4RGUA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with ferulic acid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
141
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLSTFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with ferulic acid
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription
molecule keywords Repressor protein
total genus 43
structure length 141
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rguA00
4EJUA 1F9NA 1R36A 5LRSA 2ISZA 3MFKA 1H9TA 5K1YA 2CFXA 1ZN2A 1SD7A 3HIFA 4UHTA 5CVRA 5HDNA 2GQQA 2E1NA 1PP7U 2PJPA 3CLOA 2Z33A 4ENNA 2O61A 1TNSA 1ZGAA 1B6AA 1BIAA 5JI6A 2B0LA 4O5VA 3K0LA 1PUEE 3KZYA 2M45A 2XROA 1T0FA 2F5FA 1R1UA 5D4SA 4WXHA 3J80Z 1G3SA 2XVCA 1KQ9A 2UXNA 1XSVA 2OD5A 2GZWA 2W24A 1J9IA 3O6BB 2F2EA 5CVIA 4CXFA 2XAHA 5A2QZ 1XMAA 3PFIA 2VBWA 4UV9A 1W7PB 1IXSB 5E1ZB 3EETA 4Y15A 2ELHA 4MHGA 2M8EA 3QRFF 2HFHA 1HKTA 2JTVA 3FWEA 4EJTA 3CJNA 3MAJA 1S6LA 1YLFA 4HQMA 3KEQA 1ON2A 1BJAA 1KQ8A 1ON1A 3OOPA 4PGGA 1XB4A 1EH8A 4F7ZA 1B9NA 4KYWA 1OKRA 3HRTA 1IN8A 1R5HA 1HW2A 3KCCA 3KP7A 2RDPA 2GXBA 1WWXA 1HKQA 1T2KA 3AAFA 2V79A 3D5LA 4M71A 3I54A 1JGSA 1YIOA 5ILUA 2CSOA 1R1TA 1YW9A 4KT5C 3KP2A 2IRFG 1Z6RA 1U8RA 1BN5A 4IRIA 3WODF 4OINF 4KMFA 3RPQA 4H0EA 4NQWA 2BYVE 1XD7A 1FNNA 1FP1D 1XN7A 3G73A 1IUYA 5D6EA 1B59A 1BI1A 5CVJA 4LB6B 1XDUA 1YG2A 1UHMA 1QZZA 2IA1A 3TDUC 5ERIA 3ZN0A 2W25A 1FSHA 2QWWA 3WTUC 4Z2YA 3LA7A 5ICEA 1D5VA 1FBQA 2OQRA 3KZZA 3WU0A 3GWZA 1YFHA 5HS9A 4MGRA 3IRRA 2J5PA 2PMUA 4N0BA 2D2WA 3GVAA 3GXOA 3FF5A 4HAMA 2OAZA 2L01A 4GO1A 5D5UB 3ECHA 1STZA 2ACJA 3IHUA 1RZ4A 1HBXG 4RGRA 3GX4X 4LG0B 2M5WA 2LSOA 1OR7A 5J8CA 2OA4A 1O3RA 4ZH4F 2RN7A 1TW3A 1FP2A 5IT3A 3M7GA 2VOPA 5FD5A 1DP7P 3KP4A 3T8TA 1O3QA 4LG0A 4AVPA 3KP5A 2BBYA 1QQIA 2P7CB 3V7RA 2DPDA 2EK5A 4HBLA 2R7DA 4ENKA 3JTHA 2CQKA 2LKPA 5D6FA 3WTYC 4U0WA 4D0PA 4M6XA 4YG2F 4G8XA 4M9SA 1FY7A 2XAQA 1ZRDA 2VBZA 3HRSA 1IW7F 2YSRA 4EM2A 1I5ZA 3KETA 5BQTA 4A12A 2WC2A 3E5UA 1SD6A 4M73A 1MZBA 1LEAA 3BJOA 4ETSA 3WGGA 2VN2A 2ADUA 3HYIA 2DBBA 3I59A 3GFIA 4ON0A 1K7AA 1QPMA 3E97A 3BOQA 4K2EA 3GO5A 3DFGA 3RJPA 2YU3A 4CZZA 4Q5SF 4ENJA 3L00A 5HDKA 1ZRCA 1BI2A 2ZXJA 4U88A 2QM3A 1FOKA 4PGHA 3CUQA 1W4MA 1GXPA 4HLXA 2Z9OA 3WGIA 2K86A 3T5XA 3L2CA 5J6XA 2TDXA 1YW8A 2QENA 3TO6A 1IN6A 2VT2A 3LQRA 4EV0A 1R00A 5A2QK 4A0YA 2HDCA 4IJAA 1FYKA 5FLXZ 2O8XA 5F64A 4YIFA 1BC7C 1G3YA 3FM5A 2V6CA 5D5VB 4EJVA 5L3EA 2HS5A 4R1HA 2IW5A 5E1XA 4ZYEA 1F1ZA 1J5YA 3C1DA 2FF4A 4RB0A 2FEZA 2MH2A 4HQEA 1J0RA 2J5OA 1W5TA 3LAJA 2MC3A 3F6OA 1MD0A 4HF1A 4OMYA 3I64A 2YX7A 3ZN1A 3DXJF 3BZ6A 1RIOH 1U3EM 2KIUA 4IXAA 1T98A 2ESNA 3PQKA 2H09A 2NNYA 3FXQA 5DV5A 4RB1A 3BWGA 4BHPA 3M9AA 4RGUA 3HSFA 3VFZA 1L0OC 4BYYA 3GFMA 1O3SA 1Z05A 3HOSA 4EQQA 3F3XA 3V8KA 3MWMA 2P8TA 1OYYA 3RYPA 2P5KA 3TGNA 2NRAC 5L3FA 1TW2A 4OIRF 5J8FA 1IRGA 4M9XA 1YS6A 2H6CA 4ZZDA 4I02A 1T6SA 2P4WA 3J80K 3IWZA 2P5VA 1ULYA 4HV5A 2DTRA 2IPQX 2K7LA 2PBIA 3C18A 4YIIA 2DI3A 4HYEA 1USSA 2K4JA 2BGCA 1SAXA 1TQIA 2GA2A 3VOEA 2EFNA 1BIBA 4LMYA 3RKWA 3DF8A 2Y48A 5L3CA 4BNCA 2DQLA 3EDPA 2JRTA 5ICFA 1LB2A 2O0YA 3ABUA 5JVTA 3TQNA 3F8FA 1SMTA 5DCMA 2A3SA 2HOEA 4CHUA 2LF7A 3ABTA 2VXZA 5HLGA 4WXDA 2LDUA 2NAZA 2F5DA 3JAMK 3TO7A 2ZO4A 3DPLC 2V9VA 1P2FA 4JBAA 5HLHA 3H3UA 1HW1A 3TO9A 3KE2A 3VODA 4A6EA 3GF2A 2VBXA 5HOOA 2XGXA 3E3VA 5D5WB 2RC4A 4MTEA 5ED4A 1XCVA 1WI9A 2F5CA 2P6SA 1FSEA 1P4XA 1EH7A 2P7VB 2PN6A 4HW0A 1LDDA 2K02A 3ZMZA 1XGSA 3I53A 4OIQF 3IKVA 2E7WA 2FBKA 2EV6A 5IT9K 2JZYA 4ESFA 1E17A 4P55A 1ZG3A 4HDVA 3W6JB 2DQRA 4IHSA 2VE8A 3SHFA 5BS6A 5AIQA 4FX4A 1BC8C 1RI7A 4WWCA 1TNTA 3ZQ7A 1HXDA 2EFQA 5KK1A 1ZG5A 1D8KA 4PCQA 5FFXA 1UHWA 2XAJA 3IL2A 1ZYRF 4RAZA 5TRDA 3FMQA 5BPIA 1QNTA 2L54A 2KRFA 4ASNA 4WK8F 3GFJA 3P9CA 3K2ZA 4RGSA 3MZHA 2MBFA 3N4MA 4CDGA 5JFRA 4WCGA 2KIFA 5CLSA 3FHZA 1MJAA 2FBHA 5ICCA 3HTUA 2HKXA 2EFWA 1HW5A 1PDNC 1O7LA 3V8LA 3CDHA 3WTVC 4MQ9F 2ZJ2A 3W6KB 1P4WA 4HDUA 2PFBA 2EV0A 1FX7A 3V8JA 2QQBA 3U2RA 4HV6A 4XBFA 1ZH5A 4LFUA 4G6DA 1JHFA 2QYOA 3HRMA 1T39A 1S3JA 3RKXA 4O3MA 1W5SA 2K4BA 2PEXA 2WTEA 3CUQC 2HTJA 1BOAA 3LWFA 4A5NA 1YQAA 2WWYA 4HX4A 4KFCA 2DK8A 4AIJA 1KQ0A 2GXGA 5H20A 1R5GA 1J75A 1R1VA 4GCVA 4I0AA 3DP7A 1B4AA 2IP2A 3WTTC 3JW4A 4I98B 4G7HF 1KA8A 1I1GA 4HZFA 5LLQA 4L5IA 4CICA 4B09A 3HSEA 3MZYA 2CO5A 2XV4S 1XGNA 4IPAA 1LJ9A 3QP6A 3LSTA 4ZZLA 3DKWA 2FOKA 4GYGA 4L9VA 1S7AA 2ZKZA 2Z99A 1XSDA 5CVVA 3FXUA 2HYGD 1YYVA 1AWCA 4RB2C 3L09A 5E20A 4CYDA 2X4HA 5D5XB 2NYXA 3BDDA 3SXYA 5E1WA 4MTDA 4YFKF 4JQFA 4GXOA 3P9IA 1LDKB 1LDJA 4HX7A 1LVAA 1K78B 4ZYGA 2FBIA 1X3UA 5DEQA 5D8KB 5EEGA 4XSZF 4S05A 5LRRA 4L9JA 4YFNF 5HVQC 4MEYF 4KIBA 3CO7C 1TTYA 4G9YA 1XMKA 4G7OF 1MDMB 5EEHA 3SQNA 2D1VA 2D45A 3SFZA 5LHHA 3DQVC 3WTSC 3RTRA 2A68F 3F72A 2MLGA 2V1DA 4UVCA 4UVBA 1FZPB 2MH9A 4L0ZB 2HQRA 1QBJA 1U2WA 3E5QA 3F22A 2A61A 1BM9A 1TQPA 3WG9A 3C3WA 1R58A 1CF7B 1IXCA 4HF0A 1B9MA 1REPC 2L4MA 4WXCA 2QQ9A 4EMSA 1DUXC 4AIHA 2PQ8A 1YW7A 1W7PA 3KEOA 3ZP5A 1FWZA 3RYRA 1FC3A 2DW4A 3ELKA 3F23A 1G4DA 2A5YB 5K5QA 4PZJA 2STTA 2HEOA 4Y13A 2VBYA 5CVUA 3R61A 4EGZA 5F6FA 1P6RA 1R22A 4DQ2A 1D8JA 3KP6A 2FRHA 4OIOF 5K5RA 1Z7UA 3J7AO 2IA0A 1RUNA 3WTZA 5E17F 2ETHA 4OMZA 5E8GA 4HF2A 3ROUA 3R0AA 2DO7A 1MGTA 4Q4ZF 5ILVA 1FBUA 2L4AA 1A04A 2D1HA 2QBYB 2FSWA 2XUBA 1IXRC 4LB5A 4I7HA 4R8HA 4I09A 2Q8KA 2ESHA 2VODA 2F5EA 2KJCA 2QBYA 1EH6A 3EYIA 3I71A 3R60A 1DPUA 1JXSA 1UB9A 3E6CC 3I59B 3GZ6A 1KYWA 1ZLJA 3TDZC 5L3GA 3HSRA 1TLHB 5FLXK 2WV0A 5HLIA 2FU4A 5L3DA 1UFMA 1Y0UA 2DT5A 1EV7A 2Q0OA 3MQ0A 1FBSA 2OZUA 2A69F 2M87A 3KP3A 1HKSA 1ZGJA 3P9KA 4QWQA 3U1DA 2Y0MA 3IWFA 5DDGA 4LD5A 4U0YA 1XCBA 5KVRA 2ZBKA 3QPTA 1TQMA 4EGYA 3JTGA 2VC1A 3ZMTA 5BPDA 4LLLA 2CW0F 4L0YB 2VOOA 4LJZF 2BV6A 1ZLKA 1IAWA 3WE3A 4RB3C 4P96A 1KU7A 2RKHA 5LHGA 1HSTA 3RPUA 1FPQA 5IT9Z 4A6DA 2OU2A 4KN4X 1BI0A 1USTA 3G3ZA 2Z5UA 3RKYA 4KA4A 3HHHA 2DLLA 5FO5A 2JPCA 2DAOA 3I58A 1Z1DA 1GHCA 3T0YA 1S7OA 2ZFWA 1F4KA 2QUFA 1MJBA 1VTNC 2EWNA 3FXRA 1KU2A 4N9IA 1T38A 2UWMA 2QQAA 4KIFA 3LA3A 4OU0A 2XASA 1J59A 2HQNA 5HS7A 4ESJA 2GWRA 2GA1A 3F21A 4Q47A 3I4PA 3KLOA 4UVAA 2DPUA 1ZARA 2G7UA 3IKTA 1AOYA 2R7FA 2HTSA 3IC7A 1CGPA 2IJLA 1XDSA 2CGPA 1HQCA 4AD9A 5TJJA 1V3FA 3P7NA 2W57A 1XGOA 1I27A 1GXQA 4BXUA 1U78A 2IT0A 3M8FA 1L3LA 4LLNA 2NNNA 4L5JA 2M30A 4IF4A 2XRNA 2C6YA 2Q2EA 1U6GA 1UCRA 3BJ6A 3ZMSA 3ULQB 1RNLA 3JSPA 2UZKA 5DD4A 4KNYA 4G6QA 4M74A 3QOPA 4ZYHA 2GAUA 1F5TA 3Q9VA 3H92A 1H9GA 2A6HF 3QU3A 1MKMA 5F1RA 5LGTA 1SFXA 2YX4A 1WKMA 4WF2A 3DV8A 4N9HA 3GZ5A 4RGXA 4XSXF 3FX3A 4KUMA 5FB2A 3CUQB 2RVCA 2XAGA 2FMLA 1S8NA 1I1SA 4U0VA 2O6GE 6PAXA 1K79A 3E6DA 2O3FA 4U7BA 1OYWA 3E6BA 3FZVA 1R23A 2M1BA 4Y17A 3NQOA 3O2PE 3QPHA 4L9NA 2HKOA 2VT3A 4DNCA 2FA5A 5DD8A 1DDNA 1PP8F 4MQVA 1U5TB 3DEUA 3RDIA 2XAFA 4UXNA 1G6NA 4FT8A 4LGWA 4EVIA 1U5TC 4BH9A 4NHJA 1GVJA 4IRGA 2PMHA 1KU9A 3EYYA 3GYHX 3K69A 4KDPA 1WSUA 3LFKA 1JE8A 3F8MA 1H0MA 3QU6A 3HTSB 1G3TA 1S29A 3CUOA 3SZTA 2FNPA 2KKOA 3ZMVA 1OPCA 2ZCWA 4B8XA 4BHCA 2RNJA 3M8EA 1SD4A 2HZTA 5LEJA 3QAHA 4P9FA 5CJ9A 4KN7X 4KICA 5H6QA 3GLXA 1Z9CA 2ZNYA 1DPRA 4HA8A 4CO8A 5AONA 5D4RA 2JPBA 1SMYF 2PI0A 4OOIA 2A07F 4KMUX 3BY6A 3S2WA 2FXAA 4RS8A 1SFEA 2H27A 3ERED 1QO0D 5L3BA 1OYIA 3KFWX 4M72A 4RAYA 2BE5F 3E6MA 1J7KA 3T1BA 3LA2A 1ZRFA 2LNBA 5BMZA 1IN4A 2IVMA 5CYVA 2IA2A 5HS8A 5LHIA 4EM0B 2YR2A 3WGHA 3V7SA 4AIKA 4BHBA 3EQLF 1I6XA 3U9GA 1FT9A 3J81K 3L7WA 1XGMA 1O3TA 3SZPA 2E1CA 4L18B 1G3WA 4M6YA 4TV7A 4CGZA 4HX8A 1KGSA 1C0WA 3ZMUA 2BEOA 1V4RA 4BAYA 2P6TA 5LBQA 1TBXA 2V1XA 1YO5C 4FX0A 1W7PD 3FMRA 2VONA 1ODDA 4EJWA 4A0ZA 4M9ZA 3K1MA 3OV8A 2DU9A 2Z3YA 3K1NA 3M1EA 2MD5A 5DYMA 3WE2A 5ILSA 3COAC 3F8CA 3F6VA 3JAMZ 3BJAA 3ECOA 2NS0A 5BOXA 1U5TA 3V4GA 3MCZA 2PG4A 4NB5A 3REOA 3TOBA 2RV8A 2XHKA 2P5LC 4Q48A 3H3ZA 2MA3A 4LK0F 2EV5A 2YPRA 3WU1B 2EFPA 4HLYA 4IVNA 2HYFA 4MNUA 4WX9A 2ZMEA 2QVOA 4AWXB 2OBPA 2DK5A 1YS7A 3K9TA 3E5XA 4GGGA 4FHTA 1LEBA 1Q1HA 2AS5F 4ESBA 1YTYA 5E18F 5K5OA 2EA4A 1FYLA 3JSOA 3HUGA 5DUKA 4A0XA 3CTAA 1P4AA 4QLCU 2E7XA 2JT1A 4HOBA 1K78A 3V7CA 4ZYDA 1K6OA 3O3KA 1P92A 1ONVA 5HDGA 2XIGA 4BQAA 3BP8A 3GUDA 2H6BA 4S04A 4IHTA 3LAPA 3R0JA 5D8LB 3F8BA 3J81Z 2Y75A 3WTWC 2L3DA 4LK1F 3IRQA 3TOAA 4A2UA 1IF1A 5DUIA 1LQ1A 1IZ1A 3BROA 4L9TA 1KU3A 4EJOA 4O6JA 2EB7A 5FGMA 1ZREA 1SFUA 3ZMDA 3EUHA 1ZHFA 5AIPA 4IRHA 3F8NA 5DCMB 2VE9A 4P5OA 3FM3A 2FMYA 2X0LA 5LGUA 3GEZA 3B02A 3R4KA 2G7HA 1O57A 3TKYA 1LNWA 2HWVA 3WTXC 4OIPF 3C7JA 2EA2A 3GW2A 3FMSA 3HOTA 1WRJA 1D3YA 3L9FA 3VB2A 3GFLA 4EM1A 3R6SA 5H6RA 5LGNA 2AXLA 3ZPLA 1CF7A 4XRFA 1B1BA 1RUOA 1BBYA 1E2XA 3BPVA 1J2XA 3DPTA 1IN5A 4KIGA 2LF8A 3KLNA 3MEXA 2ZNZA 1QGPA 4G94A 4GYIA 4R79A 5DCFA 4I2OA 3QP5A 2G9WA 3LQQA 1IRFA 2V1UA 4U7DA 2GIVA 2K27A 2VC0A 2KJBA 5JR3A 1Z91A 2JSCA 1NHAA 2CWEA 5ICGA 1R7JA 3NRVA 2W84A 3T8RA 4I01A 4E70A 2R3SA 1SD5A 4UNOA 2HR3A 2RQPA 4LLGF 2FNAA 5FFZA 2QLZA 2OQGA 4ENMA 4YFXF 3VEPA 1WQ2A 2STWA 4PDKA 5E8IA 4A5MA 2QZ8A 3K1PA 2ZMEB 1ZAOA 3PQJA 2UXXA 3Q9SA 1FLIA 2O03A 1BI3A 2A6EF 1KYZA 2KIMA 3CO6C 3B73A 3N97A 3HHGA 4UUVA 3HRUA 2CYYA 3RIRA 2HGCA 4UV8A 3Q5FA 2H94A 2XKPA 1MDMA 2RGVA 1QZYA 3ML6A 1OMIA 5LEKA 2EJRA 1Z6TA 2FQ3A 2CG4A 2W85A 2ISYA 1O7FA 4MEXF 1ZG1A 1JHHA 1HSJA 4XLPF 2XKOA 4P9UA 3BPXA 4JK1X 4I0BA 2MLKA 4G7ZF 2OZ6A 3I0TA 1MJ9A 2EFOA 1FYMA 4XLNF 3D0SA 2COMA 3I5UA 5JHUA 2DFIA 5FD6A 2L02A 3ISPA 3RI4A 1IN7A 2FE3A 3NEUA 2PLYA 1XSXA
chains in the Genus database with same CATH superfamily
2PX9A 1OCZH 2KPMA 4EJUA 2WBMA 1F9NA 3SDGA 1R36A 3BTIA 5LRSA 2ISZA 3MFKA 2MFZA 2NVTJ 1H9TA 5K1YA 2WV1A 2CFXA 3B6CA 2WB1N 1ZN2A 3CMMA 2MGQA 1SD7A 2X6OA 3HIFA 4CYCB 4UUSA 3A2KA 3VYSB 4UHTA 5CVRA 2L7FP 3CDIA 5HDNA 2GQQA 4HPQA 2E35A 2E1NA 1PP7U 2PJPA 5FLMJ 4A3JJ 3CLOA 2Z33A 3J7ZI 4ENNA 2O61A 1TNSA 1ZGAA 4IX7A 1B6AA 4XKCA 2CV1A 1BIAA 1FIPA 3KEYA 3BR5A 5JI6A 2B0LA 4O5VA 3K0LA 1PUEE 3S32A 3KZYA 2LH9A 2VQCA 2M45A 2XROA 2CMPA 3K7AJ 3D5SC 1T0FA 2F5FA 1R1UA 5D4SA 2HI3A 4Y52J 2RREA 1WJAA 4II2A 2ZJPF 1FOXA 4WXHA 3J80Z 5EF6A 5GTIC 3OY9A 4XORA 1G3SA 2XVCA 1KQ9A 5EG0A 1VQLI 4XN3A 2UXNA 1XSVA 4MIMA 2OD5A 2GZWA 1VQMI 1JJ6C 2W24A 2KHMA 5B3SH 1J9IA 3O6BB 1Y1VJ 2F2EA 2L9NA 5CVIA 4CXFA 3CCJI 4IHVA 1WJFA 2EZHA 2XAHA 3X2QH 1SFKA 1XMAA 2KRCA 2L9SA 3PFIA 4RM3A 5BNGA 2VBWA 4UV9A 1MIJA 1W7PB 1RPWA 5FKOA 1Z77A 2HQAA 3FXOA 1IXSB 5E1ZB 3EETA 3JREA 4Y15A 2CU7A 2ELHA 4MHGA 3OYMA 2M8EA 3QRFF 3CESA 2HFHA 1ZGWA 1HKTA 1KZHA 1Z7LA 2JTVA 2QSHX 3FBIB 3FWEA 1W0UA 1MMSA 4EJTA 1YI2I 3JRIA 3CJNA 3MAJA 2LMDA 1VQOI 3H5AA 1S6LA 1YLFA 4HQMA 3BR1A 3KEQA 3LSPA 4A3IJ 1X4OA 2Y0SA 4RAFA 1X1PA 1ON2A 1BJAA 1KQ8A 2EZKA 3ZQLA 1IDYA 1ON1A 3S2HJ 3OOPA 2KIQA 5J4VA 2LREA 3PO2J 5B66C 4PGGA 4A3FJ 2F6CA 1XB4A 4C3IJ 1EH8A 4F7ZA 1B9NA 4KYWA 1OKRA 1NH3A 2DOEA 3A03A 4PJMA 3AG3H 3FXMA 3HRTA 2HXIA 1IN8A 2UV1A 3RQ4A 3OYKA 1R5HA 1HW2A 1XG1A 3KCCA 2XAUA 3KP7A 2RDPA 3UKGA 2GXBA 4JYKA 1WWXA 1HKQA 2OCEA 3H35A 2KDOA 4BS9A 1T2KA 3AAFA 2B7EA 2V79A 4FTHA 5J40A 3SEQA 3D5LA 3HB9A 4M71A 2F4IA 3I54A 3OIOA 1IGNA 1JGSA 1YIOA 5ILUA 2CSOA 2OF7A 1R1TA 1YW9A 4X1EA 2E5NA 1R49A 4KT5C 2OTLI 5B1BH 3K4LA 3KP2A 3KIOA 2NOJB 3BCAA 2IRFG 1Z6RA 1V55H 1U8RA 4RA2A 3IV5A 1BN5A 4BEHB 3M4OJ 4IRIA 3WODF 4PJ0C 5DM7F 4OINF 4KMFA 4RM2A 1M1EB 1ORKA 3RPQA 4H0EA 4NQWA 1GLNA 2BYVE 1XD7A 1FNNA 2XPVA 1FP1D 3QWLA 3HOWJ 4XR6A 1XN7A 3G73A 1IUYA 5D6EA 1I3AA 2XSJC 4XNFA 1B59A 4X6AJ 1BI1A 5CVJA 4LB6B 4LIVA 2JVHA 1SVOA 1Z0XA 4XLHA 4HSTA 1XDUA 2DFHA 1DU6A 2CS3A 1YG2A 2HOAA 1UHMA 1QZZA 2QSGX 2IA1A 3TDUC 3H0GJ 3RKQA 5KAIC 4DJAA 4B48A 5ERIA 3I3LA 3ZN0A 2W25A 4BQNA 1FSHA 1Y8QB 1R4NB 2QWWA 3A01B 1IO2A 3Q0WA 3WTUC 4Z2YA 3LA7A 5ICEA 1D5VA 1FBQA 2OQRA 3KZZA 5C4JJ 2K9NA 1V5FA 