2RDPA

The structure of a marr family protein from bacillus stearothermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
140
Chain Sequence
b'AMNERTVAELEKLLRYIAANLKQRGREILTNYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDEHVVRIRLLEKGERIIEEVIEKRQRDLANVLESFSDEEIVVFERCLRKLHQEMTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative transcriptional regulator MarR
publication title The structure of a MarR family protein from Bacillus stearothermophilus.
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transcription
total genus 48
structure length 140
sequence length 143
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rdpA00
5FB2A 5DEQA 1TTYA 2VC1A 1UCRA 1DPRA 4ESJA 1HW2A 4EJUA 3LSTA 1L0OC 3J7AO 4CO8A 1ZLJA 2KRFA 2PFBA 3IL2A 2CG4A 3CO7C 3GZ5A 4KMUX 4R8HA 3V7SA 1XGOA 4MNUA 3D5LA 1HW1A 5E1WA 4CYDA 1XB4A 4IVNA 3LWFA 1OPCA 2STWA 4CDGA 2WWYA 5JFRA 2F5DA 2H94A 2JPCA 3E97A 2A68F 4HF0A 1H9GA 5DUIA 3LA7A 3IWZA 3BJ6A 3CDHA 2A6HF 3HHHA 1I27A 3NRVA 1JHFA 5HS7A 4RGXA 4EJVA 5FD6A 1ZREA 1JXSA 2MH2A 3I64A 2VE9A 4A5NA 3DEUA 5DD8A 3HSRA 1R22A 1BM9A 1J2XA 4S04A 4OIPF 3BPVA 3HSEA 4AIKA 1XMKA 2F5EA 1I6XA 2AXLA 4U88A 6PAXA 1MKMA 4EM2A 2IW5A 5CVIA 1P4AA 5CVRA 2ISYA 2D2WA 3SZPA 1CF7B 4N0BA 4M74A 1YFHA 3BPXA 3WE3A 2ZFWA 3W6KB 2ETHA 1YTYA 3MCZA 4NHJA 3Q5FA 4HBLA 1OR7A 3P9IA 1YYVA 4G7HF 2A6EF 2OD5A 2LF8A 3GF2A 3C7JA 1G3TA 3JTGA 2K86A 1K7AA 5LGNA 2HR3A 5HLGA 1IN4A 1DPUA 4I0BA 4MEXF 2NRAC 2X4HA 2G7UA 4GYGA 3RYPA 1W7PB 2V1UA 1HBXG 5FGMA 2H6BA 4RB2C 4DNCA 3KP2A 1J59A 2HOEA 2VE8A 2OBPA 3G73A 3FF5A 1O3SA 1HXDA 4U7BA 4AVPA 2YU3A 2QLZA 4TV7A 1EH8A 1HW5A 1QPMA 2PMHA 2QZ8A 3WODF 2FBIA 3GW2A 1KA8A 4I0AA 4GGGA 4AIJA 3I71A 2Y48A 1F1ZA 3ZN1A 1GXQA 2QYOA 4GO1A 4HX8A 3GEZA 2ESHA 2FQ3A 3SQNA 3GZ6A 3MWMA 3F6OA 5AIQA 4I7HA 3DQVC 4D0PA 4LB6B 5ICFA 4HW0A 4HLYA 1XSXA 2ZBKA 3HRSA 2LSOA 5LHHA 5E8GA 2Q8KA 5D5UB 2DPUA 4UUVA 1EH7A 3BJOA 2DLLA 2XAFA 2OZUA 1AOYA 1U3EM 3MZYA 1D8KA 4JK1X 2E7XA 4RAZA 3SFZA 3T8TA 4A0YA 4P55A 3LA3A 3FM3A 4Q5SF 3HRMA 2VN2A 3FM5A 1ZYRF 3CUQC 4ETSA 2PEXA 3LAPA 1O7FA 4LK0F 1D5VA 3HRTA 4N9IA 4A0ZA 3KP7A 4KMFA 2VODA 3E6BA 3I0TA 2RGVA 3PFIA 4IPAA 1YS6A 1XGNA 3HUGA 4Q47A 5DD4A 2RQPA 1IZ1A 1LB2A 1I1GA 5ED4A 5LRRA 4FX0A 4H0EA 4QWQA 4LD5A 5L3CA 1QO0D 2VBXA 2C6YA 2GWRA 3F21A 4FT8A 3COAC 5JR3A 2DQRA 3MAJA 2DPDA 1F9NA 4KIGA 1R36A 2WV0A 1ZAOA 3I5UA 4A12A 3R6SA 3ZMUA 4HV6A 3BDDA 1FLIA 3WGGA 4HF2A 1SD6A 1T0FA 1JGSA 2XHKA 2HTJA 3K1NA 2GAUA 5LEJA 2MC3A 1SD5A 2OQGA 4EJOA 1DUXC 3P9KA 2BBYA 1R58A 2GQQA 4UVAA 2JRTA 1FBQA 2VOOA 2Y75A 4HDUA 3REOA 1SFUA 3QP5A 1SMYF 5K5QA 3GX4X 1U2WA 2DK8A 2E7WA 4HF1A 4MHGA 1WKMA 4BQAA 2A69F 3NEUA 2O8XA 3ZMSA 2RKHA 2O0YA 2YSRA 1IN7A 2FEZA 4HOBA 4KIFA 5DV5A 1FYKA 3ZPLA 2EFWA 3EYYA 1Z05A 1ZHFA 2P7VB 5IT9K 1P92A 4PZJA 3CLOA 1KU2A 1AWCA 1BI2A 1U6GA 4MEYF 3WE2A 2UWMA 2KIFA 3KP3A 3GUDA 5K5OA 3HHGA 2PN6A 4RB0A 4BNCA 1X3UA 2RVCA 5K5RA 3LFKA 1UFMA 3F8FA 5D4RA 3ZP5A 1YW9A 3HTUA 4HLXA 4YFKF 1TLHB 1XDUA 3WTSC 2IA1A 2O61A 3E5XA 4U0YA 2A3SA 1LDJA 3VB2A 2ZKZA 1K79A 3I53A 4M6YA 5LHIA 2Y0MA 2L3DA 4UV9A 4OIOF 3K2ZA 3RTRA 1I5ZA 3O2PE 1FSEA 2COMA 2XAGA 1G3SA 4EM1A 1QBJA 4BAYA 2ZMEA 1ZG1A 5ICEA 1IRFA 3SHFA 2XKPA 1FYMA 3KZZA 4B8XA 1TNSA 2MH9A 3GVAA 5D4SA 1U5TA 1XSDA 3WTTC 2M5WA 3ZMTA 2ZCWA 2RNJA 1E2XA 1SFEA 1T38A 1J75A 2EV5A 4CZZA 4A2UA 3T8RA 3I54A 4L0YB 3CJNA 4I98B 5FD5A 1RNLA 4ZYGA 2D1VA 5ICCA 4KDPA 2ZJ2A 4IJAA 2HGCA 1BC8C 1MDMA 2TDXA 5J8FA 1B6AA 5F1RA 2P4WA 5HLHA 1OYWA 3D0SA 2QENA 1W5TA 3TGNA 2M8EA 2A61A 5HVQC 5H6RA 4EM0B 4HDVA 3FXRA 1DDNA 1UB9A 4EJTA 1ZG5A 1IAWA 1TW3A 4E70A 4FX4A 5BPDA 4BXUA 4QLCU 1RUNA 1UHWA 4LLNA 4I2OA 2QVOA 4A5MA 4M9ZA 5CVUA 2LDUA 5HOOA 2DT5A 5H20A 3RKYA 2NYXA 4EMSA 4EV0A 2L02A 2FF4A 3FHZA 2B0LA 1TQPA 3GXOA 5D5VB 3FXQA 1FYLA 2E1CA 4ENKA 5EEGA 1D3YA 3GFLA 5H6QA 5TRDA 5D5XB 2P5KA 3V7RA 1ZG3A 5ILUA 3TOBA 2Z3YA 3QU3A 4BHCA 3ABTA 2GZWA 3E5UA 1T2KA 2CSOA 1KU9A 1LQ1A 1ZRFA 3G3ZA 1BBYA 3E6CC 4MGRA 3MFKA 4XBFA 4P96A 3V8KA 2OQRA 3F8NA 3C1DA 3HTSB 1FP1D 4IXAA 3ECOA 1FWZA 2YX7A 1K78A 1W7PD 3FMRA 2CO5A 1R23A 1FX7A 2CWEA 2M30A 2EA4A 3FXUA 5D8KB 1U5TC 1J5YA 3O6BB 4O5VA 2XV4S 4LFUA 1RI7A 1S3JA 2XRNA 5ILVA 1F5TA 5FFZA 4KN7X 4WK8F 2G7HA 1RZ4A 3P9CA 3WTWC 4UXNA 3R61A 2RV8A 1LEBA 1I1SA 2GXBA 4XRFA 3FMSA 2RC4A 4MTDA 5CVJA 4Q48A 1S8NA 1W4MA 2A5YB 3EQLF 4XSZF 2BGCA 3WTVC 1G3YA 5HLIA 1XSVA 5E8IA 3E6DA 1TW2A 2STTA 2KKOA 2X0LA 2V1XA 2JSCA 2OZ6A 3OOPA 4BYYA 4ZYHA 2FBHA 5FO5A 3LQQA 5FLXK 2ZMEB 5DCMA 2DFIA 4YIFA 1WQ2A 2Z5UA 4JQFA 3L2CA 2XGXA 1U5TB 3U2RA 1OYIA 3DPTA 3O3KA 2VT2A 4M72A 1SD7A 3SZTA 4ZH4F 4WCGA 4YIIA 1F4KA 3MZHA 4G8XA 1JE8A 2BE5F 1B9MA 1XMAA 2J5PA 5CJ9A 3DXJF 3F6VA 1TQMA 3M9AA 2L4MA 1B1BA 1STZA 1Z9CA 5TJJA 1LEAA 1O7LA 4CXFA 3T5XA 1MDMB 4LB5A 2FMLA 5DUKA 1HKQA 5E20A 1Z91A 3RPUA 4KYWA 3W6JB 4WX9A 4OIQF 1NHAA 4KFCA 4I01A 2UXXA 1TNTA 1XCVA 2HS5A 5L3GA 1C0WA 3FMQA 1BJAA 1ULYA 3C3WA 1ZN2A 4R79A 2EWNA 2FBKA 5E18F 1R5HA 3R60A 3GFIA 3EYIA 2O3FA 5HDKA 5JI6A 2YR2A 3IWFA 3KP5A 2H27A 3ULQB 4AWXB 1PDNC 4XSXF 4Y15A 2K4JA 4L18B 2RDPA 2VC0A 4BHBA 3H3ZA 3VOEA 4WF2A 5HDNA 1T98A 3JSPA 1QNTA 2QQBA 3RPQA 3HOSA 1USSA 2HEOA 2AS5F 2FOKA 5HS8A 1P6RA 1WRJA 2HQRA 3ML6A 1LVAA 2VBZA 1J7KA 5IT3A 1L3LA 1IN6A 2BEOA 2XAQA 1WWXA 2QQAA 2MA3A 4ON0A 1XCBA 2HDCA 3HSFA 4G6QA 2HQNA 1BOAA 1QGPA 4S05A 2VOPA 4U0VA 4UHTA 2EJRA 3JAMK 2LF7A 2O03A 4L9JA 1XGSA 3FWEA 4EVIA 1R1VA 4M71A 1E17A 2IVMA 4EGYA 2EFOA 5LBQA 3WGHA 3SXYA 4LGWA 5E1ZB 4MTEA 4Z2YA 1O57A 2L54A 1Z6RA 1D8JA 2YX4A 3JSOA 3V7CA 1IN8A 1DP7P 2NNYA 3Q9VA 3U1DA 5BMZA 1G3WA 1IW7F 4ZYDA 1G4DA 4LJZF 1J0RA 3L9FA 1EH6A 2HKXA 1IUYA 4KT5C 4PCQA 1KYWA 1CF7A 5DYMA 2LNBA 2R7FA 4LG0A 4L5JA 3GO5A 2EK5A 3J81K 1Z7UA 1R5GA 2HFHA 4HYEA 4L9NA 5J8CA 1Y0UA 2W85A 5DCFA 5DCMB 4GYIA 4HQEA 4KIBA 1T6SA 1YQAA 3KP6A 1IRGA 4YFXF 1V3FA 2EB7A 3GFMA 3WG9A 3HOTA 2EFNA 2DAOA 1A04A 2L4AA 3QPTA 4BH9A 2XAHA 3F3XA 3BP8A 4BHPA 4WXCA 1W7PA 2R7DA 4LLGF 3P7NA 5LHGA 5L3BA 3RIRA 2P6SA 3VEPA 1FNNA 2L01A 2R3SA 4RGUA 3N4MA 5BOXA 1T39A 2HYFA 2QBYA 1KYZA 3KEQA 4CGZA 1IF1A 2H09A 3PQKA 5D6EA 2VBYA 1LNWA 1HSJA 2IJLA 3V8LA 1VTNC 1P4WA 3DFGA 2UZKA 3BOQA 2PJPA 3JAMZ 4P5OA 2V9VA 1V4RA 4ZZDA 3QAHA 3V4GA 2VT3A 4Y17A 2FRHA 4OOIA 1HQCA 2XROA 3LAJA 1P4XA 2DBBA 1MJAA 3CTAA 2M1BA 3B73A 4A0XA 2ZXJA 3T0YA 2V6CA 5IT9Z 3NQOA 2XIGA 2ELHA 1LDDA 3QOPA 4GCVA 5KVRA 4IHTA 2F5CA 2OA4A 4AIHA 1SD4A 4ESFA 3KLNA 2K4BA 5LLQA 1K6OA 4HX7A 3KE2A 3GWZA 1MD0A 4UNOA 1PP7U 1ZH5A 1YW7A 1YG2A 5KK1A 4IHSA 4WWCA 3GYHX 3J81Z 4ENNA 5LGUA 5E1XA 1UHMA 5CVVA 1XN7A 1P2FA 3V8JA 2VONA 1FC3A 1QQIA 1MJ9A 3IC7A 3KZYA 3BWGA 3RI4A 3I59A 3R4KA 3WTUC 3WU1B 3KETA 3E5QA 2E1NA 1WSUA 3JW4A 2JZYA 2P8TA 3DPLC 3TQNA 3F22A 3LQRA 2XAJA 2O6GE 2IA0A 5ICGA 4L9TA 3ECHA 4KUMA 1R7JA 2Z99A 3M1EA 4DQ2A 1Z6TA 4M9SA 4F7ZA 1R1UA 1GHCA 2WTEA 1R00A 2V1DA 3IKTA 2MBFA 2IRFG 3GLXA 1YO5C 3FZVA 1GXPA 2H6CA 4G7ZF 4ENJA 3Q9SA 5A2QK 1HKSA 1IXRC 2KJCA 3KCCA 2F5FA 3DF8A 4RAYA 5K1YA 2GA2A 2PBIA 3CUQA 2QQ9A 3DP7A 1XGMA 4JBAA 1KGSA 1BIAA 2BYVE 4PDKA 1ODDA 2JPBA 3K1MA 1QZYA 4WXDA 4I02A 1IXCA 2MLKA 3OV8A 2ZNYA 5L3EA 3ZN0A 2MLGA 3I4PA 5D6FA 1ZRCA 3TKYA 2Q2EA 4G6DA 4A6DA 2DK5A 4LG0B 1Q1HA 1ZLKA 2VBWA 1ON2A 1XDSA 5LRSA 3H92A 3L00A 2P6TA 3R0AA 2QM3A 4LLLA 1B9NA 4MQVA 2W25A 3HIFA 1O3TA 3F72A 1YLFA 2ESNA 2DQLA 4O3MA 1FBUA 3QPHA 2HWVA 2QUFA 1OKRA 3KEOA 1FSHA 2F2EA 3M7GA 4RB3C 3TDZC 1O3QA 2CQKA 4ZZLA 2CYYA 2FNAA 3MEXA 3WTXC 1HKTA 4M9XA 2PMUA 1MJBA 1Z1DA 1IXSB 1KQ9A 1ONVA 4O6JA 2QBYB 3QU6A 5CYVA 4K2EA 2QWWA 1KQ0A 4MQ9F 2XASA 3KLOA 4L0ZB 1FOKA 1RIOH 3IRRA 3ISPA 1FY7A 3IKVA 2NS0A 2ZO4A 3DKWA 2IPQX 3ELKA 1ZGAA 4GXOA 2EV0A 3QP6A 2FU4A 4IRIA 2GA1A 4I09A 3F8MA 1BIBA 3RDIA 4AD9A 3VODA 3GFJA 4IF4A 4HA8A 1FBSA 5D5WB 5AONA 3M8EA 3J80K 5A2QZ 2FMYA 2V79A 3C18A 5E17F 4KNYA 3WU0A 1SFXA 2M45A 2P5VA 2G9WA 1B4AA 1FPQA 3EETA 3LA2A 1XD7A 4EGZA 3PQJA 3ZMZA 2GIVA 2A07F 5L3FA 2YPRA 3JTHA 2XUBA 1YIOA 2P5LC 3IHUA 3HYIA 1R1TA 4KICA 3BROA 4XLPF 3ABUA 5BS6A 4L5IA 2FXAA 4KA4A 1BI3A 2PG4A 5F64A 2IP2A 5DDGA 1O3RA 2KJBA 5CLSA 2W57A 2PLYA 5BPIA 4G94A 1PUEE 3I58A 2HTSA 2K7LA 2DO7A 1KQ8A 1IN5A 4UVBA 2MD5A 5ILSA 1S7OA 2W84A 2XVCA 4CHUA 3ZMDA 2JT1A 2HKOA 4HQMA 2WC2A 2K27A 1H0MA 1EV7A 1ZGJA 2FSWA 4M6XA 4G7OF 1USTA 1TBXA 3I59B 2KIMA 4R1HA 5HS9A 3M8FA 2ADUA 4B09A 4ESBA 3WTYC 2K02A 2RN7A 2DTRA 3ERED 4LMYA 4OMYA 1BC7C 3WTZA 3RYRA 2CGPA 1SMTA 3TO6A 4IRGA 3RJPA 1S6LA 2IT0A 1JHHA 4OU0A 3TO9A 5FLXZ 4WXHA 2EV6A 3QRFF 1S7AA 3L7WA 2D45A 5BQTA 2DW4A 4EQQA 3DV8A 3R0JA 1PP8F 3WGIA 2ISZA 3KP4A 4YFNF 4HAMA 2OAZA 4CICA 2ZNZA 3CUQB 3S2WA 3RKWA 5F6FA 4HX4A 1REPC 2PI0A 4RS8A 1QZZA 2CW0F 2KIUA 5L3DA 2DI3A 3J80Z 1K78B 4UV8A 3BJAA 1B59A 4ASNA 3FX3A 2J5OA 3BY6A 3U9GA 2XKOA 2FA5A 2FE3A 1OYYA 1FT9A 1U78A 5FFXA 4N9HA 5HDGA 5LEKA 3AAFA 3F8BA 3KFWX 5ERIA 3ZQ7A 3E6MA 1FZPB 1G6NA 3K1PA 4HV5A 1U8RA 4LK1F 1OMIA 1GVJA 5LGTA 3K0LA 1RUOA 2Z9OA 2D1HA 2W24A 1J9IA 1ON1A 4FHTA 4P9FA 4OINF 1LDKB 1ZRDA 2OU2A 2DU9A 4A6EA 2NNNA 3BZ6A 1YS7A 3RKXA 4NB5A 2GXGA 3TO7A 4Q4ZF 1BI0A 1FP2A 4P9UA 2IA2A 1H9TA 3N97A 3HRUA 4ENMA 3IRQA 2HYGD 4OMZA 3EDPA 2Z33A 2HZTA 2UXNA 3K69A 4HZFA 3E3VA 3CO6C 1WI9A 3K9TA 4U7DA 3H3UA 2LKPA 2JTVA 1LJ9A 3TDUC 2EA2A 2FNPA 3B02A 4PGHA 3CUOA 3F8CA 5D8LB 1S29A 5J6XA 2VXZA 1BN5A 1TQIA 4UVCA 4RGRA 4EJWA 4Y13A 1KU3A 3VFZA 1HSTA 2BV6A 5AIPA 4YG2F 4OIRF 5JVTA 1MZBA 4XLNF 2NAZA 1MGTA 5JHUA 4IRHA 1SAXA 4L9VA 3ZMVA 4KN4X 4RGSA 3TOAA 3ROUA 2M87A 4PGGA 4NQWA 5EEHA 2Q0OA 4RB1A 2ACJA 1BI1A 3T1BA 1YW8A 1KU7A 1ZARA 2PQ8A 4U0WA 2P7CB 3EUHA 3L09A 4G9YA 2CFXA 4M73A 2EFQA 4ZYEA 1W5SA 2EFPA 3MQ0A 3F23A 1CGPA
chains in the Genus database with same CATH superfamily
4XLCA 3JRDA 5FB2A 3QQAA 2PMZN 1ZTRA 5DEQA 1TTYA 3KPHA 5K7HA 2VC1A 4BQOA 2R92J 3GLLA 1QZEA 3LL7A 1UCRA 1DPRA 4ESJA 1HW2A 1EKEA 1Y8QB 4EJUA 3HDDA 3AFHA 3LSTA 3ZOBA 5FJ8J 1WPKA 1L0OC 3OYJA 4XKVA 3J7AO 4CO8A 4AM3A 3PSFA 1ZLJA 2KRFA 2HNHA 2XF5A 3S93A 4XORA 2BY2A 2PFBA 2LKSA 1VQ8I 3IL2A 3HOZJ 1FOXA 3OYLA 1JGGA 2VL8A 2WB1A 4S0HB 3QPSA 3M07A 2CG4A 1U9NA 2LP0A 3CO7C 3GZ5A 4KMUX 4ZDPA 1BA5A 4R8HA 1X3WB 3V7SA 2L9NA 1XGOA 4MNUA 3D5LA 1HW1A 2JA2A 5E1WA 3IP4B 2VJ4A 3FXOA 4CYDA 1XB4A 2FJ1A 4IVNA 2W7NA 3TP3A 3I55I 3BTIA 3LWFA 1OPCA 3KYCB 2STWA 4M3BA 4CDGA 2WWYA 2OTJI 3M4OJ 5E3LA 2KDZA 2HVSA 5JFRA 4BACA 2F5DA 2H94A 4QPQA 3CZ6A 1NG6A 1POGA 1AKHB 2JPCA 4JX6A 3E97A 2A68F 4BEHA 5KHDA 4HF0A 4BE2A 2Y2ZA 4FQGA 1H9GA 2UV1A 1Y39A 3K4NA 1TT0A 4F91B 2VUMJ 5DUIA 4BE1A 3LA7A 2LD5A 3IWZA 1YX3A 3BJ6A 3CDHA 4NNJA 4FTHA 2A6HF 2ECCA 3HHHA 1I27A 4BQQA 3NRVA 2IS4A 1JHFA 5HS7A 4RGXA 4EJVA 1FIPA 3WG7H 5FD6A 1ZREA 1JXSA 1JKOC 2WAEA 2MH2A 3I64A 2VE9A 2A5WA 4A5NA 4HNVA 3DEUA 1SFOJ 5DD8A 3HSRA 1R22A 1BM9A 4XN3A 3K4LA 3LFUA 3CMEI 2JMWA 2A05A 4ABZA 1J2XA 4S04A 4OIPF 2HOSA 3BPVA 3HSEA 4AIKA 2ZXIA 5IYDJ 1XMKA 2F5EA 3OL4A 4YRVA 1I6XA 2AXLA 3IUOA 4U88A 6PAXA 1MKMA 4I99C 1R9TJ 1A36A 3A01B 2EINH 1RR7A 5B1BH 1TC3C 4EM2A 2IW5A 5CVIA 1TWAJ 4A69C 1P4AA 4DZJA 5CVRA 1RR8C 2ISYA 4DIQA 2NS8A 1TWFJ 1RRJA 2D2WA 3S32A 3SZPA 5IP7J 1CF7B 2QQ8A 4N0BA 4M74A 3K2AA 5CPRB 2LVSA 1D1AA 1JUPA 1YFHA 3BPXA 1XX5A 3WE3A 1KONA 2ZFWA 4E7ZA 3CC2I 1GVDA 3RZOJ 3W6KB 2ETHA 1MNEA 3S8PA 1YTYA 3MCZA 1K4TA 3EUKL 4NHJA 3Q5FA 4HBLA 1N75A 2XF6A 1NG7A 1NK3P 1OR7A 5FROA 3J7YJ 3CCYA 3P9IA 1YYVA 4DOZA 1T95A 5DM7F 2MC4A 4CZCA 4G7HF 2A6EF 3PNVA 2VXDA 2OD5A 1D5YA 2Y9ZA 4AYBN 2LF8A 3GF2A 5M5XJ 3C7JA 1G3TA 4DGWB 3JTGA 3CESA 3UKGA 1AA7A 2K86A 1K7AA 5LGNA 2HR3A 5HLGA 4CSWA 3OS2A 1GT0C 3LSPA 1IN4A 3EUHC 1P7IA 4Y7NJ 1DPUA 4I0BA 4MEXF 4LG3A 3K70C 1Y1WJ 2NRAC 2X4HA 1RKWA 2G7UA 4GYGA 3W2AA 1OCOH 3RYPA 1W7PB 2V1UA 1HBXG 5FGMA 3K6GA 5JVGF 1H8AC 2H6BA 3DBRB 4RB2C 4DNCA 3KP2A 3VSKA 