1Z05A

Crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
b'DHIKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAISRGRPAVGLQTNNLGWQFLSMRLGRGYLTIALHELGGEVLIDTKIDIHEIDQDDVLARLLFEIEEFFQTYAAQLDRVTSIAITLPGLVNSEQGIVLQMPHYNVKNLALGPEIYKATGLPVFVANDTRAWALAEKLFGHSQDVDNSVLISIHHGLGAGIVLDGRVLQGRHGNIGELGHIQIDPQGKRCHCGNYGCLETVASSQAIRDQVTARIQAGEPSCLATVEEISIEDICAAAADGDPLAVDVIQQLGRYLGAAIAIVINLFNPEKILIGGVINQAKSILYPSIEQCIREQSLPVYHQDLKLVESRFYKQATMPGAALIKQALYDGLLLMKVVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator, ROK family
publication title Crystal structure of the ROK family transcriptional regulator, homolog of E.coli MLC protein.
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transcription
total genus 137
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z05A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A03
2E1NA 4Y0WA 4H5RA 4GXOA 4BQLA 4RWTA 4OIQF 1T6DA 3GBTA 4CZGA 2RGVA 4PL8A 3R9PA 3GUDA 5E1XA 3IDHA 3W3DA 4G6DA 1HW1A 1ZGJA 3FZMA 1R22A 4BXUA 1VTNC 3C3WA 2QVOA 4BQAA 3KP5A 4CZFA 4CBWA 5HOOA 3K0LA 1S22A 2C6YA 1YW8A 2P9IA 3BJOA 1XSXA 5F0XA 4CZZA 2YJEA 5E18F 1GLBG 3U8XA 5H20A 3VEWA 1NLVA 2X4HA 1XCVA 4HV6A 2FSNA 2D1HA 4ENJA 3BPVA 4WWCA 2P9UB 2HGCA 5AQGA 4LLLA 1OKRA 3TO9A 2M8EA 2HQRA 3V8KA 3A8YA 2DPUA 3S41A 1YXQA 3H3UA 3LQRA 4MLHA 1QZ6A 3RIRA 2CQKA 1YS6A 1U3EM 2XV4S 5HVQC 4ISEA 1XCBA 5F1XA 1DEJA 3VEXA 3EDPA 1FX7A 3QRFF 2EA2A 5F64A 3J80Z 2MLKA 3GFIA 2DBBA 2HF3A 3VF2A 1WRJA 3VGLA 4NB5A 2V6CA 4M7YA 4IRIA 5DD8A 1U2WA 3NRVA 1U78A 4C23A 1MD0A 3I59A 2W41A 4XLPF 4BRHA 1KA8A 4BR4A 4KN7X 4OMYA 2WC2A 2ZNYA 1DKGD 1Z7UA 1QQMA 3H1QA 5JICA 4NHJA 4MGRA 4JQFA 1MKMA 5KVRA 4JD2B 3HTSB 4ASNA 2PFBA 2P9NA 3EO3A 3G73A 3MQ0A 2V9VA 2QM3A 3JAMZ 4R8HA 1KAYA 2ASMA 3DWLA 5FPNA 2RN7A 1UHWA 2YCHA 4A0YA 4MHGA 1ZC6A 1AWCA 2CG4A 4WYBA 3CJ1A 2XAHA 4CZIA 2RQPA 1BI2A 1Y64A 3P9CA 2P5VA 2PG4A 1IRGA 3QU3A 3D2FA 3H6EA 1ZHFA 3ID8A 4FWQA 3LQQA 5FD5A 3ZQ7A 2O3FA 2DFIA 2RV8A 2HYGD 5CVRA 3VETA 2XAQA 3ATVA 3B02A 4M73A 1R5HA 3AAQA 3MCPA 1MWKA 1B1BA 1FBQA 1V4SA 1RFQA 4BHPA 1TYQA 3J7AO 1XMAA 3T8RA 1XSVA 3LAJA 1TQMA 2QYOA 3KP2A 5JHUA 1SZ2A 5AQZA 4BREA 3GVAA 2MD5A 3MZHA 2E2OA 3I4PA 3OOPA 4O3MA 1KQ8A 3ZEUA 1D5VA 5LGUA 2PBDA 3VENA 3HSCA 1JXSA 5IT3A 3FM5A 1FT9A 5E8IA 1H0MA 1HKSA 1NGAA 5F1RA 3GL1A 3T1BA 4LFUA 4A5MA 3F23A 3HSRA 1KU2A 4RGUA 1MZBA 3F22A 1HJOA 3CJAA 4YFKF 5BMZA 4CBXA 1K7AA 1RI7A 2AS5F 4PZJA 3V4GA 3F9MA 2FMYA 4P9UA 3VEYA 4H5NA 4UVAA 3RYPA 2P9KB 1GLJO 1GLDG 3I54A 2FQ3A 3QICA 2FSKA 1SAZA 2XAJA 1TBXA 3M3ZA 4B1YB 3VB2A 5AZIB 1XSDA 1NWKA 3LM2A 3ZMVA 5ICFA 1DP7P 3ATUA 4FOIA 4BH9A 3WGGA 2CGPA 4RS8A 3FGUA 4BRGA 4HZFA 5L3CA 4K43A 5HS7A 4DCHA 3GFMA 3TDUC 2Q2RA 1FC3A 4Y13A 2H09A 4L9VA 3KZBA 4FWKA 1BI1A 5HS8A 4UNOA 4LMYA 1KU3A 1OKJA 2A6EF 2VN2A 3A5OC 2FF3B 3MK6A 4EM0B 2V52B 2ZFWA 3ECHA 3IUCA 3K2ZA 4E1JA 1MWMA 4UV8A 1MJ9A 2M30A 4WXCA 5BPIA 3HI0A 1LEAA 2AA4A 5FPDA 2EK5A 2A6HF 2EFOA 5EX5A 1O7FA 1HW5A 4RB2C 4IXCA 2STWA 2WTEA 1T0FA 3ERED 4AIKA 3LDOA 2ISYA 1BI0A 4A12A 1YUWA 1HKQA 2W40A 5EY4A 1W7PD 3K1MA 4CZLA 3C7NA 2QM1A 5AQTA 4ESFA 2DT5A 3F21A 1BJAA 2ESNA 5FPMA 3BDDA 2PAVA 1BIBA 4S05A 2FOKA 5E84A 2FBKA 1NMDA 3DQVC 5TKYA 4CD3A 1U5TC 4QS9A 5AQJA 2VBZA 1BUPA 5AQXA 4LLGF 4UHTA 3R4KA 1BOTO 1RIOH 3GXOA 4AIJA 3WE3A 2COMA 3DKWA 1NGGA 2ZO4A 3WTZA 1BDGA 1EQYA 4JN4A 4WQ4A 1JHHA 1R7JA 2KHOA 1PP8F 4Q48A 4IHSA 5AFUA 1X3NA 2CYYA 2NNYA 1FPQA 1SFEA 4HQEA 3F8FA 3ZMSA 2I7PA 4CYDA 3HHHA 5IT9K 3U1DA 4BC5A 2OBPA 3K69A 2E2PA 4FPAA 3ROUA 1G3YA 1YW9A 2MH9A 1YYVA 3KP7A 3A0IX 2L54A 4E70A 3REOA 1UB9A 2YX7A 4EM1A 2HR3A 4BRQA 3VERA 2V1XA 2JZYA 1JCGA 5AQYA 2V7YA 4EFHA 3G25A 3GFLA 3KP6A 4BG9A 4PL7A 1YS7A 4WXDA 3H3NO 3RKWA 1X3MA 2KKOA 5H6RA 4G6QA 4MEXF 3E5QA 1BC7C 3LWFA 5LHGA 4EJWA 1G3TA 1R1UA 5J6XA 2G7HA 3CUQB 4LD5A 5ILVA 5DCMB 5D5VB 1SMYF 4LG0B 3Q9SA 3WTWC 3L6QA 3KEOA 2ASOA 2MC3A 4LGWA 1HUXA 5BPMA 3A5NC 2K27A 4XH1A 4XLNF 3IHUA 1O3TA 2Q0OA 2Z3YA 4M71A 3IRRA 3VOEA 2XAFA 1CF7B 1IG8A 1FBUA 4B1ZA 4L0YB 4HF2A 2DI3A 5E17F 4BNCA 2GXGA 1XN7A 2QWLA 4A2AA 3GW2A 3P9KA 2VWBA 3ABTA 2E8AA 4I0BA 2W25A 2Q0RA 4A2UA 3GE1A 1R23A 5BREA 4HQMA 3DFGA 1QNTA 4U0VA 2P5LC 2F5CA 1DPRA 5AQRA 1IN8A 2YSRA 3QFPA 5CVVA 1K79A 4B1WB 3WQTA 4U7BA 3ZX3A 1XD7A 5AFUH 2QLZA 2W24A 4OOIA 1O3QA 5CVUA 2OD5A 1SAXA 3HRSA 3BROA 3CLOA 4H5WA 3COAC 4G94A 5AZJA 4EQQA 3KETA 3KP3A 2DW4A 2BV6A 4GNIA 1I6XA 4H0XB 2OZ6A 2CW0F 3VEZA 1LNWA 2EFWA 4BRNA 2LDUA 3D2EB 4L9TA 2GWJA 2JTVA 4KA4A 3RYRA 1Z91A 2VBXA 3E6MA 1F4KA 1LDDA 2ITMA 2XGXA 5ED4A 2YI1A 2UWMA 4I09A 4JNEA 3MZYA 2GA2A 5EVZA 2Z33A 3HTUA 1J59A 4QLCU 1LOTB 2E2NA 3SMPA 3T8TA 2DQLA 5AR0A 1FNNA 1KYWA 2G7UA 2UXXA 1F9NA 1ULYA 2P8TA 2FEZA 1T6CA 4EGYA 3QU6A 3I71A 1LB2A 4EJOA 2ZMEB 3EUHA 4XH5A 1D4XA 5K5RA 2QWPA 3I5UA 2BYVE 4CZHA 5HLHA 4IWVA 2YPRA 3KE2A 3MEXA 4DHYA 2BTFA 3EKUA 2PN6A 2QZ8A 2PEXA 1GLAG 5I9EB 3FLCO 3QAHA 4WF2A 4M9SA 3H3OB 3RSEA 2KIMA 2J5PA 1WQ2A 3SZPA 4RB1A 5D6EA 1FP1D 1IUYA 4EM2A 4IJAA 1X9JA 2W84A 2F2EA 2EJRA 1ATSA 1E4FT 4CI6A 3WTYC 4CZJA 2QWMA 3JTHA 4QS8A 4OINF 3R61A 3L00A 1CZAN 3BPXA 5AQIA 2EWNA 3HIFA 3ZP5A 4I6MB 4EJVA 4A62A 4BGAA 4Y15A 