2V79A

Crystal structure of the n-terminal domain of dnad from bacillus subtilis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
MKKQQFIDMQEQGTSTIPNLLLTHYKQLGLNETELILLLKIKMHLEKGSYFPTPNQLQEGMSISVEECTNRLRMFIQKGFLFIEECEDQNGIKFEKYSLQPLWGKLYEYIQLAQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA REPLICATION PROTEIN DNAD
publication title Structure of the N-Terminal Oligomerization Domain of Dnad Reveals a Unique Tetramerization Motif and Provides Insights Into Scaffold Formation.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 36
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2v79A00
4UV8A 3WTTC 3SZPA 3HTSB 1LJ9A 1R1UA 3KP3A 4U7DA 2H27A 3LAJA 1DUXC 5ILVA 4NHJA 2XRNA 3JSPA 4RAZA 5J8FA 2DO7A 3IC7A 5FD5A 1JHHA 5F1RA 1UHMA 4LLNA 2VBYA 5D5WB 3BROA 2FMLA 3ZN1A 3NQOA 3QRFF 4HYEA 3IL2A 2UZKA 2IJLA 3J80K 3HSEA 3ABUA 2IVMA 4I7HA 4OIRF 2ZMEA 1SFXA 2JZYA 5L3FA 1K78A 5D8LB 3IKTA 1SAXA 1YW8A 3V4GA 4HX8A 3KP2A 3WODF 1ZG1A 3QU3A 5K5OA 2MLGA 3HHHA 2JTVA 1L3LA 3H3UA 3WG9A 4LD5A 5DCMA 3K2ZA 1XD7A 2P4WA 5LHGA 4GCVA 1ZAOA 3R4KA 1REPC 1U6GA 2ZNYA 2C6YA 1BC8C 2V1UA 2FNAA 4KUMA 3B73A 3DQVC 4HV5A 4BYYA 3KE2A 1FY7A 2QUFA 3EYYA 2MH9A 4XSXF 4G7ZF 2J5PA 2DFIA 3GF2A 2QQ9A 5TRDA 5JFRA 4G94A 4Z2YA 1YYVA 3RYPA 4NB5A 2M45A 1Z1DA 5ICFA 2BV6A 1U3EM 2V9VA 3OOPA 1IN8A 2UWMA 3K1PA 2K86A 1I27A 4G6QA 2ESHA 3ZP5A 2DU9A 4AIKA 1FSEA 5HS8A 3CO6C 3OV8A 1R22A 3MZYA 3J80Z 3FF5A 3GFIA 2EFWA 4TV7A 2PEXA 3ERED 3I53A 4AD9A 1D8KA 4I0BA 1J7KA 2R7FA 1PDNC 4IPAA 3ELKA 3GZ5A 1KU3A 2G7UA 3MWMA 1HKSA 4CICA 1CF7A 4OU0A 2RN7A 1BN5A 2XAJA 5E20A 5CVUA 3C3WA 1FPQA 3DV8A 3KP5A 5A2QK 2DLLA 3ZMDA 2LNBA 2ZBKA 2H94A 3ZN0A 4ENKA 1WWXA 1MGTA 4MHGA 4Y15A 3LQQA 5CJ9A 5E1XA 5FLXZ 1W7PB 3ZMUA 1YFHA 2PJPA 4FT8A 4BHBA 2DQRA 3PQJA 1F1ZA 2PBIA 4P96A 3JSOA 3BPVA 4HX7A 4RGUA 3L7WA 3RI4A 2Z33A 3ABTA 3WTWC 2RQPA 1F5TA 2XKOA 3P9CA 3PFIA 2VBXA 5LHHA 2H09A 3FMQA 5IT9K 2MBFA 2NNNA 1MDMA 3ML6A 2VT2A 1ZLKA 4IHSA 5HS9A 1G3TA 3QAHA 5KVRA 2HR3A 4WF2A 3DPTA 3C7JA 4RAYA 1XSVA 5AONA 1HQCA 4U0YA 4HDVA 4HQEA 4CYDA 1P2FA 1BI0A 3BDDA 4L5JA 1RIOH 2QYOA 4LK0F 5EEHA 2LDUA 4XLNF 1KQ8A 5HDGA 4E70A 5HDKA 3VEPA 4BXUA 1HW1A 2M8EA 3ZMSA 4D0PA 2FQ3A 3KEQA 2PQ8A 3MCZA 1R1TA 3HYIA 5A2QZ 2G7HA 5LLQA 1I6XA 4B09A 2NNYA 3E6MA 4RB1A 2W84A 5ICGA 2IA1A 3F8NA 2Z9OA 4LG0A 5F6FA 1EH7A 4BHPA 4ESBA 3FX3A 3F3XA 5BPDA 3F8BA 2EV0A 1IN6A 4P9UA 1S8NA 2KIFA 1YS6A 2DQLA 4ESJA 5JI6A 2BEOA 4AWXB 3FXQA 2P6TA 4GYGA 3IKVA 6PAXA 2MLKA 2R7DA 3RIRA 1FOKA 3CUOA 1Z6RA 4MEYF 3E3VA 2XAGA 4M71A 3P9IA 4A0ZA 4AIHA 4EQQA 2ZCWA 2BE5F 2GXBA 2CG4A 3TDZC 4UXNA 3KFWX 3NEUA 2FA5A 2FU4A 4UV9A 3QPTA 3ROUA 3W6JB 1FP1D 1P4AA 2P7CB 2Q0OA 2HWVA 2MH2A 2OU2A 4U0WA 4L9VA 1OYYA 4EV0A 1G3WA 1WRJA 4XSZF 1TQIA 3EUHA 3PQKA 3WGGA 2D2WA 2WC2A 1MJAA 3BWGA 4EMSA 3D5LA 5L3BA 3RKWA 1YS7A 2L01A 3WE2A 1U8RA 2OZ6A 2DW4A 1LDDA 3QU6A 2OA4A 1HW5A 2D45A 1WKMA 2VT3A 3FM3A 3CJNA 2LF7A 2ACJA 1O7LA 2HGCA 2DTRA 1XGMA 2IW5A 5BPIA 4CO8A 4WWCA 2JSCA 1XGSA 1D8JA 4HX4A 2YU3A 4WK8F 2L3DA 4A0XA 1U5TB 1GXPA 2K7LA 4FX4A 4LFUA 2K4JA 1G4DA 3N97A 1EH8A 1WI9A 5LBQA 3ECOA 3LA2A 4UVAA 2XKPA 3M7GA 3EQLF 2QVOA 2HYFA 4XRFA 4F7ZA 1QGPA 1ZH5A 2HOEA 1DP7P 5DD8A 2XIGA 1D3YA 1TBXA 3IRQA 3HUGA 2XAQA 3FXRA 2G9WA 2IT0A 2ELHA 3WTUC 1USSA 5FFXA 4U7BA 2ESNA 4JBAA 4KIGA 2STWA 1LDJA 3REOA 1T38A 3ISPA 3FM5A 1AWCA 5LRSA 4ENMA 5LHIA 1PP8F 1U2WA 2B0LA 5FD6A 4ZZLA 4KN4X 3T1BA 5D8KB 2WV0A 1MJBA 3KETA 4AIJA 4IHTA 4L18B 1B6AA 3RKXA 4S05A 3KP7A 2M1BA 2V1XA 2HDCA 4KN7X 5CVVA 1IXSB 1T39A 1O3SA 2PMHA 2VBWA 1R58A 2ZXJA 3LWFA 4KT5C 3C18A 4B8XA 3TO7A 4WX9A 1SMTA 2QZ8A 1J2XA 3I59B 4M9SA 3U9GA 2FXAA 1Q1HA 3CUQC 1J0RA 4P5OA 1HBXG 2HTSA 3P9KA 2NYXA 4YG2F 5AIQA 1OKRA 4OIPF 5HLIA 2EFPA 1QO0D 1O3RA 3M8EA 2VODA 3N4MA 3E6CC 4L5IA 1S3JA 3FMRA 5HDNA 2MD5A 3DF8A 1XSDA 4MTEA 2QLZA 1ON2A 2YPRA 2OQRA 1X3UA 3RPUA 3WGHA 4Q47A 3GFLA 5D6FA 3ZPLA 3Q9SA 3IWFA 1ZRCA 5L3DA 1F4KA 2DK5A 5L3EA 1FBSA 1IN4A 1R36A 2W85A 2F5DA 1IZ1A 1OYIA 3M9AA 3HRSA 1Z05A 1P4XA 4RB2C 4OMZA 4EGZA 3E5UA 5E1ZB 3WTVC 4KFCA 2YX4A 3E5XA 3G3ZA 4CXFA 1XGOA 3GW2A 4RB3C 5DEQA 2VE9A 1I5ZA 4CGZA 4CDGA 1QBJA 4I01A 3CUQA 3EDPA 1YW9A 4KICA 1ZN2A 3DKWA 5ICEA 3KP4A 5CLSA 1IF1A 4GXOA 2GAUA 3M1EA 5FB2A 3R61A 1YTYA 1K7AA 5LGUA 1BC7C 1EV7A 2F2EA 1FX7A 3QP5A 3T5XA 4WCGA 1JGSA 4HAMA 1S7AA 1XDUA 1IN5A 2PI0A 3QPHA 3GX4X 2FEZA 4HBLA 2HZTA 1G6NA 2IPQX 2HYGD 1RUOA 2QBYB 1IRGA 3TO6A 5LGTA 1L0OC 1FYLA 2UXNA 1FBUA 3E6DA 2M87A 2P5KA 4ETSA 4I09A 3TGNA 3L00A 2CWEA 1XCVA 3EYIA 3VODA 5L3CA 1J9IA 4H0EA 2QQAA 1XB4A 2VOPA 3F22A 1LNWA 3GO5A 1R1VA 3DP7A 5FFZA 1W5TA 1IAWA 3F23A 4L0YB 2HKXA 5EEGA 4R8HA 4U88A 2DI3A 5DUIA 1QZYA 4JK1X 1XN7A 2XHKA 3E5QA 3K1MA 1KGSA 2RVCA 2RKHA 3RPQA 1ONVA 3I5UA 5J6XA 2K02A 4LB6B 2OQGA 2ISZA 3LA3A 1MKMA 3E97A 4M9ZA 1MD0A 5BOXA 3VB2A 1QPMA 2YR2A 5TJJA 4ENJA 2L4MA 2OAZA 3F8FA 3SFZA 2IRFG 1YG2A 2PN6A 3KZZA 4EVIA 2P8TA 1ZARA 1IN7A 2OD5A 2KKOA 5DV5A 4LLGF 3W6KB 2EV5A 1V3FA 4WXCA 2H6BA 3JTGA 1IRFA 4RB0A 2E1NA 4O3MA 2OBPA 4HDUA 1BIBA 5JR3A 1CGPA 4LB5A 4OIOF 1RI7A 3K9TA 3GFMA 5BS6A 1BM9A 3H92A 2DT5A 4OOIA 4I98B 4P55A 1YLFA 2A6HF 1KQ9A 1SFEA 3E6BA 3IRRA 4WXHA 4L9JA 4JQFA 3F8CA 1PP7U 4HW0A 4Y13A 2KIMA 1J5YA 2L54A 2VC1A 2XV4S 1OPCA 1TQMA 5E17F 1BI3A 2CSOA 3AAFA 5IT9Z 2FSWA 2GZWA 3WE3A 1FP2A 2WWYA 3G73A 2Y0MA 5FO5A 2RV8A 3MQ0A 5DDGA 3WTYC 4BQAA 1NHAA 4EM1A 5LRRA 2EA2A 2VC0A 1FLIA 3V8JA 2FOKA 4FHTA 2TDXA 5JVTA 1W7PA 1QZZA 1B9NA 2A6EF 4YIIA 2EA4A 4LGWA 4GO1A 1QNTA 3GEZA 1J75A 1YQAA 5E8IA 5DD4A 1ULYA 5E8GA 3KLNA 2EWNA 3L2CA 4MTDA 2VBZA 1FYMA 4IRIA 1V4RA 1O3QA 1I1GA 1XMAA 4N9IA 5CYVA 3FMSA 3F8MA 2FF4A 4LJZF 2FMYA 3DPLC 2NRAC 1KA8A 5K5QA 3QOPA 2FRHA 2ZFWA 1H9TA 2P5VA 3LA7A 3O2PE 3R60A 2RNJA 4ZYHA 1LEBA 2Z99A 4HLXA 5CVRA 1C0WA 4KMFA 1W5SA 1R5GA 1VTNC 3FZVA 1G3SA 2CO5A 4O6JA 3JW4A 5LEKA 4MEXF 4DNCA 4EJVA 4QWQA 5ILSA 3COAC 5LEJA 5DYMA 1TW2A 4ZYDA 2A61A 1IW7F 1T2KA 2HTJA 4K2EA 4KMUX 3LFKA 1R7JA 3BJOA 2QENA 2HEOA 4PCQA 1RZ4A 5E18F 1KU2A 2YX7A 2E1CA 3L9FA 4M74A 5D4SA 4UVBA 1U5TC 2COMA 3I4PA 2ZMEB 2JPBA 3FXUA 4G6DA 1K78B 3BPXA 2O0YA 4BHCA 3EETA 2RDPA 2FBIA 1FT9A 2XAHA 1GHCA 2MA3A 2ETHA 1ZLJA 3R6SA 5JHUA 3GLXA 4M6YA 1OMIA 5L3GA 5CVIA 4ZYGA 2BYVE 4UVCA 5DCMB 3HOTA 3MZHA 2HQNA 2H6CA 2AXLA 4A6DA 4G8XA 2X0LA 3D0SA 4RGSA 3FWEA 4XLPF 1R23A 2K4BA 2ZNZA 1B59A 3CLOA 3DEUA 4I02A 4A5NA 4BH9A 1Z91A 2DPUA 5D5XB 4BAYA 3KZYA 3V8KA 4UUVA 1BI1A 1QQIA 4I2OA 2ZJ2A 4YFKF 5D5VB 4LLLA 3I54A 3LQRA 2IP2A 1T6SA 1ZYRF 2EFNA 5ILUA 4IVNA 4YIFA 3GVAA 3IWZA 4PZJA 1Z9CA 2MC3A 2F5FA 5IT3A 3V7RA 2V79A 4U0VA 5AIPA 1P6RA 5ICCA 3BOQA 2E7XA 5ED4A 4EM0B 3BJAA 2VONA 3K1NA 1LDKB 1U5TA 4Q5SF 2DBBA 3U1DA 2CGPA 1TNTA 4L9NA 3J81K 1JXSA 4DQ2A 1CF7B 2VOOA 5DUKA 5ERIA 4R1HA 5D5UB 4M6XA 2Q8KA 4N0BA 2FBKA 1I1SA 1JHFA 2GWRA 2Z5UA 4LK1F 3RTRA 2ISYA 3C1DA 1TW3A 3RJPA 3GYHX 1LEAA 1UFMA 3ZMZA 4S04A 2VE8A 2EV6A 2A68F 1BOAA 2V1DA 3SQNA 2D1VA 1RUNA 3ZMTA 5F64A 2M5WA 2QWWA 1HKQA 4QLCU 3IHUA 4IXAA 3S2WA 1USTA 3CO7C 3WTZA 2RGVA 4IRHA 1MDMB 3QP6A 2V6CA 5J8CA 4OMYA 1TQPA 4MQ9F 2ADUA 3ULQB 1OYWA 2GA1A 1YW7A 2P7VB 5H20A 3O6BB 5FLXK 4OINF 2XUBA 2XASA 2KIUA 1K6OA 2NS0A 3T8TA 4N9HA 1S6LA 1P4WA 2R3SA 3CDHA 4IJAA 2QQBA 3P7NA 3J81Z 2LKPA 3ZQ7A 2LSOA 4L0ZB 3I59A 1MJ9A 4A5MA 1ODDA 3RKYA 1YIOA 3DXJF 1BJAA 3GXOA 1ZRDA 3DFGA 1KU7A 1E2XA 2W57A 2CW0F 3RDIA 2EK5A 5K1YA 3M8FA 3TKYA 3HSFA 4LG0B 3U2RA 1J59A 1F9NA 4EJOA 4EJUA 1DDNA 1AOYA 5HLGA 3KCCA 1LQ1A 4HQMA 3J7AO 5HVQC 2FBHA 3TO9A 3NRVA 1HSJA 1KYZA 4L9TA 2E7WA 3R0JA 2OZUA 3WU0A 2HKOA 4G7HF 1B9MA 4UNOA 1TNSA 2ZKZA 1XSXA 4I0AA 5H6QA 2XGXA 1DPUA 5DCFA 3BY6A 3LSTA 4HOBA 1FSHA 1FNNA 1Z6TA 5FGMA 3R0AA 2AS5F 2EFOA 3K69A 4GYIA 4UHTA 4A12A 1B1BA 2KJCA 2CYYA 3WTSC 2D1HA 4AVPA 4PDKA 2P6SA 2JRTA 2VN2A 2F5CA 2O8XA 4M72A 4HF1A 2HFHA 1LB2A 3GUDA 4LMYA 3H3ZA 4MNUA 3TQNA 1O3TA 4M73A 3HHGA 4YFXF 3WGIA 2Q2EA 1W7PD 4WXDA 1FWZA 1BI2A 3Q9VA 2CQKA 4NQWA 3SZTA 4ASNA 4G9YA 1FYKA 1WQ2A 1D5VA 2W25A 3KP6A 1UHWA 3TOBA 3V7SA 2FNPA 5D4RA 1OR7A 2KRFA 3BP8A 2PLYA 1HKTA 3L09A 1TLHB 1XCBA 2STTA 4KDPA 3VFZA 2O6GE 1HXDA 2PG4A 1ZGAA 1GVJA 2K27A 4ON0A 2A69F 1KQ0A 2IA2A 4R79A 4KA4A 1SD5A 2QBYA 1ZREA 2F5EA 4ENNA 4RS8A 3O3KA 3GZ6A 4HA8A 3JTHA 2KJBA 2L02A 2Y75A 5K5RA 1IUYA 3HSRA 1GXQA 3KEOA 3BJ6A 4HZFA 1E17A 5HS7A 2DK8A 2RC4A 4YFNF 1SD7A 1H9GA 2DAOA 1O57A 2GA2A 4HF0A 3HTUA 2ZO4A 2J5OA 2A5YB 5H6RA 1ON1A 1UB9A 2JPCA 3CTAA 3F72A 2NAZA 2A3SA 1B4AA 5E1WA 3T0YA 4IRGA 3V7CA 1IXRC 2A07F 3FHZA 3SHFA 3T8RA 3TDUC 4OIQF 4XBFA 1UCRA 3VOEA 2O3FA 3WU1B 4Q48A 3MFKA 3F6OA 1WSUA 5CVJA 2O61A 2Y48A 1SD6A 1KU9A 1JE8A 1W4MA 3F21A 2XAFA 4ZYEA 5BQTA 2QM3A 3RYRA 3F6VA 3GFJA 1XMKA 3Q5FA 1IXCA 4ZH4F 4KNYA 1FC3A 2O03A 1FZPB 4ESFA 2M30A 3JAMK 4A6EA 2GQQA 1G3YA 5HOOA 2GXGA 4RGRA 4EJWA 5KK1A 3WTXC 3V8LA 3LAPA 1O7FA 2PFBA 1HSTA 4IF4A 3I58A 1ZG3A 3TOAA 2GIVA 1PUEE 3ZMVA 4O5VA 1FBQA 4P9FA 1XDSA 3HRUA 1BIAA 2W24A 4HF2A 1SFUA 2HQRA 3HRTA 5HLHA 2EJRA 1S29A 4PGGA 1ZG5A 1BBYA 3KLOA 4FX0A 4ZZDA 2VXZA 1KYWA 4M9XA 2WTEA 4PGHA 2PMUA 3HIFA 4EJTA 4MGRA 2X4HA 3I64A 4CZZA 1SMYF 2BBYA 3GWZA 1XGNA 3BZ6A 1T98A 1STZA 2EFQA 1Y0UA 4HV6A 2HS5A 4EGYA 2DPDA 1ZHFA 2Z3YA 4A2UA 1R5HA 4EM2A 2YSRA 4A0YA 1K79A 2BGCA 4MQVA 4KIFA 1ZRFA 1U78A 1YO5C 3K0LA 1A04A 4RGXA 2XROA 1P92A 1SD4A 2IA0A 4HLYA 4Q4ZF 3CUQB 3SXYA 1ZGJA 1T0FA 1TTYA 1S7OA 3JAMZ 3HOSA 1RNLA 3I71A 4KYWA 4KIBA 2JT1A 1HW2A 1EH6A 3ECHA 1LVAA 4G7OF 5D6EA 4GGGA 2EB7A 3MEXA 4CHUA 2FE3A 1R00A 2CFXA 2LF8A 4BNCA 4Y17A 3I0TA 3B02A 1DPRA 2XVCA 2UXXA 1Z7UA 1H0MA 5LGNA 2L4AA 3HRMA 2P5LC 3MAJA 5BMZA 1MZBA
chains in the Genus database with same CATH superfamily
4UV8A 3WTTC 3DBRB 2BXZA 3G71I 3BZCA 3SZPA 2ZJRF 3HTSB 1JUSA 1LJ9A 1R1UA 3M1CA 3KP3A 4AYBA 4G12A 2WY8Q 1ETYA 2YU9J 1ETXA 3Q0UA 2QEXI 3OYGA 4U7DA 1VQLI 2H27A 4RMNA 3LAJA 5JLWA 1DUXC 1X3WB 3JCUC 5ILVA 4NHJA 2XRNA 3JSPA 4RAZA 3PNYA 4QSHA 5J8FA 2DO7A 3OYEA 3K70D 3EUKL 2DFHA 3S1MJ 3IC7A 3GZNB 4L5EA 5FD5A 3PO2J 1JHHA 5F1RA 1WJDA 4IKFA 1UHMA 2V4JC 1ETOA 5EF6A 1JKRC 4LLNA 2M2EA 1QZEA 2CMPA 2VBYA 4NC6A 5D5WB 1WVRA 1Y56A 4IOCF 3BROA 2JA5J 2JUGA 3LOCA 2FMLA 4DBQA 4IX7A 3ZN1A 3BZKA 3NQOA 3QRFF 4HYEA 1TT5B 3FBIB 3IL2A 2UZKA 3JRFA 2IJLA 2IEKA 3J80K 3HSEA 2VKVA 2NOGA 3ABUA 2IVMA 4I7HA 4OIRF 2W4SA 3AG3H 4RAFA 4BKXA 3W2AA 2IS2A 2KDOA 2ZMEA 4ZC3A 3GTJJ 5EGOB 1SFXA 2JZYA 5L3FA 1K78A 2Y31A 3DPUA 3H9GA 5D8LB 3IKTA 1SAXA 3AL0B 1I3AA 1YW8A 3IH2A 1DGRM 5FLVA 4NC7A 3OYFA 3FXOA 4HX8A 3KP2A 3V4GA 3CD6I 1I39A 3DU5A 1W5CC 3WODF 1ZG1A 3QU3A 5K5OA 4IO9F 2MLGA 3HHHA 4N4NB 2JTVA 4Y4RA 1BW6A 3KZIC 2LK2A 5J40A 1SVLA 1L3LA 3H3UA 3GTLJ 3WG9A 4LD5A 3K10A 3BR0A 2OCCH 1R71A 1UMQA 5DCMA 3LSGA 3ZOBA 3K2ZA 1XD7A 2BW3B 2P4WA 5LHGA 4GCVA 4W97A 1ZAOA 3R4KA 1REPC 1U6GA 3MN2A 3I9V2 2ZNYA 2C6YA 1BC8C 3DCFA 2V1UA 2FNAA 2DMPA 4E7SA 4KUMA 3B73A 3DQVC 4HV5A 2D5VA 2AO9A 4BYYA 1JUMA 3KE2A 2EBIA 2K9QA 1LFUP 1FEXA 1FY7A 4CYCA 2QUFA 3EYYA 2MH9A 4XSXF 4G7ZF 2J5PA 3WHBA 4BXFA 2DFIA 2HZDA 3GF2A 4A3LJ 2QQ9A 5TRDA 5JFRA 4G94A 5CPRB 3HJEA 3ZQGA 4Z2YA 3ZQQA 2DT6A 1YYVA 2AXTC 3W2WA 3RYPA 4NB5A 3HOXJ 2M45A 3W2VA 3JRBA 1Z1DA 5ICFA 2BV6A 3HOZJ 2M8GX 1U3EM 2V9VA 3OOPA 1IN8A 2DMUA 2UWMA 3K1PA 2K86A 1APLC 5LD2C 1JKQC 1A5JA 3E0JB 1I27A 4G6QA 2LRDA 1I3QJ 2ESHA 3BT9A 3ZP5A 2ECCA 2DU9A 3TW7A 4PK4A 4XOTA 2Y2ZA 1FSEA 5HS8A 3CO6C 4AIKA 3BCAA 3OV8A 1SANA 2MG4A 4MFEA 1R22A 3MZYA 2LP0A 3J80Z 2HPMA 3FF5A 3GFIA 3S2HJ 2EFWA 5FROA 1MSFC 3G1LA 2TCTA 2BOLA 4TV7A 2EZKA 1X1AA 2PEXA 3ERED 3I53A 4JX4A 3D5RC 5F1JA 4AD9A 4UB6C 1D8KA 3K4JA 3H9JA 4I0BA 1J7KA 2R7FA 1PDNC 4IPAA 2E19A 4V19K 1H88C 3ELKA 2OUMA 3GZ5A 1KU3A 2G7UA 3MWMA 1HKSA 4CICA 5EG0B 2FUG2 2M3AA 1CF7A 4OU0A 2RN7A 1W36D 1BN5A 2K85A 2XAJA 3JRDA 