1Z05A

Crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
DHIKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAISRGRPAVGLQTNNLGWQFLSMRLGRGYLTIALHELGGEVLIDTKIDIHEIDQDDVLARLLFEIEEFFQTYAAQLDRVTSIAITLPGLVNSEQGIVLQMPHYNVKNLALGPEIYKATGLPVFVANDTRAWALAEKLFGHSQDVDNSVLISIHHGLGAGIVLDGRVLQGRHGNIGELGHIQIDPQGKRCHCGNYGCLETVASSQAIRDQVTARIQAGEPSCLATVEEISIEDICAAAADGDPLAVDVIQQLGRYLGAAIAIVINLFNPEKILIGGVINQAKSILYPSIEQCIREQSLPVYHQDLKLVESRFYKQATMPGAALIKQALYDGLLLMKVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcriptional regulator, ROK family
publication title Crystal structure of the ROK family transcriptional regulator, homolog of E.coli MLC protein.
rcsb
source organism Vibrio cholerae o1 biovar eltor
total genus 137
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z05A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z05A03
3HHGA 4UV9A 3O1WA 1XCVA 4LK1F 1UCRA 4PGHA 2FQ3A 1ULYA 1U3EM 4UV8A 1O3RA 4LLNA 1GLDG 4KMUX 4ENMA 5H6QA 1V4RA 3U9GA 4GYGA 3JW4A 1U2VB 3DQVC 5J6XA 2STTA 3RJPA 4LG0B 5F1RA 2HKOA 3K9TA 4Q47A 3RDIA 4B1ZA 3WGIA 2OZ6A 2NRAC 3ENHA 5CVUA 2P9LB 3F9MA 3EETA 4HQMA 3VESA 3WTTC 1KU9A 3L0QA 1B59A 5ADXH 4FX0A 3QFUA 1WUAA 2G7UA 1LVAA 2RGVA 5KPZA 2HTSA 3LAPA 4XH5A 3J7AO 4FWPA 2O61A 1SD4A 2CG4A 2L3DA 4ZYGA 4QS8A 3I54A 4OIOF 5JICA 3ZMSA 2EJRA 2M30A 4LC9B 4ZH4F 4YDUC 5ILUA 4XSXF 4Q5SF 3GFIA 4OIPF 1G3YA 1F5TA 3ZN1A 2VT2A 5KVRA 4A6DA 5KPTA 3SZPA 1GLEG 4A0YA 4A2UA 4AM7A 3VFZA 4IRHA 4NB4A 4IRGA 1J75A 3TU5A 1NGCA 3MWMA 3LWFA 1BUPA 2R7FA 1RUOA 2R7DA 3H3ZA 3Q9SA 1S22A 5AZJA 2EV5A 4RGXA 3OOPA 1ZG1A 2P9SB 2FF4A 4HV5A 1R1VA 2W40A 3I5UA 1HBXG 4BR0A 3T0YA 5AZIB 1YW9A 4CZHA 2G9WA 4CICA 5L3CA 4WX9A 1JCFA 3L6QA 3R4KA 5JMVA 4AIJA 2Q0OA 1FYLA 2HDCA 3GFJA 5ERIA 1B6AA 4WXHA 2BE5F 3VEYA 1HW5A 3WE3A 1JCEA 4Y15A 4BRHA 1MA9B 4H0XB 4G7OF 4BRFA 4JNEA 3LDLA 4G7ZF 4RGRA 4HX4A 3DFGA 1P92A 3CETA 3WTXC 1LDJA 1YG2A 4AVPA 1QPMA 4BHBA 4BR9A 1P8ZA 5DDGA 3KP3A 5ILVA 4WQ4A 1OR7A 2F5CA 5EEGA 3P7NA 3FHZA 2ZKZA 1ZRDA 3LFKA 2O6GE 2IT0A 3UB5A 3GFMA 4U0VA 3DV8A 1P4WA 4ISEA 3BPXA 4XBFA 2E2OA 4M7XA 2FSKA 2BV6A 4PL8A 3WXIA 1WWXA 5D4SA 1K78B 3JAMZ 4BC2A 3F72A 1ZHFA 3GL1A 1NHAA 4OU0A 2ZO4A 1Y64A 2TDXA 3G25A 1MD0A 4FWRA 1W5TA 5AQYA 2XVCA 4HX8A 4K41A 4B1VA 1BM9A 2YX4A 4RCHA 3CUQB 3LDNA 1JGSA 5BS6A 4FWOA 2K4BA 1F9NA 1FT9A 1NGGA 1BA1A 3DXMB 4CGZA 5B8HA 4BRLA 3CO6C 4BHPA 1ESVA 4U7DA 4I6MB 1QZ6A 1ZRCA 3FR0A 3VODA 2HOEA 2H3GX 3CJ7A 1SMTA 4AIKA 1OYWA 3AAQA 4ENJA 3V8JA 3S41A 4D0PA 3FGUA 1T39A 1ZN2A 3QPTA 3VEVA 5E8GA 3MN9A 3UKRA 3GUDA 3SXYA 1ZRFA 1TYQA 2YHYA 1U2WA 2Q97A 1Z05A 3KLNA 3HRTA 3EUHA 1RNLA 2P9NA 2QWNA 3QAHA 2DT5A 2W57A 4FWSA 4M71A 1D8JA 5FFXA 4S05A 3WTSC 4BRCA 3HI0A 5JVTA 3D2FA 5CVRA 2GTDA 2FRHA 1RGIA 2RQPA 2M8EA 3M6GA 3F6VA 3F8NA 3R9PA 4PGGA 2M45A 4FWLA 4CYDA 3D2EB 2CGLA 5JFRA 2JTVA 2P6SA 4O5FA 1REPC 2Z5UA 3WXKA 3RPQA 3T1BA 3R6SA 3TKYA 3COAC 4KIBA 4BXUA 4DQ2A 3N97A 1GLCG 2ESNA 3QU3A 3WTYC 4HW0A 1FNNA 3QBXA 3CO7C 4YFXF 3U2RA 3C3WA 1F1ZA 5ELZA 2IA1A 5FPNA 2LSOA 1MDUB 2FNPA 2F2EA 1IN7A 2QENA 2YSRA 2ZGZA 1T44A 4RS8A 3LDQA 4BGBA 4RGSA 4MO5A 3JSPA 2D4WA 3GBTA 4H03B 2E1NA 5FO5A 2QLZA 4WWCA 1RIOH 1S6LA 4BAYA 2X0LA 4N0BA 4BC5A 1IXCA 2E7WA 5HDKA 5A2QK 2A3ZA 1LQ1A 5J8FA 1J2XA 4XSZF 4EJWA 1LCUA 1T98A 1KYWA 3SJHA 1IRFA 5E1WA 3QDKA 3EO3A 3H92A 4KNYA 1QQNA 2IVMA 2V52B 3FE1A 3GXOA 1YIOA 1JHHA 1ZLKA 4I09A 4IF4A 2KRFA 1BBYA 3BWGA 1U5TB 1U78A 3VF2A 2A07F 1XCBA 5LHHA 3RKYA 2CGJA 2R3SA 4R79A 4XRFA 2P4WA 3P9IA 1YW7A 1TTYA 3QU6A 1NGJA 2E8AA 5AQIA 3ECOA 4UXNA 1D3YA 2F5FA 5F1XA 2QWRA 1EH7A 4MHGA 1S8NA 3MN5A 4BRMA 5HS7A 6PAXA 3HSFA 3RSEB 1HX1A 4RB1A 3F6OA 3MQ0A 1KAYA 3I4PA 2YX7A 3I8BA 2HF4A 4L0YB 2NNNA 3I58A 4A5NA 1BWFO 3DWLA 1XMKA 2HGCA 5LHGA 4UVCA 3K2ZA 3IUCA 4M9XA 1QQOA 3MDQA 2VBYA 3BUZB 3VERA 4L0ZB 1MGTA 2D45A 1PP8F 3HRMA 5AONA 1ONVA 3W6KB 3ZQ7A 3SMSA 1HW1A 2MD5A 4G9YA 4GYIA 2W24A 1NGFA 5D5WB 4DB3A 4B9QA 3ELKA 3IKVA 1T6DA 1MDMB 3GLXA 1YVNA 3TDUC 5BRFA 2UXNA 1J7KA 3LQRA 1MJAA 2NZTA 2XKOA 3CJAA 3O4WA 5AQZA 3FMRA 3SHFA 2PMHA 3MK6A 5IT9K 4L9VA 2OA4A 1EQYA 1PUEE 2DK5A 1DDNA 4UVAA 1HSTA 1DPRA 4OOIA 4TV7A 3W0LA 3VEPA 1JXSA 2DBBA 3FMQA 2EFPA 1W7PA 2CO5A 3L09A 1KYZA 5DCMA 1P6RA 2B0LA 2JZYA 1FPQA 2P8TA 4L3QA 5EEHA 4BH9A 3TQNA 2P9UA 1MJ9A 4BNCA 4CBWA 2P7CB 2GA2A 3FM5A 3VB2A 2D1KA 1K79A 2A5YB 4Q4ZF 1NGDA 2QM1A 4HTLA 3I53A 4HF1A 2VBXA 4YFKF 1KU7A 2LNBA 4IPAA 4FPBA 4IXAA 1SAXA 3K0LA 2O0YA 1R1TA 2OBPA 4A0ZA 3J81Z 3VETA 2CWEA 4JHDB 2VCPA 3ISPA 4H0EA 3M1EA 5BPDA 5LRRA 2ZNZA 4UNOA 2BGCA 5DD4A 3F22A 2UYTA 1RFQA 5BRHA 1O57A 2DQLA 2QWWA 2EB7A 4O8KA 3BJOA 3G3ZA 2WTEA 3FZFA 3ZEUA 4Z2YA 4A2AA 2FBIA 1HXDA 5D8LB 3ID8A 4XEIA 2HFHA 4G6QA 2XHKA 4P9UA 4P96A 3UKUB 2L4MA 1NWKA 4B1YB 3S2WA 1BI3A 3BDDA 2ZNYA 2IP2A 4WQ4C 4WF2A 2GWKA 2E1YA 2QBYB 2BTFA 3F8MA 3M8FA 5AQNA 4HLYA 3HSCA 1MKMA 5AQSA 3BPVA 3CJ9A 3ENOA 3T8TA 1XDSA 4RWTA 2FSNA 4PKHA 4K2EA 2JPBA 1IN5A 3L4IA 1D8KA 4P55A 2V79A 5F2RA 1NMDA 5FLXK 2PBDA 2VE9A 2ZF5O 3HRSA 1ON1A 1OYIA 3EYIA 5KPRA 4GNIA 2COMA 3GE1A 4H5NA 1KAZA 1X3NA 3ZETA 3MCPA 3J80K 1XB4A 4PZJA 1NGIA 4IO8A 5TKYA 3WQUA 1T6CA 2QQAA 5AQFA 4KBOA 3WE2A 