4A3LJ

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3lJ00
4RBOA 2EBIA 3TW6A 4G12A 4A3DJ 4M3DA 2L0KA 5EGOA 3S1MJ 4M3FA 1IV6A 1IDYA 5EYRA 3VPRA 1JUSA 5F0HA 1NK2P 2ECBA 3W6VA 1K83J 2EH3A 3HOYJ 2XGCA 5EG0B 3BTLA 3Q0VA 5FKMA 4CYCA 4FCYA 2DA5A 2M34A 4DW6A 5IOZA 1JTXA 3TP3A 2NOGA 5C44J 3E7LA 3HOWJ 3GTGJ 4BY1J 3TP0A 2NVXJ 3DEWA 4C3HJ 3GTLJ 3GTPJ 3RZOJ 3HOXJ 1XS9A 1WCMJ 4C3JJ 2DMUA 1JGGA 3BR1A 1U9OA 1CQTA 3O8HA 1APLC 3LOCA 5J1RA 1ZR4A 2LLKA 4Y7NJ 2CJJA 3G1LA 3S1QJ 2IEKA 1IUFA 2X48A 4XIDA 1JKQC 3D1NI 4EEFG 4Y52J 4D5CA 4UUSA 5EGOB 1HF0A 3TEDA 4AUXA 5E3MA 1WI3A 3JRFA 2H1KA 2DTZA 1OCPA 4I6ZA 3HOUJ 2CRGA 4A3MJ 3S1NJ 1DU0A 1LFUP 3JRHA 3C2BA 3B6AA 3IH2A 1IDZA 3CQZJ 2CQQA 3MVPA 2VPRA 1GVDA 1JKRC 1MBJA 2OF7A 5DS9A 4D7MA 1UHSA 2XSDC 1WGXA 3QPLA 1ETOA 2JA8J 1F36A 2VKVA 3A03A 3G1OA 1ETQA 3HB9A 1GUUA 5FLVA 1NTCA 1U78A 5F04A 4B4CA 5IOYA 1U9NA 1MBEA 2R92J 2DMQA 3RZDJ 4C3IJ 1H8AC 1WPKA 1SFOJ 3LNQA 3GTKJ 2DMNA 2M0CA 1Y1WJ 3LSGA 4A3CJ 2XPVA 1AU7A 5E3OA 2NS8A 2FQ4A 2L7FP 5F27A 3S17J 2NVTJ 4D5FA 2HYJA 1ZGWA 2XB5A 2NS7A 3A02A 3ZQCA 1XG1A 1I3QJ 4IHYA 2E1OA 1VF9A 5M3MJ 1XC5A 3HBLA 1ETKA 4UUSB 2Y31A 1Q1VA 4A3KJ 1JJ8C 3HOVJ 3BR2A 3Q0WA 3PO3J 1IRZA 3BTIA 1Y1VJ 2QCOA 3JR9A 1D5YA 1ENHA 1QRYA 3B6CA 3BR3A 1OCTC 1G2HA 4W1UA 3FK7A 3IH4A 5FKKA 2ME0A 1RKTA 5FKNA 2L7MP 4C2MJ 3BTJA 1QVUA 1OFCX 1RPWA 2ID3A 2MGQA 1UMQA 2IAIA 3H0GJ 3FIWA 4IHWA 1VFCA 2E2JJ 2OPTA 4S0HB 2XGDA 2LVSA 2L9RA 2X6OA 3Q3SA 1MSFC 4DYCA 4FTHA 1T33A 2K9SA 2H8RA 2ME6A 1GDTA 2VI6A 3S14J 1BA5A 1E3OC 2WB1N 2K9NA 2VUMJ 1JKPC 1BW5A 1B72A 2R0QC 4JYKA 2HOTA 3WHBA 2FX0A 3BR5A 3PM1A 3I4MJ 1X2MA 1ORKA 4I76A 5EDNA 5M5WJ 2GM4A 3GTQJ 5IYBJ 1FIAA 4A69C 1IC8A 2O7OA 1PUFA 2LR8A 3FK6A 4A93J 3NAUA 2P81A 1HCRA 4M3GA 5IPAA 3WHCA 3LSRA 2R5ZA 1B8IA 3HOZJ 2O9LA 1WH5A 3FISA 2WAQN 2CQXA 2MSYA 2Y0SN 4A3IJ 2DMTA 1MNMC 2Y2ZA 2M9HA 2HXIA 1GV2A 2NVQJ 1DU6A 1ZQ3P 2K40A 4M6VA 5JLWA 4X6AJ 1BL0A 1ZTRA 3MKLA 3CMYA 1MBGA 2DMPA 1YRNA 1MBHA 2E2HJ 3JRBA 2DJNA 1RKWA 4IEJA 1W0UA 1R9TJ 1MH3A 4UUTA 1H89C 3F0CA 5F08A 4ABZA 2W48A 1JTYA 4CYCB 1LFBA 2AHQA 2LD5A 1BW6A 1B72B 4BXXJ 1Z77A 2E2IJ 4BBSJ 2XRLA 2M8GX 1SANA 3ZQIA 2JA5J 4MFEA 1VNDA 4L5EA 4J19A 3JRGA 5HODA 1FTZA 2XPWA 2CU7A 4XRSA 5E3LA 1POGA 2VKEA 5C4JJ 2R5YA 2R7ZJ 3BQYA 3IV5A 1PUFB 3LSPA 3TW7A 2YUSA 2DA1A 3S2DJ 3BR6A 1FJLA 2GBYA 1JT6A 4A3FJ 3ZQLA 3M4OJ 2R5ZB 1B8IB 4JX4A 4DYQA 1LE8A 5GP9A 3GTOJ 1TC3C 1ETVA 1OJLA 5BNGA 1FIPA 4GFBA 1AKHA 2XB0X 1I50J 2EZKA 5GPCA 2WV1A 2JA7J 3QPSA 1YRNB 1ZK8A 5JLXA 3HEFA 1TWHJ 3Q0UA 1GT0C 2EZLA 5M5YJ 2Y9ZA 2JK3A 2DA4A 3ZQHA 2HXOA 1P7JA 1HLVA 1MBKA 1A5JA 2NVYJ 5J1YA 3S15J 3LSJA 1RR7A 2DA2A 4XICA 4RDUA 2Y9YA 2R5YB 1QPIA 4MIMA 2DA6A 1TWAJ 2N8GA 5F1JA 2LK2A 2ZB9A 3M3YJ 2CUFA 1ZKGA 2K9QA 3GBGA 1F43A 3BG5A 4NDLA 1LE8B 3BR0A 5FKOA 2JJ7A 4FISA 2JN6A 1K61A 4BY7J 1RETA 1MSEC 2KDZA 1X58A 1U8BA 4W97A 1GV5A 4AC0A 4JX5A 2HQ5A 3SFIA 1JKOC 4BKXA 3S2HJ 4DYRA 2E19A 5J3LA 2CUEA 2YS9A 5IYDJ 3S1RJ 1EF4A 2AO9A 3QQAA 4IHVA 2QF7A 3CDLA 1H88C 1AHDP 4IHXA 2M2EA 4A3LJ 3OSFA 2TCTA 1NK3P 4JP0A 5M5XJ 1HDDC 3BG9A 3H3VK 5J1UA 3DCFA 2R93J 5IP9J 1JT0A 3RQIA 1FEXA 4XRMA 2X9DA 3CCYA 3MN2A 1O4XA 1UG2A 1TWGJ 2JMWA 5IP7J 2PMZN 2MG4A 4M3EA 2EZIA 3ZOBA 1S7EA 1ETXA 5M3FJ 3G1MA 1X2NA 3NARA 5FLMJ 1HOMA 5F0FA 1VI0A 2ID6A 1HDPA 4QIWN 2HDDA 1IG7A 4MFDA 3HDDA 3S16J 1TWFJ 3HKZN 3SJMA 4A3EJ 3FKIJ 3BG3A 2XPUA 5K7ZA 4FE7A 2ELKA 4A3GJ 4HNVA 5EF6A 1P7IA 2FJ1A 5FKLA 2HOAA 5F0CA 2LTPA 3BQZA 4V2GA 2DN0A 1I6HJ 5C4XJ 1A6IA 3HM5A 2HI3A 5K7FA 3SDGA 5E3NA 1TWCJ 3RKQA 4V2FA 3IH3A 2JWTA 5GPAA 3JRAA 1JJ6C 4MLOA 1T56A 4DZPA 4FE4A 3GTJJ 3I4NJ 3A01A 2DA7A 2DA3A 2RAEA 4MO7A 2MW8A 2COBA 2O8KA 5EEAA 3GTMJ 1IGNA 9ANTA 1ETWA 5C3EJ 3JREA 1W0TA 1JUMA 4AYBN 1FTTA 1MH4A 2I10A 2IBDA 2XGEA 4B1RA 3OSGA 3K7AJ 3ZQGA 2GLOA 4BBRJ 1MBFA 5IYCJ 2JA6J 4A3BJ 5K7HA 4A3JJ 4B3AA 2HOSA 2KT0A 2D5VA 2YU9J 1Z0XA 5EG0A 1JUPA 1RESA 2ECCA 3UKGA 3ZQFA 3K2AA 1WH7A 2EQRA 4XK4A 2B63J 3JRCA 1IJWC 1ZR2A 2EZHA 4XRSG 3HGYA 2Y30A 4X1EA 3JRIA 2G0EA 4QTRA 3PO2J 2LFBA 4QSHA 4DZJA 5EZGA 3BTCA 1BJZA 4D7NA 3BT9A 4LOCA 1QVTA 4M3BA 1AKHB 3A01B 5EZHA 3JRDA 1ETYA 3OIOA 3OOUA 3HGGA 2LY9A 2TRTA 5FJ8J 3L1PA 2FD5A 2LP0A 4JX6A 1ITYA 5DTDA 2LKXA 5IP6A 2L7ZA 3O8GA
chains in the Genus database with same CATH superfamily
2EBIA 4UVAA 3DU6A 3TW6A 4A3DJ 3BZKA 3DP7A 4ZC3A 5F0HA 5FD6A 4RM2A 3K9TA 3HOYJ 5EG0B 2KFDA 3FXQA 2W82A 2Z16A 2CW0F 2DDAA 2KDOA 4L0YB 1RR8C 2M34A 4OIRF 1JTXA 3R6SA 5KNLA 5F1RA 1LUJB 1U5TC 2E1MB 2VJJA 1UELB 1ON1A 4BY1J 4G6DA 3F8MA 2A3SA 3I5UA 4C3HJ 3GTPJ 5DM6F 5B1AH 2M1BA 2A68F 3DXJF 2BZTA 1U9OA 3KP5A 4XNFA 1V54H 1W7PA 2LLKA 3MZ8A 5LD2C 4M71A 3VYTB 2R7FA 3HJEA 4Q4ZF 1OCOH 3OS1A 2HGCA 1V5GA 4XIDA 2MC3A 2DU9A 3L9FA 4EEFG 1YX5A 4Y52J 2CUJA 4H0EA 3BZ6A 2MA3A 4YG2F 5B5EC 3LAPA 2VASA 1HF0A 3TEDA 2OQGA 4TV7A 2QQAA 1T95A 2CG4A 1WI3A 2CS3A 1OYWA 2QZ8A 4AIHA 1QHHD 2VC0A 3TKYA 3F72A 1DU0A 3CD6I 3ZN0A 1IDZA 3OYAA 4RAZA 1YITI 4B47A 2WWYA 3FBNB 2YX4A 3U2RA 4BDYA 1LEBA 2OF7A 1A36A 4D7MA 2XSDC 1WGXA 3WGGA 2P6SA 4FETA 3WGIA 1NTCA 3EUHC 4XN0A 1KU7A 2UXNA 4II3A 2XF5A 3J7AY 2M0CA 4WXHA 4M72A 1G3YA 2NVUB 2CYYA 2FQ4A 1H9GA 3H35A 3KPHA 1Z67A 3S17J 4PSWA 1IF1A 1ZGWA 3H5RA 2M4GA 3J81K 5GAGJ 3ZQCA 3H92A 3J7ZI 3IP4B 1I3QJ 3KP4A 5D4SA 5DM7F 1K4TA 4IHYA 2E1OA 3ELKA 5M3MJ 3HBLA 1ETKA 4UUSB 3HUGB 1GXPA 1Y6IA 1JJ8C 3HOVJ 3PO3J 1Y1VJ 1LQ1A 3JR9A 2W85A 3B6CA 1FSEA 2A6HF 3BCBA 5L3FA 3FK7A 1GXQA 3IH4A 4LLLA 2EJRA 4ESJA 3TDZC 3E6DA 4F7ZA 4E6KG 4BUPA 1ZREA 3ONQA 4OIOF 2QSGX 3CCSI 4GYIA 1SFKA 3CJRB 4BXFA 1DQUA 2MGQA 3CZ6A 1UMQA 3KCCA 1UHMA 2X6XA 2RNGA 3DF8A 4IHWA 3J81Z 2OPTA 4S0HB 4IKFA 2XGDA 1S9HA 2JTVA 2X6OA 4ENNA 1R1TA 1R7JA 4CCJA 1FYLA 4FTHA 2CV2A 1BI1A 4HAMA 1K4SA 1IAWA 1S29A 3AAFA 2ME6A 3TDUC 1GDTA 3LAJA 3UNGC 2K9NA 2LKPA 3QPHA 1W7PD 1QGPA 1B72A 2OU2A 3A0BC 1LVKA 2M87A 3WHBA 5D5WB 1TNSA 4IJAA 2MBFA 3MWMA 1B9NA 3ZMSA 3H9QA 3M1CA 2NS0A 1BI0A 5M5WJ 4HRIA 3GTQJ 3GFIA 1D0ZA 3X2QH 4I01A 3BY6A 2O7OA 1KA8A 1PUFA 1YE9A 4BH9A 1B8IA 3QRFF 4WCGA 4EM0B 3IRRA 1V5FA 3V7RA 1Y8RB 2HYGD 2QYOA 2CQXA 1T39A 4RLQA 2M9HA 1DU6A 1D1BA 2HVSA 1UHWA 3MKLA 2JT1A 2DMPA 3ZMZA 1YRNA 2AQFA 1MBHA 2W84A 3GXOA 1W0UA 1Z05A 5J4VA 2R7DA 3Q9SA 3F3XA 4LB6B 1HW5A 2R4GA 4UUTA 1DP7P 3F6OA 4ABZA 4PFOA 1YX3A 1MMDA 1X1CA 3RTRA 3RCOA 3MKYB 1ODDA 1JTYA 4CYCB 3ZQ7A 4BXXJ 2X1CA 4RAGA 1YQAA 2R7OA 3SZGA 2UZKA 2XRLA 2M8GX 4JQFA 1SEUA 2DAOA 5J4YA 4BACA 4IX7A 2AXTC 2PLYA 4KFCA 2CU7A 2VT3A 3K69A 2EIKH 4NBQA 2XSJC 4B09A 3BQYA 3DLLF 1Q1HA 2YUSA 2C6YA 2GA2A 2BY3A 1FJLA 2GBYA 1JT6A 3WE2A 3M7GA 3BP8A 2H09A 3R60A 4HPQA 3HHHA 3M1EA 3O6BB 4CH7A 3KX2A 4DYQA 4ESBA 2R5ZB 1LKXA 2X0LA 5D6FA 1IZ1A 2JRTA 3I56I 3FHNA 5D5UB 3IAS2 1OJLA 1TLHB 1TQIA 4ZJZA 5BNGA 4GFBA 1AKHA 3PUBA 2NYXA 4BQQA 4Y13A 1I50J 2F5CA 1W36D 2PJRA 2WV1A 3QPSA 2K9LA 4MGRA 3ESWB 3WG7H 4DBQA 3ASOH 3M8JA 2ZMEC 4CUGA 5ICCA 4BHCA 3R4KA 3NQOA 2XDVA 3KYLA 3QOPA 3HPGA 1GT0C 3BJOA 3QP5A 1EJ9A 2Y9ZA 1MDMA 2JK3A 3RDIA 4GYGA 3CP8A 5HLGA 4A0ZA 1HLVA 3R0AA 2H8WA 4O6JA 3KP7A 2O6GE 3LA7A 5H20A 1MIJA 1RR7A 4L5JA 2DA2A 3G73A 1ZRCA 1VZ0A 1XMKA 2L9VA 3S32A 5GADJ 2ZCWA 1QPIA 4MIMA 4ZYGA 2ZFUA 1R4MB 4KT5C 1UZCA 2ZKZA 3MCZA 2CUFA 3PIPF 1LDDA 2E36A 3QPTA 2K9QA 1F43A 4NDLA 4Y15A 3A2KA 2W4SA 4IXAA 4KMFA 3OYCA 1LPQA 2L54A 5FFXA 5E1XA 1SMYF 1WRJA 4XKWA 1QBJA 4KIGA 4GGGA 3TOAA 4YFKF 2PMZA 4XONA 2O03A 5CYVA 2M45A 1GHCA 3PNTA 4AVPA 1BC8C 1MZBA 1IN8A 3R61A 1U8BA 2KRCA 3V7CA 5JHFA 1GV5A 2EIMH 2PMHA 1X3ZB 1WJBA 1O3RA 4HV5A 2WY7Q 1U5TB 3SFIA 4L18B 1V4RA 3VSKA 2FE3A 3HHGA 4CCNA 3WTSC 4XSXF 4EJTA 5IYDJ 2ZNZA 3S1RJ 4L9JA 3QQAA 1X3WB 3ABMH 1R49A 1W1WE 1HSJA 5JVGF 2X6YA 2HKOA 1FBUA 3EPZA 3GFMA 4YIFA 1E3HA 2L4MA 3R0JA 3H3UA 4JP0A 5M5XJ 3QOEA 1HDDC 2VPLA 3FMRA 3J7YJ 1G8XA 2UXXA 3DCFA 2OQRA 5E1ZB 2F5FA 1FEXA 3CCYA 3CCEI 5HVQC 1Z9CA 4CO8A 5IP7J 1RZ4A 3B02A 4HF0A 3W6KB 2LOOA 1Z3XA 1S7EA 1ETXA 5M3FJ 3ZQQA 1X2NA 2VBWA 4OINF 4QWQA 4M9XA 2JSPA 1VI0A 3H1CA 3J80K 1R71A 1E0EA 4MFDA 2XROA 1W36C 1ZHFA 3HKZN 5KAFC 4CA0A 1C0WA 1J09A 2LG4A 5JHUA 3F8CA 4BAYA 5FKLA 2F4MB 4N4OB 1VQLI 2LTPA 3CDHA 5JFRA 3G71I 5JVTA 2A07F 1W5CC 3KZIC 2RGVA 2Y75A 1EH6A 1D8JA 3S8PA 3PSIA 3SDGA 3GMEA 3SZPA 3VSLA 3RKQA 3FXUA 2DK8A 2E7WA 3JTHA 5GPAA 2OCCH 3RKXA 4ETSA 1SAUA 4FE4A 5AIQA 2PFBA 4LFUA 2V1XA 3J80Z 4HDVA 2DA7A 4MO7A 2HU9A 2RAEA 5CPRB 3W6JB 1Y56A 2FQ3A 1FX7A 4FX0A 5TJJA 1FBQA 2KJCA 4CCKA 1T2KA 1K78B 3CCRI 3KYCB 1ERDA 4NQWB 5CVIA 2FA5A 4R8HA 3FXMA 1JUMA 3HSEA 3JREA 1W0TA 2GQQA 2IBDA 1QZYA 4AWXB 2EINH 3K7AJ 5GAEJ 3NWSA 1LNWA 2ACJA 3W2AA 2KT0A 1L0OC 2D5VA 3OYKA 1JUPA 4CXFA 1RESA 2ECCA 3OYEA 1AOYA 4B3XA 3EQLF 2EQRA 4E4HA 3F8BA 2B63J 4CYDA 