2FBHA 2HF4A 2Q36A 5K1YA 5BR9A 4CGZA 4IXAA 3M1EA 2RKHA 3HYIA 3HZ6A 3GG4A 3QP5A 4O8KA 1NGHA 2HDCA 3BUZB 5E26A 1FOKA 4BG8A 1IXCA 4P55A 2V7ZA 2IW5A 2LF7A 4CXFA 2YHWA 2E1ZA 1U5TA 3HSFA 4EHTA 2YHYA 5D5WB 2O0YA 5LEJA 2Z99A 5HLGA 4IJNA 2JT1A 2EV6A 3WU1B 2GIVA 4YIIA 4LB5A 2A41A 3BF1A 1LCUA 4BRIA 3M8FA 3CO6C 2D45A 2D1KA 4AM7A 4MTDA 2EV0A 4HX7A 1HSJA 1BWFO 2GTDA 3RTRA 2E20A 3BEXA 5K5OA 2K7LA 4WK8F 2Q31A 2H6CA 5AQQA 2ZWHA 2P9UA 3SZTA 3ABUA 1U6GA 5ICGA 4TV7A 1IN6A 4FX4A 3WXKA 1TLHB 3ZMUA 4WQ4C 4L9JA 4AWXB 4RAYA 2VE9A 5AQWA 3W6KB 2P9PA 3ZPLA 1QHAA 2J5OA 3R6SA 3BJAA 1J6ZA 2BEOA 4RB3C 3LA7A 3V7RA 4OIPF 2BUPA 1W5SA 2H27A 1LVAA 2VC0A 4U0WA 3M8EA 1K8KB 1USSA 3HRTA 2P5KA 3Q5FA 2DPNA 1LJ9A 3HRUA 5HDGA 2YJFA 4R79A 1SD6A 1SFXA 2PBIA 2PMHA 4MEYF 2V51B 2PMUA 3K9TA 4HWIA 1O3RA 4ZYDA 2XAGA 1UCRA 4WX9A 2ASPA 1QQIA 3F8BA 4JD2A 3WXIA 3AAFA 5JLHA 3O2PE 1V3FA 1IW7F 2YX4A 4M9XA 4HDUA 3I59B 4A6EA 4IHTA 4EJUA 3SMSA 4BRFA 1LDKB 4HDVA 3OV8A 3TGNA 3RKYA 1TQPA 2FSJA 3ULEB 3CQXA 4HTLA 4BRKA 2QWOA 2VOPA 5DD4A 4UVCA 1BIAA 3CIPA 5L3GA 2D1VA 4CDGA 4HV5A 5FPEA 3RDIA 1QZYA 2DAOA 4HYEA 3RPUA 3CUOA 1K78A 1X3UA 3GZ5A 1PUEE 5AQOA 3J80K 1R00A 4GY2B 3QP6A 5D4SA 2I7NA 1HKGA 2FLOA 2D4WA 3UKRB 4WCGA 2P9SB 4RGRA 2E2QA 3TQNA 3ZX0A 3VEVA 2X0LA 4CZMA 5AQVA 5FLXK 3JSOA 3H46O 1UFMA 5KPTA 2EFQA 2FRHA 4BC3A 4QS7A 2Q0UA 1KAXA 1Z1DA 2VT2A 2MBFA 3WEEA 2OQGA 5LRRA 5ICCA 4ZYGA 3OHRA 4MQ9F 4NQWA 3S2WA 1REPC 2XRNA 1Q18A 2A68F 1LEBA 1MDUB 1IXRC 2HWVA 2A61A 2NNNA 3JAMK 3DPLC 3DXMB 2V1DA 1U6ZA 2M87A 1ON1A 5EOYA 2Z9OA 2W57A 1RZ4A 3RI4A 4FWOA 2P9KA 4JBAA 4F9OA 3O6BB 4MQVA 3FMRA 1I27A 4MO5A 1ZN2A 3SJHA 2JPBA 4LK1F 5AQKA 5ADXA 4BQZA 3FM3A 1BOAA 1FYKA 3V7CA 5AZIA 1BM9A 2F5EA 1FSEA 3J8AA 3FX3A 5BOXA 1V4RA 3UKUB 4N9HA 4ZYHA 4G7HF 2OANA 3CETA 2F9TA 5LHHA 2FF6A 5ELZA 1B59A 3WTSC 1H9TA 3QDKA 3KLOA 3MMVA 2KRFA 4UVBA 4EV0A 5HDKA 6PAXA 2EV5A 3EL2A 5DUIA 2EWSA 1IN7A 2HS5A 3IKTA 4G9YA 1S3XA 1OYWA 1L0OC 2BE5F 3JXUA 5CE3A 2VCPA 3O6WA 3C7JA 3WU0A 4H5TA 2XHKA 3LA2A 4M72A 2ZKZA 1V4TA 1IN5A 2RNJA 4PGGA 3JTGA 2E1CA 3IMXA 2Q1NA 4L18B 3TOBA 4ENNA 4YIFA 1EV7A 4XH4A 3L2CA 2L02A 2KJBA 1GLEG 4YFNF 4ENMA 3BY6A 1R59O 3TOAA 4K2EA 3DPTA 2RC4A 3GEZA 2GWRA 2NS0A 2QBYB 1MGTA 3CHWA 1J75A 4AM6A 2DPDA 2PQ8A 3B73A 5DYMA 1HX1A 1A04A 2FF4A 1E17A 1Q1HA 1F5TA 3BZ6A 2DTRA 3FXUA 3RJPA 5F2RA 1S8NA 3LM9A 3FWEA 5A2QK 3F8MA 4A6DA 2F9WA 4BR9A 3W6JB 4HBLA 5AQUA 3ML6A 1R58A 3EYYA 3GDQA 2ZNZA 1EH6A 5DCFA 2IA1A 5IT9Z 2ZGYA 1ODDA 2M5WA 2FMLA 4BRAA 3ZETB 4LLNA 2A6AA 2D0PA 4B1UB 4BR7A 4U0YA 1BBYA 5TJJA 2PI0A 2CH5A 5BRFA 3V8JA 3FR0A 5KPZA 1NM1A 3C7NB 1KQ0A 4M6YA 2P9LA 5ADXH 3WTUC 1ZH5A 5J8FA 1NBWA 5AQLA 2HYFA 1J9IA 3L4IA 1SMTA 1HBXG 2IIRA 3I8BA 3U9DA 4U88A 5JLFA 2IRFG 3E6BA 2A5YB 3LDQA 4BC4A 2EA4A 2HZTA 1P8ZA 1ONVA 5FB2A 1XB4A 3VOVA 2R7DA 3DXKA 1MJBA 3FHZA 5LJVA 5BRHA 1ZRCA 4RTFD 1SD7A 3CJ7A 1D3YA 4KFCA 2EB7A 4FL9A 2B0LA 1B9NA 1YIOA 3K1PA 4KIGA 2QWNA 3U9ZA 4BYYA 3I64A 4AIHA 1C0FA 3BP8A 1Z6TA 2VT3A 4U7DA 3RPQA 1ATNA 4K42A 3CQYA 2HMPA 4KMFA 1IJJA 1NGJA 2J4RA 1BI3A 1O3SA 2Q2EA 4I0AA 1C0GA 3WG9A 3CUQA 1R5GA 5CJ9A 2LSOA 3KP4A 5DCMA 4LJZF 4PKGA 3HM8A 4PCQA 4Q5SF 3D5LA 3H92A 4LG0A 3VEPA 5ICEA 4PKHA 2XIGA 1EH7A 3QPHA 3WUHA 5BQTA 2Q97A 5L3BA 3HBTA 1IAWA 3WXJA 3MFKA 1P2FA 2CSOA 2E1YA 5E8GA 1S3JA 2O61A 4CBUA 4HA8A 4H5VA 3WGHA 1FWZA 1STZA 3ZX2A 4H0EA 3QFUA 2R3SA 1D8JA 1Y0UA 1QBJA 3LL3A 2QXLA 4L3QA 2MLGA 3H45C 2AP1A 3Q9VA 5HDNA 4N9IA 1MJAA 3CTAA 2QQ9A 1GHCA 4H0TB 3E5XA 1T38A 3WODF 3HHGA 4M63C 5DV5A 1G6NA 2DQRA 5B8HA 4MTEA 5ILSA 1PP7U 4L5JA 2MA3A 3SXYA 1XDUA 4ISFA 1ZLJA 1GLLO 4BVPA 1W7PB 2FE3A 1TNSA 3R60A 2A3SA 1BC8C 4ESJA 4G7OF 4MNUA 3CJCA 2DU9A 3GYHX 2CGJA 4ISGA 3PQKA 1HPMA 3ENOA 5D5XB 4KDPA 3WTTC 2VC1A 4FWNA 3D2EA 2DK8A 1NHAA 3KFWX 5JMVA 3FZLA 4B09A 2DO7A 1T6SA 1WKMA 2D0OA 4FWMA 1G4DA 3E3VA 2WV0A 4K25A 5JI6A 3H1VX 3UE5A 3L09A 1XUPO 4JHDB 1QZZA 2VOOA 3I0TA 2BBYA 4BRLA 3EZWA 1TUUA 1JGSA 1WOQA 5CVIA 4H0VB 4LC9B 1W5TA 2AXLA 2GAUA 3E5UA 2H3GX 2L3DA 3V8LA 3R6MA 2PJPA 4L0ZB 1MDMB 3L9FA 2XKOA 3FF5A 4I7HA 1Z6RA 4M9ZA 4FO0A 1IZ1A 1J5YA 1G3SA 2QQAA 1ZRFA 1QQNA 4YDUC 3KCCA 3WTVC 3NEUA 4L5IA 4PDKA 3RKXA 3KEQA 2WUSA 1KAZA 1U2VB 1J2XA 1DUXC 3GOIA 2VODA 4K41A 4A61A 3WGIA 5BRDA 2CGKA 3HTVA 1QGPA 2A40A 2QW9A 1KQ9A 3MDQA 2MH2A 2ZBKA 2EFPA 3WQUA 1JCFA 4BRDA 3E97A 1FLIA 4A0XA 2E7WA 4I6MA 4DQ2A 4EIAA 4DQ8A 1WSUA 3O8MA 5J8CA 4KIFA 2A42A 5BPLA 1XGOA 3MN9A 1T2KA 3VGKA 5LJWA 1IXSB 4M6XA 2P7VB 1XDSA 3ECOA 3R0JA 4HLXA 3QB0A 3P4IA 2TDXA 2XKPA 4I02A 4BRPA 4B1XB 2YHXA 2XUBA 4OU0A 2IP2A 5D8LB 2WWYA 1YFHA 2IT0A 1FYMA 1YLFA 2GUPA 3QBXA 2CH6A 2UZKA 1Z9CA 3LFKA 3IRQA 2GELA 2CWEA 3W0LA 2UXNA 1HKCA 1YO5C 1WUAA 4G8XA 1LQ1A 5L3DA 1EH8A 2LF8A 3DJCA 1U5TB 5JVTA 2M45A 2YU3A 4IRHA 2IVNA 3CJBA 1WWXA 2XASA 3KHYA 2STTA 3ENHA 3GO5A 4B1VA 3J81K 1GXPA 1IN4A 2KIFA 4AVPA 4JAXA 4FSVA 1B9MA 1AOYA 4M74A 1IF1A 1J7KA 3P9IA 3PQJA 3MN6A 3H3ZA 1S7OA 4L9NA 4HF1A 2P9IB 4MO4A 3C18A 2P4WA 2FXAA 1MA9B 1LDJA 1GLCG 1DDNA 3K1NA 2GA1A 3R0AA 4A2BA 1QO0D 2FNAA 3O3KA 3GLXA 1OPCA 4XEIA 3T5XA 1QQOA 5FO5A 5EXWA 5LLQA 4Q47A 4WQ5C 4RGSA 1Z05A 1K8KA 2QWWA 3AY9A 3VPZA 1DPUA 3HUGA 1FBSA 5JFRA 1FZPB 5DEQA 1ESVA 1BN5A 3I33A 2P9PB 2VYPA 1P6RA 4H0OA 4A5NA 3F6VA 2Y0MA 4IF4A 3HOTA 4BAYA 2F5DA 3F72A 2ESHA 4YFXF 1W4MA 1FP2A 5CYVA 3BJ6A 1YVNA 1U8RA 2FBIA 1ZAOA 2ZXJA 1B4AA 3BF3A 3O08A 3PFIA 4CJ7A 2JRTA 3CUQC 5FLXZ 4YG2F 2K4JA 3C0BA 2CO5A 3ZN0A 2NRAC 3ULEA 1KYZA 2G9WA 3TDZC 2ISZA 2HFHA 2OU2A 1XMKA 1L3LA 4CZKA 2LKPA 1XGMA 1H9GA 2ETHA 1B6AA 1OR7A 1K6OA 2E88A 2HKXA 2ZCWA 1G99A 3KLNA 2P9NB 4FWSA 1S29A 4BRMA 3AAPA 3UKRA 2L4MA 2K86A 4JK1X 5FFXA 2GEMA 2NLXA 2P9SA 3G3ZA 3E6CC 4IRGA 4KT5C 1BA0A 1NGCA 2ZGZA 3D7EO 3V7SA 1I1GA 3BWGA 2QWQA 2KJCA 2GXBA 4P9FA 1K78B 2O6GE 2FU4A 4RCHA 4HW0A 3SFZA 3D2FB 4EAHD 1OYIA 3EETA 3FXRA 3U2RA 2ZF5O 1XGSA 3FFKB 1WI9A 3FMSA 4FWLA 4IPAA 2Q8KA 4HX8A 2OQRA 4HOBA 1TYQB 5AQMA 5BN8A 4GGGA 2A5XA 3DXMA 3E6DA 2P6TA 4DNCA 5E1WA 3KZZA 3WEEB 5JR3A 1T98A 1PDNC 1ON2A 3O5BA 3ZEUB 4J8FA 2HKOA 3B8AX 4EJTA 1D8KA 4RAZA 3SHFA 3ZMDA 1RUOA 1YG2A 4LK0F 3UKUA 1HQCA 1HXDA 1C0WA 3NQOA 3GX4X 1JHFA 1P4WA 4YDUA 2ZJ2A 2NYXA 3CJNA 2DLLA 1CGPA 2A69F 2QWRA 1S7AA 1GXQA 1J0RA 4HX4A 3VESA 1I5ZA 5BN9A 1XC3A 4WXHA 4S04A 4OIOF 1ZARA 1DGKN 1NGIA 5A2QZ 3SK3A 3F6OA 3IL2A 1ZBSA 3AARA 3U4LA 2IVMA 2A07F 4FWPA 4F7ZA 3FE1A 3DV8A 1USTA 1BO5O 3I53A 3A5MC 5K5QA 4FT8A 5BPNA 2KIUA 1YQAA 1KXPA 2HOEA 4KBOA 4KYWA 4I2OA 4GO1A 3FZFA 4B9QA 4HF0A 2QBYA 1SD5A 4Y17A 3GFJA 4XSZF 1T44A 1NGDA 1OMIA 4ZZLA 3QPTA 3ULQB 3T0YA 2ELHA 1TUYA 2QQBA 4EVIA 1RGIA 4ZH4F 3JS6A 2HQNA 3CERA 2IVPA 4Z2YA 4XRFA 5LBQA 1O57A 4RGXA 5E20A 2V79A 3ISPA 3WTXC 5AQPA 5BPDA 2DK5A 2M1BA 4NB4A 3GF2A 2HEOA 3D0SA 4NO7A 2XROA 4KN4X 2BGCA 2ACJA 3EKSA 3FZKA 1ATRA 2VBWA 3ZETA 3TKYA 4FPBA 1ZREA 5FFZA 3L7WA 2JPCA 4ESBA 5ILUA 3JSPA 1JCEA 2K02A 1HSTA 3QOPA 4DB3A 3F8CA 1UHMA 1NGFA 2P7CB 2D2WA 1ZRDA 4Z94A 1TTYA 4EHUA 4KICA 4OIRF 2VONA 5ERIA 1P4AA 1F1ZA 1SQKA 2NRHA 1BU6O 4CZEA 3SQNA 5HS9A 1P92A 4KUMA 3F8NA 5CLSA 2K4BA 2GWKA 3EN9A 2RDPA 2NZTA 5KQ8A 4ZZDA 3N4MA 1HW2A 4ETSA 2P9LB 3FZVA 1XGNA 1YW7A 4BROA 1TNTA 3ZMTA 4KIBA 4WQ5A 3LAPA 2W85A 1ZG3A 4QWQA 1E2XA 1TQIA 3CDHA 3LDNA 2CFXA 4HAMA 4KMUX 5LY3A 4KNYA 1ZXOA 3VEOA 2XVCA 3DXKB 2E7XA 3O80A 4P5OA 2LNBA 3DEUA 3GWZA 3JW4A 3QMLA 3GZ6A 5L3FA 3VF6A 5LGNA 1NGBA 1TW3A 2O03A 1O7LA 2FA5A 3BOQA 3P7NA 3O1BA 4FWRA 2GQQA 5AQFA 5FD6A 5E1ZB 4IZ9A 1R1TA 2IJLA 5KPRA 3IKVA 1XQSC 3VGMA 5HLIA 1SD4A 4I01A 5D5UB 3O1WA 2HTJA 2YR2A 4R1HA 3ZN1A 5DDGA 3TO7A 1R36A 2CGLA 3VF4A 2QENA 1I1SA 2Z5UA 1CF7A 4H0YB 1G3WA 4G7ZF 3F3XA 3HSEA 4CICA 3MCZA 1ZGAA 3KVGA 5D6FA 4H03B 5DUKA 2VE8A 3IWZA 3VFZA 3UB5A 5LHIA 5AONA 1P4XA 1GVJA 3LSTA 4ON0A 4CO8A 4BR0A 1KGSA 2Y75A 1R1VA 2IVOA 1ZG1A 1HKTA 2VBYA 1BA1A 1KU9A 3A5LC 1W7PA 4OMZA 4A0ZA 1KU7A 3DXJF 4UXNA 4O5VA 3M9AA 5L3EA 4GYGA 3LA3A 4IO8A 2EFNA 3QBWA 5AQHA 2IA2A 3SLCA 4BGBA 5AIQA 4D0PA 4H0PA 5CVJA 2JSCA 5AQNA 4EGZA 2FSWA 1RDWX 3M6GA 3R8EA 3FZHA 1HKBA 4O5FA 1YTYA 4BVOA 3CI5A 4CHUA 2Y48A 2QUFA 2R7FA 4IVNA 4BR2A 3U9GA 4CD1A 4XBFA 1OYYA 4MLEA 5AZJB 5TRDA 4AD9A 4JHDA 5D8KB 3WT0A 5BS6A 4PKIA 2GZWA 1ZYRF 5LEKA 2F5FA 5EEGA 2V1UA 1E4GT 2NAZA 4O6JA 4Q4ZF 1QZ5A 5D4RA 2ADUA 1IRFA 1SFUA 1GLFO 2PLYA 4BRCA 3CJ9A 3EQLF 2FNPA 2ZMEA 1HLUA 1H1VA 4PGHA 1ZG5A 1MDMA 4GYIA 4FOEA 2IPQX 3M7GA 1JE8A 3MN5A 4B8XA 1QPMA 1S6LA 2UYTA 3TU5A 3FMQA 3IC7A 2A3ZA 2O8XA 3DAWA 1RNLA 1FY7A 3TO6A 3KZYA 5KK1A 4RB0A 4BR5A 1FYLA 2OAZA 1U2VA 3FXQA 3LDLA 3DP7A 3L0QA 2RVCA 3N97A 5FGMA 3EYIA 1TW2A 5LGTA 2H94A 4XSXF 1T39A 1NGEA 5AQSA 4BHCA 3MAJA 3I58A 4LB6B 3MN7A 3ZMZA 4FX0A 3IFRA 3VODA 5F6FA 3IWFA 2P6SA 3HRMA 3O4WA 2VXZA 3RSEB 2L4AA 4N0BA 3DF8A 4UUVA 4ZYEA 1FSHA 3WXLA 5LRSA 4ENKA 4P96A 5H6QA 2OZUA 4GCVA 3M1FA 2HTSA 1RUNA 2FXUA 4HLYA 2H6BA 3C1DA 4I98B 3ELKA 3TPQA 4UV9A 1ZLKA 2OA4A 3CO7C 4M7XA 3HOSA 3MWMA 3LDPA 4BHBA 2L01A 3J81Z 3WE2A 5EEHA 4EMSA 5KQDA 5AIPA 4FHTA 4BC2A 2IA0A 1YAGA 1BG3A
chains in the Genus database with same CATH superfamily
4J2BA 4H5RA 2R5ZB 4GXOA 3H3VK 5FDLA 3U21A 4CCHA 4CZGA 1A31A 3R9PA 4J2AA 2KRCA 1J5EK 1HNZK 4G6DA 1ZGJA 3J7YJ 3FZMA 4BXUA 4PWDA 2DMUA 3VQ5A 4KHYA 3O4NA 5M1OA 5J3LA 5HOOA 1S22A 1HQUA 3JYTA 1JGGA 1XSXA 4CZZA 5JLWA 2ICWG 3PNTA 1GLBG 4ILHA 4HV6A 4LY7A 4K0KK 2EIMH 3NH2A 4LLLA 3LSGA 3V8KA 5CHIA 1G59A 3LQRA 1QZ6A 3RIRA 1IO2A 2D5VA 5F1XA 2VI6A 2JWKA 3EDPA 4X0GA 2CV1A 3QYEA 2F4OB 2EA2A 4BEHA 4MQ3A 5F64A 3ZSWA 2HF3A 3ASOH 1SANA 3VGLA 5LL6Z 5DD8A 3KKRA 3CMMA 3F0CA 1Y1WJ 4C23A 3HUGB 1Z3YA 2FBXA 4XLPF 4B9MA 2MC4A 4KN7X 4OMYA 2ZNYA 1Z7UA 5KI6A 1VQ9N 5KVRA 2GLOA 3HTSB 2YKMA 3G73A 3KD1E 4GFBA 4FW1A 2RPIA 5IOZA 1KAYA 4IOAF 2YCHA 4YORA 2LR8A 4MHGA 4QTRA 1EP4A 3ZQIA 3LP3A 4WYBA 2XAHA 4RM2A 2EBIA 3NCIA 2DFEA 2RQPA 4XN3A 3H36A 1FKOA 1X4PA 3THXB 2PG4A 1IRGA 4N56A 4DZPA 3ZQ7A 2O3FA 4ZTFA 4YOXA 2NOGA 1NG7A 4JP0A 3DM2A 3ATVA 1J54A 4M73A 1TWHJ 1B1BA 3AO5A 4JKHA 4F2RA 3HOYJ 2M7BA 3K9JA 5AQZA 2MD5A 3OOPA 3F73A 1KQ8A 4PUSA 5LGUA 5E8IA 4NQWB 3DTEA 2ECCA 5C2FA 4A5MA 3HSRA 3F22A 1EX4A 4MLOA 3UNGC 1V55H 1JXBA 2OJED 2AS5F 3BR2A 4PZJA 2ZB9A 2O9LA 2BHZA 2FQ4A 1GLJO 1S1XA 2W6KA 4OLAA 1K4SA 1JL2A 3C2BA 1TBXA 4MIMA 3AVFA 1XSDA 2BXZA 4O0JA 3K58A 3FBNB 2D0AA 4BH9A 2X6YA 3FGUA 4HZFA 5L3CA 3OS1A 5IY5H 1FC3A 2Q2RA 4BY9C 4FJJA 4LF9K 4B9NA 