1Z05A

Crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
DHIKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAISRGRPAVGLQTNNLGWQFLSMRLGRGYLTIALHELGGEVLIDTKIDIHEIDQDDVLARLLFEIEEFFQTYAAQLDRVTSIAITLPGLVNSEQGIVLQMPHYNVKNLALGPEIYKATGLPVFVANDTRAWALAEKLFGHSQDVDNSVLISIHHGLGAGIVLDGRVLQGRHGNIGELGHIQIDPQGKRCHCGNYGCLETVASSQAIRDQVTARIQAGEPSCLATVEEISIEDICAAAADGDPLAVDVIQQLGRYLGAAIAIVINLFNPEKILIGGVINQAKSILYPSIEQCIREQSLPVYHQDLKLVESRFYKQATMPGAALIKQALYDGLLLMKVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator, ROK family
publication title Crystal structure of the ROK family transcriptional regulator, homolog of E.coli MLC protein.
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transcription
total genus 137
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z05A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A03
4BHBA 3ZPLA 1B4AA 2IRFG 4OOIA 2PLYA 2ZWHA 3WG9A 2QWPA 4WQ4C 2RNJA 2D2WA 3C1DA 5H20A 4Q4ZF 3BPVA 4M6XA 1NWKA 2NYXA 1S6LA 2CO5A 2A6AA 1BM9A 3T0YA 4WQ4A 1TW3A 3F8FA 4PZJA 1BOTO 1GXPA 1KAYA 3SFZA 4Y13A 1OKJA 3EO3A 1WRJA 4XLNF 1FLIA 5ICGA 3AAQA 3DXKA 5AZJA 3HRUA 2GELA 2Z3YA 2LNBA 3I59B 3LM2A 5FLXK 2YX4A 1BA0A 1IF1A 3M1EA 4AIJA 2Q0RA 3O1BA 3FF5A 3Q9VA 4QS7A 1XUPO 3H1VX 4IPAA 3LAPA 5LRRA 4L0ZB 2UYTA 4RGRA 5F1XA 1I27A 2NZTA 2ZGYA 4A0XA 4A6EA 2FF6A 1OR7A 2CGLA 2E1YA 3O4WA 4U7BA 2CH6A 4B1WB 3REOA 1ZRFA 2GTDA 4S05A 2P9UA 1R23A 1E2XA 1Q18A 3A5MC 3DF8A 3E97A 3ZETA 4H5WA 4BR2A 1HJOA 2HKXA 1XGOA 1T38A 5F64A 4G6QA 1YUWA 1GLCG 2NNYA 3MCPA 2HEOA 4CO8A 1UB9A 2GUPA 2D0PA 3VETA 5BRHA 4U0WA 1RFQA 4XEIA 3D2EA 1P92A 1ZREA 2B0LA 3QAHA 3WE2A 5AR0A 1LDJA 4HX8A 1FBSA 2P6TA 2IA2A 1XMKA 2OBPA 2XRNA 3VODA 1RGIA 2M8EA 1QNTA 2HKOA 4H0PA 5DD8A 3A8YA 1LCUA 3BPXA 2PAVA 3ID8A 2HS5A 3H92A 4BC3A 1MJ9A 1XCVA 5D5WB 2EFQA 5K5RA 5LHHA 2UWMA 4Y17A 4B1YB 3VEYA 1GVJA 5AQUA 2OZUA 1O3TA 1TTYA 3ZEUB 3GXOA 3ELKA 2NAZA 5LHIA 3SJHA 3FHZA 4IO8A 3CJ9A 1U2VA 1FOKA 3E5XA 1FBQA 1J7KA 2QQAA 1EH7A 2DI3A 3R61A 1MJAA 3V4GA 4PKGA 2OQRA 3GWZA 2D1VA 5FFXA 3CETA 2W85A 3QMLA 2DU9A 3JTGA 3M8FA 4KMFA 5AQXA 3QBWA 1DPRA 2NS0A 3G3ZA 3J81Z 4UXNA 3V8LA 1QQIA 2EFPA 1IG8A 4BNCA 2PMHA 4B09A 3GFMA 1XGSA 5BRDA 1U6GA 1XSXA 3CHWA 4H0TB 1I1GA 1BWFO 1FY7A 2HGCA 4M72A 3EL2A 3V7CA 3WQTA 3G73A 4L0YB 4H5TA 5JMVA 1YS6A 3T8TA 3FZLA 4KBOA 3TQNA 2VOOA 5AZIB 3ZMUA 3O2PE 2V1XA 3WU1B 4I7HA 4FWPA 5AQOA 1SFEA 1MKMA 4K2EA 4KIFA 3ERED 5K5OA 2LDUA 1RUNA 3R8EA 3L9FA 3BEXA 3EETA 1O3RA 5LY3A 2FXUA 5ICFA 2H09A 3TOBA 2X4HA 2VE9A 4RB0A 5ED4A 2P9SA 3HYIA 1R00A 1GLJO 2F5DA 2GIVA 1KQ0A 1S8NA 5HVQC 4G7OF 5FD5A 1MDMA 2Q2RA 4MTDA 1D4XA 2FEZA 4PKIA 4HDUA 4OMYA 3TGNA 3M6GA 4IHTA 1YVNA 1P4AA 3WXIA 1PDNC 1QQNA 3WTVC 2NRAC 3HI0A 2J4RA 3LDPA 2L01A 3FXRA 5E18F 2MC3A 2Q31A 2Q0OA 1BC7C 2DPNA 4Z94A 5EX5A 4I6MA 1I6XA 1KAXA 3P9CA 4CZMA 4BAYA 5LHGA 3WTYC 2AA4A 3MN9A 2A5XA 3JS6A 2JPCA 1HPMA 4G9YA 3K1MA 2DT5A 3V8JA 4ETSA 3JSOA 4EJTA 1NM1A 1G3WA 2P9NB 4MO4A 4S04A 3I64A 4MQ9F 4ASNA 5EXWA 3IMXA 2ASMA 4KDPA 3K2ZA 1ZARA 5F6FA 3AARA 2FBKA 5AQHA 3QFPA 3LA2A 2W84A 1WUAA 2M45A 1YTYA 3FFKB 1FWZA 5AQSA 2K4JA 1DUXC 3ULEA 1YO5C 3H3OB 2EWSA 1TUYA 3K9TA 3IKTA 3AY9A 5JR3A 2HF3A 4FWLA 4ZYEA 4RAYA 5TKYA 4CGZA 4J8FA 3DP7A 3R0AA 3JAMK 4JN4A 3MEXA 3QU3A 3G25A 2LSOA 2MLGA 1V4TA 5FB2A 3R4KA 2VOPA 3EKSA 4CZHA 5AQJA 1NGFA 2KJBA 4LLGF 3EYIA 3F6VA 4GGGA 3ATUA 3MWMA 3KP7A 4XBFA 5F0XA 2IP2A 2FA5A 2K27A 4Q48A 4KFCA 4DCHA 3FMSA 3HOSA 1ZBSA 2OA4A 3EQLF 2IJLA 2OU2A 2P5VA 3LL3A 5AQNA 2XUBA 1LDDA 2TDXA 3CJ7A 1XD7A 5L3EA 1K8KB 5AQKA 4BR7A 4G8XA 2XKPA 3ZMDA 3MQ0A 3HTSB 3RI4A 1XGNA 1HKBA 1W5SA 5HLGA 4XH1A 3TO9A 4TV7A 1BI2A 1PUEE 4HWIA 4BQLA 1ZG5A 5E1XA 5AQMA 4I01A 4B9QA 4L3QA 1NGCA 2ISYA 2A42A 4FX4A 1C0GA 1USSA 1WKMA 5LJWA 2YHYA 3FLCO 4OIRF 1IRFA 1XCBA 4BRLA 4BR4A 1JE8A 3V8KA 3MMVA 3T8RA 2QZ8A 4YG2F 3BY6A 2MLKA 4BVPA 1W7PA 2XAJA 3MZHA 1JCGA 2FBIA 2P9IB 1YW7A 3DXMB 2P6SA 1UHWA 3C0BA 1YFHA 3U9GA 1SD7A 1B9MA 2CYYA 2CFXA 2KIFA 3GOIA 4CZFA 3ZMSA 4ISEA 2A69F 1W7PD 1HLUA 2FMLA 1LEBA 1IUYA 1B59A 3KZYA 4HZFA 1ZGAA 2V52B 2E88A 3E6MA 4A2AA 2RV8A 3CJBA 3F8MA 3D0SA 2A6EF 3KLOA 4E1JA 1IXCA 5IT9Z 4K43A 3ROUA 3BJ6A 2CWEA 3RIRA 2DPUA 2O3FA 3DV8A 1YQAA 4AIHA 4ZYDA 4AM7A 5D6FA 3CLOA 4QS8A 5BN9A 3VB2A 3CJNA 3QBXA 3I59A 3PQKA 1TQPA 2VBXA 2FQ3A 2RC4A 4WWCA 1FNNA 2RKHA 2EFWA 1P4XA 3HRTA 4ENJA 3MN6A 3FMRA 2P5KA 3WU0A 1IXSB 3RDIA 3DEUA 1TYQB 2HOEA 3GVAA 2DBBA 3KZBA 3W6JB 4BYYA 1GLLO 4JAXA 1TW2A 3WEEA 2QM3A 3GFJA 3RSEB 1S3JA 3KFWX 2QWRA 4ESJA 1LJ9A 1FBUA 3TO7A 2IVOA 3LDLA 1HQCA 4K41A 3ZX3A 1K78B 1R36A 1F4KA 4EHUA 2W40A 4JBAA 4K25A 3UKUB 3DFGA 3WTXC 1TQIA 1NGHA 3F8NA 1USTA 5AQVA 1O3SA 4P9FA 1FP2A 1LB2A 4M7XA 1QHAA 4PL7A 4H0OA 3ML6A 4CZKA 1R1TA 1PP7U 5LGTA 4FWRA 3CUOA 4FPAA 4DNCA 1AOYA 3LAJA 4OIOF 2XAGA 2NLXA 2E1ZA 2VC1A 4HBLA 2IA1A 2LF8A 3CUQB 1F9NA 1R1UA 2QENA 4L9TA 5AQPA 1IXRC 1X3UA 3L7WA 5AIQA 2HDCA 3J81K 1HKGA 4EVIA 1D8JA 2OZ6A 3FZMA 5H6RA 3SZPA 1V4SA 5AFUA 3MAJA 4UHTA 2VXZA 1I5ZA 5LGNA 1I1SA 2JT1A 3JTHA 5DYMA 4A0YA 4KT5C 2ZBKA 3U9ZA 5FPDA 3C7NB 5AQYA 1FP1D 4KN7X 2PBDA 3ENHA 5D6EA 4CZZA 1H1VA 1BO5O 3D5LA 4ZH4F 4XH4A 2FE3A 