2ZKZA

Crystal structure of the transcriptional repressor pagr of bacillus anthracis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
b'YMSLEDDAELLKTMAHPMRLKIVNELYKHKALNVTQIIQILKLPQSTVSQHLCKMRGKVLKRNRQGLEIYYSINNPKVEGIIKLLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor pagR
publication title Crystal structure of the transcriptional repressor PagR of Bacillus anthracis
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transcription
total genus 24
structure length 86
sequence length 86
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zkzA00
1KU9A 1FX7A 2XAFA 3U9GA 5K5OA 3VOEA 3RJPA 2PG4A 2CFXA 3ZP5A 2BEOA 3RYPA 3QP6A 4ZZLA 3P9CA 1HBXG 5BS6A 4EJUA 1WSUA 3O6BB 4ZZDA 3IC7A 4GYIA 2DU9A 4EGYA 5A2QZ 4KIBA 3IKTA 4U0WA 2XASA 4S04A 1OYWA 2FNAA 2L02A 3E3VA 1FYLA 1SD4A 5FGMA 5BMZA 4KT5C 3BY6A 1HW1A 5CVJA 2QLZA 3ML6A 3HSRA 2IA0A 3I71A 1P4XA 2Z33A 1GXQA 3BDDA 3K2ZA 4I0AA 3ZN0A 2V1XA 4KIFA 5AIPA 1KYZA 1FSHA 2M30A 1IN8A 3SZTA 4U0YA 5TJJA 4TV7A 5A2QK 1LJ9A 1W7PD 2FNPA 2YX4A 1B1BA 2O6GE 1J5YA 4MQVA 5D5WB 2F2EA 1XGSA 2RQPA 2P7CB 2DW4A 1TQIA 4G7OF 1HXDA 3M9AA 1ZRDA 4HF0A 1XSXA 1D5VA 5BOXA 4EJTA 2A6EF 4EM1A 4HYEA 1ON2A 2PMUA 2M45A 2PI0A 4XRFA 4PGHA 3BJOA 5JI6A 4DNCA 1IRFA 1YG2A 2E7XA 4A0YA 4LB6B 3NRVA 4M71A 4IF4A 2Y0MA 3L09A 1PDNC 1RUOA 1UHMA 3KCCA 3HSEA 2NRAC 1OKRA 2K4JA 4EM0B 3MZHA 1BI2A 1L0OC 4LK0F 5HLIA 2X0LA 3QRFF 5LLQA 1XD7A 2R7DA 4EQQA 2M5WA 2VE8A 3J7AO 4UV9A 1I6XA 3VFZA 2Q2EA 2WTEA 4UHTA 3WU0A 4FX4A 1XMKA 2P5KA 3I58A 2X4HA 3FXUA 3B73A 2Q8KA 3H92A 3PFIA 4OU0A 1XGOA 3CLOA 3WTZA 2G7HA 2ZNYA 1P6RA 2QZ8A 1YW8A 2PJPA 4I7HA 1XSDA 2BV6A 4I98B 1MDMB 3ROUA 3F6OA 4UUVA 4OOIA 5JFRA 3PQKA 4OIRF 3E6DA 2JPBA 3SZPA 4RB2C 2E1NA 2PMHA 1BIAA 3R6SA 5ED4A 4G6QA 2V1UA 2FOKA 5EEHA 1YIOA 3GLXA 4ZYEA 1O3SA 1B4AA 4P5OA 3CUQA 4M9SA 3HTUA 1G4DA 1WQ2A 2R3SA 5E8IA 2E1CA 1FNNA 3KP6A 2P8TA 5BPDA 1DDNA 3U1DA 1UFMA 2A61A 4KFCA 3QAHA 4NHJA 3RDIA 3R61A 3WTTC 3F22A 2QM3A 2BGCA 3KEQA 2XAJA 2HS5A 2LSOA 3HOTA 3KZZA 4YFXF 2WWYA 1K78A 3KFWX 2VBYA 1FYMA 2DK8A 4IVNA 1T0FA 3E97A 4KNYA 2VONA 2K4BA 1MD0A 3C18A 3RI4A 4IXAA 3P9IA 3ULQB 1Z05A 3ABTA 2KIMA 3BPXA 1FBSA 3CJNA 3ECOA 1CGPA 4Y13A 4RB1A 3RPUA 3ECHA 1S29A 3HSFA 4P9FA 3DPLC 1HKSA 4MEXF 5HDKA 1T98A 3W6JB 5K1YA 2QBYB 2BYVE 2K02A 2HGCA 4LLLA 1F1ZA 3I5UA 4L5IA 2DPUA 3FF5A 1OR7A 1T6SA 4RGXA 3LQRA 3HUGA 1TQMA 3RKXA 4Z2YA 2ZMEA 4AWXB 3ISPA 2NS0A 4ON0A 2KJBA 3KP5A 4I2OA 1LEBA 3T8TA 1D3YA 3V7RA 1ZYRF 4IHSA 4UNOA 4L0ZB 2ESHA 3WU1B 1R00A 1SFXA 1KQ0A 1U5TC 3WTXC 1ODDA 4MEYF 1J2XA 3WTYC 1J59A 4ENJA 1QBJA 3JAMK 1UB9A 2H09A 4L5JA 4MTEA 2ELHA 4WX9A 2DAOA 3HTSB 1SD7A 3NQOA 3FX3A 1WKMA 3NEUA 3I0TA 4GCVA 3RKWA 4PCQA 3DPTA 1BBYA 1XCVA 3OOPA 3GX4X 1G6NA 3LAPA 3BWGA 3F6VA 4LLNA 4U0VA 2UXXA 2VXZA 3HHHA 2CWEA 5D6FA 1U8RA 1U5TA 3GO5A 4XLNF 5FD5A 5KK1A 2ADUA 1ZN2A 3HOSA 1SD6A 2JPCA 1MDMA 4GYGA 1R5HA 1R1VA 3MFKA 2HFHA 2XAQA 3FWEA 5HOOA 4ASNA 3TDUC 5D8KB 4M72A 1LDJA 3RKYA 2UZKA 3BP8A 4HX8A 2PLYA 3ZMDA 1SFUA 1GHCA 1WRJA 4HA8A 3GF2A 3O2PE 4Q4ZF 5KVRA 4RB0A 3GVAA 2STWA 2UXNA 2XIGA 3F8BA 3WE3A 4EJWA 1FZPB 1T39A 3T1BA 5K5RA 4KA4A 4KN7X 4P9UA 2VOOA 2RV8A 4BH9A 1XGMA 4N0BA 4LG0A 3O3KA 5F1RA 2CYYA 2A69F 1PP8F 2MA3A 3TGNA 3L00A 5JHUA 1IN4A 1ZH5A 2HTJA 4WCGA 1R58A 2XAHA 5E17F 2FQ3A 1C0WA 2XROA 1OYIA 1H9TA 1I5ZA 1SMYF 3DQVC 1ZHFA 4O6JA 5EEGA 4WWCA 1QNTA 2D1VA 2UWMA 5CVIA 4A12A 2ZKZA 3WTVC 2IA1A 1LNWA 2V1DA 4UVBA 1ZAOA 2MBFA 3HRSA 1I1SA 3E5UA 1WI9A 1TTYA 3WODF 2GA2A 1B6AA 5LRSA 3KP7A 4L18B 2ISZA 1XB4A 4HX7A 2RGVA 1XCBA 4RGSA 2YSRA 5E18F 1S7OA 3V8KA 2ZJ2A 2L01A 1SD5A 5DYMA 5D5VB 2P6TA 4RS8A 3MEXA 2EV0A 1EH8A 1QO0D 1BJAA 4HLYA 1SFEA 1EH6A 4HV5A 1W5TA 1K6OA 1KYWA 1UCRA 3E5QA 3CUQB 2DTRA 3RPQA 2OBPA 1S8NA 3V7SA 4U7DA 1P4WA 1BC8C 3DP7A 3R0AA 2H27A 2K86A 1FOKA 4PGGA 3ELKA 1FBUA 3I59A 2ZBKA 3TOBA 2EFNA 4G94A 1T38A 3LAJA 1FLIA 5ILSA 3GXOA 3M8EA 1PP7U 5E8GA 2AXLA 1IAWA 2IP2A 3MAJA 2HYGD 1JGSA 3P9KA 5BPIA 4KICA 2AS5F 4MHGA 4AIKA 1K78B 5BQTA 4OIOF 1TNSA 3C7JA 4HBLA 5LGNA 4M6YA 1UHWA 2BE5F 4R79A 3KLOA 4ENMA 4MQ9F 1SMTA 3CDHA 2GAUA 3QP5A 3WTWC 1ZRCA 4B09A 1ZRFA 5E1ZB 4CYDA 1HSJA 1V3FA 5DUKA 4LJZF 2COMA 1ULYA 1FSEA 3I53A 1R1TA 4U7BA 3W6KB 3QU6A 3GYHX 1ZLJA 4R8HA 1ZLKA 4MNUA 4HQEA 2EFQA 1W4MA 5IT9Z 2D1HA 3QU3A 5CVRA 3DEUA 4IRGA 2O3FA 2VN2A 4ZYHA 1Q1HA 1IN6A 2CSOA 3K0LA 4WXDA 3G73A 3M7GA 2E7WA 4I0BA 2V6CA 4OIPF 3WE2A 2ZMEB 5DCFA 5FB2A 5K5QA 3F8NA 2CO5A 5L3GA 2JZYA 3EUHA 5HLGA 1CF7B 2GZWA 3BPVA 2Z5UA 1J75A 4AIJA 4G8XA 4YFKF 5FO5A 2GXGA 1L3LA 4EJVA 3DF8A 5IT9K 2PFBA 2LF7A 2HZTA 1BN5A 4N9IA 4ENNA 1YW9A 4EJOA 3ZMTA 2ISYA 2FBHA 3GFIA 2VODA 3MWMA 5CVUA 3IWZA 4CXFA 1LQ1A 2FE3A 3G3ZA 3LSTA 3DV8A 1Z1DA 5D6EA 2EA2A 4K2EA 2M87A 4OMYA 1ZG3A 3TO9A 4I02A 2OZ6A 4JBAA 1HSTA 2IVMA 1U5TB 4A5MA 2IT0A 1B59A 4EVIA 4IJAA 4EMSA 4ESJA 5ICCA 1STZA 1LB2A 2A5YB 4L9TA 4CZZA 2FSWA 3OV8A 5J6XA 2DI3A 4A0XA 2MLKA 2F5EA 3VODA 2LNBA 5L3CA 1O3TA 2KIFA 1I1GA 4AIHA 5ERIA 2ESNA 1U2WA 1Z7UA 3FZVA 3M8FA 4AD9A 3F72A 2FU4A 1JXSA 4IHTA 2STTA 4UV8A 1ONVA 1YO5C 4ZYGA 1GVJA 2J5OA 4G9YA 2B0LA 4LG0B 4LLGF 3LA3A 1MGTA 3I4PA 3LA7A 4HW0A 2VBXA 2A68F 2EA4A 5JR3A 1Z6RA 2RDPA 5JVTA 2NNYA 2F5FA 3KLNA 1KU2A 4ESFA 2WC2A 2HEOA 2QQ9A 3S2WA 1ZGAA 4Q5SF 5F64A 1KQ9A 5HS8A 2EB7A 3ZMZA 2DT5A 3QOPA 1RZ4A 4KN4X 4XLPF 3T8RA 1IF1A 2K27A 3GEZA 3JAMZ 2XHKA 2HOEA 1YQAA 1QZYA 1IUYA 3F3XA 4PDKA 4NQWA 5DUIA 5L3EA 3EYIA 4OIQF 3DXJF 4I01A 2VOPA 2RN7A 1CF7A 4KIGA 1G3YA 4CDGA 2H94A 2EWNA 2CQKA 5H6QA 2KJCA 3F21A 3ZMVA 5D4RA 1U78A 3COAC 1AOYA 1S7AA 4OINF 3K9TA 4N9HA 3GZ5A 4M6XA 3VEPA 1BC7C 2M8EA 5AIQA 1FWZA 5FD6A 3I59B 2W25A 2RKHA 5FFXA 2ZFWA 1E2XA 3C1DA 4A5NA 3F8FA 5ICFA 5J8FA 1ZARA 2M1BA 2D2WA 3E6CC 4GXOA 2W85A 3REOA 5ILVA 3WTUC 3BROA 1U3EM 2MH9A 2IA2A 3B02A 4L9JA 3SHFA 2JSCA 3TOAA 3SXYA 4O5VA 2GWRA 2Z9OA 4RGUA 3TO7A 4HX4A 2A3SA 4Y15A 5ICGA 4HV6A 4NB5A 2OQGA 5DCMA 1P92A 4UVAA 4S05A 2JTVA 2RNJA 3J80K 2DK5A 4KMFA 2O03A 3V8LA 2EFPA 2HKOA 1TLHB 2FF4A 2IJLA 3L7WA 2L54A 3JSPA 1DUXC 4LK1F 1K79A 1BI0A 2OA4A 2O0YA 3CO7C 3EQLF 3R4KA 1OPCA 5HLHA 1JHFA 3RTRA 2FMYA 3CTAA 3K1NA 1XGNA 1YS6A 4BAYA 1Z9CA 2O61A 2NAZA 3R0JA 3Q9SA 2EJRA 4G6DA 1TW3A 3GZ6A 4LFUA 2YU3A 3HRTA 1Y0UA 2P5VA 2V9VA 3GFJA 1WWXA 3H3UA 2PN6A 5H6RA 2OAZA 3FMQA 2RC4A 4D0PA 3FM5A 1JHHA 2WV0A 1H9GA 5L3BA 3N4MA 4HF1A 2QWWA 5D5XB 3E5XA 2CG4A 1FBQA 1S6LA 4A0ZA 2W57A 5L3FA 4AVPA 3D0SA 1NHAA 3F23A 4IRHA 3D5LA 5IT3A 4M73A 3P7NA 1KQ8A 3I64A 4ZYDA 3FXQA 4M9ZA 4BXUA 2H6CA 1J0RA 3F8MA 1XMAA 4P55A 3JTGA 4XSZF 2LKPA 2QENA 4YIIA 2XUBA 2MLGA 3IRRA 1DP7P 1XDUA 2Y75A 3N97A 3GUDA 2GIVA 4ESBA 1D8KA 2F5CA 2LDUA 4IPAA 1R1UA 3HRMA 1O7LA 1AWCA 4LGWA 2YR2A 3QPTA 4L9NA 2NYXA 3HHGA 4EV0A 2RVCA 2XAGA 2Q0OA 3KP4A 5LBQA 1OMIA 3ZMSA 2P4WA 2JRTA 1BM9A 4HZFA 5FLXZ 5LHHA 2KIUA 3K1MA 1SAXA 4DQ2A 2IPQX 1IXRC 1W5SA 1HKQA 3K1PA 1J9IA 3H3ZA 3I54A 5E20A 3KE2A 2QQBA 3TO6A 5LHGA 4GO1A 3SQNA 3V4GA 4A6DA 1YTYA 1I27A 1XN7A 2A6HF 4M9XA 2GQQA 1LVAA 1F4KA 3J81K 4WXCA 2C6YA 2QVOA 2QQAA 5CJ9A 2CW0F 3R60A 2DLLA 1QPMA 1VTNC 1MJ9A 2G9WA 2PQ8A 3GFMA 3V7CA 2VC0A 2OZUA 5D5UB 2L3DA 3ERED 4A6EA 5FLXK 4R1HA 4CICA 1O3RA 3HRUA 1XDSA 3ZQ7A 2H6BA 5D8LB 3T5XA 1FP1D 1HW5A 1R7JA 2ZXJA 1O57A 3KETA 4XSXF 4ENKA 1TNTA 4I09A 3GWZA 3E6MA 3TKYA 3F8CA 1R5GA 1X3UA 2Z3YA 2W24A 3T0YA 1KA8A 2VC1A 2P5LC 4BYYA 2BBYA 1R23A 4ZH4F 2Z99A 1MJAA 4XBFA 5HDNA 2DBBA 4JQFA 3LA2A 2VE9A 5LRRA 1YFHA 4O3MA 2EV5A 4CO8A 3K69A 1FP2A 5CYVA 2ZO4A 2HYFA 2HTSA 1ZGJA 1RUNA 3CUOA 3M1EA 3MZYA 3CO6C 1LDDA 1RNLA 2ZNZA 2NNNA 4EGZA 3QPHA 2L4MA 4FX0A 4RAZA 3LFKA 4OMZA 3IRQA 4H0EA 2R7FA 4L9VA 2EFWA 2ACJA 1USTA 1QZZA 3ZMUA 3EDPA 4YG2F 1V4RA 1G3WA 1HKTA 3CUQC 2XKOA 4M74A 4L0YB 1O7FA 1W7PA 3GW2A 4YIFA 3KZYA 1TW2A 2G7UA 3BJ6A 1IN5A 3KP3A 3WGIA 2CGPA 2OQRA 2IRFG 4LD5A 2OU2A 5DCMB 2EV6A 4HOBA 4YFNF 1PUEE 5ICEA 3WGHA 2FBIA 6PAXA 1QGPA 5ILUA 2PEXA 4F7ZA 2HDCA 4WF2A 3JTHA 1DPUA 3L2CA 1YLFA 2IW5A 4BHCA 3JW4A 2O8XA 1MKMA 1F9NA 2GA1A 1R36A 3TQNA 3IKVA 3VB2A 2MD5A 3L9FA 5HVQC 3FHZA 3KEOA 5LGTA 3WG9A 1JE8A 1RI7A 2HQRA 2K7LA 2VBWA 4EM2A 1KU7A 4KYWA 5FFZA 3JSOA 1F5TA 2XKPA 2DO7A 4E70A 1RIOH 3RYRA 3SFZA 1FC3A 5LEJA 1J7KA 4HAMA 1A04A 2MH2A 4UXNA 4LMYA 5DEQA 3U2RA 4MGRA 4UVCA 4B8XA 2FA5A 1YW7A 2FRHA 5AONA 2F5DA 4HQMA 1B9NA 3IWFA 1K7AA 2DQLA 2XVCA 2P7VB 2DFIA 5F6FA 1BI3A 4BHPA 1S3JA 3EETA 1T2KA 2HR3A 1IN7A 2VT2A 4BQAA 3WGGA 1BI1A 4FHTA 3TDZC 1IZ1A 1E17A 2YX7A 1IRGA 1MJBA 2VT3A 1IW7F 3IL2A 3Q9VA 1HW2A 1FYKA 4MTDA 3KP2A 1BOAA 3PQJA 4QLCU 1KU3A 2HQNA 4KDPA 4PZJA 2MC3A 4HF2A 5D4SA 4KMUX 5CVVA 1P4AA 1TQPA 3FMSA 1O3QA 4WK8F 1EV7A 3EYYA 1DPRA 1ZG1A 3HYIA 3J80Z 3DFGA 4CHUA 1FY7A 1QQIA 3LQQA 3ABUA 4HDVA 1P2FA 3ZN1A 5DD4A 5LHIA 1ZREA 3AAFA 3IHUA 1ZG5A 4BNCA 1Z91A 5CLSA 1OYYA 4GGGA 1IXSB 2KKOA 3MCZA 3RIRA 1LEAA 2W84A 2D45A 2FBKA 1FT9A 2FMLA 2JT1A 4Y17A 2P6SA 5DD8A 4KUMA 1GXPA 4P96A 4G7ZF 4Q47A 1HQCA 4RB3C 4IRIA 2XGXA 1H0MA 5DDGA 1LDKB 4BHBA 5E1WA 1YYVA 2DQRA 4JK1X 4RGRA 3DKWA 2OD5A 3FM3A 4ETSA 1MZBA 5E1XA 3BJAA 1XSVA 1FPQA 4FT8A 5H20A 4QWQA 1USSA 2EK5A 4Q48A 3Q5FA 2HWVA 4U88A 5HS7A 4WXHA 3FXRA 4RAYA 2FEZA 2L4AA 2XRNA 4G7HF 2PBIA 2J5PA 1BIBA 3FMRA 3BOQA 2LF8A 2V79A 1IXCA 3LWFA 3WTSC 1G3TA 5HDGA 5L3DA 3E6BA 5J8CA 5LGUA 5HS9A 3BZ6A 1REPC 2TDXA 2DPDA 5DV5A 3MQ0A 1EH7A 1TBXA 5TRDA 1YS7A 4HLXA 4HDUA 2YPRA 2ZCWA 1KGSA 5LEKA 1W7PB 1G3SA 4LB5A 2QBYA 1U6GA 1Z6TA 4A2UA 2KRFA 3GFLA 1R22A 1D8JA 1B9MA 3ZPLA 2XV4S 4CGZA 2A07F 2ETHA 3HIFA 3V8JA 2EFOA 2QUFA 2GXBA 2FXAA 2HKXA 1ON1A 2Y48A 3C3WA 2QYOA 2VBZA 3J81Z
chains in the Genus database with same CATH superfamily
