4A3LJ

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3lJ00
4BXXJ 3DCFA 2HXIA 5EDNA 2GM4A 2HQ5A 1ETYA 3S1RJ 2R5YB 2FJ1A 1ZTRA 2JA8J 2R93J 5JLWA 2MGQA 2OF7A 3FKIJ 2M2EA 2NVQJ 1B72B 1GDTA 3LSGA 5E3MA 1ORKA 1VNDA 2HOTA 1OFCX 5FKNA 1FEXA 3FK7A 5C4JJ 1SANA 3S1QJ 2FQ4A 1SFOJ 5IYCJ 2QF7A 4AYBN 4BKXA 3HOWJ 2H1KA 3W6VA 5M5YJ 4A3EJ 5J3LA 4B4CA 1ZR2A 3HKZN 3JRIA 2EZKA 1IC8A 3S1NJ 5J1RA 5EG0A 1ZGWA 1A5JA 2NVXJ 2DMNA 2XPWA 5IP9J 1MBFA 1GT0C 3TEDA 1JKRC 1IUFA 1TWHJ 2Y9YA 5IOYA 4LOCA 2ME0A 2GLOA 3S15J 2ZB9A 1DU0A 4RDUA 3ZQFA 1ZQ3P 2COBA 4GFBA 1H8AC 2VI6A 2GBYA 4FISA 3UKGA 2IEKA 5EG0B 2EZIA 5HODA 3RZOJ 2RAEA 3HOZJ 2X6OA 2R5YA 4A93J 3SFIA 3MN2A 4JX6A 4RBOA 1MNMC 4FE4A 1Z77A 1CQTA 2NVYJ 3BR1A 3JRAA 2ECCA 4FCYA 1ETKA 3JRGA 1PUFA 2M34A 2YU9J 4XRSG 4XIDA 1HCRA 5IYBJ 1OJLA 2AO9A 2E19A 1T56A 1U9OA 1HLVA 3HGYA 1AHDP 3BQYA 1B72A 1W0TA 2AHQA 3NARA 1NK2P 2K9SA 1ETWA 4A3MJ 3O8HA 1GV2A 1ZR4A 5GP9A 5EF6A 4A3GJ 1H88C 2JJ7A 2E1OA 4QSHA 5EGOB 2ECBA 1K83J 2K40A 3OSFA 1HDPA 2JA6J 2EH3A 3S2HJ 3FIWA 1JKPC 3ZQCA 4C3HJ 3CMYA 2DTZA 1JJ6C 2MSYA 3GTMJ 3JRDA 1G2HA 1AU7A 3GTOJ 4ABZA 4DW6A 2XB0X 2DN0A 3BR6A 1F43A 1OCPA 1HF0A 2K9NA 1JJ8C 4CYCB 5F08A 2DA7A 2LR8A 4XRSA 2XB5A 1DU6A 5FJ8J 2LFBA 4I76A 3CQZJ 2CRGA 2HOAA 2ID6A 1ETOA 3A03A 1TWAJ 4JYKA 3TP0A 4M6VA 5F0HA 3BTLA 1LE8B 2XGEA 5K7ZA 1ETXA 2FD5A 3QPSA 3HGGA 3FK6A 3Q0VA 3ZQGA 2KT0A 1ETVA 2W48A 3GTJJ 2KDZA 3HOYJ 3LSJA 1RETA 2JWTA 3BG5A 5FLVA 3ZQHA 3BTIA 3JRCA 5F0CA 5K7FA 1JTXA 3ZQLA 3BTCA 1YRNB 3QQAA 4A3LJ 5E3OA 3CDLA 3L1PA 1O4XA 2CQXA 3IH2A 1QVTA 5M3FJ 2G0EA 5FKMA 1UHSA 2LK2A 4IHWA 1WH7A 2R5ZA 2DA5A 1A6IA 3M3YJ 2O8KA 4XK4A 1T33A 2Y9ZA 1H89C 4C3IJ 4UUSA 3ZOBA 2LP0A 2TCTA 1P7JA 1XC5A 1TWFJ 1FJLA 4M3BA 2EZHA 3HOUJ 1EF4A 2DMUA 3I4NJ 3PO3J 1U8BA 3H3VK 1RKWA 4MO7A 2H8RA 2DMQA 1IRZA 1RESA 3WHCA 4MFDA 3MKLA 1U78A 1B8IA 3E7LA 5JLXA 3PO2J 3GTLJ 2VKVA 4A3IJ 3HM5A 4Y7NJ 5GPCA 1UG2A 4A69C 1F36A 2DA4A 1I3QJ 2MW8A 3JRFA 3G1MA 2Y30A 1Z0XA 2DA6A 1APLC 3S14J 2EBIA 3I4MJ 4IEJA 4D7MA 4MIMA 2HI3A 1X2NA 5IP7J 4FTHA 1POGA 1XS9A 2P81A 3JRHA 3SJMA 2XGDA 2I10A 5E3NA 3HOXJ 4L5EA 2L9RA 2WAQN 4XRMA 1QPIA 2R7ZJ 1JKQC 5E3LA 3OOUA 4XICA 2M8GX 1BA5A 1MSFC 1BL0A 2IAIA 4V2FA 3K7AJ 5C44J 3B6AA 4DZPA 5FKKA 2JN6A 3BR2A 3F0CA 4V2GA 4A3FJ 3Q3SA 2E2IJ 2CJJA 4S0HB 2XRLA 5F27A 5IPAA 1GUUA 4UUTA 4DYRA 3JR9A 1IV6A 3HDDA 4A3BJ 2YS9A 2HYJA 1HDDC 2YUSA 1QRYA 1X58A 5EYRA 1FTTA 4X6AJ 2M9HA 5F04A 5IOZA 4C3JJ 2X9DA 1MBHA 3IH3A 2NOGA 2XGCA 2VUMJ 2ELKA 4D7NA 1X2MA 4C2MJ 2EQRA 2DA1A 2DMTA 5M3MJ 2Y2ZA 2JA7J 1JUMA 3BR5A 2MG4A 1ETQA 3G1OA 1XG1A 1VFCA 4QIWN 1IDZA 2NS8A 2B63J 3M4OJ 2TRTA 3G1LA 2WB1N 3TW6A 2N8GA 3C2BA 4A3DJ 1LFUP 1WI3A 4MFEA 2LLKA 4IHYA 5F0FA 4Y52J 1BJZA 1IJWC 2DMPA 1MSEC 2WV1A 4HNVA 1FIPA 2Y31A 1U9NA 3MVPA 4W97A 5M5WJ 2LY9A 1JT6A 2L7MP 2JMWA 1JKOC 1Q1VA 3BT9A 3JREA 2JA5J 2R92J 4BBRJ 9ANTA 4B1RA 3BR3A 4AUXA 1GV5A 3TW7A 1TWCJ 1JTYA 1JUSA 1VI0A 3PM1A 1ZK8A 1MBEA 4AC0A 2L0KA 2ME6A 4BY1J 2VKEA 3NAUA 5K7HA 4G12A 3OIOA 4JX4A 3IV5A 1FTZA 3OSGA 3K2AA 2CU7A 4M3DA 4DZJA 1MBKA 1IGNA 1TWGJ 3GTPJ 1P7IA 3BG3A 4X1EA 1ZKGA 2ID3A 1ENHA 2LKXA 1GVDA 3LSPA 3S1MJ 1NTCA 2FX0A 2XPUA 5EGOA 2R5ZB 4MLOA 3WHBA 5EEAA 3A01A 1S7EA 1ITYA 4M3GA 4BBSJ 2L7ZA 3DEWA 2HXOA 4UUSB 1MBJA 4IHXA 4DYCA 4DYQA 2DA2A 2E2JJ 4BY7J 1YRNA 5BNGA 2LD5A 3A02A 3S17J 3HEFA 1OCTC 1MH4A 1JT0A 2IBDA 2LVSA 3ZQIA 1WPKA 4A3CJ 3Q0WA 5J1YA 2EZLA 4JP0A 1Y1WJ 1AKHA 1B8IB 3HOVJ 3QPLA 1AKHB 3GTKJ 5DTDA 3A01B 5IP6A 1E3OC 1RR7A 3S2DJ 5C4XJ 1LE8A 5FLMJ 3BQZA 2Y0SN 3IH4A 3O8GA 1TC3C 1BW6A 5IYDJ 3H0GJ 3LOCA 5M5XJ 2CUEA 1UMQA 2X48A 4I6ZA 3GBGA 2XPVA 2DJNA 2HDDA 3TP3A 2O7OA 4A3KJ 2OPTA 4EEFG 1MH3A 1I50J 2R0QC 1JGGA 4M3EA 1BW5A 3VPRA 1WH5A 2L7FP 3S16J 3BTJA 4B3AA 3RZDJ 3B6CA 1HOMA 3SDGA 1JUPA 1WCMJ 2LTPA 5FKOA 2K9QA 4JX5A 5GPAA 1LFBA 1RPWA 1WGXA 2VPRA 1K61A 1QVUA 1R9TJ 4IHVA 4J19A 4NDLA 4W1UA 5DS9A 1IG7A 4M3FA 1RKTA 2DA3A 1MBGA 1I6HJ 1D5YA 3BR0A 3D1NI 2NVTJ 3RQIA 2HOSA 3FISA 3Q0UA 3LSRA 4D5FA 3BG9A 2CUFA 3LNQA 5FKLA 1FIAA 1PUFB 1NK3P 5EZGA 1Y1VJ 2JK3A 3GTGJ 5J1UA 2NS7A 4CYCA 4D5CA 2D5VA 4QTRA 3JRBA 5F1JA 2QCOA 3HB9A 3GTQJ 5EZHA 3CCYA 5C3EJ 1VF9A 3RKQA 2PMZN 3HBLA 4FE7A 1W0UA 2O9LA 2CQQA 1IDYA 4A3JJ 2XSDC 2E2HJ 2M0CA
chains in the Genus database with same CATH superfamily
1ZG3A 1SFEA 3DCFA 2CFXA 2HXIA 1QO0D 1I3AA 2VQLA 3CF2A 4RGSA 3S93A 5EDNA 2HQ5A 2NAZA 3BJAA 5L3GA 2R5YB 2FJ1A 4L18B 4YEJA 2JA8J 2R93J 1WQ2A 4YELA 2MC4A 2M7AA 4E4HA 3HIFA 1XTAA 2CH0A 2NVQJ 1SD6A 1YW7A 2X6YA 2QUFA 2BHYA 3KE2A 3LFUA 4RB2C 2MC3A 2WA0A 3D0SA 1J75A 2W57A 3VFZA 2AQEA 5FKNA 1FEXA 4TV7A 1IF1A 5J8FA 2PG4A 3AG3H 3CESA 2Q8KA 3S3NA 1QZEA 2LOOA 1HBXG 2FQ4A 1W4MA 5IYCJ 3T0YA 2QF7A 3HOSA 3HTUA 5FRMA 2IA0A 3TO7A 3CMMA 3HKZN 1UG0A 3JRIA 3S1NJ 1ZGWA 5DM6F 3V7CA 4E7IA 1WJDA 1FSHA 1E3HA 2B7EA 2MABA 3GVAA 3TEDA 2Y9YA 2ME0A 2ZB9A 3ZQFA 1ZQ3P 4OIPF 2VQCA 4FISA 3HYIA 3IAM2 3CF5F 3GXOA 5DD8A 1VQLI 2R5YA 3SFIA 3MN2A 4O5VA 5ICGA 3V8JA 2E34A 3JRAA 4LG0B 1SMTA 1W5SA 1WSUA 3DBRB 3K1MA 1PUFA 3HHGA 1HCRA 4G7OF 3OMYA 3EYIA 4OMYA 2QQ8A 2Q1ZB 1XN7A 4P1WA 2AO9A 1HKQA 1MMDA 3ZN1A 2JZYA 3WGHA 3I9V2 4EM0B 1QZYA 4GYIA 3ERED 3NARA 3H92A 3KP5A 2D2WA 3MWMA 1NK2P 1J5YA 1T98A 2FEZA 3DXJF 1IW7F 2R7FA 3FMSA 2H94A 5DYMA 4HQMA 3GWZA 2UWMA 2BOLA 3ZRGA 3DPTA 2M4GA 3I3LA 1YTYA 3GCMA 1IUYA 1ZHFA 5DM7F 2VE9A 1WWXA 4F55A 3PIOF 3ZQCA 1MDMA 3HSEA 5LHHA 3TOBA 2JSPA 3H5AA 5KNLA 4LFUA 3IL2A 1SVOA 2BXZA 1SC7A 1VQ6I 2GXBA 1O7LA 3HJEA 1YO5C 2ZCWA 3LQRA 3OWTA 4L9VA 2RREA 4ABZA 4JBAA 2DI3A 5D5XB 3E5XA 3BCBA 3FHZA 2E1CA 4Y3OA 3ISPA 3ZMZA 2LR8A 4MHGA 4XRSA 5K5QA 4PCQA 1IXRC 5FJ8J 5HLHA 4E7KA 2OZ6A 2EIMH 2HOAA 3F23A 1ETOA 3HSRA 3A03A 4JYKA 1FSEA 2CW7A 2XHKA 1R1VA 3DKWA 3BTLA 4OMZA 3KX2A 4ESBA 4I01A 1LE8B 2ZKZA 3OR1C 4NNJA 2V1UA 2F4IA 2FBHA 3QPSA 1BC8C 1BOAA 5J40A 4ZDOA 3HGGA 3ERMA 3WTUC 3RSNA 5JVGF 2VBWA 3RCOA 1ZLJA 2W48A 4GGGA 3GTJJ 5J6XA 2EA4A 2BV6A 4AVZA 3VEPA 1IAWA 3I4PA 4FX0A 3PSIA 5B66C 5FLVA 3BTIA 3ABLH 5F0CA 3QQAA 2QWWA 3GMEA 2VONA 3GYHX 1O4XA 2HQNA 3EUHC 1QVTA 5B1BH 2XF5A 2KIQA 1IV8A 5DV5A 3WU2C 5M3FJ 4YFKF 1FZPB 1D8KA 4ZC3A 3GX4X 1D1AA 3T1BA 1FC3A 2O8KA 4XK4A 4HSTA 3ZMSA 3TMOA 4C3IJ 1K7AA 2BGCA 3H5NA 3ZOBA 2GWRA 3IKTA 4QPOA 1V55H 2EZHA 2EA2A 3HOUJ 4KJZA 3I4NJ 1ZLKA 4HLYA 3PO3J 1LJ9A 2EB7A 2MH2A 1HKSA 2DMQA 1OQYA 2ZFWA 3C18A 3SQNA 1XSVA 2X6WA 4MFDA 1B8IA 1FOKA 2BXYA 2FQ3A 2LC2A 2KJBA 1RR8C 5H6RA 1V5EA 2ESNA 2VB6A 4EV0A 2LG4A 4ASNA 4A69C 2ZJ2A 4HF0A 3TOAA 2OAZA 4EJOA 3G1MA 5J8CA 3BPXA 1APLC 2DA6A 2CV1A 4MEXF 1EH6A 1ZGAA 4Q47A 3I4MJ 1P4XA 1WHUA 4D7MA 2H6CA 2COMA 2DT5A 1E3PA 2HI3A 2NYXA 2MA3A 4MIMA 4P9UA 5IP7J 3QU6A 1POGA 3ZMTA 1Z05A 1UZCA 1XS9A 2P81A 5FFZA 3AAFA 3JRHA 2XF6A 3DTEA 1QZZA 2HVSA 3HOXJ 1KU7A 1WRJA 4HOBA 3WTVC 5GTIC 1BA5A 1MSFC 3VYSB 4IVNA 4NQWB 3MAJA 2RNJA 2BVMA 5J47A 2DPDA 1R23A 4AYBA 2EFWA 5ERIA 3VSLA 2M45A 3PUBA 4DZPA 2XSJC 1SFUA 1S5LC 2WAEA 2DPUA 4M9SA 2KIFA 1BM9A 3DF8A 3F0CA 2ISZA 1YS6A 4KN7X 3OYJA 1W5TA 4JQFA 1YIOA 4EMSA 3HDDA 3WGGA 4CGZA 3CTAA 4B44A 3EETA 3TL4X 5HLIA 4BEHB 1PVEA 4II2A 1SD5A 3CCLI 1Y8RB 5KCMA 1FT9A 3LFKA 5KAFC 1X58A 3PQKA 2PJPA 3RDIA 2HS5A 3NEUA 5J4YA 3IHUA 3CDIA 2EV6A 2VASA 1LNWA 3F8CA 4D7NA 2EQRA 2OU2A 3COAC 5M3MJ 3JTGA 2RC4A 1K6YA 2QBYB 5DEQA 3F8FA 2QQAA 3K4MA 4CCNA 2JA7J 1TQMA 2MH9A 2EK5A 2RN7A 1D0YA 3G1OA 3ZXSA 2BY1A 1IDZA 1Q1HA 3RI4A 3WU1B 2WB1N 3TW6A 2KDOA 2IW5A 2KRCA 5B3SH 4RAZA 4PJ0C 2NVUB 2F4MB 1IJWC 2DMPA 2XKOA 2WV1A 4HNVA 2Y31A 3MVPA 2KP6A 3OYLA 3S2WA 4N0BA 1EV7A 5CQGA 2IS6A 4CCMA 9ANTA 4B1RA 3F8BA 3OYFA 5AIPA 1KA8A 5KVRA 4E7JA 2ME6A 3A1YA 2R7RA 5H2FC 2VKEA 1H9TA 1WJAA 2R7XA 1FTZA 4I99C 4B47A 3K2AA 2CU7A 2M3AA 4FHTA 4LLGF 1FMWA 2VODA 3FXLA 3FXMA 2L2OA 2V7FA 4F92B 4PDKA 3S1MJ 2XPUA 4RMNA 4A5NA 2P8TA 3I0TA 1TQPA 4ENNA 1OCRH 2VC0A 5JHUA 3A01A 3T8TA 3AFHA 2A05A 2ISYA 2QA4I 1VQ4I 2Y75A 1MMGA 1BR1A 4ITVA 4FT8A 4BBSJ 1X1CA 3ZCOA 1MBJA 4UUSB 1YHQI 3I71A 4N9HA 2DA2A 2E2JJ 1YRNA 2OA4A 1ZN2A 3QODA 2LD5A 2HYGD 1AA7A 3G73A 2P7CB 4MNUA 1ZREA 2PJRB 2ZXIA 2DFHA 3MFKA 2KLOA 2PFBA 3CJNA 2H6BA 1R7JA 1AKHA 4ZYGA 1FP1D 5CPRB 1IN8A 4CZZA 4WWCA 3BY6A 4QLCU 4PSXA 3DP7A 4F7ZA 4F93B 5IP6A 2XASA 1STZA 3L2VA 4DNCA 2Y0SN 1K78A 4BH9A 3IH4A 1LQ1A 5D5VB 3L2QA 3K4CA 3OYDA 5M5XJ 4G8XA 2CUEA 5HOOA 1F5TA 5IT9Z 4I6ZA 4A0XA 1VZ0A 4I02A 3MQ0A 3RKYA 4LJZF 3TP3A 1AWCA 3E0JB 2O7OA 1K4SA 1HA8A 2O5RA 3DEEA 3JCUC 4U7DA 3KLNA 1G3TA 1USSA 4AIDA 3K70C 3DKYA 1MW7A 2CW8A 3VYTB 2O61A 2L7FP 4UVBA 3GZNB 1XX5A 2LY1A 2ZXWH 4IHSA 1J9IA 2Z5UA 2WB1A 3A4CA 5AONA 4HEA2 1FYLA 3H1CA 1DGWY 4AU7A 1WCMJ 2F4OB 2TDXA 5GTHC 1IRXA 4JX5A 2P5KA 3CUQA 3I5UA 2V4JC 1SEUA 4YFXF 2W84A 2XIGA 2ETHA 