1HKTA 3L6QA 4IZ9A 3I0TA 3WXJA 3UKRB 1XQSC 2OQGA 2P5LC 2VC0A 3BWGA 3MCZA 5D4RA 3HIFA 4NO7A 4CYDA 1WWXA 1BI3A 4L9NA 1HSTA 1IN4A 2H6CA 5D5VB 2KRFA 5KQ8A 3KE2A 1IRGA 4H5NA 4HA8A 2Z99A 2QWQA 6PAXA 5FFZA 3CJCA 2FSJA 2VBWA 2CG4A 1RUOA 3H6EA 2P9LA 4M74A 3F22A 2Q2EA 1OYYA 2E20A 1FYMA 2IIRA 5BPNA 2O03A 2P8TA 4CBXA 1MWMA 2F5CA 1NGEA 4KMUX 4RS8A 3M3ZA 1TUUA 4GNIA 4FPBA 5ERIA 1TLHB 3IHUA 3R60A 4O8KA 4BRNA 4HW0A 2R3SA 1R5HA 5EVZA 1XDSA 5ICCA 3ABUA 2GWKA 3W6KB 5HDKA 5FGMA 3U8XA 4EV0A 4EM1A 5DUIA 4BROA 1KA8A 2P4WA 2V79A 5E1ZB 5BREA 3R9PA 2VODA 1NHAA 2DO7A 4WXCA 3ZP5A 2PEXA 1UHMA 3GLXA 4P5OA 2ZMEA 2MA3A 3A5LC 3EN9A 4BHCA 5KPRA 1ODDA 4ZYHA 3M1FA 4OIQF 1Z91A 5JLHA 1S3XA 4XSXF 1HW2A 3EYYA 2VT3A 1DDNA 1LQ1A 2E1NA 4JHDA 4L5JA 4K42A 2X0LA 5AQTA 2M30A 5ADXA 5DCMA 3BUZB 1K7AA 1S29A 4A5MA 3V7SA 3MZYA 2K02A 3O5BA 2PMUA 2K7LA 2GXBA 1ON2A 2QM1A 5L3BA 3BJAA 2JTVA 4BREA 4UVCA 3LWFA 1MGTA 5D8LB 3KP5A 1YIOA 1HKCA 2HQNA 3U1DA 1JXSA 2IVPA 4CZJA 1U3EM 3HSEA 4CXFA 3EZWA 2W25A 3TO6A 3FR0A 2V1UA 3FZVA 2K86A 3I54A 4CBWA 3N97A 2E1CA 3P7NA 3L0QA 5AQGA 3BJOA 4JD2A 1KAZA 4EAHD 1YAGA 2L3DA 2DQLA 2IVMA 1XMAA 4AD9A 2YU3A 2WUSA 4RWTA 2G9WA 3SXYA 3FMQA 2QWWA 3FM5A 2E2NA 3DAWA 3W0LA 2FMYA 3GX4X 3BROA 1K6OA 3QB0A 2HQRA 4WYBA 5BPLA 4I2OA 2VE8A 2HMPA 1DPUA 3FE1A 1Y0UA 1UFMA 4NB5A 3LM9A 1B9NA 3F21A 2P9KB 3HSCA 4U88A 3E6BA 3VESA 3VOVA 4A62A 1QZYA 2E7WA 2EV5A 1SD5A 3ABTA 3ZX2A 3VFZA 3F72A 3OV8A 3VEWA 2HTJA 3GFLA 2JRTA 4BXUA 4IXAA 2MH9A 2D45A 4ESBA 3FXUA 5JI6A 2C6YA 2HZTA 1LOTB 1HUXA 1ZXOA 3CI5A 2AP1A 3S2WA 4RCHA 2DK5A 5J8CA 1SAXA 3HZ6A 1XSDA 1KU2A 5KPTA 2VYPA 4RB3C 1QGPA 1KXPA 4MNUA 3JXUA 4PKHA 5CVRA 2P9PA 3GUDA 2ETHA 2STWA 4CD1A 3SZTA 4RTFD 4YFNF 2KIUA 1H9GA 5L3GA 2QUFA 3P4IA 2BTFA 1U5TC 2JPBA 4F9OA 3Q5FA 3O6WA 1FYKA 2QWNA 3DXKB 5AZJB 2IA0A 2VBZA 1MWKA 1GLAG 1U78A 1F1ZA 1U5TA 2BBYA 4XH5A 1YXQA 1X9JA 2ADUA 3EKUA 3C3WA 4IRIA 2P9IA 3HRMA 1FSEA 2MBFA 3KP2A 3GL1A 3DQVC 4UV9A 3I58A 2CGKA 4R79A 2Q97A 2EWNA 4MHGA 2FLOA 4N9IA 2AS5F 4LLNA 2RGVA 4JNEA 1U6ZA 4ENNA 4Y15A 5AIPA 4BR0A 4EM2A 3WUHA 3GE1A 4LLLA 5TRDA 3WQUA 2Z33A 4CD3A 1F5TA 1HW5A 1TNSA 2ITMA 4XRFA 2YJEA 1SZ2A 1U2WA 1CGPA 4U0VA 3LA3A 2P9UB 2CQKA 4QLCU 3CERA 3D7EO 3ZETB 3WGHA 1QPMA 4QS9A 3D2FA 3RPQA 2UZKA 4BRFA 2PJPA 3TDZC 3CQYA 1IW7F 2RQPA 4DQ8A 4I02A 1NLVA 2E2PA 1WSUA 2MH2A 3GYHX 3WXKA 1J9IA 2P7VB 2QWLA 5BOXA 3D2EB 2FBHA 2A40A 3H3UA 2HR3A 2GZWA 3R6MA 2QBYA 5AFUH 1G3YA 4FOIA 4KUMA 1T6SA 2VN2A 5AQQA 1CF7A 4M7YA 1IJJA 1ZH5A 3RJPA 4BC4A 1IN6A 2Y0MA 3LQRA 2V7ZA 4B1ZA 2W57A 5F1RA 4PGHA 4DHYA 5L3FA 3F9MA 4ISFA 5KPZA 2CGPA 1ATNA 1U2VB 4KNYA 4AIKA 4M63C 2ZJ2A 1KU9A 4EJWA 2PFBA 3IL2A 4EIAA 5JHUA 2FOKA 2HWVA 2YSRA 1ATRA 3VF6A 2ASPA 4CJ7A 1BU6O 1KGSA 3SK3A 2EA2A 2GA2A 4C23A 5BRFA 4CICA 4JK1X 4BRKA 4A2BA 1DP7P 2GXGA 1EH8A 1XDUA 4HQEA 5DD4A 3EUHA 3O1WA 3GG4A 1Y64A 1R1VA 4CZLA 1QZZA 3I71A 3DWLA 5JVTA 3P9KA 2D1HA 1SMTA 4H5RA 3VEPA 3GZ6A 2ZNZA 3B73A 4Q5SF 1FT9A 1HKQA 2A6HF 2F5EA 2ASOA 4IF4A 2IT0A 3CDHA 2D4WA 2DQRA 2YR2A 3K1NA 1SFUA 3SHFA 5E8IA 1KQ9A 2K4BA 3V7RA 1Z9CA 1R7JA 3NEUA 4FO0A 1WI9A 4BRHA 3I4PA 4WF2A 1BI0A 5FO5A 1W4MA 2FSKA 3LSTA 5LEKA 2LKPA 4CDGA 2P9SB 2DFIA 1P2FA 3I53A 4B8XA 4HF0A 1MDMB 4BGBA 4KN4X 4WK8F 4OIPF 3SMPA 3FGUA 1P8ZA 3GFIA 4FWSA 2QW9A 4OU0A 3J80Z 4AM6A 1ESVA 4BC2A 4E70A 2V51B 4FT8A 2A68F 2ZNYA 5ADXH 3O6BB 3ISPA 5AQLA 5DV5A 4I6MB 3VENA 2EJRA 5LEJA 3F8CA 1QO0D 3KEQA 3L09A 3L00A 4KICA 5D4SA 5KVRA 1L3LA 4CI6A 4HQMA 2CH5A 2L54A 1MJBA 1JCFA 1KQ8A 2RVCA 3AAPA 3VEXA 1J5YA 5IT3A 4EHTA 1U8RA 3M7GA 2EK5A 2UXXA 2Q36A 2WTEA 1J6ZA 1CZAN 2PQ8A 4RAZA 3VGKA 4LGWA 2BEOA 1T0FA 1R22A 4IJAA 4PGGA 3ULEB 1STZA 1NGDA 1O57A 5AQWA 2Z9OA 3K69A 3B8AX 1NGAA 1GHCA 1QZ5A 4UV8A 2IVNA 5JFRA 2GEMA 3QPTA 3VF2A 2HFHA 3IDHA 3IUCA 2YJFA 1GLEG 4D0PA 4NHJA 3M9AA 1ZG1A 1R59O 1SD4A 4A5NA 4ESFA 2JSCA 4M9SA 4N9HA 2VCPA 2A41A 4FX0A 4XLPF 4WX9A 3RKYA 1TBXA 4IWVA 5BPDA 2DPDA 2J5PA 1IZ1A 2XASA 4BRCA 4HTLA 4YFKF 2ESHA 4G7ZF 3OOPA 1NGGA 1T2KA 1G99A 3QU6A 4FHTA 4LK0F 4P96A 2XKOA 3ZEUA 2JZYA 4ZYGA 4MEYF 3O8MA 4FOEA 2AXLA 2V9VA 4EJOA 4LG0B 3DJCA 4FWMA 3E6DA 3VEOA 4GXOA 4I09A 4HX7A 4LD5A 2O6GE 3MN5A 1GLFO 4PL8A 4BG8A 1J2XA 1JHFA 5BN8A 3WODF 1HKSA 4BQZA 4EJUA 3E3VA 3QP6A 1EV7A 4NB4A 4WXDA 1SMYF 3LA7A 3BZ6A 1HX1A 1EH6A 2VBYA 1OKRA 3GO5A 1B6AA 2PI0A 5LGUA 1IN5A 2XROA 3IRQA 1W7PB 1Z1DA 4BC5A 1O7LA 1HW1A 5J8FA 5K5QA 3IRRA 5AQIA 4MLEA 2V7YA 1IAWA 3ZN0A 2ESNA 5EY4A 3IKVA 5CVVA 3IC7A 3QPHA 4BRAA 4F7ZA 3DPTA 5DEQA 1XB4A 1QBJA 5AZIA 5CVUA 2W24A 4CBUA 5BS6A 1K79A 5HS7A 3T5XA 2BE5F 2UXNA 4BH9A 3RKXA 4EM0B 1D5VA 1BIBA 4LMYA 3HRSA 1BUPA 5CLSA 1L0OC 1IN7A 2HF4A 4HAMA 2OAZA 5EEHA 5LLQA 1ZAOA 2J5OA 3KLNA 4ON0A 5DCFA 2M5WA 1LVAA 4A12A 5HLIA 4DB3A 1BBYA 4UVBA 1MDUB 1SQKA 3I5UA 3BP8A 5I9EB 1D3YA 1BN5A 1SD6A 2OANA 1ULYA 3AAFA 2L02A 3H46O 1FZPB 3KHYA 2COMA 3VPZA 3VEZA 2PG4A 4H0EA 1W5TA 3ENOA 3ATVA 3HTVA 1GXQA 2FF3B 5ILSA 4KIGA 2QVOA 4HDVA 3WEEB 2EA4A 2Q8KA 4L5IA 3BDDA 5BQTA 2FNAA 4A2UA 5AONA 2DK8A 3E5QA 3UB5A 3C7JA 4O6JA 2P9NA 5EOYA 1YS7A 4GYGA 3U9DA 2H6BA 3IFRA 5HOOA 2M1BA 2WWYA 2XVCA 3R0JA 2L4MA 3F3XA 1YLFA 4RB2C 4M9XA 4U0YA 4GCVA 4IRGA 