2V79A

Crystal structure of the n-terminal domain of dnad from bacillus subtilis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
MKKQQFIDMQEQGTSTIPNLLLTHYKQLGLNETELILLLKIKMHLEKGSYFPTPNQLQEGMSISVEECTNRLRMFIQKGFLFIEECEDQNGIKFEKYSLQPLWGKLYEYIQLAQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA REPLICATION PROTEIN DNAD
publication title Structure of the N-Terminal Oligomerization Domain of Dnad Reveals a Unique Tetramerization Motif and Provides Insights Into Scaffold Formation.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 36
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2v79A00
1XGSA 4CDGA 2YSRA 1XD7A 4D0PA 2Y0MA 3GO5A 3S2WA 1Z1DA 2GWRA 3TGNA 5E20A 1ZRFA 4A0XA 3VEPA 3T5XA 1ZARA 5HDNA 4ZZDA 3SHFA 4PCQA 2A6HF 2GQQA 1JHFA 3VOEA 3QU6A 1FPQA 1D8KA 2P5LC 2PLYA 2IT0A 2UWMA 3ABUA 5LLQA 3LQRA 2MLKA 3TQNA 4EGYA 2MH2A 2VE9A 1F4KA 3EYIA 1R22A 3J80Z 1G4DA 3RIRA 1BI0A 4U88A 5ICGA 5A2QZ 4PGHA 1F5TA 2RC4A 1BJAA 4UNOA 4YG2F 5LEJA 2KRFA 3W6KB 3QRFF 3E6DA 4GYGA 3LAPA 2RKHA 5FFZA 1FWZA 4U7DA 1I1GA 5E8IA 2EA4A 4XSXF 1OKRA 1BC7C 2GZWA 2QLZA 1W7PB 4IRIA 2ELHA 1TW3A 5DDGA 3DQVC 1XCBA 4BHCA 2LF8A 4TV7A 4IRHA 2P5VA 4ESJA 3QOPA 3ISPA 2M45A 2X4HA 3KP3A 4HBLA 4KT5C 1HQCA 1ZAOA 5EEGA 1P4XA 3LWFA 5DEQA 5JR3A 1X3UA 1RZ4A 5CVJA 4NHJA 2VBXA 1FNNA 4RGXA 3HHHA 1ZGAA 1H9GA 4EJUA 4YFNF 5LHHA 2F2EA 3CLOA 5HS8A 4KIFA 4P96A 4R79A 4O3MA 5E18F 1XDSA 3CUQA 1XMKA 2HDCA 3E3VA 4ESFA 3NRVA 2FNAA 3QP6A 1G3YA 2R3SA 1YYVA 2RVCA 4L0ZB 2G7HA 2H94A 2HOEA 4WK8F 3EETA 3IWZA 4GCVA 5TRDA 3I5UA 4MNUA 2HTJA 3K0LA 3ZN1A 4ZYEA 3TDUC 2HKXA 4HYEA 4MTEA 1B6AA 4G8XA 5D6EA 2D45A 5D8KB 4M6XA 1W5SA 2L54A 2M87A 1L0OC 1TTYA 1IN7A 3WTWC 5IT9Z 2ISYA 2AXLA 1I27A 1MDMB 1KQ0A 2QUFA 1SFUA 2EJRA 1STZA 2O61A 2HYFA 2JT1A 1WI9A 1H0MA 3RKYA 3FM5A 3MQ0A 3FXQA 1YLFA 2ZO4A 3FMQA 1Z05A 4PZJA 3RKXA 3N97A 2IP2A 2XAJA 3ZQ7A 5E8GA 2E7WA 5CVIA 2F5DA 3CTAA 3QPHA 4R1HA 5CJ9A 4AIJA 1GVJA 5BQTA 3GFMA 5FB2A 4KN7X 3WODF 1S3JA 1O3RA 3ZMZA 2HWVA 2LKPA 5L3BA 2J5OA 3KETA 4P9UA 1SMTA 3SZPA 2L01A 2RDPA 3F22A 2DLLA 3CUOA 4HQEA 2FOKA 1QPMA 2GA2A 4HA8A 1LB2A 1B4AA 1ZRDA 3MEXA 3W6JB 4JK1X 2DW4A 4HX8A 4IVNA 3F8BA 4KA4A 2M30A 3N4MA 2VT2A 1OR7A 1D5VA 2K02A 4I01A 4JBAA 3V8LA 3GX4X 4P55A 5JI6A 2FEZA 1B59A 3HOSA 2MD5A 3LA7A 3F23A 4A6DA 1ULYA 4LD5A 2G7UA 3K1MA 4E70A 3T0YA 4FT8A 3F21A 1XSXA 1SD7A 4KYWA 2A69F 1WKMA 3L09A 3KZZA 3M9AA 5CVVA 3BJAA 5E1WA 4HZFA 1YS7A 4GGGA 2VN2A 5ICFA 4RB0A 4H0EA 3IRQA 4M9ZA 1USSA 2XAQA 3KP5A 4OIPF 1ZREA 2Q8KA 1P4WA 3E6MA 2OQGA 2V1XA 1Z7UA 2HS5A 1U78A 2ZKZA 1TQIA 3ZN0A 4LJZF 3J7AO 3HRSA 4AVPA 1DDNA 3Q5FA 3HSFA 4RB3C 1U5TC 2ZMEB 4M72A 2WTEA 4IJAA 3ABTA 4O5VA 5CLSA 3RYPA 1K7AA 1IXRC 1ZRCA 3GVAA 1P6RA 1LQ1A 2M5WA 2NRAC 2HZTA 4HV6A 4I0AA 3LAJA 4EJVA 2KIMA 3T8TA 5K1YA 2B0LA 5D6FA 1KU3A 4F7ZA 3KCCA 5D5WB 3C7JA 4GXOA 2EV6A 5H6QA 4A0YA 4RGRA 1HW1A 5L3EA 1BC8C 1IXCA 1RI7A 1XMAA 2KJBA 2E1NA 4EM2A 2XAFA 2ZFWA 1YQAA 2ESHA 4XSZF 2XIGA 5H20A 2P4WA 3DPTA 2DTRA 1CF7B 3TOAA 3NQOA 1GXPA 3C1DA 1IN4A 4R8HA 3JAMZ 3ZMSA 3K69A 1WQ2A 1TQMA 1S7OA 1W7PA 1SMYF 2WWYA 2VT3A 4CXFA 1ONVA 2UXXA 4Q5SF 2Z3YA 4BH9A 5BMZA 1XB4A 1K79A 2DT5A 2F5FA 2LF7A 1DPUA 1ZG3A 2RQPA 4MQ9F 2ESNA 2P8TA 3QU3A 2ETHA 2MH9A 2PBIA 4Y13A 3JW4A 1S7AA 1HBXG 4L5JA 1D3YA 3RPUA 4EV0A 1HKSA 2GAUA 2R7DA 5ILUA 3SQNA 1ON1A 5KK1A 1OYIA 3SXYA 1O3QA 4WXDA 1F9NA 4I98B 1QGPA 3VFZA 1FYKA 1FYLA 1QZZA 1FSHA 2RGVA 1XN7A 1MZBA 5CVUA 2Q2EA 2JPCA 2J5PA 3TDZC 2K86A 2OAZA 4IRGA 2EB7A 2FBIA 2FA5A 1MDMA 5LRSA 2BGCA 4LLGF 2CYYA 3L9FA 1QO0D 2YU3A 1Z6RA 3F8FA 3PFIA 5JVTA 2ZNYA 1JHHA 3FMSA 3JTGA 2HR3A 1XCVA 2RV8A 4QWQA 3ERED 1P4AA 3BZ6A 2WV0A 4UV8A 3ZMTA 2IRFG 1ZN2A 5LEKA 3CUQC 4RGSA 4EJOA 4FHTA 4EM0B 3ML6A 1EV7A 4EQQA 2QBYB 2L4AA 2E7XA 3HIFA 4A5NA 4WXCA 4BNCA 5CYVA 1ZG5A 2QM3A 4OU0A 1BBYA 2D1HA 1WRJA 3FWEA 1RUNA 1ZHFA 2DQLA 3R61A 3MZHA 5DUIA 5KVRA 4M71A 4LG0B 3WTZA 3E5UA 2PN6A 1E2XA 3OV8A 1HXDA 5ILSA 1HKTA 1REPC 2A07F 2W57A 1LEBA 2QYOA 5TJJA 5EEHA 2DI3A 1JXSA 1G6NA 1TNSA 2EK5A 3FM3A 2XROA 2XHKA 5F1RA 4ENKA 3RI4A 1ON2A 3QP5A 4L0YB 3IWFA 4RB2C 2A68F 2W25A 3R6SA 2XAGA 3P9CA 4N9IA 1MJBA 1LDKB 2EV0A 5BOXA 4M9SA 3WTVC 3R0JA 3F8NA 4UVAA 3I0TA 4RS8A 3D0SA 1O3SA 3ULQB 2H27A 5F6FA 4LK1F 3EYYA 3GZ6A 3K1PA 3IL2A 1O57A 2YX4A 1R23A 3KP7A 2E1CA 2CQKA 4I7HA 1XGNA 5D8LB 3H3UA 1RUOA 1J75A 4UHTA 1PP8F 3TO7A 3P9IA 1WSUA 5FD6A 3WGHA 1UHWA 1IN8A 3Q9SA 4FX4A 3DKWA 3GLXA 2JTVA 2BV6A 3F6VA 1KA8A 2NYXA 2EV5A 4DNCA 4CHUA 3V4GA 2EFWA 2IPQX 1T0FA 1D8JA 2IA2A 2ZMEA 1EH6A 2VBYA 3PQKA 1H9TA 1S29A 3ELKA 3ZP5A 3RDIA 4WXHA 1P92A 1SD5A 5LHIA 1TQPA 4I2OA 4G94A 2VE8A 1IXSB 3GUDA 2EFNA 1TBXA 2EFPA 3FXRA 3RJPA 1FC3A 2O6GE 1DUXC 2MLGA 3WE3A 4WWCA 1YTYA 4A12A 3HSRA 2HFHA 3V8KA 1G3WA 1W5TA 3TKYA 2X0LA 3E97A 5E17F 4AIKA 1MD0A 5J6XA 3R60A 1SFEA 2UZKA 2ZNZA 4JQFA 4Q48A 4UUVA 3K9TA 3COAC 1R5HA 3BOQA 5FO5A 1XGMA 4A6EA 4B09A 1R1UA 4BXUA 3KLNA 5L3DA 3LA3A 3GXOA 4HF0A 4ENMA 3V7CA 1CF7A 4ZH4F 1RIOH 3B73A 3RKWA 4HDVA 1FBUA 5K5OA 2ZJ2A 3L7WA 3REOA 3HYIA 3FXUA 4KMFA 1IAWA 1B9MA 2PEXA 2CWEA 2COMA 1O3TA 4LK0F 3HHGA 3I54A 3Q9VA 1SAXA 3WTSC 4KICA 2ZCWA 3R0AA 3KP4A 3FZVA 3LFKA 1KGSA 3F3XA 1PUEE 2NAZA 1B1BA 2G9WA 4I0BA 3U1DA 4O6JA 3MWMA 2Z99A 3PQJA 4BHPA 2OU2A 3VODA 5HLHA 2D2WA 1ZG1A 3F8MA 5J8CA 3CO6C 2XKPA 2M8EA 2P7VB 2YPRA 1IRGA 2O0YA 5FLXK 3J81K 3LQQA 3K1NA 3BPXA 3HUGA 2VC1A 4HF2A 5K5QA 2P6TA 2GIVA 3O6BB 2GXBA 1O7LA 2PMUA 1ZGJA 4LLNA 2H6CA 3I53A 3E5XA 5LBQA 5BS6A 1W4MA 5D5XB 1XSVA 4HX4A 4HW0A 4Y17A 2O3FA 3G73A 2DU9A 5HS7A 1CGPA 1FLIA 2XRNA 4G7ZF 1NHAA 1LJ9A 1XGOA 2QQBA 3BP8A 4LFUA 2PFBA 1S8NA 4MGRA 1YO5C 3SFZA 1LEAA 1SD4A 2NNYA 3HTUA 2W24A 1B9NA 3LA2A 3KP2A 4HF1A 5CVRA 2QBYA 4G7OF 4M9XA 3WGGA 5L3GA 2VOPA 1V3FA 3CO7C 3RPQA 3O3KA 1HSTA 2DO7A 3M7GA 3LSTA 1R58A 3CDHA 5E1XA 5ERIA 1HSJA 4LG0A 4G9YA 4G6QA 5HS9A 4XRFA 4S05A 2CGPA 3E5QA 2IA0A 4IPAA 3IHUA 4L9VA 2HYGD 1KYWA 4GYIA 1OYYA 2A3SA 2PG4A 1T98A 3I64A 3NEUA 4WX9A 1KU9A 4IF4A 5IT3A 1LDJA 2IA1A 1U2WA 3T1BA 2NS0A 1T39A 4HLXA 3ZMVA 5A2QK 3F6OA 2XASA 3WG9A 1UFMA 1UCRA 2JPBA 3I58A 3DP7A 1U3EM 3D5LA 2DK8A 5FLXZ 2VODA 3CJNA 3ECOA 4ZYDA 2L4MA 3WU1B 2QENA 2IVMA 3GFJA 3TO9A 4ENNA 1K78B 4RAZA 4I09A 1I6XA 4CICA 5BPIA 3I59B 3GEZA 1FP2A 2OBPA 1C0WA 4AD9A 2K27A 4OOIA 5HDKA 2L3DA 1XDUA 2BEOA 1YS6A 1FYMA 1LVAA 3WE2A 3H92A 4CO8A 3TOBA 2YR2A 2FE3A 2Q0OA 4HAMA 5DCMB 1KYZA 3L2CA 2YX7A 2L02A 3EQLF 3MFKA 6PAXA 3OOPA 3FX3A 2V79A 1ODDA 1J7KA 2P6SA 1Q1HA 3BJOA 1T38A 2HGCA 2IJLA 1HW5A 2JRTA 2NNNA 3WGIA 2ISZA 1YW7A 2HTSA 4Q47A 1L3LA 3GW2A 4EVIA 4MTDA 3K2ZA 4YIIA 2H6BA 4G7HF 2KIFA 3KZYA 2DQRA 5HLGA 3F72A 5IT9K 2A5YB 3B02A 4EJTA 2PI0A 4L9TA 5F64A 5HLIA 2LDUA 2F5EA 4Y15A 4QLCU 4B8XA 3SZTA 4IHSA 2HQNA 1QNTA 4HLYA 3JTHA 2HKOA 1WWXA 3I4PA 5HOOA 1BOAA 4ZZLA 4WCGA 2VBZA 4OIOF 1QQIA 4L9JA 2STWA 4UVBA 3V7RA 3BJ6A 1HKQA 3I71A 2CO5A 1XSDA 1FBQA 4OMZA 1U5TB 4ASNA 1F1ZA 5DD4A 1SFXA 4BQAA 4L9NA 3JSPA 1IN5A 1OYWA 2V9VA 1IZ1A 5ILVA 2P7CB 1AOYA 2EWNA 3MCZA 2VOOA 2FMYA 2XVCA 3P9KA 2K7LA 5L3FA 5K5RA 4Q4ZF 5FFXA 5DYMA 2K4BA 3G3ZA 3IKVA 3RTRA 5E1ZB 1KU2A 1MJAA 3QPTA 2W84A 1BM9A 5LGNA 5DUKA 3DF8A 1KQ9A 3M8FA 5ICCA 1R1VA 1MGTA 3BY6A 2TDXA 2AS5F 4EGZA 4LGWA 1YW9A 2GA1A 3MZYA 2F5CA 3HSEA 1RNLA 4HDUA 4P9FA 5H6RA 4Z2YA 2FF4A 2FBHA 3ZMUA 1EH8A 1IUYA 2HEOA 2XKOA 1R1TA 4OINF 1IN6A 1IW7F 4IXAA 1I1SA 2Z9OA 2OQRA 3FMRA 1T6SA 3E6CC 2P5KA 1Y0UA 3BDDA 4CYDA 4A5MA 4GO1A 2BBYA 4MQVA 3QAHA 4ENJA 3AAFA 2DK5A 2MA3A 1BI1A 2DPUA 4BYYA 4UVCA 2FMLA 2PMHA 4XLNF 3ROUA 1GXQA 5D5UB 3GFIA 1T2KA 3M8EA 1J9IA 2FBKA 1QBJA 4DQ2A 1TW2A 3EDPA 1QZYA 4CGZA 3BWGA 4BHBA 3DFGA 2Z5UA 2MC3A 1BN5A 3HOTA 1BIAA 1OMIA 4HX7A 1Z6TA 3DV8A 2K4JA 3E6BA 1PP7U 4CZZA 4ZYHA 5D5VB 4NB5A 1ZH5A 1DP7P 2XV4S 5JFRA 2OZ6A 3HRMA 1BI2A 4YFKF 2C6YA 2QQAA 2JZYA 2KKOA 4RAYA 5AIQA 2DBBA 5L3CA 2OD5A 3V8JA 1O7FA 2OZUA 3IC7A 3WTTC 1R00A 4ZYGA 3C18A 4KMUX 5ED4A 4KUMA 4OIRF 1PDNC 1U6GA 2D1VA 4U0VA 4YIFA 1J5YA 4U0YA 4KFCA 2GXGA 2LSOA 1LDDA 1U8RA 1FP1D 1V4RA 1W7PD 3FHZA 1JGSA 2V6CA 2H09A 4L18B 3BPVA 5LGUA 4OMYA 5LHGA 1G3SA 3KEOA 1UB9A 3FF5A 5LRRA 4MHGA 5ICEA 5FGMA 4KDPA 3R4KA 3IKTA 1Z9CA 2WC2A 1YW8A 3V7SA 3DEUA 2Z33A 1R5GA 4ESBA 3JAMK 3DPLC 3HRUA 3C3WA 2V1DA 1R36A 3MAJA 5DD8A 3CUQB 3L00A 2VC0A 1DPRA 1K78A 1FT9A 2RN7A 2ZXJA 4U0WA 1S6LA 3I59A 2BYVE 3GYHX 3KEQA 3HRTA 3GWZA 1IF1A 2O8XA 4LLLA 1K6OA 2OA4A 2FU4A 2LNBA 2XUBA 1FBSA 3U9GA 2KIUA 3GZ5A 1USTA 2QZ8A 2A61A 4KIBA 4LB6B 5DCMA 3ZMDA 2EA2A 4NQWA 3ECHA 2CFXA 3F8CA 4PGGA 1R7JA 3O2PE 3U2RA 2CSOA 5J8FA 4RB1A 2W85A 1VTNC 4KN4X 4YFXF 1ZLKA 1KQ8A 4K2EA 3P7NA 2A6EF 1YG2A 1MKMA 1ZYRF 1FSEA 4PDKA 3WTYC 4EM1A 4HQMA 4WF2A 2ACJA 2VBWA 4L5IA 3TO6A 4MEXF 2CW0F 2HQRA 2DFIA 1J2XA 1FOKA 4UXNA 2VXZA 2V1UA 3H3ZA 4M6YA 1TNTA 3WTUC 2FNPA 2QQ9A 1P2FA 3DXJF 1TLHB 3JSOA 2R7FA 2EFQA 2MBFA 2FXAA 2CG4A 1Z91A 2DPDA 4FX0A 1IRFA 3GFLA 3RYRA 3WTXC 2PJPA 1FY7A 4N0BA 4KIGA 5D4SA 3KLOA 2ZBKA 5D4RA 2DAOA 1YIOA 2FQ3A 1FZPB 3KP6A 4LB5A 3KE2A 3GF2A 4LMYA 4ETSA 5BPDA 3WU0A 2ADUA 5HDGA 5JHUA 4A2UA 4EMSA 1G3TA 2BE5F 4P5OA 3T8RA 5DV5A 3M1EA 2QVOA 1A04A 4BAYA 1HW2A 2RNJA 1J0RA 3J80K 1GHCA 4RGUA 4AWXB 4MEYF 1KU7A 5DCFA 1LNWA 4AIHA 1U5TA 2QWWA 4G6DA 2UXNA 2IW5A 4U7BA 5FD5A 2Y75A 2FRHA 4IHTA 3J81Z 1EH7A 2KJCA 5HVQC 4OIQF 4N9HA 1J59A 2M1BA 1BI3A 4A0ZA 2Y48A 4M74A 4M73A 1YFHA 1AWCA 1ZLJA 3ZPLA 5LGTA 2VONA 4HV5A 3IRRA 3BROA 2XGXA 4EJWA 4HOBA 1UHMA 2PQ8A 4UV9A 2JSCA 1FX7A 3EUHA 4ON0A 1SD6A 1I5ZA 3VB2A 2XAHA 3KFWX 4KNYA 3HTSB 5AONA 1E17A 4XBFA 1BIBA 2O03A 2EFOA 1JE8A 1OPCA 5AIPA 4I02A 2STTA 4S04A 4XLPF 1MJ9A 2FSWA
chains in the Genus database with same CATH superfamily
3U21A 1XGSA 4CDGA 4E7SA 5CKTA 2YSRA 1XD7A 3EPZA 4RBOA 4IOCF 4D0PA 2Y0MA 3GO5A 3S2WA 1Z1DA 2GWRA 3TGNA 5E20A 1TWCJ 1ZRFA 4A0XA 3VEPA 3T5XA 2BOLA 3ZQHA 1ZARA 5HDNA 3MMYB 2LK2A 4ZZDA 3SHFA 3A01B 1JUSA 2DDAA 5K7FA 4PCQA 2A6HF 2GQQA 1JHFA 3FISA 3VOEA 3QU6A 3J7YJ 1FPQA 1D8KA 2M4GA 2B9SA 2XB0X 2P5LC 3I56I 2ZXIA 2PLYA 2IT0A 2UWMA 3ABUA 5LLQA 3LQRA 2MLKA 2ECCA 5IOZA 3TQNA 4LG3A 4BJTA 2JMWA 3K4NA 4EGYA 2AO9A 2MH2A 2WB1A 1WJFA 3V42A 3DKXA 2VE9A 5DM6F 1F4KA 3EYIA 1R22A 3J80Z 1G4DA 4FQGA 3RIRA 1BI0A 4U88A 1OJLA 2HZDA 5ICGA 2PX9A 5A2QZ 2GLOA 2CS3A 4PGHA 1F5TA 4BE2A 2HVSA 2F5VA 2RC4A 1BJAA 3HM5A 3VDXA 4PK4A 4UNOA 3HOYJ 1YRNB 3L2WA 1ETYA 2RQQA 4YG2F 1VQ5I 2X48A 4C3HJ 3EUKL 2ZC2A 1AA7A 1X3WB 5LEJA 4LIUA 4BQOA 2KRFA 3GZNB 3W6KB 3QRFF 3E6DA 2JVHA 5M3FJ 3KPHA 4GYGA 3LAPA 1LE8B 4MLOA 2RKHA 2OUMA 5FFZA 1K83J 1FWZA 3OIQA 3K2AA 4U7DA 1I1GA 3PSIA 5E8IA 2EA4A 4XSXF 1OKRA 2GXAA 3ZQQA 3JR9A 1BC7C 2R7ZJ 2GZWA 4F55A 2QLZA 4PJ0C 1W7PB 4IRIA 2ELHA 1TW3A 3FXOA 5DDGA 2RREA 2IS4A 3DQVC 3OS2A 1WH5A 2JA2A 1XCBA 3S1QJ 4BHCA 2LF8A 4TV7A 4IRHA 2P5VA 4ESJA 3CESA 3QOPA 3ISPA 1FMWA 2M45A 2X4HA 3S93A 1BJZA 3CCVI 3CDLA 4RLQA 2Y9YA 2ICWG 3KP3A 4HBLA 4CYCA 4KT5C 1HQCA 3LOCA 1ZAOA 5EEGA 1P4XA 3LWFA 2ME6A 3G4SI 5DEQA 3PUFA 5JR3A 4BBRJ 3PIPF 1X3UA 4D5CA 2JA7J 1RZ4A 5M3MJ 5CVJA 4RM2A 3A1YA 1TWGJ 1ORKA 2B7EA 2VBXA 4NHJA 3M4OJ 1FNNA 4RGXA 3HHHA 4PJLA 1ZGAA 1IC8A 1H9GA 4EJUA 4YFNF 5LHHA 1JJ8C 1FOWA 2DYRH 2F2EA 3CLOA 5HS8A 3TW6A 4IHYA 4KIFA 1VI0A 2R93J 2I8DA 2Y30A 4P96A 4R79A 4O3MA 2L9NA 5E18F 1R6RA 2BW3B 1XDSA 3CUQA 3HKZA 1JUMA 2WBMA 2ZJRF 1B8IA 1XMKA 2HDCA 2K85A 3E3VA 3ZQIA 4ESFA 3DBRB 1VZ0A 3NRVA 2FNAA 3ZQLA 2QSGX 3H3VK 4IL6C 4X1EA 2QQ8A 1DGRM 3QP6A 1UMQA 3LSPA 2ELJA 1G3YA 2JA5J 1TT0A 2R3SA 1WJ5A 1WJEA 1YYVA 2QGUA 2RVCA 4L0ZB 3HEFA 3FHNA 2G7HA 2H94A 1VQOI 2CU7A 2HOEA 1OCZH 4WK8F 3EETA 3IWZA 4GCVA 3I5UA 4MNUA 5TRDA 2OV7A 2CV1A 2HTJA 4IX7A 3K0LA 3ZN1A 4ZYEA 3TDUC 2F4MB 2HKXA 3HPGA 4HYEA 4MTEA 1IGNA 1B6AA 4G8XA 5D6EA 2D45A 2ZJPF 3OMYA 2VKVA 2E35A 5D8KB 2VASA 1F43A 