2RDPA

The structure of a marr family protein from bacillus stearothermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
140
Chain Sequence
AMNERTVAELEKLLRYIAANLKQRGREILTNYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDEHVVRIRLLEKGERIIEEVIEKRQRDLANVLESFSDEEIVVFERCLRKLHQEMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative transcriptional regulator MarR
publication title The structure of a MarR family protein from Bacillus stearothermophilus.
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transcription
total genus 48
structure length 140
sequence length 143
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rdpA00
2DLLA 1O57A 5K5OA 2LDUA 1B6AA 5FD6A 4ESBA 3LA2A 1ZGAA 1J5YA 2UWMA 2L54A 4M9ZA 4G94A 1P2FA 5HLIA 1R1VA 4HF1A 5DD8A 4A5NA 4KT5C 4B8XA 4ENKA 4LMYA 4L9TA 4PGHA 1XGSA 1P4AA 1B59A 3BJOA 4M71A 4RAZA 3Q5FA 1F5TA 1QGPA 2JZYA 1U78A 3D5LA 3L9FA 2ZNZA 3KZZA 4M72A 2ACJA 1USTA 1FPQA 1IW7F 1TQMA 4ENMA 1BI3A 1BC7C 4KNYA 2NYXA 1AWCA 1RIOH 5E8GA 2HQRA 4Q47A 2IW5A 3LAJA 2YPRA 1SD7A 4MEYF 5LHHA 3FHZA 2LF8A 4UNOA 3LA3A 3VOEA 3K69A 3CUQA 3GZ5A 2H94A 3WE2A 2RNJA 3MEXA 4CHUA 3I0TA 4L5IA 1IF1A 4AIKA 4D0PA 1YYVA 3GX4X 4EMSA 5HS8A 1I1GA 5DCMB 2VOPA 5L3GA 3V8LA 5BQTA 1O7LA 5LLQA 2VOOA 4KIGA 3K0LA 1BIBA 2L3DA 5LGNA 3DQVC 5CLSA 2XHKA 4HV6A 2ZBKA 2HOEA 3TO9A 5TJJA 3KEOA 2DQRA 1XN7A 2J5PA 1IZ1A 4I2OA 4OIQF 4RS8A 3ZMUA 4ZZDA 2M8EA 3KP3A 1K7AA 1MJ9A 5JI6A 2PMHA 2P7CB 2HDCA 1T38A 1K78B 1IAWA 2FXAA 1S8NA 5FB2A 4HAMA 2PEXA 4BH9A 2JSCA 2B0LA 2X4HA 3RYRA 4KIBA 3F8NA 2NRAC 5FGMA 6PAXA 2A68F 4LK1F 3DPTA 2DFIA 4MGRA 4WWCA 3BWGA 1TW3A 2YU3A 2VBWA 5J8CA 3RDIA 5LHGA 2A61A 3GW2A 3FZVA 1X3UA 1SFEA 2QBYB 4EJOA 5BOXA 3I59B 2BEOA 4I01A 3D0SA 5KVRA 2V1XA 1MD0A 5JR3A 3DP7A 4HX7A 4UXNA 3T5XA 2G7HA 3WE3A 2DQLA 2MC3A 2FNAA 2OD5A 3WGHA 4LK0F 1BN5A 2JRTA 2QYOA 4EJWA 2VE8A 5L3EA 1QNTA 3ULQB 3MQ0A 2K4BA 4P9UA 1QZZA 4BYYA 3DXJF 3HSFA 2A6HF 3E6CC 2V79A 5ICCA 4JQFA 1S6LA 3M8FA 1TQIA 3GWZA 4E70A 1W5TA 4IRGA 4GGGA 2WTEA 1EH7A 5D5XB 3U1DA 4CGZA 3T8TA 2K86A 4A0ZA 5H6QA 3F22A 1D5VA 4KMUX 4HLXA 3U9GA 4UVCA 1MDMB 3GFJA 2EFPA 3EQLF 3WTZA 1XSXA 1G3WA 2HS5A 3KFWX 3GXOA 1BI1A 3HOTA 1LB2A 3WG9A 4IVNA 3LAPA 3ML6A 4FT8A 3WU1B 1KA8A 1IN6A 3TDUC 1WKMA 4M73A 5J6XA 2LNBA 2EWNA 2OAZA 4HW0A 4HQMA 3LQRA 1SFUA 2CFXA 4IF4A 1CF7B 2O8XA 2HGCA 1FBSA 2F5FA 1O3RA 2BV6A 3WU0A 3T1BA 2XAHA 4S05A 2KRFA 4WF2A 1R5HA 3MZHA 3WTUC 4BHCA 4O3MA 3BJ6A 1K78A 4FX4A 2WC2A 3GYHX 1O3SA 5D8LB 4M9SA 4PGGA 4YFKF 1OMIA 4Y15A 1NHAA 2DK8A 2XV4S 1LQ1A 1LJ9A 3R0AA 5JHUA 2FMLA 1JE8A 3F6VA 2A5YB 2KKOA 3COAC 2KIMA 1IUYA 4LLNA 2D1VA 3L2CA 1T98A 4YG2F 4OMYA 1FLIA 5D5WB 2IA2A 4Q48A 5A2QZ 3WTWC 1R7JA 3M7GA 4GYIA 3IL2A 2FSWA 3MAJA 3IC7A 3ABUA 3U2RA 5DDGA 3QU6A 3PQKA 4EQQA 2STTA 4G7ZF 1FOKA 3I71A 3BP8A 2QBYA 3RPQA 3GZ6A 2CQKA 1XMKA 5LBQA 2GA1A 4IHTA 3LA7A 1D8JA 5IT9Z 4B09A 5BPIA 3LWFA 1HQCA 3GFMA 3VEPA 1REPC 3WGIA 3F8BA 2Z9OA 5CVRA 3R0JA 2ZNYA 2W84A 5L3DA 5DEQA 3V7RA 5CVVA 3E5UA 2HR3A 2HKOA 1USSA 3FX3A 5LEKA 2FOKA 1ZRFA 3WTVC 3FXQA 4A0YA 1FSHA 4ZYDA 2PFBA 4AWXB 2MLKA 4L0YB 3R61A 3I58A 3JW4A 4UHTA 2QENA 3K1NA 1QQIA 4HOBA 3W6JB 3ZMSA 1HW2A 4AVPA 3SXYA 3I64A 3EYYA 4EVIA 1VTNC 4DQ2A 5HS7A 1JGSA 1LDDA 3GUDA 4ON0A 5FFZA 1FNNA 1YW8A 5ICFA 1TLHB 5LRSA 5DV5A 3F3XA 1O3QA 3NRVA 2P6SA 2QWWA 2VXZA 1SMYF 5F64A 2XASA 2ZCWA 2Q0OA 2K4JA 1QBJA 1OYYA 1Z91A 4HZFA 4HDVA 1A04A 4LG0B 3KP4A 3EDPA 1XB4A 1RUOA 4TV7A 5DYMA 2L02A 3K1PA 2E1NA 4ZZLA 2R7FA 4I7HA 2EB7A 4G6QA 2BGCA 3ZMZA 2QM3A 4EM2A 1V4RA 4Y13A 1CF7A 3MWMA 5EEHA 5HDKA 2W85A 4L9NA 1YS7A 2P6TA 2UZKA 2D45A 5F1RA 1J9IA 4R79A 3BOQA 2R3SA 1LVAA 1MJBA 2WWYA 2GA2A 3O2PE 1R58A 1KU9A 4Y17A 4QWQA 3F8FA 1T39A 4ENNA 2QQAA 1Y0UA 3V4GA 4Z2YA 1U6GA 1XDUA 4MNUA 1GXQA 2P5KA 4KN7X 4YFXF 5BS6A 2GQQA 3QU3A 1XSDA 2YR2A 1IRFA 1EH8A 2DPDA 2XAJA 3BROA 4XLNF 4OOIA 1JHFA 4CXFA 2F5EA 1YO5C 4I0AA 3ZMTA 4WX9A 4LB6B 1LDKB 4FX0A 3CTAA 3F23A 2RDPA 2K02A 2HTJA 2P4WA 1DPUA 2HFHA 2A69F 3V7CA 4Q5SF 2H6BA 3M1EA 3E3VA 1XMAA 4R8HA 1BBYA 4OU0A 4UVBA 4KA4A 4CO8A 2FNPA 1Z6RA 4XBFA 1ZREA 1FZPB 4P9FA 3IRRA 4IRIA 1ONVA 5D4RA 2CW0F 3RKWA 3HSEA 1RI7A 1B1BA 1STZA 3SQNA 3IWZA 5D5UB 1R23A 5D4SA 1ZLKA 1J75A 1R00A 3RI4A 1HKQA 2HZTA 1GXPA 2GWRA 4PDKA 4I09A 1KQ9A 2ZMEB 3HTUA 3ELKA 4GXOA 2O03A 5FLXZ 4M6YA 4R1HA 3I53A 4AIHA 5DCFA 5ICGA 5AIPA 3IKTA 1XGOA 1I5ZA 2IA1A 2X0LA 1ZN2A 2YSRA 1YIOA 3JTGA 3BY6A 3QAHA 4EGYA 2G7UA 3Q9SA 3LFKA 3DF8A 2VT3A 1W7PD 3G3ZA 2OQRA 4XSZF 4UV9A 1YG2A 2XAQA 2EFNA 2KJBA 5F6FA 3GF2A 2FF4A 3P9CA 5AIQA 4U7BA 1W4MA 1AOYA 3E5XA 4EJTA 2M1BA 4IXAA 5JFRA 3ECHA 1SAXA 1ZRCA 2M87A 1E2XA 2RGVA 3E6DA 3TDZC 5HDNA 3ROUA 1BIAA 4BXUA 3LSTA 4G7HF 3DKWA 2QVOA 2F5DA 3ABTA 5K1YA 1ZG3A 5E1WA 3TKYA 4BQAA 3FXRA 2VN2A 1V3FA 3E6MA 1G6NA 2W57A 3TO7A 2HYGD 2PN6A 4N9HA 2FRHA 3TO6A 1B9MA 1IN5A 3SHFA 4RGRA 4HYEA 4LLGF 2KIUA 2ZJ2A 4A2UA 1T6SA 4IPAA 4N0BA 5TRDA 1WSUA 3FMSA 2YX4A 2H27A 1T2KA 4HLYA 5HOOA 2QUFA 3L09A 2BE5F 1P92A 1KU3A 3MZYA 5D5VB 2P5LC 1HKTA 2FU4A 2XIGA 2NAZA 2IVMA 4HV5A 1P4XA 3KLNA 5D6FA 4NQWA 3V8JA 2D2WA 1R1UA 1BC8C 1XDSA 2M30A 3ZMDA 4A5MA 4UV8A 1ODDA 5LGTA 1MJAA 1ZRDA 3GO5A 2F5CA 2DU9A 1FC3A 4PZJA 2EA2A 1SD4A 2MLGA 4XRFA 2OU2A 5DCMA 1W7PB 2Q2EA 1SD5A 2A07F 3E97A 4RGUA 1DUXC 2XGXA 5L3BA 5E18F 2ADUA 2FBIA 2V6CA 2LF7A 2OQGA 1EV7A 1YS6A 4PCQA 4ZYHA 4P55A 3LQQA 1YLFA 4ZYGA 2ZMEA 2XRNA 2HYFA 3BJAA 5E1ZB 2V1UA 5HLHA 3JAMZ 2DI3A 5K5RA 1U5TB 1FYKA 3H92A 5ICEA 4U0WA 4A0XA 4QLCU 1FT9A 2DO7A 1ZLJA 5EEGA 4KIFA 2DAOA 4XLPF 1I6XA 5D8KB 1I27A 4BAYA 3KLOA 4ENJA 5H6RA 1XCBA 3PFIA 3G73A 5ILSA 3VB2A 3RIRA 2CYYA 3CO6C 1MKMA 4L5JA 3L7WA 4RAYA 2RV8A 3OOPA 1UCRA 3HYIA 3R6SA 3C1DA 2EFWA 1Z9CA 4U88A 2O0YA 2Z5UA 3P9KA 1K6OA 1OR7A 3C7JA 3ERED 5DUIA 2XVCA 2VBZA 1YW9A 4LGWA 4I98B 3EUHA 5JVTA 1H9GA 3I59A 2HTSA 1FY7A 3KEQA 3T0YA 1QO0D 4LLLA 4IJAA 5BPDA 2K7LA 1L3LA 5CVUA 1J59A 1F1ZA 1B4AA 3WTSC 2IRFG 3HRMA 3ZQ7A 2RKHA 2DT5A 2VC1A 1OYIA 1XCVA 1SD6A 4JK1X 5A2QK 1FBUA 4A12A 1LNWA 1J0RA 2BBYA 3Q9VA 4MTDA 3CUQB 5E8IA 3K9TA 5HVQC 3JTHA 2PJPA 4EM1A 3KP5A 4O5VA 3J7AO 2HEOA 3W6KB 5J8FA 1KQ0A 2E7WA 1FSEA 1FP2A 2L01A 1S7OA 4LD5A 1G3YA 3C3WA 1ZYRF 2M45A 3EYIA 1BM9A 2WV0A 3WTXC 3HHGA 4L9JA 4I0BA 5E1XA 3J80K 3J81Z 1LDJA 2XAGA 4XSXF 3RJPA 4M74A 2BYVE 4G9YA 3K2ZA 5LHIA 3B73A 3QP6A 4AD9A 1FYLA 1MDMA 2R7DA 1IXSB 1EH6A 4OMZA 1ZG1A 1UHMA 2ETHA 3FMRA 4AIJA 3BZ6A 2Z99A 5D6EA 3KCCA 3C18A 3WODF 2RQPA 5K5QA 2DK5A 2W24A 1H0MA 2HKXA 3EETA 4IRHA 2ZXJA 1J2XA 1HSJA 3ECOA 4Q4ZF 3F21A 1W5SA 2GXBA 1B9NA 2JTVA 1UB9A 3SFZA 2A3SA 3RKXA 3KP2A 3AAFA 2EK5A 2VODA 1GVJA 3I4PA 1U3EM 2EA4A 2P7VB 2YX7A 4M6XA 4CYDA 3IRQA 2EV5A 1XSVA 4L0ZB 4O6JA 2DTRA 2V9VA 3ZPLA 1UHWA 1IN8A 1FX7A 3KP7A 3SZTA 4EGZA 2MH2A 1RZ4A 3O6BB 4NB5A 2IP2A 1LEBA 3OV8A 2ESNA 4U0YA 2CGPA 3TOAA 2O3FA 2H6CA 1WWXA 1Z7UA 1P4WA 4LFUA 3WGGA 5FO5A 5HLGA 2Q8KA 4MQVA 1LEAA 1TW2A 5H20A 3GVAA 1QPMA 3H3ZA 2MD5A 2H09A 1WI9A 3GEZA 3L00A 1RNLA 2VC0A 3VFZA 1IXCA 4KYWA 1CGPA 2E1CA 3B02A 4KICA 3CDHA 1S3JA 3BPVA 3I5UA 1ULYA 3GFIA 2IT0A 1Z6TA 3RKYA 1PP7U 4WXDA 4UUVA 2DPUA 2G9WA 1YTYA 3REOA 2KJCA 3FXUA 1K79A 1ZARA 2DBBA 1OYWA 2RN7A 1SMTA 2MH9A 1WRJA 2FBHA 1R1TA 1XD7A 2AXLA 1HXDA 2CSOA 3CO7C 4EM0B 2EFQA 1R36A 3IKVA 4OIRF 1GHCA 2LSOA 2FMYA 4KFCA 3HUGA 4YIFA 1U5TC 1IXRC 2HWVA 1BOAA 4M9XA 2QQ9A 2E7XA 2C6YA 4L9VA 2LKPA 2QZ8A 4LG0A 4FHTA 4BNCA 2OZ6A 2VE9A 3FWEA 4RB1A 5FLXK 2IJLA 4RB3C 2CWEA 5FFXA 2K27A 4LJZF 3RYPA 4YIIA 1HKSA 4K2EA 5DUKA 4U0VA 2PI0A 3GLXA 3M9AA 1F4KA 3BDDA 3MFKA 2XKPA 4F7ZA 2L4AA 2FEZA 3HRUA 3S2WA 3FMQA 5FD5A 3FM5A 1HBXG 1HW5A 2MA3A 2PBIA 2Y48A 3CUOA 4KUMA 3SZPA 2VBYA 3FF5A 4HDUA 2QLZA 4WXHA 3HOSA 3KE2A 3JSOA 3TGNA 3QPTA 5LGUA 4G6DA 4RGSA 2ELHA 1ON1A 3E5QA 1DPRA 2P5VA 5L3CA 1XGMA 3ISPA 4LB5A 3FM3A 3P7NA 3HRSA 5ERIA 3KP6A 1TNSA 1YW7A 2CO5A 2ESHA 1MGTA 2EFOA 2TDXA 3F8CA 4ZYEA 1KYZA 3K1MA 2PQ8A 3CUQC 3ZMVA 1E17A 4I02A 3BPXA 4H0EA 4GYGA 1O3TA 4ESJA 1FYMA 1DP7P 5LRRA 4MEXF 2XROA 1RUNA 1U8RA 1G3TA 3VODA 2O61A 2VBXA 2F2EA 1S29A 1ZAOA 3F6OA 1BI0A 4ETSA 4OIPF 2GIVA 3MCZA 3QP5A 4GCVA 1MZBA 4OIOF 5DD4A 1D8KA 2JPCA 5E20A 2XUBA 1YFHA 1YQAA 1TBXA 2RVCA 4HF0A 1IN7A 2EJRA 4UVAA 5LEJA 4OINF 3HHHA 2COMA 3V8KA 2Z33A 4N9IA 3CLOA 1KU7A 3DPLC 4KMFA 1G4DA 2KIFA 4CZZA 1FWZA 3H3UA 3ZP5A 3PQJA 3QOPA 3DEUA 1KQ8A 2NNNA 2GXGA 4HF2A 1D3YA 2EV6A 4HX4A 1BI2A 1TQPA 1Q1HA 1C0WA 4G7OF 4HQEA 5BMZA 3DV8A 2QQBA 4P96A 2M5WA 4YFNF 4S04A 5IT3A 3N4MA 3O3KA 1I1SA 2HQNA 2PMUA 2NNYA 5KK1A 2Z3YA 2ISYA 2EV0A 3KZYA 3M8EA 4JBAA 3F72A 3CJNA 3N97A 1TTYA 2UXNA 3JSPA 1IN4A 4EJVA 2AS5F 4RB0A 3JAMK 4NHJA 3ZN1A 1UFMA 5ILVA 1U2WA 1TNTA 1KYWA 1ZGJA 4ASNA 2FE3A 4MTEA 1KGSA 3HRTA 2IA0A 3P9IA 2W25A 1IRGA 4KDPA 2XKOA 3HTSB 1HW1A 2ZO4A 5AONA 4L18B 1HSTA 1PP8F 5ILUA 1PUEE 1T0FA 4DNCA 2OZUA 2PG4A 3TOBA 5CJ9A 2GAUA 1G3SA 2DW4A 1XGNA 4WXCA 1ON2A 3QRFF 1JHHA 1S7AA 4HA8A 5L3FA 4ESFA 1Z1DA 4RB2C 1J7KA 2OA4A 2RC4A 3J80Z 2PLYA 1BJAA 1WQ2A 2FBKA 2L4MA 1DDNA 5E17F 1ZHFA 2ZKZA 2O6GE 3HIFA 3WTTC 3ZN0A 3T8RA 3F8MA 3R4KA 2UXXA 4EV0A 2ZFWA 1Z05A 3QPHA 5IT9K 4A6DA 4GO1A 5HDGA 3V7SA 2GZWA 2VONA 1PDNC 3RTRA 2JT1A 2D1HA 3WTYC 4IHSA 1F9NA 4WCGA 2STWA 4WK8F 4BHPA 1O7FA 3NEUA 1R22A 4HX8A 2FQ3A 1FBQA 2MBFA 2XAFA 4MQ9F 5HS9A 1QZYA 3IHUA 1OPCA 5CVIA 3TQNA 3E6BA 3HSRA 2JPBA 1SFXA 4MHGA 2Y0MA 2ISZA 2CG4A 4HBLA 5CVJA 1H9TA 3KETA 2NS0A 2OBPA 3R60A 3I54A 4G8XA 4ZH4F 1JXSA 1FP1D 2A6EF 1ZH5A 3DFGA 1KU2A 1P6RA 1W7PA 3J81K 4A6EA 2FA5A 5CYVA 1R5GA 4KN4X 4CICA 4U7DA 3RPUA 1L0OC 5ED4A 3GFLA 2V1DA 4BHBA 4RGXA 1OKRA 4EJUA 4CDGA 4P5OA 2Y75A 1U5TA 3IWFA 2J5OA 1ZG5A 2P8TA 2IPQX 3NQOA 2VT2A
chains in the Genus database with same CATH superfamily
1OCPA 2DLLA 2NVYJ 1O57A 5K5OA 2W48A 2LDUA 3DTEA 1B6AA 3HL2A 2HYJA 5FD6A 4Y3OA 1F36A 4ESBA 3JRIA 2WB1A 1FOXA 3LA2A 1OCRH 1ZGAA 1J5YA 2UWMA 2L54A 1MBFA 1A36A 3E0JB 4M9ZA 4G94A 3SEZA 2I5UA 2CW7A 3CCEI 1YRNA 1OCCH 3BG3A 1P2FA 5HLIA 1R1VA 1K6YA 3FBNB 4HF1A 2A05A 5DD8A 1MIJA 3GZNB 4A5NA 1IV8A 4KT5C 4B8XA 4BDZA 1JT6A 3S14J 2KT0A 4XM3A 4J01A 4LMYA 4ENKA 4D9JA 2Z2SB 1Z21A 4L9TA 4PGHA 3QOEA 4BDYA 4ZYAA 3CCSI 2VJJA 1XGSA 3OYEA 1ERDA 1P4AA 2V9PA 1B59A 3BJOA 2R93J 4M71A 4RAZA 4V2FA 4N4NB 4XLFA 3Q5FA 1F5TA 4DW6A 1QGPA 2JZYA 4Y7NJ 5M3MJ 3L1PA 2DMTA 1U78A 4D5CA 3D5LA 5E3LA 2ZB9A 3VYTB 3L9FA 2ZNZA 1U0JA 3KZZA 4M72A 3GTKJ 4B1RA 2ACJA 1USTA 1BL0A 4XORA 1FPQA 1IGNA 1IW7F 1TQMA 1TWAJ 1X4PA 3H1CA 4ENMA 1BI3A 3ZQGA 1BC7C 3FK7A 3G2BA 4KNYA 2NYXA 2AQFA 1RIOH 1AWCA 3AL0B 2DMQA 4RA2A 1Q1VA 5E8GA 4NQWB 5F0CA 2HQRA 4Q47A 2IW5A 3LAJA 2YPRA 1SD7A 4MEYF 5LHHA 4IHVA 2LYCA 2O5RA 3FHZA 2LF8A 3ERMA 3LA3A 1UELB 3VOEA 4UNOA 3K69A 3CUQA 3GZ5A 2H94A 3WE2A 2RNJA 1SVMA 3MEXA 4CHUA 3I0TA 3BT9A 4L5IA 2HXOA 1GVDA 2VKEA 4BJTA 1IF1A 4AIKA 4D0PA 1YYVA 3GX4X 4EMSA 3TW7A 5HS8A 3OR2C 2VQGA 4JP0A 5EGOB 4XKVA 1I1GA 1EKEA 1P7IA 1EJ9A 3I55I 1FJLA 2E19A 2KDZA 3HGGA 2IGOA 3M8JA 5DCMB 2VOPA 5L3GA 2DTZA 2Q2EB 3OL3A 3V8LA 5BQTA 1O7LA 5LLQA 2LKXA 2V9KA 3IH4A 2VOOA 1VQ5I 4KIGA 3K0LA 1BIBA 2L3DA 4DGWB 5LGNA 3DQVC 5CLSA 2XHKA 4HV6A 2ZBKA 1JTXA 1FIPA 2R4GA 2HOEA 3TO9A 5TJJA 3KEOA 2DQRA 3G71I 2O6GE 1XN7A 2J5PA 1IZ1A 4I2OA 4IKFA 4OIQF 4RS8A 3ZMUA 5GAHJ 2GBYA 4ZZDA 1SFOJ 2MG4A 1TZLA 3GMEA 1ETXA 3SEQA 4ZTJA 2M8EA 3CLQA 3KP3A 3Q0UA 1IDZA 2BW3B 4CYCA 1K7AA 1MJ9A 3OWTA 5JI6A 2PX9A 2PMHA 2P7CB 3I4NJ 2HDCA 2OCEA 2K3FA 3AG2H 5FKLA 2HOAA 1T38A 1K78B 1IAWA 4A3DJ 3HG9A 2DT6A 2KQRA 2FXAA 1IUFA 2Y0SN 4FISA 1MBKA 3X2QH 1UMQA 3KYLA 1S8NA 2NVUB 3OYCA 1X3ZB 1ZKGA 4XKCA 5FB2A 3I3LA 4GRIA 2PEXA 4HAMA 4BH9A 2JSCA 1BW5A 2RAEA 4B3XA 3BR5A 1TWCJ 2BY1A 2Q1ZB 3HEFA 3S2HJ 2B0LA 2X4HA 2JWTA 4FE4A 4XLHA 3HKZN 3RYRA 3ONQA 4ZDLA 1YJNI 4KIBA 3F8NA 2NRAC 2AQEA 3DKXA 4EATA 3RPUD 