4RGUA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with ferulic acid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
141
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLSTFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with ferulic acid
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription
total genus 43
structure length 141
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rguA00
1OYWA 2K86A 2LKPA 5FLXK 1ZGAA 5EEGA 2M87A 2CG4A 2H6CA 4A5MA 4XLPF 1R7JA 2E7XA 4YFKF 4DQ2A 5K5RA 1ZRFA 3GLXA 2JTVA 5D8KB 3WU0A 2CGPA 2PJPA 3RYPA 2EFNA 4KIFA 2QM3A 4ENMA 1G4DA 3M9AA 4HX7A 4BYYA 5LHIA 3R0AA 3LSTA 1F4KA 2YSRA 4EVIA 4LG0A 4L0YB 4M72A 4IRGA 1U78A 4I98B 1UB9A 2Q8KA 3HRUA 1O7FA 4IJAA 1SD6A 5J8CA 1TQIA 5ICEA 2GIVA 1ODDA 3JAMZ 2A07F 1KU3A 4U7BA 3MZHA 2F5FA 1WKMA 3HHHA 1YIOA 2D2WA 1O3QA 1QNTA 2P4WA 4G6QA 5HVQC 4LD5A 2XAFA 5K5QA 3ECOA 3HIFA 1A04A 2G7UA 5ILSA 2O0YA 1BI0A 1HQCA 2CO5A 2ELHA 4A2UA 4OOIA 1SD4A 1Z7UA 4ESFA 3TOBA 2XROA 1XMKA 1S7AA 4L18B 2FQ3A 3DFGA 1OYIA 5HDNA 4OINF 3RPQA 2JRTA 2GXBA 3ZPLA 1DDNA 2EFWA 5IT9Z 2EV5A 1R5HA 3QPTA 1HW5A 5HS9A 1JHFA 5FD5A 2M8EA 3E97A 1V3FA 3FXQA 1YO5C 4RAZA 2EWNA 2FSWA 4XBFA 1ZRCA 5DD4A 1S29A 1V4RA 3QRFF 4GGGA 3CUQA 3QU6A 2W24A 3BROA 4ASNA 3QP6A 3QU3A 3FXRA 4R79A 3F72A 5CVVA 1YYVA 4CYDA 4JK1X 1R1VA 4B8XA 2HFHA 5BS6A 1IXRC 5H6RA 1KYWA 1YQAA 4RAYA 3OV8A 4ZZLA 2HR3A 1STZA 1R00A 1YTYA 3V8KA 4ENJA 3CO7C 2YX7A 3I4PA 2OZ6A 1OR7A 4O3MA 3DP7A 2EK5A 3ERED 4WX9A 2ETHA 1MZBA 2RN7A 1TTYA 2O3FA 3HSEA 2P6TA 4HLXA 3HOSA 2EV6A 4UNOA 2V1XA 4O6JA 5LHGA 2QBYA 3P9KA 1B4AA 2PMHA 1O7LA 1G3SA 1AWCA 2RGVA 2VC0A 1U2WA 2EA4A 3CUOA 2IP2A 4Q4ZF 1UCRA 2Q0OA 1QQIA 2HQRA 3J80K 2FNAA 4PZJA 2HYFA 2STWA 3C3WA 5D5VB 1K7AA 3WU1B 3WTWC 3H3UA 4LLGF 4RB2C 2HKOA 1D5VA 3GXOA 5LGNA 2BV6A 2PFBA 2R3SA 4IRHA 5D5XB 2XAGA 1U6GA 4XSXF 3I59B 4I09A 3BY6A 2IRFG 2MH2A 3WTSC 1FSHA 2AS5F 2O03A 2STTA 4PDKA 1JHHA 3HUGA 1RUNA 1SFXA 2XASA 4HF2A 5E1ZB 4CICA 1LJ9A 2Y75A 2FE3A 2V1DA 2HQNA 3LA3A 4N0BA 3I71A 5F6FA 3ULQB 3RJPA 1Z6TA 2FRHA 1D8JA 2WWYA 2CYYA 5LBQA 4EGYA 2QQ9A 2GA1A 1S8NA 3P9IA 3F8NA 1MDMA 2L3DA 4CHUA 3KCCA 5DCMB 3NRVA 3I64A 2MLKA 4RGSA 1YW8A 2YPRA 1SAXA 3FMRA 2IJLA 1U8RA 2MLGA 2E7WA 1TLHB 4BHBA 3WE2A 1QBJA 4ON0A 4HV5A 3GFJA 4HF0A 4HDUA 1K79A 3U1DA 3KE2A 4BAYA 4EV0A 2K27A 4LMYA 2M45A 2MBFA 4M73A 2MA3A 3FF5A 1HW2A 1FYLA 3L9FA 1YFHA 5F1RA 2ZKZA 3MFKA 3G73A 3K2ZA 1S3JA 2DU9A 1IN4A 1LB2A 3DKWA 1I1GA 2QLZA 3ZMZA 3EYYA 1KQ0A 4AIJA 2JPCA 1E2XA 3JAMK 4RGUA 2KKOA 1T98A 2WTEA 3EETA 4MTDA 4AIKA 2A5YB 3GO5A 3RPUA 2R7FA 1FY7A 2ISYA 3IWZA 1WQ2A 5HLIA 1MJBA 3C1DA 2KRFA 2VBZA 3LQQA 1XSDA 1KA8A 4GCVA 4KIGA 5DV5A 1H9GA 2D1HA 3K1PA 2P7CB 3FX3A 3E5UA 4U88A 1XD7A 2VE9A 3C7JA 3WTZA 2VT2A 4ENNA 5LRRA 4I0BA 4NB5A 2RV8A 3FXUA 1DUXC 2VOOA 1QZYA 1P92A 5IT9K 2Z9OA 1G6NA 3I53A 2FBKA 3IC7A 2Z99A 5DD8A 4ZYGA 3J81Z 2EB7A 5H20A 4KYWA 2XKPA 1TBXA 1F5TA 3IRQA 3M7GA 4OMYA 1EH8A 3VEPA 2PI0A 4Y13A 4CDGA 3HRSA 2A61A 1JXSA 3I0TA 4WXDA 2K02A 3LWFA 3F23A 2IW5A 1I1SA 5CVRA 3O2PE 4LB6B 3Q9VA 1FYKA 3O3KA 5L3EA 3E6DA 4G6DA 4UVAA 3CTAA 4LFUA 5LGTA 2Z33A 3GW2A 3GZ5A 3K0LA 2G9WA 3ZQ7A 2EA2A 4M9XA 3PQKA 3F21A 1P4XA 4OIOF 2HTJA 2OBPA 2VODA 3IRRA 1ZARA 1IAWA 1T6SA 2MC3A 3ISPA 2QVOA 3L00A 1CF7A 3PFIA 1TW2A 1FWZA 3FMSA 4I2OA 4KNYA 2QYOA 4ZH4F 4Y15A 1YW7A 1KQ9A 4WXCA 2NYXA 3KFWX 2Y48A 1XDUA 1PDNC 2B0LA 2BBYA 2X4HA 1Z6RA 5FFZA 5A2QZ 1BC8C 1IRFA 3HOTA 2XAQA 1GHCA 2HEOA 2ZMEB 1TNTA 4A6EA 2Q2EA 3SHFA 2DK5A 3DXJF 1YG2A 1ZHFA 3KP3A 2OZUA 2VOPA 4YFNF 4R8HA 1HW1A 4BHCA 4A0ZA 5D8LB 2VBXA 4A6DA 2V9VA 2V79A 4WF2A 2CWEA 1SFEA 2FMLA 4HDVA 3PQJA 3NEUA 4OIPF 3BJ6A 1XSVA 1UHWA 4G7OF 1O3SA 1XMAA 1LQ1A 1XSXA 4M71A 1SD7A 1J2XA 1PP8F 3HRMA 4O5VA 3K1MA 1EH6A 4AD9A 2RVCA 3SZPA 3KETA 1OMIA 1REPC 4ZYEA 1TQMA 1IN7A 2FXAA 5ICCA 1TW3A 1B9MA 4HYEA 3KP7A 2GZWA 3VODA 3TKYA 1I27A 5JI6A 1R1UA 1OYYA 1W5TA 4KIBA 1B6AA 1ZLKA 1W7PB 6PAXA 1ZAOA 1B9NA 3T8TA 4HV6A 3ZMSA 3BDDA 3MAJA 1J0RA 4UV9A 3FMQA 4PGGA 3ZMVA 5CVIA 2FF4A 4ZYHA 5CVJA 2FOKA 2MH9A 3HRTA 1FLIA 4QWQA 3LA7A 3FM3A 4KA4A 1ZH5A 5HLHA 3F8MA 1W7PD 3KP6A 3SFZA 2Z5UA 4RB0A 3TO7A 1Z05A 3GWZA 3IHUA 5CYVA 3BPXA 1FOKA 5L3BA 1FNNA 3RDIA 5EEHA 1EH7A 4G7ZF 5CLSA 2RNJA 2PLYA 2ZXJA 3RTRA 2E1CA 4A12A 5DUKA 5DCMA 3DEUA 1FZPB 3ELKA 2D1VA 5LLQA 1BIAA 1R23A 5ED4A 2M1BA 2RQPA 4M74A 1ZRDA 2ZBKA 3KLNA 2H27A 5FO5A 4LK0F 4MQVA 3P9CA 2PMUA 2H09A 1BIBA 3GYHX 4E70A 2P5KA 4TV7A 2VXZA 3TOAA 2QENA 2DQRA 1XGNA 1RNLA 3KZZA 1RIOH 4G9YA 3KEQA 2IA2A 5D6FA 2V1UA 2DT5A 1T2KA 4YIIA 4EJTA 3RI4A 4OIQF 4P55A 2DQLA 4RGRA 3I54A 5KVRA 2HS5A 3RKWA 4L0ZB 4RB3C 1HXDA 4LG0B 2DPDA 2K4JA 3TGNA 4L9VA 2JZYA 2ISZA 5ICFA 3L7WA 4XSZF 3V7SA 1BI1A 1C0WA 2H6BA 5FLXZ 1E17A 3LQRA 2ADUA 1IN8A 2ZJ2A 3MWMA 3IKTA 3FWEA 4I02A 4P9FA 4EM1A 5E18F 1J75A 4RS8A 4MNUA 4UHTA 4U7DA 4L9NA 1SMYF 4WCGA 4EJVA 4M6XA 2HWVA 2XRNA 1ZG5A 3Q9SA 2EFQA 1DPRA 5L3FA 1S6LA 4RGXA 3WE3A 1HKSA 2FBIA 3QOPA 4HQEA 3JTHA 1XDSA 1MKMA 4I0AA 4BQAA 1UHMA 5L3CA 4IXAA 4H0EA 2XAJA 4M6YA 1W4MA 4AVPA 2DK8A 1F9NA 1RI7A 1J5YA 2DAOA 3ROUA 4HOBA 4LB5A 2FA5A 3E5QA 2UZKA 3SZTA 2IT0A 5FFXA 3L09A 4MEYF 2CQKA 3GFMA 2D45A 1KU2A 2P6SA 1I6XA 5BMZA 1TQPA 2P7VB 4MQ9F 1LNWA 5TJJA 1FBUA 1HKQA 4A0XA 3V7CA 4ZYDA 3CUQB 2JT1A 4P9UA 3GX4X 3BPVA 1P4WA 1IW7F 2ACJA 1BM9A 4KMUX 2BEOA 3VOEA 1ON1A 2PN6A 2XAHA 2BGCA 5D4SA 1W5SA 2ZFWA 3JSPA 5J6XA 4EQQA 2DPUA 1KU9A 1OKRA 3EYIA 4GYIA 3P7NA 2XHKA 1EV7A 2VBWA 2CW0F 2UXXA 1WWXA 4UV8A 2IPQX 4HX8A 2F2EA 3ZMDA 4KT5C 4Q48A 3R4KA 2XVCA 3TO6A 4U0WA 2QZ8A 2Z3YA 2IA0A 3U2RA 3DF8A 4G8XA 4BXUA 2QBYB 3G3ZA 1ZGJA 4XRFA 4PCQA 4NHJA 4KDPA 4MTEA 4JQFA 4IVNA 3GFIA 2VE8A 3HSRA 3TDUC 3LA2A 1SMTA 2O8XA 2V6CA 2ESHA 3TQNA 1G3WA 1BOAA 3B02A 3GZ6A 2ZCWA 2QQAA 1VTNC 4ENKA 4OIRF 2KIUA 2L01A 4UXNA 5LRSA 2FEZA 3IKVA 4EMSA 2VONA 1HSJA 1ULYA 4LJZF 5DEQA 1L3LA 1Y0UA 4OU0A 3HHGA 1LDDA 2K7LA 4XLNF 1B59A 1ZREA 5AIPA 2ESNA 2KIFA 3ML6A 3DQVC 1U5TB 1F1ZA 1QPMA 4KICA 1GXPA 1AOYA 2RKHA 3T5XA 1FT9A 1TNSA 2GXGA 3B73A 4KN7X 1YW9A 2DFIA 4YIFA 1PUEE 2VN2A 1MDMB 5KK1A 4Z2YA 4EGZA 3F6VA 1DP7P 5ERIA 4L5IA 3DV8A 1ZYRF 1S7OA 4KMFA 1QO0D 3MZYA 1JGSA 5D5UB 3R6SA 4MGRA 2UWMA 1WSUA 2DI3A 4OMZA 2W57A 5BQTA 2DW4A 3TO9A 1XGSA 2M30A 3U9GA 1FYMA 1MJ9A 5D5WB 5HDGA 2QWWA 5DCFA 4WXHA 1K78B 4NQWA 1KGSA 4EM2A 2W25A 3WTUC 3N4MA 2HGCA 3WTVC 1G3TA 3K1NA 5BPDA 1U3EM 3WTTC 4FT8A 1XGMA 3E6BA 3LFKA 1IN5A 4ZZDA 2XGXA 1ZG3A 4K2EA 4D0PA 3HYIA 1IUYA 4FX0A 3E6CC 2F5DA 4HW0A 2QUFA 4JBAA 3W6JB 3R61A 3REOA 3ABUA 2F5EA 2XV4S 4Q47A 3RKYA 1MD0A 4KN4X 5DDGA 2LNBA 3V7RA 3GVAA 1QGPA 5F64A 3CDHA 2LF7A 1CGPA 1USTA 5ICGA 2COMA 3KP2A 2YU3A 1Z91A 3BOQA 1LEAA 2ZO4A 1XN7A 2GQQA 4HA8A 4ESJA 4FX4A 1XB4A 3COAC 2VT3A 5E8GA 4A0YA 4S04A 2M5WA 1LVAA 4HAMA 2DBBA 3DPLC 3ZMTA 2HDCA 3JTGA 5E17F 3JSOA 1MJAA 4YFXF 3HSFA 5FGMA 1GVJA 3V4GA 1H0MA 5H6QA 2JPBA 1J9IA 4I01A 2L02A 1IXCA 3I59A 3MQ0A 5BOXA 5IT3A 2AXLA 4BNCA 3K9TA 3O6BB 1LDKB 1MGTA 1BBYA 5FD6A 1I5ZA 1L0OC 4UUVA 3QPHA 2HYGD 5FB2A 2HOEA 1P6RA 1Z1DA 2E1NA 3ZN1A 1SFUA 1FX7A 1XCBA 4S05A 3H3ZA 3HTUA 3M1EA 1KU7A 2FBHA 3F3XA 5LEKA 4R1HA 1BJAA 5D4RA 5JVTA 3C18A 4CXFA 3CLOA 4HF1A 2YX4A 2WV0A 2QQBA 4MHGA 3E3VA 1FSEA 1R22A 5AIQA 3CJNA 1X3UA 1XGOA 4M9ZA 4YG2F 3KLOA 4L9JA 3KZYA 4LLLA 4ESBA 2WC2A 2LF8A 1CF7B 1R1TA 5LEJA 2A6EF 3E5XA 1HSTA 2J5PA 5E1WA 3JW4A 1T39A 2O61A 3FHZA 3EQLF 3F8FA 1BI2A 2HKXA 2OQGA 1P4AA 3QP5A 2CFXA 4AWXB 2OU2A 2UXNA 1NHAA 4HLYA 3EUHA 4B09A 2F5CA 3BWGA 2J5OA 3N97A 1J7KA 4QLCU 3CUQC 3IL2A 1O57A 1B1BA 1HKTA 1G3YA 2PG4A 4EJWA 3ZMUA 4I7HA 4LLNA 5D6EA 2A3SA 2JSCA 1HBXG 1R5GA 3NQOA 4WK8F 3BZ6A 5K5OA 3J81K 2YR2A 2L4MA 5E1XA 4PGHA 3GEZA 4DNCA 3LAJA 2A68F 3D5LA 3GF2A 3BJAA 2OA4A 4IHSA 2O6GE 2K4BA 3WGIA 4A5NA 4N9HA 3BJOA 1P2FA 1FBQA 3RYRA 3VFZA 4WWCA 2RC4A 5DUIA 4HZFA 2XKOA 5LHHA 2NNYA 3GFLA 1Z9CA 3WODF 2FU4A 2NNNA 4IRIA 1D8KA 3I5UA 2W85A 5E20A 1XCVA 3TDZC 4HX4A 2IVMA 2R7DA 2L54A 3F8CA 5L3GA 2NRAC 2X0LA 2P5LC 3T0YA 1FC3A 5JR3A 1H9TA 1YS6A 4EM0B 2VBYA 1WI9A 4LK1F 3F6OA 3S2WA 2ZNZA 2G7HA 2PBIA 1RZ4A 1U5TA 1UFMA 2DO7A 1GXQA 3MEXA 4M9SA 2HTSA 3T1BA 3KEOA 3RIRA 1OPCA 5A2QK 3IWFA 2DTRA 3ZN0A 2GAUA 3V8JA 1Q1HA 5JHUA 4U0YA 1IN6A 1IF1A 2A6HF 2Y0MA 3WG9A 3R0JA 4GO1A 2EJRA 4EJOA 4KUMA 5CVUA 3ABTA 4P5OA 5HS8A 1JE8A 3D0SA 1PP7U 4CO8A 3E6MA 3QAHA 5DYMA 1U5TC 4Y17A 3H92A 2TDXA 1J59A 2LSOA 3LAPA 4G94A 1RUOA 5TRDA 1K78A 3MCZA 2A69F 4CZZA 1FBSA 5HLGA 4IF4A 2IA1A 2L4AA 3EDPA 3K69A 2ZMEA 3AAFA 5L3DA 5ILUA 1BN5A 1T38A 1ON2A 2C6YA 5BPIA 1FP2A 3L2CA 3FM5A 2VC1A 3WGGA 4FHTA 2KJCA 1YLFA 1IRGA 4LGWA 4L9TA 2XIGA 5AONA 4AIHA 3SQNA 3V8LA 2GWRA 4KFCA 2RDPA 1ZN2A 5HOOA 3WTXC 3BP8A 3W6KB 1DPUA 1BI3A 4CGZA 2H94A 1QZZA 2W84A 2FMYA 4G7HF 3M8EA 1LEBA 4P96A 2PEXA 2NAZA 3T8RA 2GA2A 5K1YA 5LGUA 5HS7A 4GXOA 2DLLA 1BC7C 2OQRA 2LDUA 1ZG1A 3DPTA 1LDJA 2OD5A 2PQ8A 1FP1D 4L5JA 1USSA 1WRJA 3OOPA 3WTYC 2KJBA 5E8IA 2KIMA 2CSOA 4HBLA 1KYZA 1ZLJA 1W7PA 4ETSA 3J80Z 4HQMA 2EV0A 1YS7A 4RB1A 4MEXF 2XUBA 1O3RA 2P5VA 3J7AO 4U0VA 4UVCA 3VB2A 1KQ8A 3ECHA 2OAZA 5ILVA 3GUDA 2P8TA 5JFRA 1R58A 2ZNYA 3R60A 3RKXA 1IXSB 3KP5A 1FPQA 4Q5SF 2EFPA 4UVBA 1K6OA 1IZ1A 3ZP5A 3SXYA 3HTSB 3I58A 2NS0A 3F22A 1D3YA 4IHTA 3F8BA 2HZTA 5HDKA 4GYGA 4N9IA 1R36A 1SD5A 3FZVA 4BHPA 4BH9A 4EJUA 3Q5FA 3WGHA 2EFOA 1T0FA 5CJ9A 3CO6C 3KP4A 4F7ZA 2FNPA 2BYVE 2BE5F 3M8FA 4IPAA 1ONVA 2MD5A 1O3TA 5J8FA
chains in the Genus database with same CATH superfamily
1OYWA 3AG4H 2K86A 2LKPA 5FLXK 1D1CA 2ZXHA 2V7FA 1OCOH 1ZGAA 5EEGA 2Z2SB 4XKCA 5B1AH 2M87A 5C4JJ 1MSEC 2CG4A 3K4MA 2H6CA 4A5MA 4XLPF 1R7JA 3PIOF 1LE8B 2E7XA 3W2AA 4YFKF 4DQ2A 1OJLA 3CCSI 5K5RA 1ZRFA 4RMNA 4CCNA 3GLXA 3GMEA 2JTVA 1S72I 5D8KB 3Q0WA 4II2A 3WU0A 2CGPA 1TL8A 1Z21A 2K9MA 2PJPA 2ZSIB 3RYPA 2EFNA 4KIFA 2QM3A 3S93A 4ENMA 1G4DA 1Z7LA 3M9AA 4HX7A 4BYYA 2BXYA 5LHIA 3FXJA 1WJFA 1T0FC 3R0AA 3LSTA 3S14J 1F4KA 2YSRA 4EVIA 4LG0A 2H1KA 4L0YB 4M72A 4IRGA 2L9NA 1U78A 4I98B 1UB9A 5E3LA 3KYDB 1YJWI 3CMYA 2Q8KA 2LYCA 4PSXA 1T08B 2XF7A 2MD0A 3HRUA 3I3LA 1O7FA 4G12A 4IJAA 4RA2A 1SD6A 2IAIA 5J8CA 1N77A 2DOFA 3CCRI 1TQIA 5ICEA 3QODA 2GIVA 1ODDA 3JAMZ 2A07F 4IOAF 1KU3A 2E2HJ 2ID6A 1N78A 1OCZH 1FMVA 2K3FA 4U7BA 3MZHA 1ITYA 2F5FA 1WKMA 3VWBA 3HHHA 3VSLA 1YIOA 3MKLA 2D2WA 3BR6A 1XS9A 1O3QA 1XG1A 3BZKA 1QNTA 2P4WA 4AUXA 1QVTA 2QKLB 4G6QA 5HVQC 2IS1A 2KDOA 1UG0A 4LD5A 5F27A 1YRNB 2XAFA 3WU2C 1VQ5I 5K5QA 1VQNI 1RESA 2JJ7A 3ECOA 3HIFA 2Z16A 4C3JJ 1A04A 4CZCA 2GXAA 1VF9A 2G7UA 2JA7J 3AG2H 5ILSA 2R7VA 2O0YA 1BI0A 3A02A 1HQCA 1IDYA 1TWFJ 2CO5A 4LITA 4IO9F 1TWHJ 2ELHA 4A2UA 4CCJA 1NTCA 4OOIA 4Y3OA 4IHVA 1SD4A 1T33A 1A31A 1Z7UA 4ESFA 3TOBA 2XROA 1XMKA 3GTMJ 1AA7A 1WFXA 3HOVJ 1S7AA 4L18B 2FQ3A 1QHGA 3DFGA 1OYIA 2DYSH 4BDZA 5HDNA 4OINF 3RPQA 3O8HA 4A3BJ 2JRTA 2GXBA 3ZPLA 3OYIA 1DDNA 2VLAA 2AQFA 2M2EA 4C3IJ 2EFWA 4IQJA 5IT9Z 2L7FP 2EV5A 3RKQA 2Z1DA 1R5HA 2JUCA 3QPTA 3CCMI 1HW5A 1JTXA 5HS9A 1JHFA 5FD5A 2M8EA 2WADA 3E97A 1V3FA 3FXQA 1YO5C 4RAZA 4A3MJ 3CCQI 2EWNA 4J01A 3A2KA 2FSWA 4XBFA 5J3LA 1ZRCA 5DD4A 1S29A 4ABZA 1MIJA 1V4RA 5F04A 2M0MA 3QRFF 2H1LA 4GGGA 4MO7A 1I3QJ 1ETVA 1SVLA 5EGOA 2KRCA 2DT7B 3CUQA 2I8DA 3QU6A 2W24A 1JI8A 3TMOA 3BROA 4ASNA 3VYSB 2EILH 3QP6A 3QU3A 3FXRA 4XLFA 3GTJJ 1HA8A 2MYSA 4R79A 2KZGA 3F72A 5CVVA 2IEKA 1YYVA 2LOOA 4CYDA 4JK1X 1DU0A 1R1VA 4A3DJ 2DFFA 1B72A 3HJEA 2DN0A 4B8XA 2HFHA 5BS6A 3OYKA 1K61A 2GLOA 5GP9A 1IXRC 5H6RA 3RZOJ 3QQAA 1KYWA 4V2FA 1VQMI 4EEFG 1YQAA 4RAYA 3OV8A 4ZZLA 2HR3A 1STZA 5GTHC 1R00A 1YTYA 3V8KA 4ENJA 2HXOA 1FTZA 4E7SA 2JWTA 3H3VK 4F55A 2K9QA 3FKJA 3CO7C 1DGWY 2YX7A 3I4PA 2MFZA 2OZ6A 1MMDA 2R5YA 1OR7A 4O3MA 2VQHA 2DMPA 5LD2C 3DP7A 2EK5A 3ERED 3CCJI 4WX9A 1WHUA 