2R3SA 4HBLA 4M3FA 5ICFA 2KFDA 2XROA 5CLSA 1I6HJ 2VN2A 2HR3A 1D5YA 3HKZA 3BR0A 4HNTA 3D1NI 4BYYA 4H0EA 3KEQA 4ENKA 2NVTJ 3Q0UA 3LSRA 1P2FA 3CO7C 1MJ9A 4HPQA 2CUFA 3LNQA 4ESJA 1PUFB 3IUOA 4RM2A 1V54H 2IPQX 3Q9VA 2NS7A 4CZCA 1VQOI 4XL9A 4PFPA 1YQAA 4QTRA 3OYBA 2HEOA 4L0ZB 1X4OA 3NWSA 3TBIA 4FETA 3MZ8A 5EZHA 2CSOA 3F6VA 3CCYA 3QP6A 6PAXA 3ABUA 3GEZA 5GAEJ 1VF9A 4UV9A 3OYAA 2W25A 4E7SA 1W0UA 4OAZA 4M72A 2VBYA 2P4WA 2E2HJ 3E97A 4IOCF 2V79A 1Y0NA 3WTZA 3CZ6A 1ZRFA 1XMXA 4BXXJ 3MZHA 1UHMA 3BROA 3QAHA 4CO8A 1R5HA 4UHTA 2Z33A 2VXZA 4XN3A 3V42A 2X1EA 3N05A 3IRRA 1ETYA 4OU0A 2FE3A 3H5RA 4BXUA 2WAQA 2P6TA 2OTLI 3RJPA 5D4RA 1SVLA 4XR6A 2M2EA 2OBPA 1G59A 4EJVA 1B72B 3EUAA 3I53A 3GUDA 4IO9F 1BIAA 1VNDA 2Q0OA 1HKTA 1OFCX 3Q5FA 4Z6YA 3CCEI 4YG2F 3FK7A 2ESHA 2L01A 5C4JJ 2VLAA 2LKSA 3JAMK 4OIRF 4KIGA 1SFOJ 1TP4A 4N9IA 2MD0A 1REPC 4PJNA 3W6VA 1OYYA 3SYTA 4A3EJ 3FZVA 5J3LA 5CYVA 1ZR2A 1MD0A 3F8MA 1I5ZA 1IC8A 1X1DA 5J1RA 5EG0A 3KEYA 2DK8A 5LBQA 1A5JA 4OAYA 2NVXJ 1MGTA 1HXDA 2PMUA 2IVMA 1GT0C 1U0JA 2M87A 4I7HA 1TWHJ 2IS1A 5IOYA 2M8EA 2GLOA 3S15J 1T8IA 4GFBA 2GBYA 3UKGA 2IEKA 3FXOA 2EZIA 4EJTA 3W3CA 3RZOJ 2CFOA 1E2XA 2RAEA 1XGMA 1Z91A 5DCFA 2DJIA 1G8XA 4BUPA 2CV0A 5LEKA 2V9KA 3NWTA 4GCVA 2O8XA 2A07F 1UELB 1YG2A 1Z77A 1CQTA 4A6DA 2CO5A 4IPAA 2ADUA 2HVRA 2F6CA 3J7YJ 1ETKA 4XSZF 2M34A 1YYVA 4XRSG 2GXGA 1ZYRF 1AOYA 4L9JA 1YJWI 2WBMA 1HLVA 1ODDA 4Y17A 3BQYA 2R7WA 2M7BA 2OC6A 4HNUA 4PUSA 1FOXA 2K9SA 1TT0A 1BI0A 3QYFA 2NNNA 3C3WA 3O8HA 1WZ2A 5EF6A 5F64A 3E6DA 2JJ7A 5EGOB 2AXTC 3OSFA 1K83J 3EUKL 5J4VA 2HWVA 2JA6J 3E5UA 3I64A 3E6MA 4XQFA 1N25A 1YW8A 3OIQA 3GLXA 4IXAA 4PSWA 3CMYA 2C6YA 5E1XA 4MEYF 1K6OA 1JJ6C 3JRDA 4DW6A 2DN0A 1V3FA 4CUGA 1RIOH 2LBFA 3GFJA 3HUGB 1ERDA 5F08A 2DA7A 1NG6A 2YX7A 3KFWX 4G94A 5FGMA 1DU6A 2K85A 2LFBA 3CQZJ 4I76A 2KIUA 2ZO4A 4B09A 3WTTC 3HPGA 5TGTA 5FD6A 4EM1A 2IA1A 3QYBA 2KHMA 1IZ1A 4MTEA 1U5TA 2FOKA 1SD7A 2EIJH 5IY5H 3FF5A 1P6RA 1X3WB 3FK6A 3Q0VA 5BMZA 4LGWA 2KT0A 2Y0MA 1EA3A 4D0PA 5H20A 1QU3A 2KISA 5BQTA 2WY7Q 3BG5A 2IXSA 3S3MA 3DPUA 3TGNA 4ESFA 3BTCA 1YRNB 3R0AA 3LA3A 1X1PA 3CJRB 2CQXA 3IH2A 3WGIA 4CSWA 4UV8A 1I27A 5HS7A 2H09A 2UUZA 2XGXA 4D9JA 1OR7C 4HQEA 4BS9A 1PDNC 4KISA 3D5LA 2EILH 5LRRA 4IJAA 4L5JA 4RB1A 2W82A 4KIBA 1MMSA 3L2UA 4GDFA 1PUEE 1KU9A 4RS8A 4DOZA 2LP0A 2TCTA 1P7JA 2AQFA 4R8HA 3KPHA 3CUOA 3H9GA 3QP5A 5L3EA 1U8BA 1UJ8A 5K5RA 2H8RA 1YLFA 2OV7A 3MKLA 1ON2A 1TBXA 3OYNA 4S04A 4UY8I 5HS9A 2VKVA 5A2QK 5E79C 3GTLJ 2OTJI 4A3IJ 2FNPA 4A0YA 2G9WA 3LA2A 3V8LA 4CICA 1F36A 2HTSA 4PFOA 2W7NA 2DA4A 2XV4S 4CHUA 1HSTA 2K4BA 1FOYA 4HA8A 3E3VA 4E7HA 2ELHA 3IWZA 1EJ9A 3CP2A 1MNDA 4FTHA 5CVRA 1XD7A 3L7WA 3MZYA 1BI3A 2HKXA 2JT1A 4BQOA 2XGDA 2EFQA 2UXXA 4L5EA 2L9RA 2EV5A 4XRMA 1QPIA 2R7ZJ 3FBIB 2M30A 3ZQ7A 2WWYA 4AM3A 3PL8A 1W36D 2OCEA 3KYCB 4U88A 1MMAA 4NUBA 3JW4A 2FBKA 1IRGA 2JN6A 1MNEA 1LB2A 3BR2A 4BDYA 5K1YA 4V2GA 3EDPA 2JVHA 2QSHX 4XLNF 2E2IJ 2LF8A 4B48A 3HOTA 2XRLA 4KIFA 5IPAA 4UUTA 3JR9A 4A3BJ 2YX4A 5CVIA 3FHNA 2H1LA 1LEAA 1N77A 3ABKH 5GAGJ 3M8FA 2YSRA 1BI2A 3U2RA 3L2WA 2ZNYA 1S29A 5IOZA 4C3JJ 3C7JA 5HNFA 2NOGA 2XGCA 3SZGA 3OIPA 2STTA 2LY2A 1EH8A 3MMYB 3DU6A 2GQQA 1I1GA 1T95A 4C2MJ 3J81Z 2MFZA 2DMTA 4UVAA 1JUMA 3BR5A 3T8RA 3CLQA 5D5UB 4XMYA 2CS3A 3R61A 1ON1A 5HNHA 1VFCA 5DDGA 2NS8A 3ASOH 2B63J 1NHAA 2TRTA 2N8GA 3C2BA 4A3DJ 3WE3A 1WI3A 1T38A 1OLTA 3HRSA 5F0FA 1DP3A 4BQNA 2YPRA 3BG7A 1BJZA 2FUG2 1R5GA 3PNYA 5M5WJ 1XPXA 1JT6A 1R00A 1RC9A 4XKCA 2JMWA 5EEGA 2PI0A 1Q1VA 3DLAA 2JA5J 2R92J 3OY9A 3HC7A 1TZLA 1R5ID 2ZBKA 1GV5A 4UVCA 5HS8A 1JTYA 1JUSA 1VI0A 1VQ8I 2ZSIB 1I39A 2G7HA 5LGUA 2OUMA 3PM1A 1ZK8A 1MBEA 4M9ZA 3QWLA 4BY1J 1U2WA 5K7HA 4G12A 4JX4A 3J80K 1Z67A 5FLXZ 4RAGA 1IGNA 1TWGJ 4XRFA 1J59A 3GTPJ 2L5QA 2RQQA 4P96A 4I2OA 2IGOA 1ENHA 2LKXA 1GVDA 4DJAA 3LSPA 2L54A 4XOPA 2R5ZB 4NBQA 4XSXF 4XORA 1YFHA 1X1BA 3JSPA 1IXSB 4MLOA 3OYIA 2F5DA 3FM5A 5EEAA 3QU3A 3FBNB 5LEJA 1XB4A 2NXNB 4G9YA 2WC2A 2L7ZA 3O2PE 2HXOA 4DYCA 1X4PA 2X0LA 5BNGA 4HDVA 1J7KA 2VBXA 4ZDLA 2Q2EB 4L0YB 1QA6A 2B0LA 5DCMB 1JT0A 4KA4A 4BJTA 2BW3A 2K9MA 3ZR8X 1JHHA 2QLZA 1G4DA 2VJ4A 3OR2C 5GADJ 3Q0WA 5J1YA 4B43A 4JP0A 1Y1WJ 4A3CJ 3HOVJ 4GO1A 3QPLA 1AKHB 3FDYA 3BDDA 4IRGA 3I55I 1RR7A 1LVAA 2JVGA 1QQIA 1LE8A 4UXNA 5LD2C 2BYVE 4M9XA 2CW0F 1XMKA 3LSMA 3NQOA 3KCCA 3PFYA 3CCRI 3MCZA 3U1DA 1FLIA 1NG7A 2ZJPF 3H0GJ 5BOXA 1B9MA 5E8IA 3CO6C 2DJNA 3M1EA 2HDDA 1VQ5I 1IRFA 4HZFA 3CCMI 2QKMB 4A3KJ 2OPTA 1U5TC 1MJBA 2CQKA 2NOJB 4O3MA 3WE2A 3BOQA 2HOEA 3S3OA 3CD6I 2XUBA 3BWGA 1I50J 4G6DA 1N78A 3BPVA 2F48A 5HLTA 4M3EA 1LDKB 1R36A 3VPRA 2F2EA 2PMHA 1WH5A 4YIFA 1B59A 2F5CA 1FWZA 1S7AA 3QPHA 2MBFA 4KT6A 4B3AA 1RUNA 1WJEA 1Z3YA 3FXJA 2PJRA 1VQ7I 5FRNA 1R1UA 3SDGA 2DCEA 2EFNA 2LTPA 4XOTA 2L7KA 3EUHA 1OISA 1LFBA 3P5JA 1XDSA 2VPRA 3H9JA 2KJCA 4CXFA 2KMUA 3VODA 4IHVA 4J19A 2JSCA 5DS9A 3SHFA 3N97A 1G3SA 1RKTA 1MBGA 2OD5A 3CJTB 2QZ8A 2H8WA 2DW4A 3DV8A 2QM3A 2HKOA 3H35A 1IO2A 2GA1A 5CVVA 1Y1VJ 1KQ9A 5J1UA 2LBFB 2O0YA 3GTGJ 5ICCA 4P5OA 4CYCA 1PP7U 1OYIA 3ML6A 3CC4I 2RDPA 5F1JA 2FF4A 2BE5F 3JTHA 2HDWA 5KHDA 2RNGA 4EGZA 5C3EJ 2I8DA 2HNHA 3OYKA 1PYVA 2O9LA 4XLEA 1R71A 2F5VA 2XAGA 4WXCA 2M0CA 4J01A 3WTXC 1YITI 4IKFA 3PQJA 1ZG5A 1XGNA 2HTJA 4EGYA 1N75A 2IGNA 3S1RJ 1QHGA 1ZTRA 4DGWB 5FROA 2KPMA 2P0WA 5L3BA 5JLWA 4DBQA 4UNOA 1PP8F 1HW2A 2Q2EA 5DUKA 1E0EA 3ZP5A 2XAFA 4FASD 1LFPA 3LSGA 1S8NA 3M7GA 4H4KC 4BJ5C 5LFAA 1ORKA 3VSKA 1K4TA 2XF7A 3A2KA 1B1BA 4E7ZA 2BY3A 2BZTA 4LITA 5EEHA 1SANA 3S1QJ 1BC7C 2A61A 2QGUA 1JE8A 1YJ9I 3FM3A 3IC7A 3FKJA 2EINH 1FP2A 3DPLC 4HX8A 3TKYA 2ZMEB 2OQGA 4B4CA 4FQGA 1FBQA 2LMDA 3RIRA 3AG4H 2DMNA 2IRFG 2LNBA 1DQUA 1HW5A 4J00A 4PGGA 4B8XA 1JKRC 3K10A 2IGKA 3BZCA 4HDUA 4LOCA 2L4MA 3ABTA 1S7OA 2JRTA 4L5IA 1DU0A 3RYPA 2IS4A 1H8AC 1G3YA 4KNYA 2CMPA 5EG0B 2DYSH 5HODA 5D8LB 1TL8A 2E36A 4BHCA 2K02A 3HOZJ 2XAUA 5ED4A 4A93J 4JX6A 5LGTA 3OYGA 3PNVA 4FE4A 4EJWA 4BHPA 2ECCA 4FCYA 1GVJA 2FRHA 3AKZA 4RAYA 2W4SA 3JRGA 2EWNA 2E1NA 2MD5A 3R4KA 4XIDA 4KFCA 4RLFA 4HSRA 1OJLA 2EIKH 3OYCA 2E19A 3C2GA 3HGYA 1LPQA 1B72A 1W0TA 2AHQA 4P9FA 1YS7A 3DTIA 4KICA 1JGSA 1J0RA 2QVOA 4DIQA 1ETWA 4HF1A 2DO7A 4Y13A 1GV2A 5ICEA 1H88C 1D1BA 2E1OA 4IF4A 5F6FA 2K40A 2HZDA 2VOOA 2LF7A 5B1AH 2EH3A 4WXDA 1JKPC 2DDAA 2DYRH 1ONVA 2VE8A 1D8JA 2DFEA 3LAPA 1TLHB 4KT5C 4C3HJ 1UB9A 2A69F 3D5RC 2DTZA 4CCLA 1OPCA 2K3PA 2NS0A 2VKDA 3ELKA 4BDZA 1G2HA 2K3FA 1AU7A 3CUQC 2NNYA 2R7SA 1S3JA 2XB0X 5CQEA 2DODA 4Y15A 4E6KG 1D1CA 2X4HA 4KN4X 1OCPA 1HF0A 2K9NA 1F43A 3RQ4A 4CYCB 2V9PA 5LGNA 5F1RA 1KONA 4KITB 1SVMA 1JI8A 2CRGA 3SZTA 4MGRA 1L3LA 3IWFA 1TWAJ 3CMAI 2VIXA 1B9NA 5F0HA 2HU9A 5K7ZA 1ETXA 1LDJA 2IS2A 2W1OA 3KZZA 2GOXB 4DQ2A 3W2AA 5FD5A 4LG0A 5LRSA 3ZQGA 5FB2A 3E5QA 3L9FA 3LAJA 3C2HA 4I09A 2KDZA 1ZH5A 3GFLA 1B4AA 4ZTJA 3P9CA 5D6EA 1C0WA 2MLKA 3ZQHA 3WTSC 2PLYA 2VJIA 3C1DA 1I1SA 1JTXA 3BJOA 3ZQLA 3CCJI 1F9NA 3AL0C 4LD5A 3REOA 2GIVA 3KZYA 5E3OA 3L09A 3CDLA 2QQBA 3L1PA 1IN5A 1OCCH 1H9GA 5BPDA 2G0EA 5FKMA 1UHSA 1WKMA 2BW3B 1R4MB 2LK2A 4IX7A 1WH7A 3V8KA 4V19K 4OOIA 2DA5A 3OL4A 5AIQA 3OS2A 4BE1A 1R6RA 2PQ8A 2WY8Q 5E20A 3G2BA 3TQNA 5TRDA 4B3XA 4UB8C 3ULQB 1F4KA 1TT5B 1H89C 3LMMA 3LSHA 2IA2A 3OYHA 1TWFJ 3TDUC 1YE9A 1IN4A 4M3BA 2UXNA 2QKLB 1EF4A 2DMUA 4JK1X 3H3VK 5JR3A 3E6CC 1RKWA 2YU3A 3HHHA 2A6TA 2OZUA 1RESA 3ZQQA 1Y0UA 4N4NB 3WHCA 1QNTA 1MDMB 2VJJA 4NC7A 3E7LA 5JLXA 5E17F 3WODF 3WG9A 4UUVA 2A5YB 2GA2A 2KQRA 2CYYA 1T0FA 3LA7A 2NRAC 4IQ4A 3CLOA 2RVCA 2MW8A 3UNGC 2Y30A 1Z0XA 2DTRA 2M4KA 4EJUA 2E5NA 2JA2A 3DU5A 3RPUD 1S6LA 2VT2A 1LUJB 4CH7A 2VKHA 2HDCA 1TNSA 4G6QA 2FMYA 1Z21A 3ROUA 2DDBA 3TO9A 2LH9A 2FU4A 3HZJA 3SJMA 5E3NA 3W6JB 3GW2A 4I0BA 5E3LA 3HPHA 5HLGA 2JUGA 2M8GX 4L9TA 2MLGA 1W1WE 2JPCA 2XRNA 4PK4A 5BPIA 1BL0A 2VT3A 3BG6A 5JVTA 2X1DA 1V5GA 4CCOA 4IRHA 5FKKA 5D5WB 5B5EC 4ZZLA 2WAFA 3VWBA 3U9GA 4E7LA 1DP7P 2DOFA 3I58A 1YJNI 2E7XA 5F27A 2V1DA 3CCUI 3GZ6A 1O3RA 3ZMVA 3DQVC 4WX9A 2GAUA 2YS9A 4RGRA 1TNTA 2HYJA 4ZTFA 4BL0B 2YUSA 4G7ZF 5EYRA 1FTTA 3G4SI 2ELJA 4XM3A 5F04A 3J81K 2X9DA 5JFRA 1MBHA 3IH3A 2ZNZA 4X0GA 4A12A 4BU2A 1HSJA 4BQQA 3OL3A 1GLNA 3CMEI 3DLLF 1H0MA 4LIUA 2Y48A 4ANJA 1R49A 2ZSHB 3IRQA 3K4JA 2Y2ZA 4LB6B 1Z6RA 1WJCA 1ETQA 3LSKA 1XG1A 4U87A 4IHTA 4XLFA 3SFZA 1W5CC 3HL2A 2HVQA 5CJ9A 2STWA 4N4OB 2DXIA 4GRIA 3PIPF 3MKZA 1SD4A 2J5PA 3P7NA 3AG2H 4Q48A 3ECHA 3SZPA 5CVJA 3M9AA 1K79A 2VC1A 1U9NA 3BC8A 4XKVA 4A5MA 4CCJA 1EKEA 2L7MP 3F3XA 3G6EI 1JKOC 5DD4A 3BT9A 3JREA 3QRFF 4LIVA 2EJRA 1FOWA 1HW1A 2DT7B 1D5VA 2Z99A 4PJMA 4NC6A 1SFKA 2DOEA 2Z3YA 1XCBA 5HDNA 1XCVA 1R1TA 1GHCA 3CCQI 3V7RA 3NAUA 2XKPA 4C2TA 1NH3A 3OSGA 