3DCFA 3WU0A 3GWZA 1YFHA 5TGTA 3BG7A 5HS9A 4MGRA 4I99C 3IRRA 2J5PA 2PMUA 3H36A 1MNDA 2BY3A 4N0BA 3A01A 4CCNA 3ZQQA 2D2WA 3G1LA 3GVAA 3GXOA 3FF5A 3DEWA 4HAMA 2LR8A 2OAZA 2L01A 2LK2A 4GO1A 1HCRA 5D5UB 4ZJZA 4QPQA 3MZ8A 1S72I 2PJRB 3ECHA 1STZA 2ACJA 3IHUA 1RZ4A 1HBXG 4J01A 4RGRA 4ABZA 3GX4X 3IH2A 4LG0B 4YELA 4HNTA 2M5WA 1U9NA 2LSOA 2FJ1A 1OR7A 5FKMA 2M4GA 5EG0B 5J8CA 3J7YJ 2ZXWH 2O9LA 2OA4A 1O3RA 2GIZA 4ZH4F 2RN7A 2Z1DA 1TW3A 1FP2A 5IT3A 3M7GA 2P81A 1BR2A 2OV7A 2VOPA 5FD5A 1DP7P 4A93J 3KP4A 3T8TA 1TZLA 4LG0A 1O3QA 3KYCB 4AVPA 3KP5A 2BBYA 3HM5A 1QQIA 2XGEA 5FKNA 2LRDA 1N77A 1MBKA 1A31A 2P7CB 2ICWG 2VKHA 3V7RA 1OFCX 2F4MB 2DPDA 2EK5A 4HBLA 2IGKA 2R7DA 4ENKA 1X3WB 3JTHA 3OYFA 2CQKA 2LKPA 2AHQA 5D6FA 3WTYC 1WJEA 4U0WA 3LSRA 4D0PA 5GTHC 3OYJA 4NC6A 3BZKA 4M6XA 2XSDC 4YG2F 4G8XA 4M9SA 1GT0C 1FY7A 2WY8Q 2XAQA 2LY2A 1ZRDA 3JCUC 4E7JA 2IXSA 2VBZA 3VYRB 4M6VA 2MD0A 3HRSA 4I76A 2HZDA 2OJED 1IW7F 2YSRA 4EM2A 1I5ZA 3KETA 4HEA2 5BQTA 4CA0A 4A12A 4II3A 2NVUB 2WC2A 1FEXA 2KP6A 1J09A 3E5UA 1SD6A 4M73A 1MZBA 1LEAA 2X1EA 1UHSA 1VNDA 4DYRA 3BJOA 3CCQI 2JUGA 4DBRA 4C2UA 1D0ZA 3WGGA 4ETSA 4A3KJ 3FXKA 2XRLA 2KRHA 2VN2A 2ADUA 2K9SA 2HVRA 3HYIA 1MH3A 2DBBA 3BT9A 3I59A 1IUFA 1A6IA 1AKHB 3GFIA 3DTKA 1IDZA 3L2VA 4ON0A 2CV2A 4F52A 1K7AA 1X1DA 1QPMA 3E97A 3BOQA 4K2EA 3MD2A 3GO5A 3DFGA 3LSHA 3RJPA 1O4XA 2YU3A 1JTYA 4CZZA 4Q5SF 4ENJA 2E2HJ 3L00A 1WJCA 5HDKA 1ZRCA 3LOCA 2V9PA 4UB8C 2HVQA 1AKHA 1BI2A 2ZXJA 2Y30A 2AQFA 3K10A 4U88A 2QM3A 1FOKA 4PGHA 2JJ7A 3CUQA 1W4MA 1ZQ3P 1GXPA 4L5EA 5K7ZA 4HLXA 2Z9OA 2P0WA 2R7QA 5E3NA 3WGIA 2K86A 1PVEA 3T5XA 2DYRH 3L2CA 1B8IA 3P5JA 5M3FJ 5C44J 2EH3A 5J6XA 1V5GA 1YW8A 2TDXA 3DBLB 2QENA 3TO6A 1SANA 2L5QA 3LFUA 1IN6A 2VT2A 3LQRA 1JKQC 4EV0A 1R00A 4D9JA 5A2QK 1HDPA 2JA7J 3AL0C 1A6QA 4A0YA 1OCOH 3VYTB 1ETVA 4J19A 1IRXA 2HDCA 4IJAA 4V2GA 2DYSH 3NWTA 1FYKA 3HGGA 1JGGA 5FLXZ 2O8XA 1HC8A 5F64A 4YIFA 1NK3P 1BC7C 3ZR8X 2L7ZA 1VQ4I 3BC8A 1G3YA 2K3PA 1W36D 3L2WA 3FM5A 1JUMA 2V6CA 5J1UA 5D5VB 1SC7A 4EJVA 5L3EA 3IAS2 3J7AY 2HS5A 4R1HA 2IW5A 3LMMA 3QYBA 5E1XA 4YIRX 4ZYEA 4M3EA 4IOCF 1F1ZA 1T8IA 1J5YA 2L0KA 2FF4A 2WB1A 3C1DA 4RB0A 1YE9A 2E60A 4XL9A 2FEZA 2MH2A 5GAEJ 2X6WA 5KAFC 4AM3A 4HQEA 2YU9J 1J0RA 2J5OA 1W5TA 3I56I 3LAJA 1E3PA 5M5WJ 1FOWA 2MC3A 3F6OA 2HOTA 1MD0A 1LE8A 4HF1A 4OMYA 3I64A 2YX7A 5LFAA 1JTXA 2R7UA 3GTOJ 2BHYA 3ZN1A 3DXJF 3F0CA 3BZ6A 1RIOH 4YRVA 4IXAA 2KIUA 1U3EM 1T98A 2ESNA 4B44A 1OQYA 3PQKA 2H09A 5GAGJ 2NNYA 3SFIA 3FXQA 5DV5A 4RB1A 3Q0VA 3BWGA 4BHPA 3M9AA 4RGUA 1ETXA 1MNEA 3HSFA 3VFZA 1S5LC 1L0OC 4BYYA 3GFMA 1FIAA 1O3SA 5M3MJ 1Z05A 3HOSA 1YJNI 2M34A 4EQQA 3F3XA 3WHCA 3V8KA 3CZ6A 3MWMA 3PL8A 2P8TA 4U87A 1K83J 2MSYA 1OYYA 3RYPA 1ETKA 2K5CA 2P5KA 3TGNA 2NRAC 4MLOA 5L3FA 3EUKL 1TW2A 2K85A 5TISC 3QYFA 2JRMA 4OIRF 5J8FA 4FCYA 1IRGA 4M9XA 1X3ZB 4BDZA 1YS6A 2NVXJ 2H6CA 3AL0B 4ZZDA 2ZJQF 4I02A 2WAFA 2WAQN 4C2MJ 3G4SI 1AU7A 3SDBA 1T6SA 2P4WA 4XQFA 3BR0A 3CJTB 3PUFA 3IWZA 3J80K 2ZSHB 3ZQIA 2P5VA 1ULYA 4S0HB 4HV5A 1X19A 2DTRA 3FHNA 2IPQX 1DU0A 1K6YA 2K7LA 2PBIA 1SFOJ 1D0YA 3C18A 4YIIA 4BDYA 2DI3A 4HYEA 2DOAA 4XKWA 1USSA 3PIOF 2GOMA 3A4CA 2R7SA 2K4JA 3FBNB 2BGCA 2DT7B 2R7OA 2DMPA 2O5RA 3H9GA 3S1NJ 1SAXA 1A5JA 2R7VA 1TQIA 3DU6A 3CC4I 2GA2A 3VOEA 2EFNA 3W2AA 1BIBA 5M5YJ 4LMYA 3RKWA 3DF8A 2Y48A 2V4JC 3E7LA 5L3CA 3A1YA 4BNCA 2DQLA 1MMDA 3EDPA 2JRTA 5ICFA 1LB2A 2O0YA 5KNLA 3ABUA 5JVTA 2DDAA 3TL4X 3TQNA 1IRZA 2BVMA 4IO9F 3F8FA 2WAEA 1SMTA 5DCMA 3MKYB 1ZKGA 2A3SA 2BHZA 2HOEA 3A02A 3PNYA 2VUMJ 4ZDLA 2RQQA 1X1BA 2VJIA 3PUBA 4CHUA 2LF7A 3ABTA 4HRIA 2VXZA 5HLGA 4WXDA 2LDUA 2NAZA 2F5DA 3JAMK 3TO7A 4F3QA 4FE4A 1EKEA 2ZO4A 1E3HA 3DPLC 2V9VA 1P2FA 4JBAA 1OCPA 2QCOA 2R5ZA 4LITA 2VXDA 3OYEA 2DA5A 4D1QA 5CKTA 5HLHA 1WJBA 3OMYA 3H3UA 4AU7A 1HW1A 3TO9A 4OWRB 2EIKH 2XGCA 2V26A 2IBDA 2E1MC 3KE2A 3VODA 4A6EA 5DTDA 3GF2A 3CCSI 2VBXA 5HOOA 3O8HA 2PMZN 2GBYA 2XGXA 3E3VA 5D5WB 2RC4A 4MTEA 1MBJA 1QRYA 1ZTRA 2R5ZB 2VB6A 1UMQA 5ED4A 1XCVA 4I6ZA 1WI9A 1OCCH 1U8BA 4BXFA 2F5CA 2P6SA 1FSEA 3CF2A 4QSHA 2E2IJ 1P4XA 1EH7A 4E7SA 2P7VB 4IHWA 4IOAF 4PUSA 3AFHA 2PN6A 1X58A 4HW0A 1LDDA 1PYVA 3PIPF 2K02A 5FLVA 3TW7A 3OR1C 3S1QJ 1T08B 2KZGA 2CUFA 3ZMZA 1XGSA 1MSFC 2R93J 3I53A 4XN0A 2CW7A 4OIQF 3WU2C 3IKVA 2DA4A 1HOMA 1W5CC 2E7WA 2FBKA 5K7FA 2W7NA 3LSMA 5KHDA 2EV6A 4RBOA 5IT9K 2JZYA 4RAGA 1CQTA 4ESFA 5K7HA 1E17A 3GTPJ 4P55A 4XM3A 1HA8A 3KYDB 4CCLA 3DTIA 3PO3J 2LY9A 1ZG3A 1Q1VA 3U21A 4HDVA 1Z3XA 3W6JB 1QVTA 2DQRA 4IHSA 2VE8A 3SHFA 2M0CA 4PFOA 5BS6A 5AIQA 1A35A 4FX4A 1BC8C 2H8RA 3EUHC 4IL6C 1RI7A 4WWCA 1TNTA 5F27A 1ZK8A 3ZQ7A 1HXDA 4KJZA 2X6XA 2EFQA 5KK1A 1TWCJ 3VWBA 4BACA 1ZG5A 3I55I 1D8KA 4PCQA 5FFXA 1MMAA 4IKFA 2CUJA 1UHWA 3CP8A 2XAJA 5IY5H 3IL2A 1MBGA 1ZYRF 3K70C 4RAZA 2IAIA 4DYCA 3FKIJ 5TRDA 3FMQA 2JN6A 5BPIA 1VFCA 1QNTA 4Y7NJ 2L54A 1RR7A 2KRFA 2CQXA 1R4MB 2LD5A 4BJTA 4ASNA 2DOFA 4WK8F 3K4CA 3GFJA 2YUSA 3P9CA 3K2ZA 4RGSA 3MZHA 3FK6A 1MSEC 2MBFA 3N4MA 4M3FA 2ID3A 2M3AA 2IGMA 5HODA 4IHXA 4CDGA 5GAHJ 5JFRA 1YOVB 4WCGA 3CCRI 3A0HC 2KIFA 5CLSA 3FHZA 1MJAA 2FBHA 2ZB9A 5ICCA 3HTUA 2HKXA 2KL4A 3HPGA 2EFWA 4YEJA 1HW5A 1PDNC 3BG6A 1O7LA 2K9MA 5FKLA 4BE2A 2EZLA 3V8LA 3CDHA 2KDZA 1N78A 1Z3YA 1MW7A 2E2JJ 3WTVC 4MQ9F 2ZJ2A 3W6KB 1LPQA 3HPHA 1P4WA 1YX5A 1X1CA 1OCRH 4HDUA 4RMNA 2PFBA 1YJ9I 1JKRC 2EV0A 2JK3A 1S7EA 1FX7A 3KZIC 2M0MA 3SZGA 3V8JA 2QQBA 4Y4RA 2N8GA 4BUPA 3U2RA 3HXLA 4HV6A 4XBFA 1ZH5A 1RC9A 3NAUA 3DEEA 4LFUA 4G6DA 2R5YB 2DJNA 1JHFA 4RDUA 2QYOA 3OL4A 2WAQA 3K4JA 5F0HA 3HRMA 1UAAA 1Y0NA 1I6HJ 1T39A 2V6EA 1S3JA 3DLLF 3RKXA 2IGOA 5J4YA 5EEAA 1W5SA 2K4BA 2PEXA 2WTEA 3DU5A 4O3MA 3CUQC 2HTJA 1BOAA 2BXZA 3LWFA 4A5NA 1YQAA 4XICA 2WWYA 3HZJA 4HX4A 2XB0X 4KFCA 4UUSB 1VQ7I 4BY7J 2M7BA 2DK8A 4AIJA 1KQ0A 1XC5A 2LG4A 3NARA 2GXGA 3H5NA 5H20A 1R5GA 4FQGA 1J75A 1R1VA 4GCVA 5JVGF 4I0AA 4D5CA 3DP7A 2OTJI 4HG2A 3GBGA 1B4AA 4XRSG 2GOXB 2HQ5A 2IP2A 3WTTC 1BOBA 2QF7A 3JW4A 4BQQA 2LP0A 4I98B 5IYBJ 4D7MA 4G7HF 4ZDOA 1Y1WJ 1JKOC 2IS1A 2VQLA 3OYCA 1Y8RB 1KA8A 1VI0A 1WPKA 1G8XA 3U1KA 1VQ6I 1I1GA 1WHUA 5E3OA 4HZFA 1K61A 1FJLA 5LLQA 2AO9A 1VQNI 4L5IA 1S9HA 4CICA 4B09A 2I5UA 3HSEA 4XLCA 3MZYA 2CO5A 5J3LA 2R7RA 2XV4S 3MMYB 2M7AA 1XGNA 2KFDA 4IPAA 1LJ9A 1APLC 2CH0A 3QP6A 3LSTA 4ZZLA 3DKWA 2LOOA 2MC4A 2FOKA 1FOYA 2VPRA 4GYGA 3OS2A 4L9VA 1I50J 1S7AA 2ZKZA 4B1RA 1W1WE 2Z99A 2BXYA 1N25A 2E1MB 2VASA 1XSDA 5CVVA 3TP0A 3FXUA 1OISA 1GV2A 3DKXA 3W2WA 2HYGD 2RAEA 4M3GA 1YYVA 2HNHA 1ZR4A 1AWCA 4RB2C 3L09A 3FISA 4CCMA 5E20A 4CYDA 3I4NJ 2JUCA 5EZHA 2ME6A 2X4HA 5D5XB 1XPXA 2KT0A 2L2OA 2NYXA 3BDDA 1VQ8I 3LNQA 3HEFA 3SXYA 2VKVA 5GPAA 1TWFJ 5E1WA 4MTDA 1OCTC 4YFKF 4BY1J 2X1CA 4M3BA 1WVRA 2MG4A 3HGYA 4JQFA 3TMOA 4IQ4A 3G2BA 2VKEA 4GXOA 3P9IA 1LDKB 1LDJA 4HX7A 5FKKA 5B1AH 1LVAA 1K78B 2QGUA 4XLEA 2VPLA 4G6TB 4KISA 4ZYGA 2FBIA 1X3UA 4DBQA 5DEQA 1B72A 5D8KB 5EEGA 4XSZF 4S05A 5LRRA 4L9JA 1F43A 4YFNF 5HVQC 4CH7A 5IP6A 4MEYF 4KIBA 3CO7C 1TTYA 2QQ8A 4G9YA 5JHFA 2VJJA 1XMKA 4G7OF 3M3YJ 1MDMB 5EEHA 1B72B 1X2NA 2NS8A 2JWTA 2DXIA 3SQNA 2D1VA 3DLAA 2BW3A 3MKWB 3OS0A 2D45A 2EINH 2W82A 3SFZA 3LSIA 1LFBA 1V5EA 4C30A 3HL2A 5LHHA 3DQVC 4XLFA 3WTSC 3RTRA 5LD2C 2A68F 4NQWB 3OYLA 4UUTA 2B63J 2H1LA 1JKPC 4Z6YA 3HBLA 2NXNB 2WADA 3F72A 2MLGA 2V1DA 3OR2C 3C2BA 5IP9J 2JA8J 4UVCA 3WHBA 2ZFUA 4V2FA 4UVBA 1WH7A 4BJ5C 1QVUA 1I39A 1FZPB 2MH9A 4L0ZB 2OUMA 4Y33A 2HQRA 4J00A 1QBJA 5CPRB 4A69C 2E36A 3ZGKA 1U2WA 4NC7A 3VSLA 3CMEI 3M8JA 1BR1A 3E5QA 1FMWA 1D5YA 1JUSA 3F22A 3S3MA 1RKTA 2UUZA 4CUGA 1QHGA 3GTQJ 2A61A 1BM9A 2ID6A 1TQPA 4F92B 3WG9A 3C3WA 1R58A 1A36A 3HKZA 2NVQJ 3CCVI 3H5RA 1CF7B 2COBA 1IXCA 4HF0A 1B9MA 3LSJA 3QPLA 2B9SA 3PSFA 1REPC 4KITB 3PM1A 2L4MA 4WXCA 2M8GX 4FISA 2QQ9A 2PJRA 4E7KA 4EMSA 1DUXC 4DYQA 3S8PA 4PK4A 1BA5A 2MABA 4AIHA 1LFPA 2PQ8A 2R7TA 3OYBA 1YW7A 2JVGA 2CUEA 3LSGA 1W7PA 3KEOA 1D1CA 3QPSA 3ZP5A 1FWZA 3RYRA 1FC3A 2DW4A 3ELKA 4FETA 3KPHA 4G12A 3F23A 4BE0A 2DFFA 1G4DA 1WGXA 3GMEA 2MW8A 3Q0UA 2A5YB 5K5QA 1E0EA 4PZJA 3DPUA 2STTA 2V1NA 2HEOA 4Y13A 2VBYA 3MKLA 5CVUA 3AG1H 2L9RA 3PSIA 3R61A 4EGZA 1HLVA 5F6FA 4A3LJ 2VJ5A 2WA0A 2BOLA 1FTZA 1P6RA 1R22A 2IS4A 4DQ2A 3HDDA 1QHHD 1TP4A 3PJRA 4BE1A 1D8JA 4XONA 3KP6A 4D5FA 2FRHA 4OIOF 5K5RA 1Z7UA 3J7AO 2IA0A 4JX6A 1RUNA 5F0CA 2BY0A 4ZC3A 3WTZA 5E17F 2ETHA 4OMZA 5E8GA 3JRHA 4XKVA 4HF2A 3PNTA 3ROUA 3R0AA 1FMVA 2VQGA 2DO7A 1MGTA 4Q4ZF 5ILVA 3CC7I 4E4HA 1FBUA 4H4KC 2Y9ZA 2L4AA 1WH5A 4PJLA 4RLQA 3CMYA 1A04A 2D1HA 2KQRA 2QBYB 1D1AA 3ERMA 2FSWA 2FX0A 2XUBA 1IXRC 1T0FC 2LBFB 2DTZA 1BJZA 2Y69H 2LKSA 4LB5A 4I7HA 2K40A 4I09A 4R8HA 2Q8KA 2ESHA 2VODA 2F5EA 3AKZA 5H2FC 2KJCA 3ABLH 2QBYA 1EH6A 1TT0A 3EYIA 3I71A 3R60A 1DPUA 3OL3A 1IG7A 1JXSA 1UB9A 1IC8A 4MFEA 2Q2EB 3E6CC 3I59B 3OYHA 4FASD 3GZ6A 1KYWA 2I10A 1ZLJA 3TDZC 1SVMA 1TWHJ 2TCTA 2LVSA 1TWGJ 5EGOB 3FDYA 5L3GA 3HSRA 2ZC2A 1TLHB 5FLXK 2WV0A 1MBEA 4UY8I 1LKXA 5HLIA 2FU4A 5L3DA 3HOVJ 1UFMA 1Y0UA 2DT5A 3FK7A 1BW5A 4BBRJ 1EV7A 2Q0OA 2O8KA 2EBIA 2Z16A 3D1NI 5EGOA 3GTKJ 3MQ0A 3ONQA 1FBSA 2XB5A 2OZUA 2FD5A 2A69F 2M87A 3C2HA 3KP3A 1HKSA 1ZGJA 1ETWA 3P9KA 4QWQA 3U1DA 3S3OA 1QA6A 1EJ9A 4AIDA 2Y0MA 3IWFA 3OIPA 3BCBA 3W3CA 4LD5A 5DDGA 4U0YA 3JR9A 3G1OA 4EEFG 1XCBA 3MKZA 5KVRA 2V9KA 4BEHA 1U9OA 4A3EJ 2ZBKA 3QPTA 1TQMA 2W1OA 4EGYA 4PJNA 2LKXA 3JTGA 2VC1A 2E71A 3ZMTA 4AYBA 5BPDA 4LLLA 1ENHA 2CW0F 4PSXA 4L0YB 1MMGA 2W4SA 2VOOA 4LJZF 2ME0A 1UG2A 4ANJA 2BV6A 1ZLKA 1IAWA 2XC7A 3WE3A 4RB3C 4P96A 2DDBA 2RKHA 1KU7A 5LHGA 4CYCA 5C4XJ 1HSTA 4GFBA 2I8DA 1FPQA 3RPUA 5IT9Z 3CCEI 4A6DA 3H0DA 2R7XA 1POGA 3BG9A 3AG4H 2OU2A 5JLWA 2HPIA 4KN4X 1BI0A 1USTA 3G3ZA 2Z5UA 3RKYA 1BL0A 1X1AA 4KA4A 3HHHA 1KONA 2DLLA 2Y0SN 1YRNA 3CMAI 3QQAA 1F36A 4B3XA 3B6AA 5FO5A 1AHDP 4A3DJ 4BQOA 2EPFA 4XLAA 2JPCA 5F08A 2DAOA 2V7FA 2XGDA 3I58A 1Z1DA 3PFYA 1GHCA 3T0YA 2HVSA 1TL8A 1S7OA 2ZFWA 1F4KA 2QUFA 1T56A 2XF7A 4BGDA 2H1KA 5GP9A 1MJBA 1MH4A 1BW6A 1PJRA 1VTNC 2EWNA 2ELJA 1Z67A 1PUFB 2JA2A 2ZMEC 3FIWA 2HPMA 1JT6A 3CJRB 3FXRA 3K6GA 3CDLA 1DP3A 3BZCA 3RZDJ 1D0XA 1D1BA 1UZCA 1NG7A 1KU2A 2L7MP 4N9IA 1T38A 4NNJA 4XOPA 2UWMA 2K9LA 1HDDC 5EZGA 3FXLA 4LOCA 2QQAA 4KIFA 3LA3A 1PUFA 1LUJB 2H8WA 4OU0A 1LVKA 5JLXA 2F5VA 3S16J 5IYCJ 2XASA 1J59A 2DT6A 2HQNA 5HS7A 4ESJA 2GWRA 2GA1A 1FTTA 4C9YA 3F21A 3K4NA 5E79C 4Q47A 3N05A 2OPTA 3I4PA 3G1MA 3KLOA 3JRFA 3C2GA 2XPUA 4RLFA 4UVAA 2CV0A 2DPUA 1ZARA 2G7UA 4EATA 3IKTA 1AOYA 2R7FA 2HTSA 3IC7A 1CGPA 4W1UA 3HC7A 3W2VA 2X9DA 3HOYJ 3SEZA 1ETYA 2IJLA 1YHQI 1XMXA 1XDSA 3ZQHA 2CGPA 1BR4A 1HQCA 3FXJA 4NC8A 1VQPI 3S2DJ 2FUG2 4AD9A 2O7OA 3K2AA 1DGRM 3S93A 2DMUA 3CQZJ 2L9VA 2LBFA 5TJJA 3GTLJ 2X48A 1V3FA 2DA6A 3P7NA 1ITYA 2W57A 1XGOA 1I27A 5CQGA 2HDDA 1GXQA 4BXUA 1U78A 2IT0A 1JJ8C 3I9V2 3M8FA 2EQRA 3IP4B 3VYUB 1L3LA 2FOWA 2NNNA 4LLNA 1RESA 4L5JA 2QKLB 1R9TJ 1DGWY 2M30A 4IF4A 2XRNA 2C6YA 2Q2EA 3IH3A 1U6GA 1UCRA 4AC0A 3K4BA 4AVZA 5HNHA 1VQ5I 1ETOA 3BJ6A 3ZMSA 1AA7A 3ULQB 1RNLA 1WJ5A 3JSPA 2UZKA 2AQEA 5DD4A 4KNYA 4G6QA 4M74A 3QOPA 5F1JA 4JX5A 4ZYHA 3JRBA 2GAUA 5A2QZ 2DA2A 1F5TA 3Q9VA 4AYBN 3H92A 1H9GA 2A6HF 3ASOH 3QU3A 1MKMA 1VZ0A 1LFUP 1QPIA 3DBRB 3BR3A 1SFXA 5F1RA 5LGTA 4E7IA 3HOZJ 2Y2ZA 4M3DA 2E34A 2VIXA 2YX4A 1TC3C 1R6RA 1WKMA 2Y31A 4WF2A 3DV8A 4N9HA 2QEXI 2LY1A 3GZ5A 3UR3C 1NTCA 4RGXA 4XSXF 3FX3A 4KUMA 5FB2A 2IS6A 4QTRA 3CUQB 2CUZA 2RVCA 3Q3SA 2XAGA 2FMLA 1S8NA 2VI6A 4P1WA 1I1SA 1YJWI 4U0VA 2O6GE 6PAXA 4NBQA 1K79A 1X2MA 3E6DA 2O3FA 4U7BA 5DM6F 1OYWA 1B8IB 3E6BA 1EA3A 1R23A 3FZVA 3H9QA 2K3FA 3OIQA 1P7IA 2M1BA 4Y17A 1XTAA 1WZ2A 3RZOJ 1OLTA 1WFXA 3NQOA 3O2PE 2M4KA 1WI3A 3MN2A 3QPHA 2Z2SB 4L9NA 3ZXSA 3VDXA 4QPOA 2HKOA 3HOXJ 2VT3A 1Y6IA 2FA5A 4LG3A 4DNCA 4CCKA 5DD8A 1DDNA 