1MBHA 5HS8A 2WV1A 1WJDA 3OYNA 5IP9J 3OS0A 2FF3B 4EM0B 3TW7A 1MWMA 2HHWA 4UV8A 5FKLA 2WTUA 5BPIA 1JKRC 5FPDA 2O8CB 1NJYA 3QIOA 3K70C 1D1AA 2ME0A 2LREA 2R0QC 4KTZA 2IS4A 2WTEA 1T0FA 2VGNA 2NRVA 3LDOA 1W0HA 1BI0A 1YUWA 5EY4A 1W7PD 4KHSA 1T03A 3DLRA 1WBDA 2HOTA 5FPMA 3BDDA 2PAVA 9ANTA 3H08A 2KDZA 2FBKA 3DQVC 1GOCA 5AQJA 2VBZA 3L2QA 3BR5A 5FKOA 1IG9A 3DKWA 4KAZA 2KPMA 1R7JA 5M3MJ 2KHOA 4Q48A 2XY5A 1X3NA 1U48A 4IOAL 2CU7A 1FPQA 2DFHA 1T33A 3H0GJ 3F8FA 4CJPA 4FPAA 4OGCA 3PO5A 1YW9A 3REOA 1UB9A 3C2GA 2YX7A 2JZYA 2M3AA 1I3QJ 2VGMA 4EFHA 1J53A 2NS7A 2HOSA 3LOCA 3KP6A 4RW8A 4HNVA 1LUJB 4JI5K 1MU2A 2KKOA 1OCZH 3L3VA 4MEXF 1BC7C 3LWFA 3TAFA 4EJWA 3BR0A 1FTTA 5D5VB 1SMYF 3ZCMA 3NBPA 1HYVA 1DP3A 5HBMA 1OJLA 2HHHK 1SL2A 1BHLA 1MNDA 3H35A 4Z4FA 4Z4IA 4IEJA 3O3HA 3HG9A 5E17F 4BNCA 4AHCA 2BGGA 3GW2A 2VWBA 3ABTA 4XLEA 4M3TA 2Q0RA 3GE1A 1YT3A 5EG0B 1BL3A 3D1NI 3WNFA 2KP6A 3CCUI 5AQRA 1APLC 1OVQA 5CVVA 1GOAA 2KHMA 2OD5A 5C4JJ 3OSGA 4I9LA 3SJJA 3SQ1A 4EQQA 3KP3A 2BY3A 3SZGA 1YI2N 3LAKA 3VEZA 2EQRA 1RTIA 1NK2P 1A6IA 3OW2M 2VBXA 3JREA 1XNRK 1LDDA 4EATA 5KRTA 2Y69H 2UWMA 4E6KG 4A3MJ 4E7IA 3G0ZA 1J59A 4OKEA 4QLCU 2GV9A 2E2NA 3NE6A 2DQLA 1KLNA 1KYWA 2G7UA 2UXXA 5JVHL 2P8TA 1JL1A 3ZSYA 4H4OA 3K4CA 2BYVE 3LPTA 3MEXA 3R1XA 2BTFA 3EKUA 3DBRB 3S3NA 4FYDA 1WH7A 2QZ8A 1C1AA 1ZQ3P 5I9EB 2J5PA 1WQ2A 2MGQA 5D6EA 1FP1D 3U1KA 4EM2A 4IJAA 4GMJB 3WTYC 1HQEA 3L00A 2JVGA 3ZP5A 4H8KA 2Q36A 5BR9A 4Z6YA 4IXAA 1XC5A 3CC2N 2KZVA 4O8KA 4HUGA 2DDAA 4BG8A 1IXCA 4P55A 2XGEA 2LF7A 3V1QA 3Q7CA 4CXFA 1U5TA 3HSFA 3VA0A 5D5WB 4C8MA 1T0FC 2Z99A 3DMJA 2ATQA 3EY1A 4PA1A 2EH3A 3BZKA 1W9HA 1LCUA 1K73O 4RLFA 3M8FA 2D45A 4E4HA 4MTDA 3J7AP 4FJLA 2EV0A 4HX7A 3AO3A 3RTRA 1GVDA 2HQ5A 5IYCJ 3ABUA 3SNNA 1U6GA 3FK6A 4FX4A 3GBGA 2DN0A 1TLHB 3BDPA 2R7RA 4L9JA 1VFCA 4AWXB 4RAYA 2P9PA 2HI3A 3R6SA 3BJAA 4RB3C 4EEFG 2H27A 4NLCA 4U0WA 3HRTA 4DR6K 3Q5FA 1UAAA 1NG9A 1SFXA 4C8OA 2PMUA 4HWIA 1O3RA 1O4XA 1QQIA 3HT3A 4KO0A 5JLHA 4HDUA 4EJUA 1D0XA 4GVMA 4BRKA 3JRDA 1C1CA 1KONA 5DD4A 1EA3A 1XWLA 1BIAA 5CZ1A 3TAMA 4Z0UA 4CDGA 3P5JA 1BW5A 3RDIA 1K78A 1PUEE 5AQOA 1DU0A 3CMYA 2FLOA 3DU6A 1YJ9N 4RGRA 4CZMA 3T1HK 3AG3H 1S6PA 1FIPA 1Z7LA 4BC3A 4JI6K 2VT2A 4NC6A 2MBFA 3ABMH 4ZYGA 3I55N 4AU7A 1REPC 2XRNA 1Q18A 1NG6A 1MDUB 1IXRC 4GW6A 3PO2J 3C6HA 4B9LA 3HPOA 2B63J 1L3TA 4PJ0C 4B3AA 1D0YA 2V1DA 3BTLA 1U6ZA 4X65K 1ON1A 1Z21A 5HODA 3RI4A 4CHPA 2P9KA 3O6BB 4IOXA 1LKXA 3SJHA 1ZN2A 1TAUA 1BOAA 1FSEA 5GAGJ 1V4RA 4RAFA 2VWJA 1L5UA 2F9TA 5LHHA 2F7TA 3O9UA 1B59A 1H9TA 3QDKA 4JI0K 2KRFA 5HDKA 1MBEA 2LOOA 2EV5A 3JRAA 5DUIA 2HS5A 2FJ1A 4FZXC 3EE8A 2TRTA 4DBQA 4XMYA 2BE5F 3CCMI 3C7JA 3WU0A 5C3EJ 4JLHA 4M72A 4BQOA 4YOUA 4Y52J 1IN5A 4NUBA 2E1CA 1LWEA 3IMXA 2Q1NA 3OYIA 3TOBA 1FMWA 4YIFA 3KPHA 2L02A 1IDZA 2WC9A 4W97A 2E6MA 4YFNF 4ENMA 4BWJA 4FJKA 3TOAA 1TV6A 4FASD 3I56I 2GWRA 1J75A 2HHXA 3NF6A 2PQ8A 2E6LA 2R7SA 2FF4A 3R3LA 1Q1HA 4XIUA 3LM9A 2KT0A 3FWEA 4Y3OA 4QOZB 3O4QA 3UKGA 4F4KA 1LAVA 3GDQA 2ZNZA 1SKWA 2IA1A 3SEQA 3TAEA 5KGXA 2WB1A 4B1UB 1BBYA 2CH5A 3FR0A 2H8WA 5KPZA 4YHHK 3DCFA 2WOMA 3LSIA 5TGTA 1BOBA 5ADXH 3OYFA 5J8FA 1E3MA 1IRZA 4FZZA 2HYFA 4YNQA 3K5OA 1SMTA 2E60A 3DLGA 1K6YA 2JJ7A 2EA4A 5HLTA 2HVIA 4U87A 3GZNB 3QNNA 4FJXA 3DXKA 4DQIA 3FHZA 1SD7A 1QA6A 3CJ7A 3CFRA 3HYFA 5AJ3K 4KIGA 1S5LC 4BYYA 3L2UA 5GP9A 1U04A 3CPWM 3I64A 2WY8Q 2DY4A 4F93B 3BP8A 1Z6TA 4K42A 1ATNA 3FXKA 4AYBN 1NGJA 3WNEA 1O3SA 4XONA 2Q2EA 4AIDA 4C8NA 3WG9A 3CUQA 1R5GA 5DCMA 1REVA 1RC9A 3D5LA 3VEPA 4PKHA 1WPKA 3WUHA 5BQTA 2Q97A 1JKHA 4Z4GA 3MFKA 1NMNA 2CW8A 2E1YA 4HA8A 4H5VA 3ZX2A 1FWZA 3AVHA 1MSEC 4B47A 2FOWA 2WAQA 2OPQA 2R3SA 1QBJA 3OR2C 4L3QA 4KRFA 5FROA 3H45C 4FJHA 5HDNA 4FVUA 1MJAA 3CP8A 1GHCA 4A93J 1X3WB 1VRUA 4H0TB 4M63C 3PIPF 4CIEA 4MTEA 3OVNA 1FOWA 5ILSA 1BR4A 3P39A 2X1EA 1GLLO 3KK1A 3R60A 2X6OA 3S93A 3CJCA 2DU9A 1EO1A 1NK3P 4ISGA 1HPMA 3ENOA 3WTTC 2VC1A 4FWNA 4PFPA 2HDDA 3GTPJ 3KLGA 4KHWA 1KQSM 3FKIJ 1ITGA 4FWMA 4DQPA 3M5RA 2JA7J 2XC7A 1XUPO 5BNGA 1QZZA 1TT0A 2GOMA 3I0TA 2BBYA 1NH3A 2DOEA 3E9PA 2NRRA 1WOQA 1W5TA 3V8LA 3R6MA 4L0ZB 4W5NA 2Y31A 3F9KA 2QCOA 1Z6RA 2QQAA 2Y1IA 3NEUA 4BGDA 4NYNA 3ZQGA 1U2VB 4A3KJ 3S1QJ 3DWLE 2Z1JA 2NOJB 2VODA 3HTVA 3WNGA 2A40A 5DM6F 3F5TA 3MDQA 2PX9A 2ZBKA 3WQUA 1JCFA 1QE1A 5SWMA 1R71A 2AXTC 3E97A 2PYLA 4A0XA 2E7WA 1LAWA 4DQ2A 4EIAA 2NVYJ 1T2KA 3VGKA 4M6XA 2Z2SB 1X1CA 2TDXA 2LC2A 3C2HA 1FTZA 3IH3A 3NARA 3LZJA 4PY5A 1FYMA 1P90A 4EP5A 1YLFA 2IAJA 4NYFA 5EYRA 2UZKA 1QSYA 2PY5A 2M0CA 3LFKA 1KVCA 3IRQA 2CWEA 3W0LA 1X1PA 2UXNA 1HKCA 5EEAA 1LQ1A 4ZJZA 1N32K 2BVLA 5FRNA 4CUGA 3S2DJ 1WWXA 3KHYA 4J00A 3OL3A 1B72A 1R4MB 4B1VA 2KIFA 1NOYA 4AVPA 4JAXA 1AOYA 3P9IA 1Q81O 5C15A 1S7OA 4L9NA 4MO4A 3C18A 2P4WA 3DLAA 4M42A 2M9HA 1RT7A 4LOCA 1RETA 2JA2A 3HOXJ 4IBNA 2CRGA 1RBTA 1QO0D 3K2AA 3FFIA 2K9SA 3T5XA 4BBSJ 1QQOA 2V6EA 2R7ZJ 5LLQA 4Q47A 4WQ5C 1Y6IA 3I4NJ 3CFPA 4ID1A 3O3FA 2DFFA 2L5QA 4D7NA 1JLEA 4BEHB 3HOTA 2ESHA 2EINH 1QSSA 3PFIA 4CJ7A 3GTQJ 2JRTA 2LYCA 3CUQC 2K4JA 3ZYYX 3V9SA 2G8KA 3ULEA 1KYZA 2CV2A 2HFHA 1P7IA 1XMKA 3G1LA 1NTCA 4X62K 2E88A 3IAM2 2HKXA 3TR8A 5F04A 3KLNA 2P81A 4BRMA 