2RDPA

The structure of a marr family protein from bacillus stearothermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
140
Chain Sequence
AMNERTVAELEKLLRYIAANLKQRGREILTNYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDEHVVRIRLLEKGERIIEEVIEKRQRDLANVLESFSDEEIVVFERCLRKLHQEMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a MarR family protein from Bacillus stearothermophilus.
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transcription
molecule keywords putative transcriptional regulator MarR
total genus 48
structure length 140
sequence length 143
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rdpA00
1CF7B 3T1BA 4R79A 1FPQA 5E1ZB 2IVMA 5DYMA 4XLNF 4KN7X 1STZA 3R0JA 3E6CC 1I6XA 3QPTA 3V8KA 2P5KA 4XBFA 1BC8C 3M1EA 1IXCA 1HKQA 2HKXA 1QO0D 3I59A 2K4JA 3D5LA 2QBYB 3LAPA 3KEQA 2VC0A 2ACJA 4AVPA 3P9IA 4RAZA 4BAYA 2BV6A 1O7FA 1AWCA 4G7ZF 1QZZA 3F8FA 3JW4A 1U5TC 1ZG3A 5CVVA 2HYFA 2VONA 2V1DA 4LK0F 5HOOA 4EM0B 5JVTA 2R7FA 1O7LA 3FMQA 4YIFA 4I01A 1J7KA 1B6AA 2R7DA 3ZMUA 2OBPA 4G94A 1JHHA 1YQAA 1OPCA 2X0LA 4YFKF 1HW5A 2D1HA 2P4WA 1DPUA 4ON0A 3LAJA 3FXRA 1OR7A 3V7SA 1USSA 1IN6A 5BPDA 1R00A 3CDHA 5KVRA 2BE5F 5JR3A 3MCZA 4IJAA 4PCQA 2IW5A 1J59A 4MQVA 2QM3A 3I5UA 3T5XA 1PP8F 2NNNA 4KMFA 4RB2C 3F21A 2D45A 4QWQA 4EGYA 3TGNA 2ZXJA 3BY6A 3ECHA 2NRAC 5BPIA 4YFXF 2ZFWA 4CGZA 1T38A 3IL2A 3G3ZA 1NHAA 4EGZA 3TKYA 1VTNC 4B8XA 4RB3C 4HV6A 3VFZA 3BROA 5CVRA 3FM3A 1EH7A 3HRSA 4UV8A 2LNBA 2QQ9A 4DNCA 4ZYGA 3TOAA 3VB2A 2L02A 1H9TA 3RPQA 3IRRA 4CYDA 1T2KA 3OOPA 5JI6A 2FRHA 2M8EA 1HW1A 3E6DA 4P96A 5E1XA 2WC2A 4HYEA 4ZZLA 3K1NA 4F7ZA 3S2WA 1SFEA 4UVBA 2VBZA 5D6EA 2D1VA 4M6XA 4RGSA 2XGXA 1YW9A 3MAJA 2YR2A 1TQMA 4FX0A 2FMYA 3K0LA 4MTDA 4ZZDA 3P7NA 2PMHA 3GWZA 1KQ8A 2XAHA 3F8MA 4EMSA 4NB5A 3NEUA 5H6QA 3D0SA 3GUDA 1QPMA 3LQQA 4LB5A 2QUFA 5DUKA 4M9SA 2QLZA 1BI0A 4RAYA 2CQKA 1ZRFA 2ESHA 3RKYA 5D8LB 3IC7A 3HTUA 4EJWA 4QLCU 3FM5A 1IF1A 2G7UA 1OMIA 1FBSA 2MLKA 1W5SA 5E18F 2QVOA 3HSFA 3L2CA 3J80K 1WWXA 2EFNA 3K2ZA 3GXOA 4AIHA 2FNAA 4ZYDA 5L3FA 3DXJF 3GZ6A 4EM1A 1R5HA 5LGTA 5ICGA 2H09A 3HYIA 2FQ3A 1F9NA 3SXYA 4IVNA 2K4BA 2VBWA 1FSEA 2IA1A 4I0BA 2UWMA 2HR3A 3CTAA 5LRRA 2Y75A 3F8NA 4IXAA 1HW2A 1FNNA 3T8TA 4CZZA 1XB4A 5CVUA 3DPLC 2P7CB 4BNCA 2CWEA 3O2PE 4NQWA 1ZHFA 4L0YB 5LEJA 1LB2A 3TDZC 3RKWA 1IN7A 2OQGA 1RUOA 2Q2EA 4RS8A 4HLYA 5K5OA 2MD5A 3COAC 4U0VA 1F4KA 1SAXA 2YU3A 3KP5A 3HHGA 4N9IA 4O6JA 1BI2A 4RGXA 4G9YA 1ZGAA 5L3DA 2EK5A 4WCGA 2KJCA 2KIFA 2UZKA 1B4AA 4KA4A 2Y48A 2GQQA 1KGSA 4XLPF 1ZGJA 2P5VA 4HLXA 3KETA 4KYWA 1QGPA 4UV9A 1SD5A 4UHTA 5DDGA 5BQTA 4M74A 1J75A 2EA2A 4JK1X 1WSUA 5EEHA 1LDDA 2VC1A 1E17A 4EM2A 3BP8A 4GXOA 4EJUA 4L9NA 1IN8A 3RIRA 2W25A 2VN2A 1J2XA 3VODA 1FP2A 2Y0MA 2IA0A 3KFWX 1LVAA 2Z33A 1L3LA 3QPHA 2BGCA 4HA8A 1IN4A 3V7RA 1O57A 4O5VA 4WXCA 3J81K 3QU3A 1W5TA 2LDUA 1SFXA 4OIQF 3BZ6A 5A2QZ 1A04A 2L01A 3WGIA 3FX3A 5L3BA 3DPTA 5FFZA 1REPC 3MEXA 1H0MA 4CO8A 4ESJA 4L9JA 1XGMA 1BIAA 3ML6A 1J0RA 5F64A 4UNOA 5DCFA 1PUEE 2JSCA 1O3QA 5FLXK 3PFIA 4HW0A 4RGUA 2IA2A 3WGHA 5ILVA 3HIFA 3ZN1A 2M30A 3WTSC 2CO5A 2Z5UA 3M8EA 2EFQA 3QAHA 5CVJA 4DQ2A 3DP7A 2VBXA 2Q8KA 2GIVA 1U8RA 1V4RA 1KYZA 1W7PA 4IHTA 2E1NA 1IUYA 4N9HA 5D4RA 2HTJA 3U1DA 2A69F 1BN5A 3T0YA 4AWXB 4MGRA 1QNTA 1ZRCA 1Q1HA 1P2FA 4IRHA 4CDGA 4A2UA 4KIFA 4M71A 4ETSA 3NRVA 2HFHA 5F6FA 5ED4A 5IT9K 1MGTA 2LKPA 3TOBA 3RPUA 2W85A 2PEXA 2ZCWA 3LA2A 5FB2A 5D5VB 2PN6A 4BHPA 2CSOA 5H6RA 1SFUA 1T6SA 1R1VA 1XN7A 2CFXA 4A5NA 3WG9A 4ASNA 1ZH5A 2XROA 4M9ZA 2J5PA 1I27A 2DBBA 4WXDA 2WWYA 2IJLA 3F8CA 1R1UA 2IP2A 5CLSA 3R60A 4WF2A 1K78A 1Z1DA 4Y17A 4E70A 2ADUA 4UVCA 3GVAA 4M73A 1F5TA 5DEQA 2VXZA 1B59A 1D3YA 4LLLA 4A5MA 3F72A 4YIIA 1RIOH 4KIBA 2ZKZA 3JSOA 3BJAA 3GX4X 1EH8A 1G6NA 1FBQA 5AIQA 1CF7A 4FX4A 4MQ9F 2M87A 2LF7A 2ETHA 2JRTA 2OA4A 3F8BA 1J5YA 3MFKA 2H6CA 3MWMA 1XDUA 3KE2A 4OIPF 1IAWA 1D8KA 1B9NA 2VT2A 2W84A 4IRIA 1XCVA 2P7VB 4S05A 5ILSA 3WTVC 3REOA 4HX7A 3GO5A 1HQCA 1KQ9A 2ZJ2A 3H3ZA 4OOIA 1R1TA 1TTYA 1HSTA 2HQRA 2A3SA 1H9GA 3WE2A 3F23A 4HDVA 2K02A 3Q9SA 1XSXA 1MD0A 3KZYA 4AD9A 1K7AA 1YW8A 4PDKA 4TV7A 4FHTA 2WV0A 4G8XA 1IN5A 3HOTA 4PGGA 1LEAA 5J6XA 1U3EM 4EJTA 2HDCA 3CUQB 2QWWA 2V1UA 5JHUA 5DCMA 1HKSA 2ZNZA 5E8IA 3QP5A 1I1SA 5HS9A 2CG4A 3IHUA 3L7WA 1BC7C 1Z9CA 2XAFA 3DF8A 2RN7A 4HX4A 2VODA 5LGNA 5J8FA 2F5DA 4IRGA 1D5VA 1QQIA 1SD7A 5FLXZ 2EFOA 2VT3A 3ZMTA 3E6BA 1O3RA 2EFWA 1IRFA 1ZLKA 3L09A 2R3SA 3E97A 3WGGA 1ODDA 1U6GA 1ONVA 1LQ1A 1XD7A 1S3JA 2MH9A 1LNWA 2DI3A 1S7OA 5FGMA 2H94A 3IKVA 3QRFF 2EJRA 4BYYA 3RI4A 2A6HF 3R61A 3H92A 2ZO4A 3T8RA 4CHUA 1HKTA 1HSJA 3EYYA 4MEYF 1G3TA 5F1RA 5BS6A 2RVCA 4XSZF 4G7OF 2HKOA 3PQJA 3ELKA 1GVJA 3M9AA 1BIBA 2G9WA 3RYPA 2AS5F 3U2RA 1FC3A 1KU9A 3FXUA 3M7GA 4OIRF 4LJZF 3SQNA 2BEOA 2MH2A 4LG0A 1RZ4A 3IRQA 2IRFG 2UXXA 3HRTA 4CICA 4ZYHA 2G7HA 1MKMA 1FYLA 3J80Z 3SZPA 3FWEA 1KYWA 1WKMA 4M6YA 4MEXF 4ENMA 4AIJA 1G3SA 3GFIA 1MJ9A 2RDPA 3O6BB 2QYOA 2CW0F 1BBYA 3P9KA 1FX7A 4BHCA 3L00A 3ZMZA 5LLQA 1SD4A 1TNSA 2OZ6A 3CUQA 2VOOA 2DPUA 3RDIA 5LGUA 1XSVA 4MHGA 2B0LA 5ICCA 3F6OA 2XAQA 5D5UB 2V6CA 4HBLA 4BHBA 2QBYA 2A5YB 4WWCA 4UXNA 4Y13A 1ZREA 4I02A 2HS5A 2F5FA 2L54A 1F1ZA 3F22A 1UHWA 2XAGA 2EB7A 1OYWA 3TDUC 2EA4A 5E1WA 3HUGA 2GXBA 2RGVA 1OYYA 1BI1A 3WU1B 3BDDA 1GXPA 2DQRA 4JQFA 2CGPA 3WTYC 2PBIA 2O3FA 1DUXC 5D5XB 3HRMA 2A68F 5HDNA 2OU2A 3WTUC 1U5TB 2W57A 2JPCA 3JAMK 1S29A 1YTYA 3V8JA 4A6EA 1WI9A 1W4MA 4PZJA 2V79A 1RI7A 4A0ZA 1UCRA 4L9VA 5DCMB 2BYVE 2DK5A 2HOEA 4KN4X 3GFMA 5K5RA 1YYVA 2X4HA 4Q47A 1ZN2A 4PGHA 4NHJA 2CYYA 2Z99A 1Y0UA 3LFKA 4G7HF 2FE3A 4EVIA 1WRJA 2EFPA 1YS7A 4S04A 4KNYA 2Z3YA 4KT5C 2EV0A 2NAZA 3DEUA 1BM9A 3ZQ7A 5DD4A 4LLGF 1LEBA 5LHHA 1KU2A 3ULQB 2DU9A 3Q5FA 2ZMEB 1FBUA 1Z6TA 1FWZA 4EJOA 4HDUA 2FSWA 3TO6A 3JTHA 1T98A 4Q5SF 3ZPLA 2O03A 3I59B 3FF5A 2VE8A 1QBJA 3CJNA 4MTEA 1BI3A 2FF4A 2A61A 4L18B 3NQOA 3I58A 3BPVA 2KJBA 2FNPA 5IT3A 1ZG1A 3RTRA 5DD8A 5HS8A 4RB0A 3N97A 2EV6A 5HS7A 1K6OA 3FHZA 5TRDA 1TQIA 2P6TA 1Z91A 2FMLA 1JGSA 4GYIA 3KP2A 2ZNYA 2OD5A 1WQ2A 1BOAA 5HLIA 5CJ9A 2HGCA 1R36A 4Y15A 3KCCA 4U0WA 1SMYF 3EYIA 3G73A 1K78B 1HXDA 2V1XA 4O3MA 4N0BA 1ZRDA 4G6QA 2FBIA 1ON1A 3GFJA 4HQEA 5A2QK 4AIKA 2K27A 2OQRA 3ERED 3HSEA 1QZYA 1TBXA 2Z9OA 1JE8A 3GFLA 3ZMDA 1D8JA 2DK8A 5ERIA 3QOPA 5LHIA 1P92A 3FXQA 3BJOA 1OYIA 3TO7A 3RJPA 1S8NA 3ZMVA 5J8CA 5ICFA 2PMUA 3EDPA 3CUOA 1R23A 2XHKA 3L9FA 1XMAA 1RNLA 3QP6A 4ZH4F 4ENNA 3F3XA 3BPXA 2HWVA 3GW2A 3Q9VA 1C0WA 4LB6B 3CLOA 1GXQA 1R5GA 2XAJA 1PDNC 3GEZA 1IZ1A 2A6EF 2L4MA 2Q0OA 1YW7A 4KUMA 2DQLA 1DDNA 3I53A 2PQ8A 5LEKA 1B1BA 1KA8A 2PI0A 1Z05A 2E7WA 3E5UA 1IXRC 3HOSA 2PFBA 3I54A 1AOYA 4M72A 1GHCA 1L0OC 3V4GA 2RC4A 5JFRA 1U5TA 1U78A 2PLYA 4LG0B 4FT8A 1P4WA 3K69A 4B09A 2E1CA 4HQMA 2STWA 3E5XA 3KP4A 2DT5A 3EETA 2STTA 1EV7A 1OKRA 3LA7A 1JHFA 3SHFA 3GF2A 3LWFA 2DW4A 2XKOA 2QQAA 1RUNA 5D4SA 3W6JB 4GO1A 2VOPA 4HF2A 4Q4ZF 2JZYA 1LJ9A 4LFUA 2NYXA 3HHHA 3OV8A 2RNJA 1R58A 5LHGA 1ZG5A 5E17F 2GA1A 1I1GA 1FLIA 3KP7A 3O3KA 3R6SA 2DO7A 2MLGA 1BJAA 3KP3A 4M9XA 1ZAOA 3WTXC 5D5WB 1R22A 2FEZA 3BWGA 3ZMSA 3V7CA 2K86A 4A0XA 4KICA 2K7LA 5AONA 1UHMA 2JPBA 2F5EA 1SD6A 2FBKA 1X3UA 2HTSA 4BXUA 4YFNF 4OINF 4P9FA 1ON2A 1T0FA 2H27A 2NS0A 3KP6A 3LA3A 3I64A 2VE9A 4A12A 1P6RA 1P4XA 4U88A 4I7HA 3WU0A 2YPRA 3KZZA 2DLLA 1IRGA 2XV4S 3B73A 2DPDA 3DKWA 5HDKA 2ISYA 2YSRA 2ZMEA 3CO6C 2RQPA 3TQNA 3R0AA 4IPAA 3FMRA 4K2EA 1K79A 2EWNA 3ABTA 3I71A 4KFCA 1YS6A 4OIOF 4LLNA 3CO7C 5TJJA 1TNTA 4KDPA 3HTSB 2KIMA 3DFGA 1P4AA 5HVQC 5HLGA 3MZYA 3WODF 5AIPA 4L5IA 1LDJA 2JT1A 4HF1A 1TLHB 3U9GA 3C18A 2P6SA 1G3WA 2L4AA 1I5ZA 6PAXA 3LSTA 2IPQX 2LSOA 2P8TA 4D0PA 5FFXA 2GWRA 3IWFA 3FMSA 4MNUA 4I09A 1R7JA 1S6LA 1Z6RA 5H20A 3IKTA 1ZLJA 2FA5A 1MDMA 3ZP5A 1PP7U 1DP7P 4XSXF 1USTA 3I4PA 2LF8A 5E20A 3B02A 4HX8A 2YX7A 1XGSA 2RV8A 3LQRA 2GXGA 2KKOA 1FYMA 3HRUA 4U7BA 4LMYA 1ULYA 1HBXG 1XSDA 3E6MA 4GCVA 4HF0A 2MC3A 2XVCA 4ZYEA 2XIGA 2XKPA 2FXAA 1DPRA 1XGOA 2FBHA 2V9VA 4I98B 2H6BA 2M5WA 2O8XA 2XRNA 1U2WA 3CUQC 3K1MA 2J5OA 2DAOA 5L3CA 2IT0A 4L0ZB 4XRFA 2WTEA 2YX4A 2MA3A 4Q48A 1SMTA 4IF4A 4HZFA 3RKXA 1IXSB 1MJAA 3GZ5A 2O0YA 3HSRA 4JBAA 3ROUA 1KU7A 2O6GE 4A0YA 3J7AO 3ZN0A 4WK8F 1FSHA 1V3FA 5K5QA 5LRSA 2QQBA 2FOKA 2XASA 1KQ0A 4ESBA 4A6DA 3WTWC 1XMKA 3MZHA 2F2EA 3GYHX 5CYVA 5K1YA 2DFIA 3K9TA 1MZBA 2UXNA 3C3WA 2AXLA 4R8HA 2M45A 2E7XA 4OMYA 5FD5A 5LBQA 2KRFA 1KU3A 4GYGA 4RB1A 5IT9Z 4BQAA 3SFZA 3V8LA 1MJBA 4CXFA 4KMUX 1Z7UA 5HLHA 2D2WA 5ICEA 3K1PA 5ILUA 4HAMA 1G4DA 3PQKA 1XDSA 4RGRA 3VOEA 2QENA 2DTRA 2NNYA 4EJVA 1FP1D 2OAZA 4Z2YA 3N4MA 4UVAA 2ELHA 4LD5A 1T39A 3KLNA 4ESFA 5FD6A 3BOQA 3M8FA 3RYRA 1TW3A 5E8GA 4G6DA 2GA2A 3KEOA 5L3EA 1XGNA 3JAMZ 2BBYA 3W6KB 4KIGA 1TQPA 3SZTA 1FOKA 1UFMA 2MBFA 3TO9A 3JTGA 4YG2F 4H0EA 3C7JA 3IWZA 1J9IA 3R4KA 3JSPA 4ENKA 4I2OA 3ECOA 2HZTA 3J81Z 2VBYA 4I0AA 1UB9A 3GLXA 4ENJA 3DV8A 3EQLF 2XUBA 1FY7A 4P55A 3WTZA 4HOBA 1CGPA 2FU4A 4UUVA 4WXHA 2GAUA 5FO5A 2HEOA 3ABUA 4WX9A 2GZWA 5BOXA 2PJPA 1O3SA 1G3YA 1FZPB 1YLFA 4U7DA 5D6FA 1S7AA 3WE3A 4LGWA 3AAFA 2F5CA 2P5LC 2OZUA 2M1BA 1YFHA 5D8KB 1FYKA 5CVIA 5DUIA 4L9TA 4OU0A 1W7PB 5HDGA 2ISZA 2RKHA 5BMZA 2ESNA 2COMA 4P5OA 3WTTC 1IW7F 3P9CA 4R1HA 2EV5A 2HQNA 2L3DA 4IHSA 2ZBKA 4U0YA 3E5QA 1FT9A 1XCBA 3DQVC 5KK1A 3I0TA 4BH9A 3VEPA 1YG2A 3E3VA 3F6VA 1ZARA 1ZYRF 3C1DA 3QU6A 1E2XA 1YIOA 1B9MA 5EEGA 2A07F 4EQQA 4EV0A 1O3TA 2C6YA 3EUHA 4L5JA 1EH6A 2O61A 1W7PD 5L3GA 2QZ8A 4HV5A 1MDMB 3BJ6A 3FZVA 2W24A 3KLOA 1YO5C 3H3UA 2PG4A 1TW2A 3MQ0A 2KIUA 4OMZA 4GGGA 4LK1F 5DV5A 3ISPA 2HYGD 1LDKB 2TDXA 2JTVA 1JXSA 4P9UA
chains in the Genus database with same CATH superfamily
3H0GJ 4XK4A 1CF7B 4DBQA 3T1BA 2Q1ZB 1YJNI 3N05A 4R79A 1FPQA 5E1ZB 2IVMA 3LSIA 5DYMA 2IGNA 3IH3A 4XLNF 1MBEA 4KN7X 4ZC3A 3TW6A 1STZA 3MKWB 3VDXA 4PSWA 3R0JA 3E6CC 1TP4A 1I6XA 3QPTA 4XOPA 3V8KA 3ONQA 2P5KA 2H8RA 2HOSA 1O4XA 4XBFA 1G8XA 1BC8C 3HC7A 3M1EA 2M34A 2MW8A 3BG7A 5HODA 2ZJPF 4HNUA 2DT6A 2ID6A 1S9HA 2R5YA 1VQ6I 1IXCA 1HKQA 2HKXA 2ZJQF 1QO0D 1P7IA 2LC2A 3I59A 2K4JA 4D7MA 3D5LA 4GRIA 2QBYB 3LAPA 2NOJB 3KEQA 2VC0A 2QSFX 1X58A 1ETKA 2ACJA 4AVPA 2XAUA 3P9IA 1QU3A 4RAZA 4BAYA 3S2HJ 2LOOA 4Y4RA 2IEKA 3OIQA 2LRDA 5FRNA 2BV6A 3W2VA 2JUGA 4C3HJ 3A01A 1LE8A 3A03A 1O7FA 2HPIA 1AWCA 3HOUJ 2I10A 2F4MB 5F0HA 5HNFA 4G7ZF 3PUBA 1QZZA 2XF5A 3F8FA 3DPUA 2QKLB 3JW4A 3KYCB 5J1YA 1U5TC 1ETOA 1ZG3A 2EZHA 5F04A 5EZHA 3CZ6A 5CVVA 3L2RA 2HYFA 2FJ1A 2VONA 4E7SA 2V1DA 2L5QA 4LK0F 5HOOA 3CC2I 4EM0B 5JVTA 2R7FA 1O7LA 1D0YA 3FMQA 2W4SA 3CCMI 4YIFA 3P5JA 3M8JA 4I01A 1J7KA 4B48A 1B6AA 4XR6A 5KCMA 2R7DA 3ZMUA 1EA3A 2DA1A 1IV8A 2OBPA 3DLAA 4G94A 1JHHA 1YQAA 1OPCA 2X0LA 4BL0B 4YFKF 3HOXJ 1HW5A 2D1HA 2EINH 2PJRA 2P4WA 3HOWJ 1DPUA 4ON0A 3LAJA 2IS2A 2ME0A 1EJ9A 3FXRA 1OR7A 2K40A 3V7SA 5GP9A 1USSA 1IN6A 5BPDA 1R00A 3CDHA 5KVRA 2BE5F 3CCLI 5JR3A 3H35A 2X85A 2X48A 2K3PA 3M3YJ 3MCZA 4IJAA 5EEAA 2EIKH 4PCQA 2IW5A 1J59A 4MQVA 2QM3A 2KRHA 2VPLA 3I5UA 3T5XA 1PP8F 2NNNA 4KMFA 4RB2C 3FIWA 2LYCA 1WJBA 5EDNA 3HKZA 3F21A 2D45A 3K6GA 4DZPA 3BR0A 2DYRH 4QWQA 1VI0A 4NC8A 3Q0WA 3TGNA 4EGYA 4BDYA 1MBJA 2ZXJA 3BG3A 3QYFA 2VB6A 4G12A 3QYEA 3RKQA 1BW5A 3BY6A 3ECHA 1RKWA 2NRAC 5BPIA 4YFXF 2ZFWA 2QA4I 3S1NJ 3K4NA 4CGZA 1MMAA 1T38A 3IL2A 3G3ZA 1E3PA 1NHAA 4KITB 4EGZA 3TKYA 1YJ9I 1VTNC 4B8XA 4RB3C 4HV6A 3VFZA 2EILH 3BROA 2KQRA 5CVRA 3RQ4A 3FM3A 1VQOI 5B3SH 1EH7A 2A5WA 3HRSA 4UV8A 2LNBA 1VFCA 2QQ9A 4IOAF 3DTKA 4DNCA 1SVOA 4RAGA 3TOAA 3VB2A 4ZYGA 4Y52J 2L02A 1H9TA 2RAEA 3RPQA 2L7KA 1D0XA 3IRRA 2Y9YA 4CYDA 2MSYA 2M0CA 1KONA 2CH0A 1T2KA 2BY2A 3OOPA 5JI6A 2FRHA 2M8EA 1HW1A 2DA6A 2LVSA 3E6DA 3E0JB 4P96A 5E1XA 2WC2A 4ZDPA 3OYBA 1MBHA 4HYEA 1MSFC 4BQOA 2VJIA 