1Z05A

Crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
DHIKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAISRGRPAVGLQTNNLGWQFLSMRLGRGYLTIALHELGGEVLIDTKIDIHEIDQDDVLARLLFEIEEFFQTYAAQLDRVTSIAITLPGLVNSEQGIVLQMPHYNVKNLALGPEIYKATGLPVFVANDTRAWALAEKLFGHSQDVDNSVLISIHHGLGAGIVLDGRVLQGRHGNIGELGHIQIDPQGKRCHCGNYGCLETVASSQAIRDQVTARIQAGEPSCLATVEEISIEDICAAAADGDPLAVDVIQQLGRYLGAAIAIVINLFNPEKILIGGVINQAKSILYPSIEQCIREQSLPVYHQDLKLVESRFYKQATMPGAALIKQALYDGLLLMKVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ROK family transcriptional regulator, homolog of E.coli MLC protein.
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transcription
molecule keywords transcriptional regulator, ROK family
total genus 137
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z05A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A03
1T2KA 2FF3B 3KHYA 3ZMUA 3H3NO 1HKTA 3R6MA 1J2XA 5DCFA 3VETA 1MDUB 1YVNA 1NGGA 2O8XA 2YHWA 4M73A 2TDXA 2VT2A 3DJCA 5D5UB 4MEYF 3QB0A 5EY4A 4LB5A 1T6CA 3ZETB 2HGCA 1XCBA 4IRGA 3WTSC 1HKSA 2FSJA 4P5OA 3RYRA 3GYHX 4H0TB 1P6RA 4GYGA 3BUZB 3DAWA 3H6EA 2YU3A 5EOYA 1IN7A 3HRMA 3COAC 3VEOA 1J0RA 2RKHA 3LDLA 4PL7A 1FC3A 5HDKA 3GFMA 1NBWA 3IC7A 3Q9SA 5AQYA 1R23A 3EYYA 3CQYA 2JRTA 4ZYDA 3CI5A 3RIRA 2PMHA 4RB0A 1HKBA 3ZMSA 2DFIA 4BHCA 3TOBA 4PKIA 2V52B 5H20A 3MK6A 3QICA 1TQPA 3J7AO 2FE3A 3ISPA 1HJOA 5FPNA 3BF1A 3DXKB 2ISYA 4L5IA 5LEKA 3C1DA 1W5SA 5HLGA 2EFWA 1P92A 1IZ1A 1X9JA 5JLHA 4MO4A 2P9IB 1IF1A 2P9SA 3U4LA 4B9QA 4MEXF 3KZYA 2QWMA 4IWVA 2AA4A 5L3BA 3K69A 1BBYA 3O5BA 4WQ5A 3I33A 4EHTA 2MBFA 5BPNA 1MGTA 4Y0WA 4AM7A 1LOTB 3SJHA 1ZG3A 1YW7A 4D0PA 1HSTA 2D0OA 1KAYA 3O2PE 3MCZA 4FWOA 1T6DA 5BR9A 5LJWA 4BRFA 4PCQA 3O6BB 2EB7A 3ZEUA 1D8KA 1H9GA 4A0ZA 2PJPA 4RGRA 1V4TA 4LLLA 4M6YA 4Y13A 3DKWA 1R00A 3AAQA 1I1GA 2ZJ2A 3VEYA 3WTVC 3A5NC 3WTXC 5CJ9A 2LNBA 5DD4A 1MDMB 2X0LA 2QM3A 1DEJA 2OANA 4HV6A 1SFXA 4M7YA 3IRRA 4UVBA 1GXPA 1ESVA 2EA2A 5JR3A 2IA0A 2IVNA 3D0SA 3UE5A 1BDGA 4L5JA 3DQVC 1ON1A 2HDCA 2QWLA 3SHFA 4M74A 5HS7A 3KFWX 3TO7A 2A07F 3R60A 2R3SA 4HTLA 1IN5A 4JD2A 1SZ2A 2VC0A 2FMLA 3GW2A 3KZZA 3R9PA 3IUCA 2IA2A 3QP6A 3CO7C 3WUHA 2PLYA 4ZYEA 1U5TB 1SD6A 3K9TA 3M8FA 1WSUA 1T38A 2DU9A 2CWEA 4R8HA 2GUPA 3CJAA 3ZEUB 2ZCWA 1LB2A 5ADXH 3CDHA 3IHUA 2QBYB 3WXIA 1O7LA 4XLPF 3FMSA 4OU0A 2QBYA 3ID8A 4FO0A 2HYFA 2P9UB 1HUXA 1IG8A 3I54A 3JW4A 4M63C 1E4GT 1P2FA 2DW4A 2GAUA 3RKXA 4BXUA 4BRAA 4A62A 1MJ9A 3BPXA 2XKPA 4BH9A 3ENHA 3HRSA 4CXFA 3GDQA 3QFUA 1RZ4A 3LSTA 2FXUA 1ZREA 2A6AA 5A2QK 4I7HA 2QVOA 2CGJA 4MTEA 3C3WA 3VGLA 1UB9A 2V1XA 1K78B 3J8AA 3R6SA 5FPMA 4G6QA 4OIRF 4HX8A 3RSEA 3V7RA 2E2OA 3CUOA 5ED4A 2YX4A 1R58A 2ACJA 3I5UA 5HS8A 3EN9A 2IIRA 2AXLA 1ATNA 5BREA 5D6EA 3WXLA 2NRHA 3GZ6A 4CZJA 3M3ZA 4KA4A 1PP7U 3AARA 4O5VA 1GLCG 3VFZA 1SQKA 1BA0A 4FPAA 5AZIA 1EV7A 4I6MA 2VN2A 4RGXA 1IN6A 2XROA 2GXBA 3WXJA 1BU6O 3EKUA 1J5YA 2IP2A 4FWPA 1U8RA 2IT0A 1XGNA 1QZ6A 4ZYGA 2CGKA 3P9IA 3HYIA 2FU4A 2BUPA 4BR2A 1ATRA 4E70A 3LAJA 2W57A 5EX5A 2DLLA 2DO7A 2A69F 5ILVA 2G9WA 5CE3A 1G3YA 1LJ9A 1S22A 1EQYA 4CBUA 5JI6A 2H6BA 3JSOA 2GWJA 3V8KA 2OZ6A 5IT9K 3HTSB 1XC3A 4EAHD 2FBHA 2FLOA 5KPTA 5DUIA 4IHSA 1BJAA 3WXKA 2RNJA 3MMVA 5HVQC 3FXUA 3E5UA 2HKXA 5AQHA 3D2EB 2QENA 1FYLA 3VESA 2VCPA 5LGTA 3KP4A 3G25A 5F1XA 3HHGA 4CGZA 2CQKA 4PKHA 4HDUA 2XASA 2H94A 3SK3A 1Y64A 1DPRA 4P9UA 4A2BA 1K8KB 5E17F 3CJ9A 4RWTA 1G4DA 1YYVA 3S41A 1RFQA 4NB4A 2P9IA 4ISFA 4YFNF 1XSDA 2LF7A 3EDPA 1ZGAA 3KCCA 3A0IX 2M87A 2E1NA 1JXSA 3ZN1A 1WOQA 2EWSA 2RVCA 4H0VB 4IO8A 2FQ3A 2I7NA 2VE8A 2P6SA 4HF1A 3OV8A 4K25A 1F5TA 1T39A 1QPMA 3L9FA 1BC7C 2K02A 3QP5A 4ASNA 3QPHA 1SAZA 3DP7A 1V3FA 1JHHA 2Z5UA 4A5NA 4UVCA 4Q48A 3ZMTA 3CJCA 2DPDA 1TTYA 5I9EB 2XIGA 1W7PB 5AQFA 3VEWA 2VBXA 2VODA 4EIAA 3TPQA 3L4IA 1BIAA 4A5MA 1HKGA 1STZA 1YQAA 2ZGYA 5FFZA 4HX4A 2Q31A 1K6OA 3HBTA 1IRFA 4H0EA 1J59A 4ZH4F 5EEGA 4XLNF 2EWNA 1T98A 2EJRA 4BRQA 5H6RA 2VOPA 2XAGA 1J75A 1BOAA 1IN8A 4ENJA 2LSOA 2Q0RA 3AY9A 5FLXZ 3O3KA 5FGMA 4EMSA 1NMDA 3ECHA 1ZHFA 5AQPA 4BRHA 1BI2A 2L02A 1FP1D 1HQCA 1ZC6A 2E8AA 4BR7A 3R0JA 4AWXB 1FSEA 3S2WA 3L2CA 3E6DA 2GTDA 2L01A 2HEOA 4WX9A 4IRIA 1LNWA 1GXQA 4FWQA 1S8NA 4U7DA 2LF8A 2YHXA 2QQAA 5ELZA 4IXAA 2F5FA 3Q9VA 3VEZA 4CDGA 1WQ2A 4BVPA 4L0YB 4PDKA 5AQUA 3O8MA 3J81Z 2P8TA 2XGXA 3U9DA 4BR4A 4UUVA 3V7CA 3GFLA 1NGHA 3MQ0A 3T0YA 2OZUA 4R79A 1KU3A 4K41A 2E7WA 1ZXOA 3MWMA 4PGHA 4FWKA 3V4GA 3FZFA 1FSHA 4CZGA 4EJOA 4DCHA 3WEEA 1WKMA 4JK1X 2CW0F 1XDUA 3IL2A 2V79A 1GLDG 2W84A 1QHAA 4AIJA 2WC2A 3D2EA 3I71A 1K78A 2Q2EA 5BPDA 4N0BA 4HAMA 1GLBG 2ZBKA 2BGCA 1Z91A 3U2RA 1QQNA 1K8KA 2ZNYA 2F5EA 3VERA 4QLCU 2K27A 5E84A 5HLIA 4UHTA 2FXAA 5LY3A 5E8IA 4CZZA 2QW9A 2CSOA 3KP6A 1USTA 2Q0OA 3FXRA 5AIQA 4JQFA 2NLXA 5JFRA 1FY7A 2VBZA 5FPEA 3HI0A 5ICGA 4PZJA 2CG4A 1XSXA 5FLXK 3P9KA 3I0TA 3ULQB 4NHJA 3FXQA 4CBWA 3RPUA 4K2EA 1CGPA 3MZHA 3ECOA 1YXQA 3QFPA 2STTA 2XRNA 2Z99A 4H0PA 5FPDA 4U0YA 2FA5A 3R61A 3W6JB 2KIUA 4L3QA 3EQLF 1W5TA 2QWRA 2Y0MA 5K1YA 1UFMA 4FWNA 1U5TC 3R4KA 3L6QA 1TLHB 4FWLA 2P4WA 2Q2RA 3QAHA 2ADUA 4KIGA 3BWGA 1IUYA 5IT3A 3FX3A 3EZWA 5CVJA 2P5LC 4G7ZF 1MDMA 