1QHAA 4KIFA 2Q36A 2E2NA 1KXPA 1HKBA 1IUYA 1UFMA 1KA8A 1SD6A 4UVBA 3O08A 2P5LC 1FYMA 2PLYA 1D4XA 1K8KB 1XSXA 2VWBA 1TNSA 3I64A 3WG9A 2VOOA 4IWVA 4EIAA 4ESFA 5K1YA 2KHOA 4BQLA 4ON0A 3ULEA 2QQBA 3JAMK 3Q9VA 1I6XA 2X4HA 2VODA 3FXQA 2Q31A 3VF6A 4JBAA 3R60A 2ZWHA 5D5UB 2E1CA 3W3DA 3HHHA 1GLFO 3BF3A 2MLKA 4BC3A 5BN9A 2DLLA 5L3EA 2OD5A 1T6SA 5AQUA 1ZYRF 3E6CC 4FWKA 4CZIA 2K4JA 2WWYA 3WTWC 5K5RA 3DXJF 2P9PA 2OANA 2EFQA 5L3GA 2E2PA 4I02A 3SLCA 2BBYA 3IL2A 3E3VA 3EN9A 2ASPA 2LF7A 3L00A 3RI4A 4MO4A 1IAWA 3IHUA 3QOPA 1USTA 3Q5FA 1U8RA 4YIIA 1BI0A 5ICEA 5LGUA 4FWNA 4QLCU 2FXAA 5BPLA 4L9JA 4HF2A 2I7NA 4CO8A 2P5VA 4ZYDA 2QUFA 3WODF 1ZXOA 3GDQA 1NGBA 1UHWA 3QMLA 1HKCA 4JAXA 3B73A 1CGPA 4HA8A 4B1WB 3N4MA 5LJWA 3AARA 1J9IA 2MH2A 5EXWA 3ZMUA 2IPQX 2Q0UA 3O80A 2VBWA 3KCCA 3EYYA 1XQSC 4YFNF 5BMZA 4ESBA 4J8FA 1H0MA 3E6BA 2L02A 3C7NA 2IJLA 4ZZDA 1YFHA 1Z6TA 2DFIA 2ISZA 3K1MA 2ZMEA 5K5OA 1LDKB 2E88A 2F5EA 5AQMA 1HUXA 4IZ9A 3VEXA 1H9TA 3F8FA 2MLGA 3J8AA 5AFUA 1XDUA 5BN8A 1FZPB 3MMVA 3F3XA 3KEOA 5D5VB 4E1JA 1YUWA 2GELA 4HWIA 3GO5A 5L3FA 2AXLA 2P9IB 2RN7A 1MJBA 3ZMDA 3HRUA 4M9ZA 2QWMA 3VEZA 5E17F 4GO1A 4RAZA 4XH4A 4S04A 1BIAA 4EJVA 1GVJA 5DV5A 1D5VA 2E20A 3ABTA 5TJJA 4XH1A 3VENA 3HTUA 1KAXA 2IVPA 3WEEB 2XAFA 5LHIA 3FLCO 5FD5A 2E2QA 3JTHA 4U88A 3EL2A 5LY3A 3BP8A 2Y48A 2Z33A 5JR3A 2O8XA 4LB6B 3O3KA 4I0AA 2L01A 1OYYA 3L9FA 1O3QA 1QZZA 1S29A 1AWCA 1WQ2A 3EKSA 4CZKA 1P4AA 2O3FA 4Y13A 4I2OA 4RTFD 3KHYA 2E1ZA 4LLGF 5AQTA 1USSA 2WV0A 3AAPA 2YHWA 2Q2RA 2A41A 1I1GA 3GEZA 2BUPA 2QXLA 3GX4X 3VGKA 2A68F 3IC7A 3KE2A 3SZTA 2NRHA 2QWPA 1YLFA 3SQNA 5ICCA 2FA5A 3I59A 1G3TA 1TBXA 1SFXA 2XAGA 4A62A 3CHWA 4PKIA 1DKGD 2PI0A 4MEYF 1PDNC 2PEXA 3LA7A 2VXZA 2VOPA 4CXFA 5AQKA 3SK3A 5FFZA 3KP6A 3KP5A 3WTZA 4RB3C 3L7WA 5HDNA 3QPHA 1RUNA 5JI6A 2V7YA 2YR2A 2WC2A 3AY9A 2ELHA 3O6WA 3RPUA 1J5YA 4HYEA 4RAYA 1BC7C 5HDGA 1FSEA 1GLAG 3KEQA 2CQKA 2DW4A 3LDOA 3FZHA 1LJ9A 1WSUA 2O03A 5D6EA 1WKMA 3DP7A 2DPNA 3DXKB 1XD7A 2YPRA 1YAGA 4HX7A 2LKPA 1HW2A 4M63C 3HTVA 2P9KA 2MBFA 1Z1DA 3BROA 5FPEA 4N9HA 3MN7A 2PFBA 1IF1A 1CF7A 2QZ8A 4RB0A 4ZYHA 2J5OA 3H45C 2DI3A 3GW2A 3VGMA 3GF2A 1YTYA 3QB0A 2BEOA 4GGGA 3WTVC 5JHUA 2Q1NA 4DQ8A 5HOOA 3HSRA 2ITMA 1HSJA 3OHRA 1R1UA 1YQAA 3LA3A 5CVVA 2IW5A 1GXQA 2EA2A 1HKGA 2K27A 2EWSA 1NGEA 1QO0D 2E7XA 3CUQC 5E26A 4U0WA 2QM3A 4P9FA 1QNTA 2PG4A 2DPUA 3L2CA 3TDZC 2NLXA 1BOTO 1WOQA 2YCHA 2FU4A 5CVIA 4CD1A 1Q1HA 4FX4A 1TUYA 4PCQA 1G99A 2CYYA 1U2VA 1U6GA 4LG0A 4CBXA 5J8CA 4BG8A 1ZG5A 4BREA 5DEQA 5D6FA 5D5XB 2HKXA 1EH6A 2P9LA 2OZUA 3LA2A 3FFKB 1V3FA 4M9SA 4JD2A 5CLSA 4G8XA 5AZJB 4B1UB 4BQAA 5JLFA 4EM1A 5LEJA 3CJBA 1W5SA 1BDGA 2GA1A 5LJVA 4XLPF 4CD3A 3FMSA 4Y0WA 2A6HF 5F64A 1R23A 3MZYA 4L9NA 1H9GA 2GWJA 3AAFA 5AQWA 3U9ZA 5BOXA 2DK8A 4UHTA 4DHYA 5ED4A 4M7YA 3VPZA 5ILSA 3W6JB 2VC0A 4WQ5A 2ASOA 5E1XA 4JQFA 2ZBKA 4HV6A 4EHTA 1C0WA 4Z94A 2L4AA 3ZX3A 2FEZA 2WUSA 3E6MA 3QRFF 5FPMA 2P9SA 1FWZA 3A5OC 2EFOA 3B02A 5EVZA 5FB2A 2V6CA 2ASMA 4EM2A 2ACJA 3MEXA 5AZIA 2FBKA 2VC1A 2XKPA 3O2PE 1LDDA 5E1ZB 1BIBA 4AIHA 3DAWA 4EGZA 4IHTA 5HLGA 2XAHA 4YG2F 4BR2A 3GWZA 3FWEA 3U4LA 3SMPA 3ML6A 1R59O 1SMYF 3LM9A 4HAMA 2EV0A 2FSWA 1BC8C 5LGTA 1K7AA 1XGOA 3GYHX 4H5VA 3EDPA 5LLQA 1IRGA 4K43A 4RGUA 3HM8A 5ICGA 3CTAA 2F9TA 1TQPA 1E2XA 4HQEA 4CI6A 2XROA 4DCHA 3ZX2A 3D0SA 1L3LA 5DUIA 3CQXA 3I71A 1KGSA 1E4GT 3MZHA 3CI5A 2XAJA 4OMYA 3MFKA 1FX7A 1MWKA 3OV8A 5AQPA 3O5BA 1BI1A 3U9DA 2V1XA 2F5DA 1U5TC 2EWNA 5D8KB 5A2QZ 5BPMA 4LB5A 3TPQA 3IRRA 4NB5A 3EKUA 5F0XA 1RI7A 3CIPA 3KZYA 1GLJO 4G6DA 2H6BA 2DTRA 4CZMA 5KQ8A 1Z7UA 2GEMA 2OU2A 3FZLA 4HDUA 3UKRB 4FWMA 1BJAA 1TYQB 4WK8F 4FT8A 3HOSA 2C6YA 3CUQA 5FD6A 4ETSA 5E18F 1TUUA 2DU9A 3R8EA 1I27A 5BREA 4R1HA 3FZVA 2P9NB 3WGHA 3D7EO 1W4MA 3ULQB 3DXMA 2PMUA 1B4AA 1DEJA 4I6MA 3D2FB 2D0OA 3RKXA 2YI1A 4BRIA 4EVIA 1V4SA 1IG8A 1ZGJA 1ZARA 2UWMA 1HKTA 3C7JA 1MZBA 4H5WA 5DCFA 2IA2A 1XGSA 4IVNA 2W84A 1QZYA 2DQRA 1WRJA 2K02A 4EHUA 1ZLJA 1OKJA 4B8XA 4GY2B 2HQRA 4OMZA 2Z3YA 4ISGA 2UZKA 3ROUA 3HUGA 3WTUC 4NHJA 1BG3A 4WXCA 1STZA 5DUKA 3CJ1A 4QS7A 2EFWA 1ZC6A 4M72A 1CF7B 2QW9A 3LDPA 3MAJA 3V7SA 2V51B 2RC4A 3GZ5A 4BRDA 2FSJA 1FBUA 3VF4A 4BG9A 2FMYA 4L18B 4WXDA 3JS6A 2F9WA 2HYFA 2MH9A 4BGAA 2J5PA 1XUPO 1FYKA 4HZFA 1S3XA 1J0RA 3I0TA 2V1DA 3D2EA 1TQIA 4LFUA 3ATUA 1GHCA 1O7FA 5IT9Z 2OQRA 2PQ8A 3GZ6A 1VTNC 3LL3A 5AQOA 5AQQA 4MQ9F 3TGNA 1ZH5A 3QP5A 4CZEA 2FLOA 2A5XA 4BC4A 5HVQC 1K6OA 4EJTA 1U6ZA 3TOAA 1SD5A 4H0TB 5BPNA 1HKQA 2CW0F 5DD8A 4AWXB 4DNCA 2MA3A 1HLUA 3BY6A 2NAZA 2ZXJA 5CVJA 5AIPA 1LEBA 2CH5A 3CUOA 1XGMA 4F7ZA 4O3MA 3TO9A 1LEAA 3VGLA 1R5GA 3ABUA 2ZFWA 1XC3A 1TLHB 4JD2B 3H6EA 4BR7A 4BQZA 4CHUA 5AQRA 1W7PD 3JSOA 1IN8A 5AQHA 1E17A 4CZZA 2QQ9A 1FC3A 4EAHD 1S3JA 2H27A 4O5VA 3BZ6A 3V8KA 1GXPA 3WU1B 2K7LA 3PFIA 4A12A 3LAJA 2RV8A 2W41A 3FXRA 2V7ZA 2IA0A 4GXOA 3FF5A 5ADXA 2HYGD 3A5LC 5BPIA 4B1XB 2FF6A 1U5TA 3P9CA 3PQKA 1YW8A 1LB2A 4ESJA 2FF3B 4HBLA 1ATNA 2AP1A 2XUBA 3F21A 3QICA 2FMLA 3M1FA 2FBHA 1NBWA 1RDWX 4KUMA 4LD5A 3ZPLA 3IMXA 3DEUA 2QWOA 2EFNA 5L3DA 1ZG3A 3F8BA 2M87A 1P4XA 1XGNA 3TO6A 2HQNA 3GFLA 1UHMA 1LOTB 3RSEA 1TNTA 3E5QA 4H5TA 