4M6XA 5GAHJ 1W5SA 2L54A 2M87A 1L0OC 2Q2EB 4M6VA 4A3MJ 5TISC 1LPQA 4B1RA 1TTYA 2W4SA 1IN7A 3WTWC 5IT9Z 2ISYA 2AXLA 2XDVA 1MSFC 1I27A 2KISA 1MDMB 2WAEA 1KQ0A 2QUFA 4DZPA 5E3OA 1SFUA 2EJRA 1STZA 2O61A 3OYIA 2DT7B 2HYFA 2JT1A 1WI9A 1H0MA 3RKYA 3FM5A 3MQ0A 5KCMA 2E5ZA 3FXQA 1YLFA 2ZO4A 3OOUA 3FMQA 1Z05A 3DWLE 2R7OA 3QYFA 4PZJA 3RKXA 3N97A 3E0JB 2PJRA 1I6HJ 1UZCA 3CC2I 4UY8I 2IP2A 1NG6A 2XAJA 5FKKA 3ZQ7A 2ZFUA 1VQ9I 2NS8A 5E8GA 2E7WA 5CVIA 2CQNA 2HVQA 2F5DA 3CTAA 3QPHA 1RPWA 4R1HA 5CJ9A 4AIJA 1GVJA 3AG3H 2R4GA 3GFMA 5BQTA 1VFCA 2LMDA 1JI8A 5FB2A 4KN7X 3WODF 1S3JA 1OISA 1O3RA 2XAUA 3ZMZA 2HWVA 3LNQA 2LKPA 5L3BA 1YIJI 2J5OA 3KETA 4P9UA 1SMTA 3SZPA 2L01A 2RDPA 3F22A 2DLLA 2NVXJ 1W0TA 4BBSJ 1JJ6C 4A93J 3QYEA 3HL2A 2E34A 1D1CA 5IYBJ 2X6OA 3OYNA 3CUOA 4HQEA 4II2A 2FOKA 1QPMA 2GA2A 4HA8A 1LB2A 3LSIA 4EATA 1B4AA 2JSPA 4ZTFA 1ZRDA 4RMNA 4BEHB 2MABA 1N25A 2WAFA 3MEXA 3W6JB 3LSJA 4JK1X 2DW4A 2VQLA 4HX8A 4IVNA 5B1AH 3ZXSA 1FTZA 3F8BA 4KA4A 1N78A 2M30A 4FE4A 4XN3A 4CA0A 1SAUA 3N4MA 4E7IA 2Z16A 3DKYA 3OYDA 1X3ZB 1GV2A 2VT2A 2X6YA 4QPQA 1OR7A 1YX3A 4XRSA 4LIVA 1D5VA 2R7UA 2K02A 4I01A 4JBAA 3V8LA 3GX4X 3WG7H 1XMXA 3BCBA 1Z21A 3K4LA 2P81A 4P55A 5JI6A 4FETA 2FEZA 1B59A 1JT6A 2MD5A 3HOSA 3LA7A 3F23A 4XKBA 4A6DA 1VNDA 3OSFA 4XK4A 3CCLI 1ULYA 3ASOH 4LD5A 1WVRA 1X58A 1PUFA 3S15J 2G7UA 3K1MA 4E70A 3CP2A 2DCEA 4XL9A 3T0YA 3ZQFA 4FT8A 3F21A 1VQ4I 1XSXA 1SD7A 4KYWA 2A69F 1WKMA 3H35A 3L09A 4MO7A 4NC6A 3SEZA 1MBGA 5EGOA 1O4XA 2VKHA 3I55I 1WJCA 4BACA 4F93B 1BA5A 3KZZA 3M9AA 5M5XJ 3RZDJ 5CVVA 2O9LA 3BJAA 4Y52J 3CCYA 5E1WA 4HZFA 1YS7A 2CQ7A 3ABLH 4GGGA 4ZDOA 2VN2A 3O8GA 5ICFA 4RB0A 3EUAA 4H0EA 3IRQA 4XLEA 4ZYAA 1QVUA 1USSA 4M9ZA 1EF4A 3CF2A 2XAQA 3KP5A 2IXSA 4OIPF 1FMVA 1ZTRA 2KFDA 4XLFA 1ZREA 1W0UA 1JUPA 2Q8KA 1P4WA 4GRIA 3E6MA 2OQGA 2WA0A 4ITVA 2BVMA 2V1XA 2BY0A 1Z7UA 2EBIA 1BL0A 2BHYA 2HS5A 3HPHA 2NVUB 2OPTA 1U78A 1YJNI 2ZKZA 1TQIA 3ZN0A 2KZGA 1IRZA 4LJZF 4XMYA 2DOFA 3MKLA 3J7AO 3OYEA 3HRSA 1IV8A 4AVPA 1DDNA 3Q5FA 3HSFA 4RB3C 2X85A 1U5TC 2ZMEB 2L7MP 2EQRA 1A35A 4M72A 2KRHA 1WH7A 2WTEA 5GAEJ 3AL0C 1Y8RB 4IJAA 3ABTA 1Y39A 1S7EA 4O5VA 3BG9A 3QQAA 1H88C 2VLAA 2RNGA 2DA1A 5CLSA 3RYPA 2X51A 4IHVA 1ETWA 2W48A 2IGMA 1K7AA 2M2EA 1IXRC 1ZRCA 3GVAA 3HB9A 1P6RA 3ONQA 4BQQA 3MKWB 1LQ1A 2M3AA 2M5WA 4MIMA 2NRAC 2HZTA 1HA8A 2W00A 4HV6A 3HOUJ 1K4SA 3PUBA 2X1CA 4I0AA 4A3LJ 4A3JJ 3LAJA 4EJVA 3A01A 3KIOA 3CCUI 5HNHA 2IS1A 2KIMA 3T8TA 5K1YA 2B0LA 2L0KA 5D6FA 1KU3A 4F7ZA 3KCCA 5D5WB 1V54H 4ABZA 3C7JA 4GXOA 2EV6A 3GBGA 1IJWC 5H6QA 4A3IJ 2EPFA 3FK6A 3EUHC 2JA6J 4A0YA 4ZJZA 2X9DA 2QSFX 4A3GJ 1U0JA 2XSJC 4RGRA 4XN0A 3VYTB 1HW1A 5JVGF 1MNMC 2PMZN 2Z1DA 3DEEA 5L3EA 1VQMI 1X4OA 4J00A 2YS9A 3RZOJ 2JUCA 4UB6C 1BC8C 1IXCA 1RI7A 1XMAA 3BG6A 2KJBA 2E1NA 4EM2A 3K70D 2XAFA 2Y0SA 2ZFWA 1YRNA 1MBHA 3B6AA 1YJ9I 1YQAA 2ESHA 1SFOJ 2XPWA 3ERMA 1D0ZA 3DEWA 4XSZF 2XIGA 2M9HA 5H20A 1LE8A 2P4WA 3DPTA 5IOYA 2DTRA 3IUOA 1CF7B 3TOAA 3NQOA 1GXPA 3C1DA 1IN4A 3KYCB 4R8HA 2AHQA 3JAMZ 3ZMSA 1LUJB 2ZJQF 3K69A 2R7SA 1WQ2A 1TQMA 1S7OA 3JRBA 1W7PA 3BZKA 1SMYF 2WWYA 5HNFA 2VT3A 3M07A 1MBJA 4CXFA 1RR8C 1ONVA 2UXXA 5IYCJ 4F91B 4Q5SF 1UG2A 4E6KG 1F36A 2Z3YA 2V1NA 3OR2C 4BH9A 5BMZA 3K4CA 2IBDA 2YU9J 1XB4A 1K79A 4J01A 2DT5A 2F5FA 2LF7A 1DPUA 1ZG3A 4IKFA 2XC7A 2RQPA 4MQ9F 2ESNA 2W82A 2P8TA 3QU3A 3S16J 3E7LA 1GDTA 4D9JA 2ETHA 1CQTA 2MH9A 2EILH 2PBIA 2OC6A 4KJZA 4KITB 4Y13A 1X1AA 3JW4A 4F52A 4E7LA 1S7AA 1HBXG 4L5JA 1D3YA 3GTJJ 2LH9A 3RPUA 4EV0A 4RM3A 1HKSA 2BW3A 2M0MA 4IEJA 2GAUA 1NH3A 1ZK8A 2D5VA 1R5ID 2R7DA 1R4MB 3SJMA 5ILUA 2CUZA 3SQNA 1ON1A 3NWSA 3JRIA 5KK1A 1OYIA 1RRJA 4DYRA 2YUSA 3SXYA 5C44J 1O3QA 4H4KC 1YI2I 2HOAA 2LP0A 1Y6IA 4WXDA 1F9NA 4I98B 2KLOA 5GPCA 1QGPA 3HUGB 3VFZA 1FYKA 1FYLA 1UG0A 1W1WE 2WV1A 1QZZA 4PFPA 5J3LA 4GFBA 2OTJI 1FSHA 4ZTJA 4HNUA 1MBKA 2VQGA 2RGVA 1H89C 2HQAA 1W36C 4DIQA 1XN7A 1MZBA 5CVUA 3CMMA 2BZTA 2Q2EA 2JPCA 2J5PA 3AG2H 4RA2A 3TDZC 2K86A 2VJ5A 2HXOA 2OAZA 3CCJI 1MMDA 5C4JJ 4IRGA 2K9NA 2EB7A 3BCAA 1X4PA 3HOZJ 1A31A 2FBIA 2FA5A 1MDMA 5LRSA 4IOAF 2BGCA 3RKQA 4LLGF 1V55H 2CYYA 5EF6A 3L9FA 4F92B 1TT5B 2YU3A 1QO0D 1VQKI 1Z6RA 3F8FA 3SDBA 3PFIA 4MFDA 4NNJA 5JVTA 3I4MJ 1H8AC 2E60A 1WJBA 1JHHA 2JUGA 1Z3XA 2ZNYA 3E1SA 4P1WA 2E1MC 3SEQA 3FMSA 3DLAA 3JTGA 2VPLA 2LOOA 2HR3A 1XCVA 1GVDA 2RV8A 4QWQA 3JRCA 3A0BC 3ERED 1P4AA 1ZR4A 2KP6A 3BZ6A 2WV0A 4UV8A 1BW5A 3ZMTA 2V26A 2IRFG 1ZN2A 4IQ4A 5LEKA 3K4JA 3CUQC 1I3AA 2W1OA 3DCFA 4RGSA 1BR2A 4EJOA 1ZGWA 2GBYA 4FHTA 5CQGA 4EM0B 3ML6A 2LBFB 4OWRB 4HSTA 3ABKH 1U8BA 1EV7A 1HF0A 1WHUA 4B43A 4CZCA 2R5ZB 4EQQA 2DA3A 2QBYB 2L4AA 2EZLA 2E7XA 1VQ6I 1T08B 3HIFA 4A5NA 4WXCA 5IP7J 4BNCA 2V9KA 3IH2A 5CYVA 1ZG5A 2QM3A 4OU0A 1TP4A 1BBYA 2D1HA 2ID6A 1WRJA 3CZ6A 2OF7A 1IDYA 1MBFA 3FWEA 1RUNA 1ZHFA 2DQLA 3R61A 3MZHA 5DUIA 5KVRA 4M71A 5F0CA 4NC7A 4BEHA 4LG0B 3K7AJ 3E5UA 3WTZA 2DJNA 2PN6A 2Y69H 5FKNA 4MFEA 4KT6A 4B4CA 4A3EJ 2KIQA 1E2XA 1POGA 4V2FA 3OV8A 2H8WA 1HXDA 2BVLA 3OYKA 3A4CA 3K4MA 1D1AA 1TWHJ 5ILSA 1HKTA 1HDPA 1REPC 2A07F 2W57A 1LEBA 2QYOA 2MYSA 5TJJA 2CMPA 1UJ8A 3LSMA 2K3PA 5EEHA 3BR6A 3BG5A 3OYLA 4BY1J 2DI3A 1JXSA 1G6NA 1TNSA 2EK5A 3FM3A 5JHFA 2XROA 2XHKA 5F1RA 4ZDPA 1SANA 2A6TA 4ENKA 2MC4A 3RI4A 1ON2A 2LY1A 2Y0SN 2ELKA 3QP5A 1M1EB 4CUGA 1EA3A 3DPUA 3HOXJ 1JKRC 3O8HA 4L0YB 2F48A 3M8JA 5EZHA 3G2BA 1DU0A 5KHDA 3IWFA 2DA7A 5FKLA 4RB2C 2A68F 2W25A 3R6SA 2XAGA 3P9CA 1MIJA 4N9IA 1MJBA 1LDKB 2EV0A 5BOXA 3PNVA 1TZLA 4M9SA 3WTVC 4DGWB 1QHGA 4XLAA 1E0EA 4OAZA 3R0JA 3F8NA 5F0HA 2L7ZA 4UVAA 3DTKA 3I0TA 4RS8A 3H0DA 3D0SA 1O3SA 3ULQB 2H27A 3JRFA 1VQNI 5F6FA 4LK1F 3EYYA 3OR1C 4OAYA 5J4VA 1TL8A 2GM4A 2HNHA 3GZ6A 2XRLA 2L7FP 3K1PA 3IL2A 1O57A 1GLNA 2CV0A 2YX4A 1R23A 5HLTA 3KP7A 2E1CA 2CQKA 4I7HA 1XGNA 4Y33A 4LITA 5D8LB 3H3UA 3CMAI 1J75A 1RUOA 4UHTA 1ZQ3P 4D1QA 1S5LC 1ENHA 1N75A 1X1DA 1PP8F 3WHCA 3PJRA 3TO7A 4BUPA 3P9IA 2F6CA 1WSUA 1BOBA 5FD6A 3WGHA 1UHWA 4JP0A 1IN8A 3Q9SA 4FX4A 3DKWA 2X1EA 3GLXA 2JTVA 2BV6A 3W2WA 3F6VA 3I3LA 1GT0C 2KZVA 1OR7C 1KA8A 2NYXA 3GCMA 3D1NI 2QCOA 4DW6A 1JKPC 2EV5A 4DNCA 4CHUA 4DBRA 3CC4I 3V4GA 4E7JA 1YITI 1MNDA 2EFWA 2IPQX 2DYSH 5E3LA 1T0FA 1MMNA 5GAGJ 3CJRB 3A0HC 2IA2A 2VJIA 4C9YA 1D8JA 2ZB9A 2ZMEA 1DQUA 1RC9A 1EH6A 2VBYA 3PQKA 1H9TA 2I5UA 1S29A 4NDLA 3ELKA 3AKZA 2R7VA 3ZP5A 3RDIA 4WXHA 1OLTA 2HPIA 1BW6A 3BR2A 1P92A 2H1LA 2OCEA 2QSHX 1SD5A 5LHIA 1TQPA 3RQIA 4I2OA 2PMZA 4G94A 2GIZA 2LKXA 3DBLB 2K9LA 3JRAA 2VE8A 1IXSB 3GUDA 2EFNA 1TBXA 2NVQJ 2EFPA 3FXRA 3RQ4A 3W2AA 3RJPA 5E79C 1FC3A 3FBNB 2O6GE 1DUXC 2HQ5A 2MLGA 1E3HA 4DZJA 1WGXA 2LTPA 3WE3A 3Q0WA 4WWCA 1YTYA 4A12A 3HSRA 1SEUA 2HFHA 3V8KA 5K7HA 1G3WA 1W5TA 3TKYA 3KZIC 2X0LA 3E97A 3HZJA 3GLLA 1B72B 5E17F 3BLYA 1N77A 4AIKA 1MD0A 5J6XA 3ZCOA 3R60A 1SFEA 3VYUB 2LYCA 2UZKA 3CQZJ 4B48A 3ZRGA 2ZNZA 4JQFA 2Y31A 4Q48A 4UUVA 3LMMA 3K9TA 3COAC 2EZKA 1R5HA 3BOQA 3IH4A 5BNGA 5FO5A 3A2KA 1XGMA 3OYFA 3DU5A 4A6EA 3VSKA 4B09A 3U1KA 1R1UA 2NOJB 2TCTA 4BXUA 4BE0A 1BR1A 3CP8A 3KLNA 3PFYA 5L3DA 3LA3A 3GXOA 3LL7A 2DA6A 4HF0A 2FX0A 4BDYA 4XKVA 4ENMA 3V7CA 1CF7A 1JTXA 5IY5H 3G1MA 2OTLI 4ZH4F 1RIOH 4RAGA 1UELB 1RETA 3B73A 3RKWA 1UAAA 4HDVA 1RKTA 4U87A 1FBUA 3JRGA 1LFBA 2JVGA 5K5OA 2CUEA 2ZJ2A 2LC2A 3FKIJ 2E2IJ 4BS9A 2COBA 3L7WA 4DBQA 3REOA 3HYIA 1AKHB 3FXUA 3D5RC 1IAWA 1B9MA 4KMFA 2PEXA 5DTDA 3BG3A 2CWEA 2BY2A 2COMA 3W2VA 4LK0F 1O3TA 1LKXA 2NOGA 3MKYB 3HHGA 3QPLA 3I54A 3Q9VA 1SAXA 1HDDC 1Z7LA 1MH3A 3WTSC 1VQPI 4KICA 3TP0A 2ZCWA 2IAIA 3CMYA 3DTIA 3R0AA 2K3FA 2M7BA 3KP4A 4W97A 3FZVA 3H9QA 3LFKA 5IPAA 4Y4RA 1KGSA 3F3XA 1AHDP 3OS0A 3GTLJ 5CPRB 4BKXA 1PVEA 1WCMJ 1PUEE 2NAZA 1Y1WJ 1B1BA 2CW7A 4C3IJ 2G9WA 4I0BA 3U1DA 4O6JA 3MWMA 5J47A 4IO9F 2Z99A 3PQJA 1Z67A 5GPAA 3FKJA 4QIWN 4BHPA 2OU2A 3VODA 2EZIA 3BR0A 2DMPA 3LSGA 3PNYA 3JREA 4BXXJ 3ESWB 5HLHA 2D2WA 1ZG1A 3F8MA 1ACIA 3S1RJ 3C2HA 2E2HJ 5J8CA 3CO6C 2XKPA 2M8EA 3BG7A 2P7VB 1MNEA 3UNGC 3VYRB 2YPRA 1IRGA 2O0YA 1AU7A 5FLXK 3X2QH 3J81K 3LQQA 4IHWA 4YEJA 3K1NA 2JRMA 1T8IA 1RESA 2M0CA 3BPXA 2KMUA 3HUGA 3KEYA 4M3DA 3H9JA 2VC1A 4HF2A 5K5QA 2P6TA 2GIVA 5C4XJ 5F1JA 1T95A 5FLVA 3O6BB 5M5YJ 2GXBA 3GTPJ 4A3BJ 1O7LA 2PMUA 5GADJ 2XF7A 5J4YA 4DYCA 2V6EA 1ZGJA 4LLNA 2H6CA 4EEFG 2XF5A 1Y56A 2LKSA 3M3YJ 3I53A 4M3FA 3FK7A 2XPVA 1KONA 4Z6YA 3E5XA 5LBQA 5BS6A 1W4MA 5D5XB 1XSVA 4NC8A 4FTHA 5H2FC 3OYAA 4HX4A 4HW0A 4M3EA 2O3FA 4Y17A 2DU9A 3G73A 2NVTJ 5HS7A 1I50J 1CGPA 1FLIA 2DMUA 2XRNA 2VUMJ 2DOAA 4G7ZF 5K7ZA 1NHAA 1LJ9A 2X6XA 1QU3A 3OL3A 1XGOA 2QQBA 1HCRA 3BP8A 3VSLA 4LFUA 1ETQA 2DT6A 1OCCH 3OIOA 2MGQA 1S8NA 2PFBA 5TGTA 3NAUA 4MGRA 1YO5C 2OJED 3SFZA 1QVTA 1LEAA 2CUFA 2HPMA 1VF9A 4IHXA 2M8GX 1SD4A 2NNYA 1MBEA 3HTUA 3PSFA 2W24A 2EZHA 1B9NA 2LBFA 4QSHA 3LA2A 2VJ4A 2VKEA 3KP2A 5EJCA 4CSWA 1V5EA 4DOZA 4HF1A 5CVRA 2R5ZA 2F4IA 2QBYA 4G7OF 3LSHA 4M9XA 1IRXA 4C2TA 3C2BA 3WGGA 1ETOA 4XKWA 3GTKJ 5L3GA 1OCTC 1XC5A 2VOPA 1V3FA 2AQEA 3CO7C 3RPQA 3HGGA 1A6QA 5HODA 3O3KA 1HSTA 4HNVA 3HOVJ 2DO7A 3BT9A 3M7GA 4A69C 3LSTA 1R58A 2KT0A 1G8XA 1LFPA 3CDHA 2JN6A 4I6ZA 4PFOA 4CCMA 5E1XA 3VPRA 1GUUA 5ERIA 4CCJA 5E3NA 3G6EI 4N4OB 1ZKGA 2M4KA 3GMEA 3CCSI 1HSJA 1MW7A 5F04A 4LG0A 4V2GA 2JA8J 4G9YA 4XOPA 4G6QA 5HS9A 4XRFA 4S05A 2CGPA 3E5QA 5LFAA 2IA0A 4IPAA 3IHUA 2Y9ZA 1U9NA 4L9VA 3S2HJ 2HYGD 1IUFA 3BQYA 1KYWA 3PO3J 1MMAA 1YX5A 2KDOA 4BY7J 4GYIA 1OYYA 1PYVA 1TWFJ 2A3SA 2PG4A 3Q3SA 1T98A 3I64A 3NEUA 4WX9A 3OYJA 1KU9A 1KZHA 4HSRA 3K4BA 4IF4A 5IT3A 1LDJA 2IA1A 1U2WA 5FKOA 3T1BA 2NS0A 2KHMA 1UHSA 1T39A 4HLXA 4XR6A 3ZMVA 1W36D 5A2QK 3OS1A 5J1YA 3SDGA 1YOVB 3RCOA 1WI3A 3OWTA 4LOCA 3F6OA 5J1RA 2XASA 3WG9A 2IGKA 2FQ4A 1D5YA 1UFMA 1UCRA 2JPBA 1JKQC 2LREA 3I58A 1JT0A 2BXYA 3DP7A 1D0YA 1U3EM 3D5LA 2DK8A 5FLXZ 2HOSA 2VODA 3CJNA 3ECOA 4ZYDA 2L4MA 2KDZA 2CQQA 3H5AA 2IGNA 3WU1B 2QENA 3S17J 3N05A 3J7ZI 2IVMA 3GTOJ 2CW8A 3AFHA 3GFJA 3SFIA 2ZSHB 3TO9A 5GTHC 2DTZA 3VWBA 1X2MA 4B47A 1R49A 5KNLA 5IYDJ 2QKLB 2E71A 4II3A 2XB5A 4UUSB 4ENNA 4RAZA 4I09A 1I6XA 1K78B 4CICA 2R0QC 2M7AA 5BPIA 1EKEA 2QA4I 3I59B 3GEZA 1FP2A 2OBPA 4AC0A 1C0WA 4AD9A 2K27A 3VYSB 1V5FA 4OOIA 4XLCA 2MW8A 3CC7I 5HDKA 2L3DA 2L5QA 1XDUA 2BEOA 4AM3A 1YS6A 1MH4A 9ANTA 5IP9J 1FOXA 1FYMA 1LVAA 3WE2A 2JJ7A 1DGWY 3H92A 1NK2P 4CO8A 3QYBA 3TOBA 3UKGA 2DJIA 4UUTA 1QRYA 1X1BA 3M1CA 2YR2A 3OY9A 5FRMA 2FE3A 2Q0OA 4HAMA 4JX5A 5DCMB 1KYZA 3L2CA 2YX7A 2HVRA 2L02A 4NQWB 3IAS2 3EQLF 1JTYA 3MFKA 6PAXA 4E7HA 4XRMA 3OOPA 2EIMH 2OCCH 3FX3A 2V79A 1ODDA 3SYTA 1J7KA 2P6SA 1Q1HA 3BJOA 2KL4A 1T38A 2HGCA 5IP6A 3OSGA 1BR4A 1Y0NA 2IJLA 1HW5A 2JRTA 5F08A 2NNNA 3WGIA 2ISZA 2UUZA 2NS7A 1YW7A 3NWTA 2IS2A 1ZELA 2HTSA 4Q47A 3MVPA 3OYCA 1L3LA 3HXLA 3GW2A 2VQHA 1K4TA 4EVIA 3H1CA 4MTDA 5LD2C 5EDNA 4BDZA 3K2ZA 4RLFA 1V5GA 3FXJA 4YIIA 2H6BA 3OYMA 2E19A 2KIFA 4G7HF 5GTIC 5E3MA 5EG0B 4PJJA 3KZYA 1JKOC 2DQRA 2TRTA 4PUSA 1S72I 5HLGA 1WJDA 4PJMA 3F72A 4BL0B 3OYGA 4AIDA 3TW7A 4ANJA 5IT9K 2A5YB 3B02A 2E5NA 3KYDB 4EJTA 1LVKA 3BTLA 3JRDA 2PI0A 2E2JJ 4PSXA 3L2QA 1B72A 4L9TA 2F4OB 3B6CA 5F64A 5HLIA 2LDUA 4CCLA 2Z2SB 2F5EA 4Y15A 4QLCU 4XLHA 4B8XA 1OFCX 3CCRI 3SZTA 4IHSA 4A3CJ 2HQNA 1DP3A 4XOTA 1QNTA 4HLYA 3JTHA 5FJ8J 1R9TJ 2HKOA 1WWXA 1OCPA 3I4PA 1ETKA 5HOOA 1IV6A 3SZGA 1K61A 3BTIA 2E1OA 1BOAA 2CFOA 4ZZLA 4WCGA 4BE1A 4W1UA 1T0FC 5J1UA 4C30A 2X6WA 2VBZA 4D7NA 4V19K 2ZMEC 2ME0A 2BY1A 1Z3YA 2VJJA 4OIOF 2CV2A 1QQIA 4L9JA 1D0XA 2STWA 4UVBA 3V7RA 2V7FA 3BJ6A 1XTAA 2EIJH 1FIAA 2XF6A 2WY7Q 1HKQA 3I71A 2CO5A 1XSDA 1ERDA 1DU6A 5FKMA 3H5NA 1FBQA 4OMZA 1U5TB 1AKHA 1SC7A 1T33A 1RR7A 4ASNA 2K9SA 5F0FA 1F1ZA 5DD4A 1SFXA 3AL0B 2V4JC 4BQAA 4L9NA 4N4NB 4JX4A 3DLLF 3JSPA 1IN5A 3BZCA 4QTRA 1OYWA 2V9VA 1IZ1A 2WY8Q 3G71I 5ILVA 2P7CB 1AOYA 1OCRH 2EWNA 