4G7HF 3FZVA 3WODF 3BROA 1HLUA 1KAXA 2VC1A 5BMZA 5E1ZB 5KVRA 5TKYA 4AM6A 1B1BA 1NLVA 3FZKA 4BRLA 2W24A 1FLIA 4Y17A 2IRFG 1E4FT 5FD6A 5D4RA 5FB2A 4BRNA 1U2VB 3I59A 4I98B 2R7DA 5FO5A 2EFQA 1ZRCA 2O61A 4HLXA 2HOEA 4LG0B 1SD7A 3GX4X 4M72A 4CHUA 1B9NA 2O03A 3FE1A 2H27A 5L3CA 5F1RA 4RAYA 2M30A 3ABTA 3TQNA 2ZNZA 2ELHA 4EGZA 2D4WA 4PL8A 2W40A 6PAXA 2HQRA 3FZHA 3H3ZA 4UV9A 4GO1A 1ODDA 3B8AX 3ULEB 1QQOA 3SZPA 2A5XA 5AQWA 1GLJO 3B73A 3CO6C 2LKPA 4XH5A 3A8YA 2QQ9A 3GL1A 2E2PA 2JTVA 2JPCA 3H92A 4IRHA 1NHAA 1IXSB 2VT3A 4CZHA 4G9YA 4LJZF 1R59O 4BRMA 3MDQA 1KQ0A 2A61A 4LK0F 4CD1A 3LDNA 2FSKA 3U8XA 3H45C 2FSWA 1TNTA 2FBIA 5D4SA 3J81K 3LWFA 3QOPA 4ENMA 1FBQA 1LEBA 2W41A 5AZJA 4FWMA 5ICEA 5AQVA 3HRTA 4Q5SF 2FF6A 3CHWA 4WK8F 5HS9A 4CZKA 3O80A 3I64A 4G6DA 2E1YA 3D2FA 2IA1A 5AZIB 2QLZA 2P5KA 2EV5A 2KJCA 4XEIA 2QQBA 5BRDA 3HRUA 2PI0A 1NGIA 2J4RA 1Q18A 4ZZLA 2V51B 4ISEA 4BRIA 1LDJA 4A61A 3WG9A 5TJJA 3ZMZA 3F8NA 3HSEA 2JSCA 4LMYA 2YCHA 2NAZA 2PAVA 4MLHA 5AQRA 1W7PA 1C0WA 3M1FA 1IAWA 4LC9B 5AQXA 1NGFA 4KICA 1FWZA 4G8XA 3HZ6A 4NQWA 3O6WA 5D6FA 1G3WA 1AOYA 2X4HA 2D0PA 2NS0A 2V7ZA 2FF4A 3KLNA 3L00A 3BJAA 3ML6A 2D45A 4TV7A 1HBXG 4HWIA 4IVNA 4HYEA 1BUPA 3C7JA 3LQRA 4H0XB 5AQLA 5L3FA 2QWQA 4EFHA 3BP8A 4KFCA 4FOIA 3VOVA 1TYQA 3FWEA 3QU3A 2K86A 2F5DA 5BOXA 1ATSA 2D1KA 3D2FB 5EXWA 1IN4A 3VEPA 3LQQA 4M9XA 3K1PA 4AVPA 1CF7B 2OA4A 4MHGA 3CUQA 2MLKA 1EH6A 4HF2A 3HIFA 5JHUA 2IVPA 1P4WA 3F6OA 4HOBA 2VE9A 3VOEA 5LLQA 3G73A 2GA1A 4L9JA 5E20A 1USSA 1QNTA 4LG0A 3JTGA 4KNYA 3GZ5A 2FOKA 4JN4A 4BREA 2M1BA 1LDDA 3MN7A 4BGAA 2OQRA 3KLOA 4DB3A 1IXRC 2XVCA 5ICCA 2PMUA 4S04A 1U78A 3JTHA 2V7YA 4H5WA 1FZPB 2L4MA 2EK5A 1U6ZA 3QMLA 3U9ZA 4KMFA 2KKOA 5AQQA 4BC4A 5TRDA 1LQ1A 4HZFA 4CZEA 5AQOA 4L9NA 3L7WA 2Z33A 2CH5A 2QM1A 5IT9Z 4YIFA 1ZLKA 3W3DA 3E5QA 3HUGA 1OYYA 2YPRA 3F21A 1FBUA 5AQZA 2E88A 5DEQA 2CYYA 4ENNA 4CZMA 2V1UA 2YHYA 1FYKA 2BTFA 5KQ8A 4QS8A 3DPLC 1TW2A 2QXLA 1BI3A 3BF3A 3LDQA 3VGKA 2QWOA 1RDWX 4A6EA 3F3XA 3VEVA 4U0VA 4B1XB 1Z6RA 3KP7A 3RKYA 3IFRA 4HV5A 2J5PA 2RC4A 3BPVA 3E3VA 4JBAA 5D8KB 3KVGA 4AD9A 1MWMA 2B0LA 3GUDA 4K43A 2H6CA 4HX7A 3TOAA 5AZJB 3SMSA 1ZH5A 3M6GA 3TKYA 3O1BA 1NGJA 1NWKA 4EGYA 1YLFA 3E6CC 4BR0A 5CVUA 2FEZA 4B1UB 4JHDB 3GFIA 3LM2A 3H1QA 5ICFA 1S3XA 1MJAA 1V4RA 2Z9OA 4BHBA 4HQEA 3WTZA 3RKWA 4OIPF 3IWFA 1H9TA 4R1HA 2M45A 1K79A 3KEOA 4QWQA 2VYPA 3LA7A 2D2WA 1R5GA 1BIBA 3FZMA 5LRSA 4M9SA 1P4AA 2CGPA 3M8EA 4OIQF 2PG4A 1D4XA 1NGEA 2VBWA 3LDPA 2J5OA 3QBXA 1DGKN 1XD7A 1XSVA 3KZBA 5AQNA 4IJAA 1T6SA 4BR5A 3K0LA 5LHGA 1D3YA 3ULEA 1O57A 2PEXA 1O3TA 4WQ4C 1XGMA 3C7NB 1ZRFA 2ZO4A 4P96A 3RI4A 4BQZA 1OR7A 2K4BA 3T5XA 1H1VA 2QWNA 3F9MA 2HFHA 2WV0A 5AFUA 2RQPA 3TDUC 1HW2A 2HR3A 1TYQB 3A5OC 3HOSA 3IRQA 1HSJA 2P9KA 3RPQA 2RV8A 3GEZA 2HZTA 1XN7A 2ESNA 1G99A 1UHWA 1Z9CA 1X3UA 3CUQB 2ASPA 4ESFA 4C23A 1E17A 1X3NA 5F6FA 2Q36A 3E6BA 4OOIA 3FM5A 2STWA 2FNPA 4CZFA 1WWXA 5AQMA 4HF0A 3REOA 3G3ZA 1FYMA 5J6XA 3WTYC 5BN9A 5DCMA 1DP7P 1D5VA 1OPCA 3WE3A 2F9TA 2FBKA 4FHTA 3HTVA 3VF2A 1TNSA 2V1DA 3AAPA 3BEXA 1F1ZA 1ZLJA 1B59A 5CLSA 4B8XA 2W85A 5ILSA 2O0YA 3IWZA 2GZWA 3WE2A 3WGIA 3ROUA 1MWKA 3F8MA 2BBYA 2GWKA 3FHZA 1XUPO 3WGGA 4OMYA 2FMYA 2AP1A 1ZN2A 3WQTA 5AFUH 4BNCA 2OQGA 1P4XA 3HSRA 4B1VA 3RSEB 2JT1A 1Z1DA 3CLOA 5L3EA 2QYOA 3ATUA 3ZX0A 5AQSA 2P9LA 3K1MA 1FX7A 3ZETA 1G3SA 1GLLO 5AQJA 3IKTA 5BPIA 2JZYA 1EH7A 2OD5A 2QWPA 1XB4A 3KETA 3PQKA 4L9VA 3DXJF 4OMZA 2UWMA 2HF3A 3LFKA 2VBYA 3OOPA 4HA8A 4I6MB 1NGDA 4B1YB 2IVMA 1DDNA 3ZQ7A 2DTRA 5KPZA 3F22A 4IXCA 4CYDA 3IKVA 2HWVA 1C0GA 2DBBA 3I53A 3GWZA 3KEQA 2HTJA 1PP8F 4LB6B 4B1ZA 1LEAA 2RDPA 4NB5A 5D8LB 5LHIA 3VF4A 4S05A 3VGMA 4ESJA 2P9PA 4RS8A 3V8JA 4MQVA 3EO3A 4O5FA 3U9GA 2P9PB 4BQLA 5HDGA 1A04A 1R36A 4FL9A 4EJVA 5AQKA 1S7OA 2A68F 3LAPA 4A12A 1J7KA 3E6MA 1JGSA 4I09A 3ZX3A 4BC5A 2L3DA 1CZAN 1BN5A 4HBLA 2EV0A 1YW8A 3SQNA 2DPUA 5EEHA 2A41A 3A5LC 4I0AA 4YIIA 1F9NA 4KN7X 2CO5A 1QZ5A 4J8FA 1BC8C 4KBOA 3BOQA 4RB2C 5J8CA 2MD5A 1BA1A 3DXMB 3MN6A 2NYXA 4ENKA 4N9IA 1VTNC 3QDKA 1YW9A 2MH9A 1G6NA 1R5HA 4H0OA 2BV6A 3F8FA 5AONA 5D5WB 4MTDA 4QS9A 1XDSA 2EFPA 1T0FA 1XMAA 2L4AA 5HLHA 4OIOF 2GXGA 2IPQX 5CYVA 3TO9A 2XUBA 1Z7UA 1U2VA 3ZPLA 3ATVA 3M7GA 5DV5A 1TUUA 4IPAA 3GO5A 2E1CA 3C0BA 4A0XA 2OU2A 3WU1B 2IJLA 2YJFA 1YO5C 3P9CA 4Q47A 1HX1A 3I58A 3WTUC 1NGAA 4GYIA 3NQOA 2E1ZA 2YR2A 1KU7A 2V9VA 2DPNA 4LLGF 2XAJA 1K7AA 2NZTA 3N97A 5CVIA 1R1VA 2YI1A 4OINF 2OBPA 4KMUX 2XHKA 4M71A 1U3EM 3FLCO 3CETA 3EKSA 3ZX2A 1Z05A 2ZFWA 3GF2A 2UZKA 3VB2A 4ZZDA 4Y15A 3HSFA 1J9IA 1JCGA 2HYGD 2ITMA 4P9FA 2HMPA 1W7PD 4FOEA 3SLCA 3ZP5A 1Z6TA 2COMA 2HTSA 4QS7A 1U6GA 5LHHA 3KP3A 3HM8A 3GE1A 4H03B 2Q8KA 1OKJA 2KRFA 3F8CA 3DF8A 3L09A 2P9LB 1YG2A 3EUHA 3WTWC 4CBXA 4YFKF 1F4KA 1HW1A 4FPBA 3H3UA 3O4WA 4EJWA 5LGUA 4I2OA 1GHCA 1S3JA 5ADXA 1SD5A 2HF4A 3P4IA 4WXHA 3V7SA 4AIHA 1NGBA 4GNIA 1ZG5A 4P55A 2PFBA 4M6XA 2EFNA 3TGNA 3Q5FA 4WQ4A 2M5WA 1X3MA 1S29A 3M1EA 3LM9A 1S7AA 2CFXA 1B4AA 4U7BA 3IDHA 3RJPA 2D1VA 2DI3A 3OHRA 4ISGA 4B1WB 2A6EF 4GGGA 3PQJA 3J80K 3R8EA 2UXNA 1OYWA 1BI1A 3MAJA 4UXNA 3J80Z 4FX4A 2DK5A 4YG2F 3WEEB 3EETA 4EJUA 2Q1NA 5BS6A 3UKUB 