3JRCA 5CQEA 1MKMA 1IUYA 1BR2A 1JHHA 3HGYA 4HW0A 4RB3C 2Y69H 2VLAA 3D5RC 2P8TA 4X1EA 2GOMA 1HA8A 1FSHA 4BDZA 2VOPA 4GRIA 2DPDA 2QVOA 3CP2A 1XSDA 5L3CA 4DZJA 2G7HA 2E60A 2JPCA 1BJZA 3BT9A 2FOWA 4M3BA 4M9SA 4BQNA 5JR3A 4N9HA 3OIOA 1KQ8A 2FD5A 3E6CC 1R5ID 1A31A 2XVCA 4O3MA 3LSHA 2FNPA 4R1HA 4HNUA 2L7ZA 3ECHA 2VE9A 5IY5H 2G9WA 2IRFG 1B4AA 1TT5B 4M3FA 1DPUA 3HRSA 3E6MA 1EKEA 1JUSA 4IRHA 3VPRA 2D2WA 4EGZA 2ECBA 3VEPA 3W6VA 3QWLA 1DUXC 2XGCA 1YHQI 1RIOH 2HTJA 3ABKH 4LG3A 2IA1A 1U0JA 1PJRA 4U7BA 4V19K 3G3ZA 3WTXC 1WJFA 4RM3A 2HR3A 1X19A 5C44J 3HOWJ 4KNYA 1E3PA 3TP0A 3DPTA 1WJCA 2Q2EB 1BOAA 3DEWA 3GTLJ 1WJAA 1XS9A 4C3JJ 4EJWA 1ACIA 4ZDPA 3IKVA 3T8RA 1CQTA 2HFHA 4RB1A 1Y0NA 2V9VA 5ICFA 5CVUA 1APLC 1LEAA 3LOCA 2P7CB 5DD4A 1ZR4A 1MMSA 4Y7NJ 3G1LA 4RLFA 2IEKA 1IUFA 3HYIA 1JKQC 1HKTA 2HPIA 4BJ6C 2EV5A 2KHMA 1PP8F 3QYBA 4F55A 4AUXA 3O2PE 5E3MA 2V7FA 2GIZA 2HQAA 3M07A 3JRFA 4BGDA 1DPRA 4A12A 1Z3YA 2CRGA 1H0MA 2XV4S 1LFUP 2ZC2A 2OUMA 1ZRDA 2W00A 3B6AA 3I54A 2V1UA 3CQZJ 4UVCA 4YEJA 2R7TA 3MVPA 2DFFA 4MNUA 2VPRA 1GVDA 3S3MA 3RKYA 1ZAOA 3A0HC 1JKRC 3T0YA 2BY0A 4XM3A 4UNOA 3IHUA 2PX9A 3A03A 2ZMEB 1ETQA 5HS7A 1R5HA 4EV0A 3DQVC 1I39A 1U9NA 5J8FA 1MBEA 2NOJB 2DMQA 5DCMA 1XD7A 4XKBA 1VQMI 1PUEE 1I1GA 1H8AC 1KGSA 1X1AA 2QWWA 3PIOF 3I55I 2X4HA 3LSGA 1WFXA 2Z33A 4A3CJ 4ZDOA 2XPVA 2Z1DA 5E3OA 1LJ9A 2IVMA 2L01A 3ZN1A 5EEGA 3LSTA 2V6CA 4DNCA 2E71A 4HNTA 1IV8A 3VYSB 4A6DA 4D5FA 2RQQA 2XB5A 3GF2A 1A04A 3I4PA 3I0TA 3VODA 2O0YA 3K70D 4YFXF 4CGZA 1ZG3A 4BE0A 1KYZA 3F8NA 3KLOA 3BR2A 3VOEA 3OIPA 2HDWA 1IRZA 3D0SA 2QCOA 3CLQA 3C18A 1KU3A 1QRYA 3QAHA 3HXLA 3MAJA 4OMYA 1QZEA 4RGRA 1R58A 2EA2A 4W1UA 3IL2A 3G6EI 3DKWA 5FRNA 2L3DA 3DTEA 2L7MP 2IA2A 4C2MJ 1QVUA 2K85A 4FX4A 2DYSH 3OL3A 4Z2YA 1OLTA 3GLXA 4ON0A 4PUSA 1IO2A 2RREA 3FIWA 3EETA 1HC8A 2LNBA 3IAM2 2ZJRF 1UJ8A 5KAIC 5DV5A 4F3QA 3ROUA 1MSFC 2IP2A 1SC7A 3PJRA 3K4CA 4C30A 2VI6A 3OY9A 1BA5A 3H5NA 1E3OC 5GTHC 1JKPC 2DTRA 1BW5A 2LF8A 3FM3A 2ISYA 4IF4A 4JYKA 5CVRA 2FX0A 3PM1A 3VYUB 1X2MA 4I0BA 2I5UA 5EDNA 3P5JA 2BXZA 1CF7A 3CO6C 4A69C 2EWNA 5K5QA 2ZJPF 2M7BA 2OTLI 4BHPA 4NNJA 5BPIA 4IQJA 2WTEA 2JUCA 4WXDA 3WTTC 3E5XA 5AIPA 2ZXHA 3HOZJ 5BS6A 2O9LA 3BOQA 3C7JA 2WAQN 2Y0SN 3GX4X 4A3IJ 2DMTA 3TBIA 4HOBA 1IXSB 2Y2ZA 1D8KA 2HXIA 2OJED 2NVQJ 2D1VA 4M6VA 5L3EA 1SFUA 1BL0A 1KU2A 3PSFA 3CMYA 2GAUA 1KQ9A 3K4KA 1MBGA 2CO5A 3JRBA 1E17A 3H9GA 1RKWA 2HTSA 2KPMA 2WBMA 1R9TJ 4P9UA 1BIBA 1REPC 2MC4A 5LRRA 3MD2A 4BS9A 5F08A 2CGPA 2W48A 4G8XA 3T5XA 3MKWB 1Z1DA 1B72B 1Z77A 5FD5A 4BBSJ 3K70C 4N4NB 2W24A 4Y33A 3D5LA 3OYIA 1STZA 4NC8A 3V42A 1VNDA 2L5QA 2RQPA 1G3WA 4J19A 2FXAA 1T08B 3SDBA 3K4MA 4XRSA 5HDKA 2E5NA 2DODA 1MNEA 2ZO4A 2VKDA 1PUFB 2X51A 1QHGA 3WTZA 2DA1A 2VT2A 2F48A 3L2VA 4A3FJ 4XLCA 3ZQLA 3M4OJ 3CJTB 1B8IB 1LE8A 4UUVA 2UV1A 4IL6C 1S72I 2M3AA 2KKOA 3HTSB 2CWEA 1TC3C 4U0WA 1FIPA 2DJIA 3HIFA 1WKMA 3LQRA 2O5RA 5HDGA 3LSMA 2L9SA 1W5TA 2EFOA 1YRNB 1YLFA 3HPHA 1ZK8A 5JLXA 5KK1A 3HEFA 2TDXA 1BBYA 5ILVA 5K5RA 2EZLA 4P1WA 5M5YJ 5FROA 2DA4A 3ZQHA 1WZ2A 4G94A 3PQKA 5H6QA 1MBKA 2H1LA 1YIJI 3EUAA 2F6CA 3GO5A 5ICGA 2HKXA 2AXLA 2NVYJ 3ZMVA 5J1YA 2IS2A 5TRDA 1I1SA 2FRHA 1JXSA 4F92B 2DA6A 2N8GA 3RSNA 2B7EA 2E35A 3M3YJ 1FMWA 4KN7X 2CQKA 5LFAA 3GBGA 3WE3A 2WAFA 5FKOA 1B59A 2JPBA 1TL8A 4PDKA 1ONVA 4UHTA 4KIFA 4PZJA 2M8EA 2V1DA 2K7LA 2OZUA 2KDZA 4W97A 4AC0A 1TW3A 4HX8A 3S2HJ 2FNAA 3C3WA 3EDPA 4CZCA 1S6LA 4BYYA 1SFEA 3HL2A 3HKZA 1JE8A 2F2EA 1MDMB 2CUEA 3KZZA 4HBLA 2YS9A 2P0WA 1B9MA 3I53A 2DQLA 3TO6A 2QF7A 3IWFA 4HF2A 1AHDP 1P6RA 4Q48A 4ANJA 4BEHB 4MEXF 2GXAA 4ENMA 1NK3P 3OR2C 3FWEA 1N78A 2L7KA 3I3LA 3BG9A 3GWZA 4XKVA 3H3VK 2GIVA 2Y48A 4MTEA 1OYIA 3OYJA 4R79A 3MN2A 4YFNF 1TWGJ 4J00A 2ESHA 3BROA 1MJBA 1ZH5A 3ZOBA 1S5LC 3G1MA 2EFPA 4HYEA 4UV9A 2QGUA 2NNNA 3QU6A 1HOMA 4QLCU 3K1NA 4CHUA 2HDDA 3S16J 4A3EJ 3SJMA 2EFNA 2CSOA 1XB4A 1YS7A 3DTKA 2M30A 2BVLA 4FE7A 2ELKA 4E7HA 4LD5A 1WI9A 4HNVA 4A3GJ 4WF2A 5J8CA 3DPUA 5BMZA 2HOAA 3K4NA 3DBRB 1YOVB 4M73A 3FF5A 4V2GA 3BG7A 1HSTA 5C4XJ 1A6IA 1F4KA 2HI3A 2X85A 5K7FA 3ULQB 4IO9F 3JSOA 1TWCJ 4FT8A 2KIUA 3CC2I 5GTIC 3IH3A 3V8JA 2JWTA 2QLZA 1JJ6C 5LLQA 1ZGJA 2KJBA 2MD5A 4E7JA 4DZPA 2DLLA 1LVAA 4HQEA 4LG0A 4Y3OA 3NRVA 5LEJA 2DA3A 4YIIA 3FXLA 3E1SA 2LSOA 1HKQA 2QEXI 4L9TA 3RYPA 3GTMJ 2VKHA 2HNHA 3BJAA 1U2WA 4PJ0C 2R7SA 4AYBN 3N97A 4AM3A 2A69F 4XLPF 3A4CA 2I10A 3V8KA 3KZYA 2H94A 2IGKA 1QU3A 4L5IA 1VQ9I 4JOMA 3LA2A 1T38A 5IYCJ 3CUQA 2UUZA 3VB2A 3TGNA 1T0FA 1Z0XA 4GO1A 3AKZA 2XF7A 4ITVA 3PQJA 5FRMA 4XK4A 5ILUA 3BC8A 2EZHA 1J59A 3F9KA 2Q8KA 5CKTA 2DT7B 2G0EA 3S93A 1OCZH 1NHAA 2P6TA 2Y0MA 4N9IA 3AL0C 2XASA 1MMAA 2VONA 5EZGA 2ETHA 1F5TA 4LOCA 1I3AA 3KE2A 1DDNA 4MQVA 3CCVI 3TL4X 2KRHA 5D4RA 3ERMA 3HGGA 2F5DA 3BDDA 3TO9A 4EATA 2DW4A 1D3YA 2BW3B 2DQRA 2LP0A 4LLNA 2FSWA 5IP6A 3WTVC 2A6TA 5F6FA 2FBKA 4RBOA 4HEA2 4G12A 2IS6A 4ZDLA 5EGOA 5LGUA 2JVHA 3E5UA 1IDYA 5EYRA 3WU2C 1NK2P 4I99C 2BGCA 2EH3A 2K9MA 2BYVE 3ZCOA 5LEKA 5FKMA 2A6EF 3RPUA 2CMPA 4CYCA 2K02A 1HW2A 1VQ4I 3GYHX 1PVEA 2CW7A 2DA5A 3M8FA 4FCYA 4DW6A 5IOZA 2XHKA 3TP3A 2H27A 2K4BA 4XLHA 2NOGA 5L3DA 4LIUA 1SD7A 4RAFA 2NVXJ 2LC2A 3P9CA 4MEYF 2P7VB 3RZOJ 1USSA 3WTYC 3BR1A 4BQOA 4IRIA 3L2UA 1TT0A 2LMDA 1ZYRF 5H6RA 3RI4A 4XL9A 3RKWA 3O8HA 1AWCA 4BJTA 4OMZA 5J1RA 1TBXA 2K3FA 1VTNC 2QKLB 4XMYA 3O3KA 3WGHA 1QQIA 2A5WA 2QSHX 4HLYA 4GCVA 3TO7A 4BE1A 3D1NI 4XQFA 3LWFA 4D5CA 3KEOA 1XGSA 2PBIA 3EYIA 4PK4A 4KDPA 1T6SA 3ZMDA 4L0ZB 5HNHA 2DFEA 2FBHA 2VN2A 2ZNYA 1O7FA 3RQ4A 2H1KA 2IS4A 2R7XA 1OCPA 2MABA 5KCMA 4I6ZA 3HOUJ 1GVJA 2L4AA 2KMUA 3DTIA 3S2WA 4A3MJ 1Z7UA 3IUOA 1YW9A 5DDGA 1QA6A 2PI0A 3S1NJ 3RYRA 2V9KA 3MEXA 4CCMA 3JRHA 1HKSA 2HVRA 2EV6A 2LH9A 2QQ9A 4EQQA 3LFKA 1S8NA 4N0BA 5FB2A 4UVBA 5CJ9A 2FU4A 2MH2A 3LSKA 3PFYA 5DS9A 1UHSA 4LK1F 3QPLA 1ETOA 1NG7A 2EA4A 3G1OA 5FLVA 1D1CA 2YR2A 1U78A 3RJPA 5F04A 4B4CA 2QBYB 2H6CA 1P9QC 2DFIA 3RZDJ 2OD5A 4RA2A 1IRXA 4P5OA 1WPKA 1AA7A 3LNQA 1TQPA 2DMNA 1Y1WJ 2DFHA 1R4NB 2KL4A 1BN5A 1SVLA 4NC7A 2L7FP 3IWZA 2NVTJ 2UWMA 2NS7A 3A02A 1DGWY 4A5MA 1KONA 2E1CA 5CQGA 2EPFA 1SFXA 1J5YA 2ELJA 1VF9A 1FOYA 1WHUA 2F4IA 1USTA 1XC5A 4G7OF 2Y31A 3QYFA 4E7SA 5E8GA 3BZCA 3WU1B 4A3KJ 4L9NA 4BL0B 4U88A 2CFOA 2NRAC 4HQMA 4A0YA 3Q0WA 4HLXA 3BTIA 4PGGA 1B6AA 5DUKA 2HOEA 1ENHA 3BR3A 1WJDA 3GUDA 1OPCA 2ELHA 2HQRA 2R7RA 4I0AA 5FKKA 2ME0A 1RKTA 2M7AA 2FBIA 3RPUD 2NNYA 2STWA 4CCLA 1MMNA 2VQCA 5D6EA 4BQAA 4C2UA 5FLXK 5IT9K 1QO0D 3H0GJ 5DYMA 1BR4A 1VFCA 2Z2SB 1RRJA 1WJEA 5DCMB 2LVSA 2L9RA 3IRQA 1HBXG 2ZSHB 2K5CA 2KP6A 5HOOA 4DYCA 4MQ9F 1TQMA 1FC3A 4ZZDA 3ZP5A 4ZYEA 1TNTA 2ZXWH 1KZHA 1J0RA 3SEQA 3HSRA 2R7VA 3COAC 2WB1N 2HOTA 4KIBA 2IT0A 3BWGA 3BCAA 2MH9A 2OAZA 3I4MJ 2EV0A 2BEOA 2OBPA 1ORKA 2XF6A 4EJVA 3CLOA 3T1BA 1G59A 3CDIA 2P5KA 5LGTA 2NAZA 2YSRA 5IYBJ 3V7SA 4UY8I 5FLXZ 5IT9Z 1BI3A 1R23A 2LDUA 3FK6A 2QQ8A 1VQ8I 2BOLA 1HCRA 2COMA 2F5EA 4KYWA 3CUQC 3LQQA 4M3GA 3ABTA 3WHCA 3L09A 1T0FC 2XAGA 3NWTA 1WH5A 3HRUA 4XSZF 5ICEA 4XKCA 2WAEA 1MNMC 4RB2C 1N77A 1B1BA 1GV2A 4YELA 3L2CA 2K40A 1ZQ3P 1R36A 2F5VA 3KETA 1SD5A 2O61A 5DUIA 1HXDA 2VBXA 1QZZA 1ZTRA 1FNNA 4G7HF 2QENA 3CMMA 5B3SH 4NB5A 4MTDA 4IEJA 1MH3A 4NQWA 1H89C 3F0CA 2OTJI 2HZTA 1OCCH 1Y8QB 1R1UA 3F6VA 1LFBA 3FXOA 1Z7LA 1BW6A 2XAFA 2NXNB 4I98B 1V3FA 4IHSA 1IXCA 3U1KA 2XAJA 3ZQIA 2HZDA 2XKOA 1YJ9I 4L5EA 1M1EB 2H6BA 1JGSA 4RS8A 1FTZA 4I09A 2A61A 1CF7B 5BOXA 1FBSA 1E2XA 4II2A 5E3LA 2W57A 4CCOA 1POGA 2VKEA 1QNTA 4S05A 5C4JJ 2ADUA 2R5YA 2R7ZJ 3LSPA 3KFWX 4ENKA 3S2DJ 2LRDA 3TQNA 4DGWB 4A2UA 4JX4A 3BLYA 4E7IA 2RC4A 3C2GA 1VQPI 5DD8A 4PJMA 3GTOJ 1W7PB 1ETVA 2XAUA 3J7AO 3UR3C 1XX5A 3GVAA 4P9FA 1ZLKA 4OIPF 2XB0X 4RMNA 2CFXA 2EZKA 1WWXA 2EB7A 2JA7J 2R3SA 3K2ZA 2DYRH 2FEZA 1R5GA 2L9NA 3CC4I 3Q0UA 3CC7I 2PEXA 2Q0OA 4NHJA 2VQGA 1DP3A 1LB2A 1YIOA 3QODA 2VBYA 5TGTA 1P7JA 2VIXA 4WWCA 1PP7U 1OISA 2K86A 3AL0B 4AIDA 2HDCA 4U87A 2DCEA 5E20A 3OS2A 1D0YA 3OYNA 3P7NA 5E8IA 3LSJA 4S04A 2LYCA 4RDUA 2XC7A 2YX7A 4AIJA 1Z6RA 2OCEA 5HS8A 5D8LB 3SYTA 3FKJA 2LK2A 4IVNA 3KP6A 5LHIA 4AIKA 1ZKGA 1I27A 3BG5A 1LE8B 1IXRC 4FISA 2OZ6A 4F52A 1RNLA 3GCMA 2JN6A 1K61A 1G3TA 2OV7A 4BY7J 1RETA 2ICWG 5LBQA 2IGOA 1MSEC 1BR1A 3ABUA 5D5XB 3C2HA 3CMEI 1X58A 3PFIA 4HF1A 3FMSA 3K4LA 2ISZA 2HQ5A 3TMOA 1UG0A 2V9PA 1XDSA 4BKXA 4IRGA 4PJLA 4CSWA 4DYRA 3EUKL 3MMYB 4EJUA 3REOA 3LL7A 1EF4A 1FYKA 3CO7C 4IHVA 2X1DA 4XLNF 2EILH 1XCVA 1R1VA 2VJ5A 1TW2A 2W25A 2KZGA 2DK5A 2K3PA 3CDLA 1MJAA 1X1PA 3CCJI 2VB6A 2M2EA 4IHXA 1SMTA 3SEZA 4AD9A 4A3LJ 2DBBA 4YRVA 2TCTA 2VQLA 5L3GA 2O3FA 5J1UA 4ZH4F 2L02A 4KA4A 1K7AA 1SD6A 1O4XA 2K27A 3MZYA 1WSUA 1S3JA 3CCLI 2WADA 2WY8Q 2ZMEA 