HX8 A;  1ETK A;  1U9O A;  1O7L A;  3RPU D;  2VON A;  2QQ8 A;  3RZD J;  2X1C A;  5ICF A;  2XC7 A;  2E36 A;  4G7H F;  1MSF C;  4XRS A;  4XLF A;  4WX9 A;  5K5Q A;  3HL2 A;  5CQG A;  3M7G A;  3I59 B;  5L3E A;  5FRN A;  2FX0 A;  3I59 A;  2Z3Y A;  4NUB A;  2X6O A;  1JKP C;  3VYS B;  4XN0 A;  5ICC A;  1MBG A;  5DS9 A;  3JRH A;  4ZZL A;  1SVO A;  1WI3 A;  1UAA A;  1ZGA A;  3V4G A;  2BV6 A;  3LSK A;  4BXF A;  2E5N A;  1ON1 A;  1HKS A;  3CUO A;  3E5X A;  3F6O A;  1IG7 A;  2CV0 A;  4ABZ A;  1VQ9 I;  1RES A;  4PSW A;  5EF6 A;  2V4J C;  1LDD A;  4BNC A;  2COM A;  3R6S A;  3DEE A;  5D4S A;  1QA6 A;  2IW5 A;  1L0O C;  3CCS I;  5DUI A;  2HOA A;  2XDV A;  3DPU A;  4CZZ A;  5JI6 A;  5KAF C;  2O61 A;  5JVG F;  1TWF J;  2HKO A;  3MKW B;  2DU9 A;  2HS5 A;  3K69 A;  4PJN A;  4E7H A;  5DM7 F;  2Y69 H;  4CIC A;  1MMD A;  3HSE A;  2JRT A;  4V2F A;  3CCR I;  2VT2 A;  4M3G A;  1Z3Y A;  4RAF A;  1TC3 C;  1X3W B;  4MFD A;  3LA3 A;  1JT0 A;  1XS9 A;  2NOG A;  5ICE A;  5IP6 A;  1G3T A;  1V55 H;  2JJ7 A;  3A01 B;  2ME0 A;  3EDP A;  2MC3 A;  3D5L A;  3WTT C;  3A01 A;  1HKT A;  1ITY A;  2CW8 A;  2KRF A;  4EM1 A;  2L9V A;  2XIG A;  4Q47 A;  5HLT A;  2DA2 A;  3LQQ A;  3GTL J;  4HNU A;  2ELK A;  1TT5 B;  4OAY A;  1T0F C;  2A69 F;  4R79 A;  1OR7 C;  2JMW A;  3UKG A;  4PJL A;  2G7U A;  1Z7U A;  2IPQ X;  2Y30 A;  5A2Q K;  3DEU A;  3EQL F;  3U1K A;  3BR0 A;  4XOR A;  4DZJ A;  3KYL A;  2PJP A;  5IT9 Z;  2NVY J;  2E1C A;  4XOT A;  4UNO A;  2WAF A;  4M73 A;  2XHK A;  3RTR A;  3MKZ A;  2DQL A;  5HOD A;  4CYD A;  4ENJ A;  4A93 J;  1GXP A;  3I53 A;  1ZK8 A;  1TBX A;  4OIQ F;  1MMS A;  4BEH B;  3WGG A;  4A3M J;  1HBX G;  4BE1 A;  5F08 A;  2OPT A;  3QOD A;  3FWE A;  4E70 A;  1W36 C;  1DP3 A;  4G6D A;  4XMY A;  4XON A;  1JT6 A;  2DA5 A;  2VQL A;  2IGM A;  1Z21 A;  1U8R A;  4E7J A;  2NOJ B;  2R4G A;  4UV9 A;  2CUZ A;  2DLL A;  4RGS A;  4X1E A;  2D1V A;  4A6E A;  3KFW X;  1P7I A;  4ZDL A;  1DU0 A;  2XKO A;  2W4S A;  5HNH A;  5DM6 F;  2FBH A;  5H6Q A;  3OY9 A;  2V7F A;  1JJ6 C;  3JRD A;  3GCM A;  4BY7 J;  3Q9V A;  4RB0 A;  5J8F A;  3O6B B;  2ID6 A;  3I0T A;  2W57 A;  2CUF A;  1JI8 A;  4Q4Z F;  3N4M A;  5EEH A;  1NK3 P;  3BJO A;  3GWZ A;  2RN7 A;  2K9S A;  1Y56 A;  4X0G A;  4O3M A;  1R4M B;  4A3J J;  4LD5 A;  4NQW B;  5FLM J;  4WXD A;  5LBQ A;  1F4K A;  1U5T B;  2D2W A;  4NQW A;  3PIO F;  1P4A A;  5C3E J;  1U5T A;  3HEF A;  3CCE I;  1PJR A;  1R58 A;  5BMZ A;  3EYI A;  4FX4 A;  3D5S C;  1AWC A;  1YFH A;  3OYJ A;  2XF6 A;  4A0Y A;  4OMZ A;  3G4S I;  3F3X A;  2XPU A;  4CZC A;  1GLN A;  1FSH A;  3KP6 A;  1YHQ I;  1T95 A;  1LNW A;  1Y0U A;  2V1X A;  3K1M A;  2R93 J;  4G7O F;  2WA0 A;  3SZT A;  1J75 A;  2NS7 A;  5KAI C;  1W0U A;  2W1O A;  3GTJ J;  2W00 A;  3E5U A;  2MH9 A;  4FET A;  3HXL A;  5F0F A;  5FLX K;  2BE5 F;  4EGZ A;  1MNE A;  1XPX A;  2ZJR F;  1XMX A;  3SDG A;  3P9I A;  4BDZ A;  2JRM A;  2E1O A;  1G4D A;  2K27 A;  3NEU A;  4BBS J;  3R4K A;  3ABT A;  2OZ6 A;  2WY8 Q;  2P5L C;  4C3I J;  1U8B A;  3M07 A;  4K2E A;  1TWC J;  2DOA A;  2DW4 A;  3GFJ A;  5FGM A;  2FNA A;  2X85 A;  3HHG A;  2KQR A;  4B1R A;  2GLO A;  1R1U A;  2HZT A;  2QA4 I;  2UUZ A;  2M5W A;  4M3F A;  3TMO A;  3DWL E;  2KFD A;  4CCK A;  3HKZ A;  1Y8R B;  2DPD A;  3HGY A;  1B59 A;  1FT9 A;  3LQR A;  2FML A;  3G2B A;  4AIH A;  1FOX A;  1EH7 A;  1OCP A;  2HOE A;  2HYG D;  3KLO A;  3WE3 A;  3ZQQ A;  5B3S H;  2VB6 A;  2FD5 A;  1BC7 C;  1XN7 A;  4EM0 B;  2DI3 A;  2Y0S A;  2CRG A;  5J3L A;  1KQ8 A;  1HF0 A;  2IS4 A;  3WE2 A;  1TW2 A;  1GV5 A;  4W1U A;  2DN0 A;  3HRU A;  3OYN A;  2R3S A;  4BYY A;  1Y1W J;  1WJB A;  3I56 I;  4BQN A;  2VKE A;  1KON A;  2WAE A;  5D5X B;  3I4M J;  4XLP F;  3S32 A;  2JWT A;  1NG7 A;  2I5U A;  4CDG A;  1T33 A;  1MNM C;  1S5L C;  4A6D A;  1R5G A;  3VSK A;  4BL0 B;  1EJ9 A;  1MBH A;  2STT A;  2NRA C;  4NC8 A;  2OU2 A;  3R61 A;  2QSH X;  1ETY A;  1J7K A;  2ZJP F;  3IH4 A;  1QZE A;  4JX4 A;  1YE9 A;  1JHH A;  4UUT A;  4N9I A;  2DFI A;  1KU2 A;  3GF2 A;  4RAZ A;  1U0J A;  3K4N A;  4N0B A;  3TP3 A;  3GO5 A;  1T56 A;  1T8I A;  4R1H A;  2XAQ A;  3DBH B;  3OMY A;  2K7L A;  5D6E A;  4F7Z A;  5FB2 A;  2V1U A;  1W5T A;  2FBI A;  5DYM A;  4RLF A;  2JA5 J;  3S3O A;  1YW9 A;  3GZ5 A;  4L5I A;  3ERM A;  5K5R A;  5C4J J;  1ETQ A;  2BY3 A;  5FRO A;  4U0Y A;  5EEA A;  3F8C A;  2QBY B;  1D0X A;  4MHG A;  3ZMV A;  4BE0 A;  2QBY A;  1IC8 A;  2WWY A;  4ENK A;  1IF1 A;  4BH9 A;  3DTK A;  2GOX B;  4IPA A;  5F04 A;  5HOO A;  3KZI C;  3P7N