4RGUA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with ferulic acid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
141
Chain Sequence
b'REEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLSTFSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with ferulic acid
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription
total genus 43
structure length 141
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rguA00
1ZN2A 1X3UA 3CO7C 4OIQF 1F5TA 4LMYA 4S05A 3MQ0A 5LHGA 3GFMA 3O6BB 4RB3C 1Z91A 2RGVA 1XD7A 3RPQA 3F8CA 3TKYA 3MFKA 5E1WA 1VTNC 2BYVE 1FT9A 2P7CB 2XGXA 1XGSA 1MJ9A 3QRFF 1PUEE 1BI1A 2CWEA 1T2KA 5CLSA 2VE9A 3F8MA 2HDCA 4P9FA 2PEXA 3D0SA 5D4RA 2XROA 4CHUA 2P5VA 3L7WA 3JW4A 2P7VB 4M6XA 1U2WA 4IXAA 1IXRC 2G7UA 1R1TA 4OMYA 4A5NA 1ZRDA 1EH7A 5ERIA 2PI0A 4MHGA 3GXOA 1IZ1A 1IF1A 2A61A 2ZNZA 3IC7A 1BI0A 4LK1F 1ONVA 1DPUA 2VC0A 2JZYA 2W57A 3I59B 4UV9A 2B0LA 3KP2A 3BWGA 2HS5A 3AAFA 3ABTA 4FX4A 4RGXA 3G3ZA 3KCCA 1IUYA 1I27A 1BBYA 4I01A 4WXCA 2PMUA 4A5MA 4O6JA 2IW5A 2EV0A 2FNAA 1FNNA 4L9JA 3MEXA 2PG4A 4CICA 1SMTA 2OQRA 1K79A 4I7HA 2HKOA 2A07F 3ISPA 2COMA 2AS5F 2FBKA 2MH9A 4LFUA 3HRSA 4U7DA 1UHMA 1CF7A 1KU9A 3E5UA 1MJBA 4KIFA 2EK5A 4LG0A 1IN4A 1XDSA 1LEAA 4U0YA 4M9SA 2FMYA 2LF8A 4BHBA 2OU2A 1RIOH 5AONA 2HQRA 3P9CA 1Z05A 4KYWA 3T8RA 3RYPA 4PZJA 3E6MA 2Z3YA 1FYMA 4RB2C 4G6DA 4UUVA 1B1BA 3BROA 2IJLA 1XN7A 1P92A 5JVTA 1DUXC 4LB6B 1L0OC 3K2ZA 3GZ5A 1DP7P 1KU2A 2K7LA 3H92A 1P4AA 1FBSA 4UVAA 4HF0A 2EV6A 2XASA 5LGUA 1L3LA 4UNOA 3RDIA 1TLHB 3TO9A 4UHTA 1U5TA 3M8FA 3HRMA 5HDGA 3ZQ7A 5JFRA 1LVAA 3P9IA 2NNYA 1SD4A 3EUHA 3L2CA 3FM5A 5E1ZB 1HKTA 2V1XA 2NRAC 4HV6A 1BI3A 4IF4A 4YFXF 1G3WA 2FA5A 2OZUA 1SFXA 2Y0MA 1SFUA 3SQNA 1K78B 2HQNA 2MA3A 2HTJA 4BHCA 3U1DA 3IHUA 2L3DA 3ZPLA 1E2XA 3RI4A 2GAUA 2HEOA 4KIGA 2DQLA 1R7JA 5HS8A 2WC2A 1J9IA 2ESNA 1OYWA 1ON1A 2QVOA 2BGCA 1JHHA 2ZKZA 3QPHA 2ZMEA 2DO7A 1FYLA 1ZHFA 3JSPA 3BJAA 2WWYA 2DPUA 4WCGA 3IKVA 1XB4A 4ETSA 1P2FA 3LA7A 1FOKA 3MZHA 4D0PA 5K1YA 2XKPA 4RGUA 1LDKB 2F5EA 2YU3A 2DBBA 4AVPA 2A6EF 2FOKA 1W4MA 5E8GA 3E6DA 4HF1A 1BN5A 4EGYA 2XKOA 2VOPA 1FBQA 2JPCA 3EYIA 1KU3A 3LQQA 3KP7A 3WTSC 4ZZDA 2MD5A 4A0XA 2NAZA 1FC3A 2UXNA 2HZTA 1U8RA 3C7JA 1FY7A 3E5QA 3K1PA 3LAPA 2W25A 5E8IA 2HWVA 4L9NA 3IRRA 4F7ZA 4LLNA 5FLXZ 1IN5A 2LNBA 1G3YA 3DP7A 2KRFA 3F3XA 4LGWA 1ODDA 3ZMTA 1K7AA 4OIRF 2P6SA 2P5KA 2PN6A 2EWNA 1UB9A 1MD0A 5H20A 3ABUA 1LDJA 5IT3A 4AIJA 2QZ8A 3V7SA 3EDPA 1TNTA 3CO6C 3BY6A 4A6EA 1J0RA 2V1UA 2IPQX 3JAMZ 1J59A 2EV5A 3V8KA 2FBIA 4RB0A 1D8JA 2ISYA 4LD5A 2ZCWA 3FHZA 4GCVA 4NHJA 2JTVA 1HSJA 5FB2A 4ENJA 2FEZA 5HS7A 3ROUA 4PGGA 3KLOA 1U6GA 1EH6A 2Z33A 5CYVA 4UXNA 2STWA 1IRGA 4G7HF 5DCMB 3IKTA 4I09A 4ZYDA 2KIUA 2JPBA 1ZYRF 4YG2F 2Z5UA 4Q47A 4CZZA 3ERED 3FMQA 1W7PA 3HRTA 4CGZA 2GA1A 2CG4A 2D1VA 1XSXA 4L5JA 4ESFA 1HW1A 3DQVC 1LJ9A 4WK8F 4M72A 2O0YA 2EFWA 2YX4A 1U5TB 2LF7A 2XAGA 4XBFA 2E1CA 1U5TC 3L9FA 4N9HA 1RNLA 2FE3A 1XGMA 2XAJA 1ZLKA 3J7AO 1I5ZA 5E17F 1YW7A 4LJZF 2FMLA 3BP8A 3K9TA 3WTUC 1P6RA 2CSOA 4IHSA 2ELHA 2JT1A 2IRFG 4MEXF 4O5VA 3KEQA 1ZH5A 3CUOA 4G6QA 5J8CA 4GYGA 2F5DA 1YW9A 2RNJA 4KN4X 3DKWA 3GW2A 5FGMA 2CFXA 3RIRA 1BIBA 4MEYF 4Y17A 2NNNA 4ZYEA 2ADUA 4IRIA 4PDKA 5DEQA 4YFNF 4KN7X 2L4AA 3BJOA 3KEOA 4ENKA 2RV8A 4RAYA 3M8EA 4QWQA 1XCVA 2ACJA 2F5FA 3I64A 1W7PD 2A6HF 3SZPA 2UWMA 1Z6TA 2GWRA 1QZZA 2H6BA 2P8TA 3FXRA 1FP2A 4PGHA 5LGTA 1W5SA 5D5UB 4IPAA 5HDNA 4KFCA 1JE8A 4MQ9F 4Y13A 1FSEA 4N9IA 3C3WA 3GX4X 1WRJA 3FF5A 2A68F 4KIBA 4HX7A 1KA8A 3BPXA 2KIFA 3PQJA 1E17A 1D5VA 3VOEA 3MAJA 2VONA 3CUQA 2P4WA 3F6VA 1GHCA 4K2EA 4B09A 1TTYA 5E18F 3GZ6A 1F4KA 3KP3A 1R22A 1G3TA 3JTHA 2O6GE 3FXQA 1QPMA 2CGPA 2IP2A 1UFMA 2KKOA 2BBYA 1ZRFA 5HS9A 1ON2A 1ZG5A 1Z6RA 1R1UA 2X0LA 3QPTA 4KMFA 5JHUA 5F64A 4I98B 2ZFWA 2Q2EA 1FPQA 2TDXA 2QENA 2YR2A 3T1BA 1SD6A 4MGRA 3LA3A 4ASNA 2OD5A 5K5RA 5EEGA 3E3VA 1B4AA 1T6SA 4EJUA 4EQQA 3DPLC 4XLPF 3RKXA 4IJAA 3HRUA 3T5XA 2VT3A 1TW3A 2H6CA 2R7DA 5A2QK 1TQIA 3W6KB 1BJAA 2L01A 3G73A 2L02A 3HYIA 4FT8A 3R0JA 1XGOA 2D45A 5D6FA 1ZG1A 1B59A 5BMZA 4BQAA 1TW2A 5ILUA 3WGHA 1WKMA 3HOTA 3R61A 5H6RA 4XLNF 2PBIA 1FX7A 1OYIA 4LLGF 4A2UA 5CVJA 4EV0A 1T38A 1OR7A 1MKMA 1W5TA 1SMYF 3VFZA 5D5VB 5L3EA 5HOOA 3GO5A 2HGCA 3ZMSA 3M7GA 1DPRA 2DI3A 1HQCA 5CVRA 1YW8A 2QQBA 4HF2A 1KYWA 2ISZA 4HA8A 4IRGA 2O8XA 1KYZA 3WU1B 3GEZA 1QBJA 1RI7A 1YS6A 5LRSA 1G3SA 2E7XA 3QOPA 3GFIA 2QQAA 4MQVA 3WODF 2OQGA 2K27A 5L3GA 4KUMA 3P9KA 1YIOA 2M1BA 1MDMA 4WF2A 2M8EA 3HUGA 2O61A 2VBYA 2IVMA 1LEBA 1SAXA 1USSA 2RDPA 1XSVA 2JRTA 4I0BA 1FLIA 4IRHA 2F2EA 2QBYA 4M73A 1I1SA 3BPVA 3TDUC 3N4MA 2XRNA 1GXPA 3KETA 1J5YA 3J80Z 4M74A 3MCZA 3T8TA 1RZ4A 1TQPA 2X4HA 2MC3A 3TQNA 4KT5C 5L3FA 3V8JA 4JK1X 1BC7C 1XSDA 5DUKA 3KP5A 1F1ZA 1IAWA 2HYGD 2XAHA 3D5LA 5F1RA 3QP5A 5H6QA 2QWWA 5D4SA 4ENNA 4L0ZB 3F22A 3KZYA 3COAC 3C18A 2EA4A 2XV4S 1YS7A 3LAJA 1HKSA 5LHIA 1V3FA 3J81Z 1NHAA 1KQ0A 2OA4A 5CVVA 1O7FA 1FP1D 3GF2A 3CUQC 4AIHA 3MZYA 2RKHA 4EM2A 2J5OA 2MBFA 1O3QA 1TNSA 2EB7A 1O57A 2NS0A 1QGPA 2FF4A 2ZXJA 1T39A 4FHTA 2DQRA 1JGSA 1ZAOA 4OU0A 5EEHA 4CYDA 1IN7A 3BZ6A 4ESBA 2PFBA 3ZMUA 1SFEA 2LKPA 2R3SA 3JSOA 1YO5C 1U78A 3ELKA 4ZZLA 4YIFA 2A69F 3E5XA 5ILVA 2FNPA 1FBUA 2PJPA 3WTVC 4M71A 1H9GA 5ED4A 3KE2A 4DNCA 4GO1A 2FRHA 4GXOA 5D8LB 4HQEA 2XIGA 5ICGA 3WTZA 3F8BA 3F6OA 1FYKA 4KMUX 3GVAA 4M9ZA 3HSRA 3OV8A 3GWZA 3WTTC 2YPRA 2GXBA 4G7ZF 3LA2A 4A0ZA 2VODA 3B73A 2OZ6A 3K1NA 1CF7B 3NQOA 3U2RA 4LG0B 5DV5A 3I59A 3R0AA 5DD8A 4ESJA 5IT9Z 4KA4A 1J75A 3WGIA 3TO7A 3R4KA 1ZRCA 1IXSB 2NYXA 3HSEA 4CDGA 4IHTA 1T0FA 4I02A 1ZG3A 3WTYC 3ZP5A 4H0EA 3WU0A 5D5WB 2EFPA 2MLKA 2FQ3A 5E20A 2VN2A 3IWZA 1XMAA 3J81K 4HDUA 1B9MA 3I71A 4P96A 3Q5FA 5LEJA 2FSWA 3WE2A 5DDGA 3CJNA 5DYMA 4XRFA 1B6AA 5FO5A 2Q8KA 1LNWA 1XDUA 4XSXF 1S3JA 2A3SA 2RVCA 3KP4A 5CVUA 2XVCA 1ZGAA 4HYEA 3DPTA 5LEKA 1V4RA 1OKRA 1O3RA 2ZO4A 5HLGA 5LLQA 1MDMB 4Y15A 3F23A 4DQ2A 5HLHA 3VODA 1FWZA 3V7RA 1HSTA 3GUDA 4G94A 5FLXK 4QLCU 3WGGA 3ZMVA 2E1NA 3P7NA 3F21A 2HFHA 2QBYB 2QLZA 4L9TA 2PLYA 1IRFA 2W24A 4TV7A 2OAZA 3CDHA 3EYYA 1S8NA 4GYIA 3WTXC 1GVJA 2VBZA 2HKXA 4CO8A 3HSFA 3ZN0A 5K5OA 3ZN1A 4R8HA 2O03A 3DXJF 3JAMK 1QQIA 3HHGA 2ZNYA 1BIAA 4UVCA 3Q9SA 3K69A 4Z2YA 3CTAA 1ZREA 3IRQA 4WXHA 5IT9K 2RQPA 1QO0D 3GYHX 2ZMEB 2K86A 3MWMA 1QNTA 2K02A 3ECHA 1G6NA 2CO5A 3FM3A 1K78A 2DK8A 2H94A 2M45A 3R60A 1WWXA 5BS6A 3HOSA 3REOA 3I58A 3M1EA 2K4JA 1O3SA 3I54A 1MZBA 1R5GA 2RN7A 1R23A 4MTEA 4BHPA 3ULQB 2P6TA 4EM0B 3EQLF 2DFIA 2UZKA 2DLLA 2MLGA 2F5CA 4L18B 1USTA 2BEOA 2A5YB 2HYFA 4HX8A 2GA2A 3E6CC 2DW4A 1Q1HA 1S29A 1JXSA 5J8FA 5DCFA 2BE5F 2Y75A 1Z1DA 4A0YA 3GLXA 3EETA 2VBWA 4B8XA 3BDDA 3TGNA 3OOPA 4OIPF 1J7KA 3TOBA 3M9AA 1RUOA 1R00A 3E97A 3GFJA 4HBLA 3GFLA 5L3BA 2BV6A 5LBQA 2LDUA 1WI9A 5E1XA 5AIQA 2G9WA 3RPUA 1PP7U 4ON0A 2EFQA 4MTDA 2VOOA 1HXDA 1G4DA 1F9NA 2QQ9A 4EM1A 3DF8A 1XMKA 4UVBA 1A04A 5ICCA 2GIVA 3V4GA 3QP6A 1H0MA 4EJWA 1YYVA 4A6DA 4HX4A 4EJTA 3IL2A 4ZYHA 2KJBA 2P5LC 3FMSA 4HV5A 3B02A 4A12A 3K0LA 1YTYA 4HAMA 1STZA 4AIKA 4P9UA 4S04A 4ZYGA 4WWCA 1R1VA 1HKQA 4HLXA 2C6YA 3L09A 2EFNA 2R7FA 5F6FA 2Z9OA 4ENMA 4I0AA 4U0VA 1KQ9A 2D1HA 3TDZC 1W7PB 2FU4A 4YIIA 1IW7F 1AOYA 2W85A 3RKWA 4BYYA 1I1GA 1AWCA 2ESHA 3FZVA 3FX3A 1KGSA 3LWFA 2K4BA 2XAQA 2QYOA 3RKYA 4I2OA 1PP8F 2VE8A 1ZGJA 2EA2A 3TOAA 2EJRA 2M5WA 5FFZA 5CJ9A 2VC1A 5LGNA 2KJCA 3SFZA 3V7CA 2ZBKA 5DCMA 5LHHA 4RB1A 1OYYA 3QU6A 2IA2A 4RGSA 4ZH4F 3LSTA 4P5OA 4EMSA 3CLOA 5FD5A 1BI2A 1Y0UA 3HTUA 4OOIA 5BOXA 1S6LA 2GQQA 4HLYA 1GXQA 3FXUA 4JBAA 3W6JB 2FXAA 3I0TA 4CXFA 2LSOA 1EV7A 4NB5A 1P4WA 4L9VA 2V1DA 3N97A 3HTSB 2DT5A 1T98A 2HR3A 1YG2A 2PMHA 5L3CA 1S7OA 1ULYA 3DFGA 2AXLA 5K5QA 3RTRA 3O3KA 1J2XA 2ETHA 1S7AA 1K6OA 2XHKA 1CGPA 1R36A 1IN6A 3C1DA 4R1HA 4AWXB 1IN8A 1XCBA 2IA1A 2VXZA 2M30A 3ML6A 4EGZA 5BPDA 5TJJA 3WG9A 5BPIA 4OMZA 2KIMA 3RJPA 5ICEA 1PDNC 2HTSA 5D5XB 1D3YA 2DU9A 1KQ8A 1XGNA 3I4PA 4O3MA 2WV0A 1FSHA 2L4MA 3CUQB 4UV8A 4L0YB 5KVRA 3PFIA 3QAHA 2CW0F 5FD6A 1ZARA 3ZMDA 3VEPA 4Q48A 2Q0OA 5JR3A 2CQKA 2OBPA 1ZLJA 2H09A 4M9XA 1LQ1A 1EH8A 1OMIA 4RGRA 2RC4A 5TRDA 2Z99A 5ILSA 4E70A 1LB2A 2ZJ2A 1O7LA 4WXDA 1YQAA 2GZWA 4N0BA 4OIOF 1SD7A 3K1MA 3I5UA 4M6YA 1REPC 1KU7A 2UXXA 4PCQA 1R5HA 3U9GA 3R6SA 1UHWA 2PQ8A 1UCRA 3DV8A 3Q9VA 2JSCA 4HW0A 1B9NA 2DAOA 3KP6A 4EJVA 2FBHA 2M87A 4G9YA 4U0WA 4GGGA 4P55A 3H3UA 2STTA 5D6EA 4KICA 2O3FA 4EVIA 1RUNA 3F72A 5LRRA 3J80K 3BOQA 3O2PE 3V8LA 3KFWX 5DUIA 2G7HA 5CVIA 3T0YA 1FZPB 4Q5SF 4KDPA 4HZFA 1TQMA 2XAFA 1Z7UA 4BXUA 4HOBA 3KZZA 1H9TA 4AD9A 4U7BA 4U88A 4BH9A 3HHHA 1R58A 3SXYA 2E7WA 5BQTA 5J6XA 1I6XA 3ZMZA 4KNYA 1OPCA 1HW5A 2V9VA 1TBXA 3H3ZA 2VBXA 3FWEA 2QM3A 4LLLA 6PAXA 4G8XA 3S2WA 3LFKA 1YFHA 2VT2A 3ECOA 1BM9A 3F8FA 3I53A 1SD5A 2V79A 2WTEA 2V6CA 4RS8A 4OINF 1HW2A 1DDNA 3PQKA 3KLNA 1HBXG 3JTGA 3WE3A 3E6BA 1QZYA 4R79A 3TO6A 4HDVA 3VB2A 3LQRA 2HOEA 1U3EM 4NQWA 2XUBA 1WSUA 5HLIA 2J5PA 3NEUA 3QU3A 4YFKF 2L54A 2IA0A 4G7OF 3WTWC 1O3TA 1Z9CA 5KK1A 4Q4ZF 5ICFA 2Y48A 1MGTA 2QUFA 5L3DA 4MNUA 1D8KA 2MH2A 4BAYA 4RAZA 5FFXA 4EJOA 5D8KB 5HDKA 2IT0A 1MJAA 5HVQC 5AIPA 3L00A 2DPDA 1YLFA 4HQMA 4XSZF 1C0WA 2YX7A 3SZTA 2W84A 2D2WA 3SHFA 2YSRA 4L5IA 3NRVA 4BNCA 4JQFA 5A2QZ 1WQ2A 3RYRA 3IWFA 4LB5A 2DTRA 1BOAA 1JHFA 5DD4A 2H27A 4FX0A 3DEUA 5JI6A 3FMRA 2DK5A 3F8NA 2CYYA 1LDDA 3HIFA 4WX9A 1IXCA 2GXGA 1BC8C 2EFOA 3BJ6A 4LK0F 1P4XA 4IVNA
chains in the Genus database with same CATH superfamily
1ZN2A 1X3UA 4JX5A 3CO7C 4A93J 4OIQF 1F5TA 3JR9A 4LMYA 4S05A 3MQ0A 2GOMA 5LHGA 3GFMA 2E2HJ 3O6BB 4RB3C 1Z91A 2UUZA 3HOUJ 4PJ0C 3DBLB 3S17J 2RGVA 1XD7A 3RPQA 3F8CA 4RLQA 4PJMA 3TKYA 2L2OA 4ZDOA 2CW8A 4CZCA 2TRTA 2MG4A 1X4OA 5E1WA 3MFKA 2ZC2A 1VTNC 2DYSH 1IC8A 2BYVE 1FT9A 2BZTA 2P7CB 2XGXA 1XGSA 1MJ9A 4YIRX 3HKZN 4D9JA 2LY9A 3QRFF 2UV1A 1PUEE 4B1RA 1BI1A 2CWEA 3CC4I 2X6WA 2XF5A 1SANA 4ZJZA 4A3MJ 4BE1A 2ZXHA 5CLSA 1T2KA 4CA0A 1D0ZA 1WGXA 3BT9A 2VE9A 3F8MA 3MZ8A 2HDCA 4P9FA 2PEXA 5IYCJ 1TZLA 3D0SA 3TMOA 5D4RA 2XROA 1A6IA 4EATA 2P5VA 4CHUA 3L7WA 3S1QJ 1MBHA 3JW4A 2P7VB 3E7LA 4M6XA 2VKEA 1U2WA 1TT5B 4XNFA 4IXAA 1IXRC 1LKXA 1R1TA 2G7UA 4L5EA 3AG3H 4OMYA 4A5NA 2HDWA 2Y2ZA 1ZRDA 1EH7A 2CQXA 2QA4I 2GXAA 2JQ7A 5ERIA 2PI0A 3M1CA 4MFDA 1ETOA 4B47A 2R7OA 4MHGA 2H1LA 3GXOA 2PMZA 2B7EA 1IZ1A 3FKIJ 3QYEA 1IF1A 3LOCA 3VPRA 4XKVA 2A61A 3BG9A 1JT0A 2ZNZA 4GFBA 4CCKA 1Z77A 1TWCJ 3GLLA 3IC7A 1BI0A 4MIMA 1ZR2A 4LK1F 3BC8A 1ONVA 1DPUA 1G2HA 2VC0A 2JZYA 3L2UA 2W57A 3I59B 4UV9A 2B0LA 4E7IA 1RKTA 3KP2A 3PSFA 1B8IB 2ID6A 1YITI 3BWGA 2HS5A 1BOBA 5J1UA 1WFXA 3AAFA 3ABTA 4FX4A 4BU2A 2QSGX 3K4LA 4RGXA 3G3ZA 3KCCA 1IUYA 4M3BA 1I27A 1BBYA 3PIOF 3D1NI 4I01A 4WXCA 2PMUA 2R7UA 1E3HA 3KYCB 4A5MA 4O6JA 2DA7A 2EV0A 2IW5A 2FNAA 2EH3A 1FNNA 2ZJQF 2QEXI 4L9JA 4BDZA 3MEXA 1JJ8C 2XGEA 3Q3SA 5J47A 2PG4A 4CICA 5GPAA 3FXOA 1SMTA 2OQRA 1K79A 3CDLA 4I7HA 2HKOA 4AIDA 2A07F 3H3VK 3ISPA 5FKKA 2WBMA 2R7TA 1SVMA 2COMA 2AS5F 1H88C 2FBKA 1AA7A 2MH9A 1K6YA 4C2UA 2Y0SA 1Y0NA 1WCMJ 5M5XJ 4LFUA 3HRSA 1U9NA 2X9DA 1UHMA 4U7DA 1T95A 1KU9A 3OYCA 3E5UA 3ZQQA 4BGDA 2NVUB 5EDNA 1MJBA 4KIFA 2V6EA 2EK5A 4LG0A 5CPRB 1IN4A 4DZJA 1XDSA 5DM6F 3OYKA 1HC8A 1LEAA 1XTAA 4U0YA 4M9SA 5FRMA 4FISA 2O8KA 2FMYA 2VKDA 5GAGJ 2R4GA 2LF8A 1MMNA 1OLTA 4BHBA 2OU2A 5EZGA 2DXIA 1RIOH 5AONA 1MMAA 2HQRA 2FUG2 3FXKA 5M3MJ 3P9CA 3FXJA 1FMWA 1Z05A 2ELJA 5H2FC 4KYWA 4HNUA 2WB1N 3T8RA 2X51A 3PIPF 4BJTA 3JRHA 3RYPA 2BHZA 4PZJA 4I76A 3E6MA 3KX2A 2Z3YA 1FYMA 3CMMA 4RB2C 1VQLI 1HDDC 2XB0X 3TP3A 3ZCOA 4G6DA 4UUVA 1B1BA 3OS2A 1JI8A 5HNFA 2KHMA 3CCLI 4IOAF 3BROA 1RKWA 2IJLA 1XN7A 3PFYA 1N25A 1P92A 4XK4A 5JVTA 1DUXC 3QPLA 4LB6B 3G71I 1L0OC 3CJRB 3K2ZA 2QSHX 3GZ5A 