4ZZLA 2G0EA 3K1NA 1I3AA 4F7ZA 3S2WA 3H36A 1SFEA 4UVBA 2VBZA 2JQ7A 3CC4I 1A31A 5D6EA 2VQHA 1BL0A 2D1VA 4M6XA 4RGSA 2XGXA 1YW9A 4BY7J 3VPRA 3MAJA 1U9NA 2YR2A 2IXSA 4FCYA 2DFEA 1TQMA 2Z2SB 4FX0A 2R92J 2FMYA 3K0LA 4MTDA 4MO7A 4ZZDA 1RR8C 3P7NA 2PMHA 2XB5A 3GWZA 1KQ8A 2XAHA 3F8MA 4EMSA 4NB5A 3NEUA 5H6QA 3ZXSA 2K3FA 3OSFA 1PUFB 3I56I 4OAZA 1DU0A 3D0SA 3GUDA 1QPMA 3LQQA 3MN2A 4UUSB 4DBRA 2NVXJ 3MD2A 3IH4A 3ZR8X 2QUFA 3GTJJ 4LB5A 1G2HA 2XPVA 5DUKA 4M9SA 2QLZA 3CJTB 3PSFA 4F3QA 4M3GA 4AYBA 3ZGKA 3MKZA 1BI0A 1TWFJ 1IG7A 4RAYA 2CQKA 2CJJA 5B1BH 3UKGA 1ZRFA 3TL4X 2ESHA 3RKYA 5D8LB 3A1YA 3IC7A 3C2BA 3U1KA 4U87A 3HTUA 3ZOBA 1ZR4A 4EJWA 4QLCU 3FM5A 1RETA 1IF1A 2DMTA 5IYBJ 2RREA 4BJTA 3CMYA 1ZELA 1B72B 2CQXA 1OMIA 2G7UA 3DBLB 1FBSA 2MLKA 2CS3A 2LR8A 4HEA2 3I3LA 1W5SA 2E1MC 1NK2P 1ZKGA 2HOTA 1HCRA 4DIQA 5FKOA 4AYBN 5E18F 2QVOA 4W97A 3HSFA 3L2CA 3J80K 1WWXA 3PNYA 5IPAA 2EFNA 3K2ZA 1JUSA 3GXOA 2M4GA 3FBNB 4AIHA 1HDPA 3VWBA 1XS9A 2FNAA 4ZYDA 4PUSA 1FMWA 2BZTA 5L3FA 2F4OB 3DXJF 3GZ6A 4EM1A 1D5YA 4IHXA 2XSJC 1R5HA 5LGTA 5ICGA 2H09A 3G1OA 3HYIA 3BQYA 5HNHA 2FQ3A 1F9NA 3BTIA 3SXYA 3OSGA 4IVNA 1UMQA 2K4BA 2VBWA 1FSEA 2IA1A 5EGOA 4I0BA 2DA4A 2UWMA 2HR3A 3CTAA 3H5AA 1VQ7I 5LRRA 4D7NA 5GPCA 2Y75A 3F8NA 4IXAA 1HW2A 4MIMA 1FNNA 3H5NA 3CF5F 2KHMA 3T8TA 4CZZA 2WV1A 5M3MJ 4JYKA 3TEDA 1XB4A 5CVUA 1NH3A 3DPLC 1HLVA 2P7CB 1TL8A 1QVTA 1ETQA 4KJZA 4BNCA 2CWEA 3O2PE 2AHQA 4NQWA 4CUGA 2RNGA 1ZHFA 4L0YB 5LEJA 1LB2A 3ABLH 4BXXJ 1MH4A 2E35A 3KIOA 4EATA 1ACIA 3TDZC 3RKWA 3I4NJ 2EIJH 1IN7A 2OQGA 1RUOA 4CCOA 2Q2EA 2Y9ZA 4RS8A 4XM3A 4W1UA 4M3FA 3MMYB 1TZLA 5B1AH 5FKNA 3JRDA 4E7LA 4HLYA 5K5OA 1OR7C 2MD5A 3PO2J 3COAC 2RQQA 3QODA 4U0VA 4A3MJ 1F4KA 1SAXA 1POGA 4FETA 2YU3A 3KP5A 2B7EA 3HHGA 3G6EI 4N4OB 4N9IA 4O6JA 1R9TJ 5J3LA 1BI2A 4RGXA 2MGQA 3ZQGA 4G9YA 4F91B 1ZGAA 5L3DA 2EK5A 2ZSIB 4RM3A 4WCGA 2BW3B 2KJCA 2KIFA 3HJEA 2UZKA 1B4AA 3A0HC 2R0QC 4KA4A 2Y48A 2GQQA 3OY9A 4YRVA 2PMZA 1JI8A 1KGSA 4XLPF 1ZGJA 2P5VA 2XB0X 4HLXA 4UB8C 3KETA 3OYDA 2M2EA 4NUBA 4KYWA 1QGPA 1IRXA 4UV9A 1SD5A 2ME6A 2Y0SA 1X4OA 4UHTA 5DDGA 3BZKA 1XC5A 2BHYA 5BQTA 2VQCA 1BJZA 4M74A 1WJDA 1J75A 3OS0A 2EA2A 2QQ8A 2VPRA 4JK1X 4UUSA 1WSUA 5GAGJ 5EEHA 3AG1H 1LDDA 2VC1A 1HF0A 1E17A 5E3LA 4EM2A 3BP8A 4GXOA 3S14J 4EJUA 1YITI 3K4MA 3SFIA 4L9NA 2LY1A 1IN8A 3RIRA 2W25A 1NG6A 2H8WA 9ANTA 2HPMA 2VN2A 4XKCA 1J2XA 2YU9J 2WAEA 3VODA 3G2BA 3LSPA 1AA7A 2DFFA 5FKLA 1BOBA 1FP2A 2Y0MA 2IA0A 3KFWX 3B6CA 3CP2A 1LVAA 4OAYA 2OV7A 3OMYA 4DGWB 1DGWY 2LY9A 4Y7NJ 3CCJI 2UUZA 1VQ5I 2Z33A 4JOMA 3L2UA 2ZXHA 3FISA 1L3LA 3S17J 1I50J 3QPHA 4QSHA 1S72I 2BGCA 5E79C 2D5VA 2E34A 4HA8A 3DWLE 2KP6A 3V42A 1IN4A 3V7RA 1O57A 4O5VA 4WXCA 2R5ZA 2K9QA 3J81K 3QU3A 1W5TA 1NTCA 3HUGB 2LDUA 4ANJA 1SFXA 2CQQA 2WA0A 3HG9A 4XONA 4OIQF 5M5XJ 3F9KA 3BZ6A 5IP7J 5A2QZ 1RRJA 1BA5A 2WY8Q 3EUHC 1E3HA 1JKOC 2KLOA 1A04A 2L01A 3GTOJ 1BR2A 1DU6A 3WGIA 3FX3A 2IAIA 3QQAA 2BHZA 5L3BA 3DPTA 4PFOA 5FFZA 4E7IA 1REPC 2VKDA 3MEXA 1H0MA 3IAS2 4CO8A 2VIXA 2V9PA 4ESJA 4L9JA 1IDYA 1XGMA 1BIAA 3ML6A 1J0RA 3BR2A 3K4LA 5F64A 3L2QA 3HZJA 1GDTA 5DCFA 4UNOA 2ELJA 1PUEE 1LKXA 2VQLA 5E3NA 2JSCA 1T0FC 1O3QA 4X6AJ 5FLXK 3PFIA 3H9GA 1XG1A 4BE0A 4HW0A 4RGUA 2AQFA 2CV0A 4XICA 2IA2A 2DA2A 2R7WA 3PNTA 4NC7A 3WGHA 1MBKA 5ILVA 3AL0B 3HIFA 3ZN1A 2DOFA 2M30A 2PMZN 3WTSC 2CO5A 3VSLA 4YELA 3J7YJ 2Z5UA 3M8EA 2EFQA 1A5JA 3QAHA 5CVJA 1X1BA 2DMUA 4DQ2A 3DP7A 2DA3A 2VBXA 2Q8KA 2KMUA 2GIVA 2HDWA 1JTYA 3A0BC 2XRLA 3FXOA 1V4RA 4XN3A 1KYZA 5EYRA 1U8RA 1JT0A 4CSWA 4XNFA 5F1JA 1W7PA 4IHTA 2E1NA 2KDZA 2K5CA 4HNVA 1IUYA 1SEUA 4N9HA 1V5GA 3RCOA 5D4RA 2HTJA 3U1DA 3GTQJ 1LFPA 2A69F 1BN5A 4GFBA 3T0YA 1JUPA 2R7XA 2ZB9A 4AWXB 3GLLA 1AKHB 2R5ZB 4MGRA 1OCZH 1PYVA 1QNTA 1ZRCA 1Q1HA 5TISC 2OTJI 1P2FA 2QKMB 1HC8A 1XX5A 3IAM2 4CA0A 2Z16A 3OYKA 2L7FP 4IRHA 3HOZJ 4CDGA 2B9SA 1OFCX 2R7QA 3CDIA 4A2UA 4KIFA 4M71A 3NARA 4ETSA 2E2HJ 4BGDA 3NRVA 1R6RA 2HFHA 5F6FA 5ED4A 1WH5A 3HL2A 2DYSH 5IT9K 1MGTA 2CUZA 2Y30A 2LKPA 3FK7A 3TOBA 3RPUA 2W85A 1R4NB 2M4KA 3VSKA 2PEXA 3DCFA 2ZCWA 3LA2A 5FB2A 5D5VB 2JK3A 2JRMA 2AQEA 2XPWA 2PN6A 3UR3C 4BHPA 2GOXB 5DM7F 3Q0VA 2CSOA 5H6RA 5IP6A 1SFUA 3K10A 4D9JA 1T6SA 1R1VA 1XN7A 1Y6IA 2CFXA 3PJRA 1VZ0A 1MMDA 3A01B 5GAHJ 1K4TA 3OIPA 3CCQI 2VI6A 2K9NA 3WG9A 4A5NA 4ASNA 1ZH5A 2XROA 4M9ZA 2J5PA 4ZJZA 1I27A 2DBBA 1JGGA 2R7UA 4WXDA 2WWYA 2IJLA 3F8CA 1R1UA 4XLFA 3HEFA 3H3VK 3S16J 2IP2A 2WAQN 5CLSA 3R60A 4WF2A 1K78A 4A3IJ 1Z1DA 2AXTC 2QF7A 3PNVA 3K4CA 3NAUA 4Y17A 4E70A 2ADUA 4UVCA 4B43A 2VLAA 3GVAA 4M73A 3CC7I 2JA6J 2CFOA 3BR6A 2DTZA 1F5TA 5DEQA 3OYCA 2VXZA 2X1DA 1B59A 3H0DA 5K7HA 1D3YA 2EZLA 4LLLA 1QRYA 4A5MA 5EF6A 3F72A 4YIIA 2R7RA 1RIOH 3DBRB 1E3OC 4KIBA 2ZKZA 3JSOA 3BJAA 4M3BA 2M7BA 1A6QA 3GX4X 5K7ZA 1EH8A 1GVDA 3OYNA 4M6VA 1G6NA 3SYTA 4IX7A 1FBQA 5AIQA 1CF7A 4B47A 1N77A 4FX4A 4MQ9F 2R7SA 2XGEA 5IOZA 2M87A 4CH7A 2LF7A 2CQ7A 2ETHA 2JRTA 2OA4A 4F52A 3F8BA 4AM3A 5BNGA 1J5YA 3K70D 2GXAA 3MFKA 2H6CA 3MWMA 1XDUA 2XDVA 2OCCH 1OISA 3J7ZI 2HOAA 3KE2A 4OIPF 4IHYA 1IAWA 4II2A 1VQ8I 1D8KA 1B9NA 2VT2A 2W84A 4IRIA 1XCVA 3HPGA 2VJ5A 2I8DA 3E1SA 1Z21A 2OPTA 2P7VB 1ERDA 4S05A 3A4CA 5ILSA 3WTVC 1S7EA 2W82A 3G1MA 4P1WA 5KAIC 2QEXI 3REOA 3TP0A 4HX7A 3GO5A 1HQCA 3FXLA 1KQ9A 3IUOA 2ZJ2A 2MC4A 3H3ZA 1K6YA 1IC8A 1N75A 4OOIA 3EPZA 1R1TA 1KZHA 2LBFA 1TTYA 1HSTA 2HQRA 4BBRJ 4BJ5C 1N78A 2CUFA 2A3SA 1T33A 3U21A 1H9GA 1YX5A 2LTPA 3WE2A 4CZCA 3F23A 4IL6C 4HDVA 3PIOF 2K02A 3Q9SA 1XSXA 4PJJA 4BDZA 1MD0A 3KZYA 4AD9A 3BTJA 2BVMA 1YW8A 4PDKA 4TV7A 3CCRI 1LE8B 1K7AA 5GTIC 4FHTA 2WV0A 4G8XA 2JA5J 1IN5A 3HOTA 3WU2C 4C3JJ 2DXIA 4PGGA 1LEAA 5J6XA 4XLEA 1XPXA 1U3EM 4EJTA 2WADA 1WHUA 2QWWA 3CUQB 2HDCA 2V1UA 1ITYA 2DA5A 5JHUA 2LBFB 5DCMA 3CF2A 2AO9A 3LSJA 1HKSA 1PUFA 3BCBA 2ZNZA 3O8GA 1WJ5A 5E8IA 3QP5A 1I1SA 4M3EA 5HS9A 4XMYA 2CG4A 1JUMA 1ZTRA 3DEWA 5JLWA 1W0UA 2H1LA 3IHUA 2ECBA 3L7WA 1K4SA 1SC7A 1HDDC 1BC7C 2KIQA 3HKZN 1Z9CA 2XAFA 2GM4A 4IHWA 3CDLA 3DF8A 4XKBA 5IYCJ 2OC6A 2RN7A 2CW8A 1UAAA 2ELKA 1ORKA 4HX4A 2VODA 5LGNA 2IS4A 5J8FA 2F5DA 4IRGA 3LFUA 1ZGWA 3O8HA 3KYLA 1D5VA 1QQIA 2F48A 1SD7A 5FLXZ 2EFOA 3JRCA 4IQJA 2VT3A 2O5RA 3ZMTA 1JKRC 3E6BA 3SDGA 1O3RA 4EEFG 2EFWA 1IRFA 4A3FJ 5H2FC 1ZLKA 3L09A 4ZYAA 4E7KA 2R3SA 3E97A 3WGGA 3K70C 1QHGA 4LITA 1IDZA 4IZZA 1ODDA 1U6GA 1ONVA 3OYAA 4BACA 4OWRB 1LQ1A 3LMMA 1XD7A 1S3JA 4YEJA 2MH9A 2JMWA 3MKYB 1LNWA 2DI3A 4DYCA 1S7OA 1JT6A 2Z1DA 5M5YJ 1SAUA 3JRBA 2TCTA 5FGMA 4QPQA 2VL8A 2H94A 3IKVA 3QRFF 2EJRA 4BYYA 1MMNA 3RI4A 1TWAJ 1G59A 2A6HF 1V54H 3R61A 3H92A 4IHVA 2ZO4A 3T8RA 4CHUA 1HKTA 2WB1N 1HSJA 5E3MA 3EYYA 4MEYF 1G3TA 5F1RA 5BS6A 5LD2C 2RVCA 4XSZF 3S3OA 4G7OF 2DMQA 2HKOA 1FIAA 3PQJA 4II3A 3ELKA 2ID3A 1GVJA 5EJCA 1R49A 3M9AA 1BIBA 2WAFA 2O9LA 2CU7A 1FJLA 2G9WA 2HQ5A 3RYPA 3PIPF 2HXIA 2AS5F 3U2RA 1FC3A 1GLNA 1KU9A 3FXUA 3M7GA 4OIRF 5J47A 4LJZF 3SQNA 2BEOA 3CCSI 2MH2A 4LG0A 1RZ4A 3IRQA 2IRFG 2UXXA 3HRTA 4XRSG 4CICA 1DQUA 2DN0A 4ZYHA 2G7HA 4A3LJ 1TT0A 3LSKA 2DMPA 2EH3A 1MKMA 2HXOA 3ZCOA 1XTAA 1FYLA 4PSXA 1Y1VJ 3S93A 3J80Z 2XSDC 5JHFA 2BY3A 5GTHC 3SZPA 3OOUA 3FWEA 1H89C 1KYWA 1WKMA 3AG2H 4M6YA 1YRNB 4MEXF 2ZMEC 4ENMA 2EQRA 1RC9A 2ZC2A 4E6KG 3CMEI 4N4NB 4AIJA 3PO3J 3I4MJ 1G3SA 3GFIA 2NVUB 3BG5A 2O7OA 5J40A 1MJ9A 2RDPA 2TRTA 4XRSA 3O6BB 1X2NA 2DODA 3Q3SA 2XC7A 2QYOA 2JWTA 2CW0F 4ABZA 2KZGA 3M1CA 4B4CA 1BBYA 3KZIC 3P9KA 1IUFA 1FX7A 4BHCA 3DTIA 3L00A 3ZMZA 5LLQA 1YRNA 1SD4A 1TNSA 2OZ6A 2V9KA 3CUQA 3IH2A 4D5FA 2DPUA 2VOOA 3RDIA 4BS9A 5LGUA 4BEHB 1XSVA 1UG0A 4MHGA 2B0LA 3RPUD 3F0CA 1IRZA 5ICCA 3F6OA 4F93B 2XAQA 1Q1VA 3KPHA 5D5UB 3H5RA 1A36A 2V6CA 4HBLA 1WJFA 2ZJRF 1OCCH 3WG7H 5C4JJ 4MLOA 1Y8RB 4BHBA 3L1PA 2QBYA 2A5YB 3OS2A 3BCAA 4WWCA 2FX0A 4DOZA 4UXNA 4Y13A 2KDOA 2GLOA 3UNGC 1ZREA 4I02A 3D1NI 2HS5A 2F5FA 2L54A 4PJ0C 1F1ZA 3OL4A 2EIMH 3F22A 2Y2ZA 3HPHA 1UHWA 2XAGA 2WB1A 2EB7A 1OYWA 3TDUC 2E19A 2Y0SN 1X2MA 3K4JA 2EA4A 3QWLA 1T08B 1YX3A 1X3ZB 2K85A 5E1WA 3HUGA 4MFEA 2CV2A 3GTLJ 2GXBA 2M3AA 2RGVA 2XGDA 1OYYA 1BI1A 3WU1B 3BDDA 2IS6A 1GXPA 2HVSA 5F27A 5FKKA 3HXLA 2DQRA 2DFHA 4JQFA 1WCMJ 3TBIA 3JRIA 2M8GX 3I9V2 3QPSA 2CGPA 1MNDA 3WTYC 1SFKA 3QPLA 2PBIA 3PL8A 1DP3A 3G1LA 1I6HJ 2O3FA 3ESWB 5TGTA 1DUXC 5D5XB 2X9DA 3HRMA 4XLAA 2A68F 5HDNA 2O8KA 2OU2A 3K4KA 2IGOA 3WTUC 1U5TB 4AIDA 2W57A 5GAEJ 2JPCA 3JAMK 1S29A 2E2IJ 1YTYA 3V8JA 4A6EA 3CCVI 4NBQA 1WI9A 1W4MA 1R5ID 4PZJA 2CW7A 2F4IA 2V79A 1RI7A 4RAFA 4FE4A 4LIVA 4A0ZA 4F92B 1XMXA 4QIWN 1UCRA 4L9VA 5DCMB 2BYVE 2DK5A 2HOEA 4C30A 4KN4X 3J7AY 3HDDA 3GFMA 5K5RA 1YYVA 2X4HA 1Z67A 4Q47A 2OF7A 2L9NA 1ZN2A 4PGHA 5IYDJ 1UZCA 4NHJA 4BE2A 2VKHA 1HA8A 2CYYA 3ASNH 2Z99A 1Y0UA 3LFKA 4G7HF 3DKYA 2FE3A 4EVIA 2KRCA 1WRJA 3BTCA 2EFPA 1YS7A 5B66C 4CYCB 1Y0NA 1WGXA 4S04A 4KNYA 1TWCJ 3GZNB 2Z3YA 4KT5C 1FOWA 2EV0A 2NAZA 3DEUA 1BM9A 3ZQ7A 5J1RA 5DD4A 4LLGF 1LEBA 5LHHA 1B8IA 4AUXA 1U9OA 1KU2A 4RMNA 3ULQB 4BQNA 2DU9A 3Q5FA 1OCRH 1MNMC 1SVMA 2ZMEB 1FBUA 1Z6TA 1FWZA 4BY1J 4EJOA 4NNJA 2VXDA 1F43A 3FXJA 2DDAA 4HDUA 2FSWA 3JRHA 3TO6A 2JJ7A 3JTHA 1ETVA 3DTEA 3KEYA 1U8BA 1JTXA 1T98A 4Q5SF 3ZPLA 2O03A 1CQTA 3OYJA 3I59B 4E7ZA 2NVQJ 3FF5A 2VE8A 3SDBA 1QBJA 3OYMA 2V4JC 3CJNA 2QSHX 1MBFA 4MTEA 4DYRA 3JRAA 1BI3A 1FTTA 1Z77A 4Y33A 2VKEA 2FF4A 2A61A 4A3GJ 4L18B 4RLQA 3NQOA 3I58A 3BPVA 3CESA 2KJBA 4HRIA 2FNPA 5IT3A 1ZG1A 1VQKI 4Y3OA 3RTRA 5DD8A 3ZQQA 5HS8A 4RB0A 3N97A 3LSHA 2EV6A 2LG4A 5HS7A 3FKIJ 1K6OA 3FHZA 4FISA 5TRDA 3CJRB 1TQIA 3JRFA 2P6TA 1FOYA 1Z91A 2FMLA 3BG6A 2HVQA 5DM6F 5JLXA 1JGSA 4GYIA 3KP2A 4UUTA 2ZNYA 2OD5A 3SZGA 3VYRB 1WQ2A 1BOAA 2DOEA 2JN6A 5HLIA 5CJ9A 1VQ4I 2HGCA 3PFYA 1R36A 3JRGA 4Y15A 3KCCA 2P81A 2NVTJ 3K4BA 1BR1A 1RR7A 1SVLA 1A6IA 4RM2A 4U0WA 5LFAA 3CCEI 5M5WJ 1V5EA 1SMYF 2DT7B 3EYIA 3C2GA 3G73A 3CD6I 1K78B 1HXDA 2V1XA 3BR1A 2JA7J 4O3MA 1VNDA 4N0BA 1ZRDA 4PJLA 4G6QA 5C44J 2FBIA 3BT9A 4L5EA 3DKXA 1YI2I 3TP3A 1ON1A 3FDYA 4LG3A 3GFJA 1APLC 4PFPA 4HQEA 5A2QK 2OTLI 5B5EC 4AIKA 2K27A 2OQRA 3PSIA 3OR1C 3ERED 3HSEA 1QZYA 1TBXA 3S3NA 2Z9OA 1JE8A 3GFLA 1X1CA 3ZMDA 1D8JA 1H8AC 1D1AA 5F0CA 2IGMA 4IO9F 1IV6A 2DK8A 5ERIA 3QOPA 2VQGA 2WAQA 5LHIA 2L9VA 2N8GA 1HOMA 1P92A 1K83J 2NXNB 4NC6A 4GDFA 3OR2C 3FXQA 3BJOA 1OYIA 3GTGJ 3TO7A 3RJPA 2M9HA 1S8NA 3ZMVA 5J8CA 5ICFA 2PMUA 3EDPA 3CUOA 2JVHA 3RQIA 1ETYA 1E0EA 3TW7A 1R23A 2XF7A 2EPFA 5IY5H 4C2MJ 2XHKA 2LKXA 3L9FA 1XMAA 1RNLA 4B44A 3ABKH 3X2QH 1QHHD 3QP6A 4ZH4F 4ENNA 1B72A 3KYDB 4BJ6C 3F3XA 3BPXA 4H4KC 3G71I 1ZQ3P 3LSMA 2HWVA 3LNQA 3HM5A 3GW2A 2EBIA 3Q9VA 1C0WA 1MBGA 4BUPA 4LB6B 3S1MJ 4CCMA 3CLOA 1FOXA 1GXQA 1R5GA 2XAJA 2UV1A 1PDNC 3BR3A 3GEZA 2FD5A 1MW7A 1MMSA 1W0TA 1AKHA 1IZ1A 2LKSA 1VQPI 2A6EF 2L4MA 1FIPA 5GADJ 2HVRA 2Q0OA 1YW7A 4RBOA 2MD0A 1NG7A 4KUMA 2DQLA 1DDNA 3I53A 2PQ8A 1W36C 5LEKA 1B1BA 5IP9J 1QPIA 1KA8A 2FUG2 2PI0A 1Z05A 2E7WA 1Y56A 3E5UA 4UY8I 3MZ8A 2X6YA 3OYLA 1IXRC 4A69C 2L9RA 1P9QC 4BXFA 3HOSA 1OQYA 4PJNA 4RA2A 2PFBA 3I54A 2KL4A 1D1CA 3GTMJ 1JKQC 1AOYA 4M72A 3SEQA 4FQGA 1VQMI 2F6CA 3M4OJ 1L0OC 3V4GA 2RC4A 1GHCA 5JFRA 1U5TA 1D1BA 4C9YA 1U78A 5CQGA 1PJRA 2PLYA 4LG0B 5C3EJ 1AHDP 4FT8A 1P4WA 3K69A 4B09A 2E1CA 4HQMA 2STWA 3E5XA 3KP4A 2V6EA 5EG0B 2DT5A 3S3MA 2X6OA 1D0ZA 3EETA 2STTA 1EV7A 1OKRA 3LA7A 2L0KA 3W6VA 1NK3P 2JVGA 5KHDA 2DDBA 4XKVA 1JHFA 3SHFA 1Y39A 3GF2A 3LWFA 1N25A 2DW4A 2OUMA 2XKOA 2R7OA 2QQAA 1RUNA 5D4SA 1R4MB 4DZJA 3W6JB 1R71A 4GO1A 2VOPA 2KPMA 2W00A 1UJ8A 3Q0UA 4HF2A 4Q4ZF 2L7ZA 2JZYA 2BW3A 1RKTA 1WJAA 5J1UA 2YUSA 2FOWA 1LJ9A 2E1MB 4LFUA 2NYXA 3HHHA 4RLFA 3OV8A 3A2KA 3MVPA 2RNJA 3VYUB 2YS9A 1QVUA 2JA2A 1R58A 2HI3A 1UG2A 5LHGA 1ZG5A 2R7ZJ 2MG4A 5E17F 1WPKA 5FLVA 1F36A 3ZQIA 3ZQHA 2GA1A 1VQLI 3K7AJ 1I1GA 1FLIA 1ENHA 3KP7A 3O3KA 3R6SA 