4M3EA 4YIRX 3FBIB 3OYHA 4OIQF 3NARA 3LMMA 3T8TA 3BPVA 2Z5UA 4NUBA 5FLMJ 1UAAA 2ID6A 4RGSA 2J5OA 2M5WA 1HDPA 5J40A 1IG7A 1G4DA 1O3QA 4ENJA 1UFMA 5K5OA 1TWFJ 2V6EA 4IOCF 1A6QA 3WG9A 2JQ7A 3BG3A 5K7ZA 3E5QA 3MZHA 4AYBA 4IQ4A 2J5PA 4GDFA 2FJ1A 4XLAA 4PJNA 1X1BA 4BE2A 2DN0A 3L2WA 1XDUA 3HM5A 1MMGA 4XRFA 2ZFWA 5K1YA 5E3NA 4WK8F 3DFGA 4BXUA 1JI8A 2R7QA 1N75A 3PNVA 3PL8A 1PDNC 3JRAA 4I7HA 1T56A 4LGWA 3NEUA 5B66C 3GTJJ 4KJZA 3I59A 3A01A 4IZZA 5H2FC 2VQHA 5D8KB 2MW8A 3CTAA 4XN3A 3BG6A 3QYEA 5EEAA 1Z91A 1P2FA 3SHFA 5TISC 4CDGA 5E79C 1BJAA 4F91B 1ETWA 3GZ5A 1VQKI 2LBFA 1OYYA 3K4JA 4PSXA 3TOBA 3F23A 1FTTA 4P96A 3OYBA 1J7KA 4XLEA 2D45A 4B1RA 3OSGA 2VODA 1D0XA 3OWTA 2GLOA 3CF5F 2JA6J 4KUMA 5K7HA 2R7WA 4A3BJ 1O57A 1IN6A 3ZMUA 2YU9J 2I8DA 2B9SA 5EG0A 3UKGA 3SFZA 3DKXA 4D0PA 4BU2A 3ZQFA 3K2AA 5KHDA 1P92A 1ZG1A 3FXKA 3QU3A 1TZLA 1FT9A 2E34A 4HV6A 4IPAA 4XRSG 3W2VA 3BJ6A 4KN4X 3ZMTA 2W1OA 2Y30A 3PO2J 5CVVA 2E7XA 2DT5A 3DBLB 3N4MA 3DU5A 4QSHA 5IT3A 4CZZA 5DCFA 5ERIA 4D7NA 2ZXJA 1QVTA 4XOTA 1AKHB 4G6TB 4LG0B 5EZHA 3JRDA 5LRSA 2PJRB 3OOUA 3DEUA 2TRTA 2CH0A 2D1HA 3CMAI 3L1PA 4PFPA 2LKSA 1ITYA 5DTDA 1FMVA 2Q1ZB 3F21A 5HLIA 3O8GA 1OKRA 3ABLH 4M3DA 2L0KA 3E3VA 3G2BA 3S1MJ 3ML6A 1IV6A 3SXYA 3CUQB 1O3SA 1K83J 2QM3A 4ASNA 3LSIA 2OA4A 1A35A 1XPXA 3BTLA 3Q0VA 3U21A 4BHBA 1ZLJA 2W7NA 4ZTFA 2VOOA 4A5NA 4Z6YA 1YW7A 3PNYA 3OS0A 3GW2A 3E7LA 3KIOA 3GTGJ 2GXBA 2LY1A 1NH3A 2XUBA 2XRNA 1F1ZA 3Q5FA 3KEYA 1T8IA 4IHTA 2RVCA 3HOXJ 1IN5A 2CQ7A 1WCMJ 1U8RA 2DMUA 4D1QA 2L2OA 1JGGA 3K4BA 2DDBA 2BY2A 3RPQA 4B48A 5FO5A 3SZTA 2GWRA 3KEQA 3ASNH 1XMXA 4RGXA 1D1AA 4DIQA 3HOSA 1YW8A 2CJJA 4Y4RA 2G7UA 4O5VA 3S1QJ 1P4WA 3OYLA 4E70A 2X48A 5FFZA 3DEEA 1BC7C 4UUSA 3HUGA 5EGOB 3OYGA 2PN6A 3IKTA 4DOZA 3U1DA 3BPXA 2PG4A 4C2TA 4BNCA 1YJWI 1WVRA 2DOFA 2DTZA 2JA2A 5CVJA 3HOTA 2FMLA 4B8XA 3OL4A 4WXCA 3C2BA 1X4OA 1W5SA 2A5YB 3IH2A 5EJCA 4DBRA 1RC9A 2CQQA 3OYFA 1QPMA 3K0LA 2XIGA 4UB6C 1MBJA 1J9IA 2HQNA 2JA8J 1ZN2A 5KVRA 3E0JB 1F36A 2VKVA 3HB9A 1GUUA 1K6YA 3GEZA 1OCRH 4HZFA 5IOYA 1HW1A 2R92J 4C3IJ 3FDYA 3Q9VA 4M6YA 1SFOJ 3GTKJ 1SVMA 3FM5A 4PJJA 4OWRB 1AU7A 2NS8A 5F27A 2HEOA 1P4AA 1ZARA 1VQ6I 2HS5A 2HYJA 1K79A 5HLHA 1XG1A 3VDXA 3ZXSA 2V4JC 2BE5F 2X1EA 3DBHB 4BJ5C 3B73A 5J47A 1XSVA 1G3SA 1R6RA 2RNJA 1XGMA 4H4KC 1DGRM 1VQOI 2V1NA 1EH8A 4QPQA 1Q1VA 2P5VA 2WB1A 5E18F 4U0YA 2QQBA 1CGPA 2AQEA 1JHFA 1D5YA 3FMQA 2E5ZA 1SAXA 1OCTC 4KICA 4KMUX 4ZYHA 3KP3A 3OYMA 1G2HA 4XBFA 1FLIA 2F4OB 1OR7A 5FKNA 1YFHA 4BEHA 4B44A 3OIQA 3BTJA 1OFCX 1RI7A 1RPWA 4Y17A 4U0VA 2ID3A 2FMYA 2IAIA 1RUOA 1V5EA 2E2JJ 3GLLA 2V79A 2MD0A 1ULYA 4A6EA 3MFKA 3Q3SA 3V8LA 2CV1A 1IN4A 3N05A 1WQ2A 2QSFX 5HDNA 1NG6A 1T33A 2RDPA 2DI3A 3DKYA 4RGUA 5EEHA 3HRTA 2K9SA 1I5ZA 1YJNI 2H8RA 3OR1C 2B0LA 4FQGA 6PAXA 3U9GA 3S14J 1SVOA 2KIQA 2XGXA 3VYRB 2VUMJ 2MYSA 2DT6A 5ED4A 1MNDA 1VQ5I 1R22A 2R0QC 3S3OA 1XN7A 2DOAA 3L00A 3K1PA 3BR5A 4I76A 4XR6A 2IGMA 2YPRA 3CJNA 2GM4A 4UB8C 3HC7A 2BHYA 2ZJ2A 1I6XA 1FIAA 5HNFA 1IRFA 1IC8A 5FGMA 5B1BH 2LR8A 3V4GA 4A93J 2EK5A 3NAUA 4PCQA 2P81A 1FWZA 5IPAA 2R5ZA 3LSRA 4XOPA 2FUG2 1FY7A 2MFZA 1X1DA 1S7OA 1SD4A 3FISA 2P5LC 2MSYA 1VQNI 2PQ8A 1R00A 4AU7A 1YG2A 1XMAA 3JTGA 1BOBA 3ZPLA 2E1MC 3ERED 5JLWA 4X6AJ 3L2RA 1YTYA 1LDKB 1XGOA 5LHGA 5ILSA 3I71A 2ZXIA 1Z6TA 2E2HJ 2DJNA 2GOXB 3P9IA 1D5VA 5F64A 2XAQA 4X0GA 4Q47A 2QA4I 1YYVA 3VWBA 2AHQA 2LD5A 2AS5F 2E2IJ 3KP2A 2QUFA 1SANA 2JA5J 1J2XA 3FHZA 4MFEA 1IW7F 1Z21A 3JRGA 5HODA 3ISPA 2ZJQF 3RIRA 2XPWA 1KQ0A 2PMUA 4HX7A 4M9ZA 1IN7A 4FHTA 2DXIA 2KIMA 1K6OA 5BQTA 2K4JA 3IV5A 1X3UA 3MQ0A 3TW7A 2OC6A 3G4SI 3BR6A 3SQNA 2EFQA 4ZYAA 3W3CA 2EFWA 3CCMI 3L7WA 3GZ6A 3HRMA 5GP9A 4EM2A 2E1NA 1MJ9A 4OU0A 1YO5C 1F9NA 2BBYA 3CCUI 1XGNA 2KZVA 4OAYA 2FF4A 2ZBKA 3LA3A 3QP6A 5GPCA 2HYFA 1FOXA 3CESA 3ZR8X 2MLGA 2DPUA 3E6BA 1MW7A 2JRMA 2BV6A 3AFHA 5JI6A 2BW3A 1TTYA 1U5TA 4NC6A 2JSCA 1TWHJ 2KRFA 1BIAA 2M4KA 1WJ5A 3DLAA 1FYMA 1V55H 3FXJA 2HXOA 2BXYA 5HLTA 3ECOA 4D9JA 2BVMA 3ZRGA 2QKMB 1O7LA 1ZGAA 5HS9A 4JBAA 1A5JA 2WC2A 4E7ZA 3S15J 4XICA 4XORA 2JVGA 3H9JA 2LY2A 2Y9YA 1UCRA 3D5SC 3CCQI 2R5YB 2IXSA 4G9YA 1TWAJ 1OQYA 3K6GA 5F1JA 4L9VA 3H36A 5DEQA 2ZB9A 2HVQA 1RUNA 1LDJA 2DO7A 2WAQA 1U6GA 2Y0SA 4ZZLA 2XAHA 3BR0A 2Z99A 2IW5A 2JJ7A 5D5VB 3HSFA 1XSXA 3I64A 2CUZA 2RN7A 3K10A 4E7KA 1FOWA 1ON2A 2LF7A 1O3TA 2KLOA 2GXGA 2V26A 4UXNA 5LGNA 4M74A 4Q5SF 4AVZA 3GFJA 4LLGF 3OV8A 4J01A 2IGNA 4JX5A 1JKOC 3H0DA 5BPDA 5J6XA 4M6XA 2KIFA 4P55A 2E19A 5J3LA 4XLFA 2KISA 1FP2A 2R7UA 1VQ7I 4DJAA 1KYWA 2AO9A 5AONA 3F8FA 3EUHA 3JCUC 1U3EM 1ZRFA 2VXZA 4QPOA 1YI2I 4GXOA 1H88C 4RB0A 3E97A 2IA0A 1G6NA 1XTAA 3OSFA 2A05A 3F22A 2VJIA 3VFZA 4I2OA 1EA3A 2WA0A 3I9V2 2MLKA 1S7AA 3C1DA 2R93J 5IP9J 2FOKA 1TP4A 4KT6A 3RQIA 4HDUA 1JT0A 4XRMA 2X9DA 3JW4A 1W4MA 1UG2A 1Y0UA 3DWLE 4IOAF 2JMWA 2GZWA 1T98A 1YS6A 2PMZN 2VC1A 3PUFA 2MG4A 2EZIA 4LK0F 2RV8A 3AG3H 3CUOA 2PJPA 1ZELA 1K78A 2QBYA 1X4PA 1BM9A 4RAYA 4K2EA 4LJZF 5F0FA 3IC7A 1MGTA 2VL8A 4PGHA 1OR7C 3I58A 4QIWN 1BI2A 4ESFA 3P9KA 3FX3A 3JSPA 1XCBA 4ZYDA 3HDDA 3JAMK 3WODF 3FKIJ 4LMYA 2CQNA 2O8XA 2XPUA 3OOPA 2WV0A 2VBZA 3L2QA 1P4XA 4EM1A 2IJLA 5EF6A 2YU3A 1EV7A 1P7IA 2STTA 3S3NA 4HG2A 1FZPB 5F0CA 4G6QA 2P4WA 1L3LA 2BHZA 3BQZA 1I6HJ 1Y39A 3WU0A 4KISA 3KYDB 3M9AA 3K1MA 2EIJH 5E17F 4HA8A 1EH7A 4F93B 4G7ZF 3FXRA 4V2FA 4FASD 3FZVA 3H3ZA 2Z3YA 3AG4H 1N25A 4A0XA 2CV0A 3WTUC 4U7DA 4MLOA 1J75A 1GLNA 2HWVA 2VXDA 3I4NJ 3WTWC 5CLSA 4EGYA 4ZTJA 3JAMZ 4KITB 4DQ2A 4LITA 5E1WA 2Z9OA 2COBA 2BY1A 2O8KA 2DOEA 3OMYA 2VJ4A 3DPLC 3OYDA 1IGNA 4I02A 5L3BA 2CW8A 4WX9A 2IS1A 9ANTA 3KLNA 4EMSA 1PYVA 4OAZA 5C3EJ 1LFPA 1MH4A 2ZSIB 1FP1D 2XGEA 3LFUA 3ZQGA 5A2QK 3EYYA 1FOKA 4BBRJ 1MBFA 2RKHA 1HQCA 4EJOA 4A3JJ 1FPQA 3GFLA 4B3AA 2HOSA 1KU9A 3H5AA 4MHGA 2ESNA 1OMIA 2IPQX 2XKPA 1WH7A 3MKZA 3ZGKA 4E7LA 5GAHJ 1ZR2A 1IJWC 4EVIA 2X6WA 1ZG5A 3JRIA 1MD0A 4QTRA 1H9TA 4OOIA 2Q2EA 2HPMA 2VE8A 2LFBA 3CF2A 2GA1A 4JK1X 4HSTA 3AG1H 3BTCA 3HG9A 3M8EA 1UB9A 3HTUA 4B43A 2JUGA 4C9YA 3I59B 3CJQB 3A01B 4HX4A 4LB5A 1ETYA 2M0MA 3A1YA 2LY9A 5A2QZ 2JZYA 3HZJA 5FJ8J 2LREA 4JX6A 4UV8A 2LKXA 4LIVA 3AG2H 3W2WA 4CICA 5LHHA 1IRGA 3GZNB 4HSRA 2LBFB 2KQRA 3DV8A
chains in the Genus database with same CATH topology
4RBOA 2EBIA 3TW6A 4G12A 4A3DJ 4M3DA 2L0KA 5EGOA 3S1MJ 4M3FA 1IV6A 1IDYA 5EYRA 3VPRA 1JUSA 5F0HA 1NK2P 2ECBA 3W6VA 1K83J 2EH3A 3HOYJ 2XGCA 5EG0B 3BTLA 3Q0VA 5FKMA 4CYCA 4FCYA 2DA5A 2M34A 4DW6A 5IOZA 1JTXA 3TP3A 2NOGA 5C44J 3E7LA 3HOWJ 3GTGJ 4BY1J 3TP0A 2NVXJ 3DEWA 4C3HJ 3GTLJ 3GTPJ 3RZOJ 3HOXJ 1XS9A 1WCMJ 4C3JJ 2DMUA 1JGGA 3BR1A 1U9OA 1CQTA 3O8HA 1APLC 3LOCA 5J1RA 1ZR4A 2LLKA 4Y7NJ 2CJJA 3G1LA 3S1QJ 2IEKA 1IUFA 2X48A 4XIDA 1JKQC 3D1NI 4EEFG 4Y52J 4D5CA 4UUSA 5EGOB 1HF0A 3TEDA 4AUXA 5E3MA 1WI3A 3JRFA 2H1KA 2DTZA 1OCPA 4I6ZA 3HOUJ 2CRGA 4A3MJ 3S1NJ 1DU0A 1LFUP 3JRHA 3C2BA 3B6AA 3IH2A 1IDZA 3CQZJ 2CQQA 3MVPA 2VPRA 1GVDA 1JKRC 1MBJA 2OF7A 5DS9A 4D7MA 1UHSA 2XSDC 1WGXA 3QPLA 1ETOA 2JA8J 1F36A 2VKVA 3A03A 3G1OA 1ETQA 3HB9A 1GUUA 5FLVA 1NTCA 1U78A 5F04A 4B4CA 5IOYA 1U9NA 1MBEA 2R92J 2DMQA 3RZDJ 4C3IJ 1H8AC 1WPKA 1SFOJ 3LNQA 3GTKJ 2DMNA 2M0CA 1Y1WJ 3LSGA 4A3CJ 2XPVA 1AU7A 5E3OA 2NS8A 2FQ4A 2L7FP 5F27A 3S17J 2NVTJ 4D5FA 2HYJA 1ZGWA 2XB5A 2NS7A 3A02A 3ZQCA 1XG1A 1I3QJ 4IHYA 2E1OA 1VF9A 5M3MJ 1XC5A 3HBLA 1ETKA 4UUSB 2Y31A 1Q1VA 4A3KJ 1JJ8C 3HOVJ 3BR2A 3Q0WA 3PO3J 1IRZA 3BTIA 1Y1VJ 2QCOA 3JR9A 1D5YA 1ENHA 1QRYA 3B6CA 3BR3A 1OCTC 1G2HA 4W1UA 3FK7A 3IH4A 5FKKA 2ME0A 1RKTA 5FKNA 2L7MP 4C2MJ 3BTJA 1QVUA 1OFCX 1RPWA 2ID3A 2MGQA 1UMQA 2IAIA 3H0GJ 3FIWA 4IHWA 1VFCA 2E2JJ 2OPTA 4S0HB 2XGDA 2LVSA 2L9RA 2X6OA 3Q3SA 1MSFC 4DYCA 4FTHA 1T33A 2K9SA 2H8RA 2ME6A 1GDTA 2VI6A 3S14J 1BA5A 1E3OC 2WB1N 2K9NA 2VUMJ 1JKPC 1BW5A 1B72A 2R0QC 4JYKA 2HOTA 3WHBA 2FX0A 3BR5A 3PM1A 3I4MJ 1X2MA 1ORKA 4I76A 5EDNA 5M5WJ 2GM4A 3GTQJ 5IYBJ 1FIAA 4A69C 1IC8A 2O7OA 1PUFA 2LR8A 3FK6A 4A93J 3NAUA 2P81A 1HCRA 4M3GA 5IPAA 3WHCA 3LSRA 2R5ZA 1B8IA 3HOZJ 2O9LA 1WH5A 3FISA 2WAQN 2CQXA 2MSYA 2Y0SN 4A3IJ 2DMTA 1MNMC 2Y2ZA 2M9HA 2HXIA 1GV2A 2NVQJ 1DU6A 1ZQ3P 2K40A 4M6VA 5JLWA 4X6AJ 1BL0A 1ZTRA 3MKLA 3CMYA 1MBGA 2DMPA 1YRNA 1MBHA 2E2HJ 3JRBA 2DJNA 1RKWA 4IEJA 1W0UA 1R9TJ 1MH3A 4UUTA 1H89C 3F0CA 5F08A 4ABZA 2W48A 1JTYA 4CYCB 1LFBA 2AHQA 2LD5A 1BW6A 1B72B 4BXXJ 1Z77A 2E2IJ 4BBSJ 2XRLA 2M8GX 1SANA 3ZQIA 2JA5J 4MFEA 1VNDA 4L5EA 4J19A 3JRGA 5HODA 1FTZA 2XPWA 2CU7A 4XRSA 5E3LA 1POGA 2VKEA 5C4JJ 2R5YA 2R7ZJ 3BQYA 3IV5A 1PUFB 3LSPA 3TW7A 2YUSA 2DA1A 3S2DJ 3BR6A 1FJLA 2GBYA 1JT6A 4A3FJ 3ZQLA 3M4OJ 2R5ZB 1B8IB 4JX4A 4DYQA 1LE8A 5GP9A 3GTOJ 1TC3C 1ETVA 1OJLA 5BNGA 1FIPA 4GFBA 1AKHA 2XB0X 1I50J 2EZKA 