2ETHA 3PNTA 1HDDC 1MZBA 2RN7A 1XX5A 1RPWA 1TTYA 2LLKA 2OTJI 2A05A 4YELA 4NC6A 1S5LC 2E5NA 2O3FA 3HSEA 4UUSA 2P6TA 3ZQLA 3M4OJ 4HLXA 3HOSA 1HC8A 4PJNA 2JN6A 2EV6A 3OWTA 1JUSA 4UNOA 2V1XA 3CJRB 3NWTA 4O6JA 1OISA 3U1KA 3S1NJ 3BG7A 5CQGA 2K3PA 5LHGA 2R7ZJ 2QBYA 3P9KA 1IV6A 4XICA 2V4JC 1B4AA 2PMHA 1O7LA 1P9QC 1G3SA 4GDFA 1MBKA 4QTRA 1AWCA 1SC7A 2ID3A 2RGVA 2VC0A 2I10A 1U2WA 2EA4A 4RM3A 3CUOA 2IP2A 4JOMA 3S16J 4Q4ZF 2VASA 1UCRA 3GTLJ 2DDBA 4IHWA 2NS7A 2P81A 4F93B 1VQ4I 1GV2A 1QQIA 2Q0OA 3L2WA 2HQRA 2FNAA 4PZJA 3J80K 4ZTJA 2HYFA 2X1EA 2STWA 3DKYA 4B3XA 2B7EA 2FX0A 3C3WA 5D5VB 1K7AA 4ZDOA 3WU1B 3WTWC 3H3UA 4LLGF 2IS6A 2COBA 3EUAA 2QQ8A 3G1MA 2F6CA 4RB2C 2HKOA 1QZEA 1D5VA 3GXOA 1MW7A 5LGNA 2BV6A 2PFBA 1RC9A 2R3SA 3H5AA 3LSHA 4IRHA 3BZCA 3KZIC 2XAGA 3H1CA 5D5XB 1O4XA 1K4SA 3PNVA 1U6GA 2NVYJ 2OV7A 3CF2A 4XSXF 2E1MC 3I59B 1UJ8A 1Z3YA 2VKVA 4I09A 2M7BA 5J4YA 2XAUA 3BY6A 3PNYA 2NVXJ 2IRFG 3MD2A 3OMYA 3CLQA 5TISC 4XLAA 2MH2A 3WTSC 1FSHA 2AS5F 2O03A 2STTA 4A3IJ 4PDKA 1G59A 2ZB9A 1JHHA 3CC2I 3G1OA 2LFBA 3HUGA 1RUNA 3X2QH 3ASOH 1SFXA 2XASA 3AG1H 3CCVI 2HU9A 2OUMA 1X3ZB 4HF2A 5E1ZB 1UZCA 4CICA 1LJ9A 2LY2A 2Y75A 2FE3A 2V1DA 2KHMA 2HQNA 3LA3A 4N0BA 3I71A 5F6FA 3ULQB 2VL8A 3RJPA 5IYCJ 1VQ7I 2HQAA 4HEA2 5E3MA 3UR3C 4Y52J 3MN2A 1Z6TA 3V42A 4JYKA 4BJ6C 2FRHA 2VQGA 4UB8C 3LSRA 3OYFA 1D8JA 4E6KG 2WWYA 5FKNA 1QA6A 3HOUJ 2ZJPF 2CYYA 2DYRH 5LBQA 2BOLA 3HPHA 4FE7A 2KISA 4EGYA 3DLAA 2QQ9A 1IJWC 5H2FC 1LFPA 3HEFA 1OCTC 2GA1A 1S8NA 3P9IA 3F8NA 3FBIB 1IV8A 1MDMA 3GTPJ 2MG4A 2D5VA 3NARA 3MVPA 5M5YJ 1V5EA 5B1BH 2L3DA 1BR2A 4BJ5C 4CHUA 3KCCA 5DCMB 3NRVA 3I64A 2MLKA 4RGSA 2X6OA 1YW8A 2YPRA 2KZVA 1SAXA 2XF5A 4EATA 3FMRA 3FDYA 2IJLA 1U8RA 2MLGA 2E7WA 1TLHB 3SEQA 3JREA 2L9SA 2DJNA 2OTLI 4PJ0C 2JA8J 4BHBA 3K10A 3WE2A 4E7ZA 1QBJA 4ON0A 3BR1A 4HV5A 3GFJA 4HF0A 4N4NB 2DFHA 4OAYA 4HDUA 1K79A 1B8IA 1X3WB 3U1DA 4JX6A 1TWGJ 3KE2A 4BAYA 4EV0A 2Y31A 2ELKA 2K27A 4LMYA 2E19A 2M45A 2MBFA 5HODA 4M73A 2LRDA 4BL0B 2MA3A 2QF7A 3BG9A 3FF5A 3CMAI 1HW2A 1FYLA 3I4MJ 3L9FA 1YFHA 5F1RA 2LG4A 1IUFA 3OYHA 2ZKZA 3TEDA 4V19K 3MFKA 3G73A 3K2ZA 1S3JA 3CCUI 2DU9A 1IN4A 1LB2A 2WY8Q 3DKWA 1R49A 2BXZA 1I1GA 5LFAA 1ZK8A 2ZC2A 3G4SI 3KYCB 2QLZA 3ZMZA 1PUFA 3WHCA 3ONQA 3H0GJ 4BGDA 2GIZA 1XC5A 3EYYA 4I6ZA 1Y56A 1KQ0A 4AIJA 1TP4A 5DM6F 2JPCA 1E2XA 2DT6A 4FE4A 3JAMK 3OIPA 4RGUA 4XN0A 3CP2A 1X1CA 2KKOA 1T98A 3K4NA 2WTEA 5EG0A 3K2AA 4A3LJ 3EETA 1R71A 3W2VA 3DEWA 4MTDA 2O8KA 3PFYA 4AIKA 2A5YB 4XOPA 3GO5A 3RPUA 3HB9A 2R7FA 1NG7A 1FY7A 2ISYA 5J47A 1Z0XA 4DBRA 4KISA 3IWZA 2XB5A 2NOJB 2HI3A 1WQ2A 2CV1A 3HC7A 4F91B 2LH9A 5HLIA 1MJBA 4XLEA 3C1DA 3K4LA 3OSGA 2NVQJ 2KRFA 2VBZA 3LQQA 5KAFC 1XSDA 1KA8A 4GCVA 4KIGA 5DV5A 1H9GA 2D1HA 3K1PA 4ITVA 5K7ZA 3PO3J 2P7CB 3FX3A 3E5UA 2BY1A 4U88A 1XD7A 2VE9A 1LKXA 4FQGA 3C7JA 3TW6A 3WTZA 1U8BA 2VT2A 4ENNA 3HOWJ 5LRRA 3LMMA 5M5WJ 4I0BA 3CDLA 3W6VA 3S1QJ 3BR2A 4NB5A 4B1RA 2RV8A 2Q1ZB 3A4CA 3FXUA 3K4CA 1DUXC 1A36A 2VOOA 1QZYA 1XMXA 3FK6A 4FCYA 3Q0UA 1P92A 5IT9K 2Z9OA 1G6NA 3I53A 2X48A 2OCCH 2TCTA 2FBKA 2KL4A 3DWLE 3CZ6A 3IC7A 2Z99A 5DD8A 4ZYGA 3J81Z 3SDGA 2EB7A 5H20A 2WB1N 5GPCA 2VPLA 2X1DA 4KYWA 2JUGA 2XKPA 1TBXA 4DZJA 4A69C 3LSMA 1F5TA 2RNGA 4NDLA 3IRQA 3BR5A 3HZJA 2GM4A 1ZR4A 4PK4A 3M7GA 2EIMH 4OMYA 4FISA 2JRMA 4RAGA 2EQRA 1EH8A 3VEPA 2PI0A 3C2BA 3TW7A 1VQOI 3DTEA 4Y13A 1MBHA 3AG3H 3JRFA 4CDGA 2VJJA 3HRSA 5F08A 4RM2A 2A61A 1KZHA 1JXSA 3HKZN 3I0TA 1WGXA 4WXDA 2K02A 3LWFA 4ZTFA 3F23A 2NOGA 2IW5A 3ZQHA 2ZXWH 2KPMA 5M5XJ 4CYCB 2H8RA 1I1SA 4XRMA 3EUKL 4RLFA 5CVRA 5FLMJ 3O2PE 4LB6B 3Q9VA 3DPUA 2LTPA 1FYKA 3O3KA 5L3EA 1V55H 3E6DA 4G6DA 2PJRB 4UVAA 3CTAA 4LFUA 4BXFA 2MSYA 4CCOA 5LGTA 2Z33A 3GW2A 3GZ5A 2UUZA 4I99C 3EPZA 3K0LA 2G9WA 3OSFA 3ZQ7A 2EA2A 4M9XA 3PQKA 2LY1A 3F21A 3MZ8A 1P4XA 5K7FA 2HTJA 4OIOF 1MMSA 3H9GA 3MKWB 2OBPA 1GLNA 4D7MA 4C9YA 2VODA 3IRRA 2DA1A 1ZARA 5M3MJ 1IAWA 1YI2I 1HLVA 1DP3A 1T6SA 2MC3A 4IOCF 3ISPA 1RETA 3RSNA 2QVOA 3L00A 4CCMA 3UKGA 4IHYA 1CF7A 2HQ5A 3PFIA 2CW7A 4MIMA 1TW2A 4BY1J 1FWZA 3FMSA 3P5JA 4I2OA 2XSJC 4KNYA 3FK7A 1QRYA 2QYOA 4ZH4F 3H9JA 4Y15A 1YW7A 3ZRGA 1KQ9A 4PFPA 4WXCA 2NYXA 4BS9A 5DS9A 1IRZA 2MGQA 3KFWX 2Y48A 4U87A 1XDUA 1R9TJ 1PDNC 3BC8A 2B0LA 3DBHB 4C2MJ 2BBYA 5IP7J 2VXDA 2X4HA 2X6XA 3BTJA 1Z6RA 5FFZA 5A2QZ 5EEAA 1BC8C 1IC8A 1V54H 4E4HA 2GOMA 4E7JA 1IRFA 1MNMC 3HOTA 2X6YA 1MBFA 2XAQA 1GHCA 2HEOA 2ZMEB 3JR9A 1TNTA 4CH7A 1Z77A 4A6EA 2Q2EA 4XLHA 3SHFA 2B63J 2X6WA 2LBFB 4UY8I 2DK5A 3DCFA 1RR7A 1RKTA 3DXJF 1I50J 1QHHD 2CUJA 2DOEA 4E7HA 3GCMA 3SZGA 9ANTA 1YG2A 1ZHFA 3KP3A 5KNLA 2OZUA 3K4BA 1Y8QB 2VOPA 1GV5A 1YIJI 4J00A 2KDZA 4HPQA 4R8HA 4YFNF 1NG6A 1W0UA 1HW1A 4BHCA 4A0ZA 5D8LB 2VBXA 5FROA 3ZXSA 2NVTJ 2M4KA 1ZELA 4A6DA 2V9VA 5B3SH 2V79A 2OPTA 3OYEA 4WF2A 1Y1VJ 4B43A 2CWEA 1SFEA 3E0JB 2FMLA 4BJTA 4HDVA 3PQJA 3NEUA 1QPIA 4CCLA 4OIPF 2M4GA 2R7UA 2DA4A 2WV1A 2JA6J 2DJIA 4QPOA 3BJ6A 3ZQGA 1XSVA 3A0HC 1UHWA 4E7LA 4G7OF 1O3SA 2V6EA 2YU9J 1XMAA 3DKXA 1LQ1A 1XSXA 4M71A 3PIPF 1SD7A 1SVMA 3M07A 1J2XA 3DBLB 1PP8F 3HRMA 4O5VA 4PUSA 3K1MA 1FEXA 1EH6A 3BG6A 4AD9A 2CUZA 3BG3A 2RVCA 1TC3C 3SZPA 3KETA 1BW5A 1VQLI 1OMIA 1REPC 4XRSG 4ZYEA 2K5CA 1TQMA 1IN7A 2FXAA 5ICCA 1H88C 5IYBJ 2E71A 1TW3A 1B9MA 2L7ZA 3DU6A 4IX7A 4HYEA 3KP7A 2GZWA 3TL4X 3VODA 3UNGC 4DGWB 3TKYA 1I27A 5JI6A 1R1UA 4OWRB 1AKHA 1OYYA 1W5TA 2AHQA 2LREA 4KIBA 1B6AA 2R5ZA 2WB1A 1ZLKA 1W7PB 6PAXA 1ZAOA 1B9NA 1VNDA 4C2TA 3T8TA 4A3CJ 4HV6A 5B66C 3ZMSA 5EJCA 3BDDA 3MAJA 1J0RA 4UV9A 3FMQA 4PGGA 3ZMVA 4BE1A 3CC7I 5CVIA 5J1RA 2K40A 3IUOA 2FF4A 4ZYHA 2W82A 5CVJA 2FOKA 2MH9A 1SEUA 2H8WA 4F3QA 2JK3A 3HRTA 3BLYA 1FLIA 3HKZA 2CH0A 4QWQA 3LA7A 4AM3A 2Y69H 3FM3A 4KA4A 1ZH5A 3FXOA 2CS3A 5HLHA 3F8MA 1W7PD 3KP6A 3SFZA 3PSFA 2DTZA 2Z5UA 4RB0A 2K9NA 2W1OA 4G6TB 3TO7A 2FUG2 4YEJA 3H9QA 1Z05A 3GWZA 2BHZA 3IHUA 5CYVA 5J40A 3BPXA 2M8GX 1FOKA 5L3BA 1FNNA 3I4NJ 4M3DA 4C30A 4XQFA 3RDIA 2HOAA 5EEHA 1EH7A 3K70D 2R7RA 2KRHA 4G7ZF 2WBMA 4XLCA 5CKTA 1TWCJ 5CLSA 2RNJA 1R5ID 3SYTA 2PLYA 2ZXJA 3RTRA 2E1CA 2ME6A 1GT0C 3AKZA 1FOYA 3GTOJ 4XL9A 4A12A 5DUKA 1JJ8C 1JTYA 2L0KA 5DCMA 1X1BA 3DEUA 1FZPB 3ELKA 5CPRB 2D1VA 5LLQA 1BIAA 1R23A 5ED4A 3PL8A 3E7LA 2M1BA 1D0YA 4BUPA 4NQWB 2RQPA 1WJBA 2ICWG 4M74A 1ZRDA 2ZBKA 5FRMA 2M7AA 3KLNA 1F43A 1A35A 2H27A 5FO5A 4LK0F 3OYAA 4MQVA 4QPQA 5E79C 2AXTC 1R4MB 2LR8A 1N75A 3Q0VA 3P9CA 4II3A 2PMUA 5C3EJ 2QSGX 5FKLA 2H09A 1X4OA 1BIBA 3GYHX 4A3GJ 2WAFA 4E70A 2P5KA 1S9HA 1VQ9I 4HSTA 1U9OA 1VZ0A 4IQ4A 4TV7A 2QEXI 3JRAA 2VXZA 2IGKA 4RDUA 3TOAA 5BNGA 2KMUA 3DTIA 2QENA 2DQRA 4IL6C 1VQ6I 1YHQI 1G8XA 1FOWA 1XGNA 2MC4A 1RNLA 3KZZA 1RIOH 1SVOA 2HDWA 4G9YA 1JKQC 1DGRM 2DODA 4RBOA 3KEQA 2IA2A 5D6FA 4IEJA 4BY7J 2V1UA 3PM1A 2DT5A 1MH4A 1T2KA 4YIIA 1WJ5A 4EJTA 3RI4A 4OIQF 4KJZA 4P55A 2DQLA 4RGRA 3A03A 3I54A 5KVRA 2HS5A 3A01A 2F4MB 2HYJA 3RKWA 3FXKA 4N4OB 2BW3A 4L0ZB 4RB3C 1HXDA 2BHYA 2F5VA 3IV5A 3BQZA 4LG0B 1WH7A 2DPDA 3CP8A 2K4JA 5F0FA 3TGNA 4F52A 4L9VA 4DBQA 2JZYA 2ISZA 5ICFA 3ZCOA 3L7WA 4BDYA 4XSZF 2OJED 4M3GA 3V7SA 1BI1A 1C0WA 3G1LA 2H6BA 5FLXZ 1E17A 3LQRA 2ADUA 1IN8A 2ZJ2A 3MWMA 3IKTA 3FWEA 2QGUA 4I02A 3HGYA 2O5RA 4P9FA 2EINH 4EM1A 5E18F 3GLLA 1J75A 1Z3XA 3D5RC 2V9PA 4RS8A 4MNUA 4UHTA 3ZOBA 4U7DA 4L9NA 1MH3A 3ERMA 1I6HJ 2M0CA 3EUHC 1SMYF 1OQYA 4WCGA 2PMZN 4EJVA 2MW8A 4PJJA 2IGNA 1I39A 1MMGA 1WI3A 2Y9ZA 4M6XA 2HWVA 1XPXA 4XKBA 1JKOC 2XRNA 4Z6YA 4XRSA 3BTLA 1ZG5A 4AIDA 3Q9SA 2EFQA 1DPRA 5L3FA 1S6LA 3FXMA 1TWAJ 4RGXA 3WE3A 1HKSA 3KX2A 2FBIA 3QOPA 4HQEA 1OCCH 4I76A 3JTHA 1XDSA 1MKMA 3S2HJ 3JRIA 1VQPI 3QOEA 4I0AA 4BQAA 3CESA 3O8GA 1UHMA 5L3CA 1JT0A 1CQTA 4IXAA 2QCOA 4H0EA 3OS1A 1IG7A 4BKXA 2XAJA 4M6YA 1W4MA 5IY5H 4AVPA 2CU7A 2KLOA 3QPSA 4ZJZA 2DK8A 3MMYB 1F9NA 1RI7A 1J5YA 2DAOA 3ROUA 4HOBA 4CCKA 3SFIA 4LB5A 2FA5A 1XTAA 4B4CA 2MABA 2CJJA 3E5QA 2UZKA 4ZDPA 2DOAA 3SZTA 3L1PA 2IT0A 5FFXA 2EZKA 3L09A 3OIOA 4MEYF 3KPHA 2CQKA 1E3HA 2FJ1A 4M3EA 3GFMA 2D45A 1KU2A 2P6SA 3JRBA 1I6XA 5BMZA 2HOTA 1X58A 3W2WA 2DFEA 3D5SC 5GAHJ 5GPAA 1TQPA 3BT9A 2P7VB 4MQ9F 1LNWA 5TJJA 3LSGA 1FBUA 1HKQA 4A0XA 1R6RA 3V7CA 3U21A 2K9SA 4J19A 3OY9A 3VYTB 5EGOB 4ZYDA 2L9RA 3OS2A 1IDZA 3CUQB 4YRVA 2JT1A 4P9UA 1E0EA 3SJMA 2VJIA 2WAQN 5EDNA 3GX4X 3BPVA 3S15J 1P4WA 2IBDA 1MNEA 3LL7A 1MBJA 4NNJA 1IW7F 2ACJA 1B72B 1BM9A 5EZGA 1S7EA 1X2NA 4KMUX 1WPKA 2BEOA 2UV1A 2CQ7A 3VOEA 1WCMJ 3K6GA 2W00A 3G71I 1ON1A 3PUBA 2PN6A 4MFEA 2XAHA 4D7NA 3RZDJ 1UMQA 2EIKH 3G6EI 3I55I 2BGCA 5D4SA 5C4XJ 1W5SA 2ZFWA 4JX5A 3JSPA 2VJ4A 3S8PA 4EQQA 5J6XA 2DPUA 2XRLA 5FJ8J 2R92J 3M1CA 4JX4A 1KU9A 1ZGWA 1OKRA 3EYIA 3KEYA 4GYIA 3P7NA 2XHKA 1EV7A 2VBWA 2R5YB 1FJLA 2CW0F 4KITB 2LC2A 2UXXA 4B44A 1Y8RB 1JKPC 1WWXA 3TP3A 4UV8A 2IPQX 4HX8A 2BVLA 2F2EA 4UUSB 3ZMDA 2R7SA 4KT5C 1BOBA 2LY9A 3I9V2 2VIXA 3IH3A 4Q48A 3R4KA 2XVCA 3L2RA 3TO6A 4U0WA 2QZ8A 2Z3YA 2IA0A 3U2RA 3LSKA 4ZYAA 1X19A 1Y6IA 1LE8A 3DF8A 4AYBN 2OC6A 4G8XA 3CCYA 4BXUA 1A6IA 1HF0A 1K83J 2QBYB 3G3ZA 3LOCA 1ZGJA 2XF6A 1ZQ3P 3TBIA 4XRFA 3IP4B 4PCQA 5HNHA 2L7KA 4NHJA 4KDPA 2CUFA 2HPMA 4MTEA 2ZJRF 5J1YA 3BCAA 4JQFA 4IVNA 1M1EB 2XPWA 3J7YJ 2VB6A 4BE0A 4XONA 3GFIA 1BA5A 4RAFA 1UG2A 2VE8A 2Y9YA 3HSRA 3TDUC 3LA2A 5IYDJ 3OYNA 1VI0A 1SMTA 2O8XA 3ZQQA 2HZDA 4D5CA 1T56A 5GADJ 2PMZA 1Y39A 2B9SA 3HXLA 2V6CA 1YJ9I 2KQRA 2ZMEC 2ESHA 3TQNA 2O9LA 3L2UA 4QSHA 4FETA 1G3WA 1BOAA 2VQLA 2V1NA 1N25A 2ZJQF 3B02A 5KAIC 3GZ6A 2ZCWA 2QQAA 1VTNC 4IZZA 3BCBA 4ENKA 4B47A 2L9VA 1FMWA 1OCPA 4OIRF 2KIUA 1ORKA 5JVGF 2R93J 2L01A 1SANA 4UXNA 1YRNA 3ZQIA 2EZIA 2G0EA 3OS0A 3K4KA 5LRSA 2AO9A 4BE2A 3AL0B 2FEZA 2BZTA 2V9KA 3IKVA 2XPVA 3HUGB 4EMSA 5FLVA 2VONA 1W5CC 1YITI 2DMQA 1HSJA 3OR2C 4S0HB 5KHDA 1ULYA 4LJZF 2BY2A 5DEQA 2JA2A 1Y0UA 4OU0A 3HHGA 1L3LA 3S1MJ 2LMDA 3OYBA 3FXLA 1APLC 1LDDA 2K7LA 4XLNF 1B59A 3VDXA 1ZTRA 3M8JA 1ZREA 1G2HA 5AIPA 2EPFA 2ESNA 2KIFA 2W48A 3PSIA 4AC0A 2DMUA 4CUGA 3ML6A 3DQVC 1U5TB 1F1ZA 1QPMA 4KICA 1D1BA 1YJNI 1GXPA 1AOYA 2RKHA 2IGMA 3HBLA 4GRIA 3T5XA 1FT9A 2E60A 3S1RJ 1TNSA 2GXGA 3B73A 4KN7X 1Y1WJ 1YW9A 1W1WE 3CMEI 3GTQJ 1EF4A 2DFIA 4YIFA 1PUEE 1EA3A 1OFCX 2VN2A 1MDMB 5KK1A 4Z2YA 3BTCA 1UHSA 4EGZA 3F6VA 4HSRA 3ZR8X 4HNUA 1DP7P 1EKEA 4PFOA 5ERIA 3CCLI 2WAQA 4L5IA 1K6YA 1LFUP 3DV8A 3OYDA 4HRIA 1ZYRF 1S7OA 4KMFA 2ZSHB 5J1UA 1SFOJ 3ZQFA 1QO0D 3MZYA 3OYLA 1JGSA 5D5UB 3R6SA 3HPGA 4MGRA 2UWMA 2JVGA 5M3FJ 5IP9J 1WSUA 2DI3A 4OMZA 2W57A 5BQTA 3B6AA 3HL2A 2DW4A 3SDBA 3TO9A 1B8IB 1XGSA 2M30A 3U9GA 3JRDA 1FYMA 1MJ9A 2DA2A 4PSWA 2W7NA 4ZC3A 2X1CA 4LOCA 4Y4RA 5D5WB 5IP6A 5HDGA 3K70C 2QWWA 5DCFA 3QWLA 4WXHA 1WJAA 5GAGJ 2HPIA 1K78B 1VQKI 4NQWA 4XK4A 2E2IJ 1KGSA 4EM2A 2W25A 2QA4I 3WTUC 1NH3A 1ERDA 2VKEA 4PJLA 3N4MA 2HGCA 3WTVC 3CMMA 4Y33A 1G3TA 2R7QA 2WAEA 3K1NA 2R7XA 5BPDA 2CQNA 1U3EM 2KP6A 3WTTC 4FT8A 1XGMA 3E6BA 3D1NI 3LFKA 2CFOA 1IN5A 4ZZDA 1PUFB 1BW6A 2JMWA 4BEHB 2XGXA 5FKMA 1ZG3A 2TRTA 4K2EA 4BBSJ 4D0PA 3HYIA 1IUYA 4FX0A 3E6CC 2F5DA 2R7OA 4HW0A 3CDIA 2QUFA 2X9DA 2M9HA 4AYBA 4JBAA 3W6JB 3R61A 3REOA 3HOZJ 3ABUA 2F5EA 2XV4S 4DZPA 1ZR2A 4Q47A 3RKYA 1MD0A 4KN4X 3FIWA 1NK2P 3FBNB 5EG0B 5DDGA 3VPRA 1X1PA 2LNBA 3V7RA 1UAAA 3GVAA 1QGPA 5F64A 5F1JA 4QIWN 3CDHA 3DBRB 2LF7A 1CGPA 3HM5A 1USTA 5ICGA 2COMA 3KP2A 2YU3A 3IAM2 2L2OA 3I56I 1Z91A 3BOQA 1LEAA 2ZO4A 1XN7A 5JLWA 2GQQA 4BU2A 4HA8A 4ESJA 3WHBA 2P0WA 1R4NB 2M3AA 3J7ZI 3JRGA 4X6AJ 2NS8A 4XNFA 3OYJA 4FX4A 1XB4A 3COAC 2VT3A 5E8GA 4A0YA 4S04A 4D1QA 4CSWA 4DOZA 1Q1VA 2M5WA 1LVAA 4HAMA 2DBBA 3DPLC 3OIQA 1J09A 4UUTA 2QSHX 3RPUD 2CQXA 3ZMTA 1ENHA 1RKWA 3HOXJ 2HDCA 1RR8C 4GFBA 3JTGA 3S3OA 5E17F 4F92B 3JSOA 1MJAA 4YFXF 4CA0A 3HSFA 5FGMA 2NVUB 3AFHA 1GVJA 1MMNA 3QYEA 3V4GA 1H0MA 3GTGJ 1ETKA 5H6QA 2JPBA 