2V79A

Crystal structure of the n-terminal domain of dnad from bacillus subtilis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
MKKQQFIDMQEQGTSTIPNLLLTHYKQLGLNETELILLLKIKMHLEKGSYFPTPNQLQEGMSISVEECTNRLRMFIQKGFLFIEECEDQNGIKFEKYSLQPLWGKLYEYIQLAQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-Terminal Oligomerization Domain of Dnad Reveals a Unique Tetramerization Motif and Provides Insights Into Scaffold Formation.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords DNA REPLICATION PROTEIN DNAD
total genus 36
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2v79A00
4KYWA 2QQAA 3CTAA 5E1WA 2O0YA 5HLHA 3K2ZA 1XCVA 2LDUA 3ELKA 4LMYA 2YPRA 4ZZDA 1J2XA 3V7SA 2H27A 2IT0A 1HKSA 2Y75A 5LGUA 1DPRA 1OR7A 3ZMVA 6PAXA 5HVQC 3VOEA 1UFMA 1H9TA 1YW8A 2M45A 2FNAA 2V1XA 1IXSB 1E2XA 4BH9A 1PP7U 1MJAA 2H94A 2HKOA 1T38A 3RKWA 3RYRA 4RGXA 2FSWA 3BDDA 1FSEA 2VE8A 1UHWA 4KN4X 3GFIA 2XAHA 3CO7C 5D8LB 2ISZA 2EFWA 2WTEA 3E5XA 5JR3A 3G73A 2EFNA 3DXJF 5LGNA 2IVMA 3EYIA 4LG0A 4F7ZA 4WCGA 3TQNA 3GYHX 3BWGA 3J80K 1E17A 3DV8A 2K86A 4ENMA 4R79A 3KP4A 2PG4A 5KK1A 5DCFA 4BHPA 1R23A 1U2WA 3IC7A 1RZ4A 2JPBA 2CSOA 1R22A 3E6DA 4HV5A 2ETHA 4HX4A 4XBFA 2DLLA 3H3ZA 1WWXA 2R3SA 1S7OA 1FP2A 3ZQ7A 1W7PA 3ZMDA 5LRSA 3HTSB 1FSHA 2VODA 4EV0A 1SFEA 3P9KA 3ECOA 2FBIA 3OOPA 2XVCA 4ESJA 4G6DA 2KIFA 2HR3A 3WTSC 1A04A 2EA2A 3KEQA 3WTTC 4ASNA 1QPMA 3P7NA 2BE5F 5J8CA 3GUDA 5HLIA 1S3JA 4QWQA 5FLXZ 4I09A 3VEPA 1R7JA 2JTVA 1EH6A 1LDDA 1P6RA 2TDXA 4L9JA 2IP2A 2M87A 2P4WA 1G6NA 3CUQC 3RI4A 3WU1B 1HW2A 1R1VA 1O3TA 5F64A 4R8HA 4MTDA 3JAMZ 1F4KA 4UNOA 4CXFA 3QAHA 3KETA 1TBXA 2IA2A 4HDVA 1WI9A 3HYIA 2YX7A 3T5XA 3QRFF 4N0BA 1O3QA 1ZLJA 1Z6TA 1I1SA 3F8BA 2OZ6A 4O3MA 2VBWA 1AOYA 1QO0D 4AD9A 4PCQA 4A5MA 1U78A 2IRFG 4ETSA 5HS9A 1P92A 3ZN1A 4RGRA 1XGMA 3R0JA 5FO5A 4P9UA 3IHUA 4EM1A 2JZYA 2STTA 3QPTA 4M6YA 2EJRA 1J0RA 1LJ9A 2NS0A 4I2OA 3HSFA 4EVIA 1FLIA 4BHBA 5IT3A 1BJAA 2DBBA 4LLLA 2HZTA 3M8FA 2MLGA 5CVIA 1OYYA 1TQIA 3J7AO 2STWA 3WTUC 2E7XA 5D5WB 2Y0MA 3COAC 1D3YA 3LSTA 2BEOA 5ILSA 3EQLF 5LLQA 2DI3A 2FE3A 3ML6A 4IPAA 1R1TA 3WE2A 3E6CC 1B59A 2D2WA 4BHCA 1CGPA 1IN8A 4HX8A 1S29A 2R7DA 4RB0A 2XASA 5F1RA 1MJBA 3ERED 1WKMA 5TJJA 3FXRA 1KU9A 3DEUA 4G7ZF 3JSPA 3IWZA 2FOKA 2VT2A 4TV7A 1MZBA 1G3TA 1ON2A 2DTRA 1KQ9A 3TDUC 4O6JA 3HSEA 3O2PE 4OOIA 3IRRA 2CO5A 2W84A 1IF1A 4KT5C 4I0AA 2XV4S 3IL2A 3RKXA 4ENKA 3MWMA 2DAOA 2MBFA 1QQIA 1HKTA 3SFZA 3KCCA 4HV6A 2A6HF 1T39A 2GXGA 5HLGA 4XLPF 3GW2A 1BOAA 1I1GA 5DYMA 5L3BA 1FPQA 1HW5A 4RB2C 1TW3A 1SAXA 1B9MA 3WTVC 1PUEE 2WC2A 3Q9SA 4L9NA 1JHFA 4ON0A 3B73A 1R5HA 1SMTA 2OQRA 4ZYHA 2ESNA 3ZP5A 1JE8A 3HTUA 5CVJA 1U8RA 2WV0A 3I53A 4YG2F 1JXSA 5L3CA 1ZARA 3K0LA 1BI3A 3CUQA 2Y48A 1F1ZA 2ZXJA 3Q9VA 2P5LC 4EJUA 1HQCA 4GCVA 2W57A 5JFRA 5ED4A 3K69A 2P6SA 4HX7A 2GIVA 2O8XA 4P5OA 1X3UA 3QU6A 2A6EF 1HXDA 2QBYB 2XROA 1TQMA 5LHGA 1I6XA 2R7FA 2ZKZA 2LF8A 3KEOA 1QNTA 2GZWA 5DDGA 3IWFA 1HBXG 3FF5A 3MFKA 3M9AA 2VBYA 2AXLA 4HAMA 2JRTA 4WWCA 1K78A 2PI0A 2K02A 4RGUA 1Q1HA 1IN4A 3ROUA 2L4MA 3RPQA 2QYOA 4WXDA 1YG2A 5HS8A 2QM3A 1ZAOA 3WE3A 3AAFA 2O61A 2FBKA 3M8EA 3RPUA 2P5VA 4ZZLA 2KRFA 1U5TB 3KP2A 1WSUA 2HYFA 2YR2A 1W7PB 1BM9A 4P96A 1SD7A 4A5NA 2ZMEA 1Z7UA 3KP5A 2CFXA 4HLYA 4HYEA 4OMZA 4G7OF 1SFUA 3U9GA 2P7CB 2QVOA 1FWZA 2V1UA 3MZYA 1LVAA 2JPCA 1KU7A 2OQGA 1FBUA 4NQWA 4OINF 4ZYDA 1B6AA 3ZN0A 1KA8A 5HOOA 1IUYA 4QLCU 2RDPA 1SD4A 4MHGA 3TO6A 4YIFA 2BGCA 1PP8F 3MEXA 5IT9Z 2O3FA 5ERIA 3W6KB 4KIFA 1BN5A 1ZGAA 1Z05A 4OMYA 1GXPA 3D0SA 3I64A 3EUHA 2MH9A 1IXRC 2VBZA 3BPXA 3G3ZA 4WK8F 2ZFWA 2M1BA 2RV8A 4GO1A 2VOOA 2OD5A 2ZMEB 4KN7X 1LDJA 3QP5A 1G3YA 1K79A 3DP7A 1FP1D 3MQ0A 2FU4A 3NQOA 5FLXK 2P6TA 1L0OC 3PQJA 2A68F 1KU2A 3JAMK 1UHMA 4BAYA 4CHUA 1PDNC 5JI6A 2CYYA 1USSA 3DF8A 4MGRA 1T2KA 2VC1A 4ESBA 4IVNA 1YFHA 4AIJA 1LEAA 4Q4ZF 3WODF 5EEHA 2HKXA 5D5VB 2LSOA 1LDKB 2PMHA 4B09A 4KUMA 3ABTA 4CGZA 4KIBA 3HIFA 3F3XA 2V1DA 3R0AA 1FNNA 1YW9A 1QGPA 1XSXA 5FD5A 4BXUA 1H0MA 4HA8A 5CVUA 3WGGA 4L9TA 2E1CA 2CG4A 4UVCA 5AONA 5E8IA 3I71A 2AS5F 2H6BA 2HYGD 1TLHB 3JSOA 1FT9A 3FMSA 4M9XA 3J81K 4EJOA 2NNYA 5BOXA 1XSDA 4YFNF 1XD7A 2RNJA 4GYIA 2M5WA 3FM5A 2VXZA 1BC7C 4O5VA 2NNNA 3K9TA 2KIUA 5FD6A 3HSRA 1MGTA 1TQPA 5DD4A 2L3DA 5ILVA 2HFHA 4IHTA 2EV6A 1DDNA 2ACJA 5E1XA 3N4MA 1V3FA 3F8CA 1XGSA 1Z1DA 3I59A 5L3GA 4OIOF 2EFPA 3OV8A 2MA3A 3HRSA 2IPQX 3WGHA 1RI7A 3CUOA 2XIGA 3DPTA 2FBHA 2NAZA 4I98B 4LG0B 4S05A 2PMUA 3I54A 4WXCA 2FMLA 5FFZA 2G7HA 2J5OA 2MD5A 1T98A 3GFMA 2EB7A 2XAJA 3J80Z 1L3LA 4HF2A 3MZHA 2O6GE 3C1DA 5CJ9A 5A2QK 4OIRF 4Y17A 2RN7A 3C7JA 2RQPA 3J81Z 4N9IA 3DFGA 5H6RA 3FX3A 5JHUA 2Q0OA 1R00A 2XAQA 3H3UA 3R61A 2K4BA 5BPDA 2KJCA 2M30A 1ULYA 1YS6A 3BJAA 2YU3A 1BIAA 4D0PA 2E1NA 2HOEA 4H0EA 2A69F 4KNYA 5DUKA 3PQKA 2K7LA 4HBLA 3F22A 3F21A 1YLFA 2UZKA 5D5XB 3FMQA 3O3KA 4EGZA 5H6QA 4IRHA 1O3RA 4HZFA 5FGMA 1OPCA 4UXNA 2XKPA 2HDCA 4AVPA 3F8FA 3E3VA 1G4DA 1R1UA 4XRFA 4CZZA 4EMSA 4L5JA 2ZO4A 3TKYA 5E20A 1KQ0A 2VC0A 4L0ZB 5ICFA 1JGSA 1Z91A 1B1BA 4U0VA 3F6OA 4HF0A 4U0WA 1P4XA 4XSXF 1MD0A 4KFCA 1RIOH 4R1HA 1XGOA 3F6VA 1P4AA 3BJ6A 3HRUA 2HTJA 3E6MA 4MTEA 5DUIA 2DU9A 1XMKA 4DQ2A 5CVVA 1O7LA 3R60A 5CVRA 3BROA 1IZ1A 2EA4A 4YFKF 3ABUA 1R5GA 2OAZA 3Q5FA 1GXQA 3I58A 1HSTA 2F5CA 2NRAC 3P9CA 3LAJA 4HW0A 4RAYA 5EEGA 2EV0A 2FQ3A 1R36A 3ZMZA 1CF7A 2O03A 2QQBA 1XN7A 1HKQA 1AWCA 3K1MA 3BPVA 2MC3A 2XKOA 3DQVC 4KIGA 1ZG3A 4M9ZA 1XCBA 4I01A 2L4AA 3KP6A 4I02A 4G9YA 2ZNYA 2IA1A 4LJZF 2VE9A 2Z99A 3WG9A 3BZ6A 4OU0A 4U7DA 4RGSA 1LB2A 1O7FA 1P4WA 5LBQA 4IRGA 2IA0A 4LK0F 5L3FA 4G94A 2L54A 2KIMA 5DCMA 3BY6A 4UUVA 2PLYA 1U5TA 2QZ8A 2WWYA 1YS7A 4M71A 1TNSA 2QLZA 5DV5A 1YQAA 3EYYA 5HDGA 3RKYA 2ISYA 3TOBA 4G7HF 3CJNA 3GFLA 2CGPA 2Q2EA 2RGVA 5FFXA 3ZPLA 4NB5A 2GAUA 5D4SA 3P9IA 3HOTA 1BI0A 1UB9A 1ZREA 2FRHA 3GXOA 4P9FA 2W85A 2PBIA 3L9FA 5L3DA 3EETA 3I5UA 2L01A 2NYXA 3IKVA 3SZPA 5HDNA 2VT3A 4B8XA 1IRGA 2EFOA 4KDPA 1JHHA 2Z33A 2LF7A 4WX9A 1S7AA 3BJOA 5LHIA 4Q47A 2QUFA 2M8EA 3RJPA 3LQRA 1W4MA 4IXAA 1QZYA 4HDUA 1Y0UA 4FT8A 4KA4A 2K27A 2IW5A 4A12A 2GQQA 4L0YB 1BI2A 3B02A 3SXYA 1Z9CA 1REPC 3K1NA 3L09A 1J5YA 1O3SA 5K5RA 5ICCA 2XGXA 1C0WA 4IF4A 2D45A 1D8KA 2OBPA 2W24A 3KE2A 1FX7A 4RB1A 2ZNZA 3T1BA 1ZRFA 1DPUA 2H6CA 4WF2A 2DQRA 4ZYGA 4MQVA 4FHTA 4MQ9F 2A3SA 5D6FA 3L2CA 4U0YA 3RIRA 4IJAA 4ZYEA 3JTHA 4MNUA 3E6BA 3V4GA 2FEZA 3FM3A 1YTYA 2GXBA 1SD5A 5AIQA 4YIIA 4HF1A 4PGHA 1FZPB 2K4JA 4WXHA 5IT9K 1EH8A 2RC4A 2V9VA 3RYPA 1QZZA 2F5FA 1T0FA 3GF2A 1F9NA 3KP3A 2XAFA 1HSJA 4N9HA 3SHFA 2EWNA 3TGNA 4L5IA 5D6EA 3GLXA 2X4HA 2ZBKA 4LLGF 1D5VA 4XLNF 3HRTA 1ZG5A 4ENJA 3EDPA 2DW4A 3LA2A 3F72A 1LNWA 1ZYRF 4PZJA 1B4AA 3GO5A 1KYWA 1I27A 1IW7F 4K2EA 2DO7A 3QPHA 5HS7A 1OKRA 1ZRCA 1BI1A 1FBQA 4GXOA 4HQMA 1ONVA 3M7GA 1IN7A 5CLSA 3R4KA 1SFXA 1D8JA 2A07F 5FB2A 4CYDA 2QQ9A 2KKOA 3I4PA 1BC8C 3KP7A 2OZUA 3V7CA 4AWXB 2COMA 4EJWA 3SZTA 2V6CA 1OYWA 3I59B 4UV8A 1IXCA 5LHHA 4LFUA 1KGSA 4EJVA 4M74A 2X0LA 4FX4A 4A0YA 5HDKA 3WTYC 4YFXF 1SMYF 4A0XA 3T0YA 4U88A 1U3EM 3GWZA 1K78B 4AIKA 2PFBA 3TO9A 4CO8A 1BBYA 1IN5A 2MH2A 4JBAA 5ICGA 2H09A 2BBYA 2HQRA 3LAPA 3W6JB 1KU3A 3LFKA 1HW1A 4M73A 3SQNA 2D1HA 2CQKA 4UV9A 3REOA 5K5QA 3F8NA 1DP7P 4Q5SF 1J75A 4RS8A 2B0LA 3V8KA 1EV7A 2OU2A 1Z6RA 1ZHFA 2A5YB 3S2WA 3V7RA 2ZJ2A 3QP6A 2EK5A 2FF4A 1FBSA 1K7AA 2FXAA 1ZG1A 2ADUA 1ZN2A 3JW4A 3WGIA 4S04A 2MLKA 5BS6A 4EGYA 4I0BA 1KQ8A 3VFZA 4HOBA 3HUGA 2QWWA 1W5SA 5D8KB 3L00A 5E1ZB 2L02A 4ENNA 1MDMB 3IKTA 1TTYA 4EJTA 3V8JA 3WU0A 2RKHA 4HLXA 4A2UA 2DPUA 3GZ5A 5BQTA 5LEJA 2W25A 1GVJA 1MKMA 4M9SA 5AIPA 4KMUX 4GYGA 4P55A 4IHSA 4AIHA 1H9GA 3MCZA 2BYVE 3VODA 1YO5C 5E18F 4FX0A 3O6BB 4XSZF 2P5KA 2F2EA 5L3EA 2KJBA 3TOAA 1FYLA 3JTGA 2HGCA 2BV6A 3E5QA 4L18B 4LK1F 4LB6B 4KICA 1J9IA 3CO6C 4UVBA 2RVCA 5E17F 2ZCWA 5E8GA 4A6EA 2D1VA 5CYVA 3MAJA 1DUXC 3KLNA 3BOQA 3CDHA 3U1DA 2VBXA 4CDGA 3R6SA 2CWEA 2HS5A 4EM2A 2Z5UA 3KZYA 2Q8KA 3GX4X 3F8MA 2Z9OA 5DEQA 1KYZA 3LQQA 4JQFA 2GWRA 3M1EA 1CF7B 4ZH4F 4U7BA 3FWEA 1XGNA 2GA2A 3ULQB 3KLOA 3ZMUA 4M72A 1K6OA 1P2FA 4A6DA 3T8RA 2JT1A 4OIPF 4OIQF 4LLNA 2PEXA 3CUQB 3FXQA 2FNPA 1YW7A 3NRVA 5LGTA 3KZZA 3LA7A 1MDMA 3U2RA 3HRMA 3QOPA 2PQ8A 5BPIA 3DKWA 1O57A 5DCMB 2DK8A 2QENA 3I0TA 4EM0B 2HWVA 1ODDA 2YX4A 2DK5A 1LQ1A 5H20A 4PGGA 5A2QZ 2C6YA 1FY7A 1SD6A 5K1YA 3RDIA 2UXNA 3WTXC 3FHZA 1IN6A 3LWFA 5J8FA 3GFJA 3DPLC 5TRDA 3K1PA 2P7VB 1I5ZA 5ILUA 2G7UA 1XB4A 4RAZA 5BMZA 1RUOA 1F5TA 3GEZA 4I7HA 1NHAA 1STZA 3TDZC 1ZRDA 3TO7A 2HQNA 3N97A 3WTWC 1FC3A 1FOKA 4LGWA 5KVRA 1QBJA 3BP8A 2FMYA 3D5LA 3FXUA 2J5PA 5J6XA 1S8NA 4UVAA 4NHJA 2F5EA 2CW0F 3ZMSA 4PDKA 1VTNC 1UCRA 2YSRA 2XRNA 2DQLA 3KFWX 2PN6A 3GVAA 5D4RA 2DFIA 1W5TA 5LRRA 1U6GA 3HHGA 5DD8A 1J7KA 3RTRA 2ELHA 1OYIA 2LKPA 2VN2A 3L7WA 4HQEA 4BNCA 5LEKA 4Y15A 1B9NA 3VB2A 3PFIA 1LEBA 4A0ZA 1G3WA 1T6SA 2XAGA 5K5OA 1W7PD 2A61A 4BQAA 4JK1X 4LB5A 2F5DA 3IRQA 4L9VA 1J59A 2UWMA 1MJ9A 1ZGJA 1ZH5A 1XMAA 3LA3A 4ESFA 5D5UB 4MEYF 1IRFA 3WTZA 1USTA 4Z2YA 3QU3A 2HEOA 1S6LA 1V4RA 5JVTA 3ZMTA 2ESHA 2PJPA 1BIBA 5F6FA 2VONA 1WRJA 4RB3C 2GA1A 4KMFA 4CICA 4Q48A 4BYYA 3FMRA 3HHHA 4E70A 2VOPA 2FA5A 4M6XA 2IJLA 4DNCA 2V79A 3C18A 3F23A 1U5TC 3CLOA 1TW2A 1RNLA 2P8TA 2XUBA 2QBYA 4GGGA 1XDUA 4LD5A 1FYKA 1YIOA 1XSVA 2G9WA 3NEUA 4UHTA 3ECHA 1G3SA 3HOSA 5ICEA 4Y13A 2Z3YA 1ZLKA 2LNBA 2XHKA 1TNTA 4G6QA 4G8XA 2DT5A 1EH7A 3T8TA 1OMIA 2OA4A 3V8LA 3GZ6A 4MEXF 1GHCA 1XDSA 3FZVA 3E97A 1ON1A 2EV5A 2E7WA 1RUNA 3E5UA 1IAWA 4EQQA 2JSCA 3C3WA 3ISPA 1YYVA 3H92A 2UXXA 4IRIA 2DPDA 2HTSA 1R58A 1FYMA 1WQ2A 2EFQA
chains in the Genus database with same CATH superfamily
1VI0A 5CQEA 4V2FA 5IY5H 1APLC 2HDDA 2X6XA 1LFPA 4KYWA 2O7OA 2E60A 1HDPA 4PUSA 2QQAA 3CTAA 5E1WA 1Z3XA 2O0YA 3ABKH 5HLHA 2JA6J 3K2ZA 1XCVA 2FQ4A 4XR6A 1PUFA 3CC2I 2LDUA 1JJ6C 3ELKA 4LMYA 3CC7I 2YPRA 3VYUB 4ZZDA 1J2XA 1D0YA 3DTIA 3V7SA 2R4GA 4D5CA 2H27A 2IT0A 1HKSA 2Y75A 5LGUA 1DPRA 1OR7A 3L2VA 3ZMVA 1R9TJ 1VQ8I 1TP4A 2CQQA 6PAXA 3BR0A 5HVQC 1IC8A 2W1OA 3VOEA 2MFZA 1IDYA 3GCMA 1VQ6I 1OCTC 1UFMA 3L2WA 1H9TA 2TRTA 1YW8A 2M45A 2FNAA 2R7RA 2EZKA 3H5AA 3FKIJ 1Y8QB 2LOOA 1IXSB 2V1XA 5J4VA 1E2XA 2VXDA 4BH9A 3DKYA 1PP7U 4U87A 1MJAA 3CCJI 2COBA 4MLOA 3ZQIA 2H94A 2HKOA 1T38A 1R6RA 2LRDA 3OL4A 3RKWA 3RYRA 2JVGA 2NOJB 4RGXA 2FSWA 3BDDA 1FSEA 4B47A 3W6VA 2VE8A 1UHWA 4IKFA 4KN4X 3GFIA 1ZTRA 2XAHA 3JRCA 1JKPC 2IBDA 3CO7C 5D8LB 2ISZA 5FRNA 2DXIA 2EFWA 2WTEA 3E5XA 5K7HA 1QZEA 5JR3A 3G73A 2EFNA 3DXJF 5LGNA 1VQ5I 2IVMA 3EYIA 4LG0A 4F7ZA 1FMVA 3E7LA 1TZLA 4WCGA 1OLTA 3IH4A 3TQNA 3GYHX 2IGOA 4E4HA 2Q2EB 2LKSA 3BWGA 3J80K 1E17A 3DV8A 2K86A 3LSMA 4CUGA 3PIOF 4ENMA 3H3VK 4R79A 3KP4A 3A01B 2KQRA 2HDWA 2PG4A 5KK1A 2ZSIB 3HGGA 1QHGA 2W00A 2FJ1A 4PSXA 1YE9A 3CQZJ 5DCFA 1WH5A 4BHPA 1R23A 1U2WA 1KONA 1RZ4A 2JPBA 2CSOA 1R22A 2AXTC 3E6DA 3IC7A 3D1NI 4CYCA 1DU6A 4HV5A 2ETHA 4HX4A 3OYMA 2M0CA 2DLLA 4XBFA 3H3ZA 1WWXA 3I56I 2R3SA 2LYCA 1Y56A 5J3LA 1S7OA 1FP2A 4NUBA 3ZQ7A 1W7PA 3ZMDA 5LRSA 3ZQFA 1YJWI 1YOVB 2E1MB 3HTSB 2KZVA 1FSHA 1MH3A 2VODA 3VYRB 4EV0A 1SFEA 3LL7A 2XRLA 1F36A 3P9KA 3ECOA 4BE2A 3IAM2 5C4JJ 2FBIA 3OOPA 5FKMA 3K70D 4PSWA 5C4XJ 2XVCA 1OCOH 4ESJA 2ME0A 4G6DA 2BXYA 2H8WA 2KIFA 3A01A 4F93B 2HR3A 3WTSC 1A04A 2EA2A 2QEXI 3KEQA 2IS6A 3WTTC 4ASNA 4AC0A 1QPMA 2BXZA 3HEFA 3P7NA 3HC7A 3A4CA 2BE5F 2JVHA 3GUDA 5J8CA 3ABLH 4A69C 2AHQA 4HEA2 2Y9ZA 5HLIA 1S3JA 3S15J 4QWQA 5FLXZ 2LH9A 4I09A 1J09A 3VEPA 1EJ9A 1BJZA 3CZ6A 4BS9A 1R7JA 4JX5A 2JTVA 2LFBA 2OCCH 4BACA 3FXLA 3FIWA 1EH6A 2FOWA 1LDDA 1P6RA 4XICA 4I6ZA 2A5WA 2TDXA 5DS9A 4L9JA 2IP2A 2M87A 3AG2H 1R71A 2P4WA 3NWSA 4RLQA 1G6NA 2NOGA 3CUQC 3RSNA 2DYSH 4LIVA 4JX4A 1YJ9I 3RI4A 3WU1B 2DODA 2IS2A 3CCMI 2HVSA 3CC4I 3HJEA 