5B66C 2LTPA 1J59A 2HOEA 2VE8A 2OBPA 4DZPA 3G73A 4IKFA 3H9GA 2BHYA 2KPMA 4NC6A 4CCJA 3FF5A 1BR4A 5E3MA 4N4NB 1JJ8C 3HKZA 1HXDA 1X58A 2DOEA 5IP9J 4U7BA 1O3SA 4AVPA 2YU3A 2QLZA 4TV7A 2FOWA 1EH8A 1HW5A 3JRCA 1QPMA 2NS7A 4PJ0C 4W97A 2PMHA 2QZ8A 3H3VK 3WODF 2FBIA 3GW2A 1KA8A 4I0AA 4GGGA 2ME6A 4AIJA 3I71A 1OLTA 2Y48A 2LY9A 5J47A 4C3HJ 3QODA 1F1ZA 3FXJA 2TCTA 3ZN1A 1GXQA 2QYOA 2LK2A 1X1PA 4GO1A 4HX8A 3GEZA 2QF7A 4LOCA 2K3PA 4NQWB 2ESHA 2ID3A 2FQ3A 3HEFA 3SQNA 4XQFA 3QWLA 2VQLA 4F52A 3GZ6A 4II3A 4F3QA 3MWMA 1ZGWA 3F6OA 5AIQA 4I7HA 5EEAA 3DQVC 1QVTA 4M3GA 4LB6B 4D0PA 5ICFA 4HW0A 2H1KA 4HLYA 1XSXA 3RZDJ 1I6HJ 2ZBKA 3HRSA 2LSOA 1VQKI 2R5ZA 5IP6A 3CCSI 2GOXB 1ORKA 3TW7A 5E8GA 5LHHA 2Q8KA 1PUFB 5D5UB 4CCMA 2JA8J 2DPUA 4UUVA 1YRNB 1EH7A 3BJOA 2DLLA 3DEEA 1NTCA 2XAFA 2OZUA 4I6ZA 1AOYA 3IAS2 2Z1DA 1CQTA 1Z7LA 1U3EM 3MZYA 5KAFC 1D8KA 3BG5A 2DJIA 3OIQA 4JK1X 2E7XA 1HDPA 4RAZA 2HYJA 4UUTA 3SFZA 3T8TA 4A0YA 2R7UA 4P55A 3LA3A 1RPWA 3FM3A 4Q5SF 2Y69H 2VN2A 3FM5A 3HRMA 1ZYRF 3CUQC 4ETSA 2PEXA 3LAPA 1O7FA 4LK0F 1WZ2A 2M4KA 1D5VA 3D5RC 3HRTA 4CH7A 4N9IA 4A0ZA 3KP7A 1SANA 1MNMC 4KMFA 2VODA 3E6BA 2XGDA 1G8XA 5E3NA 1Z67A 3I0TA 3HGYA 5M3FJ 2RGVA 3PFIA 4IPAA 1YS6A 1XGNA 3HUGA 4Q47A 5DD4A 2X9DA 2F6CA 2VLAA 2RQPA 5FKNA 1IZ1A 1D1BA 1LB2A 1M1EB 1I1GA 5ED4A 5LRRA 2BW3B 3PNYA 2LH9A 3JRFA 4FX0A 4PJJA 4H0EA 2I5UA 4QWQA 1XC5A 4LD5A 5L3CA 4CCKA 1QO0D 3RKQA 2IEKA 2MGQA 2VBXA 1QPIA 1XMXA 2C6YA 1R49A 2GWRA 3PFYA 3F21A 3EPZA 4A3DJ 4FT8A 1HCRA 3COAC 5JR3A 3AG2H 5HNHA 1VF9A 1G59A 4BEHB 2DQRA 3MAJA 1ENHA 2MD0A 2DPDA 1AU7A 1F9NA 4KIGA 4ZJZA 1R36A 4MIMA 2WV0A 1ZAOA 3JRIA 3I5UA 4A12A 3R6SA 1E0EA 3ZMUA 4HV6A 4XK4A 3W3CA 2DT7B 2VPRA 4HSTA 1YI2I 2CUJA 3BDDA 1FLIA 2EBIA 5FLMJ 3A0HC 3WGGA 3DEWA 4HF2A 5CQEA 5EZHA 1SD6A 3OIOA 1FJLA 1T0FA 1JGSA 4A3FJ 2XHKA 2KMUA 3LSHA 4A3KJ 2BY0A 2HTJA 3K1NA 2DA5A 2F5VA 2E35A 2DTZA 1NH3A 2GAUA 3TL4X 5LEJA 2F4MB 2MC3A 1SD5A 4X0GA 2FD5A 4XLFA 2OQGA 2CUFA 2VKDA 3RQ4A 3P9KA 4EJOA 1DUXC 2BBYA 1R58A 3HOWJ 2GQQA 2JVGA 2W00A 4F55A 4UVAA 2JRTA 1FBQA 2X51A 2VOOA 2Y75A 4HDUA 5HODA 3REOA 1SFUA 2NVYJ 2NVTJ 2K9MA 1IG7A 3LSGA 2IAIA 3QP5A 1SMYF 3MKYB 5K5QA 3GX4X 1U2WA 2DK8A 1HC8A 4M6VA 2VKEA 3LSJA 5HNFA 2XAUA 2E7WA 2XSJC 4HF1A 4MHGA 1WKMA 4BQAA 2A69F 3NEUA 3AKZA 1IUFA 3H0GJ 3FIWA 4J01A 1FEXA 2IGKA 3BG3A 2R5YA 2O8XA 2L7MP 2RKHA 3ZMSA 2QGUA 4A3LJ 3V42A 2O0YA 1WJEA 4E7LA 2YSRA 3DKXA 1IN7A 2JUCA 2FEZA 2Q1ZB 4HOBA 4KIFA 5DV5A 1FYKA 1JKPC 3ZPLA 3I4NJ 2EFWA 2IS2A 3GTLJ 3EYYA 4XIDA 2W82A 5IYCJ 5C4XJ 2GBYA 3J7ZI 3S15J 4CCOA 1OJLA 4D5FA 1Z05A 1ZHFA 3A03A 3CCJI 2P7VB 5IT9K 3VYSB 1P92A 3ONQA 4PZJA 3QYFA 4DYCA 4BXXJ 4EATA 4C3JJ 4YIRX 2BY1A 3CLOA 1KU2A 1AWCA 1BI2A 1U6GA 4MEYF 3WE2A 2UWMA 2KIFA 3KP3A 2ME0A 3GUDA 3Q0UA 5K5OA 1MBJA 1QHGA 3HHGA 2PN6A 4RB0A 2EZIA 1S9HA 3ABKH 3MN2A 2ELKA 3BZKA 4BNCA 4D9JA 3BR3A 2YU9J 2X48A 3PSIA 1X3UA 4ANJA 4RDUA 2WY8Q 2RVCA 3BT9A 4JOMA 5K5RA 3QYBA 3OYNA 3LFKA 4I76A 1UFMA 3F8FA 3ZQLA 4KJZA 1R6RA 1YJNI 5D4RA 3OYHA 3ZP5A 1YW9A 5IYBJ 2BVMA 3PJRA 3HTUA 5LD2C 3OYEA 4W1UA 4HLXA 3C2GA 4YFKF 3K7AJ 4CYCA 1TLHB 3CC7I 1XDUA 3WTSC 1IDZA 2EPFA 2IA1A 2O61A 3E5XA 4U0YA 2KZGA 1TWGJ 3DCFA 1X1DA 1IJWC 3RPUD 2A3SA 1LDJA 3VB2A 2ZKZA 1ETXA 1K79A 3I53A 4M6YA 4L5EA 5LHIA 4M3EA 1GDTA 1TWHJ 3VYUB 2Y0MA 2E1MC 2CJJA 2L3DA 4QSHA 4BU2A 2WAQA 4UV9A 4OIOF 3GTGJ 2RAEA 3K2ZA 3RTRA 1I5ZA 3ASOH 2JN6A 1RESA 3O2PE 1E3PA 4XRSA 1FSEA 2COMA 2XAGA 1G3SA 2EZLA 4EM1A 3VPRA 2BXYA 3BR5A 3VSLA 1W36C 1QBJA 2X85A 4BAYA 2ZMEA 1ZG1A 5ICEA 2R5ZB 1IRFA 3HOYJ 3SHFA 4E7KA 2NXNB 3PIOF 2XKPA 1FYMA 2M0MA 3KZZA 2CRGA 1VQLI 1YJ9I 4B8XA 2R7QA 5F1JA 5HLTA 1S72I 2WB1N 4CA0A 3S2HJ 2JK3A 3S16J 2DXIA 3WHBA 2B63J 1TNSA 2MH9A 1LPQA 3GVAA 1IC8A 5D4SA 2XPVA 5EGOB 1U5TA 1XSDA 1MBGA 3WTTC 2M5WA 3ZMTA 1BW5A 4E7JA 2ZCWA 2RNJA 1E2XA 1SFEA 1T38A 1SVMA 1F36A 1ETOA 3DKYA 1JTXA 3L2QA 1J75A 1OCPA 3H5NA 2EV5A 2UUZA 3G6EI 3PNTA 4CZZA 4A2UA 4JP0A 3T8RA 2FUG2 2KL4A 2LRDA 1X1BA 2AHQA 2LMDA 3I54A 4FE4A 4L0YB 1MIJA 3CJNA 4I98B 5FD5A 1RNLA 4ZYGA 2M4GA 2D1VA 1OFCX 5ICCA 3JR9A 3HUGB 5IY5H 1QA6A 2LOOA 3DBLB 3L2VA 4KDPA 2ZJ2A 4IJAA 2HGCA 2CU7A 1BC8C 2E1MB 4BY1J 1MDMA 2TDXA 3GTJJ 5GPAA 4C30A 2VKHA 5J8FA 3HPHA 1B6AA 3GTKJ 3DTIA 5CKTA 3GTQJ 5F1RA 1VQOI 2P4WA 3MD2A 1OYWA 1WHUA 5HLHA 3HZJA 3TMOA 2E2IJ 1ZR2A 1GUUA 1UELB 3D0SA 1EJ9A 2QENA 1W5TA 3TGNA 4M3DA 2M8EA 1IV6A 5FRNA 2A61A 4RAGA 5HVQC 5H2FC 1RC9A 5H6RA 4EM0B 5IOZA 4HDVA 3FXRA 3RQIA 4B44A 1DDNA 3DU6A 2NVUB 1V55H 2ZB9A 1UB9A 1APLC 4EJTA 1ZG5A 3ASNH 3FXLA 1IAWA 1TW3A 3DPUA 4E70A 2K3FA 4FX4A 5BPDA 2LKXA 2TRTA 4OAYA 4BXUA 3IAM2 3Q0WA 4QLCU 2X6XA 3K4BA 1RUNA 1UHWA 3QPLA 4LLNA 1LKXA 4I2OA 2QVOA 2M7AA 1U9OA 1ETYA 4A5MA 2QEXI 4M9ZA 1VQ6I 4A3BJ 5CVUA 2LDUA 3FHNA 1FMVA 2MABA 5HOOA 1V5GA 2DT5A 1ETWA 1WVRA 2E1OA 5H20A 3SYTA 3HGGA 3RKYA 5JLXA 1OCTC 2NYXA 2W1OA 4EMSA 2QSHX 3S1MJ 2M2EA 3K4KA 4IHYA 3MVPA 4EV0A 2L02A 2DOFA 1YX5A 2FF4A 2I10A 3FHZA 2B0LA 1TQPA 3GXOA 5D5VB 3FXQA 1TWCJ 1FYLA 3H9JA 1R71A 2E1CA 2DA2A 3LSKA 4ENKA 4ZC3A 2M8GX 3SJMA 1D0XA 1UHSA 5EEGA 3S1RJ 1D3YA 2L7FP 3H9QA 3GFLA 4UUSA 5H6QA 5TRDA 5D5XB 2P5KA 1K4SA 1MH4A 4A3JJ 3OYIA 2HI3A 2R5YB 3V7RA 1ZG3A 5ILUA 3TOBA 1GV2A 1TZLA 5TGTA 2Z3YA 5EJCA 3QU3A 4BHCA 3ABTA 4IO9F 1OISA 3ZQCA 2GZWA 3E5UA 1T2KA 2CSOA 2BZTA 1KU9A 1LQ1A 2HXOA 1ZRFA 3G3ZA 1BBYA 3E6CC 3DTKA 2ID6A 4MGRA 1FMWA 3DTEA 3MKZA 2N8GA 3ZQFA 3OYFA 3MFKA 3HKZN 4XBFA 4P96A 1T08B 3V8KA 2OQRA 3FBNB 2ZSIB 3C1DA 2DYRH 3F8NA 2WA0A 2ZMEC 3HTSB 1FP1D 5EG0A 1AHDP 4IXAA 2Y31A 3ECOA 1FWZA 2L5QA 2E5ZA 4XL9A 2LBFA 4KT6A 5GTIC 1YOVB 2YX7A 2IS1A 1K78A 4BY7J 1W7PD 1SFKA 3FMRA 3HC7A 3QOEA 2CO5A 2CW8A 1R23A 4PJMA 1FX7A 1JKRC 2CWEA 2DMQA 3U1KA 2M30A 3ZCOA 5J1RA 2EA4A 4J00A 1YIJI 1VQ7I 3FXUA 5D8KB 3A1YA 1U5TC 4AIDA 3HOUJ 1J5YA 1R5ID 3O6BB 1GLNA 2XB5A 2XV4S 4O5VA 5DS9A 4LFUA 1RI7A 1S3JA 2XRNA 3HPGA 5ILVA 1F5TA 2EZKA 3ABMH 3H1CA 3JRGA 1UMQA 5FFZA 3BQYA 4KN7X 4WK8F 5KAIC 4BBSJ 2G7HA 1RZ4A 3P9CA 2K9QA 3WTWC 4OAZA 4UXNA 1W5CC 3L2UA 4E6KG 3R61A 2IGOA 2RV8A 4XLHA 3GCMA 1LEBA 1I1SA 2GXBA 3FKIJ 4XRFA 1LFPA 3FMSA 4FE7A 2F4OB 3B6AA 2RC4A 2HZDA 3AG4H 4MTDA 5CVJA 2JVHA 4Q48A 4IEJA 1S8NA 2KLOA 1W4MA 2A5YB 3EQLF 4XSZF 1MMNA 2BGCA 5KCMA 3WTVC 1G3YA 1XS9A 3ABLH 5HLIA 1XSVA 3PIPF 2F48A 3E6DA 2WV1A 2CQ7A 5E8IA 1TW2A 3H5RA 4NC7A 2STTA 2HU9A 2EZHA 2KKOA 2X0LA 2V1XA 2M7BA 3VWBA 2JSCA 2OZ6A 3OOPA 4BYYA 4ZYHA 2FBHA 5FO5A 3LQQA 3G4SI 5FLXK 2ZMEB 3NAUA 1VFCA 5DCMA 4HRIA 3K70D 2XB0X 2ICWG 2DFIA 2H8RA 3GBGA 4YIFA 3S2DJ 1WQ2A 3W2VA 1F43A 2DMNA 2PJRA 2Z5UA 3L1PA 2HVRA 3W6VA 4JQFA 1N25A 2CMPA 3L2CA 3BR2A 5TISC 1MBFA 3OYMA 1SVOA 4XONA 5GAGJ 2XGXA 4NC8A 2DMPA 4B4CA 4KISA 1U5TB 3U2RA 1OYIA 3DPTA 2EH3A 3O3KA 2VT2A 2VJ5A 4Z6YA 4M72A 2KT0A 1SD7A 3SZTA 4ZH4F 4WCGA 4YIIA 1F4KA 3MZHA 4RLQA 2QA4I 1VI0A 4G8XA 2DA4A 1JE8A 2HDDA 2IXSA 4C2TA 5DM6F 2BE5F 1BL0A 2CFOA 4JX5A 1B9MA 1XMAA 2J5PA 1TT5B 5CJ9A 3DXJF 5CQGA 3F6VA 1TQMA 2Y0SA 2R7RA 3M9AA 4BE0A 4MFEA 1LFUP 2R7XA 2L4MA 3OIPA 4PJNA 2ZJRF 1B1BA 4HEA2 3MMYB 1STZA 2E60A 2LY1A 1Z9CA 4B3AA 4A93J 3S3OA 2KZVA 5TJJA 1SC7A 1LEAA 1WFXA 2V7FA 4BDZA 1O7LA 3BCBA 4HSRA 4CXFA 3T5XA 1MDMB 4J19A 3BR6A 3E1SA 1E3OC 4LB5A 4QPOA 3BTCA 3ERMA 5GAHJ 2FMLA 5DUKA 1HKQA 1J09A 3OY9A 5E20A 1Z91A 3RPUA 2QSGX 4KYWA 2VB6A 3W6JB 4WX9A 4OIQF 1NHAA 4KFCA 3OS1A 3BQZA 3GTOJ 4I01A 3FISA 2R0QC 2UXXA 1SAUA 1TNTA 1XCVA 2HS5A 5L3GA 1C0WA 3G2BA 2CV2A 1YITI 4BGDA 1VZ0A 3FMQA 1BJAA 2K9LA 2K9NA 5B1AH 1ULYA 3C3WA 1ZN2A 3CP2A 2ZJQF 3BLYA 4XNFA 2VQCA 3NWTA 2HDWA 4R79A 1ZK8A 2EWNA 2FBKA 5E18F 4AVZA 1R5HA 3R60A 3GFIA 3EYIA 2AXTC 2E71A 2O3FA 5HDKA 5JI6A 1GV5A 2YR2A 3IWFA 3KP5A 2H27A 1P9QC 3ULQB 1IGNA 4AWXB 1PDNC 4XSXF 4Y15A 4RBOA 2K4JA 2GXAA 3M1CA 2RDPA 4L18B 1OR7C 2VC0A 9ANTA 1T56A 4BHBA 2DOAA 3H3ZA 3ZRGA 5GTHC 3VOEA 4WF2A 5HDNA 2K5CA 1T98A 3KIOA 3JSPA 4G6TB 1QNTA 2QQBA 3RPQA 3HOSA 2R7WA 3D5SC 1USSA 2HEOA 3W2WA 2FOKA 2AS5F 5HS8A 1P6RA 2V9KA 1ERDA 2MW8A 2OTLI 1WRJA 2HQRA 3ML6A 1LVAA 2VBZA 4UUSB 1I39A 1J7KA 2X1DA 5IT3A 1L3LA 1ZELA 4U87A 1IN6A 2BEOA 3CCVI 3JRAA 1IV8A 2XAQA 1WWXA 1UJ8A 2H1LA 4IQJA 2DFFA 1H89C 5J1YA 1YJWI 2E2JJ 4DYRA 2QQAA 2DJNA 3CJQB 2MA3A 4ZDLA 2AO9A 4ON0A 2V1NA 1XCBA 2YUSA 2HDCA 4BBRJ 2L7ZA 1Y1VJ 1G2HA 4F92B 2JA6J 3HSFA 4G6QA 2HQNA 1BOAA 1QGPA 1AKHA 4S05A 5J1UA 2VOPA 4U0VA 4UHTA 1ETKA 5EG0B 3OSGA 3I9V2 2EJRA 3JAMK 1Y0NA 2LF7A 2L2OA 2WBMA 1DGRM 2LBFB 3A4CA 2YS9A 2V4JC 4HNTA 2O03A 4XMYA 4L9JA 1XGSA 3CCUI 3FWEA 4EVIA 1R1VA 4IHVA 4M71A 1S7EA 1E17A 1X19A 2IVMA 4EGYA 2EFOA 5LBQA 3SFIA 3WGHA 3SXYA 1EA3A 4LGWA 5E1ZB 2I8DA 3CJRB 3BR1A 4MTEA 4Z2YA 3CC4I 3KZIC 4X1EA 1O57A 2L54A 2R7TA 2WAQN 3GZNB 1Z6RA 2EIMH 5EF6A 3SDBA 1OCCH 1Q1VA 5C44J 1JUMA 1X1CA 2NOJB 4IX7A 1WCMJ 1D8JA 3OR1C 4HG2A 3CJTB 2YX4A 1LVKA 3BG6A 3E7LA 1BR2A 3JSOA 3V7CA 1IN8A 1DP7P 2NNYA 3Q9VA 2L9VA 3U1DA 1Z77A 5BMZA 2HQ5A 1G3WA 2GM4A 1IW7F 3GMEA 4ZYDA 2E19A 2JJ7A 1G4DA 1VQNI 4BXFA 5FLVA 1BOBA 4LJZF 1J0RA 4M3FA 3L9FA 2CUZA 4UB8C 2EIJH 3DBHB 1EH6A 2HKXA 5LFAA 1IUYA 4KT5C 2JQ7A 2LREA 4PCQA 1KYWA 1CF7A 1SVLA 2L9RA 5DYMA 3J7AY 2LNBA 2R7FA 2L0KA 4A3MJ 4LG0A 3VYRB 4L5JA 3CD6I 3GO5A 2EK5A 3OL3A 3H36A 3J81K 4RAFA 2DA7A 1Z7UA 1R5GA 2HFHA 4HYEA 4L9NA 3LNQA 1QHHD 2F4IA 5J8CA 1K83J 1I50J 1Y0UA 3OYGA 1S5LC 2W85A 5DCFA 2B7EA 2R7SA 3EUAA 1DP3A 1ETQA 5DCMB 2DFEA 3CF2A 4GYIA 4HQEA 4KIBA 4RM2A 1T6SA 1YQAA 3KP6A 1IRGA 4YFXF 1V3FA 2EB7A 3PM1A 2LC2A 2PJRB 3DU5A 3GFMA 3WG9A 1MSEC 1W1WE 3LOCA 3HOXJ 3LSMA 2HOAA 3VDXA 4FETA 3HOTA 2EFNA 2DAOA 2DFHA 4DW6A 1A04A 2L4AA 4PFPA 3QPTA 1XTAA 4BH9A 2XAHA 3F3XA 3BP8A 4BHPA 4NUBA 3CCRI 1PYVA 3I4MJ 4WXCA 5DTDA 1W7PA 2R7DA 4LIVA 4LLGF 5C3EJ 3P7NA 5LHGA 3JRHA 1E3HA 2VQGA 5L3BA 4BUPA 1A6QA 3RIRA 2P6SA 3VEPA 1FNNA 2L01A 2R3SA 1MMDA 2BOLA 4RGUA 3N4MA 3ZXSA 5BOXA 1T39A 2HYFA 2AQEA 2QBYA 1KYZA 3HG9A 3KEQA 4CGZA 1IRXA 4KITB 1IF1A 2H09A 2ZXWH 3PQKA 5D6EA 5GAEJ 1TP4A 2VBYA 1LNWA 1MNDA 1ZR4A 4XRSG 2EILH 3S14J 1HSJA 3CDIA 3OSFA 2IJLA 2NOGA 1RKTA 3V8LA 2M0CA 1Y56A 5E3OA 1VTNC 3OYKA 3SZGA 1P4WA 3DFGA 4RA2A 1T0FC 2UZKA 3BOQA 2PJPA 3JAMZ 4P5OA 2V9VA 3NWSA 2VPLA 1V4RA 3HXLA 4IOCF 1FIAA 4ZZDA 2FQ4A 4X6AJ 2DA6A 2O7OA 2CV0A 4A3CJ 4PK4A 5M5WJ 1ZKGA 4Y3OA 3QAHA 2DDBA 4YELA 4D1QA 1VNDA 2VT3A 3V4GA 4Y17A 5IPAA 2FRHA 4OOIA 1HQCA 2CW7A 4NBQA 2XROA 3LAJA 1P4XA 4V19K 2DBBA 3M3YJ 1MJAA 3CTAA 2M1BA 2DT6A 1X2MA 3B73A 2ZXJA 4A0XA 1QU3A 3T0YA 2V6CA 4LIUA 5IT9Z 3NQOA 2XIGA 2ELHA 3IV5A 1LDDA 3QOPA 4QTRA 4GCVA 5K7ZA 5KVRA 3GTMJ 3FXMA 4IHTA 2F5CA 2OA4A 1PUFA 1YE9A 2OUMA 5GADJ 4AIHA 1SD4A 2CQQA 4ESFA 3KLNA 2K4BA 2K9SA 2MSYA 5LLQA 1K6OA 4HX7A 1B72A 3CMYA 2XRLA 3TBIA 3KE2A 4E7IA 2L7KA 3OYCA 2COBA 2CH0A 4RM3A 4XOTA 3ZGKA 5EDNA 3GWZA 1MD0A 4UNOA 1PP7U 2KQRA 2VQHA 1EF4A 5J4VA 1ZH5A 1YW7A 4UB6C 1W0UA 2OJED 4RMNA 1YG2A 3H0DA 3B6CA 5B5EC 5KK1A 4IHSA 4XM3A 3OMYA 4WWCA 3GYHX 4UY8I 3H5AA 4DBRA 4IOAF 3UNGC 3PO2J 3J81Z 4ENNA 3FXKA 1XPXA 5K7FA 4PSXA 3CF5F 5LGUA 2OF7A 5E1XA 1UHMA 5CVVA 1Z3XA 1XN7A 1P2FA 3V8JA 2OC6A 5GP9A 2CQXA 3A02A 1FC3A 1QQIA 3F9KA 1MJ9A 1Y6IA 3IC7A 3BWGA 3KZYA 1VQ9I 2X6YA 3TW6A 1V5EA 2JSPA 3RI4A 3I59A 4B1RA 2BVLA 2BW3A 3OR2C 3R4KA 3WTUC 3WU1B 3KETA 3E5QA 2E1NA 1WSUA 2Z16A 3JW4A 3O8GA 2JZYA 2KIQA 2P8TA 4AUXA 1WJAA 2XPUA 3DPLC 3ESWB 4OWRB 3FDYA 3TQNA 3F22A 1DU6A 3LQRA 3BG9A 2XAJA 2O6GE 2IA0A 4Y33A 5ICGA 4L9TA 4Y4RA 1K6YA 3ECHA 4KUMA 1MBEA 1R7JA 5FKMA 4V2GA 2JUGA 2Z99A 3AG3H 3M1EA 4DQ2A 4BQNA 2R4GA 3PO3J 1LE8A 2FX0A 1Z6TA 5BNGA 5F0HA 4M9SA 3AL0C 4F7ZA 1R1UA 3X2QH 1GHCA 2WTEA 1R00A 4MLOA 2ZJPF 1PJRA 2V1DA 3IKTA 1WH7A 2MBFA 2IRFG 3U21A 1JKQC 1T33A 2KDOA 2PMZA 3GLXA 1YO5C 1HDDC 2JA7J 3FZVA 2WADA 2KP6A 2H6CA 2XSDC 4G7ZF 1GXPA 4QIWN 4ENJA 4BDYA 1B8IA 3Q9SA 5A2QK 1HKSA 1IXRC 2KJCA 3KCCA 3KYDB 