1Z05A

Crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
DHIKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAISRGRPAVGLQTNNLGWQFLSMRLGRGYLTIALHELGGEVLIDTKIDIHEIDQDDVLARLLFEIEEFFQTYAAQLDRVTSIAITLPGLVNSEQGIVLQMPHYNVKNLALGPEIYKATGLPVFVANDTRAWALAEKLFGHSQDVDNSVLISIHHGLGAGIVLDGRVLQGRHGNIGELGHIQIDPQGKRCHCGNYGCLETVASSQAIRDQVTARIQAGEPSCLATVEEISIEDICAAAADGDPLAVDVIQQLGRYLGAAIAIVINLFNPEKILIGGVINQAKSILYPSIEQCIREQSLPVYHQDLKLVESRFYKQATMPGAALIKQALYDGLLLMKVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator, ROK family
publication title Crystal structure of the ROK family transcriptional regulator, homolog of E.coli MLC protein.
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transcription
total genus 137
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z05A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A03
4CZHA 3MN9A 2HGCA 4JQFA 3B8AX 1OYWA 5AQOA 1H1VA 4PKHA 1SFUA 3M6GA 3WXIA 1TBXA 2HKXA 3FMSA 3DFGA 2FNPA 2NAZA 3F3XA 1GXQA 2NLXA 1FZPB 2D4WA 2Z3YA 1YVNA 3RJPA 2O0YA 3QP5A 4M63C 2XAGA 3LAPA 5AQQA 5HLHA 5LRSA 5ILUA 3JAMK 3WQUA 3QDKA 4IXCA 3QPTA 1SMTA 4U88A 4WXDA 4WQ5A 3AAQA 1G6NA 3IWZA 4LK1F 2QVOA 3WGGA 2VOPA 3J80K 5KVRA 4K2EA 2R7FA 4L9NA 2P4WA 2P5VA 1ZHFA 3H92A 3D2EB 4AWXB 4EHTA 3KP3A 2Q2EA 5AQRA 2QWOA 5L3GA 4AIKA 1O7LA 1KU2A 3EDPA 3O3KA 2GA2A 1NGDA 4A61A 2A69F 4PL7A 1IXSB 2FQ3A 1J9IA 2IA2A 1TNSA 4HV5A 2TDXA 3F22A 2V7YA 2YJFA 4H5NA 5BPLA 4PDKA 2E7WA 1BU6O 1T44A 1XDUA 2W41A 2V9VA 5BRHA 1D4XA 3FX3A 2A3ZA 3BJAA 2ISZA 1XGOA 5DYMA 4UXNA 4WXCA 4B1XB 4LG0A 4LB5A 1C0GA 3I59A 4GGGA 2R7DA 4EGYA 5TRDA 2QW9A 4LGWA 5F6FA 1OKRA 1ZREA 3LDOA 1K78B 4EV0A 1QZ5A 3ZETA 3E6MA 1FLIA 4YDUC 3RSEB 3CUQA 4ESJA 4PKIA 5FFZA 3QU6A 3E3VA 2V1DA 3WXLA 2JPBA 2VE9A 3LQQA 2K4JA 1U6ZA 5AQVA 2W85A 3MAJA 4MGRA 1ZN2A 5K5QA 4DQ8A 4KT5C 2P9UA 4XSZF 3KP5A 3P9KA 4FWLA 3H6EA 4WQ5C 3ZX3A 4HZFA 2LKPA 3K9TA 3ABUA 4BH9A 3C0BA 3PFIA 3O6BB 1K7AA 1E4GT 1I1GA 4ESBA 3L09A 5FFXA 3HSEA 2KJCA 1BM9A 2O3FA 3ENHA 1K6OA 3ULEA 3FXRA 1IRGA 1R1VA 3T0YA 2F5EA 2YU3A 1NGCA 1S22A 3BF1A 2W25A 2V51B 1GXPA 3BPVA 4Y15A 4CYDA 5B8HA 4EJUA 3GF2A 1WRJA 5AIPA 1C0WA 2E2OA 3TQNA 3EYIA 1W5SA 1HKBA 5AZIB 1PP7U 3CUQC 1OR7A 2E1ZA 3VEXA 4IWVA 3TO6A 3GZ5A 3BJOA 5LY3A 5AQKA 4CBXA 4M6YA 1B9NA 1TTYA 4P9FA 3D2FB 4UV9A 4G6QA 4UVCA 2I7PA 2Q36A 4CZGA 1ZRFA 1X3UA 4OIPF 3A8YA 4JAXA 2FBHA 2E1CA 4A5MA 3GFLA 4R79A 1NGIA 4HX8A 4JK1X 2OAZA 1U8RA 1YW8A 2RKHA 3BROA 3V8LA 2KKOA 3RTRA 3HBTA 3ENOA 1Q18A 5CVIA 1TQIA 2RDPA 3QMLA 1SFEA 4YFKF 2ZNZA 1IJJA 2P5LC 1ZGJA 4RGUA 1UCRA 3HSCA 4BC3A 3ABTA 3EL2A 2QWLA 1PP8F 2W40A 4B1UB 4UVBA 1XC3A 1S29A 1J59A 1HJOA 4EVIA 1LDKB 2H6CA 3C7NB 1DDNA 2Z33A 3R61A 3KLNA 5D6EA 1CF7B 2LSOA 3ZMVA 4FWQA 4H0OA 4MEXF 2DPNA 2K86A 2P9IB 1KQ0A 3REOA 5LJWA 5E1WA 4BC2A 3CQXA 4A0YA 5IT9Z 2J5PA 3LA7A 5E1ZB 2PG4A 4YFNF 1RIOH 1MDMB 1BUPA 3N4MA 1WSUA 1R23A 5F1XA 4ZYEA 1U2VA 4HBLA 1BI1A 2P9SA 5E26A 4EHUA 3FMQA 1R22A 3VEWA 3F21A 3H3UA 1ZRDA 1MJAA 2GQQA 4GYIA 4LLLA 2HYGD 4D0PA 3WU1B 3H1VX 2ZMEB 5BN9A 1O3SA 1MJ9A 2EV0A 1YQAA 2DI3A 5EOYA 4ISGA 3HZ6A 3QRFF 3DP7A 3DAWA 1UHWA 2Q8KA 2GXBA 5J8CA 2IVMA 1IN4A 3CQYA 1BJAA 1W7PD 4BQLA 4M9SA 4RB0A 3FXUA 3CJNA 2PAVA 1JHFA 4P9UA 2BEOA 3FGUA 4IZ9A 5DCFA 5L3BA 1MWMA 1DGKN 2FA5A 1KQ9A 3L2CA 5I9EB 3ID8A 4I02A 1GLFO 1HKQA 3K1NA 4JNEA 3UKUA 1QHAA 4HLXA 4P55A 1IUYA 3TGNA 2E2NA 3O8MA 1SMYF 3VOVA 3HM8A 1IF1A 1REPC 2ASMA 3CJ9A 1RNLA 2EWSA 4JHDA 2X4HA 1DKGD 1T6DA 1K8KB 4I01A 4MO4A 4MNUA 1D3YA 1BBYA 4CD1A 4HF0A 1XDSA 3J7AO 1LVAA 4IRGA 3RKYA 1TW3A 2QQAA 5AZJB 3M9AA 3MZHA 4H0XB 2VWBA 3GL1A 2PQ8A 5H20A 4CI6A 5DV5A 2ZKZA 1OYYA 5AFUH 2FF4A 4BRAA 3CETA 4BC4A 1UHMA 5BOXA 3HHHA 2L4MA 3JSPA 3FZHA 1P6RA 3OV8A 4AIHA 4FWKA 2M5WA 4BRIA 4AIJA 1DEJA 5HS8A 1J7KA 3KCCA 3CHWA 4M71A 4ASNA 3MN7A 2DK5A 3GFMA 3VENA 2DT5A 3CTAA 3ROUA 3HYIA 4B09A 2DK8A 2QBYA 4LLGF 5D5UB 2RN7A 4HF1A 1NLVA 5D5XB 5FD6A 5ILSA 2QQBA 1G4DA 3IC7A 1WOQA 3FWEA 2O03A 3GXOA 1U78A 2P8TA 4BHCA 3UKRB 4RCHA 1ULYA 3JAMZ 5DUIA 1R58A 2ISYA 4G7OF 5ERIA 5ED4A 4XRFA 3KP2A 4ZZDA 5AQZA 3V7RA 2PN6A 5AONA 3VB2A 4BHBA 1LNWA 3CI5A 4GY2B 3J80Z 2VCPA 4OMZA 1HKCA 3VF6A 3ZMDA 1ZH5A 3JXUA 1FP1D 5IT9K 1IG8A 4QS9A 4O3MA 1QBJA 2HEOA 1NHAA 1FX7A 1I27A 3DKWA 4KYWA 1NBWA 4K41A 2P9UB 3WXKA 5CYVA 4FWOA 4FOIA 1FBSA 1U3EM 3D0SA 1LEAA 4KFCA 2ZF5O 4KBOA 1C0FA 4GNIA 4I09A 3VF4A 1BDGA 5AQSA 2EB7A 5BN8A 3O1BA 1XCBA 3C7JA 4E1JA 1IW7F 1BC8C 3H3OB 4HDUA 4EJOA 5E1XA 5EY4A 3UB5A 3ULEB 5JVTA 4WX9A 3GLXA 4HQMA 1B4AA 4HW0A 1U5TA 3Q9VA 1R59O 5HVQC 4I0BA 4HLYA 2JSCA 2ACJA 4Z2YA 2K7LA 3T1BA 5FLXK 2XASA 1YLFA 1QQIA 1S3JA 5JFRA 3A5NC 3L6QA 2UZKA 1KU3A 1IAWA 4WXHA 1OPCA 1FYMA 4WWCA 3CLOA 3VERA 2IW5A 4MTDA 1GLCG 2L54A 2P5KA 4G94A 1E17A 3MN5A 3GO5A 1HSTA 4B1YB 2DTRA 1ZLKA 4LD5A 3F8NA 3CJ7A 2AXLA 1JCFA 2LDUA 4FWNA 2QLZA 3G3ZA 3WTUC 4B8XA 3QAHA 2QWWA 3BDDA 4PZJA 5LGTA 3QPHA 2RQPA 1IN6A 2CGJA 3GG4A 5ELZA 4GXOA 3BOQA 1WWXA 2GWJA 5AQTA 2D1KA 2MA3A 3WTVC 4IJNA 1IRFA 3ELKA 4AVPA 2Q0UA 5LEKA 1SQKA 1MWKA 2C6YA 2CH5A 2ZGYA 3A5MC 1XMKA 4OMYA 2P9LA 4BRKA 5AQFA 3SZPA 5AQMA 4G9YA 1MDUB 4JN4A 3QFUA 1U5TC 5AFUA 5DCMB 2PBDA 3D5LA 