4RGUA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with ferulic acid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
141
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLSTFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with ferulic acid
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription
molecule keywords Repressor protein
total genus 43
structure length 141
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rguA00
4U88A 2GAUA 5E1ZB 3DF8A 4ZYDA 2OBPA 3CUQC 1Z6TA 2HDCA 3B02A 3CJNA 4NB5A 5F6FA 3ULQB 1XMAA 2L4MA 2O3FA 1S7AA 3IHUA 2DAOA 2G7HA 3V8LA 2VBWA 3T8TA 4HAMA 4HBLA 5AONA 3B73A 5HVQC 2DTRA 1RUNA 1FLIA 3Q9SA 5KK1A 1SD5A 3I59A 2CQKA 2KRFA 2GXBA 4RS8A 4CYDA 1XSXA 3E6DA 3CLOA 3O3KA 3Q5FA 4DNCA 3IWZA 1W7PB 2JTVA 1E2XA 1KU2A 3KP6A 4HYEA 1H9TA 3BWGA 3HSRA 3HRSA 3GWZA 2JPCA 4G9YA 1I6XA 2ACJA 2IRFG 2FBHA 1GXPA 3V8JA 4IVNA 2XAGA 1FBQA 4HF2A 4I0AA 1IRFA 2IVMA 1HBXG 1USTA 2V1UA 2FE3A 5LLQA 4GGGA 3NEUA 2VXZA 2LSOA 2O8XA 1BM9A 3I54A 3SZPA 2FU4A 4YG2F 5IT9K 2VOOA 3L7WA 4Q47A 3IWFA 1W7PD 3BOQA 4N9HA 3ZMTA 2XGXA 1R23A 5DYMA 4HX7A 3S2WA 5JVTA 4O5VA 2XROA 1G4DA 1ZREA 1J59A 3DP7A 2OZUA 1TLHB 2XAJA 3MEXA 3R60A 1IN7A 3WTUC 3FMSA 1S8NA 3EYYA 1ZH5A 3F22A 1BJAA 1ONVA 2W57A 2Z33A 2EK5A 3E6CC 2VBXA 1SFXA 2FSWA 1JHFA 3RKXA 4CICA 4MEYF 4ZZDA 3K2ZA 3E5QA 1EH6A 3F8CA 2F2EA 2EFOA 5LHHA 1JXSA 2TDXA 4R1HA 4I09A 3SXYA 3N97A 2QQAA 2KKOA 1SMTA 3MAJA 4DQ2A 4I01A 1FC3A 2YX7A 3GFMA 1R5HA 2DU9A 1SD6A 1LDDA 1KGSA 2FEZA 2LDUA 3KEQA 2F5FA 2Z99A 1LB2A 2DPUA 2X4HA 2RQPA 2D1VA 3MFKA 3P9CA 2L02A 3LA2A 4HF1A 2IW5A 5D6EA 1XDSA 4HX8A 1G3TA 2B0LA 5BQTA 1FYMA 2HQNA 5DCFA 1U5TC 4WK8F 1U78A 2JT1A 3F6OA 3W6KB 1DUXC 4JQFA 2G9WA 2Z5UA 5BPIA 4GO1A 3VEPA 3T5XA 1XGOA 3KE2A 5E20A 5ILUA 3J7AO 4FHTA 4Y15A 2D2WA 2RKHA 4WCGA 1P6RA 4G7ZF 1FPQA 1QPMA 2DK8A 1XSVA 2FF4A 3BPXA 1SMYF 3CDHA 1IRGA 4HLXA 1L3LA 3LSTA 3JAMZ 3L09A 2MLKA 5ICEA 4KMFA 4JK1X 3E6MA 2DLLA 2WTEA 1TQPA 3IL2A 4RB3C 4CXFA 1OYWA 3E6BA 3OOPA 5DUKA 1FT9A 1TW2A 2CWEA 3I59B 4YIIA 1UHWA 4EM2A 3KLOA 3BJAA 1BIBA 3HRUA 3ZQ7A 3WE2A 2XUBA 3DXJF 5DUIA 1G3WA 2ZMEA 2JRTA 1EV7A 3L9FA 2NNNA 2P5KA 3E3VA 4FX0A 1K6OA 2IA2A 3PQKA 1UHMA 3FWEA 4RGUA 1KU3A 2UWMA 1R22A 3DKWA 5D6FA 3NRVA 3CUQB 3ZMVA 2CGPA 1ZRCA 1F4KA 5HDGA 4UVBA 1QZZA 3RYRA 2KIMA 2Y48A 2HYGD 2YSRA 4RB2C 3CO7C 3NQOA 3F72A 4LFUA 2R7DA 4A12A 5HS7A 2K7LA 2PFBA 4AIJA 5L3FA 4BHCA 4MEXF 4F7ZA 1W5SA 1J0RA 3WTYC 5ICCA 4R8HA 1J2XA 2BBYA 4KYWA 4OMZA 2V9VA 4CO8A 2GXGA 1ON2A 2BYVE 2RN7A 2RC4A 2W84A 4IRGA 3ZMZA 4KICA 3J80K 4EMSA 4HF0A 4RGSA 1BI3A 1K7AA 2FMYA 1P4WA 1Z6RA 1USSA 2DBBA 4M73A 3EDPA 3GLXA 4EQQA 4CGZA 2ETHA 4RB1A 2AXLA 1IN6A 4IXAA 3HOTA 4ESFA 2PG4A 1R7JA 1R5GA 2P5VA 1OMIA 2VODA 2ZCWA 1LQ1A 1BIAA 4IJAA 5JI6A 2QZ8A 4M74A 2ZNYA 3BZ6A 1G6NA 4D0PA 2MLGA 2QLZA 4LB6B 5ILVA 1DP7P 4XSXF 2UXNA 5ED4A 1FY7A 2H09A 1MJ9A 2PJPA 2QENA 1Z05A 3WGIA 4A0YA 4EJWA 4MGRA 2H94A 1PDNC 2HZTA 1GVJA 4UVAA 1DPUA 4Z2YA 4OINF 3TO6A 3HOSA 4LMYA 5LBQA 2V79A 3KFWX 4KN7X 1QO0D 1FOKA 2H6BA 4BAYA 5HLHA 1FSHA 3L2CA 1XN7A 3D0SA 4G94A 4HV6A 2JSCA 3F8MA 2P5LC 5H20A 3HIFA 2VBZA 4LG0B 2P7CB 1J9IA 5J6XA 5TRDA 2AS5F 3I64A 4HW0A 2A3SA 3FXRA 2G7UA 2M30A 4GYGA 2A5YB 3I4PA 1YLFA 3K0LA 3K69A 2O0YA 1MJAA 1D3YA 1H9GA 3CUOA 1I1SA 2M45A 2HYFA 5CLSA 4IHSA 4HX4A 4I2OA 3LAJA 3IKTA 3GFJA 1ULYA 1U5TB 2QUFA 3TOBA 1FBUA 1SFEA 4P9UA 3BJOA 4GYIA 1YTYA 4P9FA 2NAZA 5BS6A 4Q4ZF 4EM1A 1FSEA 2QYOA 2GA1A 2VBYA 1R58A 1FYKA 1T2KA 1MDMB 5ICFA 4ENJA 2F5DA 4ENNA 2IP2A 2VONA 4BXUA 2L4AA 2COMA 3REOA 1FNNA 1G3SA 3RTRA 4MQ9F 5D5XB 3M9AA 3V7SA 1STZA 2FBIA 3QPHA 4I7HA 2E7WA 3QPTA 3ZMUA 2W85A 2DO7A 2HS5A 1O3RA 1SD4A 4KMUX 1I5ZA 3JW4A 5FFXA 1R1TA 4RAYA 1FYLA 1KYWA 1S29A 2M1BA 2FA5A 1KA8A 2STWA 3BP8A 2A61A 3MQ0A 4YFKF 5HS8A 1XGNA 3JTHA 2DI3A 1O3QA 2WWYA 2KIFA 1BI1A 3CO6C 4G7HF 1XCVA 2MC3A 3PFIA 1W7PA 4AIHA 4LK0F 2YR2A 4BHBA 1V4RA 1IXCA 3GXOA 5AIQA 1YQAA 3GFIA 2DQRA 3FXUA 4Y17A 3V4GA 4EGZA 2OQRA 2CFXA 4B8XA 1BI0A 4PCQA 2J5PA 4EVIA 2NYXA 3FF5A 3PQJA 1LEAA 3CTAA 3O6BB 3ZP5A 1XMKA 1MJBA 2RGVA 3ECHA 2IJLA 5FO5A 4ZYHA 1BN5A 2K4BA 1WSUA 1F1ZA 1I1GA 2XHKA 1BC7C 1IW7F 1Z91A 1UCRA 3TO7A 1B9NA 4ESJA 1WQ2A 3WTXC 1IN5A 4RAZA 1IAWA 4WWCA 2Y75A 5DD4A 5FD5A 1GHCA 2EA4A 3IKVA 1ZLJA 1E17A 3P7NA 5D4RA 3F23A 2EFWA 2PQ8A 1TBXA 5J8CA 1KQ0A 2ZNZA 2EFNA 4YFXF 1FZPB 1YFHA 5K5QA 2V1XA 2O61A 2CYYA 1U2WA 5DD8A 2XKPA 2O6GE 1IUYA 2PN6A 5D5UB 2H6CA 2IPQX 4L0YB 1J7KA 2PBIA 3KLNA 2XASA 5FB2A 1WI9A 2OAZA 1YG2A 2Z9OA 4LLNA 3KZYA 3ABTA 2E1NA 5BMZA 1LNWA 5DCMB 2P6SA 2Q8KA 1WWXA 4ETSA 3MZYA 1OPCA 2MD5A 3LQRA 2MBFA 4PZJA 3QRFF 5E1XA 3O2PE 3EUHA 4QLCU 3F8NA 3HUGA 1SAXA 3F3XA 1Z1DA 2DFIA 5LGNA 4OIRF 4HQMA 4KT5C 4N0BA 3ERED 1HKTA 3F8FA 3ELKA 1U5TA 1MGTA 3RKWA 5TJJA 1ZLKA 1R1VA 4OMYA 5LGUA 3LA7A 4LD5A 3WGGA 1QQIA 2K4JA 4S04A 4AWXB 2FQ3A 3RKYA 4QWQA 4A5NA 4EJOA 3GFLA 4CZZA 1TQMA 1MKMA 3WTWC 4G6QA 2L54A 4KA4A 5LEKA 2KJCA 1LVAA 4HV5A 2HEOA 1YYVA 5LRSA 3HRMA 1KYZA 2EFQA 3JSPA 1CF7A 4UV8A 3IRQA 1TNSA 4L5IA 4EM0B 3HHGA 2NNYA 1I27A 3QU6A 5DV5A 5EEGA 2K02A 3GUDA 3LFKA 3FHZA 2PLYA 1TNTA 4NHJA 4UV9A 2JZYA 5L3BA 2WC2A 2VOPA 5J8FA 2PI0A 4HZFA 3RJPA 3FM5A 4BH9A 1A04A 2A07F 4A6DA 4M71A 2GZWA 3GZ6A 2EB7A 3BDDA 4M6YA 3C7JA 3F8BA 1HXDA 2MH9A 3I58A 4OOIA 5ILSA 3JAMK 1XGMA 3MZHA 2ISYA 4PGGA 3K1MA 1R36A 3R4KA 1OYIA 3R0JA 3M8FA 5LRRA 4U7BA 1XGSA 5CVJA 4S05A 3ZMDA 2RDPA 1HKQA 1ON1A 5F1RA 1F5TA 4O3MA 1Y0UA 2XRNA 1O3SA 3P9IA 2HKXA 2ZKZA 2CW0F 4A0XA 2Z3YA 5IT3A 4L9TA 4EV0A 5HOOA 3WU0A 4EJTA 3G3ZA 1EH8A 3GW2A 1T38A 2ISZA 4ASNA 2YPRA 2FNAA 1XCBA 1PP8F 3DPLC 5JHUA 2A6HF 5D8LB 3ZN1A 4P96A 5CJ9A 1YS7A 4IRIA 2VC0A 4OIOF 1J5YA 2X0LA 2EFPA 2Y0MA 1FWZA 3TO9A 6PAXA 2ESHA 1XD7A 1V3FA 4ESBA 2EA2A 2HOEA 3FMQA 5HLIA 5F64A 4LLLA 2GIVA 2M87A 5DDGA 2XAHA 3D5LA 5E1WA 3WTSC 1MDMA 1FX7A 2ZJ2A 5E8IA 3T8RA 2CG4A 4IRHA 2Q2EA 3OV8A 5D4SA 2R3SA 1SFUA 4GCVA 2K27A 1S3JA 2OU2A 5CVRA 1LDJA 2E1CA 1S7OA 2FOKA 2RVCA 3TDZC 2QBYB 3WU1B 1YO5C 1JGSA 3SFZA 4KDPA 3ABUA 2OQGA 2PMHA 3ECOA 4FX4A 1UB9A 5HS9A 3FZVA 3U9GA 4MTDA 1CGPA 1R00A 3E97A 4OU0A 3C18A 3RIRA 1TQIA 4RB0A 1RNLA 4ZH4F 4BHPA 1K78B 2YU3A 3VOEA 2FRHA 2XAQA 2C6YA 4LG0A 5KVRA 2XV4S 4EJUA 2A6EF 1IXSB 3COAC 5HDNA 2MH2A 4KFCA 3K1NA 3F6VA 3KETA 1UFMA 4ENMA 1Z7UA 2KIUA 3FMRA 4LK1F 3E5XA 3MCZA 1P92A 2GA2A 4WXHA 3I71A 3VODA 3EETA 4RGXA 1CF7B 5HLGA 3SQNA 4A2UA 2L3DA 3R0AA 4E70A 1ZGJA 1RI7A 3U1DA 4O6JA 2IT0A 4Q5SF 3QU3A 3U2RA 1EH7A 4M9SA 4KNYA 4OIPF 2WV0A 4YFNF 5A2QK 1Q1HA 3FXQA 2DQLA 2FXAA 3WTZA 3EQLF 2XKOA 4N9IA 2PMUA 1F9NA 4M9ZA 5EEHA 1AOYA 1KQ8A 2VC1A 2VE9A 4LJZF 4UUVA 2GQQA 3C1DA 4AD9A 3I0TA 2LKPA 2LF7A 1ZARA 4XLNF 3TOAA 3N4MA 2RV8A 1ZRDA 3ROUA 2LF8A 2ESNA 3ZMSA 1PP7U 4B09A 3M8EA 3J80Z 3DQVC 4I0BA 3LAPA 1IN8A 4YIFA 4ZYEA 1H0MA 1IZ1A 3H3UA 5CVVA 1OR7A 3I53A 3F21A 2BV6A 1BI2A 1ZG1A 1FBSA 2PEXA 4RGRA 1U6GA 5K1YA 5DCMA 1HSJA 3GF2A 1P4XA 1WRJA 3T0YA 3H92A 3IC7A 4OIQF 3JSOA 4L18B 3KEOA 5D5WB 3DV8A 5E8GA 3RDIA 3WGHA 4HOBA 5H6RA 3R6SA 4WXDA 3VB2A 4M9XA 2RNJA 4ZYGA 4A5MA 3SZTA 1W4MA 1HQCA 3J81Z 2W24A 4UXNA 1J75A 2K86A 2W25A 3LQQA 1HW5A 4WF2A 4BYYA 1ZG3A 4XSZF 5CYVA 1IN4A 2EV6A 1U3EM 3JTGA 3T1BA 4ENKA 4AIKA 3R61A 2XIGA 2VT3A 2EV0A 3GYHX 4L0ZB 1T98A 3WE3A 3FM3A 3P9KA 4UNOA 1U8RA 2EV5A 2E7XA 1O3TA 2QVOA 2VE8A 1AWCA 4UVCA 3RI4A 1IXRC 4L5JA 4HLYA 1D8KA 3LWFA 3QAHA 2HFHA 1ZRFA 2OZ6A 1BBYA 1ZAOA 1YW7A 1KQ9A 3G73A 2V6CA 2DPDA 4G6DA 2XAFA 1XSDA 5K5RA 3DFGA 1OYYA 3RPUA 2FBKA 3TDUC 3W6JB 2ELHA 1T0FA 2F5EA 1T6SA 4UHTA 5LHGA 1WKMA 4JBAA 3IRRA 3J81K 1LEBA 3KP7A 1D5VA 1B1BA 1BOAA 4HQEA 1LJ9A 3DEUA 1HW1A 1YS6A 1G3YA 2L01A 4WX9A 1NHAA 3KP3A 3KP2A 1ZN2A 3ML6A 3ZN0A 3V7RA 3LA3A 4ZZLA 3M1EA 2F5CA 1YW9A 1VTNC 1PUEE 2IA1A 3QP6A 5FFZA 3FX3A 4M6XA 1KU9A 1TTYA 3HSFA 2STTA 1ZGAA 4HDVA 3ISPA 1O7LA 4U0YA 1QNTA 5HDKA 1R1UA 1SD7A 4KN4X 3HYIA 1MZBA 5BPDA 4IHTA 4LB5A 3HRTA 4P55A 2VN2A 3V7CA 4P5OA 2BE5F 1XB4A 1KU7A 3KCCA 4EJVA 1BC8C 1B59A 2UZKA 4MHGA 2NS0A 4PGHA 3KP5A 4L9NA 4EGYA 4KIGA 1ZHFA 1QGPA 2ADUA 4BNCA 1T39A 3WG9A 4KIFA 3CUQA 3I5UA 3BROA 3DPTA 4L9VA 5D5VB 3H3ZA 3HTUA 1HW2A 1Z9CA 1JHHA 2JPBA 2QWWA 3ZPLA 2DT5A 4MNUA 1LDKB 5FLXK 2UXXA 4FT8A 4ON0A 4TV7A 4NQWA 3BY6A 5CVUA 1JE8A 2A68F 3WTVC 1REPC 1IF1A 5L3GA 2A69F 4CDGA 4U0VA 4BQAA 4Q48A 3KP4A 4XLPF 1B4AA 2QQ9A 5H6QA 2QBYA 5JR3A 4MQVA 4R79A 5ERIA 3E5UA 3GO5A 4KIBA 4L9JA 3TGNA 2P7VB 2ZFWA 4Y13A 3GVAA 1YIOA 4G7OF 3VFZA 3BPVA 2LNBA 4CHUA 5DEQA 4A0ZA 1B6AA 1D8JA 3WODF 2R7FA 4GXOA 2DK5A 4XRFA 1K79A 3QOPA 5CVIA 5FD6A 3TKYA 1K78A 1FP1D 2J5OA 4AVPA 1O7FA 2OD5A 2MA3A 2O03A 2CO5A 2HQRA 3V8KA 2EWNA 5AIPA 3TQNA 5FLXZ 2FNPA 1DPRA 2ZO4A 4PDKA 4XBFA 1W5TA 5L3EA 2ZMEB 2HTSA 3M7GA 3WTTC 1GXQA 1ZYRF 3C3WA 4H0EA 1RIOH 1HKSA 3EYIA 2ZXJA 3GEZA 2H27A 4IF4A 3L00A 3SHFA 2HGCA 4A6EA 2HR3A 1P4AA 1DDNA 1YW8A 5IT9Z 1RZ4A 2P4WA 5ICGA 4I02A 4U0WA 2IA0A 3RYPA 4HA8A 2M5WA 5L3DA 2YX4A 2NRAC 2KJBA 3GZ5A 4KUMA 1X3UA 3K1PA 4WXCA 3K9TA 4MTEA 5E17F 3QP5A 1C0WA 2GWRA 2QQBA 5E18F 4HDUA 2XVCA 2D1HA 2BEOA 2BGCA 1XDUA 2ZBKA 3HHHA 5A2QZ 1QZYA 1FP2A 1OKRA 4K2EA 5JFRA 2P6TA 2Q0OA 2D45A 1RUOA 4I98B 3GX4X 5LGTA 2FMLA 2DW4A 2HTJA 1QBJA 1O57A 1ZG5A 1TW3A 1ODDA 4LGWA 2QM3A 1S6LA 5D8KB 3MWMA 4G8XA 5LHIA 3Q9VA 5K5OA 3HTSB 5BOXA 2HKOA 2VT2A 2M8EA 1MD0A 2P8TA 1P2FA 3BJ6A 5L3CA 2V1DA 1B9MA 4IPAA 4U7DA 5LEJA 5FGMA 3KZZA 1HSTA 4LLGF 2OA4A 3HSEA 2EJRA 3RPQA 4M72A 2CSOA 1L0OC 2HWVA 3AAFA
chains in the Genus database with same CATH superfamily
2OCEA 4U88A 1UELB 3AG4H 2NS7A 2OPTA 2LY1A 4PSXA 2GAUA 2MFZA 2W4SA 5E1ZB 3DF8A 4ZYDA 2OBPA 3CUQC 1BR2A 3A2KA 2HXOA 1Z6TA 3OOUA 3PJRA 2BXYA 2HDCA 3B02A 3CJNA 4NB5A 5F6FA 5HLTA 3ULQB 1XMAA 2L4MA 4KITB 2O3FA 2CQNA 2XPVA 1S7AA 4XLAA 3IHUA 3ZR8X 4S0HB 2O7OA 2DAOA 2G7HA 1QPIA 3FK6A 3V8LA 1ZR2A 1A6IA 2VBWA 3T8TA 4HAMA 4HBLA 5AONA 3B73A 3PNTA 5HVQC 4X1EA 2EZLA 2DTRA 2JMWA 1RUNA 3K4NA 2GIZA 1FLIA 2IS4A 3Q9SA 1WH5A 3QQAA 2GXAA 1JUPA 5KK1A 1SD5A 2L9VA 4A3FJ 1FMWA 3I59A 2CQKA 3OYBA 2KRFA 3ASNH 3CMMA 4RS8A 2GXBA 4CYDA 2K85A 4F55A 1XSXA 4I99C 3JRIA 3E6DA 3CLOA 3O3KA 1RKTA 4JX5A 3Q5FA 4DNCA 3IWZA 1NG6A 1W7PB 2KIQA 2JTVA 1E2XA 1KU2A 1FMVA 5IYBJ 2L2OA 3KP6A 4HYEA 3OMYA 1H9TA 2E34A 1Y0NA 3HSRA 3BWGA 2M0CA 3HRSA 3GWZA 3CDLA 2JPCA 5M5XJ 3HDDA 4G9YA 1I6XA 1T56A 3HPHA 3ZRGA 2K9LA 4Y4RA 4D5FA 5EG0A 2ACJA 2IRFG 2FBHA 2G0EA 3LMMA 1GXPA 1BJZA 5E3MA 2R7SA 3V8JA 4IVNA 2XAGA 1FBQA 4HF2A 2I10A 1IRFA 2KLOA 4I0AA 3MKWB 4IHWA 2IVMA 3DTKA 1HBXG 1USTA 3FK7A 2V1UA 2FE3A 5LLQA 4GGGA 3NEUA 2BW3B 2VXZA 1N77A 2LSOA 2O8XA 2VQGA 3LSPA 2JUGA 1BM9A 3I54A 1DU0A 3SZPA 2VLAA 2FU4A 4IEJA 4MFEA 4YG2F 5IT9K 2ME6A 5DM6F 2VOOA 4NNJA 1Z21A 2MABA 4A3GJ 3L7WA 1MH3A 3HZJA 4Q47A 4ZDOA 3IWFA 1W7PD 1EA3A 5E79C 1HC8A 1IDZA 2LKXA 3BOQA 4RM3A 3ZOBA 5GAEJ 4N9HA 2VPLA 3ZMTA 1DGRM 2XGXA 3I4NJ 1R23A 2EZIA 4BBRJ 5DYMA 4HX7A 3S2WA 3FXJA 5JVTA 5FRMA 4II3A 1IDYA 2P0WA 4O5VA 2XROA 1G4DA 1NK2P 1ZREA 2A6TA 1J59A 3DP7A 2OZUA 1TLHB 1QRYA 4PJLA 2XAJA 3MEXA 3R60A 3EPZA 1IN7A 3WTUC 5IYCJ 3FMSA 5EDNA 3CF5F 2VKEA 1R4NB 1S8NA 3EYYA 2HQAA 2EIMH 1ZH5A 5EF6A 3F22A 1BJAA 1ONVA 2W57A 3V42A 2Z33A 2V9PA 3ZQQA 5FLMJ 2EK5A 3E6CC 2VBXA 1SFXA 2FSWA 1JHFA 4FTHA 2COBA 3RKXA 1EF4A 2V9KA 3DBRB 4CICA 2ZSIB 4MEYF 4ZZDA 2O9LA 4NUBA 2YU9J 4A93J 3K2ZA 2Z2SB 2R5ZA 3E5QA 1T95A 4NBQA 1EH6A 3VYRB 4XRMA 1FTTA 1QHHD 1F36A 3F8CA 1ETXA 3UR3C 4NQWB 2F2EA 3I56I 3GTPJ 2EFOA 2GM4A 5LHHA 3CLQA 1JXSA 2TDXA 4R1HA 2WV1A 4I09A 3SXYA 3N97A 4BQQA 3NWTA 3OWTA 2QQAA 2KKOA 1SMTA 2GOMA 3MAJA 2LH9A 4DQ2A 5HODA 1DP3A 4I01A 3S8PA 3H35A 1FC3A 2L9SA 2YX7A 2L7KA 2Y0SN 3GFMA 1R5HA 2DU9A 1SD6A 2YS9A 1LDDA 2QQ8A 3K70D 1KGSA 1FTZA 2FEZA 2LDUA 2KPMA 3S1MJ 3HUGB 3KEQA 2F5FA 3CC4I 