4PUSA 3CCEI 2P81A 2XGEA 2F5FA 3DF8A 2LY2A 3HM5A 4RAYA 5K1YA 3OS0A 2GA2A 2PBIA 3CUQA 3LSRA 1IO2A 3IH3A 5J4YA 2QQ9A 2D5VA 4BKXA 1UG2A 3DP7A 2XC7A 1HOMA 4EEFG 3WHCA 4Y52J 1XGMA 4JBAA 1R4MB 1KGSA 1BIAA 2QSFX 2BYVE 5JHFA 3K4JA 3G1LA 4PDKA 2NVQJ 1ODDA 2JPBA 3S17J 3K1MA 1I3QJ 1QZYA 4D5CA 4ZTJA 3NARA 4WXDA 4I02A 1IXCA 2MLKA 3OV8A 1BR1A 1Z21A 2G0EA 5FKLA 3Q0VA 3OYAA 2ZNYA 5L3EA 3ZN0A 2MLGA 3I4PA 3K10A 4A3GJ 5D6FA 1ZRCA 3GTPJ 3TKYA 2Q2EA 2GOMA 4MFDA 4XRMA 4G6DA 4A6DA 3MKLA 1WH5A 2DK5A 4LG0B 3S3NA 2VONA 2DODA 1Q1HA 3OWTA 3KX2A 1ZLKA 2ELJA 5F0FA 1WJFA 3C2BA 4XR6A 2VBWA 2MG4A 4N4OB 1SEUA 4CCNA 2GIZA 2JRMA 4PFOA 1ON2A 4CYCB 4XKBA 1XDSA 1JJ6C 3HJEA 3S1NJ 5LRSA 3H92A 4ZTFA 3L00A 5FKOA 1MBHA 3RCOA 1X2NA 4DJAA 3DLLF 2P6TA 2LR8A 3R0AA 2QM3A 3AL0B 1YHQI 4LLLA 2MYSA 4XKWA 1X4OA 2Y0SN 3LMMA 2R7VA 3TEDA 1B9NA 4MQVA 2W25A 3HIFA 4B43A 1O3TA 3BZCA 2QCOA 3F72A 3CCQI 1HF0A 2W48A 1YLFA 2ESNA 2DQLA 4O3MA 1FBUA 3QPHA 5JLWA 2E5NA 3PUFA 2HWVA 2QUFA 1OKRA 3KEOA 2KISA 1FSHA 2F2EA 3M7GA 1JI8A 4RB3C 3TDZC 1O3QA 2O9LA 2CQKA 4ZZLA 2CYYA 5J40A 2FNAA 3MEXA 3WTXC 1HKTA 4IQ4A 4M9XA 4BS9A 2PMUA 1MJBA 1Z1DA 1IXSB 3OYBA 1WJCA 2B9SA 2HPMA 1KQ9A 1ONVA 4O6JA 4XOPA 2QBYB 2KFDA 3QU6A 2RREA 2NVXJ 5CYVA 4K2EA 2QWWA 1KQ0A 5F04A 4MQ9F 2XASA 5F27A 4PSWA 2OCCH 2W4SA 3KLOA 4IHWA 4L0ZB 1FOKA 1RIOH 3S3MA 1LUJB 3IRRA 1NK2P 2V26A 1FY7A 3ISPA 3IKVA 4P1WA 2NS0A 2ZO4A 3DKWA 2IPQX 3ELKA 2Z2SB 1ZGAA 2H8WA 4GXOA 1ZQ3P 1V5FA 2EV0A 3QP6A 2ZXHA 2FU4A 4IRIA 3I56I 2Y30A 3BTJA 1ITYA 3BTLA 1A6IA 2GA1A 1QRYA 4I09A 4JX4A 2IGMA 3F0CA 3F8MA 1BIBA 2CUEA 3RDIA 4AD9A 3VODA 1JT6A 2BY3A 4NDLA 1JTYA 3E0JB 3GFJA 4IF4A 3L2WA 4HA8A 4ZDOA 1FBSA 5D5WB 5AONA 1OCRH 1HLVA 4DBQA 3M8EA 1X3ZB 1LFBA 3J80K 2AQFA 5A2QZ 3CP8A 4AYBA 4C2UA 2FMYA 2V79A 3TP0A 3C18A 5E17F 3SEZA 4DYQA 4KNYA 1D0YA 3WU0A 1SFXA 1DGWY 1IRZA 3FK6A 2M45A 2P5VA 2G9WA 5F08A 1B4AA 5E79C 3ZR8X 1FPQA 2LFBA 1BW6A 3EETA 4GFBA 3LA2A 4A3IJ 1XD7A 4YEJA 3PQJA 2LG4A 5F0CA 3ZMZA 1FOYA 2P0WA 4EGZA 2BXZA 2GIVA 2O8KA 2R93J 2A07F 5L3FA 4B48A 3CDLA 3OOUA 2YPRA 3WU2C 1Z0XA 2XUBA 3JTHA 1YIOA 2VI6A 3D1NI 2P5LC 3IHUA 3HYIA 1R1TA 1FTZA 4KICA 3BROA 2Y9YA 4XLPF 3ABUA 1ETVA 5BS6A 1B72B 2DMTA 4L5IA 4GRIA 2CQNA 2FXAA 2A6TA 4KA4A 1BI3A 2ECBA 2PG4A 4G12A 5F64A 3PUBA 2BHZA 5EGOA 4BJ6C 3K4MA 3ZQQA 2IP2A 2DYSH 5DDGA 2KJBA 1O3RA 5CLSA 2W57A 2QKMB 3HL2A 2PLYA 5BPIA 4G94A 2E2HJ 4E7SA 3KEYA 1PUEE 1Y8RB 3I58A 2HTSA 2K7LA 4RLFA 2DO7A 1KQ8A 1OQYA 1IN5A 4UVBA 1A35A 2MD5A 1R4NB 5B3SH 2JA5J 2XDVA 5ILSA 1S7OA 2W84A 2XVCA 3Q3SA 4CHUA 1DQUA 3ZMDA 2JT1A 2QKLB 1N78A 2HKOA 2KRHA 4HQMA 2WC2A 2K27A 1H0MA 1EV7A 1IDYA 1ZGJA 2FSWA 3A0BC 4M6XA 2V6EA 1QVUA 4G7OF 1VQ5I 1USTA 3M8JA 2IS6A 4FASD 1TBXA 3I59B 2EIKH 2O5RA 2KIMA 4BL0B 3G1MA 4R1HA 5HS9A 1O4XA 2RQQA 3M8FA 2ADUA 4B09A 4ESBA 3WTYC 2K02A 2RN7A 2DTRA 3LSIA 5IOYA 3ERED 4A3EJ 4CCLA 1N77A 1XG1A 2L9SA 4LMYA 2CS3A 4OMYA 1BC7C 1WJ5A 3WTZA 3RYRA 2CGPA 1SMTA 3TO6A 3ZQIA 3HBLA 4IRGA 4MO7A 2WY7Q 3RJPA 1S6LA 2IT0A 1JHHA 4OU0A 3TO9A 5FLXZ 4WXHA 2LLKA 3H35A 1WGXA 1LE8B 2EV6A 3QRFF 1S7AA 3L7WA 1MH3A 4XN0A 2D45A 5BQTA 2ZFUA 2DW4A 4EQQA 3DV8A 3PL8A 3R0JA 4E7HA 2DDAA 4XLEA 1PP8F 1PVEA 4HPQA 3WGIA 2ISZA 2KHMA 3KP4A 2RNGA 4YFNF 2VASA 4CUGA 4HAMA 1H88C 5C4JJ 4ITVA 1B8IB 1MSFC 2DA3A 3JRBA 3G71I 2OAZA 4CICA 3SEQA 2ZNZA 3CUQB 3S2WA 3RKWA 5F6FA 1UZCA 4HX4A 3IH4A 1REPC 1P7JA 1UG0A 4JYKA 2IBDA 4RS8A 2PI0A 1X4PA 3O8HA 2WAFA 1QZZA 2CW0F 2KIUA 5L3DA 4AU7A 2DI3A 3J80Z 2DN0A 1K78B 4UV8A 3IH2A 3BJAA 4FISA 1B59A 1OCZH 4ASNA 3FX3A 3RSNA 1W0TA 5M3MJ 2J5OA 3BR0A 2E34A 1V54H 3BY6A 3U9GA 2X6WA 4HNUA 2Q2EB 2X6OA 2XKOA 1A5JA 3G1OA 2FA5A 1D1CA 2FE3A 1OYYA 1MMAA 1FT9A 1U78A 5FFXA 4N9HA 3CLQA 2XGCA 1JT0A 5HDGA 5LEKA 3AAFA 3F8BA 3KFWX 5ERIA 3ZQ7A 5EYRA 3E6MA 1FZPB 3QYEA 1G6NA 2VIXA 4BJ5C 4F93B 3OYDA 3K1PA 1FTTA 2PX9A 4IL6C 3KYLA 3JREA 4H4KC 4LITA 4IHXA 4HV5A 5KNLA 3A01A 1U8RA 4LK1F 1OMIA 2R7OA 2HVQA 4D7NA 1GVJA 3MZ8A 5LGTA 3K0LA 1MW7A 1X1AA 1RUOA 2VJIA 2ZC2A 2D1HA 4BJTA 2W24A 2M9HA 4XICA 1ON1A 2Z9OA 1J9IA 4FHTA 4P9FA 2HQAA 4OINF 1LDKB 4C2MJ 2KRCA 1ZRDA 2OU2A 4IZZA 2DU9A 2VKVA 2NNNA 2X1CA 4A6EA 3BC8A 3BZ6A 1YS7A 2ZSHB 3DWLE 4ZYAA 3RKXA 4NB5A 2GXGA 1TL8A 4B3XA 5J3LA 4XKCA 3TO7A 4Q4ZF 1FOWA 3CCLI 1BI0A 1UAAA 3S1QJ 1FP2A 1T8IA 1MMGA 4P9UA 2IA2A 1H9TA 3MKWB 3N97A 3HRUA 2HXIA 3ZQGA 1VQMI 3FKJA 5M5YJ 1U8BA 4ENMA 3IRQA 4C3IJ 2HYGD 3HOVJ 3FBIB 4OMZA 3EDPA 3I3LA 2JWTA 3K4CA 2HZTA 2Z33A 2UXNA 3K69A 4HZFA 5FRMA 3E3VA 3L2RA 3SDGA 3CO6C 1WI9A 1KZHA 2XPWA 3K9TA 4U7DA 3H3UA 2GLOA 2LKPA 2JTVA 1LJ9A 3TDUC 2EA2A 2FNPA 3B02A 3CQZJ 4PGHA 2R7ZJ 3CUOA 2EQRA 3F8CA 3CCMI 5D8LB 3JCUC 1S29A 2DCEA 3P5JA 5J6XA 1WJDA 2LYCA 2VXZA 1BN5A 1TQIA 2OCEA 4RGRA 4UVCA 4EJWA 4Y13A 1U0JA 2M3AA 1KU3A 3VFZA 1HSTA 2BV6A 3BG7A 3N05A 5AIPA 4YG2F 1WI3A 2IGNA 4II2A 4OIRF 5JVTA 1MZBA 4XLNF 5GPCA 2NAZA 1MBKA 5EZGA 1MGTA 2VJJA 5JHUA 1I3AA 4IRHA 4V2FA 1SAXA 3FK7A 4L9VA 4FCYA 3ZMVA 4KN4X 4RGSA 3TOAA 3ROUA 2M87A 1VQPI 1Z3YA 4PGGA 1W36D 1BJZA 4NQWA 5EEHA 3HB9A 2E36A 3C2HA 2K40A 4D7MA 2Q0OA 3DLAA 4RB1A 1HA8A 2MFZA 1RETA 1WJBA 1DU0A 2HPIA 1A31A 2ACJA 2DMUA 2OV7A 2M34A 1K61A 4GDFA 1BI1A 3T1BA 3CMAI 1YW8A 1KU7A 1ZARA 2PQ8A 4XLAA 4E4HA 2HOTA 4U0WA 2P7CB 3CMMA 3EUHA 4PJLA 3UR3C 1JUSA 3L09A 4AC0A 2V9PA 4G9YA 1YRNA 2CV1A 2DA1A 2K85A 2CFXA 3ZQHA 1VQ4I 2XF7A 4M73A 4C9YA 2EFQA 4ZYEA 1ACIA 1W5SA 2EFPA 3A2KA 5FKKA 3MQ0A 2X1EA 4B47A 3VYTB 2OPTA 3BCAA 3F23A 1CGPA 1MMSA 1D0ZA 3AG1H
chains in the Genus database with same CATH topology
5FB2A 5DEQA 1TTYA 2VC1A 1UCRA 1DPRA 4ESJA 1HW2A 4EJUA 3LSTA 1L0OC 3J7AO 4CO8A 1ZLJA 2KRFA 2PFBA 3IL2A 2CG4A 3CO7C 3GZ5A 4KMUX 4R8HA 3V7SA 1XGOA 4MNUA 3D5LA 1HW1A 5E1WA 4CYDA 1XB4A 4IVNA 3LWFA 1OPCA 2STWA 4CDGA 2WWYA 5JFRA 2F5DA 2H94A 2JPCA 3E97A 2A68F 4HF0A 1H9GA 5DUIA 3LA7A 3IWZA 3BJ6A 3CDHA 2A6HF 3HHHA 1I27A 3NRVA 1JHFA 5HS7A 4RGXA 4EJVA 5FD6A 1ZREA 1JXSA 2MH2A 3I64A 2VE9A 4A5NA 3DEUA 5DD8A 3HSRA 1R22A 1BM9A 1J2XA 4S04A 4OIPF 3BPVA 3HSEA 4AIKA 1XMKA 2F5EA 1I6XA 2AXLA 4U88A 6PAXA 1MKMA 4EM2A 2IW5A 5CVIA 1P4AA 5CVRA 2ISYA 2D2WA 3SZPA 1CF7B 4N0BA 4M74A 1YFHA 3BPXA 3WE3A 2ZFWA 3W6KB 2ETHA 1YTYA 3MCZA 4NHJA 3Q5FA 4HBLA 1OR7A 3P9IA 1YYVA 4G7HF 2A6EF 2OD5A 2LF8A 3GF2A 3C7JA 1G3TA 3JTGA 2K86A 1K7AA 5LGNA 2HR3A 5HLGA 1IN4A 1DPUA 4I0BA 4MEXF 2NRAC 2X4HA 2G7UA 4GYGA 3RYPA 1W7PB 2V1UA 1HBXG 5FGMA 2H6BA 4RB2C 4DNCA 3KP2A 1J59A 2HOEA 2VE8A 2OBPA 3G73A 3FF5A 1O3SA 1HXDA 4U7BA 4AVPA 2YU3A 2QLZA 4TV7A 1EH8A 1HW5A 1QPMA 2PMHA 2QZ8A 3WODF 2FBIA 3GW2A 1KA8A 4I0AA 4GGGA 4AIJA 3I71A 2Y48A 1F1ZA 3ZN1A 1GXQA 2QYOA 4GO1A 4HX8A 3GEZA 2ESHA 2FQ3A 3SQNA 3GZ6A 3MWMA 3F6OA 5AIQA 4I7HA 3DQVC 4D0PA 4LB6B 5ICFA 4HW0A 4HLYA 1XSXA 2ZBKA 3HRSA 2LSOA 5LHHA 5E8GA 2Q8KA 5D5UB 2DPUA 4UUVA 1EH7A 3BJOA 2DLLA 2XAFA 2OZUA 1AOYA 1U3EM 3MZYA 1D8KA 4JK1X 2E7XA 4RAZA 3SFZA 3T8TA 4A0YA 4P55A 3LA3A 3FM3A 4Q5SF 3HRMA 2VN2A 3FM5A 1ZYRF 3CUQC 4ETSA 2PEXA 3LAPA 1O7FA 4LK0F 1D5VA 3HRTA 4N9IA 4A0ZA 3KP7A 4KMFA 2VODA 3E6BA 3I0TA 2RGVA 3PFIA 4IPAA 1YS6A 1XGNA 3HUGA 4Q47A 5DD4A 2RQPA 1IZ1A 1LB2A 1I1GA 5ED4A 5LRRA 4FX0A 4H0EA 4QWQA 4LD5A 5L3CA 1QO0D 2VBXA 2C6YA 2GWRA 3F21A 4FT8A 3COAC 5JR3A 2DQRA 3MAJA 2DPDA 1F9NA 4KIGA 1R36A 2WV0A 1ZAOA 3I5UA 4A12A 3R6SA 3ZMUA 4HV6A 3BDDA 1FLIA 3WGGA 4HF2A 1SD6A 1T0FA 1JGSA 2XHKA 2HTJA 3K1NA 2GAUA 5LEJA 2MC3A 1SD5A 2OQGA 4EJOA 1DUXC 3P9KA 2BBYA 1R58A 2GQQA 4UVAA 2JRTA 1FBQA 2VOOA 2Y75A 4HDUA 3REOA 1SFUA 3QP5A 1SMYF 5K5QA 3GX4X 1U2WA 2DK8A 2E7WA 4HF1A 4MHGA 1WKMA 4BQAA 2A69F 3NEUA 2O8XA 3ZMSA 2RKHA 2O0YA 2YSRA 1IN7A 2FEZA 4HOBA 4KIFA 5DV5A 1FYKA 3ZPLA 2EFWA 3EYYA 1Z05A 1ZHFA 2P7VB 5IT9K 1P92A 4PZJA 3CLOA 1KU2A 1AWCA 1BI2A 1U6GA 4MEYF 3WE2A 2UWMA 2KIFA 3KP3A 3GUDA 5K5OA 3HHGA 2PN6A 4RB0A 4BNCA 1X3UA 2RVCA 5K5RA 3LFKA 1UFMA 3F8FA 5D4RA 3ZP5A 1YW9A 3HTUA 4HLXA 4YFKF 1TLHB 1XDUA 3WTSC 2IA1A 2O61A 3E5XA 4U0YA 2A3SA 1LDJA 3VB2A 2ZKZA 1K79A 3I53A 4M6YA 5LHIA 2Y0MA 2L3DA 4UV9A 4OIOF 3K2ZA 3RTRA 1I5ZA 3O2PE 1FSEA 2COMA 2XAGA 1G3SA 4EM1A 1QBJA 4BAYA 2ZMEA 1ZG1A 5ICEA 1IRFA 3SHFA 2XKPA 1FYMA 3KZZA 4B8XA 1TNSA 2MH9A 3GVAA 5D4SA 1U5TA 1XSDA 3WTTC 2M5WA 3ZMTA 2ZCWA 2RNJA 1E2XA 1SFEA 1T38A 1J75A 2EV5A 4CZZA 4A2UA 3T8RA 3I54A 4L0YB 3CJNA 4I98B 5FD5A 1RNLA 4ZYGA 2D1VA 5ICCA 4KDPA 2ZJ2A 4IJAA 2HGCA 1BC8C 1MDMA 2TDXA 5J8FA 1B6AA 5F1RA 2P4WA 5HLHA 1OYWA 3D0SA 2QENA 1W5TA 3TGNA 2M8EA 2A61A 5HVQC 5H6RA 4EM0B 4HDVA 3FXRA 1DDNA 1UB9A 4EJTA 1ZG5A 1IAWA 1TW3A 4E70A 4FX4A 5BPDA 4BXUA 4QLCU 1RUNA 1UHWA 4LLNA 4I2OA 2QVOA 4A5MA 4M9ZA 5CVUA 2LDUA 5HOOA 2DT5A 5H20A 3RKYA 2NYXA 4EMSA 4EV0A 2L02A 2FF4A 3FHZA 2B0LA 1TQPA 3GXOA 5D5VB 3FXQA 1FYLA 2E1CA 4ENKA 5EEGA 1D3YA 3GFLA 5H6QA 5TRDA 5D5XB 2P5KA 3V7RA 1ZG3A 5ILUA 3TOBA 2Z3YA 3QU3A 4BHCA 3ABTA 2GZWA 3E5UA 1T2KA 2CSOA 1KU9A 1LQ1A 1ZRFA 3G3ZA 1BBYA 3E6CC 4MGRA 3MFKA 4XBFA 4P96A 3V8KA 2OQRA 3F8NA 3C1DA 3HTSB 1FP1D 4IXAA 3ECOA 1FWZA 2YX7A 1K78A 1W7PD 3FMRA 2CO5A 1R23A 1FX7A 2CWEA 2M30A 2EA4A 3FXUA 5D8KB 1U5TC 1J5YA 3O6BB 4O5VA 2XV4S 4LFUA 1RI7A 1S3JA 2XRNA 5ILVA 1F5TA 5FFZA 4KN7X 4WK8F 2G7HA 1RZ4A 3P9CA 3WTWC 4UXNA 3R61A 2RV8A 1LEBA 1I1SA 2GXBA 4XRFA 3FMSA 2RC4A 4MTDA 5CVJA 4Q48A 1S8NA 1W4MA 2A5YB 3EQLF 4XSZF 2BGCA 3WTVC 1G3YA 5HLIA 1XSVA 5E8IA 3E6DA 1TW2A 2STTA 2KKOA 2X0LA 2V1XA 2JSCA 2OZ6A 3OOPA 4BYYA 4ZYHA 2FBHA 5FO5A 3LQQA 5FLXK 2ZMEB 5DCMA 2DFIA 4YIFA 1WQ2A 2Z5UA 4JQFA 3L2CA 2XGXA 1U5TB 3U2RA 1OYIA 3DPTA 3O3KA 2VT2A 4M72A 1SD7A 3SZTA 4ZH4F 4WCGA 4YIIA 1F4KA 3MZHA 4G8XA 1JE8A 2BE5F 1B9MA 1XMAA 2J5PA 5CJ9A 3DXJF 3F6VA 1TQMA 3M9AA 2L4MA 1B1BA 1STZA 1Z9CA 5TJJA 1LEAA 1O7LA 4CXFA 3T5XA 1MDMB 4LB5A 2FMLA 5DUKA 1HKQA 5E20A 1Z91A 3RPUA 4KYWA 3W6JB 4WX9A 4OIQF 1NHAA 4KFCA 4I01A 2UXXA 1TNTA 1XCVA 2HS5A 5L3GA 1C0WA 3FMQA 1BJAA 1ULYA 3C3WA 1ZN2A 4R79A 2EWNA 2FBKA 5E18F 1R5HA 3R60A 3GFIA 3EYIA 2O3FA 5HDKA 5JI6A 2YR2A 3IWFA 3KP5A 2H27A 3ULQB 4AWXB 1PDNC 4XSXF 4Y15A 2K4JA 4L18B 2RDPA 2VC0A 4BHBA 3H3ZA 3VOEA 4WF2A 5HDNA 1T98A 3JSPA 1QNTA 2QQBA 3RPQA 3HOSA 1USSA 2HEOA 2AS5F 2FOKA 5HS8A 1P6RA 1WRJA 2HQRA 3ML6A 1LVAA 2VBZA 1J7KA 5IT3A 1L3LA 1IN6A 2BEOA 2XAQA 1WWXA 2QQAA 2MA3A 4ON0A 1XCBA 2HDCA 3HSFA 4G6QA 2HQNA 1BOAA 1QGPA 4S05A 2VOPA 4U0VA 4UHTA 2EJRA 3JAMK 2LF7A 2O03A 4L9JA 1XGSA 3FWEA 4EVIA 1R1VA 4M71A 1E17A 2IVMA 4EGYA 2EFOA 5LBQA 3WGHA 3SXYA 4LGWA 5E1ZB 4MTEA 4Z2YA 1O57A 2L54A 1Z6RA 1D8JA 2YX4A 3JSOA 3V7CA 1IN8A 1DP7P 2NNYA 3Q9VA 3U1DA 5BMZA 1G3WA 1IW7F 4ZYDA 1G4DA 4LJZF 1J0RA 3L9FA 1EH6A 2HKXA 1IUYA 4KT5C 4PCQA 1KYWA 1CF7A 5DYMA 2LNBA 2R7FA 4LG0A 4L5JA 3GO5A 2EK5A 3J81K 1Z7UA 1R5GA 2HFHA 4HYEA 4L9NA 5J8CA 1Y0UA 2W85A 5DCFA 5DCMB 4GYIA 4HQEA 4KIBA 1T6SA 1YQAA 3KP6A 1IRGA 4YFXF 1V3FA 2EB7A 3GFMA 3WG9A 3HOTA 2EFNA 2DAOA 1A04A 2L4AA 3QPTA 4BH9A 2XAHA 3F3XA 3BP8A 4BHPA 4WXCA 1W7PA 2R7DA 4LLGF 3P7NA 5LHGA 5L3BA 3RIRA 2P6SA 3VEPA 1FNNA 2L01A 2R3SA 4RGUA 3N4MA 5BOXA 1T39A 2HYFA 2QBYA 1KYZA 3KEQA 4CGZA 1IF1A 2H09A 3PQKA 5D6EA 2VBYA 1LNWA 1HSJA 2IJLA 3V8LA 1VTNC 1P4WA 3DFGA 2UZKA 3BOQA 2PJPA 3JAMZ 4P5OA 2V9VA 1V4RA 4ZZDA 3QAHA 3V4GA 2VT3A 4Y17A 2FRHA 4OOIA 1HQCA 2XROA 3LAJA 1P4XA 2DBBA 1MJAA 3CTAA 2M1BA 3B73A 4A0XA 2ZXJA 3T0YA 2V6CA 5IT9Z 3NQOA 2XIGA 2ELHA 1LDDA 3QOPA 4GCVA 5KVRA 4IHTA 2F5CA 2OA4A 4AIHA 1SD4A 4ESFA 3KLNA 2K4BA 5LLQA 1K6OA 4HX7A 3KE2A 3GWZA 1MD0A 4UNOA 1PP7U 1ZH5A 1YW7A 1YG2A 5KK1A 4IHSA 4WWCA 3GYHX 3J81Z 4ENNA 5LGUA 5E1XA 1UHMA 5CVVA 1XN7A 1P2FA 3V8JA 2VONA 1FC3A 1QQIA 1MJ9A 3IC7A 3KZYA 3BWGA 3RI4A 3I59A 3R4KA 3WTUC 3WU1B 3KETA 3E5QA 2E1NA 1WSUA 3JW4A 2JZYA 2P8TA 3DPLC 3TQNA 3F22A 3LQRA 2XAJA 2O6GE 2IA0A 5ICGA 4L9TA 3ECHA 4KUMA 1R7JA 2Z99A 3M1EA 4DQ2A 1Z6TA 4M9SA 4F7ZA 1R1UA 1GHCA 2WTEA 1R00A 2V1DA 3IKTA 2MBFA 2IRFG 3GLXA 