4HF2A 3HUGA 1O3TA 4CXFA 5ICEA 2BYVE 1YUWA 3LFKA 3P4IA 4YDUA 5D6FA 4ZH4F 1FY7A 2IVNA 3N97A 3BF3A 4J8FA 4OIRF 5KPZA 5EX5A 4RB1A 2G7UA 2ADUA 5LHIA 1KAZA 4LFUA 1G3WA 2D0PA 1EH8A 1ATNA 3WG9A 2QWMA 3IRQA 2LF8A 1YG2A 2FLOA 2WTEA 2YHYA 5DD4A 3K0LA 1QQNA 3I8BA 1T6SA 4QWQA 2NS0A 3I71A 3ZQ7A 3HRTA 3QBWA 2OU2A 1VTNC 3LDPA 1U2VB 3QICA 5HLIA 5D8LB 2GUPA 3MK6A 4EM1A 4FL9A 4L9JA 2D1VA 3EETA 5FB2A 3JTGA 1LJ9A 3KZBA 1IN7A 2M8EA 2QWRA 3LDNA 4O8KA 1YS7A 1KYZA 1ZLJA 5KK1A 3O5BA 2QENA 1W5TA 3F72A 3LDLA 3I0TA 4O6JA 4PCQA 2FMYA 1I5ZA 4KN4X 3VETA 1HKTA 4ZYHA 2HOEA 4EGZA 3LSTA 1F5TA 1XSVA 4OINF 5L3CA 2VBXA 4MEYF 1FBUA 1TYQA 1MKMA 1V3FA 2VN2A 1Y64A 2O61A 3H3NO 3I4PA 2WWYA 4XLPF 4KIGA 4P5OA 5AQGA 2QXLA 3QB0A 2WV0A 3ZN0A 1PUEE 1FP2A 3DWLA 5ICFA 4CGZA 2X0LA 1LQ1A 2Y75A 3UKUB 1P8ZA 4CHUA 4BGBA 3MWMA 1H0MA 1QZZA 5L3EA 3E6CC 4I6MA 2VBZA 4G6DA 2VODA 1HKSA 2MH2A 1XMAA 4L0ZB 2HYFA 3B02A 3VESA 3E97A 4NHJA 1ON2A 2FRHA 2QM1A 3FZFA 1XUPO 3WTTC 3HRMA 2HMPA 3SJHA 1ZC6A 3WEEA 3HHGA 5K5RA 5JLHA 1RUOA 2P9PA 4KDPA 2K02A 2OA4A 5D4SA 2VBYA 2NYXA 4F7ZA 2PMUA 2OBPA 3KE2A 5ICGA 3A5OC 2ZO4A 2NRHA 5LJVA 1ZXOA 2EWNA 5L3DA 3L00A 1ODDA 4N9HA 1BIAA 3SK3A 3BY6A 3RKWA 1F9NA 1NGFA 5D5WB 2PJPA 4JD2A 5FPNA 4RTFD 2HTSA 4MLHA 4ENJA 1JCGA 4XLNF 4BG8A 3IWFA 2XROA 1X3MA 1X9JA 4B9QA 1OYIA 1J5YA 4H0TB 3HOTA 4LK0F 2NNYA 2B0LA 5JICA 3FM5A 2AS5F 1JGSA 2V7ZA 3DXMA 4LMYA 3BWGA 2IRFG 4XH5A 2CWEA 3SXYA 4B1WB 5JLFA 2QZ8A 3M7GA 2VT2A 1JCEA 2MD5A 3M1EA 1W7PA 3ECOA 2YX7A 4Y0WA 3C1DA 3HTSB 3FZVA 3U9GA 4IRHA 3EYYA 4H0EA 4BRHA 4ESFA 3DXKA 2OANA 4HX7A 1IN5A 4L3QA 3KLOA 4Q47A 4FWPA 1R1TA 3QU3A 2KRFA 2ZCWA 2EA2A 3EKUA 1RZ4A 2IJLA 2XGXA 4UVAA 3DJCA 1YO5C 3I54A 2M30A 1Q1HA 1YS6A 2A5YB 4FWRA 3ZEUA 5E17F 5LLQA 2MLKA 4BXUA 1S6LA 1FC3A 1P4XA 2JRTA 3QOPA 1TUYA 4PL8A 3NQOA 1P92A 3HRUA 2QWPA 1P2FA 2IP2A 2L3DA 4IHSA 4O5FA 1ON1A 4R8HA 5ILVA 1GLEG 1XB4A 1E2XA 3L7WA 3EN9A 2G9WA 1I6XA 4Y13A 3E5XA 4KIBA 4Q48A 4RB3C 2YX4A 4CZJA 4A62A 3CO6C 2AA4A 1W4MA 4L9VA 4LB6B 1GLBG 4PKGA 3E5UA 5IT3A 3BPXA 4BQAA 3U8XA 5FD5A 1JHHA 4B1ZA 1XGNA 2QWQA 3BUZB 3TDUC 3V8KA 3RDIA 4IO8A 2A3SA 3WTXC 4OIQF 5AQUA 2P9KA 4M9ZA 3RKXA 3C18A 3E6BA 4BR4A 3R6MA 4PGGA 3FHZA 1ZAOA 2I7NA 2V1XA 2HF4A 2D45A 3KZYA 1JXSA 4QS7A 1CZAN 2YR2A 5D5VB 2KIUA 3ISPA 1LEBA 4BNCA 1F1ZA 1O7FA 1KAYA 3FF5A 1O3QA 3VGLA 3MDQA 4A6EA 4I2OA 1BOAA 3F9MA 3KP6A 3VEYA 2H3GX 5DDGA 3J81Z 1NGGA 3FLCO 2EA4A 4RAZA 3AAFA 2WUSA 3WTSC 5F0XA 3VODA 5A2QK 1DPRA 3KZZA 5HDNA 2EV6A 2KIMA 1XCVA 1LCUA 4RS8A 3LQRA 1MA9B 3SHFA 3F6VA 2A68F 2DPDA 2E1YA 4GO1A 3MEXA 1RI7A 3GW2A 4CZKA 3W6KB 3RIRA 3V7CA 5H6QA 5FLXZ 4OU0A 1H9GA 1YW9A 2P9NB 2FU4A 3T8RA 5AQPA 2P9LB 5LHGA 1GLDG 5E8IA 2FXUA 3RSEA 4WF2A 2PEXA 1LB2A 1TNTA 4N9IA 2VE8A 2FBIA 1KU7A 4NO7A 1OMIA 1EQYA 4DQ2A 3U9DA 1SAXA 2PLYA 1OKJA 1DUXC 1Z91A 3KHYA 3W6JB 2KIFA 1YAGA 5AQLA 4BRNA 4KA4A 3HTUA 4CICA 3U9ZA 5BREA 1DP7P 1BN5A 4BR9A 5LEJA 4BR2A 1Z05A 4HAMA 4I0AA 5EEHA 3HOSA 2DFIA 4P96A 2BUPA 2P6SA 4YFXF 5FO5A 2DU9A 3GEZA 1STZA 3GBTA 5DEQA 1ZG1A 4E70A 3IKVA 4CZFA 1QZ6A 4IPAA 3SZTA 1O57A 2JT1A 1B1BA 4BG9A 3HSFA 3NEUA 3HSRA 3SFZA 3M8EA 2XKOA 4BAYA 3IFRA 5LGUA 4G7HF 5D4RA 4DCHA 1P4AA 3HI0A 3LA2A 3R0AA 4M73A 4LG0B 2YSRA 3I59B 2YHWA 5KQ8A 2V79A 2FF6A 4BVOA 2P6TA 2ESNA 3ZETB 3KP7A 3CUQB 4A2BA 3D2FA 3JTHA 4EJVA 3GWZA 1NGHA 3S41A 3I53A 3QFPA 4I6MB 2DAOA 1SFXA 5JHUA 2Q2RA 4HOBA 2V1UA 4A0ZA 3EKSA 5CE3A 4WK8F 3BP8A 4OOIA 3DPLC 4IVNA 2RNJA 5ADXH 2PI0A 4FOEA 2DO7A 2HS5A 2D2WA 2H94A 3VEOA 3ZMTA 4BRCA 2P7CB 2XAHA 1BIBA 3DQVC 1XSDA 1YYVA 2GELA 4RB2C 2ETHA 4A2AA 2F9WA 2IVPA 4U7DA 2EV5A 3FZKA 2OZUA 4KICA 3MQ0A 3J81K 1B9MA 4R1HA 2GA1A 2PMHA 3BJ6A 4M6XA 6PAXA 2NRAC 4XEIA 2VBWA 2GXGA 2IPQX 2W57A 3C7NA 3ZMZA 3WQTA 1PDNC 2D0OA 4BROA 4U7BA 5J8FA 4FHTA 4BRLA 4OIOF 1XQSC 5H6RA 3WODF 2ESHA 1FSEA 2RV8A 2JPCA 3FM3A 5AQXA 1MDMA 3R9PA 3CJCA 5K5OA 5BPMA 1USSA 4M74A 4B1VA 1KAXA 2OQRA 5LRRA 1FT9A 3MCPA 2VT3A 3NRVA 1RFQA 3MCZA 1ATSA 5HDKA 5HDGA 2VC0A 4NB4A 3UE5A 2ZMEA 1HXDA 5TKYA 2PFBA 1S8NA 4EJWA 3WE2A 4EM2A 4M7XA 2DQLA 3DXJF 4BRPA 3IDHA 2QWNA 3MMVA 4ETSA 2Z9OA 4L0YB 3VEVA 1XN7A 2ZNYA 4CZZA 3F8CA 4ISFA 3Q9SA 1Z9CA 3ATUA 2L01A 5BPDA 3TOAA 2UYTA 1BO5O 4FX4A 2BTFA 3M3ZA 1FWZA 4Z94A 2A41A 3E6DA 3L9FA 3TPQA 1BA0A 4JBAA 4RGRA 4CZLA 1QGPA 3C3WA 2EFWA 3GVAA 4BRMA 5DD8A 1EH7A 1FSHA 2IT0A 1T2KA 5BS6A 2FEZA 3R4KA 1QNTA 4KNYA 4EAHD 1SD7A 5F1RA 4H5WA 2XAJA 3EUHA 1K8KA 4WQ4C 1H9TA 2ZGZA 3I64A 5AIQA 3I5UA 3E5QA 3Q5FA 2FMLA 2ELHA 5AZJA 1R5GA 1Z6RA 2ZXJA 2FSKA 4M9XA 1QQMA 1SAZA 3WE3A 1G99A 2P9KB 2ASOA 4UHTA 4EJTA 2P7VB 2HTJA 2ZWHA 4M7YA 3QP6A 1AOYA 2P9SB 3VGMA 2A6HF 4A0XA 3KEOA 5TJJA 1TQMA 4U0WA 3WU0A 4XSXF 2AP1A 3WT0A 1Z7UA 4GYGA 4CZMA 1WI9A 2M45A 1MD0A 1ZBSA 2GTDA 3ML6A 2G7HA 2HKOA 4RGXA 4FPAA 2FF3B 1HLUA 2K4BA 2YCHA 5K1YA 4ENMA 2Y48A 5FGMA 2H6BA 3COAC 1GHCA 1SD6A 2FSJA 1NGAA 1F4KA 4LC9B 3LL3A 4ON0A 2FSNA 2ZFWA 1QO0D 2CFXA 1EV7A 3GYHX 5F2RA 2HWVA 3MFKA 2CQKA 4LJZF 3F8FA 2MC3A 4IHTA 1R1UA 2GEMA 3F6OA 1AWCA 5ADXA 3UKRA 1JE8A 4BRDA 1S3XA 1K79A 5CLSA 1J75A 3H45C 4I7HA 1FYKA 4BR7A 4ZYGA 1BWFO 3V7SA 4H0VB 1ONVA 3P9IA 4G8XA 4JHDB 3CDHA 5F64A 3BEXA 3HIFA 1TUUA 