4LIUA 2DO7A 3D5SC 4XORA 2MLGA 3CMMA 3FBIB 4DJAA 2BXYA 1BJAA 3K2AA 3KP3A 1WH7A 3OIOA 4M9XA 4KT6A 4BE1A 2XGCA 3TMOA 1ZAOA 2CMPA 1P7JA 1U0JA 3SJMA 1MNEA 4BU2A 3WTXC 4RDUA 2LK2A 2HU9A 5D5WB 1R22A 2EZIA 4XLHA 2FEZA 3BWGA 3ZMSA 3V7CA 5EG0A 2A05A 4BEHA 2K86A 4A0XA 4HSTA 1FEXA 4G6TB 4KICA 2K7LA 5AONA 4LOCA 1H88C 1UHMA 4CCNA 2JPBA 2F5EA 1SD6A 2FBKA 1Z7LA 4B1RA 3FK6A 3MKLA 4C2UA 1K61A 1X3UA 2HTSA 3LL7A 2X6WA 5J4VA 3M07A 2LH9A 2DJNA 4BXUA 4YFNF 4FTHA 4OINF 4P9FA 2NS7A 1ON2A 3CLQA 1T0FA 1Z3XA 5FROA 2H27A 1X3WB 1GV5A 1LVKA 4A3EJ 2NS0A 3KP6A 2BOLA 3LA3A 3I64A 2M7AA 1X4PA 3OWTA 2VE9A 2KFDA 4A12A 1OCTC 1P6RA 2OCEA 3GBGA 2W48A 3S2DJ 2WY7Q 1P4XA 4U88A 4I7HA 3LSGA 2YPRA 3KZZA 3WU0A 3ZQLA 1ETWA 2DLLA 3HGYA 1IRGA 3AG4H 4CCJA 2XV4S 4A3KJ 3B73A 2DPDA 1TWHJ 5F08A 3DKWA 5HDKA 2ISYA 2YSRA 2X51A 2R4GA 3OYGA 2ZMEA 3RZDJ 4IKFA 3CO6C 2RQPA 3TQNA 3CQZJ 3R0AA 4CCKA 1IJWC 4IPAA 3FMRA 4K2EA 4A3CJ 3C2HA 1K79A 2EWNA 3S8PA 2F5VA 3ABTA 3BC8A 3I71A 4KFCA 2E2JJ 1YS6A 5FJ8J 1ZR2A 4OIOF 3WHCA 4LLNA 3CO7C 1IGNA 1DGRM 3NWSA 4MFDA 1SANA 2COBA 5TJJA 2JA8J 1TNTA 4KDPA 4XL9A 4BBSJ 4ZTJA 2LY2A 1JJ6C 3HTSB 2KIMA 3LSRA 3DFGA 1P4AA 5HVQC 5HLGA 3MZYA 5CQEA 3WODF 3IV5A 5AIPA 1B8IB 2OJED 4L5IA 1LDJA 2JT1A 1YJWI 3PM1A 4HF1A 1TLHB 3U9GA 3C18A 2P6SA 1G3WA 4E4HA 5F0FA 2CV1A 3DEEA 2L4AA 2R5YB 3A02A 2ZSHB 3EUAA 4NDLA 1I5ZA 4KISA 1EKEA 6PAXA 3IP4B 3LSTA 1WI3A 4V2GA 2IPQX 2LSOA 4JP0A 4QPOA 2ICWG 2P8TA 4D0PA 5FFXA 2GWRA 3IWFA 2LREA 3FMSA 4MNUA 4I09A 1A35A 2X1CA 1W36D 2VKVA 1TT5B 1R7JA 1S6LA 4HG2A 4NQWB 1Z6RA 1MH3A 3ZRGA 3DBHB 5H20A 3IKTA 2IS1A 4ZDOA 1ZLJA 2FA5A 5FKMA 1T8IA 1MDMA 3ZP5A 1PP7U 1DP7P 4XSXF 1USTA 3I4PA 2LF8A 2LD5A 2BY0A 1V55H 2R7TA 5E20A 3GCMA 2Q2EB 3B02A 4HX8A 2YX7A 1XGSA 4F55A 2E36A 2RV8A 3DU5A 5KAFC 3CCUI 3LQRA 2K9SA 2GXGA 2M0MA 2KKOA 1FYMA 3HRUA 4U7BA 4LMYA 1ULYA 3D5RC 5DS9A 1HBXG 3W3CA 1XSDA 3E6MA 1YHQI 4GCVA 4HF0A 2DJIA 2MC3A 2XVCA 4ZYEA 2W7NA 1MSEC 1VF9A 2XIGA 4Z6YA 4AC0A 2XKPA 1W5CC 2FXAA 2CUEA 3CJQB 1DPRA 1QA6A 1XGOA 2HNHA 2FBHA 3OL3A 3S1QJ 3JR9A 2V9VA 3W2WA 4I98B 1VQNI 2H6BA 2HQAA 2M5WA 2O8XA 4M3DA 1WJCA 4JX4A 2XRNA 1MMGA 1U2WA 3CUQC 3K1MA 2J5OA 3I55I 2DAOA 1MIJA 2K9LA 5M3FJ 1JJ8C 3WHBA 1X1DA 5L3CA 2BXZA 2KT0A 3DU6A 2A6TA 2IT0A 4IEJA 4XKWA 4L0ZB 4XRFA 2WTEA 2LMDA 2IGKA 1OCOH 1T95A 2YX4A 1LFBA 2MA3A 4Q48A 1SMTA 4IF4A 4HZFA 2VASA 3RKXA 1IXSB 1MJAA 3GZ5A 4XLCA 2O0YA 3HSRA 4JBAA 3ROUA 1KU7A 2O6GE 3VYTB 4A0YA 3J7AO 4DYQA 3GMEA 4J01A 3ZN0A 3B6AA 4WK8F 4J00A 1FSHA 1V3FA 5K5QA 3VYSB 5LRSA 2QQBA 2FOKA 1WVRA 2XASA 1KQ0A 4ESBA 2Y69H 2JUCA 2K9MA 1ZK8A 5IOYA 4A6DA 4C2TA 4E7HA 3WTWC 3ERMA 1XMKA 3MZHA 2F2EA 3GYHX 1W1WE 5CYVA 2P0WA 3S15J 2DOAA 2BY1A 2NVYJ 4I99C 3QYBA 4BKXA 2GOMA 3QOEA 4CYCA 3L2WA 5K1YA 2QSGX 2V7FA 2DFIA 3K9TA 4B3AA 4E7JA 1MZBA 3S32A 2UXNA 3HOVJ 3C3WA 2AXLA 4R8HA 2M45A 2E7XA 4OMYA 5FD5A 1GT0C 2HYJA 2MABA 4PJMA 5LBQA 2KRFA 2ECCA 3KX2A 2R93J 1KU3A 4GYGA 4RB1A 5IT9Z 3H9JA 4BQAA 3SFZA 3V8LA 1BR4A 1MJBA 3H1CA 4S0HB 4CXFA 5GPAA 4KMUX 2L2OA 3OYEA 1Z7UA 4IQ4A 2D2WA 5HLHA 3OYFA 2LP0A 5ICEA 3K1PA 3OS1A 4XOTA 5ILUA 4HAMA 1G4DA 2WBMA 3GTPJ 3PQKA 1XDSA 1OJLA 1SFOJ 4RGRA 3VOEA 2QENA 2DTRA 2HZDA 5KNLA 2NNYA 1UHSA 5K7FA 3AL0C 2DMNA 2B63J 4C3IJ 4EJVA 1FP1D 2LFBA 4I6ZA 2OAZA 4Z2YA 3N4MA 3HB9A 3ZQFA 4UVAA 3E7LA 4ZTFA 2ELHA 4AVZA 4LD5A 1T39A 2JSPA 3KLNA 2ZFUA 4ESFA 5FD6A 1OLTA 3BOQA 3M8FA 3RYRA 2E5ZA 1TW3A 5E8GA 3ABMH 4FASD 3ZQCA 3OYIA 2XF6A 2GA2A 4G6DA 3KEOA 5L3EA 1XGNA 3CMAI 3JAMZ 1VQ9I 2BBYA 3DLLF 3FHNA 3W6KB 4PK4A 4KIGA 1TQPA 3EUKL 3SZTA 1FOKA 2R7VA 1UFMA 1I39A 3H9QA 3AFHA 2MBFA 3TO9A 4XIDA 3JTGA 2MYSA 4YG2F 1LFUP 4H0EA 3C7JA 2GIZA 4JX5A 5J4YA 1I3QJ 3IWZA 1ETXA 4X0GA 1J9IA 2H1KA 3R4KA 3JSPA 4ENKA 4I2OA 3ECOA 2HZTA 4D1QA 3J81Z 3BLYA 2VBYA 4I0AA 1UB9A 3JCUC 2E71A 3GLXA 4ENJA 3HOYJ 4HSRA 3DV8A 3EQLF 3BTLA 2XUBA 1FY7A 2QCOA 4P55A 1IO2A 3WTZA 4HOBA 1TWGJ 4I76A 2FU4A 1CGPA 1M1EB 2CUJA 1GUUA 2X1EA 2PJRB 4UUVA 3BR5A 4WXHA 2EZKA 4DW6A 2VJJA 2GAUA 5FO5A 2HEOA 3ABUA 3JREA 4WX9A 1YIJI 3AKZA 2GZWA 5BOXA 2PJPA 2VUMJ 4A3BJ 3LOCA 4V19K 1O3SA 1G3YA 1WJEA 1FZPB 1X1AA 1YLFA 4U7DA 5D6FA 1UELB 5CKTA 2XPUA 4XRMA 1S7AA 3WE3A 1AU7A 1RPWA 4D5CA 5EGOB 4LGWA 3AAFA 4A93J 2F5CA 4YIRX 2V26A 5DTDA 1S5LC 3G4SI 2ZXWH 2P5LC 5C4XJ 2OZUA 2M1BA 1YFHA 5D8KB 3ASOH 2KZVA 2DA7A 1LUJB 4BQQA 1FYKA 3HBLA 5CVIA 3BZCA 4XN0A 5DUIA 1OCPA 2BVLA 4UB6C 2HDDA 2VJ4A 3AG3H 4L9TA 4OU0A 1W7PB 2X6XA 4HPQA 5HDGA 2ISZA 2I5UA 2QGUA 2RKHA 3HGGA 3PUFA 2ESNA 5BMZA 2COMA 2CRGA 4P5OA 1IW7F 4QTRA 3P9CA 4JX6A 2IBDA 4R1HA 3WTTC 1BW6A 2EV5A 2NOGA 3NWTA 1FTZA 2W1OA 2HQNA 2L3DA 4IHSA 1X1PA 5EZGA 3W2AA 5HLTA 2ZBKA 3CP8A 2E60A 3L2VA 1JKPC 2LLKA 4U0YA 1Z0XA 1FMVA 1T56A 3E5QA 3S1RJ 1FT9A 1XCBA 3DQVC 4J19A 2V1NA 3CCYA 5KK1A 4B3XA 1Y8QB 1J09A 3I0TA 4HNTA 2MFZA 1Z3YA 4BH9A 3VEPA 1YE9A 2E5NA 1YG2A 3SEZA 3E3VA 3F6VA 2Y31A 1ZARA 1ZYRF 2GBYA 3C1DA 3QU6A 4AU7A 4CCLA 1LPQA 1E2XA 1YIOA 1X19A 1Y1WJ 1TC3C 4IOCF 1B9MA 5EEGA 5FLMJ 3BG9A 5JVGF 2A07F 4ZDLA 4EQQA 4EV0A 1PVEA 1O3TA 2C6YA 1V5FA 4XQFA 4FE7A 5CPRB 3OYHA 3EUHA 4L5JA 2KISA 1EH6A 2O61A 3RZOJ 1W7PD 2L9SA 1YOVB 2PX9A 5L3GA 1GV2A 3BQZA 1WFXA 2DCEA 2E1OA 2QZ8A 4ITVA 1WZ2A 3FKJA 4HV5A 1MDMB 4A3DJ 3BJ6A 3FZVA 2W24A 3KLOA 1YO5C 1RESA 3H3UA 5FRMA 3FXKA 2PG4A 1TW2A 3FXMA 4X1EA 3MQ0A 2NS8A 2L7MP 2KIUA 4OMZA 4A3JJ 4GGGA 4LK1F 2ZXIA 5DV5A 1QZEA 3ISPA 2HYGD 1EF4A 1LDKB 5E3OA 2FQ4A 3RSNA 2CQNA 4V2FA 2TDXA 2JTVA 3GTKJ 1JXSA 4P9UA
chains in the Genus database with same CATH topology
1CF7B 3T1BA 4R79A 1FPQA 5E1ZB 2IVMA 5DYMA 4XLNF 4KN7X 1STZA 3R0JA 3E6CC 1I6XA 3QPTA 3V8KA 2P5KA 4XBFA 1BC8C 3M1EA 1IXCA 1HKQA 2HKXA 1QO0D 3I59A 2K4JA 3D5LA 2QBYB 3LAPA 3KEQA 2VC0A 2ACJA 4AVPA 3P9IA 4RAZA 4BAYA 2BV6A 1O7FA 1AWCA 4G7ZF 1QZZA 3F8FA 3JW4A 1U5TC 1ZG3A 5CVVA 2HYFA 2VONA 2V1DA 4LK0F 5HOOA 4EM0B 5JVTA 2R7FA 1O7LA 3FMQA 4YIFA 4I01A 1J7KA 1B6AA 2R7DA 3ZMUA 2OBPA 4G94A 1JHHA 1YQAA 1OPCA 2X0LA 4YFKF 1HW5A 2D1HA 2P4WA 1DPUA 4ON0A 3LAJA 3FXRA 1OR7A 3V7SA 1USSA 1IN6A 5BPDA 1R00A 3CDHA 5KVRA 2BE5F 5JR3A 3MCZA 4IJAA 4PCQA 2IW5A 1J59A 4MQVA 2QM3A 3I5UA 3T5XA 1PP8F 2NNNA 4KMFA 4RB2C 3F21A 2D45A 4QWQA 4EGYA 3TGNA 2ZXJA 3BY6A 3ECHA 2NRAC 5BPIA 4YFXF 2ZFWA 4CGZA 1T38A 3IL2A 3G3ZA 1NHAA 4EGZA 3TKYA 1VTNC 4B8XA 4RB3C 4HV6A 3VFZA 3BROA 5CVRA 3FM3A 1EH7A 3HRSA 4UV8A 2LNBA 2QQ9A 4DNCA 4ZYGA 3TOAA 3VB2A 2L02A 1H9TA 3RPQA 3IRRA 4CYDA 1T2KA 3OOPA 5JI6A 2FRHA 2M8EA 1HW1A 3E6DA 4P96A 5E1XA 2WC2A 4HYEA 4ZZLA 3K1NA 4F7ZA 3S2WA 1SFEA 4UVBA 2VBZA 5D6EA 2D1VA 4M6XA 4RGSA 2XGXA 1YW9A 3MAJA 2YR2A 1TQMA 4FX0A 2FMYA 3K0LA 4MTDA 4ZZDA 3P7NA 2PMHA 3GWZA 1KQ8A 2XAHA 3F8MA 4EMSA 4NB5A 3NEUA 5H6QA 3D0SA 3GUDA 1QPMA 3LQQA 4LB5A 2QUFA 5DUKA 4M9SA 2QLZA 1BI0A 4RAYA 2CQKA 1ZRFA 2ESHA 3RKYA 5D8LB 3IC7A 3HTUA 4EJWA 4QLCU 3FM5A 1IF1A 2G7UA 1OMIA 1FBSA 2MLKA 1W5SA 5E18F 2QVOA 3HSFA 3L2CA 3J80K 1WWXA 2EFNA 3K2ZA 3GXOA 4AIHA 2FNAA 4ZYDA 5L3FA 3DXJF 3GZ6A 4EM1A 1R5HA 5LGTA 5ICGA 2H09A 3HYIA 2FQ3A 1F9NA 3SXYA 4IVNA 2K4BA 2VBWA 1FSEA 2IA1A 4I0BA 2UWMA 2HR3A 3CTAA 5LRRA 2Y75A 3F8NA 4IXAA 1HW2A 1FNNA 3T8TA 4CZZA 1XB4A 5CVUA 3DPLC 2P7CB 4BNCA 2CWEA 3O2PE 4NQWA 1ZHFA 4L0YB 5LEJA 1LB2A 3TDZC 3RKWA 1IN7A 2OQGA 1RUOA 2Q2EA 4RS8A 4HLYA 5K5OA 2MD5A 3COAC 4U0VA 1F4KA 1SAXA 2YU3A 3KP5A 3HHGA 4N9IA 4O6JA 1BI2A 4RGXA 4G9YA 1ZGAA 5L3DA 2EK5A 4WCGA 2KJCA 2KIFA 2UZKA 1B4AA 4KA4A 2Y48A 2GQQA 1KGSA 4XLPF 1ZGJA 2P5VA 4HLXA 3KETA 4KYWA 1QGPA 4UV9A 1SD5A 4UHTA 5DDGA 5BQTA 4M74A 1J75A 2EA2A 4JK1X 1WSUA 5EEHA 1LDDA 2VC1A 1E17A 4EM2A 3BP8A 4GXOA 4EJUA 4L9NA 1IN8A 3RIRA 2W25A 2VN2A 1J2XA 3VODA 1FP2A 2Y0MA 2IA0A 3KFWX 1LVAA 2Z33A 1L3LA 3QPHA 2BGCA 4HA8A 1IN4A 3V7RA 1O57A 4O5VA 4WXCA 3J81K 3QU3A 1W5TA 2LDUA 1SFXA 4OIQF 3BZ6A 5A2QZ 1A04A 2L01A 3WGIA 3FX3A 5L3BA 3DPTA 5FFZA 1REPC 3MEXA 1H0MA 4CO8A 4ESJA 4L9JA 1XGMA 1BIAA 3ML6A 1J0RA 5F64A 4UNOA 5DCFA 1PUEE 2JSCA 1O3QA 5FLXK 3PFIA 4HW0A 4RGUA 2IA2A 3WGHA 5ILVA 3HIFA 3ZN1A 2M30A 3WTSC 2CO5A 2Z5UA 3M8EA 2EFQA 3QAHA 5CVJA 4DQ2A 3DP7A 2VBXA 2Q8KA 2GIVA 1U8RA 1V4RA 1KYZA 1W7PA 4IHTA 2E1NA 1IUYA 4N9HA 5D4RA 2HTJA 3U1DA 2A69F 1BN5A 3T0YA 4AWXB 4MGRA 1QNTA 1ZRCA 1Q1HA 1P2FA 4IRHA 4CDGA 4A2UA 4KIFA 4M71A 4ETSA 3NRVA 2HFHA 5F6FA 5ED4A 5IT9K 1MGTA 2LKPA 3TOBA 3RPUA 2W85A 2PEXA 2ZCWA 3LA2A 5FB2A 5D5VB 2PN6A 4BHPA 2CSOA 5H6RA 1SFUA 1T6SA 1R1VA 1XN7A 2CFXA 4A5NA 3WG9A 4ASNA 1ZH5A 2XROA 4M9ZA 2J5PA 1I27A 2DBBA 4WXDA 2WWYA 2IJLA 3F8CA 1R1UA 2IP2A 5CLSA 3R60A 4WF2A 1K78A 1Z1DA 4Y17A 4E70A 2ADUA 4UVCA 3GVAA 4M73A 1F5TA 5DEQA 2VXZA 1B59A 1D3YA 4LLLA 4A5MA 3F72A 4YIIA 1RIOH 4KIBA 2ZKZA 3JSOA 3BJAA 3GX4X 1EH8A 1G6NA 1FBQA 5AIQA 1CF7A 4FX4A 4MQ9F 2M87A 2LF7A 2ETHA 2JRTA 2OA4A 3F8BA 1J5YA 3MFKA 2H6CA 3MWMA 1XDUA 3KE2A 4OIPF 1IAWA 1D8KA 1B9NA 2VT2A 2W84A 4IRIA 1XCVA 2P7VB 4S05A 5ILSA 3WTVC 3REOA 4HX7A 3GO5A 1HQCA 1KQ9A 2ZJ2A 3H3ZA 4OOIA 1R1TA 1TTYA 1HSTA 2HQRA 2A3SA 1H9GA 3WE2A 3F23A 4HDVA 2K02A 3Q9SA 1XSXA 1MD0A 3KZYA 4AD9A 1K7AA 1YW8A 4PDKA 4TV7A 4FHTA 2WV0A 4G8XA 1IN5A 3HOTA 4PGGA 1LEAA 5J6XA 1U3EM 4EJTA 2HDCA 3CUQB 2QWWA 2V1UA 5JHUA 5DCMA 1HKSA 2ZNZA 5E8IA 3QP5A 1I1SA 5HS9A 2CG4A 3IHUA 3L7WA 1BC7C 1Z9CA 2XAFA 3DF8A 2RN7A 4HX4A 2VODA 5LGNA 5J8FA 2F5DA 4IRGA 1D5VA 1QQIA 1SD7A 5FLXZ 2EFOA 2VT3A 3ZMTA 3E6BA 1O3RA 2EFWA 1IRFA 1ZLKA 3L09A 2R3SA 3E97A 3WGGA 1ODDA 1U6GA 1ONVA 1LQ1A 1XD7A 1S3JA 2MH9A 1LNWA 2DI3A 1S7OA 5FGMA 2H94A 3IKVA 3QRFF 2EJRA 4BYYA 3RI4A 2A6HF 3R61A 3H92A 2ZO4A 3T8RA 4CHUA 1HKTA 1HSJA 3EYYA 4MEYF 1G3TA 5F1RA 5BS6A 2RVCA 4XSZF 4G7OF 2HKOA 3PQJA 3ELKA 1GVJA 3M9AA 1BIBA 2G9WA 3RYPA 2AS5F 3U2RA 1FC3A 1KU9A 3FXUA 3M7GA 4OIRF 4LJZF 3SQNA 2BEOA 2MH2A 4LG0A 1RZ4A 3IRQA 2IRFG 2UXXA 3HRTA 4CICA 4ZYHA 2G7HA 1MKMA 1FYLA 3J80Z 3SZPA 3FWEA 1KYWA 1WKMA 4M6YA 4MEXF 4ENMA 4AIJA 1G3SA 3GFIA 1MJ9A 2RDPA 3O6BB 2QYOA 2CW0F 1BBYA 3P9KA 1FX7A 4BHCA 3L00A 3ZMZA 5LLQA 1SD4A 1TNSA 2OZ6A 3CUQA 2VOOA 2DPUA 3RDIA 5LGUA 1XSVA 4MHGA 2B0LA 5ICCA 3F6OA 2XAQA 5D5UB 2V6CA 4HBLA 4BHBA 2QBYA 2A5YB 4WWCA 4UXNA 4Y13A 1ZREA 4I02A 2HS5A 2F5FA 2L54A 1F1ZA 3F22A 1UHWA 2XAGA 2EB7A 1OYWA 3TDUC 2EA4A 5E1WA 3HUGA 2GXBA 2RGVA 1OYYA 1BI1A 3WU1B 3BDDA 1GXPA 2DQRA 4JQFA 2CGPA 3WTYC 2PBIA 2O3FA 1DUXC 5D5XB 3HRMA 2A68F 5HDNA 2OU2A 3WTUC 1U5TB 2W57A 2JPCA 3JAMK 1S29A 1YTYA 3V8JA 4A6EA 1WI9A 1W4MA 4PZJA 2V79A 1RI7A 4A0ZA 1UCRA 4L9VA 5DCMB 2BYVE 2DK5A 2HOEA 4KN4X 3GFMA 5K5RA 1YYVA 2X4HA 4Q47A 1ZN2A 4PGHA 4NHJA 2CYYA 2Z99A 1Y0UA 3LFKA 4G7HF 2FE3A 4EVIA 1WRJA 2EFPA 1YS7A 4S04A 4KNYA 2Z3YA 4KT5C 2EV0A 2NAZA 3DEUA 1BM9A 3ZQ7A 5DD4A 4LLGF 1LEBA 5LHHA 1KU2A 3ULQB 2DU9A 3Q5FA 2ZMEB 1FBUA 1Z6TA 1FWZA 4EJOA 4HDUA 2FSWA 3TO6A 3JTHA 1T98A 4Q5SF 3ZPLA 2O03A 3I59B 3FF5A 2VE8A 1QBJA 3CJNA 4MTEA 1BI3A 2FF4A 2A61A 4L18B 3NQOA 3I58A 3BPVA 2KJBA 2FNPA 5IT3A 1ZG1A 3RTRA 5DD8A 5HS8A 4RB0A 3N97A 2EV6A 5HS7A 1K6OA 3FHZA 5TRDA 1TQIA 2P6TA 1Z91A 2FMLA 1JGSA 4GYIA 3KP2A 2ZNYA 2OD5A 1WQ2A 1BOAA 5HLIA 5CJ9A 2HGCA 1R36A 4Y15A 3KCCA 4U0WA 1SMYF 3EYIA 3G73A 1K78B 1HXDA 2V1XA 4O3MA 4N0BA 1ZRDA 4G6QA 2FBIA 1ON1A 3GFJA 4HQEA 5A2QK 4AIKA 2K27A 2OQRA 3ERED 3HSEA 1QZYA 1TBXA 2Z9OA 1JE8A 3GFLA 3ZMDA 1D8JA 2DK8A 5ERIA 3QOPA 5LHIA 1P92A 3FXQA 3BJOA 1OYIA 3TO7A 3RJPA 1S8NA 3ZMVA 5J8CA 5ICFA 2PMUA 3EDPA 3CUOA 1R23A 2XHKA 3L9FA 1XMAA 1RNLA 3QP6A 4ZH4F 4ENNA 3F3XA 3BPXA 2HWVA 3GW2A 3Q9VA 1C0WA 4LB6B 3CLOA 1GXQA 1R5GA 2XAJA 1PDNC 3GEZA 1IZ1A 2A6EF 2L4MA 2Q0OA 1YW7A 4KUMA 2DQLA 1DDNA 3I53A 2PQ8A 5LEKA 1B1BA 1KA8A 2PI0A 1Z05A 2E7WA 3E5UA 1IXRC 3HOSA 2PFBA 3I54A 1AOYA 4M72A 1GHCA 1L0OC 3V4GA 2RC4A 5JFRA 1U5TA 1U78A 2PLYA 4LG0B 4FT8A 1P4WA 3K69A 4B09A 2E1CA 4HQMA 2STWA 3E5XA 3KP4A 2DT5A 3EETA 2STTA 1EV7A 1OKRA 3LA7A 1JHFA 3SHFA 3GF2A 3LWFA 2DW4A 2XKOA 