1Z05A

Crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
DHIKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAISRGRPAVGLQTNNLGWQFLSMRLGRGYLTIALHELGGEVLIDTKIDIHEIDQDDVLARLLFEIEEFFQTYAAQLDRVTSIAITLPGLVNSEQGIVLQMPHYNVKNLALGPEIYKATGLPVFVANDTRAWALAEKLFGHSQDVDNSVLISIHHGLGAGIVLDGRVLQGRHGNIGELGHIQIDPQGKRCHCGNYGCLETVASSQAIRDQVTARIQAGEPSCLATVEEISIEDICAAAADGDPLAVDVIQQLGRYLGAAIAIVINLFNPEKILIGGVINQAKSILYPSIEQCIREQSLPVYHQDLKLVESRFYKQATMPGAALIKQALYDGLLLMKVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ROK family transcriptional regulator, homolog of E.coli MLC protein.
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transcription
molecule keywords transcriptional regulator, ROK family
total genus 137
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z05A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A03
5CE3A 2MH2A 3BP8A 1DDNA 2HEOA 2Q36A 3S41A 1D8KA 2LSOA 3Q5FA 2ZBKA 4U7BA 2HTJA 1Z6RA 2PBIA 4RAZA 4KIGA 3A0IX 5TKYA 1JXSA 5D8KB 4K25A 4C23A 4ENMA 4EJWA 2M5WA 2DLLA 1REPC 2D1VA 4AWXB 4UHTA 4L3QA 2P7VB 2RKHA 3O6BB 1FSHA 4FT8A 2Y48A 3TU5A 4K42A 3E6CC 3H3NO 4I2OA 2JSCA 1OYYA 3F22A 3R9PA 3NQOA 1GLDG 3U1DA 1GLEG 1IW7F 3DP7A 1R36A 5DD4A 3RPQA 4TV7A 2Q97A 4OIRF 2HFHA 2PBDA 1P8ZA 1H1VA 3DXMA 2Q2EA 4BRDA 1I1GA 3I71A 1XGMA 4EJOA 5ILUA 4AM6A 4ASNA 4HDUA 4O6JA 3CO6C 1PP7U 4BQAA 2EFPA 3L7WA 5BPDA 2FE3A 3R6MA 1YLFA 2HF3A 2VBZA 5FD5A 3HSRA 4XLPF 1ATSA 2VYPA 5CYVA 4FL9A 5AQSA 1HQCA 5ILVA 2YPRA 2IW5A 4OMZA 5KPRA 1UB9A 2ZMEA 2L01A 2P9SA 2EWSA 4CBWA 4CI6A 2CG4A 1FBSA 1KXPA 4M6YA 4U0WA 3LM9A 5AQFA 3JAMZ 5AQPA 4Y15A 3HHGA 3FZFA 4CZMA 4M6XA 4RTFD 5EXWA 1HKCA 4BG8A 4BG9A 1O3QA 2HQRA 4RGXA 3F8NA 1E2XA 1FC3A 4U7DA 4YG2F 3WUHA 2HOEA 5FLXZ 3L09A 4S05A 1RUNA 2KKOA 1Z7UA 2GWRA 4GCVA 4A2UA 3RSEA 4AM7A 1Q18A 3BUZB 2P9PB 3J7AO 2IRFG 5EEGA 4HBLA 1YUWA 5CVRA 3HOSA 1T39A 2AS5F 3W6JB 5AQZA 2L54A 3HTVA 3KZBA 4BREA 4BR0A 2DK8A 4G8XA 4L9TA 2V1UA 3LSTA 2HGCA 2ITMA 4S04A 3HRUA 1ZLKA 4EVIA 4IHSA 2J5PA 1FP2A 4JAXA 2ZWHA 3EYIA 1ONVA 3LA7A 2QWRA 3MZHA 4RAYA 3CUQB 4UVAA 3LDPA 2PLYA 4CO8A 1FYMA 1HKBA 3IKTA 3F9MA 4M9XA 3GX4X 5LGUA 3WTYC 3GXOA 3O5BA 3LDLA 1MZBA 2V9VA 2A61A 4EHUA 1J0RA 4K43A 4EQQA 3GZ5A 2P5VA 3KETA 1R5HA 4R1HA 2YCHA 3F8FA 2QQ9A 2RV8A 3J8AA 3HRTA 3C18A 2ZFWA 3ZMSA 3VF6A 4FWLA 3RKYA 1NGIA 2STTA 3KP6A 2ASOA 5HDGA 3CJBA 4QS8A 3DPLC 4RGUA 3RKWA 4FSVA 3ZETA 5BPNA 2CGKA 4BRPA 4EAHD 4UXNA 5LY3A 3J81Z 2CGPA 2DPUA 4HV6A 4MTDA 2FSNA 1HPMA 3T5XA 1XSVA 3FHZA 3I64A 3CJ1A 4UUVA 4U0YA 2GUPA 3MAJA 1E4FT 2Q0OA 3M3ZA 3UB5A 3KVGA 2IVOA 5K5OA 5AQIA 3KP2A 4XSXF 1SFUA 1YVNA 3MFKA 4BRNA 4RWTA 2QWPA 1KU3A 4XH1A 4ZYEA 1MKMA 2HTSA 2CSOA 2GA1A 2FU4A 4PL7A 4ON0A 4WK8F 4MGRA 4WX9A 1ZGJA 5FPDA 1S7OA 5AQYA 3OV8A 2IA1A 4I0BA 1TUUA 3P7NA 1BC8C 3TO7A 4HDVA 2A5XA 4BRFA 3HUGA 1LEAA 2PQ8A 3BF3A 3W0LA 3K1MA 4ESFA 3QB0A 4XEIA 4WWCA 3IDHA 4B9QA 5HVQC 3ROUA 1V4SA 4WCGA 1WWXA 2HZTA 3ZMDA 3WQTA 3J80Z 1SMTA 4IJNA 3H3ZA 4QWQA 5AQQA 1QQIA 2P9UA 1E17A 3F6OA 1BA1A 1Z6TA 4GY2B 3VPZA 4G7ZF 4HLXA 3ID8A 2VBYA 1ATRA 3RSEB 3VERA 3ZETB 5KPTA 4IJAA 5BN9A 2KRFA 1Z9CA 2VBWA 1SZ2A 1MGTA 1DEJA 2PFBA 5AZIB 4BHBA 3DPTA 4FWNA 1V4TA 1VTNC 5JLHA 5HDKA 2ZF5O 1G99A 1BM9A 1KU9A 4KIFA 1ODDA 1BI2A 2YHYA 1K78A 2E20A 3Q9SA 2V7ZA 5E20A 2IA2A 4HLYA 1BJAA 1W7PB 2YSRA 3MN9A 4WQ5A 1SD7A 3I53A 5JHUA 4PKIA 1F9NA 1XCBA 2L02A 4LB5A 3Q9VA 3HZ6A 2NS0A 4CDGA 2ZNZA 5E1ZB 3V7CA 1FSEA 1TNSA 1BIAA 1XGOA 4BVPA 1K78B 4KFCA 1KYZA 3BEXA 4M7XA 2RC4A 4OIQF 3BROA 1FYKA 2V79A 3R60A 4Q4ZF 4XSZF 1T6SA 1CF7A 4B1XB 1XQSC 5AZJA 2AA4A 3F23A 3ISPA 1GVJA 4JBAA 4FOEA 3I4PA 5E26A 4PGHA 1ZAOA 1X3NA 3F6VA 2NZTA 3H6EA 4EFHA 5ICEA 3IRQA 1FYLA 1O3RA 4O3MA 3WEEB 2ZJ2A 3C0BA 2OZUA 2L3DA 5FB2A 4PL8A 3WT0A 1MJBA 1XMAA 2M30A 1ZH5A 1R59O 4Y13A 5BN8A 4MLEA 3ML6A 3WEEA 3HIFA 4KUMA 2XUBA 5LJWA 1YO5C 3KP3A 1BI1A 3V8LA 1YW8A 1RNLA 1EQYA 2D4WA 4PKGA 1WKMA 5FFXA 4L0ZB 5AFUA 1IXCA 3KEOA 1ON1A 3UE5A 5CLSA 1YYVA 4DQ8A 5D8LB 4KA4A 5KVRA 3CUQA 5DV5A 4CXFA 3M1EA 1TUYA 3O1WA 1IN8A 2EFOA 4WXHA 4JHDA 3QRFF 1P4WA 3IMXA 4BR9A 2E2NA 2BTFA 1K6OA 4HQEA 2P7CB 4ZYDA 5DYMA 1GLBG 1W7PD 5H20A 3EL2A 5DCMA 4HX4A 2XHKA 2YHWA 3T8TA 4P96A 1XD7A 4K2EA 2V1XA 1USTA 5BMZA 2E1YA 4ENJA 4YIFA 4RB2C 2QLZA 3CO7C 1NWKA 3HRSA 3SZTA 2DTRA 1SD4A 1JCFA 4ESBA 5AR0A 5DCMB 5D5VB 4HF0A 3FX3A 1QZ5A 3P4IA 2FMLA 1P92A 3F8MA 2P4WA 2ISYA 4LGWA 2CGJA 3LDNA 5EX5A 5LGNA 5FO5A 2F2EA 2D0OA 3WTUC 3L0QA 1Z1DA 1T2KA 1D4XA 3LDOA 2P9KA 1G3SA 1ZHFA 5CVUA 1AOYA 1JHHA 4MO5A 5BPMA 4H0VB 1QZ6A 2HYGD 2DPNA 3KP7A 1TYQB 5LRSA 2IA0A 3D0SA 3ECHA 3AAQA 1U5TC 4F9OA 4CZZA 4CICA 3O08A 2YI1A 2FXAA 3HSFA 3QU6A 5AQRA 2BGCA 3LA2A 1IN6A 3DXKA 3SHFA 5LLQA 3VEVA 4ZZLA 3LWFA 5HLIA 2IT0A 4BGAA 3KCCA 1FZPB 4ETSA 3FXUA 1T6CA 2IVPA 3IC7A 3C7NA 2PMUA 2QQAA 3I58A 1F1ZA 4BR4A 2ZGYA 4H5NA 3OOPA 5HDNA 1QZZA 1O57A 4PGGA 3W6KB 1D3YA 2K86A 3EQLF 2WTEA 1ZRFA 3LQQA 1X3MA 2HMPA 1BI0A 1YAGA 3D2FA 3M7GA 1H9TA 3EKUA 3EDPA 2OBPA 2FOKA 2LDUA 1Z05A 3D5LA 1R1UA 3T8RA 3WODF 1BG3A 2YJEA 2BE5F 3WU1B 2VXZA 3TOAA 2A68F 4Z2YA 3CI5A 4I6MA 3T1BA 5DUKA 1CF7B 1K8KB 5BQTA 5L3EA 2GIVA 2IVNA 3I59A 2CQKA 1W4MA 3KP4A 