5J4YA 4A3BJ 5FGMA 6PAXA 2A68F 4LK1F 3V42A 3CMMA 4BJ5C 3DPTA 3L2WA 3KYDB 2DFIA 2ICWG 4MGRA 4BQQA 2K9SA 1ETKA 1MBGA 4WWCA 3BWGA 1TC3C 1B72B 1TW3A 3MVPA 3LSIA 3G1MA 2YU3A 2R5ZA 2VBWA 5J8CA 3RDIA 5LHGA 2A61A 2WBMA 4ITVA 3GW2A 4XR6A 5FRMA 3FZVA 1X3UA 2VI6A 2XB0X 1SFEA 1YX3A 3W6VA 2QBYB 4EJOA 5BOXA 4IHWA 1JTYA 2UV1A 3I59B 2BEOA 1W36D 3KZIC 4I01A 1VFCA 3HOZJ 3D0SA 5J3LA 5E3OA 5KVRA 2L9VA 2V1XA 1SVOA 2EZKA 1MD0A 1A5JA 1RETA 5JR3A 3DP7A 4UUSB 2KLOA 4ZJZA 2HI3A 4HX7A 4UXNA 1NK3P 3T5XA 3L2RA 2G7HA 1WGXA 3WE3A 5C4XJ 2NS7A 2L9SA 1YE9A 2DQLA 2LMDA 2MYSA 4AIDA 2MC3A 4EEFG 1DP3A 2FNAA 2OD5A 1ZELA 3WGHA 4HSTA 4LK0F 1BN5A 1EF4A 3OYJA 3SDGA 4A93J 2JRTA 2F4OB 2QYOA 1XC5A 4EJWA 2VE8A 5L3EA 1QNTA 5EJCA 3ULQB 2XRLA 1JKQC 3MQ0A 2K4BA 4A69C 1D0XA 4P9UA 3WU2C 1QZZA 4BYYA 3DXJF 3H0GJ 2R92J 3HSFA 2F4MB 3AFHA 1GV2A 2A6HF 1WHUA 3E6CC 2NS8A 2V79A 3S8PA 5ICCA 3MKYB 2HVSA 4JQFA 1S6LA 4LIUA 2DYRH 2BY0A 3M8FA 1TQIA 2CV2A 3GWZA 1E0EA 3DU6A 3BZCA 3SFIA 4D1QA 4E70A 1MSFC 3VDXA 1W5TA 4IRGA 4GGGA 3C2GA 4KISA 2WTEA 1EH7A 4NC8A 5D5XB 3U1DA 4IHXA 3ASNH 4PJLA 4CGZA 1KZHA 3T8TA 2XF5A 2K86A 3BTIA 4A0ZA 2X51A 4HG2A 4ABZA 5H6QA 1RESA 3F22A 2E5ZA 4IQJA 1D5VA 1ZQ3P 4KMUX 1IDYA 4HLXA 3U9GA 2OV7A 4UVCA 1MDMB 3GFJA 1XTAA 2CS3A 2EFPA 3EQLF 3FDYA 2BXZA 1AU7A 3BG7A 2L9RA 3WTZA 1XSXA 1G3WA 2HS5A 3KFWX 3RZDJ 3GXOA 3CCUI 1BI1A 3FHNA 3HOTA 1Z77A 1LB2A 3WG9A 4IVNA 3GCMA 5KCMA 2E36A 2K3PA 3LAPA 3ML6A 4FT8A 3WU1B 5F04A 3CMEI 1KA8A 3K4NA 3OYHA 1A35A 1IN6A 3TDUC 1WKMA 4M73A 4Y52J 5KNLA 1LE8A 1UAAA 1NG6A 5J6XA 1I39A 2LNBA 2EWNA 2OAZA 1MBJA 3DTIA 4HW0A 4HQMA 2JJ7A 5IOYA 3LQRA 2VUMJ 1RRJA 5B1BH 2LBFB 1SFUA 3DLLF 2CFXA 1VQ6I 3OYGA 1MNDA 2X1EA 2LP0A 1HF0A 4IF4A 2XGDA 1CF7B 2O8XA 1VQ7I 2CMPA 2HGCA 1SANA 4BS9A 1O4XA 1FBSA 2F5FA 3A01A 4CCOA 2BV6A 2GIZA 3WU0A 3T1BA 2XAHA 4S05A 1O3RA 1F43A 3E1SA 2KRFA 4WF2A 1R5HA 1KONA 3ABKH 4F91B 3WTUC 3MZHA 1FMVA 1S72I 2XSJC 2HQAA 4BHCA 1GT0C 3B6AA 4O3MA 2BOLA 4LITA 3BJ6A 3JRHA 1K78A 1Z3XA 4FX4A 3H9GA 4FETA 5GAGJ 1ENHA 2WC2A 3GYHX 3S17J 3QYBA 1B8IA 3ZQHA 1O3SA 5D8LB 1HDDC 1OQYA 4M9SA 4PGGA 4YFKF 2QSGX 1OMIA 1RR7A 4Y15A 2M4GA 3MKWB 5HODA 1NHAA 3U1KA 2DK8A 2R7ZJ 4A3EJ 2XV4S 4XLEA 1LQ1A 1LJ9A 1QU3A 3R0AA 1ORKA 5JHUA 2FMLA 2I10A 1MBEA 1JE8A 2HZDA 3F6VA 2A5YB 2KKOA 2QF7A 3COAC 2LREA 4RMNA 2KIMA 4YELA 4LLNA 1IUYA 2D1VA 3L2CA 5J1UA 1T98A 4YG2F 3KX2A 4OMYA 1FLIA 3OS2A 5D5WB 2IA2A 3IUOA 4Q48A 4XKBA 5A2QZ 5IOZA 1H89C 3WTWC 3BTJA 4KJZA 1R7JA 2G0EA 3M7GA 1VI0A 4GYIA 1PYVA 3IL2A 1D1BA 2IAIA 2FSWA 3H5AA 2XDVA 3PO2J 3MAJA 3IC7A 3ABUA 3U2RA 5DDGA 3QU6A 1FEXA 2VKHA 3PQKA 4EQQA 2STTA 5LFAA 3LSGA 4G7ZF 1FOKA 3I71A 3BP8A 4HNVA 2QBYA 4PJJA 2LY1A 3RPQA 2MD0A 3GZ6A 2CQKA 3D5RC 4W1UA 1XMKA 3CCQI 2KISA 5LBQA 2GA1A 4IHTA 3CC7I 3B6CA 1HC8A 4S0HB 3LA7A 1D8JA 5IT9Z 3OMYA 4B09A 5BPIA 1RKWA 2E2HJ 3LWFA 1VZ0A 5GP9A 1HQCA 3GFMA 3VEPA 2M4KA 1REPC 3AL0C 5CPRB 4AUXA 3F8BA 5EDNA 3WGIA 1Y1WJ 2Z9OA 3OR1C 2WADA 5CVRA 4UB8C 3R0JA 3E7LA 2ZNYA 3BCBA 4NNJA 2W84A 1TP4A 5B66C 5L3DA 5DEQA 3OYNA 3V7RA 4W97A 1Y0NA 2GOXB 3H9QA 1SAUA 1FOWA 3FXLA 5CVVA 3E5UA 2HR3A 1WH5A 4I76A 1LPQA 2HKOA 1USSA 3FX3A 2X6OA 3RSNA 5LEKA 2FOKA 4J00A 1MNMC 1ZRFA 3WTVC 3FXQA 1TWFJ 4NBQA 4A0YA 1AKHA 1FSHA 4ZYDA 3CC2I 2PFBA 4AWXB 3OYKA 3CC4I 2DA2A 2MLKA 4L0YB 3R61A 4II3A 2O7OA 3PJRA 1QRYA 2JMWA 3G1OA 1WJAA 2OUMA 3M1CA 3I58A 2N8GA 3JW4A 1MH4A 1V5EA 4UHTA 5EZHA 2QENA 3K1NA 2VJ4A 1QQIA 2M9HA 3RCOA 4B47A 1BR2A 1YOVB 4HOBA 3K4MA 3W6JB 5KAFC 3ZMSA 1HW2A 3TW6A 4AVPA 3SXYA 3I64A 3EYYA 4EVIA 1VTNC 4FE7A 4CUGA 4DQ2A 5HS7A 5HLTA 1JGSA 4II2A 1LDDA 5K7HA 3GUDA 4ON0A 5FFZA 2K85A 3EUAA 1FNNA 2M0MA 2YS9A 2ZMEC 1YW8A 3A02A 5ICFA 1ZR2A 2M7AA 2WAFA 1TLHB 5LRSA 2DDAA 2LFBA 2VL8A 3F3XA 3IAM2 5DV5A 1O3QA 3HUGB 3G1LA 1YHQI 2L9NA 2XPUA 3NRVA 2E2JJ 4A3LJ 2P6SA 5DS9A 2QWWA 2VXZA 1SMYF 5HNHA 5F64A 4CCLA 2XASA 2ZCWA 2Q0OA 3UKGA 2K4JA 2E71A 1QBJA 1DU6A 4A3JJ 1OYYA 2R5YA 1PJRA 1Z91A 4HZFA 3RZOJ 2ME6A 4HDVA 1A04A 1JUPA 1RC9A 2CQNA 3KP4A 4LG0B 1ACIA 2NVQJ 3EDPA 1XB4A 3K7AJ 2Z1DA 3Q0VA 1RUOA 4MO7A 5CKTA 3CD6I 3OIOA 4TV7A 3ZQIA 4OAYA 1G2HA 5DYMA 2H8WA 2L02A 3HDDA 4BBSJ 2DA4A 1X1BA 2E1NA 3K1PA 4ZZLA 2R7FA 2MABA 4I7HA 2EB7A 2ZC2A 4G6QA 2BGCA 3ZMZA 2BY3A 2QM3A 5F0HA 2P0WA 4EM2A 1V4RA 4Y13A 1CF7A 3MWMA 5EEHA 5HDKA 1Y8RB 4UB6C 3CP8A 1ETVA 4C3JJ 2LD5A 1OR7C 3LSPA 2W85A 2VIXA 3BQYA 4L9NA 1WH7A 1YS7A 2P6TA 1WJ5A 3K4CA 5F1RA 2UZKA 2D45A 1J9IA 4R79A 2DOEA 3BOQA 2LH9A 1LVAA 1MJBA 1XX5A 2R3SA 4E7ZA 2WWYA 3EUHC 4A3KJ 1NK2P 2PJRA 1EA3A 2GA2A 4V19K 3GTQJ 2FX0A 3O2PE 1R58A 1KU9A 2Z16A 4CZCA 2LKSA 4Y17A 4QWQA 3F8FA 1T39A 4E7SA 4AYBN 4C2MJ 4ZTFA 3K70D 4ENNA 5DM7F 2FD5A 2QQAA 1Y0UA 4HNUA 5KAIC 1ZGWA 3V4GA 4Z2YA 3DLAA 1PVEA 1U6GA 1XDUA 2L7KA 4MNUA 3K4JA 1GXQA 2K9NA 2K5CA 3M3YJ 4DZJA 2P5KA 4KN7X 4YFXF 4BEHB 5BS6A 2GQQA 3QU3A 4DZPA 5EF6A 4L5EA 1XSDA 2YR2A 2X6YA 1IRFA 1LUJB 3DTKA 3L2UA 1VQPI 1EH8A 2DPDA 2XAJA 3BROA 3RQIA 3CP2A 4HPQA 2HDWA 2CUEA 3FKJA 2F5VA 4OOIA 4XLNF 3CMAI 1JHFA 4CXFA 2F5EA 1YO5C 2LR8A 1Z0XA 4I0AA 3ZMTA 4WX9A 4LB6B 1LDKB 4FX0A 1I6HJ 3HM5A 2MC4A 3CTAA 3F23A 2RDPA 4P1WA 1NTCA 2K02A 3A2KA 2R7XA 3ZQLA 2HTJA 1ZR4A 2P4WA 1MW7A 1T08B 1DPUA 2HFHA 1MMGA 2A69F 2KPMA 3V7CA 3S3OA 4Q5SF 2H6BA 3M1EA 3E3VA 4M3FA 1XMAA 4KT6A 4R8HA 1BBYA 4OU0A 1JJ6C 1XMXA 2QEXI 4UVBA 1N25A 1X58A 4KA4A 4CO8A 4DYQA 4OAZA 2FNPA 1Z6RA 4XBFA 1ZREA 3NARA 3UNGC 1FZPB 2JA5J 4P9FA 1AA7A 2HNHA 3IRRA 2OPTA 1VQLI 3S2DJ 1I3AA 1UG0A 4BQNA 3LSRA 3I9V2 2OCCH 1WJDA 4IRIA 2VQHA 2KDOA 2PMZN 1ONVA 5FLVA 3PNYA 5D4RA 2CW0F 2ZXHA 2B7EA 3RKWA 1YJWI 3HSEA 2K9LA 3NWSA 3H36A 2FOWA 3M4OJ 1RI7A 1GV5A 3K6GA 1B1BA 1STZA 2YU9J 1D5YA 3SQNA 3IWZA 5D5UB 2EQRA 1DQUA 1R23A 3LMMA 3CCYA 1FIAA 5D4SA 2L7ZA 3CCRI 2DA6A 1ZLKA 1J75A 3FKIJ 1JKRC 3HXLA 1R00A 3RI4A 1HKQA 2HZTA 1GXPA 1IRZA 1BR1A 1W5CC 4UY8I 2HDDA 3W2AA 4BJ6C 3HOYJ 2GWRA 4BE2A 4PDKA 4I09A 2COBA 4M3BA 4XOTA 1KQ9A 2ZMEB 1D1CA 3HTUA 1E3HA 3ELKA 4GXOA 4GFBA 5C44J 2OJED 2UUZA 1S7EA 2O03A 5FLXZ 2CUJA 3BG5A 4M6YA 2EH3A 3HGYA 2Y9ZA 4B43A 4R1HA 2EINH 3I53A 4RDUA 2FUG2 2XSDC 4BUPA 4AIHA 3QPLA 5DCFA 2KL4A 2KZVA 5ICGA 5AIPA 3IKTA 3H5NA 2M8GX 1XGOA 1I5ZA 1K83J 2IA1A 2X0LA 1ZN2A 2F4IA 3FXOA 2YSRA 3S93A 1YIOA 3J7ZI 1Z3YA 1QVUA 4XRSA 3JTGA 3O8HA 3BY6A 2ZXWH 3QAHA 1G59A 4EGYA 2IS4A 2G7UA 3Q9SA 3F9KA 3LFKA 3DF8A 5DM6F 2VT3A 1W7PD 3G3ZA 2OQRA 4XSZF 4UV9A 1YG2A 2Y31A 2XAQA 2EFNA 2QCOA 1T33A 3PNTA 2LY2A 2Y0SA 4AVZA 1OCOH 2KJBA 1R6RA 3FK6A 5F6FA 1W36C 3GF2A 2FF4A 3P9CA 2M0CA 1W0UA 1LFBA 5AIQA 2EIJH 4U7BA 4BE1A 3CCVI 1W4MA 1FTZA 3NWTA 4DJAA 1AOYA 3E5XA 2ZSHB 2K9MA 5FKKA 4EJTA 2M1BA 2IGKA 3HKZA 4IXAA 2XAUA 1S9HA 5JFRA 3AG4H 3BQZA 3ECHA 1LFPA 1SAXA 1ZRCA 2M87A 2P81A 1E2XA 2RGVA 2R7OA 2R7RA 3W2WA 3S1NJ 3OSGA 2IS6A 3E6DA 3TDZC 2NXNB 5HDNA 1S5LC 3ROUA 1GLNA 1POGA 1BIAA 3CQZJ 4BXUA 3LSTA 4G7HF 3HPHA 2KIQA 2JA6J 1OCZH 3DKWA 2QVOA 2F5DA 3GLLA 3ABTA 3S1QJ 5K1YA 3KPHA 1ZG3A 1M1EB 1MH3A 1YJ9I 5E1WA 3TKYA 4BQAA 3FXRA 1T56A 3J7AY 2VN2A 2X6WA 1V3FA 3E6MA 1G6NA 2W57A 3TO7A 2HYGD 2PN6A 1G8XA 4N9HA 2HOTA 2VASA 2FRHA 3OYBA 3TO6A 1B9MA 1IN5A 3AG3H 2CW8A 3SHFA 5E3NA 4RGRA 5F0FA 5GTHC 1A6QA 4IOCF 5J40A 2QGUA 4HYEA 4KITB 2VKDA 3QYEA 4LLGF 3AG1H 2KIUA 2ZJ2A 1CQTA 1D1AA 4A2UA 4X1EA 4D7NA 1T6SA 2R0QC 1Y1VJ 4IPAA 4N0BA 5B1AH 1YI2I 5TRDA 2QSFX 1WSUA 2DA1A 2YX4A 3FMSA 2H27A 4DYCA 1T2KA 4HLYA 4QPQA 3PUBA 4NC6A 2QUFA 3L09A 2BE5F 5HOOA 1ITYA 1X3WB 3G6EI 4Y4RA 2CV1A 1TT0A 1P92A 1KU3A 3LSHA 3MZYA 3ASOH 2EIKH 5D5VB 2V4JC 3SJMA 4YIRX 4XICA 1RKTA 5GADJ 5TGTA 2P5LC 1YIJI 1K4SA 1HKTA 2FU4A 3K4LA 2XIGA 1JUMA 2NAZA 2IVMA 4E7HA 4A3FJ 4HV5A 1T8IA 1HA8A 1P4XA 5K7ZA 2M34A 3KLNA 3BR1A 5D6FA 1N77A 3H9JA 2DFHA 4NQWA 3V8JA 4M3GA 1Y6IA 1U9OA 2BXYA 5HNFA 3GTPJ 4NDLA 2D2WA 1R1UA 1UZCA 1XDSA 1BC8C 2M30A 3ZMDA 4A5MA 4UV8A 1ODDA 4DYRA 1WI3A 4F3QA 4C30A 4XONA 4CH7A 5LGTA 1WJBA 4E7IA 1MJAA 1ZRDA 3GO5A 2F5CA 2LVSA 2DU9A 1FC3A 3EUKL 3RQ4A 3ZRGA 5EGOA 3TL4X 4PZJA 2FQ4A 3BR0A 2EA2A 3Q3SA 1SD4A 3CZ6A 2HVQA 2MLGA 4XRFA 4E7KA 3DPUA 2OU2A 5DCMA 1JKPC 1W7PB 2V7FA 2Q2EA 1SD5A 2A07F 4M3DA 3E97A 1X2NA 4RGUA 1DUXC 2WAQN 1PUFB 2E34A 2XGXA 5L3BA 5E18F 2ADUA 3IP4B 2FBIA 2V6CA 2W7NA 2LF7A 2OQGA 2HQ5A 1DGRM 1FMWA 1EV7A 1UJ8A 1YS6A 4FCYA 4PCQA 1ETQA 4ZYHA 4AC0A 1BJZA 3GTLJ 4P55A 3LQQA 1YLFA 4ZYGA 2IEKA 1IJWC 4DIQA 2ZMEA 2XRNA 2HYFA 2XF7A 1JKOC 3BJAA 5E1ZB 2V1UA 4LG3A 1MSEC 3ABLH 5HLHA 3JAMZ 2BW3A 4ZC3A 2DI3A 2QKLB 1U5TB 5K5RA 1FYKA 2ZXIA 3H92A 2R7UA 2AXTC 5ICEA 3PNVA 3CESA 4U0WA 4XLAA 4I99C 4A0XA 3TBIA 4QLCU 1FT9A 2DO7A 3IH2A 1ZLJA 3BG6A 1TL8A 4ZDPA 3HBLA 5EEGA 4E4HA 4KIFA 2DAOA 4XLPF 2R7SA 1I6XA 5D8KB 4RM3A 1I27A 4M3EA 2FJ1A 3OYMA 4BAYA 2V26A 3KLOA 1IG7A 4ENJA 5H6RA 1D0YA 1XCBA 3PFIA 3G73A 5ILSA 3VB2A 1MMSA 3RIRA 1QZEA 3ZR8X 2ME0A 2XPVA 2CYYA 2KFDA 2MFZA 3CO6C 1U9NA 2L7FP 1MKMA 4L5JA 3L7WA 4RAYA 3A0HC 2RV8A 1VQNI 3BCAA 3OOPA 1UCRA 3HYIA 4XNFA 3R6SA 3CF2A 3C1DA 2EFWA 1Z9CA 4U88A 3ZOBA 2O0YA 2VB6A 2Z5UA 3P9KA 2BVMA 1R9TJ 3S1RJ 1K6OA 1B72A 2GLOA 1OR7A 2X9DA 3C7JA 3ERED 4IO9F 4AM3A 3VWBA 5IP9J 5DUIA 4C3HJ 2XVCA 2VBZA 4PSWA 4M6VA 1YW9A 2OTLI 4LGWA 3BTLA 4I98B 3EUHA 1X1PA 5JVTA 4D7MA 1H9GA 3I59A 2L7MP 2HTSA 1MBHA 1FY7A 3KEQA 4JX4A 3T0YA 1JT0A 1QO0D 3FXJA 2DT7B 4LLLA 4IJAA 4XK4A 1BA5A 5BPDA 2ZFUA 4LIVA 4UUSA 2H1LA 2K7LA 4RM2A 2W4SA 2VQCA 1SEUA 2DCEA 4PSXA 5CVUA 1L3LA 1J59A 2DODA 1F1ZA 1B4AA 1QHGA 3MKLA 4YEJA 2M7BA 2Y2ZA 3WTSC 1Z7LA 3HRMA 2IRFG 3ZQ7A 2RKHA 3FXMA 4BACA 2R7WA 4B44A 2VC1A 2DT5A 3PIOF 1OYIA 1XCVA 1SD6A 3DBRB 1N78A 4JK1X 2H1KA 2VJ5A 1X2MA 3OYIA 1ZTRA 2OC6A 5A2QK 1AHDP 1FBUA 4CCJA 1LNWA 1J0RA 4A12A 2BBYA 3Q9VA 4MTDA 3CUQB 5E8IA 3K9TA 5HVQC 3JTHA 3OL4A 2Y30A 4EM1A 2PJPA 2X48A 5EYRA 3KP5A 1T95A 4O5VA 3J7AO 2HEOA 3W6KB 1WCMJ 5J8FA 5IYBJ 3W3CA 4XRMA 2L2OA 2F6CA 1JGGA 1R4NB 2A6TA 4XKWA 2GM4A 1IV6A 2XB5A 3VYUB 1KQ0A 2E7WA 1FSEA 1FP2A 3A0BC 2VLAA 2L01A 2WY8Q 2IBDA 4GDFA 3S15J 1S7OA 4LD5A 1G3YA 3JRAA 3C3WA 2NOGA 5IY5H 1ZYRF 2M45A 3EYIA 3LSJA 3HPGA 2I8DA 1MMNA 2LLKA 1BM9A 2WV0A 2IXSA 3HHGA 2LTPA 4JX5A 3WTXC 4QTRA 3I56I 5JVGF 4L9JA 1ZK8A 4H4KC 4PJMA 4I0BA 2EZIA 3DWLE 5E1XA 2JUGA 3J80K 3J81Z 3SYTA 3C2BA 2VPRA 2MGQA 3LFUA 1LDJA 2XAGA 2JSPA 2ID6A 4XSXF 1XPXA 3RJPA 3NAUA 4M74A 2BYVE 4G9YA 3K2ZA 1TT5B 2IS1A 5LHIA 1VQ4I 4IQ4A 3B73A 5DTDA 3QP6A 4AD9A 5IYDJ 1X1DA 1FYLA 1MDMA 2R7DA 1IXSB 4CYCB 1DGWY 3KEYA 3HC7A 2IGNA 4G6TB 3WHBA 1YITI 3OS0A 1EH6A 4OMZA 1VNDA 3BC8A 5GPAA 5E17F 3L2VA 2HPMA 3JRDA 3VYRB 1ZG1A 1UHMA 2ETHA 1K61A 3FMRA 4AIJA 2XGEA 4F93B 4PJNA 3BZ6A 2Z99A 5D6EA 1XS9A 3KCCA 3C18A 2QQ8A 3WODF 2RQPA 5K5QA 2DK5A 2W24A 4C2TA 1N75A 1H0MA 2HKXA 4ZDOA 3EETA 2JA2A 1X1CA 4IRHA 2EIMH 3OOUA 3FBIB 2ZXJA 1J2XA 1HSJA 3ECOA 2DMUA 3IAS2 4Q4ZF 2DFFA 3F21A 1W5SA 5EG0B 2GXBA 1B9NA 3PM1A 1UHSA 3BLYA 2EZHA 2LBFA 2LG4A 2JTVA 3PUFA 1IC8A 1OISA 4IHYA 1UB9A 3SFZA 3D1NI 3K70C 3IV5A 4NUBA 1I3QJ 2A3SA 3RKXA 1V5FA 2JK3A 3KP2A 2R5ZB 3AAFA 3LSKA 2EK5A 2CJJA 1Y39A 2WB1N 2JN6A 3BG9A 1GVJA 2VODA 1JJ8C 1WJCA 4IL6C 3I4PA 1JI8A 1U3EM 2OF7A 2RNGA 4PFOA 2RREA 2EA4A 2P7VB 2YX7A 4V2GA 4M6XA 1VQOI 4CYDA 3IRQA 2EV5A 1XSVA 4L0ZB 1QHHD 4O6JA 2DTRA 2V9VA 3BR2A 2R7QA 3ZPLA 4BXFA 2RQQA 1UHWA 1U8BA 1IN8A 1FX7A 3CJTB 3KP7A 3JCUC 3SZTA 4EGZA 1T0FC 2DMPA 1R4MB 2MH2A 1RZ4A 1SFKA 3O6BB 2JRMA 2NOJB 4NB5A 4AYBA 5TISC 2IP2A 4Y33A 1LEBA 3OV8A 2O8KA 2ESNA 4U0YA 2KHMA 2CGPA 3K4KA 3Q0WA 2X1CA 3TOAA 2O3FA 2H6CA 1WWXA 1Z7UA 2X1DA 1P4WA 3TP0A 5KHDA 4LFUA 4HNTA 2CV0A 3IH3A 5FKMA 4UUTA 2EZLA 3WGGA 5FO5A 5J47A 5HLGA 3P5JA 2Q8KA 4MQVA 4XOPA 3JREA 1LEAA 2JQ7A 1TW2A 5H20A 3GVAA 3HJEA 4PUSA 1QPMA 2TCTA 1H88C 2BVLA 3TMOA 2R7VA 3H3ZA 3ZGKA 2MD5A 2H09A 2ELKA 1J09A 3VYSB 3AKZA 3K4BA 3LSMA 3S3MA 1WI9A 2W82A 2LOOA 3GEZA 5FJ8J 2VPLA 3L00A 