1YO5C 3FZVA 1GXPA 2H6CA 4G7ZF 4ENJA 3Q9SA 5A2QK 1HKSA 1IXRC 2KJCA 3KCCA 2F5FA 3DF8A 4RAYA 5K1YA 2GA2A 2PBIA 3CUQA 2QQ9A 3DP7A 1XGMA 4JBAA 1KGSA 1BIAA 2BYVE 4PDKA 1ODDA 2JPBA 3K1MA 1QZYA 4WXDA 4I02A 1IXCA 2MLKA 3OV8A 2ZNYA 5L3EA 3ZN0A 2MLGA 3I4PA 5D6FA 1ZRCA 3TKYA 2Q2EA 4G6DA 4A6DA 2DK5A 4LG0B 1Q1HA 1ZLKA 2VBWA 1ON2A 1XDSA 5LRSA 3H92A 3L00A 2P6TA 3R0AA 2QM3A 4LLLA 1B9NA 4MQVA 2W25A 3HIFA 1O3TA 3F72A 1YLFA 2ESNA 2DQLA 4O3MA 1FBUA 3QPHA 2HWVA 2QUFA 1OKRA 3KEOA 1FSHA 2F2EA 3M7GA 4RB3C 3TDZC 1O3QA 2CQKA 4ZZLA 2CYYA 2FNAA 3MEXA 3WTXC 1HKTA 4M9XA 2PMUA 1MJBA 1Z1DA 1IXSB 1KQ9A 1ONVA 4O6JA 2QBYB 3QU6A 5CYVA 4K2EA 2QWWA 1KQ0A 4MQ9F 2XASA 3KLOA 4L0ZB 1FOKA 1RIOH 3IRRA 3ISPA 1FY7A 3IKVA 2NS0A 2ZO4A 3DKWA 2IPQX 3ELKA 1ZGAA 4GXOA 2EV0A 3QP6A 2FU4A 4IRIA 2GA1A 4I09A 3F8MA 1BIBA 3RDIA 4AD9A 3VODA 3GFJA 4IF4A 4HA8A 1FBSA 5D5WB 5AONA 3M8EA 3J80K 5A2QZ 2FMYA 2V79A 3C18A 5E17F 4KNYA 3WU0A 1SFXA 2M45A 2P5VA 2G9WA 1B4AA 1FPQA 3EETA 3LA2A 1XD7A 4EGZA 3PQJA 3ZMZA 2GIVA 2A07F 5L3FA 2YPRA 3JTHA 2XUBA 1YIOA 2P5LC 3IHUA 3HYIA 1R1TA 4KICA 3BROA 4XLPF 3ABUA 5BS6A 4L5IA 2FXAA 4KA4A 1BI3A 2PG4A 5F64A 2IP2A 5DDGA 1O3RA 2KJBA 5CLSA 2W57A 2PLYA 5BPIA 4G94A 1PUEE 3I58A 2HTSA 2K7LA 2DO7A 1KQ8A 1IN5A 4UVBA 2MD5A 5ILSA 1S7OA 2W84A 2XVCA 4CHUA 3ZMDA 2JT1A 2HKOA 4HQMA 2WC2A 2K27A 1H0MA 1EV7A 1ZGJA 2FSWA 4M6XA 4G7OF 1USTA 1TBXA 3I59B 2KIMA 4R1HA 5HS9A 3M8FA 2ADUA 4B09A 4ESBA 3WTYC 2K02A 2RN7A 2DTRA 3ERED 4LMYA 4OMYA 1BC7C 3WTZA 3RYRA 2CGPA 1SMTA 3TO6A 4IRGA 3RJPA 1S6LA 2IT0A 1JHHA 4OU0A 3TO9A 5FLXZ 4WXHA 2EV6A 3QRFF 1S7AA 3L7WA 2D45A 5BQTA 2DW4A 4EQQA 3DV8A 3R0JA 1PP8F 3WGIA 2ISZA 3KP4A 4YFNF 4HAMA 2OAZA 4CICA 2ZNZA 3CUQB 3S2WA 3RKWA 5F6FA 4HX4A 1REPC 2PI0A 4RS8A 1QZZA 2CW0F 2KIUA 5L3DA 2DI3A 3J80Z 1K78B 4UV8A 3BJAA 1B59A 4ASNA 3FX3A 2J5OA 3BY6A 3U9GA 2XKOA 2FA5A 2FE3A 1OYYA 1FT9A 1U78A 5FFXA 4N9HA 5HDGA 5LEKA 3AAFA 3F8BA 3KFWX 5ERIA 3ZQ7A 3E6MA 1FZPB 1G6NA 3K1PA 4HV5A 1U8RA 4LK1F 1OMIA 1GVJA 5LGTA 3K0LA 1RUOA 2Z9OA 2D1HA 2W24A 1J9IA 1ON1A 4FHTA 4P9FA 4OINF 1LDKB 1ZRDA 2OU2A 2DU9A 4A6EA 2NNNA 3BZ6A 1YS7A 3RKXA 4NB5A 2GXGA 3TO7A 4Q4ZF 1BI0A 1FP2A 4P9UA 2IA2A 1H9TA 3N97A 3HRUA 4ENMA 3IRQA 2HYGD 4OMZA 3EDPA 2Z33A 2HZTA 2UXNA 3K69A 4HZFA 3E3VA 3CO6C 1WI9A 3K9TA 4U7DA 3H3UA 2LKPA 2JTVA 1LJ9A 3TDUC 2EA2A 2FNPA 3B02A 4PGHA 3CUOA 3F8CA 5D8LB 1S29A 5J6XA 2VXZA 1BN5A 1TQIA 4UVCA 4RGRA 4EJWA 4Y13A 1KU3A 3VFZA 1HSTA 2BV6A 5AIPA 4YG2F 4OIRF 5JVTA 1MZBA 4XLNF 2NAZA 1MGTA 5JHUA 4IRHA 1SAXA 4L9VA 3ZMVA 4KN4X 4RGSA 3TOAA 3ROUA 2M87A 4PGGA 4NQWA 5EEHA 2Q0OA 4RB1A 2ACJA 1BI1A 3T1BA 1YW8A 1KU7A 1ZARA 2PQ8A 4U0WA 2P7CB 3EUHA 3L09A 4G9YA 2CFXA 4M73A 2EFQA 4ZYEA 1W5SA 2EFPA 3MQ0A 3F23A 1CGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FB2 A;  5DEQ A;  1TTY A;  2VC1 A;  1UCR A;  1DPR A;  4ESJ A;  1HW2 A;  4EJU A;  3LST A;  1L0O C;  3J7A O;  4CO8 A;  1ZLJ A;  2KRF A;  2PFB A;  3IL2 A;  2CG4 A;  3CO7 C;  3GZ5 A;  4KMU X;  4R8H A;  3V7S A;  1XGO A;  4MNU A;  3D5L A;  1HW1 A;  5E1W A;  4CYD A;  1XB4 A;  4IVN A;  3LWF A;  1OPC A;  2STW A;  4CDG A;  2WWY A;  5JFR A;  2F5D A;  2H94 A;  2JPC A;  3E97 A;  2A68 F;  4HF0 A;  1H9G A;  5DUI A;  3LA7 A;  3IWZ A;  3BJ6 A;  3CDH A;  2A6H F;  3HHH A;  1I27 A;  3NRV A;  1JHF A;  5HS7 A;  4RGX A;  4EJV A;  5FD6 A;  1ZRE A;  1JXS A;  2MH2 A;  3I64 A;  2VE9 A;  4A5N A;  3DEU A;  5DD8 A;  3HSR A;  1R22 A;  1BM9 A;  1J2X A;  4S04 A;  4OIP F;  3BPV A;  3HSE A;  4AIK A;  1XMK A;  2F5E A;  1I6X A;  2AXL A;  4U88 A;  6PAX A;  1MKM A;  4EM2 A;  2IW5 A;  5CVI A;  1P4A A;  5CVR A;  2ISY A;  2D2W A;  3SZP A;  1CF7 B;  4N0B A;  4M74 A;  1YFH A;  3BPX A;  3WE3 A;  2ZFW A;  3W6K B;  2ETH A;  1YTY A;  3MCZ A;  4NHJ A;  3Q5F A;  4HBL A;  1OR7 A;  3P9I A;  1YYV A;  4G7H F;  2A6E F;  2OD5 A;  2LF8 A;  3GF2 A;  3C7J A;  1G3T A;  3JTG A;  2K86 A;  1K7A A;  5LGN A;  2HR3 A;  5HLG A;  1IN4 A;  1DPU A;  4I0B A;  4MEX F;  2NRA C;  2X4H A;  2G7U A;  4GYG A;  3RYP A;  1W7P B;  2V1U A;  1HBX G;  5FGM A;  2H6B A;  4RB2 C;  4DNC A;  3KP2 A;  1J59 A;  2HOE A;  2VE8 A;  2OBP A;  3G73 A;  3FF5 A;  1O3S A;  1HXD A;  4U7B A;  4AVP A;  2YU3 A;  2QLZ A;  4TV7 A;  1EH8 A;  1HW5 A;  1QPM A;  2PMH A;  2QZ8 A;  3WOD F;  2FBI A;  3GW2 A;  1KA8 A;  4I0A A;  4GGG A;  4AIJ A;  3I71 A;  2Y48 A;  1F1Z A;  3ZN1 A;  1GXQ A;  2QYO A;  4GO1 A;  4HX8 A;  3GEZ A;  2ESH A;  2FQ3 A;  3SQN A;  3GZ6 A;  3MWM A;  3F6O A;  5AIQ A;  4I7H A;  3DQV C;  4D0P A;  4LB6 B;  5ICF A;  4HW0 A;  4HLY A;  1XSX A;  2ZBK A;  3HRS A;  2LSO A;  5LHH A;  5E8G A;  2Q8K A;  5D5U B;  2DPU A;  4UUV A;  1EH7 A;  3BJO A;  2DLL A;  2XAF A;  2OZU A;  1AOY A;  1U3E M;  3MZY A;  1D8K A;  4JK1 X;  2E7X A;  4RAZ A;  3SFZ A;  3T8T A;  4A0Y A;  4P55 A;  3LA3 A;  3FM3 A;  4Q5S F;  3HRM A;  2VN2 A;  3FM5 A;  1ZYR F;  3CUQ C;  4ETS A;  2PEX A;  3LAP A;  1O7F A;  4LK0 F;  1D5V A;  3HRT A;  4N9I A;  4A0Z A;  3KP7 A;  4KMF A;  2VOD A;  3E6B A;  3I0T A;  2RGV A;  3PFI A;  4IPA A;  1YS6 A;  1XGN A;  3HUG A;  4Q47 A;  5DD4 A;  2RQP A;  1IZ1 A;  1LB2 A;  1I1G A;  5ED4 A;  5LRR A;  4FX0 A;  4H0E A;  4QWQ A;  4LD5 A;  5L3C A;  1QO0 D;  2VBX A;  2C6Y A;  2GWR A;  3F21 A;  4FT8 A;  3COA C;  5JR3 A;  2DQR A;  3MAJ A;  2DPD A;  1F9N A;  4KIG A;  1R36 A;  2WV0 A;  1ZAO A;  3I5U A;  4A12 A;  3R6S A;  3ZMU A;  4HV6 A;  3BDD A;  1FLI A;  3WGG A;  4HF2 A;  1SD6 A;  1T0F A;  1JGS A;  2XHK A;  2HTJ A;  3K1N A;  2GAU A;  5LEJ A;  2MC3 A;  1SD5 A;  2OQG A;  4EJO A;  1DUX C;  3P9K A;  2BBY A;  1R58 A;  2GQQ A;  4UVA A;  2JRT A;  1FBQ A;  2VOO A;  2Y75 A;  4HDU A;  3REO A;  1SFU A;  3QP5 A;  1SMY F;  5K5Q A;  3GX4 X;  1U2W A;  2DK8 A;  2E7W A;  4HF1 A;  4MHG A;  1WKM A;  4BQA A;  2A69 F;  3NEU A;  2O8X A;  3ZMS A;  2RKH A;  2O0Y A;  2YSR A;  1IN7 A;  2FEZ A;  4HOB A;  4KIF A;  5DV5 A;  1FYK A;  3ZPL A;  2EFW A;  3EYY A;  1Z05 A;  1ZHF A;  2P7V B;  5IT9 K;  1P92 A;  4PZJ A;  3CLO A;  1KU2 A;  1AWC A;  1BI2 A;  1U6G A;  4MEY F;  3WE2 A;  2UWM A;  2KIF A;  3KP3 A;  3GUD A;  5K5O A;  3HHG A;  2PN6 A;  4RB0 A;  4BNC A;  1X3U A;  2RVC A;  5K5R A;  3LFK A;  1UFM A;  3F8F A;  5D4R A;  3ZP5 A;  1YW9 A;  3HTU A;  4HLX A;  4YFK F;  1TLH B;  1XDU A;  3WTS C;  2IA1 A;  2O61 A;  3E5X A;  4U0Y A;  2A3S A;  1LDJ A;  3VB2 A;  2ZKZ A;  1K79 A;  3I53 A;  4M6Y A;  5LHI A;  2Y0M A;  2L3D A;  4UV9 A;  4OIO F;  3K2Z A;  3RTR A;  1I5Z A;  3O2P E;  1FSE A;  2COM A;  2XAG A;  1G3S A;  4EM1 A;  1QBJ A;  4BAY A;  2ZME A;  1ZG1 A;  5ICE A;  1IRF A;  3SHF A;  2XKP A;  1FYM A;  3KZZ A;  4B8X A;  1TNS A;  2MH9 A;  3GVA A;  5D4S A;  1U5T A;  1XSD A;  3WTT C;  2M5W A;  3ZMT A;  2ZCW A;  2RNJ A;  1E2X A;  1SFE A;  1T38 A;  1J75 A;  2EV5 A;  4CZZ A;  4A2U A;  3T8R A;  3I54 A;  4L0Y B;  3CJN A;  4I98 B;  5FD5 A;  1RNL A;  4ZYG A;  2D1V A;  5ICC A;  4KDP A;  2ZJ2 A;  4IJA A;  2HGC A;  1BC8 C;  1MDM A;  2TDX A;  5J8F A;  1B6A A;  5F1R A;  2P4W A;  5HLH A;  1OYW A;  3D0S A;  2QEN A;  1W5T A;  3TGN A;  2M8E A;  2A61 A;  5HVQ C;  5H6R A;  4EM0 B;  4HDV A;  3FXR A;  1DDN A;  1UB9 A;  4EJT A;  1ZG5 A;  1IAW A;  1TW3 A;  4E70 A;  4FX4 A;  5BPD A;  4BXU A;  4QLC U;  1RUN A;  1UHW A;  4LLN A;  4I2O A;  2QVO A;  4A5M A;  4M9Z A;  5CVU A;  2LDU A;  5HOO A;  2DT5 A;  5H20 A;  3RKY A;  2NYX A;  4EMS A;  4EV0 A;  2L02 A;  2FF4 A;  3FHZ A;  2B0L A;  1TQP A;  3GXO A;  5D5V B;  3FXQ A;  1FYL A;  2E1C A;  4ENK A;  5EEG A;  1D3Y A;  3GFL A;  5H6Q A;  5TRD A;  5D5X B;  2P5K A;  3V7R A;  1ZG3 A;  5ILU A;  3TOB A;  2Z3Y A;  3QU3 A;  4BHC A;  3ABT A;  2GZW A;  3E5U A;  1T2K A;  2CSO A;  1KU9 A;  1LQ1 A;  1ZRF A;  3G3Z A;  1BBY A;  3E6C C;  4MGR A;  3MFK A;  4XBF A;  4P96 A;  3V8K A;  2OQR A;  3F8N A;  3C1D A;  3HTS B;  1FP1 D;  4IXA A;  3ECO A;  1FWZ A;  2YX7 A;  1K78 A;  1W7P D;  3FMR A;  2CO5 A;  1R23 A;  1FX7 A;  2CWE A;  2M30 A;  2EA4 A;  3FXU A;  5D8K B;  1U5T C;  1J5Y A;  3O6B B;  4O5V A;  2XV4 S;  4LFU A;  1RI7 A;  1S3J A;  2XRN A;  5ILV A;  1F5T A;  5FFZ A;  4KN7 X;  4WK8 F;  2G7H A;  1RZ4 A;  3P9C A;  3WTW C;  4UXN A;  3R61 A;  2RV8 A;  1LEB A;  1I1S A;  2GXB A;  4XRF A;  3FMS A;  2RC4 A;  4MTD A;  5CVJ A;  4Q48 A;  1S8N A;  1W4M A;  2A5Y B;  3EQL F;  4XSZ F;  2BGC A;  3WTV C;  1G3Y A;  5HLI A;  1XSV A;  5E8I A;  3E6D A;  1TW2 A;  2STT A;  2KKO A;  2X0L A;  2V1X A;  2JSC A;  2OZ6 A;  3OOP A;  4BYY A;  4ZYH A;  2FBH A;  5FO5 A;  3LQQ A;  5FLX K;  2ZME B;  5DCM A;  2DFI A;  4YIF A;  1WQ2 A;  2Z5U A;  4JQF A;  3L2C A;  2XGX A;  1U5T B;  3U2R A;  1OYI A;  3DPT A;  3O3K A;  2VT2 A;  4M72 A;  1SD7 A;  3SZT A;  4ZH4 F;  4WCG A;  4YII A;  1F4K A;  3MZH A;  4G8X A;  1JE8 A;  2BE5 F;  1B9M A;  1XMA A;  2J5P A;  5CJ9 A;  3DXJ F;  3F6V A;  1TQM A;  3M9A A;  2L4M A;  1B1B A;  1STZ A;  1Z9C A;  5TJJ A;  1LEA A;  1O7L A;  4CXF A;  3T5X A;  1MDM B;  4LB5 A;  2FML A;  5DUK A;  1HKQ A;  5E20 A;  1Z91 A;  3RPU A;  4KYW A;  3W6J B;  4WX9 A;  4OIQ F;  1NHA A;  4KFC A;  4I01 A;  2UXX A;  1TNT A;  1XCV A;  2HS5 A;  5L3G A;  1C0W A;  3FMQ A;  1BJA A;  1ULY A;  3C3W A;  1ZN2 A;  4R79 A;  2EWN A;  2FBK A;  5E18 F;  1R5H A;  3R60 A;  3GFI A;  3EYI A;  2O3F A;  5HDK A;  5JI6 A;  2YR2 A;  3IWF A;  3KP5 A;  2H27 A;  3ULQ B;  4AWX B;  1PDN C;  4XSX F;  4Y15 A;  2K4J A;  4L18 B;  2RDP A;  2VC0 A;  4BHB A;  3H3Z A;  3VOE A;  4WF2 A;  5HDN A;  1T98 A;  3JSP A;  1QNT A;  2QQB A;  3RPQ A;  3HOS A;  1USS A;  2HEO A;  2AS5 F;  2FOK A;  5HS8 A;  1P6R A;  1WRJ A;  2HQR A;  3ML6 A;  1LVA A;  2VBZ A;  1J7K A;  5IT3 A;  1L3L A;  1IN6 A;  2BEO A;  2XAQ A;  1WWX A;  2QQA A;  2MA3 A;  4ON0 A;  1XCB A;  2HDC A;  3HSF A;  4G6Q A;  2HQN A;  1BOA A;  1QGP A;  4S05 A;  2VOP A;  4U0V A;  4UHT A;  2EJR A;  3JAM K;  2LF7 A;  2O03 A;  4L9J A;  1XGS A;  3FWE A;  4EVI A;  1R1V A;  4M71 A;  1E17 A;  2IVM A;  4EGY A;  2EFO A;  5LBQ A;  3WGH A;  3SXY A;  4LGW A;  5E1Z B;  4MTE A;  4Z2Y A;  1O57 A;  2L54 A;  1Z6R A;  1D8J A;  2YX4 A;  3JSO A;  3V7C A;  1IN8 A;  1DP7 P;  2NNY A;  3Q9V A;  3U1D A;  5BMZ A;  1G3W A;  1IW7 F;  4ZYD A;  1G4D A;  4LJZ F;  1J0R A;  3L9F A;  1EH6 A;  2HKX A;  1IUY A;  4KT5 C;  4PCQ A;  1KYW A;  1CF7 A;  5DYM A;  2LNB A;  2R7F A;  4LG0 A;  4L5J A;  3GO5 A;  2EK5 A;  3J81 K;  1Z7U A;  1R5G A;  2HFH A;  4HYE A;  4L9N A;  5J8C A;  1Y0U A;  2W85 A;  5DCF A;  5DCM B;  4GYI A;  4HQE A;  4KIB A;  1T6S A;  1YQA A;  3KP6 A;  1IRG A;  4YFX F;  1V3F A;  2EB7 A;  3GFM A;  3WG9 A;  3HOT A;  2EFN A;  2DAO A;  1A04 A;  2L4A A;  3QPT A;  4BH9 A;  2XAH A;  3F3X A;  3BP8 A;  4BHP A;  4WXC A;  1W7P A;  2R7D A;  4LLG F;  3P7N A;  5LHG A;  5L3B A;  3RIR A;  2P6S A;  3VEP A;  1FNN A;  2L01 A;  2R3S A;  4RGU A;  3N4M A;  5BOX A;  1T39 A;  2HYF A;  2QBY A;  1KYZ A;  3KEQ A;  4CGZ A;  1IF1 A;  2H09 A;  3PQK A;  5D6E A;  2VBY A;  1LNW A;  1HSJ A;  2IJL A;  3V8L A;  1VTN C;  1P4W A;  3DFG A;  2UZK A;  3BOQ A;  2PJP A;  3JAM Z;  4P5O A;  2V9V A;  1V4R A;  4ZZD A;  3QAH A;  3V4G A;  2VT3 A;  4Y17 A;  2FRH A;  4OOI A;  1HQC A;  2XRO A;  3LAJ A;  1P4X A;  2DBB A;  1MJA A;  3CTA A;  2M1B A;  3B73 A;  4A0X A;  2ZXJ A;  3T0Y A;  2V6C A;  5IT9 Z;  3NQO A;  2XIG A;  2ELH A;  1LDD A;  3QOP A;  4GCV A;  5KVR A;  4IHT A;  2F5C A;  2OA4 A;  4AIH A;  1SD4 A;  4ESF A;  3KLN A;  2K4B A;  5LLQ A;  1K6O A;  4HX7 A;  3KE2 A;  3GWZ A;  1MD0 A;  4UNO A;  1PP7 U;  1ZH5 A;  1YW7 A;  1YG2 A;  5KK1 A;  4IHS A;  4WWC A;  3GYH X;  3J81 Z;  4ENN A;  5LGU A;  5E1X A;  1UHM A;  5CVV A;  1XN7 A;  1P2F A;  3V8J A;  2VON A;  1FC3 A;  1QQI A;  1MJ9 A;  3IC7 A;  3KZY A;  3BWG A;  3RI4 A;  