3SZPA 1G3YA 4Q47A 4XBFA 2GQQA 2KIMA 2IPQX 3E6MA 3R0AA 3R61A 2QWMA 2B0LA 3WTWC 1I1SA 4O8KA 2NLXA 5LJVA 2BUPA 4BRQA 3RDIA 4KICA 1JE8A 4U0VA 1SFEA 2YR2A 1FP1D 1FY7A 2Y0MA 4P9FA 4B09A 2CYYA 1RZ4A 3CLOA 3VEPA 4ENNA 4WXDA 2CWEA 3QFUA 2FBHA 3VFZA 1W5TA 2FSWA 2O0YA 3MWMA 2VCPA 5BRDA 2D1HA 5ILSA 2F9WA 3IUCA 2ZMEB 5LHIA 1BI3A 1C0WA 2FBIA 2ESNA 3MZYA 3QBWA 4LLGF 5L3CA 2X0LA 2UWMA 2J4RA 3G3ZA 3NEUA 2VODA 2EA2A 1LOTB 3U4LA 1UFMA 3IKVA 3GBTA 3JSPA 3NRVA 2QYOA 5AQMA 3C3WA 4JK1X 3JW4A 2DFIA 1BC7C 4UVCA 3MN7A 2GXGA 3SMPA 3E3VA 3SXYA 1NLVA 3E6DA 3ULEB 3FMSA 1IN7A 3VEYA 1YTYA 2XV4S 4BRLA 4B1VA 3P9KA 4O5FA 2KJCA 4WQ4C 3TO9A 3O80A 3WXIA 3KFWX 1O3SA 5E8GA 2PAVA 1BO5O 3CUOA 5D5UB 4CZLA 1T6DA 2A6AA 2BEOA 3TO6A 1JCGA 1O7LA 4L9VA 4LLLA 2V52B 3CJAA 5F6FA 2GZWA 3GFIA 2A5YB 4FWKA 2RGVA 3KEQA 5TRDA 1XMKA 3CETA 4FWSA 4LC9B 3O8MA 5F1RA 3ZMUA 3I8BA 3E5UA 2P5KA 5LRRA 1L3LA 4CYDA 5TJJA 2WC2A 5ICFA 2E7XA 1NGCA 1H9GA 4MLHA 5HLGA 1IUYA 1Z91A 3F21A 1JCEA 2LNBA 5D5WB 4FO0A 5EY4A 2J5OA 2OD5A 3GYHX 4OU0A 4ZYHA 1FT9A 2XROA 3QP5A 1XUPO 5D4SA 2ISZA 2GAUA 4KBOA 1BWFO 1F4KA 3GWZA 3FM3A 5K5RA 1OKRA 1OYIA 4N9IA 1XN7A 3COAC 1MJ9A 2A40A 3RYPA 2MC3A 3MDQA 4N9HA 1GHCA 4NQWA 1J6ZA 3H1QA 1WQ2A 3EETA 4GNIA 2QM1A 3TGNA 1YXQA 1J9IA 1LJ9A 1MWMA 2RNJA 5L3FA 1GLAG 1NGGA 3KLOA 5FPMA 4OOIA 4LB6B 4LG0A 4D0PA 4QLCU 4CHUA 4A6EA 1K79A 4EHTA 4FWMA 3HI0A 2P9IA 2CO5A 1PP8F 4QS9A 4KIBA 4IF4A 1GLCG 1KAYA 3JS6A 4YIIA 3WG9A 1IXRC 1X9JA 2JZYA 2G9WA 3E5QA 3REOA 5KPZA 2P9SB 4HAMA 3L9FA 3FWEA 3ULEA 4HX7A 4EJVA 4ISGA 1EH8A 4AVPA 3WTZA 1UCRA 3QPTA 1ZC6A 2F5FA 3HTUA 4Z94A 4H5WA 2A07F 2COMA 4MO4A 3I54A 2RN7A 4MHGA 3SMSA 3ZQ7A 5AQHA 4CZIA 4A5NA 1B59A 2E2OA 1ULYA 3IFRA 3JSOA 4M74A 2W40A 3CDHA 4HF1A 4GYIA 4E70A 3P9IA 1KQ0A 1LDDA 1STZA 3GW2A 2KIFA 3I33A 1FBQA 3O1BA 4BRIA 4ZZDA 1C0GA 3F3XA 4P55A 4BGBA 1U78A 2ETHA 4I6MB 1XGNA 3C1DA 2A3SA 4OINF 1FPQA 3FGUA 1NHAA 2W84A 4EM0B 1HSTA 2GELA 3FMRA 2OQRA 2XKPA 4EGYA 1U2VA 2Q8KA 5BPIA 4P5OA 1NGDA 4B1UB 3QFPA 1S22A 2CFXA 1LVAA 1ZRDA 1ZREA 1B6AA 2XASA 4IRHA 2A3ZA 5FPNA 5J8CA 1X3UA 1FNNA 2LKPA 3SJHA 1BDGA 4RB3C 5EEHA 1FLIA 4GO1A 3R4KA 2M8EA 1NM1A 1HKSA 2O8XA 2TDXA 4FX0A 4BRKA 1TQPA 4CD1A 4L5IA 3UKRB 3W3DA 5D6FA 2FF4A 5ADXA 4EM2A 2ZCWA 2YJFA 4CZEA 2Z33A 1S3JA 1MDMB 1R58A 4BHPA 3EYYA 2HF4A 2M1BA 2G7UA 4IHTA 2P9NB 1NGAA 1B4AA 4CZJA 2QBYB 2ESHA 2HKOA 3TOBA 1MDMA 2W85A 2A6EF 4I0AA 1R22A 2XIGA 1ZG1A 2VT2A 4UV9A 3CJ9A 4BC2A 4FHTA 4FWPA 2H6BA 3VODA 1SQKA 2MD5A 4BNCA 4P9UA 4EM1A 2I7PA 2UZKA 1W5SA 2E1ZA 2VWBA 3IHUA 1T98A 2XGXA 2R7DA 2EV6A 2OQGA 1S6LA 1BBYA 4ISFA 2ZXJA 2OA4A 5D4RA 5F1XA 2FQ3A 2IP2A 3I5UA 2PJPA 4CD3A 4H0EA 3U9GA 2NRHA 1GLJO 4BRMA 2E8AA 2MBFA 1BU6O 5LEJA 2EWNA 3G73A 3VB2A 1Y0UA 3DEUA 4IPAA 3CQYA 1QBJA 4LK0F 4I01A 4A2AA 2XRNA 5LBQA 1LDJA 1Y64A 2PI0A 2KIUA 2FBKA 5CJ9A 1U5TB 1MDUB 2VONA 1R23A 3ZN1A 2DBBA 2HS5A 2W25A 1QHAA 1SD5A 2FMYA 4IO8A 5FLXK 3GL1A 1R5GA 1SMYF 2GWJA 3H92A 1TYQA 3KP5A 1XCVA 3VENA 4N0BA 3FZMA 2QM3A 1IN5A 1DUXC 2A69F 5AQTA 1J2XA 4FOIA 4H03B 3K1PA 1DGKN 2IIRA 4E1JA 3ABTA 3FR0A 5IT3A 3GLXA 3QOPA 2NNNA 3GG4A 2IJLA 5HLHA 2VC1A 1MA9B 1IN4A 4HF2A 3ZEUB 1HLUA 4HQMA 2W57A 1XSDA 3VF2A 3BJAA 3ULQB 1DPRA 3ZMTA 1TBXA 3BOQA 4JN4A 4J8FA 2JT1A 2YHXA 5A2QK 4H5TA 2R3SA 4I7HA 4IWVA 1EH7A 4B8XA 4PZJA 1HUXA 3K1NA 4YDUC 4YFXF 1BUPA 5I9EB 5JICA 3UKUB 3MMVA 3A8YA 3A5NC 2Z5UA 1TNTA 2P6SA 4XLNF 4H5VA 1SD6A 1TW3A 4I09A 2P9LA 2XAGA 3SFZA 3MN6A 3I59B 1B9NA 2VOPA 1XB4A 3A5LC 1CGPA 2UXXA 4A0XA 4KNYA 1A04A 2F5DA 2OAZA 4XH4A 5AZIA 1CZAN 1E4GT 2JPCA 1WOQA 2DT5A 3J80K 4G6DA 1P4XA 2BYVE 3GFJA 4LMYA 3QICA 4GGGA 1BOAA 1QZYA 4MEXF 4F7ZA 2NNYA 2IVMA 3L2CA 2NRAC 1OMIA 2V7YA 3ZX0A 4H0OA 3EKSA 1HSJA 5JVTA 3R0JA 4KMFA 3BPVA 4M71A 3CHWA 4M9SA 5JMVA 4EGZA 3F72A 3GOIA 5ADXH 5IT9Z 3HSEA 2A42A 2D45A 3RIRA 4WXCA 1S7AA 2YU3A 4BR2A 1RGIA 3KZYA 4UVBA 3A5OC 2L4MA 1HW5A 3GEZA 2UYTA 3WTTC 5KQDA 2V51B 5HOOA 3DKWA 5H6RA 5LEKA 2WV0A 1V4RA 3FZVA 2Y75A 3CJ7A 5F2RA 4LG0B 2LF8A 3D2EB 3EZWA 3TDZC 5J6XA 3BWGA 4JQFA 3BDDA 3WTXC 3BZ6A 3N97A 1YW9A 4BC5A 4G7OF 3RI4A 3J81K 3LM2A 1IRFA 4RGRA 1WUAA 5ERIA 1MD0A 3HSCA 1MJAA 5FFZA 4BRHA 3HM8A 3D2EA 2HQNA 4OIPF 3BJ6A 3HOTA 4ZYGA 3LA3A 3VEWA 4FWQA 3JTGA 3SK3A 2O3FA 4I02A 1TW2A 3DV8A 4M9ZA 2UXNA 4CJ7A 2DW4A 1U6ZA 1HBXG 3ZEUA 4BQZA 3B8AX 3IWFA 5L3BA 3IRRA 4B1WB 5FPEA 3RYRA 3MCPA 3DAWA 1NGEA 2WUSA 3DQVC 2QW9A 3RTRA 1GXQA 3EN9A 3DXJF 2FXUA 4BAYA 1LCUA 2FNPA 3F8BA 1D5VA 3WTVC 3A5MC 4MQVA 5BOXA 3GDQA 2FSJA 4DB3A 2QWQA 3JAMK 4PKHA 2VOOA 4IZ9A 1ZN2A 1GXPA 3T0YA 1I5ZA 3ZPLA 2V6CA 2X4HA 3HBTA 3D7EO 1GLLO 1RDWX 3GVAA 3ECOA 1G3TA 1PUEE 2ADUA 3FFKB 2GXBA 3E97A 3IWZA 3H1VX 2QVOA 2Z3YA 4Y17A 1K8KA 5FGMA 1QQNA 3FF5A 1ZARA 4NB5A 2DI3A 2DU9A 2Z9OA 2KHOA 1U2WA 2E2PA 3MN5A 3TQNA 4YFKF 4HW0A 1S8NA 2OZ6A 5EVZA 1FWZA 2DK5A 3AY9A 2M87A 3VOVA 3UKUA 4G9YA 4CGZA 1BOTO 3HYIA 1YW7A 3RKXA 4A2BA 1HW2A 2XAJA 3D2FB 1S29A 2XAHA 4Q48A 2MLKA 2M45A 2ACJA 3ZX3A 2E7WA 4AIHA 1W7PA 5KQ8A 4RCHA 5LHGA 1QQMA 2H09A 3L6QA 3VEOA 1XC3A 4CZFA 3DFGA 3DXKB 4JNEA 4RB0A 2EK5A 1WSUA 4M7YA 3WE3A 1XDSA 1OR7A 3QPHA 1IG8A 3B73A 2NAZA 3MQ0A 3TKYA 1NGJA 1J5YA 4OIOF 2A41A 1LEBA 