5GPCA 2WV1A 2JA7J 3QPSA 1YRNB 1ZK8A 5JLXA 3HEFA 1TWHJ 3Q0UA 1GT0C 2EZLA 5M5YJ 2Y9ZA 2JK3A 2DA4A 3ZQHA 2HXOA 1P7JA 1HLVA 1MBKA 1A5JA 2NVYJ 5J1YA 3S15J 3LSJA 1RR7A 2DA2A 4XICA 4RDUA 2Y9YA 2R5YB 1QPIA 4MIMA 2DA6A 1TWAJ 2N8GA 5F1JA 2LK2A 2ZB9A 3M3YJ 2CUFA 1ZKGA 2K9QA 3GBGA 1F43A 3BG5A 4NDLA 1LE8B 3BR0A 5FKOA 2JJ7A 4FISA 2JN6A 1K61A 4BY7J 1RETA 1MSEC 2KDZA 1X58A 1U8BA 4W97A 1GV5A 4AC0A 4JX5A 2HQ5A 3SFIA 1JKOC 4BKXA 3S2HJ 4DYRA 2E19A 5J3LA 2CUEA 2YS9A 5IYDJ 3S1RJ 1EF4A 2AO9A 3QQAA 4IHVA 2QF7A 3CDLA 1H88C 1AHDP 4IHXA 2M2EA 4A3LJ 3OSFA 2TCTA 1NK3P 4JP0A 5M5XJ 1HDDC 3BG9A 3H3VK 5J1UA 3DCFA 2R93J 5IP9J 1JT0A 3RQIA 1FEXA 4XRMA 2X9DA 3CCYA 3MN2A 1O4XA 1UG2A 1TWGJ 2JMWA 5IP7J 2PMZN 2MG4A 4M3EA 2EZIA 3ZOBA 1S7EA 1ETXA 5M3FJ 3G1MA 1X2NA 3NARA 5FLMJ 1HOMA 5F0FA 1VI0A 2ID6A 1HDPA 4QIWN 2HDDA 1IG7A 4MFDA 3HDDA 3S16J 1TWFJ 3HKZN 3SJMA 4A3EJ 3FKIJ 3BG3A 2XPUA 5K7ZA 4FE7A 2ELKA 4A3GJ 4HNVA 5EF6A 1P7IA 2FJ1A 5FKLA 2HOAA 5F0CA 2LTPA 3BQZA 4V2GA 2DN0A 1I6HJ 5C4XJ 1A6IA 3HM5A 2HI3A 5K7FA 3SDGA 5E3NA 1TWCJ 3RKQA 4V2FA 3IH3A 2JWTA 5GPAA 3JRAA 1JJ6C 4MLOA 1T56A 4DZPA 4FE4A 3GTJJ 3I4NJ 3A01A 2DA7A 2DA3A 2RAEA 4MO7A 2MW8A 2COBA 2O8KA 5EEAA 3GTMJ 1IGNA 9ANTA 1ETWA 5C3EJ 3JREA 1W0TA 1JUMA 4AYBN 1FTTA 1MH4A 2I10A 2IBDA 2XGEA 4B1RA 3OSGA 3K7AJ 3ZQGA 2GLOA 4BBRJ 1MBFA 5IYCJ 2JA6J 4A3BJ 5K7HA 4A3JJ 4B3AA 2HOSA 2KT0A 2D5VA 2YU9J 1Z0XA 5EG0A 1JUPA 1RESA 2ECCA 3UKGA 3ZQFA 3K2AA 1WH7A 2EQRA 4XK4A 2B63J 3JRCA 1IJWC 1ZR2A 2EZHA 4XRSG 3HGYA 2Y30A 4X1EA 3JRIA 2G0EA 4QTRA 3PO2J 2LFBA 4QSHA 4DZJA 5EZGA 3BTCA 1BJZA 4D7NA 3BT9A 4LOCA 1QVTA 4M3BA 1AKHB 3A01B 5EZHA 3JRDA 1ETYA 3OIOA 3OOUA 3HGGA 2LY9A 2TRTA 5FJ8J 3L1PA 2FD5A 2LP0A 4JX6A 1ITYA 5DTDA 2LKXA 5IP6A 2L7ZA 3O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RBO A;  2EBI A;  3TW6 A;  4G12 A;  4A3D J;  4M3D A;  2L0K A;  5EGO A;  3S1M J;  4M3F A;  1IV6 A;  1IDY A;  5EYR A;  3VPR A;  1JUS A;  5F0H A;  1NK2 P;  2ECB A;  3W6V A;  1K83 J;  2EH3 A;  3HOY J;  2XGC A;  5EG0 B;  3BTL A;  3Q0V A;  5FKM A;  4CYC A;  4FCY A;  2DA5 A;  2M34 A;  4DW6 A;  5IOZ A;  1JTX A;  3TP3 A;  2NOG A;  5C44 J;  3E7L A;  3HOW J;  3GTG J;  4BY1 J;  3TP0 A;  2NVX J;  3DEW A;  4C3H J;  3GTL J;  3GTP J;  3RZO J;  3HOX J;  1XS9 A;  1WCM J;  4C3J J;  2DMU A;  1JGG A;  3BR1 A;  1U9O A;  1CQT A;  3O8H A;  1APL C;  3LOC A;  5J1R A;  1ZR4 A;  2LLK A;  4Y7N J;  2CJJ A;  3G1L A;  3S1Q J;  2IEK A;  1IUF A;  2X48 A;  4XID A;  1JKQ C;  3D1N I;  4EEF G;  4Y52 J;  4D5C A;  4UUS A;  5EGO B;  1HF0 A;  3TED A;  4AUX A;  5E3M A;  1WI3 A;  3JRF A;  2H1K A;  2DTZ A;  1OCP A;  4I6Z A;  3HOU J;  2CRG A;  4A3M J;  3S1N J;  1DU0 A;  1LFU P;  3JRH A;  3C2B A;  3B6A A;  3IH2 A;  1IDZ A;  3CQZ J;  2CQQ A;  3MVP A;  2VPR A;  1GVD A;  1JKR C;  1MBJ A;  2OF7 A;  5DS9 A;  4D7M A;  1UHS A;  2XSD C;  1WGX A;  3QPL A;  1ETO A;  2JA8 J;  1F36 A;  2VKV A;  3A03 A;  3G1O A;  1ETQ A;  3HB9 A;  1GUU A;  5FLV A;  1NTC A;  1U78 A;  5F04 A;  4B4C A;  5IOY A;  1U9N A;  1MBE A;  2R92 J;  2DMQ A;  3RZD J;  4C3I J;  1H8A C;  1WPK A;  1SFO J;  3LNQ A;  3GTK J;  2DMN A;  2M0C A;  1Y1W J;  3LSG A;  4A3C J;  2XPV A;  1AU7 A;  5E3O A;  2NS8 A;  2FQ4 A;  2L7F P;  5F27 A;  3S17 J;  2NVT J;  4D5F A;  2HYJ A;  1ZGW A;  2XB5 A;  2NS7 A;  3A02 A;  3ZQC A;  1XG1 A;  1I3Q J;  4IHY A;  2E1O A;  1VF9 A;  5M3M J;  1XC5 A;  3HBL A;  1ETK A;  4UUS B;  2Y31 A;  1Q1V A;  4A3K J;  1JJ8 C;  3HOV J;  3BR2 A;  3Q0W A;  3PO3 J;  1IRZ A;  3BTI A;  1Y1V J;  2QCO A;  3JR9 A;  1D5Y A;  1ENH A;  1QRY A;  3B6C A;  3BR3 A;  1OCT C;  1G2H A;  4W1U A;  3FK7 A;  3IH4 A;  5FKK A;  2ME0 A;  1RKT A;  5FKN A;  2L7M P;  4C2M J;  3BTJ A;  1QVU A;  1OFC X;  1RPW A;  2ID3 A;  2MGQ A;  1UMQ A;  2IAI A;  3H0G J;  3FIW A;  4IHW A;  1VFC A;  2E2J J;  2OPT A;  4S0H B;  2XGD A;  2LVS A;  2L9R A;  2X6O A;  3Q3S A;  1MSF C;  4DYC A;  4FTH A;  1T33 A;  2K9S A;  2H8R A;  2ME6 A;  1GDT A;  2VI6 A;  3S14 J;  1BA5 A;  1E3O C;  2WB1 N;  2K9N A;  2VUM J;  1JKP C;  1BW5 A;  1B72 A;  2R0Q C;  4JYK A;  2HOT A;  3WHB A;  2FX0 A;  3BR5 A;  3PM1 A;  3I4M J;  1X2M A;  1ORK A;  4I76 A;  5EDN A;  5M5W J;  2GM4 A;  3GTQ J;  5IYB J;  1FIA A;  4A69 C;  1IC8 A;  2O7O A;  1PUF A;  2LR8 A;  3FK6 A;  4A93 J;  3NAU A;  2P81 A;  1HCR A;  4M3G A;  5IPA A;  3WHC A;  3LSR A;  2R5Z A;  1B8I A;  3HOZ J;  2O9L A;  1WH5 A;  3FIS A;  2WAQ N;  2CQX A;  2MSY A;  2Y0S N;  4A3I J;  2DMT A;  1MNM C;  2Y2Z A;  2M9H A;  2HXI A;  1GV2 A;  2NVQ J;  1DU6 A;  1ZQ3 P;  2K40 A;  4M6V A;  5JLW A;  4X6A J;  1BL0 A;  1ZTR A;  3MKL A;  3CMY A;  1MBG A;  2DMP A;  1YRN A;  1MBH A;  2E2H J;  3JRB A;  2DJN A;  1RKW A;  4IEJ A;  1W0U A;  1R9T J;  1MH3 A;  4UUT A;  1H89 C;  3F0C A;  5F08 A;  4ABZ A;  2W48 A;  1JTY A;  4CYC B;  1LFB A;  2AHQ A;  2LD5 A;  1BW6 A;  1B72 B;  4BXX J;  1Z77 A;  2E2I J;  4BBS J;  2XRL A;  2M8G X;  1SAN A;  3ZQI A;  2JA5 J;  4MFE A;  1VND A;  4L5E A;  4J19 A;  3JRG A;  5HOD A;  1FTZ A;  2XPW A;  2CU7 A;  4XRS A;  5E3L A;  1POG A;  2VKE A;  5C4J J;  2R5Y A;  2R7Z J;  3BQY A;  3IV5 A;  1PUF B;  3LSP A;  3TW7 A;  2YUS A;  2DA1 A;  3S2D J;  3BR6 A;  1FJL A;  2GBY A;  1JT6 A;  4A3F J;  3ZQL A;  3M4O J;  2R5Z B;  1B8I B;  4JX4 A;  4DYQ A;  1LE8 A;  5GP9 A;  3GTO J;  1TC3 C;  1ETV A;  1OJL A;  5BNG A;  1FIP A;  4GFB A;  1AKH A;  2XB0 X;  1I50 J;  2EZK A;  5GPC A;  2WV1 A;  2JA7 J;  3QPS A;  1YRN B;  1ZK8 A;  5JLX A;  3HEF A;  1TWH J;  3Q0U A;  1GT0 C;  2EZL A;  5M5Y J;  2Y9Z A;  2JK3 A;  2DA4 A;  3ZQH A;  2HXO A;  1P7J A;  1HLV A;  1MBK A;  1A5J A;  2NVY J;  5J1Y A;  3S15 J;  3LSJ A;  1RR7 A;  2DA2 A;  4XIC A;  4RDU A;  2Y9Y A;  2R5Y B;  1QPI A;  4MIM A;  2DA6 A;  1TWA J;  2N8G A;  5F1J A;  2LK2 A;  2ZB9 A;  3M3Y J;  2CUF A;  1ZKG A;  2K9Q A;  3GBG A;  1F43 A;  3BG5 A;  4NDL A;  1LE8 B;  3BR0 A;  5FKO A;  2JJ7 A;  4FIS A;  2JN6 A;  1K61 A;  4BY7 J;  1RET A;  1MSE C;  2KDZ A;  1X58 A;  1U8B A;  4W97 A;  1GV5 A;  4AC0 A;  4JX5 A;  2HQ5 A;  3SFI A;  1JKO C;  4BKX A;  3S2H J;  4DYR A;  2E19 A;  5J3L A;  2CUE A;  2YS9 A;  5IYD J;  3S1R J;  1EF4 A;  2AO9 A;  3QQA A;  4IHV A;  2QF7 A;  3CDL A;  1H88 C;  1AHD P;  4IHX A;  2M2E A;  4A3L J;  3OSF A;  2TCT A;  1NK3 P;  4JP0 A;  5M5X J;  1HDD C;  3BG9 A;  3H3V K;  5J1U A;  3DCF A;  2R93 J;  5IP9 J;  1JT0 A;  3RQI A;  1FEX A;  4XRM A;  2X9D A;  3CCY A;  3MN2 A;  1O4X A;  1UG2 A;  1TWG J;  2JMW A;  5IP7 J;  2PMZ N;  2MG4 A;  4M3E A;  2EZI A;  3ZOB A;  1S7E A;  1ETX A;  5M3F J;  3G1M A;  1X2N A;  3NAR A;  5FLM J;  1HOM A;  5F0F A;  1VI0 A;  2ID6 A;  1HDP A;  4QIW N;  2HDD A;  1IG7 A;  4MFD A;  3HDD A;  3S16 J;  1TWF J;  3HKZ N;  3SJM A;  4A3E J;  3FKI J;  3BG3 A;  2XPU A;  5K7Z A;  4FE7 A;  2ELK A;  4A3G J;  4HNV A;  5EF6 A;  1P7I A;  2FJ1 A;  5FKL A;  2HOA A;  5F0C A;  2LTP A;  3BQZ A;  4V2G A;  2DN0 A;  1I6H J;  5C4X J;  1A6I A;  3HM5 A;  2HI3 A;  5K7F A;  3SDG A;  5E3N A;  1TWC J;  3RKQ A;  4V2F A;  3IH3 A;  2JWT A;  5GPA A;  3JRA A;  1JJ6 C;  4MLO A;  1T56 A;  4DZP A;  4FE4 A;  3GTJ J;  3I4N J;  3A01 A;  2DA7 A;  2DA3 A;  2RAE A;  4MO7 A;  2MW8 A;  2COB A;  2O8K A;  5EEA A;  3GTM J;  1IGN A;  9ANT A;  1ETW A;  5C3E J;  3JRE A;  1W0T A;  1JUM A;  4AYB N;  1FTT A;  1MH4 A;  2I10 A;  2IBD A;  2XGE A;  4B1R A;  3OSG A;  3K7A J;  3ZQG A;  2GLO A;  4BBR J;  1MBF A;  5IYC J;  2JA6 J;  4A3B J;  5K7H A;  4A3J J;  4B3A A;  2HOS A;  2KT0 A;  2D5V A;  2YU9 J;  1Z0X A;  5EG0 A;  1JUP A;  1RES A;  2ECC A;  3UKG A;  3ZQF A;  3K2A A;  1WH7 A;  2EQR A;  4XK4 A;  2B63 J;  3JRC A;  1IJW C;  1ZR2 A;  2EZH A;  4XRS G;  3HGY A;  2Y30 A;  4X1E A;  3JRI A;  2G0E A;  4QTR A;  3PO2 J;  2LFB A;  4QSH A;  4DZJ A;  5EZG A;  3BTC A;  1BJZ A;  4D7N A;  3BT9 A;  4LOC A;  1QVT A;  4M3B A;  1AKH B;  3A01 B;  5EZH A;  3JRD A;  1ETY A;  3OIO A;  3OOU A;  3HGG A;  2LY9 A;  2TRT A;  5FJ8 J;  3L1P A;  2FD5 A;  2LP0 A;  4JX6 A;  1ITY A;  5DTD A;  2LKX A;  5IP6 A;  2L7Z A;  3O8G A; 
#chains in the Genus database with same CATH topology