4IJAA 5ICFA 1L0OC 5AQXA 5AFUH 1X3MA 2GQQA 4FSVA 1KU3A 2HMPA 3IDHA 4CZLA 3JTGA 2ZGYA 3TO7A 3H3OB 5EOYA 3H3UA 4A5MA 1H1VA 1ON2A 5E20A 4IXCA 1HKSA 3O6BB 3QBWA 1SQKA 4PKGA 3C0BA 5AQJA 4BRNA 2CGPA 3FX3A 5TRDA 4MLEA 2V1UA 2PBIA 5FLXZ 2A40A 4ISFA 4BRQA 2CFXA 2Y75A 1R00A 4Q48A 1W7PB 4MTEA 3RYRA 5DCMB 4BRKA 3J80Z 2H09A 4CZFA 4CBUA 2VN2A 4MLHA 1Z6RA 1MDMA 1S7AA 2P9UB 2MC3A 5AIQA 2I7PA 3FM3A 2FXUA 3P4IA 1JE8A 1Q18A 2Q0RA 3ZMTA 3C18A 2A61A 2PJPA 2EA4A 4M6XA 3BF1A 1WI9A 1IXSB 1J59A 5BQTA 2YU3A 4A2BA 2Z9OA 1R7JA 2JT1A 3GOIA 3QFPA 1GLLO 1TW2A 2IIRA 2YJEA 3HOTA 2ESHA 3JXUA 1G6NA 3BEXA 4KDPA 5E84A 2IRFG 2AS5F 1CZAN 1LNWA 1XSDA 4PL7A 5AQVA 4C23A 1XSVA 4I98B 3KLOA 4JN4A 3R0AA 3ZEUB 4WQ5C 1Y0UA 3IKTA 3E6DA 1HPMA 1DGKN 2XGXA 1QGPA 2LF8A 4OINF 3KFWX 3O1BA 3HZ6A 3KP2A 5LRSA 1I1SA 2KIMA 1SD7A 3ZP5A 1ODDA 2STWA 3R0JA 2HZTA 1BN5A 4CDGA 4HOBA 1KQ0A 4KN4X 4JHDA 1NM1A 5CYVA 1OKRA 2JRTA 4I7HA 4KMFA 4KFCA 2A6AA 3EQLF 2D0PA 3U8XA 3M8EA 3DF8A 1R36A 2HF3A 1JHFA 4YIFA 4BRAA 4BRPA 2A6EF 3V4GA 1YXQA 5F6FA 2A69F 3A8YA 3HTSB 2H6CA 1SFEA 3BJAA 1KU2A 3U1DA 4A61A 3RTRA 3IRQA 2HWVA 4G7HF 4L9TA 4M74A 2DO7A 4YDUA 1SZ2A 1DP7P 4EM0B 1BA0A 3ZETB 2V9VA 4CZGA 2IVNA 3UKUA 3KP4A 3ZMZA 2KJCA 4O6JA 1FSHA 5AR0A 4H0PA 3V7RA 4AD9A 1ZBSA 3D5LA 5LBQA 1HJOA 2ADUA 4ENNA 2QBYA 1YYVA 3IWZA 2GXGA 4Y17A 1RZ4A 3WUHA 1KQ9A 2D1HA 5D4RA 3IFRA 1B1BA 3RYPA 4OIRF 2OQGA 3LM2A 2W85A 4FHTA 1EV7A 2KIFA 4ZZLA 2YJFA 5AQLA 4EJUA 3ULEB 3NQOA 3CJCA 4HDVA 1B9MA 2ZJ2A 1X9JA 3T5XA 1O3SA 2L54A 4FPAA 1IW7F 1G3SA 1Z9CA 4E70A 1I5ZA 1FP1D 2A42A 3WXJA 1DUXC 1OMIA 2P9PB 2VT3A 1IZ1A 2HTJA 3DPLC 2NNYA 3T8RA 2GZWA 1QQIA 4L5JA 4LJZF 5KK1A 1BU6O 2NYXA 4ZYEA 4EV0A 3WXLA 2Y0MA 1K8KA 4I0BA 4OIQF 3J81K 4U7BA 3E5UA 2J4RA 3V8LA 3CLOA 5AQGA 2W25A 4G94A 3DJCA 3RKWA 3HBTA 3UE5A 5HS8A 1AOYA 3I33A 1SFUA 2HS5A 4EQQA 4B09A 4LGWA 4RB2C 5H6RA 2KIUA 3NEUA 3A0IX 2M5WA 3ATVA 1J6ZA 3A5MC 1T2KA 3H1VX 2PAVA 3GVAA 4FL9A 2GWRA 2K86A 3FZKA 4BHCA 3REOA 1IXRC 4EGYA 3M9AA 3WU0A 1FBSA 2HEOA 1FLIA 3LQQA 1IJJA 2GIVA 1C0FA 5CJ9A 2VBZA 4EJOA 2CGKA 3E5XA 5FGMA 3V7CA 1IN6A 1SAZA 3C7NB 2VYPA 4QS9A 2Q8KA 3CDHA 3BOQA 1TW3A 3FXUA 2CH6A 2QYOA 1YO5C 3ECHA 2CSOA 3MCZA 3B8AX 4JK1X 2ZMEB 2D1VA 2JSCA 4MNUA 5EY4A 1A04A 1FBQA 4M6YA 4BROA 3KETA 5JLHA 2RVCA 3R6MA 4NO7A 2RNJA 1UB9A 4KN7X 1F4KA 4LK0F 4KYWA 2BYVE 1T0FA 4MEXF 3BJ6A 4IRIA 4BRGA 3F23A 3EZWA 1EH8A 5FPDA 2DPDA 3DKWA 3WT0A 4M73A 4PDKA 1BOAA 4IHSA 1R22A 3HSEA 2GXBA 2Q2EA 4EMSA 1ZAOA 4A6EA 3R61A 4HLXA 1ATRA 3PQJA 1NGHA 2P6TA 3WQTA 5HS9A 3ZN0A 1V4TA 3VOEA 3RIRA 2YHXA 4GCVA 4KIGA 4ASNA 4H5RA 3H3NO 2D2WA 1GLBG 3K1NA 5L3BA 1R5HA 4WCGA 5CE3A 4KA4A 4UUVA 1YS6A 2P5KA 3E97A 3K1PA 3HYIA 1FP2A 4ENKA 1FY7A 4H0VB 4MGRA 4XLNF 1O7LA 5KQDA 3A5NC 2GUPA 5E8IA 2QWLA 1ATSA 2H94A 4FO0A 3K69A 4L5IA 2EK5A 3MN6A 3KVGA 3O8MA 2P9IA 3VEOA 4CJ7A 2NS0A 2RDPA 2HR3A 5BR9A 4U0YA 1K78A 2JPCA 4WYBA 1QZ5A 2RKHA 3DPTA 2LDUA 2PN6A 3KP7A 2GAUA 4NQWA 1TQMA 2VE8A 3KZZA 4H0YB 2P7VB 1QBJA 4I01A 1NLVA 4BR5A 2UXXA 1HQCA 1MWMA 3CERA 1G4DA 2XAQA 3WEEA 3GG4A 3I59B 2Z99A 1JCGA 3KZBA 4BVOA 4F9OA 1G3WA 4AM6A 2VONA 3H46O 2QVOA 1ZGAA 1FOKA 1P2FA 1S7OA 1Z91A 2KKOA 5LGNA 3QP6A 4QWQA 1DPUA 3H1QA 5LEKA 1NGAA 1PP7U 4H0OA 1X3UA 5HLHA 3VEWA 3IWFA 4BR4A 2IVOA 3CQYA 2XASA 2XIGA 4KICA 2EV6A 3LSTA 2QWQA 3VOVA 1C0GA 4EFHA 2XRNA 4N9IA 5HLIA 2DAOA 5EX5A 3WGGA 1O3TA 4A0XA 2M1BA 5BRDA 2A3SA 1ZREA 2P9KB 1IN4A 1YS7A 2KJBA 3ZMVA 3TOBA 2ISYA 4FOEA 2FNAA 3F8CA 5H20A 3ERED 3C1DA 1R58A 3NRVA 2FE3A 3G73A 4K25A 4KT5C 1BO5O 4BYYA 4FOIA 5I9EB 5DYMA 1QQMA 4K42A 3CJNA 1XMAA 4BVPA 3P9KA 2G7HA 3M7GA 1E4FT 3FZMA 1OPCA 3HIFA 3ZX0A 1XN7A 2ZCWA 4CZJA 4MTDA 5K5QA 4FWQA 1KQ8A 4LLLA 2ETHA 1T38A 2XV4S 3DXKA 4LMYA 3M3ZA 2AA4A 4HF0A 4IJNA 1B9NA 1BI2A 2FOKA 5IT3A 4R8HA 2OAZA 4MQVA 3SFZA 4P5OA
chains in the Genus database with same CATH superfamily
3HHGA 2BW3A 3O1WA 4LK1F 2QSHX 4KB0A 2QTDA 4UV8A 3AA3A 5EU7A 3QYFA 5H6QA 1U2VB 3BQYA 4OLBA 5J6XA 3RJPA 4LG0B 3OIQA 2HKOA 4Q47A 1Y56A 3ENHA 4CIFA 3ZSRA 5EG0A 3T1YK 2LH9A 1LVAA 3Q7BA 3D6RA 3LAPA 4XH5A 5KHDA 1SD4A 3S93A 3I54A 5C44J 5C42A 4OIOF 5H2FC 2EJRA 2DMTA 5HP1A 3V9SA 1MMGA 4XSXF 4OIPF 4A6DA 4FK4A 5MLCQ 3HJFA 1W0TA 4A2UA 3S14J 4AM7A 3THXB 1J75A 3DOKA 3CC4I 2N8GA 3LWFA 3MWMA 4XLHA 1BUPA 2R7DA 2PZSA 3QOEA 1S22A 5AZJA 4IOCF 3PNVA 3QEPA 1MBKA 4CF2A 2G9WA 2HYJA 4PK4A 3R4KA 2HDCA 1FYLA 2O8KA 3EEQA 5HL7L 2V9PA 1B6AA 4WXHA 5CZ1A 5E3LA 3VEYA 1HW5A 1VQ4N 2AJQA 4Y15A 2F8SA 3F5TA 4XKWA 3IH4A 3RQIA 3HGYA 4RGRA 4HX4A 2ZJQF 3S1QJ 4B3TK 3DFGA 1P92A 2KLOA 3VA3A 2EX3A 1LDJA 2L7FP 3CLQA 2JA2A 4XMYA 2I8DA 2R4GA 1HNWK 1OR7A 1C0TA 1IV8A 3FHZA 2ZKZA 3JRFA 1MU2A 1K6YA 3UB5A 3HC7A 1WSHA 3LOCA 2ETJA 4ISEA 4XBFA 4M7XA 2I5JA 2DTZA 1WWXA 4CGIA 4BC2A 3GL1A 1NHAA 4Y1DA 5IP9J 1Y64A 3LSPA 3G25A 4DG1A 4KAZA 5AQYA 2XVCA 1U48A 3JR9A 4M3WA 3LZIA 2YX4A 1YITI 3MD2A 3LDNA 1JGSA 4BACA 2K4BA 2B63J 1QSSA 3DXMB 4CGZA 1JL2A 2COBA 3VODA 4PQUA 3P31A 3OYGA 1SMTA 1U45A 2EZKA 1FJLA 3BG7A 3CMAN 1ZN2A 3K5NA 2KW4A 3GUDA 2HXOA 4NCGA 1U2WA 3LPTA 3HRTA 4ILGB 4CJRA 2P9NA 3QAHA 2AQEA 4FWSA 4S05A 1N77A 4J2DA 4C9YA 2QEXN 2GTDA 2NRZA 1RGIA 3F8NA 3NE6A 