1HW2A 3HGYA 1R1VA 3KYCB 1O3TA 5F64A 4II2A 3MN2A 4R8HA 4MTDA 3A1YA 3JAMZ 1F4KA 4UNOA 4CZCA 3HOUJ 3OYLA 1R4NB 1TT0A 4CXFA 2Y0SN 2N8GA 3QAHA 3H9QA 1ZKGA 2ECBA 1X1PA 3KETA 1TBXA 4CCJA 2H1LA 1WPKA 3B6CA 3VDXA 2IA2A 4HDVA 1FIAA 1WI9A 5FJ8J 4HPQA 3HYIA 1RPWA 2YX7A 3T5XA 3OYCA 3QRFF 4N0BA 5BNGA 1O3QA 4UY8I 2QKLB 1MH4A 1ZLJA 1V5EA 1Z6TA 5E3OA 1I1SA 3DCFA 3F8BA 4IL6C 2BZTA 3S93A 2NVYJ 2OZ6A 4UB8C 2VBWA 3G6EI 4O3MA 1AOYA 1QO0D 1RESA 5DTDA 4PCQA 3SFIA 4A5MA 4AD9A 1U78A 3ZQQA 2IRFG 2DDBA 3CJTB 4ETSA 3O8GA 5HS9A 3BR5A 2IEKA 2DJIA 3DLAA 4N4OB 1P92A 3ZN1A 4RGRA 2KMUA 2WB1N 1XGMA 2DYRH 3R0JA 5FO5A 4P9UA 2VQGA 3PNVA 3CCUI 3IHUA 4EM1A 2DMQA 3OR1C 2JZYA 2MGQA 2STTA 3QPTA 4M6YA 2E19A 3LSKA 4XLFA 2R5ZB 2EJRA 3NWTA 1J0RA 2X48A 1LJ9A 2DA5A 2NS0A 1AKHB 4I2OA 3HSFA 3IUOA 4HNTA 2NS8A 2WB1A 4EVIA 1FLIA 1N78A 4BHBA 3DU5A 1N75A 5IT3A 2M7BA 1BJAA 1Q1VA 2DBBA 2HZTA 3M8FA 4LLLA 2MLGA 5CVIA 1OYYA 1TQIA 3KPHA 3J7ZI 1LFUP 3J7AO 2STWA 2DFEA 3WTUC 2E7XA 5D5WB 2HXOA 2XDVA 4M3FA 2Y0SA 2Y0MA 5KAIC 3COAC 4E7KA 4CYCB 2R7XA 1S7EA 3A02A 1D3YA 3CCQI 3LSTA 2BEOA 3PUFA 5ILSA 1P9QC 3EQLF 5LLQA 2E5ZA 2MABA 2DI3A 2FE3A 3ML6A 3LSRA 4IPAA 1R1TA 2JJ7A 3WE2A 3E6CC 1IG7A 3OYBA 4YIRX 1B59A 2D2WA 4BHCA 1MW7A 1WI3A 1CGPA 1IN8A 2QGUA 4HX8A 1S29A 2R7DA 2K5CA 3Q0VA 4MO7A 4RB0A 2XASA 5F1RA 2YUSA 1MJBA 4M3BA 3ERED 2LP0A 1WKMA 5TJJA 1G59A 3FXRA 1KU9A 5JHFA 3AFHA 1OCCH 3S3MA 3DEUA 4G7ZF 1T08B 3JSPA 3IWZA 2FOKA 4UUSB 2CUFA 4XLAA 3CCVI 3HM5A 2DCEA 2JK3A 2VT2A 4FISA 4TV7A 4CCKA 3M4OJ 1MZBA 2VASA 2L0KA 1W1WE 2Y69H 1G3TA 1ON2A 1Y1VJ 2RNGA 2DTRA 2L7FP 4DBQA 3GBGA 3MD2A 1WH7A 1KQ9A 2R7TA 4W97A 3TDUC 1S72I 3H5NA 1LUJB 4O6JA 3HSEA 3O2PE 1PYVA 4OOIA 3IRRA 2CO5A 2L9RA 2W84A 1IF1A 2XF5A 4KT5C 4I0AA 4JP0A 2XV4S 5E3LA 3IL2A 2H8RA 3RKXA 2R7WA 3OS2A 3OYAA 4ENKA 3MWMA 2DAOA 5TISC 2MBFA 1QQIA 1HKTA 3SFZA 4IO9F 3KCCA 4HV6A 2A6HF 1T39A 2GXGA 5HLGA 4XLPF 3GW2A 4YEJA 1BOAA 3RQ4A 1I1GA 5DYMA 5F0CA 1IRXA 5L3BA 1FPQA 1HW5A 4RB2C 1POGA 3AG1H 3DTKA 1TW3A 1SAXA 1B9MA 4ZDPA 3WTVC 1TC3C 1PUEE 2WC2A 2Q1ZB 3Q9SA 3TW6A 4L9NA 3CMYA 2JA7J 2E5NA 2H1KA 3TBIA 3CLQA 3OOUA 1X3WB 1K83J 2EPFA 2NS7A 3S32A 1JHFA 4ON0A 1M1EB 1Z21A 3B73A 4A3IJ 1YIJI 1NG7A 1R5HA 1SMTA 2V4JC 2OQRA 3G1MA 5C3EJ 4E7HA 2NVQJ 4ZYHA 2ESNA 4E6KG 3ZP5A 1JE8A 3JRGA 3HTUA 5CVJA 1U8RA 2WV0A 2KDZA 3I53A 4YG2F 1JXSA 1X4OA 5L3CA 1ZARA 2LBFB 5EEAA 3K0LA 2B63J 1BI3A 2R92J 3CUQA 4Y4RA 2Y48A 1F1ZA 4D5FA 2ZXJA 4J19A 3Q9VA 2P5LC 3DEEA 4EJUA 2P0WA 2CH0A 1LFBA 4PJNA 2W48A 1HQCA 4GCVA 3FKJA 2W57A 2EILH 4B43A 4A3JJ 5EF6A 5JFRA 4XORA 4F92B 5ED4A 2G0EA 5B1AH 3M1CA 4ZJZA 2W82A 2OJED 2HVQA 3I55I 3K69A 1HA8A 2P6SA 4HX7A 2GIVA 2O8XA 4D7NA 4A3GJ 4P5OA 4XLCA 1X3UA 3QU6A 2A6EF 1HXDA 1Z77A 2VI6A 4ZDLA 4IX7A 4J00A 2QBYB 4AYBA 2X1EA 2K9LA 9ANTA 2CV2A 2XROA 4Z6YA 1TQMA 5LHGA 1X1BA 3N05A 1H88C 1FOWA 1I6XA 2R7FA 4BQOA 2ZKZA 3HPHA 1YRNB 2LF8A 3KEOA 3V42A 1QNTA 2KT0A 3HOXJ 1XG1A 2GZWA 5DDGA 4ZTJA 5EZHA 3IWFA 3K4LA 1HBXG 3FF5A 4C30A 2XB5A 3M3YJ 3MFKA 3M9AA 2VBYA 5JLWA 1YX5A 3DBRB 3F0CA 2AXLA 2JWTA 4AM3A 1N25A 4HAMA 2JRTA 3L1PA 1JTYA 4WWCA 4BDYA 5K7ZA 4LIUA 4DOZA 1K78A 2PI0A 2K02A 4RGUA 3ONQA 1ZQ3P 1Q1HA 2NVUB 2DN0A 1IN4A 2DT7B 2XAUA 3ROUA 2L4MA 1IDZA 3RPQA 1XTAA 3BTIA 3BR2A 2QYOA 4WXDA 5B5EC 1YG2A 2KLOA 5HS8A 2QM3A 3RQIA 1ZAOA 3WE3A 3AAFA 3K2AA 2O61A 2FBKA 3M8EA 3RPUA 2P5VA 1ETWA 2VKHA 3X2QH 1YX3A 1ETKA 4XMYA 4ZZLA 3JRDA 1R49A 2KRFA 1U5TB 3CDLA 2OV7A 3KP2A 2EIKH 1WSUA 2HYFA 3MMYB 1OISA 2YR2A 1W7PB 4FCYA 1AHDP 3I4NJ 4KJZA 1BM9A 4OAZA 2X1DA 3Q0UA 2F4OB 4P96A 1Z0XA 2KDOA 1SD7A 4A5NA 4DGWB 4B4CA 2ZMEA 1Z7UA 3KP5A 2CFXA 4HLYA 4HYEA 1D1CA 3LSGA 2HOSA 4B48A 4OMZA 4G7OF 2LTPA 1HC8A 1SFUA 4LOCA 3U9GA 2P7CB 2QVOA 2ZJPF 2LVSA 1FWZA 2V1UA 3MZYA 2L5QA 1LVAA 2OCEA 3A03A 1HF0A 2X6WA 2JPCA 1KU7A 2OQGA 1FBUA 3PSIA 4NQWA 4OINF 3K10A 1QVUA 2A6TA 3NAUA 3CDIA 4ZYDA 1B6AA 2CW8A 3QYEA 3ZN0A 2F4IA 4ZC3A 1KA8A 4X0GA 5HOOA 2KZGA 4PFOA 2CV0A 4AYBN 1IUYA 4QLCU 2VIXA 1TWFJ 1V55H 2RDPA 4IQJA 1SD4A 3OR2C 2X51A 4MHGA 3TO6A 4YIFA 2BY1A 2BGCA 3CCEI 1PP8F 3MEXA 3TL4X 2O8KA 5IT9Z 2O3FA 5ERIA 3W6KB 1SFKA 4KIFA 1HCRA 4HNVA 3DEWA 3DU6A 2LBFA 1BN5A 1ZGAA 1Z05A 4OMYA 5IP9J 1GXPA 3D0SA 3QQAA 4B44A 3I64A 2M9HA 2L2OA 4ZYAA 1JT0A 1F43A 3EUHA 4BU2A 1WHUA 2E1OA 1VNDA 2MH9A 1IXRC 2VBZA 1A6IA 1JI8A 3BPXA 4XKCA 3G3ZA 4WK8F 1I3AA 2ZFWA 5FRMA 2M1BA 3KZIC 2RV8A 4GO1A 2VOOA 2OD5A 2ZMEB 4KN7X 1LDJA 2ZFUA 4XQFA 2LK2A 3QP5A 4D9JA 1G3YA 2ZXIA 1K79A 2V6EA 3DP7A 3OS1A 1FP1D 3MQ0A 2FU4A 3NQOA 2JQ7A 3KYLA 5FLXK 3LOCA 2P6TA 1MMDA 2VLAA 1MBFA 1L0OC 3PQJA 2VB6A 2A68F 1KU2A 2ZC2A 4C9YA 3JAMK 1UHMA 4BAYA 4CHUA 4XN3A 1VQ4I 3H5RA 1PDNC 5JI6A 2CYYA 5H2FC 1DGRM 3L2RA 1B8IB 3LMMA 1USSA 3DF8A 4MGRA 4DBRA 1GLNA 2JUCA 3ESWB 1T2KA 2VC1A 3JRFA 4B1RA 3JREA 2CU7A 3D5SC 4ESBA 5JVGF 1NK2P 4IVNA 3L2UA 1YFHA 2VQHA 4AIJA 1LEAA 1JKQC 4Q4ZF 1WJEA 3S3OA 3WODF 4X6AJ 4M3DA 4NDLA 2VJ4A 2KRCA 3OL3A 1DQUA 5EEHA 1A35A 3OSGA 2HKXA 5D5VB 2LSOA 1LDKB 5B66C 2PMHA 1QA6A 4B09A 1NK3P 4E7IA 4KUMA 1AA7A 3ABTA 1PVEA 3RKQA 4CGZA 4KIBA 3HIFA 3F3XA 2V1DA 3R0AA 4PJ0C 1GDTA 4A3FJ 2BVMA 2DMTA 1FNNA 3I3LA 2VPLA 1QGPA 1YW9A 1XSXA 2WBMA 3PL8A 3W2AA 2V1NA 5FD5A 4BXUA 1H0MA 4HA8A 5CVUA 3WGGA 4L9TA 2E1CA 4PFPA 2CG4A 3MVPA 3QYFA 4UVCA 1LE8A 4KISA 4BJ5C 1I3QJ 5AONA 5E8IA 3I71A 2AS5F 1MMSA 4LG3A 4RM3A 3HOWJ 3HZJA 4BJ6C 3BQYA 2H6BA 1T95A 1X2NA 5F0HA 5FKLA 4BJTA 2HYGD 1W36C 1TLHB 3QPLA 3CMAI 3JSOA 1FT9A 5EYRA 4XRMA 4QPQA 1WJ5A 5F1JA 1K4SA 3G2BA 3FMSA 4M3GA 1U8BA 4C2MJ 1A31A 1DP3A 1Y6IA 4M9XA 3J81K 4NQWB 4EJOA 4BE1A 2NNYA 5BOXA 1XSDA 4YFNF 1XD7A 5EG0A 2RNJA 1MBGA 1FJLA 4GYIA 1BOBA 2NXNB 3PO2J 2X6OA 2M5WA 3FM5A 3JCUC 2VXZA 1QHHD 2WY7Q 1BC7C 4O5VA 2NNNA 3K9TA 1MNEA 2KIUA 5FD6A 3HSRA 4CCLA 1MGTA 2VPRA 3UKGA 4RLFA 1TQPA 2BY0A 5DD4A 2L3DA 4IHXA 5ILVA 2HFHA 2KIQA 4IHTA 3C2HA 2QF7A 2EV6A 4PJJA 4Y3OA 1X1AA 1DDNA 2ACJA 1WJDA 1OJLA 3CMMA 5E1XA 3N4MA 1V3FA 2VQLA 2I5UA 1NH3A 4RDUA 3F8CA 1XGSA 1Z1DA 3I59A 4IZZA 2D5VA 5L3GA 3J7YJ 1MMNA 2R5YA 3JRAA 4C3JJ 3OIOA 3W2VA 4OIOF 1MNMC 1Y39A 2EFPA 2DMUA 4BKXA 4HG2A 3OV8A 2ZSHB 2MA3A 2DA6A 3HRSA 2IPQX 3WGHA 2WADA 1RI7A 2PJRA 3CUOA 2XIGA 3DPTA 2FBHA 2VUMJ 2NAZA 2IGKA 3OIPA 4I98B 5J47A 1JTXA 1WFXA 3BG3A 4XLHA 2XF6A 3GZNB 3OS0A 4LG0B 2E2JJ 3GTGJ 4N4NB 4S05A 2PMUA 4DYQA 3I54A 5E3NA 3S16J 2E71A 4WXCA 2FMLA 5FFZA 2KRHA 4AIDA 2G7HA 2J5OA 2MD5A 1BW5A 1T98A 3GFMA 2EB7A 2XAJA 3J80Z 1XPXA 1L3LA 4HF2A 3MZHA 2O6GE 3M07A 2GOMA 4Y33A 4CA0A 3C1DA 2OC6A 4IEJA 5CJ9A 5A2QK 4OIRF 3ZOBA 2K3FA 4Y17A 2RN7A 3AKZA 3C7JA 1A6QA 1BR2A 2RQPA 1SAUA 3J81Z 4N9IA 2VKVA 2KHMA 2LREA 3DFGA 5H6RA 3ZR8X 3FX3A 3AL0C 2L7KA 4DW6A 4MIMA 5JHUA 1V5GA 3CP8A 2Q0OA 3VYTB 1R00A 1Y1WJ 1E3OC 2K40A 2XAQA 2DTZA 3H3UA 3FHNA 1XC5A 3R61A 2K4BA 5IOYA 5BPDA 2KJCA 2M30A 1ULYA 5EZGA 1YS6A 3CCSI 1ETXA 3BJAA 2YU3A 3I9V2 1K6YA 1BIAA 4D0PA 2E1NA 2XSJC 2HOEA 1SC7A 1ZELA 4H0EA 3A2KA 4ANJA 1JUSA 2A69F 2WA0A 4KNYA 3GTOJ 3Q0WA 5DUKA 3PQKA 2K7LA 3EUAA 5IYBJ 4HBLA 3F22A 1RRJA 3F21A 1YLFA 1PUFB 2UZKA 5M5XJ 3ERMA 5D5XB 4FE7A 3FMQA 1RKTA 3O3KA 4EGZA 5H6QA 4XK4A 1VQLI 4IRHA 1O3RA 4IHVA 4HZFA 1WJCA 4XLEA 2IS1A 5FGMA 5GAHJ 4S0HB 3BCBA 2KL4A 1OPCA 3S2DJ 1JT6A 4UXNA 2XKPA 1X1CA 5IP7J 2HDCA 1X19A 4AVPA 5K7FA 1OFCX 5DM7F 4HRIA 2IS4A 5CQGA 2KPMA 3F8FA 1SEUA 3E3VA 1G4DA 1R1UA 3CMEI 1T0FC 4E7JA 4XRFA 4CZZA 3OYHA 4EMSA 1E3PA 4ABZA 4L5JA 1W36D 4DIQA 2ZO4A 1D0ZA 2ICWG 3TKYA 5E20A 1KQ0A 2VKDA 1OCZH 2VC0A 1MBJA 5ICFA 4L0ZB 1JGSA 3FXKA 1AKHA 1ETOA 1Z91A 2V7FA 1B1BA 4U0VA 3F6OA 4PJLA 3HB9A 2GIZA 4HF0A 2HYJA 4U0WA 2R7VA 3HUGB 2A05A 1P4XA 4XSXF 1MD0A 4DZJA 1VQOI 4KFCA 2HOTA 1RIOH 1S5LC 2LMDA 2OPTA 3BT9A 4R1HA 4YELA 1XGOA 3F6VA 2O5RA 4XOTA 1B72B 4J01A 1KZHA 1ERDA 1P4AA 2CQXA 3BJ6A 1OQYA 5IPAA 1WCMJ 3HRUA 2HTJA 4OWRB 2EIMH 3E6MA 4MTEA 3K4NA 3OYDA 3BR1A 5DUIA 2DU9A 1VQ7I 2CFOA 4HSTA 1XMKA 4DQ2A 4IOAF 5CVVA 2AQFA 4BL0B 1UAAA 1O7LA 3MKZA 1W0TA 1U9NA 2GXAA 3R60A 2QCOA 3BG7A 5CVRA 4BE0A 2XB0X 3BROA 3K70C 1IZ1A 4AU7A 2EA4A 4YFKF 2M7AA 3ABUA 1QU3A 4A3DJ 2OTJI 1R5GA 3LNQA 2OAZA 4XIDA 2LY1A 1QVTA 3Q5FA 2KFDA 1GXQA 4RAGA 3I58A 5FLMJ 2DOEA 1HSTA 2F5CA 3DKXA 3G4SI 4BEHB 2NRAC 2DMNA 1K61A 3P9CA 3LAJA 2WV1A 3AG3H 2QA4I 3HOYJ 2M3AA 3DPUA 3HDDA 1MIJA 4HW0A 4QTRA 3CD6I 3ZGKA 2EQRA 4RAYA 2M0MA 5EEGA 2EV0A 4KITB 2FQ3A 3HXLA 5HNFA 1I39A 2V9PA 1Z7LA 2K3PA 3IH3A 4II3A 1R36A 4GRIA 3ZMZA 1CF7A 2W7NA 2O03A 2LY9A 2LKXA 4ITVA 2QQBA 1XN7A 4BUPA 1HKQA 2WAQA 1AWCA 3K1MA 2VJJA 3SZGA 3OYNA 3BPVA 3QYBA 1H8AC 2I8DA 1HLVA 1ZR4A 3RZOJ 3H1CA 2LG4A 2MC3A 2XKOA 3DQVC 4KIGA 1ZG3A 1W5CC 4M9ZA 1XCBA 4I01A 1ORKA 2L4AA 3KP6A 3BR6A 3JRBA 4I02A 4G9YA 3J7AY 2ZNYA 2IA1A 4JYKA 4LJZF 4RBOA 2VE9A 2Z99A 2CMPA 3WG9A 1XX5A 3BZ6A 4OU0A 4U7DA 4RGSA 1LB2A 3S14J 3ZQLA 3FXJA 1O7FA 3HKZA 3FISA 1P4WA 1UG0A 5LBQA 4C3IJ 3KYDB 4IRGA 2IA0A 4LK0F 5L3FA 4G94A 2L54A 2R7SA 2KIMA 5DCMA 3AL0B 3BY6A 1GV2A 3PSFA 2PLYA 2CS3A 4UUVA 2XSDC 3GMEA 4CCNA 1U5TA 2K85A 2QZ8A 2LD5A 4XKVA 2WWYA 1YS7A 1GUUA 1TNSA 4M71A 4PK4A 4NNJA 2QLZA 3HPGA 4UUSA 5DV5A 1YQAA 3MZ8A 5GAGJ 1RR7A 3EYYA 2DA3A 5HDGA 3RKYA 2ISYA 3TOBA 4G7HF 2B7EA 3CJNA 3GFLA 3P5JA 2CGPA 2Q2EA 3OY9A 2RGVA 1B8IA 2HU9A 5FFXA 3ZPLA 4L5EA 4NB5A 5B1BH 2GAUA 3CCLI 1X1DA 2HI3A 5D4SA 2DFHA 3P9IA 2E34A 3HOTA 2MD0A 1BI0A 1TL8A 1UB9A 1ZREA 2FRHA 3GXOA 1TWCJ 2JRMA 4P9FA 4HNUA 2DJNA 2W85A 4CCMA 2PBIA 1EKEA 1MBEA 1UMQA 3L9FA 5L3DA 3EETA 3I5UA 2L01A 2NYXA 3IKVA 3SZPA 5HDNA 2VT3A 3DTEA 4B8XA 1IRGA 2EFOA 4KDPA 4Y7NJ 1JHHA 3GTPJ 2ZXHA 5FLVA 4E7SA 2HPIA 2Z33A 2LF7A 4FTHA 2OF7A 4WX9A 2YS9A 1S7AA 2X85A 3BJOA 1YITI 5LHIA 3ASNH 4Q47A 2QUFA 4QIWN 2FX0A 3FDYA 2RQQA 2FUG2 2M2EA 2M8EA 3RJPA 3GLLA 3LQRA 2DA1A 4XKWA 3IP4B 1W4MA 5IP6A 3GTMJ 3QWLA 4RMNA 1E0EA 2L9NA 1DGWY 4XKBA 4IXAA 1QZYA 1BR1A 4NC6A 4HDUA 1Y0UA 1LVKA 4FT8A 4F91B 1TWHJ 4KA4A 2K27A 2IW5A 2E35A 4A12A 2GQQA 3W2WA 4L0YB 1YI2I 1VQPI 1BA5A 4JOMA 1BI2A 5LFAA 1P7IA 4DJAA 3SEZA 3B02A 2ECCA 3IAS2 3SXYA 3VYSB 3OYKA 4BQNA 3K1NA 1V54H 2M8GX 1Z9CA 1REPC 4XOPA 3OIQA 3L09A 1J5YA 1TWGJ 3IH2A 2K9QA 1O3SA 5K5RA 5ICCA 2JA5J 2XGXA 1C0WA 4IF4A 3ZQHA 2D45A 1DU0A 1D8KA 2OBPA 3PM1A 3OYGA 2W24A 3KE2A 2ZJRF 5EGOA 1FX7A 1MMAA 4RB1A 2ZNZA 1TT5B 2QSGX 2X9DA 1VQKI 4NBQA 3T1BA 1ZRFA 3JRIA 1DPUA 2CRGA 2H6CA 4WF2A 2DQRA 3K7AJ 4ZYGA 3VWBA 3CJRB 2MW8A 4MQVA 4FHTA 4MQ9F 1YJNI 2A3SA 2PJRB 3CP2A 5D6FA 3L2CA 4U0YA 3RIRA 4IJAA 2F6CA 4ZYEA 3JTHA 4MNUA 3E6BA 3V4GA 3S1RJ 2FEZA 1CQTA 1QRYA 2IXSA 3FM3A 4BY1J 5CPRB 1VQNI 5M3FJ 1YTYA 2GXBA 1SD5A 2LC2A 5KHDA 5AIQA 4YIIA 1GVDA 4HF1A 4PGHA 2IAIA 1D5YA 2JSPA 2K4JA 4WXHA 1FZPB 5IT9K 2F48A 1EH8A 2RC4A 2V9VA 2XF7A 3RYPA 1QZZA 3GF2A 2F5FA 1T0FA 2L9SA 1F9NA 5F0FA 3KP3A 3BCAA 2VL8A 3BZKA 2XAFA 1D1AA 1HSJA 2PMZN 1VFCA 2Z1DA 4N9HA 3LFUA 3SHFA 5KNLA 2EWNA 3TGNA 4L5IA 5D6EA 1RETA 2VJ5A 4CSWA 3GLXA 5IYDJ 2X4HA 2ZBKA 4LLGF 3E1SA 1D5VA 4XLNF 3LSHA 2K9MA 1H89C 3BC8A 1UJ8A 3HRTA 1ZG5A 4ENJA 3EDPA 2DW4A 3MKWB 3LA2A 4X1EA 3F72A 1LNWA 1ZYRF 1VF9A 4PZJA 1B4AA 1ETQA 3GO5A 2MYSA 1KYWA 2WAFA 1I27A 3IV5A 5J1UA 1IW7F 4K2EA 3RPUD 1R5ID 1OR7C 4BQQA 3PJRA 2BY2A 1RKWA 3ZQGA 3H9GA 2RREA 3BLYA 2DO7A 2JUGA 3QPHA 5HS7A 1OKRA 1ZRCA 1BW6A 2V9KA 1BI1A 1FBQA 3H9JA 1D1BA 4GXOA 4HQMA 3EUHC 3S8PA 1WJFA 1ONVA 4G6TB 1SANA 1XMXA 3M7GA 1IN7A 2R5ZA 5CLSA 3R4KA 1SFXA 1D8JA 1U0JA 2A07F 2HNHA 5FB2A 4CYDA 4ZTFA 1MSFC 1MMGA 1TWAJ 2QQ9A 4Y52J 2KKOA 2BW3B 3I4PA 1I6HJ 5DM6F 1BC8C 3EPZA 2IGMA 3KP7A 3U21A 3TP0A 2OZUA 3FXMA 5IOZA 3V7CA 4AWXB 2COMA 5HLTA 2BHZA 1PJRA 1SVOA 4F3QA 5GTHC 4EJWA 3SZTA 4IHWA 1FTZA 2V6CA 1OYWA 3H0GJ 1JGGA 3BR3A 1G8XA 2MC4A 3K6GA 3I59B 3KEYA 4UV8A 1IXCA 5LHHA 4LFUA 1KGSA 4A3CJ 1MSEC 4EJVA 4QPOA 4M74A 2X0LA 4FX4A 2EBIA 4A0YA 5HDKA 3PO3J 3WTYC 4YFXF 1JUPA 1SMYF 