1RNLA 3BR3A 4JOMA 2VC0A 3VFZA 2EPFA 1IXCA 1MMDA 4CCKA 1BW6A 2QSHX 4KYWA 4IX7A 1CGPA 2XGCA 4X0GA 2E5NA 1IO2A 2E1CA 3ZQFA 3B02A 4KICA 3CDHA 4B4CA 1S3JA 3BPVA 4PFPA 4E7LA 1VF9A 3JRGA 1HOMA 3I5UA 4BE0A 1ULYA 5C3EJ 3GFIA 2IT0A 2DJNA 3HZJA 1Z6TA 3RKYA 1PP7U 4WXDA 2WA0A 1FTTA 2PMZA 2M2EA 4UUVA 2ZSIB 2DPUA 2LK2A 2G9WA 1P7JA 1YTYA 1HLVA 2B63J 3MD2A 3REOA 2KJCA 3FXUA 2MW8A 4C9YA 1K79A 1ZARA 4CCMA 2DBBA 1LE8B 4BU2A 1OYWA 2RN7A 1SMTA 2MH9A 1BR4A 3C2HA 3EPZA 2KMUA 1JUSA 1WRJA 3CJRB 3TP3A 5J1YA 2FBHA 1R1TA 3PSFA 4QSHA 1XD7A 2JUCA 2AXLA 1HXDA 5LD2C 2CSOA 2KRHA 4EM0B 3CO7C 2EFQA 1R36A 3IKVA 4OIRF 2BY2A 2E60A 1GHCA 2LSOA 1VQMI 2FMYA 3A01B 4KFCA 2KP6A 3HUGA 1WVRA 4LOCA 4FASD 4YIFA 3ZQQA 4RLQA 3CF5F 1U5TC 3PSIA 1IXRC 2HWVA 5JLXA 3BZKA 2W1OA 1BOAA 3GTMJ 3PL8A 1B8IB 4XL9A 4M9XA 2QQ9A 2E7XA 3FISA 4JX6A 3LNQA 2C6YA 4BL0B 1WFXA 2XC7A 4L9VA 4FTHA 2LKPA 1A6IA 2QZ8A 4LG0A 4FHTA 1VQ9I 4BNCA 2OZ6A 2VE9A 3FWEA 4RB1A 5FLXK 2IJLA 3HOVJ 4RB3C 2CWEA 4RBOA 3WG7H 2K27A 2VKVA 5FFXA 3BR6A 4LJZF 4YIIA 3RYPA 1APLC 1HKSA 1HCRA 3K10A 2WAEA 3WHCA 3S32A 2M3AA 4K2EA 4HEA2 5EG0A 2Y69H 5DUKA 4QPOA 4U0VA 2PI0A 2ELJA 2NVXJ 2KRCA 3GLXA 3M9AA 3ZCOA 3OYAA 3A03A 2ZJRF 1F4KA 3BDDA 3MFKA 2DDBA 2DYSH 2XKPA 4F7ZA 2L4AA 2FEZA 3HRUA 3S2WA 3FMQA 5FD5A 3FM5A 4E7JA 3QWLA 1LFUP 1HBXG 3LOCA 5JLWA 1HW5A 2BHZA 2L0KA 2MA3A 2PBIA 2Y48A 3CUOA 4KUMA 2VBYA 3FF5A 3ESWB 3SZPA 4DBQA 3CCJI 3QQAA 4HDUA 4IZZA 2QLZA 4WXHA 3HOSA 3KE2A 2VXDA 3JSOA 4PK4A 1I50J 5E79C 3TGNA 3QPTA 2V1NA 5LGUA 4G6DA 4RGSA 3ZQCA 2ELHA 1E3PA 4PJ0C 1ON1A 4G12A 3E5QA 1NG7A 1DPRA 2P5VA 2NVTJ 3H0DA 5L3CA 5M3FJ 1K4TA 2JA7J 1XGMA 1OCTC 3ISPA 5IPAA 3FM3A 3HOXJ 3P7NA 2WV1A 2DFEA 2ID3A 4LB5A 4XN3A 3HRSA 5ERIA 2CQ7A 5CQGA 5FKOA 2JVHA 5E3MA 3KP6A 3D5SC 4IEJA 1LKXA 3DBHB 1TNSA 1YW7A 2DXIA 3OS1A 2CO5A 2ESHA 1IRXA 1MGTA 5J1RA 2EFOA 2QKMB 2TDXA 3GTJJ 4BEHA 3F8CA 2DJIA 4ZYEA 1KYZA 3K1MA 2PQ8A 3CUQC 2VQLA 4OWRB 3ZMVA 4MIMA 1E17A 2EILH 4I02A 3BPXA 2ZJPF 4GYGA 4H0EA 1O3TA 3FIWA 1R5ID 4ESJA 1FYMA 2K40A 1OJLA 1AKHB 1DP7P 5LRRA 4BY7J 2OTJI 4MEXF 2XROA 1RUNA 2DMNA 2DOFA 2DA3A 1U8RA 2VJIA 2E1OA 3RKQA 1G3TA 3VODA 2E1MC 5C4JJ 1WPKA 2O61A 3PFYA 2DA7A 2VBXA 5JHFA 2F2EA 1S29A 5EZGA 2HVRA 1E3OC 1ZAOA 4CSWA 3F6OA 1BI0A 1WJEA 2BHYA 2MSYA 4ETSA 4OIPF 4HSRA 2GIVA 3MCZA 1QPIA 3QP5A 2DA5A 1ETYA 4GCVA 5F27A 1MMAA 2CUZA 1MZBA 3OSFA 2CU7A 1Y8QB 4OIOF 2CRGA 5DD4A 3HOWJ 4JYKA 3I4MJ 1D8KA 5H2FC 4BBRJ 2JPCA 5E20A 4XQFA 3DEEA 3DBLB 3CJQB 2XUBA 3SDBA 1YFHA 1YQAA 1TBXA 3KIOA 2BZTA 2RVCA 4HF0A 4XMYA 1IN7A 1P9QC 2EJRA 3CCLI 3OYDA 2L5QA 4UVAA 1QVTA 4MLOA 5LEJA 2ZJQF 3VSKA 3JRBA 2R5YB 4OINF 3GBGA 3HHHA 2COMA 2ECBA 3V8KA 1WZ2A 5B5EC 3CDLA 2CQQA 2Z33A 4N9IA 3CLOA 1KU7A 1QA6A 3F0CA 5K7FA 3DPLC 1RPWA 4KMFA 2WAQA 1Y56A 2LRDA 3OY9A 1G4DA 2KIFA 4CZZA 2QA4I 3ZXSA 1FWZA 3H3UA 5BNGA 4AU7A 5IYCJ 3ZP5A 3PQJA 3QOPA 3DEUA 3QYFA 2K9QA 1KQ8A 5B3SH 3OYLA 1GDTA 2NNNA 5M5WJ 2GXGA 4HRIA 4HF2A 2X85A 1D3YA 2EV6A 4HX4A 2HU9A 1BI2A 2R7TA 5FLMJ 1TQPA 1Q1HA 3UR3C 3GTOJ 4IOAF 1C0WA 1A31A 2AHQA 4G7OF 4MFDA 3DCFA 3MKZA 3DV8A 4QIWN 4HQEA 5BMZA 3DU5A 3M07A 5IP7J 4XLCA 2DOAA 4U87A 2TRTA 2QQBA 4P96A 2M5WA 4YFNF 1OLTA 4S04A 5IT3A 3N4MA 4N4OB 3O3KA 1I1SA 2HQNA 2PMUA 2NNYA 4ANJA 1D0ZA 5KK1A 1YRNB 2Z3YA 2ISYA 2PJRB 3KYCB 2EV0A 3MN2A 4RAGA 3KZYA 1W0TA 1R71A 3JR9A 5EEAA 3M8EA 4JBAA 3F72A 3CJNA 1RR8C 2X6XA 1TTYA 3N97A 2UXNA 3JSPA 4X6AJ 1IN4A 1FOYA 4EJVA 2AS5F 4RB0A 3JAMK 4NHJA 1VQ8I 3ZN1A 1UFMA 2LY9A 5ILVA 1U2WA 5CQEA 1TNTA 2JVGA 2YUSA 3H35A 5IP6A 1KYWA 1ZGJA 5J4VA 4ASNA 2HOSA 2FE3A 1R49A 4MTEA 1KGSA 1OFCX 3H5RA 1V55H 3GTGJ 3HRTA 3HOUJ 4B48A 5FKNA 2IA0A 3P9IA 2W25A 9ANTA 1IRGA 4KDPA 2XKOA 3QODA 3HTSB 3PO3J 1ETOA 1HW1A 3O8GA 3VPRA 2ZO4A 5AONA 4L18B 1HSTA 2D5VA 3FXKA 1PP8F 4A3IJ 5ILUA 1PUEE 1T0FA 4DNCA 2OZUA 2PG4A 3TOBA 5CJ9A 4A3GJ 5FROA 2GAUA 1TWGJ 1G3SA 2DW4A 1XGNA 4WXCA 4BQOA 3CCMI 1ON2A 4F92B 3W2VA 4BGDA 3QRFF 1JHHA 1S7AA 2W00A 5F1JA 4HA8A 4DBRA 5L3FA 2JA8J 4ESFA 4Z6YA 3U21A 3OYFA 3TEDA 2CH0A 4I6ZA 3K2AA 1Z1DA 1WJFA 4RB2C 3S16J 3L2QA 3BTCA 4MFEA 1H8AC 5GTIC 4C2UA 1UG2A 1J7KA 1GUUA 2AO9A 2OA4A 2RC4A 3J80Z 1SC7A 2PLYA 1BJAA 1WQ2A 2FBKA 2EBIA 2L4MA 1DDNA 5FRNA 1MNEA 1YX5A 1ZHFA 2F48A 2IGMA 2ZKZA 3HIFA 4B3AA 3WTTC 3ZN0A 2WY7Q 3T8RA 3F8MA 3CDIA 3R4KA 2E1MB 2HPIA 2UXXA 1NH3A 1LVKA 4EV0A 4J19A 2ZFWA 1Z05A 3QPHA 5IT9K 2CQXA 4A6DA 2B9SA 4GO1A 5HDGA 3V7SA 2A5WA 4A3MJ 2GZWA 2VONA 2LC2A 1PDNC 3MMYB 4NC7A 3RTRA 2IS2A 3N05A 2JT1A 2D1HA 3WTYC 4IHSA 1F9NA 3CMYA 4CA0A 5M5YJ 4WCGA 3SZGA 3OIPA 3DEWA 3DKYA 2STWA 4WK8F 4XN0A 4BHPA 1O7FA 2KZGA 3NEUA 1R22A 3A4CA 4HX8A 2FQ3A 1FBQA 1XG1A 2MBFA 4C3IJ 2H8RA 2XAFA 3H3VK 4MQ9F 1VQKI 5HS9A 3OIQA 1QZYA 3G4SI 1DU0A 3IHUA 1OPCA 5CVIA 4CCNA 5M5XJ 3PIPF 3TQNA 1SVLA 4XRSG 3E6BA 2E35A 3HSRA 3MZ8A 1BOBA 2JPBA 5GPCA 2O9LA 5GAEJ 1SFXA 4MHGA 4XIDA 4BY1J 2Y0MA 2HXIA 2ISZA 2CG4A 4HBLA 1X4OA 3QPSA 5CVJA 1H9TA 1TWHJ 3KETA 1HDPA 3J7YJ 2NS0A 2OBPA 3R60A 3I54A 4G8XA 4ZH4F 1JXSA 2E2IJ 1FP1D 2A6EF 1X19A 1ZH5A 3JRCA 3DFGA 1KU2A 1ETWA 1P6RA 1W7PA 4E6KG 3A1YA 3J81K 2XF6A 4A6EA 2FA5A 4D5FA 1PUFA 5CYVA 1R5GA 5F08A 3S3NA 4KN4X 3ABMH 4CICA 4U7DA 3RPUA 1L0OC 5ED4A 4DOZA 2V6EA 4A3CJ 3GFLA 2V1DA 1X1AA 3HB9A 4BHBA 4RGXA 4RLFA 2CUFA 1OKRA 4EJUA 2DN0A 2ECCA 4FQGA 4BXXJ 1V54H 2GOMA 4CDGA 4F55A 4P5OA 3JRFA 2Y75A 4BKXA 3LL7A 4RAFA 1U5TA 3IWFA 2J5OA 2Y9YA 1ZG5A 2XPWA 2P8TA 1Z67A 2IPQX 3S1MJ 1W1WE 4YRVA 3NQOA 2CFOA 4F52A 2GXAA 3VSLA 1V5GA 2VT2A
chains in the Genus database with same CATH topology
2DLLA 1O57A 5K5OA 2LDUA 1B6AA 5FD6A 4ESBA 3LA2A 1ZGAA 1J5YA 2UWMA 2L54A 4M9ZA 4G94A 1P2FA 5HLIA 1R1VA 4HF1A 5DD8A 4A5NA 4KT5C 4B8XA 4ENKA 4LMYA 4L9TA 4PGHA 1XGSA 1P4AA 1B59A 3BJOA 4M71A 4RAZA 3Q5FA 1F5TA 1QGPA 2JZYA 1U78A 3D5LA 3L9FA 2ZNZA 3KZZA 4M72A 2ACJA 1USTA 1FPQA 1IW7F 1TQMA 4ENMA 1BI3A 1BC7C 4KNYA 2NYXA 1AWCA 1RIOH 5E8GA 2HQRA 4Q47A 2IW5A 3LAJA 2YPRA 1SD7A 4MEYF 5LHHA 3FHZA 2LF8A 4UNOA 3LA3A 3VOEA 3K69A 3CUQA 3GZ5A 2H94A 3WE2A 2RNJA 3MEXA 4CHUA 3I0TA 4L5IA 1IF1A 4AIKA 4D0PA 1YYVA 3GX4X 4EMSA 5HS8A 1I1GA 5DCMB 2VOPA 5L3GA 3V8LA 5BQTA 1O7LA 5LLQA 2VOOA 4KIGA 3K0LA 1BIBA 2L3DA 5LGNA 3DQVC 5CLSA 2XHKA 4HV6A 2ZBKA 2HOEA 3TO9A 5TJJA 3KEOA 2DQRA 1XN7A 2J5PA 1IZ1A 4I2OA 4OIQF 4RS8A 3ZMUA 4ZZDA 2M8EA 3KP3A 1K7AA 1MJ9A 5JI6A 2PMHA 2P7CB 2HDCA 1T38A 1K78B 1IAWA 2FXAA 1S8NA 5FB2A 4HAMA 2PEXA 4BH9A 2JSCA 2B0LA 2X4HA 3RYRA 4KIBA 3F8NA 2NRAC 5FGMA 6PAXA 2A68F 4LK1F 3DPTA 2DFIA 4MGRA 4WWCA 3BWGA 1TW3A 2YU3A 2VBWA 5J8CA 3RDIA 5LHGA 2A61A 3GW2A 3FZVA 1X3UA 1SFEA 2QBYB 4EJOA 5BOXA 3I59B 2BEOA 4I01A 3D0SA 5KVRA 2V1XA 1MD0A 5JR3A 3DP7A 4HX7A 4UXNA 3T5XA 2G7HA 3WE3A 2DQLA 2MC3A 2FNAA 2OD5A 3WGHA 4LK0F 1BN5A 2JRTA 2QYOA 4EJWA 2VE8A 5L3EA 1QNTA 3ULQB 3MQ0A 2K4BA 4P9UA 1QZZA 4BYYA 3DXJF 3HSFA 2A6HF 3E6CC 2V79A 5ICCA 4JQFA 1S6LA 3M8FA 1TQIA 3GWZA 4E70A 1W5TA 4IRGA 4GGGA 2WTEA 1EH7A 5D5XB 3U1DA 4CGZA 3T8TA 2K86A 4A0ZA 5H6QA 3F22A 1D5VA 4KMUX 4HLXA 3U9GA 4UVCA 1MDMB 3GFJA 2EFPA 3EQLF 3WTZA 1XSXA 1G3WA 2HS5A 3KFWX 3GXOA 1BI1A 3HOTA 1LB2A 3WG9A 4IVNA 3LAPA 3ML6A 4FT8A 3WU1B 1KA8A 1IN6A 3TDUC 1WKMA 4M73A 5J6XA 2LNBA 2EWNA 2OAZA 4HW0A 4HQMA 3LQRA 1SFUA 2CFXA 4IF4A 1CF7B 2O8XA 2HGCA 1FBSA 2F5FA 1O3RA 2BV6A 3WU0A 3T1BA 2XAHA 4S05A 2KRFA 4WF2A 1R5HA 3MZHA 3WTUC 4BHCA 4O3MA 3BJ6A 1K78A 4FX4A 2WC2A 3GYHX 1O3SA 5D8LB 4M9SA 4PGGA 4YFKF 1OMIA 4Y15A 1NHAA 2DK8A 2XV4S 1LQ1A 1LJ9A 3R0AA 5JHUA 2FMLA 1JE8A 3F6VA 2A5YB 2KKOA 3COAC 2KIMA 1IUYA 4LLNA 2D1VA 3L2CA 1T98A 4YG2F 4OMYA 1FLIA 5D5WB 2IA2A 4Q48A 5A2QZ 3WTWC 1R7JA 3M7GA 4GYIA 3IL2A 2FSWA 3MAJA 3IC7A 3ABUA 3U2RA 5DDGA 3QU6A 3PQKA 4EQQA 2STTA 4G7ZF 1FOKA 3I71A 3BP8A 2QBYA 3RPQA 3GZ6A 2CQKA 1XMKA 5LBQA 2GA1A 4IHTA 3LA7A 1D8JA 5IT9Z 4B09A 5BPIA 3LWFA 1HQCA 3GFMA 3VEPA 1REPC 3WGIA 3F8BA 2Z9OA 5CVRA 3R0JA 2ZNYA 2W84A 5L3DA 5DEQA 3V7RA 5CVVA 3E5UA 2HR3A 2HKOA 1USSA 3FX3A 5LEKA 2FOKA 1ZRFA 3WTVC 3FXQA 4A0YA 1FSHA 4ZYDA 2PFBA 4AWXB 2MLKA 4L0YB 3R61A 3I58A 3JW4A 4UHTA 2QENA 3K1NA 1QQIA 4HOBA 3W6JB 3ZMSA 1HW2A 4AVPA 3SXYA 3I64A 3EYYA 4EVIA 1VTNC 4DQ2A 5HS7A 1JGSA 1LDDA 3GUDA 4ON0A 5FFZA 1FNNA 1YW8A 5ICFA 1TLHB 5LRSA 5DV5A 3F3XA 1O3QA 3NRVA 2P6SA 2QWWA 2VXZA 1SMYF 5F64A 2XASA 2ZCWA 2Q0OA 2K4JA 1QBJA 1OYYA 1Z91A 4HZFA 4HDVA 1A04A 4LG0B 3KP4A 3EDPA 1XB4A 1RUOA 4TV7A 5DYMA 2L02A 3K1PA 2E1NA 4ZZLA 2R7FA 4I7HA 2EB7A 4G6QA 2BGCA 3ZMZA 2QM3A 4EM2A 1V4RA 4Y13A 1CF7A 3MWMA 5EEHA 5HDKA 2W85A 4L9NA 1YS7A 2P6TA 2UZKA 2D45A 5F1RA 1J9IA 4R79A 3BOQA 2R3SA 1LVAA 1MJBA 2WWYA 2GA2A 3O2PE 1R58A 1KU9A 4Y17A 4QWQA 3F8FA 1T39A 4ENNA 2QQAA 1Y0UA 3V4GA 4Z2YA 1U6GA 1XDUA 4MNUA 1GXQA 2P5KA 4KN7X 4YFXF 5BS6A 2GQQA 3QU3A 1XSDA 2YR2A 1IRFA 1EH8A 2DPDA 2XAJA 3BROA 4XLNF 4OOIA 1JHFA 4CXFA 2F5EA 1YO5C 4I0AA 3ZMTA 4WX9A 4LB6B 1LDKB 4FX0A 3CTAA 3F23A 2RDPA 2K02A 2HTJA 2P4WA 1DPUA 2HFHA 2A69F 3V7CA 4Q5SF 2H6BA 3M1EA 3E3VA 1XMAA 4R8HA 1BBYA 4OU0A 4UVBA 4KA4A 4CO8A 2FNPA 1Z6RA 4XBFA 1ZREA 1FZPB 4P9FA 3IRRA 4IRIA 1ONVA 5D4RA 2CW0F 3RKWA 3HSEA 1RI7A 1B1BA 1STZA 3SQNA 3IWZA 5D5UB 1R23A 5D4SA 1ZLKA 1J75A 1R00A 3RI4A 1HKQA 2HZTA 1GXPA 2GWRA 4PDKA 4I09A 1KQ9A 2ZMEB 3HTUA 3ELKA 4GXOA 2O03A 5FLXZ 4M6YA 4R1HA 3I53A 4AIHA 5DCFA 5ICGA 5AIPA 3IKTA 1XGOA 1I5ZA 2IA1A 2X0LA 1ZN2A 2YSRA 1YIOA 3JTGA 3BY6A 3QAHA 4EGYA 2G7UA 3Q9SA 3LFKA 3DF8A 2VT3A 1W7PD 3G3ZA 2OQRA 4XSZF 4UV9A 1YG2A 2XAQA 2EFNA 2KJBA 5F6FA 3GF2A 2FF4A 3P9CA 5AIQA 4U7BA 1W4MA 1AOYA 3E5XA 4EJTA 2M1BA 4IXAA 5JFRA 3ECHA 1SAXA 1ZRCA 2M87A 1E2XA 2RGVA 3E6DA 3TDZC 5HDNA 3ROUA 1BIAA 4BXUA 3LSTA 4G7HF 3DKWA 2QVOA 2F5DA 3ABTA 5K1YA 1ZG3A 5E1WA 3TKYA 4BQAA 3FXRA 2VN2A 1V3FA 3E6MA 1G6NA 2W57A 3TO7A 2HYGD 2PN6A 4N9HA 2FRHA 3TO6A 1B9MA 1IN5A 3SHFA 4RGRA 4HYEA 4LLGF 2KIUA 2ZJ2A 4A2UA 1T6SA 4IPAA 4N0BA 5TRDA 1WSUA 3FMSA 2YX4A 2H27A 1T2KA 4HLYA 5HOOA 2QUFA 3L09A 2BE5F 1P92A 1KU3A 3MZYA 5D5VB 2P5LC 1HKTA 2FU4A 2XIGA 2NAZA 2IVMA 4HV5A 1P4XA 3KLNA 5D6FA 4NQWA 3V8JA 2D2WA 1R1UA 1BC8C 1XDSA 2M30A 3ZMDA 4A5MA 4UV8A 1ODDA 5LGTA 1MJAA 1ZRDA 3GO5A 2F5CA 2DU9A 1FC3A 4PZJA 2EA2A 1SD4A 2MLGA 4XRFA 2OU2A 5DCMA 1W7PB 2Q2EA 1SD5A 2A07F 3E97A 4RGUA 1DUXC 2XGXA 5L3BA 5E18F 2ADUA 2FBIA 2V6CA 2LF7A 2OQGA 1EV7A 1YS6A 4PCQA 4ZYHA 4P55A 3LQQA 1YLFA 4ZYGA 2ZMEA 2XRNA 2HYFA 3BJAA 5E1ZB 2V1UA 5HLHA 3JAMZ 2DI3A 5K5RA 1U5TB 1FYKA 3H92A 5ICEA 4U0WA 4A0XA 4QLCU 1FT9A 2DO7A 1ZLJA 5EEGA 4KIFA 2DAOA 4XLPF 1I6XA 5D8KB 1I27A 4BAYA 3KLOA 4ENJA 5H6RA 1XCBA 3PFIA 3G73A 5ILSA 3VB2A 3RIRA 2CYYA 3CO6C 1MKMA 4L5JA 3L7WA 4RAYA 2RV8A 3OOPA 1UCRA 3HYIA 3R6SA 3C1DA 2EFWA 1Z9CA 4U88A 2O0YA 2Z5UA 3P9KA 1K6OA 1OR7A 3C7JA 3ERED 5DUIA 2XVCA 2VBZA 1YW9A 4LGWA 4I98B 3EUHA 5JVTA 1H9GA 3I59A 2HTSA 1FY7A 3KEQA 3T0YA 1QO0D 4LLLA 4IJAA 5BPDA 2K7LA 1L3LA 5CVUA 1J59A 1F1ZA 1B4AA 3WTSC 2IRFG 3HRMA 3ZQ7A 2RKHA 2DT5A 2VC1A 1OYIA 1XCVA 1SD6A 4JK1X 5A2QK 1FBUA 4A12A 1LNWA 1J0RA 2BBYA 3Q9VA 4MTDA 3CUQB 5E8IA 3K9TA 5HVQC 3JTHA 2PJPA 4EM1A 3KP5A 4O5VA 3J7AO 2HEOA 3W6KB 5J8FA 1KQ0A 2E7WA 1FSEA 1FP2A 2L01A 1S7OA 4LD5A 1G3YA 3C3WA 1ZYRF 2M45A 3EYIA 1BM9A 2WV0A 3WTXC 3HHGA 4L9JA 4I0BA 5E1XA 3J80K 3J81Z 1LDJA 2XAGA 4XSXF 3RJPA 4M74A 2BYVE 4G9YA 3K2ZA 5LHIA 3B73A 3QP6A 4AD9A 1FYLA 1MDMA 2R7DA 1IXSB 1EH6A 4OMZA 1ZG1A 1UHMA 2ETHA 3FMRA 4AIJA 3BZ6A 2Z99A 5D6EA 3KCCA 3C18A 3WODF 2RQPA 5K5QA 2DK5A 2W24A 1H0MA 2HKXA 3EETA 4IRHA 2ZXJA 1J2XA 1HSJA 3ECOA 4Q4ZF 3F21A 1W5SA 2GXBA 1B9NA 2JTVA 1UB9A 3SFZA 2A3SA 3RKXA 3KP2A 3AAFA 2EK5A 2VODA 1GVJA 3I4PA 1U3EM 2EA4A 2P7VB 2YX7A 4M6XA 4CYDA 3IRQA 2EV5A 1XSVA 4L0ZB 4O6JA 2DTRA 2V9VA 3ZPLA 1UHWA 1IN8A 1FX7A 3KP7A 3SZTA 4EGZA 2MH2A 1RZ4A 3O6BB 4NB5A 2IP2A 1LEBA 3OV8A 2ESNA 4U0YA 2CGPA 3TOAA 2O3FA 2H6CA 1WWXA 1Z7UA 1P4WA 4LFUA 3WGGA 5FO5A 5HLGA 2Q8KA 