1Z7UA 2F2EA 2QQBA 5A2QZ 1REPC 2IW5A 2PBIA 3NRVA 4BR9A 1ZLJA 5CJ9A 2EB7A 2VONA 2Q0UA 1T6CA 3I33A 3GZ5A 4Q47A 3HHHA 2BGCA 3O3KA 2CSOA 4R1HA 4H5VA 1YW8A 2O8XA 3F6OA 4M71A 1E4FT 5HS8A 2H3GX 2MD5A 1E17A 3GW2A 1Q1HA 1R58A 3H3NO 1HSJA 2GAUA 1Z6TA 2RN7A 3WTSC 4MEXF 1DKGD 1HXDA 5E20A 1NGIA 3RTRA 5E84A 4YIFA 5FD6A 3KP3A 2V6CA 3KETA 4LC9B 4YFXF 5HDNA 5LBQA 3K1PA 3HUGA 2ZKZA 4G7HF 1ZG3A 1OPCA 3ZMZA 3L2CA 1NMDA 5E26A 2GA1A 1H9TA 1K8KA 2ZFWA 1J0RA 2Z5UA 5TJJA 2IPQX 4BG9A 4WCGA 3QRFF 3LQQA 1ZLKA 3GF2A 3GEZA 3VOEA 2L4AA 3ZMVA 4YIIA 1J75A 2CW0F 1LNWA 4B1VA 2A61A 5KK1A 1G3SA 4QWQA 1GLBG 2P9LB 1FC3A 4HF1A 4R8HA 2ZF5O 3HHGA 4BRGA 4UUVA 5ELZA 4ZZDA 3J80K 1OMIA 3OHRA 4OMZA 1YYVA 1LEAA 1RIOH 1ONVA 2A07F 2KHOA 2KJCA 2YPRA 2EFNA 3HBTA 2HYFA 4RGXA 2BYVE 5IT9K 2XAFA 4I0AA 1A04A 3FM3A 2DTRA 1VTNC 3TPQA 4M73A 1R5GA 2YHWA 3FZKA 5J6XA 3RYPA 4EGZA 3O08A 2BV6A 4FWQA 4P55A 1Z6RA 3UE5A 1BJAA 2E7XA 3FWEA 1X3MA 3P9IA 3DXMA 5E1WA 1B1BA 4FL9A 2XIGA 5L3DA 3QICA 4HOBA 3KZZA 4L9VA 5CVJA 3TDUC 4GO1A 3WE3A 1V4RA 3ZN1A 1BG3A 4LB5A 2QYOA 4FSVA 2NNNA 3ZQ7A 4EJVA 2ZMEB 2FU4A 1BC8C 3E6CC 3NQOA 4BRIA 5ILUA 5E17F 2GWJA 1BDGA 4FWOA 2O0YA 1J59A 1FX7A 4JHDB 5D8KB 5HS9A 1P6RA 1MZBA 2G7UA 2QWOA 4EMSA 5H6QA 4HYEA 5DCMB 5FLXZ 2YCHA 2FNPA 3ECOA 4BQAA 1C0WA 5L3CA 4HV5A 1GLDG 4YDUC 3CIPA 2H27A 4IRHA 4UNOA 1BA1A 2F9WA 3HM8A 2I7NA 5LJVA 1QZ6A 2DAOA 1XN7A 3WTTC 1ZHFA 1D8KA 3PFIA 1O3QA 3FX3A 4YDUA 1EQYA 3VGMA 2VWBA 1E4GT 4O3MA 1BIAA 4PCQA 3L4IA 2E2OA 4A0ZA 1DGKN 4JD2B 4LJZF 2ISZA 3BOQA 1TYQA 3ZMTA 2WC2A 1KU7A 3CO7C 3RSEA 2A3SA 3H45C 4BVOA 3A5NC 2Y75A 3U2RA 2GQQA 5JICA 3M8EA 1K78A 2EV0A 1JHHA 4OINF 4PDKA 5EEGA 4KA4A 3UKUA 1XGMA 4WQ5C 4B1UB 3JW4A 4Y0WA 2ZXJA 3FZHA 1TQMA 3CO6C 3HSRA 3F8BA 5DUKA 5F2RA 4RGSA 1T6DA 3CTAA 3LDOA 4WQ5A 2D1KA 1LDKB 3MK6A 1ZRDA 2HTSA 1DEJA 3CUQC 2YX7A 3MFKA 1S7AA 2BUPA 5AQRA 1HBXG 2OD5A 3VGLA 1BOAA 4LFUA 4MQVA 3CUQA 3RKWA 3LFKA 3HSFA 3RYRA 1OYWA 3LDNA 3KVGA 4GY2B 2F9TA 4G6DA 4ENMA 1UCRA 3IWFA 2ZCWA 1TNTA 4L18B 3E5UA 1FSHA 3FXQA 2FSNA 5JLFA 1QQOA 3SQNA 2XAQA 3C7NA 3CJ1A 2WV0A 3WTUC 4N0BA 3KP6A 4H03B 1MD0A 2P9PB 1P4WA 2EV6A 2HYGD 1SAZA 5AQZA 1BI1A 1OYIA 5ILVA 4LG0A 2EFOA 2A5YB 3UKRA 1FPQA 4EQQA 1MA9B 4KYWA 1RDWX 2I7PA 5HLHA 2A3ZA 4DQ2A 1ON1A 4A61A 3WTWC 1S7OA 1ZN2A 4MO5A 3W3DA 4Z2YA 2ZGZA 5AQFA 4UVAA 2PN6A 4L9JA 3ULQB 1U5TB 2GWRA 2E8AA 3WXLA 4HF2A 1AWCA 2VT2A 3CJAA 2O61A 2LF7A 1NGJA 4B1XB 1RZ4A 4KIBA 2XAHA 3T1BA 4BRPA 3SMSA 2R7FA 3U4LA 1PP8F 1Z05A 3WGIA 3Q9SA 4HLXA 1YG2A 1IN8A 5CVIA 5B8HA 4AWXB 3SLCA 4IJNA 3WTZA 4RB1A 3I8BA 2FSWA 4IHSA 2XHKA 3IWZA 1X3NA 3J8AA 1H0MA 5E8GA 4BRMA 4WXHA 3LDQA 1O7FA 2XGXA 3D2FB 1V3FA 5HDGA 3R6SA 4BRDA 1JCEA 3TU5A 5BR9A 2STTA 1RI7A 3RPUA 4ENKA 1RNLA 4A6DA 2QWMA 4MGRA 3QDKA 3KEOA 4MTEA 4CHUA 2KIMA 3QFUA 1G4DA 4H0XB 2ELHA 5DDGA 4M9ZA 3MDQA 1NBWA 4HX4A 2QBYB 2CGJA 4CZGA 4RGUA 2H94A 3H3ZA 3TKYA 5A2QK 3JSPA 2KKOA 2YHXA 2W41A 1CF7B 4EFHA 4CZIA 3WGGA 4XSZF 1G6NA 4P9UA 2D0OA 2R7DA 2ZO4A 3QP5A 3DKWA 2QXLA 4ISGA 1ZYRF 3MN7A 4IXCA 3VF4A 1KYWA 4G94A 3PQJA 3CQXA 3EDPA 5BMZA 2RDPA 1FYLA 4H0YB 3N4MA 1C0FA 2FF4A 4FWKA 1WQ2A 3FZFA 3DPLC 3TOAA 4BHPA 3KCCA 4HV6A 5CYVA 3GDQA 4H0VB 4MLHA 1ZC6A 3BF3A 3F23A 3GBTA 1YW9A 2ACJA 1SFXA 4HLYA 5LRSA 4I0BA 3JAMZ 4IVNA 1XSVA 5BPMA 3WT0A 1KYZA 5D5UB 3COAC 5FPMA 3DXJF 2E2QA 3ZX0A 3S41A 4O5FA 4GYIA 1T98A 2FRHA 1XC3A 2XV4S 1ATSA 4LB6B 1G3TA 4NQWA 2P7CB 5FPEA 4LK1F 4O5VA 5ICEA 1KU3A 2DLLA 1ZRCA 4U7DA 2V1DA 4CZEA 3J7AO 4M6YA 1WOQA 5BPIA 2QQ9A 3H1QA 3BF1A 1NGBA 3A0IX 3HTUA 4JQFA 2Q1NA 2P9KA 2QLZA 3ECHA 2YI1A 5KQDA 5CE3A 4BRQA 1T39A 1QQMA 1ZGJA 4BGAA 4AVPA 5FPNA 3C18A 3QOPA 1S22A 3O80A 4I98B 5K1YA 4BR5A 3B02A 4FWNA 2FXAA 2G7HA 3KP4A 4EGYA 2DW4A 4ZZLA 1JGSA 2M87A 3VEVA 1T44A 3VERA 2F5FA 2NRHA 3A5OC 3K0LA 5D5XB 2Y48A 3HOTA
chains in the Genus database with same CATH superfamily
3ZPLA 1NJIO 2PLYA 3S1RJ 3HVRA 2ZWHA 2H8RA 1HNVA 4WQ4C 5B66C 1NWKA 2NYXA 3NF6A 2A6AA 5K14A 4WQ4A 2HYJA 3QERA 4PZJA 1GXPA 3EO3A 2HOAA 2IC3A 2JA7J 1XC5A 2Z3YA 1NG7A 3LM2A 4DSKA 5FLXK 1BA0A 3Q9VA 4RW9A 4PJ0C 2CUJA 5LRRA 2UYTA 5F1XA 5IP9J 4A0XA 2BHZA 4A6EA 4H8KA 4E7HA 3O4WA 3O9UA 3REOA 3TSPA 2GTDA 1Q18A 1E2XA 3THWA 3VQPA 1U49A 3ZETA 3DLRA 1W1WE 5GAGP 3PLAA 1K9MO 5F64A 1XX5A 3LSJA 5J3LA 4GDFA 2HEOA 2HOSA 4U0WA 3LP2A 3WE2A 5AR0A 4HX8A 5JS2A 1QNTA 1LCUA 3BPXA 4DR1K 2PAVA 4JI0K 2HS5A 3DKXA 2XPUA 4BC3A 4IOAF 1X4PA 5LHHA 3OR1C 5GIPA 3OYAA 3BG6A 3ZEUB 3EUAA 3GXOA 2DYRH 1TWCJ 2X6SA 3CJ9A 1KVAA 3HO1A 2E2JJ 1E3PA 3E5XA 1EO1A 2M34A 4OPKA 3V4GA 2OQRA 2D1VA 2R7RA 3CC2I 4KMFA 3QEWA 2NS0A 3J81Z 2OCEA 4UXNA 3TANA 1QQIA 3KK3A 4DR3K 4XK4A 1XGSA 1FXXA 3AVMA 2Q2EB 1QZEA 1VRTA 5JMVA 3SAGA 2W82A 2FD5A 4D7MA 4AILC 5AQOA 1MKMA 1WJBA 4K2EA 1FMWA 3JR9A 3H36A 3D1NI 3BEXA 3TOBA 4RB0A 2P9SA 2YV0X 3HYIA 1R00A 4BWMA 3CQZJ 3UIQA 1D4XA 2FEZA 4PKIA 4JS4A 4E7JA 1NKEA 4OMYA 1X9MA 3M6GA 4IHTA 1GT0C 1PDNC 1VQ8I 1QQNA 4CK1A 2VPLA 5J1UA 3J7YJ 2J4RA 4KREA 5E18F 2MC3A 2YNGA 1MSFC 1WSEA 4JKAA 3CC4I 1D5AA 4BAYA 2VLAA 2AA4A 3JS6A 3KIOA 2JPCA 2BY0A 3K1MA 2DT5A 4RW8A 3V8JA 3JSOA 1NM1A 2BY2A 1G3WA 2P9NB 1DTTA 2OPSA 4YY3K 2KRHA 5AQHA 3G71N 3LA2A 2W84A 2M45A 1YTYA 1MNEA 2W48A 3ULEA 1YO5C 5JR3A 4KH6A 2G8VA 3SAHA 4JN4A 2LSOA 1V4TA 3VQDA 3ZSQA 4XLCA 4DR4K 1Z77A 1NGFA 3DM2A 3RKQA 1QA6A 2ZXHA 4GGGA 4XRSA 2XRIA 2IP2A 3VA0A 4KFCA 4AYBN 1Q9XA 1EP4A 2IJLA 2OU2A 2P5VA 3LL3A 5AQNA 3CJ7A 3C6TA 4U67L 1ETKA 3OOUA 2R5ZA 4FCYA 4IHYA 4AC0A 4CGHA 2XPWA 1W5SA 4XH1A 4PJMA 4ILGB 4TV7A 5HRNA 3G6EN 5AQMA 1IV6A 1IV8A 1SFOJ 4L3QA 4IEEA 2DYSH 1C0GA 4OKEA 2YHYA 3FLCO 4OIRF 1C1CA 3OJSA 4CJ5A 1Z7LA 4BRLA 2QZ8A 4AYBA 4BVPA 2FBIA 3AA5X 2WAEA 2X6NA 1YFHA 3U9GA 1SD7A 2M0MA 1B9MA 1X1AA 3GOIA 3SDGA 2A69F 3ZOBA 4B3RK 2DT6A 2LH9A 2DA5A 3KZYA 2DJNA 1ZGAA 2E88A 3E6MA 3F8MA 3V42A 2CWEA 3TABA 3ZSWA 3CC7I 3DBLB 1J09A 3DV8A 4AIHA 2L9VA 4ZYDA 2RF2A 4IO9L 4AM7A 5GINA 3VB2A 3CJNA 2NOGA 3N05A 3B6OA 5CPRB 1VQMI 3S3MA 3SUPA 1P4XA 3HRTA 3MN6A 3WU0A 3DEUA 5J2QA 2ME0A 3GVAA 2LBFB 1FKPA 3KZBA 3ABLH 4RM3A 3WEEA 3GFJA 2QWRA 2HW3A 3TO7A 3JREA 4K41A 1N5YA 1F4KA 4B3MK 1JI8A 2ZE2A 2W40A 1NK7A 1S9GA 3S1QJ 3UKUB 3WTXC 3P39A 2LP0A 1FP2A 3DCFA 1T03A 2DMTA 2MD0A 2BANA 4FWRA 2VKVA 3CCUN 1AOYA 4Z4CA 2NLXA 2E1ZA 3RTVA 3MWPA 2CW7A 1F9NA 2QENA 4L9TA 4JP0A 3S9HA 2WBNA 4BXXJ 1LW2A 4EVIA 1D8JA 2BW3B 3MAJA 2VXZA 1I1SA 5DYMA 3TTDA 2D0AA 3U9ZA 4OPAA 2QEXN 2B9SA 2F4OB 2CV0A 1X1CA 1FP1D 3J7YP 2PBDA 4CZZA 3S16J 3L6QA 4WFNL 4NO7A 2RE2A 1WWXA 1OCPA 1HSTA 2H6CA 1YJNI 3KE2A 4LSLA 4BE0A 2Z99A 5FFZA 1YITI 3GTPJ 3H6EA 4M74A 1DGRM 3SAFA 3F22A 3ZLJA 1R4NB 5FJ8J 2K40A 4JRQA 3M3ZA 1MH3A 5ERIA 5K7FA 4BRNA 3DLBA 2R3SA 3PY8A 4II2A 3AO5A 1XDSA 2GWKA 3AVKA 3HVTA 5F04A 1KA8A 2V79A 3R9PA 4IHWA 1NHAA 4WXCA 2PEXA 4KB1A 2MA3A 4PUOA 3B6CA 1NH3A 2AJQA 1S3XA 1IKYA 3ZYYX 1CZ9A 2MC4A 2X0LA 5EG0A 1NU0A 3LANA 5ADXA 2IGIA 3MZYA 2K02A 1Y1VJ 2GXBA 3V9XA 1ON2A 1C0TA 2JTVA 4BREA 5D8LB 1JXSA 3U1DA 4JKGA 4AM3A 1P7IA 3EZWA 1QHHD 3FR0A 3FZVA 2E1CA 3P7NA 1MMNA 1KAZA 2L3DA 3AG3H 2IVMA 4LD0A 1XMAA 1WN7A 2YU3A 2JA2A 1DU0A 2R7YA 2VASA 3FM5A 4U87A 1L3UA 3W0LA 2FMYA 1IG7A 1KSPA 3K6GA 4WYBA 3BZCA 1DPUA 1RT1A 1Y0UA 4NB5A 2XB0X 2P9KB 1GOCA 4U88A 3E6BA 3VESA 4O4GA 1C1AA 1TL3A 1UMQA 3GFLA 2JRTA 4BXUA 4CA0A 3LAMA 1FTTA 1GDTA 2MH9A 4ESBA 3FXUA 4CK3A 3AA3A 2OPQA 1VNDA 1CXQA 1ZXOA 3CI5A 4KH5A 2OJED 2BVLA 4N76A 1ETYA 2VYPA 4RB3C 3FK6A 3CCQI 3JXUA 3M8QA 2KISA 2L7MP 2HMIA 4DOZA 2A6TA 4CCJA 1WH5A 1NK0A 2STWA 3O3HA 4YFNF 4XR6A 2BTFA 1VSKA 3Q5FA 3O6WA 3I8DA 2QWNA 5AZJB 2IA0A 2IDOA 2X51A 3DLHA 3CCSI 1Z21A 1T56A 2BBYA 2PY5A 3K4MA 3JRHA 1YRNB 3DQVC 4UV9A 4R79A 4MHGA 2AS5F 3DRRA 5F0HA 4BR0A 1VQLI 1RBRA 1TNSA 4CCLA 2ITMA 3AVCA 3TSQA 2YJEA 1SZ2A 4JEPA 4QLCU 3QYEA 2CUZA 3HL8A 2PJPA 1R4MB 1IW7F 1H8AC 4FLXA 2P0WA 2OUMA 2LY2A 3Q7BA 3H3UA 1W9HA 1R9TJ 1KVBA 3PIPL 1J54A 2QBYA 1Z25A 3QWLA 4M7YA 3E7LA 3TBIA 1ZH5A 2G8UA 3HGGA 4XMYA 2YHBA 1IN6A 1U48A 3CCJI 2W57A 4C1NK 2VUMJ 2HNDA 3VDXA 3KLHA 4BUPA 3LP0A 3F9MA 3D5SC 4CCMA 3H5NA 1LWEA 1MH4A 2HBKA 2HOTA 4DTNA 2G8HA 2CGPA 3LALA 1ATNA 3K0SA 3GZNB 4EJWA 5JHUA 2FOKA 5HNHA 3V1QA 2HWVA 1BU6O 1N75A 3MEGA 4J19A 4C23A 1ETWA 4JK1X 4BRKA 4A2BA 2GXGA 1EH8A 2B7EA 5DD4A 1UG2A 1EWQA 2DA4A 2V7FA 1FEXA 1QZZA 3HJEA 1ZQ3P 2ZNZA 3CDIA 3BR6A 2ASOA 2LOOA 3JAMO 2HVQA 3SHFA 1KQ9A 2Y30A 3V7RA 1Z9CA 2GOMA 4JKBA 2CJJA 3I4PA 4B1RA 4CDGA 5LMNK 3DYAA 3SQ0A 2DFIA 2EIJH 1MDMB 4BL0B 4OIPF 3SMPA 3FGUA 1VQNN 3OJUA 4OU0A 4AM6A 3IKMA 3V9ZA 1ESVA 2V51B 4CCOA 3CD6N 4B47A 3O6BB 3ISPA 5AQLA 1OQYA 3OWTA 1QO0D 2LMDA 3KEQA 4Z4FA 1FOWA 3L00A 1FIPA 5D4SA 4HQMA 4O44A 4RBOA 4IO9F 5M5XJ 2HHSA 2F48A 1T0FC 3RZDJ 4H4MA 2EK5A 1ETOA 4XNFA 1CZAN 2CQ7A 3VGKA 4LGWA 1T0FA 2W42A 2XSJC 2DMNA 2Y1IA 1STZA 2W4SA 1OVYA 1O57A 2Z9OA 3K69A 3B8AX 1RR7A 1NGAA 2IS3A 2W00A 2EBIA 4UV8A 1JLAA 1S9HA 3NVKA 3IDHA 2IS4A 3VA3A 2YJFA 1YI2I 1GLEG 2FJ1A 3PSIA 1BIUA 4M9SA 3GTGJ 4Y3OA 4FLYA 3LPUA 4YOWA 4LSNA 2MW8A 2P81A 3RKYA 1TBXA 5BPDA 5CR4A 2Z16A 4C3IJ 1KRPA 2ESHA 3KKRA 4QTRA 1T2KA 4CJVA 1KC8O 2JWTA 3PSFA 1B8IA 1LPQA 3K4BA 4QPOA 1W0HA 2RKIA 3O8MA 1F43A 5DM6L 2AXLA 3BLYA 4FWMA 3E6DA 3VEOA 4HX7A 1I3AA 1GLFO 1J2XA 5BN8A 4E1NA 2E71A 3K2PA 2VBYA 1B6AA 1Y97A 4RA2A 5LGUA 1IN5A 3VWBA 1W7PB 4BC5A 1I39A 1IAWA 4GMJB 3HJFA 4BKXA 2L9NA 4BRAA 4F7ZA 3DPTA 5DEQA 1K61A 2WAQN 2W24A 1ZR2A 5HP1A 3SYZA 2ID6A 2BE5F 1OLTA 2NVYJ 1R6RA 4DSJA 3AFHA 3HRSA 2HF4A 4YNQA 2KZMA 1LVAA 5KGXA 1S5JA 4XQFA 3IRXA 5HRPA 4A12A 3EE8A 4DB3A 1BBYA 2IEKA 3TW6A 3LNQA 1WFXA 2QTDA 2OANA 2L02A 2CH0A 3CFOA 3VPZA 3HK2A 1W5TA 3MKLA 1GXQA 5M1NA 2FF3B 1M1EB 3OYEA 4L5IA 2WAQA 1NTCA 1NK2P 5AONA 4YOVA 4XM3A 3JSMA 1J5EK 3ZSYA 4FJXA 4B4CA 2TCTA 5GTHC 2DJIA 3IFRA 2M1BA 2WWYA 3R0JA 2L4MA 3F3XA 4XICA 4B44A 2VQLA 4IBNA 3FXJA 1J53A 5GIOA 1ZLJA 4O55A 3NHGA 3VQ5A 4NLBA 3G6EI 5M3MJ 3ZSRA 2BGCA 3Q0WA 3S2DJ 5HS8A 3PNTA 3GW2A 3ONQA 3I4MJ 1HSJA 1APLC 2FX0A 3H0GJ 1ZYQA 5B3SH 3TAEA 4DZJA 2BE2A 4XOPA 3ASMA 5E84A 3K58A 4CYCB 2V6CA 4LC9B 1GV5A 5LBQA 1Z3YA 4FZZA 3K1PA 1S6PA 3EYZA 2ZKZA 5E26A 2ZFWA 5IPAA 4WCGA 3VOEA 1J75A 2ZM6K 4D5FA 3A02A 5HL7L 2M7AA 4OVLA 1E3HA 4KHYA 1RBUA 4HF1A 4R8HA 3AA4A 1N25A 2XF5A 3OHRA 5FROA 1YYVA 1HC8A 2A07F 2KHOA 1ETQA 4G12A 4EATA 3OYGA 3L3UA 2XAFA 1HNWK 2VKDA 4D7NA 1R5GA 3T7ZA 2PMZN 4A3GJ 3O08A 1Z6RA 1S1VA 1BJAA 5CYQA 1TL1A 1OVQA 1B1BA 