2DT7B 4CYDA 1VSFA 4Z4EA 2P6SA 5DM6F 3RPQA 1NK5A 3BTJA 3E7LA 3DOLA 4B9NA 3ID6A 3LP3A 3QU3A 2MD0A 4HW0A 5FROA 3KJVA 3U2RA 2BHYA 1F1ZA 1GOCA 2ZXWH 1TKDA 1IN7A 4PFPA 3EE8A 2IC3A 1T44A 4XRSA 4RGSA 4B9UA 3AVAA 4CEZA 4MO5A 4J19A 5FO5A 2QLZA 3GBGA 2HVRA 2X0LA 4N0BA 3CCVN 1I39A 4CF9A 1TWGJ 1LQ1A 5J8FA 1BI4A 3SJHA 1IRFA 5E1WA 3EO3A 1QQNA 3HG9A 2IVMA 4IEEA 2WV1A 2KRFA 4LF7K 2MABA 3K4NA 1VRTA 4CEDA 3CFOA 1L3VA 3KTQA 1TTYA 1HPZA 5JHFA 1NGJA 3ECOA 4UXNA 4CYCA 3OW2M 1SS6A 1EO1A 4MHGA 3MEEA 4BRMA 3HSFA 3RSEB 3I4PA 3A1YA 3HK2A 3O9SA 2NNNA 3I58A 3T7ZA 1BWFO 3HEFA 2F4IA 4UVCA 1YJ9N 2OUMA 2QI2A 2D45A 1PP8F 3DPUA 3ZQ7A 1JJ6C 5GIPA 4FM1A 3K4BA 1NGFA 3ELKA 3AVIA 3VYRB 4CJFA 2EIMH 3GLXA 5BRFA 4PHTX 1WH7A 2NZTA 1TV6A 1JXEA 2XKOA 2PYLA 5C3EJ 4KHQA 1SAUA 5IT9K 2V4JC 4CK1A 1DDNA 5GAGP 4UVAA 2B6AA 3C94A 3OS0A 4PJ0C 1RT6A 3NBPA 1W7PA 1KYZA 5DCMA 4J01A 4IG0A 3K5LA 2VLAA 3FM5A 4DIQA 4HTLA 1P7JA 3H0DA 4FPBA 4M3BA 1HDDC 3RMAA 2CWEA 4LG3A 3QERA 4JK9A 3THVA 4UNOA 4AYBA 3F22A 2UYTA 2HXIA 3P39A 5BRHA 4JEPA 4N56A 4QSHA 2WTEA 2GBYA 4CHYA 4DTPA 3EUKL 3VYTB 4P96A 1RT5A 3S2WA 1BI3A 1OR7C 1DGRM 1WJEA 4Z6YA 5K14A 5J2NA 4HLYA 4JI7K 4F55A 1KSPA 3QYBA 1R5ID 4E7LA 2H1KA 1XDSA 4RWTA 2FSNA 2JPBA 1AKHA 4P55A 2V79A 2PBDA 2Z1GA 5KPRA 5KRSA 1X3NA 3ZETA 3MCPA 2WAFA 4PZJA 1NGIA 5J3LA 2HVSA 1WSEA 2PJRB 4BJ5C 4E1NA 4KHSA 2Q36A 3DKYA 2W48A 3PO5A 2FQ4A 1IUYA 1BCOA 1KA8A 1SD6A 3T3FA 3O08A 1FYMA 2HDDA 3BG9A 3OYAA 1K8KB 1XSXA 2B7EA 3MXMA 3I64A 2VOOA 2VG7A 2QQBA 3JAMK 2X4HA 2VODA 2YX6A 1XPXA 3PUBA 2ZWHA 2LY2A 1Z67A 3U3GA 3BF3A 4XONA 3MX5A 3G1MA 5BN9A 1LFPA 5L3EA 2OD5A 2K4JA 2WWYA 2E35A 1PVEA 4H4MA 5L3GA 2NXNB 2W82A 2M0CA 1WJDA 1BL3A 4NYFA 2LF7A 4MO4A 4CUGA 3IHUA 3ZGKA 4A69C 3C6HA 4YIIA 3BCBA 5LGUA 1DGWY 4QLCU 5BPLA 4L9JA 2Y2ZA 1ZXOA 4QIWN 2UV1A 3OR1C 1HKCA 1CGPA 5LJWA 3NVMA 2ME0A 2Q0UA 3O80A 1A5VA 1ITGA 2HHUA 1QHTA 1XQSC 5BMZA 4NCAA 4ESBA 1Q86O 2L02A 2HHWA 2DFIA 2EZIA 3K1MA 4UY8I 1BIUA 3CMYA 4CHNA 2ZMEA 2E88A 5AQMA 1H9TA 2XC7A 3OYFA 2MLGA 5AFUA 5GAHP 5BN8A 3F3XA 3KEOA 4FJ8A 2KKZA 2D0AA 3DLBA 4AF1A 3CQZJ 4FJ9A 2GELA 4BWMA 1UA0A 3GO5A 3OY9A 5L3FA 2P9IB 3QPLA 1MJBA 3ZMDA 4DW6A 2QWMA 4GO1A 4RAZA 3VQ9A 4AHRA 1OCRH 5EZGA 5HRSA 3AV9A 1Q9XA 3HTUA 2IVPA 3CCEN 3WEEB 4XNFA 1DTQA 2E2QA 3G2BA 3DEEA 1WJCA 4U88A 1S1WA 3BP8A 5JR3A 1FEXA 3TABA 1Z25A 4KFBA 3Q3SA 3K70C 3LFUA 3LALA 3L9FA 1O3QA 2Z16A 2O3FA 2BOLA 5AQTA 1HC8A 4M3XA 3BR2A 1ETWA 1AHDP 4E3SA 2OTLN 2NRHA 1YTUA 3SQNA 3QESA 4AYBN 1JLGA 3A03A 2XAGA 4A62A 4PKIA 3CMEI 3J7YP 4ZYAA 1FXXA 2DMQA 4CXFA 5AQKA 3SK3A 2G8FA 3WTZA 4RB3C 3L7WA 5HDNA 4DWIA 2EZHA 5JI6A 3HT3A 2YR2A 4CCNA 1AKHB 4M3ZA 4HYEA 4HNTA 3LDOA 1WKMA 2MFZA 2FX0A 2YPRA 1YAGA 4C8MA 3ALYA 3ZSVA 3HOXJ 5FPEA 5LD2C 4N9HA 1VQOI 2YNHA 1J54A 2HVQA 2R7SA 2L9RA 3GF2A 4OJRA 1CXQA 4DR3K 4W1UA 3WTVC 5JHUA 3M3YJ 2ZQBA 1R4NB 2Q1ZB 1JT6A 1G59A 4CCMA 2DODA 3LA3A 1GXQA 1QZEA 5KNLA 4O8UA 2QKMB 3OR2C 1BA5A 1NGEA 3CUQC 3E1SA 5D3GA 4P9FA 5KI6A 3L2CA 3TDZC 3LZJA 4QCLA 4KHYA 1G99A 2CYYA 1U6GA 1SANA 2JJ7A 2QK9A 1R71A 4RLQA 5D6FA 4CCOA 3CPEA 2ELJA 2P9LA 3LA2A 3FFKB 5CLSA 1WLJA 1DU0A 4BUPA 5LJVA 5C4XJ 1GV2A 4O0JA 3P38A 3QEXA 1R23A 4LF5K 1A35A 2A05A 3CP8A 3SUOA 2IDOA 1WSGA 4KH4A 3DM2A 5ILSA 2UUBK 2OTJI 5KAIC 3W6JB 2VC0A 3HP6A 1Q81O 4CJPA 4HV6A 2XY8A 4FLUA 3ZX3A 1WAJA 3E6MA 3ULDA 1B72B 3A5OC 3AA5X 2EFOA 5EVZA 2DDAA 2VGNA 5AZIA 2FBKA 2H1LA 2VC1A 3CCQN 2KP6A 3G4SN 4EGZA 3DBLB 3QINA 3FWEA 3U4LA 1MBJA 3SMPA 3ML6A 1TAQA 4CEAA 2DA6A 1R59O 2FBYA 1BC8C 2DA1A 2F4MB 3DEWA 4J2AA 3KIOA 5LLQA 3HM8A 2GOXB 2F9TA 1TQPA 2R5YA 1V55H 2XROA 1RBSA 1KGSA 4OMYA 4YFUA 3O5BA 4DUZK 2V1XA 2F5DA 1WVRA 4Y3OA 2EWNA 1U47A 4AHSA 5BPMA 4A3BJ 3NH2A 3IRRA 2WB1A 3CD6I 1YJNI 1XNRK 3GTQJ 5FKMA 2H6BA 3HM9A 2LKSA 1MNEA 1TWCJ 1VQ8N 3UKRB 4DZPA 2E6MA 4FWMA 1BJAA 3A0BC 5FD6A 2DFFA 5E18F 1TUUA 4R1HA 3D7EO 2PMUA 5C12A 2HNYA 4I7FA 1B4AA 1DEJA 3ZSOA 3ZQLA 4FJNA 1U0JA 4I6MA 4CVNE 2O4GA 2FUG2 1NKEA 3K4CA 2UWMA 1MZBA 4H5WA 4M3TA 1JLQA 5DCFA 2MYSA 2W84A 4EHUA 4JOMA 4GY2B 2Z3YA 4U87A 2UZKA 3NAUA 4WXCA 4W5TA 2HNHA 4ZJZA 3CF5L 1UOCA 5DUKA 5I42A 2QW9A 3LDPA 4BRDA 2DFEA 2FSJA 1K9MO 2L7KA 4BG9A 4WXDA 3JS6A 2EIJH 2MH9A 1JKRC 5CR4A 4FJ5A 4HZFA 5LFAA 1S3XA 1NMNA 3D2EA 1RTIA 4LFUA 2IGMA 3ATUA 5TGTA 5IT9Z 2OQRA 2PQ8A 4BBSJ 4X66K 1VTNC 4MQ9F 1S5JA 1W0HA 4BC4A 4YOUA 3H5NA 2M0MA 3SEZA 4H0TB 5DD8A 2MA3A 3BY6A 2NAZA 2ZXJA 1LEBA 3TO9A 2A5WA 3ABUA 3SAGA 2F48A 3PIPL 1E17A 1XHZA 4CZZA 4OWRB 2QQ9A 1FC3A 4EAHD 3MWPA 5J1EA 3IH2A 4D9JA 4A12A 2RV8A 5CKTA 1OCZH 2KTQA 5ADXA 4I99C 5BPIA 4FJ7A 2FF6A 2JWKA 1U5TA 4KHUA 4BWJA 2FF3B 4X62K 3QICA 3DYAA 4DTNA 5DTDA 3ZQHA 4KUMA 4E7IA 1ZG3A 2CMPA 3F8BA 1XGNA 3OVNA 3JRCA 4B43A 1TNTA 2DYSH 3E5QA 4H5TA 3PNTA 3LAMA 4IJAA 5ICFA 5AFUH 4HSRA 4FSVA 1A5XA 3VSKA 4A5MA 2VJJA 2QF7A 1XHXA 5E20A 4IXCA 3BCAA 3O6BB 3QBWA 5HBMA 3C0BA 4KTQA 2D5RA 2O8BA 3PM1A 3FX3A 5TRDA 4MLEA 2V1UA 2PBIA 4ZDLA 1QVFM 4A59A 3RYRA 3RKQA 2H09A 3AO5A 4DV7K 2NVYJ 1NNEA 1Z6RA 5AIQA 3FM3A 3P4IA 2NRTA 3IAM2 3ZMTA 2NRVA 1IXSB 3PV8A 1J59A 4DKWA 4DS4A 4JX4A 4F2RA 2JT1A 3GOIA 4RG8A 2DT6A 3RRGA 1EWQA 2IS1A 4Y4RA 5M1KA 3JXUA 5E84A 4C3HJ 1XSDA 3IP4B 