2QQAA 1RUNA 5D4SA 3W6JB 4GO1A 2VOPA 4HF2A 4Q4ZF 2JZYA 1LJ9A 4LFUA 2NYXA 3HHHA 3OV8A 2RNJA 1R58A 5LHGA 1ZG5A 5E17F 2GA1A 1I1GA 1FLIA 3KP7A 3O3KA 3R6SA 2DO7A 2MLGA 1BJAA 3KP3A 4M9XA 1ZAOA 3WTXC 5D5WB 1R22A 2FEZA 3BWGA 3ZMSA 3V7CA 2K86A 4A0XA 4KICA 2K7LA 5AONA 1UHMA 2JPBA 2F5EA 1SD6A 2FBKA 1X3UA 2HTSA 4BXUA 4YFNF 4OINF 4P9FA 1ON2A 1T0FA 2H27A 2NS0A 3KP6A 3LA3A 3I64A 2VE9A 4A12A 1P6RA 1P4XA 4U88A 4I7HA 3WU0A 2YPRA 3KZZA 2DLLA 1IRGA 2XV4S 3B73A 2DPDA 3DKWA 5HDKA 2ISYA 2YSRA 2ZMEA 3CO6C 2RQPA 3TQNA 3R0AA 4IPAA 3FMRA 4K2EA 1K79A 2EWNA 3ABTA 3I71A 4KFCA 1YS6A 4OIOF 4LLNA 3CO7C 5TJJA 1TNTA 4KDPA 3HTSB 2KIMA 3DFGA 1P4AA 5HVQC 5HLGA 3MZYA 3WODF 5AIPA 4L5IA 1LDJA 2JT1A 4HF1A 1TLHB 3U9GA 3C18A 2P6SA 1G3WA 2L4AA 1I5ZA 6PAXA 3LSTA 2IPQX 2LSOA 2P8TA 4D0PA 5FFXA 2GWRA 3IWFA 3FMSA 4MNUA 4I09A 1R7JA 1S6LA 1Z6RA 5H20A 3IKTA 1ZLJA 2FA5A 1MDMA 3ZP5A 1PP7U 1DP7P 4XSXF 1USTA 3I4PA 2LF8A 5E20A 3B02A 4HX8A 2YX7A 1XGSA 2RV8A 3LQRA 2GXGA 2KKOA 1FYMA 3HRUA 4U7BA 4LMYA 1ULYA 1HBXG 1XSDA 3E6MA 4GCVA 4HF0A 2MC3A 2XVCA 4ZYEA 2XIGA 2XKPA 2FXAA 1DPRA 1XGOA 2FBHA 2V9VA 4I98B 2H6BA 2M5WA 2O8XA 2XRNA 1U2WA 3CUQC 3K1MA 2J5OA 2DAOA 5L3CA 2IT0A 4L0ZB 4XRFA 2WTEA 2YX4A 2MA3A 4Q48A 1SMTA 4IF4A 4HZFA 3RKXA 1IXSB 1MJAA 3GZ5A 2O0YA 3HSRA 4JBAA 3ROUA 1KU7A 2O6GE 4A0YA 3J7AO 3ZN0A 4WK8F 1FSHA 1V3FA 5K5QA 5LRSA 2QQBA 2FOKA 2XASA 1KQ0A 4ESBA 4A6DA 3WTWC 1XMKA 3MZHA 2F2EA 3GYHX 5CYVA 5K1YA 2DFIA 3K9TA 1MZBA 2UXNA 3C3WA 2AXLA 4R8HA 2M45A 2E7XA 4OMYA 5FD5A 5LBQA 2KRFA 1KU3A 4GYGA 4RB1A 5IT9Z 4BQAA 3SFZA 3V8LA 1MJBA 4CXFA 4KMUX 1Z7UA 5HLHA 2D2WA 5ICEA 3K1PA 5ILUA 4HAMA 1G4DA 3PQKA 1XDSA 4RGRA 3VOEA 2QENA 2DTRA 2NNYA 4EJVA 1FP1D 2OAZA 4Z2YA 3N4MA 4UVAA 2ELHA 4LD5A 1T39A 3KLNA 4ESFA 5FD6A 3BOQA 3M8FA 3RYRA 1TW3A 5E8GA 4G6DA 2GA2A 3KEOA 5L3EA 1XGNA 3JAMZ 2BBYA 3W6KB 4KIGA 1TQPA 3SZTA 1FOKA 1UFMA 2MBFA 3TO9A 3JTGA 4YG2F 4H0EA 3C7JA 3IWZA 1J9IA 3R4KA 3JSPA 4ENKA 4I2OA 3ECOA 2HZTA 3J81Z 2VBYA 4I0AA 1UB9A 3GLXA 4ENJA 3DV8A 3EQLF 2XUBA 1FY7A 4P55A 3WTZA 4HOBA 1CGPA 2FU4A 4UUVA 4WXHA 2GAUA 5FO5A 2HEOA 3ABUA 4WX9A 2GZWA 5BOXA 2PJPA 1O3SA 1G3YA 1FZPB 1YLFA 4U7DA 5D6FA 1S7AA 3WE3A 4LGWA 3AAFA 2F5CA 2P5LC 2OZUA 2M1BA 1YFHA 5D8KB 1FYKA 5CVIA 5DUIA 4L9TA 4OU0A 1W7PB 5HDGA 2ISZA 2RKHA 5BMZA 2ESNA 2COMA 4P5OA 3WTTC 1IW7F 3P9CA 4R1HA 2EV5A 2HQNA 2L3DA 4IHSA 2ZBKA 4U0YA 3E5QA 1FT9A 1XCBA 3DQVC 5KK1A 3I0TA 4BH9A 3VEPA 1YG2A 3E3VA 3F6VA 1ZARA 1ZYRF 3C1DA 3QU6A 1E2XA 1YIOA 1B9MA 5EEGA 2A07F 4EQQA 4EV0A 1O3TA 2C6YA 3EUHA 4L5JA 1EH6A 2O61A 1W7PD 5L3GA 2QZ8A 4HV5A 1MDMB 3BJ6A 3FZVA 2W24A 3KLOA 1YO5C 3H3UA 2PG4A 1TW2A 3MQ0A 2KIUA 4OMZA 4GGGA 4LK1F 5DV5A 3ISPA 2HYGD 1LDKB 2TDXA 2JTVA 1JXSA 4P9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CF7 B;  3T1B A;  4R79 A;  1FPQ A;  5E1Z B;  2IVM A;  5DYM A;  4XLN F;  4KN7 X;  1STZ A;  3R0J A;  3E6C C;  1I6X A;  3QPT A;  3V8K A;  2P5K A;  4XBF A;  1BC8 C;  3M1E A;  1IXC A;  1HKQ A;  2HKX A;  1QO0 D;  3I59 A;  2K4J A;  3D5L A;  2QBY B;  3LAP A;  3KEQ A;  2VC0 A;  2ACJ A;  4AVP A;  3P9I A;  4RAZ A;  4BAY A;  2BV6 A;  1O7F A;  1AWC A;  4G7Z F;  1QZZ A;  3F8F A;  3JW4 A;  1U5T C;  1ZG3 A;  5CVV A;  2HYF A;  2VON A;  2V1D A;  4LK0 F;  5HOO A;  4EM0 B;  5JVT A;  2R7F A;  1O7L A;  3FMQ A;  4YIF A;  4I01 A;  1J7K A;  1B6A A;  2R7D A;  3ZMU A;  2OBP A;  4G94 A;  1JHH A;  1YQA A;  1OPC A;  2X0L A;  4YFK F;  1HW5 A;  2D1H A;  2P4W A;  1DPU A;  4ON0 A;  3LAJ A;  3FXR A;  1OR7 A;  3V7S A;  1USS A;  1IN6 A;  5BPD A;  1R00 A;  3CDH A;  5KVR A;  2BE5 F;  5JR3 A;  3MCZ A;  4IJA A;  4PCQ A;  2IW5 A;  1J59 A;  4MQV A;  2QM3 A;  3I5U A;  3T5X A;  1PP8 F;  2NNN A;  4KMF A;  4RB2 C;  3F21 A;  2D45 A;  4QWQ A;  4EGY A;  3TGN A;  2ZXJ A;  3BY6 A;  3ECH A;  2NRA C;  5BPI A;  4YFX F;  2ZFW A;  4CGZ A;  1T38 A;  3IL2 A;  3G3Z A;  1NHA A;  4EGZ A;  3TKY A;  1VTN C;  4B8X A;  4RB3 C;  4HV6 A;  3VFZ A;  3BRO A;  5CVR A;  3FM3 A;  1EH7 A;  3HRS A;  4UV8 A;  2LNB A;  2QQ9 A;  4DNC A;  4ZYG A;  3TOA A;  3VB2 A;  2L02 A;  1H9T A;  3RPQ A;  3IRR A;  4CYD A;  1T2K A;  3OOP A;  5JI6 A;  2FRH A;  2M8E A;  1HW1 A;  3E6D A;  4P96 A;  5E1X A;  2WC2 A;  4HYE A;  4ZZL A;  3K1N A;  4F7Z A;  3S2W A;  1SFE A;  4UVB A;  2VBZ A;  5D6E A;  2D1V A;  4M6X A;  4RGS A;  2XGX A;  1YW9 A;  3MAJ A;  2YR2 A;  1TQM A;  4FX0 A;  2FMY A;  3K0L A;  4MTD A;  4ZZD A;  3P7N A;  2PMH A;  3GWZ A;  1KQ8 A;  2XAH A;  3F8M A;  4EMS A;  4NB5 A;  3NEU A;  5H6Q A;  3D0S A;  3GUD A;  1QPM A;  3LQQ A;  4LB5 A;  2QUF A;  5DUK A;  4M9S A;  2QLZ A;  1BI0 A;  4RAY A;  2CQK A;  1ZRF A;  2ESH A;  3RKY A;  5D8L B;  3IC7 A;  3HTU A;  4EJW A;  4QLC U;  3FM5 A;  1IF1 A;  2G7U A;  1OMI A;  1FBS A;  2MLK A;  1W5S A;  5E18 F;  2QVO A;  3HSF A;  3L2C A;  3J80 K;  1WWX A;  2EFN A;  3K2Z A;  3GXO A;  4AIH A;  2FNA A;  4ZYD A;  5L3F A;  3DXJ F;  3GZ6 A;  4EM1 A;  1R5H A;  5LGT A;  5ICG A;  2H09 A;  3HYI A;  2FQ3 A;  1F9N A;  3SXY A;  4IVN A;  2K4B A;  2VBW A;  1FSE A;  2IA1 A;  4I0B A;  2UWM A;  2HR3 A;  3CTA A;  5LRR A;  2Y75 A;  3F8N A;  4IXA A;  1HW2 A;  1FNN A;  3T8T A;  4CZZ A;  1XB4 A;  5CVU A;  3DPL C;  2P7C B;  4BNC A;  2CWE A;  3O2P E;  4NQW A;  1ZHF A;  4L0Y B;  5LEJ A;  1LB2 A;  3TDZ C;  3RKW A;  1IN7 A;  2OQG A;  1RUO A;  2Q2E A;  4RS8 A;  4HLY A;  5K5O A;  2MD5 A;  3COA C;  4U0V A;  1F4K A;  1SAX A;  2YU3 A;  3KP5 A;  3HHG A;  4N9I A;  4O6J A;  1BI2 A;  4RGX A;  4G9Y A;  1ZGA A;  5L3D A;  2EK5 A;  4WCG A;  2KJC A;  2KIF A;  2UZK A;  1B4A A;  4KA4 A;  2Y48 A;  2GQQ A;  1KGS A;  4XLP F;  1ZGJ A;  2P5V A;  4HLX A;  3KET A;  4KYW A;  1QGP A;  4UV9 A;  1SD5 A;  4UHT A;  5DDG A;  5BQT A;  4M74 A;  1J75 A;  2EA2 A;  4JK1 X;  1WSU A;  5EEH A;  1LDD A;  2VC1 A;  1E17 A;  4EM2 A;  3BP8 A;  4GXO A;  4EJU A;  4L9N A;  1IN8 A;  3RIR A;  2W25 A;  2VN2 A;  1J2X A;  3VOD A;  1FP2 A;  2Y0M A;  2IA0 A;  3KFW X;  1LVA A;  2Z33 A;  1L3L A;  3QPH A;  2BGC A;  4HA8 A;  1IN4 A;  3V7R A;  1O57 A;  4O5V A;  4WXC A;  3J81 K;  3QU3 A;  1W5T A;  2LDU A;  1SFX A;  4OIQ F;  3BZ6 A;  5A2Q Z;  1A04 A;  2L01 A;  3WGI A;  3FX3 A;  5L3B A;  3DPT A;  5FFZ A;  1REP C;  3MEX A;  1H0M A;  4CO8 A;  4ESJ A;  4L9J A;  1XGM A;  1BIA A;  3ML6 A;  1J0R A;  5F64 A;  4UNO A;  5DCF A;  1PUE E;  2JSC A;  1O3Q A;  5FLX K;  3PFI A;  4HW0 A;  4RGU A;  2IA2 A;  3WGH A;  5ILV A;  3HIF A;  3ZN1 A;  2M30 A;  3WTS C;  2CO5 A;  2Z5U A;  3M8E A;  2EFQ A;  3QAH A;  5CVJ A;  4DQ2 A;  3DP7 A;  2VBX A;  2Q8K A;  2GIV A;  1U8R A;  1V4R A;  1KYZ A;  1W7P A;  4IHT A;  2E1N A;  1IUY A;  4N9H A;  5D4R A;  2HTJ A;  3U1D A;  2A69 F;  1BN5 A;  3T0Y A;  4AWX B;  4MGR A;  1QNT A;  1ZRC A;  1Q1H A;  1P2F A;  4IRH A;  4CDG A;  4A2U A;  4KIF A;  4M71 A;  4ETS A;  3NRV A;  2HFH A;  5F6F A;  5ED4 A;  5IT9 K;  1MGT A;  2LKP A;  3TOB A;  3RPU A;  2W85 A;  2PEX A;  2ZCW A;  3LA2 A;  5FB2 A;  5D5V B;  2PN6 A;  4BHP A;  2CSO A;  5H6R A;  1SFU A;  1T6S A;  1R1V A;  1XN7 A;  2CFX A;  4A5N A;  3WG9 A;  4ASN A;  1ZH5 A;  2XRO A;  4M9Z A;  2J5P A;  1I27 A;  2DBB A;  4WXD A;  2WWY A;  2IJL A;  3F8C A;  1R1U A;  2IP2 A;  5CLS A;  3R60 A;  4WF2 A;  1K78 A;  1Z1D A;  4Y17 A;  4E70 A;  2ADU A;  4UVC A;  3GVA A;  4M73 A;  1F5T A;  5DEQ A;  2VXZ A;  1B59 A;  1D3Y A;  4LLL A;  4A5M A;  3F72 A;  4YII A;  1RIO H;  4KIB A;  2ZKZ A;  3JSO A;  3BJA A;  3GX4 X;  1EH8 A;  1G6N A;  1FBQ A;  5AIQ A;  1CF7 A;  4FX4 A;  4MQ9 F;  2M87 A;  2LF7 A;  2ETH A;  2JRT A;  2OA4 A;  3F8B A;  1J5Y A;  3MFK A;  2H6C A;  3MWM A;  1XDU A;  3KE2 A;  4OIP F;  1IAW A;  1D8K A;  1B9N A;  2VT2 A;  2W84 A;  4IRI A;  1XCV A;  2P7V B;  4S05 A;  5ILS A;  3WTV C;  3REO A;  4HX7 A;  3GO5 A;  1HQC A;  1KQ9 A;  2ZJ2 A;  3H3Z A;  4OOI A;  1R1T A;  1TTY A;  1HST A;  2HQR A;  2A3S A;  1H9G A;  3WE2 A;  3F23 A;  4HDV A;  2K02 A;  3Q9S A;  1XSX A;  1MD0 A;  3KZY A;  4AD9 A;  1K7A A;  1YW8 A;  4PDK A;  4TV7 A;  4FHT A;  2WV0 A;  4G8X A;  1IN5 A;  3HOT A;  4PGG A;  1LEA A;  5J6X A;  1U3E M;  4EJT A;  2HDC A;  3CUQ B;  2QWW A;  2V1U A;  5JHU A;  5DCM A;  1HKS A;  2ZNZ A;  5E8I A;  3QP5 A;  1I1S A;  5HS9 A;  2CG4 A;  3IHU A;  3L7W A;  1BC7 C;  1Z9C A;  2XAF A;  3DF8 A;  2RN7 A;  4HX4 A;  2VOD A;  5LGN A;  5J8F A;  2F5D A;  4IRG A;  1D5V A;  1QQI A;  1SD7 A;  5FLX Z;  2EFO A;  2VT3 A;  3ZMT A;  3E6B A;  1O3R A;  2EFW A;  1IRF A;  1ZLK A;  3L09 A;  2R3S A;  3E97 A;  3WGG A;  1ODD A;  1U6G A;  1ONV A;  1LQ1 A;  1XD7 A;  1S3J A;  2MH9 A;  1LNW A;  2DI3 A;  1S7O A;  5FGM A;  2H94 A;  3IKV A;  3QRF F;  2EJR A;  4BYY A;  3RI4 A;  2A6H F;  3R61 A;  3H92 A;  2ZO4 A;  3T8R A;  4CHU A;  1HKT A;  1HSJ A;  3EYY A;  4MEY F;  1G3T A;  5F1R A;  5BS6 A;  2RVC A;  4XSZ F;  4G7O F;  2HKO A;  3PQJ A;  3ELK A;  1GVJ A;  3M9A A;  1BIB A;  2G9W A;  3RYP A;  2AS5 F;  3U2R A;  1FC3 A;  1KU9 A;  3FXU A;  3M7G A;  4OIR F;  4LJZ F;  3SQN A;  2BEO A;  2MH2 A;  4LG0 A;  1RZ4 A;  3IRQ A;  2IRF G;  2UXX A;  3HRT A;  4CIC A;  4ZYH A;  2G7H A;  1MKM A;  1FYL A;  3J80 Z;  3SZP A;  3FWE A;  1KYW A;  1WKM A;  4M6Y A;  4MEX F;  4ENM A;  4AIJ A;  1G3S A;  3GFI A;  1MJ9 A;  2RDP A;  3O6B B;  2QYO A;  2CW0 F;  1BBY A;  3P9K A;  1FX7 A;  4BHC A;  3L00 A;  3ZMZ A;  5LLQ A;  1SD4 A;  1TNS A;  2OZ6 A;  3CUQ A;  2VOO A;  2DPU A;  3RDI A;  5LGU A;  1XSV A;  4MHG A;  2B0L A;  5ICC A;  3F6O A;  2XAQ A;  5D5U B;  2V6C A;  4HBL A;  4BHB A;  2QBY A;  2A5Y B;  4WWC A;  4UXN A;  4Y13 A;  1ZRE A;  4I02 A;  2HS5 A;  2F5F A;  2L54 A;  1F1Z A;  3F22 A;  1UHW A;  2XAG A;  2EB7 A;  1OYW A;  3TDU C;  2EA4 A;  5E1W A;  3HUG A;  2GXB A;  2RGV A;  1OYY A;  1BI1 A;  3WU1 B;  3BDD A;  1GXP A;  2DQR A;  4JQF A;  2CGP A;  3WTY C;  2PBI A;  2O3F A;  1DUX C;  5D5X B;  3HRM A;  2A68 F;  5HDN A;  2OU2 A;  3WTU C;  1U5T B;  2W57 A;  2JPC A;  3JAM K;  1S29 A;  1YTY A;  3V8J A;  4A6E A;  1WI9 A;  1W4M A;  4PZJ A;  2V79 A;  1RI7 A;  4A0Z A;  1UCR A;  4L9V A;  5DCM B;  2BYV E;  2DK5 A;  2HOE A;  4KN4 X;  3GFM A;  5K5R A;  1YYV A;  2X4H A;  4Q47 A;  1ZN2 A;  4PGH A;  4NHJ A;  2CYY A;  2Z99 A;  1Y0U A;  3LFK A;  4G7H F;  2FE3 A;  4EVI A;  1WRJ A;  2EFP A;  1YS7 A;  4S04 A;  4KNY A;  2Z3Y A;  4KT5 C;  2EV0 A;  2NAZ A;  3DEU A;  1BM9 A;  3ZQ7 A;  5DD4 A;  4LLG F;  1LEB A;  5LHH A;  1KU2 A;  3ULQ B;  2DU9 A;  3Q5F A;  2ZME B;  1FBU A;  1Z6T A;  1FWZ A;  4EJO A;  4HDU A;  2FSW A;  3TO6 A;  3JTH A;  1T98 A;  4Q5S F;  3ZPL A;  2O03 A;  3I59 B;  3FF5 A;  2VE8 A;  1QBJ A;  3CJN A;  4MTE A;  1BI3 A;  2FF4 A;  2A61 A;  4L18 B;  3NQO A;  3I58 A;  3BPV A;  2KJB A;  2FNP A;  5IT3 A;  1ZG1 A;  3RTR A;  5DD8 A;  5HS8 A;  4RB0 A;  3N97 A;  2EV6 A;  5HS7 A;  1K6O A;  3FHZ A;  5TRD A;  1TQI A;  2P6T A;  1Z91 A;  2FML A;  1JGS A;  4GYI A;  3KP2 A;  2ZNY A;  2OD5 A;  1WQ2 A;  1BOA A;  5HLI A;  5CJ9 A;  2HGC A;  1R36 A;  4Y15 A;  3KCC A;  4U0W A;  1SMY F;  3EYI A;  3G73 A;  1K78 B;  1HXD A;  2V1X A;  4O3M A;  4N0B A;  1ZRD A;  4G6Q A;  2FBI A;  1ON1 A;  3GFJ A;  4HQE A;  5A2Q K;  4AIK A;  2K27 A;  2OQR A;  3ERE D;  3HSE A;  1QZY A;  1TBX A;  2Z9O A;  1JE8 A;  3GFL A;  3ZMD A;  1D8J A;  2DK8 A;  5ERI A;  3QOP A;  5LHI A;  1P92 A;  3FXQ A;  3BJO A;  1OYI A;  3TO7 A;  3RJP A;  1S8N A;  3ZMV A;  5J8C A;  5ICF A;  2PMU A;  3EDP A;  3CUO A;  1R23 A;  2XHK A;  3L9F A;  1XMA A;  1RNL A;  3QP6 A;  4ZH4 F;  4ENN A;  3F3X A;  3BPX A;  2HWV A;  3GW2 A;  3Q9V A;  1C0W A;  4LB6 B;  3CLO A;  1GXQ A;  1R5G A;  2XAJ A;  1PDN C;  3GEZ A;  1IZ1 A;  2A6E F;  2L4M A;  2Q0O A;  1YW7 A;  4KUM A;  2DQL A;  1DDN A;  3I53 A;  2PQ8 A;  5LEK A;  1B1B A;  1KA8 A;  2PI0 