2MSYA 1JT0A 1TP4A 1KU9A 3PO2J 1FX7A 2XAFA 3U9GA 1SFOJ 3JRIA 1YX3A 4CCOA 3GTJJ 4FASD 5K5OA 2G0EA 3OOUA 3VOEA 1AU7A 2X85A 4B1RA 4ZDLA 3RJPA 2QA4I 3FKJA 2PG4A 1VQ4I 2UV1A 1D1CA 2MGQA 2CFXA 1G2HA 3ZP5A 2BEOA 3JRAA 3RYPA 3GZNB 3QP6A 1W5CC 4JX5A 4IOCF 4CSWA 2R5ZB 4ZZLA 3P9CA 1CQTA 3HG9A 4XIDA 4XLFA 1HBXG 4EEFG 3ZQIA 2E60A 4EJUA 5BS6A 4IEJA 1WSUA 3O6BB 4ZZDA 1K4TA 3CDIA 3IC7A 4XRSA 1VQMI 2BY3A 5F0HA 2WAQN 1VQ9I 2LLKA 4GYIA 2DU9A 4EGYA 2XSJC 5A2QZ 4KIBA 2H1KA 3IKTA 4U0WA 3LSHA 2XASA 4YIRX 4S04A 3GTMJ 1VZ0A 4PK4A 1GDTA 1FIPA 1OYWA 5DTDA 2FNAA 2L02A 2L5QA 2KMUA 3AG4H 3E3VA 1FYLA 1SD4A 1EA3A 1K61A 5FGMA 1SVOA 1TT5B 2A5WA 5BMZA 4KT5C 5FRMA 1YE9A 3BY6A 1HW1A 2EINH 1UHSA 2BW3A 4PJJA 2HQAA 5CVJA 2K9SA 2QLZA 1WH5A 3ML6A 4HNVA 4NNJA 3HSRA 1WZ2A 2IA0A 3I71A 1P4XA 2Z33A 1GXQA 3BDDA 4XOTA 3K2ZA 2K9MA 4I0AA 3ZN0A 3P5JA 4BQOA 2V1XA 2E34A 4KIFA 4RM2A 3TP3A 4LIVA 4F3QA 2K3PA 5AIPA 1KYZA 5GPCA 5EEAA 1FSHA 2M30A 1IN8A 1BR4A 3SZTA 4U0YA 2E71A 2WV1A 3H9GA 5TJJA 2XC7A 3GTPJ 2M0CA 2KZGA 4TV7A 5A2QK 1LJ9A 1V54H 4LOCA 2VIXA 1W7PD 4FCYA 3OIQA 4E7SA 2VB6A 2FNPA 5FLMJ 2YX4A 1B1BA 1XMXA 4DYRA 3MKZA 2O6GE 4HRIA 1J5YA 4MQVA 1VQ5I 5CKTA 1OCZH 5D5WB 2F2EA 4HSTA 1XGSA 3ZQFA 2RQPA 4OAZA 3S3MA 2P7CB 1FIAA 1A36A 2DW4A 3FXKA 1TQIA 1LFPA 4E7HA 4G7OF 1HXDA 1A6QA 3M9AA 1ZR4A 1ZRDA 4AU7A 2CUFA 1X3ZB 4HF0A 1XSXA 4FE7A 1D5VA 5BOXA 4EJTA 4W97A 3CCEI 2A6EF 4EM1A 2ZXWH 3W6VA 4HYEA 1ON2A 2PMUA 2M45A 2QQ8A 4XRFA 2PI0A 2L0KA 2DT6A 3K7AJ 4PGHA 1K6YA 5EF6A 2EH3A 1LPQA 3BJOA 2KDZA 5JI6A 2O8KA 1RESA 4DNCA 2HI3A 4BXFA 1IRFA 1V5EA 1YG2A 2E7XA 2IGNA 4N4NB 4UUSB 1GV2A 2RQQA 4A0YA 5J1YA 4LB6B 3NRVA 1OFCX 4M71A 4IF4A 2EIKH 2Y0MA 3L09A 1X3WB 1PDNC 4EATA 1RUOA 1UHMA 2M8GX 3KCCA 3HSEA 2DOEA 2NRAC 1OKRA 3BLYA 2WB1A 2K4JA 4RLQA 3CCRI 2JJ7A 1PUFA 4A3DJ 2IS2A 5F0CA 3DKYA 3K6GA 4EM0B 3MZHA 1BI2A 1X4PA 1L0OC 3QYBA 3CF5F 4LK0F 5HLIA 4CCJA 2X0LA 3M8JA 5LLQA 3BG6A 3QRFF 1XD7A 2W7NA 2R7DA 4EQQA 5B66C 2M5WA 2VE8A 3J7AO 4UV9A 3V42A 4U87A 4XORA 2F5VA 1I6XA 2DMTA 3A4CA 3VFZA 1Z77A 2R7OA 2Q2EA 2Q1ZB 5DS9A 2XAUA 2WTEA 3BTIA 4UHTA 3AG2H 3WU0A 4FX4A 2KISA 1XMKA 2P5KA 3CCJI 3I58A 2X4HA 3FXUA 5GADJ 3B73A 3JRDA 2Q8KA 3H92A 3PFIA 4OU0A 3KEYA 1XGOA 4M3DA 3CLOA 3WTZA 1GT0C 2G7HA 2ZNYA 1P6RA 2QZ8A 1YW8A 1LUJB 5DM7F 1FMVA 2PJPA 3PO3J 4I7HA 3SYTA 1MSFC 1XSDA 2BV6A 3C2GA 4I98B 2ZFUA 5F04A 2A05A 2DA1A 2F4IA 5C4XJ 2HQ5A 1MDMB 4MFEA 3ROUA 3LSKA 4CCKA 3F6OA 4UUVA 3SEQA 4OOIA 5JFRA 4A3MJ 3PQKA 4OIRF 1JJ6C 3E6DA 1KZHA 2JPBA 3SZPA 4RB2C 2E1NA 2X6YA 2PMHA 1BIAA 1H8AC 3R6SA 5ED4A 3HPHA 4F93B 4G6QA 4ANJA 4XRSG 2V1UA 2FOKA 1T0FC 5EEHA 1BW6A 1YIOA 4CYCA 3GLXA 3WG7H 4ZYEA 1O3SA 2ZXIA 5FRNA 4KISA 1B4AA 4P5OA 2V6EA 2JA2A 3CUQA 5J47A 3HDDA 4M9SA 3HTUA 4XR6A 4BJ5C 1G4DA 1WQ2A 4PSWA 3DKXA 4JOMA 2R3SA 2DODA 5E8IA 2E1CA 1FNNA 3KP6A 2CS3A 3GLLA 1YOVB 2P8TA 4BBSJ 5BPDA 1DDNA 3U1DA 5KCMA 1UFMA 2A61A 3DBHB 3CF2A 1YJ9I 4JX4A 4KFCA 3QAHA 4NHJA 3RDIA 4ITVA 3R61A 2VJ4A 3WTTC 3F22A 3L2QA 2QM3A 1TT0A 2BGCA 2PJRA 4LG3A 3KEQA 3DBLB 2XAJA 2HS5A 2GBYA 2LSOA 4IQJA 4IQ4A 1MBEA 4B4CA 2R5YB 3HOTA 5J4YA 3QOEA 3H5AA 3KZZA 2BHZA 4YFXF 1OR7C 2HPIA 2Y30A 2WWYA 2DA5A 1K78A 1W0UA 1BR2A 1E3PA 4C3HJ 2VQLA 3KFWX 1NTCA 2VBYA 2ZMEC 3RQIA 1FYMA 3C2BA 3OYAA 2DK8A 4IVNA 3DEWA 1T0FA 2M4KA 3E97A 4KNYA 2VKVA 4BQNA 2VONA 2K4BA 3DTKA 4ZTFA 3GTLJ 1MD0A 2R7RA 3C18A 3RI4A 3SDBA 2ZJRF 4IXAA 5EG0A 4PJLA 3P9IA 3ULQB 4RMNA 1Z05A 3ABTA 2DN0A 2KIMA 3BPXA 1FBSA 3CJNA 3ECOA 4CZCA 3S1MJ 2JMWA 1CGPA 2E36A 4Y13A 3LMMA 4RB1A 3RPUA 1Z3XA 3CESA 3KYLA 3ECHA 1S29A 4B48A 3HSFA 3OIPA 4P9FA 3DPLC 1HKSA 4MEXF 5HDKA 1T98A 3W6JB 4A3EJ 1JI8A 5K1YA 1S9HA 1X1AA 1R71A 2DYSH 1E3HA 2QBYB 3OR2C 2BYVE 2LG4A 4P1WA 2FQ4A 2K02A 1HCRA 5CPRB 2E5ZA 2HGCA 4LLLA 4A3IJ 4AIDA 3CCMI 1F1ZA 3I5UA 4L5IA 4W1UA 1DU0A 2DPUA 4M3GA 3FF5A 1OR7A 1T6SA 4RGXA 3LQRA 3HUGA 3WHCA 1TQMA 3WHBA 4AUXA 3RKXA 4Z2YA 2LR8A 2ZMEA 4V19K 4AWXB 1B8IB 4FQGA 3LSIA 3ISPA 2RAEA 2NS0A 2DDBA 4ON0A 2KJBA 3KP5A 4I2OA 1LEBA 5IYBJ 3HXLA 3T8TA 1D3YA 2VKHA 3L2WA 4D1QA 3CC4I 3V7RA 1ZYRF 2DDAA 2VKDA 4G6TB 2JA6J 4J01A 3I4MJ 2BZTA 4IHSA 3FBIB 4UNOA 4L0ZB 2ESHA 3WU1B 3ZQQA 1R00A 1SFXA 3LSMA 1KQ0A 1U5TC 4F91B 3WTXC 1ODDA 2MYSA 2Y69H 2WY8Q 4UUTA 5K7HA 4MEYF 1SVMA 2X51A 1J2XA 4IZZA 4ZYAA 2IXSA 3LFUA 3WTYC 1BJZA 4ZC3A 1NH3A 2R7VA 1J59A 2EZLA 4ENJA 4XQFA 1QBJA 2HVRA 3JAMK 1UB9A 2H09A 1SC7A 4NC8A 4L5JA 1MMAA 4MTEA 4BACA 2ELHA 3OYMA 4WX9A 3U21A 3BG7A 1D1AA 5M5XJ 2DAOA 3HTSB 1SD7A 2CU7A 3NQOA 3FX3A 2MFZA 1WKMA 3NEUA 2VJ5A 4V2GA 3I0TA 4GCVA 3RKWA 4PCQA 2HVSA 2NVXJ 3DPTA 2E2IJ 1BBYA 1XCVA 5IYDJ 3ABMH 3H5RA 3OOPA 2E2JJ 3GX4X 1G6NA 3LAPA 3BWGA 2KP6A 2Y9ZA 3M1CA 3F6VA 4LLNA 4U0VA 3JR9A 2NVTJ 2BW3B 2UXXA 1XPXA 2H8RA 2VXZA 1E0EA 2ID3A 3HHHA 2CWEA 3K70D 5D6FA 3F9KA 1U8RA 2WB1N 1U5TA 3GO5A 4XLNF 5FD5A 4JX6A 5KK1A 2ADUA 3LL7A 1ZN2A 5KHDA 1SD6A 3HOSA 2JPCA 3FXOA 4BJTA 1MDMA 4PUSA 4GYGA 1R5HA 1R1VA 3LSPA 3MFKA 4A3JJ 1IUFA 2HFHA 2XAQA 3FWEA 5HOOA 4ASNA 2K3FA 3TDUC 1JKOC 5D8KB 4M72A 1LDJA 3RKYA 1HC8A 3BR1A 2UZKA 1WGXA 3BP8A 4HX8A 2PLYA 3ZMDA 1MNEA 1SFUA 3OYEA 2JA5J 3S1NJ 1WRJA 4HA8A 4F52A 1GHCA 3S3OA 3H35A 2HOTA 1R9TJ 3GF2A 2ZC2A 3O2PE 4XN0A 4Q4ZF 4RDUA 4C2TA 5DM6F 3CCVI 5KVRA 2CW7A 4RB0A 2WA0A 3GVAA 2STWA 3HGYA 4OWRB 2QSGX 3M3YJ 1ZGWA 3ZQCA 3CCQI 2UXNA 2XPVA 2XIGA 3E7LA 3F8BA 3WE3A 1Y8QB 3PM1A 2ICWG 3I55I 4EJWA 1FZPB 1P7JA 2DFFA 3CCUI 1T39A 3T1BA 5K5RA 3D1NI 4KN7X 4KA4A 1ZR2A 3BCAA 4P9UA 2VOOA 1IV8A 2DT7B 2RV8A 1V5GA 2Z1DA 4BH9A 2QF7A 1XGMA 4N0BA 1VQNI 1HLVA 2LRDA 3BQYA 5EJCA 3FXJA 4LG0A 3O3KA 5F1RA 2CYYA 2IAIA 2A69F 3DTIA 2BVMA 1PP8F 2MA3A 3TGNA 3HKZN 3L00A 3HOYJ 5JHUA 3CP2A 1IN4A 2QKMB 2CQ7A 1ZH5A 2KDOA 2HTJA 1XS9A 4WCGA 1R58A 2XAHA 1J09A 5IYCJ 5E17F 2E35A 2FQ3A 1C0WA 4A3KJ 2M3AA 2VPLA 2XROA 1ENHA 4B43A 1MMDA 1PUFB 1W36D 1OYIA 1H9TA 2DYRH 1I5ZA 1SMYF 3DQVC 1GV5A 1ZELA 1ZHFA 2R7ZJ 4O6JA 5EEGA 4WWCA 2ELJA 1QNTA 1OCRH 2UUZA 2D1VA 2UWMA 5CVIA 2LMDA 4A12A 2ZKZA 2R7WA 3NAUA 3OYHA 3WTVC 2IA1A 1I6HJ 1LNWA 5GAGJ 2V1DA 1OJLA 4UVBA 1PJRA 1ZAOA 2MBFA 5FKNA 2Q2EB 4D5CA 3HRSA 1I1SA 3E5UA 1WI9A 2QKLB 1S7EA 2EZHA 3ERMA 1TTYA 2JN6A 3WODF 2GA2A 1WHUA 1B6AA 1Z0XA 2AXTC 4XM3A 1IJWC 5LRSA 3KP7A 2OTLI 3HOXJ 4L18B 2MD0A 4NC6A 2NS7A 1XB4A 2ISZA 2HVQA 2HZDA 4I6ZA 4B3AA 3OYFA 3DBRB 4HX7A 2RGVA 3K4MA 4MLOA 1XCBA 4RGSA 3TP0A 2YSRA 5E18F 1A35A 1S7OA 3V8KA 3K4NA 2ZJ2A 3VYRB 4CH7A 2L01A 1SD5A 2A6TA 5DYMA 5D5VB 3CC2I 1Y8RB 2P6TA 5BNGA 1X2NA 4RS8A 1H89C 3MEXA 2EV0A 1EH8A 4IL6C 1QO0D 3BC8A 1BJAA 2P0WA 4HLYA 1SFEA 1EH6A 3FIWA 1W5TA 4HV5A 3Q0UA 1K6OA 4CYCB 3L2VA 1KYWA 1RPWA 4YELA 1UCRA 2HOSA 3E5QA 3OL3A 4XKWA 3CUQB 2DCEA 2DTRA 3RPQA 2OBPA 1S8NA 4BE1A 5E3NA 3V7SA 4U7DA 2CW8A 1P4WA 1BC8C 3DP7A 3R0AA 5B1AH 2H27A 2K86A 1FOKA 5GPAA 4PGGA 3ELKA 3RQ4A 3PNTA 1FBUA 1MH3A 3I59A 2ZBKA 3TOBA 2KFDA 4ZTJA 3CZ6A 3S2HJ 2EFNA 2XDVA 4G94A 1T38A 3LAJA 4BE0A 1FLIA 5ILSA 3PJRA 2Y0SA 3UR3C 1MMSA 3GXOA 3M8EA 1PP7U 1ITYA 5E8GA 4HPQA 4DYQA 1WH7A 4AVZA 2PJRB 2DMQA 2AXLA 3ABKH 4CCLA 5CQGA 4E7IA 2IP2A 3MAJA 2HYGD 1IAWA 1JGSA 3P9KA 5BPIA 4KICA 2AS5F 4MHGA 4AIKA 1K78B 5BQTA 4FETA 1ETWA 2X1CA 4OIOF 4DZJA 4PFOA 1TNSA 3C7JA 3MZ8A 1P7IA 4HBLA 2OC6A 5LGNA 4M6YA 1UHWA 2BE5F 4R79A 3KLOA 4S0HB 4ENMA 3A1YA 3EUHC 4MQ9F 1SMTA 3CDHA 1G8XA 1X1CA 2GAUA 3A0BC 3QP5A 3WTWC 1ZRCA 2LOOA 3HJEA 2DA2A 4B09A 1ZRFA 5E1ZB 4CYDA 1W0TA 1HSJA 1JKRC 5EG0B 3HGGA 1V3FA 5DUKA 5F08A 2TCTA 4LJZF 1A5JA 2VLAA 2COMA 1ULYA 1FSEA 3I53A 2JA8J 4UB8C 1R1TA 4U7BA 3W6KB 3QU6A 3GYHX 1ZLJA 4R8HA 3M4OJ 2CUJA 3FK6A 1ZLKA 1ZQ3P 4AC0A 1D0YA 5F1JA 5C3EJ 4MNUA 4HQEA 2EIJH 2EFQA 1W4MA 5IT9Z 2V7FA 2NVUB 2D1HA 4QIWN 3QU3A 3BZCA 5HNFA 5CVRA 4ZDOA 4IHYA 3DEUA 4FISA 4IRGA 2O3FA 2VN2A 5IP9J 4ZYHA 1JT6A 1Q1HA 2K9QA 1IN6A 2OCCH 2CSOA 4A3BJ 3EUAA 1F43A 1D5YA 2AQFA 2XGDA 3K0LA 4WXDA 4AYBN 2TRTA 3G73A 3HUGB 1O4XA 1BA5A 3M7GA 2E7WA 4I0BA 4NQWB 5KAFC 1VQKI 2V6CA 4OIPF 3WE2A 2VASA 2ZMEB 3D5SC 5DCFA 5FB2A 3S14J 1QVUA 1A31A 5K5QA 3F8NA 2PX9A 2P81A 2CO5A 2XF7A 5L3GA 2JZYA 3EUHA 1IDYA 5HLGA 1CF7B 2I8DA 3PL8A 3BCBA 2GZWA 3BPVA 2Z5UA 3H0GJ 1T08B 3OY9A 1IV6A 1J75A 4AIJA 4XN3A 4G8XA 2L7MP 4YFKF 5FO5A 2GXGA 1L3LA 3HM5A 3U1KA 2X1DA 3VPRA 2V4JC 3JRFA 1R4NB 4EJVA 2H1LA 3DF8A 3L2RA 5IT9K 2PFBA 2L7FP 2LF7A 3BTLA 4NC7A 4QTRA 3S93A 1VQPI 2HU9A 1BN5A 2HZTA 2VPRA 4N9IA 4ENNA 3OYNA 3QYEA 1YW9A 1BOBA 2M0MA 4J00A 4EJOA 2JVHA 3ZMTA 1AHDP 1FJLA 1GVDA 2ISYA 2FBHA 3GFIA 2Z2SB 2VODA 1WPKA 3MWMA 5CVUA 3IWZA 5J1UA 2WAEA 4CXFA 1LQ1A 3JREA 4BQQA 1ETQA 2FE3A 3G3ZA 3LSTA 3DV8A 3I3LA 1Z1DA 5HNHA 1GLNA 5D6EA 2VUMJ 2IEKA 3RKQA 2EA2A 4K2EA 2W82A 4BY1J 2Y9YA 1QU3A 2JUCA 3QWLA 1D0XA 2M87A 4OMYA 1ZG3A 3TO9A 4I02A 4BUPA 2O5RA 3LOCA 3M07A 2OZ6A 3I4NJ 3G6EI 2DJIA 4JBAA 4HNTA 4XKVA 4DIQA 2O9LA 1RRJA 1ETVA 1Z3YA 1HSTA 2IVMA 1U5TB 3CJQB 4DBRA 1I3AA 1Y0NA 4A5MA 2DXIA 2IT0A 1B59A 4EVIA 4IJAA 4EMSA 4ESJA 1NK2P 1M1EB 1MBGA 5ICCA 1MNDA 1STZA 1QHHD 1LB2A 2A5YB 3RPUD 2KLOA 1JTXA 2L7KA 2LC2A 4L9TA 5E79C 4CZZA 2FSWA 1W1WE 2E1MC 3OV8A 5J6XA 2DI3A 4A0XA 4RM3A 3JRCA 2MLKA 2DJNA 2F5EA 4BU2A 2WBMA 4KITB 3VODA 2LNBA 5L3CA 1O3TA 1R5ID 2KIFA 4JYKA 4PJNA 3SEZA 1I1GA 4AIHA 3JCUC 3O8GA 3PFYA 5ERIA 3CCSI 2ESNA 2DTZA 5LFAA 3OIOA 1U2WA 3BR6A 5J1RA 2ZB9A 3BTJA 2ZSIB 3ZRGA 3G1OA 1QRYA 1Z7UA 2JSPA 5CQEA 3FZVA 3M8FA 4AD9A 4F92B 3F72A 1U9OA 2FU4A 1JXSA 4IHTA 2STTA 4UV8A 1ONVA 1WJDA 1MIJA 4II3A 1YO5C 5EZGA 4ZYGA 1GVJA 2J5OA 1MBFA 3F0CA 3IUOA 4G9YA 2B0LA 5B3SH 4LG0B 4DZPA 4LLGF 1S5LC 3LA3A 1MGTA 2KIQA 3I4PA 3LA7A 4HW0A 2VBXA 4XKCA 2A68F 3OSFA 2EA4A 1T95A 5JR3A 4ZDPA 4MFDA 3BQZA 2X48A 5M5WJ 1Z6RA 3OYIA 2RDPA 5JVTA 3IAM2 2ELKA 2NNYA 2F5FA 2WADA 3TW6A 4XLEA 4IHWA 3KLNA 4BE2A 1KU2A 4ESFA 2WC2A 4CCMA 4A3FJ 5KAIC 1JJ8C 2HEOA 3GTGJ 2DMPA 2QQ9A 3S2WA 2EBIA 1ZGAA 3H1CA 4LIUA 3CMYA 