1J9IA 4I01A 2I5UA 1IXCA 2L02A 3I59A 3MQ0A 1T8IA 3E1SA 5K7HA 5BOXA 1MSFC 2R4GA 5IT3A 2AXLA 4BNCA 3M3YJ 2DA7A 1H8AC 3K9TA 1JUMA 3O6BB 1LDKB 3JRCA 1MGTA 1OLTA 1BBYA 5FD6A 1I5ZA 1FIPA 2JSPA 1L0OC 2V26A 3QPHA 1NK3P 2LKXA 2HYGD 5FB2A 4UUVA 2HOEA 1P6RA 3VSKA 1Z1DA 2E1NA 4BXXJ 3ZN1A 1SFUA 3DEEA 1FX7A 3TP0A 3H35A 1XCBA 4S05A 1PYVA 3H3ZA 2XC7A 5DTDA 5IPAA 3HTUA 2EIJH 3M1EA 1KU7A 2KT0A 2HVRA 2FBHA 3F3XA 1LUJB 2E36A 4R1HA 1BJAA 5LEKA 5D4RA 5FKKA 5JVTA 2EZLA 3C18A 4CXFA 2ZXIA 2L7MP 3CLOA 4HF1A 2YX4A 3G2BA 3IH2A 2WV0A 2JA5J 2QQBA 2M34A 1LFBA 4MHGA 2HVQA 2R0QC 3E3VA 1FSEA 4XMYA 2HDDA 1R22A 3RCOA 5AIQA 1P7IA 3DTKA 3CJNA 3A1YA 1X3UA 1XGOA 4M9ZA 4YG2F 1W36D 4IKFA 4M6VA 3KLOA 4L9JA 3KZYA 4B48A 4LLLA 4ESBA 4XR6A 2WC2A 2LF8A 3GZNB 2AQEA 1CF7B 2Y0SN 1R1TA 2YS9A 5LEJA 2E5ZA 3BTIA 2W4SA 4DIQA 2A6EF 2EBIA 2CV0A 1JT6A 4NUBA 1X1AA 2K85A 5JLXA 3E5XA 2VUMJ 5HLTA 3BR0A 5E3NA 2VQCA 1HSTA 5HNFA 2J5PA 3HGGA 5E1WA 3JW4A 1T39A 1FTTA 5EYRA 2O61A 4XORA 3FHZA 4KT6A 3Q3SA 3ZQCA 3EQLF 2JQ7A 3F8FA 1VFCA 5IOYA 2HVSA 1BI2A 2HKXA 1KONA 2OQGA 2E34A 1P4AA 3QP5A 2CQQA 4DYQA 2CFXA 4XKVA 2Q2EB 4AWXB 4E7KA 2OU2A 1WJDA 1QU3A 2UXNA 4X0GA 2LVSA 1NHAA 4HLYA 3EUHA 4B09A 1MBGA 2F5CA 3BWGA 2J5OA 2LK2A 4C3HJ 4AU7A 4IHXA 3ABKH 3N97A 2BY0A 3LSIA 1JJ6C 1J7KA 3CQZJ 4QLCU 3F0CA 4XOTA 2CW8A 3CUQC 3LFUA 3IL2A 1I3AA 4OAZA 4XN3A 1MBEA 2DA3A 1O57A 1B1BA 1HKTA 4NC7A 1G3YA 2PG4A 2RAEA 4DW6A 4EJWA 5J4VA 2IS2A 3ZMUA 2XGDA 4I7HA 4LLNA 2IS4A 5D6EA 1BJZA 2A3SA 3QPLA 2JSCA 3K7AJ 1HBXG 1R5GA 3NQOA 2IGOA 4WK8F 3BZ6A 5K5OA 3S32A 4ZDLA 3FISA 3J81K 2YR2A 2L4MA 2RREA 5E1XA 4PGHA 2X85A 3GEZA 4DNCA 3LAJA 2A68F 5EF6A 3D5LA 3GF2A 3BJAA 1OR7C 2OA4A 2FQ4A 2ZFUA 3ZGKA 4IHSA 3KIOA 2HNHA 2O6GE 2K4BA 3WGIA 4A5NA 1YOVB 4XIDA 4N9HA 3BJOA 3LNQA 4DYCA 1X4PA 2HXIA 3WG7H 2WY7Q 3GTKJ 1P2FA 1FBQA 4P1WA 3RYRA 1ZKGA 2RC4A 3VFZA 4WWCA 5DUIA 3CF5F 4HZFA 2XKOA 2DDAA 3PUFA 5LHHA 2NNYA 1AKHB 3VYRB 3GFLA 2R5ZB 2E2JJ 1Z9CA 5JHFA 3WODF 2FU4A 2NNNA 1WH5A 2DMTA 2QKMB 4IRIA 1D8KA 2JVHA 3I5UA 2W85A 3DU5A 5E20A 1XCVA 4RLQA 1Z67A 3TDZC 4HX4A 4A3FJ 2IVMA 2R7DA 2L54A 3F8CA 5L3GA 2NRAC 3H5NA 4L5EA 1ETYA 2X0LA 2GBYA 3JRHA 2P5LC 5B5EC 1T95A 3T0YA 1FC3A 1OCRH 2XSDC 5JR3A 1H9TA 1YS6A 4MLOA 4Y7NJ 2Y30A 1TT0A 2VBYA 1WI9A 4EM0B 4LK1F 3F6OA 2VJ5A 1TT5B 3S2WA 2ZNZA 1BR4A 2G7HA 2LD5A 2PBIA 1RZ4A 5TGTA 1U5TA 2E35A 1UFMA 2WA0A 1V5FA 4BQQA 4HG2A 3CD6I 2DO7A 1GXQA 3MEXA 3JCUC 4M9SA 2HTSA 4CYCA 3T1BA 5F0CA 3KEOA 3RIRA 3RQIA 1BL0A 1QVUA 4BBRJ 1ETXA 1OPCA 4HNVA 5A2QK 3IWFA 2DTRA 3ZN0A 2QSFX 2F4IA 2GAUA 2PJRA 3V8JA 3ASNH 1Q1HA 5JHUA 1RRJA 4U0YA 1IN6A 1IF1A 2A6HF 4BACA 1WJEA 2R7WA 2Y0MA 2Y0SA 2CV2A 3WG9A 3AL0C 3R0JA 2CMPA 4GO1A 1K4TA 2EJRA 4EJOA 4KUMA 3CJTB 5CVUA 3A0BC 5FKOA 2VI6A 3ABTA 3SEZA 4P5OA 5HS8A 2YUSA 1JE8A 3D0SA 1PP7U 4CO8A 2DCEA 3E6MA 1SFKA 3PJRA 1LVKA 3QAHA 5DYMA 1U5TC 4Y17A 3H92A 3H5RA 4XM3A 2CUEA 2TDXA 1J59A 2LSOA 3LAPA 1MNDA 1TZLA 4G94A 2CRGA 5F0HA 2XGCA 1RUOA 5TRDA 3OL3A 1K78A 3MCZA 3MKYB 1H89C 2A69F 3S2DJ 4JP0A 1MMAA 4CZZA 3ABLH 4FTHA 1FBSA 1WVRA 2FOWA 5HLGA 4IF4A 4DYRA 1PJRA 1SAUA 2IA1A 2L4AA 3EDPA 3K69A 2ZMEA 3B6CA 2Y2ZA 4UB6C 3QYFA 1D0ZA 2FD5A 5L3DA 5ILUA 3AAFA 1BN5A 2N8GA 1DQUA 1T38A 1FOXA 1ON2A 2LBFA 3IH4A 2C6YA 5BPIA 1FP2A 5GTIC 3L2CA 1VQ8I 3FM5A 4BEHA 1JUPA 2E1MB 2VC1A 1Y0NA 2DA6A 2LP0A 3N05A 3WGGA 4LG3A 4FHTA 2KJCA 3A01B 1YLFA 3ESWB 1GDTA 2BW3B 1IRGA 2PX9A 1ETQA 4LGWA 2ECCA 4L9TA 2XIGA 5AONA 2F48A 4M3BA 4AIHA 4D5FA 1ETOA 3SQNA 3V8LA 2F4OB 2GWRA 4KFCA 2RDPA 1ZN2A 5HOOA 3FKIJ 3NAUA 4LIVA 3C2GA 1A6QA 3QYBA 4HNTA 3WTXC 3BP8A 2DXIA 3W6KB 1DPUA 1BI3A 1ETWA 5KCMA 2XDVA 1JGGA 4CGZA 2H94A 1EJ9A 1A5JA 2OF7A 1QZZA 2W84A 3GBGA 3J7AY 2EH3A 2FMYA 3K4JA 3M8EA 4G7HF 1PVEA 1LEBA 4P96A 5E3OA 1X2MA 2PEXA 3H36A 3LSJA 5EZHA 2XB0X 3CC4I 4B3AA 2NAZA 3T8RA 2GA2A 3HDDA 1GVDA 1V5GA 5K1YA 5LGUA 5HS7A 4GXOA 1E3PA 2ME0A 4AVZA 2KIQA 2DLLA 3DLLF 1BC7C 2OQRA 4ANJA 3PO2J 2LDUA 4W97A 1JKRC 3OYGA 3C2HA 3LSPA 1ZG1A 3DPTA 1LDJA 2K9LA 2OD5A 2PQ8A 1FP1D 4L5JA 1USSA 4W1UA 2BY3A 2EZHA 1WRJA 2L5QA 2DMNA 1YX3A 3HOYJ 1X1DA 3OOPA 3WTYC 2KJBA 5DM7F 3HG9A 5E8IA 2KIMA 2A5WA 4D9JA 2CSOA 4HBLA 1KYZA 1ZLJA 2XGEA 4E7IA 1W7PA 4ETSA 3J80Z 4HQMA 1ACIA 2EV0A 1YS7A 3H0DA 4RB1A 4MEXF 2XUBA 1DU6A 4A93J 1LPQA 2OCEA 2VKDA 2R7TA 1O3RA 2P5VA 1BR1A 1UELB 1IRXA 2ELJA 3L2VA 4U0VA 3J7AO 4A3JJ 4UVCA 3S17J 3VB2A 2NXNB 4MFDA 1E3OC 1KQ8A 3ECHA 1IO2A 4FASD 2OAZA 3NWSA 3W3CA 5ILVA 1YX5A 3GUDA 2P8TA 3OR1C 2XPUA 1R58A 5JFRA 3F9KA 1HOMA 4H4KC 2ZNYA 3OOUA 5CQEA 3R60A 3RKXA 1WJCA 4X1EA 5C44J 1IXSB 3KP5A 1U9NA 4BQOA 1FPQA 1AHDP 2BVMA 2VPRA 2IXSA 2RQQA 3IAS2 4Q5SF 2EFPA 1POGA 1P7JA 4UVBA 1K6OA 3RQ4A 3CJQB 1IZ1A 1D1AA 2DA5A 2X51A 4NBQA 1AU7A 3OL4A 3ZP5A 1HDPA 3SXYA 2LKSA 1D5YA 3HTSB 4YIRX 2A6TA 3I58A 2NS0A 5IOZA 3F22A 3S3NA 1U0JA 1F36A 4DJAA 1D3YA 1W0TA 1IGNA 3BR3A 2KFDA 4M3FA 4V2GA 5FRNA 4IHTA 3F8BA 3OYCA 2HZTA 1D0XA 2VKHA 4XKWA 3VYUB 5HDKA 1FIAA 3FHNA 4GYGA 3S3MA 2HOSA 2O7OA 4N9IA 3ABMH 5GAEJ 1R36A 3CCEI 1SD5A 3L2QA 3FZVA 4BHPA 4A3EJ 3MKZA 4BH9A 4EJUA 1HCRA 3OYMA 1WZ2A 3Q5FA 1W36C 3WGHA 2EFOA 1T0FA 3BG5A 2E1OA 2ECBA 3BQYA 4LIUA 5CJ9A 3CO6C 3KP4A 4F7ZA 1YE9A 2FNPA 4PJMA 4BQNA 2BYVE 2BE5F 3M8FA 4IPAA 1ONVA 1GUUA 4A3KJ 2GOXB 3KYLA 4C2UA 2MD5A 1O3TA 5J8FA 4NC8A
chains in the Genus database with same CATH topology
1OYWA 2K86A 2LKPA 5FLXK 1ZGAA 5EEGA 2M87A 2CG4A 2H6CA 4A5MA 4XLPF 1R7JA 2E7XA 4YFKF 4DQ2A 5K5RA 1ZRFA 3GLXA 2JTVA 5D8KB 3WU0A 2CGPA 2PJPA 3RYPA 2EFNA 4KIFA 2QM3A 4ENMA 1G4DA 3M9AA 4HX7A 4BYYA 5LHIA 3R0AA 3LSTA 1F4KA 2YSRA 4EVIA 4LG0A 4L0YB 4M72A 4IRGA 1U78A 4I98B 1UB9A 2Q8KA 3HRUA 1O7FA 4IJAA 1SD6A 5J8CA 1TQIA 5ICEA 2GIVA 1ODDA 3JAMZ 2A07F 1KU3A 4U7BA 3MZHA 2F5FA 1WKMA 3HHHA 1YIOA 2D2WA 1O3QA 1QNTA 2P4WA 4G6QA 5HVQC 4LD5A 2XAFA 5K5QA 3ECOA 3HIFA 1A04A 2G7UA 5ILSA 2O0YA 1BI0A 1HQCA 2CO5A 2ELHA 4A2UA 4OOIA 1SD4A 1Z7UA 4ESFA 3TOBA 2XROA 1XMKA 1S7AA 4L18B 2FQ3A 3DFGA 1OYIA 5HDNA 4OINF 3RPQA 2JRTA 2GXBA 3ZPLA 1DDNA 2EFWA 5IT9Z 2EV5A 1R5HA 3QPTA 1HW5A 5HS9A 1JHFA 5FD5A 2M8EA 3E97A 1V3FA 3FXQA 1YO5C 4RAZA 2EWNA 2FSWA 4XBFA 1ZRCA 5DD4A 1S29A 1V4RA 3QRFF 4GGGA 3CUQA 3QU6A 2W24A 3BROA 4ASNA 3QP6A 3QU3A 3FXRA 4R79A 3F72A 5CVVA 1YYVA 4CYDA 4JK1X 1R1VA 4B8XA 2HFHA 5BS6A 1IXRC 5H6RA 1KYWA 1YQAA 4RAYA 3OV8A 4ZZLA 2HR3A 1STZA 1R00A 1YTYA 3V8KA 4ENJA 3CO7C 2YX7A 3I4PA 2OZ6A 1OR7A 4O3MA 3DP7A 2EK5A 3ERED 4WX9A 2ETHA 1MZBA 2RN7A 1TTYA 2O3FA 3HSEA 2P6TA 4HLXA 3HOSA 2EV6A 4UNOA 2V1XA 4O6JA 5LHGA 2QBYA 3P9KA 1B4AA 2PMHA 1O7LA 1G3SA 1AWCA 2RGVA 2VC0A 1U2WA 2EA4A 3CUOA 2IP2A 4Q4ZF 1UCRA 2Q0OA 1QQIA 2HQRA 3J80K 2FNAA 4PZJA 2HYFA 2STWA 3C3WA 5D5VB 1K7AA 3WU1B 3WTWC 3H3UA 4LLGF 4RB2C 2HKOA 1D5VA 3GXOA 5LGNA 2BV6A 2PFBA 2R3SA 4IRHA 5D5XB 2XAGA 1U6GA 4XSXF 3I59B 4I09A 3BY6A 2IRFG 2MH2A 3WTSC 1FSHA 2AS5F 2O03A 2STTA 4PDKA 1JHHA 3HUGA 1RUNA 1SFXA 2XASA 4HF2A 5E1ZB 4CICA 1LJ9A 2Y75A 2FE3A 2V1DA 2HQNA 3LA3A 4N0BA 3I71A 5F6FA 3ULQB 3RJPA 1Z6TA 2FRHA 1D8JA 2WWYA 2CYYA 5LBQA 4EGYA 2QQ9A 2GA1A 1S8NA 3P9IA 3F8NA 1MDMA 2L3DA 4CHUA 3KCCA 5DCMB 3NRVA 3I64A 2MLKA 4RGSA 1YW8A 2YPRA 1SAXA 3FMRA 2IJLA 1U8RA 2MLGA 2E7WA 1TLHB 4BHBA 3WE2A 1QBJA 4ON0A 4HV5A 3GFJA 4HF0A 4HDUA 1K79A 3U1DA 3KE2A 4BAYA 4EV0A 2K27A 4LMYA 2M45A 2MBFA 4M73A 2MA3A 3FF5A 1HW2A 1FYLA 3L9FA 1YFHA 5F1RA 2ZKZA 3MFKA 3G73A 3K2ZA 1S3JA 2DU9A 1IN4A 1LB2A 3DKWA 1I1GA 2QLZA 3ZMZA 3EYYA 1KQ0A 4AIJA 2JPCA 1E2XA 3JAMK 4RGUA 2KKOA 1T98A 2WTEA 3EETA 4MTDA 4AIKA 2A5YB 3GO5A 3RPUA 2R7FA 1FY7A 2ISYA 3IWZA 1WQ2A 5HLIA 1MJBA 3C1DA 2KRFA 2VBZA 3LQQA 1XSDA 1KA8A 4GCVA 4KIGA 5DV5A 1H9GA 2D1HA 3K1PA 2P7CB 3FX3A 3E5UA 4U88A 1XD7A 2VE9A 3C7JA 3WTZA 2VT2A 4ENNA 5LRRA 4I0BA 4NB5A 2RV8A 3FXUA 1DUXC 2VOOA 1QZYA 1P92A 5IT9K 2Z9OA 1G6NA 3I53A 2FBKA 3IC7A 2Z99A 5DD8A 4ZYGA 3J81Z 2EB7A 5H20A 4KYWA 2XKPA 1TBXA 1F5TA 3IRQA 3M7GA 4OMYA 1EH8A 3VEPA 2PI0A 4Y13A 4CDGA 3HRSA 2A61A 1JXSA 3I0TA 4WXDA 2K02A 3LWFA 3F23A 2IW5A 1I1SA 5CVRA 3O2PE 4LB6B 3Q9VA 1FYKA 3O3KA 5L3EA 3E6DA 4G6DA 4UVAA 3CTAA 4LFUA 5LGTA 2Z33A 3GW2A 3GZ5A 3K0LA 2G9WA 3ZQ7A 2EA2A 4M9XA 3PQKA 3F21A 1P4XA 4OIOF 2HTJA 2OBPA 2VODA 3IRRA 1ZARA 1IAWA 1T6SA 2MC3A 3ISPA 2QVOA 3L00A 1CF7A 3PFIA 1TW2A 1FWZA 3FMSA 4I2OA 4KNYA 2QYOA 4ZH4F 4Y15A 1YW7A 1KQ9A 4WXCA 2NYXA 3KFWX 2Y48A 1XDUA 1PDNC 2B0LA 2BBYA 2X4HA 1Z6RA 5FFZA 5A2QZ 1BC8C 1IRFA 3HOTA 2XAQA 1GHCA 2HEOA 2ZMEB 1TNTA 4A6EA 2Q2EA 3SHFA 2DK5A 3DXJF 1YG2A 1ZHFA 3KP3A 2OZUA 2VOPA 4YFNF 4R8HA 1HW1A 4BHCA 4A0ZA 5D8LB 2VBXA 4A6DA 2V9VA 2V79A 4WF2A 2CWEA 1SFEA 2FMLA 4HDVA 3PQJA 3NEUA 4OIPF 3BJ6A 1XSVA 1UHWA 4G7OF 1O3SA 1XMAA 1LQ1A 1XSXA 4M71A 1SD7A 1J2XA 1PP8F 3HRMA 4O5VA 3K1MA 1EH6A 4AD9A 2RVCA 3SZPA 3KETA 1OMIA 1REPC 4ZYEA 1TQMA 1IN7A 2FXAA 5ICCA 1TW3A 1B9MA 4HYEA 3KP7A 2GZWA 3VODA 3TKYA 1I27A 5JI6A 1R1UA 1OYYA 1W5TA 4KIBA 1B6AA 1ZLKA 1W7PB 6PAXA 1ZAOA 1B9NA 3T8TA 4HV6A 3ZMSA 3BDDA 3MAJA 1J0RA 4UV9A 3FMQA 4PGGA 3ZMVA 5CVIA 2FF4A 4ZYHA 5CVJA 2FOKA 2MH9A 3HRTA 1FLIA 4QWQA 3LA7A 3FM3A 4KA4A 1ZH5A 5HLHA 3F8MA 1W7PD 3KP6A 3SFZA 2Z5UA 4RB0A 3TO7A 1Z05A 3GWZA 3IHUA 5CYVA 3BPXA 1FOKA 5L3BA 1FNNA 3RDIA 5EEHA 1EH7A 4G7ZF 5CLSA 2RNJA 2PLYA 2ZXJA 3RTRA 2E1CA 4A12A 5DUKA 5DCMA 3DEUA 1FZPB 3ELKA 2D1VA 5LLQA 1BIAA 1R23A 5ED4A 2M1BA 2RQPA 4M74A 1ZRDA 2ZBKA 3KLNA 2H27A 5FO5A 4LK0F 4MQVA 3P9CA 2PMUA 2H09A 1BIBA 3GYHX 4E70A 2P5KA 4TV7A 2VXZA 3TOAA 2QENA 2DQRA 1XGNA 1RNLA 3KZZA 1RIOH 4G9YA 3KEQA 2IA2A 5D6FA 2V1UA 2DT5A 1T2KA 4YIIA 4EJTA 3RI4A 4OIQF 4P55A 2DQLA 4RGRA 3I54A 5KVRA 2HS5A 3RKWA 4L0ZB 4RB3C 1HXDA 4LG0B 2DPDA 2K4JA 3TGNA 4L9VA 2JZYA 2ISZA 5ICFA 3L7WA 4XSZF 3V7SA 1BI1A 1C0WA 2H6BA 5FLXZ 1E17A 3LQRA 2ADUA 1IN8A 2ZJ2A 3MWMA 3IKTA 3FWEA 4I02A 4P9FA 4EM1A 5E18F 1J75A 4RS8A 4MNUA 4UHTA 4U7DA 4L9NA 1SMYF 4WCGA 4EJVA 4M6XA 2HWVA 2XRNA 1ZG5A 3Q9SA 2EFQA 1DPRA 5L3FA 1S6LA 4RGXA 3WE3A 1HKSA 2FBIA 3QOPA 4HQEA 3JTHA 1XDSA 1MKMA 4I0AA 4BQAA 1UHMA 5L3CA 4IXAA 4H0EA 2XAJA 4M6YA 1W4MA 4AVPA 2DK8A 1F9NA 1RI7A 1J5YA 2DAOA 3ROUA 4HOBA 4LB5A 2FA5A 3E5QA 2UZKA 3SZTA 2IT0A 5FFXA 3L09A 4MEYF 2CQKA 3GFMA 2D45A 1KU2A 2P6SA 1I6XA 5BMZA 1TQPA 2P7VB 4MQ9F 1LNWA 5TJJA 1FBUA 1HKQA 4A0XA 3V7CA 4ZYDA 3CUQB 2JT1A 4P9UA 3GX4X 3BPVA 1P4WA 1IW7F 2ACJA 1BM9A 4KMUX 2BEOA 3VOEA 1ON1A 2PN6A 2XAHA 2BGCA 5D4SA 1W5SA 2ZFWA 3JSPA 5J6XA 4EQQA 2DPUA 1KU9A 1OKRA 3EYIA 4GYIA 3P7NA 2XHKA 1EV7A 2VBWA 2CW0F 2UXXA 1WWXA 4UV8A 2IPQX 4HX8A 2F2EA 3ZMDA 4KT5C 4Q48A 3R4KA 2XVCA 3TO6A 4U0WA 2QZ8A 2Z3YA 2IA0A 3U2RA 3DF8A 4G8XA 4BXUA 2QBYB 3G3ZA 1ZGJA 4XRFA 4PCQA 4NHJA 4KDPA 4MTEA 4JQFA 4IVNA 3GFIA 2VE8A 3HSRA 3TDUC 3LA2A 1SMTA 2O8XA 2V6CA 2ESHA 3TQNA 1G3WA 1BOAA 3B02A 3GZ6A 2ZCWA 2QQAA 1VTNC 4ENKA 4OIRF 2KIUA 2L01A 4UXNA 5LRSA 2FEZA 3IKVA 4EMSA 2VONA 1HSJA 1ULYA 4LJZF 5DEQA 1L3LA 1Y0UA 4OU0A 3HHGA 1LDDA 2K7LA 4XLNF 1B59A 1ZREA 5AIPA 2ESNA 2KIFA 3ML6A 3DQVC 1U5TB 1F1ZA 1QPMA 4KICA 1GXPA 1AOYA 2RKHA 3T5XA 1FT9A 1TNSA 2GXGA 3B73A 4KN7X 1YW9A 2DFIA 4YIFA 1PUEE 2VN2A 1MDMB 5KK1A 4Z2YA 4EGZA 3F6VA 1DP7P 5ERIA 4L5IA 3DV8A 1ZYRF 1S7OA 4KMFA 1QO0D 3MZYA 1JGSA 5D5UB 3R6SA 4MGRA 2UWMA 1WSUA 2DI3A 4OMZA 2W57A 5BQTA 2DW4A 3TO9A 1XGSA 2M30A 3U9GA 1FYMA 1MJ9A 5D5WB 5HDGA 2QWWA 5DCFA 4WXHA 1K78B 4NQWA 1KGSA 4EM2A 2W25A 3WTUC 3N4MA 2HGCA 3WTVC 1G3TA 3K1NA 5BPDA 1U3EM 3WTTC 4FT8A 1XGMA 3E6BA 3LFKA 1IN5A 4ZZDA 2XGXA 1ZG3A 4K2EA 4D0PA 3HYIA 1IUYA 4FX0A 3E6CC 2F5DA 4HW0A 2QUFA 4JBAA 3W6JB 3R61A 3REOA 3ABUA 2F5EA 2XV4S 4Q47A 3RKYA 1MD0A 4KN4X 5DDGA 2LNBA 3V7RA 3GVAA 1QGPA 5F64A 3CDHA 2LF7A 1CGPA 1USTA 5ICGA 2COMA 3KP2A 2YU3A 1Z91A 3BOQA 1LEAA 2ZO4A 1XN7A 2GQQA 4HA8A 4ESJA 4FX4A 1XB4A 3COAC 2VT3A 5E8GA 4A0YA 4S04A 2M5WA 1LVAA 4HAMA 2DBBA 3DPLC 3ZMTA 