3GE1A 1A04A 3CERA 2WC2A 4EIAA 3SQNA 2A6EF 4BQZA 4CO8A 2YPRA 1BG3A 4BREA 3GDQA 2LF7A 1QZYA 5AQJA 1ESVA 2IA0A 2XUBA 1SD4A 4FO0A 1HQCA 5E8GA 5BPIA 3P7NA 5A2QZ 2CGKA 2HQRA 4NB5A 4MQ9F 1IN8A 1RGIA 4G7ZF 5HOOA 3VOEA 3ZN1A 5BQTA 2CO5A 1HPMA 5D8KB 4MO5A 3CUOA 5CVRA 4BR5A 3LWFA 4MLEA 4RWTA 5ICCA 4XH1A 1NM1A 1V4SA 5LGNA 3TKYA 3R8EA 4FPBA 2JTVA 4IXAA 4HTLA 1KQ8A 4CZIA 2MH9A 3H46O 2JZYA 3IL2A 1TW2A 3ZP5A 2GZWA 1YFHA 1Z6TA 3U4LA 1XSXA 2VC1A 3PQKA 3RYPA 5CJ9A 3JSOA 2GWRA 2QBYB 4KUMA 3S2WA 5E18F 4IRIA 4H5TA 4CDGA 1NGBA 1T0FA 3WTWC 4FWMA 4Q4ZF 3BZ6A 3DV8A 1TQPA 2FE3A 4PGHA 1XGSA 2GAUA 2KJBA 2W84A 1IXRC 1KYWA 2RVCA 2J5OA 3GZ6A 2CGPA 2YJEA 4H5VA 4KN7X 1P4WA 5EXWA 3ATVA 1RDWX 4XBFA 1HUXA 2LNBA 3RPUA 2XKPA 4EFHA 1KU9A 1USTA 3O2PE 4BYYA 2E20A 2XV4S 4KIFA 3OHRA 4FT8A 3GFJA 1GLAG 1FOKA 5AR0A 3F23A 3TOBA 1NGEA 1KA8A 3CJAA 2V52B 1S7AA 3IUCA 1EH6A 4AM6A 3O80A 1O3RA 4CD3A 3O08A 3FE1A 2RGVA 2H27A 2BBYA 1G3TA 5CVUA 3R0JA 4F9OA 4HV6A 4HYEA 1MJBA 2BV6A 2YI1A 2D1HA 3F8BA 3IRRA 3FXQA 3O1WA 3HTVA 2Y0MA 2ZBKA 1HX1A 1V4TA 5J6XA 2Q97A 3AARA 5LBQA 5HS7A 2F9TA 1RUNA 2XAFA 1MZBA 3CIPA 2ASPA 2ZJ2A 5DCMA 1UB9A 4RGSA 4K42A 2VXZA 3ULQB 2FSWA 4BR0A 1FBQA 1FYLA 1U5TB 1J6ZA 1UFMA 4N0BA 4K43A 2EJRA 2OD5A 1J0RA 1R5HA 2E88A 4WYBA 1HBXG 2F5CA 5KQDA 3FZMA 4BRQA 1GLJO 4HQEA 4QS8A 3RYRA 3FMRA 3WUHA 4MHGA 1T38A 2H09A 4UNOA 4RAYA 3D2EA 2HZTA 2CSOA 1S7OA 2EFOA 3KP4A 1SZ2A 2GWKA 1ZARA 1NGJA 5AQNA 3K69A 3TU5A 1BC7C 2QM3A 4L5JA 5EVZA 4LLNA 1U2WA 1KGSA 2CW0F 3WXJA 1YIOA 4ISEA 3LAJA 4BC5A 3MZYA 2CYYA 5BPNA 1GVJA 4ZZLA 4DHYA 3V8JA 4HDVA 3CJBA 4CBUA 2UXNA 1L0OC 1BOTO 1XD7A 1K78A 3F8MA 2E2QA 3ZMSA 4FSVA 3U2RA 2A6AA 2HR3A 2BE5F 2VYPA 3L0QA 3G25A 5JMVA 3JW4A 4FX0A 4UUVA 5AQHA 1T98A 1J2XA 1LDDA 3J8AA 2PBIA 2XHKA 4QLCU 1IZ1A 2FOKA 2HF3A 3T5XA 4S05A 1QQOA 4K25A 2UXXA 3T8TA 3GX4X 3DEUA 4HWIA 2A42A 2YHXA 5E84A 5AQWA 1XGMA 3SLCA 4KMUX 2MBFA 2CH6A 1HW5A 1R36A 5LHHA 1LOTB 1FPQA 3OOPA 3O4WA 2DW4A 4HA8A 2HQNA 3TDZC 2XRNA 3K2ZA 2F5DA 3LM2A 1T39A 5KPRA 1ZRCA 5FPEA 1MGTA 4U0VA 4UV8A 4FWSA 3L4IA 3K1PA 3R6SA 4A2UA 4AM7A 3RI4A 1HW1A 2A5XA 2F2EA 1R00A 3JS6A 4YG2F 3WTZA 3EO3A 4TV7A 1G3YA 4WCGA 2VONA 2M87A 3G73A 4A6DA 1LDJA 4EQQA 2DBBA 4ENKA 3GOIA 2BGCA 2NNNA 5BMZA 4L9TA 2O6GE 3O6WA 4ENNA 1KXPA 3VF2A 1NWKA 1WQ2A 2EFQA 4Y17A 1TYQB 3WTYC 3KETA 3B73A 2GIVA 2A40A 5AZIA 1L3LA 2EFPA 1YXQA 3SMPA 3I33A 1HSJA 3ZMUA 1ZG5A 2FXAA 3LA3A 5BRFA 4AD9A 3K1MA 4O5VA 2E8AA 2IIRA 2Q0RA 2Z99A 2OQGA 5E20A 1G3SA 1T6CA 4C23A 2HDCA 1BI0A 4BHPA 3KFWX 4H0YB 3A0IX 2DPUA 4DNCA 5DUKA 2FNAA 3WGIA 3EZWA 2R3SA 4IF4A 2STWA 2K27A 5L3FA 2QUFA 3R60A 1IXCA 3DPTA 3ZX2A 2Z5UA 2RC4A 3I58A 4HX4A 2DLLA 4I98B 2E2PA 1BI3A 3GUDA 2XVCA 3A5LC 1HKGA 4A12A 3CJ1A 1NMDA 3ERED 2NZTA 1R7JA 2FBKA 3FFKB 2OZ6A 4M72A 2L02A 3WEEB 1D8KA 2VOOA 2IVOA 2E1NA 2P9PB 2COMA 1Z1DA 4A5NA 4CZEA 3CO7C 2O8XA 4NQWA 1WKMA 2M1BA 1FNNA 5HLGA 1YW7A 1SD5A 3H3ZA 4YIIA 4L18B 2XIGA 5HS9A 1GLLO 3V4GA 3GFIA 4JD2B 5BRDA 3P9CA 4BGAA 1YTYA 3PQJA 3VGKA 5AQIA 1ZYRF 1CF7A 2CGLA 2CG4A 3ECHA 3KEQA 4Q5SF 2P9IA 1D8JA 5FPMA 5FPDA 3DXMB 4IJAA 1I1SA 1D5VA 4WQ4A 4YIFA 2EFNA 1W7PB 2STTA 4EMSA 1Y0UA 3VPZA 2Q31A 1QPMA 2HFHA 4DB3A 1ZGAA 1B59A 2DQRA 4MTEA 5EEGA 3FZLA 3W3DA 3AAPA 2ITMA 5CVVA 2Q0OA 2W24A 1U6GA 2A07F 3KVGA 1B6AA 4BRGA 3DXKB 4GCVA 5BR9A 3EQLF 1V4RA 3LM9A 4L5IA 2Q1NA 4H0PA 3VEZA 1HW2A 5JI6A 1ATRA 2J4RA 4BVPA 2QYOA 3WGHA 4S04A 3TO9A 1DPUA 3M1FA 4XH4A 1E4FT 1X3NA 4BRFA 2A61A 1ZG3A 4KMFA 3ZX0A 2MLGA 2XAQA 4CJ7A 3DF8A 5AQYA 3VFZA 4CBWA 4EM0B 3AY9A 2QQ9A 3ZEUB 3MN6A 5CVJA 1CGPA 3SMSA 4U0YA 2UWMA 3H1QA 3IKTA 2IA1A 2EK5A 2F5FA 4H5RA 1WUAA 2V6CA 3TO7A 4H03B 3LDQA 1BA1A 3FR0A 3IMXA 3U1DA 5KPTA 2E7XA 2KHOA 3IHUA 3RPQA 4MQVA 2L4AA 3QBXA 3HRSA 5JR3A 1BI2A 1TLHB 4ZYDA 3D7EO 3M8FA 2P9NA 3W0LA 3ZPLA 3VEPA
chains in the Genus database with same CATH superfamily
4CZHA 3MN9A 4JQFA 1VQ9I 2HVQA 3KKSA 1OYWA 2E35A 4DTUA 4CK2A 3CC4N 2UUZA 3FMSA 4I9LA 1RDDA 1ETWA 5AQQA 3JAMK 4IXCA 3QPTA 1NNEA 3HOUJ 4WQ5A 1G6NA 2VOPA 3J80K 1KQSM 1HPZA 2P5VA 3HOWJ 4XRSG 4M3FA 2LBFA 2Q2EA 5L3GA 2AO9A 4J19A 2CRGA 3EDPA 4OAYA 3TAMA 2R7RA 1NGDA 4A61A 2A69F 4PL7A 2FQ3A 4I6ZA 1J9IA 2YJFA 4PDKA 1T44A 1HMVA 3HPGA 2KTQA 2ISZA 3RMAA 5DYMA 4LG0A 1C0GA 2K3PA 1OCCH 4C30A 4U67L 1ZBFA 4RW6A 1WH5A 4AHRA 1FLIA 4YDUC 3IAS2 1W0TA 2V1DA 2MC4A 2VE9A 2IAJA 2W85A 5A2QO 3MAJA 5KCMA 4OLBA 4M3YA 1T95A 4IOAF 3AO2A 2NRRA 4FWLA 3ZX3A 4YEJA 3S14J 4II2A 2CQXA 2LKPA 3ABUA 3KK7A 3QERA 1I1GA 4A3CJ 1MNMC 1X1CA 5FFXA 2PY5A 2XPWA 3WU2C 2JQ7A 4QIWN 1NGCA 3IG1A 1S22A 3BF1A 1QHTA 2W25A 4YRVA 3IAM2 1GXPA 1QQCA 4DV6K 4CIGA 3SPZA 4CYDA 5AIPA 3EYIA 2FD5A 5AZIB 3UIQA 5AJ3K 4IWVA 3TO6A 2XSDC 3GZ5A 1WJEA 4C2UA 1T03A 5M1PA 2R4GA 4UV9A 1ZRFA 1XNRK 1LAWA 2FBHA 2E1CA 2F7TA 2WY7Q 1K83J 1P7IA 3K9KA 3GFLA 1NK0A 1VQLI 4R79A 2RKHA 3HL2A 4Z4EA 2KKOA 1ETVA 2X6OA 4UUSA 1TQIA 1SFEA 4IHWA 3HK2A 2JWLA 1ZGJA 1VQ8N 4KI6A 1RESA 3B6PA 3BT9A 3LSHA 4B1UB 4KHSA 4UVBA 1XC3A 1J59A 3AVHA 2Z33A 4M3BA 4RW8A 1D8YA 1WHUA 1P9QC 3ZMVA 3A01A 1WJCA 1KQ0A 3REOA 1FIPA 5LJWA 2WOMA 5E1WA 4A0YA 5IT9Z 2XB5A 1RIOH 1OCRH 1BI1A 2P9SA 1JUSA 4EHUA 1O13A 3VEWA 2GQQA 