3I59 A;  3R4K A;  3WTU C;  3WU1 B;  3KET A;  3E5Q A;  2E1N A;  1WSU A;  3JW4 A;  2JZY A;  2P8T A;  3DPL C;  3TQN A;  3F22 A;  3LQR A;  2XAJ A;  2O6G E;  2IA0 A;  5ICG A;  4L9T A;  3ECH A;  4KUM A;  1R7J A;  2Z99 A;  3M1E A;  4DQ2 A;  1Z6T A;  4M9S A;  4F7Z A;  1R1U A;  1GHC A;  2WTE A;  1R00 A;  2V1D A;  3IKT A;  2MBF A;  2IRF G;  3GLX A;  1YO5 C;  3FZV A;  1GXP A;  2H6C A;  4G7Z F;  4ENJ A;  3Q9S A;  5A2Q K;  1HKS A;  1IXR C;  2KJC A;  3KCC A;  2F5F A;  3DF8 A;  4RAY A;  5K1Y A;  2GA2 A;  2PBI A;  3CUQ A;  2QQ9 A;  3DP7 A;  1XGM A;  4JBA A;  1KGS A;  1BIA A;  2BYV E;  4PDK A;  1ODD A;  2JPB A;  3K1M A;  1QZY A;  4WXD A;  4I02 A;  1IXC A;  2MLK A;  3OV8 A;  2ZNY A;  5L3E A;  3ZN0 A;  2MLG A;  3I4P A;  5D6F A;  1ZRC A;  3TKY A;  2Q2E A;  4G6D A;  4A6D A;  2DK5 A;  4LG0 B;  1Q1H A;  1ZLK A;  2VBW A;  1ON2 A;  1XDS A;  5LRS A;  3H92 A;  3L00 A;  2P6T A;  3R0A A;  2QM3 A;  4LLL A;  1B9N A;  4MQV A;  2W25 A;  3HIF A;  1O3T A;  3F72 A;  1YLF A;  2ESN A;  2DQL A;  4O3M A;  1FBU A;  3QPH A;  2HWV A;  2QUF A;  1OKR A;  3KEO A;  1FSH A;  2F2E A;  3M7G A;  4RB3 C;  3TDZ C;  1O3Q A;  2CQK A;  4ZZL A;  2CYY A;  2FNA A;  3MEX A;  3WTX C;  1HKT A;  4M9X A;  2PMU A;  1MJB A;  1Z1D A;  1IXS B;  1KQ9 A;  1ONV A;  4O6J A;  2QBY B;  3QU6 A;  5CYV A;  4K2E A;  2QWW A;  1KQ0 A;  4MQ9 F;  2XAS A;  3KLO A;  4L0Z B;  1FOK A;  1RIO H;  3IRR A;  3ISP A;  1FY7 A;  3IKV A;  2NS0 A;  2ZO4 A;  3DKW A;  2IPQ X;  3ELK A;  1ZGA A;  4GXO A;  2EV0 A;  3QP6 A;  2FU4 A;  4IRI A;  2GA1 A;  4I09 A;  3F8M A;  1BIB A;  3RDI A;  4AD9 A;  3VOD A;  3GFJ A;  4IF4 A;  4HA8 A;  1FBS A;  5D5W B;  5AON A;  3M8E A;  3J80 K;  5A2Q Z;  2FMY A;  2V79 A;  3C18 A;  5E17 F;  4KNY A;  3WU0 A;  1SFX A;  2M45 A;  2P5V A;  2G9W A;  1B4A A;  1FPQ A;  3EET A;  3LA2 A;  1XD7 A;  4EGZ A;  3PQJ A;  3ZMZ A;  2GIV A;  2A07 F;  5L3F A;  2YPR A;  3JTH A;  2XUB A;  1YIO A;  2P5L C;  3IHU A;  3HYI A;  1R1T A;  4KIC A;  3BRO A;  4XLP F;  3ABU A;  5BS6 A;  4L5I A;  2FXA A;  4KA4 A;  1BI3 A;  2PG4 A;  5F64 A;  2IP2 A;  5DDG A;  1O3R A;  2KJB A;  5CLS A;  2W57 A;  2PLY A;  5BPI A;  4G94 A;  1PUE E;  3I58 A;  2HTS A;  2K7L A;  2DO7 A;  1KQ8 A;  1IN5 A;  4UVB A;  2MD5 A;  5ILS A;  1S7O A;  2W84 A;  2XVC A;  4CHU A;  3ZMD A;  2JT1 A;  2HKO A;  4HQM A;  2WC2 A;  2K27 A;  1H0M A;  1EV7 A;  1ZGJ A;  2FSW A;  4M6X A;  4G7O F;  1UST A;  1TBX A;  3I59 B;  2KIM A;  4R1H A;  5HS9 A;  3M8F A;  2ADU A;  4B09 A;  4ESB A;  3WTY C;  2K02 A;  2RN7 A;  2DTR A;  3ERE D;  4LMY A;  4OMY A;  1BC7 C;  3WTZ A;  3RYR A;  2CGP A;  1SMT A;  3TO6 A;  4IRG A;  3RJP A;  1S6L A;  2IT0 A;  1JHH A;  4OU0 A;  3TO9 A;  5FLX Z;  4WXH A;  2EV6 A;  3QRF F;  1S7A A;  3L7W A;  2D45 A;  5BQT A;  2DW4 A;  4EQQ A;  3DV8 A;  3R0J A;  1PP8 F;  3WGI A;  2ISZ A;  3KP4 A;  4YFN F;  4HAM A;  2OAZ A;  4CIC A;  2ZNZ A;  3CUQ B;  3S2W A;  3RKW A;  5F6F A;  4HX4 A;  1REP C;  2PI0 A;  4RS8 A;  1QZZ A;  2CW0 F;  2KIU A;  5L3D A;  2DI3 A;  3J80 Z;  1K78 B;  4UV8 A;  3BJA A;  1B59 A;  4ASN A;  3FX3 A;  2J5O A;  3BY6 A;  3U9G A;  2XKO A;  2FA5 A;  2FE3 A;  1OYY A;  1FT9 A;  1U78 A;  5FFX A;  4N9H A;  5HDG A;  5LEK A;  3AAF A;  3F8B A;  3KFW X;  5ERI A;  3ZQ7 A;  3E6M A;  1FZP B;  1G6N A;  3K1P A;  4HV5 A;  1U8R A;  4LK1 F;  1OMI A;  1GVJ A;  5LGT A;  3K0L A;  1RUO A;  2Z9O A;  2D1H A;  2W24 A;  1J9I A;  1ON1 A;  4FHT A;  4P9F A;  4OIN F;  1LDK B;  1ZRD A;  2OU2 A;  2DU9 A;  4A6E A;  2NNN A;  3BZ6 A;  1YS7 A;  3RKX A;  4NB5 A;  2GXG A;  3TO7 A;  4Q4Z F;  1BI0 A;  1FP2 A;  4P9U A;  2IA2 A;  1H9T A;  3N97 A;  3HRU A;  4ENM A;  3IRQ A;  2HYG D;  4OMZ A;  3EDP A;  2Z33 A;  2HZT A;  2UXN A;  3K69 A;  4HZF A;  3E3V A;  3CO6 C;  1WI9 A;  3K9T A;  4U7D A;  3H3U A;  2LKP A;  2JTV A;  1LJ9 A;  3TDU C;  2EA2 A;  2FNP A;  3B02 A;  4PGH A;  3CUO A;  3F8C A;  5D8L B;  1S29 A;  5J6X A;  2VXZ A;  1BN5 A;  1TQI A;  4UVC A;  4RGR A;  4EJW A;  4Y13 A;  1KU3 A;  3VFZ A;  1HST A;  2BV6 A;  5AIP A;  4YG2 F;  4OIR F;  5JVT A;  1MZB A;  4XLN F;  2NAZ A;  1MGT A;  5JHU A;  4IRH A;  1SAX A;  4L9V A;  3ZMV A;  4KN4 X;  4RGS A;  3TOA A;  3ROU A;  2M87 A;  4PGG A;  4NQW A;  5EEH A;  2Q0O A;  4RB1 A;  2ACJ A;  1BI1 A;  3T1B A;  1YW8 A;  1KU7 A;  1ZAR A;  2PQ8 A;  4U0W A;  2P7C B;  3EUH A;  3L09 A;  4G9Y A;  2CFX A;  4M73 A;  2EFQ A;  4ZYE A;  1W5S A;  2EFP A;  3MQ0 A;  3F23 A;  1CGP A; 
#chains in the Genus database with same CATH topology
 4XLC A;  3JRD A;  5FB2 A;  3QQA A;  2PMZ N;  1ZTR A;  5DEQ A;  1TTY A;  3KPH A;  5K7H A;  2VC1 A;  4BQO A;  2R92 J;  3GLL A;  1QZE A;  3LL7 A;  1UCR A;  1DPR A;  4ESJ A;  1HW2 A;  1EKE A;  1Y8Q B;  4EJU A;  3HDD A;  3AFH A;  3LST A;  3ZOB A;  5FJ8 J;  1WPK A;  1L0O C;  3OYJ A;  4XKV A;  3J7A O;  4CO8 A;  4AM3 A;  3PSF A;  1ZLJ A;  2KRF A;  2HNH A;  2XF5 A;  3S93 A;  4XOR A;  2BY2 A;  2PFB A;  2LKS A;  1VQ8 I;  3IL2 A;  3HOZ J;  1FOX A;  3OYL A;  1JGG A;  2VL8 A;  2WB1 A;  4S0H B;  3QPS A;  3M07 A;  2CG4 A;  1U9N A;  2LP0 A;  3CO7 C;  3GZ5 A;  4KMU X;  4ZDP A;  1BA5 A;  4R8H A;  1X3W B;  3V7S A;  2L9N A;  1XGO A;  4MNU A;  3D5L A;  1HW1 A;  2JA2 A;  5E1W A;  3IP4 B;  2VJ4 A;  3FXO A;  4CYD A;  1XB4 A;  2FJ1 A;  4IVN A;  2W7N A;  3TP3 A;  3I55 I;  3BTI A;  3LWF A;  1OPC A;  3KYC B;  2STW A;  4M3B A;  4CDG A;  2WWY A;  2OTJ I;  3M4O J;  5E3L A;  2KDZ A;  2HVS A;  5JFR A;  4BAC A;  2F5D A;  2H94 A;  4QPQ A;  3CZ6 A;  1NG6 A;  1POG A;  1AKH B;  2JPC A;  4JX6 A;  3E97 A;  2A68 F;  4BEH A;  5KHD A;  4HF0 A;  4BE2 A;  2Y2Z A;  4FQG A;  1H9G A;  2UV1 A;  1Y39 A;  3K4N A;  1TT0 A;  4F91 B;  2VUM J;  5DUI A;  4BE1 A;  3LA7 A;  2LD5 A;  3IWZ A;  1YX3 A;  3BJ6 A;  3CDH A;  4NNJ A;  4FTH A;  2A6H F;  2ECC A;  3HHH A;  1I27 A;  4BQQ A;  3NRV A;  2IS4 A;  1JHF A;  5HS7 A;  4RGX A;  4EJV A;  1FIP A;  3WG7 H;  5FD6 A;  1ZRE A;  1JXS A;  1JKO C;  2WAE A;  2MH2 A;  3I64 A;  2VE9 A;  2A5W A;  4A5N A;  4HNV A;  3DEU A;  1SFO J;  5DD8 A;  3HSR A;  1R22 A;  1BM9 A;  4XN3 A;  3K4L A;  3LFU A;  3CME I;  2JMW A;  2A05 A;  4ABZ A;  1J2X A;  4S04 A;  4OIP F;  2HOS A;  3BPV A;  3HSE A;  4AIK A;  2ZXI A;  5IYD J;  1XMK A;  2F5E A;  3OL4 A;  4YRV A;  1I6X A;  2AXL A;  3IUO A;  4U88 A;  6PAX A;  1MKM A;  4I99 C;  1R9T J;  1A36 A;  3A01 B;  2EIN H;  1RR7 A;  5B1B H;  1TC3 C;  4EM2 A;  2IW5 A;  5CVI A;  1TWA J;  4A69 C;  1P4A A;  4DZJ A;  5CVR A;  1RR8 C;  2ISY A;  4DIQ A;  2NS8 A;  1TWF J;  1RRJ A;  2D2W A;  3S32 A;  3SZP A;  5IP7 J;  1CF7 B;  2QQ8 A;  4N0B A;  4M74 A;  3K2A A;  5CPR B;  2LVS A;  1D1A A;  1JUP A;  1YFH A;  3BPX A;  1XX5 A;  3WE3 A;  1KON A;  2ZFW A;  4E7Z A;  3CC2 I;  1GVD A;  3RZO J;  3W6K B;  2ETH A;  1MNE A;  3S8P A;  1YTY A;  3MCZ A;  1K4T A;  3EUK L;  4NHJ A;  3Q5F A;  4HBL A;  1N75 A;  2XF6 A;  1NG7 A;  1NK3 P;  1OR7 A;  5FRO A;  3J7Y J;  3CCY A;  3P9I A;  1YYV A;  4DOZ A;  1T95 A;  5DM7 F;  2MC4 A;  4CZC A;  4G7H F;  2A6E F;  3PNV A;  2VXD A;  2OD5 A;  1D5Y A;  2Y9Z A;  4AYB N;  2LF8 A;  3GF2 A;  5M5X J;  3C7J A;  1G3T A;  4DGW B;  3JTG A;  3CES A;  3UKG A;  1AA7 A;  2K86 A;  1K7A A;  5LGN A;  2HR3 A;  5HLG A;  4CSW A;  3OS2 A;  1GT0 C;  3LSP A;  1IN4 A;  3EUH C;  1P7I A;  4Y7N J;  1DPU A;  4I0B A;  4MEX F;  4LG3 A;  3K70 C;  1Y1W J;  2NRA C;  2X4H A;  1RKW A;  2G7U A;  4GYG A;  3W2A A;  1OCO H;  3RYP A;  1W7P B;  2V1U A;  1HBX G;  5FGM A;  3K6G A;  5JVG F;  1H8A C;  2H6B A;  3DBR B;  4RB2 C;  4DNC A;  3KP2 A;  3VSK A;  5B66 C;  2LTP A;  1J59 A;  2HOE A;  2VE8 A;  2OBP A;  4DZP A;  3G73 A;  4IKF A;  3H9G A;  2BHY A;  2KPM A;  4NC6 A;  4CCJ A;  3FF5 A;  1BR4 A;  5E3M A;  4N4N B;  1JJ8 C;  3HKZ A;  1HXD A;  1X58 A;  2DOE A;  5IP9 J;  4U7B A;  1O3S A;  4AVP A;  2YU3 A;  2QLZ A;  4TV7 A;  2FOW A;  1EH8 A;  1HW5 A;  3JRC A;  1QPM A;  2NS7 A;  4PJ0 C;  4W97 A;  2PMH A;  2QZ8 A;  3H3V K;  3WOD F;  2FBI A;  3GW2 A;  1KA8 A;  4I0A A;  4GGG A;  2ME6 A;  4AIJ A;  3I71 A;  1OLT A;  2Y48 A;  2LY9 A;  5J47 A;  4C3H J;  3QOD A;  1F1Z A;  3FXJ A;  2TCT A;  3ZN1 A;  1GXQ A;  2QYO A;  2LK2 A;  1X1P A;  4GO1 A;  4HX8 A;  3GEZ A;  2QF7 A;  4LOC A;  2K3P A;  4NQW B;  2ESH A;  2ID3 A;  2FQ3 A;  3HEF A;  3SQN A;  4XQF A;  3QWL A;  2VQL A;  4F52 A;  3GZ6 A;  4II3 A;  4F3Q A;  3MWM A;  1ZGW A;  3F6O A;  5AIQ A;  4I7H A;  5EEA A;  3DQV C;  1QVT A;  4M3G A;  4LB6 B;  4D0P A;  5ICF A;  4HW0 A;  2H1K A;  4HLY A;  1XSX A;  3RZD J;  1I6H J;  2ZBK A;  3HRS A;  2LSO A;  1VQK I;  2R5Z A;  5IP6 A;  3CCS I;  2GOX B;  1ORK A;  3TW7 A;  5E8G A;  5LHH A;  2Q8K A;  1PUF B;  5D5U B;  4CCM A;  2JA8 J;  2DPU A;  4UUV A;  1YRN B;  1EH7 A;  3BJO A;  2DLL A;  3DEE A;  1NTC A;  2XAF A;  2OZU A;  4I6Z A;  1AOY A;  3IAS 2;  2Z1D A;  1CQT A;  1Z7L A;  1U3E M;  3MZY A;  5KAF C;  1D8K A;  3BG5 A;  2DJI A;  3OIQ A;  4JK1 X;  2E7X A;  1HDP A;  4RAZ A;  2HYJ A;  4UUT A;  3SFZ A;  3T8T A;  4A0Y A;  2R7U A;  4P55 A;  3LA3 A;  1RPW A;  3FM3 A;  4Q5S F;  2Y69 H;  2VN2 A;  3FM5 A;  3HRM A;  1ZYR F;  3CUQ C;  4ETS A;  2PEX A;  3LAP A;  1O7F A;  4LK0 F;  1WZ2 A;  2M4K A;  1D5V A;  3D5R C;  3HRT A;  4CH7 A;  4N9I A;  4A0Z A;  3KP7 A;  1SAN A;  1MNM C;  4KMF A;  2VOD A;  3E6B A;  2XGD A;  1G8X A;  5E3N A;  1Z67 A;  3I0T A;  3HGY A;  5M3F J;  2RGV A;  3PFI A;  4IPA A;  1YS6 A;  1XGN A;  3HUG A;  4Q47 A;  5DD4 A;  2X9D A;  2F6C A;  2VLA A;  2RQP A;  5FKN A;  1IZ1 A;  1D1B A;  1LB2 A;  1M1E B;  1I1G A;  5ED4 A;  5LRR A;  2BW3 B;  3PNY A;  2LH9 A;  3JRF A;  4FX0 A;  4PJJ A;  4H0E A;  2I5U A;  4QWQ A;  1XC5 A;  4LD5 A;  5L3C A;  4CCK A;  1QO0 D;  3RKQ A;  2IEK A;  2MGQ A;  2VBX A;  1QPI A;  1XMX A;  2C6Y A;  1R49 A;  2GWR A;  3PFY A;  3F21 A;  3EPZ A;  4A3D J;  4FT8 A;  1HCR A;  3COA C;  5JR3 A;  3AG2 H;  5HNH A;  1VF9 A;  1G59 A;  4BEH B;  2DQR A;  3MAJ A;  1ENH A;  2MD0 A;  2DPD A;  1AU7 A;  1F9N A;  4KIG A;  4ZJZ A;  1R36 A;  4MIM A;  2WV0 A;  1ZAO A;  3JRI A;  3I5U A;  4A12 A;  3R6S A;  1E0E A;  3ZMU A;  4HV6 A;  4XK4 A;  3W3C A;  2DT7 B;  2VPR A;  4HST A;  1YI2 I;  2CUJ A;  3BDD A;  1FLI A;  2EBI A;  5FLM J;  3A0H C;  3WGG A;  3DEW A;  4HF2 A;  5CQE A;  5EZH A;  1SD6 A;  3OIO A;  1FJL A;  1T0F A;  1JGS A;  4A3F J;  2XHK A;  2KMU A;  3LSH A;  4A3K J;  2BY0 A;  2HTJ A;  3K1N A;  2DA5 A;  2F5V A;  2E35 A;  2DTZ A;  1NH3 A;  2GAU A;  3TL4 X;  5LEJ A;  2F4M B;  2MC3 A;  1SD5 A;  4X0G A;  2FD5 A;  4XLF A;  2OQG A;  2CUF A;  2VKD A;  3RQ4 A;  3P9K A;  4EJO A;  1DUX C;  2BBY A;  1R58 A;  3HOW J;  2GQQ A;  2JVG A;  2W00 A;  4F55 A;  4UVA A;  2JRT A;  1FBQ A;  2X51 A;  2VOO A;  2Y75 A;  4HDU A;  5HOD A;  3REO A;  1SFU A;  2NVY J;  2NVT J;  2K9M A;  1IG7 A;  3LSG A;  2IAI A;  3QP5 A;  1SMY F;  3MKY B;  5K5Q A;  3GX4 X;  1U2W A;  2DK8 A;  1HC8 A;  4M6V A;  2VKE A;  3LSJ A;  5HNF A;  2XAU A;  2E7W A;  2XSJ C;  4HF1 A;  4MHG A;  1WKM A;  4BQA A;  2A69 F;  3NEU A;  3AKZ A;  1IUF A;  3H0G J;  3FIW A;  4J01 A;  1FEX A;  2IGK A;  3BG3 A;  2R5Y A;  2O8X A;  2L7M P;  2RKH A;  3ZMS A;  2QGU A;  4A3L J;  3V42 A;  2O0Y A;  1WJE A;  4E7L A;  2YSR A;  3DKX A;  1IN7 A;  2JUC A;  2FEZ A;  2Q1Z B;  4HOB A;  4KIF A;  5DV5 A;  1FYK A;  1JKP C;  3ZPL A;  3I4N J;  2EFW A;  2IS2 A;  3GTL J;  3EYY A;  4XID A;  2W82 A;  5IYC J;  5C4X J;  2GBY A;  3J7Z I;  3S15 J;  4CCO A;  1OJL A;  4D5F A;  1Z05 A;  1ZHF A;  3A03 A;  3CCJ I;  2P7V B;  5IT9 K;  3VYS B;  1P92 A;  3ONQ A;  4PZJ A;  3QYF A;  4DYC A;  4BXX J;  4EAT A;  4C3J J;  4YIR X;  2BY1 A;  3CLO A;  1KU2 A;  1AWC A;  1BI2 A;  1U6G A;  4MEY F;  3WE2 A;  2UWM A;  2KIF A;  3KP3 A;  