5E20A 5CVUA 4AIDA 3C3WA 1FPQA 2ID6A 3DV8A 4LIUA 2DA3A 2JWTA 3VYTB 2IGNA 2DXIA 1FIPA 3KP5A 3FK6A 1BR1A 4XLHA 5A2QK 2DLLA 3ZMDA 3A01A 2LNBA 2ZBKA 2H94A 3ZN0A 3W6VA 3L2VA 4ENKA 1WWXA 2NVTJ 1MGTA 1H8AC 3H0GJ 4MHGA 4Y15A 3VYUB 2DA2A 3LQQA 5CJ9A 5E1XA 4YEJA 2DMNA 1MMGA 5FLXZ 3QODA 2KMUA 1W7PB 3ZMUA 1YFHA 1Y1WJ 2PJPA 4FT8A 4BHBA 2DQRA 3KEYA 1AKHA 3PQJA 1F1ZA 2PBIA 2PJRB 3WG7H 1MNDA 4P96A 3JSOA 3BPVA 4HX7A 4RGUA 3L7WA 3RI4A 2Z33A 3OIPA 3QPSA 5JHFA 3ABTA 5LFAA 3WTWC 1MBKA 2RQPA 1TWHJ 1MIJA 1F5TA 1P7JA 2XKOA 3P9CA 3PFIA 3OSGA 2VBXA 5LHHA 2H09A 3FMQA 2RREA 5IT9K 2MBFA 2KPMA 1M1EB 2NNNA 4ITVA 3K4KA 1MDMA 3VSKA 1XTAA 3ML6A 2VT2A 1YJWI 1ZLKA 4IZZA 4IHSA 5HS9A 1VNDA 1G3TA 1JKOC 2F48A 2W1OA 3QAHA 5KVRA 2HR3A 4WF2A 3DPTA 3C7JA 4RAYA 1XSVA 3LFUA 3JRHA 5GAGJ 1B8IB 3IH4A 3K4LA 5AONA 1HQCA 4U0YA 4HDVA 3RQIA 2DOEA 3M07A 4HQEA 3K4NA 1P2FA 3CJQB 4CYDA 3ZQLA 1BI0A 3BDDA 4L5JA 1K61A 1X2MA 2K3FA 1MBEA 1HCRA 1RIOH 2QYOA 3EUHC 2Q1ZB 4LK0F 4N4OB 5F27A 5EEHA 3UNGC 1WJAA 3H5AA 2LDUA 3PO3J 4XLNF 2XC7A 1KQ8A 4BS9A 5E3LA 2ZSHB 1Z3YA 2BHZA 5HDGA 4E70A 5HDKA 3VEPA 4BXUA 1D1BA 1HW1A 2V7FA 1S5LC 1KONA 2M8EA 3ZMSA 4D0PA 4BQOA 2ZB9A 5B3SH 4RDUA 2FQ3A 3KEQA 2HDWA 1K83J 3TL4X 2LY9A 2PQ8A 3MCZA 3S3OA 1R1TA 3HYIA 5A2QZ 2G7HA 2AQFA 5HODA 5LLQA 1I6XA 4B09A 4A3KJ 1PYVA 2NNYA 1UAAA 3E6MA 4RB1A 2W84A 5ICGA 4OAZA 2IA1A 3F8NA 2Z9OA 4LG0A 2NVUB 1E3OC 2I5UA 4XKBA 5F6FA 3HKZN 5HNFA 5CQEA 1EH7A 1YOVB 4BHPA 3S17J 4ESBA 5C3EJ 3FX3A 3F3XA 5BPDA 3F8BA 2CW8A 2EV0A 1IN6A 2L9NA 4P9UA 4BL0B 1S8NA 2HDDA 2KIFA 2LLKA 2H1LA 1YS6A 1V5FA 3OR2C 3CJRB 2DQLA 2KIQA 5JI6A 3LSPA 4ESJA 2ZFUA 4X6AJ 1R5ID 2BEOA 5KNLA 4AWXB 3ZQCA 2UUZA 3FXQA 2P6TA 2B9SA 4GYGA 3IKVA 6PAXA 2MLKA 2R7DA 3RIRA 1FOKA 3CUOA 3LSMA 4C9YA 4KITB 3HKZA 1Z6RA 4MEYF 2DJNA 3E3VA 2XAGA 2HNHA 4M71A 2W00A 2XAUA 3P9IA 4A0ZA 4AIHA 2R0QC 4EQQA 2ZCWA 2BE5F 3TBIA 4HNTA 2XPWA 2GXBA 2CG4A 3TDZC 4M3FA 4UXNA 3KFWX 3BR6A 4AM3A 5FRMA 3NEUA 2FA5A 2FU4A 2Z16A 3DKXA 2R7RA 4UV9A 1ZGWA 3QPTA 3ROUA 3W6JB 5F0CA 1FP1D 1P4AA 4DZPA 3JR9A 2P7CB 2XGCA 2Z1DA 2O8KA 2B63J 2Q0OA 2L7MP 2DN0A 2HWVA 2MH2A 2E2HJ 2OU2A 3HPHA 3CLQA 4U0WA 3NAUA 4L9VA 2LY1A 1RETA 1OYYA 2LR8A 1ZTRA 3CJTB 5J1UA 4EV0A 3OYBA 1BL0A 1MMNA 1G3WA 1A31A 4XLCA 1WRJA 4XSZF 1UHSA 4C2UA 1TQIA 2LKXA 3EUHA 3PQKA 2EIMH 3AKZA 3WGGA 2VIXA 2D2WA 2WC2A 1HC8A 3FK7A 1MJAA 3BWGA 1RKTA 1EA3A 3Q0WA 1MMSA 4EMSA 3KPHA 3JRCA 4A69C 3D5LA 4CSWA 5L3BA 3RCOA 3A2KA 3RKWA 1YS7A 2L01A 3ZQHA 2VKDA 3WE2A 3OOUA 1TT0A 1U8RA 2OZ6A 1S9HA 2DW4A 1TL8A 1LDDA 3QU6A 1Y0NA 2OA4A 1HW5A 2XGDA 2QSFX 2D45A 2QF7A 2JVHA 1WKMA 2VT3A 2E2JJ 3FM3A 3CJNA 2LF7A 3RKQA 2ACJA 1X1CA 1O7LA 3RQ4A 2HGCA 2LTPA 2DTRA 4IEJA 1XGMA 1PUFB 5M3MJ 2IW5A 2H8RA 5BPIA 3E7LA 4CO8A 2CQNA 4WWCA 2JSCA 1J09A 1XGSA 3CDLA 1D8JA 4HX4A 2YU3A 1DGWY 4WK8F 2YUSA 2L3DA 4A0XA 1NH3A 1U5TB 1GXPA 1QVUA 3FKJA 1LPQA 2K7LA 4FX4A 1JT6A 1SFKA 3FXKA 4LFUA 1WZ2A 2K4JA 2IS6A 1G4DA 3N97A 2KHMA 1EH8A 3F9KA 1WI9A 5LBQA 1WI3A 4AUXA 3ECOA 3LA2A 4YIRX 2AHQA 3KIOA 3TP3A 1YITI 4UVAA 2XKPA 3M7GA 2KRHA 3EQLF 4BBRJ 2QVOA 2HYFA 2MFZA 2VI6A 4XRFA 4ZJZA 4F7ZA 5EEAA 3S3MA 1QGPA 1D0YA 3AG2H 4A3MJ 1ZH5A 2M0CA 2O9LA 2F4MB 2HOEA 2XRLA 2WADA 3LSRA 3AG4H 4XLAA 5DD8A 3JRIA 4E7LA 1DP7P 2XIGA 2HOTA 1D3YA 1TBXA 2HYJA 3IRQA 3HUGA 4FISA 2XAQA 3FXRA 2G9WA 2IT0A 4DIQA 1TP4A 5TISC 1QA6A 2ELHA 2MC4A 3WTUC 2RAEA 1Y8QB 2R93J 1USSA 5FFXA 4U7BA 2ESNA 3SJMA 4A3IJ 3IUOA 4JBAA 3KYDB 4KIGA 2STWA 2O5RA 1MMDA 1WJCA 1O4XA 2HU9A 5EJCA 1H89C 1SVOA 1P7IA 1LDJA 2K40A 5IP7J 3REOA 1T38A 1X2NA 3ISPA 3FM5A 3I55I 1AWCA 1IRZA 5LRSA 1X1BA 4ENMA 1D5YA 5LHIA 1PP8F 3VPRA 1PVEA 4B1RA 2M7BA 4XKWA 5IOYA 1U2WA 2B0LA 2NVYJ 5FD6A 1D0XA 4ZZLA 4CCMA 2LVSA 2M9HA 3CC7I 4KN4X 3H9QA 4XLEA 4BXXJ 4B4CA 3QOEA 1QU3A 3T1BA 5D8KB 1DQUA 3DLAA 1XMXA 4RM3A 4IOAF 1LKXA 2WV0A 3J7ZI 1MJBA 2CUEA 1FOYA 3KETA 4AIJA 4IHTA 4L18B 1B6AA 1NTCA 3RKXA 4S05A 3KP7A 4M3EA 4J00A 2M1BA 4A3CJ 2V1XA 2HDCA 1D1AA 1YJ9I 4KN7X 5CVVA 1IXSB 1T39A 2DA7A 1JKPC 3GCMA 4XMYA 1O3SA 2PMHA 3H5RA 2VBWA 1R58A 2ZXJA 3CCRI 3LWFA 4KT5C 4J19A 3C18A 4B8XA 3TO7A 4CCLA 4LITA 4WX9A 2E36A 1SMTA 2QZ8A 1J2XA 3I59B 4M9SA 3C2HA 3U9GA 2FXAA 1Q1HA 3CUQC 3ZXSA 4U87A 1BW5A 2FOWA 3KX2A 1J0RA 4P5OA 1GVDA 1SVMA 4B48A 1HBXG 2O7OA 2HTSA 3P9KA 1TZLA 2NYXA 3ABLH 3MVPA 4YG2F 1T08B 5AIQA 4Y3OA 4OWRB 1OKRA 1UELB 5CKTA 3L2WA 1HF0A 1VQMI 3HOUJ 1XS9A 4OIPF 4LIVA 5HLIA 1DU6A 2EFPA 1QO0D 2CH0A 1O3RA 2MSYA 3M8EA 2VODA 3N4MA 3E6CC 2VJ5A 3BG7A 4L5IA 3CCMI 1VQ8I 4E7KA 2HVSA 3FXMA 1S3JA 3FMRA 5HDNA 2L5QA 3S93A 2RQQA 1LE8B 2MD5A 3BC8A 3DF8A 5E79C 3PIOF 1XSDA 4MTEA 5GPAA 2QLZA 1ON2A 2YPRA 2OQRA 3QWLA 5BNGA 5DTDA 1X3UA 3RPUA 3WGHA 2E35A 1Z3XA 4Q47A 3GFLA 3OYKA 1T33A 4C3HJ 4W1UA 5D6FA 3ZPLA 3Q9SA 3ABMH 3IWFA 3BTIA 1ZRCA 5K7HA 1IV8A 1D0ZA 4QIWN 5L3DA 1F4KA 2DK5A 5L3EA 4J01A 1FBSA 1IN4A 3GTGJ 1R36A 2W85A 2R7QA 2HQ5A 2BY1A 2F5DA 2CV0A 2R7TA 1IZ1A 1OYIA 2OV7A 2L9RA 2WY7Q 2L0KA 2Z2SB 3M9AA 4BEHB 3HRSA 1Z05A 2BHYA 1S7EA 1P4XA 2E5ZA 4RB2C 4OMZA 1X19A 3CMEI 4MO7A 4EGZA 4C2MJ 1JJ6C 3E5UA 5E1ZB 3WTVC 2DDBA 5GAHJ 4KFCA 2YX4A 4CCKA 5M3FJ 3E5XA 4JOMA 3G3ZA 3CP8A 4CXFA 1XGOA 1B72B 3GW2A 4XORA 2X85A 2KDZA 2E60A 4RB3C 1Y1VJ 5DEQA 1WGXA 1TWFJ 1I5ZA 2VE9A 4CGZA 2XF5A 3PSIA 4CDGA 1ENHA 3DEEA 1AA7A 1QBJA 4E7ZA 4I01A 3CUQA 3AL0C 4M3BA 5FKMA 2EIKH 1YW9A 2M4KA 3EDPA 4X1EA 2Q2EB 3M4OJ 2JVGA 4KICA 1ACIA 2VJ4A 2DFFA 1HA8A 3G4SI 2R92J 1ZN2A 3DKWA 5ICEA 3KP4A 4NQWB 3MKYB 4FASD 5E3OA 4CCNA 2VXDA 5CLSA 4B3AA 1IF1A 4GXOA 2EZHA 2GAUA 1Y39A 5B1AH 3FKIJ 3M1EA 2MGQA 5JLXA 3L2UA 4BDZA 1ERDA 4RM2A 5FB2A 3R61A 1YTYA 1K7AA 3VYSB 5LGUA 1BC7C 4UUSB 3CDIA 2XB0X 3ZRGA 4KISA 1EV7A 2F2EA 1FX7A 3QP5A 3M8JA 3T5XA 2M4GA 3WHCA 4WCGA 3OYIA 1JGSA 4HAMA 3HOWJ 5GADJ 4PFPA 3CCYA 4UUTA 1ETVA 1S7AA 1XDUA 1W0TA 1IN5A 2PI0A 4BJ6C 3QPHA 3GX4X 3P5JA 2G0EA 2FEZA 4HBLA 1NG7A 2WAQN 2HZTA 2ME6A 2R5YA 1G6NA 2IPQX 2HYGD 1RUOA 2QBYB 2RNGA 1IRGA 2BZTA 3TO6A 5LGTA 1L0OC 1T56A 1FYLA 4MLOA 1MNEA 2UXNA 1FBUA 4PJLA 2E1MB 2E5NA 3E6DA 1XPXA 3JRAA 4B44A 1Z7LA 2M87A 5GAEJ 2DJIA 1IDYA 2HXIA 5CQGA 1OCOH 2F4OB 5DM7F 2P5KA 4ETSA 4I09A 3TGNA 5JVGF 3OIQA 3L00A 2CWEA 2E1OA 5M5YJ 2B7EA 1V5GA 2GOXB 1XCVA 3EYIA 2WAQA 5GTIC 3VODA 1K4TA 1FOWA 5L3CA 1J9IA 4H0EA 4QPOA 2QQAA 3ONQA 1XB4A 1X4PA 4PSWA 2VOPA 3F22A 1LNWA 2V9PA 3GO5A 3EUAA 3HGYA 1R1VA 3DP7A 3RZOJ 3HGGA 5FFZA 1F43A 3H1CA 2VKHA 4ZYAA 1W5TA 3S3NA 3M3YJ 4A3BJ 1IAWA 1P9QC 3F23A 4E4HA 3FISA 2E1MC 4L0YB 1OCPA 1VZ0A 2GXAA 2HKXA 5EEGA 1YE9A 2DA6A 4R8HA 4BUPA 5EGOA 4U88A 2DI3A 2IS4A 5DUIA 1QZYA 4DYRA 2R7SA 1TWCJ 4JK1X 1XN7A 2XHKA 3E5QA 3K1MA 1KGSA 2RVCA 2NVXJ 2RKHA 1U0JA 1JTYA 1ONVA 3RPQA 3OYNA 4II2A 3I5UA 3OS0A 2QGUA 5J6XA 2E34A 2K02A 3G2BA 3PSFA 2CFOA 2R5ZB 4LB6B 2OQGA 2ISZA 3LA3A 1GV5A 3ASOH 4CH7A 5M5WJ 1MKMA 3PNTA 3BLYA 3E97A 4M9ZA 2LY2A 1MD0A 5BOXA 4FETA 3H5NA 3VB2A 2BW3A 1QPMA 2EZLA 2A05A 3HM5A 1VFCA 1WJEA 2YR2A 5TJJA 4A93J 3OIOA 5E3NA 4ENJA 4UB8C 2L4MA 3K6GA 2OAZA 3F8FA 2X51A 3SFZA 2IRFG 1YG2A 2PN6A 3KZZA 4EVIA 2P8TA 2W48A 2QQ8A 1ZARA 1IN7A 3BQZA 2OD5A 4BDYA 2KKOA 5DV5A 4LLGF 3K7AJ 3W6KB 2EV5A 1WJFA 1V3FA 2BVLA 2H6BA 4WXCA 3JTGA 1IRFA 4RB0A 2E1NA 4O3MA 4Y52J 1NK3P 1FOXA 1TWAJ 4FE7A 2OBPA 4HDUA 3HBLA 5IPAA 3RZDJ 1BIBA 5JR3A 3OL3A 2CUZA 3G1OA 1CGPA 3FDYA 3D1NI 4LB5A 4OIOF 1RI7A 1V54H 4BQNA 3BCBA 3K9TA 3IAM2 2ECBA 2M7AA 4CCJA 3GFMA 2KZVA 4XN0A 2V26A 3S2DJ 4A3EJ 4LG3A 5BS6A 5EYRA 4CA0A 1BM9A 3H92A 2DT5A 4OOIA 3B6AA 1T95A 4I98B 4P55A 1D1CA 2K9SA 4HNVA 5IY5H 1YLFA 2A6HF 4DYCA 2DMQA 3S16J 1KQ9A 1SFEA 3E6BA 4PJJA 5E3MA 4WXHA 3IRRA 4L9JA 3J7YJ 4JQFA 1OFCX 2DT7B 3L1PA 1IV6A 1Z67A 3F8CA 1PP7U 3OYCA 3U21A 4HW0A 1XC5A 4Y13A 2KIMA 4DYQA 4FCYA 4Y7NJ 4NUBA 1J5YA 1Z21A 2L54A 2VC1A 2A6TA 2LG4A 2XV4S 4DW6A 1OPCA 1TQMA 5E17F 4GRIA 1BI3A 5B5EC 4IL6C 1R4MB 5KAIC 2CSOA 3AAFA 5IT9Z 2FSWA 1HLVA 5EG0A 4XKVA 3OY9A 3MMYB 2BVMA 2GZWA 3I3LA 2EH3A 3WE3A 1FP2A 4B3XA 2WBMA 3VSLA 2WWYA 3A0BC 2Y0MA 5FO5A 3G73A 3A4CA 4I99C 1QVTA 3RSNA 3S32A 4IQJA 1FIAA 2RV8A 3MQ0A 5DDGA 1ZR4A 4YELA 3WTYC 3HOVJ 3FIWA 4BQAA 1NHAA 4EM1A 2R7OA 5LRRA 2EA2A 2VC0A 2VASA 1FLIA 3V8JA 5IYBJ 2FOKA 1ETKA 4FHTA 2TDXA 1SAUA 3BR5A 5JVTA 1W7PA 2KZGA 2ZC2A 1QZZA 2OPTA 2KT0A 1B9NA 2A6EF 3VYRB 2GLOA 1YRNB 5IOZA 4XN3A 2PJRA 1IUFA 4YIIA 2EA4A 4LGWA 2Y69H 2JK3A 4GO1A 1QNTA 2HI3A 4F55A 3GEZA 1J75A 4BE2A 1VQKI 1YQAA 5E8IA 5DD4A 1ULYA 5E8GA 1N25A 3KLNA 2EWNA 4NNJA 2VUMJ 1E3PA 4RAGA 3CF2A 3L2CA 2VLAA 4PUSA 3BR2A 2VBZA 4MTDA 1FYMA 4IRIA 1VQOI 1V4RA 1O3QA 3A0HC 1I1GA 3UKGA 4EATA 3ZR8X 2P81A 2VJIA 1FTZA 3ESWB 1XMAA 1A6IA 4N9IA 5CYVA 3FMSA 1VQ9I 3F8MA 2COBA 1VQPI 2FF4A 4LJZF 3LSKA 2FMYA 3DPLC 5C4XJ 2BY0A 2NS8A 2CV2A 2NRAC 1KA8A 2DYRH 2MYSA 1SEUA 5K5QA 3QOPA 2HOAA 2FRHA 2L7KA 5IYDJ 4PJMA 1B8IA 2ZFWA 3OR1C 1H9TA 3V42A 2P5VA 3LA7A 1EKEA 3O2PE 2DODA 2LYCA 3CMMA 3R60A 2RNJA 3OMYA 1RPWA 2LOOA 1FJLA 3L2RA 4ZYHA 1Q1VA 1LEBA 2Z99A 3FXJA 5FKOA 1DP3A 4KJZA 2ME0A 2LBFB 4HLXA 5CVRA 1C0WA 4KMFA 1MBHA 1W5SA 1R5GA 2ELKA 1VTNC 2WAFA 3FZVA 1G3SA 1AU7A 2CO5A 1JGGA 3HDDA 4O6JA 2JA6J 1A6QA 1RESA 3JW4A 5LEKA 4MEXF 4DNCA 4EJVA 2OC6A 1AHDP 2LFBA 3F0CA 4D7MA 4QWQA 5ILSA 3CCJI 1IDZA 3COAC 5LEJA 5KCMA 5DYMA 1TW2A 4ZYDA 4FE4A 2A61A 1X1DA 4M6VA 1IW7F 4XM3A 4GDFA 1G8XA 3PNVA 3ZQIA 1T2KA 1OCTC 4X0GA 2Y9YA 5HLTA 2IBDA 2HTJA 4K2EA 3QYEA 1U8BA 4KMUX 2XF7A 3LFKA 1R7JA 3BJOA 2QENA 2M34A 3C2GA 3KYCB 1ZQ3P 4RLFA 4PCQA 1RZ4A 2HEOA 2JQ7A 5J47A 1MMAA 5E18F 1KU2A 2DMTA 2ZSIB 1POGA 2YX7A 2X6XA 3L9FA 4M74A 2E1CA 2JJ7A 5D4SA 3L2QA 1ZR2A 2LH9A 4Y33A 2CW7A 4UY8I 4XKCA 1MBJA 4UVBA 1U5TC 2COMA 3I4PA 4PJ0C 2CQQA 2ZMEB 1SC7A 2CQXA 4A3DJ 1ZK8A 2JPBA 4LOCA 2KISA 3FXUA 4G6DA 1K78B 1R6RA 3H3VK 3BPXA 3CCUI 1MBGA 2O0YA 5F04A 1X1PA 4IHWA 1E0EA 4BHCA 3OYDA 1QRYA 3S8PA 2CS3A 1HDDC 4DOZA 3EETA 2RDPA 4AC0A 2FBIA 1FT9A 2XAHA 1GHCA 3FXLA 2MA3A 2ETHA 1ZLJA 2XGEA 3R6SA 5JHUA 1QHGA 2LD5A 2Y9ZA 3GLXA 2R7UA 5EZGA 5GPCA 4M6YA 3H35A 1OMIA 5L3GA 5CVIA 2OCEA 4ZYGA 4C3JJ 2BYVE 4UVCA 5DCMB 3HOTA 1RR8C 3CESA 3MZHA 3D5SC 4AVZA 3RPUD 2HQNA 5FKNA 2H6CA 2AXLA 1BR2A 2WA0A 3LL7A 5GP9A 1U9OA 3K2AA 4PSXA 1JUPA 2Y30A 3C2BA 4A6DA 1A36A 2ELJA 4G8XA 3PJRA 3GTOJ 4XQFA 2KP6A 2X0LA 1X58A 2XPVA 3D0SA 3BG5A 4RGSA 4XOPA 1WJ5A 3FWEA 4XLPF 1R23A 2K4BA 2ZNZA 5TGTA 1B59A 3BG6A 2R7ZJ 3CLOA 3DEUA 4I02A 4PJNA 2X9DA 3BTLA 3PM1A 4A5NA 4Z6YA 4BH9A 5H2FC 1JT0A 2NOJB 3BTCA 4CYCB 3AFHA 3ZQFA 4S0HB 1Z91A 5FLMJ 2ZXWH 1GDTA 2DPUA 3I4NJ 5D5XB 1ORKA 4BAYA 3KZYA 3H36A 2Y0SN 3MKZA 3V8KA 3HG9A 4UUVA 2R4GA 1X4OA 1BI1A 1QQIA 4I2OA 2ZJ2A 4YFKF 4CZCA 3TEDA 1YIJI 2CUFA 3K4CA 4JX5A 1W1WE 2BY3A 2DOFA 3QYFA 4BJTA 5D5VB 2WV1A 4LLLA 1RC9A 3TW6A 1KZHA 3I54A 3LQRA 1YX3A 3QYBA 2IP2A 3LSIA 1T6SA 4YRVA 1ZYRF 1N78A 2EFNA 2N8GA 3CCQI 5ILUA 4IVNA 2ZXIA 4YIFA 4IHVA 3VDXA 1MSEC 2VPRA 1MH4A 3GVAA 5B66C 3IWZA 3SDBA 4PZJA 1Z9CA 1RR7A 2MC3A 2HPIA 1N77A 2F5FA 4HG2A 2Y0SA 5C4JJ 5IT3A 1W0UA 3V7RA 2V79A 4U0VA 5AIPA 1P6RA 5ICCA 3BOQA 4GFBA 1JTXA 1PUFA 5DS9A 2DDAA 2E7XA 3PIPF 3CC2I 5ED4A 4EM0B 3BJAA 2VONA 2KQRA 5FKKA 1V55H 4II3A 4DBRA 3K1NA 2OF7A 2VQGA 1LDKB 2ZJQF 4BQQA 3K70C 1U5TA 1RKWA 1HDPA 4Q5SF 2DBBA 3U1DA 3MD2A 2CUJA 2CGPA 1TNTA 2DFEA 4L9NA 3J81K 1JXSA 4DQ2A 2E71A 1CF7B 1MH3A 2VOOA 5DUKA 5ERIA 3E1SA 3I56I 2K5CA 3DTIA 4MFDA 4HEA2 4R1HA 3DLLF 2IGMA 4XRMA 3CCLI 5D5UB 3CZ6A 4M6XA 2Q8KA 3K4MA 4N0BA 3A01B 2GOMA 4ZDOA 2FBKA 1I1SA 1JHFA 1VI0A 2GWRA 3PL8A 1ETWA 4XONA 1DU0A 1OQYA 2Z5UA 2EILH 3LSJA 4LK1F 2ISYA 3RTRA 3C1DA 1IG7A 1TW3A 3RJPA 1IJWC 3GYHX 1XG1A 1LEAA 1UFMA 2DOAA 3ZMZA 4S04A 1AKHB 3J7AY 2VE8A 2EV6A 2A68F 1BOAA 1GLNA 3OYHA 2V1DA 3SQNA 2D1VA 1RUNA 3ZMTA 5F64A 2M5WA 2QWWA 3FBNB 1HKQA 4KT6A 4QLCU 3IHUA 3Q0VA 4NBQA 1Y8RB 2CQ7A 4IXAA 3CP2A 4M3DA 2JA8J 4HRIA 2NXNB 