4DNCA 1HJOA 4FX4A 2FSKA 5AZJB 1R1TA 3U8XA 4A12A 1BA0A 2KJBA 4H0YB 1RUOA 2K4BA 2OANA 2RVCA 3L00A 4FPAA 1KGSA 3VGKA 1TLHB 5DD8A 1FX7A 4CZKA 4AIJA 3PQKA 1YFHA 4L0YB 5ELZA 4IRIA 1ZXOA 2JTVA 4RS8A 2PG4A 4O5VA 4LLNA 2YX4A 1SFXA 2QWNA 1YIOA 3V8JA 4M72A 3N4MA 5JLFA 1TTYA 3DWLA 2E1CA 1PDNC 2P6TA 1NGBA 3O4WA 2VE8A 1LB2A 2JPBA 2FF3B 3AARA 1KQ8A 4JD2B 2VN2A 2AP1A 4NB4A 3VESA 3FZLA 4IRGA 3OHRA 2HKXA 3ABUA 3VEZA 3GO5A 3RJPA 1F5TA 1RI7A 1FBUA 1UHMA 4R8HA 1ON2A 2K4JA 4BYYA 5BPLA 2K27A 4YDUA 4U88A 4DCHA 3ZP5A 2QZ8A 3G25A 2CH6A 4FWRA 2EFNA 4B1ZA 1UHWA 3FZHA 3WXKA 4BRGA 2XVCA 3P9CA 3FE1A 5CVIA 4ESJA 2HDCA 3WGIA 1B1BA 1DKGD 2VE9A 2QQBA 4LD5A 2STWA 4XRFA 2HYFA 4KDPA 1ZRCA 1KQ9A 3DF8A 3ZMZA 4IXCA 5E1WA 4EV0A 2EA4A 5AQWA 2OU2A 4H0TB 3K9TA 2Q1NA 4ENKA 3ZN0A 1IJJA 1HKTA 5K5QA 2ASMA 2RDPA 4HWIA 3ATUA 5HS8A 4DQ2A 5CVVA 2XAQA 1RIOH 3U9ZA 4NO7A 4BHCA 1LQ1A 5DEQA 3F8CA 2FRHA 1IXSB 2CGLA 2K02A 4KN7X 2DAOA 2EFQA 1GLFO 1ZG3A 1KU7A 2ZO4A 1QO0D 4HOBA 1ATNA 3I0TA 2D1KA 3QDKA 2H94A 5DDGA 3VOEA 1FOKA 5E17F 4MTEA 3WXJA 4KN4X 4FPBA 2V1DA 1KAXA 4BXUA 1TQIA 4A5MA 3EO3A 1O3TA 5KK1A 3V4GA 4R79A 1O7FA 5HS9A 1DPUA 2FLOA 4MNUA 3U9DA 5HS7A 5FD6A 5IT9K 2K7LA 5AQJA 4JD2A 2GEMA 3LL3A 3GF2A 1U2VB 1G4DA 2DQRA 4G7HF 4NHJA 5AQNA 1XDUA 1ZG5A 4WQ4A 3FXQA 3DXMB 3K2ZA 2ZGZA 2NYXA 2CH5A 4L5JA 4L9NA 1ZYRF 2ZKZA 2LF7A 4H0PA 1T38A 2GWKA 1IRGA 3R8EA 4H0XB 4G6QA 5AQVA 5BREA 2F5CA 4A61A 5F0XA 2O6GE 2FNAA 3ELKA 3BPXA 3E5XA 4BR5A 2A6HF 1P2FA 1WI9A 3LAPA 1RFQA 1HX1A 4CBUA 2HR3A 4BQLA 4AIKA 4HV5A 4L9JA 3QP6A 4WYBA 1BN5A 1KU2A 1L0OC 2MA3A 3LDQA 4HTLA 1OYWA 5D5XB 3JXUA 3ERED 1EH6A 2DPDA 1IAWA 1YG2A 1MWKA 4HA8A 1SAZA 3R6SA 5H6QA 3VEXA 5A2QZ 3HRMA 4BRCA 1G3WA 1R7JA 3K0LA 4A6DA 3ENOA 4G94A 1NBWA 4BR7A 4EMSA 5LHHA 2MH9A 3MCZA 3ATVA 1T0FA 4UV8A 1QPMA 1B9MA 1U5TA 2Q2RA 2QUFA 2JRTA 3B02A 2QWOA 1JHFA 2O03A 1WRJA 1D8JA 2XKOA 4BVOA 5ICCA 2QENA 4YFNF 4ZH4F 4Q5SF 1QGPA 4HZFA 2VT3A 4L18B 1J7KA 4QS7A 1IZ1A 3KE2A 3M9AA 3RPUA 1U8RA 3VF4A 3WGGA 5ICGA 1I6XA 5AQOA 2Q0RA 2CW0F 4MQ9F 2FF6A 3V7SA 5ED4A 3O6WA 5AQUA 2VC0A 5B8HA 3V8KA 3KZZA 4EJTA 3KHYA 3CQXA 4FWOA 3KLNA 3TPQA 2GTDA 3FLCO 2G7HA 4WF2A 4A0ZA 5AIPA 4CBXA 4MEYF 4BC3A 3BJOA 3CTAA 1OPCA 2EJRA 5EOYA 3BF1A 3L4IA 1ESVA 2W24A 3WE2A 2F5EA 4BROA 3LQRA 2FEZA 4RGSA 2PEXA 3GE1A 3C7NB 3IL2A 1NMDA 5L3GA 4A0YA 5AQKA 3M6GA 1R1VA 4LJZF 5DUIA 4Y0WA 3GZ6A 3QAHA 1C0FA 3H45C 3M1FA 1R00A 3BY6A 1ZGAA 2P9LB 1LNWA 3ZX2A 4GYGA 2BV6A 1V3FA 1U3EM 5E84A 2E2QA 4KYWA 2P8TA 1DP7P 3WXLA 2WWYA 3SQNA 5JI6A 3VGLA 2P9UB 1HXDA 3LFKA 5AQGA 2QXLA 1ZLJA 2AXLA 3HHHA 2RQPA 4BRAA 2D2WA 3FXRA 2E88A 4M73A 4GXOA 4OMYA 1AWCA 3VGMA 5D6EA 1K7AA 2QWWA 1YS6A 2DQLA 2P9KB 4CZHA 5BRFA 4UNOA 1S3XA 1I27A 3ENHA 1Q1HA 5JR3A 1EV7A 5BR9A 3AAFA 3PFIA 3H46O 3E6BA 5AQLA 3CJCA 4KT5C 1BIBA 4ISEA 3V7RA 3EUHA 2P9PA 1YS7A 1YQAA 2H27A 4PCQA 4JHDB 3CUQC 1XSXA 2P9NA 4EIAA 1TQMA 4DHYA 3K69A 1U6GA 3CJNA 2XAFA 1H0MA 3O3KA 2EB7A 2ASPA 3CERA 3FM5A 4K41A 3HTSB 2H6CA 5J8FA 1HKQA 2Q0UA 1P6RA 3WGHA 2P5LC 4M63C 2BBYA 3CIPA 2ELHA 4LK1F 2W41A 2EV0A 3VETA 4HX8A 2GA2A 3S2WA 3LAJA 2F9TA 4H5RA 2QWLA 3WQUA 5K1YA 1LDKB 5L3DA 3FZKA 2I7NA 4A62A 3H3UA 3WU0A 1IF1A 5AONA 1SAXA 4RB1A 2O61A 1HKGA 1QQOA 1T44A 3DJCA 3QU3A 4B1YB 2PN6A 1NGFA 2HWVA 5LGTA 1ZBSA 1JGSA 1P4AA 4IVNA 2H3GX 3M8FA 4BC4A 3QBXA 1HW1A 5BS6A 2DO7A 2C6YA 5F64A 2E1NA 5AQXA 4LFUA 5E8IA 2YX7A 5CVJA 3GFMA 3UKRA 3ZMVA 3FMQA 3QMLA 1KYWA 4EJUA 3MK6A 4CZGA 5AFUH 3PQJA 4XH5A 4BH9A 5JFRA 4AD9A 3SLCA 2Z99A 2MLGA 2EFWA 4IXAA 2VBXA 2L4AA 1XGSA 5DCFA 2FA5A 5AIQA 4PDKA 3O2PE 1J75A 3AAPA 1KAZA 3JTHA 3GFLA 5BRHA 2D0PA 2EV5A 4HYEA 2ZNYA 4WQ5C 2QBYA 3H3OB 2R7FA 4KMUX 1NGHA 2P9IB 1OKJA 2PMHA 1G6NA 1KA8A 1J59A 3WTSC 1QNTA 4I98B 3M8EA 1USSA 5E18F 3MEXA 6PAXA 3U2RA 3TDUC 2Q31A 3GUDA 5E1XA 3C7JA
chains in the Genus database with same CATH superfamily
1ZTRA 2CU7A 5CE3A 2MH2A 4OPHA 3BP8A 3ESWB 4BEHB 2JQ7A 4CEEA 1DDNA 2HEOA 1S1XA 2FUG2 2Q36A 3S41A 2R7UA 3ZSWA 4MO7A 1A35A 4ICLA 3HP6A 1VQ8I 1D8KA 2LSOA 3Q5FA 2ZBKA 4U7BA 2HTJA 3U21A 1Z6RA 2R7XA 2PBIA 1E0EA 4CGDA 2VJIA 4RAZA 3R3LA 4KIGA 3ZT3A 4A69C 3A0IX 3LZJA 1OLTA 5TKYA 1JXSA 5D8KB 4K25A 3GBGA 4C23A 4DKWA 5EF6A 3SAFA 5J2PA 4ENMA 4FJMA 3SBGA 4DU1A 4OAYA 4EJWA 4IHWA 2M5WA 4H4KC 4D5FA 2DLLA 2W6KA 5J3LA 1YJ9N 4HSTA 1REPC 2D1VA 2VJ5A 4AWXB 4UHTA 1UAAA 4L3QA 2P7VB 1RNHA 1S1TA 2RKHA 3M4OJ 3BG6A 3O6BB 1FSHA 4FT8A 1QQCA 2LMDA 2Y48A 3TU5A 3THVA 3FBNB 4K42A 3E6CC 4XLFA 3H3NO 4I2OA 2NVTJ 2JSCA 3TSUA 2HVHA 1X1DA 1OYYA 3K7AJ 2ECCA 3F22A 3R9PA 3NQOA 3CCVN 4N76A 4ZDLA 3U1DA 1GLEG 1VNDA 1GLDG 3CC4I 3AG3H 1F43A 1IW7F 4IEEA 2BDPA 3DP7A 1JKHA 3IUOA 1R36A 1ZR4A 4CHNA 5DD4A 3D5RC 1X9MA 3CFPA 2HQ5A 3RPQA 4C3IJ 5C12A 4TV7A 4BQOA 1IBKK 3LSMA 2Q97A 4OIRF 2BANA 2HFHA 2VKDA 3FHNA 2PBDA 2E35A 1P8ZA 4YOYA 1PUFA 3TARA 1H1VA 3DXMA 2Q2EA 4BRDA 1I1GA 1I39A 1XGMA 3I71A 4EJOA 5ILUA 5CYMA 2MFZA 4PA1A 4AM6A 4ASNA 1S9EA 2NS8A 3O9SA 3R1XA 4HDUA 3SQ0A 1BR1A 2OCEA 4O6JA 3CO6C 1PP7U 1SKRA 4BQAA 4CVNE 2EFPA 3L7WA 4QPQA 5BPDA 1K73O 2CUJA 2FE3A 3R6MA 1YLFA 2HF3A 1AA7A 2VBZA 5FD5A 5GAGJ 4F92B 4X6AJ 1QU3A 3HSRA 4XLPF 2WAEA 3PY8A 2KPMA 4M3EA 1ATSA 