4BACA 2Z99A 5TISC 5DS9A 1LB2A 1OQYA 2DPUA 2X4HA 2RQPA 4JOMA 2D1VA 3MFKA 3P9CA 4IQJA 2L02A 1QVTA 1JUMA 3LA2A 4HF1A 2IW5A 3QWLA 5D6EA 1XDSA 2B63J 2A5WA 4HX8A 1G3TA 2B0LA 5BQTA 4BQNA 1FYMA 2HDDA 2Y2ZA 4BJTA 4IOAF 2HQNA 3IH3A 3CDIA 5DCFA 1U5TC 1Y6IA 2JA6J 2M2EA 5B1AH 3RQ4A 4WK8F 1U78A 2JT1A 3F6OA 3K2AA 3W6KB 1PUFB 3DPUA 2DTZA 1DUXC 4JQFA 2G9WA 2Z5UA 5BPIA 4GO1A 3DEEA 3VEPA 3T5XA 1XGOA 4RAGA 2FX0A 1OCTC 3LSMA 3PUFA 3JRBA 2CJJA 3KE2A 5E20A 2M9HA 3HOYJ 5ILUA 3J7AO 4FHTA 1BW5A 4Y15A 2D2WA 2RKHA 3MZ8A 4DYRA 4C9YA 2XF7A 4BKXA 1P7JA 4WCGA 2MW8A 1P6RA 2RNGA 4XNFA 4G7ZF 1FPQA 1LFPA 2R5YA 1QPMA 4XRSG 2DK8A 2VJJA 4E7ZA 1XSVA 2FF4A 3BPXA 1SMYF 3A0BC 3BCBA 4V19K 2FQ4A 1DQUA 3CDHA 2ECBA 3Q0UA 1IRGA 4HLXA 1MMGA 2W48A 1L3LA 2F4OB 3LSTA 3L2VA 3JAMZ 3L09A 1GV5A 4BDZA 2MLKA 5ICEA 2DMUA 4KMFA 3GTKJ 3SDGA 4JK1X 5EZHA 1AKHB 3E6MA 2KQRA 3LFUA 3CC2I 2DLLA 2WTEA 4E7JA 1TQPA 3IL2A 1X1CA 4E6KG 4RB3C 1JI8A 1VZ0A 4L5EA 2AQFA 2DODA 4AUXA 4CXFA 4PJ0C 1OYWA 3E6BA 2F5VA 3OOPA 5DUKA 3OYHA 1FT9A 1TW2A 2CWEA 3I59B 4NC8A 2CV2A 1WZ2A 4IOCF 4YIIA 1UHWA 3WHCA 4EM2A 3KLOA 1X1DA 3BJAA 4HEA2 1BIBA 3HRUA 1ETQA 3WE2A 2XUBA 3ZQ7A 3DXJF 3A1YA 5DUIA 1G3WA 2M0MA 2ZMEA 3QODA 2JRTA 1EV7A 3L9FA 2NNNA 1GDTA 1KZHA 3ZQCA 2P5KA 3E3VA 4FX0A 1K6OA 2IA2A 3PQKA 2JN6A 1OISA 1UHMA 1MH4A 2OTJI 9ANTA 3MD2A 2VXDA 1A31A 3VYSB 2X6WA 1GUUA 3FWEA 2LC2A 4RGUA 2VL8A 1KU3A 2VJIA 5FKKA 3JRDA 3PIOF 2ZMEC 1R22A 3DKWA 5D6FA 4CA0A 2UWMA 3NRVA 3CUQB 2LD5A 4KJZA 3ZMVA 3OYAA 2CGPA 4UUSB 1F4KA 3KIOA 3LL7A 5HDGA 4UVBA 1ZRCA 1QZZA 3RYRA 2KIMA 3G2BA 1H89C 2Y48A 2HYGD 2YSRA 5EJCA 4I6ZA 2PX9A 1MBJA 3PIPF 4RB2C 4BBSJ 1MW7A 1PJRA 3CO7C 3G4SI 4FCYA 3NQOA 3F72A 4LFUA 4DYQA 2F6CA 2DYRH 2R7DA 4A12A 5EGOB 5HS7A 2K7LA 2LVSA 3MMYB 5F1JA 3NAUA 1POGA 2PFBA 4RMNA 1HDDC 2K9SA 3AKZA 4CCJA 4AIJA 4JP0A 4ZTFA 4XIDA 5L3FA 4BHCA 4MEXF 4F7ZA 1V55H 1W5SA 2WY7Q 4DYCA 4IL6C 1J0RA 3WTYC 2Q1ZB 5ICCA 2PMZA 4R8HA 1J2XA 2BBYA 4KYWA 4OMZA 2V9VA 4XKVA 4B44A 4CO8A 2R7TA 4ANJA 2FJ1A 4E7SA 5J1YA 4D1QA 2GXGA 1ON2A 2BYVE 4XMYA 2RN7A 4DW6A 2RC4A 2W84A 4IRGA 3ZMZA 4KICA 3J80K 2UUZA 4BL0B 4EMSA 1TWAJ 4HF0A 3TP3A 3J7ZI 2IGKA 4RGSA 3W2WA 4XKCA 1BI3A 2WB1A 3GTMJ 2X6OA 5FROA 1K7AA 2H1LA 3ONQA 1D1CA 2FMYA 1P4WA 2BY3A 1Z6RA 2MGQA 4F92B 1USSA 3A01B 4QPOA 4I76A 1ZR4A 2DBBA 4M73A 1YITI 3EDPA 4XN3A 1SANA 3GLXA 2HDWA 3DLAA 4EQQA 4A3JJ 4CGZA 2ETHA 4RB1A 2BY0A 2AXLA 2VKVA 1MNMC 1IN6A 2HZDA 4IXAA 1SVMA 3HOTA 3WHBA 1WJ5A 4ESFA 3G6EI 1IGNA 4DJAA 1MMNA 2IEKA 2GLOA 1B8IB 2PG4A 1R7JA 1R5GA 3KEYA 4J00A 2P5VA 1OMIA 3FDYA 3DTIA 4UB8C 2VODA 2ZCWA 1MIJA 1ENHA 1LQ1A 1BIAA 4DIQA 3CCQI 3J7YJ 4IJAA 1JKQC 5JI6A 3CCSI 2QZ8A 4M74A 1ZKGA 2WBMA 1K4TA 2QSFX 2ZNYA 2E5ZA 3OR2C 3BZ6A 4ZTJA 2DDBA 4A3KJ 1G6NA 4D0PA 3HG9A 3PNYA 2MLGA 2Q2EB 2QLZA 3QPLA 4LB6B 5ILVA 1JT0A 3DEWA 1DP7P 4XSXF 1MMSA 2UXNA 4ZDLA 5ED4A 1FY7A 1XTAA 1K4SA 2H09A 2CUZA 1MJ9A 2PJPA 2L0KA 1Z05A 2QENA 3WGIA 4A0YA 1Z7LA 4EJWA 4KISA 2TCTA 4MGRA 4ITVA 2H94A 1PDNC 2HZTA 5GAHJ 1AHDP 3CMAI 1GVJA 1WJBA 1XMXA 3M1CA 2OC6A 4IQ4A 4ZC3A 4UVAA 1DPUA 4Z2YA 4OINF 5GPAA 3TO6A 1APLC 3OL3A 3HOSA 4PUSA 4LMYA 5LBQA 1D1BA 2V79A 5M3MJ 4XLCA 4UY8I 3KFWX 4C3IJ 4KN7X 1QO0D 1FOKA 2H6BA 3FXOA 4JX6A 4BAYA 2R7RA 3G1LA 5HLHA 1T8IA 1FSHA 3L2CA 4IHVA 1XN7A 2CW7A 4IZZA 3D0SA 4G94A 4HV6A 2JSCA 4A69C 3S17J 3F8MA 2P5LC 2R92J 5H20A 2Y0SA 1T08B 3F0CA 3HIFA 3IV5A 2KFDA 2VBZA 4LG0B 3BR3A 2P7CB 2ZC2A 1J9IA 1X19A 3EUAA 3LSIA 3OL4A 5J6XA 5TRDA 2XGDA 1YI2I 4M3FA 1W5CC 2AS5F 4CCMA 3CC7I 3I64A 4P1WA 4HW0A 2A3SA 2EIJH 3FXRA 2VJ4A 5JHFA 2G7UA 2M30A 4GYGA 2A5YB 2W00A 4FETA 3OYMA 3I4PA 3SJMA 1YLFA 2K9NA 3K0LA 3K69A 2O0YA 1MJAA 1D3YA 1H9GA 3CUOA 1I1SA 1Y8RB 2HNHA 2M45A 2HYFA 5CLSA 4IHSA 2R4GA 4W1UA 3S15J 4HX4A 2XC7A 2V6EA 4YEJA 2ZXHA 4BEHB 5GPCA 4I2OA 4MIMA 3LAJA 3IKTA 3JRHA 3GFJA 3OYLA 1ULYA 1XPXA 3FBIB 1U5TB 3H36A 2QUFA 2VASA 3TOBA 1FBUA 1SFEA 2E5NA 3BJOA 3HM5A 4P9UA 1VQ8I 4GYIA 1YTYA 3UKGA 3H0DA 3PFYA 2DOAA 2NAZA 4P9FA 3KZIC 1XS9A 2DOFA 3OYJA 2V7FA 3BZCA 2R7UA 2R0QC 5BS6A 4Q4ZF 4EM1A 2EPFA 1W1WE 4X6AJ 1FSEA 4HPQA 4XORA 2QYOA 2GA1A 1X4OA 2VBYA 4AIDA 4QIWN 3BR1A 5IOYA 4UUTA 3D5RC 3OYDA 4C3HJ 1R58A 1FYKA 1T2KA 1Q1VA 5F27A 1WJCA 1MDMB 5ICFA 2BHYA 3OY9A 4ENJA 2F5DA 2M34A 4ENNA 2IP2A 3BR0A 3AFHA 2VONA 4BXUA 2L4AA 2COMA 3HPGA 3REOA 5J1RA 2JA2A 1FNNA 1G3SA 2E1MC 3OIPA 3RTRA 4XICA 4MQ9F 1IG7A 5D5XB 3M9AA 3TW7A 1HOMA 3V7SA 3FKIJ 1STZA 2FBIA 3QPHA 4I7HA 2E7WA 1WHUA 3QPTA 3ZMUA 3CMEI 2W85A 5IP6A 1GV2A 5K7ZA 2VKDA 2DO7A 2HS5A 1O3RA 2KISA 3HEFA 1SD4A 4KMUX 1I5ZA 2LY9A 2LYCA 3JW4A 5FFXA 1R1TA 4RAYA 1FYLA 1KYWA 3CCVI 4BQOA 1S29A 3RPUD 1OCOH 2M1BA 2O5RA 1U0JA 1UG0A 5CQGA 2FA5A 1KA8A 2STWA 3BTLA 2E19A 2EH3A 1MSFC 3BP8A 2A61A 3MQ0A 3CP2A 4YFKF 5HS8A 5C44J 2X6XA 5M5YJ 3GZNB 4XLEA 1XGNA 3JTHA 1FIAA 2DI3A 1O3QA 2WWYA 2KIFA 3K4JA 3Q0VA 3CJQB 1BI1A 3CO6C 3LSKA 4G7HF 1XCVA 2DT7B 4ZJZA 1A36A 1IRZA 2MC3A 5J4YA 2DMTA 3PFIA 2XPUA 3DU5A 1W7PA 1Z3YA 4AC0A 4AIHA 4LK0F 4FE4A 4CSWA 2YR2A 4BHBA 3S2HJ 1V4RA 2CQXA 2IAIA 1IXCA 1NG7A 2BZTA 3HL2A 3DWLE 3GXOA 2ZJQF 5AIQA 1YQAA 3H9JA 3P5JA 2Z1DA 3GFIA 2DQRA 3FXUA 4Y17A 3V4GA 4EGZA 1UAAA 4HNVA 2OQRA 2CFXA 3FXKA 3DU6A 4B8XA 1BI0A 4PCQA 2J5PA 4EVIA 2NYXA 2XGEA 4ZYAA 1H8AC 2CMPA 3FF5A 3PQJA 3TMOA 1TP4A 1LEAA 1HA8A 3CTAA 2JRMA 3BG5A 5J47A 3O6BB 2L5QA 2LG4A 3ZP5A 2KRHA 3EUHC 1XMKA 1MJBA 2RGVA 2QCOA 3ECHA 3I9V2 2QKLB 2IJLA 5FO5A 4DBRA 5GP9A 1IO2A 4ZYHA 1BN5A 4J01A 2K4BA 1WSUA 1F1ZA 1WFXA 1I1GA 1LFUP 2E71A 2XHKA 1BC7C 1IW7F 1SC7A 1OCZH 1Z91A 1UCRA 3TO7A 1B9NA 1V54H 4ESJA 5EZGA 1WQ2A 1TWFJ 3BC8A 3WTXC 1IN5A 2AQEA 2KZVA 4RAZA 1IAWA 1W36C 4WWCA 1VQLI 2EQRA 3AL0C 2Y75A 5DD4A 3BQZA 5FD5A 1G2HA 1GHCA 3VSKA 5FLVA 2EA4A 3IKVA 2OF7A 4NC7A 3KX2A 1ZLJA 1E17A 2CV0A 1JKOC 4XR6A 3P7NA 5D4RA 3F23A 2EFWA 4G12A 2PQ8A 1TBXA 4CH7A 5J8CA 2R5YB 1KQ0A 2HI3A 2ZNZA 3CCEI 5JVGF 5C4XJ 1P9QC 3DCFA 2EFNA 4NC6A 4YFXF 1T33A 1FZPB 1YFHA 4XQFA 5K5QA 2V1XA 1Z67A 2O61A 2CYYA 4QSHA 3RQIA 2EILH 4YRVA 1U2WA 5DD8A 5EYRA 1HLVA 1IJWC 4BU2A 2XKPA 2O6GE 1S7EA 1IUYA 2PN6A 1MBFA 5K7HA 2E35A 5D5UB 4D9JA 1KONA 1YOVB 2H6CA 2KDZA 2IPQX 5KAIC 4L0YB 1J7KA 2PBIA 3ASOH 2X6YA 3CJTB 2HOSA 1WI3A 3KLNA 2XASA 1QZEA 5FB2A 1WI9A 4IKFA 2R5ZB 3GTOJ 4CYCA 2OAZA 1YG2A 2Z9OA 4LLNA 3KZYA 3RZOJ 3ABTA 2O8KA 3L2RA 2MC4A 4XOTA 3QYBA 2E1NA 4JYKA 4IX7A 2X51A 1MMDA 5BMZA 1FIPA 1LNWA 1RR7A 3DKXA 2P6SA 1D1AA 4LG3A 5DCMB 4E7HA 2Q8KA 1WWXA 1I50J 4ETSA 2X1CA 3HB9A 4HNUA 1RRJA 2PJRA 4Y7NJ 3MZYA 1OPCA 3VWBA 4LIVA 2MD5A 4E4HA 3LQRA 1A35A 2ICWG 2MBFA 4PZJA 4XN0A 4E7KA 3QRFF 4PK4A 5E1XA 3O2PE 5GTHC 4A3IJ 3EUHA 5JLXA 4BE1A 3ZQLA 1MNEA 1SEUA 1VF9A 5J3LA 2IBDA 4QLCU 4AYBA 3ZQIA 3F8NA 3HUGA 1SAXA 3BTJA 4BEHA 3F3XA 1Z1DA 1MBHA 2DFIA 2DXIA 5FKNA 5LGNA 4OIRF 2F4MB 4HQMA 4KT5C 4N0BA 3ERED 1HKTA 3F8FA 3ELKA 1F43A 1U5TA 1MGTA 3RKWA 2WAFA 2CUFA 5TJJA 2X1EA 3MKZA 5EGOA 4OWRB 4E7IA 2LOOA 1ZLKA 4M3GA 1R1VA 3IH4A 4OMYA 2DT6A 5LGUA 4FE7A 3W3CA 2DDAA 3LA7A 4LD5A 3WGGA 2VB6A 2JWTA 2CRGA 1QQIA 3NWSA 3DBHB 2K4JA 4S04A 2X9DA 4AWXB 2FQ3A 2DA4A 1WVRA 1Z77A 3RKYA 1SFKA 4Y33A 3S1QJ 4QWQA 4A5NA 2MG4A 3GFLA 3H9GA 4CZZA 4EJOA 2ID3A 1TQMA 5J4VA 3OS1A 1NTCA 1MKMA 3WTWC 3CCRI 4G6QA 1MBGA 5E3LA 2L54A 4KA4A 3ESWB 1K6YA 1OFCX 5LEKA 1WJAA 2KJCA 3ABMH 3PO3J 5IPAA 3FIWA 3K4BA 1LVAA 4HV5A 2W7NA 2HOTA 2HEOA 3JREA 4DGWB 1YYVA 5LRSA 3HRMA 1KYZA 2EFQA 3PSIA 3L2WA 1OCCH 3JSPA 2QEXI 1CF7A 2OUMA 3GLLA 4UV8A 3IRQA 4KT6A 1TNSA 4C2TA 4L5IA 4EM0B 1NH3A 3HHGA 4BDYA 2NNYA 1I27A 2X1DA 3QU6A 1RKWA 5DV5A 3DLLF 4AYBN 5EEGA 2K02A 3GUDA 4YIRX 3LFKA 3FHZA 2L9RA 2PLYA 1TNTA 4NHJA 2M4GA 3K10A 1YE9A 2XSJC 2DA7A 4UV9A 2GOXB 2JZYA 2XAUA 5LFAA 5L3BA 2WC2A 3S2DJ 2K3PA 2VOPA 4XOPA 5J8FA 2PI0A 1A5JA 3PL8A 4DZJA 1QHGA 4HZFA 3HOUJ 1JJ8C 3RJPA 1UHSA 5KNLA 2LBFB 3FM5A 1OJLA 2Y31A 4BH9A 1A04A 2A07F 3B6AA 4A6DA 2NVQJ 4M71A 2GZWA 3GZ6A 2EB7A 3BDDA 1ZK8A 4M6YA 3C7JA 2DJIA 2E1MB 3BR6A 4BE2A 3F8BA 2WAEA 1HXDA 2MH9A 3I58A 4OOIA 2K40A 5ILSA 2NS8A 2ZXWH 1Y1VJ 4MFDA 2L9NA 3JAMK 2DFEA 1BL0A 2JUCA 1E3OC 4RDUA 2IS6A 1XGMA 2B7EA 3MZHA 2ISYA 4E7LA 4PGGA 3K1MA 1R36A 1VQ4I 1LKXA 3R4KA 1OYIA 3R0JA 1X1BA 4RA2A 2H1KA 3M8FA 5LRRA 2KZGA 4U7BA 1XGSA 2XRLA 5CVJA 5M5WJ 2R7QA 4S05A 3ZMDA 1WJEA 2B9SA 2XSDC 2RDPA 1HKQA 1ON1A 2VQLA 5F1RA 1IV6A 1OCPA 1F5TA 4O3MA 1FOXA 3TL4X 3I4MJ 4N4NB 3S93A 1Y0UA 2XRNA 1O3SA 3P9IA 2HKXA 3DTEA 2ZKZA 2CW0F 4A0XA 1MSEC 2Z3YA 5IT3A 3G1MA 4C3JJ 4L9TA 4EV0A 5HOOA 1E0EA 3WU0A 2KRCA 4EJTA 3G3ZA 1EH8A 3G1OA 3GW2A 1T38A 2OCCH 3AG3H 4ASNA 2LFBA 2ISZA 2YPRA 4MLOA 2FNAA 3BT9A 2IGNA 1ETOA 1B72A 1XCBA 1PP8F 3DPLC 5B5EC 5JHUA 1GVDA 2ZFUA 2A6HF 1Y8QB 2AO9A 5DTDA 1S9HA 5D8LB 1WPKA 1H88C 4XM3A 3L2QA 3ZN1A 4P96A 4BJ6C 4HSRA 4C2MJ 5CJ9A 3HOZJ 1BOBA 1YS7A 3ABLH 3K6GA 4IRIA 2VC0A 1U8BA 4OIOF 3PNVA 4DZPA 2H8WA 2P81A 1J5YA 2X0LA 2EFPA 1PYVA 1TZLA 1O4XA 2RQQA 2Y0MA 4PSWA 2WAQA 1FWZA 3A01A 1X2NA 3TO9A 1U9NA 3O8GA 2VQCA 4OAZA 6PAXA 2ESHA 1XD7A 1D0XA 3N05A 3HGGA 5DM7F 2NXNB 2R7ZJ 3L2UA 1V3FA 2EZHA 4ESBA 2HVRA 2EA2A 2HOEA 3FMQA 3I55I 5HLIA 5F08A 1B8IA 4PJMA 5F64A 4IO9F 4LLLA 2GIVA 2M87A 3MKYB 1BR4A 5DDGA 5M3FJ 1R9TJ 2XAHA 1YJ9I 2JVHA 3J7AY 1LE8A 3Q0WA 3D5LA 2LR8A 1YX5A 3LSJA 5E1WA 3WTSC 3H9QA 4HRIA 3BZKA 4B1RA 1VQPI 2EINH 1SAUA 1MDMA 1FX7A 5CKTA 2ZJ2A 2HQ5A 5E8IA 1RESA 3T8RA 2CG4A 3PUBA 2M3AA 4IRHA 3VPRA 2Q2EA 3OV8A 1UZCA 3M3YJ 5D4SA 1WGXA 2R3SA 1SFUA 4HSTA 3CF2A 4GCVA 2K27A 1S3JA 2OU2A 2BOLA 2K5CA 5CVRA 1LDJA 2E1CA 2OTLI 3A02A 1S7OA 2BY1A 2DA3A 2FOKA 2RVCA 3M8JA 3TDZC 2QBYB 4LOCA 1UJ8A 3WU1B 4Y52J 3CMYA 3U21A 4MO7A 1YO5C 1JGSA 3SFZA 4KDPA 2UV1A 3ABUA 2ZB9A 2JQ7A 2OQGA 2PMHA 3S14J 2E1OA 3ECOA 2NOGA 3D5SC 4FX4A 1UB9A 5HS9A 3CP8A 3W6VA 3FZVA 3U9GA 4MTDA 1CGPA 1R00A 2AHQA 3E97A 4OU0A 3C18A 4IHXA 3RIRA 1TQIA 3K4LA 4RB0A 3G71I 1N78A 2IS2A 1W0UA 1RNLA 3CCLI 3M07A 3PSFA 5C3EJ 4ZH4F 4BHPA 1K78B 2YU3A 3VOEA 5IOZA 2FRHA 3HC7A 2DA6A 2XAQA 2C6YA 3UNGC 1VI0A 4LG0A 5KVRA 2XV4S 4EJUA 2A6EF 3OIQA 1R5ID 1IXSB 1IV8A 3LSRA 3COAC 4AM3A 5HDNA 3LSHA 2MH2A 4KFCA 3LOCA 1T0FC 4JX4A 3A4CA 3K1NA 3ERMA 3F6VA 5HNFA 2LP0A 3D1NI 5F0FA 3OYEA 3KETA 1UFMA 2L7MP 4A3BJ 1S72I 4D7MA 3FXLA 4ENMA 4XKBA 3HOVJ 3MKLA 5B66C 1Z7UA 2JJ7A 3GTGJ 2KP6A 1BA5A 3K7AJ 1X3WB 5F04A 4BUPA 2KIUA 1Y56A 1ZTRA 1Z0XA 3FMRA 2Y30A 2Y9YA 4LK1F 3E5XA 3IUOA 3MCZA 1V5EA 1P92A 2R7VA 1ZELA 1IRXA 2GA2A 4WXHA 1ERDA 3I71A 4GRIA 1VQNI 4N4OB 5FKLA 3VODA 3EETA 4RGXA 1X1PA 3H1CA 1CF7B 1G8XA 1Y39A 3S3NA 2E36A 4ABZA 2ZSHB 5H2FC 2DMPA 5HLGA 3SQNA 3PO2J 3BG7A 4A2UA 2QSHX 2L3DA 5C4JJ 3R0AA 4E70A 4LIUA 5IP7J 1ZGJA 2MD0A 1RI7A 3U1DA 3RSNA 2QA4I 4O6JA 2NVUB 1GT0C 3OS2A 2IT0A 4Q5SF 3QU3A 1X4PA 2V4JC 2GBYA 3U2RA 3OSGA 1VQKI 1EH7A 4M9SA 2VQHA 5GTIC 1I39A 5B1BH 4KNYA 4OIPF 2WV0A 4YFNF 1ETWA 5A2QK 1Q1HA 3FXQA 2DQLA 3HKZA 4LITA 2FXAA 3WTZA 3VYUB 3EQLF 4U87A 2XKOA 4N9IA 5K7FA 2WB1N 2PMUA 1F9NA 1N75A 4RM2A 1I6HJ 3I3LA 1OCRH 2KMUA 4M9ZA 5EEHA 1LPQA 1AOYA 3EUKL 1KQ8A 4RLFA 2VC1A 2VE9A 4LJZF 2V1NA 2DFHA 2DA5A 4UUVA 2GQQA 3C1DA 3TBIA 1IC8A 2XB5A 2K9QA 4AD9A 1Y1WJ 3I0TA 3OS0A 3JRFA 3KPHA 2LKPA 2LF7A 3X2QH 1LUJB 1ZARA 4XLNF 3CCYA 3GTQJ 3TOAA 3N4MA 2RV8A 1ZRDA 3ROUA 2EBIA 1EKEA 2LF8A 2ESNA 3ZMSA 1PP7U 1WH7A 1XC5A 2LKSA 4B09A 3M8EA 3J80Z 3DQVC 5BNGA 4I0BA 3LAPA 4QPQA 1K61A 1IN8A 4YIFA 4ZYEA 1H0MA 1IZ1A 4II2A 3DKYA 3H3UA 2BY2A 4GDFA 5CVVA 1OR7A 4B47A 2CUJA 3I53A 3OYCA 3F21A 1ZGWA 1LFBA 1BW6A 1BI2A 1TT5B 2BV6A 4CYCB 1ZG1A 1R49A 2JA8J 1YRNB 1FBSA 2PEXA 1R71A 4RGRA 4B3XA 1U6GA 1JKPC 3LSGA 3BG9A 5K1YA 1ETYA 5DCMA 1HSJA 3GF2A 2DCEA 2M8GX 2DJNA 1YJWI 1P4XA 3SYTA 3BG6A 4YELA 2IGMA 1WRJA 3OYNA 1YHQI 3T0YA 3H92A 4Z6YA 3IC7A 3HOWJ 4OIQF 3K4MA 3JSOA 4L18B 4CCNA 1B72B 3KEOA 2IGOA 3JR9A 5D5WB 1V5GA 3DV8A 