3OSFA 3GTQJ 3S2WA 5J1YA 2H1KA 1OCCH 2XPUA 1USTA 4XL9A 3CO7C 3O8GA 3WTZA 3W3CA 2EQRA 2RGVA 4IRHA 1MDMB 4IQ4A 3QP6A 2V6CA 5J8CA 4OMYA 1TQPA 4FTHA 4MQ9F 3GTPJ 2ADUA 5EDNA 1SFOJ 3VWBA 2CJJA 3ULQB 3H0DA 4BJ5C 1OYWA 2IXSA 3SEQA 2GA1A 3ASNH 1YW7A 3TP0A 2P7VB 4V2GA 1BJZA 5H20A 1VQ5I 2DYSH 2NS7A 3A02A 3O6BB 9ANTA 1OCZH 2EPFA 3HXLA 3U1KA 3DWLE 5FLXK 4OINF 2TRTA 1Y6IA 2XUBA 5M5XJ 3CCVI 2FJ1A 2XASA 2KIUA 1K6OA 2NS0A 3T8TA 2NVQJ 4N9HA 2X6OA 1S6LA 1P4WA 2R3SA 3NWTA 4D5FA 3CDHA 1LFBA 4F52A 3SDGA 2KFDA 4IJAA 4CCOA 2QQBA 3P7NA 3J81Z 4I6ZA 4HSRA 3UR3C 4XICA 2LKPA 3ZQ7A 1MBFA 1E3HA 2LSOA 4L0ZB 3I59A 3G1MA 1MJ9A 4A5MA 3OYJA 3LMMA 1ODDA 3RKYA 2JRMA 3ZGKA 5KAFC 1YIOA 3DXJF 1BJAA 2R7VA 4E6KG 3GXOA 4E7JA 1EF4A 1YJNI 2GIZA 1ZRDA 3SEZA 3DFGA 4XLFA 1KU7A 1E2XA 3ERMA 2W57A 4OAYA 2CW0F 3RDIA 2L2OA 5GTHC 2EK5A 2JMWA 1U9NA 5K1YA 3M8FA 3TKYA 3HSFA 4LG0B 2WAEA 3U2RA 1J59A 1F9NA 4EJOA 3MKWB 4RLQA 1K6YA 4EJUA 1DDNA 5F0HA 3DKYA 1AOYA 3OYAA 2X1CA 4ZTJA 5HLGA 3GMEA 1OR7C 1W36C 2XB5A 3KCCA 5K7FA 2VL8A 3BG3A 1I50J 1LQ1A 4HQMA 1LE8A 3J7AO 1WHUA 5HVQC 2FBHA 2LMDA 3TO9A 4ABZA 3NRVA 1HSJA 1KYZA 2L7FP 3OL4A 4CUGA 4L9TA 2E7WA 1EJ9A 3R0JA 4I76A 4AU7A 2OZUA 3WU0A 2HKOA 4FQGA 4G7HF 1B9MA 4UNOA 2OJED 1JI8A 1TNSA 2VKEA 3PUBA 5J1RA 3CF5F 3CMYA 3G6EI 2K3PA 1IO2A 2ZKZA 1XSXA 3S1QJ 2XF6A 4I0AA 4ZDPA 5H6QA 1K4SA 2XGXA 2XSDC 2EINH 1CQTA 3HB9A 1DPUA 5DCFA 3A1YA 3BY6A 1TWGJ 3LSTA 4HOBA 4BEHA 3OYMA 2QA4I 1FSHA 4EEFG 1FNNA 1Z6TA 4NDLA 5FGMA 1T8IA 2QKLB 3R0AA 2JA2A 4D5CA 2AS5F 3OS2A 3S1RJ 2EFOA 3NWSA 3I4MJ 2VB6A 3K69A 4GYIA 4UHTA 5F0FA 3DTKA 4A12A 1B1BA 2KJCA 4M3GA 4BACA 3KYLA 1ITYA 5J4YA 3CQZJ 2CYYA 3WTSC 2OTJI 2D1HA 4AVPA 3DEWA 4BGDA 2VJJA 4PDKA 2P6SA 2JRTA 2VN2A 1B72A 2X6WA 2F5CA 2O8XA 4IHYA 3S15J 2R7XA 4M72A 3BG9A 3QQAA 3QPLA 4HF1A 2HFHA 1LB2A 3GUDA 4LMYA 3H3ZA 4MNUA 3BR3A 5F08A 3SZGA 5FJ8J 2V6EA 3TQNA 1O3TA 4D1QA 2WB1N 4M73A 3HHGA 4YFXF 1BOBA 3IAS2 2P0WA 4A3JJ 2CU7A 3WGIA 2Q2EA 1W7PD 4WXDA 2FD5A 1FWZA 1BI2A 3Q9VA 2CQKA 2A5WA 3JRGA 1MW7A 4NQWA 3CMAI 2DA1A 4XK4A 3SZTA 2MD0A 2ZXHA 4ASNA 4G9YA 1FYKA 1WQ2A 1D5VA 2W25A 1G59A 5K7ZA 3KP6A 1UHWA 3TOBA 3V7SA 2FNPA 1IC8A 5D4RA 4UUSA 1OR7A 4XRSA 2KRFA 3BP8A 3MKLA 2BXYA 2PLYA 2WB1A 1HKTA 1ZKGA 1WJBA 3L09A 1TLHB 1XCBA 2STTA 4KDPA 4V2FA 4XIDA 3VFZA 2O6GE 1HXDA 2JN6A 3X2QH 2CRGA 2PG4A 1ZGAA 1PJRA 1GVJA 3LNQA 3JREA 1YHQI 2UV1A 2K27A 1YI2I 4ON0A 2HOSA 3LSHA 2A69F 4A3GJ 1KQ0A 2IA2A 2KRCA 3PUFA 1ETQA 4R79A 4KA4A 1SD5A 2QBYA 5IP6A 1N75A 3OWTA 1ZREA 2F5EA 1UZCA 2VQLA 2GM4A 4ENNA 5HNHA 4RS8A 3O3KA 2DA5A 3GZ6A 1MNMC 4HA8A 3JTHA 3S14J 3HUGB 2KJBA 1Z77A 2VQCA 1HOMA 2L02A 4HNUA 3K4BA 2Y75A 4H4KC 5K5RA 1IUYA 2LKSA 4A3FJ 3HSRA 1GXQA 2HVQA 2K9MA 1FMWA 2EZIA 3KEOA 3BJ6A 4HZFA 1E17A 5DM6F 1GT0C 2EIJH 3ZCOA 4QTRA 1FTTA 1I6HJ 3IH3A 5HS7A 2DK8A 2RC4A 4XR6A 4D7NA 1SD7A 1H9GA 2DAOA 4YFNF 3HC7A 1VQ4I 1NG6A 1OCRH 2QKMB 4JX6A 1O57A 1ZELA 2GA2A 2KL4A 4HF0A 2V1NA 3CCEI 4MIMA 2I10A 3HTUA 4E7IA 2ZO4A 2J5OA 2W7NA 2A5YB 3IP4B 2CV1A 5H6RA 1ON1A 2LREA 1UB9A 2JPCA 3HL2A 2QCOA 3CTAA 4D9JA 2YS9A 2QSGX 1R9TJ 3F72A 1GUUA 2NAZA 2A3SA 1B4AA 5E1WA 4PFOA 2F6CA 3T0YA 2E2IJ 2KLOA 2H8WA 3GTKJ 4IRGA 3V7CA 4F92B 1IXRC 1WH7A 1WFXA 2A07F 3FHZA 3SHFA 1BR4A 1R4NB 2L9VA 3T8RA 3TDUC 2R5ZA 4OIQF 3S1NJ 2ZJPF 2JA7J 1F36A 4XBFA 1UCRA 4BY1J 1LUJB 3VOEA 2O3FA 3WU1B 3BQYA 4Q48A 1YX5A 2BY2A 2IS1A 3MFKA 5FRNA 1UG0A 3F6OA 4ANJA 1WSUA 4IHXA 5CVJA 1S72I 3HPGA 2L9SA 2O61A 2Y48A 5EZHA 5FKLA 1SD6A 4ZDLA 1KU9A 1JE8A 1W4MA 3F21A 2XAFA 4C30A 4BBSJ 4ZYEA 2M0MA 5BQTA 2QM3A 1IGNA 3BTJA 4JYKA 3RYRA 4RBOA 2AQEA 1T0FC 3HOYJ 2W82A 3F6VA 2HVRA 3GFJA 1XMKA 2OTLI 1VQNI 3Q5FA 1IXCA 4ZH4F 4ZTFA 2JSPA 2K9LA 1LFPA 4KNYA 4G6TB 3IV5A 1FC3A 2O03A 2XSJC 4HSTA 4NC8A 2PX9A 4ESFA 4F3QA 1FZPB 3SYTA 2M30A 3JAMK 3WU2C 2HQAA 4A6EA 2JUCA 2GQQA 1G3YA 3DBLB 5HOOA 2X48A 2GXGA 4RGRA 4EJWA 5KK1A 3WTXC 3V8LA 3LAPA 1NK2P 1O7FA 1FMVA 1WPKA 2PFBA 1HSTA 5IP9J 3SFIA 4IF4A 3OS1A 3I58A 1ZG3A 3GTMJ 3TOAA 4BE1A 2GIVA 1PUEE 3FHNA 4O5VA 1FBQA 3ZMVA 4P9FA 1G2HA 2X6YA 1XDSA 3BR1A 3HRUA 1BIAA 2W24A 4HF2A 2XDVA 3DU6A 1SFUA 2HQRA 3HRTA 5HLHA 2EJRA 1S29A 3O8HA 4PGGA 3MZ8A 1ZG5A 1VQ7I 2QSHX 1UG2A 1BBYA 1JJ8C 3KLOA 4FX0A 4ZZDA 1UJ8A 2VXZA 4XRSG 1KYWA 4M9XA 1VQ6I 4F93B 2WTEA 3HZJA 3DTEA 4PGHA 2PMUA 3HIFA 2F5VA 4F91B 3B6CA 4EJTA 3ABKH 2K9NA 4MGRA 2DCEA 5IYCJ 1OJLA 2FX0A 2VPLA 2FQ4A 2X4HA 2VQHA 3I64A 4CZZA 4JP0A 1SMYF 2BBYA 3GWZA 1XGNA 3BZ6A 3GLLA 1T98A 3Q3SA 1STZA 3N05A 2EFQA 1Y0UA 1IRXA 4RA2A 4C3IJ 1OISA 5KHDA 4HV6A 2HS5A 3PFYA 2PMZN 4EGYA 1R49A 2DPDA 1ZHFA 3GBGA 2Z3YA 4A2UA 1OLTA 1VF9A 1GV2A 1R5HA 4B43A 1XX5A 4EM2A 4B47A 3HEFA 2YSRA 4A0YA 3CC4I 5C44J 1WCMJ 1K79A 2BGCA 2ID3A 4MQVA 4DJAA 2X1DA 4KIFA 4BU2A 1ZRFA 1U78A 1Z0XA 4XNFA 1YO5C 1A35A 1YRNA 2IAIA 3K0LA 1A04A 2ZMEC 4RGXA 2XROA 2GBYA 1P92A 1SD4A 2F4IA 2IA0A 4DGWB 4Q4ZF 4HLYA 3CUQB 3SXYA 3A03A 3EPZA 1ZGJA 5J3LA 4QPQA 4C2TA 1WH5A 2PMZA 1T0FA 2DTZA 1TTYA 1S7OA 1V5EA 3JAMZ 3HOSA 1RNLA 3I71A 2X1EA 2V9KA 4KYWA 3NARA 4KIBA 2ICWG 4BE0A 2JT1A 1HW2A 1EH6A 3ECHA 3TMOA 3AG1H 2HXOA 1LVAA 4G7OF 5D6EA 2R7WA 2IGKA 3OYLA 4BY7J 4GGGA 4HPQA 3CCSI 4AYBN 2EB7A 3MEXA 4CHUA 2FE3A 1R00A 2CFXA 2IGOA 2LF8A 3DBHB 4Y17A 4BNCA 3I0TA 2L7ZA 2MW8A 4DZJA 1QHHD 3B02A 1DPRA 2MABA 5B1BH 2XVCA 1TC3C 1RRJA 2UXXA 2DA4A 1QPIA 1Z7UA 2I8DA 1H0MA 1LVKA 5LGNA 1BA5A 1X3ZB 4E7HA 4P1WA 2LBFA 2LC2A 2L4AA 3HRMA 2P5LC 3MAJA 5J4VA 5BMZA 2R5YB 1MZBA
chains in the Genus database with same CATH topology
4UV8A 3WTTC 3SZPA 3HTSB 1LJ9A 1R1UA 3KP3A 4U7DA 2H27A 3LAJA 1DUXC 5ILVA 4NHJA 2XRNA 3JSPA 4RAZA 5J8FA 2DO7A 3IC7A 5FD5A 1JHHA 5F1RA 1UHMA 4LLNA 2VBYA 5D5WB 3BROA 2FMLA 3ZN1A 3NQOA 3QRFF 4HYEA 3IL2A 2UZKA 2IJLA 3J80K 3HSEA 3ABUA 2IVMA 4I7HA 4OIRF 2ZMEA 1SFXA 2JZYA 5L3FA 1K78A 5D8LB 3IKTA 1SAXA 1YW8A 3V4GA 4HX8A 3KP2A 3WODF 1ZG1A 3QU3A 5K5OA 2MLGA 3HHHA 2JTVA 1L3LA 3H3UA 3WG9A 4LD5A 5DCMA 3K2ZA 1XD7A 2P4WA 5LHGA 4GCVA 1ZAOA 3R4KA 1REPC 1U6GA 2ZNYA 2C6YA 1BC8C 2V1UA 2FNAA 4KUMA 3B73A 3DQVC 4HV5A 4BYYA 3KE2A 1FY7A 2QUFA 3EYYA 2MH9A 4XSXF 4G7ZF 2J5PA 2DFIA 3GF2A 2QQ9A 5TRDA 5JFRA 4G94A 4Z2YA 1YYVA 3RYPA 4NB5A 2M45A 1Z1DA 5ICFA 2BV6A 1U3EM 2V9VA 3OOPA 1IN8A 2UWMA 3K1PA 2K86A 1I27A 4G6QA 2ESHA 3ZP5A 2DU9A 4AIKA 1FSEA 5HS8A 3CO6C 3OV8A 1R22A 3MZYA 3J80Z 3FF5A 3GFIA 2EFWA 4TV7A 2PEXA 3ERED 3I53A 4AD9A 1D8KA 4I0BA 1J7KA 2R7FA 1PDNC 4IPAA 3ELKA 3GZ5A 1KU3A 2G7UA 3MWMA 1HKSA 4CICA 1CF7A 4OU0A 2RN7A 1BN5A 2XAJA 5E20A 5CVUA 3C3WA 1FPQA 3DV8A 3KP5A 5A2QK 2DLLA 3ZMDA 2LNBA 2ZBKA 2H94A 3ZN0A 4ENKA 1WWXA 1MGTA 4MHGA 4Y15A 3LQQA 5CJ9A 5E1XA 5FLXZ 1W7PB 3ZMUA 1YFHA 2PJPA 4FT8A 4BHBA 2DQRA 3PQJA 1F1ZA 2PBIA 4P96A 3JSOA 3BPVA 4HX7A 4RGUA 3L7WA 3RI4A 2Z33A 3ABTA 3WTWC 2RQPA 1F5TA 2XKOA 3P9CA 3PFIA 2VBXA 5LHHA 2H09A 3FMQA 5IT9K 2MBFA 2NNNA 1MDMA 3ML6A 2VT2A 1ZLKA 4IHSA 5HS9A 1G3TA 3QAHA 5KVRA 2HR3A 4WF2A 3DPTA 3C7JA 4RAYA 1XSVA 5AONA 1HQCA 4U0YA 4HDVA 4HQEA 4CYDA 1P2FA 1BI0A 3BDDA 4L5JA 1RIOH 2QYOA 4LK0F 5EEHA 2LDUA 4XLNF 1KQ8A 5HDGA 4E70A 5HDKA 3VEPA 4BXUA 1HW1A 2M8EA 3ZMSA 4D0PA 2FQ3A 3KEQA 2PQ8A 3MCZA 1R1TA 3HYIA 5A2QZ 2G7HA 5LLQA 1I6XA 4B09A 2NNYA 3E6MA 4RB1A 2W84A 5ICGA 2IA1A 3F8NA 2Z9OA 4LG0A 5F6FA 1EH7A 4BHPA 4ESBA 3FX3A 3F3XA 5BPDA 3F8BA 2EV0A 1IN6A 4P9UA 1S8NA 2KIFA 1YS6A 2DQLA 4ESJA 5JI6A 2BEOA 4AWXB 3FXQA 2P6TA 4GYGA 3IKVA 6PAXA 2MLKA 2R7DA 3RIRA 1FOKA 3CUOA 1Z6RA 4MEYF 3E3VA 2XAGA 4M71A 3P9IA 4A0ZA 4AIHA 4EQQA 2ZCWA 2BE5F 2GXBA 2CG4A 3TDZC 4UXNA 3KFWX 3NEUA 2FA5A 2FU4A 4UV9A 3QPTA 3ROUA 3W6JB 1FP1D 1P4AA 2P7CB 2Q0OA 2HWVA 2MH2A 2OU2A 4U0WA 4L9VA 1OYYA 4EV0A 1G3WA 1WRJA 4XSZF 1TQIA 3EUHA 3PQKA 3WGGA 2D2WA 2WC2A 1MJAA 3BWGA 4EMSA 3D5LA 5L3BA 3RKWA 1YS7A 2L01A 3WE2A 1U8RA 2OZ6A 2DW4A 1LDDA 3QU6A 2OA4A 1HW5A 2D45A 1WKMA 2VT3A 3FM3A 3CJNA 2LF7A 2ACJA 1O7LA 2HGCA 2DTRA 1XGMA 2IW5A 5BPIA 4CO8A 4WWCA 2JSCA 1XGSA 1D8JA 4HX4A 2YU3A 4WK8F 2L3DA 4A0XA 1U5TB 1GXPA 2K7LA 4FX4A 4LFUA 2K4JA 1G4DA 3N97A 1EH8A 1WI9A 5LBQA 3ECOA 3LA2A 4UVAA 2XKPA 3M7GA 3EQLF 2QVOA 2HYFA 4XRFA 4F7ZA 1QGPA 1ZH5A 2HOEA 1DP7P 5DD8A 2XIGA 1D3YA 1TBXA 3IRQA 3HUGA 2XAQA 3FXRA 2G9WA 2IT0A 2ELHA 3WTUC 1USSA 5FFXA 4U7BA 2ESNA 4JBAA 4KIGA 2STWA 1LDJA 3REOA 1T38A 3ISPA 3FM5A 1AWCA 5LRSA 4ENMA 5LHIA 1PP8F 1U2WA 2B0LA 5FD6A 4ZZLA 4KN4X 3T1BA 5D8KB 2WV0A 1MJBA 3KETA 4AIJA 4IHTA 4L18B 1B6AA 3RKXA 4S05A 3KP7A 2M1BA 2V1XA 2HDCA 4KN7X 5CVVA 1IXSB 1T39A 1O3SA 2PMHA 2VBWA 1R58A 2ZXJA 3LWFA 4KT5C 3C18A 4B8XA 3TO7A 4WX9A 1SMTA 2QZ8A 1J2XA 3I59B 4M9SA 3U9GA 2FXAA 1Q1HA 3CUQC 1J0RA 4P5OA 1HBXG 2HTSA 3P9KA 2NYXA 4YG2F 5AIQA 1OKRA 4OIPF 5HLIA 2EFPA 1QO0D 1O3RA 3M8EA 2VODA 3N4MA 3E6CC 4L5IA 1S3JA 3FMRA 5HDNA 2MD5A 3DF8A 1XSDA 4MTEA 2QLZA 1ON2A 2YPRA 2OQRA 1X3UA 3RPUA 3WGHA 4Q47A 3GFLA 5D6FA 3ZPLA 3Q9SA 3IWFA 1ZRCA 5L3DA 1F4KA 2DK5A 5L3EA 1FBSA 1IN4A 1R36A 2W85A 2F5DA 1IZ1A 1OYIA 3M9AA 3HRSA 1Z05A 1P4XA 4RB2C 4OMZA 4EGZA 3E5UA 5E1ZB 3WTVC 4KFCA 2YX4A 3E5XA 3G3ZA 4CXFA 1XGOA 3GW2A 4RB3C 5DEQA 2VE9A 1I5ZA 4CGZA 4CDGA 1QBJA 4I01A 3CUQA 3EDPA 1YW9A 4KICA 1ZN2A 3DKWA 5ICEA 3KP4A 5CLSA 1IF1A 4GXOA 2GAUA 3M1EA 5FB2A 3R61A 1YTYA 1K7AA 5LGUA 1BC7C 1EV7A 2F2EA 1FX7A 3QP5A 3T5XA 4WCGA 1JGSA 4HAMA 1S7AA 1XDUA 1IN5A 2PI0A 3QPHA 3GX4X 2FEZA 4HBLA 2HZTA 1G6NA 2IPQX 2HYGD 1RUOA 2QBYB 1IRGA 3TO6A 5LGTA 1L0OC 1FYLA 2UXNA 1FBUA 3E6DA 2M87A 2P5KA 4ETSA 4I09A 3TGNA 3L00A 2CWEA 1XCVA 3EYIA 3VODA 5L3CA 1J9IA 4H0EA 2QQAA 1XB4A 2VOPA 3F22A 1LNWA 3GO5A 1R1VA 3DP7A 5FFZA 1W5TA 1IAWA 3F23A 4L0YB 2HKXA 5EEGA 4R8HA 4U88A 2DI3A 5DUIA 1QZYA 4JK1X 1XN7A 2XHKA 3E5QA 3K1MA 1KGSA 2RVCA 2RKHA 3RPQA 1ONVA 3I5UA 5J6XA 2K02A 4LB6B 2OQGA 2ISZA 3LA3A 1MKMA 3E97A 4M9ZA 1MD0A 5BOXA 3VB2A 1QPMA 2YR2A 5TJJA 4ENJA 2L4MA 2OAZA 3F8FA 3SFZA 2IRFG 1YG2A 2PN6A 3KZZA 4EVIA 2P8TA 1ZARA 1IN7A 2OD5A 2KKOA 5DV5A 4LLGF 3W6KB 2EV5A 1V3FA 4WXCA 2H6BA 3JTGA 1IRFA 4RB0A 2E1NA 4O3MA 2OBPA 4HDUA 1BIBA 5JR3A 1CGPA 4LB5A 4OIOF 1RI7A 3K9TA 3GFMA 5BS6A 1BM9A 3H92A 2DT5A 4OOIA 4I98B 4P55A 1YLFA 2A6HF 1KQ9A 1SFEA 3E6BA 3IRRA 4WXHA 4L9JA 4JQFA 3F8CA 1PP7U 4HW0A 4Y13A 2KIMA 1J5YA 2L54A 2VC1A 2XV4S 1OPCA 1TQMA 5E17F 1BI3A 2CSOA 3AAFA 5IT9Z 2FSWA 2GZWA 3WE3A 1FP2A 2WWYA 3G73A 2Y0MA 5FO5A 2RV8A 3MQ0A 5DDGA 3WTYC 4BQAA 1NHAA 4EM1A 5LRRA 2EA2A 2VC0A 1FLIA 3V8JA 2FOKA 4FHTA 2TDXA 5JVTA 1W7PA 1QZZA 1B9NA 2A6EF 4YIIA 2EA4A 4LGWA 4GO1A 1QNTA 3GEZA 1J75A 1YQAA 5E8IA 5DD4A 1ULYA 5E8GA 3KLNA 2EWNA 3L2CA 4MTDA 2VBZA 1FYMA 4IRIA 1V4RA 1O3QA 1I1GA 1XMAA 4N9IA 5CYVA 3FMSA 3F8MA 2FF4A 4LJZF 2FMYA 3DPLC 2NRAC 1KA8A 5K5QA 3QOPA 2FRHA 2ZFWA 1H9TA 2P5VA 3LA7A 3O2PE 3R60A 2RNJA 4ZYHA 1LEBA 2Z99A 4HLXA 5CVRA 1C0WA 4KMFA 1W5SA 1R5GA 1VTNC 3FZVA 1G3SA 2CO5A 4O6JA 3JW4A 5LEKA 4MEXF 4DNCA 4EJVA 4QWQA 5ILSA 3COAC 5LEJA 5DYMA 1TW2A 4ZYDA 2A61A 1IW7F 1T2KA 2HTJA 4K2EA 4KMUX 3LFKA 1R7JA 3BJOA 2QENA 2HEOA 4PCQA 1RZ4A 5E18F 1KU2A 2YX7A 2E1CA 3L9FA 4M74A 5D4SA 4UVBA 1U5TC 2COMA 3I4PA 2ZMEB 2JPBA 3FXUA 4G6DA 1K78B 3BPXA 2O0YA 4BHCA 3EETA 2RDPA 2FBIA 1FT9A 2XAHA 1GHCA 2MA3A 2ETHA 1ZLJA 3R6SA 5JHUA 3GLXA 4M6YA 1OMIA 5L3GA 5CVIA 4ZYGA 2BYVE 4UVCA 5DCMB 3HOTA 3MZHA 2HQNA 2H6CA 2AXLA 4A6DA 4G8XA 2X0LA 3D0SA 4RGSA 3FWEA 4XLPF 1R23A 2K4BA 2ZNZA 1B59A 3CLOA 3DEUA 4I02A 4A5NA 4BH9A 1Z91A 2DPUA 5D5XB 4BAYA 3KZYA 3V8KA 4UUVA 1BI1A 1QQIA 4I2OA 2ZJ2A 4YFKF 5D5VB 4LLLA 3I54A 3LQRA 2IP2A 1T6SA 1ZYRF 2EFNA 5ILUA 4IVNA 4YIFA 3GVAA 3IWZA 4PZJA 1Z9CA 2MC3A 2F5FA 5IT3A 3V7RA 2V79A 4U0VA 5AIPA 1P6RA 5ICCA 3BOQA 2E7XA 5ED4A 4EM0B 3BJAA 2VONA 3K1NA 1LDKB 1U5TA 4Q5SF 2DBBA 3U1DA 2CGPA 1TNTA 4L9NA 3J81K 1JXSA 4DQ2A 1CF7B 2VOOA 5DUKA 5ERIA 4R1HA 5D5UB 4M6XA 2Q8KA 4N0BA 2FBKA 1I1SA 1JHFA 2GWRA 2Z5UA 4LK1F 3RTRA 2ISYA 3C1DA 1TW3A 3RJPA 3GYHX 