5HODA 3GTOJ 2MW8A 1A5JA 4RG8A 1MH4A 3CMMA 3HZ6A 3QRFF 3DP7A 4A57A 1UHWA 2Q8KA 4DYQA 1IV0A 2GXBA 4B9VA 1BJAA 3FXUA 3CJNA 4BWJA 4P9UA 4ELVA 3K9JA 3ID8A 3OYEA 4XOTA 1A5XA 3UKUA 3RMBA 5F0HA 1MMSA 2YS9A 1RTIA 2YKMA 1VQPI 4B9NA 4YORA 3VOVA 3EZ5A 1IF1A 1RNLA 3QODA 1IRXA 2B7EA 4B8AB 1XDSA 5B1BH 4DSJA 2PYLA 2VB6A 3RKYA 3CCEN 5AZJB 3M9AA 2MYSA 1WJAA 4FJKA 2DMNA 1OYYA 1RCHA 1UHMA 3MAQA 3KYDB 2WB1A 3SZ2A 3OSGA 4CESA 3CHWA 4PSXA 4ASNA 2DK5A 3AG1H 3VQBA 2IS4A 3ROUA 3HYIA 4FYDA 2DK8A 2QBYA 1JLCA 4LLGF 3RTVA 5D5UB 3M8PA 3EUAA 5K7ZA 1ASWA 5D5XB 2QQBA 1G4DA 3IC7A 2K85A 2QSHX 1U78A 4M3TA 4RCHA 4FLVA 4WCEL 2VQFK 2ISYA 5ED4A 3KP2A 3BGRA 3ZGKA 5AONA 4GY2B 4BHBA 1LNWA 4RAFA 4OMZA 4KH4A 3DKXA 1FP1D 2L7KA 3IUOA 1I27A 4CHOA 1RTJA 4KYWA 1WH7A 4ABZA 1U48A 2O5RA 3VSKA 1ETYA 3VQCA 1OJLA 1TKZA 4KFCA 4E3SA 4GNIA 3OL4A 3VF4A 2EB7A 5BN8A 3THVA 2L9VA 1HQUA 4B3AA 2A6TA 4HDUA 1CQTA 3CCQI 5E1XA 2ZJRL 4WX9A 1MMAA 4DMNA 3GLXA 3AVKA 1B4AA 3OYAA 4F91B 2Z1HA 1U5TA 5JLXA 3HPOA 3QPSA 4CF1A 1Q9YA 1R59O 3G1LA 3G1OA 2JSCA 4A3MJ 4Z2YA 3VQ7A 4QPQA 1YLFA 5HLTA 3BR0A 3A5NC 3AVGA 3L6QA 1KU3A 1OPCA 3MCAB 3VERA 1IH7A 2IW5A 1GOCA 2L54A 1GLCG 2RHKA 4CGHA 1E17A 2VQGA 1NH3A 3F8NA 1PUFB 2AXLA 4A5AA 2LDUA 4FWNA 4KHPK 3BR2A 3CYMA 2RQPA 1FXXA 5AQTA 2D1KA 2XRIA 3ZQIA 1UELB 1NK9A 1IRFA 5K7FA 2Q0UA 1SQKA 2CH5A 3A5MC 1XMKA 2P9LA 5K14A 4J2AA 5TKWA 5H2FC 3SZPA 3ZSZA 5AQMA 1XTAA 5DCMB 2PBDA 3HYFA 1O3TA 4CXFA 3LFKA 3OS2A 4YDUA 3LL7A 3Q7CA 5IP7J 3N97A 3MZ8A 3BF3A 5KPZA 4NLBA 1N75A 3ZT0A 1EH8A 3WG9A 4CJPA 4XLCA 3W2AA 1MBKA 2FLOA 2YHYA 1PJRA 1TC3C 3I71A 4DTJA 3ZQ7A 3HRTA 2UXBK 4XLHA 4G9ZA 4LF6K 3O5BA 2E34A 2R5YB 3F72A 3I0TA 4O6JA 5F27A 2D0CA 1HKTA 1TK8A 2HXOA 2QKLB 1XSVA 4DUYK 5L3CA 1N36K 4B3MK 1TYQA 1FBUA 3CCYA 1MKMA 2OZSA 3X2QH 4N76A 2WWYA 1W2BM 4P5OA 3ZN0A 1FP2A 1WSIA 2QCOA 2BE2A 3K5LA 2Y75A 2LY9A 4CHUA 3SUQA 4I6MA 2W00A 2VBZA 4Z4IA 3G0ZA 1HKSA 1XMAA 2DJIA 5GPAA 1QPIA 3VESA 3TAGA 4Q5VA 4NHJA 4I2QA 1ON2A 2FRHA 3BG7A 1ZBHA 3OYGA 4MDAA 5IP9J 4II3A 1ZC6A 3WEEA 3HHGA 1JLEA 4E1MA 2K02A 2W1OA 5D4SA 3OYIA 2NYXA 4F7ZA 2PMUA 2OBPA 3A5OC 2NRHA 5GIOA 3L00A 3VWBA 1ODDA 1Q8IA 2HTSA 1QE1A 4MLHA 4ENJA 4EZ6A 3NGZA 3IWFA 4F2RA 2XROA 1X3MA 1TKDA 1J5YA 4LK0F 2NNYA 5C15A 4JKDA 5M5WJ 4B1WB 3M7GA 3PY8A 4Y0WA 3ZOBA 3HTSB 1EETA 1K73O 3KEYA 4B47A 4H0EA 4AIDA 1I39A 4GW6A 2Y30A 4HX7A 1IN5A 3S2DJ 3CP2A 3F2KA 1BCMA 4Q47A 3QU3A 2ITGA 1RETA 4X1EA 2ZCWA 3EKUA 3I54A 2UUAK 1YS6A 3C2GA 2P1JA 1WVRA 2E36A 1TZLA 2MLKA 1G8XA 1S6LA 3K7AJ 4BXUA 4PL8A 3NQOA 1T33A 2L0KA 1P92A 3ZQGA 3QIPA 2QWPA 3LSPA 2VQEK 2IP2A 3DLBA 4O5FA 5KTQA 3JSMA 1GLEG 3AVJA 2DA5A 4CJQA 4KIBA 3SJMA 4QTRA 1RR8C 3CO6C 4FE4A 1IKVA 4KISA 2KP6A 1RBTA 3MEGA 4CCLA 2D0BA 4BQAA 1T0FC 3BUZB 3K2PA 3PSIA 2UXCK 2A3SA 4OIQF 3ZT2A 2K9LA 3MN2A 5EGOB 2A1SA 1HNXK 3HO1A 3C18A 4BR4A 4FJHA 4CCJA 4PJNA 1ZAOA 2V1XA 2W6LA 4Y3OA 1BI4A 1JXSA 2KIUA 3ISPA 1LEBA 1IJWC 4BXXJ 5GTIC 4A6EA 1LW2A 5FLVA 1OISA 1FK9A 2EIMH 2H3GX 3G4SN 5DDGA 3LFUA 3J81Z 1BA5A 1NGGA 3FLCO 2EA4A 1E0EA 3H9QA 3GBGA 2KIMA 3V9UA 4RS8A 3OA9A 4UB6C 1TL3A 4DFPA 3T7ZA 3SQ2A 1FOYA 1REVA 3CC7N 2PEXA 2XF7A 5FKLA 4CJ5A 1ACIA 3A02A 5GAHJ 4IX7A 3F9KA 2FBIA 3TL4X 1SAXA 4XKVA 3W6JB 2OYQA 5AQLA 2KKZA 3HTUA 1BIUA 4DZJA 2IGKA 3ABMH 4JKAA 2VJ4A 3NVKA 4HAMA 1DU6A 2BUPA 2P6SA 2VQCA 3ULDA 1J5EK 3DLGA 1EWQA 1N33K 5DEQA 4E70A 5EYRA 2GOMA 3HSRA 3TTFA 5EZGA 1JLAA 4DCHA 5D4RA 3LA2A 9ANTA 2FF6A 4M3WA 4PK4A 4PJLA 1NK7A 3ZETB 3KP7A 1DLOA 2VG6A 4A2BA 4HVJA 3JTHA 1F21A 3I53A 3T1YK 2ID6A 2DAOA 5JHUA 2HHUA 2IC3A 2HSTA 4CW7B 3E9PA 2HS5A 2KFZA 1IKXA 2P7CB 1XSDA 1YHQN 4RB2C 5HROA 4A2AA 2IVPA 1NG7A 3FZKA 2OZUA 4KICA 3MQ0A 2NVYJ 2W7NA 1B9MA 2GA1A 2IGNA 4M6XA 3ZSWA 2BGGA 2IPQX 1Q7YO 2W57A 4LOCA 3ZMZA 2D0OA 4XIDA 1VF9A 4CECA 1EA3A 2WFBA 4FHTA 4N5SA 3TARA 5H6RA 3D5SC 1VQMI 1FSEA 2RV8A 3K57A 5M1OA 5AQXA 3QYEA 3PLAA 3CJCA 4M74A 3HOXJ 5LRRA 2VQLA 4DZPA 4B3SK 2VC0A 1VQKN 2VKHA 2QWNA 2OCCH 5F04A 1XN7A 2ZNYA 2R0QC 3F8CA 4BQQA 1Z9CA 3MXMA 3ATUA 5BPDA 2DT7B 3C2HA 2UYTA 4IG0A 4CJSA 2Z16A 4D1QA 4KHYA 2FUG2 2Y1IA 2IXSA 3AVBA 3TPQA 4JBAA 3QESA 2ZJQF 3CXCM 4WFBL 1EH7A 1JXBA 3K5OA 4JYAK 1T2KA 1VQ4I 2O8BB 3RRGA 1H9TA 1A5VA 3QEIA 5AIQA 4KRFA 4DBQA 4Z4GA 1KONA 2FMLA 1XHZA 1VQ5N 5AZJA 1Z6RA 4M9XA 1SAZA 4CUGA 4UHTA 5F0FA 3QP6A 4UY8O 2A6HF 3E0JB 1NG6A 3BLYA 2E2JJ 4U0WA 3WU0A 3WT0A 1Z7UA 4CZMA 3TAFA 3K59A 1WI9A 3ZSQA 2GTDA 3ML6A 1SANA 4CF9A 3P39A 1TGOA 3WNFA 2EZLA 2M7AA 3MMYB 4WFAL 1N6QA 4FLYA 1J5OA 3LPUA 2HWVA 3MFKA 2CQKA 3F8FA 1R1UA 3PX4A 5ADXA 1VQKI 2WBMA 2XF6A 4ZHRA 2PMZA 2X6WA 1T08B 3M8SA 3EUHC 4EATA 1K79A 1Z26A 1J75A 3SUPA 4FM2A 4BR7A 1BWFO 3KKRA 3P9IA 1L3VA 3L8BA 2R5ZB 1OCZH 3HIFA 4FJGA 3B6AA 4N4OB 4KREA 3GDQA 2LF7A 1Y56A 2DA3A 2XUBA 5EU7A 5A2QZ 2HQRA 4JX4A 4G12A 1RGIA 5HOOA 5BQTA 5D8KB 2GUIA 4MO5A 1MNDA 2JMWA 4B1RA 1WSJA 3K4NA 5LGNA 4IDHA 2EBIA 2HU9A 2HPIA 3H46O 3VN5A 4NUBA 1P7JA 2P5OA 1Z6TA 2VC1A 3PQKA 4F8RA 5CJ9A 3A0HC 5DM6F 4AM3A 5FDLA 1T0FA 2E4LA 5KI6A 1K6YA 4BJ5C 1X2MA 2M0CA 1Z25A 3GZ6A 5GTHC 2YJEA 4XBFA 1W0UA 3L2UA 4FLZA 1DU0A 2KDZA 2XV4S 3CM6A 4FT8A 3GFJA 3ZRGA 2ZC2A 1X4OA 5HLFA 1PUFA 3RKQA 3TOBA 1MBEA 2ELJA 