A;  1VQP I;  3EUA A;  4DYC A;  2VBZ A;  3BTJ A;  2A61 A;  1IAW A;  3DLL F;  1JKR C;  3WG7 H;  4D7M A;  1ZR2 A;  2Z9O A;  2VQC A;  4BDY A;  4AU7 A;  1FMW A;  4HRI A;  1YQA A;  2YS9 A;  2VBX A;  4IKF A;  2EB7 A;  3KIO A;  3GBG A;  1H9G A;  4MGR A;  4AUX A;  2CUE A;  2CV2 A;  2EZL A;  2IP2 A;  1KA8 A;  2V79 A;  3BR2 A;  4KN7 X;  2IXS A;  3VFZ A;  4S04 A;  1SAX A;  1TQI A;  4EJT A;  3BTC A;  3VOE A;  2V6E A;  1UG0 A;  2FEZ A;  4ZTF A;  5TIS C;  1K4S A;  3CLQ A;  3IL2 A;  1I50 J;  4ESB A;  3TW7 A;  5EZG A;  3OOP A;  4KT5 C;  1T08 B;  2IA0 A;  3CES A;  3FHN A;  2IS2 A;  3V8J A;  1K4T A;  1Z05 A;  3ZMZ A;  1EA3 A;  1RNL A;  2L2O A;  4KMU X;  4L9V A;  5B1A H;  2OC6 A;  3HDD A;  4XBF A;  2W7N A;  5D4R A;  1G6N A;  2Y75 A;  2ZSH B;  4BXU A;  4A3L J;  2R0Q C;  2FBK A;  3FMQ A;  3QYE A;  3C7J A;  3BZK A;  1VQO I;  2WAQ N;  4HG2 A;  2IBD A;  2OD5 A;  1BIA A;  3K1N A;  3DBL B;  4M3D A;  2HYF A;  3OOU A;  2YU9 J;  4I6Z A;  5LEK A;  2IA1 A;  2M2E A;  2EIJ H;  3I58 A;  4IHT A;  1YJ9 I;  3GZ6 A;  3H5R A;  3VYT B;  5ICG A;  3LFU A;  1WKM A;  5CQE A;  4CCM A;  4XQF A;  5EGO B;  2O6G E;  3IWF A;  4PUS A;  5FFZ A;  5EGO A;  2HR3 A;  1SEU A;  1HSJ A;  1GVJ A;  4M9S A;  2DQR A;  1I6H J;  3TBI A;  1I3Q J;  2ZNY A;  2LBF A;  3ZQL A;  4MTE A;  2KRH A;  2G9W A;  1P7J A;  2BHZ A;  3NWS A;  4RLQ A;  4XLA A;  4HAM A;  2XB0 X;  3VPR A;  2HDD A;  3GTG J;  1YOV B;  3OYI A;  1LEB A;  1MZB A;  2Z99 A;  3BQZ A;  1EKE A;  4A3G J;  3W6K B;  3OYK A;  4N4O B;  2DK5 A;  1YIO A;  2HDW A;  4PGG A;  5BOX A;  2KIM A;  4XIC A;  4DQ2 A;  2XF5 A;  2JSP A;  2YX7 A;  2A68 F;  2EIK H;  4DBR A;  1ZKG A;  5EZH A;  4KMF A;  4XRS G;  2L7M P;  1IDY A;  3QPH A;  2DYS H;  4LK0 F;  2EA2 A;  3IV5 A;  1O3T A;  2MH2 A;  3ZP5 A;  1FEX A;  2EFW A;  3KZY A;  3I71 A;  1WZ2 A;  1HW1 A;  1KQ9 A;  3ONQ A;  2ESH A;  3TO6 A;  4M74 A;  1X2M A;  1QNT A;  1XGO A;  1Z6T A;  1UZC A;  1KYZ A;  1YIT I;  2DJN A;  3HIF A;  4M9Z A;  1WCM J;  2XRO A;  1UHS A;  3BC8 A;  2LH9 A;  1BJA A;  2M7B A;  4XL9 A;  3TL4 X;  2DT6 A;  2WV0 A;  1O3Q A;  1LVK A;  3BOQ A;  1U3E M;  3KP4 A;  3WHB A;  3BG7 A;  4M72 A;  4MFE A;  4DZP A;  5E1X A;  3OWT A;  1NTC A;  2BZT A;  3HOU J;  2P6S A;  3RIR A;  3LOC A;  3CQZ J;  3CUQ A;  1EV7 A;  2PMZ N;  2GQQ A;  4NC6 A;  1ZG5 A;  5B1B H;  5IY5 H;  3OR2 C;  4MIM A;  1R1V A;  1S7A A;  3I54 A;  2R7T A;  3OYL A;  1WJA A;  3ML6 A;  3QP5 A;  4DNC A;  3SXY A;  3CD6 I;  2E7X A;  4PJJ A;  2H1K A;  3ESW B;  3CCM I;  1T0F A;  1IN5 A;  4FCY A;  1OR7 A;  1R6R A;  5J4Y A;  3J7Y J;  4QTR A;  1WVR A;  2HGC A;  2BYV E;  2P6T A;  2XAS A;  4Y4R A;  4EGY A;  1IV6 A;  2YR2 A;  3HPH A;  3H5N A;  3LSM A;  2LG4 A;  4E7K A;  2M0C A;  4Y3O A;  1IXC A;  3NWT A;  2F48 A;  1T39 A;  4M9X A;  4YFK F;  3OYG A;  1S29 A;  3F8M A;  1CF7 B;  2H6C A;  4L18 B;  3DFG A;  4P96 A;  4RMN A;  1CF7 A;  4EJW A;  4JK1 X;  3DKY A;  4EJV A;  4LIV A;  3OSF A;  3HRM A;  4V19 K;  2W48 A;  1E17 A;  4HQE A;  2EFP A;  1JJ8 C;  4H0E A;  2VJI A;  4I09 A;  4OIP F;  1SVL A;  4U87 A;  1VI0 A;  1O3R A;  4LJZ F;  5M3M J;  1WHU A;  3CP2 A;  1R5I D;  1WI9 A;  3ZMU A;  4PSX A;  1BM9 A;  1GV2 A;  3M9A A;  1XMA A;  1CGP A;  1DUX C;  2VUM J;  3W3C A;  2HPM A;  5JFR A;  1XSV A;  1V5G A;  3FBN B;  4QSH A;  4D1Q A;  3IKT A;  2AHQ A;  2CGP A;  3H3Z A;  4CCL A;  1ETV A;  2Y48 A;  3FIS A;  1DPU A;  3ZQC A;  1XMK A;  4BJT A;  5B5E C;  4F92 B;  2R7D A;  1GVD A;  3C1D A;  3F23 A;  4A3F J;  5J4V A;  2CS3 A;  4M6X A;  3KP2 A;  4JP0 A;  3FF5 A;  1MKM A;  1E3H A;  3HJE A;  3I5U A;  4KDP A;  4NBQ A;  2OQG A;  4IHV A;  4I0A A;  4YEL A;  3OYD A;  1KZH A;  3M8J A;  4A0Z A;  3DXJ F;  1WJ5 A;  2VL8 A;  3C3W A;  2Z33 A;  1VQ8 I;  3VYR B;  4MTD A;  3MQ0 A;  1QVU A;  1RR8 C;  4MO7 A;  3SYT A;  2BY1 A;  1UFM A;  2E19 A;  2QZ8 A;  4ZYH A;  3FXO A;  4UUV A;  2MAB A;  1E3P A;  2HQ5 A;  3H36 A;  2IJL A;  2V6C A;  2J5P A;  2BGC A;  2JTV A;  2XAH A;  3LMM A;  3ZRG A;  1NK2 P;  2DOE A;  1K79 A;  4GYI A;  1IN8 A;  2VPR A;  1DGR M;  3DU6 A;  3CCJ I;  3OL4 A;  1QZY A;  1T98 A;  1LJ9 A;  3BR3 A;  3K4C A;  5ILV A;  4LLG F;  4RB1 A;  1F43 A;  3QRF F;  1Z6R A;  1EF4 A;  1PYV A;  5E79 C;  1RZ4 A;  1MW7 A;  3OL3 A;  1HOM A;  2K9L A;  2E2I J;  1G59 A;  2GIV A;  5CVV A;  2DMT A;  5BPD A;  2Y31 A;  5FKL A;  4U7B A;  4RS8 A;  5HDK A;  4RM2 A;  4MQV A;  4ZTJ A;  4C2T A;  3J80 Z;  5BNG A;  1FY7 A;  3I4N J;  1MH3 A;  1ZEL A;  1STZ A;  2IS1 A;  3OS0 A;  3P9C A;  2JPB A;  3ASN H;  4IJA A;  1ETX A;  5J47 A;  1JXS