3K1NA 4M3DA 4DZJA 3KP3A 1MBKA 1Y56A 3MKWB 2YR2A 1P7IA 2E5ZA 2OCCH 4AD9A 1ZKGA 2ID3A 4NHJA 2X51A 3IAS2 4YRVA 4F52A 4R79A 3GO5A 2FBIA 2JTVA 4WXHA 3HSFA 5L3FA 4ZYAA 1BN5A 1Z9CA 4PGHA 3WHBA 3LQQA 5D4SA 2L3DA 3S32A 1MJAA 1S7EA 2ZJQF 4BAYA 4L9NA 4M3GA 1ITYA 2HQRA 3DEWA 2DU9A 2HZTA 3X2QH 1YI2I 1USTA 1ZARA 3A02A 3S17J 3HEFA 1OCTC 1P9QC 1Z6TA 2FOWA 3KP4A 2IBDA 4HW0A 3ZQIA 2ZFUA 1O57A 3L2CA 2FSWA 1O3TA 1QHHD 1FNNA 3PJRA 4RM3A 3GTKJ 2D1VA 4XNFA 2KRFA 4BNCA 1Z1DA 4BACA 1E3OC 1CF7B 3CC2I 2XVCA 1SFXA 4M71A 2VQGA 4RAFA 1MMNA 2CG4A 2VPLA 1KGSA 3LOCA 4KMFA 1UMQA 3TO6A 1HC8A 4XONA 2A5WA 1BOBA 2RQPA 3RTRA 4LK0F 4XN0A 4HYEA 3K69A 3H36A 1I6XA 5E18F 2M1BA 4EEFG 1MH3A 2R7DA 4KYWA 2E7WA 4YIRX 2ZXJA 1JGGA 2WV0A 1BW5A 2DFIA 5FFXA 5K5OA 3S16J 3MD2A 2KKOA 5ILUA 4ZYHA 3B6CA 3MEXA 2Y0SA 3CC7I 4K2EA 2HGCA 3KLOA 3Q9SA 4MQVA 3F8NA 1VQ9I 5GPAA 5GAHJ 3QYEA 5ILVA 3ZN0A 1QVUA 4EVIA 2Y69H 1VQMI 2FA5A 4NDLA 4W1UA 1IG7A 1BJAA 2RKHA 1RUOA 2B9SA 3J7ZI 3RQIA 2HOSA 4D5FA 2E1MC 3BG9A 3MKYB 2HYFA 3EQLF 5FKLA 1FIAA 1KU3A 2XAHA 1P92A 2JK3A 2K7LA 3G3ZA 3HUGA 3DFGA 3HRMA 4A6EA 4XKWA 2D5VA 1J2XA 2CQNA 2RV8A 1SMYF 2XC7A 2FNAA 2BEOA 3HB9A 2K9LA 3OYEA 4U7BA 4YIIA 3GTQJ 3KP6A 2L9NA 3GLLA 1A04A 3FXQA 5DCMA 2PMZN 3HBLA 3GFMA 4BGDA 2CUZA 5HDGA 2EV0A 3KETA 2CQQA 5ILSA 1IDYA 4A3JJ 2DOAA 2RGVA 5LHGA 3BZKA 4GXOA 1RI7A 2LREA 3R0JA 1LDDA 1W7PA 2GM4A 3KP2A 1IN6A 1JHFA 2E71A 1OYWA 4HX4A 2MGQA 2PX9A 2ZMEA 1QGPA 3NRVA 1Z7LA 3SEQA 5A2QZ 3HG9A 2OF7A 3FKIJ 3ONQA 1GDTA 4U0WA 4HF2A 5E3MA 2UV1A 4LB5A 1Y39A 5E1ZB 3B02A 5HVQC 2R7VA 4DBRA 2HOTA 2VBZA 4C30A 2VOPA 2XDVA 1DPUA 2KRHA 1D0ZA 1SAUA 1TW2A 2ZJRF 1G3WA 3I56I 4PJLA 1XMAA 3FMRA 2XAJA 4AYBN 1TQIA 4BKXA 3HOWJ 2H1KA 2PEXA 4HV6A 5M5YJ 1D0XA 1L0OC 1Y6IA 1XDUA 2EZKA 2QQ9A 1Z3XA 4F91B 4GYGA 1MZBA 2XPWA 3WTWC 1S9HA 2K27A 5IP9J 1MBFA 1W7PB 1IUFA 1JXSA 2O03A 3UR3C 1VTNC 4U0YA 2W85A 4RDUA 2MYSA 2O3FA 2COBA 4CYDA 2VI6A 1UCRA 3A0HC 1KU2A 2K5CA 4Z2YA 4LLLA 4JOMA 3N4MA 2FMLA 5KK1A 2R4GA 5D6FA 2X6OA 5L3DA 3IKVA 1U6GA 4RBOA 1RRJA 1BIBA 1MNMC 1UAAA 5IT3A 3BZ6A 2A68F 2ICWG 2K86A 2NVYJ 2F5FA 3BR1A 3CJQB 3GF2A 3LSTA 2CGPA 1T6SA 2W24A 4R1HA 2PMZA 4Y33A 1A6QA 1LVKA 5BS6A 2YU9J 1KYWA 5IYBJ 2DT6A 4LLNA 3OS0A 1U9OA 1T56A 4EQQA 2X85A 5LLQA 2BVLA 2LSOA 4PZJA 1AHDP 1BR2A 2LKPA 5JI6A 3AG1H 3FXRA 1TW3A 1X1AA 2WTEA 3JAMZ 4U0VA 2R7OA 3RPUA 4LK1F 4A3MJ 2L02A 1ZR4A 5GP9A 2BBYA 4A3GJ 4QSHA 3FMQA 3D5SC 3K0LA 2OJED 4E70A 2ECBA 1A36A 1HDPA 1OMIA 3I54A 3QOPA 3FXUA 3S2HJ 3FIWA 4HG2A 2ZMEC 4RB0A 3A0BC 1MKMA 2DFFA 4PJJA 1ZG1A 4Q5SF 4NB5A 4QWQA 1LEBA 4HLXA 3H9QA 3GTMJ 2J5OA 2MSYA 4RGXA 2V1XA 3E6BA 4M74A 3R6SA 1YX3A 3F9KA 4ZZDA 3GTOJ 1HQCA 2H27A 2Z1DA 3WU0A 4ZJZA 3BR6A 2BY0A 3I59A 1O7FA 1JJ8C 1DGRM 2LYCA 2XB5A 1M1EB 4ETSA 2ID6A 4LG3A 1Y8QB 3TP0A 4M6VA 3H3UA 4NQWA 2XGEA 2FD5A 4ENMA 2I5UA 3ECOA 1XGOA 3CP8A 2VQHA 2AS5F 1QPMA 3BJ6A 1ETVA 4A2UA 1GXPA 4M6YA 2X6XA 3HOYJ 3LSJA 1RETA 2JWTA 3DBHB 3ESWB 2VJ5A 3R60A 3JRCA 5K7FA 1FMVA 3V7SA 2G7UA 4A3LJ 2M5WA 2R7QA 2HQAA 2V26A 3PSFA 3PFIA 2VXDA 3H3ZA 3O6BB 4WCGA 1WJ5A 2XAQA 2QEXI 3ZMDA 4IHWA 4HX7A 2R5ZA 4XLPF 3VDXA 2PBIA 1A6IA 1WVRA 3PNTA 3M3YJ 4QPQA 2KZGA 4BHBA 1T33A 2Y9ZA 2JUCA 4IQJA 3OV8A 1OCZH 4UUSA 1O3QA 2V1NA 3K2ZA 4II3A 1XC5A 1FJLA 1RZ4A 4KDPA 1VQNI 3ZGKA 1GXQA 4HV5A 4AWXB 2DK5A 4MO7A 4ZYEA 1BBYA 1YX5A 1DUXC 3S8PA 3CCVI 1IRZA 4XKBA 4KUMA 1U78A 1W7PD 3TDZC 1T39A 5FLXK 1WJBA 1B6AA 2R7UA 2FXAA 4C2UA 3PO2J 2GIZA 2OQRA 1VQKI 3HM5A 3RKWA 4Y7NJ 5GPCA 3DEUA 4BE2A 1UG2A 3QOEA 3VYRB 2CV2A 3K9TA 4RB3C 1I3QJ 4WK8F 5JHFA 3OYMA 1RNLA 3JRFA 2P5VA 1XSDA 5D8KB 2EFPA 4RGUA 3SXYA 4ZYDA 4Q4ZF 1O3SA 3S14J 2EBIA 3GZ5A 3CUQB 4IEJA 3ZPLA 2CWEA 3HTSB 2QSGX 1X2NA 2KZVA 3K4NA 2EFOA 4AVPA 4ZDPA 1T2KA 1OKRA 2I10A 3KP7A 4IOAF 5H6QA 2WAQN 2V6EA 1JKQC 4BE0A 1ZELA 3OOUA 3KYLA 4XICA 1FYKA 2JPBA 3U1KA 4CA0A 5EJCA 1ZRDA 4XLAA 2IAIA 1J09A 4V2FA 3K7AJ 5C44J 3B6AA 3K70D 1FBUA 5IT9K 2ZXHA 3P9IA 2BY2A 4OINF 2KL4A 3LL7A 4AIJA 4A3FJ 3Q3SA 2E1MB 3E1SA 3J7AY 1R58A 4OIOF 2CJJA 4BXFA 3RKXA 4S0HB 3SEZA 2LDUA 1GUUA 4DYRA 1IV6A 3LSIA 2PN6A 3H0DA 2IP2A 5TJJA 1FYMA 1HDDC 4AIKA 3DBLB 3HXLA 3FWEA 1QRYA 1KQ8A 3F6OA 2JQ7A 4Y4RA 4X6AJ 2M9HA 1V5FA 4YFNF 3M1CA 3WTYC 4HRIA 3OS1A 2VUMJ 2DLLA 2ELKA 2E60A 2X1CA 1X2MA 3I59B 3M07A 2W00A 3W2WA 3QPTA 1R4NB 2DA1A 3K4BA 3F22A 1U5TB 2QBYA 3F21A 1YOVB 3ZMUA 2MG4A 3CCSI 2IGMA 4QIWN 2D1HA 1BR4A 1P4AA 4M73A 3VOEA 3M4OJ 3G1LA 3EPZA 1A35A 1KZHA 2HPIA 4ON0A 1LFUP 1E17A 4MFEA 2LLKA 1ACIA 4IHYA 2HFHA 2Z16A 4EM2A 4Y52J 1Z7UA 3FXKA 4RA2A 5FO5A 4C9YA 1FX7A 2UZKA 3GFIA 1MSEC 2EPFA 1FIPA 4A0ZA 4BEHA 1YW9A 3PUFA 4W97A 2LY9A 4BJ6C 2WADA 4BBRJ 1IXCA 4CDGA 1ZGJA 1FY7A 3BR3A 4IL6C 4AUXA 3TW7A 4P55A 1TWCJ 2A6HF 1V4RA 2A3SA 4WF2A 1QBJA 5L3CA 4I0AA 1BI1A 3ABMH 4AC0A 3J7AO 1W36C 2L0KA 3FX3A 3KYDB 4G7HF 3OIOA 3IV5A 4I98B 3EYYA 2QSFX 1LKXA 4IZZA 1ZRCA 1F1ZA 4XBFA 1ULYA 3BG3A 3L00A 4X1EA 2M0MA 3J80Z 2L4AA 2P5LC 1K78B 1R22A 2V6CA 3WG7H 1NTCA 2FX0A 1YIJI 5EGOA 1U3EM 2E35A 4G6TB 3L2RA 5E1WA 2CQ7A 3B73A 1KYZA 2HPMA 3BP8A 3K1PA 3M8EA 4AIHA 3HRUA 4IHXA 3BCAA 4DYQA 1D3YA 3W6KB 4O6JA 3LWFA 4BY7J 4D1QA 5TISC 3OOPA 2AXLA 4KMUX 5DUIA 1UFMA 1MH4A 2LVSA 1WFXA 4M6XA 4OWRB 4S05A 1OR7A 2V9VA 2DQLA 1WPKA 5CVUA 1DDNA 2EZLA 1B8IB 5E8GA 3RYRA 1T0FC 5CKTA 4OIQF 3T5XA 2GOMA 2D45A 4IRIA 3K4KA 5DTDA 3A01B 1P4WA 3S2DJ 5C4XJ 1PJRA 5LHIA 2QENA 5FLMJ 3BQZA 3G71I 1UHWA 2DBBA 4UB6C 3HRTA 2BHZA 1FPQA 3O8GA 1TC3C 1T08B 1BW6A 5IYDJ 3SDBA 2Z9OA 2X48A 3GBGA 3O3KA 2JRMA 2XPVA 2K4JA 3U21A 2GXAA 3M8JA 2IJLA 4ZH4F 3VB2A 1WI9A 1X3ZB 1XGSA 2DAOA 3K4LA 2Z2SB 3DTKA 2L9SA 2R0QC 2L9VA 3KZIC 1EH7A 3CDHA 1SAXA 1XSXA 2GZWA 5KAIC 2LRDA 3BTJA 4HAMA 2P7VB 3RZDJ 1HOMA 3BLYA 2QYOA 1JUPA 5FKOA 2K9QA 3DWLE 1KQ0A 3DKXA 3F72A 1RPWA 1WGXA 2ZC2A 3KIOA 1K61A 1CF7A 1VQPI 1DPRA 2R7TA 1R9TJ 3IP4B 4CCKA 3KEOA 4RLQA 2DA3A 2F5EA 4MTDA 4XLHA 4ENJA 1FBSA 1MIJA 3ASNH 3FISA 2KIMA 3K6GA 3JSOA 1A31A 3V4GA 3VYUB 1TTYA 4NC8A 1ZAOA 1NK3P 5EZGA 4FX4A 1CGPA 1S72I 2CUJA 4D5CA 3JRBA 3P9KA 2QCOA 4BQAA 1G6NA 1WJFA 4XLCA 1X19A 1U8RA 3AL0B 3RPQA 1X3UA 4F3QA 4LMYA 2P6SA 2DQRA 3W2VA 4EATA 3RKQA 4FE7A 2A6EF 1IN7A 4MQ9F 5HDKA 2O6GE 2ACJA 1OCOH 2XSDC 2IT0A 2VL8A
chains in the Genus database with same CATH topology
4BXXJ 3DCFA 2HXIA 5EDNA 2GM4A 2HQ5A 1ETYA 3S1RJ 2R5YB 2FJ1A 1ZTRA 2JA8J 2R93J 5JLWA 2MGQA 2OF7A 3FKIJ 2M2EA 2NVQJ 1B72B 1GDTA 3LSGA 5E3MA 1ORKA 1VNDA 2HOTA 1OFCX 5FKNA 1FEXA 3FK7A 5C4JJ 1SANA 3S1QJ 2FQ4A 1SFOJ 5IYCJ 2QF7A 4AYBN 4BKXA 3HOWJ 2H1KA 3W6VA 5M5YJ 4A3EJ 5J3LA 4B4CA 1ZR2A 3HKZN 3JRIA 2EZKA 1IC8A 3S1NJ 5J1RA 5EG0A 1ZGWA 1A5JA 2NVXJ 2DMNA 2XPWA 5IP9J 1MBFA 1GT0C 3TEDA 1JKRC 1IUFA 1TWHJ 2Y9YA 5IOYA 4LOCA 2ME0A 2GLOA 3S15J 2ZB9A 1DU0A 4RDUA 3ZQFA 1ZQ3P 2COBA 4GFBA 1H8AC 2VI6A 2GBYA 4FISA 3UKGA 2IEKA 5EG0B 2EZIA 5HODA 3RZOJ 2RAEA 3HOZJ 2X6OA 2R5YA 4A93J 3SFIA 3MN2A 4JX6A 4RBOA 1MNMC 4FE4A 1Z77A 1CQTA 2NVYJ 3BR1A 3JRAA 2ECCA 4FCYA 1ETKA 3JRGA 1PUFA 2M34A 2YU9J 4XRSG 4XIDA 1HCRA 5IYBJ 1OJLA 2AO9A 2E19A 1T56A 1U9OA 1HLVA 3HGYA 1AHDP 3BQYA 1B72A 1W0TA 2AHQA 3NARA 1NK2P 2K9SA 1ETWA 4A3MJ 3O8HA 1GV2A 1ZR4A 5GP9A 5EF6A 4A3GJ 1H88C 2JJ7A 2E1OA 4QSHA 5EGOB 2ECBA 1K83J 2K40A 3OSFA 1HDPA 2JA6J 2EH3A 3S2HJ 3FIWA 1JKPC 3ZQCA 4C3HJ 3CMYA 2DTZA 1JJ6C 2MSYA 3GTMJ 3JRDA 1G2HA 1AU7A 3GTOJ 4ABZA 4DW6A 2XB0X 2DN0A 3BR6A 1F43A 1OCPA 1HF0A 2K9NA 1JJ8C 4CYCB 5F08A 2DA7A 2LR8A 4XRSA 2XB5A 1DU6A 5FJ8J 2LFBA 4I76A 3CQZJ 2CRGA 2HOAA 2ID6A 1ETOA 3A03A 1TWAJ 4JYKA 3TP0A 4M6VA 5F0HA 3BTLA 1LE8B 2XGEA 5K7ZA 1ETXA 2FD5A 3QPSA 3HGGA 3FK6A 3Q0VA 3ZQGA 2KT0A 1ETVA 2W48A 3GTJJ 2KDZA 3HOYJ 3LSJA 1RETA 2JWTA 3BG5A 5FLVA 3ZQHA 3BTIA 3JRCA 5F0CA 5K7FA 1JTXA 3ZQLA 3BTCA 1YRNB 3QQAA 4A3LJ 5E3OA 3CDLA 3L1PA 1O4XA 2CQXA 3IH2A 1QVTA 5M3FJ 2G0EA 5FKMA 1UHSA 2LK2A 4IHWA 1WH7A 2R5ZA 2DA5A 1A6IA 3M3YJ 2O8KA 4XK4A 1T33A 2Y9ZA 1H89C 4C3IJ 4UUSA 3ZOBA 2LP0A 2TCTA 1P7JA 1XC5A 1TWFJ 1FJLA 4M3BA 2EZHA 3HOUJ 1EF4A 2DMUA 3I4NJ 3PO3J 1U8BA 3H3VK 1RKWA 4MO7A 2H8RA 2DMQA 1IRZA 1RESA 3WHCA 4MFDA 3MKLA 1U78A 1B8IA 3E7LA 5JLXA 3PO2J 3GTLJ 2VKVA 4A3IJ 3HM5A 4Y7NJ 5GPCA 1UG2A 4A69C 1F36A 2DA4A 1I3QJ 2MW8A 3JRFA 3G1MA 2Y30A 1Z0XA 2DA6A 1APLC 3S14J 2EBIA 3I4MJ 4IEJA 4D7MA 4MIMA 2HI3A 1X2NA 5IP7J 4FTHA 1POGA 1XS9A 2P81A 3JRHA 3SJMA 2XGDA 2I10A 5E3NA 3HOXJ 4L5EA 2L9RA 2WAQN 4XRMA 1QPIA 2R7ZJ 1JKQC 5E3LA 3OOUA 4XICA 2M8GX 1BA5A 1MSFC 1BL0A 2IAIA 4V2FA 3K7AJ 5C44J 3B6AA 4DZPA 5FKKA 2JN6A 3BR2A 3F0CA 4V2GA 4A3FJ 3Q3SA 2E2IJ 2CJJA 4S0HB 2XRLA 5F27A 5IPAA 1GUUA 4UUTA 4DYRA 3JR9A 1IV6A 3HDDA 4A3BJ 2YS9A 2HYJA 1HDDC 2YUSA 1QRYA 1X58A 5EYRA 1FTTA 4X6AJ 2M9HA 5F04A 5IOZA 4C3JJ 2X9DA 1MBHA 3IH3A 2NOGA 