1EH6A 4ANJA 4R5PA 4DQSA 1O3RA 3FE1A 1XNQK 5CVUA 1B8IB 2GM4A 4CJWA 2XGEA 1RBRA 3KJVA 2D0AA 1WN7A 1V4TA 4NC7A 4DTXA 2R7ZJ 1T3VA 3H3VK 3AO5A 1OH8A 3ERMA 2ASPA 1ZR4A 5DCMA 1EF4A 4K42A 2FSWA 1FBQA 2XO7A 4KHNA 4K43A 2EJRA 4DR4K 2OD5A 1J0RA 2HMIA 1S9EA 4K8XA 4BRQA 4HQEA 3ZCOA 1NTCA 1JLGA 1ZTRA 3NAEA 4UNOA 3SCXA 3D2EA 1TKTA 1KTQA 2HZTA 3KP4A 1SZ2A 1UA0A 2R5YA 5EVZA 3OIQA 1U2WA 4A69C 4ISEA 5B1AH 3H0GJ 3SV3A 1V5EA 3MX2A 3CMAI 4HDVA 2V9PA 2HHSA 1L0OC 4ID1A 1Q82O 1B9DA 2OC6A 4KH5A 2FBYA 4C3HJ 4FSVA 2A6AA 3PNVA 2VYPA 4UUVA 1RTDA 3HUGB 2PBIA 3OYNA 2HF3A 1HNZK 1QQOA 1UZCA 4K25A 4N47A 4D5CA 3T8TA 3DEUA 3GTLJ 3KLIA 2R7SA 2Y9ZA 3SLCA 4KMUX 2WTUA 2CH6A 3I0RA 1JTXA 2JA6J 1R36A 4CFBA 4PUOA 1LE8B 2XRNA 3K2ZA 5FPEA 4I7FA 2XRLA 4MLOA 4FWSA 4DR1K 3L4IA 2O4IA 1VSDA 4F2SA 2CU7A 3WNHA 3NCIA 3WTZA 4TV7A 2M87A 3LALA 3T1HK 4EQQA 2DBBA 4ENKA 2DTZA 2ZJPL 4C8NA 4B9UA 2BGCA 2O6GE 4L9TA 4ENNA 4AYBN 4GVEA 3VF2A 1WQ2A 2EFQA 1UHSA 3KETA 1YIJI 3B73A 2EFPA 1YXQA 3I33A 4O5VA 2Q0RA 2IIRA 4E7LA 4C1NK 1G3SA 4C23A 2HDCA 3KFWX 1FJLA 3A0IX 4D9JA 2ZQBA 2PZSA 2K27A 3CCLI 3S3OA 3D45A 3GUDA 1HKGA 1NMDA 3FFKB 2HNHA 1S1VA 2O8KA 2L9SA 2NRZA 3O9UA 3OL3A 4CZEA 3CO7C 2R92J 2O8XA 5HLGA 4YIIA 4L18B 2XIGA 4NCAA 1YVUA 3V4GA 1JL2A 3EUKL 1C0UA 3V1OA 4LFBK 3P9CA 4V19K 4BGAA 2DMQA 4WF9L 3PQJA 3HL8A 1ZYRF 1RDBA 2XY6A 3KEQA 4Q5SF 5FPDA 1EX4A 1GVDA 1IG7A 3HDDA 2STTA 1QPMA 2HFHA 4M3UA 1BCOA 3AAPA 1WJ5A 2BOLA 3DXKB 4DFJA 1D9FA 4GCVA 3MKWB 2O4GA 3VEZA 4FM0A 4H4KC 4FW2A 2J4RA 3WGHA 4S04A 3TP0A 2MLGA 2CMPA 3CF5L 1W7AA 1ZBUA 3ZEUB 3NF7A 1VSMA 5F08A 4DSLA 4U0YA 3JRFA 3H1QA 2IA1A 3RPQA 2KMUA 2L4AA 3QBXA 3HRSA 3QNNA 5JR3A 2OPQA 2VPLA 3SDGA 3QEXA 3NH0A 4FISA 3BTCA 3ZPLA 1X1PA 5M5YJ 3KWGA 4M42A 3B8AX 1MBGA 3G71N 4PKHA 3M6GA 1JT0A 3DFGA 2FNPA 3HPHA 3CCSN 2NAZA 1XHXA 3AV9A 2NLXA 1FZPB 2D4WA 4FJ5A 4M63C 1S1UA 3KK2A 2COBA 5HLHA 5LRSA 3WQUA 1F36A 1LFPA 1L3SA 2W4SA 1FMVA 4U88A 4WXDA 2OUMA 3AAQA 3AVNA 5KVRA 2R7FA 2QF7A 2P4WA 4JEPA 4AWXB 4EHTA 1SFOJ 3CESA 2YU9J 4AIKA 3DLKA 4BY1J 1KU2A 3O3KA 2GA2A 3ABLH 5B3SH 2E7WA 1BU6O 1C1BA 2W41A 5BRHA 3FX3A 3BJAA 3O8HA 1S9HA 4BBRJ 3DLRA 4EGYA 5HRPA 3GCMA 1V55H 5TRDA 2QW9A 2CW8A 1ZREA 2HOSA 1K78B 3ZYYX 3ZETA 3PIPF 3AG2H 4NCGA 3TEDA 3E9OA 1R4NB 3QU6A 3E3VA 5C4JJ 3RMDA 2R7QA 2K4JA 4Y1CA 1ZN2A 2PFUA 3VA3A 3G1MA 1YX5A 2LFBA 4HZFA 3K9TA 4XMYA 4NXNK 1E4GT 3D6RA 4LD0A 1AKHB 3G71I 4ESBA 4M3GA 1CXUA 2KJCA 1BM9A 2O3FA 2KFNA 3ENHA 3P31A 4JS4A 1FMWA 3FXRA 3FXLA 3RSNA 2VIXA 2F5EA 2YU3A 2QTDA 4DKWA 2VGMA 3G2BA 2BHYA 2YNHA 1V5FA 2M4GA 1WRJA 3CUQC 1D0XA 1BW6A 3VEXA 5LY3A 3LAKA 2CQQA 4E7ZA 3KIOA 3D2FB 4DTOA 2Q36A 2I7PA 4CZGA 1X3UA 3JCUC 2OAZA 1QTMA 4HCCA 4PA1A 3MEDA 2DFHA 4CJLA 1ASVA 3ENOA 1Q18A 5CVIA 4CCHA 3QMLA 4CJ4A 2ZNZA 1IJJA 2O8FB 2P5LC 3QO9A 4DR5K 1HJOA 1LDKB 2H6CA 3U3GA 3KLNA 3LSIA 2LSOA 1S1TA 3EPZA 4FWQA 1OR7C 3C6HA 2BY0A 5E3OA 2P9IB 1L5UA 3CPWM 4CYCB 4BC2A 1EO1A 3LA7A 4FK0A 2PG4A 4YFNF 1BUPA 3N4MA 1YJNI 2Y31A 3TW7A 1U2VA 4HBLA 1RBVA 2NS7A 3H3UA 3J7ZI 2LTPA 1ZRDA 2X85A 4LIUA 1OVYA 3M8RA 4LLLA 4H8KA 2LD5A 5BN9A 2HNYA 1BHLA 3HXLA 2P0WA 2EV0A 2LP0A 1N77A 2HNDA 2HB5A 2KQ2A 5J8CA 4O4GA 1WSFA 1W7PD 4M9SA 1JHFA 3DLHA 2CH0A 3CC2I 2ZB9A 5L3BA 1MWMA 1L3TA 1KQ9A 1Z67A 4I02A 1XS9A 3EY1A 4OKEA 3LNQA 3AVAA 2E2NA 4CGFA 2RAEA 3DTIA 1REPC 4A3FJ 2EWSA 2R5ZA 3KWIA 1T6DA 4LSLA 1LVAA 1BL0A 2VWBA 3GL1A 2F4VK 2PQ8A 1OCPA 4CI6A 1J53A 4LFCK 2ZKZA 1WSHA 2FF4A 3CETA 5BOXA 3OIPA 3HHHA 3QYFA 3JSPA 3FZHA 3OV8A 1YTAA 4AIJA 3E9LA 3PJRA 1NKCA 2VG7A 1NJXA 2P5GA 3S32A 4ITVA 2DT5A 3PNTA 4B09A 3S2HJ 1Y1VJ 3A4CA 5HRSA 4PSWA 1NK4A 4HF1A 5ILSA 1JT6A 3QPLA 3S93A 3PO5A 4DG1A 5C44J 4FXDA 1R58A 5ERIA 4HPQA 4ZZDA 5AQZA 3VB2A 3CI5A 1D1BA 1HKCA 4A3KJ 3DYAA 3ZMDA 1ZH5A 3JXUA 4DFKA 4QS9A 2VKDA 1QBJA 5HBMA 1NHAA 3C65A 5GAGP 3WXKA 4FWOA 1JTYA 4FOIA 3OR1C 3E1SA 1B8IA 4E7KA 2OTJN 2HBMA 1FBSA 4B4CA 1U3EM 3D0SA 1JLBA 1C0FA 2Y0SN 3OYKA 4I09A 1RDUA 1BDGA 4RW4A 3K0SA 3O1BA 4E1JA 1IW7F 1BC8C 3AA4A 3UB5A 5JVTA 3KYCB 4CGGA 3SFIA 4V2FA 2PYJA 2ACJA 2K7LA 4OVLA 3GMEA 5KAFC 3K4LA 1IAWA 4WXHA 1X9SA 1J54A 4G94A 3MN5A 2XGDA 2DTRA 4XRSA 3K70D 4CE9A 2WY8Q 3K58A 2L9RA 1GOAA 1S9GA 2UXDK 2MSYA 3WTUC 1Y97A 4B8XA 3QAHA 3O3HA 3QPHA 2ICWG 2X9DA 3BOQA 5B66C 2MA3A 4B3OA 4UUSB 1BQMA 3HSTB 2ZGYA 4BE0A 3Q0VA 4PY5A 4G9YA 2LLKA 1MSEC 5AFUA 4HF2A 3HUGA 4W5NA 1GDTA 1W36D 3HXMA 1YUWA 3P4IA 4CEAA 1XMQK 2IVNA 4OIRF 4G1QA 4RB1A 2G8UA 1QVTA 2QWMA 3CJQB 3RWUA 1KFDA 2LF8A 2RPIA 3LZJA 3K0LA 1QQNA 3KD5E 3I8BA 2KIQA 1Z3XA 2OU2A 3HBLA 1LE8A 3QICA 1OCOH 5D8LB 4EM1A 4FL9A 2D1VA 5FB2A 3KZBA 2YNGA 3VTHA 2M8EA 2NUBA 4J2EA 4DSKA 2H8RA 2QWRA 3HGYA 2QENA 1W5TA 4X65K 4A3IJ 1HF0A 2WV1A 4M3RA 1HJRA 4KN4X 4ZYHA 2HOEA 1F5TA 5C2DA 4OINF 2VN2A 1Y64A 5FKNA 3H3NO 2VKEA 5AQGA 4B48A 4J00A 3QB0A 2WV0A 2OPRA 5ICFA 4CGZA 2X0LA 1LQ1A 3UKUB 4BGBA 3MWMA 1H0MA 3IS9A 2CV1A 2W42A 3E6CC 2WAFA 2XHBA 1VQ6N 4L0ZB 2LYCA 2AXTC 2HYFA 4F93B 1QHGA 2QM1A 3FZFA 3WTTC 5LL6Z 2M8GX 2HMPA 1R6RA 5JLHA 1RUOA 2DXIA 3P1GA 1IBKK 4NDLA 3M3YJ 2ZO4A 1JI8A 4ZDOA 1BIAA 2E1MC 1ASUA 3RR7A 5FPNA 1JCGA 4XLNF 1H8AC 4B9QA 1OYIA 2EQRA 3HOTA 4CF2A 2LOOA 2AS5F 1JGSA 2V7ZA 4LMYA 