1LEAA 1UFMA 3ZMZA 4S04A 2VE8A 2EV6A 2A68F 1BOAA 2V1DA 3SQNA 2D1VA 1RUNA 3ZMTA 5F64A 2M5WA 2QWWA 1HKQA 4QLCU 3IHUA 4IXAA 3S2WA 1USTA 3CO7C 3WTZA 2RGVA 4IRHA 1MDMB 3QP6A 2V6CA 5J8CA 4OMYA 1TQPA 4MQ9F 2ADUA 3ULQB 1OYWA 2GA1A 1YW7A 2P7VB 5H20A 3O6BB 5FLXK 4OINF 2XUBA 2XASA 2KIUA 1K6OA 2NS0A 3T8TA 4N9HA 1S6LA 1P4WA 2R3SA 3CDHA 4IJAA 2QQBA 3P7NA 3J81Z 2LKPA 3ZQ7A 2LSOA 4L0ZB 3I59A 1MJ9A 4A5MA 1ODDA 3RKYA 1YIOA 3DXJF 1BJAA 3GXOA 1ZRDA 3DFGA 1KU7A 1E2XA 2W57A 2CW0F 3RDIA 2EK5A 5K1YA 3M8FA 3TKYA 3HSFA 4LG0B 3U2RA 1J59A 1F9NA 4EJOA 4EJUA 1DDNA 1AOYA 5HLGA 3KCCA 1LQ1A 4HQMA 3J7AO 5HVQC 2FBHA 3TO9A 3NRVA 1HSJA 1KYZA 4L9TA 2E7WA 3R0JA 2OZUA 3WU0A 2HKOA 4G7HF 1B9MA 4UNOA 1TNSA 2ZKZA 1XSXA 4I0AA 5H6QA 2XGXA 1DPUA 5DCFA 3BY6A 3LSTA 4HOBA 1FSHA 1FNNA 1Z6TA 5FGMA 3R0AA 2AS5F 2EFOA 3K69A 4GYIA 4UHTA 4A12A 1B1BA 2KJCA 2CYYA 3WTSC 2D1HA 4AVPA 4PDKA 2P6SA 2JRTA 2VN2A 2F5CA 2O8XA 4M72A 4HF1A 2HFHA 1LB2A 3GUDA 4LMYA 3H3ZA 4MNUA 3TQNA 1O3TA 4M73A 3HHGA 4YFXF 3WGIA 2Q2EA 1W7PD 4WXDA 1FWZA 1BI2A 3Q9VA 2CQKA 4NQWA 3SZTA 4ASNA 4G9YA 1FYKA 1WQ2A 1D5VA 2W25A 3KP6A 1UHWA 3TOBA 3V7SA 2FNPA 5D4RA 1OR7A 2KRFA 3BP8A 2PLYA 1HKTA 3L09A 1TLHB 1XCBA 2STTA 4KDPA 3VFZA 2O6GE 1HXDA 2PG4A 1ZGAA 1GVJA 2K27A 4ON0A 2A69F 1KQ0A 2IA2A 4R79A 4KA4A 1SD5A 2QBYA 1ZREA 2F5EA 4ENNA 4RS8A 3O3KA 3GZ6A 4HA8A 3JTHA 2KJBA 2L02A 2Y75A 5K5RA 1IUYA 3HSRA 1GXQA 3KEOA 3BJ6A 4HZFA 1E17A 5HS7A 2DK8A 2RC4A 4YFNF 1SD7A 1H9GA 2DAOA 1O57A 2GA2A 4HF0A 3HTUA 2ZO4A 2J5OA 2A5YB 5H6RA 1ON1A 1UB9A 2JPCA 3CTAA 3F72A 2NAZA 2A3SA 1B4AA 5E1WA 3T0YA 4IRGA 3V7CA 1IXRC 2A07F 3FHZA 3SHFA 3T8RA 3TDUC 4OIQF 4XBFA 1UCRA 3VOEA 2O3FA 3WU1B 4Q48A 3MFKA 3F6OA 1WSUA 5CVJA 2O61A 2Y48A 1SD6A 1KU9A 1JE8A 1W4MA 3F21A 2XAFA 4ZYEA 5BQTA 2QM3A 3RYRA 3F6VA 3GFJA 1XMKA 3Q5FA 1IXCA 4ZH4F 4KNYA 1FC3A 2O03A 1FZPB 4ESFA 2M30A 3JAMK 4A6EA 2GQQA 1G3YA 5HOOA 2GXGA 4RGRA 4EJWA 5KK1A 3WTXC 3V8LA 3LAPA 1O7FA 2PFBA 1HSTA 4IF4A 3I58A 1ZG3A 3TOAA 2GIVA 1PUEE 3ZMVA 4O5VA 1FBQA 4P9FA 1XDSA 3HRUA 1BIAA 2W24A 4HF2A 1SFUA 2HQRA 3HRTA 5HLHA 2EJRA 1S29A 4PGGA 1ZG5A 1BBYA 3KLOA 4FX0A 4ZZDA 2VXZA 1KYWA 4M9XA 2WTEA 4PGHA 2PMUA 3HIFA 4EJTA 4MGRA 2X4HA 3I64A 4CZZA 1SMYF 2BBYA 3GWZA 1XGNA 3BZ6A 1T98A 1STZA 2EFQA 1Y0UA 4HV6A 2HS5A 4EGYA 2DPDA 1ZHFA 2Z3YA 4A2UA 1R5HA 4EM2A 2YSRA 4A0YA 1K79A 2BGCA 4MQVA 4KIFA 1ZRFA 1U78A 1YO5C 3K0LA 1A04A 4RGXA 2XROA 1P92A 1SD4A 2IA0A 4HLYA 4Q4ZF 3CUQB 3SXYA 1ZGJA 1T0FA 1TTYA 1S7OA 3JAMZ 3HOSA 1RNLA 3I71A 4KYWA 4KIBA 2JT1A 1HW2A 1EH6A 3ECHA 1LVAA 4G7OF 5D6EA 4GGGA 2EB7A 3MEXA 4CHUA 2FE3A 1R00A 2CFXA 2LF8A 4BNCA 4Y17A 3I0TA 3B02A 1DPRA 2XVCA 2UXXA 1Z7UA 1H0MA 5LGNA 2L4AA 3HRMA 2P5LC 3MAJA 5BMZA 1MZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UV8 A;  3WTT C;  3SZP A;  3HTS B;  1LJ9 A;  1R1U A;  3KP3 A;  4U7D A;  2H27 A;  3LAJ A;  1DUX C;  5ILV A;  4NHJ A;  2XRN A;  3JSP A;  4RAZ A;  5J8F A;  2DO7 A;  3IC7 A;  5FD5 A;  1JHH A;  5F1R A;  1UHM A;  4LLN A;  2VBY A;  5D5W B;  3BRO A;  2FML A;  3ZN1 A;  3NQO A;  3QRF F;  4HYE A;  3IL2 A;  2UZK A;  2IJL A;  3J80 K;  3HSE A;  3ABU A;  2IVM A;  4I7H A;  4OIR F;  2ZME A;  1SFX A;  2JZY A;  5L3F A;  1K78 A;  5D8L B;  3IKT A;  1SAX A;  1YW8 A;  3V4G A;  4HX8 A;  3KP2 A;  3WOD F;  1ZG1 A;  3QU3 A;  5K5O A;  2MLG A;  3HHH A;  2JTV A;  1L3L A;  3H3U A;  3WG9 A;  4LD5 A;  5DCM A;  3K2Z A;  1XD7 A;  2P4W A;  5LHG A;  4GCV A;  1ZAO A;  3R4K A;  1REP C;  1U6G A;  2ZNY A;  2C6Y A;  1BC8 C;  2V1U A;  2FNA A;  4KUM A;  3B73 A;  3DQV C;  4HV5 A;  4BYY A;  3KE2 A;  1FY7 A;  2QUF A;  3EYY A;  2MH9 A;  4XSX F;  4G7Z F;  2J5P A;  2DFI A;  3GF2 A;  2QQ9 A;  5TRD A;  5JFR A;  4G94 A;  4Z2Y A;  1YYV A;  3RYP A;  4NB5 A;  2M45 A;  1Z1D A;  5ICF A;  2BV6 A;  1U3E M;  2V9V A;  3OOP A;  1IN8 A;  2UWM A;  3K1P A;  2K86 A;  1I27 A;  4G6Q A;  2ESH A;  3ZP5 A;  2DU9 A;  4AIK A;  1FSE A;  5HS8 A;  3CO6 C;  3OV8 A;  1R22 A;  3MZY A;  3J80 Z;  3FF5 A;  3GFI A;  2EFW A;  4TV7 A;  2PEX A;  3ERE D;  3I53 A;  4AD9 A;  1D8K A;  4I0B A;  1J7K A;  2R7F A;  1PDN C;  4IPA A;  3ELK A;  3GZ5 A;  1KU3 A;  2G7U A;  3MWM A;  1HKS A;  4CIC A;  1CF7 A;  4OU0 A;  2RN7 A;  1BN5 A;  2XAJ A;  5E20 A;  5CVU A;  3C3W A;  1FPQ A;  3DV8 A;  3KP5 A;  5A2Q K;  2DLL A;  3ZMD A;  2LNB A;  2ZBK A;  2H94 A;  3ZN0 A;  4ENK A;  1WWX A;  1MGT A;  4MHG A;  4Y15 A;  3LQQ A;  5CJ9 A;  5E1X A;  5FLX Z;  1W7P B;  3ZMU A;  1YFH A;  2PJP A;  4FT8 A;  4BHB A;  2DQR A;  3PQJ A;  1F1Z A;  2PBI A;  4P96 A;  3JSO A;  3BPV A;  4HX7 A;  4RGU A;  3L7W A;  3RI4 A;  2Z33 A;  3ABT A;  3WTW C;  2RQP A;  1F5T A;  2XKO A;  3P9C A;  3PFI A;  2VBX A;  5LHH A;  2H09 A;  3FMQ A;  5IT9 K;  2MBF A;  2NNN A;  1MDM A;  3ML6 A;  2VT2 A;  1ZLK A;  4IHS A;  5HS9 A;  1G3T A;  3QAH A;  5KVR A;  2HR3 A;  4WF2 A;  3DPT A;  3C7J A;  4RAY A;  1XSV A;  5AON A;  1HQC A;  4U0Y A;  4HDV A;  4HQE A;  4CYD A;  1P2F A;  1BI0 A;  3BDD A;  4L5J A;  1RIO H;  2QYO A;  4LK0 F;  5EEH A;  2LDU A;  4XLN F;  1KQ8 A;  5HDG A;  4E70 A;  5HDK A;  3VEP A;  4BXU A;  1HW1 A;  2M8E A;  3ZMS A;  4D0P A;  2FQ3 A;  3KEQ A;  2PQ8 A;  3MCZ A;  1R1T A;  3HYI A;  5A2Q Z;  2G7H A;  5LLQ A;  1I6X A;  4B09 A;  2NNY A;  3E6M A;  4RB1 A;  2W84 A;  5ICG A;  2IA1 A;  3F8N A;  2Z9O A;  4LG0 A;  5F6F A;  1EH7 A;  4BHP A;  4ESB A;  3FX3 A;  3F3X A;  5BPD A;  3F8B A;  2EV0 A;  1IN6 A;  4P9U A;  1S8N A;  2KIF A;  1YS6 A;  2DQL A;  4ESJ A;  5JI6 A;  2BEO A;  4AWX B;  3FXQ A;  2P6T A;  4GYG A;  3IKV A;  6PAX A;  2MLK A;  2R7D A;  3RIR A;  1FOK A;  3CUO A;  1Z6R A;  4MEY F;  3E3V A;  2XAG A;  4M71 A;  3P9I A;  4A0Z A;  4AIH A;  4EQQ A;  2ZCW A;  2BE5 F;  2GXB A;  2CG4 A;  3TDZ C;  4UXN A;  3KFW X;  3NEU A;  2FA5 A;  2FU4 A;  4UV9 A;  3QPT A;  3ROU A;  3W6J B;  1FP1 D;  1P4A A;  2P7C B;  2Q0O A;  2HWV A;  2MH2 A;  2OU2 A;  4U0W A;  4L9V A;  1OYY A;  4EV0 A;  1G3W A;  1WRJ A;  4XSZ F;  1TQI A;  3EUH A;  3PQK A;  3WGG A;  2D2W A;  2WC2 A;  1MJA A;  3BWG A;  4EMS A;  3D5L A;  5L3B A;  3RKW A;  1YS7 A;  2L01 A;  3WE2 A;  1U8R A;  2OZ6 A;  2DW4 A;  1LDD A;  3QU6 A;  2OA4 A;  1HW5 A;  2D45 A;  1WKM A;  2VT3 A;  3FM3 A;  3CJN A;  2LF7 A;  2ACJ A;  1O7L A;  2HGC A;  2DTR A;  1XGM A;  2IW5 A;  5BPI A;  4CO8 A;  4WWC A;  2JSC A;  1XGS A;  1D8J A;  4HX4 A;  2YU3 A;  4WK8 F;  2L3D A;  4A0X A;  1U5T B;  1GXP A;  2K7L A;  4FX4 A;  4LFU A;  2K4J A;  1G4D A;  3N97 A;  1EH8 A;  1WI9 A;  5LBQ A;  3ECO A;  3LA2 A;  4UVA A;  2XKP A;  3M7G A;  3EQL F;  2QVO A;  2HYF A;  4XRF A;  4F7Z A;  1QGP A;  1ZH5 A;  2HOE A;  1DP7 P;  5DD8 A;  2XIG A;  1D3Y A;  1TBX A;  3IRQ A;  3HUG A;  2XAQ A;  3FXR A;  2G9W A;  2IT0 A;  2ELH A;  3WTU C;  1USS A;  5FFX A;  4U7B A;  2ESN A;  4JBA A;  4KIG A;  2STW A;  1LDJ A;  3REO A;  1T38 A;  3ISP A;  3FM5 A;  1AWC A;  5LRS A;  4ENM A;  5LHI A;  1PP8 F;  1U2W A;  2B0L A;  5FD6 A;  4ZZL A;  4KN4 X;  3T1B A;  5D8K B;  2WV0 A;  1MJB A;  3KET A;  4AIJ A;  4IHT A;  4L18 B;  1B6A A;  3RKX A;  4S05 A;  3KP7 A;  2M1B A;  2V1X A;  2HDC A;  4KN7 X;  5CVV A;  1IXS B;  1T39 A;  1O3S A;  2PMH A;  2VBW A;  1R58 A;  2ZXJ A;  3LWF A;  4KT5 C;  3C18 A;  4B8X A;  3TO7 A;  4WX9 A;  1SMT A;  2QZ8 A;  1J2X A;  3I59 B;  4M9S A;  3U9G A;  2FXA A;  1Q1H A;  3CUQ C;  1J0R A;  4P5O A;  1HBX G;  2HTS A;  3P9K A;  2NYX A;  4YG2 F;  5AIQ A;  1OKR A;  4OIP F;  5HLI A;  2EFP A;  1QO0 D;  1O3R A;  3M8E A;  2VOD A;  3N4M A;  3E6C C;  4L5I A;  1S3J A;  3FMR A;  5HDN A;  2MD5 A;  3DF8 A;  1XSD A;  4MTE A;  2QLZ A;  1ON2 A;  2YPR A;  2OQR A;  1X3U A;  3RPU A;  3WGH A;  4Q47 A;  3GFL A;  5D6F A;  3ZPL A;  3Q9S A;  3IWF A;  1ZRC A;  5L3D A;  1F4K A;  2DK5 A;  5L3E A;  1FBS A;  1IN4 A;  1R36 A;  2W85 A;  2F5D A;  1IZ1 A;  1OYI A;  3M9A A;  3HRS A;  1Z05 A;  1P4X A;  4RB2 C;  4OMZ A;  4EGZ A;  3E5U A;  5E1Z B;  3WTV C;  4KFC A;  2YX4 A;  3E5X A;  3G3Z A;  4CXF A;  1XGO A;  3GW2 A;  4RB3 C;  5DEQ A;  2VE9 A;  1I5Z A;  4CGZ A;  4CDG A;  1QBJ A;  4I01 A;  3CUQ A;  3EDP A;  1YW9 A;  4KIC A;  1ZN2 A;  3DKW A;  5ICE A;  3KP4 A;  5CLS A;  1IF1 A;  4GXO A;  2GAU A;  3M1E A;  5FB2 A;  3R61 A;  1YTY A;  1K7A A;  5LGU A;  1BC7 C;  1EV7 A;  2F2E A;  1FX7 A;  3QP5 A;  3T5X A;  4WCG A;  1JGS A;  4HAM A;  1S7A A;  1XDU A;  1IN5 A;  2PI0 A;  3QPH A;  3GX4 X;  2FEZ A;  4HBL A;  2HZT A;  1G6N A;  2IPQ X;  2HYG D;  1RUO A;  2QBY B;  1IRG A;  3TO6 A;  5LGT A;  1L0O C;  1FYL A;  2UXN A;  1FBU A;  3E6D A;  2M87 A;  2P5K A;  4ETS A;  4I09 A;  3TGN A;  3L00 A;  2CWE A;  1XCV A;  3EYI A;  3VOD A;  5L3C A;  1J9I A;  4H0E A;  2QQA A;  1XB4 A;  2VOP A;  3F22 A;  1LNW A;  3GO5 A;  1R1V A;  3DP7 A;  5FFZ A;  1W5T A;  1IAW A;  3F23 A;  4L0Y B;  2HKX A;  5EEG A;  4R8H A;  4U88 A;  2DI3 A;  5DUI A;  1QZY A;  4JK1 X;  1XN7 A;  2XHK A;  3E5Q A;  3K1M A;  1KGS A;  2RVC A;  2RKH A;  3RPQ A;  1ONV A;  3I5U A;  5J6X A;  2K02 A;  4LB6 B;  2OQG A;  2ISZ A;  3LA3 A;  1MKM A;  3E97 A;  4M9Z A;  1MD0 A;  5BOX A;  3VB2 A;  1QPM A;  2YR2 A;  5TJJ A;  4ENJ A;  2L4M A;  2OAZ A;  3F8F A;  3SFZ A;  2IRF G;  1YG2 A;  2PN6 A;  3KZZ A;  4EVI A;  2P8T A;  1ZAR A;  1IN7 A;  2OD5 A;  2KKO A;  5DV5 A;  4LLG F;  3W6K B;  2EV5 A;  1V3F A;  4WXC A;  2H6B A;  3JTG A;  1IRF A;  4RB0 A;  2E1N A;  4O3M A;  2OBP A;  4HDU A;  1BIB A;  5JR3 A;  1CGP A;  4LB5 A;  4OIO F;  1RI7 A;  3K9T A;  3GFM A;  5BS6 A;  1BM9 A;  3H92 A;  2DT5 A;  4OOI A;  4I98 B;  4P55 A;  1YLF A;  2A6H F;  1KQ9 A;  1SFE A;  3E6B A;  3IRR A;  4WXH A;  4L9J A;  4JQF A;  3F8C A;  1PP7 U;  4HW0 A;  4Y13 A;  2KIM A;  1J5Y A;  2L54 A;  2VC1 A;  2XV4 S;  1OPC A;  1TQM A;  5E17 F;  1BI3 A;  2CSO A;  3AAF A;  5IT9 Z;  2FSW A;  2GZW A;  3WE3 A;  1FP2 A;  2WWY A;  3G73 A;  2Y0M A;  5FO5 A;  2RV8 A;  3MQ0 A;  5DDG A;  3WTY C;  4BQA A;  1NHA A;  4EM1 A;  5LRR A;  2EA2 A;  2VC0 A;  1FLI A;  3V8J A;  2FOK A;  4FHT A;  2TDX A;  5JVT A;  1W7P A;  1QZZ A;  1B9N A;  2A6E F;  4YII A;  2EA4 A;  4LGW A;  4GO1 A;  1QNT A;  3GEZ A;  1J75 A;  1YQA A;  5E8I A;  5DD4 A;  1ULY A;  5E8G A;  3KLN A;  2EWN A;  3L2C A;  4MTD A;  2VBZ A;  1FYM A;  4IRI A;  1V4R A;  1O3Q A;  1I1G A;  1XMA A;  4N9I A;  5CYV A;  3FMS A;  3F8M A;  2FF4 A;  4LJZ F;  2FMY A;  3DPL C;  2NRA C;  1KA8 A;  5K5Q A;  3QOP A;  2FRH A;  2ZFW A;  1H9T A;  2P5V A;  3LA7 A;  3O2P E;  3R60 A;  2RNJ A;  4ZYH A;  1LEB A;  2Z99 A;  4HLX A;  5CVR A;  1C0W A;  4KMF A;  1W5S A;  1R5G A;  1VTN C;  3FZV A;  1G3S A;  2CO5 A;  4O6J A;  3JW4 A;  5LEK A;  4MEX F;  4DNC A;  4EJV A;  4QWQ A;  5ILS A;  3COA C;  5LEJ A;  5DYM A;  1TW2 A;  4ZYD A;  2A61 A;  1IW7 F;  1T2K A;  2HTJ A;  4K2E A;  4KMU X;  3LFK A;  1R7J A;  3BJO A;  2QEN A;  2HEO A;  4PCQ A;  1RZ4 A;  5E18 F;  1KU2 A;  2YX7 A;  2E1C A;  3L9F A;  4M74 A;  5D4S A;  4UVB A;  1U5T C;  2COM A;  3I4P A;  2ZME B;  2JPB A;  3FXU A;  4G6D A;  1K78 B;  3BPX A;  2O0Y A;  4BHC A;  3EET A;  2RDP A;  2FBI A;  1FT9 A;  2XAH A;  1GHC A;  2MA3 A;  2ETH A;  1ZLJ A;  3R6S A;  5JHU A;  3GLX A;  4M6Y A;  1OMI A;  5L3G A;  5CVI A;  4ZYG A;  2BYV E;  4UVC A;  5DCM B;  3HOT A;  3MZH A;  2HQN A;  2H6C A;  2AXL A;  4A6D A;  4G8X A;  2X0L A;  3D0S A;  4RGS A;  3FWE A;  4XLP F;  1R23 A;  2K4B A;  2ZNZ A;  1B59 A;  3CLO A;  3DEU A;  4I02 A;  4A5N A;  4BH9 A;  1Z91 A;  2DPU A;  5D5X B;  4BAY A;  3KZY A;  3V8K A;  4UUV A;  1BI1 A;  1QQI A;  4I2O A;  2ZJ2 A;  4YFK F;  5D5V B;  4LLL A;  3I54 A;  3LQR A;  2IP2 A;  1T6S A;  1ZYR F;  2EFN A;  5ILU A;  4IVN A;  4YIF A;  3GVA A;  3IWZ A;  4PZJ A;  1Z9C A;  2MC3 A;  2F5F A;  5IT3 A;  3V7R A;  2V79 A;  4U0V A;  5AIP A;  1P6R A;  