5H6QA 4Q4ZF 3H46O 4U0WA 3DEUA 1UHMA 1WRJA 5LBQA 4BC3A 3FMRA 3K2ZA 2DK8A 1WI9A 1SMYF 1BO5O 2P7CB 1OMIA 3DXMA 2Q0UA 2ISZA 4M7XA 3RYPA 1REPC 3D7EO 3MN9A 5LEJA 3KP2A 2NNNA 2BYVE 4RAZA 4FWSA 1L3LA 3ERED 1IXCA 1DPUA 5BPLA 1GVJA 3V8LA 1FNNA 2XAQA 1YS6A 4CZIA 3QBWA 1D8JA 4EM1A 1YTYA 1TW3A 2VONA 3VENA 3MN5A 1ZRDA 4E1JA 2O6GE 5K5OA 3VF6A 3FM3A 4FSVA 3T1BA 3CUQC 3CERA 1L0OC 3U1DA 2DT5A 1B6AA 2E7XA 2YJEA 4WQ5C 2ASMA 2PBIA 4YDUA 3F6VA 4XSZF 1I6XA 3JXUA 2IW5A 5JVTA 2QUFA 4KUMA 2D1HA 2P9NA 4K42A 1QGPA 2P9NB 1J6ZA 1QQMA 5JLFA 3P7NA 1E2XA 4NO7A 3B02A 2CGLA 4KIBA 4IHTA 2NNYA 5LJVA 4I02A 2C6YA 3FR0A 4YFXF 4BG9A 5J8FA 1MZBA 4BVOA 3D5LA 3JAMK 4MGRA 1IJJA 3N4MA 5CVRA 1ZBSA 1GLEG 4L9TA 4XH4A 1SD4A 1KU2A 1LVAA 1FOKA 2H09A 1QZYA 1XCVA 4GXOA 4CI6A 4BHPA 3KP5A 2GEMA 2ETHA 1IW7F 4UVAA 1ON2A 4RGSA 3R0AA 2ZXJA 3WGHA 2DAOA 2VWBA 1TQMA 4CZLA 1QBJA 4BG8A 4EHUA 5L3DA 1MD0A 3UKRB 4RGUA 3FZLA 4N9HA 4JHDA 1KXPA 4UNOA 4ZYHA 1GLAG 5FFXA 4KYWA 4KIFA 2VOOA 3IMXA 1BWFO 1SMTA 2DQLA 4A2UA 3ELKA 1ONVA 5BQTA 4FT8A 4KT5C 4U88A 3WT0A 4H0YB 2GWRA 3GLXA 3JS6A 3I4PA 2XKOA 4FWRA 1MA9B 3FF5A 1TBXA 4CO8A 2AS5F 1R22A 2XAHA 5FD5A 5E1XA 3F23A 2M8EA 1ZYRF 2HQNA 4BQAA 3HHHA 2A40A 4MNUA 4HQMA 2EV6A 2GIVA 1XGSA 1NM1A 4XBFA 2JPBA 4I0BA 4EVIA 5AQGA 2F2EA 5K5RA 2RGVA 3F72A 2P7VB 1HXDA 5DDGA 3HTUA 4IF4A 2WUSA 3UKRA 4H5NA 4L18B 2K4JA 4KN4X 2KIMA 1BOTO 5ERIA 4O3MA 2K7LA 1KGSA 1R7JA 1Q1HA 1V4SA 4G7OF 5HDNA 3O1WA 1T44A 2E2QA 2UYTA 3SXYA 1U2WA 3ABUA 2ZMEB 3MEXA 2A3ZA 2MH2A 4RTFD 1O3QA 4AIKA 3DPTA 2PQ8A 2EFOA 3QPTA 4GCVA 1HPMA 3PFIA 4MQ9F 1JHFA 3TU5A 2Y48A 3NRVA 4LK1F 4HLYA 2MC3A 4BRKA 2ZKZA 5D5XB 3WTTC 3K1NA 4RB3C 4BRCA 2A42A 3CJNA 3FGUA 4UV8A 5E26A 5CVVA 1RI7A 4HDVA 2ZF5O 3E5XA 1JCFA 3VPZA 1BG3A 4YDUC 1XGOA 3A5MC 3CIPA 2UXXA 3GG4A 1PUEE 4WWCA 2P9SB 4O8KA 5AQIA 4BC2A 2XV4S 4XRFA 3DFGA 4KDPA 5LGNA 5EVZA 1LDKB 1R1UA 5AIPA 3RDIA 1RUOA 2ZMEA 1GLFO 3UKUA 5BN8A 3C18A 2QWWA 2FRHA 2G7UA 2A5YB 3FFKB 4RCHA 3I8BA 4IZ9A 4O6JA 1ZGJA 2MLGA 5D5VB 4WCGA 1I27A 4PGGA 2ZWHA 4XH1A 4B09A 4WXCA 4A6DA 3TDZC 2KHOA 2H3GX 4BGBA 2ESHA 1YIOA 3WQUA 1HKQA 3T8RA 1C0FA 1FBSA 5F2RA 3W6KB 4I01A 4RB1A 1PDNC 4H5RA 3LL3A 5ILUA 3KE2A 3SZTA 1XQSC 3VODA 3SFZA 4GY2B 4DQ2A 3SMPA 1XMKA 1RGIA 3NEUA 3JAMZ 4MLEA 3DXKA 4F7ZA 3EYIA 2F9WA 4Z94A 1KU9A 2Y75A 3CTAA 1O3SA 2IVOA 1UCRA 1S6LA 1H0MA 3WU0A 2P6TA 4BAYA 2ASOA 5AQTA 1NGCA 2XAFA 2Z3YA 3LA3A 1YFHA 1G3TA 3E97A 2G7HA 3BY6A 3HOTA 4LLNA 5E1WA 2PBDA 2O3FA 5F64A 2GA2A 4L0ZB 2CH6A 3I59B 1RIOH 4H5VA 5DD8A 3BJ6A 4EV0A 1KQ9A 1WUAA 1U5TA 4Z2YA 3DWLA 1EH8A 4BR9A 1HW5A 2E20A 3GFJA 3MZYA 4DNCA 1OYIA 4ETSA 3BJOA 2P5VA 3CJ7A 3EL2A 1JCEA 4JNEA 5L3GA 2DQRA 3GBTA 1KYZA 1I5ZA 3ENOA 5KPRA 3TO6A 3T8TA 2LDUA 4EQQA 2P9UA 4BRDA 4IJNA 5K5QA 3FMQA 1MJBA 2EA4A 3ZMVA 2YX7A 1RUNA 1P8ZA 2A6HF 2WTEA 1SAXA 2MA3A 3GOIA 4PKGA 2F5CA 4FX0A 3GVAA 1I1SA 2E2NA 5KQDA 2L54A 3CJ1A 5BRHA 1TUYA 1TQIA 1ZARA 3BZ6A 2A3SA 5B8HA 1BM9A 1ZG1A 1KAZA 1KYWA 2HKOA 2ZGZA 1FPQA 4CICA 3MFKA 1YAGA 4DQ8A 4JD2B 2WWYA 2W25A 4ON0A 1O7FA 3DV8A 4WYBA 3H3OB 5BRFA 1QQIA 2FNAA 1O3RA 3M9AA 4BRPA 2NRAC 3AAFA 5KK1A 4LFUA 3UB5A 2BE5F 1QZZA 4CJ7A 1ULYA 4BYYA 1ZAOA 1B9MA 5F0XA 2R7FA 4H5TA 3C7NA 2FSNA 2GELA 3H1VX 3RTRA 4JAXA 4CD3A 2YSRA 5HOOA 5A2QZ 3F8BA 4EM2A 1Y0UA 4HW0A 3O08A 3LA2A 1MKMA 1HKCA 2BEOA 5LRRA 1KA8A 3QU6A 2V6CA 2P9KB 2VXZA 4WXDA 3BDDA 3ZMDA 3QRFF 1SFEA 1FT9A 1DKGD 1YS7A 4A0YA 1JE8A 4MO5A 1IRGA 1AWCA 2Q97A 1DUXC 1W4MA 5JMVA 4A2AA 4XSXF 4EJTA 2HS5A 1BI0A 3LDOA 2PN6A 3W0LA 3GXOA 4LD5A 2KIFA 5DUKA 4F9OA 1OKRA 3ZN0A 2KJBA 3MCPA 5DCMB 4M9ZA 3L0QA 4BRGA 4G94A 1FP2A 1QO0D 1RNLA 4BROA 5E18F 4ESBA 2I7PA 2GQQA 3JSPA 3CQXA 1LCUA 3CJBA 1CF7A 1KQ8A 4LGWA 4EM0B 1YUWA 2RN7A 5BPMA 5AR0A 1R1TA 4DHYA 5DYMA 4WF2A 5E8GA 5JICA 2QZ8A 2OAZA 3HSCA 3VEXA 1SFUA
chains in the Genus database with same CATH superfamily
2KDOA 1WSEA 1VQPI 1WNSA 3ZCOA 1T2KA 2FF3B 3KHYA 4I9LA 3ZMUA 4CK1A 3H3NO 4Z4HA 1HKTA 2PJRB 3R6MA 1J2XA 4WCEL 3CCUN 1D0XA 2MG4A 2LFBA 3LOCA 2CUZA 5DCFA 4B48A 1MDUB 1YVNA 1NGGA 2O8XA 2KDZA 2YHWA 4M73A 2L0KA 3KWIA 4BACA 1T33A 2TDXA 2VT2A 2QSHX 2JUCA 3PO2J 1X1CA 3DJCA 2ZJRL 4CEOA 1HYVA 2K3PA 3RQIA 3JRIA 5D5UB 2X6NA 4MEYF 3OSGA 3QB0A 5EY4A 1MIJA 3HL2A 4LB5A 3BTCA 2CV2A 1T6CA 4QIWN 3ZETB 2HGCA 1XCBA 2LYCA 1IV6A 4IRGA 4CERA 2CU7A 5J4YA 1X2MA 3WTSC 3GTGJ 1HKSA 3IKMA 1TGOA 4FZXC 3DWLE 1X1PA 3I4NJ 2FSJA 4P5OA 5TGTA 3KKSA 1EO1A 4Z4EA 5DM6L 3RYRA 3GYHX 3N4PA 5JLXA 4H0TB 3JRDA 1P6RA 4GYGA 2E60A 4ZDPA 1XG1A 1EETA 4XKWA 2YU3A 2QQ8A 3BUZB 3DAWA 3H6EA 5EOYA 2YKNA 1IN7A 3HRMA 1JL1A 4BEHB 3COAC 3VEOA 2OC6A 1J0RA 2RKHA 3I0SA 3LDLA 1X1DA 4PL7A 2M0MA 1SVMA 1FC3A 1V5GA 4U87A 3GFMA 5HDKA 2D0AA 4X62K 1NBWA 1SANA 2HHUA 4NCAA 3IC7A 1F36A 3Q9SA 5AQYA 3ULDA 1R23A 3EYYA 4JI0K 2RHKA 3SQ4A 5DM6F 1D1CA 2JRTA 1IDZA 3VSKA 3CQYA 4RM3A 4ZYDA 1VF9A 1KFSA 4F52A 3RIRA 2PMHA 4KJZA 4RB0A 2QEXI 3ZMSA 1GOAA 1HKBA 3JR9A 1YF5L 4IFVA 3MZ8A 4CEZA 4CFDA 1HCRA 2DFIA 2HXIA 4BHCA 1O1WA 4A3FJ 3OBWA 2DMQA 3HVRA 3TOBA 2JA2A 2JLEA 1RTDA 4TSXA 4CEBA 1SKWA 4AILC 4PKIA 4HRIA 1WI3A 2FBYA 2V52B 3NFAA 5H20A 1HYZA 3CC4N 1RBRA 3MK6A 1TQPA 3J7AO 2FE3A 3ISPA 1G59A 