4A3LJ

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3lJ00
2WV1A 2ZB9A 1IDYA 2DMTA 4D7NA 4EEFG 1K83J 3A02A 2GLOA 1UMQA 3GTLJ 3FKIJ 5M5XJ 5DS9A 5IYDJ 3RKQA 3JRHA 1D5YA 2R5ZB 4A3JJ 3H3VK 4BBSJ 1RESA 1GVDA 3S2HJ 2LP0A 2E1OA 2XRLA 2EZIA 4BBRJ 3HGYA 5J1RA 1JUPA 2YS9A 3FK7A 1O4XA 2ECCA 3HOUJ 3S1MJ 4A69C 5F0HA 2CU7A 1PUFB 2DN0A 4UUSA 1NK2P 1ITYA 4JX5A 2EZKA 2XGCA 1ETKA 4MLOA 2R5YA 4IHWA 3BTJA 3PO3J 1OCTC 2JJ7A 1ORKA 2NVYJ 3W6VA 2L0KA 5F0FA 5FKOA 2E2JJ 1FEXA 3LSRA 3BG9A 2L7ZA 3BR6A 3GTOJ 1WPKA 3RZDJ 4DYRA 5F08A 2KDZA 2LKXA 4B1RA 1HDDC 5C3EJ 1Y1WJ 1H89C 1FIPA 1ZGWA 2CRGA 4CYCB 4A93J 2DA1A 4JX6A 2M8GX 1QVUA 2DA3A 2DJNA 5IYBJ 9ANTA 2JN6A 2LFBA 1B8IA 3FK6A 5EZHA 2M9HA 4Y52J 2FJ1A 1ETWA 4FE7A 4M3GA 2H1KA 3CCYA 2VPRA 2LD5A 2FD5A 3DCFA 2NVXJ 1Z0XA 1WCMJ 1MSEC 1ETOA 2AHQA 5FLVA 1W0UA 1B72A 2HDDA 1UG2A 3PO2J 3RZOJ 5M5YJ 3MKLA 2XPUA 4XIDA 4QTRA 3Q0VA 2YUSA 2O8KA 5GP9A 1ZR4A 2VI6A 2FX0A 1RKTA 5EGOA 1BA5A 2Y9ZA 1X2NA 4A3MJ 3LSGA 2JMWA 1MBEA 3BTLA 4HNVA 3ZQLA 1FJLA 1BW6A 5DTDA 4AC0A 2XPWA 2OF7A 1VF9A 5FKNA 4RDUA 1TWAJ 4IEJA 2MSYA 5EDNA 1APLC 3HOWJ 4V2FA 1S7EA 2TRTA 3UKGA 1QVTA 4FISA 1XG1A 5FLMJ 3ZQCA 1ZR2A 2CJJA 2ME0A 4DYCA 3CDLA 3F0CA 4XRSG 2Y2ZA 1JTXA 3HB9A 3IH3A 4I76A 4MO7A 1Q1VA 2R93J 2GM4A 1AKHB 2PMZN 4XRMA 3S17J 1GUUA 2D5VA 2JA7J 5F27A 3S15J 3DEWA 1OFCX 1WGXA 5C4XJ 3TP3A 2H8RA 2DA4A 2NOGA 3HDDA 3JREA 5IOYA 4A3LJ 3BQYA 2FQ4A 2K9SA 2COBA 4XRSA 2IBDA 1SANA 3FISA 2LY9A 3A01A 3GTPJ 1TWCJ 4A3CJ 4DYQA 2G0EA 1MH3A 4XICA 1HLVA 2EH3A 2WAQN 2R0QC 1AHDP 2MGQA 2DMNA 2HOAA 2I10A 4MIMA 3B6AA 1Z77A 1GT0C 1MBFA 1LFBA 5HODA 4LOCA 1MNMC 2KT0A 1W0TA 3GTGJ 2XPVA 1LE8A 2L7FP 4D7MA 2GBYA 3QPSA 2O7OA 1JKRC 5EF6A 5K7HA 1UHSA 1PUFA 2DMQA 2L7MP 1CQTA 1VI0A 3HKZN 4A3FJ 4A3DJ 1X2MA 1JUSA 4X6AJ 3HOXJ 2M0CA 2X6OA 3S14J 1T33A 2HXIA 4FCYA 4IHVA 1ZKGA 2DA2A 3LNQA 5EG0A 5F1JA 4BY1J 1RPWA 1ZK8A 3BTIA 5J3LA 3S16J 3CQZJ 1P7IA 3JRGA 1RETA 5J1UA 2XGDA 4A3IJ 3QPLA 4W1UA 1OJLA 3BR3A 4CYCA 1SFOJ 4D5FA 1MBJA 3Q3SA 2IAIA 3A03A 3LOCA 1R9TJ 3BT9A 1RKWA 4QIWN 5C4JJ 2TCTA 2X9DA 2YU9J 2W48A 4DZJA 1WH7A 5E3MA 2QF7A 3BR5A 5F04A 2WB1N 4A3KJ 4D5CA 1IJWC 5K7FA 2NVQJ 1NTCA 3QQAA 2K40A 3G1MA 3M4OJ 2DA6A 4S0HB 5IP9J 2ELKA 2M2EA 5BNGA 2HOSA 2EQRA 2DMUA 2Y9YA 3O8GA 4Y7NJ 3BR0A 3GTQJ 1QPIA 2R92J 2AO9A 2CQXA 1JGGA 1JT0A 3S1RJ 5EYRA 1ETYA 1JT6A 2VUMJ 4IHYA 3SFIA 3IH4A 4MFEA 5E3LA 1P7JA 1JJ8C 3TW6A 4AUXA 2HXOA 3GBGA 3JRIA 1IUFA 3ZQGA 3GTMJ 3SJMA 2EZLA 1HCRA 2RAEA 3B6CA 4A3EJ 2EZHA 5FKMA 3S1NJ 2HI3A 2M34A 1NK3P 3ZQFA 3TEDA 5JLXA 2NS8A 3NAUA 2HOTA 2E2IJ 3Q0WA 1I3QJ 2IEKA 4I6ZA 4JX4A 1YRNA 4C3IJ 1Y1VJ 1VNDA 1ENHA 3OSFA 1AKHA 1A5JA 4V2GA 1IC8A 2JWTA 3ZQHA 1H88C 1FTTA 1ZQ3P 2JA8J 1BJZA 2XB0X 3D1NI 2VKEA 4W97A 1MBKA 5IP6A 4BY7J 1EF4A 1I6HJ 3BR2A 3RQIA 2R5ZA 3JRDA 2HQ5A 4UUSB 4B3AA 1IGNA 3NARA 1LFUP 4C2MJ 2NVTJ 5EEAA 1K61A 3Q0UA 5FKKA 2R5YB 3G1LA 5IYCJ 4IHXA 3TP0A 4C3HJ 2LLKA 1AU7A 5K7ZA 1LE8B 3K7AJ 2E19A 4BXXJ 3HOYJ 3FIWA 3HM5A 1DU6A 5JLWA 1GV5A 3BR1A 3G1OA 5FKLA 5GPCA 1JKPC 1FTZA 5F0CA 2DA7A 3C2BA 1U9NA 4BKXA 4G12A 3BTCA 2ID3A 3L1PA 4DZPA 3HEFA 1U8BA 1TC3C 4JYKA 2VKVA 1E3OC 5IPAA 3ZOBA 1QRYA 2EBIA 5EG0B 3WHBA 1MBHA 4FTHA 5M3MJ 2Y31A 3H0GJ 3HBLA 4DW6A 2B63J 1HOMA 3WHCA 4M3EA 1B8IB 2XGEA 1MH4A 2CUFA 3PM1A 3HGGA 1U78A 4QSHA 3E7LA 3BG5A 3JRBA 2R7ZJ 4B4CA 1BL0A 3GTKJ 3ZQIA 3S1QJ 2JA5J 1JKOC 4X1EA 4J19A 2MW8A 2L9RA 3JRFA 4L5EA 1HF0A 1IRZA 5IOZA 3SDGA 1DU0A 1FIAA 1ETXA 3JRAA 3HOVJ 2DA5A 4M3BA 5J1YA 3GTJJ 1ETVA 1H8AC 1MSFC 1B72B 1JUMA 3LSPA 1MBGA 3LSJA 2JK3A 1IG7A 3VPRA 2K9NA 2NS7A 3HOZJ 3IV5A 1POGA 1ZTRA 1F36A 3CMYA 5C44J 5EGOB 1BW5A 1U9OA 1A6IA 2QCOA 1JTYA 2DTZA 1JKQC 2O9LA 2K9QA 1TWFJ 4MFDA 1VFCA 1ETQA 4ABZA 5M3FJ 1XS9A 3JRCA 5E3OA 4XK4A 2MG4A 1X58A 2N8GA 1HDPA 3I4NJ 2LK2A 3IH2A 4C3JJ 1WH5A 1GV2A 5GPAA 3O8HA 3MN2A 4JP0A 3OOUA 1WI3A 2Y0SN 3BG3A 5EZGA 5FJ8J 3JR9A 4AYBN 4GFBA 1G2HA 2Y30A 3OIOA 2X48A 1OCPA 2LR8A 2LTPA 2CUEA 3TW7A 5E3NA 3M3YJ 4UUTA 2P81A 2ID6A 2XB5A 1TWHJ 2ECBA 1JJ6C 1XC5A 1T56A 3K2AA 4M6VA 4A3BJ 3BQZA 4M3FA 1IDZA 1GDTA 4A3GJ 2JA6J 3MVPA 5IP7J 5M5WJ 2OPTA 2HYJA 4FE4A 4RBOA 1F43A 3I4MJ 2LVSA 1IV6A 1TWGJ 2XSDC 2CQQA 3S2DJ 4NDLA 1I50J 1RR7A 1YRNB 2ME6A 3OSGA 2DMPA 2E2HJ 4M3DA 3A01B
chains in the Genus database with same CATH superfamily
5FD5A 4E7KA 1S8NA 3BLYA 2XUBA 3GFJA 3N97A 2WY8Q 3CTAA 3LL7A 2UUZA 4B43A 1OCCH 2LSOA 3J7YJ 4WX9A 3FMSA 5DS9A 5IYDJ 3K70D 3GZNB 3JRHA 3RKQA 4YIFA 4Z2YA 4D9JA 3ASNH 3CCVI 1DGWY 4OIRF 4A3JJ 4XMYA 1ZGAA 4OWRB 3BZKA 4IL6C 1X3ZB 2E1MC 3UR3C 2Y0SA 1RESA 4L9NA 1PJRA 3KEOA 3HGYA 3ZMVA 4XQFA 2O61A 4IRGA 1HXDA 2J5PA 4AM3A 1Z7UA 4Q47A 2CU7A 5CKTA 3V8LA 4UUSA 4JX5A 4RM3A 1TQIA 2R5YA 1QZZA 3BTJA 4Y4RA 4IHWA 5CVIA 2M45A 3ZQ7A 1UELB 4QPOA 2EA4A 2QZ8A 4DBQA 4ESBA 1IXCA 4AWXB 3FWEA 4A6DA 1K7AA 3CZ6A 2L0KA 2WADA 3PQJA 3MQ0A 2HZDA 2BYVE 2L3DA 3TOAA 1QQIA 2VBXA 3EUKL 5E8GA 5JHFA 1W36D 2L7ZA 3H5RA 2XF7A 4IZZA 2RN7A 2O3FA 3GTOJ 1WPKA 3O2PE 3SEZA 5GTHC 3ZGKA 2XV4S 1XSXA 5F08A 2Z5UA 3NWTA 2KDZA 2PMZA 4B48A 2LKXA 4L5IA 4UY8I 4UHTA 2FQ3A 1T2KA 5CQGA 2F5EA 2ZXIA 2QA4I 3DPTA 1DPUA 3GFLA 2LY2A 4FT8A 2Z16A 3LSMA 5CLSA 4RB3C 2JN6A 4OINF 3FK6A 4Y52J 2M9HA 4KIBA 3FXLA 4ZTJA 3W2AA 3AKZA 2FJ1A 1T6SA 1SD6A 2IA1A 4HPQA 3DCFA 2HEOA 2VJ4A 3MZHA 3WU2C 5KNLA 2JRTA 2AHQA 3I3LA 3C1DA 4RB0A 3ERMA 1W5SA 1OPCA 3J80Z 1B72A 2YSRA 2XGXA 1NG7A 1IO2A 4WXCA 3WTWC 2F5VA 3LSHA 3Q0VA 3M1EA 1WJBA 1FBUA 1G3TA 3ZMSA 1R7JA 4PSXA 1P9QC 1X2NA 2W7NA 5TISC 3P9CA 4G6DA 3BTLA 3FBIB 3SDBA 2BY3A 1FJLA 1BW6A 2WV0A 3OYHA 1WSUA 3LWFA 4K2EA 3KEYA 1WQ2A 4RDUA 1BI3A 5FKNA 2VIXA 4IEJA 3E3VA 1ZH5A 3DKYA 3K4NA 4IRHA 4YELA 1QGPA 2BHZA 4GYGA 2TRTA 2ZMEC 1QVTA 2HDWA 4FISA 3BC8A 3UKGA 5FLMJ 1ZR2A 3MEXA 4G7OF 1HQCA 3I56I 2CJJA 4DYCA 4DQ2A 3CDLA 3TBIA 3K70C 2ZJQF 1IN5A 4BDYA 3HB9A 1T98A 3R61A 1J5YA 1FY7A 4Q48A 5CVJA 1Y6IA 3CCUI 2PMZN 1Y0NA 2GIZA 3DEUA 1GUUA 3HOSA 2FOKA 1Y0UA 1XX5A 2GAUA 3ZCOA 4AIKA 3NEUA 4M71A 1WGXA 5C4XJ 2H8RA 3PQKA 4LIUA 3WTTC 2HYGD 4JBAA 2H6CA 1D3YA 1XGMA 2F2EA 2P6TA 3LA3A 3TDUC 5IOYA 4B3XA 4ENMA 4A3LJ 2F4IA 3V7RA 5IY5H 1MMSA 4XRSA 4A12A 1FOKA 4ZC3A 1E0EA 3VSKA 1W36C 4ANJA 4NHJA 2RC4A 1OYIA 2XC7A 1JXSA 3PUFA 3ROUA 1K78A 1KGSA 4Y3OA 1T38A 2E1MB 5TRDA 1MH3A 3DU6A 1X19A 1HLVA 3AG2H 3A0BC 1G4DA 2OJED 3L2QA 1H9TA 3R6SA 2KJBA 2O03A 4PUSA 1F4KA 1ZREA 1DP7P 1Z77A 2KKOA 4M6YA 4LOCA 2KT0A 5FLXK 3T8RA 3GTGJ 1D1BA 3I55I 3H0DA 4IHSA 1N75A 1RR8C 3QP5A 2L7FP 3KIOA 1FBSA 3CCSI 5CPRB 2PEXA 4KIFA 4LG3A 5DCFA 4D7MA 5GAHJ 2O7OA 2W82A 3E0JB 2EIKH 1RUNA 1RC9A 3KEQA 1ZARA 1IRFA 1LNWA 1VI0A 4XNFA 4XKCA 3CO7C 4CDGA 1Z1DA 2VQLA 1X2MA 1JUSA 1QHGA 4CH7A 4LK1F 2M0CA 1YI2I 2FRHA 3Q9VA 4KICA 1R5GA 4OIQF 2HTJA 5EG0A 5F1JA 4BY1J 3AL0C 1RPWA 3T1BA 1I27A 2OD5A 3VOEA 1FMWA 1MGTA 3FXKA 2L5QA 3BTIA 5J47A 3LAPA 1ZLJA 2DU9A 3R0JA 3S16J 4L0YB 3EUAA 2DK8A 5DUIA 3CCJI 2M4KA 4W1UA 1OJLA 1Z3YA 2MD0A 5L3BA 2LDUA 1Y56A 3VB2A 4CYCA 1R6RA 3RKYA 5D4SA 1MBJA 2BV6A 1BBYA 2MABA 3CJQB 4ZZDA 1J59A 3EYIA 1R5HA 1W7PA 2ZXHA 5C4JJ 3U1DA 4HOBA 2B0LA 3SEQA 2W48A 3CUOA 4LG0A 1BN5A 1V5FA 2EFWA 1AWCA 4A3KJ 4B44A 3ESWB 1VQMI 3QQAA 2R7RA 1WJ5A 2EV6A 2K40A 3JAMZ 4S0HB 3GWZA 2VC0A 1Z91A 2JUCA 2AXLA 3MAJA 2ELKA 4XLPF 4HF2A 5ICEA 5LHIA 1PUEE 2ISZA 3BR0A 5KK1A 2NVUB 1EJ9A 5DD8A 2JRMA 5EYRA 1JT6A 5A2QK 4M9SA 4J01A 2RREA 4XSZF 4BJ5C 3FDYA 3IC7A 4GRIA 3F8CA 3K69A 1WFXA 1IUFA 2CH0A 3ZQGA 2Z2SB 3GTMJ 3JTGA 2M30A 1OQYA 5F64A 5GTIC 3PIOF 2EZLA 3M07A 4G6TB 2L01A 3AAFA 4J00A 4N0BA 3B6CA 3KFWX 1XSDA 5FKMA 3S1NJ 2HI3A 3DTEA 2M34A 1NK3P 3ZQFA 4R1HA 1KQ0A 2VT2A 3IUOA 4GCVA 1P4WA 2LYCA 2NS0A 3MKZA 3VWBA 1ODDA 3VODA 2EV0A 3Q0WA 3FM5A 2PJRA 4NBQA 1O7FA 4JX4A 3E5XA 5D5XB 3HSFA 4C2UA 2QYOA 1AKHA 1VNDA 1ENHA 4ESJA 3TO9A 3OSFA 2R7ZJ 2ELJA 3JTHA 1XMKA 4HX7A 4A0ZA 2DBBA 4BL0B 4XN3A 2D1VA 4I98B 3WTXC 4KIGA 3IRRA 3ZQHA 4NQWB 5CVVA 3CC7I 2VN2A 2KISA 3RPUA 1ZQ3P 2M3AA 2JA8J 1BJZA 2XB0X 1FMVA 3OIQA 4W97A 2A69F 3D0SA 3GO5A 3WG9A 4CSWA 2ZBKA 2DOFA 1S7AA 3OYLA 2IJLA 2P0WA 2HDCA 3JRDA 1TBXA 2HQ5A 5D4RA 1IGNA 2AQFA 5EEGA 1TLHB 5EEAA 3M8FA 2KPMA 2OAZA 3G1LA 1U5TA 5IYCJ 3UNGC 5DCMB 4C3HJ 2JVGA 2C6YA 2KP6A 2LLKA 4MEXF 2UXNA 5K7ZA 2E19A 1I1GA 3K4JA 3EPZA 4PJMA 3FIWA 1H9GA 2H94A 3G1OA 3C2GA 3I53A 5HS8A 5ICFA 5GPCA 5J8FA 1JKPC 1FTZA 2OCEA 1U9NA 5DYMA 4G12A 1RZ4A 3BTCA 5HDGA 1X3UA 1VQ4I 2ID3A 4ZYEA 4NC7A 4LFUA 3U1KA 2MA3A 1U8BA 2VKVA 1REPC 4HX8A 3ZOBA 4GXOA 2IS6A 1WJCA 2EBIA 1J9IA 4S05A 4HLYA 1YTYA 1MBHA 3AL0B 2R7FA 2KRFA 4KMFA 2B63J 4PJNA 4M3EA 2XGEA 3SZTA 5L3EA 5IT3A 2IP2A 3E7LA 4TV7A 4G7HF 1W4MA 4I01A 3OWTA 1A35A 2JA5J 4XL9A 4GO1A 2Z1DA 4LGWA 1IRZA 4XLEA 1B6AA 3OL4A 1ETXA 1VQ6I 2DA5A 2HQRA 