1Z05A

Crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
DHIKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAISRGRPAVGLQTNNLGWQFLSMRLGRGYLTIALHELGGEVLIDTKIDIHEIDQDDVLARLLFEIEEFFQTYAAQLDRVTSIAITLPGLVNSEQGIVLQMPHYNVKNLALGPEIYKATGLPVFVANDTRAWALAEKLFGHSQDVDNSVLISIHHGLGAGIVLDGRVLQGRHGNIGELGHIQIDPQGKRCHCGNYGCLETVASSQAIRDQVTARIQAGEPSCLATVEEISIEDICAAAADGDPLAVDVIQQLGRYLGAAIAIVINLFNPEKILIGGVINQAKSILYPSIEQCIREQSLPVYHQDLKLVESRFYKQATMPGAALIKQALYDGLLLMKVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ROK family transcriptional regulator, homolog of E.coli MLC protein.
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transcription
molecule keywords transcriptional regulator, ROK family
total genus 137
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z05A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A03
5LRRA 4OMYA 1JHFA 3WE3A 5FO5A 1D4XA 5AQOA 4B1VA 1DPRA 2BTFA 1C0GA 3E5XA 2PBIA 1H1VA 4I98B 4EMSA 2DPUA 1I27A 4Y17A 3WG9A 5AZIA 3CHWA 3F8MA 1FP1D 3ZP5A 2YU3A 4Q5SF 5D8LB 3LDOA 4ZYHA 5E20A 4AM6A 2HS5A 4HQEA 2PLYA 2X0LA 2F5CA 4NO7A 5BOXA 3DWLA 2Q0UA 3BOQA 2CGPA 4YDUA 1W7PB 3PFIA 5DCMB 2QENA 4BHBA 1BJAA 3C1DA 4B9QA 2BEOA 4S05A 2NNYA 1EV7A 1GLBG 1MWMA 5BN9A 1QZZA 2DW4A 4LK1F 2H6CA 5DEQA 3SXYA 5JMVA 2Q2EA 3COAC 1RZ4A 1V4SA 1SQKA 4CBUA 4A6DA 3DXMA 1NBWA 3QRFF 3ULEA 1HBXG 1R00A 3ZMSA 3I0TA 3WXIA 4KBOA 3I8BA 5D5WB 3VERA 3G3ZA 2J5OA 1Z7UA 4DNCA 2DAOA 4O5VA 3F22A 4EVIA 1SAXA 3C7JA 3Q9VA 3WGIA 3A5MC 1USTA 4CZHA 4EAHD 1U5TA 3GO5A 3RKXA 5A2QK 1BN5A 2WWYA 1R36A 4UVCA 3DPTA 1DDNA 3U9GA 4B8XA 3I64A 1FNNA 4HDVA 2ASOA 2FF4A 3M1EA 1IN7A 4PDKA 2L01A 1K8KB 2FEZA 1ZRFA 3CJCA 3CQYA 1G99A 4Q48A 5L3FA 2VOOA 3EKUA 2HZTA 3LAJA 4HW0A 3VF4A 3HOSA 1QPMA 1ULYA 3KFWX 1W5SA 2DQLA 1EH8A 1HSTA 4OIPF 1TYQB 4XSZF 5CVVA 4I2OA 2EV6A 4BRFA 3HTUA 1ZG5A 3B8AX 3S41A 1LDJA 5E1ZB 1JHHA 2JTVA 2E2NA 1IN8A 2V6CA 1XMAA 3WODF 5D5UB 4ASNA 2GQQA 1ZGJA 5AQRA 5F6FA 3GXOA 4KN7X 3LM9A 2EFOA 3F9MA 1JCFA 5AQPA 2E88A 5EX5A 1TUYA 4H0OA 5AQGA 5DV5A 4L5JA 2ZWHA 3CI5A 1S7AA 3QFUA 5KK1A 2GWRA 1XUPO 5KPRA 2FBKA 4LK0F 1IRGA 5ELZA 3FMRA 4EJUA 1GHCA 1G3YA 1U2VB 3O80A 2D4WA 3ISPA 5DUIA 3GFLA 4EIAA 2IW5A 4HV6A 5LEKA 5AQWA 3KVGA 3C7NA 5F0XA 1SMTA 4LLNA 1GLCG 3T8RA 3QMLA 1RUNA 5E26A 3QP5A 1DGKN 2QUFA 1MGTA 5A2QZ 1WKMA 2RNJA 3M8FA 4A62A 3HHHA 2W57A 1J75A 1W5TA 1CF7B 1K79A 3ATUA 2MA3A 4FSVA 3MWMA 2E1YA 1CGPA 1GXPA 2EV0A 1S3JA 2Z9OA 1BUPA 3DJCA 4CZFA 2Z5UA 2IVPA 3LA3A 5LBQA 2ZNZA 3LA2A 2EFNA 1ZYRF 5CLSA 1U8RA 1V4RA 3R0AA 4FWSA 4AWXB 4WQ4C 3QP6A 1O3TA 2YJEA 4BRNA 4FOIA 3R61A 3AY9A 3HSFA 3FM5A 1FWZA 3WTSC 2DI3A 2M87A 3P9CA 2ELHA 2K7LA 3V8JA 4G7HF 1A04A 3K0LA 1UHMA 4LB5A 3M6GA 3RYPA 3I71A 2GWJA 2P7CB 2VBXA 3KZZA 2UZKA 5DD4A 1T2KA 1HKBA 3H46O 1QQMA 2JPCA 2E2PA 4U88A 1HXDA 2EFQA 4FWLA 4EJWA 2ACJA 4BREA 4BVPA 3T8TA 4L9VA 1TW2A 4F9OA 4A0YA 3O3KA 3JW4A 3J7AO 6PAXA 3ZEUA 5ED4A 1FPQA 5EXWA 3GG4A 1K78A 2OU2A 5TJJA 4Q47A 5ADXH 1T6DA 1USSA 1TQPA 2VE9A 3T5XA 4BR9A 3E3VA 3FR0A 3FZHA 1FBSA 2MC3A 4CDGA 2Q1NA 3MN9A 2VE8A 3L2CA 3ZEUB 3BROA 5HS8A 1HKGA 1O57A 3TPQA 2QLZA 4YIFA 5AQLA 3OV8A 3B02A 1ZG3A 3PQJA 3VF6A 2DPDA 5D4SA 2FSJA 4BGAA 5AONA 1YVNA 2QVOA 2PMUA 4BRKA 3V7SA 2V9VA 4CGZA 2P6SA 3N4MA 3FGUA 2Q0OA 3I33A 4JQFA 2KJBA 2A69F 4H0VB 3H6EA 2F5FA 3BJ6A 1E4GT 3EQLF 4BNCA 4UXNA 3WEEA 4I6MB 1QHAA 5TKYA 1SFXA 1GLAG 2HF4A 3FM3A 1S3XA 1AOYA 2OQGA 4KIGA 4P96A 4ISEA 2V1XA 4P5OA 1DKGD 5AQZA 4IHTA 3SQNA 4BR2A 4WQ4A 3GF2A 5LHHA 3VF2A 5D4RA 4HLXA 3ZPLA 5D5XB 3L6QA 1R1UA 2WV0A 3F6OA 5CJ9A 1T0FA 2DFIA 5FFXA 4R8HA 5ICEA 4DQ2A 4EQQA 1H0MA 3MDQA 5AQQA 4CXFA 1ATNA 3HRUA 3ZN1A 4RGSA 1FP2A 4HOBA 4CO8A 5BS6A 4FWQA 3J8AA 2O03A 2P5VA 3QOPA 2CO5A 4IZ9A 1GVJA 3CQXA 3RTRA 2CQKA 2MD5A 1HPMA 3MCPA 4ENMA 3F72A 1H9GA 4K42A 2DK8A 2V7ZA 4O6JA 2WC2A 3IL2A 5L3CA 5FGMA 5D6FA 4YIIA 1Y0UA 4MLHA 1W4MA 2I7NA 3WTZA 1F4KA 2FRHA 1P2FA 1QNTA 3U9DA 3ZQ7A 3KP4A 2ZMEA 4ZYGA 4FWPA 2AA4A 4UNOA 2IA2A 3QDKA 3KLNA 3FZLA 3O5BA 2Z99A 1XGNA 4Y0WA 2A41A 3ZX2A 1NGJA 4LB6B 4A5NA 3FF5A 2W24A 4DQ8A 4ETSA 1B59A 1YIOA 2DBBA 3HRSA 2XAQA 3M7GA 4WK8F 2ASPA 2J4RA 3VOVA 5AZJA 3F6VA 2AXLA 1QQOA 3VOEA 4CHUA 2KHOA 4IXAA 4ZH4F 5ICFA 2HF3A 1XGSA 3BJAA 3E6MA 1U6GA 2P9UA 4CZKA 3T1BA 3DFGA 3GX4X 5LRSA 2P9LA 1GLDG 3GE1A 1T6SA 2HR3A 5K5OA 3IWZA 3U2RA 3DAWA 3DPLC 1R1VA 4ESFA 2P9NB 3F21A 2Q36A 3ML6A 2PN6A 3TO6A 1E4FT 4IJNA 3BDDA 3V7CA 2FMLA 1OKJA 2OQRA 2VXZA 4WQ5A 5K1YA 4EJOA 3WGGA 4KMFA 2Z3YA 1QGPA 3IHUA 4I01A 2PJPA 2CH6A 2E2OA 1XSXA 4BRHA 3I54A 3GFMA 4G94A 1Z9CA 4BG9A 3CO6C 2MH2A 4WCGA 3HTVA 3EZWA 2FBHA 2X4HA 2M45A 4A2AA 2V51B 1MJAA 2QWLA 2QZ8A 3D2EB 1BI1A 1KQ8A 2Y48A 1IW7F 2DK5A 4IF4A 3WE2A 4IVNA 4UV8A 3VB2A 4ESJA 2RC4A 4ISFA 3VEOA 3HOTA 5DCFA 3GFJA 3CO7C 4NB5A 1WQ2A 2CSOA 4HA8A 2A40A 2EV5A 4BRMA 4XEIA 2YCHA 4EM0B 4WWCA 3AAFA 4FWRA 1Z05A 1HUXA 4JHDB 2NRHA 3PQKA 2K27A 1QZ5A 1JCGA 4CI6A 5HOOA 2O8XA 4PL8A 2QWNA 1J9IA 2MBFA 2COMA 1ATRA 1MD0A 5JFRA 3L9FA 1J2XA 2VBYA 5KQDA 2RVCA 5FLXK 3WGHA 3EO3A 2WTEA 3BZ6A 4F7ZA 4H0TB 3FMQA 2XROA 3C18A 2E7WA 3MQ0A 1SD5A 4KFCA 4HWIA 1EH6A 5LJVA 4HAMA 3DEUA 3ZMUA 3U9ZA 1XN7A 3V4GA 1G3WA 