3RCOA 2M4KA 5E8GA 3RDIA 3WGHA 4AU7A 4HOBA 5H6RA 3W2AA 2JA5J 3R6SA 3S32A 4WXDA 3VB2A 3AG2H 1D5YA 4M9XA 2RNJA 4ZYGA 4A5MA 4Y3OA 2RAEA 3SZTA 2W1OA 1W4MA 2W82A 4CCOA 1HQCA 3E1SA 1ETKA 2N8GA 3J81Z 2CV1A 1K83J 2W24A 4UXNA 1J75A 2K86A 2W25A 3LQQA 1HW5A 4WF2A 3OSFA 4BYYA 1YJNI 3Q3SA 1ZG3A 4XSZF 5CYVA 1IN4A 2EV6A 1U3EM 3JTGA 3T1BA 3GCMA 4ENKA 4AIKA 3R61A 5J40A 2XIGA 1D0ZA 2VT3A 5FKOA 2EV0A 3GYHX 4L0ZB 1T98A 3WE3A 1RPWA 4M3BA 3FM3A 3P9KA 1MBEA 4A3MJ 4UNOA 1RETA 2BHZA 4F91B 1X2MA 3MVPA 1U8RA 3ZQGA 2WADA 2EV5A 2E7XA 1O3TA 4NDLA 1SVLA 2QVOA 2VE8A 1S5LC 1AWCA 4UVCA 3RI4A 3H3VK 1VQ6I 1IXRC 4L5JA 3C2HA 3C2GA 4HLYA 3SEZA 4DBQA 2TRTA 4B3AA 4B43A 2DOEA 2H8RA 1D8KA 4M3EA 3LWFA 3QAHA 4EEFG 2HFHA 2DA1A 1ZRFA 3OYKA 2OZ6A 1A6QA 3VDXA 1BBYA 1ZAOA 5FRNA 1YW7A 1KQ9A 3LNQA 3G73A 2V6CA 2DPDA 3KYLA 4G6DA 2XAFA 1HCRA 1JUSA 1XSDA 5K5RA 1VQ5I 2LMDA 3DFGA 2XB0X 1OYYA 2VKHA 2IS1A 2KHMA 4FQGA 1JGGA 3BR2A 3RPUA 3QYEA 3GTLJ 3F9KA 4BJ5C 3OYIA 1JTXA 1WCMJ 1X58A 2FBKA 3TDUC 3W6JB 5TGTA 2K9MA 2ELHA 3HGYA 1YX3A 1AU7A 2OV7A 4V2FA 5EG0B 1T0FA 3AL0B 1V5FA 2HPIA 2JSPA 2F5EA 5F0HA 1ACIA 2M7BA 1TC3C 2CS3A 1T6SA 1G59A 4UHTA 1R4MB 5CQEA 5LHGA 1WKMA 4JBAA 5B3SH 3IRRA 3GTJJ 1I3AA 3FHNA 2Y69H 3J81K 1XG1A 2DFFA 1LEBA 3KP7A 1D5VA 3CQZJ 1B1BA 3HXLA 1HF0A 2ELKA 3DBLB 2DMQA 1BOAA 4A3CJ 1QVUA 1R6RA 5IY5H 4HQEA 3K70C 3S3MA 1LJ9A 3DEUA 1HW1A 1TT0A 3OYGA 1YS6A 4OAYA 1G3YA 3OYFA 2L01A 4WX9A 3SDBA 5FJ8J 1NHAA 3KP3A 2QSGX 3KP2A 1ZN2A 2LLKA 3KYCB 3ML6A 2PJRB 2I5UA 1OLTA 3ZN0A 3V7RA 3LA3A 4H4KC 4F52A 4BGDA 1TL8A 4ZZLA 3M1EA 3CCUI 2F5CA 1YW9A 5CPRB 2VUMJ 2BXZA 3QYFA 2JA7J 3U1KA 1VTNC 3KYDB 1PUEE 2IA1A 3QP6A 2NVTJ 2BVLA 3FX3A 5FFZA 4M6XA 1KU9A 1TTYA 3BTIA 3HSFA 4CZCA 3S3OA 2STTA 2E2IJ 1ZGAA 3TW6A 4HDVA 3WU2C 4RBOA 3ISPA 5F0CA 1O7LA 4G6TB 2LREA 4U0YA 1QNTA 3E7LA 4FISA 1R1UA 5HDKA 4CCKA 2KT0A 4XL9A 3TP0A 3K4KA 1JJ6C 1SD7A 4KN4X 3HYIA 2R7OA 4D5CA 4D7NA 1U9OA 2EIKH 1MZBA 5BPDA 4IHTA 3QOEA 1FOYA 3MN2A 5KCMA 2BW3A 4PFOA 4LB5A 3CZ6A 3HRTA 4P55A 2VN2A 3V7CA 1NK3P 1E3HA 5EEAA 2VIXA 4P5OA 2BE5F 2CH0A 4GFBA 2XF5A 4PJJA 3SFIA 1XB4A 3JRCA 1KU7A 3KCCA 3W2VA 4A3DJ 4EJVA 3H5NA 2XF6A 3FXMA 2L7FP 2WY8Q 3H5RA 3NARA 1BC8C 4XKWA 3H0GJ 1JKRC 1B59A 3K4CA 2UZKA 2WAQN 3A03A 4MHGA 3GMEA 4XLFA 2Y9ZA 1ITYA 4C30A 1LVKA 2NS0A 3IAS2 3HKZN 1FEXA 4PGHA 3KP5A 4QTRA 1ZQ3P 1HDPA 1XX5A 4L9NA 3OR1C 4EGYA 4KIGA 4CCLA 1ZHFA 2X48A 2E2JJ 2D5VA 2HXIA 1WJFA 1QGPA 5GADJ 2VI6A 4BS9A 2ADUA 4X0GA 4BNCA 1T39A 3WG9A 4KIFA 3CUQA 3BLYA 3I5UA 1RC9A 3TEDA 1PVEA 3BROA 2MSYA 3DPTA 4L9VA 3H3ZA 2I8DA 3HTUA 4XK4A 5D5VB 1Z9CA 1HW2A 3M4OJ 1JHHA 2EZKA 2HOAA 2JPBA 2JVGA 2QWWA 3ZPLA 3C2BA 2DT5A 4MNUA 2FOWA 1LDKB 5FLXK 1WJDA 5FKMA 2LTPA 2UXXA 1JTYA 3ZQHA 4FT8A 1W36D 1LE8B 3PM1A 2CQQA 4ON0A 4TV7A 4NQWA 3OIOA 3RZDJ 2HYJA 3QPSA 3BY6A 2LBFA 5CVUA 2A68F 3WTVC 1JE8A 1REPC 1IF1A 5L3GA 2A69F 2QF7A 4CDGA 2IXSA 1YIJI 4C2UA 1VNDA 1M1EB 3JCUC 4U0VA 4B48A 2VPRA 4BQAA 4Q48A 3KP4A 4XLPF 5J1UA 1B4AA 2CFOA 1MBKA 2QQ9A 5H6QA 3FISA 2QBYA 2DA2A 5JR3A 4MQVA 4R79A 2F4IA 1W0TA 5ERIA 3IAM2 3E5UA 3GO5A 4A3EJ 1JT6A 2FUG2 2XGCA 3BR5A 4J19A 4KIBA 3WG7H 4L9JA 3TGNA 1VQMI 1J09A 3RKQA 1MNDA 2P7VB 3ZCOA 3L1PA 2ZFWA 2X85A 2E60A 4Y13A 3ZQFA 3GVAA 5IP9J 1YIOA 2V26A 1TWHJ 4G7OF 3VFZA 3BPVA 5KAFC 2CQ7A 2LNBA 4CHUA 5DEQA 4A0ZA 2ZJRF 3HJEA 1B6AA 2PMZN 1D8JA 4EATA 3AG1H 3WODF 1ORKA 2R7FA 4GXOA 1FOWA 2DK5A 3JRGA 4XRFA 1K79A 3QOPA 5CVIA 5FD6A 3TKYA 1K78A 3CESA 1PUFA 1FP1D 2MYSA 2J5OA 4XRSA 2CU7A 4AVPA 2HU9A 2ID6A 4AVZA 1MMAA 2NVXJ 1D0YA 1O7FA 2OD5A 2ZXIA 3ZXSA 3ZGKA 2MA3A 2O03A 2CO5A 2HQRA 1QU3A 3V8KA 3S1RJ 2EWNA 5AIPA 3TQNA 5FLXZ 2FNPA 1DPRA 2ZO4A 3E0JB 4PDKA 1UG2A 4XBFA 1W5TA 1VQ7I 5L3EA 2ZMEB 2HTSA 3M7GA 3WTTC 3B6CA 2DN0A 4W97A 1GXQA 4BXXJ 1ZYRF 2CUEA 3BTCA 1UMQA 3C3WA 2VJ5A 4H0EA 2HPMA 1RIOH 1HKSA 3EYIA 4B4CA 2ZXJA 1Z3XA 3GEZA 2H27A 3HOXJ 4RAFA 1AA7A 2FD5A 1X3ZB 2LY2A 4IF4A 1IUFA 3L00A 3JRAA 3SHFA 2HGCA 4A6EA 3BCAA 3FKJA 2HR3A 1P4AA 1DDNA 1YW8A 5IT9Z 1AKHA 1RZ4A 2P4WA 5ICGA 4I02A 4U0WA 3GBGA 3BQYA 2IA0A 3RYPA 2R7WA 4HA8A 2M5WA 2XDVA 2YX4A 2OJED 5L3DA 3SEQA 4XONA 2NRAC 2CW8A 3ABKH 2KJBA 4F3QA 1YRNA 3GZ5A 4KUMA 1X3UA 3K1PA 4UB6C 1FJLA 4M6VA 1DGWY 2LK2A 4WXCA 3K9TA 4A3LJ 4MTEA 3O8HA 5E17F 4HNTA 3QP5A 3VYTB 4XLHA 3BG3A 1X1AA 1C0WA 2GWRA 2QQBA 3H5AA 5E18F 4HDUA 1N25A 2XVCA 2D1HA 1VQ9I 2ME0A 1RR8C 2KDOA 2BEOA 2BGCA 1XDUA 2ZBKA 3HHHA 5A2QZ 4DOZA 1QZYA 2DYSH 4BY7J 5HNHA 1VFCA 2R7XA 3FBNB 3CJRB 1FP2A 1I3QJ 1OKRA 4FASD 1P7IA 4K2EA 5JFRA 3CD6I 3CCJI 2P6TA 5KHDA 2M7AA 1GLNA 4BY1J 5E3OA 1SFOJ 2Q0OA 1TWCJ 2RREA 2D45A 2KL4A 4UUSA 3VSLA 1BR1A 2ECCA 2ELJA 1RUOA 1TWGJ 1E3PA 4I98B 4ZDPA 2HVSA 3GX4X 2YUSA 5LGTA 1SVOA 2FMLA 2Z16A 3IH2A 2DW4A 2HVQA 4F93B 2HTJA 2WA0A 4BXFA 3IP4B 4CUGA 2ZJPF 5LD2C 1QBJA 1O57A 1ZG5A 1TW3A 2LRDA 1ODDA 5JLWA 4LGWA 2QM3A 2QKMB 1S6LA 2E2HJ 2L7ZA 2NVYJ 2K3FA 4HG2A 3SZGA 3MWMA 4G8XA 5D8KB 5LHIA 2AXTC 4IHYA 3Q9VA 2BVMA 5E3NA 1QA6A 5K5OA 3HTSB 2R93J 5BOXA 3S1NJ 4V2GA 2HKOA 2VT2A 2M8EA 1MD0A 3CCMI 3A0HC 2P8TA 2F48A 2A05A 1P2FA 1CQTA 4BE0A 3BJ6A 3HBLA 2V1DA 4PFPA 5L3CA 1B9MA 3S16J 2XPWA 4IPAA 4U7DA 5LEJA 5FGMA 3KZZA 1HSTA 4LLGF 5IYDJ 1ETVA 2OA4A 3HSEA 4PJNA 1DU6A 5GAGJ 1VQOI 2QGUA 2EJRA 4RLQA 2DMNA 3RPQA 4M72A 2CSOA 1OR7C 2JK3A 1L0OC 2HWVA 3AAFA 4M3DA 1EJ9A 2NOJB
chains in the Genus database with same CATH topology
4U88A 2GAUA 5E1ZB 3DF8A 4ZYDA 2OBPA 3CUQC 1Z6TA 2HDCA 3B02A 3CJNA 4NB5A 5F6FA 3ULQB 1XMAA 2L4MA 2O3FA 1S7AA 3IHUA 2DAOA 2G7HA 3V8LA 2VBWA 3T8TA 4HAMA 4HBLA 5AONA 3B73A 5HVQC 2DTRA 1RUNA 1FLIA 3Q9SA 5KK1A 1SD5A 3I59A 2CQKA 2KRFA 2GXBA 4RS8A 4CYDA 1XSXA 3E6DA 3CLOA 3O3KA 3Q5FA 4DNCA 3IWZA 1W7PB 2JTVA 1E2XA 1KU2A 3KP6A 4HYEA 1H9TA 3BWGA 3HSRA 3HRSA 3GWZA 2JPCA 4G9YA 1I6XA 2ACJA 2IRFG 2FBHA 1GXPA 3V8JA 4IVNA 2XAGA 1FBQA 4HF2A 4I0AA 1IRFA 2IVMA 1HBXG 1USTA 2V1UA 2FE3A 5LLQA 4GGGA 3NEUA 2VXZA 2LSOA 2O8XA 1BM9A 3I54A 3SZPA 2FU4A 4YG2F 5IT9K 2VOOA 3L7WA 4Q47A 3IWFA 1W7PD 3BOQA 4N9HA 3ZMTA 2XGXA 1R23A 5DYMA 4HX7A 3S2WA 5JVTA 4O5VA 2XROA 1G4DA 1ZREA 1J59A 3DP7A 2OZUA 1TLHB 2XAJA 3MEXA 3R60A 1IN7A 3WTUC 3FMSA 1S8NA 3EYYA 1ZH5A 3F22A 1BJAA 1ONVA 2W57A 2Z33A 2EK5A 3E6CC 2VBXA 1SFXA 2FSWA 1JHFA 3RKXA 4CICA 4MEYF 4ZZDA 3K2ZA 3E5QA 1EH6A 3F8CA 2F2EA 2EFOA 5LHHA 1JXSA 2TDXA 4R1HA 4I09A 3SXYA 3N97A 2QQAA 2KKOA 1SMTA 3MAJA 4DQ2A 4I01A 1FC3A 2YX7A 3GFMA 1R5HA 2DU9A 1SD6A 1LDDA 1KGSA 2FEZA 2LDUA 3KEQA 2F5FA 2Z99A 1LB2A 2DPUA 2X4HA 2RQPA 2D1VA 3MFKA 3P9CA 2L02A 3LA2A 4HF1A 2IW5A 5D6EA 1XDSA 4HX8A 1G3TA 2B0LA 5BQTA 1FYMA 2HQNA 5DCFA 1U5TC 4WK8F 1U78A 2JT1A 3F6OA 3W6KB 1DUXC 4JQFA 2G9WA 2Z5UA 5BPIA 4GO1A 3VEPA 3T5XA 1XGOA 3KE2A 5E20A 5ILUA 3J7AO 4FHTA 4Y15A 2D2WA 2RKHA 4WCGA 1P6RA 4G7ZF 1FPQA 1QPMA 2DK8A 1XSVA 2FF4A 3BPXA 1SMYF 3CDHA 1IRGA 4HLXA 1L3LA 3LSTA 3JAMZ 3L09A 2MLKA 5ICEA 4KMFA 4JK1X 3E6MA 2DLLA 2WTEA 1TQPA 3IL2A 4RB3C 4CXFA 1OYWA 3E6BA 3OOPA 5DUKA 1FT9A 1TW2A 2CWEA 3I59B 4YIIA 1UHWA 4EM2A 3KLOA 3BJAA 1BIBA 3HRUA 3ZQ7A 3WE2A 2XUBA 3DXJF 5DUIA 1G3WA 2ZMEA 2JRTA 1EV7A 3L9FA 2NNNA 2P5KA 3E3VA 4FX0A 1K6OA 2IA2A 3PQKA 1UHMA 3FWEA 4RGUA 1KU3A 2UWMA 1R22A 3DKWA 5D6FA 3NRVA 3CUQB 3ZMVA 2CGPA 1ZRCA 1F4KA 5HDGA 4UVBA 1QZZA 3RYRA 2KIMA 2Y48A 2HYGD 2YSRA 4RB2C 3CO7C 3NQOA 3F72A 4LFUA 2R7DA 4A12A 5HS7A 2K7LA 2PFBA 4AIJA 5L3FA 4BHCA 4MEXF 4F7ZA 1W5SA 1J0RA 3WTYC 5ICCA 4R8HA 1J2XA 2BBYA 4KYWA 4OMZA 2V9VA 4CO8A 2GXGA 1ON2A 2BYVE 2RN7A 2RC4A 2W84A 4IRGA 3ZMZA 4KICA 3J80K 4EMSA 4HF0A 4RGSA 1BI3A 1K7AA 2FMYA 1P4WA 1Z6RA 1USSA 2DBBA 4M73A 3EDPA 3GLXA 4EQQA 4CGZA 2ETHA 4RB1A 2AXLA 1IN6A 4IXAA 3HOTA 4ESFA 2PG4A 1R7JA 1R5GA 2P5VA 1OMIA 2VODA 2ZCWA 1LQ1A 1BIAA 4IJAA 5JI6A 2QZ8A 4M74A 2ZNYA 3BZ6A 1G6NA 4D0PA 2MLGA 2QLZA 4LB6B 5ILVA 1DP7P 4XSXF 2UXNA 5ED4A 1FY7A 2H09A 1MJ9A 2PJPA 2QENA 1Z05A 3WGIA 4A0YA 4EJWA 4MGRA 2H94A 1PDNC 2HZTA 1GVJA 4UVAA 1DPUA 4Z2YA 4OINF 3TO6A 3HOSA 4LMYA 5LBQA 2V79A 3KFWX 4KN7X 1QO0D 1FOKA 2H6BA 4BAYA 5HLHA 1FSHA 3L2CA 1XN7A 3D0SA 4G94A 4HV6A 2JSCA 3F8MA 2P5LC 5H20A 3HIFA 2VBZA 4LG0B 2P7CB 1J9IA 5J6XA 5TRDA 2AS5F 3I64A 4HW0A 2A3SA 3FXRA 2G7UA 2M30A 4GYGA 2A5YB 3I4PA 1YLFA 3K0LA 3K69A 2O0YA 1MJAA 1D3YA 1H9GA 3CUOA 1I1SA 2M45A 2HYFA 5CLSA 4IHSA 4HX4A 4I2OA 3LAJA 3IKTA 3GFJA 1ULYA 1U5TB 2QUFA 3TOBA 1FBUA 1SFEA 4P9UA 3BJOA 4GYIA 1YTYA 4P9FA 2NAZA 5BS6A 4Q4ZF 4EM1A 1FSEA 2QYOA 2GA1A 2VBYA 1R58A 1FYKA 1T2KA 1MDMB 5ICFA 4ENJA 2F5DA 4ENNA 2IP2A 2VONA 4BXUA 2L4AA 2COMA 3REOA 1FNNA 1G3SA 3RTRA 4MQ9F 5D5XB 3M9AA 3V7SA 1STZA 2FBIA 3QPHA 4I7HA 2E7WA 3QPTA 3ZMUA 2W85A 2DO7A 2HS5A 1O3RA 1SD4A 4KMUX 1I5ZA 3JW4A 5FFXA 1R1TA 4RAYA 1FYLA 1KYWA 1S29A 2M1BA 2FA5A 1KA8A 2STWA 3BP8A 2A61A 3MQ0A 4YFKF 5HS8A 1XGNA 3JTHA 2DI3A 1O3QA 2WWYA 2KIFA 1BI1A 3CO6C 4G7HF 1XCVA 2MC3A 3PFIA 1W7PA 4AIHA 4LK0F 2YR2A 4BHBA 1V4RA 1IXCA 3GXOA 5AIQA 1YQAA 3GFIA 2DQRA 3FXUA 4Y17A 3V4GA 4EGZA 2OQRA 2CFXA 4B8XA 1BI0A 4PCQA 2J5PA 4EVIA 2NYXA 3FF5A 3PQJA 1LEAA 3CTAA 3O6BB 3ZP5A 1XMKA 1MJBA 2RGVA 3ECHA 2IJLA 5FO5A 4ZYHA 1BN5A 2K4BA 1WSUA 1F1ZA 1I1GA 2XHKA 1BC7C 1IW7F 1Z91A 1UCRA 3TO7A 1B9NA 4ESJA 1WQ2A 3WTXC 1IN5A 4RAZA 1IAWA 4WWCA 2Y75A 5DD4A 5FD5A 1GHCA 2EA4A 3IKVA 1ZLJA 1E17A 3P7NA 5D4RA 3F23A 2EFWA 2PQ8A 1TBXA 5J8CA 1KQ0A 2ZNZA 2EFNA 4YFXF 1FZPB 1YFHA 5K5QA 2V1XA 2O61A 2CYYA 1U2WA 5DD8A 2XKPA 2O6GE 1IUYA 2PN6A 5D5UB 2H6CA 2IPQX 4L0YB 1J7KA 2PBIA 3KLNA 2XASA 5FB2A 1WI9A 2OAZA 1YG2A 2Z9OA 4LLNA 3KZYA 3ABTA 2E1NA 5BMZA 1LNWA 5DCMB 2P6SA 2Q8KA 1WWXA 4ETSA 3MZYA 1OPCA 2MD5A 3LQRA 2MBFA 4PZJA 3QRFF 5E1XA 3O2PE 3EUHA 4QLCU 3F8NA 3HUGA 1SAXA 3F3XA 1Z1DA 2DFIA 5LGNA 4OIRF 4HQMA 4KT5C 4N0BA 3ERED 1HKTA 3F8FA 3ELKA 1U5TA 1MGTA 3RKWA 5TJJA 1ZLKA 1R1VA 4OMYA 5LGUA 3LA7A 4LD5A 3WGGA 1QQIA 2K4JA 4S04A 4AWXB 2FQ3A 3RKYA 4QWQA 4A5NA 4EJOA 3GFLA 4CZZA 1TQMA 1MKMA 3WTWC 4G6QA 2L54A 4KA4A 5LEKA 2KJCA 1LVAA 4HV5A 2HEOA 1YYVA 5LRSA 3HRMA 1KYZA 2EFQA 3JSPA 1CF7A 4UV8A 3IRQA 1TNSA 4L5IA 4EM0B 3HHGA 2NNYA 1I27A 3QU6A 5DV5A 5EEGA 2K02A 3GUDA 3LFKA 3FHZA 2PLYA 1TNTA 4NHJA 4UV9A 2JZYA 5L3BA 2WC2A 2VOPA 5J8FA 2PI0A 4HZFA 3RJPA 3FM5A 4BH9A 1A04A 2A07F 4A6DA 4M71A 2GZWA 3GZ6A 2EB7A 3BDDA 4M6YA 3C7JA 3F8BA 1HXDA 2MH9A 3I58A 4OOIA 5ILSA 3JAMK 1XGMA 3MZHA 2ISYA 4PGGA 3K1MA 1R36A 3R4KA 1OYIA 3R0JA 3M8FA 5LRRA 4U7BA 1XGSA 5CVJA 4S05A 3ZMDA 2RDPA 1HKQA 1ON1A 5F1RA 1F5TA 4O3MA 1Y0UA 2XRNA 1O3SA 3P9IA 2HKXA 2ZKZA 2CW0F 4A0XA 2Z3YA 5IT3A 4L9TA 4EV0A 5HOOA 3WU0A 4EJTA 3G3ZA 1EH8A 3GW2A 1T38A 2ISZA 4ASNA 2YPRA 2FNAA 1XCBA 1PP8F 3DPLC 5JHUA 2A6HF 5D8LB 3ZN1A 4P96A 5CJ9A 1YS7A 4IRIA 2VC0A 4OIOF 1J5YA 2X0LA 2EFPA 2Y0MA 1FWZA 3TO9A 6PAXA 2ESHA 1XD7A 1V3FA 4ESBA 2EA2A 2HOEA 3FMQA 5HLIA 5F64A 4LLLA 2GIVA 2M87A 5DDGA 2XAHA 3D5LA 5E1WA 3WTSC 1MDMA 1FX7A 2ZJ2A 5E8IA 3T8RA 2CG4A 4IRHA 2Q2EA 3OV8A 5D4SA 2R3SA 1SFUA 4GCVA 2K27A 1S3JA 2OU2A 5CVRA 1LDJA 2E1CA 1S7OA 2FOKA 2RVCA 3TDZC 2QBYB 3WU1B 1YO5C 1JGSA 3SFZA 4KDPA 3ABUA 2OQGA 2PMHA 3ECOA 4FX4A 1UB9A 5HS9A 3FZVA 3U9GA 4MTDA 1CGPA 1R00A 3E97A 4OU0A 3C18A 3RIRA 1TQIA 4RB0A 1RNLA 4ZH4F 4BHPA 1K78B 2YU3A 3VOEA 2FRHA 2XAQA 2C6YA 4LG0A 5KVRA 2XV4S 4EJUA 2A6EF 1IXSB 3COAC 5HDNA 2MH2A 4KFCA 3K1NA 3F6VA 3KETA 1UFMA 4ENMA 1Z7UA 2KIUA 3FMRA 4LK1F 3E5XA 3MCZA 1P92A 2GA2A 4WXHA 3I71A 3VODA 3EETA 4RGXA 1CF7B 5HLGA 3SQNA 4A2UA 2L3DA 3R0AA 4E70A 1ZGJA 1RI7A 3U1DA 4O6JA 2IT0A 4Q5SF 3QU3A 3U2RA 1EH7A 4M9SA 4KNYA 4OIPF 2WV0A 4YFNF 5A2QK 1Q1HA 3FXQA 2DQLA 2FXAA 3WTZA 3EQLF 2XKOA 4N9IA 2PMUA 1F9NA 4M9ZA 5EEHA 1AOYA 1KQ8A 2VC1A 2VE9A 4LJZF 4UUVA 2GQQA 3C1DA 4AD9A 3I0TA 2LKPA 2LF7A 1ZARA 4XLNF 3TOAA 3N4MA 2RV8A 1ZRDA 3ROUA 2LF8A 2ESNA 3ZMSA 1PP7U 4B09A 3M8EA 3J80Z 3DQVC 4I0BA 3LAPA 1IN8A 4YIFA 4ZYEA 1H0MA 1IZ1A 