1HJOA 3QICA 5FPNA 2IDOA 3QETA 3BF1A 4CIFA 4B44A 3DXKB 2ISYA 3OR1C 3QODA 1VQON 4L5IA 1WLJA 5LEKA 3C1DA 2R5ZB 2JRMA 1W5SA 1RT1A 5HLGA 1WGXA 1W9HA 2EFWA 1P92A 1IZ1A 1X9JA 2HVHA 3CCVI 1QHHD 5JLHA 2M4KA 3BZKA 4FE7A 3HEFA 2P9IB 1IF1A 1GVDA 2P9SA 2RN2A 4MEXF 3U4LA 3KZYA 5GPAA 4B9QA 1Q7YO 3S1RJ 2DOEA 1KVAA 2QWMA 1PJRA 4IWVA 5M1PA 3RVCA 3VTHA 4DV5K 2PZSA 1P9QC 5FJ8J 2AA4A 5L3BA 4PHTX 1Y8RB 1UG0A 3IAS2 3K69A 3K4MA 1WBBA 1BBYA 4DBRA 3O5BA 1VQNN 4WQ5A 4A57A 1RRJA 1T3VA 1N5YA 3DYAA 1VQ4N 2HHWA 1HOMA 4IEEA 3I33A 2OPSA 2DMNA 2CUEA 3E1YA 1R6RA 4EHTA 4BKXA 2MBFA 5A2QO 4D5FA 5BPNA 1MGTA 3DTIA 1V54H 2X1CA 3IH3A 2GOMA 4IL6C 4Y0WA 3ZT2A 3PNTA 4JI7K 4AM7A 4C3JJ 4BEHA 1LOTB 4CCMA 2HBKA 5IYBJ 4CJ3A 1JXEA 5SWMA 5IOYA 3SJHA 3CM5A 1ZG3A 1YW7A 2PMZA 2ZMEC 4BWMA 4BQQA 1UAXA 4D0PA 1FEXA 3Q0WA 4IDHA 1HSTA 1XNQK 4ELUA 1X4OA 3FDYA 2D0OA 2G0EA 4C30A 1KAYA 3TAQA 2KRCA 3O2PE 3MCZA 4A3BJ 1LW2A 1T6DA 4FWOA 5BR9A 4BRFA 3SBTA 2YNIA 2B9SA 4DLGA 4PCQA 5HRNA 1JGGA 3O6BB 4E7ZA 2IXSA 2EB7A 3DOKA 4D1QA 1X9WA 3ZEUA 1N36K 1ZGWA 1D8KA 5HRSA 1H9GA 4A0ZA 2PJPA 3PX4A 2NOJB 4C9YA 4RGRA 4BQOA 4Z6YA 2HXOA 1V4TA 4DTPA 4LLLA 4ZJZA 4M6YA 4Y13A 3DKWA 4XN0A 1R00A 2A05A 4RAGA 2X6WA 3AAQA 4XOPA 1I1GA 1IDYA 2QCOA 2ZJ2A 1S6PA 1X3ZB 3WTVC 2VWKA 3A5NC 3WTXC 3VEYA 3VYSB 5CJ9A 2LNBA 4LH5A 5DD4A 2JN6A 4OAZA 4UUSB 1B8IA 4XICA 4YFUA 1JLFA 1MDMB 2X0LA 2QM3A 2KPMA 1C0MA 1DEJA 2OANA 4HV6A 1SFXA 4O8UA 4M7YA 2M3AA 3QOEA 3IRRA 4UVBA 1GXPA 2H8RA 1ESVA 2EA2A 1FOWA 2IA0A 5JR3A 2IVNA 2AXTC 2Y0SN 2CQXA 4DGWB 1D1AA 3CCRI 3D0SA 3UE5A 3TAEA 2L9VA 1BDGA 4L5JA 3DQVC 4JK7A 1ON1A 2HDCA 1WJCA 3S3NA 2BXYA 4E7HA 2QWLA 3MVPA 4QAGA 4XORA 3ZT1A 2ZB9A 3TP0A 4F3QA 3SHFA 5TISC 2JGUA 3NAEA 1VQ6I 2VQFK 3VETA 4MFDA 4M74A 5HS7A 3V9WA 3KFWX 3TO7A 2A07F 4KHYA 3R60A 5FRNA 2R3SA 2IAJA 4O0IA 4HTLA 5C4XJ 1IN5A 4JD2A 1SZ2A 2VC0A 3DPUA 4O5BA 2FMLA 4ILHA 2DOAA 1YIJN 2ID3A 1ETQA 3GW2A 3KZZA 4QTRA 1ETXA 3R9PA 4CHNA 2I10A 3IUCA 2IA2A 3ZT0A 1SL1A 3QP6A 3CO7C 3WUHA 1RBSA 2PLYA 4ZYEA 2G8KA 4BDYA 1BQNA 3KZIC 4JP0A 4CA0A 3PIPF 1C6VA 1U5TB 1SD6A 5K7HA 4AHVA 3K9TA 3M8FA 1WSUA 1T38A 4ILGB 4CECA 2DU9A 3T19A 1X2NA 3PUFA 4A3JJ 2CWEA 2R7SA 5EZHA 5CY4A 4R8HA 2GUPA 1GDTA 3CJAA 3ZEUB 2ZCWA 1LB2A 2O8BB 3UNGC 5JHFA 5ADXH 4B9VA 4Z4FA 3CDHA 4EP5A 1RDDA 3IHUA 2XSJC 3G71I 2QBYB 3WXIA 2F8SA 1O7LA 5M5XJ 4XLPF 2Y2ZA 3FMSA 1NK5A 4OU0A 3A03A 2QBYA 4FM0A 3ID8A 2OPPA 2ZJPF 2HYFA 1BHLA 5FKLA 1HUXA 1IG8A 3I54A 3JW4A 2P9UB 1D0YA 4RMNA 1E4GT 1RT3A 4M63C 5C12A 4W5QA 1P2FA 2DW4A 4CF1A 3BR1A 4DBQA 2GAUA 3RKXA 4BXUA 5FDLA 2DDAA 1MJ9A 4A62A 2VJJA 3BPXA 4UUTA 2XKPA 4BXFA 4BH9A 2ZD1A 5CZ1A 3ENHA 4DMNA 2W42A 4A69C 3HRSA 4CXFA 4Z4CA 2E1MB 3AG4H 3GDQA 3QFUA 3RKQA 4CHYA 2B4JA 1RZ4A 3LSTA 2FXUA 2FX0A 1Z21A 1NNEA 1VQ9N 4Z0UA 1XMXA 1ZREA 5M5WJ 2DFFA 2A6AA 1NK4A 5A2QK 4X66K 4I7HA 3UKGA 2QVOA 3S16J 2CGJA 1X9SA 1T56A 4MTEA 3C3WA 4BGDA 5HBMA 4E0DA 3DOLA 3VGLA 3K10A 1R5ID 4HG2A 1P90A 1YJWN 4O55A 3U3YA 1UB9A 2V1XA 1T7PA 1ZBLA 3LNQA 2R7TA 5GPCA 1K78B 3J8AA 2IGNA 3R6SA 3H9GA 2LKSA 3D45A 4G6QA 4OIRF 5FPMA 4HX8A 2Z1JA 3LP2A 2GOXB 3QINA 4A3EJ 4BU2A 1J54A 1WPKA 4BE2A 3RSEA 3V7RA 2E2OA 4CHOA 3LSPA 3P31A 2LP0A 3CUOA 4DWIA 1M1EB 1N78A 2ZQBA 5ED4A 3BTJA 2YX4A 4J2AA 1R58A 2NUBA 2ACJA 2OV7A 3I5UA 1MBJA 5HS8A 2PFUA 3A4CA 3FXKA 4PWDA 3EN9A 3AVAA 4K8ZA 1TL3A 2IIRA 2AXLA 1ATNA 2IGIA 1MSFC 5BREA 5D6EA 1OVQA 3WXLA 3G1LA 3LSGA 4XR6A 3GZ6A 2NRHA 1SFOJ 4HTUA 4CZJA 1TP4A 1BW6A 3M3ZA 5M3FJ 4KA4A 1PP7U 1RESA 3AARA 4AHCA 1YI2I 4O5VA 1GLCG 3VFZA 1FKOA 1SQKA 1BA0A 1OLTA 1VSIA 2HBJA 4CCOA 3NVMA 3BR2A 2VKVA 4FPAA 4CJVA 5AZIA 3THXA 1EV7A 4I6MA 2VN2A 3CG7A 3AFHA 4RGXA 1IN6A 3V1RA 4LF7K 2XROA 3MXMA 2Z16A 2GXBA 1JLGA 3WXJA 1BU6O 1IRZA 3EKUA 3KX2A 1J5YA 1V5FA 2IP2A 2JWLA 4FWPA 1U8RA 3VQ4A 5E3MA 2IT0A 4LF4K 4BBSJ 4H8KA 1XGNA 3TMOA 4HVJA 1QZ6A 2I5JA 4ZYGA 3HBLA 2DA5A 2BHYA 3P9IA 3HYIA 2CGKA 2FU4A 4G1QA 3VTIA 2BUPA 5IWAK 1B92A 4BR2A 1ATRA 3K58A 2BANA 4E70A 3LAJA 4CJUA 3HXMA 3CCJI 2YNGA 5FLMJ 4CE9A 2UU9K 5C10A 4YOXA 4CZCA 3LWMA 2W57A 1NK0A 5EX5A 3U6FA 2DLLA 2OA8A 4DV0K 1WB9A 2DO7A 3T3FA 4DS5A 2A69F 1K6YA 2G9WA 3OWTA 3FBIB 5ILVA 4LSNA 3VQQA 2LY1A 5J2MA 1FJGK 3FK7A 5CE3A 4A3IJ 3HKZA 2OJED 1G3YA 2XGDA 1W36C 2P51A 1LJ9A 4B47A 4CJRA 2G8UA 1ZBHA 1S22A 1EQYA 2K5CA 3K4KA 1YE9A 1OJLA 4CBUA 1ETYA 5JI6A 3KIOA 2H6BA 3JSOA 1R0AA 2GWJA 3HO1A 5AJ3K 2X48A 3PNVA 3V8KA 1S9GA 2EZKA 3VA0A 2OZ6A 5IT9K 3BG5A 2QKKA 1JTYA 2M8GX 3HTSB 5J3LA 1XS9A 1HR0K 1XC3A 2DFHA 2DA1A 3C6HA 2K85A 2MW8A 2F5VA 2FJ1A 3QPSA 2FBHA 3AVGA 4B08A 4EAHD 2FLOA 3DLAA 5KPTA 1ETOA 3KPHA 5DUIA 1N77A 5HNFA 1O4XA 4IHSA 1RBVA 1BJAA 3LSMA 3S32A 4KKOA 3WXKA 3ZQIA 3NCIA 2RNJA 2UV1A 3MMVA 5HVQC 5HRRA 4DR3K 4FK2A 3FXUA 1W0HA 2WBMA 3E5UA 1MMNA 2DA2A 2HKXA 5AQHA 3OA9A 1OCPA 1QS4A 3CCLN 3D2EB 5F0HA 2W00A 3I55N 2MFZA 3GTLJ 4B9SA 5EJCA 3V6DA 2QENA 4WF9L 1JUPA 1OQYA 4DZPA 1T05A 1FYLA 3VESA 2VCPA 3K57A 4JRPA 4NXMK 1HRHA 5LGTA 2O8DA 3PL8A 3KP4A 5BNGA 2HDWA 4AYBA 3HHGA 1YRNA 4BL0B 1I6HJ 3G25A 4KV8A 4CGZA 5F1XA 3O3HA 1D5AA 2LD5A 2CQKA 4XLCA 4PKHA 4HDUA 3VQ6A 4Q5VA 2XASA 4AQYK 1TK0A 2H94A 3SK3A 5M3MJ 2YV0X 3QYEA 1Y64A 3DRRA 1DPRA 