4FL9A 1EA3A 4JV5K 3QICA 3KZZA 2K9NA 4GO1A 4JYAK 3ZN1A 4NXNK 4JX5A 2NNNA 4EJVA 4JI3K 5J47A 4X66K 3ULDA 2E5LK 1J59A 1FX7A 4JHDB 2CMPA 1JKRC 4XORA 2G7UA 4C8NA 1TL8A 3H5RA 1GLDG 4IRHA 4UNOA 1TC3C 1BA1A 4PA1A 2PMZA 4YIRX 3HM8A 1QS4A 1QZ6A 2DAOA 1EQYA 5EU7A 3L4IA 1DGKN 5CHIA 4DLEA 3PIPF 3ZMTA 3PJRA 3OIPA 3A5NC 1RT4A 2QEXI 2HDDA 1JHHA 4PDKA 2ATQA 4LF7K 2G8IA 3HSRA 2XGCA 3BTLA 4RGSA 3P5JA 1T6DA 3DBHB 3MMYB 2PZSA 2D1KA 5E79C 1ZRDA 1LFUP 2HTSA 2F8SA 1S7AA 2BUPA 2HZDA 5AQRA 1IUFA 3ZT0A 1RKWA 3RYRA 1JTYA 2F9TA 1UCRA 2UUZA 1TNTA 4ELUA 3AO2A 2XAQA 1X2MA 3WTUC 4E4HA 4FJHA 4N0BA 1MD0A 2P9PB 2EV6A 3A2FA 1SAZA 5AQZA 4B3XA 1OYIA 5ILVA 4LG0A 3A03A 1FPQA 1YVUA 1ON1A 3OS0A 1S7OA 4M41A 5AQFA 2N8GA 2DDAA 4UVAA 3W2VA 2E8AA 4ZTFA 4KKOA 1AWCA 3MKZA 2O61A 1TKTA 4G6TB 2XAHA 3T1BA 3SMSA 3V1OA 2R7FA 3U4LA 1JXBA 3Q9SA 4HLXA 3DLKA 1WBBA 1LAVA 1JLCA 2EX3A 3EY1A 3WTZA 4RB1A 2HHWA 3AG2H 2KZGA 1CQTA 2DA6A 4XLEA 3IWZA 3J8AA 3Q0VA 2FC0A 3LDQA 3I55N 3D2FB 4XRSG 5HDGA 5F0FA 4BRDA 1JCEA 1EXQA 3DPUA 2QWMA 2R7XA 1WPKA 2DDBA 4RDUA 4CHUA 2ELHA 2ELJA 3LWLA 3A1YA 2H94A 3H3ZA 2QKMB 4CJFA 1HYVA 4EFHA 4ICLA 2ZO4A 1P9QC 2QXLA 4ISGA 3MN7A 4IXCA 4CEBA 3SUQA 1YHQN 4G94A 3PQJA 2R5YA 3SJMA 3EDPA 5H1SQ 1TK8A 1L3VA 3MECA 2E1MB 1C0FA 1WQ2A 3DPLC 3TOAA 4HV6A 1JLEA 4MLHA 3GBTA 1YW9A 4HLYA 1VQKI 1Y8QB 4A5AA 4I0BA 2X1DA 1XSVA 5BPMA 3PX6A 2KZVA 3K4CA 4W5QA 5D5UB 4N56A 4DTRA 3COAC 2CU7A 3ZX0A 1BQNA 4DTOA 2O8DA 1V5GA 2DLLA 4U7DA 2YU9J 5C10A 3J7AO 1YIJN 2HBLA 4M6YA 4C3HJ 1NGBA 1TAUA 3ZSZA 3HTUA 2QLZA 2X48A 4XIUA 2HHTA 3TAMA 3K4NA 1QQMA 5FPNA 3C18A 1K8AO 4M3GA 4DTPA 2MABA 3RVCA 3VQCA 2IBDA 4EGYA 4ZZLA 1NK4A 2F5FA 2VQHA 5D5XB 3B6PA 3HOTA 4E0DA 4BHBA 2QWPA 2D2WA 4KAZA 3C1DA 4Q4ZF 3T0YA 4D5CA 3F8FA 1BOTO 2GUIA 1XG1A 3SFZA 4Y13A 4F91B 1WRJA 1FLIA 5ICGA 3DXKA 3KD5E 3HRUA 2GELA 3E01A 4N41A 5HODA 3OYKA 1BIZA 2ZJPL 1IF1A 3M1EA 4QS7A 4CIFA 3NF8A 1OR7C 3LAPA 3AVIA 2NZTA 1OR7A 1TWGJ 4FZYA 1ZRFA 4S05A 1R23A 3A5MC 4LY7A 3S2HJ 3DF8A 4OX9K 3E97A 4BR2A 2HKXA 4G6QA 2VG6A 2NNYA 4JK9A 3KPHA 3TW7A 2D0PA 2UU9K 2EZHA 4UUSA 3D2EA 4KTQA 1LDJA 2P6TA 3VODA 1XMKA 2LKXA 4H0PA 4NDLA 3A8YA 4FJLA 4JRPA 3H92A 1ZBFA 2L2OA 4CVNE 1MJ9A 5D5WB 2EFQA 1XNQK 1Q82O 4B1YB 1UG0A 2NAZA 5LHIA 4IO8A 4W1UA 1U2VA 3ASNH 2GV9A 1ZTRA 2QQAA 5J2MA 1EH7A 4PKGA 2FBTA 2VG7A 3QMLA 2DU9A 4Y7NJ 2EFPA 3S15J 4BNCA 1IG8A 3J7AP 2PMHA 2OA8A 4RW7A 1KVCA 4DUYK 5FKOA 1XSXA 3CHWA 1NK5A 2QKBA 4H0TB 4RW6A 4LITA 2OPPA 3KZIC 4M72A 4H5TA 2V9PA 1YS6A 4NC7A 4ZTJA 2YKNA 1W36C 4KBOA 3TQNA 2VOOA 4BDPA 1SV5A 2V1XA 4FWPA 4KIFA 4BBSJ 1RUNA 5ICFA 2VE9A 2X4HA 3C2HA 2VJ5A 1KQ0A 4E3SA 2DT7B 5C0YA 3T1YK 1UELB 1ZR4A 2FOWA 3TGNA 3ZR8X 1YVNA 3D45A 3O9RA 4DS5A 3HI0A 1ENHA 1BC7C 4Z94A 5EX5A 4CZMA 3CMAI 4L8RB 5F0CA 3WTYC 1TWFJ 4R5PA 3MN9A 1LAWA 3VYRB 4CIEA 3J80O 4CJ4A 4BDYA 4MO4A 1REVA 5M3FJ 2B4JA 3NH0A 3MVPA 4LOCA 2VGNA 3IMXA 4KDPA 3K2ZA 3W2AA 3AARA 3AVAA 3P83D 4KHQA 3QFPA 3FFKB 1FWZA 5AQSA 3H3OB 2EWSA 1TUYA 3K9TA 3IKTA 4O8UA 4OAZA 2V6EA 4J8FA 4KI6A 3DP7A 3R0AA 3JAMK 3P1GA 5FLVA 2MLGA 3R4KA 2VOPA 1LKXA 5AQJA 4IEIA 2KJBA 3HEFA 4LLGF 1VQON 3ATUA 3I0RA 3K9KA 4XBFA 2AHQA 2FA5A 1W97L 2GBZA 2E5NA 4Q48A 3AVNA 3FMSA 3IP4B 4BJTA 5IY5H 4AQYK 2OA4A 1ERDA 3LSMA 4RM2A 3SV4A 1H88C 3J7ZI 2XB5A 3HUGB 2TDXA 1XD7A 5L3EA 1K8KB 4BR7A 2XKPA 3ZMDA 4CJ3A 4DR6K 4E7IA 3RI4A 1XGNA 3TO9A 2OTJI 2K5CA 3FHNA 2HPIA 2YNFA 3NARA 1PUEE 4HWIA 1JL1A 4BQLA 5E1XA 4YELA 4I01A 4YOXA 2ISYA 3HKZN 4FX4A 1WKMA 4DTUA 3VQEA 1XCBA 3MMVA 3BY6A 2MLKA 3QNOA 2XAJA 3MZHA 4CJEA 2F6CA 2HU9A 3DXMB 3LMMA 1KLMA 3CC2N 3CPEA 2CYYA 2VG5A 1L3TA 1IUYA 1B59A 4HZFA 3CJBA 3D0SA 1YTUA 4K43A 3Q7CA 3BJ6A 3HKZA 2G8WA 3A01B 1KZHA 2O3FA 3MCAB 4FJMA 1TGOA 5D6FA 3SUNA 4AU7A 5BN9A 3NAEA 4LF9K 3TMOA 5C42A 3PQKA 1TQPA 3THVA 1G2HA 2RC4A 4GFBA 2RKHA 2EFWA 4YRVA 4ENJA 2P5KA 4IG0A 3S17J 2ZD1A 2XGDA 3ALYA 4WE1A 1TYQB 3DKYA 4O5BA 2DBBA 4KHWA 3W6JB 4BYYA 4JAXA 2QM3A 1EJ9A 1LJ9A 1FBUA 3CCLI 1HQCA 1K78B 1R36A 2PJRA 4JBAA 4K25A 4ITVA 1TQIA 1LB2A 4F55A 4H0OA 2QF7A 3VSLA 1JKOC 3WHCA 4PJLA 4FPAA 2VWKA 4DNCA 3LAJA 3LOCA 1OCOH 4Z4GA 4AF1A 2VXDA 1MMDA 1R1UA 2R7WA 1IXRC 1X3UA 4AVZA 3T19A 3AKZA 1V4SA 4B9TA 3BR2A 5J2PA 1I5ZA 5LGNA 5A2QO 3JTHA 3AVGA 4AHUA 1D9FA 3BQYA 4A0YA 4KT5C 5IOZA 2ZBKA 4KN7X 2QCOA 4AIDA 5D6EA 4XH4A 4ZH4F 4FJIA 1HKTA 3AG4H 4AHCA 2WC9A 4IZ9A 4C8MA 2WAFA 2L7ZA 2OQGA 2P5LC 2KP6A 3BWGA 3UR3C 4UUTA 4JI8K 3S14J 1IDZA 1BI3A 1HQEA 2EHGA 3O4NA 1IRGA 4H5NA 1RUOA 1FYMA 2IIRA 3ZRGA 4HRIA 2P8TA 5BR8K 4CHZA 1MWMA 1NGEA 1BOBA 1RDCA 3RMCA 4V2GA 4BJ5C 3K57A 4HW0A 1JLQA 3ABUA 4E89A 3SI6A 3B6AA 4EV0A 4Z4IA 2ZMEC 4QIWN 2ZJPF 5BREA 3ZP5A 4IEJA 4B3OA 1TVRA 2ZMEA 2JRMA 3T1AA 1FJGK 3EN9A 4CESA 1Q9YA 5KPRA 1ODDA 3M1FA 5JLHA 2GLOA 3HOZJ 1X2NA 2G8KA 4FJ8A 4AHVA 3RQ4A 4L5JA 4Z6YA 5AQTA 4DF4A 5DCMA 1K7AA 3V7SA 2K7LA 2R7QA 2QM1A 2HNZA 2HNYA 3KP5A 1IGNA 2HQNA 3TTFA 4CZJA 3CJRB 3AVFA 1U3EM 1RPWA 4IL6C 3G1OA 2K86A 3N97A 2P5GA 3BJOA 4JD2A 2LFBA 2D0CA 4EAHD 2E2IJ 3QEPA 3VPRA 2OYQA 3ZT4A 4RWTA 1VSDA 2QWWA 2RHKA 1JKHA 1VQMN 5GAEJ 1D0ZA 1B8IB 4NQWB 3QB0A 2HQRA 2HMPA 2E2HJ 3HP6A 1ZBLA 3E1SA 1D8YA 4A93J 3VQ9A 5EDNA 4FM1A 2V9KA 2DODA 