2VQCA 3MCZA 5KAIC 3RSNA 2VOOA 2FMYA 2XVCA 3P9KA 2DFHA 2K7LA 2LVSA 2AXTC 5L3FA 5K5RA 1NG7A 3L2UA 4Q4ZF 5FFXA 5DYMA 1TC3C 3CD6I 2HU9A 2K4BA 3G3ZA 3IKVA 3RTRA 2CUJA 5E1ZB 3HJEA 5FROA 1KU2A 1E3PA 1MJAA 3QPTA 4C2UA 3GTQJ 2W84A 1BM9A 4UB8C 3FBIB 5LGNA 5DUKA 4Y3OA 4CH7A 3DF8A 1KQ9A 3M8FA 5ICCA 3IV5A 1R1VA 1MGTA 1RKWA 3BY6A 3ZQGA 2DFEA 2IS6A 3CDIA 2TDXA 4AYBA 2AS5F 4EGZA 4LGWA 3ZGKA 1YW9A 2GA1A 2DMNA 2IGOA 3FIWA 3HBLA 2VB6A 3ZQCA 3C2GA 4HG2A 4RAFA 3MZYA 3CCMI 2F5CA 3HSEA 1RNLA 4BXFA 4FASD 1QPIA 1EJ9A 4HDUA 4P9FA 3LSRA 5H6RA 4Z2YA 2FF4A 2HOTA 2FBHA 3ZMUA 1EH8A 1IUYA 2HEOA 2XKOA 4XKCA 3F0CA 1R1TA 4OINF 1IN6A 2VI6A 2HXIA 1IW7F 4IXAA 1I1SA 4E4HA 2Z9OA 2OQRA 3FMRA 3QPSA 3H9GA 2XGDA 1T6SA 3E6CC 1MMSA 4J19A 2P5KA 1Y0UA 3QOEA 3BDDA 4CYDA 4A5MA 2L2OA 4GO1A 2V9PA 3ZOBA 2BBYA 4MQVA 2ZXWH 2Q1ZB 3QAHA 4RDUA 2CJJA 4ENJA 1G59A 3AAFA 2R5YB 2DK5A 2MA3A 2NXNB 3FXKA 1BI1A 2DPUA 4BYYA 4DYQA 1W5CC 3UR3C 4UVCA 2FMLA 1G2HA 1SVMA 4BJ5C 3DBHB 2WAQN 1ZR2A 2PMHA 4XLNF 3ROUA 2I10A 2MFZA 1GXQA 5D5UB 3GFIA 1T2KA 2NVYJ 2G0EA 3M8EA 1J9IA 2FBKA 1QBJA 5GP9A 4FE7A 4BU2A 4DQ2A 1TW2A 4YELA 3EDPA 1QZYA 2JK3A 3CJQB 3MD2A 4D7MA 4CGZA 3BWGA 2KPMA 2MG4A 4BHBA 3IP4B 3NARA 2QF7A 3DFGA 2Z5UA 2MC3A 1TWAJ 2MD0A 2B63J 1WPKA 4AVZA 3S32A 2LFBA 2ID3A 2HDWA 3BTJA 1BN5A 1X19A 3CLQA 3HOTA 2E36A 4E7KA 3S3MA 2JQ7A 1VQ8I 1BIAA 1OMIA 4HX7A 1Z6TA 4ZC3A 1P7JA 1SVOA 3DV8A 5EZGA 2K4JA 3I9V2 4S0HB 3E6BA 1PP7U 4CZZA 4XQFA 2DXIA 4ZYHA 1OQYA 1FJLA 5D5VB 4NB5A 1ZH5A 1DP7P 2XV4S 2BXZA 5JFRA 4YIRX 3KX2A 4XIDA 2OZ6A 3HRMA 1BI2A 4YFKF 3S3OA 2H8RA 4CCOA 1X1CA 2C6YA 2QQAA 2JZYA 2KKOA 4CCNA 3BTCA 4RAYA 5AIQA 2DBBA 5L3CA 2OD5A 3L2RA 1XPXA 3V8JA 1LFUP 1O7FA 5DM7F 2OZUA 3IC7A 1HC8A 1YJWI 2VIXA 3TL4X 1E3OC 3WTTC 4BGDA 1R00A 1FEXA 3CCEI 3A03A 3TMOA 4ZYGA 4B3AA 3C18A 4L5EA 4KMUX 1FIPA 2K9MA 1QA6A 5ED4A 2O8KA 1ITYA 4A3DJ 3D5SC 4KUMA 3GTMJ 3PO2J 4OIRF 3PNTA 1PDNC 3OIPA 3QODA 4Y7NJ 1U6GA 1NTCA 2D1VA 3IH3A 3CCQI 4U0VA 4YIFA 1J5YA 2WB1N 2L7KA 4U0YA 3HG9A 2IEKA 2ZSIB 4KFCA 2GXGA 2Y2ZA 3KYLA 2LSOA 1LDDA 1WFXA 1U8RA 1FP1D 1V4RA 1W7PD 3FHZA 4A3FJ 1JGSA 2V6CA 2R7QA 2H09A 4CYCB 4PSWA 3BPVA 5LGUA 4L18B 3P5JA 4ZDLA 2K40A 4OMYA 5LHGA 4C2MJ 2EIKH 1G3SA 2QKMB 3KEOA 1UB9A 3FF5A 5LRRA 2LG4A 4MHGA 5ICEA 4M3GA 5FGMA 4KDPA 4JX6A 3R4KA 3IKTA 1Z9CA 3BC8A 2WC2A 4AUXA 2LR8A 1YW8A 2L9VA 3V7SA 2DODA 5B1BH 2E1MB 2DN0A 3DEUA 5CQEA 2BY3A 2Z33A 1R5GA 4ESBA 3HC7A 3JAMK 3CJTB 3DPLC 1A6IA 3HRUA 3C3WA 2V1DA 1R36A 3MAJA 4C3JJ 2DDBA 5DD8A 3CUQB 3G1OA 3L00A 3LFUA 4XM3A 3ZR8X 1B8IB 2R92J 3TEDA 3JCUC 2VC0A 1DPRA 3RPUD 2DMQA 4NBQA 2JWTA 2L9SA 1FT9A 4UUSA 1K78A 2RN7A 2ZXJA 1IG7A 4U0WA 2LY9A 1S6LA 3I59A 2BYVE 4XNFA 4HNTA 3GYHX 3F9KA 4QPOA 3KEQA 3K4KA 2VPRA 3HRTA 2XPUA 3GWZA 1IF1A 2FUG2 2O8XA 4LLLA 1K6OA 2OA4A 2H1KA 3G1LA 2FU4A 2LNBA 2XGCA 1Y8QB 2XUBA 4X0GA 1FBSA 3U9GA 4FISA 2K9QA 2KIUA 5KAFC 2N8GA 1SFKA 1USTA 3GZ5A 2QZ8A 3TBIA 3BQZA 2A61A 1VQ7I 3LSKA 4KIBA 4GDFA 1YHQI 3BR3A 1XS9A 4LB6B 5DCMA 4YRVA 4F3QA 1P7IA 3H36A 3ZMDA 3FDYA 2EA2A 4NQWA 3ECHA 1OCOH 2CFXA 3F8CA 3HKZN 4PGGA 4BJ6C 1R7JA 3O2PE 4AYBN 3U2RA 4IQJA 2CSOA 2LLKA 5J8FA 4RB1A 2W85A 1VTNC 4KN4X 4CCKA 4YFXF 1ZLKA 1KQ8A 4K2EA 3P7NA 5EEAA 5C3EJ 2A6EF 1YG2A 1MKMA 1ZYRF 1WJAA 1FSEA 1FTTA 3I4NJ 4PDKA 3WTYC 4EM1A 2LD5A 2FD5A 2VKDA 3H0GJ 2WADA 4HQMA 4WF2A 1HOMA 5J40A 2VBWA 4L5IA 3TO6A 2ACJA 2CW0F 1MMGA 2HQRA 4MEXF 2DFIA 5DS9A 2HYJA 3GTGJ 3J7AY 1J2XA 3H5RA 2P0WA 4BQNA 1FOKA 4UXNA 2VXZA 1P9QC 2LY2A 2V1UA 2EINH 3BR1A 1VQLI 2PJRB 3H3ZA 4M6YA 3ABMH 3S1MJ 1TNTA 1NK3P 3WTUC 4A3KJ 2FNPA 2QQ9A 1P2FA 4I76A 5EG0A 3DXJF 1TLHB 1SVLA 5B66C 1S9HA 3JSOA 2R7FA 2EFQA 2MBFA 5B5EC 4XICA 3W6VA 1GV5A 3AG1H 1K6YA 4XRSG 2FXAA 5M5WJ 2CG4A 3JRHA 2R7RA 1Z91A 2DPDA 4FX0A 2DFFA 4JOMA 1IRFA 3PL8A 3GFLA 3RYRA 3WTXC 2PJPA 1FY7A 4N0BA 3MZ8A 4NUBA 3S14J 4KIGA 3QWLA 5D4SA 3KLOA 2UV1A 1Z0XA 4HEA2 5EYRA 2DA2A 1YE9A 2ZBKA 3K6GA 5D4RA 2X1DA 2DAOA 4JYKA 3S8PA 1YIOA 3HOWJ 2FQ3A 1FZPB 3KP6A 4LB5A 3KE2A 4M3BA 3GF2A 3CF5F 4LMYA 4ETSA 5BPDA 2O5RA 3WHBA 3MN2A 2GOMA 3HGYA 1HLVA 3WU0A 2ADUA 5HDGA 5JHUA 1XG1A 1R71A 3IAM2 2DA4A 2KRCA 1A36A 4A2UA 5B3SH 4EMSA 1G3TA 2BE5F 2FJ1A 4P5OA 3T8RA 5DV5A 3M1EA 2QVOA 4PJNA 5JLWA 1A04A 4E7ZA 4BAYA 3L2VA 3PM1A 2CH0A 3W3CA 1HW2A 2CRGA 2RNJA 3HDDA 3S3NA 2R7WA 1J0RA 3J80K 3FXLA 3Q0VA 3CMEI 3S1NJ 2ZXHA 4RGUA 1GHCA 4AWXB 1APLC 4MEYF 5FRNA 2MSYA 1KU7A 5DCFA 1LNWA 1PJRA 1IO2A 2HI3A 4FCYA 4AIHA 3K10A 1U5TA 2QWWA 4G6DA 3TP3A 2UXNA 5FLMJ 2L9RA 2IW5A 4U7BA 5FD5A 2Y75A 2FRHA 4XONA 4IHTA 3BR5A 2VL8A 2FOWA 3WU2C 2R7TA 3J81Z 1EH7A 2KJCA 4DJAA 5HVQC 4OIQF 4G6TB 2LRDA 4N9HA 2XSDC 1PUFB 1J59A 2M1BA 1BI3A 4G12A 4A0ZA 2Y48A 2A5WA 2O7OA 2VXDA 4M74A 4M73A 1YFHA 1AWCA 3ASNH 1I39A 1ZLJA 3ZPLA 2ECBA 3OL4A 5EGOB 3PIOF 1WZ2A 2HDDA 5LGTA 2VONA 1ETVA 3FXMA 4HV5A 3L1PA 4B44A 2AQFA 4KISA 2DMTA 3K70C 1Y1VJ 1T56A 3IRRA 3BROA 2XGXA 4EJWA 1ETXA 1QHHD 4HOBA 4I99C 1UHMA 2PQ8A 2DA5A 4UV9A 2A05A 4B3XA 2JSCA 1FX7A 2DOEA 3DU6A 3EUHA 2R7XA 4AU7A 1R4NB 4ON0A 1SD6A 1J09A 2WAQA 2XGEA 2K5CA 2BHZA 1MSEC 1I5ZA 5JLXA 3VB2A 2W7NA 2XAHA 3A02A 3DTEA 1JGGA 2KQRA 1U9OA 1XX5A 1Z77A 1X1PA 3KFWX 4XORA 2M34A 4KNYA 3HTSB 2CQXA 4IZZA 4X6AJ 1IDZA 5AONA 2GOXB 1FOYA 4D5FA 1Q1VA 1D1BA 3Q0UA 1E17A 4XBFA 1BIBA 3OYHA 1QZEA 4HRIA 2O03A 2EFOA 1JE8A 3S2DJ 2RAEA 3MKZA 1OPCA 3AG4H 1A5JA 2EH3A 4HPQA 2QEXI 1X2NA 1I3QJ 5AIPA 4I02A 5F27A 2STTA 4S04A 4XLPF 2R5YA 1MJ9A 3OYBA 2FSWA
chains in the Genus database with same CATH topology
1XGSA 4CDGA 2YSRA 1XD7A 4D0PA 2Y0MA 3GO5A 3S2WA 1Z1DA 2GWRA 3TGNA 5E20A 1ZRFA 4A0XA 3VEPA 3T5XA 1ZARA 5HDNA 4ZZDA 3SHFA 4PCQA 2A6HF 2GQQA 1JHFA 3VOEA 3QU6A 1FPQA 1D8KA 2P5LC 2PLYA 2IT0A 2UWMA 3ABUA 5LLQA 3LQRA 2MLKA 3TQNA 4EGYA 2MH2A 2VE9A 1F4KA 3EYIA 1R22A 3J80Z 1G4DA 3RIRA 1BI0A 4U88A 5ICGA 5A2QZ 4PGHA 1F5TA 2RC4A 1BJAA 4UNOA 4YG2F 5LEJA 2KRFA 3W6KB 3QRFF 3E6DA 4GYGA 3LAPA 2RKHA 5FFZA 1FWZA 4U7DA 1I1GA 5E8IA 2EA4A 4XSXF 1OKRA 1BC7C 2GZWA 2QLZA 1W7PB 4IRIA 2ELHA 1TW3A 5DDGA 3DQVC 1XCBA 4BHCA 2LF8A 4TV7A 4IRHA 2P5VA 4ESJA 3QOPA 3ISPA 2M45A 2X4HA 3KP3A 4HBLA 4KT5C 1HQCA 1ZAOA 5EEGA 1P4XA 3LWFA 5DEQA 5JR3A 1X3UA 1RZ4A 5CVJA 4NHJA 2VBXA 1FNNA 4RGXA 3HHHA 1ZGAA 1H9GA 4EJUA 4YFNF 5LHHA 2F2EA 3CLOA 5HS8A 4KIFA 4P96A 4R79A 4O3MA 5E18F 1XDSA 3CUQA 1XMKA 2HDCA 3E3VA 4ESFA 3NRVA 2FNAA 3QP6A 1G3YA 2R3SA 1YYVA 2RVCA 4L0ZB 2G7HA 2H94A 2HOEA 4WK8F 3EETA 3IWZA 4GCVA 5TRDA 3I5UA 4MNUA 2HTJA 3K0LA 3ZN1A 4ZYEA 3TDUC 2HKXA 4HYEA 4MTEA 1B6AA 4G8XA 5D6EA 2D45A 5D8KB 4M6XA 1W5SA 2L54A 2M87A 1L0OC 1TTYA 1IN7A 3WTWC 5IT9Z 2ISYA 2AXLA 1I27A 1MDMB 1KQ0A 2QUFA 1SFUA 2EJRA 1STZA 2O61A 2HYFA 2JT1A 1WI9A 1H0MA 3RKYA 3FM5A 3MQ0A 3FXQA 1YLFA 2ZO4A 3FMQA 1Z05A 4PZJA 3RKXA 3N97A 2IP2A 2XAJA 3ZQ7A 5E8GA 2E7WA 5CVIA 2F5DA 3CTAA 3QPHA 4R1HA 5CJ9A 4AIJA 1GVJA 5BQTA 3GFMA 5FB2A 4KN7X 3WODF 1S3JA 1O3RA 3ZMZA 2HWVA 2LKPA 5L3BA 2J5OA 3KETA 4P9UA 1SMTA 3SZPA 2L01A 2RDPA 3F22A 2DLLA 3CUOA 4HQEA 2FOKA 1QPMA 2GA2A 4HA8A 1LB2A 1B4AA 1ZRDA 3MEXA 3W6JB 4JK1X 2DW4A 4HX8A 4IVNA 3F8BA 4KA4A 2M30A 3N4MA 2VT2A 1OR7A 1D5VA 2K02A 4I01A 4JBAA 3V8LA 3GX4X 4P55A 5JI6A 2FEZA 1B59A 3HOSA 2MD5A 3LA7A 3F23A 4A6DA 1ULYA 4LD5A 2G7UA 3K1MA 4E70A 3T0YA 4FT8A 3F21A 1XSXA 1SD7A 4KYWA 2A69F 1WKMA 3L09A 3KZZA 3M9AA 5CVVA 3BJAA 5E1WA 4HZFA 1YS7A 4GGGA 2VN2A 5ICFA 4RB0A 4H0EA 3IRQA 4M9ZA 1USSA 2XAQA 3KP5A 4OIPF 1ZREA 2Q8KA 1P4WA 3E6MA 2OQGA 2V1XA 1Z7UA 2HS5A 1U78A 2ZKZA 1TQIA 3ZN0A 4LJZF 3J7AO 3HRSA 4AVPA 1DDNA 3Q5FA 3HSFA 4RB3C 1U5TC 2ZMEB 4M72A 2WTEA 4IJAA 3ABTA 4O5VA 5CLSA 3RYPA 1K7AA 1IXRC 1ZRCA 3GVAA 1P6RA 1LQ1A 2M5WA 2NRAC 2HZTA 4HV6A 4I0AA 3LAJA 4EJVA 2KIMA 3T8TA 5K1YA 2B0LA 5D6FA 1KU3A 4F7ZA 3KCCA 5D5WB 3C7JA 4GXOA 2EV6A 5H6QA 4A0YA 4RGRA 1HW1A 5L3EA 1BC8C 1IXCA 1RI7A 1XMAA 2KJBA 2E1NA 4EM2A 2XAFA 2ZFWA 1YQAA 2ESHA 4XSZF 2XIGA 5H20A 2P4WA 3DPTA 2DTRA 1CF7B 3TOAA 3NQOA 1GXPA 3C1DA 1IN4A 4R8HA 3JAMZ 3ZMSA 3K69A 1WQ2A 1TQMA 1S7OA 1W7PA 1SMYF 2WWYA 2VT3A 4CXFA 1ONVA 2UXXA 4Q5SF 2Z3YA 4BH9A 5BMZA 1XB4A 1K79A 2DT5A 2F5FA 2LF7A 1DPUA 1ZG3A 2RQPA 4MQ9F 2ESNA 2P8TA 3QU3A 2ETHA 2MH9A 2PBIA 4Y13A 3JW4A 1S7AA 1HBXG 4L5JA 1D3YA 3RPUA 4EV0A 1HKSA 2GAUA 2R7DA 5ILUA 3SQNA 1ON1A 5KK1A 1OYIA 3SXYA 1O3QA 4WXDA 1F9NA 4I98B 1QGPA 3VFZA 1FYKA 1FYLA 1QZZA 1FSHA 2RGVA 1XN7A 1MZBA 5CVUA 2Q2EA 2JPCA 2J5PA 3TDZC 2K86A 2OAZA 4IRGA 2EB7A 2FBIA 2FA5A 1MDMA 5LRSA 2BGCA 4LLGF 2CYYA 3L9FA 1QO0D 2YU3A 1Z6RA 3F8FA 3PFIA 5JVTA 2ZNYA 1JHHA 3FMSA 3JTGA 2HR3A 1XCVA 2RV8A 4QWQA 3ERED 1P4AA 3BZ6A 2WV0A 4UV8A 3ZMTA 2IRFG 1ZN2A 5LEKA 3CUQC 4RGSA 4EJOA 4FHTA 4EM0B 3ML6A 1EV7A 4EQQA 2QBYB 2L4AA 2E7XA 3HIFA 4A5NA 4WXCA 4BNCA 5CYVA 1ZG5A 2QM3A 4OU0A 1BBYA 2D1HA 1WRJA 3FWEA 1RUNA 1ZHFA 2DQLA 3R61A 3MZHA 5DUIA 5KVRA 4M71A 4LG0B 3WTZA 3E5UA 2PN6A 1E2XA 3OV8A 1HXDA 5ILSA 1HKTA 1REPC 2A07F 2W57A 1LEBA 2QYOA 5TJJA 5EEHA 2DI3A 1JXSA 1G6NA 1TNSA 2EK5A 3FM3A 2XROA 2XHKA 5F1RA 4ENKA 3RI4A 1ON2A 3QP5A 4L0YB 3IWFA 4RB2C 2A68F 2W25A 3R6SA 2XAGA 3P9CA 4N9IA 1MJBA 1LDKB 2EV0A 5BOXA 4M9SA 3WTVC 3R0JA 3F8NA 4UVAA 3I0TA 4RS8A 3D0SA 1O3SA 3ULQB 2H27A 5F6FA 4LK1F 3EYYA 3GZ6A 3K1PA 3IL2A 1O57A 2YX4A 1R23A 3KP7A 2E1CA 2CQKA 4I7HA 1XGNA 5D8LB 3H3UA 1RUOA 1J75A 4UHTA 1PP8F 3TO7A 3P9IA 1WSUA 5FD6A 3WGHA 1UHWA 1IN8A 3Q9SA 4FX4A 3DKWA 3GLXA 2JTVA 2BV6A 3F6VA 1KA8A 2NYXA 2EV5A 4DNCA 4CHUA 3V4GA 2EFWA 2IPQX 1T0FA 1D8JA 2IA2A 2ZMEA 1EH6A 2VBYA 3PQKA 1H9TA 1S29A 3ELKA 3ZP5A 3RDIA 4WXHA 1P92A 1SD5A 5LHIA 1TQPA 4I2OA 4G94A 2VE8A 1IXSB 3GUDA 2EFNA 1TBXA 2EFPA 3FXRA 3RJPA 1FC3A 2O6GE 1DUXC 2MLGA 3WE3A 4WWCA 1YTYA 4A12A 3HSRA 2HFHA 3V8KA 1G3WA 1W5TA 3TKYA 2X0LA 3E97A 5E17F 4AIKA 1MD0A 5J6XA 3R60A 1SFEA 2UZKA 2ZNZA 4JQFA 4Q48A 4UUVA 3K9TA 3COAC 1R5HA 3BOQA 5FO5A 1XGMA 4A6EA 4B09A 1R1UA 4BXUA 3KLNA 5L3DA 3LA3A 3GXOA 4HF0A 4ENMA 3V7CA 1CF7A 4ZH4F 1RIOH 3B73A 3RKWA 4HDVA 1FBUA 5K5OA 2ZJ2A 3L7WA 3REOA 3HYIA 3FXUA 4KMFA 1IAWA 1B9MA 2PEXA 2CWEA 2COMA 1O3TA 4LK0F 3HHGA 3I54A 3Q9VA 1SAXA 3WTSC 4KICA 2ZCWA 3R0AA 3KP4A 3FZVA 3LFKA 1KGSA 3F3XA 1PUEE 2NAZA 1B1BA 2G9WA 4I0BA 3U1DA 4O6JA 3MWMA 2Z99A 3PQJA 4BHPA 2OU2A 3VODA 5HLHA 2D2WA 1ZG1A 3F8MA 5J8CA 3CO6C 2XKPA 2M8EA 2P7VB 2YPRA 1IRGA 2O0YA 5FLXK 3J81K 3LQQA 3K1NA 3BPXA 3HUGA 2VC1A 4HF2A 5K5QA 2P6TA 2GIVA 3O6BB 2GXBA 1O7LA 2PMUA 1ZGJA 4LLNA 2H6CA 3I53A 3E5XA 5LBQA 5BS6A 1W4MA 5D5XB 1XSVA 4HX4A 4HW0A 4Y17A 2O3FA 3G73A 2DU9A 5HS7A 1CGPA 1FLIA 2XRNA 4G7ZF 1NHAA 1LJ9A 1XGOA 2QQBA 3BP8A 4LFUA 2PFBA 1S8NA 4MGRA 1YO5C 3SFZA 1LEAA 1SD4A 2NNYA 3HTUA 2W24A 1B9NA 3LA2A 3KP2A 4HF1A 5CVRA 2QBYA 4G7OF 4M9XA 3WGGA 5L3GA 2VOPA 1V3FA 3CO7C 3RPQA 3O3KA 1HSTA 2DO7A 3M7GA 3LSTA 1R58A 3CDHA 5E1XA 5ERIA 1HSJA 4LG0A 4G9YA 4G6QA 5HS9A 4XRFA 4S05A 2CGPA 3E5QA 2IA0A 4IPAA 3IHUA 4L9VA 2HYGD 1KYWA 4GYIA 1OYYA 2A3SA 2PG4A 1T98A 3I64A 3NEUA 4WX9A 1KU9A 4IF4A 5IT3A 1LDJA 2IA1A 1U2WA 3T1BA 2NS0A 1T39A 4HLXA 3ZMVA 5A2QK 3F6OA 2XASA 3WG9A 1UFMA 1UCRA 2JPBA 3I58A 3DP7A 1U3EM 3D5LA 2DK8A 5FLXZ 2VODA 3CJNA 3ECOA 4ZYDA 2L4MA 3WU1B 2QENA 2IVMA 3GFJA 3TO9A 4ENNA 1K78B 4RAZA 4I09A 1I6XA 4CICA 5BPIA 3I59B 3GEZA 1FP2A 2OBPA 1C0WA 4AD9A 2K27A 4OOIA 5HDKA 2L3DA 1XDUA 2BEOA 1YS6A 1FYMA 1LVAA 3WE2A 3H92A 4CO8A 3TOBA 2YR2A 2FE3A 2Q0OA 4HAMA 5DCMB 1KYZA 3L2CA 2YX7A 2L02A 3EQLF 3MFKA 6PAXA 3OOPA 3FX3A 2V79A 1ODDA 1J7KA 2P6SA 1Q1HA 3BJOA 1T38A 2HGCA 2IJLA 1HW5A 2JRTA 2NNNA 3WGIA 2ISZA 1YW7A 2HTSA 4Q47A 1L3LA 3GW2A 4EVIA 4MTDA 3K2ZA 4YIIA 2H6BA 4G7HF 2KIFA 3KZYA 2DQRA 5HLGA 3F72A 5IT9K 2A5YB 3B02A 4EJTA 2PI0A 4L9TA 5F64A 5HLIA 2LDUA 2F5EA 4Y15A 4QLCU 4B8XA 3SZTA 4IHSA 2HQNA 1QNTA 4HLYA 3JTHA 2HKOA 1WWXA 3I4PA 5HOOA 1BOAA 4ZZLA 4WCGA 2VBZA 4OIOF 1QQIA 4L9JA 2STWA 4UVBA 3V7RA 3BJ6A 1HKQA 3I71A 