4MQVA 1LEAA 1TW2A 5H20A 3GVAA 1QPMA 3H3ZA 2MD5A 2H09A 1WI9A 3GEZA 3L00A 1RNLA 2VC0A 3VFZA 1IXCA 4KYWA 1CGPA 2E1CA 3B02A 4KICA 3CDHA 1S3JA 3BPVA 3I5UA 1ULYA 3GFIA 2IT0A 1Z6TA 3RKYA 1PP7U 4WXDA 4UUVA 2DPUA 2G9WA 1YTYA 3REOA 2KJCA 3FXUA 1K79A 1ZARA 2DBBA 1OYWA 2RN7A 1SMTA 2MH9A 1WRJA 2FBHA 1R1TA 1XD7A 2AXLA 1HXDA 2CSOA 3CO7C 4EM0B 2EFQA 1R36A 3IKVA 4OIRF 1GHCA 2LSOA 2FMYA 4KFCA 3HUGA 4YIFA 1U5TC 1IXRC 2HWVA 1BOAA 4M9XA 2QQ9A 2E7XA 2C6YA 4L9VA 2LKPA 2QZ8A 4LG0A 4FHTA 4BNCA 2OZ6A 2VE9A 3FWEA 4RB1A 5FLXK 2IJLA 4RB3C 2CWEA 5FFXA 2K27A 4LJZF 3RYPA 4YIIA 1HKSA 4K2EA 5DUKA 4U0VA 2PI0A 3GLXA 3M9AA 1F4KA 3BDDA 3MFKA 2XKPA 4F7ZA 2L4AA 2FEZA 3HRUA 3S2WA 3FMQA 5FD5A 3FM5A 1HBXG 1HW5A 2MA3A 2PBIA 2Y48A 3CUOA 4KUMA 3SZPA 2VBYA 3FF5A 4HDUA 2QLZA 4WXHA 3HOSA 3KE2A 3JSOA 3TGNA 3QPTA 5LGUA 4G6DA 4RGSA 2ELHA 1ON1A 3E5QA 1DPRA 2P5VA 5L3CA 1XGMA 3ISPA 4LB5A 3FM3A 3P7NA 3HRSA 5ERIA 3KP6A 1TNSA 1YW7A 2CO5A 2ESHA 1MGTA 2EFOA 2TDXA 3F8CA 4ZYEA 1KYZA 3K1MA 2PQ8A 3CUQC 3ZMVA 1E17A 4I02A 3BPXA 4H0EA 4GYGA 1O3TA 4ESJA 1FYMA 1DP7P 5LRRA 4MEXF 2XROA 1RUNA 1U8RA 1G3TA 3VODA 2O61A 2VBXA 2F2EA 1S29A 1ZAOA 3F6OA 1BI0A 4ETSA 4OIPF 2GIVA 3MCZA 3QP5A 4GCVA 1MZBA 4OIOF 5DD4A 1D8KA 2JPCA 5E20A 2XUBA 1YFHA 1YQAA 1TBXA 2RVCA 4HF0A 1IN7A 2EJRA 4UVAA 5LEJA 4OINF 3HHHA 2COMA 3V8KA 2Z33A 4N9IA 3CLOA 1KU7A 3DPLC 4KMFA 1G4DA 2KIFA 4CZZA 1FWZA 3H3UA 3ZP5A 3PQJA 3QOPA 3DEUA 1KQ8A 2NNNA 2GXGA 4HF2A 1D3YA 2EV6A 4HX4A 1BI2A 1TQPA 1Q1HA 1C0WA 4G7OF 4HQEA 5BMZA 3DV8A 2QQBA 4P96A 2M5WA 4YFNF 4S04A 5IT3A 3N4MA 3O3KA 1I1SA 2HQNA 2PMUA 2NNYA 5KK1A 2Z3YA 2ISYA 2EV0A 3KZYA 3M8EA 4JBAA 3F72A 3CJNA 3N97A 1TTYA 2UXNA 3JSPA 1IN4A 4EJVA 2AS5F 4RB0A 3JAMK 4NHJA 3ZN1A 1UFMA 5ILVA 1U2WA 1TNTA 1KYWA 1ZGJA 4ASNA 2FE3A 4MTEA 1KGSA 3HRTA 2IA0A 3P9IA 2W25A 1IRGA 4KDPA 2XKOA 3HTSB 1HW1A 2ZO4A 5AONA 4L18B 1HSTA 1PP8F 5ILUA 1PUEE 1T0FA 4DNCA 2OZUA 2PG4A 3TOBA 5CJ9A 2GAUA 1G3SA 2DW4A 1XGNA 4WXCA 1ON2A 3QRFF 1JHHA 1S7AA 4HA8A 5L3FA 4ESFA 1Z1DA 4RB2C 1J7KA 2OA4A 2RC4A 3J80Z 2PLYA 1BJAA 1WQ2A 2FBKA 2L4MA 1DDNA 5E17F 1ZHFA 2ZKZA 2O6GE 3HIFA 3WTTC 3ZN0A 3T8RA 3F8MA 3R4KA 2UXXA 4EV0A 2ZFWA 1Z05A 3QPHA 5IT9K 4A6DA 4GO1A 5HDGA 3V7SA 2GZWA 2VONA 1PDNC 3RTRA 2JT1A 2D1HA 3WTYC 4IHSA 1F9NA 4WCGA 2STWA 4WK8F 4BHPA 1O7FA 3NEUA 1R22A 4HX8A 2FQ3A 1FBQA 2MBFA 2XAFA 4MQ9F 5HS9A 1QZYA 3IHUA 1OPCA 5CVIA 3TQNA 3E6BA 3HSRA 2JPBA 1SFXA 4MHGA 2Y0MA 2ISZA 2CG4A 4HBLA 5CVJA 1H9TA 3KETA 2NS0A 2OBPA 3R60A 3I54A 4G8XA 4ZH4F 1JXSA 1FP1D 2A6EF 1ZH5A 3DFGA 1KU2A 1P6RA 1W7PA 3J81K 4A6EA 2FA5A 5CYVA 1R5GA 4KN4X 4CICA 4U7DA 3RPUA 1L0OC 5ED4A 3GFLA 2V1DA 4BHBA 4RGXA 1OKRA 4EJUA 4CDGA 4P5OA 2Y75A 1U5TA 3IWFA 2J5OA 1ZG5A 2P8TA 2IPQX 3NQOA 2VT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLL A;  1O57 A;  5K5O A;  2LDU A;  1B6A A;  5FD6 A;  4ESB A;  3LA2 A;  1ZGA A;  1J5Y A;  2UWM A;  2L54 A;  4M9Z A;  4G94 A;  1P2F A;  5HLI A;  1R1V A;  4HF1 A;  5DD8 A;  4A5N A;  4KT5 C;  4B8X A;  4ENK A;  4LMY A;  4L9T A;  4PGH A;  1XGS A;  1P4A A;  1B59 A;  3BJO A;  4M71 A;  4RAZ A;  3Q5F A;  1F5T A;  1QGP A;  2JZY A;  1U78 A;  3D5L A;  3L9F A;  2ZNZ A;  3KZZ A;  4M72 A;  2ACJ A;  1UST A;  1FPQ A;  1IW7 F;  1TQM A;  4ENM A;  1BI3 A;  1BC7 C;  4KNY A;  2NYX A;  1AWC A;  1RIO H;  5E8G A;  2HQR A;  4Q47 A;  2IW5 A;  3LAJ A;  2YPR A;  1SD7 A;  4MEY F;  5LHH A;  3FHZ A;  2LF8 A;  4UNO A;  3LA3 A;  3VOE A;  3K69 A;  3CUQ A;  3GZ5 A;  2H94 A;  3WE2 A;  2RNJ A;  3MEX A;  4CHU A;  3I0T A;  4L5I A;  1IF1 A;  4AIK A;  4D0P A;  1YYV A;  3GX4 X;  4EMS A;  5HS8 A;  1I1G A;  5DCM B;  2VOP A;  5L3G A;  3V8L A;  5BQT A;  1O7L A;  5LLQ A;  2VOO A;  4KIG A;  3K0L A;  1BIB A;  2L3D A;  5LGN A;  3DQV C;  5CLS A;  2XHK A;  4HV6 A;  2ZBK A;  2HOE A;  3TO9 A;  5TJJ A;  3KEO A;  2DQR A;  1XN7 A;  2J5P A;  1IZ1 A;  4I2O A;  4OIQ F;  4RS8 A;  3ZMU A;  4ZZD A;  2M8E A;  3KP3 A;  1K7A A;  1MJ9 A;  5JI6 A;  2PMH A;  2P7C B;  2HDC A;  1T38 A;  1K78 B;  1IAW A;  2FXA A;  1S8N A;  5FB2 A;  4HAM A;  2PEX A;  4BH9 A;  2JSC A;  2B0L A;  2X4H A;  3RYR A;  4KIB A;  3F8N A;  2NRA C;  5FGM A;  6PAX A;  2A68 F;  4LK1 F;  3DPT A;  2DFI A;  4MGR A;  4WWC A;  3BWG A;  1TW3 A;  2YU3 A;  2VBW A;  5J8C A;  3RDI A;  5LHG A;  2A61 A;  3GW2 A;  3FZV A;  1X3U A;  1SFE A;  2QBY B;  4EJO A;  5BOX A;  3I59 B;  2BEO A;  4I01 A;  3D0S A;  5KVR A;  2V1X A;  1MD0 A;  5JR3 A;  3DP7 A;  4HX7 A;  4UXN A;  3T5X A;  2G7H A;  3WE3 A;  2DQL A;  2MC3 A;  2FNA A;  2OD5 A;  3WGH A;  4LK0 F;  1BN5 A;  2JRT A;  2QYO A;  4EJW A;  2VE8 A;  5L3E A;  1QNT A;  3ULQ B;  3MQ0 A;  2K4B A;  4P9U A;  1QZZ A;  4BYY A;  3DXJ F;  3HSF A;  2A6H F;  3E6C C;  2V79 A;  5ICC A;  4JQF A;  1S6L A;  3M8F A;  1TQI A;  3GWZ A;  4E70 A;  1W5T A;  4IRG A;  4GGG A;  2WTE A;  1EH7 A;  5D5X B;  3U1D A;  4CGZ A;  3T8T A;  2K86 A;  4A0Z A;  5H6Q A;  3F22 A;  1D5V A;  4KMU X;  4HLX A;  3U9G A;  4UVC A;  1MDM B;  3GFJ A;  2EFP A;  3EQL F;  3WTZ A;  1XSX A;  1G3W A;  2HS5 A;  3KFW X;  3GXO A;  1BI1 A;  3HOT A;  1LB2 A;  3WG9 A;  4IVN A;  3LAP A;  3ML6 A;  4FT8 A;  3WU1 B;  1KA8 A;  1IN6 A;  3TDU C;  1WKM A;  4M73 A;  5J6X A;  2LNB A;  2EWN A;  2OAZ A;  4HW0 A;  4HQM A;  3LQR A;  1SFU A;  2CFX A;  4IF4 A;  1CF7 B;  2O8X A;  2HGC A;  1FBS A;  2F5F A;  1O3R A;  2BV6 A;  3WU0 A;  3T1B A;  2XAH A;  4S05 A;  2KRF A;  4WF2 A;  1R5H A;  3MZH A;  3WTU C;  4BHC A;  4O3M A;  3BJ6 A;  1K78 A;  4FX4 A;  2WC2 A;  3GYH X;  1O3S A;  5D8L B;  4M9S A;  4PGG A;  4YFK F;  1OMI A;  4Y15 A;  1NHA A;  2DK8 A;  2XV4 S;  1LQ1 A;  1LJ9 A;  3R0A A;  5JHU A;  2FML A;  1JE8 A;  3F6V A;  2A5Y B;  2KKO A;  3COA C;  2KIM A;  1IUY A;  4LLN A;  2D1V A;  3L2C A;  1T98 A;  4YG2 F;  4OMY A;  1FLI A;  5D5W B;  2IA2 A;  4Q48 A;  5A2Q Z;  3WTW C;  1R7J A;  3M7G A;  4GYI A;  3IL2 A;  2FSW A;  3MAJ A;  3IC7 A;  3ABU A;  3U2R A;  5DDG A;  3QU6 A;  3PQK A;  4EQQ A;  2STT A;  4G7Z F;  1FOK A;  3I71 A;  3BP8 A;  2QBY A;  3RPQ A;  3GZ6 A;  2CQK A;  1XMK A;  5LBQ A;  2GA1 A;  4IHT A;  3LA7 A;  1D8J A;  5IT9 Z;  4B09 A;  5BPI A;  3LWF A;  1HQC A;  3GFM A;  3VEP A;  1REP C;  3WGI A;  3F8B A;  2Z9O A;  5CVR A;  3R0J A;  2ZNY A;  2W84 A;  5L3D A;  5DEQ A;  3V7R A;  5CVV A;  3E5U A;  2HR3 A;  2HKO A;  1USS A;  3FX3 A;  5LEK A;  2FOK A;  1ZRF A;  3WTV C;  3FXQ A;  4A0Y A;  1FSH A;  4ZYD A;  2PFB A;  4AWX B;  2MLK A;  4L0Y B;  3R61 A;  3I58 A;  3JW4 A;  4UHT A;  2QEN A;  3K1N A;  1QQI A;  4HOB A;  3W6J B;  3ZMS A;  1HW2 A;  4AVP A;  3SXY A;  3I64 A;  3EYY A;  4EVI A;  1VTN C;  4DQ2 A;  5HS7 A;  1JGS A;  1LDD A;  3GUD A;  4ON0 A;  5FFZ A;  1FNN A;  1YW8 A;  5ICF A;  1TLH B;  5LRS A;  5DV5 A;  3F3X A;  1O3Q A;  3NRV A;  2P6S A;  2QWW A;  2VXZ A;  1SMY F;  5F64 A;  2XAS A;  2ZCW A;  2Q0O A;  2K4J A;  1QBJ A;  1OYY A;  1Z91 A;  4HZF A;  4HDV A;  1A04 A;  4LG0 B;  3KP4 A;  3EDP A;  1XB4 A;  1RUO A;  4TV7 A;  5DYM A;  2L02 A;  3K1P A;  2E1N A;  4ZZL A;  2R7F A;  4I7H A;  2EB7 A;  4G6Q A;  2BGC A;  3ZMZ A;  2QM3 A;  4EM2 A;  1V4R A;  4Y13 A;  1CF7 A;  3MWM A;  5EEH A;  5HDK A;  2W85 A;  4L9N A;  1YS7 A;  2P6T A;  2UZK A;  2D45 A;  5F1R A;  1J9I A;  4R79 A;  3BOQ A;  2R3S A;  1LVA A;  1MJB A;  2WWY A;  2GA2 A;  3O2P E;  1R58 A;  1KU9 A;  4Y17 A;  4QWQ A;  3F8F A;  1T39 A;  4ENN A;  2QQA A;  1Y0U A;  3V4G A;  4Z2Y A;  1U6G A;  1XDU A;  4MNU A;  1GXQ A;  2P5K A;  4KN7 X;  4YFX F;  5BS6 A;  2GQQ A;  3QU3 A;  1XSD A;  2YR2 A;  1IRF A;  1EH8 A;  2DPD A;  2XAJ A;  3BRO A;  4XLN F;  4OOI A;  1JHF A;  4CXF A;  2F5E A;  1YO5 C;  4I0A A;  3ZMT A;  4WX9 A;  4LB6 B;  1LDK B;  4FX0 A;  3CTA A;  3F23 A;  2RDP A;  2K02 A;  2HTJ A;  2P4W A;  1DPU A;  2HFH A;  2A69 F;  3V7C A;  4Q5S F;  2H6B A;  3M1E A;  3E3V A;  1XMA A;  4R8H A;  1BBY A;  4OU0 A;  4UVB A;  4KA4 A;  4CO8 A;  2FNP A;  1Z6R A;  4XBF A;  1ZRE A;  1FZP B;  4P9F A;  3IRR A;  4IRI A;  1ONV A;  5D4R A;  2CW0 F;  3RKW A;  3HSE A;  1RI7 A;  1B1B A;  1STZ A;  3SQN A;  3IWZ A;  5D5U B;  1R23 A;  5D4S A;  1ZLK A;  1J75 A;  1R00 A;  3RI4 A;  1HKQ A;  2HZT A;  1GXP A;  2GWR A;  4PDK A;  4I09 A;  1KQ9 A;  2ZME B;  3HTU A;  3ELK A;  4GXO A;  2O03 A;  5FLX Z;  4M6Y A;  4R1H A;  3I53 A;  4AIH A;  5DCF A;  5ICG A;  5AIP A;  3IKT A;  1XGO A;  1I5Z A;  2IA1 A;  2X0L A;  1ZN2 A;  2YSR A;  1YIO A;  3JTG A;  3BY6 A;  3QAH A;  4EGY A;  2G7U A;  3Q9S A;  3LFK A;  3DF8 A;  2VT3 A;  1W7P D;  3G3Z A;  2OQR A;  4XSZ F;  4UV9 A;  1YG2 A;  2XAQ A;  2EFN A;  2KJB A;  5F6F A;  3GF2 A;  2FF4 A;  3P9C A;  5AIQ A;  4U7B A;  1W4M A;  1AOY A;  3E5X A;  4EJT A;  2M1B A;  4IXA A;  5JFR A;  3ECH A;  1SAX A;  1ZRC A;  2M87 A;  1E2X A;  2RGV A;  3E6D A;  3TDZ C;  5HDN A;  3ROU A;  1BIA A;  4BXU A;  3LST A;  4G7H F;  3DKW A;  2QVO A;  2F5D A;  3ABT A;  5K1Y A;  1ZG3 A;  5E1W A;  3TKY A;  4BQA A;  3FXR A;  2VN2 A;  1V3F A;  3E6M A;  1G6N A;  2W57 A;  3TO7 A;  2HYG D;  2PN6 A;  4N9H A;  2FRH A;  3TO6 A;  1B9M A;  1IN5 A;  3SHF A;  4RGR A;  4HYE A;  4LLG F;  2KIU A;  2ZJ2 A;  4A2U A;  1T6S A;  4IPA A;  4N0B A;  5TRD A;  1WSU A;  3FMS A;  2YX4 A;  2H27 A;  1T2K A;  4HLY A;  5HOO A;  2QUF A;  3L09 A;  2BE5 F;  1P92 A;  1KU3 A;  3MZY A;  5D5V B;  2P5L C;  1HKT A;  2FU4 A;  2XIG A;  2NAZ A;  2IVM A;  4HV5 A;  1P4X A;  3KLN A;  5D6F A;  4NQW A;  3V8J A;  2D2W A;  1R1U A;  1BC8 C;  1XDS A;  2M30 A;  3ZMD A;  4A5M A;  4UV8 A;  1ODD A;  5LGT A;  1MJA A;  1ZRD A;  3GO5 A;  2F5C A;  2DU9 A;  1FC3 A;  4PZJ A;  2EA2 A;  1SD4 A;  2MLG A;  4XRF A;  2OU2 A;  5DCM A;  1W7P B;  2Q2E A;  1SD5 A;  2A07 F;  3E97 A;  4RGU A;  1DUX C;  2XGX A;  5L3B A;  5E18 F;  2ADU A;  2FBI A;  2V6C A;  2LF7 A;  2OQG A;  1EV7 A;  1YS6 A;  4PCQ A;  4ZYH A;  4P55 A;  3LQQ A;  1YLF A;  4ZYG A;  2ZME A;  2XRN A;  2HYF A;  3BJA A;  5E1Z B;  2V1U A;  5HLH A;  3JAM Z;  2DI3 A;  5K5R A;  1U5T B;  1FYK A;  3H92 A;  5ICE A;  4U0W A;  4A0X A;  4QLC U;  1FT9 A;  2DO7 A;  1ZLJ A;  5EEG A;  4KIF A;  2DAO A;  4XLP F;  1I6X A;  5D8K B;  1I27 A;  4BAY A;  3KLO A;  4ENJ A;  5H6R A;  1XCB A;  3PFI A;  3G73 A;  5ILS A;  3VB2 A;  3RIR A;  2CYY A;  3CO6 C;  1MKM A;  4L5J A;  3L7W A;  4RAY A;  2RV8 A;  3OOP A;  1UCR A;  3HYI A;  3R6S A;  3C1D A;  2EFW A;  1Z9C A;  4U88 A;  2O0Y A;  2Z5U A;  3P9K A;  1K6O A;  1OR7 A;  3C7J A;  3ERE D;  5DUI A;  2XVC A;  2VBZ A;  1YW9 A;  4LGW A;  4I98 B;  3EUH A;  5JVT A;  1H9G A;  3I59 A;  2HTS A;  1FY7 A;  3KEQ A;  3T0Y A;  1QO0 D;  4LLL A;  4IJA A;  5BPD A;  2K7L A;  1L3L A;  5CVU A;  1J59 A;  1F1Z A;  1B4A A;  3WTS C;  2IRF G;  3HRM A;  3ZQ7 A;  2RKH A;  2DT5 A;  2VC1 A;  1OYI A;  1XCV A;  1SD6 A;  4JK1 X;  5A2Q K;  1FBU A;  4A12 A;  1LNW A;  1J0R A;  2BBY A;  3Q9V A;  4MTD A;  3CUQ B;  5E8I A;  3K9T A;  5HVQ C;  3JTH A;  2PJP A;  4EM1 A;  3KP5 A;  4O5V A;  3J7A O;  2HEO A;  3W6K B;  5J8F A;  1KQ0 A;  2E7W A;  1FSE A;  1FP2 A;  2L01 A;  1S7O A;  4LD5 A;  1G3Y A;  3C3W A;  1ZYR F;  2M45 A;  3EYI A;  1BM9 A;  2WV0 A;  3WTX C;  3HHG A;  4L9J A;  4I0B A;  5E1X A;  3J80 K;  3J81 Z;  1LDJ A;  2XAG A;  4XSX F;  3RJP A;  4M74 A;  2BYV E;  4G9Y A;  3K2Z A;  5LHI A;  3B73 A;  3QP6 A;  4AD9 A;  1FYL A;  1MDM A;  2R7D A;  1IXS B;  1EH6 A;  4OMZ A;  1ZG1 A;  1UHM A;  2ETH A;  3FMR A;  4AIJ A;  3BZ6 A;  2Z99 A;  5D6E A;  3KCC A;  3C18 A;  3WOD F;  2RQP A;  5K5Q A;  2DK5 A;  2W24 A;  1H0M A;  2HKX A;  3EET A;  4IRH A;  2ZXJ A;  1J2X A;  1HSJ A;  3ECO A;  4Q4Z F;  3F21 A;  1W5S A;  2GXB A;  1B9N A;  2JTV A;  1UB9 A;  3SFZ A;  2A3S A;  3RKX A;  3KP2 A;  3AAF A;  2EK5 A;  2VOD A;  1GVJ A;  3I4P A;  1U3E M;  2EA4 A;  2P7V B;  