4Q5SF 2XGCA 2HXOA 5IOZA 2Y0SN 5F64A 1KQ9A 5HS8A 1WI3A 2EB7A 3ZMZA 3AL0C 2DT5A 3ONQA 3SZGA 4C2MJ 3A02A 1EJ9A 3S1QJ 2R4GA 1MMGA 3QOPA 1FTZA 3BG5A 2R92J 1RZ4A 4D7NA 3J7AY 5K7FA 3CCLI 4DW6A 1FMWA 4KN4X 4XLPF 3T8RA 2MG4A 1IF1A 2K27A 1LE8A 3GBGA 3GEZA 3JAMZ 2JVGA 2WAFA 1U0JA 2XHKA 3PUFA 2HOEA 4Y33A 1N25A 1YQAA 1QZYA 3DU5A 4AM3A 1IUYA 1EF4A 3F3XA 4PDKA 1R49A 4BBRJ 3K2AA 4NQWA 5DUIA 1IG7A 5IPAA 5L3EA 1YRNA 3EYIA 1DQUA 1HA8A 4OIQF 3A0HC 3DXJF 2CQXA 1V5FA 4I01A 5FKLA 4E6KG 2VOPA 2RN7A 3PNYA 1IDZA 1CF7A 2IS1A 4KIGA 2XSDC 1G3YA 1OQYA 4CDGA 2H94A 1N77A 2EWNA 2JA7J 2VL8A 3ASOH 1QA6A 2CQKA 5H6QA 3BT9A 4G12A 2LVSA 2KJCA 2LH9A 2M34A 4XICA 1TWFJ 1RETA 3F21A 1OCTC 3ZMVA 3E0JB 1BL0A 1I50J 3RSNA 3TW7A 5D4RA 1U78A 1SANA 3COAC 4GFBA 1S7AA 1AOYA 4QPQA 3FXMA 2ME0A 2RREA 4OINF 2LY1A 2B7EA 3K9TA 3HOUJ 4N9HA 3GZ5A 1Y6IA 4M6XA 3A01A 1ETYA 2HPMA 3HC7A 1FOYA 4YEJA 3VEPA 4CCNA 2M8EA 1BC7C 5AIQA 1FWZA 4JP0A 5FD6A 4A3GJ 3I59B 2W25A 2RKHA 5FFXA 2ZFWA 1XX5A 1E2XA 4FTHA 3C1DA 5FKOA 3RCOA 3SDGA 3SFIA 2DA3A 4A5NA 3GTOJ 3F8FA 2VQGA 3G4SI 3QYFA 5ICFA 1DU6A 5J8FA 1ZARA 2OJED 2M1BA 3S1RJ 4BY7J 2D2WA 2L7ZA 1AA7A 3CMMA 2IS6A 3FHNA 2YUSA 1EKEA 2HYJA 2LTPA 2W00A 3E6CC 4GXOA 1VQOI 3TBIA 2W85A 3REOA 5ILVA 1DP3A 3WTUC 2KT0A 1ETOA 3BROA 4A69C 4DJAA 2EZIA 1U3EM 2MH9A 2NVQJ 2GLOA 2IA2A 3PSFA 3B02A 2BXYA 4L9JA 3SHFA 2JSCA 2Y2ZA 3FISA 2CV0A 4CUGA 4LITA 1Y1VJ 3TOAA 5JLXA 2DMNA 2O7OA 3SXYA 1K83J 2X6XA 4O5VA 2GWRA 1UAAA 2Z9OA 2IGMA 4RGUA 2KHMA 3TO7A 1TL8A 4HX4A 2A3SA 4Y15A 5ICGA 4M3BA 4HV6A 5IP7J 2DA4A 4NB5A 4YRVA 4XKBA 2OQGA 5DCMA 2OTJI 2R7TA 4Y4RA 4C3IJ 1P92A 4UVAA 4S05A 4N4OB 4XLHA 1OCOH 2JTVA 2WY7Q 2RNJA 4X1EA 3J80K 2LKXA 1R4MB 2DK5A 4KMFA 3B6CA 2QCOA 2O03A 4UB6C 5EZHA 3V8LA 2EFPA 2HKOA 4BS9A 3GTKJ 1TLHB 4E4HA 2FF4A 1AKHB 2IJLA 4C3JJ 3L7WA 2L54A 3JSPA 2XF5A 1DUXC 1JTYA 2IS4A 3HEFA 3IP4B 1ACIA 4Y7NJ 1IRZA 4BKXA 2LREA 4LK1F 2OPTA 4L5EA 4B3XA 3OYGA 1K79A 2I5UA 2HDWA 3H9QA 1BI0A 3K70C 3FDYA 3DLLF 2OA4A 2O0YA 3CO7C 3EQLF 1WVRA 2CJJA 3R4KA 2VXDA 1RR8C 1OPCA 5HLHA 1JHFA 3RTRA 2FMYA 3CTAA 3K1NA 3KIOA 4BDZA 4DGWB 2YU9J 1LFBA 3E1SA 5M3FJ 1R6RA 4PFPA 1XGNA 1NG7A 1YS6A 4BAYA 1Z9CA 2O61A 2NAZA 1TWCJ 2LY9A 3R0JA 3Q9SA 2EJRA 3G71I 2GXAA 2VI6A 4G6DA 1MH4A 1TW3A 5FKKA 3GZ6A 4LFUA 2YU3A 2ECBA 1SVLA 1VQ8I 3HRTA 1Y0UA 2IBDA 2V9VA 2CUEA 2P5VA 3GFJA 1VFCA 1I3QJ 1WWXA 3H3UA 2X6WA 3AG1H 4M3EA 4V2FA 2PN6A 1ZTRA 5H6RA 2OAZA 3FMQA 5GTIC 2RC4A 2BY0A 4D0PA 3FM5A 1JHHA 4UY8I 2WV0A 4XONA 3DCFA 2JUGA 1H9GA 3TL4X 3H5NA 5L3BA 4M6VA 3ZXSA 3N4MA 4HF1A 3FXLA 5E3MA 3OS1A 2QWWA 2M9HA 5D5XB 3E5XA 2CG4A 1FBQA 1S6LA 4A0ZA 5EGOA 1K4SA 2W57A 1APLC 2F48A 4XLAA 5L3FA 4AVPA 3D0SA 1NHAA 2MABA 3CP8A 1HDDC 3F23A 4IRHA 3D5LA 5IT3A 5F0FA 4M73A 3P7NA 3OWTA 1KQ8A 5K7ZA 3I64A 5FLVA 4ZYDA 3FXQA 4M9ZA 4BXUA 3B6AA 3HB9A 2H6CA 1J0RA 3K4BA 1DGRM 1SFKA 3F8MA 2H8WA 4RBOA 1XMAA 3QODA 1UZCA 1UELB 4P55A 2B63J 1VI0A 3JTGA 1MSEC 1W36C 4XSZF 3ESWB 2LKPA 2QENA 4YIIA 2EPFA 2XUBA 2MLGA 3IRRA 1DP7P 1XDUA 2Y75A 2V9KA 2QEXI 3G1LA 5C44J 3N97A 2EQRA 3GUDA 2GIVA 4ESBA 3TEDA 4X6AJ 1D8KA 2F5CA 2W4SA 3KZIC 5FJ8J 2LDUA 4IPAA 1S72I 1SAUA 2LBFA 3KPHA 1OISA 3VDXA 1R1UA 2FJ1A 3HRMA 2CMPA 1O7LA 1E3OC 1AWCA 1RR7A 4LGWA 2DA6A 2YR2A 5JVGF 2JQ7A 3DLAA 3QPTA 1N78A 1VF9A 3RZOJ 4L9NA 2NYXA 1Y39A 3HHGA 3HPGA 1RKWA 2V26A 1UG2A 4EV0A 2RVCA 2PMZA 2XAGA 2Q0OA 2NS8A 3KP4A 2M7AA 5LBQA 3O8HA 3S8PA 1OMIA 3ZMSA 2YS9A 2P4WA 2JRTA 5J4VA 5IP6A 4IX7A 1B72A 1BM9A 1T56A 4HZFA 4BGDA 5FLXZ 5GP9A 5LHHA 2KIUA 3K1MA 3Q0WA 5GAHJ 1SAXA 3AKZA 2I10A 3K10A 2F4MB 5GTHC 4DQ2A 3W2VA 4GDFA 2IPQX 2ZSHB 1IXRC 5TGTA 1W5SA 1Z21A 2M4GA 1D1BA 1HKQA 3K1PA 3MVPA 4E7LA 1J9IA 2X9DA 3IH4A 1JKQC 3H3ZA 4Z6YA 1MBHA 3I54A 3CCYA 4ABZA 1X2MA 5E20A 1JUSA 3KE2A 2E1MB 2QQBA 3TO6A 5LHGA 2KRCA 1JKPC 1RKTA 4GO1A 3SQNA 1LFUP 3KYCB 2NXNB 3V4GA 3IH3A 4A6DA 1YTYA 3J7ZI 1I27A 1XN7A 2A6HF 4M9XA 2E5NA 1LVAA 2GQQA 1ZK8A 1SEUA 1VQ6I 2RNGA 2W1OA 1F4KA 3J81K 4WXCA 2C6YA 4C2UA 3GCMA 1LVKA 2QVOA 3H0DA 2QQAA 5CJ9A 2CW0F 5C4JJ 3S15J 3R60A 2DLLA 4Y3OA 1WCMJ 3Q3SA 1QPMA 5F27A 1MJ9A 2G9WA 2PQ8A 3D5RC 3GFMA 3V7CA 1VTNC 2VC0A 2OZUA 2LK2A 5D5UB 2L3DA 3ERED 2KPMA 4A6EA 5FLXK 1H88C 3UNGC 4R1HA 4CICA 5TISC 2DOFA 5JLWA 1O3RA 3HRUA 1LKXA 1XDSA 3DU6A 3NARA 5E3LA 3ZQ7A 1AKHA 2CV1A 2H6BA 5D8LB 2L9VA 3T5XA 4RA2A 1FP1D 2VQHA 1HW5A 2DMUA 1LE8B 1R7JA 1Z67A 2ZXJA 3K4JA 3PIOF 1BR1A 1O57A 3KETA 4XSXF 4ENKA 1MBKA 1TNTA 3GWZA 2K85A 4I09A 1YRNB 2L9RA 3E6MA 3TKYA 1BW5A 3F8CA 3W2AA 1T33A 1R5GA 3KX2A 1FTTA 1X3UA 2GOXB 2Z3YA 2W24A 3PIPF 2ZJPF 3T0YA 1KA8A 2VC1A 5EYRA 1MMNA 2P5LC 4BYYA 2BBYA 1R23A 4ZH4F 1OCPA 2Z99A 1MJAA 4XBFA 5HDNA 3OYCA 2DBBA 4JQFA 2ZJQF 5HODA 3BR5A 2E19A 3LA2A 2VE9A 2BOLA 2K9NA 5LRRA 3AL0B 2R0QC 3H3VK 1YFHA 2NOJB 1TZLA 4O3MA 3FK7A 2EV5A 4CO8A 1X58A 1MBJA 3K69A 1FP2A 2CRGA 5CYVA 1TWHJ 2LKSA 1YHQI 2ZO4A 3AG3H 2HYFA 3A01B 2HTSA 2DFHA 1X19A 1ZGJA 4NDLA 1RUNA 3CUOA 3M1EA 2LFBA 3MZYA 5M3MJ 5E3OA 3CO6C 1LDDA 3HZJA 4II2A 1RNLA 2ZNZA 2NNNA 2DFEA 2GIZA 4EGZA 3BR0A 3QPHA 3PSIA 2L4MA 4PJ0C 2VJIA 4FX0A 4RAZA 1DGWY 3LFKA 4OMZA 3IRQA 2LYCA 3N05A 4E7ZA 3OYKA 3A03A 4H0EA 2R7FA 4L9VA 3VYUB 3CD6I 1KONA 1UMQA 2EFWA 2ACJA 2R93J 1USTA 2KRHA 1IRXA 1OCCH 1QZZA 2XRLA 2D5VA 2L9NA 3ZMUA 1PVEA 2L9SA 3EDPA 1GUUA 1PYVA 4XL9A 4YG2F 1V4RA 1WJBA 1QPIA 1G3WA 1HKTA 5KNLA 3CUQC 2XKOA 4M74A 3ZR8X 1Y1WJ 2ECCA 2X1EA 4L0YB 1O7FA 4A93J 5J3LA 1W7PA 4MO7A 3S32A 3GW2A 2Y31A 3MKWB 4YIFA 3HL2A 3KZYA 1IC8A 1TW2A 2G7UA 3BJ6A 1IN5A 1A6IA 3KP3A 3WGIA 2CGPA 2OQRA 4NBQA 2IRFG 4LD5A 2OU2A 5DCMB 2CQQA 3EUKL 3X2QH 2EV6A 3BZKA 4HOBA 4YFNF 3UKGA 2GOMA 4QSHA 1PUEE 5ICEA 3WGHA 2FBIA 6PAXA 1QGPA 5ILUA 2EZKA 2PEXA 3OYJA 3HOWJ 2HOAA 2N8GA 2K9LA 2K5CA 4F7ZA 2HDCA 4WF2A 3IAS2 3JTHA 1DPUA 3S16J 3L2CA 2Z16A 1YLFA 2IW5A 4BHCA 3CJTB 3JW4A 2O8XA 4C9YA 2BY1A 2LY2A 3CMEI 1MKMA 1F9NA 2GA1A 1R36A 2FX0A 2KZVA 4IO9F 3OYDA 3HKZA 3TQNA 2COBA 3IKVA 3VB2A 4BEHB 3CMAI 4DYCA 2MD5A 3S3NA 4D9JA 1TC3C 1Z7LA 1QVTA 3H36A 2NVYJ 4XLCA 1WJAA 3L9FA 5HVQC 4A3CJ 1FOXA 3FHZA 3KEOA 5LGTA 2R5ZA 3WG9A 2LD5A 3ZOBA 1FOWA 1JE8A 2VKEA 1RI7A 4HEA2 3MKYB 3ZCOA 2HQRA 2K7LA 2VBWA 3EPZA 4EM2A 1YJWI 2XB5A 1KU7A 1T8IA 4KYWA 5FFZA 1WJCA 2LP0A 3JSOA 4A3LJ 2ID6A 1F5TA 2XKPA 1RC9A 2DO7A 4E70A 3CC7I 1X1DA 4ZJZA 1RIOH 1VQLI 3RYRA 3SFZA 1FC3A 3DPUA 1POGA 1I39A 5LEJA 3K4CA 3Q0VA 1J7KA 3IV5A 2V9PA 2PMZN 4HAMA 1A04A 1UG0A 2MH2A 3ZQGA 4UXNA 4BJ6C 4LMYA 4RLFA 5DEQA 3U2RA 4MGRA 4UVCA 4B8XA 3VSKA 2FA5A 4DBQA 3FBNB 2JWTA 4HSRA 2CFOA 1YW7A 5EGOB 3OS2A 5B5EC 3HOVJ 1YITI 1X4OA 2FRHA 5AONA 2F5DA 3SJMA 1YI2I 4HQMA 1B9NA 2R7QA 3LSJA 3IWFA 1K7AA 2DQLA 2XVCA 5M5YJ 3WU2C 2P7VB 2DFIA 3DEEA 1TWGJ 5F6FA 1BI3A 4QPOA 2DOAA 4BHPA 2BY2A 1S3JA 3EETA 3RZDJ 3OSGA 2DA7A 2E1OA 1T2KA 2HR3A 4HG2A 1MW7A 2AQEA 4H4KC 1IN7A 2VT2A 2BHYA 5IOYA 4BQAA 3WGGA 1BI1A 4FHTA 1Q1VA 3TDZC 3MMYB 5IY5H 4B44A 3G1MA 1ZKGA 3I56I 1YJNI 1IZ1A 1E17A 2YX7A 3DTEA 3S17J 1MJBA 1IRGA 2VT3A 3G2BA 1IW7F 1WJFA 3IL2A 3JRHA 3Q9VA 9ANTA 2IGKA 1P9QC 1N75A 1HW2A 3PNVA 3ASNH 1FYKA 3MN2A 3HBLA 3QPLA 4MTDA 3JRGA 3VYTB 3KP2A 5EDNA 4DOZA 1BOAA 3PQJA 4QLCU 1KU3A 2QSFX 2LBFB 2HQNA 4KDPA 4PZJA 2E2HJ 2MC3A 2WAQA 2VJJA 4HF2A 2X6OA 5D4SA 4XRMA 2OUMA 2XB0X 5H2FC 4KMUX 5CVVA 1P4AA 1TQPA 1JUMA 3BR2A 4IKFA 4IHVA 4UUSA 3ZQLA 3OL4A 3A2KA 1HDPA 3FMSA 3I9V2 1O3QA 4WK8F 1EV7A 3EYYA 1DPRA 5FROA 1ZG1A 4CA0A 3HYIA 3J80Z 3DFGA 4CHUA 1B72B 5J40A 1FY7A 3H9JA 1IO2A 1QQIA 5FKMA 3LQQA 3ABUA 1IGNA 1ETKA 1D0ZA 4HDVA 1P2FA 3ZN1A 3OYBA 3W3CA 5DD4A 1XTAA 5LHIA 2HXIA 1ZREA 3AAFA 1FEXA 3IHUA 4D5FA 4XMYA 3FKIJ 1ZG5A 4BNCA 2XPWA 1Z91A 2OF7A 5CLSA 1OYYA 4GGGA 2EILH 2HNHA 1IXSB 3GMEA 2KKOA 4KT6A 3NWSA 3VSLA 1YIJI 3KYDB 2CUZA 3L2UA 2F4OB 4IOAF 3MCZA 3RIRA 2QSHX 1LEAA 3CLQA 1QHGA 1XG1A 2W84A 3LSGA 2D45A 3BR3A 2KQRA 2FBKA 2JRMA 5JHFA 5GAEJ 4PJMA 1FT9A 2FMLA 2JT1A 2KL4A 4RAFA 2BVLA 1HOMA 2F6CA 4AYBA 2CV2A 4Y17A 4OAYA 2P6SA 5DD8A 4E7KA 3K4KA 4KUMA 1GXPA 4P96A 4G7ZF 4Q47A 1HQCA 2R7UA 4RB3C 1WJEA 4IRIA 3MKLA 3QQAA 3DWLE 2XGXA 1JGGA 4BDYA 1H0MA 5DDGA 3VWBA 1LDKB 4BHBA 1XC5A 5E1WA 1YYVA 4XOPA 4X0GA 3LNQA 1QZEA 2BXZA 1ORKA 4B47A 2DQRA 4JK1X 4RGRA 2ZXHA 2OD5A 3DKWA 3FM3A 2HDDA 3PUBA 4ETSA 3LSRA 1MZBA 5E1XA 4BEHA 1OLTA 1ETXA 2QGUA 3BJAA 1XSVA 1FPQA 4FT8A 3K4LA 3AFHA 2W48A 5H20A 3W2WA 4QWQA 1USSA 3MD2A 2EK5A 5LD2C 2MC4A 2CQNA 3ZQHA 2B9SA 4I76A 4Q48A 3IH2A 2L2OA 3Q5FA 2HWVA 4U88A 3CDLA 5HS7A 4FE4A 4WXHA 1HF0A 3FXRA 1U8BA 3OYLA 4RAYA 2FEZA 2L4AA 2XRNA 3ZGKA 4G7HF 4BL0B 2R7SA 2PBIA 2J5PA 1BIBA 3FMRA 1WJ5A 3VYSB 1MNMC 1JUPA 3BOQA 4PSXA 1UJ8A 2LF8A 2OV7A 2FOWA 4I99C 3OS0A 2V79A 5B1BH 2R5YA 1X1BA 1IXCA 1TWAJ 3LWFA 3QPSA 1NK3P 4F55A 2ME6A 3WTSC 1G3TA 2GM4A 1WFXA 2XF6A 3BTCA 5HDGA 1NG6A 4NUBA 5L3DA 3OR1C 4KJZA 4D7MA 3E6BA 5J8CA 2VQCA 5LGUA 4MIMA 3CJRB 1U9NA 2AO9A 2OCEA 5HS9A 3J7YJ 3BZ6A 3OMYA 3C2HA 2R7XA 1VQ7I 1REPC 2TDXA 4Y52J 2DPDA 5DV5A 4RAGA 2M7BA 3MQ0A 1EH7A 1TBXA 4IHXA 5TRDA 2M2EA 1YS7A 4HLXA 5HLTA 4HDUA 2JK3A 3NWTA 2IGOA 2YPRA 2ZCWA 4XNFA 1KGSA 1X1PA 1ERDA 2NOGA 2XGEA 5LEKA 4J19A 1W7PB 2FD5A 3TMOA 1G3SA 4E7JA 4LB5A 2QBYA 1U6GA 3GTQJ 2AHQA 1Z6TA 4M3FA 1VNDA 4A2UA 3L1PA 3HOZJ 2KRFA 3GFLA 1R22A 2FUG2 1D8JA 3S2DJ 1B9MA 1V55H 3ZPLA 1G59A 3BG9A 2XV4S 4CGZA 4XK4A 2A07F 4BXXJ 2ETHA 3HIFA 1Y56A 3V8JA 2V1NA 3JRBA 2EFOA 4GRIA 2XPUA 3CQZJ 1B8IA 2EIMH 2QUFA 2GXBA 2FXAA 2MW8A 2HKXA 1ON1A 4C30A 2Y48A 1YX5A 3C3WA 3ABLH 2QYOA 3BG3A 1F36A 4HNUA 2VBZA 3J81Z 2K40A 2CH0A
chains in the Genus database with same CATH topology