2ZO4A 1Z9CA 5H20A 2L7KA 5FROA 2WWYA 3GTJJ 4XKVA 4EJVA 2Y75A 1T0FC 2HOEA 3TO7A 3OYAA 1IXRC 1ON1A 3M8JA 1UB9A 2OBPA 3I9V2 4PJJA 4DOZA 4IOCF 2NS7A 2W25A 1HC8A 3SFZA 2KIQA 3KYDB 3HHGA 1YQAA 3FMRA 1A6IA 1U9OA 2QCOA 3S32A 3TKYA 2DFHA 4MFDA 4HV5A 4XN0A 1J7KA 4P5OA 1VFCA 3RTRA 4MGRA 2IS2A 4CCLA 5LD2C 4CXFA 2OV7A 3BY6A 1LQ1A 2YX7A 2VASA 2MG4A 2N8GA 3JW4A 2A6EF 1QBJA 2LK2A 1WJFA 2FXAA 2XF5A 4JP0A 1R49A 3BOQA 3DPLC 3BG3A 2CFXA 2UXXA 2M5WA 4DGWB 1YJ9I 2CW0F 3HL2A 1G2HA 2GQQA 2X0LA 1QHHD 2LTPA 5E3NA 2MH9A 4UUTA 4N9IA 2P81A 2ID6A 2VB6A 1XC5A 3K2AA 4EGYA 2IXSA 1GDTA 5ERIA 5M5WJ 1F43A 2OPTA 1FC3A 1OISA 4LLLA 3QRFF 2KL4A 2XDVA 4BXUA 2UV1A 3LMMA 3T5XA 5D5UB 1YFHA 1MDMB 1MJBA 3J80K 1IV6A 2AXTC 1MNDA 2GZWA 4FX0A 4P1WA 2PLYA 1I50J 3S2DJ 1RR7A 2R7UA 2GXBA 1KONA 5E1WA 1F1ZA 3KP7A 2E2HJ 4BNCA 2WV1A 2LBFA 4F93B 1IDYA 2DMTA 2K7LA 5LEKA 2CMPA 3S3OA 2DT5A 4M74A 1K83J 3F8FA 2R3SA 3I71A 4I0AA 2R7QA 1D0YA 1U0JA 2KIMA 4H4KC 3KP6A 3EQLF 1MD0A 4BEHA 1X3WB 2P4WA 1MNEA 3HSEA 3W6JB 4BAYA 2RVCA 1GVDA 2EFOA 5L3FA 2LP0A 2E1OA 4M9ZA 4AYBA 4E4HA 2LY1A 2XVCA 3ZQQA 2YS9A 5LGUA 3L9FA 1Z6RA 3TL4X 2FOWA 2ECCA 4E7IA 1FOWA 5F0HA 3DBHB 3LA2A 3MZYA 3D5SC 3VSLA 2EZKA 4U87A 3PO3J 4EVIA 3P9KA 4II3A 1BIAA 3ABMH 1TNTA 2NVYJ 5LRRA 3W6VA 4WK8F 1CF7B 1FEXA 3K9TA 3IRQA 3RQ4A 5KAFC 1LDDA 1D0ZA 3BG9A 2A3SA 2MC4A 4DYRA 5D6FA 4RLQA 3ZR8X 1T08B 4ZTFA 1HDDC 3LFUA 2VBWA 4Q4ZF 4OIOF 3DF8A 2CUZA 3WTUC 1FIPA 4CCMA 1UCRA 1MKMA 3OYIA 2DCEA 1A6QA 4A93J 3VYSB 1QVUA 4XLAA 2DJNA 3K1NA 3HTUA 3TDZC 4IXAA 1B8IA 5HNFA 3CO6C 2R7XA 3DLAA 2RNJA 3KP4A 2H1KA 4PSWA 3E6BA 5KAIC 4E7JA 1Z0XA 3GZ5A 1ETOA 1P2FA 3WTZA 4IQ4A 3CDHA 3BJOA 4NNJA 4F92B 2HDDA 2CV0A 2B7EA 4M9XA 3W2VA 3PO2J 2JZYA 2L54A 5M5YJ 4XIDA 4QTRA 4KNYA 3J7AY 1IRXA 5L3CA 2O8KA 4O6JA 5GP9A 2VI6A 1D8JA 5EGOA 2Y9ZA 2R4GA 4A3MJ 1K79A 5KCMA 2DFFA 3DXJF 4AC0A 5DTDA 4YFNF 3T8TA 1KYZA 4WCGA 1XMXA 1YG2A 2PX9A 2X1DA 2DK5A 4IQJA 1PDNC 3RIRA 1C0WA 3HOWJ 1EV7A 1S7EA 3FXUA 3I4PA 3F21A 5L3GA 1JHHA 1XG1A 1FPQA 3ZQCA 2DAOA 2ME0A 3K6GA 2ZSIB 1N77A 4XRSG 1O3TA 4KYWA 3CC2I 1X1DA 4N4NB 2F4MB 4MO7A 3CUQC 3LQRA 2YPRA 1V55H 3RSNA 4B8XA 3ECHA 4X0GA 2A61A 1LKXA 4LD5A 5F27A 4OIPF 3S15J 1HW2A 3FHZA 3A1YA 2LKPA 3DKXA 1D1AA 4JQFA 4U0YA 2NOGA 3M7GA 2L9VA 4M73A 3OYMA 1KYWA 1RRJA 2COBA 1BOAA 1T39A 1SANA 1G3YA 2LY9A 4A5NA 3A01A 2CO5A 3OS0A 4A3CJ 1BI2A 4M6XA 1HKTA 1BJAA 4EGZA 2EH3A 3PFYA 3Q9SA 2R0QC 5HLHA 2ZXWH 5LFAA 4U7DA 3QPTA 4HDUA 1WRJA 2HOAA 4XKWA 2EPFA 1S72I 2EK5A 1MBFA 1HW1A 1ZG5A 1W0TA 5FD6A 1LE8A 2CYYA 3BJAA 5K7HA 2R7WA 3H9QA 3CP8A 3VYRB 1V4RA 2FUG2 2G7HA 1G3SA 3K4MA 3H3ZA 2QM3A 1MIJA 4A3DJ 2IA0A 4HSTA 2X6OA 2O0YA 2HXIA 4OU0A 4WXDA 3DV8A 2VOOA 2DA2A 3QYFA 5LHGA 5IT9K 4HAMA 4G8XA 2E7WA 5J3LA 1B59A 4I7HA 2DDAA 1GXQA 2FBKA 3K10A 3KCCA 1RETA 3W6KB 4YIRX 3MKWB 4A3IJ 2QLZA 5E1ZB 1UHWA 4HDVA 1HSTA 3CESA 1SFOJ 3Q3SA 3LOCA 4LLGF 1FBQA 3WTVC 5LLQA 3BT9A 1RKWA 2KFDA 4U7BA 2X9DA 1X1PA 1XTAA 3KX2A 2YU9J 1B4AA 3ELKA 1USTA 5DDGA 5E3MA 5F04A 2EWNA 3BR5A 2OC6A 3OL3A 1IJWC 2FNAA 3G3ZA 2NVQJ 3PL8A 4UVBA 4LLNA 5HOOA 3G1MA 3M4OJ 2DA6A 1K4SA 3WG7H 4L9TA 3KP5A 2HOSA 2EQRA 1CGPA 4O5VA 2DMUA 2P6SA 4Y7NJ 1LPQA 1Z21A 5H6QA 3BJ6A 1QPIA 2KRCA 2AO9A 3KE2A 2IS1A 3QYBA 2BW3B 1JT0A 5E79C 1SD5A 3KYCB 3SFIA 3VYUB 4MFEA 5E3LA 1P7JA 4KT5C 1JJ8C 3TW6A 1IUYA 4PCQA 3JRIA 2VL8A 1YS6A 4EM2A 5E18F 2IPQX 4A6EA 3SJMA 1YW8A 5ILVA 1EH8A 1ZRFA 2P7VB 3QPHA 4HX4A 4ZJZA 2EZHA 1UHMA 3P7NA 2IGNA 3CUQB 1P92A 1FOXA 5J40A 2XF6A 3L7WA 5F6FA 3G73A 3TEDA 2NS8A 3IWFA 1TNSA 2HOTA 2RGVA 2XAHA 1I39A 1OR7A 4BGDA 3HUGA 4ZDOA 1F9NA 4RB1A 2X6XA 1N78A 1IZ1A 1RNLA 2RQQA 1KU9A 2E1CA 4ON0A 1J09A 4MQ9F 2QSFX 2XAQA 1Y1VJ 3FXQA 3NRVA 4CGZA 2UWMA 1A5JA 1LEAA 1UG0A 3EYYA 3HRTA 4XONA 4BQAA 3EUHA 2HKXA 3H3UA 1UAAA 1S5LC 3J81K 4XSXF 2KLOA 2DOEA 1OYYA 3SHFA 1K78B 4EATA 1R58A 2DPUA 1MBKA 5IP6A 4BY7J 1FP1D 2OQRA 3PFIA 4F91B 3F8BA 3GFMA 2OCCH 3GLXA 4RAYA 2R5ZA 1K6OA 2EV5A 4E7HA 2VLAA 4MNUA 5D6EA 2Z33A 2B9SA 2VQGA 1TTYA 1TT0A 1A04A 5BPDA 1LFUP 4C2MJ 1FP2A 1G3WA 5FKKA 4A0YA 1FYKA 3TP0A 1N25A 1W1WE 1G6NA 5JHUA 4P9UA 1O3SA 4F3QA 3HOYJ 2HQNA 4YEJA 4KISA 4I99C 3HM5A 1DU6A 3SQNA 2E60A 2L02A 5FKLA 2QSHX 4B47A 1W5TA 3C2BA 2J5OA 2XIGA 4WF2A 3L1PA 2WAFA 4DZPA 4JYKA 1E3OC 5IPAA 2WBMA 5EG0B 3F72A 3DTIA 3WHBA 1Z67A 5K1YA 3H0GJ 1O3RA 4LB6B 1MH4A 2CUFA 1XDSA 4U0VA 2VT3A 1R1UA 1SFEA 2VC1A 4CA0A 4IX7A 5LGNA 3S1QJ 2R7SA 1JKOC 1TT5B 4X1EA 2R7DA 1QZEA 2Z3YA 2CV1A 1YW9A 2DFIA 3M9AA 1DDNA 3HOVJ 3JSOA 5ILUA 3FX3A 1SFXA 4A0XA 1W7PB 4MEYF 1H8AC 3W2WA 2X1CA 2Q2EB 3OV8A 1UZCA 3T0YA 4LG0B 5HS9A 1IG7A 4ZZLA 2ADUA 2KDOA 5HDKA 3IV5A 1POGA 1A31A 1F36A 2NAZA 1BW5A 2DO7A 2LG4A 1SAXA 4BQNA 4ITVA 5AIQA 2DTZA 3E6CC 3V8KA 2VXDA 4BDZA 1QPMA 2R7VA 4UB8C 4FHTA 1ETQA 4XLCA 2W00A 1XGOA 3A0HC 3WTSC 5M3FJ 3ASOH 5B3SH 2CW8A 3R60A 3JRCA 2QKMB 1WKMA 1HDPA 3CF2A 1ACIA 1WJEA 1ZRDA 1WJDA 2ZMEB 3G4SI 1WH5A 3F3XA 5GPAA 3O8HA 1KU3A 2V9VA 1FOYA 1XDUA 1YW7A 2BY1A 5EZGA 5FJ8J 3JR9A 2HVSA 2FBIA 2K9LA 4LMYA 3OIOA 1XD7A 2P5LC 3DTKA 1OCPA 2DW4A 5JI6A 2RDPA 1VQKI 1TZLA 2X6YA 2ECBA 4N4OB 1JJ6C 3AG3H 4MQVA 4A3BJ 3QAHA 2VE8A 3BQZA 1X1AA 4M3FA 5B66C 5BS6A 1KU7A 2KQRA 2DQRA 2JA6J 4FE4A 2HYJA 3HHHA 3VEPA 3I4MJ 1DPRA 1YJWI 2FE3A 5E17F 5BOXA 2X85A 4NDLA 2OTLI 2F5CA 3CCLI 4ENNA 1IAWA 2ZXJA 2ME6A 3OSGA 2GIVA 3L2VA 1G59A 1S29A 2VXZA 3FM3A 2R93J 4RAZA 3IAM2 4V19K 1AOYA 1IXSB 4D7NA 4BQQA 1R4NB 3OR1C 1QO0D 4PK4A 5F1RA 1KA8A 4MHGA 3TGNA 1DQUA 3REOA 1UMQA 3FKIJ 2P5VA 1WJAA 3GUDA 4HSRA 3PNYA 3OR2C 2GA2A 4C30A 5FO5A 2F5DA 2YR2A 4XORA 4HQMA 4NQWA 1DUXC 3QU6A 2QENA 2X51A 3KP3A 4BBSJ 1I1SA 2R7OA 3I59A 2FSWA 3S2HJ 3ZMDA 1YIOA 2XRLA 4BBRJ 4BJTA 1ZGJA 1TQMA 3IWZA 4AVZA 1MMGA 3HOUJ 4E7SA 1GVJA 3ISPA 1PUFB 2DN0A 3F6OA 2HU9A 5GADJ 2IS4A 1ETKA 2K5CA 2M7BA 2ZJPF 2E1NA 1OCTC 2JJ7A 5DCMA 1OMIA 1ORKA 3CJRB 5F0FA 5FKOA 3DLLF 1HSJA 3PNVA 3LSRA 2E2JJ 2DODA 1VQ9I 3GF2A 3HRSA 3G71I 1YHQI 2A68F 3RZDJ 3BPVA 2QWWA 4HF0A 2DYSH 3F9KA 1VQOI 1R1VA 3GMEA 1YJNI 5C3EJ 1R1TA 3M8EA 4II2A 2V6CA 4ZDPA 1Z6TA 1Y1WJ 2WC2A 3OYEA 3WTYC 3JCUC 4C9YA 1ZGWA 1PYVA 2F4OB 2DA1A 2M8GX 2CUJA 2CW7A 1VTNC 1ULYA 1QA6A 4IPAA 4LITA 2YX4A 2E36A 3K4CA 5IYBJ 4IJAA 1ZG3A 3GZ6A 2OUMA 3MD2A 3EETA 5EZHA 3HPHA 2QBYB 2MC3A 3OYFA 1HBXG 3IHUA 3O6BB 4BHCA 1ETWA 1W5CC 4JOMA 1YOVB 1MW7A 2VPRA 3LSIA 2ISYA 2NVXJ 2CG4A 5CJ9A 2E34A 2BZTA 1S9HA 5J4VA 1K6YA 1MSEC 4DJAA 4KN4X 4M72A 4Y17A 5FLVA 2EILH 3R0AA 1W0UA 5B1AH 3HJEA 1UG2A 3CMEI 3RZOJ 1U3EM 5J6XA 3MKLA 2XPUA 2YUSA 2L9SA 1ZR4A 1R5ID 2X1EA 5HLTA 2QVOA 2PMUA 2V9KA 2JMWA 4HNVA 3OS1A 4E70A 2V1DA 1JHFA 4DBRA 3ZQLA 2ZJ2A 2FNPA 4HF1A 3QP6A 4AIHA 3J7ZI 2V7FA 3B02A 1F5TA 4EM0B 2MSYA 5EDNA 1APLC 1R71A 1FNNA 4V2FA 4D0PA 4RGRA 2V6EA 3E6DA 1DGRM 2E5ZA 3TOBA 2OA4A 4BE0A 4I02A 1ZN2A 3SZPA 3CD6I 1JTXA 1MMAA 1BI1A 2VBYA 4AIDA 3I64A 2ZNZA 3IH3A 1FSHA 1B9MA 2AQEA 2ZCWA 1Q1VA 2K4BA 5HNHA 2ZKZA 2HR3A 5H6RA 4O3MA 4L9JA 1RI7A 3KZZA 1MMDA 5FLXZ 4HYEA 3KETA 1OFCX 2DOAA 2RKHA 3TP3A 2UZKA 2DA4A 3TMOA 4LJZF 2HPMA 3HDDA 1MDMA 2H6BA 3BROA 2BHYA 3BQYA 4CCNA 5AONA 5D8KB 1X4OA 2EFQA 2FU4A 2IBDA 1ZHFA 4UV9A 3Q5FA 2KIUA 1BC8C 1NHAA 2BE5F 4BE2A 1TWCJ 1SEUA 1OCRH 2LH9A 3KPHA 4DYQA 1R4MB 2MBFA 4KITB 1IW7F 2OZUA 1EA3A 2A5YB 2JPCA 2MGQA 2I10A 3BDDA 1I6XA 3B6AA 1GHCA 2ACJA 2IRFG 1Y39A 4HA8A 4OOIA 2HQAA 2YU3A 4XLHA 3MMYB 2EFPA 2W84A 2XPVA 4JK1X 5EF6A 3V42A 1S6LA 1UHSA 1DP3A 4ETSA 2L7MP 1CQTA 4I09A 2P5KA 4E6KG 1D1CA 1R22A 4A3FJ 2PJPA 3L2UA 4X6AJ 3M1CA 1CF7A 4UUVA 1T33A 3N4MA 4FCYA 1ZKGA 4BXFA 3LNQA 5ICGA 1FX7A 3G2BA 5CYVA 4ZYAA 3EDPA 2PN6A 3N05A 5K5RA 3RKXA 3R4KA 4ENKA 4UXNA 4XBFA 2K9MA 3FXRA 4B09A 5A2QZ 3MZ8A 2XGDA 3QPLA 4CYDA 2M0MA 2NXNB 3BR3A 4BU2A 1VQPI 2VOPA 4D5FA 4IRIA 1XMAA 2IAIA 3IAS2 3DWLE 4EQQA 4RB2C 1WI9A 3BG7A 1AA7A 3C7JA 2TCTA 1PVEA 2ZFUA 2ZSHB 1OLTA 2F48A 5EJCA 4LK0F 3HG9A 2GXAA 3ABLH 3WGIA 4D5CA 5K7FA 1XGSA 2DTRA 3PSFA 1NTCA 3MFKA 1XSVA 5IP9J 3V7SA 5ED4A 3LAJA 2O6GE 5CQEA 3DEEA 5BNGA 1ZG1A 2LF7A 2LREA 2Y9YA 4P55A 3O8GA 3HYIA 5E1XA 3GTQJ 2M7AA 3U2RA 1OKRA 1W7PD 2R7TA 3S1RJ 3ABKH 3D5RC 4BS9A 2Q8KA 2ICWG 4IHYA 3QU3A 2CV2A 2VPLA 4I0BA 1TW2A 4QLCU 4YRVA 2ESHA 1E2XA 2HXOA 4EJUA 3GBGA 3F6VA 3HC7A 4GYIA 3GW2A 1SC7A 1S3JA 1KU2A 1L3LA 1JE8A 1BR2A 2JUGA 1VQ7I 2ESNA 2VJJA 2M1BA 2BXYA 3O3KA 3J7AO 5JVGF 3KLNA 1K4TA 2V79A 4PZJA 5JLXA 3JAMK 1J2XA 5FB2A 3COAC 3RI4A 4HG2A 2PFBA 2FMLA 4XKBA 5JR3A 1IRGA 2IEKA 4OMZA 1ON2A 4I6ZA 3S93A 2VE9A 1YRNA 3PSIA 3G6EI 1HA8A 1FSEA 3PUBA 2BEOA 5H2FC 3GVAA 3ULQB 4AIJA 2Z99A 4IOAF 2LRDA 4V2GA 1IC8A 2JWTA 3KZYA 2DQLA 4CCJA 1BC7C 1FTTA 3LSTA 3V8JA 3K1PA 2XKOA 1BM9A 1XGNA 4HLXA 3E6MA 2Y0MA 3RQIA 4Z6YA 3U9GA 1SMYF 4UUSB 4B3AA 3HOTA 