3AG2H 5B5EC 1PP8F 4A3GJ 3TBIA 4MQVA 9ANTA 1MMNA 2D5VA 1U5TB 1YRNB 3DEUA 3S1RJ 3DTEA 3KX2A 3RDIA 2XAFA 4UXNA 1G6NA 2E5ZA 4Y3OA 4FT8A 4LGWA 4XK4A 4EVIA 2JQ7A 1U5TC 4BH9A 4NHJA 4XMYA 5F0FA 4F91B 1GVJA 2VLAA 3ABKH 4B47A 4XRSA 4ZDPA 2PMZA 1GUUA 4IRGA 3SJMA 2PMHA 4F93B 1KU9A 3EYYA 3GYHX 3K69A 4KDPA 3JRDA 4XOTA 1WSUA 3LFKA 1JE8A 3F8MA 1H0MA 3QU6A 3HTSB 4XRMA 1G3TA 1IV8A 4BBSJ 5HLTA 3JRAA 4OAZA 1S29A 3CUOA 3SZTA 2R92J 2QA4I 2MYSA 3EPZA 2FNPA 3H3VK 2KKOA 3CJQB 3ZMVA 5FROA 1OPCA 1P7JA 4N4NB 3S1MJ 2ZCWA 4IHYA 1TWAJ 4B8XA 2ZXIA 4BHCA 2DMNA 2RNJA 3M8EA 1SD4A 2DA1A 2HZTA 3ASNH 5LEJA 3QAHA 4P9FA 5CJ9A 4KN7X 4KICA 5H6QA 3GLLA 3GLXA 2M9HA 3HUGB 4JOMA 1Z9CA 1Y39A 2ZNYA 1DPRA 3IUOA 4HA8A 4OAYA 4CO8A 2ELKA 5AONA 2BZTA 5D4RA 1G59A 2JPBA 5DS9A 4C3HJ 1SMYF 3L1PA 3VPRA 3G71I 4IZZA 3BTLA 2PI0A 4OOIA 4C3JJ 4NUBA 4E6KG 2A07F 4KMUX 3RQIA 2CFOA 3BY6A 3S2WA 1NG6A 2FXAA 3K4MA 3L2UA 2CQNA 4RS8A 3CCMI 4BKXA 1SFEA 2H27A 3ERED 4ZTFA 2HU9A 1QU3A 1H8AC 1QO0D 5L3BA 1OYIA 3CLQA 3KFWX 4E7HA 4M72A 4RAYA 3IAM2 2BE5F 2VQHA 3E6MA 3ZQFA 1J7KA 2HXOA 3T1BA 3LA2A 3BTJA 1ZRFA 4PSWA 2LNBA 5BMZA 3CD6I 2IEKA 1IN4A 2ECCA 2IVMA 2VJ4A 1T95A 5CYVA 2XF6A 2IA2A 4UB6C 5HS8A 1Y56A 5LHIA 4EM0B 1RRJA 2YR2A 3WGHA 2KZVA 2VL8A 3V7SA 4AIKA 1ACIA 4BHBA 1WJDA 2F4OB 1R71A 3EQLF 1I6XA 2HOSA 3U9GA 1FT9A 3J81K 3L7WA 1XGMA 1JUPA 1N75A 4DOZA 1O3TA 3SZPA 4B4CA 3TEDA 5FJ8J 1OJLA 1RETA 2E1CA 4L18B 1G3WA 4M6YA 1SEUA 2X85A 4TV7A 2OCCH 4CGZA 1E3OC 3ZOBA 2EILH 1HF0A 2A6TA 4HX8A 2DFEA 1KGSA 5J1RA 3ZMUA 1C0WA 2BEOA 3BTCA 5IOZA 1WCMJ 1V4RA 2CW8A 2P6TA 4ZYAA 4BAYA 5LBQA 2ZJRF 2XPWA 1TBXA 2V1XA 5KCMA 3RSNA 3LL7A 4DIQA 2DMTA 3ZCOA 1YO5C 4FX0A 1W7PD 2KISA 3FMRA 2JA6J 4ITVA 2VONA 1ODDA 4EJWA 4A0ZA 2ZXHA 4M9ZA 3K1MA 3OV8A 4A3BJ 3OYGA 2DU9A 2Z3YA 3K1NA 3QODA 3JRCA 1GV5A 2X1DA 3M1EA 3HJEA 1T33A 2GLOA 4CCJA 4JP0A 2MD5A 5DYMA 3WE2A 5ILSA 3COAC 4A3CJ 3F8CA 3F6VA 3JAMZ 5GADJ 2AXTC 3BJAA 3RCOA 3WG7H 5E3MA 3OYDA 3ECOA 2NS0A 5BOXA 4GDFA 3OWTA 2E19A 3SYTA 2W00A 1U5TA 2LFBA 3BG5A 3L2RA 4E7LA 3S14J 3LSKA 3V4GA 1OR7C 3MCZA 1LE8B 2PG4A 1ETQA 4NB5A 3REOA 3TOBA 3K4KA 2RV8A 2XHKA 2XDVA 3CCYA 3UNGC 2P5LC 4Q48A 1Z21A 3H3ZA 5FRMA 2MA3A 5IOYA 4LK0F 4GRIA 5CQEA 3ABMH 2IGNA 2EV5A 2BY1A 2YPRA 3D5RC 3WU1B 2EFPA 4HLYA 1GDTA 1IV6A 2KLOA 1SAUA 4IVNA 3ZQGA 2HYFA 4MNUA 4WX9A 3GTMJ 2ZMEA 4KT6A 1MBFA 2BY2A 2QVOA 5J47A 4AWXB 2OBPA 2ZSIB 5F04A 4B43A 2CJJA 3GZNB 1YITI 4HNVA 2DK5A 5J1YA 1YS7A 3K9TA 3E5XA 4GGGA 4FHTA 1LEBA 4NDLA 1Q1HA 3DBHB 2AS5F 1TT5B 2CQ7A 2G0EA 4QIWN 4ESBA 1YTYA 5E18F 1EF4A 5K5OA 2QKMB 2EA4A 1FYLA 4JX4A 2A05A 3ESWB 3JSOA 3HUGA 5DUKA 4A0XA 3CTAA 2LTPA 1P4AA 3PNVA 4QLCU 2E7XA 2JT1A 4HOBA 3CC2I 1K78A 2HYJA 4A3MJ 3V7CA 4ZYDA 2NOGA 4C2TA 4X0GA 2L7KA 3GTGJ 3QOEA 1K6OA 3O3KA 1P92A 2R4GA 1VF9A 1ONVA 5HDGA 5IPAA 3JRGA 3OSFA 3M07A 1RR8C 3ZQCA 2XIGA 4BQAA 3BP8A 3GUDA 2E1OA 2M2EA 2H6BA 4S04A 2DA7A 4IHTA 1H88C 3LAPA 3CF5F 3R0JA 5D8LB 3F8BA 3J81Z 4CZCA 2Y75A 3IH4A 3WTWC 2L3DA 5C3EJ 4LK1F 2FQ4A 2GXAA 3IRQA 3BQZA 3TOAA 3V42A 4A2UA 1IF1A 5DUIA 2R5YA 5E3LA 1LQ1A 1IZ1A 3DKYA 4D7NA 3BROA 4L9TA 1KU3A 4EJOA 4O6JA 2EB7A 5FGMA 3S3NA 1SFUA 1ZREA 3ZMDA 3EUHA 1I3QJ 2K9QA 4AUXA 2X6YA 1ZELA 2LYCA 3KYLA 2CRGA 2NS7A 1ZHFA 5AIPA 3TP3A 4IRHA 3F8NA 1UG0A 5DCMB 2VE9A 4P5OA 3FM3A 1X4PA 3NWSA 2FMYA 2LC2A 2X0LA 3FKJA 5LGUA 3GEZA 3OS1A 4XKBA 3B02A 3OSGA 3S17J 3R4KA 1XX5A 2G7HA 4CCOA 4IEJA 1O57A 3TKYA 1LNWA 2HWVA 3WTXC 4OIPF 3C7JA 4XIDA 2EA2A 3GW2A 3FMSA 5EDNA 3HOTA 3BQYA 2Q1ZB 1WRJA 1D3YA 2EIMH 3CCUI 4IQJA 3L9FA 3VB2A 2EZIA 3GFLA 4EM1A 3E0JB 3R6SA 2R0QC 3QYEA 3E1SA 5H6RA 5LGNA 2AXLA 3ZPLA 1CF7A 4XRFA 3BLYA 3A0BC 2TRTA 1B1BA 4DZJA 2GM4A 1RUOA 1BBYA 1E2XA 3BPVA 1J2XA 3DPTA 1IN5A 4KIGA 2LF8A 3KLNA 2DA3A 3MEXA 2ZNZA 1QGPA 2JSPA 3O8GA 2WY7Q 4G94A 4GYIA 4R79A 5DCFA 4I2OA 3QP5A 2G9WA 5FRNA 3LQQA 1IRFA 2ECBA 1UJ8A 3OYIA 2V1UA 3BR6A 3OOUA 4U7DA 2GIVA 3GTJJ 4LIUA 2K27A 2VC0A 3EUAA 2KJBA 2OC6A 1Z91A 5JR3A 3K70D 1NK2P 5IYDJ 2X51A 2JSCA 1NHAA 2CWEA 3I4MJ 1R5ID 5ICGA 1UELB 1R7JA 3NRVA 4BJ6C 2W84A 3BR2A 3T8RA 4I01A 1YIJI 3G6EI 4E70A 3HOUJ 1W36C 2R3SA 2A5WA 5GPCA 1SD5A 2CQQA 3CP2A 4UNOA 2HR3A 2RQPA 4LLGF 2FNAA 5FFZA 5M5XJ 2QLZA 2OQGA 4ENMA 4YFXF 1W0TA 3VEPA 1V54H 2DN0A 5HNFA 2RNGA 1VQ9I 1WQ2A 4CSWA 3F9KA 3CCLI 2STWA 4PDKA 1IJWC 2NVYJ 5E8IA 2R7WA 4HSRA 2Y9YA 4A5MA 2QZ8A 3TW6A 4FE7A 3W6VA 3K1PA 2ZMEB 1JT0A 1ZAOA 3VSKA 1VQKI 2QSFX 1MBHA 3PQJA 2DODA 2YS9A 4E7ZA 4PJJA 2UXXA 2DCEA 3Q9SA 2W48A 1FLIA 2O03A 1BI3A 2A6EF 2LLKA 2JMWA 2KMUA 1K4SA 1KYZA 1ZR2A 2KIMA 3CO6C 2HDWA 3B73A 4W97A 3N97A 3HHGA 2IS2A 4UUVA 3HRUA 2CYYA 1XS9A 2R7ZJ 3RIRA 5IP7J 4BXXJ 2HGCA 4UV8A 3Q5FA 2H94A 1YX3A 4HNUA 4DW6A 2XKPA 1H89C 1MDMA 2RGVA 5EJCA 1QZYA 3HG9A 3ML6A 1OMIA 3L2QA 3DWLE 1MNMC 5LEKA 2BW3B 2EJRA 1Z6TA 1JI8A 3M1CA 2FQ3A 4MFDA 2CG4A 1SVLA 2W85A 1G2HA 4ZTJA 4V19K 2ISYA 3HKZN 1O7FA 4MEXF 1ZG1A 1RKWA 4BL0B 4F55A 1JHHA 1HSJA 3OYAA 4XLPF 2XKOA 4MO7A 4P9UA 4BU2A 4PFPA 2F48A 1GVDA 3BPXA 2BVLA 3OYNA 4JK1X 2EIJH 1QZEA 4I0BA 2MLKA 4G7ZF 3H1CA 2OZ6A 3H9JA 1P9QC 1MJ9A 3I0TA 2EFOA 1FYMA 4XLNF 3BG3A 3D0SA 5EYRA 3MVPA 1U0JA 2COMA 3I5UA 5JHUA 2JA5J 2DFIA 3RPUD 1K4TA 3ZRGA 4B3AA 2DMQA 2XF5A 5FD6A 4N4OB 2L02A 1ERDA 3ISPA 4DGWB 3RI4A 3GCMA 2VKDA 2DJIA 1DQUA 3S15J 1IN7A 2FE3A 3NEUA 2PLYA 1XSXA 4DZPA
chains in the Genus database with same CATH topology
4EJUA 1F9NA 1R36A 5LRSA 2ISZA 3MFKA 1H9TA 5K1YA 2CFXA 1ZN2A 1SD7A 3HIFA 4UHTA 5CVRA 5HDNA 2GQQA 2E1NA 1PP7U 2PJPA 3CLOA 2Z33A 4ENNA 2O61A 1TNSA 1ZGAA 1B6AA 1BIAA 5JI6A 2B0LA 4O5VA 3K0LA 1PUEE 3KZYA 2M45A 2XROA 1T0FA 2F5FA 1R1UA 5D4SA 4WXHA 3J80Z 1G3SA 2XVCA 1KQ9A 2UXNA 1XSVA 2OD5A 2GZWA 2W24A 1J9IA 3O6BB 2F2EA 5CVIA 4CXFA 2XAHA 5A2QZ 1XMAA 3PFIA 2VBWA 4UV9A 1W7PB 1IXSB 5E1ZB 3EETA 4Y15A 2ELHA 4MHGA 2M8EA 3QRFF 2HFHA 1HKTA 2JTVA 3FWEA 4EJTA 3CJNA 3MAJA 1S6LA 1YLFA 4HQMA 3KEQA 1ON2A 1BJAA 1KQ8A 1ON1A 3OOPA 4PGGA 1XB4A 1EH8A 4F7ZA 1B9NA 4KYWA 1OKRA 3HRTA 1IN8A 1R5HA 1HW2A 3KCCA 3KP7A 2RDPA 2GXBA 1WWXA 1HKQA 1T2KA 3AAFA 2V79A 3D5LA 4M71A 3I54A 1JGSA 1YIOA 5ILUA 2CSOA 1R1TA 1YW9A 4KT5C 3KP2A 2IRFG 1Z6RA 1U8RA 1BN5A 4IRIA 3WODF 4OINF 4KMFA 3RPQA 4H0EA 4NQWA 2BYVE 1XD7A 1FNNA 1FP1D 1XN7A 3G73A 1IUYA 5D6EA 1B59A 1BI1A 5CVJA 4LB6B 1XDUA 1YG2A 1UHMA 1QZZA 2IA1A 3TDUC 5ERIA 3ZN0A 2W25A 1FSHA 2QWWA 3WTUC 4Z2YA 3LA7A 5ICEA 1D5VA 1FBQA 2OQRA 3KZZA 3WU0A 3GWZA 1YFHA 5HS9A 4MGRA 3IRRA 2J5PA 2PMUA 4N0BA 2D2WA 3GVAA 3GXOA 3FF5A 4HAMA 2OAZA 2L01A 4GO1A 5D5UB 3ECHA 1STZA 2ACJA 3IHUA 1RZ4A 1HBXG 4RGRA 3GX4X 4LG0B 2M5WA 2LSOA 1OR7A 5J8CA 2OA4A 1O3RA 4ZH4F 2RN7A 1TW3A 1FP2A 5IT3A 3M7GA 2VOPA 5FD5A 1DP7P 3KP4A 3T8TA 1O3QA 4LG0A 4AVPA 3KP5A 2BBYA 1QQIA 2P7CB 3V7RA 2DPDA 2EK5A 4HBLA 2R7DA 4ENKA 3JTHA 2CQKA 2LKPA 5D6FA 3WTYC 4U0WA 4D0PA 4M6XA 4YG2F 4G8XA 4M9SA 1FY7A 2XAQA 1ZRDA 2VBZA 3HRSA 1IW7F 2YSRA 4EM2A 1I5ZA 3KETA 5BQTA 4A12A 2WC2A 3E5UA 1SD6A 4M73A 1MZBA 1LEAA 3BJOA 4ETSA 3WGGA 2VN2A 2ADUA 3HYIA 2DBBA 3I59A 3GFIA 4ON0A 1K7AA 1QPMA 3E97A 3BOQA 4K2EA 3GO5A 3DFGA 3RJPA 2YU3A 4CZZA 4Q5SF 4ENJA 3L00A 5HDKA 1ZRCA 1BI2A 2ZXJA 4U88A 2QM3A 1FOKA 4PGHA 3CUQA 1W4MA 1GXPA 4HLXA 2Z9OA 3WGIA 2K86A 3T5XA 3L2CA 5J6XA 2TDXA 1YW8A 2QENA 3TO6A 1IN6A 2VT2A 3LQRA 4EV0A 1R00A 5A2QK 4A0YA 2HDCA 4IJAA 1FYKA 5FLXZ 2O8XA 5F64A 4YIFA 1BC7C 1G3YA 3FM5A 2V6CA 5D5VB 4EJVA 5L3EA 2HS5A 4R1HA 2IW5A 5E1XA 4ZYEA 1F1ZA 1J5YA 3C1DA 2FF4A 4RB0A 2FEZA 2MH2A 4HQEA 1J0RA 2J5OA 1W5TA 3LAJA 2MC3A 3F6OA 1MD0A 4HF1A 4OMYA 3I64A 2YX7A 3ZN1A 3DXJF 3BZ6A 1RIOH 1U3EM 2KIUA 4IXAA 1T98A 2ESNA 3PQKA 2H09A 2NNYA 3FXQA 5DV5A 4RB1A 3BWGA 4BHPA 3M9AA 4RGUA 3HSFA 3VFZA 1L0OC 4BYYA 3GFMA 1O3SA 1Z05A 3HOSA 4EQQA 3F3XA 3V8KA 3MWMA 2P8TA 1OYYA 3RYPA 2P5KA 3TGNA 2NRAC 5L3FA 1TW2A 4OIRF 5J8FA 1IRGA 4M9XA 1YS6A 2H6CA 4ZZDA 4I02A 1T6SA 2P4WA 3J80K 3IWZA 2P5VA 1ULYA 4HV5A 2DTRA 2IPQX 2K7LA 2PBIA 3C18A 4YIIA 2DI3A 4HYEA 1USSA 2K4JA 2BGCA 1SAXA 1TQIA 2GA2A 3VOEA 2EFNA 1BIBA 4LMYA 3RKWA 3DF8A 2Y48A 5L3CA 4BNCA 2DQLA 3EDPA 2JRTA 5ICFA 1LB2A 2O0YA 3ABUA 5JVTA 3TQNA 3F8FA 1SMTA 5DCMA 2A3SA 2HOEA 4CHUA 2LF7A 3ABTA 2VXZA 5HLGA 4WXDA 2LDUA 2NAZA 2F5DA 3JAMK 3TO7A 2ZO4A 3DPLC 2V9VA 1P2FA 4JBAA 5HLHA 3H3UA 1HW1A 3TO9A 3KE2A 3VODA 4A6EA 3GF2A 2VBXA 5HOOA 2XGXA 3E3VA 5D5WB 2RC4A 4MTEA 5ED4A 1XCVA 1WI9A 2F5CA 2P6SA 1FSEA 1P4XA 1EH7A 2P7VB 2PN6A 4HW0A 1LDDA 2K02A 3ZMZA 1XGSA 3I53A 4OIQF 3IKVA 2E7WA 2FBKA 2EV6A 5IT9K 2JZYA 4ESFA 1E17A 4P55A 1ZG3A 4HDVA 3W6JB 2DQRA 4IHSA 2VE8A 3SHFA 5BS6A 5AIQA 4FX4A 1BC8C 1RI7A 4WWCA 1TNTA 3ZQ7A 1HXDA 2EFQA 5KK1A 1ZG5A 1D8KA 4PCQA 5FFXA 1UHWA 2XAJA 3IL2A 1ZYRF 4RAZA 5TRDA 3FMQA 5BPIA 1QNTA 2L54A 2KRFA 4ASNA 4WK8F 3GFJA 3P9CA 3K2ZA 4RGSA 3MZHA 2MBFA 3N4MA 4CDGA 5JFRA 4WCGA 2KIFA 5CLSA 3FHZA 1MJAA 2FBHA 5ICCA 3HTUA 2HKXA 2EFWA 1HW5A 1PDNC 1O7LA 3V8LA 3CDHA 3WTVC 4MQ9F 2ZJ2A 3W6KB 1P4WA 4HDUA 2PFBA 2EV0A 1FX7A 3V8JA 2QQBA 3U2RA 4HV6A 4XBFA 1ZH5A 4LFUA 4G6DA 1JHFA 2QYOA 3HRMA 1T39A 1S3JA 3RKXA 4O3MA 1W5SA 2K4BA 2PEXA 2WTEA 3CUQC 2HTJA 1BOAA 3LWFA 4A5NA 1YQAA 2WWYA 4HX4A 4KFCA 2DK8A 4AIJA 1KQ0A 2GXGA 5H20A 1R5GA 1J75A 1R1VA 4GCVA 4I0AA 3DP7A 1B4AA 2IP2A 3WTTC 3JW4A 4I98B 4G7HF 1KA8A 1I1GA 4HZFA 5LLQA 4L5IA 4CICA 4B09A 3HSEA 3MZYA 2CO5A 2XV4S 1XGNA 4IPAA 1LJ9A 3QP6A 3LSTA 4ZZLA 3DKWA 2FOKA 4GYGA 4L9VA 1S7AA 2ZKZA 2Z99A 1XSDA 5CVVA 3FXUA 2HYGD 1YYVA 1AWCA 4RB2C 3L09A 5E20A 4CYDA 2X4HA 5D5XB 2NYXA 3BDDA 3SXYA 5E1WA 4MTDA 4YFKF 4JQFA 4GXOA 3P9IA 1LDKB 1LDJA 4HX7A 1LVAA 1K78B 4ZYGA 2FBIA 1X3UA 5DEQA 5D8KB 5EEGA 4XSZF 4S05A 5LRRA 4L9JA 4YFNF 5HVQC 4MEYF 4KIBA 3CO7C 1TTYA 4G9YA 1XMKA 4G7OF 1MDMB 5EEHA 3SQNA 2D1VA 2D45A 3SFZA 5LHHA 3DQVC 3WTSC 3RTRA 2A68F 3F72A 2MLGA 2V1DA 4UVCA 4UVBA 1FZPB 2MH9A 4L0ZB 2HQRA 1QBJA 1U2WA 3E5QA 3F22A 2A61A 1BM9A 1TQPA 3WG9A 3C3WA 1R58A 1CF7B 1IXCA 4HF0A 1B9MA 1REPC 2L4MA 4WXCA 2QQ9A 4EMSA 1DUXC 4AIHA 2PQ8A 1YW7A 1W7PA 3KEOA 3ZP5A 1FWZA 3RYRA 1FC3A 2DW4A 3ELKA 3F23A 1G4DA 2A5YB 5K5QA 4PZJA 2STTA 2HEOA 4Y13A 2VBYA 5CVUA 3R61A 4EGZA 5F6FA 1P6RA 1R22A 4DQ2A 1D8JA 3KP6A 2FRHA 4OIOF 5K5RA 1Z7UA 3J7AO 2IA0A 1RUNA 3WTZA 5E17F 2ETHA 4OMZA 5E8GA 4HF2A 3ROUA 3R0AA 2DO7A 1MGTA 4Q4ZF 5ILVA 1FBUA 2L4AA 1A04A 2D1HA 2QBYB 2FSWA 2XUBA 1IXRC 4LB5A 4I7HA 4R8HA 4I09A 2Q8KA 2ESHA 2VODA 2F5EA 2KJCA 2QBYA 1EH6A 3EYIA 3I71A 3R60A 1DPUA 1JXSA 1UB9A 3E6CC 3I59B 3GZ6A 1KYWA 1ZLJA 3TDZC 5L3GA 3HSRA 1TLHB 5FLXK 2WV0A 5HLIA 2FU4A 5L3DA 1UFMA 1Y0UA 2DT5A 1EV7A 2Q0OA 3MQ0A 1FBSA 2OZUA 2A69F 2M87A 3KP3A 1HKSA 1ZGJA 3P9KA 4QWQA 3U1DA 2Y0MA 3IWFA 5DDGA 4LD5A 4U0YA 1XCBA 5KVRA 2ZBKA 3QPTA 1TQMA 4EGYA 3JTGA 2VC1A 3ZMTA 5BPDA 4LLLA 2CW0F 4L0YB 2VOOA 4LJZF 2BV6A 1ZLKA 1IAWA 3WE3A 4RB3C 4P96A 1KU7A 2RKHA 5LHGA 1HSTA 3RPUA 1FPQA 5IT9Z 4A6DA 2OU2A 4KN4X 1BI0A 1USTA 3G3ZA 2Z5UA 3RKYA 4KA4A 3HHHA 2DLLA 5FO5A 2JPCA 2DAOA 3I58A 1Z1DA 1GHCA 3T0YA 1S7OA 2ZFWA 1F4KA 2QUFA 1MJBA 1VTNC 2EWNA 3FXRA 1KU2A 4N9IA 1T38A 2UWMA 2QQAA 4KIFA 3LA3A 4OU0A 2XASA 1J59A 2HQNA 5HS7A 4ESJA 2GWRA 2GA1A 3F21A 4Q47A 3I4PA 3KLOA 4UVAA 2DPUA 1ZARA 2G7UA 3IKTA 1AOYA 2R7FA 2HTSA 3IC7A 1CGPA 2IJLA 1XDSA 2CGPA 1HQCA 4AD9A 5TJJA 1V3FA 3P7NA 2W57A 1XGOA 1I27A 1GXQA 4BXUA 1U78A 2IT0A 3M8FA 1L3LA 4LLNA 2NNNA 4L5JA 2M30A 4IF4A 2XRNA 2C6YA 2Q2EA 1U6GA 1UCRA 3BJ6A 3ZMSA 3ULQB 1RNLA 3JSPA 2UZKA 5DD4A 4KNYA 4G6QA 4M74A 3QOPA 4ZYHA 2GAUA 1F5TA 3Q9VA 3H92A 1H9GA 2A6HF 3QU3A 1MKMA 5F1RA 5LGTA 1SFXA 2YX4A 1WKMA 4WF2A 3DV8A 4N9HA 3GZ5A 4RGXA 4XSXF 3FX3A 4KUMA 5FB2A 3CUQB 2RVCA 2XAGA 2FMLA 1S8NA 1I1SA 4U0VA 2O6GE 6PAXA 1K79A 3E6DA 2O3FA 4U7BA 1OYWA 3E6BA 3FZVA 1R23A 2M1BA 4Y17A 3NQOA 3O2PE 3QPHA 4L9NA 2HKOA 2VT3A 4DNCA 2FA5A 5DD8A 1DDNA 1PP8F 4MQVA 1U5TB 3DEUA 3RDIA 