3WT0A 3SK3A 1YLFA 2E20A 1UB9A 3VEXA 2GAUA 2YHWA 1ATSA 1NLVA 5BPLA 3M9AA 1BDGA 3GDQA 1NGGA 5HS7A 5AFUH 4CZEA 3D7EO 1ZG1A 4HV5A 4BROA 2XVCA 3KP2A 5BPMA 1LEAA 2HKOA 1SD4A 2ZCWA 3GWZA 1O3RA 3A0IX 5E18F 4GY2B 4HF1A 4L0ZB 3HBTA 3IKTA 5JLHA 2PEXA 1GXQA 3TQNA 1MDMA 3GUDA 2FF6A 3BPXA 1B4AA 4L18B 4AVPA 4IRGA 5HDNA 4B1YB 1RGIA 1NHAA 1R5GA 1SFUA 1HKTA 2K4JA 3CIPA 4NB4A 5E1WA 4FL9A 1ONVA 2P9PA 1NGIA 5CVJA 5AQYA 1IN5A 3ZETB 3RI4A 3CJ9A 3K69A 3TO7A 4BG8A 3GYHX 2O3FA 3QAHA 3K1MA 1JXSA 3TO9A 2XKOA 1FYKA 1YAGA 4ZZDA 4S04A 2KJCA 5DCMA 2QWWA 1DP7P 2STWA 2P6TA 5BRHA 3FLCO 2I7PA 1B9NA 5AQFA 3SJHA 4B1XB 2H6BA 1NGAA 3H1VX 2B0LA 5FPMA 1K7AA 2GXBA 1OYYA 3ZETA 3AAPA 3ENOA 3KE2A 1KU7A 4HF2A 1IUYA 4JNEA 3A5OC 4RB1A 5DUKA 4EM1A 2NS0A 3QFPA 3RDIA 3E5UA 1YYVA 1Q18A 2BYVE 5LY3A 3ERED 3HUGA 4DCHA 4QWQA 1LDKB 3O8MA 3KP7A 1YS6A 1MWKA 5CVUA 1LQ1A 3MCZA 1TQIA 1P6RA 2ZNYA 1F5TA 3L4IA 1KYZA 3I58A 4ZYDA 4FO0A 4PL7A 4CICA 4KA4A 5LJWA 1YO5C 5AR0A 2KKOA 4OIQF 3UKRA 4EGZA 4R79A 1BIBA 2GXGA 5AQKA 1S22A 2OANA 2P9KA 5JI6A 1TBXA 3MZHA 4GGGA 2YR2A 1R59O 4RTFD 1XC3A 2FU4A 1J7KA 2H27A 2R7DA 3W6KB 5LGUA 3F8CA 3OOPA 2A42A 3RPUA 2Q8KA 4MQ9F 1S29A 1NGDA 3M3ZA 1LOTB 5ILUA 2VCPA 3KEOA 3G25A 2FNPA 3WQTA 1SD6A 3CUQA 2VT2A 1SZ2A 5AQMA 4B09A 5E8GA 3QPHA 3O4WA 3GLXA 5L3DA 5E8IA 2BE5F 3P9KA 1WRJA 1AWCA 2W41A 1VTNC 5J8CA 2O0YA 4RS8A 2P7VB 3LSTA 2PI0A 5TRDA 1L3LA 1GLFO 1BC8C 4U0WA 3AARA 1BI3A 3KP5A 4CBWA 4CZGA 2EK5A 3VGKA 4PKGA 4ENKA 3D2FB 4HX7A 3R6MA 4OINF 2ISYA 4ENJA 3QB0A 2L3DA 2VWBA 2FXUA 2XAJA 3GEZA 2P8TA 2UYTA 1KU2A 3RKYA 2XGXA 1ZAOA 3FXRA 5IT9K 3VGMA 2QYOA 4MTDA 1GLLO 4JD2B 2EA4A 2Y0MA 3RSEB 1IN4A 4MNUA 5IT3A 4BRIA 2XASA 1KGSA 1ON1A 2A6HF 3VEPA 3SZPA 5F1XA 3CDHA 5BR9A 3R8EA 3GZ6A 2E1NA 3GVAA 4G6QA 3O08A 3R4KA 4E1JA 5FFZA 4JBAA 1QQNA 2FBIA 3T0YA 3V8KA 1LVAA 1R5HA 4C23A 2IP2A 2QBYA 5BRDA 4U7BA 1WI9A 4MHGA 2L4AA 2QQ9A 4BRDA 1XB4A 3I5UA 5L3BA 2ZF5O 3KP6A 1HW1A 4EV0A 3H45C 1P92A 5KQ8A 1U78A 3NQOA 4RCHA 1RNLA 3H3UA 2HYGD 1XDUA 4FPAA 4LGWA 2G7HA 4GXOA 1FSEA 2E7XA 4M71A 1PUEE 1XSDA 5HVQC 3F23A 4M9XA 5H6RA 1G3TA 1RUOA 1V4TA 1U5TC 2P9IA 3OHRA 4LG0B 5LGTA 1ZARA 3HHGA 3Q5FA 3FX3A 4MEXF 2XKPA 3I4PA 4AD9A 2D2WA 2V52B 2F9WA 3O1BA 2LSOA 1L0OC 3IWFA 2EFPA 2PAVA 4U0VA 4Y15A 1CZAN 3L00A 2JZYA 4WXCA 5AIPA 4BAYA 2VYPA 4ZZLA 4FHTA 2DLLA 2H09A 1TQMA 3MZYA 1U6ZA 2D0OA 5E1XA 4XLNF 4CZZA 5DYMA 3UKRB 4CZIA 3A8YA 4A5MA 4EHTA 2NAZA 4BYYA 4WYBA 4PGHA 2P9KB 2MH9A 2O61A 3WUHA 4PZJA 1R23A 4HTLA 2CWEA 3LWFA 2VOPA 2NNNA 3K1PA 1OYIA 2EWNA 3CTAA 3J81K 4KNYA 2GELA 2ZBKA 2RDPA 3FHZA 4K25A 3CJNA 4EFHA 4HZFA 5ILSA 1QZYA 2UXXA 2LF8A 4LFUA 3SLCA 2R7FA 2M8EA 5BQTA 5HDGA 4ZYEA 4JK1X 5AQTA 1LDDA 3ROUA 2FSNA 2A5XA 2DPNA 1D5VA 3REOA 3H92A 4JAXA 5AFUA 3ZMZA 4I02A 3AAQA 3ZX0A 4UHTA 3SMPA 5K5RA 1YXQA 5EVZA 5DDGA 1JE8A 1IG8A 3CUQC 2CYYA 2IVNA 3VEZA 3IUCA 3KETA 1P4AA 3EYIA 2F2EA 2L4MA 2W25A 3GZ5A 2J5PA 3UKUA 4WXHA 4L9JA 2HQNA 2QWQA 1WSUA 1FYMA 1OPCA 2XUBA 2ZMEB 4XSXF 4UVBA 1HSJA 3KHYA 3LQRA 3J80K 4O8KA 2FNAA 3KCCA 4QS9A 4A2UA 3I59B 5H6QA 3K2ZA 4K41A 3WTWC 3WTTC 1KQ0A 3CUQB 4RGUA 1R1TA 3EDPA 3BF1A 3CERA 4BVOA 3DXMB 3HYIA 2HKXA 4KIFA 3ENHA 4HBLA 4HX8A 4YFNF 3HSEA 4L9NA 2D1KA 3CJAA 4RGXA 1STZA 3FZFA 2KIMA 2DT5A 1Y64A 3VETA 5LGNA 2QQAA 3NEUA 2OZ6A 3LM2A 4FWNA 2G7UA 2OBPA 1IAWA 4HF0A 2P9SA 4M63C 2DQRA 5AZJB 3R60A 2ZFWA 3L09A 3F8BA 3EN9A 5BPNA 2NLXA 4A2BA 2FXAA 2XRNA 1RFQA 1K6OA 2HFHA 5AQVA 4MO4A 1K8KA 4KMUX 3F8NA 3D0SA 4WXDA 2MLGA 4XH1A 1ZN2A 1MJBA 2LNBA 5HLHA 2Q97A 2QWPA 3TOBA 2IVOA 2FOKA 4ESBA 5B8HA 2HTJA 1HLUA 2WUSA 4BR0A 1HW2A 5ICCA 5CYVA 5CVRA 2K86A 3EETA 4DB3A 4EGYA 3HIFA 5IT9Z 3R0JA 4IHSA 2FF3B 3CJ7A 4FWOA 5HLIA 4G7OF 5AQNA 5D6EA 2GEMA 3E6DA 2GWKA 2QXLA 4IO8A 2VODA 1FSHA 1NMDA 4O3MA 3BF3A 4L9TA 3ELKA 2V7YA 2IJLA 4L3QA 4WX9A 1NWKA 2HQRA 3WTUC 1ZHFA 4TV7A 5AIQA 1LEBA 2YI1A 4LD5A 3M8EA 1DEJA 4NQWA 3IFRA 1KA8A 4XLPF 2PQ8A 3E6CC 5KPTA 1RDWX 3VEYA 1DPUA 2G9WA 2QW9A 1GLEG 4J8FA 2A3ZA 5D8KB 2FA5A 4BHCA 3HM8A 2M5WA 4G6DA 4H5NA 1ZLKA 3ABTA 3MK6A 2VBWA 5BN8A 1C0WA 1X3UA 2GA1A 2VT3A 4GCVA 4YFKF 2HTSA 1REPC 2D0PA 5AQHA 4BRGA 3CUOA 1KAYA 4KICA 4BQLA 2ZXJA 4RAYA 1MZBA 4KDPA 3BJOA 2M1BA 4GNIA 1HQCA 4FT8A 1FZPB 1BI2A 1WOQA 1E17A 2FSWA 2RV8A 1BC7C 3VGLA 2QBYB 1UFMA 1S6LA 3DQVC 4BC4A 2AP1A 2KRFA 3U4LA 3K9TA 4AIKA 2H3GX 4XH5A 4O5FA 5CVIA 1ZH5A 3EL2A 3JXUA 2KIUA 4BXUA 1BO5O 5AQXA 1W7PA 1XGMA 4CYDA 2OAZA 5DD8A 2P4WA 1U2VA 3KP3A 4OMZA 2IA1A 3WEEB 2MLKA 1BM9A 4FX0A 2UXNA 3ZN0A 1KU9A 3P9IA 2E1ZA 1R58A 1MDUB 4PCQA 4AM7A 2VC0A 1BBYA 1TNSA 1NGEA 1HX1A 3GW2A 1Z91A 4N9HA 5F2RA 1G3SA 2GIVA 4BGBA 5FPEA 2V1DA 4BH9A 4BR5A 2XV4S 4ON0A 2CH5A 1O3SA 1YW9A 1BIAA 1KXPA 1HW5A 4UVAA 4A12A 3UB5A 5LEJA 4NHJA 2DTRA 1FX7A 2NZTA 4LLLA 2ZGYA 2HDCA 3LL3A 4P9UA 1SAZA 4IRHA 3E6BA 2E2QA 1Z6TA 4IXCA 1IN6A 2ESHA 3TU5A 2OA4A 4GYIA 3RIRA 4OOIA 2OZUA 4I0AA 1H9TA 5BRFA 1QQIA 3ABUA 2JRTA 1HKSA 1OMIA 5ILVA 1HKQA 2XHKA 3IDHA 1FYLA 4PGGA 1YS7A 3W0LA 4OIRF 1WUAA 1R22A 2OD5A 3VFZA 4B1UB 1S8NA 3FZMA 3FE1A 3J81Z 2PBDA 4HDUA 2GTDA 4H5RA 3IRRA 2JT1A 1YQAA 3BP8A 3N97A 4LLGF 4I6MA 3RSEA 3JTGA 1ZRDA 2ETHA 4IPAA 1JGSA 1BA0A 1NGBA 4U7DA 2W40A 