3F22A 2EJRA 2DI3A 2H1LA 3F8MA 2K3FA 4EMSA 1K61A 2NVTJ 2R5YB 5DEQA 2V1XA 1G8XA 4CZZA 2L9NA 4E7ZA 1LE8B 4BXXJ 4KT6A 2KMUA 2XAFA 1SFUA 3RPUD 2EA2A 4UNOA 5JLWA 3BR1A 5LEJA 2NRAC 2NOJB 3GLLA 2VKHA 1OCOH 2HS5A 4XOPA 3HRMA 4BKXA 3BG6A 3HEFA 4HEA2 4ENJA 1TC3C 4RAGA 1UJ8A 3AG4H 4FTHA 5M3MJ 3HBLA 3LFKA 4WXHA 3DQVC 2D45A 3WHCA 3ZP5A 3PM1A 3HGGA 4PGHA 4CZCA 1P4XA 3BG5A 2JSCA 2VONA 4PDKA 2WA0A 2FMYA 4HZFA 3CCEI 2W1OA 2JSPA 2MW8A 3JRFA 1HF0A 1FT9A 2V9PA 1EH7A 4YFXF 3JRAA 4XM3A 2F6CA 2NNYA 3PJRA 4ZH4F 5FRMA 4QPQA 3RPQA 1FWZA 5HS7A 2A6TA 1ERDA 1ONVA 5KHDA 2X6WA 1HKQA 1ETVA 1MSFC 1B72B 1HKSA 1JUMA 4G9YA 3GXOA 3OYBA 4HQEA 3LSJA 4EJWA 2DFEA 3VPRA 2XAGA 2K9NA 3VFZA 3H9GA 1BI0A 4AU7A 4BHPA 5B1BH 3RYPA 2DT6A 2IGMA 1XPXA 1ZELA 1YIJI 1JTYA 1STZA 2K02A 1SD4A 2PQ8A 4BQOA 1Z3XA 2K9QA 2VJIA 1TWFJ 2I5UA 3OY9A 4UB6C 2DLLA 3E97A 1SVLA 1HW5A 1XS9A 3C2HA 3CMMA 1V54H 3K4LA 4GDFA 3OYGA 3OYDA 1X58A 1D8KA 2VODA 5K5QA 3I4NJ 1TP4A 2BVMA 3WE2A 4C3JJ 1GV2A 1U6GA 4YFKF 2ZJRF 1IV8A 1IN8A 3FXMA 3OOUA 1WI3A 2Y0SN 4L18B 2BBYA 4AD9A 1J0RA 2A07F 4GFBA 1M1EB 1IN7A 3K4BA 1U8RA 2BW3A 2X48A 3BWGA 2LR8A 4CO8A 3M3YJ 2K3PA 3ZXSA 1TQPA 2XB5A 3WGHA 3CCQI 4ASNA 1TWHJ 1TL8A 4M6VA 4HBLA 1LFPA 3D5LA 3DBLB 3QOEA 4PFOA 6PAXA 1B9NA 3TQNA 1IDZA 4RGSA 1X4PA 4A3GJ 2KJCA 1WVRA 4Y13A 1LDKB 3HUGB 3HTSB 4RGXA 1TWGJ 3QOPA 4IVNA 3CUQA 1SVOA 2HKOA 1IF1A 2DMPA 4M3DA 2IGKA 5GAEJ 2JQ7A 1I3AA 2BGCA 2IT0A 1SFKA 2ZB9A 4FETA 4XRFA 4KUMA 4EEFG 4FX4A 2OU2A 3A02A 2GLOA 3S3MA 3GTLJ 2AS5F 5M5XJ 1LJ9A 2LNBA 3HZJA 1D5YA 3L09A 4EM1A 2R5ZB 1XN7A 1BR1A 2VQHA 3FBNB 3K1MA 1U5TC 2RQPA 1V3FA 3H3VK 3WE3A 1IN4A 2JTVA 3DFGA 3QWLA 3L2WA 2EZIA 3KZIC 5J1RA 2Y48A 1JUPA 1H0MA 3FK7A 2E5NA 2HTSA 2KRHA 1O4XA 1V5EA 3S1MJ 1E3PA 4A69C 4CCOA 2BY0A 1RIOH 4EV0A 1OYWA 1NK2P 1ITYA 5D8LB 2OTJI 2XGCA 4MLOA 1B1BA 4KJZA 3TO6A 4L9VA 5E20A 3H1CA 4NB5A 4XR6A 1NG6A 2G7UA 3GX4X 2HWVA 1I5ZA 1SAUA 3BR6A 5ILSA 1S7OA 5CVUA 3GYHX 4CICA 1VQ8I 5D5VB 3JSPA 4UVAA 2Y69H 4B1RA 3ZMUA 5L3DA 3SZGA 4F52A 2NNNA 3GEZA 3NWSA 1H89C 2EINH 3ML6A 4YIIA 3WU0A 4DNCA 2CRGA 2JT1A 2GA1A 2EB7A 4CYCB 4JX6A 5J4YA 3MWMA 1XCVA 4BH9A 5D5WB 4NC6A 2KZGA 2DA3A 3QYEA 1D5VA 4L0ZB 9ANTA 2LFBA 1FYLA 3OYJA 1SVMA 3I0TA 1U2WA 4OAYA 2ZNYA 2JVHA 4FE7A 4M3GA 1MJ9A 3BZCA 3CCYA 3WGGA 3X2QH 2LD5A 2FD5A 2W85A 1WCMJ 2H27A 2XKPA 2WAQA 2QSGX 5LGTA 2L2OA 2COMA 1MMNA 4XLFA 2XHKA 4EJTA 1WHUA 2QUFA 3P9IA 5FGMA 2Q2EA 2STTA 3KYLA 3CLQA 4P9FA 2FX0A 3ZN0A 5DM6F 1RKTA 4KA4A 2ELHA 4C2TA 4A5MA 1BA5A 3LSGA 1ZYRF 2K4JA 3FHNA 1MBEA 3F23A 4L5JA 3CCRI 2LKSA 2TDXA 2XPWA 2STWA 2W4SA 2OF7A 1FZPB 1VF9A 4S04A 2XRNA 1TWAJ 3HKZA 3L2RA 1XB4A 2ZMEA 4NUBA 5B5EC 2XAUA 3F0CA 3SXYA 2Y2ZA 1Q1HA 1BR4A 2CGPA 3AG1H 2Z9OA 2E35A 4I76A 2PJRB 1KQ8A 1XCBA 3OMYA 3QODA 4G94A 3A2KA 3H35A 2GM4A 1X1BA 1AKHB 3RCOA 4XRMA 2DXIA 2A6HF 3S17J 2D5VA 4MTEA 2JA7J 2A5WA 2M87A 2QKLB 3E5QA 3DEWA 5HDNA 5JVTA 3BCAA 4BJ6C 4ZYGA 2DDBA 4Y15A 1R23A 2LOOA 4F7ZA 2FF4A 3JREA 3ZPLA 1KQ9A 1T95A 4DIQA 2FQ4A 5AIPA 1IN6A 2K9SA 3VDXA 1SMTA 2WB1A 3L2CA 3S3NA 2GXGA 1T8IA 3FISA 5DD4A 3GTPJ 2PMHA 2BXZA 1OCZH 1U5TB 3ERED 2G0EA 4AVPA 4XICA 5IT9Z 3I59B 2ETHA 4UVCA 4E7LA 2WAQN 4FQGA 1AHDP 4P96A 4IF4A 1P4AA 4R79A 2DMNA 3RJPA 2K27A 4MIMA 4ESFA 3KP2A 2DPDA 4IHTA 3BCBA 1GT0C 3DKWA 1MNMC 1LFBA 5HODA 4HRIA 4PFPA 1VZ0A 1E3HA 2L4MA 2MD5A 1YO5C 2MLGA 2H8WA 3OS2A 3CF5F 4EJOA 5DUKA 2GBYA 3QPSA 4KFCA 1JKRC 1L0OC 4NC8A 2KIFA 1PUFA 2DMQA 2EIMH 3CCMI 2HVRA 2HGCA 1MZBA 2HVQA 2IA2A 3GFIA 2O5RA 4RLFA 4Q5SF 3DU5A 4RM2A 1MJAA 3HKZN 1NH3A 3HOXJ 5HLGA 2A05A 2XAJA 2VKDA 3S14J 4OMYA 4BE1A 4ZYHA 4IHVA 3FXOA 3RDIA 1ZK8A 2JPBA 5DV5A 4CUGA 1QU3A 3HXLA 4UV8A 4RGUA 3CDIA 3I5UA 1KZHA 3AFHA 3CQZJ 5JFRA 1P7IA 3JRGA 4N9HA 5J1UA 2VJ5A 2VBZA 1O7LA 2QQ8A 3A03A 1YITI 3C3WA 1R9TJ 3CJTB 3LA7A 4PJ0C 1YX5A 4QIWN 3B73A 4QWQA 2XSJC 5HVQC 2L4AA 1PP8F 2CSOA 2V4JC 4LB5A 4DZJA 1A36A 2QBYA 1WH7A 2CQNA 2QF7A 2EIJH 2WB1N 3RYRA 2JA2A 3HSRA 2HPIA 4WWCA 4BUPA 3H5AA 4KN7X 5K5OA 2M2EA 4G6QA 1BIBA 3RKWA 3LSKA 1Z7LA 2Q0OA 3VYTB 2R92J 2LF8A 2CQXA 3MKYB 1JGGA 4BACA 5FRNA 4BYYA 2G9WA 2ZC2A 3H9JA 3L00A 1ETYA 2V1NA 5BMZA 5HLIA 4FASD 2VUMJ 5GAGJ 2XASA 5E8IA 3CLOA 3IH4A 1R00A 3I58A 2CQKA 1LB2A 4AUXA 3J81Z 4OAZA 3ZMTA 3BZ6A 2M4GA 4KMUX 1RUOA 3ABUA 4RMNA 3H5NA 1VQ5I 3FF5A 3BP8A 1YLFA 2HYFA 3V7CA 3ZN1A 1HCRA 2RAEA 3KLOA 3OYCA 4A3EJ 2HZTA 1YS7A 4RAFA 4CCKA 2I8DA 3FKJA 2E71A 1LVKA 2W57A 3FZVA 1JI8A 5FFZA 3GCMA 3OOPA 4PJLA 3NAUA 2LBFB 2PBIA 2E2IJ 1WZ2A 3CC4I 3ZRGA 1P6RA 4U0WA 1I3QJ 2K86A 4R8HA 3H36A 4HNUA 2QEXI 3E1SA 3WU1B 4C3IJ 1EH6A 2WAEA 4XLNF 4BEHB 1Y8QB 2LC2A 1YX3A 3K4KA 4A2UA 3CMAI 4HV6A 1H88C 2FEZA 2P8TA 3D1NI 2Q1ZB 2VKEA 3IP4B 1LEBA 5LHHA 5BPIA 5FFXA 3H92A 1UFMA 2E7XA 2RV8A 1EF4A 1I6HJ 3NQOA 2DYRH 1LUJB 3BR2A 5DM7F 1J75A 4Y33A 3OIPA 3ZMZA 3NARA 2V1UA 1X1CA 2F5FA 2OQGA 3FXJA 3Q0UA 3PIPF 3IL2A 3DBRB 1FYMA 4IHXA 1V5GA 2KHMA 1AU7A 3E5UA 3K7AJ 2M8EA 2RNGA 1FLIA 3U21A 5LBQA 1EKEA 1GV5A 1Y8RB 4F55A 4U88A 3OYKA 4BHBA 1GXPA 5F0CA 1R36A 1TW3A 2DA7A 3K0LA 4KDPA 1E17A 4ZDLA 2X4HA 1ZAOA 1QNTA 3BPXA 1JGSA 4MTDA 1O57A 3LQQA 1YYVA 1QRYA 3DP7A 4I2OA 4CHUA 2BY2A 2Y31A 3P5JA 4RS8A 4DW6A 3FMQA 1HOMA 2FA5A 2GOXB 2IW5A 1B8IB 3HIFA 1U78A 4QSHA 5CVRA 3JRBA 4HW0A 2KZVA 4B4CA 4IO9F 1D0XA 2QQAA 4HNTA 3ZQIA 1BL0A 2PI0A 3GTKJ 4J19A 4GGGA 2L9RA 4L5EA 5IOZA 2HNHA 3SDGA 1DU0A 5LRSA 1FIAA 4IKFA 3DPUA 2D1HA 2QQBA 3W3CA 2CS3A 4M3BA 3A4CA 5J1YA 1YE9A 3V4GA 2GWRA 3IKTA 3LSPA 1T0FA 2CQ7A 1MBGA 1O3QA 3S8PA 2QQ9A 2JK3A 2IVMA 2MLKA 3HRUA 3HPGA 2GOMA 3HOZJ 2WY7Q 2FBHA 1VQNI 1ZTRA 3OYNA 3CMYA 3CJNA 5EGOB 5C44J 2EFNA 4ZYDA 2NYXA 1JKQC 1Z05A 2HFHA 2O9LA 1BOBA 2O8XA 3I54A 4ABZA 2LMDA 5ICCA 3CP2A 5E3OA 4G7ZF 3F8NA 1WWXA 4XK4A 2CFOA 1USSA 1GLNA 3IH2A 4XOTA 3MN2A 2QGUA 3SYTA 2P7CB 3PNTA 2D2WA 5EEHA 3ABTA 2OZ6A 3S2WA 4AYBN 4D1QA 2Y30A 2DJIA 2V26A 1PP7U 2MYSA 2VQCA 1ZLKA 3ECOA 2CUEA 3TW7A 2H09A 1VQLI 2MH2A 2XROA 1T56A 2BOLA 2BVLA 1LVAA 5KVRA 1ZRCA 2K85A 2ZFWA 4RA2A 5TGTA 3K2ZA 3MVPA 5IP7J 1OR7C 4RBOA 5BQTA 3IKVA 3C18A 1LDJA 4YG2F 2LVSA 5TJJA 5J8CA 1SD7A 2CWEA 2IGOA 2PG4A 2XSDC 2CQQA 3MCZA 4PGGA 2WTEA 3WODF 2DT7B 4LIVA 1YRNB 3EUHC 1QZYA 2MFZA 2W24A 3ONQA 4H0EA 3A01B
chains in the Genus database with same CATH topology
2WV1A 2ZB9A 1IDYA 2DMTA 4D7NA 4EEFG 1K83J 3A02A 2GLOA 1UMQA 3GTLJ 3FKIJ 5M5XJ 5DS9A 5IYDJ 3RKQA 3JRHA 1D5YA 2R5ZB 4A3JJ 3H3VK 4BBSJ 1RESA 1GVDA 3S2HJ 2LP0A 2E1OA 2XRLA 2EZIA 4BBRJ 3HGYA 5J1RA 1JUPA 2YS9A 3FK7A 1O4XA 2ECCA 3HOUJ 3S1MJ 4A69C 5F0HA 2CU7A 1PUFB 2DN0A 4UUSA 1NK2P 1ITYA 4JX5A 2EZKA 2XGCA 1ETKA 4MLOA 2R5YA 4IHWA 3BTJA 3PO3J 1OCTC 2JJ7A 1ORKA 2NVYJ 3W6VA 2L0KA 5F0FA 5FKOA 2E2JJ 1FEXA 3LSRA 3BG9A 2L7ZA 3BR6A 3GTOJ 1WPKA 3RZDJ 4DYRA 5F08A 2KDZA 2LKXA 4B1RA 1HDDC 5C3EJ 1Y1WJ 1H89C 1FIPA 1ZGWA 2CRGA 4CYCB 4A93J 2DA1A 4JX6A 2M8GX 1QVUA 2DA3A 2DJNA 5IYBJ 9ANTA 2JN6A 2LFBA 1B8IA 3FK6A 5EZHA 2M9HA 4Y52J 2FJ1A 1ETWA 4FE7A 4M3GA 2H1KA 3CCYA 2VPRA 2LD5A 2FD5A 3DCFA 2NVXJ 1Z0XA 1WCMJ 1MSEC 1ETOA 2AHQA 5FLVA 1W0UA 1B72A 2HDDA 1UG2A 3PO2J 3RZOJ 5M5YJ 3MKLA 2XPUA 4XIDA 4QTRA 3Q0VA 2YUSA 2O8KA 5GP9A 1ZR4A 2VI6A 2FX0A 1RKTA 5EGOA 1BA5A 2Y9ZA 1X2NA 4A3MJ 3LSGA 2JMWA 1MBEA 3BTLA 4HNVA 3ZQLA 1FJLA 1BW6A 5DTDA 4AC0A 2XPWA 2OF7A 1VF9A 5FKNA 4RDUA 1TWAJ 4IEJA 2MSYA 5EDNA 1APLC 3HOWJ 4V2FA 1S7EA 2TRTA 3UKGA 1QVTA 4FISA 1XG1A 5FLMJ 3ZQCA 1ZR2A 2CJJA 2ME0A 4DYCA 3CDLA 3F0CA 4XRSG 2Y2ZA 1JTXA 3HB9A 3IH3A 4I76A 4MO7A 1Q1VA 2R93J 2GM4A 1AKHB 2PMZN 4XRMA 3S17J 1GUUA 2D5VA 2JA7J 5F27A 3S15J 3DEWA 1OFCX 1WGXA 5C4XJ 3TP3A 2H8RA 2DA4A 2NOGA 3HDDA 3JREA 5IOYA 4A3LJ 3BQYA 2FQ4A 2K9SA 2COBA 4XRSA 2IBDA 1SANA 3FISA 2LY9A 3A01A 3GTPJ 1TWCJ 4A3CJ 4DYQA 2G0EA 1MH3A 4XICA 1HLVA 2EH3A 2WAQN 2R0QC 1AHDP 2MGQA 2DMNA 2HOAA 2I10A 4MIMA 3B6AA 1Z77A 1GT0C 1MBFA 1LFBA 5HODA 4LOCA 1MNMC 2KT0A 1W0TA 3GTGJ 2XPVA 1LE8A 2L7FP 4D7MA 2GBYA 3QPSA 2O7OA 1JKRC 5EF6A 5K7HA 1UHSA 1PUFA 2DMQA 2L7MP 1CQTA 1VI0A 3HKZN 4A3FJ 4A3DJ 1X2MA 1JUSA 4X6AJ 3HOXJ 2M0CA 2X6OA 3S14J 1T33A 2HXIA 4FCYA 4IHVA 1ZKGA 2DA2A 3LNQA 5EG0A 5F1JA 4BY1J 1RPWA 1ZK8A 3BTIA 5J3LA 3S16J 3CQZJ 1P7IA 3JRGA 1RETA 5J1UA 2XGDA 4A3IJ 3QPLA 4W1UA 1OJLA 3BR3A 4CYCA 1SFOJ 4D5FA 1MBJA 3Q3SA 2IAIA 3A03A 3LOCA 1R9TJ 3BT9A 1RKWA 4QIWN 5C4JJ 2TCTA 2X9DA 2YU9J 2W48A 4DZJA 1WH7A 5E3MA 2QF7A 3BR5A 5F04A 2WB1N 4A3KJ 4D5CA 1IJWC 5K7FA 2NVQJ 1NTCA 3QQAA 2K40A 3G1MA 3M4OJ 2DA6A 4S0HB 5IP9J 2ELKA 2M2EA 5BNGA 2HOSA 2EQRA 2DMUA 2Y9YA 3O8GA 4Y7NJ 3BR0A 3GTQJ 1QPIA 2R92J 2AO9A 2CQXA 1JGGA 1JT0A 3S1RJ 5EYRA 1ETYA 1JT6A 2VUMJ 4IHYA 3SFIA 3IH4A 4MFEA 5E3LA 1P7JA 1JJ8C 3TW6A 4AUXA 2HXOA 3GBGA 3JRIA 1IUFA 3ZQGA 3GTMJ 3SJMA 2EZLA 1HCRA 2RAEA 