2VYPA 1WJDA 5CYVA 4FL9A 2V9PA 5AQSA 3H9QA 3W3CA 1HQCA 4CCNA 4DG1A 2DA2A 2YPRA 5ILVA 5CZ1A 1UOCA 1JGGA 4UQGA 2IW5A 4IX7A 4OMZA 5KPRA 3NE6A 1RTDA 1UB9A 4Z4EA 2ZMEA 4ZC3A 1NU0A 3NF8A 2L01A 2FJ1A 2EWSA 2P9SA 2Z1GA 4CBWA 4CI6A 1EO1A 1KONA 4GMJB 1HNWK 2CG4A 2OYQA 3H0GJ 4B8AB 3JR9A 5GTIC 4M3WA 1FBSA 1JUPA 1KXPA 4M6YA 3NH2A 4U0WA 3LM9A 3QIPA 3VA0A 4ANJA 5AQFA 3JAMZ 4IOAF 2WAFA 2JWTA 1HC8A 5AQPA 3F73A 4Y15A 3HHGA 3FZFA 4CZMA 4M6XA 2WBNA 3PO2J 4RTFD 1FMWA 2DJNA 5EXWA 1HKCA 2B4JA 3HVRA 4NXNK 3RKQA 1OCTC 1UWBA 1X1PA 5M1OA 4IBNA 4BG8A 3TMOA 1YE9A 2MW8A 4BG9A 1O3QA 2HQRA 3VQ4A 4RGXA 3F8NA 1E2XA 1FC3A 1X4PA 1J5EK 3FK6A 2ZB9A 4U7DA 4YG2F 3WUHA 3CCLN 1C0TA 2HOEA 4AIDA 5FLXZ 3SNNA 3K6GA 1TZLA 3L09A 4S05A 1RUNA 2OPSA 2KKOA 1Z7UA 3PV8A 3I55I 2GWRA 1OCOH 4GCVA 2Z1JA 3V1OA 3HB9A 2V7FA 2HW3A 4Y1DA 1TT5B 2E60A 4A2UA 1D9FA 3HVTA 3RSEA 4I2PA 4AM7A 3A0BC 1Q18A 4E7SA 3BUZB 4FM1A 2P9PB 3M5RA 3J7AO 2UUZA 4OGEA 2IRFG 4DSIA 3BQZA 4HBLA 5EEGA 1YUWA 5CVRA 3HOSA 1T39A 2AS5F 5J1UA 1LPQA 3W6JB 3M8PA 1SC7A 2NOJB 5AQZA 5HROA 2L54A 3HTVA 3KZBA 3GTOJ 4DR4K 3WXMB 2LFBA 4BREA 2DK8A 4BR0A 1VQMN 4G8XA 3FBIB 2X48A 1WZ2A 3UKGA 4FE4A 1IRXA 2XRLA 2HOTA 2KTQA 4L9TA 2V1UA 3LSTA 1NK9A 4B9TA 3CD6N 2HGCA 2ITMA 4S04A 4AHSA 1VSIA 3HRUA 5HNFA 5E79C 3H36A 1ZLKA 3HM5A 2HNDA 2E5LK 4EVIA 1YJWI 4IHSA 4IHYA 2J5PA 1FP2A 1TGOA 2B6AA 2ZWHA 3EYIA 4ZTJA 2FBVA 2KW4A 4JAXA 3ZCMA 1D9DA 1ONVA 3HDDA 3JYTA 2DOAA 3LSIA 4GV3A 3LA7A 2DMUA 2QWRA 5EJCA 3D1NI 4XKVA 3J7ZI 1QHGA 3MZHA 4DTMA 3PM1A 2JA7J 1JLAA 3C6TA 2BHZA 2UXDK 5C0YA 4UB8C 3KWGA 3CUQB 4RAYA 4UVAA 1MH4A 5DTDA 4J19A 3OL4A 1EP4A 3LDPA 5JLWA 3MWPA 2ZM6K 3NDKA 1A6IA 2PLYA 1HNVA 3RR7A 1W0TA 2WC9A 4LFAK 4CO8A 1FYMA 3Q0VA 1HKBA 1TL1A 2VJJA 3IKTA 2QA4N 2Q3SA 1FOWA 4M9XA 3GX4X 3F9MA 4Y3OA 2IS4A 4ILGB 1VQ8N 5TISC 1VQ4I 5LGUA 5KHDA 3TWHA 2ICWG 3GXOA 3WTYC 3O5BA 2HVQA 2XGCA 3LDLA 1MZBA 4ELVA 1E3MA 2ATQA 2V9VA 4XRSA 2CV2A 4HUEA 4XM3A 2A61A 1GDTA 4EHUA 1VSLA 4JKCA 1ZBUA 1J0RA 1X9SA 1LV5A 3D6RA 4EQQA 3GZ5A 4K43A 4DF8A 1TVRA 2P5VA 3SPYA 2F6CA 4RLQA 3VYTB 1APLC 2HSTA 3KETA 1K4SA 1R5HA 4R1HA 4RM3A 2YUSA 2BOLA 3F8FA 2YCHA 5KTQA 3H35A 3I55N 4PK4A 2QQ9A 4NBQA 2RV8A 4A3JJ 2VWKA 1Y56A 4D9JA 3J8AA 3G6EI 2JUCA 3HRTA 3HM9A 3C18A 3VA3A 2ZFWA 2MYSA 4F52A 1DGRM 3ZMSA 3LP3A 1YTAA 5GADJ 3VF6A 4XMYA 3HPOA 1CZ9A 2CV0A 3SEQA 4BL0B 3O4QA 4FWLA 1T7PA 2K85A 2OF7A 3RKYA 2XHBA 3OW2M 1NGIA 2STTA 3O9UA 3KP6A 2ASOA 3NWTA 5HDGA 3CJBA 1RT1A 3G2BA 4QS8A 3DPLC 3ZT1A 2FX0A 3A02A 4RGUA 3PIPF 3RKWA 2VPLA 4DTSA 4E7KA 4FSVA 2G8VA 3ZETA 1A5WA 5BPNA 5C10A 1N32K 2RNGA 2CGKA 4M45A 4BRPA 4CJQA 4XICA 4EAHD 4YRVA 5M1FA 4KHWA 4IDHA 4UXNA 2X1CA 1WHUA 1Y97A 2UV1A 3LDSA 2L7ZA 5C25A 4IEJA 1WNSA 3VQAA 5LY3A 3AVAA 3K5NA 3J81Z 2CGPA 1JLBA 2DPUA 4HV6A 2V6EA 1YF5L 4MTDA 2O7OA 2FSNA 1VQON 4M3YA 4DFPA 1HPMA 3T5XA 1XSVA 4A5AA 3FHZA 3I64A 3KPHA 3CJ1A 4C8OA 3AVCA 3Q3SA 1W5CC 4DGWB 3S3NA 4UUVA 4Q5VA 2RE2A 4U0YA 2GUPA 4X62K 1NKEA 4KHNA 3MAJA 4MDAA 5FKKA 1N25A 3CCUN 1MW7A 5C42A 1E4FT 2Q0OA 2NNWA 2A1SA 3F2KA 4LITA 3M3ZA 3UB5A 3QPSA 2BY0A 2KISA 3KVGA 4NLCA 2IVOA 5K5OA 5AQIA 3KP2A 4XSXF 1PJRA 1S1WA 1SFUA 4DZJA 1YVNA 2DFFA 3MFKA 4AHTA 2IGMA 1P9QC 3T3FA 2X6YA 3SQ2A 2BW3B 4E7ZA 4FZYA 3OJUA 4BRNA 4RDUA 1A31A 1B9DA 4RWTA 2QWPA 2OA8A 1KU3A 4HNUA 4XH1A 1BHLA 4II3A 3S1RJ 4ZYEA 4FLZA 4UB6C 1MKMA 1YT3A 3LSJA 4A59A 2HTSA 2CSOA 1SANA 2GA1A 3OYGA 2FU4A 1M1EB 1RETA 4PL7A 4ON0A 1BISA 4WK8F 4MGRA 1HA8A 4WX9A 2E6LA 1ZGJA 2LD5A 4CEDA 3IH4A 3OYLA 1B72A 4CJLA 4DR1K 1MBHA 5FPDA 2X51A 1S7OA 4E4HA 5AQYA 1L3UA 5FDLA 3OV8A 2IA1A 5D3GA 3Q0UA 4DR7K 4ZHRA 4I0BA 1TUUA 3K4KA 4W5RA 1J09A 3P7NA 5HNHA 4NXMK 4KI4A 1MBEA 1BC8C 4XLHA 3T69A 1TKTA 3TO7A 4HDVA 4YNQA 2A5XA 1TL8A 4BRFA 3K5MA 3HUGA 4V19S 3PX0A 1LEAA 2PQ8A 3BF3A 2EIJH 2ZJRF 3LAKA 3K1MA 3BTJA 3W0LA 5EDNA 3B6CA 1ZKGA 3JSMA 4ESFA 3QB0A 3OTOK 4CYCB 2QA4I 1UA0A 4W5TA 1ILYA 4MQ3A 2YNFA 4XEIA 4WWCA 2DA1A 3CM5A 3IDHA 4B9QA 5HVQC 3ID6A 3A1YA 3ROUA 1V4SA 3ZSQA 1FIAA 4WCGA 1WWXA 2HZTA 3DCFA 4XOPA 3ZMDA 3OY9A 3WQTA 3J80Z 1SMTA 4IJNA 4WFAL 2JGUA 1NG6A 4LF9K 2Y1IA 3H3ZA 2L9RA 4QWQA 4NQWB 1T33A 1QQIA 2D5VA 4IQJA 2P9UA 5AQQA 1E17A 3F6OA 1BA1A 4BDPA 3ZQGA 1Z6TA 4CFCA 3BG5A 3VSLA 3HOWJ 1RESA 3VWBA 4GY2B 4DR2K 3VPZA 1U04A 2DFHA 4K0KK 2NS7A 4G7ZF 3HP9A 4I7FA 3TAMA 4HLXA 2LR8A 3ID8A 2VBYA 1ATRA 2X6SA 3TR8A 1VF9A 3RSEB 4B44A 3VERA 4RW9A 1SVOA 3AFHA 3ZETB 5KPTA 5KRSA 1MIJA 4IJAA 3OYNA 3AA2A 5BN9A 2OC6A 2KRFA 4CHOA 1Z9CA 1S6QA 1L5UA 4E7LA 2VBWA 2CV1A 2CQXA 1SZ2A 1MGTA 4DV2K 1DEJA 1U4BA 3SQ4A 3THWA 2PFBA 5AZIB 4BHBA 1W7AA 1VSJA 3CC2I 2BHYA 3S93A 3DPTA 3P5JA 3FFIA 4XLAA 4FWNA 1V4TA 2QKMB 4LF4K 1VTNC 3QYFA 4KISA 5HDKA 2ZF5O 5JLHA 1G99A 1BM9A 1KU9A 4KIFA 2OPTA 1ODDA 4B9UA 1BI2A 3VTHA 2YHYA 2LG4A 1K78A 2E20A 3Q9SA 2V7ZA 5E20A 5KI6A 4I6ZA 3JRHA 4QAGA 4JK8A 2FD5A 2ME0A 4JKBA 2IA2A 2XGDA 4HLYA 4WE1A 1S72N 1QTMA 4B43A 1BJAA 1W7PB 1RKTA 2YSRA 2HZDA 3L2UA 1SD7A 2DOEA 2L7FP 3I53A 3MN9A 3DTKA 5JHUA 4IG3A 3BT9A 2BE2A 4PKIA 4C9YA 4ELUA 1ETOA 1F9NA 1XCBA 3ASOH 3VTIA 1YX5A 4C1NK 1U45A 2Z1HA 2L02A 4LB5A 1JXBA 3CMMA 1SKSA 4Y7NJ 5GP9A 2O8FB 2TRTA 3Q9VA 1RBUA 2LH9A 3HZ6A 