4RGUA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with ferulic acid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
141
Chain Sequence
REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLSTFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with ferulic acid
rcsb
source organism Acinetobacter sp. adp1
total genus 43
structure length 141
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rguA00
1RUOA 4PDKA 3KP3A 2JZYA 3K69A 4U7DA 1KQ8A 2XRNA 4I98B 1B9NA 1OPCA 3F6OA 3KEQA 2PN6A 2DW4A 3HSRA 1K78A 5A2QZ 1BIAA 5D5XB 2DU9A 4UVAA 2XVCA 1Z6RA 1OYIA 1R5HA 3EETA 4KIGA 2XKOA 3QPTA 5JR3A 4DQ2A 3I71A 1CF7B 1P2FA 3V8KA 1I1GA 3FMRA 2L4MA 2A69F 3HOTA 1KA8A 3WTWC 5F1RA 1T2KA 3FXQA 2HS5A 4G6DA 2PFBA 1PP7U 4ENKA 2HKXA 2W57A 2COMA 3BROA 5TJJA 5H6QA 1LDJA 2PJPA 2RNJA 2P5VA 1S29A 3JSPA 2JTVA 1FY7A 3NRVA 2XGXA 5D6FA 2JRTA 3DPLC 3F8FA 2DBBA 2MA3A 4OIRF 3V7CA 1U78A 3PFIA 3TDUC 1FWZA 4HBLA 1G6NA 1CF7A 4L9JA 5K5OA 3MZHA 3TO7A 1Z05A 3VFZA 4IHSA 2V6CA 4I09A 4N9HA 1PP8F 2GA2A 3OV8A 3KZZA 1R23A 3QU6A 5E20A 5L3EA 3F72A 1IXCA 2DT5A 3FMQA 3F6VA 5E8IA 4O6JA 2LDUA 2VT3A 2EFQA 2ZO4A 1IN8A 1GXPA 2XAFA 4HV6A 4MEYF 1I6XA 4R79A 2L01A 2EA4A 2F2EA 2KRFA 4L9NA 1F1ZA 3EQLF 2IPQX 3CDHA 2ZJ2A 2HYFA 4HZFA 5F6FA 1HKSA 1T0FA 2NAZA 2WC2A 2ISZA 1XN7A 3ZMVA 1PUEE 3M9AA 2EV5A 3K0LA 2XAGA 1PDNC 3BJAA 1XB4A 1JHFA 3DP7A 4L5JA 1LDDA 5ICGA 1EV7A 4LLNA 1E17A 2A61A 5L3GA 1LDKB 2Y0MA 5BQTA 1U6GA 1BM9A 3EYYA 3T8RA 1S7OA 4MTDA 1FX7A 1MJAA 3ZMDA 2IW5A 2YX4A 3TO9A 4EQQA 5LHIA 4AVPA 2L54A 3BY6A 1ON2A 4HF2A 2PBIA 4HF1A 3GO5A 3R0JA 4G94A 2FOKA 3JSOA 2QVOA 1IXRC 1VTNC 1MGTA 2C6YA 2F5EA 3GF2A 2J5PA 1YYVA 3CUQB 3ABTA 4CZZA 4EJOA 5LGNA 2VBYA 1ZAOA 3IKTA 5D5VB 3VOEA 4IF4A 2CSOA 1DP7P 3DPTA 1XCBA 3BP8A 3V8LA 3WGIA 5DCFA 5CVJA 4KT5C 2ETHA 4P96A 4U88A 1YG2A 5HDKA 4N9IA 4OIOF 3HOSA 2CG4A 2VE8A 4LK1F 5DD4A 2K4BA 2YSRA 1BI3A 5KK1A 2CFXA 2EFOA 2HZTA 5LBQA 5LHGA 1LEAA 4RS8A 2A68F 3FWEA 4BHBA 3CUQA 4ENJA 3ZQ7A 3RKXA 3KCCA 2FBHA 3TOAA 3ZP5A 1XDUA 3C18A 3I58A 5AIQA 4U0VA 3CUOA 3EYIA 4QWQA 3L2CA 1J9IA 2OQGA 1IXSB 3MFKA 3JTHA 1YIOA 1KU9A 5JVTA 2VXZA 5DUIA 5J6XA 3P7NA 1XD7A 3PQKA 5ED4A 1IW7F 4Q4ZF 4ESBA 3MWMA 5KVRA 2NRAC 1T6SA 3FXUA 5E18F 3RI4A 1XMAA 2GQQA 1SFEA 1GVJA 2ZBKA 1ODDA 1OYYA 4IHTA 1Z1DA 3ERED 2IA2A 3ZMUA 3KFWX 2QZ8A 1BI1A 4E70A 1EH7A 2EK5A 4RB3C 2WWYA 2Y48A 3MQ0A 1UFMA 1ZLKA 1TBXA 4HX7A 1U8RA 4M9XA 4OOIA 1QO0D 1O3SA 1FBQA 1Z6TA 2A3SA 2GAUA 3TQNA 4PCQA 4AIKA 4OIPF 2L3DA 1XSVA 3L00A 5DEQA 5FB2A 1YW7A 1C0WA 4CHUA 4U0YA 2DO7A 5L3CA 3VEPA 2P6TA 4A6EA 1Z7UA 3ZN0A 3MCZA 1IN6A 1FYKA 4H0EA 2AXLA 3GFLA 2OU2A 2DLLA 1R00A 3U2RA 3RPUA 4GYIA 5CYVA 4D0PA 1IRGA 3K9TA 1Q1HA 3V8JA 2XV4S 4RAZA 4UUVA 3TGNA 2HDCA 4XBFA 1TQIA 1GXQA 2CWEA 2M8EA 5HS9A 4HA8A 4WXCA 3E6DA 2M5WA 3F8MA 3DEUA 3BJ6A 5FO5A 5LEKA 1XCVA 4A12A 2A6HF 1SD4A 4OMZA 4ZZLA 1L0OC 4I2OA 5F64A 2GXBA 4KMUX 4M6YA 1XSDA 4Z2YA 2NS0A 1W4MA 2VBZA 1FP1D 4HYEA 3SQNA 2D45A 2PI0A 3IC7A 2RN7A 1JE8A 3K1MA 2YU3A 4IXAA 1MJBA 1H0MA 2G9WA 4Q47A 2EJRA 1HW2A 3T8TA 2EA2A 1HXDA 1T38A 4XSZF 3GWZA 5FFZA 4EVIA 1B1BA 3T1BA 3TKYA 2VN2A 4IRGA 4XSXF 3P9CA 2A5YB 1P4WA 2B0LA 3JAMK 2GWRA 2Q0OA 3HRSA 1MDMA 1GHCA 4MEXF 4M6XA 2Z99A 4A0YA 2PMUA 1IRFA 1U3EM 2EFWA 4BHPA 4DNCA 3ISPA 4N0BA 4ZYHA 3HRTA 4OIQF 1G3TA 4YIIA 4HX8A 1HW1A 4KDPA 1LEBA 5CVRA 3B73A 4JBAA 1YQAA 1SMTA 5JFRA 4HAMA 2O03A 3QU3A 4LB6B 1FSEA 2X0LA 3WTXC 2DQRA 1BIBA 3WTTC 5LRSA 1W5TA 1J59A 4M74A 3FHZA 3FZVA 5E1WA 3LSTA 3C3WA 3SZPA 1FBUA 4LFUA 1LB2A 2GZWA 5L3BA 3WTZA 1B9MA 2KKOA 2KJBA 2RC4A 1U5TB 3LQQA 1IAWA 1W7PB 3Q5FA 2FNPA 2CO5A 1MKMA 1TNSA 2BE5F 2RV8A 4RGSA 2XASA 3O3KA 1UHMA 4G6QA 5HLIA 2RGVA 4CYDA 2W24A 5FD6A 5H6RA 3P9KA 5LLQA 1I5ZA 5D8LB 2DK8A 2EWNA 4BH9A 1RNLA 5TRDA 5HS7A 4MQ9F 2L02A 3GZ6A 1T98A 1ON1A 4MNUA 1O3TA 2VBXA 3GXOA 3S2WA 5LGUA 4FX4A 2GA1A 3F8CA 3GZ5A 2DFIA 4UV9A 4ENMA 1XSXA 3KLOA 1U5TA 4HV5A 2H94A 2HOEA 4G7HF 1W7PA 2E1CA 1TNTA 1R1TA 5IT9K 3E5XA 3Q9VA 2VC1A 2QQAA 2PLYA 3ABUA 3BWGA 5CLSA 1A04A 3FM3A 2XAJA 5HVQC 3VB2A 2NYXA 2RKHA 3CO6C 1DDNA 4ASNA 2XAHA 3WTYC 3IWFA 2QBYB 3CTAA 3DV8A 3J81K 3WU0A 5DCMB 3WE2A 1MZBA 1ZLJA 1Z9CA 5LRRA 2FQ3A 1S7AA 4EJUA 2DPDA 3ZN1A 4LK0F 3DXJF 4HF0A 4HQMA 4RB1A 4GXOA 4K2EA 3T5XA 1OYWA 5BPIA 4B09A 4IPAA 3TOBA 4S04A 4UV8A 5FLXK 1B59A 2FBIA 3V4GA 4FT8A 4WCGA 2LKPA 2AS5F 3K1NA 1SFXA 1R5GA 3OOPA 5D5WB 4KIFA 4NQWA 1I1SA 1S8NA 3IL2A 4I02A 4KN4X 4CDGA 5DCMA 3F8BA 4KNYA 2FRHA 3KP5A 2M1BA 2OA4A 1DPUA 4QLCU 1SD7A 1ZGJA 5AIPA 2IA0A 2PG4A 4LMYA 3QRFF 1QGPA 1DUXC 1G3SA 5J8FA 2CYYA 2V9VA 1G3WA 2ZNZA 5ICFA 4KICA 1KQ0A 1J5YA 3M8EA 4XLPF 4ESFA 3FXRA 2HWVA 1AWCA 4G9YA 1XGNA 2FEZA 1MJ9A 4ZZDA 1X3UA 3VODA 3ZMZA 2DK5A 1G3YA 1SFUA 4YFKF 1LJ9A 4KMFA 1J75A 2UXNA 4ZYGA 1ONVA 2IJLA 3J80K 4A0XA 4HX4A 3KLNA 4EGZA 1ULYA 3EDPA 3HTUA 4OU0A 3IHUA 3HTSB 2FA5A 2P5KA 4KA4A 1REPC 1OR7A 4XLNF 3RIRA 1WSUA 4GYGA 2KIMA 3HRUA 4M9SA 2V1DA 1KU2A 4MQVA 2O8XA 2BGCA 3COAC 1JGSA 3MEXA 5HLGA 2JPCA 3FM5A 1LVAA 4A6DA 3KETA 2QYOA 4G7OF 3F8NA 2QUFA 1USSA 3G73A 1YO5C 2MLGA 1HQCA 2ZMEB 4P55A 4A0ZA 4M73A 3HHGA 2MBFA 4B8XA 5HS8A 1H9TA 2WTEA 2FMYA 3LA7A 4IJAA 1BC7C 2J5OA 1TQPA 3MZYA 6PAXA 1EH8A 1HW5A 2XAQA 3R0AA 4RB2C 2F5CA 3TDZC 2RVCA 3WTVC 4ETSA 4HDVA 2FMLA 1J0RA 5E1ZB 4HOBA 2IRFG 4HLXA 3SHFA 3WODF 3DKWA 2JPBA 3LAPA 1P4XA 2QQ9A 1YTYA 4ON0A 1XGSA 4ZH4F 2ZMEA 3I59B 1P4AA 2EFNA 2E1NA 2JT1A 3KE2A 2L4AA 4M71A 5DD8A 4YG2F 2STWA 3R61A 3RKYA 4BHCA 4ZYEA 4RB0A 1B4AA 1TW3A 1G4DA 4O3MA 2HFHA 5K5RA 4LLGF 3JAMZ 2ESNA 4WWCA 1R58A 2P7CB 1ZYRF 2QENA 2ESHA 1ZRCA 3LA3A 2EV0A 2PMHA 4RGRA 4NHJA 3HRMA 1BI2A 3KEOA 2LF8A 4KUMA 3LFKA 3CJNA 4Y13A 2VODA 2EFPA 4WK8F 3DF8A 4RGXA 2DAOA 3EUHA 3I59A 2FNAA 4UNOA 3I54A 4MGRA 2ZKZA 2WV0A 2PQ8A 2QM3A 4OINF 1ZG3A 4A5NA 1STZA 2OBPA 4ESJA 3ECHA 1T39A 3T0YA 1O57A 3ZMTA 3JTGA 1S3JA 3MAJA 1K6OA 1IN4A 3H3UA 3M1EA 4WF2A 3E3VA 1WI9A 3WGGA 4LD5A 2XIGA 2G7HA 3RDIA 1ZRDA 2W25A 2DI3A 1KU7A 4KN7X 1O3RA 4A2UA 3GFJA 3Q9SA 4RGUA 3M8FA 2EB7A 2YR2A 5D4RA 3HUGA 4I7HA 4GCVA 2OZ6A 5DYMA 5J8CA 1FYLA 4F7ZA 5DUKA 2QLZA 4G8XA 2R7FA 1TTYA 1V4RA 5LEJA 1RI7A 5IT9Z 3QAHA 4S05A 4L9VA 1FZPB 1O3QA 3BOQA 4HQEA 2O3FA 3REOA 3I5UA 1RIOH 4BYYA 4IVNA 2QWWA 2D2WA 3SFZA 1H9GA 3LQRA 3SXYA 3J81Z 1UHWA 3IKVA 1JHHA 1UB9A 2K86A 2VOOA 3RTRA 4NB5A 1KYZA 1FLIA 1YFHA 3J7AO 2H6BA 1KQ9A 1OKRA 4LG0B 2OAZA 3FF5A 2GXGA 4JQFA 5D5UB 1QPMA 5FLXZ 1FP2A 2OZUA 3BZ6A 2HQNA 1O7LA 3F23A 5HDNA 1FPQA 4LGWA 4LB5A 1TW2A 3ZMSA 3H3ZA 3K1PA 2TDXA 4UVCA 2DPUA 5E17F 5BS6A 2F5FA 3H92A 2HTSA 3FX3A 2Z3YA 5L3DA 2K02A 5CJ9A 5FGMA 2QQBA 1USTA 2EV6A 1EH6A 2JSCA 4WXDA 4EM1A 2BEOA 3RJPA 3RKWA 3ML6A 3KP2A 1P6RA 1BN5A 2FBKA 3LWFA 1D3YA 1D8KA 4P9FA 3LA2A 1R1VA 2DQLA 3IRRA 2P6SA 4LG0A 2O6GE 2R7DA 3U1DA 2Q8KA 5E8GA 2FXAA 1YLFA 4G7ZF 5ILSA 4MHGA 4FX0A 2G7UA 2V1UA 4OMYA 4EM0B 3JW4A 1J2XA 2UWMA 5CVIA 3R60A 3RYPA 4ZYDA 1D5VA 3E5QA 4L5IA 5DV5A 4AWXB 4A5MA 4FHTA 3E6MA 3IWZA 4KYWA 3GW2A 4L0YB 2D1VA 2LF7A 2IVMA 4JK1X 3DQVC 4PGGA 3FMSA 4CGZA 2LNBA 3QP6A 1BJAA 2CW0F 1QZYA 3BPXA 1ZREA 2ZCWA 3J80Z 2OD5A 4L9TA 2CGPA 1LNWA 3B02A 4BQAA 2XHKA 3GFMA 4M9ZA 2ZFWA 1SMYF 3SZTA 3QOPA 4EMSA 2E7XA 1IN7A 1D8JA 3G3ZA 5D8KB 3HSEA 1ZG5A 1S6LA 2O0YA 1TLHB 4AIJA 4WX9A 1WRJA 3N4MA 4Y17A 2LSOA 1IF1A 1YW9A 5A2QK 4RAYA 3GEZA 4I0BA 4YIFA 1HKTA 2QBYA 2FSWA 3RYRA 5ICCA 2M30A 4LJZF 2Y75A 2HGCA 3ECOA 1SAXA 1HBXG 5FD5A 2NNYA 3I64A 1BBYA 2Q2EA 5JI6A 1FSHA 3BJOA 3O6BB 4PZJA 2D1HA 2ACJA 1FOKA 2FF4A 2ISYA 3F22A 3R6SA 1SD5A 4GGGA 5L3FA 3CUQC 1FC3A 1IUYA 3O2PE 1B6AA 3BDDA 1XMKA 2Z33A 5EEGA 3E6BA 1QQIA 1BI0A 2Z5UA 5EEHA 4AIHA 1R1UA 5CVUA 1I27A 2R3SA 1WWXA 1OMIA 5E1XA 3D5LA 5IT3A 2FE3A 4IRIA 2VBWA 4EJTA 3W6JB 5LGTA 4MTEA 4CO8A 2IT0A 3KZYA 1W5SA 4UVBA 3GFIA 3N97A 2YPRA 4BXUA 3NQOA 1FT9A 2UXXA 2V79A 3GX4X 1HSTA 3GLXA 3HHHA 3U9GA 2BV6A 4R1HA 1KYWA 4HDUA 3ELKA 3PQJA 3HSFA 3F21A 3W6KB 3ULQB 2HR3A 1K79A 1ZGAA 1RUNA 1ZRFA 5DDGA 4HLYA 5JHUA 2K7LA 3WU1B 3DFGA 1Z91A 2MH9A 3NEUA 3CO7C 2NNNA 4CXFA 4TV7A 2F5DA 1IZ1A 4GO1A 2HTJA 1FYMA 2KIUA 4KFCA 4XRFA 2UZKA 1CGPA 1R22A 5AONA 5ILVA 3M7GA 4UXNA 1YS7A 2GIVA 3WG9A 1LQ1A 3KP6A 4L18B 2HEOA 1P92A 3K2ZA 4U7BA 2MD5A 2DTRA 1F9NA 2VC0A 3F3XA 5ILUA 2A6EF 3D0SA 1QZZA 2E7WA 5FFXA 3QPHA 5BOXA 3LAJA 2H6CA 2ELHA 3HYIA 2VONA 1YW8A 1AOYA 3CLOA 3HIFA 4WXHA 4EM2A 1QNTA 4KIBA 2P7VB 1ZH5A 1IN5A 4ENNA 4Y15A 2V1XA 5BMZA 4O5VA 2MC3A 2IA1A 4M72A 3BPVA 1KU3A 4UHTA 2OQRA 3WGHA 4Q48A 2VE9A 1K7AA 1E2XA 1F5TA 1HSJA 1HKQA 2ADUA 3L9FA 2Z9OA 1U2WA 5K5QA 4EJVA 1KGSA 2P4WA 2M45A 2KJCA 2CQKA 2MLKA 3QP5A 3GVAA 1DPRA 1RZ4A 3C1DA 1WQ2A 2MH2A 1SD6A 3C7JA 2H09A 3TO6A 3ROUA 5HOOA 3WTSC 3E97A 4P9UA 3I4PA 5HDGA 5ERIA 3ZPLA 1XDSA 2YX7A 4EGYA 2K27A 2XUBA 4I0AA 3KP7A 1MD0A 3I53A 4BNCA 2K4JA 4PGHA 4YFNF 2FU4A 3WTUC 5K1YA 3KP4A 2KIFA 1BC8C 3I0TA 2XROA 1YS6A 5D6EA 2RQPA 1MDMB 1JXSA 1QBJA 5BPDA 2BYVE 2IP2A 4EV0A 5CVVA 3V7RA 4I01A 4BAYA 3AAFA 1FBSA 2X4HA 2W84A 2STTA 1FNNA 1UCRA 1ZARA 1XGOA 4L0ZB 1W7PD 1J7KA 1ZG1A 2RDPA 1Y0UA 3GUDA 2A07F 2HYGD 2HKOA 2ZXJA 4IRHA 2H27A 4AD9A 2P5LC 1ZHFA 3RPQA 1NHAA 3L09A 3E6CC 1TQMA 1R7JA 4U0WA 3IRQA 1L3LA 3L7WA 2M87A 3R4KA 4HW0A 5H20A 4LLLA 1K78B 4CICA 4YFXF 1R36A 3P9IA 5LHHA 1ZN2A 1O7FA 1F4KA 2VT2A 1XGMA 1U5TC 5HLHA 1BOAA 1WKMA 3WE3A 3GYHX 2P8TA 5ICEA 4R8HA 1V3FA 2VOPA 2BBYA 2O61A 2ZNYA 3E5UA 4Q5SF 2PEXA 2XKPA 4EJWA 2W85A 2HQRA 5D4SA 4P5OA 3V7SA
chains in the Genus database with same CATH superfamily
3FXOA 1RUOA 5GADJ 1R71A 2QF7A 4PDKA 5F08A 3KP3A 3PNVA 3S1QJ 5IP9J 5FRNA 1TT5B 2JZYA 2M9HA 4LOCA 3K69A 5TISC 1OLTA 4U7DA 3A02A 1KQ8A 2XRNA 4I98B 1B9NA 3S93A 1OPCA 3F6OA 3KEQA 4DYQA 5HODA 2PN6A 1ETXA 2HXIA 2DW4A 3HSRA 4E7KA 2R5YB 1K78A 1Y8RB 2AXTC 2KZGA 5HNHA 1IV6A 3HJEA 4E4HA 5A2QZ 1BIAA 3TL4X 5D5XB 2DU9A 4UVAA 2XVCA 1Z6RA 3QWLA 1OYIA 2M8GX 1R5HA 2X1DA 1ORKA 2VASA 2BY0A 1Z67A 2VPRA 4XLFA 3EETA 4A93J 4KIGA 2XKOA 2JQ7A 3I4NJ 3QPTA 5JR3A 1OCOH 4DQ2A 5DM6F 3I71A 4AM3A 1CF7B 1P2FA 3V8KA 1JUPA 1I1GA 3FMRA 1W5CC 2L4MA 3I3LA 3L2QA 2A69F 1VQOI 3HOTA 3A0HC 1KA8A 1UJ8A 1X1BA 3WTWC 5F1RA 5F1JA 1T2KA 4X1EA 1K6YA 1BOBA 3FXQA 1OISA 3PFYA 3GMEA 2DOFA 2HS5A 4G6DA 2B7EA 2XPWA 2PFBA 1PP7U 2K85A 4ENKA 2E5ZA 2HKXA 2JSPA 1LFPA 2OCCH 4PJNA 2W57A 4QIWN 2COMA 3BROA 1H8AC 5TJJA 5GTIC 1N78A 1XC5A 3DLAA 3GZNB 1DU0A 2R92J 5H6QA 2HZDA 4YELA 1LDJA 2EZHA 1QVUA 5J40A 2PJPA 2V9KA 1OCCH 1X3WB 2RNJA 1S7EA 2R5YA 5EGOB 4YEJA 2P5VA 1FMVA 4FE7A 1S29A 2JTVA 3JSPA 1FY7A 2CFOA 3NRVA 2L7KA 2XGXA 4XKBA 2GM4A 5D6FA 2JRTA 3DPLC 1VQ9I 3F8FA 2OUMA 2ZXHA 1TZLA 4D9JA 2DBBA 5IP7J 2MA3A 3GBGA 4OIRF 1IJWC 3V7CA 1U78A 5C4JJ 3PFIA 1Y1WJ 3TDUC 1FWZA 4HBLA 2E5NA 1I6HJ 2DMPA 1G6NA 1CF7A 3AL0C 1IG7A 4PJLA 4L9JA 5K5OA 3MZHA 3TO7A 1Z05A 3S14J 3VFZA 4QSHA 4IHSA 1OCTC 2V6CA 4I09A 4OAYA 4B4CA 4N9HA 1PP8F 2ZJPF 2GA2A 3OV8A 1BR2A 4XLEA 3V42A 4GRIA 4MFDA 3KZZA 1R4NB 1S5LC 1R23A 3BLYA 3IUOA 3QU6A 4IL6C 5E20A 5L3EA 1T08B 3F72A 4XLHA 3HKZN 1IXCA 2CW8A 3HC7A 2L9NA 1D5YA 1DP3A 4NC7A 2DT5A 4LIVA 5DM7F 4JX4A 3FMQA 3F6VA 5E8IA 4O6JA 3G1MA 2QSHX 4B3AA 2IS2A 2LDUA 2VT3A 2EFQA 1A6IA 2ZO4A 2W4SA 1IN8A 1GXPA 3LSKA 4C3HJ 3LNQA 4OAZA 2LY2A 3CLQA 4RLFA 2R7RA 3HOWJ 3DBHB 1ZK8A 2RQQA 2XAFA 4HV6A 5EGOA 4A3CJ 4MEYF 2X6WA 1I6XA 2E2JJ 4R79A 2L01A 5F0HA 3PO2J 2EA4A 3CJTB 2F2EA 2KRFA 1HA8A 4L9NA 1F1ZA 2AO9A 2DA2A 1OR7C 3EQLF 2IPQX 3CDHA 4FCYA 2ZJ2A 2HYFA 4HZFA 5F6FA 1HKSA 1H89C 2L2OA 1T0FA 2NAZA 2K9LA 3IAM2 4XICA 2B63J 2WC2A 2ISZA 2ZFUA 1XN7A 3ZMVA 2LRDA 1PUEE 3M9AA 2EV5A 1LFBA 3K0LA 4DJAA 4E7LA 1MMAA 3HM5A 2XAGA 4C2MJ 3I56I 1PDNC 3BJAA 1XB4A 1JHFA 1HC8A 3DP7A 4BEHB 1SFKA 4L5JA 5E3NA 3A0BC 1U9OA 1LDDA 1VQNI 5ICGA 4IX7A 5CPRB 1POGA 1N75A 3VYTB 1EV7A 3GTPJ 3F9KA 4JYKA 