1KU9A 1FX7A 2XAFA 3U9GA 5K5OA 3VOEA 3RJPA 2PG4A 2CFXA 3ZP5A 2BEOA 3RYPA 3QP6A 4ZZLA 3P9CA 1HBXG 5BS6A 4EJUA 1WSUA 3O6BB 4ZZDA 3IC7A 4GYIA 2DU9A 4EGYA 5A2QZ 4KIBA 3IKTA 4U0WA 2XASA 4S04A 1OYWA 2FNAA 2L02A 3E3VA 1FYLA 1SD4A 5FGMA 5BMZA 4KT5C 3BY6A 1HW1A 5CVJA 2QLZA 3ML6A 3HSRA 2IA0A 3I71A 1P4XA 2Z33A 1GXQA 3BDDA 3K2ZA 4I0AA 3ZN0A 2V1XA 4KIFA 5AIPA 1KYZA 1FSHA 2M30A 1IN8A 3SZTA 4U0YA 5TJJA 4TV7A 5A2QK 1LJ9A 1W7PD 2FNPA 2YX4A 1B1BA 2O6GE 1J5YA 4MQVA 5D5WB 2F2EA 1XGSA 2RQPA 2P7CB 2DW4A 1TQIA 4G7OF 1HXDA 3M9AA 1ZRDA 4HF0A 1XSXA 1D5VA 5BOXA 4EJTA 2A6EF 4EM1A 4HYEA 1ON2A 2PMUA 2M45A 2PI0A 4XRFA 4PGHA 3BJOA 5JI6A 4DNCA 1IRFA 1YG2A 2E7XA 4A0YA 4LB6B 3NRVA 4M71A 4IF4A 2Y0MA 3L09A 1PDNC 1RUOA 1UHMA 3KCCA 3HSEA 2NRAC 1OKRA 2K4JA 4EM0B 3MZHA 1BI2A 1L0OC 4LK0F 5HLIA 2X0LA 3QRFF 5LLQA 1XD7A 2R7DA 4EQQA 2M5WA 2VE8A 3J7AO 4UV9A 1I6XA 3VFZA 2Q2EA 2WTEA 4UHTA 3WU0A 4FX4A 1XMKA 2P5KA 3I58A 2X4HA 3FXUA 3B73A 2Q8KA 3H92A 3PFIA 4OU0A 1XGOA 3CLOA 3WTZA 2G7HA 2ZNYA 1P6RA 2QZ8A 1YW8A 2PJPA 4I7HA 1XSDA 2BV6A 4I98B 1MDMB 3ROUA 3F6OA 4UUVA 4OOIA 5JFRA 3PQKA 4OIRF 3E6DA 2JPBA 3SZPA 4RB2C 2E1NA 2PMHA 1BIAA 3R6SA 5ED4A 4G6QA 2V1UA 2FOKA 5EEHA 1YIOA 3GLXA 4ZYEA 1O3SA 1B4AA 4P5OA 3CUQA 4M9SA 3HTUA 1G4DA 1WQ2A 2R3SA 5E8IA 2E1CA 1FNNA 3KP6A 2P8TA 5BPDA 1DDNA 3U1DA 1UFMA 2A61A 4KFCA 3QAHA 4NHJA 3RDIA 3R61A 3WTTC 3F22A 2QM3A 2BGCA 3KEQA 2XAJA 2HS5A 2LSOA 3HOTA 3KZZA 4YFXF 2WWYA 1K78A 3KFWX 2VBYA 1FYMA 2DK8A 4IVNA 1T0FA 3E97A 4KNYA 2VONA 2K4BA 1MD0A 3C18A 3RI4A 4IXAA 3P9IA 3ULQB 1Z05A 3ABTA 2KIMA 3BPXA 1FBSA 3CJNA 3ECOA 1CGPA 4Y13A 4RB1A 3RPUA 3ECHA 1S29A 3HSFA 4P9FA 3DPLC 1HKSA 4MEXF 5HDKA 1T98A 3W6JB 5K1YA 2QBYB 2BYVE 2K02A 2HGCA 4LLLA 1F1ZA 3I5UA 4L5IA 2DPUA 3FF5A 1OR7A 1T6SA 4RGXA 3LQRA 3HUGA 1TQMA 3RKXA 4Z2YA 2ZMEA 4AWXB 3ISPA 2NS0A 4ON0A 2KJBA 3KP5A 4I2OA 1LEBA 3T8TA 1D3YA 3V7RA 1ZYRF 4IHSA 4UNOA 4L0ZB 2ESHA 3WU1B 1R00A 1SFXA 1KQ0A 1U5TC 3WTXC 1ODDA 4MEYF 1J2XA 3WTYC 1J59A 4ENJA 1QBJA 3JAMK 1UB9A 2H09A 4L5JA 4MTEA 2ELHA 4WX9A 2DAOA 3HTSB 1SD7A 3NQOA 3FX3A 1WKMA 3NEUA 3I0TA 4GCVA 3RKWA 4PCQA 3DPTA 1BBYA 1XCVA 3OOPA 3GX4X 1G6NA 3LAPA 3BWGA 3F6VA 4LLNA 4U0VA 2UXXA 2VXZA 3HHHA 2CWEA 5D6FA 1U8RA 1U5TA 3GO5A 4XLNF 5FD5A 5KK1A 2ADUA 1ZN2A 3HOSA 1SD6A 2JPCA 1MDMA 4GYGA 1R5HA 1R1VA 3MFKA 2HFHA 2XAQA 3FWEA 5HOOA 4ASNA 3TDUC 5D8KB 4M72A 1LDJA 3RKYA 2UZKA 3BP8A 4HX8A 2PLYA 3ZMDA 1SFUA 1GHCA 1WRJA 4HA8A 3GF2A 3O2PE 4Q4ZF 5KVRA 4RB0A 3GVAA 2STWA 2UXNA 2XIGA 3F8BA 3WE3A 4EJWA 1FZPB 1T39A 3T1BA 5K5RA 4KA4A 4KN7X 4P9UA 2VOOA 2RV8A 4BH9A 1XGMA 4N0BA 4LG0A 3O3KA 5F1RA 2CYYA 2A69F 1PP8F 2MA3A 3TGNA 3L00A 5JHUA 1IN4A 1ZH5A 2HTJA 4WCGA 1R58A 2XAHA 5E17F 2FQ3A 1C0WA 2XROA 1OYIA 1H9TA 1I5ZA 1SMYF 3DQVC 1ZHFA 4O6JA 5EEGA 4WWCA 1QNTA 2D1VA 2UWMA 5CVIA 4A12A 2ZKZA 3WTVC 2IA1A 1LNWA 2V1DA 4UVBA 1ZAOA 2MBFA 3HRSA 1I1SA 3E5UA 1WI9A 1TTYA 3WODF 2GA2A 1B6AA 5LRSA 3KP7A 4L18B 2ISZA 1XB4A 4HX7A 2RGVA 1XCBA 4RGSA 2YSRA 5E18F 1S7OA 3V8KA 2ZJ2A 2L01A 1SD5A 5DYMA 5D5VB 2P6TA 4RS8A 3MEXA 2EV0A 1EH8A 1QO0D 1BJAA 4HLYA 1SFEA 1EH6A 4HV5A 1W5TA 1K6OA 1KYWA 1UCRA 3E5QA 3CUQB 2DTRA 3RPQA 2OBPA 1S8NA 3V7SA 4U7DA 1P4WA 1BC8C 3DP7A 3R0AA 2H27A 2K86A 1FOKA 4PGGA 3ELKA 1FBUA 3I59A 2ZBKA 3TOBA 2EFNA 4G94A 1T38A 3LAJA 1FLIA 5ILSA 3GXOA 3M8EA 1PP7U 5E8GA 2AXLA 1IAWA 2IP2A 3MAJA 2HYGD 1JGSA 3P9KA 5BPIA 4KICA 2AS5F 4MHGA 4AIKA 1K78B 5BQTA 4OIOF 1TNSA 3C7JA 4HBLA 5LGNA 4M6YA 1UHWA 2BE5F 4R79A 3KLOA 4ENMA 4MQ9F 1SMTA 3CDHA 2GAUA 3QP5A 3WTWC 1ZRCA 4B09A 1ZRFA 5E1ZB 4CYDA 1HSJA 1V3FA 5DUKA 4LJZF 2COMA 1ULYA 1FSEA 3I53A 1R1TA 4U7BA 3W6KB 3QU6A 3GYHX 1ZLJA 4R8HA 1ZLKA 4MNUA 4HQEA 2EFQA 1W4MA 5IT9Z 2D1HA 3QU3A 5CVRA 3DEUA 4IRGA 2O3FA 2VN2A 4ZYHA 1Q1HA 1IN6A 2CSOA 3K0LA 4WXDA 3G73A 3M7GA 2E7WA 4I0BA 2V6CA 4OIPF 3WE2A 2ZMEB 5DCFA 5FB2A 5K5QA 3F8NA 2CO5A 5L3GA 2JZYA 3EUHA 5HLGA 1CF7B 2GZWA 3BPVA 2Z5UA 1J75A 4AIJA 4G8XA 4YFKF 5FO5A 2GXGA 1L3LA 4EJVA 3DF8A 5IT9K 2PFBA 2LF7A 2HZTA 1BN5A 4N9IA 4ENNA 1YW9A 4EJOA 3ZMTA 2ISYA 2FBHA 3GFIA 2VODA 3MWMA 5CVUA 3IWZA 4CXFA 1LQ1A 2FE3A 3G3ZA 3LSTA 3DV8A 1Z1DA 5D6EA 2EA2A 4K2EA 2M87A 4OMYA 1ZG3A 3TO9A 4I02A 2OZ6A 4JBAA 1HSTA 2IVMA 1U5TB 4A5MA 2IT0A 1B59A 4EVIA 4IJAA 4EMSA 4ESJA 5ICCA 1STZA 1LB2A 2A5YB 4L9TA 4CZZA 2FSWA 3OV8A 5J6XA 2DI3A 4A0XA 2MLKA 2F5EA 3VODA 2LNBA 5L3CA 1O3TA 2KIFA 1I1GA 4AIHA 5ERIA 2ESNA 1U2WA 1Z7UA 3FZVA 3M8FA 4AD9A 3F72A 2FU4A 1JXSA 4IHTA 2STTA 4UV8A 1ONVA 1YO5C 4ZYGA 1GVJA 2J5OA 4G9YA 2B0LA 4LG0B 4LLGF 3LA3A 1MGTA 3I4PA 3LA7A 4HW0A 2VBXA 2A68F 2EA4A 5JR3A 1Z6RA 2RDPA 5JVTA 2NNYA 2F5FA 3KLNA 1KU2A 4ESFA 2WC2A 2HEOA 2QQ9A 3S2WA 1ZGAA 4Q5SF 5F64A 1KQ9A 5HS8A 2EB7A 3ZMZA 2DT5A 3QOPA 1RZ4A 4KN4X 4XLPF 3T8RA 1IF1A 2K27A 3GEZA 3JAMZ 2XHKA 2HOEA 1YQAA 1QZYA 1IUYA 3F3XA 4PDKA 4NQWA 5DUIA 5L3EA 3EYIA 4OIQF 3DXJF 4I01A 2VOPA 2RN7A 1CF7A 4KIGA 1G3YA 4CDGA 2H94A 2EWNA 2CQKA 5H6QA 2KJCA 3F21A 3ZMVA 5D4RA 1U78A 3COAC 1AOYA 1S7AA 4OINF 3K9TA 4N9HA 3GZ5A 4M6XA 3VEPA 1BC7C 2M8EA 5AIQA 1FWZA 5FD6A 3I59B 2W25A 2RKHA 5FFXA 2ZFWA 1E2XA 3C1DA 4A5NA 3F8FA 5ICFA 5J8FA 1ZARA 2M1BA 2D2WA 3E6CC 4GXOA 2W85A 3REOA 5ILVA 3WTUC 3BROA 1U3EM 2MH9A 2IA2A 3B02A 4L9JA 3SHFA 2JSCA 3TOAA 3SXYA 4O5VA 2GWRA 2Z9OA 4RGUA 3TO7A 4HX4A 2A3SA 4Y15A 5ICGA 4HV6A 4NB5A 2OQGA 5DCMA 1P92A 4UVAA 4S05A 2JTVA 2RNJA 3J80K 2DK5A 4KMFA 2O03A 3V8LA 2EFPA 2HKOA 1TLHB 2FF4A 2IJLA 3L7WA 2L54A 3JSPA 1DUXC 4LK1F 1K79A 1BI0A 2OA4A 2O0YA 3CO7C 3EQLF 3R4KA 1OPCA 5HLHA 1JHFA 3RTRA 2FMYA 3CTAA 3K1NA 1XGNA 1YS6A 4BAYA 1Z9CA 2O61A 2NAZA 3R0JA 3Q9SA 2EJRA 4G6DA 1TW3A 3GZ6A 4LFUA 2YU3A 3HRTA 1Y0UA 2P5VA 2V9VA 3GFJA 1WWXA 3H3UA 2PN6A 5H6RA 2OAZA 3FMQA 2RC4A 4D0PA 3FM5A 1JHHA 2WV0A 1H9GA 5L3BA 3N4MA 4HF1A 2QWWA 5D5XB 3E5XA 2CG4A 1FBQA 1S6LA 4A0ZA 2W57A 5L3FA 4AVPA 3D0SA 1NHAA 3F23A 4IRHA 3D5LA 5IT3A 4M73A 3P7NA 1KQ8A 3I64A 4ZYDA 3FXQA 4M9ZA 4BXUA 2H6CA 1J0RA 3F8MA 1XMAA 4P55A 3JTGA 4XSZF 2LKPA 2QENA 4YIIA 2XUBA 2MLGA 3IRRA 1DP7P 1XDUA 2Y75A 3N97A 3GUDA 2GIVA 4ESBA 1D8KA 2F5CA 2LDUA 4IPAA 1R1UA 3HRMA 1O7LA 1AWCA 4LGWA 2YR2A 3QPTA 4L9NA 2NYXA 3HHGA 4EV0A 2RVCA 2XAGA 2Q0OA 3KP4A 5LBQA 1OMIA 3ZMSA 2P4WA 2JRTA 1BM9A 4HZFA 5FLXZ 5LHHA 2KIUA 3K1MA 1SAXA 4DQ2A 2IPQX 1IXRC 1W5SA 1HKQA 3K1PA 1J9IA 3H3ZA 3I54A 5E20A 3KE2A 2QQBA 3TO6A 5LHGA 4GO1A 3SQNA 3V4GA 4A6DA 1YTYA 1I27A 1XN7A 2A6HF 4M9XA 2GQQA 1LVAA 1F4KA 3J81K 4WXCA 2C6YA 2QVOA 2QQAA 5CJ9A 2CW0F 3R60A 2DLLA 1QPMA 1VTNC 1MJ9A 2G9WA 2PQ8A 3GFMA 3V7CA 2VC0A 2OZUA 5D5UB 2L3DA 3ERED 4A6EA 5FLXK 4R1HA 4CICA 1O3RA 3HRUA 1XDSA 3ZQ7A 2H6BA 5D8LB 3T5XA 1FP1D 1HW5A 1R7JA 2ZXJA 1O57A 3KETA 4XSXF 4ENKA 1TNTA 4I09A 3GWZA 3E6MA 3TKYA 3F8CA 1R5GA 1X3UA 2Z3YA 2W24A 3T0YA 1KA8A 2VC1A 2P5LC 4BYYA 2BBYA 1R23A 4ZH4F 2Z99A 1MJAA 4XBFA 5HDNA 2DBBA 4JQFA 3LA2A 2VE9A 5LRRA 1YFHA 4O3MA 2EV5A 4CO8A 3K69A 1FP2A 5CYVA 2ZO4A 2HYFA 2HTSA 1ZGJA 1RUNA 3CUOA 3M1EA 3MZYA 3CO6C 1LDDA 1RNLA 2ZNZA 2NNNA 4EGZA 3QPHA 2L4MA 4FX0A 4RAZA 3LFKA 4OMZA 3IRQA 4H0EA 2R7FA 4L9VA 2EFWA 2ACJA 1USTA 1QZZA 3ZMUA 3EDPA 4YG2F 1V4RA 1G3WA 1HKTA 3CUQC 2XKOA 4M74A 4L0YB 1O7FA 1W7PA 3GW2A 4YIFA 3KZYA 1TW2A 2G7UA 3BJ6A 1IN5A 3KP3A 3WGIA 2CGPA 2OQRA 2IRFG 4LD5A 2OU2A 5DCMB 2EV6A 4HOBA 4YFNF 1PUEE 5ICEA 3WGHA 2FBIA 6PAXA 1QGPA 5ILUA 2PEXA 4F7ZA 2HDCA 4WF2A 3JTHA 1DPUA 3L2CA 1YLFA 2IW5A 4BHCA 3JW4A 2O8XA 1MKMA 1F9NA 2GA1A 1R36A 3TQNA 3IKVA 3VB2A 2MD5A 3L9FA 5HVQC 3FHZA 3KEOA 5LGTA 3WG9A 1JE8A 1RI7A 2HQRA 2K7LA 2VBWA 4EM2A 1KU7A 4KYWA 5FFZA 3JSOA 1F5TA 2XKPA 2DO7A 4E70A 1RIOH 3RYRA 3SFZA 1FC3A 5LEJA 1J7KA 4HAMA 1A04A 2MH2A 4UXNA 4LMYA 5DEQA 3U2RA 4MGRA 4UVCA 4B8XA 2FA5A 1YW7A 2FRHA 5AONA 2F5DA 4HQMA 1B9NA 3IWFA 1K7AA 2DQLA 2XVCA 2P7VB 2DFIA 5F6FA 1BI3A 4BHPA 1S3JA 3EETA 1T2KA 2HR3A 1IN7A 2VT2A 4BQAA 3WGGA 1BI1A 4FHTA 3TDZC 1IZ1A 1E17A 2YX7A 1IRGA 1MJBA 2VT3A 1IW7F 3IL2A 3Q9VA 1HW2A 1FYKA 4MTDA 3KP2A 1BOAA 3PQJA 4QLCU 1KU3A 2HQNA 4KDPA 4PZJA 2MC3A 4HF2A 5D4SA 4KMUX 5CVVA 1P4AA 1TQPA 3FMSA 1O3QA 4WK8F 1EV7A 3EYYA 1DPRA 1ZG1A 3HYIA 3J80Z 3DFGA 4CHUA 1FY7A 1QQIA 3LQQA 3ABUA 4HDVA 1P2FA 3ZN1A 5DD4A 5LHIA 1ZREA 3AAFA 3IHUA 1ZG5A 4BNCA 1Z91A 5CLSA 1OYYA 4GGGA 1IXSB 2KKOA 3MCZA 3RIRA 1LEAA 2W84A 2D45A 2FBKA 1FT9A 2FMLA 2JT1A 4Y17A 2P6SA 5DD8A 4KUMA 1GXPA 4P96A 4G7ZF 4Q47A 1HQCA 4RB3C 4IRIA 2XGXA 1H0MA 5DDGA 1LDKB 4BHBA 5E1WA 1YYVA 2DQRA 4JK1X 4RGRA 3DKWA 2OD5A 3FM3A 4ETSA 1MZBA 5E1XA 3BJAA 1XSVA 1FPQA 4FT8A 5H20A 4QWQA 1USSA 2EK5A 4Q48A 3Q5FA 2HWVA 4U88A 5HS7A 4WXHA 3FXRA 4RAYA 2FEZA 2L4AA 2XRNA 4G7HF 2PBIA 2J5PA 1BIBA 3FMRA 3BOQA 2LF8A 2V79A 1IXCA 3LWFA 3WTSC 1G3TA 5HDGA 5L3DA 3E6BA 5J8CA 5LGUA 5HS9A 3BZ6A 1REPC 2TDXA 2DPDA 5DV5A 3MQ0A 1EH7A 1TBXA 5TRDA 1YS7A 4HLXA 4HDUA 2YPRA 2ZCWA 1KGSA 5LEKA 1W7PB 1G3SA 4LB5A 2QBYA 1U6GA 1Z6TA 4A2UA 2KRFA 3GFLA 1R22A 1D8JA 1B9MA 3ZPLA 2XV4S 4CGZA 2A07F 2ETHA 3HIFA 3V8JA 2EFOA 2QUFA 2GXBA 2FXAA 2HKXA 1ON1A 2Y48A 3C3WA 2QYOA 2VBZA 3J81Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KU9 A;  1FX7 A;  2XAF A;  3U9G A;  5K5O A;  3VOE A;  3RJP A;  2PG4 A;  2CFX A;  3ZP5 A;  2BEO A;  3RYP A;  3QP6 A;  4ZZL A;  3P9C A;  1HBX G;  5BS6 A;  4EJU A;  1WSU A;  3O6B B;  4ZZD A;  3IC7 A;  4GYI A;  2DU9 A;  4EGY A;  5A2Q Z;  4KIB A;  3IKT A;  4U0W A;  2XAS A;  4S04 A;  1OYW A;  2FNA A;  2L02 A;  3E3V A;  1FYL A;  1SD4 A;  5FGM A;  5BMZ A;  4KT5 C;  3BY6 A;  1HW1 A;  5CVJ A;  2QLZ A;  3ML6 A;  3HSR A;  2IA0 A;  3I71 A;  1P4X A;  2Z33 A;  1GXQ A;  3BDD A;  3K2Z A;  4I0A A;  3ZN0 A;  2V1X A;  4KIF A;  5AIP A;  1KYZ A;  1FSH A;  2M30 A;  1IN8 A;  3SZT A;  4U0Y A;  5TJJ A;  4TV7 A;  5A2Q K;  1LJ9 A;  1W7P D;  2FNP A;  2YX4 A;  1B1B A;  2O6G E;  1J5Y A;  4MQV A;  5D5W B;  2F2E A;  1XGS A;  2RQP A;  2P7C B;  2DW4 A;  1TQI A;  4G7O F;  1HXD A;  3M9A A;  1ZRD A;  4HF0 A;  1XSX A;  1D5V A;  5BOX A;  4EJT A;  2A6E F;  4EM1 A;  