2ME0 A;  3GUD A;  3Q0U A;  5K5O A;  1MBJ A;  1QHG A;  3HHG A;  2PN6 A;  4RB0 A;  2EZI A;  1S9H A;  3ABK H;  3MN2 A;  2ELK A;  3BZK A;  4BNC A;  4D9J A;  3BR3 A;  2YU9 J;  2X48 A;  3PSI A;  1X3U A;  4ANJ A;  4RDU A;  2WY8 Q;  2RVC A;  3BT9 A;  4JOM A;  5K5R A;  3QYB A;  3OYN A;  3LFK A;  4I76 A;  1UFM A;  3F8F A;  3ZQL A;  4KJZ A;  1R6R A;  1YJN I;  5D4R A;  3OYH A;  3ZP5 A;  1YW9 A;  5IYB J;  2BVM A;  3PJR A;  3HTU A;  5LD2 C;  3OYE A;  4W1U A;  4HLX A;  3C2G A;  4YFK F;  3K7A J;  4CYC A;  1TLH B;  3CC7 I;  1XDU A;  3WTS C;  1IDZ A;  2EPF A;  2IA1 A;  2O61 A;  3E5X A;  4U0Y A;  2KZG A;  1TWG J;  3DCF A;  1X1D A;  1IJW C;  3RPU D;  2A3S A;  1LDJ A;  3VB2 A;  2ZKZ A;  1ETX A;  1K79 A;  3I53 A;  4M6Y A;  4L5E A;  5LHI A;  4M3E A;  1GDT A;  1TWH J;  3VYU B;  2Y0M A;  2E1M C;  2CJJ A;  2L3D A;  4QSH A;  4BU2 A;  2WAQ A;  4UV9 A;  4OIO F;  3GTG J;  2RAE A;  3K2Z A;  3RTR A;  1I5Z A;  3ASO H;  2JN6 A;  1RES A;  3O2P E;  1E3P A;  4XRS A;  1FSE A;  2COM A;  2XAG A;  1G3S A;  2EZL A;  4EM1 A;  3VPR A;  2BXY A;  3BR5 A;  3VSL A;  1W36 C;  1QBJ A;  2X85 A;  4BAY A;  2ZME A;  1ZG1 A;  5ICE A;  2R5Z B;  1IRF A;  3HOY J;  3SHF A;  4E7K A;  2NXN B;  3PIO F;  2XKP A;  1FYM A;  2M0M A;  3KZZ A;  2CRG A;  1VQL I;  1YJ9 I;  4B8X A;  2R7Q A;  5F1J A;  5HLT A;  1S72 I;  2WB1 N;  4CA0 A;  3S2H J;  2JK3 A;  3S16 J;  2DXI A;  3WHB A;  2B63 J;  1TNS A;  2MH9 A;  1LPQ A;  3GVA A;  1IC8 A;  5D4S A;  2XPV A;  5EGO B;  1U5T A;  1XSD A;  1MBG A;  3WTT C;  2M5W A;  3ZMT A;  1BW5 A;  4E7J A;  2ZCW A;  2RNJ A;  1E2X A;  1SFE A;  1T38 A;  1SVM A;  1F36 A;  1ETO A;  3DKY A;  1JTX A;  3L2Q A;  1J75 A;  1OCP A;  3H5N A;  2EV5 A;  2UUZ A;  3G6E I;  3PNT A;  4CZZ A;  4A2U A;  4JP0 A;  3T8R A;  2FUG 2;  2KL4 A;  2LRD A;  1X1B A;  2AHQ A;  2LMD A;  3I54 A;  4FE4 A;  4L0Y B;  1MIJ A;  3CJN A;  4I98 B;  5FD5 A;  1RNL A;  4ZYG A;  2M4G A;  2D1V A;  1OFC X;  5ICC A;  3JR9 A;  3HUG B;  5IY5 H;  1QA6 A;  2LOO A;  3DBL B;  3L2V A;  4KDP A;  2ZJ2 A;  4IJA A;  2HGC A;  2CU7 A;  1BC8 C;  2E1M B;  4BY1 J;  1MDM A;  2TDX A;  3GTJ J;  5GPA A;  4C30 A;  2VKH A;  5J8F A;  3HPH A;  1B6A A;  3GTK J;  3DTI A;  5CKT A;  3GTQ J;  5F1R A;  1VQO I;  2P4W A;  3MD2 A;  1OYW A;  1WHU A;  5HLH A;  3HZJ A;  3TMO A;  2E2I J;  1ZR2 A;  1GUU A;  1UEL B;  3D0S A;  1EJ9 A;  2QEN A;  1W5T A;  3TGN A;  4M3D A;  2M8E A;  1IV6 A;  5FRN A;  2A61 A;  4RAG A;  5HVQ C;  5H2F C;  1RC9 A;  5H6R A;  4EM0 B;  5IOZ A;  4HDV A;  3FXR A;  3RQI A;  4B44 A;  1DDN A;  3DU6 A;  2NVU B;  1V55 H;  2ZB9 A;  1UB9 A;  1APL C;  4EJT A;  1ZG5 A;  3ASN H;  3FXL A;  1IAW A;  1TW3 A;  3DPU A;  4E70 A;  2K3F A;  4FX4 A;  5BPD A;  2LKX A;  2TRT A;  4OAY A;  4BXU A;  3IAM 2;  3Q0W A;  4QLC U;  2X6X A;  3K4B A;  1RUN A;  1UHW A;  3QPL A;  4LLN A;  1LKX A;  4I2O A;  2QVO A;  2M7A A;  1U9O A;  1ETY A;  4A5M A;  2QEX I;  4M9Z A;  1VQ6 I;  4A3B J;  5CVU A;  2LDU A;  3FHN A;  1FMV A;  2MAB A;  5HOO A;  1V5G A;  2DT5 A;  1ETW A;  1WVR A;  2E1O A;  5H20 A;  3SYT A;  3HGG A;  3RKY A;  5JLX A;  1OCT C;  2NYX A;  2W1O A;  4EMS A;  2QSH X;  3S1M J;  2M2E A;  3K4K A;  4IHY A;  3MVP A;  4EV0 A;  2L02 A;  2DOF A;  1YX5 A;  2FF4 A;  2I10 A;  3FHZ A;  2B0L A;  1TQP A;  3GXO A;  5D5V B;  3FXQ A;  1TWC J;  1FYL A;  3H9J A;  1R71 A;  2E1C A;  2DA2 A;  3LSK A;  4ENK A;  4ZC3 A;  2M8G X;  3SJM A;  1D0X A;  1UHS A;  5EEG A;  3S1R J;  1D3Y A;  2L7F P;  3H9Q A;  3GFL A;  4UUS A;  5H6Q A;  5TRD A;  5D5X B;  2P5K A;  1K4S A;  1MH4 A;  4A3J J;  3OYI A;  2HI3 A;  2R5Y B;  3V7R A;  1ZG3 A;  5ILU A;  3TOB A;  1GV2 A;  1TZL A;  5TGT A;  2Z3Y A;  5EJC A;  3QU3 A;  4BHC A;  3ABT A;  4IO9 F;  1OIS A;  3ZQC A;  2GZW A;  3E5U A;  1T2K A;  2CSO A;  2BZT A;  1KU9 A;  1LQ1 A;  2HXO A;  1ZRF A;  3G3Z A;  1BBY A;  3E6C C;  3DTK A;  2ID6 A;  4MGR A;  1FMW A;  3DTE A;  3MKZ A;  2N8G A;  3ZQF A;  3OYF A;  3MFK A;  3HKZ N;  4XBF A;  4P96 A;  1T08 B;  3V8K A;  2OQR A;  3FBN B;  2ZSI B;  3C1D A;  2DYR H;  3F8N A;  2WA0 A;  2ZME C;  3HTS B;  1FP1 D;  5EG0 A;  1AHD P;  4IXA A;  2Y31 A;  3ECO A;  1FWZ A;  2L5Q A;  2E5Z A;  4XL9 A;  2LBF A;  4KT6 A;  5GTI C;  1YOV B;  2YX7 A;  2IS1 A;  1K78 A;  4BY7 J;  1W7P D;  1SFK A;  3FMR A;  3HC7 A;  3QOE A;  2CO5 A;  2CW8 A;  1R23 A;  4PJM A;  1FX7 A;  1JKR C;  2CWE A;  2DMQ A;  3U1K A;  2M30 A;  3ZCO A;  5J1R A;  2EA4 A;  4J00 A;  1YIJ I;  1VQ7 I;  3FXU A;  5D8K B;  3A1Y A;  1U5T C;  4AID A;  3HOU J;  1J5Y A;  1R5I D;  3O6B B;  1GLN A;  2XB5 A;  2XV4 S;  4O5V A;  5DS9 A;  4LFU A;  1RI7 A;  1S3J A;  2XRN A;  3HPG A;  5ILV A;  1F5T A;  2EZK A;  3ABM H;  3H1C A;  3JRG A;  1UMQ A;  5FFZ A;  3BQY A;  4KN7 X;  4WK8 F;  5KAI C;  4BBS J;  2G7H A;  1RZ4 A;  3P9C A;  2K9Q A;  3WTW C;  4OAZ A;  4UXN A;  1W5C C;  3L2U A;  4E6K G;  3R61 A;  2IGO A;  2RV8 A;  4XLH A;  3GCM A;  1LEB A;  1I1S A;  2GXB A;  3FKI J;  4XRF A;  1LFP A;  3FMS A;  4FE7 A;  2F4O B;  3B6A A;  2RC4 A;  2HZD A;  3AG4 H;  4MTD A;  5CVJ A;  2JVH A;  4Q48 A;  4IEJ A;  1S8N A;  2KLO A;  1W4M A;  2A5Y B;  3EQL F;  4XSZ F;  1MMN A;  2BGC A;  5KCM A;  3WTV C;  1G3Y A;  1XS9 A;  3ABL H;  5HLI A;  1XSV A;  3PIP F;  2F48 A;  3E6D A;  2WV1 A;  2CQ7 A;  5E8I A;  1TW2 A;  3H5R A;  4NC7 A;  2STT A;  2HU9 A;  2EZH A;  2KKO A;  2X0L A;  2V1X A;  2M7B A;  3VWB A;  2JSC A;  2OZ6 A;  3OOP A;  4BYY A;  4ZYH A;  2FBH A;  5FO5 A;  3LQQ A;  3G4S I;  5FLX K;  2ZME B;  3NAU A;  1VFC A;  5DCM A;  4HRI A;  3K70 D;  2XB0 X;  2ICW G;  2DFI A;  2H8R A;  3GBG A;  4YIF A;  3S2D J;  1WQ2 A;  3W2V A;  1F43 A;  2DMN A;  2PJR A;  2Z5U A;  3L1P A;  2HVR A;  3W6V A;  4JQF A;  1N25 A;  2CMP A;  3L2C A;  3BR2 A;  5TIS C;  1MBF A;  3OYM A;  1SVO A;  4XON A;  5GAG J;  2XGX A;  4NC8 A;  2DMP A;  4B4C A;  4KIS A;  1U5T B;  3U2R A;  1OYI A;  3DPT A;  2EH3 A;  3O3K A;  2VT2 A;  2VJ5 A;  4Z6Y A;  4M72 A;  2KT0 A;  1SD7 A;  3SZT A;  4ZH4 F;  4WCG A;  4YII A;  1F4K A;  3MZH A;  4RLQ A;  2QA4 I;  1VI0 A;  4G8X A;  2DA4 A;  1JE8 A;  2HDD A;  2IXS A;  4C2T A;  5DM6 F;  2BE5 F;  1BL0 A;  2CFO A;  4JX5 A;  1B9M A;  1XMA A;  2J5P A;  1TT5 B;  5CJ9 A;  3DXJ F;  5CQG A;  3F6V A;  1TQM A;  2Y0S A;  2R7R A;  3M9A A;  4BE0 A;  4MFE A;  1LFU P;  2R7X A;  2L4M A;  3OIP A;  4PJN A;  2ZJR F;  1B1B A;  4HEA 2;  3MMY B;  1STZ A;  2E60 A;  2LY1 A;  1Z9C A;  4B3A A;  4A93 J;  3S3O A;  2KZV A;  5TJJ A;  1SC7 A;  1LEA A;  1WFX A;  2V7F A;  4BDZ A;  1O7L A;  3BCB A;  4HSR A;  4CXF A;  3T5X A;  1MDM B;  4J19 A;  3BR6 A;  3E1S A;  1E3O C;  4LB5 A;  4QPO A;  3BTC A;  3ERM A;  5GAH J;  2FML A;  5DUK A;  1HKQ A;  1J09 A;  3OY9 A;  5E20 A;  1Z91 A;  3RPU A;  2QSG X;  4KYW A;  2VB6 A;  3W6J B;  4WX9 A;  4OIQ F;  1NHA A;  4KFC A;  3OS1 A;  3BQZ A;  3GTO J;  4I01 A;  3FIS A;  2R0Q C;  2UXX A;  1SAU A;  1TNT A;  1XCV A;  2HS5 A;  5L3G A;  1C0W A;  3G2B A;  2CV2 A;  1YIT I;  4BGD A;  1VZ0 A;  3FMQ A;  1BJA A;  2K9L A;  2K9N A;  5B1A H;  1ULY A;  3C3W A;  1ZN2 A;  3CP2 A;  2ZJQ F;  3BLY A;  4XNF A;  2VQC A;  3NWT A;  2HDW A;  4R79 A;  1ZK8 A;  2EWN A;  2FBK A;  5E18 F;  4AVZ A;  1R5H A;  3R60 A;  3GFI A;  3EYI A;  2AXT C;  2E71 A;  2O3F A;  5HDK A;  5JI6 A;  1GV5 A;  2YR2 A;  3IWF A;  3KP5 A;  2H27 A;  1P9Q C;  3ULQ B;  1IGN A;  4AWX B;  1PDN C;  4XSX F;  4Y15 A;  4RBO A;  2K4J A;  2GXA A;  3M1C A;  2RDP A;  4L18 B;  1OR7 C;  2VC0 A;  9ANT A;  1T56 A;  4BHB A;  2DOA A;  3H3Z A;  3ZRG A;  5GTH C;  3VOE A;  4WF2 A;  5HDN A;  2K5C A;  1T98 A;  3KIO A;  3JSP A;  4G6T B;  1QNT A;  2QQB A;  3RPQ A;  3HOS A;  2R7W A;  3D5S C;  1USS A;  2HEO A;  3W2W A;  2FOK A;  2AS5 F;  5HS8 A;  1P6R A;  2V9K A;  1ERD A;  2MW8 A;  2OTL I;  1WRJ A;  2HQR A;  3ML6 A;  1LVA A;  2VBZ A;  4UUS B;  1I39 A;  1J7K A;  2X1D A;  5IT3 A;  1L3L A;  1ZEL A;  4U87 A;  1IN6 A;  2BEO A;  3CCV I;  3JRA A;  1IV8 A;  2XAQ A;  1WWX A;  1UJ8 A;  2H1L A;  4IQJ A;  2DFF A;  1H89 C;  5J1Y A;  1YJW I;  2E2J J;  4DYR A;  2QQA A;  2DJN A;  3CJQ B;  2MA3 A;  4ZDL A;  2AO9 A;  4ON0 A;  2V1N A;  1XCB A;  2YUS A;  2HDC A;  4BBR J;  2L7Z A;  1Y1V J;  1G2H A;  4F92 B;  2JA6 J;  3HSF A;  4G6Q A;  2HQN A;  1BOA A;  1QGP A;  1AKH A;  4S05 A;  5J1U A;  2VOP A;  4U0V A;  4UHT A;  1ETK A;  5EG0 B;  3OSG A;  3I9V 2;  2EJR A;  3JAM K;  1Y0N A;  2LF7 A;  2L2O A;  2WBM A;  1DGR M;  2LBF B;  3A4C A;  2YS9 A;  2V4J C;  4HNT A;  2O03 A;  4XMY A;  4L9J A;  1XGS A;  3CCU I;  3FWE A;  4EVI A;  1R1V A;  4IHV A;  4M71 A;  1S7E A;  1E17 A;  1X19 A;  2IVM A;  4EGY A;  2EFO A;  5LBQ A;  3SFI A;  3WGH A;  3SXY A;  1EA3 A;  4LGW A;  5E1Z B;  2I8D A;  3CJR B;  3BR1 A;  4MTE A;  4Z2Y A;  3CC4 I;  3KZI C;  4X1E A;  1O57 A;  2L54 A;  2R7T A;  2WAQ N;  3GZN B;  1Z6R A;  2EIM H;  5EF6 A;  3SDB A;  1OCC H;  1Q1V A;  5C44 J;  1JUM A;  1X1C A;  2NOJ B;  4IX7 A;  1WCM J;  1D8J A;  3OR1 C;  4HG2 A;  3CJT B;  2YX4 A;  1LVK A;  3BG6 A;  3E7L A;  1BR2 A;  3JSO A;  3V7C A;  1IN8 A;  1DP7 P;  2NNY A;  3Q9V A;  2L9V A;  3U1D A;  1Z77 A;  5BMZ A;  2HQ5 A;  1G3W A;  2GM4 A;  1IW7 F;  3GME A;  4ZYD A;  2E19 A;  2JJ7 A;  1G4D A;  1VQN I;  4BXF A;  5FLV A;  1BOB A;  4LJZ F;  1J0R A;  4M3F A;  3L9F A;  2CUZ A;  4UB8 C;  2EIJ H;  3DBH B;  1EH6 A;  2HKX A;  5LFA A;  1IUY A;  4KT5 C;  2JQ7 A;  2LRE A;  4PCQ A;  1KYW A;  1CF7 A;  1SVL A;  2L9R A;  5DYM A;  3J7A Y;  2LNB A;  2R7F A;  2L0K A;  4A3M J;  4LG0 A;  3VYR B;  4L5J A;  3CD6 I;  3GO5 A;  2EK5 A;  3OL3 A;  3H36 A;  3J81 K;  4RAF A;  2DA7 A;  1Z7U A;  1R5G A;  2HFH A;  4HYE A;  4L9N A;  3LNQ A;  1QHH D;  2F4I A;  5J8C A;  1K83 J;  1I50 J;  1Y0U A;  3OYG A;  1S5L C;  2W85 A;  5DCF A;  2B7E A;  2R7S A;  3EUA A;  1DP3 A;  1ETQ A;  5DCM B;  2DFE A;  3CF2 A;  4GYI A;  4HQE A;  4KIB A;  4RM2 A;  1T6S A;  1YQA A;  3KP6 A;  1IRG A;  4YFX F;  1V3F A;  2EB7 A;  3PM1 A;  2LC2 A;  2PJR B;  3DU5 A;  3GFM A;  3WG9 A;  1MSE C;  1W1W E;  3LOC A;  3HOX J;  3LSM A;  2HOA A;  3VDX A;  4FET A;  3HOT A;  2EFN A;  2DAO A;  2DFH A;  4DW6 A;  1A04 A;  2L4A A;  4PFP A;  3QPT A;  1XTA A;  4BH9 A;  2XAH A;  3F3X A;  3BP8 A;  4BHP A;  4NUB A;  3CCR I;  1PYV A;  3I4M J;  4WXC A;  5DTD A;  1W7P A;  2R7D A;  4LIV A;  4LLG F;  5C3E J;  3P7N A;  5LHG A;  3JRH A;  1E3H A;  2VQG A;  5L3B A;  4BUP A;  1A6Q A;  3RIR A;  2P6S A;  3VEP A;  1FNN A;  2L01 A;  2R3S A;  1MMD A;  2BOL A;  4RGU A;  3N4M A;  3ZXS A;  5BOX A;  1T39 A;  2HYF A;  2AQE A;  2QBY A;  1KYZ A;  3HG9 A;  3KEQ A;  4CGZ A;  1IRX A;  4KIT B;  1IF1 A;  2H09 A;  2ZXW H;  3PQK A;  5D6E A;  5GAE J;  1TP4 A;  2VBY A;  1LNW A;  1MND A;  1ZR4 A;  4XRS G;  2EIL H;  3S14 J;  1HSJ A;  3CDI A;  3OSF A;  2IJL A;  2NOG A;  1RKT A;  3V8L A;  2M0C A;  1Y56 A;  5E3O A;  1VTN C;  3OYK A;  3SZG A;  1P4W A;  3DFG A;  4RA2 A;  1T0F C;  2UZK A;  3BOQ A;  2PJP A;  3JAM Z;  4P5O A;  2V9V A;  3NWS A;  2VPL A;  1V4R A;  3HXL A;  4IOC F;  1FIA A;  4ZZD A;  2FQ4 A;  4X6A J;  2DA6 A;  2O7O A;  2CV0 A;  4A3C J;  4PK4 A;  5M5W J;  1ZKG A;  4Y3O A;  3QAH A;  2DDB A;  4YEL A;  4D1Q A;  1VND A;  2VT3 A;  3V4G A;  4Y17 A;  5IPA A;  2FRH A;  4OOI A;  1HQC A;  2CW7 A;  4NBQ A;  2XRO A;  3LAJ A;  1P4X A;  4V19 K;  2DBB A;  3M3Y J;  1MJA A;  3CTA A;  2M1B A;  2DT6 A;  1X2M A;  3B73 A;  2ZXJ A;  4A0X A;  1QU3 A;  3T0Y A;  2V6C A;  4LIU A;  5IT9 Z;  3NQO A;  2XIG A;  2ELH A;  3IV5 A;  1LDD A;  3QOP A;  4QTR A;  4GCV A;  5K7Z A;  5KVR A;  3GTM J;  3FXM A;  4IHT A;  2F5C A;  2OA4 A;  1PUF A;  1YE9 A;  2OUM A;  5GAD J;  4AIH A;  1SD4 A;  2CQQ A;  4ESF A;  3KLN A;  2K4B A;  2K9S A;  2MSY A;  5LLQ A;  