3S32A

Crystal structure of ash2l n-terminal domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
163
structure length
161
Chain Sequence
NGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Set1/Ash2 histone methyltransferase complex subunit ASH2
publication title Crystal structure of the trithorax group protein ASH2L reveals a forkhead-like DNA binding domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 161
sequence length 163
ec nomenclature
pdb deposition date 2011-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2760 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s32A00
3RSNA 3S32A
chains in the Genus database with same CATH superfamily
4V19K 4Q5SF 1Y0NA 2PX9A 2XF6A 5F0CA 4HNTA 3P9IA 5HS8A 2OTJI 2E2HJ 2WWYA 1MMGA 4KNYA 4I7HA 2V6CA 1OYYA 2Y30A 1T2KA 4V2FA 3BPXA 2XPUA 2HYGD 4XLAA 2DK8A 2YX7A 5E79C 4IHTA 2CYYA 1K61A 3SEZA 1X1AA 2A68F 4XIDA 4A6DA 2P5LC 4K2EA 3HSEA 3MKWB 2XGCA 3CLOA 1I5ZA 2L9VA 4EM2A 2R5YB 1W36C 1R6RA 4IRHA 2IA1A 1Q1VA 3IRQA 5CPRB 3F8MA 2DI3A 2VQHA 3HPGA 1OCCH 2F5CA 3H9QA 3O2PE 1KZHA 2L4MA 4U7DA 2PEXA 4BY7J 5GAGJ 1XGSA 5JR3A 1FIAA 4B43A 2QSGX 2VJJA 5IP9J 3HOYJ 3GUDA 2FX0A 4B8XA 1Y56A 2VT2A 2M1BA 1ZKGA 2V7FA 2HU9A 3FXLA 2O0YA 2EQRA 2IS1A 3R60A 4RM3A 2M34A 4II3A 5FKLA 1I27A 1G6NA 2OV7A 2K4JA 3LSTA 4LG3A 3FKJA 3VDXA 3OYBA 1ITYA 1VQKI 3JTHA 2EWNA 1LNWA 4XLPF 1WKMA 2EPFA 2KKOA 5DCMB 5BPDA 4IHYA 4JK1X 3A01A 3L00A 3H0DA 3G1MA 1IN7A 3RTRA 4S04A 2JA5J 2VI6A 5ILUA 4L9NA 1U3EM 5HS7A 4AUXA 2A5YB 2WB1A 4RAYA 4CICA 3HTSB 3JTGA 1XMXA 2QLZA 2LBFB 3I64A 1JE8A 2K9LA 4E7IA 3WHBA 1R5HA 2KPMA 3JAMZ 4DYCA 1UB9A 1IN8A 4XONA 3AAFA 1ZRDA 3CJRB 2A05A 2V1XA 4OOIA 2ETHA 2E2JJ 4AM3A 3BTJA 1Y1WJ 1Q1HA 3QPHA 1MZBA 4FCYA 3KP5A 1EH8A 2YPRA 3GW2A 3OS0A 2JPBA 3E0JB 1HSJA 3CJTB 3MFKA 1BW6A 3K4KA 5K1YA 3ZQHA 2DDAA 5HS9A 4ZZLA 4HDVA 4CUGA 1RNLA 1BL0A 4KICA 4HX8A 5EZGA 3FZVA 3QP5A 1VQMI 2DTRA 2KFDA 2L7MP 5ED4A 5HLTA 3HOZJ 1NG7A 2ZO4A 3BG9A 2LNBA 2DDBA 3HOXJ 2QM3A 1IJWC 2H09A 4KT6A 1MD0A 3F8CA 4L0YB 4WX9A 5FGMA 1FIPA 3CO6C 2VQLA 1BI2A 3BT9A 2JRMA 4RAZA 2CRGA 2F5FA 1OFCX 4CO8A 2EV0A 2DMPA 3HKZN 2EBIA 4HV6A 2X1EA 4UXNA 1DP3A 2XRNA 1ETXA 2YU3A 1ONVA 1TWGJ 3L2QA 1B9NA 3RYRA 1B9MA 1N77A 1QA6A 3Q0UA 3S16J 1A6QA 2ELHA 4IRGA 3QYFA 4CH7A 3DEUA 3W6KB 3S2HJ 5FO5A 3DU5A 1QVTA 5JVTA 2PJRB 3MKZA 2CFOA 1F5TA 2HYJA 2X4HA 3NWSA 2QKLB 4FQGA 3G3ZA 3PJRA 4HF0A 5D5VB 5FROA 2Y9ZA 2P4WA 1ZGJA 3Q3SA 5JI6A 2LY9A 5CYVA 4LFUA 2CFXA 1TQPA 5FB2A 2W4SA 1I50J 2ISYA 2LKPA 4B09A 4EV0A 5D6EA 2XKPA 1KQ9A 2I10A 1T6SA 1V4RA 2KT0A 3PNTA 1LVKA 2VC0A 3QQAA 4OMZA 5CVUA 1XPXA 1FOXA 3ESWB 3IRRA 3QU6A 4N4NB 1K4TA 3K1PA 5M5XJ 2DT5A 3TGNA 1JHFA 3L2UA 2UV1A 3WTWC 4ENNA 1TQIA 3TP3A 3K4LA 1J59A 3ERMA 5J1RA 1MNMC 3BR5A 3V42A 1B8IA 2UWMA 2CS3A 2K5CA 2J5PA 3LSHA 1YS7A 5B1BH 3OYGA 3JREA 4A3IJ 3X2QH 5A2QK 2VQCA 1B4AA 3MAJA 4A3KJ 2Z5UA 2BHYA 3I53A 4G8XA 1ETOA 1R00A 2M30A 1U8BA 3IHUA 2XF7A 5H6RA 1X58A 1JGGA 2N8GA 2KHMA 2YSRA 2EA2A 4RAFA 2JA8J 1FTTA 2LY1A 2LF8A 3MD2A 1Z7LA 4U7BA 4AYBN 4DNCA 2CO5A 3BG3A 5TGTA 2E60A 3CCUI 4JX4A 3G73A 2DK5A 2D2WA 1JJ8C 3JW4A 2DQLA 2HI3A 4GCVA 5CVIA 4S0HB 2QCOA 3S8PA 4OMYA 4D1QA 3JCUC 2OCEA 3A01B 2P8TA 3K69A 2HOAA 5EZHA 4LIUA 4U0YA 3AL0B 4G94A 1E3PA 2IS6A 2L9NA 1VTNC 5F0FA 1IGNA 3EDPA 3GCMA 5JLXA 2ME0A 2DA7A 5FFXA 4A0ZA 2K40A 4F3QA 4RGXA 1UAAA 2VOPA 4Y17A 3A2KA 2BOLA 1LDJA 2IP2A 4C3IJ 2VC1A 4BE1A 2V6EA 2BZTA 1XCBA 2GXBA 5CVVA 2DA4A 1XSVA 4MQ9F 1YE9A 1JT6A 1X4PA 2KRHA 4OIRF 4BYYA 3DKWA 4DOZA 5FLXZ 3J80Z 3RKQA 4OIOF 2ZFUA 4HDUA 2IGKA 2XGDA 1UHWA 5K5OA 4M3DA 1O57A 1IDZA 3RKWA 3FBNB 1IUYA 2VODA 3CLQA 1S9HA 2M3AA 3WTYC 3GBGA 1YX5A 4A0YA 1K4SA 5JHUA 2FU4A 1B72A 1FX7A 2XUBA 3LSIA 2XGXA 2LMDA 2OAZA 3BR1A 1HA8A 2HOEA 1VFCA 1TC3C 2IAIA 1ZREA 1ACIA 3L2RA 2BW3A 4XOTA 4NC7A 2W84A 1POGA 3FKIJ 5L3GA 1BI0A 3R0JA 2TRTA 4F92B 3BLYA 2ZNZA 4HRIA 4MQVA 1JTXA 2DJIA 2DW4A 1PJRA 1MW7A 4WXHA 3GTKJ 1A04A 1TNTA 3Q0WA 4FASD 5K7HA 2BEOA 2MH9A 4XLHA 1HKQA 5IOYA 2WAFA 3A1YA 1APLC 2ME6A 2OBPA 3MWMA 4BHPA 4ITVA 2G0EA 2JMWA 5FLMJ 3HSRA 1U0JA 3FHNA 5IPAA 2XSDC 2OQGA 3F23A 1P6RA 3FBIB 4EMSA 2VBXA 2R7OA 2L5QA 2UZKA 4BDZA 2FJ1A 2X48A 2AXTC 3RJPA 2E34A 5H6QA 1HDPA 2DA5A 2QF7A 1D5YA 3JRHA 1VQNI 4E7SA 1GVJA 2BHZA 3G71I 2AO9A 4NQWA 5AONA 3WU2C 1S7OA 5IY5H 2DFIA 2TCTA 2B7EA 5D5XB 2W25A 3HL2A 3ZMTA 4R79A 4GGGA 2I5UA 5L3DA 4RGUA 1FEXA 2W48A 3QOPA 1LVAA 2DN0A 1FP1D 3F3XA 3HRMA 2FD5A 4UY8I 2X1DA 3FM3A 1T33A 3D5LA 3TW7A 2HZTA 1PUFA 3S17J 5LGNA 2CMPA 4AVPA 5LGTA 2YR2A 2ZFWA 3OSFA 3IP4B 3ZP5A 1SEUA 2WV1A 2WB1N 3C2BA 2LH9A 4JYKA 4CZCA 4FX4A 3ULQB 6PAXA 1B8IB 3M3YJ 2ZJPF 1VQ8I 3ELKA 4KIBA 2FUG2 2HKXA 3V7RA 2QWWA 3ZQQA 3GVAA 3K4NA 3DPUA 5EEAA 1YITI 3H9JA 1V54H 3MQ0A 4LB6B 2KQRA 4IHVA 1DPRA 2ELJA 3ONQA 1J2XA 3I4PA 2CV0A 4BBRJ 3CC7I 1QU3A 4GFBA 3TO7A 1U5TC 3S3NA 1ON2A 2EB7A 4WXDA 1R22A 2HDDA 1W0TA 1X2MA 4LB5A 4S05A 1SAXA 3H5AA 1VQ5I 4YIFA 5HDGA 1FP2A 2FQ4A 4BDYA 1B1BA 1E3HA 2HOSA 3H5NA 3IH3A 2KL4A 4G9YA 1BN5A 1MBJA 3K6GA 1MMSA 4D9JA 3RZOJ 4XRSA 4Y4RA 2YU9J 4M73A 2XV4S 4XKVA 5LEJA 2Y0MA 5CVRA 2HXOA 5GADJ 2NVTJ 2XC7A 3PUFA 4UVCA 5CQEA 5GAHJ 2FA5A 1OCPA 1FJLA 4IOAF 5J1UA 3K1MA 1X1DA 1I6HJ 2DXIA 1FLIA 4J00A 1M1EB 4HOBA 4C2TA 3LA2A 2O61A 3SEQA 1OQYA 4KUMA 1XB4A 4QWQA 2F48A 4B48A 2A6EF 2KMUA 3OYLA 4RDUA 4P55A 3CCJI 3K2ZA 1UELB 4RB0A 1J5YA 2HDCA 1ORKA 1JXSA 3HOUJ 3GZ6A 4AC0A 2M2EA 3CF2A 1E0EA 3AG1H 1P4AA 1ZQ3P 3ECOA 3GFJA 3EPZA 3TBIA 1SD6A 2R4GA 3P7NA 4OAYA 4YELA 3ZRGA 5J8FA 5DS9A 2QA4I 2V1DA 2JSPA 4HQEA 4ASNA 2PMHA 5J6XA 5LGUA 1QPMA 5E3MA 2OA4A 3RKXA 3U1KA 3CMAI 4M9ZA 1UFMA 2WBMA 2L7FP 2W1OA 2K27A 1HLVA 4PGGA 1V5FA 1SAUA 2DPUA 1YIJI 1YJWI 2BW3B 3JAMK 2JA6J 4M3BA 2PQ8A 1D8JA 2BXYA 3SYTA 3U9GA 5JHFA 1TL8A 3F8FA 1YQAA 3K4MA 3U1DA 1HKSA 3IV5A 1FYMA 1BW5A 4LD5A 3CZ6A 4D5CA 4DBRA 4EATA 2PG4A 1JHHA 1HKTA 1P9QC 3DKXA 3W2WA 1BI3A 1K6OA 4BL0B 2UXNA 4CHUA 3V8JA 3J7ZI 3BJ6A 2PN6A 3JRDA 2EFQA 2QVOA 3HUGA 1T0FA 4L9VA 4G6QA 4NQWB 1MBKA 5IYBJ 2Z2SB 3LSPA 4EM1A 3CCRI 2OQRA 2FBKA 2NYXA 1BR4A 4QIWN 2QUFA 5KAFC 3P9KA 1OR7C 1OCZH 3KYLA 1J09A 2WADA 4GO1A 4KA4A 2GBYA 4MFDA 5E8IA 4CYDA 1NH3A 3AKZA 1MH3A 3GTGJ 1TNSA 2DFFA 1K79A 4ESFA 5DM7F 1PUFB 2HDWA 2CQNA 2OCCH 4IL6C 2E36A 3C18A 5DD4A 1NK2P 3B73A 4KITB 2E19A 4UHTA 5D6FA 1FBQA 4Y52J 1OCOH 3DBLB 3DWLE 2CW7A 3FHZA 5C4XJ 4H4KC 4UNOA 3ZQGA 1S8NA 2HKOA 3RCOA 5TRDA 1ZH5A 2NS7A 1XTAA 4XK4A 2V9VA 2MFZA 2CQQA 3E6BA 3CCMI 4L5EA 1F43A 4IO9F 2HFHA 2ZKZA 3ABTA 4XBFA 4XNFA 3OS2A 3BR6A 3WHCA 2M9HA 1LPQA 4PFPA 2X6YA 5E20A 4A5MA 3PFIA 4KJZA 2VKHA 1PP8F 3ZOBA 4LMYA 3LMMA 4BQQA 1Z1DA 1KGSA 2Q2EA 1RC9A 5EDNA 3GTLJ 4IQ4A 1H88C 2HQ5A 3BJAA 3EUHA 3O8HA 1X1BA 2BE5F 2P0WA 3MVPA 4V2GA 1MBGA 2UUZA 3C7JA 2OPTA 4Q48A 4EJTA 3CF5F 3EYIA 2HVRA 4DBQA 1D5VA 3PSFA 2GLOA 3PSIA 2QYOA 3KE2A 1MBFA 1OLTA 3MZYA 1IRGA 1R23A 1Z21A 4PDKA 4MTEA 4BXUA 1WVRA 3PFYA 4L5JA 2V79A 3AG4H 4RGRA 2ZB9A 4ENMA 2PI0A 4C2MJ 1ZGWA 3FM5A 1IUFA 2IXSA 3M1CA 5TJJA 5LHHA 2VBZA 2O6GE 1ZARA 1O4XA 2LDUA 5GPAA 4A3FJ 1MMDA 1RRJA 3BDDA 1KA8A 5FRMA 1ZGAA 3B6CA 5LLQA 4BJ5C 4BS9A 3CUOA 1B6AA 2PFBA 4XR6A 4BE2A 1DDNA 2KJCA 4TV7A 4JQFA 3QYEA 3TO6A 1LDKB 5E8GA 3KEOA 3KP6A 4NC6A 2E35A 1PUEE 3KPHA 1A5JA 4W97A 5D8LB 5JVGF 5EEGA 2IJLA 4N4OB 2C6YA 1HW1A 5B3SH 1FMWA 3ZMVA 2GM4A 2HNHA 1TT0A 4A3MJ 5E3LA 4G7ZF 2CQ7A 3MN2A 3ZQ7A 2KDOA 2GZWA 3I59A 4ZH4F 4EJWA 2VOOA 2GAUA 5DTDA 3PQJA 3DP7A 3RZDJ 5D4RA 4LJZF 3ZMDA 2P5VA 2IS2A 2ID6A 3WTSC 3H3VK 2B63J 4ZDLA 