A;  1Z05 A;  2E7W A;  3E5U A;  1IXR C;  3HOS A;  2PFB A;  3I54 A;  1AOY A;  4M72 A;  1GHC A;  1L0O C;  3V4G A;  2RC4 A;  5JFR A;  1U5T A;  1U78 A;  2PLY A;  4LG0 B;  4FT8 A;  1P4W A;  3K69 A;  4B09 A;  2E1C A;  4HQM A;  2STW A;  3E5X A;  3KP4 A;  2DT5 A;  3EET A;  2STT A;  1EV7 A;  1OKR A;  3LA7 A;  1JHF A;  3SHF A;  3GF2 A;  3LWF A;  2DW4 A;  2XKO A;  2QQA A;  1RUN A;  5D4S A;  3W6J B;  4GO1 A;  2VOP A;  4HF2 A;  4Q4Z F;  2JZY A;  1LJ9 A;  4LFU A;  2NYX A;  3HHH A;  3OV8 A;  2RNJ A;  1R58 A;  5LHG A;  1ZG5 A;  5E17 F;  2GA1 A;  1I1G A;  1FLI A;  3KP7 A;  3O3K A;  3R6S A;  2DO7 A;  2MLG A;  1BJA A;  3KP3 A;  4M9X A;  1ZAO A;  3WTX C;  5D5W B;  1R22 A;  2FEZ A;  3BWG A;  3ZMS A;  3V7C A;  2K86 A;  4A0X A;  4KIC A;  2K7L A;  5AON A;  1UHM A;  2JPB A;  2F5E A;  1SD6 A;  2FBK A;  1X3U A;  2HTS A;  4BXU A;  4YFN F;  4OIN F;  4P9F A;  1ON2 A;  1T0F A;  2H27 A;  2NS0 A;  3KP6 A;  3LA3 A;  3I64 A;  2VE9 A;  4A12 A;  1P6R A;  1P4X A;  4U88 A;  4I7H A;  3WU0 A;  2YPR A;  3KZZ A;  2DLL A;  1IRG A;  2XV4 S;  3B73 A;  2DPD A;  3DKW A;  5HDK A;  2ISY A;  2YSR A;  2ZME A;  3CO6 C;  2RQP A;  3TQN A;  3R0A A;  4IPA A;  3FMR A;  4K2E A;  1K79 A;  2EWN A;  3ABT A;  3I71 A;  4KFC A;  1YS6 A;  4OIO F;  4LLN A;  3CO7 C;  5TJJ A;  1TNT A;  4KDP A;  3HTS B;  2KIM A;  3DFG A;  1P4A A;  5HVQ C;  5HLG A;  3MZY A;  3WOD F;  5AIP A;  4L5I A;  1LDJ A;  2JT1 A;  4HF1 A;  1TLH B;  3U9G A;  3C18 A;  2P6S A;  1G3W A;  2L4A A;  1I5Z A;  6PAX A;  3LST A;  2IPQ X;  2LSO A;  2P8T A;  4D0P A;  5FFX A;  2GWR A;  3IWF A;  3FMS A;  4MNU A;  4I09 A;  1R7J A;  1S6L A;  1Z6R A;  5H20 A;  3IKT A;  1ZLJ A;  2FA5 A;  1MDM A;  3ZP5 A;  1PP7 U;  1DP7 P;  4XSX F;  1UST A;  3I4P A;  2LF8 A;  5E20 A;  3B02 A;  4HX8 A;  2YX7 A;  1XGS A;  2RV8 A;  3LQR A;  2GXG A;  2KKO A;  1FYM A;  3HRU A;  4U7B A;  4LMY A;  1ULY A;  1HBX G;  1XSD A;  3E6M A;  4GCV A;  4HF0 A;  2MC3 A;  2XVC A;  4ZYE A;  2XIG A;  2XKP A;  2FXA A;  1DPR A;  1XGO A;  2FBH A;  2V9V A;  4I98 B;  2H6B A;  2M5W A;  2O8X A;  2XRN A;  1U2W A;  3CUQ C;  3K1M A;  2J5O A;  2DAO A;  5L3C A;  2IT0 A;  4L0Z B;  4XRF A;  2WTE A;  2YX4 A;  2MA3 A;  4Q48 A;  1SMT A;  4IF4 A;  4HZF A;  3RKX A;  1IXS B;  1MJA A;  3GZ5 A;  2O0Y A;  3HSR A;  4JBA A;  3ROU A;  1KU7 A;  2O6G E;  4A0Y A;  3J7A O;  3ZN0 A;  4WK8 F;  1FSH A;  1V3F A;  5K5Q A;  5LRS A;  2QQB A;  2FOK A;  2XAS A;  1KQ0 A;  4ESB A;  4A6D A;  3WTW C;  1XMK A;  3MZH A;  2F2E A;  3GYH X;  5CYV A;  5K1Y A;  2DFI A;  3K9T A;  1MZB A;  2UXN A;  3C3W A;  2AXL A;  4R8H A;  2M45 A;  2E7X A;  4OMY A;  5FD5 A;  5LBQ A;  2KRF A;  1KU3 A;  4GYG A;  4RB1 A;  5IT9 Z;  4BQA A;  3SFZ A;  3V8L A;  1MJB A;  4CXF A;  4KMU X;  1Z7U A;  5HLH A;  2D2W A;  5ICE A;  3K1P A;  5ILU A;  4HAM A;  1G4D A;  3PQK A;  1XDS A;  4RGR A;  3VOE A;  2QEN A;  2DTR A;  2NNY A;  4EJV A;  1FP1 D;  2OAZ A;  4Z2Y A;  3N4M A;  4UVA A;  2ELH A;  4LD5 A;  1T39 A;  3KLN A;  4ESF A;  5FD6 A;  3BOQ A;  3M8F A;  3RYR A;  1TW3 A;  5E8G A;  4G6D A;  2GA2 A;  3KEO A;  5L3E A;  1XGN A;  3JAM Z;  2BBY A;  3W6K B;  4KIG A;  1TQP A;  3SZT A;  1FOK A;  1UFM A;  2MBF A;  3TO9 A;  3JTG A;  4YG2 F;  4H0E A;  3C7J A;  3IWZ A;  1J9I A;  3R4K A;  3JSP A;  4ENK A;  4I2O A;  3ECO A;  2HZT A;  3J81 Z;  2VBY A;  4I0A A;  1UB9 A;  3GLX A;  4ENJ A;  3DV8 A;  3EQL F;  2XUB A;  1FY7 A;  4P55 A;  3WTZ A;  4HOB A;  1CGP A;  2FU4 A;  4UUV A;  4WXH A;  2GAU A;  5FO5 A;  2HEO A;  3ABU A;  4WX9 A;  2GZW A;  5BOX A;  2PJP A;  1O3S A;  1G3Y A;  1FZP B;  1YLF A;  4U7D A;  5D6F A;  1S7A A;  3WE3 A;  4LGW A;  3AAF A;  2F5C A;  2P5L C;  2OZU A;  2M1B A;  1YFH A;  5D8K B;  1FYK A;  5CVI A;  5DUI A;  4L9T A;  4OU0 A;  1W7P B;  5HDG A;  2ISZ A;  2RKH A;  5BMZ A;  2ESN A;  2COM A;  4P5O A;  3WTT C;  1IW7 F;  3P9C A;  4R1H A;  2EV5 A;  2HQN A;  2L3D A;  4IHS A;  2ZBK A;  4U0Y A;  3E5Q A;  1FT9 A;  1XCB A;  3DQV C;  5KK1 A;  3I0T A;  4BH9 A;  3VEP A;  1YG2 A;  3E3V A;  3F6V A;  1ZAR A;  1ZYR F;  3C1D A;  3QU6 A;  1E2X A;  1YIO A;  1B9M A;  5EEG A;  2A07 F;  4EQQ A;  4EV0 A;  1O3T A;  2C6Y A;  3EUH A;  4L5J A;  1EH6 A;  2O61 A;  1W7P D;  5L3G A;  2QZ8 A;  4HV5 A;  1MDM B;  3BJ6 A;  3FZV A;  2W24 A;  3KLO A;  1YO5 C;  3H3U A;  2PG4 A;  1TW2 A;  3MQ0 A;  2KIU A;  4OMZ A;  4GGG A;  4LK1 F;  5DV5 A;  3ISP A;  2HYG D;  1LDK B;  2TDX A;  2JTV A;  1JXS A;  4P9U A; 
#chains in the Genus database with same CATH topology
 3H0G J;  4XK4 A;  1CF7 B;  4DBQ A;  3T1B A;  2Q1Z B;  1YJN I;  3N05 A;  4R79 A;  1FPQ A;  5E1Z B;  2IVM A;  3LSI A;  5DYM A;  2IGN A;  3IH3 A;  4XLN F;  1MBE A;  4KN7 X;  4ZC3 A;  3TW6 A;  1STZ A;  3MKW B;  3VDX A;  4PSW A;  3R0J A;  3E6C C;  1TP4 A;  1I6X A;  3QPT A;  4XOP A;  3V8K A;  3ONQ A;  2P5K A;  2H8R A;  2HOS A;  1O4X A;  4XBF A;  1G8X A;  1BC8 C;  3HC7 A;  3M1E A;  2M34 A;  2MW8 A;  3BG7 A;  5HOD A;  2ZJP F;  4HNU A;  2DT6 A;  2ID6 A;  1S9H A;  2R5Y A;  1VQ6 I;  1IXC A;  1HKQ A;  2HKX A;  2ZJQ F;  1QO0 D;  1P7I A;  2LC2 A;  3I59 A;  2K4J A;  4D7M A;  3D5L A;  4GRI A;  2QBY B;  3LAP A;  2NOJ B;  3KEQ A;  2VC0 A;  2QSF X;  1X58 A;  1ETK A;  2ACJ A;  4AVP A;  2XAU A;  3P9I A;  1QU3 A;  4RAZ A;  4BAY A;  3S2H J;  2LOO A;  4Y4R A;  2IEK A;  3OIQ A;  2LRD A;  5FRN A;  2BV6 A;  3W2V A;  2JUG A;  4C3H J;  3A01 A;  1LE8 A;  3A03 A;  1O7F A;  2HPI A;  1AWC A;  3HOU J;  2I10 A;  2F4M B;  5F0H A;  5HNF A;  4G7Z F;  3PUB A;  1QZZ A;  2XF5 A;  3F8F A;  3DPU A;  2QKL B;  3JW4 A;  3KYC B;  5J1Y A;  1U5T C;  1ETO A;  1ZG3 A;  2EZH A;  5F04 A;  5EZH A;  3CZ6 A;  5CVV A;  3L2R A;  2HYF A;  2FJ1 A;  2VON A;  4E7S A;  2V1D A;  2L5Q A;  4LK0 F;  5HOO A;  3CC2 I;  4EM0 B;  5JVT A;  2R7F A;  1O7L A;  1D0Y A;  3FMQ A;  2W4S A;  3CCM I;  4YIF A;  3P5J A;  3M8J A;  4I01 A;  1J7K A;  4B48 A;  1B6A A;  4XR6 A;  5KCM A;  2R7D A;  3ZMU A;  1EA3 A;  2DA1 A;  1IV8 A;  2OBP A;  3DLA A;  4G94 A;  1JHH A;  1YQA A;  1OPC A;  2X0L A;  4BL0 B;  4YFK F;  3HOX J;  1HW5 A;  2D1H A;  2EIN H;  2PJR A;  2P4W A;  3HOW J;  1DPU A;  4ON0 A;  3LAJ A;  2IS2 A;  2ME0 A;  1EJ9 A;  3FXR A;  1OR7 A;  2K40 A;  3V7S A;  5GP9 A;  1USS A;  1IN6 A;  5BPD A;  1R00 A;  3CDH A;  5KVR A;  2BE5 F;  3CCL I;  5JR3 A;  3H35 A;  2X85 A;  2X48 A;  2K3P A;  3M3Y J;  3MCZ A;  4IJA A;  5EEA A;  2EIK H;  4PCQ A;  2IW5 A;  1J59 A;  4MQV A;  2QM3 A;  2KRH A;  2VPL A;  3I5U A;  3T5X A;  1PP8 F;  2NNN A;  4KMF A;  4RB2 C;  3FIW A;  2LYC A;  1WJB A;  5EDN A;  3HKZ A;  3F21 A;  2D45 A;  3K6G A;  4DZP A;  3BR0 A;  2DYR H;  4QWQ A;  1VI0 A;  4NC8 A;  3Q0W A;  3TGN A;  4EGY A;  4BDY A;  1MBJ A;  2ZXJ A;  3BG3 A;  3QYF A;  2VB6 A;  4G12 A;  3QYE A;  3RKQ A;  1BW5 A;  3BY6 A;  3ECH A;  1RKW A;  2NRA C;  5BPI A;  4YFX F;  2ZFW A;  2QA4 I;  3S1N J;  3K4N A;  4CGZ A;  1MMA A;  1T38 A;  3IL2 A;  3G3Z A;  1E3P A;  1NHA A;  4KIT B;  4EGZ A;  3TKY A;  1YJ9 I;  1VTN C;  4B8X A;  4RB3 C;  4HV6 A;  3VFZ A;  2EIL H;  3BRO A;  2KQR A;  5CVR A;  3RQ4 A;  3FM3 A;  1VQO I;  5B3S H;  1EH7 A;  2A5W A;  3HRS A;  4UV8 A;  2LNB A;  1VFC A;  2QQ9 A;  4IOA F;  3DTK A;  4DNC A;  1SVO A;  4RAG A;  3TOA A;  3VB2 A;  4ZYG A;  4Y52 J;  2L02 A;  1H9T A;  2RAE A;  3RPQ A;  2L7K A;  1D0X A;  3IRR A;  2Y9Y A;  4CYD A;  2MSY A;  2M0C A;  1KON A;  2CH0 A;  1T2K A;  2BY2 A;  3OOP A;  5JI6 A;  2FRH A;  2M8E A;  1HW1 A;  2DA6 A;  2LVS A;  3E6D A;  3E0J B;  4P96 A;  5E1X A;  2WC2 A;  4ZDP A;  3OYB A;  1MBH A;  4HYE A;  1MSF C;  4BQO A;  2VJI A;  4ZZL A;  2G0E A;  3K1N A;  1I3A A;  4F7Z A;  3S2W A;  3H36 A;  1SFE A;  4UVB A;  2VBZ A;  2JQ7 A;  3CC4 I;  1A31 A;  5D6E A;  2VQH A;  1BL0 A;  2D1V A;  4M6X A;  4RGS A;  2XGX A;  1YW9 A;  4BY7 J;  3VPR A;  3MAJ A;  1U9N A;  2YR2 A;  2IXS A;  4FCY A;  2DFE A;  1TQM A;  2Z2S B;  4FX0 A;  2R92 J;  2FMY A;  3K0L A;  4MTD A;  4MO7 A;  4ZZD A;  1RR8 C;  3P7N A;  2PMH A;  2XB5 A;  3GWZ A;  1KQ8 A;  2XAH A;  3F8M A;  4EMS A;  4NB5 A;  3NEU A;  5H6Q A;  3ZXS A;  2K3F A;  3OSF A;  1PUF B;  3I56 I;  4OAZ A;  1DU0 A;  3D0S A;  3GUD A;  1QPM A;  3LQQ A;  3MN2 A;  4UUS B;  4DBR A;  2NVX J;  3MD2 A;  3IH4 A;  3ZR8 X;  2QUF A;  3GTJ J;  4LB5 A;  1G2H A;  2XPV A;  5DUK A;  4M9S A;  2QLZ A;  3CJT B;  3PSF A;  4F3Q A;  4M3G A;  4AYB A;  3ZGK A;  3MKZ A;  1BI0 A;  1TWF J;  1IG7 A;  4RAY A;  2CQK A;  2CJJ A;  5B1B H;  3UKG A;  1ZRF A;  3TL4 X;  2ESH A;  3RKY A;  5D8L B;  3A1Y A;  3IC7 A;  3C2B A;  3U1K A;  4U87 A;  3HTU A;  3ZOB A;  1ZR4 A;  4EJW A;  4QLC U;  3FM5 A;  1RET A;  1IF1 A;  2DMT A;  5IYB J;  2RRE A;  4BJT A;  3CMY A;  1ZEL A;  1B72 B;  2CQX A;  1OMI A;  2G7U A;  3DBL B;  1FBS A;  2MLK A;  2CS3 A;  2LR8 A;  4HEA 2;  3I3L A;  1W5S A;  2E1M C;  1NK2 P;  1ZKG A;  2HOT A;  1HCR A;  4DIQ A;  5FKO A;  4AYB N;  5E18 F;  2QVO A;  4W97 A;  3HSF A;  3L2C A;  3J80 K;  1WWX A;  3PNY A;  5IPA A;  2EFN A;  3K2Z A;  1JUS A;  3GXO A;  2M4G A;  3FBN B;  4AIH A;  1HDP A;  3VWB A;  1XS9 A;  2FNA A;  4ZYD A;  4PUS A;  1FMW A;  2BZT A;  5L3F A;  2F4O B;  3DXJ F;  3GZ6 A;  4EM1 A;  1D5Y A;  4IHX A;  2XSJ C;  1R5H A;  5LGT A;  5ICG A;  2H09 A;  3G1O A;  3HYI A;  3BQY A;  5HNH A;  2FQ3 A;  1F9N A;  3BTI A;  3SXY A;  3OSG A;  4IVN A;  1UMQ A;  2K4B A;  2VBW A;  1FSE A;  2IA1 A;  5EGO A;  4I0B A;  2DA4 A;  2UWM A;  2HR3 A;  3CTA A;  3H5A A;  1VQ7 I;  5LRR A;  4D7N A;  5GPC A;  2Y75 A;  3F8N A;  4IXA A;  1HW2 A;  4MIM A;  1FNN A;  3H5N A;  3CF5 F;  2KHM A;  3T8T A;  4CZZ A;  2WV1 A;  5M3M J;  4JYK A;  3TED A;  1XB4 A;  5CVU A;  1NH3 A;  3DPL C;  1HLV A;  2P7C B;  1TL8 A;  1QVT A;  1ETQ A;  4KJZ A;  4BNC A;  2CWE A;  3O2P E;  2AHQ A;  4NQW A;  4CUG A;  2RNG A;  1ZHF A;  4L0Y B;  5LEJ A;  1LB2 A;  3ABL H;  4BXX J;  1MH4 A;  2E35 A;  3KIO A;  4EAT A;  1ACI A;  3TDZ C;  3RKW A;  3I4N J;  2EIJ H;  1IN7 A;  2OQG A;  1RUO A;  4CCO A;  2Q2E A;  2Y9Z A;  4RS8 A;  4XM3 A;  4W1U A;  4M3F A;  3MMY B;  1TZL A;  5B1A H;  5FKN A;  3JRD A;  4E7L A;  4HLY A;  5K5O A;  1OR7 C;  2MD5 A;  3PO2 J;  3COA C;  2RQQ A;  3QOD A;  4U0V A;  4A3M J;  1F4K A;  1SAX A;  1POG A;  4FET A;  2YU3 A;  3KP5 A;  2B7E A;  3HHG A;  3G6E I;  4N4O B;  4N9I A;  4O6J A;  1R9T J;  5J3L A;  1BI2 A;  4RGX A;  2MGQ A;  3ZQG A;  4G9Y A;  4F91 B;  1ZGA A;  5L3D A;  2EK5 A;  2ZSI B;  4RM3 A;  4WCG A;  2BW3 B;  2KJC A;  2KIF A;  3HJE A;  2UZK A;  1B4A A;  3A0H C;  2R0Q C;  4KA4 A;  2Y48 A;  2GQQ A;  3OY9 A;  4YRV A;  2PMZ A;  1JI8 A;  1KGS A;  4XLP F;  1ZGJ A;  2P5V A;  2XB0 X;  4HLX A;  4UB8 C;  3KET A;  3OYD A;  2M2E A;  4NUB A;  4KYW A;  1QGP A;  1IRX A;  4UV9 A;  1SD5 A;  2ME6 A;  2Y0S A;  1X4O A;  4UHT A;  5DDG A;  3BZK A;  1XC5 A;  2BHY A;  5BQT A;  2VQC A;  1BJZ A;  4M74 A;  1WJD A;  1J75 A;  3OS0 A;  2EA2 A;  2QQ8 A;  2VPR A;  4JK1 X;  4UUS A;  1WSU A;  5GAG J;  5EEH A;  3AG1 H;  1LDD A;  2VC1 A;  1HF0 A;  1E17 A;  5E3L A;  4EM2 A;  3BP8 A;  4GXO A;  3S14 J;  4EJU A;  1YIT I;  3K4M A;  3SFI A;  4L9N A;  2LY1 A;  1IN8 A;  3RIR A;  2W25 A;  1NG6 A;  2H8W A;  9ANT A;  2HPM A;  2VN2 A;  4XKC A;  1J2X A;  2YU9 J;  2WAE A;  3VOD A;  3G2B A;  3LSP A;  1AA7 A;  2DFF A;  5FKL A;  1BOB A;  1FP2 A;  2Y0M A;  2IA0 A;  3KFW X;  3B6C A;  3CP2 A;  1LVA A;  4OAY A;  2OV7 A;  3OMY A;  4DGW B;  1DGW Y;  2LY9 A;  4Y7N J;  3CCJ I;  2UUZ A;  1VQ5 I;  2Z33 A;  4JOM A;  3L2U A;  2ZXH A;  3FIS A;  1L3L A;  3S17 J;  1I50 J;  3QPH A;  4QSH A;  1S72 I;  2BGC A;  5E79 C;  2D5V A;  2E34 A;  4HA8 A;  3DWL E;  2KP6 A;  3V42 A;  1IN4 A;  3V7R A;  1O57 A;  4O5V A;  4WXC A;  2R5Z A;  2K9Q A;  3J81 K;  3QU3 