2E36A 4A0XA 2GLOA 2X1CA 3T0YA 4UUTA 4D1QA 4U88A 1U3EM 3GWZA 1LPQA 3DWLE 1K78B 4AIKA 2PFBA 3TO9A 3ZCOA 4CO8A 3O8HA 2L7MP 2L7ZA 1JUMA 1BBYA 1OCPA 1IN5A 3CESA 4B3XA 5KAFC 2MH2A 1QPIA 4JBAA 5ICGA 1UHSA 3S1QJ 2H09A 3JR9A 2BBYA 2HQRA 1EF4A 3LAPA 3W6JB 1KU3A 2WAEA 3LFKA 5HNHA 1HW1A 4M73A 3SQNA 3KIOA 2EZLA 2D1HA 2CQKA 4UV9A 3HOVJ 3REOA 4KT6A 3OYFA 5K5QA 3H35A 3F8NA 1DP7P 4Q5SF 2ME6A 1J75A 4C2UA 5M5YJ 1WVRA 4RS8A 2B0LA 3V8KA 4F55A 1EV7A 4FASD 1LE8B 3K4BA 1S9HA 1HDDC 3FK6A 3K4JA 2HXIA 2OU2A 2R93J 1Z6RA 1T33A 1ZHFA 3PUBA 2A5YB 2CQ7A 3S2WA 2OTLI 3S17J 3V7RA 2ZJ2A 3QP6A 2EK5A 2FF4A 3VSLA 4BBRJ 1FBSA 1K7AA 1RR8C 2FXAA 2R7QA 1ZG1A 4GDFA 2ADUA 1ZN2A 3JW4A 4M3EA 5GAEJ 1ENHA 3WGIA 4S04A 1ZK8A 3FBNB 2MLKA 5BS6A 4EGYA 2RAEA 2DA7A 5J1YA 4I0BA 2NVTJ 1KQ8A 3Q3SA 2BY3A 1SFOJ 2BVLA 4A3EJ 3VFZA 4V19K 1P7JA 4HOBA 3HUGA 3OYEA 2QWWA 1W5SA 5D8KB 3L00A 5E1ZB 2L02A 2CJJA 4ENNA 1IO2A 2Y31A 3IKTA 1MDMB 1TTYA 4EJTA 3LSPA 5FKOA 2R5YB 3V8JA 2QSFX 3TW7A 3CF5F 4BY7J 4M6VA 3WU0A 3SJMA 2RKHA 4HLXA 2EZIA 3ASOH 4A2UA 2OUMA 2DPUA 2XC7A 3BG9A 2ZJQF 2Y9YA 3GZ5A 5BQTA 5LEJA 2E1MC 2AO9A 2W25A 1GVJA 1X4PA 1MKMA 1SVMA 4M9SA 1AU7A 5AIPA 2B9SA 4KMUX 4GYGA 4P55A 4I99C 4IHSA 4AIHA 2IGNA 3BTCA 1H9GA 4XNFA 3MCZA 2BYVE 3RZDJ 3VODA 1YO5C 1WJBA 2R7ZJ 5E18F 4FX0A 3O6BB 4AVZA 4XSZF 3SDBA 1UG2A 2P5KA 4E7LA 2F2EA 5L3EA 3U1KA 1O4XA 2KJBA 2CV1A 4W1UA 3TOAA 2UUZA 2X6YA 5E79C 1FYLA 3JTGA 2HGCA 2BV6A 3E5QA 4L18B 4LK1F 1YRNA 4LB6B 2Z2SB 3I4MJ 4RM2A 4KICA 1J9IA 3VSKA 4OAYA 3CO6C 2EINH 3GTQJ 1FEXA 4UVBA 2RVCA 4FETA 5J4YA 5E17F 2QQ8A 4A3MJ 2PMZA 2ZCWA 3DLLF 2ID6A 5E8GA 2KP6A 4BDZA 4A6EA 2D1VA 5CYVA 3MAJA 1DUXC 5M5WJ 3KLNA 3PNYA 4BBSJ 3WHCA 3BOQA 3CDHA 3U1DA 2VBXA 2ID3A 2PX9A 3WU2C 2HPMA 4IOCF 1E3HA 4CDGA 4XRSG 3R6SA 2CWEA 2HS5A 4BGDA 4P1WA 4EM2A 2E2HJ 2Z5UA 3KZYA 2Q8KA 3GX4X 2MG4A 1FOYA 3F8MA 3FXOA 4UB6C 4LITA 2TCTA 1WZ2A 2Z9OA 5DEQA 3ZRGA 1KYZA 3LQQA 4JQFA 2GWRA 3M1EA 1X2MA 1IUFA 4ZH4F 5TGTA 4U7BA 3PIPF 3FWEA 5FROA 5IYCJ 1CF7B 3FBIB 1WGXA 2JA8J 1XGNA 3B6AA 1N77A 2GA2A 2XGDA 3G1LA 2BOLA 3ULQB 2AQEA 3CCYA 1IRZA 1IJWC 1YHQI 3KLOA 3ZMUA 1BR4A 2Y30A 4M72A 1K6OA 4FE4A 1P2FA 3NARA 4A6DA 3S1NJ 5GPAA 3OWTA 3T8RA 2R0QC 2JT1A 2XPUA 1NG6A 1ZGWA 1U9OA 3SYTA 2CW7A 5F27A 1JKRC 4OIPF 4OIQF 5J40A 4E7ZA 4LLNA 2PEXA 3CUQB 1ETYA 2F4MB 3FXQA 2GBYA 4AUXA 1FIPA 2FNPA 4PJMA 1YW7A 3NRVA 5LGTA 3KZZA 2Y2ZA 3BQZA 3LA7A 4XRSA 4XL9A 1MDMA 5M3MJ 3BZCA 2HOAA 3U2RA 3HRMA 3QOPA 2PQ8A 3ZXSA 5BPIA 3DKWA 1O57A 4A3BJ 3BTJA 5DCMB 2W4SA 2DK8A 2K9SA 4DYCA 2QENA 3MKYB 3I0TA 2LR8A 3HL2A 4EM0B 2HWVA 1ODDA 1ACIA 2YX4A 3MKLA 1B72A 1OCRH 3BG6A 2L9VA 1X58A 3QODA 3TMOA 2DK5A 1LQ1A 3L2QA 5H20A 4PGGA 1SVLA 5E3MA 5A2QZ 2C6YA 3JRHA 4IQ4A 4GFBA 1FY7A 1SD6A 2DT6A 2UV1A 5K1YA 3UR3C 5GPCA 3GTKJ 4G12A 3RDIA 2LLKA 2UXNA 3WTXC 3FHZA 1IN6A 2HQ5A 3LWFA 1UELB 5EJCA 5J8FA 4A3LJ 3GFJA 3DPLC 4IHYA 4C2TA 3G1OA 2DOAA 1D0XA 3WG7H 5TRDA 1Y8RB 2VQCA 3TP3A 5GADJ 5HODA 2R7UA 3K1PA 1EA3A 2P7VB 1I5ZA 5FKKA 5ILUA 3A0BC 3BTLA 4A3KJ 4BXXJ 2G7UA 1XB4A 2BW3A 4I76A 3FK7A 4RAZA 3TEDA 3DBHB 4NC8A 5BMZA 4XONA 3C2GA 1RUOA 1F5TA 3GEZA 3OMYA 4I7HA 1NHAA 1STZA 3TDZC 1ZRDA 3TO7A 2HQNA 3OSFA 3N97A 3WTWC 2M4GA 2QSHX 1FC3A 2CUJA 1FOKA 2MSYA 4LGWA 5KVRA 3CCRI 3HKZN 3BP8A 2FMYA 1QBJA 3LSJA 4EATA 3D5LA 3S3NA 2O9LA 3S1MJ 3FXUA 2J5PA 2Z16A 4BEHA 3E0JB 4JX6A 2EZHA 1A36A 5J6XA 1S8NA 4UVAA 4NHJA 2F5EA 1JJ8C 2CW0F 3A0HC 2JA2A 3W3CA 3ZMSA 4PDKA 1VTNC 1UZCA 3SEQA 1UCRA 2YSRA 3KX2A 2HVRA 1LKXA 2WY8Q 2XRNA 3RCOA 2DQLA 3KFWX 2PN6A 3K4CA 1FTTA 3GVAA 5D4RA 1Z67A 2DFIA 4CCOA 1W5TA 5LRRA 3OYIA 1U6GA 1BL0A 3GTLJ 3HHGA 4QSHA 5DD8A 4CH7A 1J7KA 3CJQB 2P81A 2ZXWH 3RTRA 4A93J 2ELHA 1OYIA 2EH3A 2VN2A 2LKPA 1Y0NA 2BHYA 3L7WA 1I50J 2GOXB 3OYJA 1NTCA 1VZ0A 5FKNA 1HOMA 4NC7A 4HQEA 4BNCA 1GV5A 2FD5A 3ABMH 5JLXA 4DZPA 1VQMI 5LEKA 4Y15A 1B9NA 3HG9A 3VB2A 2HQAA 3PFIA 2YU9J 1LEBA 4A0ZA 1G3WA 1T6SA 4C3HJ 1MBKA 2XAGA 5K5OA 1W7PD 2A61A 4BQAA 5C44J 4JK1X 4LB5A 1Z3YA 1ETVA 2F5DA 3GTJJ 2DA2A 3M8JA 3QPSA 4V2GA 4L9VA 5GTIC 3K4KA 3K4MA 5EG0B 4D7MA 3IRQA 2E2IJ 1IV8A 1J59A 2UWMA 1MJ9A 2CUEA 3S2HJ 1ZGJA 3PFYA 1W0UA 3G71I 2DOFA 1RC9A 2ZMEC 1ZH5A 4H4KC 1XMAA 3LA3A 1GT0C 4ESFA 5D5UB 2F5VA 3WHBA 4MEYF 1IRFA 5EDNA 3WTZA 3H0DA 1USTA 4Z2YA 3QU3A 2HEOA 1MBHA 1S6LA 3BG5A 1V4RA 5F04A 4YRVA 1IGNA 3VPRA 5F08A 5JVTA 3ZMTA 1K4TA 2ESHA 2PJPA 1BIBA 5F6FA 2VONA 1WRJA 3ZQCA 4F52A 4RB3C 5LD2C 3LSIA 4DYRA 1FMWA 2GA1A 2K9NA 3DBLB 4KMFA 4CICA 4XN0A 4Q48A 4BYYA 3FMRA 4ZDOA 3SDGA 3UNGC 3HHHA 2DFFA 4E70A 2FA5A 2VOPA 4M6XA 2XPWA 2IJLA 2XPVA 1X3ZB 3F9KA 3PNTA 4DNCA 1ITYA 2V79A 4B3AA 3C18A 3F23A 4MFDA 2NVXJ 1U5TC 3CLOA 1A5JA 1TW2A 1RNLA 2P8TA 2XUBA 2QBYA 4FQGA 4RAFA 4XM3A 2GM4A 4MFEA 4GGGA 1XDUA 4LD5A 1FYKA 1YIOA 1XSVA 2G9WA 2VJIA 3D5RC 3H36A 1FOXA 3NEUA 4UHTA 3EUKL 3ECHA 1G3SA 3HOSA 3C2BA 3HBLA 5ICEA 1XS9A 4Y13A 2Z3YA 1T8IA 5J1RA 1ZLKA 2LNBA 2XHKA 1TNTA 4G6QA 2XGCA 4G8XA 2DT5A 2JN6A 2VKEA 2JMWA 1WJAA 1G2HA 5KCMA 2DMPA 5GP9A 1EH7A 3T8TA 1OMIA 2OA4A 3QOEA 2ZB9A 2WAQN 3V8LA 2HZDA 3GZ6A 5EGOB 1R4MB 2M4KA 2M34A 4MEXF 3CF2A 2DA4A 2V26A 2LY2A 1GHCA 1XDSA 3FZVA 3E97A 1T56A 1ON1A 2ELKA 2EV5A 2I10A 2ELJA 2CUZA 4BXFA 4RA2A 2XGEA 5CKTA 2E7WA 1RUNA 3HOZJ 1IV6A 3E5UA 1IAWA 3AG4H 4EQQA 2JSCA 1MNDA 3C3WA 3ISPA 2CQNA 1YYVA 2EIJH 1JKOC 3H92A 4HSRA 2UXXA 4IRIA 2R7OA 2DPDA 2HTSA 5B3SH 1R58A 2KISA 1ZR2A 1VQ9I 2QKMB 2DDAA 1V5FA 4EEFG 1FYMA 1WQ2A 2EFQA
chains in the Genus database with same CATH topology
4KYWA 2QQAA 3CTAA 5E1WA 2O0YA 5HLHA 3K2ZA 1XCVA 2LDUA 3ELKA 4LMYA 2YPRA 4ZZDA 1J2XA 3V7SA 2H27A 2IT0A 1HKSA 2Y75A 5LGUA 1DPRA 1OR7A 3ZMVA 6PAXA 5HVQC 3VOEA 1UFMA 1H9TA 1YW8A 2M45A 2FNAA 2V1XA 1IXSB 1E2XA 4BH9A 1PP7U 1MJAA 2H94A 2HKOA 1T38A 3RKWA 3RYRA 4RGXA 2FSWA 3BDDA 1FSEA 2VE8A 1UHWA 4KN4X 3GFIA 2XAHA 3CO7C 5D8LB 2ISZA 2EFWA 2WTEA 3E5XA 5JR3A 3G73A 2EFNA 3DXJF 5LGNA 2IVMA 3EYIA 4LG0A 4F7ZA 4WCGA 3TQNA 3GYHX 3BWGA 3J80K 1E17A 3DV8A 2K86A 4ENMA 4R79A 3KP4A 2PG4A 5KK1A 5DCFA 4BHPA 1R23A 1U2WA 3IC7A 1RZ4A 2JPBA 2CSOA 1R22A 3E6DA 4HV5A 2ETHA 4HX4A 4XBFA 2DLLA 3H3ZA 1WWXA 2R3SA 1S7OA 1FP2A 3ZQ7A 1W7PA 3ZMDA 5LRSA 3HTSB 1FSHA 2VODA 4EV0A 1SFEA 3P9KA 3ECOA 2FBIA 3OOPA 2XVCA 4ESJA 4G6DA 2KIFA 2HR3A 3WTSC 1A04A 2EA2A 3KEQA 3WTTC 4ASNA 1QPMA 3P7NA 2BE5F 5J8CA 3GUDA 5HLIA 1S3JA 4QWQA 5FLXZ 4I09A 3VEPA 1R7JA 2JTVA 1EH6A 1LDDA 1P6RA 2TDXA 4L9JA 2IP2A 2M87A 2P4WA 1G6NA 3CUQC 3RI4A 3WU1B 1HW2A 1R1VA 1O3TA 5F64A 4R8HA 4MTDA 3JAMZ 1F4KA 4UNOA 4CXFA 3QAHA 3KETA 1TBXA 2IA2A 4HDVA 1WI9A 3HYIA 2YX7A 3T5XA 3QRFF 4N0BA 1O3QA 1ZLJA 1Z6TA 1I1SA 3F8BA 2OZ6A 4O3MA 2VBWA 1AOYA 1QO0D 4AD9A 4PCQA 4A5MA 1U78A 2IRFG 4ETSA 5HS9A 1P92A 3ZN1A 4RGRA 1XGMA 3R0JA 5FO5A 4P9UA 3IHUA 4EM1A 2JZYA 2STTA 3QPTA 4M6YA 2EJRA 1J0RA 1LJ9A 2NS0A 4I2OA 3HSFA 4EVIA 1FLIA 4BHBA 5IT3A 1BJAA 2DBBA 4LLLA 2HZTA 3M8FA 2MLGA 5CVIA 1OYYA 1TQIA 3J7AO 2STWA 3WTUC 2E7XA 5D5WB 2Y0MA 3COAC 1D3YA 3LSTA 2BEOA 5ILSA 3EQLF 5LLQA 2DI3A 2FE3A 3ML6A 4IPAA 1R1TA 3WE2A 3E6CC 1B59A 2D2WA 4BHCA 1CGPA 1IN8A 4HX8A 1S29A 2R7DA 4RB0A 2XASA 5F1RA 1MJBA 3ERED 1WKMA 5TJJA 3FXRA 1KU9A 3DEUA 4G7ZF 3JSPA 3IWZA 2FOKA 2VT2A 4TV7A 1MZBA 1G3TA 1ON2A 2DTRA 1KQ9A 3TDUC 4O6JA 3HSEA 3O2PE 4OOIA 3IRRA 2CO5A 2W84A 1IF1A 4KT5C 4I0AA 2XV4S 3IL2A 3RKXA 4ENKA 3MWMA 2DAOA 2MBFA 1QQIA 1HKTA 3SFZA 3KCCA 4HV6A 2A6HF 1T39A 2GXGA 5HLGA 4XLPF 3GW2A 1BOAA 1I1GA 5DYMA 5L3BA 1FPQA 1HW5A 4RB2C 1TW3A 1SAXA 1B9MA 3WTVC 1PUEE 2WC2A 3Q9SA 4L9NA 1JHFA 4ON0A 3B73A 1R5HA 1SMTA 2OQRA 4ZYHA 2ESNA 3ZP5A 1JE8A 3HTUA 5CVJA 1U8RA 2WV0A 3I53A 4YG2F 1JXSA 5L3CA 1ZARA 3K0LA 1BI3A 3CUQA 2Y48A 1F1ZA 2ZXJA 3Q9VA 2P5LC 4EJUA 1HQCA 4GCVA 2W57A 5JFRA 5ED4A 3K69A 2P6SA 4HX7A 2GIVA 2O8XA 4P5OA 1X3UA 3QU6A 2A6EF 1HXDA 2QBYB 2XROA 1TQMA 5LHGA 1I6XA 2R7FA 2ZKZA 2LF8A 3KEOA 1QNTA 2GZWA 5DDGA 3IWFA 1HBXG 3FF5A 3MFKA 3M9AA 2VBYA 2AXLA 4HAMA 2JRTA 4WWCA 1K78A 2PI0A 2K02A 4RGUA 1Q1HA 1IN4A 3ROUA 2L4MA 3RPQA 2QYOA 4WXDA 1YG2A 5HS8A 2QM3A 1ZAOA 3WE3A 3AAFA 2O61A 2FBKA 3M8EA 3RPUA 2P5VA 4ZZLA 2KRFA 1U5TB 3KP2A 1WSUA 2HYFA 2YR2A 1W7PB 1BM9A 4P96A 1SD7A 4A5NA 2ZMEA 1Z7UA 3KP5A 2CFXA 4HLYA 4HYEA 4OMZA 4G7OF 1SFUA 3U9GA 2P7CB 2QVOA 1FWZA 2V1UA 3MZYA 1LVAA 2JPCA 1KU7A 2OQGA 1FBUA 4NQWA 4OINF 4ZYDA 1B6AA 3ZN0A 1KA8A 5HOOA 1IUYA 4QLCU 2RDPA 1SD4A 4MHGA 3TO6A 4YIFA 2BGCA 1PP8F 3MEXA 5IT9Z 2O3FA 5ERIA 3W6KB 4KIFA 1BN5A 1ZGAA 1Z05A 4OMYA 1GXPA 3D0SA 3I64A 3EUHA 2MH9A 1IXRC 2VBZA 3BPXA 3G3ZA 4WK8F 2ZFWA 2M1BA 2RV8A 4GO1A 2VOOA 2OD5A 2ZMEB 4KN7X 1LDJA 3QP5A 1G3YA 1K79A 3DP7A 1FP1D 3MQ0A 2FU4A 3NQOA 5FLXK 2P6TA 1L0OC 3PQJA 2A68F 1KU2A 3JAMK 1UHMA 4BAYA 4CHUA 1PDNC 5JI6A 2CYYA 1USSA 3DF8A 4MGRA 1T2KA 2VC1A 4ESBA 4IVNA 1YFHA 4AIJA 1LEAA 4Q4ZF 3WODF 5EEHA 2HKXA 5D5VB 2LSOA 1LDKB 2PMHA 4B09A 4KUMA 3ABTA 4CGZA 4KIBA 3HIFA 3F3XA 2V1DA 3R0AA 1FNNA 1YW9A 1QGPA 1XSXA 5FD5A 4BXUA 1H0MA 4HA8A 5CVUA 3WGGA 4L9TA 2E1CA 2CG4A 4UVCA 5AONA 5E8IA 3I71A 2AS5F 2H6BA 2HYGD 1TLHB 3JSOA 1FT9A 3FMSA 4M9XA 3J81K 4EJOA 2NNYA 5BOXA 1XSDA 4YFNF 1XD7A 2RNJA 4GYIA 2M5WA 3FM5A 2VXZA 1BC7C 4O5VA 2NNNA 3K9TA 2KIUA 5FD6A 3HSRA 1MGTA 1TQPA 5DD4A 2L3DA 5ILVA 2HFHA 4IHTA 2EV6A 1DDNA 2ACJA 5E1XA 3N4MA 1V3FA 3F8CA 1XGSA 1Z1DA 3I59A 5L3GA 4OIOF 2EFPA 3OV8A 2MA3A 3HRSA 2IPQX 3WGHA 1RI7A 3CUOA 2XIGA 3DPTA 2FBHA 2NAZA 4I98B 4LG0B 4S05A 2PMUA 3I54A 4WXCA 2FMLA 5FFZA 2G7HA 2J5OA 2MD5A 1T98A 3GFMA 2EB7A 2XAJA 3J80Z 1L3LA 4HF2A 3MZHA 2O6GE 3C1DA 5CJ9A 5A2QK 4OIRF 4Y17A 2RN7A 3C7JA 2RQPA 3J81Z 4N9IA 3DFGA 5H6RA 3FX3A 5JHUA 2Q0OA 1R00A 2XAQA 3H3UA 3R61A 2K4BA 5BPDA 2KJCA 2M30A 1ULYA 1YS6A 3BJAA 2YU3A 1BIAA 4D0PA 2E1NA 2HOEA 4H0EA 2A69F 4KNYA 5DUKA 3PQKA 2K7LA 4HBLA 3F22A 3F21A 1YLFA 2UZKA 5D5XB 3FMQA 3O3KA 4EGZA 5H6QA 4IRHA 1O3RA 4HZFA 5FGMA 1OPCA 4UXNA 2XKPA 2HDCA 4AVPA 3F8FA 3E3VA 1G4DA 1R1UA 4XRFA 4CZZA 4EMSA 4L5JA 2ZO4A 3TKYA 5E20A 1KQ0A 2VC0A 4L0ZB 5ICFA 1JGSA 1Z91A 1B1BA 4U0VA 3F6OA 4HF0A 4U0WA 1P4XA 4XSXF 1MD0A 4KFCA 1RIOH 4R1HA 1XGOA 3F6VA 1P4AA 3BJ6A 3HRUA 2HTJA 3E6MA 4MTEA 5DUIA 2DU9A 1XMKA 4DQ2A 5CVVA 1O7LA 3R60A 5CVRA 3BROA 1IZ1A 2EA4A 4YFKF 3ABUA 1R5GA 2OAZA 3Q5FA 1GXQA 3I58A 1HSTA 2F5CA 2NRAC 3P9CA 3LAJA 4HW0A 4RAYA 5EEGA 2EV0A 2FQ3A 1R36A 3ZMZA 1CF7A 2O03A 2QQBA 1XN7A 1HKQA 1AWCA 3K1MA 3BPVA 2MC3A 2XKOA 3DQVC 4KIGA 1ZG3A 4M9ZA 1XCBA 4I01A 2L4AA 3KP6A 4I02A 4G9YA 2ZNYA 2IA1A 4LJZF 2VE9A 2Z99A 3WG9A 3BZ6A 4OU0A 4U7DA 4RGSA 1LB2A 1O7FA 1P4WA 5LBQA 4IRGA 2IA0A 4LK0F 5L3FA 4G94A 2L54A 2KIMA 5DCMA 3BY6A 4UUVA 2PLYA 1U5TA 2QZ8A 2WWYA 1YS7A 4M71A 1TNSA 2QLZA 5DV5A 1YQAA 3EYYA 5HDGA 3RKYA 2ISYA 3TOBA 4G7HF 3CJNA 3GFLA 2CGPA 2Q2EA 2RGVA 5FFXA 3ZPLA 4NB5A 2GAUA 5D4SA 3P9IA 3HOTA 1BI0A 1UB9A 1ZREA 2FRHA 3GXOA 4P9FA 2W85A 2PBIA 3L9FA 5L3DA 3EETA 3I5UA 2L01A 2NYXA 3IKVA 3SZPA 5HDNA 2VT3A 4B8XA 1IRGA 2EFOA 4KDPA 1JHHA 2Z33A 2LF7A 4WX9A 1S7AA 3BJOA 5LHIA 4Q47A 2QUFA 2M8EA 3RJPA 3LQRA 1W4MA 4IXAA 1QZYA 4HDUA 1Y0UA 4FT8A 4KA4A 2K27A 2IW5A 4A12A 2GQQA 4L0YB 1BI2A 3B02A 3SXYA 1Z9CA 1REPC 3K1NA 3L09A 1J5YA 1O3SA 5K5RA 5ICCA 2XGXA 1C0WA 4IF4A 2D45A 1D8KA 2OBPA 2W24A 3KE2A 1FX7A 4RB1A 2ZNZA 3T1BA 1ZRFA 1DPUA 2H6CA 4WF2A 2DQRA 4ZYGA 4MQVA 4FHTA 4MQ9F 2A3SA 5D6FA 3L2CA 4U0YA 3RIRA 4IJAA 4ZYEA 3JTHA 4MNUA 3E6BA 3V4GA 2FEZA 3FM3A 1YTYA 2GXBA 1SD5A 5AIQA 4YIIA 4HF1A 4PGHA 1FZPB 2K4JA 4WXHA 5IT9K 1EH8A 2RC4A 2V9VA 3RYPA 1QZZA 2F5FA 1T0FA 3GF2A 1F9NA 3KP3A 2XAFA 1HSJA 4N9HA 3SHFA 2EWNA 3TGNA 4L5IA 5D6EA 3GLXA 2X4HA 2ZBKA 4LLGF 1D5VA 4XLNF 3HRTA 1ZG5A 4ENJA 3EDPA 2DW4A 3LA2A 3F72A 1LNWA 1ZYRF 4PZJA 1B4AA 3GO5A 1KYWA 1I27A 1IW7F 4K2EA 2DO7A 3QPHA 5HS7A 1OKRA 1ZRCA 1BI1A 1FBQA 4GXOA 4HQMA 1ONVA 3M7GA 1IN7A 5CLSA 3R4KA 1SFXA 1D8JA 2A07F 5FB2A 4CYDA 2QQ9A 2KKOA 3I4PA 