4PL7A 5AQVA 4CERA 1XSVA 4I98B 3KLOA 1LAVA 1HCRA 5C4JJ 3LSJA 2X51A 2WFBA 3SQ2A 3JAMO 2XGXA 1QGPA 3S17J 2WB1N 3KFWX 3O1BA 3HZ6A 2IS2A 4L8RB 4DF8A 2KIMA 4ELUA 5C10A 1SD7A 2R7WA 4Z4HA 1ODDA 2STWA 1PYVA 2OPRA 2HZTA 4IFEA 4CDGA 3OJSA 4HOBA 4B3MK 1NM1A 1HOMA 2D0PA 3RVCA 1TAUA 3DF8A 4BRPA 2MSYA 4KH6A 4KI6A 3PSIA 2A69F 3AA2A 3HTSB 1SFEA 4PJNA 3RTRA 2HWVA 4M74A 1N5YA 3R3LA 4EM0B 1RBRA 3ZMZA 4BDYA 5AR0A 2X6NA 3BR1A 4LF4K 1ASUA 3TSPA 3IWZA 3LWLA 1RZ4A 2HNZA 4MFDA 1LWFA 4NLBA 1B1BA 2QSGX 2W85A 1D0XA 4DFPA 3ULEB 1IJWC 3SQ4A 2DXIA 4FJGA 2WTUA 1EKEA 4BE2A 1Z9CA 1YITN 4E70A 1OMIA 2P9PB 2VT3A 4DLEA 3T8RA 2GZWA 4L5JA 3K9JA 3NWSA 3HP9A 3CP2A 4IEIA 3WG7H 4OIQF 3PY8A 3CLOA 2W25A 4V19K 2BGGA 4A5BA 4WFNL 3DJCA 3I33A 1SFUA 3ZSYA 2HS5A 3K6GA 1QVTA 1VF9A 5H6RA 2KIUA 2R7VA 3ATVA 4LSLA 1T2KA 3H1VX 1JT0A 3L8BA 4BHCA 3REOA 3V4IA 1IXRC 3WU0A 1FLIA 1C0FA 5LMNK 2VBZA 4EJOA 3E5XA 3V7CA 1IN6A 3GTOJ 3BR6A 2VYPA 2B5JA 2ICWG 3BOQA 3FXUA 3CC2N 3N4PA 3NF6A 4MNUA 2D1VA 5EY4A 4KPYA 4DR6K 1FBQA 2OZMA 4BJTA 2R7RA 3CDLA 1IBLK 3DBHB 3TAGA 2RNJA 4C30A 1UB9A 4KN7X 1F4KA 2XHBA 3S15J 1BL0A 1WNSA 4BRGA 1BW6A 2Y1JA 2OCEA 1Z21A 4UUTA 4JI2K 4IHSA 1BOAA 1R22A 2FJ1A 2VI6A 3SDBA 2GXBA 3HYFA 4IDKA 1PJRA 1CQTA 1ATRA 1TGOA 3WQTA 2BDPA 2XF7A 2G8VA 3VOEA 1PUFB 4CCLA 5EDNA 4CK3A 5B1BH 3H3NO 4WCGA 3QIOA 4UUVA 1YS6A 2P5KA 4NXMK 1X9WA 1FP2A 2JK3A 4H0VB 1HF0A 3I0SA 3DBRB 1O4XA 4FO0A 5HLTA 4PWDA 4OLAA 2JUGA 1VQPI 2VUMJ 1MBFA 2M8GX 3NGIA 2NS0A 3TTCA 4CGGA 1QZ5A 4H0YB 1C6VA 1QRYA 1K61A 1QBJA 1NLVA 4BR5A 1NK7A 1G4DA 3I59B 2ME6A 2Z99A 3L4QA 2VONA 1ZGAA 1ZR2A 1S7OA 5J4YA 3QP6A 1DPUA 3H1QA 5LEKA 3I4MJ 3SBTA 4PUSA 5HLHA 3VEWA 3OYEA 1JUPA 4KICA 2EV6A 3LSTA 3DTEA 3UKGA 3VOVA 1RT7A 4N9IA 3OYKA 2ECCA 4RAGA 3SUNA 1O3TA 1YS7A 2KJBA 3V1QA 3F8CA 1Y6IA 4K25A 4LH5A 5DK5A 4FOIA 5I9EB 2HW3A 3CJNA 3SAFA 4BVPA 3P9KA 1QTMA 3MKWB 4CJEA 3HIFA 1OQYA 4DR5K 1XN7A 2ZCWA 1T33A 1KQ8A 2ETHA 2ZD1A 4JKFA 3DXKA 3M3ZA 1VQ4I 3THYB 2WY8Q 1ZBIA 4R8HA 4MQVA 3SFZA 1MSEC 4P5OA 2E1MB 1SEUA 1X58A 1UCRA 3OBYA 4LLNA 5CQGA 1GLDG 1V4RA 1M1EB 3K58A 2R7QA 5F1RA 2NRAC 2JGUA 1N33K 5CVUA 3WTTC 4JKEA 1KU9A 3THWB 5ADXH 2G7UA 5GADP 4F3TA 2RGVA 2HTSA 2UXDK 4FWPA 2O61A 3ZMSA 1IO2A 4II2A 2F96A 2VQFK 4B9TA 5JS1A 5E41A 4Q5SF 3WHCA 3GFIA 5KVRA 3VN5A 3VFZA 4IRHA 3V9ZA 4IRGA 1NGCA 1Q7YO 4DQIA 2R7FA 1RUOA 4ZHRA 1FKPA 2Y30A 4RGXA 1XWLA 4JKAA 2P9SB 4C1NI 4FVUA 4DV4K 1YW9A 3DU6A 3ITHA 3CMAI 5I3UA 5FDLA 5T7BA 2G8IA 3EZ5A 2BE5F 3WE3A 4KITB 1BGXT 2Y0SA 4QAGA 3TW7A 2GIZA 4BRFA 1JKQC 3AVCA 4KH5A 1QPMA 1RETA 4BR9A 2RQQA 1P8ZA 4FZXC 3KP3A 5ILVA 3LWMA 3P7NA 2ELKA 1X9MA 1ZRDA 1D9DA 4FK2A 5FJ8J 2CU7A 3GMEA 1D1CA 4U0VA 4XLFA 3BPXA 2FSKA 2BV6A 3WXIA 1LFBA 1R0AA 3F72A 1G2HA 2VKEA 4UB6C 4FWRA 1UWBA 1BM9A 3OYLA 3CUQB 4UY8O 3AVJA 2E34A 4FWOA 1JKPC 5J2QA 1FIPA 1LWCA 2EBIA 4C8NA 1F9NA 1NGGA 5JVGF 3O3FA 3PO3J 3C6AA 1BA1A 2Z2SB 4IHWA 4BRLA 3TP0A 3CCVI 1ESVA 2LFBA 2H3GX 2WAQA 1OYWA 3HOWJ 2VB6A 3JRGA 3FKIJ 4DOZA 5CZ2A 4CW7B 5GP9A 4CGJA 1T39A 3QPTA 4A3KJ 1J9AA 5E8GA 1BQMA 3GTMJ 1FOWA 1FJGK 4M41A 1ZRFA 3KLNA 4JI0K 2E5ZA 5CHIA 2QWNA 3IG1A 3VYUB 2K40A 2A1SA 4BRCA 2R5ZB 3DMJA 3HI0A 2EILH 1K4SA 4NCBA 2HI3A 3NF9A 1D5YA 3F6VA 3R9PA 3AO3A 4PGGA 2CGLA 5JFRA 3RZOJ 2JTVA 3K4MA 5F0CA 1REPC 3WXKA 4GW6A 2LOOA 1XMOK 4NLCA 1LV5A 3JRDA 4JKHA 1T95A 4FVMA 5GAGJ 2ESNA 3V1RA 1ILYA 3WTYC 3UNGC 3QBXA 4H8KA 5IY5H 4YFXF 3C3WA 4Y1CA 5ELZA 3TAEA 2IA1A 4Z4GA 1UHSA 1JLFA 1MDUB 3K59A 2QENA 2LBFB 2LR8A 3AKZA 4BGBA 3GBTA 4H03B 2E1NA 3V6DA 1RIOH 1S6LA 2DMNA 1IXCA 2E7WA 1RCHA 5EYRA 4EJWA 3S1NJ 3QODA 3NCIA 3QDKA 4KNYA 3FE1A 3GXOA 1YIOA 2E5LK 1BBYA 3BWGA 1A31A 2IOCA 2A07F 2LC2A 1XCBA 3RKYA 2R3SA 3IS9A 4XRFA 3VQDA 3P9IA 3DLGA 2E8AA 5AQIA 3CMEN 1D3YA 2F5FA 3SPYA 5F1XA 1NJYA 5GINA 4Z0UA 5HS7A 3MQ0A 1KAYA 2HF4A 1S9HA 1XMKA 3DRRA 3PSFA 5LHGA 1HQUA 3IUCA 4M9XA 1QQOA 1QU3A 2VBYA 3BUZB 4L0ZB 4MFEA 3HRMA 1ONVA 3LDSA 3AG1H 4G9YA 3RTVA 2W24A 1VQON 2LTPA 2IAJA 1VFCA 1YVNA 3TDUC 4BU2A 2UXNA 2L9VA 3LQRA 2O8DA 3PIPF 3CCJI 3O4WA 3JYTA 1V5EA 2Y0SN 5LMUK 3KYCB 1T3VA 3FMRA 4DYQA 1KZHA 2PMHA 3MEGA 2DK5A 3SQ1A 2IS6A 5SZTA 1VQKN 4TV7A 1HRHA 3MAQA 3W0LA 3VEPA 2EFPA 1Y97A 2JZYA 4L3QA 4BH9A 1MJ9A 2YUSA 1ORKA 3VQBA 3VB2A 2D1KA 2A5YB 2KDZA 2VBXA 2ZB9A 5DM6L 2DTUA 2XSDC 4A0ZA 1Z3XA 4W5QA 2VCPA 1ZQ3P 1LE8A 2DFHA 1IKWA 2BGCA 1V5FA 4RLFA 4TSXA 3BJOA 2OTJN 1B92A 2FBIA 3TSQA 1HXDA 3TANA 2WAQN 2HFHA 5HRNA 1YTAA 3CQ8A 4XORA 3UKUB 3L2UA 1ZBFA 1ENHA 3C2GA 4B9MA 4WF2A 3F8MA 4BY7J 1ETOA 4CGFA 5HODA 3T8TA 5F1JA 5GAHJ 5HNFA 3L4IA 3H9QA 1NMDA 5FLXK 2VE9A 2ZF5O 4KB1A 4C1NK 2COMA 3GE1A 4H5NA 1KAZA 3J80K 4B08A 3WQUA 2QQAA 5AQFA 4KBOA 3WE2A 3WU2C 1BR2A 1WGXA 4FLYA 4XOPA 3WXMB 5CPRB 3RQ4A 3OA9A 1HKBA 3HDDA 1UFMA 1WPKA 4AHCA 4OAYA 4UVBA 2P5LC 4JKGB 4A3FJ 4B3OA 2F4VK 4BEHA 4ON0A 1I6XA 2Q31A 3FXQA 3R60A 1P9QC 5D5UB 3CCMN 2VKHA 4XICA 4FYDA 3W3DA 3HHHA 1GLFO 3L2RA 2KZVA 2DLLA 3AO1A 3E6CC 2M3AA 3TI0A 2ITGA 4E7KA 3ZXSA 4Z4IA 3WTWC 5K5RA 2BH1A 3CG7A 2EFQA 3BZCA 2PMZN 3SLCA 5GAEP 2BBYA 2E2HJ 3E3VA 3EN9A 4QPOA 3LP1A 1LPQA 3RI4A 1IAWA 2X6OA 3OTOK 2CQNA 1USTA 3Q5FA 3M8JA 1LUJB 4HF2A 4E7HA 3ZSQA 2I7NA 4CO8A 2E6LA 