4A3LJ

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3lJ00
2HYJA 1DU6A 1OJLA 2L9RA 1JUSA 4MFEA 4XIDA 2HOAA 2CJJA 4IHYA 3BR0A 4M3EA 5M5YJ 2Y0SN 1Z77A 3BT9A 2OF7A 4FE4A 1H8AC 1BW6A 3CMYA 3S16J 2LD5A 2IEKA 3M4OJ 4M3FA 1XC5A 2CQQA 1TWAJ 1X58A 3Q0WA 3FISA 3HOZJ 1EF4A 4MLOA 5FLMJ 1OFCX 1VF9A 1XS9A 2DA7A 2NS7A 1RPWA 3Q0VA 5FKLA 4V2FA 3NARA 1MNMC 2JWTA 1ITYA 2K9QA 1POGA 3L1PA 3S2DJ 2DJNA 1YRNA 3FKIJ 2HOTA 1MH4A 1PUFB 1NK3P 4A3CJ 3QPSA 3CQZJ 5IYCJ 3JRAA 3HOWJ 5IP9J 1ETQA 5EZHA 2KDZA 2WAQN 1OCPA 4JYKA 1NK2P 1JKQC 1IDYA 5IOZA 2L0KA 4A3EJ 5F27A 5J1YA 1ENHA 3IV5A 1S7EA 2OPTA 1ZGWA 2YUSA 4L5EA 1F36A 1ORKA 2PMZN 5HODA 1JJ8C 4JX6A 2R5YB 3GTOJ 3BG5A 1LE8B 1AU7A 3A02A 1GV5A 2FJ1A 3QPLA 2QCOA 2Y30A 1Y1WJ 2IBDA 5F1JA 3WHCA 3A01B 3BR5A 3K7AJ 2I10A 2XGEA 1RKTA 2R0QC 4A3IJ 2M8GX 4W97A 4FE7A 3BTCA 3JRGA 5FKMA 3S1NJ 4M6VA 2VPRA 2LVSA 4XRSG 3UKGA 5E3LA 2NOGA 1AKHB 1MBJA 2L7FP 2GM4A 3BTLA 2ID6A 3VPRA 2XPVA 3HGGA 3FK7A 1JUMA 3TW7A 2YU9J 2JA6J 4MO7A 4G12A 2R7ZJ 4Y52J 2H1KA 4RDUA 1R9TJ 2XB5A 5J3LA 3B6AA 4HNVA 2DA2A 1PUFA 3FIWA 5C3EJ 5FKKA 1K83J 5FKOA 4W1UA 5JLWA 3JRBA 2X9DA 2HOSA 3GTGJ 9ANTA 1TC3C 2VKVA 2CUFA 5GPAA 3ZQLA 2DA1A 2DMQA 3ZQCA 3JRFA 1LFBA 2NVQJ 1OCTC 4GFBA 2M0CA 4C2MJ 1O4XA 2G0EA 2O7OA 1RR7A 4DYCA 3TEDA 1TWHJ 1W0TA 5FLVA 3GTPJ 3ZQHA 2R5YA 5DS9A 1HOMA 3OSGA 2ID3A 2Y31A 1LE8A 3GTMJ 5F0HA 4IEJA 1BW5A 4C3JJ 5EEAA 2E2IJ 3FK6A 3SFIA 2HQ5A 2HDDA 2YS9A 1MSEC 4B1RA 3HOUJ 1B72B 2VI6A 4S0HB 4LOCA 1FEXA 3A01A 3SDGA 2R92J 1T33A 1RKWA 3JRHA 1IG7A 1MBKA 2FD5A 3JRDA 1GT0C 3RKQA 2Y9YA 3D1NI 1HF0A 4FTHA 2O9LA 3S14J 3RZOJ 1GVDA 3LSGA 4DZPA 4MIMA 5EGOB 1I50J 4BKXA 5E3NA 3HEFA 1WH7A 2Y9ZA 2H8RA 1AKHA 3LSJA 3BR1A 2ECBA 4D7MA 3O8HA 4XICA 5C4XJ 2HXOA 3G1LA 4FISA 2CU7A 1ZQ3P 1U8BA 3TP0A 2E19A 2VUMJ 5F04A 4DZJA 5C44J 3LOCA 2EBIA 3DEWA 4X1EA 4AYBN 3BR6A 3CDLA 3OSFA 2MGQA 3BG3A 1JKRC 5C4JJ 2ELKA 5EZGA 2ZB9A 4FCYA 5M5XJ 2DMUA 2DMTA 3HBLA 4V2GA 1IDZA 1ETXA 1ZK8A 1Q1VA 4XRMA 3GTLJ 3K2AA 3HOYJ 2R93J 3MVPA 3ZQFA 4A3MJ 4UUSB 1HDPA 3SJMA 1H88C 4XK4A 1WPKA 3PM1A 3ZQGA 2E2HJ 2KT0A 4A3LJ 2DTZA 1IGNA 5GPCA 1QVUA 1T56A 4CYCB 2EZHA 2TRTA 3Q3SA 1HLVA 1RETA 1P7JA 1ZR4A 1BJZA 1WI3A 2N8GA 2QF7A 5F0FA 4D5CA 1UMQA 1TWCJ 1B72A 2L7ZA 5F0CA 5EDNA 4D7NA 1ETWA 4BXXJ 4A69C 3MN2A 1E3OC 3LSPA 2GBYA 2JJ7A 2ECCA 2DA6A 2HI3A 2LR8A 1K61A 1IRZA 4A3KJ 5EF6A 1MBFA 4RBOA 1A5JA 2VKEA 2ME0A 5EGOA 1IJWC 2O8KA 1U78A 1DU0A 1QRYA 2LP0A 2LY9A 3ZOBA 2R5ZB 1MBHA 1HDDC 2JN6A 3S1RJ 4IHVA 3HOVJ 1H89C 4AC0A 3S1MJ 1UG2A 5J1RA 3S15J 4M3DA 2XPUA 5IPAA 2FQ4A 5DTDA 2X6OA 1JTYA 5EG0A 1B8IB 1UHSA 3IH4A 3DCFA 5M3MJ 3PO3J 2M34A 1NTCA 1GUUA 2CUEA 2LLKA 3S1QJ 3G1MA 2XGDA 3OIOA 1ZTRA 4BBSJ 2NVTJ 1U9OA 1ZR2A 1JUPA 2EZIA 3I4MJ 4UUSA 5K7FA 4J19A 2XB0X 3S2HJ 2MSYA 2EQRA 2TCTA 3F0CA 3RZDJ 3RQIA 3H3VK 5J1UA 2LK2A 3JREA 2IAIA 1ETKA 5IP7J 1JKPC 4CYCA 2DA3A 2JA7J 3TW6A 1CQTA 4A3DJ 1I3QJ 4A3GJ 3ZQIA 3BTJA 4XRSA 1JT0A 1APLC 2B63J 4JP0A 3HKZN 1IV6A 4ABZA 3BQZA 1I6HJ 2DA5A 3BR2A 1GDTA 4I76A 4JX4A 4DW6A 4IHWA 2LFBA 4DYQA 1A6IA 2CQXA 4X6AJ 2EZLA 4A3JJ 4BBRJ 3PO2J 1BL0A 2E1OA 1TWFJ 4BY1J 2R5ZA 2RAEA 2JA8J 3LSRA 5EG0B 1ETOA 4MFDA 5IYDJ 2COBA 5EYRA 2ME6A 1ZKGA 1ETVA 2WV1A 5K7HA 2MG4A 1JKOC 2LKXA 1VNDA 3G1OA 1B8IA 5M3FJ 1MSFC 4NDLA 2EH3A 2DN0A 1TWGJ 4C3IJ 5GP9A 1F43A 2AO9A 3BTIA 1X2MA 3LNQA 3CCYA 2W48A 3HB9A 2M9HA 3IH3A 3IH2A 2JK3A 5FKNA 1MBEA 1Z0XA 3HDDA 1U9NA 1JJ6C 3BG9A 2D5VA 1RESA 2K9NA 3OOUA 3E7LA 3GTKJ 1P7IA 2AHQA 4JX5A 2X48A 4M3GA 3MKLA 5BNGA 2XRLA 1FTZA 3WHBA 2M2EA 1FIPA 5JLXA 1FIAA 1WH5A 3Q0UA 2DMNA 3H0GJ 3HGYA 2NS8A 3M3YJ 4DYRA 1QPIA 1FJLA 1ETYA 5E3OA 1SFOJ 2GLOA 2E2JJ 3JRCA 1W0UA 1LFUP 4Y7NJ 4B4CA 3A03A 5E3MA 1JGGA 4QTRA 2JA5J 4EEFG 4BY7J 3GTQJ 4AUXA 1X2NA 2XPWA 1JTXA 3HOXJ 2P81A 2WB1N 5M5WJ 1BA5A 4UUTA 2NVYJ 1IC8A 1SANA 3QQAA 1XG1A 1JT6A 1Y1VJ 1D5YA 3JR9A 1WGXA 3GBGA 3B6CA 3W6VA 1YRNB 5F08A 3HM5A 1MH3A 4A3FJ 2Y2ZA 2FX0A 2NVXJ 3O8GA 2LTPA 2XSDC 1GV2A 2DA4A 4C3HJ 1VFCA 2L7MP 4D5FA 2XGCA 2K9SA 4A3BJ 4QIWN 1WCMJ 5K7ZA 1HCRA 3C2BA 5IP6A 3GTJJ 4A93J 2EZKA 1QVTA 2HXIA 2K40A 3BR3A 4QSHA 3BQYA 2DMPA 1AHDP 3I4NJ 4IHXA 2CRGA 1IUFA 3NAUA 5IOYA 5FJ8J 4B3AA 2MW8A 4I6ZA 1MBGA 3JRIA 5IYBJ 4M3BA 3TP3A 3S17J 1VI0A 1G2HA 2JMWA 1FTTA
chains in the Genus database with same CATH superfamily
1RI7A 5B66C 3FBIB 2E34A 3DBHB 3S2WA 4XIDA 4I02A 5ICCA 2ZJRF 2CJJA 3GW2A 2EV0A 4II2A 3BR0A 2HGCA 3QYFA 3AG4H 5M5YJ 1Z77A 3BZCA 2OF7A 2X51A 2CV1A 3I59B 1OKRA 5BQTA 3CDIA 2H94A 3CMYA 2E60A 3S16J 4M3FA 3HSFA 1XC5A 2HKXA 3Q0WA 1IZ1A 5ERIA 3HOZJ 2DPUA 1VF9A 4BQQA 1ZG5A 5HDKA 3DPLC 2NS7A 4HRIA 4IXAA 1X3UA 2CV0A 5FKLA 3LAJA 2JVGA 3NARA 3OYFA 1GHCA 2ZFUA 3L1PA 1EH8A 3ABLH 3LQRA 5AIPA 2DJNA 3GLLA 1H0MA 3ROUA 2HDCA 2FNAA 2FMLA 1W7PA 2PG4A 2WADA 1E2XA 3QPSA 2M8EA 3CC7I 5H6QA 3I54A 4M72A 2KDZA 4E7ZA 1TW2A 3WU1B 1IDYA 1S7AA 1UG0A 4N9HA 4BHBA 5IOZA 2L3DA 4PSXA 4PUSA 5CQGA 4IRGA 1ENHA 3FXUA 3IV5A 1S7EA 2OPTA 2YUSA 4M9ZA 1ZLJA 1LUJB 1T38A 4XRFA 5JHUA 3ZMVA 1S72I 2R4GA 3GX4X 4JX6A 2QKLB 2IT0A 3CCVI 2FBIA 3EUAA 1D0YA 3K4BA 1LE8B 2Z2SB 3MFKA 1OCRH 3WTSC 3FHZA 3P7NA 1XSVA 3DQVC 2IBDA 5JFRA 1ZG1A 2DT5A 2L02A 5CQEA 1X3ZB 3A01B 2K5CA 1T2KA 1R6RA 3BR5A 4G6TB 2I10A 2F2EA 2RGVA 1RKTA 2NNYA 3OS0A 2M8GX 4G7OF 1D8JA 2MYSA 1XPXA 3UKGA 2NOGA 3DWLE 4R8HA 2HS5A 4HA8A 2VXDA 2KJBA 1XGSA 3OYMA 1GXPA 2YX4A 1MBJA 5E1WA 5D5XB 4HLXA 3R6SA 4OU0A 3OYBA 1D1CA 3CLOA 3FK7A 2MFZA 1OMIA 2I5UA 3PSIA 2XKOA 1ZAOA 2XB5A 2K3PA 5A2QZ 5J3LA 3EYIA 3B6AA 4HNVA 3I3LA 3O3KA 3BLYA 3ZRGA 1K83J 5FKOA 4MEYF 1VQKI 2BOLA 5D5WB 2X9DA 3IAS2 5A2QK 1EH6A 3MKZA 3QP5A 1G59A 2HPIA 1BIBA 2W85A 3NWSA 4ANJA 3WTVC 4BJTA 1LFBA 2VBWA 3CZ6A 3W6JB 2ESHA 4AIKA 4ESBA 2NVQJ 5D5VB 1OCTC 2O5RA 4E70A 4U87A 4C2MJ 3HSRA 3IWFA 2G0EA 5FO5A 2E7XA 2LSOA 3LL7A 2G9WA 3HUGB 3JSOA 3CC2I 4DYCA 4F91B 3BCAA 3COAC 2NS0A 5DS9A 2ID3A 3KETA 2LG4A 5JVTA 3CO7C 4C3JJ 2MH2A 3FK6A 3SFIA 1MKMA 2HQ5A 4OOIA 1MSEC 4GRIA 3F8MA 2QGUA 3HOUJ 3SXYA 2V9VA 2V9KA 3PQJA 1RKWA 1IG7A 2K9MA 3ECOA 5K5OA 2WY7Q 1KQ9A 1HF0A 4LLGF 3G73A 4FTHA 4OIOF 3S14J 1J59A 3RZOJ 1GVDA 1ZHFA 4HW0A 1Z7LA 2OTLI 5EGOB 2QA4I 1I50J 4B09A 3QRFF 1IF1A 5LLQA 5E3NA 3OYAA 2Y9ZA 3B02A 1G3TA 2JA2A 1AKHA 3V7CA 4D7MA 1FSEA 3HL2A 3C2GA 4ESJA 3BY6A 1FNNA 3BC8A 1FPQA 5EJCA 2OTJI 2CU7A 2LMDA 4D0PA 1W36C 5HNFA 3ESWB 3CJRB 2VUMJ 3TQNA 1ZLKA 3ZN0A 4IJAA 4D1QA 2PI0A 3OSFA 1FX7A 3AL0C 5EZGA 2ZB9A 2R7DA 2DMUA 3HBLA 4LLLA 4AVZA 1UHWA 2YR2A 4XRMA 1PUEE 1WRJA 2HFHA 1H9TA 3DXJF 3GVAA 4UHTA 3DKWA 4A3MJ 2R93J 4UUSB 2KZGA 4KIFA 2EFWA 1J09A 2ZXIA 5ILSA 3KLOA 2KISA 1UCRA 1QPMA 3PFYA 2CFOA 3R0JA 3CO6C 5KVRA 3K4JA 1UB9A 2FSWA 4A3LJ 3OYCA 1U5TB 1SFUA 5GPCA 3Q3SA 1RETA 1ZR4A 1BJZA 2LC2A 3TO6A 5D6FA 2N8GA 2EK5A 1WJCA 2R7QA 5F0FA 4D5CA 2VQHA 3P5JA 3J7AO 1TWCJ 2DT7B 2DDBA 3KYDB 4BQAA 4A69C 1E3OC 1I1GA 1VQ6I 3K2ZA 4CCJA 2DU9A 4HBLA 4EGZA 1RR8C 1MBFA 1TNTA 1MNDA 2L5QA 4ENMA 2VJ5A 3CTAA 2VKEA 4WWCA 3R61A 3FXLA 4PGHA 4RM2A 1DU0A 2LP0A 3WTUC 2K9LA 4P96A 1BC8C 2FBHA 1USSA 2JN6A 1IO2A 2XROA 4IHVA 3HHGA 1UFMA 1LJ9A 2L4AA 4XOPA 3S1MJ 3ERED 3S15J 1F9NA 2XPUA 3OL3A 5IPAA 1GXQA 4WXHA 4KIBA 1MMGA 1JTYA 4HSTA 4A12A 2RNJA 3IH4A 5L3DA 3TDUC 4Y3OA 1TL8A 5M3MJ 4MQVA 2KJCA 4BHPA 3NWTA 2M7AA 3KP5A 1GUUA 2CUEA 3JCUC 3PJRA 1WFXA 2P5VA 1T0FA 5E18F 4ZYDA 3R4KA 2IGOA 4RS8A 2PJRB 1JUPA 2JUGA 3I4MJ 4KNYA 4J19A 2RQQA 2XB0X 5J47A 3DPUA 2MSYA 1W5CC 3VODA 1MMAA 3RQIA 3H3VK 3EDPA 5HDNA 3JREA 2IAIA 4XSXF 1JKPC 5L3GA 5DD8A 2VIXA 4HQEA 3IKTA 4DQ2A 5F6FA 1I3QJ 2ZNZA 4A3GJ 1G4DA 3ZQIA 4BDYA 5DM7F 2R7WA 2B63J 2V7FA 3H5RA 3MAJA 2ELJA 2H6CA 3HKZN 4ABZA 2AQFA 2F5FA 3CCMI 3S8PA 1I6HJ 2ZXHA 2DA5A 1FBSA 1R23A 4JX4A 3O6BB 1J5YA 3ASOH 3OL4A 2CMPA 4FX4A 4ZDOA 1Z6TA 4I01A 3U9GA 4QPQA 4BY1J 2JA8J 1YX5A 4HX7A 5EG0B 3CUQB 3LSRA 3HHHA 1ETOA 2BY0A 2WAEA 2COBA 2M87A 1A35A 2AS5F 4CA0A 3K1PA 3IL2A 3GZNB 4ENKA 3E0JB 3I9V2 3G1OA 4RB2C 5M3FJ 1XSXA 4NQWA 3CCSI 3N4MA 3BZKA 5LGNA 1Q1HA 3CP2A 1EH7A 1UHMA 3D5SC 2AO9A 4IRHA 5EEHA 2LBFB 5ILUA 3BJAA 3DP7A 3VDXA 4ZYGA 3BOQA 3HTSB 3HB9A 3IH2A 2FEZA 3F22A 1WJBA 4KFCA 1WJFA 2JK3A 4G94A 5FKNA 2ZJQF 4BE1A 4GO1A 3HDDA 1ZRCA 2F4MB 3SHFA 2VQGA 1RESA 4PCQA 2K9NA 4KN4X 3GTKJ 1P7IA 2H09A 2M4KA 2X48A 1LVAA 1IRXA 3F8CA 4XKCA 2HTJA 3MQ0A 2XRNA 5F1RA 3CJTB 5J4YA 2ADUA 3GFMA 5K5QA 3EPZA 3OYHA 4L0YB 2PMUA 3Q0UA 2A68F 1Z6RA 2RQPA 4HNTA 4DYRA 2G7HA 1C0WA 2WAFA 1FYMA 1DUXC 1W0UA 2LNBA 4CCLA 2ISZA 1K78A 1DP7P 4Y7NJ 1B59A 2DOAA 3ULQB 1HW1A 4BHCA 2DK5A 3R60A 3TOBA 1X2NA 4L5JA 2GXBA 2P81A 3HPHA 1YJWI 1E3PA 2DYRH 1J7KA 1LB2A 5CLSA 4L5IA 1IC8A 2CG4A 3QQAA 2ISYA 1P9QC 1YQAA 2XGXA 3GBGA 3AG2H 1Z3XA 4EM1A 1P2FA 5LHIA 2ZBKA 4Q47A 4MTDA 1PP8F 4A3FJ 