4LLNA 2IBDA 3OIPA 1E17A 2A61A 5FKNA 4N4NB 5L3GA 1Y39A 1FTZA 4ZDLA 3HXLA 1LDKB 2VIXA 4M3EA 3W2AA 2Y0MA 3V7SA 5BQTA 5GTHC 1BM9A 1U6GA 5F0CA 3EYYA 3T8RA 1S7OA 1XX5A 1W1WE 2KT0A 1A36A 3K4NA 3OYBA 4MTDA 1BW6A 1FX7A 4XRSA 4FQGA 2ID6A 1MJAA 3K7AJ 3MKZA 3ZMDA 2IW5A 2YX4A 3TO9A 4EQQA 3CMEI 3OYAA 4PUSA 3CCJI 5LHIA 4AVPA 2L54A 3BY6A 1ON2A 4HF2A 1VI0A 1YX3A 2PBIA 1LE8B 3GO5A 3R0JA 4G94A 4HF1A 2FOKA 3JSOA 2QVOA 1IXRC 2WB1N 1VTNC 2JJ7A 3ZQHA 1MGTA 3BG5A 2C6YA 2EZKA 2F5EA 3GTGJ 3VSLA 2MD0A 3GF2A 2XSDC 2XAUA 1JKRC 2NVYJ 1P7IA 2JMWA 2D5VA 2J5PA 3QYFA 2LBFB 2LKSA 2PX9A 1YYVA 4BEHA 3CUQB 1UHSA 2MW8A 4V2FA 3ABTA 5EG0A 4CZZA 4V2GA 4EJOA 5LGNA 4X6AJ 2VBYA 2ZMEC 1ZAOA 4E7HA 3IKTA 2ME6A 1UZCA 3ZR8X 4BJ5C 5D5VB 2M0CA 3VOEA 4IF4A 2CSOA 4JX5A 1DP7P 3DPTA 1XCBA 5GP9A 4UUTA 4RAGA 3BP8A 3V8LA 3WGIA 5DCFA 5CVJA 1JGGA 2LYCA 4KT5C 4ITVA 4A3MJ 3OWTA 2ETHA 4P96A 4U88A 5IYDJ 3L1PA 3D1NI 2K40A 4A3GJ 1YG2A 5F04A 4PK4A 5HDKA 2JWTA 4N9IA 4OIOF 1X1DA 3KX2A 3HOSA 2BZTA 2CG4A 1KZHA 3X2QH 1ITYA 1LE8A 2W82A 1CQTA 5B1BH 2VE8A 2DT6A 4NUBA 5GAGJ 4LK1F 5DD4A 2K4BA 2YSRA 1BI3A 2KISA 4Y33A 5KK1A 5LFAA 2CFXA 2EFOA 5FLVA 2HZTA 2IAIA 5LBQA 2KRCA 5LHGA 3FXKA 1LEAA 2LBFA 4RS8A 2A68F 3FWEA 4BHBA 1B72B 4RAFA 3CUQA 4ENJA 3E7LA 3ZQ7A 3DKYA 1TT0A 2LTPA 3RKXA 1WJEA 3KCCA 2FBHA 3BT9A 3OYJA 2VUMJ 3EUHC 2V26A 3TOAA 3ZP5A 4AYBN 2R4GA 2E71A 3KPHA 3FXLA 3A1YA 1XDUA 3C18A 3I58A 5AIQA 3JRIA 4U0VA 3CUOA 4DBQA 3EYIA 4RA2A 3GTLJ 4QWQA 3L2CA 1A6QA 4P1WA 1J9IA 3W3CA 3DLLF 9ANTA 2OQGA 2RNGA 1U0JA 2V4JC 2R7QA 3Q3SA 1IXSB 1WGXA 3FIWA 3MFKA 2A6TA 3A2KA 1V55H 3HKZA 1WJBA 1KU9A 1YIOA 3BC8A 3JTHA 2KHMA 5JVTA 4M3GA 2VXZA 3QODA 5K7HA 5DUIA 5J6XA 3JREA 3M3YJ 3P7NA 1XD7A 3PQKA 5ED4A 1X4OA 3MVPA 4XKCA 1IW7F 2WV1A 4Q4ZF 2AQFA 4ESBA 3MWMA 5KVRA 2NRAC 1T6SA 3FXUA 2Y0SA 4MLOA 1X1PA 5E18F 1XMAA 3RI4A 2DXIA 2GQQA 1SFEA 3DBLB 4F91B 1GVJA 2ZBKA 4IEJA 3QPLA 1ODDA 2DJNA 2LKXA 1SEUA 1OYYA 4IHTA 1TWAJ 1Z1DA 3QYBA 5GPCA 3ERED 2IA2A 3ZMUA 1B72A 3KFWX 3HOZJ 2QZ8A 3VYUB 2ZSHB 3W6VA 1ENHA 1BI1A 4E70A 1EH7A 3LOCA 2EK5A 4RB3C 4D7NA 2Y48A 3MQ0A 2WWYA 4BACA 1UFMA 1ZLKA 1TBXA 4HX7A 1U8RA 4M9XA 4OOIA 1A31A 1QO0D 1DQUA 2EBIA 2XF7A 3OYFA 1UG0A 2V9PA 3OL3A 1O3SA 1FBQA 1JKPC 1OCPA 1Z6TA 2A3SA 2GAUA 3TQNA 4PCQA 4IHXA 4Y52J 4AIKA 2M4GA 5EDNA 4OIPF 2L3DA 1MBGA 1XSVA 3L00A 2W7NA 5DEQA 5FB2A 4II2A 1UELB 2TRTA 4C3JJ 1JT0A 1YW7A 1T56A 4ANJA 1C0WA 4CHUA 4U0YA 2EPFA 2DO7A 5L3CA 2XDVA 4B44A 3VEPA 2P6TA 3ZQFA 1Z7UA 1RKTA 2E1MB 4A6EA 5C4XJ 3ZN0A 3MCZA 1IN6A 4JX6A 3BCBA 1FYKA 4H0EA 3FKIJ 4PFOA 2AXLA 3GFLA 3QQAA 2OU2A 2V1NA 3JRCA 2DLLA 1R00A 3S32A 1BA5A 2KDZA 3U2RA 3PSFA 3RPUA 4GYIA 5CYVA 3OS1A 4D0PA 3CC4I 1LVKA 1IRGA 2KL4A 2GIZA 3K9TA 1Q1HA 2EZLA 3V8JA 4AIDA 3K10A 1F36A 2DA6A 3S17J 2XV4S 3DEWA 1AKHB 3CCYA 4RAZA 4UUVA 3TGNA 5M3FJ 1MBHA 4PSWA 4FASD 4XBFA 1TQIA 2HDCA 1M1EB 4QPQA 1D0YA 1GXQA 2CWEA 5EZHA 1NK3P 3SJMA 2M8EA 5HS9A 4HA8A 3BG3A 4WXCA 2X6YA 2IGMA 2CUJA 3E6DA 2M5WA 1YI2I 2BY1A 3F8MA 2FD5A 3DEUA 3BJ6A 5FO5A 5LEKA 1V5GA 2HNHA 1XCVA 4J19A 1WJCA 1E3OC 4A12A 2O9LA 1GV2A 3DEEA 3BR0A 2ICWG 2A6HF 2LR8A 1SD4A 4HSRA 1YHQI 3ONQA 4OMZA 4FISA 1ETKA 5E3LA 3AKZA 5EZGA 2XC7A 3BQZA 2E35A 4UY8I 4ZZLA 3Q0WA 4XONA 4DOZA 1L0OC 4AUXA 1Y0NA 2CUEA 2VKDA 4I2OA 5F64A 2GXBA 3OR2C 3M8JA 4KMUX 4M6YA 1XSDA 3C2HA 3OS0A 4Z2YA 2NS0A 1W4MA 2VBZA 1ETYA 1FP1D 1VF9A 4HYEA 3HPHA 3SQNA 2D45A 2PI0A 2HPIA 2E2HJ 3IC7A 3IP4B 4DIQA 2RN7A 4BJTA 1JE8A 3K1MA 5FRMA 1B8IB 3K4MA 2YU3A 2DA3A 4IXAA 4Y7NJ 1SFOJ 4ZTJA 1IDZA 1MJBA 1H0MA 2G9WA 1AKHA 4KT6A 2KP6A 4XRSG 5B5EC 4Q47A 2EJRA 1HW2A 3T8TA 2EA2A 2BY2A 1HXDA 1T38A 2L7ZA 4XSZF 2LMDA 3GWZA 5FFZA 1V5EA 4EVIA 3BR6A 1B1BA 3T1BA 3RSNA 3TKYA 2NOJB 2I5UA 2VN2A 4IRGA 4XSXF 3P9CA 2MC4A 1D1AA 1JTXA 3MD2A 4NBQA 2A5YB 1P4WA 2B0LA 3EUKL 1UG2A 3QPSA 3JAMK 3K4LA 2GWRA 2Q0OA 3HRSA 1MDMA 1GHCA 4MEXF 4M6XA 2Z99A 4A0YA 4HG2A 2PMUA 1GLNA 4AYBA 1IRFA 1U3EM 2EFWA 4BHPA 2XGDA 4DNCA 3KIOA 1JTYA 3ISPA 2MSYA 4N0BA 1T95A 1BW5A 2I8DA 3HRTA 4ZYHA 5F0FA 4OIQF 4ZDPA 1G3TA 2Y2ZA 4YIIA 4HX8A 1YRNB 1HW1A 4KDPA 1LEBA 4BL0B 2BOLA 1FIAA 4XOTA 5CVRA 2XGEA 1FOYA 3B73A 2QKMB 4JBAA 3S3MA 1YQAA 1SMTA 5JFRA 1B8IA 2R7TA 4HAMA 2O03A 4UB6C 3QU3A 4LB6B 1FSEA 1EF4A 2X0LA 3WTXC 5J1RA 2DQRA 1BIBA 3MKLA 2LC2A 5LRSA 3WTTC 1Z7LA 2JN6A 1W5TA 3S15J 1MW7A 2KZVA 2L7FP 2VI6A 3AFHA 3FZVA 4M74A 3FHZA 1J59A 1PJRA 5E1WA 3OYHA 3LSTA 1RKWA 3C3WA 3SZPA 3TEDA 1FBUA 4LFUA 1W36D 1LB2A 2GZWA 5L3BA 3CMAI 3WTZA 3LSGA 1B9MA 2KKOA 2MABA 4BDZA 2KJBA 1MBKA 3VSKA 2RC4A 1U5TB 3LQQA 3PUBA 3I55I 1SVOA 1IAWA 1W7PB 3H9JA 4BXFA 3RKQA 3Q5FA 2FNPA 3J7AY 1MSFC 2CO5A 1MKMA 1TNSA 1ZELA 2BE5F 2RV8A 4RGSA 3RZDJ 2VKVA 2XGCA 2XASA 5M3MJ 3ZOBA 3O3KA 1JT6A 1UHMA 2WAFA 3HB9A 3PUFA 2EZIA 4G6QA 3TW6A 5HLIA 2RGVA 4CYDA 2W24A 5FD6A 5H6RA 3P9KA 5LLQA 3G71I 1RC9A 1I5ZA 5D8LB 3SEQA 4RLQA 2DK8A 2EWNA 4BH9A 3FKJA 5GAEJ 1RNLA 1TWFJ 3BTLA 2LK2A 5TRDA 3JRDA 4ABZA 5HS7A 3ESWB 4MQ9F 1D0XA 2L02A 1W36C 3GZ6A 1T98A 2WAEA 1WI3A 1ON1A 2ZJRF 1JI8A 3WG7H 1RPWA 3MMYB 3LSIA 2P81A 4MNUA 1O3TA 2VBXA 3GXOA 3S2WA 5LGUA 4FX4A 2GA1A 1W0TA 3DTEA 1F43A 3F8CA 3GZ5A 2DFIA 2RREA 4UV9A 1LPQA 3VDXA 4ENMA 1ETWA 2DJIA 1XSXA 3KLOA 5JVGF 1U5TA 4HV5A 2H94A 2XSJC 2HOEA 4G7HF 4BE0A 1IRXA 1W7PA 2HVQA 2F4IA 4XRMA 2E1CA 1TNTA 1R1TA 2M0MA 5IT9K 3WHBA 1Z3XA 3E5XA 1O4XA 2XB0X 3Q9VA 2VC1A 2QQAA 3KYDB 2QSGX 2PJRB 4BJ6C 2PLYA 3OYLA 3ABUA 3EUAA 2XPVA 3BWGA 3HZJA 1A04A 5CLSA 4XL9A 1SVLA 3FM3A 2EIMH 2XAJA 3G1OA 3VB2A 4NQWB 2NYXA 3CP2A 5HVQC 2RKHA 3CO6C 1A35A 1DDNA 2MFZA 4IQ4A 2GBYA 3M1CA 4ASNA 1K61A 2XAHA 2DODA 2HDWA 3WTYC 1MNEA 3H0DA 3IWFA 2QBYB 2CS3A 3CTAA 3DV8A 3WU2C 5KAIC 3J81K 4IHYA 3WU0A 3GTOJ 2DYSH 5DCMB 3ZQCA 2VB6A 3WE2A 1MZBA 1ZLJA 3HOVJ 2ZC2A 4HNTA 4HNVA 1K83J 2ZB9A 1Z9CA 5LRRA 2JA7J 3PIOF 2FQ3A 1S7AA 5JLXA 4EJUA 2DPDA 3ZN1A 3HEFA 3TP3A 3IV5A 1IGNA 4LK0F 3DXJF 4HF0A 4HQMA 1MNDA 3TP0A 4DBRA 4RB1A 2Y0SN 4PFPA 4GXOA 4A3BJ 2ZXWH 1FIPA 4K2EA 3T5XA 1VNDA 1OYWA 5BPIA 2FJ1A 4B09A 1IRZA 4IPAA 1BJZA 2XPUA 3TOBA 4HEA2 1A5JA 4S04A 2R5ZB 4UV8A 5FLXK 2A05A 2YU9J 2L9VA 3OIQA 3OYGA 4A3LJ 2ELJA 2VJ4A 1B59A 2FBIA 4XOPA 3V4GA 4NC6A 1U8BA 5M5XJ 3AL0B 4FT8A 4WCGA 4IZZA 2LKPA 2AS5F 3DTIA 1MH3A 1MSEC 1WZ2A 2PJRA 3K1NA 1SFXA 3IH2A 1R5GA 3OOPA 5D5WB 4KIFA 1MH4A 4NQWA 3CJRB 1R6RA 1I1SA 1MMNA 1S8NA 1VQ8I 2BVMA 3IL2A 4I02A 4KN4X 4CDGA 5DCMA 3DU6A 3F8BA 2OPTA 4CH7A 4F3QA 4KNYA 2LREA 5IY5H 2X9DA 4GDFA 3GTKJ 1FTTA 1APLC 2CU7A 2WAQN 3RQIA 1TC3C 1TL8A 1WFXA 2FRHA 3KP5A 2M1BA 2OA4A 2VPLA 2CQXA 2DFEA 4M3DA 2DYRH 2XRLA 5KNLA 1DPUA 1TWGJ 3BTCA 4DYRA 4QLCU 1SD7A 1ZGJA 5AIPA 1XPXA 2IA0A 2PG4A 4LMYA 1ZTRA 1QGPA 3QRFF 1Z0XA 3BG9A 1DUXC 1G3SA 5J8FA 2CYYA 2K3PA 2V9VA 1G3WA 1R9TJ 2ZNZA 5ICFA 4KICA 1KQ0A 3C2BA 2NVQJ 1J5YA 3A4CA 3M8EA 4XLPF 2X6XA 4ESFA 1FEXA 5C44J 3FXRA 2HWVA 1NG6A 2L7MP 2NS7A 1AWCA 3HOYJ 2WA0A 2HXOA 5DS9A 1TWCJ 5FKMA 4G9YA 2FOWA 3BG7A 1VQLI 3S1MJ 4BS9A 1XGNA 2X48A 5HNFA 2FEZA 4XN3A 4BQQA 2OTJI 5IYCJ 1MJ9A 1WH5A 1D1CA 4ZZDA 1X3UA 5DTDA 2VKEA 3ASOH 4EATA 3VODA 1QZEA 2BW3B 3ZMZA 2DK5A 2HVRA 1G3YA 1SFUA 4YFKF 1LJ9A 4KMFA 1DGRM 1J75A 2UXNA 3H36A 3HBLA 4ZYGA 1ONVA 2IJLA 3VWBA 3J80K 4A0XA 4HX4A 3KLNA 4XLCA 3LMMA 1ULYA 3EDPA 3HTUA 4EGZA 2O7OA 4OU0A 3IHUA 4XM3A 3HTSB 2X1EA 4RM2A 2K3FA 2FA5A 4CCMA 2P5KA 4KA4A 3I4MJ 4CZCA 2QSFX 1REPC 4X0GA 5FLMJ 2EIJH 3JRGA 2L5QA 1OR7A 4XLNF 4CCKA 3RIRA 1TWHJ 1WSUA 4GYGA 2KIMA 3HRUA 4M9SA 2V1DA 1KU2A 1SVMA 4MQVA 4RM3A 3E0JB 2ZJQF 2O8XA 2BGCA 3COAC 2CQNA 2HQAA 1JGSA 3MEXA 5HLGA 2JPCA 3FM5A 1LVAA 3CD6I 3CCMI 4A6DA 3KETA 2QYOA 3OYKA 4G7OF 2VJIA 3PM1A 3LL7A 4CCJA 3F8NA 1UAAA 2P0WA 2DA1A 2QUFA 1USSA 2BHZA 3G73A 1YO5C 2N8GA 2MLGA 2QEXI 1HQCA 4CA0A 2ZMEB 3W2VA 4P55A 4E7SA 4A0ZA 4M73A 2TCTA 3HHGA 2DMNA 2NVXJ 2MBFA 1K4TA 4B8XA 1NG7A 3M07A 2H8WA 4I99C 5HS8A 3CDLA 1H9TA 2WTEA 2FMYA 3K70D 3LA7A 4IJAA 2WBMA 1VQ4I 1BC7C 2J5OA 1P9QC 3ABLH 3DU5A 3HDDA 1TQPA 3MZYA 1XTAA 1EH8A 6PAXA 1HW5A 3BR2A 1HF0A 2E60A 2XAQA 3R0AA 4G6TB 3ASNH 4RB2C 4E7JA 3CDIA 4FE4A 3L2VA 1VQKI 3QOEA 1X19A 3S16J 4Y4RA 3G4SI 2F5CA 3S2HJ 3TDZC 1WJAA 2RVCA 2XF5A 5EEAA 2JA5J 3WTVC 4ETSA 4HDVA 1OFCX 1G8XA 1VQ7I 2FMLA 2Z2SB 1J0RA 5E1ZB 3VPRA 4DYCA 2DA7A 4HOBA 1V54H 2JUGA 2IRFG 4HLXA 3SHFA 5KCMA 3WODF 2MYSA 3DKWA 2JPBA 1WJDA 3LAPA 1P4XA 3S3OA 1ERDA 2QQ9A 4BGDA 1YTYA 2Y30A 4ON0A 4C30A 2R0QC 2R7UA 1XGSA 1OCRH 3UR3C 3PIPF 4ZH4F 2ZMEA 2HVSA 3I59B 4BY7J 1P4AA 3K70C 2EFNA 2E1NA 2OCEA 2JT1A 3KE2A 2L4AA 4M6VA 4M71A 5DD8A 3QYEA 4YG2F 2STWA 3O8GA 3R61A 3RKYA 4BHCA 3BQYA 4ZYEA 3W2WA 2DDBA 1Z77A 3ABKH 3Q0UA 3RCOA 5IP6A 2AHQA 1GDTA 2YS9A 3OOUA 2MG4A 4RB0A 1B4AA 4HRIA 1TW3A 3LSMA 1G4DA 4O3MA 3JRBA 2HFHA 3OY9A 1VQMI 3OIOA 5K5RA 2ELKA 2IGNA 4LLGF 3JAMZ 4JP0A 3HOUJ 2ESNA 2JVGA 2DMQA 4HNUA 5J47A 4WWCA 1R58A 3HPGA 2P7CB 2WAQA 1YE9A 1FJLA 2CQQA 3NWSA 2LP0A 1ZYRF 4XLAA 2QENA 2ESHA 1ZRCA 4ZYAA 1PUFB 3LA3A 3ERMA 4H4KC 2E36A 2EV0A 2PMHA 2OC6A 2JVHA 2ECBA 2VLAA 4RGRA 4NHJA 3HRMA 1BI2A 3KEOA 2LF8A 4KUMA 3LSPA 3LFKA 3CJNA 4C9YA 4AU7A 4Y13A 4XK4A 3BTIA 3SZGA 3CMMA 5B66C 2VODA 1WPKA 1NTCA 3K4BA 2EFPA 4WK8F 3DF8A 4RGXA 1ZQ3P 2DAOA 1R4MB 3EUHA 2FNAA 3I59A 2LD5A 3ZCOA 4D5FA 4UNOA 1EA3A 1OJLA 5FKKA 3I54A 4MGRA 2ZKZA 4FTHA 2WV0A 2PQ8A 5FROA 2QM3A 3SYTA 4OINF 3HUGB 1ZG3A 4A5NA 1STZA 2OBPA 4ESJA 2K9SA 3DPUA 3ECHA 2R7XA 3L2WA 1JUMA 3KYLA 1T39A 4LIUA 3T0YA 1O57A 4YRVA 4NC8A 3ZMTA 3MN2A 3JTGA 4EEFG 2VQCA 1QPIA 4CCLA 1S3JA 3MAJA 1K6OA 1Z3YA 1IN4A 3H3UA 3FHNA 3M1EA 4WF2A 3E3VA 1WI9A 3WGGA 5J4VA 1PUFA 2R7SA 5GAHJ 4LD5A 4JOMA 2XIGA 3E1SA 4FETA 1VZ0A 2HYJA 2V6EA 2G7HA 4U87A 3RDIA 1ZRDA 2W25A 4V19K 2Y9ZA 2DI3A 1KU7A 4ZDOA 4KN7X 2HOAA 2WY8Q 2VQLA 4G12A 1O3RA 2W1OA 1SC7A 2LY1A 4A2UA 3BR5A 2JA2A 1I39A 3J7ZI 2LVSA 3GFJA 3Q9SA 4NDLA 1XMXA 4RGUA 2DN0A 1OCZH 2X85A 3H9QA 3M8FA 2EB7A 3I9V2 1JKOC 2YR2A 5D4RA 1MBJA 3HUGA 1S9HA 4I7HA 2DOEA 1QRYA 2OZ6A 4GCVA 5DYMA 1I3QJ 5J8CA 2MGQA 1FYLA 4DW6A 4F7ZA 1WHUA 2GLOA 3MZ8A 1NK2P 5DUKA 2QLZA 2OTLI 2E1OA 4G8XA 2R7FA 2KMUA 4BUPA 1TTYA 1V4RA 5LEJA 1RI7A 4J00A 4IHWA 2NVTJ 3VYRB 5IT9Z 3QAHA 4S05A 3FBIB 4L9VA 2W00A 1SAUA 2K9MA 1FZPB 2IGOA 3A01B 1O3QA 3BOQA 4HQEA 3K4CA 2O3FA 3REOA 3I5UA 1RIOH 4IO9F 4BYYA 3JRHA 2KLOA 4IVNA 2QWWA 4E7ZA 2D2WA 1WH7A 3SFZA 3JRAA 1H9GA 2JRMA 3H5AA 3OYIA 3LQRA 3SXYA 3J81Z 1UHWA 3ZRGA 3IKVA 1JHHA 1UB9A 2K86A 2VOOA 3RTRA 3IH4A 4NB5A 1KYZA 1FLIA 1YFHA 5KHDA 2Y31A 3FXMA 2H6BA 5H2FC 3J7AO 1KONA 1MBFA 2NVUB 1KQ9A 4QTRA 3HG9A 2V7FA 4II3A 4KISA 4J01A 1MMDA 1EKEA 4NNJA 1OKRA 4LG0B 2BXYA 2OAZA 2KRHA 3FF5A 2GXGA 3VYSB 4C2TA 2R7VA 4JQFA 4KJZA 5J3LA 1ETQA 3LSJA 4C3IJ 5D5UB 4XMYA 1QPMA 3K6GA 5FLXZ 2Q1ZB 1FP2A 2OZUA 3BZ6A 2HQNA 2FX0A 1O7LA 3FXJA 3F23A 2L9RA 5HDNA 2IGKA 1FPQA 4LGWA 4LB5A 1TW2A 1Y56A 3ZMSA 4B48A 1FOXA 3H3ZA 3K1PA 2TDXA 4UVCA 2DPUA 5E17F 4IKFA 2ZXIA 5BS6A 3FDYA 3S1NJ 3CF2A 3CMYA 2F5FA 3H92A 1GVDA 3A01A 2IS1A 2HTSA 2H8RA 1EJ9A 3FX3A 2Z3YA 2M7AA 5L3DA 3K4KA 2K02A 3CZ6A 5CJ9A 5FGMA 2QQBA 3KEYA 3GCMA 1USTA 2CV2A 2EV6A 2UV1A 4DZJA 1HDDC 1YRNA 4Z6YA 1EH6A 1IV8A 2AQEA 2JSCA 4W1UA 3AG4H 4WXDA 4EM1A 2BEOA 3JCUC 2JUCA 3RJPA 1T8IA 5K7ZA 1ZR2A 2E34A 5E79C 3RKWA 2GXAA 3ML6A 3KP2A 5EJCA 3DCFA 4IHVA 1P6RA 3D5RC 1J09A 2KFDA 1BN5A 2FBKA 3LWFA 1G59A 1D3YA 2CJJA 4BE2A 1D8KA 4XORA 4ZJZA 4P9FA 1BR4A 3LFUA 2CH0A 3LA2A 1R1VA 2DOAA 2DQLA 1JUSA 4RBOA 3IRRA 2P6SA 1T0FC 3NAUA 3ABMH 1MNMC 4LG0A 3U21A 4F92B 2JK3A 2O6GE 2DMUA 3H5NA 4LITA 2R7DA 3U1DA 2Q8KA 5E8GA 3WHCA 2FXAA 1YLFA 2QKLB 4G7ZF 1JJ8C 5ILSA 4MHGA 3CCSI 4FX0A 3PO3J 3PNTA 2G7UA 2NOGA 2V1UA 4D7MA 4OMYA 1ACIA 4A69C 4YIRX 4EM0B 3JW4A 2E2IJ 1J2XA 1S72I 2UWMA 5CVIA 3ZGKA 5LD2C 5FKLA 3R60A 2ECCA 3RYPA 4ZYDA 2XF6A 2HU9A 1D5VA 3E5QA 4CYCB 4L5IA 5DV5A 4AWXB 