3B6CA 4A3EJ 2EZHA 5FKMA 3S1NJ 2HI3A 2M34A 1NK3P 3ZQFA 3TEDA 5JLXA 2NS8A 3NAUA 2HOTA 2E2IJ 3Q0WA 1I3QJ 2IEKA 4I6ZA 4JX4A 1YRNA 4C3IJ 1Y1VJ 1VNDA 1ENHA 3OSFA 1AKHA 1A5JA 4V2GA 1IC8A 2JWTA 3ZQHA 1H88C 1FTTA 1ZQ3P 2JA8J 1BJZA 2XB0X 3D1NI 2VKEA 4W97A 1MBKA 5IP6A 4BY7J 1EF4A 1I6HJ 3BR2A 3RQIA 2R5ZA 3JRDA 2HQ5A 4UUSB 4B3AA 1IGNA 3NARA 1LFUP 4C2MJ 2NVTJ 5EEAA 1K61A 3Q0UA 5FKKA 2R5YB 3G1LA 5IYCJ 4IHXA 3TP0A 4C3HJ 2LLKA 1AU7A 5K7ZA 1LE8B 3K7AJ 2E19A 4BXXJ 3HOYJ 3FIWA 3HM5A 1DU6A 5JLWA 1GV5A 3BR1A 3G1OA 5FKLA 5GPCA 1JKPC 1FTZA 5F0CA 2DA7A 3C2BA 1U9NA 4BKXA 4G12A 3BTCA 2ID3A 3L1PA 4DZPA 3HEFA 1U8BA 1TC3C 4JYKA 2VKVA 1E3OC 5IPAA 3ZOBA 1QRYA 2EBIA 5EG0B 3WHBA 1MBHA 4FTHA 5M3MJ 2Y31A 3H0GJ 3HBLA 4DW6A 2B63J 1HOMA 3WHCA 4M3EA 1B8IB 2XGEA 1MH4A 2CUFA 3PM1A 3HGGA 1U78A 4QSHA 3E7LA 3BG5A 3JRBA 2R7ZJ 4B4CA 1BL0A 3GTKJ 3ZQIA 3S1QJ 2JA5J 1JKOC 4X1EA 4J19A 2MW8A 2L9RA 3JRFA 4L5EA 1HF0A 1IRZA 5IOZA 3SDGA 1DU0A 1FIAA 1ETXA 3JRAA 3HOVJ 2DA5A 4M3BA 5J1YA 3GTJJ 1ETVA 1H8AC 1MSFC 1B72B 1JUMA 3LSPA 1MBGA 3LSJA 2JK3A 1IG7A 3VPRA 2K9NA 2NS7A 3HOZJ 3IV5A 1POGA 1ZTRA 1F36A 3CMYA 5C44J 5EGOB 1BW5A 1U9OA 1A6IA 2QCOA 1JTYA 2DTZA 1JKQC 2O9LA 2K9QA 1TWFJ 4MFDA 1VFCA 1ETQA 4ABZA 5M3FJ 1XS9A 3JRCA 5E3OA 4XK4A 2MG4A 1X58A 2N8GA 1HDPA 3I4NJ 2LK2A 3IH2A 4C3JJ 1WH5A 1GV2A 5GPAA 3O8HA 3MN2A 4JP0A 3OOUA 1WI3A 2Y0SN 3BG3A 5EZGA 5FJ8J 3JR9A 4AYBN 4GFBA 1G2HA 2Y30A 3OIOA 2X48A 1OCPA 2LR8A 2LTPA 2CUEA 3TW7A 5E3NA 3M3YJ 4UUTA 2P81A 2ID6A 2XB5A 1TWHJ 2ECBA 1JJ6C 1XC5A 1T56A 3K2AA 4M6VA 4A3BJ 3BQZA 4M3FA 1IDZA 1GDTA 4A3GJ 2JA6J 3MVPA 5IP7J 5M5WJ 2OPTA 2HYJA 4FE4A 4RBOA 1F43A 3I4MJ 2LVSA 1IV6A 1TWGJ 2XSDC 2CQQA 3S2DJ 4NDLA 1I50J 1RR7A 1YRNB 2ME6A 3OSGA 2DMPA 2E2HJ 4M3DA 3A01B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WV1 A;  2ZB9 A;  1IDY A;  2DMT A;  4D7N A;  4EEF G;  1K83 J;  3A02 A;  2GLO A;  1UMQ A;  3GTL J;  3FKI J;  5M5X J;  5DS9 A;  5IYD J;  3RKQ A;  3JRH A;  1D5Y A;  2R5Z B;  4A3J J;  3H3V K;  4BBS J;  1RES A;  1GVD A;  3S2H J;  2LP0 A;  2E1O A;  2XRL A;  2EZI A;  4BBR J;  3HGY A;  5J1R A;  1JUP A;  2YS9 A;  3FK7 A;  1O4X A;  2ECC A;  3HOU J;  3S1M J;  4A69 C;  5F0H A;  2CU7 A;  1PUF B;  2DN0 A;  4UUS A;  1NK2 P;  1ITY A;  4JX5 A;  2EZK A;  2XGC A;  1ETK A;  4MLO A;  2R5Y A;  4IHW A;  3BTJ A;  3PO3 J;  1OCT C;  2JJ7 A;  1ORK A;  2NVY J;  3W6V A;  2L0K A;  5F0F A;  5FKO A;  2E2J J;  1FEX A;  3LSR A;  3BG9 A;  2L7Z A;  3BR6 A;  3GTO J;  1WPK A;  3RZD J;  4DYR A;  5F08 A;  2KDZ A;  2LKX A;  4B1R A;  1HDD C;  5C3E J;  1Y1W J;  1H89 C;  1FIP A;  1ZGW A;  2CRG A;  4CYC B;  4A93 J;  2DA1 A;  4JX6 A;  2M8G X;  1QVU A;  2DA3 A;  2DJN A;  5IYB J;  9ANT A;  2JN6 A;  2LFB A;  1B8I A;  3FK6 A;  5EZH A;  2M9H A;  4Y52 J;  2FJ1 A;  1ETW A;  4FE7 A;  4M3G A;  2H1K A;  3CCY A;  2VPR A;  2LD5 A;  2FD5 A;  3DCF A;  2NVX J;  1Z0X A;  1WCM J;  1MSE C;  1ETO A;  2AHQ A;  5FLV A;  1W0U A;  1B72 A;  2HDD A;  1UG2 A;  3PO2 J;  3RZO J;  5M5Y J;  3MKL A;  2XPU A;  4XID A;  4QTR A;  3Q0V A;  2YUS A;  2O8K A;  5GP9 A;  1ZR4 A;  2VI6 A;  2FX0 A;  1RKT A;  5EGO A;  1BA5 A;  2Y9Z A;  1X2N A;  4A3M J;  3LSG A;  2JMW A;  1MBE A;  3BTL A;  4HNV A;  3ZQL A;  1FJL A;  1BW6 A;  5DTD A;  4AC0 A;  2XPW A;  2OF7 A;  1VF9 A;  5FKN A;  4RDU A;  1TWA J;  4IEJ A;  2MSY A;  5EDN A;  1APL C;  3HOW J;  4V2F A;  1S7E A;  2TRT A;  3UKG A;  1QVT A;  4FIS A;  1XG1 A;  5FLM J;  3ZQC A;  1ZR2 A;  2CJJ A;  2ME0 A;  4DYC A;  3CDL A;  3F0C A;  4XRS G;  2Y2Z A;  1JTX A;  3HB9 A;  3IH3 A;  4I76 A;  4MO7 A;  1Q1V A;  2R93 J;  2GM4 A;  1AKH B;  2PMZ N;  4XRM A;  3S17 J;  1GUU A;  2D5V A;  2JA7 J;  5F27 A;  3S15 J;  3DEW A;  1OFC X;  1WGX A;  5C4X J;  3TP3 A;  2H8R A;  2DA4 A;  2NOG A;  3HDD A;  3JRE A;  5IOY A;  4A3L J;  3BQY A;  2FQ4 A;  2K9S A;  2COB A;  4XRS A;  2IBD A;  1SAN A;  3FIS A;  2LY9 A;  3A01 A;  3GTP J;  1TWC J;  4A3C J;  4DYQ A;  2G0E A;  1MH3 A;  4XIC A;  1HLV A;  2EH3 A;  2WAQ N;  2R0Q C;  1AHD P;  2MGQ A;  2DMN A;  2HOA A;  2I10 A;  4MIM A;  3B6A A;  1Z77 A;  1GT0 C;  1MBF A;  1LFB A;  5HOD A;  4LOC A;  1MNM C;  2KT0 A;  1W0T A;  3GTG J;  2XPV A;  1LE8 A;  2L7F P;  4D7M A;  2GBY A;  3QPS A;  2O7O A;  1JKR C;  5EF6 A;  5K7H A;  1UHS A;  1PUF A;  2DMQ A;  2L7M P;  1CQT A;  1VI0 A;  3HKZ N;  4A3F J;  4A3D J;  1X2M A;  1JUS A;  4X6A J;  3HOX J;  2M0C A;  2X6O A;  3S14 J;  1T33 A;  2HXI A;  4FCY A;  4IHV A;  1ZKG A;  2DA2 A;  3LNQ A;  5EG0 A;  5F1J A;  4BY1 J;  1RPW A;  1ZK8 A;  3BTI A;  5J3L A;  3S16 J;  3CQZ J;  1P7I A;  3JRG A;  1RET A;  5J1U A;  2XGD A;  4A3I J;  3QPL A;  4W1U A;  1OJL A;  3BR3 A;  4CYC A;  1SFO J;  4D5F A;  1MBJ A;  3Q3S A;  2IAI A;  3A03 A;  3LOC A;  1R9T J;  3BT9 A;  1RKW A;  4QIW N;  5C4J J;  2TCT A;  2X9D A;  2YU9 J;  2W48 A;  4DZJ A;  1WH7 A;  5E3M A;  2QF7 A;  3BR5 A;  5F04 A;  2WB1 N;  4A3K J;  4D5C A;  1IJW C;  5K7F A;  2NVQ J;  1NTC A;  3QQA A;  2K40 A;  3G1M A;  3M4O J;  2DA6 A;  4S0H B;  5IP9 J;  2ELK A;  2M2E A;  5BNG A;  2HOS A;  2EQR A;  2DMU A;  2Y9Y A;  3O8G A;  4Y7N J;  3BR0 A;  3GTQ J;  1QPI A;  2R92 J;  2AO9 A;  2CQX A;  1JGG A;  1JT0 A;  3S1R J;  5EYR A;  1ETY A;  1JT6 A;  2VUM J;  4IHY A;  3SFI A;  3IH4 A;  4MFE A;  5E3L A;  1P7J A;  1JJ8 C;  3TW6 A;  4AUX A;  2HXO A;  3GBG A;  3JRI A;  1IUF A;  3ZQG A;  3GTM J;  3SJM A;  2EZL A;  1HCR A;  2RAE A;  3B6C A;  4A3E J;  2EZH A;  5FKM A;  3S1N J;  2HI3 A;  2M34 A;  1NK3 P;  3ZQF A;  3TED A;  5JLX A;  2NS8 A;  3NAU A;  2HOT A;  2E2I J;  3Q0W A;  1I3Q J;  2IEK A;  4I6Z A;  4JX4 A;  1YRN A;  4C3I J;  1Y1V J;  1VND A;  1ENH A;  3OSF A;  1AKH A;  1A5J A;  4V2G A;  1IC8 A;  2JWT A;  3ZQH A;  1H88 C;  1FTT A;  1ZQ3 P;  2JA8 J;  1BJZ A;  2XB0 X;  3D1N I;  2VKE A;  4W97 A;  1MBK A;  5IP6 A;  4BY7 J;  1EF4 A;  1I6H J;  3BR2 A;  3RQI A;  2R5Z A;  3JRD A;  2HQ5 A;  4UUS B;  4B3A A;  1IGN A;  3NAR A;  1LFU P;  4C2M J;  2NVT J;  5EEA A;  1K61 A;  3Q0U A;  5FKK A;  2R5Y B;  3G1L A;  5IYC J;  4IHX A;  3TP0 A;  4C3H J;  2LLK A;  1AU7 A;  5K7Z A;  1LE8 B;  3K7A J;  2E19 A;  4BXX J;  3HOY J;  3FIW A;  3HM5 A;  1DU6 A;  5JLW A;  1GV5 A;  3BR1 A;  3G1O A;  5FKL A;  5GPC A;  1JKP C;  1FTZ A;  5F0C A;  2DA7 A;  3C2B A;  1U9N A;  4BKX A;  4G12 A;  3BTC A;  2ID3 A;  3L1P A;  4DZP A;  3HEF A;  1U8B A;  1TC3 C;  4JYK A;  2VKV A;  1E3O C;  5IPA A;  3ZOB A;  1QRY A;  2EBI A;  5EG0 B;  3WHB A;  1MBH A;  4FTH A;  5M3M J;  2Y31 A;  3H0G J;  3HBL A;  4DW6 A;  2B63 J;  1HOM A;  3WHC A;  4M3E A;  1B8I B;  2XGE A;  1MH4 A;  2CUF A;  3PM1 A;  3HGG A;  1U78 A;  4QSH A;  3E7L A;  3BG5 A;  3JRB A;  2R7Z J;  4B4C A;  1BL0 A;  3GTK J;  3ZQI A;  3S1Q J;  2JA5 J;  1JKO C;  4X1E A;  4J19 A;  2MW8 A;  2L9R A;  3JRF A;  4L5E A;  1HF0 A;  1IRZ A;  5IOZ A;  3SDG A;  1DU0 A;  1FIA A;  1ETX A;  3JRA A;  3HOV J;  2DA5 A;  4M3B A;  5J1Y A;  3GTJ J;  1ETV A;  1H8A C;  1MSF C;  1B72 B;  1JUM A;  3LSP A;  1MBG A;  3LSJ A;  2JK3 A;  1IG7 A;  3VPR A;  2K9N A;  2NS7 A;  3HOZ J;  3IV5 A;  1POG A;  1ZTR A;  1F36 A;  3CMY A;  5C44 J;  5EGO B;  1BW5 A;  1U9O A;  1A6I A;  2QCO A;  1JTY A;  2DTZ A;  1JKQ C;  2O9L A;  2K9Q A;  1TWF J;  4MFD A;  1VFC A;  1ETQ A;  4ABZ A;  5M3F J;  1XS9 A;  3JRC A;  5E3O A;  4XK4 A;  2MG4 A;  1X58 A;  2N8G A;  1HDP A;  3I4N J;  2LK2 A;  3IH2 A;  4C3J J;  1WH5 A;  1GV2 A;  5GPA A;  3O8H A;  3MN2 A;  4JP0 A;  3OOU A;  1WI3 A;  2Y0S N;  3BG3 A;  5EZG A;  5FJ8 J;  3JR9 A;  4AYB N;  4GFB A;  1G2H A;  2Y30 A;  3OIO A;  2X48 A;  1OCP A;  2LR8 A;  2LTP A;  2CUE A;  3TW7 A;  5E3N A;  3M3Y J;  4UUT A;  2P81 A;  2ID6 A;  2XB5 A;  1TWH J;  2ECB A;  1JJ6 C;  1XC5 A;  1T56 A;  3K2A A;  4M6V A;  4A3B J;  3BQZ A;  4M3F A;  1IDZ A;  1GDT A;  4A3G J;  2JA6 J;  3MVP A;  5IP7 J;  5M5W J;  2OPT A;  2HYJ A;  4FE4 A;  4RBO A;  1F43 A;  3I4M J;  2LVS A;  1IV6 A;  1TWG J;  2XSD C;  2CQQ A;  3S2D J;  4NDL A;  1I50 J;  1RR7 A;  1YRN B;  2ME6 A;  3OSG A;  2DMP A;  2E2H J;  4M3D A;  3A01 B; 
#chains in the Genus database with same CATH topology