 2EBI A;  4UVA A;  3DU6 A;  3TW6 A;  4A3D J;  3BZK A;  3DP7 A;  4ZC3 A;  5F0H A;  5FD6 A;  4RM2 A;  3K9T A;  3HOY J;  5EG0 B;  2KFD A;  3FXQ A;  2W82 A;  2Z16 A;  2CW0 F;  2DDA A;  2KDO A;  4L0Y B;  1RR8 C;  2M34 A;  4OIR F;  1JTX A;  3R6S A;  5KNL A;  5F1R A;  1LUJ B;  1U5T C;  2E1M B;  2VJJ A;  1UEL B;  1ON1 A;  4BY1 J;  4G6D A;  3F8M A;  2A3S A;  3I5U A;  4C3H J;  3GTP J;  5DM6 F;  5B1A H;  2M1B A;  2A68 F;  3DXJ F;  2BZT A;  1U9O A;  3KP5 A;  4XNF A;  1V54 H;  1W7P A;  2LLK A;  3MZ8 A;  5LD2 C;  4M71 A;  3VYT B;  2R7F A;  3HJE A;  4Q4Z F;  1OCO H;  3OS1 A;  2HGC A;  1V5G A;  4XID A;  2MC3 A;  2DU9 A;  3L9F A;  4EEF G;  1YX5 A;  4Y52 J;  2CUJ A;  4H0E A;  3BZ6 A;  2MA3 A;  4YG2 F;  5B5E C;  3LAP A;  2VAS A;  1HF0 A;  3TED A;  2OQG A;  4TV7 A;  2QQA A;  1T95 A;  2CG4 A;  1WI3 A;  2CS3 A;  1OYW A;  2QZ8 A;  4AIH A;  1QHH D;  2VC0 A;  3TKY A;  3F72 A;  1DU0 A;  3CD6 I;  3ZN0 A;  1IDZ A;  3OYA A;  4RAZ A;  1YIT I;  4B47 A;  2WWY A;  3FBN B;  2YX4 A;  3U2R A;  4BDY A;  1LEB A;  2OF7 A;  1A36 A;  4D7M A;  2XSD C;  1WGX A;  3WGG A;  2P6S A;  4FET A;  3WGI A;  1NTC A;  3EUH C;  4XN0 A;  1KU7 A;  2UXN A;  4II3 A;  2XF5 A;  3J7A Y;  2M0C A;  4WXH A;  4M72 A;  1G3Y A;  2NVU B;  2CYY A;  2FQ4 A;  1H9G A;  3H35 A;  3KPH A;  1Z67 A;  3S17 J;  4PSW A;  1IF1 A;  1ZGW A;  3H5R A;  2M4G A;  3J81 K;  5GAG J;  3ZQC A;  3H92 A;  3J7Z I;  3IP4 B;  1I3Q J;  3KP4 A;  5D4S A;  5DM7 F;  1K4T A;  4IHY A;  2E1O A;  3ELK A;  5M3M J;  3HBL A;  1ETK A;  4UUS B;  3HUG B;  1GXP A;  1Y6I A;  1JJ8 C;  3HOV J;  3PO3 J;  1Y1V J;  1LQ1 A;  3JR9 A;  2W85 A;  3B6C A;  1FSE A;  2A6H F;  3BCB A;  5L3F A;  3FK7 A;  1GXQ A;  3IH4 A;  4LLL A;  2EJR A;  4ESJ A;  3TDZ C;  3E6D A;  4F7Z A;  4E6K G;  4BUP A;  1ZRE A;  3ONQ A;  4OIO F;  2QSG X;  3CCS I;  4GYI A;  1SFK A;  3CJR B;  4BXF A;  1DQU A;  2MGQ A;  3CZ6 A;  1UMQ A;  3KCC A;  1UHM A;  2X6X A;  2RNG A;  3DF8 A;  4IHW A;  3J81 Z;  2OPT A;  4S0H B;  4IKF A;  2XGD A;  1S9H A;  2JTV A;  2X6O A;  4ENN A;  1R1T A;  1R7J A;  4CCJ A;  1FYL A;  4FTH A;  2CV2 A;  1BI1 A;  4HAM A;  1K4S A;  1IAW A;  1S29 A;  3AAF A;  2ME6 A;  3TDU C;  1GDT A;  3LAJ A;  3UNG C;  2K9N A;  2LKP A;  3QPH A;  1W7P D;  1QGP A;  1B72 A;  2OU2 A;  3A0B C;  1LVK A;  2M87 A;  3WHB A;  5D5W B;  1TNS A;  4IJA A;  2MBF A;  3MWM A;  1B9N A;  3ZMS A;  3H9Q A;  3M1C A;  2NS0 A;  1BI0 A;  5M5W J;  4HRI A;  3GTQ J;  3GFI A;  1D0Z A;  3X2Q H;  4I01 A;  3BY6 A;  2O7O A;  1KA8 A;  1PUF A;  1YE9 A;  4BH9 A;  1B8I A;  3QRF F;  4WCG A;  4EM0 B;  3IRR A;  1V5F A;  3V7R A;  1Y8R B;  2HYG D;  2QYO A;  2CQX A;  1T39 A;  4RLQ A;  2M9H A;  1DU6 A;  1D1B A;  2HVS A;  1UHW A;  3MKL A;  2JT1 A;  2DMP A;  3ZMZ A;  1YRN A;  2AQF A;  1MBH A;  2W84 A;  3GXO A;  1W0U A;  1Z05 A;  5J4V A;  2R7D A;  3Q9S A;  3F3X A;  4LB6 B;  1HW5 A;  2R4G A;  4UUT A;  1DP7 P;  3F6O A;  4ABZ A;  4PFO A;  1YX3 A;  1MMD A;  1X1C A;  3RTR A;  3RCO A;  3MKY B;  1ODD A;  1JTY A;  4CYC B;  3ZQ7 A;  4BXX J;  2X1C A;  4RAG A;  1YQA A;  2R7O A;  3SZG A;  2UZK A;  2XRL A;  2M8G X;  4JQF A;  1SEU A;  2DAO A;  5J4Y A;  4BAC A;  4IX7 A;  2AXT C;  2PLY A;  4KFC A;  2CU7 A;  2VT3 A;  3K69 A;  2EIK H;  4NBQ A;  2XSJ C;  4B09 A;  3BQY A;  3DLL F;  1Q1H A;  2YUS A;  2C6Y A;  2GA2 A;  2BY3 A;  1FJL A;  2GBY A;  1JT6 A;  3WE2 A;  3M7G A;  3BP8 A;  2H09 A;  3R60 A;  4HPQ A;  3HHH A;  3M1E A;  3O6B B;  4CH7 A;  3KX2 A;  4DYQ A;  4ESB A;  2R5Z B;  1LKX A;  2X0L A;  5D6F A;  1IZ1 A;  2JRT A;  3I56 I;  3FHN A;  5D5U B;  3IAS 2;  1OJL A;  1TLH B;  1TQI A;  4ZJZ A;  5BNG A;  4GFB A;  1AKH A;  3PUB A;  2NYX A;  4BQQ A;  4Y13 A;  1I50 J;  2F5C A;  1W36 D;  2PJR A;  2WV1 A;  3QPS A;  2K9L A;  4MGR A;  3ESW B;  3WG7 H;  4DBQ A;  3ASO H;  3M8J A;  2ZME C;  4CUG A;  5ICC A;  4BHC A;  3R4K A;  3NQO A;  2XDV A;  3KYL A;  3QOP A;  3HPG A;  1GT0 C;  3BJO A;  3QP5 A;  1EJ9 A;  2Y9Z A;  1MDM A;  2JK3 A;  3RDI A;  4GYG A;  3CP8 A;  5HLG A;  4A0Z A;  1HLV A;  3R0A A;  2H8W A;  4O6J A;  3KP7 A;  2O6G E;  3LA7 A;  5H20 A;  1MIJ A;  1RR7 A;  4L5J A;  2DA2 A;  3G73 A;  1ZRC A;  1VZ0 A;  1XMK A;  2L9V A;  3S32 A;  5GAD J;  2ZCW A;  1QPI A;  4MIM A;  4ZYG A;  2ZFU A;  1R4M B;  4KT5 C;  1UZC A;  2ZKZ A;  3MCZ A;  2CUF A;  3PIP F;  1LDD A;  2E36 A;  3QPT A;  2K9Q A;  1F43 A;  4NDL A;  4Y15 A;  3A2K A;  2W4S A;  4IXA A;  4KMF A;  3OYC A;  1LPQ A;  2L54 A;  5FFX A;  5E1X A;  1SMY F;  1WRJ A;  4XKW A;  1QBJ A;  4KIG A;  4GGG A;  3TOA A;  4YFK F;  2PMZ A;  4XON A;  2O03 A;  5CYV A;  2M45 A;  1GHC A;  3PNT A;  4AVP A;  1BC8 C;  1MZB A;  1IN8 A;  3R61 A;  1U8B A;  2KRC A;  3V7C A;  5JHF A;  1GV5 A;  2EIM H;  2PMH A;  1X3Z B;  1WJB A;  1O3R A;  4HV5 A;  2WY7 Q;  1U5T B;  3SFI A;  4L18 B;  1V4R A;  3VSK A;  2FE3 A;  3HHG A;  4CCN A;  3WTS C;  4XSX F;  4EJT A;  5IYD J;  2ZNZ A;  3S1R J;  4L9J A;  3QQA A;  1X3W B;  3ABM H;  1R49 A;  1W1W E;  1HSJ A;  5JVG F;  2X6Y A;  2HKO A;  1FBU A;  3EPZ A;  3GFM A;  4YIF A;  1E3H A;  2L4M A;  3R0J A;  3H3U A;  4JP0 A;  5M5X J;  3QOE A;  1HDD C;  2VPL A;  3FMR A;  3J7Y J;  1G8X A;  2UXX A;  3DCF A;  2OQR A;  5E1Z B;  2F5F A;  1FEX A;  3CCY A;  3CCE I;  5HVQ C;  1Z9C A;  4CO8 A;  5IP7 J;  1RZ4 A;  3B02 A;  4HF0 A;  3W6K B;  2LOO A;  1Z3X A;  1S7E A;  1ETX A;  5M3F J;  3ZQQ A;  1X2N A;  2VBW A;  4OIN F;  4QWQ A;  4M9X A;  2JSP A;  1VI0 A;  3H1C A;  3J80 K;  1R71 A;  1E0E A;  4MFD A;  2XRO A;  1W36 C;  1ZHF A;  3HKZ N;  5KAF C;  4CA0 A;  1C0W A;  1J09 A;  2LG4 A;  5JHU A;  3F8C A;  4BAY A;  5FKL A;  2F4M B;  4N4O B;  1VQL I;  2LTP A;  3CDH A;  5JFR A;  3G71 I;  5JVT A;  2A07 F;  1W5C C;  3KZI C;  2RGV A;  2Y75 A;  1EH6 A;  1D8J A;  3S8P A;  3PSI A;  3SDG A;  3GME A;  3SZP A;  3VSL A;  3RKQ A;  3FXU A;  2DK8 A;  2E7W A;  3JTH A;  5GPA A;  2OCC H;  3RKX A;  4ETS A;  1SAU A;  4FE4 A;  5AIQ A;  2PFB A;  4LFU A;  2V1X A;  3J80 Z;  4HDV A;  2DA7 A;  4MO7 A;  2HU9 A;  2RAE A;  5CPR B;  3W6J B;  1Y56 A;  2FQ3 A;  1FX7 A;  4FX0 A;  5TJJ A;  1FBQ A;  2KJC A;  4CCK A;  1T2K A;  1K78 B;  3CCR I;  3KYC B;  1ERD A;  4NQW B;  5CVI A;  2FA5 A;  4R8H A;  3FXM A;  1JUM A;  3HSE A;  3JRE A;  1W0T A;  2GQQ A;  2IBD A;  1QZY A;  4AWX B;  2EIN H;  3K7A J;  5GAE J;  3NWS A;  1LNW A;  2ACJ A;  3W2A A;  2KT0 A;  1L0O C;  2D5V A;  3OYK A;  1JUP A;  4CXF A;  1RES A;  2ECC A;  3OYE A;  1AOY A;  4B3X A;  3EQL F;  2EQR A;  4E4H A;  3F8B A;  2B63 J;  4CYD A;  3JRC A;  5CQE A;  1MKM A;  1IUY A;  1BR2 A;  1JHH A;  3HGY A;  4HW0 A;  4RB3 C;  2Y69 H;  2VLA A;  3D5R C;  2P8T A;  4X1E A;  2GOM A;  1HA8 A;  1FSH A;  4BDZ A;  2VOP A;  4GRI A;  2DPD A;  2QVO A;  3CP2 A;  1XSD A;  5L3C A;  4DZJ A;  2G7H A;  2E60 A;  2JPC A;  1BJZ A;  3BT9 A;  2FOW A;  4M3B A;  4M9S A;  4BQN A;  5JR3 A;  4N9H A;  3OIO A;  1KQ8 A;  2FD5 A;  3E6C C;  1R5I D;  1A31 A;  2XVC A;  4O3M A;  3LSH A;  2FNP A;  4R1H A;  4HNU A;  2L7Z A;  3ECH A;  2VE9 A;  5IY5 H;  2G9W A;  2IRF G;  1B4A A;  1TT5 B;  4M3F A;  1DPU A;  3HRS A;  3E6M A;  1EKE A;  1JUS A;  4IRH A;  3VPR A;  2D2W A;  4EGZ A;  2ECB A;  3VEP A;  3W6V A;  3QWL A;  1DUX C;  2XGC A;  1YHQ I;  1RIO H;  2HTJ A;  3ABK H;  4LG3 A;  2IA1 A;  1U0J A;  1PJR A;  4U7B A;  4V19 K;  3G3Z A;  3WTX C;  1WJF A;  4RM3 A;  2HR3 A;  1X19 A;  5C44 J;  3HOW J;  4KNY A;  1E3P A;  3TP0 A;  3DPT A;  1WJC A;  2Q2E B;  1BOA A;  3DEW A;  3GTL J;  1WJA A;  1XS9 A;  4C3J J;  4EJW A;  1ACI A;  4ZDP A;  3IKV A;  3T8R A;  1CQT A;  2HFH A;  4RB1 A;  1Y0N A;  2V9V A;  5ICF A;  5CVU A;  1APL C;  1LEA A;  3LOC A;  2P7C B;  5DD4 A;  1ZR4 A;  1MMS A;  4Y7N J;  3G1L A;  4RLF A;  2IEK A;  1IUF A;  3HYI A;  1JKQ C;  1HKT A;  2HPI A;  4BJ6 C;  2EV5 A;  2KHM A;  1PP8 F;  3QYB A;  4F55 A;  4AUX A;  3O2P E;  5E3M A;  2V7F A;  2GIZ A;  2HQA A;  3M07 A;  3JRF A;  4BGD A;  1DPR A;  4A12 A;  1Z3Y A;  2CRG A;  1H0M A;  2XV4 S;  1LFU P;  2ZC2 A;  2OUM A;  1ZRD A;  2W00 A;  3B6A A;  3I54 A;  2V1U A;  3CQZ J;  4UVC A;  4YEJ A;  2R7T A;  3MVP A;  2DFF A;  4MNU A;  2VPR A;  1GVD A;  3S3M A;  3RKY A;  1ZAO A;  3A0H C;  1JKR C;  3T0Y A;  2BY0 A;  4XM3 A;  4UNO A;  3IHU A;  2PX9 A;  3A03 A;  2ZME B;  1ETQ A;  5HS7 A;  1R5H A;  4EV0 A;  3DQV C;  1I39 A;  1U9N A;  5J8F A;  1MBE A;  2NOJ B;  2DMQ A;  5DCM A;  1XD7 A;  4XKB A;  1VQM I;  1PUE E;  1I1G A;  1H8A C;  1KGS A;  1X1A A;  2QWW A;  3PIO F;  3I55 I;  2X4H A;  3LSG A;  1WFX A;  2Z33 A;  4A3C J;  4ZDO A;  2XPV A;  2Z1D A;  5E3O A;  1LJ9 A;  2IVM A;  2L01 A;  3ZN1 A;  5EEG A;  3LST A;  2V6C A;  4DNC A;  2E71 A;  4HNT A;  1IV8 A;  3VYS B;  4A6D A;  4D5F A;  2RQQ A;  2XB5 A;  3GF2 A;  1A04 A;  3I4P A;  3I0T A;  3VOD A;  2O0Y A;  3K70 D;  4YFX F;  4CGZ A;  1ZG3 A;  4BE0 A;  1KYZ A;  3F8N A;  3KLO A;  3BR2 A;  3VOE A;  3OIP A;  2HDW A;  1IRZ A;  3D0S A;  2QCO A;  3CLQ A;  3C18 A;  1KU3 A;  1QRY A;  3QAH A;  3HXL A;  3MAJ A;  4OMY A;  1QZE A;  4RGR A;  1R58 A;  2EA2 A;  4W1U A;  3IL2 A;  3G6E I;  3DKW A;  5FRN A;  2L3D A;  3DTE A;  2L7M P;  2IA2 A;  4C2M J;  1QVU A;  2K85 A;  4FX4 A;  2DYS H;  3OL3 