2YX7 A;  4M6X A;  4CYD A;  3IRQ A;  2EV5 A;  1XSV A;  4L0Z B;  4O6J A;  2DTR A;  2V9V A;  3ZPL A;  1UHW A;  1IN8 A;  1FX7 A;  3KP7 A;  3SZT A;  4EGZ A;  2MH2 A;  1RZ4 A;  3O6B B;  4NB5 A;  2IP2 A;  1LEB A;  3OV8 A;  2ESN A;  4U0Y A;  2CGP A;  3TOA A;  2O3F A;  2H6C A;  1WWX A;  1Z7U A;  1P4W A;  4LFU A;  3WGG A;  5FO5 A;  5HLG A;  2Q8K A;  4MQV A;  1LEA A;  1TW2 A;  5H20 A;  3GVA A;  1QPM A;  3H3Z A;  2MD5 A;  2H09 A;  1WI9 A;  3GEZ A;  3L00 A;  1RNL A;  2VC0 A;  3VFZ A;  1IXC A;  4KYW A;  1CGP A;  2E1C A;  3B02 A;  4KIC A;  3CDH A;  1S3J A;  3BPV A;  3I5U A;  1ULY A;  3GFI A;  2IT0 A;  1Z6T A;  3RKY A;  1PP7 U;  4WXD A;  4UUV A;  2DPU A;  2G9W A;  1YTY A;  3REO A;  2KJC A;  3FXU A;  1K79 A;  1ZAR A;  2DBB A;  1OYW A;  2RN7 A;  1SMT A;  2MH9 A;  1WRJ A;  2FBH A;  1R1T A;  1XD7 A;  2AXL A;  1HXD A;  2CSO A;  3CO7 C;  4EM0 B;  2EFQ A;  1R36 A;  3IKV A;  4OIR F;  1GHC A;  2LSO A;  2FMY A;  4KFC A;  3HUG A;  4YIF A;  1U5T C;  1IXR C;  2HWV A;  1BOA A;  4M9X A;  2QQ9 A;  2E7X A;  2C6Y A;  4L9V A;  2LKP A;  2QZ8 A;  4LG0 A;  4FHT A;  4BNC A;  2OZ6 A;  2VE9 A;  3FWE A;  4RB1 A;  5FLX K;  2IJL A;  4RB3 C;  2CWE A;  5FFX A;  2K27 A;  4LJZ F;  3RYP A;  4YII A;  1HKS A;  4K2E A;  5DUK A;  4U0V A;  2PI0 A;  3GLX A;  3M9A A;  1F4K A;  3BDD A;  3MFK A;  2XKP A;  4F7Z A;  2L4A A;  2FEZ A;  3HRU A;  3S2W A;  3FMQ A;  5FD5 A;  3FM5 A;  1HBX G;  1HW5 A;  2MA3 A;  2PBI A;  2Y48 A;  3CUO A;  4KUM A;  3SZP A;  2VBY A;  3FF5 A;  4HDU A;  2QLZ A;  4WXH A;  3HOS A;  3KE2 A;  3JSO A;  3TGN A;  3QPT A;  5LGU A;  4G6D A;  4RGS A;  2ELH A;  1ON1 A;  3E5Q A;  1DPR A;  2P5V A;  5L3C A;  1XGM A;  3ISP A;  4LB5 A;  3FM3 A;  3P7N A;  3HRS A;  5ERI A;  3KP6 A;  1TNS A;  1YW7 A;  2CO5 A;  2ESH A;  1MGT A;  2EFO A;  2TDX A;  3F8C A;  4ZYE A;  1KYZ A;  3K1M A;  2PQ8 A;  3CUQ C;  3ZMV A;  1E17 A;  4I02 A;  3BPX A;  4H0E A;  4GYG A;  1O3T A;  4ESJ A;  1FYM A;  1DP7 P;  5LRR A;  4MEX F;  2XRO A;  1RUN A;  1U8R A;  1G3T A;  3VOD A;  2O61 A;  2VBX A;  2F2E A;  1S29 A;  1ZAO A;  3F6O A;  1BI0 A;  4ETS A;  4OIP F;  2GIV A;  3MCZ A;  3QP5 A;  4GCV A;  1MZB A;  4OIO F;  5DD4 A;  1D8K A;  2JPC A;  5E20 A;  2XUB A;  1YFH A;  1YQA A;  1TBX A;  2RVC A;  4HF0 A;  1IN7 A;  2EJR A;  4UVA A;  5LEJ A;  4OIN F;  3HHH A;  2COM A;  3V8K A;  2Z33 A;  4N9I A;  3CLO A;  1KU7 A;  3DPL C;  4KMF A;  1G4D A;  2KIF A;  4CZZ A;  1FWZ A;  3H3U A;  3ZP5 A;  3PQJ A;  3QOP A;  3DEU A;  1KQ8 A;  2NNN A;  2GXG A;  4HF2 A;  1D3Y A;  2EV6 A;  4HX4 A;  1BI2 A;  1TQP A;  1Q1H A;  1C0W A;  4G7O F;  4HQE A;  5BMZ A;  3DV8 A;  2QQB A;  4P96 A;  2M5W A;  4YFN F;  4S04 A;  5IT3 A;  3N4M A;  3O3K A;  1I1S A;  2HQN A;  2PMU A;  2NNY A;  5KK1 A;  2Z3Y A;  2ISY A;  2EV0 A;  3KZY A;  3M8E A;  4JBA A;  3F72 A;  3CJN A;  3N97 A;  1TTY A;  2UXN A;  3JSP A;  1IN4 A;  4EJV A;  2AS5 F;  4RB0 A;  3JAM K;  4NHJ A;  3ZN1 A;  1UFM A;  5ILV A;  1U2W A;  1TNT A;  1KYW A;  1ZGJ A;  4ASN A;  2FE3 A;  4MTE A;  1KGS A;  3HRT A;  2IA0 A;  3P9I A;  2W25 A;  1IRG A;  4KDP A;  2XKO A;  3HTS B;  1HW1 A;  2ZO4 A;  5AON A;  4L18 B;  1HST A;  1PP8 F;  5ILU A;  1PUE E;  1T0F A;  4DNC A;  2OZU A;  2PG4 A;  3TOB A;  5CJ9 A;  2GAU A;  1G3S A;  2DW4 A;  1XGN A;  4WXC A;  1ON2 A;  3QRF F;  1JHH A;  1S7A A;  4HA8 A;  5L3F A;  4ESF A;  1Z1D A;  4RB2 C;  1J7K A;  2OA4 A;  2RC4 A;  3J80 Z;  2PLY A;  1BJA A;  1WQ2 A;  2FBK A;  2L4M A;  1DDN A;  5E17 F;  1ZHF A;  2ZKZ A;  2O6G E;  3HIF A;  3WTT C;  3ZN0 A;  3T8R A;  3F8M A;  3R4K A;  2UXX A;  4EV0 A;  2ZFW A;  1Z05 A;  3QPH A;  5IT9 K;  4A6D A;  4GO1 A;  5HDG A;  3V7S A;  2GZW A;  2VON A;  1PDN C;  3RTR A;  2JT1 A;  2D1H A;  3WTY C;  4IHS A;  1F9N A;  4WCG A;  2STW A;  4WK8 F;  4BHP A;  1O7F A;  3NEU A;  1R22 A;  4HX8 A;  2FQ3 A;  1FBQ A;  2MBF A;  2XAF A;  4MQ9 F;  5HS9 A;  1QZY A;  3IHU A;  1OPC A;  5CVI A;  3TQN A;  3E6B A;  3HSR A;  2JPB A;  1SFX A;  4MHG A;  2Y0M A;  2ISZ A;  2CG4 A;  4HBL A;  5CVJ A;  1H9T A;  3KET A;  2NS0 A;  2OBP A;  3R60 A;  3I54 A;  4G8X A;  4ZH4 F;  1JXS A;  1FP1 D;  2A6E F;  1ZH5 A;  3DFG A;  1KU2 A;  1P6R A;  1W7P A;  3J81 K;  4A6E A;  2FA5 A;  5CYV A;  1R5G A;  4KN4 X;  4CIC A;  4U7D A;  3RPU A;  1L0O C;  5ED4 A;  3GFL A;  2V1D A;  4BHB A;  4RGX A;  1OKR A;  4EJU A;  4CDG A;  4P5O A;  2Y75 A;  1U5T A;  3IWF A;  2J5O A;  1ZG5 A;  2P8T A;  2IPQ X;  3NQO A;  2VT2 A; 
#chains in the Genus database with same CATH topology
 1OCP A;  2DLL A;  2NVY J;  1O57 A;  5K5O A;  2W48 A;  2LDU A;  3DTE A;  1B6A A;  3HL2 A;  2HYJ A;  5FD6 A;  4Y3O A;  1F36 A;  4ESB A;  3JRI A;  2WB1 A;  1FOX A;  3LA2 A;  1OCR H;  1ZGA A;  1J5Y A;  2UWM A;  2L54 A;  1MBF A;  1A36 A;  3E0J B;  4M9Z A;  4G94 A;  3SEZ A;  2I5U A;  2CW7 A;  3CCE I;  1YRN A;  1OCC H;  3BG3 A;  1P2F A;  5HLI A;  1R1V A;  1K6Y A;  3FBN B;  4HF1 A;  2A05 A;  5DD8 A;  1MIJ A;  3GZN B;  4A5N A;  1IV8 A;  4KT5 C;  4B8X A;  4BDZ A;  1JT6 A;  3S14 J;  2KT0 A;  4XM3 A;  4J01 A;  4LMY A;  4ENK A;  4D9J A;  2Z2S B;  1Z21 A;  4L9T A;  4PGH A;  3QOE A;  4BDY A;  4ZYA A;  3CCS I;  2VJJ A;  1XGS A;  3OYE A;  1ERD A;  1P4A A;  2V9P A;  1B59 A;  3BJO A;  2R93 J;  4M71 A;  4RAZ A;  4V2F A;  4N4N B;  4XLF A;  3Q5F A;  1F5T A;  4DW6 A;  1QGP A;  2JZY A;  4Y7N J;  5M3M J;  3L1P A;  2DMT A;  1U78 A;  4D5C A;  3D5L A;  5E3L A;  2ZB9 A;  3VYT B;  3L9F A;  2ZNZ A;  1U0J A;  3KZZ A;  4M72 A;  3GTK J;  4B1R A;  2ACJ A;  1UST A;  1BL0 A;  4XOR A;  1FPQ A;  1IGN A;  1IW7 F;  1TQM A;  1TWA J;  1X4P A;  3H1C A;  4ENM A;  1BI3 A;  3ZQG A;  1BC7 C;  3FK7 A;  3G2B A;  4KNY A;  2NYX A;  2AQF A;  1RIO H;  1AWC A;  3AL0 B;  2DMQ A;  4RA2 A;  1Q1V A;  5E8G A;  4NQW B;  5F0C A;  2HQR A;  4Q47 A;  2IW5 A;  3LAJ A;  2YPR A;  1SD7 A;  4MEY F;  5LHH A;  4IHV A;  2LYC A;  2O5R A;  3FHZ A;  2LF8 A;  3ERM A;  3LA3 A;  1UEL B;  3VOE A;  4UNO A;  3K69 A;  3CUQ A;  3GZ5 A;  2H94 A;  3WE2 A;  2RNJ A;  1SVM A;  3MEX A;  4CHU A;  3I0T A;  3BT9 A;  4L5I A;  2HXO A;  1GVD A;  2VKE A;  4BJT A;  1IF1 A;  4AIK A;  4D0P A;  1YYV A;  3GX4 X;  4EMS A;  3TW7 A;  5HS8 A;  3OR2 C;  2VQG A;  4JP0 A;  5EGO B;  4XKV A;  1I1G A;  1EKE A;  1P7I A;  1EJ9 A;  3I55 I;  1FJL A;  2E19 A;  2KDZ A;  3HGG A;  2IGO A;  3M8J A;  5DCM B;  2VOP A;  5L3G A;  2DTZ A;  2Q2E B;  3OL3 A;  3V8L A;  5BQT A;  1O7L A;  5LLQ A;  2LKX A;  2V9K A;  3IH4 A;  2VOO A;  1VQ5 I;  4KIG A;  3K0L A;  1BIB A;  2L3D A;  4DGW B;  5LGN A;  3DQV C;  5CLS A;  2XHK A;  4HV6 A;  2ZBK A;  1JTX A;  1FIP A;  2R4G A;  2HOE A;  3TO9 A;  5TJJ A;  3KEO A;  2DQR A;  3G71 I;  2O6G E;  1XN7 A;  2J5P A;  1IZ1 A;  4I2O A;  4IKF A;  4OIQ F;  4RS8 A;  3ZMU A;  5GAH J;  2GBY A;  4ZZD A;  1SFO J;  2MG4 A;  1TZL A;  3GME A;  1ETX A;  3SEQ A;  4ZTJ A;  2M8E A;  3CLQ A;  3KP3 A;  3Q0U A;  1IDZ A;  2BW3 B;  4CYC A;  1K7A A;  1MJ9 A;  3OWT A;  5JI6 A;  2PX9 A;  2PMH A;  2P7C B;  3I4N J;  2HDC A;  2OCE A;  2K3F A;  3AG2 H;  5FKL A;  2HOA A;  1T38 A;  1K78 B;  1IAW A;  4A3D J;  3HG9 A;  2DT6 A;  2KQR A;  2FXA A;  1IUF A;  2Y0S N;  4FIS A;  1MBK A;  3X2Q H;  1UMQ A;  3KYL A;  1S8N A;  2NVU B;  3OYC A;  1X3Z B;  1ZKG A;  4XKC A;  5FB2 A;  3I3L A;  4GRI A;  2PEX A;  4HAM A;  4BH9 A;  2JSC A;  1BW5 A;  2RAE A;  4B3X A;  3BR5 A;  1TWC J;  2BY1 A;  2Q1Z B;  3HEF A;  3S2H J;  2B0L A;  2X4H A;  2JWT A;  4FE4 A;  4XLH A;  3HKZ N;  3RYR A;  3ONQ A;  4ZDL A;  1YJN I;  4KIB A;  3F8N A;  2NRA C;  2AQE A;  3DKX A;  4EAT A;  3RPU D;  5J4Y A;  4A3B J;  5FGM A;  6PAX A;  2A68 F;  4LK1 F;  3V42 A;  3CMM A;  4BJ5 C;  3DPT A;  3L2W A;  3KYD B;  2DFI A;  2ICW G;  4MGR A;  4BQQ A;  2K9S A;  1ETK A;  1MBG A;  4WWC A;  3BWG A;  1TC3 C;  1B72 B;  1TW3 A;  3MVP A;  3LSI A;  3G1M A;  2YU3 A;  2R5Z A;  2VBW A;  5J8C A;  3RDI A;  5LHG A;  2A61 A;  2WBM A;  4ITV A;  3GW2 A;  4XR6 A;  5FRM A;  3FZV A;  1X3U A;  2VI6 A;  2XB0 X;  1SFE A;  1YX3 A;  3W6V A;  2QBY B;  4EJO A;  5BOX A;  4IHW A;  1JTY A;  2UV1 A;  3I59 B;  2BEO A;  1W36 D;  3KZI C;  4I01 A;  1VFC A;  3HOZ J;  3D0S A;  5J3L A;  5E3O A;  5KVR A;  2L9V A;  2V1X A;  1SVO A;  2EZK A;  1MD0 A;  1A5J A;  1RET A;  5JR3 A;  3DP7 A;  4UUS B;  2KLO A;  4ZJZ A;  2HI3 A;  4HX7 A;  4UXN A;  1NK3 P;  3T5X A;  3L2R A;  2G7H A;  1WGX A;  3WE3 A;  5C4X J;  2NS7 A;  2L9S A;  1YE9 A;  2DQL A;  2LMD A;  2MYS A;  4AID A;  2MC3 A;  4EEF G;  1DP3 A;  2FNA A;  2OD5 A;  1ZEL A;  3WGH A;  4HST A;  4LK0 F;  1BN5 A;  1EF4 A;  3OYJ A;  3SDG A;  4A93 J;  2JRT A;  2F4O B;  2QYO A;  1XC5 A;  4EJW A;  2VE8 A;  5L3E A;  1QNT A;  5EJC A;  3ULQ B;  2XRL A;  1JKQ C;  3MQ0 A;  2K4B A;  4A69 C;  1D0X A;  4P9U A;  3WU2 C;  1QZZ A;  4BYY A;  3DXJ F;  3H0G J;  2R92 J;  3HSF A;  2F4M B;  3AFH A;  1GV2 A;  2A6H F;  1WHU A;  3E6C C;  2NS8 A;  2V79 A;  3S8P A;  5ICC A;  3MKY B;  2HVS A;  4JQF A;  1S6L A;  4LIU A;  2DYR H;  2BY0 A;  3M8F A;  1TQI A;  2CV2 A;  3GWZ A;  1E0E A;  3DU6 A;  3BZC A;  3SFI A;  4D1Q A;  4E70 A;  1MSF C;  3VDX A;  1W5T A;  4IRG A;  4GGG A;  3C2G A;  4KIS A;  2WTE A;  1EH7 A;  4NC8 A;  5D5X B;  3U1D A;  4IHX A;  3ASN H;  4PJL A;  4CGZ A;  1KZH A;  3T8T A;  2XF5 A;  2K86 A;  3BTI A;  4A0Z A;  2X51 A;  4HG2 A;  4ABZ A;  5H6Q A;  1RES A;  3F22 A;  2E5Z A;  4IQJ A;  1D5V A;  1ZQ3 P;  4KMU X;  1IDY A;  4HLX A;  3U9G A;  2OV7 A;  4UVC A;  1MDM B;  3GFJ A;  1XTA A;  2CS3 A;  2EFP A;  3EQL F;  3FDY A;  2BXZ A;  1AU7 A;  3BG7 A;  2L9R A;  3WTZ A;  1XSX A;  1G3W A;  2HS5 A;  3KFW X;  3RZD J;  3GXO A;  3CCU I;  1BI1 A;  3FHN A;  3HOT A;  1Z77 A;  1LB2 A;  3WG9 A;  4IVN A;  3GCM A;  5KCM A;  2E36 A;  2K3P A;  3LAP A;  3ML6 A;  4FT8 A;  3WU1 B;  5F04 A;  3CME I;  1KA8 A;  3K4N A;  3OYH A;  1A35 A;  1IN6 A;  3TDU C;  1WKM A;  4M73 A;  4Y52 J;  5KNL A;  1LE8 A;  1UAA A;  1NG6 A;  5J6X A;  1I39 A;  2LNB A;  2EWN A;  2OAZ A;  1MBJ A;  3DTI A;  4HW0 A;  4HQM A;  2JJ7 A;  5IOY A;  3LQR A;  2VUM J;  1RRJ A;  5B1B H;  2LBF B;  1SFU A;  3DLL F;  2CFX A;  1VQ6 I;  3OYG A;  1MND A;  2X1E A;  2LP0 A;  1HF0 A;  4IF4 A;  2XGD A;  1CF7 B;  2O8X A;  1VQ7 I;  2CMP A;  2HGC A;  1SAN A;  4BS9 A;  1O4X A;  1FBS A;  2F5F A;  3A01 A;  4CCO A;  2BV6 A;  2GIZ A;  3WU0 A;  3T1B A;  2XAH A;  4S05 A;  1O3R A;  1F43 A;  3E1S A;  2KRF A;  4WF2 A;  1R5H A;  1KON A;  3ABK H;  4F91 B;  3WTU C;  3MZH A;  1FMV A;  1S72 I;  2XSJ C;  2HQA A;  4BHC A;  1GT0 C;  3B6A A;  4O3M A;  2BOL A;  4LIT A;  3BJ6 A;  3JRH A;  1K78 A;  1Z3X A;  4FX4 A;  3H9G A;  4FET A;  5GAG J;  1ENH A;  2WC2 A;  3GYH X;  3S17 J;  3QYB A;  1B8I A;  3ZQH A;  1O3S A;  5D8L B;  1HDD C;  1OQY A;  4M9S A;  4PGG A;  4YFK F;  2QSG X;  1OMI A;  1RR7 A;  4Y15 A;  2M4G A;  3MKW B;  5HOD A;  1NHA A;  3U1K A;  2DK8 A;  2R7Z J;  4A3E J;  2XV4 S;  4XLE A;  1LQ1 A;  1LJ9 A;  1QU3 A;  3R0A A;  1ORK A;  5JHU A;  2FML A;  2I10 A;  1MBE A;  1JE8 A;  2HZD A;  3F6V A;  2A5Y B;  2KKO A;  2QF7 A;  3COA C;  2LRE A;  4RMN A;  2KIM A;  4YEL A;  4LLN A;  1IUY A;  2D1V A;  3L2C A;  5J1U A;  1T98 A;  4YG2 F;  3KX2 A;  4OMY A;  1FLI A;  3OS2 A;  5D5W B;  2IA2 A;  3IUO A;  4Q48 A;  4XKB A;  5A2Q Z;  5IOZ A;  1H89 C;  3WTW C;  3BTJ A;  4KJZ A;  1R7J A;  2G0E A;  3M7G A;  1VI0 A;  4GYI A;  1PYV A;  3IL2 A;  1D1B A;  2IAI A;  2FSW A;  3H5A A;  2XDV A;  3PO2 J;  3MAJ A;  3IC7 A;  3ABU A;  3U2R A;  5DDG A;  3QU6 A;  1FEX A;  2VKH A;  3PQK A;  4EQQ A;  2STT A;  5LFA A;  3LSG A;  4G7Z F;  1FOK A;  3I71 A;  3BP8 A;  4HNV A;  2QBY A;  4PJJ A;  2LY1 A;  3RPQ A;  2MD0 A;  3GZ6 A;  2CQK A;  3D5R C;  4W1U A;  1XMK A;  3CCQ I;  2KIS A;  