2CO5A 1XSDA 1FBQA 4OMZA 1U5TB 4ASNA 1F1ZA 5DD4A 1SFXA 4BQAA 4L9NA 3JSPA 1IN5A 1OYWA 2V9VA 1IZ1A 5ILVA 2P7CB 1AOYA 2EWNA 3MCZA 2VOOA 2FMYA 2XVCA 3P9KA 2K7LA 5L3FA 5K5RA 4Q4ZF 5FFXA 5DYMA 2K4BA 3G3ZA 3IKVA 3RTRA 5E1ZB 1KU2A 1MJAA 3QPTA 2W84A 1BM9A 5LGNA 5DUKA 3DF8A 1KQ9A 3M8FA 5ICCA 1R1VA 1MGTA 3BY6A 2TDXA 2AS5F 4EGZA 4LGWA 1YW9A 2GA1A 3MZYA 2F5CA 3HSEA 1RNLA 4HDUA 4P9FA 5H6RA 4Z2YA 2FF4A 2FBHA 3ZMUA 1EH8A 1IUYA 2HEOA 2XKOA 1R1TA 4OINF 1IN6A 1IW7F 4IXAA 1I1SA 2Z9OA 2OQRA 3FMRA 1T6SA 3E6CC 2P5KA 1Y0UA 3BDDA 4CYDA 4A5MA 4GO1A 2BBYA 4MQVA 3QAHA 4ENJA 3AAFA 2DK5A 2MA3A 1BI1A 2DPUA 4BYYA 4UVCA 2FMLA 2PMHA 4XLNF 3ROUA 1GXQA 5D5UB 3GFIA 1T2KA 3M8EA 1J9IA 2FBKA 1QBJA 4DQ2A 1TW2A 3EDPA 1QZYA 4CGZA 3BWGA 4BHBA 3DFGA 2Z5UA 2MC3A 1BN5A 3HOTA 1BIAA 1OMIA 4HX7A 1Z6TA 3DV8A 2K4JA 3E6BA 1PP7U 4CZZA 4ZYHA 5D5VB 4NB5A 1ZH5A 1DP7P 2XV4S 5JFRA 2OZ6A 3HRMA 1BI2A 4YFKF 2C6YA 2QQAA 2JZYA 2KKOA 4RAYA 5AIQA 2DBBA 5L3CA 2OD5A 3V8JA 1O7FA 2OZUA 3IC7A 3WTTC 1R00A 4ZYGA 3C18A 4KMUX 5ED4A 4KUMA 4OIRF 1PDNC 1U6GA 2D1VA 4U0VA 4YIFA 1J5YA 4U0YA 4KFCA 2GXGA 2LSOA 1LDDA 1U8RA 1FP1D 1V4RA 1W7PD 3FHZA 1JGSA 2V6CA 2H09A 4L18B 3BPVA 5LGUA 4OMYA 5LHGA 1G3SA 3KEOA 1UB9A 3FF5A 5LRRA 4MHGA 5ICEA 5FGMA 4KDPA 3R4KA 3IKTA 1Z9CA 2WC2A 1YW8A 3V7SA 3DEUA 2Z33A 1R5GA 4ESBA 3JAMK 3DPLC 3HRUA 3C3WA 2V1DA 1R36A 3MAJA 5DD8A 3CUQB 3L00A 2VC0A 1DPRA 1K78A 1FT9A 2RN7A 2ZXJA 4U0WA 1S6LA 3I59A 2BYVE 3GYHX 3KEQA 3HRTA 3GWZA 1IF1A 2O8XA 4LLLA 1K6OA 2OA4A 2FU4A 2LNBA 2XUBA 1FBSA 3U9GA 2KIUA 3GZ5A 1USTA 2QZ8A 2A61A 4KIBA 4LB6B 5DCMA 3ZMDA 2EA2A 4NQWA 3ECHA 2CFXA 3F8CA 4PGGA 1R7JA 3O2PE 3U2RA 2CSOA 5J8FA 4RB1A 2W85A 1VTNC 4KN4X 4YFXF 1ZLKA 1KQ8A 4K2EA 3P7NA 2A6EF 1YG2A 1MKMA 1ZYRF 1FSEA 4PDKA 3WTYC 4EM1A 4HQMA 4WF2A 2ACJA 2VBWA 4L5IA 3TO6A 4MEXF 2CW0F 2HQRA 2DFIA 1J2XA 1FOKA 4UXNA 2VXZA 2V1UA 3H3ZA 4M6YA 1TNTA 3WTUC 2FNPA 2QQ9A 1P2FA 3DXJF 1TLHB 3JSOA 2R7FA 2EFQA 2MBFA 2FXAA 2CG4A 1Z91A 2DPDA 4FX0A 1IRFA 3GFLA 3RYRA 3WTXC 2PJPA 1FY7A 4N0BA 4KIGA 5D4SA 3KLOA 2ZBKA 5D4RA 2DAOA 1YIOA 2FQ3A 1FZPB 3KP6A 4LB5A 3KE2A 3GF2A 4LMYA 4ETSA 5BPDA 3WU0A 2ADUA 5HDGA 5JHUA 4A2UA 4EMSA 1G3TA 2BE5F 4P5OA 3T8RA 5DV5A 3M1EA 2QVOA 1A04A 4BAYA 1HW2A 2RNJA 1J0RA 3J80K 1GHCA 4RGUA 4AWXB 4MEYF 1KU7A 5DCFA 1LNWA 4AIHA 1U5TA 2QWWA 4G6DA 2UXNA 2IW5A 4U7BA 5FD5A 2Y75A 2FRHA 4IHTA 3J81Z 1EH7A 2KJCA 5HVQC 4OIQF 4N9HA 1J59A 2M1BA 1BI3A 4A0ZA 2Y48A 4M74A 4M73A 1YFHA 1AWCA 1ZLJA 3ZPLA 5LGTA 2VONA 4HV5A 3IRRA 3BROA 2XGXA 4EJWA 4HOBA 1UHMA 2PQ8A 4UV9A 2JSCA 1FX7A 3EUHA 4ON0A 1SD6A 1I5ZA 3VB2A 2XAHA 3KFWX 4KNYA 3HTSB 5AONA 1E17A 4XBFA 1BIBA 2O03A 2EFOA 1JE8A 1OPCA 5AIPA 4I02A 2STTA 4S04A 4XLPF 1MJ9A 2FSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XGS A;  4CDG A;  2YSR A;  1XD7 A;  4D0P A;  2Y0M A;  3GO5 A;  3S2W A;  1Z1D A;  2GWR A;  3TGN A;  5E20 A;  1ZRF A;  4A0X A;  3VEP A;  3T5X A;  1ZAR A;  5HDN A;  4ZZD A;  3SHF A;  4PCQ A;  2A6H F;  2GQQ A;  1JHF A;  3VOE A;  3QU6 A;  1FPQ A;  1D8K A;  2P5L C;  2PLY A;  2IT0 A;  2UWM A;  3ABU A;  5LLQ A;  3LQR A;  2MLK A;  3TQN A;  4EGY A;  2MH2 A;  2VE9 A;  1F4K A;  3EYI A;  1R22 A;  3J80 Z;  1G4D A;  3RIR A;  1BI0 A;  4U88 A;  5ICG A;  5A2Q Z;  4PGH A;  1F5T A;  2RC4 A;  1BJA A;  4UNO A;  4YG2 F;  5LEJ A;  2KRF A;  3W6K B;  3QRF F;  3E6D A;  4GYG A;  3LAP A;  2RKH A;  5FFZ A;  1FWZ A;  4U7D A;  1I1G A;  5E8I A;  2EA4 A;  4XSX F;  1OKR A;  1BC7 C;  2GZW A;  2QLZ A;  1W7P B;  4IRI A;  2ELH A;  1TW3 A;  5DDG A;  3DQV C;  1XCB A;  4BHC A;  2LF8 A;  4TV7 A;  4IRH A;  2P5V A;  4ESJ A;  3QOP A;  3ISP A;  2M45 A;  2X4H A;  3KP3 A;  4HBL A;  4KT5 C;  1HQC A;  1ZAO A;  5EEG A;  1P4X A;  3LWF A;  5DEQ A;  5JR3 A;  1X3U A;  1RZ4 A;  5CVJ A;  4NHJ A;  2VBX A;  1FNN A;  4RGX A;  3HHH A;  1ZGA A;  1H9G A;  4EJU A;  4YFN F;  5LHH A;  2F2E A;  3CLO A;  5HS8 A;  4KIF A;  4P96 A;  4R79 A;  4O3M A;  5E18 F;  1XDS A;  3CUQ A;  1XMK A;  2HDC A;  3E3V A;  4ESF A;  3NRV A;  2FNA A;  3QP6 A;  1G3Y A;  2R3S A;  1YYV A;  2RVC A;  4L0Z B;  2G7H A;  2H94 A;  2HOE A;  4WK8 F;  3EET A;  3IWZ A;  4GCV A;  5TRD A;  3I5U A;  4MNU A;  2HTJ A;  3K0L A;  3ZN1 A;  4ZYE A;  3TDU C;  2HKX A;  4HYE A;  4MTE A;  1B6A A;  4G8X A;  5D6E A;  2D45 A;  5D8K B;  4M6X A;  1W5S A;  2L54 A;  2M87 A;  1L0O C;  1TTY A;  1IN7 A;  3WTW C;  5IT9 Z;  2ISY A;  2AXL A;  1I27 A;  1MDM B;  1KQ0 A;  2QUF A;  1SFU A;  2EJR A;  1STZ A;  2O61 A;  2HYF A;  2JT1 A;  1WI9 A;  1H0M A;  3RKY A;  3FM5 A;  3MQ0 A;  3FXQ A;  1YLF A;  2ZO4 A;  3FMQ A;  1Z05 A;  4PZJ A;  3RKX A;  3N97 A;  2IP2 A;  2XAJ A;  3ZQ7 A;  5E8G A;  2E7W A;  5CVI A;  2F5D A;  3CTA A;  3QPH A;  4R1H A;  5CJ9 A;  4AIJ A;  1GVJ A;  5BQT A;  3GFM A;  5FB2 A;  4KN7 X;  3WOD F;  1S3J A;  1O3R A;  3ZMZ A;  2HWV A;  2LKP A;  5L3B A;  2J5O A;  3KET A;  4P9U A;  1SMT A;  3SZP A;  2L01 A;  2RDP A;  3F22 A;  2DLL A;  3CUO A;  4HQE A;  2FOK A;  1QPM A;  2GA2 A;  4HA8 A;  1LB2 A;  1B4A A;  1ZRD A;  3MEX A;  3W6J B;  4JK1 X;  2DW4 A;  4HX8 A;  4IVN A;  3F8B A;  4KA4 A;  2M30 A;  3N4M A;  2VT2 A;  1OR7 A;  1D5V A;  2K02 A;  4I01 A;  4JBA A;  3V8L A;  3GX4 X;  4P55 A;  5JI6 A;  2FEZ A;  1B59 A;  3HOS A;  2MD5 A;  3LA7 A;  3F23 A;  4A6D A;  1ULY A;  4LD5 A;  2G7U A;  3K1M A;  4E70 A;  3T0Y A;  4FT8 A;  3F21 A;  1XSX A;  1SD7 A;  4KYW A;  2A69 F;  1WKM A;  3L09 A;  3KZZ A;  3M9A A;  5CVV A;  3BJA A;  5E1W A;  4HZF A;  1YS7 A;  4GGG A;  2VN2 A;  5ICF A;  4RB0 A;  4H0E A;  3IRQ A;  4M9Z A;  1USS A;  2XAQ A;  3KP5 A;  4OIP F;  1ZRE A;  2Q8K A;  1P4W A;  3E6M A;  2OQG A;  2V1X A;  1Z7U A;  2HS5 A;  1U78 A;  2ZKZ A;  1TQI A;  3ZN0 A;  4LJZ F;  3J7A O;  3HRS A;  4AVP A;  1DDN A;  3Q5F A;  3HSF A;  4RB3 C;  1U5T C;  2ZME B;  4M72 A;  2WTE A;  4IJA A;  3ABT A;  4O5V A;  5CLS A;  3RYP A;  1K7A A;  1IXR C;  1ZRC A;  3GVA A;  1P6R A;  1LQ1 A;  2M5W A;  2NRA C;  2HZT A;  4HV6 A;  4I0A A;  3LAJ A;  4EJV A;  2KIM A;  3T8T A;  5K1Y A;  2B0L A;  5D6F A;  1KU3 A;  4F7Z A;  3KCC A;  5D5W B;  3C7J A;  4GXO A;  2EV6 A;  5H6Q A;  4A0Y A;  4RGR A;  1HW1 A;  5L3E A;  1BC8 C;  1IXC A;  1RI7 A;  1XMA A;  2KJB A;  2E1N A;  4EM2 A;  2XAF A;  2ZFW A;  1YQA A;  2ESH A;  4XSZ F;  2XIG A;  5H20 A;  2P4W A;  3DPT A;  2DTR A;  1CF7 B;  3TOA A;  3NQO A;  1GXP A;  3C1D A;  1IN4 A;  4R8H A;  3JAM Z;  3ZMS A;  3K69 A;  1WQ2 A;  1TQM A;  1S7O A;  1W7P A;  1SMY F;  2WWY A;  2VT3 A;  4CXF A;  1ONV A;  2UXX A;  4Q5S F;  2Z3Y A;  4BH9 A;  5BMZ A;  1XB4 A;  1K79 A;  2DT5 A;  2F5F A;  2LF7 A;  1DPU A;  1ZG3 A;  2RQP A;  4MQ9 F;  2ESN A;  2P8T A;  3QU3 A;  2ETH A;  2MH9 A;  2PBI A;  4Y13 A;  3JW4 A;  1S7A A;  1HBX G;  4L5J A;  1D3Y A;  3RPU A;  4EV0 A;  1HKS A;  2GAU A;  2R7D A;  5ILU A;  3SQN A;  1ON1 A;  5KK1 A;  1OYI A;  3SXY A;  1O3Q A;  4WXD A;  1F9N A;  4I98 B;  1QGP A;  3VFZ A;  1FYK A;  1FYL A;  1QZZ A;  1FSH A;  2RGV A;  1XN7 A;  1MZB A;  5CVU A;  2Q2E A;  2JPC A;  2J5P A;  3TDZ C;  2K86 A;  2OAZ A;  4IRG A;  2EB7 A;  2FBI A;  2FA5 A;  1MDM A;  5LRS A;  2BGC A;  4LLG F;  2CYY A;  3L9F A;  1QO0 D;  2YU3 A;  1Z6R A;  3F8F A;  3PFI A;  5JVT A;  2ZNY A;  1JHH A;  3FMS A;  3JTG A;  2HR3 A;  1XCV A;  2RV8 A;  4QWQ A;  3ERE D;  1P4A A;  3BZ6 A;  2WV0 A;  4UV8 A;  3ZMT A;  2IRF G;  1ZN2 A;  5LEK A;  3CUQ C;  4RGS A;  4EJO A;  4FHT A;  4EM0 B;  3ML6 A;  1EV7 A;  4EQQ A;  2QBY B;  2L4A A;  2E7X A;  3HIF A;  4A5N A;  4WXC A;  4BNC A;  5CYV A;  1ZG5 A;  2QM3 A;  4OU0 A;  1BBY A;  2D1H A;  1WRJ A;  3FWE A;  1RUN A;  1ZHF A;  2DQL A;  3R61 A;  3MZH A;  5DUI A;  5KVR A;  4M71 A;  4LG0 B;  3WTZ A;  3E5U A;  2PN6 A;  1E2X A;  3OV8 A;  1HXD A;  5ILS A;  1HKT A;  1REP C;  2A07 F;  2W57 A;  1LEB A;  2QYO A;  5TJJ A;  5EEH A;  2DI3 A;  1JXS A;  1G6N A;  1TNS A;  2EK5 A;  3FM3 A;  2XRO A;  2XHK A;  5F1R A;  4ENK A;  3RI4 A;  1ON2 A;  3QP5 A;  4L0Y B;  3IWF A;  4RB2 C;  2A68 F;  2W25 A;  3R6S A;  2XAG A;  3P9C A;  4N9I A;  1MJB A;  1LDK B;  2EV0 A;  5BOX A;  4M9S A;  3WTV C;  3R0J A;  3F8N A;  4UVA A;  3I0T A;  4RS8 A;  3D0S A;  1O3S A;  3ULQ B;  2H27 A;  5F6F A;  4LK1 F;  3EYY A;  3GZ6 A;  3K1P A;  3IL2 A;  1O57 A;  2YX4 A;  1R23 A;  3KP7 A;  2E1C A;  2CQK A;  4I7H A;  1XGN A;  5D8L B;  3H3U A;  1RUO A;  1J75 A;  4UHT A;  1PP8 F;  3TO7 A;  3P9I A;  1WSU A;  5FD6 A;  3WGH A;  1UHW A;  1IN8 A;  3Q9S A;  4FX4 A;  3DKW A;  3GLX A;  2JTV A;  2BV6 A;  3F6V A;  1KA8 A;  2NYX A;  2EV5 A;  4DNC A;  4CHU A;  3V4G A;  2EFW A;  2IPQ X;  1T0F A;  1D8J A;  2IA2 A;  2ZME A;  1EH6 A;  2VBY A;  3PQK A;  1H9T A;  1S29 A;  3ELK A;  3ZP5 A;  3RDI A;  4WXH A;  1P92 A;  1SD5 A;  5LHI A;  1TQP A;  4I2O A;  4G94 A;  2VE8 A;  1IXS B;  3GUD A;  2EFN A;  1TBX A;  2EFP A;  3FXR A;  3RJP A;  1FC3 A;  2O6G E;  1DUX C;  2MLG A;  3WE3 A;  4WWC A;  1YTY A;  4A12 A;  3HSR A;  2HFH A;  3V8K A;  1G3W A;  1W5T A;  3TKY A;  2X0L A;  3E97 A;  5E17 F;  4AIK A;  1MD0 A;  5J6X A;  3R60 A;  1SFE A;  2UZK A;  2ZNZ A;  4JQF A;  4Q48 A;  4UUV A;  3K9T A;  3COA C;  1R5H A;  3BOQ A;  5FO5 A;  1XGM A;  4A6E A;  4B09 A;  1R1U A;  4BXU A;  3KLN A;  5L3D A;  3LA3 A;  3GXO A;  4HF0 A;  4ENM A;  3V7C A;  1CF7 A;  4ZH4 F;  1RIO H;  3B73 A;  3RKW A;  4HDV A;  1FBU A;  5K5O A;  2ZJ2 A;  3L7W A;  3REO A;  3HYI A;  3FXU A;  4KMF A;  1IAW A;  1B9M A;  2PEX A;  2CWE A;  2COM A;  1O3T A;  4LK0 F;  3HHG A;  3I54 A;  3Q9V A;  1SAX A;  3WTS C;  4KIC A;  2ZCW A;  3R0A A;  3KP4 A;  3FZV A;  3LFK A;  1KGS A;  3F3X A;  1PUE E;  2NAZ A;  1B1B A;  2G9W A;  4I0B A;  3U1D A;  4O6J A;  3MWM A;  2Z99 A;  3PQJ A;  4BHP A;  2OU2 A;  3VOD A;  5HLH A;  2D2W A;  1ZG1 A;  3F8M A;  5J8C A;  3CO6 C;  2XKP A;  2M8E A;  2P7V B;  2YPR A;  1IRG A;  2O0Y A;  5FLX K;  3J81 K;  3LQQ A;  3K1N A;  3BPX A;  3HUG A;  2VC1 A;  4HF2 A;  5K5Q A;  2P6T A;  2GIV A;  3O6B B;  2GXB A;  1O7L A;  2PMU A;  1ZGJ A;  4LLN A;  2H6C A;  3I53 A;  3E5X A;  5LBQ A;  5BS6 A;  1W4M A;  5D5X B;  1XSV A;  4HX4 A;  4HW0 A;  4Y17 A;  2O3F A;  3G73 A;  2DU9 A;  5HS7 A;  1CGP A;  1FLI A;  2XRN A;  4G7Z F;  1NHA A;  1LJ9 A;  1XGO A;  2QQB A;  3BP8 A;  4LFU A;  2PFB A;  1S8N A;  4MGR A;  1YO5 C;  3SFZ A;  1LEA A;  1SD4 A;  2NNY A;  3HTU A;  2W24 A;  1B9N A;  3LA2 A;  3KP2 A;  4HF1 A;  5CVR A;  2QBY A;  4G7O F;  4M9X A;  3WGG A;  5L3G A;  2VOP A;  1V3F A;  3CO7 C;  3RPQ A;  3O3K A;  1HST A;  2DO7 A;  3M7G A;  3LST A;  1R58 A;  3CDH A;  5E1X A;  5ERI A;  1HSJ A;  4LG0 A;  4G9Y A;  4G6Q A;  5HS9 A;  4XRF A;  4S05 A;  2CGP A;  3E5Q A;  2IA0 A;  4IPA A;  3IHU A;  4L9V A;  2HYG D;  1KYW A;  4GYI A;  1OYY A;  2A3S A;  2PG4 A;  1T98 A;  3I64 A;  3NEU A;  4WX9 A;  1KU9 A;  4IF4 A;  5IT3 A;  1LDJ A;  2IA1 A;  1U2W A;  3T1B A;  2NS0 A;  1T39 A;  4HLX A;  3ZMV A;  5A2Q K;  3F6O A;  2XAS A;  3WG9 A;  1UFM A;  1UCR A;  2JPB A;  3I58 A;  3DP7 A;  1U3E M;  3D5L A;  2DK8 A;  5FLX Z;  2VOD A;  3CJN A;  3ECO A;  4ZYD A;  2L4M A;  3WU1 B;  2QEN A;  2IVM A;  3GFJ A;  3TO9 A;  4ENN A;  1K78 B;  4RAZ A;  4I09 A;  1I6X A;  4CIC A;  5BPI A;  3I59 B;  3GEZ A;  1FP2 A;  2OBP A;  1C0W A;  4AD9 A;  2K27 A;  4OOI A;  5HDK A;  2L3D A;  1XDU A;  2BEO A;  1YS6 A;  1FYM A;  1LVA A;  3WE2 A;  3H92 A;  4CO8 A;  3TOB A;  2YR2 A;  2FE3 A;  2Q0O A;  4HAM A;  5DCM B;  1KYZ A;  3L2C A;  2YX7 A;  2L02 A;  3EQL F;  3MFK A;  6PAX A;  3OOP A;  3FX3 A;  2V79 A;  1ODD A;  1J7K A;  2P6S A;  1Q1H A;  3BJO A;  1T38 A;  2HGC A;  2IJL A;  1HW5 A;  2JRT A;  2NNN A;  3WGI A;  2ISZ A;  1YW7 A;  2HTS A;  4Q47 A;  1L3L A;  3GW2 A;  4EVI A;  4MTD A;  3K2Z A;  4YII A;  2H6B A;  4G7H F;  2KIF A;  