2XGCA 2VUMJ 2ELKA 4D7NA 1X2MA 4C2MJ 2EQRA 2DA1A 2DMTA 5M3MJ 2Y2ZA 2JA7J 1JUMA 3BR5A 2MG4A 1ETQA 3G1OA 1XG1A 1VFCA 4QIWN 1IDZA 2NS8A 2B63J 3M4OJ 2TRTA 3G1LA 2WB1N 3TW6A 2N8GA 3C2BA 4A3DJ 1LFUP 1WI3A 4MFEA 2LLKA 4IHYA 5F0FA 4Y52J 1BJZA 1IJWC 2DMPA 1MSEC 2WV1A 4HNVA 1FIPA 2Y31A 1U9NA 3MVPA 4W97A 5M5WJ 2LY9A 1JT6A 2L7MP 2JMWA 1JKOC 1Q1VA 3BT9A 3JREA 2JA5J 2R92J 4BBRJ 9ANTA 4B1RA 3BR3A 4AUXA 1GV5A 3TW7A 1TWCJ 1JTYA 1JUSA 1VI0A 3PM1A 1ZK8A 1MBEA 4AC0A 2L0KA 2ME6A 4BY1J 2VKEA 3NAUA 5K7HA 4G12A 3OIOA 4JX4A 3IV5A 1FTZA 3OSGA 3K2AA 2CU7A 4M3DA 4DZJA 1MBKA 1IGNA 1TWGJ 3GTPJ 1P7IA 3BG3A 4X1EA 1ZKGA 2ID3A 1ENHA 2LKXA 1GVDA 3LSPA 3S1MJ 1NTCA 2FX0A 2XPUA 5EGOA 2R5ZB 4MLOA 3WHBA 5EEAA 3A01A 1S7EA 1ITYA 4M3GA 4BBSJ 2L7ZA 3DEWA 2HXOA 4UUSB 1MBJA 4IHXA 4DYCA 4DYQA 2DA2A 2E2JJ 4BY7J 1YRNA 5BNGA 2LD5A 3A02A 3S17J 3HEFA 1OCTC 1MH4A 1JT0A 2IBDA 2LVSA 3ZQIA 1WPKA 4A3CJ 3Q0WA 5J1YA 2EZLA 4JP0A 1Y1WJ 1AKHA 1B8IB 3HOVJ 3QPLA 1AKHB 3GTKJ 5DTDA 3A01B 5IP6A 1E3OC 1RR7A 3S2DJ 5C4XJ 1LE8A 5FLMJ 3BQZA 2Y0SN 3IH4A 3O8GA 1TC3C 1BW6A 5IYDJ 3H0GJ 3LOCA 5M5XJ 2CUEA 1UMQA 2X48A 4I6ZA 3GBGA 2XPVA 2DJNA 2HDDA 3TP3A 2O7OA 4A3KJ 2OPTA 4EEFG 1MH3A 1I50J 2R0QC 1JGGA 4M3EA 1BW5A 3VPRA 1WH5A 2L7FP 3S16J 3BTJA 4B3AA 3RZDJ 3B6CA 1HOMA 3SDGA 1JUPA 1WCMJ 2LTPA 5FKOA 2K9QA 4JX5A 5GPAA 1LFBA 1RPWA 1WGXA 2VPRA 1K61A 1QVUA 1R9TJ 4IHVA 4J19A 4NDLA 4W1UA 5DS9A 1IG7A 4M3FA 1RKTA 2DA3A 1MBGA 1I6HJ 1D5YA 3BR0A 3D1NI 2NVTJ 3RQIA 2HOSA 3FISA 3Q0UA 3LSRA 4D5FA 3BG9A 2CUFA 3LNQA 5FKLA 1FIAA 1PUFB 1NK3P 5EZGA 1Y1VJ 2JK3A 3GTGJ 5J1UA 2NS7A 4CYCA 4D5CA 2D5VA 4QTRA 3JRBA 5F1JA 2QCOA 3HB9A 3GTQJ 5EZHA 3CCYA 5C3EJ 1VF9A 3RKQA 2PMZN 3HBLA 4FE7A 1W0UA 2O9LA 2CQQA 1IDYA 4A3JJ 2XSDC 2E2HJ 2M0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX J;  3DCF A;  2HXI A;  5EDN A;  2GM4 A;  2HQ5 A;  1ETY A;  3S1R J;  2R5Y B;  2FJ1 A;  1ZTR A;  2JA8 J;  2R93 J;  5JLW A;  2MGQ A;  2OF7 A;  3FKI J;  2M2E A;  2NVQ J;  1B72 B;  1GDT A;  3LSG A;  5E3M A;  1ORK A;  1VND A;  2HOT A;  1OFC X;  5FKN A;  1FEX A;  3FK7 A;  5C4J J;  1SAN A;  3S1Q J;  2FQ4 A;  1SFO J;  5IYC J;  2QF7 A;  4AYB N;  4BKX A;  3HOW J;  2H1K A;  3W6V A;  5M5Y J;  4A3E J;  5J3L A;  4B4C A;  1ZR2 A;  3HKZ N;  3JRI A;  2EZK A;  1IC8 A;  3S1N J;  5J1R A;  5EG0 A;  1ZGW A;  1A5J A;  2NVX J;  2DMN A;  2XPW A;  5IP9 J;  1MBF A;  1GT0 C;  3TED A;  1JKR C;  1IUF A;  1TWH J;  2Y9Y A;  5IOY A;  4LOC A;  2ME0 A;  2GLO A;  3S15 J;  2ZB9 A;  1DU0 A;  4RDU A;  3ZQF A;  1ZQ3 P;  2COB A;  4GFB A;  1H8A C;  2VI6 A;  2GBY A;  4FIS A;  3UKG A;  2IEK A;  5EG0 B;  2EZI A;  5HOD A;  3RZO J;  2RAE A;  3HOZ J;  2X6O A;  2R5Y A;  4A93 J;  3SFI A;  3MN2 A;  4JX6 A;  4RBO A;  1MNM C;  4FE4 A;  1Z77 A;  1CQT A;  2NVY J;  3BR1 A;  3JRA A;  2ECC A;  4FCY A;  1ETK A;  3JRG A;  1PUF A;  2M34 A;  2YU9 J;  4XRS G;  4XID A;  1HCR A;  5IYB J;  1OJL A;  2AO9 A;  2E19 A;  1T56 A;  1U9O A;  1HLV A;  3HGY A;  1AHD P;  3BQY A;  1B72 A;  1W0T A;  2AHQ A;  3NAR A;  1NK2 P;  2K9S A;  1ETW A;  4A3M J;  3O8H A;  1GV2 A;  1ZR4 A;  5GP9 A;  5EF6 A;  4A3G J;  1H88 C;  2JJ7 A;  2E1O A;  4QSH A;  5EGO B;  2ECB A;  1K83 J;  2K40 A;  3OSF A;  1HDP A;  2JA6 J;  2EH3 A;  3S2H J;  3FIW A;  1JKP C;  3ZQC A;  4C3H J;  3CMY A;  2DTZ A;  1JJ6 C;  2MSY A;  3GTM J;  3JRD A;  1G2H A;  1AU7 A;  3GTO J;  4ABZ A;  4DW6 A;  2XB0 X;  2DN0 A;  3BR6 A;  1F43 A;  1OCP A;  1HF0 A;  2K9N A;  1JJ8 C;  4CYC B;  5F08 A;  2DA7 A;  2LR8 A;  4XRS A;  2XB5 A;  1DU6 A;  5FJ8 J;  2LFB A;  4I76 A;  3CQZ J;  2CRG A;  2HOA A;  2ID6 A;  1ETO A;  3A03 A;  1TWA J;  4JYK A;  3TP0 A;  4M6V A;  5F0H A;  3BTL A;  1LE8 B;  2XGE A;  5K7Z A;  1ETX A;  2FD5 A;  3QPS A;  3HGG A;  3FK6 A;  3Q0V A;  3ZQG A;  2KT0 A;  1ETV A;  2W48 A;  3GTJ J;  2KDZ A;  3HOY J;  3LSJ A;  1RET A;  2JWT A;  3BG5 A;  5FLV A;  3ZQH A;  3BTI A;  3JRC A;  5F0C A;  5K7F A;  1JTX A;  3ZQL A;  3BTC A;  1YRN B;  3QQA A;  4A3L J;  5E3O A;  3CDL A;  3L1P A;  1O4X A;  2CQX A;  3IH2 A;  1QVT A;  5M3F J;  2G0E A;  5FKM A;  1UHS A;  2LK2 A;  4IHW A;  1WH7 A;  2R5Z A;  2DA5 A;  1A6I A;  3M3Y J;  2O8K A;  4XK4 A;  1T33 A;  2Y9Z A;  1H89 C;  4C3I J;  4UUS A;  3ZOB A;  2LP0 A;  2TCT A;  1P7J A;  1XC5 A;  1TWF J;  1FJL A;  4M3B A;  2EZH A;  3HOU J;  1EF4 A;  2DMU A;  3I4N J;  3PO3 J;  1U8B A;  3H3V K;  1RKW A;  4MO7 A;  2H8R A;  2DMQ A;  1IRZ A;  1RES A;  3WHC A;  4MFD A;  3MKL A;  1U78 A;  1B8I A;  3E7L A;  5JLX A;  3PO2 J;  3GTL J;  2VKV A;  4A3I J;  3HM5 A;  4Y7N J;  5GPC A;  1UG2 A;  4A69 C;  1F36 A;  2DA4 A;  1I3Q J;  2MW8 A;  3JRF A;  3G1M A;  2Y30 A;  1Z0X A;  2DA6 A;  1APL C;  3S14 J;  2EBI A;  3I4M J;  4IEJ A;  4D7M A;  4MIM A;  2HI3 A;  1X2N A;  5IP7 J;  4FTH A;  1POG A;  1XS9 A;  2P81 A;  3JRH A;  3SJM A;  2XGD A;  2I10 A;  5E3N A;  3HOX J;  4L5E A;  2L9R A;  2WAQ N;  4XRM A;  1QPI A;  2R7Z J;  1JKQ C;  5E3L A;  3OOU A;  4XIC A;  2M8G X;  1BA5 A;  1MSF C;  1BL0 A;  2IAI A;  4V2F A;  3K7A J;  5C44 J;  3B6A A;  4DZP A;  5FKK A;  2JN6 A;  3BR2 A;  3F0C A;  4V2G A;  4A3F J;  3Q3S A;  2E2I J;  2CJJ A;  4S0H B;  2XRL A;  5F27 A;  5IPA A;  1GUU A;  4UUT A;  4DYR A;  3JR9 A;  1IV6 A;  3HDD A;  4A3B J;  2YS9 A;  2HYJ A;  1HDD C;  2YUS A;  1QRY A;  1X58 A;  5EYR A;  1FTT A;  4X6A J;  2M9H A;  5F04 A;  5IOZ A;  4C3J J;  2X9D A;  1MBH A;  3IH3 A;  2NOG A;  2XGC A;  2VUM J;  2ELK A;  4D7N A;  1X2M A;  4C2M J;  2EQR A;  2DA1 A;  2DMT A;  5M3M J;  2Y2Z A;  2JA7 J;  1JUM A;  3BR5 A;  2MG4 A;  1ETQ A;  3G1O A;  1XG1 A;  1VFC A;  4QIW N;  1IDZ A;  2NS8 A;  2B63 J;  3M4O J;  2TRT A;  3G1L A;  2WB1 N;  3TW6 A;  2N8G A;  3C2B A;  4A3D J;  1LFU P;  1WI3 A;  4MFE A;  2LLK A;  4IHY A;  5F0F A;  4Y52 J;  1BJZ A;  1IJW C;  2DMP A;  1MSE C;  2WV1 A;  4HNV A;  1FIP A;  2Y31 A;  1U9N A;  3MVP A;  4W97 A;  5M5W J;  2LY9 A;  1JT6 A;  2L7M P;  2JMW A;  1JKO C;  1Q1V A;  3BT9 A;  3JRE A;  2JA5 J;  2R92 J;  4BBR J;  9ANT A;  4B1R A;  3BR3 A;  4AUX A;  1GV5 A;  3TW7 A;  1TWC J;  1JTY A;  1JUS A;  1VI0 A;  3PM1 A;  1ZK8 A;  1MBE A;  4AC0 A;  2L0K A;  2ME6 A;  4BY1 J;  2VKE A;  3NAU A;  5K7H A;  4G12 A;  3OIO A;  4JX4 A;  3IV5 A;  1FTZ A;  3OSG A;  3K2A A;  2CU7 A;  4M3D A;  4DZJ A;  1MBK A;  1IGN A;  1TWG J;  3GTP J;  1P7I A;  3BG3 A;  4X1E A;  1ZKG A;  2ID3 A;  1ENH A;  2LKX A;  1GVD A;  3LSP A;  3S1M J;  1NTC A;  2FX0 A;  2XPU A;  5EGO A;  2R5Z B;  4MLO A;  3WHB A;  5EEA A;  3A01 A;  1S7E A;  1ITY A;  4M3G A;  4BBS J;  2L7Z A;  3DEW A;  2HXO A;  4UUS B;  1MBJ A;  4IHX A;  4DYC A;  4DYQ A;  2DA2 A;  2E2J J;  4BY7 J;  1YRN A;  5BNG A;  2LD5 A;  3A02 A;  3S17 J;  3HEF A;  1OCT C;  1MH4 A;  1JT0 A;  2IBD A;  2LVS A;  3ZQI A;  1WPK A;  4A3C J;  3Q0W A;  5J1Y A;  2EZL A;  4JP0 A;  1Y1W J;  1AKH A;  1B8I B;  3HOV J;  3QPL A;  1AKH B;  3GTK J;  5DTD A;  3A01 B;  5IP6 A;  1E3O C;  1RR7 A;  3S2D J;  5C4X J;  1LE8 A;  5FLM J;  3BQZ A;  2Y0S N;  3IH4 A;  3O8G A;  1TC3 C;  1BW6 A;  5IYD J;  3H0G J;  3LOC A;  5M5X J;  2CUE A;  1UMQ A;  2X48 A;  4I6Z A;  3GBG A;  2XPV A;  2DJN A;  2HDD A;  3TP3 A;  2O7O A;  4A3K J;  2OPT A;  4EEF G;  1MH3 A;  1I50 J;  2R0Q C;  1JGG A;  4M3E A;  1BW5 A;  3VPR A;  1WH5 A;  2L7F P;  3S16 J;  3BTJ A;  4B3A A;  3RZD J;  3B6C A;  1HOM A;  3SDG A;  1JUP A;  1WCM J;  2LTP A;  5FKO A;  2K9Q A;  4JX5 A;  5GPA A;  1LFB A;  1RPW A;  1WGX A;  2VPR A;  1K61 A;  1QVU A;  1R9T J;  4IHV A;  4J19 A;  4NDL A;  4W1U A;  5DS9 A;  1IG7 A;  4M3F A;  1RKT A;  2DA3 A;  1MBG A;  1I6H J;  1D5Y A;  3BR0 A;  3D1N I;  2NVT J;  3RQI A;  2HOS A;  3FIS A;  3Q0U A;  3LSR A;  4D5F A;  3BG9 A;  2CUF A;  3LNQ A;  5FKL A;  1FIA A;  1PUF B;  1NK3 P;  5EZG A;  1Y1V J;  2JK3 A;  3GTG J;  5J1U A;  2NS7 A;  4CYC A;  4D5C A;  2D5V A;  4QTR A;  3JRB A;  5F1J A;  2QCO A;  3HB9 A;  3GTQ J;  5EZH A;  3CCY A;  5C3E J;  1VF9 A;  3RKQ A;  2PMZ N;  3HBL A;  4FE7 A;  1W0U A;  2O9L A;  2CQQ A;  1IDY A;  4A3J J;  2XSD C;  2E2H J;  2M0C A; 
#chains in the Genus database with same CATH topology