A;  3S1Q J;  1BJZ A;  1I3A A;  5K5O A;  2DFE A;  3GEZ A;  2ADU A;  3FXU A;  4KJZ A;  4WXH A;  3OIP A;  5FKN A;  2Q1Z B;  2NVU B;  2Z1D A;  4QWQ A;  2O7O A;  3AFH A;  3X2Q H;  3I55 I;  5HLH A;  2HDC A;  4A3K J;  3DKX A;  1SFO J;  1X3Z B;  2IGO A;  2ZJ2 A;  2D5V A;  1MJA A;  1USS A;  4AWX B;  2VXZ A;  3M8E A;  3QOP A;  1SD7 A;  1XCB A;  2XRL A;  2A5W A;  4AID A;  5B66 C;  4UY8 I;  3ELK A;  3GTO J;  3ZQI A;  4CA0 A;  3JSO A;  3QU6 A;  4ETS A;  3FXK A;  2RAE A;  2DFH A;  4G12 A;  1IGN A;  1ZGJ A;  2O3F A;  4Q5S F;  3DP7 A;  3G1L A;  4F91 B;  3OYB A;  4KIC A;  5AIP A;  4JBA A;  2XPW A;  1K6O A;  3RJP A;  6PAX A;  1TWH J;  1VQ4 I;  2EJR A;  2K9N A;  1GUU A;  3TO9 A;  3ZMS A;  4GYG A;  2OBP A;  1SFX A;  2BW3 B;  3O3K A;  2HI3 A;  2JUG A;  4HBL A;  2XGD A;  5IYC J;  2BW3 A;  5LGT A;  3OIQ A;  3NAR A;  4RDU A;  4GRI A;  2DA3 A;  4LB5 A;  3HYI A;  5BS6 A;  3LL7 A;  2GM4 A;  2P5V A;  3RKQ A;  1P6R A;  2LY9 A;  3FXQ A;  1D0Z A;  2D1H A;  4JOM A;  3WU1 B;  1ZLK A;  3HOZ J;  2M30 A;  2GAU A;  4ZDP A;  1ETO A;  3P5J A;  4OMY A;  3QU3 A;  5F1R A;  3H9J A;  4FAS D;  2P4W A;  2AO9 A;  2QLZ A;  4HYE A;  2PEX A;  4P55 A;  3RCO A;  2L7Z A;  4G9Y A;  2EWN A;  2PBI A;  1ZG3 A;  2RGV A;  3T5X A;  5L3G A;  1JUS A;  2LF8 A;  1REP C;  3TOB A;  3CUQ C;  3K4K A;  2MA3 A;  1FYK A;  3VSL A;  1W1W E;  5KHD A;  2DMU A;  4HX7 A;  2R7Q A;  2QVO A;  3SZG A;  3AG3 H;  1T6S A;  4KUM A;  4FTH A;  3A02 A;  2MGQ A;  2HOT A;  3HOY J;  1MBE A;  2ZCW A;  1F5T A;  3MMY B;  5ERI A;  2XGE A;  4UUS B;  1LDJ A;  4TV7 A;  5GPC A;  4BAC A;  2UZK A;  4L9J A;  1I27 A;  2LTP A;  4UUS A;  3H9G A;  2CQX A;  3ZQG A;  2OQR A;  1D5V A;  2QWW A;  1D8K A;  2DT5 A;  3HRT A;  3U9G A;  2E1M C;  3E6C C;  1FSE A;  2W85 A;  2IRF G;  2EZK A;  3QQA A;  5HS9 A;  1HW2 A;  1V3F A;  3ABL H;  5BPI A;  1UHW A;  4B47 A;  2OV7 A;  4AYB A;  4HV5 A;  1C0W A;  2YU3 A;  2A3S A;  1DGW Y;  2VN2 A;  1TT0 A;  4FQG A;  3SHF A;  1VQL I;  2Y9Y A;  1IN6 A;  1OYY A;  2M4K A;  2CYY A;  5HS7 A;  1QPM A;  2DA7 A;  4XM3 A;  2CW7 A;  2H6B A;  1YTY A;  3AL0 C;  4LG3 A;  1JTX A;  1LE8 B;  5EYR A;  1W36 D;  3KCC A;  2HVR A;  4IHY A;  1LE8 A;  1JTY A;  3TDZ C;  2X4H A;  3V42 A;  4S0H B;  5JHF A;  1O7F A;  2P81 A;  2VOP A;  3JW4 A;  5L3C A;  3GFI A;  3G3Z A;  2VT3 A;  1OFC X;  3A2K A;  1A5J A;  5D5W B;  3CJR B;  2A6T A;  2DO7 A;  2EFQ A;  2MG4 A;  1RC9 A;  1SVM A;  3PNT A;  2A07 F;  2B0L A;  2E7W A;  2DMN A;  2K5C A;  2MD0 A;  3OIO A;  5ILU A;  1G8X A;  5E17 F;  5FO5 A;  4L5J A;  3EUK L;  2JQ7 A;  3HSR A;  2A6E F;  2OA4 A;  3ERE D;  3F21 A;  4L0Y B;  1I6X A;  3HOW J;  2OAZ A;  2WB1 A;  2J5O A;  2NVT J;  1IRZ A;  2K40 A;  3HUG B;  2DA6 A;  5LGU A;  4AIJ A;  2ECB A;  3HUG A;  4YEJ A;  3DQV C;  3IKV A;  1ZRD A;  2IAI A;  2KIF A;  1X1A A;  1OPC A;  4HDV A;  3IUO A;  4EEF G;  1MDM B;  2IT0 A;  5A2Q Z;  1MDM A;  4A2U A;  1N78 A;  4L5E A;  2R7X A;  4U0V A;  3LAP A;  3FM3 A;  5FFX A;  3CJN A;  4BBR J;  1ORK A;  5DD8 A;  1W0T A;  3I4P A;  1R49 A;  1IDZ A;  3BT9 A;  3P9K A;  2JPC A;  2JN6 A;  2LLK A;  3DU5 A;  3LSI A;  3COA C;  1MH4 A;  4C9Y A;  4BHC A;  3OYH A;  2IA2 A;  3T1B A;  2UWM A;  2LY2 A;  2BXY A;  4QIW N;  2V9K A;  4CGZ A;  2V9P A;  1OKR A;  1UEL B;  2O0Y A;  2FNP A;  4HEA 2;  4MEY F;  3Q0U A;  2LVS A;  5F6F A;  1XTA A;  3SQN A;  4OIO F;  1ACI A;  3BTI A;  4O6J A;  2L4A A;  4IHS A;  4LGW A;  4XRF A;  1R5H A;  3S2D J;  2G0E A;  1T2K A;  4IOC F;  4LOC A;  4RA2 A;  3H1C A;  5F0C A;  4DYR A;  1OMI A;  2O8K A;  1D8J A;  2M1B A;  2X9D A;  1UB9 A;  3BTL A;  2NS8 A;  3F6V A;  1Z91 A;  2HTJ A;  2M8G X;  3GVA A;  1S72 I;  1TWG J;  1HC8 A;  3M4O J;  1Z1D A;  2FQ4 A;  4FHT A;  2CMP A;  2A6H F;  1TP4 A;  4YFN F;  4DIQ A;  2VJ4 A;  1Z77 A;  4XOP A;  5DTD A;  5DCM B;  4KIS A;  3KEY A;  1VF9 A;  3MD2 A;  5DCM A;  3AG2 H;  4HW0 A;  4ESF A;  2B63 J;  1FIP A;  3RKX A;  4IL6 C;  3M8F A;  1I39 A;  3PFI A;  2W84 A;  4AVP A;  3S16 J;  3TP0 A;  1RKT A;  3B6A A;  4EQQ A;  1TL8 A;  4YIR X;  1K61 A;  2F4O B;  2FA5 A;  1FBS A;  3ECO A;  3MEX A;  2I8D A;  2RNJ A;  2WTE A;  4F55 A;  2Q8K A;  1ZG1 A;  2VJ5 A;  4C30 A;  3WTX C;  2QGU A;  4IHW A;  1IJW C;  1RUN A;  5FLX Z;  5D5V B;  1YRN B;  2Y2Z A;  1FBQ A;  3GLL A;  3CC4 I;  4BJ6 C;  1YRN A;  3JSP A;  1SFE A;  2AQF A;  3NRV A;  4P9U A;  1XGS A;  1H0M A;  2CH0 A;  4EJO A;  4KIB A;  3J7A Y;  5HLI A;  4LMY A;  4JYK A;  2A05 A;  1HA8 A;  1TNT A;  1ZN2 A;  3IRQ A;  2RKH A;  1X3U A;  3BR1 A;  2BEO A;  2LKS A;  2PQ8 A;  4ENN A;  