3QINA 3UKRA 1F43A 3N4QA 2K86A 4GV6A 2GEMA 2EIJH 3E6CC 4IRGA 4KT5C 2HYJA 1I1GA 5HLFA 3ALYA 4X64K 3LWLA 1FOXA 2FU4A 3ID6A 4HW0A 2DT7B 1MBKA 3FXRA 1IKXA 2NRXA 4RLQA 3FFKB 1M1KO 3LFUA 3CF2A 3NH1A 4IPAA 1U49A 1KVBA 2OQRA 2ZD1A 3CDLA 4FISA 5DM6L 3E6DA 3AVMA 5E1WA 3KZZA 5JR3A 1T98A 1ON2A 3O5BA 4CJTA 4J8FA 3B8AX 3OTOK 4OVLA 1HYSA 4LK0F 1BR2A 4YOTA 3LSPA 2VL8A 2ZSHB 2XGDA 1FJLA 2ZJ2A 3CJNA 4ILGB 1Q86O 1UZCA 4ZTJA 3PLAA 4XRMA 1J0RA 3DTIA 1Z25A 2QEXI 1ZARA 4IL6C 3JR9A 4DSKA 3F6OA 3U4LA 2IVMA 4FWPA 3FE1A 1BO5O 3I53A 4ZHRA 3Q0UA 4I2OA 1VSKA 2HSTA 4B9QA 1SD5A 3PO3J 2QKBA 1TL1A 3DLLL 3ULQB 4M3ZA 3T0YA 2ELHA 4PJNA 1RGIA 5HNFA 2HQNA 2IVPA 4I76A 3G6EI 4XRFA 5LBQA 1O57A 5C12A 4I6ZA 1G15A 3NAUA 4DUYK 1C1BA 1HA8A 2M1BA 4M3DA 3GF2A 4CHZA 1S72N 3K5NA 3ZLJA 2XROA 2BGCA 3FXOA 4IQ4A 3HJEA 2LRDA 3IKMA 3JSPA 3K2PA 2X6NA 3F8CA 1W36D 2P7CB 3W3CA 4QPOA 1NK6A 4EHUA 2VONA 1ETKA 3KX2A 1P4AA 4O44A 2CW7A 3V6DA 4RG8A 5KQ8A 1N25A 3CF5F 3N4MA 4AHUA 1HW2A 2P9LB 3FZVA 1X9MA 1XGNA 3LAPA 2W85A 4QWQA 1O13A 4CCNA 3LDNA 2JVHA 2HNDA 3ABKH 3RQ4A 4LIVA 4DTJA 1MH4A 5LY3A 4JI1K 4KNYA 2B6AA 2XVCA 3Q0WA 3QMLA 5B66C 1VQNN 2CUZA 4YIRX 3P7NA 5E1ZB 4R5PA 2R5YA 2F5VA 2IJLA 2RQQA 3OYEA 5HLIA 2W4SA 5D5UB 3O1WA 2HTJA 2HHTA 1RR7A 3OIPA 3ZN1A 5B3SH 1YVUA 3CC4N 1R36A 3VF4A 2QENA 4F52A 4YEJA 2NS8A 3SYTA 4G7ZF 1CZBA 4CGIA 4FJIA 2DA3A 5GINA 4LF7K 4BUPA 3KJVA 2OPTA 3IWZA 3V1RA 3RRGA 3UB5A 3HGYA 2N8GA 3A0HC 1MBFA 1KGSA 2Y75A 1KU9A 3A5LC 3MEGA 1J09A 1W7PA 4OMZA 1KU7A 4UXNA 3CDIA 4LD0A 2R7YA 3LA3A 4IO8A 4XORA 1VAZA 5AQHA 1VQPI 3C6AA 4H0PA 5CVJA 1ZBHA 1NOZA 3LPUA 3OYCA 2IGNA 3DRPA 3R8EA 3J7ZO 5MLCQ 3EE9A 1YTYA 4HNUA 4KJZA 1D1CA 1UMQA 4HG2A 3RMCA 3OOUA 4JHDA 5D8KB 2F5FA 1XX5A 5EEGA 2V1UA 4O6JA 1SFUA 2PLYA 4BRCA 4FJGA 4FLTA 2ZMEA 1H1VA 1ZG5A 2NRZA 2IPQX 1QU3A 4DW6A 3QEIA 1EF4A 4FLZA 2V9PA 3FMQA 3RTVA 5FKMA 4QIWN 3DAWA 1FY7A 3TO6A 3VYSB 4RB0A 2E35A 3FXQA 4DTRA 1JKPC 1OH7A 1TW2A 4XSXF 3ONQA 3I58A 2WBNA 3MN7A 3AFHA 3ZMZA 3IFRA 3IWFA 3SEZA 3QOEA 4ZYEA 3QODA 4E7KA 2XO7A 2OZUA 1R4NB 1RUNA 4CH7A 2FXUA 4HLYA 2H6BA 2KISA 3TPQA 4O55A 2OA4A 3LDPA 1U8BA 5EEHA 4Y1CA 3GTMJ 4KT6A 2IA0A 2E1NA 3DRRA 4RW6A 2UXCK 1T6DA 2K85A 3GBTA 3WNHA 2RKIA 2RGVA 2W6LA 2WAFA 3GUDA 4C1NI 1A36A 5E3OA 3IDHA 4I2QA 3W3DA 1HW1A 4X6AJ 1W5CC 4A3DJ 1YITN 1VTNC 4KISA 2ZFUA 3C3WA 1T8IA 4CBWA 2C6YA 1VQMI 1KFSA 2YJEA 2CUFA 5LFAA 2CFOA 1S9GA 3VEWA 3PFYA 2FSNA 2E5LK 2BY0A 3BPVA 4WWCA 4DSIA 1U0JA 3S2HJ 4Y1DA 1V5EA 2CQKA 3SUNA 1XCBA 1GUUA 1BQMA 2CQ7A 2ME6A 3VQ9A 1FX7A 5JVGF 3QRFF 3CMEN 2MLKA 3GFIA 3CCQI 4HTUA 2DBBA 5LD2C 5M1PA 1S5JA 1WRJA 1M1EB 4M7YA 2L9RA 4IRIA 2JUGA 1U2WA 3TEDA 3NRVA 4XNFA 1MD0A 3IG1A 2W41A 4CK1A 3G10A 4RAGA 3MCAB 4WFNL 2GOXB 2A05A 2IXSA 4BE0A 3BR1A 1RKTA 5JICA 1QQMA 2IDOA 1MMAA 1ILYA 2P9NA 3EO3A 3JAMZ 2RN7A 5HP1A 4A0YA 3T7ZA 1VQ4I 1BI2A 3CMAI 5I42A 1C6VA 3ID8A 3D2FA 3H6EA 4FWQA 5GTHC 3VETA 2XAQA 3AAQA 3MCPA 1MWKA 3I9V2 2V7FA 1TYQA 2K9MA 3J7AO 3T8RA 1XSVA 4H4MA 3LAJA 2VJIA 3KP2A 4BREA 3MZHA 1JTYA 4CGFA 3ZEUA 2XAUA 5IT3A 3FM5A 1HKSA 1NGAA 3T1BA 3K4NA 4IHXA 3BTCA 3CJAA 4CBXA 5KRSA 4DFMA 4H5NA 4UVAA 2P9KB 1GLDG 5E3MA 3QICA 2YUSA 4N4OB 2RHKA 2LTPA 1BISA 3AA3A 2YV0X 1DP7P 4FOIA 4XLFA 3WGGA 2CGPA 4RS8A 2KMUA 5HS7A 3GFMA 3TDUC 4Y13A 1VSEA 4L9VA 3CESA 4JKDA 4FWKA 3EUHC 2K40A 2OC6A 4UNOA 2VN2A 3MK6A 2B4JA 2ZFWA 3M8QA 4CFAA 3IUCA 4DV3K 1W7AA 3MZ8A 2M30A 1MMGA 1LEAA 4ZYAA 2EK5A 2A6HF 1O7FA 4OLBA 4D1QA 3CCEI 2XY7A 4RB2C 4ZC3A 4AIKA 1XMXA 4F91B 1D1BA 4A12A 1HKQA 2L7ZA 3ERMA 4BDYA 4CZLA 3KLHA 4WF9L 2QM1A 2K9NA 1UA0A 3QQAA 2ESNA 4KREA 4XLAA 2YKNA 2FOKA 3VPRA 2X9DA 2VQHA 1NMDA 5TKYA 4CD3A 2G0EA 4LF4K 2AQEA 1WBBA 1T08B 5AQXA 4LLGF 4UHTA 2B9SA 2EPFA 3R4KA 3Q0VA 3NGIA 4M3YA 4GKKK 3WE3A 2COMA 1NGGA 2WFBA 1X4OA 1EQYA 2BXYA 1PP8F 2E1MC 2GX9A 4ELUA 2NNYA 2QKMB 2I7PA 5IT9K 2E2PA 3BG7A 3AA5X 2NUBA 4YY3K 2L54A 4CGJA 5EJCA 3VERA 4IO9L 2V7YA 4HHTA 1HOMA 3G25A 2WY7Q 4PL7A 2R92J 4F55A 5H6RA 1LVKA 3RKQA 4G6QA 3S3MA 2Q2EB 4D7MA 5LHGA 1VQ6I 1WJAA 3CUQB 4LD5A 5DCMB 4CHYA 4J2EA 3Q9SA 5JS1A 2ASOA 3SI6A 4LGWA 2HDWA 3RR7A 4BKXA 3A5NC 2K27A 4PSWA 4XLNF 5E41A 3RRHA 3IRRA 1CF7B 1FBUA 4B1ZA 2R7XA 3HGGA 1DTTA 2HVHA 4DF4A 3H5RA 3P9KA 2E8AA 4DLGA 1RILA 4HQMA 3DFGA 2OTJN 2P5LC 4Q0BA 1BI4B 1DPRA 1JJ8C 2YSRA 3QFPA 1WB9A 4B1WB 3WQTA 4U7BA 2W24A 2Z1DA 1GOBA 1SAXA 3HRSA 3CCVI 1KC8O 3NFAA 1UWBA 4H5WA 3OYDA 5AZJA 2BV6A 4GNIA 4KHQA 4H0XB 5GTIC 3W2AA 2EFWA 4KHUA 2GWJA 3OIOA 1RNHA 4KA4A 1ASUA 3UR3C 3E6MA 5ED4A 2YI1A 4I09A 4CJEA 4A5AA 1NK4A 5J2PA 1LOTB 1HNWK 5AR0A 3ESWB 3CCLN 1F9NA 3HVTA 1T6CA 1LB2A 3VN5A 3AO4A 3BT9A 3P83D 2QWPA 4CGGA 1QZEA 2DYRH 3NVKA 3TL4X 2OPSA 4IWVA 4DHYA 4DV2K 4NCBA 4WFAL 2PN6A 4OPAA 2PEXA 1GLAG 3VSKA 3QAHA 3FLCO 4WF2A 1S1VA 2KIMA 2XPVA 4AHVA 4RB1A 1X9JA 5C42A 3H9GA 2QWMA 4QS8A 4OINF 3K59A 4FJ7A 2EWNA 3HIFA 2ELJA 4BGAA 2UUBK 2FBHA 4CGZA 1VQLN 3MEDA 3S1RJ 2UUZA 1QVGM 3BUZB 2JQ7A 1YX3A 1TKDA 1TL3A 4FE4A 3CC7N 2EIKH 2E1ZA 1VQON 5HLGA 4ICLA 4IX7A 2L2OA 3ZSXA 1TKTA 1MNMC 4LB5A 2A41A 1OCOH 3BF1A 4BRIA 3CO6C 4AM7A 4NXMK 1HSJA 1X2NA 3S32A 1IUFA 1JUMA 2NVUB 2K7LA 3CCJI 1B72B 2ZWHA 1N8RO 2P9UA 2HVSA 4DZJA 4E7HA 