 1ZG3 A;  1SFE A;  3DCF A;  2CFX A;  2HXI A;  1QO0 D;  1I3A A;  2VQL A;  3CF2 A;  4RGS A;  3S93 A;  5EDN A;  2HQ5 A;  2NAZ A;  3BJA A;  5L3G A;  2R5Y B;  2FJ1 A;  4L18 B;  4YEJ A;  2JA8 J;  2R93 J;  1WQ2 A;  4YEL A;  2MC4 A;  2M7A A;  4E4H A;  3HIF A;  1XTA A;  2CH0 A;  2NVQ J;  1SD6 A;  1YW7 A;  2X6Y A;  2QUF A;  2BHY A;  3KE2 A;  3LFU A;  4RB2 C;  2MC3 A;  2WA0 A;  3D0S A;  1J75 A;  2W57 A;  3VFZ A;  2AQE A;  5FKN A;  1FEX A;  4TV7 A;  1IF1 A;  5J8F A;  2PG4 A;  3AG3 H;  3CES A;  2Q8K A;  3S3N A;  1QZE A;  2LOO A;  1HBX G;  2FQ4 A;  1W4M A;  5IYC J;  3T0Y A;  2QF7 A;  3HOS A;  3HTU A;  5FRM A;  2IA0 A;  3TO7 A;  3CMM A;  3HKZ N;  1UG0 A;  3JRI A;  3S1N J;  1ZGW A;  5DM6 F;  3V7C A;  4E7I A;  1WJD A;  1FSH A;  1E3H A;  2B7E A;  2MAB A;  3GVA A;  3TED A;  2Y9Y A;  2ME0 A;  2ZB9 A;  3ZQF A;  1ZQ3 P;  4OIP F;  2VQC A;  4FIS A;  3HYI A;  3IAM 2;  3CF5 F;  3GXO A;  5DD8 A;  1VQL I;  2R5Y A;  3SFI A;  3MN2 A;  4O5V A;  5ICG A;  3V8J A;  2E34 A;  3JRA A;  4LG0 B;  1SMT A;  1W5S A;  1WSU A;  3DBR B;  3K1M A;  1PUF A;  3HHG A;  1HCR A;  4G7O F;  3OMY A;  3EYI A;  4OMY A;  2QQ8 A;  2Q1Z B;  1XN7 A;  4P1W A;  2AO9 A;  1HKQ A;  1MMD A;  3ZN1 A;  2JZY A;  3WGH A;  3I9V 2;  4EM0 B;  1QZY A;  4GYI A;  3ERE D;  3NAR A;  3H92 A;  3KP5 A;  2D2W A;  3MWM A;  1NK2 P;  1J5Y A;  1T98 A;  2FEZ A;  3DXJ F;  1IW7 F;  2R7F A;  3FMS A;  2H94 A;  5DYM A;  4HQM A;  3GWZ A;  2UWM A;  2BOL A;  3ZRG A;  3DPT A;  2M4G A;  3I3L A;  1YTY A;  3GCM A;  1IUY A;  1ZHF A;  5DM7 F;  2VE9 A;  1WWX A;  4F55 A;  3PIO F;  3ZQC A;  1MDM A;  3HSE A;  5LHH A;  3TOB A;  2JSP A;  3H5A A;  5KNL A;  4LFU A;  3IL2 A;  1SVO A;  2BXZ A;  1SC7 A;  1VQ6 I;  2GXB A;  1O7L A;  3HJE A;  1YO5 C;  2ZCW A;  3LQR A;  3OWT A;  4L9V A;  2RRE A;  4ABZ A;  4JBA A;  2DI3 A;  5D5X B;  3E5X A;  3BCB A;  3FHZ A;  2E1C A;  4Y3O A;  3ISP A;  3ZMZ A;  2LR8 A;  4MHG A;  4XRS A;  5K5Q A;  4PCQ A;  1IXR C;  5FJ8 J;  5HLH A;  4E7K A;  2OZ6 A;  2EIM H;  2HOA A;  3F23 A;  1ETO A;  3HSR A;  3A03 A;  4JYK A;  1FSE A;  2CW7 A;  2XHK A;  1R1V A;  3DKW A;  3BTL A;  4OMZ A;  3KX2 A;  4ESB A;  4I01 A;  1LE8 B;  2ZKZ A;  3OR1 C;  4NNJ A;  2V1U A;  2F4I A;  2FBH A;  3QPS A;  1BC8 C;  1BOA A;  5J40 A;  4ZDO A;  3HGG A;  3ERM A;  3WTU C;  3RSN A;  5JVG F;  2VBW A;  3RCO A;  1ZLJ A;  2W48 A;  4GGG A;  3GTJ J;  5J6X A;  2EA4 A;  2BV6 A;  4AVZ A;  3VEP A;  1IAW A;  3I4P A;  4FX0 A;  3PSI A;  5B66 C;  5FLV A;  3BTI A;  3ABL H;  5F0C A;  3QQA A;  2QWW A;  3GME A;  2VON A;  3GYH X;  1O4X A;  2HQN A;  3EUH C;  1QVT A;  5B1B H;  2XF5 A;  2KIQ A;  1IV8 A;  5DV5 A;  3WU2 C;  5M3F J;  4YFK F;  1FZP B;  1D8K A;  4ZC3 A;  3GX4 X;  1D1A A;  3T1B A;  1FC3 A;  2O8K A;  4XK4 A;  4HST A;  3ZMS A;  3TMO A;  4C3I J;  1K7A A;  2BGC A;  3H5N A;  3ZOB A;  2GWR A;  3IKT A;  4QPO A;  1V55 H;  2EZH A;  2EA2 A;  3HOU J;  4KJZ A;  3I4N J;  1ZLK A;  4HLY A;  3PO3 J;  1LJ9 A;  2EB7 A;  2MH2 A;  1HKS A;  2DMQ A;  1OQY A;  2ZFW A;  3C18 A;  3SQN A;  1XSV A;  2X6W A;  4MFD A;  1B8I A;  1FOK A;  2BXY A;  2FQ3 A;  2LC2 A;  2KJB A;  1RR8 C;  5H6R A;  1V5E A;  2ESN A;  2VB6 A;  4EV0 A;  2LG4 A;  4ASN A;  4A69 C;  2ZJ2 A;  4HF0 A;  3TOA A;  2OAZ A;  4EJO A;  3G1M A;  5J8C A;  3BPX A;  1APL C;  2DA6 A;  2CV1 A;  4MEX F;  1EH6 A;  1ZGA A;  4Q47 A;  3I4M J;  1P4X A;  1WHU A;  4D7M A;  2H6C A;  2COM A;  2DT5 A;  1E3P A;  2HI3 A;  2NYX A;  2MA3 A;  4MIM A;  4P9U A;  5IP7 J;  3QU6 A;  1POG A;  3ZMT A;  1Z05 A;  1UZC A;  1XS9 A;  2P81 A;  5FFZ A;  3AAF A;  3JRH A;  2XF6 A;  3DTE A;  1QZZ A;  2HVS A;  3HOX J;  1KU7 A;  1WRJ A;  4HOB A;  3WTV C;  5GTI C;  1BA5 A;  1MSF C;  3VYS B;  4IVN A;  4NQW B;  3MAJ A;  2RNJ A;  2BVM A;  5J47 A;  2DPD A;  1R23 A;  4AYB A;  2EFW A;  5ERI A;  3VSL A;  2M45 A;  3PUB A;  4DZP A;  2XSJ C;  1SFU A;  1S5L C;  2WAE A;  2DPU A;  4M9S A;  2KIF A;  1BM9 A;  3DF8 A;  3F0C A;  2ISZ A;  1YS6 A;  4KN7 X;  3OYJ A;  1W5T A;  4JQF A;  1YIO A;  4EMS A;  3HDD A;  3WGG A;  4CGZ A;  3CTA A;  4B44 A;  3EET A;  3TL4 X;  5HLI A;  4BEH B;  1PVE A;  4II2 A;  1SD5 A;  3CCL I;  1Y8R B;  5KCM A;  1FT9 A;  3LFK A;  5KAF C;  1X58 A;  3PQK A;  2PJP A;  3RDI A;  2HS5 A;  3NEU A;  5J4Y A;  3IHU A;  3CDI A;  2EV6 A;  2VAS A;  1LNW A;  3F8C A;  4D7N A;  2EQR A;  2OU2 A;  3COA C;  5M3M J;  3JTG A;  2RC4 A;  1K6Y A;  2QBY B;  5DEQ A;  3F8F A;  2QQA A;  3K4M A;  4CCN A;  2JA7 J;  1TQM A;  2MH9 A;  2EK5 A;  2RN7 A;  1D0Y A;  3G1O A;  3ZXS A;  2BY1 A;  1IDZ A;  1Q1H A;  3RI4 A;  3WU1 B;  2WB1 N;  3TW6 A;  2KDO A;  2IW5 A;  2KRC A;  5B3S H;  4RAZ A;  4PJ0 C;  2NVU B;  2F4M B;  1IJW C;  2DMP A;  2XKO A;  2WV1 A;  4HNV A;  2Y31 A;  3MVP A;  2KP6 A;  3OYL A;  3S2W A;  4N0B A;  1EV7 A;  5CQG A;  2IS6 A;  4CCM A;  9ANT A;  4B1R A;  3F8B A;  3OYF A;  5AIP A;  1KA8 A;  5KVR A;  4E7J A;  2ME6 A;  3A1Y A;  2R7R A;  5H2F C;  2VKE A;  1H9T A;  1WJA A;  2R7X A;  1FTZ A;  4I99 C;  4B47 A;  3K2A A;  2CU7 A;  2M3A A;  4FHT A;  4LLG F;  1FMW A;  2VOD A;  3FXL A;  3FXM A;  2L2O A;  2V7F A;  4F92 B;  4PDK A;  3S1M J;  2XPU A;  4RMN A;  4A5N A;  2P8T A;  3I0T A;  1TQP A;  4ENN A;  1OCR H;  2VC0 A;  5JHU A;  3A01 A;  3T8T A;  3AFH A;  2A05 A;  2ISY A;  2QA4 I;  1VQ4 I;  2Y75 A;  1MMG A;  1BR1 A;  4ITV A;  4FT8 A;  4BBS J;  1X1C A;  3ZCO A;  1MBJ A;  4UUS B;  1YHQ I;  3I71 A;  4N9H A;  2DA2 A;  2E2J J;  1YRN A;  2OA4 A;  1ZN2 A;  3QOD A;  2LD5 A;  2HYG D;  1AA7 A;  3G73 A;  2P7C B;  4MNU A;  1ZRE A;  2PJR B;  2ZXI A;  2DFH A;  3MFK A;  2KLO A;  2PFB A;  3CJN A;  2H6B A;  1R7J A;  1AKH A;  4ZYG A;  1FP1 D;  5CPR B;  1IN8 A;  4CZZ A;  4WWC A;  3BY6 A;  4QLC U;  4PSX A;  3DP7 A;  4F7Z A;  4F93 B;  5IP6 A;  2XAS A;  1STZ A;  3L2V A;  4DNC A;  2Y0S N;  1K78 A;  4BH9 A;  3IH4 A;  1LQ1 A;  5D5V B;  3L2Q A;  3K4C A;  3OYD A;  5M5X J;  4G8X A;  2CUE A;  5HOO A;  1F5T A;  5IT9 Z;  4I6Z A;  4A0X A;  1VZ0 A;  4I02 A;  3MQ0 A;  3RKY A;  4LJZ F;  3TP3 A;  1AWC A;  3E0J B;  2O7O A;  1K4S A;  1HA8 A;  2O5R A;  3DEE A;  3JCU C;  4U7D A;  3KLN A;  1G3T A;  1USS A;  4AID A;  3K70 C;  3DKY A;  1MW7 A;  2CW8 A;  3VYT B;  2O61 A;  2L7F P;  4UVB A;  3GZN B;  1XX5 A;  2LY1 A;  2ZXW H;  4IHS A;  1J9I A;  2Z5U A;  2WB1 A;  3A4C A;  5AON A;  4HEA 2;  1FYL A;  3H1C A;  1DGW Y;  4AU7 A;  1WCM J;  2F4O B;  2TDX A;  5GTH C;  1IRX A;  4JX5 A;  2P5K A;  3CUQ A;  3I5U A;  2V4J C;  1SEU A;  4YFX F;  2W84 A;  2XIG A;  2ETH A;  2R3S A;  4HBL A;  4M3F A;  5ICF A;  2KFD A;  2XRO A;  5CLS A;  1I6H J;  2VN2 A;  2HR3 A;  1D5Y A;  3HKZ A;  3BR0 A;  4HNT A;  3D1N I;  4BYY A;  4H0E A;  3KEQ A;  4ENK A;  2NVT J;  3Q0U A;  3LSR A;  1P2F A;  3CO7 C;  1MJ9 A;  4HPQ A;  2CUF A;  3LNQ A;  4ESJ A;  1PUF B;  3IUO A;  4RM2 A;  1V54 H;  2IPQ X;  3Q9V A;  2NS7 A;  4CZC A;  1VQO I;  4XL9 A;  4PFP A;  1YQA A;  4QTR A;  3OYB A;  2HEO A;  4L0Z B;  1X4O A;  3NWS A;  3TBI A;  4FET A;  3MZ8 A;  5EZH A;  2CSO A;  3F6V A;  3CCY A;  3QP6 A;  6PAX A;  3ABU A;  3GEZ A;  5GAE J;  1VF9 A;  4UV9 A;  3OYA A;  2W25 A;  4E7S A;  1W0U A;  4OAZ A;  4M72 A;  2VBY A;  2P4W A;  2E2H J;  3E97 A;  4IOC F;  2V79 A;  1Y0N A;  3WTZ A;  3CZ6 A;  1ZRF A;  1XMX A;  4BXX J;  3MZH A;  1UHM A;  3BRO A;  3QAH A;  4CO8 A;  1R5H A;  4UHT A;  2Z33 A;  2VXZ A;  4XN3 A;  3V42 A;  2X1E A;  3N05 A;  3IRR A;  1ETY A;  4OU0 A;  2FE3 A;  3H5R A;  4BXU A;  2WAQ A;  2P6T A;  2OTL I;  3RJP A;  5D4R A;  1SVL A;  4XR6 A;  2M2E A;  2OBP A;  1G59 A;  4EJV A;  1B72 B;  3EUA A;  3I53 A;  3GUD A;  4IO9 F;  1BIA A;  1VND A;  2Q0O A;  1HKT A;  1OFC X;  3Q5F A;  4Z6Y A;  3CCE I;  4YG2 F;  3FK7 A;  2ESH A;  2L01 A;  5C4J J;  2VLA A;  2LKS A;  3JAM K;  4OIR F;  4KIG A;  1SFO J;  1TP4 A;  4N9I A;  2MD0 A;  1REP C;  4PJN A;  3W6V A;  1OYY A;  3SYT A;  4A3E J;  3FZV A;  5J3L A;  5CYV A;  1ZR2 A;  1MD0 A;  3F8M A;  1I5Z A;  1IC8 A;  1X1D A;  5J1R A;  5EG0 A;  3KEY A;  2DK8 A;  5LBQ A;  1A5J A;  4OAY A;  2NVX J;  1MGT A;  1HXD A;  2PMU A;  2IVM A;  1GT0 C;  1U0J A;  2M87 A;  4I7H A;  1TWH J;  2IS1 A;  5IOY A;  2M8E A;  2GLO A;  3S15 J;  1T8I A;  4GFB A;  2GBY A;  3UKG A;  2IEK A;  3FXO A;  2EZI A;  4EJT A;  3W3C A;  3RZO J;  2CFO A;  1E2X A;  2RAE A;  1XGM A;  1Z91 A;  5DCF A;  2DJI A;  1G8X A;  4BUP A;  2CV0 A;  5LEK A;  2V9K A;  3NWT A;  4GCV A;  2O8X A;  2A07 F;  1UEL B;  1YG2 A;  1Z77 A;  1CQT A;  4A6D A;  2CO5 A;  4IPA A;  2ADU A;  2HVR A;  2F6C A;  3J7Y J;  1ETK A;  4XSZ F;  2M34 A;  1YYV A;  4XRS G;  2GXG A;  1ZYR F;  1AOY A;  4L9J A;  1YJW I;  2WBM A;  1HLV A;  1ODD A;  4Y17 A;  3BQY A;  2R7W A;  2M7B A;  2OC6 A;  4HNU A;  4PUS A;  1FOX A;  2K9S A;  1TT0 A;  1BI0 A;  3QYF A;  2NNN A;  3C3W A;  3O8H A;  1WZ2 A;  5EF6 A;  5F64 A;  3E6D A;  2JJ7 A;  5EGO B;  2AXT C;  3OSF A;  1K83 J;  3EUK L;  5J4V A;  2HWV A;  2JA6 J;  3E5U A;  3I64 A;  3E6M A;  4XQF A;  1N25 A;  1YW8 A;  3OIQ A;  3GLX A;  4IXA A;  4PSW A;  3CMY A;  2C6Y A;  5E1X A;  4MEY F;  1K6O A;  1JJ6 C;  3JRD A;  4DW6 A;  2DN0 A;  1V3F A;  4CUG A;  1RIO H;  2LBF A;  3GFJ A;  3HUG B;  1ERD A;  5F08 A;  