2JRMA 2HEOA 2Y2ZA 4I09A 1YTYA 2NVXJ 2XSDC 5FROA 2PMZA 1YITI 2QVOA 4Z2YA 2K9SA 4O6JA 5K7ZA 1WCMJ 3KP2A 3L2QA 3L7WA 5DCMB 2QQ9A 4XLCA 4NC6A 4HV5A 4RB1A 1IXRC 4F92B 1QVTA 2E35A 2IGNA 2L7KA 3BR3A 4BEHA 4ASNA 2X6XA 1AHDP 2WWYA 3ZP5A 4CCNA 4EVIA 1HKQA 5IOYA 4B3AA 2Y0MA 4L9JA 5IYBJ 3S17J 1VI0A 3VOEA 1G2HA 3LQQA 2IA0A 1OLTA 2L54A 4EV0A 2BVLA 2D1HA 4CGZA 4MFEA 3ZQQA 2X85A 2HOAA 2QBYB 2H6BA 5GAEJ 4IHYA 1KU3A 4M3EA 1HKSA 2Y0SN 3FXOA 3BT9A 2VJIA 2X4HA 4A0YA 3HZJA 3FXMA 2CW8A 1MMSA 1PVEA 3S3OA 2IEKA 2CQKA 1X58A 4PGGA 3LSIA 1T0FC 2EA4A 2PJPA 3L2WA 2A61A 2DA7A 3WTZA 3Q0VA 3MWMA 4M9XA 3OYGA 1QBJA 4CCOA 1UELB 2AXTC 5LHHA 3E6DA 4RMNA 3SDBA 1CF7B 5KHDA 3F6VA 1PJRA 3F21A 4U88A 4ENJA 3MZYA 1YRNA 3FKIJ 5LRRA 1TQMA 1YS6A 3DTKA 2V1UA 1TW3A 4I99C 4KMUX 2B9SA 4DNCA 3LA7A 1PUFB 2EV5A 1X3WB 2G7UA 3T0YA 3CCEI 4BS9A 2P7VB 3T8RA 3CQZJ 3J7YJ 3LSMA 4A3CJ 3G4SI 5IP9J 5EZHA 3J7AY 1IRGA 4JYKA 2EFQA 4HNUA 1JKQC 2GWRA 4M71A 5FLXZ 1G6NA 2BV6A 2L0KA 5F27A 4L0ZB 3I58A 1O7LA 1BI2A 4I7HA 5J1YA 4G7ZF 1YFHA 4CHUA 5LEJA 1MDMB 1K7AA 2M1BA 4L5EA 5FLXK 3F8BA 1ODDA 1F36A 2XF5A 1S29A 3H1CA 4IPAA 1Y56A 5E1ZB 4XN3A 2JSPA 3GTOJ 3F72A 1AU7A 2UV1A 3A02A 4BJ5C 1GV5A 5EEGA 1K4TA 2FJ1A 1OYYA 3IP4B 2ZMEB 1VQMI 2VXZA 1G3SA 1S8NA 1DQUA 5F1JA 4S05A 4ESFA 1U3EM 3WHCA 5J6XA 4XBFA 1A36A 4LIVA 3K7AJ 2XGEA 3SZTA 3QP6A 4F7ZA 2IA1A 2Z3YA 3ABTA 3LFKA 3BTCA 4NHJA 3S1NJ 1KQ0A 1DPUA 1ON1A 1UZCA 2ZCWA 3ML6A 4BE0A 1VQPI 2VQLA 4XRSG 2BW3B 3L2RA 2H27A 3DTEA 4BXFA 2KDOA 2V26A 4LMYA 4HX4A 1WZ2A 3ZN1A 3VPRA 4ZZLA 4GYIA 1JUMA 3TW7A 2R7ZJ 2WA0A 3M8FA 2P0WA 4RDUA 1R9TJ 3M1CA 4UVAA 1R58A 2RKHA 5C3EJ 3V42A 4Q48A 1RRJA 3JRBA 2HOSA 3VWBA 2CW0F 4XL9A 5DYMA 4O3MA 1TC3C 3V8KA 4A2UA 4LK1F 2IXSA 3ZQLA 2DMQA 1J0RA 3JRFA 3Q5FA 1FBUA 4BXUA 4E7HA 1BBYA 4I98B 3MZHA 4GFBA 2M0CA 1J2XA 2CGPA 2CS3A 2A6TA 3EUKL 3P9CA 3T8TA 4G6QA 3LSHA 3TEDA 1TWHJ 4AIDA 3GF2A 5AIQA 3A1YA 2CSOA 2R5YA 4N0BA 1HOMA 2Y31A 5KAFC 4V19K 3GTMJ 3QAHA 5F0HA 1BW5A 3QWLA 4EJWA 1LEAA 3KIOA 3K1MA 2E2IJ 1M1EB 3G6EI 2OV7A 4MQ9F 3WG7H 5L3CA 1B72B 3PUBA 2KRCA 3H36A 1YJ9I 1V5GA 4S0HB 5ED4A 2ZXWH 2W57A 3E6MA 2FD5A 2DCEA 3QPTA 4LFUA 2VJJA 3JRDA 3RKQA 2Y9YA 2O9LA 1XMKA 2VE9A 4OINF 3LSGA 3N97A 1HBXG 1I27A 2XAFA 4IOAF 3K4NA 3PIOF 4JK1X 2F6CA 2VBXA 3E5XA 4AIJA 2DODA 5H20A 2BY1A 3WTWC 2F4IA 3LSJA 2H8RA 2GIVA 3P9IA 2DYSH 1BOAA 1LDKB 3WU0A 1WQ2A 2BXZA 4XICA 2F5DA 3G1LA 3L2VA 3J7ZI 3BG6A 1ZQ3P 3ASNH 2DJIA 1YS7A 5F04A 3LAPA 2MLGA 4D9JA 1D5VA 4DZJA 4ENNA 2RDPA 2EBIA 2K4BA 4X1EA 3WGIA 4X0GA 4G9YA 4PJJA 2MGQA 3EYYA 4FCYA 1XX5A 2DMTA 4V2GA 3HYIA 2HR3A 4RAZA 1ETXA 1Q1VA 3TBIA 4EJUA 1B6AA 3MMYB 2HZDA 1EKEA 1IW7F 3MVPA 3V8LA 3S32A 3ZQFA 2EFOA 4FQGA 2R7TA 1HDPA 2MD5A 3KZIC 1UJ8A 1BI0A 5LGTA 3I55I 1H88C 4XK4A 4J01A 4HYEA 1WPKA 1BN5A 3PM1A 4RGXA 3VYRB 3FF5A 2A3SA 4U0WA 4CYCB 5D8KB 2EZHA 3OIPA 3CMEI 1HLVA 1P7JA 4BL0B 1WI3A 2QF7A 4PFOA 4L9TA 2E1MC 4M9SA 4XSZF 1VQ8I 1V55H 2L7ZA 3BCBA 3E3VA 5EDNA 3H35A 2GZWA 2V4JC 4D7NA 4BXXJ 4AIHA 3C2HA 5LGUA 2PQ8A 4HZFA 4J00A 2DA6A 4CH7A 3F8FA 4C30A 3J80Z 2ZFWA 3K4MA 4A3KJ 3HRMA 5EF6A 4XMYA 4RBOA 5HOOA 1XMXA 2ME0A 4M74A 4EM2A 2HTSA 1IJWC 3J80K 2O8KA 1PYVA 4WK8F 3TKYA 1LNWA 2XAJA 2UXNA 1MNEA 2V1NA 2LY9A 4GCVA 2XVCA 1K4SA 2R5ZB 1MBHA 4HDUA 2XASA 4I0BA 3KZYA 3S1RJ 2IS2A 1H89C 3CLQA 3M9AA 1T8IA 1SFKA 1HSTA 2EILH 2M5WA 2QUFA 5ICGA 5EG0A 1B8IB 4F55A 1FMVA 3D5RC 4B44A 1U2WA 5LFAA 5FFXA 1ULYA 1V5EA 1YIJI 1WWXA 3OIOA 5E1XA 2NVTJ 3J81Z 2UUZA 2IRFG 4IQJA 2EZIA 3G71I 5K7FA 1X19A 4CXFA 2OZ6A 5E8GA 2RNGA 3GZ5A 3S2HJ 1G3YA 2TCTA 3J81K 2CH0A 1YW7A 2QM3A 2Y75A 2OUMA 1E3HA 2Q2EA 1EV7A 2HYGD 4B48A 2DA3A 2BVMA 4PK4A 3WU2C 2JA7J 3BP8A 4L9VA 5JVGF 3IKVA 4LK0F 2X6WA 4RAGA 4XRSA 3M8JA 3IRQA 1S5LC 2E5NA 3F9KA 1ON2A 3AG3H 2E1CA 4LG0A 3CF5F 3WGGA 2HDWA 2IS4A 3LFUA 3FMRA 5FD5A 1IV6A 4IHSA 4LLNA 1P4WA 2KL4A 3BQZA 1IV8A 2PBIA 1QQIA 3FX3A 2K85A 4E7SA 3CJQB 5FD6A 1DGRM 2ZNYA 4I76A 1KONA 4KIGA 1FBQA 4DW6A 2VASA 4ZC3A 1A6IA 5CKTA 4LB5A 2VPLA 1JHFA 1ZN2A 1BI3A 4CDGA 2DTRA 3ELKA 3KFWX 1CGPA 4A3JJ 3VYUB 1VQOI 3VFZA 2QSFX 3PO2J 2HNHA 1TWFJ 1TP4A 4RA2A 1MW7A 4KUMA 3IRRA 4MFDA 4KITB 4IOCF 5K7HA 2WV1A 3HG9A 2MG4A 1JKOC 4A5MA 3F6OA 2K4JA 1SAUA 2M7BA 1VNDA 2JUCA 1TBXA 2R7VA 1QZZA 1YG2A 3W6KB 2DN0A 1TWGJ 5ICFA 4C3IJ 1F43A 1SFEA 2RN7A 4HLYA 1GVJA 1SAXA 2F5EA 1VQNI 2M9HA 5DCMA 4XLFA 2L9VA 1MBEA 2XDVA 1Z0XA 1SMYF 2ELHA 2W1OA 5HLGA 2F48A 4PJLA 4LB6B 1BI1A 2KMUA 1X1CA 1JJ6C 1QZYA 2DK8A 2D5VA 5D6EA 1S3JA 3OOUA 4RLFA 1H9GA 3MEXA 4YIFA 2AHQA 4JX5A 1XDSA 4IQ4A 2KIMA 4ETSA 3KYLA 3MKLA 1LDDA 1FTZA 5FRNA 2DLLA 1R00A 3WHBA 3LA2A 3Q9VA 5LBQA 2M2EA 3OIQA 3GXOA 4BQOA 5JLXA 2AXLA 4YFXF 2DMNA 3H0GJ 3M3YJ 3AL0B 1QPIA 1ETYA 2KQRA 2CUJA 1NG6A 2KP6A 5B1BH 3K70D 4B4CA 3A03A 2DI3A 5E3MA 1RZ4A 2EFNA 1JGGA 2A6EF 4LD5A 4C9YA 4EEFG 4QLCU 5KNLA 3D0SA 2HZTA 2NOJB 3E1SA 4N4NB 3QOPA 5M5WJ 1BA5A 3BG7A 4UUTA 4XOTA 2B7EA 2HPMA 2XV4S 3MZ8A 3WE3A 1REPC 3V7SA 1SANA 4ZTFA 5HNHA 1XG1A 1JT6A 3L2UA 1VQ5I 3R0AA 2PX9A 1VQLI 1D5YA 2MLKA 3JR9A 2MC3A 3MKYB 2EFPA 2YSRA 5LEKA 1WGXA 3B6CA 3W6VA 1O3QA 1T98A 1WKMA 1W7PB 1GV2A 3ABUA 4UV9A 1VTNC 4BH9A 3BPVA 3QYBA 3V8JA 4QIWN 4KISA 1N77A 1I3AA 4A93J 3ZPLA 3CD6I 5H2FC 1KU7A 1D0ZA 2EZKA 1T95A 5CYVA 3AAFA 4Y17A 1X1DA 4BNCA 5BMZA 1Z67A 2EINH 3K0LA 4M6YA 1JI8A 4MNUA 2H8WA 3ZQ7A 1KU9A 1R49A 4XORA 3FMSA 4I6ZA 2JPBA 3JRIA 3TP3A 4DBQA 2EPFA 3QOEA 2UZKA 1L3LA 4NC7A 3OYKA 3DU5A 1DU6A 1FP2A 4ZYEA 2MC4A 4K2EA 5J8FA 2L9RA 4ZYAA 3DBRB 2GIZA 2STTA 1LPQA 2VONA 5FGMA 1B1BA 1O3RA 3L9FA 4XKBA 2IW5A 4E7LA 2KRHA 3FMQA 1FT9A 5JHFA 1H8AC 4QWQA 3M4OJ 2OD5A 2DQRA 2ZXJA 1TWAJ 1EF4A 5E20A 4CSWA 6PAXA 1X1PA 1XGNA 2K86A 2RREA 1FOYA 3S93A 2XAHA 3NEUA 2VOOA 4B8XA 1SD4A 2LH9A 2WBMA 3OS2A 2VODA 2BW3A 3HPGA 4IL6C 3ZXSA 2O61A 2Y69H 5KCMA 5ILVA 1VZ0A 3HOTA 2GOXB 4FT8A 2DOEA 4KYWA 2D45A 1WHUA 3AFHA 4EGYA 1NK3P 1OISA 1IXSB 3JRAA 5IYCJ 3H9JA 1PP7U 2WAQN 1OCPA 2Z9OA 2OBPA 2W84A 2X1CA 3H3ZA 3UNGC 5CVRA 4JOMA 4GDFA 3RKYA 3M1EA 1OCZH 4IZZA 1K6OA 1FWZA 3TO9A 1ZGWA 2HVRA 2PMHA 1DPRA 2PMZN 3QPHA 2STWA 5HODA 1F5TA 2R3SA 1JJ8C 3LWFA 3ZMZA 3PNTA 4RM3A 2ZJ2A 3RJPA 3BG5A 2O6GE 2FF4A 2L9NA 4A6DA 4LIUA 1XD7A 2Y30A 1D1BA 2L9SA 1X4PA 4Q5SF 4IKFA 3I59A 1O3SA 4GXOA 2OQRA 1TQPA 4W97A 2JTVA 4FE7A 5FKMA 2K7LA 2VPRA 2WAQA 2LVSA 5L3EA 2X1DA 1QU3A 3FZVA 4U7BA 3TOAA 3F23A 1YOVB 4LGWA 1QA6A 2A07F 3TGNA 1P6RA 2BBYA 4GYGA 1SVOA 1AKHB 1AOYA 1XTAA 2KLOA 2KHMA 1MMNA 3VB2A 1HKTA 2GM4A 5KAIC 3JAMZ 2GXAA 3BTLA 1IN6A 2ID6A 3PIPF 2JA6J 4XKWA 4MO7A 4G12A 2PFBA 2XAGA 2AQEA 3GWZA 2DA2A 4NNJA 2IJLA 1WJDA 2R7RA 1P4XA 4W1UA 1Y0UA 3CJNA 3KPHA 3GTGJ 1FC3A 2KPMA 2CW7A 2VKVA 2Z1DA 3BROA 5GPAA 4XLHA 4XM3A 3ZQCA 1RUNA 2P8TA 4DIQA 2CFXA 3KEOA 3OYJA 3WGHA 5CVJA 1U0JA 3H9GA 3PUFA 1O4XA 1IUYA 2Q8KA 1Z7UA 2V1XA 3I53A 1SVLA 4N4OB 5FLVA 3GTPJ 5CPRB 3OSGA 1LE8A 4IEJA 1JE8A 2HDDA 2XAUA 3OV8A 2J5PA 2Z33A 3TDZC 2HWVA 3RPUD 1MZBA 2C6YA 2VI6A 4LOCA 1FEXA 3A01A 2DFHA 2R92J 1R5ID 1Y39A 4ZYHA 1OYIA 5TRDA 1GT0C 3D1NI 4P9FA 2L01A 4MEXF 2XSJC 3FM3A 3LMMA 4L9NA 2MA3A 3TO7A 4MIMA 5HLIA 1X4OA 1LQ1A 1AWCA 2QSHX 1XGMA 2Y48A 3L00A 2DQLA 2DFFA 1WH7A 2LOOA 3HEFA 3RPUA 2HVSA 4AM3A 3BR1A 2ECBA 3C7JA 1R1VA 3MCZA 3CP8A 3RKXA 1AA7A 3VSKA 3O8HA 5FB2A 4OAZA 5AONA 5C4XJ 4XR6A 1WJ5A 1YX3A 2BY2A 2L4MA 4HF2A 5K1YA 3EUHA 4NB5A 3GFIA 3PFIA 4E7IA 1FZPB 2VT3A 1R4NB 1NHAA 3KX2A 1R1UA 4RGRA 1YYVA 2QENA 3HJEA 5DUKA 3RSNA 3CDLA 4AU7A 4AYBN 1R36A 5TISC 1V54H 5C4JJ 2ELKA 3A0HC 2P6TA 4PJNA 3SQNA 3L09A 4G8XA 4L18B 2M4GA 3FXKA 1Y6IA 4IHTA 1J9IA 5E17F 1Z3YA 2DFEA 3U1KA 3KP6A 4LITA 2LF8A 1X1AA 2OC6A 3K2AA 3U1DA 4CZCA 3MD2A 2NVUB 4ZH4F 3ONQA 3SJMA 2O0YA 2A69F 3JTGA 3VSLA 1XB4A 3KP4A 5ICEA 3HUGA 3ZQGA 2E2HJ 4PSWA 2KT0A 2OCEA 2DTZA 4IF4A 2TRTA 4RGUA 4FASD 3FWEA 3IAM2 2D1VA 1FOXA 2D2WA 1FP1D 5F0CA 2A5YB 4BQNA 2CYYA 1R7JA 2HYFA 2PLYA 2R7OA 3MN2A 1ZRDA 2EJRA 4AYBA 2GBYA 2JJ7A 2ECCA 1R1TA 1G8XA 3E97A 2JRTA 1K61A 3U21A 2BEOA 4UVCA 1HA8A 4HDVA 1DDNA 1IN5A 4NBQA 1A5JA 5J4VA 5EGOA 1SD5A 1TNSA 5L3FA 1YJNI 2K02A 1STZA 1U78A 2ETHA 2RC4A 2OA4A 3ZOBA 5J8CA 1EA3A 2M45A 4IX7A 5DM6F 4AC0A 1UG2A 1Z05A 5J1RA 2V79A 4M3DA 3FDYA 3CMMA 1L0OC 4HV6A 5BS6A 1FLIA 5BPIA 3HRTA 4NQWB 2VLAA 2COMA 3ABMH 2IS6A 1J75A 1XMAA 3OY9A 2M34A 4E7KA 3ECHA 2LLKA 5E8IA 2XHKA 3QODA 4EQQA 3RPQA 4UB8C 3WODF 3CCQI 1ERDA 1BR4A 1NG7A 2VBZA 2EA2A 4UUSA 4ON0A 4A5NA 1ZH5A 1B9NA 2WY8Q 3IUOA 3UR3C 4BU2A 1W36D 3W3CA 4YELA 1ZELA 5J1UA 2LK2A 2OQGA 4OWRB 1U5TA 3ZMTA 4B3XA 5DDGA 3OYNA 3BJ6A 1IXCA 2XF6A 4WX9A 1F1ZA 1FY7A 1YI2I 1CQTA 3KYCB 3BTJA 3I5UA 2ICWG 1JT0A 3GFLA 1LEBA 3IHUA 3V7RA 3S3NA 4JP0A 1K78B 2OU2A 3GCMA 1KYWA 2EV6A 4I0AA 2MBFA 5DCFA 2EIJH 2EIKH 