5ICGA 3WXKA 3ZMUA 4UY8O 5J2MA 2VE9A 3ZPLA 3H1CA 2J5OA 1J6ZA 2BEOA 3LA7A 4OIPF 4AM3A 1W5SA 1KCFA 2VKDA 2CH0A 1HPZA 3G2BA 1USSA 2P5KA 4XICA 3HRUA 2YJFA 1A5JA 4HVJA 1ACIA 5FKNA 3LDSA 4ZYDA 2XAGA 5FJ8J 1WSIA 3HPGA 4JD2A 4DR7K 5GAGP 3CQZJ 2MABA 4UB6C 3I59B 4V19K 3SMSA 4HDVA 1JLGA 3TGNA 3RKYA 2FSJA 2QA4I 3ULEB 4J2DA 3OL4A 2HOAA 1TKZA 5L3GA 3CZ6A 4HV5A 4YOYA 4CK2A 3ZSZA 3GZ5A 1FK9A 1EKEA 3TABA 4GY2B 3QP6A 3UKRB 3QEPA 4UQGA 2E2QA 3PIOF 3TQNA 3ZX0A 2IC3A 4G1QA 4I7FA 1UFMA 3FK7A 1JLCA 4E7SA 2HQAA 4M3BA 1RESA 4QS7A 2BHYA 5LRRA 5ICCA 4MQ9F 1IG7A 1OH6A 2ELKA 3G1MA 2HWVA 2A61A 4LFCK 3JAMK 1B8IA 4AHSA 2OCEA 2UV1A 3AVBA 1WJBA 3HOUJ 3AG1H 4JBAA 4F9OA 4MQVA 3OY9A 4MO5A 2Z1HA 4BWMA 4BQZA 4X1EA 3V7CA 5AZIA 3FX3A 4ZYHA 3TARA 2XDVA 1NKEA 2FF6A 4QCLA 3CD6N 3FXLA 2WB1N 2JN6A 3EL2A 3SV4A 1WAFA 3IKTA 1XNQK 3LSKA 1L0OC 2KIQA 3MXMA 1F36A 2A5WA 4H5TA 4OPJA 2XHKA 4JKAA 2ZKZA 2RNJA 1AU7A 4XH4A 1GLEG 3KZIC 1R59O 2RC4A 4RBOA 2DPDA 1HX1A 1A04A 4OAYA 4DQRA 3RJPA 2XGCA 3VTIA 4BR9A 4HBLA 1R58A 3EYYA 1WJFA 1EH6A 5DCFA 4AHRA 3JRCA 3PX0A 4CCOA 3P38A 5JLXA 3WU2C 3AKZA 3CCSI 2D0PA 5TJJA 1LFPA 4DYQA 2W82A 1NM1A 2IS3A 1Z3XA 3C7NB 1N5YA 2OTLN 2HPIA 2WAQN 2VQLA 1ZH5A 4DYRA 1RBUA 2NVTJ 1J9IA 2HB5A 5F0HA 3L4IA 1A5XA 4B9TA 1HBXG 2CMPA 1VQKN 2DA2A 3A1YA 3LDQA 1HF0A 4BC4A 1JLBA 1P8ZA 2UU9K 3HP9A 1MJBA 5BRHA 1KRPA 1JXEA 3CCRI 2E19A 2TCTA 4KFCA 2GBYA 4FL9A 3U9ZA 1T95A 2VT3A 3PIOL 3RPQA 3K4MA 4A3LJ 4K8ZA 1HCRA 1IJJA 4S0HB 4I0AA 1C0GA 2UXDK 3CYMA 5GADP 3AVJA 4FLUA 4PKGA 3TWHA 4CZCA 4LG0A 5ICEA 2XIGA 1EH7A 4HNTA 4IZZA 3L2VA 2R5YB 5L3BA 1I94K 4CSWA 4DR5K 4DR2K 1STZA 4OPHA 1A6QA 1IJWC 3G71N 4DTMA 1XI1A 4E7LA 1IC8A 3SUQA 3ULDA 1X1BA 4CEFA 2QQ9A 2KQRA 1RBSA 4PFOA 3CM5A 1X9SA 4HUEA 3HHGA 4BXXJ 2A1SA 1G6NA 5B8HA 3SXYA 4ISFA 3J80O 3ZQQA 1ZLJA 1VQ8I 1W7PB 2FE3A 1BC8C 4CEQA 4G7OF 2HPMA 2HW3A 4FZYA 2CGJA 3PQKA 1D0ZA 1HMVA 3O9TA 2L7MP 1U4BA 3D2EA 3KFWX 5JMVA 4DSFA 2VASA 1RTJA 4B9SA 1S9HA 1G4DA 3E3VA 3EPZA 3H1VX 4JHDB 4DTUA 2PZSA 3S3OA 2B5JA 3THVA 3VYRB 1BGXT 1YE9A 2O8DB 2AXLA 3E5UA 2H3GX 2L3DA 4EP4A 3ASNH 1Q7YO 4M3WA 3HPHA 3L9FA 3ZT0A 3FF5A 3SDBA 1S6QA 1G3SA 4YDUC 3KCCA 1T3VA 3WTVC 3QPSA 2OPPA 1MH3A 3TANA 1KAZA 4JI7K 1DUXC 1Y97A 3GOIA 3WGIA 5BRDA 2CGKA 2IGIA 1KQ9A 3L2RA 3VA3A 1FLIA 1IKVA 2I5JA 5BPLA 1TAQA 3MN9A 5LJWA 3H0DA 1IXSB 3VQ4A 4Z4CA 3QO9A 4FJNA 3ECOA 4ITVA 3R0JA 3QB0A 2XKPA 4BRPA 4B1XB 2YHXA 1JKQC 1YFHA 1N77A 3CM6A 2GUPA 2QGUA 4G9ZA 1Z9CA 1U47A 1RTDA 1YHQI 4XKCA 3VQ8A 3S17J 1YO5C 3MWTA 1EH8A 1QQCA 2DCEA 3OS2A 2M45A 3RZDJ 4DMNA 1NKCA 2Q1ZB 5KHDA 3MKYB 3GO5A 2LK2A 1B9MA 1IF1A 1J7KA 1ASWA 2E1MB 4HF1A 1MA9B 1JLFA 1GLCG 2GA1A 2H1LA 3CJTB 3R0AA 4JRPA 4A2BA 3G4SI 1VQ5I 1TWCJ 3GLXA 4XEIA 2FX0A 1QHTA 5FO5A 3HUGA 2DMPA 1FZPB 1BN5A 1P6RA 3F6VA 5CZ2A 4IF4A 2F5DA 1B9DA 1CXQA 2WBMA 1W4MA 2A1RA 2M2EA 2ZXJA 3O08A 5EF6A 3WHBA 3C94A 2ZQBA 3GTLJ 4YG2F 1WFXA 3V81A 3C0BA 4CVNE 2R7VA 3ZN0A 1D5YA 2OU2A 1KD1O 4M3RA 4DTXA 3PSIA 3SV3A 1OR7A 1K6OA 1PUFA 3THXA 1G99A 2P9NB 1S29A 3NVMA 3THWB 4GV9A 4JK1X 5FFXA 2NLXA 2ZXIA 2P9SA 3KYDB 4BJTA 1NGCA 2ZGZA 3V7SA 1R5ID 3LSJA 2ZM6K 3QERA 1QHGA 4A3EJ 5CYMA 3PNYA 4P9FA 2VLAA 4AC0A 3D2FB 1BIZA 1OYIA 3EETA 3U2RA 4B8CA 3NAEA 1YJNI 4A69C 2F8TA 2XSDC 1TYQB 3DXMA 1W36C 1AA7A 3AVAA 4DTOA 2QSGX 4DNCA 5M3FJ 3WEEB 2NVQJ 3MN2A 3ZEUB 3K5LA 2QTDA 3M8PA 3SHFA 3HZJA 1H8AC 3IH2A 3OYKA 3NQOA 1ORKA 4FLXA 1QPIA 2NYXA 1OQYA 4CJKA 2ID3A 2QWRA 2VKVA 3ZT1A 1I6HJ 3VESA 1WSHA 1I5ZA 5BN9A 2KZGA 4N4NB 4UUSA 4S04A 1NGIA 3PUBA 1ZBSA 1C0UA 2A07F 3MKWB 4FT8A 2HOEA 1K8AO 2K9LA 4JI3K 3I3LA 3GFJA 4XSZF 1T44A 1NGDA 4CEZA 1TUYA 4AH9A 3SAHA 3JS6A 4Z2YA 3U6FA 4A3GJ 5AQPA 3J7AY 2DK5A 3OBYA 4NNJA 2XRIA 2BZTA 3PNVA 4FPBA 1ZREA 1X19A 1KZHA 4CGHA 1DU6A 3L7WA 4DGWB 3MXJA 2K02A 1HSTA 4DR4K 4ZDPA 1TTYA 4B3OA 4BE1A 5ERIA 4JKEA 4KI6A 1BU6O 4DS5A 4CZEA 4KUMA 5CLSA 2GWKA 2K4BA 2HBMA 4BACA 2OF7A 4GDFA 2RDPA 4A3BJ 2XF7A 1KSPA 1YW7A 4BROA 3ZMTA 3K5MA 4RDUA 4KIBA 3T69A 3BC8A 3M8SA 1MIJA 1BR1A 2CFXA 4IFEA 2V1NA 1ZXOA 3ZSQA 2OCCH 4P5OA 3CXCM 1A35A 4FJMA 1RR8C 5L3FA 3VF6A 5LGNA 1TW3A 1JJ6C 3CCUN 4FWRA 5AQFA 3ZSRA 1VSDA 5FD6A 2DJIA 4RW9A 2M34A 4O8UA 5KPRA 3IKVA 1XQSC 4Y33A 4I01A 4R1HA 3M1CA 1QTMA 3C6TA 1OCTC 4YELA 4GVEA 1VQ7I 4BU2A 3KVGA 5DUKA 3KWIA 5EU7A 1RTHA 1OR7C 2QF7A 2VQCA 1DLOA 4ON0A 3FISA 4CO8A 5CR4A 3X2QH 2YNFA 1SKSA 1ZG1A 2P5GA 2VBYA 1TWGJ 3EUAA 3DYAA 4A0ZA 4CJ5A 3DXJF 3DLKA 4O5VA 2O8BA 5L3EA 2X48A 4OKKA 4B48A 3HC7A 4BGBA 5AIQA 4D0PA 4FJ5A 2JSCA 4DTSA 5AQNA 2FSWA 2JWLA 4EZ6A 1HKBA 1IBKK 4BVOA 3CI5A 4M6VA 5EGOA 3U9GA 3OYBA 4XBFA 5AZJB 4AD9A 1VSMA 5BS6A 4PKIA 3HJFA 2GZWA 1ZYRF 4DR1K 1OCRH 3ENBA 4JKGA 5D4RA 2ADUA 4KITB 1WN7A 1GV2A 2FBVA 3CJ9A 4RW7A 1MDMA 4M3GA 5HL7L 4B8XA 3VQAA 3DLEA 3TU5A 1OCPA 2O8XA 3KZYA 4B08A 3DP7A 3N97A 4MDAA 1Y8RB 1Z0XA 4BHCA 3MAJA 4JS5A 4FX0A 3HRMA 2VG7A 3DF8A 2YNIA 1J5OA 1FSHA 2X6WA 2IBDA 4P96A 4GCVA 4M7XA 3HOSA 1YJWI 4EMSA 1ZK8A 1JKOC 4BQNA 5K7ZA 5J1YA 5E79C 1NJXA 2VKHA 2PFUA 5E1XA 3MMYB 4XM3A 1M90O 1R22A 4RMNA 4BQAA 3KP5A 4CZFA 4GRIA 3K0LA 1CLQA 2I5UA 1YW8A 2P9IA 5F0XA 4PJJA 1N6QA 1EWRA 3AVKA 5E18F 4DJAA 5H20A 3QEXA 1NLVA 3LMMA 