 5FD5 A;  4E7K A;  1S8N A;  3BLY A;  2XUB A;  3GFJ A;  3N97 A;  2WY8 Q;  3CTA A;  3LL7 A;  2UUZ A;  4B43 A;  1OCC H;  2LSO A;  3J7Y J;  4WX9 A;  3FMS A;  5DS9 A;  5IYD J;  3K70 D;  3GZN B;  3JRH A;  3RKQ A;  4YIF A;  4Z2Y A;  4D9J A;  3ASN H;  3CCV I;  1DGW Y;  4OIR F;  4A3J J;  4XMY A;  1ZGA A;  4OWR B;  3BZK A;  4IL6 C;  1X3Z B;  2E1M C;  3UR3 C;  2Y0S A;  1RES A;  4L9N A;  1PJR A;  3KEO A;  3HGY A;  3ZMV A;  4XQF A;  2O61 A;  4IRG A;  1HXD A;  2J5P A;  4AM3 A;  1Z7U A;  4Q47 A;  2CU7 A;  5CKT A;  3V8L A;  4UUS A;  4JX5 A;  4RM3 A;  1TQI A;  2R5Y A;  1QZZ A;  3BTJ A;  4Y4R A;  4IHW A;  5CVI A;  2M45 A;  3ZQ7 A;  1UEL B;  4QPO A;  2EA4 A;  2QZ8 A;  4DBQ A;  4ESB A;  1IXC A;  4AWX B;  3FWE A;  4A6D A;  1K7A A;  3CZ6 A;  2L0K A;  2WAD A;  3PQJ A;  3MQ0 A;  2HZD A;  2BYV E;  2L3D A;  3TOA A;  1QQI A;  2VBX A;  3EUK L;  5E8G A;  5JHF A;  1W36 D;  2L7Z A;  3H5R A;  2XF7 A;  4IZZ A;  2RN7 A;  2O3F A;  3GTO J;  1WPK A;  3O2P E;  3SEZ A;  5GTH C;  3ZGK A;  2XV4 S;  1XSX A;  5F08 A;  2Z5U A;  3NWT A;  2KDZ A;  2PMZ A;  4B48 A;  2LKX A;  4L5I A;  4UY8 I;  4UHT A;  2FQ3 A;  1T2K A;  5CQG A;  2F5E A;  2ZXI A;  2QA4 I;  3DPT A;  1DPU A;  3GFL A;  2LY2 A;  4FT8 A;  2Z16 A;  3LSM A;  5CLS A;  4RB3 C;  2JN6 A;  4OIN F;  3FK6 A;  4Y52 J;  2M9H A;  4KIB A;  3FXL A;  4ZTJ A;  3W2A A;  3AKZ A;  2FJ1 A;  1T6S A;  1SD6 A;  2IA1 A;  4HPQ A;  3DCF A;  2HEO A;  2VJ4 A;  3MZH A;  3WU2 C;  5KNL A;  2JRT A;  2AHQ A;  3I3L A;  3C1D A;  4RB0 A;  3ERM A;  1W5S A;  1OPC A;  3J80 Z;  1B72 A;  2YSR A;  2XGX A;  1NG7 A;  1IO2 A;  4WXC A;  3WTW C;  2F5V A;  3LSH A;  3Q0V A;  3M1E A;  1WJB A;  1FBU A;  1G3T A;  3ZMS A;  1R7J A;  4PSX A;  1P9Q C;  1X2N A;  2W7N A;  5TIS C;  3P9C A;  4G6D A;  3BTL A;  3FBI B;  3SDB A;  2BY3 A;  1FJL A;  1BW6 A;  2WV0 A;  3OYH A;  1WSU A;  3LWF A;  4K2E A;  3KEY A;  1WQ2 A;  4RDU A;  1BI3 A;  5FKN A;  2VIX A;  4IEJ A;  3E3V A;  1ZH5 A;  3DKY A;  3K4N A;  4IRH A;  4YEL A;  1QGP A;  2BHZ A;  4GYG A;  2TRT A;  2ZME C;  1QVT A;  2HDW A;  4FIS A;  3BC8 A;  3UKG A;  5FLM J;  1ZR2 A;  3MEX A;  4G7O F;  1HQC A;  3I56 I;  2CJJ A;  4DYC A;  4DQ2 A;  3CDL A;  3TBI A;  3K70 C;  2ZJQ F;  1IN5 A;  4BDY A;  3HB9 A;  1T98 A;  3R61 A;  1J5Y A;  1FY7 A;  4Q48 A;  5CVJ A;  1Y6I A;  3CCU I;  2PMZ N;  1Y0N A;  2GIZ A;  3DEU A;  1GUU A;  3HOS A;  2FOK A;  1Y0U A;  1XX5 A;  2GAU A;  3ZCO A;  4AIK A;  3NEU A;  4M71 A;  1WGX A;  5C4X J;  2H8R A;  3PQK A;  4LIU A;  3WTT C;  2HYG D;  4JBA A;  2H6C A;  1D3Y A;  1XGM A;  2F2E A;  2P6T A;  3LA3 A;  3TDU C;  5IOY A;  4B3X A;  4ENM A;  4A3L J;  2F4I A;  3V7R A;  5IY5 H;  1MMS A;  4XRS A;  4A12 A;  1FOK A;  4ZC3 A;  1E0E A;  3VSK A;  1W36 C;  4ANJ A;  4NHJ A;  2RC4 A;  1OYI A;  2XC7 A;  1JXS A;  3PUF A;  3ROU A;  1K78 A;  1KGS A;  4Y3O A;  1T38 A;  2E1M B;  5TRD A;  1MH3 A;  3DU6 A;  1X19 A;  1HLV A;  3AG2 H;  3A0B C;  1G4D A;  2OJE D;  3L2Q A;  1H9T A;  3R6S A;  2KJB A;  2O03 A;  4PUS A;  1F4K A;  1ZRE A;  1DP7 P;  1Z77 A;  2KKO A;  4M6Y A;  4LOC A;  2KT0 A;  5FLX K;  3T8R A;  3GTG J;  1D1B A;  3I55 I;  3H0D A;  4IHS A;  1N75 A;  1RR8 C;  3QP5 A;  2L7F P;  3KIO A;  1FBS A;  3CCS I;  5CPR B;  2PEX A;  4KIF A;  4LG3 A;  5DCF A;  4D7M A;  5GAH J;  2O7O A;  2W82 A;  3E0J B;  2EIK H;  1RUN A;  1RC9 A;  3KEQ A;  1ZAR A;  1IRF A;  1LNW A;  1VI0 A;  4XNF A;  4XKC A;  3CO7 C;  4CDG A;  1Z1D A;  2VQL A;  1X2M A;  1JUS A;  1QHG A;  4CH7 A;  4LK1 F;  2M0C A;  1YI2 I;  2FRH A;  3Q9V A;  4KIC A;  1R5G A;  4OIQ F;  2HTJ A;  5EG0 A;  5F1J A;  4BY1 J;  3AL0 C;  1RPW A;  3T1B A;  1I27 A;  2OD5 A;  3VOE A;  1FMW A;  1MGT A;  3FXK A;  2L5Q A;  3BTI A;  5J47 A;  3LAP A;  1ZLJ A;  2DU9 A;  3R0J A;  3S16 J;  4L0Y B;  3EUA A;  2DK8 A;  5DUI A;  3CCJ I;  2M4K A;  4W1U A;  1OJL A;  1Z3Y A;  2MD0 A;  5L3B A;  2LDU A;  1Y56 A;  3VB2 A;  4CYC A;  1R6R A;  3RKY A;  5D4S A;  1MBJ A;  2BV6 A;  1BBY A;  2MAB A;  3CJQ B;  4ZZD A;  1J59 A;  3EYI A;  1R5H A;  1W7P A;  2ZXH A;  5C4J J;  3U1D A;  4HOB A;  2B0L A;  3SEQ A;  2W48 A;  3CUO A;  4LG0 A;  1BN5 A;  1V5F A;  2EFW A;  1AWC A;  4A3K J;  4B44 A;  3ESW B;  1VQM I;  3QQA A;  2R7R A;  1WJ5 A;  2EV6 A;  2K40 A;  3JAM Z;  4S0H B;  3GWZ A;  2VC0 A;  1Z91 A;  2JUC A;  2AXL A;  3MAJ A;  2ELK A;  4XLP F;  4HF2 A;  5ICE A;  5LHI A;  1PUE E;  2ISZ A;  3BR0 A;  5KK1 A;  2NVU B;  1EJ9 A;  5DD8 A;  2JRM A;  5EYR A;  1JT6 A;  5A2Q K;  4M9S A;  4J01 A;  2RRE A;  4XSZ F;  4BJ5 C;  3FDY A;  3IC7 A;  4GRI A;  3F8C A;  3K69 A;  1WFX A;  1IUF A;  2CH0 A;  3ZQG A;  2Z2S B;  3GTM J;  3JTG A;  2M30 A;  1OQY A;  5F64 A;  5GTI C;  3PIO F;  2EZL A;  3M07 A;  4G6T B;  2L01 A;  3AAF A;  4J00 A;  4N0B A;  3B6C A;  3KFW X;  1XSD A;  5FKM A;  3S1N J;  2HI3 A;  3DTE A;  2M34 A;  1NK3 P;  3ZQF A;  4R1H A;  1KQ0 A;  2VT2 A;  3IUO A;  4GCV A;  1P4W A;  2LYC A;  2NS0 A;  3MKZ A;  3VWB A;  1ODD A;  3VOD A;  2EV0 A;  3Q0W A;  3FM5 A;  2PJR A;  4NBQ A;  1O7F A;  4JX4 A;  3E5X A;  5D5X B;  3HSF A;  4C2U A;  2QYO A;  1AKH A;  1VND A;  1ENH A;  4ESJ A;  3TO9 A;  3OSF A;  2R7Z J;  2ELJ A;  3JTH A;  1XMK A;  4HX7 A;  4A0Z A;  2DBB A;  4BL0 B;  4XN3 A;  2D1V A;  4I98 B;  3WTX C;  4KIG A;  3IRR A;  3ZQH A;  4NQW B;  5CVV A;  3CC7 I;  2VN2 A;  2KIS A;  3RPU A;  1ZQ3 P;  2M3A A;  2JA8 J;  1BJZ A;  2XB0 X;  1FMV A;  3OIQ A;  4W97 A;  2A69 F;  3D0S A;  3GO5 A;  3WG9 A;  4CSW A;  2ZBK A;  2DOF A;  1S7A A;  3OYL A;  2IJL A;  2P0W A;  2HDC A;  3JRD A;  1TBX A;  2HQ5 A;  5D4R A;  1IGN A;  2AQF A;  5EEG A;  1TLH B;  5EEA A;  3M8F A;  2KPM A;  2OAZ A;  3G1L A;  1U5T A;  5IYC J;  3UNG C;  5DCM B;  4C3H J;  2JVG A;  2C6Y A;  2KP6 A;  2LLK A;  4MEX F;  2UXN A;  5K7Z A;  2E19 A;  1I1G A;  3K4J A;  3EPZ A;  4PJM A;  3FIW A;  1H9G A;  2H94 A;  3G1O A;  3C2G A;  3I53 A;  5HS8 A;  5ICF A;  5GPC A;  5J8F A;  1JKP C;  1FTZ A;  2OCE A;  1U9N A;  5DYM A;  4G12 A;  1RZ4 A;  3BTC A;  5HDG A;  1X3U A;  1VQ4 I;  2ID3 A;  4ZYE A;  4NC7 A;  4LFU A;  3U1K A;  2MA3 A;  1U8B A;  2VKV A;  1REP C;  4HX8 A;  3ZOB A;  4GXO A;  2IS6 A;  1WJC A;  2EBI A;  1J9I A;  4S05 A;  4HLY A;  1YTY A;  1MBH A;  3AL0 B;  2R7F A;  2KRF A;  4KMF A;  2B63 J;  4PJN A;  4M3E A;  2XGE A;  3SZT A;  5L3E A;  5IT3 A;  2IP2 A;  3E7L A;  4TV7 A;  4G7H F;  1W4M A;  4I01 A;  3OWT A;  1A35 A;  2JA5 J;  4XL9 A;  4GO1 A;  2Z1D A;  4LGW A;  1IRZ A;  4XLE A;  1B6A A;  3OL4 A;  1ETX A;  1VQ6 I;  2DA5 A;  2HQR A;  2ZO4 A;  1Z9C A;  5H20 A;  2L7K A;  5FRO A;  2WWY A;  3GTJ J;  4XKV A;  4EJV A;  2Y75 A;  1T0F C;  2HOE A;  3TO7 A;  3OYA A;  1IXR C;  1ON1 A;  3M8J A;  1UB9 A;  2OBP A;  3I9V 2;  4PJJ A;  4DOZ A;  4IOC F;  2NS7 A;  2W25 A;  1HC8 A;  3SFZ A;  2KIQ A;  3KYD B;  3HHG A;  1YQA A;  3FMR A;  1A6I A;  1U9O A;  2QCO A;  3S32 A;  3TKY A;  2DFH A;  4MFD A;  4HV5 A;  4XN0 A;  1J7K A;  4P5O A;  1VFC A;  3RTR A;  4MGR A;  2IS2 A;  4CCL A;  5LD2 C;  4CXF A;  2OV7 A;  3BY6 A;  1LQ1 A;  2YX7 A;  2VAS A;  2MG4 A;  2N8G A;  3JW4 A;  2A6E F;  1QBJ A;  2LK2 A;  1WJF A;  2FXA A;  2XF5 A;  4JP0 A;  1R49 A;  3BOQ A;  3DPL C;  3BG3 A;  2CFX A;  2UXX A;  2M5W A;  4DGW B;  1YJ9 I;  2CW0 F;  3HL2 A;  1G2H A;  2GQQ A;  2X0L A;  1QHH D;  2LTP A;  5E3N A;  2MH9 A;  4UUT A;  4N9I A;  2P81 A;  2ID6 A;  2VB6 A;  1XC5 A;  3K2A A;  4EGY A;  2IXS A;  1GDT A;  5ERI A;  5M5W J;  1F43 A;  2OPT A;  1FC3 A;  1OIS A;  4LLL A;  3QRF F;  2KL4 A;  2XDV A;  4BXU A;  2UV1 A;  3LMM A;  3T5X A;  5D5U B;  1YFH A;  1MDM B;  1MJB A;  3J80 K;  1IV6 A;  2AXT C;  1MND A;  2GZW A;  4FX0 A;  4P1W A;  2PLY A;  1I50 J;  3S2D J;  1RR7 A;  2R7U A;  2GXB A;  1KON A;  5E1W A;  1F1Z A;  3KP7 A;  2E2H J;  4BNC A;  2WV1 A;  2LBF A;  4F93 B;  1IDY A;  2DMT A;  2K7L A;  5LEK A;  2CMP A;  3S3O A;  2DT5 A;  4M74 A;  1K83 J;  3F8F A;  2R3S A;  3I71 A;  4I0A A;  2R7Q A;  1D0Y A;  1U0J A;  2KIM A;  4H4K C;  3KP6 A;  3EQL F;  1MD0 A;  4BEH A;  1X3W B;  2P4W A;  1MNE A;  3HSE A;  3W6J B;  4BAY A;  2RVC A;  1GVD A;  2EFO A;  5L3F A;  2LP0 A;  2E1O A;  4M9Z A;  4AYB A;  4E4H A;  2LY1 A;  2XVC A;  3ZQQ A;  2YS9 A;  5LGU A;  3L9F A;  1Z6R A;  3TL4 X;  2FOW A;  2ECC A;  4E7I A;  1FOW A;  5F0H A;  3DBH B;  3LA2 A;  3MZY A;  3D5S C;  3VSL A;  2EZK A;  4U87 A;  3PO3 J;  4EVI A;  3P9K A;  4II3 A;  1BIA A;  3ABM H;  1TNT A;  2NVY J;  5LRR A;  3W6V A;  4WK8 F;  1CF7 B;  1FEX A;  3K9T A;  3IRQ A;  3RQ4 A;  5KAF C;  1LDD A;  1D0Z A;  3BG9 A;  2A3S A;  2MC4 A;  4DYR A;  5D6F A;  4RLQ A;  3ZR8 X;  1T08 B;  4ZTF A;  1HDD C;  3LFU A;  2VBW A;  4Q4Z F;  4OIO F;  3DF8 A;  2CUZ A;  3WTU C;  1FIP A;  4CCM A;  1UCR A;  1MKM A;  3OYI A;  2DCE A;  1A6Q A;  4A93 J;  3VYS B;  1QVU A;  4XLA A;  2DJN A;  3K1N A;  3HTU A;  3TDZ C;  4IXA A;  1B8I A;  5HNF A;  3CO6 C;  2R7X A;  3DLA A;  2RNJ A;  3KP4 A;  2H1K A;  4PSW A;  3E6B A;  5KAI C;  4E7J A;  1Z0X A;  3GZ5 A;  1ETO A;  1P2F A;  3WTZ A;  4IQ4 A;  3CDH A;  3BJO A;  4NNJ A;  4F92 B;  2HDD A;  2CV0 A;  2B7E A;  4M9X A;  3W2V A;  3PO2 J;  2JZY A;  2L54 A;  5M5Y J;  4XID A;  4QTR A;  4KNY A;  3J7A Y;  1IRX A;  