4P9UA 3AVJA 3DTEA 1K8KB 4A2BA 2DFEA 5E3NA 5E17F 3G0ZA 2VG7A 1N32K 1KZHA 3BTIA 3CJ9A 4E4HA 5M1NA 1JLEA 4RWTA 1G4DA 1BCMA 2EZHA 1YYVA 3S41A 3BGRA 1RFQA 4NB4A 4LF6K 1EA3A 4K0KK 2HHSA 2NRWA 2P9IA 3NGIA 2DDBA 5M1KA 2NVUB 1BCOA 4YFNF 2XPWA 3H3VK 4ISFA 2PJRA 4DU4A 1XSDA 2IS3A 2NS8A 4B9TA 2LF7A 3EDPA 1ZGAA 1ETVA 2HU9A 3KCCA 3G4SI 3A0IX 2M87A 3DLKA 1ASVA 2E1NA 1JXSA 3ZN1A 2R93J 1OR7C 1WOQA 4HSRA 2NVXJ 4BY1J 2EWSA 2F48A 2RVCA 4H0VB 4IO8A 1IKVA 5J1EA 4CFAA 2HHVA 2FQ3A 2I7NA 4DTMA 2VE8A 2P6SA 4HF1A 3THYA 2B7EA 2F6CA 4DU3A 3OV8A 3GLLA 3S3MA 3HXLA 4ITVA 3EZ5A 4K25A 4HCCA 3THYB 1F5TA 2N8GA 3BG3A 3PIPL 1JKOC 1D9DA 2HNDA 1T39A 4HPQA 2M7AA 1QPMA 1TKZA 3L9FA 1BC7C 1X9MA 2X9DA 3CFOA 2MC4A 4OPJA 4DR5K 2K02A 3QP5A 4ASNA 3QPHA 4FASD 1SAZA 2BVLA 4KHWA 2RREA 3DP7A 4DV6K 3OYDA 1ZBIA 1V3FA 1JHHA 1FXXA 2XHBA 1I3AA 3DLGA 2Z5UA 4KTQA 2E34A 1R71A 1L5UA 4A5NA 2FBXA 4UVCA 4IG3A 1BA5A 4Q48A 3ZMTA 3CJCA 3O4QA 1NKCA 2DPDA 1TTYA 2OZSA 1RKWA 1RT6A 1HNIA 5I9EB 4IEIA 4M3YA 2DA7A 2XIGA 1W7PB 3OR2C 5AQFA 3VEWA 3MAQA 2VBXA 2VODA 2GV9A 2WADA 1UJ8A 3O4NA 3TPQA 4EIAA 1DU6A 1AA7A 4C8KA 3KLIA 1BIAA 4A5MA 4RA2A 1STZA 1YQAA 4F91B 1JKHA 4A3MJ 1HKGA 2D0BA 2ZGYA 5FFZA 2E1MC 3OYJA 4HX4A 1SVOA 3BG7A 1H8AC 2Q31A 4DTSA 1K6OA 4RG8A 3SV3A 2KZMA 1NG7A 1XC5A 1TL8A 1IRFA 1W0UA 3HBTA 3HRGA 3JRHA 4ZH4F 4H0EA 5EEGA 1J59A 4XLNF 3A2KA 2EWNA 1T98A 2EJRA 5KAFC 4MO4A 4GFBA 4BRQA 5H6RA 2VOPA 3CCMN 1H88C 4CYCB 4LF8K 1GLNA 2XAGA 1J75A 4LF5K 1BOAA 1IN8A 3IH4A 2X6XA 4ENJA 3J7YP 2LSOA 1XMQK 2Q0RA 3AY9A 3X2QH 2E5ZA 4IO9F 2WONA 5FLXZ 4E89A 3THVA 2LOOA 2KL4A 1QQCA 3BR6A 3O3KA 5K7ZA 2V26A 4JKHA 5FGMA 1NKBA 4EMSA 3THWB 1TVRA 3VQ7A 5M1FA 1WAJA 3HB9A 4OKJA 1NMDA 3THWA 5K7FA 3AO5A 3ECHA 1WAFA 1ZHFA 2IS1A 5AQPA 4BRHA 4KT6A 2LRDA 2COBA 2VJ4A 3J7YJ 4CJSA 1VQ6N 3TSQA 1HNWK 1POGA 4M3GA 1BI2A 2LK2A 2L02A 3H1CA 1FP1D 2MD0A 1DT9A 2QXFA 2PYJA 1HQCA 1ZC6A 2IAIA 2E8AA 5LL6Z 4BR7A 1VSKA 1WSJA 4V2FA 2HNYA 1NK6A 3R0JA 2WY8Q 5E3LA 4AWXB 1FSEA 3S2WA 3L2CA 3E6DA 2GTDA 2WC9A 4DV4K 4DTRA 4NC7A 2L01A 2HEOA 4FJ7A 4WX9A 4IRIA 1LNWA 1GXQA 4FWQA 1S8NA 2ECCA 4U7DA 2OCEA 2LF8A 5GIPA 1R49A 2JSPA 3OJUA 1Q8IA 2YHXA 2QQAA 5ELZA 1GV2A 3EYZA 3TAPA 4IXAA 4HSTA 2F5FA 3E9OA 3DLHA 4V2GA 3Q9VA 3VEZA 4CDGA 4AHSA 3SQ2A 1WQ2A 4N47A 5F0CA 4BVPA 4L0YB 3EPZA 3Q0UA 4PDKA 1HNXK 5HP1A 2KW4A 3O8MA 5AQUA 3J81Z 2AHQA 3OL3A 1KONA 5EG0A 3JRFA 3K5MA 2P8TA 2XF7A 2XGXA 3ZXSA 3U9DA 4UUVA 4BR4A 4I7FA 5F04A 3V7CA 2YNFA 3GFLA 4PJMA 3MQ0A 3T0YA 1NGHA 4KHSA 2OZUA 3BR5A 4R79A 1KU3A 4K41A 2E7WA 1K61A 3JRBA 1ENHA 1ZXOA 2Q1ZB 3MWMA 3N4QA 5KRSA 5E41A 4PGHA 4FWKA 3V4GA 4CJ4A 3FZFA 4OO1J 1OCZH 4AU7A 2XF5A 3FXLA 1LE8B 1FSHA 1VQMN 2BGGA 1VFCA 1ZYQA 4CZGA 1VHXA 4XK4A 4EJOA 4DCHA 3OJSA 3WEEA 1DGWY 2GIZA 2VGNA 1WKMA 3GZNB 1P7IA 4JK1X 2CW0F 2KT0A 4FJHA 3K4CA 4RW8A 1FOXA 1XDUA 1G15A 4M3TA 3IL2A 2V79A 2HVIA 1SVLA 1S72N 2OYQA 1GLDG 2W84A 4JKBA 4FM2A 3NF6A 1QHAA 1WSIA 3S14J 4AIJA 2WC2A 1Z25A 4NC6A 1S72I 3D2EA 3I71A 3H5RA 3AVKA 1K78A 2Q2EA 3BR3A 1LVKA 1NG9A 5BPDA 1Z3XA 1XC9A 2ICWG 4N0BA 4FISA 4HAMA 4ZYAA 1GLBG 4GVEA 4E7LA 4FLYA 2ZBKA 2BGCA 3GTJJ 1Z91A 1JLQA 5IP9J 2Z1GA 4J2BA 2OPRA 3CPWM 3L2UA 2X74A 4ABZA 2JA6J 3TW7A 1YITI 5KGWA 1K9MO 3HVTA 4PK4A 4CIEA 3NDKA 1QE1A 2GXAA 5C15A 3U2RA 1QQNA 1K8KA 3M8QA 3KLEA 2ZNYA 1U45A 3RMBA 2F5EA 2EZLA 4QLCU 1HA8A 3VERA 4C2MJ 3M1CA 5CHIA 4B4CA 2K27A 3EEQA 2KISA 2VJIA 5HLIA 5E84A 4UHTA 2FXAA 5LY3A 2O4GA 1NTCA 5E8IA 2RQQA 4CZZA 2QW9A 4KTZA 2CSOA 3L3UA 1NJXA 4F3TA 3MX2A 2ZJRF 2M4GA 2GX9A 3KP6A 1USTA 3THXB 2Q0OA 4X65K 3FXRA 2H1LA 5AIQA 3TR8A 4JQFA 4X64K 3JRAA 2NLXA 3O3FA 5JFRA 1FY7A 1XX5A 4PJLA 3LSRA 1JKPC 3G71N 3TBIA 4M3DA 1KCFA 4A3DJ 4DSIA 1EXQA 4XMYA 2XDVA 4FJ8A 2VBZA 1TKDA 3VYUB 5FPEA 1WH7A 1LE8A 4MLOA 3HI0A 2OCCH 5ICGA 3CF5L 3V4IA 1TWGJ 4PZJA 2CG4A 1QVTA 1U48A 4ZTFA 4AH9A 1XSXA 1EJ9A 3P9KA 5FLXK 1VSMA 3DLRA 3I0TA 1MH4A 3ULQB 2K9NA 3FXQA 4NHJA 3C65A 4GV3A 4FJ9A 4CBWA 3U3GA 1K73O 3RPUA 3KLHA 1P7JA 3SYTA 4DQSA 1QSSA 3K2AA 3HC7A 1S1UA 4K2EA 1CGPA 3MZHA 3ECOA 1YXQA 3QFPA 4ICLA 2JUGA 1MNEA 1UZCA 3OL4A 3CCUI 1DU0A 2STTA 2XRNA 3SJMA 4DLEA 2IGKA 2HVQA 2Z99A 5SZTA 4Y1CA 4H0PA 4MFEA 5FPDA 4U0YA 2VQHA 2FA5A 2CQNA 2K9LA 3IG1A 1IUFA 3R61A 3W6JB 2KIUA 5FLVA 1XMOK 4L3QA 3EQLF 3NAUA 1W5TA 4P1WA 1IKXA 2DODA 4XIUA 1NJYA 4RW4A 4X0GA 2QWRA 3HYFA 3MD2A 2Y0MA 3WNFA 1VSLA 3H9JA 5K1YA 2PY5A 1UFMA 2JWKA 4FWNA 1U5TC 3R4KA 3L6QA 1TLHB 4FTHA 3TTCA 3WNHA 4QOZB 2HVSA 2HHXA 1TK5A 4FWLA 2P4WA 1Y0NA 3A0BC 5EYRA 2Q2RA 3QAHA 2B5JA 2E2HJ 4B3MK 4KHPK 2ADUA 4KIGA 3BWGA 1IUYA 2YS9A 5IT3A 3FX3A 3EZWA 3ZSOA 3CCJN 3OBYA 1MBHA 3P5JA 4PSWA 5CVJA 1JLBA 2P5LC 4G7ZF 1MDMA 4AIDA 4G7HF 3FZVA 4LFBK 2WY7Q 3WODF 5C0YA 3BROA 2DY4A 1HLUA 3QEXA 1KAXA 2VC1A 5BMZA 1VSJA 1V55H 1WSGA 3AVCA 5E1ZB 3H5NA 5KVRA 2XY8A 5TKYA 4AM6A 3HGYA 2HOTA 4KISA 3TAFA 5CZ2A 1B1BA 1NLVA 3FZKA 4BRLA 2R7QA 2W24A 1FLIA 4Y17A 5EU7A 3AA5X 4YRVA 2IRFG 4HUGA 2LREA 2L5QA 4GVMA 1E4FT 4UY8O 3JCUC 1VI0A 3TAMA 3J7AY 5FD6A 5D4RA 5FB2A 3H0DA 3ZSVA 5HODA 2UUAK 4EZ6A 4LIUA 4BRNA 4DOZA 3RRGA 1U2VB 3I59A 1H89C 3SEQA 3TEDA 4I98B 3HSTB 2R7DA 5FO5A 2EFQA 3AVBA 3BQZA 1ZRCA 2O61A 4HLXA 2HOEA 