2HQRA 5FLXK 3J80K 2XF5A 3JRAA 1ETKA 3G6EI 4QTRA 3S93A 2K9NA 1RR8C 1LFBA 3O8GA 3JSPA 5C44J 3CD6I 2GIVA 4ESJA 2FMLA 5J4YA 1B59A 3TO9A 3BQYA 5KK1A 2JSCA 3HPHA 4XN3A 5ICEA 3GFLA 4N9HA 4BHBA 3OYIA 1E3OC 3S3OA 2DJNA 5E1ZB 1FBUA 3WG9A 2HQAA 4H0EA 1QPIA 1ZG3A 2IVMA 4M74A 2Q8KA 3GF2A 1X3UA 2VE8A 5LBQA 2P6TA 1WSUA 3U21A 2E5NA 3HUGB 3W2VA 2VBYA 3BJOA 2JUCA 1J7KA 1FOYA 5DUIA 5BNGA 2DFEA 2O8XA 3EUKL 2NXNB 1S3JA 2G7UA 1E2XA 2ZXJA 2IS4A 1WRJA 3OIQA 1WWXA 2KRCA 4W1UA 3SHFA 3E6CC 3GX4X 1F36A 2WV0A 1SANA 2VBWA 4CCNA 1D1CA 3ZQFA 5J47A 3E1SA 3GTOJ 3KLNA 4HV5A 2ZMEC 1GUUA 1H89C 1IAWA 1BI1A 2ZCWA 3GZ5A 3R61A 4IEJA 2HTSA 4ESBA 2QGUA 1WJDA 3MKYB 4ENJA 4M3EA 5HODA 3BR3A 3MEXA 2DA3A 3I5UA 1UHSA 3PUBA 3CQZJ 4DYQA 5IYDJ 2PMUA 3W3CA 4Y13A 1P4XA 1D1BA 2F4OB 4KISA 3COAC 1D0YA 5CKTA 4C30A 3O6BB 2LYCA 3M8FA 1LE8A 1I3QJ 1HW5A 1ZHFA 3LSJA 2CUFA 1R1TA 3KP4A 2K86A 4EEFG 1W7PA 3REOA 1EH7A 4CYCA 3UKGA 4G6DA 3M4OJ 1NHAA 2DQRA 3ABLH 3GTMJ 1QHHD 1T56A 3RQIA 2Q2EB 2HZDA 3OYHA 3V7SA 2BVMA 4MTDA 4YEJA 5M5YJ 1XS9A 3AG2H 3T0YA 4RBOA 1E17A 4C2UA 4P1WA 1DPUA 2HPMA 1MJAA 5M3FJ 3ECHA 3CUQC 4MHGA 3IUOA 2XKOA 5E17F 2ADUA 1T8IA 1DGRM 3FXOA 2DAOA 2VKVA 1TBXA 4E70A 4XKBA 5GPCA 2HS5A 2K9MA 2EJRA 1FC3A 2M8EA 5BS6A 2E7XA 2W7NA 1JTYA 3BQZA 2Z16A 1G3WA 2V1NA 2EV5A 4B1RA 4IQJA 3CCLI 1R9TJ 2X85A 4ZJZA 3RYPA 4HF2A 4JP0A 4XSZF 3SFZA 5LFAA 1TZLA 3OL3A 1IN5A 3A02A 4B4CA 4BXXJ 3DCFA 1SD7A 1BOBA 2MGQA 2VXZA 3A03A 1EJ9A 4AIKA 3HC7A 5J8CA 2BBYA 1Z05A 1Z7UA 4UV8A 1WGXA 3I71A 1R71A 4QPOA 3KIOA 1IRZA 1XSDA 3HRTA 4FTHA 3FF5A 3SDGA 4CCKA 1ETQA 2OJED 1BJAA 1WI3A 5BPIA 1YS6A 1MBEA 2A61A 4XOPA 4I0BA 3QPLA 4F7ZA 4BQOA 4KT5C 1X19A 2EZIA 1OMIA 4R8HA 4UUTA 4GRIA 4XRSG 1TT5B 2DA2A 3MCZA 4YFKF 2ZXWH 2O9LA 1IV8A 1TWCJ 1L0OC 1CGPA 3I59B 2PBIA 2VUMJ 3ISPA 5E18F 1D1AA 3FMSA 1MSFC 2NVYJ 1YRNA 1VF9A 4XLNF 4KFCA 4GYIA 1G3YA 3FDYA 4ZYDA 1W5CC 1G4DA 1IXRC 4CCLA 3HGGA 5H20A 3RPUA 4WF2A 5D5UB 1R5ID 3VYTB 1K83J 1IXCA 3CC2I 4JX6A 3BOQA 4PJMA 4U87A 4UB6C 2P7VB 1ZELA 3I56I 4M6YA 3WG7H 1DGWY 1W7PD 4A3LJ 3H9GA 2E1OA 2K7LA 1QNTA 3BCAA 3HB9A 2DMTA 1SFOJ 4R1HA 4HYEA 1YOVB 2EIJH 4ABZA 2XVCA 3OMYA 1HDDC 2ICWG 3BTLA 2H1LA 2F5VA 3FK6A 3W6VA 3L2VA 9ANTA 1IRXA 5CVJA 3ASOH 4A12A 4L0ZB 5FFZA 4CCOA 1SC7A 3HIFA 3F8BA 1GXPA 5DEQA 3IAM2 2GA2A 4MO7A 3PIPF 4BHCA 3CTAA 4XKCA 5KAIC 1K7AA 2R7RA 1WJCA 1WJEA 2L02A 4CZZA 3OY9A 3ZCOA 1ZG1A 4DW6A 3I4NJ 3B02A 3TQNA 1PDNC 4P96A 3D0SA 1V3FA 2EV6A 4JBAA 4ZZDA 2CUJA 5BOXA 3QYBA 2V4JC 3VYRB 2LLKA 4Y7NJ 4NHJA 3J7AO 2JQ7A 4UUVA 3EYYA 3NRVA 4NDLA 4DQ2A 1ZG5A 3KP7A 2VJ4A 1MH4A 3FK7A 3HEFA 3V8LA 3TOBA 5BQTA 2STWA 2KZVA 4BBSJ 3OOUA 4QSHA 1LE8B 5B5EC 2BVLA 2DU9A 2RNJA 1W7PB 1Y0UA 3GFMA 2LG4A 2Y9YA 3DQVC 2NS0A 3SZTA 4BU2A 2BXZA 3S3MA 3N05A 4CYCB 3WTTC 4IHSA 3OV8A 4YFNF 4PJNA 3HOVJ 1S29A 2F2EA 3GMEA 4AIJA 3WGHA 1ZR2A 2ZXHA 2FBHA 2VKEA 2A3SA 2E5ZA 3K4CA 3CP2A 4NUBA 3S14J 1ODDA 2WY7Q 4PJ0C 2M7BA 1EH6A 1RR7A 3G1LA 3UNGC 3GO5A 4MEYF 3ZMSA 1WJAA 3HRSA 4U88A 1FSHA 3L2CA 1QO0D 2P7CB 1HXDA 2D1HA 3TP0A 4DYRA 3NWTA 4FX0A 3ZXSA 3CDHA 2D5VA 2F6CA 4G7OF 2ZMEA 3MZ8A 3OYCA 1WJ5A 2VLAA 5EF6A 2COBA 4XL9A 1RESA 3QWLA 3RIRA 4D5FA 3N4MA 3K2AA 3DTEA 1FZPB 4XM3A 4RMNA 5DYMA 5ILVA 3L7WA 4LLNA 4HPQA 3FXRA 1XC5A 2ZJ2A 3RPUD 4DZPA 2R7ZJ 4F52A 4C3JJ 1IV6A 4CA0A 2IEKA 1FYKA 5CJ9A 3ZGKA 4QLCU 1TQMA 3CCQI 4BUPA 1HOMA 2QSFX 2RN7A 3J7YJ 4BJ6C 2X6WA 1O3RA 3DBRB 3S2WA 3BC8A 1SFEA 3RPQA 1U9OA 1VQ9I 3CJQB 2HVQA 1H9TA 3M8JA 2VN2A 3KCCA 3PL8A 4ZYGA 3BZKA 1IDYA 3JSOA 3GFIA 3W2AA 4A3DJ 3K4JA 4HLYA 2EH3A 4WCGA 2EZKA 3VSKA 4BAYA 5KNLA 3HZJA 2QQ9A 4UVAA 4OIPF 2X6OA 2R7DA 3ZQCA 4XN0A 2BGCA 3SDBA 2DFHA 4DIQA 1W36D 3LQRA 3M7GA 4AVZA 3OYAA 3D5RC 3LSKA 2ACJA 2M0MA 2LP0A 1I6XA 1FBSA 1YRNB 1YIOA 1HC8A 2CGPA 4E7JA 3E6MA 3ZMUA 4HF1A 2OZ6A 2R92J 1RZ4A 5FRNA 4BH9A 3VSLA 1WZ2A 1IN6A 5FD5A 1BBYA 3WTXC 1USTA 3CDLA 3IAS2 4ZYHA 2FEZA 4Y15A 4FE4A 3F0CA 1DU0A 1HSTA 3VB2A 3LSRA 3CCEI 3CESA 4XICA 3VFZA 2RDPA 3L9FA 4M6XA 1JUPA 4LITA 2L01A 2KZGA 3ZN0A 2GOXB 4EJVA 3KP2A 2HYFA 1V55H 5KCMA 5JFRA 1MDMA 2Y2ZA 3EETA 2WC2A 1Z0XA 2KLOA 2CQXA 1H8AC 1TW2A 3JRGA 1FOKA 3H3ZA 1KU3A 3F22A 4ZYAA 1P7JA 1A31A 3HYIA 1RPWA 4LK1F 3MKLA 3S1MJ 1UG2A 2O03A 2OD5A 1YHQI 1TP4A 3GTPJ 1O7FA 3C3WA 4XLFA 4P9UA 1YTYA 1FT9A 3E5QA 2LD5A 1HW2A 3WE2A 5ICFA 1RETA 2XAUA 1AA7A 2K9SA 2DA1A 1F9NA 2MC4A 1SMTA 3H36A 3KEQA 4LGWA 5EG0A 1YFHA 1JKQC 5F1JA 4OWRB 4M71A 2K3FA 3FXKA 3CC4I 3AL0C 1X1PA 1ETWA 5FKOA 5KHDA 2DYRH 3OYDA 2FQ3A 2NVQJ 4E6KG 5D4SA 1USSA 3ABMH 2GXAA 2DLLA 1A36A 1S6LA 2UXXA 2DYSH 4BQAA 1RI7A 1TWHJ 2CJJA 3CP8A 3DBHB 1R1UA 4J01A 1YO5C 2BY3A 4A93J 2KIMA 4HBLA 2H1KA 2YS9A 2RNGA 5ILSA 4LG0A 2XB5A 4A3EJ 3LOCA 3S1QJ 1WCMJ 5F27A 3LSGA 2P6SA 1TWAJ 3LSMA 2NS8A 4A2UA 5HDNA 1BIBA 1ZN2A 2ZMEB 3UR3C 2NNYA 1LEBA 2F4IA 2X1CA 1RKWA 4HSRA 5F08A 2CUZA 4XQFA 2ISZA 2BYVE 3FX3A 5F6FA 2JUGA 2Z9OA 3G4SI 3KZIC 4Z2YA 1I1GA 1R58A 2FOWA 3KLOA 3P5JA 5KVRA 2R0QC 2KDZA 2GQQA 2XPVA 2NVXJ 2VL8A 3FWEA 3TL4X 4RB2C 3W6JB 4ANJA 1KQ0A 2RVCA 2IA2A 1P92A 4UV9A 1XX5A 3F8NA 1OPCA 4QPQA 4A69C 2Y31A 3WE3A 1G8XA 5DCFA 3OYEA 2WAEA 4NB5A 1FY7A 4UUSA 4ZTJA 1C0WA 4KYWA 4YIRX 2W57A 2QQBA 1I3AA 2M8GX 1O3QA 3PIOF 1FPQA 1KONA 3SZPA 3JR9A 4UVBA 4P5OA 2LVSA 4CSWA 1NTCA 4XKWA 4ZDOA 1FMVA 2OZUA 1IN4A 3LAJA 4XRFA 2RC4A 3TMOA 4DGWB 3I9V2 3Q5FA 4A3GJ 1Z3YA 2X6XA 2JA7J 4MEXF 2VASA 1VI0A 1ZTRA 2H6BA 2ESHA 3FISA 3FIWA 2L54A 4IVNA 1P2FA 1O3SA 3KZYA 1JKOC 2L9RA 1NK3P 3KYCB 3E7LA 2DOEA 1GV5A 1MIJA 4I01A 1G59A 2V9KA 1T39A 2V1UA 4IOCF 3NARA 2MD5A 4G6TB 3VPRA 5M3MJ 2JTVA 4M3GA 2GOMA 3F6OA 4CCJA 4PSXA 2EFPA 3ASNH 4XMYA 5FD6A 3FXQA 2QZ8A 2XAJA 1G3TA 4FE7A 3J81K 4MGRA 1SMYF 4BEHA 2WA0A 1Z6TA 4II2A 1MDMB 1ZLKA 4L9TA 4ZYEA 2XAQA 4DZJA 1ON1A 2O5RA 4IXAA 1ZRCA 1ZR4A 2LK2A 2PMZA 2ZC2A 3T1BA 5L3BA 3HOTA 3ABKH 2AS5F 3D5SC 3GYHX 2A6TA 4I2OA 3GWZA 1KQ8A 3QODA 2XRLA 1X4OA 3PO2J 1KYZA 2VIXA 1BM9A 2M7AA 1U6GA 2KIFA 1NG6A 2OF7A 4KMUX 4ETSA 5HDKA 1LUJB 1SVMA 2QQAA 3BG7A 2VPLA 2Y69H 4PJLA 1GDTA 1T95A 4N9IA 1TLHB 3HHHA 3K9TA 4KN7X 1W5SA 4MNUA 1JGSA 4M9SA 3K70C 1U5TA 1ETVA 1XMKA 1R49A 1O3TA 1FNNA 3GTQJ 1JI8A 3I54A 2LFBA 5J3LA 2H8RA 3ZN1A 3IWZA 4EGZA 5EG0B 2MD0A 2XASA 3DKYA 3BTIA 2WY8Q 3ZQLA 2Q0OA 3KEYA 1UG0A 3DLLF 4E7HA 3NQOA 1HF0A 3LAPA 5HLIA 1D0XA 3HHGA 1R7JA 3PNYA 2Z33A 4PZJA 3B6AA 1BJZA 2AHQA 4C9YA 4MFEA 1Y39A 4E7LA 2W82A 2FOKA 2JRTA 3RI4A 1QQIA 1WFXA 2CV2A 1R1VA 3BZCA 3R6SA 1EV7A 4HNVA 5IT3A 4BQNA 1ENHA 3RKYA 4ZTFA 4LG0B 5EEHA 5K5RA 4B3XA 2FMYA 4EJUA 4CCMA 2RGVA 4A0XA 2EK5A 2E7WA 4NBQA 1YW9A 4Y33A 1PVEA 5IT9Z 1UZCA 3BR2A 2A07F 3H3UA 2K9QA 2XAGA 4A3BJ 2HTJA 1WI9A 1XDSA 2WAQN 3VEPA 1ERDA 4PFOA 1MGTA 3DLAA 2EIMH 1R4MB 1WJFA 2XAHA 2E1NA 1GXQA 4X6AJ 3V7CA 5FKKA 4B44A 2STTA 3KFWX 5H2FC 1R36A 3LL7A 2CW0F 3VWBA 1WJBA 2WTEA 4ZDPA 4F55A 2W85A 3M1EA 2MA3A 2L2OA 5LHGA 5CLSA 3HJEA 1J9IA 4AIHA 1FSEA 3IL2A 1VZ0A 5DM6F 1LJ9A 5LD2C 2QENA 3GXOA 1R4NB 1YX3A 1JUSA 1Y6IA 4UUSB 2XAFA 4RM2A 3QP6A 1REPC 2VJIA 5E3OA 1LQ1A 2DTZA 4IZZA 2JK3A 3G2BA 2M4KA 2BY2A 2H27A 1FWZA 1TWFJ 4FHTA 4HW0A 4PUSA 2X0LA 1WH7A 2KP6A 4BGDA 1XMAA 1Y1VJ 3IH2A 4LK0F 3OOPA 3WODF 1ZK8A 2XIGA 3V8KA 2FNAA 1XGMA 2PJPA 2GIZA 3DPTA 2K02A 2RAEA 5M5WJ 2BY0A 2L9SA 3HOWJ 4A6EA 1YYVA 2R3SA 1YJ9I 3OR1C 5CQGA 5AIQA 3QOEA 1OYIA 4O3MA 2Y48A 3ZQIA 2LC2A 4HAMA 3BPVA 5L3EA 2QSHX 3WGGA 2NRAC 3OWTA 2RQQA 2VB6A 4U0VA 1WH5A 2CWEA 3OYKA 1Z77A 2EZHA 4B3AA 4CGZA 1XN7A 2RV8A 3Q9SA 1QVUA 3RQ4A 3Q0VA 5F1RA 5HVQC 4A3CJ 3T8RA 1S7AA 2R7SA 2OC6A 