A;  4Z2Y A;  1OLT A;  3GLX A;  4ON0 A;  4PUS A;  1IO2 A;  2RRE A;  3FIW A;  3EET A;  1HC8 A;  2LNB A;  3IAM 2;  2ZJR F;  1UJ8 A;  5KAI C;  5DV5 A;  4F3Q A;  3ROU A;  1MSF C;  2IP2 A;  1SC7 A;  3PJR A;  3K4C A;  4C30 A;  2VI6 A;  3OY9 A;  1BA5 A;  3H5N A;  1E3O C;  5GTH C;  1JKP C;  2DTR A;  1BW5 A;  2LF8 A;  3FM3 A;  2ISY A;  4IF4 A;  4JYK A;  5CVR A;  2FX0 A;  3PM1 A;  3VYU B;  1X2M A;  4I0B A;  2I5U A;  5EDN A;  3P5J A;  2BXZ A;  1CF7 A;  3CO6 C;  4A69 C;  2EWN A;  5K5Q A;  2ZJP F;  2M7B A;  2OTL I;  4BHP A;  4NNJ A;  5BPI A;  4IQJ A;  2WTE A;  2JUC A;  4WXD A;  3WTT C;  3E5X A;  5AIP A;  2ZXH A;  3HOZ J;  5BS6 A;  2O9L A;  3BOQ A;  3C7J A;  2WAQ N;  2Y0S N;  3GX4 X;  4A3I J;  2DMT A;  3TBI A;  4HOB A;  1IXS B;  2Y2Z A;  1D8K A;  2HXI A;  2OJE D;  2NVQ J;  2D1V A;  4M6V A;  5L3E A;  1SFU A;  1BL0 A;  1KU2 A;  3PSF A;  3CMY A;  2GAU A;  1KQ9 A;  3K4K A;  1MBG A;  2CO5 A;  3JRB A;  1E17 A;  3H9G A;  1RKW A;  2HTS A;  2KPM A;  2WBM A;  1R9T J;  4P9U A;  1BIB A;  1REP C;  2MC4 A;  5LRR A;  3MD2 A;  4BS9 A;  5F08 A;  2CGP A;  2W48 A;  4G8X A;  3T5X A;  3MKW B;  1Z1D A;  1B72 B;  1Z77 A;  5FD5 A;  4BBS J;  3K70 C;  4N4N B;  2W24 A;  4Y33 A;  3D5L A;  3OYI A;  1STZ A;  4NC8 A;  3V42 A;  1VND A;  2L5Q A;  2RQP A;  1G3W A;  4J19 A;  2FXA A;  1T08 B;  3SDB A;  3K4M A;  4XRS A;  5HDK A;  2E5N A;  2DOD A;  1MNE A;  2ZO4 A;  2VKD A;  1PUF B;  2X51 A;  1QHG A;  3WTZ A;  2DA1 A;  2VT2 A;  2F48 A;  3L2V A;  4A3F J;  4XLC A;  3ZQL A;  3M4O J;  3CJT B;  1B8I B;  1LE8 A;  4UUV A;  2UV1 A;  4IL6 C;  1S72 I;  2M3A A;  2KKO A;  3HTS B;  2CWE A;  1TC3 C;  4U0W A;  1FIP A;  2DJI A;  3HIF A;  1WKM A;  3LQR A;  2O5R A;  5HDG A;  3LSM A;  2L9S A;  1W5T A;  2EFO A;  1YRN B;  1YLF A;  3HPH A;  1ZK8 A;  5JLX A;  5KK1 A;  3HEF A;  2TDX A;  1BBY A;  5ILV A;  5K5R A;  2EZL A;  4P1W A;  5M5Y J;  5FRO A;  2DA4 A;  3ZQH A;  1WZ2 A;  4G94 A;  3PQK A;  5H6Q A;  1MBK A;  2H1L A;  1YIJ I;  3EUA A;  2F6C A;  3GO5 A;  5ICG A;  2HKX A;  2AXL A;  2NVY J;  3ZMV A;  5J1Y A;  2IS2 A;  5TRD A;  1I1S A;  2FRH A;  1JXS A;  4F92 B;  2DA6 A;  2N8G A;  3RSN A;  2B7E A;  2E35 A;  3M3Y J;  1FMW A;  4KN7 X;  2CQK A;  5LFA A;  3GBG A;  3WE3 A;  2WAF A;  5FKO A;  1B59 A;  2JPB A;  1TL8 A;  4PDK A;  1ONV A;  4UHT A;  4KIF A;  4PZJ A;  2M8E A;  2V1D A;  2K7L A;  2OZU A;  2KDZ A;  4W97 A;  4AC0 A;  1TW3 A;  4HX8 A;  3S2H J;  2FNA A;  3C3W A;  3EDP A;  4CZC A;  1S6L A;  4BYY A;  1SFE A;  3HL2 A;  3HKZ A;  1JE8 A;  2F2E A;  1MDM B;  2CUE A;  3KZZ A;  4HBL A;  2YS9 A;  2P0W A;  1B9M A;  3I53 A;  2DQL A;  3TO6 A;  2QF7 A;  3IWF A;  4HF2 A;  1AHD P;  1P6R A;  4Q48 A;  4ANJ A;  4BEH B;  4MEX F;  2GXA A;  4ENM A;  1NK3 P;  3OR2 C;  3FWE A;  1N78 A;  2L7K A;  3I3L A;  3BG9 A;  3GWZ A;  4XKV A;  3H3V K;  2GIV A;  2Y48 A;  4MTE A;  1OYI A;  3OYJ A;  4R79 A;  3MN2 A;  4YFN F;  1TWG J;  4J00 A;  2ESH A;  3BRO A;  1MJB A;  1ZH5 A;  3ZOB A;  1S5L C;  3G1M A;  2EFP A;  4HYE A;  4UV9 A;  2QGU A;  2NNN A;  3QU6 A;  1HOM A;  4QLC U;  3K1N A;  4CHU A;  2HDD A;  3S16 J;  4A3E J;  3SJM A;  2EFN A;  2CSO A;  1XB4 A;  1YS7 A;  3DTK A;  2M30 A;  2BVL A;  4FE7 A;  2ELK A;  4E7H A;  4LD5 A;  1WI9 A;  4HNV A;  4A3G J;  4WF2 A;  5J8C A;  3DPU A;  5BMZ A;  2HOA A;  3K4N A;  3DBR B;  1YOV B;  4M73 A;  3FF5 A;  4V2G A;  3BG7 A;  1HST A;  5C4X J;  1A6I A;  1F4K A;  2HI3 A;  2X85 A;  5K7F A;  3ULQ B;  4IO9 F;  3JSO A;  1TWC J;  4FT8 A;  2KIU A;  3CC2 I;  5GTI C;  3IH3 A;  3V8J A;  2JWT A;  2QLZ A;  1JJ6 C;  5LLQ A;  1ZGJ A;  2KJB A;  2MD5 A;  4E7J A;  4DZP A;  2DLL A;  1LVA A;  4HQE A;  4LG0 A;  4Y3O A;  3NRV A;  5LEJ A;  2DA3 A;  4YII A;  3FXL A;  3E1S A;  2LSO A;  1HKQ A;  2QEX I;  4L9T A;  3RYP A;  3GTM J;  2VKH A;  2HNH A;  3BJA A;  1U2W A;  4PJ0 C;  2R7S A;  4AYB N;  3N97 A;  4AM3 A;  2A69 F;  4XLP F;  3A4C A;  2I10 A;  3V8K A;  3KZY A;  2H94 A;  2IGK A;  1QU3 A;  4L5I A;  1VQ9 I;  4JOM A;  3LA2 A;  1T38 A;  5IYC J;  3CUQ A;  2UUZ A;  3VB2 A;  3TGN A;  1T0F A;  1Z0X A;  4GO1 A;  3AKZ A;  2XF7 A;  4ITV A;  3PQJ A;  5FRM A;  4XK4 A;  5ILU A;  3BC8 A;  2EZH A;  1J59 A;  3F9K A;  2Q8K A;  5CKT A;  2DT7 B;  2G0E A;  3S93 A;  1OCZ H;  1NHA A;  2P6T A;  2Y0M A;  4N9I A;  3AL0 C;  2XAS A;  1MMA A;  2VON A;  5EZG A;  2ETH A;  1F5T A;  4LOC A;  1I3A A;  3KE2 A;  1DDN A;  4MQV A;  3CCV I;  3TL4 X;  2KRH A;  5D4R A;  3ERM A;  3HGG A;  2F5D A;  3BDD A;  3TO9 A;  4EAT A;  2DW4 A;  1D3Y A;  2BW3 B;  2DQR A;  2LP0 A;  4LLN A;  2FSW A;  5IP6 A;  3WTV C;  2A6T A;  5F6F A;  2FBK A;  4RBO A;  4HEA 2;  4G12 A;  2IS6 A;  4ZDL A;  5EGO A;  5LGU A;  2JVH A;  3E5U A;  1IDY A;  5EYR A;  3WU2 C;  1NK2 P;  4I99 C;  2BGC A;  2EH3 A;  2K9M A;  2BYV E;  3ZCO A;  5LEK A;  5FKM A;  2A6E F;  3RPU A;  2CMP A;  4CYC A;  2K02 A;  1HW2 A;  1VQ4 I;  3GYH X;  1PVE A;  2CW7 A;  2DA5 A;  3M8F A;  4FCY A;  4DW6 A;  5IOZ A;  2XHK A;  3TP3 A;  2H27 A;  2K4B A;  4XLH A;  2NOG A;  5L3D A;  4LIU A;  1SD7 A;  4RAF A;  2NVX J;  2LC2 A;  3P9C A;  4MEY F;  2P7V B;  3RZO J;  1USS A;  3WTY C;  3BR1 A;  4BQO A;  4IRI A;  3L2U A;  1TT0 A;  2LMD A;  1ZYR F;  5H6R A;  3RI4 A;  4XL9 A;  3RKW A;  3O8H A;  1AWC A;  4BJT A;  4OMZ A;  5J1R A;  1TBX A;  2K3F A;  1VTN C;  2QKL B;  4XMY A;  3O3K A;  3WGH A;  1QQI A;  2A5W A;  2QSH X;  4HLY A;  4GCV A;  3TO7 A;  4BE1 A;  3D1N I;  4XQF A;  3LWF A;  4D5C A;  3KEO A;  1XGS A;  2PBI A;  3EYI A;  4PK4 A;  4KDP A;  1T6S A;  3ZMD A;  4L0Z B;  5HNH A;  2DFE A;  2FBH A;  2VN2 A;  2ZNY A;  1O7F A;  3RQ4 A;  2H1K A;  2IS4 A;  2R7X A;  1OCP A;  2MAB A;  5KCM A;  4I6Z A;  3HOU J;  1GVJ A;  2L4A A;  2KMU A;  3DTI A;  3S2W A;  4A3M J;  1Z7U A;  3IUO A;  1YW9 A;  5DDG A;  1QA6 A;  2PI0 A;  3S1N J;  3RYR A;  2V9K A;  3MEX A;  4CCM A;  3JRH A;  1HKS A;  2HVR A;  2EV6 A;  2LH9 A;  2QQ9 A;  4EQQ A;  3LFK A;  1S8N A;  4N0B A;  5FB2 A;  4UVB A;  5CJ9 A;  2FU4 A;  2MH2 A;  3LSK A;  3PFY A;  5DS9 A;  1UHS A;  4LK1 F;  3QPL A;  1ETO A;  1NG7 A;  2EA4 A;  3G1O A;  5FLV A;  1D1C A;  2YR2 A;  1U78 A;  3RJP A;  5F04 A;  4B4C A;  2QBY B;  2H6C A;  1P9Q C;  2DFI A;  3RZD J;  2OD5 A;  4RA2 A;  1IRX A;  4P5O A;  1WPK A;  1AA7 A;  3LNQ A;  1TQP A;  2DMN A;  1Y1W J;  2DFH A;  1R4N B;  2KL4 A;  1BN5 A;  1SVL A;  4NC7 A;  2L7F P;  3IWZ A;  2NVT J;  2UWM A;  2NS7 A;  3A02 A;  1DGW Y;  4A5M A;  1KON A;  2E1C A;  5CQG A;  2EPF A;  1SFX A;  1J5Y A;  2ELJ A;  1VF9 A;  1FOY A;  1WHU A;  2F4I A;  1UST A;  1XC5 A;  4G7O F;  2Y31 A;  3QYF A;  4E7S A;  5E8G A;  3BZC A;  3WU1 B;  4A3K J;  4L9N A;  4BL0 B;  4U88 A;  2CFO A;  2NRA C;  4HQM A;  4A0Y A;  3Q0W A;  4HLX A;  3BTI A;  4PGG A;  1B6A A;  5DUK A;  2HOE A;  1ENH A;  3BR3 A;  1WJD A;  3GUD A;  1OPC A;  2ELH A;  2HQR A;  2R7R A;  4I0A A;  5FKK A;  2ME0 A;  1RKT A;  2M7A A;  2FBI A;  3RPU D;  2NNY A;  2STW A;  4CCL A;  1MMN A;  2VQC A;  5D6E A;  4BQA A;  4C2U A;  5FLX K;  5IT9 K;  1QO0 D;  3H0G J;  5DYM A;  1BR4 A;  1VFC A;  2Z2S B;  1RRJ A;  1WJE A;  5DCM B;  2LVS A;  2L9R A;  3IRQ A;  1HBX G;  2ZSH B;  2K5C A;  2KP6 A;  5HOO A;  4DYC A;  4MQ9 F;  1TQM A;  1FC3 A;  4ZZD A;  3ZP5 A;  4ZYE A;  1TNT A;  2ZXW H;  1KZH A;  1J0R A;  3SEQ A;  3HSR A;  2R7V A;  3COA C;  2WB1 N;  2HOT A;  4KIB A;  2IT0 A;  3BWG A;  3BCA A;  2MH9 A;  2OAZ A;  3I4M J;  2EV0 A;  2BEO A;  2OBP A;  1ORK A;  2XF6 A;  4EJV A;  3CLO A;  3T1B A;  1G59 A;  3CDI A;  2P5K A;  5LGT A;  2NAZ A;  2YSR A;  5IYB J;  3V7S A;  4UY8 I;  5FLX Z;  5IT9 Z;  1BI3 A;  1R23 A;  2LDU A;  3FK6 A;  2QQ8 A;  1VQ8 I;  2BOL A;  1HCR A;  2COM A;  2F5E A;  4KYW A;  3CUQ C;  3LQQ A;  4M3G A;  3ABT A;  3WHC A;  3L09 A;  1T0F C;  2XAG A;  3NWT A;  1WH5 A;  3HRU A;  4XSZ F;  5ICE A;  4XKC A;  2WAE A;  1MNM C;  4RB2 C;  1N77 A;  1B1B A;  1GV2 A;  4YEL A;  3L2C A;  2K40 A;  1ZQ3 P;  1R36 A;  2F5V A;  3KET A;  1SD5 A;  2O61 A;  5DUI A;  1HXD A;  2VBX A;  1QZZ A;  1ZTR A;  1FNN A;  4G7H F;  2QEN A;  3CMM A;  5B3S H;  4NB5 A;  4MTD A;  4IEJ A;  1MH3 A;  4NQW A;  1H89 C;  3F0C A;  2OTJ I;  2HZT A;  1OCC H;  1Y8Q B;  1R1U A;  3F6V A;  1LFB A;  3FXO A;  1Z7L A;  1BW6 A;  2XAF A;  2NXN B;  4I98 B;  1V3F A;  4IHS A;  1IXC A;  3U1K A;  2XAJ A;  3ZQI A;  2HZD A;  2XKO A;  1YJ9 I;  4L5E A;  1M1E B;  2H6B A;  1JGS A;  4RS8 A;  1FTZ A;  4I09 A;  2A61 A;  1CF7 B;  5BOX A;  1FBS A;  1E2X A;  4II2 A;  5E3L A;  2W57 A;  4CCO A;  1POG A;  2VKE A;  1QNT A;  4S05 A;  5C4J J;  2ADU A;  2R5Y A;  2R7Z J;  3LSP A;  3KFW X;  4ENK A;  3S2D J;  2LRD A;  3TQN A;  4DGW B;  