1NK9A 3K5OA 1IBMK 4A3GJ 3KK3A 4LG0B 1IV8A 1SD7A 3GX4X 4M72A 3ZRGA 2UUCK 1BOBA 4A3KJ 4CHUA 3QO9A 1B9NA 2O03A 2B6AA 3FE1A 3K9JA 1A6IA 5L3CA 2H27A 3SI6A 5F1RA 2A1SA 4RAYA 3E9LA 3IS9A 4E7KA 4Q0BA 2M30A 4Y1DA 4D7MA 3ABTA 3ID6A 5EZGA 3TQNA 4FO0A 5JS2A 1TK8A 2ZNZA 2ELHA 1U9NA 1T03A 1QA6A 4EGZA 4CJ5A 1ILYA 4DFPA 2I8DA 1VQNI 5J1YA 2D4WA 4PL8A 2ME0A 2W40A 1G2HA 1MW7A 6PAXA 5LD2C 3KYDB 3VQDA 1Q86O 2VPLA 2RPIA 3CC4I 2HQRA 2XPUA 1TT0A 3FZHA 3H3ZA 4UV9A 4GO1A 1ODDA 2R7XA 3VQ8A 2TCTA 2GBYA 4DYCA 3B8AX 1QQOA 3ULEB 4XLHA 4D9JA 1XTAA 4CGDA 4DFMA 4UUSA 3SZPA 2WTUA 4GKKK 4RLQA 1WHUA 2A5XA 5AQWA 3TSUA 3JREA 1GLJO 3IUOA 3B73A 3CO6C 4C3HJ 2VLAA 1OCRH 2LKPA 3OIPA 4HNVA 2Y69H 3GCMA 4JYKA 2OTLN 3RCOA 1N34K 4XH5A 2EIJH 3A8YA 1LFPA 2QQ9A 3S2HJ 1ASUA 3GL1A 2A1RA 4J19A 3S8PA 3FKIJ 3JRGA 2E2PA 1EF4A 4OKKA 4BY7J 4J01A 2IS4A 2JTVA 1SKSA 5HNHA 2JPCA 1YJ9I 5DS9A 2QSGX 3K4NA 3HGGA 3H92A 5KGXA 4IRHA 1MBFA 4MIMA 2NXNB 3HP6A 1NHAA 3TTFA 1IXSB 4OLBA 2VT3A 3O9TA 4G9YA 4CJEA 4CZHA 1BISA 4LJZF 1VQMI 3SAHA 4Z4GA 1R59O 4BRMA 3MDQA 3W2WA 1KQ0A 1IG7A 2A61A 3CJRB 4LK0F 4D7NA 4WE1A 3ZQHA 2FSKA 3LDNA 3U8XA 1REVA 3H45C 4CD1A 2FSWA 3ZT3A 4JI6K 4YOTA 1TNTA 2FBIA 3M07A 5D4SA 5EGOA 3J81K 2LH9A 3ZSXA 3LWFA 3QOPA 3IV5A 4ENMA 4DTNA 1FBQA 4IFYA 2I5UA 1LEBA 2W41A 5AZJA 2FUG2 4FWMA 5ICEA 1WJFA 4YELA 5AQVA 3HRTA 4Q5SF 1BR2A 2Y30A 2FF6A 4WK8F 5GP9A 5HS9A 3CHWA 3DLEA 3O80A 4DJAA 4CZKA 2XF6A 4CEFA 3I64A 2G8WA 4KI4A 3CCSN 3FBNB 4FZYA 4G6DA 4FK4A 2VGMA 1MNMC 2GLOA 2E1YA 3D2FA 3ZCMA 4DTXA 4M3BA 2IA1A 2O9LA 5AZIB 2A5WA 2QLZA 5F0FA 3AVNA 3KJVA 2P5KA 3SAGA 3S17J 2F4OB 4B8CA 5GIOA 1VSHA 2EV5A 3PO4A 2M9HA 4X6AJ 1T0FC 2KJCA 1CQTA 4O4GA 2QQBA 4XEIA 3PO5A 4M3UA 5BRDA 2YNHA 4R5PA 4FJXA 3HRUA 2PI0A 2ZJQL 1NGIA 2J4RA 4JI4K 1TWAJ 3PUBA 1Q18A 4ZZLA 2V51B 4ISEA 4BRIA 3CP2A 2WB1N 5D3GA 2X6YA 1LDJA 1Y39A 4IQJA 4A61A 3WG9A 1ITYA 2VQLA 4FETA 5TJJA 4YNQA 3ZMZA 3HSEA 3F8NA 1V5EA 2JSCA 4LMYA 2YCHA 2DA6A 3ZQGA 4FZZA 2NAZA 2PAVA 1YI2N 4MLHA 4DFKA 4EP4A 5AQRA 1W7PA 3Q0VA 1X4PA 1DLOA 1RT2A 2VKEA 1JL2A 2R4GA 4AHUA 5J2PA 3IH2A 1C0WA 3M1FA 1IAWA 3O9QA 4LC9B 3PO3J 3HOWJ 5AQXA 4V19K 3VQCA 4W5OA 1M1KO 1NGFA 4KICA 3JAMO 4D5CA 1LFBA 1FWZA 4G8XA 3HZ6A 4NQWA 4XRMA 4KFBA 2DXIA 3O6WA 5D6FA 1G3WA 3I4MJ 2X4HA 1AOYA 2NS0A 2D0PA 2V7ZA 3PSIA 2FF4A 4FJMA 4CH7A 3CC7I 3KLNA 3L2WA 4I99C 1YITN 3L00A 3BJAA 5IYCJ 2JA7J 3ML6A 2IS2A 2D45A 4CYCA 4C8MA 4N56A 4TV7A 1HBXG 4E7IA 1U4BA 4HWIA 1T08B 4IVNA 2NRZA 4ILJA 4HYEA 1BUPA 3ZSWA 3C7JA 3LQRA 4H0XB 3JRCA 5K14A 5AQLA 4CGJA 5L3FA 2QWQA 4EFHA 1TWHJ 3BP8A 2XSDC 1NK7A 1RPWA 4KFCA 4FOIA 5LJWA 3VOVA 1UG2A 1TYQA 1N6QA 3FWEA 5I42A 3QU3A 3C2BA 3HG9A 4B3TK 2F4IA 2K86A 4CCKA 2F5DA 4F93B 5BOXA 2ZXIA 1ATSA 2D1KA 3D2FB 3ONQA 1JLCA 5EXWA 2DT7B 2CS3A 3KK1A 1IN4A 2EZIA 3VEPA 3LQQA 4M9XA 2ETJA 3AO4A 3VQAA 3K0SA 3SDBA 1QPIA 3VMFB 3GMEA 3K1PA 4AVPA 1CF7B 2OA4A 4BJTA 4FM1A 1SEUA 4BRAA 1ETWA 1YRNB 2YHAA 4MHGA 2HDDA 3D5RC 3G10A 4CF2A 3CUQA 2MLKA 3OYIA 3AVIA 4F8RA 1A5JA 1EH6A 4HF2A 3L3VA 3HIFA 1VQ4I 2LKXA 3C2HA 5EDNA 3RMCA 2M7BA 4JKGA 3TTDA 1XPXA 4OPKA 4JKFA 3DEEA 5JHUA 1P4WA 2IVPA 5I3UA 3F6OA 2QF7A 4HOBA 2VE9A 2R5YB 3VOEA 5FRMA 4DG1A 2VKHA 3QQAA 3GTPJ 3OIOA 4CSWA 3V9SA 1UA1A 5LLQA 3P38A 3G73A 2GA1A 4L9JA 5E20A 2R7OA 1VSEA 5EG0B 1USSA 3IAYA 4JX4A 1QNTA 4LG0A 5GAHJ 2JVGA 4B1XB 1DP3A 3JTGA 4KNYA 3K2PA 4JK9A 3GZ5A 2FOKA 4JN4A 2ME6A 4BREA 2M1BA 3QLHA 1LDDA 3MN7A 4JEPA 2Z2SB 4BGAA 4PUSA 2RE2A 2OQRA 4XRSA 3KLOA 4FVMA 4DB3A 2P5GA 1IXRC 2XVCA 5ICCA 3AV9A 3DRSA 3LL7A 2PMUA 2HPIA 4S04A 4MO7A 3NF8A 1U78A 2O8EB 2DJNA 3JTHA 2V7YA 4H5WA 1FZPB 1J09A 5JS1A 4IX7A 2L4MA 3CF5F 1PUFA 2EK5A 2XGCA 5CQGA 1U6ZA 3ITHA 3QMLA 3U9ZA 4KMFA 2KKOA 5AQQA 4BC4A 5TRDA 1LQ1A 5JVGL 4HZFA 2E2IJ 3TABA 2IEKA 5AQOA 4CZEA 4FLWA 1HYSA 4L9NA 1YOVB 3CM6A 3L7WA 2Z33A 4CIGA 4KH5A 3T1YK 1W7AA 3OY9A 1LUJB 4L5EA 2CH5A 2QM1A 3QIPA 5IT9Z 4JI2K 4YIFA 1ZLKA 3HT3A 3HUGB 1E0EA 1TAQA 3W3DA 2Y9YA 4NBQA 2F8TA 2IOCA 3E5QA 3HUGA 1OYYA 2KMUA 2YPRA 3RQ4A 1FBUA 2FD5A 3H0GJ 4JOMA 3F21A 2IS6A 5AQZA 2DT6A 2E88A 2RF2A 4FE4A 5DEQA 3C94A 2CYYA 3RPUD 3MKWB 2XRLA 1I50J 4BUPA 4ENNA 2V1UA 4CZMA 3V81A 4NUBA 4H4MA 2YHYA 1JUMA 4GV6A 3G2BA 1FYKA 1FMWA 4JKCA 2BTFA 5KQ8A 4QS8A 4N5SA 4B9LA 3DPLC 2KQ2A 3J80O 1TW2A 4LITA 2QXLA 3E1SA 1BI3A 3BF3A 2O5RA 3LDQA 3VGKA 3ZSRA 1HF0A 2QWOA 1RDWX 4CVNE 3M8SA 4A6EA 4DV7K 3F3XA 1WN7A 1QSYA 3M8PA 3AO3A 4U0VA 3PNYA 1J9AA 3VEVA 1Z6RA 2W48A 3KP7A 3RKYA 1A5XA 3CJTB 1OCOH 4HV5A 1CXUA 2J5PA 2RC4A 3BPVA 3E3VA 3NARA 4JBAA 5D8KB 3SQ0A 2E35A 1ITGA 3NF9A 3KVGA 4AD9A 1MWMA 3UIQA 2B0LA 3GUDA 2BHZA 1X3WB 1SS6A 2O8FA 4K43A 5DMRA 2H6CA 3AVLA 4HX7A 3TOAA 3TAGA 4N4NB 5AZJB 1MNDA 1NU0A 3PIOF 3SMSA 1A35A 1ZH5A 2EILH 3TKYA 1CZBA 3M6GA 3O1BA 4ID1A 1NGJA 1NWKA 2K9QA 1KLMA 2XAUA 4JI1K 2BZTA 2Z1DA 4EGYA 1YLFA 3GBGA 2O8EA 2QI2A 3E6CC 4BR0A 5CVUA 2FEZA 1HC8A 1LAVA 4LH4A 4B1UB 3PFYA 4JHDB 4EZ9A 3GFIA 3AA3A 3NBPA 3LM2A 3H1QA 5DK5A 3I3LA 5ICFA 1UHSA 2WBNA 1S3XA 1MJAA 1V4RA 3TP3A 4BHBA 2Z9OA 3F2KA 4HQEA 3WTZA 2L7KA 3A1YA 3RKWA 4KHNA 2HOAA 2K9SA 2L9NA 4MFBA 3CYMA 4DUZK 1EKEA 4OIPF 3IWFA 5KHDA 5C2DA 3QEWA 1VQ7N 3IAM2 3HK2A 1H9TA 4R1HA 