3ISNC 3I3LA 2R0QC 2QUFA 3WODF 5JVHL 1NGBA 4JAXA 3N4MA 4ILHA 3ZMUA 2VBWA 3JSMA 4B3RK 3KCCA 2OTLI 3VA0A 2X1EA 3E6BA 5E3MA 4FCYA 3C7NA 1U04A 4JI5K 3TAMA 3MCAB 1Z6TA 1T8EA 2O8DB 3NHGA 1ERDA 2CQXA 3AO2A 1OCCH 3BR0A 2F5EA 3A2FA 1KFSA 1J09A 4IFYA 3F8FA 3J8AA 1SL0A 4NC6A 4CEFA 2LY1A 2RE2A 2BVLA 5J1RA 1RT3A 4EJVA 1ZELA 4BY9C 1D5VA 2E20A 3CPWM 2VWKA 3ABTA 4BJ6C 1KAXA 4G1QA 1KFDA 5LHIA 2BY0A 3O9RA 1LE8B 4ANJA 1HYZA 3O3KA 4I0AA 1MIJA 4OPAA 3QO9A 4CZKA 1OISA 2E1ZA 4LLGF 2WV0A 3AAPA 1I1GA 1C0UA 2QXLA 4FJHA 5IP6A 3GX4X 1KONA 3IC7A 2VJ4A 3SZTA 2AXTC 3RMCA 1HR0K 1SFXA 1N78A 1S5LC 2PI0A 1PDNC 3JCUC 2PEXA 2AQFA 5FFZA 1UAAA 1QHHD 1RBUA 3JRIA 5JS2A 3HPOA 1YOVB 1J5YA 5HDGA 2CQKA 2O03A 1OH7A 2DPNA 1XD7A 3VQPA 2P9KA 3TAFA 1U9NA 3QIPA 3MN7A 2PFBA 2PYJA 4HCCA 4LF8K 4ZYHA 1X19A 2J5OA 1IUFA 2HVIA 3VGMA 1YTYA 2BEOA 4JX5A 3HSRA 2RNGA 3CCQI 1HSJA 1D8YA 3ZSZA 1HKGA 4CJ5A 1QO0D 1IV0A 1GT0C 4U0WA 2PG4A 3B6PA 1X1DA 1YF5L 2KFZA 4CJQA 5J2PA 2ZM6K 1J5OA 1SV5A 4Y7NJ 3K4JA 1TUYA 1U2VA 3QWLA 4LG0A 4BG8A 4HHTA 1EH6A 1V3FA 4M9SA 4G8XA 4B9SA 4BQAA 2ATQA 2E36A 1W5SA 1T03A 4JX6A 3SJJA 4XLPF 2VPRA 3K57A 3MZYA 4ZC3A 3AAFA 5AQWA 5BOXA 1VQ8I 2DK8A 4UHTA 3S3MA 4DHYA 4WCEL 1XC5A 3VPZA 2TCTA 1ETQA 1ZBHA 2XDVA 2ASOA 2O8EB 2M4KA 4HPQA 1C0WA 2GXAA 3VMFB 3I55I 5FPMA 1RDDA 2KZGA 4BBRJ 4D7MA 4GVMA 3DAWA 3AFHA 2JA6J 2CH0A 1I6HJ 5CYMA 5M5XJ 1AU7A 1J5EK 1S1XA 2GBZA 4JI3K 3CJQB 2KLAA 4ILJA 4IFVA 5LGTA 1XGOA 3EDPA 4RGUA 5ICGA 3KK1A 4N4OB 4HQEA 3D0SA 1L3LA 2ZFUA 5E79C 5DUIA 3CQXA 1GLNA 1MWKA 1WCMJ 1G8XA 4FJLA 5IYCJ 1WBDA 5D8KB 1B9DA 3FXMA 2XPUA 4NB5A 1RI7A 3KZYA 2UUZA 4CZMA 2GEMA 3CXCM 4BQNA 3HSTB 4G9ZA 4QTRA 1TYQB 4FT8A 4ETSA 5BREA 1Y1VJ 3FZVA 1O1WA 2CUEA 1VQMN 4DLGA 3DXMA 3LP0A 3CMMA 4CF0A 4CZCA 3D2FB 2YI1A 4BRIA 1C1AA 3U6FA 3VTHA 3G6EN 1ZARA 2CV0A 4MDBA 1HKTA 1XGSA 2VASA 2P1JA 2M9HA 1YIJN 1BG3A 3EY1A 3H5AA 3KLHA 3FXOA 2VXDA 4OVLA 1KRPA 4QS7A 2EFWA 1ZC6A 3M8RA 2FBVA 1NKCA 3V7SA 2V51B 1GVDA 2V9KA 3J7ZI 1SL1A 1FBUA 4V2GA 5EGOA 1CLQA 3LSKA 3K70D 2LVSA 1SC7A 4IBNA 3NARA 3TARA 4ID5A 2F9WA 3BG5A 3IKMA 1XUPO 4A93J 4O5BA 1FYKA 1MMAA 3FDYA 3QEVA 4KHNA 3E66A 2KDOA 1O7FA 4DFMA 3GZ6A 4GFBA 1TC3C 1VQPN 3M4OJ 3LL3A 3AVMA 3AGKA 2A5XA 1RILA 2DOAA 2DA5A 3G1LA 2E60A 1HKQA 4Q0BA 2IS3A 4EP5A 3IAS2 4E6KG 4DNCA 1QQCA 4GV9A 4A57A 3CUOA 4O3MA 3Q7CA 4HRIA 1LEAA 3JREA 2A6TA 1XC3A 4NDLA 5EJCA 3H1CA 4BQZA 2KZMA 1W7PD 5AQHA 2O9LA 4CIEA 2H27A 3S9HA 3KKSA 1KTQA 4DTSA 1GXPA 3LSIA 3PFIA 4CE9A 2RPIA 2W41A 2V7ZA 2IA0A 4GXOA 4JKCA 2NNWA 3RR7A 3P9CA 3PQKA 4ESJA 1RKWA 1ATNA 1RTJA 1FIAA 2XUBA 3F21A 2FMLA 1RT4A 2FBHA 1RDWX 1SFOJ 2EFNA 5L3DA 2K3PA 1P4XA 3VQAA 2HQNA 2HHTA 2G8UA 3RSEA 4DFJA 1BHLA 3HGGA 1DT9A 3IDHA 2HBKA 3K7AJ 5EOYA 4LD0A 1XI1A 1ON2A 1HKSA 3AO4A 5AQJA 4DTUA 1E3PA 2CGPA 2VQLA 5FLXZ 2A40A 4BRQA 1R00A 1I94K 4Q48A 2KIQA 3PX0A 3BZKA 3J80Z 3RWUA 4CZFA 4CBUA 2VN2A 4A3GJ 1S7AA 2P9UB 2MC3A 3TBIA 5C25A 4DUYK 5FLXO 1YX5A 2Q0RA 2PJPA 3QLHA 3J80O 1SKSA 2Z9OA 3MXJA 4W5NA 5B66C 3QFPA 3U1KA 1GLLO 1HYSA 2IAIA 2YJEA 1Y8RB 3HOTA 1D5AA 3W2WA 4XKVA 1LNWA 4IX7A 3DTKA 3ZEUB 1HPMA 3SZ2A 3O4NA 2DDBA 4RW9A 2LF8A 4OINF 3IH3A 2I10A 3AL0B 4N76A 4HEA2 3KP2A 1I1SA 1WFXA 1NK6A 4NYNA 3C95A 1BN5A 1KQ0A 4KN4X 1OKRA 2JRTA 4Z4CA 1MSFC 4KFCA 4CHZA 2A6AA 5HROA 3LMMA 3IV5A 3U8XA 3M8EA 1O13A 3U21A 1JHFA 4YIFA 2GV9A 1YXQA 5F6FA 1JGGA 2F5VA 2H6CA 3BJAA 1KU2A 4FJKA 4A61A 4L9TA 5EGOB 3EYZA 1DP7P 1VQLN 5M1OA 3CC2I 4H0PA 4FTHA 3V7RA 1ZBSA 1KVBA 4ENNA 3CCLI 1IV6A 3IFRA 2NVXJ 3RMBA 3OSGA 2KRHA 4DBQA 2OQGA 2VJIA 1S6PA 3E01A 4FHTA 1EV7A 3MMYB 2YJFA 1EXQA 2V26A 3CJCA 4CJLA 1B9MA 3L2VA 2ZJ2A 2L54A 4FPAA 4B9LA 1JI8A 3OIPA 4YIRX 4FJIA 2P5GA 2PJRA 2JVGA 2HTJA 2NNYA 2MC4A 4JRPA 5KK1A 1BU6O 3L3VA 2HNDA 3K9KA 2Y0MA 1K8KA 4I0BA 2HBJA 3E5UA 1H89C 4G94A 2FOWA 3UE5A 4EQQA 2PFUA 2EIKH 2M5WA 2WC9A 3A5MC 3L1PA 2LP0A 2PAVA 4DQPA 4IHYA 2X74A 3OS2A 4OGCA 3LQQA 1X3WB 5FLMJ 5CJ9A 3SJMA 4U67L 5FGMA 3K0SA 1SAZA 2Q8KA 3CDHA 2X48A 1TW3A 2CSOA 2MW8A 3B8AX 1HNIA 5FKOA 1T05A 2VIXA 4M6YA 4BROA 3I9V2 4FXDA 2RVCA 1VQNN 3MKYB 2R7OA 2VG5A 4CHPA 2BYVE 1D1BA 1T0FA 3KKRA 2WOMA 4XN0A 3F23A 1RR7A 4KV8A 1EH8A 4H4KC 3DKWA 2Y9ZA 2AHQA 4M73A 4KI4A 4EMSA 2XB0X 1MMDA 4A6EA 2E19A 2HBMA 3R61A 3V9UA 3PQJA 1NGHA 2P6TA 3LAKA 3ZN0A 3RIRA 1S1VA 4H5RA 2XRIA 2D2WA 5L3BA 1R5HA 4C3JJ 3SUPA 3E97A 1IGNA 4B44A 5HRPA 4MGRA 1O7LA 2M7AA 2CQ7A 2OPQA 4F93B 2H94A 4X0GA 3K69A 4OPKA 2RREA 5GADJ 2DMUA 3O8MA 2P9IA 4DSIA 2HZDA 1XS9A 3VEOA 4CJ7A 2V7FA 2RDPA 1RPWA 5BR9A 1K78A 2JPCA 4WYBA 3VPRA 3KP7A 1TQMA 3KZZA 3Q0VA 3IRXA 1S7EA 2UXXA 1W5CC 3CERA 2XAQA 3WEEA 4IOXA 2JQ7A 1JCGA 4BVOA 1QSLA 1NK0A 1G3WA 4AM6A 3H46O 2QVOA 3VYSB 1FOKA 1P2FA 1Z77A 1SFKA 4IZZA 4QWQA 1NGAA 1MBGA 1PP7U 3K10A 4H0OA 1QPIA 1X3UA 3IWFA 2IVOA 2W4SA 3DKXA 2QWQA 4EFHA 4F4KA 2XRNA 2DAOA 1Z0XA 2M1BA 4KKOA 1ZREA 1IN4A 2HHXA 1MNDA 3ZMVA 2IS4A 4JYAK 2FNAA 3ERED 5CY4A 3PL8A 3G73A 3CCJN 4BYYA 4K42A 3EE9A 1XMAA 2I5UA 3M7GA 1Q8IA 2IXSA 1OPCA 1XC9A 4OGEA 2KQRA 3HZJA 2XGCA 3SQ0A 5J1UA 1UAXA 4WF9L 3BG6A 3RSNA 2XV4S 2O7OA 4LMYA 4HF0A 3DLLL 2OAZA 3I8DA 2IGKA 4IHVA 1L3TA 1ULYA 1U3EM 1O3RA 4ENMA 3U9GA 3D5SC 3CYMA 4GYGA 