4PUSA 1KU2A 2W82A 1DP7P 5B66C 2K7LA 3H92A 4A3BJ 1P4AA 2KL4A 1FBSA 4UVAA 3CD6I 2ZSHB 3AG1H 3OMYA 3S8PA 4HF0A 2EV6A 2XASA 5B1BH 4RAFA 4BEHA 5LGUA 4X1EA 1L3LA 2ID3A 4UNOA 3RDIA 1TLHB 3TBIA 3OS1A 3TO9A 3BTLA 2DA6A 4UHTA 2VJIA 1U5TA 3B6AA 3M8FA 3HRMA 5HDGA 3ZQ7A 1PUFA 3M3YJ 5JFRA 1LVAA 3P9IA 1UZCA 2V7FA 2LKXA 3K4BA 2NNYA 2G0EA 2VXDA 1SD4A 4XICA 5JLXA 3H9GA 3EUHA 3L2CA 3FM5A 5FROA 5E1ZB 1HKTA 2V1XA 2F4IA 4CYCB 2NRAC 3GMEA 4HV6A 1BI3A 3SEQA 1RR8C 4IF4A 2JVHA 1M1EB 1N78A 1D1AA 1TP4A 4YFXF 3GTLJ 1G3WA 2FA5A 2OZUA 4MO7A 1SFXA 2R5YA 2Y0MA 3A1YA 2JWTA 3SQNA 1SFUA 3EPZA 2HQNA 1K78B 2A6TA 2MA3A 2LP0A 2K40A 1FTZA 2HTJA 2D5VA 4BHCA 3U1DA 3IHUA 2L3DA 3ZPLA 3CCEI 3TW6A 1E2XA 3DKXA 3VDXA 3RI4A 2GAUA 2HEOA 4KIGA 2DQLA 3NAUA 1R7JA 5HS8A 2Y9YA 3HOVJ 4I6ZA 2WC2A 2MD0A 1ETVA 1J9IA 2ESNA 1ETWA 1OYWA 1ON1A 4BBSJ 5EG0A 2QVOA 4NC6A 2VQLA 4CCJA 3OIQA 3IP4B 3VYTB 1YX3A 3CC2I 1BW5A 2BGCA 5F0HA 1JHHA 4N4OB 1CF7A 2ZKZA 3QPHA 4B43A 2ZMEA 2DO7A 2R0QC 4H4KC 1TL8A 2GLOA 1FYLA 1ZHFA 3JSPA 3WHCA 4IHWA 3BJAA 1EJ9A 4E7ZA 1N75A 2WWYA 2DPUA 1DQUA 2JA7J 1VQ4I 1HCRA 1XG1A 3L2VA 4WCGA 3IKVA 1XB4A 1TWAJ 4ETSA 3MN2A 2L9SA 2CFOA 2XF6A 4E7JA 4XKWA 3DU5A 2X6XA 1P2FA 3LA7A 4FE4A 2OJED 1FOKA 3MZHA 3SZGA 4D0PA 3BR5A 5K1YA 4DIQA 2XKPA 4FASD 4RGUA 1PJRA 1LDKB 2F5EA 2YU3A 2DBBA 3DBRB 2ZB9A 4AVPA 4W1UA 2A6EF 2FOKA 1W4MA 2P0WA 5E8GA 1IRXA 1X4PA 3E6DA 2F6CA 4XRSA 4HF1A 1BN5A 4EGYA 2XKOA 4E7KA 2V9PA 2Y69H 3IH4A 1MMSA 3HOWJ 4JX4A 2VOPA 1FBQA 2JPCA 1V5EA 4XOPA 3EYIA 1KU3A 3LQQA 2K3PA 1MH4A 3KP7A 1HDPA 3WTSC 2R7QA 4ZZDA 2MD5A 4A0XA 2NAZA 1FC3A 2UXNA 3UNGC 2HZTA 3A01B 1U8RA 3C7JA 1FY7A 3E5QA 3K1PA 3LAPA 2W25A 5E8IA 2HDDA 2HWVA 2WA0A 4L9NA 3CMYA 2CQQA 3LSMA 4J01A 3IRRA 3BG5A 4F7ZA 1NH3A 4LLNA 1IN5A 2LNBA 5FLXZ 3HGYA 1G3YA 1X2NA 3DP7A 2KRFA 3F3XA 4LGWA 2RAEA 1ODDA 3ZMTA 2HVQA 1K7AA 4OIRF 2P6SA 2P5KA 5CQEA 4D5FA 4AUXA 4HNVA 3A0BC 2PN6A 2DA2A 2EWNA 2QKMB 1P9QC 4M3EA 3CDIA 5J40A 3OY9A 2LY2A 1UB9A 1MD0A 5H20A 5E3MA 1QPIA 4Y4RA 2WAFA 3ABUA 1LDJA 2YU9J 5F0CA 3RQ4A 5IT3A 4AIJA 2QZ8A 3V7SA 3EDPA 1TNTA 3LSGA 1MH3A 1I3QJ 3Q0WA 3CO6C 4NDLA 3BY6A 4A6EA 3Q0VA 1G59A 1J0RA 2V1UA 4IHYA 2IPQX 3JAMZ 1J59A 2EV5A 3V8KA 2FBIA 4RB0A 5IP7J 3S1MJ 4Y52J 1D8JA 2ISYA 4LD5A 2EILH 2VQGA 3CF2A 4XKCA 2IEKA 2QQ8A 1UG0A 4QPOA 3BTIA 4RA2A 3VSLA 2DT6A 2ZCWA 3BR6A 3FHZA 4GCVA 4NHJA 2JTVA 1HSJA 4F91B 3O8HA 5FB2A 2IGNA 4XN3A 4ENJA 2CQNA 3RZDJ 1SVOA 2FEZA 5HS7A 3E1SA 3ROUA 5EZHA 4PGGA 4OAYA 2VUMJ 1IDYA 4F52A 2O9LA 3OYMA 3ESWB 1U6GA 2XDVA 3DTEA 3KLOA 2K9LA 5FRNA 1HF0A 1VI0A 1EH6A 2Z33A 4LIUA 2IS6A 2MFZA 5CYVA 4UXNA 3LFUA 5KNLA 2JRMA 1T56A 2STWA 3QYFA 2JA6J 4G7HF 1IRGA 4HSRA 3SEZA 1IO2A 5DCMB 2EINH 3G1OA 4XLAA 1V55H 3JRCA 1MBKA 3V42A 3IKTA 2KDZA 3DPUA 4I09A 4XRSG 4ZYDA 1NTCA 2KIUA 2JPBA 1ZYRF 4YG2F 2Z5UA 1WJDA 3NWTA 4Q47A 4CZZA 3ERED 2HI3A 1T33A 1W7PA 3FMQA 3HRTA 4CGZA 1LE8A 3OL3A 2GA1A 2DDBA 2Y30A 5IYBJ 2CG4A 4IEJA 2D1VA 1XSXA 4L5JA 3CJQB 1RESA 2LD5A 4ESFA 1R5ID 1HW1A 5GAEJ 3DQVC 3QQAA 1LJ9A 4WK8F 4M72A 2O0YA 2OCCH 1WI3A 1U0JA 2IGOA 2EFWA 2YX4A 2AQFA 1S7EA 1U5TB 1ZKGA 2LF7A 2XAGA 1SFOJ 4XBFA 3ONQA 2L7KA 2E1CA 4DZPA 1U5TC 3L9FA 4N9HA 1RNLA 3GTKJ 2FE3A 1XGMA 3FXMA 3ZQCA 2XAJA 5TISC 4XIDA 2JSPA 4PFOA 4RM3A 1ZLKA 3J7AO 1I5ZA 5E17F 3GTPJ 1YW7A 1R4MB 2FMLA 3BP8A 3K9TA 4LJZF 2IGMA 5GP9A 4A3EJ 4KISA 3WTUC 1P6RA 3EUHC 2CSOA 4IHSA 3HB9A 1ITYA 1XC5A 2CU7A 2ELHA 2VI6A 4KJZA 4ZTJA 2JT1A 3CESA 3AL0B 1WJEA 4JYKA 4MEXF 4O5VA 3KEQA 2IRFG 1ZH5A 3CUOA 1RPWA 2L0KA 2MSYA 3AL0C 4G6QA 5J8CA 4GYGA 3RKQA 1Z3XA 3ZOBA 1SC7A 1LPQA 1ZK8A 2F5DA 3G4SI 4OWRB 1W1WE 3F9KA 1YW9A 2RNJA 3K4KA 3DKWA 4KN4X 2EZIA 3GTGJ 3IV5A 1LUJB 1UMQA 2EZHA 3GW2A 3A2KA 1JUPA 1X3WB 2VKVA 5F0FA 2ZJRF 5FGMA 2CFXA 3HZJA 3RIRA 4B44A 4LIVA 1BIBA 4MEYF 4Y17A 2NNNA 4ZYEA 4P1WA 4BL0B 2ECBA 4IRIA 4PDKA 3LSJA 5DEQA 4YFNF 4KN7X 2L4AA 3BJOA 3KEOA 4ENKA 2RV8A 3MMYB 4RAYA 4YELA 1B72A 3QPSA 2W4SA 3M8EA 5K7FA 4QWQA 2YS9A 1XCVA 1VZ0A 2LTPA 3AG4H 2ACJA 2F5FA 3I64A 1W7PD 2A6HF 3SZPA 3IH3A 3TL4X 1Z6TA 2GWRA 2UWMA 1X1PA 4D1QA 4OAZA 1QU3A 2ZMEC 1QZZA 5M3FJ 2H6BA 2P8TA 3FXRA 1FP2A 4U87A 1W36D 3MVPA 4PGHA 5LGTA 3H9JA 1W5SA 4M6VA 5FKMA 5D5UB 1SAUA 4IPAA 5HDNA 4KFCA 5E3NA 4UB6C 4IL6C 1JE8A 2R5ZA 2E5ZA 4MQ9F 2M7AA 4PSWA 3CMAI 4Y13A 2WAQA 1FSEA 4LOCA 3KYLA 4MLOA 4B3AA 4E7SA 3BQYA 4N9IA 5FJ8J 1VQ8I 3D5SC 1OJLA 3C3WA 3ZR8X 2EIKH 3GX4X 1WRJA 3FF5A 3ZGKA 1YX5A 3ZQHA 3OYFA 2A68F 4KIBA 4HX7A 2BY1A 1KA8A 3BPXA 1BJZA 2KIFA 3PQJA 1E17A 1ZQ3P 1D5VA 2TCTA 2DTZA 3VOEA 3MAJA 3K70D 4ZDLA 2VONA 2VJJA 3CUQA 4A69C 2WADA 2P4WA 2FD5A 3F6VA 1GHCA 3NWSA 2B63J 2IXSA 1A35A 2LFBA 4K2EA 4B09A 2Z16A 1TTYA 5E18F 2BXYA 3GZ6A 1F4KA 3KP3A 1R22A 1G3TA 3JTHA 3S3OA 2DOAA 2O6GE 2GBYA 3FXQA 1QPMA 2HYJA 1FOXA 5J1RA 3H36A 3BLYA 1RETA 3ZXSA 2IP2A 2CGPA 4J19A 1UFMA 2I10A 5DS9A 2KKOA 2BBYA 1ZRFA 5HS9A 4CH7A 5GPCA 1ON2A 1ZG5A 1Z6RA 1R1UA 2X0LA 3QPTA 1MMDA 1VFCA 5HODA 4KMFA 2KPMA 5JHUA 2CQ7A 5F64A 1ETYA 1AKHB 4AU7A 4I98B 2ZFWA 4F93B 5M5WJ 2VASA 2Q2EA 1FPQA 2TDXA 3JRAA 2GM4A 2QENA 2YR2A 2ZXIA 3T1BA 1SD6A 2BW3B 9ANTA 4MGRA 4DBRA 4QPQA 4D7MA 5E3OA 2RNGA 3LA3A 3I4MJ 4ASNA 2OD5A 4RBOA 5K5RA 2WAEA 5EEGA 3S3NA 1Y8RB 3E3VA 1B4AA 1T6SA 4EJUA 1H89C 4IKFA 2CUJA 2XAUA 1V5GA 5GADJ 2DCEA 2XSJC 2M0CA 4EQQA 1JTXA 3DPLC 4XLPF 2HNHA 2V1NA 1QRYA 5LD2C 3RKXA 4IJAA 3HRUA 2MW8A 3T5XA 2VT3A 3DU6A 4PFPA 1TW3A 1WJFA 3GTQJ 1PYVA 2H6CA 2R7DA 5A2QK 1VQ5I 1TQIA 1WHUA 1WVRA 3W6KB 1YJ9I 1BJAA 2L01A 3G73A 4BY7J 4BE2A 1AHDP 2L02A 2E35A 3HYIA 2VLAA 4FT8A 1OCPA 2XPWA 3R0JA 1XGOA 2D45A 2OTLI 5D6FA 1ZG1A 1B59A 5BMZA 4A3FJ 4BQAA 1TW2A 5ILUA 3WGHA 1OCCH 1WKMA 3GTJJ 3HOTA 1MIJA 3F0CA 3R61A 5H6RA 4XLNF 2PBIA 1TC3C 4XM3A 5FKLA 1FX7A 1OYIA 2F4OB 4LLGF 4A2UA 5CVJA 4IHXA 4LITA 5DM7F 1EKEA 1YRNA 5IYDJ 4EV0A 2LVSA 1T38A 1OR7A 3OWTA 2VJ5A 1LFUP 1MKMA 2PJRA 2DA3A 3H5RA 2DOFA 4XLFA 5B5EC 2QCOA 1W5TA 3DBHB 3OYJA 1SMYF 2HZDA 1JTYA 3VFZA 2DMPA 1O4XA 5D5VB 3BG3A 1DU0A 2DMNA 3PNVA 5L3EA 3K4NA 3AKZA 1LE8B 3VWBA 1IUFA 1A6QA 5HOOA 3GO5A 2HGCA 3ZMSA 3M7GA 1DPRA 5JLWA 2DI3A 1HQCA 4C3IJ 1OCOH 5CVRA 1W36C 1YW8A 2QQBA 2VL8A 4HF2A 4NQWB 1KYWA 3ASOH 5EEAA 1JKRC 1X58A 4UUSA 2B9SA 2K9MA 2E60A 2CUZA 2IS1A 2ISZA 2LBFB 4BE0A 2M2EA 2I8DA 4CCLA 2RQQA 1IGNA 2R7RA 4HA8A 3HOYJ 4XQFA 1QHGA 2Q1ZB 4DGWB 4IRGA 1ZTRA 2O8XA 4FE7A 2EZLA 4BQOA 2VKHA 1TWHJ 1KYZA 5E79C 1W5CC 2LG4A 3H5NA 3WU1B 3GEZA 5J3LA 4ZYAA 1QBJA 2CJJA 1RI7A 1YS6A 5LRSA 3FHNA 1G3SA 1SVLA 2VIXA 2DFEA 2E7XA 3QOPA 4EEFG 3SDGA 3GFIA 1R6RA 2QQAA 4MQVA 3S1NJ 1MMGA 3WODF 2E1OA 4HEA2 2OQGA 1KZHA 2K27A 1JUMA 3DEWA 5L3GA 2PMZN 4BUPA 3QYBA 4KUMA 3K70C 3S16J 3Q0UA 3P9KA 1YIOA 2M1BA 1MDMA 2LK2A 5FKOA 3M4OJ 2K9QA 4WF2A 3BG6A 2M8EA 3HUGA 4DYCA 4RLFA 3HPHA 2O61A 2VBYA 5M5YJ 2IVMA 2QSFX 1LEBA 5J4YA 2HPIA 4M3FA 4IOCF 4AYBN 3I55I 1X1DA 1SAXA 1USSA 2RDPA 1EA3A 4I99C 1BR4A 1XSVA 2JRTA 3H1CA 3VYRB 4C9YA 4I0BA 1FLIA 2QKLB 3G1MA 4IRHA 5F1JA 2NOJB 2F2EA 2QBYA 1MNDA 1T8IA 4HSTA 1UELB 2CRGA 4M73A 1I1SA 1VQNI 4BQQA 3BPVA 3TDUC 1R49A 3H35A 3N4MA 2I5UA 4XN0A 2X1EA 2XRNA 1GXPA 3KETA 1J5YA 1NG6A 4DYQA 4BXFA 3J80Z 4M74A 2VQHA 3MCZA 3T8TA 3FK7A 1RZ4A 1TQPA 2NXNB 3BR3A 5F27A 2LOOA 4CXFA 2X4HA 2XRLA 2MC3A 4PJNA 3W2VA 3SFIA 3TQNA 4KT5C 2DMTA 2XPVA 2Y0SN 5L3FA 3V8JA 4JK1X 1BC7C 1XSDA 5DUKA 3KP5A 5C44J 1F1ZA 3CCUI 1IAWA 2HYGD 2XAHA 3D5LA 5F1RA 3I9V2 3QP5A 1WZ2A 5C4JJ 4AC0A 4RAGA 5H6QA 3CLQA 2QWWA 5D4SA 4ENNA 3S15J 4L0ZB 2E71A 3F22A 1MNMC 4XLEA 4ZC3A 3KZYA 3CP2A 3COAC 2KT0A 2KFDA 1GLNA 2DMQA 2ZJPF 3C18A 2EA4A 2XV4S 2KDOA 2KRHA 1YS7A 3HC7A 3LAJA 3CZ6A 1HKSA 5LHIA 3ABMH 1V3FA 3J81Z 1NHAA 1Z67A 1KQ0A 2OA4A 5CVVA 1O7FA 1FP1D 3GF2A 2HXOA 3CUQC 5LFAA 4AIHA 2X6YA 3MZYA 2RKHA 4EM2A 2J5OA 2CMPA 1FJLA 2MBFA 1O3QA 4A3JJ 1TNSA 1VF9A 4ZTFA 2EB7A 3I3LA 3K10A 1O57A 2NS0A 1QGPA 1IRZA 1YI2I 2FF4A 2ZXJA 1T39A 3BR2A 4FHTA 2DQRA 1JGSA 4UB8C 1ZAOA 4OU0A 2JUGA 3FXLA 3W2AA 1T08B 4JX6A 5EEHA 1VQOI 2JA2A 1A31A 4CYDA 1IN7A 3BZ6A 4ESBA 1N77A 2Q2EB 2PFBA 3ZMUA 2H8RA 1SFEA 1OISA 2LKPA 2R3SA 3JSOA 1YO5C 1U78A 2DN0A 3ELKA 2N8GA 4ZZLA 4YIFA 2A69F 3E5XA 4E7LA 5ILVA 2FNPA 2DODA 3MKZA 1FBUA 2PJPA 1BR1A 3WTVC 2K3FA 4V2FA 4M71A 1H9GA 5ED4A 1I6HJ 2DJIA 3KE2A 4DNCA 4E4HA 1VQ9I 3HEFA 4GO1A 3DEEA 1R9TJ 4GRIA 2FRHA 4GXOA 1CQTA 4E6KG 5D8LB 4HQEA 3FISA 2XIGA 5ICGA 3WTZA 3F8BA 3F6OA 1FYKA 4KMUX 3GVAA 4M9ZA 3OIOA 2FX0A 3HSRA 3OV8A 1GDTA 1IV8A 3UKGA 2E34A 4FCYA 3GWZA 1JUSA 3WTTC 2YPRA 4MFEA 2GXBA 1VNDA 4G7ZF 1Z21A 3LA2A 4A0ZA 2VODA 3B73A 2OZ6A 1LVKA 3K1NA 3O8GA 1X3ZB 5J1YA 3B6CA 2HU9A 3OYDA 1CF7B 4XL9A 3NQOA 1DGRM 2F5VA 2HPMA 3BZKA 3U2RA 3IAS2 4LG0B 3LSIA 5DV5A 3I59A 2YUSA 3IAM2 3R0AA 2R7ZJ 5DD8A 1B8IA 2L9NA 4ESJA 2XB5A 3D5RC 5IT9Z 2WY8Q 1MBEA 4NC8A 4KA4A 3WGIA 3TO7A 1J75A 1IG7A 3GTOJ 3QWLA 3R4KA 3S2DJ 1P7IA 1ZRCA 1IXSB 3L2WA 2NYXA 1OR7C 3HPGA 3S1RJ 1FMVA 3HSEA 1MSFC 5C4XJ 2MABA 4CDGA 4IHTA 1T0FA 4I02A 1W0TA 1ZG3A 5K7ZA 5GAHJ 3ABLH 3WTYC 1U9OA 2E19A 3ZP5A 2HOAA 5EGOA 4IO9F 2W1OA 1YJWI 3L2RA 4H0EA 3CQZJ 2WY7Q 3AG2H 4JP0A 3WU0A 2AXTC 2M7BA 5D5WB 2EFPA 4PSXA 1ACIA 1R71A 2MLKA 2FQ3A 5E20A 2XGDA 2VN2A 3IWZA 1XMAA 3J81K 2XC7A 1BL0A 4HDUA 1B9MA 2LMDA 3I71A 3OL4A 4P96A 3Q5FA 5LEJA 2FSWA 3WE2A 2OUMA 5DDGA 3L2QA 3S3MA 3CJNA 5DYMA 4XRFA 1B6AA 5FO5A 2Q8KA 5FLVA 1Y1WJ 3HGGA 1LNWA 2F48A 1XDUA 2NVXJ 4HG2A 3BR0A 4XSXF 1S3JA 1ETKA 2A3SA 2RVCA 2HVSA 1XPXA 3J7AY 3KP4A 4IX7A 5CVUA 1MSEC 4FQGA 2XVCA 1ZGAA 4II3A 2R7WA 4HYEA 1A5JA 4F92B 3JRGA 4BEHB 3DPTA 2KISA 1V4RA 3HKZA 5LEKA 5IP9J 1RRJA 4PJJA 5EYRA 5CQGA 1YE9A 2K85A 3KPHA 2A05A 1OKRA 5IOYA 1O3RA 2ZO4A 5HLGA 5LLQA 1P7JA 1MDMB 1X19A 1PUFB 3CJTB 4Y15A 3F23A 4QSHA 4DQ2A 1K4TA 1APLC 4DYRA 5HLHA 2CW7A 3VODA 1FWZA 3V7RA 1HSTA 1UJ8A 3GUDA 2NOGA 4G94A 5FLXK 4QLCU 3J7YJ 2KP6A 4Y33A 3WGGA 3ZMVA 1S72I 2VQCA 2E1NA 1PVEA 3P7NA 3F21A 2HFHA 2E2JJ 2QBYB 2QLZA 3A0HC 2R5YB 3MKWB 4L9TA 5KCMA 3K6GA 1FEXA 3PO2J 1HLVA 2PLYA 3IH2A 1IRFA 5GTHC 2W24A 5CKTA 4TV7A 1VQMI 4D7NA 2OAZA 4YEJA 3CDHA 3RQIA 2W7NA 1ETQA 3G1LA 3EYYA 1S8NA 3PJRA 1Z7LA 2DOEA 4GYIA 1XS9A 3WTXC 1GVJA 1ENHA 2AO9A 2VBZA 2HKXA 4BY1J 4CO8A 3HSFA 3ZN0A 2XSDC 2Y31A 2X85A 5K5OA 3ZN1A 2IGKA 1R4NB 4R8HA 2HQAA 2O03A 3DXJF 3PUFA 3JAMK 1QQIA 5EG0B 1IV6A 3HHGA 2ZNYA 1BIAA 4BKXA 4UVCA 3Q9SA 3DCFA 3K69A 4Z2YA 3CTAA 5IP6A 4BJ6C 1ZREA 4B4CA 4B48A 3U21A 1XX5A 3IRQA 4WXHA 2EPFA 5IT9K 2RQPA 1QO0D 3GYHX 1LFBA 2ZMEB 1X1CA 3OYNA 1RR7A 1TWFJ 2K86A 3AFHA 2LYCA 4F55A 3MWMA 1QNTA 2E1MB 2K02A 4J00A 1HOMA 5IPAA 3S93A 3ECHA 2E1MC 4KITB 1G6NA 2CO5A 2LR8A 1ZR4A 2CS3A 2IAIA 3K4CA 3FM3A 1FOYA 1GUUA 3K4JA 1K78A 2DK8A 3RZOJ 2H94A 2M45A 1F36A 1X2MA 2VJ4A 3R60A 1WWXA 5BS6A 3HOSA 1S9HA 3DLLF 3REOA 2M4GA 3I58A 2ECCA 3M1EA 1NG7A 2K4JA 1O3SA 3I54A 1MZBA 1WPKA 2OTJI 1R5GA 1QVTA 1WJBA 2RN7A 1R23A 4MTEA 2X48A 4BHPA 4PJLA 2XPUA 3ULQB 2P6TA 3MD2A 4EM0B 2M3AA 4N4NB 3C2BA 2DFIA 3EQLF 4YRVA 4DW6A 3L1PA 2UZKA 2DLLA 2MLGA 2F5CA 1E0EA 1KONA 2WB1A 4L18B 1USTA 2BEOA 1VQ6I 2A5YB 2HYFA 4HX8A 5F04A 4CCNA 4XORA 4IZZA 5K7HA 2Z2SB 2GA2A 4Y3OA 3E6CC 2DW4A 1WJCA 1Q1HA 1S29A 1MBJA 1D0XA 1Y56A 2X6OA 2FJ1A 3SDBA 3OYLA 3MKYB 3ZQLA 1JXSA 3HDDA 2E2IJ 4BXXJ 3OR1C 2NVTJ 5J8FA 5DCFA 2BE5F 2Y75A 1Z1DA 3FBNB 4A0YA 3GLXA 3ZQFA 3EETA 2ME0A 2VBWA 3DKYA 4B8XA 3BDDA 2JN6A 3TGNA 3OOPA 4OIPF 1J7KA 3TOBA 3M9AA 1RUOA 1R00A 3E97A 3GFJA 3FBIB 2ME6A 4HBLA 2BOLA 3GFLA 5L3BA 4XR6A 3HOZJ 2BV6A 2R93J 5LBQA 2LDUA 1YIJI 4BDYA 3G6EI 1WI9A 2JMWA 5E1XA 5AIQA 2CV0A 2G9WA 1GVDA 3GZNB 1OFCX 3RPUA 4CCOA 1PP7U 3S2HJ 4ON0A 3JRIA 2M0MA 2EFQA 4MTDA 2IS4A 2DJNA 2VOOA 3GTMJ 1VQ7I 4QIWN 1HXDA 1G4DA 1IDZA 3A01A 3FIWA 1F9NA 2QQ9A 2JVGA 4EM1A 4Z6YA 1UAAA 4C2TA 4AYBA 3DF8A 4ANJA 1XMKA 2DA4A 4UVBA 1A04A 5ICCA 2GIVA 3ZRGA 1D1BA 3V4GA 