2P9UB 2HGCA 5AQGA 1IH7A 3TO9A 2M8EA 2HQRA 3A8YA 3S41A 2DA4A 1AKHB 1DT9A 4MLHA 1YS6A 1U3EM 2XV4S 5HVQC 2W00A 2VPRA 4V19S 1ASVA 4CIGA 2VWKA 1WAJA 3J80Z 1CQTA 1IDYA 3VF2A 5IT9O 4IG0A 1LE8A 1L3VA 4BR4A 3QETA 4CJVA 1XHXA 3O3GA 4LF8K 4AHTA 2WC2A 3ITHA 1DKGD 3H1QA 4NHJA 5KNLA 4MGRA 4JQFA 4JD2B 2QKKA 3MQ0A 2L0KA 4R8HA 5FPNA 4ZDOA 1ZC6A 3BR3A 5DM7L 1AWCA 2CG4A 4BY1J 4XRSG 5GAHJ 2GBZA 2P0WA 3BCBA 4XR6A 1IKWA 5FD5A 2DFIA 2RV8A 2HYGD 2Y0SA 1R5HA 3AVLA 3O9SA 1XMAA 1YIJN 4FTHA 2QYOA 1SZ2A 3CCMN 3C65A 3GVAA 2E2OA 2JGUA 5F1JA 2QXFA 4O3MA 3VENA 3HSCA 1JXSA 3MEEA 2LP0A 5F1RA 3GL1A 5KCMA 3CLQA 3F23A 1KU2A 4RGUA 1B8IB 4YFKF 5BMZA 3HB9A 1VSIA 3I56N 3V4GA 2FMYA 4P9UA 3VEYA 1HRHA 4YOWA 3RYPA 1ETVA 1I50J 3I54A 1DTQA 1WCMJ 3V4IA 2FSKA 4A3CJ 3VQBA 1MW7A 4B1YB 3VWBA 1F21A 5AZIB 3LM2A 2LVSA 3ZMVA 2BY1A 5ICFA 3ATUA 2Z1IA 4BRGA 4DCHA 3K4KA 1YIJI 1BI1A 4LMYA 1KU3A 2O8EA 1H88C 3EUKL 4PQUA 3SQ2A 3QWLA 5KAFC 3DBLB 4DS4A 1R0AA 3GTOJ 3VQPA 4NCGA 3L3UA 2IGOA 4JK7A 2KKZA 2AA4A 3U3GA 1H89C 4N5SA 3HM9A 4KV8A 4RM3A 2EFOA 5EX5A 4FQGA 4A59A 1DGWY 5TKWA 3AVGA 1G8XA 3ASMA 3K1MA 4JYKA 3S9HA 3E01A 4ESFA 3F21A 1BJAA 3IAYA 4M3UA 3BG5A 1HJRA 2HHQA 3JRHA 5E84A 4CHNA 1U5TC 2NNWA 4QS9A 3S16J 3DRSA 1BUPA 4DV6K 3GXOA 2BH1A 1BDGA 4WQ4A 1T05A 3PJRA 4IHSA 5AFUA 3VQCA 1Y39A 1Q9YA 4FE7A 2M8GX 1SFEA 4HQEA 1E0EA 1EXQA 4CYDA 3HHHA 3U1DA 3E66A 2R7TA 2OBPA 4BC5A 1TL8A 1G3YA 2MH9A 3KP7A 3LAMA 3A0IX 4CEEA 4EM1A 5AQYA 2DTUA 1YS7A 4WXDA 2HXIA 1BA5A 1NNEA 4PSXA 1V5GA 2PJRA 1G3TA 1R1UA 4CEOA 2G7HA 1WSGA 4LG0B 2YHAA 2NVXJ 3L6QA 3KEOA 2KTQA 4CCLA 2RAEA 1Q8IA 5M1FA 5J4VA 2Z3YA 3VOEA 4XKWA 2YNHA 1IG8A 4HF2A 4BJ6C 2GXGA 1XN7A 2QWLA 1SL0A 3MXIA 3I4MJ 4A2UA 1R23A 4KI4A 1VNDA 5GIOA 3DI6A 3BTIA 4F2SA 2F5CA 2H1KA 2OPRA 1D5AA 3HL8A 4LF5K 1IN8A 1SVLA 1XD7A 2EZIA 4NDLA 4DSEA 1BCOA 1O3QA 5CVUA 1YTUA 1Y0NA 2JUCA 3COAC 3G1OA 4G94A 2DW4A 3B6CA 3T1YK 4DG1A 1IV0A 1LNWA 2LDUA 3D2EB 2DA7A 2JTVA 2LKSA 1F4KA 3RWUA 5GADJ 2VQGA 2XGXA 4JNEA 2X1DA 1JT0A 5EVZA 5DK5A 2Z33A 3HTUA 3JAMO 4XN0A 4BXFA 3PUFA 3MECA 2LG4A 1ULYA 4EGYA 3QU6A 3GTGJ 4XH5A 1D4XA 5K5RA 2KFDA 3I5UA 5HLHA 3WG7H 4CCMA 2YPRA 3KE2A 3QIPA 3RMAA 4M9SA 4ELVA 3SZPA 1WJCA 3NMUA 5B1AH 2CUJA 2W84A 2F2EA 2EJRA 1ATSA 5EZHA 4HSTA 3VQDA 3W2VA 4CJRA 3I0RA 1OH8A 3HVRA 4FCYA 1ETYA 3BPXA 2IGMA 5AQIA 3ZQLA 4A62A 4Y15A 2HF4A 5K1YA 3L4QA 3F2KA 2X78A 2RKHA 3FHNA 3HYIA 3HZ6A 4M3XA 2Z16A 3GG4A 1NGHA 2HDCA 4QAGA 2GM4A 5E26A 4CFDA 2IW5A 3V9WA 4XOTA 3TTDA 2RN2A 5LEJA 5TISC 3ZCOA 1Z67A 4IJNA 2JT1A 2EV6A 1RT2A 3WU1B 4YIIA 5GAEP 2BE2A 2D1KA 1BWFO 3IAS2 2GTDA 5K5OA 4WK8F 2UUAK 2Q31A 3GCMA 2XRLA 2EHGA 4TV7A 2M4GA 4L5EA 1IN6A 3DLLF 1NK0A 4WQ4C 1JUPA 3KK3A 4XK4A 4QSHA 3JRGA 3W6KB 4GKJK 1KLMA 5HRPA 4CCKA 3RSNA 1O1WA 3V7RA 3OA9A 4IDHA 4KTWA 4E3SA 2DPNA 4DR3K 2QSHX 1KFDA 1SD6A 2PBIA 2PMHA 1IBMK 1RBVA 3NF7A 3OBWA 1UCRA 2ASPA 4HEA2 3WXIA 3K4BA 3HKZA 4DU3A 1IW7F 4M9XA 3FXMA 4BRFA 1LDKB 4CF2A 3IV5A 5C44J 4HTLA 1S1WA 2VOPA 2QWOA 1VSFA 1FMVA 5FPEA 1PUFB 2ZC2A 5C24A 3J7ZI 1X3UA 3JRBA 3OWTA 3J80K 3K9KA 2VKEA 1HKGA 1OVYA 4WCGA 2P9SB 3N4PA 4MFDA 2X0LA 2R93J 5AQVA 5FLXK 3H46O 3S1NJ 2QEXN 2OQGA 3BLYA 2E2JJ 4KTQA 3DLHA 5IYBJ 2KRHA 1SV5A 1VQ9I 3DXMB 2M87A 5EOYA 2W57A 1RZ4A 1SEUA 2LY2A 3KTQA 1POGA 4C8KA 3K4JA 2JPBA 4LK1F 5AQKA 3G6EN 3FM3A 4JX6A 5M1NA 1FYKA 2F5EA 3J8AA 5HRRA 5BOXA 4N9HA 4G7HF 1W2BM 3CETA 2PMZN 2FBYA 3U3YA 3LL7A 3KLOA 3MMVA 4EV0A 6PAXA 2EWSA 5FKKA 3T19A 2R7UA 3O6WA 2R7QA 4UUSB 4CGDA 3CQ8A 2BANA 3AA4A 4JEPA 4L18B 3EYZA 1EV7A 3L2CA 2KJBA 3GMEA 3BY6A 3O8GA 2NS0A 3CHWA 3M07A 4IFYA 3B73A 4A57A 2K3FA 1F5TA 3RCOA 2PYJA 1V5FA 3TAQA 3AO2A 5A2QK 5DS9A 4XRSA 3FDYA 3W6JB 1XHZA 3MX5A 4CJFA 2RE2A 2MG4A 1QVTA 3DOKA 3ZR8X 3ZT4A 3DLBA 5IT9Z 2ZGYA 2M5WA 1UG2A 2FMLA 4N76A 3S1MJ 4BR7A 4IKFA 2PI0A 3V8JA 3ZSOA 1NK5A 4CF0A 3MAQA 1KQ0A 2HBKA 4MFBA 2P9LA 2LMDA 1UAXA 3PX4A 3WTUC 3VDXA 3ZT3A 2IIRA 3I8BA 4LIUA 3U9DA 2XF6A 4U88A 5JLFA 2IRFG 2A5YB 4DTPA 2HHSA 2COBA 2ZXHA 3L1PA 5FB2A 1XB4A 3VOVA 3SUOA 5LJVA 4OAZA 1DGRM 1D3YA 2EB7A 2D5RA 4AVZA 1B9NA 1YIOA 3K1PA 4D5CA 3VQQA 2VPLA 4AIHA 3GLLA 1C0FA 1Q82O 4OKJA 2OZSA 2JA5J 1AHDP 3O8HA 2J4RA 1BI3A 3TAPA 4XKVA 4F3OA 5CQEA 3KP4A 1Z77A 3HM8A 4PCQA 1E3PA 3V9UA 1VQPN 3H92A 4KHPK 1LWCA 4CFCA 3HL2A 3HBTA 4C30A 2Y1JA 3WXJA 1P2FA 2CSOA 2O8FA 1P9QC 1GT0C 1S3JA 3WGHA 4D9JA 3BGRA 4MO7A 1Y0UA 2QXLA 4W5QA 2GXAA 2G8IA 3VYTB 1TWFJ 2MLGA 2AP1A 3Q9VA 3AVIA 3CTAA 3BY5A 4PHTX 3TP3A 3E5XA 1T38A 1A5VA 4KH6A 2KLOA 4L5JA 2MA3A 1PP7U 1XDUA 3A0BC 3V9ZA 3EZ5A 4BVPA 2A3SA 4ESJA 2O8BB 3DEWA 5T7BA 4HCCA 1KTQA 2F6CA 4DV7K 2EZKA 2R7WA 3QPLA 2DK8A 1NHAA 2DO7A 1T6SA 4DV0K 1U45A 5EGOB 2D0OA 3JRIA 2KL4A 2WV0A 5JI6A 1MBJA 3A03A 1QSLA 4KFBA 1HLVA 4JKGB 1VHXA 2L9NA 2GAUA 2KFZA 2PJPA 1MDMB 2I8DA 1RT4A 4FO0A 1IZ1A 1ZRFA 3OYMA 1QQNA 4PDKA 1LFUP 4YOVA 3KEQA 2WUSA 2ZE2A 1J2XA 4CE9A 4DQQA 3PX6A 3VSLA 4B43A 2Q3SA 1LFBA 2MH2A 1NK9A 1Y56A 3KWGA 3LSHA 1IBLK 1YI2I 1SUQA 1VQMN 3OJSA 4I6MA 1IRXA 3O8MA 4W5OA 4KIFA 4Z4HA 1YRNA 4KPYA 1XGOA 2YX6A 5IP6A 1BQNA 4HRIA 3BTJA 1XDSA 5E3NA 5J1RA 3P4IA 2BW3A 3RPUD 5HNHA 3IRXA 1E3OC 2XUBA 1R49A 2LH9A 2IP2A 4OU0A 2WWYA 2IT0A 5M5XJ 