1GOAA 3LM9A 1B9NA 3F21A 3VOVA 1QZYA 1SD5A 4RAFA 3ZGKA 3OV8A 1J5OA 2HTJA 2EIKH 4XRMA 1A6IA 1OH8A 4H4OA 2V26A 2NVXJ 1HUXA 2AP1A 2JVHA 3AO3A 2DK5A 2KQ2A 1SAXA 4HNTA 1QGPA 5CVRA 3GUDA 3H9GA 2HVIA 3OMYA 4EEFG 2KIUA 1Z67A 5L3GA 2QUFA 1FYKA 2VBZA 4XH5A 4IRIA 2P9IA 3MAQA 2MBFA 3KP2A 3H5AA 2EWNA 2FLOA 4N9IA 1RBVA 3I4NJ 4IX7A 1U6ZA 4Y15A 4B8AB 4CJKA 4LLLA 4LH5A 3WQUA 4S0HB 1F5TA 3A0HC 3HG9A 1YITN 2O4IA 2CQNA 3CPWM 3NF7A 4U0VA 1RESA 2P9UB 2CQKA 2IGOA 1NJZA 1QPMA 4QS9A 5HRSA 1RBSA 3RPQA 1UAAA 4I02A 1NLVA 5F27A 1WSUA 4DYCA 1Z26A 1DU6A 2P7VB 2QWLA 5HROA 2HR3A 1UOCA 4N47A 5AFUH 3T1HK 2XRLA 3IH4A 2L0KA 4BC4A 2KFZA 1YIJI 5F1RA 4PGHA 2L9SA 1JGGA 1C1BA 2WONA 4CEOA 1D5YA 5J1RA 4KNYA 4AIKA 4XLHA 1KU9A 2PFBA 3IL2A 2ZB9A 2PFUA 4B3AA 4M3RA 1R0AA 2EA2A 2GA2A 4CICA 4QOZB 2HXIA 3A2KA 4C30A 1DP7P 1C6VA 1MBGA 3PO5A 2KZZA 3O1WA 5J1YA 1OH6A 4IHVA 4MDBA 5JVTA 2IXSA 4CW7B 3VEPA 3GZ6A 4B8CA 4CHQA 4BEHB 4A3CJ 1HKQA 2A6HF 2IT0A 3CDHA 2D4WA 1MBFA 2DQRA 2YR2A 3K1NA 1SFUA 5E8IA 4CFCA 1XS9A 3NEUA 5EF6A 1NK3P 3MD2A 4FO0A 4DFMA 4JK8A 4FQGA 5EGOB 2VL8A 2XGEA 4B8XA 2P5OA 4HF0A 2JWKA 5KGWA 3DTEA 4P1WA 1E3MA 4FWSA 2KMUA 3OYLA 2F4MB 4GKKK 4I99C 2CV1A 2WA0A 5DV5A 1N6QA 4I6MB 3VENA 4KFBA 4I2QA 5MLCQ 4FW1A 1W0UA 1B92A 4KICA 3NVMA 1L3LA 3CCQN 1JCFA 1KQ8A 1T08B 4C1NI 5GAEP 3PIOF 2UXXA 4BDZA 4MFEA 2BEOA 1R22A 2X6OA 3PNVA 4IJAA 4PGGA 4DV7K 3THXB 1O13A 5IOYA 1BCMA 2DA1A 2G8FA 1QZ5A 3G4SI 3QPTA 2EH3A 2HFHA 1VQLN 3IUCA 3MEDA 4AHTA 2PYJA 4D0PA 4NHJA 3M9AA 4Y1DA 3J7AY 1R59O 4A5NA 2M8GX 2JSCA 2DY4A 3T69A 4BY1J 2W6KA 4IWVA 3M8RA 4YFKF 2KFDA 1NGGA 4F3QA 3QU6A 4PUSA 3E9LA 2X85A 1D1CA 2HHUA 2IGMA 3ZEUA 4ZYGA 3HXLA 3H35A 4OLAA 4MEYF 5M1OA 1K4SA 2VPRA 2V9VA 4LG0B 3DJCA 2XHBA 4I09A 4LD5A 4PL8A 5CQEA 4EJUA 5FRNA 3E3VA 4NB4A 3QNNA 1OFCX 1HX1A 4XKCA 3ZCOA 3IRQA 2XROA 2PX9A 1O7LA 1HW1A 5K5QA 3K5LA 3MKWB 4MLEA 1JT6A 3ZN0A 5HBMA 3IC7A 4WFAL 3QPHA 4D1QA 3L2VA 2K3PA 3J81O 1XB4A 4RMNA 1QBJA 5EZHA 2R93J 3C2GA 1SEUA 3CF5F 1K79A 3GTMJ 3T5XA 5FDLA 1OCRH 1GVDA 4EM0B 1X1DA 5HRRA 1BUPA 3CLQA 1IN7A 5LLQA 2M5WA 3SEQA 1MNMC 4CF1A 1JUPA 1WSFA 4UVBA 4CEEA 3FISA 2F4IA 5I9EB 1FZPB 3KHYA 3OL3A 2M2EA 2COMA 3VEZA 3D6RA 2XO7A 4YEJA 4H0EA 3ENOA 5FKLA 3HTVA 5ILSA 4KIGA 4HDVA 2EA4A 1VQOI 1RTIA 1AHDP 2FNAA 4A2UA 5J2NA 4JI5K 3E5QA 3C7JA 4O6JA 2P9NA 3TEDA 2D0BA 5HLFA 3L2RA 4ELVA 3EEQA 1Q81O 1JJ6C 2XVCA 2XC7A 4RLQA 4RB2C 1QVGM 4GCVA 4UB8C 1YE9A 1Z7UA 1M1KO 1ZBHA 3HHHA 1E3OC 2CSOA 3K9JA 2DOAA 4R1HA 3LAKA 1YW8A 3U21A 1T3VA 2H3GX 1E17A 3ZXSA 1D1AA 4M3UA 5SZTA 2GAUA 4PWDA 4B9NA 2RN7A 3WTSC 4MEXF 1DKGD 4D9JA 1V5EA 5E20A 1NGIA 1XMXA 4YIFA 3KETA 2JQ7A 2DFEA 4A3LJ 1TZLA 1YI2N 4LIUA 1OPCA 2HBMA 3L2CA 2GA1A 2F5VA 1SVMA 3K5NA 4EP4A 4HPQA 4DBRA 2BHYA 3QRFF 2L4AA 2CW0F 2Y69H 4FK2A 3MKYB 2A61A 1G3SA 3FBIB 4QWQA 2GX9A 2P9LB 1FC3A 4ZC3A 1SUQA 2ZF5O 3HHGA 5ELZA 3J80K 1OMIA 4CCHA 1LEAA 4DJAA 1F36A 2KJCA 4LG3A 2YPRA 3HBTA 4RGXA 2BYVE 4F92B 1R5ID 3VYTB 2DTRA 2GXAA 4J2DA 1K4TA 3F0CA 3RYPA 4HNUA 4BU2A 1XNRK 5E1WA 2XIGA 2OTLN 5L3DA 4HOBA 4GKJK 3TDUC 5M1QA 3WE3A 2BH1A 1BG3A 3JRDA 1A5XA 4LB5A 2QYOA 2BGGA 1BC8C 1VQPI 3AO1A 3NQOA 4BRIA 3HZJA 1G15A 3BY5A 3RWUA 5E17F 2B63J 2O0YA 1P6RA 1MZBA 4CEZA 5H6QA 3J7ZO 5FLXZ 1C0WA 2WBMA 4YDUC 1KLNA 4CCKA 2UUBK 1D0XA 1BW5A 3CZ6A 2COBA 1ZHFA 4YDUA 2HI3A 2VWBA 3NGZA 1NNEA 3OIOA 4PY5A 4A0ZA 1VSMA 3VQAA 2LBFA 2A3SA 3U2RA 2HB5A 3M8EA 2EV0A 1S7EA 5EEGA 4KA4A 3UKUA 1XGMA 1LFBA 2HDWA 1IJWC 3F73A 4B9SA 2I8DA 3F8BA 4DYRA 1HNIA 5JVGF 3CTAA 3LDOA 1Y6IA 1DEJA 3GTOJ 2XY8A 1X3WB 2EIMH 4CF0A 4JOMA 4LFUA 4A3IJ 3LFKA 3HSFA 3IH3A 3LDNA 3KVGA 4V2FA 1NOZA 4GY2B 2IAJA 1XC9A 5E3OA 4ENMA 3IWFA 5F08A 4L18B 2NVTJ 2BW3A 3FXQA 3U6FA 1SL2A 5AJ3K 3KP6A 4H03B 1P4WA 2K3FA 2HYGD 1VQ9I 1BI1A 3SEZA 3G1LA 2EFOA 3NCIA 4EQQA 1BHLA 2YNHA 2GBYA 1NG6A 5HLHA 2A3ZA 3EPZA 1W7AA 4L9JA 1U5TB 1X9SA 2X1EA 2ZXWH 3WXLA 1XI1A 1NMNA 2VT2A 1I50J 2LF7A 1NGJA 2VKEA 1RZ4A 1Z05A 1YG2A 1IN8A 5B8HA 2RREA 3KK7A 4IJNA 1DQUA 4M3WA 4IHSA 2XHKA 4UB6C 3H9QA 4Q5VA 3D0PA 3A4CA 3QINA 4H4KC 4XKVA 3TU5A 2STTA 1RI7A 1JJ8C 3RPUA 3OYCA 4DGWB 4A6DA 2ICWG 2KPMA 3QDKA 1NK9A 4RAGA 4Z4HA 2KIMA 3FXOA 3QFUA 5DDGA 4M9ZA 4HX4A 3OYJA 3TKYA 5A2QK 2W41A 1CF7B 4OPHA 3CFRA 2HVSA 3WGGA 3WNFA 4P9UA 3V81A 3PO3J 1FK9A 3QP5A 3DKWA 3VF4A 2KL4A 3U3GA 4MO7A 5KHDA 3H3VK 4FWKA 3P38A 3IS9A 3KCCA 5CYVA 3GDQA 4H0VB 1ZC6A 1S5LC 3AV9A 3IAS2 4A3BJ 3WT0A 5C2DA 3S41A 4O5FA 2O8BB 4GYIA 5JLXA 4Z4EA 3DU6A 1XC3A 4QCLA 3ZQIA 2XV4S 1ATSA 4V19S 2ZFUA 5ICEA 3RMBA 4A57A 3HL2A 2DMQA 1WOQA 5BPIA 1U04A 3A0IX 2F96A 4FM0A 3DRPA 3W6VA 3F2KA 2P9KA 3JRGA 4BRQA 4BGAA 4GV3A 4DF8A 4LFBK 2KHMA 3O80A 4I98B 4BR5A 4HUGA 3TTCA 4KHNA 3KP4A 1G8XA 1B72B 4CHPA 1T44A 3VERA 2NRHA 3A5OC 3K0LA 2LTPA 2Y48A 4BACA 4OOIA 3WG9A 2RNJA 3HPGA 4M6XA 3DEWA 1S6LA 1BM9A 1PUFB 1TW3A 1BR1A 3HBLA 1MBJA 1F21A 4NYNA 2NRZA 2FBXA 1HNXK 3AAQA 5AZJA 3BDPA 3K4LA 2LYCA 4FJ9A 2YX4A 2K9LA 1YRNA 2Q0RA 3O1BA 3FF5A 3LSGA 3OIQA 3VQ8A 1Q1VA 1MU2A 4RGRA 4DQPA 4Y52J 4NBQA 3HOXJ 2ZGYA 3H1CA 3CQ8A 2E1YA 4U7BA 2CH6A 2NXNB 5DM7L 1HF0A 1PJRA 2AXTC 4DU4A 4OKKA 4H5WA 1HJOA 2VJJA 1HLVA 1T8IA 2K9QA 1XGOA 1T38A 3N4PA 2XY5A 