3H3UA 5CVVA 1OR7A 3I53A 3F21A 2BV6A 1BI2A 1ZG1A 1FBSA 2PEXA 4RGRA 1U6GA 5K1YA 5DCMA 1HSJA 3GF2A 1P4XA 1WRJA 3T0YA 3H92A 3IC7A 4OIQF 3JSOA 4L18B 3KEOA 5D5WB 3DV8A 5E8GA 3RDIA 3WGHA 4HOBA 5H6RA 3R6SA 4WXDA 3VB2A 4M9XA 2RNJA 4ZYGA 4A5MA 3SZTA 1W4MA 1HQCA 3J81Z 2W24A 4UXNA 1J75A 2K86A 2W25A 3LQQA 1HW5A 4WF2A 4BYYA 1ZG3A 4XSZF 5CYVA 1IN4A 2EV6A 1U3EM 3JTGA 3T1BA 4ENKA 4AIKA 3R61A 2XIGA 2VT3A 2EV0A 3GYHX 4L0ZB 1T98A 3WE3A 3FM3A 3P9KA 4UNOA 1U8RA 2EV5A 2E7XA 1O3TA 2QVOA 2VE8A 1AWCA 4UVCA 3RI4A 1IXRC 4L5JA 4HLYA 1D8KA 3LWFA 3QAHA 2HFHA 1ZRFA 2OZ6A 1BBYA 1ZAOA 1YW7A 1KQ9A 3G73A 2V6CA 2DPDA 4G6DA 2XAFA 1XSDA 5K5RA 3DFGA 1OYYA 3RPUA 2FBKA 3TDUC 3W6JB 2ELHA 1T0FA 2F5EA 1T6SA 4UHTA 5LHGA 1WKMA 4JBAA 3IRRA 3J81K 1LEBA 3KP7A 1D5VA 1B1BA 1BOAA 4HQEA 1LJ9A 3DEUA 1HW1A 1YS6A 1G3YA 2L01A 4WX9A 1NHAA 3KP3A 3KP2A 1ZN2A 3ML6A 3ZN0A 3V7RA 3LA3A 4ZZLA 3M1EA 2F5CA 1YW9A 1VTNC 1PUEE 2IA1A 3QP6A 5FFZA 3FX3A 4M6XA 1KU9A 1TTYA 3HSFA 2STTA 1ZGAA 4HDVA 3ISPA 1O7LA 4U0YA 1QNTA 5HDKA 1R1UA 1SD7A 4KN4X 3HYIA 1MZBA 5BPDA 4IHTA 4LB5A 3HRTA 4P55A 2VN2A 3V7CA 4P5OA 2BE5F 1XB4A 1KU7A 3KCCA 4EJVA 1BC8C 1B59A 2UZKA 4MHGA 2NS0A 4PGHA 3KP5A 4L9NA 4EGYA 4KIGA 1ZHFA 1QGPA 2ADUA 4BNCA 1T39A 3WG9A 4KIFA 3CUQA 3I5UA 3BROA 3DPTA 4L9VA 5D5VB 3H3ZA 3HTUA 1HW2A 1Z9CA 1JHHA 2JPBA 2QWWA 3ZPLA 2DT5A 4MNUA 1LDKB 5FLXK 2UXXA 4FT8A 4ON0A 4TV7A 4NQWA 3BY6A 5CVUA 1JE8A 2A68F 3WTVC 1REPC 1IF1A 5L3GA 2A69F 4CDGA 4U0VA 4BQAA 4Q48A 3KP4A 4XLPF 1B4AA 2QQ9A 5H6QA 2QBYA 5JR3A 4MQVA 4R79A 5ERIA 3E5UA 3GO5A 4KIBA 4L9JA 3TGNA 2P7VB 2ZFWA 4Y13A 3GVAA 1YIOA 4G7OF 3VFZA 3BPVA 2LNBA 4CHUA 5DEQA 4A0ZA 1B6AA 1D8JA 3WODF 2R7FA 4GXOA 2DK5A 4XRFA 1K79A 3QOPA 5CVIA 5FD6A 3TKYA 1K78A 1FP1D 2J5OA 4AVPA 1O7FA 2OD5A 2MA3A 2O03A 2CO5A 2HQRA 3V8KA 2EWNA 5AIPA 3TQNA 5FLXZ 2FNPA 1DPRA 2ZO4A 4PDKA 4XBFA 1W5TA 5L3EA 2ZMEB 2HTSA 3M7GA 3WTTC 1GXQA 1ZYRF 3C3WA 4H0EA 1RIOH 1HKSA 3EYIA 2ZXJA 3GEZA 2H27A 4IF4A 3L00A 3SHFA 2HGCA 4A6EA 2HR3A 1P4AA 1DDNA 1YW8A 5IT9Z 1RZ4A 2P4WA 5ICGA 4I02A 4U0WA 2IA0A 3RYPA 4HA8A 2M5WA 5L3DA 2YX4A 2NRAC 2KJBA 3GZ5A 4KUMA 1X3UA 3K1PA 4WXCA 3K9TA 4MTEA 5E17F 3QP5A 1C0WA 2GWRA 2QQBA 5E18F 4HDUA 2XVCA 2D1HA 2BEOA 2BGCA 1XDUA 2ZBKA 3HHHA 5A2QZ 1QZYA 1FP2A 1OKRA 4K2EA 5JFRA 2P6TA 2Q0OA 2D45A 1RUOA 4I98B 3GX4X 5LGTA 2FMLA 2DW4A 2HTJA 1QBJA 1O57A 1ZG5A 1TW3A 1ODDA 4LGWA 2QM3A 1S6LA 5D8KB 3MWMA 4G8XA 5LHIA 3Q9VA 5K5OA 3HTSB 5BOXA 2HKOA 2VT2A 2M8EA 1MD0A 2P8TA 1P2FA 3BJ6A 5L3CA 2V1DA 1B9MA 4IPAA 4U7DA 5LEJA 5FGMA 3KZZA 1HSTA 4LLGF 2OA4A 3HSEA 2EJRA 3RPQA 4M72A 2CSOA 1L0OC 2HWVA 3AAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U88 A;  2GAU A;  5E1Z B;  3DF8 A;  4ZYD A;  2OBP A;  3CUQ C;  1Z6T A;  2HDC A;  3B02 A;  3CJN A;  4NB5 A;  5F6F A;  3ULQ B;  1XMA A;  2L4M A;  2O3F A;  1S7A A;  3IHU A;  2DAO A;  2G7H A;  3V8L A;  2VBW A;  3T8T A;  4HAM A;  4HBL A;  5AON A;  3B73 A;  5HVQ C;  2DTR A;  1RUN A;  1FLI A;  3Q9S A;  5KK1 A;  1SD5 A;  3I59 A;  2CQK A;  2KRF A;  2GXB A;  4RS8 A;  4CYD A;  1XSX A;  3E6D A;  3CLO A;  3O3K A;  3Q5F A;  4DNC A;  3IWZ A;  1W7P B;  2JTV A;  1E2X A;  1KU2 A;  3KP6 A;  4HYE A;  1H9T A;  3BWG A;  3HSR A;  3HRS A;  3GWZ A;  2JPC A;  4G9Y A;  1I6X A;  2ACJ A;  2IRF G;  2FBH A;  1GXP A;  3V8J A;  4IVN A;  2XAG A;  1FBQ A;  4HF2 A;  4I0A A;  1IRF A;  2IVM A;  1HBX G;  1UST A;  2V1U A;  2FE3 A;  5LLQ A;  4GGG A;  3NEU A;  2VXZ A;  2LSO A;  2O8X A;  1BM9 A;  3I54 A;  3SZP A;  2FU4 A;  4YG2 F;  5IT9 K;  2VOO A;  3L7W A;  4Q47 A;  3IWF A;  1W7P D;  3BOQ A;  4N9H A;  3ZMT A;  2XGX A;  1R23 A;  5DYM A;  4HX7 A;  3S2W A;  5JVT A;  4O5V A;  2XRO A;  1G4D A;  1ZRE A;  1J59 A;  3DP7 A;  2OZU A;  1TLH B;  2XAJ A;  3MEX A;  3R60 A;  1IN7 A;  3WTU C;  3FMS A;  1S8N A;  3EYY A;  1ZH5 A;  3F22 A;  1BJA A;  1ONV A;  2W57 A;  2Z33 A;  2EK5 A;  3E6C C;  2VBX A;  1SFX A;  2FSW A;  1JHF A;  3RKX A;  4CIC A;  4MEY F;  4ZZD A;  3K2Z A;  3E5Q A;  1EH6 A;  3F8C A;  2F2E A;  2EFO A;  5LHH A;  1JXS A;  2TDX A;  4R1H A;  4I09 A;  3SXY A;  3N97 A;  2QQA A;  2KKO A;  1SMT A;  3MAJ A;  4DQ2 A;  4I01 A;  1FC3 A;  2YX7 A;  3GFM A;  1R5H A;  2DU9 A;  1SD6 A;  1LDD A;  1KGS A;  2FEZ A;  2LDU A;  3KEQ A;  2F5F A;  2Z99 A;  1LB2 A;  2DPU A;  2X4H A;  2RQP A;  2D1V A;  3MFK A;  3P9C A;  2L02 A;  3LA2 A;  4HF1 A;  2IW5 A;  5D6E A;  1XDS A;  4HX8 A;  1G3T A;  2B0L A;  5BQT A;  1FYM A;  2HQN A;  5DCF A;  1U5T C;  4WK8 F;  1U78 A;  2JT1 A;  3F6O A;  3W6K B;  1DUX C;  4JQF A;  2G9W A;  2Z5U A;  5BPI A;  4GO1 A;  3VEP A;  3T5X A;  1XGO A;  3KE2 A;  5E20 A;  5ILU A;  3J7A O;  4FHT A;  4Y15 A;  2D2W A;  2RKH A;  4WCG A;  1P6R A;  4G7Z F;  1FPQ A;  1QPM A;  2DK8 A;  1XSV A;  2FF4 A;  3BPX A;  1SMY F;  3CDH A;  1IRG A;  4HLX A;  1L3L A;  3LST A;  3JAM Z;  3L09 A;  2MLK A;  5ICE A;  4KMF A;  4JK1 X;  3E6M A;  2DLL A;  2WTE A;  1TQP A;  3IL2 A;  4RB3 C;  4CXF A;  1OYW A;  3E6B A;  3OOP A;  5DUK A;  1FT9 A;  1TW2 A;  2CWE A;  3I59 B;  4YII A;  1UHW A;  4EM2 A;  3KLO A;  3BJA A;  1BIB A;  3HRU A;  3ZQ7 A;  3WE2 A;  2XUB A;  3DXJ F;  5DUI A;  1G3W A;  2ZME A;  2JRT A;  1EV7 A;  3L9F A;  2NNN A;  2P5K A;  3E3V A;  4FX0 A;  1K6O A;  2IA2 A;  3PQK A;  1UHM A;  3FWE A;  4RGU A;  1KU3 A;  2UWM A;  1R22 A;  3DKW A;  5D6F A;  3NRV A;  3CUQ B;  3ZMV A;  2CGP A;  1ZRC A;  1F4K A;  5HDG A;  4UVB A;  1QZZ A;  3RYR A;  2KIM A;  2Y48 A;  2HYG D;  2YSR A;  4RB2 C;  3CO7 C;  3NQO A;  3F72 A;  4LFU A;  2R7D A;  4A12 A;  5HS7 A;  2K7L A;  2PFB A;  4AIJ A;  5L3F A;  4BHC A;  4MEX F;  4F7Z A;  1W5S A;  1J0R A;  3WTY C;  5ICC A;  4R8H A;  1J2X A;  2BBY A;  4KYW A;  4OMZ A;  2V9V A;  4CO8 A;  2GXG A;  1ON2 A;  2BYV E;  2RN7 A;  2RC4 A;  2W84 A;  4IRG A;  3ZMZ A;  4KIC A;  3J80 K;  4EMS A;  4HF0 A;  4RGS A;  1BI3 A;  1K7A A;  2FMY A;  1P4W A;  1Z6R A;  1USS A;  2DBB A;  4M73 A;  3EDP A;  3GLX A;  4EQQ A;  4CGZ A;  2ETH A;  4RB1 A;  2AXL A;  1IN6 A;  4IXA A;  3HOT A;  4ESF A;  2PG4 A;  1R7J A;  1R5G A;  2P5V A;  1OMI A;  2VOD A;  2ZCW A;  1LQ1 A;  1BIA A;  4IJA A;  5JI6 A;  2QZ8 A;  4M74 A;  2ZNY A;  3BZ6 A;  1G6N A;  4D0P A;  2MLG A;  2QLZ A;  4LB6 B;  5ILV A;  1DP7 P;  4XSX F;  2UXN A;  5ED4 A;  1FY7 A;  2H09 A;  1MJ9 A;  2PJP A;  2QEN A;  1Z05 A;  3WGI A;  4A0Y A;  4EJW A;  4MGR A;  2H94 A;  1PDN C;  2HZT A;  1GVJ A;  4UVA A;  1DPU A;  4Z2Y A;  4OIN F;  3TO6 A;  3HOS A;  4LMY A;  5LBQ A;  2V79 A;  3KFW X;  4KN7 X;  1QO0 D;  1FOK A;  2H6B A;  4BAY A;  5HLH A;  1FSH A;  3L2C A;  1XN7 A;  3D0S A;  4G94 A;  4HV6 A;  2JSC A;  3F8M A;  2P5L C;  5H20 A;  3HIF A;  2VBZ A;  4LG0 B;  2P7C B;  1J9I A;  5J6X A;  5TRD A;  2AS5 F;  3I64 A;  4HW0 A;  2A3S A;  3FXR A;  2G7U A;  2M30 A;  4GYG A;  2A5Y B;  3I4P A;  1YLF A;  3K0L A;  3K69 A;  2O0Y A;  1MJA A;  1D3Y A;  1H9G A;  3CUO A;  1I1S A;  2M45 A;  2HYF A;  5CLS A;  4IHS A;  4HX4 A;  4I2O A;  3LAJ A;  3IKT A;  3GFJ A;  1ULY A;  1U5T B;  2QUF A;  3TOB A;  1FBU A;  1SFE A;  4P9U A;  3BJO A;  4GYI A;  1YTY A;  4P9F A;  2NAZ A;  5BS6 A;  4Q4Z F;  4EM1 A;  1FSE A;  2QYO A;  2GA1 A;  2VBY A;  1R58 A;  1FYK A;  1T2K A;  1MDM B;  5ICF A;  4ENJ A;  2F5D A;  4ENN A;  2IP2 A;  2VON A;  4BXU A;  2L4A A;  2COM A;  3REO A;  1FNN A;  1G3S A;  3RTR A;  4MQ9 F;  5D5X B;  3M9A A;  3V7S A;  1STZ A;  2FBI A;  3QPH A;  4I7H A;  2E7W A;  3QPT A;  3ZMU A;  2W85 A;  2DO7 A;  2HS5 A;  1O3R A;  1SD4 A;  4KMU X;  1I5Z A;  3JW4 A;  5FFX A;  1R1T A;  4RAY A;  1FYL A;  1KYW A;  1S29 A;  2M1B A;  2FA5 A;  1KA8 A;  2STW A;  3BP8 A;  2A61 A;  3MQ0 A;  4YFK F;  5HS8 A;  1XGN A;  3JTH A;  2DI3 A;  1O3Q A;  2WWY A;  2KIF A;  1BI1 A;  3CO6 C;  4G7H F;  1XCV A;  2MC3 A;  3PFI A;  1W7P A;  4AIH A;  4LK0 F;  2YR2 A;  4BHB A;  1V4R A;  1IXC A;  3GXO A;  5AIQ A;  1YQA A;  3GFI A;  2DQR A;  3FXU A;  4Y17 A;  3V4G A;  4EGZ A;  2OQR A;  2CFX A;  4B8X A;  1BI0 A;  4PCQ A;  2J5P A;  4EVI A;  2NYX A;  3FF5 A;  3PQJ A;  1LEA A;  3CTA A;  3O6B B;  3ZP5 A;  1XMK A;  1MJB A;  2RGV A;  3ECH A;  2IJL A;  5FO5 A;  4ZYH A;  1BN5 A;  2K4B A;  1WSU A;  1F1Z A;  1I1G A;  2XHK A;  1BC7 C;  1IW7 F;  1Z91 A;  1UCR A;  3TO7 A;  1B9N A;  4ESJ A;  1WQ2 A;  3WTX C;  1IN5 A;  4RAZ A;  1IAW A;  4WWC A;  2Y75 A;  5DD4 A;  5FD5 A;  1GHC A;  2EA4 A;  3IKV A;  1ZLJ A;  1E17 A;  3P7N A;  5D4R A;  3F23 A;  2EFW A;  2PQ8 A;  1TBX A;  5J8C A;  1KQ0 A;  2ZNZ A;  2EFN A;  4YFX F;  1FZP B;  1YFH A;  5K5Q A;  2V1X A;  2O61 A;  2CYY A;  1U2W A;  5DD8 A;  2XKP A;  2O6G E;  1IUY A;  2PN6 A;  5D5U B;  2H6C A;  2IPQ X;  4L0Y B;  1J7K A;  2PBI A;  3KLN A;  2XAS A;  5FB2 A;  1WI9 A;  2OAZ A;  1YG2 A;  2Z9O A;  4LLN A;  3KZY A;  3ABT A;  2E1N A;  5BMZ A;  1LNW A;  5DCM B;  2P6S A;  2Q8K A;  1WWX A;  4ETS A;  3MZY A;  1OPC A;  2MD5 A;  3LQR A;  2MBF A;  4PZJ A;  3QRF F;  5E1X A;  3O2P E;  3EUH A;  4QLC U;  3F8N A;  3HUG A;  1SAX A;  3F3X A;  1Z1D A;  2DFI A;  5LGN A;  4OIR F;  4HQM A;  4KT5 C;  4N0B A;  3ERE D;  1HKT A;  3F8F A;  3ELK A;  1U5T A;  1MGT A;  3RKW A;  5TJJ A;  1ZLK A;  1R1V A;  4OMY A;  5LGU A;  3LA7 A;  4LD5 A;  3WGG A;  1QQI A;  2K4J A;  4S04 A;  4AWX B;  2FQ3 A;  3RKY A;  4QWQ A;  4A5N A;  4EJO A;  3GFL A;  4CZZ A;  1TQM A;  1MKM A;  3WTW C;  4G6Q A;  2L54 A;  4KA4 A;  5LEK A;  2KJC A;  1LVA A;  4HV5 A;  2HEO A;  1YYV A;  5LRS A;  3HRM A;  1KYZ A;  2EFQ A;  3JSP A;  1CF7 A;  4UV8 A;  3IRQ A;  1TNS A;  4L5I A;  4EM0 B;  3HHG A;  2NNY A;  1I27 A;  3QU6 A;  5DV5 A;  5EEG A;  2K02 A;  3GUD A;  3LFK A;  3FHZ A;  2PLY A;  1TNT A;  4NHJ A;  4UV9 A;  2JZY A;  5L3B A;  2WC2 A;  2VOP A;  5J8F A;  2PI0 A;  4HZF A;  3RJP A;  3FM5 A;  4BH9 A;  1A04 A;  2A07 F;  4A6D A;  4M71 A;  2GZW A;  3GZ6 A;  2EB7 A;  3BDD A;  4M6Y A;  3C7J A;  3F8B A;  1HXD A;  2MH9 A;  3I58 A;  4OOI A;  5ILS A;  3JAM K;  1XGM A;  3MZH A;  2ISY A;  4PGG A;  3K1M A;  1R36 A;  3R4K A;  1OYI A;  3R0J A;  3M8F A;  5LRR A;  4U7B A;  1XGS A;  5CVJ A;  4S05 A;  3ZMD A;  2RDP A;  1HKQ A;  1ON1 A;  5F1R A;  1F5T A;  4O3M A;  1Y0U A;  2XRN A;  1O3S A;  3P9I A;  2HKX A;  2ZKZ A;  2CW0 F;  4A0X A;  2Z3Y A;  5IT3 A;  4L9T A;  4EV0 A;  5HOO A;  3WU0 A;  4EJT A;  3G3Z A;  1EH8 A;  3GW2 A;  1T38 A;  2ISZ A;  4ASN A;  2YPR A;  2FNA A;  1XCB A;  1PP8 F;  3DPL C;  5JHU A;  2A6H F;  5D8L B;  3ZN1 A;  4P96 A;  5CJ9 A;  1YS7 A;  4IRI A;  2VC0 A;  4OIO F;  1J5Y A;  2X0L A;  2EFP A;  2Y0M A;  1FWZ A;  3TO9 A;  6PAX A;  2ESH A;  1XD7 A;  1V3F A;  4ESB A;  2EA2 A;  2HOE A;  3FMQ A;  5HLI A;  5F64 A;  4LLL A;  2GIV A;  2M87 A;  5DDG A;  2XAH A;  3D5L A;  5E1W A;  3WTS C;  1MDM A;  1FX7 A;  2ZJ2 A;  5E8I A;  3T8R A;  2CG4 A;  4IRH A;  2Q2E A;  3OV8 A;  5D4S A;  2R3S A;  1SFU A;  4GCV A;  2K27 A;  1S3J A;  2OU2 A;  5CVR A;  1LDJ A;  2E1C A;  1S7O A;  2FOK A;  2RVC A;  3TDZ C;  2QBY B;  3WU1 B;  1YO5 C;  1JGS A;  3SFZ A;  4KDP A;  3ABU A;  2OQG A;  2PMH A;  3ECO A;  4FX4 A;  1UB9 A;  5HS9 A;  3FZV A;  3U9G A;  4MTD A;  1CGP A;  1R00 A;  3E97 A;  4OU0 A;  3C18 A;  3RIR A;  1TQI A;  4RB0 A;  1RNL A;  4ZH4 F;  4BHP A;  1K78 B;  2YU3 A;  3VOE A;  2FRH A;  2XAQ A;  2C6Y A;  4LG0 A;  5KVR A;  2XV4 S;  4EJU A;  2A6E F;  1IXS B;  3COA C;  5HDN A;  2MH2 A;  4KFC A;  3K1N A;  3F6V A;  3KET A;  1UFM A;  4ENM A;  1Z7U A;  2KIU A;  3FMR A;  4LK1 F;  3E5X A;  3MCZ A;  1P92 A;  2GA2 A;  4WXH A;  3I71 A;  3VOD A;  3EET A;  4RGX A;  1CF7 B;  5HLG A;  3SQN A;  4A2U A;  2L3D A;  3R0A A;  4E70 A;  1ZGJ A;  1RI7 A;  3U1D A;  4O6J A;  2IT0 A;  4Q5S F;  3QU3 A;  3U2R A;  1EH7 A;  4M9S A;  4KNY A;  4OIP F;  2WV0 A;  4YFN