5ICC A;  3BOQ A;  2E7X A;  5ED4 A;  4EM0 B;  3BJA A;  2VON A;  3K1N A;  1LDK B;  1U5T A;  4Q5S F;  2DBB A;  3U1D A;  2CGP A;  1TNT A;  4L9N A;  3J81 K;  1JXS A;  4DQ2 A;  1CF7 B;  2VOO A;  5DUK A;  5ERI A;  4R1H A;  5D5U B;  4M6X A;  2Q8K A;  4N0B A;  2FBK A;  1I1S A;  1JHF A;  2GWR A;  2Z5U A;  4LK1 F;  3RTR A;  2ISY A;  3C1D A;  1TW3 A;  3RJP A;  3GYH X;  1LEA A;  1UFM A;  3ZMZ A;  4S04 A;  2VE8 A;  2EV6 A;  2A68 F;  1BOA A;  2V1D A;  3SQN A;  2D1V A;  1RUN A;  3ZMT A;  5F64 A;  2M5W A;  2QWW A;  1HKQ A;  4QLC U;  3IHU A;  4IXA A;  3S2W A;  1UST A;  3CO7 C;  3WTZ A;  2RGV A;  4IRH A;  1MDM B;  3QP6 A;  2V6C A;  5J8C A;  4OMY A;  1TQP A;  4MQ9 F;  2ADU A;  3ULQ B;  1OYW A;  2GA1 A;  1YW7 A;  2P7V B;  5H20 A;  3O6B B;  5FLX K;  4OIN F;  2XUB A;  2XAS A;  2KIU A;  1K6O A;  2NS0 A;  3T8T A;  4N9H A;  1S6L A;  1P4W A;  2R3S A;  3CDH A;  4IJA A;  2QQB A;  3P7N A;  3J81 Z;  2LKP A;  3ZQ7 A;  2LSO A;  4L0Z B;  3I59 A;  1MJ9 A;  4A5M A;  1ODD A;  3RKY A;  1YIO A;  3DXJ F;  1BJA A;  3GXO A;  1ZRD A;  3DFG A;  1KU7 A;  1E2X A;  2W57 A;  2CW0 F;  3RDI A;  2EK5 A;  5K1Y A;  3M8F A;  3TKY A;  3HSF A;  4LG0 B;  3U2R A;  1J59 A;  1F9N A;  4EJO A;  4EJU A;  1DDN A;  1AOY A;  5HLG A;  3KCC A;  1LQ1 A;  4HQM A;  3J7A O;  5HVQ C;  2FBH A;  3TO9 A;  3NRV A;  1HSJ A;  1KYZ A;  4L9T A;  2E7W A;  3R0J A;  2OZU A;  3WU0 A;  2HKO A;  4G7H F;  1B9M A;  4UNO A;  1TNS A;  2ZKZ A;  1XSX A;  4I0A A;  5H6Q A;  2XGX A;  1DPU A;  5DCF A;  3BY6 A;  3LST A;  4HOB A;  1FSH A;  1FNN A;  1Z6T A;  5FGM A;  3R0A A;  2AS5 F;  2EFO A;  3K69 A;  4GYI A;  4UHT A;  4A12 A;  1B1B A;  2KJC A;  2CYY A;  3WTS C;  2D1H A;  4AVP A;  4PDK A;  2P6S A;  2JRT A;  2VN2 A;  2F5C A;  2O8X A;  4M72 A;  4HF1 A;  2HFH A;  1LB2 A;  3GUD A;  4LMY A;  3H3Z A;  4MNU A;  3TQN A;  1O3T A;  4M73 A;  3HHG A;  4YFX F;  3WGI A;  2Q2E A;  1W7P D;  4WXD A;  1FWZ A;  1BI2 A;  3Q9V A;  2CQK A;  4NQW A;  3SZT A;  4ASN A;  4G9Y A;  1FYK A;  1WQ2 A;  1D5V A;  2W25 A;  3KP6 A;  1UHW A;  3TOB A;  3V7S A;  2FNP A;  5D4R A;  1OR7 A;  2KRF A;  3BP8 A;  2PLY A;  1HKT A;  3L09 A;  1TLH B;  1XCB A;  2STT A;  4KDP A;  3VFZ A;  2O6G E;  1HXD A;  2PG4 A;  1ZGA A;  1GVJ A;  2K27 A;  4ON0 A;  2A69 F;  1KQ0 A;  2IA2 A;  4R79 A;  4KA4 A;  1SD5 A;  2QBY A;  1ZRE A;  2F5E A;  4ENN A;  4RS8 A;  3O3K A;  3GZ6 A;  4HA8 A;  3JTH A;  2KJB A;  2L02 A;  2Y75 A;  5K5R A;  1IUY A;  3HSR A;  1GXQ A;  3KEO A;  3BJ6 A;  4HZF A;  1E17 A;  5HS7 A;  2DK8 A;  2RC4 A;  4YFN F;  1SD7 A;  1H9G A;  2DAO A;  1O57 A;  2GA2 A;  4HF0 A;  3HTU A;  2ZO4 A;  2J5O A;  2A5Y B;  5H6R A;  1ON1 A;  1UB9 A;  2JPC A;  3CTA A;  3F72 A;  2NAZ A;  2A3S A;  1B4A A;  5E1W A;  3T0Y A;  4IRG A;  3V7C A;  1IXR C;  2A07 F;  3FHZ A;  3SHF A;  3T8R A;  3TDU C;  4OIQ F;  4XBF A;  1UCR A;  3VOE A;  2O3F A;  3WU1 B;  4Q48 A;  3MFK A;  3F6O A;  1WSU A;  5CVJ A;  2O61 A;  2Y48 A;  1SD6 A;  1KU9 A;  1JE8 A;  1W4M A;  3F21 A;  2XAF A;  4ZYE A;  5BQT A;  2QM3 A;  3RYR A;  3F6V A;  3GFJ A;  1XMK A;  3Q5F A;  1IXC A;  4ZH4 F;  4KNY A;  1FC3 A;  2O03 A;  1FZP B;  4ESF A;  2M30 A;  3JAM K;  4A6E A;  2GQQ A;  1G3Y A;  5HOO A;  2GXG A;  4RGR A;  4EJW A;  5KK1 A;  3WTX C;  3V8L A;  3LAP A;  1O7F A;  2PFB A;  1HST A;  4IF4 A;  3I58 A;  1ZG3 A;  3TOA A;  2GIV A;  1PUE E;  3ZMV A;  4O5V A;  1FBQ A;  4P9F A;  1XDS A;  3HRU A;  1BIA A;  2W24 A;  4HF2 A;  1SFU A;  2HQR A;  3HRT A;  5HLH A;  2EJR A;  1S29 A;  4PGG A;  1ZG5 A;  1BBY A;  3KLO A;  4FX0 A;  4ZZD A;  2VXZ A;  1KYW A;  4M9X A;  2WTE A;  4PGH A;  2PMU A;  3HIF A;  4EJT A;  4MGR A;  2X4H A;  3I64 A;  4CZZ A;  1SMY F;  2BBY A;  3GWZ A;  1XGN A;  3BZ6 A;  1T98 A;  1STZ A;  2EFQ A;  1Y0U A;  4HV6 A;  2HS5 A;  4EGY A;  2DPD A;  1ZHF A;  2Z3Y A;  4A2U A;  1R5H A;  4EM2 A;  2YSR A;  4A0Y A;  1K79 A;  2BGC A;  4MQV A;  4KIF A;  1ZRF A;  1U78 A;  1YO5 C;  3K0L A;  1A04 A;  4RGX A;  2XRO A;  1P92 A;  1SD4 A;  2IA0 A;  4HLY A;  4Q4Z F;  3CUQ B;  3SXY A;  1ZGJ A;  1T0F A;  1TTY A;  1S7O A;  3JAM Z;  3HOS A;  1RNL A;  3I71 A;  4KYW A;  4KIB A;  2JT1 A;  1HW2 A;  1EH6 A;  3ECH A;  1LVA A;  4G7O F;  5D6E A;  4GGG A;  2EB7 A;  3MEX A;  4CHU A;  2FE3 A;  1R00 A;  2CFX A;  2LF8 A;  4BNC A;  4Y17 A;  3I0T A;  3B02 A;  1DPR A;  2XVC A;  2UXX A;  1Z7U A;  1H0M A;  5LGN A;  2L4A A;  3HRM A;  2P5L C;  3MAJ A;  5BMZ A;  1MZB A; 
#chains in the Genus database with same CATH topology
 4UV8 A;  3WTT C;  3DBR B;  2BXZ A;  3G71 I;  3BZC A;  3SZP A;  2ZJR F;  3HTS B;  1JUS A;  1LJ9 A;  1R1U A;  3M1C A;  3KP3 A;  4AYB A;  4G12 A;  2WY8 Q;  1ETY A;  2YU9 J;  1ETX A;  3Q0U A;  2QEX I;  3OYG A;  4U7D A;  1VQL I;  2H27 A;  4RMN A;  3LAJ A;  5JLW A;  1DUX C;  1X3W B;  3JCU C;  5ILV A;  4NHJ A;  2XRN A;  3JSP A;  4RAZ A;  3PNY A;  4QSH A;  5J8F A;  2DO7 A;  3OYE A;  3K70 D;  3EUK L;  2DFH A;  3S1M J;  3IC7 A;  3GZN B;  4L5E A;  5FD5 A;  3PO2 J;  1JHH A;  5F1R A;  1WJD A;  4IKF A;  1UHM A;  2V4J C;  1ETO A;  5EF6 A;  1JKR C;  4LLN A;  2M2E A;  1QZE A;  2CMP A;  2VBY A;  4NC6 A;  5D5W B;  1WVR A;  1Y56 A;  4IOC F;  3BRO A;  2JA5 J;  2JUG A;  3LOC A;  2FML A;  4DBQ A;  4IX7 A;  3ZN1 A;  3BZK A;  3NQO A;  3QRF F;  4HYE A;  1TT5 B;  3FBI B;  3IL2 A;  2UZK A;  3JRF A;  2IJL A;  2IEK A;  3J80 K;  3HSE A;  2VKV A;  2NOG A;  3ABU A;  2IVM A;  4I7H A;  4OIR F;  2W4S A;  3AG3 H;  4RAF A;  4BKX A;  3W2A A;  2IS2 A;  2KDO A;  2ZME A;  4ZC3 A;  3GTJ J;  5EGO B;  1SFX A;  2JZY A;  5L3F A;  1K78 A;  2Y31 A;  3DPU A;  3H9G A;  5D8L B;  3IKT A;  1SAX A;  3AL0 B;  1I3A A;  1YW8 A;  3IH2 A;  1DGR M;  5FLV A;  4NC7 A;  3OYF A;  3FXO A;  4HX8 A;  3KP2 A;  3V4G A;  3CD6 I;  1I39 A;  3DU5 A;  1W5C C;  3WOD F;  1ZG1 A;  3QU3 A;  5K5O A;  4IO9 F;  2MLG A;  3HHH A;  4N4N B;  2JTV A;  4Y4R A;  1BW6 A;  3KZI C;  2LK2 A;  5J40 A;  1SVL A;  1L3L A;  3H3U A;  3GTL J;  3WG9 A;  4LD5 A;  3K10 A;  3BR0 A;  2OCC H;  1R71 A;  1UMQ A;  5DCM A;  3LSG A;  3ZOB A;  3K2Z A;  1XD7 A;  2BW3 B;  2P4W A;  5LHG A;  4GCV A;  4W97 A;  1ZAO A;  3R4K A;  1REP C;  1U6G A;  3MN2 A;  3I9V 2;  2ZNY A;  2C6Y A;  1BC8 C;  3DCF A;  2V1U A;  2FNA A;  2DMP A;  4E7S A;  4KUM A;  3B73 A;  3DQV C;  4HV5 A;  2D5V A;  2AO9 A;  4BYY A;  1JUM A;  3KE2 A;  2EBI A;  2K9Q A;  1LFU P;  1FEX A;  1FY7 A;  4CYC A;  2QUF A;  3EYY A;  2MH9 A;  4XSX F;  4G7Z F;  2J5P A;  3WHB A;  4BXF A;  2DFI A;  2HZD A;  3GF2 A;  4A3L J;  2QQ9 A;  5TRD A;  5JFR A;  4G94 A;  5CPR B;  3HJE A;  3ZQG A;  4Z2Y A;  3ZQQ A;  2DT6 A;  1YYV A;  2AXT C;  3W2W A;  3RYP A;  4NB5 A;  3HOX J;  2M45 A;  3W2V A;  3JRB A;  1Z1D A;  5ICF A;  2BV6 A;  3HOZ J;  2M8G X;  1U3E M;  2V9V A;  3OOP A;  1IN8 A;  2DMU A;  2UWM A;  3K1P A;  2K86 A;  1APL C;  5LD2 C;  1JKQ C;  1A5J A;  3E0J B;  1I27 A;  4G6Q A;  2LRD A;  1I3Q J;  2ESH A;  3BT9 A;  3ZP5 A;  2ECC A;  2DU9 A;  3TW7 A;  4PK4 A;  4XOT A;  2Y2Z A;  1FSE A;  5HS8 A;  3CO6 C;  4AIK A;  3BCA A;  3OV8 A;  1SAN A;  2MG4 A;  4MFE A;  1R22 A;  3MZY A;  2LP0 A;  3J80 Z;  2HPM A;  3FF5 A;  3GFI A;  3S2H J;  2EFW A;  5FRO A;  1MSF C;  3G1L A;  2TCT A;  2BOL A;  4TV7 A;  2EZK A;  1X1A A;  2PEX A;  3ERE D;  3I53 A;  4JX4 A;  3D5R C;  5F1J A;  4AD9 A;  4UB6 C;  1D8K A;  3K4J A;  3H9J A;  4I0B A;  1J7K A;  2R7F A;  1PDN C;  4IPA A;  2E19 A;  4V19 K;  1H88 C;  3ELK A;  2OUM A;  3GZ5 A;  1KU3 A;  2G7U A;  3MWM A;  1HKS A;  4CIC A;  5EG0 B;  2FUG 2;  2M3A A;  1CF7 A;  4OU0 A;  2RN7 A;  1W36 D;  1BN5 A;  2K85 A;  2XAJ A;  3JRD A;  5E20 A;  5CVU A;  4AID A;  3C3W A;  1FPQ A;  2ID6 A;  3DV8 A;  4LIU A;  2DA3 A;  2JWT A;  3VYT B;  2IGN A;  2DXI A;  1FIP A;  3KP5 A;  3FK6 A;  1BR1 A;  4XLH A;  5A2Q K;  2DLL A;  3ZMD A;  3A01 A;  2LNB A;  2ZBK A;  2H94 A;  3ZN0 A;  3W6V A;  3L2V A;  4ENK A;  1WWX A;  2NVT J;  1MGT A;  1H8A C;  3H0G J;  4MHG A;  4Y15 A;  3VYU B;  2DA2 A;  3LQQ A;  5CJ9 A;  5E1X A;  4YEJ A;  2DMN A;  1MMG A;  5FLX Z;  3QOD A;  2KMU A;  1W7P B;  3ZMU A;  1YFH A;  1Y1W J;  2PJP A;  4FT8 A;  4BHB A;  2DQR A;  3KEY A;  1AKH A;  3PQJ A;  1F1Z A;  2PBI A;  2PJR B;  3WG7 H;  1MND A;  4P96 A;  3JSO A;  3BPV A;  4HX7 A;  4RGU A;  3L7W A;  3RI4 A;  2Z33 A;  3OIP A;  3QPS A;  5JHF A;  3ABT A;  5LFA A;  3WTW C;  1MBK A;  2RQP A;  1TWH J;  1MIJ A;  1F5T A;  1P7J A;  2XKO A;  3P9C A;  3PFI A;  3OSG A;  2VBX A;  5LHH A;  2H09 A;  3FMQ A;  2RRE A;  5IT9 K;  2MBF A;  2KPM A;  1M1E B;  2NNN A;  4ITV A;  3K4K A;  1MDM A;  3VSK A;  1XTA A;  3ML6 A;  2VT2 A;  1YJW I;  1ZLK A;  4IZZ A;  4IHS A;  5HS9 A;  1VND A;  1G3T A;  1JKO C;  2F48 A;  2W1O A;  3QAH A;  5KVR A;  2HR3 A;  4WF2 A;  3DPT A;  3C7J A;  4RAY A;  1XSV A;  3LFU A;  3JRH A;  5GAG J;  1B8I B;  3IH4 A;  3K4L A;  5AON A;  1HQC A;  4U0Y A;  4HDV A;  3RQI A;  2DOE A;  3M07 A;  4HQE A;  3K4N A;  1P2F A;  3CJQ B;  4CYD A;  3ZQL A;  1BI0 A;  3BDD A;  4L5J A;  1K61 A;  1X2M A;  2K3F A;  1MBE A;  1HCR A;  1RIO H;  2QYO A;  3EUH C;  2Q1Z B;  4LK0 F;  4N4O B;  5F27 A;  5EEH A;  3UNG C;  1WJA A;  3H5A A;  2LDU A;  3PO3 J;  4XLN F;  2XC7 A;  1KQ8 A;  4BS9 A;  5E3L A;  2ZSH B;  1Z3Y A;  2BHZ A;  5HDG A;  4E70 A;  5HDK A;  3VEP A;  4BXU A;  1D1B A;  1HW1 A;  2V7F A;  1S5L C;  1KON A;  2M8E A;  3ZMS A;  4D0P A;  4BQO A;  2ZB9 A;  5B3S H;  4RDU A;  2FQ3 A;  3KEQ A;  2HDW A;  1K83 J;  3TL4 X;  2LY9 A;  2PQ8 A;  3MCZ A;  3S3O A;  1R1T A;  3HYI A;  5A2Q Z;  2G7H A;  2AQF A;  5HOD A;  5LLQ A;  1I6X A;  4B09 A;  4A3K J;  1PYV A;  2NNY A;  1UAA A;  3E6M A;  4RB1 A;  2W84 A;  5ICG A;  4OAZ A;  2IA1 A;  3F8N A;  2Z9O A;  4LG0 A;  2NVU B;  1E3O C;  2I5U A;  4XKB A;  5F6F A;  3HKZ N;  5HNF A;  5CQE A;  1EH7 A;  1YOV B;  4BHP A;  3S17 J;  4ESB A;  5C3E J;  3FX3 A;  3F3X A;  5BPD A;  3F8B A;  2CW8 A;  2EV0 A;  1IN6 A;  2L9N A;  4P9U A;  4BL0 B;  1S8N A;  2HDD A;  2KIF A;  2LLK A;  2H1L A;  1YS6 A;  1V5F A;  3OR2 C;  3CJR B;  2DQL A;  2KIQ A;  5JI6 A;  3LSP A;  4ESJ A;  2ZFU A;  4X6A J;  1R5I D;  2BEO A;  5KNL A;  4AWX B;  3ZQC A;  2UUZ A;  3FXQ A;  2P6T A;  2B9S A;  4GYG A;  3IKV A;  6PAX A;  2MLK A;  2R7D A;  3RIR A;  1FOK A;  3CUO A;  3LSM A;  4C9Y A;  4KIT B;  3HKZ A;  1Z6R A;  4MEY F;  2DJN A;  3E3V A;  2XAG A;  2HNH A;  4M71 A;  2W00 A;  2XAU A;  3P9I A;  4A0Z A;  4AIH A;  2R0Q C;  4EQQ A;  2ZCW A;  2BE5 F;  3TBI A;  4HNT A;  2XPW A;  2GXB A;  2CG4 A;  3TDZ C;  4M3F A;  4UXN A;  3KFW X;  3BR6 A;  4AM3 A;  5FRM A;  3NEU A;  2FA5 A;  2FU4 A;  2Z16 A;  3DKX A;  2R7R A;  4UV9 A;  1ZGW A;  3QPT A;  3ROU A;  3W6J B;  5F0C A;  1FP1 D;  1P4A A;  4DZP A;  3JR9 A;  2P7C B;  2XGC A;  2Z1D A;  2O8K A;  2B63 J;  2Q0O A;  2L7M P;  2DN0 A;  2HWV A;  2MH2 A;  2E2H J;  2OU2 A;  3HPH A;  3CLQ A;  4U0W A;  3NAU A;  4L9V A;  2LY1 A;  1RET A;  1OYY A;  2LR8 A;  1ZTR A;  3CJT B;  5J1U A;  4EV0 A;  3OYB A;  1BL0 A;  1MMN A;  1G3W A;  1A31 A;  4XLC A;  1WRJ A;  4XSZ F;  1UHS A;  4C2U A;  1TQI A;  2LKX A;  3EUH A;  3PQK A;  2EIM H;  3AKZ A;  3WGG A;  2VIX A;  2D2W A;  2WC2 A;  1HC8 A;  3FK7 A;  1MJA A;  3BWG A;  1RKT A;  1EA3 A;  3Q0W A;  1MMS A;  4EMS A;  3KPH A;  3JRC A;  4A69 C;  3D5L A;  4CSW A;  5L3B A;  3RCO A;  3A2K A;  3RKW A;  1YS7 A;  2L01 A;  3ZQH A;  2VKD A;  3WE2 A;  3OOU A;  1TT0 A;  1U8R A;  2OZ6 A;  1S9H A;  2DW4 A;  1TL8 A;  1LDD A;  3QU6 A;  1Y0N A;  2OA4 A;  1HW5 A;  2XGD A;  2QSF X;  2D45 A;  2QF7 A;  2JVH A;  1WKM A;  2VT3 A;  2E2J J;  3FM3 A;  3CJN A;  2LF7 A;  3RKQ A;  2ACJ A;  1X1C A;  1O7L A;  3RQ4 A;  2HGC A;  2LTP A;  2DTR A;  4IEJ A;  1XGM A;  1PUF B;  5M3M J;  2IW5 A;  2H8R