3QP6A 1H0MA 4EJWA 1S5LC 2LKSA 4QTRA 1YYVA 4A6DA 4HX4A 1NK3P 3BCAA 4EJTA 1ZGWA 3IL2A 4ZYHA 2MC4A 1SEUA 2KJBA 2H1KA 2P5LC 3FMSA 4HV5A 1T0FC 3B02A 4A12A 5EGOB 3K0LA 1YTYA 1JJ6C 2HVRA 4HAMA 4A3CJ 1STZA 4PK4A 3CCYA 4A3GJ 3A4CA 4V2GA 3VYSB 4P9UA 3QOEA 5BNGA 3HL2A 1OCZH 4AIKA 4S04A 4ZYGA 2GOXB 3ZQGA 1MBFA 1D0YA 1R1VA 4WWCA 1HKQA 4W97A 3HXLA 4HLXA 2C6YA 3CMEI 4XONA 1BA5A 2V9KA 4NC7A 2ELKA 1TWGJ 3L09A 2OCEA 2EFNA 2R7FA 5F6FA 1I39A 2R7XA 2E36A 2E5NA 3K2AA 2Z9OA 1POGA 2QGUA 4C30A 4ENMA 4I0AA 2P81A 4U0VA 1GV2A 4GDFA 3OSFA 1KQ9A 2D1HA 1ETXA 1W7PB 2FU4A 2WAQN 4YIIA 3TDZC 2DFFA 2R7SA 1F43A 3G2BA 1IW7F 3OIPA 1AOYA 1QZEA 2W85A 3LL7A 3RKWA 3KYDB 1I1GA 4BYYA 2L7FP 1AWCA 1UG2A 2F4MB 2ESHA 3FZVA 3KEYA 3FX3A 2L9VA 1KGSA 3PSIA 5F08A 3LWFA 2K4BA 2FQ4A 2XAQA 1MW7A 3LNQA 2EIJH 2QYOA 4NBQA 3RKYA 4I2OA 4HPQA 1PP8F 2VE8A 3ZQIA 4RDUA 1ZGJA 2EA2A 2AHQA 3TOAA 3RPUD 2EJRA 4CCMA 2M5WA 5FFZA 2CUFA 5CJ9A 1ORKA 2VC1A 3FDYA 1BW6A 5LGNA 1HA8A 2KJCA 3E0JB 2COBA 3SFZA 4A3LJ 3V7CA 1TT0A 2ZBKA 5DCMA 4A3KJ 2BVMA 2HOSA 1ZELA 5LHHA 4RB1A 3A02A 2LY1A 1Y6IA 1OYYA 2MYSA 3QU6A 2O7OA 3W2WA 1JKOC 2IA2A 2WV1A 3K7AJ 4RGSA 1MNEA 4ZH4F 3LSTA 2DA1A 2JK3A 3H9QA 1QVUA 4P5OA 4EMSA 3CLOA 5FD5A 1BI2A 4G6TB 1Y0UA 3HTUA 2L9RA 4OOIA 5BOXA 1S6LA 4XOTA 2GQQA 4HLYA 1GXQA 3FXUA 3PNYA 4JBAA 2FXAA 3I0TA 3W6JB 4DBQA 5B3SH 2LSOA 2DT7B 2QF7A 3OYIA 1EV7A 3ASNH 4NB5A 1P4WA 4XMYA 2LLKA 2IS2A 4L9VA 5B1AH 2V1DA 4BS9A 3N97A 3HTSB 2M8GX 2DT5A 3HG9A 1T98A 2HR3A 1YG2A 3DLAA 2M34A 1B72B 2PMHA 5L3CA 1S7OA 1ULYA 3DFGA 3SJMA 2AXLA 5K5QA 1OQYA 3RTRA 3O3KA 3EUAA 1J2XA 2ETHA 4FETA 1S7AA 1K6OA 5HNHA 2XHKA 3CCRI 1CGPA 1R36A 1IN6A 2BHYA 2KZVA 4ZDPA 3C1DA 1I50J 4R1HA 4RMNA 3CCVI 3S14J 4AWXB 1IN8A 2X1DA 1K61A 3K4MA 3X2QH 1XCBA 2BY0A 2IA1A 2VXZA 2M30A 1FIPA 3ML6A 4EGZA 2XGCA 5BPDA 5TJJA 2W48A 3WG9A 2MGQA 3GCMA 5BPIA 3OR2C 2LH9A 4RM2A 3N05A 4OMZA 2KIMA 3GBGA 2R5ZB 5J4VA 3OYBA 3RJPA 2BXZA 5ICEA 2EZKA 2X1CA 4XLHA 1YHQI 2DYRH 1PDNC 2HTSA 1K4SA 5D5XB 2CV2A 3DTIA 1D3YA 1QHHD 1X1BA 3OYHA 2DU9A 1KQ8A 1XGNA 2LRDA 5FKNA 1U8BA 3I4PA 3PUBA 3WHBA 1D5YA 3M07A 4O3MA 3WG7H 4UUTA 2WV0A 3CCSI 4IQ4A 1E3OC 1E3PA 1FSHA 2L7MP 4XRMA 1WH7A 2L4MA 3CUQB 4UV8A 4L0YB 3BTCA 5KVRA 1JKQC 1VQKI 3PFIA 3QAHA 3W6VA 2CW0F 5FD6A 1ZARA 4IHVA 3ZMDA 3CCQI 3VEPA 3I4NJ 3TP0A 1VQPI 4JOMA 2K9SA 2K9NA 4Q48A 2Q0OA 5JR3A 4C3HJ 4ITVA 4C3JJ 2CQKA 2OBPA 5TGTA 4C2MJ 5E3LA 1ZLJA 2H09A 4M9XA 2RREA 2NS8A 2DMUA 3BR1A 1EH8A 1LQ1A 2HOTA 1I3AA 1OMIA 4RGRA 2RC4A 5TRDA 3LMMA 2Z99A 3PNTA 5IOZA 5ILSA 4BBRJ 4E70A 1LB2A 2ZJ2A 1O7LA 2CH0A 4X0GA 4WXDA 3DTKA 1YQAA 2GZWA 4N0BA 5GTIC 2VB6A 4OIOF 1SD7A 2NS7A 3J7ZI 3K1MA 3I5UA 4M6YA 1REPC 2KIQA 1KU7A 2UXXA 4PCQA 1JGGA 1R5HA 3U9GA 3JRDA 3R6SA 1UHWA 2PQ8A 2ZXWH 1Z3YA 3LSKA 1UCRA 5JHFA 5KAFC 3LSRA 1OCTC 1OCRH 3CCJI 3DV8A 3Q9VA 5C3EJ 1X1AA 2JSCA 2BY2A 4HW0A 2A5WA 3UR3C 1B9NA 2DAOA 4G12A 3KP6A 4EJVA 2FBHA 2M87A 4G9YA 4BJ5C 1A36A 4U0WA 1XMXA 2KQRA 1G8XA 1Y1VJ 4A3DJ 4GGGA 2ZSIB 2L5QA 3WU2C 1LFPA 4P55A 2JA5J 2K5CA 3LSPA 4CUGA 3P5JA 3JCUC 3H3UA 1JKPC 2STTA 4BQNA 5D6EA 4KICA 4HNTA 2VPLA 2O3FA 4EVIA 3H0DA 1RUNA 3F72A 3PM1A 1GV5A 5LRRA 2O5RA 5EJCA 1Q1VA 3J80K 1AKHA 3C2HA 1WJAA 3BOQA 3RCOA 1DU6A 3O2PE 3V8LA 3KFWX 3OSGA 2G7HA 2JJ7A 5DUIA 5CVIA 3T0YA 3BZCA 5KHDA 1FZPB 4IQJA 1YRNB 2BW3A 4Q5SF 4KDPA 4HZFA 3W3CA 2IBDA 1RC9A 1Y8QB 2PJRB 2V4JC 1TQMA 1NK2P 1ERDA 2XAFA 1Z7UA 2HQ5A 4BXUA 4HOBA 1SFKA 1H8AC 3KZZA 1H9TA 2CV1A 2BY3A 4AD9A 1P4XA 1DGWY 1JT6A 4U7BA 4NUBA 5HLTA 3ERMA 1MBGA 2LC2A 3SYTA 4KT6A 3BCBA 5JVGF 4U88A 4BH9A 2FOWA 3I56I 1FIAA 3PL8A 3VYUB 2EQRA 3HHHA 1R58A 3JRFA 3SXYA 2E7WA 3MKLA 4B3XA 5BQTA 1V54H 2M9HA 4UUSB 5DTDA 5J6XA 1I6XA 1J09A 3ZMZA 4KNYA 1OPCA 3TW7A 1HW5A 2ZFUA 2V9VA 1TBXA 4A3IJ 2BVLA 3H3ZA 2VPRA 3CC7I 3QODA 2VBXA 3FWEA 2QM3A 4LLLA 6PAXA 4G8XA 3S2WA 3LFKA 1YFHA 2VT2A 4XKBA 3HBLA 5FLMJ 3ECOA 1BM9A 2DDAA 3F8FA 3I53A 1SD5A 2V79A 2OV7A 2WTEA 3C2GA 2V6CA 4RS8A 2DFHA 4OINF 1HW2A 1DDNA 3PQKA 4HRIA 2Z1DA 3HM5A 2JA8J 3KLNA 2CUEA 2HXIA 1Z0XA 2JUCA 1QA6A 4BACA 1HBXG 3JTGA 2EBIA 2AQEA 3WE3A 3LSHA 2PX9A 4XLCA 1W0UA 4CSWA 2KRCA 3E6BA 3DWLE 1QZYA 4R79A 1YOVB 3HUGB 3TO6A 3OYAA 4S0HB 4M3DA 4HDVA 3FK6A 3VB2A 3LQRA 2HOEA 2W00A 3BTJA 2EIMH 1WJ5A 3ABKH 1U3EM 2M4KA 4ABZA 4NQWA 2XUBA 3CP8A 3H0GJ 1WSUA 4II2A 4DJAA 3EUKL 2KMUA 2OPTA 3S32A 2L7ZA 1D1CA 1WH5A 2ICWG 2J5PA 5HLIA 1DP3A 2OC6A 3NEUA 3QU3A 2LBFA 4YFKF 2L54A 2IA0A 4LG3A 4G7OF 4AM3A 3WTWC 1O3TA 1Z9CA 5KK1A 4Q4ZF 3BG7A 5ICFA 2NVQJ 2Y48A 3FKJA 1MGTA 2QUFA 5L3DA 4MNUA 1D8KA 2MH2A 4DOZA 4BAYA 4RAZA 3IUOA 5FFXA 4EJOA 3JREA 2OF7A 5D8KB 2H8WA 5IY5H 1UHSA 3M8JA 2DA5A 5HDKA 1GT0C 2IT0A 1MJAA 3A03A 5HVQC 3RSNA 5AIPA 5EF6A 3L00A 3JRBA 4F3QA 4AVZA 2DPDA 4UY8I 1YLFA 3OS0A 3H5AA 4HQMA 4V19K 4XSZF 1C0WA 2V26A 1FOWA 2NVYJ 2YX7A 3SZTA 1EF4A 2W84A 3CCMI 2D2WA 1YJNI 1FTTA 3HOXJ 3SHFA 4NNJA 3OYGA 2XF7A 2YSRA 4Y7NJ 3PO3J 2R92J 4M3GA 2KLOA 4L5IA 2R7VA 3BQZA 3TEDA 3NRVA 4BNCA 1AU7A 4CYCA 3KIOA 4JQFA 3OOUA 3VSKA 5A2QZ 1WQ2A 3RYRA 3NARA 3IWFA 4LB5A 1K83J 3U1KA 2DTRA 2LREA 3KZIC 1BOAA 1JHFA 5DD4A 2H27A 4FX0A 3HJEA 1BR2A 3DEUA 1V5FA 5JI6A 3OYEA 3FMRA 2DK5A 2Y9ZA 1IJWC 3CF5F 3F8NA 4E7HA 2CYYA 1LDDA 1Y39A 2GIZA 5KAIC 3HIFA 2KZGA 4WX9A 1IXCA 4X6AJ 2GXGA 4D5CA 1BC8C 2EFOA 3BJ6A 4FTHA 4LK0F 2ADUA 4IVNA
chains in the Genus database with same CATH topology
1ZN2A 1X3UA 3CO7C 4OIQF 1F5TA 4LMYA 4S05A 3MQ0A 5LHGA 3GFMA 3O6BB 4RB3C 1Z91A 2RGVA 1XD7A 3RPQA 3F8CA 3TKYA 3MFKA 5E1WA 1VTNC 2BYVE 1FT9A 2P7CB 2XGXA 1XGSA 1MJ9A 3QRFF 1PUEE 1BI1A 2CWEA 1T2KA 5CLSA 2VE9A 3F8MA 2HDCA 4P9FA 2PEXA 3D0SA 5D4RA 2XROA 4CHUA 2P5VA 3L7WA 3JW4A 2P7VB 4M6XA 1U2WA 4IXAA 1IXRC 2G7UA 1R1TA 4OMYA 4A5NA 1ZRDA 1EH7A 5ERIA 2PI0A 4MHGA 3GXOA 1IZ1A 1IF1A 2A61A 2ZNZA 3IC7A 1BI0A 4LK1F 1ONVA 1DPUA 2VC0A 2JZYA 2W57A 3I59B 4UV9A 2B0LA 3KP2A 3BWGA 2HS5A 3AAFA 3ABTA 4FX4A 4RGXA 3G3ZA 3KCCA 1IUYA 1I27A 1BBYA 4I01A 4WXCA 2PMUA 4A5MA 4O6JA 2IW5A 2EV0A 2FNAA 1FNNA 4L9JA 3MEXA 2PG4A 4CICA 1SMTA 2OQRA 1K79A 4I7HA 2HKOA 2A07F 3ISPA 2COMA 2AS5F 2FBKA 2MH9A 4LFUA 3HRSA 4U7DA 1UHMA 1CF7A 1KU9A 3E5UA 1MJBA 4KIFA 2EK5A 4LG0A 1IN4A 1XDSA 1LEAA 4U0YA 4M9SA 2FMYA 2LF8A 4BHBA 2OU2A 1RIOH 5AONA 2HQRA 3P9CA 1Z05A 4KYWA 3T8RA 3RYPA 4PZJA 3E6MA 2Z3YA 1FYMA 4RB2C 4G6DA 4UUVA 1B1BA 3BROA 2IJLA 1XN7A 1P92A 5JVTA 1DUXC 4LB6B 1L0OC 3K2ZA 3GZ5A 1DP7P 1KU2A 2K7LA 3H92A 1P4AA 1FBSA 4UVAA 4HF0A 2EV6A 2XASA 5LGUA 1L3LA 4UNOA 3RDIA 1TLHB 3TO9A 4UHTA 1U5TA 3M8FA 3HRMA 5HDGA 3ZQ7A 5JFRA 1LVAA 3P9IA 2NNYA 1SD4A 3EUHA 3L2CA 3FM5A 5E1ZB 1HKTA 2V1XA 2NRAC 4HV6A 1BI3A 4IF4A 4YFXF 1G3WA 2FA5A 2OZUA 1SFXA 2Y0MA 1SFUA 3SQNA 1K78B 2HQNA 2MA3A 2HTJA 4BHCA 3U1DA 3IHUA 2L3DA 3ZPLA 1E2XA 3RI4A 2GAUA 2HEOA 4KIGA 2DQLA 1R7JA 5HS8A 2WC2A 1J9IA 2ESNA 1OYWA 1ON1A 2QVOA 2BGCA 1JHHA 2ZKZA 3QPHA 2ZMEA 2DO7A 1FYLA 1ZHFA 3JSPA 3BJAA 2WWYA 2DPUA 4WCGA 3IKVA 1XB4A 4ETSA 1P2FA 3LA7A 1FOKA 3MZHA 4D0PA 5K1YA 2XKPA 4RGUA 1LDKB 2F5EA 2YU3A 2DBBA 4AVPA 2A6EF 2FOKA 1W4MA 5E8GA 3E6DA 4HF1A 1BN5A 4EGYA 2XKOA 2VOPA 1FBQA 2JPCA 3EYIA 1KU3A 3LQQA 3KP7A 3WTSC 4ZZDA 2MD5A 4A0XA 2NAZA 1FC3A 2UXNA 2HZTA 1U8RA 3C7JA 1FY7A 3E5QA 3K1PA 3LAPA 2W25A 5E8IA 2HWVA 4L9NA 3IRRA 4F7ZA 4LLNA 5FLXZ 1IN5A 2LNBA 1G3YA 3DP7A 2KRFA 3F3XA 4LGWA 1ODDA 3ZMTA 1K7AA 4OIRF 2P6SA 2P5KA 2PN6A 2EWNA 1UB9A 1MD0A 5H20A 3ABUA 1LDJA 5IT3A 4AIJA 2QZ8A 3V7SA 3EDPA 1TNTA 3CO6C 3BY6A 4A6EA 1J0RA 2V1UA 2IPQX 3JAMZ 1J59A 2EV5A 3V8KA 2FBIA 4RB0A 1D8JA 2ISYA 4LD5A 2ZCWA 3FHZA 4GCVA 4NHJA 2JTVA 1HSJA 5FB2A 4ENJA 2FEZA 5HS7A 3ROUA 4PGGA 3KLOA 1U6GA 1EH6A 2Z33A 5CYVA 4UXNA 2STWA 1IRGA 4G7HF 5DCMB 3IKTA 4I09A 4ZYDA 2KIUA 2JPBA 1ZYRF 4YG2F 2Z5UA 4Q47A 4CZZA 3ERED 3FMQA 1W7PA 3HRTA 4CGZA 2GA1A 2CG4A 2D1VA 1XSXA 4L5JA 4ESFA 1HW1A 3DQVC 1LJ9A 4WK8F 4M72A 2O0YA 2EFWA 2YX4A 1U5TB 2LF7A 2XAGA 4XBFA 2E1CA 1U5TC 3L9FA 4N9HA 1RNLA 2FE3A 1XGMA 2XAJA 1ZLKA 3J7AO 1I5ZA 5E17F 1YW7A 4LJZF 2FMLA 3BP8A 3K9TA 3WTUC 1P6RA 2CSOA 4IHSA 2ELHA 2JT1A 2IRFG 4MEXF 4O5VA 3KEQA 1ZH5A 3CUOA 4G6QA 5J8CA 4GYGA 2F5DA 1YW9A 2RNJA 4KN4X 3DKWA 3GW2A 5FGMA 2CFXA 3RIRA 1BIBA 4MEYF 4Y17A 2NNNA 4ZYEA 2ADUA 4IRIA 4PDKA 5DEQA 4YFNF 4KN7X 2L4AA 3BJOA 3KEOA 4ENKA 2RV8A 4RAYA 3M8EA 4QWQA 1XCVA 2ACJA 2F5FA 3I64A 1W7PD 2A6HF 3SZPA 2UWMA 1Z6TA 2GWRA 1QZZA 2H6BA 2P8TA 3FXRA 1FP2A 4PGHA 5LGTA 1W5SA 5D5UB 4IPAA 5HDNA 4KFCA 1JE8A 4MQ9F 4Y13A 1FSEA 4N9IA 3C3WA 3GX4X 1WRJA 3FF5A 2A68F 4KIBA 4HX7A 1KA8A 3BPXA 2KIFA 3PQJA 1E17A 1D5VA 3VOEA 3MAJA 2VONA 3CUQA 2P4WA 3F6VA 1GHCA 4K2EA 4B09A 1TTYA 5E18F 3GZ6A 1F4KA 3KP3A 1R22A 1G3TA 3JTHA 2O6GE 3FXQA 1QPMA 2CGPA 2IP2A 1UFMA 2KKOA 2BBYA 1ZRFA 5HS9A 1ON2A 1ZG5A 1Z6RA 1R1UA 2X0LA 3QPTA 4KMFA 5JHUA 5F64A 4I98B 2ZFWA 2Q2EA 1FPQA 2TDXA 2QENA 2YR2A 3T1BA 1SD6A 4MGRA 3LA3A 4ASNA 2OD5A 5K5RA 5EEGA 3E3VA 1B4AA 1T6SA 4EJUA 4EQQA 3DPLC 4XLPF 3RKXA 4IJAA 3HRUA 3T5XA 2VT3A 1TW3A 2H6CA 2R7DA 5A2QK 1TQIA 3W6KB 1BJAA 2L01A 3G73A 2L02A 3HYIA 4FT8A 3R0JA 1XGOA 2D45A 5D6FA 1ZG1A 1B59A 5BMZA 4BQAA 1TW2A 5ILUA 3WGHA 1WKMA 3HOTA 3R61A 5H6RA 4XLNF 2PBIA 1FX7A 1OYIA 4LLGF 4A2UA 5CVJA 4EV0A 1T38A 1OR7A 1MKMA 1W5TA 1SMYF 3VFZA 5D5VB 5L3EA 5HOOA 3GO5A 2HGCA 3ZMSA 3M7GA 1DPRA 2DI3A 1HQCA 5CVRA 1YW8A 2QQBA 4HF2A 1KYWA 2ISZA 4HA8A 4IRGA 2O8XA 1KYZA 3WU1B 3GEZA 1QBJA 1RI7A 1YS6A 5LRSA 1G3SA 2E7XA 3QOPA 3GFIA 2QQAA 4MQVA 3WODF 2OQGA 2K27A 5L3GA 4KUMA 3P9KA 1YIOA 2M1BA 1MDMA 4WF2A 2M8EA 3HUGA 2O61A 2VBYA 2IVMA 1LEBA 1SAXA 1USSA 2RDPA 1XSVA 2JRTA 4I0BA 1FLIA 4IRHA 2F2EA 2QBYA 4M73A 1I1SA 3BPVA 3TDUC 3N4MA 2XRNA 1GXPA 3KETA 1J5YA 3J80Z 4M74A 3MCZA 3T8TA 1RZ4A 1TQPA 2X4HA 2MC3A 3TQNA 4KT5C 5L3FA 3V8JA 4JK1X 1BC7C 1XSDA 5DUKA 3KP5A 1F1ZA 1IAWA 2HYGD 2XAHA 3D5LA 5F1RA 3QP5A 5H6QA 2QWWA 5D4SA 4ENNA 4L0ZB 3F22A 3KZYA 3COAC 3C18A 2EA4A 2XV4S 1YS7A 3LAJA 1HKSA 5LHIA 1V3FA 3J81Z 1NHAA 1KQ0A 2OA4A 5CVVA 1O7FA 1FP1D 3GF2A 3CUQC 4AIHA 3MZYA 2RKHA 4EM2A 2J5OA 2MBFA 1O3QA 1TNSA 2EB7A 1O57A 2NS0A 1QGPA 2FF4A 2ZXJA 1T39A 4FHTA 2DQRA 1JGSA 1ZAOA 4OU0A 5EEHA 4CYDA 1IN7A 3BZ6A 4ESBA 2PFBA 3ZMUA 1SFEA 2LKPA 2R3SA 3JSOA 1YO5C 1U78A 3ELKA 4ZZLA 4YIFA 2A69F 3E5XA 5ILVA 2FNPA 1FBUA 2PJPA 3WTVC 4M71A 1H9GA 5ED4A 3KE2A 4DNCA 4GO1A 2FRHA 4GXOA 5D8LB 4HQEA 2XIGA 5ICGA 3WTZA 3F8BA 3F6OA 1FYKA 4KMUX 3GVAA 4M9ZA 3HSRA 3OV8A 3GWZA 3WTTC 2YPRA 2GXBA 4G7ZF 3LA2A 4A0ZA 2VODA 3B73A 2OZ6A 3K1NA 1CF7B 3NQOA 3U2RA 4LG0B 5DV5A 3I59A 3R0AA 5DD8A 4ESJA 5IT9Z 4KA4A 1J75A 3WGIA 3TO7A 3R4KA 1ZRCA 1IXSB 2NYXA 3HSEA 4CDGA 4IHTA 1T0FA 4I02A 1ZG3A 3WTYC 3ZP5A 4H0EA 3WU0A 5D5WB 2EFPA 2MLKA 2FQ3A 5E20A 2VN2A 3IWZA 1XMAA 3J81K 4HDUA 1B9MA 3I71A 4P96A 3Q5FA 5LEJA 2FSWA 3WE2A 5DDGA 3CJNA 5DYMA 4XRFA 1B6AA 5FO5A 2Q8KA 1LNWA 1XDUA 4XSXF 1S3JA 2A3SA 2RVCA 3KP4A 5CVUA 2XVCA 1ZGAA 4HYEA 3DPTA 5LEKA 1V4RA 1OKRA 1O3RA 2ZO4A 5HLGA 5LLQA 1MDMB 4Y15A 3F23A 4DQ2A 5HLHA 3VODA 1FWZA 3V7RA 1HSTA 3GUDA 4G94A 5FLXK 4QLCU 3WGGA 3ZMVA 2E1NA 3P7NA 3F21A 2HFHA 2QBYB 2QLZA 4L9TA 2PLYA 1IRFA 2W24A 4TV7A 2OAZA 3CDHA 3EYYA 1S8NA 4GYIA 3WTXC 1GVJA 2VBZA 2HKXA 4CO8A 3HSFA 3ZN0A 5K5OA 3ZN1A 4R8HA 2O03A 3DXJF 3JAMK 1QQIA 3HHGA 2ZNYA 1BIAA 4UVCA 3Q9SA 3K69A 4Z2YA 3CTAA 1ZREA 3IRQA 4WXHA 5IT9K 2RQPA 1QO0D 3GYHX 2ZMEB 2K86A 3MWMA 1QNTA 2K02A 3ECHA 1G6NA 2CO5A 3FM3A 1K78A 2DK8A 2H94A 2M45A 3R60A 1WWXA 5BS6A 3HOSA 3REOA 3I58A 3M1EA 2K4JA 1O3SA 3I54A 1MZBA 1R5GA 2RN7A 1R23A 4MTEA 4BHPA 3ULQB 2P6TA 4EM0B 3EQLF 2DFIA 2UZKA 2DLLA 2MLGA 2F5CA 4L18B 1USTA 2BEOA 2A5YB 2HYFA 4HX8A 2GA2A 3E6CC 2DW4A 1Q1HA 1S29A 1JXSA 5J8FA 5DCFA 2BE5F 2Y75A 1Z1DA 4A0YA 3GLXA 3EETA 2VBWA 4B8XA 3BDDA 3TGNA 3OOPA 4OIPF 1J7KA 3TOBA 3M9AA 1RUOA 1R00A 3E97A 3GFJA 4HBLA 3GFLA 5L3BA 2BV6A 5LBQA 2LDUA 1WI9A 