F;  5A2Q K;  1Q1H A;  3FXQ A;  2DQL A;  2FXA A;  3WTZ A;  3EQL F;  2XKO A;  4N9I A;  2PMU A;  1F9N A;  4M9Z A;  5EEH A;  1AOY A;  1KQ8 A;  2VC1 A;  2VE9 A;  4LJZ F;  4UUV A;  2GQQ A;  3C1D A;  4AD9 A;  3I0T A;  2LKP A;  2LF7 A;  1ZAR A;  4XLN F;  3TOA A;  3N4M A;  2RV8 A;  1ZRD A;  3ROU A;  2LF8 A;  2ESN A;  3ZMS A;  1PP7 U;  4B09 A;  3M8E A;  3J80 Z;  3DQV C;  4I0B A;  3LAP A;  1IN8 A;  4YIF A;  4ZYE A;  1H0M A;  1IZ1 A;  3H3U A;  5CVV A;  1OR7 A;  3I53 A;  3F21 A;  2BV6 A;  1BI2 A;  1ZG1 A;  1FBS A;  2PEX A;  4RGR A;  1U6G A;  5K1Y A;  5DCM A;  1HSJ A;  3GF2 A;  1P4X A;  1WRJ A;  3T0Y A;  3H92 A;  3IC7 A;  4OIQ F;  3JSO A;  4L18 B;  3KEO A;  5D5W B;  3DV8 A;  5E8G A;  3RDI A;  3WGH A;  4HOB A;  5H6R A;  3R6S A;  4WXD A;  3VB2 A;  4M9X A;  2RNJ A;  4ZYG A;  4A5M A;  3SZT A;  1W4M A;  1HQC A;  3J81 Z;  2W24 A;  4UXN A;  1J75 A;  2K86 A;  2W25 A;  3LQQ A;  1HW5 A;  4WF2 A;  4BYY A;  1ZG3 A;  4XSZ F;  5CYV A;  1IN4 A;  2EV6 A;  1U3E M;  3JTG A;  3T1B A;  4ENK A;  4AIK A;  3R61 A;  2XIG A;  2VT3 A;  2EV0 A;  3GYH X;  4L0Z B;  1T98 A;  3WE3 A;  3FM3 A;  3P9K A;  4UNO A;  1U8R A;  2EV5 A;  2E7X A;  1O3T A;  2QVO A;  2VE8 A;  1AWC A;  4UVC A;  3RI4 A;  1IXR C;  4L5J A;  4HLY A;  1D8K A;  3LWF A;  3QAH A;  2HFH A;  1ZRF A;  2OZ6 A;  1BBY A;  1ZAO A;  1YW7 A;  1KQ9 A;  3G73 A;  2V6C A;  2DPD A;  4G6D A;  2XAF A;  1XSD A;  5K5R A;  3DFG A;  1OYY A;  3RPU A;  2FBK A;  3TDU C;  3W6J B;  2ELH A;  1T0F A;  2F5E A;  1T6S A;  4UHT A;  5LHG A;  1WKM A;  4JBA A;  3IRR A;  3J81 K;  1LEB A;  3KP7 A;  1D5V A;  1B1B A;  1BOA A;  4HQE A;  1LJ9 A;  3DEU A;  1HW1 A;  1YS6 A;  1G3Y A;  2L01 A;  4WX9 A;  1NHA A;  3KP3 A;  3KP2 A;  1ZN2 A;  3ML6 A;  3ZN0 A;  3V7R A;  3LA3 A;  4ZZL A;  3M1E A;  2F5C A;  1YW9 A;  1VTN C;  1PUE E;  2IA1 A;  3QP6 A;  5FFZ A;  3FX3 A;  4M6X A;  1KU9 A;  1TTY A;  3HSF A;  2STT A;  1ZGA A;  4HDV A;  3ISP A;  1O7L A;  4U0Y A;  1QNT A;  5HDK A;  1R1U A;  1SD7 A;  4KN4 X;  3HYI A;  1MZB A;  5BPD A;  4IHT A;  4LB5 A;  3HRT A;  4P55 A;  2VN2 A;  3V7C A;  4P5O A;  2BE5 F;  1XB4 A;  1KU7 A;  3KCC A;  4EJV A;  1BC8 C;  1B59 A;  2UZK A;  4MHG A;  2NS0 A;  4PGH A;  3KP5 A;  4L9N A;  4EGY A;  4KIG A;  1ZHF A;  1QGP A;  2ADU A;  4BNC A;  1T39 A;  3WG9 A;  4KIF A;  3CUQ A;  3I5U A;  3BRO A;  3DPT A;  4L9V A;  5D5V B;  3H3Z A;  3HTU A;  1HW2 A;  1Z9C A;  1JHH A;  2JPB A;  2QWW A;  3ZPL A;  2DT5 A;  4MNU A;  1LDK B;  5FLX K;  2UXX A;  4FT8 A;  4ON0 A;  4TV7 A;  4NQW A;  3BY6 A;  5CVU A;  1JE8 A;  2A68 F;  3WTV C;  1REP C;  1IF1 A;  5L3G A;  2A69 F;  4CDG A;  4U0V A;  4BQA A;  4Q48 A;  3KP4 A;  4XLP F;  1B4A A;  2QQ9 A;  5H6Q A;  2QBY A;  5JR3 A;  4MQV A;  4R79 A;  5ERI A;  3E5U A;  3GO5 A;  4KIB A;  4L9J A;  3TGN A;  2P7V B;  2ZFW A;  4Y13 A;  3GVA A;  1YIO A;  4G7O F;  3VFZ A;  3BPV A;  2LNB A;  4CHU A;  5DEQ A;  4A0Z A;  1B6A A;  1D8J A;  3WOD F;  2R7F A;  4GXO A;  2DK5 A;  4XRF A;  1K79 A;  3QOP A;  5CVI A;  5FD6 A;  3TKY A;  1K78 A;  1FP1 D;  2J5O A;  4AVP A;  1O7F A;  2OD5 A;  2MA3 A;  2O03 A;  2CO5 A;  2HQR A;  3V8K A;  2EWN A;  5AIP A;  3TQN A;  5FLX Z;  2FNP A;  1DPR A;  2ZO4 A;  4PDK A;  4XBF A;  1W5T A;  5L3E A;  2ZME B;  2HTS A;  3M7G A;  3WTT C;  1GXQ A;  1ZYR F;  3C3W A;  4H0E A;  1RIO H;  1HKS A;  3EYI A;  2ZXJ A;  3GEZ A;  2H27 A;  4IF4 A;  3L00 A;  3SHF A;  2HGC A;  4A6E A;  2HR3 A;  1P4A A;  1DDN A;  1YW8 A;  5IT9 Z;  1RZ4 A;  2P4W A;  5ICG A;  4I02 A;  4U0W A;  2IA0 A;  3RYP A;  4HA8 A;  2M5W A;  5L3D A;  2YX4 A;  2NRA C;  2KJB A;  3GZ5 A;  4KUM A;  1X3U A;  3K1P A;  4WXC A;  3K9T A;  4MTE A;  5E17 F;  3QP5 A;  1C0W A;  2GWR A;  2QQB A;  5E18 F;  4HDU A;  2XVC A;  2D1H A;  2BEO A;  2BGC A;  1XDU A;  2ZBK A;  3HHH A;  5A2Q Z;  1QZY A;  1FP2 A;  1OKR A;  4K2E A;  5JFR A;  2P6T A;  2Q0O A;  2D45 A;  1RUO A;  4I98 B;  3GX4 X;  5LGT A;  2FML A;  2DW4 A;  2HTJ A;  1QBJ A;  1O57 A;  1ZG5 A;  1TW3 A;  1ODD A;  4LGW A;  2QM3 A;  1S6L A;  5D8K B;  3MWM A;  4G8X A;  5LHI A;  3Q9V A;  5K5O A;  3HTS B;  5BOX A;  2HKO A;  2VT2 A;  2M8E A;  1MD0 A;  2P8T A;  1P2F A;  3BJ6 A;  5L3C A;  2V1D A;  1B9M A;  4IPA A;  4U7D A;  5LEJ A;  5FGM A;  3KZZ A;  1HST A;  4LLG F;  2OA4 A;  3HSE A;  2EJR A;  3RPQ A;  4M72 A;  2CSO A;  1L0O C;  2HWV A;  3AAF A; 
#chains in the Genus database with same CATH topology
 2OCE A;  4U88 A;  1UEL B;  3AG4 H;  2NS7 A;  2OPT A;  2LY1 A;  4PSX A;  2GAU A;  2MFZ A;  2W4S A;  5E1Z B;  3DF8 A;  4ZYD A;  2OBP A;  3CUQ C;  1BR2 A;  3A2K A;  2HXO A;  1Z6T A;  3OOU A;  3PJR A;  2BXY A;  2HDC A;  3B02 A;  3CJN A;  4NB5 A;  5F6F A;  5HLT A;  3ULQ B;  1XMA A;  2L4M A;  4KIT B;  2O3F A;  2CQN A;  2XPV A;  1S7A A;  4XLA A;  3IHU A;  3ZR8 X;  4S0H B;  2O7O A;  2DAO A;  2G7H A;  1QPI A;  3FK6 A;  3V8L A;  1ZR2 A;  1A6I A;  2VBW A;  3T8T A;  4HAM A;  4HBL A;  5AON A;  3B73 A;  3PNT A;  5HVQ C;  4X1E A;  2EZL A;  2DTR A;  2JMW A;  1RUN A;  3K4N A;  2GIZ A;  1FLI A;  2IS4 A;  3Q9S A;  1WH5 A;  3QQA A;  2GXA A;  1JUP A;  5KK1 A;  1SD5 A;  2L9V A;  4A3F J;  1FMW A;  3I59 A;  2CQK A;  3OYB A;  2KRF A;  3ASN H;  3CMM A;  4RS8 A;  2GXB A;  4CYD A;  2K85 A;  4F55 A;  1XSX A;  4I99 C;  3JRI A;  3E6D A;  3CLO A;  3O3K A;  1RKT A;  4JX5 A;  3Q5F A;  4DNC A;  3IWZ A;  1NG6 A;  1W7P B;  2KIQ A;  2JTV A;  1E2X A;  1KU2 A;  1FMV A;  5IYB J;  2L2O A;  3KP6 A;  4HYE A;  3OMY A;  1H9T A;  2E34 A;  1Y0N A;  3HSR A;  3BWG A;  2M0C A;  3HRS A;  3GWZ A;  3CDL A;  2JPC A;  5M5X J;  3HDD A;  4G9Y A;  1I6X A;  1T56 A;  3HPH A;  3ZRG A;  2K9L A;  4Y4R A;  4D5F A;  5EG0 A;  2ACJ A;  2IRF G;  2FBH A;  2G0E A;  3LMM A;  1GXP A;  1BJZ A;  5E3M A;  2R7S A;  3V8J A;  4IVN A;  2XAG A;  1FBQ A;  4HF2 A;  2I10 A;  1IRF A;  2KLO A;  4I0A A;  3MKW B;  4IHW A;  2IVM A;  3DTK A;  1HBX G;  1UST A;  3FK7 A;  2V1U A;  2FE3 A;  5LLQ A;  4GGG A;  3NEU A;  2BW3 B;  2VXZ A;  1N77 A;  2LSO A;  2O8X A;  2VQG A;  3LSP A;  2JUG A;  1BM9 A;  3I54 A;  1DU0 A;  3SZP A;  2VLA A;  2FU4 A;  4IEJ A;  4MFE A;  4YG2 F;  5IT9 K;  2ME6 A;  5DM6 F;  2VOO A;  4NNJ A;  1Z21 A;  2MAB A;  4A3G J;  3L7W A;  1MH3 A;  3HZJ A;  4Q47 A;  4ZDO A;  3IWF A;  1W7P D;  1EA3 A;  5E79 C;  1HC8 A;  1IDZ A;  2LKX A;  3BOQ A;  4RM3 A;  3ZOB A;  5GAE J;  4N9H A;  2VPL A;  3ZMT A;  1DGR M;  2XGX A;  3I4N J;  1R23 A;  2EZI A;  4BBR J;  5DYM A;  4HX7 A;  3S2W A;  3FXJ A;  5JVT A;  5FRM A;  4II3 A;  1IDY A;  2P0W A;  4O5V A;  2XRO A;  1G4D A;  1NK2 P;  1ZRE A;  2A6T A;  1J59 A;  3DP7 A;  2OZU A;  1TLH B;  1QRY A;  4PJL A;  2XAJ A;  3MEX A;  3R60 A;  3EPZ A;  1IN7 A;  3WTU C;  5IYC J;  3FMS A;  5EDN A;  3CF5 F;  2VKE A;  1R4N B;  1S8N A;  3EYY A;  2HQA A;  2EIM H;  1ZH5 A;  5EF6 A;  3F22 A;  1BJA A;  1ONV A;  2W57 A;  3V42 A;  2Z33 A;  2V9P A;  3ZQQ A;  5FLM J;  2EK5 A;  3E6C C;  2VBX A;  1SFX A;  2FSW A;  1JHF A;  4FTH A;  2COB A;  3RKX A;  1EF4 A;  2V9K A;  3DBR B;  4CIC A;  2ZSI B;  4MEY F;  4ZZD A;  2O9L A;  4NUB A;  2YU9 J;  4A93 J;  3K2Z A;  2Z2S B;  2R5Z A;  3E5Q A;  1T95 A;  4NBQ A;  1EH6 A;  3VYR B;  4XRM A;  1FTT A;  1QHH D;  1F36 A;  3F8C A;  1ETX A;  3UR3 C;  4NQW B;  2F2E A;  3I56 I;  3GTP J;  2EFO A;  2GM4 A;  5LHH A;  3CLQ A;  1JXS A;  2TDX A;  4R1H A;  2WV1 A;  4I09 A;  3SXY A;  3N97 A;  4BQQ A;  3NWT A;  3OWT A;  2QQA A;  2KKO A;  1SMT A;  2GOM A;  3MAJ A;  2LH9 A;  4DQ2 A;  5HOD A;  1DP3 A;  4I01 A;  3S8P A;  3H35 A;  1FC3 A;  2L9S A;  2YX7 A;  2L7K A;  2Y0S N;  3GFM A;  1R5H A;  2DU9 A;  1SD6 A;  2YS9 A;  1LDD A;  2QQ8 A;  3K70 D;  1KGS A;  1FTZ A;  2FEZ A;  2LDU A;  2KPM A;  3S1M J;  3HUG B;  3KEQ A;  2F5F A;  3CC4 I;  4BAC A;  2Z99 A;  5TIS C;  5DS9 A;  1LB2 A;  1OQY A;  2DPU A;  2X4H A;  2RQP A;  4JOM A;  2D1V A;  3MFK A;  3P9C A;  4IQJ A;  2L02 A;  1QVT A;  1JUM A;  3LA2 A;  4HF1 A;  2IW5 A;  3QWL A;  5D6E A;  1XDS A;  2B63 J;  2A5W A;  4HX8 A;  1G3T A;  2B0L A;  5BQT A;  4BQN A;  1FYM A;  2HDD A;  2Y2Z A;  4BJT A;  4IOA F;  2HQN A;  3IH3 A;  3CDI A;  5DCF A;  1U5T C;  1Y6I A;  2JA6 J;  2M2E A;  5B1A H;  3RQ4 A;  4WK8 F;  1U78 A;  2JT1 A;  3F6O A;  3K2A A;  3W6K B;  1PUF B;  3DPU A;  2DTZ A;  1DUX C;  4JQF A;  2G9W A;  2Z5U A;  5BPI A;  4GO1 A;  3DEE A;  3VEP A;  3T5X A;  1XGO A;  4RAG A;  2FX0 A;  1OCT C;  3LSM A;  3PUF A;  3JRB A;  2CJJ A;  3KE2 A;  5E20 A;  2M9H A;  3HOY J;  5ILU A;  3J7A O;  4FHT A;  1BW5 A;  4Y15 A;  2D2W A;  2RKH A;  3MZ8 A;  4DYR A;  4C9Y A;  2XF7 A;  4BKX A;  1P7J A;  4WCG A;  2MW8 A;  1P6R A;  2RNG A;  4XNF A;  4G7Z F;  1FPQ A;  1LFP A;  2R5Y A;  1QPM A;  4XRS G;  2DK8 A;  2VJJ A;  4E7Z A;  1XSV A;  2FF4 A;  3BPX A;  1SMY F;  3A0B C;  3BCB A;  4V19 K;  2FQ4 A;  1DQU A;  3CDH A;  2ECB A;  3Q0U A;  1IRG A;  4HLX A;  1MMG A;  2W48 A;  1L3L A;  2F4O B;  3LST A;  3L2V A;  3JAM Z;  3L09 A;  1GV5 A;  4BDZ A;  2MLK A;  5ICE A;  2DMU A;  4KMF A;  3GTK J;  3SDG A;  4JK1 X;  5EZH A;  1AKH B;  3E6M A;  2KQR A;  3LFU A;  3CC2 I;  2DLL A;  2WTE A;  4E7J A;  1TQP A;  3IL2 A;  1X1C A;  4E6K G;  4RB3 C;  1JI8 A;  1VZ0 A;  4L5E A;  2AQF A;  2DOD A;  4AUX A;  4CXF A;  4PJ0 C;  1OYW A;  3E6B A;  2F5V A;  3OOP A;  5DUK A;  3OYH A;  1FT9 A;  1TW2 A;  2CWE A;  3I59 B;  4NC8 A;  2CV2 A;  1WZ2 A;  4IOC F;  4YII A;  1UHW A;  3WHC A;  4EM2 A;  3KLO A;  1X1D A;  3BJA A;  4HEA 2;  1BIB A;  3HRU A;  1ETQ A;  3WE2 A;  2XUB A;  3ZQ7 A;  3DXJ F;  3A1Y A;  5DUI A;  1G3W A;  2M0M A;  2ZME A;  3QOD A;  2JRT A;  1EV7 A;  3L9F A;  2NNN A;  1GDT A;  1KZH A;  3ZQC A;  2P5K A;  3E3V A;  4FX0 A;  1K6O A;  2IA2 A;  3PQK A;  2JN6 A;  1OIS A;  1UHM A;  1MH4 A;  2OTJ I;  9ANT A;  3MD2 A;  2VXD A;  1A31 A;  3VYS B;  2X6W A;  1GUU A;  3FWE A;  2LC2 A;  4RGU A;  2VL8 A;  1KU3 A;  2VJI A;  5FKK A;  3JRD A;  3PIO F;  2ZME C;  1R22 A;  3DKW A;  5D6F A;  4CA0 A;  2UWM A;  3NRV A;  3CUQ B;  2LD5 A;  4KJZ A;  3ZMV A;  3OYA A;  2CGP A;  4UUS B;  1F4K A;  3KIO A;  3LL7 A;  5HDG A;  4UVB A;  1ZRC A;  1QZZ A;  3RYR A;  2KIM A;  3G2B A;  1H89 C;  2Y48 A;  2HYG D;  2YSR A;  5EJC A;  4I6Z A;  2PX9 A;  1MBJ A;  3PIP F;  4RB2 C;  4BBS J;  1MW7 A;  1PJR A;  3CO7 C;  3G4S I;  4FCY A;  3NQO A;  3F72 A;  4LFU A;  4DYQ A;  2F6C A;  2DYR H;  2R7D A;  4A12 A;  5EGO B;  5HS7 A;  2K7L A;  2LVS A;  3MMY B;  5F1J A;  3NAU A;  1POG A;  2PFB A;  4RMN A;  1HDD C;  2K9S A;  3AKZ A;  4CCJ A;  4AIJ A;  4JP0 A;  4ZTF A;  4XID A;  5L3F A;  4BHC A;  4MEX F;  4F7Z A;  1V55 H;  1W5S A;  2WY7 Q;  4DYC A;  4IL6 C;  1J0R A;  3WTY C;  2Q1Z B;  5ICC A;  2PMZ A;  4R8H A;  1J2X A;  2BBY A;  4KYW A;  4OMZ A;  2V9V A;  4XKV A;  4B44 A;  4CO8 A;  2R7T A;  4ANJ A;  2FJ1 A;  4E7S A;  5J1Y A;  4D1Q A;  2GXG A;  1ON2 A;  2BYV E;  4XMY A;  2RN7 A;  4DW6 A;  2RC4 A;  2W84 A;  4IRG A;  3ZMZ A;  4KIC A;  3J80 K;  2UUZ A;  4BL0 B;  4EMS A;  1TWA J;  4HF0 A;  3TP3 A;  3J7Z I;  2IGK A;  4RGS A;  3W2W A;  4XKC A;  1BI3 A;  2WB1 A;  3GTM J;  2X6O A;  5FRO A;  1K7A A;  2H1L A;  3ONQ A;  1D1C A;  2FMY A;  1P4W A;  2BY3 A;  1Z6R A;  2MGQ A;  4F92 B;  1USS A;  3A01 B;  4QPO A;  4I76 A;  1ZR4 A;  2DBB A;  4M73 A;  1YIT I;  3EDP A;  4XN3 A;  1SAN A;  3GLX A;  2HDW A;  3DLA A;  4EQQ A;  4A3J J;  4CGZ A;  2ETH A;  4RB1 A;  2BY0 A;  2AXL A;  2VKV A;  1MNM C;  1IN6 A;  2HZD A;  4IXA A;  1SVM A;  3HOT A;  3WHB A;  1WJ5 A;  4ESF A;  3G6E I;  1IGN A;  4DJA A;  1MMN A;  2IEK A;  2GLO A;  1B8I B;  2PG4 A;  1R7J A;  1R5G A;  3KEY A;  4J00 A;  2P5V A;  1OMI A;  3FDY A;  3DTI A;  4UB8 C;  2VOD A;  2ZCW A;  1MIJ A;  1ENH A;  1LQ1 A;  1BIA A;  