4XN0A 4XH5A 2CWEA 5JLFA 3ENBA 2QZ8A 2VT2A 1JCEA 3ECOA 2YX7A 3C1DA 4CIFA 3FZVA 3W3CA 3ASNH 2FBXA 2VGNA 1D0ZA 4CJFA 2F5VA 3DXKA 2V6EA 3NFAA 4RLFA 4L3QA 3KLOA 4DV0K 5T7BA 2KRFA 2IJLA 3SQ4A 3DJCA 4DR6K 2Y69H 3CFPA 2QKMB 2M30A 1KSPA 3ZEUA 5E17F 5LLQA 1FC3A 2JRTA 1TUYA 2ATQA 3JREA 4R8HA 1VQ6I 5ILVA 3L7WA 3EN9A 3M8QA 4Y13A 5C3EJ 4RB3C 1SV5A 1TT5B 4A62A 1W4MA 2HZDA 4L9VA 4LB6B 5M1FA 3U8XA 5FD5A 4B1ZA 4GRIA 3RDIA 4AYBA 4IO8A 2X1CA 4AHUA 3DOKA 2P9KA 3RKXA 4JI5K 4LIVA 1C0MA 3S3NA 2I7NA 5J3LA 2YR2A 4BNCA 4DW6A 1KAYA 2XY7A 4M3ZA 1BOAA 3TAQA 4QAGA 1QSYA 2G0EA 2I8DA 4RAZA 2HHQA 3VODA 5A2QK 2YNFA 1I50J 5HDNA 4D7NA 4CVNE 1LCUA 1POGA 2RKIA 4QSHA 4CFCA 2GIZA 2DPDA 2E1YA 4GO1A 1RI7A 2WA0A 3V42A 2ZFUA 4CZKA 3W6KB 4XKWA 3VQ8A 4XRMA 3V7CA 5H6QA 4OU0A 1YW9A 2P9LB 3RPUD 5LHGA 2X1EA 3NBPA 4X62K 1WZ2A 4YOYA 3IH4A 4GV6A 4RM2A 4N9IA 2VE8A 1KU7A 4CEQA 3VQ5A 3U9DA 1OKJA 1DUXC 1Z91A 1WCMJ 5GAEP 4IOXA 2O8EB 1X1AA 2KIFA 1YAGA 4KA4A 4AHSA 4GV9A 3ALYA 4CF0A 3VPRA 2NOJB 4DV3K 4XL9A 4BR9A 4CK1A 5KAIC 5GPCA 1AKHA 5HRNA 1R71A 4CERA 4X0GA 3HOSA 4RW7A 3V9ZA 3NF9A 2DFIA 3S9HA 4P96A 1WI3A 3L2RA 1ZG1A 3H9JA 5IYBJ 4IPAA 3SZTA 2JT1A 3NEUA 1ETOA 2XKOA 4KI4A 4B9TA 5CZ2A 1P4AA 2YSRA 1OH7A 3I59B 4OWRB 2V79A 4BVOA 3NH2A 3CMEI 3I55N 2LRDA 3K5MA 3D2FA 3GWZA 1NGHA 3QFPA 4I6MB 1YJ9N 3TAPA 4M3DA 1TP4A 3EKSA 2HI3A 5CE3A 4WK8F 3BP8A 2GBYA 2IGOA 3H1CA 2XAHA 1OH6A 2GELA 5KGWA 2F9WA 2O8FA 4U7DA 1JUPA 3A0BC 5KRSA 3U21A 1JKRC 4CEFA 4XEIA 2GXGA 1PDNC 4DQIA 1VK0A 2BXZA 1XWLA 1TWGJ 4OIOF 5J47A 3WODF 2ESHA 4CYCA 1BISA 1KVAA 1BOBA 2KZGA 4HUGA 2FX0A 3NRVA 3FXMA 3MCZA 5HDKA 1ATSA 4B9SA 4FCYA 4JRQA 3UE5A 4CJTA 1QS4A 3DTKA 4A3JJ 1H89C 4X64K 2YHAA 2FQ4A 2DQLA 4OX9K 3MMVA 4ETSA 4QPOA 2Z9OA 3VEVA 4OLAA 4CGJA 3Q9SA 3TOAA 5SZTA 1KC8O 4FX4A 3M3ZA 4KH6A 2KRCA 1A35A 4EZ9A 1YJ9I 3E6DA 4U87A 5GINA 1X3ZB 4CZLA 3C3WA 3S3MA 4BRMA 3RCOA 2IAIA 5TISC 2IT0A 2OTLN 4KNYA 1X9MA 3H36A 4EAHD 2AQEA 3I64A 3I5UA 3SAGA 3E5QA 3RVCA 5D3GA 2ZXJA 2FSKA 2QEXI 4DTPA 1QQMA 3WE3A 2N8GA 3LSJA 4DJAA 3OYDA 4M7YA 3VGMA 4BS9A 2ZMEC 4P1WA 3K4BA 3KEOA 1TQMA 1IGNA 1BI4B 4XSXF 1I6HJ 4GYGA 3AO3A 1ZBSA 5C25A 2G7HA 2HKOA 3THXB 4X66K 4KAZA 4FPAA 2M0MA 2O8DB 3TABA 5FGMA 2H6BA 3VQAA 1ILYA 1GHCA 4BGDA 2FSNA 1QO0D 4YELA 2CFXA 5F2RA 4NBQA 3HEFA 1B72B 1NKBA 2GEMA 1AWCA 4YOWA 4DU3A 2FOWA 4JP0A 3L1PA 2LG4A 3SYZA 4KKOA 3H45C 1FYKA 3JRBA 3V7SA 4JHDB 3BEXA 3I9V2 1A04A 3CERA 4CO8A 2YPRA 3HGGA 4XICA 1BG3A 3PO4A 3ZXSA 1HLVA 5CKTA 5AQJA 2IA0A 1SD4A 1VI0A 3P7NA 2MABA 1HQEA 4Z4HA 1IN8A 4G7ZF 3CUOA 5CVRA 4BR5A 3LWFA 3I3LA 4RWTA 5ICCA 1NM1A 3R8EA 1IBLK 4FPBA 3ZT4A 1KQ8A 3DLLF 3CC4I 2JZYA 3T19A 1TW2A 1QSSA 4PFPA 2GZWA 3ZP5A 3U4LA 4DFMA 1RDCA 3JSOA 4KUMA 5E18F 3SAHA 4H5TA 4CDGA 1NGBA 3CP8A 5C2FA 3BZ6A 5FKMA 2KQRA 1TL8A 1TQPA 3MKYB 3OYJA 1KYWA 2J5OA 2CGPA 4KN7X 3AVLA 4Y1DA 1USTA 3O2PE 2GOXB 2F8TA 3E1YA 2KL4A 1NGEA 3IUCA 1S7AA 3O80A 5IP6A 4CD3A 3O08A 3DU6A 2RGVA 4CJ3A 3R0JA 4HV6A 3FISA 4HYEA 1FKPA 3AVFA 4CIEA 4YOUA 2M4KA 4RMNA 3F8BA 3PUBA 2V4JC 3O1WA 3BCAA 3MWTA 1U4BA 1HRHA 5HS7A 2F9TA 3QOEA 3O9RA 4UQGA 5LD2C 1UB9A 4IEJA 2OZMA 3BY5A 4JRPA 1FYLA 1HYVA 2E88A 3TTDA 3PFYA 4B9MA 2HHWA 4QS8A 5J2PA 2DA7A 4BEHB 3WUHA 3CF2A 1T38A 3EEQA 2KZZA 3AVIA 2GWKA 1ZARA 3TU5A 1X1BA 2G8FA 5CYMA 4JKBA 4EP5A 4L5JA 3ITHA 1MBFA 3WXJA 3DPUA 2ZD1A 4B8CA 5FLXO 4DHYA 1AHDP 3CJBA 2CS3A 1OLTA 1BOTO 2EIJH 4JKHA 3PV8A 3L0QA 1J09A 1YTUA 2QI2A 1T98A 1LDDA 1IDYA 4QLCU 2FOKA 3T5XA 3AG3H 3FK7A 4BY9C 4BQNA 1YOVB 4DGWB 1UAAA 5LHHA 4IOCL 3K5NA 1SKRA 1VQ8I 4HEA2 1HDPA 3TDZC 3LM2A 1ZRCA 4GMJB 1KFSA 1MGTA 3W6VA 3R6SA 4A2UA 4DV4K 1HW1A 2CUFA 1G3YA 3HG9A 1LDJA 3GOIA 2QA4N 3K10A 2ZJRF 4ILHA 4KTWA 5BR8K 2DA4A 3B6CA 3HT3A 2GIVA 2E19A 2A40A 4O55A 2DFEA 1HSJA 3ZMUA 1ZG5A 2FXAA 5BRFA 3S1QJ 4K0KK 3M5RA 3K1MA 1IO2A 1RT3A 2OQGA 4FJLA 1T6CA 4NCBA 3VYUB 2JA2A 3SDBA 3A2KA 1EXQA 2DPUA 1VRUA 3R1XA 4IEIA 5GADP 4CEDA 4F52A 3EZWA 4GKKK 2R3SA 4A3EJ 1N8RO 2QUFA 3R60A 1IXCA 3ZX2A 2Z5UA 4IFEA 3I58A 4HX4A 2DLLA 2E2PA 1BW5A 2XVCA 4A12A 3I56N 3NAUA 2NZTA 2FBKA 3O9SA 1ZK8A 1D8KA 1Z77A 3QETA 2IOCA 4A5NA 1WKMA 4FTHA 1FNNA 2EHGA 2MFZA 1YW7A 1SD5A 5J1UA 4CGDA 1WBDA 4BDPA 1SVLA 4JD2B 1YTYA 1G59A 4MFEA 2LMDA 1CF7A 3CCEI 2CG4A 3ECHA 4W5TA 2EINH 1Z21A 3VDXA 4LFAK 1D8JA 5FPMA 2W6KA 4IJAA 3S1RJ 1I1SA 1D5VA 1JLQA 2EFNA 1W7PB 1Y0UA 2HQ5A 3ZSVA 3DMJA 1YT3A 3QEPA 1ZGAA 4MTEA 2B6AA 3W3DA 2Q0OA 2W24A 1QVUA 1B6AA 4DTSA 1FJGK 4J2DA 2PX9A 5BR9A 1SKWA 3LM9A 4L5IA 1MU2A 4KB1A 1HW2A 5JI6A 2QYOA 1X3NA 3ZX0A 4EM0B 3MKZA 4E7HA 5CVJA 5FRNA 1ZELA 3IH3A 5C12A 3IKTA 2EK5A 2F5FA 3CDLA 4H5RA 1WUAA 2V6CA 3U1DA 5KPTA 4HUFA 4JLHA 1BI2A 1TLHB 2D5RA 3D7EO 4C2MJ 2XPUA 2CV2A 3O9QA 3I56I 5AQOA 4O0IA 3N4PA 4IHYA 2QKKA 1IC8A 4BL0B 1SFUA 2X6YA 5DS9A 1N5YA 2O8EA 2DYRH 2BXYA 3ESWB 2B4JA 1YVNA 2ZM6K 2XAGA 5ILUA 2HYJA 1WSGA 5I3UA 1SMTA 1RR7A 1QRYA 2M7BA 3WGGA 4L9NA 2DTUA 1ZHFA 3H92A 3D2EB 2IBDA 2Z1IA 5DK5A 3KP3A 1A31A 4JK7A 5JVGL 4MFBA 2IA2A 1TNSA 3F22A 1GOBA 1XDUA 3T3FA 2V9VA 2A3ZA 1FIAA 4WXCA 1XX5A 4LB5A 3I59A 4GGGA 3PIOL 3S15J 2R7DA 1E3PA 3KD1E 5F6FA 2NXNB 1OKRA 3LDOA 4EV0A 1YRNA 3E6MA 3H5RA 3NWTA 4ESJA 2HVRA 