3KZY A;  2DQR A;  5HLG A;  3F72 A;  5IT9 K;  2A5Y B;  3B02 A;  4EJT A;  2PI0 A;  4L9T A;  5F64 A;  5HLI A;  2LDU A;  2F5E A;  4Y15 A;  4QLC U;  4B8X A;  3SZT A;  4IHS A;  2HQN A;  1QNT A;  4HLY A;  3JTH A;  2HKO A;  1WWX A;  3I4P A;  5HOO A;  1BOA A;  4ZZL A;  4WCG A;  2VBZ A;  4OIO F;  1QQI A;  4L9J A;  2STW A;  4UVB A;  3V7R A;  3BJ6 A;  1HKQ A;  3I71 A;  2CO5 A;  1XSD A;  1FBQ A;  4OMZ A;  1U5T B;  4ASN A;  1F1Z A;  5DD4 A;  1SFX A;  4BQA A;  4L9N A;  3JSP A;  1IN5 A;  1OYW A;  2V9V A;  1IZ1 A;  5ILV A;  2P7C B;  1AOY A;  2EWN A;  3MCZ A;  2VOO A;  2FMY A;  2XVC A;  3P9K A;  2K7L A;  5L3F A;  5K5R A;  4Q4Z F;  5FFX A;  5DYM A;  2K4B A;  3G3Z A;  3IKV A;  3RTR A;  5E1Z B;  1KU2 A;  1MJA A;  3QPT A;  2W84 A;  1BM9 A;  5LGN A;  5DUK A;  3DF8 A;  1KQ9 A;  3M8F A;  5ICC A;  1R1V A;  1MGT A;  3BY6 A;  2TDX A;  2AS5 F;  4EGZ A;  4LGW A;  1YW9 A;  2GA1 A;  3MZY A;  2F5C A;  3HSE A;  1RNL A;  4HDU A;  4P9F A;  5H6R A;  4Z2Y A;  2FF4 A;  2FBH A;  3ZMU A;  1EH8 A;  1IUY A;  2HEO A;  2XKO A;  1R1T A;  4OIN F;  1IN6 A;  1IW7 F;  4IXA A;  1I1S A;  2Z9O A;  2OQR A;  3FMR A;  1T6S A;  3E6C C;  2P5K A;  1Y0U A;  3BDD A;  4CYD A;  4A5M A;  4GO1 A;  2BBY A;  4MQV A;  3QAH A;  4ENJ A;  3AAF A;  2DK5 A;  2MA3 A;  1BI1 A;  2DPU A;  4BYY A;  4UVC A;  2FML A;  2PMH A;  4XLN F;  3ROU A;  1GXQ A;  5D5U B;  3GFI A;  1T2K A;  3M8E A;  1J9I A;  2FBK A;  1QBJ A;  4DQ2 A;  1TW2 A;  3EDP A;  1QZY A;  4CGZ A;  3BWG A;  4BHB A;  3DFG A;  2Z5U A;  2MC3 A;  1BN5 A;  3HOT A;  1BIA A;  1OMI A;  4HX7 A;  1Z6T A;  3DV8 A;  2K4J A;  3E6B A;  1PP7 U;  4CZZ A;  4ZYH A;  5D5V B;  4NB5 A;  1ZH5 A;  1DP7 P;  2XV4 S;  5JFR A;  2OZ6 A;  3HRM A;  1BI2 A;  4YFK F;  2C6Y A;  2QQA A;  2JZY A;  2KKO A;  4RAY A;  5AIQ A;  2DBB A;  5L3C A;  2OD5 A;  3V8J A;  1O7F A;  2OZU A;  3IC7 A;  3WTT C;  1R00 A;  4ZYG A;  3C18 A;  4KMU X;  5ED4 A;  4KUM A;  4OIR F;  1PDN C;  1U6G A;  2D1V A;  4U0V A;  4YIF A;  1J5Y A;  4U0Y A;  4KFC A;  2GXG A;  2LSO A;  1LDD A;  1U8R A;  1FP1 D;  1V4R A;  1W7P D;  3FHZ A;  1JGS A;  2V6C A;  2H09 A;  4L18 B;  3BPV A;  5LGU A;  4OMY A;  5LHG A;  1G3S A;  3KEO A;  1UB9 A;  3FF5 A;  5LRR A;  4MHG A;  5ICE A;  5FGM A;  4KDP A;  3R4K A;  3IKT A;  1Z9C A;  2WC2 A;  1YW8 A;  3V7S A;  3DEU A;  2Z33 A;  1R5G A;  4ESB A;  3JAM K;  3DPL C;  3HRU A;  3C3W A;  2V1D A;  1R36 A;  3MAJ A;  5DD8 A;  3CUQ B;  3L00 A;  2VC0 A;  1DPR A;  1K78 A;  1FT9 A;  2RN7 A;  2ZXJ A;  4U0W A;  1S6L A;  3I59 A;  2BYV E;  3GYH X;  3KEQ A;  3HRT A;  3GWZ A;  1IF1 A;  2O8X A;  4LLL A;  1K6O A;  2OA4 A;  2FU4 A;  2LNB A;  2XUB A;  1FBS A;  3U9G A;  2KIU A;  3GZ5 A;  1UST A;  2QZ8 A;  2A61 A;  4KIB A;  4LB6 B;  5DCM A;  3ZMD A;  2EA2 A;  4NQW A;  3ECH A;  2CFX A;  3F8C A;  4PGG A;  1R7J A;  3O2P E;  3U2R A;  2CSO A;  5J8F A;  4RB1 A;  2W85 A;  1VTN C;  4KN4 X;  4YFX F;  1ZLK A;  1KQ8 A;  4K2E A;  3P7N A;  2A6E F;  1YG2 A;  1MKM A;  1ZYR F;  1FSE A;  4PDK A;  3WTY C;  4EM1 A;  4HQM A;  4WF2 A;  2ACJ A;  2VBW A;  4L5I A;  3TO6 A;  4MEX F;  2CW0 F;  2HQR A;  2DFI A;  1J2X A;  1FOK A;  4UXN A;  2VXZ A;  2V1U A;  3H3Z A;  4M6Y A;  1TNT A;  3WTU C;  2FNP A;  2QQ9 A;  1P2F A;  3DXJ F;  1TLH B;  3JSO A;  2R7F A;  2EFQ A;  2MBF A;  2FXA A;  2CG4 A;  1Z91 A;  2DPD A;  4FX0 A;  1IRF A;  3GFL A;  3RYR A;  3WTX C;  2PJP A;  1FY7 A;  4N0B A;  4KIG A;  5D4S A;  3KLO A;  2ZBK A;  5D4R A;  2DAO A;  1YIO A;  2FQ3 A;  1FZP B;  3KP6 A;  4LB5 A;  3KE2 A;  3GF2 A;  4LMY A;  4ETS A;  5BPD A;  3WU0 A;  2ADU A;  5HDG A;  5JHU A;  4A2U A;  4EMS A;  1G3T A;  2BE5 F;  4P5O A;  3T8R A;  5DV5 A;  3M1E A;  2QVO A;  1A04 A;  4BAY A;  1HW2 A;  2RNJ A;  1J0R A;  3J80 K;  1GHC A;  4RGU A;  4AWX B;  4MEY F;  1KU7 A;  5DCF A;  1LNW A;  4AIH A;  1U5T A;  2QWW A;  4G6D A;  2UXN A;  2IW5 A;  4U7B A;  5FD5 A;  2Y75 A;  2FRH A;  4IHT A;  3J81 Z;  1EH7 A;  2KJC A;  5HVQ C;  4OIQ F;  4N9H A;  1J59 A;  2M1B A;  1BI3 A;  4A0Z A;  2Y48 A;  4M74 A;  4M73 A;  1YFH A;  1AWC A;  1ZLJ A;  3ZPL A;  5LGT A;  2VON A;  4HV5 A;  3IRR A;  3BRO A;  2XGX A;  4EJW A;  4HOB A;  1UHM A;  2PQ8 A;  4UV9 A;  2JSC A;  1FX7 A;  3EUH A;  4ON0 A;  1SD6 A;  1I5Z A;  3VB2 A;  2XAH A;  3KFW X;  4KNY A;  3HTS B;  5AON A;  1E17 A;  4XBF A;  1BIB A;  2O03 A;  2EFO A;  1JE8 A;  1OPC A;  5AIP A;  4I02 A;  2STT A;  4S04 A;  4XLP F;  1MJ9 A;  2FSW A; 
#chains in the Genus database with same CATH topology
 3U21 A;  1XGS A;  4CDG A;  4E7S A;  5CKT A;  2YSR A;  1XD7 A;  3EPZ A;  4RBO A;  4IOC F;  4D0P A;  2Y0M A;  3GO5 A;  3S2W A;  1Z1D A;  2GWR A;  3TGN A;  5E20 A;  1TWC J;  1ZRF A;  4A0X A;  3VEP A;  3T5X A;  2BOL A;  3ZQH A;  1ZAR A;  5HDN A;  3MMY B;  2LK2 A;  4ZZD A;  3SHF A;  3A01 B;  1JUS A;  2DDA A;  5K7F A;  4PCQ A;  2A6H F;  2GQQ A;  1JHF A;  3FIS A;  3VOE A;  3QU6 A;  3J7Y J;  1FPQ A;  1D8K A;  2M4G A;  2B9S A;  2XB0 X;  2P5L C;  3I56 I;  2ZXI A;  2PLY A;  2IT0 A;  2UWM A;  3ABU A;  5LLQ A;  3LQR A;  2MLK A;  2ECC A;  5IOZ A;  3TQN A;  4LG3 A;  4BJT A;  2JMW A;  3K4N A;  4EGY A;  2AO9 A;  2MH2 A;  2WB1 A;  1WJF A;  3V42 A;  3DKX A;  2VE9 A;  5DM6 F;  1F4K A;  3EYI A;  1R22 A;  3J80 Z;  1G4D A;  4FQG A;  3RIR A;  1BI0 A;  4U88 A;  1OJL A;  2HZD A;  5ICG A;  2PX9 A;  5A2Q Z;  2GLO A;  2CS3 A;  4PGH A;  1F5T A;  4BE2 A;  2HVS A;  2F5V A;  2RC4 A;  1BJA A;  3HM5 A;  3VDX A;  4PK4 A;  4UNO A;  3HOY J;  1YRN B;  3L2W A;  1ETY A;  2RQQ A;  4YG2 F;  1VQ5 I;  2X48 A;  4C3H J;  3EUK L;  2ZC2 A;  1AA7 A;  1X3W B;  5LEJ A;  4LIU A;  4BQO A;  2KRF A;  3GZN B;  3W6K B;  3QRF F;  3E6D A;  2JVH A;  5M3F J;  3KPH A;  4GYG A;  3LAP A;  1LE8 B;  4MLO A;  2RKH A;  2OUM A;  5FFZ A;  1K83 J;  1FWZ A;  3OIQ A;  3K2A A;  4U7D A;  1I1G A;  3PSI A;  5E8I A;  2EA4 A;  4XSX F;  1OKR A;  2GXA A;  3ZQQ A;  3JR9 A;  1BC7 C;  2R7Z J;  2GZW A;  4F55 A;  2QLZ A;  4PJ0 C;  1W7P B;  4IRI A;  2ELH A;  1TW3 A;  3FXO A;  5DDG A;  2RRE A;  2IS4 A;  3DQV C;  3OS2 A;  1WH5 A;  2JA2 A;  1XCB A;  3S1Q J;  4BHC A;  2LF8 A;  4TV7 A;  4IRH A;  2P5V A;  4ESJ A;  3CES A;  3QOP A;  3ISP A;  1FMW A;  2M45 A;  2X4H A;  3S93 A;  1BJZ A;  3CCV I;  3CDL A;  4RLQ A;  2Y9Y A;  2ICW G;  3KP3 A;  4HBL A;  4CYC A;  4KT5 C;  1HQC A;  3LOC A;  1ZAO A;  5EEG A;  1P4X A;  3LWF A;  2ME6 A;  3G4S I;  5DEQ A;  3PUF A;  5JR3 A;  4BBR J;  3PIP F;  1X3U A;  4D5C A;  2JA7 J;  1RZ4 A;  5M3M J;  5CVJ A;  4RM2 A;  3A1Y A;  1TWG J;  1ORK A;  2B7E A;  2VBX A;  4NHJ A;  3M4O J;  1FNN A;  4RGX A;  3HHH A;  4PJL A;  1ZGA A;  1IC8 A;  1H9G A;  4EJU A;  4YFN F;  5LHH A;  1JJ8 C;  1FOW A;  2DYR H;  2F2E A;  3CLO A;  5HS8 A;  3TW6 A;  4IHY A;  4KIF A;  1VI0 A;  2R93 J;  2I8D A;  2Y30 A;  4P96 A;  4R79 A;  4O3M A;  2L9N A;  5E18 F;  1R6R A;  2BW3 B;  1XDS A;  3CUQ A;  3HKZ A;  1JUM A;  2WBM A;  2ZJR F;  1B8I A;  1XMK A;  2HDC A;  2K85 A;  3E3V A;  3ZQI A;  4ESF A;  3DBR B;  1VZ0 A;  3NRV A;  2FNA A;  3ZQL A;  2QSG X;  3H3V K;  4IL6 C;  4X1E A;  2QQ8 A;  1DGR M;  3QP6 A;  1UMQ A;  3LSP A;  2ELJ A;  1G3Y A;  2JA5 J;  1TT0 A;  2R3S A;  1WJ5 A;  1WJE A;  1YYV A;  2QGU A;  2RVC A;  4L0Z B;  3HEF A;  3FHN A;  2G7H A;  2H94 A;  1VQO I;  2CU7 A;  2HOE A;  1OCZ H;  4WK8 F;  3EET A;  3IWZ A;  4GCV A;  3I5U A;  4MNU A;  5TRD A;  2OV7 A;  2CV1 A;  2HTJ A;  4IX7 A;  3K0L A;  3ZN1 A;  4ZYE A;  3TDU C;  2F4M B;  2HKX A;  3HPG A;  4HYE A;  4MTE A;  1IGN A;  1B6A A;  4G8X A;  5D6E A;  2D45 A;  2ZJP F;  3OMY A;  2VKV A;  2E35 A;  5D8K B;  2VAS A;  1F43 A;  4M6X A;  5GAH J;  1W5S A;  2L54 A;  2M87 A;  1L0O C;  2Q2E B;  4M6V A;  4A3M J;  5TIS C;  1LPQ A;  4B1R A;  1TTY A;  2W4S A;  1IN7 A;  3WTW C;  5IT9 Z;  2ISY A;  2AXL A;  2XDV A;  1MSF C;  1I27 A;  2KIS A;  1MDM B;  2WAE A;  1KQ0 A;  2QUF A;  4DZP A;  5E3O A;  1SFU A;  2EJR A;  1STZ A;  2O61 A;  3OYI A;  2DT7 B;  2HYF A;  2JT1 A;  1WI9 A;  1H0M A;  3RKY A;  3FM5 A;  3MQ0 A;  5KCM A;  2E5Z A;  3FXQ A;  1YLF A;  2ZO4 A;  3OOU A;  3FMQ A;  1Z05 A;  3DWL E;  2R7O A;  3QYF A;  4PZJ A;  3RKX A;  3N97 A;  3E0J B;  2PJR A;  1I6H J;  1UZC A;  3CC2 I;  4UY8 I;  2IP2 A;  1NG6 A;  2XAJ A;  5FKK A;  3ZQ7 A;  2ZFU A;  1VQ9 I;  2NS8 A;  5E8G A;  2E7W A;  5CVI A;  2CQN A;  2HVQ A;  2F5D A;  3CTA A;  3QPH A;  1RPW A;  4R1H A;  5CJ9 A;  4AIJ A;  1GVJ A;  3AG3 H;  2R4G A;  3GFM A;  5BQT A;  1VFC A;  2LMD A;  1JI8 A;  5FB2 A;  4KN7 X;  3WOD F;  1S3J A;  1OIS A;  1O3R A;  2XAU A;  3ZMZ A;  2HWV A;  3LNQ A;  2LKP A;  5L3B A;  1YIJ I;  2J5O A;  3KET A;  4P9U A;  1SMT A;  3SZP A;  2L01 A;  2RDP A;  3F22 A;  2DLL A;  2NVX J;  1W0T A;  4BBS J;  1JJ6 C;  4A93 J;  3QYE A;  3HL2 A;  2E34 A;  1D1C A;  5IYB J;  2X6O A;  3OYN A;  3CUO A;  4HQE A;  4II2 A;  2FOK A;  1QPM A;  2GA2 A;  4HA8 A;  1LB2 A;  3LSI A;  4EAT A;  1B4A A;  2JSP A;  4ZTF A;  1ZRD A;  4RMN A;  4BEH B;  2MAB A;  1N25 A;  2WAF A;  3MEX A;  3W6J B;  3LSJ A;  4JK1 X;  2DW4 A;  2VQL A;  4HX8 A;  4IVN A;  5B1A H;  3ZXS A;  1FTZ A;  3F8B A;  4KA4 A;  1N78 A;  2M30 A;  4FE4 A;  4XN3 A;  4CA0 A;  1SAU A;  3N4M A;  4E7I A;  2Z16 A;  3DKY A;  3OYD A;  1X3Z B;  1GV2 A;  2VT2 A;  2X6Y A;  4QPQ A;  1OR7 A;  1YX3 A;  4XRS A;  4LIV A;  1D5V A;  2R7U A;  2K02 A;  4I01 A;  4JBA A;  3V8L A;  3GX4 X;  3WG7 H;  1XMX A;  3BCB A;  1Z21 A;  3K4L A;  2P81 A;  4P55 A;  5JI6 A;  4FET A;  2FEZ A;  1B59 A;  1JT6 A;  2MD5 A;  3HOS A;  3LA7 A;  3F23 A;  4XKB A;  4A6D A;  1VND A;  3OSF A;  4XK4 A;  3CCL I;  1ULY A;  3ASO H;  4LD5 A;  1WVR A;  1X58 A;  1PUF A;  3S15 J;  2G7U A;  3K1M A;  4E70 A;  3CP2 A;  2DCE A;  4XL9 A;  3T0Y A;  3ZQF A;  4FT8 A;  3F21 A;  1VQ4 I;  1XSX A;  1SD7 A;  4KYW A;  2A69 F;  1WKM A;  3H35 A;  3L09 A;  4MO7 A;  4NC6 A;  3SEZ A;  1MBG A;  5EGO A;  1O4X A;  2VKH A;  3I55 I;  1WJC A;  4BAC A;  4F93 B;  1BA5 A;  3KZZ A;  3M9A A;  5M5X J;  3RZD J;  5CVV A;  2O9L A;  3BJA A;  4Y52 J;  3CCY A;  5E1W A;  4HZF A;  1YS7 A;  2CQ7 A;  3ABL H;  4GGG A;  4ZDO A;  2VN2 A;  3O8G A;  5ICF A;  4RB0 A;  3EUA A;  4H0E A;  3IRQ A;  4XLE A;  4ZYA A;  1QVU A;  1USS A;  4M9Z A;  1EF4 A;  3CF2 A;  2XAQ A;  3KP5 A;  2IXS A;  4OIP F;  1FMV A;  1ZTR A;  2KFD A;  4XLF A;  1ZRE A;  1W0U A;  1JUP A;  2Q8K A;  1P4W A;  4GRI A;  3E6M A;  2OQG A;  2WA0 A;  4ITV A;  2BVM A;  2V1X A;  2BY0 A;  1Z7U A;  2EBI A;  1BL0 A;  2BHY A;  2HS5 A;  3HPH A;  2NVU B;  2OPT A;  1U78 A;  1YJN I;  2ZKZ A;  1TQI A;  3ZN0 A;  2KZG A;  1IRZ A;  4LJZ F;  4XMY A;  2DOF A;  3MKL A;  3J7A O;  3OYE A;  3HRS A;  1IV8 A;  4AVP A;  1DDN A;  3Q5F A;  3HSF A;  4RB3 C;  2X85 A;  1U5T C;  2ZME B;  2L7M P;  2EQR A;  1A35 A;  4M72 A;  2KRH A;  1WH7 A;  2WTE A;  5GAE J;  3AL0 C;  1Y8R B;  4IJA A;  3ABT A;  1Y39 A;  1S7E A;  4O5V A;  3BG9 A;  3QQA A;  1H88 C;  2VLA A;  2RNG A;  2DA1 A;  5CLS A;  3RYP A;  2X51 A;  4IHV A;  1ETW A;  2W48 A;  2IGM A;  1K7A A;  2M2E A;  1IXR C;  1ZRC A;  3GVA A;  3HB9 A;  1P6R A;  3ONQ A;  4BQQ A;  3MKW B;  1LQ1 A;  2M3A A;  2M5W A;  4MIM A;  2NRA C;  2HZT A;  1HA8 A;  2W00 A;  4HV6 A;  3HOU J;  1K4S A;  3PUB A;  2X1C A;  4I0A A;  4A3L J;  4A3J J;  3LAJ A;  4EJV A;  3A01 A;  3KIO A;  3CCU I;  5HNH A;  2IS1 A;  2KIM A;  3T8T A;  5K1Y A;  2B0L A;  2L0K A;  5D6F A;  1KU3 A;  4F7Z A;  3KCC A;  5D5W B;  1V54 H;  4ABZ A;  3C7J A;  4GXO A;  2EV6 A;  3GBG A;  1IJW C;  5H6Q A;  4A3I J;  2EPF A;  3FK6 A;  3EUH C;  2JA6 J;  4A0Y A;  4ZJZ A;  2X9D A;  2QSF X;  4A3G J;  1U0J A;  2XSJ C;  4RGR A;  4XN0 A;  3VYT B;  1HW1 A;  5JVG F;  1MNM C;  2PMZ N;  2Z1D A;  3DEE A;  5L3E A;  1VQM I;  1X4O A;  4J00 