4DIQ A;  3CCQ I;  3J7Y J;  4IJA A;  1JKQ C;  5JI6 A;  3CCS I;  2QZ8 A;  4M74 A;  1ZKG A;  2WBM A;  1K4T A;  2QSF X;  2ZNY A;  2E5Z A;  3OR2 C;  3BZ6 A;  4ZTJ A;  2DDB A;  4A3K J;  1G6N A;  4D0P A;  3HG9 A;  3PNY A;  2MLG A;  2Q2E B;  2QLZ A;  3QPL A;  4LB6 B;  5ILV A;  1JT0 A;  3DEW A;  1DP7 P;  4XSX F;  1MMS A;  2UXN A;  4ZDL A;  5ED4 A;  1FY7 A;  1XTA A;  1K4S A;  2H09 A;  2CUZ A;  1MJ9 A;  2PJP A;  2L0K A;  1Z05 A;  2QEN A;  3WGI A;  4A0Y A;  1Z7L A;  4EJW A;  4KIS A;  2TCT A;  4MGR A;  4ITV A;  2H94 A;  1PDN C;  2HZT A;  5GAH J;  1AHD P;  3CMA I;  1GVJ A;  1WJB A;  1XMX A;  3M1C A;  2OC6 A;  4IQ4 A;  4ZC3 A;  4UVA A;  1DPU A;  4Z2Y A;  4OIN F;  5GPA A;  3TO6 A;  1APL C;  3OL3 A;  3HOS A;  4PUS A;  4LMY A;  5LBQ A;  1D1B A;  2V79 A;  5M3M J;  4XLC A;  4UY8 I;  3KFW X;  4C3I J;  4KN7 X;  1QO0 D;  1FOK A;  2H6B A;  3FXO A;  4JX6 A;  4BAY A;  2R7R A;  3G1L A;  5HLH A;  1T8I A;  1FSH A;  3L2C A;  4IHV A;  1XN7 A;  2CW7 A;  4IZZ A;  3D0S A;  4G94 A;  4HV6 A;  2JSC A;  4A69 C;  3S17 J;  3F8M A;  2P5L C;  2R92 J;  5H20 A;  2Y0S A;  1T08 B;  3F0C A;  3HIF A;  3IV5 A;  2KFD A;  2VBZ A;  4LG0 B;  3BR3 A;  2P7C B;  2ZC2 A;  1J9I A;  1X19 A;  3EUA A;  3LSI A;  3OL4 A;  5J6X A;  5TRD A;  2XGD A;  1YI2 I;  4M3F A;  1W5C C;  2AS5 F;  4CCM A;  3CC7 I;  3I64 A;  4P1W A;  4HW0 A;  2A3S A;  2EIJ H;  3FXR A;  2VJ4 A;  5JHF A;  2G7U A;  2M30 A;  4GYG A;  2A5Y B;  2W00 A;  4FET A;  3OYM A;  3I4P A;  3SJM A;  1YLF A;  2K9N A;  3K0L A;  3K69 A;  2O0Y A;  1MJA A;  1D3Y A;  1H9G A;  3CUO A;  1I1S A;  1Y8R B;  2HNH A;  2M45 A;  2HYF A;  5CLS A;  4IHS A;  2R4G A;  4W1U A;  3S15 J;  4HX4 A;  2XC7 A;  2V6E A;  4YEJ A;  2ZXH A;  4BEH B;  5GPC A;  4I2O A;  4MIM A;  3LAJ A;  3IKT A;  3JRH A;  3GFJ A;  3OYL A;  1ULY A;  1XPX A;  3FBI B;  1U5T B;  3H36 A;  2QUF A;  2VAS A;  3TOB A;  1FBU A;  1SFE A;  2E5N A;  3BJO A;  3HM5 A;  4P9U A;  1VQ8 I;  4GYI A;  1YTY A;  3UKG A;  3H0D A;  3PFY A;  2DOA A;  2NAZ A;  4P9F A;  3KZI C;  1XS9 A;  2DOF A;  3OYJ A;  2V7F A;  3BZC A;  2R7U A;  2R0Q C;  5BS6 A;  4Q4Z F;  4EM1 A;  2EPF A;  1W1W E;  4X6A J;  1FSE A;  4HPQ A;  4XOR A;  2QYO A;  2GA1 A;  1X4O A;  2VBY A;  4AID A;  4QIW N;  3BR1 A;  5IOY A;  4UUT A;  3D5R C;  3OYD A;  4C3H J;  1R58 A;  1FYK A;  1T2K A;  1Q1V A;  5F27 A;  1WJC A;  1MDM B;  5ICF A;  2BHY A;  3OY9 A;  4ENJ A;  2F5D A;  2M34 A;  4ENN A;  2IP2 A;  3BR0 A;  3AFH A;  2VON A;  4BXU A;  2L4A A;  2COM A;  3HPG A;  3REO A;  5J1R A;  2JA2 A;  1FNN A;  1G3S A;  2E1M C;  3OIP A;  3RTR A;  4XIC A;  4MQ9 F;  1IG7 A;  5D5X B;  3M9A A;  3TW7 A;  1HOM A;  3V7S A;  3FKI J;  1STZ A;  2FBI A;  3QPH A;  4I7H A;  2E7W A;  1WHU A;  3QPT A;  3ZMU A;  3CME I;  2W85 A;  5IP6 A;  1GV2 A;  5K7Z A;  2VKD A;  2DO7 A;  2HS5 A;  1O3R A;  2KIS A;  3HEF A;  1SD4 A;  4KMU X;  1I5Z A;  2LY9 A;  2LYC A;  3JW4 A;  5FFX A;  1R1T A;  4RAY A;  1FYL A;  1KYW A;  3CCV I;  4BQO A;  1S29 A;  3RPU D;  1OCO H;  2M1B A;  2O5R A;  1U0J A;  1UG0 A;  5CQG A;  2FA5 A;  1KA8 A;  2STW A;  3BTL A;  2E19 A;  2EH3 A;  1MSF C;  3BP8 A;  2A61 A;  3MQ0 A;  3CP2 A;  4YFK F;  5HS8 A;  5C44 J;  2X6X A;  5M5Y J;  3GZN B;  4XLE A;  1XGN A;  3JTH A;  1FIA A;  2DI3 A;  1O3Q A;  2WWY A;  2KIF A;  3K4J A;  3Q0V A;  3CJQ B;  1BI1 A;  3CO6 C;  3LSK A;  4G7H F;  1XCV A;  2DT7 B;  4ZJZ A;  1A36 A;  1IRZ A;  2MC3 A;  5J4Y A;  2DMT A;  3PFI A;  2XPU A;  3DU5 A;  1W7P A;  1Z3Y A;  4AC0 A;  4AIH A;  4LK0 F;  4FE4 A;  4CSW A;  2YR2 A;  4BHB A;  3S2H J;  1V4R A;  2CQX A;  2IAI A;  1IXC A;  1NG7 A;  2BZT A;  3HL2 A;  3DWL E;  3GXO A;  2ZJQ F;  5AIQ A;  1YQA A;  3H9J A;  3P5J A;  2Z1D A;  3GFI A;  2DQR A;  3FXU A;  4Y17 A;  3V4G A;  4EGZ A;  1UAA A;  4HNV A;  2OQR A;  2CFX A;  3FXK A;  3DU6 A;  4B8X A;  1BI0 A;  4PCQ A;  2J5P A;  4EVI A;  2NYX A;  2XGE A;  4ZYA A;  1H8A C;  2CMP A;  3FF5 A;  3PQJ A;  3TMO A;  1TP4 A;  1LEA A;  1HA8 A;  3CTA A;  2JRM A;  3BG5 A;  5J47 A;  3O6B B;  2L5Q A;  2LG4 A;  3ZP5 A;  2KRH A;  3EUH C;  1XMK A;  1MJB A;  2RGV A;  2QCO A;  3ECH A;  3I9V 2;  2QKL B;  2IJL A;  5FO5 A;  4DBR A;  5GP9 A;  1IO2 A;  4ZYH A;  1BN5 A;  4J01 A;  2K4B A;  1WSU A;  1F1Z A;  1WFX A;  1I1G A;  1LFU P;  2E71 A;  2XHK A;  1BC7 C;  1IW7 F;  1SC7 A;  1OCZ H;  1Z91 A;  1UCR A;  3TO7 A;  1B9N A;  1V54 H;  4ESJ A;  5EZG A;  1WQ2 A;  1TWF J;  3BC8 A;  3WTX C;  1IN5 A;  2AQE A;  2KZV A;  4RAZ A;  1IAW A;  1W36 C;  4WWC A;  1VQL I;  2EQR A;  3AL0 C;  2Y75 A;  5DD4 A;  3BQZ A;  5FD5 A;  1G2H A;  1GHC A;  3VSK A;  5FLV A;  2EA4 A;  3IKV A;  2OF7 A;  4NC7 A;  3KX2 A;  1ZLJ A;  1E17 A;  2CV0 A;  1JKO C;  4XR6 A;  3P7N A;  5D4R A;  3F23 A;  2EFW A;  4G12 A;  2PQ8 A;  1TBX A;  4CH7 A;  5J8C A;  2R5Y B;  1KQ0 A;  2HI3 A;  2ZNZ A;  3CCE I;  5JVG F;  5C4X J;  1P9Q C;  3DCF A;  2EFN A;  4NC6 A;  4YFX F;  1T33 A;  1FZP B;  1YFH A;  4XQF A;  5K5Q A;  2V1X A;  1Z67 A;  2O61 A;  2CYY A;  4QSH A;  3RQI A;  2EIL H;  4YRV A;  1U2W A;  5DD8 A;  5EYR A;  1HLV A;  1IJW C;  4BU2 A;  2XKP A;  2O6G E;  1S7E A;  1IUY A;  2PN6 A;  1MBF A;  5K7H A;  2E35 A;  5D5U B;  4D9J A;  1KON A;  1YOV B;  2H6C A;  2KDZ A;  2IPQ X;  5KAI C;  4L0Y B;  1J7K A;  2PBI A;  3ASO H;  2X6Y A;  3CJT B;  2HOS A;  1WI3 A;  3KLN A;  2XAS A;  1QZE A;  5FB2 A;  1WI9 A;  4IKF A;  2R5Z B;  3GTO J;  4CYC A;  2OAZ A;  1YG2 A;  2Z9O A;  4LLN A;  3KZY A;  3RZO J;  3ABT A;  2O8K A;  3L2R A;  2MC4 A;  4XOT A;  3QYB A;  2E1N A;  4JYK A;  4IX7 A;  2X51 A;  1MMD A;  5BMZ A;  1FIP A;  1LNW A;  1RR7 A;  3DKX A;  2P6S A;  1D1A A;  4LG3 A;  5DCM B;  4E7H A;  2Q8K A;  1WWX A;  1I50 J;  4ETS A;  2X1C A;  3HB9 A;  4HNU A;  1RRJ A;  2PJR A;  4Y7N J;  3MZY A;  1OPC A;  3VWB A;  4LIV A;  2MD5 A;  4E4H A;  3LQR A;  1A35 A;  2ICW G;  2MBF A;  4PZJ A;  4XN0 A;  4E7K A;  3QRF F;  4PK4 A;  5E1X A;  3O2P E;  5GTH C;  4A3I J;  3EUH A;  5JLX A;  4BE1 A;  3ZQL A;  1MNE A;  1SEU A;  1VF9 A;  5J3L A;  2IBD A;  4QLC U;  4AYB A;  3ZQI A;  3F8N A;  3HUG A;  1SAX A;  3BTJ A;  4BEH A;  3F3X A;  1Z1D A;  1MBH A;  2DFI A;  2DXI A;  5FKN A;  5LGN A;  4OIR F;  2F4M B;  4HQM A;  4KT5 C;  4N0B A;  3ERE D;  1HKT A;  3F8F A;  3ELK A;  1F43 A;  1U5T A;  1MGT A;  3RKW A;  2WAF A;  2CUF A;  5TJJ A;  2X1E A;  3MKZ A;  5EGO A;  4OWR B;  4E7I A;  2LOO A;  1ZLK A;  4M3G A;  1R1V A;  3IH4 A;  4OMY A;  2DT6 A;  5LGU A;  4FE7 A;  3W3C A;  2DDA A;  3LA7 A;  4LD5 A;  3WGG A;  2VB6 A;  2JWT A;  2CRG A;  1QQI A;  3NWS A;  3DBH B;  2K4J A;  4S04 A;  2X9D A;  4AWX B;  2FQ3 A;  2DA4 A;  1WVR A;  1Z77 A;  3RKY A;  1SFK A;  4Y33 A;  3S1Q J;  4QWQ A;  4A5N A;  2MG4 A;  3GFL A;  3H9G A;  4CZZ A;  4EJO A;  2ID3 A;  1TQM A;  5J4V A;  3OS1 A;  1NTC A;  1MKM A;  3WTW C;  3CCR I;  4G6Q A;  1MBG A;  5E3L A;  2L54 A;  4KA4 A;  3ESW B;  1K6Y A;  1OFC X;  5LEK A;  1WJA A;  2KJC A;  3ABM H;  3PO3 J;  5IPA A;  3FIW A;  3K4B A;  1LVA A;  4HV5 A;  2W7N A;  2HOT A;  2HEO A;  3JRE A;  4DGW B;  1YYV A;  5LRS A;  3HRM A;  1KYZ A;  2EFQ A;  3PSI A;  3L2W A;  1OCC H;  3JSP A;  2QEX I;  1CF7 A;  2OUM A;  3GLL A;  4UV8 A;  3IRQ A;  4KT6 A;  1TNS A;  4C2T A;  4L5I A;  4EM0 B;  1NH3 A;  3HHG A;  4BDY A;  2NNY A;  1I27 A;  2X1D A;  3QU6 A;  1RKW A;  5DV5 A;  3DLL F;  4AYB N;  5EEG A;  2K02 A;  3GUD A;  4YIR X;  3LFK A;  3FHZ A;  2L9R A;  2PLY A;  1TNT A;  4NHJ A;  2M4G A;  3K10 A;  1YE9 A;  2XSJ C;  2DA7 A;  4UV9 A;  2GOX B;  2JZY A;  2XAU A;  5LFA A;  5L3B A;  2WC2 A;  3S2D J;  2K3P A;  2VOP A;  4XOP A;  5J8F A;  2PI0 A;  1A5J A;  3PL8 A;  4DZJ A;  1QHG A;  4HZF A;  3HOU J;  1JJ8 C;  3RJP A;  1UHS A;  5KNL A;  2LBF B;  3FM5 A;  1OJL A;  2Y31 A;  4BH9 A;  1A04 A;  2A07 F;  3B6A A;  4A6D A;  2NVQ J;  4M71 A;  2GZW A;  3GZ6 A;  2EB7 A;  3BDD A;  1ZK8 A;  4M6Y A;  3C7J A;  2DJI A;  2E1M B;  3BR6 A;  4BE2 A;  3F8B A;  2WAE A;  1HXD A;  2MH9 A;  3I58 A;  4OOI A;  2K40 A;  5ILS A;  2NS8 A;  2ZXW H;  1Y1V J;  4MFD A;  2L9N A;  3JAM K;  2DFE A;  1BL0 A;  2JUC A;  1E3O C;  4RDU A;  2IS6 A;  1XGM A;  2B7E A;  3MZH A;  2ISY A;  4E7L A;  4PGG A;  3K1M A;  1R36 A;  1VQ4 I;  1LKX A;  3R4K A;  1OYI A;  3R0J A;  1X1B A;  4RA2 A;  2H1K A;  3M8F A;  5LRR A;  2KZG A;  4U7B A;  1XGS A;  2XRL A;  5CVJ A;  5M5W J;  2R7Q A;  4S05 A;  3ZMD A;  1WJE A;  2B9S A;  2XSD C;  2RDP A;  1HKQ A;  1ON1 A;  2VQL A;  5F1R A;  1IV6 A;  1OCP A;  1F5T A;  4O3M A;  1FOX A;  3TL4 X;  3I4M J;  4N4N B;  3S93 A;  1Y0U A;  2XRN A;  1O3S A;  3P9I A;  2HKX A;  3DTE A;  2ZKZ A;  2CW0 F;  4A0X A;  1MSE C;  2Z3Y A;  5IT3 A;  3G1M A;  4C3J J;  4L9T A;  4EV0 A;  5HOO A;  1E0E A;  3WU0 A;  2KRC A;  4EJT A;  3G3Z A;  1EH8 A;  3G1O A;  3GW2 A;  1T38 A;  2OCC H;  3AG3 H;  4ASN A;  2LFB A;  2ISZ A;  2YPR A;  4MLO A;  2FNA A;  3BT9 A;  2IGN A;  1ETO A;  1B72 A;  1XCB A;  1PP8 F;  3DPL C;  5B5E C;  5JHU A;  1GVD A;  2ZFU A;  2A6H F;  1Y8Q B;  2AO9 A;  5DTD A;  1S9H A;  5D8L B;  1WPK A;  1H88 C;  4XM3 A;  3L2Q A;  3ZN1 A;  4P96 A;  4BJ6 C;  4HSR A;  4C2M J;  5CJ9 A;  3HOZ J;  1BOB A;  1YS7 A;  3ABL H;  3K6G A;  4IRI A;  2VC0 A;  1U8B A;  4OIO F;  3PNV A;  4DZP A;  2H8W A;  2P81 A;  1J5Y A;  2X0L A;  2EFP A;  1PYV A;  1TZL A;  1O4X A;  2RQQ A;  2Y0M A;  4PSW A;  2WAQ A;  1FWZ A;  3A01 A;  1X2N A;  3TO9 A;  1U9N A;  3O8G A;  2VQC A;  4OAZ A;  6PAX A;  2ESH A;  1XD7 A;  1D0X A;  3N05 A;  3HGG A;  5DM7 F;  2NXN B;  2R7Z J;  3L2U A;  1V3F A;  2EZH A;  4ESB A;  2HVR A;  2EA2 A;  2HOE A;  3FMQ A;  3I55 I;  5HLI A;  5F08 A;  1B8I A;  4PJM A;  5F64 A;  4IO9 F;  4LLL A;  2GIV A;  2M87 A;  3MKY B;  1BR4 A;  5DDG A;  5M3F J;  1R9T J;  2XAH A;  1YJ9 I;  2JVH A;  3J7A Y;  1LE8 A;  3Q0W A;  3D5L A;  2LR8 A;  1YX5 A;  3LSJ A;  5E1W A;  3WTS C;  3H9Q A;  4HRI A;  3BZK A;  4B1R A;  1VQP I;  2EIN H;  1SAU A;  1MDM A;  1FX7 A;  5CKT A;  2ZJ2 A;  2HQ5 A;  5E8I A;  1RES A;  3T8R A;  2CG4 A;  3PUB A;  2M3A A;  4IRH A;  3VPR A;  2Q2E A;  3OV8 A;  1UZC A;  3M3Y J;  5D4S A;  1WGX A;  2R3S A;  1SFU A;  4HST A;  3CF2 A;  4GCV A;  2K27 A;  1S3J A;  2OU2 A;  2BOL A;  2K5C A;  5CVR A;  1LDJ A;  2E1C A;  2OTL I;  3A02 A;  1S7O A;  2BY1 A;  2DA3 A;  2FOK A;  2RVC A;  3M8J A;  3TDZ C;  2QBY B;  4LOC A;  1UJ8 A;  3WU1 B;  4Y52 J;  3CMY A;  3U21 A;  4MO7 A;  1YO5 C;  1JGS A;  3SFZ A;  4KDP A;  2UV1 A;  3ABU A;  2ZB9 A;  2JQ7 A;  2OQG A;  2PMH A;  3S14 J;  2E1O A;  3ECO A;  2NOG A;  3D5S C;  4FX4 A;  1UB9 A;  5HS9 A;  3CP8 A;  3W6V A;  3FZV A;  3U9G A;  4MTD A;  1CGP A;  1R00 A;  2AHQ A;  3E97 A;  4OU0 A;  3C18 A;  4IHX A;  3RIR A;  1TQI A;  3K4L A;  4RB0 A;  3G71 I;  1N78 A;  2IS2 A;  1W0U A;  1RNL A;  3CCL I;  3M07 A;  3PSF A;  5C3E J;  4ZH4 F;  4BHP A;  1K78 B;  2YU3 A;  3VOE A;  5IOZ A;  2FRH A;  3HC7 A;  2DA6 A;  2XAQ A;  2C6Y A;  3UNG C;  1VI0 A;  4LG0 A;  5KVR A;  2XV4 S;  4EJU A;  2A6E F;  3OIQ A;  1R5I D;  1IXS B;  1IV8 A;  3LSR A;  3COA C;  4AM3 A;  5HDN A;  3LSH A;  2MH2 A;  4KFC A;  3LOC A;  1T0F C;  4JX4 A;  3A4C A;  3K1N A;  3ERM A;  3F6V A;  5HNF A;  2LP0 A;  3D1N I;  5F0F A;  3OYE A;  3KET A;  1UFM A;  2L7M P;  4A3B J;  1S72 I;  4D7M A;  3FXL A;  4ENM A;  4XKB A;  3HOV J;  3MKL A;  5B66 C;  1Z7U A;  2JJ7 A;  3GTG J;  2KP6 A;  1BA5 A;  3K7A J;  1X3W B;  5F04 A;  4BUP A;  2KIU A;  1Y56 A;  1ZTR A;  1Z0X A;  3FMR A;  2Y30 A;  2Y9Y A;  4LK1 F;  3E5X A;  3IUO A;  3MCZ A;  1V5E A;  1P92 A;  2R7V A;  1ZEL A;  1IRX A;  2GA2 A;  4WXH A;  1ERD A;  3I71 A;  4GRI A;  1VQN I;  4N4O B;  5FKL A;  3VOD A;  3EET A;  4RGX A;  1X1P A;  3H1C A;  1CF7 B;  1G8X A;  1Y39 