4WWC A;  3L2V A;  2VC0 A;  1D3Y A;  2F4M B;  1HDP A;  2VKH A;  2L5Q A;  4BE2 A;  4P5O A;  3WTU C;  2OJE D;  2M8E A;  3BG6 A;  1RR7 A;  3GTP J;  4I98 B;  1O57 A;  1HLV A;  3C2H A;  3J7A O;  5KCM A;  1RET A;  3OV8 A;  2PI0 A;  3RPQ A;  1QHG A;  4S05 A;  5DD4 A;  4XSX F;  1FOK A;  1SD4 A;  2HTS A;  4I0B A;  2QKM B;  1P4X A;  3CMA I;  3IC7 A;  2VPL A;  2PG4 A;  3CMM A;  4II2 A;  2LSO A;  2V9V A;  4AVZ A;  3K9T A;  4WK8 F;  1MBJ A;  9ANT A;  1HDD C;  2VJJ A;  4YRV A;  1MSE C;  3WHC A;  2XSD C;  1H9T A;  4D7N A;  3DPT A;  4YII A;  1WSU A;  1WQ2 A;  1BR1 A;  1KQ0 A;  4PFP A;  5AON A;  2AQE A;  1ZGW A;  1X1D A;  2KJB A;  3HKZ N;  5C44 J;  2JA8 J;  1BW6 A;  1HKQ A;  1MMG A;  3MKL A;  3CCQ I;  4XLC A;  1LFB A;  3GFL A;  4PJM A;  1HCR A;  2NNY A;  4HF1 A;  2Y0S N;  3AG1 H;  1IN4 A;  1MJ9 A;  1KU9 A;  1IW7 F;  3FK7 A;  3KYC B;  4P1W A;  2DOD A;  5HVQ C;  3GFM A;  4HST A;  4LIU A;  4L0Z B;  3CF2 A;  3JAM K;  1W7P B;  1VZ0 A;  4ZDO A;  3WU2 C;  3L2Q A;  1W7P A;  2QQB A;  2O5R A;  1N75 A;  1QPI A;  3WTY C;  4FX0 A;  1R23 A;  2D45 A;  3PIP F;  2DTZ A;  4W97 A;  3V7C A;  3PO3 J;  1MIJ A;  5JHU A;  1X4P A;  3WOD F;  5ILS A;  2GIZ A;  3K4B A;  2HNH A;  2LBF B;  4CXF A;  5C4X J;  4XID A;  3FHZ A;  3GX4 X;  1ULY A;  3FXJ A;  2MYS A;  4A3E J;  5CPR B;  3BPV A;  2PX9 A;  1TNS A;  5LFA A;  3S1N J;  3R0J A;  3R0A A;  3KEO A;  3WTS C;  1QO0 D;  3KEQ A;  3QAH A;  3QWL A;  2X6X A;  5J1R A;  3E6M A;  2F5C A;  5CJ9 A;  3R60 A;  4LIT A;  4E7S A;  1GHC A;  4IXA A;  5KK1 A;  4D5F A;  4PJ0 C;  2CFO A;  2K3F A;  4A3B J;  4HPQ A;  4HF2 A;  2L7K A;  3Q0V A;  2M7A A;  1FOW A;  3OYF A;  2K3P A;  4XKV A;  2ACJ A;  1BI0 A;  2ESN A;  4B48 A;  4MEX F;  4G94 A;  2QKL B;  1D1C A;  2FSW A;  2KZG A;  1WH5 A;  4E4H A;  3QOE A;  5K7F A;  2CSO A;  1I1S A;  3VDX A;  3JTH A;  3K7A J;  5JR3 A;  2YSR A;  1GDT A;  1X4O A;  2OTJ I;  1ETW A;  5D8L B;  3F72 A;  3KE2 A;  5E18 F;  3BRO A;  1BOA A;  1D5Y A;  5KNL A;  1BR4 A;  4ZH4 F;  3PO2 J;  2EV5 A;  4FE7 A;  3DKW A;  1KYW A;  1ZRF A;  1IXS B;  3HOT A;  3QYB A;  1H8A C;  2JUC A;  4F52 A;  5D5U B;  5FRM A;  2E35 A;  1P92 A;  3CUQ B;  2VQH A;  3T8R A;  2R7W A;  1A04 A;  1FOY A;  2P7V B;  2LOO A;  4C2U A;  1UCR A;  5BQT A;  3A03 A;  1WGX A;  1J0R A;  3HC7 A;  1MND A;  3A0H C;  2KL4 A;  2DYR H;  1PP8 F;  1HXD A;  3KP7 A;  2E5Z A;  4XKB A;  2ELJ A;  3S93 A;  3HOV J;  1W5C C;  2DT7 B;  1FP1 D;  1IO2 A;  1TWA J;  5HDG A;  2O03 A;  4Z2Y A;  2LMD A;  1Q1V A;  3ZMT A;  2HXI A;  1K6Y A;  2E1M B;  1SFU A;  4N4N B;  4EMS A;  3E6D A;  1A6I A;  1Y8Q B;  3E5Q A;  2JVG A;  4G7Z F;  2QQ9 A;  5GP9 A;  1YYV A;  2ZBK A;  1X1P A;  5F27 A;  2KIS A;  4GXO A;  4Y7N J;  1S6L A;  5LHH A;  2V1D A;  5LHG A;  4QPQ A;  4BKX A;  3MZY A;  1R9T J;  2FRH A;  3NQO A;  3PQK A;  3BCA A;  4IHX A;  3DCF A;  5AIQ A;  3L1P A;  3BP8 A;  4XKC A;  1BI3 A;  1UHM A;  2CG4 A;  3AL0 B;  2P0W A;  4RGU A;  4M6V A;  3FMS A;  2KMU A;  5JVT A;  2LDU A;  3GLX A;  1A35 A;  3ABK H;  1FTT A;  1TQM A;  4EVI A;  1S9H A;  2NVQ J;  3V8K A;  1PVE A;  4B43 A;  3CC2 I;  3VWB A;  2TCT A;  2K02 A;  2XSJ C;  3WTW C;  3KYD B;  2KIQ A;  1J5Y A;  2N8G A;  2GA1 A;  1N25 A;  3BY6 A;  2LRD A;  2L9S A;  1JE8 A;  1SMY F;  1Y1V J;  2ZFU A;  1LFP A;  2AXL A;  2Q0O A;  3CME I;  3ASO H;  2K4J A;  2DCE A;  4X6A J;  5M5Y J;  2KT0 A;  4ESJ A;  2DDA A;  3MKY B;  4J19 A;  2MLG A;  2JK3 A;  2LNB A;  4U0W A;  1MBK A;  3FDY A;  1ON2 A;  1R7J A;  1TTY A;  2GXA A;  1JGG A;  2VOO A;  4M6Y A;  4CSW A;  3LSH A;  5IP7 J;  4KFC A;  1RI7 A;  3ROU A;  2FE3 A;  1WFX A;  4IEJ A;  4D0P A;  1U6G A;  3VYU B;  4BHB A;  1OYW A;  3EET A;  2M3A A;  2VKV A;  4YFX F;  2M4G A;  1RRJ A;  3LSJ A;  1OCC H;  3E3V A;  2RQP A;  3HOS A;  2V1N A;  3DEW A;  3JRF A;  5K7Z A;  4OAZ A;  2K86 A;  3MCZ A;  1DDN A;  2XPV A;  5DUK A;  2KPM A;  4ANJ A;  1AOY A;  3S1M J;  3IHU A;  3RKY A;  3RQ4 A;  3J81 Z;  2JA6 J;  3O2P E;  1LKX A;  2GXB A;  3BWG A;  2FQ3 A;  1XX5 A;  1SD6 A;  5L3B A;  1UJ8 A;  2OUM A;  3IRR A;  3EPZ A;  4E7Z A;  2EFO A;  1DQU A;  2BVL A;  5EG0 B;  5FKM A;  4Y13 A;  3VB2 A;  5FLV A;  5EG0 A;  2F4I A;  2BXZ A;  4Z6Y A;  2CQN A;  1B1B A;  1KU3 A;  2L4M A;  1S7O A;  3L2R A;  2DFF A;  1T38 A;  3ZPL A;  3HSF A;  4LFU A;  5DEQ A;  2P8T A;  4U88 A;  3FXM A;  3WTZ A;  4ZZD A;  4RB3 C;  3H9Q A;  4LLN A;  2Y9Z A;  5F0H A;  3L2U A;  2QCO A;  4BHP A;  2DMQ A;  3ZXS A;  1G3Y A;  2IEK A;  4KA4 A;  2G7H A;  1OCO H;  2YPR A;  3VEP A;  4GO1 A;  5KVR A;  3F22 A;  2H8R A;  3U21 