4A5NA 1OR7A 2EA4A 2JWTA 4RA2A 1T38A 3IC7A 1OKRA 2E71A 5K5QA 3OIPA 5DDGA 4U0WA 4WK8F 1JKRC 3A0BC 1Z6RA 2Y0SA 2E1MC 4OINF 2F5DA 5IYCJ 4BEHB 3OS1A 2DCEA 1YJNI 5GTHC 1BA5A 2KRFA 4L5IA 4XLCA 1UCRA 3A4CA 3K7AJ 1RUNA 4P9FA 1XDUA 3JRCA 3BTCA 2V9PA 3QRFF 1LB2A 1VQ6I 2R7XA 3TW6A 2R5ZA 4PCQA 1ZAOA 2X9DA 5B66C 1YLFA 3H35A 2CV1A 3J7AY 2X51A 4LOCA 1RUOA 5F0HA 1W0UA 2EFNA 3ABUA 1T98A 3F9KA 1SFXA 1MBHA 5GAEJ 4IRIA 3BWGA 2DOAA 1U5TB 4RLFA 2VE9A 2PLYA 3V4GA 4IKFA 1BR2A 1A35A 2LY2A 2QEXI 2YX4A 5FKMA 5F04A 2COMA 2EIKH 2E1CA 2F4MB 4YG2F 3DV8A 1Y8RB 2EZLA 2F5EA 4IX7A 1JJ6C 2BY1A 1V5EA 1QGPA 4AIDA 1LFPA 2LKSA 2CH0A 1VQPI 5K7FA 1KYWA 3L09A 4HNUA 4C3HJ 3VYUB 3J81Z 2JA2A 1XGOA 2O3FA 1IZ1A 2MLGA 3BP8A 4I02A 1VQ4I 3GEZA 3ML6A 4E7KA 3S32A 1IF1A 2JN6A 2EINH 1JT0A 2NOGA 2JVHA 2A6HF 3OL4A 4Q47A 4MLOA 3DEWA 2YUSA 5IP6A 2ZSIB 2EILH 5ERIA 3I3LA 2Y75A 4HZFA 4JX5A 4RB1A 1U2WA 4I98B 3WGIA 2O8KA 4KMFA 2IPQX 1X1CA 5DD8A 5DUKA 1S5LC 5K7ZA 4CDGA 2M4GA 1X3ZB 3HG9A 3QU3A 1VQ7I 5GTIC 1K78A 3QPTA 4M9XA 1IRFA 1SFUA 1ZYRF 1TTYA 4E7ZA 5HLHA 1P4WA 3PNVA 3DTIA 3LNQA 1QZYA 2H8WA 4NC8A 1DUXC 4I76A 3LA3A 1PYVA 1SFKA 3BG6A 1HQCA 1X2NA 3HBLA 3K0LA 3TKYA 2BV6A 4A3JJ 1SVOA 2B0LA 3QAHA 4RS8A 3LWFA 2O7OA 2AQEA 3D1NI 3TEDA 5D5WB 3GLXA 1H0MA 2HWVA 3LFKA 3Q9VA 3T8TA 3H0GJ 4M6VA 2K4BA 3VOEA 1J75A 2EFOA 2IGNA 4ON0A 5B1AH 2NOJB 1QZEA 4NNJA 1ZLJA 4BXFA 3BY6A 3VODA 3S2DJ 5EGOA 4L9JA 1W1WE 2CQKA 3BZ6A 2DMQA 5GP9A 2VJ5A 2RKHA 3GLLA 1AU7A 2PMZN 3QPSA 1L3LA 2LTPA 2K85A 1W4MA 3F21A 2QQ8A 2R7UA 1Z91A 1T0FC 3SXYA 2OUMA 3CCYA 3CCVI 3IH4A 4G7HF 5HOOA 3HRUA 4B47A 2GXGA 3M8EA 3BR0A 1JUMA 1LKXA 3E97A 3SJMA 2A5WA 1Z67A 2Z99A 2ZJQF 5LRRA 2XPWA 4BKXA 1STZA 4KIFA 4XORA 4FT8A 2R7WA 2FRHA 3M07A 2DT6A 3R4KA 2HPIA 2XSJC 2FE3A 3FXMA 3O3KA 2CG4A 3JRBA 2V26A 3I0TA 2LRDA 5D8KB 3I4MJ 2A69F 3CJNA 1MNEA 2GWRA 4BE0A 4EJOA 1YW8A 2IW5A 1IC8A 3OYNA 3OIOA 3SZGA 3PQKA 1MNDA 4D7MA 4J19A 4O5VA 4LIVA 5HNFA 3E6DA 4PGHA 1O7LA 5AIPA 2VT3A 2MLKA 4ZC3A 5J4VA 2ELKA 2R5ZB 1OISA 1MKMA 2XB0X 1ULYA 4XSXF 4AD9A 4D7NA 5IOZA 4E4HA 2G9WA 1CF7A 1R5GA 3EUAA 2I8DA 3EUHC 5EYRA 2DPDA 2DMUA 3HSFA 2R7TA 4PJJA 4GYGA 2R93J 2FBIA 1IG7A 2EFWA 2Z3YA 2KISA 2L7KA 5E1WA 3HXLA 1UMQA 3G1OA 3K70D 1KU7A 1FYLA 1QRYA 4M3FA 1XSXA 2HXIA 4I6ZA 2E2IJ 4XRMA 4M72A 3KX2A 1UHMA 1RKTA 2NVUB 1IW7F 2CU7A 2KJBA 1I1SA 2RREA 3MZHA 3KP3A 2IT0A 1EA3A 3HOSA 4ENKA 3DXJF 3S1RJ 3CUQA 1YW7A 1GT0C 2RQPA 1OCRH 3KYDB 2IGMA 2IGOA 4RGSA 5LHIA 2G7HA 2DOFA 2WAQA 1T08B 5BMZA 3OR2C 1VQLI 3GZNB 4KDPA 1KU9A 3CMYA 2R7QA 2FNPA 2MBFA 1AKHA 2VXDA 1S7EA 5C4JJ 3CMEI 2M87A 1HCRA 1U78A 1MMAA 5HNHA 2IRFG 3BG5A 2CSOA 1QZZA 4AU7A 2W00A 1QBJA 3IWFA 5LRSA 3RDIA 1EF4A 4D0PA 4Z6YA 2QBYA 3K10A 4GXOA 1F1ZA 1AOYA 3NAUA 3T5XA 2JT1A 3L2WA 5L3FA 2DMNA 1K78B 4Q4ZF 2MABA 1MSEC 2HQNA 2HEOA 2B9SA 1U8RA 4AWXB 3TOAA 1N25A 2ZSHB 1WPKA 4OU0A 2D45A 3F72A 1XD7A 5E1XA 2ESNA 3A0HC 3ZR8X 3ZMZA 1SD4A 2MH2A 2MW8A 3RSNA 3L1PA 3ROUA 1XG1A 3JRFA 1MJBA 1G3SA 4FETA 1LFUP 4EM0B 1YG2A 1OJLA 4FISA 3DEEA 1MJ9A 2MC3A 3OYFA 3OYJA 4GDFA 3EQLF 2DA6A 2KIQA 3FMQA 3FMRA 2Z1DA 1ZRFA 2OTLI 2L4AA 1H9GA 2Y0SN 3NEUA 4UB8C 5TISC 4IF4A 5ICGA 4CXFA 2ZJRF 3FXJA 5IT9K 5EGOB 1AHDP 2HGCA 5A2QZ 2XGEA 3IKTA 4IHXA 1WHUA 2CW8A 2ECBA 5J40A 3I55I 2ECCA 3LA7A 4PSWA 1PP7U 4KIGA 1G2HA 3SFIA 1BOAA 3SQNA 2L7ZA 2FXAA 4IPAA 1X3WB 4HA8A 1ETYA 2ID3A 4I99C 5FKNA 3FXUA 4X1EA 4OAZA 1VNDA 2XROA 3LQQA 4HLXA 1TW3A 2FF4A 2R7VA 2KIUA 3HKZA 1B72B 1D0ZA 3K1NA 1FOWA 5LEKA 3PM1A 1IO2A 2LOOA 2R5YA 1LDDA 3JRIA 2MSYA 5J1YA 1DQUA 3DPLC 1S72I 4I0AA 1BC7C 1YI2I 2J5OA 5F64A 2H94A 3MMYB 3WU0A 1K6YA 2CUEA 4F93B 3OSGA 2VQGA 3OYMA 1LEAA 1I39A 3M9AA 1VQOI 4BY1J 1IXSB 2H6CA 3CO7C 3ERED 2R7FA 3BCBA 4HX4A 2XDVA 3HTUA 4RLQA 1RIOH 3WTUC 1JKPC 1SD5A 1GVDA 3WTVC 4HSTA 3IKVA 3C2GA 2JPCA 5DCMA 4G12A 1QHGA 4Y3OA 1UJ8A 2Q1ZB 5EJCA 3TDUC 4EGYA 5L3CA 4BACA 2M0CA 3PO3J 3KETA 2M5WA 2HOTA 3H5RA 1XGNA 1F4KA 1CF7B 1OYWA 3DU6A 2LSOA 2L0KA 4HG2A 2LBFA 1U9NA 2ZXIA 2JVGA 1BC8C 2JZYA 3I58A 4IHWA 3U2RA 3S15J 2D1VA 4LLLA 3TDZC 2DBBA 4BNCA 2LR8A 2AQFA 1MMNA 2VPRA 1FTZA 4LLGF 2MYSA 3HM5A 2LREA 2ZNYA 1N78A 3E5XA 1GLNA 3P9CA 2P81A 4YIIA 2W24A 3CUQB 1J0RA 1Y8QB 1KU2A 2P5KA 3AG3H 2HR3A 2K3PA 4OIQF 4AYBA 1N75A 1Z3XA 3CDIA 1EKEA 2NAZA 4RB3C 1AKHB 5JLWA 5FJ8J 3K4BA 3S1NJ 1D3YA 4BJTA 2E1MB 4XLEA 4YRVA 3WU1B 1P7IA 5ICCA 1XCVA 1V5GA 4F91B 1GHCA 4WXCA 1D8KA 1Z9CA 1BR1A 4KN4X 2QBYB 3ZPLA 3DTKA 2JJ7A 2LF7A 5C3EJ 4EVIA 2LKXA 2MG4A 4EQQA 1CQTA 2VONA 3LFUA 4JOMA 3WTZA 1BIAA 4I09A 4WWCA 2AXLA 1W5TA 2QKMB 4HQMA 5HLGA 2M45A 2NNNA 2OU2A 5E3NA 4O6JA 4N0BA 5DV5A 5IP7J 4DJAA 3C1DA 3DFGA 1DU6A 3CCSI 1A6IA 3HDDA 3GTJJ 3H1CA 1DP7P 5FLVA 1OCTC 3N97A 4RAGA 4YFXF 3R0AA 4HX7A 4IJAA 2HVSA 3VYSB 2IA0A 2PJRA 3DF8A 2DODA 1AWCA 2IBDA 1SVLA 2L3DA 3E3VA 3KZZA 2VKDA 3BROA 1GV2A 4MIMA 2XHKA 4X0GA 4PK4A 3C2HA 3CMMA 1WQ2A 2GA1A 3F6VA 1HBXG 3H92A 2FSWA 2DO7A 4L18B 3HGYA 3E5UA 2TDXA 2DT7B 4HEA2 2ZBKA 3AFHA
chains in the Genus database with same CATH topology
3UNGC 1WJAA 2XF6A 4HNTA 3H35A 1V5FA 1SAUA 2CV1A 3J7AY 2X51A 1MMGA 2BW3B 3NWTA 3ZXSA 2F6CA 3SYTA 5JHFA 3OYCA 1WJ5A 2VLAA 4XLAA 3K4MA 3F9KA 4XL9A 2DOAA 3SEZA 1X1AA 3DTEA 3CZ6A 4RLFA 4IKFA 4DBRA 4EATA 1BR2A 4RMNA 2LY2A 4XM3A 3MKWB 1P9QC 3DKXA 3W2WA 4HPQA 3RPUD 1W36C 1R6RA 4F52A 4BL0B 5CPRB 4IX7A 1V5EA 2VQHA 4CA0A 3HPGA 1LFPA 3H9QA 2CH0A 3ZGKA 4HNUA 4BUPA 3VYUB 2JA2A 4B43A 2VJJA 4BJ6C 2X6WA 1Y56A 4E7KA 2V7FA 3S32A 2HU9A 3BC8A 4NQWB 2Z2SB 3CJQB 2HVQA 3M8JA 3PL8A 3W2AA 2JVHA 2IS1A 4RM3A 3OL4A 1BR4A 4MLOA 4II3A 3K4JA 2ZSIB 2OV7A 3I3LA 4LG3A 3VSKA 3FKJA 5KNLA 3VDXA 1OR7C 3OYBA 3KYLA 1J09A 2WADA 4XN0A 3AKZA 4DIQA 3SDBA 1W36D 3H0DA 1X1CA 3RTRA 4AVZA 2HDWA 2M4GA 3HG9A 3OYAA 4KITB 3D5RC 3LSKA 2M0MA 3DWLE 2CW7A 2WB1A 4E7ZA 3PNVA 4H4KC 3DTIA 4E7JA 4NC8A 2LBFB 3RCOA 1PYVA 1SFKA 3BG6A 5FRNA 2K9LA 4E7IA 2MFZA 3VSLA 2KPMA 2AQEA 4XNFA 3OS2A 4XONA 3IAS2 2X6YA 4PFPA 4KJZA 2VKHA 3CJRB 3LMMA 3CESA 4BQQA 2IGNA 4LITA 2GOXB 2NOJB 3OS0A 4NNJA 4BXFA 4IQ4A 3E0JB 5KCMA 3K4KA 2KLOA 1X1BA 2P0WA 4CUGA 2VJ5A 2UUZA 4ZYAA 2R7UA 1T0FC 2HVRA 5HLTA 1NG7A 2OUMA 4DBQA 3PSFA 3PSIA 5HOOA 1OLTA 4XLFA 4KT6A 1Z21A 4B47A 3PFYA 1LKXA 2VQLA 2A5WA 2XAUA 1AA7A 2IXSA 3M1CA 2MC4A 2X1EA 1DP3A 4XORA 4OWRB 2R7WA 3L2QA 2DT6A 1MMDA 3AL0C 1N77A 2HPIA 2XSJC 5FRMA 3QYFA 4CH7A 5KHDA 2V26A 3OYDA 4BJ5C 3DU5A 4BS9A 2LRDA 4XR6A 3MKZA 2PJRB 2CFOA 4E6KG 4BE2A 1MNEA 4BE0A 3NWSA 2QKLB 3QYEA 4JQFA 1LDKB 3OYNA 3PJRA 3SZGA 1MNDA 5FROA 4N4OB 4LIVA 5HNFA 3CP8A 4J01A 1FMWA 2HNHA 1TT0A 2RNGA 2W4SA 4ZC3A 3PNTA 2KDOA 1LVKA 3LSGA 4N4NB 3LSMA 4E4HA 3EUAA 2I8DA 3EUHC 2IS2A 3UR3C 2F4IA 2R7TA 4ZDLA 2X1CA 4PJJA 3L2UA 4HSRA 2UV1A 2XF5A 3S93A 3K4LA 2CUZA 2L7KA 4XQFA 3HXLA 3V42A 2UWMA 2CS3A 2K5CA 2JUGA 3K70D 3LSHA 3OYGA 3KX2A 3HPHA 4XN3A 3OYIA 2VQCA 2VL8A 3S3OA 2RREA 3TL4X 2HQAA 1EA3A 3HOSA 2XF7A 4ANJA 2IGMA 2IGOA 3U21A 2KHMA 2E5NA 3HUGB 4QPQA 3W2VA 2LY1A 1G8XA 2WAQA 3OR2C 3OYEA 2WAEA 3MD2A 1Z7LA 4ZTJA 4U7BA 2R7QA 5TGTA 2VXDA 2E60A 3EUKL 1MMAA 5HNHA 2IS4A 3OIQA 2KRCA 4AU7A 2W00A 1KONA 3S8PA 4P5OA 4CCNA 4CSWA 1D1CA 3E1SA 4XKWA 4D1QA 4ZDOA 1FMVA 3K10A 4LIUA 3TMOA 4DGWB 3L2WA 3I9V2 3AL0B 2IS6A 2L9NA 2MABA 1WJDA 1Z3YA 3MKYB 2X6XA 2VASA 4F3QA 2ZSHB 1UAAA 3A2KA 2BOLA 3PUBA 3ZR8X 4BE1A 3RSNA 2V6EA 3W3CA 1D1BA 4KISA 1G59A 1D0YA 5CKTA 2V9KA 4FETA 2LYCA 4C30A 1YE9A 1X4PA 4G6TB 2KRHA 4DOZA 2GOMA 3DEEA 3OYFA 4CCJA 3OYJA 4PSXA 4XMYA 1QHHD 2ZFUA 2IGKA 2Q2EB 2HZDA 2Z1DA 3OYHA 3FBNB 2BVMA 