2XAFA 4UXNA 1G6NA 4FT8A 4LGWA 4EVIA 1U5TC 4BH9A 4NHJA 1GVJA 4IRGA 2PMHA 1KU9A 3EYYA 3GYHX 3K69A 4KDPA 1WSUA 3LFKA 1JE8A 3F8MA 1H0MA 3QU6A 3HTSB 1G3TA 1S29A 3CUOA 3SZTA 2FNPA 2KKOA 3ZMVA 1OPCA 2ZCWA 4B8XA 4BHCA 2RNJA 3M8EA 1SD4A 2HZTA 5LEJA 3QAHA 4P9FA 5CJ9A 4KN7X 4KICA 5H6QA 3GLXA 1Z9CA 2ZNYA 1DPRA 4HA8A 4CO8A 5AONA 5D4RA 2JPBA 1SMYF 2PI0A 4OOIA 2A07F 4KMUX 3BY6A 3S2WA 2FXAA 4RS8A 1SFEA 2H27A 3ERED 1QO0D 5L3BA 1OYIA 3KFWX 4M72A 4RAYA 2BE5F 3E6MA 1J7KA 3T1BA 3LA2A 1ZRFA 2LNBA 5BMZA 1IN4A 2IVMA 5CYVA 2IA2A 5HS8A 5LHIA 4EM0B 2YR2A 3WGHA 3V7SA 4AIKA 4BHBA 3EQLF 1I6XA 3U9GA 1FT9A 3J81K 3L7WA 1XGMA 1O3TA 3SZPA 2E1CA 4L18B 1G3WA 4M6YA 4TV7A 4CGZA 4HX8A 1KGSA 1C0WA 3ZMUA 2BEOA 1V4RA 4BAYA 2P6TA 5LBQA 1TBXA 2V1XA 1YO5C 4FX0A 1W7PD 3FMRA 2VONA 1ODDA 4EJWA 4A0ZA 4M9ZA 3K1MA 3OV8A 2DU9A 2Z3YA 3K1NA 3M1EA 2MD5A 5DYMA 3WE2A 5ILSA 3COAC 3F8CA 3F6VA 3JAMZ 3BJAA 3ECOA 2NS0A 5BOXA 1U5TA 3V4GA 3MCZA 2PG4A 4NB5A 3REOA 3TOBA 2RV8A 2XHKA 2P5LC 4Q48A 3H3ZA 2MA3A 4LK0F 2EV5A 2YPRA 3WU1B 2EFPA 4HLYA 4IVNA 2HYFA 4MNUA 4WX9A 2ZMEA 2QVOA 4AWXB 2OBPA 2DK5A 1YS7A 3K9TA 3E5XA 4GGGA 4FHTA 1LEBA 1Q1HA 2AS5F 4ESBA 1YTYA 5E18F 5K5OA 2EA4A 1FYLA 3JSOA 3HUGA 5DUKA 4A0XA 3CTAA 1P4AA 4QLCU 2E7XA 2JT1A 4HOBA 1K78A 3V7CA 4ZYDA 1K6OA 3O3KA 1P92A 1ONVA 5HDGA 2XIGA 4BQAA 3BP8A 3GUDA 2H6BA 4S04A 4IHTA 3LAPA 3R0JA 5D8LB 3F8BA 3J81Z 2Y75A 3WTWC 2L3DA 4LK1F 3IRQA 3TOAA 4A2UA 1IF1A 5DUIA 1LQ1A 1IZ1A 3BROA 4L9TA 1KU3A 4EJOA 4O6JA 2EB7A 5FGMA 1ZREA 1SFUA 3ZMDA 3EUHA 1ZHFA 5AIPA 4IRHA 3F8NA 5DCMB 2VE9A 4P5OA 3FM3A 2FMYA 2X0LA 5LGUA 3GEZA 3B02A 3R4KA 2G7HA 1O57A 3TKYA 1LNWA 2HWVA 3WTXC 4OIPF 3C7JA 2EA2A 3GW2A 3FMSA 3HOTA 1WRJA 1D3YA 3L9FA 3VB2A 3GFLA 4EM1A 3R6SA 5H6RA 5LGNA 2AXLA 3ZPLA 1CF7A 4XRFA 1B1BA 1RUOA 1BBYA 1E2XA 3BPVA 1J2XA 3DPTA 1IN5A 4KIGA 2LF8A 3KLNA 3MEXA 2ZNZA 1QGPA 4G94A 4GYIA 4R79A 5DCFA 4I2OA 3QP5A 2G9WA 3LQQA 1IRFA 2V1UA 4U7DA 2GIVA 2K27A 2VC0A 2KJBA 5JR3A 1Z91A 2JSCA 1NHAA 2CWEA 5ICGA 1R7JA 3NRVA 2W84A 3T8RA 4I01A 4E70A 2R3SA 1SD5A 4UNOA 2HR3A 2RQPA 4LLGF 2FNAA 5FFZA 2QLZA 2OQGA 4ENMA 4YFXF 3VEPA 1WQ2A 2STWA 4PDKA 5E8IA 4A5MA 2QZ8A 3K1PA 2ZMEB 1ZAOA 3PQJA 2UXXA 3Q9SA 1FLIA 2O03A 1BI3A 2A6EF 1KYZA 2KIMA 3CO6C 3B73A 3N97A 3HHGA 4UUVA 3HRUA 2CYYA 3RIRA 2HGCA 4UV8A 3Q5FA 2H94A 2XKPA 1MDMA 2RGVA 1QZYA 3ML6A 1OMIA 5LEKA 2EJRA 1Z6TA 2FQ3A 2CG4A 2W85A 2ISYA 1O7FA 4MEXF 1ZG1A 1JHHA 1HSJA 4XLPF 2XKOA 4P9UA 3BPXA 4JK1X 4I0BA 2MLKA 4G7ZF 2OZ6A 3I0TA 1MJ9A 2EFOA 1FYMA 4XLNF 3D0SA 2COMA 3I5UA 5JHUA 2DFIA 5FD6A 2L02A 3ISPA 3RI4A 1IN7A 2FE3A 3NEUA 2PLYA 1XSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EJU A;  1F9N A;  1R36 A;  5LRS A;  2ISZ A;  3MFK A;  1H9T A;  5K1Y A;  2CFX A;  1ZN2 A;  1SD7 A;  3HIF A;  4UHT A;  5CVR A;  5HDN A;  2GQQ A;  2E1N A;  1PP7 U;  2PJP A;  3CLO A;  2Z33 A;  4ENN A;  2O61 A;  1TNS A;  1ZGA A;  1B6A A;  1BIA A;  5JI6 A;  2B0L A;  4O5V A;  3K0L A;  1PUE E;  3KZY A;  2M45 A;  2XRO A;  1T0F A;  2F5F A;  1R1U A;  5D4S A;  4WXH A;  3J80 Z;  1G3S A;  2XVC A;  1KQ9 A;  2UXN A;  1XSV A;  2OD5 A;  2GZW A;  2W24 A;  1J9I A;  3O6B B;  2F2E A;  5CVI A;  4CXF A;  2XAH A;  5A2Q Z;  1XMA A;  3PFI A;  2VBW A;  4UV9 A;  1W7P B;  1IXS B;  5E1Z B;  3EET A;  4Y15 A;  2ELH A;  4MHG A;  2M8E A;  3QRF F;  2HFH A;  1HKT A;  2JTV A;  3FWE A;  4EJT A;  3CJN A;  3MAJ A;  1S6L A;  1YLF A;  4HQM A;  3KEQ A;  1ON2 A;  1BJA A;  1KQ8 A;  1ON1 A;  3OOP A;  4PGG A;  1XB4 A;  1EH8 A;  4F7Z A;  1B9N A;  4KYW A;  1OKR A;  3HRT A;  1IN8 A;  1R5H A;  1HW2 A;  3KCC A;  3KP7 A;  2RDP A;  2GXB A;  1WWX A;  1HKQ A;  1T2K A;  3AAF A;  2V79 A;  3D5L A;  4M71 A;  3I54 A;  1JGS A;  1YIO A;  5ILU A;  2CSO A;  1R1T A;  1YW9 A;  4KT5 C;  3KP2 A;  2IRF G;  1Z6R A;  1U8R A;  1BN5 A;  4IRI A;  3WOD F;  4OIN F;  4KMF A;  3RPQ A;  4H0E A;  4NQW A;  2BYV E;  1XD7 A;  1FNN A;  1FP1 D;  1XN7 A;  3G73 A;  1IUY A;  5D6E A;  1B59 A;  1BI1 A;  5CVJ A;  4LB6 B;  1XDU A;  1YG2 A;  1UHM A;  1QZZ A;  2IA1 A;  3TDU C;  5ERI A;  3ZN0 A;  2W25 A;  1FSH A;  2QWW A;  3WTU C;  4Z2Y A;  3LA7 A;  5ICE A;  1D5V A;  1FBQ A;  2OQR A;  3KZZ A;  3WU0 A;  3GWZ A;  1YFH A;  5HS9 A;  4MGR A;  3IRR A;  2J5P A;  2PMU A;  4N0B A;  2D2W A;  3GVA A;  3GXO A;  3FF5 A;  4HAM A;  2OAZ A;  2L01 A;  4GO1 A;  5D5U B;  3ECH A;  1STZ A;  2ACJ A;  3IHU A;  1RZ4 A;  1HBX G;  4RGR A;  3GX4 X;  4LG0 B;  2M5W A;  2LSO A;  1OR7 A;  5J8C A;  2OA4 A;  1O3R A;  4ZH4 F;  2RN7 A;  1TW3 A;  1FP2 A;  5IT3 A;  3M7G A;  2VOP A;  5FD5 A;  1DP7 P;  3KP4 A;  3T8T A;  1O3Q A;  4LG0 A;  4AVP A;  3KP5 A;  2BBY A;  1QQI A;  2P7C B;  3V7R A;  2DPD A;  2EK5 A;  4HBL A;  2R7D A;  4ENK A;  3JTH A;  2CQK A;  2LKP A;  5D6F A;  3WTY C;  4U0W A;  4D0P A;  4M6X A;  4YG2 F;  4G8X A;  4M9S A;  1FY7 A;  2XAQ A;  1ZRD A;  2VBZ A;  3HRS A;  1IW7 F;  2YSR A;  4EM2 A;  1I5Z A;  3KET A;  5BQT A;  4A12 A;  2WC2 A;  3E5U A;  1SD6 A;  4M73 A;  1MZB A;  1LEA A;  3BJO A;  4ETS A;  3WGG A;  2VN2 A;  2ADU A;  3HYI A;  2DBB A;  3I59 A;  3GFI A;  4ON0 A;  1K7A A;  1QPM A;  3E97 A;  3BOQ A;  4K2E A;  3GO5 A;  3DFG A;  3RJP A;  2YU3 A;  4CZZ A;  4Q5S F;  4ENJ A;  3L00 A;  5HDK A;  1ZRC A;  1BI2 A;  2ZXJ A;  4U88 A;  2QM3 A;  1FOK A;  4PGH A;  3CUQ A;  1W4M A;  1GXP A;  4HLX A;  2Z9O A;  3WGI A;  2K86 A;  3T5X A;  3L2C A;  5J6X A;  2TDX A;  1YW8 A;  2QEN A;  3TO6 A;  1IN6 A;  2VT2 A;  3LQR A;  4EV0 A;  1R00 A;  5A2Q K;  4A0Y A;  2HDC A;  4IJA A;  1FYK A;  5FLX Z;  2O8X A;  5F64 A;  4YIF A;  1BC7 C;  1G3Y A;  3FM5 A;  2V6C A;  5D5V B;  4EJV A;  5L3E A;  2HS5 A;  4R1H A;  2IW5 A;  5E1X A;  4ZYE A;  1F1Z A;  1J5Y A;  3C1D A;  2FF4 A;  4RB0 A;  2FEZ A;  2MH2 A;  4HQE A;  1J0R A;  2J5O A;  1W5T A;  3LAJ A;  2MC3 A;  3F6O A;  1MD0 A;  4HF1 A;  4OMY A;  3I64 A;  2YX7 A;  3ZN1 A;  3DXJ F;  3BZ6 A;  1RIO H;  1U3E M;  2KIU A;  4IXA A;  1T98 A;  2ESN A;  3PQK A;  2H09 A;  2NNY A;  3FXQ A;  5DV5 A;  4RB1 A;  3BWG A;  4BHP A;  3M9A A;  4RGU A;  3HSF A;  3VFZ A;  1L0O C;  4BYY A;  3GFM A;  1O3S A;  1Z05 A;  3HOS A;  4EQQ A;  3F3X A;  3V8K A;  3MWM A;  2P8T A;  1OYY A;  3RYP A;  2P5K A;  3TGN A;  2NRA C;  5L3F A;  1TW2 A;  4OIR F;  5J8F A;  1IRG A;  4M9X A;  1YS6 A;  2H6C A;  4ZZD A;  4I02 A;  1T6S A;  2P4W A;  3J80 K;  3IWZ A;  2P5V A;  1ULY A;  4HV5 A;  2DTR A;  2IPQ X;  2K7L A;  2PBI A;  3C18 A;  4YII A;  2DI3 A;  4HYE A;  1USS A;  2K4J A;  2BGC A;  1SAX A;  1TQI A;  2GA2 A;  3VOE A;  2EFN A;  1BIB A;  4LMY A;  3RKW A;  3DF8 A;  2Y48 A;  5L3C A;  4BNC A;  2DQL A;  3EDP A;  2JRT A;  5ICF A;  1LB2 A;  2O0Y A;  3ABU A;  5JVT A;  3TQN A;  3F8F A;  1SMT A;  5DCM A;  2A3S A;  2HOE A;  4CHU A;  2LF7 A;  3ABT A;  2VXZ A;  5HLG A;  4WXD A;  2LDU A;  2NAZ A;  2F5D A;  3JAM K;  3TO7 A;  2ZO4 A;  3DPL C;  2V9V A;  1P2F A;  4JBA A;  5HLH A;  3H3U A;  1HW1 A;  3TO9 A;  3KE2 A;  3VOD A;  4A6E A;  3GF2 A;  2VBX A;  5HOO A;  2XGX A;  3E3V A;  5D5W B;  2RC4 A;  4MTE A;  5ED4 A;  1XCV A;  1WI9 A;  2F5C A;  2P6S A;  1FSE A;  1P4X A;  1EH7 A;  2P7V B;  2PN6 A;  4HW0 A;  1LDD A;  2K02 A;  3ZMZ A;  1XGS A;  3I53 A;  4OIQ F;  3IKV A;  2E7W A;  2FBK A;  2EV6 A;  5IT9 K;  2JZY A;  4ESF A;  1E17 A;  4P55 A;  1ZG3 A;  4HDV A;  3W6J B;  2DQR A;  4IHS A;  2VE8 A;  3SHF A;  5BS6 A;  5AIQ A;  4FX4 A;  1BC8 C;  1RI7 A;  4WWC A;  1TNT A;  3ZQ7 A;  1HXD A;  2EFQ A;  5KK1 A;  1ZG5 A;  1D8K A;  4PCQ A;  5FFX A;  1UHW A;  2XAJ A;  3IL2 A;  1ZYR F;  4RAZ A;  5TRD A;  3FMQ A;  5BPI A;  1QNT A;  2L54 A;  2KRF A;  4ASN A;  4WK8 F;  3GFJ A;  3P9C A;  3K2Z A;  4RGS A;  3MZH A;  2MBF A;  3N4M A;  4CDG A;  5JFR A;  4WCG A;  2KIF A;  5CLS A;  3FHZ A;  1MJA A;  2FBH A;  5ICC A;  3HTU A;  2HKX A;  2EFW A;  1HW5 A;  1PDN C;  1O7L A;  3V8L A;  3CDH A;  3WTV C;  4MQ9 F;  2ZJ2 A;  3W6K B;  1P4W A;  4HDU A;  2PFB A;  2EV0 A;  1FX7 A;  3V8J A;  2QQB A;  3U2R A;  4HV6 A;  4XBF A;  1ZH5 A;  4LFU A;  4G6D A;  1JHF A;  2QYO A;  3HRM A;  1T39 A;  1S3J A;  3RKX A;  4O3M A;  1W5S A;  2K4B A;  2PEX A;  2WTE A;  3CUQ C;  2HTJ A;  1BOA A;  3LWF A;  4A5N A;  1YQA A;  2WWY A;  4HX4 A;  4KFC A;  2DK8 A;  4AIJ A;  1KQ0 A;  2GXG A;  5H20 A;  1R5G A;  1J75 A;  1R1V A;  4GCV A;  4I0A A;  3DP7 A;  1B4A A;  2IP2 A;  3WTT C;  3JW4 A;  4I98 B;  4G7H F;  1KA8 A;  1I1G A;  4HZF A;  5LLQ A;  4L5I A;  4CIC A;  4B09 A;  3HSE A;  3MZY A;  2CO5 A;  2XV4 S;  1XGN A;  4IPA A;  1LJ9 A;  3QP6 A;  3LST A;  4ZZL A;  3DKW A;  2FOK A;  4GYG A;  4L9V A;  1S7A A;  2ZKZ A;  2Z99 A;  1XSD A;  5CVV A;  3FXU A;  2HYG D;  1YYV A;  1AWC A;  4RB2 C;  3L09 A;  5E20 A;  4CYD A;  2X4H A;  5D5X B;  2NYX A;  3BDD A;  3SXY A;  5E1W A;  4MTD A;  4YFK F;  4JQF A;  4GXO A;  3P9I A;  1LDK B;  1LDJ A;  4HX7 A;  1LVA A;  1K78 B;  4ZYG A;  2FBI A;  1X3U A;  5DEQ A;  5D8K B;  5EEG A;  4XSZ F;  4S05 A;  5LRR A;  4L9J A;  4YFN F;  5HVQ C;  4MEY F;  4KIB A;  3CO7 C;  1TTY A;  4G9Y A;  1XMK A;  4G7O F;  1MDM B;  5EEH A;  3SQN A;  2D1V A;  2D45 A;  3SFZ A;  5LHH A;  3DQV C;  3WTS C;  3RTR A;  2A68 F;  3F72 A;  2MLG A;  2V1D A;  4UVC A;  4UVB A;  1FZP B;  2MH9 A;  4L0Z B;  2HQR A;  1QBJ A;  1U2W A;  3E5Q A;  3F22 A;  2A61 A;  1BM9 A;  1TQP A;  3WG9 A;  3C3W A;  1R58 A;  1CF7 B;  1IXC A;  4HF0 A;  1B9M A;  1REP C;  2L4M A;  4WXC A;  2QQ9 A;  4EMS A;  1DUX C;  4AIH A;  2PQ8 A;  1YW7 A;  1W7P A;  3KEO A;  3ZP5 A;  1FWZ A;  3RYR A;  1FC3 A;  2DW4 A;  3ELK A;  3F23 A;  1G4D A;  2A5Y B;  5K5Q A;  4PZJ A;  2STT A;  2HEO A;  4Y13 A;  2VBY A;  5CVU A;  3R61 A;  4EGZ A;  5F6F A;  1P6R A;  1R22 A;  4DQ2 A;  1D8J A;  3KP6 A;  2FRH A;  4OIO F;  5K5R A;  1Z7U A;  3J7A O;  2IA0 A;  1RUN A;  3WTZ A;  5E17 F;  2ETH A;  4OMZ A;  5E8G A;  4HF2 A;  3ROU A;  3R0A A;  2DO7 A;  1MGT A;  4Q4Z F;  5ILV A;  1FBU A;  2L4A A;  1A04 A;  2D1H A;  2QBY B;  2FSW A;  2XUB A;  1IXR C;  4LB5 A;  4I7H A;  4R8H A;  4I09 A;  2Q8K A;  2ESH A;  2VOD A;  2F5E A;  2KJC A;  2QBY A;  1EH6 A;  3EYI A;  3I71 A;  3R60 A;  1DPU A;  1JXS A;  1UB9 A;  3E6C C;  3I59 B;  3GZ6 A;  1KYW A;  1ZLJ A;  3TDZ C;  5L3G A;  3HSR A;  1TLH B;  5FLX K;  2WV0 A;  5HLI A;  2FU4 A;  5L3D A;  1UFM A;  1Y0U A;  2DT5 A;  1EV7 A;  2Q0O A;  3MQ0 A;  1FBS A;  2OZU A;  2A69 F;  2M87 A;  3KP3 A;  1HKS A;  1ZGJ A;  3P9K A;  4QWQ A;  3U1D A;  2Y0M A;  3IWF A;  5DDG A;  4LD5 A;  4U0Y A;  1XCB A;  5KVR A;  2ZBK A;  3QPT A;  1TQM A;  4EGY A;  3JTG A;  2VC1 A;  3ZMT A;  5BPD A;  4LLL A;  2CW0 F;  4L0Y B;  2VOO A;  4LJZ F;  2BV6 A;  1ZLK A;  1IAW A;  3WE3 A;  4RB3 C;  4P96 A;  1KU7 A;  2RKH A;  5LHG A;  1HST A;  3RPU A;  1FPQ A;  5IT9 Z;  4A6D A;  2OU2 A;  4KN4 X;  1BI0 A;  1UST A;  3G3Z A;  2Z5U A;  3RKY A;  4KA4 A;  3HHH A;  2DLL A;  5FO5 A;  2JPC A;  2DAO A;  3I58 A;  1Z1D A;  1GHC A;  3T0Y A;  1S7O A;  2ZFW A;  1F4K A;  2QUF A;  1MJB A;  1VTN C;  2EWN A;  3FXR A;  1KU2 A;  4N9I A;  1T38 A;  2UWM A;  2QQA A;  4KIF A;  3LA3 A;  4OU0 A;  2XAS A;  1J59 A;  2HQN A;  5HS7 A;  4ESJ A;  2GWR A;  2GA1 A;  3F21 A;  4Q47 A;  3I4P A;  3KLO A;  4UVA A;  2DPU A;  1ZAR A;  2G7U A;  3IKT A;  1AOY A;  2R7F A;  2HTS A;  3IC7 A;  1CGP A;  2IJL A;  1XDS A;  2CGP A;  1HQC A;  4AD9 A;  5TJJ A;  1V3F A;  3P7N A;  2W57 A;  1XGO A;  1I27 A;  1GXQ A;  4BXU A;  1U78 A;  2IT0 A;  3M8F A;  1L3L A;  4LLN A;  2NNN A;  4L5J A;  2M30 A;  4IF4 A;  2XRN A;  2C6Y A;  2Q2E A;  1U6G A;  1UCR A;  3BJ6 A;  3ZMS A;  3ULQ B;  1RNL A;  3JSP A;  2UZK A;  5DD4 A;  4KNY A;  4G6Q A;  4M74 A;  3QOP A;  4ZYH A;  2GAU A;  1F5T A;  3Q9V A;  3H92 A;  1H9G A;  2A6H F;  3QU3 A;  1MKM A;  5F1R A;  5LGT A;  1SFX A;  2YX4 A;  1WKM A;  4WF2 A;  3DV8 A;  4N9H A;  3GZ5 A;  4RGX A;  4XSX F;  3FX3 A;  4KUM A;  5FB2 A;  3CUQ B;  2RVC A;  2XAG A;  2FML A;  1S8N A;  1I1S A;  4U0V A;  2O6G E;  6PAX A;  1K79 A;  3E6D A;  2O3F A;  4U7B A;  1OYW A;  3E6B A;  3FZV A;  1R23 A;  2M1B A;  4Y17 A;  3NQO A;  3O2P E;  3QPH A;  4L9N A;  2HKO A;  2VT3 A;  4DNC A;  2FA5 A;  5DD8 A;  1DDN A;  1PP8 F;  4MQV A;  1U5T B;  3DEU A;  3RDI A;  2XAF A;  4UXN A;  1G6N A;  4FT8 A;  4LGW A;  4EVI A;  1U5T C;  4BH9 A;  4NHJ A;  1GVJ A;  4IRG A;  2PMH A;  1KU9 A;  3EYY A;  3GYH X;  3K69 A;  4KDP A;  1WSU A;  3LFK A;  1JE8 A;  3F8M A;  1H0M A;  3QU6 A;  3HTS B;  1G3T A;  1S29 A;  3CUO A;  3SZT A;  2FNP A;  2KKO A;  3ZMV A;  1OPC A;  2ZCW A;  4B8X A;  4BHC A;  2RNJ A;  3M8E A;  1SD4 A;  2HZT A;  5LEJ A;  3QAH A;  4P9F A;  5CJ9 A;  4KN7 X;  4KIC A;  5H6Q A;  3GLX A;  1Z9C A;  2ZNY A;  1DPR A;  4HA8 A;  4CO8 A;  5AON A;  5D4R A;  2JPB A;  1SMY F;  2PI0 A;  4OOI A;  2A07 F;  4KMU X;  3BY6 A;  3S2W A;  2FXA A;  4RS8 A;  1SFE A;  2H27 A;  3ERE D;  1QO0 D;  5L3B A;  1OYI A;  3KFW X;  4M72 A;  4RAY A;  2BE5 F;  3E6M A;  1J7K A;  3T1B A;  3LA2 A;  1ZRF A;  2LNB A;  5BMZ A;  1IN4 A;  2IVM A;  5CYV A;  2IA2 A;  5HS8 A;  5LHI A;  4EM0 B;  2YR2 A;  3WGH A;  3V7S A;  4AIK A;  4BHB A;  3EQL F;  1I6X A;  3U9G A;  1FT9 A;  3J81 K;  3L7W A;  1XGM A;  1O3T A;  3SZP A;  2E1C A;  4L18 B;  1G3W A;  4M6Y A;  4TV7 A;  4CGZ A;  4HX8 A;  1KGS A;  1C0W A;  3ZMU A;  2BEO A;  1V4R A;  4BAY A;  2P6T A;  5LBQ A;  1TBX A;  2V1X A;  1YO5 C;  4FX0 A;  1W7P D;  3FMR A;  2VON A;  1ODD A;  4EJW A;  4A0Z A;  4M9Z A;  3K1M A;  3OV8 A;  2DU9 A;  2Z3Y A;  3K1N A;  3M1E A;  2MD5 A;  5DYM A;  3WE2 A;  5ILS A;  3COA C;  3F8C A;  3F6V A;  3JAM Z;  3BJA A;  3ECO A;  2NS0 A;  5BOX A;  1U5T A;  3V4G A;  3MCZ A;  2PG4 A;  4NB5 A;  3REO A;  3TOB A;  2RV8 A;  2XHK A;  2P5L C;  4Q48 A;  3H3Z A;  2MA3 A;  4LK0 F;  2EV5 A;  2YPR A;  3WU1 B;  2EFP A;  4HLY A;  4IVN A;  2HYF A;  4MNU A;  4WX9 A;  2ZME A;  2QVO A;  4AWX B;  2OBP A;  2DK5 A;  1YS7 A;  3K9T A;  3E5X A;  4GGG A;  4FHT A;  1LEB A;  1Q1H A;  2AS5 F;  4ESB A;  1YTY A;  5E18 F;  5K5O A;  2EA4 A;  1FYL A;  3JSO A;  3HUG A;  5DUK A;  4A0X A;  3CTA A;  1P4A A;  4QLC U;  2E7X A;  2JT1 A;  4HOB A;  1K78 A;  3V7C A;  4ZYD A;  1K6O A;  3O3K A;  1P92 A;  1ONV A;  5HDG A;  2XIG A;  4BQA A;  3BP8 A;  3GUD A;  2H6B A;  4S04 A;  4IHT A;  3LAP A;  3R0J A;  5D8L B;  3F8B A;  3J81 Z;  2Y75 A;  3WTW C;  2L3D A;  4LK1 F;  3IRQ A;  3TOA A;  4A2U A;  1IF1 A;  5DUI A;  1LQ1 A;  1IZ1 A;  3BRO A;  4L9T A;  1KU3 A;  4EJO A;  4O6J A;  2EB7 A;  5FGM A;  1ZRE A;  1SFU A;  3ZMD A;  3EUH A;  1ZHF A;  5AIP A;  4IRH A;  3F8N A;  5DCM B;  2VE9 A;  4P5O A;  3FM3 A;  2FMY A;  2X0L A;  5LGU A;  3GEZ A;  3B02 A;  3R4K A;  2G7H A;  1O57 A;  3TKY A;  1LNW A;  2HWV A;  3WTX C;  4OIP F;  3C7J A;  2EA2 A;  3GW2 A;  3FMS A;  3HOT A;  1WRJ A;  1D3Y A;  3L9F A;  3VB2 A;  3GFL A;  4EM1 A;  3R6S A;  5H6R A;  5LGN A;  2AXL A;  3ZPL A;  1CF7 A;  4XRF A;  1B1B A;  1RUO A;  1BBY A;  1E2X A;  3BPV A;  1J2X A;  3DPT A;  1IN5 A;  4KIG A;  2LF8 A;  3KLN A;  3MEX A;  2ZNZ A;  1QGP A;  4G94 A;  4GYI A;  4R79 A;  5DCF A;  4I2O A;  3QP5 A;  2G9W A;  3LQQ A;  1IRF A;  2V1U A;  4U7D A;  2GIV A;  2K27 A;  2VC0 A;  2KJB A;  5JR3 A;  1Z91 A;  2JSC A;  1NHA A;  2CWE A;  5ICG A;  1R7J A;  3NRV A;  2W84 A;  3T8R A;  4I01 A;  4E70 A;  2R3S A;  1SD5 A;  4UNO A;  2HR3 A;  2RQP A;  4LLG F;  2FNA A;  5FFZ A;  2QLZ A;  2OQG A;  4ENM A;  4YFX F;  3VEP A;  1WQ2 A;  2STW A;  4PDK A;  5E8I A;  4A5M A;  2QZ8 A;  3K1P A;  2ZME B;  1ZAO A;  3PQJ A;  2UXX A;  3Q9S A;  1FLI A;  2O03 A;  1BI3 A;  2A6E F;  1KYZ A;  2KIM A;  3CO6 C;  3B73 A;  3N97 A;  3HHG A;  4UUV A;  3HRU A;  2CYY A;  3RIR A;  2HGC A;  4UV8 A;  3Q5F A;  2H94 A;  2XKP A;  1MDM A;  2RGV A;  1QZY A;  3ML6 A;  1OMI A;  5LEK A;  2EJR A;  1Z6T A;  2FQ3 A;  2CG4 A;  2W85 A;  2ISY A;  1O7F A;  4MEX F;  1ZG1 A;  1JHH A;  1HSJ A;  4XLP F;  2XKO A;  4P9U A;  3BPX A;  4JK1 X;  4I0B A;  2MLK A;  4G7Z F;  2OZ6 A;  3I0T A;  1MJ9 A;  2EFO A;  1FYM A;  4XLN F;  3D0S A;  2COM A;  3I5U A;  5JHU A;  2DFI A;  5FD6 A;  2L02 A;  3ISP A;  3RI4 A;  1IN7 A;  2FE3 A;  3NEU A;  2PLY A;  1XSX A; 
#chains in the Genus database with same CATH topology
 2PX9 A;  1OCZ H;  2KPM A;  4EJU A;  2WBM A;  1F9N A;  3SDG A;  1R36 A;  3BTI A;  5LRS A;  2ISZ A;  3MFK A;  2MFZ A;  2NVT J;  1H9T A;  5K1Y A;  2WV1 A;  2CFX A;  3B6C A;  2WB1 N;  1ZN2 A;  3CMM A;  2MGQ A;  1SD7 A;  2X6O A;  3HIF A;  4CYC B;  4UUS A;  3A2K A;  3VYS B;  4UHT A;  5CVR A;  2L7F P;  3CDI A;  5HDN A;  2GQQ A;  4HPQ A;  2E35 A;  2E1N A;  1PP7 U;  2PJP A;  5FLM J;  4A3J J;  3CLO A;  2Z33 A;  3J7Z I;  4ENN A;  2O61 A;  1TNS A;  1ZGA A;  4IX7 A;  1B6A A;  4XKC A;  2CV1 A;  1BIA A;  1FIP A;  3KEY A;  3BR5 A;  5JI6 A;  2B0L A;  4O5V A;  3K0L A;  1PUE E;  3S32 A;  3KZY A;  2LH9 A;  2VQC A;  2M45 A;  2XRO A;  2CMP A;  3K7A J;  3D5S C;  1T0F A;  2F5F A;  1R1U A;  5D4S A;  2HI3 A;  4Y52 J;  2RRE A;  1WJA A;  4II2 A;  2ZJP F;  1FOX A;  4WXH A;  3J80 Z;  5EF6 A;  5GTI C;  3OY9 A;  4XOR A;  1G3S A;  2XVC A;  1KQ9 A;  5EG0 A;  1VQL I;  4XN3 A;  2UXN A;  1XSV A;  4MIM A;  2OD5 A;  2GZW A;  1VQM I;  1JJ6 C;  2W24 A;  2KHM A;  5B3S H;  1J9I A;  3O6B B;  1Y1V J;  2F2E A;  2L9N A;  5CVI A;  4CXF A;  3CCJ I;  4IHV A;  1WJF A;  2EZH A;  2XAH A;  3X2Q H;  1SFK A;  1XMA A;  2KRC A;  2L9S A;  3PFI A;  4RM3 A;  5BNG A;  2VBW A;  4UV9 A;  1MIJ A;  1W7P B;  1RPW A;  5FKO A;  1Z77 A;  2HQA A;  3FXO A;  1IXS B;  5E1Z B;  3EET A;  3JRE A;  4Y15 A;  2CU7 A;  2ELH A;  4MHG A;  3OYM A;  2M8E A;  3QRF F;  3CES A;  2HFH A;  1ZGW A;  1HKT A;  1KZH A;  1Z7L A;  2JTV A;  2QSH X;  3FBI B;  3FWE A;  1W0U A;  1MMS A;  4EJT A;  1YI2 I;  3JRI A;  3CJN A;  3MAJ A;  2LMD A;  1VQO I;  3H5A A;  1S6L A;  1YLF A;  4HQM A;  3BR1 A;  3KEQ A;  3LSP A;  4A3I J;  1X4O A;  2Y0S A;  4RAF A;  1X1P A;  1ON2 A;  1BJA A;  1KQ8 A;  2EZK A;  3ZQL A;  1IDY A;  1ON1 A;  3S2H J;  3OOP A;  2KIQ A;  5J4V A;  2LRE A;  3PO2 J;  5B66 C;  4PGG A;  4A3F J;  2F6C A;  1XB4 A;  4C3I J;  1EH8 A;  4F7Z A;  1B9N A;  4KYW A;  1OKR A;  1NH3 A;  2DOE A;  3A03 A;  4PJM A;  3AG3 H;  3FXM A;  3HRT A;  2HXI A;  1IN8 A;  2UV1 A;  3RQ4 A;  3OYK A;  1R5H A;  1HW2 A;  1XG1 A;  3KCC A;  2XAU A;  3KP7 A;  2RDP A;  3UKG A;  2GXB A;  4JYK A;  1WWX A;  1HKQ A;  2OCE A;  3H35 A;  2KDO A;  4BS9 A;  1T2K A;  3AAF A;  2B7E A;  2V79 A;  4FTH A;  5J40 A;  3SEQ A;  3D5L A;  3HB9 A;  4M71 A;  2F4I A;  3I54 A;  3OIO A;  1IGN A;  1JGS A;  1YIO A;  5ILU A;  2CSO A;  2OF7 A;  1R1T A;  1YW9 A;  4X1E A;  2E5N A;  1R49 A;  4KT5 C;  2OTL I;  5B1B H;  3K4L A;  3KP2 A;  3KIO A;  2NOJ B;  3BCA A;  2IRF G;  1Z6R A;  1V55 H;  1U8R A;  4RA2 A;  3IV5 A;  1BN5 A;  4BEH B;  3M4O J;  4IRI A;  3WOD F;  4PJ0 C;  5DM7 F;  4OIN F;  4KMF A;  4RM2 A;  1M1E B;  1ORK A;  3RPQ A;  4H0E A;  4NQW A;  1GLN A;  2BYV E;  1XD7 A;  1FNN A;  2XPV A;  1FP1 D;  3QWL A;  3HOW J;  4XR6 A;  1XN7 A;  3G73 A;  1IUY A;  5D6E A;  1I3A A;  2XSJ C;  4XNF A;  1B59 A;  4X6A J;  1BI1 A;  5CVJ A;  4LB6 B;  4LIV A;  2JVH A;  1SVO A;  1Z0X A;  4XLH A;  4HST A;  1XDU A;  2DFH A;  1DU6 A;  2CS3 A;  1YG2 A;  2HOA A;  1UHM A;  1QZZ A;  2QSG X;  2IA1 A;  3TDU C;  3H0G J;  3RKQ A;  5KAI C;  4DJA A;  4B48 A;  5ERI A;  3I3L A;  3ZN0 A;  2W25 A;  4BQN A;  1FSH A;  1Y8Q B;  1R4N B;  2QWW A;  3A01 B;  1IO2 A;  3Q0W A;  3WTU C;  4Z2Y A;  3LA7 A;  5ICE A;  1D5V A;  1FBQ A;  2OQR A;  3KZZ A;  5C4J J;  2K9N A;  1V5F A;  3DCF A;  3WU0 A;  3GWZ A;  1YFH A;  5TGT A;  3BG7 A;  5HS9 A;  4MGR A;  4I99 C;  3IRR A;  2J5P A;  2PMU A;  3H36 A;  1MND A;  2BY3 A;  4N0B A;  3A01 A;  4CCN A;  3ZQQ A;  2D2W A;  3G1L A;  3GVA A;  3GXO A;  3FF5 A;  3DEW A;  4HAM A;  2LR8 A;  2OAZ A;  2L01 A;  2LK2 A;  4GO1 A;  1HCR A;  5D5U B;  4ZJZ A;  4QPQ A;  3MZ8 A;  1S72 I;  2PJR B;  3ECH A;  1STZ A;  2ACJ A;  3IHU A;  1RZ4 A;  1HBX G;  4J01 A;  4RGR A;  4ABZ A;  3GX4 X;  3IH2 A;  4LG0 B;  4YEL A;  4HNT A;  2M5W A;  1U9N A;  2LSO A;  2FJ1 A;  1OR7 A;  5FKM A;  2M4G A;  5EG0 B;  5J8C A;  3J7Y J;  2ZXW H;  2O9L A;  2OA4 A;  1O3R A;  2GIZ A;  4ZH4 F;  2RN7 A;  2Z1D A;  1TW3 A;  1FP2 A;  5IT3 A;  3M7G A;  2P81 A;  1BR2 A;  2OV7 A;  2VOP A;  5FD5 A;  1DP7 P;  4A93 J;  3KP4 A;  3T8T A;  1TZL A;  4LG0 A;  1O3Q A;  3KYC B;  4AVP A;  3KP5 A;  2BBY A;  3HM5 A;  1QQI A;  2XGE A;  5FKN A;  2LRD A;  1N77 A;  1MBK A;  1A31 A;  2P7C B;  2ICW G;  2VKH A;  3V7R A;  1OFC X;  2F4M B;  2DPD A;  2EK5 A;  4HBL A;  2IGK A;  2R7D A;  4ENK A;  1X3W B;  3JTH A;  3OYF A;  2CQK A;  2LKP A;  2AHQ A;  5D6F A;  3WTY C;  1WJE A;  4U0W A;  3LSR A;  4D0P A;  5GTH C;  3OYJ A;  4NC6 A;  3BZK A;  4M6X A;  2XSD C;  4YG2 F;  4G8X A;  4M9S A;  1GT0 C;  1FY7 A;  2WY8 Q;  2XAQ A;  2LY2 A;  1ZRD A;  3JCU C;  4E7J A;  2IXS A;  2VBZ A;  3VYR B;  4M6V A;  2MD0 A;  3HRS A;  4I76 A;  2HZD A;  2OJE D;  1IW7 F;  2YSR A;  4EM2 A;  1I5Z A;  3KET A;  4HEA 2;  5BQT A;  4CA0 A;  4A12 A;  4II3 A;  2NVU B;  2WC2 A;  1FEX A;  2KP6 A;  1J09 A;  3E5U A;  1SD6 A;  4M73 A;  1MZB A;  1LEA A;  2X1E A;  1UHS A;  1VND A;  4DYR A;  3BJO A;  3CCQ I;  2JUG A;  4DBR A;  4C2U A;  1D0Z A;  3WGG A;  4ETS A;  4A3K J;  3FXK A;  2XRL A;  2KRH A;  2VN2 A;  2ADU A;  2K9S A;  2HVR A;  3HYI A;  1MH3 A;  2DBB A;  3BT9 A;  3I59 A;  1IUF A;  1A6I A;  1AKH B;  3GFI A;  3DTK A;  1IDZ A;  3L2V A;  4ON0 A;  2CV2 A;  4F52 A;  1K7A A;  1X1D A;  1QPM A;  3E97 A;  3BOQ A;  4K2E A;  3MD2 A;  3GO5 A;  3DFG A;  3LSH A;  3RJP A;  1O4X A;  2YU3 A;  1JTY A;  4CZZ A;  4Q5S F;  4ENJ A;  2E2H J;  3L00 A;  1WJC A;  5HDK A;  1ZRC A;  3LOC A;  2V9P A;  4UB8 C;  2HVQ A;  1AKH A;  1BI2 A;  2ZXJ A;  2Y30 A;  2AQF A;  3K10 A;  4U88 A;  2QM3 A;  1FOK A;  4PGH A;  2JJ7 A;  3CUQ A;  1W4M A;  1ZQ3 P;  1GXP A;  4L5E A;  5K7Z A;  4HLX A;  2Z9O A;  2P0W A;  2R7Q A;  5E3N A;  3WGI A;  2K86 A;  1PVE A;  3T5X A;  2DYR H;  3L2C A;  1B8I A;  3P5J A;  5M3F J;  5C44 J;  2EH3 A;  5J6X A;  1V5G A;  1YW8 A;  2TDX A;  3DBL B;  2QEN A;  3TO6 A;  1SAN A;  2L5Q A;  3LFU A;  1IN6 A;  2VT2 A;  3LQR A;  1JKQ C;  4EV0 A;  1R00 A;  4D9J A;  5A2Q K;  1HDP A;  2JA7 J;  3AL0 C;  1A6Q A;  4A0Y A;  1OCO H;  3VYT B;  1ETV A;  4J19 A;  1IRX A;  2HDC A;  4IJA A;  4V2G A;  2DYS H;  3NWT A;  1FYK A;  3HGG A;  1JGG A;  5FLX Z;  2O8X A;  1HC8 A;  5F64 A;  4YIF A;  1NK3 P;  1BC7 C;  3ZR8 X;  2L7Z A;  1VQ4 I;  3BC8 A;  1G3Y A;  2K3P A;  1W36 D;  3L2W A;  3FM5 A;  1JUM A;  2V6C A;  5J1U A;  5D5V B;  1SC7 A;  4EJV A;  5L3E A;  3IAS 2;  3J7A Y;  2HS5 A;  4R1H A;  2IW5 A;  3LMM A;  3QYB A;  5E1X A;  4YIR X;  4ZYE A;  4M3E A;  4IOC F;  1F1Z A;  1T8I A;  1J5Y A;  2L0K A;  2FF4 A;  2WB1 A;  3C1D A;  4RB0 A;  1YE9 A;  2E60 A;  4XL9 A;  2FEZ A;  2MH2 A;  5GAE J;  2X6W A;  5KAF C;  4AM3 A;  4HQE A;  2YU9 J;  1J0R A;  2J5O A;  1W5T A;  3I56 I;  3LAJ A;  1E3P A;  5M5W J;  1FOW A;  2MC3 A;  3F6O A;  2HOT A;  1MD0 A;  1LE8 A;  4HF1 A;  4OMY A;  3I64 A;  2YX7 A;  5LFA A;  1JTX A;  2R7U A;  3GTO J;  2BHY A;  3ZN1 A;  3DXJ F;  3F0C A;  3BZ6 A;  1RIO H;  4YRV A;  4IXA A;  2KIU A;  1U3E M;  1T98 A;  2ESN A;  4B44 A;  1OQY A;  3PQK A;  2H09 A;  5GAG J;  2NNY A;  3SFI A;  3FXQ A;  5DV5 A;  4RB1 A;  3Q0V A;  3BWG A;  4BHP A;  3M9A A;  4RGU A;  1ETX A;  1MNE A;  3HSF A;  3VFZ A;  1S5L C;  1L0O C;  4BYY A;  3GFM A;  1FIA A;  1O3S A;  5M3M J;  