5L3C A;  2O8K A;  4O6J A;  5GP9 A;  2VI6 A;  1D8J A;  5EGO A;  2Y9Z A;  2R4G A;  4A3M J;  1K79 A;  5KCM A;  2DFF A;  3DXJ F;  4AC0 A;  5DTD A;  4YFN F;  3T8T A;  1KYZ A;  4WCG A;  1XMX A;  1YG2 A;  2PX9 A;  2X1D A;  2DK5 A;  4IQJ A;  1PDN C;  3RIR A;  1C0W A;  3HOW J;  1EV7 A;  1S7E A;  3FXU A;  3I4P A;  3F21 A;  5L3G A;  1JHH A;  1XG1 A;  1FPQ A;  3ZQC A;  2DAO A;  2ME0 A;  3K6G A;  2ZSI B;  1N77 A;  4XRS G;  1O3T A;  4KYW A;  3CC2 I;  1X1D A;  4N4N B;  2F4M B;  4MO7 A;  3CUQ C;  3LQR A;  2YPR A;  1V55 H;  3RSN A;  4B8X A;  3ECH A;  4X0G A;  2A61 A;  1LKX A;  4LD5 A;  5F27 A;  4OIP F;  3S15 J;  1HW2 A;  3FHZ A;  3A1Y A;  2LKP A;  3DKX A;  1D1A A;  4JQF A;  4U0Y A;  2NOG A;  3M7G A;  2L9V A;  4M73 A;  3OYM A;  1KYW A;  1RRJ A;  2COB A;  1BOA A;  1T39 A;  1SAN A;  1G3Y A;  2LY9 A;  4A5N A;  3A01 A;  2CO5 A;  3OS0 A;  4A3C J;  1BI2 A;  4M6X A;  1HKT A;  1BJA A;  4EGZ A;  2EH3 A;  3PFY A;  3Q9S A;  2R0Q C;  5HLH A;  2ZXW H;  5LFA A;  4U7D A;  3QPT A;  4HDU A;  1WRJ A;  2HOA A;  4XKW A;  2EPF A;  1S72 I;  2EK5 A;  1MBF A;  1HW1 A;  1ZG5 A;  1W0T A;  5FD6 A;  1LE8 A;  2CYY A;  3BJA A;  5K7H A;  2R7W A;  3H9Q A;  3CP8 A;  3VYR B;  1V4R A;  2FUG 2;  2G7H A;  1G3S A;  3K4M A;  3H3Z A;  2QM3 A;  1MIJ A;  4A3D J;  2IA0 A;  4HST A;  2X6O A;  2O0Y A;  2HXI A;  4OU0 A;  4WXD A;  3DV8 A;  2VOO A;  2DA2 A;  3QYF A;  5LHG A;  5IT9 K;  4HAM A;  4G8X A;  2E7W A;  5J3L A;  1B59 A;  4I7H A;  2DDA A;  1GXQ A;  2FBK A;  3K10 A;  3KCC A;  1RET A;  3W6K B;  4YIR X;  3MKW B;  4A3I J;  2QLZ A;  5E1Z B;  1UHW A;  4HDV A;  1HST A;  3CES A;  1SFO J;  3Q3S A;  3LOC A;  4LLG F;  1FBQ A;  3WTV C;  5LLQ A;  3BT9 A;  1RKW A;  2KFD A;  4U7B A;  2X9D A;  1X1P A;  1XTA A;  3KX2 A;  2YU9 J;  1B4A A;  3ELK A;  1UST A;  5DDG A;  5E3M A;  5F04 A;  2EWN A;  3BR5 A;  2OC6 A;  3OL3 A;  1IJW C;  2FNA A;  3G3Z A;  2NVQ J;  3PL8 A;  4UVB A;  4LLN A;  5HOO A;  3G1M A;  3M4O J;  2DA6 A;  1K4S A;  3WG7 H;  4L9T A;  3KP5 A;  2HOS A;  2EQR A;  1CGP A;  4O5V A;  2DMU A;  2P6S A;  4Y7N J;  1LPQ A;  1Z21 A;  5H6Q A;  3BJ6 A;  1QPI A;  2KRC A;  2AO9 A;  3KE2 A;  2IS1 A;  3QYB A;  2BW3 B;  1JT0 A;  5E79 C;  1SD5 A;  3KYC B;  3SFI A;  3VYU B;  4MFE A;  5E3L A;  1P7J A;  4KT5 C;  1JJ8 C;  3TW6 A;  1IUY A;  4PCQ A;  3JRI A;  2VL8 A;  1YS6 A;  4EM2 A;  5E18 F;  2IPQ X;  4A6E A;  3SJM A;  1YW8 A;  5ILV A;  1EH8 A;  1ZRF A;  2P7V B;  3QPH A;  4HX4 A;  4ZJZ A;  2EZH A;  1UHM A;  3P7N A;  2IGN A;  3CUQ B;  1P92 A;  1FOX A;  5J40 A;  2XF6 A;  3L7W A;  5F6F A;  3G73 A;  3TED A;  2NS8 A;  3IWF A;  1TNS A;  2HOT A;  2RGV A;  2XAH A;  1I39 A;  1OR7 A;  4BGD A;  3HUG A;  4ZDO A;  1F9N A;  4RB1 A;  2X6X A;  1N78 A;  1IZ1 A;  1RNL A;  2RQQ A;  1KU9 A;  2E1C A;  4ON0 A;  1J09 A;  4MQ9 F;  2QSF X;  2XAQ A;  1Y1V J;  3FXQ A;  3NRV A;  4CGZ A;  2UWM A;  1A5J A;  1LEA A;  1UG0 A;  3EYY A;  3HRT A;  4XON A;  4BQA A;  3EUH A;  2HKX A;  3H3U A;  1UAA A;  1S5L C;  3J81 K;  4XSX F;  2KLO A;  2DOE A;  1OYY A;  3SHF A;  1K78 B;  4EAT A;  1R58 A;  2DPU A;  1MBK A;  5IP6 A;  4BY7 J;  1FP1 D;  2OQR A;  3PFI A;  4F91 B;  3F8B A;  3GFM A;  2OCC H;  3GLX A;  4RAY A;  2R5Z A;  1K6O A;  2EV5 A;  4E7H A;  2VLA A;  4MNU A;  5D6E A;  2Z33 A;  2B9S A;  2VQG A;  1TTY A;  1TT0 A;  1A04 A;  5BPD A;  1LFU P;  4C2M J;  1FP2 A;  1G3W A;  5FKK A;  4A0Y A;  1FYK A;  3TP0 A;  1N25 A;  1W1W E;  1G6N A;  5JHU A;  4P9U A;  1O3S A;  4F3Q A;  3HOY J;  2HQN A;  4YEJ A;  4KIS A;  4I99 C;  3HM5 A;  1DU6 A;  3SQN A;  2E60 A;  2L02 A;  5FKL A;  2QSH X;  4B47 A;  1W5T A;  3C2B A;  2J5O A;  2XIG A;  4WF2 A;  3L1P A;  2WAF A;  4DZP A;  4JYK A;  1E3O C;  5IPA A;  2WBM A;  5EG0 B;  3F72 A;  3DTI A;  3WHB A;  1Z67 A;  5K1Y A;  3H0G J;  1O3R A;  4LB6 B;  1MH4 A;  2CUF A;  1XDS A;  4U0V A;  2VT3 A;  1R1U A;  1SFE A;  2VC1 A;  4CA0 A;  4IX7 A;  5LGN A;  3S1Q J;  2R7S A;  1JKO C;  1TT5 B;  4X1E A;  2R7D A;  1QZE A;  2Z3Y A;  2CV1 A;  1YW9 A;  2DFI A;  3M9A A;  1DDN A;  3HOV J;  3JSO A;  5ILU A;  3FX3 A;  1SFX A;  4A0X A;  1W7P B;  4MEY F;  1H8A C;  3W2W A;  2X1C A;  2Q2E B;  3OV8 A;  1UZC A;  3T0Y A;  4LG0 B;  5HS9 A;  1IG7 A;  4ZZL A;  2ADU A;  2KDO A;  5HDK A;  3IV5 A;  1POG A;  1A31 A;  1F36 A;  2NAZ A;  1BW5 A;  2DO7 A;  2LG4 A;  1SAX A;  4BQN A;  4ITV A;  5AIQ A;  2DTZ A;  3E6C C;  3V8K A;  2VXD A;  4BDZ A;  1QPM A;  2R7V A;  4UB8 C;  4FHT A;  1ETQ A;  4XLC A;  2W00 A;  1XGO A;  3A0H C;  3WTS C;  5M3F J;  3ASO H;  5B3S H;  2CW8 A;  3R60 A;  3JRC A;  2QKM B;  1WKM A;  1HDP A;  3CF2 A;  1ACI A;  1WJE A;  1ZRD A;  1WJD A;  2ZME B;  3G4S I;  1WH5 A;  3F3X A;  5GPA A;  3O8H A;  1KU3 A;  2V9V A;  1FOY A;  1XDU A;  1YW7 A;  2BY1 A;  5EZG A;  5FJ8 J;  3JR9 A;  2HVS A;  2FBI A;  2K9L A;  4LMY A;  3OIO A;  1XD7 A;  2P5L C;  3DTK A;  1OCP A;  2DW4 A;  5JI6 A;  2RDP A;  1VQK I;  1TZL A;  2X6Y A;  2ECB A;  4N4O B;  1JJ6 C;  3AG3 H;  4MQV A;  4A3B J;  3QAH A;  2VE8 A;  3BQZ A;  1X1A A;  4M3F A;  5B66 C;  5BS6 A;  1KU7 A;  2KQR A;  2DQR A;  2JA6 J;  4FE4 A;  2HYJ A;  3HHH A;  3VEP A;  3I4M J;  1DPR A;  1YJW I;  2FE3 A;  5E17 F;  5BOX A;  2X85 A;  4NDL A;  2OTL I;  2F5C A;  3CCL I;  4ENN A;  1IAW A;  2ZXJ A;  2ME6 A;  3OSG A;  2GIV A;  3L2V A;  1G59 A;  1S29 A;  2VXZ A;  3FM3 A;  2R93 J;  4RAZ A;  3IAM 2;  4V19 K;  1AOY A;  1IXS B;  4D7N A;  4BQQ A;  1R4N B;  3OR1 C;  1QO0 D;  4PK4 A;  5F1R A;  1KA8 A;  4MHG A;  3TGN A;  1DQU A;  3REO A;  1UMQ A;  3FKI J;  2P5V A;  1WJA A;  3GUD A;  4HSR A;  3PNY A;  3OR2 C;  2GA2 A;  4C30 A;  5FO5 A;  2F5D A;  2YR2 A;  4XOR A;  4HQM A;  4NQW A;  1DUX C;  3QU6 A;  2QEN A;  2X51 A;  3KP3 A;  4BBS J;  1I1S A;  2R7O A;  3I59 A;  2FSW A;  3S2H J;  3ZMD A;  1YIO A;  2XRL A;  4BBR J;  4BJT A;  1ZGJ A;  1TQM A;  3IWZ A;  4AVZ A;  1MMG A;  3HOU J;  4E7S A;  1GVJ A;  3ISP A;  1PUF B;  2DN0 A;  3F6O A;  2HU9 A;  5GAD J;  2IS4 A;  1ETK A;  2K5C A;  2M7B A;  2ZJP F;  2E1N A;  1OCT C;  2JJ7 A;  5DCM A;  1OMI A;  1ORK A;  3CJR B;  5F0F A;  5FKO A;  3DLL F;  1HSJ A;  3PNV A;  3LSR A;  2E2J J;  2DOD A;  1VQ9 I;  3GF2 A;  3HRS A;  3G71 I;  1YHQ I;  2A68 F;  3RZD J;  3BPV A;  2QWW A;  4HF0 A;  2DYS H;  3F9K A;  1VQO I;  1R1V A;  3GME A;  1YJN I;  5C3E J;  1R1T A;  3M8E A;  4II2 A;  2V6C A;  4ZDP A;  1Z6T A;  1Y1W J;  2WC2 A;  3OYE A;  3WTY C;  3JCU C;  4C9Y A;  1ZGW A;  1PYV A;  2F4O B;  2DA1 A;  2M8G X;  2CUJ A;  2CW7 A;  1VTN C;  1ULY A;  1QA6 A;  4IPA A;  4LIT A;  2YX4 A;  2E36 A;  3K4C A;  5IYB J;  4IJA A;  1ZG3 A;  3GZ6 A;  2OUM A;  3MD2 A;  3EET A;  5EZH A;  3HPH A;  2QBY B;  2MC3 A;  3OYF A;  1HBX G;  3IHU A;  3O6B B;  4BHC A;  1ETW A;  1W5C C;  4JOM A;  1YOV B;  1MW7 A;  2VPR A;  3LSI A;  2ISY A;  2NVX J;  2CG4 A;  5CJ9 A;  2E34 A;  2BZT A;  1S9H A;  5J4V A;  1K6Y A;  1MSE C;  4DJA A;  4KN4 X;  4M72 A;  4Y17 A;  5FLV A;  2EIL H;  3R0A A;  1W0U A;  5B1A H;  3HJE A;  1UG2 A;  3CME I;  3RZO J;  1U3E M;  5J6X A;  3MKL A;  2XPU A;  2YUS A;  2L9S A;  1ZR4 A;  1R5I D;  2X1E A;  5HLT A;  2QVO A;  2PMU A;  2V9K A;  2JMW A;  4HNV A;  3OS1 A;  4E70 A;  2V1D A;  1JHF A;  4DBR A;  3ZQL A;  2ZJ2 A;  2FNP A;  4HF1 A;  3QP6 A;  4AIH A;  3J7Z I;  2V7F A;  3B02 A;  1F5T A;  4EM0 B;  2MSY A;  5EDN A;  1APL C;  1R71 A;  1FNN A;  4V2F A;  4D0P A;  4RGR A;  2V6E A;  3E6D A;  1DGR M;  2E5Z A;  3TOB A;  2OA4 A;  4BE0 A;  4I02 A;  1ZN2 A;  3SZP A;  3CD6 I;  1JTX A;  1MMA A;  1BI1 A;  2VBY A;  4AID A;  3I64 A;  2ZNZ A;  3IH3 A;  1FSH A;  1B9M A;  2AQE A;  2ZCW A;  1Q1V A;  2K4B A;  5HNH A;  2ZKZ A;  2HR3 A;  5H6R A;  4O3M A;  4L9J A;  1RI7 A;  3KZZ A;  1MMD A;  5FLX Z;  4HYE A;  3KET A;  1OFC X;  2DOA A;  2RKH A;  3TP3 A;  2UZK A;  2DA4 A;  3TMO A;  4LJZ F;  2HPM A;  3HDD A;  1MDM A;  2H6B A;  3BRO A;  2BHY A;  3BQY A;  4CCN A;  5AON A;  5D8K B;  1X4O A;  2EFQ A;  2FU4 A;  2IBD A;  1ZHF A;  4UV9 A;  3Q5F A;  2KIU A;  1BC8 C;  1NHA A;  2BE5 F;  4BE2 A;  1TWC J;  1SEU A;  1OCR H;  2LH9 A;  3KPH A;  4DYQ A;  1R4M B;  2MBF A;  4KIT B;  1IW7 F;  2OZU A;  1EA3 A;  2A5Y B;  2JPC A;  2MGQ A;  2I10 A;  3BDD A;  1I6X A;  3B6A A;  1GHC A;  2ACJ A;  2IRF G;  1Y39 A;  4HA8 A;  4OOI A;  2HQA A;  2YU3 A;  4XLH A;  3MMY B;  2EFP A;  2W84 A;  2XPV A;  4JK1 X;  5EF6 A;  3V42 A;  1S6L A;  1UHS A;  1DP3 A;  4ETS A;  2L7M P;  1CQT A;  4I09 A;  2P5K A;  4E6K G;  1D1C A;  1R22 A;  4A3F J;  2PJP A;  3L2U A;  4X6A J;  3M1C A;  1CF7 A;  4UUV A;  1T33 A;  3N4M A;  4FCY A;  1ZKG A;  4BXF A;  3LNQ A;  5ICG A;  1FX7 A;  3G2B A;  5CYV A;  4ZYA A;  