A;  1W5T A;  1NTC A;  3HUG B;  2LDU A;  4ANJ A;  1SFX A;  2CQQ A;  2WA0 A;  3HG9 A;  4XON A;  4OIQ F;  5M5X J;  3F9K A;  3BZ6 A;  5IP7 J;  5A2Q Z;  1RRJ A;  1BA5 A;  2WY8 Q;  3EUH C;  1E3H A;  1JKO C;  2KLO A;  1A04 A;  2L01 A;  3GTO J;  1BR2 A;  1DU6 A;  3WGI A;  3FX3 A;  2IAI A;  3QQA A;  2BHZ A;  5L3B A;  3DPT A;  4PFO A;  5FFZ A;  4E7I A;  1REP C;  2VKD A;  3MEX A;  1H0M A;  3IAS 2;  4CO8 A;  2VIX A;  2V9P A;  4ESJ A;  4L9J A;  1IDY A;  1XGM A;  1BIA A;  3ML6 A;  1J0R A;  3BR2 A;  3K4L A;  5F64 A;  3L2Q A;  3HZJ A;  1GDT A;  5DCF A;  4UNO A;  2ELJ A;  1PUE E;  1LKX A;  2VQL A;  5E3N A;  2JSC A;  1T0F C;  1O3Q A;  4X6A J;  5FLX K;  3PFI A;  3H9G A;  1XG1 A;  4BE0 A;  4HW0 A;  4RGU A;  2AQF A;  2CV0 A;  4XIC A;  2IA2 A;  2DA2 A;  2R7W A;  3PNT A;  4NC7 A;  3WGH A;  1MBK A;  5ILV A;  3AL0 B;  3HIF A;  3ZN1 A;  2DOF A;  2M30 A;  2PMZ N;  3WTS C;  2CO5 A;  3VSL A;  4YEL A;  3J7Y J;  2Z5U A;  3M8E A;  2EFQ A;  1A5J A;  3QAH A;  5CVJ A;  1X1B A;  2DMU A;  4DQ2 A;  3DP7 A;  2DA3 A;  2VBX A;  2Q8K A;  2KMU A;  2GIV A;  2HDW A;  1JTY A;  3A0B C;  2XRL A;  3FXO A;  1V4R A;  4XN3 A;  1KYZ A;  5EYR A;  1U8R A;  1JT0 A;  4CSW A;  4XNF A;  5F1J A;  1W7P A;  4IHT A;  2E1N A;  2KDZ A;  2K5C A;  4HNV A;  1IUY A;  1SEU A;  4N9H A;  1V5G A;  3RCO A;  5D4R A;  2HTJ A;  3U1D A;  3GTQ J;  1LFP A;  2A69 F;  1BN5 A;  4GFB A;  3T0Y A;  1JUP A;  2R7X A;  2ZB9 A;  4AWX B;  3GLL A;  1AKH B;  2R5Z B;  4MGR A;  1OCZ H;  1PYV A;  1QNT A;  1ZRC A;  1Q1H A;  5TIS C;  2OTJ I;  1P2F A;  2QKM B;  1HC8 A;  1XX5 A;  3IAM 2;  4CA0 A;  2Z16 A;  3OYK A;  2L7F P;  4IRH A;  3HOZ J;  4CDG A;  2B9S A;  1OFC X;  2R7Q A;  3CDI A;  4A2U A;  4KIF A;  4M71 A;  3NAR A;  4ETS A;  2E2H J;  4BGD A;  3NRV A;  1R6R A;  2HFH A;  5F6F A;  5ED4 A;  1WH5 A;  3HL2 A;  2DYS H;  5IT9 K;  1MGT A;  2CUZ A;  2Y30 A;  2LKP A;  3FK7 A;  3TOB A;  3RPU A;  2W85 A;  1R4N B;  2M4K A;  3VSK A;  2PEX A;  3DCF A;  2ZCW A;  3LA2 A;  5FB2 A;  5D5V B;  2JK3 A;  2JRM A;  2AQE A;  2XPW A;  2PN6 A;  3UR3 C;  4BHP A;  2GOX B;  5DM7 F;  3Q0V A;  2CSO A;  5H6R A;  5IP6 A;  1SFU A;  3K10 A;  4D9J A;  1T6S A;  1R1V A;  1XN7 A;  1Y6I A;  2CFX A;  3PJR A;  1VZ0 A;  1MMD A;  3A01 B;  5GAH J;  1K4T A;  3OIP A;  3CCQ I;  2VI6 A;  2K9N A;  3WG9 A;  4A5N A;  4ASN A;  1ZH5 A;  2XRO A;  4M9Z A;  2J5P A;  4ZJZ A;  1I27 A;  2DBB A;  1JGG A;  2R7U A;  4WXD A;  2WWY A;  2IJL A;  3F8C A;  1R1U A;  4XLF A;  3HEF A;  3H3V K;  3S16 J;  2IP2 A;  2WAQ N;  5CLS A;  3R60 A;  4WF2 A;  1K78 A;  4A3I J;  1Z1D A;  2AXT C;  2QF7 A;  3PNV A;  3K4C A;  3NAU A;  4Y17 A;  4E70 A;  2ADU A;  4UVC A;  4B43 A;  2VLA A;  3GVA A;  4M73 A;  3CC7 I;  2JA6 J;  2CFO A;  3BR6 A;  2DTZ A;  1F5T A;  5DEQ A;  3OYC A;  2VXZ A;  2X1D A;  1B59 A;  3H0D A;  5K7H A;  1D3Y A;  2EZL A;  4LLL A;  1QRY A;  4A5M A;  5EF6 A;  3F72 A;  4YII A;  2R7R A;  1RIO H;  3DBR B;  1E3O C;  4KIB A;  2ZKZ A;  3JSO A;  3BJA A;  4M3B A;  2M7B A;  1A6Q A;  3GX4 X;  5K7Z A;  1EH8 A;  1GVD A;  3OYN A;  4M6V A;  1G6N A;  3SYT A;  4IX7 A;  1FBQ A;  5AIQ A;  1CF7 A;  4B47 A;  1N77 A;  4FX4 A;  4MQ9 F;  2R7S A;  2XGE A;  5IOZ A;  2M87 A;  4CH7 A;  2LF7 A;  2CQ7 A;  2ETH A;  2JRT A;  2OA4 A;  4F52 A;  3F8B A;  4AM3 A;  5BNG A;  1J5Y A;  3K70 D;  2GXA A;  3MFK A;  2H6C A;  3MWM A;  1XDU A;  2XDV A;  2OCC H;  1OIS A;  3J7Z I;  2HOA A;  3KE2 A;  4OIP F;  4IHY A;  1IAW A;  4II2 A;  1VQ8 I;  1D8K A;  1B9N A;  2VT2 A;  2W84 A;  4IRI A;  1XCV A;  3HPG A;  2VJ5 A;  2I8D A;  3E1S A;  1Z21 A;  2OPT A;  2P7V B;  1ERD A;  4S05 A;  3A4C A;  5ILS A;  3WTV C;  1S7E A;  2W82 A;  3G1M A;  4P1W A;  5KAI C;  2QEX I;  3REO A;  3TP0 A;  4HX7 A;  3GO5 A;  1HQC A;  3FXL A;  1KQ9 A;  3IUO A;  2ZJ2 A;  2MC4 A;  3H3Z A;  1K6Y A;  1IC8 A;  1N75 A;  4OOI A;  3EPZ A;  1R1T A;  1KZH A;  2LBF A;  1TTY A;  1HST A;  2HQR A;  4BBR J;  4BJ5 C;  1N78 A;  2CUF A;  2A3S A;  1T33 A;  3U21 A;  1H9G A;  1YX5 A;  2LTP A;  3WE2 A;  4CZC A;  3F23 A;  4IL6 C;  4HDV A;  3PIO F;  2K02 A;  3Q9S A;  1XSX A;  4PJJ A;  4BDZ A;  1MD0 A;  3KZY A;  4AD9 A;  3BTJ A;  2BVM A;  1YW8 A;  4PDK A;  4TV7 A;  3CCR I;  1LE8 B;  1K7A A;  5GTI C;  4FHT A;  2WV0 A;  4G8X A;  2JA5 J;  1IN5 A;  3HOT A;  3WU2 C;  4C3J J;  2DXI A;  4PGG A;  1LEA A;  5J6X A;  4XLE A;  1XPX A;  1U3E M;  4EJT A;  2WAD A;  1WHU A;  2QWW A;  3CUQ B;  2HDC A;  2V1U A;  1ITY A;  2DA5 A;  5JHU A;  2LBF B;  5DCM A;  3CF2 A;  2AO9 A;  3LSJ A;  1HKS A;  1PUF A;  3BCB A;  2ZNZ A;  3O8G A;  1WJ5 A;  5E8I A;  3QP5 A;  1I1S A;  4M3E A;  5HS9 A;  4XMY A;  2CG4 A;  1JUM A;  1ZTR A;  3DEW A;  5JLW A;  1W0U A;  2H1L A;  3IHU A;  2ECB A;  3L7W A;  1K4S A;  1SC7 A;  1HDD C;  1BC7 C;  2KIQ A;  3HKZ N;  1Z9C A;  2XAF A;  2GM4 A;  4IHW A;  3CDL A;  3DF8 A;  4XKB A;  5IYC J;  2OC6 A;  2RN7 A;  2CW8 A;  1UAA A;  2ELK A;  1ORK A;  4HX4 A;  2VOD A;  5LGN A;  2IS4 A;  5J8F A;  2F5D A;  4IRG A;  3LFU A;  1ZGW A;  3O8H A;  3KYL A;  1D5V A;  1QQI A;  2F48 A;  1SD7 A;  5FLX Z;  2EFO A;  3JRC A;  4IQJ A;  2VT3 A;  2O5R A;  3ZMT A;  1JKR C;  3E6B A;  3SDG A;  1O3R A;  4EEF G;  2EFW A;  1IRF A;  4A3F J;  5H2F C;  1ZLK A;  3L09 A;  4ZYA A;  4E7K A;  2R3S A;  3E97 A;  3WGG A;  3K70 C;  1QHG A;  4LIT A;  1IDZ A;  4IZZ A;  1ODD A;  1U6G A;  1ONV A;  3OYA A;  4BAC A;  4OWR B;  1LQ1 A;  3LMM A;  1XD7 A;  1S3J A;  4YEJ A;  2MH9 A;  2JMW A;  3MKY B;  1LNW A;  2DI3 A;  4DYC A;  1S7O A;  1JT6 A;  2Z1D A;  5M5Y J;  1SAU A;  3JRB A;  2TCT A;  5FGM A;  4QPQ A;  2VL8 A;  2H94 A;  3IKV A;  3QRF F;  2EJR A;  4BYY A;  1MMN A;  3RI4 A;  1TWA J;  1G59 A;  2A6H F;  1V54 H;  3R61 A;  3H92 A;  4IHV A;  2ZO4 A;  3T8R A;  4CHU A;  1HKT A;  2WB1 N;  1HSJ A;  5E3M A;  3EYY A;  4MEY F;  1G3T A;  5F1R A;  5BS6 A;  5LD2 C;  2RVC A;  4XSZ F;  3S3O A;  4G7O F;  2DMQ A;  2HKO A;  1FIA A;  3PQJ A;  4II3 A;  3ELK A;  2ID3 A;  1GVJ A;  5EJC A;  1R49 A;  3M9A A;  1BIB A;  2WAF A;  2O9L A;  2CU7 A;  1FJL A;  2G9W A;  2HQ5 A;  3RYP A;  3PIP F;  2HXI A;  2AS5 F;  3U2R A;  1FC3 A;  1GLN A;  1KU9 A;  3FXU A;  3M7G A;  4OIR F;  5J47 A;  4LJZ F;  3SQN A;  2BEO A;  3CCS I;  2MH2 A;  4LG0 A;  1RZ4 A;  3IRQ A;  2IRF G;  2UXX A;  3HRT A;  4XRS G;  4CIC A;  1DQU A;  2DN0 A;  4ZYH A;  2G7H A;  4A3L J;  1TT0 A;  3LSK A;  2DMP A;  2EH3 A;  1MKM A;  2HXO A;  3ZCO A;  1XTA A;  1FYL A;  4PSX A;  1Y1V J;  3S93 A;  3J80 Z;  2XSD C;  5JHF A;  2BY3 A;  5GTH C;  3SZP A;  3OOU A;  3FWE A;  1H89 C;  1KYW A;  1WKM A;  3AG2 H;  4M6Y A;  1YRN B;  4MEX F;  2ZME C;  4ENM A;  2EQR A;  1RC9 A;  2ZC2 A;  4E6K G;  3CME I;  4N4N B;  4AIJ A;  3PO3 J;  3I4M J;  1G3S A;  3GFI A;  2NVU B;  3BG5 A;  2O7O A;  5J40 A;  1MJ9 A;  2RDP A;  2TRT A;  4XRS A;  3O6B B;  1X2N A;  2DOD A;  3Q3S A;  2XC7 A;  2QYO A;  2JWT A;  2CW0 F;  4ABZ A;  2KZG A;  3M1C A;  4B4C A;  1BBY A;  3KZI C;  3P9K A;  1IUF A;  1FX7 A;  4BHC A;  3DTI A;  3L00 A;  3ZMZ A;  5LLQ A;  1YRN A;  1SD4 A;  1TNS A;  2OZ6 A;  2V9K A;  3CUQ A;  3IH2 A;  4D5F A;  2DPU A;  2VOO A;  3RDI A;  4BS9 A;  5LGU A;  4BEH B;  1XSV A;  1UG0 A;  4MHG A;  2B0L A;  3RPU D;  3F0C A;  1IRZ A;  5ICC A;  3F6O A;  4F93 B;  2XAQ A;  1Q1V A;  3KPH A;  5D5U B;  3H5R A;  1A36 A;  2V6C A;  4HBL A;  1WJF A;  2ZJR F;  1OCC H;  3WG7 H;  5C4J J;  4MLO A;  1Y8R B;  4BHB A;  3L1P A;  2QBY A;  2A5Y B;  3OS2 A;  3BCA A;  4WWC A;  2FX0 A;  4DOZ A;  4UXN A;  4Y13 A;  2KDO A;  2GLO A;  3UNG C;  1ZRE A;  4I02 A;  3D1N I;  2HS5 A;  2F5F A;  2L54 A;  4PJ0 C;  1F1Z A;  3OL4 A;  2EIM H;  3F22 A;  2Y2Z A;  3HPH A;  1UHW A;  2XAG A;  2WB1 A;  2EB7 A;  1OYW A;  3TDU C;  2E19 A;  2Y0S N;  1X2M A;  3K4J A;  2EA4 A;  3QWL A;  1T08 B;  1YX3 A;  1X3Z B;  2K85 A;  5E1W A;  3HUG A;  4MFE A;  2CV2 A;  3GTL J;  2GXB A;  2M3A A;  2RGV A;  2XGD A;  1OYY A;  1BI1 A;  3WU1 B;  3BDD A;  2IS6 A;  1GXP A;  2HVS A;  5F27 A;  5FKK A;  3HXL A;  2DQR A;  2DFH A;  4JQF A;  1WCM J;  3TBI A;  3JRI A;  2M8G X;  3I9V 2;  3QPS A;  2CGP A;  1MND A;  3WTY C;  1SFK A;  3QPL A;  2PBI A;  3PL8 A;  1DP3 A;  3G1L A;  1I6H J;  2O3F A;  3ESW B;  5TGT A;  1DUX C;  5D5X B;  2X9D A;  3HRM A;  4XLA A;  2A68 F;  5HDN A;  2O8K A;  2OU2 A;  3K4K A;  2IGO A;  3WTU C;  1U5T B;  4AID A;  2W57 A;  5GAE J;  2JPC A;  3JAM K;  1S29 A;  2E2I J;  1YTY A;  3V8J A;  4A6E A;  3CCV I;  4NBQ A;  1WI9 A;  1W4M A;  1R5I D;  4PZJ A;  2CW7 A;  2F4I A;  2V79 A;  1RI7 A;  4RAF A;  4FE4 A;  4LIV A;  4A0Z A;  4F92 B;  1XMX A;  4QIW N;  1UCR A;  4L9V A;  5DCM B;  2BYV E;  2DK5 A;  2HOE A;  4C30 A;  4KN4 X;  3J7A Y;  3HDD A;  3GFM A;  5K5R A;  1YYV A;  2X4H A;  1Z67 A;  4Q47 A;  2OF7 A;  2L9N A;  1ZN2 A;  4PGH A;  5IYD J;  1UZC A;  4NHJ A;  4BE2 A;  2VKH A;  1HA8 A;  2CYY A;  3ASN H;  2Z99 A;  1Y0U A;  3LFK A;  4G7H F;  3DKY A;  2FE3 A;  4EVI A;  2KRC A;  1WRJ A;  3BTC A;  2EFP A;  1YS7 A;  5B66 C;  4CYC B;  1Y0N A;  1WGX A;  4S04 A;  4KNY A;  1TWC J;  3GZN B;  2Z3Y A;  4KT5 C;  1FOW A;  2EV0 A;  2NAZ A;  3DEU A;  1BM9 A;  3ZQ7 A;  5J1R A;  5DD4 A;  4LLG F;  1LEB A;  5LHH A;  1B8I A;  4AUX A;  1U9O A;  1KU2 A;  4RMN A;  3ULQ B;  4BQN A;  2DU9 A;  3Q5F A;  1OCR H;  1MNM C;  1SVM A;  2ZME B;  1FBU A;  1Z6T A;  1FWZ A;  4BY1 J;  4EJO A;  4NNJ A;  2VXD A;  1F43 A;  3FXJ A;  2DDA A;  4HDU A;  2FSW A;  3JRH A;  3TO6 A;  2JJ7 A;  3JTH A;  1ETV A;  3DTE A;  3KEY A;  1U8B A;  1JTX A;  1T98 A;  4Q5S F;  3ZPL A;  2O03 A;  1CQT A;  3OYJ A;  3I59 B;  4E7Z A;  2NVQ J;  3FF5 A;  2VE8 A;  3SDB A;  1QBJ A;  3OYM A;  2V4J C;  3CJN A;  2QSH X;  1MBF A;  4MTE A;  4DYR A;  3JRA A;  1BI3 A;  1FTT A;  1Z77 A;  4Y33 A;  2VKE A;  2FF4 A;  2A61 A;  4A3G J;  4L18 B;  4RLQ A;  3NQO A;  3I58 A;  3BPV A;  3CES A;  2KJB A;  4HRI A;  2FNP A;  5IT3 A;  1ZG1 A;  1VQK I;  4Y3O A;  3RTR A;  5DD8 A;  3ZQQ A;  5HS8 A;  4RB0 A;  3N97 A;  3LSH A;  2EV6 A;  2LG4 A;  5HS7 A;  3FKI J;  1K6O A;  3FHZ A;  4FIS A;  5TRD A;  3CJR B;  1TQI A;  3JRF A;  2P6T A;  1FOY A;  1Z91 A;  2FML A;  3BG6 A;  2HVQ A;  5DM6 F;  5JLX A;  1JGS A;  4GYI A;  3KP2 A;  4UUT A;  2ZNY A;  2OD5 A;  3SZG A;  3VYR B;  1WQ2 A;  1BOA A;  2DOE A;  2JN6 A;  5HLI A;  5CJ9 A;  1VQ4 I;  2HGC A;  3PFY A;  1R36 A;  3JRG A;  4Y15 A;  3KCC A;  2P81 A;  2NVT J;  3K4B A;  1BR1 A;  1RR7 A;  1SVL A;  1A6I A;  4RM2 A;  4U0W A;  5LFA A;  3CCE I;  5M5W J;  1V5E A;  1SMY F;  2DT7 B;  3EYI A;  3C2G A;  3G73 A;  3CD6 I;  1K78 B;  1HXD A;  2V1X A;  3BR1 A;  2JA7 J;  4O3M A;  1VND A;  4N0B A;  1ZRD A;  4PJL A;  4G6Q A;  5C44 J;  2FBI A;  3BT9 A;  4L5E A;  3DKX A;  1YI2 I;  3TP3 A;  1ON1 A;  3FDY A;  4LG3 A;  3GFJ A;  1APL C;  4PFP A;  4HQE A;  5A2Q K;  2OTL I;  5B5E C;  4AIK A;  2K27 A;  2OQR A;  3PSI A;  3OR1 C;  3ERE D;  3HSE A;  1QZY A;  1TBX A;  3S3N A;  2Z9O A;  1JE8 A;  3GFL A;  1X1C A;  3ZMD A;  1D8J A;  1H8A C;  1D1A A;  5F0C A;  2IGM A;  4IO9 F;  1IV6 A;  2DK8 A;  5ERI A;  3QOP A;  2VQG A;  2WAQ A;  5LHI A;  2L9V A;  2N8G A;  1HOM A;  1P92 A;  1K83 J;  2NXN B;  4NC6 A;  4GDF A;  3OR2 C;  3FXQ A;  3BJO A;  1OYI A;  3GTG J;  3TO7 A;  3RJP A;  2M9H A;  1S8N A;  3ZMV A;  5J8C A;  5ICF A;  2PMU A;  3EDP A;  3CUO A;  2JVH A;  3RQI A;  1ETY A;  1E0E A;  3TW7 A;  1R23 A;  2XF7 A;  2EPF A;  5IY5 H;  4C2M J;  2XHK A;  2LKX A;  3L9F A;  1XMA A;  1RNL A;  4B44 A;  3ABK H;  3X2Q H;  1QHH D;  3QP6 A;  4ZH4 F;  4ENN A;  1B72 A;  3KYD B;  4BJ6 C;  3F3X A;  3BPX A;  4H4K C;  3G71 I;  1ZQ3 P;  3LSM A;  2HWV A;  3LNQ A;  3HM5 A;  3GW2 A;  2EBI A;  3Q9V A;  1C0W A;  1MBG A;  4BUP A;  4LB6 B;  3S1M J;  4CCM