4A6EA 4YDUC 2K4BA 2ZKZA 4A0ZA 2PMHA 4RGRA 3UKUB 1MJ9A 3GBTA 2KIFA 1HJOA 1TYQA 3GL1A 1KYWA 3DV8A 3V8LA 1XCVA 4FWKA 1Q1HA 1XD7A 2FMYA 3MAJA 5D5VB 4BC5A 1LB2A 3SMSA 4EHUA 1BWFO 3WTXC 2P9PB 3LDLA 1OR7A 3ECOA 4M73A 3UE5A 1B9MA 1MKMA 3V7RA 4HQMA 2Q31A 4M74A 2P9NA 4XRFA 2ZJ2A 4Z2YA 3QICA 4B1WB 1FLIA 2P9UB 3JAMK 1F9NA 3KZYA 3VEWA 5JHUA 2A68F 2P9LB 3VENA 3BPVA 4L5IA 3F3XA 1LJ9A 4MGRA 4XH4A 3WTVC 2L54A 2V1UA 4EJVA 1T6CA 4P55A 4BR7A 5AQIA 3H3ZA 1O7FA 1WWXA 4MLEA 1NGFA 3WXLA 3W6JB 2D1VA 1P4XA 2M30A 1SFEA 3E97A 1KQ9A 1QO0D 3HI0A 5KVRA 4LMYA 2GUPA 4BHPA 3IRQA 3ULQB 2GZWA 3MN7A 2P9SB 1ESVA 4JN4A 1ZGAA 3SFZA 1X9JA 1B1BA 1FC3A 3EUHA 4GYGA 3CJBA 1ZC6A 1BA1A 4WF2A 4H5WA 5EY4A 1Z1DA 1S7OA 4K2EA 1P4WA 4K43A 2XAHA 5JLFA 1T38A 3SHFA 1GLJO 1G4DA 2BV6A 4QS8A 4H0XB 5FD5A 4M6XA 3LDPA 4MTEA 2P9IB 3EKSA 1G6NA 2F5EA 3O2PE 3TGNA 2ESNA 3B73A 3TKYA 3K1NA 3HTSB 3BWGA 4IRIA 1BI0A 3JSPA 5BMZA 3H3NO 4UV9A 3SZTA 2E1CA 3BUZB 1ZBSA 2D1HA 3ZMTA 3RJPA 4M7YA 1I5ZA 2YX7A 2YHYA 4YG2F 3C7NB 2QWOA 1IRFA 3ATVA 3R6SA 4UUVA 1IXSB 2QQBA 4OIOF 2DU9A 1RIOH 3ZMVA 1YG2A 3BEXA 2H94A 4DHYA 5F64A 5EEGA 4KUMA 2VN2A 3DKWA 3ZX3A 1NGCA 2P5KA 5HS9A 2YHXA 3ID8A 4KN4X 4RB0A 1CF7A 4H0EA 4U0YA 1J6ZA 4RB2C 3S2WA 3QBXA 1Z6RA 3IMXA 1YFHA 1FBQA 3D2FA 4N0BA 2EB7A 4R1HA 1NM1A 4CZJA 2RGVA 5J6XA 1XQSC 4BRAA 1OYWA 5F1RA 2PFBA 4I0BA 3QU3A 4RAZA 4E70A 4QS7A 1U2WA 4N9IA 3LFKA 2UWMA 3Q9SA 2L02A 2EFWA 3RPQA 2XAFA 1BOTO 4CD3A 2W84A 2BUPA 3O6WA 3WU1B 4BQZA 3H3OB 5EEHA 1C0FA 4LG0A 1HKCA 3FZVA 4A61A 2JSCA 3U8XA 2EWSA 1O7LA 2BBYA 1EQYA 1IXRC 1KAXA 1TW3A 5BREA 4H0PA 3VEVA 4H5VA 2HYFA 3LA7A 4M9ZA 1PDNC 3H1QA 3O1WA 4FWMA 2EA2A 3C0BA 3VPZA 1YTYA 4FOEA 4WQ5C 3VODA 3ZMDA 1FOKA 4MO5A 3KLOA 5FLXZ 2FSKA 3DF8A 4L0YB 2K02A 5AQJA 3NRVA 1OKRA 1MDMB 1PP8F 2QWMA 5ERIA 1RI7A 2O6GE 1TUUA 2QM1A 1J5YA 1T39A 4B1ZA 2IIRA 3JTHA 2HEOA 1ZRCA 1DUXC 2FE3A 2E8AA 4CZMA 4IJAA 1X3MA 1J0RA 4EM2A 2QM3A 4HYEA 1SD7A 3MMVA 5LHGA 4P9FA 2D45A 2A6EF 5HDKA 2RKHA 4RWTA 1LNWA 3IC7A 4G9YA 1BG3A 5JVTA 2ZO4A 5L3GA 2Z33A 1ODDA 1EH7A 1I1GA 4FPBA 4G7ZF 4YFXF 2NYXA 5LHIA 4H03B 4FX4A 2HGCA 3TDUC 3A5NC 1FBUA 3GFIA 4XBFA 4G8XA 3BY6A 5ADXA 1D3YA 2IVMA 2VBZA 2JPBA 2FQ3A 2HMPA 3DXKA 1ZLJA 2TDXA 4EJTA 2V79A 3MN5A 4QLCU 4KT5C 4MQVA 2ZGZA 1IZ1A 2LKPA 1O3QA 1IXCA 2DO7A 2YPRA 2CGKA 2NRAC 4M6YA 3J80Z 5AZIB 2IRFG 2Y75A 4LJZF 3L0QA 1YW7A 2XAGA 4H0YB 5JR3A 1BU6O 1B6AA 2HWVA 1NGHA 3MN6A 3LAPA 4BRLA 3TDZC 1ZXOA 2ADUA 5FD6A 1P8ZA 4H5TA 2CFXA 2RQPA 2VONA 4KYWA 1TLHB 4LC9B 1TTYA 2STTA 4JD2A 4BRPA 1IF1A 3WU0A 1SMYF 3W3DA 5E17F 4I09A 5BPIA 4Z94A 3QPTA 4IWVA 2R3SA 1UHWA 3D5LA 3GOIA 4BRQA 5FB2A 1XCBA 4GO1A 3P7NA 4BR4A 1R7JA 3E5QA 3HZ6A 2A61A 3C3WA 3P4IA 4ENNA 4AIHA 2A07F 3D2EA 5BPDA 1FT9A 3HSRA 2P5LC 3RYRA 1XGOA 4A0XA 4BC3A 2W85A 2FLOA 2YJFA 3MEXA 2F5DA 4HX4A 5ICGA 2PG4A 4OU0A 1YW8A 4BQAA 2ISZA 2HOEA 3IKVA 5HLGA 1J59A 3M1FA 1V3FA 3O6BB 5L3EA 4M7XA 3U1DA 2A6AA 3WXKA 1TNTA 3FFKB 2IT0A 4BRCA 3FMSA 3L7WA 2XIGA 2QWRA 1FY7A 2C6YA 2CW0F 2GA2A 3A5LC 1E2XA 3QBWA 3WTYC 3MFKA 1XDSA 3FZKA 3TOAA 5H20A 1QZ6A 2ITMA 3FWEA 3FXQA 3ULEB 2IA0A 3JS6A 3KEQA 2IPQX 1QBJA 4D0PA 1JCEA 5FPDA 3R9PA 5JICA 3QU6A 1ON2A 3I53A 3LDQA 1KU3A 2BGCA 1U3EM 3CETA 3EYYA 3ECHA 4KIBA 1T98A 5EOYA 1MA9B 5E84A 4I7HA 2EJRA 1F1ZA 2YSRA 5KPZA 2AS5F 2YX4A 4Q4ZF 3CLOA 4MEYF 1PP7U 1XSVA 1W7PD 3WQUA 4AIJA 1ZREA 2VC1A 2A3SA 2CGJA 3KZBA 1YUWA 2LDUA 3JAMZ 4PKIA 4HLYA 2CGLA 2RN7A 1UCRA 1D8KA 1K78B 4CZLA 5CE3A 1LCUA 3DXKB 3HSCA 2A5YB 1X3NA 1IJJA 3DXJF 2F9TA 4CJ7A 4JHDA 4M9SA 1XMKA 3HRTA 4RB3C 3CJ1A 1T44A 2LF7A 3G73A 4BC2A 1KAZA 5K5QA 3LQQA 4Y13A 5FPNA 3VESA 2Q2RA 3F8FA 4ISGA 4CD1A 3JSOA 1D8JA 1I1SA 5AQUA 5AQSA 4M72A 1BOAA 3FXUA 4CBXA 2ASMA 2CG4A 3HRMA 3I59A 1I6XA 2Q0RA 5LLQA 5I9EB 3WXJA 3LDNA 3DP7A 1U5TB 5J8FA 4PKHA 3RKWA
chains in the Genus database with same CATH superfamily
5LRRA 4OMYA 1JHFA 2V9PA 1UA1A 2ECBA 3KK7A 3WE3A 1B9FA 1F21A 5FO5A 1D4XA 5AQOA 4B1VA 3IH2A 1DPRA 5GADP 5FDLA 2BTFA 2E1MB 4BDZA 3E5XA 2PBIA 1XS9A 1C0GA 1H1VA 3VQQA 4I98B 4EMSA 2DPUA 1VQNN 2L9RA 3F9KA 2WONA 1I27A 4Y17A 3LL7A 1SANA 2DA4A 1LE8B 1VQMN 2BY0A 3WG9A 5AZIA 3CHWA 4DR5K 4BU2A 5CHIA 1ETOA 1OH5A 1RDUA 3F8MA 5K7HA 4CHYA 2HHQA 1FP1D 3FXMA 2YU3A 3ZP5A 4GDFA 1JT6A 5D8LB 1A36A 4ZYHA 5E20A 3CJQB 4Q5SF 3LDOA 4AM6A 2HS5A 4HQEA 1TT5B 1DGWY 2XGEA 4WFNL 3PX0A 2PLYA 3TMOA 2X0LA 3CCJI 5LMUK 2F5CA 2X85A 4NO7A 3OYBA 3PO5A 5BOXA 4DV0K 3LWLA 3DWLA 2Q0UA 4F91B 5CZ2A 3BOQA 1D5YA 2QK9A 3K6GA 2CGPA 2OTJN 3NVMA 4DBRA 4OKKA 4YDUA 3S9HA 1W7PB 3PFIA 4BDPA 5FKLA 1Z3XA 2XPVA 1LFPA 3CC2N 1HF0A 1Q81O 5DCMB 3D5SC 4CF0A 1QTMA 2QENA 3KIOA 4BHBA 1BJAA 3C1DA 4MFBA 4BJ6C 4B9QA 4XR6A 3CJTB 2OPQA 1MH3A 3ABLH 2K40A 1LKXA 4N47A 1JLGA 2BEOA 5IPAA 4S05A 2NNYA 2E2JJ 2MSYA 1EV7A 5I42A 1QVGM 1WFXA 4JX5A 1GLBG 2VPLA 1MWMA 2JN6A 3LP1A 5BN9A 4CW7B 1FOWA 4X6AJ 5J4YA 1QZZA 2DW4A 2DOFA 2H6CA 1J09A 4LK1F 5DEQA 3SXYA 1JKRC 3CQZJ 3NAEA 2KIQA 5JMVA 2Q2EA 5DTDA 3COAC 5C0YA 4XKCA 3P39A 1VSMA 1RZ4A 1C1BA 1V4SA 3L8BA 1JKOC 1SQKA 4CBUA 4A6DA 1X4PA 5F0HA 3DXMA 1NBWA 2V7FA 1X1BA 3QRFF 3CPEA 3ULEA 5M1NA 3RMAA 1X19A 3PIOF 1HBXG 4FJGA 3L2WA 1R00A 1MH4A 1Y8QB 