3EDP A;  2PN6 A;  3N05 A;  5K5R A;  3RKX A;  3R4K A;  4ENK A;  4UXN A;  4XBF A;  2K9M A;  3FXR A;  4B09 A;  5A2Q Z;  3MZ8 A;  2XGD A;  3QPL A;  4CYD A;  2M0M A;  2NXN B;  3BR3 A;  4BU2 A;  1VQP I;  2VOP A;  4D5F A;  4IRI A;  1XMA A;  2IAI A;  3IAS 2;  3DWL E;  4EQQ A;  4RB2 C;  1WI9 A;  3BG7 A;  1AA7 A;  3C7J A;  2TCT A;  1PVE A;  2ZFU A;  2ZSH B;  1OLT A;  2F48 A;  5EJC A;  4LK0 F;  3HG9 A;  2GXA A;  3ABL H;  3WGI A;  4D5C A;  5K7F A;  1XGS A;  2DTR A;  3PSF A;  1NTC A;  3MFK A;  1XSV A;  5IP9 J;  3V7S A;  5ED4 A;  3LAJ A;  2O6G E;  5CQE A;  3DEE A;  5BNG A;  1ZG1 A;  2LF7 A;  2LRE A;  2Y9Y A;  4P55 A;  3O8G A;  3HYI A;  5E1X A;  3GTQ J;  2M7A A;  3U2R A;  1OKR A;  1W7P D;  2R7T A;  3S1R J;  3ABK H;  3D5R C;  4BS9 A;  2Q8K A;  2ICW G;  4IHY A;  3QU3 A;  2CV2 A;  2VPL A;  4I0B A;  1TW2 A;  4QLC U;  4YRV A;  2ESH A;  1E2X A;  2HXO A;  4EJU A;  3GBG A;  3F6V A;  3HC7 A;  4GYI A;  3GW2 A;  1SC7 A;  1S3J A;  1KU2 A;  1L3L A;  1JE8 A;  1BR2 A;  2JUG A;  1VQ7 I;  2ESN A;  2VJJ A;  2M1B A;  2BXY A;  3O3K A;  3J7A O;  5JVG F;  3KLN A;  1K4T A;  2V79 A;  4PZJ A;  5JLX A;  3JAM K;  1J2X A;  5FB2 A;  3COA C;  3RI4 A;  4HG2 A;  2PFB A;  2FML A;  4XKB A;  5JR3 A;  1IRG A;  2IEK A;  4OMZ A;  1ON2 A;  4I6Z A;  3S93 A;  2VE9 A;  1YRN A;  3PSI A;  3G6E I;  1HA8 A;  1FSE A;  3PUB A;  2BEO A;  5H2F C;  3GVA A;  3ULQ B;  4AIJ A;  2Z99 A;  4IOA F;  2LRD A;  4V2G A;  1IC8 A;  2JWT A;  3KZY A;  2DQL A;  4CCJ A;  1BC7 C;  1FTT A;  3LST A;  3V8J A;  3K1P A;  2XKO A;  1BM9 A;  1XGN A;  4HLX A;  3E6M A;  2Y0M A;  3RQI A;  4Z6Y A;  3U9G A;  1SMY F;  4UUS B;  4B3A A;  3HOT A;  3F22 A;  2EJR A;  2DI3 A;  2H1L A;  3F8M A;  2K3F A;  4EMS A;  1K61 A;  2NVT J;  2R5Y B;  5DEQ A;  2V1X A;  1G8X A;  4CZZ A;  2L9N A;  4E7Z A;  1LE8 B;  4BXX J;  4KT6 A;  2KMU A;  2XAF A;  1SFU A;  3RPU D;  2EA2 A;  4UNO A;  5JLW A;  3BR1 A;  5LEJ A;  2NRA C;  2NOJ B;  3GLL A;  2VKH A;  1OCO H;  2HS5 A;  4XOP A;  3HRM A;  4BKX A;  3BG6 A;  3HEF A;  4HEA 2;  4ENJ A;  1TC3 C;  4RAG A;  1UJ8 A;  3AG4 H;  4FTH A;  5M3M J;  3HBL A;  3LFK A;  4WXH A;  3DQV C;  2D45 A;  3WHC A;  3ZP5 A;  3PM1 A;  3HGG A;  4PGH A;  4CZC A;  1P4X A;  3BG5 A;  2JSC A;  2VON A;  4PDK A;  2WA0 A;  2FMY A;  4HZF A;  3CCE I;  2W1O A;  2JSP A;  2MW8 A;  3JRF A;  1HF0 A;  1FT9 A;  2V9P A;  1EH7 A;  4YFX F;  3JRA A;  4XM3 A;  2F6C A;  2NNY A;  3PJR A;  4ZH4 F;  5FRM A;  4QPQ A;  3RPQ A;  1FWZ A;  5HS7 A;  2A6T A;  1ERD A;  1ONV A;  5KHD A;  2X6W A;  1HKQ A;  1ETV A;  1MSF C;  1B72 B;  1HKS A;  1JUM A;  4G9Y A;  3GXO A;  3OYB A;  4HQE A;  3LSJ A;  4EJW A;  2DFE A;  3VPR A;  2XAG A;  2K9N A;  3VFZ A;  3H9G A;  1BI0 A;  4AU7 A;  4BHP A;  5B1B H;  3RYP A;  2DT6 A;  2IGM A;  1XPX A;  1ZEL A;  1YIJ I;  1JTY A;  1STZ A;  2K02 A;  1SD4 A;  2PQ8 A;  4BQO A;  1Z3X A;  2K9Q A;  2VJI A;  1TWF J;  2I5U A;  3OY9 A;  4UB6 C;  2DLL A;  3E97 A;  1SVL A;  1HW5 A;  1XS9 A;  3C2H A;  3CMM A;  1V54 H;  3K4L A;  4GDF A;  3OYG A;  3OYD A;  1X58 A;  1D8K A;  2VOD A;  5K5Q A;  3I4N J;  1TP4 A;  2BVM A;  3WE2 A;  4C3J J;  1GV2 A;  1U6G A;  4YFK F;  2ZJR F;  1IV8 A;  1IN8 A;  3FXM A;  3OOU A;  1WI3 A;  2Y0S N;  4L18 B;  2BBY A;  4AD9 A;  1J0R A;  2A07 F;  4GFB A;  1M1E B;  1IN7 A;  3K4B A;  1U8R A;  2BW3 A;  2X48 A;  3BWG A;  2LR8 A;  4CO8 A;  3M3Y J;  2K3P A;  3ZXS A;  1TQP A;  2XB5 A;  3WGH A;  3CCQ I;  4ASN A;  1TWH J;  1TL8 A;  4M6V A;  4HBL A;  1LFP A;  3D5L A;  3DBL B;  3QOE A;  4PFO A;  6PAX A;  1B9N A;  3TQN A;  1IDZ A;  4RGS A;  1X4P A;  4A3G J;  2KJC A;  1WVR A;  4Y13 A;  1LDK B;  3HUG B;  3HTS B;  4RGX A;  1TWG J;  3QOP A;  4IVN A;  3CUQ A;  1SVO A;  2HKO A;  1IF1 A;  2DMP A;  4M3D A;  2IGK A;  5GAE J;  2JQ7 A;  1I3A A;  2BGC A;  2IT0 A;  1SFK A;  2ZB9 A;  4FET A;  4XRF A;  4KUM A;  4EEF G;  4FX4 A;  2OU2 A;  3A02 A;  2GLO A;  3S3M A;  3GTL J;  2AS5 F;  5M5X J;  1LJ9 A;  2LNB A;  3HZJ A;  1D5Y A;  3L09 A;  4EM1 A;  2R5Z B;  1XN7 A;  1BR1 A;  2VQH A;  3FBN B;  3K1M A;  1U5T C;  2RQP A;  1V3F A;  3H3V K;  3WE3 A;  1IN4 A;  2JTV A;  3DFG A;  3QWL A;  3L2W A;  2EZI A;  3KZI C;  5J1R A;  2Y48 A;  1JUP A;  1H0M A;  3FK7 A;  2E5N A;  2HTS A;  2KRH A;  1O4X A;  1V5E A;  3S1M J;  1E3P A;  4A69 C;  4CCO A;  2BY0 A;  1RIO H;  4EV0 A;  1OYW A;  1NK2 P;  1ITY A;  5D8L B;  2OTJ I;  2XGC A;  4MLO A;  1B1B A;  4KJZ A;  3TO6 A;  4L9V A;  5E20 A;  3H1C A;  4NB5 A;  4XR6 A;  1NG6 A;  2G7U A;  3GX4 X;  2HWV A;  1I5Z A;  1SAU A;  3BR6 A;  5ILS A;  1S7O A;  5CVU A;  3GYH X;  4CIC A;  1VQ8 I;  5D5V B;  3JSP A;  4UVA A;  2Y69 H;  4B1R A;  3ZMU A;  5L3D A;  3SZG A;  4F52 A;  2NNN A;  3GEZ A;  3NWS A;  1H89 C;  2EIN H;  3ML6 A;  4YII A;  3WU0 A;  4DNC A;  2CRG A;  2JT1 A;  2GA1 A;  2EB7 A;  4CYC B;  4JX6 A;  5J4Y A;  3MWM A;  1XCV A;  4BH9 A;  5D5W B;  4NC6 A;  2KZG A;  2DA3 A;  3QYE A;  1D5V A;  4L0Z B;  9ANT A;  2LFB A;  1FYL A;  3OYJ A;  1SVM A;  3I0T A;  1U2W A;  4OAY A;  2ZNY A;  2JVH A;  4FE7 A;  4M3G A;  1MJ9 A;  3BZC A;  3CCY A;  3WGG A;  3X2Q H;  2LD5 A;  2FD5 A;  2W85 A;  1WCM J;  2H27 A;  2XKP A;  2WAQ A;  2QSG X;  5LGT A;  2L2O A;  2COM A;  1MMN A;  4XLF A;  2XHK A;  4EJT A;  1WHU A;  2QUF A;  3P9I A;  5FGM A;  2Q2E A;  2STT A;  3KYL A;  3CLQ A;  4P9F A;  2FX0 A;  3ZN0 A;  5DM6 F;  1RKT A;  4KA4 A;  2ELH A;  4C2T A;  4A5M A;  1BA5 A;  3LSG A;  1ZYR F;  2K4J A;  3FHN A;  1MBE A;  3F23 A;  4L5J A;  3CCR I;  2LKS A;  2TDX A;  2XPW A;  2STW A;  2W4S A;  2OF7 A;  1FZP B;  1VF9 A;  4S04 A;  2XRN A;  1TWA J;  3HKZ A;  3L2R A;  1XB4 A;  2ZME A;  4NUB A;  5B5E C;  2XAU A;  3F0C A;  3SXY A;  2Y2Z A;  1Q1H A;  1BR4 A;  2CGP A;  3AG1 H;  2Z9O A;  2E35 A;  4I76 A;  2PJR B;  1KQ8 A;  1XCB A;  3OMY A;  3QOD A;  4G94 A;  3A2K A;  3H35 A;  2GM4 A;  1X1B A;  1AKH B;  3RCO A;  4XRM A;  2DXI A;  2A6H F;  3S17 J;  2D5V A;  4MTE A;  2JA7 J;  2A5W A;  2M87 A;  2QKL B;  3E5Q A;  3DEW A;  5HDN A;  5JVT A;  3BCA A;  4BJ6 C;  4ZYG A;  2DDB A;  4Y15 A;  1R23 A;  2LOO A;  4F7Z A;  2FF4 A;  3JRE A;  3ZPL A;  1KQ9 A;  1T95 A;  4DIQ A;  2FQ4 A;  5AIP A;  1IN6 A;  2K9S A;  3VDX A;  1SMT A;  2WB1 A;  3L2C A;  3S3N A;  2GXG A;  1T8I A;  3FIS A;  5DD4 A;  3GTP J;  2PMH A;  2BXZ A;  1OCZ H;  1U5T B;  3ERE D;  2G0E A;  4AVP A;  4XIC A;  5IT9 Z;  3I59 B;  2ETH A;  4UVC A;  4E7L A;  2WAQ N;  4FQG A;  1AHD P;  4P96 A;  4IF4 A;  1P4A A;  4R79 A;  2DMN A;  3RJP A;  2K27 A;  4MIM A;  4ESF A;  3KP2 A;  2DPD A;  4IHT A;  3BCB A;  1GT0 C;  3DKW A;  1MNM C;  1LFB A;  5HOD A;  4HRI A;  4PFP A;  1VZ0 A;  1E3H A;  2L4M A;  2MD5 A;  1YO5 C;  2MLG A;  2H8W A;  3OS2 A;  3CF5 F;  4EJO A;  5DUK A;  2GBY A;  3QPS A;  4KFC A;  1JKR C;  1L0O C;  4NC8 A;  2KIF A;  1PUF A;  2DMQ A;  2EIM H;  3CCM I;  2HVR A;  2HGC A;  1MZB A;  2HVQ A;  2IA2 A;  3GFI A;  2O5R A;  4RLF A;  4Q5S F;  3DU5 A;  4RM2 A;  1MJA A;  3HKZ N;  1NH3 A;  3HOX J;  5HLG A;  2A05 A;  2XAJ A;  2VKD A;  3S14 J;  4OMY A;  4BE1 A;  4ZYH A;  4IHV A;  3FXO A;  3RDI A;  1ZK8 A;  2JPB A;  5DV5 A;  4CUG A;  1QU3 A;  3HXL A;  4UV8 A;  4RGU A;  3CDI A;  3I5U A;  1KZH A;  3AFH A;  3CQZ J;  5JFR A;  1P7I A;  3JRG A;  4N9H A;  5J1U A;  2VJ5 A;  2VBZ A;  1O7L A;  2QQ8 A;  3A03 A;  1YIT I;  3C3W A;  1R9T J;  3CJT B;  3LA7 A;  4PJ0 C;  1YX5 A;  4QIW N;  3B73 A;  4QWQ A;  2XSJ C;  5HVQ C;  2L4A A;  1PP8 F;  2CSO A;  2V4J C;  4LB5 A;  4DZJ A;  1A36 A;  2QBY A;  1WH7 A;  2CQN A;  2QF7 A;  2EIJ H;  2WB1 N;  3RYR A;  2JA2 A;  3HSR A;  2HPI A;  4WWC A;  4BUP A;  3H5A A;  4KN7 X;  5K5O A;  2M2E A;  4G6Q A;  1BIB A;  3RKW A;  3LSK A;  1Z7L A;  2Q0O A;  3VYT B;  2R92 J;  2LF8 A;  2CQX A;  3MKY B;  1JGG A;  4BAC A;  5FRN A;  4BYY A;  2G9W A;  2ZC2 A;  3H9J A;  3L00 A;  1ETY A;  2V1N A;  5BMZ A;  5HLI A;  4FAS D;  2VUM J;  5GAG J;  2XAS A;  5E8I A;  3CLO A;  3IH4 A;  1R00 A;  3I58 A;  2CQK A;  1LB2 A;  4AUX A;  3J81 Z;  4OAZ A;  3ZMT A;  3BZ6 A;  2M4G A;  4KMU X;  1RUO A;  3ABU A;  4RMN A;  3H5N A;  1VQ5 I;  3FF5 A;  3BP8 A;  1YLF A;  2HYF A;  3V7C A;  3ZN1 A;  1HCR A;  2RAE A;  3KLO A;  3OYC A;  4A3E J;  2HZT A;  1YS7 A;  4RAF A;  4CCK A;  2I8D A;  3FKJ A;  2E71 A;  1LVK A;  2W57 A;  3FZV A;  1JI8 A;  5FFZ A;  3GCM A;  3OOP A;  4PJL A;  3NAU A;  2LBF B;  2PBI A;  2E2I J;  1WZ2 A;  3CC4 I;  3ZRG A;  1P6R A;  4U0W A;  1I3Q J;  2K86 A;  4R8H A;  3H36 A;  4HNU A;  2QEX I;  3E1S A;  3WU1 B;  4C3I J;  1EH6 A;  2WAE A;  4XLN F;  4BEH B;  1Y8Q B;  2LC2 A;  1YX3 A;  3K4K A;  4A2U A;  3CMA I;  4HV6 A;  1H88 C;  2FEZ A;  2P8T A;  3D1N