5FFZA 2HBKA 5KRTA 1RT6A 2JPBA 3LQQA 4XR6A 1U6ZA 3ZQQA 1N78A 1NJZA 2JN6A 3AO4A 4DQ8A 2HVHA 2P9UA 4XSZF 3P9KA 1R9TJ 3H6EA 4WQ5C 4BH9A 3C2BA 2LY1A 2H8WA 3PFIA 3OOUA 3HSEA 3G6EN 1M1KO 4FZXC 3K4MA 2G8VA 1K6OA 3ULEA 1IRGA 2EZHA 1MBHA 4XLFA 2DN0A 4I76A 4OPAA 4FLTA 3SQ1A 1WSEA 3BPVA 4HTUA 4Y15A 5EEAA 4EJUA 3OWTA 1C0WA 5IPAA 3FXKA 3TQNA 4PJ0C 1TAUA 2E1ZA 1XMOK 3C95A 2VI6A 4M3EA 3OYFA 4FLWA 1B9NA 4DOZA 1TTYA 3BQYA 4P9FA 2K9NA 4XKCA 4JI0K 4HCBA 4OIPF 3A8YA 1T8EA 4JAXA 3JRAA 3SUNA 4FLUA 3H35A 1FTTA 3JRDA 2OPPA 5SWMA 4JK1X 3DLEA 1YW8A 2WAQA 2W48A 4JI1K 2DOFA 3HBTA 4JKGB 2RDPA 4YFKF 4RAGA 3WG7H 1WNSA 4RGUA 3HSCA 2QWLA 1W1WE 3MKLA 2W40A 1BJZA 1DDNA 3R61A 1VAZA 3CCUN 4A3LJ 2NRVA 4MEXF 2K86A 3BTLA 3CQXA 1MH3A 3O3GA 5E1ZB 3OVNA 2DYSH 1WSUA 5F1XA 4LG3A 4ZYEA 2G8KA 4N41A 1R22A 3C6UA 2JUGA 2ZXWH 1Q86O 3NGYA 1O3SA 3CCJN 1MJ9A 1E3OC 4CSWA 3THXA 1YQAA 2DI3A 5EOYA 2O8DA 2RN2A 3PO3J 3S1NJ 2LC2A 4BY7J 1IN4A 3VQDA 2PAVA 1A5WA 2BEOA 1N25A 3CQ8A 2DOAA 4IZ9A 4W1UA 3AVCA 2AHQA 3L2CA 1B72A 5I9EB 3CCVN 1Q1VA 5K7HA 2L7MP 3OSFA 3TGNA 3O8MA 3V9XA 1SMYF 2ASMA 2NVXJ 3PM1A 4JHDA 1DKGD 5J1YA 1K8KB 4MO4A 4CD1A 1D3YA 3J7AO 4IRGA 2YHBA 1TW3A 2QQAA 2VPRA 4H0XB 3TAEA 3OYCA 3CM5A 3UR3C 4Z0UA 5IYDJ 4E4HA 3LWMA 5CY4A 4C3JJ 2XF5A 3NHGA 2AJQA 4BRAA 2CQNA 1NMNA 3J7YP 1Y0NA 1P6RA 1RC9A 4AIHA 3CCUI 4FWKA 2M5WA 4BRIA 3EE9A 4AILC 1J7KA 3KCCA 3MN7A 3TBIA 3VENA 3NGIA 2RREA 3CTAA 3HKZA 4YHHK 4CCNA 2L2OA 4CK3A 2VLAA 1NLVA 1C6VA 2P8TA 4BHCA 3DOLA 3UKRB 1O1WA 1RT7A 4G7OF 5DUIA 1LFBA 4XRFA 4Q0BA 3G4SI 3TSUA 1ENHA 3V7RA 3BDPA 2PN6A 2M9HA 1C1CA 1HC8A 3M4OJ 2IS3A 4HUEA 2VCPA 4V19S 1KLNA 4E89A 2JJ7A 1IG8A 2HVIA 4O3MA 3W2VA 1G2HA 1FX7A 3DKWA 2XDVA 4AHCA 2GLOA 3RQ4A 1NBWA 4K41A 2BHZA 2XSJC 4V2GA 3GTPJ 2Y1JA 4O44A 4KFBA 4KBOA 4TSXA 3CC7I 1CLQA 3K70C 3C7JA 4OGEA 1XMXA 4EJOA 5EY4A 3PUFA 3S1MJ 1Z3YA 1S72N 1HYSA 3LSGA 1X58A 4HQMA 1W9HA 2D5VA 4HNTA 2R7VA 4HLYA 2XASA 1S3JA 1HNWK 2UZKA 3HZJA 1FYMA 4C1NI 4BEHA 3CLOA 4WWCA 2G8HA 4MTDA 3CD6N 2P5KA 4AC0A 1W36C 3GO5A 1HSTA 2DDAA 4B1YB 3THYB 4DQRA 3CJ7A 4JKCA 5IYCJ 1EP4A 1JCFA 2VJIA 2QLZA 3BDDA 4PZJA 4A3GJ 4FM1A 4BWMA 2GWJA 2M34A 4BJTA 4IJNA 3ELKA 4AVPA 5LEKA 1I3QJ 1MWKA 2C6YA 3J7ZO 4DLGA 4FASD 4FK2A 4IZZA 4JN4A 1U5TC 3QNOA 1TK0A 2TRTA 2BYVE 1FY7A 4DTRA 4KPYA 2A5WA 2G7UA 2ADUA 1KAZA 3JRHA 1G3WA 3PL8A 1YHQI 1V5GA 2Z1GA 2WTEA 1T6SA 2JA7J 1R4MB 4QWQA 2NS0A 2V26A 1S72I 4F55A 3R3LA 1U2VB 4PWDA 5HLIA 4L9JA 3EETA 4HSRA 1IN7A 2Q1ZB 2QKBA 3LDNA 4O8KA 1YS7A 1KYZA 1ZLJA 5KK1A 3LDLA 2K9SA 3HJEA 4EGZA 3LSTA 4C8OA 2BZTA 2VBXA 5JLWA 2OA8A 1VQLN 3CD6I 2O61A 3JRIA 3I4PA 4XLPF 3LDSA 5LMNK 1IKYA 3IV5A 1P8ZA 1QZZA 5L3EA 2VODA 1LVKA 2LR8A 2MG4A 3B02A 1UG0A 5EZHA 4QOZB 4PJJA 4DQPA 4DV1K 3ASMA 3SJHA 1VSKA 2JA5J 5K5RA 1ITGA 4KDPA 5KNLA 2OA4A 4JK9A 2VBYA 4OO1J 4AU7A 5ICGA 4CHQA 5LJVA 1ZXOA 2ECBA 1RT1A 4AHVA 3SK3A 2PJPA 4EEFG 4JD2A 4RTFD 4ZYAA 4BG8A 3IKMA 2OPTA 1X9JA 3OTOK 1VQ5I 4E7SA 1KZHA 2B0LA 4JKFA 3FM5A 2E5ZA 4B44A 5FLMJ 4BUPA 2IRFG 4DQQA 3SXYA 1ETKA 3DWLE 2MD5A 3M1EA 1W7PA 3HVRA 2K5CA 2NRXA 3U9GA 1TAQA 2EH3A 3U6FA 1BIZA 3EYYA 4MFDA 3RMCA 5C42A 4ESFA 1JKOC 4FWPA 1VQPN 3GTKJ 4DF4A 2EA2A 4DV2K 1RZ4A 4UVAA 3NF8A 2ZSIB 4IOAL 2OV7A 1JL1A 2KRHA 1Q1HA 1IV8A 3QIOA 2LH9A 1P4XA 4NNJA 2I10A 4IHSA 5J2QA 4XM3A 2PMZN 2CFOA 1VFCA 1GV2A 1I6XA 4Z6YA 5MLCQ 3DLLL 2YX4A 4CZJA 2HNZA 2AA4A 1R5ID 2DA2A 3CLQA 1UMQA 4PKGA 3E5UA 4CH7A 3DI6A 1XGNA 1Y6IA 2QWQA 3MX5A 2UUCK 2L5QA 3OIOA 3WTXC 2VXDA 5AQUA 4OAZA 3H5NA 4M9ZA 1K4TA 3R6MA 2NVQJ 2HF4A 2D45A 1FTZA 3RZDJ 1CZAN 2HHTA 5D5VB 1O3QA 3MDQA 2UU9K 3NMUA 5HL7L 3GZNB 3F9MA 1SVOA 3OMYA 3VEYA 3MVPA 3SEZA 3AAFA 3NF6A 3DLAA 2WUSA 3WTSC 5F0XA 4AQYK 2ZJPF 3ZT1A 3KZZA 5J4VA 1SL1A 1XCVA 1APLC 3D1NI 3SHFA 1LWCA 2A68F 2XGCA 4IKFA 1Y1WJ 3GW2A 5FLXZ 4A3DJ 2NRWA 2FU4A 3SZGA 3WXMB 3T8RA 5AQPA 2P81A 1DGWY 1B92A 4WF2A 3CCMN 1TNTA 1VRTA 4NO7A 1EQYA 4DQ2A 5E3LA 4JI7K 5J40A 3CCQN 3KHYA 4JX5A 3U9ZA 1DP7P 2O7OA 5EG0A 2DMUA 5GP9A 2EIKH 5J1RA 3JR9A 4BR2A 1Z05A 4I0AA 5FKOA 4YFXF 5FO5A 2R93J 2DU9A 1STZA 1JLFA 3FHNA 3UKGA 3GBTA 4FE7A 3OW2M 3VTIA 3BG9A 1QZ6A 1B1BA 3AVMA 3HSFA 4BG9A 4BAYA 3VQEA 4KJZA 4G7HF 1Y8QB 3JAMO 4JI8K 2ESNA 3J80O 3CUQB 1NK2P 3S41A 1SFXA 1ETXA 2Q2RA 4RDUA 1TV6A 3OYBA 4DV5K 3SBGA 1OH5A 3CF5F 4IVNA 2RNJA 5ADXH 2PI0A 4N4NB 1U9OA 4FOEA 2DO7A 3OS0A 3A2FA 2D2WA 2H94A 3VEOA 4OPJA 4BRCA 3WHBA 4AVZA 4JKGA 1IG9A 3CCMI 2GBZA 4IO9F 3EYZA 5C0YA 4OPHA 4A93J 1WGXA 3TMOA 2E71A 4R1HA 3BTIA 1D9DA 3TSQA 3BJ6A 1U45A 2VBWA 3DRSA 3WQTA 4U7BA 1NKEA 2R7TA 1XQSC 1WB9A 2JPCA 3L4QA 3FM3A 3SI6A 3R9PA 1USSA 4B1VA 1RKTA 1KAXA 2VT3A 4NB4A 3V9WA 4HNVA 2IDOA 1FEXA 3ZSYA 1S8NA 4EJWA 3WE2A 4XONA 4EM2A 1QVFM 1UAXA 3IDHA 4I2PA 2KLOA 4L0YB 2BANA 4CZZA 4ISFA 2KISA 4XORA 4HSTA 1BO5O 2RE2A 3CQZJ 1FWZA 4Z94A 2A41A 3L9FA 1BA0A 5LMUK 3DRRA 3GVAA 4EP4A 4XNFA 3FKIJ 3RR8A 2FEZA 3R4KA 1SD7A 5F1RA 2XAJA 3EUHA 4LH5A 1K8KA 4WQ4C 2ZGZA 2YKNA 1LWEA 2JA8J 3Q5FA 2O9LA 1ZGWA 2P9KB 2ASOA 4EJTA 1UG2A 1QVGM 3TSPA 2VKVA 4CJRA 5GAGJ 2R7XA 5C10A 2LVSA 4RGXA 1VQON 1HLUA 2K4BA 1N32K 2Y48A 4AH9A 3COAC 1LAVA 3C6AA 3LL3A 2ZFWA 1ZYQA 1EV7A 3GYHX 4BBSJ 3ZT3A 4DTMA 4IHTA 