2R7WA 4A5MA 4BDYA 4FHTA 2FQ4A 3AG3H 3E6MA 1IO2A 3IWZA 3OSFA 3S1RJ 2HDDA 4A3EJ 4XNFA 2DFHA 5FJ8J 4KYWA 3GW2A 4L0YB 2D1VA 2LF7A 1X1AA 2IVMA 3DTKA 3S2DJ 4JK1X 3CC7I 3DQVC 4PGGA 1GUUA 3FMSA 4N4OB 1T33A 2HQ5A 4XKVA 4CGZA 2LNBA 3QP6A 3G6EI 1BJAA 3CESA 2CW0F 4F93B 3GTJJ 1WJFA 1QZYA 3DWLE 3BPXA 4CCOA 2ZCWA 4A3FJ 1ZREA 3OYNA 3J80Z 2OD5A 1BR1A 3SFIA 3GTMJ 4BU2A 1MBEA 1MMGA 1HCRA 4L9TA 2CGPA 1LNWA 2Q2EB 1VQPI 3U1KA 2EQRA 1HLVA 3B02A 4BQAA 3H0GJ 2XHKA 3GFMA 4M9ZA 5IPAA 2ZFWA 1SMYF 2X1CA 3SZTA 3QOPA 1Q1VA 3IAS2 4EMSA 5BNGA 2E7XA 1IN7A 3BCAA 1D8JA 5CKTA 3G3ZA 2CV1A 3OYEA 5D8KB 3HSEA 4PJJA 1ZG5A 1S6LA 1Y8QB 2O0YA 1TLHB 2R7OA 4AIJA 4WX9A 1WRJA 3N4MA 4Y17A 1YX5A 3FISA 2DMTA 4CYCA 2LSOA 1Y6IA 1IF1A 1YW9A 1FMWA 3NWTA 3LSRA 4A3JJ 5A2QK 4RAYA 4XIDA 3ZQLA 3JR9A 3GEZA 4I0BA 4YIFA 1HKTA 2QBYA 2FSWA 2G0EA 5J1UA 4AVZA 1AA7A 1RR7A 3RYRA 1X2NA 2HI3A 5ICCA 2M30A 4LJZF 2Y75A 2IEKA 2VQGA 2Y69H 5C3EJ 2LY9A 2HGCA 2K9QA 4XQFA 3ECOA 1SAXA 1HBXG 1R5ID 4PSXA 5FD5A 2NNYA 3I64A 1JKQC 1BBYA 1JJ6C 4ZTFA 3OL4A 2Q2EA 5JI6A 5E3OA 3DBRB 1FSHA 3BJOA 3O6BB 2O5RA 4PZJA 2D1HA 2PMZA 2ACJA 1FOKA 2FF4A 3G2BA 2LLKA 2ISYA 3GLLA 3F22A 1NH3A 2CV0A 2R5ZA 5EG0B 2GOMA 3OYMA 4BBSJ 2CRGA 2DT7B 3R6SA 4B1RA 5JLWA 1SD5A 4GGGA 5B1AH 5L3FA 4IOCF 3CUQC 1DGWY 1AHDP 2DTZA 4F52A 2QA4I 1FC3A 2CUFA 2Z1DA 1IUYA 2L9SA 3O2PE 1B6AA 3BDDA 1XMKA 1RRJA 2Z33A 5EEGA 1HDPA 1I3AA 1QQIA 3E6BA 1BI0A 2Z5UA 5EEHA 2LOOA 2VKHA 4AIHA 1R1UA 5CVUA 3OMYA 1I27A 1RESA 1WWXA 2R3SA 3CCRI 3K4JA 1OMIA 2DCEA 5E1XA 1RR8C 3CCQI 3D5LA 2K5CA 5IT3A 2FE3A 1ETVA 4IRIA 2VBWA 3OS2A 4EJTA 3OR1C 3W6JB 3OYDA 5LGTA 3LSHA 4MTEA 4CO8A 5K7FA 3JRFA 4A3DJ 1ETOA 1GV5A 2IT0A 3KZYA 1W5SA 4UVBA 3GFIA 3N97A 2YPRA 4BXUA 3NQOA 1FT9A 2UXXA 2V79A 3GX4X 1HSTA 3GLXA 3HHHA 2H1LA 3U9GA 2BV6A 2BVLA 4I6ZA 2F6CA 4R1HA 1KYWA 4HDUA 1WCMJ 3G1LA 3J7YJ 2LG4A 2W48A 3ELKA 1X1CA 3PQJA 3HSFA 3F21A 3W6KB 3ULQB 3RPUD 2HR3A 3CC2I 1I50J 1K79A 3H5RA 1ZGAA 5M5YJ 1RUNA 3BR3A 1ZRFA 3SDBA 5DDGA 4HLYA 4I76A 5JHUA 2ME0A 2K7LA 5FKOA 4BQNA 1K4SA 3H3VK 3WU1B 3ZXSA 3OYCA 1ZKGA 1W0UA 2M3AA 4HPQA 3DFGA 3L2RA 1R49A 5TGTA 1Z91A 2MH9A 1IC8A 3NEUA 3CO7C 1WJ5A 4UB8C 2NNNA 1ZGWA 3FBNB 4CXFA 2DA4A 1VQ5I 4TV7A 2BW3A 4B43A 3HGGA 2X51A 2BXZA 3O8HA 2F5DA 2Y9YA 4LG3A 3MKYB 2VL8A 1IZ1A 1X3ZB 4GO1A 2HTJA 2IS6A 3K2AA 3CP8A 2KIUA 1FYMA 4KFCA 2CUZA 1LUJB 4XRFA 2UZKA 4E6KG 1CGPA 1UMQA 1R22A 2EIKH 5AONA 1XG1A 5ILVA 1X4PA 3M7GA 4BKXA 4IOAF 2X6OA 4M3FA 1IUFA 4UUSB 3CCLI 4UXNA 2EH3A 1YS7A 2F48A 2GIVA 5EF6A 3WG9A 1LQ1A 4D1QA 3KP6A 3S8PA 5J4YA 4L18B 2HEOA 1P92A 3K2ZA 4U7BA 2MD5A 2DTRA 4XR6A 1F9NA 2B9SA 2VC0A 1YJWI 3F3XA 5ILUA 2QGUA 3D5SC 2A6EF 2Z16A 1U9NA 3D0SA 2R7ZJ 2WADA 1WVRA 3N05A 5IOYA 2F4OB 3BZCA 1QZZA 1X58A 2E7WA 4S0HB 2JA6J 5FFXA 3QPHA 2BY3A 5BOXA 3CCEI 4E7IA 4BXXJ 3P5JA 3LAJA 4W97A 2H6CA 1D1BA 2ELHA 2FUG2 3HYIA 1YIJI 2VONA 3PNYA 1YW8A 3CCUI 2KIQA 1AOYA 1D0ZA 3CLOA 3S3NA 4BY1J 5B3SH 3HIFA 1FOWA 4BE1A 3BZKA 4WXHA 4EM2A 2R93J 1HOMA 4IQJA 3H35A 2E1MC 1QNTA 4KIBA 2P7VB 1GT0C 1ZH5A 4RDUA 1Y1VJ 1IN5A 4AC0A 4ENNA 2VQHA 2CQ7A 4Y15A 1LFUP 2V1XA 3H9GA 2KPMA 5BMZA 4O5VA 2MC3A 2IA1A 1Z21A 1IDYA 3CF5F 4UUSA 1LKXA 4M72A 2KQRA 3BPVA 1KU3A 2ID3A 4B3XA 2HOSA 4UHTA 3A03A 5M5WJ 2OQRA 3WGHA 3SEZA 1E3PA 4Q48A 2VE9A 1K7AA 1MMSA 1E2XA 1F5TA 4A3KJ 3MKWB 1HSJA 3RQ4A 1HKQA 2ADUA 3L9FA 2Z9OA 1BL0A 3ZQGA 4HSTA 1U2WA 5K5QA 1N25A 4EJVA 2OV7A 2NXNB 1KGSA 2P4WA 2M45A 4L5EA 5GPAA 2KJCA 2CQKA 2MLKA 3QP5A 3GVAA 1DPRA 3ZQQA 1ZR4A 1RZ4A 3C1DA 1VQ6I 1QU3A 1WQ2A 2MH2A 1SD6A 3C7JA 2VXDA 3BTJA 1P7JA 2E19A 2H09A 3TO6A 3ROUA 2M34A 5HOOA 3WTSC 3E97A 2O8KA 3C2GA 4P9UA 3UKGA 3PJRA 1AU7A 3I4PA 5HDGA 5ERIA 2KDOA 1PVEA 2COBA 3PL8A 3ZPLA 1H88C 2GOXB 3CCVI 4DZPA 3KZIC 1XDSA 3M4OJ 3HL2A 4A3IJ 2YX7A 4C2UA 2DA5A 2M7BA 4EGYA 2K27A 1VFCA 2XUBA 4I0AA 3KP7A 2IS4A 3OSGA 2LFBA 3FK7A 1MD0A 3I53A 4MIMA 2NS8A 3BG6A 2M2EA 3BR1A 4BNCA 5EYRA 2WB1A 4D5CA 2DFFA 5E3MA 2H1KA 2K4JA 4PGHA 4YFNF 2FU4A 1E3HA 2F5VA 3WTUC 5K1YA 3KP4A 3FK6A 3L2UA 2KIFA 3TBIA 4CSWA 3Q0VA 4XN0A 1BC8C 1YJNI 5CQGA 3I0TA 2XROA 4PJ0C 2QQ8A 1QVTA 3DKXA 3F0CA 4F55A 1YS6A 5D6EA 2RQPA 1MDMB 3AG1H 2HPMA 1JXSA 1QBJA 5BPDA 2BYVE 2IP2A 4EV0A 4B47A 1N77A 5CVVA 3V7RA 4I01A 3HGYA 4BAYA 3AAFA 3CJQB 1FBSA 2X4HA 2EINH 3UNGC 2L0KA 5IOZA 2W84A 2STTA 1FNNA 3ZQIA 1TP4A 1UCRA 1ZARA 1RETA 1XGOA 1V5FA 2ZSIB 1XS9A 4L0ZB 5HLTA 5IYBJ 1W7PD 1MIJA 1J7KA 1YITI 5J1YA 1ZG1A 2EILH 3HOXJ 5CQEA 2UUZA 2QCOA 3SDGA 3PSIA 3AG2H 2RDPA 1Y0UA 3IH3A 3B6AA 4BQOA 2M4KA 3TW7A 2HOTA 2F4MB 3GUDA 2LH9A 2HYGD 2HKOA 2A07F 2ZXJA 2OF7A 4Y3OA 4ZC3A 2RAEA 4IRHA 4KITB 2H27A 4AD9A 2DDAA 3CQZJ 3NARA 2P5LC 1YJ9I 2CW7A 4DGWB 5JHFA 1ZHFA 3RPQA 1NHAA 4MO7A 2XB5A 3L09A 4CUGA 3E6CC 4OWRB 4GFBA 1TQMA 1R7JA 1E0EA 4U0WA 3IRQA 1L3LA 3L7WA 1SANA 2M87A 3R4KA 4HW0A 5H20A 3KYCB 4LLLA 3EPZA 1K78B 2VJJA 4CICA 4CCNA 4RMNA 4YFXF 1R36A 3P9IA 5LHHA 1OQYA 2IXSA 3GTQJ 2WY7Q 1ZN2A 3RZOJ 2PMZN 1O7FA 1F4KA 2VT2A 1XGMA 1U5TC 5HLHA 2OJED 3H1CA 1BOAA 1G2HA 1YOVB 1WKMA 1X2MA 3WE3A 4BBRJ 5KAFC 1QA6A 2BHYA 1DU6A 5F27A 3GYHX 2YUSA 1PYVA 2P8TA 3TMOA 4QPOA 5ICEA 4R8HA 4M3BA 1V3FA 3B6CA 1QHGA 4MFEA 2VOPA 2A5WA 2BBYA 2O61A 2JA8J 2ZNYA 2K9NA 3E5UA 4Q5SF 4PJMA 2PEXA 2VJ5A 2XKPA 2I10A 2W85A 4EJWA 2HQRA 1QHHD 5D4SA 4XKWA 4P5OA 2CMPA
chains in the Genus database with same CATH topology
1RUOA 4PDKA 3KP3A 2JZYA 3K69A 4U7DA 1KQ8A 2XRNA 4I98B 1B9NA 1OPCA 3F6OA 3KEQA 2PN6A 2DW4A 3HSRA 1K78A 5A2QZ 1BIAA 5D5XB 2DU9A 4UVAA 2XVCA 1Z6RA 1OYIA 1R5HA 3EETA 4KIGA 2XKOA 3QPTA 5JR3A 4DQ2A 3I71A 1CF7B 1P2FA 3V8KA 1I1GA 3FMRA 2L4MA 2A69F 3HOTA 1KA8A 3WTWC 5F1RA 1T2KA 3FXQA 2HS5A 4G6DA 2PFBA 1PP7U 4ENKA 2HKXA 2W57A 2COMA 3BROA 5TJJA 5H6QA 1LDJA 2PJPA 2RNJA 2P5VA 1S29A 3JSPA 2JTVA 1FY7A 3NRVA 2XGXA 5D6FA 2JRTA 3DPLC 3F8FA 2DBBA 2MA3A 4OIRF 3V7CA 1U78A 3PFIA 3TDUC 1FWZA 4HBLA 1G6NA 1CF7A 4L9JA 5K5OA 3MZHA 3TO7A 1Z05A 3VFZA 4IHSA 2V6CA 4I09A 4N9HA 1PP8F 2GA2A 3OV8A 3KZZA 1R23A 3QU6A 5E20A 5L3EA 3F72A 1IXCA 2DT5A 3FMQA 3F6VA 5E8IA 4O6JA 2LDUA 2VT3A 2EFQA 2ZO4A 1IN8A 1GXPA 2XAFA 4HV6A 4MEYF 1I6XA 4R79A 2L01A 2EA4A 2F2EA 2KRFA 4L9NA 1F1ZA 3EQLF 2IPQX 3CDHA 2ZJ2A 2HYFA 4HZFA 5F6FA 1HKSA 1T0FA 2NAZA 2WC2A 2ISZA 1XN7A 3ZMVA 1PUEE 3M9AA 2EV5A 3K0LA 2XAGA 1PDNC 3BJAA 1XB4A 1JHFA 3DP7A 4L5JA 1LDDA 5ICGA 1EV7A 4LLNA 1E17A 2A61A 5L3GA 1LDKB 2Y0MA 5BQTA 1U6GA 1BM9A 3EYYA 3T8RA 1S7OA 4MTDA 1FX7A 1MJAA 3ZMDA 2IW5A 2YX4A 3TO9A 4EQQA 5LHIA 4AVPA 2L54A 3BY6A 1ON2A 4HF2A 2PBIA 4HF1A 3GO5A 3R0JA 4G94A 2FOKA 3JSOA 2QVOA 1IXRC 1VTNC 1MGTA 2C6YA 2F5EA 3GF2A 2J5PA 1YYVA 3CUQB 3ABTA 4CZZA 4EJOA 5LGNA 2VBYA 1ZAOA 3IKTA 5D5VB 3VOEA 4IF4A 2CSOA 1DP7P 3DPTA 1XCBA 3BP8A 3V8LA 3WGIA 5DCFA 5CVJA 4KT5C 2ETHA 4P96A 4U88A 1YG2A 5HDKA 4N9IA 4OIOF 3HOSA 2CG4A 2VE8A 4LK1F 5DD4A 2K4BA 2YSRA 1BI3A 5KK1A 2CFXA 2EFOA 2HZTA 5LBQA 5LHGA 1LEAA 4RS8A 2A68F 3FWEA 4BHBA 3CUQA 4ENJA 3ZQ7A 3RKXA 3KCCA 2FBHA 3TOAA 3ZP5A 1XDUA 3C18A 3I58A 5AIQA 4U0VA 3CUOA 3EYIA 4QWQA 3L2CA 1J9IA 2OQGA 1IXSB 3MFKA 3JTHA 1YIOA 1KU9A 5JVTA 2VXZA 5DUIA 5J6XA 3P7NA 1XD7A 3PQKA 5ED4A 1IW7F 4Q4ZF 4ESBA 3MWMA 5KVRA 2NRAC 1T6SA 3FXUA 5E18F 3RI4A 1XMAA 2GQQA 1SFEA 1GVJA 2ZBKA 1ODDA 1OYYA 4IHTA 1Z1DA 3ERED 2IA2A 3ZMUA 3KFWX 2QZ8A 1BI1A 4E70A 1EH7A 2EK5A 4RB3C 2WWYA 2Y48A 3MQ0A 1UFMA 1ZLKA 1TBXA 4HX7A 1U8RA 4M9XA 4OOIA 1QO0D 1O3SA 1FBQA 1Z6TA 2A3SA 2GAUA 3TQNA 4PCQA 4AIKA 4OIPF 2L3DA 1XSVA 3L00A 5DEQA 5FB2A 1YW7A 1C0WA 4CHUA 4U0YA 2DO7A 5L3CA 3VEPA 2P6TA 4A6EA 1Z7UA 3ZN0A 3MCZA 1IN6A 1FYKA 4H0EA 2AXLA 3GFLA 2OU2A 2DLLA 1R00A 3U2RA 3RPUA 4GYIA 5CYVA 4D0PA 1IRGA 3K9TA 1Q1HA 3V8JA 2XV4S 4RAZA 4UUVA 3TGNA 2HDCA 4XBFA 1TQIA 1GXQA 2CWEA 2M8EA 5HS9A 4HA8A 4WXCA 3E6DA 2M5WA 3F8MA 3DEUA 3BJ6A 5FO5A 5LEKA 1XCVA 4A12A 2A6HF 1SD4A 4OMZA 4ZZLA 1L0OC 4I2OA 5F64A 2GXBA 4KMUX 4M6YA 1XSDA 4Z2YA 2NS0A 1W4MA 2VBZA 1FP1D 4HYEA 3SQNA 2D45A 2PI0A 3IC7A 2RN7A 1JE8A 3K1MA 2YU3A 4IXAA 1MJBA 1H0MA 2G9WA 4Q47A 2EJRA 1HW2A 3T8TA 2EA2A 1HXDA 1T38A 4XSZF 3GWZA 5FFZA 4EVIA 1B1BA 3T1BA 3TKYA 2VN2A 4IRGA 4XSXF 3P9CA 2A5YB 1P4WA 2B0LA 3JAMK 2GWRA 2Q0OA 3HRSA 1MDMA 1GHCA 4MEXF 4M6XA 2Z99A 4A0YA 2PMUA 1IRFA 1U3EM 2EFWA 4BHPA 4DNCA 3ISPA 4N0BA 4ZYHA 3HRTA 4OIQF 1G3TA 4YIIA 4HX8A 1HW1A 4KDPA 1LEBA 5CVRA 3B73A 4JBAA 1YQAA 1SMTA 5JFRA 4HAMA 2O03A 3QU3A 4LB6B 1FSEA 2X0LA 3WTXC 2DQRA 1BIBA 3WTTC 5LRSA 1W5TA 1J59A 4M74A 3FHZA 3FZVA 5E1WA 3LSTA 3C3WA 3SZPA 1FBUA 4LFUA 1LB2A 2GZWA 5L3BA 3WTZA 1B9MA 2KKOA 2KJBA 2RC4A 1U5TB 3LQQA 1IAWA 1W7PB 3Q5FA 2FNPA 2CO5A 1MKMA 1TNSA 2BE5F 2RV8A 4RGSA 2XASA 3O3KA 1UHMA 4G6QA 5HLIA 2RGVA 4CYDA 2W24A 5FD6A 5H6RA 3P9KA 5LLQA 1I5ZA 5D8LB 2DK8A 2EWNA 4BH9A 1RNLA 5TRDA 5HS7A 4MQ9F 2L02A 3GZ6A 1T98A 1ON1A 4MNUA 1O3TA 2VBXA 3GXOA 3S2WA 5LGUA 4FX4A 2GA1A 3F8CA 3GZ5A 2DFIA 4UV9A 4ENMA 1XSXA 3KLOA 1U5TA 4HV5A 2H94A 2HOEA 4G7HF 1W7PA 2E1CA 1TNTA 1R1TA 5IT9K 3E5XA 3Q9VA 2VC1A 2QQAA 2PLYA 3ABUA 3BWGA 5CLSA 1A04A 3FM3A 2XAJA 5HVQC 3VB2A 2NYXA 2RKHA 3CO6C 1DDNA 4ASNA 2XAHA 3WTYC 3IWFA 2QBYB 3CTAA 3DV8A 3J81K 3WU0A 5DCMB 3WE2A 1MZBA 1ZLJA 1Z9CA 5LRRA 2FQ3A 1S7AA 4EJUA 2DPDA 3ZN1A 4LK0F 3DXJF 4HF0A 4HQMA 4RB1A 4GXOA 4K2EA 3T5XA 1OYWA 5BPIA 4B09A 4IPAA 3TOBA 4S04A 4UV8A 5FLXK 1B59A 2FBIA 3V4GA 4FT8A 4WCGA 2LKPA 2AS5F 3K1NA 1SFXA 1R5GA 3OOPA 5D5WB 4KIFA 4NQWA 1I1SA 1S8NA 3IL2A 4I02A 4KN4X 4CDGA 5DCMA 3F8BA 4KNYA 2FRHA 3KP5A 2M1BA 2OA4A 1DPUA 4QLCU 1SD7A 1ZGJA 5AIPA 2IA0A 2PG4A 4LMYA 3QRFF 1QGPA 1DUXC 1G3SA 5J8FA 2CYYA 2V9VA 1G3WA 2ZNZA 5ICFA 4KICA 1KQ0A 1J5YA 3M8EA 4XLPF 4ESFA 3FXRA 2HWVA 1AWCA 4G9YA 1XGNA 2FEZA 1MJ9A 4ZZDA 1X3UA 3VODA 3ZMZA 2DK5A 1G3YA 1SFUA 4YFKF 1LJ9A 4KMFA 1J75A 2UXNA 4ZYGA 1ONVA 2IJLA 3J80K 4A0XA 4HX4A 3KLNA 4EGZA 1ULYA 3EDPA 3HTUA 4OU0A 3IHUA 3HTSB 2FA5A 2P5KA 4KA4A 1REPC 1OR7A 4XLNF 3RIRA 1WSUA 4GYGA 2KIMA 3HRUA 4M9SA 2V1DA 1KU2A 4MQVA 2O8XA 2BGCA 3COAC 1JGSA 3MEXA 5HLGA 2JPCA 3FM5A 1LVAA 4A6DA 3KETA 2QYOA 4G7OF 3F8NA 2QUFA 1USSA 3G73A 1YO5C 2MLGA 1HQCA 2ZMEB 4P55A 4A0ZA 4M73A 3HHGA 2MBFA 4B8XA 5HS8A 1H9TA 2WTEA 2FMYA 3LA7A 4IJAA 1BC7C 2J5OA 1TQPA 3MZYA 6PAXA 1EH8A 1HW5A 2XAQA 3R0AA 4RB2C 2F5CA 3TDZC 2RVCA 3WTVC 4ETSA 4HDVA 2FMLA 1J0RA 5E1ZB 4HOBA 2IRFG 4HLXA 3SHFA 3WODF 3DKWA 2JPBA 3LAPA 1P4XA 2QQ9A 1YTYA 4ON0A 1XGSA 4ZH4F 2ZMEA 3I59B 1P4AA 2EFNA 2E1NA 2JT1A 3KE2A 2L4AA 4M71A 5DD8A 4YG2F 2STWA 3R61A 3RKYA 4BHCA 4ZYEA 4RB0A 1B4AA 1TW3A 1G4DA 4O3MA 2HFHA 5K5RA 4LLGF 3JAMZ 2ESNA 4WWCA 1R58A 2P7CB 1ZYRF 2QENA 2ESHA 1ZRCA 3LA3A 2EV0A 2PMHA 4RGRA 4NHJA 3HRMA 1BI2A 3KEOA 2LF8A 4KUMA 3LFKA 3CJNA 4Y13A 2VODA 2EFPA 4WK8F 3DF8A 4RGXA 2DAOA 3EUHA 3I59A 2FNAA 4UNOA 3I54A 4MGRA 2ZKZA 2WV0A 2PQ8A 2QM3A 4OINF 1ZG3A 4A5NA 1STZA 2OBPA 4ESJA 3ECHA 1T39A 3T0YA 1O57A 3ZMTA 3JTGA 1S3JA 3MAJA 1K6OA 1IN4A 3H3UA 3M1EA 4WF2A 3E3VA 1WI9A 3WGGA 4LD5A 2XIGA 2G7HA 3RDIA 1ZRDA 2W25A 2DI3A 1KU7A 4KN7X 1O3RA 4A2UA 3GFJA 3Q9SA 4RGUA 3M8FA 2EB7A 2YR2A 5D4RA 3HUGA 4I7HA 4GCVA 2OZ6A 5DYMA 5J8CA 1FYLA 4F7ZA 5DUKA 2QLZA 4G8XA 2R7FA 1TTYA 1V4RA 5LEJA 1RI7A 5IT9Z 3QAHA 4S05A 4L9VA 1FZPB 1O3QA 3BOQA 4HQEA 2O3FA 3REOA 3I5UA 1RIOH 4BYYA 4IVNA 2QWWA 2D2WA 3SFZA 1H9GA 3LQRA 3SXYA 3J81Z 1UHWA 3IKVA 1JHHA 1UB9A 2K86A 2VOOA 3RTRA 4NB5A 1KYZA 1FLIA 1YFHA 3J7AO 2H6BA 1KQ9A 1OKRA 4LG0B 2OAZA 3FF5A 2GXGA 4JQFA 5D5UB 1QPMA 5FLXZ 1FP2A 2OZUA 3BZ6A 2HQNA 1O7LA 3F23A 5HDNA 1FPQA 4LGWA 4LB5A 1TW2A 3ZMSA 3H3ZA 3K1PA 2TDXA 4UVCA 2DPUA 5E17F 5BS6A 2F5FA 3H92A 2HTSA 3FX3A 2Z3YA 5L3DA 2K02A 5CJ9A 5FGMA 2QQBA 1USTA 2EV6A 1EH6A 2JSCA 4WXDA 4EM1A 2BEOA 3RJPA 3RKWA 3ML6A 3KP2A 1P6RA 1BN5A 2FBKA 3LWFA 1D3YA 1D8KA 4P9FA 3LA2A 1R1VA 2DQLA 3IRRA 2P6SA 4LG0A 2O6GE 2R7DA 3U1DA 2Q8KA 5E8GA 2FXAA 1YLFA 4G7ZF 