4YEJA 1S9HA 2M3AA 4BEHA 2WA0A 3GBGA 1YX5A 4II2A 4C2UA 4P1WA 2CW8A 2HPMA 2O5RA 3LSIA 4PSWA 2PMZA 3HOTA 3D5SC 1HA8A 2A6TA 3IUOA 3QODA 1DGRM 3L2RA 1X4OA 2BW3A 4XOTA 2VIXA 4NC7A 4XKBA 4F92B 2M7AA 1NG6A 2K9MA 3BLYA 4HRIA 3BG7A 2DJIA 2VPLA 1PJRA 1MW7A 4OAZA 4PJLA 1T95A 4FASD 2W7NA 2Z16A 3K70C 4XLHA 2V1NA 4IQJA 2R7VA 1JI8A 2WAFA 2X85A 3A1YA 3HKZA 4ZJZA 1D0ZA 2LOOA 2MD0A 4ITVA 3DKYA 5LFAA 1TZLA 2WY8Q 1U0JA 3FHNA 3OL3A 1DQUA 3KEYA 1UG0A 3DPLC 4E7HA 3FBIB 1BOBA 2VXZA 1D0XA 2R7OA 3MMYB 2L5QA 4BDZA 1K6YA 3HC7A 4F93B 2VQGA 3PNYA 3OYMA 4E7SA 4QPOA 4C9YA 4E7LA 2W82A 3BCBA 1WFXA 3HL2A 4CCKA 2CV2A 2XDVA 4RLQA 4R79A 4XOPA 4BQOA 4BQNA 4HSTA 1X19A 4GRIA 3C2GA 4ZTFA 4B3XA 1QHGA 2X1DA 3D5LA 4Y3OA 2Q1ZB 4CCMA 4Y33A 4BACA 2CMPA 1D1AA 3H5RA 3DU6A 3IP4B 4HG2A 2LH9A 2LBFA 4CZCA 1ERDA 2ZXIA 3FDYA 4PFOA 3DLAA 2JVGA 1WJFA 4CCLA 2FUG2 2AQFA 3ZQQA 3K4NA 3VYTB 1MMNA 3DPUA 4B44A 3H9JA 2KQRA 2ELJA 3LL7A 3ONQA 4PJMA 4U87A 2MYSA 1WJBA 4ZDPA 2LREA 1ZELA 4F55A 3VWBA 2CV0A 1N78A 1QU3A 2L2OA 1GLNA 1DGWY 3H9GA 3S3NA 1VZ0A 3BCAA 2K3PA 5LD2C 1YX3A 1Y6IA 3H5AA 4AYBA 4BDYA 4RM2A 1N75A 1Z3XA 3OMYA 2F5VA 2VJIA 3L2VA 1IRXA 3H5NA 3K4BA 4IZZA 3G2BA 4BJTA 2M4KA 4HEA2 2E1MB 4PUSA 4CCOA 4XLEA 2KL4A 2KP6A 4YRVA 4BGDA 3IAM2 3K6GA 4D9JA 1V5GA 4F91B 4Y4RA 4XKCA 1BR1A 2R7RA 1WJCA 1WJEA 3DPTA 4XKVA 3OY9A 3DTKA 3ZCOA 2L9SA 3LFUA 2XC7A 4JOMA 2CUJA 3OR1C 3QYBA 5CQEA 5CQGA 2V4JC 3VYRB 3QOEA 1X1DA 2QKMB 2DXIA 2LC2A 4J00A 3OWTA 2RQQA 2VB6A 2VJ4A 3OYKA 4DJAA 4C2TA 3SEQA 2KZVA 4B48A 3OOUA 3RQ4A 5HVQC 2KMUA 3OYLA 2R7SA 2OC6A 1UELB 2HVSA 3VYSB 2BVLA 2LG4A 3S3MA 3DQVC 2PJRA 3OIPA 4BU2A 3N05A 3CF2A 1E0EA 4PJNA 3EPZA 3TBIA 2R4GA 2Y0SA 2E1MC 2VKDA 4OAYA 4YELA 3ZRGA 4BEHB 4PK4A 3C2HA 4X0GA 2JSPA 2DCEA 2ZXHA 3CMMA 3OS1A 2E5ZA 4XLCA 3A4CA 3K4CA 3CP2A 4NUBA 2WY7Q 2R7XA 2M7BA 2WBMA 2DT7B 2W1OA 3AFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RSN A;  3S32 A; 
#chains in the Genus database with same CATH topology
 4V19 K;  4Q5S F;  1Y0N A;  2PX9 A;  2XF6 A;  5F0C A;  4HNT A;  3P9I A;  5HS8 A;  2OTJ I;  2E2H J;  2WWY A;  1MMG A;  4KNY A;  4I7H A;  2V6C A;  1OYY A;  2Y30 A;  1T2K A;  4V2F A;  3BPX A;  2XPU A;  2HYG D;  4XLA A;  2DK8 A;  2YX7 A;  5E79 C;  4IHT A;  2CYY A;  1K61 A;  3SEZ A;  1X1A A;  2A68 F;  4XID A;  4A6D A;  2P5L C;  4K2E A;  3HSE A;  3MKW B;  2XGC A;  3CLO A;  1I5Z A;  2L9V A;  4EM2 A;  2R5Y B;  1W36 C;  1R6R A;  4IRH A;  2IA1 A;  1Q1V A;  3IRQ A;  5CPR B;  3F8M A;  2DI3 A;  2VQH A;  3HPG A;  1OCC H;  2F5C A;  3H9Q A;  3O2P E;  1KZH A;  2L4M A;  4U7D A;  2PEX A;  4BY7 J;  5GAG J;  1XGS A;  5JR3 A;  1FIA A;  4B43 A;  2QSG X;  2VJJ A;  5IP9 J;  3HOY J;  3GUD A;  2FX0 A;  4B8X A;  1Y56 A;  2VT2 A;  2M1B A;  1ZKG A;  2V7F A;  2HU9 A;  3FXL A;  2O0Y A;  2EQR A;  2IS1 A;  3R60 A;  4RM3 A;  2M34 A;  4II3 A;  5FKL A;  1I27 A;  1G6N A;  2OV7 A;  2K4J A;  3LST A;  4LG3 A;  3FKJ A;  3VDX A;  3OYB A;  1ITY A;  1VQK I;  3JTH A;  2EWN A;  1LNW A;  4XLP F;  1WKM A;  2EPF A;  2KKO A;  5DCM B;  5BPD A;  4IHY A;  4JK1 X;  3A01 A;  3L00 A;  3H0D A;  3G1M A;  1IN7 A;  3RTR A;  4S04 A;  2JA5 J;  2VI6 A;  5ILU A;  4L9N A;  1U3E M;  5HS7 A;  4AUX A;  2A5Y B;  2WB1 A;  4RAY A;  4CIC A;  3HTS B;  3JTG A;  1XMX A;  2QLZ A;  2LBF B;  3I64 A;  1JE8 A;  2K9L A;  4E7I A;  3WHB A;  1R5H A;  2KPM A;  3JAM Z;  4DYC A;  1UB9 A;  1IN8 A;  4XON A;  3AAF A;  1ZRD A;  3CJR B;  2A05 A;  2V1X A;  4OOI A;  2ETH A;  2E2J J;  4AM3 A;  3BTJ A;  1Y1W J;  1Q1H A;  3QPH A;  1MZB A;  4FCY A;  3KP5 A;  1EH8 A;  2YPR A;  3GW2 A;  3OS0 A;  2JPB A;  3E0J B;  1HSJ A;  3CJT B;  3MFK A;  1BW6 A;  3K4K A;  5K1Y A;  3ZQH A;  2DDA A;  5HS9 A;  4ZZL A;  4HDV A;  4CUG A;  1RNL A;  1BL0 A;  4KIC A;  4HX8 A;  5EZG A;  3FZV A;  3QP5 A;  1VQM I;  2DTR A;  2KFD A;  2L7M P;  5ED4 A;  5HLT A;  3HOZ J;  1NG7 A;  2ZO4 A;  3BG9 A;  2LNB A;  2DDB A;  3HOX J;  2QM3 A;  1IJW C;  2H09 A;  4KT6 A;  1MD0 A;  3F8C A;  4L0Y B;  4WX9 A;  5FGM A;  1FIP A;  3CO6 C;  2VQL A;  1BI2 A;  3BT9 A;  2JRM A;  4RAZ A;  2CRG A;  2F5F A;  1OFC X;  4CO8 A;  2EV0 A;  2DMP A;  3HKZ N;  2EBI A;  4HV6 A;  2X1E A;  4UXN A;  1DP3 A;  2XRN A;  1ETX A;  2YU3 A;  1ONV A;  1TWG J;  3L2Q A;  1B9N A;  3RYR A;  1B9M A;  1N77 A;  1QA6 A;  3Q0U A;  3S16 J;  1A6Q A;  2ELH A;  4IRG A;  3QYF A;  4CH7 A;  3DEU A;  3W6K B;  3S2H J;  5FO5 A;  3DU5 A;  1QVT A;  5JVT A;  2PJR B;  3MKZ A;  2CFO A;  1F5T A;  2HYJ A;  2X4H A;  3NWS A;  2QKL B;  4FQG A;  3G3Z A;  3PJR A;  4HF0 A;  5D5V B;  5FRO A;  2Y9Z A;  2P4W A;  1ZGJ A;  3Q3S A;  5JI6 A;  2LY9 A;  5CYV A;  4LFU A;  2CFX A;  1TQP A;  5FB2 A;  2W4S A;  1I50 J;  2ISY A;  2LKP A;  4B09 A;  4EV0 A;  5D6E A;  2XKP A;  1KQ9 A;  2I10 A;  1T6S A;  1V4R A;  2KT0 A;  3PNT A;  1LVK A;  2VC0 A;  3QQA A;  4OMZ A;  5CVU A;  1XPX A;  1FOX A;  3ESW B;  3IRR A;  3QU6 A;  4N4N B;  1K4T A;  3K1P A;  5M5X J;  2DT5 A;  3TGN A;  1JHF A;  3L2U A;  2UV1 A;  3WTW C;  4ENN A;  1TQI A;  3TP3 A;  3K4L A;  1J59 A;  3ERM A;  5J1R A;  1MNM C;  3BR5 A;  3V42 A;  1B8I A;  2UWM A;  2CS3 A;  2K5C A;  2J5P A;  3LSH A;  1YS7 A;  5B1B H;  3OYG A;  3JRE A;  4A3I J;  3X2Q H;  5A2Q K;  2VQC A;  1B4A A;  3MAJ A;  4A3K J;  2Z5U A;  2BHY A;  3I53 A;  4G8X A;  1ETO A;  1R00 A;  2M30 A;  1U8B A;  3IHU A;  2XF7 A;  5H6R A;  1X58 A;  1JGG A;  2N8G A;  2KHM A;  2YSR A;  2EA2 A;  4RAF A;  2JA8 J;  1FTT A;  2LY1 A;  2LF8 A;  3MD2 A;  1Z7L A;  4U7B A;  4AYB N;  4DNC A;  2CO5 A;  3BG3 A;  5TGT A;  2E60 A;  3CCU I;  4JX4 A;  3G73 A;  2DK5 A;  2D2W A;  1JJ8 C;  3JW4 A;  2DQL A;  2HI3 A;  4GCV A;  5CVI A;  4S0H B;  2QCO A;  3S8P A;  4OMY A;  4D1Q A;  3JCU C;  2OCE A;  3A01 B;  2P8T A;  3K69 A;  2HOA A;  5EZH A;  4LIU A;  4U0Y A;  3AL0 B;  4G94 A;  1E3P A;  2IS6 A;  2L9N A;  1VTN C;  5F0F A;  1IGN A;  3EDP A;  3GCM A;  5JLX A;  2ME0 A;  2DA7 A;  5FFX A;  4A0Z A;  2K40 A;  4F3Q A;  4RGX A;  1UAA A;  2VOP A;  4Y17 A;  3A2K A;  2BOL A;  1LDJ A;  2IP2 A;  4C3I J;  2VC1 A;  4BE1 A;  2V6E A;  2BZT A;  1XCB A;  2GXB A;  5CVV A;  2DA4 A;  1XSV A;  4MQ9 F;  1YE9 A;  1JT6 A;  1X4P A;  2KRH A;  4OIR F;  4BYY A;  3DKW A;  4DOZ A;  5FLX Z;  3J80 Z;  3RKQ A;  4OIO F;  2ZFU A;  4HDU A;  2IGK A;  2XGD A;  1UHW A;  5K5O A;  4M3D A;  1O57 A;  1IDZ A;  3RKW A;  3FBN B;  1IUY A;  2VOD A;  3CLQ A;  1S9H A;  2M3A A;  3WTY C;  3GBG A;  1YX5 A;  4A0Y A;  1K4S A;  5JHU A;  2FU4 A;  1B72 A;  1FX7 A;  2XUB A;  3LSI A;  2XGX A;  2LMD A;  2OAZ A;  3BR1 A;  1HA8 A;  2HOE A;  1VFC A;  1TC3 C;  2IAI A;  1ZRE A;  1ACI A;  3L2R A;  2BW3 A;  4XOT A;  4NC7 A;  2W84 A;  1POG A;  3FKI J;  5L3G A;  1BI0 A;  3R0J A;  2TRT A;  4F92 B;  3BLY A;  2ZNZ A;  4HRI A;  4MQV A;  1JTX A;  2DJI A;  2DW4 A;  1PJR A;  1MW7 A;  4WXH A;  3GTK J;  1A04 A;  1TNT A;  3Q0W A;  4FAS D;  5K7H A;  2BEO A;  2MH9 A;  4XLH A;  1HKQ A;  5IOY A;  2WAF A;  3A1Y A;  1APL C;  2ME6 A;  2OBP A;  3MWM A;  4BHP A;  4ITV A;  2G0E A;  2JMW A;  5FLM J;  3HSR A;  1U0J A;  3FHN A;  5IPA A;  2XSD C;  2OQG A;  3F23 A;  1P6R A;  3FBI B;  4EMS A;  2VBX A;  2R7O A;  2L5Q A;  2UZK A;  4BDZ A;  2FJ1 A;  2X48 A;  2AXT C;  3RJP A;  2E34 A;  5H6Q A;  1HDP A;  2DA5 A;  2QF7 A;  1D5Y A;  3JRH A;  1VQN I;  4E7S A;  1GVJ A;  2BHZ A;  3G71 I;  2AO9 A;  4NQW A;  5AON A;  3WU2 C;  1S7O A;  5IY5 H;  2DFI A;  2TCT A;  2B7E A;  5D5X B;  2W25 A;  3HL2 A;  3ZMT A;  4R79 A;  4GGG