4HYE A;  1ON2 A;  2PMU A;  2M45 A;  2PI0 A;  4XRF A;  4PGH A;  3BJO A;  5JI6 A;  4DNC A;  1IRF A;  1YG2 A;  2E7X A;  4A0Y A;  4LB6 B;  3NRV A;  4M71 A;  4IF4 A;  2Y0M A;  3L09 A;  1PDN C;  1RUO A;  1UHM A;  3KCC A;  3HSE A;  2NRA C;  1OKR A;  2K4J A;  4EM0 B;  3MZH A;  1BI2 A;  1L0O C;  4LK0 F;  5HLI A;  2X0L A;  3QRF F;  5LLQ A;  1XD7 A;  2R7D A;  4EQQ A;  2M5W A;  2VE8 A;  3J7A O;  4UV9 A;  1I6X A;  3VFZ A;  2Q2E A;  2WTE A;  4UHT A;  3WU0 A;  4FX4 A;  1XMK A;  2P5K A;  3I58 A;  2X4H A;  3FXU A;  3B73 A;  2Q8K A;  3H92 A;  3PFI A;  4OU0 A;  1XGO A;  3CLO A;  3WTZ A;  2G7H A;  2ZNY A;  1P6R A;  2QZ8 A;  1YW8 A;  2PJP A;  4I7H A;  1XSD A;  2BV6 A;  4I98 B;  1MDM B;  3ROU A;  3F6O A;  4UUV A;  4OOI A;  5JFR A;  3PQK A;  4OIR F;  3E6D A;  2JPB A;  3SZP A;  4RB2 C;  2E1N A;  2PMH A;  1BIA A;  3R6S A;  5ED4 A;  4G6Q A;  2V1U A;  2FOK A;  5EEH A;  1YIO A;  3GLX A;  4ZYE A;  1O3S A;  1B4A A;  4P5O A;  3CUQ A;  4M9S A;  3HTU A;  1G4D A;  1WQ2 A;  2R3S A;  5E8I A;  2E1C A;  1FNN A;  3KP6 A;  2P8T A;  5BPD A;  1DDN A;  3U1D A;  1UFM A;  2A61 A;  4KFC A;  3QAH A;  4NHJ A;  3RDI A;  3R61 A;  3WTT C;  3F22 A;  2QM3 A;  2BGC A;  3KEQ A;  2XAJ A;  2HS5 A;  2LSO A;  3HOT A;  3KZZ A;  4YFX F;  2WWY A;  1K78 A;  3KFW X;  2VBY A;  1FYM A;  2DK8 A;  4IVN A;  1T0F A;  3E97 A;  4KNY A;  2VON A;  2K4B A;  1MD0 A;  3C18 A;  3RI4 A;  4IXA A;  3P9I A;  3ULQ B;  1Z05 A;  3ABT A;  2KIM A;  3BPX A;  1FBS A;  3CJN A;  3ECO A;  1CGP A;  4Y13 A;  4RB1 A;  3RPU A;  3ECH A;  1S29 A;  3HSF A;  4P9F A;  3DPL C;  1HKS A;  4MEX F;  5HDK A;  1T98 A;  3W6J B;  5K1Y A;  2QBY B;  2BYV E;  2K02 A;  2HGC A;  4LLL A;  1F1Z A;  3I5U A;  4L5I A;  2DPU A;  3FF5 A;  1OR7 A;  1T6S A;  4RGX A;  3LQR A;  3HUG A;  1TQM A;  3RKX A;  4Z2Y A;  2ZME A;  4AWX B;  3ISP A;  2NS0 A;  4ON0 A;  2KJB A;  3KP5 A;  4I2O A;  1LEB A;  3T8T A;  1D3Y A;  3V7R A;  1ZYR F;  4IHS A;  4UNO A;  4L0Z B;  2ESH A;  3WU1 B;  1R00 A;  1SFX A;  1KQ0 A;  1U5T C;  3WTX C;  1ODD A;  4MEY F;  1J2X A;  3WTY C;  1J59 A;  4ENJ A;  1QBJ A;  3JAM K;  1UB9 A;  2H09 A;  4L5J A;  4MTE A;  2ELH A;  4WX9 A;  2DAO A;  3HTS B;  1SD7 A;  3NQO A;  3FX3 A;  1WKM A;  3NEU A;  3I0T A;  4GCV A;  3RKW A;  4PCQ A;  3DPT A;  1BBY A;  1XCV A;  3OOP A;  3GX4 X;  1G6N A;  3LAP A;  3BWG A;  3F6V A;  4LLN A;  4U0V A;  2UXX A;  2VXZ A;  3HHH A;  2CWE A;  5D6F A;  1U8R A;  1U5T A;  3GO5 A;  4XLN F;  5FD5 A;  5KK1 A;  2ADU A;  1ZN2 A;  3HOS A;  1SD6 A;  2JPC A;  1MDM A;  4GYG A;  1R5H A;  1R1V A;  3MFK A;  2HFH A;  2XAQ A;  3FWE A;  5HOO A;  4ASN A;  3TDU C;  5D8K B;  4M72 A;  1LDJ A;  3RKY A;  2UZK A;  3BP8 A;  4HX8 A;  2PLY A;  3ZMD A;  1SFU A;  1GHC A;  1WRJ A;  4HA8 A;  3GF2 A;  3O2P E;  4Q4Z F;  5KVR A;  4RB0 A;  3GVA A;  2STW A;  2UXN A;  2XIG A;  3F8B A;  3WE3 A;  4EJW A;  1FZP B;  1T39 A;  3T1B A;  5K5R A;  4KA4 A;  4KN7 X;  4P9U A;  2VOO A;  2RV8 A;  4BH9 A;  1XGM A;  4N0B A;  4LG0 A;  3O3K A;  5F1R A;  2CYY A;  2A69 F;  1PP8 F;  2MA3 A;  3TGN A;  3L00 A;  5JHU A;  1IN4 A;  1ZH5 A;  2HTJ A;  4WCG A;  1R58 A;  2XAH A;  5E17 F;  2FQ3 A;  1C0W A;  2XRO A;  1OYI A;  1H9T A;  1I5Z A;  1SMY F;  3DQV C;  1ZHF A;  4O6J A;  5EEG A;  4WWC A;  1QNT A;  2D1V A;  2UWM A;  5CVI A;  4A12 A;  2ZKZ A;  3WTV C;  2IA1 A;  1LNW A;  2V1D A;  4UVB A;  1ZAO A;  2MBF A;  3HRS A;  1I1S A;  3E5U A;  1WI9 A;  1TTY A;  3WOD F;  2GA2 A;  1B6A A;  5LRS A;  3KP7 A;  4L18 B;  2ISZ A;  1XB4 A;  4HX7 A;  2RGV A;  1XCB A;  4RGS A;  2YSR A;  5E18 F;  1S7O A;  3V8K A;  2ZJ2 A;  2L01 A;  1SD5 A;  5DYM A;  5D5V B;  2P6T A;  4RS8 A;  3MEX A;  2EV0 A;  1EH8 A;  1QO0 D;  1BJA A;  4HLY A;  1SFE A;  1EH6 A;  4HV5 A;  1W5T A;  1K6O A;  1KYW A;  1UCR A;  3E5Q A;  3CUQ B;  2DTR A;  3RPQ A;  2OBP A;  1S8N A;  3V7S A;  4U7D A;  1P4W A;  1BC8 C;  3DP7 A;  3R0A A;  2H27 A;  2K86 A;  1FOK A;  4PGG A;  3ELK A;  1FBU A;  3I59 A;  2ZBK A;  3TOB A;  2EFN A;  4G94 A;  1T38 A;  3LAJ A;  1FLI A;  5ILS A;  3GXO A;  3M8E A;  1PP7 U;  5E8G A;  2AXL A;  1IAW A;  2IP2 A;  3MAJ A;  2HYG D;  1JGS A;  3P9K A;  5BPI A;  4KIC A;  2AS5 F;  4MHG A;  4AIK A;  1K78 B;  5BQT A;  4OIO F;  1TNS A;  3C7J A;  4HBL A;  5LGN A;  4M6Y A;  1UHW A;  2BE5 F;  4R79 A;  3KLO A;  4ENM A;  4MQ9 F;  1SMT A;  3CDH A;  2GAU A;  3QP5 A;  3WTW C;  1ZRC A;  4B09 A;  1ZRF A;  5E1Z B;  4CYD A;  1HSJ A;  1V3F A;  5DUK A;  4LJZ F;  2COM A;  1ULY A;  1FSE A;  3I53 A;  1R1T A;  4U7B A;  3W6K B;  3QU6 A;  3GYH X;  1ZLJ A;  4R8H A;  1ZLK A;  4MNU A;  4HQE A;  2EFQ A;  1W4M A;  5IT9 Z;  2D1H A;  3QU3 A;  5CVR A;  3DEU A;  4IRG A;  2O3F A;  2VN2 A;  4ZYH A;  1Q1H A;  1IN6 A;  2CSO A;  3K0L A;  4WXD A;  3G73 A;  3M7G A;  2E7W A;  4I0B A;  2V6C A;  4OIP F;  3WE2 A;  2ZME B;  5DCF A;  5FB2 A;  5K5Q A;  3F8N A;  2CO5 A;  5L3G A;  2JZY A;  3EUH A;  5HLG A;  1CF7 B;  2GZW A;  3BPV A;  2Z5U A;  1J75 A;  4AIJ A;  4G8X A;  4YFK F;  5FO5 A;  2GXG A;  1L3L A;  4EJV A;  3DF8 A;  5IT9 K;  2PFB A;  2LF7 A;  2HZT A;  1BN5 A;  4N9I A;  4ENN A;  1YW9 A;  4EJO A;  3ZMT A;  2ISY A;  2FBH A;  3GFI A;  2VOD A;  3MWM A;  5CVU A;  3IWZ A;  4CXF A;  1LQ1 A;  2FE3 A;  3G3Z A;  3LST A;  3DV8 A;  1Z1D A;  5D6E A;  2EA2 A;  4K2E A;  2M87 A;  4OMY A;  1ZG3 A;  3TO9 A;  4I02 A;  2OZ6 A;  4JBA A;  1HST A;  2IVM A;  1U5T B;  4A5M A;  2IT0 A;  1B59 A;  4EVI A;  4IJA A;  4EMS A;  4ESJ A;  5ICC A;  1STZ A;  1LB2 A;  2A5Y B;  4L9T A;  4CZZ A;  2FSW A;  3OV8 A;  5J6X A;  2DI3 A;  4A0X A;  2MLK A;  2F5E A;  3VOD A;  2LNB A;  5L3C A;  1O3T A;  2KIF A;  1I1G A;  4AIH A;  5ERI A;  2ESN A;  1U2W A;  1Z7U A;  3FZV A;  3M8F A;  4AD9 A;  3F72 A;  2FU4 A;  1JXS A;  4IHT A;  2STT A;  4UV8 A;  1ONV A;  1YO5 C;  4ZYG A;  1GVJ A;  2J5O A;  4G9Y A;  2B0L A;  4LG0 B;  4LLG F;  3LA3 A;  1MGT A;  3I4P A;  3LA7 A;  4HW0 A;  2VBX A;  2A68 F;  2EA4 A;  5JR3 A;  1Z6R A;  2RDP A;  5JVT A;  2NNY A;  2F5F A;  3KLN A;  1KU2 A;  4ESF A;  2WC2 A;  2HEO A;  2QQ9 A;  3S2W A;  1ZGA A;  4Q5S F;  5F64 A;  1KQ9 A;  5HS8 A;  2EB7 A;  3ZMZ A;  2DT5 A;  3QOP A;  1RZ4 A;  4KN4 X;  4XLP F;  3T8R A;  1IF1 A;  2K27 A;  3GEZ A;  3JAM Z;  2XHK A;  2HOE A;  1YQA A;  1QZY A;  1IUY A;  3F3X A;  4PDK A;  4NQW A;  5DUI A;  5L3E A;  3EYI A;  4OIQ F;  3DXJ F;  4I01 A;  2VOP A;  2RN7 A;  1CF7 A;  4KIG A;  1G3Y A;  4CDG A;  2H94 A;  2EWN A;  2CQK A;  5H6Q A;  2KJC A;  3F21 A;  3ZMV A;  5D4R A;  1U78 A;  3COA C;  1AOY A;  1S7A A;  4OIN F;  3K9T A;  4N9H A;  3GZ5 A;  4M6X A;  3VEP A;  1BC7 C;  2M8E A;  5AIQ A;  1FWZ A;  5FD6 A;  3I59 B;  2W25 A;  2RKH A;  5FFX A;  2ZFW A;  1E2X A;  3C1D A;  4A5N A;  3F8F A;  5ICF A;  5J8F A;  1ZAR A;  2M1B A;  2D2W A;  3E6C C;  4GXO A;  2W85 A;  3REO A;  5ILV A;  3WTU C;  3BRO A;  1U3E M;  2MH9 A;  2IA2 A;  3B02 A;  4L9J A;  3SHF A;  2JSC A;  3TOA A;  3SXY A;  4O5V A;  2GWR A;  2Z9O A;  4RGU A;  3TO7 A;  4HX4 A;  2A3S A;  4Y15 A;  5ICG A;  4HV6 A;  4NB5 A;  2OQG A;  5DCM A;  1P92 A;  4UVA A;  4S05 A;  2JTV A;  2RNJ A;  3J80 K;  2DK5 A;  4KMF A;  2O03 A;  3V8L A;  2EFP A;  2HKO A;  1TLH B;  2FF4 A;  2IJL A;  3L7W A;  2L54 A;  3JSP A;  1DUX C;  4LK1 F;  1K79 A;  1BI0 A;  2OA4 A;  2O0Y A;  3CO7 C;  3EQL F;  3R4K A;  1OPC A;  5HLH A;  1JHF A;  3RTR A;  2FMY A;  3CTA A;  3K1N A;  1XGN A;  1YS6 A;  4BAY A;  1Z9C A;  2O61 A;  2NAZ A;  3R0J A;  3Q9S A;  2EJR A;  4G6D A;  1TW3 A;  3GZ6 A;  4LFU A;  2YU3 A;  3HRT A;  1Y0U A;  2P5V A;  2V9V A;  3GFJ A;  1WWX A;  3H3U A;  2PN6 A;  5H6R A;  2OAZ A;  3FMQ A;  2RC4 A;  4D0P A;  3FM5 A;  1JHH A;  2WV0 A;  1H9G A;  5L3B A;  3N4M A;  4HF1 A;  2QWW A;  5D5X B;  3E5X A;  2CG4 A;  1FBQ A;  1S6L A;  4A0Z A;  2W57 A;  5L3F A;  4AVP A;  3D0S A;  1NHA A;  3F23 A;  4IRH A;  3D5L A;  5IT3 A;  4M73 A;  3P7N A;  1KQ8 A;  3I64 A;  4ZYD A;  3FXQ A;  4M9Z A;  4BXU A;  2H6C A;  1J0R A;  3F8M A;  1XMA A;  4P55 A;  3JTG A;  4XSZ F;  2LKP A;  2QEN A;  4YII A;  2XUB A;  2MLG A;  3IRR A;  1DP7 P;  1XDU A;  2Y75 A;  3N97 A;  3GUD A;  2GIV A;  4ESB A;  1D8K A;  2F5C A;  2LDU A;  4IPA A;  1R1U A;  3HRM A;  1O7L A;  1AWC A;  4LGW A;  2YR2 A;  3QPT A;  4L9N A;  2NYX A;  3HHG A;  4EV0 A;  2RVC A;  2XAG A;  2Q0O A;  3KP4 A;  5LBQ A;  1OMI A;  3ZMS A;  2P4W A;  2JRT A;  1BM9 A;  4HZF A;  5FLX Z;  5LHH A;  2KIU A;  3K1M A;  1SAX A;  4DQ2 A;  2IPQ X;  1IXR C;  1W5S A;  1HKQ A;  3K1P A;  1J9I A;  3H3Z A;  3I54 A;  5E20 A;  3KE2 A;  2QQB A;  3TO6 A;  5LHG A;  4GO1 A;  3SQN A;  3V4G A;  4A6D A;  1YTY A;  1I27 A;  1XN7 A;  2A6H F;  4M9X A;  2GQQ A;  1LVA A;  1F4K A;  3J81 K;  4WXC A;  2C6Y A;  2QVO A;  2QQA A;  5CJ9 A;  2CW0 F;  3R60 A;  2DLL A;  1QPM A;  1VTN C;  1MJ9 A;  2G9W A;  2PQ8 A;  3GFM A;  3V7C A;  2VC0 A;  2OZU A;  5D5U B;  2L3D A;  3ERE D;  4A6E A;  5FLX K;  4R1H A;  4CIC A;  1O3R A;  3HRU A;  1XDS A;  3ZQ7 A;  2H6B A;  5D8L B;  3T5X A;  1FP1 D;  1HW5 A;  1R7J A;  2ZXJ A;  1O57 A;  3KET A;  4XSX F;  4ENK A;  1TNT A;  4I09 A;  3GWZ A;  3E6M A;  3TKY A;  3F8C A;  1R5G A;  1X3U A;  2Z3Y A;  2W24 A;  3T0Y A;  1KA8 A;  2VC1 A;  2P5L C;  4BYY A;  2BBY A;  1R23 A;  4ZH4 F;  2Z99 A;  1MJA A;  4XBF A;  5HDN A;  2DBB A;  4JQF A;  3LA2 A;  2VE9 A;  5LRR A;  1YFH A;  4O3M A;  2EV5 A;  4CO8 A;  3K69 A;  1FP2 A;  5CYV A;  2ZO4 A;  2HYF A;  2HTS A;  1ZGJ A;  1RUN A;  3CUO A;  3M1E A;  3MZY A;  3CO6 C;  1LDD A;  1RNL A;  2ZNZ A;  2NNN A;  4EGZ A;  3QPH A;  2L4M A;  4FX0 A;  4RAZ A;  3LFK A;  4OMZ A;  3IRQ A;  4H0E A;  2R7F A;  4L9V A;  2EFW A;  2ACJ A;  1UST A;  1QZZ A;  3ZMU A;  3EDP A;  