5ILSA 4MHGA 4FX0A 2G7UA 2V1UA 4OMYA 4EM0B 3JW4A 1J2XA 2UWMA 5CVIA 3R60A 3RYPA 4ZYDA 1D5VA 3E5QA 4L5IA 5DV5A 4AWXB 4A5MA 4FHTA 3E6MA 3IWZA 4KYWA 3GW2A 4L0YB 2D1VA 2LF7A 2IVMA 4JK1X 3DQVC 4PGGA 3FMSA 4CGZA 2LNBA 3QP6A 1BJAA 2CW0F 1QZYA 3BPXA 1ZREA 2ZCWA 3J80Z 2OD5A 4L9TA 2CGPA 1LNWA 3B02A 4BQAA 2XHKA 3GFMA 4M9ZA 2ZFWA 1SMYF 3SZTA 3QOPA 4EMSA 2E7XA 1IN7A 1D8JA 3G3ZA 5D8KB 3HSEA 1ZG5A 1S6LA 2O0YA 1TLHB 4AIJA 4WX9A 1WRJA 3N4MA 4Y17A 2LSOA 1IF1A 1YW9A 5A2QK 4RAYA 3GEZA 4I0BA 4YIFA 1HKTA 2QBYA 2FSWA 3RYRA 5ICCA 2M30A 4LJZF 2Y75A 2HGCA 3ECOA 1SAXA 1HBXG 5FD5A 2NNYA 3I64A 1BBYA 2Q2EA 5JI6A 1FSHA 3BJOA 3O6BB 4PZJA 2D1HA 2ACJA 1FOKA 2FF4A 2ISYA 3F22A 3R6SA 1SD5A 4GGGA 5L3FA 3CUQC 1FC3A 1IUYA 3O2PE 1B6AA 3BDDA 1XMKA 2Z33A 5EEGA 3E6BA 1QQIA 1BI0A 2Z5UA 5EEHA 4AIHA 1R1UA 5CVUA 1I27A 2R3SA 1WWXA 1OMIA 5E1XA 3D5LA 5IT3A 2FE3A 4IRIA 2VBWA 4EJTA 3W6JB 5LGTA 4MTEA 4CO8A 2IT0A 3KZYA 1W5SA 4UVBA 3GFIA 3N97A 2YPRA 4BXUA 3NQOA 1FT9A 2UXXA 2V79A 3GX4X 1HSTA 3GLXA 3HHHA 3U9GA 2BV6A 4R1HA 1KYWA 4HDUA 3ELKA 3PQJA 3HSFA 3F21A 3W6KB 3ULQB 2HR3A 1K79A 1ZGAA 1RUNA 1ZRFA 5DDGA 4HLYA 5JHUA 2K7LA 3WU1B 3DFGA 1Z91A 2MH9A 3NEUA 3CO7C 2NNNA 4CXFA 4TV7A 2F5DA 1IZ1A 4GO1A 2HTJA 1FYMA 2KIUA 4KFCA 4XRFA 2UZKA 1CGPA 1R22A 5AONA 5ILVA 3M7GA 4UXNA 1YS7A 2GIVA 3WG9A 1LQ1A 3KP6A 4L18B 2HEOA 1P92A 3K2ZA 4U7BA 2MD5A 2DTRA 1F9NA 2VC0A 3F3XA 5ILUA 2A6EF 3D0SA 1QZZA 2E7WA 5FFXA 3QPHA 5BOXA 3LAJA 2H6CA 2ELHA 3HYIA 2VONA 1YW8A 1AOYA 3CLOA 3HIFA 4WXHA 4EM2A 1QNTA 4KIBA 2P7VB 1ZH5A 1IN5A 4ENNA 4Y15A 2V1XA 5BMZA 4O5VA 2MC3A 2IA1A 4M72A 3BPVA 1KU3A 4UHTA 2OQRA 3WGHA 4Q48A 2VE9A 1K7AA 1E2XA 1F5TA 1HSJA 1HKQA 2ADUA 3L9FA 2Z9OA 1U2WA 5K5QA 4EJVA 1KGSA 2P4WA 2M45A 2KJCA 2CQKA 2MLKA 3QP5A 3GVAA 1DPRA 1RZ4A 3C1DA 1WQ2A 2MH2A 1SD6A 3C7JA 2H09A 3TO6A 3ROUA 5HOOA 3WTSC 3E97A 4P9UA 3I4PA 5HDGA 5ERIA 3ZPLA 1XDSA 2YX7A 4EGYA 2K27A 2XUBA 4I0AA 3KP7A 1MD0A 3I53A 4BNCA 2K4JA 4PGHA 4YFNF 2FU4A 3WTUC 5K1YA 3KP4A 2KIFA 1BC8C 3I0TA 2XROA 1YS6A 5D6EA 2RQPA 1MDMB 1JXSA 1QBJA 5BPDA 2BYVE 2IP2A 4EV0A 5CVVA 3V7RA 4I01A 4BAYA 3AAFA 1FBSA 2X4HA 2W84A 2STTA 1FNNA 1UCRA 1ZARA 1XGOA 4L0ZB 1W7PD 1J7KA 1ZG1A 2RDPA 1Y0UA 3GUDA 2A07F 2HYGD 2HKOA 2ZXJA 4IRHA 2H27A 4AD9A 2P5LC 1ZHFA 3RPQA 1NHAA 3L09A 3E6CC 1TQMA 1R7JA 4U0WA 3IRQA 1L3LA 3L7WA 2M87A 3R4KA 4HW0A 5H20A 4LLLA 1K78B 4CICA 4YFXF 1R36A 3P9IA 5LHHA 1ZN2A 1O7FA 1F4KA 2VT2A 1XGMA 1U5TC 5HLHA 1BOAA 1WKMA 3WE3A 3GYHX 2P8TA 5ICEA 4R8HA 1V3FA 2VOPA 2BBYA 2O61A 2ZNYA 3E5UA 4Q5SF 2PEXA 2XKPA 4EJWA 2W85A 2HQRA 5D4SA 4P5OA 3V7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RUO A;  4PDK A;  3KP3 A;  2JZY A;  3K69 A;  4U7D A;  1KQ8 A;  2XRN A;  4I98 B;  1B9N A;  1OPC A;  3F6O A;  3KEQ A;  2PN6 A;  2DW4 A;  3HSR A;  1K78 A;  5A2Q Z;  1BIA A;  5D5X B;  2DU9 A;  4UVA A;  2XVC A;  1Z6R A;  1OYI A;  1R5H A;  3EET A;  4KIG A;  2XKO A;  3QPT A;  5JR3 A;  4DQ2 A;  3I71 A;  1CF7 B;  1P2F A;  3V8K A;  1I1G A;  3FMR A;  2L4M A;  2A69 F;  3HOT A;  1KA8 A;  3WTW C;  5F1R A;  1T2K A;  3FXQ A;  2HS5 A;  4G6D A;  2PFB A;  1PP7 U;  4ENK A;  2HKX A;  2W57 A;  2COM A;  3BRO A;  5TJJ A;  5H6Q A;  1LDJ A;  2PJP A;  2RNJ A;  2P5V A;  1S29 A;  3JSP A;  2JTV A;  1FY7 A;  3NRV A;  2XGX A;  5D6F A;  2JRT A;  3DPL C;  3F8F A;  2DBB A;  2MA3 A;  4OIR F;  3V7C A;  1U78 A;  3PFI A;  3TDU C;  1FWZ A;  4HBL A;  1G6N A;  1CF7 A;  4L9J A;  5K5O A;  3MZH A;  3TO7 A;  1Z05 A;  3VFZ A;  4IHS A;  2V6C A;  4I09 A;  4N9H A;  1PP8 F;  2GA2 A;  3OV8 A;  3KZZ A;  1R23 A;  3QU6 A;  5E20 A;  5L3E A;  3F72 A;  1IXC A;  2DT5 A;  3FMQ A;  3F6V A;  5E8I A;  4O6J A;  2LDU A;  2VT3 A;  2EFQ A;  2ZO4 A;  1IN8 A;  1GXP A;  2XAF A;  4HV6 A;  4MEY F;  1I6X A;  4R79 A;  2L01 A;  2EA4 A;  2F2E A;  2KRF A;  4L9N A;  1F1Z A;  3EQL F;  2IPQ X;  3CDH A;  2ZJ2 A;  2HYF A;  4HZF A;  5F6F A;  1HKS A;  1T0F A;  2NAZ A;  2WC2 A;  2ISZ A;  1XN7 A;  3ZMV A;  1PUE E;  3M9A A;  2EV5 A;  3K0L A;  2XAG A;  1PDN C;  3BJA A;  1XB4 A;  1JHF A;  3DP7 A;  4L5J A;  1LDD A;  5ICG A;  1EV7 A;  4LLN A;  1E17 A;  2A61 A;  5L3G A;  1LDK B;  2Y0M A;  5BQT A;  1U6G A;  1BM9 A;  3EYY A;  3T8R A;  1S7O A;  4MTD A;  1FX7 A;  1MJA A;  3ZMD A;  2IW5 A;  2YX4 A;  3TO9 A;  4EQQ A;  5LHI A;  4AVP A;  2L54 A;  3BY6 A;  1ON2 A;  4HF2 A;  2PBI A;  4HF1 A;  3GO5 A;  3R0J A;  4G94 A;  2FOK A;  3JSO A;  2QVO A;  1IXR C;  1VTN C;  1MGT A;  2C6Y A;  2F5E A;  3GF2 A;  2J5P A;  1YYV A;  3CUQ B;  3ABT A;  4CZZ A;  4EJO A;  5LGN A;  2VBY A;  1ZAO A;  3IKT A;  5D5V B;  3VOE A;  4IF4 A;  2CSO A;  1DP7 P;  3DPT A;  1XCB A;  3BP8 A;  3V8L A;  3WGI A;  5DCF A;  5CVJ A;  4KT5 C;  2ETH A;  4P96 A;  4U88 A;  1YG2 A;  5HDK A;  4N9I A;  4OIO F;  3HOS A;  2CG4 A;  2VE8 A;  4LK1 F;  5DD4 A;  2K4B A;  2YSR A;  1BI3 A;  5KK1 A;  2CFX A;  2EFO A;  2HZT A;  5LBQ A;  5LHG A;  1LEA A;  4RS8 A;  2A68 F;  3FWE A;  4BHB A;  3CUQ A;  4ENJ A;  3ZQ7 A;  3RKX A;  3KCC A;  2FBH A;  3TOA A;  3ZP5 A;  1XDU A;  3C18 A;  3I58 A;  5AIQ A;  4U0V A;  3CUO A;  3EYI A;  4QWQ A;  3L2C A;  1J9I A;  2OQG A;  1IXS B;  3MFK A;  3JTH A;  1YIO A;  1KU9 A;  5JVT A;  2VXZ A;  5DUI A;  5J6X A;  3P7N A;  1XD7 A;  3PQK A;  5ED4 A;  1IW7 F;  4Q4Z F;  4ESB A;  3MWM A;  5KVR A;  2NRA C;  1T6S A;  3FXU A;  5E18 F;  3RI4 A;  1XMA A;  2GQQ A;  1SFE A;  1GVJ A;  2ZBK A;  1ODD A;  1OYY A;  4IHT A;  1Z1D A;  3ERE D;  2IA2 A;  3ZMU A;  3KFW X;  2QZ8 A;  1BI1 A;  4E70 A;  1EH7 A;  2EK5 A;  4RB3 C;  2WWY A;  2Y48 A;  3MQ0 A;  1UFM A;  1ZLK A;  1TBX A;  4HX7 A;  1U8R A;  4M9X A;  4OOI A;  1QO0 D;  1O3S A;  1FBQ A;  1Z6T A;  2A3S A;  2GAU A;  3TQN A;  4PCQ A;  4AIK A;  4OIP F;  2L3D A;  1XSV A;  3L00 A;  5DEQ A;  5FB2 A;  1YW7 A;  1C0W A;  4CHU A;  4U0Y A;  2DO7 A;  5L3C A;  3VEP A;  2P6T A;  4A6E A;  1Z7U A;  3ZN0 A;  3MCZ A;  1IN6 A;  1FYK A;  4H0E A;  2AXL A;  3GFL A;  2OU2 A;  2DLL A;  1R00 A;  3U2R A;  3RPU A;  4GYI A;  5CYV A;  4D0P A;  1IRG A;  3K9T A;  1Q1H A;  3V8J A;  2XV4 S;  4RAZ A;  4UUV A;  3TGN A;  2HDC A;  4XBF A;  1TQI A;  1GXQ A;  2CWE A;  2M8E A;  5HS9 A;  4HA8 A;  4WXC A;  3E6D A;  2M5W A;  3F8M A;  3DEU A;  3BJ6 A;  5FO5 A;  5LEK A;  1XCV A;  4A12 A;  2A6H F;  1SD4 A;  4OMZ A;  4ZZL A;  1L0O C;  4I2O A;  5F64 A;  2GXB A;  4KMU X;  4M6Y A;  1XSD A;  4Z2Y A;  2NS0 A;  1W4M A;  2VBZ A;  1FP1 D;  4HYE A;  3SQN A;  2D45 A;  2PI0 A;  3IC7 A;  2RN7 A;  1JE8 A;  3K1M A;  2YU3 A;  4IXA A;  1MJB A;  1H0M A;  2G9W A;  4Q47 A;  2EJR A;  1HW2 A;  3T8T A;  2EA2 A;  1HXD A;  1T38 A;  4XSZ F;  3GWZ A;  5FFZ A;  4EVI A;  1B1B A;  3T1B A;  3TKY A;  2VN2 A;  4IRG A;  4XSX F;  3P9C A;  2A5Y B;  1P4W A;  2B0L A;  3JAM K;  2GWR A;  2Q0O A;  3HRS A;  1MDM A;  1GHC A;  4MEX F;  4M6X A;  2Z99 A;  4A0Y A;  2PMU A;  1IRF A;  1U3E M;  2EFW A;  4BHP A;  4DNC A;  3ISP A;  4N0B A;  4ZYH A;  3HRT A;  4OIQ F;  1G3T A;  4YII A;  4HX8 A;  1HW1 A;  4KDP A;  1LEB A;  5CVR A;  3B73 A;  4JBA A;  1YQA A;  1SMT A;  5JFR A;  4HAM A;  2O03 A;  3QU3 A;  4LB6 B;  1FSE A;  2X0L A;  3WTX C;  2DQR A;  1BIB A;  3WTT C;  5LRS A;  1W5T A;  1J59 A;  4M74 A;  3FHZ A;  3FZV A;  5E1W A;  3LST A;  3C3W A;  3SZP A;  1FBU A;  4LFU A;  1LB2 A;  2GZW A;  5L3B A;  3WTZ A;  1B9M A;  2KKO A;  2KJB A;  2RC4 A;  1U5T B;  3LQQ A;  1IAW A;  1W7P B;  3Q5F A;  2FNP A;  2CO5 A;  1MKM A;  1TNS A;  2BE5 F;  2RV8 A;  4RGS A;  2XAS A;  3O3K A;  1UHM A;  4G6Q A;  5HLI A;  2RGV A;  4CYD A;  2W24 A;  5FD6 A;  5H6R A;  3P9K A;  5LLQ A;  1I5Z A;  5D8L B;  2DK8 A;  2EWN A;  4BH9 A;  1RNL A;  5TRD A;  5HS7 A;  4MQ9 F;  2L02 A;  3GZ6 A;  1T98 A;  1ON1 A;  4MNU A;  1O3T A;  2VBX A;  3GXO A;  3S2W A;  5LGU A;  4FX4 A;  2GA1 A;  3F8C A;  3GZ5 A;  2DFI A;  4UV9 A;  4ENM A;  1XSX A;  3KLO A;  1U5T A;  4HV5 A;  2H94 A;  2HOE A;  4G7H F;  1W7P A;  2E1C A;  1TNT A;  1R1T A;  5IT9 K;  3E5X A;  3Q9V A;  2VC1 A;  2QQA A;  2PLY A;  3ABU A;  3BWG A;  5CLS A;  1A04 A;  3FM3 A;  2XAJ A;  5HVQ C;  3VB2 A;  2NYX A;  2RKH A;  3CO6 C;  1DDN A;  4ASN A;  2XAH A;  3WTY C;  3IWF A;  2QBY B;  3CTA A;  3DV8 A;  3J81 K;  3WU0 A;  5DCM B;  3WE2 A;  1MZB A;  1ZLJ A;  1Z9C A;  5LRR A;  2FQ3 A;  1S7A A;  4EJU A;  2DPD A;  3ZN1 A;  4LK0 F;  3DXJ F;  4HF0 A;  4HQM A;  4RB1 A;  4GXO A;  4K2E A;  3T5X A;  1OYW A;  5BPI A;  4B09 A;  4IPA A;  3TOB A;  4S04 A;  4UV8 A;  5FLX K;  1B59 A;  2FBI A;  3V4G A;  4FT8 A;  4WCG A;  2LKP A;  2AS5 F;  3K1N A;  1SFX A;  1R5G A;  3OOP A;  5D5W B;  4KIF A;  4NQW A;  1I1S A;  1S8N A;  3IL2 A;  4I02 A;  4KN4 X;  4CDG A;  5DCM A;  3F8B A;  4KNY A;  2FRH A;  3KP5 A;  2M1B A;  2OA4 A;  1DPU A;  4QLC U;  1SD7 A;  1ZGJ A;  5AIP A;  2IA0 A;  2PG4 A;  4LMY A;  3QRF F;  1QGP A;  1DUX C;  1G3S A;  5J8F A;  2CYY A;  2V9V A;  1G3W A;  2ZNZ A;  5ICF A;  4KIC A;  1KQ0 A;  1J5Y A;  3M8E A;  4XLP F;  4ESF A;  3FXR A;  2HWV A;  1AWC A;  4G9Y A;  1XGN A;  2FEZ A;  1MJ9 A;  4ZZD A;  1X3U A;  3VOD A;  3ZMZ A;  2DK5 A;  1G3Y A;  1SFU A;  4YFK F;  1LJ9 A;  4KMF A;  1J75 A;  2UXN A;  4ZYG A;  1ONV A;  2IJL A;  3J80 K;  4A0X A;  4HX4 A;  3KLN A;  4EGZ A;  1ULY A;  3EDP A;  3HTU A;  4OU0 A;  3IHU A;  3HTS B;  2FA5 A;  2P5K A;  4KA4 A;  1REP C;  1OR7 A;  4XLN F;  3RIR A;  1WSU A;  4GYG A;  2KIM A;  3HRU A;  4M9S A;  2V1D A;  1KU2 A;  4MQV A;  2O8X A;  2BGC A;  3COA C;  1JGS A;  3MEX A;  5HLG A;  2JPC A;  3FM5 A;  1LVA A;  4A6D A;  3KET A;  2QYO A;  4G7O F;  3F8N A;  2QUF A;  1USS A;  3G73 A;  1YO5 C;  2MLG A;  1HQC A;  2ZME B;  4P55 A;  4A0Z A;  4M73 A;  3HHG A;  2MBF A;  4B8X A;  5HS8 A;  1H9T A;  2WTE A;  2FMY A;  3LA7 A;  4IJA A;  1BC7 C;  2J5O A;  1TQP A;  3MZY A;  6PAX A;  1EH8 A;  1HW5 A;  2XAQ A;  3R0A A;  4RB2 C;  2F5C A;  3TDZ C;  2RVC A;  3WTV C;  4ETS A;  4HDV A;  2FML A;  1J0R A;  5E1Z B;  4HOB A;  2IRF G;  4HLX A;  3SHF A;  3WOD F;  3DKW A;  2JPB A;  3LAP A;  1P4X A;  2QQ9 A;  1YTY A;  4ON0 A;  1XGS A;  4ZH4 F;  2ZME A;  3I59 B;  1P4A A;  2EFN A;  2E1N A;  2JT1 A;  3KE2 A;  2L4A A;  4M71 A;  5DD8 A;  4YG2 F;  2STW A;  3R61 A;  3RKY A;  4BHC A;  4ZYE A;  4RB0 A;  1B4A A;  1TW3 A;  1G4D A;  4O3M A;  2HFH A;  5K5R A;  4LLG F;  3JAM Z;  2ESN A;  4WWC A;  1R58 A;  2P7C B;  1ZYR F;  2QEN A;  2ESH A;  1ZRC A;  3LA3 A;  2EV0 A;  2PMH A;  4RGR A;  4NHJ A;  3HRM A;  1BI2 A;  3KEO A;  2LF8 A;  4KUM A;  3LFK A;  3CJN A;  4Y13 A;  2VOD A;  2EFP A;  4WK8 F;  3DF8 A;  4RGX A;  2DAO A;  3EUH A;  3I59 A;  2FNA A;  4UNO A;  3I54 A;  4MGR A;  2ZKZ A;  2WV0 A;  2PQ8 A;  2QM3 A;  4OIN F;  1ZG3 A;  4A5N A;  1STZ A;  2OBP A;  4ESJ A;  3ECH A;  1T39 A;  3T0Y A;  1O57 A;  3ZMT A;  3JTG A;  1S3J A;  3MAJ A;  1K6O A;  1IN4 A;  3H3U A;  3M1E A;  4WF2 A;  3E3V A;  1WI9 A;  3WGG A;  4LD5 A;  2XIG A;  2G7H A;  3RDI A;  1ZRD A;  2W25 A;  2DI3 A;  1KU7 A;  4KN7 X;  1O3R A;  4A2U A;  3GFJ A;  3Q9S A;  4RGU A;  3M8F A;  2EB7 A;  2YR2 A;  5D4R A;  3HUG A;  4I7H A;  4GCV A;  2OZ6 A;  5DYM A;  5J8C A;  1FYL A;  4F7Z A;  5DUK A;  2QLZ A;  4G8X A;  2R7F A;  1TTY A;  1V4R A;  5LEJ A;  1RI7 A;  5IT9 Z;  3QAH A;  4S05 A;  4L9V A;  1FZP B;  1O3Q A;  3BOQ A;  4HQE A;  2O3F A;  3REO A;  3I5U A;  1RIO H;  4BYY A;  4IVN A;  2QWW A;  2D2W A;  3SFZ A;  1H9G A;  3LQR A;  3SXY A;  3J81 Z;  1UHW A;  3IKV A;  1JHH A;  1UB9 A;  2K86 A;  2VOO A;  3RTR A;  4NB5 A;  1KYZ A;  1FLI A;  1YFH A;  3J7A O;  2H6B A;  1KQ9 A;  1OKR A;  4LG0 B;  2OAZ A;  3FF5 A;  2GXG A;  4JQF A;  5D5U B;  1QPM A;  5FLX Z;  1FP2 A;  2OZU A;  3BZ6 A;  2HQN A;  1O7L A;  3F23 A;  5HDN A;  1FPQ A;  4LGW A;  4LB5 A;  1TW2 A;  3ZMS