A;  5BPI A;  3E7L A;  4CO8 A;  2CQN A;  4WWC A;  2JSC A;  1J09 A;  1XGS A;  3CDL A;  1D8J A;  4HX4 A;  2YU3 A;  1DGW Y;  4WK8 F;  2YUS A;  2L3D A;  4A0X A;  1NH3 A;  1U5T B;  1GXP A;  1QVU A;  3FKJ A;  1LPQ A;  2K7L A;  4FX4 A;  1JT6 A;  1SFK A;  3FXK A;  4LFU A;  1WZ2 A;  2K4J A;  2IS6 A;  1G4D A;  3N97 A;  2KHM A;  1EH8 A;  3F9K A;  1WI9 A;  5LBQ A;  1WI3 A;  4AUX A;  3ECO A;  3LA2 A;  4YIR X;  2AHQ A;  3KIO A;  3TP3 A;  1YIT I;  4UVA A;  2XKP A;  3M7G A;  2KRH A;  3EQL F;  4BBR J;  2QVO A;  2HYF A;  2MFZ A;  2VI6 A;  4XRF A;  4ZJZ A;  4F7Z A;  5EEA A;  3S3M A;  1QGP A;  1D0Y A;  3AG2 H;  4A3M J;  1ZH5 A;  2M0C A;  2O9L A;  2F4M B;  2HOE A;  2XRL A;  2WAD A;  3LSR A;  3AG4 H;  4XLA A;  5DD8 A;  3JRI A;  4E7L A;  1DP7 P;  2XIG A;  2HOT A;  1D3Y A;  1TBX A;  2HYJ A;  3IRQ A;  3HUG A;  4FIS A;  2XAQ A;  3FXR A;  2G9W A;  2IT0 A;  4DIQ A;  1TP4 A;  5TIS C;  1QA6 A;  2ELH A;  2MC4 A;  3WTU C;  2RAE A;  1Y8Q B;  2R93 J;  1USS A;  5FFX A;  4U7B A;  2ESN A;  3SJM A;  4A3I J;  3IUO A;  4JBA A;  3KYD B;  4KIG A;  2STW A;  2O5R A;  1MMD A;  1WJC A;  1O4X A;  2HU9 A;  5EJC A;  1H89 C;  1SVO A;  1P7I A;  1LDJ A;  2K40 A;  5IP7 J;  3REO A;  1T38 A;  1X2N A;  3ISP A;  3FM5 A;  3I55 I;  1AWC A;  1IRZ A;  5LRS A;  1X1B A;  4ENM A;  1D5Y A;  5LHI A;  1PP8 F;  3VPR A;  1PVE A;  4B1R A;  2M7B A;  4XKW A;  5IOY A;  1U2W A;  2B0L A;  2NVY J;  5FD6 A;  1D0X A;  4ZZL A;  4CCM A;  2LVS A;  2M9H A;  3CC7 I;  4KN4 X;  3H9Q A;  4XLE A;  4BXX J;  4B4C A;  3QOE A;  1QU3 A;  3T1B A;  5D8K B;  1DQU A;  3DLA A;  1XMX A;  4RM3 A;  4IOA F;  1LKX A;  2WV0 A;  3J7Z I;  1MJB A;  2CUE A;  1FOY A;  3KET A;  4AIJ A;  4IHT A;  4L18 B;  1B6A A;  1NTC A;  3RKX A;  4S05 A;  3KP7 A;  4M3E A;  4J00 A;  2M1B A;  4A3C J;  2V1X A;  2HDC A;  1D1A A;  1YJ9 I;  4KN7 X;  5CVV A;  1IXS B;  1T39 A;  2DA7 A;  1JKP C;  3GCM A;  4XMY A;  1O3S A;  2PMH A;  3H5R A;  2VBW A;  1R58 A;  2ZXJ A;  3CCR I;  3LWF A;  4KT5 C;  4J19 A;  3C18 A;  4B8X A;  3TO7 A;  4CCL A;  4LIT A;  4WX9 A;  2E36 A;  1SMT A;  2QZ8 A;  1J2X A;  3I59 B;  4M9S A;  3C2H A;  3U9G A;  2FXA A;  1Q1H A;  3CUQ C;  3ZXS A;  4U87 A;  1BW5 A;  2FOW A;  3KX2 A;  1J0R A;  4P5O A;  1GVD A;  1SVM A;  4B48 A;  1HBX G;  2O7O A;  2HTS A;  3P9K A;  1TZL A;  2NYX A;  3ABL H;  3MVP A;  4YG2 F;  1T08 B;  5AIQ A;  4Y3O A;  4OWR B;  1OKR A;  1UEL B;  5CKT A;  3L2W A;  1HF0 A;  1VQM I;  3HOU J;  1XS9 A;  4OIP F;  4LIV A;  5HLI A;  1DU6 A;  2EFP A;  1QO0 D;  2CH0 A;  1O3R A;  2MSY A;  3M8E A;  2VOD A;  3N4M A;  3E6C C;  2VJ5 A;  3BG7 A;  4L5I A;  3CCM I;  1VQ8 I;  4E7K A;  2HVS A;  3FXM A;  1S3J A;  3FMR A;  5HDN A;  2L5Q A;  3S93 A;  2RQQ A;  1LE8 B;  2MD5 A;  3BC8 A;  3DF8 A;  5E79 C;  3PIO F;  1XSD A;  4MTE A;  5GPA A;  2QLZ A;  1ON2 A;  2YPR A;  2OQR A;  3QWL A;  5BNG A;  5DTD A;  1X3U A;  3RPU A;  3WGH A;  2E35 A;  1Z3X A;  4Q47 A;  3GFL A;  3OYK A;  1T33 A;  4C3H J;  4W1U A;  5D6F A;  3ZPL A;  3Q9S A;  3ABM H;  3IWF A;  3BTI A;  1ZRC A;  5K7H A;  1IV8 A;  1D0Z A;  4QIW N;  5L3D A;  1F4K A;  2DK5 A;  5L3E A;  4J01 A;  1FBS A;  1IN4 A;  3GTG J;  1R36 A;  2W85 A;  2R7Q A;  2HQ5 A;  2BY1 A;  2F5D A;  2CV0 A;  2R7T A;  1IZ1 A;  1OYI A;  2OV7 A;  2L9R A;  2WY7 Q;  2L0K A;  2Z2S B;  3M9A A;  4BEH B;  3HRS A;  1Z05 A;  2BHY A;  1S7E A;  1P4X A;  2E5Z A;  4RB2 C;  4OMZ A;  1X19 A;  3CME I;  4MO7 A;  4EGZ A;  4C2M J;  1JJ6 C;  3E5U A;  5E1Z B;  3WTV C;  2DDB A;  5GAH J;  4KFC A;  2YX4 A;  4CCK A;  5M3F J;  3E5X A;  4JOM A;  3G3Z A;  3CP8 A;  4CXF A;  1XGO A;  1B72 B;  3GW2 A;  4XOR A;  2X85 A;  2KDZ A;  2E60 A;  4RB3 C;  1Y1V J;  5DEQ A;  1WGX A;  1TWF J;  1I5Z A;  2VE9 A;  4CGZ A;  2XF5 A;  3PSI A;  4CDG A;  1ENH A;  3DEE A;  1AA7 A;  1QBJ A;  4E7Z A;  4I01 A;  3CUQ A;  3AL0 C;  4M3B A;  5FKM A;  2EIK H;  1YW9 A;  2M4K A;  3EDP A;  4X1E A;  2Q2E B;  3M4O J;  2JVG A;  4KIC A;  1ACI A;  2VJ4 A;  2DFF A;  1HA8 A;  3G4S I;  2R92 J;  1ZN2 A;  3DKW A;  5ICE A;  3KP4 A;  4NQW B;  3MKY B;  4FAS D;  5E3O A;  4CCN A;  2VXD A;  5CLS A;  4B3A A;  1IF1 A;  4GXO A;  2EZH A;  2GAU A;  1Y39 A;  5B1A H;  3FKI J;  3M1E A;  2MGQ A;  5JLX A;  3L2U A;  4BDZ A;  1ERD A;  4RM2 A;  5FB2 A;  3R61 A;  1YTY A;  1K7A A;  3VYS B;  5LGU A;  1BC7 C;  4UUS B;  3CDI A;  2XB0 X;  3ZRG A;  4KIS A;  1EV7 A;  2F2E A;  1FX7 A;  3QP5 A;  3M8J A;  3T5X A;  2M4G A;  3WHC A;  4WCG A;  3OYI A;  1JGS A;  4HAM A;  3HOW J;  5GAD J;  4PFP A;  3CCY A;  4UUT A;  1ETV A;  1S7A A;  1XDU A;  1W0T A;  1IN5 A;  2PI0 A;  4BJ6 C;  3QPH A;  3GX4 X;  3P5J A;  2G0E A;  2FEZ A;  4HBL A;  1NG7 A;  2WAQ N;  2HZT A;  2ME6 A;  2R5Y A;  1G6N A;  2IPQ X;  2HYG D;  1RUO A;  2QBY B;  2RNG A;  1IRG A;  2BZT A;  3TO6 A;  5LGT A;  1L0O C;  1T56 A;  1FYL A;  4MLO A;  1MNE A;  2UXN A;  1FBU A;  4PJL A;  2E1M B;  2E5N A;  3E6D A;  1XPX A;  3JRA A;  4B44 A;  1Z7L A;  2M87 A;  5GAE J;  2DJI A;  1IDY A;  2HXI A;  5CQG A;  1OCO H;  2F4O B;  5DM7 F;  2P5K A;  4ETS A;  4I09 A;  3TGN A;  5JVG F;  3OIQ A;  3L00 A;  2CWE A;  2E1O A;  5M5Y J;  2B7E A;  1V5G A;  2GOX B;  1XCV A;  3EYI A;  2WAQ A;  5GTI C;  3VOD A;  1K4T A;  1FOW A;  5L3C A;  1J9I A;  4H0E A;  4QPO A;  2QQA A;  3ONQ A;  1XB4 A;  1X4P A;  4PSW A;  2VOP A;  3F22 A;  1LNW A;  2V9P A;  3GO5 A;  3EUA A;  3HGY A;  1R1V A;  3DP7 A;  3RZO J;  3HGG A;  5FFZ A;  1F43 A;  3H1C A;  2VKH A;  4ZYA A;  1W5T A;  3S3N A;  3M3Y J;  4A3B J;  1IAW A;  1P9Q C;  3F23 A;  4E4H A;  3FIS A;  2E1M C;  4L0Y B;  1OCP A;  1VZ0 A;  2GXA A;  2HKX A;  5EEG A;  1YE9 A;  2DA6 A;  4R8H A;  4BUP A;  5EGO A;  4U88 A;  2DI3 A;  2IS4 A;  5DUI A;  1QZY A;  4DYR A;  2R7S A;  1TWC J;  4JK1 X;  1XN7 A;  2XHK A;  3E5Q A;  3K1M A;  1KGS A;  2RVC A;  2NVX J;  2RKH A;  1U0J A;  1JTY A;  1ONV A;  3RPQ A;  3OYN A;  4II2 A;  3I5U A;  3OS0 A;  2QGU A;  5J6X A;  2E34 A;  2K02 A;  3G2B A;  3PSF A;  2CFO A;  2R5Z B;  4LB6 B;  2OQG A;  2ISZ A;  3LA3 A;  1GV5 A;  3ASO H;  4CH7 A;  5M5W J;  1MKM A;  3PNT A;  3BLY A;  3E97 A;  4M9Z A;  2LY2 A;  1MD0 A;  5BOX A;  4FET A;  3H5N A;  3VB2 A;  2BW3 A;  1QPM A;  2EZL A;  2A05 A;  3HM5 A;  1VFC A;  1WJE A;  2YR2 A;  5TJJ A;  4A93 J;  3OIO A;  5E3N A;  4ENJ A;  4UB8 C;  2L4M A;  3K6G A;  2OAZ A;  3F8F A;  2X51 A;  3SFZ A;  2IRF G;  1YG2 A;  2PN6 A;  3KZZ A;  4EVI A;  2P8T A;  2W48 A;  2QQ8 A;  1ZAR A;  1IN7 A;  3BQZ A;  2OD5 A;  4BDY A;  2KKO A;  5DV5 A;  4LLG F;  3K7A J;  3W6K B;  2EV5 A;  1WJF A;  1V3F A;  2BVL A;  2H6B A;  4WXC A;  3JTG A;  1IRF A;  4RB0 A;  2E1N A;  4O3M A;  4Y52 J;  1NK3 P;  1FOX A;  1TWA J;  4FE7 A;  2OBP A;  4HDU A;  3HBL A;  5IPA A;  3RZD J;  1BIB A;  5JR3 A;  3OL3 A;  2CUZ A;  3G1O A;  1CGP A;  3FDY A;  3D1N I;  4LB5 A;  4OIO F;  1RI7 A;  1V54 H;  4BQN A;  3BCB A;  3K9T A;  3IAM 2;  2ECB A;  2M7A A;  4CCJ A;  3GFM A;  2KZV A;  4XN0 A;  2V26 A;  3S2D J;  4A3E J;  4LG3 A;  5BS6 A;  5EYR A;  4CA0 A;  1BM9 A;  3H92 A;  2DT5 A;  4OOI A;  3B6A A;  1T95 A;  4I98 B;  4P55 A;  1D1C A;  2K9S A;  4HNV A;  5IY5 H;  1YLF A;  2A6H F;  4DYC A;  2DMQ A;  3S16 J;  1KQ9 A;  1SFE A;  3E6B A;  4PJJ A;  5E3M A;  4WXH A;  3IRR A;  4L9J A;  3J7Y J;  4JQF A;  1OFC X;  2DT7 B;  3L1P A;  1IV6 A;  1Z67 A;  3F8C A;  1PP7 U;  3OYC A;  3U21 A;  4HW0 A;  1XC5 A;  4Y13 A;  2KIM A;  4DYQ A;  4FCY A;  4Y7N J;  4NUB A;  1J5Y A;  1Z21 A;  2L54 A;  2VC1 A;  2A6T A;  2LG4 A;  2XV4 S;  4DW6 A;  1OPC A;  1TQM A;  5E17 F;  4GRI A;  1BI3 A;  5B5E C;  4IL6 C;  1R4M B;  5KAI C;  2CSO A;  3AAF A;  5IT9 Z;  2FSW A;  1HLV A;  5EG0 A;  4XKV A;  3OY9 A;  3MMY B;  2BVM A;  2GZW A;  3I3L A;  2EH3 A;  3WE3 A;  1FP2 A;  4B3X A;  2WBM A;  3VSL A;  2WWY A;  3A0B C;  2Y0M A;  5FO5 A;  3G73 A;  3A4C A;  4I99 C;  1QVT A;  3RSN A;  3S32 A;  4IQJ A;  1FIA A;  2RV8 A;  3MQ0 A;  5DDG A;  1ZR4 A;  4YEL A;  3WTY C;  3HOV J;  3FIW A;  4BQA A;  1NHA A;  4EM1 A;  2R7O A;  5LRR A;  2EA2 A;  2VC0 A;  2VAS A;  1FLI A;  3V8J A;  5IYB J;  2FOK A;  1ETK A;  4FHT A;  2TDX A;  1SAU A;  3BR5 A;  5JVT A;  1W7P A;  2KZG A;  2ZC2 A;  1QZZ A;  2OPT A;  2KT0 A;  1B9N A;  2A6E F;  3VYR B;  2GLO A;  1YRN B;  5IOZ A;  4XN3 A;  2PJR A;  1IUF A;  4YII A;  2EA4 A;  4LGW A;  2Y69 H;  2JK3 A;  4GO1 A;  1QNT A;  2HI3 A;  4F55 A;  3GEZ A;  1J75 A;  4BE2 A;  1VQK I;  1YQA A;  5E8I A;  5DD4 A;  1ULY A;  5E8G A;  1N25 A;  3KLN A;  2EWN A;  4NNJ A;  2VUM J;  1E3P A;  4RAG A;  3CF2 A;  3L2C A;  2VLA A;  4PUS A;  3BR2 A;  2VBZ A;  4MTD A;  1FYM A;  4IRI A;  1VQO I;  1V4R A;  1O3Q A;  3A0H C;  1I1G A;  3UKG A;  4EAT A;  3ZR8 X;  2P81 A;  2VJI A;  1FTZ A;  3ESW B;  1XMA A;  1A6I A;  4N9I A;  5CYV A;  3FMS A;  1VQ9 I;  3F8M A;  2COB A;  1VQP I;  2FF4 A;  4LJZ F;  3LSK A;  2FMY A;  3DPL C;  5C4X J;  2BY0 A;  2NS8 A;  2CV2 A;  2NRA C;  1KA8 A;  2DYR H;  2MYS A;  1SEU A;  5K5Q A;  3QOP A;  2HOA A;  2FRH A;  2L7K A;  5IYD J;  4PJM A;  1B8I A;  2ZFW A;  3OR1 C;  1H9T A;  3V42 A;  2P5V A;  3LA7 A;  1EKE A;  3O2P E;  2DOD A;  2LYC A;  3CMM A;  3R60 A;  2RNJ A;  3OMY A;  1RPW A;  2LOO A;  1FJL A;  3L2R A;  4ZYH A;  1Q1V A;  1LEB A;  2Z99 A;  3FXJ A;  5FKO A;  1DP3 A;  4KJZ A;  2ME0 A;  2LBF B;  4HLX A;  5CVR A;  1C0W A;  4KMF A;  1MBH A;  1W5S A;  1R5G A;  2ELK A;  1VTN C;  2WAF A;  3FZV A;  1G3S A;  1AU7 A;  2CO5 A;  1JGG A;  3HDD A;  4O6J A;  2JA6 J;  1A6Q A;  1RES A;  3JW4 A;  5LEK A;  4MEX F;  4DNC A;  4EJV A;  2OC6 A;  1AHD P;  2LFB A;  3F0C A;  4D7M A;  4QWQ A;  5ILS A;  3CCJ I;  1IDZ A;  3COA C;  5LEJ A;  5KCM A;  5DYM A;  1TW2 A;  4ZYD A;  4FE4 A;  2A61 A;  1X1D A;  4M6V A;  1IW7 F;  4XM3 A;  4GDF A;  1G8X A;  3PNV A;  3ZQI A;  1T2K A;  1OCT C;  4X0G A;  2Y9Y A;  5HLT A;  2IBD A;  2HTJ A;  4K2E A;  3QYE A;  1U8B A;  4KMU X;  2XF7 A;  3LFK A;  1R7J A;  3BJO A;  2QEN A;  2M34 A;  3C2G A;  3KYC B;  1ZQ3 P;  4RLF A;  4PCQ A;  1RZ4 A;  2HEO A;  2JQ7 A;  5J47 A;  1MMA A;  5E18 F;  1KU2 A;  2DMT A;  2ZSI B;  1POG A;  2YX7 A;  2X6X A;  3L9F A;  4M74 A;  2E1C A;  2JJ7 A;  5D4S A;  3L2Q A;  1ZR2 A;  2LH9 A;  4Y33 A;  2CW7 A;  4UY8 I;  4XKC A;  1MBJ A;  4UVB A;  1U5T C;  2COM A;  3I4P A;  4PJ0 C;  2CQQ A;  2ZME B;  1SC7 A;  2CQX A;  4A3D J;  1ZK8 A;  2JPB A;  4LOC A;  2KIS A;  3FXU A;  4G6D A;  1K78 B;  1R6R A;  3H3V K;  3BPX A;  3CCU I;  1MBG A;  2O0Y A;  5F04 A;  1X1P A;  4IHW A;  1E0E A;  4BHC A;  3OYD A;  1QRY A;  3S8P A;  2CS3 A;  1HDD C;  4DOZ A;  3EET A;  2RDP A;  4AC0 A;  2FBI A;  1FT9 A;  2XAH A;  1GHC A;  3FXL A;  2MA3 A;  2ETH A;  1ZLJ A;  2XGE A;  3R6S A;  5JHU A;  1QHG A;  2LD5 A;  2Y9Z A;  3GLX A;  2R7U A;  5EZG A;  5GPC A;  4M6Y A;  3H35 A;  1OMI A;  5L3G A;  5CVI A;  2OCE A;  4ZYG A;  4C3J J;  2BYV E;  4UVC A;  5DCM B;  3HOT A;  1RR8 C;  3CES A;  3MZH A;  3D5S C;  4AVZ A;  3RPU D;  2HQN A;  5FKN A;  2H6C A;  2AXL A;  1BR2 A;  2WA0 A;  3LL7 A;  5GP9 A;  1U9O A;  3K2A A;  4PSX A;  1JUP A;  2Y30 A;  3C2B A;  4A6D A;  1A36 A;  2ELJ A;  4G8X A;  3PJR A;  3GTO J;  4XQF A;  2KP6 A;  2X0L A;  1X58 A;  2XPV A;  3D0S A;  3BG5 A;  4RGS A;  4XOP A;  1WJ5 A;  3FWE A;  4XLP F;  1R23 A;  2K4B A;  2ZNZ A;  5TGT A;  1B59 A;  3BG6 A;  2R7Z J;  3CLO A;  3DEU A;  4I02 A;  4PJN A;  2X9D A;  3BTL A;  3PM1 A;  4A5N A;  4Z6Y A;  4BH9 A;  5H2F C;  1JT0 A;  2NOJ B;  3BTC A;  4CYC B;  3AFH A;  3ZQF A;  4S0H B;  1Z91 A;  5FLM J;  2ZXW H;  1GDT A;  2DPU A;  3I4N J;  5D5X B;  1ORK A;  4BAY A;  3KZY A;  3H36 A;  2Y0S N;  3MKZ A;  3V8K A;  3HG9 A;  4UUV A;  2R4G A;  1X4O A;  1BI1 A;  1QQI A;  4I2O A;  2ZJ2 A;  4YFK F;  4CZC A;  3TED A;  1YIJ I;  2CUF A;  3K4C A;  4JX5 A;  1W1W E;  2BY3 A;  2DOF A;  3QYF A;  4BJT A;  5D5V B;  2WV1 A;  4LLL A;  1RC9 A;  3TW6 A;  1KZH A;  3I54 A;  3LQR A;  1YX3 A;  3QYB A;  2IP2 A;  3LSI A;  1T6S A;  4YRV A;  1ZYR F;  1N78 A;  2EFN A;  2N8G A;  3CCQ I;  5ILU A;  4IVN A;  2ZXI A;  4YIF A;  4IHV A;  3VDX A;  1MSE C;  2VPR A;  1MH4 A;  3GVA A;  5B66 C;  3IWZ A;  3SDB A;  4PZJ A;  1Z9C A;  1RR7 A;  2MC3 A;  2HPI A;  1N77 A;  2F5F A;  4HG2 A;  2Y0S A;  5C4J J;  5IT3 A;  1W0U A;  3V7R A;  2V79 A;  4U0V A;  5AIP A;  1P6R A;  5ICC A;  3BOQ A;  4GFB A;  1JTX A;  1PUF A;  5DS9 A;  2DDA A;  2E7X A;  3PIP F;  3CC2 I;  5ED4 A;  4EM0 B;  3BJA A;  2VON A;  2KQR A;  5FKK A;  1V55 H;  4II3 A;  4DBR A;  3K1N A;  2OF7 A;  2VQG A;  1LDK B;  2ZJQ F;  4BQQ A;  3K70 C;  1U5T A;  1RKW A;  1HDP A;  4Q5S F;  2DBB A;  3U1D A;  3MD2 A;  2CUJ A;  2CGP A;  1TNT A;  2DFE A;  4L9N A;  3J81 K;  1JXS A;  4DQ2 A;  2E71 A;  1CF7 B;  1MH3 A;  2VOO A;  5DUK A;  5ERI A;  3E1S A;  3I56 I;  2K5C A;  3DTI A;  4MFD A;  4HEA 2;  4R1H A;  3DLL F;  2IGM A;  4XRM A;  3CCL I;  5D5U B;  3CZ6 A;  4M6X A;  2Q8K A;  3K4M A;  4N0B A;  3A01 B;  2GOM A;  4ZDO A;  2FBK A;  1I1S A;  1JHF A;  1VI0 A;  2GWR A;  3PL8 A;  1ETW A;  4XON A;  1DU0 A;  1OQY A;  2Z5U A;  2EIL H;  3LSJ A;  4LK1 F;  2ISY A;  3RTR A;  3C1D A;  1IG7 A;  1TW3 A;  3RJP A;  1IJW C;  3GYH X;  1XG1 A;  1LEA A;  1UFM A;  2DOA A;  3ZMZ A;  4S04 A;  1AKH B;  3J7A Y;  2VE8 A;  2EV6 A;  2A68 F;  1BOA A;  1GLN A;  3OYH A;  2V1D A;  3SQN A;  2D1V A;  1RUN A;  3ZMT A;  5F64 A;  2M5W A;  2QWW A;  3FBN B;  1HKQ A;  4KT6 A;  4QLC U;  3IHU A;  3Q0V A;  4NBQ A;  1Y8R B;  2CQ7 A;  4IXA A;  3CP2 A;  4M3D A;  2JA8 J;  4HRI A;  2NXN B;  3OSF A;  3GTQ J;  3S2W A;  5J1Y A;  2H1K A;  1OCC H;  2XPU A;  1UST A;  4XL9 A;  3CO7 C;  3O8G A;  3WTZ A;  3W3C A;  2EQR A;  2RGV A;  4IRH A;  1MDM B;  4IQ4 A;  3QP6 A;  2V6C A;  5J8C A;  4OMY A;  1TQP A;  4FTH A;  4MQ9 F;  3GTP J;  2ADU A;  5EDN A;  1SFO J;  3VWB A;  2CJJ A;  3ULQ B;  3H0D A;  4BJ5 C;  1OYW A;  2IXS A;  3SEQ A;  2GA1 A;  3ASN H;  1YW7 A;  3TP0 A;  2P7V B;  4V2G A;  1BJZ A;  5H20 A;  1VQ5 I;  2DYS H;  2NS7 A;  3A02 A;  3O6B B;  9ANT A;  1OCZ H;  2EPF A;  3HXL A;  3U1K A;  3DWL E;  5FLX K;  4OIN F;  2TRT A;  1Y6I A;  2XUB A;  5M5X J;  3CCV I;  2FJ1 A;  2XAS A;  2KIU A;  1K6O A;  2NS0 A;  3T8T A;  2NVQ J;  4N9H A;  2X6O A;  1S6L A;  1P4W A;  2R3S A;  3NWT A;  4D5F A;  3CDH A;  1LFB A;  4F52 A;  3SDG A;  2KFD A;  4IJA A;  4CCO A;  2QQB A;  3P7N A;  3J81 Z;  4I6Z A;  4HSR A;  3UR3 C;  4XIC A;  2LKP A;  3ZQ7 A;  1MBF A;  1E3H A;  2LSO A;  4L0Z B;  3I59 A;  3G1M A;  1MJ9 A;  4A5M A;  3OYJ A;  3LMM A;  1ODD A;  3RKY A;  2JRM A;  3ZGK A;  5KAF C;  1YIO A;  3DXJ F;  1BJA A;  2R7V A;  4E6K G;  3GXO A;  4E7J A;  1EF4 A;  1YJN I;  2GIZ A;  1ZRD A;  3SEZ A;  3DFG A;  4XLF A;  1KU7 A;  1E2X A;  3ERM A;  2W57 A;  4OAY A;  2CW0 F;  3RDI A;  2L2O A;  5GTH C;  2EK5 A;  2JMW A;  1U9N A;  5K1Y A;  3M8F A;  3TKY A;  3HSF A;  4LG0 B;  2WAE A;  3U2R A;  1J59 A;  1F9N A;  4EJO A;  3MKW B;  4RLQ A;  1K6Y A;  4EJU A;  1DDN A;  5F0H A;  3DKY A;  1AOY A;  3OYA A;  2X1C A;  4ZTJ A;  5HLG A;  3GME A;  1OR7 C;  1W36 C;  2XB5 A;  3KCC A;  5K7F A;  2VL8 A;  3BG3 A;  1I50 J;  1LQ1 A;  4HQM A;  1LE8 A;  3J7A O;  1WHU A;  5HVQ C;  2FBH A;  2LMD A;  3TO9 A;  4ABZ A;  3NRV A;  1HSJ A;  1KYZ A;  2L7F P;  3OL4 A;  4CUG A;  4L9T A;  2E7W A;  1EJ9 A;  3R0J A;  4I76 A;  4AU7 A;  2OZU A;  3WU0 A;  2HKO A;  4FQG A;  4G7H F;  1B9M A;  4UNO A;  2OJE D;  1JI8 A;  1TNS A;  2VKE A;  3PUB A;  5J1R A;  3CF5 F;  3CMY A;  3G6E I;  2K3P A;  1IO2 A;  2ZKZ A;  1XSX A;  3S1Q J;  2XF6 A;  4I0A A;  4ZDP A;  5H6Q A;  1K4S A;  2XGX A;  2XSD C;  2EIN H;  1CQT A;  3HB9 A;  1DPU A;  5DCF A;  3A1Y A;  3BY6 A;  1TWG J;  3LST A;  4HOB A;  4BEH A;  3OYM A;  2QA4 I;  1FSH A;  4EEF G;  1FNN A;  1Z6T A;  4NDL A;  5FGM A;  1T8I A;  2QKL B;  3R0A A;  2JA2 A;  4D5C A;  2AS5 F;  3OS2 A;  3S1R J;  2EFO A;  3NWS A;  3I4M J;  2VB6 A;  3K69 A;  4GYI A;  4UHT A;  5F0F A;  3DTK A;  4A12 A;  1B1B A;  2KJC A;  4M3G A;  4BAC A;  3KYL A;  1ITY A;  5J4Y A;  3CQZ J;  2CYY A;  3WTS C;  2OTJ I;  2D1H A;  4AVP A;  3DEW A;  4BGD A;  2VJJ A;  4PDK A;  2P6S A;  2JRT A;  2VN2 A;  1B72 A;  2X6W A;  2F5C A;  2O8X A;  4IHY A;  3S15 J;  2R7X A;  4M72 A;  3BG9 A;  3QQA A;  3QPL A;  4HF1 A;  2HFH A;  1LB2 A;  3GUD A;  4LMY A;  3H3Z A;  4MNU A;  3BR3 A;  5F08 A;  3SZG A;  5FJ8 J;  2V6E A;  3TQN A;  1O3T A;  4D1Q A;  2WB1 N;  4M73 A;  3HHG A;  4YFX F;  1BOB A;  3IAS 2;  2P0W A;  4A3J J;  2CU7 A;  3WGI A;  2Q2E A;  1W7P D;  4WXD A;  2FD5 A;  1FWZ A;  1BI2 A;  3Q9V A;  2CQK A;  2A5W A;  3JRG A;  1MW7 A;  4NQW A;  3CMA I;  2DA1 A;  4XK4 A;  3SZT A;  2MD0 A;  2ZXH A;  4ASN A;  4G9Y A;  1FYK A;  1WQ2 A;  1D5V A;  2W25 A;  1G59 A;  5K7Z A;  3KP6 A;  1UHW A;  3TOB A;  3V7S A;  2FNP A;  1IC8 A;  5D4R A;  4UUS A;  1OR7 A;  4XRS A;  2KRF A;  3BP8 A;  3MKL A;  2BXY A;  2PLY A;  2WB1 A;  1HKT A;  1ZKG A;  1WJB A;  3L09 A;  1TLH B;  1XCB A;  2STT A;  4KDP A;  4V2F A;  4XID A;  3VFZ A;  2O6G E;  1HXD A;  2JN6 A;  3X2Q H;  2CRG A;  2PG4 A;  1ZGA A;  1PJR A;  1GVJ A;  3LNQ A;  3JRE A;  1YHQ I;  2UV1 A;  2K27 A;  1YI2 I;  4ON0 A;  2HOS A;  3LSH A;  2A69 F;  4A3G J;  1KQ0 A;  2IA2 A;  2KRC A;  3PUF A;  1ETQ A;  4R79 A;  4KA4 A;  1SD5 A;  2QBY A;  5IP6 A;  1N75 A;  3OWT A;  1ZRE A;  2F5E A;  1UZC A;  2VQL A;  2GM4 A;  4ENN A;  5HNH A;  4RS8 A;  3O3K A;  2DA5 A;  3GZ6 A;  1MNM C;  4HA8 A;  3JTH A;  3S14 J;  3HUG B;  2KJB A;  1Z77 A;  2VQC A;  1HOM A;  2L02 A;  4HNU A;  3K4B A;  2Y75 A;  4H4K C;  5K5R A;  1IUY A;  2LKS A;  4A3F J;  3HSR A;  1GXQ A;  2HVQ A;  2K9M A;  1FMW A;  2EZI A;  3KEO A;  3BJ6 A;  4HZF A;  1E17 A;  5DM6 F;  1GT0 C;  2EIJ H;  3ZCO A;  4QTR A;  1FTT A;  1I6H J;  3IH3 A;  5HS7 A;  2DK8 A;  2RC4 A;  4XR6 A;  4D7N A;  1SD7 A;  1H9G A;  2DAO A;  4YFN F;  3HC7 A;  1VQ4 I;  1NG6 A;  1OCR H;  2QKM B;  4JX6 A;  1O57 A;  1ZEL A;  2GA2 A;  2KL4 A;  4HF0 A;  2V1N A;  3CCE I;  4MIM A;  2I10 A;  3HTU A;  4E7I A;  2ZO4 A;  2J5O A;  2W7N A;  2A5Y B;  3IP4 B;  2CV1 A;  5H6R A;  1ON1 A;  2LRE A;  1UB9 A;  2JPC A;  3HL2 A;  2QCO A;  3CTA A;  4D9J A;  2YS9 A;  2QSG X;  1R9T J;  3F72 A;  1GUU A;  2NAZ A;  2A3S A;  1B4A A;  5E1W A;  4PFO A;  2F6C A;  3T0Y A;  2E2I J;  2KLO A;  2H8W A;  3GTK J;  4IRG A;  3V7C A;  4F92 B;  1IXR C;  1WH7 A;  1WFX A;  2A07 F;  3FHZ A;  3SHF A;  1BR4 A;  1R4N B;  2L9V A;  3T8R A;  3TDU C;  2R5Z A;  4OIQ F;  3S1N J;  2ZJP F;  2JA7 J;  1F36 A;  4XBF A;  1UCR A;  4BY1 J;  1LUJ B;  3VOE A;  2O3F A;  3WU1 B;  3BQY A;  4Q48 A;  1YX5 A;  2BY2 A;  2IS1 A;  3MFK A;  5FRN A;  1UG0 A;  3F6O A;  4ANJ A;  1WSU A;  4IHX A;  5CVJ A;  1S72 I;  3HPG A;  2L9S A;  2O61 A;  2Y48 A;  5EZH A;  5FKL A;  1SD6 A;  4ZDL A;  1KU9 A;  1JE8 A;  1W4M A;  3F21 A;  2XAF A;  4C30 A;  4BBS J;  4ZYE A;  2M0M A;  5BQT A;  2QM3 A;  1IGN A;  3BTJ A;  4JYK A;  3RYR A;  4RBO A;  2AQE A;  1T0F C;  3HOY J;  2W82 A;  3F6V A;  2HVR A;  3GFJ A;  1XMK A;  2OTL I;  1VQN I;  3Q5F A;  1IXC A;  4ZH4 F;  4ZTF A;  2JSP A;  2K9L A;  1LFP A;  4KNY A;  4G6T B;  3IV5 A;  1FC3 A;  2O03 A;  2XSJ C;  4HST A;  4NC8 A;  2PX9 A;  4ESF A;  4F3Q A;  1FZP B;  3SYT A;  2M30 A;  3JAM K;  3WU2 C;  2HQA A;  4A6E A;  2JUC A;  2GQQ A;  1G3Y A;  3DBL B;  5HOO A;  2X48 A;  2GXG A;  4RGR A;  4EJW A;  5KK1 A;  3WTX C;  3V8L A;  3LAP A;  1NK2 P;  1O7F A;  1FMV A;  1WPK A;  2PFB A;  1HST A;  5IP9 J;  3SFI A;  4IF4 A;  3OS1 A;  3I58 A;  1ZG3 A;  3GTM J;  3TOA A;  4BE1 A;  2GIV A;  1PUE E;  3FHN A;  4O5V A;  1FBQ A;  3ZMV A;  4P9F A;  1G2H A;  2X6Y A;  1XDS A;  3BR1 A;  3HRU A;  1BIA A;  2W24 A;  4HF2 A;  2XDV A;  3DU6 A;  1SFU A;  2HQR A;  3HRT A;  5HLH A;  2EJR A;  1S29 A;  3O8H A;  4PGG A;  3MZ8 A;  1ZG5 A;  1VQ7 I;  2QSH X;  1UG2 A;  1BBY A;  1JJ8 C;  3KLO A;  4FX0 A;  4ZZD A;  1UJ8 A;  2VXZ A;  4XRS G;  1KYW A;  4M9X A;  1VQ6 I;  4F93 B;  2WTE A;  3HZJ A;  3DTE A;  4PGH A;  2PMU A;  3HIF A;  2F5V A;  4F91 B;  3B6C A;  4EJT A;  3ABK H;  2K9N A;  4MGR A;  2DCE A;  5IYC J;  1OJL A;  2FX0 A;  2VPL A;  2FQ4 A;  2X4H A;  2VQH A;  3I64 A;  4CZZ A;  4JP0 A;  1SMY F;  2BBY A;  3GWZ A;  1XGN A;  3BZ6 A;  3GLL A;  1T98 A;  3Q3S A;  1STZ A;  3N05 A;  2EFQ A;  1Y0U A;  1IRX A;  4RA2 A;  4C3I J;  1OIS A;  5KHD A;  4HV6 A;  2HS5 A;  3PFY A;  2PMZ N;  4EGY A;  1R49 A;  2DPD A;  1ZHF A;  3GBG A;  2Z3Y A;  4A2U A;  1OLT A;  1VF9 A;  1GV2 A;  1R5H A;  4B43 A;  1XX5 A;  4EM2 A;  4B47 A;  3HEF A;  2YSR A;  4A0Y A;  3CC4 I;  5C44 J;  1WCM J;  1K79 A;  2BGC A;  2ID3 A;  4MQV A;  4DJA A;  2X1D A;  4KIF A;  4BU2 A;  1ZRF A;  1U78 A;  1Z0X A;  4XNF A;  1YO5 C;  1A35 A;  1YRN A;  2IAI A;  3K0L A;  1A04 A;  2ZME C;  4RGX A;  2XRO A;  2GBY A;  1P92 A;  1SD4 A;  2F4I A;  2IA0 A;  4DGW B;  4Q4Z F;  4HLY A;  3CUQ B;  3SXY A;  3A03 A;  3EPZ A;  1ZGJ A;  5J3L A;  4QPQ A;  4C2T A;  1WH5 A;  2PMZ A;  1T0F A;  2DTZ A;  1TTY A;  1S7O A;  1V5E A;  3JAM Z;  3HOS A;  1RNL A;  3I71 A;  2X1E A;  2V9K A;  4KYW A;  3NAR A;  4KIB A;  2ICW G;  4BE0 A;  2JT1 A;  1HW2 A;  1EH6 A;  3ECH A;  3TMO A;  3AG1 H;  2HXO A;  1LVA A;  4G7O F;  5D6E A;  2R7W A;  2IGK A;  3OYL A;  4BY7 J;  4GGG A;  4HPQ A;  3CCS I;  4AYB N;  2EB7 A;  3MEX A;  4CHU A;  2FE3 A;  1R00 A;  2CFX A;  2IGO A;  2LF8 A;  3DBH B;  4Y17 A;  4BNC A;  3I0T A;  2L7Z A;  2MW8 A;  4DZJ A;  1QHH D;  3B02 A;  1DPR A;  2MAB A;  5B1B H;  2XVC A;  1TC3 C;  1RRJ A;  2UXX A;  2DA4 A;  1QPI A;  1Z7U A;  2I8D A;  1H0M A;  1LVK A;  5LGN A;  1BA5 A;  1X3Z B;  4E7H A;  4P1W A;  2LBF A;  2LC2 A;  2L4A A;  3HRM A;  2P5L C;  3MAJ A;  5J4V A;  5BMZ A;  2R5Y B;  1MZB A; 
#chains in the Genus database with same CATH homology