A;  3S3N A;  2E36 A;  4ABZ A;  2ZSH B;  5H2F C;  2DMP A;  5HLG A;  3SQN A;  3PO2 J;  3BG7 A;  4A2U A;  2QSH X;  2L3D A;  5C4J J;  3R0A A;  4E70 A;  4LIU A;  5IP7 J;  1ZGJ A;  2MD0 A;  1RI7 A;  3U1D A;  3RSN A;  2QA4 I;  4O6J A;  2NVU B;  1GT0 C;  3OS2 A;  2IT0 A;  4Q5S F;  3QU3 A;  1X4P A;  2V4J C;  2GBY A;  3U2R A;  3OSG A;  1VQK I;  1EH7 A;  4M9S A;  2VQH A;  5GTI C;  1I39 A;  5B1B H;  4KNY A;  4OIP F;  2WV0 A;  4YFN F;  1ETW A;  5A2Q K;  1Q1H A;  3FXQ A;  2DQL A;  3HKZ A;  4LIT A;  2FXA A;  3WTZ A;  3VYU B;  3EQL F;  4U87 A;  2XKO A;  4N9I A;  5K7F A;  2WB1 N;  2PMU A;  1F9N A;  1N75 A;  4RM2 A;  1I6H J;  3I3L A;  1OCR H;  2KMU A;  4M9Z A;  5EEH A;  1LPQ A;  1AOY A;  3EUK L;  1KQ8 A;  4RLF A;  2VC1 A;  2VE9 A;  4LJZ F;  2V1N A;  2DFH A;  2DA5 A;  4UUV A;  2GQQ A;  3C1D A;  3TBI A;  1IC8 A;  2XB5 A;  2K9Q A;  4AD9 A;  1Y1W J;  3I0T A;  3OS0 A;  3JRF A;  3KPH A;  2LKP A;  2LF7 A;  3X2Q H;  1LUJ B;  1ZAR A;  4XLN F;  3CCY A;  3GTQ J;  3TOA A;  3N4M A;  2RV8 A;  1ZRD A;  3ROU A;  2EBI A;  1EKE A;  2LF8 A;  2ESN A;  3ZMS A;  1PP7 U;  1WH7 A;  1XC5 A;  2LKS A;  4B09 A;  3M8E A;  3J80 Z;  3DQV C;  5BNG A;  4I0B A;  3LAP A;  4QPQ A;  1K61 A;  1IN8 A;  4YIF A;  4ZYE A;  1H0M A;  1IZ1 A;  4II2 A;  3DKY A;  3H3U A;  2BY2 A;  4GDF A;  5CVV A;  1OR7 A;  4B47 A;  2CUJ A;  3I53 A;  3OYC A;  3F21 A;  1ZGW A;  1LFB A;  1BW6 A;  1BI2 A;  1TT5 B;  2BV6 A;  4CYC B;  1ZG1 A;  1R49 A;  2JA8 J;  1YRN B;  1FBS A;  2PEX A;  1R71 A;  4RGR A;  4B3X A;  1U6G A;  1JKP C;  3LSG A;  3BG9 A;  5K1Y A;  1ETY A;  5DCM A;  1HSJ A;  3GF2 A;  2DCE A;  2M8G X;  2DJN A;  1YJW I;  1P4X A;  3SYT A;  3BG6 A;  4YEL A;  2IGM A;  1WRJ A;  3OYN A;  1YHQ I;  3T0Y A;  3H92 A;  4Z6Y A;  3IC7 A;  3HOW J;  4OIQ F;  3K4M A;  3JSO A;  4L18 B;  4CCN A;  1B72 B;  3KEO A;  2IGO A;  3JR9 A;  5D5W B;  1V5G A;  3DV8 A;  3RCO A;  2M4K A;  5E8G A;  3RDI A;  3WGH A;  4AU7 A;  4HOB A;  5H6R A;  3W2A A;  2JA5 J;  3R6S A;  3S32 A;  4WXD A;  3VB2 A;  3AG2 H;  1D5Y A;  4M9X A;  2RNJ A;  4ZYG A;  4A5M A;  4Y3O A;  2RAE A;  3SZT A;  2W1O A;  1W4M A;  2W82 A;  4CCO A;  1HQC A;  3E1S A;  1ETK A;  2N8G A;  3J81 Z;  2CV1 A;  1K83 J;  2W24 A;  4UXN A;  1J75 A;  2K86 A;  2W25 A;  3LQQ A;  1HW5 A;  4WF2 A;  3OSF A;  4BYY A;  1YJN I;  3Q3S A;  1ZG3 A;  4XSZ F;  5CYV A;  1IN4 A;  2EV6 A;  1U3E M;  3JTG A;  3T1B A;  3GCM A;  4ENK A;  4AIK A;  3R61 A;  5J40 A;  2XIG A;  1D0Z A;  2VT3 A;  5FKO A;  2EV0 A;  3GYH X;  4L0Z B;  1T98 A;  3WE3 A;  1RPW A;  4M3B A;  3FM3 A;  3P9K A;  1MBE A;  4A3M J;  4UNO A;  1RET A;  2BHZ A;  4F91 B;  1X2M A;  3MVP A;  1U8R A;  3ZQG A;  2WAD A;  2EV5 A;  2E7X A;  1O3T A;  4NDL A;  1SVL A;  2QVO A;  2VE8 A;  1S5L C;  1AWC A;  4UVC A;  3RI4 A;  3H3V K;  1VQ6 I;  1IXR C;  4L5J A;  3C2H A;  3C2G A;  4HLY A;  3SEZ A;  4DBQ A;  2TRT A;  4B3A A;  4B43 A;  2DOE A;  2H8R A;  1D8K A;  4M3E A;  3LWF A;  3QAH A;  4EEF G;  2HFH A;  2DA1 A;  1ZRF A;  3OYK A;  2OZ6 A;  1A6Q A;  3VDX A;  1BBY A;  1ZAO A;  5FRN A;  1YW7 A;  1KQ9 A;  3LNQ A;  3G73 A;  2V6C A;  2DPD A;  3KYL A;  4G6D A;  2XAF A;  1HCR A;  1JUS A;  1XSD A;  5K5R A;  1VQ5 I;  2LMD A;  3DFG A;  2XB0 X;  1OYY A;  2VKH A;  2IS1 A;  2KHM A;  4FQG A;  1JGG A;  3BR2 A;  3RPU A;  3QYE A;  3GTL J;  3F9K A;  4BJ5 C;  3OYI A;  1JTX A;  1WCM J;  1X58 A;  2FBK A;  3TDU C;  3W6J B;  5TGT A;  2K9M A;  2ELH A;  3HGY A;  1YX3 A;  1AU7 A;  2OV7 A;  4V2F A;  5EG0 B;  1T0F A;  3AL0 B;  1V5F A;  2HPI A;  2JSP A;  2F5E A;  5F0H A;  1ACI A;  2M7B A;  1TC3 C;  2CS3 A;  1T6S A;  1G59 A;  4UHT A;  1R4M B;  5CQE A;  5LHG A;  1WKM A;  4JBA A;  5B3S H;  3IRR A;  3GTJ J;  1I3A A;  3FHN A;  2Y69 H;  3J81 K;  1XG1 A;  2DFF A;  1LEB A;  3KP7 A;  1D5V A;  3CQZ J;  1B1B A;  3HXL A;  1HF0 A;  2ELK A;  3DBL B;  2DMQ A;  1BOA A;  4A3C J;  1QVU A;  1R6R A;  5IY5 H;  4HQE A;  3K70 C;  3S3M A;  1LJ9 A;  3DEU A;  1HW1 A;  1TT0 A;  3OYG A;  1YS6 A;  4OAY A;  1G3Y A;  3OYF A;  2L01 A;  4WX9 A;  3SDB A;  5FJ8 J;  1NHA A;  3KP3 A;  2QSG X;  3KP2 A;  1ZN2 A;  2LLK A;  3KYC B;  3ML6 A;  2PJR B;  2I5U A;  1OLT A;  3ZN0 A;  3V7R A;  3LA3 A;  4H4K C;  4F52 A;  4BGD A;  1TL8 A;  4ZZL A;  3M1E A;  3CCU I;  2F5C A;  1YW9 A;  5CPR B;  2VUM J;  2BXZ A;  3QYF A;  2JA7 J;  3U1K A;  1VTN C;  3KYD B;  1PUE E;  2IA1 A;  3QP6 A;  2NVT J;  2BVL A;  3FX3 A;  5FFZ A;  4M6X A;  1KU9 A;  1TTY A;  3BTI A;  3HSF A;  4CZC A;  3S3O A;  2STT A;  2E2I J;  1ZGA A;  3TW6 A;  4HDV A;  3WU2 C;  4RBO A;  3ISP A;  5F0C A;  1O7L A;  4G6T B;  2LRE A;  4U0Y A;  1QNT A;  3E7L A;  4FIS A;  1R1U A;  5HDK A;  4CCK A;  2KT0 A;  4XL9 A;  3TP0 A;  3K4K A;  1JJ6 C;  1SD7 A;  4KN4 X;  3HYI A;  2R7O A;  4D5C A;  4D7N A;  1U9O A;  2EIK H;  1MZB A;  5BPD A;  4IHT A;  3QOE A;  1FOY A;  3MN2 A;  5KCM A;  2BW3 A;  4PFO A;  4LB5 A;  3CZ6 A;  3HRT A;  4P55 A;  2VN2 A;  3V7C A;  1NK3 P;  1E3H A;  5EEA A;  2VIX A;  4P5O A;  2BE5 F;  2CH0 A;  4GFB A;  2XF5 A;  4PJJ A;  3SFI A;  1XB4 A;  3JRC A;  1KU7 A;  3KCC A;  3W2V A;  4A3D J;  4EJV A;  3H5N A;  2XF6 A;  3FXM A;  2L7F P;  2WY8 Q;  3H5R A;  3NAR A;  1BC8 C;  4XKW A;  3H0G J;  1JKR C;  1B59 A;  3K4C A;  2UZK A;  2WAQ N;  3A03 A;  4MHG A;  3GME A;  4XLF A;  2Y9Z A;  1ITY A;  4C30 A;  1LVK A;  2NS0 A;  3IAS 2;  3HKZ N;  1FEX A;  4PGH A;  3KP5 A;  4QTR A;  1ZQ3 P;  1HDP A;  1XX5 A;  4L9N A;  3OR1 C;  4EGY A;  4KIG A;  4CCL A;  1ZHF A;  2X48 A;  2E2J J;  2D5V A;  2HXI A;  1WJF A;  1QGP A;  5GAD J;  2VI6 A;  4BS9 A;  2ADU A;  4X0G A;  4BNC A;  1T39 A;  3WG9 A;  4KIF A;  3CUQ A;  3BLY A;  3I5U A;  1RC9 A;  3TED A;  1PVE A;  3BRO A;  2MSY A;  3DPT A;  4L9V A;  3H3Z A;  2I8D A;  3HTU A;  4XK4 A;  5D5V B;  1Z9C A;  1HW2 A;  3M4O J;  1JHH A;  2EZK A;  2HOA A;  2JPB A;  2JVG A;  2QWW A;  3ZPL A;  3C2B A;  2DT5 A;  4MNU A;  2FOW A;  1LDK B;  5FLX K;  1WJD A;  5FKM A;  2LTP A;  2UXX A;  1JTY A;  3ZQH A;  4FT8 A;  1W36 D;  1LE8 B;  3PM1 A;  2CQQ A;  4ON0 A;  4TV7 A;  4NQW A;  3OIO A;  3RZD J;  2HYJ A;  3QPS A;  3BY6 A;  2LBF A;  5CVU A;  2A68 F;  3WTV C;  1JE8 A;  1REP C;  1IF1 A;  5L3G A;  2A69 F;  2QF7 A;  4CDG A;  2IXS A;  1YIJ I;  4C2U A;  1VND A;  1M1E B;  3JCU C;  4U0V A;  4B48 A;  2VPR A;  4BQA A;  4Q48 A;  3KP4 A;  4XLP F;  5J1U A;  1B4A A;  2CFO A;  1MBK A;  2QQ9 A;  5H6Q A;  3FIS A;  2QBY A;  2DA2 A;  5JR3 A;  4MQV A;  4R79 A;  2F4I A;  1W0T A;  5ERI A;  3IAM 2;  3E5U A;  3GO5 A;  4A3E J;  1JT6 A;  2FUG 2;  2XGC A;  3BR5 A;  4J19 A;  4KIB A;  3WG7 H;  4L9J A;  3TGN A;  1VQM I;  1J09 A;  3RKQ A;  1MND A;  2P7V B;  3ZCO A;  3L1P A;  2ZFW A;  2X85 A;  2E60 A;  4Y13 A;  3ZQF A;  3GVA A;  5IP9 J;  1YIO A;  2V26 A;  1TWH J;  4G7O F;  3VFZ A;  3BPV A;  5KAF C;  2CQ7 A;  2LNB A;  4CHU A;  5DEQ A;  4A0Z A;  2ZJR F;  3HJE A;  1B6A A;  2PMZ N;  1D8J A;  4EAT A;  3AG1 H;  3WOD F;  1ORK A;  2R7F A;  4GXO A;  1FOW A;  2DK5 A;  3JRG A;  4XRF A;  1K79 A;  3QOP A;  5CVI A;  5FD6 A;  3TKY A;  1K78 A;  3CES A;  1PUF A;  1FP1 D;  2MYS A;  2J5O A;  4XRS A;  2CU7 A;  4AVP A;  2HU9 A;  2ID6 A;  4AVZ A;  1MMA A;  2NVX J;  1D0Y A;  1O7F A;  2OD5 A;  2ZXI A;  3ZXS A;  3ZGK A;  2MA3 A;  2O03 A;  2CO5 A;  2HQR A;  1QU3 A;  3V8K A;  3S1R J;  2EWN A;  5AIP A;  3TQN A;  5FLX Z;  2FNP A;  1DPR A;  2ZO4 A;  3E0J B;  4PDK A;  1UG2 A;  4XBF A;  1W5T A;  1VQ7 I;  5L3E A;  2ZME B;  2HTS A;  3M7G A;  3WTT C;  3B6C A;  2DN0 A;  4W97 A;  1GXQ A;  4BXX J;  1ZYR F;  2CUE A;  3BTC A;  1UMQ A;  3C3W A;  2VJ5 A;  4H0E A;  2HPM A;  1RIO H;  1HKS A;  3EYI A;  4B4C A;  2ZXJ A;  1Z3X A;  3GEZ A;  2H27 A;  3HOX J;  4RAF A;  1AA7 A;  2FD5 A;  1X3Z B;  2LY2 A;  4IF4 A;  1IUF A;  3L00 A;  3JRA A;  3SHF A;  2HGC A;  4A6E A;  3BCA A;  3FKJ A;  2HR3 A;  1P4A A;  1DDN A;  1YW8 A;  5IT9 Z;  1AKH A;  1RZ4 A;  2P4W A;  5ICG A;  4I02 A;  4U0W A;  3GBG A;  3BQY A;  2IA0 A;  3RYP A;  2R7W A;  4HA8 A;  2M5W A;  2XDV A;  2YX4 A;  2OJE D;  5L3D A;  3SEQ A;  4XON A;  2NRA C;  2CW8 A;  3ABK H;  2KJB A;  4F3Q A;  1YRN A;  3GZ5 A;  4KUM A;  1X3U A;  3K1P A;  4UB6 C;  1FJL A;  4M6V A;  1DGW Y;  2LK2 A;  4WXC A;  3K9T A;  4A3L J;  4MTE A;  3O8H A;  5E17 F;  4HNT A;  3QP5 A;  3VYT B;  4XLH A;  3BG3 A;  1X1A A;  1C0W A;  2GWR A;  2QQB A;  3H5A A;  5E18 F;  4HDU A;  1N25 A;  2XVC A;  2D1H A;  1VQ9 I;  2ME0 A;  1RR8 C;  2KDO A;  2BEO A;  2BGC A;  1XDU A;  2ZBK A;  3HHH A;  5A2Q Z;  4DOZ A;  1QZY A;  2DYS H;  4BY7 J;  5HNH A;  1VFC A;  2R7X A;  3FBN B;  3CJR B;  1FP2 A;  1I3Q J;  1OKR A;  4FAS D;  1P7I A;  4K2E A;  5JFR A;  3CD6 I;  3CCJ I;  2P6T A;  5KHD A;  2M7A A;  1GLN A;  4BY1 J;  5E3O A;  1SFO J;  2Q0O A;  1TWC J;  2RRE A;  2D45 A;  2KL4 A;  4UUS A;  3VSL A;  1BR1 A;  2ECC A;  2ELJ A;  1RUO A;  1TWG J;  1E3P A;  4I98 B;  4ZDP A;  2HVS A;  3GX4 X;  2YUS A;  5LGT A;  1SVO A;  2FML A;  2Z16 A;  3IH2 A;  2DW4 A;  2HVQ A;  4F93 B;  2HTJ A;  2WA0 A;  4BXF A;  3IP4 B;  4CUG A;  2ZJP F;  5LD2 C;  1QBJ A;  1O57 A;  1ZG5 A;  1TW3 A;  2LRD A;  1ODD A;  5JLW A;  4LGW A;  2QM3 A;  2QKM B;  1S6L A;  2E2H J;  2L7Z A;  2NVY J;  2K3F A;  4HG2 A;  3SZG A;  3MWM A;  4G8X A;  5D8K B;  5LHI A;  2AXT C;  4IHY A;  3Q9V A;  2BVM A;  5E3N A;  1QA6 A;  5K5O A;  3HTS B;  2R93 J;  5BOX A;  3S1N J;  4V2G A;  2HKO A;  2VT2 A;  2M8E A;  1MD0 A;  3CCM I;  3A0H C;  2P8T A;  2F48 A;  2A05 A;  1P2F A;  1CQT A;  4BE0 A;  3BJ6 A;  3HBL A;  2V1D A;  4PFP A;  5L3C A;  1B9M A;  3S16 J;  2XPW A;  4IPA A;  4U7D A;  5LEJ A;  5FGM A;  3KZZ A;  1HST A;  4LLG F;  5IYD J;  1ETV A;  2OA4 A;  3HSE A;  4PJN A;  1DU6 A;  5GAG J;  1VQO I;  2QGU A;  2EJR A;  4RLQ A;  2DMN A;  3RPQ A;  4M72 A;  2CSO A;  1OR7 C;  2JK3 A;  1L0O C;  2HWV A;  3AAF A;  4M3D A;  1EJ9 A;  2NOJ B; 
#chains in the Genus database with same CATH homology
 4U88 A;  2GAU A;  5E1Z B;  3DF8 A;  4ZYD A;  2OBP A;  3CUQ C;  1Z6T A;  2HDC A;  3B02 A;  3CJN A;  4NB5 A;  5F6F A;  3ULQ B;  1XMA A;  2L4M A;  2O3F A;  1S7A A;  3IHU A;  2DAO A;  2G7H A;  3V8L A;  2VBW A;  3T8T A;  4HAM A;  4HBL A;  5AON A;  3B73 A;  5HVQ C;  2DTR A;  1RUN A;  1FLI A;  3Q9S A;  5KK1 A;  1SD5 A;  3I59 A;  2CQK A;  2KRF A;  2GXB A;  4RS8 A;  4CYD A;  1XSX A;  3E6D A;  3CLO A;  3O3K A;  3Q5F A;  4DNC A;  3IWZ A;  1W7P B;  2JTV A;  1E2X A;  1KU2 A;  3KP6 A;  4HYE A;  1H9T A;  3BWG A;  3HSR A;  3HRS A;  3GWZ A;  2JPC A;  4G9Y A;  1I6X A;  2ACJ A;  2IRF G;  2FBH A;  1GXP A;  3V8J A;  4IVN A;  2XAG A;  1FBQ A;  4HF2 A;  4I0A A;  1IRF A;  2IVM A;  1HBX G;  1UST A;  2V1U A;  2FE3 A;  5LLQ A;  4GGG A;  3NEU A;  2VXZ A;  2LSO A;  2O8X A;  1BM9 A;  3I54 A;  3SZP A;  2FU4 A;  4YG2 F;  5IT9 K;  2VOO A;  3L7W A;  4Q47 A;  3IWF A;  1W7P D;  3BOQ A;  4N9H A;  3ZMT A;  2XGX A;  1R23 A;  5DYM A;  4HX7 A;  3S2W A;  5JVT A;  4O5V A;  2XRO A;  1G4D A;  1ZRE A;  1J59 A;  3DP7 A;  2OZU A;  1TLH B;  2XAJ A;  3MEX A;  3R60 A;  1IN7 A;  3WTU C;  3FMS A;  1S8N A;  3EYY A;  1ZH5 A;  3F22 A;  1BJA A;  1ONV A;  2W57 A;  2Z33 A;  2EK5 A;  3E6C C;  2VBX A;  1SFX A;  2FSW A;  1JHF A;  3RKX A;  4CIC A;  4MEY F;  4ZZD A;  3K2Z A;  3E5Q A;  1EH6 A;  3F8C A;  2F2E A;  2EFO A;  5LHH A;  1JXS A;  2TDX A;  4R1H A;  4I09 A;  3SXY A;  3N97 A;  2QQA A;  2KKO A;  1SMT A;  3MAJ A;  4DQ2 A;  4I01 A;  1FC3 A;  2YX7 A;  3GFM A;  1R5H A;  2DU9 A;  1SD6 A;  1LDD A;  1KGS A;  2FEZ A;  2LDU A;  3KEQ A;  2F5F A;  2Z99 A;  1LB2 A;  2DPU A;  2X4H A;  2RQP A;  2D1V A;  3MFK A;  3P9C A;  2L02 A;  3LA2 A;  4HF1 A;  2IW5 A;  5D6E A;  1XDS A;  4HX8 A;  1G3T A;  2B0L A;  