1Z05 A;  3HOS A;  1YJN I;  2M34 A;  4EQQ A;  3F3X A;  3WHC A;  3V8K A;  3CZ6 A;  3MWM A;  3PL8 A;  2P8T A;  4U87 A;  1K83 J;  2MSY A;  1OYY A;  3RYP A;  1ETK A;  2K5C A;  2P5K A;  3TGN A;  2NRA C;  4MLO A;  5L3F A;  3EUK L;  1TW2 A;  2K85 A;  5TIS C;  3QYF A;  2JRM A;  4OIR F;  5J8F A;  4FCY A;  1IRG A;  4M9X A;  1X3Z B;  4BDZ A;  1YS6 A;  2NVX J;  2H6C A;  3AL0 B;  4ZZD A;  2ZJQ F;  4I02 A;  2WAF A;  2WAQ N;  4C2M J;  3G4S I;  1AU7 A;  3SDB A;  1T6S A;  2P4W A;  4XQF A;  3BR0 A;  3CJT B;  3PUF A;  3IWZ A;  3J80 K;  2ZSH B;  3ZQI A;  2P5V A;  1ULY A;  4S0H B;  4HV5 A;  1X19 A;  2DTR A;  3FHN A;  2IPQ X;  1DU0 A;  1K6Y A;  2K7L A;  2PBI A;  1SFO J;  1D0Y A;  3C18 A;  4YII A;  4BDY A;  2DI3 A;  4HYE A;  2DOA A;  4XKW A;  1USS A;  3PIO F;  2GOM A;  3A4C A;  2R7S A;  2K4J A;  3FBN B;  2BGC A;  2DT7 B;  2R7O A;  2DMP A;  2O5R A;  3H9G A;  3S1N J;  1SAX A;  1A5J A;  2R7V A;  1TQI A;  3DU6 A;  3CC4 I;  2GA2 A;  3VOE A;  2EFN A;  3W2A A;  1BIB A;  5M5Y J;  4LMY A;  3RKW A;  3DF8 A;  2Y48 A;  2V4J C;  3E7L A;  5L3C A;  3A1Y A;  4BNC A;  2DQL A;  1MMD A;  3EDP A;  2JRT A;  5ICF A;  1LB2 A;  2O0Y A;  5KNL A;  3ABU A;  5JVT A;  2DDA A;  3TL4 X;  3TQN A;  1IRZ A;  2BVM A;  4IO9 F;  3F8F A;  2WAE A;  1SMT A;  5DCM A;  3MKY B;  1ZKG A;  2A3S A;  2BHZ A;  2HOE A;  3A02 A;  3PNY A;  2VUM J;  4ZDL A;  2RQQ A;  1X1B A;  2VJI A;  3PUB A;  4CHU A;  2LF7 A;  3ABT A;  4HRI A;  2VXZ A;  5HLG A;  4WXD A;  2LDU A;  2NAZ A;  2F5D A;  3JAM K;  3TO7 A;  4F3Q A;  4FE4 A;  1EKE A;  2ZO4 A;  1E3H A;  3DPL C;  2V9V A;  1P2F A;  4JBA A;  1OCP A;  2QCO A;  2R5Z A;  4LIT A;  2VXD A;  3OYE A;  2DA5 A;  4D1Q A;  5CKT A;  5HLH A;  1WJB A;  3OMY A;  3H3U A;  4AU7 A;  1HW1 A;  3TO9 A;  4OWR B;  2EIK H;  2XGC A;  2V26 A;  2IBD A;  2E1M C;  3KE2 A;  3VOD A;  4A6E A;  5DTD A;  3GF2 A;  3CCS I;  2VBX A;  5HOO A;  3O8H A;  2PMZ N;  2GBY A;  2XGX A;  3E3V A;  5D5W B;  2RC4 A;  4MTE A;  1MBJ A;  1QRY A;  1ZTR A;  2R5Z B;  2VB6 A;  1UMQ A;  5ED4 A;  1XCV A;  4I6Z A;  1WI9 A;  1OCC H;  1U8B A;  4BXF A;  2F5C A;  2P6S A;  1FSE A;  3CF2 A;  4QSH A;  2E2I J;  1P4X A;  1EH7 A;  4E7S A;  2P7V B;  4IHW A;  4IOA F;  4PUS A;  3AFH A;  2PN6 A;  1X58 A;  4HW0 A;  1LDD A;  1PYV A;  3PIP F;  2K02 A;  5FLV A;  3TW7 A;  3OR1 C;  3S1Q J;  1T08 B;  2KZG A;  2CUF A;  3ZMZ A;  1XGS A;  1MSF C;  2R93 J;  3I53 A;  4XN0 A;  2CW7 A;  4OIQ F;  3WU2 C;  3IKV A;  2DA4 A;  1HOM A;  1W5C C;  2E7W A;  2FBK A;  5K7F A;  2W7N A;  3LSM A;  5KHD A;  2EV6 A;  4RBO A;  5IT9 K;  2JZY A;  4RAG A;  1CQT A;  4ESF A;  5K7H A;  1E17 A;  3GTP J;  4P55 A;  4XM3 A;  1HA8 A;  3KYD B;  4CCL A;  3DTI A;  3PO3 J;  2LY9 A;  1ZG3 A;  1Q1V A;  3U21 A;  4HDV A;  1Z3X A;  3W6J B;  1QVT A;  2DQR A;  4IHS A;  2VE8 A;  3SHF A;  2M0C A;  4PFO A;  5BS6 A;  5AIQ A;  1A35 A;  4FX4 A;  1BC8 C;  2H8R A;  3EUH C;  4IL6 C;  1RI7 A;  4WWC A;  1TNT A;  5F27 A;  1ZK8 A;  3ZQ7 A;  1HXD A;  4KJZ A;  2X6X A;  2EFQ A;  5KK1 A;  1TWC J;  3VWB A;  4BAC A;  1ZG5 A;  3I55 I;  1D8K A;  4PCQ A;  5FFX A;  1MMA A;  4IKF A;  2CUJ A;  1UHW A;  3CP8 A;  2XAJ A;  5IY5 H;  3IL2 A;  1MBG A;  1ZYR F;  3K70 C;  4RAZ A;  2IAI A;  4DYC A;  3FKI J;  5TRD A;  3FMQ A;  2JN6 A;  5BPI A;  1VFC A;  1QNT A;  4Y7N J;  2L54 A;  1RR7 A;  2KRF A;  2CQX A;  1R4M B;  2LD5 A;  4BJT A;  4ASN A;  2DOF A;  4WK8 F;  3K4C A;  3GFJ A;  2YUS A;  3P9C A;  3K2Z A;  4RGS A;  3MZH A;  3FK6 A;  1MSE C;  2MBF A;  3N4M A;  4M3F A;  2ID3 A;  2M3A A;  2IGM A;  5HOD A;  4IHX A;  4CDG A;  5GAH J;  5JFR A;  1YOV B;  4WCG A;  3CCR I;  3A0H C;  2KIF A;  5CLS A;  3FHZ A;  1MJA A;  2FBH A;  2ZB9 A;  5ICC A;  3HTU A;  2HKX A;  2KL4 A;  3HPG A;  2EFW A;  4YEJ A;  1HW5 A;  1PDN C;  3BG6 A;  1O7L A;  2K9M A;  5FKL A;  4BE2 A;  2EZL A;  3V8L A;  3CDH A;  2KDZ A;  1N78 A;  1Z3Y A;  1MW7 A;  2E2J J;  3WTV C;  4MQ9 F;  2ZJ2 A;  3W6K B;  1LPQ A;  3HPH A;  1P4W A;  1YX5 A;  1X1C A;  1OCR H;  4HDU A;  4RMN A;  2PFB A;  1YJ9 I;  1JKR C;  2EV0 A;  2JK3 A;  1S7E A;  1FX7 A;  3KZI C;  2M0M A;  3SZG A;  3V8J A;  2QQB A;  4Y4R A;  2N8G A;  4BUP A;  3U2R A;  3HXL A;  4HV6 A;  4XBF A;  1ZH5 A;  1RC9 A;  3NAU A;  3DEE A;  4LFU A;  4G6D A;  2R5Y B;  2DJN A;  1JHF A;  4RDU A;  2QYO A;  3OL4 A;  2WAQ A;  3K4J A;  5F0H A;  3HRM A;  1UAA A;  1Y0N A;  1I6H J;  1T39 A;  2V6E A;  1S3J A;  3DLL F;  3RKX A;  2IGO A;  5J4Y A;  5EEA A;  1W5S A;  2K4B A;  2PEX A;  2WTE A;  3DU5 A;  4O3M A;  3CUQ C;  2HTJ A;  1BOA A;  2BXZ A;  3LWF A;  4A5N A;  1YQA A;  4XIC A;  2WWY A;  3HZJ A;  4HX4 A;  2XB0 X;  4KFC A;  4UUS B;  1VQ7 I;  4BY7 J;  2M7B A;  2DK8 A;  4AIJ A;  1KQ0 A;  1XC5 A;  2LG4 A;  3NAR A;  2GXG A;  3H5N A;  5H20 A;  1R5G A;  4FQG A;  1J75 A;  1R1V A;  4GCV A;  5JVG F;  4I0A A;  4D5C A;  3DP7 A;  2OTJ I;  4HG2 A;  3GBG A;  1B4A A;  4XRS G;  2GOX B;  2HQ5 A;  2IP2 A;  3WTT C;  1BOB A;  2QF7 A;  3JW4 A;  4BQQ A;  2LP0 A;  4I98 B;  5IYB J;  4D7M A;  4G7H F;  4ZDO A;  1Y1W J;  1JKO C;  2IS1 A;  2VQL A;  3OYC A;  1Y8R B;  1KA8 A;  1VI0 A;  1WPK A;  1G8X A;  3U1K A;  1VQ6 I;  1I1G A;  1WHU A;  5E3O A;  4HZF A;  1K61 A;  1FJL A;  5LLQ A;  2AO9 A;  1VQN I;  4L5I A;  1S9H A;  4CIC A;  4B09 A;  2I5U A;  3HSE A;  4XLC A;  3MZY A;  2CO5 A;  5J3L A;  2R7R A;  2XV4 S;  3MMY B;  2M7A A;  1XGN A;  2KFD A;  4IPA A;  1LJ9 A;  1APL C;  2CH0 A;  3QP6 A;  3LST A;  4ZZL A;  3DKW A;  2LOO A;  2MC4 A;  2FOK A;  1FOY A;  2VPR A;  4GYG A;  3OS2 A;  4L9V A;  1I50 J;  1S7A A;  2ZKZ A;  4B1R A;  1W1W E;  2Z99 A;  2BXY A;  1N25 A;  2E1M B;  2VAS A;  1XSD A;  5CVV A;  3TP0 A;  3FXU A;  1OIS A;  1GV2 A;  3DKX A;  3W2W A;  2HYG D;  2RAE A;  4M3G A;  1YYV A;  2HNH A;  1ZR4 A;  1AWC A;  4RB2 C;  3L09 A;  3FIS A;  4CCM A;  5E20 A;  4CYD A;  3I4N J;  2JUC A;  5EZH A;  2ME6 A;  2X4H A;  5D5X B;  1XPX A;  2KT0 A;  2L2O A;  2NYX A;  3BDD A;  1VQ8 I;  3LNQ A;  3HEF A;  3SXY A;  2VKV A;  5GPA A;  1TWF J;  5E1W A;  4MTD A;  1OCT C;  4YFK F;  4BY1 J;  2X1C A;  4M3B A;  1WVR A;  2MG4 A;  3HGY A;  4JQF A;  3TMO A;  4IQ4 A;  3G2B A;  2VKE A;  4GXO A;  3P9I A;  1LDK B;  1LDJ A;  4HX7 A;  5FKK A;  5B1A H;  1LVA A;  1K78 B;  2QGU A;  4XLE A;  2VPL A;  4G6T B;  4KIS A;  4ZYG A;  2FBI A;  1X3U A;  4DBQ A;  5DEQ A;  1B72 A;  5D8K B;  5EEG A;  4XSZ F;  4S05 A;  5LRR A;  4L9J A;  1F43 A;  4YFN F;  5HVQ C;  4CH7 A;  5IP6 A;  4MEY F;  4KIB A;  3CO7 C;  1TTY A;  2QQ8 A;  4G9Y A;  5JHF A;  2VJJ A;  1XMK A;  4G7O F;  3M3Y J;  1MDM B;  5EEH A;  1B72 B;  1X2N A;  2NS8 A;  2JWT A;  2DXI A;  3SQN A;  2D1V A;  3DLA A;  2BW3 A;  3MKW B;  3OS0 A;  2D45 A;  2EIN H;  2W82 A;  3SFZ A;  3LSI A;  1LFB A;  1V5E A;  4C30 A;  3HL2 A;  5LHH A;  3DQV C;  4XLF A;  3WTS C;  3RTR A;  5LD2 C;  2A68 F;  4NQW B;  3OYL A;  4UUT A;  2B63 J;  2H1L A;  1JKP C;  4Z6Y A;  3HBL A;  2NXN B;  2WAD A;  3F72 A;  2MLG A;  2V1D A;  3OR2 C;  3C2B A;  5IP9 J;  2JA8 J;  4UVC A;  3WHB A;  2ZFU A;  4V2F A;  4UVB A;  1WH7 A;  4BJ5 C;  1QVU A;  1I39 A;  1FZP B;  2MH9 A;  4L0Z B;  2OUM A;  4Y33 A;  2HQR A;  4J00 A;  1QBJ A;  5CPR B;  4A69 C;  2E36 A;  3ZGK A;  1U2W A;  4NC7 A;  3VSL A;  3CME I;  3M8J A;  1BR1 A;  3E5Q A;  1FMW A;  1D5Y A;  1JUS A;  3F22 A;  3S3M A;  1RKT A;  2UUZ A;  4CUG A;  1QHG A;  3GTQ J;  2A61 A;  1BM9 A;  2ID6 A;  1TQP A;  4F92 B;  3WG9 A;  3C3W A;  1R58 A;  1A36 A;  3HKZ A;  2NVQ J;  3CCV I;  3H5R A;  1CF7 B;  2COB A;  1IXC A;  4HF0 A;  1B9M A;  3LSJ A;  3QPL A;  2B9S A;  3PSF A;  1REP C;  4KIT B;  3PM1 A;  2L4M A;  4WXC A;  2M8G X;  4FIS A;  2QQ9 A;  2PJR A;  4E7K A;  4EMS A;  1DUX C;  4DYQ A;  3S8P A;  4PK4 A;  1BA5 A;  2MAB A;  4AIH A;  1LFP A;  2PQ8 A;  2R7T A;  3OYB A;  1YW7 A;  2JVG A;  2CUE A;  3LSG A;  1W7P A;  3KEO A;  1D1C A;  3QPS A;  3ZP5 A;  1FWZ A;  3RYR A;  1FC3 A;  2DW4 A;  3ELK A;  4FET A;  3KPH A;  4G12 A;  3F23 A;  4BE0 A;  2DFF A;  1G4D A;  1WGX A;  3GME A;  2MW8 A;  3Q0U A;  2A5Y B;  5K5Q A;  1E0E A;  4PZJ A;  3DPU A;  2STT A;  2V1N A;  2HEO A;  4Y13 A;  2VBY A;  3MKL A;  5CVU A;  3AG1 H;  2L9R A;  3PSI A;  3R61 A;  4EGZ A;  1HLV A;  5F6F A;  4A3L J;  2VJ5 A;  2WA0 A;  2BOL A;  1FTZ A;  1P6R A;  1R22 A;  2IS4 A;  4DQ2 A;  3HDD A;  1QHH D;  1TP4 A;  3PJR A;  4BE1 A;  1D8J A;  4XON A;  3KP6 A;  4D5F A;  2FRH A;  4OIO F;  5K5R A;  1Z7U A;  3J7A O;  2IA0 A;  4JX6 A;  1RUN A;  5F0C A;  2BY0 A;  4ZC3 A;  3WTZ A;  5E17 F;  2ETH A;  4OMZ A;  5E8G A;  3JRH A;  4XKV A;  4HF2 A;  3PNT A;  3ROU A;  3R0A A;  1FMV A;  2VQG A;  2DO7 A;  1MGT A;  4Q4Z F;  5ILV A;  3CC7 I;  4E4H A;  1FBU A;  4H4K C;  2Y9Z A;  2L4A A;  1WH5 A;  4PJL A;  4RLQ A;  3CMY A;  1A04 A;  2D1H A;  2KQR A;  2QBY B;  1D1A A;  3ERM A;  2FSW A;  2FX0 A;  2XUB A;  1IXR C;  1T0F C;  2LBF B;  2DTZ A;  1BJZ A;  2Y69 H;  2LKS A;  4LB5 A;  4I7H A;  2K40 A;  4I09 A;  4R8H A;  2Q8K A;  2ESH A;  2VOD A;  2F5E A;  3AKZ A;  5H2F C;  2KJC A;  3ABL H;  2QBY A;  1EH6 A;  1TT0 A;  3EYI A;  3I71 A;  3R60 A;  1DPU A;  3OL3 A;  1IG7 A;  1JXS A;  1UB9 A;  1IC8 A;  4MFE A;  2Q2E B;  3E6C C;  3I59 B;  3OYH A;  4FAS D;  3GZ6 A;  1KYW A;  2I10 A;  1ZLJ A;  3TDZ C;  1SVM A;  1TWH J;  2TCT A;  2LVS A;  1TWG J;  5EGO B;  3FDY A;  5L3G A;  3HSR A;  2ZC2 A;  1TLH B;  5FLX K;  2WV0 A;  1MBE A;  4UY8 I;  1LKX A;  5HLI A;  2FU4 A;  5L3D A;  3HOV J;  1UFM A;  1Y0U A;  2DT5 A;  3FK7 A;  1BW5 A;  4BBR J;  1EV7 A;  2Q0O A;  2O8K A;  2EBI A;  2Z16 A;  3D1N I;  5EGO A;  3GTK J;  3MQ0 A;  3ONQ A;  1FBS A;  2XB5 A;  2OZU A;  2FD5 A;  2A69 F;  2M87 A;  3C2H A;  3KP3 A;  1HKS A;  1ZGJ A;  1ETW A;  3P9K A;  4QWQ A;  3U1D A;  3S3O A;  1QA6 A;  1EJ9 A;  4AID A;  2Y0M A;  3IWF A;  3OIP A;  3BCB A;  3W3C A;  4LD5 A;  5DDG A;  4U0Y A;  3JR9 A;  3G1O A;  4EEF G;  1XCB A;  3MKZ A;  5KVR A;  2V9K A;  4BEH A;  1U9O A;  4A3E J;  2ZBK A;  3QPT A;  1TQM A;  2W1O A;  4EGY A;  4PJN A;  2LKX A;  3JTG A;  2VC1 A;  2E71 A;  3ZMT A;  4AYB A;  5BPD A;  4LLL A;  1ENH A;  2CW0 F;  4PSX A;  4L0Y B;  1MMG A;  2W4S A;  2VOO A;  4LJZ F;  2ME0 A;  1UG2 A;  4ANJ A;  2BV6 A;  1ZLK A;  1IAW A;  2XC7 A;  3WE3 A;  4RB3 C;  4P96 A;  2DDB A;  2RKH A;  1KU7 A;  5LHG A;  4CYC A;  5C4X J;  1HST A;  4GFB A;  2I8D A;  1FPQ A;  3RPU A;  5IT9 Z;  3CCE I;  4A6D A;  3H0D A;  2R7X A;  1POG A;  3BG9 A;  3AG4 H;  2OU2 A;  5JLW A;  2HPI A;  4KN4 X;  1BI0 A;  1UST A;  3G3Z A;  2Z5U A;  3RKY A;  1BL0 A;  1X1A A;  4KA4 A;  3HHH A;  1KON A;  2DLL A;  2Y0S N;  1YRN A;  3CMA I;  3QQA A;  1F36 A;  4B3X A;  3B6A A;  5FO5 A;  1AHD P;  4A3D J;  4BQO A;  2EPF A;  4XLA A;  2JPC A;  5F08 A;  2DAO A;  2V7F A;  2XGD A;  3I58 A;  1Z1D A;  3PFY A;  1GHC A;  3T0Y A;  2HVS A;  1TL8 A;  1S7O A;  2ZFW A;  1F4K A;  2QUF A;  1T56 A;  2XF7 A;  4BGD A;  2H1K A;  5GP9 A;  1MJB A;  1MH4 A;  1BW6 A;  1PJR A;  1VTN C;  2EWN A;  2ELJ A;  1Z67 A;  1PUF B;  2JA2 A;  2ZME C;  3FIW A;  2HPM A;  1JT6 A;  3CJR B;  3FXR A;  3K6G A;  3CDL A;  1DP3 A;  3BZC A;  3RZD J;  1D0X A;  1D1B A;  1UZC A;  1NG7 A;  1KU2 A;  2L7M P;  4N9I A;  1T38 A;  4NNJ A;  4XOP A;  2UWM A;  2K9L A;  1HDD C;  5EZG A;  3FXL A;  4LOC A;  2QQA A;  4KIF A;  3LA3 A;  1PUF A;  1LUJ B;  2H8W A;  4OU0 A;  1LVK A;  5JLX A;  2F5V A;  3S16 J;  5IYC J;  2XAS A;  1J59 A;  2DT6 A;  2HQN A;  5HS7 A;  4ESJ A;  2GWR A;  2GA1 A;  1FTT A;  4C9Y A;  3F21 A;  3K4N A;  5E79 C;  4Q47 A;  3N05 A;  2OPT A;  3I4P A;  3G1M A;  3KLO A;  3JRF A;  3C2G A;  2XPU A;  4RLF A;  4UVA A;  2CV0 A;  2DPU A;  1ZAR A;  2G7U A;  4EAT A;  3IKT A;  1AOY A;  2R7F A;  2HTS