2DA3A 2M45A 1K79A 1R4MB 3KEOA 1OH8A 4QPOA 4QWQA 1AU7A 2VYPA 3LA7A 1U9OA 1OH7A 1KLNA 1A6QA 2VG5A 2D2WA 1R5GA 1BIBA 3FZMA 2XY6A 1JUSA 1YJ9N 5IOZA 4H4KC 4M9SA 5LRSA 4E19A 1P4AA 2CGPA 2ZM6K 3M8EA 4OGEA 5B66C 4PA1A 4OIQF 2PG4A 2PMZN 1D4XA 3OTOK 3KEYA 5H2FC 1NGEA 5GADJ 4KHUA 1VSDA 2CV0A 2VBWA 3LDPA 3CCVN 2J5OA 4DF4A 2LG4A 4A59A 1X19A 2B63J 3SJJA 1JT0A 1OVYA 4FLUA 1LWEA 1YJNN 2HB5A 3QBXA 1DGKN 3RTVA 1FKPA 1XD7A 1XSVA 3KZBA 1BR4A 3FXOA 5AQNA 4IJAA 1T6SA 3QNOA 4BR5A 3ABKH 2MABA 4CJPA 3K0LA 1U49A 5LHGA 1D3YA 3ULEA 1O57A 4NYFA 2PEXA 1O3TA 3K5LA 4WQ4C 1XGMA 3C2GA 4C8LA 4CCNA 1NG6A 1ZRFA 2BE2A 3C7NB 5HLFA 2ZO4A 4P96A 1UMQA 3RI4A 1OR7A 4BQZA 4XLFA 2K4BA 1NOZA 2Y9ZA 1QVGM 3RMAA 3T5XA 3A01A 1H1VA 2QWNA 3OYNA 1IKWA 3F9MA 4IO9L 2HW3A 1Y97A 2HFHA 2WV0A 1K4SA 2RQPA 1FTZA 5AFUA 2P0WA 3TDUC 2E2JJ 3W6VA 2O8CB 1HW2A 2HR3A 3OYHA 3F73A 2HQ5A 3S1QJ 3I55I 2LVSA 1TYQB 3A5OC 3HOSA 2M34A 4IFEA 4KB0A 4A3CJ 3IRQA 4DR4K 2EPFA 4GV9A 4NCBA 1HSJA 5GAGJ 2P9KA 3E66A 2QGUA 2Q2EB 3PSFA 3RPQA 2RV8A 1WZ2A 1IG9A 3GEZA 3MEGA 5J2NA 2W4SA 4Y3OA 2HZTA 3D6RA 1HDPA 2JK3A 1XN7A 4KHQA 2ESNA 2BY0A 4RAFA 1G99A 1UHWA 2EINH 2WB1A 1B9DA 1Z9CA 5LMUK 1X3UA 3CF2A 3CUQB 3ATVA 1BW5A 1TC3C 1F43A 2ASPA 4NCGA 4B9NA 4ESFA 3QEIA 4C23A 1E17A 1X3NA 4FK0A 5FROA 5F6FA 4CCJA 3E6BA 2Q36A 3AGKA 1VRTA 3C6TA 4OOIA 3FM5A 2STWA 2FNPA 2CUFA 4CZFA 2KP6A 4XLAA 1WWXA 1D5YA 4ID5A 3MCAB 5M5YJ 1UWBA 3RRHA 1WH5A 3K7AJ 4HF0A 3REOA 5AQMA 4ANJA 2KLOA 3G3ZA 1FYMA 4FLTA 5J6XA 3MKYB 3WTYC 5BN9A 2ELKA 1XHXA 5DCMA 1DP7P 2AJQA 1D5VA 3FKJA 1LWCA 1BR1A 3AKZA 1LFUP 1RBTA 4OPAA 1OPCA 2QEXN 4II3A 2WAQA 2HYJA 1W1WE 1NK3P 3VPRA 2F4VK 3AGRA 3WE3A 3CCSI 1K8AO 2F9TA 1UAAA 2FBKA 4FHTA 3HTVA 3VF2A 1TNSA 2V1DA 4FJIA 2Z1HA 1VAZA 1Y1VJ 4GDFA 1PUFB 1TT5B 3AAPA 1HQEA 3BEXA 4DSLA 1F1ZA 1ZLJA 1S1XA 3Q7CA 3MKLA 1B59A 4AM3A 5IP6A 4CJWA 5CLSA 3NE6A 1HLVA 4WFBL 3PIOL 4DV1K 4B8XA 2G8VA 2W85A 5ILSA 2O0YA 1KRPA 3LWLA 3IWZA 2GZWA 3WE2A 3WGIA 4RLFA 3ROUA 4HNTA 1HNVA 4E3SA 1MWKA 3F8MA 2BBYA 1VQKI 4ELTA 3ERMA 2GWKA 3FHZA 4Y52J 4F2SA 1MMAA 4RM2A 4L8RB 1ZKGA 4B8AB 1XUPO 3WGGA 4OMYA 5C3EJ 2FMYA 2AP1A 3TI0A 3KYCB 1ZN2A 4M3RA 3MEEA 3WQTA 4CJQA 3VN5A 4WQ5C 4BNCA 5B3SH 5AFUH 3ZSQA 4ZHRA 4JRQA 1RR8C 2OQGA 2HHQA 1P4XA 1I39A 2JWTA 3HSRA 3RSEB 4B1VA 3HM9A 4KI6A 4BBRJ 5GAGP 2JT1A 1BL3A 2HHTA 1Z1DA 3CLOA 5L3EA 4CGGA 2QYOA 2MSYA 1SFKA 3H35A 3ATUA 1IRXA 3OYBA 3WNGA 3GTOJ 3ZX0A 5AQSA 2P9LA 3K1MA 1FX7A 2NVYJ 3ZETA 1G3SA 1GT0C 3GTKJ 3J7ZI 1GLLO 4N76A 5AQJA 3IKTA 3NF7A 5H1SQ 1BIZA 5BPIA 2F7TA 2JZYA 4FW2A 4BXXJ 1EH7A 3MEDA 2OD5A 2QWPA 1JI8A 1XB4A 1EX4A 5HLTA 3G1MA 3OIQA 3PQKA 3F9KA 3DXJF 4L9VA 4OMZA 3U21A 3KETA 4DQQA 5M1QA 2UWMA 1ASWA 3O9RA 2R0QC 2O8FB 4LOCA 2HF3A 3LFKA 2VBYA 3OOPA 4DFJA 4HA8A 4W97A 2D5RA 4I6MB 2GM4A 1NGDA 3VQBA 3HJFA 4DV3K 3M3YJ 4B1YB 2JMWA 1WCMJ 4Z4IA 2IVMA 1ORKA 1YJNI 1RC9A 2DTRA 3ZQ7A 1DDNA 5KPZA 1SL0A 3F22A 4KPYA 1OFCX 1C1BA 4IXCA 4CYDA 1JTXA 3IKVA 1E3HA 4CESA 4M3XA 2HWVA 1WVRA 2DBBA 1C0GA 1LV5A 1RDUA 3I53A 3GWZA 3KEQA 2HTJA 4NNJA 4HCBA 4B9MA 1PP8F 4PJJA 4LB6B 4YORA 3RR7A 1RT4A 1LEAA 4B1ZA 2RDPA 3QIOA 3EUHC 4NB5A 5D8LB 5LHIA 3VF4A 4S05A 1NK8A 1IKYA 4PSXA 3VGMA 3OVNA 3V1QA 4ESJA 1VQKN 2P9PA 3D0PA 4RS8A 3V8JA 4MQVA 5J47A 2F96A 3EO3A 4O5FA 3U9GA 2FBTA 2P9PB 4BQLA 5HDGA 3BDPA 2R7YA 1A04A 1R36A 3LSHA 3VYRB 4DQIA 4FL9A 4EJVA 4RW6A 2KTQA 3K70C 5AQKA 1S7OA 1N75A 2LC2A 2NS7A 3WNEA 2A68F 4DSJA 2M2EA 3KD1E 3LAPA 4A12A 1J7KA 4S0HB 3E6MA 3OYGA 1JGSA 4I09A 2UUZA 3CCLI 3ZX3A 2L3DA 4BC5A 3I8DA 3SUNA 2ZFUA 1CZAN 3S9HA 4NQWB 2YU9J 2BY2A 1BN5A 4HBLA 3OS1A 3HKZN 2Z1IA 3ZQQA 2EV0A 1YW8A 3SQNA 1Y1WJ 1S5JA 2DPUA 3SDGA 2OUMA 5EEHA 1QHGA 2A41A 4IZZA 4I0AA 3A5LC 2DMUA 4YIIA 3C95A 4B3OA 4JI5K 5IYDJ 3V9UA 1F9NA 1VQ5N 1A5WA 2DMTA 2CO5A 4KN7X 1QZ5A 4J8FA 4G9ZA 4KITB 1BC8C 4KBOA 2HI3A 2ZXWH 4XIDA 3BOQA 2VKDA 3HP9A 4RB2C 5J8CA 2MD5A 2E4LA 5T7BA 1BA1A 2ZE2A 3DXMB 3MN6A 2NYXA 1Y56A 5IP7J 4ENKA 4N9IA 4BDPA 1VTNC 3QDKA 4KH4A 2XY5A 1PYVA 1YW9A 2O8DB 4M3EA 4IOCL 3DTKA 3M5RA 2MH9A 1G6NA 1R5HA 4H0OA 4NXNK 2BV6A 3F8FA 3NMUA 3EUAA 5AONA 5D5WB 3H9QA 4MTDA 4QS9A 4OWRB 1XDSA 2G8HA 2EFPA 1T0FA 1XMAA 2L4AA 5HLHA 4OIOF 2GXGA 4KREA 3L2VA 3HM5A 2IPQX 5CYVA 2X1DA 3TO9A 2XUBA 3OYEA 3K4LA 5E3OA 3LAKA 1Z7UA 3CCYA 1U2VA 3BC8A 3ZLJA 1YX5A 4IOAF 3EUKL 3ZPLA 2O8KA 3M7GA 2VASA 2L2OA 3CZ6A 5DV5A 3MKZA 1EWRA 2V7FA 1TUUA 4CK2A 4IPAA 3O3GA 1QU3A 3GO5A 3CCMI 3TL4X 5J1UA 2E1CA 3SPZA 2LBFA 4HUEA 1W5CC 3C0BA 4A0XA 5KRTA 5EGOB 2OU2A 2Y0SA 3WU1B 3MXJA 4G12A 4UY8I 3MWPA 2L7ZA 3E0JB 5E79C 1B8IB 1QTMA 2IJLA 4B43A 4CF9A 2QSFX 4C8NA 1VQPN 3QYBA 1QVFM 1S9HA 2YJFA 4F4KA 3IRXA 1YO5C 3P9CA 5DM7F 1QHTA 4Q47A 2ZJQF 1HX1A 3CP8A 3U1KA 2ITGA 2YKMA 3AG2H 2CJJA 4HEA2 4CEAA 2JQ7A 2VJ5A 3I58A 3WTUC 1NK2P 1K83J 1TKXA 1L3UA 3A2FA 3RR8A 2WA0A 1QVUA 1Y8QB 1NGAA 2LTPA 3HOVJ 4GYIA 3NQOA 2E1ZA 2YR2A 1KU7A 2V9VA 1LPQA 1A31A 3TWHA 4JI8K 5F27A 2DPNA 3AO2A 3L2QA 5TKWA 4LLGF 2XAJA 1K7AA 3PX6A 1MH3A 3GTQJ 2NZTA 2R7UA 1VQLN 3N97A 5CVIA 2Y1IA 4XKBA 5FKMA 3PLAA 1E3PA 1R1VA 2OTJI 2YI1A 2QKMB 4OINF 2OBPA 1YHQN 4KMUX 3GTMJ 2XHKA 4M71A 3S1NJ 1U3EM 2NRVA 5C44J 3KYLA 3FLCO 3CETA 3LSKA 