A;  2YS9 A;  3RZO J;  2JUC A;  4UB6 C;  1BC8 C;  1IXC A;  1RI7 A;  1XMA A;  3BG6 A;  2KJB A;  2E1N A;  4EM2 A;  3K70 D;  2XAF A;  2Y0S A;  2ZFW A;  1YRN A;  1MBH A;  3B6A A;  1YJ9 I;  1YQA A;  2ESH A;  1SFO J;  2XPW A;  3ERM A;  1D0Z A;  3DEW A;  4XSZ F;  2XIG A;  2M9H A;  5H20 A;  1LE8 A;  2P4W A;  3DPT A;  5IOY A;  2DTR A;  3IUO A;  1CF7 B;  3TOA A;  3NQO A;  1GXP A;  3C1D A;  1IN4 A;  3KYC B;  4R8H A;  2AHQ A;  3JAM Z;  3ZMS A;  1LUJ B;  2ZJQ F;  3K69 A;  2R7S A;  1WQ2 A;  1TQM A;  1S7O A;  3JRB A;  1W7P A;  3BZK A;  1SMY F;  2WWY A;  5HNF A;  2VT3 A;  3M07 A;  1MBJ A;  4CXF A;  1RR8 C;  1ONV A;  2UXX A;  5IYC J;  4F91 B;  4Q5S F;  1UG2 A;  4E6K G;  1F36 A;  2Z3Y A;  2V1N A;  3OR2 C;  4BH9 A;  5BMZ A;  3K4C A;  2IBD A;  2YU9 J;  1XB4 A;  1K79 A;  4J01 A;  2DT5 A;  2F5F A;  2LF7 A;  1DPU A;  1ZG3 A;  4IKF A;  2XC7 A;  2RQP A;  4MQ9 F;  2ESN A;  2W82 A;  2P8T A;  3QU3 A;  3S16 J;  3E7L A;  1GDT A;  4D9J A;  2ETH A;  1CQT A;  2MH9 A;  2EIL H;  2PBI A;  2OC6 A;  4KJZ A;  4KIT B;  4Y13 A;  1X1A A;  3JW4 A;  4F52 A;  4E7L A;  1S7A A;  1HBX G;  4L5J A;  1D3Y A;  3GTJ J;  2LH9 A;  3RPU A;  4EV0 A;  4RM3 A;  1HKS A;  2BW3 A;  2M0M A;  4IEJ A;  2GAU A;  1NH3 A;  1ZK8 A;  2D5V A;  1R5I D;  2R7D A;  1R4M B;  3SJM A;  5ILU A;  2CUZ A;  3SQN A;  1ON1 A;  3NWS A;  3JRI A;  5KK1 A;  1OYI A;  1RRJ A;  4DYR A;  2YUS A;  3SXY A;  5C44 J;  1O3Q A;  4H4K C;  1YI2 I;  2HOA A;  2LP0 A;  1Y6I A;  4WXD A;  1F9N A;  4I98 B;  2KLO A;  5GPC A;  1QGP A;  3HUG B;  3VFZ A;  1FYK A;  1FYL A;  1UG0 A;  1W1W E;  2WV1 A;  1QZZ A;  4PFP A;  5J3L A;  4GFB A;  2OTJ I;  1FSH A;  4ZTJ A;  4HNU A;  1MBK A;  2VQG A;  2RGV A;  1H89 C;  2HQA A;  1W36 C;  4DIQ A;  1XN7 A;  1MZB A;  5CVU A;  3CMM A;  2BZT A;  2Q2E A;  2JPC A;  2J5P A;  3AG2 H;  4RA2 A;  3TDZ C;  2K86 A;  2VJ5 A;  2HXO A;  2OAZ A;  3CCJ I;  1MMD A;  5C4J J;  4IRG A;  2K9N A;  2EB7 A;  3BCA A;  1X4P A;  3HOZ J;  1A31 A;  2FBI A;  2FA5 A;  1MDM A;  5LRS A;  4IOA F;  2BGC A;  3RKQ A;  4LLG F;  1V55 H;  2CYY A;  5EF6 A;  3L9F A;  4F92 B;  1TT5 B;  2YU3 A;  1QO0 D;  1VQK I;  1Z6R A;  3F8F A;  3SDB A;  3PFI A;  4MFD A;  4NNJ A;  5JVT A;  3I4M J;  1H8A C;  2E60 A;  1WJB A;  1JHH A;  2JUG A;  1Z3X A;  2ZNY A;  3E1S A;  4P1W A;  2E1M C;  3SEQ A;  3FMS A;  3DLA A;  3JTG A;  2VPL A;  2LOO A;  2HR3 A;  1XCV A;  1GVD A;  2RV8 A;  4QWQ A;  3JRC A;  3A0B C;  3ERE D;  1P4A A;  1ZR4 A;  2KP6 A;  3BZ6 A;  2WV0 A;  4UV8 A;  1BW5 A;  3ZMT A;  2V26 A;  2IRF G;  1ZN2 A;  4IQ4 A;  5LEK A;  3K4J A;  3CUQ C;  1I3A A;  2W1O A;  3DCF A;  4RGS A;  1BR2 A;  4EJO A;  1ZGW A;  2GBY A;  4FHT A;  5CQG A;  4EM0 B;  3ML6 A;  2LBF B;  4OWR B;  4HST A;  3ABK H;  1U8B A;  1EV7 A;  1HF0 A;  1WHU A;  4B43 A;  4CZC A;  2R5Z B;  4EQQ A;  2DA3 A;  2QBY B;  2L4A A;  2EZL A;  2E7X A;  1VQ6 I;  1T08 B;  3HIF A;  4A5N A;  4WXC A;  5IP7 J;  4BNC A;  2V9K A;  3IH2 A;  5CYV A;  1ZG5 A;  2QM3 A;  4OU0 A;  1TP4 A;  1BBY A;  2D1H A;  2ID6 A;  1WRJ A;  3CZ6 A;  2OF7 A;  1IDY A;  1MBF A;  3FWE A;  1RUN A;  1ZHF A;  2DQL A;  3R61 A;  3MZH A;  5DUI A;  5KVR A;  4M71 A;  5F0C A;  4NC7 A;  4BEH A;  4LG0 B;  3K7A J;  3E5U A;  3WTZ A;  2DJN A;  2PN6 A;  2Y69 H;  5FKN A;  4MFE A;  4KT6 A;  4B4C A;  4A3E J;  2KIQ A;  1E2X A;  1POG A;  4V2F A;  3OV8 A;  2H8W A;  1HXD A;  2BVL A;  3OYK A;  3A4C A;  3K4M A;  1D1A A;  1TWH J;  5ILS A;  1HKT A;  1HDP A;  1REP C;  2A07 F;  2W57 A;  1LEB A;  2QYO A;  2MYS A;  5TJJ A;  2CMP A;  1UJ8 A;  3LSM A;  2K3P A;  5EEH A;  3BR6 A;  3BG5 A;  3OYL A;  4BY1 J;  2DI3 A;  1JXS A;  1G6N A;  1TNS A;  2EK5 A;  3FM3 A;  5JHF A;  2XRO A;  2XHK A;  5F1R A;  4ZDP A;  1SAN A;  2A6T A;  4ENK A;  2MC4 A;  3RI4 A;  1ON2 A;  2LY1 A;  2Y0S N;  2ELK A;  3QP5 A;  1M1E B;  4CUG A;  1EA3 A;  3DPU A;  3HOX J;  1JKR C;  3O8H A;  4L0Y B;  2F48 A;  3M8J A;  5EZH A;  3G2B A;  1DU0 A;  5KHD A;  3IWF A;  2DA7 A;  5FKL A;  4RB2 C;  2A68 F;  2W25 A;  3R6S A;  2XAG A;  3P9C A;  1MIJ A;  4N9I A;  1MJB A;  1LDK B;  2EV0 A;  5BOX A;  3PNV A;  1TZL A;  4M9S A;  3WTV C;  4DGW B;  1QHG A;  4XLA A;  1E0E A;  4OAZ A;  3R0J A;  3F8N A;  5F0H A;  2L7Z A;  4UVA A;  3DTK A;  3I0T A;  4RS8 A;  3H0D A;  3D0S A;  1O3S A;  3ULQ B;  2H27 A;  3JRF A;  1VQN I;  5F6F A;  4LK1 F;  3EYY A;  3OR1 C;  4OAY A;  5J4V A;  1TL8 A;  2GM4 A;  2HNH A;  3GZ6 A;  2XRL A;  2L7F P;  3K1P A;  3IL2 A;  1O57 A;  1GLN A;  2CV0 A;  2YX4 A;  1R23 A;  5HLT A;  3KP7 A;  2E1C A;  2CQK A;  4I7H A;  1XGN A;  4Y33 A;  4LIT A;  5D8L B;  3H3U A;  3CMA I;  1J75 A;  1RUO A;  4UHT A;  1ZQ3 P;  4D1Q A;  1S5L C;  1ENH A;  1N75 A;  1X1D A;  1PP8 F;  3WHC A;  3PJR A;  3TO7 A;  4BUP A;  3P9I A;  2F6C A;  1WSU A;  1BOB A;  5FD6 A;  3WGH A;  1UHW A;  4JP0 A;  1IN8 A;  3Q9S A;  4FX4 A;  3DKW A;  2X1E A;  3GLX A;  2JTV A;  2BV6 A;  3W2W A;  3F6V A;  3I3L A;  1GT0 C;  2KZV A;  1OR7 C;  1KA8 A;  2NYX A;  3GCM A;  3D1N I;  2QCO A;  4DW6 A;  1JKP C;  2EV5 A;  4DNC A;  4CHU A;  4DBR A;  3CC4 I;  3V4G A;  4E7J A;  1YIT I;  1MND A;  2EFW A;  2IPQ X;  2DYS H;  5E3L A;  1T0F A;  1MMN A;  5GAG J;  3CJR B;  3A0H C;  2IA2 A;  2VJI A;  4C9Y A;  1D8J A;  2ZB9 A;  2ZME A;  1DQU A;  1RC9 A;  1EH6 A;  2VBY A;  3PQK A;  1H9T A;  2I5U A;  1S29 A;  4NDL A;  3ELK A;  3AKZ A;  2R7V A;  3ZP5 A;  3RDI A;  4WXH A;  1OLT A;  2HPI A;  1BW6 A;  3BR2 A;  1P92 A;  2H1L A;  2OCE A;  2QSH X;  1SD5 A;  5LHI A;  1TQP A;  3RQI A;  4I2O A;  2PMZ A;  4G94 A;  2GIZ A;  2LKX A;  3DBL B;  2K9L A;  3JRA A;  2VE8 A;  1IXS B;  3GUD A;  2EFN A;  1TBX A;  2NVQ J;  2EFP A;  3FXR A;  3RQ4 A;  3W2A A;  3RJP A;  5E79 C;  1FC3 A;  3FBN B;  2O6G E;  1DUX C;  2HQ5 A;  2MLG A;  1E3H A;  4DZJ A;  1WGX A;  2LTP A;  3WE3 A;  3Q0W A;  4WWC A;  1YTY A;  4A12 A;  3HSR A;  1SEU A;  2HFH A;  3V8K A;  5K7H A;  1G3W A;  1W5T A;  3TKY A;  3KZI C;  2X0L A;  3E97 A;  3HZJ A;  3GLL A;  1B72 B;  5E17 F;  3BLY A;  1N77 A;  4AIK A;  1MD0 A;  5J6X A;  3ZCO A;  3R60 A;  1SFE A;  3VYU B;  2LYC A;  2UZK A;  3CQZ J;  4B48 A;  3ZRG A;  2ZNZ A;  4JQF A;  2Y31 A;  4Q48 A;  4UUV A;  3LMM A;  3K9T A;  3COA C;  2EZK A;  1R5H A;  3BOQ A;  3IH4 A;  5BNG A;  5FO5 A;  3A2K A;  1XGM A;  3OYF A;  3DU5 A;  4A6E A;  3VSK A;  4B09 A;  3U1K A;  1R1U A;  2NOJ B;  2TCT A;  4BXU A;  4BE0 A;  1BR1 A;  3CP8 A;  3KLN A;  3PFY A;  5L3D A;  3LA3 A;  3GXO A;  3LL7 A;  2DA6 A;  4HF0 A;  2FX0 A;  4BDY A;  4XKV A;  4ENM A;  3V7C A;  1CF7 A;  1JTX A;  5IY5 H;  3G1M A;  2OTL I;  4ZH4 F;  1RIO H;  4RAG A;  1UEL B;  1RET A;  3B73 A;  3RKW A;  1UAA A;  4HDV A;  1RKT A;  4U87 A;  1FBU A;  3JRG A;  1LFB A;  2JVG A;  5K5O A;  2CUE A;  2ZJ2 A;  2LC2 A;  3FKI J;  2E2I J;  4BS9 A;  2COB A;  3L7W A;  4DBQ A;  3REO A;  3HYI A;  1AKH B;  3FXU A;  3D5R C;  1IAW A;  1B9M A;  4KMF A;  2PEX A;  5DTD A;  3BG3 A;  2CWE A;  2BY2 A;  2COM A;  3W2V A;  4LK0 F;  1O3T A;  1LKX A;  2NOG A;  3MKY B;  3HHG A;  3QPL A;  3I54 A;  3Q9V A;  1SAX A;  1HDD C;  1Z7L A;  1MH3 A;  3WTS C;  1VQP I;  4KIC A;  3TP0 A;  2ZCW A;  2IAI A;  3CMY A;  3DTI A;  3R0A A;  2K3F A;  2M7B A;  3KP4 A;  4W97 A;  3FZV A;  3H9Q A;  3LFK A;  5IPA A;  4Y4R A;  1KGS A;  3F3X A;  1AHD P;  3OS0 A;  3GTL J;  5CPR B;  4BKX A;  1PVE A;  1WCM J;  1PUE E;  2NAZ A;  1Y1W J;  1B1B A;  2CW7 A;  4C3I J;  2G9W A;  4I0B A;  3U1D A;  4O6J A;  3MWM A;  5J47 A;  4IO9 F;  2Z99 A;  3PQJ A;  1Z67 A;  5GPA A;  3FKJ A;  4QIW N;  4BHP A;  2OU2 A;  3VOD A;  2EZI A;  3BR0 A;  2DMP A;  3LSG A;  3PNY A;  3JRE A;  4BXX J;  3ESW B;  5HLH A;  2D2W A;  1ZG1 A;  3F8M A;  1ACI A;  3S1R J;  3C2H A;  2E2H J;  5J8C A;  3CO6 C;  2XKP A;  2M8E A;  3BG7 A;  2P7V B;  1MNE A;  3UNG C;  3VYR B;  2YPR A;  1IRG A;  2O0Y A;  1AU7 A;  5FLX K;  3X2Q H;  3J81 K;  3LQQ A;  4IHW A;  4YEJ A;  3K1N A;  2JRM A;  1T8I A;  1RES A;  2M0C A;  3BPX A;  2KMU A;  3HUG A;  3KEY A;  4M3D A;  3H9J A;  2VC1 A;  4HF2 A;  5K5Q A;  2P6T A;  2GIV A;  5C4X J;  5F1J A;  1T95 A;  5FLV A;  3O6B B;  5M5Y J;  2GXB A;  3GTP J;  4A3B J;  1O7L A;  2PMU A;  5GAD J;  2XF7 A;  5J4Y A;  4DYC A;  2V6E A;  1ZGJ A;  4LLN A;  2H6C A;  4EEF G;  2XF5 A;  1Y56 A;  2LKS A;  3M3Y J;  3I53 A;  4M3F A;  3FK7 A;  2XPV A;  1KON A;  4Z6Y A;  3E5X A;  5LBQ A;  5BS6 A;  1W4M A;  5D5X B;  1XSV A;  4NC8 A;  4FTH A;  5H2F C;  3OYA A;  4HX4 A;  4HW0 A;  4M3E A;  2O3F A;  4Y17 A;  2DU9 A;  3G73 A;  2NVT J;  5HS7 A;  1I50 J;  1CGP A;  1FLI A;  2DMU A;  2XRN A;  2VUM J;  2DOA A;  4G7Z F;  5K7Z A;  1NHA A;  1LJ9 A;  2X6X A;  1QU3 A;  3OL3 A;  1XGO A;  2QQB A;  1HCR A;  3BP8 A;  3VSL A;  4LFU A;  1ETQ A;  2DT6 A;  1OCC H;  3OIO A;  2MGQ A;  1S8N A;  2PFB A;  5TGT A;  3NAU A;  4MGR A;  1YO5 C;  2OJE D;  3SFZ A;  1QVT A;  1LEA A;  2CUF A;  2HPM A;  1VF9 A;  4IHX A;  2M8G X;  1SD4 A;  2NNY A;  1MBE A;  3HTU A;  3PSF A;  2W24 A;  2EZH A;  1B9N A;  2LBF A;  4QSH A;  3LA2 A;  2VJ4 A;  2VKE A;  3KP2 A;  5EJC A;  4CSW A;  1V5E A;  4DOZ A;  4HF1 A;  5CVR A;  2R5Z A;  2F4I A;  2QBY A;  4G7O F;  3LSH A;  4M9X A;  1IRX A;  4C2T A;  3C2B A;  3WGG A;  1ETO A;  4XKW A;  3GTK J;  5L3G A;  1OCT C;  1XC5 A;  2VOP A;  1V3F A;  2AQE A;  3CO7 C;  3RPQ A;  3HGG A;  1A6Q A;  5HOD A;  3O3K A;  1HST A;  4HNV A;  3HOV J;  2DO7 A;  3BT9 A;  3M7G A;  4A69 C;  3LST A;  1R58 A;  2KT0 A;  1G8X A;  1LFP A;  3CDH A;  2JN6 A;  4I6Z A;  4PFO A;  4CCM A;  5E1X A;  3VPR A;  1GUU A;  5ERI A;  4CCJ A;  5E3N A;  3G6E I;  4N4O B;  1ZKG A;  2M4K A;  3GME A;  3CCS I;  1HSJ A;  1MW7 A;  5F04 A;  4LG0 A;  4V2G A;  2JA8 J;  4G9Y A;  4XOP A;  4G6Q A;  5HS9 A;  4XRF A;  4S05 A;  2CGP A;  3E5Q A;  5LFA A;  2IA0 A;  4IPA A;  3IHU A;  2Y9Z A;  1U9N A;  4L9V A;  3S2H J;  2HYG D;  1IUF A;  3BQY A;  1KYW A;  3PO3 J;  1MMA A;  1YX5 A;  2KDO A;  4BY7 J;  4GYI A;  1OYY A;  1PYV A;  1TWF J;  2A3S A;  2PG4 A;  3Q3S A;  1T98 A;  3I64 A;  3NEU A;  4WX9 A;  3OYJ A;  1KU9 A;  1KZH A;  4HSR A;  3K4B A;  4IF4 A;  5IT3 A;  1LDJ A;  2IA1 A;  1U2W A;  5FKO A;  3T1B A;  2NS0 A;  2KHM A;  1UHS A;  1T39 A;  4HLX A;  4XR6 A;  3ZMV A;  1W36 D;  5A2Q K;  3OS1 A;  5J1Y A;  3SDG A;  1YOV B;  3RCO A;  1WI3 A;  3OWT A;  4LOC A;  3F6O A;  5J1R A;  2XAS A;  3WG9 A;  2IGK A;  2FQ4 A;  1D5Y A;  1UFM A;  1UCR A;  2JPB A;  1JKQ C;  2LRE A;  3I58 A;  1JT0 A;  2BXY A;  3DP7 A;  1D0Y A;  1U3E M;  3D5L A;  2DK8 A;  5FLX Z;  2HOS A;  2VOD A;  3CJN A;  3ECO A;  4ZYD A;  2L4M A;  2KDZ A;  2CQQ A;  3H5A A;  2IGN A;  3WU1 B;  2QEN A;  3S17 J;  3N05 A;  3J7Z I;  2IVM A;  3GTO J;  2CW8 A;  3AFH A;  3GFJ A;  3SFI A;  2ZSH B;  3TO9 A;  5GTH C;  2DTZ A;  3VWB A;  1X2M A;  4B47 A;  1R49 A;  5KNL A;  5IYD J;  2QKL B;  2E71 A;  4II3 A;  2XB5 A;  4UUS B;  4ENN A;  4RAZ A;  4I09 A;  1I6X A;  1K78 B;  4CIC A;  2R0Q C;  2M7A A;  5BPI A;  1EKE A;  2QA4 I;  3I59 B;  3GEZ A;  1FP2 A;  2OBP A;  4AC0 A;  1C0W A;  4AD9 A;  2K27 A;  3VYS B;  1V5F A;  4OOI A;  4XLC A;  2MW8 A;  3CC7 I;  5HDK A;  2L3D A;  2L5Q A;  1XDU A;  2BEO A;  4AM3 A;  1YS6 A;  1MH4 A;  9ANT A;  5IP9 J;  1FOX A;  1FYM A;  1LVA A;  3WE2 A;  2JJ7 A;  1DGW Y;  3H92 A;  1NK2 P;  4CO8 A;  3QYB A;  3TOB A;  3UKG A;  2DJI A;  4UUT A;  1QRY A;  1X1B A;  3M1C A;  2YR2 A;  3OY9 A;  5FRM A;  2FE3 A;  2Q0O A;  4HAM A;  4JX5 A;  5DCM B;  1KYZ A;  3L2C A;  2YX7 A;  2HVR A;  2L02 A;  4NQW B;  3IAS 2;  3EQL F;  1JTY A;  3MFK A;  6PAX A;  4E7H A;  4XRM A;  3OOP A;  2EIM H;  2OCC H;  3FX3 A;  2V79 A;  1ODD A;  3SYT A;  1J7K A;  2P6S A;  1Q1H A;  3BJO A;  2KL4 A;  1T38 A;  2HGC A;  5IP6 A;  3OSG A;  1BR4 A;  1Y0N