A;  3IC7 A;  1CGP A;  4W1U A;  3HC7 A;  3W2V A;  2X9D A;  3HOY J;  3SEZ A;  1ETY A;  2IJL A;  1YHQ I;  1XMX A;  1XDS A;  3ZQH A;  2CGP A;  1BR4 A;  1HQC A;  3FXJ A;  4NC8 A;  1VQP I;  3S2D J;  2FUG 2;  4AD9 A;  2O7O A;  3K2A A;  1DGR M;  3S93 A;  2DMU A;  3CQZ J;  2L9V A;  2LBF A;  5TJJ A;  3GTL J;  2X48 A;  1V3F A;  2DA6 A;  3P7N A;  1ITY A;  2W57 A;  1XGO A;  1I27 A;  5CQG A;  2HDD A;  1GXQ A;  4BXU A;  1U78 A;  2IT0 A;  1JJ8 C;  3I9V 2;  3M8F A;  2EQR A;  3IP4 B;  3VYU B;  1L3L A;  2FOW A;  2NNN A;  4LLN A;  1RES A;  4L5J A;  2QKL B;  1R9T J;  1DGW Y;  2M30 A;  4IF4 A;  2XRN A;  2C6Y A;  2Q2E A;  3IH3 A;  1U6G A;  1UCR A;  4AC0 A;  3K4B A;  4AVZ A;  5HNH A;  1VQ5 I;  1ETO A;  3BJ6 A;  3ZMS A;  1AA7 A;  3ULQ B;  1RNL A;  1WJ5 A;  3JSP A;  2UZK A;  2AQE A;  5DD4 A;  4KNY A;  4G6Q A;  4M74 A;  3QOP A;  5F1J A;  4JX5 A;  4ZYH A;  3JRB A;  2GAU A;  5A2Q Z;  2DA2 A;  1F5T A;  3Q9V A;  4AYB N;  3H92 A;  1H9G A;  2A6H F;  3ASO H;  3QU3 A;  1MKM A;  1VZ0 A;  1LFU P;  1QPI A;  3DBR B;  3BR3 A;  1SFX A;  5F1R A;  5LGT A;  4E7I A;  3HOZ J;  2Y2Z A;  4M3D A;  2E34 A;  2VIX A;  2YX4 A;  1TC3 C;  1R6R A;  1WKM A;  2Y31 A;  4WF2 A;  3DV8 A;  4N9H A;  2QEX I;  2LY1 A;  3GZ5 A;  3UR3 C;  1NTC A;  4RGX A;  4XSX F;  3FX3 A;  4KUM A;  5FB2 A;  2IS6 A;  4QTR A;  3CUQ B;  2CUZ A;  2RVC A;  3Q3S A;  2XAG A;  2FML A;  1S8N A;  2VI6 A;  4P1W A;  1I1S A;  1YJW I;  4U0V A;  2O6G E;  6PAX A;  4NBQ A;  1K79 A;  1X2M A;  3E6D A;  2O3F A;  4U7B A;  5DM6 F;  1OYW A;  1B8I B;  3E6B A;  1EA3 A;  1R23 A;  3FZV A;  3H9Q A;  2K3F A;  3OIQ A;  1P7I A;  2M1B A;  4Y17 A;  1XTA A;  1WZ2 A;  3RZO J;  1OLT A;  1WFX A;  3NQO A;  3O2P E;  2M4K A;  1WI3 A;  3MN2 A;  3QPH A;  2Z2S B;  4L9N A;  3ZXS A;  3VDX A;  4QPO A;  2HKO A;  3HOX J;  2VT3 A;  1Y6I A;  2FA5 A;  4LG3 A;  4DNC A;  4CCK A;  5DD8 A;  1DDN A;  3AG2 H;  5B5E C;  1PP8 F;  4A3G J;  3TBI A;  4MQV A;  9ANT A;  1MMN A;  2D5V A;  1U5T B;  1YRN B;  3DEU A;  3S1R J;  3DTE A;  3KX2 A;  3RDI A;  2XAF A;  4UXN A;  1G6N A;  2E5Z A;  4Y3O A;  4FT8 A;  4LGW A;  4XK4 A;  4EVI A;  2JQ7 A;  1U5T C;  4BH9 A;  4NHJ A;  4XMY A;  5F0F A;  4F91 B;  1GVJ A;  2VLA A;  3ABK H;  4B47 A;  4XRS A;  4ZDP A;  2PMZ A;  1GUU A;  4IRG A;  3SJM A;  2PMH A;  4F93 B;  1KU9 A;  3EYY A;  3GYH X;  3K69 A;  4KDP A;  3JRD A;  4XOT A;  1WSU A;  3LFK A;  1JE8 A;  3F8M A;  1H0M A;  3QU6 A;  3HTS B;  4XRM A;  1G3T A;  1IV8 A;  4BBS J;  5HLT A;  3JRA A;  4OAZ A;  1S29 A;  3CUO A;  3SZT A;  2R92 J;  2QA4 I;  2MYS A;  3EPZ A;  2FNP A;  3H3V K;  2KKO A;  3CJQ B;  3ZMV A;  5FRO A;  1OPC A;  1P7J A;  4N4N B;  3S1M J;  2ZCW A;  4IHY A;  1TWA J;  4B8X A;  2ZXI A;  4BHC A;  2DMN A;  2RNJ A;  3M8E A;  1SD4 A;  2DA1 A;  2HZT A;  3ASN H;  5LEJ A;  3QAH A;  4P9F A;  5CJ9 A;  4KN7 X;  4KIC A;  5H6Q A;  3GLL A;  3GLX A;  2M9H A;  3HUG B;  4JOM A;  1Z9C A;  1Y39 A;  2ZNY A;  1DPR A;  3IUO A;  4HA8 A;  4OAY A;  4CO8 A;  2ELK A;  5AON A;  2BZT A;  5D4R A;  1G59 A;  2JPB A;  5DS9 A;  4C3H J;  1SMY F;  3L1P A;  3VPR A;  3G71 I;  4IZZ A;  3BTL A;  2PI0 A;  4OOI A;  4C3J J;  4NUB A;  4E6K G;  2A07 F;  4KMU X;  3RQI A;  2CFO A;  3BY6 A;  3S2W A;  1NG6 A;  2FXA A;  3K4M A;  3L2U A;  2CQN A;  4RS8 A;  3CCM I;  4BKX A;  1SFE A;  2H27 A;  3ERE D;  4ZTF A;  2HU9 A;  1QU3 A;  1H8A C;  1QO0 D;  5L3B A;  1OYI A;  3CLQ A;  3KFW X;  4E7H A;  4M72 A;  4RAY A;  3IAM 2;  2BE5 F;  2VQH A;  3E6M A;  3ZQF A;  1J7K A;  2HXO A;  3T1B A;  3LA2 A;  3BTJ A;  1ZRF A;  4PSW A;  2LNB A;  5BMZ A;  3CD6 I;  2IEK A;  1IN4 A;  2ECC A;  2IVM A;  2VJ4 A;  1T95 A;  5CYV A;  2XF6 A;  2IA2 A;  4UB6 C;  5HS8 A;  1Y56 A;  5LHI A;  4EM0 B;  1RRJ A;  2YR2 A;  3WGH A;  2KZV A;  2VL8 A;  3V7S A;  4AIK A;  1ACI A;  4BHB A;  1WJD A;  2F4O B;  1R71 A;  3EQL F;  1I6X A;  2HOS A;  3U9G A;  1FT9 A;  3J81 K;  3L7W A;  1XGM A;  1JUP A;  1N75 A;  4DOZ A;  1O3T A;  3SZP A;  4B4C A;  3TED A;  5FJ8 J;  1OJL A;  1RET A;  2E1C A;  4L18 B;  1G3W A;  4M6Y A;  1SEU A;  2X85 A;  4TV7 A;  2OCC H;  4CGZ A;  1E3O C;  3ZOB A;  2EIL H;  1HF0 A;  2A6T A;  4HX8 A;  2DFE A;  1KGS A;  5J1R A;  3ZMU A;  1C0W A;  2BEO A;  3BTC A;  5IOZ A;  1WCM J;  1V4R A;  2CW8 A;  2P6T A;  4ZYA A;  4BAY A;  5LBQ A;  2ZJR F;  2XPW A;  1TBX A;  2V1X A;  5KCM A;  3RSN A;  3LL7 A;  4DIQ A;  2DMT A;  3ZCO A;  1YO5 C;  4FX0 A;  1W7P D;  2KIS A;  3FMR A;  2JA6 J;  4ITV A;  2VON A;  1ODD A;  4EJW A;  4A0Z A;  2ZXH A;  4M9Z A;  3K1M A;  3OV8 A;  4A3B J;  3OYG A;  2DU9 A;  2Z3Y A;  3K1N A;  3QOD A;  3JRC A;  1GV5 A;  2X1D A;  3M1E A;  3HJE A;  1T33 A;  2GLO A;  4CCJ A;  4JP0 A;  2MD5 A;  5DYM A;  3WE2 A;  5ILS A;  3COA C;  4A3C J;  3F8C A;  3F6V A;  3JAM Z;  5GAD J;  2AXT C;  3BJA A;  3RCO A;  3WG7 H;  5E3M A;  3OYD A;  3ECO A;  2NS0 A;  5BOX A;  4GDF A;  3OWT A;  2E19 A;  3SYT A;  2W00 A;  1U5T A;  2LFB A;  3BG5 A;  3L2R A;  4E7L A;  3S14 J;  3LSK A;  3V4G A;  1OR7 C;  3MCZ A;  1LE8 B;  2PG4 A;  1ETQ A;  4NB5 A;  3REO A;  3TOB A;  3K4K A;  2RV8 A;  2XHK A;  2XDV A;  3CCY A;  3UNG C;  2P5L C;  4Q48 A;  1Z21 A;  3H3Z A;  5FRM A;  2MA3 A;  5IOY A;  4LK0 F;  4GRI A;  5CQE A;  3ABM H;  2IGN A;  2EV5 A;  2BY1 A;  2YPR A;  3D5R C;  3WU1 B;  2EFP A;  4HLY A;  1GDT A;  1IV6 A;  2KLO A;  1SAU A;  4IVN A;  3ZQG A;  2HYF A;  4MNU A;  4WX9 A;  3GTM J;  2ZME A;  4KT6 A;  1MBF A;  2BY2 A;  2QVO A;  5J47 A;  4AWX B;  2OBP A;  2ZSI B;  5F04 A;  4B43 A;  2CJJ A;  3GZN B;  1YIT I;  4HNV A;  2DK5 A;  5J1Y A;  1YS7 A;  3K9T A;  3E5X A;  4GGG A;  4FHT A;  1LEB A;  4NDL A;  1Q1H A;  3DBH B;  2AS5 F;  1TT5 B;  2CQ7 A;  2G0E A;  4QIW N;  4ESB A;  1YTY A;  5E18 F;  1EF4 A;  5K5O A;  2QKM B;  2EA4 A;  1FYL A;  4JX4 A;  2A05 A;  3ESW B;  3JSO A;  3HUG A;  5DUK A;  4A0X A;  3CTA A;  2LTP A;  1P4A A;  3PNV A;  4QLC U;  2E7X A;  2JT1 A;  4HOB A;  3CC2 I;  1K78 A;  2HYJ A;  4A3M J;  3V7C A;  4ZYD A;  2NOG A;  4C2T A;  4X0G A;  2L7K A;  3GTG J;  3QOE A;  1K6O A;  3O3K A;  1P92 A;  2R4G A;  1VF9 A;  1ONV A;  5HDG A;  5IPA A;  3JRG A;  3OSF A;  3M07 A;  1RR8 C;  3ZQC A;  2XIG A;  4BQA A;  3BP8 A;  3GUD A;  2E1O A;  2M2E A;  2H6B A;  4S04 A;  2DA7 A;  4IHT A;  1H88 C;  3LAP A;  3CF5 F;  3R0J A;  5D8L B;  3F8B A;  3J81 Z;  4CZC A;  2Y75 A;  3IH4 A;  3WTW C;  2L3D A;  5C3E J;  4LK1 F;  2FQ4 A;  2GXA A;  3IRQ A;  3BQZ A;  3TOA A;  3V42 A;  4A2U A;  1IF1 A;  5DUI A;  2R5Y A;  5E3L A;  1LQ1 A;  1IZ1 A;  3DKY A;  4D7N A;  3BRO A;  4L9T A;  1KU3 A;  4EJO A;  4O6J A;  2EB7 A;  5FGM A;  3S3N A;  1SFU A;  1ZRE A;  3ZMD A;  3EUH A;  1I3Q J;  2K9Q A;  4AUX A;  2X6Y A;  1ZEL A;  2LYC A;  3KYL A;  2CRG A;  2NS7 A;  1ZHF A;  5AIP A;  3TP3 A;  4IRH A;  3F8N A;  1UG0 A;  5DCM B;  2VE9 A;  4P5O A;  3FM3 A;  1X4P A;  3NWS A;  2FMY A;  2LC2 A;  2X0L A;  3FKJ A;  5LGU A;  3GEZ A;  3OS1 A;  4XKB A;  3B02 A;  3OSG A;  3S17 J;  3R4K A;  1XX5 A;  2G7H A;  4CCO A;  4IEJ A;  1O57 A;  3TKY A;  1LNW A;  2HWV A;  3WTX C;  4OIP F;  3C7J A;  4XID A;  2EA2 A;  3GW2 A;  3FMS A;  5EDN A;  3HOT A;  3BQY A;  2Q1Z B;  1WRJ A;  1D3Y A;  2EIM H;  3CCU I;  4IQJ A;  3L9F A;  3VB2 A;  2EZI A;  3GFL A;  4EM1 A;  3E0J B;  3R6S A;  2R0Q C;  3QYE A;  3E1S A;  5H6R A;  5LGN A;  2AXL A;  3ZPL A;  1CF7 A;  4XRF A;  3BLY A;  3A0B C;  2TRT A;  1B1B A;  4DZJ A;  2GM4 A;  1RUO A;  1BBY A;  1E2X A;  3BPV A;  1J2X A;  3DPT A;  1IN5 A;  4KIG A;  2LF8 A;  3KLN A;  2DA3 A;  3MEX A;  2ZNZ A;  1QGP A;  2JSP A;  3O8G A;  2WY7 Q;  4G94 A;  4GYI A;  4R79 A;  5DCF A;  4I2O A;  3QP5 A;  2G9W A;  5FRN A;  3LQQ A;  1IRF A;  2ECB A;  1UJ8 A;  3OYI A;  2V1U A;  3BR6 A;  3OOU A;  4U7D A;  2GIV A;  3GTJ J;  4LIU A;  2K27 A;  2VC0 A;  3EUA A;  2KJB A;  2OC6 A;  1Z91 A;  5JR3 A;  3K70 D;  1NK2 P;  5IYD J;  2X51 A;  2JSC A;  1NHA A;  2CWE A;  3I4M J;  1R5I D;  5ICG A;  1UEL B;  1R7J A;  3NRV A;  4BJ6 C;  2W84 A;  3BR2 A;  3T8R A;  4I01 A;  1YIJ I;  3G6E I;  4E70 A;  3HOU J;  1W36 C;  2R3S A;  2A5W A;  5GPC A;  1SD5 A;  2CQQ A;  3CP2 A;  4UNO A;  2HR3 A;  2RQP A;  4LLG F;  2FNA A;  5FFZ A;  5M5X J;  2QLZ A;  2OQG A;  4ENM A;  4YFX F;  1W0T A;  3VEP A;  1V54 H;  2DN0 A;  5HNF A;  2RNG A;  1VQ9 I;  1WQ2 A;  4CSW A;  3F9K A;  3CCL I;  2STW A;  4PDK A;  1IJW C;  2NVY J;  5E8I A;  2R7W A;  4HSR A;  2Y9Y A;  4A5M A;  2QZ8 A;  3TW6 A;  4FE7 A;  3W6V A;  3K1P A;  2ZME B;  1JT0 A;  1ZAO A;  3VSK A;  1VQK I;  2QSF X;  1MBH A;  3PQJ A;  2DOD A;  2YS9 A;  4E7Z A;  4PJJ A;  2UXX A;  2DCE A;  3Q9S A;  2W48 A;  1FLI A;  2O03 A;  1BI3 A;  2A6E F;  2LLK A;  2JMW A;  2KMU A;  1K4S A;  1KYZ A;  1ZR2 A;  2KIM A;  3CO6 C;  2HDW A;  3B73 A;  4W97 A;  3N97 A;  3HHG A;  2IS2 A;  4UUV A;  3HRU A;  2CYY A;  1XS9 A;  2R7Z J;  3RIR A;  5IP7 J;  4BXX J;  2HGC A;  4UV8 A;  3Q5F A;  2H94 A;  1YX3 A;  4HNU A;  4DW6 A;  2XKP A;  1H89 C;  1MDM A;  2RGV A;  5EJC A;  1QZY A;  3HG9 A;  3ML6 A;  1OMI A;  3L2Q A;  3DWL E;  1MNM C;  5LEK A;  2BW3 B;  2EJR A;  1Z6T A;  1JI8 A;  3M1C A;  2FQ3 A;  4MFD A;  2CG4 A;  1SVL A;  2W85 A;  1G2H A;  4ZTJ A;  4V19 K;  2ISY A;  3HKZ N;  1O7F A;  4MEX F;  1ZG1 A;  1RKW A;  4BL0 B;  4F55 A;  1JHH A;  1HSJ A;  3OYA A;  4XLP F;  2XKO A;  4MO7 A;  4P9U A;  4BU2 A;  4PFP A;  2F48 A;  1GVD A;  3BPX A;  2BVL A;  3OYN A;  4JK1 X;  2EIJ H;  1QZE A;  4I0B A;  2MLK A;  4G7Z F;  3H1C A;  2OZ6 A;  3H9J A;  1P9Q C;  1MJ9 A;  3I0T A;  2EFO A;  1FYM A;  4XLN F;  3BG3 A;  3D0S A;  5EYR A;  3MVP A;  1U0J A;  2COM A;  3I5U A;  5JHU A;  2JA5 J;  2DFI A;  3RPU D;  1K4T A;  3ZRG A;  4B3A A;  2DMQ A;  2XF5 A;  5FD6 A;  4N4O B;  2L02 A;  1ERD A;  3ISP A;  4DGW B;  3RI4 A;  3GCM A;  2VKD A;  2DJI A;  1DQU A;  3S15 J;  1IN7 A;  2FE3 A;  3NEU A;  2PLY A;  1XSX A;  4DZP A; 
#chains in the Genus database with same CATH homology
 4EJU A;  1F9N A;  1R36 A;  5LRS A;  2ISZ A;  3MFK A;  1H9T A;  5K1Y A;  2CFX A;  1ZN2 A;  1SD7 A;  3HIF A;  4UHT A;  5CVR A;  5HDN A;  2GQQ A;  2E1N A;  1PP7 U;  2PJP A;  3CLO A;  2Z33 A;  4ENN A;  2O61 A;  1TNS A;  1ZGA A;  1B6A A;  1BIA A;  5JI6 A;  2B0L A;  4O5V A;  3K0L A;  1PUE E;  3KZY A;  2M45 A;  2XRO A;  1T0F A;  2F5F A;  1R1U A;  5D4S A;  4WXH A;  3J80 Z;  1G3S A;  2XVC A;  1KQ9 A;  2UXN A;  1XSV A;  2OD5 A;  2GZW A;  2W24 A;  1J9I A;  3O6B B;  2F2E A;  5CVI A;  4CXF A;  2XAH A;  5A2Q Z;  1XMA A;  3PFI A;  2VBW A;  4UV9 A;  1W7P B;  1IXS B;  5E1Z B;  3EET A;  4Y15 A;  2ELH A;  4MHG A;  2M8E A;  3QRF F;  2HFH A;  1HKT A;  2JTV A;  3FWE A;  4EJT A;  3CJN A;  3MAJ A;  1S6L A;  1YLF A;  4HQM A;  3KEQ A;  1ON2 A;  1BJA A;  1KQ8 A;  1ON1 A;  3OOP A;  4PGG A;  1XB4 A;  1EH8 A;  4F7Z A;  1B9N A;  4KYW A;  1OKR A;  3HRT A;  1IN8 A;  1R5H A;  1HW2 A;  3KCC A;  3KP7 A;  2RDP A;  2GXB A;  1WWX A;  1HKQ A;  1T2K A;  3AAF A;  2V79 A;  3D5L A;  4M71 A;  3I54 A;  1JGS A;  1YIO A;  5ILU A;  2CSO A;  1R1T A;  1YW9 A;  4KT5 C;  3KP2 A;  2IRF G;  1Z6R A;  1U8R A;  1BN5 A;  4IRI A;  3WOD F;  4OIN F;  4KMF A;  3RPQ A;  4H0E A;  4NQW A;  2BYV E;  1XD7 A;  1FNN A;  1FP1 D;  1XN7 A;  3G73 A;  1IUY A;  5D6E A;  1B59 A;  1BI1 A;  5CVJ A;  4LB6 B;  1XDU A;  1YG2 A;  1UHM A;  1QZZ A;  2IA1 A;  3TDU C;  5ERI A;  3ZN0 A;  2W25 A;  1FSH A;  2QWW A;  3WTU C;  4Z2Y A;  3LA7 A;  5ICE A;  1D5V A;  1FBQ A;  2OQR A;  3KZZ A;  3WU0 A;  3GWZ A;  1YFH A;  5HS9 A;  4MGR A;  3IRR A;  2J5P A;  2PMU A;  4N0B A;  2D2W A;  3GVA A;  3GXO A;  3FF5 A;  4HAM A;  2OAZ A;  2L01 A;  4GO1 A;  5D5U B;  3ECH A;  1STZ A;  2ACJ A;  3IHU A;  1RZ4 A;  1HBX G;  4RGR A;  3GX4 X;  