2DA7 A;  1NG6 A;  2YX7 A;  3KFW X;  4G94 A;  5FGM A;  1DU6 A;  2K85 A;  2LFB A;  3CQZ J;  4I76 A;  2KIU A;  2ZO4 A;  4B09 A;  3WTT C;  3HPG A;  5TGT A;  5FD6 A;  4EM1 A;  2IA1 A;  3QYB A;  2KHM A;  1IZ1 A;  4MTE A;  1U5T A;  2FOK A;  1SD7 A;  2EIJ H;  5IY5 H;  3FF5 A;  1P6R A;  1X3W B;  3FK6 A;  3Q0V A;  5BMZ A;  4LGW A;  2KT0 A;  2Y0M A;  1EA3 A;  4D0P A;  5H20 A;  1QU3 A;  2KIS A;  5BQT A;  2WY7 Q;  3BG5 A;  2IXS A;  3S3M A;  3DPU A;  3TGN A;  4ESF A;  3BTC A;  1YRN B;  3R0A A;  3LA3 A;  1X1P A;  3CJR B;  2CQX A;  3IH2 A;  3WGI A;  4CSW A;  4UV8 A;  1I27 A;  5HS7 A;  2H09 A;  2UUZ A;  2XGX A;  4D9J A;  1OR7 C;  4HQE A;  4BS9 A;  1PDN C;  4KIS A;  3D5L A;  2EIL H;  5LRR A;  4IJA A;  4L5J A;  4RB1 A;  2W82 A;  4KIB A;  1MMS A;  3L2U A;  4GDF A;  1PUE E;  1KU9 A;  4RS8 A;  4DOZ A;  2LP0 A;  2TCT A;  1P7J A;  2AQF A;  4R8H A;  3KPH A;  3CUO A;  3H9G A;  3QP5 A;  5L3E A;  1U8B A;  1UJ8 A;  5K5R A;  2H8R A;  1YLF A;  2OV7 A;  3MKL A;  1ON2 A;  1TBX A;  3OYN A;  4S04 A;  4UY8 I;  5HS9 A;  2VKV A;  5A2Q K;  5E79 C;  3GTL J;  2OTJ I;  4A3I J;  2FNP A;  4A0Y A;  2G9W A;  3LA2 A;  3V8L A;  4CIC A;  1F36 A;  2HTS A;  4PFO A;  2W7N A;  2DA4 A;  2XV4 S;  4CHU A;  1HST A;  2K4B A;  1FOY A;  4HA8 A;  3E3V A;  4E7H A;  2ELH A;  3IWZ A;  1EJ9 A;  3CP2 A;  1MND A;  4FTH A;  5CVR A;  1XD7 A;  3L7W A;  3MZY A;  1BI3 A;  2HKX A;  2JT1 A;  4BQO A;  2XGD A;  2EFQ A;  2UXX A;  4L5E A;  2L9R A;  2EV5 A;  4XRM A;  1QPI A;  2R7Z J;  3FBI B;  2M30 A;  3ZQ7 A;  2WWY A;  4AM3 A;  3PL8 A;  1W36 D;  2OCE A;  3KYC B;  4U88 A;  1MMA A;  4NUB A;  3JW4 A;  2FBK A;  1IRG A;  2JN6 A;  1MNE A;  1LB2 A;  3BR2 A;  4BDY A;  5K1Y A;  4V2G A;  3EDP A;  2JVH A;  2QSH X;  4XLN F;  2E2I J;  2LF8 A;  4B48 A;  3HOT A;  2XRL A;  4KIF A;  5IPA A;  4UUT A;  3JR9 A;  4A3B J;  2YX4 A;  5CVI A;  3FHN A;  2H1L A;  1LEA A;  1N77 A;  3ABK H;  5GAG J;  3M8F A;  2YSR A;  1BI2 A;  3U2R A;  3L2W A;  2ZNY A;  1S29 A;  5IOZ A;  4C3J J;  3C7J A;  5HNF A;  2NOG A;  2XGC A;  3SZG A;  3OIP A;  2STT A;  2LY2 A;  1EH8 A;  3MMY B;  3DU6 A;  2GQQ A;  1I1G A;  1T95 A;  4C2M J;  3J81 Z;  2MFZ A;  2DMT A;  4UVA A;  1JUM A;  3BR5 A;  3T8R A;  3CLQ A;  5D5U B;  4XMY A;  2CS3 A;  3R61 A;  1ON1 A;  5HNH A;  1VFC A;  5DDG A;  2NS8 A;  3ASO H;  2B63 J;  1NHA A;  2TRT A;  2N8G A;  3C2B A;  4A3D J;  3WE3 A;  1WI3 A;  1T38 A;  1OLT A;  3HRS A;  5F0F A;  1DP3 A;  4BQN A;  2YPR A;  3BG7 A;  1BJZ A;  2FUG 2;  1R5G A;  3PNY A;  5M5W J;  1XPX A;  1JT6 A;  1R00 A;  1RC9 A;  4XKC A;  2JMW A;  5EEG A;  2PI0 A;  1Q1V A;  3DLA A;  2JA5 J;  2R92 J;  3OY9 A;  3HC7 A;  1TZL A;  1R5I D;  2ZBK A;  1GV5 A;  4UVC A;  5HS8 A;  1JTY A;  1JUS A;  1VI0 A;  1VQ8 I;  2ZSI B;  1I39 A;  2G7H A;  5LGU A;  2OUM A;  3PM1 A;  1ZK8 A;  1MBE A;  4M9Z A;  3QWL A;  4BY1 J;  1U2W A;  5K7H A;  4G12 A;  4JX4 A;  3J80 K;  1Z67 A;  5FLX Z;  4RAG A;  1IGN A;  1TWG J;  4XRF A;  1J59 A;  3GTP J;  2L5Q A;  2RQQ A;  4P96 A;  4I2O A;  2IGO A;  1ENH A;  2LKX A;  1GVD A;  4DJA A;  3LSP A;  2L54 A;  4XOP A;  2R5Z B;  4NBQ A;  4XSX F;  4XOR A;  1YFH A;  1X1B A;  3JSP A;  1IXS B;  4MLO A;  3OYI A;  2F5D A;  3FM5 A;  5EEA A;  3QU3 A;  3FBN B;  5LEJ A;  1XB4 A;  2NXN B;  4G9Y A;  2WC2 A;  2L7Z A;  3O2P E;  2HXO A;  4DYC A;  1X4P A;  2X0L A;  5BNG A;  4HDV A;  1J7K A;  2VBX A;  4ZDL A;  2Q2E B;  4L0Y B;  1QA6 A;  2B0L A;  5DCM B;  1JT0 A;  4KA4 A;  4BJT A;  2BW3 A;  2K9M A;  3ZR8 X;  1JHH A;  2QLZ A;  1G4D A;  2VJ4 A;  3OR2 C;  5GAD J;  3Q0W A;  5J1Y A;  4B43 A;  4JP0 A;  1Y1W J;  4A3C J;  3HOV J;  4GO1 A;  3QPL A;  1AKH B;  3FDY A;  3BDD A;  4IRG A;  3I55 I;  1RR7 A;  1LVA A;  2JVG A;  1QQI A;  1LE8 A;  4UXN A;  5LD2 C;  2BYV E;  4M9X A;  2CW0 F;  1XMK A;  3LSM A;  3NQO A;  3KCC A;  3PFY A;  3CCR I;  3MCZ A;  3U1D A;  1FLI A;  1NG7 A;  2ZJP F;  3H0G J;  5BOX A;  1B9M A;  5E8I A;  3CO6 C;  2DJN A;  3M1E A;  2HDD A;  1VQ5 I;  1IRF A;  4HZF A;  3CCM I;  2QKM B;  4A3K J;  2OPT A;  1U5T C;  1MJB A;  2CQK A;  2NOJ B;  4O3M A;  3WE2 A;  3BOQ A;  2HOE A;  3S3O A;  3CD6 I;  2XUB A;  3BWG A;  1I50 J;  4G6D A;  1N78 A;  3BPV A;  2F48 A;  5HLT A;  4M3E A;  1LDK B;  1R36 A;  3VPR A;  2F2E A;  2PMH A;  1WH5 A;  4YIF A;  1B59 A;  2F5C A;  1FWZ A;  1S7A A;  3QPH A;  2MBF A;  4KT6 A;  4B3A A;  1RUN A;  1WJE A;  1Z3Y A;  3FXJ A;  2PJR A;  1VQ7 I;  5FRN A;  1R1U A;  3SDG A;  2DCE A;  2EFN A;  2LTP A;  4XOT A;  2L7K A;  3EUH A;  1OIS A;  1LFB A;  3P5J A;  1XDS A;  2VPR A;  3H9J A;  2KJC A;  4CXF A;  2KMU A;  3VOD A;  4IHV A;  4J19 A;  2JSC A;  5DS9 A;  3SHF A;  3N97 A;  1G3S A;  1RKT A;  1MBG A;  2OD5 A;  3CJT B;  2QZ8 A;  2H8W A;  2DW4 A;  3DV8 A;  2QM3 A;  2HKO A;  3H35 A;  1IO2 A;  2GA1 A;  5CVV A;  1Y1V J;  1KQ9 A;  5J1U A;  2LBF B;  2O0Y A;  3GTG J;  5ICC A;  4P5O A;  4CYC A;  1PP7 U;  1OYI A;  3ML6 A;  3CC4 I;  2RDP A;  5F1J A;  2FF4 A;  2BE5 F;  3JTH A;  2HDW A;  5KHD A;  2RNG A;  4EGZ A;  5C3E J;  2I8D A;  2HNH A;  3OYK A;  1PYV A;  2O9L A;  4XLE A;  1R71 A;  2F5V A;  2XAG A;  4WXC A;  2M0C A;  4J01 A;  3WTX C;  1YIT I;  4IKF A;  3PQJ A;  1ZG5 A;  1XGN A;  2HTJ A;  4EGY A;  1N75 A;  2IGN A;  3S1R J;  1QHG A;  1ZTR A;  4DGW B;  5FRO A;  2KPM A;  2P0W A;  5L3B A;  5JLW A;  4DBQ A;  4UNO A;  1PP8 F;  1HW2 A;  2Q2E A;  5DUK A;  1E0E A;  3ZP5 A;  2XAF A;  4FAS D;  1LFP A;  3LSG A;  1S8N A;  3M7G A;  4H4K C;  4BJ5 C;  5LFA A;  1ORK A;  3VSK A;  1K4T A;  2XF7 A;  3A2K A;  1B1B A;  4E7Z A;  2BY3 A;  2BZT A;  4LIT A;  5EEH A;  1SAN A;  3S1Q J;  1BC7 C;  2A61 A;  2QGU A;  1JE8 A;  1YJ9 I;  3FM3 A;  3IC7 A;  3FKJ A;  2EIN H;  1FP2 A;  3DPL C;  4HX8 A;  3TKY A;  2ZME B;  2OQG A;  4B4C A;  4FQG A;  1FBQ A;  2LMD A;  3RIR A;  3AG4 H;  2DMN A;  2IRF G;  2LNB A;  1DQU A;  1HW5 A;  4J00 A;  4PGG A;  4B8X A;  1JKR C;  3K10 A;  2IGK A;  3BZC A;  4HDU A;  4LOC A;  2L4M A;  3ABT A;  1S7O A;  2JRT A;  4L5I A;  1DU0 A;  3RYP A;  2IS4 A;  1H8A C;  1G3Y A;  4KNY A;  2CMP A;  5EG0 B;  2DYS H;  5HOD A;  5D8L B;  1TL8 A;  2E36 A;  4BHC A;  2K02 A;  3HOZ J;  2XAU A;  5ED4 A;  4A93 J;  4JX6 A;  5LGT A;  3OYG A;  3PNV A;  4FE4 A;  4EJW A;  4BHP A;  2ECC A;  4FCY A;  1GVJ A;  2FRH A;  3AKZ A;  4RAY A;  2W4S A;  3JRG A;  2EWN A;  2E1N A;  2MD5 A;  3R4K A;  4XID A;  4KFC A;  4RLF A;  4HSR A;  1OJL A;  2EIK H;  3OYC A;  2E19 A;  3C2G A;  3HGY A;  1LPQ A;  1B72 A;  1W0T A;  2AHQ A;  4P9F A;  1YS7 A;  3DTI A;  4KIC A;  1JGS A;  1J0R A;  2QVO A;  4DIQ A;  1ETW A;  4HF1 A;  2DO7 A;  4Y13 A;  1GV2 A;  5ICE A;  1H88 C;  1D1B A;  2E1O A;  4IF4 A;  5F6F A;  2K40 A;  2HZD A;  2VOO A;  2LF7 A;  5B1A H;  2EH3 A;  4WXD A;  1JKP C;  2DDA A;  2DYR H;  1ONV A;  2VE8 A;  1D8J A;  2DFE A;  3LAP A;  1TLH B;  4KT5 C;  4C3H J;  1UB9 A;  2A69 F;  3D5R C;  2DTZ A;  4CCL A;  1OPC A;  2K3P A;  2NS0 A;  2VKD A;  3ELK A;  4BDZ A;  1G2H A;  2K3F A;  1AU7 A;  3CUQ C;  2NNY A;  2R7S A;  1S3J A;  2XB0 X;  5CQE A;  2DOD A;  4Y15 A;  4E6K G;  1D1C A;  2X4H A;  4KN4 X;  1OCP A;  1HF0 A;  2K9N A;  1F43 A;  3RQ4 A;  4CYC B;  2V9P A;  5LGN A;  5F1R A;  1KON A;  4KIT B;  1SVM A;  1JI8 A;  2CRG A;  3SZT A;  4MGR A;  1L3L A;  3IWF A;  1TWA J;  3CMA I;  2VIX A;  1B9N A;  5F0H A;  2HU9 A;  5K7Z A;  1ETX A;  1LDJ A;  2IS2 A;  2W1O A;  3KZZ A;  2GOX B;  4DQ2 A;  3W2A A;  5FD5 A;  4LG0 A;  5LRS A;  3ZQG A;  5FB2 A;  3E5Q A;  3L9F A;  3LAJ A;  3C2H A;  4I09 A;  2KDZ A;  1ZH5 A;  3GFL A;  1B4A A;  4ZTJ A;  3P9C A;  5D6E A;  1C0W A;  2MLK A;  3ZQH A;  3WTS C;  2PLY A;  2VJI A;  3C1D A;  1I1S A;  1JTX A;  3BJO A;  3ZQL A;  3CCJ I;  1F9N A;  3AL0 C;  4LD5 A;  3REO A;  2GIV A;  3KZY A;  5E3O A;  3L09 A;  3CDL A;  2QQB A;  3L1P A;  1IN5 A;  1OCC H;  1H9G A;  5BPD A;  2G0E A;  5FKM A;  1UHS A;  1WKM A;  2BW3 B;  1R4M B;  2LK2 A;  4IX7 A;  1WH7 A;  3V8K A;  4V19 K;  4OOI A;  2DA5 A;  3OL4 A;  5AIQ A;  3OS2 A;  4BE1 A;  1R6R A;  2PQ8 A;  2WY8 Q;  5E20 A;  3G2B A;  3TQN A;  5TRD A;  4B3X A;  4UB8 C;  3ULQ B;  1F4K A;  1TT5 B;  1H89 C;  3LMM A;  3LSH A;  2IA2 A;  3OYH A;  1TWF J;  3TDU C;  1YE9 A;  1IN4 A;  4M3B A;  2UXN A;  2QKL B;  1EF4 A;  2DMU A;  4JK1 X;  3H3V K;  5JR3 A;  3E6C C;  1RKW A;  2YU3 A;  3HHH A;  2A6T A;  2OZU A;  1RES A;  3ZQQ A;  1Y0U A;  4N4N B;  3WHC A;  1QNT A;  1MDM B;  2VJJ A;  4NC7 A;  3E7L A;  5JLX A;  5E17 F;  3WOD F;  3WG9 A;  4UUV A;  2A5Y B;  2GA2 A;  2KQR A;  2CYY A;  1T0F A;  3LA7 A;  2NRA C;  4IQ4 A;  3CLO A;  2RVC A;  2MW8 A;  3UNG C;  2Y30 A;  1Z0X A;  2DTR A;  2M4K A;  4EJU A;  