A;  3H3Z A;  3K1P A;  2TDX A;  4UVC A;  2DPU A;  5E17 F;  5BS6 A;  2F5F A;  3H92 A;  2HTS A;  3FX3 A;  2Z3Y A;  5L3D A;  2K02 A;  5CJ9 A;  5FGM A;  2QQB A;  1UST A;  2EV6 A;  1EH6 A;  2JSC A;  4WXD A;  4EM1 A;  2BEO A;  3RJP A;  3RKW A;  3ML6 A;  3KP2 A;  1P6R A;  1BN5 A;  2FBK A;  3LWF A;  1D3Y A;  1D8K A;  4P9F A;  3LA2 A;  1R1V A;  2DQL A;  3IRR A;  2P6S A;  4LG0 A;  2O6G E;  2R7D A;  3U1D A;  2Q8K A;  5E8G A;  2FXA A;  1YLF A;  4G7Z F;  5ILS A;  4MHG A;  4FX0 A;  2G7U A;  2V1U A;  4OMY A;  4EM0 B;  3JW4 A;  1J2X A;  2UWM A;  5CVI A;  3R60 A;  3RYP A;  4ZYD A;  1D5V A;  3E5Q A;  4L5I A;  5DV5 A;  4AWX B;  4A5M A;  4FHT A;  3E6M A;  3IWZ A;  4KYW A;  3GW2 A;  4L0Y B;  2D1V A;  2LF7 A;  2IVM A;  4JK1 X;  3DQV C;  4PGG A;  3FMS A;  4CGZ A;  2LNB A;  3QP6 A;  1BJA A;  2CW0 F;  1QZY A;  3BPX A;  1ZRE A;  2ZCW A;  3J80 Z;  2OD5 A;  4L9T A;  2CGP A;  1LNW A;  3B02 A;  4BQA A;  2XHK A;  3GFM A;  4M9Z A;  2ZFW A;  1SMY F;  3SZT A;  3QOP A;  4EMS A;  2E7X A;  1IN7 A;  1D8J A;  3G3Z A;  5D8K B;  3HSE A;  1ZG5 A;  1S6L A;  2O0Y A;  1TLH B;  4AIJ A;  4WX9 A;  1WRJ A;  3N4M A;  4Y17 A;  2LSO A;  1IF1 A;  1YW9 A;  5A2Q K;  4RAY A;  3GEZ A;  4I0B A;  4YIF A;  1HKT A;  2QBY A;  2FSW A;  3RYR A;  5ICC A;  2M30 A;  4LJZ F;  2Y75 A;  2HGC A;  3ECO A;  1SAX A;  1HBX G;  5FD5 A;  2NNY A;  3I64 A;  1BBY A;  2Q2E A;  5JI6 A;  1FSH A;  3BJO A;  3O6B B;  4PZJ A;  2D1H A;  2ACJ A;  1FOK A;  2FF4 A;  2ISY A;  3F22 A;  3R6S A;  1SD5 A;  4GGG A;  5L3F A;  3CUQ C;  1FC3 A;  1IUY A;  3O2P E;  1B6A A;  3BDD A;  1XMK A;  2Z33 A;  5EEG A;  3E6B A;  1QQI A;  1BI0 A;  2Z5U A;  5EEH A;  4AIH A;  1R1U A;  5CVU A;  1I27 A;  2R3S A;  1WWX A;  1OMI A;  5E1X A;  3D5L A;  5IT3 A;  2FE3 A;  4IRI A;  2VBW A;  4EJT A;  3W6J B;  5LGT A;  4MTE A;  4CO8 A;  2IT0 A;  3KZY A;  1W5S A;  4UVB A;  3GFI A;  3N97 A;  2YPR A;  4BXU A;  3NQO A;  1FT9 A;  2UXX A;  2V79 A;  3GX4 X;  1HST A;  3GLX A;  3HHH A;  3U9G A;  2BV6 A;  4R1H A;  1KYW A;  4HDU A;  3ELK A;  3PQJ A;  3HSF A;  3F21 A;  3W6K B;  3ULQ B;  2HR3 A;  1K79 A;  1ZGA A;  1RUN A;  1ZRF A;  5DDG A;  4HLY A;  5JHU A;  2K7L A;  3WU1 B;  3DFG A;  1Z91 A;  2MH9 A;  3NEU A;  3CO7 C;  2NNN A;  4CXF A;  4TV7 A;  2F5D A;  1IZ1 A;  4GO1 A;  2HTJ A;  1FYM A;  2KIU A;  4KFC A;  4XRF A;  2UZK A;  1CGP A;  1R22 A;  5AON A;  5ILV A;  3M7G A;  4UXN A;  1YS7 A;  2GIV A;  3WG9 A;  1LQ1 A;  3KP6 A;  4L18 B;  2HEO A;  1P92 A;  3K2Z A;  4U7B A;  2MD5 A;  2DTR A;  1F9N A;  2VC0 A;  3F3X A;  5ILU A;  2A6E F;  3D0S A;  1QZZ A;  2E7W A;  5FFX A;  3QPH A;  5BOX A;  3LAJ A;  2H6C A;  2ELH A;  3HYI A;  2VON A;  1YW8 A;  1AOY A;  3CLO A;  3HIF A;  4WXH A;  4EM2 A;  1QNT A;  4KIB A;  2P7V B;  1ZH5 A;  1IN5 A;  4ENN A;  4Y15 A;  2V1X A;  5BMZ A;  4O5V A;  2MC3 A;  2IA1 A;  4M72 A;  3BPV A;  1KU3 A;  4UHT A;  2OQR A;  3WGH A;  4Q48 A;  2VE9 A;  1K7A A;  1E2X A;  1F5T A;  1HSJ A;  1HKQ A;  2ADU A;  3L9F A;  2Z9O A;  1U2W A;  5K5Q A;  4EJV A;  1KGS A;  2P4W A;  2M45 A;  2KJC A;  2CQK A;  2MLK A;  3QP5 A;  3GVA A;  1DPR A;  1RZ4 A;  3C1D A;  1WQ2 A;  2MH2 A;  1SD6 A;  3C7J A;  2H09 A;  3TO6 A;  3ROU A;  5HOO A;  3WTS C;  3E97 A;  4P9U A;  3I4P A;  5HDG A;  5ERI A;  3ZPL A;  1XDS A;  2YX7 A;  4EGY A;  2K27 A;  2XUB A;  4I0A A;  3KP7 A;  1MD0 A;  3I53 A;  4BNC A;  2K4J A;  4PGH A;  4YFN F;  2FU4 A;  3WTU C;  5K1Y A;  3KP4 A;  2KIF A;  1BC8 C;  3I0T A;  2XRO A;  1YS6 A;  5D6E A;  2RQP A;  1MDM B;  1JXS A;  1QBJ A;  5BPD A;  2BYV E;  2IP2 A;  4EV0 A;  5CVV A;  3V7R A;  4I01 A;  4BAY A;  3AAF A;  1FBS A;  2X4H A;  2W84 A;  2STT A;  1FNN A;  1UCR A;  1ZAR A;  1XGO A;  4L0Z B;  1W7P D;  1J7K A;  1ZG1 A;  2RDP A;  1Y0U A;  3GUD A;  2A07 F;  2HYG D;  2HKO A;  2ZXJ A;  4IRH A;  2H27 A;  4AD9 A;  2P5L C;  1ZHF A;  3RPQ A;  1NHA A;  3L09 A;  3E6C C;  1TQM A;  1R7J A;  4U0W A;  3IRQ A;  1L3L A;  3L7W A;  2M87 A;  3R4K A;  4HW0 A;  5H20 A;  4LLL A;  1K78 B;  4CIC A;  4YFX F;  1R36 A;  3P9I A;  5LHH A;  1ZN2 A;  1O7F A;  1F4K A;  2VT2 A;  1XGM A;  1U5T C;  5HLH A;  1BOA A;  1WKM A;  3WE3 A;  3GYH X;  2P8T A;  5ICE A;  4R8H A;  1V3F A;  2VOP A;  2BBY A;  2O61 A;  2ZNY A;  3E5U A;  4Q5S F;  2PEX A;  2XKP A;  4EJW A;  2W85 A;  2HQR A;  5D4S A;  4P5O A;  3V7S A; 
#chains in the Genus database with same CATH topology
 3FXO A;  1RUO A;  5GAD J;  1R71 A;  2QF7 A;  4PDK A;  5F08 A;  3KP3 A;  3PNV A;  3S1Q J;  5IP9 J;  5FRN A;  1TT5 B;  2JZY A;  2M9H A;  4LOC A;  3K69 A;  5TIS C;  1OLT A;  4U7D A;  3A02 A;  1KQ8 A;  2XRN A;  4I98 B;  1B9N A;  3S93 A;  1OPC A;  3F6O A;  3KEQ A;  4DYQ A;  5HOD A;  2PN6 A;  1ETX A;  2HXI A;  2DW4 A;  3HSR A;  4E7K A;  2R5Y B;  1K78 A;  1Y8R B;  2AXT C;  2KZG A;  5HNH A;  1IV6 A;  3HJE A;  4E4H A;  5A2Q Z;  1BIA A;  3TL4 X;  5D5X B;  2DU9 A;  4UVA A;  2XVC A;  1Z6R A;  3QWL A;  1OYI A;  2M8G X;  1R5H A;  2X1D A;  1ORK A;  2VAS A;  2BY0 A;  1Z67 A;  2VPR A;  4XLF A;  3EET A;  4A93 J;  4KIG A;  2XKO A;  2JQ7 A;  3I4N J;  3QPT A;  5JR3 A;  1OCO H;  4DQ2 A;  5DM6 F;  3I71 A;  4AM3 A;  1CF7 B;  1P2F A;  3V8K A;  1JUP A;  1I1G A;  3FMR A;  1W5C C;  2L4M A;  3I3L A;  3L2Q A;  2A69 F;  1VQO I;  3HOT A;  3A0H C;  1KA8 A;  1UJ8 A;  1X1B A;  3WTW C;  5F1R A;  5F1J A;  1T2K A;  4X1E A;  1K6Y A;  1BOB A;  3FXQ A;  1OIS A;  3PFY A;  3GME A;  2DOF A;  2HS5 A;  4G6D A;  2B7E A;  2XPW A;  2PFB A;  1PP7 U;  2K85 A;  4ENK A;  2E5Z A;  2HKX A;  2JSP A;  1LFP A;  2OCC H;  4PJN A;  2W57 A;  4QIW N;  2COM A;  3BRO A;  1H8A C;  5TJJ A;  5GTI C;  1N78 A;  1XC5 A;  3DLA A;  3GZN B;  1DU0 A;  2R92 J;  5H6Q A;  2HZD A;  4YEL A;  1LDJ A;  2EZH A;  1QVU A;  5J40 A;  2PJP A;  2V9K A;  1OCC H;  1X3W B;  2RNJ A;  1S7E A;  2R5Y A;  5EGO B;  4YEJ A;  2P5V A;  1FMV A;  4FE7 A;  1S29 A;  2JTV A;  3JSP A;  1FY7 A;  2CFO A;  3NRV A;  2L7K A;  2XGX A;  4XKB A;  2GM4 A;  5D6F A;  2JRT A;  3DPL C;  1VQ9 I;  3F8F A;  2OUM A;  2ZXH A;  1TZL A;  4D9J A;  2DBB A;  5IP7 J;  2MA3 A;  3GBG A;  4OIR F;  1IJW C;  3V7C A;  1U78 A;  5C4J J;  3PFI A;  1Y1W J;  3TDU C;  1FWZ A;  4HBL A;  2E5N A;  1I6H J;  2DMP A;  1G6N A;  1CF7 A;  3AL0 C;  1IG7 A;  4PJL A;  4L9J A;  5K5O A;  3MZH A;  3TO7 A;  1Z05 A;  3S14 J;  3VFZ A;  4QSH A;  4IHS A;  1OCT C;  2V6C A;  4I09 A;  4OAY A;  4B4C A;  4N9H A;  1PP8 F;  2ZJP F;  2GA2 A;  3OV8 A;  1BR2 A;  4XLE A;  3V42 A;  4GRI A;  4MFD A;  3KZZ A;  1R4N B;  1S5L C;  1R23 A;  3BLY A;  3IUO A;  3QU6 A;  4IL6 C;  5E20 A;  5L3E A;  1T08 B;  3F72 A;  4XLH A;  3HKZ N;  1IXC A;  2CW8 A;  3HC7 A;  2L9N A;  1D5Y A;  1DP3 A;  4NC7 A;  2DT5 A;  4LIV A;  5DM7 F;  4JX4 A;  3FMQ A;  3F6V A;  5E8I A;  4O6J A;  3G1M A;  2QSH X;  4B3A A;  2IS2 A;  2LDU A;  2VT3 A;  2EFQ A;  1A6I A;  2ZO4 A;  2W4S A;  1IN8 A;  1GXP A;  3LSK A;  4C3H J;  3LNQ A;  4OAZ A;  2LY2 A;  3CLQ A;  4RLF A;  2R7R A;  3HOW J;  3DBH B;  1ZK8 A;  2RQQ A;  2XAF A;  4HV6 A;  5EGO A;  4A3C J;  4MEY F;  2X6W A;  1I6X A;  2E2J J;  4R79 A;  2L01 A;  5F0H A;  3PO2 J;  2EA4 A;  3CJT B;  2F2E A;  2KRF A;  1HA8 A;  4L9N A;  1F1Z A;  2AO9 A;  2DA2 A;  1OR7 C;  3EQL F;  2IPQ X;  3CDH A;  4FCY A;  2ZJ2 A;  2HYF A;  4HZF A;  5F6F A;  1HKS A;  1H89 C;  2L2O A;  1T0F A;  2NAZ A;  2K9L A;  3IAM 2;  4XIC A;  2B63 J;  2WC2 A;  2ISZ A;  2ZFU A;  1XN7 A;  3ZMV A;  2LRD A;  1PUE E;  3M9A A;  2EV5 A;  1LFB A;  3K0L A;  4DJA A;  4E7L A;  1MMA A;  3HM5 A;  2XAG A;  4C2M J;  3I56 I;  1PDN C;  3BJA A;  1XB4 A;  1JHF A;  1HC8 A;  3DP7 A;  4BEH B;  1SFK A;  4L5J A;  5E3N A;  3A0B C;  1U9O A;  1LDD A;  1VQN I;  5ICG A;  4IX7 A;  5CPR B;  1POG A;  1N75 A;  3VYT B;  1EV7 A;  3GTP J;  3F9K A;  4JYK A;  4LLN A;  2IBD A;  3OIP A;  1E17 A;  2A61 A;  5FKN A;  4N4N B;  5L3G A;  1Y39 A;  1FTZ A;  4ZDL A;  3HXL A;  1LDK B;  2VIX A;  4M3E A;  3W2A A;  2Y0M A;  3V7S A;  5BQT A;  5GTH C;  1BM9 A;  1U6G A;  5F0C A;  3EYY A;  3T8R A;  1S7O A;  1XX5 A;  1W1W E;  2KT0 A;  1A36 A;  3K4N A;  3OYB A;  4MTD A;  1BW6 A;  1FX7 A;  4XRS A;  4FQG A;  2ID6 A;  1MJA A;  3K7A J;  3MKZ A;  3ZMD A;  2IW5 A;  2YX4 A;  3TO9 A;  4EQQ A;  3CME I;  3OYA A;  4PUS A;  3CCJ I;  5LHI A;  4AVP A;  2L54 A;  3BY6 A;  1ON2 A;  4HF2 A;  1VI0 A;  1YX3 A;  2PBI A;  1LE8 B;  3GO5 A;  3R0J A;  4G94 A;  4HF1 A;  2FOK A;  3JSO A;  2QVO A;  1IXR C;  2WB1 N;  1VTN C;  2JJ7 A;  3ZQH A;  1MGT A;  3BG5 A;  2C6Y A;  2EZK A;  2F5E A;  3GTG J;  3VSL A;  2MD0 A;  3GF2 A;  2XSD C;  2XAU A;  1JKR C;  2NVY J;  1P7I A;  2JMW A;  2D5V A;  2J5P A;  3QYF A;  2LBF B;  2LKS A;  2PX9 A;  1YYV A;  4BEH A;  3CUQ B;  1UHS A;  2MW8 A;  4V2F A;  3ABT A;  5EG0 A;  4CZZ A;  4V2G A;  4EJO A;  5LGN A;  4X6A J;  2VBY A;  2ZME C;  1ZAO A;  4E7H A;  3IKT A;  2ME6 A;  1UZC A;  3ZR8 X;  4BJ5 C;  5D5V B;  2M0C A;  3VOE A;  4IF4 A;  2CSO A;  4JX5 A;  1DP7 P;  3DPT A;  1XCB A;  5GP9 A;  4UUT A;  4RAG A;  3BP8 A;  3V8L A;  3WGI A;  5DCF A;  5CVJ A;  1JGG A;  2LYC A;  4KT5 C;  4ITV A;  4A3M J;  3OWT A;  2ETH A;  4P96 A;  4U88 A;  5IYD J;  3L1P A;  3D1N I;  2K40 A;  4A3G J;  1YG2 A;  5F04 A;  4PK4 A;  5HDK A;  2JWT A;  4N9I A;  4OIO F;  1X1D A;  3KX2 A;  3HOS A;  2BZT A;  2CG4 A;  1KZH A;  3X2Q H;  1ITY A;  1LE8 A;  2W82 A;  1CQT A;  5B1B H;  2VE8 A;  2DT6 A;  4NUB A;  5GAG J;  4LK1 F;  5DD4 A;  2K4B A;  2YSR A;  1BI3 A;  2KIS A;  4Y33 A;  5KK1 A;  5LFA A;  2CFX A;  2EFO A;  5FLV A;  2HZT A;  2IAI A;  5LBQ A;  2KRC A;  5LHG A;  3FXK A;  1LEA A;  2LBF A;  4RS8 A;  2A68 F;  3FWE A;  4BHB A;  1B72 B;  4RAF A;  3CUQ A;  4ENJ A;  3E7L A;  3ZQ7 A;  3DKY A;  1TT0 A;  2LTP A;  3RKX A;  1WJE A;  3KCC A;  2FBH A;  3BT9 A;  3OYJ A;  2VUM J;  3EUH C;  2V26 A;  3TOA A;  3ZP5 A;  4AYB N;  2R4G A;  2E71 A;  3KPH A;  3FXL A;  3A1Y A;  1XDU A;  3C18 A;  3I58 A;  5AIQ A;  3JRI A;  4U0V A;  3CUO A;  4DBQ A;  3EYI A;  4RA2 A;  3GTL J;  4QWQ A;  3L2C A;  1A6Q A;  4P1W A;  1J9I A;  3W3C A;  3DLL F;  9ANT A;  2OQG A;  2RNG A;  1U0J A;  2V4J C;  2R7Q A;  3Q3S A;  1IXS B;  1WGX A;  3FIW A;  3MFK A;  2A6T A;  3A2K A;  1V55 H;  3HKZ A;  1WJB A;  1KU9 A;  1YIO A;  3BC8 A;  3JTH A;  2KHM A;  5JVT A;  4M3G A;  2VXZ A;  3QOD A;  5K7H A;  5DUI A;  5J6X A;  3JRE A;  3M3Y J;  3P7N A;  1XD7 A;  3PQK A;  5ED4 A;  1X4O A;  3MVP A;  4XKC A;  1IW7 F;  2WV1 A;  4Q4Z F;  2AQF A;  4ESB A;  3MWM A;  5KVR A;  2NRA C;  1T6S A;  3FXU A;  2Y0S A;  4MLO A;  1X1P A;  5E18 F;  1XMA A;  3RI4 A;  2DXI A;  2GQQ A;  1SFE A;  3DBL B;  4F91 B;  1GVJ A;  2ZBK A;  4IEJ A;  3QPL A;  1ODD A;  2DJN A;  2LKX A;  1SEU A;  1OYY A;  4IHT A;  1TWA J;  1Z1D A;  3QYB A;  5GPC A;  3ERE D;  2IA2 A;  3ZMU A;  1B72 A;  3KFW X;  3HOZ J;  2QZ8 A;  3VYU B;  2ZSH B;  3W6V A;  1ENH A;  1BI1 A;  4E70 A;  1EH7 A;  3LOC A;  2EK5 A;  4RB3 C;  4D7N A;  2Y48 A;  3MQ0 A;  2WWY A;  4BAC A;  1UFM A;  1ZLK A;  1TBX A;  4HX7 A;  1U8R A;  4M9X A;  4OOI A;  1A31 A;  1QO0 D;  1DQU A;  2EBI A;  2XF7 A;  3OYF A;  1UG0 A;  2V9P A;  3OL3 A;  1O3S A;  1FBQ A;  1JKP C;  1OCP A;  1Z6T A;  2A3S A;  2GAU A;  3TQN A;  4PCQ A;  4IHX A;  4Y52 J;  4AIK A;  2M4G A;  5EDN A;  4OIP F;  2L3D A;  1MBG A;  1XSV A;  3L00 A;  2W7N A;  5DEQ A;  5FB2 A;  4II2 A;  1UEL B;  2TRT A;  4C3J J;  1JT0 A;  1YW7 A;  1T56 A;  4ANJ A;  1C0W A;  4CHU A;  4U0Y A;  2EPF A;  2DO7 A;  5L3C A;  2XDV A;  4B44 A;  3VEP A;  2P6T A;  3ZQF A;  1Z7U A;  1RKT A;  2E1M B;  4A6E A;  5C4X J;  3ZN0 A;  3MCZ A;  1IN6 A;  4JX6 A;  3BCB A;  1FYK A;  4H0E A;  3FKI J;  4PFO A;  2AXL A;  3GFL A;  3QQA A;  2OU2 A;  2V1N A;  3JRC