5LBQ A;  2GA1 A;  4IHT A;  3CC7 I;  3B6C A;  1HC8 A;  4S0H B;  3LA7 A;  1D8J A;  5IT9 Z;  3OMY A;  4B09 A;  5BPI A;  1RKW A;  2E2H J;  3LWF A;  1VZ0 A;  5GP9 A;  1HQC A;  3GFM A;  3VEP A;  2M4K A;  1REP C;  3AL0 C;  5CPR B;  4AUX A;  3F8B A;  5EDN A;  3WGI A;  1Y1W J;  2Z9O A;  3OR1 C;  2WAD A;  5CVR A;  4UB8 C;  3R0J A;  3E7L A;  2ZNY A;  3BCB A;  4NNJ A;  2W84 A;  1TP4 A;  5B66 C;  5L3D A;  5DEQ A;  3OYN A;  3V7R A;  4W97 A;  1Y0N A;  2GOX B;  3H9Q A;  1SAU A;  1FOW A;  3FXL A;  5CVV A;  3E5U A;  2HR3 A;  1WH5 A;  4I76 A;  1LPQ A;  2HKO A;  1USS A;  3FX3 A;  2X6O A;  3RSN A;  5LEK A;  2FOK A;  4J00 A;  1MNM C;  1ZRF A;  3WTV C;  3FXQ A;  1TWF J;  4NBQ A;  4A0Y A;  1AKH A;  1FSH A;  4ZYD A;  3CC2 I;  2PFB A;  4AWX B;  3OYK A;  3CC4 I;  2DA2 A;  2MLK A;  4L0Y B;  3R61 A;  4II3 A;  2O7O A;  3PJR A;  1QRY A;  2JMW A;  3G1O A;  1WJA A;  2OUM A;  3M1C A;  3I58 A;  2N8G A;  3JW4 A;  1MH4 A;  1V5E A;  4UHT A;  5EZH A;  2QEN A;  3K1N A;  2VJ4 A;  1QQI A;  2M9H A;  3RCO A;  4B47 A;  1BR2 A;  1YOV B;  4HOB A;  3K4M A;  3W6J B;  5KAF C;  3ZMS A;  1HW2 A;  3TW6 A;  4AVP A;  3SXY A;  3I64 A;  3EYY A;  4EVI A;  1VTN C;  4FE7 A;  4CUG A;  4DQ2 A;  5HS7 A;  5HLT A;  1JGS A;  4II2 A;  1LDD A;  5K7H A;  3GUD A;  4ON0 A;  5FFZ A;  2K85 A;  3EUA A;  1FNN A;  2M0M A;  2YS9 A;  2ZME C;  1YW8 A;  3A02 A;  5ICF A;  1ZR2 A;  2M7A A;  2WAF A;  1TLH B;  5LRS A;  2DDA A;  2LFB A;  2VL8 A;  3F3X A;  3IAM 2;  5DV5 A;  1O3Q A;  3HUG B;  3G1L A;  1YHQ I;  2L9N A;  2XPU A;  3NRV A;  2E2J J;  4A3L J;  2P6S A;  5DS9 A;  2QWW A;  2VXZ A;  1SMY F;  5HNH A;  5F64 A;  4CCL A;  2XAS A;  2ZCW A;  2Q0O A;  3UKG A;  2K4J A;  2E71 A;  1QBJ A;  1DU6 A;  4A3J J;  1OYY A;  2R5Y A;  1PJR A;  1Z91 A;  4HZF A;  3RZO J;  2ME6 A;  4HDV A;  1A04 A;  1JUP A;  1RC9 A;  2CQN A;  3KP4 A;  4LG0 B;  1ACI A;  2NVQ J;  3EDP A;  1XB4 A;  3K7A J;  2Z1D A;  3Q0V A;  1RUO A;  4MO7 A;  5CKT A;  3CD6 I;  3OIO A;  4TV7 A;  3ZQI A;  4OAY A;  1G2H A;  5DYM A;  2H8W A;  2L02 A;  3HDD A;  4BBS J;  2DA4 A;  1X1B A;  2E1N A;  3K1P A;  4ZZL A;  2R7F A;  2MAB A;  4I7H A;  2EB7 A;  2ZC2 A;  4G6Q A;  2BGC A;  3ZMZ A;  2BY3 A;  2QM3 A;  5F0H A;  2P0W A;  4EM2 A;  1V4R A;  4Y13 A;  1CF7 A;  3MWM A;  5EEH A;  5HDK A;  1Y8R B;  4UB6 C;  3CP8 A;  1ETV A;  4C3J J;  2LD5 A;  1OR7 C;  3LSP A;  2W85 A;  2VIX A;  3BQY A;  4L9N A;  1WH7 A;  1YS7 A;  2P6T A;  1WJ5 A;  3K4C A;  5F1R A;  2UZK A;  2D45 A;  1J9I A;  4R79 A;  2DOE A;  3BOQ A;  2LH9 A;  1LVA A;  1MJB A;  1XX5 A;  2R3S A;  4E7Z A;  2WWY A;  3EUH C;  4A3K J;  1NK2 P;  2PJR A;  1EA3 A;  2GA2 A;  4V19 K;  3GTQ J;  2FX0 A;  3O2P E;  1R58 A;  1KU9 A;  2Z16 A;  4CZC A;  2LKS A;  4Y17 A;  4QWQ A;  3F8F A;  1T39 A;  4E7S A;  4AYB N;  4C2M J;  4ZTF A;  3K70 D;  4ENN A;  5DM7 F;  2FD5 A;  2QQA A;  1Y0U A;  4HNU A;  5KAI C;  1ZGW A;  3V4G A;  4Z2Y A;  3DLA A;  1PVE A;  1U6G A;  1XDU A;  2L7K A;  4MNU A;  3K4J A;  1GXQ A;  2K9N A;  2K5C A;  3M3Y J;  4DZJ A;  2P5K A;  4KN7 X;  4YFX F;  4BEH B;  5BS6 A;  2GQQ A;  3QU3 A;  4DZP A;  5EF6 A;  4L5E A;  1XSD A;  2YR2 A;  2X6Y A;  1IRF A;  1LUJ B;  3DTK A;  3L2U A;  1VQP I;  1EH8 A;  2DPD A;  2XAJ A;  3BRO A;  3RQI A;  3CP2 A;  4HPQ A;  2HDW A;  2CUE A;  3FKJ A;  2F5V A;  4OOI A;  4XLN F;  3CMA I;  1JHF A;  4CXF A;  2F5E A;  1YO5 C;  2LR8 A;  1Z0X A;  4I0A A;  3ZMT A;  4WX9 A;  4LB6 B;  1LDK B;  4FX0 A;  1I6H J;  3HM5 A;  2MC4 A;  3CTA A;  3F23 A;  2RDP A;  4P1W A;  1NTC A;  2K02 A;  3A2K A;  2R7X A;  3ZQL A;  2HTJ A;  1ZR4 A;  2P4W A;  1MW7 A;  1T08 B;  1DPU A;  2HFH A;  1MMG A;  2A69 F;  2KPM A;  3V7C A;  3S3O A;  4Q5S F;  2H6B A;  3M1E A;  3E3V A;  4M3F A;  1XMA A;  4KT6 A;  4R8H A;  1BBY A;  4OU0 A;  1JJ6 C;  1XMX A;  2QEX I;  4UVB A;  1N25 A;  1X58 A;  4KA4 A;  4CO8 A;  4DYQ A;  4OAZ A;  2FNP A;  1Z6R A;  4XBF A;  1ZRE A;  3NAR A;  3UNG C;  1FZP B;  2JA5 J;  4P9F A;  1AA7 A;  2HNH A;  3IRR A;  2OPT A;  1VQL I;  3S2D J;  1I3A A;  1UG0 A;  4BQN A;  3LSR A;  3I9V 2;  2OCC H;  1WJD A;  4IRI A;  2VQH A;  2KDO A;  2PMZ N;  1ONV A;  5FLV A;  3PNY A;  5D4R A;  2CW0 F;  2ZXH A;  2B7E A;  3RKW A;  1YJW I;  3HSE A;  2K9L A;  3NWS A;  3H36 A;  2FOW A;  3M4O J;  1RI7 A;  1GV5 A;  3K6G A;  1B1B A;  1STZ A;  2YU9 J;  1D5Y A;  3SQN A;  3IWZ A;  5D5U B;  2EQR A;  1DQU A;  1R23 A;  3LMM A;  3CCY A;  1FIA A;  5D4S A;  2L7Z A;  3CCR I;  2DA6 A;  1ZLK A;  1J75 A;  3FKI J;  1JKR C;  3HXL A;  1R00 A;  3RI4 A;  1HKQ A;  2HZT A;  1GXP A;  1IRZ A;  1BR1 A;  1W5C C;  4UY8 I;  2HDD A;  3W2A A;  4BJ6 C;  3HOY J;  2GWR A;  4BE2 A;  4PDK A;  4I09 A;  2COB A;  4M3B A;  4XOT A;  1KQ9 A;  2ZME B;  1D1C A;  3HTU A;  1E3H A;  3ELK A;  4GXO A;  4GFB A;  5C44 J;  2OJE D;  2UUZ A;  1S7E A;  2O03 A;  5FLX Z;  2CUJ A;  3BG5 A;  4M6Y A;  2EH3 A;  3HGY A;  2Y9Z A;  4B43 A;  4R1H A;  2EIN H;  3I53 A;  4RDU A;  2FUG 2;  2XSD C;  4BUP A;  4AIH A;  3QPL A;  5DCF A;  2KL4 A;  2KZV A;  5ICG A;  5AIP A;  3IKT A;  3H5N A;  2M8G X;  1XGO A;  1I5Z A;  1K83 J;  2IA1 A;  2X0L A;  1ZN2 A;  2F4I A;  3FXO A;  2YSR A;  3S93 A;  1YIO A;  3J7Z I;  1Z3Y A;  1QVU A;  4XRS A;  3JTG A;  3O8H A;  3BY6 A;  2ZXW H;  3QAH A;  1G59 A;  4EGY A;  2IS4 A;  2G7U A;  3Q9S A;  3F9K A;  3LFK A;  3DF8 A;  5DM6 F;  2VT3 A;  1W7P D;  3G3Z A;  2OQR A;  4XSZ F;  4UV9 A;  1YG2 A;  2Y31 A;  2XAQ A;  2EFN A;  2QCO A;  1T33 A;  3PNT A;  2LY2 A;  2Y0S A;  4AVZ A;  1OCO H;  2KJB A;  1R6R A;  3FK6 A;  5F6F A;  1W36 C;  3GF2 A;  2FF4 A;  3P9C A;  2M0C A;  1W0U A;  1LFB A;  5AIQ A;  2EIJ H;  4U7B A;  4BE1 A;  3CCV I;  1W4M A;  1FTZ A;  3NWT A;  4DJA A;  1AOY A;  3E5X A;  2ZSH B;  2K9M A;  5FKK A;  4EJT A;  2M1B A;  2IGK A;  3HKZ A;  4IXA A;  2XAU A;  1S9H A;  5JFR A;  3AG4 H;  3BQZ A;  3ECH A;  1LFP A;  1SAX A;  1ZRC A;  2M87 A;  2P81 A;  1E2X A;  2RGV A;  2R7O A;  2R7R A;  3W2W A;  3S1N J;  3OSG A;  2IS6 A;  3E6D A;  3TDZ C;  2NXN B;  5HDN A;  1S5L C;  3ROU A;  1GLN A;  1POG A;  1BIA A;  3CQZ J;  4BXU A;  3LST A;  4G7H F;  3HPH A;  2KIQ A;  2JA6 J;  1OCZ H;  3DKW A;  2QVO A;  2F5D A;  3GLL A;  3ABT A;  3S1Q J;  5K1Y A;  3KPH A;  1ZG3 A;  1M1E B;  1MH3 A;  1YJ9 I;  5E1W A;  3TKY A;  4BQA A;  3FXR A;  1T56 A;  3J7A Y;  2VN2 A;  2X6W A;  1V3F A;  3E6M A;  1G6N A;  2W57 A;  3TO7 A;  2HYG D;  2PN6 A;  1G8X A;  4N9H A;  2HOT A;  2VAS A;  2FRH A;  3OYB A;  3TO6 A;  1B9M A;  1IN5 A;  3AG3 H;  2CW8 A;  3SHF A;  5E3N A;  4RGR A;  5F0F A;  5GTH C;  1A6Q A;  4IOC F;  5J40 A;  2QGU A;  4HYE A;  4KIT B;  2VKD A;  3QYE A;  4LLG F;  3AG1 H;  2KIU A;  2ZJ2 A;  1CQT A;  1D1A A;  4A2U A;  4X1E A;  4D7N A;  1T6S A;  2R0Q C;  1Y1V J;  4IPA A;  4N0B A;  5B1A H;  1YI2 I;  5TRD A;  2QSF X;  1WSU A;  2DA1 A;  2YX4 A;  3FMS A;  2H27 A;  4DYC A;  1T2K A;  4HLY A;  4QPQ A;  3PUB A;  4NC6 A;  2QUF A;  3L09 A;  2BE5 F;  5HOO A;  1ITY A;  1X3W B;  3G6E I;  4Y4R A;  2CV1 A;  1TT0 A;  1P92 A;  1KU3 A;  3LSH A;  3MZY A;  3ASO H;  2EIK H;  5D5V B;  2V4J C;  3SJM A;  4YIR X;  4XIC A;  1RKT A;  5GAD J;  5TGT A;  2P5L C;  1YIJ I;  1K4S A;  1HKT A;  2FU4 A;  3K4L A;  2XIG A;  1JUM A;  2NAZ A;  2IVM A;  4E7H A;  4A3F J;  4HV5 A;  1T8I A;  1HA8 A;  1P4X A;  5K7Z A;  2M34 A;  3KLN A;  3BR1 A;  5D6F A;  1N77 A;  3H9J A;  2DFH A;  4NQW A;  3V8J A;  4M3G A;  1Y6I A;  1U9O A;  2BXY A;  5HNF A;  3GTP J;  4NDL A;  2D2W A;  1R1U A;  1UZC A;  1XDS A;  1BC8 C;  2M30 A;  3ZMD A;  4A5M A;  4UV8 A;  1ODD A;  4DYR A;  1WI3 A;  4F3Q A;  4C30 A;  4XON A;  4CH7 A;  5LGT A;  1WJB A;  4E7I A;  1MJA A;  1ZRD A;  3GO5 A;  2F5C A;  2LVS A;  2DU9 A;  1FC3 A;  3EUK L;  3RQ4 A;  3ZRG A;  5EGO A;  3TL4 X;  4PZJ A;  2FQ4 A;  3BR0 A;  2EA2 A;  3Q3S A;  1SD4 A;  3CZ6 A;  2HVQ A;  2MLG A;  4XRF A;  4E7K A;  3DPU A;  2OU2 A;  5DCM A;  1JKP C;  1W7P B;  2V7F A;  2Q2E A;  1SD5 A;  2A07 F;  4M3D A;  3E97 A;  1X2N A;  4RGU A;  1DUX C;  2WAQ N;  1PUF B;  2E34 A;  2XGX A;  5L3B A;  5E18 F;  2ADU A;  3IP4 B;  2FBI A;  2V6C A;  2W7N A;  2LF7 A;  2OQG A;  2HQ5 A;  1DGR M;  1FMW A;  1EV7 A;  1UJ8 A;  1YS6 A;  4FCY A;  4PCQ A;  1ETQ A;  4ZYH A;  4AC0 A;  1BJZ A;  3GTL J;  4P55 A;  3LQQ A;  1YLF A;  4ZYG A;  2IEK A;  1IJW C;  4DIQ A;  2ZME A;  2XRN A;  2HYF A;  2XF7 A;  1JKO C;  3BJA A;  5E1Z B;  2V1U A;  4LG3 A;  1MSE C;  3ABL H;  5HLH A;  3JAM Z;  2BW3 A;  4ZC3 A;  2DI3 A;  2QKL B;  1U5T B;  5K5R A;  1FYK A;  2ZXI A;  3H92 A;  2R7U A;  2AXT C;  5ICE A;  3PNV A;  3CES A;  4U0W A;  4XLA A;  4I99 C;  4A0X A;  3TBI A;  4QLC U;  1FT9 A;  2DO7 A;  3IH2 A;  1ZLJ A;  3BG6 A;  1TL8 A;  4ZDP A;  3HBL A;  5EEG A;  4E4H A;  4KIF A;  2DAO A;  4XLP F;  2R7S A;  1I6X A;  5D8K B;  4RM3 A;  1I27 A;  4M3E A;  2FJ1 A;  3OYM A;  4BAY A;  2V26 A;  3KLO A;  1IG7 A;  4ENJ A;  5H6R A;  1D0Y A;  1XCB A;  3PFI A;  3G73 A;  5ILS A;  3VB2 A;  1MMS A;  3RIR A;  1QZE A;  3ZR8 X;  2ME0 A;  2XPV A;  2CYY A;  2KFD A;  2MFZ A;  3CO6 C;  1U9N A;  2L7F P;  1MKM A;  4L5J A;  3L7W A;  4RAY A;  3A0H C;  2RV8 A;  1VQN I;  3BCA A;  3OOP A;  1UCR A;  3HYI A;  4XNF A;  3R6S A;  3CF2 A;  3C1D A;  2EFW A;  1Z9C A;  4U88 A;  3ZOB A;  2O0Y A;  2VB6 A;  2Z5U A;  3P9K A;  2BVM A;  1R9T J;  3S1R J;  1K6O A;  1B72 A;  2GLO A;  1OR7 A;  2X9D A;  3C7J A;  3ERE D;  4IO9 F;  4AM3 A;  3VWB A;  5IP9 J;  5DUI A;  4C3H J;  2XVC A;  2VBZ A;  4PSW A;  4M6V A;  1YW9 A;  2OTL I;  4LGW A;  3BTL A;  4I98 B;  3EUH A;  1X1P A;  5JVT A;  4D7M A;  1H9G A;  3I59 A;  2L7M P;  2HTS A;  1MBH A;  1FY7 A;  3KEQ A;  4JX4 A;  3T0Y A;  1JT0 A;  1QO0 D;  3FXJ A;  2DT7 B;  4LLL A;  4IJA A;  4XK4 A;  1BA5 A;  5BPD A;  2ZFU A;  4LIV A;  4UUS A;  2H1L A;  2K7L A;  4RM2 A;  2W4S A;  2VQC A;  1SEU A;  2DCE A;  4PSX A;  5CVU A;  1L3L A;  1J59 A;  2DOD A;  1F1Z A;  1B4A A;  1QHG A;  3MKL A;  4YEJ A;  2M7B A;  2Y2Z A;  3WTS C;  1Z7L A;  3HRM A;  2IRF G;  3ZQ7 A;  2RKH A;  3FXM A;  4BAC A;  2R7W A;  4B44 A;  2VC1 A;  2DT5 A;  3PIO F;  1OYI A;  1XCV A;  1SD6 A;  3DBR B;  1N78 A;  4JK1 X;  2H1K A;  2VJ5 A;  1X2M A;  3OYI A;  1ZTR A;  2OC6 A;  5A2Q K;  1AHD P;  1FBU A;  4CCJ A;  1LNW A;  1J0R A;  4A12 A;  2BBY A;  3Q9V A;  4MTD A;  3CUQ B;  5E8I A;  3K9T A;  5HVQ C;  3JTH A;  3OL4 A;  2Y30 A;  4EM1 A;  2PJP A;  2X48 A;  5EYR A;  3KP5 A;  1T95 A;  4O5V A;  3J7A O;  2HEO A;  3W6K B;  1WCM J;  5J8F A;  5IYB J;  3W3C A;  4XRM A;  2L2O A;  2F6C A;  1JGG A;  1R4N B;  2A6T A;  4XKW A;  2GM4 A;  1IV6 A;  2XB5 A;  3VYU B;  1KQ0 A;  2E7W A;  1FSE A;  1FP2 A;  3A0B C;  2VLA A;  2L01 A;  2WY8 Q;  2IBD A;  4GDF A;  3S15 J;  1S7O A;  4LD5 A;  1G3Y A;  3JRA A;  3C3W A;  2NOG A;  5IY5 H;  1ZYR F;  2M45 A;  3EYI A;  3LSJ A;  3HPG A;  2I8D A;  1MMN A;  2LLK A;  1BM9 A;  2WV0 A;  2IXS A;  3HHG A;  2LTP A;  4JX5 A;  3WTX C;  4QTR A;  3I56 I;  5JVG F;  4L9J A;  1ZK8 A;  4H4K C;  4PJM A;  4I0B A;  2EZI A;  3DWL E;  5E1X A;  2JUG A;  3J80 K;  3J81 Z;  3SYT A;  3C2B A;  2VPR A;  2MGQ A;  3LFU A;  1LDJ A;  2XAG A;  2JSP A;  2ID6 A;  4XSX F;  1XPX A;  3RJP A;  3NAU A;  4M74 A;  2BYV E;  4G9Y A;  3K2Z A;  1TT5 B;  2IS1 A;  5LHI A;  1VQ4 I;  4IQ4 A;  3B73 A;  5DTD A;  3QP6 A;  4AD9 A;  5IYD J;  1X1D A;  1FYL A;  1MDM A;  2R7D A;  1IXS B;  4CYC B;  1DGW Y;  3KEY A;  3HC7 A;  2IGN A;  4G6T B;  3WHB A;  1YIT I;  3OS0 A;  1EH6 A;  4OMZ A;  1VND A;  3BC8 A;  5GPA A;  5E17 F;  3L2V A;  2HPM A;  3JRD A;  3VYR B;  1ZG1 A;  1UHM A;  2ETH A;  1K61 A;  3FMR A;  4AIJ A;  2XGE A;  4F93 B;  4PJN A;  3BZ6 A;  2Z99 A;  5D6E A;  1XS9 A;  3KCC A;  3C18 A;  2QQ8 A;  3WOD F;  2RQP A;  5K5Q A;  2DK5 