3T5XA 4IRIA 3DPTA 2LYCA 3DLAA 2VOPA 5FFZA 3BR2A 1GDTA 3TMOA 4PJ0C 1Y8RB 3DF8A 4IHWA 1K79A 4DYQA 1YW8A 4AWXB 3VYSB 4X6AJ 2EZLA 1W7PD 5B3SH 4BACA 1BL0A 2E1OA 3H5AA 5TGTA 1W4MA 2RAEA 1VQ7I 3FXRA 1LDJA 4RAFA 2DOFA 3PNYA 5K5RA 3OS1A 1LFPA 1R5HA 2P4WA 2ME6A 3WTYC 1KZHA 4B43A 1SD6A 2LKXA 1A6QA 5HS9A 2FQ3A 3F8NA 4EJOA 4CZZA 1MSFC 3GZ6A 4FETA 3CDHA 1NH3A 5GP9A 1Y0NA 2QYOA 3BTIA 2FXAA 1TZLA 1TT0A 4H0EA 2XC7A 3LNQA 4BEHB 4GGGA 3S3MA 3CMAI 4Z6YA 4EATA 1OQYA 4S04A 4YFNF 2PJRA 2PEXA 2TDXA 2FNPA 3KCCA 1VQ4I 2M3AA 4XONA 1B9MA 1HC8A 5BPDA 1K6YA 1T6SA 3H9QA 4H4KC 5DV5A 3B73A 3I56I 3CF2A 2VE8A 4M3GA 3EUHC 1HQCA 2Q0OA 1V5FA 3DFGA 5BNGA 1SD7A 4PZJA 4C2UA 1V3FA 1R22A 2XRLA 3BDDA 2OAZA 4E6KG 4WF2A 1YIOA 4WXCA 4O5VA 3SZGA 1FIPA 1WH5A 3HGYA 2RVCA 1MD0A 2FU4A 2W4SA 5E3OA 2X0LA 1BR2A 3O2PE 1SFOJ 1FJLA 4A0XA 2GLOA 1D3YA 3OYLA 2FUG2 3H5NA 4QTRA 1YE9A 2MH9A 4BY7J 2EIMH 4AUXA 4BYYA 3GTQJ 2XPWA 4WXDA 2VN2A 1Z21A 2YU3A 1FOKA 3K9TA 3M8EA 3DKYA 4YIRX 1Y1VJ 4ITVA 4KJZA 2IS1A 3K6GA 1YRNB 1IN7A 5F08A 3CUQA 1JHHA 2BZTA 3HM5A 4N9IA 2W25A 2F5VA 2ZSHB 3O8GA 3ZMUA 2LREA 2DA4A 1FOWA 2E1MB 1OYWA 1YHQI 1OR7A 3RIRA 3C2BA 2EB7A 3DV8A 1YLFA 3I4PA 4E4HA 4EJVA 4XLPF 4KMFA 1Z1DA 3JW4A 5LD2C 3DU6A 2LBFA 4DBRA 3CCRI 2HXIA 1SVMA 4HF0A 2DMPA 5HLTA 4IHXA 2O8XA 2XIGA 3RQ4A 3VEPA 1MIJA 2CRGA 1IUFA 3HRUA 2UWMA 1G3WA 3OWTA 2WC2A 4OMZA 2KIFA 3GO5A 1MBGA 2VJ4A 3GYHX 4HF1A 2V6EA 3RYRA 3A0BC 4KT5C 2HYJA 2LY2A 1OJLA 1JUSA 5JR3A 3I64A 1ZG3A 1R4MB 3K69A 1O57A 2E7WA 3PL8A 4BGDA 5IT3A 1BIAA 4FE4A 3KE2A 1BW6A 4YRVA 2LD5A 2CQQA 1A31A 2QWWA 3FISA 4MLOA 5FLMJ 1OFCX 2CWEA 1XS9A 3DEUA 1RPWA 3G2BA 4V2FA 2J5OA 2DPDA 4UVBA 3E5UA 1MNMC 2VBYA 1RUOA 2JWTA 1ITYA 2K9QA 1POGA 1TQIA 5DUIA 3PSFA 3S2DJ 2EWNA 5CJ9A 1U5TC 4P9UA 3FKJA 1WSUA 2WTEA 2BXYA 2HOTA 1MH4A 3AG1H 4HQMA 2A5WA 3Q9SA 3HOWJ 2FRHA 3RDIA 2NRAC 1ETQA 3PNVA 1NK2P 3NQOA 3KP3A 1D8KA 3FHNA 2GQQA 3I0TA 4R79A 1XDUA 3N05A 4A3EJ 3CCJI 3K4CA 2KRFA 1KU2A 2JQ7A 4ZJZA 3C1DA 1I6XA 1Z91A 4A6EA 1YO5C 3CUOA 2JVHA 3FXJA 3LSTA 1MJAA 2HQRA 3GUDA 5HVQC 1ORKA 3HIFA 1SFXA 2IA2A 1B4AA 4UB6C 1X1BA 3DKXA 2PN6A 3GEZA 3HC7A 2R5YB 3RCOA 4ZZDA 2KIQA 2ZJPF 4KICA 2RV8A 3GMEA 2QQBA 2A05A 2E36A 5GTIC 3QPLA 4BJ6C 4ZDLA 2R7UA 2QCOA 3JTHA 3ZMSA 3LA3A 1Y1WJ 2QBYA 3FM5A 4YEJA 1ZGAA 2V1DA 2V9PA 3H92A 1LKXA 1S6LA 1BJAA 2KFDA 3HTUA 2WV0A 2CUZA 2NXNB 2YX7A 2R0QC 4A3IJ 4UNOA 2VKDA 2UXXA 3H3UA 3JRGA 3OMYA 4M6VA 3EETA 5E3LA 2P6SA 3ZCOA 2ESNA 4RB0A 3REOA 2L7FP 2JSCA 2BHYA 3OR2C 4RAYA 2M0MA 2GOMA 1CF7A 2VB6A 2NYXA 2XPVA 2ZO4A 3HGGA 4FX0A 4E7JA 2YU9J 2OJED 1N25A 4YFKF 4Y52J 2H1KA 1U6GA 3H0DA 2A6HF 4HX8A 1XCVA 5D4SA 4JBAA 3BJOA 1PUFA 3FIWA 5FKKA 4XLAA 1OCCH 1USTA 5JLWA 2BHZA 3F3XA 2DXIA 9ANTA 2P7CB 4PFPA 2DDAA 2CUFA 3NRVA 1YW9A 4R1HA 2DA1A 4WCGA 2GXGA 2DFIA 4DOZA 4XQFA 4CICA 4MGRA 1GLNA 2B0LA 4MTEA 3V4GA 1MDMA 1KQ8A 5KK1A 4PJMA 3ISPA 1JXSA 4HG2A 1W1WE 3P9KA 2O7OA 2OZUA 1JGSA 1RR7A 2XAQA 5LHGA 4MHGA 2NAZA 4BE2A 1W0TA 3ZGKA 3OOPA 3ZQHA 4EM0B 4CYDA 4IO9F 3CUQC 3OYEA 3DTIA 5EEAA 4XKVA 1ZARA 2YS9A 1XCBA 4Q4ZF 2ZMEA 4B1RA 4OIQF 4DJAA 1OR7C 4CCKA 4HAMA 1HSJA 1FSHA 3FXQA 3SDGA 1T33A 2CQ7A 2XKPA 3K1NA 1MBKA 2IGMA 4PDKA 3WTTC 3JRHA 2QSGX 3X2QH 3CCLI 3HSEA 3CC4I 1WVRA 3HOSA 4DZPA 1D1AA 1FYLA 3QU3A 2FE3A 4BKXA 1WI9A 5GAHJ 2L2OA 5CVIA 5IT9Z 1QZEA 4AVPA 3SZPA 4QPOA 2HXOA 4U0VA 1LVKA 2HKOA 4FISA 3ABKH 3CCUI 5IT9K 1I39A 3TP0A 1U8BA 2E19A 1WJAA 1OPCA 2E71A 3I71A 4UV8A 1V4RA 5C44J 3ZR8X 3K10A 3LOCA 3DEWA 1TT5B 3MKWB 3BR6A 3BG3A 1JKRC 2E5ZA 1P92A 5M5XJ 4CO8A 3OYIA 1IDZA 4Y33A 1ZK8A 4P5OA 3GTLJ 2R7XA 1DP3A 3HOYJ 2Z5UA 2QLZA 2VC0A 1KYZA 1E17A 2VT2A 1T39A 3G3ZA 1IAWA 3HKZA 4KN7X 5GAGJ 4XLNF 1HXDA 2DAOA 1IN4A 2IGKA 2QKMB 2FMYA 2QEXI 2Q2EB 1IGNA 2K27A 1QVUA 1T56A 1ZREA 1FYKA 4YG2F 4ZDPA 3L2CA 4G6DA 1UMQA 2MD0A 2O03A 1HW2A 1A04A 3IC7A 1B72A 5TJJA 4KT6A 4LG0B 2Z16A 1ETWA 4KDPA 1ZRFA 3LSPA 2QQAA 4B47A 1R5GA 5HLHA 2HI3A 3KP7A 3VYTB 2LR8A 2JPCA 2GA1A 1WJEA 1IRZA 2ZSIB 4BUPA 3WTXC 1IRFA 2JZYA 1KA8A 1P4AA 3ERMA 4TV7A 2W82A 1QRYA 2FBKA 1ACIA 4II3A 5D5UB 1N75A 1F4KA 2CO5A 2M30A 3SFZA 2Q1ZB 3JAMK 5HS7A 3KZZA 1HDDC 4CUGA 2F5CA 3TL4X 3HOVJ 2BYVE 2ZC2A 3AKZA 1XN7A 3IWZA 1FMWA 1W5TA 5HDGA 5CVVA 1QHGA 2FQ4A 5DTDA 2P5LC 2X6OA 3BWGA 1UHSA 4JQFA 2W7NA 3DCFA 2JT1A 2R7FA 4P55A 3M07A 2LKSA 3PO3J 1QO0D 2FA5A 1TLHB 1D0XA 2X6YA 1NTCA 3KEYA 4NUBA 4ZTJA 2YPRA 3W2WA 3C3WA 3S1QJ 3G1MA 2XGDA 1ZTRA 1N78A 4BBSJ 1TTYA 4U0YA 1U9OA 1ZR2A 1HW5A 3U2RA 3K70C 3RKWA 2CV2A 2HOEA 4P1WA 4Y15A 2HVQA 2V6CA 2EQRA 3F0CA 4UY8I 1MGTA 3RZDJ 1T08B 2F4OB 1SC7A 5JI6A 2Z99A 2LF7A 1ETKA 5IP7J 3W2AA 4CYCA 1XGOA 1BC7C 2VKHA 5H6RA 3TW6A 2NNNA 3QU6A 4A3DJ 2KZVA 2KIUA 2X1EA 4RB3C 4G7HF 2R7SA 2LDUA 2VQCA 3T1BA 1APLC 4BDZA 3WG9A 1ZGJA 4F93B 1W5SA 3BPXA 4LJZF 3E6CC 2BY3A 2KKOA 4RLQA 1DGWY 2IPQX 2QQ8A 2DO7A 1I1SA 1MJBA 2QZ8A 3BZ6A 2FOWA 2LFBA 2CQXA 4F3QA 2W00A 1OCOH 4HSRA 2OCCH 2ZKZA 3KEQA 5GTHC 4M73A 2H1LA 4RGSA 4BBRJ 4OIPF 1VQ9I 2IP2A 4BAYA 3RYPA 2R5ZA 5DEQA 3A4CA 5IYDJ 5EYRA 1QNTA 1ZKGA 1ETVA 2ZMEC 3OYDA 3SEZA 2XUBA 4FHTA 1BOBA 4KA4A 1B8IA 1EJ9A 4NDLA 4UXNA 2EH3A 3QYEA 1XSDA 4OAYA 1RC9A 3HXLA 4DGWB 2CQNA 4UUVA 1X2MA 4OMYA 3CCYA 2LY1A 2W48A 4EJTA 3DEEA 3IH3A 1Z9CA 3HRSA 1S9HA 3GFJA 4CCMA 2Y0SA 4YIIA 1IN8A 2BGCA 1U9NA 3C18A 3DBLB 3LSKA 3BG9A 1S7OA 1UAAA 4F52A 3DLLF 3A2KA 3E7LA 2LRDA 5E79C 3D5LA 2GAUA 3K4KA 3CESA 4U7DA 2O3FA 1PDNC 1MMDA 4I2OA 3RI4A 2HQAA 4XLEA 1ONVA 1SMTA 2BE5F 1FIAA 1BR1A 2NS8A 3K4LA 2I8DA 1RIOH 2E2JJ 3JRCA 3ZMDA 4M6XA 1LFUP 4IVNA 4Y13A 1SEUA 4HOBA 5FRMA 2P5KA 3EQLF 2JA5J 1BM9A 1KGSA 1O7FA 2MABA 1JTXA 5J40A 3WE2A 3HOXJ 2IVMA 3SYTA 2WB1N 5CVUA 1E0EA 2NVYJ 5L3BA 5HS8A 1O3TA 4C2TA 3RTRA 5D4RA 4OIRF 4XNFA 4NC8A 2XF7A 2K3FA 1MJ9A 4HEA2 2HU9A 3FBNB 3E6BA 3KLNA 5GADJ 5LRSA 1MH3A 2FX0A 4LG3A 2ACJA 2LTPA 5DD4A 1QHHD 3OR1C 4EMSA 1VFCA 4C3HJ 2W24A 2L7MP 4D5FA 2XGCA 4AD9A 3GLXA 1U8RA 4HPQA 3JSPA 2DT6A 4A3BJ 1RNLA 2DBBA 2FOKA 2GA2A 4Y4RA 5IY5H 1HCRA 5IP6A 3GTJJ 2HQNA 2VC1A 3W2VA 2E1NA 3M7GA 5B5EC 1R71A 5BOXA 1Y8QB 2K40A 4QSHA 3BQYA 5D8LB 1QGPA 3I4NJ 2DW4A 3E5QA 4XN0A 3SEQA 1ZYRF 2VL8A 5B1AH 5F64A 4A0ZA 3NAUA 5FJ8J 2LKPA 2WB1A 2MW8A 3PQKA 4M3BA 2JMWA 1FTTA 1I5ZA
chains in the Genus database with same CATH topology
2HYJA 1DU6A 1OJLA 2L9RA 1JUSA 4MFEA 4XIDA 2HOAA 2CJJA 4IHYA 3BR0A 4M3EA 5M5YJ 2Y0SN 1Z77A 3BT9A 2OF7A 4FE4A 1H8AC 1BW6A 3CMYA 3S16J 2LD5A 2IEKA 3M4OJ 4M3FA 1XC5A 2CQQA 1TWAJ 1X58A 3Q0WA 3FISA 3HOZJ 1EF4A 4MLOA 5FLMJ 1OFCX 1VF9A 1XS9A 2DA7A 2NS7A 1RPWA 3Q0VA 5FKLA 4V2FA 3NARA 1MNMC 2JWTA 1ITYA 2K9QA 1POGA 3L1PA 3S2DJ 2DJNA 1YRNA 3FKIJ 2HOTA 1MH4A 1PUFB 1NK3P 4A3CJ 3QPSA 3CQZJ 5IYCJ 3JRAA 3HOWJ 5IP9J 1ETQA 5EZHA 2KDZA 2WAQN 1OCPA 4JYKA 1NK2P 1JKQC 1IDYA 5IOZA 2L0KA 4A3EJ 5F27A 5J1YA 1ENHA 3IV5A 1S7EA 2OPTA 1ZGWA 2YUSA 4L5EA 1F36A 1ORKA 2PMZN 5HODA 1JJ8C 4JX6A 2R5YB 3GTOJ 3BG5A 1LE8B 1AU7A 3A02A 1GV5A 2FJ1A 3QPLA 2QCOA 2Y30A 1Y1WJ 2IBDA 5F1JA 3WHCA 3A01B 3BR5A 3K7AJ 2I10A 2XGEA 1RKTA 2R0QC 4A3IJ 2M8GX 4W97A 4FE7A 3BTCA 3JRGA 5FKMA 3S1NJ 4M6VA 2VPRA 2LVSA 4XRSG 3UKGA 5E3LA 2NOGA 1AKHB 1MBJA 2L7FP 2GM4A 3BTLA 2ID6A 3VPRA 2XPVA 3HGGA 3FK7A 1JUMA 3TW7A 2YU9J 2JA6J 4MO7A 4G12A 2R7ZJ 4Y52J 2H1KA 4RDUA 1R9TJ 2XB5A 5J3LA 3B6AA 4HNVA 2DA2A 1PUFA 3FIWA 5C3EJ 5FKKA 1K83J 5FKOA 4W1UA 5JLWA 3JRBA 2X9DA 2HOSA 3GTGJ 9ANTA 1TC3C 2VKVA 2CUFA 5GPAA 3ZQLA 2DA1A 2DMQA 3ZQCA 3JRFA 1LFBA 2NVQJ 1OCTC 4GFBA 2M0CA 4C2MJ 1O4XA 2G0EA 2O7OA 1RR7A 4DYCA 3TEDA 1TWHJ 1W0TA 5FLVA 3GTPJ 3ZQHA 2R5YA 5DS9A 1HOMA 3OSGA 2ID3A 2Y31A 1LE8A 3GTMJ 5F0HA 4IEJA 1BW5A 4C3JJ 5EEAA 2E2IJ 3FK6A 3SFIA 2HQ5A 2HDDA 2YS9A 1MSEC 4B1RA 3HOUJ 1B72B 2VI6A 4S0HB 4LOCA 1FEXA 3A01A 3SDGA 2R92J 1T33A 1RKWA 3JRHA 1IG7A 1MBKA 2FD5A 3JRDA 1GT0C 3RKQA 2Y9YA 3D1NI 1HF0A 4FTHA 2O9LA 3S14J 3RZOJ 1GVDA 3LSGA 4DZPA 4MIMA 5EGOB 1I50J 4BKXA 5E3NA 3HEFA 1WH7A 2Y9ZA 2H8RA 1AKHA 3LSJA 3BR1A 2ECBA 4D7MA 3O8HA 4XICA 5C4XJ 2HXOA 3G1LA 4FISA 2CU7A 1ZQ3P 1U8BA 3TP0A 2E19A 2VUMJ 5F04A 4DZJA 5C44J 3LOCA 2EBIA 3DEWA 4X1EA 4AYBN 3BR6A 3CDLA 3OSFA 2MGQA 3BG3A 1JKRC 5C4JJ 2ELKA 5EZGA 2ZB9A 4FCYA 5M5XJ 2DMUA 2DMTA 3HBLA 4V2GA 1IDZA 1ETXA 1ZK8A 1Q1VA 4XRMA 3GTLJ 3K2AA 3HOYJ 2R93J 3MVPA 3ZQFA 4A3MJ 4UUSB 1HDPA 3SJMA 1H88C 4XK4A 1WPKA 3PM1A 3ZQGA 2E2HJ 2KT0A 4A3LJ 2DTZA 1IGNA 5GPCA 1QVUA 1T56A 4CYCB 2EZHA 2TRTA 3Q3SA 1HLVA 1RETA 1P7JA 1ZR4A 1BJZA 1WI3A 2N8GA 2QF7A 5F0FA 4D5CA 1UMQA 1TWCJ 1B72A 2L7ZA 5F0CA 5EDNA 4D7NA 1ETWA 4BXXJ 4A69C 3MN2A 1E3OC 3LSPA 2GBYA 2JJ7A 2ECCA 2DA6A 2HI3A 2LR8A 1K61A 1IRZA 4A3KJ 5EF6A 1MBFA 4RBOA 1A5JA 2VKEA 2ME0A 5EGOA 1IJWC 2O8KA 1U78A 1DU0A 1QRYA 2LP0A 2LY9A 3ZOBA 2R5ZB 1MBHA 1HDDC 2JN6A 