A;  2I5U A;  5L3D A;  4RGU A;  1FEX A;  2W48 A;  3QOP A;  1LVA A;  2DN0 A;  1FP1 D;  3F3X A;  3HRM A;  2FD5 A;  4UY8 I;  2X1D A;  3FM3 A;  1T33 A;  3D5L A;  3TW7 A;  2HZT A;  1PUF A;  3S17 J;  5LGN A;  2CMP A;  4AVP A;  5LGT A;  2YR2 A;  2ZFW A;  3OSF A;  3IP4 B;  3ZP5 A;  1SEU A;  2WV1 A;  2WB1 N;  3C2B A;  2LH9 A;  4JYK A;  4CZC A;  4FX4 A;  3ULQ B;  6PAX A;  1B8I B;  3M3Y J;  2ZJP F;  1VQ8 I;  3ELK A;  4KIB A;  2FUG 2;  2HKX A;  3V7R A;  2QWW A;  3ZQQ A;  3GVA A;  3K4N A;  3DPU A;  5EEA A;  1YIT I;  3H9J A;  1V54 H;  3MQ0 A;  4LB6 B;  2KQR A;  4IHV A;  1DPR A;  2ELJ A;  3ONQ A;  1J2X A;  3I4P A;  2CV0 A;  4BBR J;  3CC7 I;  1QU3 A;  4GFB A;  3TO7 A;  1U5T C;  3S3N A;  1ON2 A;  2EB7 A;  4WXD A;  1R22 A;  2HDD A;  1W0T A;  1X2M A;  4LB5 A;  4S05 A;  1SAX A;  3H5A A;  1VQ5 I;  4YIF A;  5HDG A;  1FP2 A;  2FQ4 A;  4BDY A;  1B1B A;  1E3H A;  2HOS A;  3H5N A;  3IH3 A;  2KL4 A;  4G9Y A;  1BN5 A;  1MBJ A;  3K6G A;  1MMS A;  4D9J A;  3RZO J;  4XRS A;  4Y4R A;  2YU9 J;  4M73 A;  2XV4 S;  4XKV A;  5LEJ A;  2Y0M A;  5CVR A;  2HXO A;  5GAD J;  2NVT J;  2XC7 A;  3PUF A;  4UVC A;  5CQE A;  5GAH J;  2FA5 A;  1OCP A;  1FJL A;  4IOA F;  5J1U A;  3K1M A;  1X1D A;  1I6H J;  2DXI A;  1FLI A;  4J00 A;  1M1E B;  4HOB A;  4C2T A;  3LA2 A;  2O61 A;  3SEQ A;  1OQY A;  4KUM A;  1XB4 A;  4QWQ A;  2F48 A;  4B48 A;  2A6E F;  2KMU A;  3OYL A;  4RDU A;  4P55 A;  3CCJ I;  3K2Z A;  1UEL B;  4RB0 A;  1J5Y A;  2HDC A;  1ORK A;  1JXS A;  3HOU J;  3GZ6 A;  4AC0 A;  2M2E A;  3CF2 A;  1E0E A;  3AG1 H;  1P4A A;  1ZQ3 P;  3ECO A;  3GFJ A;  3EPZ A;  3TBI A;  1SD6 A;  2R4G A;  3P7N A;  4OAY A;  4YEL A;  3ZRG A;  5J8F A;  5DS9 A;  2QA4 I;  2V1D A;  2JSP A;  4HQE A;  4ASN A;  2PMH A;  5J6X A;  5LGU A;  1QPM A;  5E3M A;  2OA4 A;  3RKX A;  3U1K A;  3CMA I;  4M9Z A;  1UFM A;  2WBM A;  2L7F P;  2W1O A;  2K27 A;  1HLV A;  4PGG A;  1V5F A;  1SAU A;  2DPU A;  1YIJ I;  1YJW I;  2BW3 B;  3JAM K;  2JA6 J;  4M3B A;  2PQ8 A;  1D8J A;  2BXY A;  3SYT A;  3U9G A;  5JHF A;  1TL8 A;  3F8F A;  1YQA A;  3K4M A;  3U1D A;  1HKS A;  3IV5 A;  1FYM A;  1BW5 A;  4LD5 A;  3CZ6 A;  4D5C A;  4DBR A;  4EAT A;  2PG4 A;  1JHH A;  1HKT A;  1P9Q C;  3DKX A;  3W2W A;  1BI3 A;  1K6O A;  4BL0 B;  2UXN A;  4CHU A;  3V8J A;  3J7Z I;  3BJ6 A;  2PN6 A;  3JRD A;  2EFQ A;  2QVO A;  3HUG A;  1T0F A;  4L9V A;  4G6Q A;  4NQW B;  1MBK A;  5IYB J;  2Z2S B;  3LSP A;  4EM1 A;  3CCR I;  2OQR A;  2FBK A;  2NYX A;  1BR4 A;  4QIW N;  2QUF A;  5KAF C;  3P9K A;  1OR7 C;  1OCZ H;  3KYL A;  1J09 A;  2WAD A;  4GO1 A;  4KA4 A;  2GBY A;  4MFD A;  5E8I A;  4CYD A;  1NH3 A;  3AKZ A;  1MH3 A;  3GTG J;  1TNS A;  2DFF A;  1K79 A;  4ESF A;  5DM7 F;  1PUF B;  2HDW A;  2CQN A;  2OCC H;  4IL6 C;  2E36 A;  3C18 A;  5DD4 A;  1NK2 P;  3B73 A;  4KIT B;  2E19 A;  4UHT A;  5D6F A;  1FBQ A;  4Y52 J;  1OCO H;  3DBL B;  3DWL E;  2CW7 A;  3FHZ A;  5C4X J;  4H4K C;  4UNO A;  3ZQG A;  1S8N A;  2HKO A;  3RCO A;  5TRD A;  1ZH5 A;  2NS7 A;  1XTA A;  4XK4 A;  2V9V A;  2MFZ A;  2CQQ A;  3E6B A;  3CCM I;  4L5E A;  1F43 A;  4IO9 F;  2HFH A;  2ZKZ A;  3ABT A;  4XBF A;  4XNF A;  3OS2 A;  3BR6 A;  3WHC A;  2M9H A;  1LPQ A;  4PFP A;  2X6Y A;  5E20 A;  4A5M A;  3PFI A;  4KJZ A;  2VKH A;  1PP8 F;  3ZOB A;  4LMY A;  3LMM A;  4BQQ A;  1Z1D A;  1KGS A;  2Q2E A;  1RC9 A;  5EDN A;  3GTL J;  4IQ4 A;  1H88 C;  2HQ5 A;  3BJA A;  3EUH A;  3O8H A;  1X1B A;  2BE5 F;  2P0W A;  3MVP A;  4V2G A;  1MBG A;  2UUZ A;  3C7J A;  2OPT A;  4Q48 A;  4EJT A;  3CF5 F;  3EYI A;  2HVR A;  4DBQ A;  1D5V A;  3PSF A;  2GLO A;  3PSI A;  2QYO A;  3KE2 A;  1MBF A;  1OLT A;  3MZY A;  1IRG A;  1R23 A;  1Z21 A;  4PDK A;  4MTE A;  4BXU A;  1WVR A;  3PFY A;  4L5J A;  2V79 A;  3AG4 H;  4RGR A;  2ZB9 A;  4ENM A;  2PI0 A;  4C2M J;  1ZGW A;  3FM5 A;  1IUF A;  2IXS A;  3M1C A;  5TJJ A;  5LHH A;  2VBZ A;  2O6G E;  1ZAR A;  1O4X A;  2LDU A;  5GPA A;  4A3F J;  1MMD A;  1RRJ A;  3BDD A;  1KA8 A;  5FRM A;  1ZGA A;  3B6C A;  5LLQ A;  4BJ5 C;  4BS9 A;  3CUO A;  1B6A A;  2PFB A;  4XR6 A;  4BE2 A;  1DDN A;  2KJC A;  4TV7 A;  4JQF A;  3QYE A;  3TO6 A;  1LDK B;  5E8G A;  3KEO A;  3KP6 A;  4NC6 A;  2E35 A;  1PUE E;  3KPH A;  1A5J A;  4W97 A;  5D8L B;  5JVG F;  5EEG A;  2IJL A;  4N4O B;  2C6Y A;  1HW1 A;  5B3S H;  1FMW A;  3ZMV A;  2GM4 A;  2HNH A;  1TT0 A;  4A3M J;  5E3L A;  4G7Z F;  2CQ7 A;  3MN2 A;  3ZQ7 A;  2KDO A;  2GZW A;  3I59 A;  4ZH4 F;  4EJW A;  2VOO A;  2GAU A;  5DTD A;  3PQJ A;  3DP7 A;  3RZD J;  5D4R A;  4LJZ F;  3ZMD A;  2P5V A;  2IS2 A;  2ID6 A;  3WTS C;  3H3V K;  2B63 J;  4ZDL A;  2HQR A;  5FLX K;  3J80 K;  2XF5 A;  3JRA A;  1ETK A;  3G6E I;  4QTR A;  3S93 A;  2K9N A;  1RR8 C;  1LFB A;  3O8G A;  3JSP A;  5C44 J;  3CD6 I;  2GIV A;  4ESJ A;  2FML A;  5J4Y A;  1B59 A;  3TO9 A;  3BQY A;  5KK1 A;  2JSC A;  3HPH A;  4XN3 A;  5ICE A;  3GFL A;  4N9H A;  4BHB A;  3OYI A;  1E3O C;  3S3O A;  2DJN A;  5E1Z B;  1FBU A;  3WG9 A;  2HQA A;  4H0E A;  1QPI A;  1ZG3 A;  2IVM A;  4M74 A;  2Q8K A;  3GF2 A;  1X3U A;  2VE8 A;  5LBQ A;  2P6T A;  1WSU A;  3U21 A;  2E5N A;  3HUG B;  3W2V A;  2VBY A;  3BJO A;  2JUC A;  1J7K A;  1FOY A;  5DUI A;  5BNG A;  2DFE A;  2O8X A;  3EUK L;  2NXN B;  1S3J A;  2G7U A;  1E2X A;  2ZXJ A;  2IS4 A;  1WRJ A;  3OIQ A;  1WWX A;  2KRC A;  4W1U A;  3SHF A;  3E6C C;  3GX4 X;  1F36 A;  2WV0 A;  1SAN A;  2VBW A;  4CCN A;  1D1C A;  3ZQF A;  5J47 A;  3E1S A;  3GTO J;  3KLN A;  4HV5 A;  2ZME C;  1GUU A;  1H89 C;  1IAW A;  1BI1 A;  2ZCW A;  3GZ5 A;  3R61 A;  4IEJ A;  2HTS A;  4ESB A;  2QGU A;  1WJD A;  3MKY B;  4ENJ A;  4M3E A;  5HOD A;  3BR3 A;  3MEX A;  2DA3 A;  3I5U A;  1UHS A;  3PUB A;  3CQZ J;  4DYQ A;  5IYD J;  2PMU A;  3W3C A;  4Y13 A;  1P4X A;  1D1B A;  2F4O B;  4KIS A;  3COA C;  1D0Y A;  5CKT A;  4C30 A;  3O6B B;  2LYC A;  3M8F A;  1LE8 A;  1I3Q J;  1HW5 A;  1ZHF A;  3LSJ A;  2CUF A;  1R1T A;  3KP4 A;  2K86 A;  4EEF G;  1W7P A;  3REO A;  1EH7 A;  4CYC A;  3UKG A;  4G6D A;  3M4O J;  1NHA A;  2DQR A;  3ABL H;  3GTM J;  1QHH D;  1T56 A;  3RQI A;  2Q2E B;  2HZD A;  3OYH A;  3V7S A;  2BVM A;  4MTD A;  4YEJ A;  5M5Y J;  1XS9 A;  3AG2 H;  3T0Y A;  4RBO A;  1E17 A;  4C2U A;  4P1W A;  1DPU A;  2HPM A;  1MJA A;  5M3F J;  3ECH A;  3CUQ C;  4MHG A;  3IUO A;  2XKO A;  5E17 F;  2ADU A;  1T8I A;  1DGR M;  3FXO A;  2DAO A;  2VKV A;  1TBX A;  4E70 A;  4XKB A;  5GPC A;  2HS5 A;  2K9M A;  2EJR A;  1FC3 A;  2M8E A;  5BS6 A;  2E7X A;  2W7N A;  1JTY A;  3BQZ A;  2Z16 A;  1G3W A;  2V1N A;  2EV5 A;  4B1R A;  4IQJ A;  3CCL I;  1R9T J;  2X85 A;  4ZJZ A;  3RYP A;  4HF2 A;  4JP0 A;  4XSZ F;  3SFZ A;  5LFA A;  1TZL A;  3OL3 A;  1IN5 A;  3A02 A;  4B4C A;  4BXX J;  3DCF A;  1SD7 A;  1BOB A;  2MGQ A;  2VXZ A;  3A03 A;  1EJ9 A;  4AIK A;  3HC7 A;  5J8C A;  2BBY A;  1Z05 A;  1Z7U A;  4UV8 A;  1WGX A;  3I71 A;  1R71 A;  4QPO A;  3KIO A;  1IRZ A;  1XSD A;  3HRT A;  4FTH A;  3FF5 A;  3SDG A;  4CCK A;  1ETQ A;  2OJE D;  1BJA A;  1WI3 A;  5BPI A;  1YS6 A;  1MBE A;  2A61 A;  4XOP A;  4I0B A;  3QPL A;  4F7Z A;  4BQO A;  4KT5 C;  1X19 A;  2EZI A;  1OMI A;  4R8H A;  4UUT A;  4GRI A;  4XRS G;  1TT5 B;  2DA2 A;  3MCZ A;  4YFK F;  2ZXW H;  2O9L A;  1IV8 A;  1TWC J;  1L0O C;  1CGP A;  3I59 B;  2PBI A;  2VUM J;  3ISP A;  5E18 F;  1D1A A;  3FMS A;  1MSF C;  2NVY J;  1YRN A;  1VF9 A;  4XLN F;  4KFC A;  4GYI A;  1G3Y A;  3FDY