1BC8C 3KP7A 2OZUA 3V7CA 4AWXB 2COMA 4EJWA 3SZTA 2V6CA 1OYWA 3I59B 4UV8A 1IXCA 5LHHA 4LFUA 1KGSA 4EJVA 4M74A 2X0LA 4FX4A 4A0YA 5HDKA 3WTYC 4YFXF 1SMYF 4A0XA 3T0YA 4U88A 1U3EM 3GWZA 1K78B 4AIKA 2PFBA 3TO9A 4CO8A 1BBYA 1IN5A 2MH2A 4JBAA 5ICGA 2H09A 2BBYA 2HQRA 3LAPA 3W6JB 1KU3A 3LFKA 1HW1A 4M73A 3SQNA 2D1HA 2CQKA 4UV9A 3REOA 5K5QA 3F8NA 1DP7P 4Q5SF 1J75A 4RS8A 2B0LA 3V8KA 1EV7A 2OU2A 1Z6RA 1ZHFA 2A5YB 3S2WA 3V7RA 2ZJ2A 3QP6A 2EK5A 2FF4A 1FBSA 1K7AA 2FXAA 1ZG1A 2ADUA 1ZN2A 3JW4A 3WGIA 4S04A 2MLKA 5BS6A 4EGYA 4I0BA 1KQ8A 3VFZA 4HOBA 3HUGA 2QWWA 1W5SA 5D8KB 3L00A 5E1ZB 2L02A 4ENNA 1MDMB 3IKTA 1TTYA 4EJTA 3V8JA 3WU0A 2RKHA 4HLXA 4A2UA 2DPUA 3GZ5A 5BQTA 5LEJA 2W25A 1GVJA 1MKMA 4M9SA 5AIPA 4KMUX 4GYGA 4P55A 4IHSA 4AIHA 1H9GA 3MCZA 2BYVE 3VODA 1YO5C 5E18F 4FX0A 3O6BB 4XSZF 2P5KA 2F2EA 5L3EA 2KJBA 3TOAA 1FYLA 3JTGA 2HGCA 2BV6A 3E5QA 4L18B 4LK1F 4LB6B 4KICA 1J9IA 3CO6C 4UVBA 2RVCA 5E17F 2ZCWA 5E8GA 4A6EA 2D1VA 5CYVA 3MAJA 1DUXC 3KLNA 3BOQA 3CDHA 3U1DA 2VBXA 4CDGA 3R6SA 2CWEA 2HS5A 4EM2A 2Z5UA 3KZYA 2Q8KA 3GX4X 3F8MA 2Z9OA 5DEQA 1KYZA 3LQQA 4JQFA 2GWRA 3M1EA 1CF7B 4ZH4F 4U7BA 3FWEA 1XGNA 2GA2A 3ULQB 3KLOA 3ZMUA 4M72A 1K6OA 1P2FA 4A6DA 3T8RA 2JT1A 4OIPF 4OIQF 4LLNA 2PEXA 3CUQB 3FXQA 2FNPA 1YW7A 3NRVA 5LGTA 3KZZA 3LA7A 1MDMA 3U2RA 3HRMA 3QOPA 2PQ8A 5BPIA 3DKWA 1O57A 5DCMB 2DK8A 2QENA 3I0TA 4EM0B 2HWVA 1ODDA 2YX4A 2DK5A 1LQ1A 5H20A 4PGGA 5A2QZ 2C6YA 1FY7A 1SD6A 5K1YA 3RDIA 2UXNA 3WTXC 3FHZA 1IN6A 3LWFA 5J8FA 3GFJA 3DPLC 5TRDA 3K1PA 2P7VB 1I5ZA 5ILUA 2G7UA 1XB4A 4RAZA 5BMZA 1RUOA 1F5TA 3GEZA 4I7HA 1NHAA 1STZA 3TDZC 1ZRDA 3TO7A 2HQNA 3N97A 3WTWC 1FC3A 1FOKA 4LGWA 5KVRA 1QBJA 3BP8A 2FMYA 3D5LA 3FXUA 2J5PA 5J6XA 1S8NA 4UVAA 4NHJA 2F5EA 2CW0F 3ZMSA 4PDKA 1VTNC 1UCRA 2YSRA 2XRNA 2DQLA 3KFWX 2PN6A 3GVAA 5D4RA 2DFIA 1W5TA 5LRRA 1U6GA 3HHGA 5DD8A 1J7KA 3RTRA 2ELHA 1OYIA 2LKPA 2VN2A 3L7WA 4HQEA 4BNCA 5LEKA 4Y15A 1B9NA 3VB2A 3PFIA 1LEBA 4A0ZA 1G3WA 1T6SA 2XAGA 5K5OA 1W7PD 2A61A 4BQAA 4JK1X 4LB5A 2F5DA 3IRQA 4L9VA 1J59A 2UWMA 1MJ9A 1ZGJA 1ZH5A 1XMAA 3LA3A 4ESFA 5D5UB 4MEYF 1IRFA 3WTZA 1USTA 4Z2YA 3QU3A 2HEOA 1S6LA 1V4RA 5JVTA 3ZMTA 2ESHA 2PJPA 1BIBA 5F6FA 2VONA 1WRJA 4RB3C 2GA1A 4KMFA 4CICA 4Q48A 4BYYA 3FMRA 3HHHA 4E70A 2VOPA 2FA5A 4M6XA 2IJLA 4DNCA 2V79A 3C18A 3F23A 1U5TC 3CLOA 1TW2A 1RNLA 2P8TA 2XUBA 2QBYA 4GGGA 1XDUA 4LD5A 1FYKA 1YIOA 1XSVA 2G9WA 3NEUA 4UHTA 3ECHA 1G3SA 3HOSA 5ICEA 4Y13A 2Z3YA 1ZLKA 2LNBA 2XHKA 1TNTA 4G6QA 4G8XA 2DT5A 1EH7A 3T8TA 1OMIA 2OA4A 3V8LA 3GZ6A 4MEXF 1GHCA 1XDSA 3FZVA 3E97A 1ON1A 2EV5A 2E7WA 1RUNA 3E5UA 1IAWA 4EQQA 2JSCA 3C3WA 3ISPA 1YYVA 3H92A 2UXXA 4IRIA 2DPDA 2HTSA 1R58A 1FYMA 1WQ2A 2EFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYW A;  2QQA A;  3CTA A;  5E1W A;  2O0Y A;  5HLH A;  3K2Z A;  1XCV A;  2LDU A;  3ELK A;  4LMY A;  2YPR A;  4ZZD A;  1J2X A;  3V7S A;  2H27 A;  2IT0 A;  1HKS A;  2Y75 A;  5LGU A;  1DPR A;  1OR7 A;  3ZMV A;  6PAX A;  5HVQ C;  3VOE A;  1UFM A;  1H9T A;  1YW8 A;  2M45 A;  2FNA A;  2V1X A;  1IXS B;  1E2X A;  4BH9 A;  1PP7 U;  1MJA A;  2H94 A;  2HKO A;  1T38 A;  3RKW A;  3RYR A;  4RGX A;  2FSW A;  3BDD A;  1FSE A;  2VE8 A;  1UHW A;  4KN4 X;  3GFI A;  2XAH A;  3CO7 C;  5D8L B;  2ISZ A;  2EFW A;  2WTE A;  3E5X A;  5JR3 A;  3G73 A;  2EFN A;  3DXJ F;  5LGN A;  2IVM A;  3EYI A;  4LG0 A;  4F7Z A;  4WCG A;  3TQN A;  3GYH X;  3BWG A;  3J80 K;  1E17 A;  3DV8 A;  2K86 A;  4ENM A;  4R79 A;  3KP4 A;  2PG4 A;  5KK1 A;  5DCF A;  4BHP A;  1R23 A;  1U2W A;  3IC7 A;  1RZ4 A;  2JPB A;  2CSO A;  1R22 A;  3E6D A;  4HV5 A;  2ETH A;  4HX4 A;  4XBF A;  2DLL A;  3H3Z A;  1WWX A;  2R3S A;  1S7O A;  1FP2 A;  3ZQ7 A;  1W7P A;  3ZMD A;  5LRS A;  3HTS B;  1FSH A;  2VOD A;  4EV0 A;  1SFE A;  3P9K A;  3ECO A;  2FBI A;  3OOP A;  2XVC A;  4ESJ A;  4G6D A;  2KIF A;  2HR3 A;  3WTS C;  1A04 A;  2EA2 A;  3KEQ A;  3WTT C;  4ASN A;  1QPM A;  3P7N A;  2BE5 F;  5J8C A;  3GUD A;  5HLI A;  1S3J A;  4QWQ A;  5FLX Z;  4I09 A;  3VEP A;  1R7J A;  2JTV A;  1EH6 A;  1LDD A;  1P6R A;  2TDX A;  4L9J A;  2IP2 A;  2M87 A;  2P4W A;  1G6N A;  3CUQ C;  3RI4 A;  3WU1 B;  1HW2 A;  1R1V A;  1O3T A;  5F64 A;  4R8H A;  4MTD A;  3JAM Z;  1F4K A;  4UNO A;  4CXF A;  3QAH A;  3KET A;  1TBX A;  2IA2 A;  4HDV A;  1WI9 A;  3HYI A;  2YX7 A;  3T5X A;  3QRF F;  4N0B A;  1O3Q A;  1ZLJ A;  1Z6T A;  1I1S A;  3F8B A;  2OZ6 A;  4O3M A;  2VBW A;  1AOY A;  1QO0 D;  4AD9 A;  4PCQ A;  4A5M A;  1U78 A;  2IRF G;  4ETS A;  5HS9 A;  1P92 A;  3ZN1 A;  4RGR A;  1XGM A;  3R0J A;  5FO5 A;  4P9U A;  3IHU A;  4EM1 A;  2JZY A;  2STT A;  3QPT A;  4M6Y A;  2EJR A;  1J0R A;  1LJ9 A;  2NS0 A;  4I2O A;  3HSF A;  4EVI A;  1FLI A;  4BHB A;  5IT3 A;  1BJA A;  2DBB A;  4LLL A;  2HZT A;  3M8F A;  2MLG A;  5CVI A;  1OYY A;  1TQI A;  3J7A O;  2STW A;  3WTU C;  2E7X A;  5D5W B;  2Y0M A;  3COA C;  1D3Y A;  3LST A;  2BEO A;  5ILS A;  3EQL F;  5LLQ A;  2DI3 A;  2FE3 A;  3ML6 A;  4IPA A;  1R1T A;  3WE2 A;  3E6C C;  1B59 A;  2D2W A;  4BHC A;  1CGP A;  1IN8 A;  4HX8 A;  1S29 A;  2R7D A;  4RB0 A;  2XAS A;  5F1R A;  1MJB A;  3ERE D;  1WKM A;  5TJJ A;  3FXR A;  1KU9 A;  3DEU A;  4G7Z F;  3JSP A;  3IWZ A;  2FOK A;  2VT2 A;  4TV7 A;  1MZB A;  1G3T A;  1ON2 A;  2DTR A;  1KQ9 A;  3TDU C;  4O6J A;  3HSE A;  3O2P E;  4OOI A;  3IRR A;  2CO5 A;  2W84 A;  1IF1 A;  4KT5 C;  4I0A A;  2XV4 S;  3IL2 A;  3RKX A;  4ENK A;  3MWM A;  2DAO A;  2MBF A;  1QQI A;  1HKT A;  3SFZ A;  3KCC A;  4HV6 A;  2A6H F;  1T39 A;  2GXG A;  5HLG A;  4XLP F;  3GW2 A;  1BOA A;  1I1G A;  5DYM A;  5L3B A;  1FPQ A;  1HW5 A;  4RB2 C;  1TW3 A;  1SAX A;  1B9M A;  3WTV C;  1PUE E;  2WC2 A;  3Q9S A;  4L9N A;  1JHF A;  4ON0 A;  3B73 A;  1R5H A;  1SMT A;  2OQR A;  4ZYH A;  2ESN A;  3ZP5 A;  1JE8 A;  3HTU A;  5CVJ A;  1U8R A;  2WV0 A;  3I53 A;  4YG2 F;  1JXS A;  5L3C A;  1ZAR A;  3K0L A;  1BI3 A;  3CUQ A;  2Y48 A;  1F1Z A;  2ZXJ A;  3Q9V A;  2P5L C;  4EJU A;  1HQC A;  4GCV A;  2W57 A;  5JFR A;  5ED4 A;  3K69 A;  2P6S A;  4HX7 A;  2GIV A;  2O8X A;  4P5O A;  1X3U A;  3QU6 A;  2A6E F;  1HXD A;  2QBY B;  2XRO A;  1TQM A;  5LHG A;  1I6X A;  2R7F A;  2ZKZ A;  2LF8 A;  3KEO A;  1QNT A;  2GZW A;  5DDG A;  3IWF A;  1HBX G;  3FF5 A;  3MFK A;  3M9A A;  2VBY A;  2AXL A;  4HAM A;  2JRT A;  4WWC A;  1K78 A;  2PI0 A;  2K02 A;  4RGU A;  1Q1H A;  1IN4 A;  3ROU A;  2L4M A;  3RPQ A;  2QYO A;  4WXD A;  1YG2 A;  5HS8 A;  2QM3 A;  1ZAO A;  3WE3 A;  3AAF A;  2O61 A;  2FBK A;  3M8E A;  3RPU A;  2P5V A;  4ZZL A;  2KRF A;  1U5T B;  3KP2 A;  1WSU A;  2HYF A;  2YR2 A;  1W7P B;  1BM9 A;  4P96 A;  1SD7 A;  4A5N A;  2ZME A;  1Z7U A;  3KP5 A;  2CFX A;  4HLY A;  4HYE A;  4OMZ A;  4G7O F;  1SFU A;  3U9G A;  2P7C B;  2QVO A;  1FWZ A;  2V1U A;  3MZY A;  1LVA A;  2JPC A;  1KU7 A;  2OQG A;  1FBU A;  4NQW A;  4OIN F;  4ZYD A;  1B6A A;  3ZN0 A;  1KA8 A;  5HOO A;  1IUY A;  4QLC U;  2RDP A;  1SD4 A;  4MHG A;  3TO6 A;  4YIF A;  2BGC A;  1PP8 F;  3MEX A;  5IT9 Z;  2O3F A;  5ERI A;  3W6K B;  4KIF A;  1BN5 A;  1ZGA A;  1Z05 A;  4OMY A;  1GXP A;  3D0S A;  3I64 A;  3EUH A;  2MH9 A;  1IXR C;  2VBZ A;  3BPX A;  3G3Z A;  4WK8 F;  2ZFW A;  2M1B A;  2RV8 A;  4GO1 A;  2VOO A;  2OD5 A;  2ZME B;  4KN7 X;  1LDJ A;  3QP5 A;  1G3Y A;  1K79 A;  3DP7 A;  1FP1 D;  3MQ0 A;  2FU4 A;  3NQO A;  5FLX K;  2P6T A;  1L0O C;  3PQJ A;  2A68 F;  1KU2 A;  3JAM K;  1UHM A;  4BAY A;  4CHU A;  1PDN C;  5JI6 A;  2CYY A;  1USS A;  3DF8 A;  4MGR A;  1T2K A;  2VC1 A;  4ESB A;  4IVN A;  1YFH A;  4AIJ A;  1LEA A;  4Q4Z F;  3WOD F;  5EEH A;  2HKX A;  5D5V B;  2LSO A;  1LDK B;  2PMH A;  4B09 A;  4KUM A;  3ABT A;  4CGZ A;  4KIB A;  3HIF A;  3F3X A;  2V1D A;  3R0A A;  1FNN A;  1YW9 A;  1QGP A;  1XSX A;  5FD5 A;  4BXU A;  1H0M A;  4HA8 A;  5CVU A;  3WGG A;  4L9T A;  2E1C A;  2CG4 A;  4UVC A;  5AON A;  5E8I A;  3I71 A;  2AS5 F;  2H6B A;  2HYG D;  1TLH B;  3JSO A;  1FT9 A;  3FMS A;  4M9X A;  3J81 K;  4EJO A;  2NNY A;  5BOX A;  1XSD A;  4YFN F;  1XD7 A;  2RNJ A;  4GYI A;  2M5W A;  3FM5 A;  2VXZ A;  1BC7 C;  4O5V A;  2NNN A;  3K9T A;  2KIU A;  5FD6 A;  3HSR A;  1MGT A;  1TQP A;  5DD4 A;  2L3D A;  5ILV A;  2HFH A;  4IHT A;  2EV6 A;  1DDN A;  2ACJ A;  5E1X A;  3N4M A;  1V3F A;  3F8C A;  1XGS A;  1Z1D A;  3I59 A;  5L3G A;  4OIO F;  2EFP A;  3OV8 A;  2MA3 A;  3HRS A;  2IPQ X;  3WGH A;  1RI7 A;  3CUO A;  2XIG A;  3DPT A;  2FBH A;  2NAZ A;  4I98 B;  4LG0 B;  4S05 A;  2PMU A;  3I54 A;  4WXC A;  2FML A;  5FFZ A;  2G7H A;  2J5O A;  2MD5 A;  1T98 A;  3GFM A;  2EB7 A;  2XAJ A;  3J80 Z;  1L3L A;  4HF2 A;  3MZH A;  2O6G E;  3C1D A;  5CJ9 A;  5A2Q K;  4OIR F;  4Y17 A;  2RN7 A;  3C7J A;  2RQP A;  3J81 Z;  4N9I A;  3DFG A;  5H6R A;  3FX3 A;  5JHU A;  2Q0O A;  1R00 A;  2XAQ A;  3H3U A;  3R61 A;  2K4B A;  5BPD A;  2KJC A;  2M30 A;  1ULY A;  1YS6 A;  3BJA A;  2YU3 A;  1BIA A;  4D0P A;  2E1N A;  2HOE A;  4H0E A;  2A69 F;  4KNY A;  5DUK A;  3PQK A;  2K7L A;  4HBL A;  3F22 A;  3F21 A;  1YLF A;  2UZK A;  5D5X B;  3FMQ A;  3O3K A;  4EGZ A;  5H6Q A;  4IRH A;  1O3R A;  4HZF A;  5FGM A;  1OPC A;  4UXN A;  2XKP A;  2HDC A;  4AVP A;  3F8F A;  3E3V A;  1G4D A;  1R1U A;  4XRF A;  4CZZ A;  4EMS A;  4L5J A;  2ZO4 A;  3TKY A;  5E20 A;  1KQ0 A;  2VC0 A;  4L0Z B;  5ICF A;  1JGS A;  1Z91 A;  1B1B A;  4U0V A;  3F6O A;  4HF0 A;  4U0W A;  1P4X A;  4XSX F;  1MD0 A;  4KFC A;  1RIO H;  4R1H A;  1XGO A;  3F6V A;  1P4A A;  3BJ6 A;  3HRU A;  2HTJ A;  3E6M A;  4MTE A;  5DUI A;  2DU9 A;  1XMK A;  4DQ2 A;  5CVV A;  1O7L A;  3R60 A;  5CVR A;  3BRO A;  1IZ1 A;  2EA4 A;  4YFK F;  3ABU A;  1R5G A;  2OAZ A;  3Q5F A;  1GXQ A;  3I58 A;  1HST A;  2F5C A;  2NRA C;  3P9C A;  3LAJ A;  4HW0 A;  4RAY A;  5EEG A;  2EV0 A;  2FQ3 A;  1R36 A;  3ZMZ A;  1CF7 A;  2O03 A;  2QQB A;  1XN7 A;  1HKQ A;  1AWC A;  3K1M A;  3BPV A;  2MC3 A;  2XKO A;  3DQV C;  4KIG A;  1ZG3 A;  4M9Z A;  1XCB A;  4I01 A;  2L4A A;  3KP6 A;  4I02 A;  4G9Y A;  2ZNY A;  2IA1 A;  4LJZ F;  2VE9 A;  2Z99 A;  3WG9 A;  3BZ6 A;  4OU0 A;  4U7D A;  4RGS A;  1LB2 A;  1O7F A;  1P4W A;  5LBQ A;  4IRG A;  2IA0 A;  4LK0 F;  5L3F A;  4G94 A;  2L54 A;  2KIM A;  5DCM A;  3BY6 A;  4UUV A;  2PLY A;  1U5T A;  2QZ8 A;  2WWY A;  1YS7 A;  4M71 A;  1TNS A;  2QLZ A;  5DV5 A;  1YQA A;  3EYY A;  5HDG A;  3RKY A;  2ISY A;  3TOB A;  4G7H F;  3CJN A;  3GFL A;  2CGP A;  2Q2E A;  2RGV A;  5FFX A;  3ZPL A;  4NB5 A;  2GAU A;  5D4S A;  3P9I A;  3HOT A;  1BI0 A;  1UB9 A;  1ZRE A;  2FRH A;  3GXO A;  4P9F A;  2W85 A;  2PBI A;  3L9F A;  5L3D A;  3EET A;  3I5U A;  2L01 A;  2NYX A;  3IKV A;  3SZP A;  5HDN A;  2VT3 A;  4B8X A;  1IRG A;  2EFO A;  4KDP A;  1JHH A;  2Z33 A;  2LF7 A;  4WX9 A;  1S7A A;  3BJO A;  5LHI A;  4Q47 A;  2QUF A;  2M8E A;  3RJP A;  3LQR A;  1W4M A;  4IXA A;  1QZY A;  4HDU A;  1Y0U A;  4FT8 A;  4KA4 A;  2K27 A;  2IW5 A;  4A12 A;  2GQQ A;  4L0Y B;  1BI2 A;  3B02 A;  3SXY A;  1Z9C A;  1REP C;  3K1N A;  3L09 A;  1J5Y A;  1O3S A;  5K5R A;  5ICC A;  2XGX A;  1C0W A;  4IF4 A;  2D45 A;  1D8K A;  2OBP A;  2W24 A;  3KE2 A;  1FX7 A;  4RB1 A;  2ZNZ A;  3T1B A;  1ZRF A;  1DPU A;  2H6C A;  4WF2 A;  2DQR A;  4ZYG A;  4MQV A;  4FHT A;  4MQ9 F;  2A3S A;  5D6F A;  3L2C A;  4U0Y A;  3RIR A;  4IJA A;  4ZYE A;  3JTH A;  4MNU A;  3E6B A;  3V4G A;  2FEZ A;  3FM3 A;  1YTY A;  2GXB A;  1SD5 A;  5AIQ A;  4YII A;  4HF1 A;  4PGH A;  1FZP B;  2K4J A;  4WXH A;  5IT9 K;  1EH8 A;  2RC4 A;  2V9V A;  3RYP A;  1QZZ A;  2F5F A;  1T0F A;  3GF2 A;  1F9N A;  3KP3 A;  2XAF A;  1HSJ A;  4N9H A;  3SHF A;  2EWN A;  3TGN A;  4L5I A;  5D6E A;  3GLX A;  2X4H A;  2ZBK A;  