3S1RJ 4IHVA 3HOVJ 1H89C 4AC0A 3S1MJ 1UG2A 5J1RA 3S15J 4M3DA 2XPUA 5IPAA 2FQ4A 5DTDA 2X6OA 1JTYA 5EG0A 1B8IB 1UHSA 3IH4A 3DCFA 5M3MJ 3PO3J 2M34A 1NTCA 1GUUA 2CUEA 2LLKA 3S1QJ 3G1MA 2XGDA 3OIOA 1ZTRA 4BBSJ 2NVTJ 1U9OA 1ZR2A 1JUPA 2EZIA 3I4MJ 4UUSA 5K7FA 4J19A 2XB0X 3S2HJ 2MSYA 2EQRA 2TCTA 3F0CA 3RZDJ 3RQIA 3H3VK 5J1UA 2LK2A 3JREA 2IAIA 1ETKA 5IP7J 1JKPC 4CYCA 2DA3A 2JA7J 3TW6A 1CQTA 4A3DJ 1I3QJ 4A3GJ 3ZQIA 3BTJA 4XRSA 1JT0A 1APLC 2B63J 4JP0A 3HKZN 1IV6A 4ABZA 3BQZA 1I6HJ 2DA5A 3BR2A 1GDTA 4I76A 4JX4A 4DW6A 4IHWA 2LFBA 4DYQA 1A6IA 2CQXA 4X6AJ 2EZLA 4A3JJ 4BBRJ 3PO2J 1BL0A 2E1OA 1TWFJ 4BY1J 2R5ZA 2RAEA 2JA8J 3LSRA 5EG0B 1ETOA 4MFDA 5IYDJ 2COBA 5EYRA 2ME6A 1ZKGA 1ETVA 2WV1A 5K7HA 2MG4A 1JKOC 2LKXA 1VNDA 3G1OA 1B8IA 5M3FJ 1MSFC 4NDLA 2EH3A 2DN0A 1TWGJ 4C3IJ 5GP9A 1F43A 2AO9A 3BTIA 1X2MA 3LNQA 3CCYA 2W48A 3HB9A 2M9HA 3IH3A 3IH2A 2JK3A 5FKNA 1MBEA 1Z0XA 3HDDA 1U9NA 1JJ6C 3BG9A 2D5VA 1RESA 2K9NA 3OOUA 3E7LA 3GTKJ 1P7IA 2AHQA 4JX5A 2X48A 4M3GA 3MKLA 5BNGA 2XRLA 1FTZA 3WHBA 2M2EA 1FIPA 5JLXA 1FIAA 1WH5A 3Q0UA 2DMNA 3H0GJ 3HGYA 2NS8A 3M3YJ 4DYRA 1QPIA 1FJLA 1ETYA 5E3OA 1SFOJ 2GLOA 2E2JJ 3JRCA 1W0UA 1LFUP 4Y7NJ 4B4CA 3A03A 5E3MA 1JGGA 4QTRA 2JA5J 4EEFG 4BY7J 3GTQJ 4AUXA 1X2NA 2XPWA 1JTXA 3HOXJ 2P81A 2WB1N 5M5WJ 1BA5A 4UUTA 2NVYJ 1IC8A 1SANA 3QQAA 1XG1A 1JT6A 1Y1VJ 1D5YA 3JR9A 1WGXA 3GBGA 3B6CA 3W6VA 1YRNB 5F08A 3HM5A 1MH3A 4A3FJ 2Y2ZA 2FX0A 2NVXJ 3O8GA 2LTPA 2XSDC 1GV2A 2DA4A 4C3HJ 1VFCA 2L7MP 4D5FA 2XGCA 2K9SA 4A3BJ 4QIWN 1WCMJ 5K7ZA 1HCRA 3C2BA 5IP6A 3GTJJ 4A93J 2EZKA 1QVTA 2HXIA 2K40A 3BR3A 4QSHA 3BQYA 2DMPA 1AHDP 3I4NJ 4IHXA 2CRGA 1IUFA 3NAUA 5IOYA 5FJ8J 4B3AA 2MW8A 4I6ZA 1MBGA 3JRIA 5IYBJ 4M3BA 3TP3A 3S17J 1VI0A 1G2HA 2JMWA 1FTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYJ A;  1DU6 A;  1OJL A;  2L9R A;  1JUS A;  4MFE A;  4XID A;  2HOA A;  2CJJ A;  4IHY A;  3BR0 A;  4M3E A;  5M5Y J;  2Y0S N;  1Z77 A;  3BT9 A;  2OF7 A;  4FE4 A;  1H8A C;  1BW6 A;  3CMY A;  3S16 J;  2LD5 A;  2IEK A;  3M4O J;  4M3F A;  1XC5 A;  2CQQ A;  1TWA J;  1X58 A;  3Q0W A;  3FIS A;  3HOZ J;  1EF4 A;  4MLO A;  5FLM J;  1OFC X;  1VF9 A;  1XS9 A;  2DA7 A;  2NS7 A;  1RPW A;  3Q0V A;  5FKL A;  4V2F A;  3NAR A;  1MNM C;  2JWT A;  1ITY A;  2K9Q A;  1POG A;  3L1P A;  3S2D J;  2DJN A;  1YRN A;  3FKI J;  2HOT A;  1MH4 A;  1PUF B;  1NK3 P;  4A3C J;  3QPS A;  3CQZ J;  5IYC J;  3JRA A;  3HOW J;  5IP9 J;  1ETQ A;  5EZH A;  2KDZ A;  2WAQ N;  1OCP A;  4JYK A;  1NK2 P;  1JKQ C;  1IDY A;  5IOZ A;  2L0K A;  4A3E J;  5F27 A;  5J1Y A;  1ENH A;  3IV5 A;  1S7E A;  2OPT A;  1ZGW A;  2YUS A;  4L5E A;  1F36 A;  1ORK A;  2PMZ N;  5HOD A;  1JJ8 C;  4JX6 A;  2R5Y B;  3GTO J;  3BG5 A;  1LE8 B;  1AU7 A;  3A02 A;  1GV5 A;  2FJ1 A;  3QPL A;  2QCO A;  2Y30 A;  1Y1W J;  2IBD A;  5F1J A;  3WHC A;  3A01 B;  3BR5 A;  3K7A J;  2I10 A;  2XGE A;  1RKT A;  2R0Q C;  4A3I J;  2M8G X;  4W97 A;  4FE7 A;  3BTC A;  3JRG A;  5FKM A;  3S1N J;  4M6V A;  2VPR A;  2LVS A;  4XRS G;  3UKG A;  5E3L A;  2NOG A;  1AKH B;  1MBJ A;  2L7F P;  2GM4 A;  3BTL A;  2ID6 A;  3VPR A;  2XPV A;  3HGG A;  3FK7 A;  1JUM A;  3TW7 A;  2YU9 J;  2JA6 J;  4MO7 A;  4G12 A;  2R7Z J;  4Y52 J;  2H1K A;  4RDU A;  1R9T J;  2XB5 A;  5J3L A;  3B6A A;  4HNV A;  2DA2 A;  1PUF A;  3FIW A;  5C3E J;  5FKK A;  1K83 J;  5FKO A;  4W1U A;  5JLW A;  3JRB A;  2X9D A;  2HOS A;  3GTG J;  9ANT A;  1TC3 C;  2VKV A;  2CUF A;  5GPA A;  3ZQL A;  2DA1 A;  2DMQ A;  3ZQC A;  3JRF A;  1LFB A;  2NVQ J;  1OCT C;  4GFB A;  2M0C A;  4C2M J;  1O4X A;  2G0E A;  2O7O A;  1RR7 A;  4DYC A;  3TED A;  1TWH J;  1W0T A;  5FLV A;  3GTP J;  3ZQH A;  2R5Y A;  5DS9 A;  1HOM A;  3OSG A;  2ID3 A;  2Y31 A;  1LE8 A;  3GTM J;  5F0H A;  4IEJ A;  1BW5 A;  4C3J J;  5EEA A;  2E2I J;  3FK6 A;  3SFI A;  2HQ5 A;  2HDD A;  2YS9 A;  1MSE C;  4B1R A;  3HOU J;  1B72 B;  2VI6 A;  4S0H B;  4LOC A;  1FEX A;  3A01 A;  3SDG A;  2R92 J;  1T33 A;  1RKW A;  3JRH A;  1IG7 A;  1MBK A;  2FD5 A;  3JRD A;  1GT0 C;  3RKQ A;  2Y9Y A;  3D1N I;  1HF0 A;  4FTH A;  2O9L A;  3S14 J;  3RZO J;  1GVD A;  3LSG A;  4DZP A;  4MIM A;  5EGO B;  1I50 J;  4BKX A;  5E3N A;  3HEF A;  1WH7 A;  2Y9Z A;  2H8R A;  1AKH A;  3LSJ A;  3BR1 A;  2ECB A;  4D7M A;  3O8H A;  4XIC A;  5C4X J;  2HXO A;  3G1L A;  4FIS A;  2CU7 A;  1ZQ3 P;  1U8B A;  3TP0 A;  2E19 A;  2VUM J;  5F04 A;  4DZJ A;  5C44 J;  3LOC A;  2EBI A;  3DEW A;  4X1E A;  4AYB N;  3BR6 A;  3CDL A;  3OSF A;  2MGQ A;  3BG3 A;  1JKR C;  5C4J J;  2ELK A;  5EZG A;  2ZB9 A;  4FCY A;  5M5X J;  2DMU A;  2DMT A;  3HBL A;  4V2G A;  1IDZ A;  1ETX A;  1ZK8 A;  1Q1V A;  4XRM A;  3GTL J;  3K2A A;  3HOY J;  2R93 J;  3MVP A;  3ZQF A;  4A3M J;  4UUS B;  1HDP A;  3SJM A;  1H88 C;  4XK4 A;  1WPK A;  3PM1 A;  3ZQG A;  2E2H J;  2KT0 A;  4A3L J;  2DTZ A;  1IGN A;  5GPC A;  1QVU A;  1T56 A;  4CYC B;  2EZH A;  2TRT A;  3Q3S A;  1HLV A;  1RET A;  1P7J A;  1ZR4 A;  1BJZ A;  1WI3 A;  2N8G A;  2QF7 A;  5F0F A;  4D5C A;  1UMQ A;  1TWC J;  1B72 A;  2L7Z A;  5F0C A;  5EDN A;  4D7N A;  1ETW A;  4BXX J;  4A69 C;  3MN2 A;  1E3O C;  3LSP A;  2GBY A;  2JJ7 A;  2ECC A;  2DA6 A;  2HI3 A;  2LR8 A;  1K61 A;  1IRZ A;  4A3K J;  5EF6 A;  1MBF A;  4RBO A;  1A5J A;  2VKE A;  2ME0 A;  5EGO A;  1IJW C;  2O8K A;  1U78 A;  1DU0 A;  1QRY A;  2LP0 A;  2LY9 A;  3ZOB A;  2R5Z B;  1MBH A;  1HDD C;  2JN6 A;  3S1R J;  4IHV A;  3HOV J;  1H89 C;  4AC0 A;  3S1M J;  1UG2 A;  5J1R A;  3S15 J;  4M3D A;  2XPU A;  5IPA A;  2FQ4 A;  5DTD A;  2X6O A;  1JTY A;  5EG0 A;  1B8I B;  1UHS A;  3IH4 A;  3DCF A;  5M3M J;  3PO3 J;  2M34 A;  1NTC A;  1GUU A;  2CUE A;  2LLK A;  3S1Q J;  3G1M A;  2XGD A;  3OIO A;  1ZTR A;  4BBS J;  2NVT J;  1U9O A;  1ZR2 A;  1JUP A;  2EZI A;  3I4M J;  4UUS A;  5K7F A;  4J19 A;  2XB0 X;  3S2H J;  2MSY A;  2EQR A;  2TCT A;  3F0C A;  3RZD J;  3RQI A;  3H3V K;  5J1U A;  2LK2 A;  3JRE A;  2IAI A;  1ETK A;  5IP7 J;  1JKP C;  4CYC A;  2DA3 A;  2JA7 J;  3TW6 A;  1CQT A;  4A3D J;  1I3Q J;  4A3G J;  3ZQI A;  3BTJ A;  4XRS A;  1JT0 A;  1APL C;  2B63 J;  4JP0 A;  3HKZ N;  1IV6 A;  4ABZ A;  3BQZ A;  1I6H J;  2DA5 A;  3BR2 A;  1GDT A;  4I76 A;  4JX4 A;  4DW6 A;  4IHW A;  2LFB A;  4DYQ A;  1A6I A;  2CQX A;  4X6A J;  2EZL A;  4A3J J;  4BBR J;  3PO2 J;  1BL0 A;  2E1O A;  1TWF J;  4BY1 J;  2R5Z A;  2RAE A;  2JA8 J;  3LSR A;  5EG0 B;  1ETO A;  4MFD A;  5IYD J;  2COB A;  5EYR A;  2ME6 A;  1ZKG A;  1ETV A;  2WV1 A;  5K7H A;  2MG4 A;  1JKO C;  2LKX A;  1VND A;  3G1O A;  1B8I A;  5M3F J;  1MSF C;  4NDL A;  2EH3 A;  2DN0 A;  1TWG J;  4C3I J;  5GP9 A;  1F43 A;  2AO9 A;  3BTI A;  1X2M A;  3LNQ A;  3CCY A;  2W48 A;  3HB9 A;  2M9H A;  3IH3 A;  3IH2 A;  2JK3 A;  5FKN A;  1MBE A;  1Z0X A;  3HDD A;  1U9N A;  1JJ6 C;  3BG9 A;  2D5V A;  1RES A;  2K9N A;  3OOU A;  3E7L A;  3GTK J;  1P7I A;  2AHQ A;  4JX5 A;  2X48 A;  4M3G A;  3MKL A;  5BNG A;  2XRL A;  1FTZ A;  3WHB A;  2M2E A;  1FIP A;  5JLX A;  1FIA A;  1WH5 A;  3Q0U A;  2DMN A;  3H0G J;  3HGY A;  2NS8 A;  3M3Y J;  4DYR A;  1QPI A;  1FJL A;  1ETY A;  5E3O A;  1SFO J;  2GLO A;  2E2J J;  3JRC A;  1W0U A;  1LFU P;  4Y7N J;  4B4C A;  3A03 A;  5E3M A;  1JGG A;  4QTR A;  2JA5 J;  4EEF G;  4BY7 J;  3GTQ J;  4AUX A;  1X2N A;  2XPW A;  1JTX A;  3HOX J;  2P81 A;  2WB1 N;  5M5W J;  1BA5 A;  4UUT A;  2NVY J;  1IC8 A;  1SAN A;  3QQA A;  1XG1 A;  1JT6 A;  1Y1V J;  1D5Y A;  3JR9 A;  1WGX A;  3GBG A;  3B6C A;  3W6V A;  1YRN B;  5F08 A;  3HM5 A;  1MH3 A;  4A3F J;  2Y2Z A;  2FX0 A;  2NVX J;  3O8G A;  2LTP A;  2XSD C;  1GV2 A;  2DA4 A;  4C3H J;  1VFC A;  2L7M P;  4D5F A;  2XGC A;  2K9S A;  4A3B J;  4QIW N;  1WCM J;  5K7Z A;  1HCR A;  3C2B A;  5IP6 A;  3GTJ J;  4A93 J;  2EZK A;  1QVT A;  2HXI A;  2K40 A;  3BR3 A;  4QSH A;  3BQY A;  2DMP A;  1AHD P;  3I4N J;  4IHX A;  2CRG A;  1IUF A;  3NAU A;  5IOY A;  5FJ8 J;  4B3A A;  2MW8 A;  4I6Z A;  1MBG A;  3JRI A;  5IYB J;  4M3B A;  3TP3 A;  3S17 J;  1VI0 A;  1G2H A;  2JMW A;  1FTT A; 
#chains in the Genus database with same CATH topology