2HDCA 3JTGA 5E17F 3JSOA 1MJAA 4YFXF 3HSFA 5FGMA 1GVJA 3V4GA 1H0MA 5H6QA 2JPBA 1J9IA 4I01A 2L02A 1IXCA 3I59A 3MQ0A 5BOXA 5IT3A 2AXLA 4BNCA 3K9TA 3O6BB 1LDKB 1MGTA 1BBYA 5FD6A 1I5ZA 1L0OC 4UUVA 3QPHA 2HYGD 5FB2A 2HOEA 1P6RA 1Z1DA 2E1NA 3ZN1A 1SFUA 1FX7A 1XCBA 4S05A 3H3ZA 3HTUA 3M1EA 1KU7A 2FBHA 3F3XA 5LEKA 4R1HA 1BJAA 5D4RA 5JVTA 3C18A 4CXFA 3CLOA 4HF1A 2YX4A 2WV0A 2QQBA 4MHGA 3E3VA 1FSEA 1R22A 5AIQA 3CJNA 1X3UA 1XGOA 4M9ZA 4YG2F 3KLOA 4L9JA 3KZYA 4LLLA 4ESBA 2WC2A 2LF8A 1CF7B 1R1TA 5LEJA 2A6EF 3E5XA 1HSTA 2J5PA 5E1WA 3JW4A 1T39A 2O61A 3FHZA 3EQLF 3F8FA 1BI2A 2HKXA 2OQGA 1P4AA 3QP5A 2CFXA 4AWXB 2OU2A 2UXNA 1NHAA 4HLYA 3EUHA 4B09A 2F5CA 3BWGA 2J5OA 3N97A 1J7KA 4QLCU 3CUQC 3IL2A 1O57A 1B1BA 1HKTA 1G3YA 2PG4A 4EJWA 3ZMUA 4I7HA 4LLNA 5D6EA 2A3SA 2JSCA 1HBXG 1R5GA 3NQOA 4WK8F 3BZ6A 5K5OA 3J81K 2YR2A 2L4MA 5E1XA 4PGHA 3GEZA 4DNCA 3LAJA 2A68F 3D5LA 3GF2A 3BJAA 2OA4A 4IHSA 2O6GE 2K4BA 3WGIA 4A5NA 4N9HA 3BJOA 1P2FA 1FBQA 3RYRA 3VFZA 4WWCA 2RC4A 5DUIA 4HZFA 2XKOA 5LHHA 2NNYA 3GFLA 1Z9CA 3WODF 2FU4A 2NNNA 4IRIA 1D8KA 3I5UA 2W85A 5E20A 1XCVA 3TDZC 4HX4A 2IVMA 2R7DA 2L54A 3F8CA 5L3GA 2NRAC 2X0LA 2P5LC 3T0YA 1FC3A 5JR3A 1H9TA 1YS6A 4EM0B 2VBYA 1WI9A 4LK1F 3F6OA 3S2WA 2ZNZA 2G7HA 2PBIA 1RZ4A 1U5TA 1UFMA 2DO7A 1GXQA 3MEXA 4M9SA 2HTSA 3T1BA 3KEOA 3RIRA 1OPCA 5A2QK 3IWFA 2DTRA 3ZN0A 2GAUA 3V8JA 1Q1HA 5JHUA 4U0YA 1IN6A 1IF1A 2A6HF 2Y0MA 3WG9A 3R0JA 4GO1A 2EJRA 4EJOA 4KUMA 5CVUA 3ABTA 4P5OA 5HS8A 1JE8A 3D0SA 1PP7U 4CO8A 3E6MA 3QAHA 5DYMA 1U5TC 4Y17A 3H92A 2TDXA 1J59A 2LSOA 3LAPA 4G94A 1RUOA 5TRDA 1K78A 3MCZA 2A69F 4CZZA 1FBSA 5HLGA 4IF4A 2IA1A 2L4AA 3EDPA 3K69A 2ZMEA 3AAFA 5L3DA 5ILUA 1BN5A 1T38A 1ON2A 2C6YA 5BPIA 1FP2A 3L2CA 3FM5A 2VC1A 3WGGA 4FHTA 2KJCA 1YLFA 1IRGA 4LGWA 4L9TA 2XIGA 5AONA 4AIHA 3SQNA 3V8LA 2GWRA 4KFCA 2RDPA 1ZN2A 5HOOA 3WTXC 3BP8A 3W6KB 1DPUA 1BI3A 4CGZA 2H94A 1QZZA 2W84A 2FMYA 4G7HF 3M8EA 1LEBA 4P96A 2PEXA 2NAZA 3T8RA 2GA2A 5K1YA 5LGUA 5HS7A 4GXOA 2DLLA 1BC7C 2OQRA 2LDUA 1ZG1A 3DPTA 1LDJA 2OD5A 2PQ8A 1FP1D 4L5JA 1USSA 1WRJA 3OOPA 3WTYC 2KJBA 5E8IA 2KIMA 2CSOA 4HBLA 1KYZA 1ZLJA 1W7PA 4ETSA 3J80Z 4HQMA 2EV0A 1YS7A 4RB1A 4MEXF 2XUBA 1O3RA 2P5VA 3J7AO 4U0VA 4UVCA 3VB2A 1KQ8A 3ECHA 2OAZA 5ILVA 3GUDA 2P8TA 5JFRA 1R58A 2ZNYA 3R60A 3RKXA 1IXSB 3KP5A 1FPQA 4Q5SF 2EFPA 4UVBA 1K6OA 1IZ1A 3ZP5A 3SXYA 3HTSB 3I58A 2NS0A 3F22A 1D3YA 4IHTA 3F8BA 2HZTA 5HDKA 4GYGA 4N9IA 1R36A 1SD5A 3FZVA 4BHPA 4BH9A 4EJUA 3Q5FA 3WGHA 2EFOA 1T0FA 5CJ9A 3CO6C 3KP4A 4F7ZA 2FNPA 2BYVE 2BE5F 3M8FA 4IPAA 1ONVA 2MD5A 1O3TA 5J8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYW A;  2K86 A;  2LKP A;  5FLX K;  1ZGA A;  5EEG A;  2M87 A;  2CG4 A;  2H6C A;  4A5M A;  4XLP F;  1R7J A;  2E7X A;  4YFK F;  4DQ2 A;  5K5R A;  1ZRF A;  3GLX A;  2JTV A;  5D8K B;  3WU0 A;  2CGP A;  2PJP A;  3RYP A;  2EFN A;  4KIF A;  2QM3 A;  4ENM A;  1G4D A;  3M9A A;  4HX7 A;  4BYY A;  5LHI A;  3R0A A;  3LST A;  1F4K A;  2YSR A;  4EVI A;  4LG0 A;  4L0Y B;  4M72 A;  4IRG A;  1U78 A;  4I98 B;  1UB9 A;  2Q8K A;  3HRU A;  1O7F A;  4IJA A;  1SD6 A;  5J8C A;  1TQI A;  5ICE A;  2GIV A;  1ODD A;  3JAM Z;  2A07 F;  1KU3 A;  4U7B A;  3MZH A;  2F5F A;  1WKM A;  3HHH A;  1YIO A;  2D2W A;  1O3Q A;  1QNT A;  2P4W A;  4G6Q A;  5HVQ C;  4LD5 A;  2XAF A;  5K5Q A;  3ECO A;  3HIF A;  1A04 A;  2G7U A;  5ILS A;  2O0Y A;  1BI0 A;  1HQC A;  2CO5 A;  2ELH A;  4A2U A;  4OOI A;  1SD4 A;  1Z7U A;  4ESF A;  3TOB A;  2XRO A;  1XMK A;  1S7A A;  4L18 B;  2FQ3 A;  3DFG A;  1OYI A;  5HDN A;  4OIN F;  3RPQ A;  2JRT A;  2GXB A;  3ZPL A;  1DDN A;  2EFW A;  5IT9 Z;  2EV5 A;  1R5H A;  3QPT A;  1HW5 A;  5HS9 A;  1JHF A;  5FD5 A;  2M8E A;  3E97 A;  1V3F A;  3FXQ A;  1YO5 C;  4RAZ A;  2EWN A;  2FSW A;  4XBF A;  1ZRC A;  5DD4 A;  1S29 A;  1V4R A;  3QRF F;  4GGG A;  3CUQ A;  3QU6 A;  2W24 A;  3BRO A;  4ASN A;  3QP6 A;  3QU3 A;  3FXR A;  4R79 A;  3F72 A;  5CVV A;  1YYV A;  4CYD A;  4JK1 X;  1R1V A;  4B8X A;  2HFH A;  5BS6 A;  1IXR C;  5H6R A;  1KYW A;  1YQA A;  4RAY A;  3OV8 A;  4ZZL A;  2HR3 A;  1STZ A;  1R00 A;  1YTY A;  3V8K A;  4ENJ A;  3CO7 C;  2YX7 A;  3I4P A;  2OZ6 A;  1OR7 A;  4O3M A;  3DP7 A;  2EK5 A;  3ERE D;  4WX9 A;  2ETH A;  1MZB A;  2RN7 A;  1TTY A;  2O3F A;  3HSE A;  2P6T A;  4HLX A;  3HOS A;  2EV6 A;  4UNO A;  2V1X A;  4O6J A;  5LHG A;  2QBY A;  3P9K A;  1B4A A;  2PMH A;  1O7L A;  1G3S A;  1AWC A;  2RGV A;  2VC0 A;  1U2W A;  2EA4 A;  3CUO A;  2IP2 A;  4Q4Z F;  1UCR A;  2Q0O A;  1QQI A;  2HQR A;  3J80 K;  2FNA A;  4PZJ A;  2HYF A;  2STW A;  3C3W A;  5D5V B;  1K7A A;  3WU1 B;  3WTW C;  3H3U A;  4LLG F;  4RB2 C;  2HKO A;  1D5V A;  3GXO A;  5LGN A;  2BV6 A;  2PFB A;  2R3S A;  4IRH A;  5D5X B;  2XAG A;  1U6G A;  4XSX F;  3I59 B;  4I09 A;  3BY6 A;  2IRF G;  2MH2 A;  3WTS C;  1FSH A;  2AS5 F;  2O03 A;  2STT A;  4PDK A;  1JHH A;  3HUG A;  1RUN A;  1SFX A;  2XAS A;  4HF2 A;  5E1Z B;  4CIC A;  1LJ9 A;  2Y75 A;  2FE3 A;  2V1D A;  2HQN A;  3LA3 A;  4N0B A;  3I71 A;  5F6F A;  3ULQ B;  3RJP A;  1Z6T A;  2FRH A;  1D8J A;  2WWY A;  2CYY A;  5LBQ A;  4EGY A;  2QQ9 A;  2GA1 A;  1S8N A;  3P9I A;  3F8N A;  1MDM A;  2L3D A;  4CHU A;  3KCC A;  5DCM B;  3NRV A;  3I64 A;  2MLK A;  4RGS A;  1YW8 A;  2YPR A;  1SAX A;  3FMR A;  2IJL A;  1U8R A;  2MLG A;  2E7W A;  1TLH B;  4BHB A;  3WE2 A;  1QBJ A;  4ON0 A;  4HV5 A;  3GFJ A;  4HF0 A;  4HDU A;  1K79 A;  3U1D A;  3KE2 A;  4BAY A;  4EV0 A;  2K27 A;  4LMY A;  2M45 A;  2MBF A;  4M73 A;  2MA3 A;  3FF5 A;  1HW2 A;  1FYL A;  3L9F A;  1YFH A;  5F1R A;  2ZKZ A;  3MFK A;  3G73 A;  3K2Z A;  1S3J A;  2DU9 A;  1IN4 A;  1LB2 A;  3DKW A;  1I1G A;  2QLZ A;  3ZMZ A;  3EYY A;  1KQ0 A;  4AIJ A;  2JPC A;  1E2X A;  3JAM K;  4RGU A;  2KKO A;  1T98 A;  2WTE A;  3EET A;  4MTD A;  4AIK A;  2A5Y B;  3GO5 A;  3RPU A;  2R7F A;  1FY7 A;  2ISY A;  3IWZ A;  1WQ2 A;  5HLI A;  1MJB A;  3C1D A;  2KRF A;  2VBZ A;  3LQQ A;  1XSD A;  1KA8 A;  4GCV A;  4KIG A;  5DV5 A;  1H9G A;  2D1H A;  3K1P A;  2P7C B;  3FX3 A;  3E5U A;  4U88 A;  1XD7 A;  2VE9 A;  3C7J A;  3WTZ A;  2VT2 A;  4ENN A;  5LRR A;  4I0B A;  4NB5 A;  2RV8 A;  3FXU A;  1DUX C;  2VOO A;  1QZY A;  1P92 A;  5IT9 K;  2Z9O A;  1G6N A;  3I53 A;  2FBK A;  3IC7 A;  2Z99 A;  5DD8 A;  4ZYG A;  3J81 Z;  2EB7 A;  5H20 A;  4KYW A;  2XKP A;  1TBX A;  1F5T A;  3IRQ A;  3M7G A;  4OMY A;  1EH8 A;  3VEP A;  2PI0 A;  4Y13 A;  4CDG A;  3HRS A;  2A61 A;  1JXS A;  3I0T A;  4WXD A;  2K02 A;  3LWF A;  3F23 A;  2IW5 A;  1I1S A;  5CVR A;  3O2P E;  4LB6 B;  3Q9V A;  1FYK A;  3O3K A;  5L3E A;  3E6D A;  4G6D A;  4UVA A;  3CTA A;  4LFU A;  5LGT A;  2Z33 A;  3GW2 A;  3GZ5 A;  3K0L A;  2G9W A;  3ZQ7 A;  2EA2 A;  4M9X A;  3PQK A;  3F21 A;  1P4X A;  4OIO F;  2HTJ A;  2OBP A;  2VOD A;  3IRR A;  1ZAR A;  1IAW A;  1T6S A;  2MC3 A;  3ISP A;  2QVO A;  3L00 A;  1CF7 A;  3PFI A;  1TW2 A;  1FWZ A;  3FMS A;  4I2O A;  4KNY A;  2QYO A;  4ZH4 F;  4Y15 A;  1YW7 A;  1KQ9 A;  4WXC A;  2NYX A;  3KFW X;  2Y48 A;  1XDU A;  1PDN C;  2B0L A;  2BBY A;  2X4H A;  1Z6R A;  5FFZ A;  5A2Q Z;  1BC8 C;  1IRF A;  3HOT A;  2XAQ A;  1GHC A;  2HEO A;  2ZME B;  1TNT A;  4A6E A;  2Q2E A;  3SHF A;  2DK5 A;  3DXJ F;  1YG2 A;  1ZHF A;  3KP3 A;  2OZU A;  2VOP A;  4YFN F;  4R8H A;  1HW1 A;  4BHC A;  4A0Z A;  5D8L B;  2VBX A;  4A6D A;  2V9V A;  2V79 A;  4WF2 A;  2CWE A;  1SFE A;  2FML A;  4HDV A;  3PQJ A;  3NEU A;  4OIP F;  3BJ6 A;  1XSV A;  1UHW A;  4G7O F;  1O3S A;  1XMA A;  1LQ1 A;  1XSX A;  4M71 A;  1SD7 A;  1J2X A;  1PP8 F;  3HRM A;  4O5V A;  3K1M A;  1EH6 A;  4AD9 A;  2RVC A;  3SZP A;  3KET A;  1OMI A;  1REP C;  4ZYE A;  1TQM A;  1IN7 A;  2FXA A;  5ICC A;  1TW3 A;  1B9M A;  4HYE A;  3KP7 A;  2GZW A;  3VOD A;  3TKY A;  1I27 A;  5JI6 A;  1R1U A;  1OYY A;  1W5T A;  4KIB A;  1B6A A;  1ZLK A;  1W7P B;  6PAX A;  1ZAO A;  1B9N A;  3T8T A;  4HV6 A;  3ZMS A;  3BDD A;  3MAJ A;  1J0R A;  4UV9 A;  3FMQ A;  4PGG A;  3ZMV A;  5CVI A;  2FF4 A;  4ZYH A;  5CVJ A;  2FOK A;  2MH9 A;  3HRT A;  1FLI A;  4QWQ A;  3LA7 A;  3FM3 A;  4KA4 A;  1ZH5 A;  5HLH A;  3F8M A;  1W7P D;  3KP6 A;  3SFZ A;  2Z5U A;  4RB0 A;  3TO7 A;  1Z05 A;  3GWZ A;  3IHU A;  5CYV A;  3BPX A;  1FOK A;  5L3B A;  1FNN A;  3RDI A;  5EEH A;  1EH7 A;  4G7Z F;  5CLS A;  2RNJ A;  2PLY A;  2ZXJ A;  3RTR A;  2E1C A;  4A12 A;  5DUK A;  5DCM A;  3DEU A;  1FZP B;  3ELK A;  2D1V A;  5LLQ A;  1BIA A;  1R23 A;  5ED4 A;  2M1B A;  2RQP A;  4M74 A;  1ZRD A;  2ZBK A;  3KLN A;  2H27 A;  5FO5 A;  4LK0 F;  4MQV A;  3P9C A;  2PMU A;  2H09 A;  1BIB A;  3GYH X;  4E70 A;  2P5K A;  4TV7 A;  2VXZ A;  3TOA A;  2QEN A;  2DQR A;  1XGN A;  1RNL A;  3KZZ A;  1RIO H;  4G9Y A;  3KEQ A;  2IA2 A;  5D6F A;  2V1U A;  2DT5 A;  1T2K A;  4YII A;  4EJT A;  3RI4 A;  4OIQ F;  4P55 A;  2DQL A;  4RGR A;  3I54 A;  5KVR A;  2HS5 A;  3RKW A;  4L0Z B;  4RB3 C;  1HXD A;  4LG0 B;  2DPD A;  2K4J A;  3TGN A;  4L9V A;  2JZY A;  2ISZ A;  5ICF A;  3L7W A;  4XSZ F;  3V7S A;  1BI1 A;  1C0W A;  2H6B A;  5FLX Z;  1E17 A;  3LQR A;  2ADU A;  1IN8 A;  2ZJ2 A;  3MWM A;  3IKT A;  3FWE A;  4I02 A;  4P9F A;  4EM1 A;  5E18 F;  1J75 A;  4RS8 A;  4MNU A;  4UHT A;  4U7D A;  4L9N A;  1SMY F;  4WCG A;  4EJV A;  4M6X A;  2HWV A;  2XRN A;  1ZG5 A;  3Q9S A;  2EFQ A;  1DPR A;  5L3F A;  1S6L A;  4RGX A;  3WE3 A;  1HKS A;  2FBI A;  3QOP A;  4HQE A;  3JTH A;  1XDS A;  1MKM A;  4I0A A;  4BQA A;  1UHM A;  5L3C A;  4IXA A;  4H0E A;  2XAJ A;  4M6Y A;  1W4M A;  4AVP A;  2DK8 A;  1F9N A;  1RI7 A;  1J5Y A;  2DAO A;  3ROU A;  4HOB A;  4LB5 A;  2FA5 A;  3E5Q A;  2UZK A;  3SZT A;  2IT0 A;  5FFX A;  3L09 A;  4MEY F;  2CQK A;  3GFM A;  2D45 A;  1KU2 A;  2P6S A;  1I6X A;  5BMZ A;  1TQP A;  2P7V B;  4MQ9 F;  1LNW A;  5TJJ A;  1FBU A;  1HKQ A;  4A0X A;  3V7C A;  4ZYD A;  3CUQ B;  2JT1 A;  4P9U A;  3GX4 X;  3BPV A;  1P4W A;  1IW7 F;  2ACJ A;  1BM9 A;  4KMU X;  2BEO A;  3VOE A;  1ON1 A;  2PN6 A;  2XAH A;  2BGC A;  5D4S A;  1W5S A;  2ZFW A;  3JSP A;  5J6X A;  4EQQ A;  2DPU A;  1KU9 A;  1OKR A;  3EYI A;  4GYI A;  3P7N A;  2XHK A;  1EV7 A;  2VBW A;  2CW0 F;  2UXX A;  1WWX A;  4UV8 A;  2IPQ X;  4HX8 A;  2F2E A;  3ZMD A;  4KT5 C;  4Q48 A;  3R4K A;  2XVC A;  3TO6 A;  4U0W A;  2QZ8 A;  2Z3Y A;  2IA0 A;  3U2R A;  3DF8 A;  4G8X A;  4BXU A;  2QBY B;  3G3Z A;  1ZGJ A;  4XRF A;  4PCQ A;  4NHJ A;  4KDP A;  4MTE A;  4JQF A;  4IVN A;  3GFI A;  2VE8 A;  3HSR A;  3TDU C;  3LA2 A;  1SMT A;  2O8X A;  2V6C A;  2ESH A;  3TQN A;  1G3W A;  1BOA A;  3B02 A;  3GZ6 A;  2ZCW A;  2QQA A;  1VTN C;  4ENK A;  4OIR F;  2KIU A;  2L01 A;  4UXN A;  5LRS A;  2FEZ A;  3IKV A;  4EMS A;  2VON A;  1HSJ A;  1ULY A;  4LJZ F;  5DEQ A;  1L3L A;  1Y0U A;  4OU0 A;  3HHG A;  1LDD A;  2K7L A;  4XLN F;  1B59 A;  1ZRE A;  5AIP A;  2ESN A;  2KIF A;  3ML6 A;  3DQV C;  1U5T B;  1F1Z A;  1QPM A;  4KIC A;  1GXP A;  1AOY A;  2RKH A;  3T5X A;  1FT9 A;  1TNS A;  2GXG A;  3B73 A;  4KN7 X;  1YW9 A;  2DFI A;  4YIF A;  1PUE E;  2VN2 A;  1MDM B;  5KK1 A;  4Z2Y A;  4EGZ A;  3F6V A;  1DP7 P;  5ERI A;  4L5I A;  3DV8 A;  1ZYR F;  1S7O A;  4KMF A;  1QO0 D;  3MZY A;  1JGS A;  5D5U B;  3R6S A;  4MGR A;  2UWM A;  1WSU A;  2DI3 A;  4OMZ A;  2W57 A;  5BQT A;  2DW4 A;  3TO9 A;  1XGS A;  2M30 A;  3U9G A;  1FYM A;  1MJ9 A;  5D5W B;  5HDG A;  2QWW A;  5DCF A;  4WXH A;  1K78 B;  4NQW A;  1KGS A;  4EM2 A;  2W25 A;  3WTU C;  3N4M A;  2HGC A;  3WTV C;  1G3T A;  3K1N A;  5BPD A;  1U3E M;  3WTT C;  4FT8 A;  1XGM A;  3E6B A;  3LFK A;  1IN5 A;  4ZZD A;  2XGX A;  1ZG3 A;  4K2E A;  4D0P A;  3HYI A;  1IUY A;  4FX0 A;  3E6C