4LLG F;  1D5V A;  4XLN F;  3HRT A;  1ZG5 A;  4ENJ A;  3EDP A;  2DW4 A;  3LA2 A;  3F72 A;  1LNW A;  1ZYR F;  4PZJ A;  1B4A A;  3GO5 A;  1KYW A;  1I27 A;  1IW7 F;  4K2E A;  2DO7 A;  3QPH A;  5HS7 A;  1OKR A;  1ZRC A;  1BI1 A;  1FBQ A;  4GXO A;  4HQM A;  1ONV A;  3M7G A;  1IN7 A;  5CLS A;  3R4K A;  1SFX A;  1D8J A;  2A07 F;  5FB2 A;  4CYD A;  2QQ9 A;  2KKO A;  3I4P A;  1BC8 C;  3KP7 A;  2OZU A;  3V7C A;  4AWX B;  2COM A;  4EJW A;  3SZT A;  2V6C A;  1OYW A;  3I59 B;  4UV8 A;  1IXC A;  5LHH A;  4LFU A;  1KGS A;  4EJV A;  4M74 A;  2X0L A;  4FX4 A;  4A0Y A;  5HDK A;  3WTY C;  4YFX F;  1SMY F;  4A0X A;  3T0Y A;  4U88 A;  1U3E M;  3GWZ A;  1K78 B;  4AIK A;  2PFB A;  3TO9 A;  4CO8 A;  1BBY A;  1IN5 A;  2MH2 A;  4JBA A;  5ICG A;  2H09 A;  2BBY A;  2HQR A;  3LAP A;  3W6J B;  1KU3 A;  3LFK A;  1HW1 A;  4M73 A;  3SQN A;  2D1H A;  2CQK A;  4UV9 A;  3REO A;  5K5Q A;  3F8N A;  1DP7 P;  4Q5S F;  1J75 A;  4RS8 A;  2B0L A;  3V8K A;  1EV7 A;  2OU2 A;  1Z6R A;  1ZHF A;  2A5Y B;  3S2W A;  3V7R A;  2ZJ2 A;  3QP6 A;  2EK5 A;  2FF4 A;  1FBS A;  1K7A A;  2FXA A;  1ZG1 A;  2ADU A;  1ZN2 A;  3JW4 A;  3WGI A;  4S04 A;  2MLK A;  5BS6 A;  4EGY A;  4I0B A;  1KQ8 A;  3VFZ A;  4HOB A;  3HUG A;  2QWW A;  1W5S A;  5D8K B;  3L00 A;  5E1Z B;  2L02 A;  4ENN A;  1MDM B;  3IKT A;  1TTY A;  4EJT A;  3V8J A;  3WU0 A;  2RKH A;  4HLX A;  4A2U A;  2DPU A;  3GZ5 A;  5BQT A;  5LEJ A;  2W25 A;  1GVJ A;  1MKM A;  4M9S A;  5AIP A;  4KMU X;  4GYG A;  4P55 A;  4IHS A;  4AIH A;  1H9G A;  3MCZ A;  2BYV E;  3VOD A;  1YO5 C;  5E18 F;  4FX0 A;  3O6B B;  4XSZ F;  2P5K A;  2F2E A;  5L3E A;  2KJB A;  3TOA A;  1FYL A;  3JTG A;  2HGC A;  2BV6 A;  3E5Q A;  4L18 B;  4LK1 F;  4LB6 B;  4KIC A;  1J9I A;  3CO6 C;  4UVB A;  2RVC A;  5E17 F;  2ZCW A;  5E8G A;  4A6E A;  2D1V A;  5CYV A;  3MAJ A;  1DUX C;  3KLN A;  3BOQ A;  3CDH A;  3U1D A;  2VBX A;  4CDG A;  3R6S A;  2CWE A;  2HS5 A;  4EM2 A;  2Z5U A;  3KZY A;  2Q8K A;  3GX4 X;  3F8M A;  2Z9O A;  5DEQ A;  1KYZ A;  3LQQ A;  4JQF A;  2GWR A;  3M1E A;  1CF7 B;  4ZH4 F;  4U7B A;  3FWE A;  1XGN A;  2GA2 A;  3ULQ B;  3KLO A;  3ZMU A;  4M72 A;  1K6O A;  1P2F A;  4A6D A;  3T8R A;  2JT1 A;  4OIP F;  4OIQ F;  4LLN A;  2PEX A;  3CUQ B;  3FXQ A;  2FNP A;  1YW7 A;  3NRV A;  5LGT A;  3KZZ A;  3LA7 A;  1MDM A;  3U2R A;  3HRM A;  3QOP A;  2PQ8 A;  5BPI A;  3DKW A;  1O57 A;  5DCM B;  2DK8 A;  2QEN A;  3I0T A;  4EM0 B;  2HWV A;  1ODD A;  2YX4 A;  2DK5 A;  1LQ1 A;  5H20 A;  4PGG A;  5A2Q Z;  2C6Y A;  1FY7 A;  1SD6 A;  5K1Y A;  3RDI A;  2UXN A;  3WTX C;  3FHZ A;  1IN6 A;  3LWF A;  5J8F A;  3GFJ A;  3DPL C;  5TRD A;  3K1P A;  2P7V B;  1I5Z A;  5ILU A;  2G7U A;  1XB4 A;  4RAZ A;  5BMZ A;  1RUO A;  1F5T A;  3GEZ A;  4I7H A;  1NHA A;  1STZ A;  3TDZ C;  1ZRD A;  3TO7 A;  2HQN A;  3N97 A;  3WTW C;  1FC3 A;  1FOK A;  4LGW A;  5KVR A;  1QBJ A;  3BP8 A;  2FMY A;  3D5L A;  3FXU A;  2J5P A;  5J6X A;  1S8N A;  4UVA A;  4NHJ A;  2F5E A;  2CW0 F;  3ZMS A;  4PDK A;  1VTN C;  1UCR A;  2YSR A;  2XRN A;  2DQL A;  3KFW X;  2PN6 A;  3GVA A;  5D4R A;  2DFI A;  1W5T A;  5LRR A;  1U6G A;  3HHG A;  5DD8 A;  1J7K A;  3RTR A;  2ELH A;  1OYI A;  2LKP A;  2VN2 A;  3L7W A;  4HQE A;  4BNC A;  5LEK A;  4Y15 A;  1B9N A;  3VB2 A;  3PFI A;  1LEB A;  4A0Z A;  1G3W A;  1T6S A;  2XAG A;  5K5O A;  1W7P D;  2A61 A;  4BQA A;  4JK1 X;  4LB5 A;  2F5D A;  3IRQ A;  4L9V A;  1J59 A;  2UWM A;  1MJ9 A;  1ZGJ A;  1ZH5 A;  1XMA A;  3LA3 A;  4ESF A;  5D5U B;  4MEY F;  1IRF A;  3WTZ A;  1UST A;  4Z2Y A;  3QU3 A;  2HEO A;  1S6L A;  1V4R A;  5JVT A;  3ZMT A;  2ESH A;  2PJP A;  1BIB A;  5F6F A;  2VON A;  1WRJ A;  4RB3 C;  2GA1 A;  4KMF A;  4CIC A;  4Q48 A;  4BYY A;  3FMR A;  3HHH A;  4E70 A;  2VOP A;  2FA5 A;  4M6X A;  2IJL A;  4DNC A;  2V79 A;  3C18 A;  3F23 A;  1U5T C;  3CLO A;  1TW2 A;  1RNL A;  2P8T A;  2XUB A;  2QBY A;  4GGG A;  1XDU A;  4LD5 A;  1FYK A;  1YIO A;  1XSV A;  2G9W A;  3NEU A;  4UHT A;  3ECH A;  1G3S A;  3HOS A;  5ICE A;  4Y13 A;  2Z3Y A;  1ZLK A;  2LNB A;  2XHK A;  1TNT A;  4G6Q A;  4G8X A;  2DT5 A;  1EH7 A;  3T8T A;  1OMI A;  2OA4 A;  3V8L A;  3GZ6 A;  4MEX F;  1GHC A;  1XDS A;  3FZV A;  3E97 A;  1ON1 A;  2EV5 A;  2E7W A;  1RUN A;  3E5U A;  1IAW A;  4EQQ A;  2JSC A;  3C3W A;  3ISP A;  1YYV A;  3H92 A;  2UXX A;  4IRI A;  2DPD A;  2HTS A;  1R58 A;  1FYM A;  1WQ2 A;  2EFQ A; 
#chains in the Genus database with same CATH topology
 1VI0 A;  5CQE A;  4V2F A;  5IY5 H;  1APL C;  2HDD A;  2X6X A;  1LFP A;  4KYW A;  2O7O A;  2E60 A;  1HDP A;  4PUS A;  2QQA A;  3CTA A;  5E1W A;  1Z3X A;  2O0Y A;  3ABK H;  5HLH A;  2JA6 J;  3K2Z A;  1XCV A;  2FQ4 A;  4XR6 A;  1PUF A;  3CC2 I;  2LDU A;  1JJ6 C;  3ELK A;  4LMY A;  3CC7 I;  2YPR A;  3VYU B;  4ZZD A;  1J2X A;  1D0Y A;  3DTI A;  3V7S A;  2R4G A;  4D5C A;  2H27 A;  2IT0 A;  1HKS A;  2Y75 A;  5LGU A;  1DPR A;  1OR7 A;  3L2V A;  3ZMV A;  1R9T J;  1VQ8 I;  1TP4 A;  2CQQ A;  6PAX A;  3BR0 A;  5HVQ C;  1IC8 A;  2W1O A;  3VOE A;  2MFZ A;  1IDY A;  3GCM A;  1VQ6 I;  1OCT C;  1UFM A;  3L2W A;  1H9T A;  2TRT A;  1YW8 A;  2M45 A;  2FNA A;  2R7R A;  2EZK A;  3H5A A;  3FKI J;  1Y8Q B;  2LOO A;  1IXS B;  2V1X A;  5J4V A;  1E2X A;  2VXD A;  4BH9 A;  3DKY A;  1PP7 U;  4U87 A;  1MJA A;  3CCJ I;  2COB A;  4MLO A;  3ZQI A;  2H94 A;  2HKO A;  1T38 A;  1R6R A;  2LRD A;  3OL4 A;  3RKW A;  3RYR A;  2JVG A;  2NOJ B;  4RGX A;  2FSW A;  3BDD A;  1FSE A;  4B47 A;  3W6V A;  2VE8 A;  1UHW A;  4IKF A;  4KN4 X;  3GFI A;  1ZTR A;  2XAH A;  3JRC A;  1JKP C;  2IBD A;  3CO7 C;  5D8L B;  2ISZ A;  5FRN A;  2DXI A;  2EFW A;  2WTE A;  3E5X A;  5K7H A;  1QZE A;  5JR3 A;  3G73 A;  2EFN A;  3DXJ F;  5LGN A;  1VQ5 I;  2IVM A;  3EYI A;  4LG0 A;  4F7Z A;  1FMV A;  3E7L A;  1TZL A;  4WCG A;  1OLT A;  3IH4 A;  3TQN A;  3GYH X;  2IGO A;  4E4H A;  2Q2E B;  2LKS A;  3BWG A;  3J80 K;  1E17 A;  3DV8 A;  2K86 A;  3LSM A;  4CUG A;  3PIO F;  4ENM A;  3H3V K;  4R79 A;  3KP4 A;  3A01 B;  2KQR A;  2HDW A;  2PG4 A;  5KK1 A;  2ZSI B;  3HGG A;  1QHG A;  2W00 A;  2FJ1 A;  4PSX A;  1YE9 A;  3CQZ J;  5DCF A;  1WH5 A;  4BHP A;  1R23 A;  1U2W A;  1KON A;  1RZ4 A;  2JPB A;  2CSO A;  1R22 A;  2AXT C;  3E6D A;  3IC7 A;  3D1N I;  4CYC A;  1DU6 A;  4HV5 A;  2ETH A;  4HX4 A;  3OYM A;  2M0C A;  2DLL A;  4XBF A;  3H3Z A;  1WWX A;  3I56 I;  2R3S A;  2LYC A;  1Y56 A;  5J3L A;  1S7O A;  1FP2 A;  4NUB A;  3ZQ7 A;  1W7P A;  3ZMD A;  5LRS A;  3ZQF A;  1YJW I;  1YOV B;  2E1M B;  3HTS B;  2KZV A;  1FSH A;  1MH3 A;  2VOD A;  3VYR B;  4EV0 A;  1SFE A;  3LL7 A;  2XRL A;  1F36 A;  3P9K A;  3ECO A;  4BE2 A;  3IAM 2;  5C4J J;  2FBI A;  3OOP A;  5FKM A;  3K70 D;  4PSW A;  5C4X J;  2XVC A;  1OCO H;  4ESJ A;  2ME0 A;  4G6D A;  2BXY A;  2H8W A;  2KIF A;  3A01 A;  4F93 B;  2HR3 A;  3WTS C;  1A04 A;  2EA2 A;  2QEX I;  3KEQ A;  2IS6 A;  3WTT C;  4ASN A;  4AC0 A;  1QPM A;  2BXZ A;  3HEF A;  3P7N A;  3HC7 A;  3A4C A;  2BE5 F;  2JVH A;  3GUD A;  5J8C A;  3ABL H;  4A69 C;  2AHQ A;  4HEA 2;  2Y9Z A;  5HLI A;  1S3J A;  3S15 J;  4QWQ A;  5FLX Z;  2LH9 A;  4I09 A;  1J09 A;  3VEP A;  1EJ9 A;  1BJZ A;  3CZ6 A;  4BS9 A;  1R7J A;  4JX5 A;  2JTV A;  2LFB A;  2OCC H;  4BAC A;  3FXL A;  3FIW A;  1EH6 A;  2FOW A;  1LDD A;  1P6R A;  4XIC A;  4I6Z A;  2A5W A;  2TDX A;  5DS9 A;  4L9J A;  2IP2 A;  2M87 A;  3AG2 H;  1R71 A;  2P4W A;  3NWS A;  4RLQ A;  1G6N A;  2NOG A;  3CUQ C;  3RSN A;  2DYS H;  4LIV A;  4JX4 A;  1YJ9 I;  3RI4 A;  3WU1 B;  2DOD A;  2IS2 A;  3CCM I;  2HVS A;  3CC4 I;  3HJE A;  1HW2 A;  3HGY A;  1R1V A;  3KYC B;  1O3T A;  5F64 A;  4II2 A;  3MN2 A;  4R8H A;  4MTD A;  3A1Y A;  3JAM Z;  1F4K A;  4UNO A;  4CZC A;  3HOU J;  3OYL A;  1R4N B;  1TT0 A;  4CXF A;  2Y0S N;  2N8G A;  3QAH A;  3H9Q A;  1ZKG A;  2ECB A;  1X1P A;  3KET A;  1TBX A;  4CCJ A;  2H1L A;  1WPK A;  3B6C A;  3VDX A;  2IA2 A;  4HDV A;  1FIA A;  1WI9 A;  5FJ8 J;  4HPQ A;  3HYI A;  1RPW A;  2YX7 A;  3T5X A;  3OYC A;  3QRF F;  4N0B A;  5BNG A;  1O3Q A;  4UY8 I;  2QKL B;  1MH4 A;  1ZLJ A;  1V5E A;  1Z6T A;  5E3O A;  1I1S A;  3DCF A;  3F8B A;  4IL6 C;  2BZT A;  3S93 A;  2NVY J;  2OZ6 A;  4UB8 C;  2VBW A;  3G6E I;  4O3M A;  1AOY A;  1QO0 D;  1RES A;  5DTD A;  4PCQ A;  3SFI A;  4A5M A;  4AD9 A;  1U78 A;  3ZQQ A;  2IRF G;  2DDB A;  3CJT B;  4ETS A;  3O8G A;  5HS9 A;  3BR5 A;  2IEK A;  2DJI A;  3DLA A;  4N4O B;  1P92 A;  3ZN1 A;  4RGR A;  2KMU A;  2WB1 N;  1XGM A;  2DYR H;  3R0J A;  5FO5 A;  4P9U A;  2VQG A;  3PNV A;  3CCU I;  3IHU A;  4EM1 A;  2DMQ A;  3OR1 C;  2JZY A;  2MGQ A;  2STT A;  3QPT A;  4M6Y A;  2E19 A;  3LSK A;  4XLF A;  2R5Z B;  2EJR A;  3NWT A;  1J0R A;  2X48 A;  1LJ9 A;  2DA5 A;  2NS0 A;  1AKH B;  4I2O A;  3HSF A;  3IUO A;  4HNT A;  2NS8 A;  2WB1 A;  4EVI A;  1FLI A;  1N78 A;  4BHB A;  3DU5 A;  1N75 A;  5IT3 A;  2M7B A;  1BJA A;  1Q1V A;  2DBB A;  2HZT A;  3M8F A;  4LLL A;  2MLG A;  5CVI A;  1OYY A;  1TQI A;  3KPH A;  3J7Z I;  1LFU P;  3J7A O;  2STW A;  2DFE A;  3WTU C;  2E7X A;  5D5W B;  2HXO A;  2XDV A;  4M3F A;  2Y0S A;  2Y0M A;  5KAI C;  3COA C;  4E7K A;  4CYC B;  2R7X A;  1S7E A;  3A02 A;  1D3Y A;  3CCQ I;  3LST A;  2BEO A;  3PUF A;  5ILS A;  1P9Q C;  3EQL F;  5LLQ A;  2E5Z A;  2MAB A;  2DI3 A;  2FE3 A;  3ML6 A;  3LSR A;  4IPA A;  1R1T A;  2JJ7 A;  3WE2 A;  3E6C C;  1IG7 A;  3OYB A;  4YIR X;  1B59 A;  2D2W A;  4BHC A;  1MW7 A;  1WI3 A;  1CGP A;  1IN8 A;  2QGU A;  4HX8 A;  1S29 A;  2R7D A;  2K5C A;  3Q0V A;  4MO7 A;  4RB0 A;  2XAS A;  5F1R A;  2YUS A;  1MJB A;  4M3B A;  3ERE D;  2LP0 A;  1WKM A;  5TJJ A;  1G59 A;  3FXR A;  1KU9 A;  5JHF A;  3AFH A;  1OCC H;  3S3M A;  3DEU A;  4G7Z F;  1T08 B;  3JSP A;  3IWZ A;  2FOK A;  4UUS B;  2CUF A;  4XLA A;  3CCV I;  3HM5 A;  2DCE A;  2JK3 A;  2VT2 A;  4FIS A;  4TV7 A;  4CCK A;  3M4O J;  1MZB A;  2VAS A;  2L0K A;  1W1W E;  2Y69 H;  1G3T A;  1ON2 A;  1Y1V J;  2RNG A;  2DTR A;  2L7F P;  4DBQ A;  3GBG A;  3MD2 A;  1WH7 A;  1KQ9 A;  2R7T A;  4W97 A;  3TDU C;  1S72 I;  3H5N A;  1LUJ B;  4O6J A;  3HSE A;  3O2P E;  1PYV A;  4OOI A;  3IRR A;  2CO5 A;  2L9R A;  2W84 A;  1IF1 A;  2XF5 A;  4KT5 C;  4I0A A;  4JP0 A;  2XV4 S;  5E3L A;  3IL2 A;  2H8R A;  3RKX A;  2R7W A;  3OS2 A;  3OYA A;  4ENK A;  3MWM A;  2DAO A;  5TIS C;  2MBF A;  1QQI A;  1HKT A;  3SFZ A;  4IO9 F;  3KCC A;  4HV6 A;  2A6H F;  1T39 A;  2GXG A;  5HLG A;  4XLP F;  3GW2 A;  4YEJ A;  1BOA A;  3RQ4 A;  1I1G A;  5DYM A;  5F0C A;  1IRX A;  5L3B A;  1FPQ A;  1HW5 A;  4RB2 C;  1POG A;  3AG1 H;  3DTK A;  1TW3 A;  1SAX A;  1B9M A;  4ZDP A;  3WTV C;  1TC3 C;  1PUE E;  2WC2 A;  2Q1Z B;  3Q9S A;  3TW6 A;  4L9N A;  3CMY A;  2JA7 J;  2E5N A;  2H1K A;  3TBI A;  3CLQ A;  3OOU A;  1X3W B;  1K83 J;  2EPF A;  2NS7 A;  3S32 A;  1JHF A;  4ON0 A;  1M1E B;  1Z21 A;  3B73 A;  4A3I J;  1YIJ I;  1NG7 A;  1R5H A;  1SMT A;  2V4J C;  2OQR A;  3G1M A;  5C3E J;  4E7H A;  2NVQ J;  4ZYH A;  2ESN A;  4E6K G;  3ZP5 A;  1JE8 A;  3JRG A;  3HTU A;  5CVJ A;  1U8R A;  2WV0 A;  2KDZ A;  3I53 A;  4YG2 F;  1JXS A;  1X4O A;  5L3C A;  1ZAR A;  2LBF B;  5EEA A;  3K0L A;  2B63 J;  1BI3 A;  2R92 J;  3CUQ A;  4Y4R A;  2Y48 A;  1F1Z A;  4D5F A;  2ZXJ A;  4J19 A;  3Q9V A;  2P5L C;  3DEE A;  4EJU A;  2P0W A;  2CH0 A;  1LFB A;  4PJN A;  2W48 A;  1HQC A;  4GCV A;  3FKJ A;  2W57 A;  2EIL H;  4B43 A;  4A3J J;  5EF6 A;  5JFR A;  4XOR A;  4F92 B;  5ED4 A;  2G0E A;  5B1A H;  3M1C A;  4ZJZ A;  2W82 A;  2OJE D;  2HVQ A;  3I55 I;  3K69 A;  1HA8 A;  2P6S A;  4HX7 A;  2GIV A;  2O8X A;  4D7N A;  4A3G J;  4P5O A;  4XLC A;  1X3U A;  3QU6 