 1RI7 A;  5B66 C;  3FBI B;  2E34 A;  3DBH B;  3S2W A;  4XID A;  4I02 A;  5ICC A;  2ZJR F;  2CJJ A;  3GW2 A;  2EV0 A;  4II2 A;  3BR0 A;  2HGC A;  3QYF A;  3AG4 H;  5M5Y J;  1Z77 A;  3BZC A;  2OF7 A;  2X51 A;  2CV1 A;  3I59 B;  1OKR A;  5BQT A;  3CDI A;  2H94 A;  3CMY A;  2E60 A;  3S16 J;  4M3F A;  3HSF A;  1XC5 A;  2HKX A;  3Q0W A;  1IZ1 A;  5ERI A;  3HOZ J;  2DPU A;  1VF9 A;  4BQQ A;  1ZG5 A;  5HDK A;  3DPL C;  2NS7 A;  4HRI A;  4IXA A;  1X3U A;  2CV0 A;  5FKL A;  3LAJ A;  2JVG A;  3NAR A;  3OYF A;  1GHC A;  2ZFU A;  3L1P A;  1EH8 A;  3ABL H;  3LQR A;  5AIP A;  2DJN A;  3GLL A;  1H0M A;  3ROU A;  2HDC A;  2FNA A;  2FML A;  1W7P A;  2PG4 A;  2WAD A;  1E2X A;  3QPS A;  2M8E A;  3CC7 I;  5H6Q A;  3I54 A;  4M72 A;  2KDZ A;  4E7Z A;  1TW2 A;  3WU1 B;  1IDY A;  1S7A A;  1UG0 A;  4N9H A;  4BHB A;  5IOZ A;  2L3D A;  4PSX A;  4PUS A;  5CQG A;  4IRG A;  1ENH A;  3FXU A;  3IV5 A;  1S7E A;  2OPT A;  2YUS A;  4M9Z A;  1ZLJ A;  1LUJ B;  1T38 A;  4XRF A;  5JHU A;  3ZMV A;  1S72 I;  2R4G A;  3GX4 X;  4JX6 A;  2QKL B;  2IT0 A;  3CCV I;  2FBI A;  3EUA A;  1D0Y A;  3K4B A;  1LE8 B;  2Z2S B;  3MFK A;  1OCR H;  3WTS C;  3FHZ A;  3P7N A;  1XSV A;  3DQV C;  2IBD A;  5JFR A;  1ZG1 A;  2DT5 A;  2L02 A;  5CQE A;  1X3Z B;  3A01 B;  2K5C A;  1T2K A;  1R6R A;  3BR5 A;  4G6T B;  2I10 A;  2F2E A;  2RGV A;  1RKT A;  2NNY A;  3OS0 A;  2M8G X;  4G7O F;  1D8J A;  2MYS A;  1XPX A;  3UKG A;  2NOG A;  3DWL E;  4R8H A;  2HS5 A;  4HA8 A;  2VXD A;  2KJB A;  1XGS A;  3OYM A;  1GXP A;  2YX4 A;  1MBJ A;  5E1W A;  5D5X B;  4HLX A;  3R6S A;  4OU0 A;  3OYB A;  1D1C A;  3CLO A;  3FK7 A;  2MFZ A;  1OMI A;  2I5U A;  3PSI A;  2XKO A;  1ZAO A;  2XB5 A;  2K3P A;  5A2Q Z;  5J3L A;  3EYI A;  3B6A A;  4HNV A;  3I3L A;  3O3K A;  3BLY A;  3ZRG A;  1K83 J;  5FKO A;  4MEY F;  1VQK I;  2BOL A;  5D5W B;  2X9D A;  3IAS 2;  5A2Q K;  1EH6 A;  3MKZ A;  3QP5 A;  1G59 A;  2HPI A;  1BIB A;  2W85 A;  3NWS A;  4ANJ A;  3WTV C;  4BJT A;  1LFB A;  2VBW A;  3CZ6 A;  3W6J B;  2ESH A;  4AIK A;  4ESB A;  2NVQ J;  5D5V B;  1OCT C;  2O5R A;  4E70 A;  4U87 A;  4C2M J;  3HSR A;  3IWF A;  2G0E A;  5FO5 A;  2E7X A;  2LSO A;  3LL7 A;  2G9W A;  3HUG B;  3JSO A;  3CC2 I;  4DYC A;  4F91 B;  3BCA A;  3COA C;  2NS0 A;  5DS9 A;  2ID3 A;  3KET A;  2LG4 A;  5JVT A;  3CO7 C;  4C3J J;  2MH2 A;  3FK6 A;  3SFI A;  1MKM A;  2HQ5 A;  4OOI A;  1MSE C;  4GRI A;  3F8M A;  2QGU A;  3HOU J;  3SXY A;  2V9V A;  2V9K A;  3PQJ A;  1RKW A;  1IG7 A;  2K9M A;  3ECO A;  5K5O A;  2WY7 Q;  1KQ9 A;  1HF0 A;  4LLG F;  3G73 A;  4FTH A;  4OIO F;  3S14 J;  1J59 A;  3RZO J;  1GVD A;  1ZHF A;  4HW0 A;  1Z7L A;  2OTL I;  5EGO B;  2QA4 I;  1I50 J;  4B09 A;  3QRF F;  1IF1 A;  5LLQ A;  5E3N A;  3OYA A;  2Y9Z A;  3B02 A;  1G3T A;  2JA2 A;  1AKH A;  3V7C A;  4D7M A;  1FSE A;  3HL2 A;  3C2G A;  4ESJ A;  3BY6 A;  1FNN A;  3BC8 A;  1FPQ A;  5EJC A;  2OTJ I;  2CU7 A;  2LMD A;  4D0P A;  1W36 C;  5HNF A;  3ESW B;  3CJR B;  2VUM J;  3TQN A;  1ZLK A;  3ZN0 A;  4IJA A;  4D1Q A;  2PI0 A;  3OSF A;  1FX7 A;  3AL0 C;  5EZG A;  2ZB9 A;  2R7D A;  2DMU A;  3HBL A;  4LLL A;  4AVZ A;  1UHW A;  2YR2 A;  4XRM A;  1PUE E;  1WRJ A;  2HFH A;  1H9T A;  3DXJ F;  3GVA A;  4UHT A;  3DKW A;  4A3M J;  2R93 J;  4UUS B;  2KZG A;  4KIF A;  2EFW A;  1J09 A;  2ZXI A;  5ILS A;  3KLO A;  2KIS A;  1UCR A;  1QPM A;  3PFY A;  2CFO A;  3R0J A;  3CO6 C;  5KVR A;  3K4J A;  1UB9 A;  2FSW A;  4A3L J;  3OYC A;  1U5T B;  1SFU A;  5GPC A;  3Q3S A;  1RET A;  1ZR4 A;  1BJZ A;  2LC2 A;  3TO6 A;  5D6F A;  2N8G A;  2EK5 A;  1WJC A;  2R7Q A;  5F0F A;  4D5C A;  2VQH A;  3P5J A;  3J7A O;  1TWC J;  2DT7 B;  2DDB A;  3KYD B;  4BQA A;  4A69 C;  1E3O C;  1I1G A;  1VQ6 I;  3K2Z A;  4CCJ A;  2DU9 A;  4HBL A;  4EGZ A;  1RR8 C;  1MBF A;  1TNT A;  1MND A;  2L5Q A;  4ENM A;  2VJ5 A;  3CTA A;  2VKE A;  4WWC A;  3R61 A;  3FXL A;  4PGH A;  4RM2 A;  1DU0 A;  2LP0 A;  3WTU C;  2K9L A;  4P96 A;  1BC8 C;  2FBH A;  1USS A;  2JN6 A;  1IO2 A;  2XRO A;  4IHV A;  3HHG A;  1UFM A;  1LJ9 A;  2L4A A;  4XOP A;  3S1M J;  3ERE D;  3S15 J;  1F9N A;  2XPU A;  3OL3 A;  5IPA A;  1GXQ A;  4WXH A;  4KIB A;  1MMG A;  1JTY A;  4HST A;  4A12 A;  2RNJ A;  3IH4 A;  5L3D A;  3TDU C;  4Y3O A;  1TL8 A;  5M3M J;  4MQV A;  2KJC A;  4BHP A;  3NWT A;  2M7A A;  3KP5 A;  1GUU A;  2CUE A;  3JCU C;  3PJR A;  1WFX A;  2P5V A;  1T0F A;  5E18 F;  4ZYD A;  3R4K A;  2IGO A;  4RS8 A;  2PJR B;  1JUP A;  2JUG A;  3I4M J;  4KNY A;  4J19 A;  2RQQ A;  2XB0 X;  5J47 A;  3DPU A;  2MSY A;  1W5C C;  3VOD A;  1MMA A;  3RQI A;  3H3V K;  3EDP A;  5HDN A;  3JRE A;  2IAI A;  4XSX F;  1JKP C;  5L3G A;  5DD8 A;  2VIX A;  4HQE A;  3IKT A;  4DQ2 A;  5F6F A;  1I3Q J;  2ZNZ A;  4A3G J;  1G4D A;  3ZQI A;  4BDY A;  5DM7 F;  2R7W A;  2B63 J;  2V7F A;  3H5R A;  3MAJ A;  2ELJ A;  2H6C A;  3HKZ N;  4ABZ A;  2AQF A;  2F5F A;  3CCM I;  3S8P A;  1I6H J;  2ZXH A;  2DA5 A;  1FBS A;  1R23 A;  4JX4 A;  3O6B B;  1J5Y A;  3ASO H;  3OL4 A;  2CMP A;  4FX4 A;  4ZDO A;  1Z6T A;  4I01 A;  3U9G A;  4QPQ A;  4BY1 J;  2JA8 J;  1YX5 A;  4HX7 A;  5EG0 B;  3CUQ B;  3LSR A;  3HHH A;  1ETO A;  2BY0 A;  2WAE A;  2COB A;  2M87 A;  1A35 A;  2AS5 F;  4CA0 A;  3K1P A;  3IL2 A;  3GZN B;  4ENK A;  3E0J B;  3I9V 2;  3G1O A;  4RB2 C;  5M3F J;  1XSX A;  4NQW A;  3CCS I;  3N4M A;  3BZK A;  5LGN A;  1Q1H A;  3CP2 A;  1EH7 A;  1UHM A;  3D5S C;  2AO9 A;  4IRH A;  5EEH A;  2LBF B;  5ILU A;  3BJA A;  3DP7 A;  3VDX A;  4ZYG A;  3BOQ A;  3HTS B;  3HB9 A;  3IH2 A;  2FEZ A;  3F22 A;  1WJB A;  4KFC A;  1WJF A;  2JK3 A;  4G94 A;  5FKN A;  2ZJQ F;  4BE1 A;  4GO1 A;  3HDD A;  1ZRC A;  2F4M B;  3SHF A;  2VQG A;  1RES A;  4PCQ A;  2K9N A;  4KN4 X;  3GTK J;  1P7I A;  2H09 A;  2M4K A;  2X48 A;  1LVA A;  1IRX A;  3F8C A;  4XKC A;  2HTJ A;  3MQ0 A;  2XRN A;  5F1R A;  3CJT B;  5J4Y A;  2ADU A;  3GFM A;  5K5Q A;  3EPZ A;  3OYH A;  4L0Y B;  2PMU A;  3Q0U A;  2A68 F;  1Z6R A;  2RQP A;  4HNT A;  4DYR A;  2G7H A;  1C0W A;  2WAF A;  1FYM A;  1DUX C;  1W0U A;  2LNB A;  4CCL A;  2ISZ A;  1K78 A;  1DP7 P;  4Y7N J;  1B59 A;  2DOA A;  3ULQ B;  1HW1 A;  4BHC A;  2DK5 A;  3R60 A;  3TOB A;  1X2N A;  4L5J A;  2GXB A;  2P81 A;  3HPH A;  1YJW I;  1E3P A;  2DYR H;  1J7K A;  1LB2 A;  5CLS A;  4L5I A;  1IC8 A;  2CG4 A;  3QQA A;  2ISY A;  1P9Q C;  1YQA A;  2XGX A;  3GBG A;  3AG2 H;  1Z3X A;  4EM1 A;  1P2F A;  5LHI A;  2ZBK A;  4Q47 A;  4MTD A;  1PP8 F;  4A3F J;  2JRM A;  2HEO A;  2Y2Z A;  4I09 A;  1YTY A;  2NVX J;  2XSD C;  5FRO A;  2PMZ A;  1YIT I;  2QVO A;  4Z2Y A;  2K9S A;  4O6J A;  5K7Z A;  1WCM J;  3KP2 A;  3L2Q A;  3L7W A;  5DCM B;  2QQ9 A;  4XLC A;  4NC6 A;  4HV5 A;  4RB1 A;  1IXR C;  4F92 B;  1QVT A;  2E35 A;  2IGN A;  2L7K A;  3BR3 A;  4BEH A;  4ASN A;  2X6X A;  1AHD P;  2WWY A;  3ZP5 A;  4CCN A;  4EVI A;  1HKQ A;  5IOY A;  4B3A A;  2Y0M A;  4L9J A;  5IYB J;  3S17 J;  1VI0 A;  3VOE A;  1G2H A;  3LQQ A;  2IA0 A;  1OLT A;  2L54 A;  4EV0 A;  2BVL A;  2D1H A;  4CGZ A;  4MFE A;  3ZQQ A;  2X85 A;  2HOA A;  2QBY B;  2H6B A;  5GAE J;  4IHY A;  1KU3 A;  4M3E A;  1HKS A;  2Y0S N;  3FXO A;  3BT9 A;  2VJI A;  2X4H A;  4A0Y A;  3HZJ A;  3FXM A;  2CW8 A;  1MMS A;  1PVE A;  3S3O A;  2IEK A;  2CQK A;  1X58 A;  4PGG A;  3LSI A;  1T0F C;  2EA4 A;  2PJP A;  3L2W A;  2A61 A;  2DA7 A;  3WTZ A;  3Q0V A;  3MWM A;  4M9X A;  3OYG A;  1QBJ A;  4CCO A;  1UEL B;  2AXT C;  5LHH A;  3E6D A;  4RMN A;  3SDB A;  1CF7 B;  5KHD A;  3F6V A;  1PJR A;  3F21 A;  4U88 A;  4ENJ A;  3MZY A;  1YRN A;  3FKI J;  5LRR A;  1TQM A;  1YS6 A;  3DTK A;  2V1U A;  1TW3 A;  4I99 C;  4KMU X;  2B9S A;  4DNC A;  3LA7 A;  1PUF B;  2EV5 A;  1X3W B;  2G7U A;  3T0Y A;  3CCE I;  4BS9 A;  2P7V B;  3T8R A;  3CQZ J;  3J7Y J;  3LSM A;  4A3C J;  3G4S I;  5IP9 J;  5EZH A;  3J7A Y;  1IRG A;  4JYK A;  2EFQ A;  4HNU A;  1JKQ C;  2GWR A;  4M71 A;  5FLX Z;  1G6N A;  2BV6 A;  2L0K A;  5F27 A;  4L0Z B;  3I58 A;  1O7L A;  1BI2 A;  4I7H A;  5J1Y A;  4G7Z F;  1YFH A;  4CHU A;  5LEJ A;  1MDM B;  1K7A A;  2M1B A;  4L5E A;  5FLX K;  3F8B A;  1ODD A;  1F36 A;  2XF5 A;  1S29 A;  3H1C A;  4IPA A;  1Y56 A;  5E1Z B;  4XN3 A;  2JSP A;  3GTO J;  3F72 A;  1AU7 A;  2UV1 A;  3A02 A;  4BJ5 C;  1GV5 A;  5EEG A;  1K4T A;  2FJ1 A;  1OYY A;  3IP4 B;  2ZME B;  1VQM I;  2VXZ A;  1G3S A;  1S8N A;  1DQU A;  5F1J A;  4S05 A;  4ESF A;  1U3E M;  3WHC A;  5J6X A;  4XBF A;  1A36 A;  4LIV A;  3K7A J;  2XGE A;  3SZT A;  3QP6 A;  4F7Z A;  2IA1 A;  2Z3Y A;  3ABT A;  3LFK A;  3BTC A;  4NHJ A;  3S1N J;  1KQ0 A;  1DPU A;  1ON1 A;  1UZC A;  2ZCW A;  3ML6 A;  4BE0 A;  1VQP I;  2VQL A;  4XRS G;  2BW3 B;  3L2R A;  2H27 A;  3DTE A;  4BXF A;  2KDO A;  2V26 A;  4LMY A;  4HX4 A;  1WZ2 A;  3ZN1 A;  3VPR A;  4ZZL A;  4GYI A;  1JUM A;  3TW7 A;  2R7Z J;  2WA0 A;  3M8F A;  2P0W A;  4RDU A;  1R9T J;  3M1C A;  4UVA A;  1R58 A;  2RKH A;  5C3E J;  3V42 A;  4Q48 A;  1RRJ A;  3JRB A;  2HOS A;  3VWB A;  2CW0 F;  4XL9 A;  5DYM A;  4O3M A;  1TC3 C;  3V8K A;  4A2U A;  4LK1 F;  2IXS A;  3ZQL A;  2DMQ A;  1J0R A;  3JRF A;  3Q5F A;  1FBU A;  