C;  2F5D A;  4HW0 A;  2QUF A;  4JBA A;  3W6J B;  3R61 A;  3REO A;  3ABU A;  2F5E A;  2XV4 S;  4Q47 A;  3RKY A;  1MD0 A;  4KN4 X;  5DDG A;  2LNB A;  3V7R A;  3GVA A;  1QGP A;  5F64 A;  3CDH A;  2LF7 A;  1CGP A;  1UST A;  5ICG A;  2COM A;  3KP2 A;  2YU3 A;  1Z91 A;  3BOQ A;  1LEA A;  2ZO4 A;  1XN7 A;  2GQQ A;  4HA8 A;  4ESJ A;  4FX4 A;  1XB4 A;  3COA C;  2VT3 A;  5E8G A;  4A0Y A;  4S04 A;  2M5W A;  1LVA A;  4HAM A;  2DBB A;  3DPL C;  3ZMT A;  2HDC A;  3JTG A;  5E17 F;  3JSO A;  1MJA A;  4YFX F;  3HSF A;  5FGM A;  1GVJ A;  3V4G A;  1H0M A;  5H6Q A;  2JPB A;  1J9I A;  4I01 A;  2L02 A;  1IXC A;  3I59 A;  3MQ0 A;  5BOX A;  5IT3 A;  2AXL A;  4BNC A;  3K9T A;  3O6B B;  1LDK B;  1MGT A;  1BBY A;  5FD6 A;  1I5Z A;  1L0O C;  4UUV A;  3QPH A;  2HYG D;  5FB2 A;  2HOE A;  1P6R A;  1Z1D A;  2E1N A;  3ZN1 A;  1SFU A;  1FX7 A;  1XCB A;  4S05 A;  3H3Z A;  3HTU A;  3M1E A;  1KU7 A;  2FBH A;  3F3X A;  5LEK A;  4R1H A;  1BJA A;  5D4R A;  5JVT A;  3C18 A;  4CXF A;  3CLO A;  4HF1 A;  2YX4 A;  2WV0 A;  2QQB A;  4MHG A;  3E3V A;  1FSE A;  1R22 A;  5AIQ A;  3CJN A;  1X3U A;  1XGO A;  4M9Z A;  4YG2 F;  3KLO A;  4L9J A;  3KZY A;  4LLL A;  4ESB A;  2WC2 A;  2LF8 A;  1CF7 B;  1R1T A;  5LEJ A;  2A6E F;  3E5X A;  1HST A;  2J5P A;  5E1W A;  3JW4 A;  1T39 A;  2O61 A;  3FHZ A;  3EQL F;  3F8F A;  1BI2 A;  2HKX A;  2OQG A;  1P4A A;  3QP5 A;  2CFX A;  4AWX B;  2OU2 A;  2UXN A;  1NHA A;  4HLY A;  3EUH A;  4B09 A;  2F5C A;  3BWG A;  2J5O A;  3N97 A;  1J7K A;  4QLC U;  3CUQ C;  3IL2 A;  1O57 A;  1B1B A;  1HKT A;  1G3Y A;  2PG4 A;  4EJW A;  3ZMU A;  4I7H A;  4LLN A;  5D6E A;  2A3S A;  2JSC A;  1HBX G;  1R5G A;  3NQO A;  4WK8 F;  3BZ6 A;  5K5O A;  3J81 K;  2YR2 A;  2L4M A;  5E1X A;  4PGH A;  3GEZ A;  4DNC A;  3LAJ A;  2A68 F;  3D5L A;  3GF2 A;  3BJA A;  2OA4 A;  4IHS A;  2O6G E;  2K4B A;  3WGI A;  4A5N A;  4N9H A;  3BJO A;  1P2F A;  1FBQ A;  3RYR A;  3VFZ A;  4WWC A;  2RC4 A;  5DUI A;  4HZF A;  2XKO A;  5LHH A;  2NNY A;  3GFL A;  1Z9C A;  3WOD F;  2FU4 A;  2NNN A;  4IRI A;  1D8K A;  3I5U A;  2W85 A;  5E20 A;  1XCV A;  3TDZ C;  4HX4 A;  2IVM A;  2R7D A;  2L54 A;  3F8C A;  5L3G A;  2NRA C;  2X0L A;  2P5L C;  3T0Y A;  1FC3 A;  5JR3 A;  1H9T A;  1YS6 A;  4EM0 B;  2VBY A;  1WI9 A;  4LK1 F;  3F6O A;  3S2W A;  2ZNZ A;  2G7H A;  2PBI A;  1RZ4 A;  1U5T A;  1UFM A;  2DO7 A;  1GXQ A;  3MEX A;  4M9S A;  2HTS A;  3T1B A;  3KEO A;  3RIR A;  1OPC A;  5A2Q K;  3IWF A;  2DTR A;  3ZN0 A;  2GAU A;  3V8J A;  1Q1H A;  5JHU A;  4U0Y A;  1IN6 A;  1IF1 A;  2A6H F;  2Y0M A;  3WG9 A;  3R0J A;  4GO1 A;  2EJR A;  4EJO A;  4KUM A;  5CVU A;  3ABT A;  4P5O A;  5HS8 A;  1JE8 A;  3D0S A;  1PP7 U;  4CO8 A;  3E6M A;  3QAH A;  5DYM A;  1U5T C;  4Y17 A;  3H92 A;  2TDX A;  1J59 A;  2LSO A;  3LAP A;  4G94 A;  1RUO A;  5TRD A;  1K78 A;  3MCZ A;  2A69 F;  4CZZ A;  1FBS A;  5HLG A;  4IF4 A;  2IA1 A;  2L4A A;  3EDP A;  3K69 A;  2ZME A;  3AAF A;  5L3D A;  5ILU A;  1BN5 A;  1T38 A;  1ON2 A;  2C6Y A;  5BPI A;  1FP2 A;  3L2C A;  3FM5 A;  2VC1 A;  3WGG A;  4FHT A;  2KJC A;  1YLF A;  1IRG A;  4LGW A;  4L9T A;  2XIG A;  5AON A;  4AIH A;  3SQN A;  3V8L A;  2GWR A;  4KFC A;  2RDP A;  1ZN2 A;  5HOO A;  3WTX C;  3BP8 A;  3W6K B;  1DPU A;  1BI3 A;  4CGZ A;  2H94 A;  1QZZ A;  2W84 A;  2FMY A;  4G7H F;  3M8E A;  1LEB A;  4P96 A;  2PEX A;  2NAZ A;  3T8R A;  2GA2 A;  5K1Y A;  5LGU A;  5HS7 A;  4GXO A;  2DLL A;  1BC7 C;  2OQR A;  2LDU A;  1ZG1 A;  3DPT A;  1LDJ A;  2OD5 A;  2PQ8 A;  1FP1 D;  4L5J A;  1USS A;  1WRJ A;  3OOP A;  3WTY C;  2KJB A;  5E8I A;  2KIM A;  2CSO A;  4HBL A;  1KYZ A;  1ZLJ A;  1W7P A;  4ETS A;  3J80 Z;  4HQM A;  2EV0 A;  1YS7 A;  4RB1 A;  4MEX F;  2XUB A;  1O3R A;  2P5V A;  3J7A O;  4U0V A;  4UVC A;  3VB2 A;  1KQ8 A;  3ECH A;  2OAZ A;  5ILV A;  3GUD A;  2P8T A;  5JFR A;  1R58 A;  2ZNY A;  3R60 A;  3RKX A;  1IXS B;  3KP5 A;  1FPQ A;  4Q5S F;  2EFP A;  4UVB A;  1K6O A;  1IZ1 A;  3ZP5 A;  3SXY A;  3HTS B;  3I58 A;  2NS0 A;  3F22 A;  1D3Y A;  4IHT A;  3F8B A;  2HZT A;  5HDK A;  4GYG A;  4N9I A;  1R36 A;  1SD5 A;  3FZV A;  4BHP A;  4BH9 A;  4EJU A;  3Q5F A;  3WGH A;  2EFO A;  1T0F A;  5CJ9 A;  3CO6 C;  3KP4 A;  4F7Z A;  2FNP A;  2BYV E;  2BE5 F;  3M8F A;  4IPA A;  1ONV A;  2MD5 A;  1O3T A;  5J8F A; 
#chains in the Genus database with same CATH topology
 1OYW A;  3AG4 H;  2K86 A;  2LKP A;  5FLX K;  1D1C A;  2ZXH A;  2V7F A;  1OCO H;  1ZGA A;  5EEG A;  2Z2S B;  4XKC A;  5B1A H;  2M87 A;  5C4J J;  1MSE C;  2CG4 A;  3K4M A;  2H6C A;  4A5M A;  4XLP F;  1R7J A;  3PIO F;  1LE8 B;  2E7X A;  3W2A A;  4YFK F;  4DQ2 A;  1OJL A;  3CCS I;  5K5R A;  1ZRF A;  4RMN A;  4CCN A;  3GLX A;  3GME A;  2JTV A;  1S72 I;  5D8K B;  3Q0W A;  4II2 A;  3WU0 A;  2CGP A;  1TL8 A;  1Z21 A;  2K9M A;  2PJP A;  2ZSI B;  3RYP A;  2EFN A;  4KIF A;  2QM3 A;  3S93 A;  4ENM A;  1G4D A;  1Z7L A;  3M9A A;  4HX7 A;  4BYY A;  2BXY A;  5LHI A;  3FXJ A;  1WJF A;  1T0F C;  3R0A A;  3LST A;  3S14 J;  1F4K A;  2YSR A;  4EVI A;  4LG0 A;  2H1K A;  4L0Y B;  4M72 A;  4IRG A;  2L9N A;  1U78 A;  4I98 B;  1UB9 A;  5E3L A;  3KYD B;  1YJW I;  3CMY A;  2Q8K A;  2LYC A;  4PSX A;  1T08 B;  2XF7 A;  2MD0 A;  3HRU A;  3I3L A;  1O7F A;  4G12 A;  4IJA A;  4RA2 A;  1SD6 A;  2IAI A;  5J8C A;  1N77 A;  2DOF A;  3CCR I;  1TQI A;  5ICE A;  3QOD A;  2GIV A;  1ODD A;  3JAM Z;  2A07 F;  4IOA F;  1KU3 A;  2E2H J;  2ID6 A;  1N78 A;  1OCZ H;  1FMV A;  2K3F A;  4U7B A;  3MZH A;  1ITY A;  2F5F A;  1WKM A;  3VWB A;  3HHH A;  3VSL A;  1YIO A;  3MKL A;  2D2W A;  3BR6 A;  1XS9 A;  1O3Q A;  1XG1 A;  3BZK A;  1QNT A;  2P4W A;  4AUX A;  1QVT A;  2QKL B;  4G6Q A;  5HVQ C;  2IS1 A;  2KDO A;  1UG0 A;  4LD5 A;  5F27 A;  1YRN B;  2XAF A;  3WU2 C;  1VQ5 I;  5K5Q A;  1VQN I;  1RES A;  2JJ7 A;  3ECO A;  3HIF A;  2Z16 A;  4C3J J;  1A04 A;  4CZC A;  2GXA A;  1VF9 A;  2G7U A;  2JA7 J;  3AG2 H;  5ILS A;  2R7V A;  2O0Y A;  1BI0 A;  3A02 A;  1HQC A;  1IDY A;  1TWF J;  2CO5 A;  4LIT A;  4IO9 F;  1TWH J;  2ELH A;  4A2U A;  4CCJ A;  1NTC A;  4OOI A;  4Y3O A;  4IHV A;  1SD4 A;  1T33 A;  1A31 A;  1Z7U A;  4ESF A;  3TOB A;  2XRO A;  1XMK A;  3GTM J;  1AA7 A;  1WFX A;  3HOV J;  1S7A A;  4L18 B;  2FQ3 A;  1QHG A;  3DFG A;  1OYI A;  2DYS H;  4BDZ A;  5HDN A;  4OIN F;  3RPQ A;  3O8H A;  4A3B J;  2JRT A;  2GXB A;  3ZPL A;  3OYI A;  1DDN A;  2VLA A;  2AQF A;  2M2E A;  4C3I J;  2EFW A;  4IQJ A;  5IT9 Z;  2L7F P;  2EV5 A;  3RKQ A;  2Z1D A;  1R5H A;  2JUC A;  3QPT A;  3CCM I;  1HW5 A;  1JTX A;  5HS9 A;  1JHF A;  5FD5 A;  2M8E A;  2WAD A;  3E97 A;  1V3F A;  3FXQ A;  1YO5 C;  4RAZ A;  4A3M J;  3CCQ I;  2EWN A;  4J01 A;  3A2K A;  2FSW A;  4XBF A;  5J3L A;  1ZRC A;  5DD4 A;  1S29 A;  4ABZ A;  1MIJ A;  1V4R A;  5F04 A;  2M0M A;  3QRF F;  2H1L A;  4GGG A;  4MO7 A;  1I3Q J;  1ETV A;  1SVL A;  5EGO A;  2KRC A;  2DT7 B;  3CUQ A;  2I8D A;  3QU6 A;  2W24 A;  1JI8 A;  3TMO A;  3BRO A;  4ASN A;  3VYS B;  2EIL H;  3QP6 A;  3QU3 A;  3FXR A;  4XLF A;  3GTJ J;  1HA8 A;  2MYS A;  4R79 A;  2KZG A;  3F72 A;  5CVV A;  2IEK A;  1YYV A;  2LOO A;  4CYD A;  4JK1 X;  1DU0 A;  1R1V A;  4A3D J;  2DFF A;  1B72 A;  3HJE A;  2DN0 A;  4B8X A;  2HFH A;  5BS6 A;  3OYK A;  1K61 A;  2GLO A;  5GP9 A;  1IXR C;  5H6R A;  3RZO J;  3QQA A;  1KYW A;  4V2F A;  1VQM I;  4EEF G;  1YQA A;  4RAY A;  3OV8 A;  4ZZL A;  2HR3 A;  1STZ A;  5GTH C;  1R00 A;  1YTY A;  3V8K A;  4ENJ A;  2HXO A;  1FTZ A;  4E7S A;  2JWT A;  3H3V K;  4F55 A;  2K9Q A;  3FKJ A;  3CO7 C;  1DGW Y;  2YX7 A;  3I4P A;  2MFZ A;  2OZ6 A;  1MMD A;  2R5Y A;  1OR7 A;  4O3M A;  2VQH A;  2DMP A;  5LD2 C;  3DP7 A;  2EK5 A;  3ERE D;  3CCJ I;  4WX9 A;  1WHU A;  2ETH A;  3PNT A;  1HDD C;  1MZB A;  2RN7 A;  1XX5 A;  1RPW A;  1TTY A;  2LLK A;  2OTJ I;  2A05 A;  4YEL A;  4NC6 A;  1S5L C;  2E5N A;  2O3F A;  3HSE A;  4UUS A;  2P6T A;  3ZQL A;  3M4O J;  4HLX A;  3HOS A;  1HC8 A;  4PJN A;  2JN6 A;  2EV6 A;  3OWT A;  1JUS A;  4UNO A;  2V1X A;  3CJR B;  3NWT A;  4O6J A;  1OIS A;  3U1K A;  3S1N J;  3BG7 A;  5CQG A;  2K3P A;  5LHG A;  2R7Z J;  2QBY A;  3P9K A;  1IV6 A;  4XIC A;  2V4J C;  1B4A A;  2PMH A;  1O7L A;  1P9Q C;  1G3S A;  4GDF A;  1MBK A;  4QTR A;  1AWC A;  1SC7 A;  2ID3 A;  2RGV A;  2VC0 A;  2I10 A;  1U2W A;  2EA4 A;  4RM3 A;  3CUO A;  2IP2 A;  4JOM A;  3S16 J;  4Q4Z F;  2VAS A;  1UCR A;  3GTL J;  2DDB A;  4IHW A;  2NS7 A;  2P81 A;  4F93 B;  1VQ4 I;  1GV2 A;  1QQI A;  2Q0O A;  3L2W A;  2HQR A;  2FNA A;  4PZJ A;  3J80 K;  4ZTJ A;  2HYF A;  2X1E A;  2STW A;  3DKY A;  4B3X A;  2B7E A;  2FX0 A;  3C3W A;  5D5V B;  1K7A A;  4ZDO A;  3WU1 B;  3WTW C;  3H3U A;  4LLG F;  2IS6 A;  2COB A;  3EUA A;  2QQ8 A;  3G1M A;  2F6C A;  4RB2 C;  2HKO A;  1QZE A;  1D5V A;  3GXO A;  1MW7 A;  5LGN A;  2BV6 A;  2PFB A;  1RC9 A;  2R3S A;  3H5A A;  3LSH A;  4IRH A;  3BZC A;  3KZI C;  2XAG A;  3H1C A;  5D5X B;  1O4X A;  1K4S A;  3PNV A;  1U6G A;  2NVY J;  2OV7 A;  3CF2 A;  4XSX F;  2E1M C;  3I59 B;  1UJ8 A;  1Z3Y A;  2VKV A;  4I09 A;  2M7B A;  5J4Y A;  2XAU A;  3BY6 A;  3PNY A;  2NVX J;  2IRF G;  3MD2 A;  3OMY A;  3CLQ A;  5TIS C;  4XLA A;  2MH2 A;  3WTS C;  1FSH A;  2AS5 F;  2O03 A;  2STT A;  4A3I J;  4PDK A;  1G59 A;  2ZB9 A;  1JHH A;  3CC2 I;  3G1O A;  2LFB A;  3HUG A;  1RUN A;  3X2Q H;  3ASO H;  1SFX A;  2XAS A;  3AG1 H;  3CCV I;  2HU9 A;  2OUM A;  1X3Z B;  4HF2 A;  5E1Z B;  1UZC A;  4CIC A;  1LJ9 A;  2LY2 A;  2Y75 A;  2FE3 A;  2V1D A;  2KHM A;  2HQN A;  3LA3 A;  4N0B A;  3I71 A;  5F6F A;  3ULQ B;  2VL8 A;  3RJP A;  5IYC J;  1VQ7 I;  2HQA A;  4HEA 2;  5E3M A;  3UR3 C;  4Y52 J;  3MN2 A;  1Z6T A;  3V42 A;  4JYK A;  4BJ6 C;  2FRH A;  2VQG A;  4UB8 C;  3LSR A;  3OYF A;  1D8J A;  4E6K G;  2WWY A;  5FKN A;  1QA6 A;  3HOU J;  2ZJP F;  2CYY A;  2DYR H;  5LBQ A;  2BOL A;  3HPH A;  4FE7 A;  2KIS A;  4EGY A;  3DLA A;  2QQ9 A;  1IJW C;  5H2F C;  1LFP A;  3HEF A;  1OCT C;  2GA1 A;  1S8N A;  3P9I A;  3F8N A;  3FBI B;  1IV8 A;  1MDM A;  3GTP J;  2MG4 A;  2D5V A;  3NAR A;  3MVP A;  5M5Y J;  1V5E A;  5B1B H;  2L3D A;  1BR2 A;  4BJ5 C;  4CHU A;  3KCC A;  5DCM B;  3NRV A;  3I64 A;  2MLK A;  4RGS A;  2X6O A;  1YW8 A;  2YPR A;  2KZV A;  1SAX A;  2XF5 A;  4EAT A;  3FMR A;  3FDY A;  2IJL A;  1U8R A;  2MLG A;  2E7W A;  1TLH B;  3SEQ A;  3JRE A;  2L9S A;  2DJN A;  2OTL I;  4PJ0 C;  2JA8 J;  4BHB A;  3K10 A;  3WE2 A;  4E7Z A;  1QBJ A;  4ON0 A;  3BR1 A;  4HV5 A;  3GFJ A;  4HF0 A;  4N4N B;  2DFH A;  4OAY A;  4HDU A;  1K79 A;  1B8I A;  1X3W B;  3U1D A;  4JX6 A;  1TWG J;  3KE2 A;  4BAY A;  4EV0 A;  2Y31 A;  2ELK A;  2K27 A;  4LMY A;  2E19 A;  2M45 A;  2MBF A;  5HOD A;  4M73 A;  2LRD A;  4BL0 B;  2MA3 A;  2QF7 A;  3BG9 A;  3FF5 A;  3CMA I;  1HW2 A;  1FYL A;  3I4M J;  3L9F A;  1YFH A;  5F1R A;  2LG4 A;  1IUF A;  3OYH A;  2ZKZ A;  3TED A;  4V19 K;  3MFK A;  3G73 A;  3K2Z A;  1S3J A;  3CCU I;  2DU9 A;  1IN4 A;  1LB2 A;  2WY8 Q;  3DKW A;  1R49 A;  2BXZ A;  1I1G A;  5LFA A;  1ZK8 A;  2ZC2 A;  3G4S I;  3KYC B;  2QLZ A;  3ZMZ A;  1PUF A;  3WHC A;  3ONQ A;  3H0G J;  4BGD A;  2GIZ A;  1XC5 A;  3EYY A;  4I6Z A;  1Y56 A;  1KQ0 A;  4AIJ A;  1TP4 A;  5DM6 F;  2JPC A;  1E2X A;  2DT6 A;  4FE4 A;  3JAM K;  3OIP A;  4RGU A;  4XN0 A;  3CP2 A;  1X1C A;  2KKO A;  1T98 A;  3K4N A;  2WTE A;  5EG0 A;  3K2A A;  4A3L J;  3EET A;  1R71 A;  3W2V A;  3DEW A;  4MTD A;  2O8K A;  3PFY A;  4AIK A;  2A5Y B;  4XOP A;  3GO5 A;  3RPU A;  3HB9 A;  2R7F A;  1NG7 A;  1FY7 A;  2ISY A;  5J47 A;  1Z0X A;  4DBR A;  4KIS A;  3IWZ A;  2XB5 A;  2NOJ B;  2HI3 