2P81A 3EKSA 3ZX2A 1Z05A 1SUQA 2ZFWA 4AHRA 1HPZA 4K8XA 3GF2A 2Q3SA 2UZKA 1JXBA 3FIWA 1TKTA 3VB2A 3CQZJ 4ZZDA 4Y15A 4PJ0C 3CI5A 3CCQN 3HSFA 1J9IA 1JCGA 1OCTC 2HYGD 2LMDA 1J5EK 2DTUA 2ITMA 4P9FA 2HMPA 1GUUA 1W7PD 1I3QJ 4FOEA 3SLCA 2UXBK 1MMSA 5LFAA 5CYQA 3ZP5A 1Z6TA 2R7VA 4DYQA 3E01A 2COMA 4M3FA 1WJEA 2HTSA 4QS7A 3FK6A 1U6GA 4OX9K 5LHHA 2XC7A 3M4OJ 3KP3A 3HM8A 3DEWA 3GE1A 3KKRA 3ZT4A 4H03B 5GAEJ 1Q9XA 3SFIA 4CCHA 2Q8KA 1PVEA 2KRFA 2HNHA 3F8CA 1OKJA 1F21A 4H4OA 2DYRH 3DF8A 3L09A 2P9LB 4IOAL 2MYSA 4IDKA 1IBKK 4PY5A 1D1BA 1YG2A 3QYFA 3DU6A 5B1BH 4XNFA 2NOGA 3EUHA 3WTWC 4CBXA 2QKBA 1U8BA 4CW7B 4YFKF 1F4KA 1B9FA 1HW1A 2O8CA 3MN2A 4FPBA 3OSFA 3ZSZA 3H3UA 2G8IA 1FTTA 2R92J 3O4WA 4EJWA 5LGUA 4I2OA 1GHCA 1S3JA 1CZ9A 4B3SK 3HPOA 5ADXA 1ACIA 1CXQA 3B6PA 1SD5A 1KQSM 2RNGA 2K40A 2HF4A 3KK2A 3P4IA 2AQFA 4IHWA 3KWGA 3S2DJ 3MX5A 4WXHA 4AF1A 3V7SA 4AIHA 1ZQ3P 1MBKA 1NGBA 4CEQA 4I76A 2V6EA 3QPLA 3V42A 1QZEA 1FW6A 2ZSIB 4GNIA 1RKTA 2YUSA 4ZC3A 1Z26A 4W5NA 1ZG5A 4P55A 2PFBA 4M6XA 2BXZA 2EFNA 3TGNA 1YIJI 3WXMB 3SNNA 3Q5FA 4WQ4A 5EF6A 2NRXA 2M5WA 3LZIA 1X3MA 3K6GA 3OYLA 1S29A 3M1EA 3LM9A 2QA4I 1S7AA 1T95A 2PYLA 2CFXA 1B4AA 4U7BA 3IDHA 2CW8A 1N33K 3RJPA 5M1OA 3O8GA 2D1VA 3PM1A 2CQ7A 3KLFA 3N05A 2DI3A 3LPTA 3C6UA 3OHRA 1T8EA 2RAEA 4ISGA 4B1WB 1ERDA 1RT5A 4DR7K 4DUYK 2A6EF 3QNNA 4GGGA 3FXJA 2EIMH 3PQJA 3J80K 3R8EA 2UXNA 1OYWA 1BI1A 1TWCJ 4EEFG 4HNUA 4FJKA 3MAJA 4UXNA 1RTJA 1DTTA 2LY2A 3J80Z 4FX4A 1TWFJ 2DK5A 1ZELA 4YG2F 3WEEB 3EETA 4EJUA 4LG3A 3AVFA 2Q1NA 3TSPA 3DLLL 5BS6A 1NJZA 3UKUB 2BVMA 4IHYA 2DA4A 5H6QA 1SAUA 4Q4ZF 2X6OA 1Z67A 4OGCA 3H46O 3T7ZA 4U0WA 3DEUA 1UHMA 1WRJA 3CJQB 5LBQA 1KVCA 2HZDA 4BC3A 3ABMH 3CCRN 1RCHA 1U0JA 3FMRA 3K2ZA 2Y31A 4I2QA 2DK8A 3MECA 1WI9A 2P1JA 3ZQLA 1SMYF 2XB0X 1BO5O 2VWJA 4YOWA 4HUFA 1VNDA 3DBRB 1E3MA 2P7CB 1OMIA 1QRYA 2EX3A 3DXMA 4JK8A 3VA3A 4B3RK 4GKJK 2Q0UA 3ABLH 3A02A 2ISZA 2X78A 2X1EA 1DTQA 3HOUJ 4KTWA 3RYPA 1REPC 1ZBFA 4M7XA 1Q82O 3D7EO 4YEJA 3NVKA 3CFRA 3DBHB 1S6QA 3MN9A 3BTLA 3T1AA 3KP2A 5LEJA 2NNNA 2BYVE 4RAZA 4DTJA 1WBDA 4NLCA 1KSPA 3AL0C 4FWSA 4DQRA 3OW2M 4JKGB 2WAQN 4NC8A 3ERED 1L3LA 1IXCA 3VQEA 1DPUA 5IY5H 2E19A 2R5YA 5J4VA 3HJEA 4FXDA 5BPLA 1HMVA 1GVJA 3V8LA 4JS4A 1ZR4A 1FNNA 2XAQA 2VG6A 1YS6A 2DOFA 4FJNA 2LR8A 4CZIA 3QBWA 1D8JA 5HROA 3CCEN 2DTZA 4DR6K 5F08A 4JKEA 3CCQI 2BY1A 2L9RA 1MMGA 4EM1A 4RBOA 1O13A 1YTYA 4LF9K 4AYBN 1TW3A 2OPTA 5KCMA 3ZQFA 5C42A 2VONA 3VENA 4RDUA 2A6TA 3AO1A 3DRPA 1ZRDA 3MN5A 5C25A 4RW9A 3SAFA 4DR1K 1YJWI 4E1JA 2UUBK 2O6GE 4PUOA 3MXIA 5K5OA 3VF6A 3NH2A 4CF0A 4CJKA 3FM3A 1TV6A 4FLXA 4FSVA 2KZGA 4UQGA 1XHZA 3T1BA 4ZDLA 3CUQC 3CERA 1L0OC 3U1DA 2DT5A 1B6AA 2E7XA 3WU2C 2YJEA 3AVMA 2ASMA 2PBIA 1GOCA 3W3CA 3F6VA 4YDUA 4XSZF 4KH6A 1I6XA 2HPMA 1SV5A 3CQ8A 4F92B 3JXUA 2IW5A 5JVTA 4OAYA 2K9MA 2QUFA 2WAFA 4KUMA 4XL9A 2D1HA 4B3AA 2JA8J 4CEEA 2P9NA 4K42A 3NWSA 4PFOA 1QGPA 2HOSA 5GINA 2P9NB 4F2RA 1J6ZA 3QERA 1QQMA 5JLFA 3P1GA 3VYTB 3LPUA 3VSLA 3P7NA 1E2XA 4NO7A 3B02A 1APLC 4JYAK 2LLKA 3IP4B 5J1RA 4KIBA 2CGLA 3W2VA 2NVTJ 4IHTA 2NNYA 1ZBUA 4I02A 4IG0A 2C6YA 3FR0A 5LJVA 2XO7A 4UB8C 4YFXF 4QCLA 4BG9A 5J8FA 1MZBA 4BVOA 3D5LA 2EH3A 3NWTA 3JAMK 4MGRA 1IJJA 3N4MA 4LFAK 5CVRA 1ZBSA 1GLEG 3ENBA 4L9TA 4XH4A 3SZ2A 1SD4A 1KU2A 4A93J 3MWTA 1LVAA 4DTOA 1FOKA 5HRPA 2H09A 1RDCA 1QZYA 1D9FA 4LFCK 1XCVA 3AA4A 4GXOA 3NGYA 4CI6A 3CMAN 4BHPA 3KP5A 4AC0A 3LALA 3F0CA 2GEMA 2ETHA 1IW7F 2IGMA 4UVAA 2KKZA 4YIRX 1ON2A 1Z0XA 4RGSA 3R0AA 2ZXJA 3WGHA 2HVRA 3L8BA 3T1HK 3TANA 3CESA 2DAOA 5C24A 3VDXA 3TARA 2OTJN 4I2PA 3FFIA 2VWBA 1KFDA 1TQMA 2O7OA 4F55A 3BY5A 4B1RA 2ELJA 1VQLI 1VK0A 3EE8A 4GMJB 4CZLA 1U04A 1UELB 1QBJA 4BG8A 4EHUA 5L3DA 1L3TA 1LKXA 2IBDA 1TAUA 5JVHL 4CEDA 1MD0A 2MGQA 3UKRB 4RGUA 3FZLA 3VQPA 3VQ5A 4N9HA 3M8JA 3L2RA 1KXPA 1W97L 4JHDA 2KQRA 4UNOA 4ZYHA 5KTQA 3ISNC 4M6VA 1C1AA 5FFXA 1GLAG 3P39A 2RKIA 4KYWA 5IPAA 4KIFA 3DMJA 2VOOA 4XLEA 3IMXA 4DS4A 3CDIA 1BWFO 2BH1A 1SMTA 2DQLA 5CQEA 4A2UA 3ELKA 2YX6A 1ONVA 5GTIC 2E6LA 4ZTJA 3DCFA 2VIXA 3CLQA 4FT8A 4KT5C 5BQTA 2VQGA 4U88A 1JJ8C 4DTUA 2AO9A 4H0YB 3WT0A 2QK9A 2GWRA 2R5ZA 1RILA 4ELVA 3GLXA 3OMYA 4V19S 4EATA 1WJ5A 2E36A 3H36A 2QA4N 1JKQC 3JS6A 3J81O 1YVUA 3I4PA 2XKOA 2QTDA 2ID6A 4JX6A 4E6KG 5CPRB 4KRFA 4O44A 2VQCA 2FC0A 4FWRA 3KK7A 1MA9B 2EBIA 2W7NA 1RTHA 2VL8A 1TBXA 3FF5A 4CO8A 1R22A 2AS5F 3HOYJ 4M41A 1C0TA 2XAHA 4YHHK 5FD5A 1IH7A 2R7ZJ 4LY7A 3VWBA 2H1KA 3SCXA 2WV1A 5E1XA 2TRTA 4CCLA 3F23A 1JT6A 3HPHA 5FKKA 3R3LA 2JVHA 2M8EA 1ZYRF 2HQNA 1AKHA 4FVUA 2D0CA 3JYTA 2W1OA 3HHHA 1D0ZA 4BQAA 4MNUA 2A40A 4HQMA 2EV6A 2GIVA 2UXDK 1XGSA 2F4MB 5GAEP 4CK3A 3G6EN 4LD0A 1NM1A 4XBFA 3FISA 4QPQA 4W5RA 2JPBA 4I0BA 2HSTA 4EVIA 3BZCA 1W0TA 3Q7BA 5AQGA 3OYFA 2F2EA 1A5VA 5K5RA 3A01B 2RGVA 3F72A 1S7EA 2P7VB 4DR2K 3DU5A 1HXDA 4BE0A 5DDGA 3HTUA 4CGIA 3J7AP 5GTHC 3CMEN 4IF4A 4XQFA 2WUSA 3UKRA 3OYAA 1SKRA 4H5NA 1XNRK 4FLZA 1J5OA 4L18B 3O9SA 3LP0A 4IBNA 2K4JA 1NJWA 4KN4X 4OVLA 3CDLA 9ANTA 2KIMA 1BOTO 5ERIA 4XKVA 4PFPA 2K7LA 4O3MA 1KGSA 1S5LC 1R7JA 1Q1HA 1VQ9I 4BWJA 1V4SA 2EHGA 2P5OA 4UB6C 4G7OF 2O8BA 3DI6A 3R1XA 3ZYYX 1X1BA 4KO0A 3ZGKA 4XRSG