A;  2DLL A;  1R00 A;  3S32 A;  1BA5 A;  2KDZ A;  3U2R A;  3PSF A;  3RPU A;  4GYI A;  5CYV A;  3OS1 A;  4D0P A;  3CC4 I;  1LVK A;  1IRG A;  2KL4 A;  2GIZ A;  3K9T A;  1Q1H A;  2EZL A;  3V8J A;  4AID A;  3K10 A;  1F36 A;  2DA6 A;  3S17 J;  2XV4 S;  3DEW A;  1AKH B;  3CCY A;  4RAZ A;  4UUV A;  3TGN A;  5M3F J;  1MBH A;  4PSW A;  4FAS D;  4XBF A;  1TQI A;  2HDC A;  1M1E B;  4QPQ A;  1D0Y A;  1GXQ A;  2CWE A;  5EZH A;  1NK3 P;  3SJM A;  2M8E A;  5HS9 A;  4HA8 A;  3BG3 A;  4WXC A;  2X6Y A;  2IGM A;  2CUJ A;  3E6D A;  2M5W A;  1YI2 I;  2BY1 A;  3F8M A;  2FD5 A;  3DEU A;  3BJ6 A;  5FO5 A;  5LEK A;  1V5G A;  2HNH A;  1XCV A;  4J19 A;  1WJC A;  1E3O C;  4A12 A;  2O9L A;  1GV2 A;  3DEE A;  3BR0 A;  2ICW G;  2A6H F;  2LR8 A;  1SD4 A;  4HSR A;  1YHQ I;  3ONQ A;  4OMZ A;  4FIS A;  1ETK A;  5E3L A;  3AKZ A;  5EZG A;  2XC7 A;  3BQZ A;  2E35 A;  4UY8 I;  4ZZL A;  3Q0W A;  4XON A;  4DOZ A;  1L0O C;  4AUX A;  1Y0N A;  2CUE A;  2VKD A;  4I2O A;  5F64 A;  2GXB A;  3OR2 C;  3M8J A;  4KMU X;  4M6Y A;  1XSD A;  3C2H A;  3OS0 A;  4Z2Y A;  2NS0 A;  1W4M A;  2VBZ A;  1ETY A;  1FP1 D;  1VF9 A;  4HYE A;  3HPH A;  3SQN A;  2D45 A;  2PI0 A;  2HPI A;  2E2H J;  3IC7 A;  3IP4 B;  4DIQ A;  2RN7 A;  4BJT A;  1JE8 A;  3K1M A;  5FRM A;  1B8I B;  3K4M A;  2YU3 A;  2DA3 A;  4IXA A;  4Y7N J;  1SFO J;  4ZTJ A;  1IDZ A;  1MJB A;  1H0M A;  2G9W A;  1AKH A;  4KT6 A;  2KP6 A;  4XRS G;  5B5E C;  4Q47 A;  2EJR A;  1HW2 A;  3T8T A;  2EA2 A;  2BY2 A;  1HXD A;  1T38 A;  2L7Z A;  4XSZ F;  2LMD A;  3GWZ A;  5FFZ A;  1V5E A;  4EVI A;  3BR6 A;  1B1B A;  3T1B A;  3RSN A;  3TKY A;  2NOJ B;  2I5U A;  2VN2 A;  4IRG A;  4XSX F;  3P9C A;  2MC4 A;  1D1A A;  1JTX A;  3MD2 A;  4NBQ A;  2A5Y B;  1P4W A;  2B0L A;  3EUK L;  1UG2 A;  3QPS A;  3JAM K;  3K4L A;  2GWR A;  2Q0O A;  3HRS A;  1MDM A;  1GHC A;  4MEX F;  4M6X A;  2Z99 A;  4A0Y A;  4HG2 A;  2PMU A;  1GLN A;  4AYB A;  1IRF A;  1U3E M;  2EFW A;  4BHP A;  2XGD A;  4DNC A;  3KIO A;  1JTY A;  3ISP A;  2MSY A;  4N0B A;  1T95 A;  1BW5 A;  2I8D A;  3HRT A;  4ZYH A;  5F0F A;  4OIQ F;  4ZDP A;  1G3T A;  2Y2Z A;  4YII A;  4HX8 A;  1YRN B;  1HW1 A;  4KDP A;  1LEB A;  4BL0 B;  2BOL A;  1FIA A;  4XOT A;  5CVR A;  2XGE A;  1FOY A;  3B73 A;  2QKM B;  4JBA A;  3S3M A;  1YQA A;  1SMT A;  5JFR A;  1B8I A;  2R7T A;  4HAM A;  2O03 A;  4UB6 C;  3QU3 A;  4LB6 B;  1FSE A;  1EF4 A;  2X0L A;  3WTX C;  5J1R A;  2DQR A;  1BIB A;  3MKL A;  2LC2 A;  5LRS A;  3WTT C;  1Z7L A;  2JN6 A;  1W5T A;  3S15 J;  1MW7 A;  2KZV A;  2L7F P;  2VI6 A;  3AFH A;  3FZV A;  4M74 A;  3FHZ A;  1J59 A;  1PJR A;  5E1W A;  3OYH A;  3LST A;  1RKW A;  3C3W A;  3SZP A;  3TED A;  1FBU A;  4LFU A;  1W36 D;  1LB2 A;  2GZW A;  5L3B A;  3CMA I;  3WTZ A;  3LSG A;  1B9M A;  2KKO A;  2MAB A;  4BDZ A;  2KJB A;  1MBK A;  3VSK A;  2RC4 A;  1U5T B;  3LQQ A;  3PUB A;  3I55 I;  1SVO A;  1IAW A;  1W7P B;  3H9J A;  4BXF A;  3RKQ A;  3Q5F A;  2FNP A;  3J7A Y;  1MSF C;  2CO5 A;  1MKM A;  1TNS A;  1ZEL A;  2BE5 F;  2RV8 A;  4RGS A;  3RZD J;  2VKV A;  2XGC A;  2XAS A;  5M3M J;  3ZOB A;  3O3K A;  1JT6 A;  1UHM A;  2WAF A;  3HB9 A;  3PUF A;  2EZI A;  4G6Q A;  3TW6 A;  5HLI A;  2RGV A;  4CYD A;  2W24 A;  5FD6 A;  5H6R A;  3P9K A;  5LLQ A;  3G71 I;  1RC9 A;  1I5Z A;  5D8L B;  3SEQ A;  4RLQ A;  2DK8 A;  2EWN A;  4BH9 A;  3FKJ A;  5GAE J;  1RNL A;  1TWF J;  3BTL A;  2LK2 A;  5TRD A;  3JRD A;  4ABZ A;  5HS7 A;  3ESW B;  4MQ9 F;  1D0X A;  2L02 A;  1W36 C;  3GZ6 A;  1T98 A;  2WAE A;  1WI3 A;  1ON1 A;  2ZJR F;  1JI8 A;  3WG7 H;  1RPW A;  3MMY B;  3LSI A;  2P81 A;  4MNU A;  1O3T A;  2VBX A;  3GXO A;  3S2W A;  5LGU A;  4FX4 A;  2GA1 A;  1W0T A;  3DTE A;  1F43 A;  3F8C A;  3GZ5 A;  2DFI A;  2RRE A;  4UV9 A;  1LPQ A;  3VDX A;  4ENM A;  1ETW A;  2DJI A;  1XSX A;  3KLO A;  5JVG F;  1U5T A;  4HV5 A;  2H94 A;  2XSJ C;  2HOE A;  4G7H F;  4BE0 A;  1IRX A;  1W7P A;  2HVQ A;  2F4I A;  4XRM A;  2E1C A;  1TNT A;  1R1T A;  2M0M A;  5IT9 K;  3WHB A;  1Z3X A;  3E5X A;  1O4X A;  2XB0 X;  3Q9V A;  2VC1 A;  2QQA A;  3KYD B;  2QSG X;  2PJR B;  4BJ6 C;  2PLY A;  3OYL A;  3ABU A;  3EUA A;  2XPV A;  3BWG A;  3HZJ A;  1A04 A;  5CLS A;  4XL9 A;  1SVL A;  3FM3 A;  2EIM H;  2XAJ A;  3G1O A;  3VB2 A;  4NQW B;  2NYX A;  3CP2 A;  5HVQ C;  2RKH A;  3CO6 C;  1A35 A;  1DDN A;  2MFZ A;  4IQ4 A;  2GBY A;  3M1C A;  4ASN A;  1K61 A;  2XAH A;  2DOD A;  2HDW A;  3WTY C;  1MNE A;  3H0D A;  3IWF A;  2QBY B;  2CS3 A;  3CTA A;  3DV8 A;  3WU2 C;  5KAI C;  3J81 K;  4IHY A;  3WU0 A;  3GTO J;  2DYS H;  5DCM B;  3ZQC A;  2VB6 A;  3WE2 A;  1MZB A;  1ZLJ A;  3HOV J;  2ZC2 A;  4HNT A;  4HNV A;  1K83 J;  2ZB9 A;  1Z9C A;  5LRR A;  2JA7 J;  3PIO F;  2FQ3 A;  1S7A A;  5JLX A;  4EJU A;  2DPD A;  3ZN1 A;  3HEF A;  3TP3 A;  3IV5 A;  1IGN A;  4LK0 F;  3DXJ F;  4HF0 A;  4HQM A;  1MND A;  3TP0 A;  4DBR A;  4RB1 A;  2Y0S N;  4PFP A;  4GXO A;  4A3B J;  2ZXW H;  1FIP A;  4K2E A;  3T5X A;  1VND A;  1OYW A;  5BPI A;  2FJ1 A;  4B09 A;  1IRZ A;  4IPA A;  1BJZ A;  2XPU A;  3TOB A;  4HEA 2;  1A5J A;  4S04 A;  2R5Z B;  4UV8 A;  5FLX K;  2A05 A;  2YU9 J;  2L9V A;  3OIQ A;  3OYG A;  4A3L J;  2ELJ A;  2VJ4 A;  1B59 A;  2FBI A;  4XOP A;  3V4G A;  4NC6 A;  1U8B A;  5M5X J;  3AL0 B;  4FT8 A;  4WCG A;  4IZZ A;  2LKP A;  2AS5 F;  3DTI A;  1MH3 A;  1MSE C;  1WZ2 A;  2PJR A;  3K1N A;  1SFX A;  3IH2 A;  1R5G A;  3OOP A;  5D5W B;  4KIF A;  1MH4 A;  4NQW A;  3CJR B;  1R6R A;  1I1S A;  1MMN A;  1S8N A;  1VQ8 I;  2BVM A;  3IL2 A;  4I02 A;  4KN4 X;  4CDG A;  5DCM A;  3DU6 A;  3F8B A;  2OPT A;  4CH7 A;  4F3Q A;  4KNY A;  2LRE A;  5IY5 H;  2X9D A;  4GDF A;  3GTK J;  1FTT A;  1APL C;  2CU7 A;  2WAQ N;  3RQI A;  1TC3 C;  1TL8 A;  1WFX A;  2FRH A;  3KP5 A;  2M1B A;  2OA4 A;  2VPL A;  2CQX A;  2DFE A;  4M3D A;  2DYR H;  2XRL A;  5KNL A;  1DPU A;  1TWG J;  3BTC A;  4DYR A;  4QLC U;  1SD7 A;  1ZGJ A;  5AIP A;  1XPX A;  2IA0 A;  2PG4 A;  4LMY A;  1ZTR A;  1QGP A;  3QRF F;  1Z0X A;  3BG9 A;  1DUX C;  1G3S A;  5J8F A;  2CYY A;  2K3P A;  2V9V A;  1G3W A;  1R9T J;  2ZNZ A;  5ICF A;  4KIC A;  1KQ0 A;  3C2B A;  2NVQ J;  1J5Y A;  3A4C A;  3M8E A;  4XLP F;  2X6X A;  4ESF A;  1FEX A;  5C44 J;  3FXR A;  2HWV A;  1NG6 A;  2L7M P;  2NS7 A;  1AWC A;  3HOY J;  2WA0 A;  2HXO A;  5DS9 A;  1TWC J;  5FKM A;  4G9Y A;  2FOW A;  3BG7 A;  1VQL I;  3S1M J;  4BS9 A;  1XGN A;  2X48 A;  5HNF A;  2FEZ A;  4XN3 A;  4BQQ A;  2OTJ I;  5IYC J;  1MJ9 A;  1WH5 A;  1D1C A;  4ZZD A;  1X3U A;  5DTD A;  2VKE A;  3ASO H;  4EAT A;  3VOD A;  1QZE A;  2BW3 B;  3ZMZ A;  2DK5 A;  2HVR A;  1G3Y A;  1SFU A;  4YFK F;  1LJ9 A;  4KMF A;  1DGR M;  1J75 A;  2UXN A;  3H36 A;  3HBL A;  4ZYG A;  1ONV A;  2IJL A;  3VWB A;  3J80 K;  4A0X A;  4HX4 A;  3KLN A;  4XLC A;  3LMM A;  1ULY A;  3EDP A;  3HTU A;  4EGZ A;  2O7O A;  4OU0 A;  3IHU A;  4XM3 A;  3HTS B;  2X1E A;  4RM2 A;  2K3F A;  2FA5 A;  4CCM A;  2P5K A;  4KA4 A;  3I4M J;  4CZC A;  2QSF X;  1REP C;  4X0G A;  5FLM J;  2EIJ H;  3JRG A;  2L5Q A;  1OR7 A;  4XLN F;  4CCK A;  3RIR A;  1TWH J;  1WSU A;  4GYG A;  2KIM A;  3HRU A;  4M9S A;  2V1D A;  1KU2 A;  1SVM A;  4MQV A;  4RM3 A;  3E0J B;  2ZJQ F;  2O8X A;  2BGC A;  3COA C;  2CQN A;  2HQA A;  1JGS A;  3MEX A;  5HLG A;  2JPC A;  3FM5 A;  1LVA A;  3CD6 I;  3CCM I;  4A6D A;  3KET A;  2QYO A;  3OYK A;  4G7O F;  2VJI A;  3PM1 A;  3LL7 A;  4CCJ A;  3F8N A;  1UAA A;  2P0W A;  2DA1 A;  2QUF A;  1USS A;  2BHZ A;  3G73 A;  1YO5 C;  2N8G A;  2MLG A;  2QEX I;  1HQC A;  4CA0 A;  2ZME B;  3W2V A;  4P55 A;  4E7S A;  4A0Z A;  4M73 A;  2TCT A;  3HHG A;  2DMN A;  2NVX J;  2MBF A;  1K4T A;  4B8X A;  1NG7 A;  3M07 A;  2H8W A;  4I99 C;  5HS8 A;  3CDL A;  1H9T A;  2WTE A;  2FMY A;  3K70 D;  3LA7 A;  4IJA A;  2WBM A;  1VQ4 I;  1BC7 C;  2J5O A;  1P9Q C;  3ABL H;  3DU5 A;  3HDD A;  1TQP A;  3MZY A;  1XTA A;  1EH8 A;  6PAX A;  1HW5 A;  3BR2 A;  1HF0 A;  2E60 A;  2XAQ A;  3R0A A;  4G6T B;  3ASN H;  4RB2 C;  4E7J A;  3CDI A;  4FE4 A;  3L2V A;  1VQK I;  3QOE A;  1X19 A;  3S16 J;  4Y4R A;  3G4S I;  2F5C A;  3S2H J;  3TDZ C;  1WJA A;  2RVC A;  2XF5 A;  5EEA A;  2JA5 J;  3WTV C;  4ETS A;  4HDV A;  1OFC X;  1G8X A;  1VQ7 I;  2FML A;  2Z2S B;  1J0R A;  5E1Z B;  3VPR A;  4DYC A;  2DA7 A;  4HOB A;  1V54 H;  2JUG A;  2IRF G;  4HLX A;  3SHF A;  5KCM A;  3WOD F;  2MYS A;  3DKW A;  2JPB A;  1WJD A;  3LAP A;  1P4X A;  3S3O A;  1ERD A;  2QQ9 A;  4BGD A;  1YTY A;  2Y30 A;  4ON0 A;  4C30 A;  2R0Q C;  2R7U A;  1XGS A;  1OCR H;  3UR3 C;  3PIP F;  4ZH4 F;  2ZME A;  2HVS A;  3I59 B;  4BY7 J;  1P4A A;  3K70 C;  2EFN A;  2E1N A;  2OCE A;  2JT1 A;  3KE2 A;  2L4A A;  4M6V A;  4M71 A;  5DD8 A;  3QYE A;  4YG2 F;  2STW A;  3O8G A;  3R61 A;  3RKY A;  4BHC A;  3BQY A;  4ZYE A;  3W2W A;  2DDB A;  1Z77 A;  3ABK H;  3Q0U A;  3RCO A;  5IP6 A;  2AHQ A;  1GDT A;  2YS9 A;  3OOU A;  2MG4 A;  4RB0 A;  1B4A A;  4HRI A;  1TW3 A;  3LSM A;  1G4D A;  4O3M A;  3JRB A;  2HFH A;  3OY9 A;  1VQM I;  3OIO A;  5K5R A;  2ELK A;  2IGN A;  4LLG F;  3JAM Z;  4JP0 A;  3HOU J;  2ESN A;  2JVG A;  2DMQ A;  4HNU A;  5J47 A;  4WWC A;  1R58 A;  3HPG A;  2P7C B;  2WAQ A;  1YE9 A;  1FJL A;  2CQQ A;  3NWS A;  2LP0 A;  1ZYR F;  4XLA A;  2QEN A;  2ESH A;  1ZRC A;  4ZYA A;  1PUF B;  3LA3 A;  3ERM A;  4H4K C;  2E36 A;  2EV0 A;  2PMH A;  2OC6 A;  2JVH A;  2ECB A;  2VLA A;  4RGR A;  4NHJ A;  3HRM A;  1BI2 A;  3KEO A;  2LF8 A;  4KUM A;  3LSP A;  3LFK A;  3CJN A;  4C9Y A;  4AU7 A;  4Y13 A;  4XK4 A;  3BTI A;  3SZG A;  3CMM A;  5B66 C;  2VOD A;  1WPK A;  1NTC A;  3K4B A;  2EFP A;  4WK8 F;  3DF8 A;  4RGX A;  1ZQ3 P;  2DAO A;  1R4M B;  3EUH A;  2FNA A;  3I59 A;  2LD5 A;  3ZCO A;  4D5F A;  4UNO A;  1EA3 A;  1OJL A;  5FKK A;  3I54 A;  4MGR A;  2ZKZ A;  4FTH A;  2WV0 A;  2PQ8 A;  5FRO A;  2QM3 A;  3SYT A;  4OIN F;  3HUG B;  1ZG3 A;  4A5N A;  1STZ A;  2OBP A;  4ESJ A;  2K9S A;  3DPU A;  3ECH A;  2R7X A;  3L2W A;  1JUM A;  3KYL A;  1T39 A;  4LIU A;  3T0Y A;  1O57 A;  4YRV A;  4NC8 A;  3ZMT A;  3MN2 A;  3JTG A;  4EEF G;  2VQC A;  1QPI A;  4CCL A;  1S3J A;  3MAJ A;  1K6O A;  1Z3Y A;  1IN4 A;  3H3U A;  3FHN A;  3M1E A;  4WF2 A;  3E3V A;  1WI9 A;  3WGG A;  5J4V A;  1PUF A;  2R7S A;  5GAH J;  4LD5 A;  4JOM A;  2XIG A;  3E1S A;  4FET A;  1VZ0 A;  2HYJ A;  2V6E A;  2G7H A;  4U87 A;  3RDI A;  1ZRD A;  2W25 A;  4V19 K;  2Y9Z A;  2DI3 A;  1KU7 A;  4ZDO A;  4KN7 X;  2HOA A;  2WY8 Q;  2VQL A;  4G12 A;  1O3R A;  2W1O A;  1SC7 A;  2LY1 A;  4A2U A;  3BR5 A;  2JA2 A;  1I39 A;  3J7Z I;  2LVS A;  3GFJ A;  3Q9S A;  4NDL A;  1XMX A;  4RGU A;  2DN0 A;  1OCZ H;  2X85 A;  3H9Q A;  3M8F A;  2EB7 A;  3I9V 2;  1JKO C;  2YR2 A;  5D4R A;  1MBJ A;  3HUG A;  1S9H A;  4I7H A;  2DOE A;  1QRY A;  2OZ6 A;  4GCV A;  5DYM A;  1I3Q J;  5J8C A;  2MGQ A;  1FYL A;  4DW6 A;  4F7Z A;  1WHU A;  2GLO A;  3MZ8 A;  1NK2 P;  5DUK A;  2QLZ A;  2OTL I;  2E1O A;  4G8X A;  2R7F A;  2KMU A;  4BUP A;  1TTY A;  1V4R A;  5LEJ A;  1RI7 A;  4J00 A;  4IHW A;  2NVT J;  3VYR B;  5IT9 Z;  3QAH A;  4S05 A;  3FBI B;  4L9V A;  2W00 A;  1SAU A;  2K9M A;  1FZP B;  2IGO A;  3A01 B;  1O3Q A;  3BOQ A;  4HQE A;  3K4C A;  2O3F A;  3REO A;  3I5U A;  1RIO H;  4IO9 F;  4BYY A;  3JRH A;  2KLO A;  4IVN A;  2QWW A;  4E7Z A;  2D2W A;  1WH7 A;  3SFZ A;  3JRA A;  1H9G A;  2JRM A;  3H5A A;  3OYI A;  3LQR A;  3SXY A;  3J81 Z;  1UHW A;  3ZRG A;  3IKV A;  1JHH A;  1UB9 A;  2K86 A;  2VOO A;  3RTR A;  3IH4 A;  4NB5 A;  1KYZ A;  1FLI A;  1YFH A;  5KHD A;  2Y31 A;  3FXM A;  2H6B A;  5H2F C;  3J7A O;  1KON