4CO8A 1UB9A 2GUPA 3VETA 3VQBA 4ZDPA 1RFQA 5GADJ 3QAHA 4KISA 4OO1J 1FBSA 2XRNA 2IA2A 3WXMB 2M8EA 4M3EA 3NH2A 5DD8A 3RRHA 3JRAA 1A6QA 3ID8A 2MGQA 3C6HA 4BY9C 1XCVA 5K5RA 2IAIA 2UWMA 2BY1A 2ZSIB 3VEYA 1GVJA 5AQUA 1O3TA 3P31A 3GTLJ 3ELKA 5K7HA 3SJHA 3FHZA 3TARA 2O8CB 3SYTA 3LSIA 5B1AH 1FBQA 3RMDA 2DI3A 3BG7A 2QKLB 2O8FB 5FFXA 3CETA 3K5OA 5AQXA 3QBWA 2Z2SB 5C4XJ 2LD5A 1YOVB 1C0UA 1TT0A 4DW6A 3IAYA 4B09A 2NOJB 3GFMA 4OPJA 5BRDA 1U6GA 1QPIA 1VQKN 1I1GA 1BWFO 4FJ7A 1U8BA 4CCNA 1FY7A 2HGCA 3WQTA 3G73A 3NFAA 3T8TA 3FZLA 3OYBA 1ACIA 2E34A 4BQOA 5AZIB 3ZMUA 2E36A 3BC8A 5LY3A 4DQIA 2H09A 5ED4A 1BI4A 2GIVA 1TT5B 4AHSA 1MDMA 4MTDA 1W36D 2ITGA 3WXIA 3WTVC 4YOUA 2NRAC 3OYFA 4LF6K 3LDPA 3FXRA 2Q31A 2AQEA 1KAXA 4FXDA 3P9CA 1OISA 2A5XA 3HM9A 1HPMA 3LZIA 3L2QA 4J2EA 5J4YA 3BTIA 4ABZA 4ETSA 3OVNA 4EJTA 4HG2A 2WY7Q 3I56I 2JUGA 3AVHA 1DT9A 2LREA 4S04A 4MQ9F 4ASNA 1IBMK 1BGXT 4DV1K 5IT9O 2W7NA 1ZARA 5F6FA 2FBKA 1D9DA 1WUAA 3O8GA 2K4JA 1DUXC 3BR0A 2HF3A 4FWLA 4RAYA 5TKYA 4UY8O 3ISNC 5TISC 2CUEA 5FB2A 1S9EA 2KFNA 4CF9A 2CV2A 3EYIA 1X1BA 3V1RA 1MMGA 2W1OA 3F6VA 3HP9A 1ZELA 1VFCA 3KP7A 2XY7A 3CXCM 2WADA 4DCHA 3HOSA 1ZBSA 4ZJZA 1WHUA 3EQLF 3PX4A 2Y9YA 2Z1HA 1LDDA 4PJNA 2G0EA 1NG9A 4BGDA 3CMEN 3MQ0A 4L5EA 3HTSB 2X6XA 1HKBA 4CSWA 3GTJJ 4B3SK 3BR1A 3CCMI 1RR8C 4MDAA 1UA1A 1ZG5A 3JRCA 4NNJA 4B9QA 3OL4A 4XOTA 1NGCA 2A42A 4M3TA 1USSA 3WNHA 1IRFA 2M3AA 3AGRA 1WJFA 4XKWA 4YG2F 3FFIA 1W7PA 2P9IB 1YW7A 5M1FA 1ASUA 1VSLA 1U4BA 1UHWA 2O8EA 2KRCA 2DFHA 3SNNA 5M1PA 3GTQJ 5KRSA 2LVSA 1W5CC 3AL0B 4CZFA 2L7KA 5GADP 1DTQA 2FMLA 4KHUA 2V52B 1FKOA 3WU2C 4DFJA 4E1JA 1IXCA 5IT9Z 2Z1IA 3ZT3A 1ORKA 3GLLA 5LFAA 2VJ4A 4DUZK 1UAXA 1QHGA 1WJCA 2B6AA 2DPUA 1YQAA 4DKWA 2QI2A 3A0BC 4QS8A 5CZ1A 5J1EA 3K5MA 5M5WJ 2R7OA 1Q8IA 3I59A 1IC8A 3NWSA 4WWCA 1FNNA 3CMMA 4LF8K 3RDIA 4DSIA 1TW2A 3V9UA 3RSEB 4ESJA 3LDLA 1XHXA 4LFCK 4EHUA 4ELTA 1FOYA 3CMAN 1NGHA 4X65K 3F8NA 1USTA 5AQVA 1O3SA 3HT3A 4P9FA 4FK4A 4PL7A 2A1SA 3ML6A 4CK2A 4M3FA 1FTZA 2WB1N 4W5RA 4BS9A 3CUOA 4OWRB 4CJSA 3ABKH 4FLTA 4FETA 2IA1A 2KT0A 2LF8A 3CUQB 5AQPA 3NH1A 2RQQA 5AIQA 2HDCA 3J81K 1RILA 2H1LA 2OZ6A 4JK7A 3CCEN 3FZMA 5AFUA 4UHTA 2QXFA 1SANA 2BOLA 3C7NB 3ENHA 2JN6A 2JLEA 1H1VA 4IFEA 4CYCA 4RLFA 3BCAA 3ZSOA 3I0TA 3WXJA 3UKRB 3G0ZA 1XQSC 2VC0A 5EEAA 5D4RA 2OTLI 3HIFA 3BGRA 2WB1A 3LSPA 1M90O 1IN4A 2CQQA 5J4VA 4JI4K 2KRFA 1LWCA 4HA8A 1OCZH 2NRRA 3MXMA 6PAXA 3CJCA 2HQAA 4FJNA 2FSJA 2EZKA 1GLNA 3CCVI 1SKWA 1VQ5I 4HVJA 3OTOK 3DMJA 4CZCA 3MWTA 4GW6A 4RS8A 2LY9A 1I94K 2OTJN 1SS6A 3IHUA 3R60A 4O8KA 1R49A 3HSTB 3W6KB 4BXFA 5HDKA 4XN3A 3OYIA 3G1MA 5FGMA 3U8XA 4EM1A 4BROA 2FQ4A 2VODA 3KYLA 4P5OA 1BQMA 3A5LC 4BHCA 4F4KA 4OIQF 1Z91A 4XSXF 1HW2A 2VT3A 1LE8B 1DDNA 2E1NA 1Y39A 4JHDA 1ILYA 5IYDJ 2MFZA 2R92J 5DM7F 3BUZB 4DTXA 1J9AA 1S29A 4LH4A 3O5BA 2OF7A 2O5RA 5L3BA 1LWFA 3OA9A 4UVCA 1YIOA 1HKCA 3TAPA 2E60A 2IVPA 3L2UA 3HSEA 4CXFA 1QVFM 3TO6A 2V1UA 5AQGA 3L1PA 1YAGA 2ID3A 3KYCB 3ZT1A 4HCBA 4LFAK 1RT7A 2WUSA 2DXIA 2G9WA 3SXYA 1Y56A 1JL2A 1TKZA 3DAWA 3GMEA 3GX4X 1ZKGA 3IV5A 3LSRA 2VE8A 1YJ9I 4KJZA 4FJJA 5D3GA 3FE1A 3CCLN 1UFMA 3HSCA 4A62A 3S1NJ 3I0SA 3VFZA 3F72A 2JWLA 1N32K 5IP6A 2ECCA 1O4XA 2ELKA 4Y1CA 3KK2A 2D45A 1AKHB 1S1XA 5JI6A 3ZT2A 2C6YA 2HZTA 1LOTB 2HSTA 2CUFA 3S2WA 5J8CA 1BW6A 4CERA 5KPTA 4ID1A 2ZC2A 1KXPA 4MNUA 1YX3A 2K85A 3LP1A 1HQUA 2P9PA 2XSDC 5DMRA 4B9VA 3SZTA 3TP3A 3P4IA 3OR2C 2QSFX 4F9OA 1A36A 2IS1A 1GLAG 4JX4A 1U78A 1F1ZA 4X6AJ 4DSLA 3RSNA 1X9JA 1KFDA 3GL1A 1QSLA 1A5JA 2Q97A 2R7UA 1RTDA 2RGVA 4ENNA 5AIPA 1CZBA 4EM2A 3WUHA 3OSFA 4CD3A 1WI3A 3M8JA 5E41A 1U2WA 3S32A 3LA3A 4O0IA 3THWB 3RMAA 2V1NA 3CERA 4BWJA 3D7EO 3ZETB 3DI6A 3D2FA 2VI6A 4BQQA 4BRFA 1VZ0A 3AO4A 2RQPA 3L2WA 4C2UA 2E2PA 2MH2A 3GYHX 3WXKA 1QQCA 2A1RA 3VQ6A 3DBRB 2FBHA 2GZWA 3R6MA 3KYDB 3NDKA 3LP3A 3S3OA 2QA4I 4CGGA 4FOIA 1LV5A 5AQQA 1IJJA 2DA7A 4HNVA 3RJPA 1UJ8A 2Y0MA 2V7ZA 5K7ZA 1VSFA 4B1ZA 2OCCH 2E1MC 2CQXA 5L3FA 3K4KA 4I6ZA 3ZQHA 5KPZA 3UNGC 1W2BM 1HPZA 3C94A 4FJKA 2OPTA 3JRBA 4M63C 4UQGA 4EIAA 1U9NA 3IH2A 5GPAA 2YSRA 3VF6A 2ASPA 4JKCA 3QYFA 1WJAA 3EUHC 1KGSA 3FK7A 1HDPA 4DS4A 2D5RA 4GRIA 4CE9A 1XDUA 4HQEA 4DBQA 3EUHA 1BA5A 1Y64A 4DIQA 3FBNB 1JLFA 1R1VA 4OKJA 4CZLA 3I71A 1SMTA 4H5RA 1NOYA 1Q86O 2F5EA 2K9MA 4J2AA 1ITGA 3S1MJ 4GVMA 1POGA 4DV2K 1R7JA 2JA5J 1WI9A 4BRHA 4WF2A 2FSKA 3LSTA 5LEKA 2LKPA 3QODA 2P9SB 1TKXA 1V54H 1P2FA 1HCRA 4WK8F 1T33A 1QSSA 4XONA 5EJCA 4BC2A 4KH4A 4E70A 1NJWA 2ETJA 1T05A 3QO9A 4CHYA 4A3DJ 2EJRA 5LEJA 4FYDA 3F8CA 4CEFA 3L09A 4CH7A 1X19A 3ENBA 3OYMA 4CI6A 2CH5A 3SPZA 2L54A 3NE6A 1WSGA 4LIVA 2YNIA 3VEXA 4JYKA 1IRZA 3L3VA 1J6ZA 2PYLA 2EINH 4RAZA 3TAFA 1PVEA 2Y9ZA 3KD1E 3ULEB 2QK9A 4B48A 4C8LA 2LK2A 3SUOA 3PV8A 2IOCA 2IVNA 3RR8A 2MG4A 1WCMJ 1ZG1A 4F2RA 1GUUA 4QAGA 4N9HA 4FX0A 3NGYA 2DTUA 4A3FJ 2DMPA 4NCAA 3H0DA 4CEAA 2KIQA 1RTHA 2J5PA 3RRGA 4DQRA 4BRCA 2OZMA 1WB9A 4G7ZF 3WG7H 2R5ZB 1G99A 2BXYA 4P96A 2JZYA 3EE9A 3U3YA 3HC7A 3HRGA 3G2BA 2HVRA 1EX4A 2EQRA 2UXDK 3MN5A 3CCRI 4BG8A 2JA6J 1FW6A 4ILHA 3WODF 1HKSA 5DM6F 4BQZA 3CFPA 3QP6A 1EV7A 4WXDA 1SMYF 2ZXIA 3LA7A 1TKDA 3BZ6A 2IS6A 1EH6A 1A5WA 