A;  4B3X A;  1MMA A;  3HOX J;  2EIN H;  1W7P D;  1OQY A;  2L54 A;  2QSG X;  3M1C A;  1LQ1 A;  3G6E I;  1YI2 I;  5IOZ A;  2W24 A;  2EZI A;  4BU2 A;  1Z67 A;  1YS6 A;  4NHJ A;  3ZQF A;  4CYC B;  1YLF A;  3RDI A;  1VTN C;  2X6W A;  4CYC A;  5M3F J;  5HLG A;  2EPF A;  4PCQ A;  1ODD A;  4RGX A;  1TW3 A;  3PUF A;  2BOL A;  4F93 B;  2XAU A;  2FMY A;  3LSG A;  3U2R A;  4U7D A;  2JA7 J;  1YX5 A;  4KIT B;  2L02 A;  5E3O A;  4WXC A;  1PP7 U;  1MMN A;  1WJD A;  3K10 A;  1X19 A;  1Z7L A;  3HRS A;  3Q3S A;  1Q1H A;  3SEQ A;  4B44 A;  1GT0 C;  5K7H A;  1B72 B;  1FBU A;  4IRI A;  1F1Z A;  2MD5 A;  1JUM A;  1B72 A;  3D0S A;  4BUP A;  2MSY A;  2PFB A;  3CTA A;  2K9Q A;  4IRG A;  4UVC A;  4ASN A;  5K1Y A;  1ZLJ A;  1D1A A;  2DDB A;  2LK2 A;  1AA7 A;  1IV8 A;  3L2C A;  3UR3 C;  3F0C A;  3H35 A;  3TDU C;  3JRA A;  3M3Y J;  3S14 J;  5IT9 K;  2K9M A;  4RGR A;  1HST A;  1MGT A;  5CKT A;  2H09 A;  2L3D A;  2R7R A;  4UV8 A;  3PJR A;  2VQG A;  2HKX A;  4EM2 A;  2QSF X;  3VOD A;  1R00 A;  2EA4 A;  1RKW A;  4L9T A;  2E60 A;  4HLX A;  1B4A A;  4UVA A;  1R4N B;  2O8X A;  3FBI B;  4ZYA A;  1OIS A;  2LYC A;  2BVM A;  2XV4 S;  1FTZ A;  4C3H J;  3PM1 A;  1FLI A;  1IRX A;  1I1G A;  1P4W A;  3PSF A;  3OYM A;  2XGX A;  2F5E A;  3F8B A;  1FPQ A;  1GXQ A;  3LSR A;  2F2E A;  3BJ6 A;  1ZAR A;  3M1E A;  1XB4 A;  3MAJ A;  1NH3 A;  1LDK B;  1BA5 A;  2MW8 A;  3S17 J;  4XR6 A;  1BIB A;  3L7W A;  3CLO A;  1FZP B;  4QLC U;  2CV1 A;  3E97 A;  2DTR A;  1OLT A;  4MNU A;  3ZMD A;  3BR5 A;  2Z5U A;  2HQN A;  3DF8 A;  3MWM A;  2ZME C;  3WU0 A;  3BDD A;  2QQA A;  3GTK J;  1FMV A;  4FT8 A;  1JKO C;  1QHH D;  2VC1 A;  3OS2 A;  3BG9 A;  1FIA A;  3FK6 A;  1H89 C;  1WJF A;  2ZXI A;  5CLS A;  3F8N A;  1FNN A;  3QPS A;  3CCL I;  4Q48 A;  1G2H A;  2X51 A;  5FKO A;  3OSG A;  1G3W A;  1WPK A;  2OCC H;  1ZH5 A;  2EZH A;  3FMR A;  2EK5 A;  3I9V 2;  2ECC A;  1IRF A;  1FWZ A;  2RC4 A;  3WTV C;  2HEO A;  5H6R A;  4A0X A;  3N97 A;  5GAG J;  1YO5 C;  3GUD A;  3BCB A;  4JX6 A;  3IAS 2;  2LR8 A;  5HS8 A;  2EH3 A;  4E7L A;  2ZO4 A;  2ETH A;  4J00 A;  5HNF A;  1OYI A;  4KN4 X;  2KDZ A;  3QP6 A;  3LWF A;  2ZC2 A;  5J8C A;  1XD7 A;  2X0L A;  4ZYE A;  2H27 A;  2KZV A;  1F9N A;  2CO5 A;  2FOK A;  4IF4 A;  3H0D A;  5M5W J;  2JA2 A;  2FOW A;  4O5V A;  4GDF A;  3EUH A;  3PL8 A;  2DMP A;  2XB5 A;  3K2A A;  3BZC A;  1ZAO A;  2RRE A;  2X6Y A;  5H20 A;  4BEH A;  2WY7 Q;  1RPW A;  1BOB A;  2OTL I;  1HW5 A;  3K2Z A;  3LA7 A;  5H2F C;  1ENH A;  3MZH A;  1ZTR A;  4XKW A;  5F1J A;  5GTH C;  4A3I J;  5JLX A;  2JT1 A;  2FU4 A;  4HZF A;  4LLL A;  2CFX A;  1FX7 A;  2CU7 A;  3V7R A;  4EJU A;  1BW5 A;  2RV8 A;  3LFK A;  2OF7 A;  2E1N A;  1D1B A;  3TOA A;  4PZJ A;  3I64 A;  5IYB J;  2DOF A;  3D5R C;  2EIM H;  5EEG A;  1U9N A;  4R8H A;  4A69 C;  3BQY A;  3LST A;  2WC2 A;  1LPQ A;  2CJJ A;  3EYY A;  3BR6 A;  2DA1 A;  3ECH A;  4M3B A;  1QRY A;  1E0E A;  3E1S A;  2HZD A;  3BG3 A;  1AU7 A;  3CF5 F;  4FE4 A;  3J7Z I;  5L3F A;  2R7U A;  1ZRE A;  3W2A A;  2STW A;  3JCU C;  3Q9S A;  5HDN A;  1S8N A;  2VE9 A;  2COB A;  3PQJ A;  1V4R A;  4ON0 A;  5FKK A;  2HYJ A;  3A1Y A;  4HNT A;  1TQP A;  1K7A A;  5D8K B;  4I76 A;  5FD6 A;  2LKX A;  1E2X A;  3CDL A;  5CVR A;  3E0J B;  3GYH X;  2R7S A;  3CDI A;  1FC3 A;  2L9N A;  4P9F A;  3S3N A;  4M3E A;  2JSC A;  5GAD J;  4IZZ A;  3W2V A;  4AYB N;  4C2M J;  3QYF A;  1U2W A;  3T8T A;  1FJL A;  4DGW B;  5LGN A;  2F5F A;  1V5E A;  4FIS A;  5E1Z B;  4XLN F;  3KLN A;  2I10 A;  4I02 A;  4E6K G;  2WBM A;  1HQC A;  4PGH A;  2HVS A;  2MFZ A;  3HPG A;  3S8P A;  4BXX J;  4KIG A;  2RVC A;  2CQQ A;  4KNY A;  2DPU A;  2LP0 A;  3OS1 A;  2PN6 A;  3ZN0 A;  2R5Z B;  4RBO A;  4Y15 A;  2R5Z A;  2QYO A;  4IQ4 A;  2H1L A;  2PLY A;  5DDG A;  2IGN A;  4OOI A;  4OU0 A;  2QUF A;  2VLA A;  3CZ6 A;  2R92 J;  2IGK A;  3AKZ A;  3OYA A;  2Z2S B;  2MLK A;  2BY0 A;  2VOD A;  3Q5F A;  3HM5 A;  1JUP A;  1MBF A;  2L7F P;  1SMT A;  2VXD A;  4BQA A;  1JHF A;  3PUB A;  4RM3 A;  2DBB A;  2E2H J;  2WAQ A;  3GW2 A;  4JQF A;  2XAG A;  2Z16 A;  2TDX A;  3IWZ A;  4CCN A;  4A12 A;  2ELH A;  2H94 A;  1AHD P;  4QPO A;  2YX4 A;  3WG9 A;  1EH6 A;  2WB1 N;  1O3S A;  3BLY A;  1XCV A;  4NB5 A;  1A6Q A;  2E34 A;  5CVJ A;  1X1C A;  2C6Y A;  2CUJ A;  1P2F A;  2K85 A;  3CCU I;  4E7I A;  4XLE A;  3SZP A;  1L3L A;  4BS9 A;  1IN7 A;  2CQ7 A;  2OCE A;  2X1E A;  3JRE A;  2HU9 A;  3DBR B;  4G6T B;  1JKQ C;  3SFI A;  3KP5 A;  3RKW A;  3ZN1 A;  3UNG C;  2VAS A;  2LKP A;  3E6B A;  5LEJ A;  3MN2 A;  4CH7 A;  1XC5 A;  1XSD A;  3BG5 A;  4C3J J;  1RUO A;  2V26 A;  3OR1 C;  4IVN A;  4IQJ A;  3A0B C;  4KT6 A;  5DV5 A;  2KJC A;  2QEX I;  1FYM A;  3ABM H;  3H3U A;  2K4B A;  4D5C A;  2LF7 A;  4IX7 A;  3LSP A;  3H3V K;  1WH7 A;  1WRJ A;  4RB2 C;  3BZ6 A; 