 4UV8 A;  3WTT C;  3SZP A;  3HTS B;  1LJ9 A;  1R1U A;  3KP3 A;  4U7D A;  2H27 A;  3LAJ A;  1DUX C;  5ILV A;  4NHJ A;  2XRN A;  3JSP A;  4RAZ A;  5J8F A;  2DO7 A;  3IC7 A;  5FD5 A;  1JHH A;  5F1R A;  1UHM A;  4LLN A;  2VBY A;  5D5W B;  3BRO A;  2FML A;  3ZN1 A;  3NQO A;  3QRF F;  4HYE A;  3IL2 A;  2UZK A;  2IJL A;  3J80 K;  3HSE A;  3ABU A;  2IVM A;  4I7H A;  4OIR F;  2ZME A;  1SFX A;  2JZY A;  5L3F A;  1K78 A;  5D8L B;  3IKT A;  1SAX A;  1YW8 A;  3V4G A;  4HX8 A;  3KP2 A;  3WOD F;  1ZG1 A;  3QU3 A;  5K5O A;  2MLG A;  3HHH A;  2JTV A;  1L3L A;  3H3U A;  3WG9 A;  4LD5 A;  5DCM A;  3K2Z A;  1XD7 A;  2P4W A;  5LHG A;  4GCV A;  1ZAO A;  3R4K A;  1REP C;  1U6G A;  2ZNY A;  2C6Y A;  1BC8 C;  2V1U A;  2FNA A;  4KUM A;  3B73 A;  3DQV C;  4HV5 A;  4BYY A;  3KE2 A;  1FY7 A;  2QUF A;  3EYY A;  2MH9 A;  4XSX F;  4G7Z F;  2J5P A;  2DFI A;  3GF2 A;  2QQ9 A;  5TRD A;  5JFR A;  4G94 A;  4Z2Y A;  1YYV A;  3RYP A;  4NB5 A;  2M45 A;  1Z1D A;  5ICF A;  2BV6 A;  1U3E M;  2V9V A;  3OOP A;  1IN8 A;  2UWM A;  3K1P A;  2K86 A;  1I27 A;  4G6Q A;  2ESH A;  3ZP5 A;  2DU9 A;  4AIK A;  1FSE A;  5HS8 A;  3CO6 C;  3OV8 A;  1R22 A;  3MZY A;  3J80 Z;  3FF5 A;  3GFI A;  2EFW A;  4TV7 A;  2PEX A;  3ERE D;  3I53 A;  4AD9 A;  1D8K A;  4I0B A;  1J7K A;  2R7F A;  1PDN C;  4IPA A;  3ELK A;  3GZ5 A;  1KU3 A;  2G7U A;  3MWM A;  1HKS A;  4CIC A;  1CF7 A;  4OU0 A;  2RN7 A;  1BN5 A;  2XAJ A;  5E20 A;  5CVU A;  3C3W A;  1FPQ A;  3DV8 A;  3KP5 A;  5A2Q K;  2DLL A;  3ZMD A;  2LNB A;  2ZBK A;  2H94 A;  3ZN0 A;  4ENK A;  1WWX A;  1MGT A;  4MHG A;  4Y15 A;  3LQQ A;  5CJ9 A;  5E1X A;  5FLX Z;  1W7P B;  3ZMU A;  1YFH A;  2PJP A;  4FT8 A;  4BHB A;  2DQR A;  3PQJ A;  1F1Z A;  2PBI A;  4P96 A;  3JSO A;  3BPV A;  4HX7 A;  4RGU A;  3L7W A;  3RI4 A;  2Z33 A;  3ABT A;  3WTW C;  2RQP A;  1F5T A;  2XKO A;  3P9C A;  3PFI A;  2VBX A;  5LHH A;  2H09 A;  3FMQ A;  5IT9 K;  2MBF A;  2NNN A;  1MDM A;  3ML6 A;  2VT2 A;  1ZLK A;  4IHS A;  5HS9 A;  1G3T A;  3QAH A;  5KVR A;  2HR3 A;  4WF2 A;  3DPT A;  3C7J A;  4RAY A;  1XSV A;  5AON A;  1HQC A;  4U0Y A;  4HDV A;  4HQE A;  4CYD A;  1P2F A;  1BI0 A;  3BDD A;  4L5J A;  1RIO H;  2QYO A;  4LK0 F;  5EEH A;  2LDU A;  4XLN F;  1KQ8 A;  5HDG A;  4E70 A;  5HDK A;  3VEP A;  4BXU A;  1HW1 A;  2M8E A;  3ZMS A;  4D0P A;  2FQ3 A;  3KEQ A;  2PQ8 A;  3MCZ A;  1R1T A;  3HYI A;  5A2Q Z;  2G7H A;  5LLQ A;  1I6X A;  4B09 A;  2NNY A;  3E6M A;  4RB1 A;  2W84 A;  5ICG A;  2IA1 A;  3F8N A;  2Z9O A;  4LG0 A;  5F6F A;  1EH7 A;  4BHP A;  4ESB A;  3FX3 A;  3F3X A;  5BPD A;  3F8B A;  2EV0 A;  1IN6 A;  4P9U A;  1S8N A;  2KIF A;  1YS6 A;  2DQL A;  4ESJ A;  5JI6 A;  2BEO A;  4AWX B;  3FXQ A;  2P6T A;  4GYG A;  3IKV A;  6PAX A;  2MLK A;  2R7D A;  3RIR A;  1FOK A;  3CUO A;  1Z6R A;  4MEY F;  3E3V A;  2XAG A;  4M71 A;  3P9I A;  4A0Z A;  4AIH A;  4EQQ A;  2ZCW A;  2BE5 F;  2GXB A;  2CG4 A;  3TDZ C;  4UXN A;  3KFW X;  3NEU A;  2FA5 A;  2FU4 A;  4UV9 A;  3QPT A;  3ROU A;  3W6J B;  1FP1 D;  1P4A A;  2P7C B;  2Q0O A;  2HWV A;  2MH2 A;  2OU2 A;  4U0W A;  4L9V A;  1OYY A;  4EV0 A;  1G3W A;  1WRJ A;  4XSZ F;  1TQI A;  3EUH A;  3PQK A;  3WGG A;  2D2W A;  2WC2 A;  1MJA A;  3BWG A;  4EMS A;  3D5L A;  5L3B A;  3RKW A;  1YS7 A;  2L01 A;  3WE2 A;  1U8R A;  2OZ6 A;  2DW4 A;  1LDD A;  3QU6 A;  2OA4 A;  1HW5 A;  2D45 A;  1WKM A;  2VT3 A;  3FM3 A;  3CJN A;  2LF7 A;  2ACJ A;  1O7L A;  2HGC A;  2DTR A;  1XGM A;  2IW5 A;  5BPI A;  4CO8 A;  4WWC A;  2JSC A;  1XGS A;  1D8J A;  4HX4 A;  2YU3 A;  4WK8 F;  2L3D A;  4A0X A;  1U5T B;  1GXP A;  2K7L A;  4FX4 A;  4LFU A;  2K4J A;  1G4D A;  3N97 A;  1EH8 A;  1WI9 A;  5LBQ A;  3ECO A;  3LA2 A;  4UVA A;  2XKP A;  3M7G A;  3EQL F;  2QVO A;  2HYF A;  4XRF A;  4F7Z A;  1QGP A;  1ZH5 A;  2HOE A;  1DP7 P;  5DD8 A;  2XIG A;  1D3Y A;  1TBX A;  3IRQ A;  3HUG A;  2XAQ A;  3FXR A;  2G9W A;  2IT0 A;  2ELH A;  3WTU C;  1USS A;  5FFX A;  4U7B A;  2ESN A;  4JBA A;  4KIG A;  2STW A;  1LDJ A;  3REO A;  1T38 A;  3ISP A;  3FM5 A;  1AWC A;  5LRS A;  4ENM A;  5LHI A;  1PP8 F;  1U2W A;  2B0L A;  5FD6 A;  4ZZL A;  4KN4 X;  3T1B A;  5D8K B;  2WV0 A;  1MJB A;  3KET A;  4AIJ A;  4IHT A;  4L18 B;  1B6A A;  3RKX A;  4S05 A;  3KP7 A;  2M1B A;  2V1X A;  2HDC A;  4KN7 X;  5CVV A;  1IXS B;  1T39 A;  1O3S A;  2PMH A;  2VBW A;  1R58 A;  2ZXJ A;  3LWF A;  4KT5 C;  3C18 A;  4B8X A;  3TO7 A;  4WX9 A;  1SMT A;  2QZ8 A;  1J2X A;  3I59 B;  4M9S A;  3U9G A;  2FXA A;  1Q1H A;  3CUQ C;  1J0R A;  4P5O A;  1HBX G;  2HTS A;  3P9K A;  2NYX A;  4YG2 F;  5AIQ A;  1OKR A;  4OIP F;  5HLI A;  2EFP A;  1QO0 D;  1O3R A;  3M8E A;  2VOD A;  3N4M A;  3E6C C;  4L5I A;  1S3J A;  3FMR A;  5HDN A;  2MD5 A;  3DF8 A;  1XSD A;  4MTE A;  2QLZ A;  1ON2 A;  2YPR A;  2OQR A;  1X3U A;  3RPU A;  3WGH A;  4Q47 A;  3GFL A;  5D6F A;  3ZPL A;  3Q9S A;  3IWF A;  1ZRC A;  5L3D A;  1F4K A;  2DK5 A;  5L3E A;  1FBS A;  1IN4 A;  1R36 A;  2W85 A;  2F5D A;  1IZ1 A;  1OYI A;  3M9A A;  3HRS A;  1Z05 A;  1P4X A;  4RB2 C;  4OMZ A;  4EGZ A;  3E5U A;  5E1Z B;  3WTV C;  4KFC A;  2YX4 A;  3E5X A;  3G3Z A;  4CXF A;  1XGO A;  3GW2 A;  4RB3 C;  5DEQ A;  2VE9 A;  1I5Z A;  4CGZ A;  4CDG A;  1QBJ A;  4I01 A;  3CUQ A;  3EDP A;  1YW9 A;  4KIC A;  1ZN2 A;  3DKW A;  5ICE A;  3KP4 A;  5CLS A;  1IF1 A;  4GXO A;  2GAU A;  3M1E A;  5FB2 A;  3R61 A;  1YTY A;  1K7A A;  5LGU A;  1BC7 C;  1EV7 A;  2F2E A;  1FX7 A;  3QP5 A;  3T5X A;  4WCG A;  1JGS A;  4HAM A;  1S7A A;  1XDU A;  1IN5 A;  2PI0 A;  3QPH A;  3GX4 X;  2FEZ A;  4HBL A;  2HZT A;  1G6N A;  2IPQ X;  2HYG D;  1RUO A;  2QBY B;  1IRG A;  3TO6 A;  5LGT A;  1L0O C;  1FYL A;  2UXN A;  1FBU A;  3E6D A;  2M87 A;  2P5K A;  4ETS A;  4I09 A;  3TGN A;  3L00 A;  2CWE A;  1XCV A;  3EYI A;  3VOD A;  5L3C A;  1J9I A;  4H0E A;  2QQA A;  1XB4 A;  2VOP A;  3F22 A;  1LNW A;  3GO5 A;  1R1V A;  3DP7 A;  5FFZ A;  1W5T A;  1IAW A;  3F23 A;  4L0Y B;  2HKX A;  5EEG A;  4R8H A;  4U88 A;  2DI3 A;  5DUI A;  1QZY A;  4JK1 X;  1XN7 A;  2XHK A;  3E5Q A;  3K1M A;  1KGS A;  2RVC A;  2RKH A;  3RPQ A;  1ONV A;  3I5U A;  5J6X A;  2K02 A;  4LB6 B;  2OQG A;  2ISZ A;  3LA3 A;  1MKM A;  3E97 A;  4M9Z A;  1MD0 A;  5BOX A;  3VB2 A;  1QPM A;  2YR2 A;  5TJJ A;  4ENJ A;  2L4M A;  2OAZ A;  3F8F A;  3SFZ A;  2IRF G;  1YG2 A;  2PN6 A;  3KZZ A;  4EVI A;  2P8T A;  1ZAR A;  1IN7 A;  2OD5 A;  2KKO A;  5DV5 A;  4LLG F;  3W6K B;  2EV5 A;  1V3F A;  4WXC A;  2H6B A;  3JTG A;  1IRF A;  4RB0 A;  2E1N A;  4O3M A;  2OBP A;  4HDU A;  1BIB A;  5JR3 A;  1CGP A;  4LB5 A;  4OIO F;  1RI7 A;  3K9T A;  3GFM A;  5BS6 A;  1BM9 A;  3H92 A;  2DT5 A;  4OOI A;  4I98 B;  4P55 A;  1YLF A;  2A6H F;  1KQ9 A;  1SFE A;  3E6B A;  3IRR A;  4WXH A;  4L9J A;  4JQF A;  3F8C A;  1PP7 U;  4HW0 A;  4Y13 A;  2KIM A;  1J5Y A;  2L54 A;  2VC1 A;  2XV4 S;  1OPC A;  1TQM A;  5E17 F;  1BI3 A;  2CSO A;  3AAF A;  5IT9 Z;  2FSW A;  2GZW A;  3WE3 A;  1FP2 A;  2WWY A;  3G73 A;  2Y0M A;  5FO5 A;  2RV8 A;  3MQ0 A;  5DDG A;  3WTY C;  4BQA A;  1NHA A;  4EM1 A;  5LRR A;  2EA2 A;  2VC0 A;  1FLI A;  3V8J A;  2FOK A;  4FHT A;  2TDX A;  5JVT A;  1W7P A;  1QZZ A;  1B9N A;  2A6E F;  4YII A;  2EA4 A;  4LGW A;  4GO1 A;  1QNT A;  3GEZ A;  1J75 A;  1YQA A;  5E8I A;  5DD4 A;  1ULY A;  5E8G A;  3KLN A;  2EWN A;  3L2C A;  4MTD A;  2VBZ A;  1FYM A;  4IRI A;  1V4R A;  1O3Q A;  1I1G A;  1XMA A;  4N9I A;  5CYV A;  3FMS A;  3F8M A;  2FF4 A;  4LJZ F;  2FMY A;  3DPL C;  2NRA C;  1KA8 A;  5K5Q A;  3QOP A;  2FRH A;  2ZFW A;  1H9T A;  2P5V A;  3LA7 A;  3O2P E;  3R60 A;  2RNJ A;  4ZYH A;  1LEB A;  2Z99 A;  4HLX A;  5CVR A;  1C0W A;  4KMF A;  1W5S A;  1R5G A;  1VTN C;  3FZV A;  1G3S A;  2CO5 A;  4O6J A;  3JW4 A;  5LEK A;  4MEX F;  4DNC A;  4EJV A;  4QWQ A;  5ILS A;  3COA C;  5LEJ A;  5DYM A;  1TW2 A;  4ZYD A;  2A61 A;  1IW7 F;  1T2K A;  2HTJ A;  4K2E A;  4KMU X;  3LFK A;  1R7J A;  3BJO A;  2QEN A;  2HEO A;  4PCQ A;  1RZ4 A;  5E18 F;  1KU2 A;  2YX7 A;  2E1C A;  3L9F A;  4M74 A;  5D4S A;  4UVB A;  1U5T C;  2COM A;  3I4P A;  2ZME B;  2JPB A;  3FXU A;  4G6D A;  1K78 B;  3BPX A;  2O0Y A;  4BHC A;  3EET A;  2RDP A;  2FBI A;  1FT9 A;  2XAH A;  1GHC A;  2MA3 A;  2ETH A;  1ZLJ A;  3R6S A;  5JHU A;  3GLX A;  4M6Y A;  1OMI A;  5L3G A;  5CVI A;  4ZYG A;  2BYV E;  4UVC A;  5DCM B;  3HOT A;  3MZH A;  2HQN A;  2H6C A;  2AXL A;  4A6D A;  4G8X A;  2X0L A;  3D0S A;  4RGS A;  3FWE A;  4XLP F;  1R23 A;  2K4B A;  2ZNZ A;  1B59 A;  3CLO A;  3DEU A;  4I02 A;  4A5N A;  4BH9 A;  1Z91 A;  2DPU A;  5D5X B;  4BAY A;  3KZY A;  3V8K A;  4UUV A;  1BI1 A;  1QQI A;  4I2O A;  2ZJ2 A;  4YFK F;  5D5V B;  4LLL A;  3I54 A;  3LQR A;  2IP2 A;  1T6S A;  1ZYR F;  2EFN A;  5ILU A;  4IVN A;  4YIF A;  3GVA A;  3IWZ A;  4PZJ A;  1Z9C A;  2MC3 A;  2F5F A;  5IT3 A;  3V7R A;  2V79 A;  4U0V A;  5AIP A;  1P6R A;  5ICC A;  3BOQ A;  2E7X A;  5ED4 A;  4EM0 B;  3BJA A;  2VON A;  3K1N A;  1LDK B;  1U5T A;  4Q5S F;  2DBB A;  3U1D A;  2CGP A;  1TNT A;  4L9N A;  3J81 K;  1JXS A;  4DQ2 A;  1CF7 B;  2VOO A;  5DUK A;  5ERI A;  4R1H A;  5D5U B;  4M6X A;  2Q8K A;  4N0B A;  2FBK A;  1I1S A;  1JHF A;  2GWR A;  2Z5U A;  4LK1 F;  3RTR A;  2ISY A;  3C1D A;  1TW3 A;  3RJP A;  3GYH X;  1LEA A;  1UFM A;  3ZMZ A;  4S04 A;  2VE8 A;  2EV6 A;  2A68 F;  1BOA A;  2V1D A;  3SQN A;  2D1V A;  1RUN A;  3ZMT A;  5F64 A;  2M5W A;  2QWW A;  1HKQ A;  4QLC U;  3IHU A;  4IXA A;  3S2W A;  1UST A;  3CO7 C;  3WTZ A;  2RGV A;  4IRH A;  1MDM B;  3QP6 A;  2V6C A;  5J8C A;  4OMY A;  1TQP A;  4MQ9 F;  2ADU A;  3ULQ B;  1OYW A;  2GA1 A;  1YW7 A;  2P7V B;  5H20 A;  3O6B B;  5FLX K;  4OIN F;  2XUB A;  2XAS A;  2KIU A;  1K6O A;  2NS0 A;  3T8T A;  4N9H A;  1S6L A;  1P4W A;  2R3S A;  3CDH A;  4IJA A;  2QQB A;  3P7N A;  3J81 Z;  2LKP A;  3ZQ7 A;  2LSO A;  4L0Z B;  3I59 A;  1MJ9 A;  4A5M A;  1ODD A;  3RKY A;  1YIO A;  3DXJ F;  1BJA A;  3GXO A;  1ZRD A;  3DFG A;  1KU7 A;  1E2X A;  2W57 A;  2CW0 F;  3RDI A;  2EK5 A;  5K1Y A;  3M8F A;  3TKY A;  3HSF A;  4LG0 B;  3U2R A;  1J59 A;  1F9N A;  4EJO A;  4EJU A;  1DDN A;  1AOY A;  5HLG A;  3KCC A;  1LQ1 A;  4HQM A;  3J7A O;  5HVQ C;  2FBH A;  3TO9 A;  3NRV A;  1HSJ A;  1KYZ A;  4L9T A;  2E7W A;  3R0J A;  2OZU A;  3WU0 A;  2HKO A;  4G7H F;  1B9M A;  4UNO A;  1TNS A;  2ZKZ A;  1XSX A;  4I0A A;  5H6Q A;  2XGX A;  1DPU A;  5DCF A;  3BY6 A;  3LST A;  4HOB A;  1FSH A;  1FNN A;  1Z6T A;  5FGM A;  3R0A A;  2AS5 F;  2EFO A;  3K69 A;  4GYI A;  4UHT A;  4A12 A;  1B1B A;  2KJC A;  2CYY A;  3WTS C;  2D1H A;  4AVP A;  4PDK A;  2P6S A;  2JRT A;  2VN2 A;  2F5C A;  2O8X A;  4M72 A;  4HF1 A;  2HFH A;  1LB2 A;  3GUD A;  4LMY A;  3H3Z A;  4MNU A;  3TQN A;  1O3T A;  4M73 A;  3HHG A;  4YFX F;  3WGI A;  2Q2E A;  1W7P D;  4WXD A;  1FWZ A;  1BI2 A;  3Q9V A;  2CQK A;  4NQW A;  3SZT A;  4ASN A;  4G9Y A;  1FYK A;  1WQ2 A;  1D5V A;  2W25 A;  3KP6 A;  1UHW A;  3TOB A;  3V7S A;  2FNP A;  5D4R A;  1OR7 A;  2KRF A;  3BP8 A;  2PLY A;  1HKT A;  3L09 A;  1TLH B;  1XCB A;  2STT A;  4KDP A;  3VFZ A;  2O6G E;  1HXD A;  2PG4 A;  1ZGA A;  1GVJ A;  2K27 A;  4ON0 A;  2A69 F;  1KQ0 A;  2IA2 A;  4R79 A;  4KA4 A;  1SD5 A;  2QBY A;  1ZRE A;  2F5E A;  4ENN A;  4RS8 A;  3O3K A;  3GZ6 A;  4HA8 A;  3JTH A;  2KJB A;  2L02 A;  2Y75 A;  5K5R A;  1IUY A;  3HSR A;  1GXQ A;  3KEO A;  3BJ6 A;  4HZF A;  1E17 A;  5HS7 A;  2DK8 A;  2RC4 A;  4YFN F;  1SD7 A;  1H9G A;  2DAO A;  1O57 A;  2GA2 A;  4HF0 A;  3HTU A;  2ZO4 A;  2J5O A;  2A5Y B;  5H6R A;  1ON1 A;  1UB9 A;  2JPC A;  3CTA A;  3F72 A;  2NAZ A;  2A3S A;  1B4A A;  5E1W A;  3T0Y A;  4IRG A;  3V7C A;  1IXR C;  2A07 F;  3FHZ A;  3SHF A;  3T8R A;  3TDU C;  4OIQ F;  4XBF A;  1UCR A;  3VOE A;  2O3F A;  3WU1 B;  4Q48 A;  3MFK A;  3F6O A;  1WSU A;  5CVJ A;  2O61 A;  2Y48 A;  1SD6 A;  1KU9 A;  1JE8 A;  1W4M A;  3F21 A;  2XAF A;  4ZYE A;  5BQT A;  2QM3 A;  3RYR A;  3F6V A;  3GFJ A;  1XMK A;  3Q5F A;  1IXC A;  4ZH4 F;  4KNY A;  1FC3 A;  2O03 A;  1FZP B;  4ESF A;  2M30 A;  3JAM K;  4A6E A;  2GQQ A;  1G3Y A;  5HOO A;  2GXG A;  4RGR A;  4EJW A;  5KK1 A;  3WTX C;  3V8L A;  3LAP A;  1O7F A;  2PFB A;  1HST A;  4IF4 A;  3I58 A;  1ZG3 A;  3TOA A;  2GIV A;  1PUE E;  3ZMV A;  4O5V A;  1FBQ A;  4P9F A;  1XDS A;  3HRU A;  1BIA A;  2W24 A;  4HF2 A;  1SFU A;  2HQR A;  3HRT A;  5HLH A;  2EJR A;  1S29 A;  4PGG A;  1ZG5 A;  1BBY A;  3KLO A;  4FX0 A;  4ZZD A;  2VXZ A;  1KYW A;  4M9X A;  2WTE A;  4PGH A;  2PMU A;  3HIF A;  4EJT A;  4MGR A;  2X4H A;  3I64 A;  4CZZ A;  1SMY F;  2BBY A;  3GWZ A;  1XGN A;  3BZ6 A;  1T98 A;  1STZ A;  2EFQ A;  1Y0U A;  4HV6 A;  2HS5 A;  4EGY A;  2DPD A;  1ZHF A;  2Z3Y A;  4A2U A;  1R5H A;  4EM2 A;  2YSR A;  4A0Y A;  1K79 A;  2BGC A;  4MQV A;  4KIF A;  1ZRF A;  1U78 A;  1YO5 C;  3K0L A;  1A04 A;  4RGX A;  2XRO A;  1P92 A;  1SD4 A;  2IA0 A;  4HLY A;  4Q4Z F;  3CUQ B;  3SXY A;  1ZGJ A;  1T0F A;  1TTY A;  1S7O A;  3JAM Z;  3HOS A;  1RNL A;  3I71 A;  4KYW A;  4KIB A;  2JT1 A;  1HW2 A;  1EH6 A;  3ECH A;  1LVA A;  4G7O F;  5D6E A;  4GGG A;  2EB7 A;  3MEX A;  4CHU A;  2FE3 A;  1R00 A;  2CFX A;  2LF8 A;  4BNC A;  4Y17 A;  3I0T A;  3B02 A;  1DPR A;  2XVC A;  2UXX A;  1Z7U A;  1H0M A;  5LGN A;  2L4A A;  3HRM A;  2P5L C;  3MAJ A;  5BMZ A;  1MZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...