2E5N A;  2JA2 A;  3DU5 A;  3RPU D;  1S6L A;  2VT2 A;  1LUJ B;  4CH7 A;  2VKH A;  2HDC A;  1TNS A;  4G6Q A;  2FMY A;  1Z21 A;  3ROU A;  2DDB A;  3TO9 A;  2LH9 A;  2FU4 A;  3HZJ A;  3SJM A;  5E3N A;  3W6J B;  3GW2 A;  4I0B A;  5E3L A;  3HPH A;  5HLG A;  2JUG A;  2M8G X;  4L9T A;  2MLG A;  1W1W E;  2JPC A;  2XRN A;  4PK4 A;  5BPI A;  1BL0 A;  2VT3 A;  3BG6 A;  5JVT A;  2X1D A;  1V5G A;  4CCO A;  4IRH A;  5FKK A;  5D5W B;  5B5E C;  4ZZL A;  2WAF A;  3VWB A;  3U9G A;  4E7L A;  1DP7 P;  2DOF A;  3I58 A;  1YJN I;  2E7X A;  5F27 A;  2V1D A;  3CCU I;  3GZ6 A;  1O3R A;  3ZMV A;  3DQV C;  4WX9 A;  2GAU A;  2YS9 A;  4RGR A;  1TNT A;  2HYJ A;  4ZTF A;  4BL0 B;  2YUS A;  4G7Z F;  5EYR A;  1FTT A;  3G4S I;  2ELJ A;  4XM3 A;  5F04 A;  3J81 K;  2X9D A;  5JFR A;  1MBH A;  3IH3 A;  2ZNZ A;  4X0G A;  4A12 A;  4BU2 A;  1HSJ A;  4BQQ A;  3OL3 A;  1GLN A;  3CME I;  3DLL F;  1H0M A;  4LIU A;  2Y48 A;  4ANJ A;  1R49 A;  2ZSH B;  3IRQ A;  3K4J A;  2Y2Z A;  4LB6 B;  1Z6R A;  1WJC A;  1ETQ A;  3LSK A;  1XG1 A;  4U87 A;  4IHT A;  4XLF A;  3SFZ A;  1W5C C;  3HL2 A;  2HVQ A;  5CJ9 A;  2STW A;  4N4O B;  2DXI A;  4GRI A;  3PIP F;  3MKZ A;  1SD4 A;  2J5P A;  3P7N A;  3AG2 H;  4Q48 A;  3ECH A;  3SZP A;  5CVJ A;  3M9A A;  1K79 A;  2VC1 A;  1U9N A;  3BC8 A;  4XKV A;  4A5M A;  4CCJ A;  1EKE A;  2L7M P;  3F3X A;  3G6E I;  1JKO C;  5DD4 A;  3BT9 A;  3JRE A;  3QRF F;  4LIV A;  2EJR A;  1FOW A;  1HW1 A;  2DT7 B;  1D5V A;  2Z99 A;  4PJM A;  4NC6 A;  1SFK A;  2DOE A;  2Z3Y A;  1XCB A;  5HDN A;  1XCV A;  1R1T A;  1GHC A;  3CCQ I;  3V7R A;  3NAU A;  2XKP A;  4C2T A;  1NH3 A;  3OSG A;  3K1N A;  4M3D A;  4DZJ A;  3KP3 A;  1MBK A;  1Y56 A;  3MKW B;  2YR2 A;  1P7I A;  2E5Z A;  2OCC H;  4AD9 A;  1ZKG A;  2ID3 A;  4NHJ A;  2X51 A;  3IAS 2;  4YRV A;  4F52 A;  4R79 A;  3GO5 A;  2FBI A;  2JTV A;  4WXH A;  3HSF A;  5L3F A;  4ZYA A;  1BN5 A;  1Z9C A;  4PGH A;  3WHB A;  3LQQ A;  5D4S A;  2L3D A;  3S32 A;  1MJA A;  1S7E A;  2ZJQ F;  4BAY A;  4L9N A;  4M3G A;  1ITY A;  2HQR A;  3DEW A;  2DU9 A;  2HZT A;  3X2Q H;  1YI2 I;  1UST A;  1ZAR A;  3A02 A;  3S17 J;  3HEF A;  1OCT C;  1P9Q C;  1Z6T A;  2FOW A;  3KP4 A;  2IBD A;  4HW0 A;  3ZQI A;  2ZFU A;  1O57 A;  3L2C A;  2FSW A;  1O3T A;  1QHH D;  1FNN A;  3PJR A;  4RM3 A;  3GTK J;  2D1V A;  4XNF A;  2KRF A;  4BNC A;  1Z1D A;  4BAC A;  1E3O C;  1CF7 B;  3CC2 I;  2XVC A;  1SFX A;  4M71 A;  2VQG A;  4RAF A;  1MMN A;  2CG4 A;  2VPL A;  1KGS A;  3LOC A;  4KMF A;  1UMQ A;  3TO6 A;  1HC8 A;  4XON A;  2A5W A;  1BOB A;  2RQP A;  3RTR A;  4LK0 F;  4XN0 A;  4HYE A;  3K69 A;  3H36 A;  1I6X A;  5E18 F;  2M1B A;  4EEF G;  1MH3 A;  2R7D A;  4KYW A;  2E7W A;  4YIR X;  2ZXJ A;  1JGG A;  2WV0 A;  1BW5 A;  2DFI A;  5FFX A;  5K5O A;  3S16 J;  3MD2 A;  2KKO A;  5ILU A;  4ZYH A;  3B6C A;  3MEX A;  2Y0S A;  3CC7 I;  4K2E A;  2HGC A;  3KLO A;  3Q9S A;  4MQV A;  3F8N A;  1VQ9 I;  5GPA A;  5GAH J;  3QYE A;  5ILV A;  3ZN0 A;  1QVU A;  4EVI A;  2Y69 H;  1VQM I;  2FA5 A;  4NDL A;  4W1U A;  1IG7 A;  1BJA A;  2RKH A;  1RUO A;  2B9S A;  3J7Z I;  3RQI A;  2HOS A;  4D5F A;  2E1M C;  3BG9 A;  3MKY B;  2HYF A;  3EQL F;  5FKL A;  1FIA A;  1KU3 A;  2XAH A;  1P92 A;  2JK3 A;  2K7L A;  3G3Z A;  3HUG A;  3DFG A;  3HRM A;  4A6E A;  4XKW A;  2D5V A;  1J2X A;  2CQN A;  2RV8 A;  1SMY F;  2XC7 A;  2FNA A;  2BEO A;  3HB9 A;  2K9L A;  3OYE A;  4U7B A;  4YII A;  3GTQ J;  3KP6 A;  2L9N A;  3GLL A;  1A04 A;  3FXQ A;  5DCM A;  2PMZ N;  3HBL A;  3GFM A;  4BGD A;  2CUZ A;  5HDG A;  2EV0 A;  3KET A;  2CQQ A;  5ILS A;  1IDY A;  4A3J J;  2DOA A;  2RGV A;  5LHG A;  3BZK A;  4GXO A;  1RI7 A;  2LRE A;  3R0J A;  1LDD A;  1W7P A;  2GM4 A;  3KP2 A;  1IN6 A;  1JHF A;  2E71 A;  1OYW A;  4HX4 A;  2MGQ A;  2PX9 A;  2ZME A;  1QGP A;  3NRV A;  1Z7L A;  3SEQ A;  5A2Q Z;  3HG9 A;  2OF7 A;  3FKI J;  3ONQ A;  1GDT A;  4U0W A;  4HF2 A;  5E3M A;  2UV1 A;  4LB5 A;  1Y39 A;  5E1Z B;  3B02 A;  5HVQ C;  2R7V A;  4DBR A;  2HOT A;  2VBZ A;  4C30 A;  2VOP A;  2XDV A;  1DPU A;  2KRH A;  1D0Z A;  1SAU A;  1TW2 A;  2ZJR F;  1G3W A;  3I56 I;  4PJL A;  1XMA A;  3FMR A;  2XAJ A;  4AYB N;  1TQI A;  4BKX A;  3HOW J;  2H1K A;  2PEX A;  4HV6 A;  5M5Y J;  1D0X A;  1L0O C;  1Y6I A;  1XDU A;  2EZK A;  2QQ9 A;  1Z3X A;  4F91 B;  4GYG A;  1MZB A;  2XPW A;  3WTW C;  1S9H A;  2K27 A;  5IP9 J;  1MBF A;  1W7P B;  1IUF A;  1JXS A;  2O03 A;  3UR3 C;  1VTN C;  4U0Y A;  2W85 A;  4RDU A;  2MYS A;  2O3F A;  2COB A;  4CYD A;  2VI6 A;  1UCR A;  3A0H C;  1KU2 A;  2K5C A;  4Z2Y A;  4LLL A;  4JOM A;  3N4M A;  2FML A;  5KK1 A;  2R4G A;  5D6F A;  2X6O A;  5L3D A;  3IKV A;  1U6G A;  4RBO A;  1RRJ A;  1BIB A;  1MNM C;  1UAA A;  5IT3 A;  3BZ6 A;  2A68 F;  2ICW G;  2K86 A;  2NVY J;  2F5F A;  3BR1 A;  3CJQ B;  3GF2 A;  3LST A;  2CGP A;  1T6S A;  2W24 A;  4R1H A;  2PMZ A;  4Y33 A;  1A6Q A;  1LVK A;  5BS6 A;  2YU9 J;  1KYW A;  5IYB J;  2DT6 A;  4LLN A;  3OS0 A;  1U9O A;  1T56 A;  4EQQ A;  2X85 A;  5LLQ A;  2BVL A;  2LSO A;  4PZJ A;  1AHD P;  1BR2 A;  2LKP A;  5JI6 A;  3AG1 H;  3FXR A;  1TW3 A;  1X1A A;  2WTE A;  3JAM Z;  4U0V A;  2R7O A;  3RPU A;  4LK1 F;  4A3M J;  2L02 A;  1ZR4 A;  5GP9 A;  2BBY A;  4A3G J;  4QSH A;  3FMQ A;  3D5S C;  3K0L A;  2OJE D;  4E70 A;  2ECB A;  1A36 A;  1HDP A;  1OMI A;  3I54 A;  3QOP A;  3FXU A;  3S2H J;  3FIW A;  4HG2 A;  2ZME C;  4RB0 A;  3A0B C;  1MKM A;  2DFF A;  4PJJ A;  1ZG1 A;  4Q5S F;  4NB5 A;  4QWQ A;  1LEB A;  4HLX A;  3H9Q A;  3GTM J;  2J5O A;  2MSY A;  4RGX A;  2V1X A;  3E6B A;  4M74 A;  3R6S A;  1YX3 A;  3F9K A;  4ZZD A;  3GTO J;  1HQC A;  2H27 A;  2Z1D A;  3WU0 A;  4ZJZ A;  3BR6 A;  2BY0 A;  3I59 A;  1O7F A;  1JJ8 C;  1DGR M;  2LYC A;  2XB5 A;  1M1E B;  4ETS A;  2ID6 A;  4LG3 A;  1Y8Q B;  3TP0 A;  4M6V A;  3H3U A;  4NQW A;  2XGE A;  2FD5 A;  4ENM A;  2I5U A;  3ECO A;  1XGO A;  3CP8 A;  2VQH A;  2AS5 F;  1QPM A;  3BJ6 A;  1ETV A;  4A2U A;  1GXP A;  4M6Y A;  2X6X A;  3HOY J;  3LSJ A;  1RET A;  2JWT A;  3DBH B;  3ESW B;  2VJ5 A;  3R60 A;  3JRC A;  5K7F A;  1FMV A;  3V7S A;  2G7U A;  4A3L J;  2M5W A;  2R7Q A;  2HQA A;  2V26 A;  3PSF A;  3PFI A;  2VXD A;  3H3Z A;  3O6B B;  4WCG A;  1WJ5 A;  2XAQ A;  2QEX I;  3ZMD A;  4IHW A;  4HX7 A;  2R5Z A;  4XLP F;  3VDX A;  2PBI A;  1A6I A;  1WVR A;  3PNT A;  3M3Y J;  4QPQ A;  2KZG A;  4BHB A;  1T33 A;  2Y9Z A;  2JUC A;  4IQJ A;  3OV8 A;  1OCZ H;  4UUS A;  1O3Q A;  2V1N A;  3K2Z A;  4II3 A;  1XC5 A;  1FJL A;  1RZ4 A;  4KDP A;  1VQN I;  3ZGK A;  1GXQ A;  4HV5 A;  4AWX B;  2DK5 A;  4MO7 A;  4ZYE A;  1BBY A;  1YX5 A;  1DUX C;  3S8P A;  3CCV I;  1IRZ A;  4XKB A;  4KUM A;  1U78 A;  1W7P D;  3TDZ C;  1T39 A;  5FLX K;  1WJB A;  1B6A A;  2R7U A;  2FXA A;  4C2U A;  3PO2 J;  2GIZ A;  2OQR A;  1VQK I;  3HM5 A;  3RKW A;  4Y7N J;  5GPC A;  3DEU A;  4BE2 A;  1UG2 A;  3QOE A;  3VYR B;  2CV2 A;  3K9T A;  4RB3 C;  1I3Q J;  4WK8 F;  5JHF A;  3OYM A;  1RNL A;  3JRF A;  2P5V A;  1XSD A;  5D8K B;  2EFP A;  4RGU A;  3SXY A;  4ZYD A;  4Q4Z F;  1O3S A;  3S14 J;  2EBI A;  3GZ5 A;  3CUQ B;  4IEJ A;  3ZPL A;  2CWE A;  3HTS B;  2QSG X;  1X2N A;  2KZV A;  3K4N A;  2EFO A;  4AVP A;  4ZDP A;  1T2K A;  1OKR A;  2I10 A;  3KP7 A;  4IOA F;  5H6Q A;  2WAQ N;  2V6E A;  1JKQ C;  4BE0 A;  1ZEL A;  3OOU A;  3KYL A;  4XIC A;  1FYK A;  2JPB A;  3U1K A;  4CA0 A;  5EJC A;  1ZRD A;  4XLA A;  2IAI A;  1J09 A;  4V2F A;  3K7A J;  5C44 J;  3B6A A;  3K70 D;  1FBU A;  5IT9 K;  2ZXH A;  3P9I A;  2BY2 A;  4OIN F;  2KL4 A;  3LL7 A;  4AIJ A;  4A3F J;  3Q3S A;  2E1M B;  3E1S A;  3J7A Y;  1R58 A;  4OIO F;  2CJJ A;  4BXF A;  3RKX A;  4S0H B;  3SEZ A;  2LDU A;  1GUU A;  4DYR A;  1IV6 A;  3LSI A;  2PN6 A;  3H0D A;  2IP2 A;  5TJJ A;  1FYM A;  1HDD C;  4AIK A;  3DBL B;  3HXL A;  3FWE A;  1QRY A;  1KQ8 A;  3F6O A;  2JQ7 A;  4Y4R A;  4X6A J;  2M9H A;  1V5F A;  4YFN F;  3M1C A;  3WTY C;  4HRI A;  3OS1 A;  2VUM J;  2DLL A;  2ELK A;  2E60 A;  2X1C A;  1X2M A;  3I59 B;  3M07 A;  2W00 A;  3W2W A;  3QPT A;  1R4N B;  2DA1 A;  3K4B A;  3F22 A;  1U5T B;  2QBY A;  3F21 A;  1YOV B;  3ZMU A;  2MG4 A;  3CCS I;  2IGM A;  4QIW N;  2D1H A;  1BR4 A;  1P4A A;  4M73 A;  3VOE A;  3M4O J;  3G1L A;  3EPZ A;  1A35 A;  1KZH A;  2HPI A;  4ON0 A;  1LFU P;  1E17 A;  4MFE A;  2LLK A;  1ACI A;  4IHY A;  2HFH A;  2Z16 A;  4EM2 A;  4Y52 J;  1Z7U A;  3FXK A;  4RA2 A;  5FO5 A;  4C9Y A;  1FX7 A;  2UZK A;  3GFI A;  1MSE C;  2EPF A;  1FIP A;  4A0Z A;  4BEH A;  1YW9 A;  3PUF A;  4W97 A;  2LY9 A;  4BJ6 C;  2WAD A;  4BBR J;  1IXC A;  4CDG A;  1ZGJ A;  1FY7 A;  3BR3 A;  4IL6 C;  4AUX A;  3TW7 A;  4P55 A;  1TWC J;  2A6H F;  1V4R A;  2A3S A;  4WF2 A;  1QBJ A;  5L3C A;  4I0A A;  1BI1 A;  3ABM H;  4AC0 A;  3J7A O;  1W36 C;  2L0K A;  3FX3 A;  3KYD B;  4G7H F;  3OIO A;  3IV5 A;  4I98 B;  3EYY A;  2QSF X;  1LKX A;  4IZZ A;  1ZRC A;  1F1Z A;  4XBF A;  1ULY A;  3BG3 A;  3L00 A;  4X1E A;  2M0M A;  3J80 Z;  2L4A A;  2P5L C;  1K78 B;  1R22 A;  2V6C A;  3WG7 H;  1NTC A;  2FX0 A;  1YIJ I;  5EGO A;  1U3E M;  2E35 A;  4G6T B;  3L2R A;  5E1W A;  2CQ7 A;  3B73 A;  1KYZ A;  2HPM A;  3BP8 A;  3K1P A;  3M8E A;  4AIH A;  3HRU A;  4IHX A;  3BCA A;  4DYQ A;  1D3Y A;  3W6K B;  4O6J A;  3LWF A;  4BY7 J;  4D1Q A;  5TIS C;  3OOP A;  2AXL A;  4KMU X;  5DUI A;  1UFM A;  1MH4 A;  2LVS A;  1WFX A;  4M6X A;  4OWR B;  4S05 A;  1OR7 A;  2V9V A;  2DQL A;  1WPK A;  5CVU A;  1DDN A;  2EZL A;  1B8I B;  5E8G A;  3RYR A;  1T0F C;  5CKT A;  4OIQ F;  3T5X A;  2GOM A;  2D45 A;  4IRI A;  3K4K A;  5DTD A;  3A01 B;  1P4W A;  3S2D J;  5C4X J;  1PJR A;  5LHI A;  2QEN A;  5FLM J;  3BQZ A;  3G71 I;  1UHW A;  2DBB A;  4UB6 C;  3HRT A;  2BHZ A;  1FPQ A;  3O8G A;  1TC3 C;  1T08 B;  1BW6 A;  5IYD J;  3SDB A;  2Z9O A;  2X48 A;  3GBG A;  3O3K A;  2JRM A;  2XPV A;  2K4J A;  3U21 A;  2GXA A;  3M8J A;  2IJL A;  4ZH4 F;  3VB2 A;  1WI9 A;  1X3Z B;  1XGS A;  2DAO A;  3K4L A;  2Z2S B;  3DTK A;  2L9S A;  2R0Q C;  2L9V A;  3KZI C;  1EH7 A;  3CDH A;  1SAX A;  1XSX A;  2GZW A;  5KAI C;  2LRD A;  3BTJ A;  4HAM A;  2P7V B;  3RZD J;  1HOM A;  3BLY A;  2QYO A;  1JUP A;  5FKO A;  2K9Q A;  3DWL E;  1KQ0 A;  3DKX A;  3F72 A;  1RPW A;  1WGX A;  2ZC2 A;  3KIO A;  1K61 A;  1CF7 A;  1VQP I;  1DPR A;  2R7T A;  1R9T J;  3IP4 B;  4CCK A;  3KEO A;  4RLQ A;  2DA3 A;  2F5E A;  4MTD A;  4XLH A;  4ENJ A;  1FBS A;  1MIJ A;  3ASN H;  3FIS A;  2KIM A;  3K6G A;  3JSO A;  1A31 A;  3V4G A;  3VYU B;  1TTY A;  4NC8 A;  1ZAO A;  1NK3 P;  5EZG A;  4FX4 A;  1CGP A;  1S72 I;  2CUJ A;  4D5C A;  3JRB A;  3P9K A;  2QCO A;  4BQA A;  1G6N A;  1WJF A;  4XLC A;  1X19 A;  1U8R A;  3AL0 B;  3RPQ A;  1X3U A;  4F3Q A;  4LMY A;  2P6S A;  2DQR A;  3W2V A;  4EAT A;  3RKQ A;  4FE7 A;  2A6E F;  1IN7 A;  4MQ9 F;  5HDK A;  2O6G E;  2ACJ A;  1OCO H;  2XSD C;  2IT0 A;  2VL8 A; 
#chains in the Genus database with same CATH homology
 4BXX J;  3DCF A;  2HXI A;  5EDN A;  2GM4 A;  2HQ5 A;  1ETY A;  3S1R J;  2R5Y B;  2FJ1 A;  1ZTR A;  2JA8 J;  2R93 J;  5JLW A;  2MGQ A;  2OF7 A;  3FKI J;  2M2E A;  2NVQ J;  1B72 B;  1GDT A;  3LSG A;  5E3M A;  1ORK A;  1VND A;  2HOT A;  1OFC X;  5FKN A;  1FEX A;  3FK7 A;  5C4J J;  1SAN A;  3S1Q J;  2FQ4 A;  1SFO J;  5IYC J;  2QF7 A;  4AYB N;  4BKX A;  3HOW J;  2H1K A;  3W6V A;  5M5Y J;  4A3E J;  5J3L A;  4B4C A;  1ZR2 A;  3HKZ N;  3JRI A;  2EZK A;  1IC8 A;  3S1N J;  5J1R A;  5EG0 A;  1ZGW A;  1A5J A;  2NVX J;  2DMN A;  2XPW A;  5IP9 J;  1MBF A;  1GT0 C;  3TED A;  1JKR C;  1IUF A;  1TWH J;  2Y9Y A;  5IOY A;  4LOC A;  2ME0 A;  2GLO A;  3S15 J;  2ZB9 A;  1DU0 A;  4RDU A;  3ZQF A;  1ZQ3 P;  2COB A;  4GFB A;  1H8A C;  2VI6 A;  2GBY A;  4FIS A;  3UKG A;  2IEK A;  5EG0 B;  2EZI A;  5HOD A;  3RZO J;  2RAE A;  3HOZ J;  2X6O A;  2R5Y A;  4A93 J;  3SFI A;  3MN2 A;  4JX6 A;  4RBO A;  1MNM C;  4FE4 A;  1Z77 A;  1CQT A;  2NVY J;  3BR1 A;  3JRA A;  2ECC A;  4FCY A;  1ETK A;  3JRG A;  1PUF A;  2M34 A;  2YU9 J;  4XRS G;  4XID A;  1HCR A;  5IYB J;  1OJL A;  2AO9 A;  2E19 A;  1T56 A;  1U9O A;  1HLV A;  3HGY A;  1AHD P;  3BQY A;  1B72 A;  1W0T A;  2AHQ A;  3NAR A;  1NK2 P;  2K9S A;  1ETW A;  4A3M J;  3O8H A;  1GV2 A;  1ZR4 A;  5GP9 A;  5EF6 A;  4A3G J;  1H88 C;  2JJ7 A;  2E1O A;  4QSH A;  5EGO B;  2ECB A;  1K83 J;  2K40 A;  3OSF A;  1HDP A;  2JA6 J;  2EH3 A;  3S2H J;  3FIW A;  1JKP C;  3ZQC A;  4C3H J;  3CMY A;  2DTZ A;  1JJ6 C;  2MSY A;  3GTM J;  3JRD A;  1G2H A;  1AU7 A;  3GTO J;  4ABZ A;  4DW6 A;  2XB0 X;  2DN0 A;  3BR6 A;  1F43 A;  1OCP A;  1HF0 A;  2K9N A;  1JJ8 C;  4CYC B;  5F08 A;  2DA7 A;  2LR8 A;  4XRS A;  2XB5 A;  1DU6 A;  5FJ8 J;  2LFB A;  4I76 A;  3CQZ J;  2CRG A;  2HOA A;  2ID6 A;  1ETO A;  3A03 A;  1TWA J;  4JYK A;  3TP0 A;  4M6V A;  5F0H A;  3BTL A;  1LE8 B;  2XGE A;  5K7Z A;  1ETX A;  2FD5 A;  3QPS A;  3HGG A;  3FK6 A;  3Q0V A;  3ZQG A;  2KT0 A;  1ETV A;  2W48 A;  3GTJ J;  2KDZ A;  3HOY J;  3LSJ A;  1RET A;  2JWT A;  3BG5 A;  5FLV A;  3ZQH A;  3BTI A;  3JRC A;  5F0C A;  5K7F A;  1JTX A;  3ZQL A;  3BTC A;  1YRN B;  3QQA A;  4A3L J;  5E3O A;  3CDL A;  3L1P A;  1O4X A;  2CQX A;  3IH2 A;  1QVT A;  5M3F J;  2G0E A;  5FKM A;  1UHS A;  2LK2 A;  4IHW A;  1WH7 A;  2R5Z A;  2DA5 A;  1A6I A;  3M3Y J;  2O8K A;  4XK4 A;  1T33 A;  2Y9Z A;  1H89 C;  4C3I J;  4UUS A;  3ZOB A;  2LP0 A;  2TCT A;  1P7J A;  1XC5 A;  1TWF J;  1FJL A;  4M3B A;  2EZH A;  3HOU J;  1EF4 A;  2DMU A;  3I4N J;  3PO3 J;  1U8B A;  3H3V K;  1RKW A;  4MO7 A;  2H8R A;  2DMQ A;  1IRZ A;  1RES A;  3WHC A;  4MFD A;  3MKL A;  1U78 A;  1B8I A;  3E7L A;  5JLX A;  3PO2 J;  3GTL J;  2VKV A;  4A3I J;  3HM5 A;  4Y7N J;  5GPC A;  1UG2 A;  4A69 C;  1F36 A;  2DA4 A;  1I3Q J;  2MW8 A;  3JRF A;  3G1M A;  2Y30 A;  1Z0X A;  2DA6 A;  1APL C;  3S14 J;  2EBI A;  3I4M J;  4IEJ A;  4D7M A;  4MIM A;  2HI3 A;  1X2N A;  5IP7 J;  4FTH A;  1POG A;  1XS9 A;  2P81 A;  3JRH A;  3SJM A;  2XGD A;  2I10 A;  5E3N A;  3HOX J;  4L5E A;  2L9R A;  2WAQ N;  4XRM A;  1QPI A;  2R7Z J;  1JKQ C;  5E3L A;  3OOU A;  4XIC A;  2M8G X;  1BA5 A;  1MSF C;  1BL0 A;  2IAI A;  4V2F A;  3K7A J;  5C44 J;  3B6A A;  4DZP A;  5FKK A;  2JN6 A;  3BR2 A;  3F0C A;  4V2G A;  4A3F J;  3Q3S A;  2E2I J;  2CJJ A;  4S0H B;  2XRL A;  5F27 A;  5IPA A;  1GUU A;  4UUT A;  4DYR A;  3JR9 A;  1IV6 A;  3HDD A;  4A3B J;  2YS9 A;  2HYJ A;  1HDD C;  2YUS A;  1QRY A;  1X58 A;  5EYR A;  1FTT A;  4X6A J;  2M9H A;  5F04 A;  5IOZ A;  4C3J J;  2X9D A;  1MBH A;  3IH3 A;  2NOG A;  2XGC A;  2VUM J;  2ELK A;  4D7N A;  1X2M A;  4C2M J;  2EQR A;  2DA1 A;  2DMT A;  5M3M J;  2Y2Z A;  2JA7 J;  1JUM A;  3BR5 A;  2MG4 A;  1ETQ A;  3G1O A;  1XG1 A;  1VFC A;  4QIW N;  1IDZ A;  2NS8 A;  2B63 J;  3M4O J;  2TRT A;  3G1L A;  2WB1 N;  3TW6 A;  2N8G A;  3C2B A;  4A3D J;  1LFU P;  1WI3 A;  4MFE A;  2LLK A;  4IHY A;  5F0F A;  4Y52 J;  1BJZ A;  1IJW C;  2DMP A;  1MSE C;  2WV1 A;  4HNV A;  1FIP A;  2Y31 A;  1U9N A;  3MVP A;  4W97 A;  5M5W J;  2LY9 A;  1JT6 A;  2L7M P;  2JMW A;  1JKO C;  1Q1V A;  3BT9 A;  3JRE A;  2JA5 J;  2R92 J;  4BBR J;  9ANT A;  4B1R A;  3BR3 A;  4AUX A;  1GV5 A;  3TW7 A;  1TWC J;  1JTY A;  1JUS A;  1VI0 A;  3PM1 A;  1ZK8 A;  1MBE A;  4AC0 A;  2L0K A;  2ME6 A;  4BY1 J;  2VKE A;  3NAU A;  5K7H A;  4G12 A;  3OIO A;  4JX4 A;  3IV5 A;  1FTZ A;  3OSG A;  3K2A A;  2CU7 A;  4M3D A;  4DZJ A;  1MBK A;  1IGN A;  1TWG J;  3GTP J;  1P7I A;  3BG3 A;  4X1E A;  1ZKG A;  2ID3 A;  1ENH A;  2LKX A;  1GVD A;  3LSP A;  3S1M J;  1NTC A;  2FX0 A;  2XPU A;  5EGO A;  2R5Z B;  4MLO A;  3WHB A;  5EEA A;  3A01 A;  1S7E A;  1ITY A;  4M3G A;  4BBS J;  2L7Z A;  3DEW A;  2HXO A;  4UUS B;  1MBJ A;  4IHX A;  4DYC A;  4DYQ A;  2DA2 A;  2E2J J;  4BY7 J;  1YRN A;  5BNG A;  2LD5 A;  3A02 A;  3S17 J;  3HEF A;  1OCT C;  1MH4 A;  1JT0 A;  2IBD A;  2LVS A;  3ZQI A;  1WPK A;  4A3C J;  3Q0W A;  5J1Y A;  2EZL A;  4JP0 A;  1Y1W J;  1AKH A;  1B8I B;  3HOV J;  3QPL A;  1AKH B;  3GTK J;  5DTD A;  3A01 B;  5IP6 A;  1E3O C;  1RR7 A;  3S2D J;  5C4X J;  1LE8 A;  5FLM J;  3BQZ A;  2Y0S N;  3IH4 A;  3O8G A;  1TC3 C;  1BW6 A;  5IYD J;  3H0G J;  3LOC A;  5M5X J;  2CUE A;  1UMQ A;  2X48 A;  4I6Z A;  3GBG A;  2XPV A;  2DJN A;  2HDD A;  3TP3 A;  2O7O A;  4A3K J;  2OPT A;  4EEF G;  1MH3 A;  1I50 J;  2R0Q C;  1JGG A;  4M3E A;  1BW5 A;  3VPR A;  1WH5 A;  2L7F P;  3S16 J;  3BTJ A;  4B3A A;  3RZD J;  3B6C A;  1HOM A;  3SDG A;  1JUP A;  1WCM J;  2LTP A;  5FKO A;  2K9Q A;  4JX5 A;  5GPA A;  1LFB A;  1RPW A;  1WGX A;  2VPR A;  1K61 A;  1QVU A;  1R9T J;  4IHV A;  4J19 A;  4NDL A;  4W1U A;  5DS9 A;  1IG7 A;  4M3F A;  1RKT A;  2DA3 A;  1MBG A;  1I6H J;  1D5Y A;  3BR0 A;  3D1N I;  2NVT J;  3RQI A;  2HOS A;  3FIS A;  3Q0U A;  3LSR A;  4D5F A;  3BG9 A;  2CUF A;  3LNQ A;  5FKL A;  1FIA A;  1PUF B;  1NK3 P;  5EZG A;  1Y1V J;  2JK3 A;  3GTG J;  5J1U A;  2NS7 A;  4CYC A;  4D5C A;  2D5V A;  4QTR A;  3JRB A;  5F1J A;  2QCO A;  3HB9 A;  3GTQ J;  5EZH A;  3CCY A;  5C3E J;  1VF9 A;  3RKQ A;  2PMZ N;  3HBL A;  4FE7 A;  1W0U A;  2O9L A;  2CQQ A;  1IDY A;  4A3J J;  2XSD C;  2E2H J;  2M0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...