#chains in the Genus database with same CATH homology
 1UST A;  1G3S A;  4XSZ F;  5TRD A;  2RDP A;  2CWE A;  1BC8 C;  4GGG A;  4OIN F;  3S2W A;  3FZV A;  1DPR A;  2M87 A;  2IVM A;  1B9M A;  4I7H A;  4RAY A;  3ZQ7 A;  1QGP A;  4HV6 A;  4ZYG A;  1KU7 A;  4EV0 A;  3MFK A;  2NS0 A;  5CVI A;  2AS5 F;  4I01 A;  1QBJ A;  2A5Y B;  3TKY A;  3DV8 A;  5DCF A;  3TQN A;  1JGS A;  2XAF A;  1BBY A;  1ONV A;  2XUB A;  4A5N A;  2XKP A;  4HA8 A;  4CO8 A;  1J59 A;  3V8L A;  2P7C B;  2W25 A;  4AIK A;  5TJJ A;  3K1P A;  1ZRC A;  2EFN A;  3ISP A;  4ENM A;  1XDS A;  4G8X A;  4B09 A;  1LVA A;  1R36 A;  4KIF A;  1QZZ A;  5D6F A;  1FYL A;  1XSX A;  3KZZ A;  2JZY A;  4B8X A;  1Z9C A;  3FX3 A;  2QM3 A;  1YW8 A;  1XDU A;  3SFZ A;  2Q2E A;  2P5K A;  3QPT A;  3B02 A;  1NHA A;  2UXX A;  2Y0M A;  3CO7 C;  2HFH A;  2NAZ A;  3CDH A;  2ZFW A;  3RPU A;  2EV0 A;  5ED4 A;  1U5T C;  5E8G A;  2NNN A;  3HTU A;  3T0Y A;  1IRG A;  4LK1 F;  5FD5 A;  4LG0 B;  1R22 A;  1PUE E;  3JAM Z;  2NYX A;  4LG0 A;  5F64 A;  1K78 B;  4HF0 A;  3K0L A;  4HOB A;  1YS7 A;  1K78 A;  1W4M A;  4G6Q A;  2DAO A;  3LAJ A;  4YG2 F;  2F5D A;  2R7F A;  4A5M A;  2ZME B;  4PDK A;  4KYW A;  2ZME A;  3RYP A;  4HDU A;  1LB2 A;  4GCV A;  2ISY A;  3KP3 A;  4N9H A;  5LRR A;  3BPX A;  5CVU A;  5LHI A;  3AAF A;  4ZYD A;  3CO6 C;  1MD0 A;  4Y17 A;  3G73 A;  2KKO A;  4WCG A;  3H92 A;  2XAJ A;  4OIR F;  3KET A;  3C18 A;  5J6X A;  2EV6 A;  2GA2 A;  1RIO H;  4YIF A;  3LA2 A;  3TO7 A;  3L00 A;  3J81 K;  2CW0 F;  4CHU A;  4IRH A;  1FP2 A;  1QQI A;  4M71 A;  1MJB A;  2XVC A;  3HTS B;  2GXG A;  1BN5 A;  2PMH A;  3B73 A;  3WGH A;  4I2O A;  5IT3 A;  1YW7 A;  3F8F A;  4AD9 A;  3J80 K;  1IZ1 A;  2ISZ A;  1EH8 A;  2L01 A;  5E8I A;  1DP7 P;  3DPL C;  2PMU A;  3RYR A;  1SD5 A;  2GZW A;  2FXA A;  2UXN A;  3JTG A;  4UXN A;  5LRS A;  1J9I A;  3V7S A;  1J2X A;  2M45 A;  1U78 A;  1YG2 A;  3BJA A;  4UHT A;  2VBW A;  3GXO A;  2OZU A;  2GWR A;  4MQ9 F;  4HLY A;  5LLQ A;  1S3J A;  2FF4 A;  1B6A A;  3ULQ B;  1IUY A;  5E1W A;  2XRN A;  1BI1 A;  2ZXJ A;  1TLH B;  2BBY A;  3W6J B;  4UVB A;  4LB6 B;  1XGN A;  1KGS A;  1XGM A;  1B9N A;  3FXR A;  1ZHF A;  2VBY A;  2HWV A;  3TGN A;  4HX4 A;  1ZYR F;  1R1T A;  2KIU A;  3L9F A;  2MBF A;  2QEN A;  3L09 A;  3HHH A;  4HQM A;  1W5S A;  1I5Z A;  5CYV A;  3RI4 A;  4WF2 A;  1IXR C;  1WWX A;  3U1D A;  1LEA A;  2ZNZ A;  4BAY A;  2HQR A;  5L3D A;  1BI2 A;  2DK8 A;  3FM5 A;  3WGI A;  2VE8 A;  5E20 A;  3REO A;  3ABU A;  2CQK A;  1PDN C;  2ZKZ A;  4L9N A;  4HX8 A;  1O7L A;  2VON A;  5ICF A;  4G7H F;  4WX9 A;  5K5Q A;  3M7G A;  3I59 B;  5L3E A;  3I59 A;  2Z3Y A;  5ICC A;  4ZZL A;  1ZGA A;  3V4G A;  2BV6 A;  1ON1 A;  1HKS A;  3CUO A;  3E5X A;  3F6O A;  1LDD A;  4BNC A;  2COM A;  3R6S A;  5D4S A;  2IW5 A;  1L0O C;  5DUI A;  4CZZ A;  2O61 A;  5JI6 A;  2HKO A;  2DU9 A;  2HS5 A;  3K69 A;  4CIC A;  3HSE A;  2JRT A;  2VT2 A;  3LA3 A;  5ICE A;  1G3T A;  3EDP A;  2MC3 A;  3D5L A;  3WTT C;  1HKT A;  2KRF A;  4EM1 A;  2XIG A;  4Q47 A;  3LQQ A;  2A69 F;  4R79 A;  2G7U A;  1Z7U A;  2IPQ X;  5A2Q K;  3DEU A;  3EQL F;  2PJP A;  5IT9 Z;  2E1C A;  4UNO A;  4M73 A;  2XHK A;  3RTR A;  2DQL A;  4CYD A;  4ENJ A;  1GXP A;  3I53 A;  4OIQ F;  1TBX A;  3WGG A;  1HBX G;  3FWE A;  4E70 A;  4G6D A;  1U8R A;  4UV9 A;  2DLL A;  4RGS A;  2D1V A;  4A6E A;  3KFW X;  2XKO A;  2FBH A;  5H6Q A;  3Q9V A;  4RB0 A;  5J8F A;  3O6B B;  3I0T A;  2W57 A;  4Q4Z F;  3N4M A;  5EEH A;  3BJO A;  3GWZ A;  2RN7 A;  4O3M A;  4LD5 A;  4WXD A;  5LBQ A;  1F4K A;  1U5T B;  2D2W A;  4NQW A;  1P4A A;  1U5T A;  1R58 A;  5BMZ A;  3EYI A;  4FX4 A;  1AWC A;  1YFH A;  4A0Y A;  4OMZ A;  3F3X A;  1FSH A;  3KP6 A;  1LNW A;  1Y0U A;  2V1X A;  3K1M A;  4G7O F;  3SZT A;  1J75 A;  3E5U A;  2MH9 A;  5FLX K;  2BE5 F;  4EGZ A;  3P9I A;  1G4D A;  2K27 A;  3NEU A;  3R4K A;  3ABT A;  2OZ6 A;  2P5L C;  4K2E A;  2DW4 A;  3GFJ A;  5FGM A;  2FNA A;  3HHG A;  1R1U A;  2HZT A;  2M5W A;  2DPD A;  1B59 A;  1FT9 A;  3LQR A;  2FML A;  4AIH A;  1EH7 A;  2HOE A;  2HYG D;  3KLO A;  3WE3 A;  1BC7 C;  1XN7 A;  4EM0 B;  2DI3 A;  1KQ8 A;  3WE2 A;  1TW2 A;  3HRU A;  2R3S A;  4BYY A;  5D5X B;  4XLP F;  4CDG A;  4A6D A;  1R5G A;  2STT A;  2NRA C;  