2F4MB 2FD5A 3CCQN 5H2FC 1D9FA 1HC8A 4OO1J 4FM1A 4G8XA 2K5CA 2E34A 2LF8A 3S15J 1U5TB 5JVTA 3I0SA 2YU3A 4C1NK 1VZ0A 2VJ5A 5IOYA 1NK7A 4IRHA 2CQXA 2IVNA 3CJBA 3NWTA 2XASA 2STTA 4AF1A 3J81K 1GXPA 1WJEA 1WNSA 3PQJA 3MN6A 3H3ZA 2P9IB 2FXAA 1LDJA 3HRGA 3K1NA 3V9XA 1WVRA 3CC2I 3O3KA 1OPCA 1VQ4N 3SQ4A 3TSPA 5EXWA 3CMAN 5C25A 4CEBA 4RGSA 5F0CA 1Z05A 1K8KA 3VPZA 1SS6A 1DPUA 1FBSA 4W5RA 2QK9A 1ESVA 3I33A 4FLYA 2P9PB 2CV0A 1TWAJ 4A5NA 2Y0MA 4BAYA 4YFXF 1FP2A 5CYVA 1YVNA 1U8RA 1HDDC 4XQFA 2FBIA 4JKFA 3KKSA 1ZAOA 1B4AA 2NRTA 3RQIA 4Y4RA 4H4KC 1TK8A 1LE8B 2HBJA 2CO5A 2NRAC 1FXXA 4XKBA 2G8FA 4B9VA 1UA1A 2YNGA 3TTFA 1L3LA 4CCJA 2X74A 3TP0A 4CZKA 1XGMA 3THYA 1B6AA 2CQQA 1HDPA 3SZ2A 4JI8K 1UHSA 2XY6A 2ZCWA 1BL0A 3SPYA 1VK0A 3AAPA 3HXMA 3K57A 3V42A 3AA2A 3ABLH 3A4CA 3AG4H 1T7PA 3G3ZA 1OLTA 1BA0A 3D7EO 4JKCA 2KJCA 2VIXA 4LF6K 1K78B 4RCHA 4IO9F 4F92B 3E0JB 1A5WA 4FWLA 1K9MO 2Q8KA 4HX8A 3Q7BA 3B6OA 4CA0A 4HOBA 4LG3A 4Z4EA 4GGGA 3SQ0A 2A5XA 4KH4A 4I9QA 1JTXA 4JRQA 4RW4A 2YU9J 4Q5VA 2HKOA 1D8KA 4RAZA 3ZMDA 2RREA 3UKUA 1HQCA 1C0WA 1YX5A 3SDGA 2M0MA 1YJ9I 3CCEN 1N34K 2DTZA 1CGPA 2A69F 4DV5K 1GXQA 1ZR4A 2ZMEC 5C10A 4BJ5C 1XC3A 3SJMA 2E2IJ 4ILJA 4WXHA 1T56A 1DGKN 3TSUA 1WH5A 1X9WA 3I55I 3IL2A 4LFBK 4F7ZA 3DV8A 1USTA 1G2HA 5K5QA 1TZLA 2KIUA 2NRWA 4KBOA 2L7FP 4GO1A 2QBYA 2O8EB 4ZZLA 3QPTA 2X6XA 4G6TB 1WJ5A 4EVIA 4ZH4F 4J01A 3AV9A 1MMSA 4RGXA 2WAEA 5E20A 2V79A 3WTXC 4NB4A 2HEOA 3D0SA 3DU5A 4NO7A 3GTJJ 1RDBA 4PUOA 4KN4X 2VBWA 3ZETA 3TKYA 5DTDA 4FK4A 5FFZA 2NXNB 1JCEA 1LPQA 4DFPA 2Y9YA 4UY8I 4DB3A 1UHMA 1NGFA 1LV5A 3QNOA 2D2WA 1ZRDA 1VQ6N 4BDPA 4KICA 3WHCA 1B9FA 1X1DA 4OIRF 1F1ZA 3MWPA 2X1CA 1Q9XA 4F8RA 3SQNA 5HRNA 5HS9A 1P92A 4BE2A 2CJJA 4ZZDA 4ETSA 3P1GA 1TNTA 3NGYA 4WQ5A 1E2XA 3ZOBA 4TSXA 3CDHA 4IFVA 2JMWA 3VEOA 3TBIA 3DXKB 4DFKA 3JW4A 2XHBA 2DMQA 3A01A 4CFBA 3E1SA 1CXUA 1NGBA 2O03A 2FA5A 3O1BA 4UUTA 4IZ9A 1R1TA 3VGMA 1NJZA 1Y1VJ 1SD4A 4FETA 2PJRB 3CCVN 2M7AA 3T1AA 4B8AB 2VB6A 5F08A 4AILC 1K4TA 3H5NA 2Z5UA 1CF7A 3AGKA 3F3XA 3HSEA 3JSMA 2BVMA 3MCZA 3SCXA 3HBLA 3VFZA 2F8SA 5LHIA 1MBGA 2VG5A 5BR8K 1P4XA 4IEEA 3QESA 4LFAK 5M1QA 1BI4A 4CYCA 3IH4A 1HKTA 1BA1A 1HNIA 1FKPA 3M9AA 4GYGA 3E7LA 4FVMA 2IA2A 4CEDA 3SLCA 1QVUA 4EGZA 1RDWX 4CF9A 3M6GA 4O5FA 1LW2A 3FIWA 4CHUA 4ID5A 2QUFA 2R7FA 4IVNA 4BR2A 2O5RA 1SC7A 4MLEA 5TRDA 3NH0A 2HZDA 3WT0A 5LEKA 1E4GT 2E5NA 5B5EC 1XMOK 4IHYA 4Q4ZF 1TK5A 3EQLF 2FNPA 1HLUA 2IS6A 1IV6A 4GYIA 5FLMJ 4CECA 3MN5A 2IGKA 4C3JJ 1K83J 3NHGA 3AG2H 5KK1A 2ZJQF 1FYLA 3M8RA 3RMDA 5FGMA 3EYIA 5LGTA 2H94A 1EWQA 1HYZA 1NJWA 4LB6B 1VI0A 1S7EA 2QSFX 3VODA 3KK7A 3O4WA 2VXZA 2L4AA 1K61A 4NLBA 4N0BA 2W7NA 3WXLA 5LRSA 4CJUA 3CCJN 1RDCA 2HTSA 3MX2A 4I98B 1I39A 4JKBA 1RCHA 1GV5A 1ZLKA 2IS2A 2L01A 3WE2A 2VQEK 2CS3A 2XF5A 3I8DA 4BC2A 3CCYA 4Y0WA 4LSLA 4M41A 4BQLA 4RWTA 4OIQF 2DDBA 1HNXK 4PL8A 5IPAA 3HOZJ 3V1OA 4RA2A 4B9UA 2QVOA 5GAHP 5KTQA 3BJOA 1Q1VA 4A3IJ 2QA4N 5C0YA 3U8XA 2X4HA 1XCVA 3LSMA 2D1HA 4ENJA 2JLEA 3QYFA 4M3EA 1OKRA 2DPUA 1YXQA 3H3UA 4ISEA 2Y0SN 1RT1A 3PIPL 3Q3SA 1DEJA 4JK8A 3VEXA 4CF1A 1EETA 4B3MK 1BCMA 4B44A 4NB5A 2V6CA 2QQ8A 4FM0A 1U78A 3PY8A 1RRJA 2YHBA 3I59A 5C2DA 1FOYA 4BRHA 1KA8A 2JRMA 4E7JA 3HK2A 3AL0C 4YFUA 2XPWA 4D5FA 3ISNC 4E0DA 1MKMA 1N78A 3KD5E 4ASNA 2PFBA 2V9VA 2QM3A 2ASMA 3DWLA 1UHWA 2QKLB 5GAEJ 1X58A 3CJ1A 4CZIA 1Y64A 3DPUA 3P9CA 2P5VA 3QU3A 3ZQFA 1ZHFA 3LQQA 3UIQA 2E5ZA 1ZBFA 5CVRA 2HHVA 1OH5A 4DLEA 1XTAA 3B02A 4IQJA 2ZJQL 1FBQA 3OJUA 1V4SA 1RFQA 4BHPA 5SZTA 2IS1A 2DOFA 1TQMA 5EDNA 3JRFA 5JHUA 5CYQA 3I4PA 1X1AA 2ZSIB 4DF8A 1D5VA 2PBDA 1H0MA 1FT9A 2UUCK 4LFUA 1MZBA 1HJOA 4BS9A 1YF5L 1GLNA 1K7AA 1RI7A 4JX4A 3CPEA 1ITYA 2F48A 3F9MA 4IOCF 2FQ3A 3BG3A 1SAZA 2XAJA 3LALA 3M3ZA 3VB2A 1YTAA 1NWKA 3QYBA 1SFKA 3S14J 2V26A 4K43A 1N33K 1FW6A 3CCSN 2H09A 3KZBA 3PSFA 2LLKA 1U9OA 3HSTB 2Y9ZA 3OMYA 3BR6A 3H5AA 1OKJA 4C8LA 2A6EF 2HBLA 5EZGA 3DBHB 3D45A 3A5OC 3M4OJ 1LW0A 2V52B 3ECHA 2L9SA 3B6AA 3K2ZA 4E1JA 1R9TJ 4B3RK 1MJ9A 5M1KA 3DKXA 4WXCA 3HI0A 4DSJA 2XSJC 3CCRN 1HW5A 3LANA 2LSNA 4IXCA 2STWA 3LNQA 3ZQCA 5IWAK 3VYUB 3ERED 3KEYA 2ISYA 5K7FA 2W40A 3C7NA 5AQTA 1TVRA 2DT5A 3FBIB 1BIBA 1RBRA 4S05A 1JUSA 1JI8A 3RMBA 3ZT2A 3SYZA 4CEAA 1VSLA 3C95A 1BOTO 2LY9A 1RIOH 1FEXA 4AIJA 3VQ7A 3L2WA 2ZO4A 3WTZA 4JN4A 1JHHA 3LP0A 3L8BA 2E71A 1ZR2A 3AVCA 5CY4A 2CYYA 1RT5A 3ZMSA 4JK9A 3K69A 3ROUA 2O4IA 5LMUK 1YYVA 1S72I 4E70A 1S1TA 2HR3A 4BRQA 2V1XA 1JCGA 3PL8A 5CPRB 3GFLA 2R7OA 4BG9A 2UXBK 3OYJA 3H3NO 3RKWA 1X3MA 2DA1A 1VQ8N 3E5QA 4JOMA 2KLAA 5J6XA 5ILVA 2FBTA 1ZBIA 2LBFA 3WTWC 1TC3C 2A6TA 2BOLA 2MC3A 1HUXA 5BPMA 3S8PA 2QI2A 2O8FB 4XH1A 3IHUA 1VRTA 3VTHA 1O3TA 3OYAA 2Q0OA 2KFNA 4M71A 3BQZA 3K70D 3ZQHA 2AQFA 2XAFA 1JLQA 4L0YB 4IOCL 4XOPA 2DI3A 5IP7J 3PO4A 4A2AA 4I0BA 3H9JA 1IGNA 2W25A 4FLVA 5BREA 5JS2A 4LH5A 4ANJA 1VQNI 1QNTA 4U0VA 4IHVA 1K79A 4F3TA 3ZX3A 2F96A 5AFUH 2QLZA 4OOIA 3BROA 5FLXO 2L9VA 3CLOA 5JHFA 3CC4I 3KETA 1PVEA 1I6XA 1N75A 1ETWA 2JA6J 2OZ6A 2CW0F 2EX3A 4BRNA 4FK2A 4L9TA 3RYRA 1Z91A 4KHNA 2O8DA 3DTKA 2ITMA 3MZYA 3VQEA 2GA2A 2E2HJ 5J1EA 3J7YP 4B3TK 3HO1A 3CG7A 1C0MA 3SMPA 3T8TA 1FNNA 2BDPA 2FEZA