3ZMSA 4QIWN 3I0TA 2WC9A 3WXIA 3OMYA 2L9VA 2O8FB 4KBOA 2QXFA 3I8BA 1FXXA 1FMVA 3T1HK 5D5WB 3OYFA 2L5QA 3G3ZA 4NUBA 5FLVA 2E6MA 1BQMA 3P31A 2J5OA 2ZB9A 1Z7UA 1HNXK 2E4LA 2L2OA 4DNCA 1I3QJ 2DAOA 4O5VA 4U87A 1Z77A 3F22A 4EVIA 3GTOJ 1SAXA 3C7JA 1UWBA 2VB6A 4DTJA 3Q9VA 3WGIA 3LAMA 3A5MC 1USTA 2QCOA 4YELA 2NUBA 1R4MB 4CZHA 1U5TA 3GO5A 3RKXA 2UUZA 4FW1A 5FLMJ 3ZSZA 4EAHD 5A2QK 1Z67A 1JLEA 1BN5A 2WWYA 1R36A 4UVCA 4LF4K 3DPTA 3N05A 2IGMA 3U9GA 4B8XA 3I64A 1DDNA 1FNNA 4CF2A 4FETA 4BQNA 1RILA 2BW3A 4HDVA 2ASOA 2G8IA 1G2HA 3ZQHA 2FF4A 2UXDK 3M1EA 1IN7A 4PDKA 2ZFUA 1ZELA 2L01A 2FEZA 3TL4X 5IY5H 3QPLA 3D1NI 1ZRFA 1K8KB 2MFZA 3CQYA 3QIOA 5F04A 4GV3A 4ZTJA 5B1BH 1G99A 3O3GA 4X66K 4Q48A 2KP6A 5L3FA 2HNHA 3CCEI 2VOOA 2DMNA 3EKUA 3MWPA 2HZTA 3OYGA 3LAJA 3HB9A 3TTCA 3ZGKA 1YX3A 2L0KA 4HUFA 4HW0A 3VF4A 3HOSA 1FTTA 1QPMA 1ULYA 3KFWX 4DQRA 2DFEA 3NGYA 4RBOA 1W5SA 4IOCF 2DQLA 1EH8A 4IEIA 1HSTA 4OIPF 1MNEA 2HOAA 3HL8A 4KV8A 3U3GA 1TYQB 3V9SA 4XSZF 1ETVA 3G6EI 3TSUA 2F4IA 5CVVA 4I2OA 2EV6A 3OTOK 3KLFA 4BRFA 1ETYA 4AIDA 1OLTA 3HTUA 5CKTA 3DLAA 1ZG5A 1BR4A 3B8AX 3S41A 4K0KK 1LDJA 5E1ZB 1JHHA 2JTVA 4I6ZA 1IN8A 2R7SA 2E2NA 3N4PA 2G8KA 1YTAA 3NF6A 1WSFA 4Z0UA 4YOUA 2Y9ZA 2V6CA 3GLLA 2X6SA 1XMQK 1XMAA 3WODF 4CHQA 1I94K 2A1RA 2WOMA 3NARA 1QZEA 5D5UB 1FTZA 4ASNA 4XLFA 3ZETA 2GQQA 1ZGJA 2V6EA 5AQRA 1R6RA 2VWKA 5DM6L 5F6FA 3V6DA 3GXOA 1IC8A 3NF9A 4PY5A 1OR7C 1J54A 5FKNA 4KN7X 3S1MJ 3LM9A 2EFOA 3F9MA 1W9HA 4IFEA 4OLAA 3BR1A 3SPYA 1JCFA 5AQPA 3TSQA 3OS2A 2E88A 1TUYA 5EX5A 4H0OA 5AQGA 2VKVA 5DV5A 4GVMA 4L5JA 2ZWHA 3VMFB 4V2GA 1K83J 5BR8K 3CI5A 1S7AA 3QFUA 3IAS2 2HSTA 3CC2I 3SYTA 5KK1A 3ZR8X 4XRMA 2GWRA 2AJQA 2XSDC 1XUPO 1TK5A 5KPRA 2FBKA 2E6LA 2PZSA 4LK0F 3HGGA 1MNMC 2BHZA 1ZBIA 1IRGA 3LNQA 5ELZA 1KC8O 3FMRA 4EJUA 1VHXA 3ZQCA 3VGMA 2YU9J 1GHCA 1G3YA 1U2VB 3O80A 2ZM6K 2D4WA 3ISPA 5DUIA 3GFLA 4A3LJ 3FIWA 4RMNA 4DLEA 1RTJA 4ABZA 1IKXA 4EIAA 2IW5A 4HV6A 5EG0B 3B6OA 3U6FA 3V1OA 5LEKA 4M45A 5AQWA 3KVGA 1NKEA 3C7NA 2Y31A 2WAQN 2PJRA 5F0XA 3DOKA 3AVJA 1P90A 2CUEA 4IKFA 1IH7A 5IYDJ 1SMTA 1E3PA 4LLNA 1GLCG 3T8RA 4C1NK 2EIKH 4PA1A 4BACA 3BQZA 3TAPA 3QMLA 1RUNA 1WGXA 2VL8A 3QP5A 1TGOA 5E26A 1DGKN 3NVKA 2R0QC 2QUFA 2EHGA 1MGTA 5A2QZ 1X9MA 3K2PA 1WKMA 2RNJA 3M8FA 3HEFA 2LKXA 3KYCB 3AVLA 4A62A 3HHHA 4DJAA 2W57A 1VZ0A 2B7EA 1W5TA 1J75A 3M3YJ 1CXQA 2E60A 1YJNI 1K79A 1CF7B 3ATUA 2MA3A 3OL4A 3MWMA 3O8GA 1D5AA 2E1YA 3BG3A 1CGPA 4FSVA 5E3LA 4FXDA 1GXPA 2EV0A 1S3JA 2H8RA 3K4JA 2CRGA 4E7SA 2Z9OA 2R5YB 1V54H 3OIOA 1BUPA 3DJCA 4CZFA 2Z5UA 2IVPA 1SKWA 3LA3A 2FD5A 5LBQA 3RKQA 2QA4I 2ZNZA 3LA2A 3PUFA 1KCFA 4CZCA 2PYLA 4GV9A 2EFNA 1ZYRF 5CLSA 1MNDA 1U8RA 1V4RA 3R0AA 4FVUA 4FWSA 3ESWB 4XOTA 4AWXB 3MEGA 3QP6A 1O3TA 2YJEA 3AGKA 4WQ4C 4Y1DA 2Y9YA 4FOIA 4M41A 4M3RA 4BRNA 3MXMA 4C8LA 3R61A 3AY9A 4A59A 3QWLA 2E35A 3HSFA 4CA0A 5KRSA 4HCBA 3FM5A 4A3JJ 1FWZA 3WTSC 2DI3A 3TTFA 2M87A 3DWLE 1VSKA 3P9CA 1FOYA 1TKZA 2ELHA 5KGWA 3TEDA 2K7LA 3PY8A 3V8JA 4G7HF 4H8KA 1A04A 1WJ5A 3K0LA 4FTHA 1UHMA 2K9MA 1NOZA 4LB5A 3M6GA 3RYPA 3LPTA 2M7AA 3I71A 2GWJA 4Q5VA 2VBXA 2P7CB 2BGGA 4Q0BA 4CF8A 3KZZA 4CHPA 4JP0A 3WHCA 2UZKA 3SV4A 2XY7A 5DD4A 3DLRA 1T2KA 1HKBA 1XWLA 3H46O 1QQMA 4V2FA 3S1NJ 2JPCA 1WBBA 2HVQA 2E2PA 4BWMA 4JI6K 4U88A 5GIOA 1HXDA 4FJ5A 1K9MO 3M8RA 2IGIA 2X74A 4AILC 1Q82O 1NG9A 2EFQA 1S5LC 3CCYA 5DMRA 3BTLA 1DTTA 4FWLA 4EJWA 2XY5A 3E7LA 2ACJA 4G1QA 4BREA 3NDKA 4BVPA 3T8TA 4L9VA 1TW2A 4F9OA 4EZ6A 4UB8C 4A0YA 4DTPA 3O3KA 4ZYAA 3JW4A 1VQON 3J7AO 5IP7J 5JVGF 6PAXA 3ZEUA 4RW4A 5ED4A 1HYVA 1PUFA 1FPQA 1RPWA 2BXZA 3ASOH 3K7AJ 1MW7A 3MKLA 2GUIA 1K78A 3GG4A 5EXWA 3THWA 2OU2A 4DYRA 4JRQA 5TJJA 4BL0B 4Q47A 4AHVA 5EJCA 2WB1A 5ADXH 1T05A 4IHYA 2F96A 1VF9A 2DODA 4C30A 2LD5A 3E01A 3ULDA 1T6DA 1ENHA 1USSA 3SEQA 3GZNB 4QAGA 1N25A 4FE7A 2LBFB 1FEXA 4CFCA 1TQPA 3EYZA 1GOBA 1VQ6I 2VE9A 3T5XA 4BR9A 4DFKA 3SQ0A 3E3VA 2O8BB 4GW6A 3FR0A 1F36A 5LFAA 3FXJA 3AVIA 3FZHA 5C25A 1FBSA 3E1SA 5IYCJ 2MC3A 4BE2A 3PO3J 5C2FA 2DDAA 3FKIJ 3U3YA 1NK4A 4CDGA 2Q1NA 3MN9A 3WNEA 1JKPC 2VE8A 4CHZA 3L2CA 3ZEUB 1BI4A 4CJ5A 3BROA 5HS8A 1HKGA 1O57A 3K5MA 3TPQA 3PNTA 4P1WA 2DFHA 2KMUA 4FM0A 2QLZA 3LPUA 1W5CC 2XSJC 3X2QH 4YIFA 5AQLA 3BR3A 3OV8A 1ZGWA 5LMNK 2VJ5A 2XGDA 1ZG3A 3B02A 3H5AA 3PQJA 4X1EA 2DPDA 2O8KA 3TSPA 3VF6A 5D4SA 5H1SQ 4CJPA 2FSJA 4W1UA 4XIUA 1LAVA 4BGAA 5AONA 1YVNA 2QVOA 2VQEK 2LBFA 2PMUA 4BRKA 3V7SA 2V9VA 4CGZA 2OPTA 2DT6A 2P6SA 4YIRX 3N4MA 3FGUA 2Q0OA 3I33A 4KRFA 4JQFA 2KJBA 2A69F 4H0VB 3H6EA 2F5FA 3BJ6A 1E4GT 4DTMA 3NMUA 3EQLF 4BNCA 4O0JA 1W0UA 3CMAI 4UXNA 3WEEA 1JLBA 4KHQA 1VQ7I 4I6MB 1QHAA 2NVUB 3MAQA 3PX6A 4B9VA 5TKYA 1SFXA 5C15A 1JLFA 4LFCK 1GLAG 2HF4A 4D7MA 3FM3A 3BG7A 1S3XA 2LC2A 1AOYA 1NNEA 2NRZA 2OQGA 4B8CA 4KIGA 4LH4A 3TAMA 4P96A 1FJLA 4JX6A 4MIMA 4ISEA 1WJDA 2V1XA 4DV3K 4P5OA 1DKGD 5AQZA 4IHTA 1MBFA 4UUSA 3VTIA 3MD2A 4OPHA 3WXMB 3SQNA 4AC0A 2YHBA 5FKMA 2OZSA 4NNJA 3VYSB 3VQ6A 4WQ4A 4BR2A 1VQ5N 1XHZA 3GF2A 4B3OA 5LHHA 2CUZA 3T7ZA 3VF2A 3AO1A 4YOXA 5D4RA 2VIXA 4HLXA 4BBRJ 5D5XB 3OYKA 1R1UA 3ZPLA 3L6QA 3TR8A 3K58A 3OBWA 2WV0A 3F6OA 5CJ9A 3HP6A 1T0FA 2DFIA 5FFXA 1U47A 