4YG2 F;  1V4R A;  1G3W A;  1HKT A;  3CUQ C;  2XKO A;  4M74 A;  4L0Y B;  1O7F A;  1W7P A;  3GW2 A;  4YIF A;  3KZY A;  1TW2 A;  2G7U A;  3BJ6 A;  1IN5 A;  3KP3 A;  3WGI A;  2CGP A;  2OQR A;  2IRF G;  4LD5 A;  2OU2 A;  5DCM B;  2EV6 A;  4HOB A;  4YFN F;  1PUE E;  5ICE A;  3WGH A;  2FBI A;  6PAX A;  1QGP A;  5ILU A;  2PEX A;  4F7Z A;  2HDC A;  4WF2 A;  3JTH A;  1DPU A;  3L2C A;  1YLF A;  2IW5 A;  4BHC A;  3JW4 A;  2O8X A;  1MKM A;  1F9N A;  2GA1 A;  1R36 A;  3TQN A;  3IKV A;  3VB2 A;  2MD5 A;  3L9F A;  5HVQ C;  3FHZ A;  3KEO A;  5LGT A;  3WG9 A;  1JE8 A;  1RI7 A;  2HQR A;  2K7L A;  2VBW A;  4EM2 A;  1KU7 A;  4KYW A;  5FFZ A;  3JSO A;  1F5T A;  2XKP A;  2DO7 A;  4E70 A;  1RIO H;  3RYR A;  3SFZ A;  1FC3 A;  5LEJ A;  1J7K A;  4HAM A;  1A04 A;  2MH2 A;  4UXN A;  4LMY A;  5DEQ A;  3U2R A;  4MGR A;  4UVC A;  4B8X A;  2FA5 A;  1YW7 A;  2FRH A;  5AON A;  2F5D A;  4HQM A;  1B9N A;  3IWF A;  1K7A A;  2DQL A;  2XVC A;  2P7V B;  2DFI A;  5F6F A;  1BI3 A;  4BHP A;  1S3J A;  3EET A;  1T2K A;  2HR3 A;  1IN7 A;  2VT2 A;  4BQA A;  3WGG A;  1BI1 A;  4FHT A;  3TDZ C;  1IZ1 A;  1E17 A;  2YX7 A;  1IRG A;  1MJB A;  2VT3 A;  1IW7 F;  3IL2 A;  3Q9V A;  1HW2 A;  1FYK A;  4MTD A;  3KP2 A;  1BOA A;  3PQJ A;  4QLC U;  1KU3 A;  2HQN A;  4KDP A;  4PZJ A;  2MC3 A;  4HF2 A;  5D4S A;  4KMU X;  5CVV A;  1P4A A;  1TQP A;  3FMS A;  1O3Q A;  4WK8 F;  1EV7 A;  3EYY A;  1DPR A;  1ZG1 A;  3HYI A;  3J80 Z;  3DFG A;  4CHU A;  1FY7 A;  1QQI A;  3LQQ A;  3ABU A;  4HDV A;  1P2F A;  3ZN1 A;  5DD4 A;  5LHI A;  1ZRE A;  3AAF A;  3IHU A;  1ZG5 A;  4BNC A;  1Z91 A;  5CLS A;  1OYY A;  4GGG A;  1IXS B;  2KKO A;  3MCZ A;  3RIR A;  1LEA A;  2W84 A;  2D45 A;  2FBK A;  1FT9 A;  2FML A;  2JT1 A;  4Y17 A;  2P6S A;  5DD8 A;  4KUM A;  1GXP A;  4P96 A;  4G7Z F;  4Q47 A;  1HQC A;  4RB3 C;  4IRI A;  2XGX A;  1H0M A;  5DDG A;  1LDK B;  4BHB A;  5E1W A;  1YYV A;  2DQR A;  4JK1 X;  4RGR A;  3DKW A;  2OD5 A;  3FM3 A;  4ETS A;  1MZB A;  5E1X A;  3BJA A;  1XSV A;  1FPQ A;  4FT8 A;  5H20 A;  4QWQ A;  1USS A;  2EK5 A;  4Q48 A;  3Q5F A;  2HWV A;  4U88 A;  5HS7 A;  4WXH A;  3FXR A;  4RAY A;  2FEZ A;  2L4A A;  2XRN A;  4G7H F;  2PBI A;  2J5P A;  1BIB A;  3FMR A;  3BOQ A;  2LF8 A;  2V79 A;  1IXC A;  3LWF A;  3WTS C;  1G3T A;  5HDG A;  5L3D A;  3E6B A;  5J8C A;  5LGU A;  5HS9 A;  3BZ6 A;  1REP C;  2TDX A;  2DPD A;  5DV5 A;  3MQ0 A;  1EH7 A;  1TBX A;  5TRD A;  1YS7 A;  4HLX A;  4HDU A;  2YPR A;  2ZCW A;  1KGS A;  5LEK A;  1W7P B;  1G3S A;  4LB5 A;  2QBY A;  1U6G A;  1Z6T A;  4A2U A;  2KRF A;  3GFL A;  1R22 A;  1D8J A;  1B9M A;  3ZPL A;  2XV4 S;  4CGZ A;  2A07 F;  2ETH A;  3HIF A;  3V8J A;  2EFO A;  2QUF A;  2GXB A;  2FXA A;  2HKX A;  1ON1 A;  2Y48 A;  3C3W A;  2QYO A;  2VBZ A;  3J81 Z; 
#chains in the Genus database with same CATH topology
 2MSY A;  1JT0 A;  1TP4 A;  1KU9 A;  3PO2 J;  1FX7 A;  2XAF A;  3U9G A;  1SFO J;  3JRI A;  1YX3 A;  4CCO A;  3GTJ J;  4FAS D;  5K5O A;  2G0E A;  3OOU A;  3VOE A;  1AU7 A;  2X85 A;  4B1R A;  4ZDL A;  3RJP A;  2QA4 I;  3FKJ A;  2PG4 A;  1VQ4 I;  2UV1 A;  1D1C A;  2MGQ A;  2CFX A;  1G2H A;  3ZP5 A;  2BEO A;  3JRA A;  3RYP A;  3GZN B;  3QP6 A;  1W5C C;  4JX5 A;  4IOC F;  4CSW A;  2R5Z B;  4ZZL A;  3P9C A;  1CQT A;  3HG9 A;  4XID A;  4XLF A;  1HBX G;  4EEF G;  3ZQI A;  2E60 A;  4EJU A;  5BS6 A;  4IEJ A;  1WSU A;  3O6B B;  4ZZD A;  1K4T A;  3CDI A;  3IC7 A;  4XRS A;  1VQM I;  2BY3 A;  5F0H A;  2WAQ N;  1VQ9 I;  2LLK A;  4GYI A;  2DU9 A;  4EGY A;  2XSJ C;  5A2Q Z;  4KIB A;  2H1K A;  3IKT A;  4U0W A;  3LSH A;  2XAS A;  4YIR X;  4S04 A;  3GTM J;  1VZ0 A;  4PK4 A;  1GDT A;  1FIP A;  1OYW A;  5DTD A;  2FNA A;  2L02 A;  2L5Q A;  2KMU A;  3AG4 H;  3E3V A;  1FYL A;  1SD4 A;  1EA3 A;  1K61 A;  5FGM A;  1SVO A;  1TT5 B;  2A5W A;  5BMZ A;  4KT5 C;  5FRM A;  1YE9 A;  3BY6 A;  1HW1 A;  2EIN H;  1UHS A;  2BW3 A;  4PJJ A;  2HQA A;  5CVJ A;  2K9S A;  2QLZ A;  1WH5 A;  3ML6 A;  4HNV A;  4NNJ A;  3HSR A;  1WZ2 A;  2IA0 A;  3I71 A;  1P4X A;  2Z33 A;  1GXQ A;  3BDD A;  4XOT A;  3K2Z A;  2K9M A;  4I0A A;  3ZN0 A;  3P5J A;  4BQO A;  2V1X A;  2E34 A;  4KIF A;  4RM2 A;  3TP3 A;  4LIV A;  4F3Q A;  2K3P A;  5AIP A;  1KYZ A;  5GPC A;  5EEA A;  1FSH A;  2M30 A;  1IN8 A;  1BR4 A;  3SZT A;  4U0Y A;  2E71 A;  2WV1 A;  3H9G A;  5TJJ A;  2XC7 A;  3GTP J;  2M0C A;  2KZG A;  4TV7 A;  5A2Q K;  1LJ9 A;  1V54 H;  4LOC A;  2VIX A;  1W7P D;  4FCY A;  3OIQ A;  4E7S A;  2VB6 A;  2FNP A;  5FLM J;  2YX4 A;  1B1B A;  1XMX A;  4DYR A;  3MKZ A;  2O6G E;  4HRI A;  1J5Y A;  4MQV A;  1VQ5 I;  5CKT A;  1OCZ H;  5D5W B;  2F2E A;  4HST A;  1XGS A;  3ZQF A;  2RQP A;  4OAZ A;  3S3M A;  2P7C B;  1FIA A;  1A36 A;  2DW4 A;  3FXK A;  1TQI A;  1LFP A;  4E7H A;  4G7O F;  1HXD A;  1A6Q A;  3M9A A;  1ZR4 A;  1ZRD A;  4AU7 A;  2CUF A;  1X3Z B;  4HF0 A;  1XSX A;  4FE7 A;  1D5V A;  5BOX A;  4EJT A;  4W97 A;  3CCE I;  2A6E F;  4EM1 A;  2ZXW H;  3W6V A;  4HYE A;  1ON2 A;  2PMU A;  2M45 A;  2QQ8 A;  4XRF A;  2PI0 A;  2L0K A;  2DT6 A;  3K7A J;  4PGH A;  1K6Y A;  5EF6 A;  2EH3 A;  1LPQ A;  3BJO A;  2KDZ A;  5JI6 A;  2O8K A;  1RES A;  4DNC A;  2HI3 A;  4BXF A;  1IRF A;  1V5E A;  1YG2 A;  2E7X A;  2IGN A;  4N4N B;  4UUS B;  1GV2 A;  2RQQ A;  4A0Y A;  5J1Y A;  4LB6 B;  3NRV A;  1OFC X;  4M71 A;  4IF4 A;  2EIK H;  2Y0M A;  3L09 A;  1X3W B;  1PDN C;  4EAT A;  1RUO A;  1UHM A;  2M8G X;  3KCC A;  3HSE A;  2DOE A;  2NRA C;  1OKR A;  3BLY A;  2WB1 A;  2K4J A;  4RLQ A;  3CCR I;  2JJ7 A;  1PUF A;  4A3D J;  2IS2 A;  5F0C A;  3DKY A;  3K6G A;  4EM0 B;  3MZH A;  1BI2 A;  1X4P A;  1L0O C;  3QYB A;  3CF5 F;  4LK0 F;  5HLI A;  4CCJ A;  2X0L A;  3M8J A;  5LLQ A;  3BG6 A;  3QRF F;  1XD7 A;  2W7N A;  2R7D A;  4EQQ A;  5B66 C;  2M5W A;  2VE8 A;  3J7A O;  4UV9 A;  3V42 A;  4U87 A;  4XOR A;  2F5V A;  1I6X A;  2DMT A;  3A4C A;  3VFZ A;  1Z77 A;  2R7O A;  2Q2E A;  2Q1Z B;  5DS9 A;  2XAU A;  2WTE A;  3BTI A;  4UHT A;  3AG2 H;  3WU0 A;  4FX4 A;  2KIS A;  1XMK A;  2P5K A;  3CCJ I;  3I58 A;  2X4H A;  3FXU A;  5GAD J;  3B73 A;  3JRD A;  2Q8K A;  3H92 A;  3PFI A;  4OU0 A;  3KEY A;  1XGO A;  4M3D A;  3CLO A;  3WTZ A;  1GT0 C;  2G7H A;  2ZNY A;  1P6R A;  2QZ8 A;  1YW8 A;  1LUJ B;  5DM7 F;  1FMV A;  2PJP A;  3PO3 J;  4I7H A;  3SYT A;  1MSF C;  1XSD A;  2BV6 A;  3C2G A;  4I98 B;  2ZFU A;  5F04 A;  2A05 A;  2DA1 A;  2F4I A;  5C4X J;  2HQ5 A;  1MDM B;  4MFE A;  3ROU A;  3LSK A;  4CCK A;  3F6O A;  4UUV A;  3SEQ A;  4OOI A;  5JFR A;  4A3M J;  3PQK A;  4OIR F;  1JJ6 C;  3E6D A;  1KZH A;  2JPB A;  3SZP A;  4RB2 C;  2E1N A;  2X6Y A;  2PMH A;  1BIA A;  1H8A C;  3R6S A;  5ED4 A;  3HPH A;  4F93 B;  4G6Q A;  4ANJ A;  4XRS G;  2V1U A;  2FOK A;  1T0F C;  5EEH A;  1BW6 A;  1YIO A;  4CYC A;  3GLX A;  3WG7 H;  4ZYE A;  1O3S A;  2ZXI A;  5FRN A;  4KIS A;  1B4A A;  4P5O A;  2V6E A;  2JA2 A;  3CUQ A;  5J47 A;  3HDD A;  4M9S A;  3HTU A;  4XR6 A;  4BJ5 C;  1G4D A;  1WQ2 A;  4PSW A;  3DKX A;  4JOM A;  2R3S A;  2DOD A;  5E8I A;  2E1C A;  1FNN A;  3KP6 A;  2CS3 A;  3GLL A;  1YOV B;  2P8T A;  4BBS J;  5BPD A;  1DDN A;  3U1D A;  5KCM A;  1UFM A;  2A61 A;  3DBH B;  3CF2 A;  1YJ9 I;  4JX4 A;  4KFC A;  3QAH A;  4NHJ A;  3RDI A;  4ITV A;  3R61 A;  2VJ4 A;  3WTT C;  3F22 A;  3L2Q A;  2QM3 A;  1TT0 A;  2BGC A;  2PJR A;  4LG3 A;  3KEQ A;  3DBL B;  2XAJ A;  2HS5 A;  2GBY A;  2LSO A;  4IQJ A;  4IQ4 A;  1MBE A;  4B4C A;  2R5Y B;  3HOT A;  5J4Y A;  3QOE A;  3H5A A;  3KZZ A;  2BHZ A;  4YFX F;  1OR7 C;  2HPI A;  2Y30 A;  2WWY A;  2DA5 A;  1K78 A;  1W0U A;  1BR2 A;  1E3P A;  4C3H J;  2VQL A;  3KFW X;  1NTC A;  2VBY A;  2ZME C;  3RQI A;  1FYM A;  3C2B A;  3OYA A;  2DK8 A;  4IVN A;  3DEW A;  1T0F A;  2M4K A;  3E97 A;  4KNY A;  2VKV A;  4BQN A;  2VON A;  2K4B A;  3DTK A;  4ZTF A;  3GTL J;  1MD0 A;  2R7R A;  3C18 A;  3RI4 A;  3SDB A;  2ZJR F;  4IXA A;  5EG0 A;  4PJL A;  3P9I A;  3ULQ B;  4RMN A;  1Z05 A;  3ABT A;  2DN0 A;  2KIM A;  3BPX A;  1FBS A;  3CJN A;  3ECO A;  4CZC A;  3S1M J;  2JMW A;  1CGP A;  2E36 A;  4Y13 A;  3LMM A;  4RB1 A;  3RPU A;  1Z3X A;  3CES A;  3KYL A;  3ECH A;  1S29 A;  4B48 A;  3HSF A;  3OIP A;  4P9F A;  3DPL C;  1HKS A;  4MEX F;  5HDK A;  1T98 A;  3W6J B;  4A3E J;  1JI8 A;  5K1Y A;  1S9H A;  1X1A A;  1R71 A;  2DYS H;  1E3H A;  2QBY B;  3OR2 C;  2BYV E;  2LG4 A;  4P1W A;  2FQ4 A;  2K02 A;  1HCR A;  5CPR B;  2E5Z A;  2HGC A;  4LLL A;  4A3I J;  4AID A;  3CCM I;  1F1Z A;  3I5U A;  4L5I A;  4W1U A;  1DU0 A;  2DPU A;  4M3G A;  3FF5 A;  1OR7 A;  1T6S A;  4RGX A;  3LQR A;  3HUG A;  3WHC A;  1TQM A;  3WHB A;  4AUX A;  3RKX A;  4Z2Y A;  2LR8 A;  2ZME A;  4V19 K;  4AWX B;  1B8I B;  4FQG A;  3LSI A;  3ISP A;  2RAE A;  2NS0 A;  2DDB A;  4ON0 A;  2KJB A;  3KP5 A;  4I2O A;  1LEB A;  5IYB J;  3HXL A;  3T8T A;  1D3Y A;  2VKH A;  3L2W A;  4D1Q A;  3CC4 I;  3V7R A;  1ZYR F;  2DDA A;  2VKD A;  4G6T B;  2JA6 J;  4J01 A;  3I4M J;  2BZT A;  4IHS A;  3FBI B;  4UNO A;  4L0Z B;  2ESH A;  3WU1 B;  3ZQQ A;  1R00 A;  1SFX A;  3LSM A;  1KQ0 A;  1U5T C;  4F91 B;  3WTX C;  1ODD A;  2MYS A;  2Y69 H;  2WY8 Q;  4UUT A;  5K7H A;  4MEY F;  1SVM A;  2X51 A;  1J2X A;  4IZZ A;  4ZYA A;  2IXS A;  3LFU A;  3WTY C;  1BJZ A;  4ZC3 A;  1NH3 A;  2R7V A;  1J59 A;  2EZL A;  4ENJ A;  4XQF A;  1QBJ A;  2HVR A;  3JAM K;  1UB9 A;  2H09 A;  1SC7 A;  4NC8 A;  4L5J A;  1MMA A;  4MTE A;  4BAC A;  2ELH A;  3OYM A;  4WX9 A;  3U21 A;  3BG7 A;  1D1A A;  5M5X J;  2DAO A;  3HTS B;  1SD7 A;  2CU7 A;  3NQO A;  3FX3 A;  2MFZ A;  1WKM A;  3NEU A;  2VJ5 A;  4V2G A;  