4LG0 B;  2M5W A;  2LSO A;  1OR7 A;  5J8C A;  2OA4 A;  1O3R A;  4ZH4 F;  2RN7 A;  1TW3 A;  1FP2 A;  5IT3 A;  3M7G A;  2VOP A;  5FD5 A;  1DP7 P;  3KP4 A;  3T8T A;  1O3Q A;  4LG0 A;  4AVP A;  3KP5 A;  2BBY A;  1QQI A;  2P7C B;  3V7R A;  2DPD A;  2EK5 A;  4HBL A;  2R7D A;  4ENK A;  3JTH A;  2CQK A;  2LKP A;  5D6F A;  3WTY C;  4U0W A;  4D0P A;  4M6X A;  4YG2 F;  4G8X A;  4M9S A;  1FY7 A;  2XAQ A;  1ZRD A;  2VBZ A;  3HRS A;  1IW7 F;  2YSR A;  4EM2 A;  1I5Z A;  3KET A;  5BQT A;  4A12 A;  2WC2 A;  3E5U A;  1SD6 A;  4M73 A;  1MZB A;  1LEA A;  3BJO A;  4ETS A;  3WGG A;  2VN2 A;  2ADU A;  3HYI A;  2DBB A;  3I59 A;  3GFI A;  4ON0 A;  1K7A A;  1QPM A;  3E97 A;  3BOQ A;  4K2E A;  3GO5 A;  3DFG A;  3RJP A;  2YU3 A;  4CZZ A;  4Q5S F;  4ENJ A;  3L00 A;  5HDK A;  1ZRC A;  1BI2 A;  2ZXJ A;  4U88 A;  2QM3 A;  1FOK A;  4PGH A;  3CUQ A;  1W4M A;  1GXP A;  4HLX A;  2Z9O A;  3WGI A;  2K86 A;  3T5X A;  3L2C A;  5J6X A;  2TDX A;  1YW8 A;  2QEN A;  3TO6 A;  1IN6 A;  2VT2 A;  3LQR A;  4EV0 A;  1R00 A;  5A2Q K;  4A0Y A;  2HDC A;  4IJA A;  1FYK A;  5FLX Z;  2O8X A;  5F64 A;  4YIF A;  1BC7 C;  1G3Y A;  3FM5 A;  2V6C A;  5D5V B;  4EJV A;  5L3E A;  2HS5 A;  4R1H A;  2IW5 A;  5E1X A;  4ZYE A;  1F1Z A;  1J5Y A;  3C1D A;  2FF4 A;  4RB0 A;  2FEZ A;  2MH2 A;  4HQE A;  1J0R A;  2J5O A;  1W5T A;  3LAJ A;  2MC3 A;  3F6O A;  1MD0 A;  4HF1 A;  4OMY A;  3I64 A;  2YX7 A;  3ZN1 A;  3DXJ F;  3BZ6 A;  1RIO H;  1U3E M;  2KIU A;  4IXA A;  1T98 A;  2ESN A;  3PQK A;  2H09 A;  2NNY A;  3FXQ A;  5DV5 A;  4RB1 A;  3BWG A;  4BHP A;  3M9A A;  4RGU A;  3HSF A;  3VFZ A;  1L0O C;  4BYY A;  3GFM A;  1O3S A;  1Z05 A;  3HOS A;  4EQQ A;  3F3X A;  3V8K A;  3MWM A;  2P8T A;  1OYY A;  3RYP A;  2P5K A;  3TGN A;  2NRA C;  5L3F A;  1TW2 A;  4OIR F;  5J8F A;  1IRG A;  4M9X A;  1YS6 A;  2H6C A;  4ZZD A;  4I02 A;  1T6S A;  2P4W A;  3J80 K;  3IWZ A;  2P5V A;  1ULY A;  4HV5 A;  2DTR A;  2IPQ X;  2K7L A;  2PBI A;  3C18 A;  4YII A;  2DI3 A;  4HYE A;  1USS A;  2K4J A;  2BGC A;  1SAX A;  1TQI A;  2GA2 A;  3VOE A;  2EFN A;  1BIB A;  4LMY A;  3RKW A;  3DF8 A;  2Y48 A;  5L3C A;  4BNC A;  2DQL A;  3EDP A;  2JRT A;  5ICF A;  1LB2 A;  2O0Y A;  3ABU A;  5JVT A;  3TQN A;  3F8F A;  1SMT A;  5DCM A;  2A3S A;  2HOE A;  4CHU A;  2LF7 A;  3ABT A;  2VXZ A;  5HLG A;  4WXD A;  2LDU A;  2NAZ A;  2F5D A;  3JAM K;  3TO7 A;  2ZO4 A;  3DPL C;  2V9V A;  1P2F A;  4JBA A;  5HLH A;  3H3U A;  1HW1 A;  3TO9 A;  3KE2 A;  3VOD A;  4A6E A;  3GF2 A;  2VBX A;  5HOO A;  2XGX A;  3E3V A;  5D5W B;  2RC4 A;  4MTE A;  5ED4 A;  1XCV A;  1WI9 A;  2F5C A;  2P6S A;  1FSE A;  1P4X A;  1EH7 A;  2P7V B;  2PN6 A;  4HW0 A;  1LDD A;  2K02 A;  3ZMZ A;  1XGS A;  3I53 A;  4OIQ F;  3IKV A;  2E7W A;  2FBK A;  2EV6 A;  5IT9 K;  2JZY A;  4ESF A;  1E17 A;  4P55 A;  1ZG3 A;  4HDV A;  3W6J B;  2DQR A;  4IHS A;  2VE8 A;  3SHF A;  5BS6 A;  5AIQ A;  4FX4 A;  1BC8 C;  1RI7 A;  4WWC A;  1TNT A;  3ZQ7 A;  1HXD A;  2EFQ A;  5KK1 A;  1ZG5 A;  1D8K A;  4PCQ A;  5FFX A;  1UHW A;  2XAJ A;  3IL2 A;  1ZYR F;  4RAZ A;  5TRD A;  3FMQ A;  5BPI A;  1QNT A;  2L54 A;  2KRF A;  4ASN A;  4WK8 F;  3GFJ A;  3P9C A;  3K2Z A;  4RGS A;  3MZH A;  2MBF A;  3N4M A;  4CDG A;  5JFR A;  4WCG A;  2KIF A;  5CLS A;  3FHZ A;  1MJA A;  2FBH A;  5ICC A;  3HTU A;  2HKX A;  2EFW A;  1HW5 A;  1PDN C;  1O7L A;  3V8L A;  3CDH A;  3WTV C;  4MQ9 F;  2ZJ2 A;  3W6K B;  1P4W A;  4HDU A;  2PFB A;  2EV0 A;  1FX7 A;  3V8J A;  2QQB A;  3U2R A;  4HV6 A;  4XBF A;  1ZH5 A;  4LFU A;  4G6D A;  1JHF A;  2QYO A;  3HRM A;  1T39 A;  1S3J A;  3RKX A;  4O3M A;  1W5S A;  2K4B A;  2PEX A;  2WTE A;  3CUQ C;  2HTJ A;  1BOA A;  3LWF A;  4A5N A;  1YQA A;  2WWY A;  4HX4 A;  4KFC A;  2DK8 A;  4AIJ A;  1KQ0 A;  2GXG A;  5H20 A;  1R5G A;  1J75 A;  1R1V A;  4GCV A;  4I0A A;  3DP7 A;  1B4A A;  2IP2 A;  3WTT C;  3JW4 A;  4I98 B;  4G7H F;  1KA8 A;  1I1G A;  4HZF A;  5LLQ A;  4L5I A;  4CIC A;  4B09 A;  3HSE A;  3MZY A;  2CO5 A;  2XV4 S;  1XGN A;  4IPA A;  1LJ9 A;  3QP6 A;  3LST A;  4ZZL A;  3DKW A;  2FOK A;  4GYG A;  4L9V A;  1S7A A;  2ZKZ A;  2Z99 A;  1XSD A;  5CVV A;  3FXU A;  2HYG D;  1YYV A;  1AWC A;  4RB2 C;  3L09 A;  5E20 A;  4CYD A;  2X4H A;  5D5X B;  2NYX A;  3BDD A;  3SXY A;  5E1W A;  4MTD A;  4YFK F;  4JQF A;  4GXO A;  3P9I A;  1LDK B;  1LDJ A;  4HX7 A;  1LVA A;  1K78 B;  4ZYG A;  2FBI A;  1X3U A;  5DEQ A;  5D8K B;  5EEG A;  4XSZ F;  4S05 A;  5LRR A;  4L9J A;  4YFN F;  5HVQ C;  4MEY F;  4KIB A;  3CO7 C;  1TTY A;  4G9Y A;  1XMK A;  4G7O F;  1MDM B;  5EEH A;  3SQN A;  2D1V A;  2D45 A;  3SFZ A;  5LHH A;  3DQV C;  3WTS C;  3RTR A;  2A68 F;  3F72 A;  2MLG A;  2V1D A;  4UVC A;  4UVB A;  1FZP B;  2MH9 A;  4L0Z B;  2HQR A;  1QBJ A;  1U2W A;  3E5Q A;  3F22 A;  2A61 A;  1BM9 A;  1TQP A;  3WG9 A;  3C3W A;  1R58 A;  1CF7 B;  1IXC A;  4HF0 A;  1B9M A;  1REP C;  2L4M A;  4WXC A;  2QQ9 A;  4EMS A;  1DUX C;  4AIH A;  2PQ8 A;  1YW7 A;  1W7P A;  3KEO A;  3ZP5 A;  1FWZ A;  3RYR A;  1FC3 A;  2DW4 A;  3ELK A;  3F23 A;  1G4D A;  2A5Y B;  5K5Q A;  4PZJ A;  2STT A;  2HEO A;  4Y13 A;  2VBY A;  5CVU A;  3R61 A;  4EGZ A;  5F6F A;  1P6R A;  1R22 A;  4DQ2 A;  1D8J A;  3KP6 A;  2FRH A;  4OIO F;  5K5R A;  1Z7U A;  3J7A O;  2IA0 A;  1RUN A;  3WTZ A;  5E17 F;  2ETH A;  4OMZ A;  5E8G A;  4HF2 A;  3ROU A;  3R0A A;  2DO7 A;  1MGT A;  4Q4Z F;  5ILV A;  1FBU A;  2L4A A;  1A04 A;  2D1H A;  2QBY B;  2FSW A;  2XUB A;  1IXR C;  4LB5 A;  4I7H A;  4R8H A;  4I09 A;  2Q8K A;  2ESH A;  2VOD A;  2F5E A;  2KJC A;  2QBY A;  1EH6 A;  3EYI A;  3I71 A;  3R60 A;  1DPU A;  1JXS A;  1UB9 A;  3E6C C;  3I59 B;  3GZ6 A;  1KYW A;  1ZLJ A;  3TDZ C;  5L3G A;  3HSR A;  1TLH B;  5FLX K;  2WV0 A;  5HLI A;  2FU4 A;  5L3D A;  1UFM A;  1Y0U A;  2DT5 A;  1EV7 A;  2Q0O A;  3MQ0 A;  1FBS A;  2OZU A;  2A69 F;  2M87 A;  3KP3 A;  1HKS A;  1ZGJ A;  3P9K A;  4QWQ A;  3U1D A;  2Y0M A;  3IWF A;  5DDG A;  4LD5 A;  4U0Y A;  1XCB A;  5KVR A;  2ZBK A;  3QPT A;  1TQM A;  4EGY A;  3JTG A;  2VC1 A;  3ZMT A;  5BPD A;  4LLL A;  2CW0 F;  4L0Y B;  2VOO A;  4LJZ F;  2BV6 A;  1ZLK A;  1IAW A;  3WE3 A;  4RB3 C;  4P96 A;  1KU7 A;  2RKH A;  5LHG A;  1HST A;  3RPU A;  1FPQ A;  5IT9 Z;  4A6D A;  2OU2 A;  4KN4 X;  1BI0 A;  1UST A;  3G3Z A;  2Z5U A;  3RKY A;  4KA4 A;  3HHH A;  2DLL A;  5FO5 A;  2JPC A;  2DAO A;  3I58 A;  1Z1D A;  1GHC A;  3T0Y A;  1S7O A;  2ZFW A;  1F4K A;  2QUF A;  1MJB A;  1VTN C;  2EWN A;  3FXR A;  1KU2 A;  4N9I A;  1T38 A;  2UWM A;  2QQA A;  4KIF A;  3LA3 A;  4OU0 A;  2XAS A;  1J59 A;  2HQN A;  5HS7 A;  4ESJ A;  2GWR A;  2GA1 A;  3F21 A;  4Q47 A;  3I4P A;  3KLO A;  4UVA A;  2DPU A;  1ZAR A;  2G7U A;  3IKT A;  1AOY A;  2R7F A;  2HTS A;  3IC7 A;  1CGP A;  2IJL A;  1XDS A;  2CGP A;  1HQC A;  4AD9 A;  5TJJ A;  1V3F A;  3P7N A;  2W57 A;  1XGO A;  1I27 A;  1GXQ A;  4BXU A;  1U78 A;  2IT0 A;  3M8F A;  1L3L A;  4LLN A;  2NNN A;  4L5J A;  2M30 A;  4IF4 A;  2XRN A;  2C6Y A;  2Q2E A;  1U6G A;  1UCR A;  3BJ6 A;  3ZMS A;  3ULQ B;  1RNL A;  3JSP A;  2UZK A;  5DD4 A;  4KNY A;  4G6Q A;  4M74 A;  3QOP A;  4ZYH A;  2GAU A;  1F5T A;  3Q9V A;  3H92 A;  1H9G A;  2A6H F;  3QU3 A;  1MKM A;  5F1R A;  5LGT A;  1SFX A;  2YX4 A;  1WKM A;  4WF2 A;  3DV8 A;  4N9H A;  3GZ5 A;  4RGX A;  4XSX F;  3FX3 A;  4KUM A;  5FB2 A;  3CUQ B;  2RVC A;  2XAG A;  2FML A;  1S8N A;  1I1S A;  4U0V A;  2O6G E;  6PAX A;  1K79 A;  3E6D A;  2O3F A;  4U7B A;  1OYW A;  3E6B A;  3FZV A;  1R23 A;  2M1B A;  4Y17 A;  3NQO A;  3O2P E;  3QPH A;  4L9N A;  2HKO A;  2VT3 A;  4DNC A;  2FA5 A;  5DD8 A;  1DDN A;  1PP8 F;  4MQV A;  1U5T B;  3DEU A;  3RDI A;  2XAF A;  4UXN A;  1G6N A;  4FT8 A;  4LGW A;  4EVI A;  1U5T C;  4BH9 A;  4NHJ A;  1GVJ A;  4IRG A;  2PMH A;  1KU9 A;  3EYY A;  3GYH X;  3K69 A;  4KDP A;  1WSU A;  3LFK A;  1JE8 A;  3F8M A;  1H0M A;  3QU6 A;  3HTS B;  1G3T A;  1S29 A;  3CUO A;  3SZT A;  2FNP A;  2KKO A;  3ZMV A;  1OPC A;  2ZCW A;  4B8X A;  4BHC A;  2RNJ A;  3M8E A;  1SD4 A;  2HZT A;  5LEJ A;  3QAH A;  4P9F A;  5CJ9 A;  4KN7 X;  4KIC A;  5H6Q A;  3GLX A;  1Z9C A;  2ZNY A;  1DPR A;  4HA8 A;  4CO8 A;  5AON A;  5D4R A;  2JPB A;  1SMY F;  2PI0 A;  4OOI A;  2A07 F;  4KMU X;  3BY6 A;  3S2W A;  2FXA A;  4RS8 A;  1SFE A;  2H27 A;  3ERE D;  1QO0 D;  5L3B A;  1OYI A;  3KFW X;  4M72 A;  4RAY A;  2BE5 F;  3E6M A;  1J7K A;  3T1B A;  3LA2 A;  1ZRF A;  2LNB A;  5BMZ A;  1IN4 A;  2IVM A;  5CYV A;  2IA2 A;  5HS8 A;  5LHI A;  4EM0 B;  2YR2 A;  3WGH A;  3V7S A;  4AIK A;  4BHB A;  3EQL F;  1I6X A;  3U9G A;  1FT9 A;  3J81 K;  3L7W A;  1XGM A;  1O3T A;  3SZP A;  2E1C A;  4L18 B;  1G3W A;  4M6Y A;  4TV7 A;  4CGZ A;  4HX8 A;  1KGS A;  1C0W A;  3ZMU A;  2BEO A;  1V4R A;  4BAY A;  2P6T A;  5LBQ A;  1TBX A;  2V1X A;  1YO5 C;  4FX0 A;  1W7P D;  3FMR A;  2VON A;  1ODD A;  4EJW A;  4A0Z A;  4M9Z A;  3K1M A;  3OV8 A;  2DU9 A;  2Z3Y A;  3K1N A;  3M1E A;  2MD5 A;  5DYM A;  3WE2 A;  5ILS A;  3COA C;  3F8C A;  3F6V A;  3JAM Z;  3BJA A;  3ECO A;  2NS0 A;  5BOX A;  1U5T A;  3V4G A;  3MCZ A;  2PG4 A;  4NB5 A;  3REO A;  3TOB A;  2RV8 A;  2XHK A;  2P5L C;  4Q48 A;  3H3Z A;  2MA3 A;  4LK0 F;  2EV5 A;  2YPR A;  3WU1 B;  2EFP A;  4HLY A;  4IVN A;  2HYF A;  4MNU A;  4WX9 A;  2ZME A;  2QVO A;  4AWX B;  2OBP A;  2DK5 A;  1YS7 A;  3K9T A;  3E5X A;  4GGG A;  4FHT A;  1LEB A;  1Q1H A;  2AS5 F;  4ESB A;  1YTY A;  5E18 F;  5K5O A;  2EA4 A;  1FYL A;  3JSO A;  3HUG A;  5DUK A;  4A0X A;  3CTA A;  1P4A A;  4QLC U;  2E7X A;  2JT1 A;  4HOB A;  1K78 A;  3V7C A;  4ZYD A;  1K6O A;  3O3K A;  1P92 A;  1ONV A;  5HDG A;  2XIG A;  4BQA A;  3BP8 A;  3GUD A;  2H6B A;  4S04 A;  4IHT A;  3LAP A;  3R0J A;  5D8L B;  3F8B A;  3J81 Z;  2Y75 A;  3WTW C;  2L3D A;  4LK1 F;  3IRQ A;  3TOA A;  4A2U A;  1IF1 A;  5DUI A;  1LQ1 A;  1IZ1 A;  3BRO A;  4L9T A;  1KU3 A;  4EJO A;  4O6J A;  2EB7 A;  5FGM A;  1ZRE A;  1SFU A;  3ZMD A;  3EUH A;  1ZHF A;  5AIP A;  4IRH A;  3F8N A;  5DCM B;  2VE9 A;  4P5O A;  3FM3 A;  2FMY A;  2X0L A;  5LGU A;  3GEZ A;  3B02 A;  3R4K A;  2G7H A;  1O57 A;  3TKY A;  1LNW A;  2HWV A;  3WTX C;  4OIP F;  3C7J A;  2EA2 A;  3GW2 A;  3FMS A;  3HOT A;  1WRJ A;  1D3Y A;  3L9F A;  3VB2 A;  3GFL A;  4EM1 A;  3R6S A;  5H6R A;  5LGN A;  2AXL A;  3ZPL A;  1CF7 A;  4XRF A;  1B1B A;  1RUO A;  1BBY A;  1E2X A;  3BPV A;  1J2X A;  3DPT A;  1IN5 A;  4KIG A;  2LF8 A;  3KLN A;  3MEX A;  2ZNZ A;  1QGP A;  4G94 A;  4GYI A;  4R79 A;  5DCF A;  4I2O A;  3QP5 A;  2G9W A;  3LQQ A;  1IRF A;  2V1U A;  4U7D A;  2GIV A;  2K27 A;  2VC0 A;  2KJB A;  5JR3 A;  1Z91 A;  2JSC A;  1NHA A;  2CWE A;  5ICG A;  1R7J A;  3NRV A;  2W84 A;  3T8R A;  4I01 A;  4E70 A;  2R3S A;  1SD5 A;  4UNO A;  2HR3 A;  2RQP A;  4LLG F;  2FNA A;  5FFZ A;  2QLZ A;  2OQG A;  4ENM A;  4YFX F;  3VEP A;  1WQ2 A;  2STW A;  4PDK A;  5E8I A;  4A5M A;  2QZ8 A;  3K1P A;  2ZME B;  1ZAO A;  3PQJ A;  2UXX A;  3Q9S A;  1FLI A;  2O03 A;  1BI3 A;  2A6E F;  1KYZ A;  2KIM A;  3CO6 C;  3B73 A;  3N97 A;  3HHG A;  4UUV A;  3HRU A;  2CYY A;  3RIR A;  2HGC A;  4UV8 A;  3Q5F A;  2H94 A;  2XKP A;  1MDM A;  2RGV A;  1QZY A;  3ML6 A;  1OMI A;  5LEK A;  2EJR A;  1Z6T A;  2FQ3 A;  2CG4 A;  2W85 A;  2ISY A;  1O7F A;  4MEX F;  1ZG1 A;  1JHH A;  1HSJ A;  4XLP F;  2XKO A;  4P9U A;  3BPX A;  4JK1 X;  4I0B A;  2MLK A;  4G7Z F;  2OZ6 A;  3I0T A;  1MJ9 A;  2EFO A;  1FYM A;  4XLN F;  3D0S A;  2COM A;  3I5U A;  5JHU A;  2DFI A;  5FD6 A;  2L02 A;  3ISP A;  3RI4 A;  1IN7 A;  2FE3 A;  3NEU A;  2PLY A;  1XSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...