A;  2W24 A;  4C2T A;  1N75 A;  1H0M A;  2HKX A;  4ZDO A;  3EET A;  2JA2 A;  1X1C A;  4IRH A;  2EIM H;  3OOU A;  3FBI B;  2ZXJ A;  1J2X A;  1HSJ A;  3ECO A;  2DMU A;  3IAS 2;  4Q4Z F;  2DFF A;  3F21 A;  1W5S A;  5EG0 B;  2GXB A;  1B9N A;  3PM1 A;  1UHS A;  3BLY A;  2EZH A;  2LBF A;  2LG4 A;  2JTV A;  3PUF A;  1IC8 A;  1OIS A;  4IHY A;  1UB9 A;  3SFZ A;  3D1N I;  3K70 C;  3IV5 A;  4NUB A;  1I3Q J;  2A3S A;  3RKX A;  1V5F A;  2JK3 A;  3KP2 A;  2R5Z B;  3AAF A;  3LSK A;  2EK5 A;  2CJJ A;  1Y39 A;  2WB1 N;  2JN6 A;  3BG9 A;  1GVJ A;  2VOD A;  1JJ8 C;  1WJC A;  4IL6 C;  3I4P A;  1JI8 A;  1U3E M;  2OF7 A;  2RNG A;  4PFO A;  2RRE A;  2EA4 A;  2P7V B;  2YX7 A;  4V2G A;  4M6X A;  1VQO I;  4CYD A;  3IRQ A;  2EV5 A;  1XSV A;  4L0Z B;  1QHH D;  4O6J A;  2DTR A;  2V9V A;  3BR2 A;  2R7Q A;  3ZPL A;  4BXF A;  2RQQ A;  1UHW A;  1U8B A;  1IN8 A;  1FX7 A;  3CJT B;  3KP7 A;  3JCU C;  3SZT A;  4EGZ A;  1T0F C;  2DMP A;  1R4M B;  2MH2 A;  1RZ4 A;  1SFK A;  3O6B B;  2JRM A;  2NOJ B;  4NB5 A;  4AYB A;  5TIS C;  2IP2 A;  4Y33 A;  1LEB A;  3OV8 A;  2O8K A;  2ESN A;  4U0Y A;  2KHM A;  2CGP A;  3K4K A;  3Q0W A;  2X1C A;  3TOA A;  2O3F A;  2H6C A;  1WWX A;  1Z7U A;  2X1D A;  1P4W A;  3TP0 A;  5KHD A;  4LFU A;  4HNT A;  2CV0 A;  3IH3 A;  5FKM A;  4UUT A;  2EZL A;  3WGG A;  5FO5 A;  5J47 A;  5HLG A;  3P5J A;  2Q8K A;  4MQV A;  4XOP A;  3JRE A;  1LEA A;  2JQ7 A;  1TW2 A;  5H20 A;  3GVA A;  3HJE A;  4PUS A;  1QPM A;  2TCT A;  1H88 C;  2BVL A;  3TMO A;  2R7V A;  3H3Z A;  3ZGK A;  2MD5 A;  2H09 A;  2ELK A;  1J09 A;  3VYS B;  3AKZ A;  3K4B A;  3LSM A;  3S3M A;  1WI9 A;  2W82 A;  2LOO A;  3GEZ A;  5FJ8 J;  2VPL A;  3L00 A;  1RNL A;  3BR3 A;  4JOM A;  2VC0 A;  3VFZ A;  2EPF A;  1IXC A;  1MMD A;  4CCK A;  1BW6 A;  2QSH X;  4KYW A;  4IX7 A;  1CGP A;  2XGC A;  4X0G A;  2E5N A;  1IO2 A;  2E1C A;  3ZQF A;  3B02 A;  4KIC A;  3CDH A;  4B4C A;  1S3J A;  3BPV A;  4PFP A;  4E7L A;  1VF9 A;  3JRG A;  1HOM A;  3I5U A;  4BE0 A;  1ULY A;  5C3E J;  3GFI A;  2IT0 A;  2DJN A;  3HZJ A;  1Z6T A;  3RKY A;  1PP7 U;  4WXD A;  2WA0 A;  1FTT A;  2PMZ A;  2M2E A;  4UUV A;  2ZSI B;  2DPU A;  2LK2 A;  2G9W A;  1P7J A;  1YTY A;  1HLV A;  2B63 J;  3MD2 A;  3REO A;  2KJC A;  3FXU A;  2MW8 A;  4C9Y A;  1K79 A;  1ZAR A;  4CCM A;  2DBB A;  1LE8 B;  4BU2 A;  1OYW A;  2RN7 A;  1SMT A;  2MH9 A;  1BR4 A;  3C2H A;  3EPZ A;  2KMU A;  1JUS A;  1WRJ A;  3CJR B;  3TP3 A;  5J1Y A;  2FBH A;  1R1T A;  3PSF A;  4QSH A;  1XD7 A;  2JUC A;  2AXL A;  1HXD A;  5LD2 C;  2CSO A;  2KRH A;  4EM0 B;  3CO7 C;  2EFQ A;  1R36 A;  3IKV A;  4OIR F;  2BY2 A;  2E60 A;  1GHC A;  2LSO A;  1VQM I;  2FMY A;  3A01 B;  4KFC A;  2KP6 A;  3HUG A;  1WVR A;  4LOC A;  4FAS D;  4YIF A;  3ZQQ A;  4RLQ A;  3CF5 F;  1U5T C;  3PSI A;  1IXR C;  2HWV A;  5JLX A;  3BZK A;  2W1O A;  1BOA A;  3GTM J;  3PL8 A;  1B8I B;  4XL9 A;  4M9X A;  2QQ9 A;  2E7X A;  3FIS A;  4JX6 A;  3LNQ A;  2C6Y A;  4BL0 B;  1WFX A;  2XC7 A;  4L9V A;  4FTH A;  2LKP A;  1A6I A;  2QZ8 A;  4LG0 A;  4FHT A;  1VQ9 I;  4BNC A;  2OZ6 A;  2VE9 A;  3FWE A;  4RB1 A;  5FLX K;  2IJL A;  3HOV J;  4RB3 C;  2CWE A;  4RBO A;  3WG7 H;  2K27 A;  2VKV A;  5FFX A;  3BR6 A;  4LJZ F;  4YII A;  3RYP A;  1APL C;  1HKS A;  1HCR A;  3K10 A;  2WAE A;  3WHC A;  3S32 A;  2M3A A;  4K2E A;  4HEA 2;  5EG0 A;  2Y69 H;  5DUK A;  4QPO A;  4U0V A;  2PI0 A;  2ELJ A;  2NVX J;  2KRC A;  3GLX A;  3M9A A;  3ZCO A;  3OYA A;  3A03 A;  2ZJR F;  1F4K A;  3BDD A;  3MFK A;  2DDB A;  2DYS H;  2XKP A;  4F7Z A;  2L4A A;  2FEZ A;  3HRU A;  3S2W A;  3FMQ A;  5FD5 A;  3FM5 A;  4E7J A;  3QWL A;  1LFU P;  1HBX G;  3LOC A;  5JLW A;  1HW5 A;  2BHZ A;  2L0K A;  2MA3 A;  2PBI A;  2Y48 A;  3CUO A;  4KUM A;  2VBY A;  3FF5 A;  3ESW B;  3SZP A;  4DBQ A;  3CCJ I;  3QQA A;  4HDU A;  4IZZ A;  2QLZ A;  4WXH A;  3HOS A;  3KE2 A;  2VXD A;  3JSO A;  4PK4 A;  1I50 J;  5E79 C;  3TGN A;  3QPT A;  2V1N A;  5LGU A;  4G6D A;  4RGS A;  3ZQC A;  2ELH A;  1E3P A;  4PJ0 C;  1ON1 A;  4G12 A;  3E5Q A;  1NG7 A;  1DPR A;  2P5V A;  2NVT J;  3H0D A;  5L3C A;  5M3F J;  1K4T A;  2JA7 J;  1XGM A;  1OCT C;  3ISP A;  5IPA A;  3FM3 A;  3HOX J;  3P7N A;  2WV1 A;  2DFE A;  2ID3 A;  4LB5 A;  4XN3 A;  3HRS A;  5ERI A;  2CQ7 A;  5CQG A;  5FKO A;  2JVH A;  5E3M A;  3KP6 A;  3D5S C;  4IEJ A;  1LKX A;  3DBH B;  1TNS A;  1YW7 A;  2DXI A;  3OS1 A;  2CO5 A;  2ESH A;  1IRX A;  1MGT A;  5J1R A;  2EFO A;  2QKM B;  2TDX A;  3GTJ J;  4BEH A;  3F8C A;  2DJI A;  4ZYE A;  1KYZ A;  3K1M A;  2PQ8 A;  3CUQ C;  2VQL A;  4OWR B;  3ZMV A;  4MIM A;  1E17 A;  2EIL H;  4I02 A;  3BPX A;  2ZJP F;  4GYG A;  4H0E A;  1O3T A;  3FIW A;  1R5I D;  4ESJ A;  1FYM A;  2K40 A;  1OJL A;  1AKH B;  1DP7 P;  5LRR A;  4BY7 J;  2OTJ I;  4MEX F;  2XRO A;  1RUN A;  2DMN A;  2DOF A;  2DA3 A;  1U8R A;  2VJI A;  2E1O A;  3RKQ A;  1G3T A;  3VOD A;  2E1M C;  5C4J J;  1WPK A;  2O61 A;  3PFY A;  2DA7 A;  2VBX A;  5JHF A;  2F2E A;  1S29 A;  5EZG A;  2HVR A;  1E3O C;  1ZAO A;  4CSW A;  3F6O A;  1BI0 A;  1WJE A;  2BHY A;  2MSY A;  4ETS A;  4OIP F;  4HSR A;  2GIV A;  3MCZ A;  1QPI A;  3QP5 A;  2DA5 A;  1ETY A;  4GCV A;  5F27 A;  1MMA A;  2CUZ A;  1MZB A;  3OSF A;  2CU7 A;  1Y8Q B;  4OIO F;  2CRG A;  5DD4 A;  3HOW J;  4JYK A;  3I4M J;  1D8K A;  5H2F C;  4BBR J;  2JPC A;  5E20 A;  4XQF A;  3DEE A;  3DBL B;  3CJQ B;  2XUB A;  3SDB A;  1YFH A;  1YQA A;  1TBX A;  3KIO A;  2BZT A;  2RVC A;  4HF0 A;  4XMY A;  1IN7 A;  1P9Q C;  2EJR A;  3CCL I;  3OYD A;  2L5Q A;  4UVA A;  1QVT A;  4MLO A;  5LEJ A;  2ZJQ F;  3VSK A;  3JRB A;  2R5Y B;  4OIN F;  3GBG A;  3HHH A;  2COM A;  2ECB A;  3V8K A;  1WZ2 A;  5B5E C;  3CDL A;  2CQQ A;  2Z33 A;  4N9I A;  3CLO A;  1KU7 A;  1QA6 A;  3F0C A;  5K7F A;  3DPL C;  1RPW A;  4KMF A;  2WAQ A;  1Y56 A;  2LRD A;  3OY9 A;  1G4D A;  2KIF A;  4CZZ A;  2QA4 I;  3ZXS A;  1FWZ A;  3H3U A;  5BNG A;  4AU7 A;  5IYC J;  3ZP5 A;  3PQJ A;  3QOP A;  3DEU A;  3QYF A;  2K9Q A;  1KQ8 A;  5B3S H;  3OYL A;  1GDT A;  2NNN A;  5M5W J;  2GXG A;  4HRI A;  4HF2 A;  2X85 A;  1D3Y A;  2EV6 A;  4HX4 A;  2HU9 A;  1BI2 A;  2R7T A;  5FLM J;  1TQP A;  1Q1H A;  3UR3 C;  3GTO J;  4IOA F;  1C0W A;  1A31 A;  2AHQ A;  4G7O F;  4MFD A;  3DCF A;  3MKZ A;  3DV8 A;  4QIW N;  4HQE A;  5BMZ A;  3DU5 A;  3M07 A;  5IP7 J;  4XLC A;  2DOA A;  4U87 A;  2TRT A;  2QQB A;  4P96 A;  2M5W A;  4YFN F;  1OLT A;  4S04 A;  5IT3 A;  3N4M A;  4N4O B;  3O3K A;  1I1S A;  2HQN A;  2PMU A;  2NNY A;  4ANJ A;  1D0Z A;  5KK1 A;  1YRN B;  2Z3Y A;  2ISY A;  2PJR B;  3KYC B;  2EV0 A;  3MN2 A;  4RAG A;  3KZY A;  1W0T A;  1R71 A;  3JR9 A;  5EEA A;  3M8E A;  4JBA A;  3F72 A;  3CJN A;  1RR8 C;  2X6X A;  1TTY A;  3N97 A;  2UXN A;  3JSP A;  4X6A J;  1IN4 A;  1FOY A;  4EJV A;  2AS5 F;  4RB0 A;  3JAM K;  4NHJ A;  1VQ8 I;  3ZN1 A;  1UFM A;  2LY9 A;  5ILV A;  1U2W A;  5CQE A;  1TNT A;  2JVG A;  2YUS A;  3H35 A;  5IP6 A;  1KYW A;  1ZGJ A;  5J4V A;  4ASN A;  2HOS A;  2FE3 A;  1R49 A;  4MTE A;  1KGS A;  1OFC X;  3H5R A;  1V55 H;  3GTG J;  3HRT A;  3HOU J;  4B48 A;  5FKN A;  2IA0 A;  3P9I A;  2W25 A;  9ANT A;  1IRG A;  4KDP A;  2XKO A;  3QOD A;  3HTS B;  3PO3 J;  1ETO A;  1HW1 A;  3O8G A;  3VPR A;  2ZO4 A;  5AON A;  4L18 B;  1HST A;  2D5V A;  3FXK A;  1PP8 F;  4A3I J;  5ILU A;  1PUE E;  1T0F A;  4DNC A;  2OZU A;  2PG4 A;  3TOB A;  5CJ9 A;  4A3G J;  5FRO A;  2GAU A;  1TWG J;  1G3S A;  2DW4 A;  1XGN A;  4WXC A;  4BQO A;  3CCM I;  1ON2 A;  4F92 B;  3W2V A;  4BGD A;  3QRF F;  1JHH A;  1S7A A;  2W00 A;  5F1J A;  4HA8 A;  4DBR A;  5L3F A;  2JA8 J;  4ESF A;  4Z6Y A;  3U21 A;  3OYF A;  3TED A;  2CH0 A;  4I6Z A;  3K2A A;  1Z1D A;  1WJF A;  4RB2 C;  3S16 J;  3L2Q A;  3BTC A;  4MFE A;  1H8A C;  5GTI C;  4C2U A;  1UG2 A;  1J7K A;  1GUU A;  2AO9 A;  2OA4 A;  2RC4 A;  3J80 Z;  1SC7 A;  2PLY A;  1BJA A;  1WQ2 A;  2FBK A;  2EBI A;  2L4M A;  1DDN A;  5FRN A;  1MNE A;  1YX5 A;  1ZHF A;  2F48 A;  2IGM A;  2ZKZ A;  3HIF A;  4B3A A;  3WTT C;  3ZN0 A;  2WY7 Q;  3T8R A;  3F8M A;  3CDI A;  3R4K A;  2E1M B;  2HPI A;  2UXX A;  1NH3 A;  1LVK A;  4EV0 A;  4J19 A;  2ZFW A;  1Z05 A;  3QPH A;  5IT9 K;  2CQX A;  4A6D A;  2B9S A;  4GO1 A;  5HDG A;  3V7S A;  2A5W A;  4A3M J;  2GZW A;  2VON A;  2LC2 A;  1PDN C;  3MMY B;  4NC7 A;  3RTR A;  2IS2 A;  3N05 A;  2JT1 A;  2D1H A;  3WTY C;  4IHS A;  1F9N A;  3CMY A;  4CA0 A;  5M5Y J;  4WCG A;  3SZG A;  3OIP A;  3DEW A;  3DKY A;  2STW A;  4WK8 F;  4XN0 A;  4BHP A;  1O7F A;  2KZG A;  3NEU A;  1R22 A;  3A4C A;  4HX8 A;  2FQ3 A;  1FBQ A;  1XG1 A;  2MBF A;  4C3I J;  2H8R A;  2XAF A;  3H3V K;  4MQ9 F;  1VQK I;  5HS9 A;  3OIQ A;  1QZY A;  3G4S I;  1DU0 A;  3IHU A;  1OPC A;  5CVI A;  4CCN A;  5M5X J;  3PIP F;  3TQN A;  1SVL A;  4XRS G;  3E6B A;  2E35 A;  3HSR A;  3MZ8 A;  1BOB A;  2JPB A;  5GPC A;  2O9L A;  5GAE J;  1SFX A;  4MHG A;  4XID A;  4BY1 J;  2Y0M A;  2HXI A;  2ISZ A;  2CG4 A;  4HBL A;  1X4O A;  3QPS A;  5CVJ A;  1H9T A;  1TWH J;  3KET A;  1HDP A;  3J7Y J;  2NS0 A;  2OBP A;  3R60 A;  3I54 A;  4G8X A;  4ZH4 F;  1JXS A;  2E2I J;  1FP1 D;  2A6E F;  1X19 A;  1ZH5 A;  3JRC A;  3DFG A;  1KU2 A;  1ETW A;  1P6R A;  1W7P A;  4E6K G;  3A1Y A;  3J81 K;  2XF6 A;  4A6E A;  2FA5 A;  4D5F A;  1PUF A;  5CYV A;  1R5G A;  5F08 A;  3S3N A;  4KN4 X;  3ABM H;  4CIC A;  4U7D A;  3RPU A;  1L0O C;  5ED4 A;  4DOZ A;  2V6E A;  4A3C J;  3GFL A;  2V1D A;  1X1A A;  3HB9 A;  4BHB A;  4RGX A;  4RLF A;  2CUF A;  1OKR A;  4EJU A;  2DN0 A;  2ECC A;  4FQG A;  4BXX J;  1V54 H;  2GOM A;  4CDG A;  4F55 A;  4P5O A;  3JRF A;  2Y75 A;  4BKX A;  3LL7 A;  4RAF A;  1U5T A;  3IWF A;  2J5O A;  2Y9Y A;  1ZG5 A;  2XPW A;  2P8T A;  1Z67 A;  2IPQ X;  3S1M J;  1W1W E;  4YRV A;  3NQO A;  2CFO A;  4F52 A;  2GXA A;  3VSL A;  1V5G A;  2VT2 A; 
#chains in the Genus database with same CATH homology