A;  1MBF A;  2NVU B;  1KQ9 A;  4QTR A;  3HG9 A;  2V7F A;  4II3 A;  4KIS A;  4J01 A;  1MMD A;  1EKE A;  4NNJ A;  1OKR A;  4LG0 B;  2BXY A;  2OAZ A;  2KRH A;  3FF5 A;  2GXG A;  3VYS B;  4C2T A;  2R7V A;  4JQF A;  4KJZ A;  5J3L A;  1ETQ A;  3LSJ A;  4C3I J;  5D5U B;  4XMY A;  1QPM A;  3K6G A;  5FLX Z;  2Q1Z B;  1FP2 A;  2OZU A;  3BZ6 A;  2HQN A;  2FX0 A;  1O7L A;  3FXJ A;  3F23 A;  2L9R A;  5HDN A;  2IGK A;  1FPQ A;  4LGW A;  4LB5 A;  1TW2 A;  1Y56 A;  3ZMS A;  4B48 A;  1FOX A;  3H3Z A;  3K1P A;  2TDX A;  4UVC A;  2DPU A;  5E17 F;  4IKF A;  2ZXI A;  5BS6 A;  3FDY A;  3S1N J;  3CF2 A;  3CMY A;  2F5F A;  3H92 A;  1GVD A;  3A01 A;  2IS1 A;  2HTS A;  2H8R A;  1EJ9 A;  3FX3 A;  2Z3Y A;  2M7A A;  5L3D A;  3K4K A;  2K02 A;  3CZ6 A;  5CJ9 A;  5FGM A;  2QQB A;  3KEY A;  3GCM A;  1UST A;  2CV2 A;  2EV6 A;  2UV1 A;  4DZJ A;  1HDD C;  1YRN A;  4Z6Y A;  1EH6 A;  1IV8 A;  2AQE A;  2JSC A;  4W1U A;  3AG4 H;  4WXD A;  4EM1 A;  2BEO A;  3JCU C;  2JUC A;  3RJP A;  1T8I A;  5K7Z A;  1ZR2 A;  2E34 A;  5E79 C;  3RKW A;  2GXA A;  3ML6 A;  3KP2 A;  5EJC A;  3DCF A;  4IHV A;  1P6R A;  3D5R C;  1J09 A;  2KFD A;  1BN5 A;  2FBK A;  3LWF A;  1G59 A;  1D3Y A;  2CJJ A;  4BE2 A;  1D8K A;  4XOR A;  4ZJZ A;  4P9F A;  1BR4 A;  3LFU A;  2CH0 A;  3LA2 A;  1R1V A;  2DOA A;  2DQL A;  1JUS A;  4RBO A;  3IRR A;  2P6S A;  1T0F C;  3NAU A;  3ABM H;  1MNM C;  4LG0 A;  3U21 A;  4F92 B;  2JK3 A;  2O6G E;  2DMU A;  3H5N A;  4LIT A;  2R7D A;  3U1D A;  2Q8K A;  5E8G A;  3WHC A;  2FXA A;  1YLF A;  2QKL B;  4G7Z F;  1JJ8 C;  5ILS A;  4MHG A;  3CCS I;  4FX0 A;  3PO3 J;  3PNT A;  2G7U A;  2NOG A;  2V1U A;  4D7M A;  4OMY A;  1ACI A;  4A69 C;  4YIR X;  4EM0 B;  3JW4 A;  2E2I J;  1J2X A;  1S72 I;  2UWM A;  5CVI A;  3ZGK A;  5LD2 C;  5FKL A;  3R60 A;  2ECC A;  3RYP A;  4ZYD A;  2XF6 A;  2HU9 A;  1D5V A;  3E5Q A;  4CYC B;  4L5I A;  5DV5 A;  4AWX B;  2R7W A;  4A5M A;  4BDY A;  4FHT A;  2FQ4 A;  3AG3 H;  3E6M A;  1IO2 A;  3IWZ A;  3OSF A;  3S1R J;  2HDD A;  4A3E J;  4XNF A;  2DFH A;  5FJ8 J;  4KYW A;  3GW2 A;  4L0Y B;  2D1V A;  2LF7 A;  1X1A A;  2IVM A;  3DTK A;  3S2D J;  4JK1 X;  3CC7 I;  3DQV C;  4PGG A;  1GUU A;  3FMS A;  4N4O B;  1T33 A;  2HQ5 A;  4XKV A;  4CGZ A;  2LNB A;  3QP6 A;  3G6E I;  1BJA A;  3CES A;  2CW0 F;  4F93 B;  3GTJ J;  1WJF A;  1QZY A;  3DWL E;  3BPX A;  4CCO A;  2ZCW A;  4A3F J;  1ZRE A;  3OYN A;  3J80 Z;  2OD5 A;  1BR1 A;  3SFI A;  3GTM J;  4BU2 A;  1MBE A;  1MMG A;  1HCR A;  4L9T A;  2CGP A;  1LNW A;  2Q2E B;  1VQP I;  3U1K A;  2EQR A;  1HLV A;  3B02 A;  4BQA A;  3H0G J;  2XHK A;  3GFM A;  4M9Z A;  5IPA A;  2ZFW A;  1SMY F;  2X1C A;  3SZT A;  3QOP A;  1Q1V A;  3IAS 2;  4EMS A;  5BNG A;  2E7X A;  1IN7 A;  3BCA A;  1D8J A;  5CKT A;  3G3Z A;  2CV1 A;  3OYE A;  5D8K B;  3HSE A;  4PJJ A;  1ZG5 A;  1S6L A;  1Y8Q B;  2O0Y A;  1TLH B;  2R7O A;  4AIJ A;  4WX9 A;  1WRJ A;  3N4M A;  4Y17 A;  1YX5 A;  3FIS A;  2DMT A;  4CYC A;  2LSO A;  1Y6I A;  1IF1 A;  1YW9 A;  1FMW A;  3NWT A;  3LSR A;  4A3J J;  5A2Q K;  4RAY A;  4XID A;  3ZQL A;  3JR9 A;  3GEZ A;  4I0B A;  4YIF A;  1HKT A;  2QBY A;  2FSW A;  2G0E A;  5J1U A;  4AVZ A;  1AA7 A;  1RR7 A;  3RYR A;  1X2N A;  2HI3 A;  5ICC A;  2M30 A;  4LJZ F;  2Y75 A;  2IEK A;  2VQG A;  2Y69 H;  5C3E J;  2LY9 A;  2HGC A;  2K9Q A;  4XQF A;  3ECO A;  1SAX A;  1HBX G;  1R5I D;  4PSX A;  5FD5 A;  2NNY A;  3I64 A;  1JKQ C;  1BBY A;  1JJ6 C;  4ZTF A;  3OL4 A;  2Q2E A;  5JI6 A;  5E3O A;  3DBR B;  1FSH A;  3BJO A;  3O6B B;  2O5R A;  4PZJ A;  2D1H A;  2PMZ A;  2ACJ A;  1FOK A;  2FF4 A;  3G2B A;  2LLK A;  2ISY A;  3GLL A;  3F22 A;  1NH3 A;  2CV0 A;  2R5Z A;  5EG0 B;  2GOM A;  3OYM A;  4BBS J;  2CRG A;  2DT7 B;  3R6S A;  4B1R A;  5JLW A;  1SD5 A;  4GGG A;  5B1A H;  5L3F A;  4IOC F;  3CUQ C;  1DGW Y;  1AHD P;  2DTZ A;  4F52 A;  2QA4 I;  1FC3 A;  2CUF A;  2Z1D A;  1IUY A;  2L9S A;  3O2P E;  1B6A A;  3BDD A;  1XMK A;  1RRJ A;  2Z33 A;  5EEG A;  1HDP A;  1I3A A;  1QQI A;  3E6B A;  1BI0 A;  2Z5U A;  5EEH A;  2LOO A;  2VKH A;  4AIH A;  1R1U A;  5CVU A;  3OMY A;  1I27 A;  1RES A;  1WWX A;  2R3S A;  3CCR I;  3K4J A;  1OMI A;  2DCE A;  5E1X A;  1RR8 C;  3CCQ I;  3D5L A;  2K5C A;  5IT3 A;  2FE3 A;  1ETV A;  4IRI A;  2VBW A;  3OS2 A;  4EJT A;  3OR1 C;  3W6J B;  3OYD A;  5LGT A;  3LSH A;  4MTE A;  4CO8 A;  5K7F A;  3JRF A;  4A3D J;  1ETO A;  1GV5 A;  2IT0 A;  3KZY A;  1W5S A;  4UVB A;  3GFI A;  3N97 A;  2YPR A;  4BXU A;  3NQO A;  1FT9 A;  2UXX A;  2V79 A;  3GX4 X;  1HST A;  3GLX A;  3HHH A;  2H1L A;  3U9G A;  2BV6 A;  2BVL A;  4I6Z A;  2F6C A;  4R1H A;  1KYW A;  4HDU A;  1WCM J;  3G1L A;  3J7Y J;  2LG4 A;  2W48 A;  3ELK A;  1X1C A;  3PQJ A;  3HSF A;  3F21 A;  3W6K B;  3ULQ B;  3RPU D;  2HR3 A;  3CC2 I;  1I50 J;  1K79 A;  3H5R A;  1ZGA A;  5M5Y J;  1RUN A;  3BR3 A;  1ZRF A;  3SDB A;  5DDG A;  4HLY A;  4I76 A;  5JHU A;  2ME0 A;  2K7L A;  5FKO A;  4BQN A;  1K4S A;  3H3V K;  3WU1 B;  3ZXS A;  3OYC A;  1ZKG A;  1W0U A;  2M3A A;  4HPQ A;  3DFG A;  3L2R A;  1R49 A;  5TGT A;  1Z91 A;  2MH9 A;  1IC8 A;  3NEU A;  3CO7 C;  1WJ5 A;  4UB8 C;  2NNN A;  1ZGW A;  3FBN B;  4CXF A;  2DA4 A;  1VQ5 I;  4TV7 A;  2BW3 A;  4B43 A;  3HGG A;  2X51 A;  2BXZ A;  3O8H A;  2F5D A;  2Y9Y A;  4LG3 A;  3MKY B;  2VL8 A;  1IZ1 A;  1X3Z B;  4GO1 A;  2HTJ A;  2IS6 A;  3K2A A;  3CP8 A;  2KIU A;  1FYM A;  4KFC A;  2CUZ A;  1LUJ B;  4XRF A;  2UZK A;  4E6K G;  1CGP A;  1UMQ A;  1R22 A;  2EIK H;  5AON A;  1XG1 A;  5ILV A;  1X4P A;  3M7G A;  4BKX A;  4IOA F;  2X6O A;  4M3F A;  1IUF A;  4UUS B;  3CCL I;  4UXN A;  2EH3 A;  1YS7 A;  2F48 A;  2GIV A;  5EF6 A;  3WG9 A;  1LQ1 A;  4D1Q A;  3KP6 A;  3S8P A;  5J4Y A;  4L18 B;  2HEO A;  1P92 A;  3K2Z A;  4U7B A;  2MD5 A;  2DTR A;  4XR6 A;  1F9N A;  2B9S A;  2VC0 A;  1YJW I;  3F3X A;  5ILU A;  2QGU A;  3D5S C;  2A6E F;  2Z16 A;  1U9N A;  3D0S A;  2R7Z J;  2WAD A;  1WVR A;  3N05 A;  5IOY A;  2F4O B;  3BZC A;  1QZZ A;  1X58 A;  2E7W A;  4S0H B;  2JA6 J;  5FFX A;  3QPH A;  2BY3 A;  5BOX A;  3CCE I;  4E7I A;  4BXX J;  3P5J A;  3LAJ A;  4W97 A;  2H6C A;  1D1B A;  2ELH A;  2FUG 2;  3HYI A;  1YIJ I;  2VON A;  3PNY A;  1YW8 A;  3CCU I;  2KIQ A;  1AOY A;  1D0Z A;  3CLO A;  3S3N A;  4BY1 J;  5B3S H;  3HIF A;  1FOW A;  4BE1 A;  3BZK A;  4WXH A;  4EM2 A;  2R93 J;  1HOM A;  4IQJ A;  3H35 A;  2E1M C;  1QNT A;  4KIB A;  2P7V B;  1GT0 C;  1ZH5 A;  4RDU A;  1Y1V J;  1IN5 A;  4AC0 A;  4ENN A;  2VQH A;  2CQ7 A;  4Y15 A;  1LFU P;  2V1X A;  3H9G A;  2KPM A;  5BMZ A;  4O5V A;  2MC3 A;  2IA1 A;  1Z21 A;  1IDY A;  3CF5 F;  4UUS A;  1LKX A;  4M72 A;  2KQR A;  3BPV A;  1KU3 A;  2ID3 A;  4B3X A;  2HOS A;  4UHT A;  3A03 A;  5M5W J;  2OQR A;  3WGH A;  3SEZ A;  1E3P A;  4Q48 A;  2VE9 A;  1K7A A;  1MMS A;  1E2X A;  1F5T A;  4A3K J;  3MKW B;  1HSJ A;  3RQ4 A;  1HKQ A;  2ADU A;  3L9F A;  2Z9O A;  1BL0 A;  3ZQG A;  4HST A;  1U2W A;  5K5Q A;  1N25 A;  4EJV A;  2OV7 A;  2NXN B;  1KGS A;  2P4W A;  2M45 A;  4L5E A;  5GPA A;  2KJC A;  2CQK A;  2MLK A;  3QP5 A;  3GVA A;  1DPR A;  3ZQQ A;  1ZR4 A;  1RZ4 A;  3C1D A;  1VQ6 I;  1QU3 A;  1WQ2 A;  2MH2 A;  1SD6 A;  3C7J A;  2VXD A;  3BTJ A;  1P7J A;  2E19 A;  2H09 A;  3TO6 A;  3ROU A;  2M34 A;  5HOO A;  3WTS C;  3E97 A;  2O8K A;  3C2G A;  4P9U A;  3UKG A;  3PJR A;  1AU7 A;  3I4P A;  5HDG A;  5ERI A;  2KDO A;  1PVE A;  2COB A;  3PL8 A;  3ZPL A;  1H88 C;  2GOX B;  3CCV I;  4DZP A;  3KZI C;  1XDS A;  3M4O J;  3HL2 A;  4A3I J;  2YX7 A;  4C2U A;  2DA5 A;  2M7B A;  4EGY A;  2K27 A;  1VFC A;  2XUB A;  4I0A A;  3KP7 A;  2IS4 A;  3OSG A;  2LFB A;  3FK7 A;  1MD0 A;  3I53 A;  4MIM A;  2NS8 A;  3BG6 A;  2M2E A;  3BR1 A;  4BNC A;  5EYR A;  2WB1 A;  4D5C A;  2DFF A;  5E3M A;  2H1K A;  2K4J A;  4PGH A;  4YFN F;  2FU4 A;  1E3H A;  2F5V A;  3WTU C;  5K1Y A;  3KP4 A;  3FK6 A;  3L2U A;  2KIF A;  3TBI A;  4CSW A;  3Q0V A;  4XN0 A;  1BC8 C;  1YJN I;  5CQG A;  3I0T A;  2XRO A;  4PJ0 C;  2QQ8 A;  1QVT A;  3DKX A;  3F0C A;  4F55 A;  1YS6 A;  5D6E A;  2RQP A;  1MDM B;  3AG1 H;  2HPM A;  1JXS A;  1QBJ A;  5BPD A;  2BYV E;  2IP2 A;  4EV0 A;  4B47 A;  1N77 A;  5CVV A;  3V7R A;  4I01 A;  3HGY A;  4BAY A;  3AAF A;  3CJQ B;  1FBS A;  2X4H A;  2EIN H;  3UNG C;  2L0K A;  5IOZ A;  2W84 A;  2STT A;  1FNN A;  3ZQI A;  1TP4 A;  1UCR A;  1ZAR A;  1RET A;  1XGO A;  1V5F A;  2ZSI B;  1XS9 A;  4L0Z B;  5HLT A;  5IYB J;  1W7P D;  1MIJ A;  1J7K A;  1YIT I;  5J1Y A;  1ZG1 A;  2EIL H;  3HOX J;  5CQE A;  2UUZ A;  2QCO A;  3SDG A;  3PSI A;  3AG2 H;  2RDP A;  1Y0U A;  3IH3 A;  3B6A A;  4BQO A;  2M4K A;  3TW7 A;  2HOT A;  2F4M B;  3GUD A;  2LH9 A;  2HYG D;  2HKO A;  2A07 F;  2ZXJ A;  2OF7 A;  4Y3O A;  4ZC3 A;  2RAE A;  4IRH A;  4KIT B;  2H27 A;  4AD9 A;  2DDA A;  3CQZ J;  3NAR A;  2P5L C;  1YJ9 I;  2CW7 A;  4DGW B;  5JHF A;  1ZHF A;  3RPQ A;  1NHA A;  4MO7 A;  2XB5 A;  3L09 A;  4CUG A;  3E6C C;  4OWR B;  4GFB A;  1TQM A;  1R7J A;  1E0E A;  4U0W A;  3IRQ A;  1L3L A;  3L7W A;  1SAN A;  2M87 A;  3R4K A;  4HW0 A;  5H20 A;  3KYC B;  4LLL A;  3EPZ A;  1K78 B;  2VJJ A;  4CIC A;  4CCN A;  4RMN A;  4YFX F;  1R36 A;  3P9I A;  5LHH A;  1OQY A;  2IXS A;  3GTQ J;  2WY7 Q;  1ZN2 A;  3RZO J;  2PMZ N;  1O7F A;  1F4K A;  2VT2 A;  1XGM A;  1U5T C;  5HLH A;  2OJE D;  3H1C A;  1BOA A;  1G2H A;  1YOV B;  1WKM A;  1X2M A;  3WE3 A;  4BBR J;  5KAF C;  1QA6 A;  2BHY A;  1DU6 A;  5F27 A;  3GYH X;  2YUS A;  1PYV A;  2P8T A;  3TMO A;  4QPO A;  5ICE A;  4R8H A;  4M3B A;  1V3F A;  3B6C A;  1QHG A;  4MFE A;  2VOP A;  2A5W A;  2BBY A;  2O61 A;  2JA8 J;  2ZNY A;  2K9N A;  3E5U A;  4Q5S F;  4PJM A;  2PEX A;  2VJ5 A;  2XKP A;  2I10 A;  2W85 A;  4EJW A;  2HQR A;  1QHH D;  5D4S A;  4XKW A;  4P5O A;  2CMP A; 
#chains in the Genus database with same CATH homology
 1RUO A;  4PDK A;  3KP3 A;  2JZY A;  3K69 A;  4U7D A;  1KQ8 A;  2XRN A;  4I98 B;  1B9N A;  1OPC A;  3F6O A;  3KEQ A;  2PN6 A;  2DW4 A;  3HSR A;  1K78 A;  5A2Q Z;  1BIA A;  5D5X B;  2DU9 A;  4UVA A;  2XVC A;  1Z6R A;  1OYI A;  1R5H A;  3EET A;  4KIG A;  2XKO A;  3QPT A;  5JR3 A;  4DQ2 A;  3I71 A;  1CF7 B;  1P2F A;  3V8K A;  1I1G A;  3FMR A;  2L4M A;  2A69 F;  3HOT A;  1KA8 A;  3WTW C;  5F1R A;  1T2K A;  3FXQ A;  2HS5 A;  4G6D A;  2PFB A;  1PP7 U;  4ENK A;  2HKX A;  2W57 A;  2COM A;  3BRO A;  5TJJ A;  5H6Q A;  1LDJ A;  2PJP A;  2RNJ A;  2P5V A;  1S29 A;  3JSP A;  2JTV A;  1FY7 A;  3NRV A;  2XGX A;  5D6F A;  2JRT A;  3DPL C;  3F8F A;  2DBB A;  2MA3 A;  4OIR F;  3V7C A;  1U78 A;  3PFI A;  3TDU C;  1FWZ A;  4HBL A;  1G6N A;  1CF7 A;  4L9J A;  5K5O A;  3MZH A;  3TO7 A;  1Z05 A;  3VFZ A;  4IHS A;  2V6C A;  4I09 A;  4N9H A;  1PP8 F;  2GA2 A;  3OV8 A;  3KZZ A;  1R23 A;  3QU6 A;  5E20 A;  5L3E A;  3F72 A;  1IXC A;  2DT5 A;  3FMQ A;  3F6V A;  5E8I A;  4O6J A;  2LDU A;  2VT3 A;  2EFQ A;  2ZO4 A;  1IN8 A;  1GXP A;  2XAF A;  4HV6 A;  4MEY F;  1I6X A;  4R79 A;  2L01 A;  2EA4 A;  2F2E A;  2KRF A;  4L9N A;  1F1Z A;  3EQL F;  2IPQ X;  3CDH A;  2ZJ2 A;  2HYF A;  4HZF A;  5F6F A;  1HKS A;  1T0F A;  2NAZ A;  2WC2 A;  2ISZ A;  1XN7 A;  3ZMV A;  1PUE E;  3M9A A;  2EV5 A;  3K0L A;  2XAG A;  1PDN C;  3BJA A;  1XB4 A;  1JHF A;  3DP7 A;  4L5J A;  1LDD A;  5ICG A;  1EV7 A;  4LLN A;  1E17 A;  2A61 A;  5L3G A;  1LDK B;  2Y0M A;  5BQT A;  1U6G A;  1BM9 A;  3EYY A;  3T8R A;  1S7O A;  4MTD A;  1FX7 A;  1MJA A;  3ZMD A;  2IW5 A;  2YX4 A;  3TO9 A;  4EQQ A;  5LHI A;  4AVP A;  2L54 A;  3BY6 A;  1ON2 A;  4HF2 A;  2PBI A;  4HF1 A;  3GO5 A;  3R0J A;  4G94 A;  2FOK A;  3JSO