I;  2Q1Z B;  2VKE A;  3IP4 B;  1LEB A;  5LHH A;  5BPI A;  5FFX A;  3H92 A;  1UFM A;  2E7X A;  2RV8 A;  1EF4 A;  1I6H J;  3NQO A;  2DYR H;  1LUJ B;  3BR2 A;  5DM7 F;  1J75 A;  4Y33 A;  3OIP A;  3ZMZ A;  3NAR A;  2V1U A;  1X1C A;  2F5F A;  2OQG A;  3FXJ A;  3Q0U A;  3PIP F;  3IL2 A;  3DBR B;  1FYM A;  4IHX A;  1V5G A;  2KHM A;  1AU7 A;  3E5U A;  3K7A J;  2M8E A;  2RNG A;  1FLI A;  3U21 A;  5LBQ A;  1EKE A;  1GV5 A;  1Y8R B;  4F55 A;  4U88 A;  3OYK A;  4BHB A;  1GXP A;  5F0C A;  1R36 A;  1TW3 A;  2DA7 A;  3K0L A;  4KDP A;  1E17 A;  4ZDL A;  2X4H A;  1ZAO A;  1QNT A;  3BPX A;  1JGS A;  4MTD A;  1O57 A;  3LQQ A;  1YYV A;  1QRY A;  3DP7 A;  4I2O A;  4CHU A;  2BY2 A;  2Y31 A;  3P5J A;  4RS8 A;  4DW6 A;  3FMQ A;  1HOM A;  2FA5 A;  2GOX B;  2IW5 A;  1B8I B;  3HIF A;  1U78 A;  4QSH A;  5CVR A;  3JRB A;  4HW0 A;  2KZV A;  4B4C A;  4IO9 F;  1D0X A;  2QQA A;  4HNT A;  3ZQI A;  1BL0 A;  2PI0 A;  3GTK J;  4J19 A;  4GGG A;  2L9R A;  4L5E A;  5IOZ A;  2HNH A;  3SDG A;  1DU0 A;  5LRS A;  1FIA A;  4IKF A;  3DPU A;  2D1H A;  2QQB A;  3W3C A;  2CS3 A;  4M3B A;  3A4C A;  5J1Y A;  1YE9 A;  3V4G A;  2GWR A;  3IKT A;  3LSP A;  1T0F A;  2CQ7 A;  1MBG A;  1O3Q A;  3S8P A;  2QQ9 A;  2JK3 A;  2IVM A;  2MLK A;  3HRU A;  3HPG A;  2GOM A;  3HOZ J;  2WY7 Q;  2FBH A;  1VQN I;  1ZTR A;  3OYN A;  3CMY A;  3CJN A;  5EGO B;  5C44 J;  2EFN A;  4ZYD A;  2NYX A;  1JKQ C;  1Z05 A;  2HFH A;  2O9L A;  1BOB A;  2O8X A;  3I54 A;  4ABZ A;  2LMD A;  5ICC A;  3CP2 A;  5E3O A;  4G7Z F;  3F8N A;  1WWX A;  4XK4 A;  2CFO A;  1USS A;  1GLN A;  3IH2 A;  4XOT A;  3MN2 A;  2QGU A;  3SYT A;  2P7C B;  3PNT A;  2D2W A;  5EEH A;  3ABT A;  2OZ6 A;  3S2W A;  4AYB N;  4D1Q A;  2Y30 A;  2DJI A;  2V26 A;  1PP7 U;  2MYS A;  2VQC A;  1ZLK A;  3ECO A;  2CUE A;  3TW7 A;  2H09 A;  1VQL I;  2MH2 A;  2XRO A;  1T56 A;  2BOL A;  2BVL A;  1LVA A;  5KVR A;  1ZRC A;  2K85 A;  2ZFW A;  4RA2 A;  5TGT A;  3K2Z A;  3MVP A;  5IP7 J;  1OR7 C;  4RBO A;  5BQT A;  3IKV A;  3C18 A;  1LDJ A;  4YG2 F;  2LVS A;  5TJJ A;  5J8C A;  1SD7 A;  2CWE A;  2IGO A;  2PG4 A;  2XSD C;  2CQQ A;  3MCZ A;  4PGG A;  2WTE A;  3WOD F;  2DT7 B;  4LIV A;  1YRN B;  3EUH C;  1QZY A;  2MFZ A;  2W24 A;  3ONQ A;  4H0E A;  3A01 B; 
#chains in the Genus database with same CATH homology
 2WV1 A;  2ZB9 A;  1IDY A;  2DMT A;  4D7N A;  4EEF G;  1K83 J;  3A02 A;  2GLO A;  1UMQ A;  3GTL J;  3FKI J;  5M5X J;  5DS9 A;  5IYD J;  3RKQ A;  3JRH A;  1D5Y A;  2R5Z B;  4A3J J;  3H3V K;  4BBS J;  1RES A;  1GVD A;  3S2H J;  2LP0 A;  2E1O A;  2XRL A;  2EZI A;  4BBR J;  3HGY A;  5J1R A;  1JUP A;  2YS9 A;  3FK7 A;  1O4X A;  2ECC A;  3HOU J;  3S1M J;  4A69 C;  5F0H A;  2CU7 A;  1PUF B;  2DN0 A;  4UUS A;  1NK2 P;  1ITY A;  4JX5 A;  2EZK A;  2XGC A;  1ETK A;  4MLO A;  2R5Y A;  4IHW A;  3BTJ A;  3PO3 J;  1OCT C;  2JJ7 A;  1ORK A;  2NVY J;  3W6V A;  2L0K A;  5F0F A;  5FKO A;  2E2J J;  1FEX A;  3LSR A;  3BG9 A;  2L7Z A;  3BR6 A;  3GTO J;  1WPK A;  3RZD J;  4DYR A;  5F08 A;  2KDZ A;  2LKX A;  4B1R A;  1HDD C;  5C3E J;  1Y1W J;  1H89 C;  1FIP A;  1ZGW A;  2CRG A;  4CYC B;  4A93 J;  2DA1 A;  4JX6 A;  2M8G X;  1QVU A;  2DA3 A;  2DJN A;  5IYB J;  9ANT A;  2JN6 A;  2LFB A;  1B8I A;  3FK6 A;  5EZH A;  2M9H A;  4Y52 J;  2FJ1 A;  1ETW A;  4FE7 A;  4M3G A;  2H1K A;  3CCY A;  2VPR A;  2LD5 A;  2FD5 A;  3DCF A;  2NVX J;  1Z0X A;  1WCM J;  1MSE C;  1ETO A;  2AHQ A;  5FLV A;  1W0U A;  1B72 A;  2HDD A;  1UG2 A;  3PO2 J;  3RZO J;  5M5Y J;  3MKL A;  2XPU A;  4XID A;  4QTR A;  3Q0V A;  2YUS A;  2O8K A;  5GP9 A;  1ZR4 A;  2VI6 A;  2FX0 A;  1RKT A;  5EGO A;  1BA5 A;  2Y9Z A;  1X2N A;  4A3M J;  3LSG A;  2JMW A;  1MBE A;  3BTL A;  4HNV A;  3ZQL A;  1FJL A;  1BW6 A;  5DTD A;  4AC0 A;  2XPW A;  2OF7 A;  1VF9 A;  5FKN A;  4RDU A;  1TWA J;  4IEJ A;  2MSY A;  5EDN A;  1APL C;  3HOW J;  4V2F A;  1S7E A;  2TRT A;  3UKG A;  1QVT A;  4FIS A;  1XG1 A;  5FLM J;  3ZQC A;  1ZR2 A;  2CJJ A;  2ME0 A;  4DYC A;  3CDL A;  3F0C A;  4XRS G;  2Y2Z A;  1JTX A;  3HB9 A;  3IH3 A;  4I76 A;  4MO7 A;  1Q1V A;  2R93 J;  2GM4 A;  1AKH B;  2PMZ N;  4XRM A;  3S17 J;  1GUU A;  2D5V A;  2JA7 J;  5F27 A;  3S15 J;  3DEW A;  1OFC X;  1WGX A;  5C4X J;  3TP3 A;  2H8R A;  2DA4 A;  2NOG A;  3HDD A;  3JRE A;  5IOY A;  4A3L J;  3BQY A;  2FQ4 A;  2K9S A;  2COB A;  4XRS A;  2IBD A;  1SAN A;  3FIS A;  2LY9 A;  3A01 A;  3GTP J;  1TWC J;  4A3C J;  4DYQ A;  2G0E A;  1MH3 A;  4XIC A;  1HLV A;  2EH3 A;  2WAQ N;  2R0Q C;  1AHD P;  2MGQ A;  2DMN A;  2HOA A;  2I10 A;  4MIM A;  3B6A A;  1Z77 A;  1GT0 C;  1MBF A;  1LFB A;  5HOD A;  4LOC A;  1MNM C;  2KT0 A;  1W0T A;  3GTG J;  2XPV A;  1LE8 A;  2L7F P;  4D7M A;  2GBY A;  3QPS A;  2O7O A;  1JKR C;  5EF6 A;  5K7H A;  1UHS A;  1PUF A;  2DMQ A;  2L7M P;  1CQT A;  1VI0 A;  3HKZ N;  4A3F J;  4A3D J;  1X2M A;  1JUS A;  4X6A J;  3HOX J;  2M0C A;  2X6O A;  3S14 J;  1T33 A;  2HXI A;  4FCY A;  4IHV A;  1ZKG A;  2DA2 A;  3LNQ A;  5EG0 A;  5F1J A;  4BY1 J;  1RPW A;  1ZK8 A;  3BTI A;  5J3L A;  3S16 J;  3CQZ J;  1P7I A;  3JRG A;  1RET A;  5J1U A;  2XGD A;  4A3I J;  3QPL A;  4W1U A;  1OJL A;  3BR3 A;  4CYC A;  1SFO J;  4D5F A;  1MBJ A;  3Q3S A;  2IAI A;  3A03 A;  3LOC A;  1R9T J;  3BT9 A;  1RKW A;  4QIW N;  5C4J J;  2TCT A;  2X9D A;  2YU9 J;  2W48 A;  4DZJ A;  1WH7 A;  5E3M A;  2QF7 A;  3BR5 A;  5F04 A;  2WB1 N;  4A3K J;  4D5C A;  1IJW C;  5K7F A;  2NVQ J;  1NTC A;  3QQA A;  2K40 A;  3G1M A;  3M4O J;  2DA6 A;  4S0H B;  5IP9 J;  2ELK A;  2M2E A;  5BNG A;  2HOS A;  2EQR A;  2DMU A;  2Y9Y A;  3O8G A;  4Y7N J;  3BR0 A;  3GTQ J;  1QPI A;  2R92 J;  2AO9 A;  2CQX A;  1JGG A;  1JT0 A;  3S1R J;  5EYR A;  1ETY A;  1JT6 A;  2VUM J;  4IHY A;  3SFI A;  3IH4 A;  4MFE A;  5E3L A;  1P7J A;  1JJ8 C;  3TW6 A;  4AUX A;  2HXO A;  3GBG A;  3JRI A;  1IUF A;  3ZQG A;  3GTM J;  3SJM A;  2EZL A;  1HCR A;  2RAE A;  3B6C A;  4A3E J;  2EZH A;  5FKM A;  3S1N J;  2HI3 A;  2M34 A;  1NK3 P;  3ZQF A;  3TED A;  5JLX A;  2NS8 A;  3NAU A;  2HOT A;  2E2I J;  3Q0W A;  1I3Q J;  2IEK A;  4I6Z A;  4JX4 A;  1YRN A;  4C3I J;  1Y1V J;  1VND A;  1ENH A;  3OSF A;  1AKH A;  1A5J A;  4V2G A;  1IC8 A;  2JWT A;  3ZQH A;  1H88 C;  1FTT A;  1ZQ3 P;  2JA8 J;  1BJZ A;  2XB0 X;  3D1N I;  2VKE A;  4W97 A;  1MBK A;  5IP6 A;  4BY7 J;  1EF4 A;  1I6H J;  3BR2 A;  3RQI A;  2R5Z A;  3JRD A;  2HQ5 A;  4UUS B;  4B3A A;  1IGN A;  3NAR A;  1LFU P;  4C2M J;  2NVT J;  5EEA A;  1K61 A;  3Q0U A;  5FKK A;  2R5Y B;  3G1L A;  5IYC J;  4IHX A;  3TP0 A;  4C3H J;  2LLK A;  1AU7 A;  5K7Z A;  1LE8 B;  3K7A J;  2E19 A;  4BXX J;  3HOY J;  3FIW A;  3HM5 A;  1DU6 A;  5JLW A;  1GV5 A;  3BR1 A;  3G1O A;  5FKL A;  5GPC A;  1JKP C;  1FTZ A;  5F0C A;  2DA7 A;  3C2B A;  1U9N A;  4BKX A;  4G12 A;  3BTC A;  2ID3 A;  3L1P A;  4DZP A;  3HEF A;  1U8B A;  1TC3 C;  4JYK A;  2VKV A;  1E3O C;  5IPA A;  3ZOB A;  1QRY A;  2EBI A;  5EG0 B;  3WHB A;  1MBH A;  4FTH A;  5M3M J;  2Y31 A;  3H0G J;  3HBL A;  4DW6 A;  2B63 J;  1HOM A;  3WHC A;  4M3E A;  1B8I B;  2XGE A;  1MH4 A;  2CUF A;  3PM1 A;  3HGG A;  1U78 A;  4QSH A;  3E7L A;  3BG5 A;  3JRB A;  2R7Z J;  4B4C A;  1BL0 A;  3GTK J;  3ZQI A;  3S1Q J;  2JA5 J;  1JKO C;  4X1E A;  4J19 A;  2MW8 A;  2L9R A;  3JRF A;  4L5E A;  1HF0 A;  1IRZ A;  5IOZ A;  3SDG A;  1DU0 A;  1FIA A;  1ETX A;  3JRA A;  3HOV J;  2DA5 A;  4M3B A;  5J1Y A;  3GTJ J;  1ETV A;  1H8A C;  1MSF C;  1B72 B;  1JUM A;  3LSP A;  1MBG A;  3LSJ A;  2JK3 A;  1IG7 A;  3VPR A;  2K9N A;  2NS7 A;  3HOZ J;  3IV5 A;  1POG A;  1ZTR A;  1F36 A;  3CMY A;  5C44 J;  5EGO B;  1BW5 A;  1U9O A;  1A6I A;  2QCO A;  1JTY A;  2DTZ A;  1JKQ C;  2O9L A;  2K9Q A;  1TWF J;  4MFD A;  1VFC A;  1ETQ A;  4ABZ A;  5M3F J;  1XS9 A;  3JRC A;  5E3O A;  4XK4 A;  2MG4 A;  1X58 A;  2N8G A;  1HDP A;  3I4N J;  2LK2 A;  3IH2 A;  4C3J J;  1WH5 A;  1GV2 A;  5GPA A;  3O8H A;  3MN2 A;  4JP0 A;  3OOU A;  1WI3 A;  2Y0S N;  3BG3 A;  5EZG A;  5FJ8 J;  3JR9 A;  4AYB N;  4GFB A;  1G2H A;  2Y30 A;  3OIO A;  2X48 A;  1OCP A;  2LR8 A;  2LTP A;  2CUE A;  3TW7 A;  5E3N A;  3M3Y J;  4UUT A;  2P81 A;  2ID6 A;  2XB5 A;  1TWH J;  2ECB A;  1JJ6 C;  1XC5 A;  1T56 A;  3K2A A;  4M6V A;  4A3B J;  3BQZ A;  4M3F A;  1IDZ A;  1GDT A;  4A3G J;  2JA6 J;  3MVP A;  5IP7 J;  5M5W J;  2OPT A;  2HYJ A;  4FE4 A;  4RBO A;  1F43 A;  3I4M J;  2LVS A;  1IV6 A;  1TWG J;  2XSD C;  2CQQ A;  3S2D J;  4NDL A;  1I50 J;  1RR7 A;  1YRN B;  2ME6 A;  3OSG A;  2DMP A;  2E2H J;  4M3D A;  3A01 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...