A;  3CLO A;  1FOX A;  1GXQ A;  1R5G A;  2XAJ A;  2UV1 A;  1PDN C;  3BR3 A;  3GEZ A;  2FD5 A;  1MW7 A;  1MMS A;  1W0T A;  1AKH A;  1IZ1 A;  2LKS A;  1VQP I;  2A6E F;  2L4M A;  1FIP A;  5GAD J;  2HVR A;  2Q0O A;  1YW7 A;  4RBO A;  2MD0 A;  1NG7 A;  4KUM A;  2DQL A;  1DDN A;  3I53 A;  2PQ8 A;  1W36 C;  5LEK A;  1B1B A;  5IP9 J;  1QPI A;  1KA8 A;  2FUG 2;  2PI0 A;  1Z05 A;  2E7W A;  1Y56 A;  3E5U A;  4UY8 I;  3MZ8 A;  2X6Y A;  3OYL A;  1IXR C;  4A69 C;  2L9R A;  1P9Q C;  4BXF A;  3HOS A;  1OQY A;  4PJN A;  4RA2 A;  2PFB A;  3I54 A;  2KL4 A;  1D1C A;  3GTM J;  1JKQ C;  1AOY A;  4M72 A;  3SEQ A;  4FQG A;  1VQM I;  2F6C A;  3M4O J;  1L0O C;  3V4G A;  2RC4 A;  1GHC A;  5JFR A;  1U5T A;  1D1B A;  4C9Y A;  1U78 A;  5CQG A;  1PJR A;  2PLY A;  4LG0 B;  5C3E J;  1AHD P;  4FT8 A;  1P4W A;  3K69 A;  4B09 A;  2E1C A;  4HQM A;  2STW A;  3E5X A;  3KP4 A;  2V6E A;  5EG0 B;  2DT5 A;  3S3M A;  2X6O A;  1D0Z A;  3EET A;  2STT A;  1EV7 A;  1OKR A;  3LA7 A;  2L0K A;  3W6V A;  1NK3 P;  2JVG A;  5KHD A;  2DDB A;  4XKV A;  1JHF A;  3SHF A;  1Y39 A;  3GF2 A;  3LWF A;  1N25 A;  2DW4 A;  2OUM A;  2XKO A;  2R7O A;  2QQA A;  1RUN A;  5D4S A;  1R4M B;  4DZJ A;  3W6J B;  1R71 A;  4GO1 A;  2VOP A;  2KPM A;  2W00 A;  1UJ8 A;  3Q0U A;  4HF2 A;  4Q4Z F;  2L7Z A;  2JZY A;  2BW3 A;  1RKT A;  1WJA A;  5J1U A;  2YUS A;  2FOW A;  1LJ9 A;  2E1M B;  4LFU A;  2NYX A;  3HHH A;  4RLF A;  3OV8 A;  3A2K A;  3MVP A;  2RNJ A;  3VYU B;  2YS9 A;  1QVU A;  2JA2 A;  1R58 A;  2HI3 A;  1UG2 A;  5LHG A;  1ZG5 A;  2R7Z J;  2MG4 A;  5E17 F;  1WPK A;  5FLV A;  1F36 A;  3ZQI A;  3ZQH A;  2GA1 A;  1VQL I;  3K7A J;  1I1G A;  1FLI A;  1ENH A;  3KP7 A;  3O3K A;  3R6S A;  4LIU A;  2DO7 A;  3D5S C;  4XOR A;  2MLG A;  3CMM A;  3FBI B;  4DJA A;  2BXY A;  1BJA A;  3K2A A;  3KP3 A;  1WH7 A;  3OIO A;  4M9X A;  4KT6 A;  4BE1 A;  2XGC A;  3TMO A;  1ZAO A;  2CMP A;  1P7J A;  1U0J A;  3SJM A;  1MNE A;  4BU2 A;  3WTX C;  4RDU A;  2LK2 A;  2HU9 A;  5D5W B;  1R22 A;  2EZI A;  4XLH A;  2FEZ A;  3BWG A;  3ZMS A;  3V7C A;  5EG0 A;  2A05 A;  4BEH A;  2K86 A;  4A0X A;  4HST A;  1FEX A;  4G6T B;  4KIC A;  2K7L A;  5AON A;  4LOC A;  1H88 C;  1UHM A;  4CCN A;  2JPB A;  2F5E A;  1SD6 A;  2FBK A;  1Z7L A;  4B1R A;  3FK6 A;  3MKL A;  4C2U A;  1K61 A;  1X3U A;  2HTS A;  3LL7 A;  2X6W A;  5J4V A;  3M07 A;  2LH9 A;  2DJN A;  4BXU A;  4YFN F;  4FTH A;  4OIN F;  4P9F A;  2NS7 A;  1ON2 A;  3CLQ A;  1T0F A;  1Z3X A;  5FRO A;  2H27 A;  1X3W B;  1GV5 A;  1LVK A;  4A3E J;  2NS0 A;  3KP6 A;  2BOL A;  3LA3 A;  3I64 A;  2M7A A;  1X4P A;  3OWT A;  2VE9 A;  2KFD A;  4A12 A;  1OCT C;  1P6R A;  2OCE A;  3GBG A;  2W48 A;  3S2D J;  2WY7 Q;  1P4X A;  4U88 A;  4I7H A;  3LSG A;  2YPR A;  3KZZ A;  3WU0 A;  3ZQL A;  1ETW A;  2DLL A;  3HGY A;  1IRG A;  3AG4 H;  4CCJ A;  2XV4 S;  4A3K J;  3B73 A;  2DPD A;  1TWH J;  5F08 A;  3DKW A;  5HDK A;  2ISY A;  2YSR A;  2X51 A;  2R4G A;  3OYG A;  2ZME A;  3RZD J;  4IKF A;  3CO6 C;  2RQP A;  3TQN A;  3CQZ J;  3R0A A;  4CCK A;  1IJW C;  4IPA A;  3FMR A;  4K2E A;  4A3C J;  3C2H A;  1K79 A;  2EWN A;  3S8P A;  2F5V A;  3ABT A;  3BC8 A;  3I71 A;  4KFC A;  2E2J J;  1YS6 A;  5FJ8 J;  1ZR2 A;  4OIO F;  3WHC A;  4LLN A;  3CO7 C;  1IGN A;  1DGR M;  3NWS A;  4MFD A;  1SAN A;  2COB A;  5TJJ A;  2JA8 J;  1TNT A;  4KDP A;  4XL9 A;  4BBS J;  4ZTJ A;  2LY2 A;  1JJ6 C;  3HTS B;  2KIM A;  3LSR A;  3DFG A;  1P4A A;  5HVQ C;  5HLG A;  3MZY A;  5CQE A;  3WOD F;  3IV5 A;  5AIP A;  1B8I B;  2OJE D;  4L5I A;  1LDJ A;  2JT1 A;  1YJW I;  3PM1 A;  4HF1 A;  1TLH B;  3U9G A;  3C18 A;  2P6S A;  1G3W A;  4E4H A;  5F0F A;  2CV1 A;  3DEE A;  2L4A A;  2R5Y B;  3A02 A;  2ZSH B;  3EUA A;  4NDL A;  1I5Z A;  4KIS A;  1EKE A;  6PAX A;  3IP4 B;  3LST A;  1WI3 A;  4V2G A;  2IPQ X;  2LSO A;  4JP0 A;  4QPO A;  2ICW G;  2P8T A;  4D0P A;  5FFX A;  2GWR A;  3IWF A;  2LRE A;  3FMS A;  4MNU A;  4I09 A;  1A35 A;  2X1C A;  1W36 D;  2VKV A;  1TT5 B;  1R7J A;  1S6L A;  4HG2 A;  4NQW B;  1Z6R A;  1MH3 A;  3ZRG A;  3DBH B;  5H20 A;  3IKT A;  2IS1 A;  4ZDO A;  1ZLJ A;  2FA5 A;  5FKM A;  1T8I A;  1MDM A;  3ZP5 A;  1PP7 U;  1DP7 P;  4XSX F;  1UST A;  3I4P A;  2LF8 A;  2LD5 A;  2BY0 A;  1V55 H;  2R7T A;  5E20 A;  3GCM A;  2Q2E B;  3B02 A;  4HX8 A;  2YX7 A;  1XGS A;  4F55 A;  2E36 A;  2RV8 A;  3DU5 A;  5KAF C;  3CCU I;  3LQR A;  2K9S A;  2GXG A;  2M0M A;  2KKO A;  1FYM A;  3HRU A;  4U7B A;  4LMY A;  1ULY A;  3D5R C;  5DS9 A;  1HBX G;  3W3C A;  1XSD A;  3E6M A;  1YHQ I;  4GCV A;  4HF0 A;  2DJI A;  2MC3 A;  2XVC A;  4ZYE A;  2W7N A;  1MSE C;  1VF9 A;  2XIG A;  4Z6Y A;  4AC0 A;  2XKP A;  1W5C C;  2FXA A;  2CUE A;  3CJQ B;  1DPR A;  1QA6 A;  1XGO A;  2HNH A;  2FBH A;  3OL3 A;  3S1Q J;  3JR9 A;  2V9V A;  3W2W A;  4I98 B;  1VQN I;  2H6B A;  2HQA A;  2M5W A;  2O8X A;  4M3D A;  1WJC A;  4JX4 A;  2XRN A;  1MMG A;  1U2W A;  3CUQ C;  3K1M A;  2J5O A;  3I55 I;  2DAO A;  1MIJ A;  2K9L A;  5M3F J;  1JJ8 C;  3WHB A;  1X1D A;  5L3C A;  2BXZ A;  2KT0 A;  3DU6 A;  2A6T A;  2IT0 A;  4IEJ A;  4XKW A;  4L0Z B;  4XRF A;  2WTE A;  2LMD A;  2IGK A;  1OCO H;  1T95 A;  2YX4 A;  1LFB A;  2MA3 A;  4Q48 A;  1SMT A;  4IF4 A;  4HZF A;  2VAS A;  3RKX A;  1IXS B;  1MJA A;  3GZ5 A;  4XLC A;  2O0Y A;  3HSR A;  4JBA A;  3ROU A;  1KU7 A;  2O6G E;  3VYT B;  4A0Y A;  3J7A O;  4DYQ A;  3GME A;  4J01 A;  3ZN0 A;  3B6A A;  4WK8 F;  4J00 A;  1FSH A;  1V3F A;  5K5Q A;  3VYS B;  5LRS A;  2QQB A;  2FOK A;  1WVR A;  2XAS A;  1KQ0 A;  4ESB A;  2Y69 H;  2JUC A;  2K9M A;  1ZK8 A;  5IOY A;  4A6D A;  4C2T A;  4E7H A;  3WTW C;  3ERM A;  1XMK A;  3MZH A;  2F2E A;  3GYH X;  1W1W E;  5CYV A;  2P0W A;  3S15 J;  2DOA A;  2BY1 A;  2NVY J;  4I99 C;  3QYB A;  4BKX A;  2GOM A;  3QOE A;  4CYC A;  3L2W A;  5K1Y A;  2QSG X;  2V7F A;  2DFI A;  3K9T A;  4B3A A;  4E7J A;  1MZB A;  3S32 A;  2UXN A;  3HOV J;  3C3W A;  2AXL A;  4R8H A;  2M45 A;  2E7X A;  4OMY A;  5FD5 A;  1GT0 C;  2HYJ A;  2MAB A;  4PJM A;  5LBQ A;  2KRF A;  2ECC A;  3KX2 A;  2R93 J;  1KU3 A;  4GYG A;  4RB1 A;  5IT9 Z;  3H9J A;  4BQA A;  3SFZ A;  3V8L A;  1BR4 A;  1MJB A;  3H1C A;  4S0H B;  4CXF A;  5GPA A;  4KMU X;  2L2O A;  3OYE A;  1Z7U A;  4IQ4 A;  2D2W A;  5HLH A;  3OYF A;  2LP0 A;  5ICE A;  3K1P A;  3OS1 A;  4XOT A;  5ILU A;  4HAM A;  1G4D A;  2WBM A;  3GTP J;  3PQK A;  1XDS A;  1OJL A;  1SFO J;  4RGR A;  3VOE A;  2QEN A;  2DTR A;  2HZD A;  5KNL A;  2NNY A;  1UHS A;  5K7F A;  3AL0 C;  2DMN A;  2B63 J;  4C3I J;  4EJV A;  1FP1 D;  2LFB A;  4I6Z A;  2OAZ A;  4Z2Y A;  3N4M A;  3HB9 A;  3ZQF A;  4UVA A;  3E7L A;  4ZTF A;  2ELH A;  4AVZ A;  4LD5 A;  1T39 A;  2JSP A;  3KLN A;  2ZFU A;  4ESF A;  5FD6 A;  1OLT A;  3BOQ A;  3M8F A;  3RYR A;  2E5Z A;  1TW3 A;  5E8G A;  3ABM H;  4FAS D;  3ZQC A;  3OYI A;  2XF6 A;  2GA2 A;  4G6D A;  3KEO A;  5L3E A;  1XGN A;  3CMA I;  3JAM Z;  1VQ9 I;  2BBY A;  3DLL F;  3FHN A;  3W6K B;  4PK4 A;  4KIG A;  1TQP A;  3EUK L;  3SZT A;  1FOK A;  2R7V A;  1UFM A;  1I39 A;  3H9Q A;  3AFH A;  2MBF A;  3TO9 A;  4XID A;  3JTG A;  2MYS A;  4YG2 F;  1LFU P;  4H0E A;  3C7J A;  2GIZ A;  4JX5 A;  5J4Y A;  1I3Q J;  3IWZ A;  1ETX A;  4X0G A;  1J9I A;  2H1K A;  3R4K A;  3JSP A;  4ENK A;  4I2O A;  3ECO A;  2HZT A;  4D1Q A;  3J81 Z;  3BLY A;  2VBY A;  4I0A A;  1UB9 A;  3JCU C;  2E71 A;  3GLX A;  4ENJ A;  3HOY J;  4HSR A;  3DV8 A;  3EQL F;  3BTL A;  2XUB A;  1FY7 A;  2QCO A;  4P55 A;  1IO2 A;  3WTZ A;  4HOB A;  1TWG J;  4I76 A;  2FU4 A;  1CGP A;  1M1E B;  2CUJ A;  1GUU A;  2X1E A;  2PJR B;  4UUV A;  3BR5 A;  4WXH A;  2EZK A;  4DW6 A;  2VJJ A;  2GAU A;  5FO5 A;  2HEO A;  3ABU A;  3JRE A;  4WX9 A;  1YIJ I;  3AKZ A;  2GZW A;  5BOX A;  2PJP A;  2VUM J;  4A3B J;  3LOC A;  4V19 K;  1O3S A;  1G3Y A;  1WJE A;  1FZP B;  1X1A A;  1YLF A;  4U7D A;  5D6F A;  1UEL B;  5CKT A;  2XPU A;  4XRM A;  1S7A A;  3WE3 A;  1AU7 A;  1RPW A;  4D5C A;  5EGO B;  4LGW A;  3AAF A;  4A93 J;  2F5C A;  4YIR X;  2V26 A;  5DTD A;  1S5L C;  3G4S I;  2ZXW H;  2P5L C;  5C4X J;  2OZU A;  2M1B A;  1YFH A;  5D8K B;  3ASO H;  2KZV A;  2DA7 A;  1LUJ B;  4BQQ A;  1FYK A;  3HBL A;  5CVI A;  3BZC A;  4XN0 A;  5DUI A;  1OCP A;  2BVL A;  4UB6 C;  2HDD A;  2VJ4 A;  3AG3 H;  4L9T A;  4OU0 A;  1W7P B;  2X6X A;  4HPQ A;  5HDG A;  2ISZ A;  2I5U A;  2QGU A;  2RKH A;  3HGG A;  3PUF A;  2ESN A;  5BMZ A;  2COM A;  2CRG A;  4P5O A;  1IW7 F;  4QTR A;  3P9C A;  4JX6 A;  2IBD A;  4R1H A;  3WTT C;  1BW6 A;  2EV5 A;  2NOG A;  3NWT A;  1FTZ A;  2W1O A;  2HQN A;  2L3D A;  4IHS A;  1X1P A;  5EZG A;  3W2A A;  5HLT A;  2ZBK A;  3CP8 A;  2E60 A;  3L2V A;  1JKP C;  2LLK A;  4U0Y A;  1Z0X A;  1FMV A;  1T56 A;  3E5Q A;  3S1R J;  1FT9 A;  1XCB A;  3DQV C;  4J19 A;  2V1N A;  3CCY A;  5KK1 A;  4B3X A;  1Y8Q B;  1J09 A;  3I0T A;  4HNT A;  2MFZ A;  1Z3Y A;  4BH9 A;  3VEP A;  1YE9 A;  2E5N A;  1YG2 A;  3SEZ A;  3E3V A;  3F6V A;  2Y31 A;  1ZAR A;  1ZYR F;  2GBY A;  3C1D A;  3QU6 A;  4AU7 A;  4CCL A;  1LPQ A;  1E2X A;  1YIO A;  1X19 A;  1Y1W J;  1TC3 C;  4IOC F;  1B9M A;  5EEG A;  5FLM J;  3BG9 A;  5JVG F;  2A07 F;  4ZDL A;  4EQQ A;  4EV0 A;  1PVE A;  1O3T A;  2C6Y A;  1V5F A;  4XQF A;  4FE7 A;  5CPR B;  3OYH A;  3EUH A;  4L5J A;  2KIS A;  1EH6 A;  2O61 A;  3RZO J;  1W7P D;  2L9S A;  1YOV B;  2PX9 A;  5L3G A;  1GV2 A;  3BQZ A;  1WFX A;  2DCE A;  2E1O A;  2QZ8 A;  4ITV A;  1WZ2 A;  3FKJ A;  4HV5 A;  1MDM B;  4A3D J;  3BJ6 A;  3FZV A;  2W24 A;  3KLO A;  1YO5 C;  1RES A;  3H3U A;  5FRM A;  3FXK A;  2PG4 A;  1TW2 A;  3FXM A;  4X1E A;  3MQ0 A;  2NS8 A;  2L7M P;  2KIU A;  4OMZ A;  4A3J J;  4GGG A;  4LK1 F;  2ZXI A;  5DV5 A;  1QZE A;  3ISP A;  2HYG D;  1EF4 A;  1LDK B;  5E3O A;  2FQ4 A;  3RSN A;  2CQN A;  4V2F A;  2TDX A;  2JTV A;  3GTK J;  1JXS A;  4P9U A; 
#chains in the Genus database with same CATH homology