5E1XA 5AIQA 2G9WA 3RPUA 1PP7U 4ON0A 2EFQA 4MTDA 2VOOA 1HXDA 1G4DA 1F9NA 2QQ9A 4EM1A 3DF8A 1XMKA 4UVBA 1A04A 5ICCA 2GIVA 3V4GA 3QP6A 1H0MA 4EJWA 1YYVA 4A6DA 4HX4A 4EJTA 3IL2A 4ZYHA 2KJBA 2P5LC 3FMSA 4HV5A 3B02A 4A12A 3K0LA 1YTYA 4HAMA 1STZA 4AIKA 4P9UA 4S04A 4ZYGA 4WWCA 1R1VA 1HKQA 4HLXA 2C6YA 3L09A 2EFNA 2R7FA 5F6FA 2Z9OA 4ENMA 4I0AA 4U0VA 1KQ9A 2D1HA 3TDZC 1W7PB 2FU4A 4YIIA 1IW7F 1AOYA 2W85A 3RKWA 4BYYA 1I1GA 1AWCA 2ESHA 3FZVA 3FX3A 1KGSA 3LWFA 2K4BA 2XAQA 2QYOA 3RKYA 4I2OA 1PP8F 2VE8A 1ZGJA 2EA2A 3TOAA 2EJRA 2M5WA 5FFZA 5CJ9A 2VC1A 5LGNA 2KJCA 3SFZA 3V7CA 2ZBKA 5DCMA 5LHHA 4RB1A 1OYYA 3QU6A 2IA2A 4RGSA 4ZH4F 3LSTA 4P5OA 4EMSA 3CLOA 5FD5A 1BI2A 1Y0UA 3HTUA 4OOIA 5BOXA 1S6LA 2GQQA 4HLYA 1GXQA 3FXUA 4JBAA 3W6JB 2FXAA 3I0TA 4CXFA 2LSOA 1EV7A 4NB5A 1P4WA 4L9VA 2V1DA 3N97A 3HTSB 2DT5A 1T98A 2HR3A 1YG2A 2PMHA 5L3CA 1S7OA 1ULYA 3DFGA 2AXLA 5K5QA 3RTRA 3O3KA 1J2XA 2ETHA 1S7AA 1K6OA 2XHKA 1CGPA 1R36A 1IN6A 3C1DA 4R1HA 4AWXB 1IN8A 1XCBA 2IA1A 2VXZA 2M30A 3ML6A 4EGZA 5BPDA 5TJJA 3WG9A 5BPIA 4OMZA 2KIMA 3RJPA 5ICEA 1PDNC 2HTSA 5D5XB 1D3YA 2DU9A 1KQ8A 1XGNA 3I4PA 4O3MA 2WV0A 1FSHA 2L4MA 3CUQB 4UV8A 4L0YB 5KVRA 3PFIA 3QAHA 2CW0F 5FD6A 1ZARA 3ZMDA 3VEPA 4Q48A 2Q0OA 5JR3A 2CQKA 2OBPA 1ZLJA 2H09A 4M9XA 1LQ1A 1EH8A 1OMIA 4RGRA 2RC4A 5TRDA 2Z99A 5ILSA 4E70A 1LB2A 2ZJ2A 1O7LA 4WXDA 1YQAA 2GZWA 4N0BA 4OIOF 1SD7A 3K1MA 3I5UA 4M6YA 1REPC 1KU7A 2UXXA 4PCQA 1R5HA 3U9GA 3R6SA 1UHWA 2PQ8A 1UCRA 3DV8A 3Q9VA 2JSCA 4HW0A 1B9NA 2DAOA 3KP6A 4EJVA 2FBHA 2M87A 4G9YA 4U0WA 4GGGA 4P55A 3H3UA 2STTA 5D6EA 4KICA 2O3FA 4EVIA 1RUNA 3F72A 5LRRA 3J80K 3BOQA 3O2PE 3V8LA 3KFWX 5DUIA 2G7HA 5CVIA 3T0YA 1FZPB 4Q5SF 4KDPA 4HZFA 1TQMA 2XAFA 1Z7UA 4BXUA 4HOBA 3KZZA 1H9TA 4AD9A 4U7BA 4U88A 4BH9A 3HHHA 1R58A 3SXYA 2E7WA 5BQTA 5J6XA 1I6XA 3ZMZA 4KNYA 1OPCA 1HW5A 2V9VA 1TBXA 3H3ZA 2VBXA 3FWEA 2QM3A 4LLLA 6PAXA 4G8XA 3S2WA 3LFKA 1YFHA 2VT2A 3ECOA 1BM9A 3F8FA 3I53A 1SD5A 2V79A 2WTEA 2V6CA 4RS8A 4OINF 1HW2A 1DDNA 3PQKA 3KLNA 1HBXG 3JTGA 3WE3A 3E6BA 1QZYA 4R79A 3TO6A 4HDVA 3VB2A 3LQRA 2HOEA 1U3EM 4NQWA 2XUBA 1WSUA 5HLIA 2J5PA 3NEUA 3QU3A 4YFKF 2L54A 2IA0A 4G7OF 3WTWC 1O3TA 1Z9CA 5KK1A 4Q4ZF 5ICFA 2Y48A 1MGTA 2QUFA 5L3DA 4MNUA 1D8KA 2MH2A 4BAYA 4RAZA 5FFXA 4EJOA 5D8KB 5HDKA 2IT0A 1MJAA 5HVQC 5AIPA 3L00A 2DPDA 1YLFA 4HQMA 4XSZF 1C0WA 2YX7A 3SZTA 2W84A 2D2WA 3SHFA 2YSRA 4L5IA 3NRVA 4BNCA 4JQFA 5A2QZ 1WQ2A 3RYRA 3IWFA 4LB5A 2DTRA 1BOAA 1JHFA 5DD4A 2H27A 4FX0A 3DEUA 5JI6A 3FMRA 2DK5A 3F8NA 2CYYA 1LDDA 3HIFA 4WX9A 1IXCA 2GXGA 1BC8C 2EFOA 3BJ6A 4LK0F 1P4XA 4IVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZN2 A;  1X3U A;  3CO7 C;  4OIQ F;  1F5T A;  4LMY A;  4S05 A;  3MQ0 A;  5LHG A;  3GFM A;  3O6B B;  4RB3 C;  1Z91 A;  2RGV A;  1XD7 A;  3RPQ A;  3F8C A;  3TKY A;  3MFK A;  5E1W A;  1VTN C;  2BYV E;  1FT9 A;  2P7C B;  2XGX A;  1XGS A;  1MJ9 A;  3QRF F;  1PUE E;  1BI1 A;  2CWE A;  1T2K A;  5CLS A;  2VE9 A;  3F8M A;  2HDC A;  4P9F A;  2PEX A;  3D0S A;  5D4R A;  2XRO A;  4CHU A;  2P5V A;  3L7W A;  3JW4 A;  2P7V B;  4M6X A;  1U2W A;  4IXA A;  1IXR C;  2G7U A;  1R1T A;  4OMY A;  4A5N A;  1ZRD A;  1EH7 A;  5ERI A;  2PI0 A;  4MHG A;  3GXO A;  1IZ1 A;  1IF1 A;  2A61 A;  2ZNZ A;  3IC7 A;  1BI0 A;  4LK1 F;  1ONV A;  1DPU A;  2VC0 A;  2JZY A;  2W57 A;  3I59 B;  4UV9 A;  2B0L A;  3KP2 A;  3BWG A;  2HS5 A;  3AAF A;  3ABT A;  4FX4 A;  4RGX A;  3G3Z A;  3KCC A;  1IUY A;  1I27 A;  1BBY A;  4I01 A;  4WXC A;  2PMU A;  4A5M A;  4O6J A;  2IW5 A;  2EV0 A;  2FNA A;  1FNN A;  4L9J A;  3MEX A;  2PG4 A;  4CIC A;  1SMT A;  2OQR A;  1K79 A;  4I7H A;  2HKO A;  2A07 F;  3ISP A;  2COM A;  2AS5 F;  2FBK A;  2MH9 A;  4LFU A;  3HRS A;  4U7D A;  1UHM A;  1CF7 A;  1KU9 A;  3E5U A;  1MJB A;  4KIF A;  2EK5 A;  4LG0 A;  1IN4 A;  1XDS A;  1LEA A;  4U0Y A;  4M9S A;  2FMY A;  2LF8 A;  4BHB A;  2OU2 A;  1RIO H;  5AON A;  2HQR A;  3P9C A;  1Z05 A;  4KYW A;  3T8R A;  3RYP A;  4PZJ A;  3E6M A;  2Z3Y A;  1FYM A;  4RB2 C;  4G6D A;  4UUV A;  1B1B A;  3BRO A;  2IJL A;  1XN7 A;  1P92 A;  5JVT A;  1DUX C;  4LB6 B;  1L0O C;  3K2Z A;  3GZ5 A;  1DP7 P;  1KU2 A;  2K7L A;  3H92 A;  1P4A A;  1FBS A;  4UVA A;  4HF0 A;  2EV6 A;  2XAS A;  5LGU A;  1L3L A;  4UNO A;  3RDI A;  1TLH B;  3TO9 A;  4UHT A;  1U5T A;  3M8F A;  3HRM A;  5HDG A;  3ZQ7 A;  5JFR A;  1LVA A;  3P9I A;  2NNY A;  1SD4 A;  3EUH A;  3L2C A;  3FM5 A;  5E1Z B;  1HKT A;  2V1X A;  2NRA C;  4HV6 A;  1BI3 A;  4IF4 A;  4YFX F;  1G3W A;  2FA5 A;  2OZU A;  1SFX A;  2Y0M A;  1SFU A;  3SQN A;  1K78 B;  2HQN A;  2MA3 A;  2HTJ A;  4BHC A;  3U1D A;  3IHU A;  2L3D A;  3ZPL A;  1E2X A;  3RI4 A;  2GAU A;  2HEO A;  4KIG A;  2DQL A;  1R7J A;  5HS8 A;  2WC2 A;  1J9I A;  2ESN A;  1OYW A;  1ON1 A;  2QVO A;  2BGC A;  1JHH A;  2ZKZ A;  3QPH A;  2ZME A;  2DO7 A;  1FYL A;  1ZHF A;  3JSP A;  3BJA A;  2WWY A;  2DPU A;  4WCG A;  3IKV A;  1XB4 A;  4ETS A;  1P2F A;  3LA7 A;  1FOK A;  3MZH A;  4D0P A;  5K1Y A;  2XKP A;  4RGU A;  1LDK B;  2F5E A;  2YU3 A;  2DBB A;  4AVP A;  2A6E F;  2FOK A;  1W4M A;  5E8G A;  3E6D A;  4HF1 A;  1BN5 A;  4EGY A;  2XKO A;  2VOP A;  1FBQ A;  2JPC A;  3EYI A;  1KU3 A;  3LQQ A;  3KP7 A;  3WTS C;  4ZZD A;  2MD5 A;  4A0X A;  2NAZ A;  1FC3 A;  2UXN A;  2HZT A;  1U8R A;  3C7J A;  1FY7 A;  3E5Q A;  3K1P A;  3LAP A;  2W25 A;  5E8I A;  2HWV A;  4L9N A;  3IRR A;  4F7Z A;  4LLN A;  5FLX Z;  1IN5 A;  2LNB A;  1G3Y A;  3DP7 A;  2KRF A;  3F3X A;  4LGW A;  1ODD A;  3ZMT A;  1K7A A;  4OIR F;  2P6S A;  2P5K A;  2PN6 A;  2EWN A;  1UB9 A;  1MD0 A;  5H20 A;  3ABU A;  1LDJ A;  5IT3 A;  4AIJ A;  2QZ8 A;  3V7S A;  3EDP A;  1TNT A;  3CO6 C;  3BY6 A;  4A6E A;  1J0R A;  2V1U A;  2IPQ X;  3JAM Z;  1J59 A;  2EV5 A;  3V8K A;  2FBI A;  4RB0 A;  1D8J A;  2ISY A;  4LD5 A;  2ZCW A;  3FHZ A;  4GCV A;  4NHJ A;  2JTV A;  1HSJ A;  5FB2 A;  4ENJ A;  2FEZ A;  5HS7 A;  3ROU A;  4PGG A;  3KLO A;  1U6G A;  1EH6 A;  2Z33 A;  5CYV A;  4UXN A;  2STW A;  1IRG A;  4G7H F;  5DCM B;  3IKT A;  4I09 A;  4ZYD A;  2KIU A;  2JPB A;  1ZYR F;  4YG2 F;  2Z5U A;  4Q47 A;  4CZZ A;  3ERE D;  3FMQ A;  1W7P A;  3HRT A;  4CGZ A;  2GA1 A;  2CG4 A;  2D1V A;  1XSX A;  4L5J A;  4ESF A;  1HW1 A;  3DQV C;  1LJ9 A;  4WK8 F;  4M72 A;  2O0Y A;  2EFW A;  2YX4 A;  1U5T B;  2LF7 A;  2XAG A;  4XBF A;  2E1C A;  1U5T C;  3L9F A;  4N9H A;  1RNL A;  2FE3 A;  1XGM A;  2XAJ A;  1ZLK A;  3J7A O;  1I5Z A;  5E17 F;  1YW7 A;  4LJZ F;  2FML A;  3BP8 A;  3K9T A;  3WTU C;  1P6R A;  2CSO A;  4IHS A;  2ELH A;  2JT1 A;  2IRF G;  4MEX F;  4O5V A;  3KEQ A;  1ZH5 A;  3CUO A;  4G6Q A;  5J8C A;  4GYG A;  2F5D A;  1YW9 A;  2RNJ A;  4KN4 X;  3DKW A;  3GW2 A;  5FGM A;  2CFX A;  3RIR A;  1BIB A;  4MEY F;  4Y17 A;  2NNN A;  4ZYE A;  2ADU A;  4IRI A;  4PDK A;  5DEQ A;  4YFN F;  4KN7 X;  2L4A A;  3BJO A;  3KEO A;  4ENK A;  2RV8 A;  4RAY A;  3M8E A;  4QWQ A;  1XCV A;  2ACJ A;  2F5F A;  3I64 A;  1W7P D;  2A6H F;  3SZP A;  2UWM A;  1Z6T A;  2GWR A;  1QZZ A;  2H6B A;  2P8T A;  3FXR A;  1FP2 A;  4PGH A;  5LGT A;  1W5S A;  5D5U B;  4IPA A;  5HDN A;  4KFC A;  1JE8 A;  4MQ9 F;  4Y13 A;  1FSE A;  4N9I A;  3C3W A;  3GX4 X;  1WRJ A;  3FF5 A;  2A68 F;  4KIB A;  4HX7 A;  1KA8 A;  3BPX A;  2KIF A;  3PQJ A;  1E17 A;  1D5V A;  3VOE A;  3MAJ A;  2VON A;  3CUQ A;  2P4W A;  3F6V A;  1GHC A;  4K2E A;  4B09 A;  1TTY A;  5E18 F;  3GZ6 A;  1F4K A;  3KP3 A;  1R22 A;  1G3T A;  3JTH A;  2O6G E;  3FXQ A;  1QPM A;  2CGP A;  2IP2 A;  1UFM A;  2KKO A;  2BBY A;  1ZRF A;  5HS9 A;  1ON2 A;  1ZG5 A;  1Z6R A;  1R1U A;  2X0L A;  3QPT A;  4KMF A;  5JHU A;  5F64 A;  4I98 B;  2ZFW A;  2Q2E A;  1FPQ A;  2TDX A;  2QEN A;  2YR2 A;  3T1B A;  1SD6 A;  4MGR A;  3LA3 A;  4ASN A;  2OD5 A;  5K5R A;  5EEG A;  3E3V A;  1B4A A;  1T6S A;  4EJU A;  4EQQ A;  3DPL C;  4XLP F;  3RKX A;  4IJA A;  3HRU A;  3T5X A;  2VT3 A;  1TW3 A;  2H6C A;  2R7D A;  5A2Q K;  1TQI A;  3W6K B;  1BJA A;  2L01 A;  3G73 A;  2L02 A;  3HYI A;  4FT8 A;  3R0J A;  1XGO A;  2D45 A;  5D6F A;  1ZG1 A;  1B59 A;  5BMZ A;  4BQA A;  1TW2 A;  5ILU A;  3WGH A;  1WKM A;  3HOT A;  3R61 A;  5H6R A;  4XLN F;  2PBI A;  1FX7 A;  1OYI A;  4LLG F;  4A2U A;  5CVJ A;  4EV0 A;  1T38 A;  1OR7 A;  1MKM A;  1W5T A;  1SMY F;  3VFZ A;  5D5V B;  5L3E A;  5HOO A;  3GO5 A;  2HGC A;  3ZMS A;  3M7G A;  1DPR A;  2DI3 A;  1HQC A;  5CVR A;  1YW8 A;  2QQB A;  4HF2 A;  1KYW A;  2ISZ A;  4HA8 A;  4IRG A;  2O8X A;  1KYZ A;  3WU1 B;  3GEZ A;  1QBJ A;  1RI7 A;  1YS6 A;  5LRS A;  1G3S A;  2E7X A;  3QOP A;  3GFI A;  2QQA A;  4MQV A;  3WOD F;  2OQG A;  2K27 A;  5L3G A;  4KUM A;  3P9K A;  1YIO A;  2M1B A;  1MDM A;  4WF2 A;  2M8E A;  3HUG A;  2O61 A;  2VBY A;  2IVM A;  1LEB A;  1SAX A;  1USS A;  2RDP A;  1XSV A;  2JRT A;  4I0B A;  1FLI A;  4IRH A;  2F2E A;  2QBY A;  4M73 A;  1I1S A;  3BPV A;  3TDU C;  3N4M A;  2XRN A;  1GXP A;  3KET A;  1J5Y A;  3J80 Z;  4M74 A;  3MCZ A;  3T8T A;  1RZ4 A;  1TQP A;  2X4H A;  2MC3 A;  3TQN A;  4KT5 C;  5L3F A;  3V8J A;  4JK1 X;  1BC7 C;  1XSD A;  5DUK A;  3KP5 A;  1F1Z A;  1IAW A;  2HYG D;  2XAH A;  3D5L A;  5F1R A;  3QP5 A;  5H6Q A;  2QWW A;  5D4S A;  4ENN A;  4L0Z B;  3F22 A;  3KZY A;  3COA C;  3C18 A;  2EA4 A;  2XV4 S;  1YS7 A;  3LAJ A;  1HKS A;  5LHI A;  1V3F A;  3J81 Z;  1NHA A;  1KQ0 A;  2OA4 A;  5CVV A;  1O7F A;  1FP1 D;  3GF2 A;  3CUQ C;  4AIH A;  3MZY A;  2RKH A;  4EM2 A;  2J5O A;  2MBF A;  1O3Q A;  1TNS A;  2EB7 A;  1O57 A;  2NS0 A;  1QGP A;  2FF4 A;  2ZXJ A;  1T39 A;  4FHT A;  2DQR A;  1JGS A;  1ZAO A;  4OU0 A;  5EEH A;  4CYD A;  1IN7 A;  3BZ6 A;  4ESB A;  2PFB A;  3ZMU A;  1SFE A;  2LKP A;  2R3S A;  3JSO A;  1YO5 C;  1U78 A;  3ELK A;  4ZZL A;  4YIF A;  2A69 F;  3E5X A;  5ILV A;  2FNP A;  1FBU A;  2PJP A;  3WTV C;  4M71 A;  1H9G A;  5ED4 A;  3KE2 A;  4DNC A;  4GO1 A;  2FRH A;  4GXO A;  5D8L B;  4HQE A;  2XIG A;  5ICG A;  3WTZ A;  3F8B A;  3F6O A;  1FYK A;  4KMU X;  3GVA A;  4M9Z A;  3HSR A;  3OV8 A;  3GWZ A;  3WTT C;  2YPR A;  2GXB A;  4G7Z F;  3LA2 A;  4A0Z A;  2VOD A;  3B73 A;  2OZ6 A;  3K1N A;  1CF7 B;  3NQO A;  3U2R A;  4LG0 B;  5DV5 A;  3I59 A;  3R0A A;  5DD8 A;  4ESJ A;  5IT9 Z;  4KA4 A;  1J75 A;  3WGI A;  3TO7 A;  3R4K A;  1ZRC A;  1IXS B;  2NYX A;  3HSE A;  4CDG A;  4IHT A;  1T0F A;  4I02 A;  1ZG3 A;  3WTY C;  3ZP5 A;  4H0E A;  3WU0 A;  5D5W B;  2EFP A;  2MLK A;  2FQ3 A;  5E20 A;  2VN2 A;  3IWZ A;  1XMA A;  3J81 K;  4HDU A;  1B9M A;  3I71 A;  4P96 A;  3Q5F A;  5LEJ A;  2FSW A;  3WE2 A;  5DDG A;  3CJN A;  5DYM A;  4XRF A;  1B6A A;  5FO5 A;  2Q8K A;  1LNW A;  1XDU A;  4XSX F;  1S3J A;  2A3S A;  2RVC A;  3KP4 A;  5CVU A;  2XVC A;  1ZGA A;  4HYE A;  3DPT A;  5LEK A;  1V4R A;  1OKR A;  1O3R A;  2ZO4 A;  5HLG A;  5LLQ A;  1MDM B;  4Y15 A;  3F23 A;  4DQ2 A;  5HLH A;  3VOD A;  1FWZ A;  3V7R A;  1HST A;  3GUD A;  4G94 A;  5FLX K;  4QLC U;  3WGG A;  3ZMV A;  2E1N A;  3P7N A;  3F21 A;  2HFH A;  2QBY B;  2QLZ A;  4L9T A;  2PLY A;  1IRF A;  2W24 A;  4TV7 A;  2OAZ A;  3CDH A;  3EYY A;  1S8N A;  4GYI A;  3WTX C;  1GVJ A;  2VBZ A;  2HKX A;  4CO8 A;  3HSF A;  3ZN0 A;  5K5O A;  3ZN1 A;  4R8H A;  2O03 A;  3DXJ F;  3JAM K;  1QQI A;  3HHG A;  2ZNY A;  1BIA A;  4UVC A;  3Q9S A;  3K69 A;  4Z2Y A;  3CTA A;  1ZRE A;  3IRQ A;  4WXH A;  5IT9 K;  2RQP A;  1QO0 D;  3GYH X;  2ZME B;  2K86 A;  3MWM A;  1QNT A;  2K02 A;  3ECH A;  1G6N A;  2CO5 A;  3FM3 A;  1K78 A;  2DK8 A;  2H94 A;  2M45 A;  3R60 A;  1WWX A;  5BS6 A;  3HOS A;  3REO A;  3I58 A;  3M1E A;  2K4J A;  1O3S A;  3I54 A;  1MZB A;  1R5G A;  2RN7 A;  1R23 A;  4MTE A;  4BHP A;  3ULQ B;  2P6T A;  4EM0 B;  3EQL F;  2DFI A;  2UZK A;  2DLL A;  2MLG A;  2F5C A;  4L18 B;  1UST A;  2BEO A;  2A5Y B;  2HYF A;  4HX8 A;  2GA2 A;  3E6C C;  2DW4 A;  1Q1H A;  1S29 A;  1JXS A;  5J8F A;  5DCF A;  2BE5 F;  2Y75 A;  1Z1D A;  4A0Y A;  3GLX A;  3EET A;  2VBW A;  4B8X A;  3BDD A;  3TGN A;  3OOP A;  4OIP F;  1J7K A;  3TOB A;  3M9A A;  1RUO A;  1R00 A;  3E97 A;  3GFJ A;  4HBL A;  3GFL A;  5L3B A;  2BV6 A;  5LBQ A;  2LDU A;  1WI9 A;  5E1X A;  5AIQ A;  2G9W A;  3RPU A;  1PP7 U;  4ON0 A;  2EFQ A;  4MTD A;  2VOO A;  1HXD A;  1G4D A;  1F9N A;  2QQ9 A;  4EM1 A;  3DF8 A;  1XMK A;  4UVB A;  1A04 A;  5ICC A;  2GIV A;  3V4G A;  3QP6 A;  1H0M A;  4EJW A;  1YYV A;  4A6D A;  4HX4 A;  4EJT A;  3IL2 A;  4ZYH A;  2KJB A;  2P5L C;  3FMS A;  4HV5 A;  3B02 A;  4A12 A;  3K0L A;  1YTY A;  4HAM A;  1STZ A;  4AIK A;  4P9U A;  4S04 A;  4ZYG A;  4WWC A;  1R1V A;  1HKQ A;  4HLX A;  2C6Y A;  3L09 A;  2EFN A;  2R7F A;  5F6F A;  2Z9O A;  4ENM A;  4I0A A;  4U0V A;  1KQ9 A;  2D1H A;  3TDZ C;  1W7P B;  2FU4 A;  4YII A;  1IW7 F;  1AOY A;  2W85 A;  3RKW A;  4BYY A;  1I1G A;  1AWC A;  2ESH A;  3FZV A;  3FX3 A;  1KGS A;  3LWF A;  2K4B A;  2XAQ A;  2QYO A;  3RKY A;  4I2O A;  1PP8 F;  2VE8 A;  1ZGJ A;  2EA2 A;  3TOA A;  2EJR A;  2M5W A;  5FFZ A;  5CJ9 A;  2VC1 A;  5LGN A;  2KJC A;  3SFZ A;  3V7C A;  2ZBK A;  5DCM A;  5LHH A;  4RB1 A;  1OYY A;  3QU6 A;  2IA2 A;  4RGS A;  4ZH4 F;  3LST A;  4P5O A;  4EMS A;  3CLO A;  5FD5 A;  1BI2 A;  1Y0U A;  3HTU A;  4OOI A;  5BOX A;  1S6L A;  2GQQ A;  4HLY A;  1GXQ A;  3FXU A;  4JBA A;  3W6J B;  2FXA A;  3I0T A;  4CXF A;  2LSO A;  1EV7 A;  4NB5 A;  1P4W A;  4L9V A;  2V1D A;  3N97 A;  3HTS B;  2DT5 A;  1T98 A;  2HR3 A;  1YG2 A;  2PMH A;  5L3C A;  1S7O A;  1ULY A;  3DFG A;  2AXL A;  5K5Q A;  3RTR A;  3O3K A;  1J2X A;  2ETH A;  1S7A A;  1K6O A;  2XHK A;  1CGP A;  1R36 A;  1IN6 A;  3C1D A;  4R1H A;  4AWX B;  1IN8 A;  1XCB A;  2IA1 A;  2VXZ A;  2M30 A;  3ML6 A;  4EGZ A;  5BPD A;  5TJJ A;  3WG9 A;  5BPI A;  4OMZ A;  2KIM A;  3RJP A;  5ICE A;  1PDN C;  2HTS A;  5D5X B;  1D3Y A;  2DU9 A;  1KQ8 A;  1XGN A;  3I4P A;  4O3M A;  2WV0 A;  1FSH A;  2L4M A;  3CUQ B;  4UV8 A;  4L0Y B;  5KVR A;  3PFI A;  3QAH A;  2CW0 F;  5FD6 A;  1ZAR A;  3ZMD A;  3VEP A;  4Q48 A;  2Q0O A;  5JR3 A;  2CQK A;  2OBP A;  1ZLJ A;  2H09 A;  4M9X A;  1LQ1 A;  1EH8 A;  1OMI A;  4RGR A;  2RC4 A;  5TRD A;  2Z99 A;  5ILS A;  4E70 A;  1LB2 A;  2ZJ2 A;  1O7L A;  4WXD A;  1YQA A;  2GZW A;  4N0B A;  4OIO F;  1SD7 A;  3K1M A;  3I5U A;  4M6Y A;  1REP C;  1KU7 A;  2UXX A;  4PCQ A;  1R5H A;  3U9G A;  3R6S A;  1UHW A;  2PQ8 A;  1UCR A;  3DV8 A;  3Q9V A;  2JSC A;  4HW0 A;  1B9N A;  2DAO A;  3KP6 A;  4EJV A;  2FBH A;  2M87 A;  4G9Y A;  4U0W A;  4GGG A;  4P55 A;  3H3U A;  2STT A;  5D6E A;  4KIC A;  2O3F A;  4EVI A;  1RUN A;  3F72 A;  5LRR A;  3J80 K;  3BOQ A;  3O2P E;  3V8L A;  3KFW X;  5DUI A;  2G7H A;  5CVI A;  3T0Y A;  1FZP B;  4Q5S F;  4KDP A;  4HZF A;  1TQM A;  2XAF A;  1Z7U A;  4BXU A;  4HOB A;  3KZZ A;  1H9T A;  4AD9 A;  4U7B A;  4U88 A;  4BH9 A;  3HHH A;  1R58 A;  3SXY A;  2E7W A;  5BQT A;  5J6X A;  1I6X A;  3ZMZ A;  4KNY A;  1OPC A;  1HW5 A;  2V9V A;  1TBX A;  3H3Z A;  2VBX A;  3FWE A;  2QM3 A;  4LLL A;  6PAX A;  4G8X A;  3S2W A;  3LFK A;  1YFH A;  2VT2 A;  3ECO A;  1BM9 A;  3F8F A;  3I53 A;  1SD5 A;  2V79 A;  2WTE A;  2V6C A;  4RS8 A;  4OIN F;  1HW2 A;  1DDN A;  3PQK A;  3KLN A;  1HBX G;  3JTG A;  3WE3 A;  3E6B A;  1QZY A;  4R79 A;  3TO6 A;  4HDV A;  3VB2 A;  3LQR A;  2HOE A;  1U3E M;  4NQW A;  2XUB A;  1WSU A;  5HLI A;  2J5P A;  3NEU A;  3QU3 A;  4YFK F;  2L54 A;  2IA0 A;  4G7O F;  3WTW C;  1O3T A;  1Z9C A;  5KK1 A;  4Q4Z F;  5ICF A;  2Y48 A;  1MGT A;  2QUF A;  5L3D A;  4MNU A;  1D8K A;  2MH2 A;  4BAY A;  4RAZ A;  5FFX A;  4EJO A;  5D8K B;  5HDK A;  2IT0 A;  1MJA A;  5HVQ C;  5AIP A;  3L00 A;  2DPD A;  1YLF A;  4HQM A;  4XSZ F;  1C0W A;  2YX7 A;  3SZT A;  2W84 A;  2D2W A;  3SHF A;  2YSR A;  4L5I A;  3NRV A;  4BNC A;  4JQF A;  5A2Q Z;  1WQ2 A;  3RYR A;  3IWF A;  4LB5 A;  2DTR A;  1BOA A;  1JHF A;  5DD4 A;  2H27 A;  4FX0 A;  3DEU A;  5JI6 A;  3FMR A;  2DK5 A;  3F8N A;  2CYY A;  1LDD A;  3HIF A;  4WX9 A;  1IXC A;  2GXG A;  1BC8 C;  2EFO A;  3BJ6 A;  4LK0 F;  1P4X A;  4IVN A; 
#chains in the Genus database with same CATH topology
 1ZN2 A;  1X3U A;  4JX5 A;  3CO7 C;  4A93 J;  4OIQ F;  1F5T A;  3JR9 A;  4LMY A;  4S05 A;  3MQ0 A;  2GOM A;  5LHG A;  3GFM A;  2E2H J;  3O6B B;  4RB3 C;  1Z91 A;  2UUZ A;  3HOU J;  4PJ0 C;  3DBL B;  3S17 J;  2RGV A;  1XD7 A;  3RPQ A;  3F8C A;  4RLQ A;  4PJM A;  3TKY A;  2L2O A;  4ZDO A;  2CW8 A;  4CZC A;  2TRT A;  2MG4 A;  1X4O A;  5E1W A;  3MFK A;  2ZC2 A;  1VTN C;  2DYS H;  1IC8 A;  2BYV E;  1FT9 A;  2BZT A;  2P7C B;  2XGX A;  1XGS A;  1MJ9 A;  4YIR X;  3HKZ N;  4D9J A;  2LY9 A;  3QRF F;  2UV1 A;  1PUE E;  4B1R A;  1BI1 A;  2CWE A;  3CC4 I;  2X6W A;  2XF5 A;  1SAN A;  4ZJZ A;  4A3M J;  4BE1 A;  2ZXH A;  5CLS A;  1T2K A;  4CA0 A;  1D0Z A;  1WGX A;  3BT9 A;  2VE9 A;  3F8M A;  3MZ8 A;  2HDC A;  4P9F A;  2PEX A;  5IYC J;  1TZL A;  3D0S A;  3TMO A;  5D4R A;  2XRO A;  1A6I A;  4EAT A;  2P5V A;  4CHU A;  3L7W A;  3S1Q J;  1MBH A;  3JW4 A;  2P7V B;  3E7L A;  4M6X A;  2VKE A;  1U2W A;  1TT5 B;  4XNF A;  4IXA A;  1IXR C;  1LKX A;  1R1T A;  2G7U A;  4L5E A;  3AG3 H;  4OMY A;  4A5N A;  2HDW A;  2Y2Z A;  1ZRD A;  1EH7 A;  2CQX A;  2QA4 I;  2GXA A;  2JQ7 A;  5ERI A;  2PI0 A;  3M1C A;  4MFD A;  1ETO A;  4B47 A;  2R7O A;  4MHG A;  2H1L A;  3GXO A;  2PMZ A;  2B7E A;  1IZ1 A;  3FKI J;  3QYE A;  1IF1 A;  3LOC A;  3VPR A;  4XKV A;  2A61 A;  3BG9 A;  1JT0 A;  2ZNZ A;  4GFB A;  4CCK A;  1Z77 A;  1TWC J;  3GLL A;  3IC7 A;  1BI0 A;  4MIM A;  1ZR2 A;  4LK1 F;  3BC8 A;  1ONV A;  1DPU A;  1G2H A;  2VC0 A;  2JZY A;  3L2U A;  2W57 A;  3I59 B;  4UV9 A;  2B0L A;  4E7I A;  1RKT A;  3KP2 A;  3PSF A;  1B8I B;  2ID6 A;  1YIT I;  3BWG A;  2HS5 A;  1BOB A;  5J1U A;  1WFX A;  3AAF A;  3ABT A;  4FX4 A;  4BU2 A;  2QSG X;  3K4L A;  4RGX A;  3G3Z A;  3KCC A;  1IUY A;  4M3B A;  1I27 A;  1BBY A;  3PIO F;  3D1N I;  4I01 A;  4WXC A;  2PMU A;  2R7U A;  1E3H A;  3KYC B;  4A5M A;  4O6J A;  2DA7 A;  2EV0 A;  2IW5 A;  2FNA A;  2EH3 A;  1FNN A;  2ZJQ F;  2QEX I;  4L9J A;  4BDZ A;  3MEX A;  1JJ8 C;  2XGE A;  3Q3S A;  5J47 A;  2PG4 A;  4CIC A;  5GPA A;  3FXO A;  1SMT A;  2OQR A;  1K79 A;  3CDL A;  4I7H A;  2HKO A;  4AID A;  2A07 F;  3H3V K;  3ISP A;  5FKK A;  2WBM A;  2R7T A;  1SVM A;  2COM A;  2AS5 F;  1H88 C;  2FBK A;  1AA7 A;  2MH9 A;  1K6Y A;  4C2U A;  2Y0S A;  1Y0N A;  1WCM J;  5M5X J;  4LFU A;  3HRS A;  1U9N A;  2X9D A;  1UHM A;  4U7D A;  1T95 A;  1KU9 A;  3OYC A;  3E5U A;  3ZQQ A;  4BGD A;  2NVU B;  5EDN A;  1MJB A;  4KIF A;  2V6E A;  2EK5 A;  4LG0 A;  5CPR B;  1IN4 A;  4DZJ A;  1XDS A;  5DM6 F;  3OYK A;  1HC8 A;  1LEA A;  1XTA A;  4U0Y A;  4M9S A;  5FRM A;  4FIS A;  2O8K A;  2FMY A;  2VKD A;  5GAG J;  2R4G A;  2LF8 A;  1MMN A;  1OLT A;  4BHB A;  2OU2 A;  5EZG A;  2DXI A;  1RIO H;  5AON A;  1MMA A;  2HQR A;  2FUG 2;  3FXK A;  5M3M J;  3P9C A;  3FXJ A;  1FMW A;  1Z05 A;  2ELJ A;  5H2F C;  4KYW A;  4HNU A;  2WB1 N;  3T8R A;  2X51 A;  3PIP F;  4BJT A;  3JRH A;  3RYP A;  2BHZ A;  4PZJ A;  4I76 A;  3E6M A;  3KX2 A;  2Z3Y A;  1FYM A;  3CMM A;  4RB2 C;  1VQL I;  1HDD C;  2XB0 X;  3TP3 A;  3ZCO A;  4G6D A;  4UUV A;  1B1B A;  3OS2 A;  1JI8 A;  5HNF A;  2KHM A;  3CCL I;  4IOA F;  3BRO A;  1RKW A;  2IJL A;  1XN7 A;  3PFY A;  1N25 A;  1P92 A;  4XK4 A;  5JVT A;  1DUX C;  3QPL A;  4LB6 B;  3G71 I;  1L0O C;  3CJR B;  3K2Z A;  2QSH X;  3GZ5 A;  4PUS A;  1KU2 A;  2W82 A;  1DP7 P;  5B66 C;  2K7L A;  3H92 A;  4A3B J;  1P4A A;  2KL4 A;  1FBS A;  4UVA A;  3CD6 I;  2ZSH B;  3AG1 H;  3OMY A;  3S8P A;  4HF0 A;  2EV6 A;  2XAS A;  5B1B H;  4RAF A;  4BEH A;  5LGU A;  4X1E A;  1L3L A;  2ID3 A;  4UNO A;  3RDI A;  1TLH B;  3TBI A;  3OS1 A;  3TO9 A;  3BTL A;  2DA6 A;  4UHT A;  2VJI A;  1U5T A;  3B6A A;  3M8F A;  3HRM A;  5HDG A;  3ZQ7 A;  1PUF A;  3M3Y J;  5JFR A;  1LVA A;  3P9I A;  1UZC A;  2V7F A;  2LKX A;  3K4B A;  2NNY A;  2G0E A;  2VXD A;  1SD4 A;  4XIC A;  5JLX A;  3H9G A;  3EUH A;  3L2C A;  3FM5 A;  5FRO A;  5E1Z B;  1HKT A;  2V1X A;  2F4I A;  4CYC B;  2NRA C;  3GME A;  4HV6 A;  1BI3 A;  3SEQ A;  1RR8 C;  4IF4 A;  2JVH A;  1M1E B;  1N78 A;  1D1A A;  1TP4 A;  4YFX F;  3GTL J;  1G3W A;  2FA5 A;  2OZU A;  4MO7 A;  1SFX A;  2R5Y A;  2Y0M A;  3A1Y A;  2JWT A;  3SQN A;  1SFU A;  3EPZ A;  2HQN A;  1K78 B;  2A6T A;  2MA3 A;  2LP0 A;  2K40 A;  1FTZ A;  2HTJ A;  2D5V A;  4BHC A;  3U1D A;  3IHU A;  2L3D A;  3ZPL A;  3CCE I;  3TW6 A;  1E2X A;  3DKX A;  3VDX A;  3RI4 A;  2GAU A;  2HEO A;  4KIG A;  2DQL A;  3NAU A;  1R7J A;  5HS8 A;  2Y9Y A;  3HOV J;  4I6Z A;  2WC2 A;  2MD0 A;  1ETV A;  1J9I A;  2ESN A;  1ETW A;  1OYW A;  1ON1 A;  4BBS J;  5EG0 A;  2QVO A;  4NC6 A;  2VQL A;  4CCJ A;  3OIQ A;  3IP4 B;  3VYT B;  1YX3 A;  3CC2 I;  1BW5 A;  2BGC A;  5F0H A;  1JHH A;  4N4O B;  1CF7 A;  2ZKZ A;  3QPH A;  4B43 A;  2ZME A;  2DO7 A;  2R0Q C;  4H4K C;  1TL8 A;  2GLO A;  1FYL A;  1ZHF A;  3JSP A;  3WHC A;  4IHW A;  3BJA A;  1EJ9 A;  4E7Z A;  1N75 A;  2WWY A;  2DPU A;  1DQU A;  2JA7 J;  1VQ4 I;  1HCR A;  1XG1 A;  3L2V A;  4WCG A;  3IKV A;  1XB4 A;  1TWA J;  4ETS A;  3MN2 A;  2L9S A;  2CFO A;  2XF6 A;  4E7J A;  4XKW A;  3DU5 A;  2X6X A;  1P2F A;  3LA7 A;  4FE4 A;  2OJE D;  1FOK A;  3MZH A;  3SZG A;  4D0P A;  3BR5 A;  5K1Y A;  4DIQ A;  2XKP A;  4FAS D;  4RGU A;  1PJR A;  1LDK B;  2F5E A;  2YU3 A;  2DBB A;  3DBR B;  2ZB9 A;  4AVP A;  4W1U A;  2A6E F;  2FOK A;  1W4M A;  2P0W A;  5E8G A;  1IRX A;  1X4P A;  3E6D A;  2F6C A;  4XRS A;  4HF1 A;  1BN5 A;  4EGY A;  2XKO A;  4E7K A;  2V9P A;  2Y69 H;  3IH4 A;  1MMS A;  3HOW J;  4JX4 A;  2VOP A;  1FBQ A;  2JPC A;  1V5E A;  4XOP A;  3EYI A;  1KU3 A;  3LQQ A;  2K3P A;  1MH4 A;  3KP7 A;  1HDP A;  3WTS C;  2R7Q A;  4ZZD A;  2MD5 A;  4A0X A;  2NAZ A;  1FC3 A;  2UXN A;  3UNG C;  2HZT A;  3A01 B;  1U8R A;  3C7J A;  1FY7 A;  3E5Q A;  3K1P A;  3LAP A;  2W25 A;  5E8I A;  2HDD A;  2HWV A;  2WA0 A;  4L9N A;  3CMY A;  2CQQ A;  3LSM A;  4J01 A;  3IRR A;  3BG5 A;  4F7Z A;  1NH3 A;  4LLN A;  1IN5 A;  2LNB A;  5FLX Z;  3HGY A;  1G3Y A;  1X2N A;  3DP7 A;  2KRF A;  3F3X A;  4LGW A;  2RAE A;  1ODD A;  3ZMT A;  2HVQ A;  1K7A A;  4OIR F;  2P6S A;  2P5K A;  5CQE A;  4D5F A;  4AUX A;  4HNV A;  3A0B C;  2PN6 A;  2DA2 A;  2EWN A;  2QKM B;  1P9Q C;  4M3E A;  3CDI A;  5J40 A;  3OY9 A;  2LY2 A;  1UB9 A;  1MD0 A;  5H20 A;  5E3M A;  1QPI A;  4Y4R A;  2WAF A;  3ABU A;  1LDJ A;  2YU9 J;  5F0C A;  3RQ4 A;  5IT3 A;  4AIJ A;  2QZ8 A;  3V7S A;  3EDP A;  1TNT A;  3LSG A;  1MH3 A;  1I3Q J;  3Q0W A;  3CO6 C;  4NDL A;  3BY6 A;  4A6E A;  3Q0V A;  1G59 A;  1J0R A;  2V1U A;  4IHY A;  2IPQ X;  3JAM Z;  1J59 A;  2EV5 A;  3V8K A;  2FBI A;  4RB0 A;  5IP7 J;  3S1M J;  4Y52 J;  1D8J A;  2ISY A;  4LD5 A;  2EIL H;  2VQG A;  3CF2 A;  4XKC A;  2IEK A;  2QQ8 A;  1UG0 A;  4QPO A;  3BTI A;  4RA2 A;  3VSL A;  2DT6 A;  2ZCW A;  3BR6 A;  3FHZ A;  4GCV A;  4NHJ A;  2JTV A;  1HSJ A;  4F91 B;  3O8H A;  5FB2 A;  2IGN A;  4XN3 A;  4ENJ A;  2CQN A;  3RZD J;  1SVO A;  2FEZ A;  5HS7 A;  3E1S A;  3ROU A;  5EZH A;  4PGG A;  4OAY A;  2VUM J;  1IDY A;  4F52 A;  2O9L A;  3OYM A;  3ESW B;  1U6G A;  2XDV A;  3DTE A;  3KLO A;  2K9L A;  5FRN A;  1HF0 A;  1VI0 A;  1EH6 A;  2Z33 A;  4LIU A;  2IS6 A;  2MFZ A;  5CYV A;  4UXN A;  3LFU