4BXU A;  4E7H A;  1BBY A;  4I98 B;  3MZH A;  4GFB A;  2M0C A;  1J2X A;  2CGP A;  2CS3 A;  2A6T A;  3EUK L;  3P9C A;  3T8T A;  4G6Q A;  3LSH A;  3TED A;  1TWH J;  4AID A;  3GF2 A;  5AIQ A;  3A1Y A;  2CSO A;  2R5Y A;  4N0B A;  1HOM A;  2Y31 A;  5KAF C;  4V19 K;  3GTM J;  3QAH A;  5F0H A;  1BW5 A;  3QWL A;  4EJW A;  1LEA A;  3KIO A;  3K1M A;  2E2I J;  1M1E B;  3G6E I;  2OV7 A;  4MQ9 F;  3WG7 H;  5L3C A;  1B72 B;  3PUB A;  2KRC A;  3H36 A;  1YJ9 I;  1V5G A;  4S0H B;  5ED4 A;  2ZXW H;  2W57 A;  3E6M A;  2FD5 A;  2DCE A;  3QPT A;  4LFU A;  2VJJ A;  3JRD A;  3RKQ A;  2Y9Y A;  2O9L A;  1XMK A;  2VE9 A;  4OIN F;  3LSG A;  3N97 A;  1HBX G;  1I27 A;  2XAF A;  4IOA F;  3K4N A;  3PIO F;  4JK1 X;  2F6C A;  2VBX A;  3E5X A;  4AIJ A;  2DOD A;  5H20 A;  2BY1 A;  3WTW C;  2F4I A;  3LSJ A;  2H8R A;  2GIV A;  3P9I A;  2DYS H;  1BOA A;  1LDK B;  3WU0 A;  1WQ2 A;  2BXZ A;  4XIC A;  2F5D A;  3G1L A;  3L2V A;  3J7Z I;  3BG6 A;  1ZQ3 P;  3ASN H;  2DJI A;  1YS7 A;  5F04 A;  3LAP A;  2MLG A;  4D9J A;  1D5V A;  4DZJ A;  4ENN A;  2RDP A;  2EBI A;  2K4B A;  4X1E A;  3WGI A;  4X0G A;  4G9Y A;  4PJJ A;  2MGQ A;  3EYY A;  4FCY A;  1XX5 A;  2DMT A;  4V2G A;  3HYI A;  2HR3 A;  4RAZ A;  1ETX A;  1Q1V A;  3TBI A;  4EJU A;  1B6A A;  3MMY B;  2HZD A;  1EKE A;  1IW7 F;  3MVP A;  3V8L A;  3S32 A;  3ZQF A;  2EFO A;  4FQG A;  2R7T A;  1HDP A;  2MD5 A;  3KZI C;  1UJ8 A;  1BI0 A;  5LGT A;  3I55 I;  1H88 C;  4XK4 A;  4J01 A;  4HYE A;  1WPK A;  1BN5 A;  3PM1 A;  4RGX A;  3VYR B;  3FF5 A;  2A3S A;  4U0W A;  4CYC B;  5D8K B;  2EZH A;  3OIP A;  3CME I;  1HLV A;  1P7J A;  4BL0 B;  1WI3 A;  2QF7 A;  4PFO A;  4L9T A;  2E1M C;  4M9S A;  4XSZ F;  1VQ8 I;  1V55 H;  2L7Z A;  3BCB A;  3E3V A;  5EDN A;  3H35 A;  2GZW A;  2V4J C;  4D7N A;  4BXX J;  4AIH A;  3C2H A;  5LGU A;  2PQ8 A;  4HZF A;  4J00 A;  2DA6 A;  4CH7 A;  3F8F A;  4C30 A;  3J80 Z;  2ZFW A;  3K4M A;  4A3K J;  3HRM A;  5EF6 A;  4XMY A;  4RBO A;  5HOO A;  1XMX A;  2ME0 A;  4M74 A;  4EM2 A;  2HTS A;  1IJW C;  3J80 K;  2O8K A;  1PYV A;  4WK8 F;  3TKY A;  1LNW A;  2XAJ A;  2UXN A;  1MNE A;  2V1N A;  2LY9 A;  4GCV A;  2XVC A;  1K4S A;  2R5Z B;  1MBH A;  4HDU A;  2XAS A;  4I0B A;  3KZY A;  3S1R J;  2IS2 A;  1H89 C;  3CLQ A;  3M9A A;  1T8I A;  1SFK A;  1HST A;  2EIL H;  2M5W A;  2QUF A;  5ICG A;  5EG0 A;  1B8I B;  4F55 A;  1FMV A;  3D5R C;  4B44 A;  1U2W A;  5LFA A;  5FFX A;  1ULY A;  1V5E A;  1YIJ I;  1WWX A;  3OIO A;  5E1X A;  2NVT J;  3J81 Z;  2UUZ A;  2IRF G;  4IQJ A;  2EZI A;  3G71 I;  5K7F A;  1X19 A;  4CXF A;  2OZ6 A;  5E8G A;  2RNG A;  3GZ5 A;  3S2H J;  1G3Y A;  2TCT A;  3J81 K;  2CH0 A;  1YW7 A;  2QM3 A;  2Y75 A;  2OUM A;  1E3H A;  2Q2E A;  1EV7 A;  2HYG D;  4B48 A;  2DA3 A;  2BVM A;  4PK4 A;  3WU2 C;  2JA7 J;  3BP8 A;  4L9V A;  5JVG F;  3IKV A;  4LK0 F;  2X6W A;  4RAG A;  4XRS A;  3M8J A;  3IRQ A;  1S5L C;  2E5N A;  3F9K A;  1ON2 A;  3AG3 H;  2E1C A;  4LG0 A;  3CF5 F;  3WGG A;  2HDW A;  2IS4 A;  3LFU A;  3FMR A;  5FD5 A;  1IV6 A;  4IHS A;  4LLN A;  1P4W A;  2KL4 A;  3BQZ A;  1IV8 A;  2PBI A;  1QQI A;  3FX3 A;  2K85 A;  4E7S A;  3CJQ B;  5FD6 A;  1DGR M;  2ZNY A;  4I76 A;  1KON A;  4KIG A;  1FBQ A;  4DW6 A;  2VAS A;  4ZC3 A;  1A6I A;  5CKT A;  4LB5 A;  2VPL A;  1JHF A;  1ZN2 A;  1BI3 A;  4CDG A;  2DTR A;  3ELK A;  3KFW X;  1CGP A;  4A3J J;  3VYU B;  1VQO I;  3VFZ A;  2QSF X;  3PO2 J;  2HNH A;  1TWF J;  1TP4 A;  4RA2 A;  1MW7 A;  4KUM A;  3IRR A;  4MFD A;  4KIT B;  4IOC F;  5K7H A;  2WV1 A;  3HG9 A;  2MG4 A;  1JKO C;  4A5M A;  3F6O A;  2K4J A;  1SAU A;  2M7B A;  1VND A;  2JUC A;  1TBX A;  2R7V A;  1QZZ A;  1YG2 A;  3W6K B;  2DN0 A;  1TWG J;  5ICF A;  4C3I J;  1F43 A;  1SFE A;  2RN7 A;  4HLY A;  1GVJ A;  1SAX A;  2F5E A;  1VQN I;  2M9H A;  5DCM A;  4XLF A;  2L9V A;  1MBE A;  2XDV A;  1Z0X A;  1SMY F;  2ELH A;  2W1O A;  5HLG A;  2F48 A;  4PJL A;  4LB6 B;  1BI1 A;  2KMU A;  1X1C A;  1JJ6 C;  1QZY A;  2DK8 A;  2D5V A;  5D6E A;  1S3J A;  3OOU A;  4RLF A;  1H9G A;  3MEX A;  4YIF A;  2AHQ A;  4JX5 A;  1XDS A;  4IQ4 A;  2KIM A;  4ETS A;  3KYL A;  3MKL A;  1LDD A;  1FTZ A;  5FRN A;  2DLL A;  1R00 A;  3WHB A;  3LA2 A;  3Q9V A;  5LBQ A;  2M2E A;  3OIQ A;  3GXO A;  4BQO A;  5JLX A;  2AXL A;  4YFX F;  2DMN A;  3H0G J;  3M3Y J;  3AL0 B;  1QPI A;  1ETY A;  2KQR A;  2CUJ A;  1NG6 A;  2KP6 A;  5B1B H;  3K70 D;  4B4C A;  3A03 A;  2DI3 A;  5E3M A;  1RZ4 A;  2EFN A;  1JGG A;  2A6E F;  4LD5 A;  4C9Y A;  4EEF G;  4QLC U;  5KNL A;  3D0S A;  2HZT A;  2NOJ B;  3E1S A;  4N4N B;  3QOP A;  5M5W J;  1BA5 A;  3BG7 A;  4UUT A;  4XOT A;  2B7E A;  2HPM A;  2XV4 S;  3MZ8 A;  3WE3 A;  1REP C;  3V7S A;  1SAN A;  4ZTF A;  5HNH A;  1XG1 A;  1JT6 A;  3L2U A;  1VQ5 I;  3R0A A;  2PX9 A;  1VQL I;  1D5Y A;  2MLK A;  3JR9 A;  2MC3 A;  3MKY B;  2EFP A;  2YSR A;  5LEK A;  1WGX A;  3B6C A;  3W6V A;  1O3Q A;  1T98 A;  1WKM A;  1W7P B;  1GV2 A;  3ABU A;  4UV9 A;  1VTN C;  4BH9 A;  3BPV A;  3QYB A;  3V8J A;  4QIW N;  4KIS A;  1N77 A;  1I3A A;  4A93 J;  3ZPL A;  3CD6 I;  5H2F C;  1KU7 A;  1D0Z A;  2EZK A;  1T95 A;  5CYV A;  3AAF A;  4Y17 A;  1X1D A;  4BNC A;  5BMZ A;  1Z67 A;  2EIN H;  3K0L A;  4M6Y A;  1JI8 A;  4MNU A;  2H8W A;  3ZQ7 A;  1KU9 A;  1R49 A;  4XOR A;  3FMS A;  4I6Z A;  2JPB A;  3JRI A;  3TP3 A;  4DBQ A;  2EPF A;  3QOE A;  2UZK A;  1L3L A;  4NC7 A;  3OYK A;  3DU5 A;  1DU6 A;  1FP2 A;  4ZYE A;  2MC4 A;  4K2E A;  5J8F A;  2L9R A;  4ZYA A;  3DBR B;  2GIZ A;  2STT A;  1LPQ A;  2VON A;  5FGM A;  1B1B A;  1O3R A;  3L9F A;  4XKB A;  2IW5 A;  4E7L A;  2KRH A;  3FMQ A;  1FT9 A;  5JHF A;  1H8A C;  4QWQ A;  3M4O J;  2OD5 A;  2DQR A;  2ZXJ A;  1TWA J;  1EF4 A;  5E20 A;  4CSW A;  6PAX A;  1X1P A;  1XGN A;  2K86 A;  2RRE A;  1FOY A;  3S93 A;  2XAH A;  3NEU A;  2VOO A;  4B8X A;  1SD4 A;  2LH9 A;  2WBM A;  3OS2 A;  2VOD A;  2BW3 A;  3HPG A;  4IL6 C;  3ZXS A;  2O61 A;  2Y69 H;  5KCM A;  5ILV A;  1VZ0 A;  3HOT A;  2GOX B;  4FT8 A;  2DOE A;  4KYW A;  2D45 A;  1WHU A;  3AFH A;  4EGY A;  1NK3 P;  1OIS A;  1IXS B;  3JRA A;  5IYC J;  3H9J A;  1PP7 U;  2WAQ N;  1OCP A;  2Z9O A;  2OBP A;  2W84 A;  2X1C A;  3H3Z A;  3UNG C;  5CVR A;  4JOM A;  4GDF A;  3RKY A;  3M1E A;  1OCZ H;  4IZZ A;  1K6O A;  1FWZ A;  3TO9 A;  1ZGW A;  2HVR A;  2PMH A;  1DPR A;  2PMZ N;  3QPH A;  2STW A;  5HOD A;  1F5T A;  2R3S A;  1JJ8 C;  3LWF A;  3ZMZ A;  3PNT A;  4RM3 A;  2ZJ2 A;  3RJP A;  3BG5 A;  2O6G E;  2FF4 A;  2L9N A;  4A6D A;  4LIU A;  1XD7 A;  2Y30 A;  1D1B A;  2L9S A;  1X4P A;  4Q5S F;  4IKF A;  3I59 A;  1O3S A;  4GXO A;  2OQR A;  1TQP A;  4W97 A;  2JTV A;  4FE7 A;  5FKM A;  2K7L A;  2VPR A;  2WAQ A;  2LVS A;  5L3E A;  2X1D A;  1QU3 A;  3FZV A;  4U7B A;  3TOA A;  3F23 A;  1YOV B;  4LGW A;  1QA6 A;  2A07 F;  3TGN A;  1P6R A;  2BBY A;  4GYG A;  1SVO A;  1AKH B;  1AOY A;  1XTA A;  2KLO A;  2KHM A;  1MMN A;  3VB2 A;  1HKT A;  2GM4 A;  5KAI C;  3JAM Z;  2GXA A;  3BTL A;  1IN6 A;  2ID6 A;  3PIP F;  2JA6 J;  4XKW A;  4MO7 A;  4G12 A;  2PFB A;  2XAG A;  2AQE A;  3GWZ A;  2DA2 A;  4NNJ A;  2IJL A;  1WJD A;  2R7R A;  1P4X A;  4W1U A;  1Y0U A;  3CJN A;  3KPH A;  3GTG J;  1FC3 A;  2KPM A;  2CW7 A;  2VKV A;  2Z1D A;  3BRO A;  5GPA A;  4XLH A;  4XM3 A;  3ZQC A;  1RUN A;  2P8T A;  4DIQ A;  2CFX A;  3KEO A;  3OYJ A;  3WGH A;  5CVJ A;  1U0J A;  3H9G A;  3PUF A;  1O4X A;  1IUY A;  2Q8K A;  1Z7U A;  2V1X A;  3I53 A;  1SVL A;  4N4O B;  5FLV A;  3GTP J;  5CPR B;  3OSG A;  1LE8 A;  4IEJ A;  1JE8 A;  2HDD A;  2XAU A;  3OV8 A;  2J5P A;  2Z33 A;  3TDZ C;  2HWV A;  3RPU D;  1MZB A;  2C6Y A;  2VI6 A;  4LOC A;  1FEX A;  3A01 A;  2DFH A;  2R92 J;  1R5I D;  1Y39 A;  4ZYH A;  1OYI A;  5TRD A;  1GT0 C;  3D1N I;  4P9F A;  2L01 A;  4MEX F;  2XSJ C;  3FM3 A;  3LMM A;  4L9N A;  2MA3 A;  3TO7 A;  4MIM A;  5HLI A;  1X4O A;  1LQ1 A;  1AWC A;  2QSH X;  1XGM A;  2Y48 A;  3L00 A;  2DQL A;  2DFF A;  1WH7 A;  2LOO A;  3HEF A;  3RPU A;  2HVS A;  4AM3 A;  3BR1 A;  2ECB A;  3C7J A;  1R1V A;  3MCZ A;  3CP8 A;  3RKX A;  1AA7 A;  3VSK A;  3O8H A;  5FB2 A;  4OAZ A;  5AON A;  5C4X J;  4XR6 A;  1WJ5 A;  1YX3 A;  2BY2 A;  2L4M A;  4HF2 A;  5K1Y A;  3EUH A;  4NB5 A;  3GFI A;  3PFI A;  4E7I A;  1FZP B;  2VT3 A;  1R4N B;  1NHA A;  3KX2 A;  1R1U A;  4RGR A;  1YYV A;  2QEN A;  3HJE A;  5DUK A;  3RSN A;  3CDL A;  4AU7 A;  4AYB N;  1R36 A;  5TIS C;  1V54 H;  5C4J J;  2ELK A;  3A0H C;  2P6T A;  4PJN A;  3SQN A;  3L09 A;  4G8X A;  4L18 B;  2M4G A;  3FXK A;  1Y6I A;  4IHT A;  1J9I A;  5E17 F;  1Z3Y A;  2DFE A;  3U1K A;  