1HJRA 2NS0A 3G1MA 2ZNZA 3HGYA 4CDGA 5E1ZB 1MMNA 1FSEA 1TNSA 1BIAA 1UG2A 1XGOA 3OIQA 3V7CA 4BU2A 3HKZA 4QSHA 1WAJA 4BVPA 1K78B 4KFCA 1ZYQA 1N34K 4BQQA 3W2WA 1U47A 2CW8A 1KYZA 3BEXA 4M7XA 5J1YA 2RC4A 4OIQF 3OIOA 1N77A 1IGNA 2VWJA 3BROA 5JVGF 1FYKA 1VQKN 1K83J 2V79A 1H8AC 2P0WA 1NK4A 3R60A 1YRNA 4Q4ZF 4XSZF 1T03A 1T6SA 3TSPA 1CF7A 2W00A 1MBFA 2JSPA 4B1XB 4W97A 5EZGA 3CCJI 1VSKA 1XQSC 5AZJA 3C95A 3OYJA 2AA4A 2VQCA 3F23A 3S1NJ 1CQTA 2DCEA 3ISPA 4C2MJ 2KZZA 3V6DA 1GVJA 2WFBA 4JBAA 1LWEA 4FOEA 3I4PA 2XB5A 4IOCF 5E26A 4PGHA 2KP6A 1ZAOA 1X3NA 3F6VA 1SUQA 2BY3A 2DT7B 1JKPC 2NZTA 3H6EA 4EFHA 5ICEA 4WCEL 3IRQA 1BGXT 1FYLA 3AVHA 3CCSN 4AQYK 1O3RA 4AHRA 4O3MA 3WEEB 1K8AO 2ZJ2A 4LF7K 1CXUA 4AHCA 2WA0A 5GAHP 3C0BA 2OZUA 2OPPA 4NYFA 4U87A 2L3DA 5FB2A 1J53A 4PL8A 3WT0A 3AA5X 1TKDA 1MJBA 4O4GA 1T3VA 4Z4HA 4IL6C 1XMAA 2M30A 1ZH5A 4HNVA 3MX5A 1HCRA 2QTDA 1XWLA 3I8DA 3I0RA 1FOXA 1R59O 4AVZA 3E9OA 2D0BA 1BCMA 4Y13A 1TL3A 1YJNI 2Y9YA 5BN8A 2UXCK 3RPUD 4MLEA 4NCBA 4CCMA 2QEXI 3NARA 3ML6A 3WEEA 3HIFA 4BXXJ 5GAGP 4KUMA 2XUBA 5B1AH 3JRDA 1RT7A 4CCKA 4M3RA 5LJWA 1YO5C 3KP3A 1BI1A 4FCYA 3V9WA 4M3DA 3V8LA 3KYLA 1D1BA 2KDZA 4OPKA 1YW8A 1RNLA 1EQYA 1ZBFA 3A2KA 2D4WA 4PKGA 1WKMA 5FFXA 5C44J 4L0ZB 3CD6I 1S1UA 4E7JA 5AFUA 1JI8A 2PY5A 2LKSA 1IXCA 2VKVA 3KEOA 1ON1A 2KDOA 3V42A 5CLSA 3UE5A 4LF8K 1VAZA 2XY6A 1YYVA 4DQ8A 1IKVA 3LP0A 4S0HB 5D8LB 2M7AA 5KVRA 3L2RA 4KA4A 1MBJA 3CUQA 5DV5A 2NVXJ 4Z4GA 3DWLE 1VZ0A 4CXFA 1DT9A 3J81O 1Z21A 1ENHA 3M1EA 5CKTA 1TUYA 1IN8A 3O1WA 2EFOA 5M5YJ 2D5RA 4WXHA 1HYVA 4JHDA 1R4MB 3NGIA 4B9NA 3QRFF 4CK1A 2ID3A 4C3HJ 1ZBHA 2H8WA 1P4WA 3IMXA 4NCAA 4BR9A 3TAPA 4G6TB 1FJGK 2E2NA 1R4NB 2BTFA 2QKKA 4B1RA 1K6OA 4HQEA 2P7CB 4ZYDA 3S14J 3BG7A 3AY9A 5CR4A 2JK3A 4DSLA 5DYMA 1GLBG 5IOZA 4GV6A 1W7PD 5H20A 4BS9A 1HR0K 1VQ4N 5FJ8J 3O9RA 4TSXA 4ID1A 1XHZA 4B3SK 1R49A 3EL2A 5DCMA 4HX4A 2B63J 1I6HJ 3KLGA 2XHKA 2UUBK 3LALA 3TP0A 3T8TA 2YHWA 1S1VA 5MLCQ 4J2AA 3KLFA 2B7EA 3KK2A 4M6VA 2BGGA 1HYZA 1JTYA 4P96A 1XD7A 3LSHA 4K2EA 2V1XA 4CCLA 1USTA 3AO4A 4KH6A 3KK3A 2KZVA 3NBPA 5BMZA 1KFDA 2FQ4A 5IYCJ 3OYFA 2E1YA 4JK9A 4DQQA 2OZSA 3KLIA 1TWGJ 4XN3A 4ENJA 1LWFA 4YIFA 4RB2C 2QLZA 3CZ6A 3CO7C 1NWKA 2K5CA 1TWFJ 2EH3A 3HRSA 2DTRA 3SZTA 2O8KA 1SD4A 3GTLJ 1JCFA 4ESBA 2HB5A 3CCMI 5AR0A 4M7YA 4BWJA 3TTFA 5DCMB 3S2HJ 1VQLN 5D5VB 4HF0A 3S15J 2V4JC 3THWB 5I3UA 3FX3A 4E6KG 3CP8A 2GM4A 1QZ5A 2CS3A 3P4IA 4JKEA 4JI2K 3LWLA 3PO5A 2FMLA 1BI4B 1P92A 1T8IA 3F8MA 4CHQA 4F8RA 2JVHA 2P4WA 2EIMH 3K58A 3RRHA 2ISYA 4FZXC 4LGWA 2CGJA 3KZIC 4NUBA 2GUIA 2A5WA 2L0KA 3LDNA 5EX5A 4O0IA 3K9KA 3PSIA 1R6RA 5LGNA 3AVLA 4B3MK 4FJ7A 3PUFA 5FO5A 1OR7C 4UUTA 4FVMA 4E19A 2F2EA 2D0OA 3WTUC 3L0QA 4EZ9A 1XC5A 3V9UA 4NLBA 1Z1DA 4FETA 3MMYB 1T2KA 1A6QA 1D4XA 3LDOA 2P9KA 3P1GA 1NK8A 2FC0A 1G3SA 1ZHFA 4BE2A 3QWLA 5CVUA 3ZQHA 1JKQC 1AOYA 3G10A 4IO9F 4FJ8A 1JHHA 4MO5A 5BPMA 4H0VB 1QZ6A 4CEAA 3OIPA 5J2QA 1MMDA 2HYGD 2DPNA 3QYEA 3KP7A 1TYQB 3V9ZA 5LRSA 3SUOA 2AHQA 4DR6K 3ZXSA 2IA0A 3D0SA 3ECHA 2ZMEC 3AAQA 4M42A 1U5TC 3J7ZO 2K9NA 5J40A 1GOAA 4CZZA 1RDAA 4F9OA 4CICA 4RW7A 3O08A 3BG3A 2YI1A 1GV5A 4AHVA 3ALYA 4B3TK 2FXAA 3HSFA 4BR2A 4FLWA 2JN6A 3DU5A 4B47A 3QU6A 3T7ZA 5AQRA 4HTUA 2BGCA 3LA2A 1IN6A 3DXKA 3SHFA 5LLQA 5HLTA 4LH5A 3VEVA 4M41A 4JP0A 4ZZLA 3LWFA 2WONA 1BJZA 5HLIA 2IT0A 3KCCA 1EWRA 1FZPB 3ZSOA 4ETSA 4BGAA 1YHQN 2KT0A 3J7YJ 3FXUA 1T6CA 2ME6A 4OWRB 2IVPA 3IC7A 1JJ6C 3C7NA 4PUSA 2PMUA 2QQAA 3I58A 4FXDA 1F1ZA 1DU0A 2ZGYA 4BR4A 1JTXA 4H5NA 3AG1H 3OOPA 5HDNA 1LW0A 1QZZA 1O57A 1Y8QB 4PGGA 1D3YA 2K86A 3CF2A 3EQLF 3W6KB 1RT6A 2WTEA 4JKGB 1ZRFA 3BR3A 1OCPA 1YJ9I 1X1CA 3HJEA 3LQQA 3OYKA 1X3MA 4HPQA 3SI6A 2HMPA 3NH1A 1BI0A 2DTUA 3B6PA 1RT2A 1YAGA 2I5JA 3D2FA 2GXAA 3WNHA 3K10A 3M7GA 4A3KJ 1H9TA 2LY2A 1LFUP 3EKUA 3EDPA 5M1NA 2OBPA 2FOKA 4QCLA 4O5BA 3NVMA 3GCMA 2LDUA 1Z05A 3ZOBA 4LH4A 3D5LA 1R1UA 3T8RA 3WODF 1OCZH 3MKZA 1BG3A 2YJEA 1Z7LA 4F3QA 4JX4A 4BXFA 2BE5F 1WH7A 3WU1B 1NG9A 2VXZA 2E71A 3TOAA 4KTWA 2RQQA 2A68F 4Z2YA 3CI5A 4I6MA 3T1BA 5DUKA 2IAJA 2CUFA 4XL9A 1CF7B 2ZXHA 2HHXA 4ZJZA 1K8KB 2L9NA 2Y1JA 5BQTA 5L3EA 3G71N 2VGNA 3SQ1A 3QODA 1RDDA 3SDBA 1HDDC 4JKHA 3H5NA 3DKYA 2GIVA 3K70D 1QSSA 2IVNA 4ILHA 3I59A 4AILC 2CQKA 1OVQA 2K3FA 1W4MA 4AC0A 2QKLB 2Y69H 3KP4A 1S9HA 3SZPA 3CCLI 3F5TA 3MXIA 1G3YA 1ASUA 3KD1E 4Q47A 1N36K 4XBFA 3V81A 4KHQA 2GQQA 2KIMA 1VQLI 1VQPI 1T0FC 2IPQX 4HSRA 3E6MA 3EYZA 3R0AA 3R61A 2QWMA 3CYMA 1NG7A 1D8YA 2B0LA 5K7ZA 3WTWC 1I1SA 3KKSA 1S9GA 4O8KA 2ZJPL 1G59A 4JRQA 3OS1A 2CFOA 2NLXA 5LJVA 3JRBA 3F0CA 1JKRC 4JI6K 1K9MO 1WJ5A 2BUPA 5C4JJ 4BRQA 5J4YA 1KRPA 3RDIA 4KICA 3UIQA 1C1CA 3KYDB 1JE8A 4U0VA 3AVJA 5HRPA 1SFEA 2YR2A 1FP1D 1FY7A 2Y0MA 2R7QA 4P9FA 1C0UA 5EG0A 2CYYA 1RZ4A 3CLOA 4B09A 3VEPA 4ENNA 1XS9A 5GAEP 4WXDA 2LREA 2CWEA 4CF8A 3GMEA 4CH7A 3AO2A 3QFUA 2FBHA 3VFZA 1W5TA 2FSWA 2O0YA 4X66K 3MWMA 2VCPA 4XIUA 1YI2I 2D1HA 2WB1A 5BRDA 4D7MA 5ILSA 2FBXA 2F9WA 1TKZA 2ID6A 4E7HA 3WHCA 3IUCA 2ZMEB 3JRIA 4YHHK 3V9SA 2GX9A 4AU7A 1WLJA 5LHIA 1BI3A 3VSKA 1C0WA 2FBIA 2ESNA 3MZYA 4C8MA 3QBWA 3S3MA 3CG7A 2KLOA 4LLGF 5L3CA 2X0LA 2UWMA 2J4RA 1DGWY 5TKWA 2H1LA 