 2DLL A;  1O57 A;  5K5O A;  2LDU A;  1B6A A;  5FD6 A;  4ESB A;  3LA2 A;  1ZGA A;  1J5Y A;  2UWM A;  2L54 A;  4M9Z A;  4G94 A;  1P2F A;  5HLI A;  1R1V A;  4HF1 A;  5DD8 A;  4A5N A;  4KT5 C;  4B8X A;  4ENK A;  4LMY A;  4L9T A;  4PGH A;  1XGS A;  1P4A A;  1B59 A;  3BJO A;  4M71 A;  4RAZ A;  3Q5F A;  1F5T A;  1QGP A;  2JZY A;  1U78 A;  3D5L A;  3L9F A;  2ZNZ A;  3KZZ A;  4M72 A;  2ACJ A;  1UST A;  1FPQ A;  1IW7 F;  1TQM A;  4ENM A;  1BI3 A;  1BC7 C;  4KNY A;  2NYX A;  1AWC A;  1RIO H;  5E8G A;  2HQR A;  4Q47 A;  2IW5 A;  3LAJ A;  2YPR A;  1SD7 A;  4MEY F;  5LHH A;  3FHZ A;  2LF8 A;  4UNO A;  3LA3 A;  3VOE A;  3K69 A;  3CUQ A;  3GZ5 A;  2H94 A;  3WE2 A;  2RNJ A;  3MEX A;  4CHU A;  3I0T A;  4L5I A;  1IF1 A;  4AIK A;  4D0P A;  1YYV A;  3GX4 X;  4EMS A;  5HS8 A;  1I1G A;  5DCM B;  2VOP A;  5L3G A;  3V8L A;  5BQT A;  1O7L A;  5LLQ A;  2VOO A;  4KIG A;  3K0L A;  1BIB A;  2L3D A;  5LGN A;  3DQV C;  5CLS A;  2XHK A;  4HV6 A;  2ZBK A;  2HOE A;  3TO9 A;  5TJJ A;  3KEO A;  2DQR A;  1XN7 A;  2J5P A;  1IZ1 A;  4I2O A;  4OIQ F;  4RS8 A;  3ZMU A;  4ZZD A;  2M8E A;  3KP3 A;  1K7A A;  1MJ9 A;  5JI6 A;  2PMH A;  2P7C B;  2HDC A;  1T38 A;  1K78 B;  1IAW A;  2FXA A;  1S8N A;  5FB2 A;  4HAM A;  2PEX A;  4BH9 A;  2JSC A;  2B0L A;  2X4H A;  3RYR A;  4KIB A;  3F8N A;  2NRA C;  5FGM A;  6PAX A;  2A68 F;  4LK1 F;  3DPT A;  2DFI A;  4MGR A;  4WWC A;  3BWG A;  1TW3 A;  2YU3 A;  2VBW A;  5J8C A;  3RDI A;  5LHG A;  2A61 A;  3GW2 A;  3FZV A;  1X3U A;  1SFE A;  2QBY B;  4EJO A;  5BOX A;  3I59 B;  2BEO A;  4I01 A;  3D0S A;  5KVR A;  2V1X A;  1MD0 A;  5JR3 A;  3DP7 A;  4HX7 A;  4UXN A;  3T5X A;  2G7H A;  3WE3 A;  2DQL A;  2MC3 A;  2FNA A;  2OD5 A;  3WGH A;  4LK0 F;  1BN5 A;  2JRT A;  2QYO A;  4EJW A;  2VE8 A;  5L3E A;  1QNT A;  3ULQ B;  3MQ0 A;  2K4B A;  4P9U A;  1QZZ A;  4BYY A;  3DXJ F;  3HSF A;  2A6H F;  3E6C C;  2V79 A;  5ICC A;  4JQF A;  1S6L A;  3M8F A;  1TQI A;  3GWZ A;  4E70 A;  1W5T A;  4IRG A;  4GGG A;  2WTE A;  1EH7 A;  5D5X B;  3U1D A;  4CGZ A;  3T8T A;  2K86 A;  4A0Z A;  5H6Q A;  3F22 A;  1D5V A;  4KMU X;  4HLX A;  3U9G A;  4UVC A;  1MDM B;  3GFJ A;  2EFP A;  3EQL F;  3WTZ A;  1XSX A;  1G3W A;  2HS5 A;  3KFW X;  3GXO A;  1BI1 A;  3HOT A;  1LB2 A;  3WG9 A;  4IVN A;  3LAP A;  3ML6 A;  4FT8 A;  3WU1 B;  1KA8 A;  1IN6 A;  3TDU C;  1WKM A;  4M73 A;  5J6X A;  2LNB A;  2EWN A;  2OAZ A;  4HW0 A;  4HQM A;  3LQR A;  1SFU A;  2CFX A;  4IF4 A;  1CF7 B;  2O8X A;  2HGC A;  1FBS A;  2F5F A;  1O3R A;  2BV6 A;  3WU0 A;  3T1B A;  2XAH A;  4S05 A;  2KRF A;  4WF2 A;  1R5H A;  3MZH A;  3WTU C;  4BHC A;  4O3M A;  3BJ6 A;  1K78 A;  4FX4 A;  2WC2 A;  3GYH X;  1O3S A;  5D8L B;  4M9S A;  4PGG A;  4YFK F;  1OMI A;  4Y15 A;  1NHA A;  2DK8 A;  2XV4 S;  1LQ1 A;  1LJ9 A;  3R0A A;  5JHU A;  2FML A;  1JE8 A;  3F6V A;  2A5Y B;  2KKO A;  3COA C;  2KIM A;  1IUY A;  4LLN A;  2D1V A;  3L2C A;  1T98 A;  4YG2 F;  4OMY A;  1FLI A;  5D5W B;  2IA2 A;  4Q48 A;  5A2Q Z;  3WTW C;  1R7J A;  3M7G A;  4GYI A;  3IL2 A;  2FSW A;  3MAJ A;  3IC7 A;  3ABU A;  3U2R A;  5DDG A;  3QU6 A;  3PQK A;  4EQQ A;  2STT A;  4G7Z F;  1FOK A;  3I71 A;  3BP8 A;  2QBY A;  3RPQ A;  3GZ6 A;  2CQK A;  1XMK A;  5LBQ A;  2GA1 A;  4IHT A;  3LA7 A;  1D8J A;  5IT9 Z;  4B09 A;  5BPI A;  3LWF A;  1HQC A;  3GFM A;  3VEP A;  1REP C;  3WGI A;  3F8B A;  2Z9O A;  5CVR A;  3R0J A;  2ZNY A;  2W84 A;  5L3D A;  5DEQ A;  3V7R A;  5CVV A;  3E5U A;  2HR3 A;  2HKO A;  1USS A;  3FX3 A;  5LEK A;  2FOK A;  1ZRF A;  3WTV C;  3FXQ A;  4A0Y A;  1FSH A;  4ZYD A;  2PFB A;  4AWX B;  2MLK A;  4L0Y B;  3R61 A;  3I58 A;  3JW4 A;  4UHT A;  2QEN A;  3K1N A;  1QQI A;  4HOB A;  3W6J B;  3ZMS A;  1HW2 A;  4AVP A;  3SXY A;  3I64 A;  3EYY A;  4EVI A;  1VTN C;  4DQ2 A;  5HS7 A;  1JGS A;  1LDD A;  3GUD A;  4ON0 A;  5FFZ A;  1FNN A;  1YW8 A;  5ICF A;  1TLH B;  5LRS A;  5DV5 A;  3F3X A;  1O3Q A;  3NRV A;  2P6S A;  2QWW A;  2VXZ A;  1SMY F;  5F64 A;  2XAS A;  2ZCW A;  2Q0O A;  2K4J A;  1QBJ A;  1OYY A;  1Z91 A;  4HZF A;  4HDV A;  1A04 A;  4LG0 B;  3KP4 A;  3EDP A;  1XB4 A;  1RUO A;  4TV7 A;  5DYM A;  2L02 A;  3K1P A;  2E1N A;  4ZZL A;  2R7F A;  4I7H A;  2EB7 A;  4G6Q A;  2BGC A;  3ZMZ A;  2QM3 A;  4EM2 A;  1V4R A;  4Y13 A;  1CF7 A;  3MWM A;  5EEH A;  5HDK A;  2W85 A;  4L9N A;  1YS7 A;  2P6T A;  2UZK A;  2D45 A;  5F1R A;  1J9I A;  4R79 A;  3BOQ A;  2R3S A;  1LVA A;  1MJB A;  2WWY A;  2GA2 A;  3O2P E;  1R58 A;  1KU9 A;  4Y17 A;  4QWQ A;  3F8F A;  1T39 A;  4ENN A;  2QQA A;  1Y0U A;  3V4G A;  4Z2Y A;  1U6G A;  1XDU A;  4MNU A;  1GXQ A;  2P5K A;  4KN7 X;  4YFX F;  5BS6 A;  2GQQ A;  3QU3 A;  1XSD A;  2YR2 A;  1IRF A;  1EH8 A;  2DPD A;  2XAJ A;  3BRO A;  4XLN F;  4OOI A;  1JHF A;  4CXF A;  2F5E A;  1YO5 C;  4I0A A;  3ZMT A;  4WX9 A;  4LB6 B;  1LDK B;  4FX0 A;  3CTA A;  3F23 A;  2RDP A;  2K02 A;  2HTJ A;  2P4W A;  1DPU A;  2HFH A;  2A69 F;  3V7C A;  4Q5S F;  2H6B A;  3M1E A;  3E3V A;  1XMA A;  4R8H A;  1BBY A;  4OU0 A;  4UVB A;  4KA4 A;  4CO8 A;  2FNP A;  1Z6R A;  4XBF A;  1ZRE A;  1FZP B;  4P9F A;  3IRR A;  4IRI A;  1ONV A;  5D4R A;  2CW0 F;  3RKW A;  3HSE A;  1RI7 A;  1B1B A;  1STZ A;  3SQN A;  3IWZ A;  5D5U B;  1R23 A;  5D4S A;  1ZLK A;  1J75 A;  1R00 A;  3RI4 A;  1HKQ A;  2HZT A;  1GXP A;  2GWR A;  4PDK A;  4I09 A;  1KQ9 A;  2ZME B;  3HTU A;  3ELK A;  4GXO A;  2O03 A;  5FLX Z;  4M6Y A;  4R1H A;  3I53 A;  4AIH A;  5DCF A;  5ICG A;  5AIP A;  3IKT A;  1XGO A;  1I5Z A;  2IA1 A;  2X0L A;  1ZN2 A;  2YSR A;  1YIO A;  3JTG A;  3BY6 A;  3QAH A;  4EGY A;  2G7U A;  3Q9S A;  3LFK A;  3DF8 A;  2VT3 A;  1W7P D;  3G3Z A;  2OQR A;  4XSZ F;  4UV9 A;  1YG2 A;  2XAQ A;  2EFN A;  2KJB A;  5F6F A;  3GF2 A;  2FF4 A;  3P9C A;  5AIQ A;  4U7B A;  1W4M A;  1AOY A;  3E5X A;  4EJT A;  2M1B A;  4IXA A;  5JFR A;  3ECH A;  1SAX A;  1ZRC A;  2M87 A;  1E2X A;  2RGV A;  3E6D A;  3TDZ C;  5HDN A;  3ROU A;  1BIA A;  4BXU A;  3LST A;  4G7H F;  3DKW A;  2QVO A;  2F5D A;  3ABT A;  5K1Y A;  1ZG3 A;  5E1W A;  3TKY A;  4BQA A;  3FXR A;  2VN2 A;  1V3F A;  3E6M A;  1G6N A;  2W57 A;  3TO7 A;  2HYG D;  2PN6 A;  4N9H A;  2FRH A;  3TO6 A;  1B9M A;  1IN5 A;  3SHF A;  4RGR A;  4HYE A;  4LLG F;  2KIU A;  2ZJ2 A;  4A2U A;  1T6S A;  4IPA A;  4N0B A;  5TRD A;  1WSU A;  3FMS A;  2YX4 A;  2H27 A;  1T2K A;  4HLY A;  5HOO A;  2QUF A;  3L09 A;  2BE5 F;  1P92 A;  1KU3 A;  3MZY A;  5D5V B;  2P5L C;  1HKT A;  2FU4 A;  2XIG A;  2NAZ A;  2IVM A;  4HV5 A;  1P4X A;  3KLN A;  5D6F A;  4NQW A;  3V8J A;  2D2W A;  1R1U A;  1BC8 C;  1XDS A;  2M30 A;  3ZMD A;  4A5M A;  4UV8 A;  1ODD A;  5LGT A;  1MJA A;  1ZRD A;  3GO5 A;  2F5C A;  2DU9 A;  1FC3 A;  4PZJ A;  2EA2 A;  1SD4 A;  2MLG A;  4XRF A;  2OU2 A;  5DCM A;  1W7P B;  2Q2E A;  1SD5 A;  2A07 F;  3E97 A;  4RGU A;  1DUX C;  2XGX A;  5L3B A;  5E18 F;  2ADU A;  2FBI A;  2V6C A;  2LF7 A;  2OQG A;  1EV7 A;  1YS6 A;  4PCQ A;  4ZYH A;  4P55 A;  3LQQ A;  1YLF A;  4ZYG A;  2ZME A;  2XRN A;  2HYF A;  3BJA A;  5E1Z B;  2V1U A;  5HLH A;  3JAM Z;  2DI3 A;  5K5R A;  1U5T B;  1FYK A;  3H92 A;  5ICE A;  4U0W A;  4A0X A;  4QLC U;  1FT9 A;  2DO7 A;  1ZLJ A;  5EEG A;  4KIF A;  2DAO A;  4XLP F;  1I6X A;  5D8K B;  1I27 A;  4BAY A;  3KLO A;  4ENJ A;  5H6R A;  1XCB A;  3PFI A;  3G73 A;  5ILS A;  3VB2 A;  3RIR A;  2CYY A;  3CO6 C;  1MKM A;  4L5J A;  3L7W A;  4RAY A;  2RV8 A;  3OOP A;  1UCR A;  3HYI A;  3R6S A;  3C1D A;  2EFW A;  1Z9C A;  4U88 A;  2O0Y A;  2Z5U A;  3P9K A;  1K6O A;  1OR7 A;  3C7J A;  3ERE D;  5DUI A;  2XVC A;  2VBZ A;  1YW9 A;  4LGW A;  4I98 B;  3EUH A;  5JVT A;  1H9G A;  3I59 A;  2HTS A;  1FY7 A;  3KEQ A;  3T0Y A;  1QO0 D;  4LLL A;  4IJA A;  5BPD A;  2K7L A;  1L3L A;  5CVU A;  1J59 A;  1F1Z A;  1B4A A;  3WTS C;  2IRF G;  3HRM A;  3ZQ7 A;  2RKH A;  2DT5 A;  2VC1 A;  1OYI A;  1XCV A;  1SD6 A;  4JK1 X;  5A2Q K;  1FBU A;  4A12 A;  1LNW A;  1J0R A;  2BBY A;  3Q9V A;  4MTD A;  3CUQ B;  5E8I A;  3K9T A;  5HVQ C;  3JTH A;  2PJP A;  4EM1 A;  3KP5 A;  4O5V A;  3J7A O;  2HEO A;  3W6K B;  5J8F A;  1KQ0 A;  2E7W A;  1FSE A;  1FP2 A;  2L01 A;  1S7O A;  4LD5 A;  1G3Y A;  3C3W A;  1ZYR F;  2M45 A;  3EYI A;  1BM9 A;  2WV0 A;  3WTX C;  3HHG A;  4L9J A;  4I0B A;  5E1X A;  3J80 K;  3J81 Z;  1LDJ A;  2XAG A;  4XSX F;  3RJP A;  4M74 A;  2BYV E;  4G9Y A;  3K2Z A;  5LHI A;  3B73 A;  3QP6 A;  4AD9 A;  1FYL A;  1MDM A;  2R7D A;  1IXS B;  1EH6 A;  4OMZ A;  1ZG1 A;  1UHM A;  2ETH A;  3FMR A;  4AIJ A;  3BZ6 A;  2Z99 A;  5D6E A;  3KCC A;  3C18 A;  3WOD F;  2RQP A;  5K5Q A;  2DK5 A;  2W24 A;  1H0M A;  2HKX A;  3EET A;  4IRH A;  2ZXJ A;  1J2X A;  1HSJ A;  3ECO A;  4Q4Z F;  3F21 A;  1W5S A;  2GXB A;  1B9N A;  2JTV A;  1UB9 A;  3SFZ A;  2A3S A;  3RKX A;  3KP2 A;  3AAF A;  2EK5 A;  2VOD A;  1GVJ A;  3I4P A;  1U3E M;  2EA4 A;  2P7V B;  2YX7 A;  4M6X A;  4CYD A;  3IRQ A;  2EV5 A;  1XSV A;  4L0Z B;  4O6J A;  2DTR A;  2V9V A;  3ZPL A;  1UHW A;  1IN8 A;  1FX7 A;  3KP7 A;  3SZT A;  4EGZ A;  2MH2 A;  1RZ4 A;  3O6B B;  4NB5 A;  2IP2 A;  1LEB A;  3OV8 A;  2ESN A;  4U0Y A;  2CGP A;  3TOA A;  2O3F A;  2H6C A;  1WWX A;  1Z7U A;  1P4W A;  4LFU A;  3WGG A;  5FO5 A;  5HLG A;  2Q8K A;  4MQV A;  1LEA A;  1TW2 A;  5H20 A;  3GVA A;  1QPM A;  3H3Z A;  2MD5 A;  2H09 A;  1WI9 A;  3GEZ A;  3L00 A;  1RNL A;  2VC0 A;  3VFZ A;  1IXC A;  4KYW A;  1CGP A;  2E1C A;  3B02 A;  4KIC A;  3CDH A;  1S3J A;  3BPV A;  3I5U A;  1ULY A;  3GFI A;  2IT0 A;  1Z6T A;  3RKY A;  1PP7 U;  4WXD A;  4UUV A;  2DPU A;  2G9W A;  1YTY A;  3REO A;  2KJC A;  3FXU A;  1K79 A;  1ZAR A;  2DBB A;  1OYW A;  2RN7 A;  1SMT A;  2MH9 A;  1WRJ A;  2FBH A;  1R1T A;  1XD7 A;  2AXL A;  1HXD A;  2CSO A;  3CO7 C;  4EM0 B;  2EFQ A;  1R36 A;  3IKV A;  4OIR F;  1GHC A;  2LSO A;  2FMY A;  4KFC A;  3HUG A;  4YIF A;  1U5T C;  1IXR C;  2HWV A;  1BOA A;  4M9X A;  2QQ9 A;  2E7X A;  2C6Y A;  4L9V A;  2LKP A;  2QZ8 A;  4LG0 A;  4FHT A;  4BNC A;  2OZ6 A;  2VE9 A;  3FWE A;  4RB1 A;  5FLX K;  2IJL A;  4RB3 C;  2CWE A;  5FFX A;  2K27 A;  4LJZ F;  3RYP A;  4YII A;  1HKS A;  4K2E A;  5DUK A;  4U0V A;  2PI0 A;  3GLX A;  3M9A A;  1F4K A;  3BDD A;  3MFK A;  2XKP A;  4F7Z A;  2L4A A;  2FEZ A;  3HRU A;  3S2W A;  3FMQ A;  5FD5 A;  3FM5 A;  1HBX G;  1HW5 A;  2MA3 A;  2PBI A;  2Y48 A;  3CUO A;  4KUM A;  3SZP A;  2VBY A;  3FF5 A;  4HDU A;  2QLZ A;  4WXH A;  3HOS A;  3KE2 A;  3JSO A;  3TGN A;  3QPT A;  5LGU A;  4G6D A;  4RGS A;  2ELH A;  1ON1 A;  3E5Q A;  1DPR A;  2P5V A;  5L3C A;  1XGM A;  3ISP A;  4LB5 A;  3FM3 A;  3P7N A;  3HRS A;  5ERI A;  3KP6 A;  1TNS A;  1YW7 A;  2CO5 A;  2ESH A;  1MGT A;  2EFO A;  2TDX A;  3F8C A;  4ZYE A;  1KYZ A;  3K1M A;  2PQ8 A;  3CUQ C;  3ZMV A;  1E17 A;  4I02 A;  3BPX A;  4H0E A;  4GYG A;  1O3T A;  4ESJ A;  1FYM A;  1DP7 P;  5LRR A;  4MEX F;  2XRO A;  1RUN A;  1U8R A;  1G3T A;  3VOD A;  2O61 A;  2VBX A;  2F2E A;  1S29 A;  1ZAO A;  3F6O A;  1BI0 A;  4ETS A;  4OIP F;  2GIV A;  3MCZ A;  3QP5 A;  4GCV A;  1MZB A;  4OIO F;  5DD4 A;  1D8K A;  2JPC A;  5E20 A;  2XUB A;  1YFH A;  1YQA A;  1TBX A;  2RVC A;  4HF0 A;  1IN7 A;  2EJR A;  4UVA A;  5LEJ A;  4OIN F;  3HHH A;  2COM A;  3V8K A;  2Z33 A;  4N9I A;  3CLO A;  1KU7 A;  3DPL C;  4KMF A;  1G4D A;  2KIF A;  4CZZ A;  1FWZ A;  3H3U A;  3ZP5 A;  3PQJ A;  3QOP A;  3DEU A;  1KQ8 A;  2NNN A;  2GXG A;  4HF2 A;  1D3Y A;  2EV6 A;  4HX4 A;  1BI2 A;  1TQP A;  1Q1H A;  1C0W A;  4G7O F;  4HQE A;  5BMZ A;  3DV8 A;  2QQB A;  4P96 A;  2M5W A;  4YFN F;  4S04 A;  5IT3 A;  3N4M A;  3O3K A;  1I1S A;  2HQN A;  2PMU A;  2NNY A;  5KK1 A;  2Z3Y A;  2ISY A;  2EV0 A;  3KZY A;  3M8E A;  4JBA A;  3F72 A;  3CJN A;  3N97 A;  1TTY A;  2UXN A;  3JSP A;  1IN4 A;  4EJV A;  2AS5 F;  4RB0 A;  3JAM K;  4NHJ A;  3ZN1 A;  1UFM A;  5ILV A;  1U2W A;  1TNT A;  1KYW A;  1ZGJ A;  4ASN A;  2FE3 A;  4MTE A;  1KGS A;  3HRT A;  2IA0 A;  3P9I A;  2W25 A;  1IRG A;  4KDP A;  2XKO A;  3HTS B;  1HW1 A;  2ZO4 A;  5AON A;  4L18 B;  1HST A;  1PP8 F;  5ILU A;  1PUE E;  1T0F A;  4DNC A;  2OZU A;  2PG4 A;  3TOB A;  5CJ9 A;  2GAU A;  1G3S A;  2DW4 A;  1XGN A;  4WXC A;  1ON2 A;  3QRF F;  1JHH A;  1S7A A;  4HA8 A;  5L3F A;  4ESF A;  1Z1D A;  4RB2 C;  1J7K A;  2OA4 A;  2RC4 A;  3J80 Z;  2PLY A;  1BJA A;  1WQ2 A;  2FBK A;  2L4M A;  1DDN A;  5E17 F;  1ZHF A;  2ZKZ A;  2O6G E;  3HIF A;  3WTT C;  3ZN0 A;  3T8R A;  3F8M A;  3R4K A;  2UXX A;  4EV0 A;  2ZFW A;  1Z05 A;  3QPH A;  5IT9 K;  4A6D A;  4GO1 A;  5HDG A;  3V7S A;  2GZW A;  2VON A;  1PDN C;  3RTR A;  2JT1 A;  2D1H A;  3WTY C;  4IHS A;  1F9N A;  4WCG A;  2STW A;  4WK8 F;  4BHP A;  1O7F A;  3NEU A;  1R22 A;  4HX8 A;  2FQ3 A;  1FBQ A;  2MBF A;  2XAF A;  4MQ9 F;  5HS9 A;  1QZY A;  3IHU A;  1OPC A;  5CVI A;  3TQN A;  3E6B A;  3HSR A;  2JPB A;  1SFX A;  4MHG A;  2Y0M A;  2ISZ A;  2CG4 A;  4HBL A;  5CVJ A;  1H9T A;  3KET A;  2NS0 A;  2OBP A;  3R60 A;  3I54 A;  4G8X A;  4ZH4 F;  1JXS A;  1FP1 D;  2A6E F;  1ZH5 A;  3DFG A;  1KU2 A;  1P6R A;  1W7P A;  3J81 K;  4A6E A;  2FA5 A;  5CYV A;  1R5G A;  4KN4 X;  4CIC A;  4U7D A;  3RPU A;  1L0O C;  5ED4 A;  3GFL A;  2V1D A;  4BHB A;  4RGX A;  1OKR A;  4EJU A;  4CDG A;  4P5O A;  2Y75 A;  1U5T A;  3IWF A;  2J5O A;  1ZG5 A;  2P8T A;  2IPQ X;  3NQO A;  2VT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...