5BQT A;  1FYM A;  2HQN A;  5DCF A;  1U5T C;  4WK8 F;  1U78 A;  2JT1 A;  3F6O A;  3W6K B;  1DUX C;  4JQF A;  2G9W A;  2Z5U A;  5BPI A;  4GO1 A;  3VEP A;  3T5X A;  1XGO A;  3KE2 A;  5E20 A;  5ILU A;  3J7A O;  4FHT A;  4Y15 A;  2D2W A;  2RKH A;  4WCG A;  1P6R A;  4G7Z F;  1FPQ A;  1QPM A;  2DK8 A;  1XSV A;  2FF4 A;  3BPX A;  1SMY F;  3CDH A;  1IRG A;  4HLX A;  1L3L A;  3LST A;  3JAM Z;  3L09 A;  2MLK A;  5ICE A;  4KMF A;  4JK1 X;  3E6M A;  2DLL A;  2WTE A;  1TQP A;  3IL2 A;  4RB3 C;  4CXF A;  1OYW A;  3E6B A;  3OOP A;  5DUK A;  1FT9 A;  1TW2 A;  2CWE A;  3I59 B;  4YII A;  1UHW A;  4EM2 A;  3KLO A;  3BJA A;  1BIB A;  3HRU A;  3ZQ7 A;  3WE2 A;  2XUB A;  3DXJ F;  5DUI A;  1G3W A;  2ZME A;  2JRT A;  1EV7 A;  3L9F A;  2NNN A;  2P5K A;  3E3V A;  4FX0 A;  1K6O A;  2IA2 A;  3PQK A;  1UHM A;  3FWE A;  4RGU A;  1KU3 A;  2UWM A;  1R22 A;  3DKW A;  5D6F A;  3NRV A;  3CUQ B;  3ZMV A;  2CGP A;  1ZRC A;  1F4K A;  5HDG A;  4UVB A;  1QZZ A;  3RYR A;  2KIM A;  2Y48 A;  2HYG D;  2YSR A;  4RB2 C;  3CO7 C;  3NQO A;  3F72 A;  4LFU A;  2R7D A;  4A12 A;  5HS7 A;  2K7L A;  2PFB A;  4AIJ A;  5L3F A;  4BHC A;  4MEX F;  4F7Z A;  1W5S A;  1J0R A;  3WTY C;  5ICC A;  4R8H A;  1J2X A;  2BBY A;  4KYW A;  4OMZ A;  2V9V A;  4CO8 A;  2GXG A;  1ON2 A;  2BYV E;  2RN7 A;  2RC4 A;  2W84 A;  4IRG A;  3ZMZ A;  4KIC A;  3J80 K;  4EMS A;  4HF0 A;  4RGS A;  1BI3 A;  1K7A A;  2FMY A;  1P4W A;  1Z6R A;  1USS A;  2DBB A;  4M73 A;  3EDP A;  3GLX A;  4EQQ A;  4CGZ A;  2ETH A;  4RB1 A;  2AXL A;  1IN6 A;  4IXA A;  3HOT A;  4ESF A;  2PG4 A;  1R7J A;  1R5G A;  2P5V A;  1OMI A;  2VOD A;  2ZCW A;  1LQ1 A;  1BIA A;  4IJA A;  5JI6 A;  2QZ8 A;  4M74 A;  2ZNY A;  3BZ6 A;  1G6N A;  4D0P A;  2MLG A;  2QLZ A;  4LB6 B;  5ILV A;  1DP7 P;  4XSX F;  2UXN A;  5ED4 A;  1FY7 A;  2H09 A;  1MJ9 A;  2PJP A;  2QEN A;  1Z05 A;  3WGI A;  4A0Y A;  4EJW A;  4MGR A;  2H94 A;  1PDN C;  2HZT A;  1GVJ A;  4UVA A;  1DPU A;  4Z2Y A;  4OIN F;  3TO6 A;  3HOS A;  4LMY A;  5LBQ A;  2V79 A;  3KFW X;  4KN7 X;  1QO0 D;  1FOK A;  2H6B A;  4BAY A;  5HLH A;  1FSH A;  3L2C A;  1XN7 A;  3D0S A;  4G94 A;  4HV6 A;  2JSC A;  3F8M A;  2P5L C;  5H20 A;  3HIF A;  2VBZ A;  4LG0 B;  2P7C B;  1J9I A;  5J6X A;  5TRD A;  2AS5 F;  3I64 A;  4HW0 A;  2A3S A;  3FXR A;  2G7U A;  2M30 A;  4GYG A;  2A5Y B;  3I4P A;  1YLF A;  3K0L A;  3K69 A;  2O0Y A;  1MJA A;  1D3Y A;  1H9G A;  3CUO A;  1I1S A;  2M45 A;  2HYF A;  5CLS A;  4IHS A;  4HX4 A;  4I2O A;  3LAJ A;  3IKT A;  3GFJ A;  1ULY A;  1U5T B;  2QUF A;  3TOB A;  1FBU A;  1SFE A;  4P9U A;  3BJO A;  4GYI A;  1YTY A;  4P9F A;  2NAZ A;  5BS6 A;  4Q4Z F;  4EM1 A;  1FSE A;  2QYO A;  2GA1 A;  2VBY A;  1R58 A;  1FYK A;  1T2K A;  1MDM B;  5ICF A;  4ENJ A;  2F5D A;  4ENN A;  2IP2 A;  2VON A;  4BXU A;  2L4A A;  2COM A;  3REO A;  1FNN A;  1G3S A;  3RTR A;  4MQ9 F;  5D5X B;  3M9A A;  3V7S A;  1STZ A;  2FBI A;  3QPH A;  4I7H A;  2E7W A;  3QPT A;  3ZMU A;  2W85 A;  2DO7 A;  2HS5 A;  1O3R A;  1SD4 A;  4KMU X;  1I5Z A;  3JW4 A;  5FFX A;  1R1T A;  4RAY A;  1FYL A;  1KYW A;  1S29 A;  2M1B A;  2FA5 A;  1KA8 A;  2STW A;  3BP8 A;  2A61 A;  3MQ0 A;  4YFK F;  5HS8 A;  1XGN A;  3JTH A;  2DI3 A;  1O3Q A;  2WWY A;  2KIF A;  1BI1 A;  3CO6 C;  4G7H F;  1XCV A;  2MC3 A;  3PFI A;  1W7P A;  4AIH A;  4LK0 F;  2YR2 A;  4BHB A;  1V4R A;  1IXC A;  3GXO A;  5AIQ A;  1YQA A;  3GFI A;  2DQR A;  3FXU A;  4Y17 A;  3V4G A;  4EGZ A;  2OQR A;  2CFX A;  4B8X A;  1BI0 A;  4PCQ A;  2J5P A;  4EVI A;  2NYX A;  3FF5 A;  3PQJ A;  1LEA A;  3CTA A;  3O6B B;  3ZP5 A;  1XMK A;  1MJB A;  2RGV A;  3ECH A;  2IJL A;  5FO5 A;  4ZYH A;  1BN5 A;  2K4B A;  1WSU A;  1F1Z A;  1I1G A;  2XHK A;  1BC7 C;  1IW7 F;  1Z91 A;  1UCR A;  3TO7 A;  1B9N A;  4ESJ A;  1WQ2 A;  3WTX C;  1IN5 A;  4RAZ A;  1IAW A;  4WWC A;  2Y75 A;  5DD4 A;  5FD5 A;  1GHC A;  2EA4 A;  3IKV A;  1ZLJ A;  1E17 A;  3P7N A;  5D4R A;  3F23 A;  2EFW A;  2PQ8 A;  1TBX A;  5J8C A;  1KQ0 A;  2ZNZ A;  2EFN A;  4YFX F;  1FZP B;  1YFH A;  5K5Q A;  2V1X A;  2O61 A;  2CYY A;  1U2W A;  5DD8 A;  2XKP A;  2O6G E;  1IUY A;  2PN6 A;  5D5U B;  2H6C A;  2IPQ X;  4L0Y B;  1J7K A;  2PBI A;  3KLN A;  2XAS A;  5FB2 A;  1WI9 A;  2OAZ A;  1YG2 A;  2Z9O A;  4LLN A;  3KZY A;  3ABT A;  2E1N A;  5BMZ A;  1LNW A;  5DCM B;  2P6S A;  2Q8K A;  1WWX A;  4ETS A;  3MZY A;  1OPC A;  2MD5 A;  3LQR A;  2MBF A;  4PZJ A;  3QRF F;  5E1X A;  3O2P E;  3EUH A;  4QLC U;  3F8N A;  3HUG A;  1SAX A;  3F3X A;  1Z1D A;  2DFI A;  5LGN A;  4OIR F;  4HQM A;  4KT5 C;  4N0B A;  3ERE D;  1HKT A;  3F8F A;  3ELK A;  1U5T A;  1MGT A;  3RKW A;  5TJJ A;  1ZLK A;  1R1V A;  4OMY A;  5LGU A;  3LA7 A;  4LD5 A;  3WGG A;  1QQI A;  2K4J A;  4S04 A;  4AWX B;  2FQ3 A;  3RKY A;  4QWQ A;  4A5N A;  4EJO A;  3GFL A;  4CZZ A;  1TQM A;  1MKM A;  3WTW C;  4G6Q A;  2L54 A;  4KA4 A;  5LEK A;  2KJC A;  1LVA A;  4HV5 A;  2HEO A;  1YYV A;  5LRS A;  3HRM A;  1KYZ A;  2EFQ A;  3JSP A;  1CF7 A;  4UV8 A;  3IRQ A;  1TNS A;  4L5I A;  4EM0 B;  3HHG A;  2NNY A;  1I27 A;  3QU6 A;  5DV5 A;  5EEG A;  2K02 A;  3GUD A;  3LFK A;  3FHZ A;  2PLY A;  1TNT A;  4NHJ A;  4UV9 A;  2JZY A;  5L3B A;  2WC2 A;  2VOP A;  5J8F A;  2PI0 A;  4HZF A;  3RJP A;  3FM5 A;  4BH9 A;  1A04 A;  2A07 F;  4A6D A;  4M71 A;  2GZW A;  3GZ6 A;  2EB7 A;  3BDD A;  4M6Y A;  3C7J A;  3F8B A;  1HXD A;  2MH9 A;  3I58 A;  4OOI A;  5ILS A;  3JAM K;  1XGM A;  3MZH A;  2ISY A;  4PGG A;  3K1M A;  1R36 A;  3R4K A;  1OYI A;  3R0J A;  3M8F A;  5LRR A;  4U7B A;  1XGS A;  5CVJ A;  4S05 A;  3ZMD A;  2RDP A;  1HKQ A;  1ON1 A;  5F1R A;  1F5T A;  4O3M A;  1Y0U A;  2XRN A;  1O3S A;  3P9I A;  2HKX A;  2ZKZ A;  2CW0 F;  4A0X A;  2Z3Y A;  5IT3 A;  4L9T A;  4EV0 A;  5HOO A;  3WU0 A;  4EJT A;  3G3Z A;  1EH8 A;  3GW2 A;  1T38 A;  2ISZ A;  4ASN A;  2YPR A;  2FNA A;  1XCB A;  1PP8 F;  3DPL C;  5JHU A;  2A6H F;  5D8L B;  3ZN1 A;  4P96 A;  5CJ9 A;  1YS7 A;  4IRI A;  2VC0 A;  4OIO F;  1J5Y A;  2X0L A;  2EFP A;  2Y0M A;  1FWZ A;  3TO9 A;  6PAX A;  2ESH A;  1XD7 A;  1V3F A;  4ESB A;  2EA2 A;  2HOE A;  3FMQ A;  5HLI A;  5F64 A;  4LLL A;  2GIV A;  2M87 A;  5DDG A;  2XAH A;  3D5L A;  5E1W A;  3WTS C;  1MDM A;  1FX7 A;  2ZJ2 A;  5E8I A;  3T8R A;  2CG4 A;  4IRH A;  2Q2E A;  3OV8 A;  5D4S A;  2R3S A;  1SFU A;  4GCV A;  2K27 A;  1S3J A;  2OU2 A;  5CVR A;  1LDJ A;  2E1C A;  1S7O A;  2FOK A;  2RVC A;  3TDZ C;  2QBY B;  3WU1 B;  1YO5 C;  1JGS A;  3SFZ A;  4KDP A;  3ABU A;  2OQG A;  2PMH A;  3ECO A;  4FX4 A;  1UB9 A;  5HS9 A;  3FZV A;  3U9G A;  4MTD A;  1CGP A;  1R00 A;  3E97 A;  4OU0 A;  3C18 A;  3RIR A;  1TQI A;  4RB0 A;  1RNL A;  4ZH4 F;  4BHP A;  1K78 B;  2YU3 A;  3VOE A;  2FRH A;  2XAQ A;  2C6Y A;  4LG0 A;  5KVR A;  2XV4 S;  4EJU A;  2A6E F;  1IXS B;  3COA C;  5HDN A;  2MH2 A;  4KFC A;  3K1N A;  3F6V A;  3KET A;  1UFM A;  4ENM A;  1Z7U A;  2KIU A;  3FMR A;  4LK1 F;  3E5X A;  3MCZ A;  1P92 A;  2GA2 A;  4WXH A;  3I71 A;  3VOD A;  3EET A;  4RGX A;  1CF7 B;  5HLG A;  3SQN A;  4A2U A;  2L3D A;  3R0A A;  4E70 A;  1ZGJ A;  1RI7 A;  3U1D A;  4O6J A;  2IT0 A;  4Q5S F;  3QU3 A;  3U2R A;  1EH7 A;  4M9S A;  4KNY A;  4OIP F;  2WV0 A;  4YFN F;  5A2Q K;  1Q1H A;  3FXQ A;  2DQL A;  2FXA A;  3WTZ A;  3EQL F;  2XKO A;  4N9I A;  2PMU A;  1F9N A;  4M9Z A;  5EEH A;  1AOY A;  1KQ8 A;  2VC1 A;  2VE9 A;  4LJZ F;  4UUV A;  2GQQ A;  3C1D A;  4AD9 A;  3I0T A;  2LKP A;  2LF7 A;  1ZAR A;  4XLN F;  3TOA A;  3N4M A;  2RV8 A;  1ZRD A;  3ROU A;  2LF8 A;  2ESN A;  3ZMS A;  1PP7 U;  4B09 A;  3M8E A;  3J80 Z;  3DQV C;  4I0B A;  3LAP A;  1IN8 A;  4YIF A;  4ZYE A;  1H0M A;  1IZ1 A;  3H3U A;  5CVV A;  1OR7 A;  3I53 A;  3F21 A;  2BV6 A;  1BI2 A;  1ZG1 A;  1FBS A;  2PEX A;  4RGR A;  1U6G A;  5K1Y A;  5DCM A;  1HSJ A;  3GF2 A;  1P4X A;  1WRJ A;  3T0Y A;  3H92 A;  3IC7 A;  4OIQ F;  3JSO A;  4L18 B;  3KEO A;  5D5W B;  3DV8 A;  5E8G A;  3RDI A;  3WGH A;  4HOB A;  5H6R A;  3R6S A;  4WXD A;  3VB2 A;  4M9X A;  2RNJ A;  4ZYG A;  4A5M A;  3SZT A;  1W4M A;  1HQC A;  3J81 Z;  2W24 A;  4UXN A;  1J75 A;  2K86 A;  2W25 A;  3LQQ A;  1HW5 A;  4WF2 A;  4BYY A;  1ZG3 A;  4XSZ F;  5CYV A;  1IN4 A;  2EV6 A;  1U3E M;  3JTG A;  3T1B A;  4ENK A;  4AIK A;  3R61 A;  2XIG A;  2VT3 A;  2EV0 A;  3GYH X;  4L0Z B;  1T98 A;  3WE3 A;  3FM3 A;  3P9K A;  4UNO A;  1U8R A;  2EV5 A;  2E7X A;  1O3T A;  2QVO A;  2VE8 A;  1AWC A;  4UVC A;  3RI4 A;  1IXR C;  4L5J A;  4HLY A;  1D8K A;  3LWF A;  3QAH A;  2HFH A;  1ZRF A;  2OZ6 A;  1BBY A;  1ZAO A;  1YW7 A;  1KQ9 A;  3G73 A;  2V6C A;  2DPD A;  4G6D A;  2XAF A;  1XSD A;  5K5R A;  3DFG A;  1OYY A;  3RPU A;  2FBK A;  3TDU C;  3W6J B;  2ELH A;  1T0F A;  2F5E A;  1T6S A;  4UHT A;  5LHG A;  1WKM A;  4JBA A;  3IRR A;  3J81 K;  1LEB A;  3KP7 A;  1D5V A;  1B1B A;  1BOA A;  4HQE A;  1LJ9 A;  3DEU A;  1HW1 A;  1YS6 A;  1G3Y A;  2L01 A;  4WX9 A;  1NHA A;  3KP3 A;  3KP2 A;  1ZN2 A;  3ML6 A;  3ZN0 A;  3V7R A;  3LA3 A;  4ZZL A;  3M1E A;  2F5C A;  1YW9 A;  1VTN C;  1PUE E;  2IA1 A;  3QP6 A;  5FFZ A;  3FX3 A;  4M6X A;  1KU9 A;  1TTY A;  3HSF A;  2STT A;  1ZGA A;  4HDV A;  3ISP A;  1O7L A;  4U0Y A;  1QNT A;  5HDK A;  1R1U A;  1SD7 A;  4KN4 X;  3HYI A;  1MZB A;  5BPD A;  4IHT A;  4LB5 A;  3HRT A;  4P55 A;  2VN2 A;  3V7C A;  4P5O A;  2BE5 F;  1XB4 A;  1KU7 A;  3KCC A;  4EJV A;  1BC8 C;  1B59 A;  2UZK A;  4MHG A;  2NS0 A;  4PGH A;  3KP5 A;  4L9N A;  4EGY A;  4KIG A;  1ZHF A;  1QGP A;  2ADU A;  4BNC A;  1T39 A;  3WG9 A;  4KIF A;  3CUQ A;  3I5U A;  3BRO A;  3DPT A;  4L9V A;  5D5V B;  3H3Z A;  3HTU A;  1HW2 A;  1Z9C A;  1JHH A;  2JPB A;  2QWW A;  3ZPL A;  2DT5 A;  4MNU A;  1LDK B;  5FLX K;  2UXX A;  4FT8 A;  4ON0 A;  4TV7 A;  4NQW A;  3BY6 A;  5CVU A;  1JE8 A;  2A68 F;  3WTV C;  1REP C;  1IF1 A;  5L3G A;  2A69 F;  4CDG A;  4U0V A;  4BQA A;  4Q48 A;  3KP4 A;  4XLP F;  1B4A A;  2QQ9 A;  5H6Q A;  2QBY A;  5JR3 A;  4MQV A;  4R79 A;  5ERI A;  3E5U A;  3GO5 A;  4KIB A;  4L9J A;  3TGN A;  2P7V B;  2ZFW A;  4Y13 A;  3GVA A;  1YIO A;  4G7O F;  3VFZ A;  3BPV A;  2LNB A;  4CHU A;  5DEQ A;  4A0Z A;  1B6A A;  1D8J A;  3WOD F;  2R7F A;  4GXO A;  2DK5 A;  4XRF A;  1K79 A;  3QOP A;  5CVI A;  5FD6 A;  3TKY A;  1K78 A;  1FP1 D;  2J5O A;  4AVP A;  1O7F A;  2OD5 A;  2MA3 A;  2O03 A;  2CO5 A;  2HQR A;  3V8K A;  2EWN A;  5AIP A;  3TQN A;  5FLX Z;  2FNP A;  1DPR A;  2ZO4 A;  4PDK A;  4XBF A;  1W5T A;  5L3E A;  2ZME B;  2HTS A;  3M7G A;  3WTT C;  1GXQ A;  1ZYR F;  3C3W A;  4H0E A;  1RIO H;  1HKS A;  3EYI A;  2ZXJ A;  3GEZ A;  2H27 A;  4IF4 A;  3L00 A;  3SHF A;  2HGC A;  4A6E A;  2HR3 A;  1P4A A;  1DDN A;  1YW8 A;  5IT9 Z;  1RZ4 A;  2P4W A;  5ICG A;  4I02 A;  4U0W A;  2IA0 A;  3RYP A;  4HA8 A;  2M5W A;  5L3D A;  2YX4 A;  2NRA C;  2KJB A;  3GZ5 A;  4KUM A;  1X3U A;  3K1P A;  4WXC A;  3K9T A;  4MTE A;  5E17 F;  3QP5 A;  1C0W A;  2GWR A;  2QQB A;  5E18 F;  4HDU A;  2XVC A;  2D1H A;  2BEO A;  2BGC A;  1XDU A;  2ZBK A;  3HHH A;  5A2Q Z;  1QZY A;  1FP2 A;  1OKR A;  4K2E A;  5JFR A;  2P6T A;  2Q0O A;  2D45 A;  1RUO A;  4I98 B;  3GX4 X;  5LGT A;  2FML A;  2DW4 A;  2HTJ A;  1QBJ A;  1O57 A;  1ZG5 A;  1TW3 A;  1ODD A;  4LGW A;  2QM3 A;  1S6L A;  5D8K B;  3MWM A;  4G8X A;  5LHI A;  3Q9V A;  5K5O A;  3HTS B;  5BOX A;  2HKO A;  2VT2 A;  2M8E A;  1MD0 A;  2P8T A;  1P2F A;  3BJ6 A;  5L3C A;  2V1D A;  1B9M A;  4IPA A;  4U7D A;  5LEJ A;  5FGM A;  3KZZ A;  1HST A;  4LLG F;  2OA4 A;  3HSE A;  2EJR A;  3RPQ A;  4M72 A;  2CSO A;  1L0O C;  2HWV A;  3AAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...