3G3ZA 3MWTA 3NEUA 5CPRB 2VODA 3OBYA 5IP9J 2EA2A 4E1NA 3FKIJ 1WJCA 2OTJI 1LOTB 4M3BA 3U4LA 4FJIA 1CXQA 2IGKA 1NK6A 3O8HA 1UFMA 3IKVA 3GBTA 3JSPA 4DTRA 3CFOA 3NRVA 1JXEA 2QYOA 5AQMA 1FKPA 2MD0A 3K9JA 1IC8A 1MSFC 5EZHA 3C3WA 4E3SA 4JK1X 2LBFB 4FJ9A 3DBRB 4O44A 4FLUA 3JW4A 2DFIA 1BC7C 4UVCA 3H08A 3MN7A 2GXGA 3OYCA 3E3VA 3SMPA 3SXYA 1NLVA 3DOLA 3E6DA 3S1MJ 2Q2EB 3ULEB 3FMSA 3DRSA 4MDBA 1IN7A 2XY5A 3SUPA 4RM2A 4G1QA 3VEYA 1YTYA 1WPKA 2XV4S 1WBBA 4BRLA 4BY9C 4B1VA 3P9KA 2IS3A 3IS9A 4O5FA 2KJCA 4WQ4C 3TO9A 3O80A 2G8UA 3WXIA 3PX6A 2HU9A 5IT9O 3KFWX 4B3RK 4NC8A 3TEDA 1O3SA 1MBKA 2M3AA 5E8GA 3E1SA 2Y0SA 5H2FC 2PAVA 4DV6K 5IPAA 5SWMA 1OH6A 4C8KA 2YKNA 1BO5O 2R7SA 1VQ5N 3CUOA 1XI1A 2QSFX 5D5UB 3NGZA 4CZLA 1RC9A 2KHMA 1T6DA 4RW4A 3E9PA 1QZEA 1Y0NA 2OV7A 3OYBA 2A6AA 3MXMA 4B4CA 1VQNN 2LY9A 2BEOA 2R5ZB 3TO6A 1JCGA 3QETA 1KVBA 1O7LA 2WV1A 3ZCOA 4DBRA 4JLHA 4L9VA 4LLLA 2V52B 4KH5A 4DJAA 5LD2C 3CJAA 2NVQJ 3KTQA 3ZLJA 5F6FA 2GZWA 5K7HA 4D1QA 3GFIA 2A5YB 4FWKA 4CK3A 3G0ZA 2RGVA 3T1HK 1NK5A 1Z25A 3KEQA 2XPUA 5TRDA 1XMKA 4XKWA 3CETA 4XLCA 4FWSA 4LC9B 3O8MA 5F1RA 3ZMUA 1RBSA 3I8BA 2VB6A 2LSNA 3LANA 2BZTA 3E5UA 3SJJA 1EJ9A 5J1EA 3RMAA 2HHVA 2P5KA 5LRRA 2HMIA 1L3LA 1HOMA 3QNNA 4CYDA 3CM6A 1Q8IA 5TJJA 2WC2A 4CHZA 3K5LA 5ICFA 1IKWA 2E7XA 1NGCA 2G8IA 1H9GA 4MLHA 5HLGA 3CFRA 1IUYA 1Z91A 3F21A 1I50J 4QTRA 1JCEA 2LNBA 3M1CA 5D5WB 1HLVA 4FO0A 2J5OA 2OD5A 3GYHX 4OU0A 3A03A 2JA5J 1B8IB 4ZYHA 1EETA 1RKWA 1FT9A 3ZSZA 3QESA 3TI0A 2XROA 1A5XA 1IG9A 1XPXA 5DMRA 2DA5A 3QP5A 3DKXA 2VL8A 1XUPO 2XPWA 5D4SA 3TTCA 5E1XA 2I8DA 2ISZA 1HQEA 2HHHK 3CLQA 2WAQA 2GAUA 2KMUA 3EUHC 3K4BA 1IJWC 1BWFO 2WOMA 4KBOA 4FJJA 2M0CA 1F4KA 4RW8A 4W1UA 1R0AA 3VQ6A 3OR1C 1QHTA 1D0XA 3GWZA 3FM3A 5K5RA 1S6PA 1X9WA 1OKRA 1OYIA 3EUAA 4N9IA 1XN7A 3SJMA 3COAC 1MJ9A 2A40A 1BI4A 3RYPA 3I56I 3MX2A 4BGDA 2MC3A 3MDQA 4FE7A 4N9HA 4NQWA 1GHCA 4OKKA 3BR1A 1PUFB 1Q9YA 2CH0A 1J6ZA 3H1QA 1HMVA 5HL7L 1WQ2A 3EETA 4GNIA 2QM1A 3TGNA 3GTQJ 1NK3P 1LJ9A 1J9IA 2RNJA 5L3FA 1YIJI 1GLAG 1MWMA 1NGGA 4Z4IA 3KLOA 5FPMA 4M3GA 3O4NA 1RILA 2R7TA 4OOIA 4LB6B 4LG0A 4D0PA 2HVSA 4IFVA 5GPAA 3ABMH 2IBDA 4QLCU 2QSHX 4CHUA 4A6EA 1XC9A 1OH8A 1K79A 4EHTA 2O8BB 3CMAN 3K4NA 4FWMA 3DI6A 3HI0A 2OZMA 4GV9A 2P9IA 2CO5A 2F8SA 1DTQA 3WNGA 1PP8F 4QS9A 5BNGA 5F08A 4KIBA 2CQQA 4IF4A 1GLCG 1KAYA 3JS6A 4YIIA 3WG9A 1IXRC 3HC7A 1WJBA 4BACA 2JZYA 2G9WA 1X9JA 3K2PA 2CW7A 2IS2A 4LY7A 3E5QA 3REOA 5KPZA 1TWHJ 2P9SB 4HAMA 2O9LA 4CJFA 3L9FA 1WBDA 3FWEA 4M3TA 3QYBA 3ULEA 3AA3A 4HX7A 1MNMC 4EJVA 4KJZA 1EH8A 4AVPA 2H8RA 1O1WA 4ISGA 3WTZA 4FZZA 3O9TA 3OOUA 3PNVA 1UCRA 3QPTA 5B66C 2F5FA 5J47A 1VQMI 3HTUA 1ZC6A 3BGRA 4I9LA 4YOUA 4H5WA 1N75A 3QQAA 4Z94A 2A07F 5I42A 2VG6A 2COMA 5GIPA 4MO4A 2B9SA 3I54A 4AYBA 2RN7A 3DYAA 4MHGA 4HRIA 1ACIA 3SMSA 1VQ6I 1TK5A 3ZQ7A 5AQHA 3G4SN 2ZJPF 4CCJA 4CZIA 4E1MA 2RREA 1NTCA 4A5NA 2E19A 1B59A 2E2OA 1ULYA 1MSEC 2R7ZJ 2ZD1A 3IFRA 2GLOA 4DF4A 1NOYA 3JSOA 3L2WA 4W5OA 4M74A 2W40A 3CDHA 4HF1A 4GYIA 1SL2A 4E70A 3P9IA 5KNLA 4CJPA 2M0MA 2K9QA 5E3OA 5EU7A 1KQ0A 5FKMA 1LDDA 1STZA 3C65A 1KFSA 1U49A 1HNXK 3ZQQA 4BBSJ 1ITGA 3GW2A 2KIFA 3ERMA 4LFCK 3I33A 4N56A 1SFOJ 1AHDP 3DBHB 1FBQA 4IHXA 3O1BA 4BRIA 3ULDA 4ZZDA 4PWDA 1C0GA 1JUMA 2WADA 1RTHA 3LNQA 1UAXA 3F3XA 4P55A 3S32A 1RT5A 5EYRA 1XG1A 1U78A 4BGBA 3DTEA 1YX3A 2A05A 3DLKA 3CC7I 1RRJA 1SVMA 2ETHA 1C0MA 3P38A 1XGNA 4I6MB 3C1DA 4PFOA 1J5OA 2K9LA 1N78A 2EILH 3CCQI 2W42A 4DFMA 2YHAA 2IS1A 4O55A 5E41A 2KQRA 2A3SA 3IAM2 2R7WA 2O8CB 3OWTA 1K6YA 1T08B 4KT6A 1FPQA 4OINF 1I94K 2MGQA 3FGUA 1NHAA 2DYSH 2W84A 2ZC2A 3GLLA 1VSMA 2NOGA 4EM0B 1HSTA 3CMEI 1FKOA 2GELA 3CDLA 3CCVI 4AH9A 3CJQB 3FMRA 2OQRA 2XKPA 4JI4K 2DY4A 1KVAA 3WU2C 4C2TA 4EGYA 1SL1A 2A6TA 1U2VA 1WJEA 2Q8KA 5BPIA 1YXQA 2HQAA 4P5OA 2E1OA 2F4OB 4DYRA 1VQ7I 1NGDA 3QFPA 1S22A 4B1UB 2CFXA 2LOOA 4YEJA 1LVAA 1ZRDA 1ZREA 3HPHA 2JUGA 1B6AA 2XASA 2MABA 4IRHA 3HOUJ 4XLEA 2A3ZA 5FPNA 3THXB 4JI7K 2E4LA 5J8CA 2VUMJ 2W48A 3LP2A 1X3UA 2M34A 2NRZA 4CGGA 2UU9K 4PUOA 1FNNA 2LKPA 3F9KA 3IH2A 4BJ6C 4RB3C 1BDGA 3SJHA 4KB0A 4JV5K 5EEHA 1FLIA 1NJIO 3CCEN 4GO1A 3R4KA 4UUSB 2M8EA 4DYQA 1EF4A 2JA2A 1NM1A 1VK0A 4FW2A 4KKOA 1JLCA 1KZHA 3QEVA 4OX9K 3L4QA 1B9FA 3NFAA 1HKSA 2O8XA 3K2AA 2TDXA 4FX0A 3PJRA 1TQPA 4BRKA 5KAFC 3DRPA 3MXJA 4CD1A 1NJXA 4NC6A 4L5IA 3CCYA 5CY4A 3UKRB 4L5EA 3W3DA 1UA1A 5D6FA 2HI3A 2FF4A 2X6NA 1YHQI 5BR8K 2L7KA 5ADXA 4EM2A 3V9XA 4JI0K 1A36A 3IAYA 4B3OA 2ZCWA 4B8CA 4PSXA 2YJFA 4CZEA 4DW6A 1D1AA 1S3JA 2Z33A 3QIOA 3AV9A 1TK0A 3HO1A 1MDMB 3T1AA 1R58A 4BHPA 3EYYA 2HHSA 1GOBA 3IAS2 2HF4A 2GIZA 2M1BA 4BE0A 1C6VA 1E3OC 3N05A 2G7UA 2HDWA 4IHTA 3HJFA 2P9NB 2EQRA 1NGAA 4PQUA 1B4AA 3ONQA 5F1JA 4FM0A 2XY8A 4A93J 1V5GA 4CZJA 3G6EN 3GTKJ 3PO3J 4XORA 2QBYB 1VQNI 2VQGA 3HGGA 2DMNA 2ESHA 3BTLA 2HKOA 5J2NA 3PSFA 5E3LA 2AQEA 3JCUC 3TOBA 1MDMA 2W85A 2JLEA 1XX5A 2A6EF 3FXKA 2ZFUA 3KKRA 4Z6YA 2P5OA 2F4IA 3S9HA 4PJMA 4I0AA 2K40A 1R22A 1ZELA 2XIGA 2VT2A 4UV9A 1ZG1A 2ITGA 4FHTA 3CJ9A 2V1NA 4BC2A 1LFPA 2XPVA 3I9V2 3TAFA 4FWPA 2H6BA 2AJQA 1SEUA 3VODA 3ENBA 1SQKA 3TSQA 2MD5A 4KO0A 4BNCA 2QKBA 3CXCM 3VQBA 1M90O 1BL0A 4P9UA 