A;  4ZYD A;  1W5C C;  1G4D A;  1IXR C;  4CCL A;  3HGG A;  5H20 A;  3RPU A;  4WF2 A;  5D5U B;  1R5I D;  3VYT B;  1K83 J;  1IXC A;  3CC2 I;  4JX6 A;  3BOQ A;  4PJM A;  4U87 A;  4UB6 C;  2P7V B;  1ZEL A;  3I56 I;  4M6Y A;  3WG7 H;  1DGW Y;  1W7P D;  4A3L J;  3H9G A;  2E1O A;  2K7L A;  1QNT A;  3BCA A;  3HB9 A;  2DMT A;  1SFO J;  4R1H A;  4HYE A;  1YOV B;  2EIJ H;  4ABZ A;  2XVC A;  3OMY A;  1HDD C;  2ICW G;  3BTL A;  2H1L A;  2F5V A;  3FK6 A;  3W6V A;  3L2V A;  9ANT A;  1IRX A;  5CVJ A;  3ASO H;  4A12 A;  4L0Z B;  5FFZ A;  4CCO A;  1SC7 A;  3HIF A;  3F8B A;  1GXP A;  5DEQ A;  3IAM 2;  2GA2 A;  4MO7 A;  3PIP F;  4BHC A;  3CTA A;  4XKC A;  5KAI C;  1K7A A;  2R7R A;  1WJC A;  1WJE A;  2L02 A;  4CZZ A;  3OY9 A;  3ZCO A;  1ZG1 A;  4DW6 A;  3I4N J;  3B02 A;  3TQN A;  1PDN C;  4P96 A;  3D0S A;  1V3F A;  2EV6 A;  4JBA A;  4ZZD A;  2CUJ A;  5BOX A;  3QYB A;  2V4J C;  3VYR B;  2LLK A;  4Y7N J;  4NHJ A;  3J7A O;  2JQ7 A;  4UUV A;  3EYY A;  3NRV A;  4NDL A;  4DQ2 A;  1ZG5 A;  3KP7 A;  2VJ4 A;  1MH4 A;  3FK7 A;  3HEF A;  3V8L A;  3TOB A;  5BQT A;  2STW A;  2KZV A;  4BBS J;  3OOU A;  4QSH A;  1LE8 B;  5B5E C;  2BVL A;  2DU9 A;  2RNJ A;  1W7P B;  1Y0U A;  3GFM A;  2LG4 A;  2Y9Y A;  3DQV C;  2NS0 A;  3SZT A;  4BU2 A;  2BXZ A;  3S3M A;  3N05 A;  4CYC B;  3WTT C;  4IHS A;  3OV8 A;  4YFN F;  4PJN A;  3HOV J;  1S29 A;  2F2E A;  3GME A;  4AIJ A;  3WGH A;  1ZR2 A;  2ZXH A;  2FBH A;  2VKE A;  2A3S A;  2E5Z A;  3K4C A;  3CP2 A;  4NUB A;  3S14 J;  1ODD A;  2WY7 Q;  4PJ0 C;  2M7B A;  1EH6 A;  1RR7 A;  3G1L A;  3UNG C;  3GO5 A;  4MEY F;  3ZMS A;  1WJA A;  3HRS A;  4U88 A;  1FSH A;  3L2C A;  1QO0 D;  2P7C B;  1HXD A;  2D1H A;  3TP0 A;  4DYR A;  3NWT A;  4FX0 A;  3ZXS A;  3CDH A;  2D5V A;  2F6C A;  4G7O F;  2ZME A;  3MZ8 A;  3OYC A;  1WJ5 A;  2VLA A;  5EF6 A;  2COB A;  4XL9 A;  1RES A;  3QWL A;  3RIR A;  4D5F A;  3N4M A;  3K2A A;  3DTE A;  1FZP B;  4XM3 A;  4RMN A;  5DYM A;  5ILV A;  3L7W A;  4LLN A;  4HPQ A;  3FXR A;  1XC5 A;  2ZJ2 A;  3RPU D;  4DZP A;  2R7Z J;  4F52 A;  4C3J J;  1IV6 A;  4CA0 A;  2IEK A;  1FYK A;  5CJ9 A;  3ZGK A;  4QLC U;  1TQM A;  3CCQ I;  4BUP A;  1HOM A;  2QSF X;  2RN7 A;  3J7Y J;  4BJ6 C;  2X6W A;  1O3R A;  3DBR B;  3S2W A;  3BC8 A;  1SFE A;  3RPQ A;  1U9O A;  1VQ9 I;  3CJQ B;  2HVQ A;  1H9T A;  3M8J A;  2VN2 A;  3KCC A;  3PL8 A;  4ZYG A;  3BZK A;  1IDY A;  3JSO A;  3GFI A;  3W2A A;  4A3D J;  3K4J A;  4HLY A;  2EH3 A;  4WCG A;  2EZK A;  3VSK A;  4BAY A;  5KNL A;  3HZJ A;  2QQ9 A;  4UVA A;  4OIP F;  2X6O A;  2R7D A;  3ZQC A;  4XN0 A;  2BGC A;  3SDB A;  2DFH A;  4DIQ A;  1W36 D;  3LQR A;  3M7G A;  4AVZ A;  3OYA A;  3D5R C;  3LSK A;  2ACJ A;  2M0M A;  2LP0 A;  1I6X A;  1FBS A;  1YRN B;  1YIO A;  1HC8 A;  2CGP A;  4E7J A;  3E6M A;  3ZMU A;  4HF1 A;  2OZ6 A;  2R92 J;  1RZ4 A;  5FRN A;  4BH9 A;  3VSL A;  1WZ2 A;  1IN6 A;  5FD5 A;  1BBY A;  3WTX C;  1UST A;  3CDL A;  3IAS 2;  4ZYH A;  2FEZ A;  4Y15 A;  4FE4 A;  3F0C A;  1DU0 A;  1HST A;  3VB2 A;  3LSR A;  3CCE I;  3CES A;  4XIC A;  3VFZ A;  2RDP A;  3L9F A;  4M6X A;  1JUP A;  4LIT A;  2L01 A;  2KZG A;  3ZN0 A;  2GOX B;  4EJV A;  3KP2 A;  2HYF A;  1V55 H;  5KCM A;  5JFR A;  1MDM A;  2Y2Z A;  3EET A;  2WC2 A;  1Z0X A;  2KLO A;  2CQX A;  1H8A C;  1TW2 A;  3JRG A;  1FOK A;  3H3Z A;  1KU3 A;  3F22 A;  4ZYA A;  1P7J A;  1A31 A;  3HYI A;  1RPW A;  4LK1 F;  3MKL A;  3S1M J;  1UG2 A;  2O03 A;  2OD5 A;  1YHQ I;  1TP4 A;  3GTP J;  1O7F A;  3C3W A;  4XLF A;  4P9U A;  1YTY A;  1FT9 A;  3E5Q A;  2LD5 A;  1HW2 A;  3WE2 A;  5ICF A;  1RET A;  2XAU A;  1AA7 A;  2K9S A;  2DA1 A;  1F9N A;  2MC4 A;  1SMT A;  3H36 A;  3KEQ A;  4LGW A;  5EG0 A;  1YFH A;  1JKQ C;  5F1J A;  4OWR B;  4M71 A;  2K3F A;  3FXK A;  3CC4 I;  3AL0 C;  1X1P A;  1ETW A;  5FKO A;  5KHD A;  2DYR H;  3OYD A;  2FQ3 A;  2NVQ J;  4E6K G;  5D4S A;  1USS A;  3ABM H;  2GXA A;  2DLL A;  1A36 A;  1S6L A;  2UXX A;  2DYS H;  4BQA A;  1RI7 A;  1TWH J;  2CJJ A;  3CP8 A;  3DBH B;  1R1U A;  4J01 A;  1YO5 C;  2BY3 A;  4A93 J;  2KIM A;  4HBL A;  2H1K A;  2YS9 A;  2RNG A;  5ILS A;  4LG0 A;  2XB5 A;  4A3E J;  3LOC A;  3S1Q J;  1WCM J;  5F27 A;  3LSG A;  2P6S A;  1TWA J;  3LSM A;  2NS8 A;  4A2U A;  5HDN A;  1BIB A;  1ZN2 A;  2ZME B;  3UR3 C;  2NNY A;  1LEB A;  2F4I A;  2X1C A;  1RKW A;  4HSR A;  5F08 A;  2CUZ A;  4XQF A;  2ISZ A;  2BYV E;  3FX3 A;  5F6F A;  2JUG A;  2Z9O A;  3G4S I;  3KZI C;  4Z2Y A;  1I1G A;  1R58 A;  2FOW A;  3KLO A;  3P5J A;  5KVR A;  2R0Q C;  2KDZ A;  2GQQ A;  2XPV A;  2NVX J;  2VL8 A;  3FWE A;  3TL4 X;  4RB2 C;  3W6J B;  4ANJ A;  1KQ0 A;  2RVC A;  2IA2 A;  1P92 A;  4UV9 A;  1XX5 A;  3F8N A;  1OPC A;  4QPQ A;  4A69 C;  2Y31 A;  3WE3 A;  1G8X A;  5DCF A;  3OYE A;  2WAE A;  4NB5 A;  1FY7 A;  4UUS A;  4ZTJ A;  1C0W A;  4KYW A;  4YIR X;  2W57 A;  2QQB A;  1I3A A;  2M8G X;  1O3Q A;  3PIO F;  1FPQ A;  1KON A;  3SZP A;  3JR9 A;  4UVB A;  4P5O A;  2LVS A;  4CSW A;  1NTC A;  4XKW A;  4ZDO A;  1FMV A;  2OZU A;  1IN4 A;  3LAJ A;  4XRF A;  2RC4 A;  3TMO A;  4DGW B;  3I9V 2;  3Q5F A;  4A3G J;  1Z3Y A;  2X6X A;  2JA7 J;  4MEX F;  2VAS A;  1VI0 A;  1ZTR A;  2H6B A;  2ESH A;  3FIS A;  3FIW A;  2L54 A;  4IVN A;  1P2F A;  1O3S A;  3KZY A;  1JKO C;  2L9R A;  1NK3 P;  3KYC B;  3E7L A;  2DOE A;  1GV5 A;  1MIJ A;  4I01 A;  1G59 A;  2V9K A;  1T39 A;  2V1U A;  4IOC F;  3NAR A;  2MD5 A;  4G6T B;  3VPR A;  5M3M J;  2JTV A;  4M3G A;  2GOM A;  3F6O A;  4CCJ A;  4PSX A;  2EFP A;  3ASN H;  4XMY A;  5FD6 A;  3FXQ A;  2QZ8 A;  2XAJ A;  1G3T A;  4FE7 A;  3J81 K;  4MGR A;  1SMY F;  4BEH A;  2WA0 A;  1Z6T A;  4II2 A;  1MDM B;  1ZLK A;  4L9T A;  4ZYE A;  2XAQ A;  4DZJ A;  1ON1 A;  2O5R A;  4IXA A;  1ZRC A;  1ZR4 A;  2LK2 A;  2PMZ A;  2ZC2 A;  3T1B A;  5L3B A;  3HOT A;  3ABK H;  2AS5 F;  3D5S C;  3GYH X;  2A6T A;  4I2O A;  3GWZ A;  1KQ8 A;  3QOD A;  2XRL A;  1X4O A;  3PO2 J;  1KYZ A;  2VIX A;  1BM9 A;  2M7A A;  1U6G A;  2KIF A;  1NG6 A;  2OF7 A;  4KMU X;  4ETS A;  5HDK A;  1LUJ B;  1SVM A;  2QQA A;  3BG7 A;  2VPL A;  2Y69 H;  4PJL A;  1GDT A;  1T95 A;  4N9I A;  1TLH B;  3HHH A;  3K9T A;  4KN7 X;  1W5S A;  4MNU A;  1JGS A;  4M9S A;  3K70 C;  1U5T A;  1ETV A;  1XMK A;  1R49 A;  1O3T A;  1FNN A;  3GTQ J;  1JI8 A;  3I54 A;  2LFB A;  5J3L A;  2H8R A;  3ZN1 A;  3IWZ A;  4EGZ A;  5EG0 B;  2MD0 A;  2XAS A;  3DKY A;  3BTI A;  2WY8 Q;  3ZQL A;  2Q0O A;  3KEY A;  1UG0 A;  3DLL F;  4E7H A;  3NQO A;  1HF0 A;  3LAP A;  5HLI A;  1D0X A;  3HHG A;  1R7J A;  3PNY A;  2Z33 A;  4PZJ A;  3B6A A;  1BJZ A;  2AHQ A;  4C9Y A;  4MFE A;  1Y39 A;  4E7L A;  2W82 A;  2FOK A;  2JRT A;  3RI4 A;  1QQI A;  1WFX A;  2CV2 A;  1R1V A;  3BZC A;  3R6S A;  1EV7 A;  4HNV A;  5IT3 A;  4BQN A;  1ENH A;  3RKY A;  4ZTF A;  4LG0 B;  5EEH A;  5K5R A;  4B3X A;  2FMY A;  4EJU A;  4CCM A;  2RGV A;  4A0X A;  2EK5 A;  2E7W A;  4NBQ A;  1YW9 A;  4Y33 A;  1PVE A;  5IT9 Z;  1UZC A;  3BR2 A;  2A07 F;  3H3U A;  2K9Q A;  2XAG A;  4A3B J;  2HTJ A;  1WI9 A;  1XDS A;  2WAQ N;  3VEP A;  1ERD A;  4PFO A;  1MGT A;  3DLA A;  2EIM H;  1R4M B;  1WJF A;  2XAH A;  2E1N A;  1GXQ A;  4X6A J;  3V7C A;  5FKK A;  4B44 A;  2STT A;  3KFW X;  5H2F C;  1R36 A;  3LL7 A;  2CW0 F;  3VWB A;  1WJB A;  2WTE A;  4ZDP A;  4F55 A;  2W85 A;  3M1E A;  2MA3 A;  2L2O A;  5LHG A;  5CLS A;  3HJE A;  1J9I A;  4AIH A;  1FSE A;  3IL2 A;  1VZ0 A;  