1K6O A;  4HX7 A;  1B72 A;  3CMY A;  2XRL A;  3TBI A;  3KE2 A;  4E7I A;  2L7K A;  3OYC A;  2COB A;  2CH0 A;  4RM3 A;  4XOT A;  3ZGK A;  5EDN A;  3GWZ A;  1MD0 A;  4UNO A;  1PP7 U;  2KQR A;  2VQH A;  1EF4 A;  5J4V A;  1ZH5 A;  1YW7 A;  4UB6 C;  1W0U A;  2OJE D;  4RMN A;  1YG2 A;  3H0D A;  3B6C A;  5B5E C;  5KK1 A;  4IHS A;  4XM3 A;  3OMY A;  4WWC A;  3GYH X;  4UY8 I;  3H5A A;  4DBR A;  4IOA F;  3UNG C;  3PO2 J;  3J81 Z;  4ENN A;  3FXK A;  1XPX A;  5K7F A;  4PSX A;  3CF5 F;  5LGU A;  2OF7 A;  5E1X A;  1UHM A;  5CVV A;  1Z3X A;  1XN7 A;  1P2F A;  3V8J A;  2OC6 A;  5GP9 A;  2CQX A;  3A02 A;  1FC3 A;  1QQI A;  3F9K A;  1MJ9 A;  1Y6I A;  3IC7 A;  3BWG A;  3KZY A;  1VQ9 I;  2X6Y A;  3TW6 A;  1V5E A;  2JSP A;  3RI4 A;  3I59 A;  4B1R A;  2BVL A;  2BW3 A;  3OR2 C;  3R4K A;  3WTU C;  3WU1 B;  3KET A;  3E5Q A;  2E1N A;  1WSU A;  2Z16 A;  3JW4 A;  3O8G A;  2JZY A;  2KIQ A;  2P8T A;  4AUX A;  1WJA A;  2XPU A;  3DPL C;  3ESW B;  4OWR B;  3FDY A;  3TQN A;  3F22 A;  1DU6 A;  3LQR A;  3BG9 A;  2XAJ A;  2O6G E;  2IA0 A;  4Y33 A;  5ICG A;  4L9T A;  4Y4R A;  1K6Y A;  3ECH A;  4KUM A;  1MBE A;  1R7J A;  5FKM A;  4V2G A;  2JUG A;  2Z99 A;  3AG3 H;  3M1E A;  4DQ2 A;  4BQN A;  2R4G A;  3PO3 J;  1LE8 A;  2FX0 A;  1Z6T A;  5BNG A;  5F0H A;  4M9S A;  3AL0 C;  4F7Z A;  1R1U A;  3X2Q H;  1GHC A;  2WTE A;  1R00 A;  4MLO A;  2ZJP F;  1PJR A;  2V1D A;  3IKT A;  1WH7 A;  2MBF A;  2IRF G;  3U21 A;  1JKQ C;  1T33 A;  2KDO A;  2PMZ A;  3GLX A;  1YO5 C;  1HDD C;  2JA7 J;  3FZV A;  2WAD A;  2KP6 A;  2H6C A;  2XSD C;  4G7Z F;  1GXP A;  4QIW N;  4ENJ A;  4BDY A;  1B8I A;  3Q9S A;  5A2Q K;  1HKS A;  1IXR C;  2KJC A;  3KCC A;  3KYD B;  4PUS A;  3CCE I;  2P81 A;  2XGE A;  2F5F A;  3DF8 A;  2LY2 A;  3HM5 A;  4RAY A;  5K1Y A;  3OS0 A;  2GA2 A;  2PBI A;  3CUQ A;  3LSR A;  1IO2 A;  3IH3 A;  5J4Y A;  2QQ9 A;  2D5V A;  4BKX A;  1UG2 A;  3DP7 A;  2XC7 A;  1HOM A;  4EEF G;  3WHC A;  4Y52 J;  1XGM A;  4JBA A;  1R4M B;  1KGS A;  1BIA A;  2QSF X;  2BYV E;  5JHF A;  3K4J A;  3G1L A;  4PDK A;  2NVQ J;  1ODD A;  2JPB A;  3S17 J;  3K1M A;  1I3Q J;  1QZY A;  4D5C A;  4ZTJ A;  3NAR A;  4WXD A;  4I02 A;  1IXC A;  2MLK A;  3OV8 A;  1BR1 A;  1Z21 A;  2G0E A;  5FKL A;  3Q0V A;  3OYA A;  2ZNY A;  5L3E A;  3ZN0 A;  2MLG A;  3I4P A;  3K10 A;  4A3G J;  5D6F A;  1ZRC A;  3GTP J;  3TKY A;  2Q2E A;  2GOM A;  4MFD A;  4XRM A;  4G6D A;  4A6D A;  3MKL A;  1WH5 A;  2DK5 A;  4LG0 B;  3S3N A;  2VON A;  2DOD A;  1Q1H A;  3OWT A;  3KX2 A;  1ZLK A;  2ELJ A;  5F0F A;  1WJF A;  3C2B A;  4XR6 A;  2VBW A;  2MG4 A;  4N4O B;  1SEU A;  4CCN A;  2GIZ A;  2JRM A;  4PFO A;  1ON2 A;  4CYC B;  4XKB A;  1XDS A;  1JJ6 C;  3HJE A;  3S1N J;  5LRS A;  3H92 A;  4ZTF A;  3L00 A;  5FKO A;  1MBH A;  3RCO A;  1X2N A;  4DJA A;  3DLL F;  2P6T A;  2LR8 A;  3R0A A;  2QM3 A;  3AL0 B;  1YHQ I;  4LLL A;  2MYS A;  4XKW A;  1X4O A;  2Y0S N;  3LMM A;  2R7V A;  3TED A;  1B9N A;  4MQV A;  2W25 A;  3HIF A;  4B43 A;  1O3T A;  3BZC A;  2QCO A;  3F72 A;  3CCQ I;  1HF0 A;  2W48 A;  1YLF A;  2ESN A;  2DQL A;  4O3M A;  1FBU A;  3QPH A;  5JLW A;  2E5N A;  3PUF A;  2HWV A;  2QUF A;  1OKR A;  3KEO A;  2KIS A;  1FSH A;  2F2E A;  3M7G A;  1JI8 A;  4RB3 C;  3TDZ C;  1O3Q A;  2O9L A;  2CQK A;  4ZZL A;  2CYY A;  5J40 A;  2FNA A;  3MEX A;  3WTX C;  1HKT A;  4IQ4 A;  4M9X A;  4BS9 A;  2PMU A;  1MJB A;  1Z1D A;  1IXS B;  3OYB A;  1WJC A;  2B9S A;  2HPM A;  1KQ9 A;  1ONV A;  4O6J A;  4XOP A;  2QBY B;  2KFD A;  3QU6 A;  2RRE A;  2NVX J;  5CYV A;  4K2E A;  2QWW A;  1KQ0 A;  5F04 A;  4MQ9 F;  2XAS A;  5F27 A;  4PSW A;  2OCC H;  2W4S A;  3KLO A;  4IHW A;  4L0Z B;  1FOK A;  1RIO H;  3S3M A;  1LUJ B;  3IRR A;  1NK2 P;  2V26 A;  1FY7 A;  3ISP A;  3IKV A;  4P1W A;  2NS0 A;  2ZO4 A;  3DKW A;  2IPQ X;  3ELK A;  2Z2S B;  1ZGA A;  2H8W A;  4GXO A;  1ZQ3 P;  1V5F A;  2EV0 A;  3QP6 A;  2ZXH A;  2FU4 A;  4IRI A;  3I56 I;  2Y30 A;  3BTJ A;  1ITY A;  3BTL A;  1A6I A;  2GA1 A;  1QRY A;  4I09 A;  4JX4 A;  2IGM A;  3F0C A;  3F8M A;  1BIB A;  2CUE A;  3RDI A;  4AD9 A;  3VOD A;  1JT6 A;  2BY3 A;  4NDL A;  1JTY A;  3E0J B;  3GFJ A;  4IF4 A;  3L2W A;  4HA8 A;  4ZDO A;  1FBS A;  5D5W B;  5AON A;  1OCR H;  1HLV A;  4DBQ A;  3M8E A;  1X3Z B;  1LFB A;  3J80 K;  2AQF A;  5A2Q Z;  3CP8 A;  4AYB A;  4C2U A;  2FMY A;  2V79 A;  3TP0 A;  3C18 A;  5E17 F;  3SEZ A;  4DYQ A;  4KNY A;  1D0Y A;  3WU0 A;  1SFX A;  1DGW Y;  1IRZ A;  3FK6 A;  2M45 A;  2P5V A;  2G9W A;  5F08 A;  1B4A A;  5E79 C;  3ZR8 X;  1FPQ A;  2LFB A;  1BW6 A;  3EET A;  4GFB A;  3LA2 A;  4A3I J;  1XD7 A;  4YEJ A;  3PQJ A;  2LG4 A;  5F0C A;  3ZMZ A;  1FOY A;  2P0W A;  4EGZ A;  2BXZ A;  2GIV A;  2O8K A;  2R93 J;  2A07 F;  5L3F A;  4B48 A;  3CDL A;  3OOU A;  2YPR A;  3WU2 C;  1Z0X A;  2XUB A;  3JTH A;  1YIO A;  2VI6 A;  3D1N I;  2P5L C;  3IHU A;  3HYI A;  1R1T A;  1FTZ A;  4KIC A;  3BRO A;  2Y9Y A;  4XLP F;  3ABU A;  1ETV A;  5BS6 A;  1B72 B;  2DMT A;  4L5I A;  4GRI A;  2CQN A;  2FXA A;  2A6T A;  4KA4 A;  1BI3 A;  2ECB A;  2PG4 A;  4G12 A;  5F64 A;  3PUB A;  2BHZ A;  5EGO A;  4BJ6 C;  3K4M A;  3ZQQ A;  2IP2 A;  2DYS H;  5DDG A;  2KJB A;  1O3R A;  5CLS A;  2W57 A;  2QKM B;  3HL2 A;  2PLY A;  5BPI A;  4G94 A;  2E2H J;  4E7S A;  3KEY A;  1PUE E;  1Y8R B;  3I58 A;  2HTS A;  2K7L A;  4RLF A;  2DO7 A;  1KQ8 A;  1OQY A;  1IN5 A;  4UVB A;  1A35 A;  2MD5 A;  1R4N B;  5B3S H;  2JA5 J;  2XDV A;  5ILS A;  1S7O A;  2W84 A;  2XVC A;  3Q3S A;  4CHU A;  1DQU A;  3ZMD A;  2JT1 A;  2QKL B;  1N78 A;  2HKO A;  2KRH A;  4HQM A;  2WC2 A;  2K27 A;  1H0M A;  1EV7 A;  1IDY A;  1ZGJ A;  2FSW A;  3A0B C;  4M6X A;  2V6E A;  1QVU A;  4G7O F;  1VQ5 I;  1UST A;  3M8J A;  2IS6 A;  4FAS D;  1TBX A;  3I59 B;  2EIK H;  2O5R A;  2KIM A;  4BL0 B;  3G1M A;  4R1H A;  5HS9 A;  1O4X A;  2RQQ A;  3M8F A;  2ADU A;  4B09 A;  4ESB A;  3WTY C;  2K02 A;  2RN7 A;  2DTR A;  3LSI A;  5IOY A;  3ERE D;  4A3E J;  4CCL A;  1N77 A;  1XG1 A;  2L9S A;  4LMY A;  2CS3 A;  4OMY A;  1BC7 C;  1WJ5 A;  3WTZ A;  3RYR A;  2CGP A;  1SMT A;  3TO6 A;  3ZQI A;  3HBL A;  4IRG A;  4MO7 A;  2WY7 Q;  3RJP A;  1S6L A;  2IT0 A;  1JHH A;  4OU0 A;  3TO9 A;  5FLX Z;  4WXH A;  2LLK A;  3H35 A;  1WGX A;  1LE8 B;  2EV6 A;  3QRF F;  1S7A A;  3L7W A;  1MH3 A;  4XN0 A;  2D45 A;  5BQT A;  2ZFU A;  2DW4 A;  4EQQ A;  3DV8 A;  3PL8 A;  3R0J A;  4E7H A;  2DDA A;  4XLE A;  1PP8 F;  1PVE A;  4HPQ A;  3WGI A;  2ISZ A;  2KHM A;  3KP4 A;  2RNG A;  4YFN F;  2VAS A;  4CUG A;  4HAM A;  1H88 C;  5C4J J;  4ITV A;  1B8I B;  1MSF C;  2DA3 A;  3JRB A;  3G71 I;  2OAZ A;  4CIC A;  3SEQ A;  2ZNZ A;  3CUQ B;  3S2W A;  3RKW A;  5F6F A;  1UZC A;  4HX4 A;  3IH4 A;  1REP C;  1P7J A;  1UG0 A;  4JYK A;  2IBD A;  4RS8 A;  2PI0 A;  1X4P A;  3O8H A;  2WAF A;  1QZZ A;  2CW0 F;  2KIU A;  5L3D A;  4AU7 A;  2DI3 A;  3J80 Z;  2DN0 A;  1K78 B;  4UV8 A;  3IH2 A;  3BJA A;  4FIS A;  1B59 A;  1OCZ H;  4ASN A;  3FX3 A;  3RSN A;  1W0T A;  5M3M J;  2J5O A;  3BR0 A;  2E34 A;  1V54 H;  3BY6 A;  3U9G A;  2X6W A;  4HNU A;  2Q2E B;  2X6O A;  2XKO A;  1A5J A;  3G1O A;  2FA5 A;  1D1C A;  2FE3 A;  1OYY A;  1MMA A;  1FT9 A;  1U78 A;  5FFX A;  4N9H A;  3CLQ A;  2XGC A;  1JT0 A;  5HDG A;  5LEK A;  3AAF A;  3F8B A;  3KFW X;  5ERI A;  3ZQ7 A;  5EYR A;  3E6M A;  1FZP B;  3QYE A;  1G6N A;  2VIX A;  4BJ5 C;  4F93 B;  3OYD A;  3K1P A;  1FTT A;  2PX9 A;  4IL6 C;  3KYL A;  3JRE A;  4H4K C;  4LIT A;  4IHX A;  4HV5 A;  5KNL A;  3A01 A;  1U8R A;  4LK1 F;  1OMI A;  2R7O A;  2HVQ A;  4D7N A;  1GVJ A;  3MZ8 A;  5LGT A;  3K0L A;  1MW7 A;  1X1A A;  1RUO A;  2VJI A;  2ZC2 A;  2D1H A;  4BJT A;  2W24 A;  2M9H A;  4XIC A;  1ON1 A;  2Z9O A;  1J9I A;  4FHT A;  4P9F A;  2HQA A;  4OIN F;  1LDK B;  4C2M J;  2KRC A;  1ZRD A;  2OU2 A;  4IZZ A;  2DU9 A;  2VKV A;  2NNN A;  2X1C A;  4A6E A;  3BC8 A;  3BZ6 A;  1YS7 A;  2ZSH B;  3DWL E;  4ZYA A;  3RKX A;  4NB5 A;  2GXG A;  1TL8 A;  4B3X A;  5J3L A;  4XKC A;  3TO7 A;  4Q4Z F;  1FOW A;  3CCL I;  1BI0 A;  1UAA A;  3S1Q J;  1FP2 A;  1T8I A;  1MMG A;  4P9U A;  2IA2 A;  1H9T A;  3MKW B;  3N97 A;  3HRU A;  2HXI A;  3ZQG A;  1VQM I;  3FKJ A;  5M5Y J;  1U8B A;  4ENM A;  3IRQ A;  4C3I J;  2HYG D;  3HOV J;  3FBI B;  4OMZ A;  3EDP A;  3I3L A;  2JWT A;  3K4C A;  2HZT A;  2Z33 A;  2UXN A;  3K69 A;  4HZF A;  5FRM A;  3E3V A;  3L2R A;  3SDG A;  3CO6 C;  1WI9 A;  1KZH A;  2XPW A;  3K9T A;  4U7D A;  3H3U A;  2GLO A;  2LKP A;  2JTV A;  1LJ9 A;  3TDU C;  2EA2 A;  2FNP A;  3B02 A;  3CQZ J;  4PGH A;  2R7Z J;  3CUO A;  2EQR A;  3F8C A;  3CCM I;  5D8L B;  3JCU C;  1S29 A;  2DCE A;  3P5J A;  5J6X A;  1WJD A;  2LYC A;  2VXZ A;  1BN5 A;  1TQI A;  2OCE A;  4RGR A;  4UVC A;  4EJW A;  4Y13 A;  1U0J A;  2M3A A;  1KU3 A;  3VFZ A;  1HST A;  2BV6 A;  3BG7 A;  3N05 A;  5AIP A;  4YG2 F;  1WI3 A;  2IGN A;  4II2 A;  4OIR F;  5JVT A;  1MZB A;  4XLN F;  5GPC A;  2NAZ A;  1MBK A;  5EZG A;  1MGT A;  2VJJ A;  5JHU A;  1I3A A;  4IRH A;  4V2F A;  1SAX A;  3FK7 A;  4L9V A;  4FCY A;  3ZMV A;  4KN4 X;  4RGS A;  3TOA A;  3ROU A;  2M87 A;  1VQP I;  1Z3Y A;  4PGG A;  1W36 D;  1BJZ A;  4NQW A;  5EEH A;  3HB9 A;  2E36 A;  3C2H A;  2K40 A;  4D7M A;  2Q0O A;  3DLA A;  4RB1 A;  1HA8 A;  2MFZ A;  1RET A;  1WJB A;  1DU0 A;  2HPI A;  1A31 A;  2ACJ A;  2DMU A;  2OV7 A;  2M34 A;  1K61 A;  4GDF A;  1BI1 A;  3T1B A;  3CMA I;  1YW8 A;  1KU7 A;  1ZAR A;  2PQ8 A;  4XLA A;  4E4H A;  2HOT A;  4U0W A;  2P7C B;  3CMM A;  3EUH A;  4PJL A;  3UR3 C;  1JUS A;  3L09 A;  4AC0 A;  2V9P A;  4G9Y A;  1YRN A;  2CV1 A;  2DA1 A;  2K85 A;  2CFX A;  3ZQH A;  1VQ4 I;  2XF7 A;  4M73 A;  4C9Y A;  2EFQ A;  4ZYE A;  1ACI A;  1W5S A;  2EFP A;  3A2K A;  5FKK A;  3MQ0 A;  2X1E A;  4B47 A;  3VYT B;  2OPT A;  3BCA A;  3F23 A;  1CGP A;  1MMS A;  1D0Z A;  3AG1 H; 
#chains in the Genus database with same CATH homology