A;  2IJL A;  1HW5 A;  2JRT A;  5F08 A;  2NNN A;  3WGI A;  2ISZ A;  2UUZ A;  2NS7 A;  1YW7 A;  3NWT A;  2IS2 A;  1ZEL A;  2HTS A;  4Q47 A;  3MVP A;  3OYC A;  1L3L A;  3HXL A;  3GW2 A;  2VQH A;  1K4T A;  4EVI A;  3H1C A;  4MTD A;  5LD2 C;  5EDN A;  4BDZ A;  3K2Z A;  4RLF A;  1V5G A;  3FXJ A;  4YII A;  2H6B A;  3OYM A;  2E19 A;  2KIF A;  4G7H F;  5GTI C;  5E3M A;  5EG0 B;  4PJJ A;  3KZY A;  1JKO C;  2DQR A;  2TRT A;  4PUS A;  1S72 I;  5HLG A;  1WJD A;  4PJM A;  3F72 A;  4BL0 B;  3OYG A;  4AID A;  3TW7 A;  4ANJ A;  5IT9 K;  2A5Y B;  3B02 A;  2E5N A;  3KYD B;  4EJT A;  1LVK A;  3BTL A;  3JRD A;  2PI0 A;  2E2J J;  4PSX A;  3L2Q A;  1B72 A;  4L9T A;  2F4O B;  3B6C A;  5F64 A;  5HLI A;  2LDU A;  4CCL A;  2Z2S B;  2F5E A;  4Y15 A;  4QLC U;  4XLH A;  4B8X A;  1OFC X;  3CCR I;  3SZT A;  4IHS A;  4A3C J;  2HQN A;  1DP3 A;  4XOT A;  1QNT A;  4HLY A;  3JTH A;  5FJ8 J;  1R9T J;  2HKO A;  1WWX A;  1OCP A;  3I4P A;  1ETK A;  5HOO A;  1IV6 A;  3SZG A;  1K61 A;  3BTI A;  2E1O A;  1BOA A;  2CFO A;  4ZZL A;  4WCG A;  4BE1 A;  4W1U A;  1T0F C;  5J1U A;  4C30 A;  2X6W A;  2VBZ A;  4D7N A;  4V19 K;  2ZME C;  2ME0 A;  2BY1 A;  1Z3Y A;  2VJJ A;  4OIO F;  2CV2 A;  1QQI A;  4L9J A;  1D0X A;  2STW A;  4UVB A;  3V7R A;  2V7F A;  3BJ6 A;  1XTA A;  2EIJ H;  1FIA A;  2XF6 A;  2WY7 Q;  1HKQ A;  3I71 A;  2CO5 A;  1XSD A;  1ERD A;  1DU6 A;  5FKM A;  3H5N A;  1FBQ A;  4OMZ A;  1U5T B;  1AKH A;  1SC7 A;  1T33 A;  1RR7 A;  4ASN A;  2K9S A;  5F0F A;  1F1Z A;  5DD4 A;  1SFX A;  3AL0 B;  2V4J C;  4BQA A;  4L9N A;  4N4N B;  4JX4 A;  3DLL F;  3JSP A;  1IN5 A;  3BZC A;  4QTR A;  1OYW A;  2V9V A;  1IZ1 A;  2WY8 Q;  3G71 I;  5ILV A;  2P7C B;  1AOY A;  1OCR H;  2EWN A;  2VQC A;  3MCZ A;  5KAI C;  3RSN A;  2VOO A;  2FMY A;  2XVC A;  3P9K A;  2DFH A;  2K7L A;  2LVS A;  2AXT C;  5L3F A;  5K5R A;  1NG7 A;  3L2U A;  4Q4Z F;  5FFX A;  5DYM A;  1TC3 C;  3CD6 I;  2HU9 A;  2K4B A;  3G3Z A;  3IKV A;  3RTR A;  2CUJ A;  5E1Z B;  3HJE A;  5FRO A;  1KU2 A;  1E3P A;  1MJA A;  3QPT A;  4C2U A;  3GTQ J;  2W84 A;  1BM9 A;  4UB8 C;  3FBI B;  5LGN A;  5DUK A;  4Y3O A;  4CH7 A;  3DF8 A;  1KQ9 A;  3M8F A;  5ICC A;  3IV5 A;  1R1V A;  1MGT A;  1RKW A;  3BY6 A;  3ZQG A;  2DFE A;  2IS6 A;  3CDI A;  2TDX A;  4AYB A;  2AS5 F;  4EGZ A;  4LGW A;  3ZGK A;  1YW9 A;  2GA1 A;  2DMN A;  2IGO A;  3FIW A;  3HBL A;  2VB6 A;  3ZQC A;  3C2G A;  4HG2 A;  4RAF A;  3MZY A;  3CCM I;  2F5C A;  3HSE A;  1RNL A;  4BXF A;  4FAS D;  1QPI A;  1EJ9 A;  4HDU A;  4P9F A;  3LSR A;  5H6R A;  4Z2Y A;  2FF4 A;  2HOT A;  2FBH A;  3ZMU A;  1EH8 A;  1IUY A;  2HEO A;  2XKO A;  4XKC A;  3F0C A;  1R1T A;  4OIN F;  1IN6 A;  2VI6 A;  2HXI A;  1IW7 F;  4IXA A;  1I1S A;  4E4H A;  2Z9O A;  2OQR A;  3FMR A;  3QPS A;  3H9G A;  2XGD A;  1T6S A;  3E6C C;  1MMS A;  4J19 A;  2P5K A;  1Y0U A;  3QOE A;  3BDD A;  4CYD A;  4A5M A;  2L2O A;  4GO1 A;  2V9P A;  3ZOB A;  2BBY A;  4MQV A;  2ZXW H;  2Q1Z B;  3QAH A;  4RDU A;  2CJJ A;  4ENJ A;  1G59 A;  3AAF A;  2R5Y B;  2DK5 A;  2MA3 A;  2NXN B;  3FXK A;  1BI1 A;  2DPU A;  4BYY A;  4DYQ A;  1W5C C;  3UR3 C;  4UVC A;  2FML A;  1G2H A;  1SVM A;  4BJ5 C;  3DBH B;  2WAQ N;  1ZR2 A;  2PMH A;  4XLN F;  3ROU A;  2I10 A;  2MFZ A;  1GXQ A;  5D5U B;  3GFI A;  1T2K A;  2NVY J;  2G0E A;  3M8E A;  1J9I A;  2FBK A;  1QBJ A;  5GP9 A;  4FE7 A;  4BU2 A;  4DQ2 A;  1TW2 A;  4YEL A;  3EDP A;  1QZY A;  2JK3 A;  3CJQ B;  3MD2 A;  4D7M A;  4CGZ A;  3BWG A;  2KPM A;  2MG4 A;  4BHB A;  3IP4 B;  3NAR A;  2QF7 A;  3DFG A;  2Z5U A;  2MC3 A;  1TWA J;  2MD0 A;  2B63 J;  1WPK A;  4AVZ A;  3S32 A;  2LFB A;  2ID3 A;  2HDW A;  3BTJ A;  1BN5 A;  1X19 A;  3CLQ A;  3HOT A;  2E36 A;  4E7K A;  3S3M A;  2JQ7 A;  1VQ8 I;  1BIA A;  1OMI A;  4HX7 A;  1Z6T A;  4ZC3 A;  1P7J A;  1SVO A;  3DV8 A;  5EZG A;  2K4J A;  3I9V 2;  4S0H B;  3E6B A;  1PP7 U;  4CZZ A;  4XQF A;  2DXI A;  4ZYH A;  1OQY A;  1FJL A;  5D5V B;  4NB5 A;  1ZH5 A;  1DP7 P;  2XV4 S;  2BXZ A;  5JFR A;  4YIR X;  3KX2 A;  4XID A;  2OZ6 A;  3HRM A;  1BI2 A;  4YFK F;  3S3O A;  2H8R A;  4CCO A;  1X1C A;  2C6Y A;  2QQA A;  2JZY A;  2KKO A;  4CCN A;  3BTC A;  4RAY A;  5AIQ A;  2DBB A;  5L3C A;  2OD5 A;  3L2R A;  1XPX A;  3V8J A;  1LFU P;  1O7F A;  5DM7 F;  2OZU A;  3IC7 A;  1HC8 A;  1YJW I;  2VIX A;  3TL4 X;  1E3O C;  3WTT C;  4BGD A;  1R00 A;  1FEX A;  3CCE I;  3A03 A;  3TMO A;  4ZYG A;  4B3A A;  3C18 A;  4L5E A;  4KMU X;  1FIP A;  2K9M A;  1QA6 A;  5ED4 A;  2O8K A;  1ITY A;  4A3D J;  3D5S C;  4KUM A;  3GTM J;  3PO2 J;  4OIR F;  3PNT A;  1PDN C;  3OIP A;  3QOD A;  4Y7N J;  1U6G A;  1NTC A;  2D1V A;  3IH3 A;  3CCQ I;  4U0V A;  4YIF A;  1J5Y A;  2WB1 N;  2L7K A;  4U0Y A;  3HG9 A;  2IEK A;  2ZSI B;  4KFC A;  2GXG A;  2Y2Z A;  3KYL A;  2LSO A;  1LDD A;  1WFX A;  1U8R A;  1FP1 D;  1V4R A;  1W7P D;  3FHZ A;  4A3F J;  1JGS A;  2V6C A;  2R7Q A;  2H09 A;  4CYC B;  4PSW A;  3BPV A;  5LGU A;  4L18 B;  3P5J A;  4ZDL A;  2K40 A;  4OMY A;  5LHG A;  4C2M J;  2EIK H;  1G3S A;  2QKM B;  3KEO A;  1UB9 A;  3FF5 A;  5LRR A;  2LG4 A;  4MHG A;  5ICE A;  4M3G A;  5FGM A;  4KDP A;  4JX6 A;  3R4K A;  3IKT A;  1Z9C A;  3BC8 A;  2WC2 A;  4AUX A;  2LR8 A;  1YW8 A;  2L9V A;  3V7S A;  2DOD A;  5B1B H;  2E1M B;  2DN0 A;  3DEU A;  5CQE A;  2BY3 A;  2Z33 A;  1R5G A;  4ESB A;  3HC7 A;  3JAM K;  3CJT B;  3DPL C;  1A6I A;  3HRU A;  3C3W A;  2V1D A;  1R36 A;  3MAJ A;  4C3J J;  2DDB A;  5DD8 A;  3CUQ B;  3G1O A;  3L00 A;  3LFU A;  4XM3 A;  3ZR8 X;  1B8I B;  2R92 J;  3TED A;  3JCU C;  2VC0 A;  1DPR A;  3RPU D;  2DMQ A;  4NBQ A;  2JWT A;  2L9S A;  1FT9 A;  4UUS A;  1K78 A;  2RN7 A;  2ZXJ A;  1IG7 A;  4U0W A;  2LY9 A;  1S6L A;  3I59 A;  2BYV E;  4XNF A;  4HNT A;  3GYH X;  3F9K A;  4QPO A;  3KEQ A;  3K4K A;  2VPR A;  3HRT A;  2XPU A;  3GWZ A;  1IF1 A;  2FUG 2;  2O8X A;  4LLL A;  1K6O A;  2OA4 A;  2H1K A;  3G1L A;  2FU4 A;  2LNB A;  2XGC A;  1Y8Q B;  2XUB A;  4X0G A;  1FBS A;  3U9G A;  4FIS A;  2K9Q A;  2KIU A;  5KAF C;  2N8G A;  1SFK A;  1UST A;  3GZ5 A;  2QZ8 A;  3TBI A;  3BQZ A;  2A61 A;  1VQ7 I;  3LSK A;  4KIB A;  4GDF A;  1YHQ I;  3BR3 A;  1XS9 A;  4LB6 B;  5DCM A;  4YRV A;  4F3Q A;  1P7I A;  3H36 A;  3ZMD A;  3FDY A;  2EA2 A;  4NQW A;  3ECH A;  1OCO H;  2CFX A;  3F8C A;  3HKZ N;  4PGG A;  4BJ6 C;  1R7J A;  3O2P E;  4AYB N;  3U2R A;  4IQJ A;  2CSO A;  2LLK A;  5J8F A;  4RB1 A;  2W85 A;  1VTN C;  4KN4 X;  4CCK A;  4YFX F;  1ZLK A;  1KQ8 A;  4K2E A;  3P7N A;  5EEA A;  5C3E J;  2A6E F;  1YG2 A;  1MKM A;  1ZYR F;  1WJA A;  1FSE A;  1FTT A;  3I4N J;  4PDK A;  3WTY C;  4EM1 A;  2LD5 A;  2FD5 A;  2VKD A;  3H0G J;  2WAD A;  4HQM A;  4WF2 A;  1HOM A;  5J40 A;  2VBW A;  4L5I A;  3TO6 A;  2ACJ A;  2CW0 F;  1MMG A;  2HQR A;  4MEX F;  2DFI A;  5DS9 A;  2HYJ A;  3GTG J;  3J7A Y;  1J2X A;  3H5R A;  2P0W A;  4BQN A;  1FOK A;  4UXN A;  2VXZ A;  1P9Q C;  2LY2 A;  2V1U A;  2EIN H;  3BR1 A;  1VQL I;  2PJR B;  3H3Z A;  4M6Y A;  3ABM H;  3S1M J;  1TNT A;  1NK3 P;  3WTU C;  4A3K J;  2FNP A;  2QQ9 A;  1P2F A;  4I76 A;  5EG0 A;  3DXJ F;  1TLH B;  1SVL A;  5B66 C;  1S9H A;  3JSO A;  2R7F A;  2EFQ A;  2MBF A;  5B5E C;  4XIC A;  3W6V A;  1GV5 A;  3AG1 H;  1K6Y A;  4XRS G;  2FXA A;  5M5W J;  2CG4 A;  3JRH A;  2R7R A;  1Z91 A;  2DPD A;  4FX0 A;  2DFF A;  4JOM A;  1IRF A;  3PL8 A;  3GFL A;  3RYR A;  3WTX C;  2PJP A;  1FY7 A;  4N0B A;  3MZ8 A;  4NUB A;  3S14 J;  4KIG A;  3QWL A;  5D4S A;  3KLO A;  2UV1 A;  1Z0X A;  4HEA 2;  5EYR A;  2DA2 A;  1YE9 A;  2ZBK A;  3K6G A;  5D4R A;  2X1D A;  2DAO A;  4JYK A;  3S8P A;  1YIO A;  3HOW J;  2FQ3 A;  1FZP B;  3KP6 A;  4LB5 A;  3KE2 A;  4M3B A;  3GF2 A;  3CF5 F;  4LMY A;  4ETS A;  5BPD A;  2O5R A;  3WHB A;  3MN2 A;  2GOM A;  3HGY A;  1HLV A;  3WU0 A;  2ADU A;  5HDG A;  5JHU A;  1XG1 A;  1R71 A;  3IAM 2;  2DA4 A;  2KRC A;  1A36 A;  4A2U A;  5B3S H;  4EMS A;  1G3T A;  2BE5 F;  2FJ1 A;  4P5O A;  3T8R A;  5DV5 A;  3M1E A;  2QVO A;  4PJN A;  5JLW A;  1A04 A;  4E7Z A;  4BAY A;  3L2V A;  3PM1 A;  2CH0 A;  3W3C A;  1HW2 A;  2CRG A;  2RNJ A;  3HDD A;  3S3N A;  2R7W A;  1J0R A;  3J80 K;  3FXL A;  3Q0V A;  3CME I;  3S1N J;  2ZXH A;  4RGU A;  1GHC A;  4AWX B;  1APL C;  4MEY F;  5FRN A;  2MSY A;  1KU7 A;  5DCF A;  1LNW A;  1PJR A;  1IO2 A;  2HI3 A;  4FCY A;  4AIH A;  3K10 A;  1U5T A;  2QWW A;  4G6D A;  3TP3 A;  2UXN A;  5FLM J;  2L9R A;  2IW5 A;  4U7B A;  5FD5 A;  2Y75 A;  2FRH A;  4XON A;  4IHT A;  3BR5 A;  2VL8 A;  2FOW A;  3WU2 C;  2R7T A;  3J81 Z;  1EH7 A;  2KJC A;  4DJA A;  5HVQ C;  4OIQ F;  4G6T B;  2LRD A;  4N9H A;  2XSD C;  1PUF B;  1J59 A;  2M1B A;  1BI3 A;  4G12 A;  4A0Z A;  2Y48 A;  2A5W A;  2O7O A;  2VXD A;  4M74 A;  4M73 A;  1YFH A;  1AWC A;  3ASN H;  1I39 A;  1ZLJ A;  3ZPL A;  2ECB A;  3OL4 A;  5EGO B;  3PIO F;  1WZ2 A;  2HDD A;  5LGT A;  2VON A;  1ETV A;  3FXM A;  4HV5 A;  3L1P A;  4B44 A;  2AQF A;  4KIS A;  2DMT A;  3K70 C;  1Y1V J;  1T56 A;  3IRR A;  3BRO A;  2XGX A;  4EJW A;  1ETX A;  1QHH D;  4HOB A;  4I99 C;  1UHM A;  2PQ8 A;  2DA5 A;  4UV9 A;  2A05 A;  4B3X A;  2JSC A;  1FX7 A;  2DOE A;  3DU6 A;  3EUH A;  2R7X A;  4AU7 A;  1R4N B;  4ON0 A;  1SD6 A;  1J09 A;  2WAQ A;  2XGE A;  2K5C A;  2BHZ A;  1MSE C;  1I5Z A;  5JLX A;  3VB2 A;  2W7N A;  2XAH A;  3A02 A;  3DTE A;  1JGG A;  2KQR A;  1U9O A;  1XX5 A;  1Z77 A;  1X1P A;  3KFW X;  4XOR A;  2M34 A;  4KNY A;  3HTS B;  2CQX A;  4IZZ A;  4X6A J;  1IDZ A;  5AON A;  2GOX B;  1FOY A;  4D5F A;  1Q1V A;  1D1B A;  3Q0U A;  1E17 A;  4XBF A;  1BIB A;  3OYH A;  1QZE A;  4HRI A;  2O03 A;  2EFO A;  1JE8 A;  3S2D J;  2RAE A;  3MKZ A;  1OPC A;  3AG4 H;  1A5J A;  2EH3 A;  4HPQ A;  2QEX I;  1X2N A;  1I3Q J;  5AIP A;  4I02 A;  5F27 A;  2STT A;  4S04 A;  4XLP F;  2R5Y A;  1MJ9 A;  3OYB A;  2FSW A; 
#chains in the Genus database with same CATH homology