3JW4A 4K8ZA 3VWBA 1OCPA 3TR8A 1RBVA 2K85A 4B1ZA 3WGIA 4B4CA 2CQQA 3EETA 4HQMA 3VESA 4ZDPA 2JRMA 1QSYA 1VSLA 3L0QA 1JTYA 1B59A 4FX0A 1FK9A 3QFUA 5M1QA 1WUAA 5KPZA 3J7AO 2L3DA 4ZYGA 2Z1DA 1KD1O 2M30A 4LC9B 2OF7A 4ZH4F 4B47A 4CEEA 3LSMA 1K73O 3ZN1A 2VT2A 4A0YA 1VQ5I 4NB4A 2JSPA 3O8HA 3Q9SA 3O3HA 1ZG1A 2FF4A 5HNHA 4HV5A 1R1VA 2W40A 1HBXG 2H8WA 3FIWA 3M1CA 3VQ5A 5L3CA 1RRJA 3L6QA 5JMVA 5KGXA 4B3XA 3GFJA 1YRNB 4DTJA 2V1NA 2DA4A 4II3A 4BGDA 4LITA 1MA9B 3LDLA 4G7ZF 2XSJC 3E9OA 4FM2A 3WTXC 1B72A 4XIUA 1YG2A 2VQGA 1RKTA 4BHBA 2NRRA 4WE1A 2B4JA 3RCOA 3KLIA 2F5CA 5EEGA 2X85A 2O6GE 2XF5A 1P4WA 1JJ2M 3VQ7A 5C24A 5M1FA 1K78B 5C2FA 1ZHFA 3K4LA 4RW8A 2ZO4A 2IGIA 2TDXA 1SKWA 2HU9A 4KISA 3QNOA 4RCHA 3K2PA 4IKFA 2EZLA 1AA7A 1FT9A 1UMQA 4W5RA 1HDPA 5B8HA 1F21A 4BHPA 4CH7A 1QZ6A 1ZRCA 3FR0A 2ZE2A 2HOEA 3CJ7A 3KLGA 4AIKA 4JS4A 3V8JA 4D0PA 1NG6A 3FGUA 1R6RA 2BANA 1JJ8C 3A2KA 1Y8QB 1NJZA 4B48A 3PIOF 3HUGB 3UKRA 3SXYA 5J4VA 2YHYA 2O8FB 3W3CA 4ZDOA 1Z05A 3TAQA 2BY3A 2BZTA 4DTMA 3DLEA 5KRTA 1D8JA 1VQ9N 3C6TA 4HNVA 3FFIA 3E9PA 5CVRA 1BCMA 3M6GA 2R92J 4LIVA 2M45A 4WFAL 2HMIA 4D1QA 2K9SA 4C2UA 4GKJK 4O5FA 3X2QH 2Z5UA 3SCXA 2KISA 3R6SA 3TKYA 4KIBA 2XPWA 4BXUA 4HUGA 4DQ2A 2WBNA 1FNNA 1NTCA 3PFYA 1IG9A 3CCYA 4EZ6A 1IBMK 1XTAA 5SWMA 1U9OA 2QSFX 2FNPA 2F2EA 5LL6Z 5FLVA 2ZGZA 3LDQA 2NUBA 4Y52J 3FK6A 2O8CA 3LPUA 3KK3A 4WWCA 1J53A 4BAYA 2M4GA 5H1SQ 2V6EA 2A3ZA 3LL7A 4DV3K 2VQCA 1VQKI 1T98A 4HTUA 3G10A 4CESA 3AA4A 2V52B 2KQ2A 1IRXA 4I09A 4IF4A 4JK8A 3OBWA 1U78A 3VF2A 1TT5B 4KT6A 5LHHA 1M90O 4IOAF 2VKVA 4R79A 2P4WA 2MGQA 1YW7A 3QU6A 4A3CJ 4A3IJ 4ITVA 1A6IA 2QWRA 1EH7A 1S8NA 2G8HA 3MN5A 6PAXA 4BE1A 4JI4K 1HX1A 1SVMA 2YX7A 3MVPA 1W9HA 4L0YB 1VHXA 3DWLA 4DV2K 4E7JA 2VGMA 3OYIA 1A36A 3MDQA 4UUSB 5EF6A 3Q0UA 1OH8A 3W6KB 3SMSA 1HW1A 3NFAA 2GLOA 4B9QA 2LMDA 5JVGL 1E3HA 1KC8O 2DCEA 3MZ8A 1EA3A 2W7NA 1MDMB 3VQ4A 4NC8A 5F08A 2KL4A 5M1PA 1MJAA 2EPFA 5EEAA 3OSFA 1IH7A 4AQYK 3CJAA 2XO7A 3I56N 4PSXA 5DM7F 2OA4A 1EF4A 3T69A 4A3LJ 1PUEE 5KTQA 1QE1A 4OOIA 3HOZJ 4DV6K 2RF2A 1JXSA 4BDZA 3FMQA 3L09A 1NOYA 1FPQA 4DU1A 5EEHA 4BNCA 3ERMA 4CBWA 2P7CB 2GA2A 2XPVA 3ZT2A 1K79A 4Q4ZF 1UG0A 1NGDA 2QM1A 5GAEJ 4YFKF 2LNBA 3B6AA 3EUAA 4YNQA 3OYDA 3K0LA 1FW6A 1R1TA 4CJ3A 4JHDB 3ISPA 1X1CA 2HOAA 5BPDA 4BXXJ 5M5YJ 3CCMI 2ZNZA 2Y69H 1RFQA 2JVHA 3PLAA 3H08A 3AVHA 2DQLA 4O8KA 2EB7A 3FZFA 2ZMEC 4Z2YA 4A2AA 3ID8A 2PY5A 4XEIA 4YOXA 4HG2A 2E2JJ 3C6UA 2XHKA 4P9UA 3P1GA 3I55N 4B1YB 3GTLJ 2L7ZA 2GWKA 5IYDJ 1VRUA 2E1YA 3A0HC 2QBYB 2BTFA 1S1TA 3M8FA 4LOCA 5AQNA 3HSCA 5AQSA 4PKHA 3L2WA 2BY1A 1D8KA 3N4QA 1VQ6I 2JN6A 1OYIA 4GNIA 1XB4A 4IO8A 5TKYA 2GOMA 4XLAA 2LD5A 4YRVA 4CJSA 2O8CB 1QHAA 1ZBUA 4K0KK 2KZZA 4YEJA 1KXPA 1FMVA 3SPZA 3QEIA 3AVBA 3V1OA 2PLYA 1ZYQA 2VWBA 2M34A 4IWVA 5K1YA 3MWTA 3ULEA 3MKZA 3Q9VA 3VF6A 2CFOA 4E89A 4ELVA 2NOJB 2MLKA 3KLFA 5IT9O 1T6SA 5AQUA 3LSGA 3DXJF 2P9PA 4LF6K 3J7ZO 4I02A 4LIUA 1D0YA 3IL2A 1X1PA 1SVOA 2ASPA 3BGRA 4DS5A 3HXMA 3AVFA 3QOPA 3KZIC 1U8RA 3DRSA 4O55A 4UB8C 1BI0A 5ICEA 4FWNA 4CA0A 4ZYDA 5HLFA 3TMOA 3FISA 3OYBA 4HA8A 4B1WB 4D5CA 4IEJA 2MH2A 1BR4A 5EXWA 1RBTA 3DLHA 4CFDA 2Q2EB 5FRNA 3K2AA 4ZZDA 2ISZA 1OVYA 1LDKB 1RDUA 1P90A 2Z1IA 4FQGA 3GZNB 3M8QA 3AG3H 3R1XA 1FZPB 1ASVA 3WNFA 2HQ5A 2HPIA 2AXLA 2RN7A 2HVHA 1P7IA 4AIDA 1N75A 4M9ZA 3VEZA 5M1NA 5E17F 4XH4A 4S04A 1BIAA 2NVTJ 3ZT3A 1LVKA 1MBEA 1GVJA 1PUFA 5DV5A 4DSFA 3V42A 1JL1A 2DYRH 2YKMA 3VENA 3P83D 1S72N 3FLCO 1TK0A 3JTHA 1QA6A 3MEDA 1N6QA 2Y48A 3ZQGA 4HSTA 4YELA 1TL3A 1NK4A 4CF8A 3CCRI 2L01A 1OYYA 3DLAA 1QZZA 3JRHA 4DJAA 4Y13A 4RTFD 3KHYA 3VQEA 4F92B 2BUPA 2JUCA 4I2QA 2A68F 4JI6K 3KE2A 2QWPA 1YLFA 1IKVA 4YHHK 3LANA 3I59A 3ZT0A 2E4LA 4M3UA 3CHWA 4MEYF 2M2EA 2IGOA 3KP6A 2NRXA 4DR1K 3KP5A 1RUNA 4IL6C 2CW8A 2V7YA 1JTXA 2WC2A 3O6WA 1T08B 3RPUA 4RAYA 3ABMH 1BC7C 1GLAG 3KEQA 2OCCH 4FW2A 3HO1A 3FZHA 1HNXK 3BQZA 3T19A 1L5UA 1D1AA 2LKPA 4GMJB 3PJRA 2MBFA 1JUSA 1KLNA 2BW3B 3BROA 1NKBA 5KAFC 3FXKA 4X6AJ 1IF1A 1MBHA 1CF7A 2DI3A 1HYVA 2Q1NA 2H8RA 5J40A 4MO7A 2R93J 3OHRA 2OC6A 3J7AP 5EG0B 4E7SA 2K27A 2EWSA 3BLYA 2E7XA 5E26A 2X6XA 3THYA 3SDGA 2DPUA 2NS7A 2YCHA 2FU4A 5CVIA 1KCFA 4FX4A 1BOBA 3S3NA 1KVCA 5J8CA 3VTIA 1ZG5A 4BREA 5DEQA 2HKXA 4C2MJ 2G0EA 4JD2A 5GPAA 5AZJB 4B1UB 3THWA 3CF2A 1DLOA 4EM1A 1BDGA 2OPTA 4IHXA 3FMSA 4Y0WA 2A6HF 5F64A 4RW6A 1KVAA 4YOVA 4KHPK 4G12A 3U9ZA 4OKJA 1UA1A 3DLLF 3WHBA 3JRBA 1BR1A 3SZGA 4GDFA 1VQMI 4WQ5A 2O4IA 1MNMC 1T8IA 2IBDA 2ZBKA 4Z94A 3CCLN 3QRFF 2P9SA 3CCUN 1FWZA 3B02A 2ASMA 3G6EI 4EM2A 2ACJA 1EETA 2KFNA 2F8TA 2XKPA 3O2PE 1LDDA 5E1ZB 1BIBA 4AIHA 4FJXA 2HOSA 4IHTA 4JYKA 3S1MJ 2XAHA 4YG2F 4BR2A 1YIJI 3NF7A 4DYCA 2K9QA 1SMYF 3LM9A 4HAMA 3HOVJ 2EV0A 4B9VA 3A02A 3UIQA 3GYHX 2Z1JA 4OX9K 1XG1A 2DN0A 2OPPA 1WJAA 4PJLA 2YHAA 4YORA 3MFKA 1FX7A 4JKDA 4UQGA 1U5TC 2F4OB 3VQQA 3GLLA 2ZJRF 5CQEA 1WJBA 2E2IJ 4GV6A 3ZQCA 3ZQFA 5F0XA 3BG3A 4G6DA 1OCOH 4B3AA 2DTRA 1K4TA 3RR8A 1W36D 2YKNA 3FZLA 3MECA 3G71N 4AC0A 2C6YA 3CUQA 1I27A 2P9NB 2DOEA 4NXNK 1X1AA 1W4MA 3ULQB 4R5PA 1NK8A 5B3SH 1C1CA 2D0OA 1QS4A 1ZGJA 4A3EJ 3B6CA 2IA2A 2XGDA 4IVNA 5M3FJ 1YX3A 2DQRA 1WRJA 2K02A 