3I0T A;  4GCV A;  3RKW A;  4PCQ A;  2HVS A;  2NVX J;  3DPT A;  2E2I J;  1BBY A;  1XCV A;  5IYD J;  3ABM H;  3H5R A;  3OOP A;  2E2J J;  3GX4 X;  1G6N A;  3LAP A;  3BWG A;  2KP6 A;  2Y9Z A;  3M1C A;  3F6V A;  4LLN A;  4U0V A;  3JR9 A;  2NVT J;  2BW3 B;  2UXX A;  1XPX A;  2H8R A;  2VXZ A;  1E0E A;  2ID3 A;  3HHH A;  2CWE A;  3K70 D;  5D6F A;  3F9K A;  1U8R A;  2WB1 N;  1U5T A;  3GO5 A;  4XLN F;  5FD5 A;  4JX6 A;  5KK1 A;  2ADU A;  3LL7 A;  1ZN2 A;  5KHD A;  1SD6 A;  3HOS A;  2JPC A;  3FXO A;  4BJT A;  1MDM A;  4PUS A;  4GYG A;  1R5H A;  1R1V A;  3LSP A;  3MFK A;  4A3J J;  1IUF A;  2HFH A;  2XAQ A;  3FWE A;  5HOO A;  4ASN A;  2K3F A;  3TDU C;  1JKO C;  5D8K B;  4M72 A;  1LDJ A;  3RKY A;  1HC8 A;  3BR1 A;  2UZK A;  1WGX A;  3BP8 A;  4HX8 A;  2PLY A;  3ZMD A;  1MNE A;  1SFU A;  3OYE A;  2JA5 J;  3S1N J;  1WRJ A;  4HA8 A;  4F52 A;  1GHC A;  3S3O A;  3H35 A;  2HOT A;  1R9T J;  3GF2 A;  2ZC2 A;  3O2P E;  4XN0 A;  4Q4Z F;  4RDU A;  4C2T A;  5DM6 F;  3CCV I;  5KVR A;  2CW7 A;  4RB0 A;  2WA0 A;  3GVA A;  2STW A;  3HGY A;  4OWR B;  2QSG X;  3M3Y J;  1ZGW A;  3ZQC A;  3CCQ I;  2UXN A;  2XPV A;  2XIG A;  3E7L A;  3F8B A;  3WE3 A;  1Y8Q B;  3PM1 A;  2ICW G;  3I55 I;  4EJW A;  1FZP B;  1P7J A;  2DFF A;  3CCU I;  1T39 A;  3T1B A;  5K5R A;  3D1N I;  4KN7 X;  4KA4 A;  1ZR2 A;  3BCA A;  4P9U A;  2VOO A;  1IV8 A;  2DT7 B;  2RV8 A;  1V5G A;  2Z1D A;  4BH9 A;  2QF7 A;  1XGM A;  4N0B A;  1VQN I;  1HLV A;  2LRD A;  3BQY A;  5EJC A;  3FXJ A;  4LG0 A;  3O3K A;  5F1R A;  2CYY A;  2IAI A;  2A69 F;  3DTI A;  2BVM A;  1PP8 F;  2MA3 A;  3TGN A;  3HKZ N;  3L00 A;  3HOY J;  5JHU A;  3CP2 A;  1IN4 A;  2QKM B;  2CQ7 A;  1ZH5 A;  2KDO A;  2HTJ A;  1XS9 A;  4WCG A;  1R58 A;  2XAH A;  1J09 A;  5IYC J;  5E17 F;  2E35 A;  2FQ3 A;  1C0W A;  4A3K J;  2M3A A;  2VPL A;  2XRO A;  1ENH A;  4B43 A;  1MMD A;  1PUF B;  1W36 D;  1OYI A;  1H9T A;  2DYR H;  1I5Z A;  1SMY F;  3DQV C;  1GV5 A;  1ZEL A;  1ZHF A;  2R7Z J;  4O6J A;  5EEG A;  4WWC A;  2ELJ A;  1QNT A;  1OCR H;  2UUZ A;  2D1V A;  2UWM A;  5CVI A;  2LMD A;  4A12 A;  2ZKZ A;  2R7W A;  3NAU A;  3OYH A;  3WTV C;  2IA1 A;  1I6H J;  1LNW A;  5GAG J;  2V1D A;  1OJL A;  4UVB A;  1PJR A;  1ZAO A;  2MBF A;  5FKN A;  2Q2E B;  4D5C A;  3HRS A;  1I1S A;  3E5U A;  1WI9 A;  2QKL B;  1S7E A;  2EZH A;  3ERM A;  1TTY A;  2JN6 A;  3WOD F;  2GA2 A;  1WHU A;  1B6A A;  1Z0X A;  2AXT C;  4XM3 A;  1IJW C;  5LRS A;  3KP7 A;  2OTL I;  3HOX J;  4L18 B;  2MD0 A;  4NC6 A;  2NS7 A;  1XB4 A;  2ISZ A;  2HVQ A;  2HZD A;  4I6Z A;  4B3A A;  3OYF A;  3DBR B;  4HX7 A;  2RGV A;  3K4M A;  4MLO A;  1XCB A;  4RGS A;  3TP0 A;  2YSR A;  5E18 F;  1A35 A;  1S7O A;  3V8K A;  3K4N A;  2ZJ2 A;  3VYR B;  4CH7 A;  2L01 A;  1SD5 A;  2A6T A;  5DYM A;  5D5V B;  3CC2 I;  1Y8R B;  2P6T A;  5BNG A;  1X2N A;  4RS8 A;  1H89 C;  3MEX A;  2EV0 A;  1EH8 A;  4IL6 C;  1QO0 D;  3BC8 A;  1BJA A;  2P0W A;  4HLY A;  1SFE A;  1EH6 A;  3FIW A;  1W5T A;  4HV5 A;  3Q0U A;  1K6O A;  4CYC B;  3L2V A;  1KYW A;  1RPW A;  4YEL A;  1UCR A;  2HOS A;  3E5Q A;  3OL3 A;  4XKW A;  3CUQ B;  2DCE A;  2DTR A;  3RPQ A;  2OBP A;  1S8N A;  4BE1 A;  5E3N A;  3V7S A;  4U7D A;  2CW8 A;  1P4W A;  1BC8 C;  3DP7 A;  3R0A A;  5B1A H;  2H27 A;  2K86 A;  1FOK A;  5GPA A;  4PGG A;  3ELK A;  3RQ4 A;  3PNT A;  1FBU A;  1MH3 A;  3I59 A;  2ZBK A;  3TOB A;  2KFD A;  4ZTJ A;  3CZ6 A;  3S2H J;  2EFN A;  2XDV A;  4G94 A;  1T38 A;  3LAJ A;  4BE0 A;  1FLI A;  5ILS A;  3PJR A;  2Y0S A;  3UR3 C;  1MMS A;  3GXO A;  3M8E A;  1PP7 U;  1ITY A;  5E8G A;  4HPQ A;  4DYQ A;  1WH7 A;  4AVZ A;  2PJR B;  2DMQ A;  2AXL A;  3ABK H;  4CCL A;  5CQG A;  4E7I A;  2IP2 A;  3MAJ A;  2HYG D;  1IAW A;  1JGS A;  3P9K A;  5BPI A;  4KIC A;  2AS5 F;  4MHG A;  4AIK A;  1K78 B;  5BQT A;  4FET A;  1ETW A;  2X1C A;  4OIO F;  4DZJ A;  4PFO A;  1TNS A;  3C7J A;  3MZ8 A;  1P7I A;  4HBL A;  2OC6 A;  5LGN A;  4M6Y A;  1UHW A;  2BE5 F;  4R79 A;  3KLO A;  4S0H B;  4ENM A;  3A1Y A;  3EUH C;  4MQ9 F;  1SMT A;  3CDH A;  1G8X A;  1X1C A;  2GAU A;  3A0B C;  3QP5 A;  3WTW C;  1ZRC A;  2LOO A;  3HJE A;  2DA2 A;  4B09 A;  1ZRF A;  5E1Z B;  4CYD A;  1W0T A;  1HSJ A;  1JKR C;  5EG0 B;  3HGG A;  1V3F A;  5DUK A;  5F08 A;  2TCT A;  4LJZ F;  1A5J A;  2VLA A;  2COM A;  1ULY A;  1FSE A;  3I53 A;  2JA8 J;  4UB8 C;  1R1T A;  4U7B A;  3W6K B;  3QU6 A;  3GYH X;  1ZLJ A;  4R8H A;  3M4O J;  2CUJ A;  3FK6 A;  1ZLK A;  1ZQ3 P;  4AC0 A;  1D0Y A;  5F1J A;  5C3E J;  4MNU A;  4HQE A;  2EIJ H;  2EFQ A;  1W4M A;  5IT9 Z;  2V7F A;  2NVU B;  2D1H A;  4QIW N;  3QU3 A;  3BZC A;  5HNF A;  5CVR A;  4ZDO A;  4IHY A;  3DEU A;  4FIS A;  4IRG A;  2O3F A;  2VN2 A;  5IP9 J;  4ZYH A;  1JT6 A;  1Q1H A;  2K9Q A;  1IN6 A;  2OCC H;  2CSO A;  4A3B J;  3EUA A;  1F43 A;  1D5Y A;  2AQF A;  2XGD A;  3K0L A;  4WXD A;  4AYB N;  2TRT A;  3G73 A;  3HUG B;  1O4X A;  1BA5 A;  3M7G A;  2E7W A;  4I0B A;  4NQW B;  5KAF C;  1VQK I;  2V6C A;  4OIP F;  3WE2 A;  2VAS A;  2ZME B;  3D5S C;  5DCF A;  5FB2 A;  3S14 J;  1QVU A;  1A31 A;  5K5Q A;  3F8N A;  2PX9 A;  2P81 A;  2CO5 A;  2XF7 A;  5L3G A;  2JZY A;  3EUH A;  1IDY A;  5HLG A;  1CF7 B;  2I8D A;  3PL8 A;  3BCB A;  2GZW A;  3BPV A;  2Z5U A;  3H0G J;  1T08 B;  3OY9 A;  1IV6 A;  1J75 A;  4AIJ A;  4XN3 A;  4G8X A;  2L7M P;  4YFK F;  5FO5 A;  2GXG A;  1L3L A;  3HM5 A;  3U1K A;  2X1D A;  3VPR A;  2V4J C;  3JRF A;  1R4N B;  4EJV A;  2H1L A;  3DF8 A;  3L2R A;  5IT9 K;  2PFB A;  2L7F P;  2LF7 A;  3BTL A;  4NC7 A;  4QTR A;  3S93 A;  1VQP I;  2HU9 A;  1BN5 A;  2HZT A;  2VPR A;  4N9I A;  4ENN A;  3OYN A;  3QYE A;  1YW9 A;  1BOB A;  2M0M A;  4J00 A;  4EJO A;  2JVH A;  3ZMT A;  1AHD P;  1FJL A;  1GVD A;  2ISY A;  2FBH A;  3GFI A;  2Z2S B;  2VOD A;  1WPK A;  3MWM A;  5CVU A;  3IWZ A;  5J1U A;  2WAE A;  4CXF A;  1LQ1 A;  3JRE A;  4BQQ A;  1ETQ A;  2FE3 A;  3G3Z A;  3LST A;  3DV8 A;  3I3L A;  1Z1D A;  5HNH A;  1GLN A;  5D6E A;  2VUM J;  2IEK A;  3RKQ A;  2EA2 A;  4K2E A;  2W82 A;  4BY1 J;  2Y9Y A;  1QU3 A;  2JUC A;  3QWL A;  1D0X A;  2M87 A;  4OMY A;  1ZG3 A;  3TO9 A;  4I02 A;  4BUP A;  2O5R A;  3LOC A;  3M07 A;  2OZ6 A;  3I4N J;  3G6E I;  2DJI A;  4JBA A;  4HNT A;  4XKV A;  4DIQ A;  2O9L A;  1RRJ A;  1ETV A;  1Z3Y A;  1HST A;  2IVM A;  1U5T B;  3CJQ B;  4DBR A;  1I3A A;  1Y0N A;  4A5M A;  2DXI A;  2IT0 A;  1B59 A;  4EVI A;  4IJA A;  4EMS A;  4ESJ A;  1NK2 P;  1M1E B;  1MBG A;  5ICC A;  1MND A;  1STZ A;  1QHH D;  1LB2 A;  2A5Y B;  3RPU D;  2KLO A;  1JTX A;  2L7K A;  2LC2 A;  4L9T A;  5E79 C;  4CZZ A;  2FSW A;  1W1W E;  2E1M C;  3OV8 A;  5J6X A;  2DI3 A;  4A0X A;  4RM3 A;  3JRC A;  2MLK A;  2DJN A;  2F5E A;  4BU2 A;  2WBM A;  4KIT B;  3VOD A;  2LNB A;  5L3C A;  1O3T A;  1R5I D;  2KIF A;  4JYK A;  4PJN A;  3SEZ A;  1I1G A;  4AIH A;  3JCU C;  3O8G A;  3PFY A;  5ERI A;  3CCS I;  2ESN A;  2DTZ A;  5LFA A;  3OIO A;  1U2W A;  3BR6 A;  5J1R A;  2ZB9 A;  3BTJ A;  2ZSI B;  3ZRG A;  3G1O A;  1QRY A;  1Z7U A;  2JSP A;  5CQE A;  3FZV A;  3M8F A;  4AD9 A;  4F92 B;  3F72 A;  1U9O A;  2FU4 A;  1JXS A;  4IHT A;  2STT A;  4UV8 A;  1ONV A;  1WJD A;  1MIJ A;  4II3 A;  1YO5 C;  5EZG A;  4ZYG A;  1GVJ A;  2J5O A;  1MBF A;  3F0C A;  3IUO A;  4G9Y A;  2B0L A;  5B3S H;  4LG0 B;  4DZP A;  4LLG F;  1S5L C;  3LA3 A;  1MGT A;  2KIQ A;  3I4P A;  3LA7 A;  4HW0 A;  2VBX A;  4XKC A;  2A68 F;  3OSF A;  2EA4 A;  1T95 A;  5JR3 A;  4ZDP A;  4MFD A;  3BQZ A;  2X48 A;  5M5W J;  1Z6R A;  3OYI A;  2RDP A;  5JVT A;  3IAM 2;  2ELK A;  2NNY A;  2F5F A;  2WAD A;  3TW6 A;  4XLE A;  4IHW A;  3KLN A;  4BE2 A;  1KU2 A;  4ESF A;  2WC2 A;  4CCM A;  4A3F J;  5KAI C;  1JJ8 C;  2HEO A;  3GTG J;  2DMP A;  2QQ9 A;  3S2W A;  2EBI A;  1ZGA A;  3H1C A;  4LIU A;  3CMY A;  4Q5S F;  2XGC A;  2HXO A;  5IOZ A;  2Y0S N;  5F64 A;  1KQ9 A;  5HS8 A;  1WI3 A;  2EB7 A;  3ZMZ A;  3AL0 C;  2DT5 A;  3ONQ A;  3SZG A;  4C2M J;  3A02 A;  1EJ9 A;  3S1Q J;  2R4G A;  1MMG A;  3QOP A;  1FTZ A;  3BG5 A;  2R92 J;  1RZ4 A;  4D7N A;  3J7A Y;  5K7F A;  3CCL I;  4DW6 A;  1FMW A;  4KN4 X;  4XLP F;  3T8R A;  2MG4 A;  1IF1 A;  2K27 A;  1LE8 A;  3GBG A;  3GEZ A;  3JAM Z;  2JVG A;  2WAF A;  1U0J A;  2XHK A;  3PUF A;  2HOE A;  4Y33 A;  1N25 A;  1YQA A;  1QZY A;  3DU5 A;  4AM3 A;  1IUY A;  1EF4 A;  3F3X A;  4PDK A;  1R49 A;  4BBR J;  3K2A A;  4NQW A;  5DUI A;  1IG7 A;  5IPA A;  5L3E A;  1YRN A;  3EYI A;  1DQU A;  1HA8 A;  4OIQ F;  3A0H C;  3DXJ F;  2CQX A;  1V5F A;  4I01 A;  5FKL A;  4E6K G;  2VOP A;  2RN7 A;  3PNY A;  1IDZ A;  1CF7 A;  2IS1 A;  4KIG A;  2XSD C;  1G3Y A;  1OQY A;  4CDG A;  2H94 A;  1N77 A;  2EWN A;  2JA7 J;  2VL8 A;  3ASO H;  1QA6 A;  2CQK A;  5H6Q A;  3BT9 A;  4G12 A;  2LVS A;  2KJC A;  2LH9 A;  2M34 A;  4XIC A;  1TWF J;  1RET A;  3F21 A;  1OCT C;  3ZMV A;  3E0J B;  1BL0 A;  1I50 J;  3RSN A;  3TW7 A;  5D4R A;  1U78 A;  1SAN A;  3COA C;  4GFB A;  1S7A A;  1AOY A;  4QPQ A;  3FXM A;  2ME0 A;  2RRE A;  4OIN F;  2LY1 A;  2B7E A;  3K9T A;  3HOU J;  4N9H A;  3GZ5 A;  1Y6I A;  4M6X A;  3A01 A;  1ETY A;  2HPM A;  3HC7 A;  1FOY A;  4YEJ A;  3VEP A;  4CCN A;  2M8E A;  1BC7 C;  5AIQ A;  1FWZ A;  4JP0 A;  5FD6 A;  4A3G J;  3I59 B;  2W25 A;  2RKH A;  5FFX A;  2ZFW A;  1XX5 A;  1E2X A;  4FTH A;  3C1D A;  5FKO A;  3RCO A;  3SDG A;  3SFI A;  2DA3 A;  4A5N A;  3GTO J;  3F8F A;  2VQG A;  3G4S I;  3QYF A;  5ICF A;  1DU6 A;  5J8F A;  1ZAR A;  2OJE D;  2M1B A;  3S1R J;  4BY7 J;  2D2W A;  2L7Z A;  1AA7 A;  3CMM A;  2IS6 A;  3FHN A;  2YUS A;  1EKE A;  2HYJ A;  2LTP A;  2W00 A;  3E6C C;  