A;  2A6E F;  1HXD A;  1Z77 A;  2VI6 A;  4ZDL A;  4IX7 A;  4J00 A;  2QBY B;  4AYB A;  2X1E A;  2K9L A;  9ANT A;  2CV2 A;  2XRO A;  4Z6Y A;  1TQM A;  5LHG A;  1X1B A;  3N05 A;  1H88 C;  1FOW A;  1I6X A;  2R7F A;  4BQO A;  2ZKZ A;  3HPH A;  1YRN B;  2LF8 A;  3KEO A;  3V42 A;  1QNT A;  2KT0 A;  3HOX J;  1XG1 A;  2GZW A;  5DDG A;  4ZTJ A;  5EZH A;  3IWF A;  3K4L A;  1HBX G;  3FF5 A;  4C30 A;  2XB5 A;  3M3Y J;  3MFK A;  3M9A A;  2VBY A;  5JLW A;  1YX5 A;  3DBR B;  3F0C A;  2AXL A;  2JWT A;  4AM3 A;  1N25 A;  4HAM A;  2JRT A;  3L1P A;  1JTY A;  4WWC A;  4BDY A;  5K7Z A;  4LIU A;  4DOZ A;  1K78 A;  2PI0 A;  2K02 A;  4RGU A;  3ONQ A;  1ZQ3 P;  1Q1H A;  2NVU B;  2DN0 A;  1IN4 A;  2DT7 B;  2XAU A;  3ROU A;  2L4M A;  1IDZ A;  3RPQ A;  1XTA A;  3BTI A;  3BR2 A;  2QYO A;  4WXD A;  5B5E C;  1YG2 A;  2KLO A;  5HS8 A;  2QM3 A;  3RQI A;  1ZAO A;  3WE3 A;  3AAF A;  3K2A A;  2O61 A;  2FBK A;  3M8E A;  3RPU A;  2P5V A;  1ETW A;  2VKH A;  3X2Q H;  1YX3 A;  1ETK A;  4XMY A;  4ZZL A;  3JRD A;  1R49 A;  2KRF A;  1U5T B;  3CDL A;  2OV7 A;  3KP2 A;  2EIK H;  1WSU A;  2HYF A;  3MMY B;  1OIS A;  2YR2 A;  1W7P B;  4FCY A;  1AHD P;  3I4N J;  4KJZ A;  1BM9 A;  4OAZ A;  2X1D A;  3Q0U A;  2F4O B;  4P96 A;  1Z0X A;  2KDO A;  1SD7 A;  4A5N A;  4DGW B;  4B4C A;  2ZME A;  1Z7U A;  3KP5 A;  2CFX A;  4HLY A;  4HYE A;  1D1C A;  3LSG A;  2HOS A;  4B48 A;  4OMZ A;  4G7O F;  2LTP A;  1HC8 A;  1SFU A;  4LOC A;  3U9G A;  2P7C B;  2QVO A;  2ZJP F;  2LVS A;  1FWZ A;  2V1U A;  3MZY A;  2L5Q A;  1LVA A;  2OCE A;  3A03 A;  1HF0 A;  2X6W A;  2JPC A;  1KU7 A;  2OQG A;  1FBU A;  3PSI A;  4NQW A;  4OIN F;  3K10 A;  1QVU A;  2A6T A;  3NAU A;  3CDI A;  4ZYD A;  1B6A A;  2CW8 A;  3QYE A;  3ZN0 A;  2F4I A;  4ZC3 A;  1KA8 A;  4X0G A;  5HOO A;  2KZG A;  4PFO A;  2CV0 A;  4AYB N;  1IUY A;  4QLC U;  2VIX A;  1TWF J;  1V55 H;  2RDP A;  4IQJ A;  1SD4 A;  3OR2 C;  2X51 A;  4MHG A;  3TO6 A;  4YIF A;  2BY1 A;  2BGC A;  3CCE I;  1PP8 F;  3MEX A;  3TL4 X;  2O8K A;  5IT9 Z;  2O3F A;  5ERI A;  3W6K B;  1SFK A;  4KIF A;  1HCR A;  4HNV A;  3DEW A;  3DU6 A;  2LBF A;  1BN5 A;  1ZGA A;  1Z05 A;  4OMY A;  5IP9 J;  1GXP A;  3D0S A;  3QQA A;  4B44 A;  3I64 A;  2M9H A;  2L2O A;  4ZYA A;  1JT0 A;  1F43 A;  3EUH A;  4BU2 A;  1WHU A;  2E1O A;  1VND A;  2MH9 A;  1IXR C;  2VBZ A;  1A6I A;  1JI8 A;  3BPX A;  4XKC A;  3G3Z A;  4WK8 F;  1I3A A;  2ZFW A;  5FRM A;  2M1B A;  3KZI C;  2RV8 A;  4GO1 A;  2VOO A;  2OD5 A;  2ZME B;  4KN7 X;  1LDJ A;  2ZFU A;  4XQF A;  2LK2 A;  3QP5 A;  4D9J A;  1G3Y A;  2ZXI A;  1K79 A;  2V6E A;  3DP7 A;  3OS1 A;  1FP1 D;  3MQ0 A;  2FU4 A;  3NQO A;  2JQ7 A;  3KYL A;  5FLX K;  3LOC A;  2P6T A;  1MMD A;  2VLA A;  1MBF A;  1L0O C;  3PQJ A;  2VB6 A;  2A68 F;  1KU2 A;  2ZC2 A;  4C9Y A;  3JAM K;  1UHM A;  4BAY A;  4CHU A;  4XN3 A;  1VQ4 I;  3H5R A;  1PDN C;  5JI6 A;  2CYY A;  5H2F C;  1DGR M;  3L2R A;  1B8I B;  3LMM A;  1USS A;  3DF8 A;  4MGR A;  4DBR A;  1GLN A;  2JUC A;  3ESW B;  1T2K A;  2VC1 A;  3JRF A;  4B1R A;  3JRE A;  2CU7 A;  3D5S C;  4ESB A;  5JVG F;  1NK2 P;  4IVN A;  3L2U A;  1YFH A;  2VQH A;  4AIJ A;  1LEA A;  1JKQ C;  4Q4Z F;  1WJE A;  3S3O A;  3WOD F;  4X6A J;  4M3D A;  4NDL A;  2VJ4 A;  2KRC A;  3OL3 A;  1DQU A;  5EEH A;  1A35 A;  3OSG A;  2HKX A;  5D5V B;  2LSO A;  1LDK B;  5B66 C;  2PMH A;  1QA6 A;  4B09 A;  1NK3 P;  4E7I A;  4KUM A;  1AA7 A;  3ABT A;  1PVE A;  3RKQ A;  4CGZ A;  4KIB A;  3HIF A;  3F3X A;  2V1D A;  3R0A A;  4PJ0 C;  1GDT A;  4A3F J;  2BVM A;  2DMT A;  1FNN A;  3I3L A;  2VPL A;  1QGP A;  1YW9 A;  1XSX A;  2WBM A;  3PL8 A;  3W2A A;  2V1N A;  5FD5 A;  4BXU A;  1H0M A;  4HA8 A;  5CVU A;  3WGG A;  4L9T A;  2E1C A;  4PFP A;  2CG4 A;  3MVP A;  3QYF A;  4UVC A;  1LE8 A;  4KIS A;  4BJ5 C;  1I3Q J;  5AON A;  5E8I A;  3I71 A;  2AS5 F;  1MMS A;  4LG3 A;  4RM3 A;  3HOW J;  3HZJ A;  4BJ6 C;  3BQY A;  2H6B A;  1T95 A;  1X2N A;  5F0H A;  5FKL A;  4BJT A;  2HYG D;  1W36 C;  1TLH B;  3QPL A;  3CMA I;  3JSO A;  1FT9 A;  5EYR A;  4XRM A;  4QPQ A;  1WJ5 A;  5F1J A;  1K4S A;  3G2B A;  3FMS A;  4M3G A;  1U8B A;  4C2M J;  1A31 A;  1DP3 A;  1Y6I A;  4M9X A;  3J81 K;  4NQW B;  4EJO A;  4BE1 A;  2NNY A;  5BOX A;  1XSD A;  4YFN F;  1XD7 A;  5EG0 A;  2RNJ A;  1MBG A;  1FJL A;  4GYI A;  1BOB A;  2NXN B;  3PO2 J;  2X6O A;  2M5W A;  3FM5 A;  3JCU C;  2VXZ A;  1QHH D;  2WY7 Q;  1BC7 C;  4O5V A;  2NNN A;  3K9T A;  1MNE A;  2KIU A;  5FD6 A;  3HSR A;  4CCL A;  1MGT A;  2VPR A;  3UKG A;  4RLF A;  1TQP A;  2BY0 A;  5DD4 A;  2L3D A;  4IHX A;  5ILV A;  2HFH A;  2KIQ A;  4IHT A;  3C2H A;  2QF7 A;  2EV6 A;  4PJJ A;  4Y3O A;  1X1A A;  1DDN A;  2ACJ A;  1WJD A;  1OJL A;  3CMM A;  5E1X A;  3N4M A;  1V3F A;  2VQL A;  2I5U A;  1NH3 A;  4RDU A;  3F8C A;  1XGS A;  1Z1D A;  3I59 A;  4IZZ A;  2D5V A;  5L3G A;  3J7Y J;  1MMN A;  2R5Y A;  3JRA A;  4C3J J;  3OIO A;  3W2V A;  4OIO F;  1MNM C;  1Y39 A;  2EFP A;  2DMU A;  4BKX A;  4HG2 A;  3OV8 A;  2ZSH B;  2MA3 A;  2DA6 A;  3HRS A;  2IPQ X;  3WGH A;  2WAD A;  1RI7 A;  2PJR A;  3CUO A;  2XIG A;  3DPT A;  2FBH A;  2VUM J;  2NAZ A;  2IGK A;  3OIP A;  4I98 B;  5J47 A;  1JTX A;  1WFX A;  3BG3 A;  4XLH A;  2XF6 A;  3GZN B;  3OS0 A;  4LG0 B;  2E2J J;  3GTG J;  4N4N B;  4S05 A;  2PMU A;  4DYQ A;  3I54 A;  5E3N A;  3S16 J;  2E71 A;  4WXC A;  2FML A;  5FFZ A;  2KRH A;  4AID A;  2G7H A;  2J5O A;  2MD5 A;  1BW5 A;  1T98 A;  3GFM A;  2EB7 A;  2XAJ A;  3J80 Z;  1XPX A;  1L3L A;  4HF2 A;  3MZH A;  2O6G E;  3M07 A;  2GOM A;  4Y33 A;  4CA0 A;  3C1D A;  2OC6 A;  4IEJ A;  5CJ9 A;  5A2Q K;  4OIR F;  3ZOB A;  2K3F A;  4Y17 A;  2RN7 A;  3AKZ A;  3C7J A;  1A6Q A;  1BR2 A;  2RQP A;  1SAU A;  3J81 Z;  4N9I A;  2VKV A;  2KHM A;  2LRE A;  3DFG A;  5H6R A;  3ZR8 X;  3FX3 A;  3AL0 C;  2L7K A;  4DW6 A;  4MIM A;  5JHU A;  1V5G A;  3CP8 A;  2Q0O A;  3VYT B;  1R00 A;  1Y1W J;  1E3O C;  2K40 A;  2XAQ A;  2DTZ A;  3H3U A;  3FHN A;  1XC5 A;  3R61 A;  2K4B A;  5IOY A;  5BPD A;  2KJC A;  2M30 A;  1ULY A;  5EZG A;  1YS6 A;  3CCS I;  1ETX A;  3BJA A;  2YU3 A;  3I9V 2;  1K6Y A;  1BIA A;  4D0P A;  2E1N A;  2XSJ C;  2HOE A;  1SC7 A;  1ZEL A;  4H0E A;  3A2K A;  4ANJ A;  1JUS A;  2A69 F;  2WA0 A;  4KNY A;  3GTO J;  3Q0W A;  5DUK A;  3PQK A;  2K7L A;  3EUA A;  5IYB J;  4HBL A;  3F22 A;  1RRJ A;  3F21 A;  1YLF A;  1PUF B;  2UZK A;  5M5X J;  3ERM A;  5D5X B;  4FE7 A;  3FMQ A;  1RKT A;  3O3K A;  4EGZ A;  5H6Q A;  4XK4 A;  1VQL I;  4IRH A;  1O3R A;  4IHV A;  4HZF A;  1WJC A;  4XLE A;  2IS1 A;  5FGM A;  5GAH J;  4S0H B;  3BCB A;  2KL4 A;  1OPC A;  3S2D J;  1JT6 A;  4UXN A;  2XKP A;  1X1C A;  5IP7 J;  2HDC A;  1X19 A;  4AVP A;  5K7F A;  1OFC X;  5DM7 F;  4HRI A;  2IS4 A;  5CQG A;  2KPM A;  3F8F A;  1SEU A;  3E3V A;  1G4D A;  1R1U A;  3CME I;  1T0F C;  4E7J A;  4XRF A;  4CZZ A;  3OYH A;  4EMS A;  1E3P A;  4ABZ A;  4L5J A;  1W36 D;  4DIQ A;  2ZO4 A;  1D0Z A;  2ICW G;  3TKY A;  5E20 A;  1KQ0 A;  2VKD A;  1OCZ H;  2VC0 A;  1MBJ A;  5ICF A;  4L0Z B;  1JGS A;  3FXK A;  1AKH A;  1ETO A;  1Z91 A;  2V7F A;  1B1B A;  4U0V A;  3F6O A;  4PJL A;  3HB9 A;  2GIZ A;  4HF0 A;  2HYJ A;  4U0W A;  2R7V A;  3HUG B;  2A05 A;  1P4X A;  4XSX F;  1MD0 A;  4DZJ A;  1VQO I;  4KFC A;  2HOT A;  1RIO H;  1S5L C;  2LMD A;  2OPT A;  3BT9 A;  4R1H A;  4YEL A;  1XGO A;  3F6V A;  2O5R A;  4XOT A;  1B72 B;  4J01 A;  1KZH A;  1ERD A;  1P4A A;  2CQX A;  3BJ6 A;  1OQY A;  5IPA A;  1WCM J;  3HRU A;  2HTJ A;  4OWR B;  2EIM H;  3E6M A;  4MTE A;  3K4N A;  3OYD A;  3BR1 A;  5DUI A;  2DU9 A;  1VQ7 I;  2CFO A;  4HST A;  1XMK A;  4DQ2 A;  4IOA F;  5CVV A;  2AQF A;  4BL0 B;  1UAA A;  1O7L A;  3MKZ A;  1W0T A;  1U9N A;  2GXA A;  3R60 A;  2QCO A;  3BG7 A;  5CVR A;  4BE0 A;  2XB0 X;  3BRO A;  3K70 C;  1IZ1 A;  4AU7 A;  2EA4 A;  4YFK F;  2M7A A;  3ABU A;  1QU3 A;  4A3D J;  2OTJ I;  1R5G A;  3LNQ A;  2OAZ A;  4XID A;  2LY1 A;  1QVT A;  3Q5F A;  2KFD A;  1GXQ A;  4RAG A;  3I58 A;  5FLM J;  2DOE A;  1HST A;  2F5C A;  3DKX A;  3G4S I;  4BEH B;  2NRA C;  2DMN A;  1K61 A;  3P9C A;  3LAJ A;  2WV1 A;  3AG3 H;  2QA4 I;  3HOY J;  2M3A A;  3DPU A;  3HDD A;  1MIJ A;  4HW0 A;  4QTR A;  3CD6 I;  3ZGK A;  2EQR A;  4RAY A;  2M0M A;  5EEG A;  2EV0 A;  4KIT B;  2FQ3 A;  3HXL A;  5HNF A;  1I39 A;  2V9P A;  1Z7L A;  2K3P A;  3IH3 A;  4II3 A;  1R36 A;  4GRI A;  3ZMZ A;  1CF7 A;  2W7N A;  2O03 A;  2LY9 A;  2LKX A;  4ITV A;  2QQB A;  1XN7 A;  4BUP A;  1HKQ A;  2WAQ A;  1AWC A;  3K1M A;  2VJJ A;  3SZG A;  3OYN A;  3BPV A;  3QYB A;  1H8A C;  2I8D A;  1HLV A;  1ZR4 A;  3RZO J;  3H1C A;  2LG4 A;  2MC3 A;  2XKO A;  3DQV C;  4KIG A;  1ZG3 A;  1W5C C;  4M9Z A;  1XCB A;  4I01 A;  1ORK A;  2L4A A;  3KP6 A;  3BR6 A;  3JRB A;  4I02 A;  4G9Y A;  3J7A Y;  2ZNY A;  2IA1 A;  4JYK A;  4LJZ F;  4RBO A;  2VE9 A;  2Z99 A;  2CMP A;  3WG9 A;  1XX5 A;  3BZ6 A;  4OU0 A;  4U7D A;  4RGS A;  1LB2 A;  3S14 J;  3ZQL A;  3FXJ A;  1O7F A;  3HKZ A;  3FIS A;  1P4W A;  1UG0 A;  5LBQ A;  4C3I J;  3KYD B;  4IRG A;  2IA0 A;  4LK0 F;  5L3F A;  4G94 A;  2L54 A;  2R7S A;  2KIM A;  5DCM A;  3AL0 B;  3BY6 A;  1GV2 A;  3PSF A;  2PLY A;  2CS3 A;  4UUV A;  2XSD C;  3GME A;  4CCN A;  1U5T A;  2K85 A;  2QZ8 A;  2LD5 A;  4XKV A;  2WWY A;  1YS7 A;  1GUU A;  1TNS A;  4M71 A;  4PK4 A;  4NNJ A;  2QLZ A;  3HPG A;  4UUS A;  5DV5 A;  1YQA A;  3MZ8 A;  5GAG J;  1RR7 A;  3EYY A;  2DA3 A;  5HDG A;  3RKY A;  2ISY A;  3TOB A;  4G7H F;  2B7E A;  3CJN A;  3GFL A;  3P5J A;  2CGP A;  2Q2E A;  3OY9 A;  2RGV A;  1B8I A;  2HU9 A;  5FFX A;  3ZPL A;  4L5E A;  4NB5 A;  5B1B H;  2GAU A;  3CCL I;  1X1D A;  2HI3 A;  5D4S A;  2DFH A;  3P9I A;  2E34 A;  3HOT A;  2MD0 A;  1BI0 A;  1TL8 A;  1UB9 A;  1ZRE A;  2FRH A;  3GXO A;  1TWC J;  2JRM A;  4P9F A;  4HNU A;  2DJN A;  2W85 A;  4CCM A;  2PBI A;  1EKE A;  1MBE A;  1UMQ A;  3L9F A;  5L3D A;  3EET A;  3I5U A;  2L01 A;  2NYX A;  3IKV A;  3SZP A;  5HDN A;  2VT3 A;  3DTE A;  4B8X A;  1IRG A;  2EFO A;  4KDP A;  4Y7N J;  1JHH A;  3GTP J;  2ZXH A;  5FLV A;  4E7S A;  2HPI A;  2Z33 A;  2LF7 A;  4FTH A;  2OF7 A;  4WX9 A;  2YS9 A;  1S7A A;  2X85 A;  3BJO A;  1YIT I;  5LHI A;  3ASN H;  4Q47 A;  2QUF A;  4QIW N;  2FX0 A;  3FDY A;  2RQQ A;  2FUG 2;  2M2E A;  2M8E A;  3RJP A;  3GLL A;  3LQR A;  2DA1 A;  4XKW A;  3IP4 B;  1W4M A;  5IP6 A;  3GTM J;  3QWL A;  4RMN A;  1E0E A;  2L9N A;  1DGW Y;  4XKB A;  4IXA A;  1QZY A;  1BR1 A;  4NC6 A;  4HDU A;  1Y0U A;  1LVK A;  4FT8 A;  4F91 B;  1TWH J;  4KA4 A;  2K27 A;  2IW5 A;  2E35 A;  4A12 A;  2GQQ A;  3W2W A;  4L0Y B;  1YI2 I;  1VQP I;  1BA5 A;  4JOM A;  1BI2 A;  5LFA A;  1P7I A;  4DJA A;  3SEZ A;  3B02 A;  2ECC A;  3IAS 2;  3SXY A;  3VYS B;  3OYK A;  4BQN A;  3K1N A;  1V54 H;  2M8G X;  1Z9C A;  1REP C;  4XOP A;  3OIQ A;  3L09 A;  1J5Y A;  1TWG J;  3IH2 A;  2K9Q A;  1O3S A;  5K5R A;  5ICC A;  2JA5 J;  2XGX A;  1C0W A;  4IF4 A;  3ZQH A;  2D45 A;  1DU0 A;  1D8K A;  2OBP A;  3PM1 A;  3OYG A;  2W24 A;  3KE2 A;  2ZJR F;  5EGO A;  1FX7 A;  1MMA A;  4RB1 A;  2ZNZ A;  1TT5 B;  2QSG X;  2X9D A;  1VQK I;  4NBQ A;  3T1B A;  1ZRF A;  3JRI A;  1DPU A;  2CRG A;  2H6C A;  4WF2 A;  2DQR A;  3K7A J;  4ZYG A;  3VWB A;  3CJR B;  2MW8 A;  4MQV A;  4FHT A;  4MQ9 F;  1YJN I;  2A3S A;  2PJR B;  3CP2 A;  5D6F A;  3L2C A;  4U0Y A;  3RIR A;  4IJA A;  2F6C A;  4ZYE A;  3JTH A;  4MNU A;  3E6B A;  3V4G A;  3S1R J;  2FEZ A;  1CQT A;  1QRY A;  2IXS A;  3FM3 A;  4BY1 J;  5CPR B;  1VQN I;  5M3F J;  1YTY A;  2GXB A;  1SD5 A;  2LC2 A;  5KHD A;  5AIQ A;  4YII A;  1GVD A;  4HF1 A;  4PGH A;  