4R8HA 3CDIA 5ICEA 2LKSA 1JUPA 4DQ2A 4EQQA 1H0MA 1FK9A 3MDQA 4CYCA 4JKGB 4LSLA 3WG7H 4CIFA 4DQSA 5AQQA 4V19K 4DF8A 1KZHA 5J2NA 4CXFA 1ATNA 2BY1A 3ZT2A 3HRUA 3ZN1A 4RGSA 1GOCA 4PJJA 3HSTB 3RVCA 1FP2A 4HOBA 1JLQA 2DN0A 2JRMA 4CO8A 5BS6A 4FWQA 2PMZA 3J8AA 2O03A 2P5VA 3C94A 3QOPA 2CO5A 4IZ9A 2HW3A 1YE9A 1GVJA 3CQXA 5KTQA 2WV1A 3RTRA 2CQKA 5HODA 2RN2A 3ZSVA 1VQ9I 2I10A 3M07A 2MD5A 5JLXA 2Z1HA 2OYQA 4PQUA 1HPMA 1VSFA 3DPUA 3SFIA 2QTDA 4M3GA 1WN7A 3S2HJ 3MCPA 4ENMA 3F72A 1H9GA 2IEKA 4JKDA 4K42A 2ZJRF 2DK8A 2V7ZA 4O6JA 1WJCA 1J9AA 4BWJA 2WC2A 3WHBA 4FLTA 4KH6A 2HVSA 1KQSM 4YEJA 3IL2A 5L3CA 2L7MP 2LLKA 2F4OB 4HG2A 4CF9A 5FGMA 1WAJA 5D6FA 4MFEA 4RAFA 9ANTA 2XY6A 4YIIA 1Y0UA 4MLHA 2IS6A 1W4MA 2ZMEC 2I7NA 2CV1A 3WTZA 1F4KA 2FRHA 1CZ9A 1P2FA 1QNTA 2MGQA 3QIPA 4IG3A 3ZQ7A 3U9DA 3KP4A 2ZMEA 3ITHA 3UNGC 4ZYGA 1LV5A 1SVOA 3CCUN 3KD1E 4FWPA 2AA4A 4UNOA 2IA2A 4NXMK 4NYFA 2Y0SN 3LSGA 3VYRB 3QDKA 3ZQFA 4DTNA 1ACIA 3KLNA 3TI0A 2QA4N 4IOCL 4DQPA 5F1JA 3FZLA 2KQ2A 3O5BA 2Z99A 1XGNA 4Y0WA 4A3GJ 2RNGA 2A41A 3ZX2A 3CDLA 1CZBA 2HYJA 1NGJA 4IFVA 4LB6B 4A5NA 3FF5A 5J3LA 3C65A 3SUPA 3P83D 2F4VK 3A02A 2W24A 4DQ8A 4G9ZA 3QYEA 4DZJA 4ETSA 2Z2SB 3IP4B 4YHHK 1B59A 1YIOA 2DMUA 5GTIC 3RZOJ 1TK0A 1BCOA 1JI8A 1VSEA 2DBBA 3HRSA 1W7AA 4R5PA 2L7ZA 2XAQA 4IQJA 4A3CJ 4Y1CA 4FJJA 3M7GA 4WK8F 2ASPA 2D0BA 4FLYA 1W36C 1SEUA 4C2UA 2YNGA 5FLXO 4M3UA 2J4RA 3VOVA 5AZJA 1V5FA 3F6VA 5GAHP 2FX0A 2AXLA 1QQOA 2NOGA 3VOEA 5J1UA 4CHUA 4B9NA 4E7HA 2KHOA 4IXAA 4C3JJ 4ZH4F 1WSHA 5ICFA 2HF3A 1XGSA 3QODA 1V5GA 3BJAA 3E6MA 1U6GA 2P9UA 3SI6A 1WJAA 4CJQA 3R1XA 4CZKA 3JCUC 3MWTA 3DKYA 1YRNA 3T1BA 5KI6A 1XNQK 3DFGA 3GX4X 5LRSA 2P9LA 2QKKA 2LP0A 1GLDG 3JRCA 2GX9A 4KAZA 5KHDA 3GE1A 1T6SA 2HR3A 3OBYA 4CEDA 1OCRH 2EZKA 5K5OA 3SAHA 1XI1A 3RR8A 3IWZA 3U2RA 3RTVA 3CC4N 3DAWA 3DPLC 1R1VA 1U9OA 4ESFA 2VQLA 2P9NB 3F21A 1N34K 2Q36A 2EIMH 2KFZA 4F52A 3ML6A 1HCRA 4N76A 2PN6A 1QVTA 3TO6A 1E4FT 4IJNA 3S14J 3G0ZA 1EF4A 4GVEA 3BDDA 3V7CA 2FMLA 1OKJA 1ZBUA 2Y1IA 1RT7A 3OR2C 1LUJB 2P5OA 2JA5J 3CESA 2O8EA 1EXQA 2NVQJ 2HBMA 1NK9A 2OQRA 2XGCA 1BISA 3GTPJ 2K85A 3L1PA 1X1PA 2VXZA 4WQ5A 4OGEA 5K1YA 4EJOA 2EIJH 3WGGA 2Z3YA 4KMFA 1VSIA 1QGPA 1A6IA 2XY8A 3IHUA 2ZC2A 3LMMA 4I01A 4YNQA 4JI0K 2PJPA 2CH6A 2E2OA 5GAEP 1XSXA 5HRSA 3OW2M 4CF1A 4B3RK 4BRHA 2VQGA 5KRTA 3I54A 3GFMA 4G94A 1Z9CA 4BG9A 2WBMA 3CO6C 2MH2A 4WCGA 3HTVA 4CEQA 3EZWA 3THYA 3LZIA 2FBHA 2X4HA 3A1YA 2KDZA 2HBKA 2M45A 1D0XA 4A2AA 3CD6N 1GV5A 4KTZA 1DU0A 2MW8A 2V51B 3E0JB 3AVCA 1MJAA 2I5UA 3JRBA 4Z4FA 2EH3A 1FJGK 5IOZA 3I55N 2QWLA 2QZ8A 2N8GA 3TAEA 1VQKN 4F3QA 3D2EB 1BI1A 5C44J 1WJBA 5EGOB 3V81A 1KQ8A 1YITI 4CCKA 3LAKA 2EPFA 1SFKA 2Y48A 5C4JJ 4FJXA 1IW7F 2DK5A 1RNHA 2HBLA 1H8AC 3IV5A 3LSJA 4CESA 1MU2A 2RPIA 4IF4A 3WE2A 2O4GA 4JLHA 4IVNA 1OCOH 4UV8A 2JLEA 3E9LA 4E1MA 3VB2A 4ESJA 2RC4A 1S1WA 4ISFA 3HOTA 3VEOA 3HPOA 4A57A 4FZZA 5DCFA 1EO1A 3GFJA 1KONA 2L9NA 3IRXA 3CO7C 4NB5A 1WQ2A 1VFCA 4ICLA 2CSOA 4HA8A 1RKTA 1C0MA 1D1CA 1PYVA 3A4CA 2A40A 2RKIA 3CCVN 3TWHA 2EV5A 4HCCA 4HNTA 4BRMA 4ZC3A 2CQ7A 2DCEA 4MLOA 4QPQA 3AA5X 3J7YJ 2CFOA 4LOCA 4DV6K 4CGGA 2HBJA 3OYHA 4XEIA 5LL6Z 2YCHA 4FJMA 1X2MA 1ZBLA 4EM0B 4IZZA 3SYZA 2DA5A 2BZTA 1YX5A 2KQRA 4WWCA 3AAFA 4Z4CA 4FWRA 2ELKA 1Z05A 1HUXA 3K59A 4DIQA 4JHDB 2NRHA 3KZIC 3H9JA 3T3FA 4B9MA 4DMNA 5FKKA 3PQKA 2VKDA 2K27A 5H2FC 2V9KA 1YJWI 3CXCM 1QZ5A 1JCGA 3LOCA 4CI6A 5HOOA 5F08A 4LIVA 1BCMA 3JRIA 2O8XA 1WNSA 3BTJA 3FXKA 2RE2A 3K10A 4CFAA 2KZVA 3KJVA 4PL8A 3TARA 4UB6C 1ZBHA 4PSXA 3C6AA 3H36A 4FJKA 5DM7L 2QWNA 3H08A 3V9XA 3HZJA 1TZLA 3I9V2 3HKZA 1ORKA 4C2MJ 1J9IA 4GKJK 2MBFA 2COMA 2EX3A 1ATRA 3RRGA 1MD0A 2NVYJ 2VJ4A 5JFRA 1VRTA 1WSEA 4X64K 3LFUA 3L9FA 1J2XA 4BBSJ 2VBYA 4IQ4A 5KQDA 2RVCA 5FLXK 1Z7LA 3WGHA 1LVKA 3VQEA 3EO3A 1L5UA 1S1XA 2BY3A 2WTEA 3BZ6A 3DRSA 4F7ZA 4M6VA 1IDYA 2G0EA 3EUAA 1NMNA 4H0TB 3W2WA 3M5RA 3FMQA 2PY5A 2MG4A 4KB0A 1N33K 1GVDA 2XROA 3C18A 4GKKK 2E7WA 3FBIB 3RRHA 4RW8A 1VQOI 2A1SA 3MQ0A 3N4QA 1SD5A 3PL8A 4KFCA 1PVEA 4HWIA 1EH6A 5LJVA 4HAMA 1J5OA 3DEUA 3ZMUA 3BDPA 5M1QA 4RLFA 5DS9A 3U9ZA 1XN7A 3V4GA 2X51A 4BXFA 1G3WA 4A3FJ 2R7UA 2WFBA 3MXJA 3WT0A 3SK3A 5J1EA 1YLFA 3FXOA 5J1YA 3QEVA 1NK3P 2E20A 1UB9A 1B8IA 3VEXA 2GAUA 3MCAB 4Y4RA 4B08A 2YHWA 2IOCA 1ATSA 1NLVA 5BPLA 2EBIA 3M9AA 1BDGA 3GDQA 1QVFM 1NGGA 5HS7A 5AFUH 1SL2A 4CZEA 3D7EO 2EILH 4E7KA 2YKNA 3Q7BA 2QKLB 4BXXJ 1U0JA 2ECCA 1ZG1A 4HV5A 1JXBA 4BROA 2Y69H 2XVCA 3KP2A 5BPMA 3LSIA 2F5VA 1LEAA 4E0DA 1VQ4N 2HKOA 5C4XJ 3SUOA 3G1MA 2DFFA 3JR9A 2LG4A 1SD4A 2R7QA 2ZCWA 3GWZA 3OY9A 1O3RA 3A0IX 5E18F 4MDAA 1KTQA 4CJRA 4GY2B 3OL3A 4ZDOA 4B9LA 2X78A 5IT9O 4L8RB 4HF1A 4DS5A 4KI6A 3JRHA 4ITVA 4L0ZB 3HBTA 2D0CA 3IKTA 3DKXA 5JLHA 5IWAK 4FLVA 4LF9K 3T19A 2HVRA 4H4OA 2PEXA 1GXQA 3TQNA 4HNUA 3GUDA 1MDMA 2FF6A 3AA2A 5EEAA 3BPXA 1B4AA 3G1LA 1I3AA 4L18B 2I8DA 4IRGA 4AVPA 5HDNA 5KAIC 3TBIA 5E3NA 1RBSA 1RGIA 1NHAA 3CF2A 1R5GA 4B1YB 1HYZA 1SFUA 3NCIA 1HKTA 4FJ9A 2H1KA 3G71N 3HOYJ 2K4JA 1Y39A 3CIPA 3SQ4A 4NB4A 1HNZK 5E1WA 1POGA 4FJLA 1DU6A 3JSMA 3QLHA 4FL9A 1ONVA 1N32K 5SZTA 2P9PA 4C8OA 1NGIA 5CVJA 4C3IJ 5AQYA 1IN5A 3ZETB 3RI4A 3H0GJ 