3KP6 A;  4LIT A;  2LF8 A;  1X1A A;  2OC6 A;  3K2A A;  3U1D A;  4CZC A;  3MD2 A;  2NVU B;  4ZH4 F;  3ONQ A;  3SJM A;  2O0Y A;  2A69 F;  3JTG A;  3VSL A;  1XB4 A;  3KP4 A;  5ICE A;  3HUG A;  3ZQG A;  2E2H J;  4PSW A;  2KT0 A;  2OCE A;  2DTZ A;  4IF4 A;  2TRT A;  4RGU A;  4FAS D;  3FWE A;  3IAM 2;  2D1V A;  1FOX A;  2D2W A;  1FP1 D;  5F0C A;  2A5Y B;  4BQN A;  2CYY A;  1R7J A;  2HYF A;  2PLY A;  2R7O A;  3MN2 A;  1ZRD A;  2EJR A;  4AYB A;  2GBY A;  2JJ7 A;  2ECC A;  1R1T A;  1G8X A;  3E97 A;  2JRT A;  1K61 A;  3U21 A;  2BEO A;  4UVC A;  1HA8 A;  4HDV A;  1DDN A;  1IN5 A;  4NBQ A;  1A5J A;  5J4V A;  5EGO A;  1SD5 A;  1TNS A;  5L3F A;  1YJN I;  2K02 A;  1STZ A;  1U78 A;  2ETH A;  2RC4 A;  2OA4 A;  3ZOB A;  5J8C A;  1EA3 A;  2M45 A;  4IX7 A;  5DM6 F;  4AC0 A;  1UG2 A;  1Z05 A;  5J1R A;  2V79 A;  4M3D A;  3FDY A;  3CMM A;  1L0O C;  4HV6 A;  5BS6 A;  1FLI A;  5BPI A;  3HRT A;  4NQW B;  2VLA A;  2COM A;  3ABM H;  2IS6 A;  1J75 A;  1XMA A;  3OY9 A;  2M34 A;  4E7K A;  3ECH A;  2LLK A;  5E8I A;  2XHK A;  3QOD A;  4EQQ A;  3RPQ A;  4UB8 C;  3WOD F;  3CCQ I;  1ERD A;  1BR4 A;  1NG7 A;  2VBZ A;  2EA2 A;  4UUS A;  4ON0 A;  4A5N A;  1ZH5 A;  1B9N A;  2WY8 Q;  3IUO A;  3UR3 C;  4BU2 A;  1W36 D;  3W3C A;  4YEL A;  1ZEL A;  5J1U A;  2LK2 A;  2OQG A;  4OWR B;  1U5T A;  3ZMT A;  4B3X A;  5DDG A;  3OYN A;  3BJ6 A;  1IXC A;  2XF6 A;  4WX9 A;  1F1Z A;  1FY7 A;  1YI2 I;  1CQT A;  3KYC B;  3BTJ A;  3I5U A;  2ICW G;  1JT0 A;  3GFL A;  1LEB A;  3IHU A;  3V7R A;  3S3N A;  4JP0 A;  1K78 B;  2OU2 A;  3GCM A;  1KYW A;  2EV6 A;  4I0A A;  2MBF A;  5DCF A;  2EIJ H;  2EIK H;  3T5X A;  4IRI A;  3DPT A;  2LYC A;  3DLA A;  2VOP A;  5FFZ A;  3BR2 A;  1GDT A;  3TMO A;  4PJ0 C;  1Y8R B;  3DF8 A;  4IHW A;  1K79 A;  4DYQ A;  1YW8 A;  4AWX B;  3VYS B;  4X6A J;  2EZL A;  1W7P D;  5B3S H;  4BAC A;  1BL0 A;  2E1O A;  3H5A A;  5TGT A;  1W4M A;  2RAE A;  1VQ7 I;  3FXR A;  1LDJ A;  4RAF A;  2DOF A;  3PNY A;  5K5R A;  3OS1 A;  1LFP A;  1R5H A;  2P4W A;  2ME6 A;  3WTY C;  1KZH A;  4B43 A;  1SD6 A;  2LKX A;  1A6Q A;  5HS9 A;  2FQ3 A;  3F8N A;  4EJO A;  4CZZ A;  1MSF C;  3GZ6 A;  4FET A;  3CDH A;  1NH3 A;  5GP9 A;  1Y0N A;  2QYO A;  3BTI A;  2FXA A;  1TZL A;  1TT0 A;  4H0E A;  2XC7 A;  3LNQ A;  4BEH B;  4GGG A;  3S3M A;  3CMA I;  4Z6Y A;  4EAT A;  1OQY A;  4S04 A;  4YFN F;  2PJR A;  2PEX A;  2TDX A;  2FNP A;  3KCC A;  1VQ4 I;  2M3A A;  4XON A;  1B9M A;  1HC8 A;  5BPD A;  1K6Y A;  1T6S A;  3H9Q A;  4H4K C;  5DV5 A;  3B73 A;  3I56 I;  3CF2 A;  2VE8 A;  4M3G A;  3EUH C;  1HQC A;  2Q0O A;  1V5F A;  3DFG A;  5BNG A;  1SD7 A;  4PZJ A;  4C2U A;  1V3F A;  1R22 A;  2XRL A;  3BDD A;  2OAZ A;  4E6K G;  4WF2 A;  1YIO A;  4WXC A;  4O5V A;  3SZG A;  1FIP A;  1WH5 A;  3HGY A;  2RVC A;  1MD0 A;  2FU4 A;  2W4S A;  5E3O A;  2X0L A;  1BR2 A;  3O2P E;  1SFO J;  1FJL A;  4A0X A;  2GLO A;  1D3Y A;  3OYL A;  2FUG 2;  3H5N A;  4QTR A;  1YE9 A;  2MH9 A;  4BY7 J;  2EIM H;  4AUX A;  4BYY A;  3GTQ J;  2XPW A;  4WXD A;  2VN2 A;  1Z21 A;  2YU3 A;  1FOK A;  3K9T A;  3M8E A;  3DKY A;  4YIR X;  1Y1V J;  4ITV A;  4KJZ A;  2IS1 A;  3K6G A;  1YRN B;  1IN7 A;  5F08 A;  3CUQ A;  1JHH A;  2BZT A;  3HM5 A;  4N9I A;  2W25 A;  2F5V A;  2ZSH B;  3O8G A;  3ZMU A;  2LRE A;  2DA4 A;  1FOW A;  2E1M B;  1OYW A;  1YHQ I;  1OR7 A;  3RIR A;  3C2B A;  2EB7 A;  3DV8 A;  1YLF A;  3I4P A;  4E4H A;  4EJV A;  4XLP F;  4KMF A;  1Z1D A;  3JW4 A;  5LD2 C;  3DU6 A;  2LBF A;  4DBR A;  3CCR I;  2HXI A;  1SVM A;  4HF0 A;  2DMP A;  5HLT A;  4IHX A;  2O8X A;  2XIG A;  3RQ4 A;  3VEP A;  1MIJ A;  2CRG A;  1IUF A;  3HRU A;  2UWM A;  1G3W A;  3OWT A;  2WC2 A;  4OMZ A;  2KIF A;  3GO5 A;  1MBG A;  2VJ4 A;  3GYH X;  4HF1 A;  2V6E A;  3RYR A;  3A0B C;  4KT5 C;  2HYJ A;  2LY2 A;  1OJL A;  1JUS A;  5JR3 A;  3I64 A;  1ZG3 A;  1R4M B;  3K69 A;  1O57 A;  2E7W A;  3PL8 A;  4BGD A;  5IT3 A;  1BIA A;  4FE4 A;  3KE2 A;  1BW6 A;  4YRV A;  2LD5 A;  2CQQ A;  1A31 A;  2QWW A;  3FIS A;  4MLO A;  5FLM J;  1OFC X;  2CWE A;  1XS9 A;  3DEU A;  1RPW A;  3G2B A;  4V2F A;  2J5O A;  2DPD A;  4UVB A;  3E5U A;  1MNM C;  2VBY A;  1RUO A;  2JWT A;  1ITY A;  2K9Q A;  1POG A;  1TQI A;  5DUI A;  3PSF A;  3S2D J;  2EWN A;  5CJ9 A;  1U5T C;  4P9U A;  3FKJ A;  1WSU A;  2WTE A;  2BXY A;  2HOT A;  1MH4 A;  3AG1 H;  4HQM A;  2A5W A;  3Q9S A;  3HOW J;  2FRH A;  3RDI A;  2NRA C;  1ETQ A;  3PNV A;  1NK2 P;  3NQO A;  3KP3 A;  1D8K A;  3FHN A;  2GQQ A;  3I0T A;  4R79 A;  1XDU A;  3N05 A;  4A3E J;  3CCJ I;  3K4C A;  2KRF A;  1KU2 A;  2JQ7 A;  4ZJZ A;  3C1D A;  1I6X A;  1Z91 A;  4A6E A;  1YO5 C;  3CUO A;  2JVH A;  3FXJ A;  3LST A;  1MJA A;  2HQR A;  3GUD A;  5HVQ C;  1ORK A;  3HIF A;  1SFX A;  2IA2 A;  1B4A A;  4UB6 C;  1X1B A;  3DKX A;  2PN6 A;  3GEZ A;  3HC7 A;  2R5Y B;  3RCO A;  4ZZD A;  2KIQ A;  2ZJP F;  4KIC A;  2RV8 A;  3GME A;  2QQB A;  2A05 A;  2E36 A;  5GTI C;  3QPL A;  4BJ6 C;  4ZDL A;  2R7U A;  2QCO A;  3JTH A;  3ZMS A;  3LA3 A;  1Y1W J;  2QBY A;  3FM5 A;  4YEJ A;  1ZGA A;  2V1D A;  2V9P A;  3H92 A;  1LKX A;  1S6L A;  1BJA A;  2KFD A;  3HTU A;  2WV0 A;  2CUZ A;  2NXN B;  2YX7 A;  2R0Q C;  4A3I J;  4UNO A;  2VKD A;  2UXX A;  3H3U A;  3JRG A;  3OMY A;  4M6V A;  3EET A;  5E3L A;  2P6S A;  3ZCO A;  2ESN A;  4RB0 A;  3REO A;  2L7F P;  2JSC A;  2BHY A;  3OR2 C;  4RAY A;  2M0M A;  2GOM A;  1CF7 A;  2VB6 A;  2NYX A;  2XPV A;  2ZO4 A;  3HGG A;  4FX0 A;  4E7J A;  2YU9 J;  2OJE D;  1N25 A;  4YFK F;  4Y52 J;  2H1K A;  1U6G A;  3H0D A;  2A6H F;  4HX8 A;  1XCV A;  5D4S A;  4JBA A;  3BJO A;  1PUF A;  3FIW A;  5FKK A;  4XLA A;  1OCC H;  1UST A;  5JLW A;  2BHZ A;  3F3X A;  2DXI A;  9ANT A;  2P7C B;  4PFP A;  2DDA A;  2CUF A;  3NRV A;  1YW9 A;  4R1H A;  2DA1 A;  4WCG A;  2GXG A;  2DFI A;  4DOZ A;  4XQF A;  4CIC A;  4MGR A;  1GLN A;  2B0L A;  4MTE A;  3V4G A;  1MDM A;  1KQ8 A;  5KK1 A;  4PJM A;  3ISP A;  1JXS A;  4HG2 A;  1W1W E;  3P9K A;  2O7O A;  2OZU A;  1JGS A;  1RR7 A;  2XAQ A;  5LHG A;  4MHG A;  2NAZ A;  4BE2 A;  1W0T A;  3ZGK A;  3OOP A;  3ZQH A;  4EM0 B;  4CYD A;  4IO9 F;  3CUQ C;  3OYE A;  3DTI A;  5EEA A;  4XKV A;  1ZAR A;  2YS9 A;  1XCB A;  4Q4Z F;  2ZME A;  4B1R A;  4OIQ F;  4DJA A;  1OR7 C;  4CCK A;  4HAM A;  1HSJ A;  1FSH A;  3FXQ A;  3SDG A;  1T33 A;  2CQ7 A;  2XKP A;  3K1N A;  1MBK A;  2IGM A;  4PDK A;  3WTT C;  3JRH A;  2QSG X;  3X2Q H;  3CCL I;  3HSE A;  3CC4 I;  1WVR A;  3HOS A;  4DZP A;  1D1A A;  1FYL A;  3QU3 A;  2FE3 A;  4BKX A;  1WI9 A;  5GAH J;  2L2O A;  5CVI A;  5IT9 Z;  1QZE A;  4AVP A;  3SZP A;  4QPO A;  2HXO A;  4U0V A;  1LVK A;  2HKO A;  4FIS A;  3ABK H;  3CCU I;  5IT9 K;  1I39 A;  3TP0 A;  1U8B A;  2E19 A;  1WJA A;  1OPC A;  2E71 A;  3I71 A;  4UV8 A;  1V4R A;  5C44 J;  3ZR8 X;  3K10 A;  3LOC A;  3DEW A;  1TT5 B;  3MKW B;  3BR6 A;  3BG3 A;  1JKR C;  2E5Z A;  1P92 A;  5M5X J;  4CO8 A;  3OYI A;  1IDZ A;  4Y33 A;  1ZK8 A;  4P5O A;  3GTL J;  2R7X A;  1DP3 A;  3HOY J;  2Z5U A;  2QLZ A;  2VC0 A;  1KYZ A;  1E17 A;  2VT2 A;  1T39 A;  3G3Z A;  1IAW A;  3HKZ A;  4KN7 X;  5GAG J;  4XLN F;  1HXD A;  2DAO A;  1IN4 A;  2IGK A;  2QKM B;  2FMY A;  2QEX I;  2Q2E B;  1IGN A;  2K27 A;  1QVU A;  1T56 A;  1ZRE A;  1FYK A;  4YG2 F;  4ZDP A;  3L2C A;  4G6D A;  1UMQ A;  2MD0 A;  2O03 A;  1HW2 A;  1A04 A;  3IC7 A;  1B72 A;  5TJJ A;  4KT6 A;  4LG0 B;  2Z16 A;  1ETW A;  4KDP A;  1ZRF A;  3LSP A;  2QQA A;  4B47 A;  1R5G A;  5HLH A;  2HI3 A;  3KP7 A;  3VYT B;  2LR8 A;  2JPC A;  2GA1 A;  1WJE A;  1IRZ A;  2ZSI B;  4BUP A;  3WTX C;  1IRF A;  2JZY A;  1KA8 A;  1P4A A;  3ERM A;  4TV7 A;  2W82 A;  1QRY A;  2FBK A;  1ACI A;  4II3 A;  5D5U B;  1N75 A;  1F4K A;  2CO5 A;  2M30 A;  3SFZ A;  2Q1Z B;  3JAM K;  5HS7 A;  3KZZ A;  1HDD C;  4CUG A;  2F5C A;  3TL4 X;  3HOV J;  2BYV E;  2ZC2 A;  3AKZ A;  1XN7 A;  3IWZ A;  1FMW A;  1W5T A;  5HDG A;  5CVV A;  1QHG A;  2FQ4 A;  5DTD A;  2P5L C;  2X6O A;  3BWG A;  1UHS A;  4JQF A;  2W7N A;  3DCF A;  2JT1 A;  2R7F A;  4P55 A;  3M07 A;  2LKS A;  3PO3 J;  1QO0 D;  2FA5 A;  1TLH B;  1D0X A;  2X6Y A;  1NTC A;  3KEY A;  4NUB A;  4ZTJ A;  2YPR A;  3W2W A;  3C3W A;  3S1Q J;  3G1M A;  2XGD A;  1ZTR A;  1N78 A;  4BBS J;  1TTY A;  4U0Y A;  1U9O A;  1ZR2 A;  1HW5 A;  3U2R A;  3K70 C;  3RKW A;  2CV2 A;  2HOE A;  4P1W A;  4Y15 A;  2HVQ A;  2V6C A;  2EQR A;  3F0C A;  4UY8 I;  1MGT A;  3RZD J;  1T08 B;  2F4O B;  1SC7 A;  5JI6 A;  2Z99 A;  2LF7 A;  1ETK A;  5IP7 J;  3W2A A;  4CYC A;  1XGO A;  1BC7 C;  2VKH A;  5H6R A;  3TW6 A;  2NNN A;  3QU6 A;  4A3D