2OU2 A;  3R61 A;  1J7K A;  1JHH A;  4N9I A;  2DFI A;  1KU2 A;  3GF2 A;  4RAZ A;  4N0B A;  3GO5 A;  4R1H A;  2XAQ A;  2K7L A;  5D6E A;  4F7Z A;  5FB2 A;  2V1U A;  1W5T A;  2FBI A;  5DYM A;  1YW9 A;  3GZ5 A;  4L5I A;  5K5R A;  4U0Y A;  3F8C A;  2QBY B;  4MHG A;  3ZMV A;  2QBY A;  2WWY A;  4ENK A;  1IF1 A;  4BH9 A;  5HOO A;  4IPA A;  3P7N A;  2VBZ A;  2A61 A;  1IAW A;  2Z9O A;  1YQA A;  2VBX A;  2EB7 A;  1H9G A;  4MGR A;  2V79 A;  2IP2 A;  1KA8 A;  4KN7 X;  3VFZ A;  4S04 A;  1SAX A;  1TQI A;  4EJT A;  3VOE A;  2FEZ A;  3IL2 A;  4ESB A;  3OOP A;  4KT5 C;  2IA0 A;  3V8J A;  1Z05 A;  3ZMZ A;  1RNL A;  4L9V A;  4KMU X;  4XBF A;  5D4R A;  1G6N A;  2Y75 A;  4BXU A;  2FBK A;  3FMQ A;  3C7J A;  2OD5 A;  1BIA A;  3K1N A;  2HYF A;  5LEK A;  2IA1 A;  4IHT A;  3I58 A;  3GZ6 A;  5ICG A;  1WKM A;  2O6G E;  3IWF A;  5FFZ A;  2HR3 A;  1HSJ A;  1GVJ A;  4M9S A;  2DQR A;  2ZNY A;  4MTE A;  2G9W A;  4HAM A;  1LEB A;  1MZB A;  2Z99 A;  3W6K B;  2DK5 A;  1YIO A;  4PGG A;  5BOX A;  2KIM A;  4DQ2 A;  2YX7 A;  2A68 F;  4KMF A;  3QPH A;  4LK0 F;  2EA2 A;  1O3T A;  2MH2 A;  3ZP5 A;  2EFW A;  3KZY A;  3I71 A;  1HW1 A;  1KQ9 A;  2ESH A;  3TO6 A;  4M74 A;  1QNT A;  1XGO A;  1Z6T A;  1KYZ A;  3HIF A;  4M9Z A;  2XRO A;  1BJA A;  2WV0 A;  1O3Q A;  3BOQ A;  1U3E M;  3KP4 A;  4M72 A;  5E1X A;  2P6S A;  3RIR A;  3CUQ A;  1EV7 A;  2GQQ A;  1ZG5 A;  1R1V A;  1S7A A;  3I54 A;  4DNC A;  3ML6 A;  3QP5 A;  3SXY A;  2E7X A;  1T0F A;  1IN5 A;  1OR7 A;  2HGC A;  2BYV E;  2P6T A;  2XAS A;  4EGY A;  2YR2 A;  1IXC A;  1T39 A;  4M9X A;  4YFK F;  1S29 A;  3F8M A;  1CF7 B;  2H6C A;  4L18 B;  3DFG A;  4P96 A;  1CF7 A;  4EJW A;  4JK1 X;  4EJV A;  3HRM A;  1E17 A;  4HQE A;  2EFP A;  4H0E A;  4I09 A;  4OIP F;  1O3R A;  4LJZ F;  1WI9 A;  3ZMU A;  1BM9 A;  3M9A A;  1XMA A;  1CGP A;  1DUX C;  5JFR A;  1XSV A;  3IKT A;  2CGP A;  3H3Z A;  2Y48 A;  1DPU A;  1XMK A;  2R7D A;  3C1D A;  3F23 A;  4M6X A;  3KP2 A;  3FF5 A;  1MKM A;  3I5U A;  4KDP A;  2OQG A;  4I0A A;  4A0Z A;  3DXJ F;  3C3W A;  2Z33 A;  4MTD A;  3MQ0 A;  1UFM A;  2QZ8 A;  4ZYH A;  4UUV A;  2IJL A;  2V6C A;  2J5P A;  2BGC A;  2JTV A;  2XAH A;  1K79 A;  4GYI A;  1IN8 A;  1QZY A;  1T98 A;  1LJ9 A;  5ILV A;  4LLG F;  4RB1 A;  3QRF F;  1Z6R A;  1RZ4 A;  2GIV A;  5CVV A;  5BPD A;  4U7B A;  4RS8 A;  5HDK A;  4MQV A;  3J80 Z;  1FY7 A;  1STZ A;  3P9C A;  2JPB A;  4IJA A;  1JXS A;  5K5O A;  3GEZ A;  2ADU A;  3FXU A;  4WXH A;  4QWQ A;  5HLH A;  2HDC A;  2ZJ2 A;  1MJA A;  1USS A;  4AWX B;  2VXZ A;  3M8E A;  3QOP A;  1SD7 A;  1XCB A;  3ELK A;  3JSO A;  3QU6 A;  4ETS A;  1ZGJ A;  2O3F A;  4Q5S F;  3DP7 A;  4KIC A;  5AIP A;  4JBA A;  1K6O A;  3RJP A;  6PAX A;  2EJR A;  3TO9 A;  3ZMS A;  4GYG A;  2OBP A;  1SFX A;  3O3K A;  4HBL A;  5LGT A;  4LB5 A;  3HYI A;  5BS6 A;  2P5V A;  1P6R A;  3FXQ A;  2D1H A;  3WU1 B;  1ZLK A;  2M30 A;  2GAU A;  4OMY A;  3QU3 A;  5F1R A;  2P4W A;  2QLZ A;  4HYE A;  2PEX A;  4P55 A;  4G9Y A;  2EWN A;  2PBI A;  1ZG3 A;  2RGV A;  3T5X A;  5L3G A;  2LF8 A;  1REP C;  3TOB A;  3CUQ C;  2MA3 A;  1FYK A;  4HX7 A;  2QVO A;  1T6S A;  4KUM A;  2ZCW A;  1F5T A;  5ERI A;  1LDJ A;  4TV7 A;  2UZK A;  4L9J A;  1I27 A;  2OQR A;  1D5V A;  2QWW A;  1D8K A;  2DT5 A;  3HRT A;  3U9G A;  3E6C C;  1FSE A;  2W85 A;  2IRF G;  1HW2 A;  5HS9 A;  1V3F A;  5BPI A;  1UHW A;  4HV5 A;  1C0W A;  2YU3 A;  2A3S A;  2VN2 A;  3SHF A;  1IN6 A;  1OYY A;  2CYY A;  5HS7 A;  1QPM A;  2H6B A;  1YTY A;  3KCC A;  3TDZ C;  2X4H A;  1O7F A;  2VOP A;  3JW4 A;  5L3C A;  3GFI A;  3G3Z A;  2VT3 A;  5D5W B;  2DO7 A;  2EFQ A;  2A07 F;  2B0L A;  2E7W A;  5ILU A;  5E17 F;  5FO5 A;  4L5J A;  3HSR A;  2A6E F;  2OA4 A;  3ERE D;  3F21 A;  4L0Y B;  1I6X A;  2OAZ A;  2J5O A;  5LGU A;  4AIJ A;  3HUG A;  3DQV C;  3IKV A;  1ZRD A;  2KIF A;  1OPC A;  4HDV A;  1MDM B;  2IT0 A;  5A2Q Z;  1MDM A;  4A2U A;  4U0V A;  3LAP A;  3FM3 A;  5FFX A;  3CJN A;  5DD8 A;  3I4P A;  3P9K A;  2JPC A;  3COA C;  4BHC A;  2IA2 A;  3T1B A;  2UWM A;  4CGZ A;  1OKR A;  2O0Y A;  2FNP A;  4OIO F;  4MEY F;  5F6F A;  3SQN A;  4O6J A;  2L4A A;  4IHS A;  4LGW A;  4XRF A;  1R5H A;  1T2K A;  1OMI A;  1D8J A;  2M1B A;  1UB9 A;  3F6V A;  1Z91 A;  2HTJ A;  3GVA A;  1Z1D A;  4FHT A;  2A6H F;  4YFN F;  5DCM B;  5DCM A;  4HW0 A;  4ESF A;  3RKX A;  3M8F A;  3PFI A;  2W84 A;  4AVP A;  4EQQ A;  2FA5 A;  1FBS A;  3ECO A;  3MEX A;  2RNJ A;  2WTE A;  2Q8K A;  1ZG1 A;  3WTX C;  1RUN A;  5FLX Z;  5D5V B;  1FBQ A;  3JSP A;  1SFE A;  4P9U A;  