2O8EB 1KVCA 2VQHA 4EM1A 3VMFB 1WGXA 2I7PA 2UZKA 2X6WA 1BQMA 1EXQA 3MD2A 2KFDA 2W1OA 3BZKA 3S16J 4CJ4A 3MKLA 1W5SA 2E1ZA 3GZNB 2VWBA 1TV6A 2DODA 1KQSM 4B9LA 3G1OA 3I3LA 2X6OA 3IHUA 1T98A 2XGXA 3GTMJ 1JLEA 1GOCA 3OJSA 2R7DA 2EV6A 2OQGA 1S6LA 2D0CA 4OLBA 3NH0A 1BBYA 2FOWA 4ISFA 2ZXJA 3CPWM 2OA4A 3OYHA 5D4RA 4CE9A 3JAMO 4FLYA 3AO5A 5F1XA 5DM7L 2FQ3A 2IP2A 3I5UA 4HEA2 2PJPA 4CD3A 3RMBA 3SCXA 1G8XA 4FJNA 4DU3A 1NK7A 3KD5E 2XDVA 3HKZN 3CCUI 2E1MC 4GFBA 1WB9A 4H0EA 3U9GA 3WNEA 3QEIA 2EZHA 3MZ8A 1EX4A 4CF0A 3DLRA 4JI5K 2ELKA 2NRHA 3ZT2A 2VQFK 1GLJO 4BRMA 3ZGKA 3RZDJ 2MBFA 2E8AA 2EHGA 3O3FA 1BU6O 1EWQA 4NC7A 5LEJA 2EWNA 4YOTA 3G73A 3VB2A 3AVKA 2GBYA 1Y0UA 3DEUA 4IPAA 1U8BA 1JLQA 4FJGA 1HPZA 2LK2A 4CGFA 3CQYA 3DEWA 4KTQA 1QBJA 4LK0F 3DLLL 2EZIA 1RT3A 4I01A 3UKUA 4Y4RA 4J01A 1RTJA 4GDFA 3M3YJ 1RR8C 4A2AA 2XRNA 5LBQA 3SAGA 4JOMA 1LDJA 1Y64A 2PI0A 2KIUA 2FBKA 3AO3A 4YIRX 3GTGJ 1XHXA 3TBIA 5CJ9A 3L2VA 1X4OA 3H9GA 5HP1A 1B92A 3O8GA 1U5TB 1MDUB 3P31A 3WNFA 4B9MA 1ETKA 2VONA 1R23A 2F5VA 4RA2A 3ZN1A 2DFEA 2DBBA 4CA0A 2IGIA 3ITHA 4HUGA 1ITYA 4EZ6A 2HS5A 2W25A 3AVFA 1QHAA 3SV3A 5T7BA 1SD5A 1WVRA 1HF0A 4DWIA 4BWMA 4FVUA 4PJLA 4J2BA 2FMYA 2HDDA 2R7RA 3ZSVA 4C2UA 1LVKA 4ZDPA 5FLXK 4IO8A 3GL1A 3CCMN 1R5GA 4CJEA 1SMYF 2GWJA 4DSKA 3HOXJ 3H92A 1TYQA 3RQ4A 4XNFA 3KP5A 1XCVA 3VENA 3LFUA 4N0BA 4DTJA 3G1LA 1L3SA 4E89A 3FZMA 1JJ2M 2QM3A 3VQCA 1IN5A 2XY7A 1DUXC 2A69F 5AQTA 2F96A 1J2XA 4FOIA 2VLAA 3ASNH 4H03B 3MN2A 3K1PA 1DGKN 1QA6A 2IIRA 2XB0X 3ZYYX 5IOYA 3AL0C 1CLQA 3EE9A 4Q0BA 2YNGA 4E1JA 3ABTA 3FR0A 5IT3A 2MG4A 3GLXA 1I3AA 3QEWA 3TANA 1KSPA 3QOPA 4H4MA 2NNNA 3V1QA 1SV5A 3QEXA 4YOVA 3GG4A 4F2SA 1RBTA 2IJLA 3KK1A 3M8RA 1D0YA 1W97L 5HLHA 2VC1A 3VQDA 3BTCA 1MA9B 1P90A 1IN4A 4HF2A 1WN7A 3BY5A 1HLUA 3ZEUB 4A5BA 4HQMA 3K4LA 5EY4A 2W57A 4DQSA 3FISA 1XSDA 3VF2A 2JVGA 3BJAA 3ULQB 4LIUA 3VN5A 4DV5K 1DPRA 3ZMTA 1TBXA 3BOQA 4JN4A 4DOZA 5LMNK 1BIZA 4J8FA 2JT1A 3Q7BA 3K5OA 4A3LJ 1Y1WJ 2YHXA 3KK7A 1NJZA 4KHUA 5A2QK 3E7LA 4H5TA 5AJ3K 5GAHJ 2LY1A 1DTTA 4IOXA 2R3SA 3SDGA 4I7HA 1UG0A 1QVUA 4ABZA 2HBJA 4IWVA 1EH7A 4B8XA 4XKBA 2Z1DA 2ZSHB 4PZJA 3C2BA 3OSGA 4N4NB 5JLXA 1HUXA 1Q82O 3K1NA 4YDUC 1TC3C 4YFXF 1BUPA 5I9EB 2BH1A 5JICA 3UKUB 3MMVA 3BR6A 3A8YA 1JL2A 3EPZA 3A5NC 2Z5UA 3P83D 5DK5A 3HXMA 1TNTA 2P6SA 1D1CA 2JRMA 4HG2A 4XLNF 1SD6A 1WJAA 1POGA 1TW3A 2IAIA 5B5EC 4H5VA 4H8KA 4JI8K 4W5NA 4BKXA 1OCRH 4I09A 2P9LA 2XAGA 3SFZA 1FEXA 3RMCA 1TAUA 4BUPA 3I59B 3MN6A 3C6AA 4BY1J 1O13A 4HNTA 1B9NA 2VOPA 4O8UA 2XF6A 4CECA 4KI6A 1XB4A 4MFEA 3A5LC 1CGPA 3NAUA 2UXXA 4A0XA 3CMYA 4KNYA 4U67L 1A04A 2F5DA 4DV0K 1M1KO 2X85A 2OAZA 4XH4A 5FRMA 4JS4A 4XR6A 5AZIA 1CZAN 1NMNA 1E4GT 2JPCA 2PMZA 2DT5A 2RAEA 3J80K 1WOQA 4MFDA 5IP6A 1P4XA 2BYVE 3GFJA 4G6DA 4LMYA 3OS2A 3QICA 4IEIA 2L7MP 3BLYA 4GGGA 1BOAA 1IBLK 3BR2A 4CCOA 1QZYA 2RF2A 4MEXF 1IV8A 4CF1A 3DMJA 4DHYA 1QHHD 3TW7A 2Y30A 4F7ZA 1BW5A 2NNYA 3PIOL 2IVMA 2WB1N 3L2CA 2NRAC 1OMIA 3HYFA 2UUAK 1O4XA 2OPQA 4YY3K 5JS1A 2V7YA 3ZX0A 1GVDA 4H0OA 3EKSA 4LFBK 1HSJA 1T56A 2W7NA 5JVTA 1VQ9I 3R0JA 4KMFA 2YU9J 2VPRA 3BPVA 1S5LC 4RAFA 4M71A 4EATA 3CHWA 4M9SA 3ZQIA 5JMVA 5GIOA 4QOZB 9ANTA 2O5RA 4EGZA 2VXDA 2OTLI 1VQPN 3F72A 3LWMA 1VQ9N 4I2QA 3GOIA 1E3HA 5ADXH 4CGJA 3K4MA 1B72B 3Q7CA 2FBYA 5IT9Z 3HSEA 1MMGA 2A42A 2CUZA 5DS9A 3VYSB 4DQPA 1VSHA 1QVFM 1ZBIA 2D45A 3H5RA 2K3PA 1S7AA 2V26A 2YU3A 4WXCA 5F04A 2L5QA 3RIRA 5E3NA 1K4TA 3KZYA 3OR2C 2PJRB 3JRAA 1RGIA 4UVBA 2YHBA 3RWUA 4M3ZA 1WFXA 1N6QA 1XNQK 3A5OC 3MVPA 3PNYA 4A3CJ 1AKHB 1JLGA 1IV0A 2L4MA 2RN2A 1HW5A 3GEZA 4DSEA 3UNGC 3OYEA 4A3BJ 3RMDA 4DLGA 2A1RA 2UYTA 3WTTC 3S2DJ 2V9KA 3DM2A 5KQDA 3EY1A 2V51B 3K59A 4AYBN 3O3GA 1YJNN 5HOOA 4OJRA 2R93J 3DKWA 2R0QC 4UY8I 3HOYJ 1P7IA 4II2A 1IDYA 3DLBA 3FXMA 5H6RA 5LEKA 2WV0A 3QO9A 1ZBLA 4A3MJ 1V4RA 3FZVA 2Y75A 1VQOI 2X78A 3HOZJ 1SAUA 3CJ7A 4LG0B 2EIKH 2LF8A 5F2RA 3D2EB 3EZWA 1WH5A 2R92J 3TDZC 5J6XA 1X3WB 1WI3A 3BWGA 3O9QA 4JQFA 3BDDA 1T95A 3WTXC 4DQRA 3BZ6A 3N97A 1FJLA 4DQIA 3OS0A 3W6VA 3IKMA 1YW9A 3SZ2A 4BC5A 1HRHA 2M9HA 4FK4A 4FJKA 4BDZA 5SZTA 4G7OF 3RI4A 3NF6A 3J81K 2CUEA 5B3SH 4N41A 3DLAA 4DLEA 3LM2A 1IRFA 4CEOA 4RGRA 4XKCA 4CF9A 1WUAA 2CMPA 4X64K 5ERIA 4HHTA 1MD0A 3CC7N 1Z67A 3DLEA 4DR3K 3HSCA 1MJAA 5FFZA 3AVBA 4BRHA 3HM8A 4F2RA 3D2EA 2HQNA 3PL8A 4X1EA 4OIPF 1WSGA 3BJ6A 2NVUB 3FXOA 2LRDA 3HOTA 2FBTA 4ZYGA 2DA6A 5GINA 3LA3A 4AUXA 3VEWA 4FWQA 5M1QA 3JTGA 3SK3A 3CCJN 3IP4B 2O3FA 4I02A 4FTHA 1WSHA 1TW2A 3HG9A 1X2MA 3C94A 3OSFA 5FLMJ 4CIGA 4KHSA 3DV8A 4M9ZA 4WFBL 5DM7F 2UXNA 3VQPA 4CJ7A 4FJ5A 2DW4A 1U6ZA 4B9SA 4GKJK 2G8HA 1HBXG 3QERA 3NGYA 2E2IJ 3AVIA 3B8AX 3ZEUA 4BQZA 3IWFA 2KLAA 2LKXA 5L3BA 3IRRA 4B1WB 5FPEA 2NRWA 1HDPA 3RYRA 4OKJA 5HLFA 3MCPA 1Y6IA 4GW6A 3DAWA 1NGEA 2WUSA 2N8GA 3DQVC 3TW6A 3RTRA 1GXQA 2QW9A 4IFEA 3KEYA 1VFCA 3EN9A 4D5CA 3DXJF 1YI2N 4FLVA 2FXUA 4BAYA 4NCGA 4FJXA 3PUBA 1LCUA 2FNPA 5F0FA 1VRTA 3F8BA 2PYLA 1D5VA 5IWAK 3WTVC 3A5MC 4JEPA 5FROA 2AO9A 4MQVA 1DQUA 3Q0WA 5BOXA 3GDQA 2FSJA 4DB3A 2QWQA 3JAMK 2BY2A 4PKHA 1NKBA 3BG9A 2VOOA 4IZ9A 4B08A 1ZN2A 1GXPA 4CJVA 4F91B 3T0YA 1I5ZA 3FIWA 4JYAK 4BDYA 4DR5K 