2IAI A;  1D5Y A;  2JSP A;  2K4J A;  4WXH A;  1FZP B;  5IT9 K;  2F48 A;  1EH8 A;  2RC4 A;  2V9V A;  2XF7 A;  3RYP A;  1QZZ A;  3GF2 A;  2F5F A;  1T0F A;  2L9S A;  1F9N A;  5F0F A;  3KP3 A;  3BCA A;  2VL8 A;  3BZK A;  2XAF A;  1D1A A;  1HSJ A;  2PMZ N;  1VFC A;  2Z1D A;  4N9H A;  3LFU A;  3SHF A;  5KNL A;  2EWN A;  3TGN A;  4L5I A;  5D6E A;  1RET A;  2VJ5 A;  4CSW A;  3GLX A;  5IYD J;  2X4H A;  2ZBK A;  4LLG F;  3E1S A;  1D5V A;  4XLN F;  3LSH A;  2K9M A;  1H89 C;  3BC8 A;  1UJ8 A;  3HRT A;  1ZG5 A;  4ENJ A;  3EDP A;  2DW4 A;  3MKW B;  3LA2 A;  4X1E A;  3F72 A;  1LNW A;  1ZYR F;  1VF9 A;  4PZJ A;  1B4A A;  1ETQ A;  3GO5 A;  2MYS A;  1KYW A;  2WAF A;  1I27 A;  3IV5 A;  5J1U A;  1IW7 F;  4K2E A;  3RPU D;  1R5I D;  1OR7 C;  4BQQ A;  3PJR A;  2BY2 A;  1RKW A;  3ZQG A;  3H9G A;  2RRE A;  3BLY A;  2DO7 A;  2JUG A;  3QPH A;  5HS7 A;  1OKR A;  1ZRC A;  1BW6 A;  2V9K A;  1BI1 A;  1FBQ A;  3H9J A;  1D1B A;  4GXO A;  4HQM A;  3EUH C;  3S8P A;  1WJF A;  1ONV A;  4G6T B;  1SAN A;  1XMX A;  3M7G A;  1IN7 A;  2R5Z A;  5CLS A;  3R4K A;  1SFX A;  1D8J A;  1U0J A;  2A07 F;  2HNH A;  5FB2 A;  4CYD A;  4ZTF A;  1MSF C;  1MMG A;  1TWA J;  2QQ9 A;  4Y52 J;  2KKO A;  2BW3 B;  3I4P A;  1I6H J;  5DM6 F;  1BC8 C;  3EPZ A;  2IGM A;  3KP7 A;  3U21 A;  3TP0 A;  2OZU A;  3FXM A;  5IOZ A;  3V7C A;  4AWX B;  2COM A;  5HLT A;  2BHZ A;  1PJR A;  1SVO A;  4F3Q A;  5GTH C;  4EJW A;  3SZT A;  4IHW A;  1FTZ A;  2V6C A;  1OYW A;  3H0G J;  1JGG A;  3BR3 A;  1G8X A;  2MC4 A;  3K6G A;  3I59 B;  3KEY A;  4UV8 A;  1IXC A;  5LHH A;  4LFU A;  1KGS A;  4A3C J;  1MSE C;  4EJV A;  4QPO A;  4M74 A;  2X0L A;  4FX4 A;  2EBI A;  4A0Y A;  5HDK A;  3PO3 J;  3WTY C;  4YFX F;  1JUP A;  1SMY F;  2E36 A;  4A0X A;  2GLO A;  2X1C A;  3T0Y A;  4UUT A;  4D1Q A;  4U88 A;  1U3E M;  3GWZ A;  1LPQ A;  3DWL E;  1K78 B;  4AIK A;  2PFB A;  3TO9 A;  3ZCO A;  4CO8 A;  3O8H A;  2L7M P;  2L7Z A;  1JUM A;  1BBY A;  1OCP A;  1IN5 A;  3CES A;  4B3X A;  5KAF C;  2MH2 A;  1QPI A;  4JBA A;  5ICG A;  1UHS A;  3S1Q J;  2H09 A;  3JR9 A;  2BBY A;  2HQR A;  1EF4 A;  3LAP A;  3W6J B;  1KU3 A;  2WAE A;  3LFK A;  5HNH A;  1HW1 A;  4M73 A;  3SQN A;  3KIO A;  2EZL A;  2D1H A;  2CQK A;  4UV9 A;  3HOV J;  3REO A;  4KT6 A;  3OYF A;  5K5Q A;  3H35 A;  3F8N A;  1DP7 P;  4Q5S F;  2ME6 A;  1J75 A;  4C2U A;  5M5Y J;  1WVR A;  4RS8 A;  2B0L A;  3V8K A;  4F55 A;  1EV7 A;  4FAS D;  1LE8 B;  3K4B A;  1S9H A;  1HDD C;  3FK6 A;  3K4J A;  2HXI A;  2OU2 A;  2R93 J;  1Z6R A;  1T33 A;  1ZHF A;  3PUB A;  2A5Y B;  2CQ7 A;  3S2W A;  2OTL I;  3S17 J;  3V7R A;  2ZJ2 A;  3QP6 A;  2EK5 A;  2FF4 A;  3VSL A;  4BBR J;  1FBS A;  1K7A A;  1RR8 C;  2FXA A;  2R7Q A;  1ZG1 A;  4GDF A;  2ADU A;  1ZN2 A;  3JW4 A;  4M3E A;  5GAE J;  1ENH A;  3WGI A;  4S04 A;  1ZK8 A;  3FBN B;  2MLK A;  5BS6 A;  4EGY A;  2RAE A;  2DA7 A;  5J1Y A;  4I0B A;  2NVT J;  1KQ8 A;  3Q3S A;  2BY3 A;  1SFO J;  2BVL A;  4A3E J;  3VFZ A;  4V19 K;  1P7J A;  4HOB A;  3HUG A;  3OYE A;  2QWW A;  1W5S A;  5D8K B;  3L00 A;  5E1Z B;  2L02 A;  2CJJ A;  4ENN A;  1IO2 A;  2Y31 A;  3IKT A;  1MDM B;  1TTY A;  4EJT A;  3LSP A;  5FKO A;  2R5Y B;  3V8J A;  2QSF X;  3TW7 A;  3CF5 F;  4BY7 J;  4M6V A;  3WU0 A;  3SJM A;  2RKH A;  4HLX A;  2EZI A;  3ASO H;  4A2U A;  2OUM A;  2DPU A;  2XC7 A;  3BG9 A;  2ZJQ F;  2Y9Y A;  3GZ5 A;  5BQT A;  5LEJ A;  2E1M C;  2AO9 A;  2W25 A;  1GVJ A;  1X4P A;  1MKM A;  1SVM A;  4M9S A;  1AU7 A;  5AIP A;  2B9S A;  4KMU X;  4GYG A;  4P55 A;  4I99 C;  4IHS A;  4AIH A;  2IGN A;  3BTC A;  1H9G A;  4XNF A;  3MCZ A;  2BYV E;  3RZD J;  3VOD A;  1YO5 C;  1WJB A;  2R7Z J;  5E18 F;  4FX0 A;  3O6B B;  4AVZ A;  4XSZ F;  3SDB A;  1UG2 A;  2P5K A;  4E7L A;  2F2E A;  5L3E A;  3U1K A;  1O4X A;  2KJB A;  2CV1 A;  4W1U A;  3TOA A;  2UUZ A;  2X6Y A;  5E79 C;  1FYL A;  3JTG A;  2HGC A;  2BV6 A;  3E5Q A;  4L18 B;  4LK1 F;  1YRN A;  4LB6 B;  2Z2S B;  3I4M J;  4RM2 A;  4KIC A;  1J9I A;  3VSK A;  4OAY A;  3CO6 C;  2EIN H;  3GTQ J;  1FEX A;  4UVB A;  2RVC A;  4FET A;  5J4Y A;  5E17 F;  2QQ8 A;  4A3M J;  2PMZ A;  2ZCW A;  3DLL F;  2ID6 A;  5E8G A;  2KP6 A;  4BDZ A;  4A6E A;  2D1V A;  5CYV A;  3MAJ A;  1DUX C;  5M5W J;  3KLN A;  3PNY A;  4BBS J;  3WHC A;  3BOQ A;  3CDH A;  3U1D A;  2VBX A;  2ID3 A;  2PX9 A;  3WU2 C;  2HPM A;  4IOC F;  1E3H A;  4CDG A;  4XRS G;  3R6S A;  2CWE A;  2HS5 A;  4BGD A;  4P1W A;  4EM2 A;  2E2H J;  2Z5U A;  3KZY A;  2Q8K A;  3GX4 X;  2MG4 A;  1FOY A;  3F8M A;  3FXO A;  4UB6 C;  4LIT A;  2TCT A;  1WZ2 A;  2Z9O A;  5DEQ A;  3ZRG A;  1KYZ A;  3LQQ A;  4JQF A;  2GWR A;  3M1E A;  1X2M A;  1IUF A;  4ZH4 F;  5TGT A;  4U7B A;  3PIP F;  3FWE A;  5FRO A;  5IYC J;  1CF7 B;  3FBI B;  1WGX A;  2JA8 J;  1XGN A;  3B6A A;  1N77 A;  2GA2 A;  2XGD A;  3G1L A;  2BOL A;  3ULQ B;  2AQE A;  3CCY A;  1IRZ A;  1IJW C;  1YHQ I;  3KLO A;  3ZMU A;  1BR4 A;  2Y30 A;  4M72 A;  1K6O A;  4FE4 A;  1P2F A;  3NAR A;  4A6D A;  3S1N J;  5GPA A;  3OWT A;  3T8R A;  2R0Q C;  2JT1 A;  2XPU A;  1NG6 A;  1ZGW A;  1U9O A;  3SYT A;  2CW7 A;  5F27 A;  1JKR C;  4OIP F;  4OIQ F;  5J40 A;  4E7Z A;  4LLN A;  2PEX A;  3CUQ B;  1ETY A;  2F4M B;  3FXQ A;  2GBY A;  4AUX A;  1FIP A;  2FNP A;  4PJM A;  1YW7 A;  3NRV A;  5LGT A;  3KZZ A;  2Y2Z A;  3BQZ A;  3LA7 A;  4XRS A;  4XL9 A;  1MDM A;  5M3M J;  3BZC A;  2HOA A;  3U2R A;  3HRM A;  3QOP A;  2PQ8 A;  3ZXS A;  5BPI A;  3DKW A;  1O57 A;  4A3B J;  3BTJ A;  5DCM B;  2W4S A;  2DK8 A;  2K9S A;  4DYC A;  2QEN A;  3MKY B;  3I0T A;  2LR8 A;  3HL2 A;  4EM0 B;  2HWV A;  1ODD A;  1ACI A;  2YX4 A;  3MKL A;  1B72 A;  1OCR H;  3BG6 A;  2L9V A;  1X58 A;  3QOD A;  3TMO A;  2DK5 A;  1LQ1 A;  3L2Q A;  5H20 A;  4PGG A;  1SVL A;  5E3M A;  5A2Q Z;  2C6Y A;  3JRH A;  4IQ4 A;  4GFB A;  1FY7 A;  1SD6 A;  2DT6 A;  2UV1 A;  5K1Y A;  3UR3 C;  5GPC A;  3GTK J;  4G12 A;  3RDI A;  2LLK A;  2UXN A;  3WTX C;  3FHZ A;  1IN6 A;  2HQ5 A;  3LWF A;  1UEL B;  5EJC A;  5J8F A;  4A3L J;  3GFJ A;  3DPL C;  4IHY A;  4C2T A;  3G1O A;  2DOA A;  1D0X A;  3WG7 H;  5TRD A;  1Y8R B;  2VQC A;  3TP3 A;  5GAD J;  5HOD A;  2R7U A;  3K1P A;  1EA3 A;  2P7V B;  1I5Z A;  5FKK A;  5ILU A;  3A0B C;  3BTL A;  4A3K J;  4BXX J;  2G7U A;  1XB4 A;  2BW3 A;  4I76 A;  3FK7 A;  4RAZ A;  3TED A;  3DBH B;  4NC8 A;  5BMZ A;  4XON A;  3C2G A;  1RUO A;  1F5T A;  3GEZ A;  3OMY A;  4I7H A;  1NHA A;  1STZ A;  3TDZ C;  1ZRD A;  3TO7 A;  2HQN A;  3OSF A;  3N97 A;  3WTW C;  2M4G A;  2QSH X;  1FC3 A;  2CUJ A;  1FOK A;  2MSY A;  4LGW A;  5KVR A;  3CCR I;  3HKZ N;  3BP8 A;  2FMY A;  1QBJ A;  3LSJ A;  4EAT A;  3D5L A;  3S3N A;  2O9L A;  3S1M J;  3FXU A;  2J5P A;  2Z16 A;  4BEH A;  3E0J B;  4JX6 A;  2EZH A;  1A36 A;  5J6X A;  1S8N A;  4UVA A;  4NHJ A;  2F5E A;  1JJ8 C;  2CW0 F;  3A0H C;  2JA2 A;  3W3C A;  3ZMS A;  4PDK A;  1VTN C;  1UZC A;  3SEQ A;  1UCR A;  2YSR A;  3KX2 A;  2HVR A;  1LKX A;  2WY8 Q;  2XRN A;  3RCO A;  2DQL A;  3KFW X;  2PN6 A;  3K4C A;  1FTT A;  3GVA A;  5D4R A;  1Z67 A;  2DFI A;  4CCO A;  1W5T A;  5LRR A;  3OYI A;  1U6G A;  1BL0 A;  3GTL J;  3HHG A;  4QSH A;  5DD8 A;  4CH7 A;  1J7K A;  3CJQ B;  2P81 A;  2ZXW H;  3RTR A;  4A93 J;  2ELH A;  1OYI A;  2EH3 A;  2VN2 A;  2LKP A;  1Y0N A;  2BHY A;  3L7W A;  1I50 J;  2GOX B;  3OYJ A;  1NTC A;  1VZ0 A;  5FKN A;  1HOM A;  4NC7 A;  4HQE A;  4BNC A;  1GV5 A;  2FD5 A;  3ABM H;  5JLX A;  4DZP A;  1VQM I;  5LEK A;  4Y15 A;  1B9N A;  3HG9 A;  3VB2 A;  2HQA A;  3PFI A;  2YU9 J;  1LEB A;  4A0Z A;  1G3W A;  1T6S A;  4C3H J;  1MBK A;  2XAG A;  5K5O A;  1W7P D;  2A61 A;  4BQA A;  5C44 J;  4JK1 X;  4LB5 A;  1Z3Y A;  1ETV A;  2F5D A;  3GTJ J;  2DA2 A;  3M8J A;  3QPS A;  4V2G A;  4L9V A;  5GTI C;  3K4K A;  3K4M A;  5EG0 B;  4D7M A;  3IRQ A;  2E2I J;  1IV8 A;  1J59 A;  2UWM A;  1MJ9 A;  2CUE A;  3S2H J;  1ZGJ A;  3PFY A;  1W0U A;  3G71 I;  2DOF A;  1RC9 A;  2ZME C;  1ZH5 A;  4H4K C;  1XMA A;  3LA3 A;  1GT0 C;  4ESF A;  5D5U B;  2F5V A;  3WHB A;  4MEY F;  1IRF A;  5EDN A;  3WTZ A;  3H0D A;  1UST A;  4Z2Y A;  3QU3 A;  2HEO A;  1MBH A;  1S6L A;  3BG5 A;  1V4R A;  5F04 A;  4YRV A;  1IGN A;  3VPR A;  5F08 A;  5JVT A;  3ZMT A;  1K4T A;  2ESH A;  2PJP A;  1BIB A;  5F6F A;  2VON A;  1WRJ A;  3ZQC A;  4F52 A;  4RB3 C;  5LD2 C;  3LSI A;  4DYR A;  1FMW A;  2GA1 A;  2K9N A;  3DBL B;  4KMF A;  4CIC A;  4XN0 A;  4Q48 A;  4BYY A;  3FMR A;  4ZDO A;  3SDG A;  3UNG C;  3HHH A;  2DFF A;  4E70 A;  2FA5 A;  2VOP A;  4M6X A;  2XPW A;  2IJL A;  2XPV A;  1X3Z B;  3F9K A;  3PNT A;  4DNC A;  1ITY A;  2V79 A;  4B3A A;  3C18 A;  3F23 A;  4MFD A;  2NVX J;  1U5T C;  3CLO A;  1A5J A;  1TW2 A;  1RNL A;  2P8T A;  2XUB A;  2QBY A;  4FQG A;  4RAF A;  4XM3 A;  2GM4 A;  4MFE A;  4GGG A;  1XDU A;  4LD5 A;  1FYK A;  1YIO A;  1XSV A;  2G9W A;  2VJI A;  3D5R C;  3H36 A;  1FOX A;  3NEU A;  4UHT A;  3EUK L;  3ECH A;  1G3S A;  3HOS A;  3C2B A;  3HBL A;  5ICE A;  1XS9 A;  4Y13 A;  2Z3Y A;  1T8I A;  5J1R A;  1ZLK A;  2LNB A;  2XHK A;  1TNT A;  4G6Q A;  2XGC A;  4G8X A;  2DT5 A;  2JN6 A;  2VKE A;  2JMW A;  1WJA A;  1G2H A;  5KCM A;  2DMP A;  5GP9 A;  1EH7 A;  3T8T A;  1OMI A;  2OA4 A;  3QOE A;  2ZB9 A;  2WAQ N;  3V8L A;  2HZD A;  3GZ6 A;  5EGO B;  1R4M B;  2M4K A;  2M34 A;  4MEX F;  3CF2 A;  2DA4 A;  2V26 A;  2LY2 A;  1GHC A;  1XDS A;  3FZV A;  3E97 A;  1T56 A;  1ON1 A;  2ELK A;  2EV5 A;  2I10 A;  2ELJ A;  2CUZ A;  4BXF A;  4RA2 A;  2XGE A;  5CKT A;  2E7W A;  1RUN A;  3HOZ J;  1IV6 A;  3E5U A;  1IAW A;  3AG4 H;  4EQQ A;  2JSC A;  1MND A;  3C3W A;  3ISP A;  2CQN A;  1YYV A;  2EIJ H;  1JKO C;  3H92 A;  4HSR A;  2UXX A;  4IRI A;  2R7O A;  2DPD A;  2HTS A;  5B3S H;  1R58 A;  2KIS A;  1ZR2 A;  1VQ9 I;  2QKM B;  2DDA A;  1V5F A;  4EEF G;  1FYM A;  1WQ2 A;  2EFQ A; 
#chains in the Genus database with same CATH homology