5DM6 F;  1LJ9 A;  5LD2 C;  2QEN A;  3GXO A;  1R4N B;  1YX3 A;  1JUS A;  1Y6I A;  4UUS B;  2XAF A;  4RM2 A;  3QP6 A;  1REP C;  2VJI A;  5E3O A;  1LQ1 A;  2DTZ A;  4IZZ A;  2JK3 A;  3G2B A;  2M4K A;  2BY2 A;  2H27 A;  1FWZ A;  1TWF J;  4FHT A;  4HW0 A;  4PUS A;  2X0L A;  1WH7 A;  2KP6 A;  4BGD A;  1XMA A;  1Y1V J;  3IH2 A;  4LK0 F;  3OOP A;  3WOD F;  1ZK8 A;  2XIG A;  3V8K A;  2FNA A;  1XGM A;  2PJP A;  2GIZ A;  3DPT A;  2K02 A;  2RAE A;  5M5W J;  2BY0 A;  2L9S A;  3HOW J;  4A6E A;  1YYV A;  2R3S A;  1YJ9 I;  3OR1 C;  5CQG A;  5AIQ A;  3QOE A;  1OYI A;  4O3M A;  2Y48 A;  3ZQI A;  2LC2 A;  4HAM A;  3BPV A;  5L3E A;  2QSH X;  3WGG A;  2NRA C;  3OWT A;  2RQQ A;  2VB6 A;  4U0V A;  1WH5 A;  2CWE A;  3OYK A;  1Z77 A;  2EZH A;  4B3A A;  4CGZ A;  1XN7 A;  2RV8 A;  3Q9S A;  1QVU A;  3RQ4 A;  3Q0V A;  5F1R A;  5HVQ C;  4A3C J;  3T8R A;  1S7A A;  2R7S A;  2OC6 A;  4A5N A;  1OR7 A;  2EA4 A;  2JWT A;  4RA2 A;  1T38 A;  3IC7 A;  1OKR A;  2E71 A;  5K5Q A;  3OIP A;  5DDG A;  4U0W A;  4WK8 F;  1JKR C;  3A0B C;  1Z6R A;  2Y0S A;  2E1M C;  4OIN F;  2F5D A;  5IYC J;  4BEH B;  3OS1 A;  2DCE A;  1YJN I;  5GTH C;  1BA5 A;  2KRF A;  4L5I A;  4XLC A;  1UCR A;  3A4C A;  3K7A J;  1RUN A;  4P9F A;  1XDU A;  3JRC A;  3BTC A;  2V9P A;  3QRF F;  1LB2 A;  1VQ6 I;  2R7X A;  3TW6 A;  2R5Z A;  4PCQ A;  1ZAO A;  2X9D A;  5B66 C;  1YLF A;  3H35 A;  2CV1 A;  3J7A Y;  2X51 A;  4LOC A;  1RUO A;  5F0H A;  1W0U A;  2EFN A;  3ABU A;  1T98 A;  3F9K A;  1SFX A;  1MBH A;  5GAE J;  4IRI A;  3BWG A;  2DOA A;  1U5T B;  4RLF A;  2VE9 A;  2PLY A;  3V4G A;  4IKF A;  1BR2 A;  1A35 A;  2LY2 A;  2QEX I;  2YX4 A;  5FKM A;  5F04 A;  2COM A;  2EIK H;  2E1C A;  2F4M B;  4YG2 F;  3DV8 A;  1Y8R B;  2EZL A;  2F5E A;  4IX7 A;  1JJ6 C;  2BY1 A;  1V5E A;  1QGP A;  4AID A;  1LFP A;  2LKS A;  2CH0 A;  1VQP I;  5K7F A;  1KYW A;  3L09 A;  4HNU A;  4C3H J;  3VYU B;  3J81 Z;  2JA2 A;  1XGO A;  2O3F A;  1IZ1 A;  2MLG A;  3BP8 A;  4I02 A;  1VQ4 I;  3GEZ A;  3ML6 A;  4E7K A;  3S32 A;  1IF1 A;  2JN6 A;  2EIN H;  1JT0 A;  2NOG A;  2JVH A;  2A6H F;  3OL4 A;  4Q47 A;  4MLO A;  3DEW A;  2YUS A;  5IP6 A;  2ZSI B;  2EIL H;  5ERI A;  3I3L A;  2Y75 A;  4HZF A;  4JX5 A;  4RB1 A;  1U2W A;  4I98 B;  3WGI A;  2O8K A;  4KMF A;  2IPQ X;  1X1C A;  5DD8 A;  5DUK A;  1S5L C;  5K7Z A;  4CDG A;  2M4G A;  1X3Z B;  3HG9 A;  3QU3 A;  1VQ7 I;  5GTI C;  1K78 A;  3QPT A;  4M9X A;  1IRF A;  1SFU A;  1ZYR F;  1TTY A;  4E7Z A;  5HLH A;  1P4W A;  3PNV A;  3DTI A;  3LNQ A;  1QZY A;  2H8W A;  4NC8 A;  1DUX C;  4I76 A;  3LA3 A;  1PYV A;  1SFK A;  3BG6 A;  1HQC A;  1X2N A;  3HBL A;  3K0L A;  3TKY A;  2BV6 A;  4A3J J;  1SVO A;  2B0L A;  3QAH A;  4RS8 A;  3LWF A;  2O7O A;  2AQE A;  3D1N I;  3TED A;  5D5W B;  3GLX A;  1H0M A;  2HWV A;  3LFK A;  3Q9V A;  3T8T A;  3H0G J;  4M6V A;  2K4B A;  3VOE A;  1J75 A;  2EFO A;  2IGN A;  4ON0 A;  5B1A H;  2NOJ B;  1QZE A;  4NNJ A;  1ZLJ A;  4BXF A;  3BY6 A;  3VOD A;  3S2D J;  5EGO A;  4L9J A;  1W1W E;  2CQK A;  3BZ6 A;  2DMQ A;  5GP9 A;  2VJ5 A;  2RKH A;  3GLL A;  1AU7 A;  2PMZ N;  3QPS A;  1L3L A;  2LTP A;  2K85 A;  1W4M A;  3F21 A;  2QQ8 A;  2R7U A;  1Z91 A;  1T0F C;  3SXY A;  2OUM A;  3CCY A;  3CCV I;  3IH4 A;  4G7H F;  5HOO A;  3HRU A;  4B47 A;  2GXG A;  3M8E A;  3BR0 A;  1JUM A;  1LKX A;  3E97 A;  3SJM A;  2A5W A;  1Z67 A;  2Z99 A;  2ZJQ F;  5LRR A;  2XPW A;  4BKX A;  1STZ A;  4KIF A;  4XOR A;  4FT8 A;  2R7W A;  2FRH A;  3M07 A;  2DT6 A;  3R4K A;  2HPI A;  2XSJ C;  2FE3 A;  3FXM A;  3O3K A;  2CG4 A;  3JRB A;  2V26 A;  3I0T A;  2LRD A;  5D8K B;  3I4M J;  2A69 F;  3CJN A;  1MNE A;  2GWR A;  4BE0 A;  4EJO A;  1YW8 A;  2IW5 A;  1IC8 A;  3OYN A;  3OIO A;  3SZG A;  3PQK A;  1MND A;  4D7M A;  4J19 A;  4O5V A;  4LIV A;  5HNF A;  3E6D A;  4PGH A;  1O7L A;  5AIP A;  2VT3 A;  2MLK A;  4ZC3 A;  5J4V A;  2ELK A;  2R5Z B;  1OIS A;  1MKM A;  2XB0 X;  1ULY A;  4XSX F;  4AD9 A;  4D7N A;  5IOZ A;  4E4H A;  2G9W A;  1CF7 A;  1R5G A;  3EUA A;  2I8D A;  3EUH C;  5EYR A;  2DPD A;  2DMU A;  3HSF A;  2R7T A;  4PJJ A;  4GYG A;  2R93 J;  2FBI A;  1IG7 A;  2EFW A;  2Z3Y A;  2KIS A;  2L7K A;  5E1W A;  3HXL A;  1UMQ A;  3G1O A;  3K70 D;  1KU7 A;  1FYL A;  1QRY A;  4M3F A;  1XSX A;  2HXI A;  4I6Z A;  2E2I J;  4XRM A;  4M72 A;  3KX2 A;  1UHM A;  1RKT A;  2NVU B;  1IW7 F;  2CU7 A;  2KJB A;  1I1S A;  2RRE A;  3MZH A;  3KP3 A;  2IT0 A;  1EA3 A;  3HOS A;  4ENK A;  3DXJ F;  3S1R J;  3CUQ A;  1YW7 A;  1GT0 C;  2RQP A;  1OCR H;  3KYD B;  2IGM A;  2IGO A;  4RGS A;  5LHI A;  2G7H A;  2DOF A;  2WAQ A;  1T08 B;  5BMZ A;  3OR2 C;  1VQL I;  3GZN B;  4KDP A;  1KU9 A;  3CMY A;  2R7Q A;  2FNP A;  2MBF A;  1AKH A;  2VXD A;  1S7E A;  5C4J J;  3CME I;  2M87 A;  1HCR A;  1U78 A;  1MMA A;  5HNH A;  2IRF G;  3BG5 A;  2CSO A;  1QZZ A;  4AU7 A;  2W00 A;  1QBJ A;  3IWF A;  5LRS A;  3RDI A;  1EF4 A;  4D0P A;  4Z6Y A;  2QBY A;  3K10 A;  4GXO A;  1F1Z A;  1AOY A;  3NAU A;  3T5X A;  2JT1 A;  3L2W A;  5L3F A;  2DMN A;  1K78 B;  4Q4Z F;  2MAB A;  1MSE C;  2HQN A;  2HEO A;  2B9S A;  1U8R A;  4AWX B;  3TOA A;  1N25 A;  2ZSH B;  1WPK A;  4OU0 A;  2D45 A;  3F72 A;  1XD7 A;  5E1X A;  2ESN A;  3A0H C;  3ZR8 X;  3ZMZ A;  1SD4 A;  2MH2 A;  2MW8 A;  3RSN A;  3L1P A;  3ROU A;  1XG1 A;  3JRF A;  1MJB A;  1G3S A;  4FET A;  1LFU P;  4EM0 B;  1YG2 A;  1OJL A;  4FIS A;  3DEE A;  1MJ9 A;  2MC3 A;  3OYF A;  3OYJ A;  4GDF A;  3EQL F;  2DA6 A;  2KIQ A;  3FMQ A;  3FMR A;  2Z1D A;  1ZRF A;  2OTL I;  2L4A A;  1H9G A;  2Y0S N;  3NEU A;  4UB8 C;  5TIS C;  4IF4 A;  5ICG A;  4CXF A;  2ZJR F;  3FXJ A;  5IT9 K;  5EGO B;  1AHD P;  2HGC A;  5A2Q Z;  2XGE A;  3IKT A;  4IHX A;  1WHU A;  2CW8 A;  2ECB A;  5J40 A;  3I55 I;  2ECC A;  3LA7 A;  4PSW A;  1PP7 U;  4KIG A;  1G2H A;  3SFI A;  1BOA A;  3SQN A;  2L7Z A;  2FXA A;  4IPA A;  1X3W B;  4HA8 A;  1ETY A;  2ID3 A;  4I99 C;  5FKN A;  3FXU A;  4X1E A;  4OAZ A;  1VND A;  2XRO A;  3LQQ A;  4HLX A;  1TW3 A;  2FF4 A;  2R7V A;  2KIU A;  3HKZ A;  1B72 B;  1D0Z A;  3K1N A;  1FOW A;  5LEK A;  3PM1 A;  1IO2 A;  2LOO A;  2R5Y A;  1LDD A;  3JRI A;  2MSY A;  5J1Y A;  1DQU A;  3DPL C;  1S72 I;  4I0A A;  1BC7 C;  1YI2 I;  2J5O A;  5F64 A;  2H94 A;  3MMY B;  3WU0 A;  1K6Y A;  2CUE A;  4F93 B;  3OSG A;  2VQG A;  3OYM A;  1LEA A;  1I39 A;  3M9A A;  1VQO I;  4BY1 J;  1IXS B;  2H6C A;  3CO7 C;  3ERE D;  2R7F A;  3BCB A;  4HX4 A;  2XDV A;  3HTU A;  4RLQ A;  1RIO H;  3WTU C;  1JKP C;  1SD5 A;  1GVD A;  3WTV C;  4HST A;  3IKV A;  3C2G A;  2JPC A;  5DCM A;  4G12 A;  1QHG A;  4Y3O A;  1UJ8 A;  2Q1Z B;  5EJC A;  3TDU C;  4EGY A;  5L3C A;  4BAC A;  2M0C A;  3PO3 J;  3KET A;  2M5W A;  2HOT A;  3H5R A;  1XGN A;  1F4K A;  1CF7 B;  1OYW A;  3DU6 A;  2LSO A;  2L0K A;  4HG2 A;  2LBF A;  1U9N A;  2ZXI A;  2JVG A;  1BC8 C;  2JZY A;  3I58 A;  4IHW A;  3U2R A;  3S15 J;  2D1V A;  4LLL A;  3TDZ C;  2DBB A;  4BNC A;  2LR8 A;  2AQF A;  1MMN A;  2VPR A;  1FTZ A;  4LLG F;  2MYS A;  3HM5 A;  2LRE A;  2ZNY A;  1N78 A;  3E5X A;  1GLN A;  3P9C A;  2P81 A;  4YII A;  2W24 A;  3CUQ B;  1J0R A;  1Y8Q B;  1KU2 A;  2P5K A;  3AG3 H;  2HR3 A;  2K3P A;  4OIQ F;  4AYB A;  1N75 A;  1Z3X A;  3CDI A;  1EKE A;  2NAZ A;  4RB3 C;  1AKH B;  5JLW A;  5FJ8 J;  3K4B A;  3S1N J;  1D3Y A;  4BJT A;  2E1M B;  4XLE A;  4YRV A;  3WU1 B;  1P7I A;  5ICC A;  1XCV A;  1V5G A;  4F91 B;  1GHC A;  4WXC A;  1D8K A;  1Z9C A;  1BR1 A;  4KN4 X;  2QBY B;  3ZPL A;  3DTK A;  2JJ7 A;  2LF7 A;  5C3E J;  4EVI A;  2LKX A;  2MG4 A;  4EQQ A;  1CQT A;  2VON A;  3LFU A;  4JOM A;  3WTZ A;  1BIA A;  4I09 A;  4WWC A;  2AXL A;  1W5T A;  2QKM B;  4HQM A;  5HLG A;  2M45 A;  2NNN A;  2OU2 A;  5E3N A;  4O6J A;  4N0B A;  5DV5 A;  5IP7 J;  4DJA A;  3C1D A;  3DFG A;  1DU6 A;  3CCS I;  1A6I A;  3HDD A;  3GTJ J;  3H1C A;  1DP7 P;  5FLV A;  1OCT C;  3N97 A;  4RAG A;  4YFX F;  3R0A A;  4HX7 A;  4IJA A;  2HVS A;  3VYS B;  2IA0 A;  2PJR A;  3DF8 A;  2DOD A;  1AWC A;  2IBD A;  1SVL A;  2L3D A;  3E3V A;  3KZZ A;  2VKD A;  3BRO A;  1GV2 A;  4MIM A;  2XHK A;  4X0G A;  4PK4 A;  3C2H A;  3CMM A;  1WQ2 A;  2GA1 A;  3F6V A;  1HBX G;  3H92 A;  2FSW A;  2DO7 A;  4L18 B;  3HGY A;  3E5U A;  2TDX A;  2DT7 B;  4HEA 2;  2ZBK A;  3AFH A; 