1OKRA 2E6LA 1Z1DA 5J8FA 3IRRA 1KONA 4CJLA 2ESNA 4DV3K 3IKVA 1WVRA 1MW7A 4M3ZA 3TAGA 4FLWA 1SFKA 5C12A 3BG9A 1LFPA 2E19A 4GV6A 5BS6A 4CFAA 5HS7A 2UXNA 3RKXA 1RDDA 2YS9A 3BTJA 4DR2K 1D5VA 3ZQCA 1D1BA 3BR5A 1YJWN 4BY7J 5EEHA 1ZAOA 2J5OA 4ON0A 5LD2C 2DMUA 3HPHA 3OBWA 4IOXA 5HLIA 2LKSA 1MSEC 4NC6A 1MDUB 3I5UA 3BP8A 1D3YA 1XWLA 1BN5A 2R0QC 1ULYA 3AAFA 3H46O 3I3LA 1A35A 3ATVA 3JRIA 3KLGA 2QVOA 3WEEB 2O8KA 2Q8KA 3BDDA 5BQTA 4CF2A 4MLOA 3UB5A 3MN2A 4C3JJ 4DQQA 1JKPC 4GYGA 3U9DA 2BXZA 2H6BA 5HOOA 3BCBA 1YLFA 2NRTA 1N78A 3CMEI 1OCTC 4CECA 2PBIA 3NRVA 4A3KJ 3I33A 5IYBJ 3O3KA 4H5VA 2O8XA 3HOUJ 1E4FT 5T7BA 1Q1HA 1R58A 1JXEA 1Z6TA 4C8KA 3VQQA 1HXDA 4DWIA 3RTRA 1IKXA 4FE7A 3G4SN 3ZQQA 2DTZA 5FD6A 5HDNA 2R7VA 2VQGA 3HUGA 4G7HF 3ZMZA 1NMDA 1K8KA 9ANTA 4B9UA 4ZHRA 5TJJA 1TK0A 2IPQX 4N4NB 3ID6A 3GF2A 3DTKA 1LNWA 3AVBA 4B1VA 1GLBG 2UV1A 1VSIA 5GAHJ 3SCXA 1RT5A 4BRGA 4UUVA 4ZZDA 1T8EA 5J40A 4NC8A 1RIOH 3AG1H 3OYNA 1ONVA 4E19A 4KHPK 2CW8A 2EFNA 4M3YA 2HYFA 1OCCH 1K73O 2XF7A 5IT9K 4I0AA 3FM3A 1VTNC 4M73A 2YHWA 3CP2A 4IG3A 3SQ1A 5J6XA 4CHNA 4FWQA 4P55A 1I3QJ 3UE5A 2E7XA 3DXMA 2HHXA 3DEEA 2YX6A 4NXMK 5CVJA 1IH7A 4FSVA 3FDYA 4M3XA 3E6CC 2GWJA 3PO4A 2QKKA 5D8KB 5HS9A 4KV8A 2QWOA 5EG0B 3A01A 3C95A 4EMSA 2FNPA 3ECOA 4HV5A 2VB6A 5C25A 4FW2A 1TP4A 1RT2A 3M5RA 4FLZA 1SAUA 4K0KK 2F9WA 5LJVA 4JKGB 3PFIA 1O3QA 3FX3A 3VGMA 1LVKA 1E4GT 2H8WA 4O3MA 1BIAA 4PCQA 3AGKA 1VQ7I 3BQZA 3BOQA 3CCEI 1TYQA 3SBTA 1KU7A 2DA3A 3LSHA 3SQ2A 2Y75A 2GM4A 2GQQA 5JICA 1K78A 4OINF 3FKJA 1QHTA 3VQ4A 4WQ5C 4B1UB 3JW4A 3FZHA 4O0JA 1TQMA 2VQFK 5F2RA 5IP7J 5KNLA 4WQ5A 3CG7A 4M42A 1HBXG 2OD5A 3VGLA 1IG9A 4MQVA 1OYWA 3IG1A 2M4GA 3SZ2A 1C0MA 5JLFA 3HOYJ 1QQOA 3OYHA 1KTQA 4X64K 3DOLA 2WV0A 4B3TK 1WZ2A 1SC7A 1BI4B 2HHHK 5C15A 5EZGA 3PUBA 4KYWA 3TP0A 3HM5A 4XN0A 1N77A 2M9HA 3WTWC 1ZN2A 2NS7A 4MO5A 3K59A 3W3DA 2L7FP 4JI7K 2IGKA 4Z2YA 3HB9A 1O1WA 1VHXA 2LR8A 4HF2A 4CJTA 2BY3A 3CJAA 4NUBA 3K4JA 4KIBA 4BRPA 3HDDA 1PP8F 4YORA 3WGIA 4DFKA 3BR3A 4W97A 3RQIA 1T7PA 4AWXB 3SLCA 1UZCA 1IO2A 5B1BH 1WSJA 4C9YA 1U0JA 1X3NA 3HYFA 2XAUA 1RDBA 5E8GA 4WXHA 2XGXA 1V3FA 3R6SA 5BR9A 3PL8A 4CJUA 1RNLA 3DLGA 1VAZA 2EPFA 3KEOA 4DSFA 4A3JJ 4LF4K 1G4DA 2NVQJ 1TAQA 3MDQA 1NBWA 4F3OA 4FVUA 2QBYB 4CZGA 2QSGX 2GOXB 5M1KA 1L3SA 3RPUD 4FLVA 3QPSA 2R7DA 5FKMA 3KK1A 1ZYRF 4FJ5A 5E3NA 1KYWA 2KTQA 3CQXA 1VQPN 4YHHK 3L4QA 3N4MA 3SBGA 5GAHP 4JKEA 3FZFA 4BHPA 3AVLA 3BF3A 2OPRA 2ACJA 2NUBA 5LRSA 2JGUA 4DTMA 3JAMZ 3V9SA 1KYZA 4B9MA 5FPMA 5C2FA 2E2QA 1P90A 1T98A 3KJVA 1BL0A 1V5FA 4HSTA 1G3TA 4LB6B 4NQWA 1NJYA 2Y0SN 3GCMA 5JS1A 1KU3A 1HR0K 4CZEA 2V4JC 2QQ9A 3H1QA 3BF1A 4IDHA 3DRSA 2ZJRL 3M07A 1RDUA 3ECHA 3HOVJ 5KQDA 5CE3A 1T39A 4AVPA 3QOPA 1SKRA 1S22A 4FJGA 1U47A 4FWNA 5DK5A 3DOKA 2O8EB 2RAEA 1BR2A 4TSXA 2FBYA 1IV0A 3K7AJ 4OJRA 5KI6A 1B4AA 2IRFG 2I5JA 4HUFA 1ZBIA 3HOWJ 2BZTA 5H20A 3BPVA 2Y0SA 4RW4A 3DLEA 2CO5A 1S6QA 1VQ6N 1X1PA 1KAYA 4KO0A 3OW2M 1OKJA 3OBYA 4XLNF 3U1KA 3G71I 4Q0BA 2ME6A 2LNBA 1L5UA 3I59B 1VQ9N 3KLIA 3LPTA 1H89C 1XPXA 2EILH 3VTIA 4QSHA 3O9TA 4AIJA 3QPLA 1SVLA 1XUPO 3RZOJ 4ILJA 3H1VX 4M3DA 4IPAA 4BE2A 4L0ZB 2ECBA 3R3LA 1CLQA 1I27A 2LSNA 5CZ2A 2FF6A 2CGLA 4IQJA 4B1WB 2WTUA 1XMOK 2P9UA 2F7TA 5HLTA 1QSYA 1SL0A 1VSJA 4F3TA 4DTSA 1YUWA 1GLCG 1NKCA 3MCPA 1X58A 2E5ZA 4F93B 5BRHA 4XEIA 1P92A 1ZREA 2B0LA 4FM2A 2OBPA 5M5YJ 3PX0A 1RGIA 2HKOA 1YTAA 3PNYA 1HMVA 4EZ9A 1MBEA 4CEDA 3SJJA 4Y17A 2JUCA 2OZUA 4WFBL 2LLKA 1TTYA 4FASD 4EZ6A 3QQAA 1FOKA 1J7KA 3R61A 1MJAA 3GWZA 3K2AA 5EYRA 2W85A 4XIDA 3UKGA 4PQUA 4HUEA 3JTGA 3M8FA 1DPRA 3G3ZA 5HNFA 1VK0A 3V8LA 5C4JJ 1FMVA 3EL2A 3V7CA 4BEHA 1ASVA 1EKEA 1T95A 4L0YB 1LUJB 3KWGA 4ZYAA 1EWRA 3WU1B 1QRYA 3O2PE 2KKZA 5FLMJ 4I7HA 1SFEA 3QEIA 3NAUA 2AO9A 1HOMA 3ERED 5K5OA 4ID5A 2LDUA 3R8EA 4X62K 3L9FA 3EETA 1O3RA 1NKBA 2IS2A 2FXUA 5EGOA 1GLJO 2F5DA 1S8NA 5HVQC 4G7OF 5FD5A 2Q2RA 4HDUA 1X9WA 4W5NA 1RRJA 3TL4X 1P4AA 1QU3A 2HQ5A 2L01A 2Q0OA 5TGTA 2DPNA 4JI1K 3BT9A 4I6MA 1I6XA 4DR5K 3M8SA 5LHGA 1OH7A 1LW0A 2WOMA 3JYTA 3AA2A 2LY1A 2IGNA 4G9YA 3E9PA 3MXIA 3V4IA 4HEA2 5DS9A 3CF2A 3CCUI 3I64A 2O4GA 1IKWA 1HJRA 5EXWA 4JKDA 4OGCA 2ASMA 4NYFA 2EZIA 1ASWA 2A05A 1Z0XA 5FKNA 3THXA 3AY9A 1RNHA 4ZYEA 4CGZA 4PJJA 3MEXA 3ZSXA 3QU3A 3G25A 3EKSA 1HRHA 2ZJQL 4CZHA 5LMUK 3JRFA 1YT3A 2Z1GA 3MWMA 4KHSA 3BG3A 5F0XA 2K27A 1S72N 3THYA 4B9LA 3S93A 4JKFA 4FK0A 5C24A 4DQSA 2XUBA 5AQKA 4G8XA 1KD1O 3CJTB 1MBHA 2I5UA 4IQ4A 4CJRA 5HLGA 3QIPA 1RBTA 2Y31A 4CFBA 1BI2A 1SL1A 2Y2ZA 3CDLA 4KITB 4CJPA 1JT0A 1P7JA 2LC2A 5LJWA 3MZ8A 2NNWA 1YJWI 4BR4A 1JE8A 4OGEA 3V8KA 3T8RA 3O3FA 1JCGA 3RCOA 5JLWA 2A5WA 2P6SA 3C0BA 4F8RA 1YF5L 3M8PA 2X74A 4KI4A 2CFXA 2KIFA 2EZLA 3ZMSA 4ISEA 2JA8J 3KWIA 3SFIA 1W7PD 1HLUA 1LEBA 4A2AA 2RV8A 2A6EF 3KLOA 4NCGA 3TI0A 3ROUA 4IZZA 3M3YJ 4I2PA 1IRXA 3RIRA 3LWMA 4RG8A 2VQCA 3CLOA 1N33K 2E6MA 3QBXA 1KQSM 2R4GA 3PM1A 3EZ5A 4DV5K 1Y8RB 4CUGA 4A3MJ 2VBXA 4B43A 3NWTA 3D5RC 2FQ3A 4W5OA 3OY9A 4PFPA 3FMRA 3MXJA 1VQ4N 1IXSB 2L9RA 3H9JA 1WJEA 2HOEA 4WF9L 1GLLO 2H1KA 4JS5A 1S3JA 1AU7A 3KFWX 2IVOA 3ZX3A 3ESWB 1WLJA 1E0EA 1TV6A 1DP3A 3DFGA 4DYQA 4II3A 3ZQGA 2QGUA 4M7XA 4JI6K