 4KYW A;  2QQA A;  3CTA A;  5E1W A;  2O0Y A;  5HLH A;  3K2Z A;  1XCV A;  2LDU A;  3ELK A;  4LMY A;  2YPR A;  4ZZD A;  1J2X A;  3V7S A;  2H27 A;  2IT0 A;  1HKS A;  2Y75 A;  5LGU A;  1DPR A;  1OR7 A;  3ZMV A;  6PAX A;  5HVQ C;  3VOE A;  1UFM A;  1H9T A;  1YW8 A;  2M45 A;  2FNA A;  2V1X A;  1IXS B;  1E2X A;  4BH9 A;  1PP7 U;  1MJA A;  2H94 A;  2HKO A;  1T38 A;  3RKW A;  3RYR A;  4RGX A;  2FSW A;  3BDD A;  1FSE A;  2VE8 A;  1UHW A;  4KN4 X;  3GFI A;  2XAH A;  3CO7 C;  5D8L B;  2ISZ A;  2EFW A;  2WTE A;  3E5X A;  5JR3 A;  3G73 A;  2EFN A;  3DXJ F;  5LGN A;  2IVM A;  3EYI A;  4LG0 A;  4F7Z A;  4WCG A;  3TQN A;  3GYH X;  3BWG A;  3J80 K;  1E17 A;  3DV8 A;  2K86 A;  4ENM A;  4R79 A;  3KP4 A;  2PG4 A;  5KK1 A;  5DCF A;  4BHP A;  1R23 A;  1U2W A;  3IC7 A;  1RZ4 A;  2JPB A;  2CSO A;  1R22 A;  3E6D A;  4HV5 A;  2ETH A;  4HX4 A;  4XBF A;  2DLL A;  3H3Z A;  1WWX A;  2R3S A;  1S7O A;  1FP2 A;  3ZQ7 A;  1W7P A;  3ZMD A;  5LRS A;  3HTS B;  1FSH A;  2VOD A;  4EV0 A;  1SFE A;  3P9K A;  3ECO A;  2FBI A;  3OOP A;  2XVC A;  4ESJ A;  4G6D A;  2KIF A;  2HR3 A;  3WTS C;  1A04 A;  2EA2 A;  3KEQ A;  3WTT C;  4ASN A;  1QPM A;  3P7N A;  2BE5 F;  5J8C A;  3GUD A;  5HLI A;  1S3J A;  4QWQ A;  5FLX Z;  4I09 A;  3VEP A;  1R7J A;  2JTV A;  1EH6 A;  1LDD A;  1P6R A;  2TDX A;  4L9J A;  2IP2 A;  2M87 A;  2P4W A;  1G6N A;  3CUQ C;  3RI4 A;  3WU1 B;  1HW2 A;  1R1V A;  1O3T A;  5F64 A;  4R8H A;  4MTD A;  3JAM Z;  1F4K A;  4UNO A;  4CXF A;  3QAH A;  3KET A;  1TBX A;  2IA2 A;  4HDV A;  1WI9 A;  3HYI A;  2YX7 A;  3T5X A;  3QRF F;  4N0B A;  1O3Q A;  1ZLJ A;  1Z6T A;  1I1S A;  3F8B A;  2OZ6 A;  4O3M A;  2VBW A;  1AOY A;  1QO0 D;  4AD9 A;  4PCQ A;  4A5M A;  1U78 A;  2IRF G;  4ETS A;  5HS9 A;  1P92 A;  3ZN1 A;  4RGR A;  1XGM A;  3R0J A;  5FO5 A;  4P9U A;  3IHU A;  4EM1 A;  2JZY A;  2STT A;  3QPT A;  4M6Y A;  2EJR A;  1J0R A;  1LJ9 A;  2NS0 A;  4I2O A;  3HSF A;  4EVI A;  1FLI A;  4BHB A;  5IT3 A;  1BJA A;  2DBB A;  4LLL A;  2HZT A;  3M8F A;  2MLG A;  5CVI A;  1OYY A;  1TQI A;  3J7A O;  2STW A;  3WTU C;  2E7X A;  5D5W B;  2Y0M A;  3COA C;  1D3Y A;  3LST A;  2BEO A;  5ILS A;  3EQL F;  5LLQ A;  2DI3 A;  2FE3 A;  3ML6 A;  4IPA A;  1R1T A;  3WE2 A;  3E6C C;  1B59 A;  2D2W A;  4BHC A;  1CGP A;  1IN8 A;  4HX8 A;  1S29 A;  2R7D A;  4RB0 A;  2XAS A;  5F1R A;  1MJB A;  3ERE D;  1WKM A;  5TJJ A;  3FXR A;  1KU9 A;  3DEU A;  4G7Z F;  3JSP A;  3IWZ A;  2FOK A;  2VT2 A;  4TV7 A;  1MZB A;  1G3T A;  1ON2 A;  2DTR A;  1KQ9 A;  3TDU C;  4O6J A;  3HSE A;  3O2P E;  4OOI A;  3IRR A;  2CO5 A;  2W84 A;  1IF1 A;  4KT5 C;  4I0A A;  2XV4 S;  3IL2 A;  3RKX A;  4ENK A;  3MWM A;  2DAO A;  2MBF A;  1QQI A;  1HKT A;  3SFZ A;  3KCC A;  4HV6 A;  2A6H F;  1T39 A;  2GXG A;  5HLG A;  4XLP F;  3GW2 A;  1BOA A;  1I1G A;  5DYM A;  5L3B A;  1FPQ A;  1HW5 A;  4RB2 C;  1TW3 A;  1SAX A;  1B9M A;  3WTV C;  1PUE E;  2WC2 A;  3Q9S A;  4L9N A;  1JHF A;  4ON0 A;  3B73 A;  1R5H A;  1SMT A;  2OQR A;  4ZYH A;  2ESN A;  3ZP5 A;  1JE8 A;  3HTU A;  5CVJ A;  1U8R A;  2WV0 A;  3I53 A;  4YG2 F;  1JXS A;  5L3C A;  1ZAR A;  3K0L A;  1BI3 A;  3CUQ A;  2Y48 A;  1F1Z A;  2ZXJ A;  3Q9V A;  2P5L C;  4EJU A;  1HQC A;  4GCV A;  2W57 A;  5JFR A;  5ED4 A;  3K69 A;  2P6S A;  4HX7 A;  2GIV A;  2O8X A;  4P5O A;  1X3U A;  3QU6 A;  2A6E F;  1HXD A;  2QBY B;  2XRO A;  1TQM A;  5LHG A;  1I6X A;  2R7F A;  2ZKZ A;  2LF8 A;  3KEO A;  1QNT A;  2GZW A;  5DDG A;  3IWF A;  1HBX G;  3FF5 A;  3MFK A;  3M9A A;  2VBY A;  2AXL A;  4HAM A;  2JRT A;  4WWC A;  1K78 A;  2PI0 A;  2K02 A;  4RGU A;  1Q1H A;  1IN4 A;  3ROU A;  2L4M A;  3RPQ A;  2QYO A;  4WXD A;  1YG2 A;  5HS8 A;  2QM3 A;  1ZAO A;  3WE3 A;  3AAF A;  2O61 A;  2FBK A;  3M8E A;  3RPU A;  2P5V A;  4ZZL A;  2KRF A;  1U5T B;  3KP2 A;  1WSU A;  2HYF A;  2YR2 A;  1W7P B;  1BM9 A;  4P96 A;  1SD7 A;  4A5N A;  2ZME A;  1Z7U A;  3KP5 A;  2CFX A;  4HLY A;  4HYE A;  4OMZ A;  4G7O F;  1SFU A;  3U9G A;  2P7C B;  2QVO A;  1FWZ A;  2V1U A;  3MZY A;  1LVA A;  2JPC A;  1KU7 A;  2OQG A;  1FBU A;  4NQW A;  4OIN F;  4ZYD A;  1B6A A;  3ZN0 A;  1KA8 A;  5HOO A;  1IUY A;  4QLC U;  2RDP A;  1SD4 A;  4MHG A;  3TO6 A;  4YIF A;  2BGC A;  1PP8 F;  3MEX A;  5IT9 Z;  2O3F A;  5ERI A;  3W6K B;  4KIF A;  1BN5 A;  1ZGA A;  1Z05 A;  4OMY A;  1GXP A;  3D0S A;  3I64 A;  3EUH A;  2MH9 A;  1IXR C;  2VBZ A;  3BPX A;  3G3Z A;  4WK8 F;  2ZFW A;  2M1B A;  2RV8 A;  4GO1 A;  2VOO A;  2OD5 A;  2ZME B;  4KN7 X;  1LDJ A;  3QP5 A;  1G3Y A;  1K79 A;  3DP7 A;  1FP1 D;  3MQ0 A;  2FU4 A;  3NQO A;  5FLX K;  2P6T A;  1L0O C;  3PQJ A;  2A68 F;  1KU2 A;  3JAM K;  1UHM A;  4BAY A;  4CHU A;  1PDN C;  5JI6 A;  2CYY A;  1USS A;  3DF8 A;  4MGR A;  1T2K A;  2VC1 A;  4ESB A;  4IVN A;  1YFH A;  4AIJ A;  1LEA A;  4Q4Z F;  3WOD F;  5EEH A;  2HKX A;  5D5V B;  2LSO A;  1LDK B;  2PMH A;  4B09 A;  4KUM A;  3ABT A;  4CGZ A;  4KIB A;  3HIF A;  3F3X A;  2V1D A;  3R0A A;  1FNN A;  1YW9 A;  1QGP A;  1XSX A;  5FD5 A;  4BXU A;  1H0M A;  4HA8 A;  5CVU A;  3WGG A;  4L9T A;  2E1C A;  2CG4 A;  4UVC A;  5AON A;  5E8I A;  3I71 A;  2AS5 F;  2H6B A;  2HYG D;  1TLH B;  3JSO A;  1FT9 A;  3FMS A;  4M9X A;  3J81 K;  4EJO A;  2NNY A;  5BOX A;  1XSD A;  4YFN F;  1XD7 A;  2RNJ A;  4GYI A;  2M5W A;  3FM5 A;  2VXZ A;  1BC7 C;  4O5V A;  2NNN A;  3K9T A;  2KIU A;  5FD6 A;  3HSR A;  1MGT A;  1TQP A;  5DD4 A;  2L3D A;  5ILV A;  2HFH A;  4IHT A;  2EV6 A;  1DDN A;  2ACJ A;  5E1X A;  3N4M A;  1V3F A;  3F8C A;  1XGS A;  1Z1D A;  3I59 A;  5L3G A;  4OIO F;  2EFP A;  3OV8 A;  2MA3 A;  3HRS A;  2IPQ X;  3WGH A;  1RI7 A;  3CUO A;  2XIG A;  3DPT A;  2FBH A;  2NAZ A;  4I98 B;  4LG0 B;  4S05 A;  2PMU A;  3I54 A;  4WXC A;  2FML A;  5FFZ A;  2G7H A;  2J5O A;  2MD5 A;  1T98 A;  3GFM A;  2EB7 A;  2XAJ A;  3J80 Z;  1L3L A;  4HF2 A;  3MZH A;  2O6G E;  3C1D A;  5CJ9 A;  5A2Q K;  4OIR F;  4Y17 A;  2RN7 A;  3C7J A;  2RQP A;  3J81 Z;  4N9I A;  3DFG A;  5H6R A;  3FX3 A;  5JHU A;  2Q0O A;  1R00 A;  2XAQ A;  3H3U A;  3R61 A;  2K4B A;  5BPD A;  2KJC A;  2M30 A;  1ULY A;  1YS6 A;  3BJA A;  2YU3 A;  1BIA A;  4D0P A;  2E1N A;  2HOE A;  4H0E A;  2A69 F;  4KNY A;  5DUK A;  3PQK A;  2K7L A;  4HBL A;  3F22 A;  3F21 A;  1YLF A;  2UZK A;  5D5X B;  3FMQ A;  3O3K A;  4EGZ A;  5H6Q A;  4IRH A;  1O3R A;  4HZF A;  5FGM A;  1OPC A;  4UXN A;  2XKP A;  2HDC A;  4AVP A;  3F8F A;  3E3V A;  1G4D A;  1R1U A;  4XRF A;  4CZZ A;  4EMS A;  4L5J A;  2ZO4 A;  3TKY A;  5E20 A;  1KQ0 A;  2VC0 A;  4L0Z B;  5ICF A;  1JGS A;  1Z91 A;  1B1B A;  4U0V A;  3F6O A;  4HF0 A;  4U0W A;  1P4X A;  4XSX F;  1MD0 A;  4KFC A;  1RIO H;  4R1H A;  1XGO A;  3F6V A;  1P4A A;  3BJ6 A;  3HRU A;  2HTJ A;  3E6M A;  4MTE A;  5DUI A;  2DU9 A;  1XMK A;  4DQ2 A;  5CVV A;  1O7L A;  3R60 A;  5CVR A;  3BRO A;  1IZ1 A;  2EA4 A;  4YFK F;  3ABU A;  1R5G A;  2OAZ A;  3Q5F A;  1GXQ A;  3I58 A;  1HST A;  2F5C A;  2NRA C;  3P9C A;  3LAJ A;  4HW0 A;  4RAY A;  5EEG A;  2EV0 A;  2FQ3 A;  1R36 A;  3ZMZ A;  1CF7 A;  2O03 A;  2QQB A;  1XN7 A;  1HKQ A;  1AWC A;  3K1M A;  3BPV A;  2MC3 A;  2XKO A;  3DQV C;  4KIG A;  1ZG3 A;  4M9Z A;  1XCB A;  4I01 A;  2L4A A;  3KP6 A;  4I02 A;  4G9Y A;  2ZNY A;  2IA1 A;  4LJZ F;  2VE9 A;  2Z99 A;  3WG9 A;  3BZ6 A;  4OU0 A;  4U7D A;  4RGS A;  1LB2 A;  1O7F A;  1P4W A;  5LBQ A;  4IRG A;  2IA0 A;  4LK0 F;  5L3F A;  4G94 A;  2L54 A;  2KIM A;  5DCM A;  3BY6 A;  4UUV A;  2PLY A;  1U5T A;  2QZ8 A;  2WWY A;  1YS7 A;  4M71 A;  1TNS A;  2QLZ A;  5DV5 A;  1YQA A;  3EYY A;  5HDG A;  3RKY A;  2ISY A;  3TOB A;  4G7H F;  3CJN A;  3GFL A;  2CGP A;  2Q2E A;  2RGV A;  5FFX A;  3ZPL A;  4NB5 A;  2GAU A;  5D4S A;  3P9I A;  3HOT A;  1BI0 A;  1UB9 A;  1ZRE A;  2FRH A;  3GXO A;  4P9F A;  2W85 A;  2PBI A;  3L9F A;  5L3D A;  3EET A;  3I5U A;  2L01 A;  2NYX A;  3IKV A;  3SZP A;  5HDN A;  2VT3 A;  4B8X A;  1IRG A;  2EFO A;  4KDP A;  1JHH A;  2Z33 A;  2LF7 A;  4WX9 A;  1S7A A;  3BJO A;  5LHI A;  4Q47 A;  2QUF A;  2M8E A;  3RJP A;  3LQR A;  1W4M A;  4IXA A;  1QZY A;  4HDU A;  1Y0U A;  4FT8 A;  4KA4 A;  2K27 A;  2IW5 A;  4A12 A;  2GQQ A;  4L0Y B;  1BI2 A;  3B02 A;  3SXY A;  1Z9C A;  1REP C;  3K1N A;  3L09 A;  1J5Y A;  1O3S A;  5K5R A;  5ICC A;  2XGX A;  1C0W A;  4IF4 A;  2D45 A;  1D8K A;  2OBP A;  2W24 A;  3KE2 A;  1FX7 A;  4RB1 A;  2ZNZ A;  3T1B A;  1ZRF A;  1DPU A;  2H6C A;  4WF2 A;  2DQR A;  4ZYG A;  4MQV A;  4FHT A;  4MQ9 F;  2A3S A;  5D6F A;  3L2C A;  4U0Y A;  3RIR A;  4IJA A;  4ZYE A;  3JTH A;  4MNU A;  3E6B A;  3V4G A;  2FEZ A;  3FM3 A;  1YTY A;  2GXB A;  1SD5 A;  5AIQ A;  4YII A;  4HF1 A;  4PGH A;  1FZP B;  2K4J A;  4WXH A;  5IT9 K;  1EH8 A;  2RC4 A;  2V9V A;  3RYP A;  1QZZ A;  2F5F A;  1T0F A;  3GF2 A;  1F9N A;  3KP3 A;  2XAF A;  1HSJ A;  4N9H A;  3SHF A;  2EWN A;  3TGN A;  4L5I A;  5D6E A;  3GLX A;  2X4H A;  2ZBK A;  4LLG F;  1D5V A;  4XLN F;  3HRT A;  1ZG5 A;  4ENJ A;  3EDP A;  2DW4 A;  3LA2 A;  3F72 A;  1LNW A;  1ZYR F;  4PZJ A;  1B4A A;  3GO5 A;  1KYW A;  1I27 A;  1IW7 F;  4K2E A;  2DO7 A;  3QPH A;  5HS7 A;  1OKR A;  1ZRC A;  1BI1 A;  1FBQ A;  4GXO A;  4HQM A;  1ONV A;  3M7G A;  1IN7 A;  5CLS A;  3R4K A;  1SFX A;  1D8J A;  2A07 F;  5FB2 A;  4CYD A;  2QQ9 A;  2KKO A;  3I4P A;  1BC8 C;  3KP7 A;  2OZU A;  3V7C A;  4AWX B;  2COM A;  4EJW A;  3SZT A;  2V6C A;  1OYW A;  3I59 B;  4UV8 A;  1IXC A;  5LHH A;  4LFU A;  1KGS A;  4EJV A;  4M74 A;  2X0L A;  4FX4 A;  4A0Y A;  5HDK A;  3WTY C;  4YFX F;  1SMY F;  4A0X A;  3T0Y A;  4U88 A;  1U3E M;  3GWZ A;  1K78 B;  4AIK A;  2PFB A;  3TO9 A;  4CO8 A;  1BBY A;  1IN5 A;  2MH2 A;  4JBA A;  5ICG A;  2H09 A;  2BBY A;  2HQR A;  3LAP A;  3W6J B;  1KU3 A;  3LFK A;  1HW1 A;  4M73 A;  3SQN A;  2D1H A;  2CQK A;  4UV9 A;  3REO A;  5K5Q A;  3F8N A;  1DP7 P;  4Q5S F;  1J75 A;  4RS8 A;  2B0L A;  3V8K A;  1EV7 A;  2OU2 A;  1Z6R A;  1ZHF A;  2A5Y B;  3S2W A;  3V7R A;  2ZJ2 A;  3QP6 A;  2EK5 A;  2FF4 A;  1FBS A;  1K7A A;  2FXA A;  1ZG1 A;  2ADU A;  1ZN2 A;  3JW4 A;  3WGI A;  4S04 A;  2MLK A;  5BS6 A;  4EGY A;  4I0B A;  1KQ8 A;  3VFZ A;  4HOB A;  3HUG A;  2QWW A;  1W5S A;  5D8K B;  3L00 A;  5E1Z B;  2L02 A;  4ENN A;  1MDM B;  3IKT A;  1TTY A;  4EJT A;  3V8J A;  3WU0 A;  2RKH A;  4HLX A;  4A2U A;  2DPU A;  3GZ5 A;  5BQT A;  5LEJ A;  2W25 A;  1GVJ A;  1MKM A;  4M9S A;  5AIP A;  4KMU X;  4GYG A;  4P55 A;  4IHS A;  4AIH A;  1H9G A;  3MCZ A;  2BYV E;  3VOD A;  1YO5 C;  5E18 F;  4FX0 A;  3O6B B;  4XSZ F;  2P5K A;  2F2E A;  5L3E A;  2KJB A;  3TOA A;  1FYL A;  3JTG A;  2HGC A;  2BV6 A;  3E5Q A;  4L18 B;  4LK1 F;  4LB6 B;  4KIC A;  1J9I A;  3CO6 C;  4UVB A;  2RVC A;  5E17 F;  2ZCW A;  5E8G A;  4A6E A;  2D1V A;  5CYV A;  3MAJ A;  1DUX C;  3KLN A;  3BOQ A;  3CDH A;  3U1D A;  2VBX A;  4CDG A;  3R6S A;  2CWE A;  2HS5 A;  4EM2 A;  2Z5U A;  3KZY A;  2Q8K A;  3GX4 X;  3F8M A;  2Z9O A;  5DEQ A;  1KYZ A;  3LQQ A;  4JQF A;  2GWR A;  3M1E A;  1CF7 B;  4ZH4 F;  4U7B A;  3FWE A;  1XGN A;  2GA2 A;  3ULQ B;  3KLO A;  3ZMU A;  4M72 A;  1K6O A;  1P2F A;  4A6D A;  3T8R A;  2JT1 A;  4OIP F;  4OIQ F;  4LLN A;  2PEX A;  3CUQ B;  3FXQ A;  2FNP A;  1YW7 A;  3NRV A;  5LGT A;  3KZZ A;  3LA7 A;  1MDM A;  3U2R A;  3HRM A;  3QOP A;  2PQ8 A;  5BPI A;  3DKW A;  1O57 A;  5DCM B;  2DK8 A;  2QEN A;  3I0T A;  4EM0 B;  2HWV A;  1ODD A;  2YX4 A;  2DK5 A;  1LQ1 A;  5H20 A;  4PGG A;  5A2Q Z;  2C6Y A;  1FY7 A;  1SD6 A;  5K1Y A;  3RDI A;  2UXN A;  3WTX C;  3FHZ A;  1IN6 A;  3LWF A;  5J8F A;  3GFJ A;  3DPL C;  5TRD A;  3K1P A;  2P7V B;  1I5Z A;  5ILU A;  2G7U A;  1XB4 A;  4RAZ A;  5BMZ A;  1RUO A;  1F5T A;  3GEZ A;  4I7H A;  1NHA A;  1STZ A;  3TDZ C;  1ZRD A;  3TO7 A;  2HQN A;  3N97 A;  3WTW C;  1FC3 A;  1FOK A;  4LGW A;  5KVR A;  1QBJ A;  3BP8 A;  2FMY A;  3D5L A;  3FXU A;  2J5P A;  5J6X A;  1S8N A;  4UVA A;  4NHJ A;  2F5E A;  2CW0 F;  3ZMS A;  4PDK A;  1VTN C;  1UCR A;  2YSR A;  2XRN A;  2DQL A;  3KFW X;  2PN6 A;  3GVA A;  5D4R A;  2DFI A;  1W5T A;  5LRR A;  1U6G A;  3HHG A;  5DD8 A;  1J7K A;  3RTR A;  2ELH A;  1OYI A;  2LKP A;  2VN2 A;  3L7W A;  4HQE A;  4BNC A;  5LEK A;  4Y15 A;  1B9N A;  3VB2 A;  3PFI A;  1LEB A;  4A0Z A;  1G3W A;  1T6S A;  2XAG A;  5K5O A;  1W7P D;  2A61 A;  4BQA A;  4JK1 X;  4LB5 A;  2F5D A;  3IRQ A;  4L9V A;  1J59 A;  2UWM A;  1MJ9 A;  1ZGJ A;  1ZH5 A;  1XMA A;  3LA3 A;  4ESF A;  5D5U B;  4MEY F;  1IRF A;  3WTZ A;  1UST A;  4Z2Y A;  3QU3 A;  2HEO A;  1S6L A;  1V4R A;  5JVT A;  3ZMT A;  2ESH A;  2PJP A;  1BIB A;  5F6F A;  2VON A;  1WRJ A;  4RB3 C;  2GA1 A;  4KMF A;  4CIC A;  4Q48 A;  4BYY A;  3FMR A;  3HHH A;  4E70 A;  2VOP A;  2FA5 A;  4M6X A;  2IJL A;  4DNC A;  2V79 A;  3C18 A;  3F23 A;  1U5T C;  3CLO A;  1TW2 A;  1RNL A;  2P8T A;  2XUB A;  2QBY A;  4GGG A;  1XDU A;  4LD5 A;  1FYK A;  1YIO A;  1XSV A;  2G9W A;  3NEU A;  4UHT A;  3ECH A;  1G3S A;  3HOS A;  5ICE A;  4Y13 A;  2Z3Y A;  1ZLK A;  2LNB A;  2XHK A;  1TNT A;  4G6Q A;  4G8X A;  2DT5 A;  1EH7 A;  3T8T A;  1OMI A;  2OA4 A;  3V8L A;  3GZ6 A;  4MEX F;  1GHC A;  1XDS A;  3FZV A;  3E97 A;  1ON1 A;  2EV5 A;  2E7W A;  1RUN A;  3E5U A;  1IAW A;  4EQQ A;  2JSC A;  3C3W A;  3ISP A;  1YYV A;  3H92 A;  2UXX A;  4IRI A;  2DPD A;  2HTS A;  1R58 A;  1FYM A;  1WQ2 A;  2EFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...