4WFNL 1RDCA 5DM6F 4V19K 3L8BA 3CC4N 5LMUK 1WSEA 3FXLA 3SV4A 4IFYA 3ZPLA 3AVMA 1KTQA 3TAQA 4N4OB 1OCCH 3H0DA 3N4QA 3PX4A 5J4VA 2V6CA 2X4HA 3HBTA 3PNTA 2G8KA 1JLFA 3D7EO 1GLLO 1OVYA 3IH3A 1VQ6N 3DBLB 1RDWX 3GVAA 3ECOA 4N47A 5KRTA 1G3TA 1AKHA 1PUEE 2HBMA 4AM3A 2P5GA 4HCCA 4KAZA 2ADUA 4FM2A 3FFKB 5EG0B 2O8BA 2GXBA 3E97A 3IWZA 2PFUA 1QS4A 4YFUA 3H1VX 2QVOA 3A2FA 3ZT0A 3U6FA 2Z3YA 1NJYA 4Y17A 2TCTA 1K8KA 4XONA 5FGMA 5J1RA 4E7IA 1QQNA 1VHXA 1BR4A 5KGWA 3FF5A 2O4GA 4A3GJ 1ZARA 4NB5A 4OPAA 2ECBA 3I56N 3UR3C 4K41A 2DI3A 2IXSA 3LL7A 4FISA 1DP3A 2DU9A 2Z9OA 1VQ7N 2KHOA 1U2WA 2E2PA 3MN5A 5EGOA 1D5YA 1ERDA 3AVNA 3TQNA 3KLHA 4YFKF 4HW0A 1S8NA 2OZ6A 3MKYB 4ID5A 5EVZA 1FWZA 2DK5A 5FRNA 3CP2A 2M87A 1H89C 1IUFA 1Z3YA 3DPUA 4G9YA 3HYIA 4CGZA 1ASVA 1BOTO 3AL0B 1YW7A 2Y0SN 3RKXA 4A2BA 1HW2A 1JUSA 2KIQA 2XAJA 1S29A 2XAHA 2RKIA 3D2FB 2DN0A 3O3HA 1KD1O 4M3UA 4CERA 4Q48A 2NUBA 2MLKA 3OMYA 2M45A 3K70C 2KL4A 2NXNB 3BCAA 3U1KA 2BVLA 2ACJA 3U3GA 3ZX3A 1R5ID 2JWKA 2E7WA 4DV1K 1V5EA 5CHIA 3BQYA 4AIHA 1W7PA 3CDIA 5KQ8A 4CUGA 3NF9A 1L3TA 3D5SC 4RCHA 2PX9A 5F0CA 4CZCA 5LHGA 1QQMA 2B5JA 2H09A 3L6QA 4QIWN 2QEXN 2BY1A 1FIPA 3L1PA 3VEOA 1XC3A 4CZFA 3FDYA 1IV6A 3DFGA 2NRRA 1WJFA 3DXKB 3DU6A 4JNEA 1XMQK 4RB0A 2EK5A 2M2EA 4XN0A 3VPRA 3WE3A 1WSUA 1UMQA 1XDSA 2NRXA 3THYA 1SFKA 3ZSRA 3A4CA 3CF5F 1OR7A 1NKCA 3QPHA 3CQ8A 2HHQA 1IG8A 3B73A 2NAZA 2ZSIB 3MQ0A 3TKYA 3ISNC 4WF9L 1NGJA 2HNHA 1J5YA 2L9VA 4V2GA 3V1RA 4OIOF 2E34A 4CHPA 5C2DA 1UZCA 5KGXA 1F36A 1LEBA 2A41A 1GUUA 4DNCA 1C1AA 1HJOA 1JL1A 4FX4A 2L2OA 3OYMA 2FSKA 3LPTA 4KTZA 5AZJB 1R1TA 3A01A 1HQUA 4A12A 4KFBA 1BA0A 3U8XA 2Y9ZA 2O8CA 4IQ4A 3EE8A 3BZCA 3ASMA 2KJBA 4H0YB 4G12A 1RUOA 1N5YA 2K4BA 2OANA 3K57A 2RVCA 3L00A 3FXJA 3TL4X 4NDLA 4FPAA 1YVUA 1KGSA 3VGKA 1TLHB 3OA9A 5DD8A 1RBVA 1NK0A 4AF1A 4PHTX 1FX7A 4CHYA 4Z4FA 1ETVA 1W1WE 3B6OA 3ZQFA 4CZKA 4AIJA 3ABLH 3PQKA 1YFHA 4L0YB 4YELA 5ELZA 4IRIA 1ZXOA 3SAHA 3ZQCA 4GKKK 2JTVA 1T05A 4RS8A 2HNZA 3ZSXA 2PG4A 4DTPA 4O5VA 4LLNA 2OJED 1TWCJ 1FW6A 2YX4A 2E5NA 1SFXA 2QWNA 2O8FA 2YX6A 3A01B 1YIOA 3V8JA 2R4GA 2M4GA 1MNDA 1BR2A 4M72A 3N4MA 5JLFA 1TTYA 3DWLA 4BEHA 4A3FJ 1JJ8C 2E1CA 1WSJA 4H4OA 1F21A 3DTIA 1WSIA 2HHUA 4IG0A 1PDNC 2DOFA 2P6TA 1NGBA 1VSDA 3O4WA 4DUYK 2VE8A 1LB2A 2LTPA 3M8SA 1XMXA 2Q1ZB 4CEQA 2JPBA 4XRSG 4JKGA 2FF3B 2X1EA 4IZZA 1JKOC 4FJLA 1LW2A 3AARA 1KQ8A 1W36D 2R7OA 2VG7A 2VN2A 2WBMA 2AP1A 4JD2B 3FZLA 3I0SA 4NB4A 3VESA 4IRGA 4PJNA 1IKYA 4E0DA 3OHRA 3WHBA 2HKXA 3CCRN 3RRGA 3ABUA 3VEZA 2F8TA 1NOZA 3GO5A 3VQEA 3RJPA 2NRVA 1YOVB 4F3TA 5IYDJ 1F5TA 1RI7A 1YIJN 4BE1A 3CF5L 3GTPJ 1FBUA 1UHMA 4R8HA 1ON2A 1A5JA 2YKMA 3G71I 2K4JA 1RCHA 3QOEA 1L3VA 4BYYA 5BPLA 2K27A 3NHGA 1S72I 4YDUA 4U88A 3J7AP 2UUCK 3VOVA 3HZJA 4DCHA 3ZP5A 5FLVA 2QZ8A 3CC2N 4PY5A 2DJIA 3G25A 2CH6A 3BR5A 2EFNA 2VGMA 3MECA 4FWRA 4B1ZA 4R5PA 1UHWA 3RSNA 2NRTA 3HRGA 3FZHA 2LYCA 3WXKA 4J2DA 4CJ3A 3HBLA 5JHFA 4BRGA 2DA7A 2HBKA 4DYCA 2XVCA 3QPLA 3P9CA 3FE1A 3DRRA 2DTZA 3U3YA 2L9SA 1A5VA 3TAGA 3CMEN 1I3QJ 5FKOA 5CVIA 4ESJA 2HDCA 4GVEA 3WGIA 4FK2A 1B1BA 2Y31A 4MLOA 2JA8J 1DKGD 4LD0A 3KJVA 2WTUA 1UJ8A 3OYDA 2JMWA 4ZTFA 1SL0A 2VE9A 2KZMA 2QQBA 4LD5A 2STWA 2RHKA 3C2HA 1XTAA 4XRFA 2HYFA 4GVMA 1ZRCA 4KDPA 1RBRA 1KQ9A 3DF8A 3ZMZA 4IXCA 4DSJA 2DYRH 5E1WA 4EV0A 3MEEA 3HOVJ 2EA4A 2F7TA 1S7EA 5AQWA 3NF7A 2BVMA 2LC2A 2OU2A 3HUGB 2X74A 2ZQBA 4H0TB 1IG7A 3K9TA 2Q1NA 1WCMJ 4ENKA 3LP1A 3CCQN 3ZN0A 1IJJA 4LIVA 2ZJRL 1HKTA 4KREA 1W0UA 2OTLN 5K5QA 2ASMA 2DMPA 3RVCA 2RDPA 4HWIA 5CYQA 3ATUA 2CRGA 4DQ2A 1UHSA 5HS8A 1BQNA 2HBLA 5CVVA 1OFCX 1QPIA 2XAQA 1RIOH 3U9ZA 4NO7A 1OJLA 4BHCA 5M5WJ 1LQ1A 5DEQA 3F8CA 1IXSB 2FRHA 2ZJQF 4A57A 2CGLA 2K02A 3ZR8X 4KN7X 4F3OA 4DFJA 1WAFA 2IDOA 2DAOA 1KC8O 5EEAA 2EFQA 2RPIA 3VDXA 1GLFO 3AG2H 1ZG3A 4LSLA 1KU7A 1Z3XA 2ZO4A 1BCOA 5C15A 1QO0D 1JT6A 3OYAA 4HOBA 1ATNA 3I0TA 2D1KA 1RDUA 3QDKA 1LUJB 2R7VA 4ILJA 4RMNA 5B1BH 3S17J 4JK7A 4JYKA 3CCSI 2H94A 5DDGA 2KFNA 3VOEA 2YS9A 3H9JA 3JRCA 1FOKA 5E17F 4MTEA 3VYRB 4FW1A 3WXJA 2F4VK 4KN4X 4CJ5A 2O4IA 2O8EA 4C3JJ 4FPBA 2V1DA 3L3UA 1TP4A 1KAXA 4BXUA 1TQIA 1LAVA 3M8JA 4A5MA 4CEFA 3EO3A 5FKNA 1O3TA 1CZBA 5KK1A 2E2HJ 5LL6Z 4OVLA 2HXIA 3V4GA 2HVRA 4R79A 1YJWN 4MFBA 1O7FA 1U48A 5HS9A 1DPUA 2FLOA 4MNUA 3QEPA 3U9DA 4NNJA 4QPOA 2F4MB 4CSWA 5M3FJ 2QXFA 3IV5A 2G8FA 1MH3A 5HS7A 5FD6A 2E2JJ 4IKFA 2OUMA 3SEZA 5IT9K 2G0EA 2K7LA 3E01A 2XF7A 5AQJA 4JD2A 4RW6A 2HYJA 4PJ0C 2JA6J 1VSFA 2GEMA 2QI2A 3KLEA 1Y8RB 4XIDA 3GF2A 3LL3A 3ZQLA 3AVGA 4CEBA 1U2VB 1G4DA 3BDPA 2K9SA 3HPGA 2DQRA 3VQ9A 4G7HF 4NHJA 1RPWA 2KRCA 5AQNA 1LKXA 4DBQA 1XDUA 4RAGA 3LSPA 2YNIA 4Y1CA 5E3MA 1ZG5A 4WQ4A 3LPUA 3RCOA 4CJSA 3FXQA 3DXMB 2QK9A 3GTJJ 2DA3A 3K2ZA 3MEDA 2QF7A 5F0HA 2ZXIA 3H3VK 1N8RO 1NNEA 1V54H 3LOCA 4CJRA 3T19A 2G8WA 1N33K 4XRMA 2KZGA 2VKEA 1IH7A 2W82A 2ZGZA 2NYXA 2CH5A 4IDKA 4C8LA 5M1KA 3LZIA 5H1SQ 4KRFA 4L5JA 4L9NA 2PMZN 1R71A 1ZYRF 4A3EJ 2ZKZA 3THYB 2LF7A 2P81A 4LG3A 4H0PA 4DV3K 1T38A 2GWKA 1IRGA 1ZK8A 3R8EA 4H0XB 2VKHA 5C3EJ 1D5AA 4G6QA 1U0JA 3FK7A 2GV9A 5AQVA 2F5CA 2XSJC 5BREA 4A61A 5F0XA 2W6LA 4WQ5A 2O6GE 2FNAA 4D7NA 1G15A 5IP7J 3NWSA 3ELKA 1VRUA