4A59A 3SYTA 3U1KA 1X19A 3UKRA 3BG3A 4BRDA 3M07A 4F3QA 1S3XA 4LSNA 3TP3A 1YITN 1I94K 3AG4H 4I7HA 3JYTA 4H0VB 4G8XA 2JLEA 2O8CB 1VSIA 2JK3A 5J4YA 5F64A 4XN3A 3TW6A 1TUUA 3BTJA 3SQNA 1RILA 3ZSOA 4FVUA 1QZYA 1ESVA 2PJRB 4W5RA 2Y9YA 3CFRA 4DSFA 2CGKA 4XKBA 1TK5A 3VOEA 1WPKA 1NU0A 1G15A 1LUJB 4MLEA 2ME6A 3TKYA 1DP3A 4HTLA 4CZIA 1Q81O 2MH9A 1YFHA 1XSXA 1HNVA 4N56A 3RYPA 3CCSI 3V9SA 4XLEA 3S2WA 1NK6A 4Q4ZF 4XOPA 3FBIB 3DV8A 2FE3A 2VWKA 1N34K 1IXRC 1JKPC 1VQOI 4XQFA 4HG2A 2QSGX 1P4WA 5EXWA 3ATVA 1RDWX 1JKQC 2YV0X 1HUXA 2DMPA 1Z0XA 3PO2J 3RPUA 2XKPA 3V6DA 1KU9A 4BYYA 1E3HA 4JOMA 2E20A 4DR7K 3OHRA 3U3YA 2WONA 4M6VA 3THYA 1GLAG 1K4SA 1RDAA 5F0CA 1F43A 3CJAA 4HRIA 2V52B 4AM6A 3FDYA 4KITB 5C4XJ 2BDPA 2KZVA 4BJ6C 2H27A 1X9WA 1G3TA 3ZCMA 5JVHL 4F9OA 3BR1A 1YITI 2YI1A 2D1HA 3FXQA 1SL2A 1E3MA 2ETJA 3HTVA 1HX1A 1WAJA 4CFDA 5J6XA 2Q97A 3AARA 5LBQA 4CJUA 1RUNA 1VSJA 3VA0A 1MMNA 4RGSA 3RZOJ 4E6KG 4UB8C 4BR0A 1X1DA 2ZE2A 1J6ZA 1UFMA 4Y7NJ 5J1EA 4ILGB 2F5CA 4FLXA 4B3XA 2HPMA 1TWHJ 1GLJO 1H88C 2HDDA 3HVTA 3FMRA 1DGRM 2H09A 4PUSA 2IS2A 4FJXA 3OBWA 5M1QA 2CSOA 3M8JA 1S7OA 2EFOA 3FIWA 3OJUA 1NGJA 3K69A 1MMGA 1BC7C 1P90A 2QM3A 4PFOA 4LLNA 4YOTA 2VUMJ 1KGSA 2CW0F 1YIOA 1ZBLA 1EKEA 5BPNA 5E3NA 4CBUA 3L2QA 1VSFA 1OFCX 2E2QA 3ZMSA 5CQEA 1BR1A 2FJ1A 3JW4A 4FX0A 1IZ1A 2JWKA 2UXXA 2NS8A 3KK3A 4HWIA 2HXIA 2A42A 2YHXA 3FFIA 2MBFA 3NARA 2E6LA 1GUUA 3M1CA 1LOTB 4JV5K 2QSFX 3OOPA 2DW4A 1DTTA 4HA8A 2HQNA 2F5DA 5KPRA 1ZBIA 1VQMN 2HOTA 4UV8A 4FJ8A 4AM7A 3RI4A 2DA1A 2A5XA 2E2HJ 1R00A 2GV9A 3JS6A 4YG2F 3EO3A 4WCGA 5CPRB 2X78A 1TWCJ 2E1MB 1IV6A 1KXPA 3SPYA 4KO0A 1NWKA 4Y17A 4YNQA 2RF2A 5AZIA 1IRZA 3SMPA 2IGIA 3LA3A 3JRGA 4AD9A 2E8AA 5E20A 4C3IJ 2EZIA 4H0YB 1RT4A 4DNCA 1C1AA 1Q9XA 3WGIA 1UWBA 2STWA 1RRJA 4I98B 1BI3A 3A5LC 1RPWA 1VQ4N 3ERED 1R7JA 4M72A 2E1NA 3I4MJ 2P9PB 4CCMA 1KD1O 2BY2A 3QLHA 1RT5A 1EWRA 4C8LA 2LK2A 1HDDC 3HM9A 3KLEA 1GLLO 1SUQA 2KPMA 3O9TA 3DRPA 4BDZA 4F92B 3C94A 2QQ8A 3K6GA 4DYRA 3VGKA 3SJJA 5AQIA 4MO7A 4DLEA 4JKEA 1LV5A 3DXMB 2V9KA 3PSFA 4YIFA 3LAMA 4WQ4A 4EMSA 3VPZA 3QWLA 5E41A 3AA3A 1B59A 5EEGA 3FZLA 2ITMA 5GAEJ 1U6GA 1ZKGA 2HW3A 4ZTFA 4BRGA 3BG5A 2Q1NA 2NVUB 2CUZA 4BVPA 1DPUA 3M1FA 4M41A 4XH4A 3OYLA 2FBTA 2A61A 1ZG3A 4KMFA 1PVEA 2KHMA 1XPXA 4DR2K 4DTNA 2XAQA 4CJ7A 3DF8A 5AQYA 3VFZA 4CBWA 5M5XJ 2QQ9A 2KZMA 3FXJA 2RNGA 3N4QA 3MN6A 4CEZA 1CGPA 4OJRA 3NH1A 2UWMA 1U0JA 4K8ZA 3TO7A 3HM5A 3LDQA 3FR0A 3IMXA 4E7IA 3LP3A 3O8GA 3ISNC 4L5EA 3M8FA 4CF8A 4DF8A 3VEPA 3LZIA 1ZQ3P 2HGCA 4DU1A 2F6CA 3ID6A 1U9NA 3Q7BA 1MW7A 1H1VA 1T8IA 3WXIA 1TBXA 2OTJI 2HKXA 2LREA 3F3XA 1GXQA 1AU7A 5IOYA 3I8DA 3MXJA 2Z3YA 3MECA 3RJPA 2O0YA 3QP5A 3LAPA 1UA1A 1GV5A 3QDKA 5FJ8J 4LH4A 2KFDA 3IP4B 4OGCA 4WE1A 3IWZA 4LK1F 2QVOA 2G8IA 2BY1A 4DYCA 4K2EA 2K40A 4H4OA 2HDWA 3LSMA 4LF5K 5AQRA 2A1RA 2QWOA 1SS6A 3THWB 1O7LA 3VQ6A 2V7FA 4DBRA 4RLQA 1IXSB 4HV5A 3K4JA 2TDXA 2V7YA 4H5NA 5BPLA 1D4XA 1XGOA 2JSPA 4UXNA 4JI4K 4B1XB 3QINA 2JUCA 1TKXA 2ZJQL 4LGWA 1QSLA 1QZ5A 4JYKA 4CEEA 3RSEB 3CUQA 4CFAA 4PKIA 2LY2A 2X48A 3WXLA 3CMYA 4YFUA 5AQVA 1YF5L 4MGRA 5K5QA 4KT5C 3KP5A 4WFNL 4LF8K 4ID5A 4FJ9A 3AA2A 2L7ZA 3OYMA 3C0BA 3NWSA 4H4MA 4J01A 3O6BB 1K7AA 1IKWA 3L2WA 1SL0A 3L09A 1C0TA 1D1AA 2DJNA 3CZ6A 2E6MA 4A5BA 2JVHA 1R1VA 3T0YA 3BCBA 4CHYA 3SUOA 2V51B 1A6QA 3DBLB 3L3UA 5B8HA 4OKJA 3CPEA 3GF2A 4Y33A 2E2OA 1W5SA 1LKXA 1HKBA 2EZKA 1PP7U 1OR7A 4XIUA 1NG9A 3BJOA 5AQKA 3CMAN 5GAHP 4CBXA 4M6YA 2HQAA 1RT2A 3OYHA 4G6QA 4UVCA 1UOCA 3H0DA 1BL3A 2DODA 2NOGA 4A5MA 1R0AA 4B43A 3IAYA 1NGIA 4HX8A 3SEQA 1XG1A 2VWJA 1U8RA 3CFOA 3BROA 5J2MA 3V8LA 4BDYA 2HHHK 3HOVJ 5HRRA 3RTRA 2R7WA 1OQYA 4JK8A 5M1NA 2EX3A 1UCRA 1R49A 4BC3A 3ABTA 3EL2A 1NK3P 1PP8F 3O4NA 3L2VA 4FJ7A 1JJ6C 1S29A 4EVIA 3C7NB 5DM6L 5D6EA 1CF7B 4DS5A 1WLJA 4H0OA 2DPNA 1M90O 3VQPA 4GKJK 2W82A 4KTZA 2J5PA 1MDMB 1R23A 1YIJN 2DA6A 5E26A 4CEBA 3FMQA 1PYVA 3F21A 3P5JA 5CR4A 1MJAA 4GYIA 2HYGD 4D0PA 3WU1B 3H1VX 2ZMEB 2HBJA 1TT0A 2Q3SA 4ISGA 1SEUA 3DAWA 3LOCA 3Q0UA 3CCLN 1KVCA 2BVMA 3OBYA 2IVMA 3CQYA 4BQLA 4RB0A 3FGUA 5DCFA 3VYSB 1DGKN 2FA5A 1U04A 1BGXT 1GLFO 1HKQA 3K1NA 4JNEA 4NYNA 1QHAA 4HLXA 4P55A 1IUYA 4HHTA 2DFFA 1JJ2M 3HM8A 2Z1DA 2X6NA 3CJ9A 3H08A 2O8CA 2X4HA 1BR2A 4I01A 4MNUA 1BBYA 4HF0A 2NNWA 4KHUA 2VJJA 4LF9K 2JGUA 4ZDLA 3MZHA 1TVRA 4FJIA 2PJRA 2WBNA 3NVMA 1XI1A 4BE1A 1RNHA 5H20A 4B9LA 1HA8A 2Y2ZA 2L7FP 5DV5A 5AFUH 5DM7F 4BC4A 1JGGA 2L4MA 4YOVA 4JX6A 2OPSA 1DEJA 5HS8A 3SQ0A 4M71A 1CZBA 3DEWA 4FK4A 3GFMA 1V54H 3ZR8X 2BW3B 1QA6A 4NXMK 2CQ7A 1KRPA 3H9GA 2KDOA 3AL0B 2RN7A 4RM3A 4BACA 3ZQFA 4J2BA 5FD6A 1WOQA 1KCFA 3FWEA 2O03A 3GXOA 3CDIA 3J7AY 1ULYA 3JAMZ 3T69A 2R7UA 1NOYA 3A1YA 2X1DA 1YRNB 3BZCA 2Z2SB 3J80Z 3VF6A 3AA5X 5IT9K 3RRHA 4IDKA 3TR8A 2HEOA 4MQ3A 4CCKA 1MMDA 3LANA 4C8KA 2CUJA 2P9UB 5CYVA 5LFAA 4AUXA 1LEAA 2ZF5O 5AQSA 2IS1A 2QK9A 3O3FA 4OKKA 1XCBA 1U49A 4NLCA 2B63J 3H3OB 4ZTJA 3ULEB 5EGOA 4HW0A 5DMRA 3Q9VA 2K3FA 3DTEA 4YOXA 1YE9A 4BXFA 5HVQC 3QEWA 4I0BA 4X6AJ 3T1BA 5FLXK 4NYFA 1QQIA 5JFRA 4GFBA 4HNUA 3IRXA 2XB0X 5J2NA 1ZLKA 4LD5A 4KHQA 4FVMA 5HP1A 3Q0WA 1FOWA 2ECCA 4RA2A 3G3ZA 2DY4A 1NJIO 2QWWA 1S6PA