A;  1WQ2 A;  2CV1 A;  3HC7 A;  4F91 B;  2LH9 A;  5HLI A;  1MJB A;  4XLE A;  3C1D A;  3K4L A;  3OSG A;  2NVQ J;  2KRF A;  2VBZ A;  3LQQ A;  5KAF C;  1XSD A;  1KA8 A;  4GCV A;  4KIG A;  5DV5 A;  1H9G A;  2D1H A;  3K1P A;  4ITV A;  5K7Z A;  3PO3 J;  2P7C B;  3FX3 A;  3E5U A;  2BY1 A;  4U88 A;  1XD7 A;  2VE9 A;  1LKX A;  4FQG A;  3C7J A;  3TW6 A;  3WTZ A;  1U8B A;  2VT2 A;  4ENN A;  3HOW J;  5LRR A;  3LMM A;  5M5W J;  4I0B A;  3CDL A;  3W6V A;  3S1Q J;  3BR2 A;  4NB5 A;  4B1R A;  2RV8 A;  2Q1Z B;  3A4C A;  3FXU A;  3K4C A;  1DUX C;  1A36 A;  2VOO A;  1QZY A;  1XMX A;  3FK6 A;  4FCY A;  3Q0U A;  1P92 A;  5IT9 K;  2Z9O A;  1G6N A;  3I53 A;  2X48 A;  2OCC H;  2TCT A;  2FBK A;  2KL4 A;  3DWL E;  3CZ6 A;  3IC7 A;  2Z99 A;  5DD8 A;  4ZYG A;  3J81 Z;  3SDG A;  2EB7 A;  5H20 A;  2WB1 N;  5GPC A;  2VPL A;  2X1D A;  4KYW A;  2JUG A;  2XKP A;  1TBX A;  4DZJ A;  4A69 C;  3LSM A;  1F5T A;  2RNG A;  4NDL A;  3IRQ A;  3BR5 A;  3HZJ A;  2GM4 A;  1ZR4 A;  4PK4 A;  3M7G A;  2EIM H;  4OMY A;  4FIS A;  2JRM A;  4RAG A;  2EQR A;  1EH8 A;  3VEP A;  2PI0 A;  3C2B A;  3TW7 A;  1VQO I;  3DTE A;  4Y13 A;  1MBH A;  3AG3 H;  3JRF A;  4CDG A;  2VJJ A;  3HRS A;  5F08 A;  4RM2 A;  2A61 A;  1KZH A;  1JXS A;  3HKZ N;  3I0T A;  1WGX A;  4WXD A;  2K02 A;  3LWF A;  4ZTF A;  3F23 A;  2NOG A;  2IW5 A;  3ZQH A;  2ZXW H;  2KPM A;  5M5X J;  4CYC B;  2H8R A;  1I1S A;  4XRM A;  3EUK L;  4RLF A;  5CVR A;  5FLM J;  3O2P E;  4LB6 B;  3Q9V A;  3DPU A;  2LTP A;  1FYK A;  3O3K A;  5L3E A;  1V55 H;  3E6D A;  4G6D A;  2PJR B;  4UVA A;  3CTA A;  4LFU A;  4BXF A;  2MSY A;  4CCO A;  5LGT A;  2Z33 A;  3GW2 A;  3GZ5 A;  2UUZ A;  4I99 C;  3EPZ A;  3K0L A;  2G9W A;  3OSF A;  3ZQ7 A;  2EA2 A;  4M9X A;  3PQK A;  2LY1 A;  3F21 A;  3MZ8 A;  1P4X A;  5K7F A;  2HTJ A;  4OIO F;  1MMS A;  3H9G A;  3MKW B;  2OBP A;  1GLN A;  4D7M A;  4C9Y A;  2VOD A;  3IRR A;  2DA1 A;  1ZAR A;  5M3M J;  1IAW A;  1YI2 I;  1HLV A;  1DP3 A;  1T6S A;  2MC3 A;  4IOC F;  3ISP A;  1RET A;  3RSN A;  2QVO A;  3L00 A;  4CCM A;  3UKG A;  4IHY A;  1CF7 A;  2HQ5 A;  3PFI A;  2CW7 A;  4MIM A;  1TW2 A;  4BY1 J;  1FWZ A;  3FMS A;  3P5J A;  4I2O A;  2XSJ C;  4KNY A;  3FK7 A;  1QRY A;  2QYO A;  4ZH4 F;  3H9J A;  4Y15 A;  1YW7 A;  3ZRG A;  1KQ9 A;  4PFP A;  4WXC A;  2NYX A;  4BS9 A;  5DS9 A;  1IRZ A;  2MGQ A;  3KFW X;  2Y48 A;  4U87 A;  1XDU A;  1R9T J;  1PDN C;  3BC8 A;  2B0L A;  3DBH B;  4C2M J;  2BBY A;  5IP7 J;  2VXD A;  2X4H A;  2X6X A;  3BTJ A;  1Z6R A;  5FFZ A;  5A2Q Z;  5EEA A;  1BC8 C;  1IC8 A;  1V54 H;  4E4H A;  2GOM A;  4E7J A;  1IRF A;  1MNM C;  3HOT A;  2X6Y A;  1MBF A;  2XAQ A;  1GHC A;  2HEO A;  2ZME B;  3JR9 A;  1TNT A;  4CH7 A;  1Z77 A;  4A6E A;  2Q2E A;  4XLH A;  3SHF A;  2B63 J;  2X6W A;  2LBF B;  4UY8 I;  2DK5 A;  3DCF A;  1RR7 A;  1RKT A;  3DXJ F;  1I50 J;  1QHH D;  2CUJ A;  2DOE A;  4E7H A;  3GCM A;  3SZG A;  9ANT A;  1YG2 A;  1ZHF A;  3KP3 A;  5KNL A;  2OZU A;  3K4B A;  1Y8Q B;  2VOP A;  1GV5 A;  1YIJ I;  4J00 A;  2KDZ A;  4HPQ A;  4R8H A;  4YFN F;  1NG6 A;  1W0U A;  1HW1 A;  4BHC A;  4A0Z A;  5D8L B;  2VBX A;  5FRO A;  3ZXS A;  2NVT J;  2M4K A;  1ZEL A;  4A6D A;  2V9V A;  5B3S H;  2V79 A;  2OPT A;  3OYE A;  4WF2 A;  1Y1V J;  4B43 A;  2CWE A;  1SFE A;  3E0J B;  2FML A;  4BJT A;  4HDV A;  3PQJ A;  3NEU A;  1QPI A;  4CCL A;  4OIP F;  2M4G A;  2R7U A;  2DA4 A;  2WV1 A;  2JA6 J;  2DJI A;  4QPO A;  3BJ6 A;  3ZQG A;  1XSV A;  3A0H C;  1UHW A;  4E7L A;  4G7O F;  1O3S A;  2V6E A;  2YU9 J;  1XMA A;  3DKX A;  1LQ1 A;  1XSX A;  4M71 A;  3PIP F;  1SD7 A;  1SVM A;  3M07 A;  1J2X A;  3DBL B;  1PP8 F;  3HRM A;  4O5V A;  4PUS A;  3K1M A;  1FEX A;  1EH6 A;  3BG6 A;  4AD9 A;  2CUZ A;  3BG3 A;  2RVC A;  1TC3 C;  3SZP A;  3KET A;  1BW5 A;  1VQL I;  1OMI A;  1REP C;  4XRS G;  4ZYE A;  2K5C A;  1TQM A;  1IN7 A;  2FXA A;  5ICC A;  1H88 C;  5IYB J;  2E71 A;  1TW3 A;  1B9M A;  2L7Z A;  3DU6 A;  4IX7 A;  4HYE A;  3KP7 A;  2GZW A;  3TL4 X;  3VOD A;  3UNG C;  4DGW B;  3TKY A;  1I27 A;  5JI6 A;  1R1U A;  4OWR B;  1AKH A;  1OYY A;  1W5T A;  2AHQ A;  2LRE A;  4KIB A;  1B6A A;  2R5Z A;  2WB1 A;  1ZLK A;  1W7P B;  6PAX A;  1ZAO A;  1B9N A;  1VND A;  4C2T A;  3T8T A;  4A3C J;  4HV6 A;  5B66 C;  3ZMS A;  5EJC A;  3BDD A;  3MAJ A;  1J0R A;  4UV9 A;  3FMQ A;  4PGG A;  3ZMV A;  4BE1 A;  3CC7 I;  5CVI A;  5J1R A;  2K40 A;  3IUO A;  2FF4 A;  4ZYH A;  2W82 A;  5CVJ A;  2FOK A;  2MH9 A;  1SEU A;  2H8W A;  4F3Q A;  2JK3 A;  3HRT A;  3BLY A;  1FLI A;  3HKZ A;  2CH0 A;  4QWQ A;  3LA7 A;  4AM3 A;  2Y69 H;  3FM3 A;  4KA4 A;  1ZH5 A;  3FXO A;  2CS3 A;  5HLH A;  3F8M A;  1W7P D;  3KP6 A;  3SFZ A;  3PSF A;  2DTZ A;  2Z5U A;  4RB0 A;  2K9N A;  2W1O A;  4G6T B;  3TO7 A;  2FUG 2;  4YEJ A;  3H9Q A;  1Z05 A;  3GWZ A;  2BHZ A;  3IHU A;  5CYV A;  5J40 A;  3BPX A;  2M8G X;  1FOK A;  5L3B A;  1FNN A;  3I4N J;  4M3D A;  4C30 A;  4XQF A;  3RDI A;  2HOA A;  5EEH A;  1EH7 A;  3K70 D;  2R7R A;  2KRH A;  4G7Z F;  2WBM A;  4XLC A;  5CKT A;  1TWC J;  5CLS A;  2RNJ A;  1R5I D;  3SYT A;  2PLY A;  2ZXJ A;  3RTR A;  2E1C A;  2ME6 A;  1GT0 C;  3AKZ A;  1FOY A;  3GTO J;  4XL9 A;  4A12 A;  5DUK A;  1JJ8 C;  1JTY A;  2L0K A;  5DCM A;  1X1B A;  3DEU A;  1FZP B;  3ELK A;  5CPR B;  2D1V A;  5LLQ A;  1BIA A;  1R23 A;  5ED4 A;  3PL8 A;  3E7L A;  2M1B A;  1D0Y A;  4BUP A;  4NQW B;  2RQP A;  1WJB A;  2ICW G;  4M74 A;  1ZRD A;  2ZBK A;  5FRM A;  2M7A A;  3KLN A;  1F43 A;  1A35 A;  2H27 A;  5FO5 A;  4LK0 F;  3OYA A;  4MQV A;  4QPQ A;  5E79 C;  2AXT C;  1R4M B;  2LR8 A;  1N75 A;  3Q0V A;  3P9C A;  4II3 A;  2PMU A;  5C3E J;  2QSG X;  5FKL A;  2H09 A;  1X4O A;  1BIB A;  3GYH X;  4A3G J;  2WAF A;  4E70 A;  2P5K A;  1S9H A;  1VQ9 I;  4HST A;  1U9O A;  1VZ0 A;  4IQ4 A;  4TV7 A;  2QEX I;  3JRA A;  2VXZ A;  2IGK A;  4RDU A;  3TOA A;  5BNG A;  2KMU A;  3DTI A;  2QEN A;  2DQR A;  4IL6 C;  1VQ6 I;  1YHQ I;  1G8X A;  1FOW A;  1XGN A;  2MC4 A;  1RNL A;  3KZZ A;  1RIO H;  1SVO A;  2HDW A;  4G9Y A;  1JKQ C;  1DGR M;  2DOD A;  4RBO A;  3KEQ A;  2IA2 A;  5D6F A;  4IEJ A;  4BY7 J;  2V1U A;  3PM1 A;  2DT5 A;  1MH4 A;  1T2K A;  4YII A;  1WJ5 A;  4EJT A;  3RI4 A;  4OIQ F;  4KJZ A;  4P55 A;  2DQL A;  4RGR A;  3A03 A;  3I54 A;  5KVR A;  2HS5 A;  3A01 A;  2F4M B;  2HYJ A;  3RKW A;  3FXK A;  4N4O B;  2BW3 A;  4L0Z B;  4RB3 C;  1HXD A;  2BHY A;  2F5V A;  3IV5 A;  3BQZ A;  4LG0 B;  1WH7 A;  2DPD A;  3CP8 A;  2K4J A;  5F0F A;  3TGN A;  4F52 A;  4L9V A;  4DBQ A;  2JZY A;  2ISZ A;  5ICF A;  3ZCO A;  3L7W A;  4BDY A;  4XSZ F;  2OJE D;  4M3G A;  3V7S A;  1BI1 A;  1C0W A;  3G1L A;  2H6B A;  5FLX Z;  1E17 A;  3LQR A;  2ADU A;  1IN8 A;  2ZJ2 A;  3MWM A;  3IKT A;  3FWE A;  2QGU A;  4I02 A;  3HGY A;  2O5R A;  4P9F A;  2EIN H;  4EM1 A;  5E18 F;  3GLL A;  1J75 A;  1Z3X A;  3D5R C;  2V9P A;  4RS8 A;  4MNU A;  4UHT A;  3ZOB A;  4U7D A;  4L9N A;  1MH3 A;  3ERM A;  1I6H J;  2M0C A;  3EUH C;  1SMY F;  1OQY A;  4WCG A;  2PMZ N;  4EJV A;  2MW8 A;  4PJJ A;  2IGN A;  1I39 A;  1MMG A;  1WI3 A;  2Y9Z A;  4M6X A;  2HWV A;  1XPX A;  4XKB A;  1JKO C;  2XRN A;  4Z6Y A;  4XRS A;  3BTL A;  1ZG5 A;  4AID A;  3Q9S A;  2EFQ A;  1DPR A;  5L3F A;  1S6L A;  3FXM A;  1TWA J;  4RGX A;  3WE3 A;  1HKS A;  3KX2 A;  2FBI A;  3QOP A;  4HQE A;  1OCC H;  4I76 A;  3JTH A;  1XDS A;  1MKM A;  3S2H J;  3JRI A;  1VQP I;  3QOE A;  4I0A A;  4BQA A;  3CES A;  3O8G A;  1UHM A;  5L3C A;  1JT0 A;  1CQT A;  4IXA A;  2QCO A;  4H0E A;  3OS1 A;  1IG7 A;  4BKX A;  2XAJ A;  4M6Y A;  1W4M A;  5IY5 H;  4AVP A;  2CU7 A;  2KLO A;  3QPS A;  4ZJZ A;  2DK8 A;  3MMY B;  1F9N A;  1RI7 A;  1J5Y A;  2DAO A;  3ROU A;  4HOB A;  4CCK A;  3SFI A;  4LB5 A;  2FA5 A;  1XTA A;  4B4C A;  2MAB A;  2CJJ A;  3E5Q A;  2UZK A;  4ZDP A;  2DOA A;  3SZT A;  3L1P A;  2IT0 A;  5FFX A;  2EZK A;  3L09 A;  3OIO A;  4MEY F;  3KPH A;  2CQK A;  1E3H A;  2FJ1 A;  4M3E A;  3GFM A;  2D45 A;  1KU2 A;  2P6S A;  3JRB A;  1I6X A;  5BMZ A;  2HOT A;  1X58 A;  3W2W A;  2DFE A;  3D5S C;  5GAH J;  5GPA A;  1TQP A;  3BT9 A;  2P7V B;  4MQ9 F;  1LNW A;  5TJJ A;  3LSG A;  1FBU A;  1HKQ A;  4A0X A;  1R6R A;  3V7C A;  3U21 A;  2K9S A;  4J19 A;  3OY9 A;  3VYT B;  5EGO B;  4ZYD A;  2L9R A;  3OS2 A;  1IDZ A;  3CUQ B;  4YRV A;  2JT1 A;  4P9U A;  1E0E A;  3SJM A;  2VJI A;  2WAQ N;  5EDN A;  3GX4 X;  3BPV A;  3S15 J;  1P4W A;  2IBD A;  1MNE A;  3LL7 A;  1MBJ A;  4NNJ A;  1IW7 F;  2ACJ A;  1B72 B;  1BM9 A;  5EZG A;  1S7E A;  1X2N A;  4KMU X;  1WPK A;  2BEO A;  2UV1 A;  2CQ7 A;  3VOE A;  1WCM J;  3K6G A;  2W00 A;  3G71 I;  1ON1 A;  3PUB A;  2PN6 A;  4MFE A;  2XAH A;  4D7N A;  3RZD J;  1UMQ A;  2EIK H;  3G6E I;  3I55 I;  2BGC A;  5D4S A;  5C4X J;  1W5S A;  2ZFW A;  4JX5 A;  3JSP A;  2VJ4 A;  3S8P A;  4EQQ A;  5J6X A;  2DPU A;  2XRL A;  5FJ8 J;  2R92 J;  3M1C A;  4JX4 A;  1KU9 A;  1ZGW A;  1OKR A;  3EYI A;  3KEY A;  4GYI A;  3P7N A;  2XHK A;  1EV7 A;  2VBW A;  2R5Y B;  1FJL A;  2CW0 F;  4KIT B;  2LC2 A;  2UXX A;  4B44 A;  1Y8R B;  1JKP C;  1WWX A;  3TP3 A;  4UV8 A;  2IPQ X;  4HX8 A;  2BVL A;  2F2E A;  4UUS B;  3ZMD A;  2R7S A;  4KT5 C;  1BOB A;  2LY9 A;  3I9V 2;  2VIX A;  3IH3 A;  4Q48 A;  3R4K A;  2XVC A;  3L2R A;  3TO6 A;  4U0W A;  2QZ8 A;  2Z3Y A;  2IA0 A;  3U2R A;  3LSK A;  4ZYA A;  1X19 A;  1Y6I A;  1LE8 A;  3DF8 A;  4AYB N;  2OC6 A;  4G8X A;  3CCY A;  4BXU A;  1A6I A;  1HF0 A;  1K83 J;  2QBY B;  3G3Z A;  3LOC A;  1ZGJ A;  2XF6 A;  1ZQ3 P;  3TBI A;  4XRF A;  3IP4 B;  4PCQ A;  5HNH A;  2L7K A;  4NHJ A;  4KDP A;  2CUF A;  2HPM A;  4MTE A;  2ZJR F;  5J1Y A;  3BCA A;  4JQF A;  4IVN A;  1M1E B;  2XPW A;  3J7Y J;  2VB6 A;  4BE0 A;  4XON A;  3GFI A;  1BA5 A;  4RAF A;  1UG2 A;  2VE8 A;  2Y9Y A;  3HSR A;  3TDU C;  3LA2 A;  5IYD J;  3OYN A;  1VI0 A;  1SMT A;  2O8X A;  3ZQQ A;  2HZD A;  4D5C A;  1T56 A;  5GAD J;  2PMZ A;  1Y39 A;  2B9S A;  3HXL A;  2V6C A;  1YJ9 I;  2KQR A;  2ZME C;  2ESH A;  3TQN A;  2O9L A;  3L2U A;  4QSH A;  4FET A;  1G3W A;  1BOA A;  2VQL A;  2V1N A;  1N25 A;  2ZJQ F;  3B02 A;  5KAI C;  3GZ6 A;  2ZCW A;  2QQA A;  1VTN C;  4IZZ A;  3BCB A;  4ENK A;  4B47 A;  2L9V A;  1FMW A;  1OCP A;  4OIR F;  2KIU A;  1ORK A;  5JVG F;  2R93 J;  2L01 A;  1SAN A;  4UXN A;  1YRN A;  3ZQI A;  2EZI A;  2G0E A;  3OS0 A;  3K4K A;  5LRS A;  2AO9 A;  4BE2 A;  3AL0 B;  2FEZ A;  2BZT A;  2V9K A;  3IKV A;  2XPV A;  3HUG B;  4EMS A;  5FLV A;  2VON A;  1W5C C;  1YIT I;  2DMQ A;  1HSJ A;  3OR2 C;  4S0H B;  5KHD A;  1ULY A;  4LJZ F;  2BY2 A;  5DEQ A;  2JA2 A;  1Y0U A;  4OU0 A;  3HHG A;  1L3L A;  3S1M J;  2LMD A;  3OYB A;  3FXL A;  1APL C;  1LDD A;  2K7L A;  4XLN F;  1B59 A;  3VDX A;  1ZTR A;  3M8J A;  1ZRE A;  1G2H A;  5AIP A;  2EPF A;  2ESN A;  2KIF A;  2W48 A;  3PSI A;  4AC0 A;  2DMU A;  4CUG A;  3ML6 A;  3DQV C;  1U5T B;  1F1Z A;  1QPM A;  4KIC A;  1D1B A;  1YJN I;  1GXP A;  1AOY A;  2RKH A;  2IGM A;  3HBL A;  4GRI A;  3T5X A;  1FT9 A;  2E60 A;  3S1R J;  1TNS A;  2GXG A;  3B73 A;  4KN7 X;  1Y1W J;  1YW9 A;  1W1W E;  3CME I;  3GTQ J;  1EF4 A;  2DFI A;  4YIF A;  1PUE E;  1EA3 A;  1OFC X;  2VN2 A;  1MDM B;  5KK1 A;  4Z2Y A;  3BTC A;  1UHS A;  4EGZ A;  3F6V A;  4HSR A;  3ZR8 X;  4HNU A;  1DP7 P;  1EKE A;  4PFO A;  5ERI A;  3CCL I;  2WAQ A;  4L5I A;  1K6Y A;  1LFU P;  3DV8 A;  3OYD A;  4HRI A;  1ZYR F;  1S7O A;  4KMF A;  2ZSH B;  5J1U A;  1SFO J;  3ZQF A;  1QO0 D;  3MZY A;  3OYL A;  1JGS A;  5D5U B;  3R6S A;  3HPG A;  4MGR A;  2UWM A;  2JVG A;  5M3F J;  5IP9 J;  1WSU A;  2DI3 A;  4OMZ A;  2W57 A;  5BQT