3NRV A;  1XGS A;  1H0M A;  4EJO A;  4KIB A;  5HLI A;  4LMY A;  1TNT A;  1ZN2 A;  3IRQ A;  1X3U A;  2BEO A;  2RKH A;  2PQ8 A;  4ENN A;  4WWC A;  2VC0 A;  1D3Y A;  4P5O A;  3WTU C;  2M8E A;  4I98 B;  1O57 A;  3J7A O;  3OV8 A;  2PI0 A;  3RPQ A;  4S05 A;  5DD4 A;  4XSX F;  1FOK A;  1SD4 A;  2HTS A;  4I0B A;  1P4X A;  3IC7 A;  2PG4 A;  2LSO A;  2V9V A;  3K9T A;  4WK8 F;  1H9T A;  3DPT A;  4YII A;  1WSU A;  1WQ2 A;  1KQ0 A;  5AON A;  2KJB A;  1HKQ A;  3GFL A;  2NNY A;  4HF1 A;  1IN4 A;  1MJ9 A;  1KU9 A;  1IW7 F;  5HVQ C;  3GFM A;  4L0Z B;  3JAM K;  1W7P B;  1W7P A;  2QQB A;  3WTY C;  4FX0 A;  1R23 A;  2D45 A;  3V7C A;  5JHU A;  3WOD F;  5ILS A;  4CXF A;  3FHZ A;  3GX4 X;  1ULY A;  3BPV A;  1TNS A;  3R0J A;  3R0A A;  3KEO A;  3WTS C;  1QO0 D;  3KEQ A;  3QAH A;  3E6M A;  2F5C A;  5CJ9 A;  3R60 A;  1GHC A;  4IXA A;  5KK1 A;  4HF2 A;  2ACJ A;  1BI0 A;  2ESN A;  4MEX F;  4G94 A;  2FSW A;  2CSO A;  1I1S A;  3JTH A;  5JR3 A;  2YSR A;  5D8L B;  3F72 A;  3KE2 A;  5E18 F;  3BRO A;  1BOA A;  4ZH4 F;  2EV5 A;  3DKW A;  1KYW A;  1ZRF A;  1IXS B;  3HOT A;  5D5U B;  1P92 A;  3CUQ B;  3T8R A;  1A04 A;  2P7V B;  1UCR A;  5BQT A;  1J0R A;  1PP8 F;  1HXD A;  3KP7 A;  1FP1 D;  5HDG A;  2O03 A;  4Z2Y A;  3ZMT A;  1SFU A;  4EMS A;  3E6D A;  3E5Q A;  4G7Z F;  2QQ9 A;  1YYV A;  2ZBK A;  4GXO A;  1S6L A;  5LHH A;  2V1D A;  5LHG A;  3MZY A;  2FRH A;  3NQO A;  3PQK A;  5AIQ A;  3BP8 A;  1BI3 A;  1UHM A;  2CG4 A;  4RGU A;  3FMS A;  5JVT A;  2LDU A;  3GLX A;  1TQM A;  4EVI A;  3V8K A;  2K02 A;  3WTW C;  1J5Y A;  2GA1 A;  3BY6 A;  1JE8 A;  1SMY F;  2Q0O A;  2AXL A;  2K4J A;  4ESJ A;  2MLG A;  2LNB A;  4U0W A;  1ON2 A;  1R7J A;  1TTY A;  2VOO A;  4M6Y A;  4KFC A;  1RI7 A;  3ROU A;  2FE3 A;  4D0P A;  1U6G A;  4BHB A;  1OYW A;  3EET A;  4YFX F;  3E3V A;  2RQP A;  3HOS A;  2K86 A;  3MCZ A;  1DDN A;  5DUK A;  1AOY A;  3IHU A;  3RKY A;  3J81 Z;  3O2P E;  2GXB A;  3BWG A;  2FQ3 A;  1SD6 A;  5L3B A;  3IRR A;  2EFO A;  4Y13 A;  3VB2 A;  1B1B A;  1KU3 A;  2L4M A;  1S7O A;  1T38 A;  3ZPL A;  3HSF A;  4LFU A;  5DEQ A;  2P8T A;  4U88 A;  3WTZ A;  4ZZD A;  4RB3 C;  4LLN A;  4BHP A;  1G3Y A;  4KA4 A;  2G7H A;  2YPR A;  3VEP A;  4GO1 A;  5KVR A;  3F22 A;  1W7P D;  2L54 A;  1LQ1 A;  2W24 A;  1YS6 A;  4NHJ A;  1YLF A;  3RDI A;  1VTN C;  5HLG A;  4PCQ A;  1ODD A;  4RGX A;  1TW3 A;  2FMY A;  3U2R A;  4U7D A;  2L02 A;  4WXC A;  1PP7 U;  3HRS A;  1Q1H A;  1FBU A;  4IRI A;  1F1Z A;  2MD5 A;  3D0S A;  2PFB A;  3CTA A;  4IRG A;  4UVC A;  4ASN A;  5K1Y A;  1ZLJ A;  3L2C A;  3TDU C;  5IT9 K;  4RGR A;  1HST A;  1MGT A;  2H09 A;  2L3D A;  4UV8 A;  2HKX A;  4EM2 A;  3VOD A;  1R00 A;  2EA4 A;  4L9T A;  4HLX A;  1B4A A;  4UVA A;  2O8X A;  2XV4 S;  1FLI A;  1I1G A;  1P4W A;  2XGX A;  2F5E A;  3F8B A;  1FPQ A;  1GXQ A;  2F2E A;  3BJ6 A;  1ZAR A;  3M1E A;  1XB4 A;  3MAJ A;  1LDK B;  1BIB A;  3L7W A;  3CLO A;  1FZP B;  4QLC U;  3E97 A;  2DTR A;  4MNU A;  3ZMD A;  2Z5U A;  2HQN A;  3DF8 A;  3MWM A;  3WU0 A;  3BDD A;  2QQA A;  4FT8 A;  2VC1 A;  5CLS A;  3F8N A;  1FNN A;  4Q48 A;  1G3W A;  1ZH5 A;  3FMR A;  2EK5 A;  1IRF A;  1FWZ A;  2RC4 A;  3WTV C;  2HEO A;  5H6R A;  4A0X A;  3N97 A;  1YO5 C;  3GUD A;  5HS8 A;  2ZO4 A;  2ETH A;  1OYI A;  4KN4 X;  3QP6 A;  3LWF A;  5J8C A;  1XD7 A;  2X0L A;  4ZYE A;  2H27 A;  1F9N A;  2CO5 A;  2FOK A;  4IF4 A;  4O5V A;  3EUH A;  1ZAO A;  5H20 A;  1HW5 A;  3K2Z A;  3LA7 A;  3MZH A;  2JT1 A;  2FU4 A;  4HZF A;  4LLL A;  2CFX A;  1FX7 A;  3V7R A;  4EJU A;  2RV8 A;  3LFK A;  2E1N A;  3TOA A;  4PZJ A;  3I64 A;  5EEG A;  4R8H A;  3LST A;  2WC2 A;  3EYY A;  3ECH A;  5L3F A;  1ZRE A;  2STW A;  3Q9S A;  5HDN A;  1S8N A;  2VE9 A;  3PQJ A;  1V4R A;  4ON0 A;  1TQP A;  1K7A A;  5D8K B;  5FD6 A;  1E2X A;  5CVR A;  3GYH X;  1FC3 A;  4P9F A;  2JSC A;  1U2W A;  3T8T A;  5LGN A;  2F5F A;  5E1Z B;  4XLN F;  3KLN A;  4I02 A;  1HQC A;  4PGH A;  4KIG A;  2RVC A;  4KNY A;  2DPU A;  2PN6 A;  3ZN0 A;  4Y15 A;  2QYO A;  2PLY A;  5DDG A;  4OOI A;  4OU0 A;  2QUF A;  2MLK A;  2VOD A;  3Q5F A;  1SMT A;  4BQA A;  1JHF A;  2DBB A;  3GW2 A;  4JQF A;  3IWZ A;  4A12 A;  2XAG A;  2TDX A;  2ELH A;  2H94 A;  2YX4 A;  3WG9 A;  1EH6 A;  1O3S A;  1XCV A;  4NB5 A;  2C6Y A;  5CVJ A;  1P2F A;  3SZP A;  1L3L A;  1IN7 A;  3KP5 A;  3RKW A;  3ZN1 A;  2LKP A;  3E6B A;  5LEJ A;  1XSD A;  1RUO A;  4IVN A;  5DV5 A;  2KJC A;  1FYM A;  3H3U A;  2K4B A;  2LF7 A;  1WRJ A;  4RB2 C;  3BZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...