A;  5KNL A;  2JRM A;  1T56 A;  2STW A;  3QYF A;  2JA6 J;  4G7H F;  1IRG A;  4HSR A;  3SEZ A;  1IO2 A;  5DCM B;  2EIN H;  3G1O A;  4XLA A;  1V55 H;  3JRC A;  1MBK A;  3V42 A;  3IKT A;  2KDZ A;  3DPU A;  4I09 A;  4XRS G;  4ZYD A;  1NTC A;  2KIU A;  2JPB A;  1ZYR F;  4YG2 F;  2Z5U A;  1WJD A;  3NWT A;  4Q47 A;  4CZZ A;  3ERE D;  2HI3 A;  1T33 A;  1W7P A;  3FMQ A;  3HRT A;  4CGZ A;  1LE8 A;  3OL3 A;  2GA1 A;  2DDB A;  2Y30 A;  5IYB J;  2CG4 A;  4IEJ A;  2D1V A;  1XSX A;  4L5J A;  3CJQ B;  1RES A;  2LD5 A;  4ESF A;  1R5I D;  1HW1 A;  5GAE J;  3DQV C;  3QQA A;  1LJ9 A;  4WK8 F;  4M72 A;  2O0Y A;  2OCC H;  1WI3 A;  1U0J A;  2IGO A;  2EFW A;  2YX4 A;  2AQF A;  1S7E A;  1U5T B;  1ZKG A;  2LF7 A;  2XAG A;  1SFO J;  4XBF A;  3ONQ A;  2L7K A;  2E1C A;  4DZP A;  1U5T C;  3L9F A;  4N9H A;  1RNL A;  3GTK J;  2FE3 A;  1XGM A;  3FXM A;  3ZQC A;  2XAJ A;  5TIS C;  4XID A;  2JSP A;  4PFO A;  4RM3 A;  1ZLK A;  3J7A O;  1I5Z A;  5E17 F;  3GTP J;  1YW7 A;  1R4M B;  2FML A;  3BP8 A;  3K9T A;  4LJZ F;  2IGM A;  5GP9 A;  4A3E J;  4KIS A;  3WTU C;  1P6R A;  3EUH C;  2CSO A;  4IHS A;  3HB9 A;  1ITY A;  1XC5 A;  2CU7 A;  2ELH A;  2VI6 A;  4KJZ A;  4ZTJ A;  2JT1 A;  3CES A;  3AL0 B;  1WJE A;  4JYK A;  4MEX F;  4O5V A;  3KEQ A;  2IRF G;  1ZH5 A;  3CUO A;  1RPW A;  2L0K A;  2MSY A;  3AL0 C;  4G6Q A;  5J8C A;  4GYG A;  3RKQ A;  1Z3X A;  3ZOB A;  1SC7 A;  1LPQ A;  1ZK8 A;  2F5D A;  3G4S I;  4OWR B;  1W1W E;  3F9K A;  1YW9 A;  2RNJ A;  3K4K A;  3DKW A;  4KN4 X;  2EZI A;  3GTG J;  3IV5 A;  1LUJ B;  1UMQ A;  2EZH A;  3GW2 A;  3A2K A;  1JUP A;  1X3W B;  2VKV A;  5F0F A;  2ZJR F;  5FGM A;  2CFX A;  3HZJ A;  3RIR A;  4B44 A;  4LIV A;  1BIB A;  4MEY F;  4Y17 A;  2NNN A;  4ZYE A;  4P1W A;  4BL0 B;  2ECB A;  4IRI A;  4PDK A;  3LSJ A;  5DEQ A;  4YFN F;  4KN7 X;  2L4A A;  3BJO A;  3KEO A;  4ENK A;  2RV8 A;  3MMY B;  4RAY A;  4YEL A;  1B72 A;  3QPS A;  2W4S A;  3M8E A;  5K7F A;  4QWQ A;  2YS9 A;  1XCV A;  1VZ0 A;  2LTP A;  3AG4 H;  2ACJ A;  2F5F A;  3I64 A;  1W7P D;  2A6H F;  3SZP A;  3IH3 A;  3TL4 X;  1Z6T A;  2GWR A;  2UWM A;  1X1P A;  4D1Q A;  4OAZ A;  1QU3 A;  2ZME C;  1QZZ A;  5M3F J;  2H6B A;  2P8T A;  3FXR A;  1FP2 A;  4U87 A;  1W36 D;  3MVP A;  4PGH A;  5LGT A;  3H9J A;  1W5S A;  4M6V A;  5FKM A;  5D5U B;  1SAU A;  4IPA A;  5HDN A;  4KFC A;  5E3N A;  4UB6 C;  4IL6 C;  1JE8 A;  2R5Z A;  2E5Z A;  4MQ9 F;  2M7A A;  4PSW A;  3CMA I;  4Y13 A;  2WAQ A;  1FSE A;  4LOC A;  3KYL A;  4MLO A;  4B3A A;  4E7S A;  3BQY A;  4N9I A;  5FJ8 J;  1VQ8 I;  3D5S C;  1OJL A;  3C3W A;  3ZR8 X;  2EIK H;  3GX4 X;  1WRJ A;  3FF5 A;  3ZGK A;  1YX5 A;  3ZQH A;  3OYF A;  2A68 F;  4KIB A;  4HX7 A;  2BY1 A;  1KA8 A;  3BPX A;  1BJZ A;  2KIF A;  3PQJ A;  1E17 A;  1ZQ3 P;  1D5V A;  2TCT A;  2DTZ A;  3VOE A;  3MAJ A;  3K70 D;  4ZDL A;  2VON A;  2VJJ A;  3CUQ A;  4A69 C;  2WAD A;  2P4W A;  2FD5 A;  3F6V A;  1GHC A;  3NWS A;  2B63 J;  2IXS A;  1A35 A;  2LFB A;  4K2E A;  4B09 A;  2Z16 A;  1TTY A;  5E18 F;  2BXY A;  3GZ6 A;  1F4K A;  3KP3 A;  1R22 A;  1G3T A;  3JTH A;  3S3O A;  2DOA A;  2O6G E;  2GBY A;  3FXQ A;  1QPM A;  2HYJ A;  1FOX A;  5J1R A;  3H36 A;  3BLY A;  1RET A;  3ZXS A;  2IP2 A;  2CGP A;  4J19 A;  1UFM A;  2I10 A;  5DS9 A;  2KKO A;  2BBY A;  1ZRF A;  5HS9 A;  4CH7 A;  5GPC A;  1ON2 A;  1ZG5 A;  1Z6R A;  1R1U A;  2X0L A;  3QPT A;  1MMD A;  1VFC A;  5HOD A;  4KMF A;  2KPM A;  5JHU A;  2CQ7 A;  5F64 A;  1ETY A;  1AKH B;  4AU7 A;  4I98 B;  2ZFW A;  4F93 B;  5M5W J;  2VAS A;  2Q2E A;  1FPQ A;  2TDX A;  3JRA A;  2GM4 A;  2QEN A;  2YR2 A;  2ZXI A;  3T1B A;  1SD6 A;  2BW3 B;  9ANT A;  4MGR A;  4DBR A;  4QPQ A;  4D7M A;  5E3O A;  2RNG A;  3LA3 A;  3I4M J;  4ASN A;  2OD5 A;  4RBO A;  5K5R A;  2WAE A;  5EEG A;  3S3N A;  1Y8R B;  3E3V A;  1B4A A;  1T6S A;  4EJU A;  1H89 C;  4IKF A;  2CUJ A;  2XAU A;  1V5G A;  5GAD J;  2DCE A;  2XSJ C;  2M0C A;  4EQQ A;  1JTX A;  3DPL C;  4XLP F;  2HNH A;  2V1N A;  1QRY A;  5LD2 C;  3RKX A;  4IJA A;  3HRU A;  2MW8 A;  3T5X A;  2VT3 A;  3DU6 A;  4PFP A;  1TW3 A;  1WJF A;  3GTQ J;  1PYV A;  2H6C A;  2R7D A;  5A2Q K;  1VQ5 I;  1TQI A;  1WHU A;  1WVR A;  3W6K B;  1YJ9 I;  1BJA A;  2L01 A;  3G73 A;  4BY7 J;  4BE2 A;  1AHD P;  2L02 A;  2E35 A;  3HYI A;  2VLA A;  4FT8 A;  1OCP A;  2XPW A;  3R0J A;  1XGO A;  2D45 A;  2OTL I;  5D6F A;  1ZG1 A;  1B59 A;  5BMZ A;  4A3F J;  4BQA A;  1TW2 A;  5ILU A;  3WGH A;  1OCC H;  1WKM A;  3GTJ J;  3HOT A;  1MIJ A;  3F0C A;  3R61 A;  5H6R A;  4XLN F;  2PBI A;  1TC3 C;  4XM3 A;  5FKL A;  1FX7 A;  1OYI A;  2F4O B;  4LLG F;  4A2U A;  5CVJ A;  4IHX A;  4LIT A;  5DM7 F;  1EKE A;  1YRN A;  5IYD J;  4EV0 A;  2LVS A;  1T38 A;  1OR7 A;  3OWT A;  2VJ5 A;  1LFU P;  1MKM A;  2PJR A;  2DA3 A;  3H5R A;  2DOF A;  4XLF A;  5B5E C;  2QCO A;  1W5T A;  3DBH B;  3OYJ A;  1SMY F;  2HZD A;  1JTY A;  3VFZ A;  2DMP A;  1O4X A;  5D5V B;  3BG3 A;  1DU0 A;  2DMN A;  3PNV A;  5L3E A;  3K4N A;  3AKZ A;  1LE8 B;  3VWB A;  1IUF A;  1A6Q A;  5HOO A;  3GO5 A;  2HGC A;  3ZMS A;  3M7G A;  1DPR A;  5JLW A;  2DI3 A;  1HQC A;  4C3I J;  1OCO H;  5CVR A;  1W36 C;  1YW8 A;  2QQB A;  2VL8 A;  4HF2 A;  4NQW B;  1KYW A;  3ASO H;  5EEA A;  1JKR C;  1X58 A;  4UUS A;  2B9S A;  2K9M A;  2E60 A;  2CUZ A;  2IS1 A;  2ISZ A;  2LBF B;  4BE0 A;  2M2E A;  2I8D A;  4CCL A;  2RQQ A;  1IGN A;  2R7R A;  4HA8 A;  3HOY J;  4XQF A;  1QHG A;  2Q1Z B;  4DGW B;  4IRG A;  1ZTR A;  2O8X A;  4FE7 A;  2EZL A;  4BQO A;  2VKH A;  1TWH J;  1KYZ A;  5E79 C;  1W5C C;  2LG4 A;  3H5N A;  3WU1 B;  3GEZ A;  5J3L A;  4ZYA A;  1QBJ A;  2CJJ A;  1RI7 A;  1YS6 A;  5LRS A;  3FHN A;  1G3S A;  1SVL A;  2VIX A;  2DFE A;  2E7X A;  3QOP A;  4EEF G;  3SDG A;  3GFI A;  1R6R A;  2QQA A;  4MQV A;  3S1N J;  1MMG A;  3WOD F;  2E1O A;  4HEA 2;  2OQG A;  1KZH A;  2K27 A;  1JUM A;  3DEW A;  5L3G A;  2PMZ N;  4BUP A;  3QYB A;  4KUM A;  3K70 C;  3S16 J;  3Q0U A;  3P9K A;  1YIO A;  2M1B A;  1MDM A;  2LK2 A;  5FKO A;  3M4O J;  2K9Q A;  4WF2 A;  3BG6 A;  2M8E A;  3HUG A;  4DYC A;  4RLF A;  3HPH A;  2O61 A;  2VBY A;  5M5Y J;  2IVM A;  2QSF X;  1LEB A;  5J4Y A;  2HPI A;  4M3F A;  4IOC F;  4AYB N;  3I55 I;  1X1D A;  1SAX A;  1USS A;  2RDP A;  1EA3 A;  4I99 C;  1BR4 A;  1XSV A;  2JRT A;  3H1C A;  3VYR B;  4C9Y A;  4I0B A;  1FLI A;  2QKL B;  3G1M A;  4IRH A;  5F1J A;  2NOJ B;  2F2E A;  2QBY A;  1MND A;  1T8I A;  4HST A;  1UEL B;  2CRG A;  4M73 A;  1I1S A;  1VQN I;  4BQQ A;  3BPV A;  3TDU C;  1R49 A;  3H35 A;  3N4M A;  2I5U A;  4XN0 A;  2X1E A;  2XRN A;  1GXP A;  3KET A;  1J5Y A;  1NG6 A;  4DYQ A;  4BXF A;  3J80 Z;  4M74 A;  2VQH A;  3MCZ A;  3T8T A;  3FK7 A;  1RZ4 A;  1TQP A;  2NXN B;  3BR3 A;  5F27 A;  2LOO A;  4CXF A;  2X4H A;  2XRL A;  2MC3 A;  4PJN A;  3W2V A;  3SFI A;  3TQN A;  4KT5 C;  2DMT A;  2XPV A;  2Y0S N;  5L3F A;  3V8J A;  4JK1 X;  1BC7 C;  1XSD A;  5DUK A;  3KP5 A;  5C44 J;  1F1Z A;  3CCU I;  1IAW A;  2HYG D;  2XAH A;  3D5L A;  5F1R A;  3I9V 2;  3QP5 A;  1WZ2 A;  5C4J J;  4AC0 A;  4RAG A;  5H6Q A;  3CLQ A;  2QWW A;  5D4S A;  4ENN A;  3S15 J;  4L0Z B;  2E71 A;  3F22 A;  1MNM C;  4XLE A;  4ZC3 A;  3KZY A;  3CP2 A;  3COA C;  2KT0 A;  2KFD A;  1GLN A;  2DMQ A;  2ZJP F;  3C18 A;  2EA4 A;  2XV4 S;  2KDO A;  2KRH A;  1YS7 A;  3HC7 A;  3LAJ A;  3CZ6 A;  1HKS A;  5LHI A;  3ABM H;  1V3F A;  3J81 Z;  1NHA A;  1Z67 A;  1KQ0 A;  2OA4 A;  5CVV A;  1O7F A;  1FP1 D;  3GF2 A;  2HXO A;  3CUQ C;  5LFA A;  4AIH A;  2X6Y A;  3MZY A;  2RKH A;  4EM2 A;  2J5O A;  2CMP A;  1FJL A;  2MBF A;  1O3Q A;  4A3J J;  1TNS A;  1VF9 A;  4ZTF A;  2EB7 A;  3I3L A;  3K10 A;  1O57 A;  2NS0 A;  1QGP A;  1IRZ A;  1YI2 I;  2FF4 A;  2ZXJ A;  1T39 A;  3BR2 A;  4FHT A;  2DQR A;  1JGS A;  4UB8 C;  1ZAO A;  4OU0 A;  2JUG A;  3FXL A;  3W2A A;  1T08 B;  4JX6 A;  5EEH A;  1VQO I;  2JA2 A;  1A31 A;  4CYD A;  1IN7 A;  3BZ6 A;  4ESB A;  1N77 A;  2Q2E B;  2PFB A;  3ZMU A;  2H8R A;  1SFE A;  1OIS A;  2LKP A;  2R3S A;  3JSO A;  1YO5 C;  1U78 A;  2DN0 A;  3ELK A;  2N8G A;  4ZZL A;  4YIF A;  2A69 F;  3E5X A;  4E7L A;  5ILV A;  2FNP A;  2DOD A;  3MKZ A;  1FBU A;  2PJP A;  1BR1 A;  3WTV C;  2K3F A;  4V2F A;  4M71 A;  1H9G A;  5ED4 A;  1I6H J;  2DJI A;  3KE2 A;  4DNC A;  4E4H A;  1VQ9 I;  3HEF A;  4GO1 A;  3DEE A;  1R9T J;  4GRI A;  2FRH A;  4GXO A;  1CQT A;  4E6K G;  5D8L B;  4HQE A;  3FIS A;  2XIG A;  5ICG A;  3WTZ A;  3F8B A;  3F6O A;  1FYK A;  4KMU X;  3GVA A;  4M9Z A;  3OIO A;  2FX0 A;  3HSR A;  3OV8 A;  1GDT A;  1IV8 A;  3UKG A;  2E34 A;  4FCY A;  3GWZ A;  1JUS A;  3WTT C;  2YPR A;  4MFE A;  2GXB A;  1VND A;  4G7Z F;  1Z21 A;  3LA2 A;  4A0Z A;  2VOD A;  3B73 A;  2OZ6 A;  1LVK A;  3K1N A;  3O8G A;  1X3Z B;  5J1Y A;  3B6C A;  2HU9 A;  3OYD A;  1CF7 B;  4XL9 A;  3NQO A;  1DGR M;  2F5V A;  2HPM A;  3BZK A;  3U2R A;  3IAS 2;  4LG0 B;  3LSI A;  5DV5 A;  3I59 A;  2YUS A;  3IAM 2;  3R0A A;  2R7Z J;  5DD8 A;  1B8I A;  2L9N A;  4ESJ A;  2XB5 A;  3D5R C;  5IT9 Z;  2WY8 Q;  1MBE A;  4NC8 A;  4KA4 A;  3WGI A;  3TO7 A;  1J75 A;  1IG7 A;  3GTO J;  3QWL A;  3R4K A;  3S2D J;  1P7I A;  1ZRC A;  1IXS B;  3L2W A;  2NYX A;  1OR7 C;  3HPG A;  3S1R J;  1FMV A;  3HSE A;  1MSF C;  5C4X J;  2MAB A;  4CDG A;  4IHT A;  1T0F A;  4I02 A;  1W0T A;  1ZG3 A;  5K7Z A;  5GAH J;  3ABL H;  3WTY C;  1U9O A;  2E19 A;  3ZP5 A;  2HOA A;  5EGO A;  4IO9 F;  2W1O A;  1YJW I;  3L2R A;  4H0E A;  3CQZ J;  2WY7 Q;  3AG2 H;  4JP0 A;  3WU0 A;  2AXT C;  2M7B A;  5D5W B;  2EFP A;  4PSX A;  1ACI A;  1R71 A;  2MLK A;  2FQ3 A;  5E20 A;  2XGD A;  2VN2 A;  3IWZ A;  1XMA A;  3J81 K;  2XC7 A;  1BL0 A;  4HDU A;  1B9M A;  2LMD A;  3I71 A;  3OL4 A;  4P96 A;  3Q5F A;  5LEJ A;  2FSW A;  3WE2 A;  2OUM A;  5DDG A;  3L2Q A;  3S3M A;  3CJN A;  5DYM A;  4XRF A;  1B6A A;  5FO5 A;  2Q8K A;  5FLV A;  1Y1W J;  3HGG A;  1LNW A;  2F48 A;  1XDU A;  2NVX J;  4HG2 A;  3BR0 A;  4XSX F;  1S3J A;  1ETK A;  2A3S A;  2RVC A;  2HVS A;  1XPX A;  3J7A Y;  3KP4 A;  4IX7 A;  5CVU A;  1MSE C;  4FQG A;  2XVC A;  1ZGA A;  4II3 A;  2R7W A;  4HYE A;  1A5J A;  4F92 B;  3JRG A;  4BEH B;  3DPT A;  2KIS A;  1V4R A;  3HKZ A;  5LEK A;  5IP9 J;  1RRJ A;  4PJJ A;  5EYR A;  5CQG A;  1YE9 A;  2K85 A;  3KPH A;  2A05 A;  1OKR A;  5IOY A;  1O3R A;  2ZO4 A;  5HLG A;  5LLQ A;  1P7J A;  1MDM B;  1X19 A;  1PUF B;  3CJT B;  4Y15 A;  3F23 A;  4QSH A;  4DQ2 A;  1K4T A;  1APL C;  4DYR A;  5HLH A;  2CW7 A;  3VOD A;  1FWZ A;  3V7R A;  1HST A;  1UJ8 A;  3GUD A;  2NOG A;  4G94 A;  5FLX K;  4QLC U;  3J7Y J;  2KP6 A;  4Y33 A;  3WGG A;  3ZMV A;  1S72 I;  2VQC A;  2E1N A;  1PVE A;  3P7N A;  3F21 A;  2HFH A;  2E2J J;  2QBY B;  2QLZ A;  3A0H C;  2R5Y B;  3MKW B;  4L9T A;  5KCM A;  3K6G A;  1FEX A;  3PO2 J;  1HLV A;  2PLY A;  3IH2 A;  1IRF A;  5GTH C;  2W24 A;  5CKT A;  4TV7 A;  1VQM I;  4D7N A;  2OAZ A;  4YEJ A;  3CDH A;  3RQI A;  2W7N A;  1ETQ A;  3G1L A;  3EYY A;  1S8N A;  3PJR A;  1Z7L A;  2DOE A;  4GYI A;  1XS9 A;  3WTX C;  1GVJ A;  1ENH A;  2AO9 A;  2VBZ A;  2HKX A;  4BY1 J;  4CO8 A;  3HSF A;  3ZN0 A;  2XSD C;  2Y31 A;  2X85 A;  5K5O A;  3ZN1 A;  2IGK A;  1R4N B;  4R8H A;  2HQA A;  2O03 A;  3DXJ F;  3PUF A;  3JAM K;  1QQI A;  5EG0 B;  1IV6 A;  3HHG A;  2ZNY A;  1BIA A;  4BKX A;  4UVC A;  3Q9S A;  3DCF A;  3K69 A;  4Z2Y A;  3CTA A;  5IP6 A;  4BJ6 C;  1ZRE A;  4B4C A;  4B48 A;  3U21 A;  1XX5 A;  3IRQ A;  4WXH A;  2EPF A;  5IT9 K;  2RQP A;  1QO0 D;  3GYH X;  1LFB A;  2ZME B;  1X1C A;  3OYN A;  1RR7 A;  1TWF J;  2K86 A;  3AFH A;  2LYC A;  4F55 A;  3MWM A;  