A;  3B6A A;  3HL2 A;  2DW4 A;  3SDB A;  3TO9 A;  1B8I B;  1XGS A;  2M30 A;  3U9G A;  3JRD A;  1FYM A;  1MJ9 A;  2DA2 A;  4PSW A;  2W7N A;  4ZC3 A;  2X1C A;  4LOC A;  4Y4R A;  5D5W B;  5IP6 A;  5HDG A;  3K70 C;  2QWW A;  5DCF A;  3QWL A;  4WXH A;  1WJA A;  5GAG J;  2HPI A;  1K78 B;  1VQK I;  4NQW A;  4XK4 A;  2E2I J;  1KGS A;  4EM2 A;  2W25 A;  2QA4 I;  3WTU C;  1NH3 A;  1ERD A;  2VKE A;  4PJL A;  3N4M A;  2HGC A;  3WTV C;  3CMM A;  4Y33 A;  1G3T A;  2R7Q A;  2WAE A;  3K1N A;  2R7X A;  5BPD A;  2CQN A;  1U3E M;  2KP6 A;  3WTT C;  4FT8 A;  1XGM A;  3E6B A;  3D1N I;  3LFK A;  2CFO A;  1IN5 A;  4ZZD A;  1PUF B;  1BW6 A;  2JMW A;  4BEH B;  2XGX A;  5FKM A;  1ZG3 A;  2TRT A;  4K2E A;  4BBS J;  4D0P A;  3HYI A;  1IUY A;  4FX0 A;  3E6C C;  2F5D A;  2R7O A;  4HW0 A;  3CDI A;  2QUF A;  2X9D A;  2M9H A;  4AYB A;  4JBA A;  3W6J B;  3R61 A;  3REO A;  3HOZ J;  3ABU A;  2F5E A;  2XV4 S;  4DZP A;  1ZR2 A;  4Q47 A;  3RKY A;  1MD0 A;  4KN4 X;  3FIW A;  1NK2 P;  3FBN B;  5EG0 B;  5DDG A;  3VPR A;  1X1P A;  2LNB A;  3V7R A;  1UAA A;  3GVA A;  1QGP A;  5F64 A;  5F1J A;  4QIW N;  3CDH A;  3DBR B;  2LF7 A;  1CGP A;  3HM5 A;  1UST A;  5ICG A;  2COM A;  3KP2 A;  2YU3 A;  3IAM 2;  2L2O A;  3I56 I;  1Z91 A;  3BOQ A;  1LEA A;  2ZO4 A;  1XN7 A;  5JLW A;  2GQQ A;  4BU2 A;  4HA8 A;  4ESJ A;  3WHB A;  2P0W A;  1R4N B;  2M3A A;  3J7Z I;  3JRG A;  4X6A J;  2NS8 A;  4XNF A;  3OYJ A;  4FX4 A;  1XB4 A;  3COA C;  2VT3 A;  5E8G A;  4A0Y A;  4S04 A;  4D1Q A;  4CSW A;  4DOZ A;  1Q1V A;  2M5W A;  1LVA A;  4HAM A;  2DBB A;  3DPL C;  3OIQ A;  1J09 A;  4UUT A;  2QSH X;  3RPU D;  2CQX A;  3ZMT A;  1ENH A;  1RKW A;  3HOX J;  2HDC A;  1RR8 C;  4GFB A;  3JTG A;  3S3O A;  5E17 F;  4F92 B;  3JSO A;  1MJA A;  4YFX F;  4CA0 A;  3HSF A;  5FGM A;  2NVU B;  3AFH A;  1GVJ A;  1MMN A;  3QYE A;  3V4G A;  1H0M A;  3GTG J;  1ETK A;  5H6Q A;  2JPB A;  1J9I A;  4I01 A;  2I5U A;  1IXC A;  2L02 A;  3I59 A;  3MQ0 A;  1T8I A;  3E1S A;  5K7H A;  5BOX A;  1MSF C;  2R4G A;  5IT3 A;  2AXL A;  4BNC A;  3M3Y J;  2DA7 A;  1H8A C;  3K9T A;  1JUM A;  3O6B B;  1LDK B;  3JRC A;  1MGT A;  1OLT A;  1BBY A;  5FD6 A;  1I5Z A;  1FIP A;  2JSP A;  1L0O C;  2V26 A;  3QPH A;  1NK3 P;  2LKX A;  2HYG D;  5FB2 A;  4UUV A;  2HOE A;  1P6R A;  3VSK A;  1Z1D A;  2E1N A;  4BXX J;  3ZN1 A;  1SFU A;  3DEE A;  1FX7 A;  3TP0 A;  3H35 A;  1XCB A;  4S05 A;  1PYV A;  3H3Z A;  2XC7 A;  5DTD A;  5IPA A;  3HTU A;  2EIJ H;  3M1E A;  1KU7 A;  2KT0 A;  2HVR A;  2FBH A;  3F3X A;  1LUJ B;  2E36 A;  4R1H A;  1BJA A;  5LEK A;  5D4R A;  5FKK A;  5JVT A;  2EZL A;  3C18 A;  4CXF A;  2ZXI A;  2L7M P;  3CLO A;  4HF1 A;  2YX4 A;  3G2B A;  3IH2 A;  2WV0 A;  2JA5 J;  2QQB A;  2M34 A;  1LFB A;  4MHG A;  2HVQ A;  2R0Q C;  3E3V A;  1FSE A;  4XMY A;  2HDD A;  1R22 A;  3RCO A;  5AIQ A;  1P7I A;  3DTK A;  3CJN A;  3A1Y A;  1X3U A;  1XGO A;  4M9Z A;  4YG2 F;  1W36 D;  4IKF A;  4M6V A;  3KLO A;  4L9J A;  3KZY A;  4B48 A;  4LLL A;  4ESB A;  4XR6 A;  2WC2 A;  2LF8 A;  3GZN B;  2AQE A;  1CF7 B;  2Y0S N;  1R1T A;  2YS9 A;  5LEJ A;  2E5Z A;  3BTI A;  2W4S A;  4DIQ A;  2A6E F;  2EBI A;  2CV0 A;  1JT6 A;  4NUB A;  1X1A A;  2K85 A;  5JLX A;  3E5X A;  2VUM J;  5HLT A;  3BR0 A;  5E3N A;  2VQC A;  1HST A;  5HNF A;  2J5P A;  3HGG A;  5E1W A;  3JW4 A;  1T39 A;  1FTT A;  5EYR A;  2O61 A;  4XOR A;  3FHZ A;  4KT6 A;  3Q3S A;  3ZQC A;  3EQL F;  2JQ7 A;  3F8F A;  1VFC A;  5IOY A;  2HVS A;  1BI2 A;  2HKX A;  1KON A;  2OQG A;  2E34 A;  1P4A A;  3QP5 A;  2CQQ A;  4DYQ A;  2CFX A;  4XKV A;  2Q2E B;  4AWX B;  4E7K A;  2OU2 A;  1WJD A;  1QU3 A;  2UXN A;  4X0G A;  2LVS A;  1NHA A;  4HLY A;  3EUH A;  4B09 A;  1MBG A;  2F5C A;  3BWG A;  2J5O A;  2LK2 A;  4C3H J;  4AU7 A;  4IHX A;  3ABK H;  3N97 A;  2BY0 A;  3LSI A;  1JJ6 C;  1J7K A;  3CQZ J;  4QLC U;  3F0C A;  4XOT A;  2CW8 A;  3CUQ C;  3LFU A;  3IL2 A;  1I3A A;  4OAZ A;  4XN3 A;  1MBE A;  2DA3 A;  1O57 A;  1B1B A;  1HKT A;  4NC7 A;  1G3Y A;  2PG4 A;  2RAE A;  4DW6 A;  4EJW A;  5J4V A;  2IS2 A;  3ZMU A;  2XGD A;  4I7H A;  4LLN A;  2IS4 A;  5D6E A;  1BJZ A;  2A3S A;  3QPL A;  2JSC A;  3K7A J;  1HBX G;  1R5G A;  3NQO A;  2IGO A;  4WK8 F;  3BZ6 A;  5K5O A;  3S32 A;  4ZDL A;  3FIS A;  3J81 K;  2YR2 A;  2L4M A;  2RRE A;  5E1X A;  4PGH A;  2X85 A;  3GEZ A;  4DNC A;  3LAJ A;  2A68 F;  5EF6 A;  3D5L A;  3GF2 A;  3BJA A;  1OR7 C;  2OA4 A;  2FQ4 A;  2ZFU A;  3ZGK A;  4IHS A;  3KIO A;  2HNH A;  2O6G E;  2K4B A;  3WGI A;  4A5N A;  1YOV B;  4XID A;  4N9H A;  3BJO A;  3LNQ A;  4DYC A;  1X4P A;  2HXI A;  3WG7 H;  2WY7 Q;  3GTK J;  1P2F A;  1FBQ A;  4P1W A;  3RYR A;  1ZKG A;  2RC4 A;  3VFZ A;  4WWC A;  5DUI A;  3CF5 F;  4HZF A;  2XKO A;  2DDA A;  3PUF A;  5LHH A;  2NNY A;  1AKH B;  3VYR B;  3GFL A;  2R5Z B;  2E2J J;  1Z9C A;  5JHF A;  3WOD F;  2FU4 A;  2NNN A;  1WH5 A;  2DMT A;  2QKM B;  4IRI A;  1D8K A;  2JVH A;  3I5U A;  2W85 A;  3DU5 A;  5E20 A;  1XCV A;  4RLQ A;  1Z67 A;  3TDZ C;  4HX4 A;  4A3F J;  2IVM A;  2R7D A;  2L54 A;  3F8C A;  5L3G A;  2NRA C;  3H5N A;  4L5E A;  1ETY A;  2X0L A;  2GBY A;  3JRH A;  2P5L C;  5B5E C;  1T95 A;  3T0Y A;  1FC3 A;  1OCR H;  2XSD C;  5JR3 A;  1H9T A;  1YS6 A;  4MLO A;  4Y7N J;  2Y30 A;  1TT0 A;  2VBY A;  1WI9 A;  4EM0 B;  4LK1 F;  3F6O A;  2VJ5 A;  1TT5 B;  3S2W A;  2ZNZ A;  1BR4 A;  2G7H A;  2LD5 A;  2PBI A;  1RZ4 A;  5TGT A;  1U5T A;  2E35 A;  1UFM A;  2WA0 A;  1V5F A;  4BQQ A;  4HG2 A;  3CD6 I;  2DO7 A;  1GXQ A;  3MEX A;  3JCU C;  4M9S A;  2HTS A;  4CYC A;  3T1B A;  5F0C A;  3KEO A;  3RIR A;  3RQI A;  1BL0 A;  1QVU A;  4BBR J;  1ETX A;  1OPC A;  4HNV A;  5A2Q K;  3IWF A;  2DTR A;  3ZN0 A;  2QSF X;  2F4I A;  2GAU A;  2PJR A;  3V8J A;  3ASN H;  1Q1H A;  5JHU A;  1RRJ A;  4U0Y A;  1IN6 A;  1IF1 A;  2A6H F;  4BAC A;  1WJE A;  2R7W A;  2Y0M A;  2Y0S A;  2CV2 A;  3WG9 A;  3AL0 C;  3R0J A;  2CMP A;  4GO1 A;  1K4T A;  2EJR A;  4EJO A;  4KUM A;  3CJT B;  5CVU A;  3A0B C;  5FKO A;  2VI6 A;  3ABT A;  3SEZ A;  4P5O A;  5HS8 A;  2YUS A;  1JE8 A;  3D0S A;  1PP7 U;  4CO8 A;  2DCE A;  3E6M A;  1SFK A;  3PJR A;  1LVK A;  3QAH A;  5DYM A;  1U5T C;  4Y17 A;  3H92 A;  3H5R A;  4XM3 A;  2CUE A;  2TDX A;  1J59 A;  2LSO A;  3LAP A;  1MND A;  1TZL A;  4G94 A;  2CRG A;  5F0H A;  2XGC A;  1RUO A;  5TRD A;  3OL3 A;  1K78 A;  3MCZ A;  3MKY B;  1H89 C;  2A69 F;  3S2D J;  4JP0 A;  1MMA A;  4CZZ A;  3ABL H;  4FTH A;  1FBS A;  1WVR A;  2FOW A;  5HLG A;  4IF4 A;  4DYR A;  1PJR A;  1SAU A;  2IA1 A;  2L4A A;  3EDP A;  3K69 A;  2ZME A;  3B6C A;  2Y2Z A;  4UB6 C;  3QYF A;  1D0Z A;  2FD5 A;  5L3D A;  5ILU A;  3AAF A;  1BN5 A;  2N8G A;  1DQU A;  1T38 A;  1FOX A;  1ON2 A;  2LBF A;  3IH4 A;  2C6Y A;  5BPI A;  1FP2 A;  5GTI C;  3L2C A;  1VQ8 I;  3FM5 A;  4BEH A;  1JUP A;  2E1M B;  2VC1 A;  1Y0N A;  2DA6 A;  2LP0 A;  3N05 A;  3WGG A;  4LG3 A;  4FHT A;  2KJC A;  3A01 B;  1YLF A;  3ESW B;  1GDT A;  2BW3 B;  1IRG A;  2PX9 A;  1ETQ A;  4LGW A;  2ECC A;  4L9T A;  2XIG A;  5AON A;  2F48 A;  4M3B A;  4AIH A;  4D5F A;  1ETO A;  3SQN A;  3V8L A;  2F4O B;  2GWR A;  4KFC A;  2RDP A;  1ZN2 A;  5HOO A;  3FKI J;  3NAU A;  4LIV A;  3C2G A;  1A6Q A;  3QYB A;  4HNT A;  3WTX C;  3BP8 A;  2DXI A;  3W6K B;  1DPU A;  1BI3 A;  1ETW A;  5KCM A;  2XDV A;  1JGG A;  4CGZ A;  2H94 A;  1EJ9 A;  1A5J A;  2OF7 A;  1QZZ A;  2W84 A;  3GBG A;  3J7A Y;  2EH3 A;  2FMY A;  3K4J A;  3M8E A;  4G7H F;  1PVE A;  1LEB A;  4P96 A;  5E3O A;  1X2M A;  2PEX A;  3H36 A;  3LSJ A;  5EZH A;  2XB0 X;  3CC4 I;  4B3A A;  2NAZ A;  3T8R A;  2GA2 A;  3HDD A;  1GVD A;  1V5G A;  5K1Y A;  5LGU A;  5HS7 A;  4GXO A;  1E3P A;  2ME0 A;  4AVZ A;  2KIQ A;  2DLL A;  3DLL F;  1BC7 C;  2OQR A;  4ANJ A;  3PO2 J;  2LDU A;  4W97 A;  1JKR C;  3OYG A;  3C2H A;  3LSP A;  1ZG1 A;  3DPT A;  1LDJ A;  2K9L A;  2OD5 A;  2PQ8 A;  1FP1 D;  4L5J A;  1USS A;  4W1U A;  2BY3 A;  2EZH A;  1WRJ A;  2L5Q A;  2DMN A;  1YX3 A;  3HOY J;  1X1D A;  3OOP A;  3WTY C;  2KJB A;  5DM7 F;  3HG9 A;  5E8I A;  2KIM A;  2A5W A;  4D9J A;  2CSO A;  4HBL A;  1KYZ A;  1ZLJ A;  2XGE A;  4E7I A;  1W7P A;  4ETS A;  3J80 Z;  4HQM A;  1ACI A;  2EV0 A;  1YS7 A;  3H0D A;  4RB1 A;  4MEX F;  2XUB A;  1DU6 A;  4A93 J;  1LPQ A;  2OCE A;  2VKD A;  2R7T A;  1O3R A;  2P5V A;  1BR1 A;  1UEL B;  1IRX A;  2ELJ A;  3L2V A;  4U0V A;  3J7A O;  4A3J J;  4UVC A;  3S17 J;  3VB2 A;  2NXN B;  4MFD A;  1E3O C;  1KQ8 A;  3ECH A;  1IO2 A;  4FAS D;  2OAZ A;  3NWS A;  3W3C A;  5ILV A;  1YX5 A;  3GUD A;  2P8T A;  3OR1 C;  2XPU A;  1R58 A;  5JFR A;  3F9K A;  1HOM A;  4H4K C;  2ZNY A;  3OOU A;  5CQE A;  3R60 A;  3RKX A;  1WJC A;  4X1E A;  5C44 J;  1IXS B;  3KP5 A;  1U9N A;  4BQO A;  1FPQ A;  1AHD P;  2BVM A;  2VPR A;  2IXS A;  2RQQ A;  3IAS 2;  4Q5S F;  2EFP A;  1POG A;  1P7J A;  4UVB A;  1K6O A;  3RQ4 A;  3CJQ B;  1IZ1 A;  1D1A A;  2DA5 A;  2X51 A;  4NBQ A;  1AU7 A;  3OL4 A;  3ZP5 A;  1HDP A;  3SXY A;  2LKS A;  1D5Y A;  3HTS B;  4YIR X;  2A6T A;  3I58 A;  2NS0 A;  5IOZ A;  3F22 A;  3S3N A;  1U0J A;  1F36 A;  4DJA A;  1D3Y A;  1W0T A;  1IGN A;  3BR3 A;  2KFD A;  4M3F A;  4V2G A;  5FRN A;  4IHT A;  3F8B A;  3OYC A;  2HZT A;  1D0X A;  2VKH A;  4XKW A;  3VYU B;  5HDK A;  1FIA A;  3FHN A;  4GYG A;  3S3M A;  2HOS A;  2O7O A;  4N9I A;  3ABM H;  5GAE J;  1R36 A;  3CCE I;  1SD5 A;  3L2Q A;  3FZV A;  4BHP A;  4A3E J;  3MKZ A;  4BH9 A;  4EJU A;  1HCR A;  3OYM A;  1WZ2 A;  3Q5F A;  1W36 C;  3WGH A;  2EFO A;  1T0F A;  3BG5 A;  2E1O A;  2ECB A;  3BQY A;  4LIU A;  5CJ9 A;  3CO6 C;  3KP4 A;  4F7Z A;  1YE9 A;  2FNP A;  4PJM A;  4BQN A;  2BYV E;  2BE5 F;  3M8F A;  4IPA A;  1ONV A;  1GUU A;  4A3K J;  2GOX B;  3KYL A;  4C2U A;  2MD5 A;  1O3T A;  5J8F A;  4NC8 A; 
#chains in the Genus database with same CATH homology
 1OYW A;  2K86 A;  2LKP A;  5FLX K;  1ZGA A;  5EEG A;  2M87 A;  2CG4 A;  2H6C A;  4A5M A;  4XLP F;  1R7J A;  2E7X A;  4YFK F;  4DQ2 A;  5K5R A;  1ZRF A;  3GLX A;  2JTV A;  5D8K B;  3WU0 A;  2CGP A;  2PJP A;  3RYP A;  2EFN A;  4KIF A;  2QM3 A;  4ENM A;  1G4D A;  3M9A A;  4HX7 A;  4BYY A;  5LHI A;  3R0A A;  3LST A;  1F4K A;  2YSR A;  4EVI A;  4LG0 A;  4L0Y B;  4M72 A;  4IRG A;  1U78 A;  4I98 B;  1UB9 A;  2Q8K A;  3HRU A;  1O7F A;  4IJA A;  1SD6 A;  5J8C A;  1TQI A;  5ICE A;  2GIV A;  1ODD A;  3JAM Z;  2A07 F;  1KU3 A;  4U7B A;  3MZH A;  2F5F A;  1WKM A;  3HHH A;  1YIO A;  2D2W A;  1O3Q A;  1QNT A;  2P4W A;  4G6Q A;  5HVQ C;  4LD5 A;  2XAF A;  5K5Q A;  3ECO A;  3HIF A;  1A04 A;  2G7U A;  5ILS A;  2O0Y A;  1BI0 A;  1HQC A;  2CO5 A;  2ELH A;  4A2U A;  4OOI A;  1SD4 A;  1Z7U A;  4ESF A;  3TOB A;  2XRO A;  1XMK A;  1S7A A;  4L18 B;  2FQ3 A;  3DFG A;  1OYI A;  5HDN A;  4OIN F;  3RPQ A;  2JRT A;  2GXB A;  3ZPL A;  1DDN A;  2EFW A;  5IT9 Z;  2EV5 A;  1R5H A;  3QPT A;  1HW5 A;  5HS9 A;  1JHF A;  5FD5 A;  2M8E A;  3E97 A;  1V3F A;  3FXQ A;  1YO5 C;  4RAZ A;  2EWN A;  2FSW A;  4XBF A;  1ZRC A;  5DD4 A;  1S29 A;  1V4R A;  3QRF F;  4GGG A;  3CUQ A;  3QU6 A;  2W24 A;  3BRO A;  4ASN A;  3QP6 A;  3QU3 A;  3FXR A;  4R79 A;  3F72 A;  5CVV A;  1YYV A;  4CYD A;  4JK1 X;  1R1V A;  4B8X A;  2HFH A;  5BS6 A;  1IXR C;  5H6R A;  1KYW A;  1YQA A;  4RAY A;  3OV8 A;  4ZZL A;  2HR3 A;  1STZ A;  1R00 A;  1YTY A;  3V8K A;  4ENJ A;  3CO7 C;  2YX7 A;  3I4P A;  2OZ6 A;  1OR7 A;  4O3M A;  3DP7 A;  2EK5 A;  3ERE D;  4WX9 A;  2ETH A;  1MZB A;  2RN7 A;  1TTY A;  2O3F A;  3HSE A;  2P6T A;  4HLX A;  3HOS A;  2EV6 A;  4UNO A;  2V1X A;  4O6J A;  5LHG A;  2QBY A;  3P9K A;  1B4A