3K69A 1JLCA 3TO7A 1BL3A 3CJ9A 4JKEA 4E19A 3HG9A 4BG8A 3GYHX 3MX5A 2O3FA 4RDUA 2HDDA 2VUMJ 4JKBA 3QAHA 1LPQA 3K1MA 1JXSA 3TO9A 4QCLA 2VG7A 3HYFA 3K70C 2XKOA 1FYKA 1HQEA 3L4QA 1SVMA 1YAGA 2XPUA 4ZZDA 2DA3A 4S04A 1IG9A 2PJRB 2KJCA 5DCMA 1YHQI 2Y0SA 1U45A 2QWWA 1DP7P 3HPGA 3BG6A 2STWA 5M3FJ 2Q3SA 2P6TA 1SVLA 5F0FA 3I8DA 5BRHA 3J7YP 2WY8Q 3FLCO 4O0IA 2I7PA 1B9NA 5AQFA 1X9SA 3IKMA 3SJHA 4B1XB 2ZJQF 2H6BA 1B9DA 1NGAA 3H1VX 2B0LA 4YFUA 3CCSN 2ID6A 1BOBA 1XX5A 2FQ4A 5FPMA 1UG0A 2VKHA 1K7AA 5CR4A 4PUSA 1H88C 2GXBA 1RBUA 2WAFA 1OYYA 2WY7Q 3AVFA 3VQCA 2COBA 2HXOA 2EZHA 3O9TA 3AAPA 3AGRA 3KE2A 1KU7A 1BR2A 4HF2A 1IUYA 3ENOA 4JNEA 4RG8A 5CYMA 2YNFA 2XHBA 5J2QA 3I4MJ 3A5OC 1DGRM 3QINA 4TSXA 3HXLA 4RB1A 4CCHA 2ICWG 5DUKA 4E6KG 4EM1A 3J81O 2NS0A 2DTZA 1WPKA 3QFPA 4B3TK 3RDIA 3E5UA 2LOOA 3G4SI 1YYVA 2NOJB 1Q18A 2BYVE 5HRRA 4IOAF 1VQKI 4KKOA 5LY3A 5JS1A 3ERED 3HUGA 2F8SA 4DCHA 3NWSA 1E0EA 4QWQA 4KISA 1K73O 2P81A 1LDKB 3O8MA 5CZ1A 3J7AP 3KP7A 3DRRA 1GUUA 4HRIA 2B6AA 4MDBA 1YS6A 3OSFA 1MWKA 3HM9A 5CVUA 1LQ1A 3MCZA 1TQIA 1P6RA 2ZNYA 1BW6A 1F5TA 1K61A 4XLEA 1WI3A 2K9SA 3L4IA 1RT1A 2XO7A 4FQGA 1KYZA 3I58A 4ZYDA 3PJRA 4FO0A 4DTSA 4DSKA 4BUPA 2F7TA 3GTQJ 5K14A 2OUMA 1IBLK 1ILYA 5J4VA 1NK0A 4DFMA 1X4OA 1MMSA 4FLWA 4KI4A 4CEZA 4FVMA 3T1YK 3AL0B 4PL7A 3C2GA 4B4CA 4CICA 4KA4A 5LJWA 3CFPA 1YO5C 2D5VA 5AR0A 2KKOA 4OIQF 3UKRA 4A3EJ 1N6QA 5E41A 1MIJA 4EGZA 2YUSA 3S15J 3K4KA 2VLAA 2JVHA 2CQQA 4R79A 1BIBA 1BR1A 2GXGA 2QSGX 3S17J 1LWEA 1LW2A 1S22A 2JWLA 2OANA 5AQKA 1NH3A 3MKZA 1YITN 2P9KA 5JI6A 3LP0A 4B1RA 4ILJA 1TBXA 4DUZK 3MZHA 4GGGA 5SWMA 2UV1A 1H89C 1ITGA 1NJXA 1SV5A 2YR2A 3DTKA 1R59O 4RTFD 3C2HA 3O8HA 1XC3A 1A31A 3SAGA 1VK0A 1AU7A 2FU4A 3V1RA 1NK6A 3CQ8A 1J7KA 1KLNA 2H27A 2R7DA 3THYB 2DA1A 2R7OA 3I3LA 1ETQA 4RA2A 5GPAA 1VRUA 5M5WJ 3L2RA 3CFOA 3W6KB 5LGUA 1S6QA 3F8CA 2FC0A 1XMOK 4AYBN 3BGRA 4M42A 2JGUA 3QERA 3RMDA 3GTKJ 3VQ8A 3OOPA 2A42A 3RPUA 5C12A 2Q8KA 4MQ9F 1D1BA 1S29A 1NGDA 3M3ZA 4XN0A 3SQ1A 4EZ9A 4JI2K 1LOTB 1KFDA 5ILUA 3TP3A 3EE8A 2VCPA 4A5BA 3KEOA 4FJNA 1I39A 3G25A 4B48A 1AHDP 2HHUA 2FNPA 5GPCA 3M1CA 3WQTA 1U9NA 2E36A 1SD6A 3CUQA 3BT9A 2HB5A 2VT2A 1XPXA 1TC3C 1RCHA 2PYJA 2X6XA 3FKJA 4BEHB 3GTMJ 1SZ2A 1S1TA 3AVBA 3O9SA 5AQMA 3NHGA 4B09A 4FZXC 5E8GA 4JEPA 4KB1A 3QPHA 2E34A 2O8DA 3RSNA 3T1AA 2IAJA 4WCEL 2G8WA 2HHVA 3I4NJ 1CXUA 4XM3A 1TV6A 3O4WA 2FOWA 3J7ZI 3GLXA 3JYTA 1TP4A 5L3DA 3MECA 5E8IA 2YX6A 2A6TA 2BE5F 4X62K 3P9KA 1WRJA 1EA3A 2E1MC 4IEJA 4XICA 1JUSA 1AWCA 2W41A 1VTNC 5J8CA 4HTUA 2O0YA 4RS8A 4DFJA 2P7VB 3LSTA 2PI0A 1RTIA 3QNOA 5TRDA 1L3LA 1TAQA 1GLFO 4DGWB 1BC8C 1RT5A 3O4QA 2Z1IA 3HVTA 4B9TA 1HNWK 4W5RA 4AYBA 1QRYA 4IX7A 4U0WA 4CJTA 4YY3K 3AARA 4DR3K 3TANA 1BI3A 3KP5A 4JX4A 3KKSA 1WVRA 4CBWA 4CZGA 2EK5A 3D45A 1BA5A 4NC8A 2IXSA 3VGKA 3FDYA 4PKGA 2E71A 1RT6A 4IOXA 4ENKA 3D2FB 4HX7A 2CQNA 3R6MA 4OINF 2ISYA 4ENJA 3AG2H 3QB0A 2R5ZB 2L3DA 4DR1K 2VWBA 2BANA 2DYSH 2JUGA 1MMAA 4Z6YA 2FXUA 3ZSYA 2XAJA 3GEZA 1MBJA 2P8TA 1KU2A 2V4JC 3V42A 4JOMA 3RKYA 3UKGA 2UYTA 2QKBA 2XGXA 5GAHJ 1ZAOA 3FXRA 5B5EC 3D5RC 2XC7A 5IT9K 2QYOA 1Q8IA 2Z16A 1VSHA 3QO9A 4NQWB 4MTDA 4I2QA 1GLLO 4JD2B 1YJNN 2EA4A 2Y0MA 1RTDA 1OJLA 3RSEB 1IN4A 2D5RA 4KITB 4MNUA 2DJIA 2JK3A 5IT3A 2O8BA 4BRIA 1Z26A 1D9FA 2XASA 1KGSA 1ON1A 2A6HF 2W82A 1D0YA 3SZPA 3VEPA 2ZSIB 3CDHA 4CGDA 5BR9A 3DEWA 3R8EA 3ASMA 5F1XA 3HVRA 1DLOA 3VQ5A 2E1NA 3GVAA 3GZ6A 1A5XA 2D0AA 5HRPA 4G6QA 4CUGA 3OYIA 3O08A 4CJVA 4DF4A 4J2DA 3R4KA 4E1JA 5FFZA 4JBAA 1QQNA 2FBIA 3H9QA 4J00A 3T0YA 4CCMA 3V8KA 3KWGA 2CS3A 3CJCA 3VDXA 2KL4A 3TABA 3HDDA 1LVAA 5HNFA 1R5HA 3AG3H 3HC7A 1HJRA 4C23A 2HHTA 4XLAA 2IP2A 2W00A 2X6WA 3P38A 1E3HA 2QBYA 5BRDA 4W5QA 1NK8A 1OISA 4JYKA 1WI9A 4U7BA 4Z4EA 4FLUA 4MHGA 1ZR4A 1JKQC 3LSMA 3AL0C 2L4AA 4UY8I 3H5RA 5KGXA 1FIAA 2QQ9A 4ZJZA 4BRDA 1XB4A 3I56N 2UUAK 3QEWA 3J7ZO 3CCRI 3I5UA 5L3BA 2ZF5O 3KP6A 1HW1A 4EV0A 3H45C 1P92A 5KQ8A 3PO4A 1U78A 2X6YA 3CP8A 3ABMH 3K4BA 3NQOA 1RNLA 2MYSA 3H3UA 3QPSA 4RCHA 2HYGD 4CJWA 4PWDA 4NLBA 3KLHA 1XDUA 2AHQA 2KISA 2HNYA 4XKWA 4FPAA 4LGWA 1VI0A 2XF6A 2G7HA 4GXOA 1FSEA 3BC8A 2E7XA 4M71A 1JJ8C 1PUEE 2NNWA 1KVBA 3MXIA 2OZMA 1XSDA 5HVQC 2HNZA 3QEPA 3F23A 2PMZN 4F8RA 1ZK8A 2GOXB 4M9XA 5H6RA 4FJ7A 1SKRA 3VQBA 1G3TA 1RUOA 1GT0C 2Y2ZA 1U5TC 1V4TA 2P9IA 2WBNA 4BJ5C 3OHRA 4LG0B 1S9EA 2KRHA 3ENBA 2HOTA 4DS4A 5LGTA 1OH7A 1ZARA 3HHGA 3Q5FA 3O3HA 3LALA 1BGXT 2IGOA 5KAFC 1YIJI 5EU7A 2VG5A 3UE5A 1D1AA 4DSLA 2K9NA 3FX3A 4MEXF 2XKPA 3I4PA 5C42A 4AD9A 2D2WA 2V52B 4CYCB 3ZLJA 4B44A 3CC7N 2F9WA 1T56A 3GCMA 3O1BA 3HXMA 2LSOA 4IHWA 4XOPA 1GV2A 1L0OC 3IWFA 2EFPA 1R49A 1U04A 1T3VA 2PAVA 4U0VA 4Y15A 3NF8A 1UZCA 1CZAN 1ERDA 4OPJA 3L00A 1FOXA 3Q3SA 2JZYA 4D5FA 4IDKA 4GMJB 1T08B 2X48A 4WXCA 5AIPA 4BAYA 5GAGJ 2VYPA 3BTIA 4FHTA 4ZZLA 2DLLA 1JT0A 1W0TA 1MBEA 2H09A 2OTLI 4E1NA 3RQ4A 1TQMA 3MZYA 1U6ZA 3CYMA 4FZYA 2D0OA 1WSGA 1TWHJ 1NK2P 5FRMA 1UOCA 5E1XA 4XLNF 4CZZA 3K5NA 5DYMA 3BG9A 2BXYA 3A8YA 3UKRB 4CZIA 3KTQA 4A5MA 2F4MB 4BS9A 3CCSI 1VQ7N 4EHTA 2NAZA 2CV0A 4CJ4A 4BYYA 2CV2A 4DTOA 2WB1N 4WYBA 2LRDA 4PGHA 1EETA 2MH9A 2P9KB 2O61A 3ZSRA 3WUHA 4PZJA 1R23A 