J;  2KZV A;  2KIU A;  2X1E A;  4RB3 C;  4G7H F;  2R7S A;  2LDU A;  2VQC A;  3T1B A;  1APL C;  4BDZ A;  3WG9 A;  1ZGJ A;  4F93 B;  1W5S A;  3BPX A;  4LJZ F;  3E6C C;  2BY3 A;  2KKO A;  4RLQ A;  1DGW Y;  2IPQ X;  2QQ8 A;  2DO7 A;  1I1S A;  1MJB A;  2QZ8 A;  3BZ6 A;  2FOW A;  2LFB A;  2CQX A;  4F3Q A;  2W00 A;  1OCO H;  4HSR A;  2OCC H;  2ZKZ A;  3KEQ A;  5GTH C;  4M73 A;  2H1L A;  4RGS A;  4BBR J;  4OIP F;  1VQ9 I;  2IP2 A;  4BAY A;  3RYP A;  2R5Z A;  5DEQ A;  3A4C A;  5IYD J;  5EYR A;  1QNT A;  1ZKG A;  1ETV A;  2ZME C;  3OYD A;  3SEZ A;  2XUB A;  4FHT A;  1BOB A;  4KA4 A;  1B8I A;  1EJ9 A;  4NDL A;  4UXN A;  2EH3 A;  3QYE A;  1XSD A;  4OAY A;  1RC9 A;  3HXL A;  4DGW B;  2CQN A;  4UUV A;  1X2M A;  4OMY A;  3CCY A;  2LY1 A;  2W48 A;  4EJT A;  3DEE A;  3IH3 A;  1Z9C A;  3HRS A;  1S9H A;  3GFJ A;  4CCM A;  2Y0S A;  4YII A;  1IN8 A;  2BGC A;  1U9N A;  3C18 A;  3DBL B;  3LSK A;  3BG9 A;  1S7O A;  1UAA A;  4F52 A;  3DLL F;  3A2K A;  3E7L A;  2LRD A;  5E79 C;  3D5L A;  2GAU A;  3K4K A;  3CES A;  4U7D A;  2O3F A;  1PDN C;  1MMD A;  4I2O A;  3RI4 A;  2HQA A;  4XLE A;  1ONV A;  1SMT A;  2BE5 F;  1FIA A;  1BR1 A;  2NS8 A;  3K4L A;  2I8D A;  1RIO H;  2E2J J;  3JRC A;  3ZMD A;  4M6X A;  1LFU P;  4IVN A;  4Y13 A;  1SEU A;  4HOB A;  5FRM A;  2P5K A;  3EQL F;  2JA5 J;  1BM9 A;  1KGS A;  1O7F A;  2MAB A;  1JTX A;  5J40 A;  3WE2 A;  3HOX J;  2IVM A;  3SYT A;  2WB1 N;  5CVU A;  1E0E A;  2NVY J;  5L3B A;  5HS8 A;  1O3T A;  4C2T A;  3RTR A;  5D4R A;  4OIR F;  4XNF A;  4NC8 A;  2XF7 A;  2K3F A;  1MJ9 A;  4HEA 2;  2HU9 A;  3FBN B;  3E6B A;  3KLN A;  5GAD J;  5LRS A;  1MH3 A;  2FX0 A;  4LG3 A;  2ACJ A;  2LTP A;  5DD4 A;  1QHH D;  3OR1 C;  4EMS A;  1VFC A;  4C3H J;  2W24 A;  2L7M P;  4D5F A;  2XGC A;  4AD9 A;  3GLX A;  1U8R A;  4HPQ A;  3JSP A;  2DT6 A;  4A3B J;  1RNL A;  2DBB A;  2FOK A;  2GA2 A;  4Y4R A;  5IY5 H;  1HCR A;  5IP6 A;  3GTJ J;  2HQN A;  2VC1 A;  3W2V A;  2E1N A;  3M7G A;  5B5E C;  1R71 A;  5BOX A;  1Y8Q B;  2K40 A;  4QSH A;  3BQY A;  5D8L B;  1QGP A;  3I4N J;  2DW4 A;  3E5Q A;  4XN0 A;  3SEQ A;  1ZYR F;  2VL8 A;  5B1A H;  5F64 A;  4A0Z A;  3NAU A;  5FJ8 J;  2LKP A;  2WB1 A;  2MW8 A;  3PQK A;  4M3B A;  2JMW A;  1FTT A;  1I5Z A; 
#chains in the Genus database with same CATH homology
 2HYJ A;  1DU6 A;  1OJL A;  2L9R A;  1JUS A;  4MFE A;  4XID A;  2HOA A;  2CJJ A;  4IHY A;  3BR0 A;  4M3E A;  5M5Y J;  2Y0S N;  1Z77 A;  3BT9 A;  2OF7 A;  4FE4 A;  1H8A C;  1BW6 A;  3CMY A;  3S16 J;  2LD5 A;  2IEK A;  3M4O J;  4M3F A;  1XC5 A;  2CQQ A;  1TWA J;  1X58 A;  3Q0W A;  3FIS A;  3HOZ J;  1EF4 A;  4MLO A;  5FLM J;  1OFC X;  1VF9 A;  1XS9 A;  2DA7 A;  2NS7 A;  1RPW A;  3Q0V A;  5FKL A;  4V2F A;  3NAR A;  1MNM C;  2JWT A;  1ITY A;  2K9Q A;  1POG A;  3L1P A;  3S2D J;  2DJN A;  1YRN A;  3FKI J;  2HOT A;  1MH4 A;  1PUF B;  1NK3 P;  4A3C J;  3QPS A;  3CQZ J;  5IYC J;  3JRA A;  3HOW J;  5IP9 J;  1ETQ A;  5EZH A;  2KDZ A;  2WAQ N;  1OCP A;  4JYK A;  1NK2 P;  1JKQ C;  1IDY A;  5IOZ A;  2L0K A;  4A3E J;  5F27 A;  5J1Y A;  1ENH A;  3IV5 A;  1S7E A;  2OPT A;  1ZGW A;  2YUS A;  4L5E A;  1F36 A;  1ORK A;  2PMZ N;  5HOD A;  1JJ8 C;  4JX6 A;  2R5Y B;  3GTO J;  3BG5 A;  1LE8 B;  1AU7 A;  3A02 A;  1GV5 A;  2FJ1 A;  3QPL A;  2QCO A;  2Y30 A;  1Y1W J;  2IBD A;  5F1J A;  3WHC A;  3A01 B;  3BR5 A;  3K7A J;  2I10 A;  2XGE A;  1RKT A;  2R0Q C;  4A3I J;  2M8G X;  4W97 A;  4FE7 A;  3BTC A;  3JRG A;  5FKM A;  3S1N J;  4M6V A;  2VPR A;  2LVS A;  4XRS G;  3UKG A;  5E3L A;  2NOG A;  1AKH B;  1MBJ A;  2L7F P;  2GM4 A;  3BTL A;  2ID6 A;  3VPR A;  2XPV A;  3HGG A;  3FK7 A;  1JUM A;  3TW7 A;  2YU9 J;  2JA6 J;  4MO7 A;  4G12 A;  2R7Z J;  4Y52 J;  2H1K A;  4RDU A;  1R9T J;  2XB5 A;  5J3L A;  3B6A A;  4HNV A;  2DA2 A;  1PUF A;  3FIW A;  5C3E J;  5FKK A;  1K83 J;  5FKO A;  4W1U A;  5JLW A;  3JRB A;  2X9D A;  2HOS A;  3GTG J;  9ANT A;  1TC3 C;  2VKV A;  2CUF A;  5GPA A;  3ZQL A;  2DA1 A;  2DMQ A;  3ZQC A;  3JRF A;  1LFB A;  2NVQ J;  1OCT C;  4GFB A;  2M0C A;  4C2M J;  1O4X A;  2G0E A;  2O7O A;  1RR7 A;  4DYC A;  3TED A;  1TWH J;  1W0T A;  5FLV A;  3GTP J;  3ZQH A;  2R5Y A;  5DS9 A;  1HOM A;  3OSG A;  2ID3 A;  2Y31 A;  1LE8 A;  3GTM J;  5F0H A;  4IEJ A;  1BW5 A;  4C3J J;  5EEA A;  2E2I J;  3FK6 A;  3SFI A;  2HQ5 A;  2HDD A;  2YS9 A;  1MSE C;  4B1R A;  3HOU J;  1B72 B;  2VI6 A;  4S0H B;  4LOC A;  1FEX A;  3A01 A;  3SDG A;  2R92 J;  1T33 A;  1RKW A;  3JRH A;  1IG7 A;  1MBK A;  2FD5 A;  3JRD A;  1GT0 C;  3RKQ A;  2Y9Y A;  3D1N I;  1HF0 A;  4FTH A;  2O9L A;  3S14 J;  3RZO J;  1GVD A;  3LSG A;  4DZP A;  4MIM A;  5EGO B;  1I50 J;  4BKX A;  5E3N A;  3HEF A;  1WH7 A;  2Y9Z A;  2H8R A;  1AKH A;  3LSJ A;  3BR1 A;  2ECB A;  4D7M A;  3O8H A;  4XIC A;  5C4X J;  2HXO A;  3G1L A;  4FIS A;  2CU7 A;  1ZQ3 P;  1U8B A;  3TP0 A;  2E19 A;  2VUM J;  5F04 A;  4DZJ A;  5C44 J;  3LOC A;  2EBI A;  3DEW A;  4X1E A;  4AYB N;  3BR6 A;  3CDL A;  3OSF A;  2MGQ A;  3BG3 A;  1JKR C;  5C4J J;  2ELK A;  5EZG A;  2ZB9 A;  4FCY A;  5M5X J;  2DMU A;  2DMT A;  3HBL A;  4V2G A;  1IDZ A;  1ETX A;  1ZK8 A;  1Q1V A;  4XRM A;  3GTL J;  3K2A A;  3HOY J;  2R93 J;  3MVP A;  3ZQF A;  4A3M J;  4UUS B;  1HDP A;  3SJM A;  1H88 C;  4XK4 A;  1WPK A;  3PM1 A;  3ZQG A;  2E2H J;  2KT0 A;  4A3L J;  2DTZ A;  1IGN A;  5GPC A;  1QVU A;  1T56 A;  4CYC B;  2EZH A;  2TRT A;  3Q3S A;  1HLV A;  1RET A;  1P7J A;  1ZR4 A;  1BJZ A;  1WI3 A;  2N8G A;  2QF7 A;  5F0F A;  4D5C A;  1UMQ A;  1TWC J;  1B72 A;  2L7Z A;  5F0C A;  5EDN A;  4D7N A;  1ETW A;  4BXX J;  4A69 C;  3MN2 A;  1E3O C;  3LSP A;  2GBY A;  2JJ7 A;  2ECC A;  2DA6 A;  2HI3 A;  2LR8 A;  1K61 A;  1IRZ A;  4A3K J;  5EF6 A;  1MBF A;  4RBO A;  1A5J A;  2VKE A;  2ME0 A;  5EGO A;  1IJW C;  2O8K A;  1U78 A;  1DU0 A;  1QRY A;  2LP0 A;  2LY9 A;  3ZOB A;  2R5Z B;  1MBH A;  1HDD C;  2JN6 A;  3S1R J;  4IHV A;  3HOV J;  1H89 C;  4AC0 A;  3S1M J;  1UG2 A;  5J1R A;  3S15 J;  4M3D A;  2XPU A;  5IPA A;  2FQ4 A;  5DTD A;  2X6O A;  1JTY A;  5EG0 A;  1B8I B;  1UHS A;  3IH4 A;  3DCF A;  5M3M J;  3PO3 J;  2M34 A;  1NTC A;  1GUU A;  2CUE A;  2LLK A;  3S1Q J;  3G1M A;  2XGD A;  3OIO A;  1ZTR A;  4BBS J;  2NVT J;  1U9O A;  1ZR2 A;  1JUP A;  2EZI A;  3I4M J;  4UUS A;  5K7F A;  4J19 A;  2XB0 X;  3S2H J;  2MSY A;  2EQR A;  2TCT A;  3F0C A;  3RZD J;  3RQI A;  3H3V K;  5J1U A;  2LK2 A;  3JRE A;  2IAI A;  1ETK A;  5IP7 J;  1JKP C;  4CYC A;  2DA3 A;  2JA7 J;  3TW6 A;  1CQT A;  4A3D J;  1I3Q J;  4A3G J;  3ZQI A;  3BTJ A;  4XRS A;  1JT0 A;  1APL C;  2B63 J;  4JP0 A;  3HKZ N;  1IV6 A;  4ABZ A;  3BQZ A;  1I6H J;  2DA5 A;  3BR2 A;  1GDT A;  4I76 A;  4JX4 A;  4DW6 A;  4IHW A;  2LFB A;  4DYQ A;  1A6I A;  2CQX A;  4X6A J;  2EZL A;  4A3J J;  4BBR J;  3PO2 J;  1BL0 A;  2E1O A;  1TWF J;  4BY1 J;  2R5Z A;  2RAE A;  2JA8 J;  3LSR A;  5EG0 B;  1ETO A;  4MFD A;  5IYD J;  2COB A;  5EYR A;  2ME6 A;  1ZKG A;  1ETV A;  2WV1 A;  5K7H A;  2MG4 A;  1JKO C;  2LKX A;  1VND A;  3G1O A;  1B8I A;  5M3F J;  1MSF C;  4NDL A;  2EH3 A;  2DN0 A;  1TWG J;  4C3I J;  5GP9 A;  1F43 A;  2AO9 A;  3BTI A;  1X2M A;  3LNQ A;  3CCY A;  2W48 A;  3HB9 A;  2M9H A;  3IH3 A;  3IH2 A;  2JK3 A;  5FKN A;  1MBE A;  1Z0X A;  3HDD A;  1U9N A;  1JJ6 C;  3BG9 A;  2D5V A;  1RES A;  2K9N A;  3OOU A;  3E7L A;  3GTK J;  1P7I A;  2AHQ A;  4JX5 A;  2X48 A;  4M3G A;  3MKL A;  5BNG A;  2XRL A;  1FTZ A;  3WHB A;  2M2E A;  1FIP A;  5JLX A;  1FIA A;  1WH5 A;  3Q0U A;  2DMN A;  3H0G J;  3HGY A;  2NS8 A;  3M3Y J;  4DYR A;  1QPI A;  1FJL A;  1ETY A;  5E3O A;  1SFO J;  2GLO A;  2E2J J;  3JRC A;  1W0U A;  1LFU P;  4Y7N J;  4B4C A;  3A03 A;  5E3M A;  1JGG A;  4QTR A;  2JA5 J;  4EEF G;  4BY7 J;  3GTQ J;  4AUX A;  1X2N A;  2XPW A;  1JTX A;  3HOX J;  2P81 A;  2WB1 N;  5M5W J;  1BA5 A;  4UUT A;  2NVY J;  1IC8 A;  1SAN A;  3QQA A;  1XG1 A;  1JT6 A;  1Y1V J;  1D5Y A;  3JR9 A;  1WGX A;  3GBG A;  3B6C A;  3W6V A;  1YRN B;  5F08 A;  3HM5 A;  1MH3 A;  4A3F J;  2Y2Z A;  2FX0 A;  2NVX J;  3O8G A;  2LTP A;  2XSD C;  1GV2 A;  2DA4 A;  4C3H J;  1VFC A;  2L7M P;  4D5F A;  2XGC A;  2K9S A;  4A3B J;  4QIW N;  1WCM J;  5K7Z A;  1HCR A;  3C2B A;  5IP6 A;  3GTJ J;  4A93 J;  2EZK A;  1QVT A;  2HXI A;  2K40 A;  3BR3 A;  4QSH A;  3BQY A;  2DMP A;  1AHD P;  3I4N J;  4IHX A;  2CRG A;  1IUF A;  3NAU A;  5IOY A;  5FJ8 J;  4B3A A;  2MW8 A;  4I6Z A;  1MBG A;  3JRI A;  5IYB J;  4M3B A;  3TP3 A;  3S17 J;  1VI0 A;  1G2H A;  2JMW A;  1FTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...