A;  2PMH A;  1O7L A;  1G3S A;  1AWC A;  2RGV A;  2VC0 A;  1U2W A;  2EA4 A;  3CUO A;  2IP2 A;  4Q4Z F;  1UCR A;  2Q0O A;  1QQI A;  2HQR A;  3J80 K;  2FNA A;  4PZJ A;  2HYF A;  2STW A;  3C3W A;  5D5V B;  1K7A A;  3WU1 B;  3WTW C;  3H3U A;  4LLG F;  4RB2 C;  2HKO A;  1D5V A;  3GXO A;  5LGN A;  2BV6 A;  2PFB A;  2R3S A;  4IRH A;  5D5X B;  2XAG A;  1U6G A;  4XSX F;  3I59 B;  4I09 A;  3BY6 A;  2IRF G;  2MH2 A;  3WTS C;  1FSH A;  2AS5 F;  2O03 A;  2STT A;  4PDK A;  1JHH A;  3HUG A;  1RUN A;  1SFX A;  2XAS A;  4HF2 A;  5E1Z B;  4CIC A;  1LJ9 A;  2Y75 A;  2FE3 A;  2V1D A;  2HQN A;  3LA3 A;  4N0B A;  3I71 A;  5F6F A;  3ULQ B;  3RJP A;  1Z6T A;  2FRH A;  1D8J A;  2WWY A;  2CYY A;  5LBQ A;  4EGY A;  2QQ9 A;  2GA1 A;  1S8N A;  3P9I A;  3F8N A;  1MDM A;  2L3D A;  4CHU A;  3KCC A;  5DCM B;  3NRV A;  3I64 A;  2MLK A;  4RGS A;  1YW8 A;  2YPR A;  1SAX A;  3FMR A;  2IJL A;  1U8R A;  2MLG A;  2E7W A;  1TLH B;  4BHB A;  3WE2 A;  1QBJ A;  4ON0 A;  4HV5 A;  3GFJ A;  4HF0 A;  4HDU A;  1K79 A;  3U1D A;  3KE2 A;  4BAY A;  4EV0 A;  2K27 A;  4LMY A;  2M45 A;  2MBF A;  4M73 A;  2MA3 A;  3FF5 A;  1HW2 A;  1FYL A;  3L9F A;  1YFH A;  5F1R A;  2ZKZ A;  3MFK A;  3G73 A;  3K2Z A;  1S3J A;  2DU9 A;  1IN4 A;  1LB2 A;  3DKW A;  1I1G A;  2QLZ A;  3ZMZ A;  3EYY A;  1KQ0 A;  4AIJ A;  2JPC A;  1E2X A;  3JAM K;  4RGU A;  2KKO A;  1T98 A;  2WTE A;  3EET A;  4MTD A;  4AIK A;  2A5Y B;  3GO5 A;  3RPU A;  2R7F A;  1FY7 A;  2ISY A;  3IWZ A;  1WQ2 A;  5HLI A;  1MJB A;  3C1D A;  2KRF A;  2VBZ A;  3LQQ A;  1XSD A;  1KA8 A;  4GCV A;  4KIG A;  5DV5 A;  1H9G A;  2D1H A;  3K1P A;  2P7C B;  3FX3 A;  3E5U A;  4U88 A;  1XD7 A;  2VE9 A;  3C7J A;  3WTZ A;  2VT2 A;  4ENN A;  5LRR A;  4I0B A;  4NB5 A;  2RV8 A;  3FXU A;  1DUX C;  2VOO A;  1QZY A;  1P92 A;  5IT9 K;  2Z9O A;  1G6N A;  3I53 A;  2FBK A;  3IC7 A;  2Z99 A;  5DD8 A;  4ZYG A;  3J81 Z;  2EB7 A;  5H20 A;  4KYW A;  2XKP A;  1TBX A;  1F5T A;  3IRQ A;  3M7G A;  4OMY A;  1EH8 A;  3VEP A;  2PI0 A;  4Y13 A;  4CDG A;  3HRS A;  2A61 A;  1JXS A;  3I0T A;  4WXD A;  2K02 A;  3LWF A;  3F23 A;  2IW5 A;  1I1S A;  5CVR A;  3O2P E;  4LB6 B;  3Q9V A;  1FYK A;  3O3K A;  5L3E A;  3E6D A;  4G6D A;  4UVA A;  3CTA A;  4LFU A;  5LGT A;  2Z33 A;  3GW2 A;  3GZ5 A;  3K0L A;  2G9W A;  3ZQ7 A;  2EA2 A;  4M9X A;  3PQK A;  3F21 A;  1P4X A;  4OIO F;  2HTJ A;  2OBP A;  2VOD A;  3IRR A;  1ZAR A;  1IAW A;  1T6S A;  2MC3 A;  3ISP A;  2QVO A;  3L00 A;  1CF7 A;  3PFI A;  1TW2 A;  1FWZ A;  3FMS A;  4I2O A;  4KNY A;  2QYO A;  4ZH4 F;  4Y15 A;  1YW7 A;  1KQ9 A;  4WXC A;  2NYX A;  3KFW X;  2Y48 A;  1XDU A;  1PDN C;  2B0L A;  2BBY A;  2X4H A;  1Z6R A;  5FFZ A;  5A2Q Z;  1BC8 C;  1IRF A;  3HOT A;  2XAQ A;  1GHC A;  2HEO A;  2ZME B;  1TNT A;  4A6E A;  2Q2E A;  3SHF A;  2DK5 A;  3DXJ F;  1YG2 A;  1ZHF A;  3KP3 A;  2OZU A;  2VOP A;  4YFN F;  4R8H A;  1HW1 A;  4BHC A;  4A0Z A;  5D8L B;  2VBX A;  4A6D A;  2V9V A;  2V79 A;  4WF2 A;  2CWE A;  1SFE A;  2FML A;  4HDV A;  3PQJ A;  3NEU A;  4OIP F;  3BJ6 A;  1XSV A;  1UHW A;  4G7O F;  1O3S A;  1XMA A;  1LQ1 A;  1XSX A;  4M71 A;  1SD7 A;  1J2X A;  1PP8 F;  3HRM A;  4O5V A;  3K1M A;  1EH6 A;  4AD9 A;  2RVC A;  3SZP A;  3KET A;  1OMI A;  1REP C;  4ZYE A;  1TQM A;  1IN7 A;  2FXA A;  5ICC A;  1TW3 A;  1B9M A;  4HYE A;  3KP7 A;  2GZW A;  3VOD A;  3TKY A;  1I27 A;  5JI6 A;  1R1U A;  1OYY A;  1W5T A;  4KIB A;  1B6A A;  1ZLK A;  1W7P B;  6PAX A;  1ZAO A;  1B9N A;  3T8T A;  4HV6 A;  3ZMS A;  3BDD A;  3MAJ A;  1J0R A;  4UV9 A;  3FMQ A;  4PGG A;  3ZMV A;  5CVI A;  2FF4 A;  4ZYH A;  5CVJ A;  2FOK A;  2MH9 A;  3HRT A;  1FLI A;  4QWQ A;  3LA7 A;  3FM3 A;  4KA4 A;  1ZH5 A;  5HLH A;  3F8M A;  1W7P D;  3KP6 A;  3SFZ A;  2Z5U A;  4RB0 A;  3TO7 A;  1Z05 A;  3GWZ A;  3IHU A;  5CYV A;  3BPX A;  1FOK A;  5L3B A;  1FNN A;  3RDI A;  5EEH A;  1EH7 A;  4G7Z F;  5CLS A;  2RNJ A;  2PLY A;  2ZXJ A;  3RTR A;  2E1C A;  4A12 A;  5DUK A;  5DCM A;  3DEU A;  1FZP B;  3ELK A;  2D1V A;  5LLQ A;  1BIA A;  1R23 A;  5ED4 A;  2M1B A;  2RQP A;  4M74 A;  1ZRD A;  2ZBK A;  3KLN A;  2H27 A;  5FO5 A;  4LK0 F;  4MQV A;  3P9C A;  2PMU A;  2H09 A;  1BIB A;  3GYH X;  4E70 A;  2P5K A;  4TV7 A;  2VXZ A;  3TOA A;  2QEN A;  2DQR A;  1XGN A;  1RNL A;  3KZZ A;  1RIO H;  4G9Y A;  3KEQ A;  2IA2 A;  5D6F A;  2V1U A;  2DT5 A;  1T2K A;  4YII A;  4EJT A;  3RI4 A;  4OIQ F;  4P55 A;  2DQL A;  4RGR A;  3I54 A;  5KVR A;  2HS5 A;  3RKW A;  4L0Z B;  4RB3 C;  1HXD A;  4LG0 B;  2DPD A;  2K4J A;  3TGN A;  4L9V A;  2JZY A;  2ISZ A;  5ICF A;  3L7W A;  4XSZ F;  3V7S A;  1BI1 A;  1C0W A;  2H6B A;  5FLX Z;  1E17 A;  3LQR A;  2ADU A;  1IN8 A;  2ZJ2 A;  3MWM A;  3IKT A;  3FWE A;  4I02 A;  4P9F A;  4EM1 A;  5E18 F;  1J75 A;  4RS8 A;  4MNU A;  4UHT A;  4U7D A;  4L9N A;  1SMY F;  4WCG A;  4EJV A;  4M6X A;  2HWV A;  2XRN A;  1ZG5 A;  3Q9S A;  2EFQ A;  1DPR A;  5L3F A;  1S6L A;  4RGX A;  3WE3 A;  1HKS A;  2FBI A;  3QOP A;  4HQE A;  3JTH A;  1XDS A;  1MKM A;  4I0A A;  4BQA A;  1UHM A;  5L3C A;  4IXA A;  4H0E A;  2XAJ A;  4M6Y A;  1W4M A;  4AVP A;  2DK8 A;  1F9N A;  1RI7 A;  1J5Y A;  2DAO A;  3ROU A;  4HOB A;  4LB5 A;  2FA5 A;  3E5Q A;  2UZK A;  3SZT A;  2IT0 A;  5FFX A;  3L09 A;  4MEY F;  2CQK A;  3GFM A;  2D45 A;  1KU2 A;  2P6S A;  1I6X A;  5BMZ A;  1TQP A;  2P7V B;  4MQ9 F;  1LNW A;  5TJJ A;  1FBU A;  1HKQ A;  4A0X A;  3V7C A;  4ZYD A;  3CUQ B;  2JT1 A;  4P9U A;  3GX4 X;  3BPV A;  1P4W A;  1IW7 F;  2ACJ A;  1BM9 A;  4KMU X;  2BEO A;  3VOE A;  1ON1 A;  2PN6 A;  2XAH A;  2BGC A;  5D4S A;  1W5S A;  2ZFW A;  3JSP A;  5J6X A;  4EQQ A;  2DPU A;  1KU9 A;  1OKR A;  3EYI A;  4GYI A;  3P7N A;  2XHK A;  1EV7 A;  2VBW A;  2CW0 F;  2UXX A;  1WWX A;  4UV8 A;  2IPQ X;  4HX8 A;  2F2E A;  3ZMD A;  4KT5 C;  4Q48 A;  3R4K A;  2XVC A;  3TO6 A;  4U0W A;  2QZ8 A;  2Z3Y A;  2IA0 A;  3U2R A;  3DF8 A;  4G8X A;  4BXU A;  2QBY B;  3G3Z A;  1ZGJ A;  4XRF A;  4PCQ A;  4NHJ A;  4KDP A;  4MTE A;  4JQF A;  4IVN A;  3GFI A;  2VE8 A;  3HSR A;  3TDU C;  3LA2 A;  1SMT A;  2O8X A;  2V6C A;  2ESH A;  3TQN A;  1G3W A;  1BOA A;  3B02 A;  3GZ6 A;  2ZCW A;  2QQA A;  1VTN C;  4ENK A;  4OIR F;  2KIU A;  2L01 A;  4UXN A;  5LRS A;  2FEZ A;  3IKV A;  4EMS A;  2VON A;  1HSJ A;  1ULY A;  4LJZ F;  5DEQ A;  1L3L A;  1Y0U A;  4OU0 A;  3HHG A;  1LDD A;  2K7L A;  4XLN F;  1B59 A;  1ZRE A;  5AIP A;  2ESN A;  2KIF A;  3ML6 A;  3DQV C;  1U5T B;  1F1Z A;  1QPM A;  4KIC A;  1GXP A;  1AOY A;  2RKH A;  3T5X A;  1FT9 A;  1TNS A;  2GXG A;  3B73 A;  4KN7 X;  1YW9 A;  2DFI A;  4YIF A;  1PUE E;  2VN2 A;  1MDM B;  5KK1 A;  4Z2Y A;  4EGZ A;  3F6V A;  1DP7 P;  5ERI A;  4L5I A;  3DV8 A;  1ZYR F;  1S7O A;  4KMF A;  1QO0 D;  3MZY A;  1JGS A;  5D5U B;  3R6S A;  4MGR A;  2UWM A;  1WSU A;  2DI3 A;  4OMZ A;  2W57 A;  5BQT A;  2DW4 A;  3TO9 A;  1XGS A;  2M30 A;  3U9G A;  1FYM A;  1MJ9 A;  5D5W B;  5HDG A;  2QWW A;  5DCF A;  4WXH A;  1K78 B;  4NQW A;  1KGS A;  4EM2 A;  2W25 A;  3WTU C;  3N4M A;  2HGC A;  3WTV C;  1G3T A;  3K1N A;  5BPD A;  1U3E M;  3WTT C;  4FT8 A;  1XGM A;  3E6B A;  3LFK A;  1IN5 A;  4ZZD A;  2XGX A;  1ZG3 A;  4K2E A;  4D0P A;  3HYI A;  1IUY A;  4FX0 A;  3E6C C;  2F5D A;  4HW0 A;  2QUF A;  4JBA A;  3W6J B;  3R61 A;  3REO A;  3ABU A;  2F5E A;  2XV4 S;  4Q47 A;  3RKY A;  1MD0 A;  4KN4 X;  5DDG A;  2LNB A;  3V7R A;  3GVA A;  1QGP A;  5F64 A;  3CDH A;  2LF7 A;  1CGP A;  1UST A;  5ICG A;  2COM A;  3KP2 A;  2YU3 A;  1Z91 A;  3BOQ A;  1LEA A;  2ZO4 A;  1XN7 A;  2GQQ A;  4HA8 A;  4ESJ A;  4FX4 A;  1XB4 A;  3COA C;  2VT3 A;  5E8G A;  4A0Y A;  4S04 A;  2M5W A;  1LVA A;  4HAM A;  2DBB A;  3DPL C;  3ZMT A;  2HDC A;  3JTG A;  5E17 F;  3JSO A;  1MJA A;  4YFX F;  3HSF A;  5FGM A;  1GVJ A;  3V4G A;  1H0M A;  5H6Q A;  2JPB A;  1J9I A;  4I01 A;  2L02 A;  1IXC A;  3I59 A;  3MQ0 A;  5BOX A;  5IT3 A;  2AXL A;  4BNC A;  3K9T A;  3O6B B;  1LDK B;  1MGT A;  1BBY A;  5FD6 A;  1I5Z A;  1L0O C;  4UUV A;  3QPH A;  2HYG D;  5FB2 A;  2HOE A;  1P6R A;  1Z1D A;  2E1N A;  3ZN1 A;  1SFU A;  1FX7 A;  1XCB A;  4S05 A;  3H3Z A;  3HTU A;  3M1E A;  1KU7 A;  2FBH A;  3F3X A;  5LEK A;  4R1H A;  1BJA A;  5D4R A;  5JVT A;  3C18 A;  4CXF A;  3CLO A;  4HF1 A;  2YX4 A;  2WV0 A;  2QQB A;  4MHG A;  3E3V A;  1FSE A;  1R22 A;  5AIQ A;  3CJN A;  1X3U A;  1XGO A;  4M9Z A;  4YG2 F;  3KLO A;  4L9J A;  3KZY A;  4LLL A;  4ESB A;  2WC2 A;  2LF8 A;  1CF7 B;  1R1T A;  5LEJ A;  2A6E F;  3E5X A;  1HST A;  2J5P A;  5E1W A;  3JW4 A;  1T39 A;  2O61 A;  3FHZ A;  3EQL F;  3F8F A;  1BI2 A;  2HKX A;  2OQG A;  1P4A A;  3QP5 A;  2CFX A;  4AWX B;  2OU2 A;  2UXN A;  1NHA A;  4HLY A;  3EUH A;  4B09 A;  2F5C A;  3BWG A;  2J5O A;  3N97 A;  1J7K A;  4QLC U;  3CUQ C;  3IL2 A;  1O57 A;  1B1B A;  1HKT A;  1G3Y A;  2PG4 A;  4EJW A;  3ZMU A;  4I7H A;  4LLN A;  5D6E A;  2A3S A;  2JSC A;  1HBX G;  1R5G A;  3NQO A;  4WK8 F;  3BZ6 A;  5K5O A;  3J81 K;  2YR2 A;  2L4M A;  5E1X A;  4PGH A;  3GEZ A;  4DNC A;  3LAJ A;  2A68 F;  3D5L A;  3GF2 A;  3BJA A;  2OA4 A;  4IHS A;  2O6G E;  2K4B A;  3WGI A;  4A5N A;  4N9H A;  3BJO A;  1P2F A;  1FBQ A;  3RYR A;  3VFZ A;  4WWC A;  2RC4 A;  5DUI A;  4HZF A;  2XKO A;  5LHH A;  2NNY A;  3GFL A;  1Z9C A;  3WOD F;  2FU4 A;  2NNN A;  4IRI A;  1D8K A;  3I5U A;  2W85 A;  5E20 A;  1XCV A;  3TDZ C;  4HX4 A;  2IVM A;  2R7D A;  2L54 A;  3F8C A;  5L3G A;  2NRA C;  2X0L A;  2P5L C;  3T0Y A;  1FC3 A;  5JR3 A;  1H9T A;  1YS6 A;  4EM0 B;  2VBY A;  1WI9 A;  4LK1 F;  3F6O A;  3S2W A;  2ZNZ A;  2G7H A;  2PBI A;  1RZ4 A;  1U5T A;  1UFM A;  2DO7 A;  1GXQ A;  3MEX A;  4M9S A;  2HTS A;  3T1B A;  3KEO A;  3RIR A;  1OPC A;  5A2Q K;  3IWF A;  2DTR A;  3ZN0 A;  2GAU A;  3V8J A;  1Q1H A;  5JHU A;  4U0Y A;  1IN6 A;  1IF1 A;  2A6H F;  2Y0M A;  3WG9 A;  3R0J A;  4GO1 A;  2EJR A;  4EJO A;  4KUM A;  5CVU A;  3ABT A;  4P5O A;  5HS8 A;  1JE8 A;  3D0S A;  1PP7 U;  4CO8 A;  3E6M A;  3QAH A;  5DYM A;  1U5T C;  4Y17 A;  3H92 A;  2TDX A;  1J59 A;  2LSO A;  3LAP A;  4G94 A;  1RUO A;  5TRD A;  1K78 A;  3MCZ A;  2A69 F;  4CZZ A;  1FBS A;  5HLG A;  4IF4 A;  2IA1 A;  2L4A A;  3EDP A;  3K69 A;  2ZME A;  3AAF A;  5L3D A;  5ILU A;  1BN5 A;  1T38 A;  1ON2 A;  2C6Y A;  5BPI A;  1FP2 A;  3L2C A;  3FM5 A;  2VC1 A;  3WGG A;  4FHT A;  2KJC A;  1YLF A;  1IRG A;  4LGW A;  4L9T A;  2XIG A;  5AON A;  4AIH A;  3SQN A;  3V8L A;  2GWR A;  4KFC A;  2RDP A;  1ZN2 A;  5HOO A;  3WTX C;  3BP8 A;  3W6K B;  1DPU A;  1BI3 A;  4CGZ A;  2H94 A;  1QZZ A;  2W84 A;  2FMY A;  4G7H F;  3M8E A;  1LEB A;  4P96 A;  2PEX A;  2NAZ A;  3T8R A;  2GA2 A;  5K1Y A;  5LGU A;  5HS7 A;  4GXO A;  2DLL A;  1BC7 C;  2OQR A;  2LDU A;  1ZG1 A;  3DPT A;  1LDJ A;  2OD5 A;  2PQ8 A;  1FP1 D;  4L5J A;  1USS A;  1WRJ A;  3OOP A;  3WTY C;  2KJB A;  5E8I A;  2KIM A;  2CSO A;  4HBL A;  1KYZ A;  1ZLJ A;  1W7P A;  4ETS A;  3J80 Z;  4HQM A;  2EV0 A;  1YS7 A;  4RB1 A;  4MEX F;  2XUB A;  1O3R A;  2P5V A;  3J7A O;  4U0V A;  4UVC A;  3VB2 A;  1KQ8 A;  3ECH A;  2OAZ A;  5ILV A;  3GUD A;  2P8T A;  5JFR A;  1R58 A;  2ZNY A;  3R60 A;  3RKX A;  1IXS B;  3KP5 A;  1FPQ A;  4Q5S F;  2EFP A;  4UVB A;  1K6O A;  1IZ1 A;  3ZP5 A;  3SXY A;  3HTS B;  3I58 A;  2NS0 A;  3F22 A;  1D3Y A;  4IHT A;  3F8B A;  2HZT A;  5HDK A;  4GYG A;  4N9I A;  1R36 A;  1SD5 A;  3FZV A;  4BHP A;  4BH9 A;  4EJU A;  3Q5F A;  3WGH A;  2EFO A;  1T0F A;  5CJ9 A;  3CO6 C;  3KP4 A;  4F7Z A;  2FNP A;  2BYV E;  2BE5 F;  3M8F A;  4IPA A;  1ONV A;  2MD5 A;  1O3T A;  5J8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...