4FE4A 4HTLA 2CWEA 2LFBA 3THVA 1SL0A 3LWFA 1EX4A 4NXNK 4KHSA 2VOPA 2NNNA 3CCQI 2O7OA 3VQ9A 1TWAJ 3K1PA 1OYIA 4JS4A 4KHYA 2EWNA 3CTAA 3ALYA 3J81K 1O13A 5BN8A 4KNYA 4ILGB 1JJ2M 4DV4K 4UUSB 4LIUA 2GELA 4RW6A 4DR2K 2JWTA 3UR3C 1SFOJ 3PIOL 2O8EB 2ZBKA 3QEXA 3LDSA 3PSIA 2RDPA 3FHZA 4CJFA 3HPHA 4K25A 1Y6IA 3CJNA 4EFHA 4HZFA 5ILSA 1ITYA 1QZYA 2UXXA 3ZQIA 5CY4A 4AHCA 3CMMA 1VQNI 2LF8A 4LFUA 2ZD1A 2R7FA 3SLCA 2M8EA 2W4SA 5BQTA 5HDGA 2BE2A 4IO9L 1NJZA 4DSJA 1IV8A 4ZYEA 3VWBA 3DLGA 4JK1X 3RCOA 4XONA 5AQTA 1LDDA 3M8JA 3ROUA 1KVCA 4N56A 2FSNA 1RESA 2GBZA 2VASA 4O8UA 4HSTA 2A5XA 2DPNA 1D5VA 4C8NA 4M3DA 3REOA 1KD1O 3H92A 2UUBK 4NCBA 4JAXA 5AFUA 2DDBA 1ETWA 4I02A 3ZMZA 4LH5A 3W3CA 3AAQA 3ZX0A 4CJKA 3OSGA 3A0BC 4UHTA 3SMPA 5K5RA 3Q7CA 1YXQA 2E1OA 3ZT4A 1VQ8N 3Q0UA 1RBVA 5EVZA 3JAMO 3NE6A 4DLGA 5DDGA 3TAGA 4FK0A 1JE8A 2AXTC 1U8BA 1TL8A 1EP4A 3L2QA 1WZ2A 4CECA 3DLLL 1IG8A 3CUQC 4MFDA 4CEOA 2CYYA 4ID1A 3OYNA 2JQ7A 2IVNA 3VEZA 3IUCA 2F48A 3MX2A 3KETA 3J80O 1NJYA 1P4AA 2HPMA 5JLWA 3EYIA 3CF5F 2G8HA 2H1LA 2F2EA 2KLAA 2L4MA 2OPSA 2W25A 3GZ5A 1Q7YO 2J5PA 3UKUA 3ZT3A 2LVSA 3ZSOA 4WXHA 1SS6A 4O5BA 3ZXSA 4L9JA 1M1EB 2HQNA 4HSRA 3K4MA 2QWQA 4G6TB 3SUNA 3TAFA 1WSUA 1FYMA 1OPCA 1MMGA 2DYRH 2XUBA 2ZMEB 3NWTA 4S0HB 4ZTFA 4XSXF 4UVBA 4PJ0C 1HSJA 3GMEA 3KHYA 3LQRA 3J80K 3OYDA 4O8KA 4OKEA 2FNAA 3BY5A 3AA4A 3KCCA 3W2AA 4CE9A 4QS9A 4IO9F 4I76A 3I59B 4A2UA 5H6QA 1VSJA 2JA2A 1X1CA 3HUGB 3K2ZA 1KLMA 3IH4A 4K41A 2DJNA 1RTHA 2QQ8A 3WTWC 2M0CA 3WTTC 1KQ0A 1Z25A 2HVIA 2M7BA 2ME0A 3CUQB 4DYCA 3LSHA 4PJMA 5HNHA 1VQMI 1WSIA 3AVHA 3NFAA 4CIGA 1WAFA 1T8EA 4RGUA 3C6HA 3HKZN 1R1TA 3EDPA 3I56I 4JI7K 3BF1A 3CERA 3VQDA 2GBYA 3S3NA 4BVOA 2X1DA 3DXMB 2LR8A 2VQCA 4NBQA 1UG2A 1T33A 3HYIA 2IS2A 2JA8J 1WH7A 2HKXA 4KIFA 3ENHA 4HBLA 4CK2A 4DFPA 4HX8A 4FLZA 4YFNF 1IV0A 3HSEA 4L9NA 4EATA 2D1KA 3CJAA 4F93B 4RGXA 1T03A 1STZA 4JKGA 4AH9A 4XLHA 3FZFA 3O9QA 4IHXA 4M3XA 2KIMA 2DT5A 3C2BA 3U1KA 2R7WA 1Y64A 3KPHA 5LGNA 1G8XA 2QSHX 3VETA 4DU3A 2QQAA 3NEUA 2OZ6A 3LM2A 4FWNA 2G7UA 4CJEA 2OA8A 2DMTA 2OBPA 3DTIA 3DBHB 4BY7J 1IAWA 4HF0A 4A5AA 1NOYA 2P9SA 4DKWA 4M63C 1D0ZA 2DQRA 3JREA 3OWTA 3R60A 2K9LA 2ZFWA 2ZXIA 5AZJB 3DCFA 1Q1VA 4WF9L 3L09A 4BGDA 2QGUA 2RHKA 4JRPA 3F8BA 4I9LA 1ZR2A 3EN9A 4YOTA 2R7YA 1IGNA 1A5JA 2G8UA 5BPNA 4KT6A 2NLXA 4YORA 2K3PA 3HOWJ 4M3BA 4A2BA 1K4TA 3KX2A 3O9RA 2FXAA 2XRNA 3BG5A 1RFQA 3HOVJ 1YF5L 4CH7A 1K6OA 1HNIA 2YNIA 1QHGA 3AVAA 3M8PA 5D3GA 2KZGA 3G6EN 2HFHA 3CCVI 5AQVA 3P1GA 4MO4A 3L3VA 3SJMA 1SKSA 3IUOA 1HLVA 2NVTJ 1XTAA 5HLTA 1K8KA 1O1WA 4KMUX 3F8NA 3D0SA 4WXDA 2MLGA 4XH1A 1N5YA 1ZN2A 1MJBA 1O4XA 2VGNA 4JK7A 4CEEA 1HNVA 2L7KA 3V9WA 4X0GA 4WFBL 1P7JA 3ERMA 5E79C 2JMWA 3AO4A 2LNBA 5HLHA 3H35A 4E7LA 2Q97A 5HBMA 1X58A 2QWPA 2NXNB 3L2UA 1OCTC 2F6CA 3TOBA 3AG1H 4BEHA 2ID3A 2FOKA 2IVOA 4UUTA 4JK8A 1LAWA 4ESBA 2BVLA 1OCCH 2AQFA 5B8HA 2HTJA 5J2MA 3K5LA 1HLUA 2WUSA 2H8WA 3I55I 4BR0A 1HW2A 1XC5A 2X1CA 5ICCA 3THWB 3LSKA 5CYVA 5CVRA 2W42A 4PSWA 2OPRA 2K86A 3EETA 3VERA 3KYDB 4EGYA 4DB3A 1IKYA 1U4BA 3DLHA 3HIFA 3O9UA 1MMDA 1R4NB 1N78A 4Y52J 1OH6A 3H0DA 3KD5E 5IT9Z 2K9QA 2BHYA 3R0JA 3BR5A 3DLLF 4IHSA 2FF3B 3I0SA 3KK2A 3SCXA 3BCAA 3CJ7A 5C2DA 3OOUA 4FLXA 1OH8A 4FWOA 5HLIA 4G7OF 3AVKA 1LWCA 5AQNA 1OQYA 5D6EA 2GEMA 3OJSA 1QE1A 3E6DA 3SZ2A 1V55H 2M4GA 3BZCA 4EP5A 1VQPI 4ANJA 2GWKA 1N36K 2QXLA 4IO8A 4LF7K 2VODA 1FSHA 4XRSA 1NMDA 2EZLA 3V9ZA 4FK2A 4XQFA 4O3MA 3BF3A 3BR0A 4CJSA 4L9TA 3GTJJ 3ELKA 1Y97A 1RDDA 4YOWA 2V7YA 3OYAA 2IJLA 4L3QA 3HT3A 5EG0A 4WX9A 5GAGP 4CK3A 1NWKA 2HQRA 4A3IJ 3WTUC 1ZHFA 4TV7A 5AIQA 3ZCOA 1LEBA 1M1KO 2YI1A 4LD5A 1QHTA 3M8EA 1DEJA 1UMQA 4NQWA 3IFRA 4CEAA 1TKXA 1BW5A 1KA8A 4XLPF 3BTCA 1BL0A 1P7IA 2PQ8A 2O9LA 1Q9YA 2M4KA 2DMQA 3E6CC 3MVPA 4FJHA 1JLAA 5KPTA 1RDWX 3H3VK 3VEYA 1DPUA 5MLCQ 1VNDA 3NGIA 3DLBA 2G9WA 1DQUA 2QW9A 2WTUA 1RBTA 1GLEG 4J8FA 2NRTA 2A3ZA 5D8KB 1TL3A 2FA5A 4BHCA 5B3SH 4Y33A 3HM8A 3AO5A 4PK4A 4OLBA 2M5WA 4G6DA 3CCMN 2NRRA 3QESA 4F2SA 3TW6A 4H5NA 3F73A 1ZLKA 3ABTA 2LY1A 2VBWA 3MK6A 2GOMA 1B92A 1TVRA 5IOYA 3IAM2 1YVUA 1C0WA 1X3UA 2JA7J 2Z1JA 2GA1A 1C0UA 1HR0K 2VT3A 4GCVA 1W97L 2K3FA 1XNRK 4YFKF 2HTSA 1REPC 1T7PA 3IAYA 1S1VA 3CMEI 2D0PA 5AQHA 4BRGA 3CUOA 1KAYA 5AJ3K 2VJJA 4KICA 4BQLA 4CJ3A 2ZXJA 4RAYA 4DV1K 1MZBA 3M4OJ 3OYLA 2NRVA 1XG1A 2JUCA 4KDPA 3BJOA 2M1BA 3MEDA 4GNIA 4HPQA 1BQNA 1HQCA 4DSEA 5HROA 4FT8A 1FZPB 1BI2A 3CM6A 3IG1A 1JTXA 1WOQA 2OCEA 2M0MA 2TRTA 4XMYA 4XLCA 1T8IA 1E17A 3HOUJ 2FSWA 2OF7A 2HDWA 2RV8A 1NK5A 1BC7C 4FW2A 3VGLA 2QBYB 3VSLA 2OCCH 1UFMA 2XB5A 1S6LA 4CGHA 3DQVC 4WFAL 2IAIA 4BC4A 2AP1A 2KRFA 1RDCA 2R5ZA 3U4LA 4LFBK 3K9TA 4AIKA 2H3GX 3K9KA 4XH5A 3S93A 3S32A 1W36D 4O5FA 4CVNE 4OPKA 4OX9K 4DTXA 4DOZA 5CVIA 4F55A 1ZH5A 4NC7A 1L3UA 1LFUP 3EL2A 3JXUA 2KIUA 4BXUA 1BO5O 1JUMA 5AQXA 3EY1A 1TAUA 1W7PA 1XGMA 3CZ6A 4CYDA 4D9JA 2OAZA 5DD8A 4D5CA 1S72I 4JS5A 5I3UA 2P4WA 1U2VA 2HZDA 4AU7A 3KP3A 4OMZA 2M3AA 3HGYA 2IA1A 5M1PA 3WEEB 2MLKA 2IC3A 3K4NA 1BM9A 4FX0A 2UXNA 4DBQA 2ETJA 3ZN0A 1KU9A 3F5TA 1C6VA 4BY1J 3P9IA 2E1ZA 3DEEA 3LWMA 4ZDPA 1BIUA 1CQTA 3K0SA 4ELTA 1R58A 3RZDJ 1MDUB 4F3OA 1MBKA 