1QNT A;  2E1M B;  2K02 A;  4J00 A;  1HOM A;  5IPA A;  3S93 A;  3ECH A;  2E1M C;  4KIT B;  1G6N A;  2CO5 A;  2LR8 A;  1ZR4 A;  2CS3 A;  2IAI A;  3K4C A;  3FM3 A;  1FOY A;  1GUU A;  3K4J A;  1K78 A;  2DK8 A;  3RZO J;  2H94 A;  2M45 A;  1F36 A;  1X2M A;  2VJ4 A;  3R60 A;  1WWX A;  5BS6 A;  3HOS A;  1S9H A;  3DLL F;  3REO A;  2M4G A;  3I58 A;  2ECC A;  3M1E A;  1NG7 A;  2K4J A;  1O3S A;  3I54 A;  1MZB A;  1WPK A;  2OTJ I;  1R5G A;  1QVT A;  1WJB A;  2RN7 A;  1R23 A;  4MTE A;  2X48 A;  4BHP A;  4PJL A;  2XPU A;  3ULQ B;  2P6T A;  3MD2 A;  4EM0 B;  2M3A A;  4N4N B;  3C2B A;  2DFI A;  3EQL F;  4YRV A;  4DW6 A;  3L1P A;  2UZK A;  2DLL A;  2MLG A;  2F5C A;  1E0E A;  1KON A;  2WB1 A;  4L18 B;  1UST A;  2BEO A;  1VQ6 I;  2A5Y B;  2HYF A;  4HX8 A;  5F04 A;  4CCN A;  4XOR A;  4IZZ A;  5K7H A;  2Z2S B;  2GA2 A;  4Y3O A;  3E6C C;  2DW4 A;  1WJC A;  1Q1H A;  1S29 A;  1MBJ A;  1D0X A;  1Y56 A;  2X6O A;  2FJ1 A;  3SDB A;  3OYL A;  3MKY B;  3ZQL A;  1JXS A;  3HDD A;  2E2I J;  4BXX J;  3OR1 C;  2NVT J;  5J8F A;  5DCF A;  2BE5 F;  2Y75 A;  1Z1D A;  3FBN B;  4A0Y A;  3GLX A;  3ZQF A;  3EET A;  2ME0 A;  2VBW A;  3DKY A;  4B8X A;  3BDD A;  2JN6 A;  3TGN A;  3OOP A;  4OIP F;  1J7K A;  3TOB A;  3M9A A;  1RUO A;  1R00 A;  3E97 A;  3GFJ A;  3FBI B;  2ME6 A;  4HBL A;  2BOL A;  3GFL A;  5L3B A;  4XR6 A;  3HOZ J;  2BV6 A;  2R93 J;  5LBQ A;  2LDU A;  1YIJ I;  4BDY A;  3G6E I;  1WI9 A;  2JMW A;  5E1X A;  5AIQ A;  2CV0 A;  2G9W A;  1GVD A;  3GZN B;  1OFC X;  3RPU A;  4CCO A;  1PP7 U;  3S2H J;  4ON0 A;  3JRI A;  2M0M A;  2EFQ A;  4MTD A;  2IS4 A;  2DJN A;  2VOO A;  3GTM J;  1VQ7 I;  4QIW N;  1HXD A;  1G4D A;  1IDZ A;  3A01 A;  3FIW A;  1F9N A;  2QQ9 A;  2JVG A;  4EM1 A;  4Z6Y A;  1UAA A;  4C2T A;  4AYB A;  3DF8 A;  4ANJ A;  1XMK A;  2DA4 A;  4UVB A;  1A04 A;  5ICC A;  2GIV A;  3ZRG A;  1D1B A;  3V4G A;  3QP6 A;  1H0M A;  4EJW A;  1S5L C;  2LKS A;  4QTR A;  1YYV A;  4A6D A;  4HX4 A;  1NK3 P;  3BCA A;  4EJT A;  1ZGW A;  3IL2 A;  4ZYH A;  2MC4 A;  1SEU A;  2KJB A;  2H1K A;  2P5L C;  3FMS A;  4HV5 A;  1T0F C;  3B02 A;  4A12 A;  5EGO B;  3K0L A;  1YTY A;  1JJ6 C;  2HVR A;  4HAM A;  4A3C J;  1STZ A;  4PK4 A;  3CCY A;  4A3G J;  3A4C A;  4V2G A;  3VYS B;  4P9U A;  3QOE A;  5BNG A;  3HL2 A;  1OCZ H;  4AIK A;  4S04 A;  4ZYG A;  2GOX B;  3ZQG A;  1MBF A;  1D0Y A;  1R1V A;  4WWC A;  1HKQ A;  4W97 A;  3HXL A;  4HLX A;  2C6Y A;  3CME I;  4XON A;  1BA5 A;  2V9K A;  4NC7 A;  2ELK A;  1TWG J;  3L09 A;  2OCE A;  2EFN A;  2R7F A;  5F6F A;  1I39 A;  2R7X A;  2E36 A;  2E5N A;  3K2A A;  2Z9O A;  1POG A;  2QGU A;  4C30 A;  4ENM A;  4I0A A;  2P81 A;  4U0V A;  1GV2 A;  4GDF A;  3OSF A;  1KQ9 A;  2D1H A;  1ETX A;  1W7P B;  2FU4 A;  2WAQ N;  4YII A;  3TDZ C;  2DFF A;  2R7S A;  1F43 A;  3G2B A;  1IW7 F;  3OIP A;  1AOY A;  1QZE A;  2W85 A;  3LL7 A;  3RKW A;  3KYD B;  1I1G A;  4BYY A;  2L7F P;  1AWC A;  1UG2 A;  2F4M B;  2ESH A;  3FZV A;  3KEY A;  3FX3 A;  2L9V A;  1KGS A;  3PSI A;  5F08 A;  3LWF A;  2K4B A;  2FQ4 A;  2XAQ A;  1MW7 A;  3LNQ A;  2EIJ H;  2QYO A;  4NBQ A;  3RKY A;  4I2O A;  4HPQ A;  1PP8 F;  2VE8 A;  3ZQI A;  4RDU A;  1ZGJ A;  2EA2 A;  2AHQ A;  3TOA A;  3RPU D;  2EJR A;  4CCM A;  2M5W A;  5FFZ A;  2CUF A;  5CJ9 A;  1ORK A;  2VC1 A;  3FDY A;  1BW6 A;  5LGN A;  1HA8 A;  2KJC A;  3E0J B;  2COB A;  3SFZ A;  4A3L J;  3V7C A;  1TT0 A;  2ZBK A;  5DCM A;  4A3K J;  2BVM A;  2HOS A;  1ZEL A;  5LHH A;  4RB1 A;  3A02 A;  2LY1 A;  1Y6I A;  1OYY A;  2MYS A;  3QU6 A;  2O7O A;  3W2W A;  1JKO C;  2IA2 A;  2WV1 A;  3K7A J;  4RGS A;  1MNE A;  4ZH4 F;  3LST A;  2DA1 A;  2JK3 A;  3H9Q A;  1QVU A;  4P5O A;  4EMS A;  3CLO A;  5FD5 A;  1BI2 A;  4G6T B;  1Y0U A;  3HTU A;  2L9R A;  4OOI A;  5BOX A;  1S6L A;  4XOT A;  2GQQ A;  4HLY A;  1GXQ A;  3FXU A;  3PNY A;  4JBA A;  2FXA A;  3I0T A;  3W6J B;  4DBQ A;  5B3S H;  2LSO A;  2DT7 B;  2QF7 A;  3OYI A;  1EV7 A;  3ASN H;  4NB5 A;  1P4W A;  4XMY A;  2LLK A;  2IS2 A;  4L9V A;  5B1A H;  2V1D A;  4BS9 A;  3N97 A;  3HTS B;  2M8G X;  2DT5 A;  3HG9 A;  1T98 A;  2HR3 A;  1YG2 A;  3DLA A;  2M34 A;  1B72 B;  2PMH A;  5L3C A;  1S7O A;  1ULY A;  3DFG A;  3SJM A;  2AXL A;  5K5Q A;  1OQY A;  3RTR A;  3O3K A;  3EUA A;  1J2X A;  2ETH A;  4FET A;  1S7A A;  1K6O A;  5HNH A;  2XHK A;  3CCR I;  1CGP A;  1R36 A;  1IN6 A;  2BHY A;  2KZV A;  4ZDP A;  3C1D A;  1I50 J;  4R1H A;  4RMN A;  3CCV I;  3S14 J;  4AWX B;  1IN8 A;  2X1D A;  1K61 A;  3K4M A;  3X2Q H;  1XCB A;  2BY0 A;  2IA1 A;  2VXZ A;  2M30 A;  1FIP A;  3ML6 A;  4EGZ A;  2XGC A;  5BPD A;  5TJJ A;  2W48 A;  3WG9 A;  2MGQ A;  3GCM A;  5BPI A;  3OR2 C;  2LH9 A;  4RM2 A;  3N05 A;  4OMZ A;  2KIM A;  3GBG A;  2R5Z B;  5J4V A;  3OYB A;  3RJP A;  2BXZ A;  5ICE A;  2EZK A;  2X1C A;  4XLH A;  1YHQ I;  2DYR H;  1PDN C;  2HTS A;  1K4S A;  5D5X B;  2CV2 A;  3DTI A;  1D3Y A;  1QHH D;  1X1B A;  3OYH A;  2DU9 A;  1KQ8 A;  1XGN A;  2LRD A;  5FKN A;  1U8B A;  3I4P A;  3PUB A;  3WHB A;  1D5Y A;  3M07 A;  4O3M A;  3WG7 H;  4UUT A;  2WV0 A;  3CCS I;  4IQ4 A;  1E3O C;  1E3P A;  1FSH A;  2L7M P;  4XRM A;  1WH7 A;  2L4M A;  3CUQ B;  4UV8 A;  4L0Y B;  3BTC A;  5KVR A;  1JKQ C;  1VQK I;  3PFI A;  3QAH A;  3W6V A;  2CW0 F;  5FD6 A;  1ZAR A;  4IHV A;  3ZMD A;  3CCQ I;  3VEP A;  3I4N J;  3TP0 A;  1VQP I;  4JOM A;  2K9S A;  2K9N A;  4Q48 A;  2Q0O A;  5JR3 A;  4C3H J;  4ITV A;  4C3J J;  2CQK A;  2OBP A;  5TGT A;  4C2M J;  5E3L A;  1ZLJ A;  2H09 A;  4M9X A;  2RRE A;  2NS8 A;  2DMU A;  3BR1 A;  1EH8 A;  1LQ1 A;  2HOT A;  1I3A A;  1OMI A;  4RGR A;  2RC4 A;  5TRD A;  3LMM A;  2Z99 A;  3PNT A;  5IOZ A;  5ILS A;  4BBR J;  4E70 A;  1LB2 A;  2ZJ2 A;  1O7L A;  2CH0 A;  4X0G A;  4WXD A;  3DTK A;  1YQA A;  2GZW A;  4N0B A;  5GTI C;  2VB6 A;  4OIO F;  1SD7 A;  2NS7 A;  3J7Z I;  3K1M A;  3I5U A;  4M6Y A;  1REP C;  2KIQ A;  1KU7 A;  2UXX A;  4PCQ A;  1JGG A;  1R5H A;  3U9G A;  3JRD A;  3R6S A;  1UHW A;  2PQ8 A;  2ZXW H;  1Z3Y A;  3LSK A;  1UCR A;  5JHF A;  5KAF C;  3LSR A;  1OCT C;  1OCR H;  3CCJ I;  3DV8 A;  3Q9V A;  5C3E J;  1X1A A;  2JSC A;  2BY2 A;  4HW0 A;  2A5W A;  3UR3 C;  1B9N A;  2DAO A;  4G12 A;  3KP6 A;  4EJV A;  2FBH A;  2M87 A;  4G9Y A;  4BJ5 C;  1A36 A;  4U0W A;  1XMX A;  2KQR A;  1G8X A;  1Y1V J;  4A3D J;  4GGG A;  2ZSI B;  2L5Q A;  3WU2 C;  1LFP A;  4P55 A;  2JA5 J;  2K5C A;  3LSP A;  4CUG A;  3P5J A;  3JCU C;  3H3U A;  1JKP C;  2STT A;  4BQN A;  5D6E A;  4KIC A;  4HNT A;  2VPL A;  2O3F A;  4EVI A;  3H0D A;  1RUN A;  3F72 A;  3PM1 A;  1GV5 A;  5LRR A;  2O5R A;  5EJC A;  1Q1V A;  3J80 K;  1AKH A;  3C2H A;  1WJA A;  3BOQ A;  3RCO A;  1DU6 A;  3O2P E;  3V8L A;  3KFW X;  3OSG A;  2G7H A;  2JJ7 A;  5DUI A;  5CVI A;  3T0Y A;  3BZC A;  5KHD A;  1FZP B;  4IQJ A;  1YRN B;  2BW3 A;  4Q5S F;  4KDP A;  4HZF A;  3W3C A;  2IBD A;  1RC9 A;  1Y8Q B;  2PJR B;  2V4J C;  1TQM A;  1NK2 P;  1ERD A;  2XAF A;  1Z7U A;  2HQ5 A;  4BXU A;  4HOB A;  1SFK A;  1H8A C;  3KZZ A;  1H9T A;  2CV1 A;  2BY3 A;  4AD9 A;  1P4X A;  1DGW Y;  1JT6 A;  4U7B A;  4NUB A;  5HLT A;  3ERM A;  1MBG A;  2LC2 A;  3SYT A;  4KT6 A;  3BCB A;  5JVG F;  4U88 A;  4BH9 A;  2FOW A;  3I56 I;  1FIA A;  3PL8 A;  3VYU B;  2EQR A;  3HHH A;  1R58 A;  3JRF A;  3SXY A;  2E7W A;  3MKL A;  4B3X A;  5BQT A;  1V54 H;  2M9H A;  4UUS B;  5DTD A;  5J6X A;  1I6X A;  1J09 A;  3ZMZ A;  4KNY A;  1OPC A;  3TW7 A;  1HW5 A;  2ZFU A;  2V9V A;  1TBX A;  4A3I J;  2BVL A;  3H3Z A;  2VPR A;  3CC7 I;  3QOD A;  2VBX A;  3FWE A;  2QM3 A;  4LLL A;  6PAX A;  4G8X A;  3S2W A;  3LFK A;  1YFH A;  2VT2 A;  4XKB A;  3HBL A;  5FLM J;  3ECO A;  1BM9 A;  2DDA A;  3F8F A;  3I53 A;  1SD5 A;  2V79 A;  2OV7 A;  2WTE A;  3C2G A;  2V6C A;  4RS8 A;  2DFH A;  4OIN F;  1HW2 A;  1DDN A;  3PQK A;  4HRI A;  2Z1D A;  3HM5 A;  2JA8 J;  3KLN A;  2CUE A;  2HXI A;  1Z0X A;  2JUC A;  1QA6 A;  4BAC A;  1HBX G;  3JTG A;  2EBI A;  2AQE A;  3WE3 A;  3LSH A;  2PX9 A;  4XLC A;  1W0U A;  4CSW A;  2KRC A;  3E6B A;  3DWL E;  1QZY A;  4R79 A;  1YOV B;  3HUG B;  3TO6 A;  3OYA A;  4S0H B;  4M3D A;  4HDV A;  3FK6 A;  3VB2 A;  3LQR A;  2HOE A;  2W00 A;  3BTJ A;  2EIM H;  1WJ5 A;  3ABK H;  1U3E M;  2M4K A;  4ABZ A;  4NQW A;  2XUB A;  3CP8 A;  3H0G J;  1WSU A;  4II2 A;  4DJA A;  3EUK L;  2KMU A;  2OPT A;  3S32 A;  2L7Z A;  1D1C A;  1WH5 A;  2ICW G;  2J5P A;  5HLI A;  1DP3 A;  2OC6 A;  3NEU A;  3QU3 A;  2LBF A;  4YFK F;  2L54 A;  2IA0 A;  4LG3 A;  4G7O F;  4AM3 A;  3WTW C;  1O3T A;  1Z9C A;  5KK1 A;  4Q4Z F;  3BG7 A;  5ICF A;  2NVQ J;  2Y48 A;  3FKJ A;  1MGT A;  2QUF A;  5L3D A;  4MNU A;  1D8K A;  2MH2 A;  4DOZ A;  4BAY A;  4RAZ A;  3IUO A;  5FFX A;  4EJO A;  3JRE A;  2OF7 A;  5D8K B;  2H8W A;  5IY5 H;  1UHS A;  3M8J A;  2DA5 A;  5HDK A;  1GT0 C;  2IT0 A;  1MJA A;  3A03 A;  5HVQ C;  3RSN A;  5AIP A;  5EF6 A;  3L00 A;  3JRB A;  4F3Q A;  4AVZ A;  2DPD A;  4UY8 I;  1YLF A;  3OS0 A;  3H5A A;  4HQM A;  4V19 K;  4XSZ F;  1C0W A;  2V26 A;  1FOW A;  2NVY J;  2YX7 A;  3SZT A;  1EF4 A;  2W84 A;  3CCM I;  2D2W A;  1YJN I;  1FTT A;  3HOX J;  3SHF A;  4NNJ A;  3OYG A;  2XF7 A;  2YSR A;  4Y7N J;  3PO3 J;  2R92 J;  4M3G A;  2KLO A;  4L5I A;  2R7V A;  3BQZ A;  3TED A;  3NRV A;  4BNC A;  1AU7 A;  4CYC A;  3KIO A;  4JQF A;  3OOU A;  3VSK A;  5A2Q Z;  1WQ2 A;  3RYR A;  3NAR A;  3IWF A;  4LB5 A;  1K83 J;  3U1K A;  2DTR A;  2LRE A;  3KZI C;  1BOA A;  1JHF A;  5DD4 A;  2H27 A;  4FX0 A;  3HJE A;  1BR2 A;  3DEU A;  1V5F A;  5JI6 A;  3OYE A;  3FMR A;  2DK5 A;  2Y9Z A;  1IJW C;  3CF5 F;  3F8N A;  4E7H A;  2CYY A;  1LDD A;  1Y39 A;  2GIZ A;  5KAI C;  3HIF A;  2KZG A;  4WX9 A;  1IXC A;  4X6A J;  2GXG A;  4D5C A;  1BC8 C;  2EFO A;  3BJ6 A;  4FTH A;  4LK0 F;  2ADU A;  4IVN A; 
#chains in the Genus database with same CATH homology
 1ZN2 A;  1X3U A;  3CO7 C;  4OIQ F;  1F5T A;  4LMY A;  4S05 A;  3MQ0 A;  5LHG A;  3GFM A;  3O6B B;  4RB3 C;  1Z91 A;  2RGV A;  1XD7 A;  3RPQ A;  3F8C A;  3TKY A;  3MFK A;  5E1W A;  1VTN C;  2BYV E;  1FT9 A;  2P7C B;  2XGX A;  1XGS A;  1MJ9 A;  3QRF F;  1PUE E;  1BI1 A;  2CWE A;  1T2K A;  5CLS A;  2VE9 A;  3F8M A;  2HDC A;  4P9F A;  2PEX A;  3D0S A;  5D4R A;  2XRO A;  4CHU A;  2P5V A;  3L7W A;  3JW4 A;  2P7V B;  4M6X A;  1U2W A;  4IXA A;  1IXR C;  2G7U A;  1R1T A;  4OMY A;  4A5N A;  1ZRD A;  1EH7 A;  5ERI A;  2PI0 A;  4MHG A;  3GXO A;  1IZ1 A;  1IF1 A;  2A61 A;  2ZNZ A;  3IC7 A;  1BI0 A;  4LK1 F;  1ONV A;  1DPU A;  2VC0 A;  2JZY A;  2W57 A;  3I59 B;  4UV9 A;  2B0L A;  3KP2 A;  3BWG A;  2HS5 A;  3AAF A;  3ABT A;  4FX4 A;  4RGX A;  3G3Z A;  3KCC A;  1IUY A;  1I27 A;  1BBY A;  4I01 A;  4WXC A;  2PMU A;  4A5M A;  4O6J A;  2IW5 A;  2EV0 A;  2FNA A;  1FNN A;  4L9J A;  3MEX A;  2PG4 A;  4CIC A;  1SMT A;  2OQR A;  1K79 A;  4I7H A;  2HKO A;  2A07 F;  3ISP A;  2COM A;  2AS5 F;  2FBK A;  2MH9 A;  4LFU A;  3HRS A;  4U7D A;  1UHM A;  1CF7 A;  1KU9 A;  3E5U A;  1MJB A;  4KIF A;  2EK5 A;  4LG0 A;  1IN4 A;  1XDS A;  1LEA A;  4U0Y A;  4M9S A;  2FMY A;  2LF8 A;  4BHB A;  2OU2 A;  1RIO H;  5AON A;  2HQR A;  3P9C A;  1Z05 A;  4KYW A;  3T8R A;  3RYP A;  4PZJ A;  3E6M A;  2Z3Y A;  1FYM A;  4RB2 C;  4G6D A;  4UUV A;  1B1B A;  3BRO A;  2IJL A;  1XN7 A;  1P92 A;  5JVT A;  1DUX C;  4LB6 B;  1L0O C;  3K2Z A;  3GZ5 A;  1DP7 P;  1KU2 A;  2K7L A;  3H92 A;  1P4A A;  1FBS A;  4UVA A;  4HF0 A;  2EV6 A;  2XAS A;  5LGU A;  1L3L A;  4UNO A;  3RDI A;  1TLH B;  3TO9 A;  4UHT A;  1U5T A;  3M8F A;  3HRM A;  5HDG A;  3ZQ7 A;  5JFR A;  1LVA A;  3P9I A;  2NNY A;  1SD4 A;  