4A2U A;  4JX4 A;  3BLY A;  4E7I A;  2RC4 A;  3C2G A;  1VQP I;  5DD8 A;  4PJM A;  3GTO J;  1W7P B;  1ETV A;  2XAU A;  3J7A O;  3UR3 C;  1XX5 A;  3GVA A;  4P9F A;  1ZLK A;  4OIP F;  2XB0 X;  4RMN A;  2CFX A;  2EZK A;  1WWX A;  2EB7 A;  2JA7 J;  2R3S A;  3K2Z A;  2DYR H;  2FEZ A;  1R5G A;  2L9N A;  3CC4 I;  3Q0U A;  3CC7 I;  2PEX A;  2Q0O A;  4NHJ A;  2VQG A;  1DP3 A;  1LB2 A;  1YIO A;  3QOD A;  2VBY A;  5TGT A;  1P7J A;  2VIX A;  4WWC A;  1PP7 U;  1OIS A;  2K86 A;  3AL0 B;  4AID A;  2HDC A;  4U87 A;  2DCE A;  5E20 A;  3OS2 A;  1D0Y A;  3OYN A;  3P7N A;  5E8I A;  3LSJ A;  4S04 A;  2LYC A;  4RDU A;  2XC7 A;  2YX7 A;  4AIJ A;  1Z6R A;  2OCE A;  5HS8 A;  5D8L B;  3SYT A;  3FKJ A;  2LK2 A;  4IVN A;  3KP6 A;  5LHI A;  4AIK A;  1ZKG A;  1I27 A;  3BG5 A;  1LE8 B;  1IXR C;  4FIS A;  2OZ6 A;  4F52 A;  1RNL A;  3GCM A;  2JN6 A;  1K61 A;  1G3T A;  2OV7 A;  4BY7 J;  1RET A;  2ICW G;  5LBQ A;  2IGO A;  1MSE C;  1BR1 A;  3ABU A;  5D5X B;  3C2H A;  3CME I;  1X58 A;  3PFI A;  4HF1 A;  3FMS A;  3K4L A;  2ISZ A;  2HQ5 A;  3TMO A;  1UG0 A;  2V9P A;  1XDS A;  4BKX A;  4IRG A;  4PJL A;  4CSW A;  4DYR A;  3EUK L;  3MMY B;  4EJU A;  3REO A;  3LL7 A;  1EF4 A;  1FYK A;  3CO7 C;  4IHV A;  2X1D A;  4XLN F;  2EIL H;  1XCV A;  1R1V A;  2VJ5 A;  1TW2 A;  2W25 A;  2KZG A;  2DK5 A;  2K3P A;  3CDL A;  1MJA A;  1X1P A;  3CCJ I;  2VB6 A;  2M2E A;  4IHX A;  1SMT A;  3SEZ A;  4AD9 A;  4A3L J;  2DBB A;  4YRV A;  2TCT A;  2VQL A;  5L3G A;  2O3F A;  5J1U A;  4ZH4 F;  2L02 A;  4KA4 A;  1K7A A;  1SD6 A;  1O4X A;  2K27 A;  3MZY A;  1WSU A;  1S3J A;  3CCL I;  2WAD A;  2WY8 Q;  2ZME A;  4M3E A;  4YIR X;  3FBI B;  3OYH A;  4OIQ F;  3NAR A;  3LMM A;  3T8T A;  3BPV A;  2Z5U A;  4NUB A;  5FLM J;  1UAA A;  2ID6 A;  4RGS A;  2J5O A;  2M5W A;  1HDP A;  5J40 A;  1IG7 A;  1G4D A;  1O3Q A;  4ENJ A;  1UFM A;  5K5O A;  1TWF J;  2V6E A;  4IOC F;  1A6Q A;  3WG9 A;  2JQ7 A;  3BG3 A;  5K7Z A;  3E5Q A;  3MZH A;  4AYB A;  4IQ4 A;  2J5P A;  4GDF A;  2FJ1 A;  4XLA A;  4PJN A;  1X1B A;  4BE2 A;  2DN0 A;  3L2W A;  1XDU A;  3HM5 A;  1MMG A;  4XRF A;  2ZFW A;  5K1Y A;  5E3N A;  4WK8 F;  3DFG A;  4BXU A;  1JI8 A;  2R7Q A;  1N75 A;  3PNV A;  3PL8 A;  1PDN C;  3JRA A;  4I7H A;  1T56 A;  4LGW A;  3NEU A;  5B66 C;  3GTJ J;  4KJZ A;  3I59 A;  3A01 A;  4IZZ A;  5H2F C;  2VQH A;  5D8K B;  2MW8 A;  3CTA A;  4XN3 A;  3BG6 A;  3QYE A;  5EEA A;  1Z91 A;  1P2F A;  3SHF A;  5TIS C;  4CDG A;  5E79 C;  1BJA A;  4F91 B;  1ETW A;  3GZ5 A;  1VQK I;  2LBF A;  1OYY A;  3K4J A;  4PSX A;  3TOB A;  3F23 A;  1FTT A;  4P96 A;  3OYB A;  1J7K A;  4XLE A;  2D45 A;  4B1R A;  3OSG A;  2VOD A;  1D0X A;  3OWT A;  2GLO A;  3CF5 F;  2JA6 J;  4KUM A;  5K7H A;  2R7W A;  4A3B J;  1O57 A;  1IN6 A;  3ZMU A;  2YU9 J;  2I8D A;  2B9S A;  5EG0 A;  3UKG A;  3SFZ A;  3DKX A;  4D0P A;  4BU2 A;  3ZQF A;  3K2A A;  5KHD A;  1P92 A;  1ZG1 A;  3FXK A;  3QU3 A;  1TZL A;  1FT9 A;  2E34 A;  4HV6 A;  4IPA A;  4XRS G;  3W2V A;  3BJ6 A;  4KN4 X;  3ZMT A;  2W1O A;  2Y30 A;  3PO2 J;  5CVV A;  2E7X A;  2DT5 A;  3DBL B;  3N4M A;  3DU5 A;  4QSH A;  5IT3 A;  4CZZ A;  5DCF A;  5ERI A;  4D7N A;  2ZXJ A;  1QVT A;  4XOT A;  1AKH B;  4G6T B;  4LG0 B;  5EZH A;  3JRD A;  5LRS A;  2PJR B;  3OOU A;  3DEU A;  2TRT A;  2CH0 A;  2D1H A;  3CMA I;  3L1P A;  4PFP A;  2LKS A;  1ITY A;  5DTD A;  1FMV A;  2Q1Z B;  3F21 A;  5HLI A;  3O8G A;  1OKR A;  3ABL H;  4M3D A;  2L0K A;  3E3V A;  3G2B A;  3S1M J;  3ML6 A;  1IV6 A;  3SXY A;  3CUQ B;  1O3S A;  1K83 J;  2QM3 A;  4ASN A;  3LSI A;  2OA4 A;  1A35 A;  1XPX A;  3BTL A;  3Q0V A;  3U21 A;  4BHB A;  1ZLJ A;  2W7N A;  4ZTF A;  2VOO A;  4A5N A;  4Z6Y A;  1YW7 A;  3PNY A;  3OS0 A;  3GW2 A;  3E7L A;  3KIO A;  3GTG J;  2GXB A;  2LY1 A;  1NH3 A;  2XUB A;  2XRN A;  1F1Z A;  3Q5F A;  3KEY A;  1T8I A;  4IHT A;  2RVC A;  3HOX J;  1IN5 A;  2CQ7 A;  1WCM J;  1U8R A;  2DMU A;  4D1Q A;  2L2O A;  1JGG A;  3K4B A;  2DDB A;  2BY2 A;  3RPQ A;  4B48 A;  5FO5 A;  3SZT A;  2GWR A;  3KEQ A;  3ASN H;  1XMX A;  4RGX A;  1D1A A;  4DIQ A;  3HOS A;  1YW8 A;  2CJJ A;  4Y4R A;  2G7U A;  4O5V A;  3S1Q J;  1P4W A;  3OYL A;  4E70 A;  2X48 A;  5FFZ A;  3DEE A;  1BC7 C;  4UUS A;  3HUG A;  5EGO B;  3OYG A;  2PN6 A;  3IKT A;  4DOZ A;  3U1D A;  3BPX A;  2PG4 A;  4C2T A;  4BNC A;  1YJW I;  1WVR A;  2DOF A;  2DTZ A;  2JA2 A;  5CVJ A;  3HOT A;  2FML A;  4B8X A;  3OL4 A;  4WXC A;  3C2B A;  1X4O A;  1W5S A;  2A5Y B;  3IH2 A;  5EJC A;  4DBR A;  1RC9 A;  2CQQ A;  3OYF A;  1QPM A;  3K0L A;  2XIG A;  4UB6 C;  1MBJ A;  1J9I A;  2HQN A;  2JA8 J;  1ZN2 A;  5KVR A;  3E0J B;  1F36 A;  2VKV A;  3HB9 A;  1GUU A;  1K6Y A;  3GEZ A;  1OCR H;  4HZF A;  5IOY A;  1HW1 A;  2R92 J;  4C3I J;  3FDY A;  3Q9V A;  4M6Y A;  1SFO J;  3GTK J;  1SVM A;  3FM5 A;  4PJJ A;  4OWR B;  1AU7 A;  2NS8 A;  5F27 A;  2HEO A;  1P4A A;  1ZAR A;  1VQ6 I;  2HS5 A;  2HYJ A;  1K79 A;  5HLH A;  1XG1 A;  3VDX A;  3ZXS A;  2V4J C;  2BE5 F;  2X1E A;  3DBH B;  4BJ5 C;  3B73 A;  5J47 A;  1XSV A;  1G3S A;  1R6R A;  2RNJ A;  1XGM A;  4H4K C;  1DGR M;  1VQO I;  2V1N A;  1EH8 A;  4QPQ A;  1Q1V A;  2P5V A;  2WB1 A;  5E18 F;  4U0Y A;  2QQB A;  1CGP A;  2AQE A;  1JHF A;  1D5Y A;  3FMQ A;  2E5Z A;  1SAX A;  1OCT C;  4KIC A;  4KMU X;  4ZYH A;  3KP3 A;  3OYM A;  1G2H A;  4XBF A;  1FLI A;  2F4O B;  1OR7 A;  5FKN A;  1YFH A;  4BEH A;  4B44 A;  3OIQ A;  3BTJ A;  1OFC X;  1RI7 A;  1RPW A;  4Y17 A;  4U0V A;  2ID3 A;  2FMY A;  2IAI A;  1RUO A;  1V5E A;  2E2J J;  3GLL A;  2V79 A;  2MD0 A;  1ULY A;  4A6E A;  3MFK A;  3Q3S A;  3V8L A;  2CV1 A;  1IN4 A;  3N05 A;  1WQ2 A;  2QSF X;  5HDN A;  1NG6 A;  1T33 A;  2RDP A;  2DI3 A;  3DKY A;  4RGU A;  5EEH A;  3HRT A;  2K9S A;  1I5Z A;  1YJN I;  2H8R A;  3OR1 C;  2B0L A;  4FQG A;  6PAX A;  3U9G A;  3S14 J;  1SVO A;  2KIQ A;  2XGX A;  3VYR B;  2VUM J;  2MYS A;  2DT6 A;  5ED4 A;  1MND A;  1VQ5 I;  1R22 A;  2R0Q C;  3S3O A;  1XN7 A;  2DOA A;  3L00 A;  3K1P A;  3BR5 A;  4I76 A;  4XR6 A;  2IGM A;  2YPR A;  3CJN A;  2GM4 A;  4UB8 C;  3HC7 A;  2BHY A;  2ZJ2 A;  1I6X A;  1FIA A;  5HNF A;  1IRF A;  1IC8 A;  5FGM A;  5B1B H;  2LR8 A;  3V4G A;  4A93 J;  2EK5 A;  3NAU A;  4PCQ A;  2P81 A;  1FWZ A;  5IPA A;  2R5Z A;  3LSR A;  4XOP A;  2FUG 2;  1FY7 A;  2MFZ A;  1X1D A;  1S7O A;  1SD4 A;  3FIS A;  2P5L C;  2MSY A;  1VQN I;  2PQ8 A;  1R00 A;  4AU7 A;  1YG2 A;  1XMA A;  3JTG A;  1BOB A;  3ZPL A;  2E1M C;  3ERE D;  5JLW A;  4X6A J;  3L2R A;  1YTY A;  1LDK B;  1XGO A;  5LHG A;  5ILS A;  3I71 A;  2ZXI A;  1Z6T A;  2E2H J;  2DJN A;  2GOX B;  3P9I A;  1D5V A;  5F64 A;  2XAQ A;  4X0G A;  4Q47 A;  2QA4 I;  1YYV A;  3VWB A;  2AHQ A;  2LD5 A;  2AS5 F;  2E2I J;  3KP2 A;  2QUF A;  1SAN A;  2JA5 J;  1J2X A;  3FHZ A;  4MFE A;  1IW7 F;  1Z21 A;  3JRG A;  5HOD A;  3ISP A;  2ZJQ F;  3RIR A;  2XPW A;  1KQ0 A;  2PMU A;  4HX7 A;  4M9Z A;  1IN7 A;  4FHT A;  2DXI A;  2KIM A;  1K6O A;  5BQT A;  2K4J A;  3IV5 A;  1X3U A;  3MQ0 A;  3TW7 A;  2OC6 A;  3G4S I;  3BR6 A;  3SQN A;  2EFQ A;  4ZYA A;  3W3C A;  2EFW A;  3CCM I;  3L7W A;  3GZ6 A;  3HRM A;  5GP9 A;  4EM2 A;  2E1N A;  1MJ9 A;  4OU0 A;  1YO5 C;  1F9N A;  2BBY A;  3CCU I;  1XGN A;  2KZV A;  4OAY A;  2FF4 A;  2ZBK A;  3LA3 A;  3QP6 A;  5GPC A;  2HYF A;  1FOX A;  3CES A;  3ZR8 X;  2MLG A;  2DPU A;  3E6B A;  1MW7 A;  2JRM A;  2BV6 A;  3AFH A;  5JI6 A;  2BW3 A;  1TTY A;  1U5T A;  4NC6 A;  2JSC A;  1TWH J;  2KRF A;  1BIA A;  2M4K A;  1WJ5 A;  3DLA A;  1FYM A;  1V55 H;  3FXJ A;  2HXO A;  2BXY A;  5HLT A;  3ECO A;  4D9J A;  2BVM A;  3ZRG A;  2QKM B;  1O7L A;  1ZGA A;  5HS9 A;  4JBA A;  1A5J A;  2WC2 A;  4E7Z A;  3S15 J;  4XIC A;  4XOR A;  2JVG A;  3H9J A;  2LY2 A;  2Y9Y A;  1UCR A;  3D5S C;  3CCQ I;  2R5Y B;  2IXS A;  4G9Y A;  1TWA J;  1OQY A;  3K6G A;  5F1J A;  4L9V A;  3H36 A;  5DEQ A;  2ZB9 A;  2HVQ A;  1RUN A;  1LDJ A;  2DO7 A;  2WAQ A;  1U6G A;  2Y0S A;  4ZZL A;  2XAH A;  3BR0 A;  2Z99 A;  2IW5 A;  2JJ7 A;  5D5V B;  3HSF A;  1XSX A;  3I64 A;  2CUZ A;  2RN7 A;  3K10 A;  4E7K A;  1FOW A;  1ON2 A;  2LF7 A;  1O3T A;  2KLO A;  2GXG A;  2V26 A;  4UXN A;  5LGN A;  4M74 A;  4Q5S F;  4AVZ A;  3GFJ A;  4LLG F;  3OV8 A;  4J01 A;  2IGN A;  4JX5 A;  1JKO C;  3H0D A;  5BPD A;  5J6X A;  4M6X A;  2KIF A;  4P55 A;  2E19 A;  5J3L A;  4XLF A;  2KIS A;  1FP2 A;  2R7U A;  1VQ7 I;  4DJA A;  1KYW A;  2AO9 A;  5AON A;  3F8F A;  3EUH A;  3JCU C;  1U3E M;  1ZRF A;  2VXZ A;  4QPO A;  1YI2 I;  4GXO A;  1H88 C;  4RB0 A;  3E97 A;  2IA0 A;  1G6N A;  1XTA A;  3OSF A;  2A05 A;  3F22 