2AO9A 1AKHB 4PCQA 2W7NA 1VSDA 4KH5A 4AM7A 4EEFG 4RLQA 2QEXI 1S9GA 2P0WA 1K6YA 3THXA 3I0RA 2W1OA 2VC0A 3HOZJ 4KHWA 2IDOA 2QI2A 4BQOA 1BBYA 3PNYA 5K7ZA 1TNSA 1VQ4I 1HX1A 2R7XA 3GW2A 1NGEA 1Z91A 4KTWA 3DBRB 1QVUA 4N9HA 5F2RA 3VTHA 4CK1A 4PHTX 1G3SA 1Q86O 3ZT1A 2GIVA 3PM1A 4BGBA 4LF6K 5FPEA 2JSPA 5J2PA 2V1DA 4DTRA 2LMDA 4BH9A 2BH1A 2XV4S 4BR5A 4ON0A 3K57A 3VA3A 2CH5A 1O3SA 2O4IA 3AKZA 1YW9A 3IS9A 3KYLA 1BIAA 4IBNA 3P5JA 1HW5A 1KXPA 4FISA 3JRDA 4UVAA 2GV9A 4OPAA 1L3SA 3C6TA 2ME6A 1GOAA 4A12A 1DP3A 1MSEC 3UB5A 3HJEA 5LEJA 4NHJA 3K9JA 2DTRA 5GADJ 1FX7A 2NZTA 4CHOA 3ZQLA 2ZXWH 1K8AO 2CMPA 4LLLA 4B9UA 2UXBK 1V5EA 2ZGYA 2MC4A 2HDCA 3LL3A 1E3MA 4W97A 4P9UA 3K4CA 1VQ5I 1SAZA 4JKCA 4IRHA 3E6BA 3SEZA 2E2QA 1ZTRA 4NCGA 1B72B 4HUGA 3OYJA 3CCMI 1Z6TA 4RM2A 3PIPF 4JK9A 4OAYA 4IXCA 1IN6A 1HRHA 2ESHA 4DSFA 2P5GA 4YOVA 4FM2A 3TU5A 1UELB 2OA4A 2O5RA 2E5ZA 3Q0VA 4GYIA 3DM2A 3RIRA 4CGJA 4CFBA 2Y30A 3HOXJ 4OOIA 2OZUA 4I0AA 2DT7B 1H9TA 1A35A 1QQIA 3ABUA 1VSLA 5BRFA 1A5VA 1BI4B 1KFSA 3AVMA 3CMAN 2JRTA 1HKSA 3MKYB 1OMIA 4PFOA 1KRPA 5ILVA 1HKQA 4C8KA 4XRSG 2XHKA 2DTUA 3IDHA 3HM5A 1FYLA 4PGGA 3PUBA 4DR4K 3AA3A 1X9WA 3ZSXA 2RQQA 1E3OC 2G8VA 1YS7A 3OYMA 2OJED 4OJRA 3W0LA 2V26A 1ASUA 4OIRF 4IG0A 1WUAA 1R22A 2OD5A 1SC7A 1YJ9I 4JKHA 2JVGA 2LY9A 3VFZA 2PFUA 4B1UB 3QOEA 4DSIA 5J47A 1S8NA 3FZMA 3FE1A 4LY7A 5EZGA 2ELJA 3VN5A 3J81Z 2PBDA 1U49A 4HDUA 2GTDA 4AHRA 4H5RA 3IRRA 2JT1A 5CPRB 4N4NB 1YQAA 1RR8C 3BP8A 4B3AA 3N97A 4O55A 2DA6A 4LLGF 2YS9A 4I6MA 3RSEA 3SBGA 4A93J 3JTGA 3EPZA 2E2IJ 1ZRDA 1Q9XA 3Q0WA 2ETHA 3DLKA 2VQHA 4IPAA 1JGSA 1BA0A 1NGBA 4U7DA 2W40A 4A6EA 4YDUC 2K4BA 3V9UA 4BE0A 1LW0A 2ZKZA 4L5EA 2B63J 4A0ZA 2O8CA 2PMHA 3FISA 3PFYA 4RGRA 1Y1VJ 3UKUB 1N75A 1MJ9A 1R71A 3GBTA 4CHNA 4W5OA 2HHWA 2QKMB 4QSHA 3HRGA 2KIFA 4M3TA 3RPUD 1S7EA 1HJOA 3GTLJ 1TYQA 3GL1A 2HXIA 4F92B 1KYWA 3EUKL 1IBMK 2RAEA 2CH0A 3B6CA 1XCVA 3DV8A 3V8LA 4FWKA 1HMVA 1WBDA 1Q1HA 3KK1A 1XD7A 2FMYA 2KFDA 3MAJA 5D5VB 4I7FA 4BC5A 3CPWM 3C6UA 1LB2A 3H9GA 3SMSA 1BWFO 4EHUA 2CW8A 3WTXC 3BR2A 5GP9A 1YRNB 2P9PB 2YKMA 3LDLA 1OR7A 3M8QA 2FBVA 1QSLA 2YNHA 3ECOA 4M73A 5TISC 4DYQA 1B9MA 1MKMA 3V7RA 4E4HA 5C3EJ 3G2BA 3AVGA 4HQMA 3MZ8A 3ONQA 2Q31A 3CCLN 4QOZB 3KEYA 4M74A 1TKDA 2P9NA 1VQPN 4XRFA 1UAAA 2NRWA 2ZJ2A 4Z2YA 3QICA 4B1WB 1RT2A 2HPIA 1FLIA 2P9UB 3JAMK 1F9NA 3KZYA 5DM7F 3G10A 2F8TA 3VEWA 3VPRA 5KNLA 5J40A 5JHUA 1PJRA 2A68F 1IKVA 5JHFA 1VQLI 2P9LB 3L3UA 4GV6A 3CCJN 2CUFA 2XRIA 3BPVA 4L5IA 3VENA 1Y8RB 1IKWA 5EZHA 3F3XA 1LJ9A 4MGRA 4CEFA 4ELUA 3OIPA 2KLOA 2UXCK 4B3XA 4XH4A 3WTVC 2L54A 5F0CA 2V1UA 4ZHRA 2V1NA 4EJVA 2NVXJ 1T6CA 4P55A 4BR7A 2W48A 5JVGL 4RAGA 5AQIA 3H3ZA 1O7FA 1WWXA 4HHTA 4MLEA 2VQFK 1Z3YA 1NGFA 5M5YJ 1KVAA 3W6JB 2D1VA 3WXLA 1KSPA 1P4XA 1OVYA 2UUCK 2KRCA 1X1DA 2M30A 2BDPA 1SFEA 3E97A 1KQ9A 4JI8K 4C3HJ 1QHHD 1LFBA 1QO0D 4DV5K 4B3MK 5T7BA 2IGKA 3F2KA 3HI0A 1NKBA 4LMYA 5KVRA 2R5YA 3DBLB 4E7JA 2GUPA 2LTPA 4BHPA 3IRQA 3B6AA 2XF7A 2GZWA 3ULQB 2P9SB 3MN7A 1UAXA 3PSFA 5EF6A 2VGMA 4HUEA 1ESVA 3EUHC 4JN4A 2ZXHA 1ZGAA 3SFZA 4A3MJ 2XF5A 1X9JA 1B1BA 1I6HJ 4U67L 1FC3A 3EUHA 4GYGA 3CJBA 1ASWA 1ZC6A 4JKAA 2VPRA 1BA1A 4LFAK 4II2A 4WF2A 2NS8A 2R7RA 3OYEA 3WNFA 4DU1A 4H5WA 1DTQA 1Z1DA 1N77A 1WLJA 5EY4A 3EZ5A 1S7OA 2HVHA 4AHSA 4K2EA 1P4WA 3BZKA 4K43A 3VSKA 2XAHA 5JLFA 1T38A 3HJFA 3AO2A 4DW6A 3SHFA 1R0AA 5GINA 1GLJO 4FJ8A 4JI4K 4KPYA 1EWQA 1G4DA 2BV6A 1G59A 1NG6A 1YI2I 2R93J 1YJ9N 4QS8A 1RT4A 1OCPA 4H0XB 4A3DJ 5FD5A 4XKVA 4M6XA 2WA0A 4MTEA 4OAZA 3LDPA 2P9IB 3T69A 3EKSA 3K2AA 1G6NA 2F5EA 3O2PE 3TGNA 3NBPA 3CCEN 2ESNA 3B73A 3TKYA 3ZT0A 3K1NA 4FK4A 1TK8A 4N41A 5FJ8J 2RF2A 3HTSB 3BWGA 4IRIA 3D0PA 1BI0A 3JSPA 5BMZA 3H3NO 2VG6A 2R7VA 4UV9A 2X6NA 4Y7NJ 1Y0NA 2LSNA 3SZTA 2E1CA 3DLEA 1TKTA 1ZBSA 3BUZB 3ISNC 4KO0A 2D1HA 3VQ4A 3ZMTA 3RJPA 1JKHA 4M7YA 5IYBJ 3HO1A 1I5ZA 2YX7A 3KWIA 1N8RO 3A01B 1NJIO 3H5NA 3TW7A 2HNDA 2YHYA 4PKHA 3TP0A 3PV8A 4YG2F 5EDNA 3CCUI 3C7NB 3QNNA 4DR6K 2QWOA 5FROA 3JRAA 4C8MA 1IRFA 1EJ9A 4M3FA 1VQ8I 1S6PA 3R6SA 3ATVA 4UUVA 4Z4GA 1IXSB 1WJFA 1LWFA 2QQBA 5M1KA 4DR7K 4OIOF 2DU9A 4I2PA 5JS2A 1RIOH 3ID6A 3ZMVA 1FKPA 3CCRN 2ZJQL 1YG2A 3BEXA 4HEA2 2H94A 3ZQQA 4AVZA 4DHYA 2GIZA 5F64A 5EEGA 3ASNH 4LG3A 2KZMA 3E9OA 4KUMA 1W2BM 2BVMA 2HI3A 2VN2A 3LP2A 4PUOA 1MBGA 3DKWA 3ZX3A 4B8AB 3SNNA 1NGCA 4DQQA 3K70D 2P5KA 5HS9A 1VQLN 2YHXA 1TWGJ 1L3VA 3ID8A 4KN4X 4RB0A 2O8DB 2CW7A 1CF7A 4LSNA 2GLOA 3VA0A 1X1AA 4H0EA 4U0YA 1NKCA 1J6ZA 2HQ5A 4RB2C 1APLC 3FFIA 2LY2A 3S2WA 1S5JA 3QBXA 4FASD 4E89A 1Z6RA 2KPMA 1WJEA 1R9TJ 1YFHA 3PNVA 1JL2A 4GFBA 3IMXA 1ETKA 1FBQA 3ZSWA 1UA0A 3D2FA 4N0BA 1QSYA 2FBYA 2EB7A 2KW4A 4R1HA 3BQYA 5IP6A 3AV9A 4BDYA 1NM1A 4CZJA 3HK2A 1R5ID 2RGVA 5J6XA 2M2EA 2JA6J 1ETXA 3ABKH 3PIPL 1XQSC 4BRAA 1OYWA 3F0CA 4PFPA 5F1RA 1YT3A 2PFBA 3QYFA 3MMYB 4I0BA 3QU3A 4BQQA 1BJZA 4RAZA 4E70A 4QS7A 4CIEA 1U2WA 4LITA 3LFKA 4N9IA 2UWMA 3SV3A 3W2VA 3A2KA 3B6PA 4PJLA 3Q9SA 2L02A 4XKBA 2EFWA 4C2TA 3RPQA 1IJWC 1J5EK 2XAFA 1BOTO 2ATQA 4CD3A 4KHNA 2KDOA 2W84A 2EINH 1JGGA 3SZGA 4OKJA 4CJUA 2BUPA 1A5WA 1T95A 3O6WA 1IDZA 1FW6A 4IFYA 3WU1B 4BQZA 3H3OB 5EEHA 5M3MJ 1FKOA 1C0FA