3EUH A;  3L2C A;  3FM5 A;  5E1Z B;  1HKT A;  2V1X A;  2NRA C;  4HV6 A;  1BI3 A;  4IF4 A;  4YFX F;  1G3W A;  2FA5 A;  2OZU A;  1SFX A;  2Y0M A;  1SFU A;  3SQN A;  1K78 B;  2HQN A;  2MA3 A;  2HTJ A;  4BHC A;  3U1D A;  3IHU A;  2L3D A;  3ZPL A;  1E2X A;  3RI4 A;  2GAU A;  2HEO A;  4KIG A;  2DQL A;  1R7J A;  5HS8 A;  2WC2 A;  1J9I A;  2ESN A;  1OYW A;  1ON1 A;  2QVO A;  2BGC A;  1JHH A;  2ZKZ A;  3QPH A;  2ZME A;  2DO7 A;  1FYL A;  1ZHF A;  3JSP A;  3BJA A;  2WWY A;  2DPU A;  4WCG A;  3IKV A;  1XB4 A;  4ETS A;  1P2F A;  3LA7 A;  1FOK A;  3MZH A;  4D0P A;  5K1Y A;  2XKP A;  4RGU A;  1LDK B;  2F5E A;  2YU3 A;  2DBB A;  4AVP A;  2A6E F;  2FOK A;  1W4M A;  5E8G A;  3E6D A;  4HF1 A;  1BN5 A;  4EGY A;  2XKO A;  2VOP A;  1FBQ A;  2JPC A;  3EYI A;  1KU3 A;  3LQQ A;  3KP7 A;  3WTS C;  4ZZD A;  2MD5 A;  4A0X A;  2NAZ A;  1FC3 A;  2UXN A;  2HZT A;  1U8R A;  3C7J A;  1FY7 A;  3E5Q A;  3K1P A;  3LAP A;  2W25 A;  5E8I A;  2HWV A;  4L9N A;  3IRR A;  4F7Z A;  4LLN A;  5FLX Z;  1IN5 A;  2LNB A;  1G3Y A;  3DP7 A;  2KRF A;  3F3X A;  4LGW A;  1ODD A;  3ZMT A;  1K7A A;  4OIR F;  2P6S A;  2P5K A;  2PN6 A;  2EWN A;  1UB9 A;  1MD0 A;  5H20 A;  3ABU A;  1LDJ A;  5IT3 A;  4AIJ A;  2QZ8 A;  3V7S A;  3EDP A;  1TNT A;  3CO6 C;  3BY6 A;  4A6E A;  1J0R A;  2V1U A;  2IPQ X;  3JAM Z;  1J59 A;  2EV5 A;  3V8K A;  2FBI A;  4RB0 A;  1D8J A;  2ISY A;  4LD5 A;  2ZCW A;  3FHZ A;  4GCV A;  4NHJ A;  2JTV A;  1HSJ A;  5FB2 A;  4ENJ A;  2FEZ A;  5HS7 A;  3ROU A;  4PGG A;  3KLO A;  1U6G A;  1EH6 A;  2Z33 A;  5CYV A;  4UXN A;  2STW A;  1IRG A;  4G7H F;  5DCM B;  3IKT A;  4I09 A;  4ZYD A;  2KIU A;  2JPB A;  1ZYR F;  4YG2 F;  2Z5U A;  4Q47 A;  4CZZ A;  3ERE D;  3FMQ A;  1W7P A;  3HRT A;  4CGZ A;  2GA1 A;  2CG4 A;  2D1V A;  1XSX A;  4L5J A;  4ESF A;  1HW1 A;  3DQV C;  1LJ9 A;  4WK8 F;  4M72 A;  2O0Y A;  2EFW A;  2YX4 A;  1U5T B;  2LF7 A;  2XAG A;  4XBF A;  2E1C A;  1U5T C;  3L9F A;  4N9H A;  1RNL A;  2FE3 A;  1XGM A;  2XAJ A;  1ZLK A;  3J7A O;  1I5Z A;  5E17 F;  1YW7 A;  4LJZ F;  2FML A;  3BP8 A;  3K9T A;  3WTU C;  1P6R A;  2CSO A;  4IHS A;  2ELH A;  2JT1 A;  2IRF G;  4MEX F;  4O5V A;  3KEQ A;  1ZH5 A;  3CUO A;  4G6Q A;  5J8C A;  4GYG A;  2F5D A;  1YW9 A;  2RNJ A;  4KN4 X;  3DKW A;  3GW2 A;  5FGM A;  2CFX A;  3RIR A;  1BIB A;  4MEY F;  4Y17 A;  2NNN A;  4ZYE A;  2ADU A;  4IRI A;  4PDK A;  5DEQ A;  4YFN F;  4KN7 X;  2L4A A;  3BJO A;  3KEO A;  4ENK A;  2RV8 A;  4RAY A;  3M8E A;  4QWQ A;  1XCV A;  2ACJ A;  2F5F A;  3I64 A;  1W7P D;  2A6H F;  3SZP A;  2UWM A;  1Z6T A;  2GWR A;  1QZZ A;  2H6B A;  2P8T A;  3FXR A;  1FP2 A;  4PGH A;  5LGT A;  1W5S A;  5D5U B;  4IPA A;  5HDN A;  4KFC A;  1JE8 A;  4MQ9 F;  4Y13 A;  1FSE A;  4N9I A;  3C3W A;  3GX4 X;  1WRJ A;  3FF5 A;  2A68 F;  4KIB A;  4HX7 A;  1KA8 A;  3BPX A;  2KIF A;  3PQJ A;  1E17 A;  1D5V A;  3VOE A;  3MAJ A;  2VON A;  3CUQ A;  2P4W A;  3F6V A;  1GHC A;  4K2E A;  4B09 A;  1TTY A;  5E18 F;  3GZ6 A;  1F4K A;  3KP3 A;  1R22 A;  1G3T A;  3JTH A;  2O6G E;  3FXQ A;  1QPM A;  2CGP A;  2IP2 A;  1UFM A;  2KKO A;  2BBY A;  1ZRF A;  5HS9 A;  1ON2 A;  1ZG5 A;  1Z6R A;  1R1U A;  2X0L A;  3QPT A;  4KMF A;  5JHU A;  5F64 A;  4I98 B;  2ZFW A;  2Q2E A;  1FPQ A;  2TDX A;  2QEN A;  2YR2 A;  3T1B A;  1SD6 A;  4MGR A;  3LA3 A;  4ASN A;  2OD5 A;  5K5R A;  5EEG A;  3E3V A;  1B4A A;  1T6S A;  4EJU A;  4EQQ A;  3DPL C;  4XLP F;  3RKX A;  4IJA A;  3HRU A;  3T5X A;  2VT3 A;  1TW3 A;  2H6C A;  2R7D A;  5A2Q K;  1TQI A;  3W6K B;  1BJA A;  2L01 A;  3G73 A;  2L02 A;  3HYI A;  4FT8 A;  3R0J A;  1XGO A;  2D45 A;  5D6F A;  1ZG1 A;  1B59 A;  5BMZ A;  4BQA A;  1TW2 A;  5ILU A;  3WGH A;  1WKM A;  3HOT A;  3R61 A;  5H6R A;  4XLN F;  2PBI A;  1FX7 A;  1OYI A;  4LLG F;  4A2U A;  5CVJ A;  4EV0 A;  1T38 A;  1OR7 A;  1MKM A;  1W5T A;  1SMY F;  3VFZ A;  5D5V B;  5L3E A;  5HOO A;  3GO5 A;  2HGC A;  3ZMS A;  3M7G A;  1DPR A;  2DI3 A;  1HQC A;  5CVR A;  1YW8 A;  2QQB A;  4HF2 A;  1KYW A;  2ISZ A;  4HA8 A;  4IRG A;  2O8X A;  1KYZ A;  3WU1 B;  3GEZ A;  1QBJ A;  1RI7 A;  1YS6 A;  5LRS A;  1G3S A;  2E7X A;  3QOP A;  3GFI A;  2QQA A;  4MQV A;  3WOD F;  2OQG A;  2K27 A;  5L3G A;  4KUM A;  3P9K A;  1YIO A;  2M1B A;  1MDM A;  4WF2 A;  2M8E A;  3HUG A;  2O61 A;  2VBY A;  2IVM A;  1LEB A;  1SAX A;  1USS A;  2RDP A;  1XSV A;  2JRT A;  4I0B A;  1FLI A;  4IRH A;  2F2E A;  2QBY A;  4M73 A;  1I1S A;  3BPV A;  3TDU C;  3N4M A;  2XRN A;  1GXP A;  3KET A;  1J5Y A;  3J80 Z;  4M74 A;  3MCZ A;  3T8T A;  1RZ4 A;  1TQP A;  2X4H A;  2MC3 A;  3TQN A;  4KT5 C;  5L3F A;  3V8J A;  4JK1 X;  1BC7 C;  1XSD A;  5DUK A;  3KP5 A;  1F1Z A;  1IAW A;  2HYG D;  2XAH A;  3D5L A;  5F1R A;  3QP5 A;  5H6Q A;  2QWW A;  5D4S A;  4ENN A;  4L0Z B;  3F22 A;  3KZY A;  3COA C;  3C18 A;  2EA4 A;  2XV4 S;  1YS7 A;  3LAJ A;  1HKS A;  5LHI A;  1V3F A;  3J81 Z;  1NHA A;  1KQ0 A;  2OA4 A;  5CVV A;  1O7F A;  1FP1 D;  3GF2 A;  3CUQ C;  4AIH A;  3MZY A;  2RKH A;  4EM2 A;  2J5O A;  2MBF A;  1O3Q A;  1TNS A;  2EB7 A;  1O57 A;  2NS0 A;  1QGP A;  2FF4 A;  2ZXJ A;  1T39 A;  4FHT A;  2DQR A;  1JGS A;  1ZAO A;  4OU0 A;  5EEH A;  4CYD A;  1IN7 A;  3BZ6 A;  4ESB A;  2PFB A;  3ZMU A;  1SFE A;  2LKP A;  2R3S A;  3JSO A;  1YO5 C;  1U78 A;  3ELK A;  4ZZL A;  4YIF A;  2A69 F;  3E5X A;  5ILV A;  2FNP A;  1FBU A;  2PJP A;  3WTV C;  4M71 A;  1H9G A;  5ED4 A;  3KE2 A;  4DNC A;  4GO1 A;  2FRH A;  4GXO A;  5D8L B;  4HQE A;  2XIG A;  5ICG A;  3WTZ A;  3F8B A;  3F6O A;  1FYK A;  4KMU X;  3GVA A;  4M9Z A;  3HSR A;  3OV8 A;  3GWZ A;  3WTT C;  2YPR A;  2GXB A;  4G7Z F;  3LA2 A;  4A0Z A;  2VOD A;  3B73 A;  2OZ6 A;  3K1N A;  1CF7 B;  3NQO A;  3U2R A;  4LG0 B;  5DV5 A;  3I59 A;  3R0A A;  5DD8 A;  4ESJ A;  5IT9 Z;  4KA4 A;  1J75 A;  3WGI A;  3TO7 A;  3R4K A;  1ZRC A;  1IXS B;  2NYX A;  3HSE A;  4CDG A;  4IHT A;  1T0F A;  4I02 A;  1ZG3 A;  3WTY C;  3ZP5 A;  4H0E A;  3WU0 A;  5D5W B;  2EFP A;  2MLK A;  2FQ3 A;  5E20 A;  2VN2 A;  3IWZ A;  1XMA A;  3J81 K;  4HDU A;  1B9M A;  3I71 A;  4P96 A;  3Q5F A;  5LEJ A;  2FSW A;  3WE2 A;  5DDG A;  3CJN A;  5DYM A;  4XRF A;  1B6A A;  5FO5 A;  2Q8K A;  1LNW A;  1XDU A;  4XSX F;  1S3J A;  2A3S A;  2RVC A;  3KP4 A;  5CVU A;  2XVC A;  1ZGA A;  4HYE A;  3DPT A;  5LEK A;  1V4R A;  1OKR A;  1O3R A;  2ZO4 A;  5HLG A;  5LLQ A;  1MDM B;  4Y15 A;  3F23 A;  4DQ2 A;  5HLH A;  3VOD A;  1FWZ A;  3V7R A;  1HST A;  3GUD A;  4G94 A;  5FLX K;  4QLC U;  3WGG A;  3ZMV A;  2E1N A;  3P7N A;  3F21 A;  2HFH A;  2QBY B;  2QLZ A;  4L9T A;  2PLY A;  1IRF A;  2W24 A;  4TV7 A;  2OAZ A;  3CDH A;  3EYY A;  1S8N A;  4GYI A;  3WTX C;  1GVJ A;  2VBZ A;  2HKX A;  4CO8 A;  3HSF A;  3ZN0 A;  5K5O A;  3ZN1 A;  4R8H A;  2O03 A;  3DXJ F;  3JAM K;  1QQI A;  3HHG A;  2ZNY A;  1BIA A;  4UVC A;  3Q9S A;  3K69 A;  4Z2Y A;  3CTA A;  1ZRE A;  3IRQ A;  4WXH A;  5IT9 K;  2RQP A;  1QO0 D;  3GYH X;  2ZME B;  2K86 A;  3MWM A;  1QNT A;  2K02 A;  3ECH A;  1G6N A;  2CO5 A;  3FM3 A;  1K78 A;  2DK8 A;  2H94 A;  2M45 A;  3R60 A;  1WWX A;  5BS6 A;  3HOS A;  3REO A;  3I58 A;  3M1E A;  2K4J A;  1O3S A;  3I54 A;  1MZB A;  1R5G A;  2RN7 A;  1R23 A;  4MTE A;  4BHP A;  3ULQ B;  2P6T A;  4EM0 B;  3EQL F;  2DFI A;  2UZK A;  2DLL A;  2MLG A;  2F5C A;  4L18 B;  1UST A;  2BEO A;  2A5Y B;  2HYF A;  4HX8 A;  2GA2 A;  3E6C C;  2DW4 A;  1Q1H A;  1S29 A;  1JXS A;  5J8F A;  5DCF A;  2BE5 F;  2Y75 A;  1Z1D A;  4A0Y A;  3GLX A;  3EET A;  2VBW A;  4B8X A;  3BDD A;  3TGN A;  3OOP A;  4OIP F;  1J7K A;  3TOB A;  3M9A A;  1RUO A;  1R00 A;  3E97 A;  3GFJ A;  4HBL A;  3GFL A;  5L3B A;  2BV6 A;  5LBQ A;  2LDU A;  1WI9 A;  5E1X A;  5AIQ A;  2G9W A;  3RPU A;  1PP7 U;  4ON0 A;  2EFQ A;  4MTD A;  2VOO A;  1HXD A;  1G4D A;  1F9N A;  2QQ9 A;  4EM1 A;  3DF8 A;  1XMK A;  4UVB A;  1A04 A;  5ICC A;  2GIV A;  3V4G A;  3QP6 A;  1H0M A;  4EJW A;  1YYV A;  4A6D A;  4HX4 A;  4EJT A;  3IL2 A;  4ZYH A;  2KJB A;  2P5L C;  3FMS A;  4HV5 A;  3B02 A;  4A12 A;  3K0L A;  1YTY A;  4HAM A;  1STZ A;  4AIK A;  4P9U A;  4S04 A;  4ZYG A;  4WWC A;  1R1V A;  1HKQ A;  4HLX A;  2C6Y A;  3L09 A;  2EFN A;  2R7F A;  5F6F A;  2Z9O A;  4ENM A;  4I0A A;  4U0V A;  1KQ9 A;  2D1H A;  3TDZ C;  1W7P B;  2FU4 A;  4YII A;  1IW7 F;  1AOY A;  2W85 A;  3RKW A;  4BYY A;  1I1G A;  1AWC A;  2ESH A;  3FZV A;  3FX3 A;  1KGS A;  3LWF A;  2K4B A;  2XAQ A;  2QYO A;  3RKY A;  4I2O A;  1PP8 F;  2VE8 A;  1ZGJ A;  2EA2 A;  3TOA A;  2EJR A;  2M5W A;  5FFZ A;  5CJ9 A;  2VC1 A;  5LGN A;  2KJC A;  3SFZ A;  3V7C A;  2ZBK A;  5DCM A;  5LHH A;  4RB1 A;  1OYY A;  3QU6 A;  2IA2 A;  4RGS A;  4ZH4 F;  3LST A;  4P5O A;  4EMS A;  3CLO A;  5FD5 A;  1BI2 A;  1Y0U A;  3HTU A;  4OOI A;  5BOX A;  1S6L A;  2GQQ A;  4HLY A;  1GXQ A;  3FXU A;  4JBA A;  3W6J B;  2FXA A;  3I0T A;  4CXF A;  2LSO A;  1EV7 A;  4NB5 A;  1P4W A;  4L9V A;  2V1D A;  3N97 A;  3HTS B;  2DT5 A;  1T98 A;  2HR3 A;  1YG2 A;  2PMH A;  5L3C A;  1S7O A;  1ULY A;  3DFG A;  2AXL A;  5K5Q A;  3RTR A;  3O3K A;  1J2X A;  2ETH A;  1S7A A;  1K6O A;  2XHK A;  1CGP A;  1R36 A;  1IN6 A;  3C1D A;  4R1H A;  4AWX B;  1IN8 A;  1XCB A;  2IA1 A;  2VXZ A;  2M30 A;  3ML6 A;  4EGZ A;  5BPD A;  5TJJ A;  3WG9 A;  5BPI A;  4OMZ A;  2KIM A;  3RJP A;  5ICE A;  1PDN C;  2HTS A;  5D5X B;  1D3Y A;  2DU9 A;  1KQ8 A;  1XGN A;  3I4P A;  4O3M A;  2WV0 A;  1FSH A;  2L4M A;  3CUQ B;  4UV8 A;  4L0Y B;  5KVR A;  3PFI A;  3QAH A;  2CW0 F;  5FD6 A;  1ZAR A;  3ZMD A;  3VEP A;  4Q48 A;  2Q0O A;  5JR3 A;  2CQK A;  2OBP A;  1ZLJ A;  2H09 A;  4M9X A;  1LQ1 A;  1EH8 A;  1OMI A;  4RGR A;  2RC4 A;  5TRD A;  2Z99 A;  5ILS A;  4E70 A;  1LB2 A;  2ZJ2 A;  1O7L A;  4WXD A;  1YQA A;  2GZW A;  4N0B A;  4OIO F;  1SD7 A;  3K1M A;  3I5U A;  4M6Y A;  1REP C;  1KU7 A;  2UXX A;  4PCQ A;  1R5H A;  3U9G A;  3R6S A;  1UHW A;  2PQ8 A;  1UCR A;  3DV8 A;  3Q9V A;  2JSC A;  4HW0 A;  1B9N A;  2DAO A;  3KP6 A;  4EJV A;  2FBH A;  2M87 A;  4G9Y A;  4U0W A;  4GGG A;  4P55 A;  3H3U A;  2STT A;  5D6E A;  4KIC A;  2O3F A;  4EVI A;  1RUN A;  3F72 A;  5LRR A;  3J80 K;  3BOQ A;  3O2P E;  3V8L A;  3KFW X;  5DUI A;  2G7H A;  5CVI A;  3T0Y A;  1FZP B;  4Q5S F;  4KDP A;  4HZF A;  1TQM A;  2XAF A;  1Z7U A;  4BXU A;  4HOB A;  3KZZ A;  1H9T A;  4AD9 A;  4U7B A;  4U88 A;  4BH9 A;  3HHH A;  1R58 A;  3SXY A;  2E7W A;  5BQT A;  5J6X A;  1I6X A;  3ZMZ A;  4KNY A;  1OPC A;  1HW5 A;  2V9V A;  1TBX A;  3H3Z A;  2VBX A;  3FWE A;  2QM3 A;  4LLL A;  6PAX A;  4G8X A;  3S2W A;  3LFK A;  1YFH A;  2VT2 A;  3ECO A;  1BM9 A;  3F8F A;  3I53 A;  1SD5 A;  2V79 A;  2WTE A;  2V6C A;  4RS8 A;  4OIN F;  1HW2 A;  1DDN A;  3PQK A;  3KLN A;  1HBX G;  3JTG A;  3WE3 A;  3E6B A;  1QZY A;  4R79 A;  3TO6 A;  4HDV A;  3VB2 A;  3LQR A;  2HOE A;  1U3E M;  4NQW A;  2XUB A;  1WSU A;  5HLI A;  2J5P A;  3NEU A;  3QU3 A;  4YFK F;  2L54 A;  2IA0 A;  4G7O F;  3WTW C;  1O3T A;  1Z9C A;  5KK1 A;  4Q4Z F;  5ICF A;  2Y48 A;  1MGT A;  2QUF A;  5L3D A;  4MNU A;  1D8K A;  2MH2 A;  4BAY A;  4RAZ A;  5FFX A;  4EJO A;  5D8K B;  5HDK A;  2IT0 A;  1MJA A;  5HVQ C;  5AIP A;  3L00 A;  2DPD A;  1YLF A;  4HQM A;  4XSZ F;  1C0W A;  2YX7 A;  3SZT A;  2W84 A;  2D2W A;  3SHF A;  2YSR A;  4L5I A;  3NRV A;  4BNC A;  4JQF A;  5A2Q Z;  1WQ2 A;  3RYR A;  3IWF A;  4LB5 A;  2DTR A;  1BOA A;  1JHF A;  5DD4 A;  2H27 A;  4FX0 A;  3DEU A;  5JI6 A;  3FMR A;  2DK5 A;  3F8N A;  2CYY A;  1LDD A;  3HIF A;  4WX9 A;  1IXC A;  2GXG A;  1BC8 C;  2EFO A;  3BJ6 A;  4LK0 F;  1P4X A;  4IVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...