A;  2QVO A;  1IXR C;  1VTN C;  1MGT A;  2C6Y A;  2F5E A;  3GF2 A;  2J5P A;  1YYV A;  3CUQ B;  3ABT A;  4CZZ A;  4EJO A;  5LGN A;  2VBY A;  1ZAO A;  3IKT A;  5D5V B;  3VOE A;  4IF4 A;  2CSO A;  1DP7 P;  3DPT A;  1XCB A;  3BP8 A;  3V8L A;  3WGI A;  5DCF A;  5CVJ A;  4KT5 C;  2ETH A;  4P96 A;  4U88 A;  1YG2 A;  5HDK A;  4N9I A;  4OIO F;  3HOS A;  2CG4 A;  2VE8 A;  4LK1 F;  5DD4 A;  2K4B A;  2YSR A;  1BI3 A;  5KK1 A;  2CFX A;  2EFO A;  2HZT A;  5LBQ A;  5LHG A;  1LEA A;  4RS8 A;  2A68 F;  3FWE A;  4BHB A;  3CUQ A;  4ENJ A;  3ZQ7 A;  3RKX A;  3KCC A;  2FBH A;  3TOA A;  3ZP5 A;  1XDU A;  3C18 A;  3I58 A;  5AIQ A;  4U0V A;  3CUO A;  3EYI A;  4QWQ A;  3L2C A;  1J9I A;  2OQG A;  1IXS B;  3MFK A;  3JTH A;  1YIO A;  1KU9 A;  5JVT A;  2VXZ A;  5DUI A;  5J6X A;  3P7N A;  1XD7 A;  3PQK A;  5ED4 A;  1IW7 F;  4Q4Z F;  4ESB A;  3MWM A;  5KVR A;  2NRA C;  1T6S A;  3FXU A;  5E18 F;  3RI4 A;  1XMA A;  2GQQ A;  1SFE A;  1GVJ A;  2ZBK A;  1ODD A;  1OYY A;  4IHT A;  1Z1D A;  3ERE D;  2IA2 A;  3ZMU A;  3KFW X;  2QZ8 A;  1BI1 A;  4E70 A;  1EH7 A;  2EK5 A;  4RB3 C;  2WWY A;  2Y48 A;  3MQ0 A;  1UFM A;  1ZLK A;  1TBX A;  4HX7 A;  1U8R A;  4M9X A;  4OOI A;  1QO0 D;  1O3S A;  1FBQ A;  1Z6T A;  2A3S A;  2GAU A;  3TQN A;  4PCQ A;  4AIK A;  4OIP F;  2L3D A;  1XSV A;  3L00 A;  5DEQ A;  5FB2 A;  1YW7 A;  1C0W A;  4CHU A;  4U0Y A;  2DO7 A;  5L3C A;  3VEP A;  2P6T A;  4A6E A;  1Z7U A;  3ZN0 A;  3MCZ A;  1IN6 A;  1FYK A;  4H0E A;  2AXL A;  3GFL A;  2OU2 A;  2DLL A;  1R00 A;  3U2R A;  3RPU A;  4GYI A;  5CYV A;  4D0P A;  1IRG A;  3K9T A;  1Q1H A;  3V8J A;  2XV4 S;  4RAZ A;  4UUV A;  3TGN A;  2HDC A;  4XBF A;  1TQI A;  1GXQ A;  2CWE A;  2M8E A;  5HS9 A;  4HA8 A;  4WXC A;  3E6D A;  2M5W A;  3F8M A;  3DEU A;  3BJ6 A;  5FO5 A;  5LEK A;  1XCV A;  4A12 A;  2A6H F;  1SD4 A;  4OMZ A;  4ZZL A;  1L0O C;  4I2O A;  5F64 A;  2GXB A;  4KMU X;  4M6Y A;  1XSD A;  4Z2Y A;  2NS0 A;  1W4M A;  2VBZ A;  1FP1 D;  4HYE A;  3SQN A;  2D45 A;  2PI0 A;  3IC7 A;  2RN7 A;  1JE8 A;  3K1M A;  2YU3 A;  4IXA A;  1MJB A;  1H0M A;  2G9W A;  4Q47 A;  2EJR A;  1HW2 A;  3T8T A;  2EA2 A;  1HXD A;  1T38 A;  4XSZ F;  3GWZ A;  5FFZ A;  4EVI A;  1B1B A;  3T1B A;  3TKY A;  2VN2 A;  4IRG A;  4XSX F;  3P9C A;  2A5Y B;  1P4W A;  2B0L A;  3JAM K;  2GWR A;  2Q0O A;  3HRS A;  1MDM A;  1GHC A;  4MEX F;  4M6X A;  2Z99 A;  4A0Y A;  2PMU A;  1IRF A;  1U3E M;  2EFW A;  4BHP A;  4DNC A;  3ISP A;  4N0B A;  4ZYH A;  3HRT A;  4OIQ F;  1G3T A;  4YII A;  4HX8 A;  1HW1 A;  4KDP A;  1LEB A;  5CVR A;  3B73 A;  4JBA A;  1YQA A;  1SMT A;  5JFR A;  4HAM A;  2O03 A;  3QU3 A;  4LB6 B;  1FSE A;  2X0L A;  3WTX C;  2DQR A;  1BIB A;  3WTT C;  5LRS A;  1W5T A;  1J59 A;  4M74 A;  3FHZ A;  3FZV A;  5E1W A;  3LST A;  3C3W A;  3SZP A;  1FBU A;  4LFU A;  1LB2 A;  2GZW A;  5L3B A;  3WTZ A;  1B9M A;  2KKO A;  2KJB A;  2RC4 A;  1U5T B;  3LQQ A;  1IAW A;  1W7P B;  3Q5F A;  2FNP A;  2CO5 A;  1MKM A;  1TNS A;  2BE5 F;  2RV8 A;  4RGS A;  2XAS A;  3O3K A;  1UHM A;  4G6Q A;  5HLI A;  2RGV A;  4CYD A;  2W24 A;  5FD6 A;  5H6R A;  3P9K A;  5LLQ A;  1I5Z A;  5D8L B;  2DK8 A;  2EWN A;  4BH9 A;  1RNL A;  5TRD A;  5HS7 A;  4MQ9 F;  2L02 A;  3GZ6 A;  1T98 A;  1ON1 A;  4MNU A;  1O3T A;  2VBX A;  3GXO A;  3S2W A;  5LGU A;  4FX4 A;  2GA1 A;  3F8C A;  3GZ5 A;  2DFI A;  4UV9 A;  4ENM A;  1XSX A;  3KLO A;  1U5T A;  4HV5 A;  2H94 A;  2HOE A;  4G7H F;  1W7P A;  2E1C A;  1TNT A;  1R1T A;  5IT9 K;  3E5X A;  3Q9V A;  2VC1 A;  2QQA A;  2PLY A;  3ABU A;  3BWG A;  5CLS A;  1A04 A;  3FM3 A;  2XAJ A;  5HVQ C;  3VB2 A;  2NYX A;  2RKH A;  3CO6 C;  1DDN A;  4ASN A;  2XAH A;  3WTY C;  3IWF A;  2QBY B;  3CTA A;  3DV8 A;  3J81 K;  3WU0 A;  5DCM B;  3WE2 A;  1MZB A;  1ZLJ A;  1Z9C A;  5LRR A;  2FQ3 A;  1S7A A;  4EJU A;  2DPD A;  3ZN1 A;  4LK0 F;  3DXJ F;  4HF0 A;  4HQM A;  4RB1 A;  4GXO A;  4K2E A;  3T5X A;  1OYW A;  5BPI A;  4B09 A;  4IPA A;  3TOB A;  4S04 A;  4UV8 A;  5FLX K;  1B59 A;  2FBI A;  3V4G A;  4FT8 A;  4WCG A;  2LKP A;  2AS5 F;  3K1N A;  1SFX A;  1R5G A;  3OOP A;  5D5W B;  4KIF A;  4NQW A;  1I1S A;  1S8N A;  3IL2 A;  4I02 A;  4KN4 X;  4CDG A;  5DCM A;  3F8B A;  4KNY A;  2FRH A;  3KP5 A;  2M1B A;  2OA4 A;  1DPU A;  4QLC U;  1SD7 A;  1ZGJ A;  5AIP A;  2IA0 A;  2PG4 A;  4LMY A;  3QRF F;  1QGP A;  1DUX C;  1G3S A;  5J8F A;  2CYY A;  2V9V A;  1G3W A;  2ZNZ A;  5ICF A;  4KIC A;  1KQ0 A;  1J5Y A;  3M8E A;  4XLP F;  4ESF A;  3FXR A;  2HWV A;  1AWC A;  4G9Y A;  1XGN A;  2FEZ A;  1MJ9 A;  4ZZD A;  1X3U A;  3VOD A;  3ZMZ A;  2DK5 A;  1G3Y A;  1SFU A;  4YFK F;  1LJ9 A;  4KMF A;  1J75 A;  2UXN A;  4ZYG A;  1ONV A;  2IJL A;  3J80 K;  4A0X A;  4HX4 A;  3KLN A;  4EGZ A;  1ULY A;  3EDP A;  3HTU A;  4OU0 A;  3IHU A;  3HTS B;  2FA5 A;  2P5K A;  4KA4 A;  1REP C;  1OR7 A;  4XLN F;  3RIR A;  1WSU A;  4GYG A;  2KIM A;  3HRU A;  4M9S A;  2V1D A;  1KU2 A;  4MQV A;  2O8X A;  2BGC A;  3COA C;  1JGS A;  3MEX A;  5HLG A;  2JPC A;  3FM5 A;  1LVA A;  4A6D A;  3KET A;  2QYO A;  4G7O F;  3F8N A;  2QUF A;  1USS A;  3G73 A;  1YO5 C;  2MLG A;  1HQC A;  2ZME B;  4P55 A;  4A0Z A;  4M73 A;  3HHG A;  2MBF A;  4B8X A;  5HS8 A;  1H9T A;  2WTE A;  2FMY A;  3LA7 A;  4IJA A;  1BC7 C;  2J5O A;  1TQP A;  3MZY A;  6PAX A;  1EH8 A;  1HW5 A;  2XAQ A;  3R0A A;  4RB2 C;  2F5C A;  3TDZ C;  2RVC A;  3WTV C;  4ETS A;  4HDV A;  2FML A;  1J0R A;  5E1Z B;  4HOB A;  2IRF G;  4HLX A;  3SHF A;  3WOD F;  3DKW A;  2JPB A;  3LAP A;  1P4X A;  2QQ9 A;  1YTY A;  4ON0 A;  1XGS A;  4ZH4 F;  2ZME A;  3I59 B;  1P4A A;  2EFN A;  2E1N A;  2JT1 A;  3KE2 A;  2L4A A;  4M71 A;  5DD8 A;  4YG2 F;  2STW A;  3R61 A;  3RKY A;  4BHC A;  4ZYE A;  4RB0 A;  1B4A A;  1TW3 A;  1G4D A;  4O3M A;  2HFH A;  5K5R A;  4LLG F;  3JAM Z;  2ESN A;  4WWC A;  1R58 A;  2P7C B;  1ZYR F;  2QEN A;  2ESH A;  1ZRC A;  3LA3 A;  2EV0 A;  2PMH A;  4RGR A;  4NHJ A;  3HRM A;  1BI2 A;  3KEO A;  2LF8 A;  4KUM A;  3LFK A;  3CJN A;  4Y13 A;  2VOD A;  2EFP A;  4WK8 F;  3DF8 A;  4RGX A;  2DAO A;  3EUH A;  3I59 A;  2FNA A;  4UNO A;  3I54 A;  4MGR A;  2ZKZ A;  2WV0 A;  2PQ8 A;  2QM3 A;  4OIN F;  1ZG3 A;  4A5N A;  1STZ A;  2OBP A;  4ESJ A;  3ECH A;  1T39 A;  3T0Y A;  1O57 A;  3ZMT A;  3JTG A;  1S3J A;  3MAJ A;  1K6O A;  1IN4 A;  3H3U A;  3M1E A;  4WF2 A;  3E3V A;  1WI9 A;  3WGG A;  4LD5 A;  2XIG A;  2G7H A;  3RDI A;  1ZRD A;  2W25 A;  2DI3 A;  1KU7 A;  4KN7 X;  1O3R A;  4A2U A;  3GFJ A;  3Q9S A;  4RGU A;  3M8F A;  2EB7 A;  2YR2 A;  5D4R A;  3HUG A;  4I7H A;  4GCV A;  2OZ6 A;  5DYM A;  5J8C A;  1FYL A;  4F7Z A;  5DUK A;  2QLZ A;  4G8X A;  2R7F A;  1TTY A;  1V4R A;  5LEJ A;  1RI7 A;  5IT9 Z;  3QAH A;  4S05 A;  4L9V A;  1FZP B;  1O3Q A;  3BOQ A;  4HQE A;  2O3F A;  3REO A;  3I5U A;  1RIO H;  4BYY A;  4IVN A;  2QWW A;  2D2W A;  3SFZ A;  1H9G A;  3LQR A;  3SXY A;  3J81 Z;  1UHW A;  3IKV A;  1JHH A;  1UB9 A;  2K86 A;  2VOO A;  3RTR A;  4NB5 A;  1KYZ A;  1FLI A;  1YFH A;  3J7A O;  2H6B A;  1KQ9 A;  1OKR A;  4LG0 B;  2OAZ A;  3FF5 A;  2GXG A;  4JQF A;  5D5U B;  1QPM A;  5FLX Z;  1FP2 A;  2OZU A;  3BZ6 A;  2HQN A;  1O7L A;  3F23 A;  5HDN A;  1FPQ A;  4LGW A;  4LB5 A;  1TW2 A;  3ZMS A;  3H3Z A;  3K1P A;  2TDX A;  4UVC A;  2DPU A;  5E17 F;  5BS6 A;  2F5F A;  3H92 A;  2HTS A;  3FX3 A;  2Z3Y A;  5L3D A;  2K02 A;  5CJ9 A;  5FGM A;  2QQB A;  1UST A;  2EV6 A;  1EH6 A;  2JSC A;  4WXD A;  4EM1 A;  2BEO A;  3RJP A;  3RKW A;  3ML6 A;  3KP2 A;  1P6R A;  1BN5 A;  2FBK A;  3LWF A;  1D3Y A;  1D8K A;  4P9F A;  3LA2 A;  1R1V A;  2DQL A;  3IRR A;  2P6S A;  4LG0 A;  2O6G E;  2R7D A;  3U1D A;  2Q8K A;  5E8G A;  2FXA A;  1YLF A;  4G7Z F;  5ILS A;  4MHG A;  4FX0 A;  2G7U A;  2V1U A;  4OMY A;  4EM0 B;  3JW4 A;  1J2X A;  2UWM A;  5CVI A;  3R60 A;  3RYP A;  4ZYD A;  1D5V A;  3E5Q A;  4L5I A;  5DV5 A;  4AWX B;  4A5M A;  4FHT A;  3E6M A;  3IWZ A;  4KYW A;  3GW2 A;  4L0Y B;  2D1V A;  2LF7 A;  2IVM A;  4JK1 X;  3DQV C;  4PGG A;  3FMS A;  4CGZ A;  2LNB A;  3QP6 A;  1BJA A;  2CW0 F;  1QZY A;  3BPX A;  1ZRE A;  2ZCW A;  3J80 Z;  2OD5 A;  4L9T A;  2CGP A;  1LNW A;  3B02 A;  4BQA A;  2XHK A;  3GFM A;  4M9Z A;  2ZFW A;  1SMY F;  3SZT A;  3QOP A;  4EMS A;  2E7X A;  1IN7 A;  1D8J A;  3G3Z A;  5D8K B;  3HSE A;  1ZG5 A;  1S6L A;  2O0Y A;  1TLH B;  4AIJ A;  4WX9 A;  1WRJ A;  3N4M A;  4Y17 A;  2LSO A;  1IF1 A;  1YW9 A;  5A2Q K;  4RAY A;  3GEZ A;  4I0B A;  4YIF A;  1HKT A;  2QBY A;  2FSW A;  3RYR A;  5ICC A;  2M30 A;  4LJZ F;  2Y75 A;  2HGC A;  3ECO A;  1SAX A;  1HBX G;  5FD5 A;  2NNY A;  3I64 A;  1BBY A;  2Q2E A;  5JI6 A;  1FSH A;  3BJO A;  3O6B B;  4PZJ A;  2D1H A;  2ACJ A;  1FOK A;  2FF4 A;  2ISY A;  3F22 A;  3R6S A;  1SD5 A;  4GGG A;  5L3F A;  3CUQ C;  1FC3 A;  1IUY A;  3O2P E;  1B6A A;  3BDD A;  1XMK A;  2Z33 A;  5EEG A;  3E6B A;  1QQI A;  1BI0 A;  2Z5U A;  5EEH A;  4AIH A;  1R1U A;  5CVU A;  1I27 A;  2R3S A;  1WWX A;  1OMI A;  5E1X A;  3D5L A;  5IT3 A;  2FE3 A;  4IRI A;  2VBW A;  4EJT A;  3W6J B;  5LGT A;  4MTE A;  4CO8 A;  2IT0 A;  3KZY A;  1W5S A;  4UVB A;  3GFI A;  3N97 A;  2YPR A;  4BXU A;  3NQO A;  1FT9 A;  2UXX A;  2V79 A;  3GX4 X;  1HST A;  3GLX A;  3HHH A;  3U9G A;  2BV6 A;  4R1H A;  1KYW A;  4HDU A;  3ELK A;  3PQJ A;  3HSF A;  3F21 A;  3W6K B;  3ULQ B;  2HR3 A;  1K79 A;  1ZGA A;  1RUN A;  1ZRF A;  5DDG A;  4HLY A;  5JHU A;  2K7L A;  3WU1 B;  3DFG A;  1Z91 A;  2MH9 A;  3NEU A;  3CO7 C;  2NNN A;  4CXF A;  4TV7 A;  2F5D A;  1IZ1 A;  4GO1 A;  2HTJ A;  1FYM A;  2KIU A;  4KFC A;  4XRF A;  2UZK A;  1CGP A;  1R22 A;  5AON A;  5ILV A;  3M7G A;  4UXN A;  1YS7 A;  2GIV A;  3WG9 A;  1LQ1 A;  3KP6 A;  4L18 B;  2HEO A;  1P92 A;  3K2Z A;  4U7B A;  2MD5 A;  2DTR A;  1F9N A;  2VC0 A;  3F3X A;  5ILU A;  2A6E F;  3D0S A;  1QZZ A;  2E7W A;  5FFX A;  3QPH A;  5BOX A;  3LAJ A;  2H6C A;  2ELH A;  3HYI A;  2VON A;  1YW8 A;  1AOY A;  3CLO A;  3HIF A;  4WXH A;  4EM2 A;  1QNT A;  4KIB A;  2P7V B;  1ZH5 A;  1IN5 A;  4ENN A;  4Y15 A;  2V1X A;  5BMZ A;  4O5V A;  2MC3 A;  2IA1 A;  4M72 A;  3BPV A;  1KU3 A;  4UHT A;  2OQR A;  3WGH A;  4Q48 A;  2VE9 A;  1K7A A;  1E2X A;  1F5T A;  1HSJ A;  1HKQ A;  2ADU A;  3L9F A;  2Z9O A;  1U2W A;  5K5Q A;  4EJV A;  1KGS A;  2P4W A;  2M45 A;  2KJC A;  2CQK A;  2MLK A;  3QP5 A;  3GVA A;  1DPR A;  1RZ4 A;  3C1D A;  1WQ2 A;  2MH2 A;  1SD6 A;  3C7J A;  2H09 A;  3TO6 A;  3ROU A;  5HOO A;  3WTS C;  3E97 A;  4P9U A;  3I4P A;  5HDG A;  5ERI A;  3ZPL A;  1XDS A;  2YX7 A;  4EGY A;  2K27 A;  2XUB A;  4I0A A;  3KP7 A;  1MD0 A;  3I53 A;  4BNC A;  2K4J A;  4PGH A;  4YFN F;  2FU4 A;  3WTU C;  5K1Y A;  3KP4 A;  2KIF A;  1BC8 C;  3I0T A;  2XRO A;  1YS6 A;  5D6E A;  2RQP A;  1MDM B;  1JXS A;  1QBJ A;  5BPD A;  2BYV E;  2IP2 A;  4EV0 A;  5CVV A;  3V7R A;  4I01 A;  4BAY A;  3AAF A;  1FBS A;  2X4H A;  2W84 A;  2STT A;  1FNN A;  1UCR A;  1ZAR A;  1XGO A;  4L0Z B;  1W7P D;  1J7K A;  1ZG1 A;  2RDP A;  1Y0U A;  3GUD A;  2A07 F;  2HYG D;  2HKO A;  2ZXJ A;  4IRH A;  2H27 A;  4AD9 A;  2P5L C;  1ZHF A;  3RPQ A;  1NHA A;  3L09 A;  3E6C C;  1TQM A;  1R7J A;  4U0W A;  3IRQ A;  1L3L A;  3L7W A;  2M87 A;  3R4K A;  4HW0 A;  5H20 A;  4LLL A;  1K78 B;  4CIC A;  4YFX F;  1R36 A;  3P9I A;  5LHH A;  1ZN2 A;  1O7F A;  1F4K A;  2VT2 A;  1XGM A;  1U5T C;  5HLH A;  1BOA A;  1WKM A;  3WE3 A;  3GYH X;  2P8T A;  5ICE A;  4R8H A;  1V3F A;  2VOP A;  2BBY A;  2O61 A;  2ZNY A;  3E5U A;  4Q5S F;  2PEX A;  2XKP A;  4EJW A;  2W85 A;  2HQR A;  5D4S A;  4P5O A;  3V7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...