 5FB2 A;  5DEQ A;  1TTY A;  2VC1 A;  1UCR A;  1DPR A;  4ESJ A;  1HW2 A;  4EJU A;  3LST A;  1L0O C;  3J7A O;  4CO8 A;  1ZLJ A;  2KRF A;  2PFB A;  3IL2 A;  2CG4 A;  3CO7 C;  3GZ5 A;  4KMU X;  4R8H A;  3V7S A;  1XGO A;  4MNU A;  3D5L A;  1HW1 A;  5E1W A;  4CYD A;  1XB4 A;  4IVN A;  3LWF A;  1OPC A;  2STW A;  4CDG A;  2WWY A;  5JFR A;  2F5D A;  2H94 A;  2JPC A;  3E97 A;  2A68 F;  4HF0 A;  1H9G A;  5DUI A;  3LA7 A;  3IWZ A;  3BJ6 A;  3CDH A;  2A6H F;  3HHH A;  1I27 A;  3NRV A;  1JHF A;  5HS7 A;  4RGX A;  4EJV A;  5FD6 A;  1ZRE A;  1JXS A;  2MH2 A;  3I64 A;  2VE9 A;  4A5N A;  3DEU A;  5DD8 A;  3HSR A;  1R22 A;  1BM9 A;  1J2X A;  4S04 A;  4OIP F;  3BPV A;  3HSE A;  4AIK A;  1XMK A;  2F5E A;  1I6X A;  2AXL A;  4U88 A;  6PAX A;  1MKM A;  4EM2 A;  2IW5 A;  5CVI A;  1P4A A;  5CVR A;  2ISY A;  2D2W A;  3SZP A;  1CF7 B;  4N0B A;  4M74 A;  1YFH A;  3BPX A;  3WE3 A;  2ZFW A;  3W6K B;  2ETH A;  1YTY A;  3MCZ A;  4NHJ A;  3Q5F A;  4HBL A;  1OR7 A;  3P9I A;  1YYV A;  4G7H F;  2A6E F;  2OD5 A;  2LF8 A;  3GF2 A;  3C7J A;  1G3T A;  3JTG A;  2K86 A;  1K7A A;  5LGN A;  2HR3 A;  5HLG A;  1IN4 A;  1DPU A;  4I0B A;  4MEX F;  2NRA C;  2X4H A;  2G7U A;  4GYG A;  3RYP A;  1W7P B;  2V1U A;  1HBX G;  5FGM A;  2H6B A;  4RB2 C;  4DNC A;  3KP2 A;  1J59 A;  2HOE A;  2VE8 A;  2OBP A;  3G73 A;  3FF5 A;  1O3S A;  1HXD A;  4U7B A;  4AVP A;  2YU3 A;  2QLZ A;  4TV7 A;  1EH8 A;  1HW5 A;  1QPM A;  2PMH A;  2QZ8 A;  3WOD F;  2FBI A;  3GW2 A;  1KA8 A;  4I0A A;  4GGG A;  4AIJ A;  3I71 A;  2Y48 A;  1F1Z A;  3ZN1 A;  1GXQ A;  2QYO A;  4GO1 A;  4HX8 A;  3GEZ A;  2ESH A;  2FQ3 A;  3SQN A;  3GZ6 A;  3MWM A;  3F6O A;  5AIQ A;  4I7H A;  3DQV C;  4D0P A;  4LB6 B;  5ICF A;  4HW0 A;  4HLY A;  1XSX A;  2ZBK A;  3HRS A;  2LSO A;  5LHH A;  5E8G A;  2Q8K A;  5D5U B;  2DPU A;  4UUV A;  1EH7 A;  3BJO A;  2DLL A;  2XAF A;  2OZU A;  1AOY A;  1U3E M;  3MZY A;  1D8K A;  4JK1 X;  2E7X A;  4RAZ A;  3SFZ A;  3T8T A;  4A0Y A;  4P55 A;  3LA3 A;  3FM3 A;  4Q5S F;  3HRM A;  2VN2 A;  3FM5 A;  1ZYR F;  3CUQ C;  4ETS A;  2PEX A;  3LAP A;  1O7F A;  4LK0 F;  1D5V A;  3HRT A;  4N9I A;  4A0Z A;  3KP7 A;  4KMF A;  2VOD A;  3E6B A;  3I0T A;  2RGV A;  3PFI A;  4IPA A;  1YS6 A;  1XGN A;  3HUG A;  4Q47 A;  5DD4 A;  2RQP A;  1IZ1 A;  1LB2 A;  1I1G A;  5ED4 A;  5LRR A;  4FX0 A;  4H0E A;  4QWQ A;  4LD5 A;  5L3C A;  1QO0 D;  2VBX A;  2C6Y A;  2GWR A;  3F21 A;  4FT8 A;  3COA C;  5JR3 A;  2DQR A;  3MAJ A;  2DPD A;  1F9N A;  4KIG A;  1R36 A;  2WV0 A;  1ZAO A;  3I5U A;  4A12 A;  3R6S A;  3ZMU A;  4HV6 A;  3BDD A;  1FLI A;  3WGG A;  4HF2 A;  1SD6 A;  1T0F A;  1JGS A;  2XHK A;  2HTJ A;  3K1N A;  2GAU A;  5LEJ A;  2MC3 A;  1SD5 A;  2OQG A;  4EJO A;  1DUX C;  3P9K A;  2BBY A;  1R58 A;  2GQQ A;  4UVA A;  2JRT A;  1FBQ A;  2VOO A;  2Y75 A;  4HDU A;  3REO A;  1SFU A;  3QP5 A;  1SMY F;  5K5Q A;  3GX4 X;  1U2W A;  2DK8 A;  2E7W A;  4HF1 A;  4MHG A;  1WKM A;  4BQA A;  2A69 F;  3NEU A;  2O8X A;  3ZMS A;  2RKH A;  2O0Y A;  2YSR A;  1IN7 A;  2FEZ A;  4HOB A;  4KIF A;  5DV5 A;  1FYK A;  3ZPL A;  2EFW A;  3EYY A;  1Z05 A;  1ZHF A;  2P7V B;  5IT9 K;  1P92 A;  4PZJ A;  3CLO A;  1KU2 A;  1AWC A;  1BI2 A;  1U6G A;  4MEY F;  3WE2 A;  2UWM A;  2KIF A;  3KP3 A;  3GUD A;  5K5O A;  3HHG A;  2PN6 A;  4RB0 A;  4BNC A;  1X3U A;  2RVC A;  5K5R A;  3LFK A;  1UFM A;  3F8F A;  5D4R A;  3ZP5 A;  1YW9 A;  3HTU A;  4HLX A;  4YFK F;  1TLH B;  1XDU A;  3WTS C;  2IA1 A;  2O61 A;  3E5X A;  4U0Y A;  2A3S A;  1LDJ A;  3VB2 A;  2ZKZ A;  1K79 A;  3I53 A;  4M6Y A;  5LHI A;  2Y0M A;  2L3D A;  4UV9 A;  4OIO F;  3K2Z A;  3RTR A;  1I5Z A;  3O2P E;  1FSE A;  2COM A;  2XAG A;  1G3S A;  4EM1 A;  1QBJ A;  4BAY A;  2ZME A;  1ZG1 A;  5ICE A;  1IRF A;  3SHF A;  2XKP A;  1FYM A;  3KZZ A;  4B8X A;  1TNS A;  2MH9 A;  3GVA A;  5D4S A;  1U5T A;  1XSD A;  3WTT C;  2M5W A;  3ZMT A;  2ZCW A;  2RNJ A;  1E2X A;  1SFE A;  1T38 A;  1J75 A;  2EV5 A;  4CZZ A;  4A2U A;  3T8R A;  3I54 A;  4L0Y B;  3CJN A;  4I98 B;  5FD5 A;  1RNL A;  4ZYG A;  2D1V A;  5ICC A;  4KDP A;  2ZJ2 A;  4IJA A;  2HGC A;  1BC8 C;  1MDM A;  2TDX A;  5J8F A;  1B6A A;  5F1R A;  2P4W A;  5HLH A;  1OYW A;  3D0S A;  2QEN A;  1W5T A;  3TGN A;  2M8E A;  2A61 A;  5HVQ C;  5H6R A;  4EM0 B;  4HDV A;  3FXR A;  1DDN A;  1UB9 A;  4EJT A;  1ZG5 A;  1IAW A;  1TW3 A;  4E70 A;  4FX4 A;  5BPD A;  4BXU A;  4QLC U;  1RUN A;  1UHW A;  4LLN A;  4I2O A;  2QVO A;  4A5M A;  4M9Z A;  5CVU A;  2LDU A;  5HOO A;  2DT5 A;  5H20 A;  3RKY A;  2NYX A;  4EMS A;  4EV0 A;  2L02 A;  2FF4 A;  3FHZ A;  2B0L A;  1TQP A;  3GXO A;  5D5V B;  3FXQ A;  1FYL A;  2E1C A;  4ENK A;  5EEG A;  1D3Y A;  3GFL A;  5H6Q A;  5TRD A;  5D5X B;  2P5K A;  3V7R A;  1ZG3 A;  5ILU A;  3TOB A;  2Z3Y A;  3QU3 A;  4BHC A;  3ABT A;  2GZW A;  3E5U A;  1T2K A;  2CSO A;  1KU9 A;  1LQ1 A;  1ZRF A;  3G3Z A;  1BBY A;  3E6C C;  4MGR A;  3MFK A;  4XBF A;  4P96 A;  3V8K A;  2OQR A;  3F8N A;  3C1D A;  3HTS B;  1FP1 D;  4IXA A;  3ECO A;  1FWZ A;  2YX7 A;  1K78 A;  1W7P D;  3FMR A;  2CO5 A;  1R23 A;  1FX7 A;  2CWE A;  2M30 A;  2EA4 A;  3FXU A;  5D8K B;  1U5T C;  1J5Y A;  3O6B B;  4O5V A;  2XV4 S;  4LFU A;  1RI7 A;  1S3J A;  2XRN A;  5ILV A;  1F5T A;  5FFZ A;  4KN7 X;  4WK8 F;  2G7H A;  1RZ4 A;  3P9C A;  3WTW C;  4UXN A;  3R61 A;  2RV8 A;  1LEB A;  1I1S A;  2GXB A;  4XRF A;  3FMS A;  2RC4 A;  4MTD A;  5CVJ A;  4Q48 A;  1S8N A;  1W4M A;  2A5Y B;  3EQL F;  4XSZ F;  2BGC A;  3WTV C;  1G3Y A;  5HLI A;  1XSV A;  5E8I A;  3E6D A;  1TW2 A;  2STT A;  2KKO A;  2X0L A;  2V1X A;  2JSC A;  2OZ6 A;  3OOP A;  4BYY A;  4ZYH A;  2FBH A;  5FO5 A;  3LQQ A;  5FLX K;  2ZME B;  5DCM A;  2DFI A;  4YIF A;  1WQ2 A;  2Z5U A;  4JQF A;  3L2C A;  2XGX A;  1U5T B;  3U2R A;  1OYI A;  3DPT A;  3O3K A;  2VT2 A;  4M72 A;  1SD7 A;  3SZT A;  4ZH4 F;  4WCG A;  4YII A;  1F4K A;  3MZH A;  4G8X A;  1JE8 A;  2BE5 F;  1B9M A;  1XMA A;  2J5P A;  5CJ9 A;  3DXJ F;  3F6V A;  1TQM A;  3M9A A;  2L4M A;  1B1B A;  1STZ A;  1Z9C A;  5TJJ A;  1LEA A;  1O7L A;  4CXF A;  3T5X A;  1MDM B;  4LB5 A;  2FML A;  5DUK A;  1HKQ A;  5E20 A;  1Z91 A;  3RPU A;  4KYW A;  3W6J B;  4WX9 A;  4OIQ F;  1NHA A;  4KFC A;  4I01 A;  2UXX A;  1TNT A;  1XCV A;  2HS5 A;  5L3G A;  1C0W A;  3FMQ A;  1BJA A;  1ULY A;  3C3W A;  1ZN2 A;  4R79 A;  2EWN A;  2FBK A;  5E18 F;  1R5H A;  3R60 A;  3GFI A;  3EYI A;  2O3F A;  5HDK A;  5JI6 A;  2YR2 A;  3IWF A;  3KP5 A;  2H27 A;  3ULQ B;  4AWX B;  1PDN C;  4XSX F;  4Y15 A;  2K4J A;  4L18 B;  2RDP A;  2VC0 A;  4BHB A;  3H3Z A;  3VOE A;  4WF2 A;  5HDN A;  1T98 A;  3JSP A;  1QNT A;  2QQB A;  3RPQ A;  3HOS A;  1USS A;  2HEO A;  2AS5 F;  2FOK A;  5HS8 A;  1P6R A;  1WRJ A;  2HQR A;  3ML6 A;  1LVA A;  2VBZ A;  1J7K A;  5IT3 A;  1L3L A;  1IN6 A;  2BEO A;  2XAQ A;  1WWX A;  2QQA A;  2MA3 A;  4ON0 A;  1XCB A;  2HDC A;  3HSF A;  4G6Q A;  2HQN A;  1BOA A;  1QGP A;  4S05 A;  2VOP A;  4U0V A;  4UHT A;  2EJR A;  3JAM K;  2LF7 A;  2O03 A;  4L9J A;  1XGS A;  3FWE A;  4EVI A;  1R1V A;  4M71 A;  1E17 A;  2IVM A;  4EGY A;  2EFO A;  5LBQ A;  3WGH A;  3SXY A;  4LGW A;  5E1Z B;  4MTE A;  4Z2Y A;  1O57 A;  2L54 A;  1Z6R A;  1D8J A;  2YX4 A;  3JSO A;  3V7C A;  1IN8 A;  1DP7 P;  2NNY A;  3Q9V A;  3U1D A;  5BMZ A;  1G3W A;  1IW7 F;  4ZYD A;  1G4D A;  4LJZ F;  1J0R A;  3L9F A;  1EH6 A;  2HKX A;  1IUY A;  4KT5 C;  4PCQ A;  1KYW A;  1CF7 A;  5DYM A;  2LNB A;  2R7F A;  4LG0 A;  4L5J A;  3GO5 A;  2EK5 A;  3J81 K;  1Z7U A;  1R5G A;  2HFH A;  4HYE A;  4L9N A;  5J8C A;  1Y0U A;  2W85 A;  5DCF A;  5DCM B;  4GYI A;  4HQE A;  4KIB A;  1T6S A;  1YQA A;  3KP6 A;  1IRG A;  4YFX F;  1V3F A;  2EB7 A;  3GFM A;  3WG9 A;  3HOT A;  2EFN A;  2DAO A;  1A04 A;  2L4A A;  3QPT A;  4BH9 A;  2XAH A;  3F3X A;  3BP8 A;  4BHP A;  4WXC A;  1W7P A;  2R7D A;  4LLG F;  3P7N A;  5LHG A;  5L3B A;  3RIR A;  2P6S A;  3VEP A;  1FNN A;  2L01 A;  2R3S A;  4RGU A;  3N4M A;  5BOX A;  1T39 A;  2HYF A;  2QBY A;  1KYZ A;  3KEQ A;  4CGZ A;  1IF1 A;  2H09 A;  3PQK A;  5D6E A;  2VBY A;  1LNW A;  1HSJ A;  2IJL A;  3V8L A;  1VTN C;  1P4W A;  3DFG A;  2UZK A;  3BOQ A;  2PJP A;  3JAM Z;  4P5O A;  2V9V A;  1V4R A;  4ZZD A;  3QAH A;  3V4G A;  2VT3 A;  4Y17 A;  2FRH A;  4OOI A;  1HQC A;  2XRO A;  3LAJ A;  1P4X A;  2DBB A;  1MJA A;  3CTA A;  2M1B A;  3B73 A;  4A0X A;  2ZXJ A;  3T0Y A;  2V6C A;  5IT9 Z;  3NQO A;  2XIG A;  2ELH A;  1LDD A;  3QOP A;  4GCV A;  5KVR A;  4IHT A;  2F5C A;  2OA4 A;  4AIH A;  1SD4 A;  4ESF A;  3KLN A;  2K4B A;  5LLQ A;  1K6O A;  4HX7 A;  3KE2 A;  3GWZ A;  1MD0 A;  4UNO A;  1PP7 U;  1ZH5 A;  1YW7 A;  1YG2 A;  5KK1 A;  4IHS A;  4WWC A;  3GYH X;  3J81 Z;  4ENN A;  5LGU A;  5E1X A;  1UHM A;  5CVV A;  1XN7 A;  1P2F A;  3V8J A;  2VON A;  1FC3 A;  1QQI A;  1MJ9 A;  3IC7 A;  3KZY A;  3BWG A;  3RI4 A;  3I59 A;  3R4K A;  3WTU C;  3WU1 B;  3KET A;  3E5Q A;  2E1N A;  1WSU A;  3JW4 A;  2JZY A;  2P8T A;  3DPL C;  3TQN A;  3F22 A;  3LQR A;  2XAJ A;  2O6G E;  2IA0 A;  5ICG A;  4L9T A;  3ECH A;  4KUM A;  1R7J A;  2Z99 A;  3M1E A;  4DQ2 A;  1Z6T A;  4M9S A;  4F7Z A;  1R1U A;  1GHC A;  2WTE A;  1R00 A;  2V1D A;  3IKT A;  2MBF A;  2IRF G;  3GLX A;  1YO5 C;  3FZV A;  1GXP A;  2H6C A;  4G7Z F;  4ENJ A;  3Q9S A;  5A2Q K;  1HKS A;  1IXR C;  2KJC A;  3KCC A;  2F5F A;  3DF8 A;  4RAY A;  5K1Y A;  2GA2 A;  2PBI A;  3CUQ A;  2QQ9 A;  3DP7 A;  1XGM A;  4JBA A;  1KGS A;  1BIA A;  2BYV E;  4PDK A;  1ODD A;  2JPB A;  3K1M A;  1QZY A;  4WXD A;  4I02 A;  1IXC A;  2MLK A;  3OV8 A;  2ZNY A;  5L3E A;  3ZN0 A;  2MLG A;  3I4P A;  5D6F A;  1ZRC A;  3TKY A;  2Q2E A;  4G6D A;  4A6D A;  2DK5 A;  4LG0 B;  1Q1H A;  1ZLK A;  2VBW A;  1ON2 A;  1XDS A;  5LRS A;  3H92 A;  3L00 A;  2P6T A;  3R0A A;  2QM3 A;  4LLL A;  1B9N A;  4MQV A;  2W25 A;  3HIF A;  1O3T A;  3F72 A;  1YLF A;  2ESN A;  2DQL A;  4O3M A;  1FBU A;  3QPH A;  2HWV A;  2QUF A;  1OKR A;  3KEO A;  1FSH A;  2F2E A;  3M7G A;  4RB3 C;  3TDZ C;  1O3Q A;  2CQK A;  4ZZL A;  2CYY A;  2FNA A;  3MEX A;  3WTX C;  1HKT A;  4M9X A;  2PMU A;  1MJB A;  1Z1D A;  1IXS B;  1KQ9 A;  1ONV A;  4O6J A;  2QBY B;  3QU6 A;  5CYV A;  4K2E A;  2QWW A;  1KQ0 A;  4MQ9 F;  2XAS A;  3KLO A;  4L0Z B;  1FOK A;  1RIO H;  3IRR A;  3ISP A;  1FY7 A;  3IKV A;  2NS0 A;  2ZO4 A;  3DKW A;  2IPQ X;  3ELK A;  1ZGA A;  4GXO A;  2EV0 A;  3QP6 A;  2FU4 A;  4IRI A;  2GA1 A;  4I09 A;  3F8M A;  1BIB A;  3RDI A;  4AD9 A;  3VOD A;  3GFJ A;  4IF4 A;  4HA8 A;  1FBS A;  5D5W B;  5AON A;  3M8E A;  3J80 K;  5A2Q Z;  2FMY A;  2V79 A;  3C18 A;  5E17 F;  4KNY A;  3WU0 A;  1SFX A;  2M45 A;  2P5V A;  2G9W A;  1B4A A;  1FPQ A;  3EET A;  3LA2 A;  1XD7 A;  4EGZ A;  3PQJ A;  3ZMZ A;  2GIV A;  2A07 F;  5L3F A;  2YPR A;  3JTH A;  2XUB A;  1YIO A;  2P5L C;  3IHU A;  3HYI A;  1R1T A;  4KIC A;  3BRO A;  4XLP F;  3ABU A;  5BS6 A;  4L5I A;  2FXA A;  4KA4 A;  1BI3 A;  2PG4 A;  5F64 A;  2IP2 A;  5DDG A;  1O3R A;  2KJB A;  5CLS A;  2W57 A;  2PLY A;  5BPI A;  4G94 A;  1PUE E;  3I58 A;  2HTS A;  2K7L A;  2DO7 A;  1KQ8 A;  1IN5 A;  4UVB A;  2MD5 A;  5ILS A;  1S7O A;  2W84 A;  2XVC A;  4CHU A;  3ZMD A;  2JT1 A;  2HKO A;  4HQM A;  2WC2 A;  2K27 A;  1H0M A;  1EV7 A;  1ZGJ A;  2FSW A;  4M6X A;  4G7O F;  1UST A;  1TBX A;  3I59 B;  2KIM A;  4R1H A;  5HS9 A;  3M8F A;  2ADU A;  4B09 A;  4ESB A;  3WTY C;  2K02 A;  2RN7 A;  2DTR A;  3ERE D;  4LMY A;  4OMY A;  1BC7 C;  3WTZ A;  3RYR A;  2CGP A;  1SMT A;  3TO6 A;  4IRG A;  3RJP A;  1S6L A;  2IT0 A;  1JHH A;  4OU0 A;  3TO9 A;  5FLX Z;  4WXH A;  2EV6 A;  3QRF F;  1S7A A;  3L7W A;  2D45 A;  5BQT A;  2DW4 A;  4EQQ A;  3DV8 A;  3R0J A;  1PP8 F;  3WGI A;  2ISZ A;  3KP4 A;  4YFN F;  4HAM A;  2OAZ A;  4CIC A;  2ZNZ A;  3CUQ B;  3S2W A;  3RKW A;  5F6F A;  4HX4 A;  1REP C;  2PI0 A;  4RS8 A;  1QZZ A;  2CW0 F;  2KIU A;  5L3D A;  2DI3 A;  3J80 Z;  1K78 B;  4UV8 A;  3BJA A;  1B59 A;  4ASN A;  3FX3 A;  2J5O A;  3BY6 A;  3U9G A;  2XKO A;  2FA5 A;  2FE3 A;  1OYY A;  1FT9 A;  1U78 A;  5FFX A;  4N9H A;  5HDG A;  5LEK A;  3AAF A;  3F8B A;  3KFW X;  5ERI A;  3ZQ7 A;  3E6M A;  1FZP B;  1G6N A;  3K1P A;  4HV5 A;  1U8R A;  4LK1 F;  1OMI A;  1GVJ A;  5LGT A;  3K0L A;  1RUO A;  2Z9O A;  2D1H A;  2W24 A;  1J9I A;  1ON1 A;  4FHT A;  4P9F A;  4OIN F;  1LDK B;  1ZRD A;  2OU2 A;  2DU9 A;  4A6E A;  2NNN A;  3BZ6 A;  1YS7 A;  3RKX A;  4NB5 A;  2GXG A;  3TO7 A;  4Q4Z F;  1BI0 A;  1FP2 A;  4P9U A;  2IA2 A;  1H9T A;  3N97 A;  3HRU A;  4ENM A;  3IRQ A;  2HYG D;  4OMZ A;  3EDP A;  2Z33 A;  2HZT A;  2UXN A;  3K69 A;  4HZF A;  3E3V A;  3CO6 C;  1WI9 A;  3K9T A;  4U7D A;  3H3U A;  2LKP A;  2JTV A;  1LJ9 A;  3TDU C;  2EA2 A;  2FNP A;  3B02 A;  4PGH A;  3CUO A;  3F8C A;  5D8L B;  1S29 A;  5J6X A;  2VXZ A;  1BN5 A;  1TQI A;  4UVC A;  4RGR A;  4EJW A;  4Y13 A;  1KU3 A;  3VFZ A;  1HST A;  2BV6 A;  5AIP A;  4YG2 F;  4OIR F;  5JVT A;  1MZB A;  4XLN F;  2NAZ A;  1MGT A;  5JHU A;  4IRH A;  1SAX A;  4L9V A;  3ZMV A;  4KN4 X;  4RGS A;  3TOA A;  3ROU A;  2M87 A;  4PGG A;  4NQW A;  5EEH A;  2Q0O A;  4RB1 A;  2ACJ A;  1BI1 A;  3T1B A;  1YW8 A;  1KU7 A;  1ZAR A;  2PQ8 A;  4U0W A;  2P7C B;  3EUH A;  3L09 A;  4G9Y A;  2CFX A;  4M73 A;  2EFQ A;  4ZYE A;  1W5S A;  2EFP A;  3MQ0 A;  3F23 A;  1CGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...