A;  2VJI A;  3VFZ A;  4I2O A;  1EA3 A;  2WA0 A;  3I9V 2;  2MLK A;  1S7A A;  3C1D A;  2R93 J;  5IP9 J;  2FOK A;  1TP4 A;  4KT6 A;  3RQI A;  4HDU A;  1JT0 A;  4XRM A;  2X9D A;  3JW4 A;  1W4M A;  1UG2 A;  1Y0U A;  3DWL E;  4IOA F;  2JMW A;  2GZW A;  1T98 A;  1YS6 A;  2PMZ N;  2VC1 A;  3PUF A;  2MG4 A;  2EZI A;  4LK0 F;  2RV8 A;  3AG3 H;  3CUO A;  2PJP A;  1ZEL A;  1K78 A;  2QBY A;  1X4P A;  1BM9 A;  4RAY A;  4K2E A;  4LJZ F;  5F0F A;  3IC7 A;  1MGT A;  2VL8 A;  4PGH A;  1OR7 C;  3I58 A;  4QIW N;  1BI2 A;  4ESF A;  3P9K A;  3FX3 A;  3JSP A;  1XCB A;  4ZYD A;  3HDD A;  3JAM K;  3WOD F;  3FKI J;  4LMY A;  2CQN A;  2O8X A;  2XPU A;  3OOP A;  2WV0 A;  2VBZ A;  3L2Q A;  1P4X A;  4EM1 A;  2IJL A;  5EF6 A;  2YU3 A;  1EV7 A;  1P7I A;  2STT A;  3S3N A;  4HG2 A;  1FZP B;  5F0C A;  4G6Q A;  2P4W A;  1L3L A;  2BHZ A;  3BQZ A;  1I6H J;  1Y39 A;  3WU0 A;  4KIS A;  3KYD B;  3M9A A;  3K1M A;  2EIJ H;  5E17 F;  4HA8 A;  1EH7 A;  4F93 B;  4G7Z F;  3FXR A;  4V2F A;  4FAS D;  3FZV A;  3H3Z A;  2Z3Y A;  3AG4 H;  1N25 A;  4A0X A;  2CV0 A;  3WTU C;  4U7D A;  4MLO A;  1J75 A;  1GLN A;  2HWV A;  2VXD A;  3I4N J;  3WTW C;  5CLS A;  4EGY A;  4ZTJ A;  3JAM Z;  4KIT B;  4DQ2 A;  4LIT A;  5E1W A;  2Z9O A;  2COB A;  2BY1 A;  2O8K A;  2DOE A;  3OMY A;  2VJ4 A;  3DPL C;  3OYD A;  1IGN A;  4I02 A;  5L3B A;  2CW8 A;  4WX9 A;  2IS1 A;  9ANT A;  3KLN A;  4EMS A;  1PYV A;  4OAZ A;  5C3E J;  1LFP A;  1MH4 A;  2ZSI B;  1FP1 D;  2XGE A;  3LFU A;  3ZQG A;  5A2Q K;  3EYY A;  1FOK A;  4BBR J;  1MBF A;  2RKH A;  1HQC A;  4EJO A;  4A3J J;  1FPQ A;  3GFL A;  4B3A A;  2HOS A;  1KU9 A;  3H5A A;  4MHG A;  2ESN A;  1OMI A;  2IPQ X;  2XKP A;  1WH7 A;  3MKZ A;  3ZGK A;  4E7L A;  5GAH J;  1ZR2 A;  1IJW C;  4EVI A;  2X6W A;  1ZG5 A;  3JRI A;  1MD0 A;  4QTR A;  1H9T A;  4OOI A;  2Q2E A;  2HPM A;  2VE8 A;  2LFB A;  3CF2 A;  2GA1 A;  4JK1 X;  4HST A;  3AG1 H;  3BTC A;  3HG9 A;  3M8E A;  1UB9 A;  3HTU A;  4B43 A;  2JUG A;  4C9Y A;  3I59 B;  3CJQ B;  3A01 B;  4HX4 A;  4LB5 A;  1ETY A;  2M0M A;  3A1Y A;  2LY9 A;  5A2Q Z;  2JZY A;  3HZJ A;  5FJ8 J;  2LRE A;  4JX6 A;  4UV8 A;  2LKX A;  4LIV A;  3AG2 H;  3W2W A;  4CIC A;  5LHH A;  1IRG A;  3GZN B;  4HSR A;  2LBF B;  2KQR A;  3DV8 A; 
#chains in the Genus database with same CATH homology
 4RBO A;  2EBI A;  3TW6 A;  4G12 A;  4A3D J;  4M3D A;  2L0K A;  5EGO A;  3S1M J;  4M3F A;  1IV6 A;  1IDY A;  5EYR A;  3VPR A;  1JUS A;  5F0H A;  1NK2 P;  2ECB A;  3W6V A;  1K83 J;  2EH3 A;  3HOY J;  2XGC A;  5EG0 B;  3BTL A;  3Q0V A;  5FKM A;  4CYC A;  4FCY A;  2DA5 A;  2M34 A;  4DW6 A;  5IOZ A;  1JTX A;  3TP3 A;  2NOG A;  5C44 J;  3E7L A;  3HOW J;  3GTG J;  4BY1 J;  3TP0 A;  2NVX J;  3DEW A;  4C3H J;  3GTL J;  3GTP J;  3RZO J;  3HOX J;  1XS9 A;  1WCM J;  4C3J J;  2DMU A;  1JGG A;  3BR1 A;  1U9O A;  1CQT A;  3O8H A;  1APL C;  3LOC A;  5J1R A;  1ZR4 A;  2LLK A;  4Y7N J;  2CJJ A;  3G1L A;  3S1Q J;  2IEK A;  1IUF A;  2X48 A;  4XID A;  1JKQ C;  3D1N I;  4EEF G;  4Y52 J;  4D5C A;  4UUS A;  5EGO B;  1HF0 A;  3TED A;  4AUX A;  5E3M A;  1WI3 A;  3JRF A;  2H1K A;  2DTZ A;  1OCP A;  4I6Z A;  3HOU J;  2CRG A;  4A3M J;  3S1N J;  1DU0 A;  1LFU P;  3JRH A;  3C2B A;  3B6A A;  3IH2 A;  1IDZ A;  3CQZ J;  2CQQ A;  3MVP A;  2VPR A;  1GVD A;  1JKR C;  1MBJ A;  2OF7 A;  5DS9 A;  4D7M A;  1UHS A;  2XSD C;  1WGX A;  3QPL A;  1ETO A;  2JA8 J;  1F36 A;  2VKV A;  3A03 A;  3G1O A;  1ETQ A;  3HB9 A;  1GUU A;  5FLV A;  1NTC A;  1U78 A;  5F04 A;  4B4C A;  5IOY A;  1U9N A;  1MBE A;  2R92 J;  2DMQ A;  3RZD J;  4C3I J;  1H8A C;  1WPK A;  1SFO J;  3LNQ A;  3GTK J;  2DMN A;  2M0C A;  1Y1W J;  3LSG A;  4A3C J;  2XPV A;  1AU7 A;  5E3O A;  2NS8 A;  2FQ4 A;  2L7F P;  5F27 A;  3S17 J;  2NVT J;  4D5F A;  2HYJ A;  1ZGW A;  2XB5 A;  2NS7 A;  3A02 A;  3ZQC A;  1XG1 A;  1I3Q J;  4IHY A;  2E1O A;  1VF9 A;  5M3M J;  1XC5 A;  3HBL A;  1ETK A;  4UUS B;  2Y31 A;  1Q1V A;  4A3K J;  1JJ8 C;  3HOV J;  3BR2 A;  3Q0W A;  3PO3 J;  1IRZ A;  3BTI A;  1Y1V J;  2QCO A;  3JR9 A;  1D5Y A;  1ENH A;  1QRY A;  3B6C A;  3BR3 A;  1OCT C;  1G2H A;  4W1U A;  3FK7 A;  3IH4 A;  5FKK A;  2ME0 A;  1RKT A;  5FKN A;  2L7M P;  4C2M J;  3BTJ A;  1QVU A;  1OFC X;  1RPW A;  2ID3 A;  2MGQ A;  1UMQ A;  2IAI A;  3H0G J;  3FIW A;  4IHW A;  1VFC A;  2E2J J;  2OPT A;  4S0H B;  2XGD A;  2LVS A;  2L9R A;  2X6O A;  3Q3S A;  1MSF C;  4DYC A;  4FTH A;  1T33 A;  2K9S A;  2H8R A;  2ME6 A;  1GDT A;  2VI6 A;  3S14 J;  1BA5 A;  1E3O C;  2WB1 N;  2K9N A;  2VUM J;  1JKP C;  1BW5 A;  1B72 A;  2R0Q C;  4JYK A;  2HOT A;  3WHB A;  2FX0 A;  3BR5 A;  3PM1 A;  3I4M J;  1X2M A;  1ORK A;  4I76 A;  5EDN A;  5M5W J;  2GM4 A;  3GTQ J;  5IYB J;  1FIA A;  4A69 C;  1IC8 A;  2O7O A;  1PUF A;  2LR8 A;  3FK6 A;  4A93 J;  3NAU A;  2P81 A;  1HCR A;  4M3G A;  5IPA A;  3WHC A;  3LSR A;  2R5Z A;  1B8I A;  3HOZ J;  2O9L A;  1WH5 A;  3FIS A;  2WAQ N;  2CQX A;  2MSY A;  2Y0S N;  4A3I J;  2DMT A;  1MNM C;  2Y2Z A;  2M9H A;  2HXI A;  1GV2 A;  2NVQ J;  1DU6 A;  1ZQ3 P;  2K40 A;  4M6V A;  5JLW A;  4X6A J;  1BL0 A;  1ZTR A;  3MKL A;  3CMY A;  1MBG A;  2DMP A;  1YRN A;  1MBH A;  2E2H J;  3JRB A;  2DJN A;  1RKW A;  4IEJ A;  1W0U A;  1R9T J;  1MH3 A;  4UUT A;  1H89 C;  3F0C A;  5F08 A;  4ABZ A;  2W48 A;  1JTY A;  4CYC B;  1LFB A;  2AHQ A;  2LD5 A;  1BW6 A;  1B72 B;  4BXX J;  1Z77 A;  2E2I J;  4BBS J;  2XRL A;  2M8G X;  1SAN A;  3ZQI A;  2JA5 J;  4MFE A;  1VND A;  4L5E A;  4J19 A;  3JRG A;  5HOD A;  1FTZ A;  2XPW A;  2CU7 A;  4XRS A;  5E3L A;  1POG A;  2VKE A;  5C4J J;  2R5Y A;  2R7Z J;  3BQY A;  3IV5 A;  1PUF B;  3LSP A;  3TW7 A;  2YUS A;  2DA1 A;  3S2D J;  3BR6 A;  1FJL A;  2GBY A;  1JT6 A;  4A3F J;  3ZQL A;  3M4O J;  2R5Z B;  1B8I B;  4JX4 A;  4DYQ A;  1LE8 A;  5GP9 A;  3GTO J;  1TC3 C;  1ETV A;  1OJL A;  5BNG A;  1FIP A;  4GFB A;  1AKH A;  2XB0 X;  1I50 J;  2EZK A;  5GPC A;  2WV1 A;  2JA7 J;  3QPS A;  1YRN B;  1ZK8 A;  5JLX A;  3HEF A;  1TWH J;  3Q0U A;  1GT0 C;  2EZL A;  5M5Y J;  2Y9Z A;  2JK3 A;  2DA4 A;  3ZQH A;  2HXO A;  1P7J A;  1HLV A;  1MBK A;  1A5J A;  2NVY J;  5J1Y A;  3S15 J;  3LSJ A;  1RR7 A;  2DA2 A;  4XIC A;  4RDU A;  2Y9Y A;  2R5Y B;  1QPI A;  4MIM A;  2DA6 A;  1TWA J;  2N8G A;  5F1J A;  2LK2 A;  2ZB9 A;  3M3Y J;  2CUF A;  1ZKG A;  2K9Q A;  3GBG A;  1F43 A;  3BG5 A;  4NDL A;  1LE8 B;  3BR0 A;  5FKO A;  2JJ7 A;  4FIS A;  2JN6 A;  1K61 A;  4BY7 J;  1RET A;  1MSE C;  2KDZ A;  1X58 A;  1U8B A;  4W97 A;  1GV5 A;  4AC0 A;  4JX5 A;  2HQ5 A;  3SFI A;  1JKO C;  4BKX A;  3S2H J;  4DYR A;  2E19 A;  5J3L A;  2CUE A;  2YS9 A;  5IYD J;  3S1R J;  1EF4 A;  2AO9 A;  3QQA A;  4IHV A;  2QF7 A;  3CDL A;  1H88 C;  1AHD P;  4IHX A;  2M2E A;  4A3L J;  3OSF A;  2TCT A;  1NK3 P;  4JP0 A;  5M5X J;  1HDD C;  3BG9 A;  3H3V K;  5J1U A;  3DCF A;  2R93 J;  5IP9 J;  1JT0 A;  3RQI A;  1FEX A;  4XRM A;  2X9D A;  3CCY A;  3MN2 A;  1O4X A;  1UG2 A;  1TWG J;  2JMW A;  5IP7 J;  2PMZ N;  2MG4 A;  4M3E A;  2EZI A;  3ZOB A;  1S7E A;  1ETX A;  5M3F J;  3G1M A;  1X2N A;  3NAR A;  5FLM J;  1HOM A;  5F0F A;  1VI0 A;  2ID6 A;  1HDP A;  4QIW N;  2HDD A;  1IG7 A;  4MFD A;  3HDD A;  3S16 J;  1TWF J;  3HKZ N;  3SJM A;  4A3E J;  3FKI J;  3BG3 A;  2XPU A;  5K7Z A;  4FE7 A;  2ELK A;  4A3G J;  4HNV A;  5EF6 A;  1P7I A;  2FJ1 A;  5FKL A;  2HOA A;  5F0C A;  2LTP A;  3BQZ A;  4V2G A;  2DN0 A;  1I6H J;  5C4X J;  1A6I A;  3HM5 A;  2HI3 A;  5K7F A;  3SDG A;  5E3N A;  1TWC J;  3RKQ A;  4V2F A;  3IH3 A;  2JWT A;  5GPA A;  3JRA A;  1JJ6 C;  4MLO A;  1T56 A;  4DZP A;  4FE4 A;  3GTJ J;  3I4N J;  3A01 A;  2DA7 A;  2DA3 A;  2RAE A;  4MO7 A;  2MW8 A;  2COB A;  2O8K A;  5EEA A;  3GTM J;  1IGN A;  9ANT A;  1ETW A;  5C3E J;  3JRE A;  1W0T A;  1JUM A;  4AYB N;  1FTT A;  1MH4 A;  2I10 A;  2IBD A;  2XGE A;  4B1R A;  3OSG A;  3K7A J;  3ZQG A;  2GLO A;  4BBR J;  1MBF A;  5IYC J;  2JA6 J;  4A3B J;  5K7H A;  4A3J J;  4B3A A;  2HOS A;  2KT0 A;  2D5V A;  2YU9 J;  1Z0X A;  5EG0 A;  1JUP A;  1RES A;  2ECC A;  3UKG A;  3ZQF A;  3K2A A;  1WH7 A;  2EQR A;  4XK4 A;  2B63 J;  3JRC A;  1IJW C;  1ZR2 A;  2EZH A;  4XRS G;  3HGY A;  2Y30 A;  4X1E A;  3JRI A;  2G0E A;  4QTR A;  3PO2 J;  2LFB A;  4QSH A;  4DZJ A;  5EZG A;  3BTC A;  1BJZ A;  4D7N A;  3BT9 A;  4LOC A;  1QVT A;  4M3B A;  1AKH B;  3A01 B;  5EZH A;  3JRD A;  1ETY A;  3OIO A;  3OOU A;  3HGG A;  2LY9 A;  2TRT A;  5FJ8 J;  3L1P A;  2FD5 A;  2LP0 A;  4JX6 A;  1ITY A;  5DTD A;  2LKX A;  5IP6 A;  2L7Z A;  3O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...