 1XGS A;  4CDG A;  2YSR A;  1XD7 A;  4D0P A;  2Y0M A;  3GO5 A;  3S2W A;  1Z1D A;  2GWR A;  3TGN A;  5E20 A;  1ZRF A;  4A0X A;  3VEP A;  3T5X A;  1ZAR A;  5HDN A;  4ZZD A;  3SHF A;  4PCQ A;  2A6H F;  2GQQ A;  1JHF A;  3VOE A;  3QU6 A;  1FPQ A;  1D8K A;  2P5L C;  2PLY A;  2IT0 A;  2UWM A;  3ABU A;  5LLQ A;  3LQR A;  2MLK A;  3TQN A;  4EGY A;  2MH2 A;  2VE9 A;  1F4K A;  3EYI A;  1R22 A;  3J80 Z;  1G4D A;  3RIR A;  1BI0 A;  4U88 A;  5ICG A;  5A2Q Z;  4PGH A;  1F5T A;  2RC4 A;  1BJA A;  4UNO A;  4YG2 F;  5LEJ A;  2KRF A;  3W6K B;  3QRF F;  3E6D A;  4GYG A;  3LAP A;  2RKH A;  5FFZ A;  1FWZ A;  4U7D A;  1I1G A;  5E8I A;  2EA4 A;  4XSX F;  1OKR A;  1BC7 C;  2GZW A;  2QLZ A;  1W7P B;  4IRI A;  2ELH A;  1TW3 A;  5DDG A;  3DQV C;  1XCB A;  4BHC A;  2LF8 A;  4TV7 A;  4IRH A;  2P5V A;  4ESJ A;  3QOP A;  3ISP A;  2M45 A;  2X4H A;  3KP3 A;  4HBL A;  4KT5 C;  1HQC A;  1ZAO A;  5EEG A;  1P4X A;  3LWF A;  5DEQ A;  5JR3 A;  1X3U A;  1RZ4 A;  5CVJ A;  4NHJ A;  2VBX A;  1FNN A;  4RGX A;  3HHH A;  1ZGA A;  1H9G A;  4EJU A;  4YFN F;  5LHH A;  2F2E A;  3CLO A;  5HS8 A;  4KIF A;  4P96 A;  4R79 A;  4O3M A;  5E18 F;  1XDS A;  3CUQ A;  1XMK A;  2HDC A;  3E3V A;  4ESF A;  3NRV A;  2FNA A;  3QP6 A;  1G3Y A;  2R3S A;  1YYV A;  2RVC A;  4L0Z B;  2G7H A;  2H94 A;  2HOE A;  4WK8 F;  3EET A;  3IWZ A;  4GCV A;  5TRD A;  3I5U A;  4MNU A;  2HTJ A;  3K0L A;  3ZN1 A;  4ZYE A;  3TDU C;  2HKX A;  4HYE A;  4MTE A;  1B6A A;  4G8X A;  5D6E A;  2D45 A;  5D8K B;  4M6X A;  1W5S A;  2L54 A;  2M87 A;  1L0O C;  1TTY A;  1IN7 A;  3WTW C;  5IT9 Z;  2ISY A;  2AXL A;  1I27 A;  1MDM B;  1KQ0 A;  2QUF A;  1SFU A;  2EJR A;  1STZ A;  2O61 A;  2HYF A;  2JT1 A;  1WI9 A;  1H0M A;  3RKY A;  3FM5 A;  3MQ0 A;  3FXQ A;  1YLF A;  2ZO4 A;  3FMQ A;  1Z05 A;  4PZJ A;  3RKX A;  3N97 A;  2IP2 A;  2XAJ A;  3ZQ7 A;  5E8G A;  2E7W A;  5CVI A;  2F5D A;  3CTA A;  3QPH A;  4R1H A;  5CJ9 A;  4AIJ A;  1GVJ A;  5BQT A;  3GFM A;  5FB2 A;  4KN7 X;  3WOD F;  1S3J A;  1O3R A;  3ZMZ A;  2HWV A;  2LKP A;  5L3B A;  2J5O A;  3KET A;  4P9U A;  1SMT A;  3SZP A;  2L01 A;  2RDP A;  3F22 A;  2DLL A;  3CUO A;  4HQE A;  2FOK A;  1QPM A;  2GA2 A;  4HA8 A;  1LB2 A;  1B4A A;  1ZRD A;  3MEX A;  3W6J B;  4JK1 X;  2DW4 A;  4HX8 A;  4IVN A;  3F8B A;  4KA4 A;  2M30 A;  3N4M A;  2VT2 A;  1OR7 A;  1D5V A;  2K02 A;  4I01 A;  4JBA A;  3V8L A;  3GX4 X;  4P55 A;  5JI6 A;  2FEZ A;  1B59 A;  3HOS A;  2MD5 A;  3LA7 A;  3F23 A;  4A6D A;  1ULY A;  4LD5 A;  2G7U A;  3K1M A;  4E70 A;  3T0Y A;  4FT8 A;  3F21 A;  1XSX A;  1SD7 A;  4KYW A;  2A69 F;  1WKM A;  3L09 A;  3KZZ A;  3M9A A;  5CVV A;  3BJA A;  5E1W A;  4HZF A;  1YS7 A;  4GGG A;  2VN2 A;  5ICF A;  4RB0 A;  4H0E A;  3IRQ A;  4M9Z A;  1USS A;  2XAQ A;  3KP5 A;  4OIP F;  1ZRE A;  2Q8K A;  1P4W A;  3E6M A;  2OQG A;  2V1X A;  1Z7U A;  2HS5 A;  1U78 A;  2ZKZ A;  1TQI A;  3ZN0 A;  4LJZ F;  3J7A O;  3HRS A;  4AVP A;  1DDN A;  3Q5F A;  3HSF A;  4RB3 C;  1U5T C;  2ZME B;  4M72 A;  2WTE A;  4IJA A;  3ABT A;  4O5V A;  5CLS A;  3RYP A;  1K7A A;  1IXR C;  1ZRC A;  3GVA A;  1P6R A;  1LQ1 A;  2M5W A;  2NRA C;  2HZT A;  4HV6 A;  4I0A A;  3LAJ A;  4EJV A;  2KIM A;  3T8T A;  5K1Y A;  2B0L A;  5D6F A;  1KU3 A;  4F7Z A;  3KCC A;  5D5W B;  3C7J A;  4GXO A;  2EV6 A;  5H6Q A;  4A0Y A;  4RGR A;  1HW1 A;  5L3E A;  1BC8 C;  1IXC A;  1RI7 A;  1XMA A;  2KJB A;  2E1N A;  4EM2 A;  2XAF A;  2ZFW A;  1YQA A;  2ESH A;  4XSZ F;  2XIG A;  5H20 A;  2P4W A;  3DPT A;  2DTR A;  1CF7 B;  3TOA A;  3NQO A;  1GXP A;  3C1D A;  1IN4 A;  4R8H A;  3JAM Z;  3ZMS A;  3K69 A;  1WQ2 A;  1TQM A;  1S7O A;  1W7P A;  1SMY F;  2WWY A;  2VT3 A;  4CXF A;  1ONV A;  2UXX A;  4Q5S F;  2Z3Y A;  4BH9 A;  5BMZ A;  1XB4 A;  1K79 A;  2DT5 A;  2F5F A;  2LF7 A;  1DPU A;  1ZG3 A;  2RQP A;  4MQ9 F;  2ESN A;  2P8T A;  3QU3 A;  2ETH A;  2MH9 A;  2PBI A;  4Y13 A;  3JW4 A;  1S7A A;  1HBX G;  4L5J A;  1D3Y A;  3RPU A;  4EV0 A;  1HKS A;  2GAU A;  2R7D A;  5ILU A;  3SQN A;  1ON1 A;  5KK1 A;  1OYI A;  3SXY A;  1O3Q A;  4WXD A;  1F9N A;  4I98 B;  1QGP A;  3VFZ A;  1FYK A;  1FYL A;  1QZZ A;  1FSH A;  2RGV A;  1XN7 A;  1MZB A;  5CVU A;  2Q2E A;  2JPC A;  2J5P A;  3TDZ C;  2K86 A;  2OAZ A;  4IRG A;  2EB7 A;  2FBI A;  2FA5 A;  1MDM A;  5LRS A;  2BGC A;  4LLG F;  2CYY A;  3L9F A;  1QO0 D;  2YU3 A;  1Z6R A;  3F8F A;  3PFI A;  5JVT A;  2ZNY A;  1JHH A;  3FMS A;  3JTG A;  2HR3 A;  1XCV A;  2RV8 A;  4QWQ A;  3ERE D;  1P4A A;  3BZ6 A;  2WV0 A;  4UV8 A;  3ZMT A;  2IRF G;  1ZN2 A;  5LEK A;  3CUQ C;  4RGS A;  4EJO A;  4FHT A;  4EM0 B;  3ML6 A;  1EV7 A;  4EQQ A;  2QBY B;  2L4A A;  2E7X A;  3HIF A;  4A5N A;  4WXC A;  4BNC A;  5CYV A;  1ZG5 A;  2QM3 A;  4OU0 A;  1BBY A;  2D1H A;  1WRJ A;  3FWE A;  1RUN A;  1ZHF A;  2DQL A;  3R61 A;  3MZH A;  5DUI A;  5KVR A;  4M71 A;  4LG0 B;  3WTZ A;  3E5U A;  2PN6 A;  1E2X A;  3OV8 A;  1HXD A;  5ILS A;  1HKT A;  1REP C;  2A07 F;  2W57 A;  1LEB A;  2QYO A;  5TJJ A;  5EEH A;  2DI3 A;  1JXS A;  1G6N A;  1TNS A;  2EK5 A;  3FM3 A;  2XRO A;  2XHK A;  5F1R A;  4ENK A;  3RI4 A;  1ON2 A;  3QP5 A;  4L0Y B;  3IWF A;  4RB2 C;  2A68 F;  2W25 A;  3R6S A;  2XAG A;  3P9C A;  4N9I A;  1MJB A;  1LDK B;  2EV0 A;  5BOX A;  4M9S A;  3WTV C;  3R0J A;  3F8N A;  4UVA A;  3I0T A;  4RS8 A;  3D0S A;  1O3S A;  3ULQ B;  2H27 A;  5F6F A;  4LK1 F;  3EYY A;  3GZ6 A;  3K1P A;  3IL2 A;  1O57 A;  2YX4 A;  1R23 A;  3KP7 A;  2E1C A;  2CQK A;  4I7H A;  1XGN A;  5D8L B;  3H3U A;  1RUO A;  1J75 A;  4UHT A;  1PP8 F;  3TO7 A;  3P9I A;  1WSU A;  5FD6 A;  3WGH A;  1UHW A;  1IN8 A;  3Q9S A;  4FX4 A;  3DKW A;  3GLX A;  2JTV A;  2BV6 A;  3F6V A;  1KA8 A;  2NYX A;  2EV5 A;  4DNC A;  4CHU A;  3V4G A;  2EFW A;  2IPQ X;  1T0F A;  1D8J A;  2IA2 A;  2ZME A;  1EH6 A;  2VBY A;  3PQK A;  1H9T A;  1S29 A;  3ELK A;  3ZP5 A;  3RDI A;  4WXH A;  1P92 A;  1SD5 A;  5LHI A;  1TQP A;  4I2O A;  4G94 A;  2VE8 A;  1IXS B;  3GUD A;  2EFN A;  1TBX A;  2EFP A;  3FXR A;  3RJP A;  1FC3 A;  2O6G E;  1DUX C;  2MLG A;  3WE3 A;  4WWC A;  1YTY A;  4A12 A;  3HSR A;  2HFH A;  3V8K A;  1G3W A;  1W5T A;  3TKY A;  2X0L A;  3E97 A;  5E17 F;  4AIK A;  1MD0 A;  5J6X A;  3R60 A;  1SFE A;  2UZK A;  2ZNZ A;  4JQF A;  4Q48 A;  4UUV A;  3K9T A;  3COA C;  1R5H A;  3BOQ A;  5FO5 A;  1XGM A;  4A6E A;  4B09 A;  1R1U A;  4BXU A;  3KLN A;  5L3D A;  3LA3 A;  3GXO A;  4HF0 A;  4ENM A;  3V7C A;  1CF7 A;  4ZH4 F;  1RIO H;  3B73 A;  3RKW A;  4HDV A;  1FBU A;  5K5O A;  2ZJ2 A;  3L7W A;  3REO A;  3HYI A;  3FXU A;  4KMF A;  1IAW A;  1B9M A;  2PEX A;  2CWE A;  2COM A;  1O3T A;  4LK0 F;  3HHG A;  3I54 A;  3Q9V A;  1SAX A;  3WTS C;  4KIC A;  2ZCW A;  3R0A A;  3KP4 A;  3FZV A;  3LFK A;  1KGS A;  3F3X A;  1PUE E;  2NAZ A;  1B1B A;  2G9W A;  4I0B A;  3U1D A;  4O6J A;  3MWM A;  2Z99 A;  3PQJ A;  4BHP A;  2OU2 A;  3VOD A;  5HLH A;  2D2W A;  1ZG1 A;  3F8M A;  5J8C A;  3CO6 C;  2XKP A;  2M8E A;  2P7V B;  2YPR A;  1IRG A;  2O0Y A;  5FLX K;  3J81 K;  3LQQ A;  3K1N A;  3BPX A;  3HUG A;  2VC1 A;  4HF2 A;  5K5Q A;  2P6T A;  2GIV A;  3O6B B;  2GXB A;  1O7L A;  2PMU A;  1ZGJ A;  4LLN A;  2H6C A;  3I53 A;  3E5X A;  5LBQ A;  5BS6 A;  1W4M A;  5D5X B;  1XSV A;  4HX4 A;  4HW0 A;  4Y17 A;  2O3F A;  3G73 A;  2DU9 A;  5HS7 A;  1CGP A;  1FLI A;  2XRN A;  4G7Z F;  1NHA A;  1LJ9 A;  1XGO A;  2QQB A;  3BP8 A;  4LFU A;  2PFB A;  1S8N A;  4MGR A;  1YO5 C;  3SFZ A;  1LEA A;  1SD4 A;  2NNY A;  3HTU A;  2W24 A;  1B9N A;  3LA2 A;  3KP2 A;  4HF1 A;  5CVR A;  2QBY A;  4G7O F;  4M9X A;  3WGG A;  5L3G A;  2VOP A;  1V3F A;  3CO7 C;  3RPQ A;  3O3K A;  1HST A;  2DO7 A;  3M7G A;  3LST A;  1R58 A;  3CDH A;  5E1X A;  5ERI A;  1HSJ A;  4LG0 A;  4G9Y A;  4G6Q A;  5HS9 A;  4XRF A;  4S05 A;  2CGP A;  3E5Q A;  2IA0 A;  4IPA A;  3IHU A;  4L9V A;  2HYG D;  1KYW A;  4GYI A;  1OYY A;  2A3S A;  2PG4 A;  1T98 A;  3I64 A;  3NEU A;  4WX9 A;  1KU9 A;  4IF4 A;  5IT3 A;  1LDJ A;  2IA1 A;  1U2W A;  3T1B A;  2NS0 A;  1T39 A;  4HLX A;  3ZMV A;  5A2Q K;  3F6O A;  2XAS A;  3WG9 A;  1UFM A;  1UCR A;  2JPB A;  3I58 A;  3DP7 A;  1U3E M;  3D5L A;  2DK8 A;  5FLX Z;  2VOD A;  3CJN A;  3ECO A;  4ZYD A;  2L4M A;  3WU1 B;  2QEN A;  2IVM A;  3GFJ A;  3TO9 A;  4ENN A;  1K78 B;  4RAZ A;  4I09 A;  1I6X A;  4CIC A;  5BPI A;  3I59 B;  3GEZ A;  1FP2 A;  2OBP A;  1C0W A;  4AD9 A;  2K27 A;  4OOI A;  5HDK A;  2L3D A;  1XDU A;  2BEO A;  1YS6 A;  1FYM A;  1LVA A;  3WE2 A;  3H92 A;  4CO8 A;  3TOB A;  2YR2 A;  2FE3 A;  2Q0O A;  4HAM A;  5DCM B;  1KYZ A;  3L2C A;  2YX7 A;  2L02 A;  3EQL F;  3MFK A;  6PAX A;  3OOP A;  3FX3 A;  2V79 A;  1ODD A;  1J7K A;  2P6S A;  1Q1H A;  3BJO A;  1T38 A;  2HGC A;  2IJL A;  1HW5 A;  2JRT A;  2NNN A;  3WGI A;  2ISZ A;  1YW7 A;  2HTS A;  4Q47 A;  1L3L A;  3GW2 A;  4EVI A;  4MTD A;  3K2Z A;  4YII A;  2H6B A;  4G7H F;  2KIF A;  3KZY A;  2DQR A;  5HLG A;  3F72 A;  5IT9 K;  2A5Y B;  3B02 A;  4EJT A;  2PI0 A;  4L9T A;  5F64 A;  5HLI A;  2LDU A;  2F5E A;  4Y15 A;  4QLC U;  4B8X A;  3SZT A;  4IHS A;  2HQN A;  1QNT A;  4HLY A;  3JTH A;  2HKO A;  1WWX A;  3I4P A;  5HOO A;  1BOA A;  4ZZL A;  4WCG A;  2VBZ A;  4OIO F;  1QQI A;  4L9J A;  2STW A;  4UVB A;  3V7R A;  3BJ6 A;  1HKQ A;  3I71 A;  2CO5 A;  1XSD A;  1FBQ A;  4OMZ A;  1U5T B;  4ASN A;  1F1Z A;  5DD4 A;  1SFX A;  4BQA A;  4L9N A;  3JSP A;  1IN5 A;  1OYW A;  2V9V A;  1IZ1 A;  5ILV A;  2P7C B;  1AOY A;  2EWN A;  3MCZ A;  2VOO A;  2FMY A;  2XVC A;  3P9K A;  2K7L A;  5L3F A;  5K5R A;  4Q4Z F;  5FFX A;  5DYM A;  2K4B A;  3G3Z A;  3IKV A;  3RTR A;  5E1Z B;  1KU2 A;  1MJA A;  3QPT A;  2W84 A;  1BM9 A;  5LGN A;  5DUK A;  3DF8 A;  1KQ9 A;  3M8F A;  5ICC A;  1R1V A;  1MGT A;  3BY6 A;  2TDX A;  2AS5 F;  4EGZ A;  4LGW A;  1YW9 A;  2GA1 A;  3MZY A;  2F5C A;  3HSE A;  1RNL A;  4HDU A;  4P9F A;  5H6R A;  4Z2Y A;  2FF4 A;  2FBH A;  3ZMU A;  1EH8 A;  1IUY A;  2HEO A;  2XKO A;  1R1T A;  4OIN F;  1IN6 A;  1IW7 F;  4IXA A;  1I1S A;  2Z9O A;  2OQR A;  3FMR A;  1T6S A;  3E6C C;  2P5K A;  1Y0U A;  3BDD A;  4CYD A;  4A5M A;  4GO1 A;  2BBY A;  4MQV A;  3QAH A;  4ENJ A;  3AAF A;  2DK5 A;  2MA3 A;  1BI1 A;  2DPU A;  4BYY A;  4UVC A;  2FML A;  2PMH A;  4XLN F;  3ROU A;  1GXQ A;  5D5U B;  3GFI A;  1T2K A;  3M8E A;  1J9I A;  2FBK A;  1QBJ A;  4DQ2 A;  1TW2 A;  3EDP A;  1QZY A;  4CGZ A;  3BWG A;  4BHB A;  3DFG A;  2Z5U A;  2MC3 A;  1BN5 A;  3HOT A;  1BIA A;  1OMI A;  4HX7 A;  1Z6T A;  3DV8 A;  2K4J A;  3E6B A;  1PP7 U;  4CZZ A;  4ZYH A;  5D5V B;  4NB5 A;  1ZH5 A;  1DP7 P;  2XV4 S;  5JFR A;  2OZ6 A;  3HRM A;  1BI2 A;  4YFK F;  2C6Y A;  2QQA A;  2JZY A;  2KKO A;  4RAY A;  5AIQ A;  2DBB A;  5L3C A;  2OD5 A;  3V8J A;  1O7F A;  2OZU A;  3IC7 A;  3WTT C;  1R00 A;  4ZYG A;  3C18 A;  4KMU X;  5ED4 A;  4KUM A;  4OIR F;  1PDN C;  1U6G A;  2D1V A;  4U0V A;  4YIF A;  1J5Y A;  4U0Y A;  4KFC A;  2GXG A;  2LSO A;  1LDD A;  1U8R A;  1FP1 D;  1V4R A;  1W7P D;  3FHZ A;  1JGS A;  2V6C A;  2H09 A;  4L18 B;  3BPV A;  5LGU A;  4OMY A;  5LHG A;  1G3S A;  3KEO A;  1UB9 A;  3FF5 A;  5LRR A;  4MHG A;  5ICE A;  5FGM A;  4KDP A;  3R4K A;  3IKT A;  1Z9C A;  2WC2 A;  1YW8 A;  3V7S A;  3DEU A;  2Z33 A;  1R5G A;  4ESB A;  3JAM K;  3DPL C;  3HRU A;  3C3W A;  2V1D A;  1R36 A;  3MAJ A;  5DD8 A;  3CUQ B;  3L00 A;  2VC0 A;  1DPR A;  1K78 A;  1FT9 A;  2RN7 A;  2ZXJ A;  4U0W A;  1S6L A;  3I59 A;  2BYV E;  3GYH X;  3KEQ A;  3HRT A;  3GWZ A;  1IF1 A;  2O8X A;  4LLL A;  1K6O A;  2OA4 A;  2FU4 A;  2LNB A;  2XUB A;  1FBS A;  3U9G A;  2KIU A;  3GZ5 A;  1UST A;  2QZ8 A;  2A61 A;  4KIB A;  4LB6 B;  5DCM A;  3ZMD A;  2EA2 A;  4NQW A;  3ECH A;  2CFX A;  3F8C A;  4PGG A;  1R7J A;  3O2P E;  3U2R A;  2CSO A;  5J8F A;  4RB1 A;  2W85 A;  1VTN C;  4KN4 X;  4YFX F;  1ZLK A;  1KQ8 A;  4K2E A;  3P7N A;  2A6E F;  1YG2 A;  1MKM A;  1ZYR F;  1FSE A;  4PDK A;  3WTY C;  4EM1 A;  4HQM A;  4WF2 A;  2ACJ A;  2VBW A;  4L5I A;  3TO6 A;  4MEX F;  2CW0 F;  2HQR A;  2DFI A;  1J2X A;  1FOK A;  4UXN A;  2VXZ A;  2V1U A;  3H3Z A;  4M6Y A;  1TNT A;  3WTU C;  2FNP A;  2QQ9 A;  1P2F A;  3DXJ F;  1TLH B;  3JSO A;  2R7F A;  2EFQ A;  2MBF A;  2FXA A;  2CG4 A;  1Z91 A;  2DPD A;  4FX0 A;  1IRF A;  3GFL A;  3RYR A;  3WTX C;  2PJP A;  1FY7 A;  4N0B A;  4KIG A;  5D4S A;  3KLO A;  2ZBK A;  5D4R A;  2DAO A;  1YIO A;  2FQ3 A;  1FZP B;  3KP6 A;  4LB5 A;  3KE2 A;  3GF2 A;  4LMY A;  4ETS A;  5BPD A;  3WU0 A;  2ADU A;  5HDG A;  5JHU A;  4A2U A;  4EMS A;  1G3T A;  2BE5 F;  4P5O A;  3T8R A;  5DV5 A;  3M1E A;  2QVO A;  1A04 A;  4BAY A;  1HW2 A;  2RNJ A;  1J0R A;  3J80 K;  1GHC A;  4RGU A;  4AWX B;  4MEY F;  1KU7 A;  5DCF A;  1LNW A;  4AIH A;  1U5T A;  2QWW A;  4G6D A;  2UXN A;  2IW5 A;  4U7B A;  5FD5 A;  2Y75 A;  2FRH A;  4IHT A;  3J81 Z;  1EH7 A;  2KJC A;  5HVQ C;  4OIQ F;  4N9H A;  1J59 A;  2M1B A;  1BI3 A;  4A0Z A;  2Y48 A;  4M74 A;  4M73 A;  1YFH A;  1AWC A;  1ZLJ A;  3ZPL A;  5LGT A;  2VON A;  4HV5 A;  3IRR A;  3BRO A;  2XGX A;  4EJW A;  4HOB A;  1UHM A;  2PQ8 A;  4UV9 A;  2JSC A;  1FX7 A;  3EUH A;  4ON0 A;  1SD6 A;  1I5Z A;  3VB2 A;  2XAH A;  3KFW X;  4KNY A;  3HTS B;  5AON A;  1E17 A;  4XBF A;  1BIB A;  2O03 A;  2EFO A;  1JE8 A;  1OPC A;  5AIP A;  4I02 A;  2STT A;  4S04 A;  4XLP F;  1MJ9 A;  2FSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...