#chains in the Genus database with same CATH homology
 3UNG C;  1WJA A;  2XF6 A;  4HNT A;  3H35 A;  1V5F A;  1SAU A;  2CV1 A;  3J7A Y;  2X51 A;  1MMG A;  2BW3 B;  3NWT A;  3ZXS A;  2F6C A;  3SYT A;  5JHF A;  3OYC A;  1WJ5 A;  2VLA A;  4XLA A;  3K4M A;  3F9K A;  4XL9 A;  2DOA A;  3SEZ A;  1X1A A;  3DTE A;  3CZ6 A;  4RLF A;  4IKF A;  4DBR A;  4EAT A;  1BR2 A;  4RMN A;  2LY2 A;  4XM3 A;  3MKW B;  1P9Q C;  3DKX A;  3W2W A;  4HPQ A;  3RPU D;  1W36 C;  1R6R A;  4F52 A;  4BL0 B;  5CPR B;  4IX7 A;  1V5E A;  2VQH A;  4CA0 A;  3HPG A;  1LFP A;  3H9Q A;  2CH0 A;  3ZGK A;  4HNU A;  4BUP A;  3VYU B;  2JA2 A;  4B43 A;  2VJJ A;  4BJ6 C;  2X6W A;  1Y56 A;  4E7K A;  2V7F A;  3S32 A;  2HU9 A;  3BC8 A;  4NQW B;  2Z2S B;  3CJQ B;  2HVQ A;  3M8J A;  3PL8 A;  3W2A A;  2JVH A;  2IS1 A;  4RM3 A;  3OL4 A;  1BR4 A;  4MLO A;  4II3 A;  3K4J A;  2ZSI B;  2OV7 A;  3I3L A;  4LG3 A;  3VSK A;  3FKJ A;  5KNL A;  3VDX A;  1OR7 C;  3OYB A;  3KYL A;  1J09 A;  2WAD A;  4XN0 A;  3AKZ A;  4DIQ A;  3SDB A;  1W36 D;  3H0D A;  1X1C A;  3RTR A;  4AVZ A;  2HDW A;  2M4G A;  3HG9 A;  3OYA A;  4KIT B;  3D5R C;  3LSK A;  2M0M A;  3DWL E;  2CW7 A;  2WB1 A;  4E7Z A;  3PNV A;  4H4K C;  3DTI A;  4E7J A;  4NC8 A;  2LBF B;  3RCO A;  1PYV A;  1SFK A;  3BG6 A;  5FRN A;  2K9L A;  4E7I A;  2MFZ A;  3VSL A;  2KPM A;  2AQE A;  4XNF A;  3OS2 A;  4XON A;  3IAS 2;  2X6Y A;  4PFP A;  4KJZ A;  2VKH A;  3CJR B;  3LMM A;  3CES A;  4BQQ A;  2IGN A;  4LIT A;  2GOX B;  2NOJ B;  3OS0 A;  4NNJ A;  4BXF A;  4IQ4 A;  3E0J B;  5KCM A;  3K4K A;  2KLO A;  1X1B A;  2P0W A;  4CUG A;  2VJ5 A;  2UUZ A;  4ZYA A;  2R7U A;  1T0F C;  2HVR A;  5HLT A;  1NG7 A;  2OUM A;  4DBQ A;  3PSF A;  3PSI A;  5HOO A;  1OLT A;  4XLF A;  4KT6 A;  1Z21 A;  4B47 A;  3PFY A;  1LKX A;  2VQL A;  2A5W A;  2XAU A;  1AA7 A;  2IXS A;  3M1C A;  2MC4 A;  2X1E A;  1DP3 A;  4XOR A;  4OWR B;  2R7W A;  3L2Q A;  2DT6 A;  1MMD A;  3AL0 C;  1N77 A;  2HPI A;  2XSJ C;  5FRM A;  3QYF A;  4CH7 A;  5KHD A;  2V26 A;  3OYD A;  4BJ5 C;  3DU5 A;  4BS9 A;  2LRD A;  4XR6 A;  3MKZ A;  2PJR B;  2CFO A;  4E6K G;  4BE2 A;  1MNE A;  4BE0 A;  3NWS A;  2QKL B;  3QYE A;  4JQF A;  1LDK B;  3OYN A;  3PJR A;  3SZG A;  1MND A;  5FRO A;  4N4O B;  4LIV A;  5HNF A;  3CP8 A;  4J01 A;  1FMW A;  2HNH A;  1TT0 A;  2RNG A;  2W4S A;  4ZC3 A;  3PNT A;  2KDO A;  1LVK A;  3LSG A;  4N4N B;  3LSM A;  4E4H A;  3EUA A;  2I8D A;  3EUH C;  2IS2 A;  3UR3 C;  2F4I A;  2R7T A;  4ZDL A;  2X1C A;  4PJJ A;  3L2U A;  4HSR A;  2UV1 A;  2XF5 A;  3S93 A;  3K4L A;  2CUZ A;  2L7K A;  4XQF A;  3HXL A;  3V42 A;  2UWM A;  2CS3 A;  2K5C A;  2JUG A;  3K70 D;  3LSH A;  3OYG A;  3KX2 A;  3HPH A;  4XN3 A;  3OYI A;  2VQC A;  2VL8 A;  3S3O A;  2RRE A;  3TL4 X;  2HQA A;  1EA3 A;  3HOS A;  2XF7 A;  4ANJ A;  2IGM A;  2IGO A;  3U21 A;  2KHM A;  2E5N A;  3HUG B;  4QPQ A;  3W2V A;  2LY1 A;  1G8X A;  2WAQ A;  3OR2 C;  3OYE A;  2WAE A;  3MD2 A;  1Z7L A;  4ZTJ A;  4U7B A;  2R7Q A;  5TGT A;  2VXD A;  2E60 A;  3EUK L;  1MMA A;  5HNH A;  2IS4 A;  3OIQ A;  2KRC A;  4AU7 A;  2W00 A;  1KON A;  3S8P A;  4P5O A;  4CCN A;  4CSW A;  1D1C A;  3E1S A;  4XKW A;  4D1Q A;  4ZDO A;  1FMV A;  3K10 A;  4LIU A;  3TMO A;  4DGW B;  3L2W A;  3I9V 2;  3AL0 B;  2IS6 A;  2L9N A;  2MAB A;  1WJD A;  1Z3Y A;  3MKY B;  2X6X A;  2VAS A;  4F3Q A;  2ZSH B;  1UAA A;  3A2K A;  2BOL A;  3PUB A;  3ZR8 X;  4BE1 A;  3RSN A;  2V6E A;  3W3C A;  1D1B A;  4KIS A;  1G59 A;  1D0Y A;  5CKT A;  2V9K A;  4FET A;  2LYC A;  4C30 A;  1YE9 A;  1X4P A;  4G6T B;  2KRH A;  4DOZ A;  2GOM A;  3DEE A;  3OYF A;  4CCJ A;  3OYJ A;  4PSX A;  4XMY A;  1QHH D;  2ZFU A;  2IGK A;  2Q2E B;  2HZD A;  2Z1D A;  3OYH A;  3FBN B;  2BVM A;  4YEJ A;  1S9H A;  2M3A A;  4BEH A;  2WA0 A;  3GBG A;  1YX5 A;  4II2 A;  4C2U A;  4P1W A;  2CW8 A;  2HPM A;  2O5R A;  3LSI A;  4PSW A;  2PMZ A;  3HOT A;  3D5S C;  1HA8 A;  2A6T A;  3IUO A;  3QOD A;  1DGR M;  3L2R A;  1X4O A;  2BW3 A;  4XOT A;  2VIX A;  4NC7 A;  4XKB A;  4F92 B;  2M7A A;  1NG6 A;  2K9M A;  3BLY A;  4HRI A;  3BG7 A;  2DJI A;  2VPL A;  1PJR A;  1MW7 A;  4OAZ A;  4PJL A;  1T95 A;  4FAS D;  2W7N A;  2Z16 A;  3K70 C;  4XLH A;  2V1N A;  4IQJ A;  2R7V A;  1JI8 A;  2WAF A;  2X85 A;  3A1Y A;  3HKZ A;  4ZJZ A;  1D0Z A;  2LOO A;  2MD0 A;  4ITV A;  3DKY A;  5LFA A;  1TZL A;  2WY8 Q;  1U0J A;  3FHN A;  3OL3 A;  1DQU A;  3KEY A;  1UG0 A;  3DPL C;  4E7H A;  3FBI B;  1BOB A;  2VXZ A;  1D0X A;  2R7O A;  3MMY B;  2L5Q A;  4BDZ A;  1K6Y A;  3HC7 A;  4F93 B;  2VQG A;  3PNY A;  3OYM A;  4E7S A;  4QPO A;  4C9Y A;  4E7L A;  2W82 A;  3BCB A;  1WFX A;  3HL2 A;  4CCK A;  2CV2 A;  2XDV A;  4RLQ A;  4R79 A;  4XOP A;  4BQO A;  4BQN A;  4HST A;  1X19 A;  4GRI A;  3C2G A;  4ZTF A;  4B3X A;  1QHG A;  2X1D A;  3D5L A;  4Y3O A;  2Q1Z B;  4CCM A;  4Y33 A;  4BAC A;  2CMP A;  1D1A A;  3H5R A;  3DU6 A;  3IP4 B;  4HG2 A;  2LH9 A;  2LBF A;  4CZC A;  1ERD A;  2ZXI A;  3FDY A;  4PFO A;  3DLA A;  2JVG A;  1WJF A;  4CCL A;  2FUG 2;  2AQF A;  3ZQQ A;  3K4N A;  3VYT B;  1MMN A;  3DPU A;  4B44 A;  3H9J A;  2KQR A;  2ELJ A;  3LL7 A;  3ONQ A;  4PJM A;  4U87 A;  2MYS A;  1WJB A;  4ZDP A;  2LRE A;  1ZEL A;  4F55 A;  3VWB A;  2CV0 A;  1N78 A;  1QU3 A;  2L2O A;  1GLN A;  1DGW Y;  3H9G A;  3S3N A;  1VZ0 A;  3BCA A;  2K3P A;  5LD2 C;  1YX3 A;  1Y6I A;  3H5A A;  4AYB A;  4BDY A;  4RM2 A;  1N75 A;  1Z3X A;  3OMY A;  2F5V A;  2VJI A;  3L2V A;  1IRX A;  3H5N A;  3K4B A;  4IZZ A;  3G2B A;  4BJT A;  2M4K A;  4HEA 2;  2E1M B;  4PUS A;  4CCO A;  4XLE A;  2KL4 A;  2KP6 A;  4YRV A;  4BGD A;  3IAM 2;  3K6G A;  4D9J A;  1V5G A;  4F91 B;  4Y4R A;  4XKC A;  1BR1 A;  2R7R A;  1WJC A;  1WJE A;  3DPT A;  4XKV A;  3OY9 A;  3DTK A;  3ZCO A;  2L9S A;  3LFU A;  2XC7 A;  4JOM A;  2CUJ A;  3OR1 C;  3QYB A;  5CQE A;  5CQG A;  2V4J C;  3VYR B;  3QOE A;  1X1D A;  2QKM B;  2DXI A;  2LC2 A;  4J00 A;  3OWT A;  2RQQ A;  2VB6 A;  2VJ4 A;  3OYK A;  4DJA A;  4C2T A;  3SEQ A;  2KZV A;  4B48 A;  3OOU A;  3RQ4 A;  5HVQ C;  2KMU A;  3OYL A;  2R7S A;  2OC6 A;  1UEL B;  2HVS A;  3VYS B;  2BVL A;  2LG4 A;  3S3M A;  3DQV C;  2PJR A;  3OIP A;  4BU2 A;  3N05 A;  3CF2 A;  1E0E A;  4PJN A;  3EPZ A;  3TBI A;  2R4G A;  2Y0S A;  2E1M C;  2VKD A;  4OAY A;  4YEL A;  3ZRG A;  4BEH B;  4PK4 A;  3C2H A;  4X0G A;  2JSP A;  2DCE A;  2ZXH A;  3CMM A;  3OS1 A;  2E5Z A;  4XLC A;  3A4C A;  3K4C A;  3CP2 A;  4NUB A;  2WY7 Q;  2R7X A;  2M7B A;  2WBM A;  2DT7 B;  2W1O A;  3AFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...