4Z4FA 4B8XA 4LF9K 2HQRA 4ISGA 1Y39A 4CCHA 4XK4A 1FTTA 3CJ1A 1RNHA 1ETVA 3LSRA 9ANTA 4M3RA 4G6TB 1CF7B 1K8AO 3MAJA 2R5ZA 4L18B 3SV3A 4M3EA 5M5WJ 4FLXA 2KRCA 3ZR8X 3M5RA 4FJJA 1TQIA 5B5EC 4QPQA 1RT2A 1BI4B 5AQQA 5AQOA 4DR7K 2QA4N 1QVUA 1ZH5A 3QP5A 1F43A 3ESWB 2IGNA 1K6OA 4EJTA 4CJUA 1SD5A 3KYLA 3KWGA 2L5QA 3S2DJ 2CW0F 4AWXB 1LW0A 1I3AA 5AIPA 2CH5A 3CCSN 4DU3A 2LBFA 1XGMA 4F7ZA 1X3ZB 3VGLA 1X9SA 1R5GA 2ZFWA 3OYCA 1K83J 1TLHB 5K7HA 4CYCB 2R7XA 4JD2B 3H6EA 4BR7A 5F0FA 4B8CA 1OH5A 3AG2H 4CJWA 1S3JA 2P0WA 3NDKA 4AVZA 4O5VA 3BZ6A 4JK7A 3FXRA 1D9FA 3OYMA 3FF5A 3A5LC 3T1HK 4NUBA 1YW8A 1LB2A 2AP1A 2ZSHB 3M1FA 1T7PA 3BTLA 1JLBA 4LD5A 3ZPLA 3DEUA 2QWOA 4PUOA 4M42A 3TO6A 3GFLA 4J2BA 1LOTB 1L0OC 4HNUA 1KU3A 2HMPA 2DA7A 3JTGA 1H1VA 5GTHC 4HCBA 3AVNA 2MG4A 1ZBLA 2GX9A 4BRNA 2E1MC 2CFXA 2Y75A 1VQLI 1W7PB 5DCMB 4BRKA 1IC8A 2VWJA 1JLAA 2I7PA 2FXUA 1JE8A 4P1WA 3C18A 1N25A 4MQ3A 2YU3A 4A2BA 1R7JA 1R49A 1UELB 4CGHA 1FOXA 4I2PA 2IIRA 2F6CA 2OJED 4BXFA 1G6NA 2CRGA 2X6WA 1W2BM 4NC7A 4JN4A 1JKHA 1SKRA 2KT0A 1Y0UA 4WQ5C 2W6KA 3E6DA 1RDAA 1VQ5N 1DGKN 4O44A 3H9GA 4DSLA 2BXYA 1NJIO 3R0JA 4AILC 3OWTA 2YHBA 1RDBA 5CYVA 4I7HA 2A1RA 1X2NA 3ZLJA 2Q3SA 3EQLF 2K9LA 1YJWI 4A3DJ 4CFCA 4BRAA 4F52A 3A8YA 3U1DA 4G7HF 4YDUA 1SZ2A 3ZETB 2V9VA 4LSNA 2IVNA 3UKUA 3HPHA 3KP4A 2KJCA 2OV7A 1FSHA 2L7MP 4AD9A 3D5LA 5LBQA 2ADUA 4DMNA 4E4HA 2GXGA 5M3MJ 1KQ9A 3CDIA 1VQNI 5D4RA 4OIRF 1NH3A 4MLOA 3LM2A 4ZZLA 4AH9A 5AQLA 4DSKA 4HDVA 2JA8J 3T5XA 1O3SA 1NJWA 2W00A 1YHQI 1IW7F 1G3SA 3BY5A 2LK2A 3FXLA 3UR3C 1I5ZA 1DUXC 1IZ1A 2B9SA 2FBXA 2P5OA 3TTFA 1TWHJ 4LJZF 3OYNA 2NYXA 4JKGA 3WXLA 2X78A 3O8GA 3GTPJ 1NK2P 2PMZA 3J81K 2J4RA 1VQ7N 4CCJA 3BTCA 4EZ9A 3RKWA 4BE0A 1AOYA 3MXIA 2XAUA 5FKKA 4RB2C 3NEUA 3T1AA 2WY7Q 1J6ZA 1Z7LA 1UG2A 3GVAA 3GTGJ 4FL9A 3FZKA 2RAEA 4EGYA 1FBSA 1JKOC 3F73A 3BT9A 2CGKA 3S2HJ 1Z26A 4QS9A 5KCMA 2QYOA 3KPHA 4MIMA 2ZMEB 2JSCA 1JUMA 3MKLA 2WONA 3KETA 1LWEA 4DSEA 4KYWA 4MEXF 1WSFA 1VNDA 4IRIA 3EZWA 1BW5A 5FPDA 3SV4A 2NVQJ 4FK0A 2VL8A 2YHXA 1XX5A 1ASWA 4ASNA 1GLBG 3K1NA 4E19A 5CE3A 4KA4A 3QPSA 4ENKA 1FY7A 2EQRA 2YNIA 5KQDA 3A5NC 1RESA 1S9EA 5EZHA 1ATSA 3O4QA 3Q0WA 4DQQA 2HHQA 3OL3A 4A5AA 2QXFA 4U0YA 3OS1A 1ITYA 2PN6A 4NQWA 2VE8A 2P7VB 2LKXA 4JLHA 4BQQA 2HQAA 1BIZA 3KZBA 3VQ6A 4F9OA 3ZSXA 1ACIA 1Z91A 5LGNA 4AU7A 4FW1A 2E71A 4JRQA 4BR4A 4I6ZA 3CQYA 2XIGA 2HHHK 1C0GA 4BS9A 5HLIA 1WJFA 3DLKA 1F36A 3WGGA 3B6OA 4A0XA 4IDHA 1N36K 2DMPA 2YNGA 3TOBA 4FOEA 2BHZA 3HVRA 1TVRA 3C1DA 1VSDA 2BXZA 4RW7A 4KT5C 1BO5O 4KO0A 4I76A 1QQMA 3CC7N 1YI2I 2G7HA 3FZMA 4XKBA 4W97A 4RW4A 3ZX0A 5TKWA 2VJ5A 3HL8A 3TL4X 4CZJA 4MTDA 5K5QA 3AG4H 1T38A 4FLWA 3O9UA 2X6SA 3EPZA 1BI2A 2FOKA 5IT3A 2O5RA 1V5GA 4UV9A 1XCVA 2X1CA 3QYEA 1N8RO 4PGHA 2FQ3A 4ID1A 4KMUX 4DYRA 1TKZA 2D5VA 3DQVC 2JA7J 2STTA 3V81A 4X1EA 3K9TA 3RDIA 2G8WA 2OZ6A 3ABKH 3A01A 1TP4A 2P9LB 3F9MA 3FKJA 1W7AA 2R7ZJ 4PJJA 1N34K 3OMYA 2CG4A 3DI6A 4QS8A 3ZOBA 4MFBA 1VZ0A 5JICA 3FK7A 4YDUC 4M3GA 3AVLA 5ILUA 2CJJA 1G3YA 1F5TA 1JLEA 5KPTA 3SZPA 1GLEG 3TU5A 5K7ZA 4MDAA 3H3ZA 2EV5A 3OOPA 4AUXA 1IKYA 4CJKA 5B1AH 3I5UA 1B9FA 4BR0A 3T0YA 5AZIB 4CZHA 1NK9A 4D7NA 4AHTA 4CICA 4WX9A 1JCFA 1WB9A 1VQ6N 4CGDA 4AIJA 2Q0OA 4F2SA 4OPJA 1I3QJ 5ERIA 4M3YA 3GTJJ 4K8XA 3H35A 5GIOA 1JCEA 3ZRGA 3BR5A 4BRHA 3HL2A 4H0XB 4G7OF 4JNEA 2O8EA 2LREA 1VQ9I 1W36C 4CEQA 3KK2A 3SBGA 3CETA 2R5YB 2L9NA 4AVPA 3NMUA 2IEKA 3D1NI 5DDGA 4WQ4A 1MMNA 2LG4A 4PJMA 2R7TA 2XY7A 3LFKA 2IT0A 3GFMA 1VAZA 3DV8A 4CHOA 3SNNA 2E2OA 4PL8A 5D4SA 3JAMZ 4CIGA 4OU0A 4NQWB 1MD0A 4GVEA 1W5TA 2DA3A 4HX8A 4K41A 4B1VA 3K5MA 3BTIA 4PSWA 2WADA 1SUQA 3VSLA 5BS6A 3ZT1A 1ETXA 4DV1K 4KTWA 3CC4N 3CO6C 4U7DA 4I6MB 2ZJPL 4M45A 1OFCX 4F3QA 3AAQA 2X6YA 4ENJA 4Q5VA 4DSJA 3S41A 4EEFG 1VSMA 1GDTA 3VEVA 4H4OA 3MN9A 4XIDA 1KLMA 1BQNA 4KJZA 1TYQA 2Q97A 3D45A 3EUHA 1RNLA 4LFAK 2DT5A 3GTKJ 2W57A 4M71A 5FFXA 3NH1A 3WTSC 3ZQIA 5KGWA 4OPHA 3KD5E 5JVTA 3D2FA 5IPAA 2FRHA 2RQPA 2M8EA 5JLXA 3E0JB 4FWLA 3D2EB 4ZTFA 2M7BA 3T1BA 3COAC 1RTDA 5BR8K 3N97A 1GLCG 1LW2A 3GCMA 2HHVA 1CZBA 3CO7C 5FKLA 3E1YA 1MW7A 2Y31A 5FPNA 2LSOA 2JLEA 3S8PA 4ZTJA 3G0ZA 4RM2A 3A01B 2YSRA 4RS8A 1T56A 3C2HA 1QVGM 3KX2A 2LLKA 3I56I 3JSPA 2D4WA 2AO9A 2YU9J 3CCRN 4DTOA 5E3NA 4BC5A 5HDKA 1VSKA 5A2QK 3LP2A 1J2XA 4XSZF 1LCUA 1KYWA 3KWIA 3H92A 2ZC2A 1ZLKA 1JHHA 2UUAK 1U5TB 4YOWA 2EH3A 4W5OA 2UUCK 4DTXA 2CGJA 2KFDA 2BVMA 1DP3A 4Y33A 2JA5J 1I50J 3G1OA 1M1KO 3PNYA 3C65A 4RB1A 3F6OA 2XF6A 3I8BA 4GV3A 4XN3A 4A5NA 3O3GA 4XM3A 2HGCA 3K2ZA 1HNVA 3W6VA 4AHVA 4I9QA 3VERA 2O8BB 1MGTA 2DJIA 5AONA 2MD5A 4GYIA 4N5SA 3ZCOA 5D5WB 4DB3A 2Z1HA 3IKVA 1IBKK 1T6DA 3SYZA 1TK8A 1J7KA 3KEYA 1DQUA 4IO9L 5AQZA 2KPMA 3SHFA 3HVTA 3NWTA 3MK6A 2QQ8A 4L9VA 3H9JA 3PIOL 2NRWA 1EQYA 1WI3A 3DU5A 4DZJA 2VKDA 1HSTA 1DPRA 1NOZA 2DBBA 1B8IA 2CO5A 1P6RA 2B0LA 2P8TA 4XRMA 3TQNA 2P9UA 1TL1A 2ID3A 2L2OA 3I53A 4HF1A 1KU7A 4IPAA 3PUFA 4IXAA 4LH4A 1SAXA 2O0YA 2OBPA 3J81Z 2K3FA 3VETA 1ETKA 4H0EA 3M1EA 5LRRA 4B8AB 5DD4A 1GOBA 4L5EA 2VG6A 3NGYA 1O57A 2CW7A 2JWTA 2ECBA 1WAFA 2QWWA 3HOYJ 3G3ZA 3J81O 3ZEUA 5D8LB 1XMXA 3WNHA 4G6QA 4CFBA 4JI8K 2L4MA 1VSHA 1GUUA 1NWKA <