 1CF7 B;  3T1B A;  4R79 A;  1FPQ A;  5E1Z B;  2IVM A;  5DYM A;  4XLN F;  4KN7 X;  1STZ A;  3R0J A;  3E6C C;  1I6X A;  3QPT A;  3V8K A;  2P5K A;  4XBF A;  1BC8 C;  3M1E A;  1IXC A;  1HKQ A;  2HKX A;  1QO0 D;  3I59 A;  2K4J A;  3D5L A;  2QBY B;  3LAP A;  3KEQ A;  2VC0 A;  2ACJ A;  4AVP A;  3P9I A;  4RAZ A;  4BAY A;  2BV6 A;  1O7F A;  1AWC A;  4G7Z F;  1QZZ A;  3F8F A;  3JW4 A;  1U5T C;  1ZG3 A;  5CVV A;  2HYF A;  2VON A;  2V1D A;  4LK0 F;  5HOO A;  4EM0 B;  5JVT A;  2R7F A;  1O7L A;  3FMQ A;  4YIF A;  4I01 A;  1J7K A;  1B6A A;  2R7D A;  3ZMU A;  2OBP A;  4G94 A;  1JHH A;  1YQA A;  1OPC A;  2X0L A;  4YFK F;  1HW5 A;  2D1H A;  2P4W A;  1DPU A;  4ON0 A;  3LAJ A;  3FXR A;  1OR7 A;  3V7S A;  1USS A;  1IN6 A;  5BPD A;  1R00 A;  3CDH A;  5KVR A;  2BE5 F;  5JR3 A;  3MCZ A;  4IJA A;  4PCQ A;  2IW5 A;  1J59 A;  4MQV A;  2QM3 A;  3I5U A;  3T5X A;  1PP8 F;  2NNN A;  4KMF A;  4RB2 C;  3F21 A;  2D45 A;  4QWQ A;  4EGY A;  3TGN A;  2ZXJ A;  3BY6 A;  3ECH A;  2NRA C;  5BPI A;  4YFX F;  2ZFW A;  4CGZ A;  1T38 A;  3IL2 A;  3G3Z A;  1NHA A;  4EGZ A;  3TKY A;  1VTN C;  4B8X A;  4RB3 C;  4HV6 A;  3VFZ A;  3BRO A;  5CVR A;  3FM3 A;  1EH7 A;  3HRS A;  4UV8 A;  2LNB A;  2QQ9 A;  4DNC A;  4ZYG A;  3TOA A;  3VB2 A;  2L02 A;  1H9T A;  3RPQ A;  3IRR A;  4CYD A;  1T2K A;  3OOP A;  5JI6 A;  2FRH A;  2M8E A;  1HW1 A;  3E6D A;  4P96 A;  5E1X A;  2WC2 A;  4HYE A;  4ZZL A;  3K1N A;  4F7Z A;  3S2W A;  1SFE A;  4UVB A;  2VBZ A;  5D6E A;  2D1V A;  4M6X A;  4RGS A;  2XGX A;  1YW9 A;  3MAJ A;  2YR2 A;  1TQM A;  4FX0 A;  2FMY A;  3K0L A;  4MTD A;  4ZZD A;  3P7N A;  2PMH A;  3GWZ A;  1KQ8 A;  2XAH A;  3F8M A;  4EMS A;  4NB5 A;  3NEU A;  5H6Q A;  3D0S A;  3GUD A;  1QPM A;  3LQQ A;  4LB5 A;  2QUF A;  5DUK A;  4M9S A;  2QLZ A;  1BI0 A;  4RAY A;  2CQK A;  1ZRF A;  2ESH A;  3RKY A;  5D8L B;  3IC7 A;  3HTU A;  4EJW A;  4QLC U;  3FM5 A;  1IF1 A;  2G7U A;  1OMI A;  1FBS A;  2MLK A;  1W5S A;  5E18 F;  2QVO A;  3HSF A;  3L2C A;  3J80 K;  1WWX A;  2EFN A;  3K2Z A;  3GXO A;  4AIH A;  2FNA A;  4ZYD A;  5L3F A;  3DXJ F;  3GZ6 A;  4EM1 A;  1R5H A;  5LGT A;  5ICG A;  2H09 A;  3HYI A;  2FQ3 A;  1F9N A;  3SXY A;  4IVN A;  2K4B A;  2VBW A;  1FSE A;  2IA1 A;  4I0B A;  2UWM A;  2HR3 A;  3CTA A;  5LRR A;  2Y75 A;  3F8N A;  4IXA A;  1HW2 A;  1FNN A;  3T8T A;  4CZZ A;  1XB4 A;  5CVU A;  3DPL C;  2P7C B;  4BNC A;  2CWE A;  3O2P E;  4NQW A;  1ZHF A;  4L0Y B;  5LEJ A;  1LB2 A;  3TDZ C;  3RKW A;  1IN7 A;  2OQG A;  1RUO A;  2Q2E A;  4RS8 A;  4HLY A;  5K5O A;  2MD5 A;  3COA C;  4U0V A;  1F4K A;  1SAX A;  2YU3 A;  3KP5 A;  3HHG A;  4N9I A;  4O6J A;  1BI2 A;  4RGX A;  4G9Y A;  1ZGA A;  5L3D A;  2EK5 A;  4WCG A;  2KJC A;  2KIF A;  2UZK A;  1B4A A;  4KA4 A;  2Y48 A;  2GQQ A;  1KGS A;  4XLP F;  1ZGJ A;  2P5V A;  4HLX A;  3KET A;  4KYW A;  1QGP A;  4UV9 A;  1SD5 A;  4UHT A;  5DDG A;  5BQT A;  4M74 A;  1J75 A;  2EA2 A;  4JK1 X;  1WSU A;  5EEH A;  1LDD A;  2VC1 A;  1E17 A;  4EM2 A;  3BP8 A;  4GXO A;  4EJU A;  4L9N A;  1IN8 A;  3RIR A;  2W25 A;  2VN2 A;  1J2X A;  3VOD A;  1FP2 A;  2Y0M A;  2IA0 A;  3KFW X;  1LVA A;  2Z33 A;  1L3L A;  3QPH A;  2BGC A;  4HA8 A;  1IN4 A;  3V7R A;  1O57 A;  4O5V A;  4WXC A;  3J81 K;  3QU3 A;  1W5T A;  2LDU A;  1SFX A;  4OIQ F;  3BZ6 A;  5A2Q Z;  1A04 A;  2L01 A;  3WGI A;  3FX3 A;  5L3B A;  3DPT A;  5FFZ A;  1REP C;  3MEX A;  1H0M A;  4CO8 A;  4ESJ A;  4L9J A;  1XGM A;  1BIA A;  3ML6 A;  1J0R A;  5F64 A;  4UNO A;  5DCF A;  1PUE E;  2JSC A;  1O3Q A;  5FLX K;  3PFI A;  4HW0 A;  4RGU A;  2IA2 A;  3WGH A;  5ILV A;  3HIF A;  3ZN1 A;  2M30 A;  3WTS C;  2CO5 A;  2Z5U A;  3M8E A;  2EFQ A;  3QAH A;  5CVJ A;  4DQ2 A;  3DP7 A;  2VBX A;  2Q8K A;  2GIV A;  1U8R A;  1V4R A;  1KYZ A;  1W7P A;  4IHT A;  2E1N A;  1IUY A;  4N9H A;  5D4R A;  2HTJ A;  3U1D A;  2A69 F;  1BN5 A;  3T0Y A;  4AWX B;  4MGR A;  1QNT A;  1ZRC A;  1Q1H A;  1P2F A;  4IRH A;  4CDG A;  4A2U A;  4KIF A;  4M71 A;  4ETS A;  3NRV A;  2HFH A;  5F6F A;  5ED4 A;  5IT9 K;  1MGT A;  2LKP A;  3TOB A;  3RPU A;  2W85 A;  2PEX A;  2ZCW A;  3LA2 A;  5FB2 A;  5D5V B;  2PN6 A;  4BHP A;  2CSO A;  5H6R A;  1SFU A;  1T6S A;  1R1V A;  1XN7 A;  2CFX A;  4A5N A;  3WG9 A;  4ASN A;  1ZH5 A;  2XRO A;  4M9Z A;  2J5P A;  1I27 A;  2DBB A;  4WXD A;  2WWY A;  2IJL A;  3F8C A;  1R1U A;  2IP2 A;  5CLS A;  3R60 A;  4WF2 A;  1K78 A;  1Z1D A;  4Y17 A;  4E70 A;  2ADU A;  4UVC A;  3GVA A;  4M73 A;  1F5T A;  5DEQ A;  2VXZ A;  1B59 A;  1D3Y A;  4LLL A;  4A5M A;  3F72 A;  4YII A;  1RIO H;  4KIB A;  2ZKZ A;  3JSO A;  3BJA A;  3GX4 X;  1EH8 A;  1G6N A;  1FBQ A;  5AIQ A;  1CF7 A;  4FX4 A;  4MQ9 F;  2M87 A;  2LF7 A;  2ETH A;  2JRT A;  2OA4 A;  3F8B A;  1J5Y A;  3MFK A;  2H6C A;  3MWM A;  1XDU A;  3KE2 A;  4OIP F;  1IAW A;  1D8K A;  1B9N A;  2VT2 A;  2W84 A;  4IRI A;  1XCV A;  2P7V B;  4S05 A;  5ILS A;  3WTV C;  3REO A;  4HX7 A;  3GO5 A;  1HQC A;  1KQ9 A;  2ZJ2 A;  3H3Z A;  4OOI A;  1R1T A;  1TTY A;  1HST A;  2HQR A;  2A3S A;  1H9G A;  3WE2 A;  3F23 A;  4HDV A;  2K02 A;  3Q9S A;  1XSX A;  1MD0 A;  3KZY A;  4AD9 A;  1K7A A;  1YW8 A;  4PDK A;  4TV7 A;  4FHT A;  2WV0 A;  4G8X A;  1IN5 A;  3HOT A;  4PGG A;  1LEA A;  5J6X A;  1U3E M;  4EJT A;  2HDC A;  3CUQ B;  2QWW A;  2V1U A;  5JHU A;  5DCM A;  1HKS A;  2ZNZ A;  5E8I A;  3QP5 A;  1I1S A;  5HS9 A;  2CG4 A;  3IHU A;  3L7W A;  1BC7 C;  1Z9C A;  2XAF A;  3DF8 A;  2RN7 A;  4HX4 A;  2VOD A;  5LGN A;  5J8F A;  2F5D A;  4IRG A;  1D5V A;  1QQI A;  1SD7 A;  5FLX Z;  2EFO A;  2VT3 A;  3ZMT A;  3E6B A;  1O3R A;  2EFW A;  1IRF A;  1ZLK A;  3L09 A;  2R3S A;  3E97 A;  3WGG A;  1ODD A;  1U6G A;  1ONV A;  1LQ1 A;  1XD7 A;  1S3J A;  2MH9 A;  1LNW A;  2DI3 A;  1S7O A;  5FGM A;  2H94 A;  3IKV A;  3QRF F;  2EJR A;  4BYY A;  3RI4 A;  2A6H F;  3R61 A;  3H92 A;  2ZO4 A;  3T8R A;  4CHU A;  1HKT A;  1HSJ A;  3EYY A;  4MEY F;  1G3T A;  5F1R A;  5BS6 A;  2RVC A;  4XSZ F;  4G7O F;  2HKO A;  3PQJ A;  3ELK A;  1GVJ A;  3M9A A;  1BIB A;  2G9W A;  3RYP A;  2AS5 F;  3U2R A;  1FC3 A;  1KU9 A;  3FXU A;  3M7G A;  4OIR F;  4LJZ F;  3SQN A;  2BEO A;  2MH2 A;  4LG0 A;  1RZ4 A;  3IRQ A;  2IRF G;  2UXX A;  3HRT A;  4CIC A;  4ZYH A;  2G7H A;  1MKM A;  1FYL A;  3J80 Z;  3SZP A;  3FWE A;  1KYW A;  1WKM A;  4M6Y A;  4MEX F;  4ENM A;  4AIJ A;  1G3S A;  3GFI A;  1MJ9 A;  2RDP A;  3O6B B;  2QYO A;  2CW0 F;  1BBY A;  3P9K A;  1FX7 A;  4BHC A;  3L00 A;  3ZMZ A;  5LLQ A;  1SD4 A;  1TNS A;  2OZ6 A;  3CUQ A;  2VOO A;  2DPU A;  3RDI A;  5LGU A;  1XSV A;  4MHG A;  2B0L A;  5ICC A;  3F6O A;  2XAQ A;  5D5U B;  2V6C A;  4HBL A;  4BHB A;  2QBY A;  2A5Y B;  4WWC A;  4UXN A;  4Y13 A;  1ZRE A;  4I02 A;  2HS5 A;  2F5F A;  2L54 A;  1F1Z A;  3F22 A;  1UHW A;  2XAG A;  2EB7 A;  1OYW A;  3TDU C;  2EA4 A;  5E1W A;  3HUG A;  2GXB A;  2RGV A;  1OYY A;  1BI1 A;  3WU1 B;  3BDD A;  1GXP A;  2DQR A;  4JQF A;  2CGP A;  3WTY C;  2PBI A;  2O3F A;  1DUX C;  5D5X B;  3HRM A;  2A68 F;  5HDN A;  2OU2 A;  3WTU C;  1U5T B;  2W57 A;  2JPC A;  3JAM K;  1S29 A;  1YTY A;  3V8J A;  4A6E A;  1WI9 A;  1W4M A;  4PZJ A;  2V79 A;  1RI7 A;  4A0Z A;  1UCR A;  4L9V A;  5DCM B;  2BYV E;  2DK5 A;  2HOE A;  4KN4 X;  3GFM A;  5K5R A;  1YYV A;  2X4H A;  4Q47 A;  1ZN2 A;  4PGH A;  4NHJ A;  2CYY A;  2Z99 A;  1Y0U A;  3LFK A;  4G7H F;  2FE3 A;  4EVI A;  1WRJ A;  2EFP A;  1YS7 A;  4S04 A;  4KNY A;  2Z3Y A;  4KT5 C;  2EV0 A;  2NAZ A;  3DEU A;  1BM9 A;  3ZQ7 A;  5DD4 A;  4LLG F;  1LEB A;  5LHH A;  1KU2 A;  3ULQ B;  2DU9 A;  3Q5F A;  2ZME B;  1FBU A;  1Z6T A;  1FWZ A;  4EJO A;  4HDU A;  2FSW A;  3TO6 A;  3JTH A;  1T98 A;  4Q5S F;  3ZPL A;  2O03 A;  3I59 B;  3FF5 A;  2VE8 A;  1QBJ A;  3CJN A;  4MTE A;  1BI3 A;  2FF4 A;  2A61 A;  4L18 B;  3NQO A;  3I58 A;  3BPV A;  2KJB A;  2FNP A;  5IT3 A;  1ZG1 A;  3RTR A;  5DD8 A;  5HS8 A;  4RB0 A;  3N97 A;  2EV6 A;  5HS7 A;  1K6O A;  3FHZ A;  5TRD A;  1TQI A;  2P6T A;  1Z91 A;  2FML A;  1JGS A;  4GYI A;  3KP2 A;  2ZNY A;  2OD5 A;  1WQ2 A;  1BOA A;  5HLI A;  5CJ9 A;  2HGC A;  1R36 A;  4Y15 A;  3KCC A;  4U0W A;  1SMY F;  3EYI A;  3G73 A;  1K78 B;  1HXD A;  2V1X A;  4O3M A;  4N0B A;  1ZRD A;  4G6Q A;  2FBI A;  1ON1 A;  3GFJ A;  4HQE A;  5A2Q K;  4AIK A;  2K27 A;  2OQR A;  3ERE D;  3HSE A;  1QZY A;  1TBX A;  2Z9O A;  1JE8 A;  3GFL A;  3ZMD A;  1D8J A;  2DK8 A;  5ERI A;  3QOP A;  5LHI A;  1P92 A;  3FXQ A;  3BJO A;  1OYI A;  3TO7 A;  3RJP A;  1S8N A;  3ZMV A;  5J8C A;  5ICF A;  2PMU A;  3EDP A;  3CUO A;  1R23 A;  2XHK A;  3L9F A;  1XMA A;  1RNL A;  3QP6 A;  4ZH4 F;  4ENN A;  3F3X A;  3BPX A;  2HWV A;  3GW2 A;  3Q9V A;  1C0W A;  4LB6 B;  3CLO A;  1GXQ A;  1R5G A;  2XAJ A;  1PDN C;  3GEZ A;  1IZ1 A;  2A6E F;  2L4M A;  2Q0O A;  1YW7 A;  4KUM A;  2DQL A;  1DDN A;  3I53 A;  2PQ8 A;  5LEK A;  1B1B A;  1KA8 A;  2PI0 A;  1Z05 A;  2E7W A;  3E5U A;  1IXR C;  3HOS A;  2PFB A;  3I54 A;  1AOY A;  4M72 A;  1GHC A;  1L0O C;  3V4G A;  2RC4 A;  5JFR A;  1U5T A;  1U78 A;  2PLY A;  4LG0 B;  4FT8 A;  1P4W A;  3K69 A;  4B09 A;  2E1C A;  4HQM A;  2STW A;  3E5X A;  3KP4 A;  2DT5 A;  3EET A;  2STT A;  1EV7 A;  1OKR A;  3LA7 A;  1JHF A;  3SHF A;  3GF2 A;  3LWF A;  2DW4 A;  2XKO A;  2QQA A;  1RUN A;  5D4S A;  3W6J B;  4GO1 A;  2VOP A;  4HF2 A;  4Q4Z F;  2JZY A;  1LJ9 A;  4LFU A;  2NYX A;  3HHH A;  3OV8 A;  2RNJ A;  1R58 A;  5LHG A;  1ZG5 A;  5E17 F;  2GA1 A;  1I1G A;  1FLI A;  3KP7 A;  3O3K A;  3R6S A;  2DO7 A;  2MLG A;  1BJA A;  3KP3 A;  4M9X A;  1ZAO A;  3WTX C;  5D5W B;  1R22 A;  2FEZ A;  3BWG A;  3ZMS A;  3V7C A;  2K86 A;  4A0X A;  4KIC A;  2K7L A;  5AON A;  1UHM A;  2JPB A;  2F5E A;  1SD6 A;  2FBK A;  1X3U A;  2HTS A;  4BXU A;  4YFN F;  4OIN F;  4P9F A;  1ON2 A;  1T0F A;  2H27 A;  2NS0 A;  3KP6 A;  3LA3 A;  3I64 A;  2VE9 A;  4A12 A;  1P6R A;  1P4X A;  4U88 A;  4I7H A;  3WU0 A;  2YPR A;  3KZZ A;  2DLL A;  1IRG A;  2XV4 S;  3B73 A;  2DPD A;  3DKW A;  5HDK A;  2ISY A;  2YSR A;  2ZME A;  3CO6 C;  2RQP A;  3TQN A;  3R0A A;  4IPA A;  3FMR A;  4K2E A;  1K79 A;  2EWN A;  3ABT A;  3I71 A;  4KFC A;  1YS6 A;  4OIO F;  4LLN A;  3CO7 C;  5TJJ A;  1TNT A;  4KDP A;  3HTS B;  2KIM A;  3DFG A;  1P4A A;  5HVQ C;  5HLG A;  3MZY A;  3WOD F;  5AIP A;  4L5I A;  1LDJ A;  2JT1 A;  4HF1 A;  1TLH B;  3U9G A;  3C18 A;  2P6S A;  1G3W A;  2L4A A;  1I5Z A;  6PAX A;  3LST A;  2IPQ X;  2LSO A;  2P8T A;  4D0P A;  5FFX A;  2GWR A;  3IWF A;  3FMS A;  4MNU A;  4I09 A;  1R7J A;  1S6L A;  1Z6R A;  5H20 A;  3IKT A;  1ZLJ A;  2FA5 A;  1MDM A;  3ZP5 A;  1PP7 U;  1DP7 P;  4XSX F;  1UST A;  3I4P A;  2LF8 A;  5E20 A;  3B02 A;  4HX8 A;  2YX7 A;  1XGS A;  2RV8 A;  3LQR A;  2GXG A;  2KKO A;  1FYM A;  3HRU A;  4U7B A;  4LMY A;  1ULY A;  1HBX G;  1XSD A;  3E6M A;  4GCV A;  4HF0 A;  2MC3 A;  2XVC A;  4ZYE A;  2XIG A;  2XKP A;  2FXA A;  1DPR A;  1XGO A;  2FBH A;  2V9V A;  4I98 B;  2H6B A;  2M5W A;  2O8X A;  2XRN A;  1U2W A;  3CUQ C;  3K1M A;  2J5O A;  2DAO A;  5L3C A;  2IT0 A;  4L0Z B;  4XRF A;  2WTE A;  2YX4 A;  2MA3 A;  4Q48 A;  1SMT A;  4IF4 A;  4HZF A;  3RKX A;  1IXS B;  1MJA A;  3GZ5 A;  2O0Y A;  3HSR A;  4JBA A;  3ROU A;  1KU7 A;  2O6G E;  4A0Y A;  3J7A O;  3ZN0 A;  4WK8 F;  1FSH A;  1V3F A;  5K5Q A;  5LRS A;  2QQB A;  2FOK A;  2XAS A;  1KQ0 A;  4ESB A;  4A6D A;  3WTW C;  1XMK A;  3MZH A;  2F2E A;  3GYH X;  5CYV A;  5K1Y A;  2DFI A;  3K9T A;  1MZB A;  2UXN A;  3C3W A;  2AXL A;  4R8H A;  2M45 A;  2E7X A;  4OMY A;  5FD5 A;  5LBQ A;  2KRF A;  1KU3 A;  4GYG A;  4RB1 A;  5IT9 Z;  4BQA A;  3SFZ A;  3V8L A;  1MJB A;  4CXF A;  4KMU X;  1Z7U A;  5HLH A;  2D2W A;  5ICE A;  3K1P A;  5ILU A;  4HAM A;  1G4D A;  3PQK A;  1XDS A;  4RGR A;  3VOE A;  2QEN A;  2DTR A;  2NNY A;  4EJV A;  1FP1 D;  2OAZ A;  4Z2Y A;  3N4M A;  4UVA A;  2ELH A;  4LD5 A;  1T39 A;  3KLN A;  4ESF A;  5FD6 A;  3BOQ A;  3M8F A;  3RYR A;  1TW3 A;  5E8G A;  4G6D A;  2GA2 A;  3KEO A;  5L3E A;  1XGN A;  3JAM Z;  2BBY A;  3W6K B;  4KIG A;  1TQP A;  3SZT A;  1FOK A;  1UFM A;  2MBF A;  3TO9 A;  3JTG A;  4YG2 F;  4H0E A;  3C7J A;  3IWZ A;  1J9I A;  3R4K A;  3JSP A;  4ENK A;  4I2O A;  3ECO A;  2HZT A;  3J81 Z;  2VBY A;  4I0A A;  1UB9 A;  3GLX A;  4ENJ A;  3DV8 A;  3EQL F;  2XUB A;  1FY7 A;  4P55 A;  3WTZ A;  4HOB A;  1CGP A;  2FU4 A;  4UUV A;  4WXH A;  2GAU A;  5FO5 A;  2HEO A;  3ABU A;  4WX9 A;  2GZW A;  5BOX A;  2PJP A;  1O3S A;  1G3Y A;  1FZP B;  1YLF A;  4U7D A;  5D6F A;  1S7A A;  3WE3 A;  4LGW A;  3AAF A;  2F5C A;  2P5L C;  2OZU A;  2M1B A;  1YFH A;  5D8K B;  1FYK A;  5CVI A;  5DUI A;  4L9T A;  4OU0 A;  1W7P B;  5HDG A;  2ISZ A;  2RKH A;  5BMZ A;  2ESN A;  2COM A;  4P5O A;  3WTT C;  1IW7 F;  3P9C A;  4R1H A;  2EV5 A;  2HQN A;  2L3D A;  4IHS A;  2ZBK A;  4U0Y A;  3E5Q A;  1FT9 A;  1XCB A;  3DQV C;  5KK1 A;  3I0T A;  4BH9 A;  3VEP A;  1YG2 A;  3E3V A;  3F6V A;  1ZAR A;  1ZYR F;  3C1D A;  3QU6 A;  1E2X A;  1YIO A;  1B9M A;  5EEG A;  2A07 F;  4EQQ A;  4EV0 A;  1O3T A;  2C6Y A;  3EUH A;  4L5J A;  1EH6 A;  2O61 A;  1W7P D;  5L3G A;  2QZ8 A;  4HV5 A;  1MDM B;  3BJ6 A;  3FZV A;  2W24 A;  3KLO A;  1YO5 C;  3H3U A;  2PG4 A;  1TW2 A;  3MQ0 A;  2KIU A;  4OMZ A;  4GGG A;  4LK1 F;  5DV5 A;  3ISP A;  2HYG D;  1LDK B;  2TDX A;  2JTV A;  1JXS A;  4P9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...