4GXO A;  1VQO I;  3TBI A;  2W85 A;  3REO A;  5ILV A;  1DP3 A;  3WTU C;  2KT0 A;  1ETO A;  3BRO A;  4A69 C;  4DJA A;  2EZI A;  1U3E M;  2MH9 A;  2NVQ J;  2GLO A;  2IA2 A;  3PSF A;  3B02 A;  2BXY A;  4L9J A;  3SHF A;  2JSC A;  2Y2Z A;  3FIS A;  2CV0 A;  4CUG A;  4LIT A;  1Y1V J;  3TOA A;  5JLX A;  2DMN A;  2O7O A;  3SXY A;  1K83 J;  2X6X A;  4O5V A;  2GWR A;  1UAA A;  2Z9O A;  2IGM A;  4RGU A;  2KHM A;  3TO7 A;  1TL8 A;  4HX4 A;  2A3S A;  4Y15 A;  5ICG A;  4M3B A;  4HV6 A;  5IP7 J;  2DA4 A;  4NB5 A;  4YRV A;  4XKB A;  2OQG A;  5DCM A;  2OTJ I;  2R7T A;  4Y4R A;  4C3I J;  1P92 A;  4UVA A;  4S05 A;  4N4O B;  4XLH A;  1OCO H;  2JTV A;  2WY7 Q;  2RNJ A;  4X1E A;  3J80 K;  2LKX A;  1R4M B;  2DK5 A;  4KMF A;  3B6C A;  2QCO A;  2O03 A;  4UB6 C;  5EZH A;  3V8L A;  2EFP A;  2HKO A;  4BS9 A;  3GTK J;  1TLH B;  4E4H A;  2FF4 A;  1AKH B;  2IJL A;  4C3J J;  3L7W A;  2L54 A;  3JSP A;  2XF5 A;  1DUX C;  1JTY A;  2IS4 A;  3HEF A;  3IP4 B;  1ACI A;  4Y7N J;  1IRZ A;  4BKX A;  2LRE A;  4LK1 F;  2OPT A;  4L5E A;  4B3X A;  3OYG A;  1K79 A;  2I5U A;  2HDW A;  3H9Q A;  1BI0 A;  3K70 C;  3FDY A;  3DLL F;  2OA4 A;  2O0Y A;  3CO7 C;  3EQL F;  1WVR A;  2CJJ A;  3R4K A;  2VXD A;  1RR8 C;  1OPC A;  5HLH A;  1JHF A;  3RTR A;  2FMY A;  3CTA A;  3K1N A;  3KIO A;  4BDZ A;  4DGW B;  2YU9 J;  1LFB A;  3E1S A;  5M3F J;  1R6R A;  4PFP A;  1XGN A;  1NG7 A;  1YS6 A;  4BAY A;  1Z9C A;  2O61 A;  2NAZ A;  1TWC J;  2LY9 A;  3R0J A;  3Q9S A;  2EJR A;  3G71 I;  2GXA A;  2VI6 A;  4G6D A;  1MH4 A;  1TW3 A;  5FKK A;  3GZ6 A;  4LFU A;  2YU3 A;  2ECB A;  1SVL A;  1VQ8 I;  3HRT A;  1Y0U A;  2IBD A;  2V9V A;  2CUE A;  2P5V A;  3GFJ A;  1VFC A;  1I3Q J;  1WWX A;  3H3U A;  2X6W A;  3AG1 H;  4M3E A;  4V2F A;  2PN6 A;  1ZTR A;  5H6R A;  2OAZ A;  3FMQ A;  5GTI C;  2RC4 A;  2BY0 A;  4D0P A;  3FM5 A;  1JHH A;  4UY8 I;  2WV0 A;  4XON A;  3DCF A;  2JUG A;  1H9G A;  3TL4 X;  3H5N A;  5L3B A;  4M6V A;  3ZXS A;  3N4M A;  4HF1 A;  3FXL A;  5E3M A;  3OS1 A;  2QWW A;  2M9H A;  5D5X B;  3E5X A;  2CG4 A;  1FBQ A;  1S6L A;  4A0Z A;  5EGO A;  1K4S A;  2W57 A;  1APL C;  2F48 A;  4XLA A;  5L3F A;  4AVP A;  3D0S A;  1NHA A;  2MAB A;  3CP8 A;  1HDD C;  3F23 A;  4IRH A;  3D5L A;  5IT3 A;  5F0F A;  4M73 A;  3P7N A;  3OWT A;  1KQ8 A;  5K7Z A;  3I64 A;  5FLV A;  4ZYD A;  3FXQ A;  4M9Z A;  4BXU A;  3B6A A;  3HB9 A;  2H6C A;  1J0R A;  3K4B A;  1DGR M;  1SFK A;  3F8M A;  2H8W A;  4RBO A;  1XMA A;  3QOD A;  1UZC A;  1UEL B;  4P55 A;  2B63 J;  1VI0 A;  3JTG A;  1MSE C;  1W36 C;  4XSZ F;  3ESW B;  2LKP A;  2QEN A;  4YII A;  2EPF A;  2XUB A;  2MLG A;  3IRR A;  1DP7 P;  1XDU A;  2Y75 A;  2V9K A;  2QEX I;  3G1L A;  5C44 J;  3N97 A;  2EQR A;  3GUD A;  2GIV A;  4ESB A;  3TED A;  4X6A J;  1D8K A;  2F5C A;  2W4S A;  3KZI C;  5FJ8 J;  2LDU A;  4IPA A;  1S72 I;  1SAU A;  2LBF A;  3KPH A;  1OIS A;  3VDX A;  1R1U A;  2FJ1 A;  3HRM A;  2CMP A;  1O7L A;  1E3O C;  1AWC A;  1RR7 A;  4LGW A;  2DA6 A;  2YR2 A;  5JVG F;  2JQ7 A;  3DLA A;  3QPT A;  1N78 A;  1VF9 A;  3RZO J;  4L9N A;  2NYX A;  1Y39 A;  3HHG A;  3HPG A;  1RKW A;  2V26 A;  1UG2 A;  4EV0 A;  2RVC A;  2PMZ A;  2XAG A;  2Q0O A;  2NS8 A;  3KP4 A;  2M7A A;  5LBQ A;  3O8H A;  3S8P A;  1OMI A;  3ZMS A;  2YS9 A;  2P4W A;  2JRT A;  5J4V A;  5IP6 A;  4IX7 A;  1B72 A;  1BM9 A;  1T56 A;  4HZF A;  4BGD A;  5FLX Z;  5GP9 A;  5LHH A;  2KIU A;  3K1M A;  3Q0W A;  5GAH J;  1SAX A;  3AKZ A;  2I10 A;  3K10 A;  2F4M B;  5GTH C;  4DQ2 A;  3W2V A;  4GDF A;  2IPQ X;  2ZSH B;  1IXR C;  5TGT A;  1W5S A;  1Z21 A;  2M4G A;  1D1B A;  1HKQ A;  3K1P A;  3MVP A;  4E7L A;  1J9I A;  2X9D A;  3IH4 A;  1JKQ C;  3H3Z A;  4Z6Y A;  1MBH A;  3I54 A;  3CCY A;  4ABZ A;  1X2M A;  5E20 A;  1JUS A;  3KE2 A;  2E1M B;  2QQB A;  3TO6 A;  5LHG A;  2KRC A;  1JKP C;  1RKT A;  4GO1 A;  3SQN A;  1LFU P;  3KYC B;  2NXN B;  3V4G A;  3IH3 A;  4A6D A;  1YTY A;  3J7Z I;  1I27 A;  1XN7 A;  2A6H F;  4M9X A;  2E5N A;  1LVA A;  2GQQ A;  1ZK8 A;  1SEU A;  1VQ6 I;  2RNG A;  2W1O A;  1F4K A;  3J81 K;  4WXC A;  2C6Y A;  4C2U A;  3GCM A;  1LVK A;  2QVO A;  3H0D A;  2QQA A;  5CJ9 A;  2CW0 F;  5C4J J;  3S15 J;  3R60 A;  2DLL A;  4Y3O A;  1WCM J;  3Q3S A;  1QPM A;  5F27 A;  1MJ9 A;  2G9W A;  2PQ8 A;  3D5R C;  3GFM A;  3V7C A;  1VTN C;  2VC0 A;  2OZU A;  2LK2 A;  5D5U B;  2L3D A;  3ERE D;  2KPM A;  4A6E A;  5FLX K;  1H88 C;  3UNG C;  4R1H A;  4CIC A;  5TIS C;  2DOF A;  5JLW A;  1O3R A;  3HRU A;  1LKX A;  1XDS A;  3DU6 A;  3NAR A;  5E3L A;  3ZQ7 A;  1AKH A;  2CV1 A;  2H6B A;  5D8L B;  2L9V A;  3T5X A;  4RA2 A;  1FP1 D;  2VQH A;  1HW5 A;  2DMU A;  1LE8 B;  1R7J A;  1Z67 A;  2ZXJ A;  3K4J A;  3PIO F;  1BR1 A;  1O57 A;  3KET A;  4XSX F;  4ENK A;  1MBK A;  1TNT A;  3GWZ A;  2K85 A;  4I09 A;  1YRN B;  2L9R A;  3E6M A;  3TKY A;  1BW5 A;  3F8C A;  3W2A A;  1T33 A;  1R5G A;  3KX2 A;  1FTT A;  1X3U A;  2GOX B;  2Z3Y A;  2W24 A;  3PIP F;  2ZJP F;  3T0Y A;  1KA8 A;  2VC1 A;  5EYR A;  1MMN A;  2P5L C;  4BYY A;  2BBY A;  1R23 A;  4ZH4 F;  1OCP A;  2Z99 A;  1MJA A;  4XBF A;  5HDN A;  3OYC A;  2DBB A;  4JQF A;  2ZJQ F;  5HOD A;  3BR5 A;  2E19 A;  3LA2 A;  2VE9 A;  2BOL A;  2K9N A;  5LRR A;  3AL0 B;  2R0Q C;  3H3V K;  1YFH A;  2NOJ B;  1TZL A;  4O3M A;  3FK7 A;  2EV5 A;  4CO8 A;  1X58 A;  1MBJ A;  3K69 A;  1FP2 A;  2CRG A;  5CYV A;  1TWH J;  2LKS A;  1YHQ I;  2ZO4 A;  3AG3 H;  2HYF A;  3A01 B;  2HTS A;  2DFH A;  1X19 A;  1ZGJ A;  4NDL A;  1RUN A;  3CUO A;  3M1E A;  2LFB A;  3MZY A;  5M3M J;  5E3O A;  3CO6 C;  1LDD A;  3HZJ A;  4II2 A;  1RNL A;  2ZNZ A;  2NNN A;  2DFE A;  2GIZ A;  4EGZ A;  3BR0 A;  3QPH A;  3PSI A;  2L4M A;  4PJ0 C;  2VJI A;  4FX0 A;  4RAZ A;  1DGW Y;  3LFK A;  4OMZ A;  3IRQ A;  2LYC A;  3N05 A;  4E7Z A;  3OYK A;  3A03 A;  4H0E A;  2R7F A;  4L9V A;  3VYU B;  3CD6 I;  1KON A;  1UMQ A;  2EFW A;  2ACJ A;  2R93 J;  1UST A;  2KRH A;  1IRX A;  1OCC H;  1QZZ A;  2XRL A;  2D5V A;  2L9N A;  3ZMU A;  1PVE A;  2L9S A;  3EDP A;  1GUU A;  1PYV A;  4XL9 A;  4YG2 F;  1V4R A;  1WJB A;  1QPI A;  1G3W A;  1HKT A;  5KNL A;  3CUQ C;  2XKO A;  4M74 A;  3ZR8 X;  1Y1W J;  2ECC A;  2X1E A;  4L0Y B;  1O7F A;  4A93 J;  5J3L A;  1W7P A;  4MO7 A;  3S32 A;  3GW2 A;  2Y31 A;  3MKW B;  4YIF A;  3HL2 A;  3KZY A;  1IC8 A;  1TW2 A;  2G7U A;  3BJ6 A;  1IN5 A;  1A6I A;  3KP3 A;  3WGI A;  2CGP A;  2OQR A;  4NBQ A;  2IRF G;  4LD5 A;  2OU2 A;  5DCM B;  2CQQ A;  3EUK L;  3X2Q H;  2EV6 A;  3BZK A;  4HOB A;  4YFN F;  3UKG A;  2GOM A;  4QSH A;  1PUE E;  5ICE A;  3WGH A;  2FBI A;  6PAX A;  1QGP A;  5ILU A;  2EZK A;  2PEX A;  3OYJ A;  3HOW J;  2HOA A;  2N8G A;  2K9L A;  2K5C A;  4F7Z A;  2HDC A;  4WF2 A;  3IAS 2;  3JTH A;  1DPU A;  3S16 J;  3L2C A;  2Z16 A;  1YLF A;  2IW5 A;  4BHC A;  3CJT B;  3JW4 A;  2O8X A;  4C9Y A;  2BY1 A;  2LY2 A;  3CME I;  1MKM A;  1F9N A;  2GA1 A;  1R36 A;  2FX0 A;  2KZV A;  4IO9 F;  3OYD A;  3HKZ A;  3TQN A;  2COB A;  3IKV A;  3VB2 A;  4BEH B;  3CMA I;  4DYC A;  2MD5 A;  3S3N A;  4D9J A;  1TC3 C;  1Z7L A;  1QVT A;  3H36 A;  2NVY J;  4XLC A;  1WJA A;  3L9F A;  5HVQ C;  4A3C J;  1FOX A;  3FHZ A;  3KEO A;  5LGT A;  2R5Z A;  3WG9 A;  2LD5 A;  3ZOB A;  1FOW A;  1JE8 A;  2VKE A;  1RI7 A;  4HEA 2;  3MKY B;  3ZCO A;  2HQR A;  2K7L A;  2VBW A;  3EPZ A;  4EM2 A;  1YJW I;  2XB5 A;  1KU7 A;  1T8I A;  4KYW A;  5FFZ A;  1WJC A;  2LP0 A;  3JSO A;  4A3L J;  2ID6 A;  1F5T A;  2XKP A;  1RC9 A;  2DO7 A;  4E70 A;  3CC7 I;  1X1D A;  4ZJZ A;  1RIO H;  1VQL I;  3RYR A;  3SFZ A;  1FC3 A;  3DPU A;  1POG A;  1I39 A;  5LEJ A;  3K4C A;  3Q0V A;  1J7K A;  3IV5 A;  2V9P A;  2PMZ N;  4HAM A;  1A04 A;  1UG0 A;  2MH2 A;  3ZQG A;  4UXN A;  4BJ6 C;  4LMY A;  4RLF A;  5DEQ A;  3U2R A;  4MGR A;  4UVC A;  4B8X A;  3VSK A;  2FA5 A;  4DBQ A;  3FBN B;  2JWT A;  4HSR A;  2CFO A;  1YW7 A;  5EGO B;  3OS2 A;  5B5E C;  3HOV J;  1YIT I;  1X4O A;  2FRH A;  5AON A;  2F5D A;  3SJM A;  1YI2 I;  4HQM A;  1B9N A;  2R7Q A;  3LSJ A;  3IWF A;  1K7A A;  2DQL A;  2XVC A;  5M5Y J;  3WU2 C;  2P7V B;  2DFI A;  3DEE A;  1TWG J;  5F6F A;  1BI3 A;  4QPO A;  2DOA A;  4BHP A;  2BY2 A;  1S3J A;  3EET A;  3RZD J;  3OSG A;  2DA7 A;  2E1O A;  1T2K A;  2HR3 A;  4HG2 A;  1MW7 A;  2AQE A;  4H4K C;  1IN7 A;  2VT2 A;  2BHY A;  5IOY A;  4BQA A;  3WGG A;  1BI1 A;  4FHT A;  1Q1V A;  3TDZ C;  3MMY B;  5IY5 H;  4B44 A;  3G1M A;  1ZKG A;  3I56 I;  1YJN I;  1IZ1 A;  1E17 A;  2YX7 A;  3DTE A;  3S17 J;  1MJB A;  1IRG A;  2VT3 A;  3G2B A;  1IW7 F;  1WJF A;  3IL2 A;  3JRH A;  3Q9V A;  9ANT A;  2IGK A;  1P9Q C;  1N75 A;  1HW2 A;  3PNV A;  3ASN H;  1FYK A;  3MN2 A;  3HBL A;  3QPL A;  4MTD A;  3JRG A;  3VYT B;  3KP2 A;  5EDN A;  4DOZ A;  1BOA A;  3PQJ A;  4QLC U;  1KU3 A;  2QSF X;  2LBF B;  2HQN A;  4KDP A;  4PZJ A;  2E2H J;  2MC3 A;  2WAQ A;  2VJJ A;  4HF2 A;  2X6O A;  5D4S A;  4XRM A;  2OUM A;  2XB0 X;  5H2F C;  4KMU X;  5CVV A;  1P4A A;  1TQP A;  1JUM A;  3BR2 A;  4IKF A;  4IHV A;  4UUS A;  3ZQL A;  3OL4 A;  3A2K A;  1HDP A;  3FMS A;  3I9V 2;  1O3Q A;  4WK8 F;  1EV7 A;  3EYY A;  1DPR A;  5FRO A;  1ZG1 A;  4CA0 A;  3HYI A;  3J80 Z;  3DFG A;  4CHU A;  1B72 B;  5J40 A;  1FY7 A;  3H9J A;  1IO2 A;  1QQI A;  5FKM A;  3LQQ A;  3ABU A;  1IGN A;  1ETK A;  1D0Z A;  4HDV A;  1P2F A;  3ZN1 A;  3OYB A;  3W3C A;  5DD4 A;  1XTA A;  5LHI A;  2HXI A;  1ZRE A;  3AAF A;  1FEX A;  3IHU A;  4D5F A;  4XMY A;  3FKI J;  1ZG5 A;  4BNC A;  2XPW A;  1Z91 A;  2OF7 A;  5CLS A;  1OYY A;  4GGG A;  2EIL H;  2HNH A;  1IXS B;  3GME A;  2KKO A;  4KT6 A;  3NWS A;  3VSL A;  1YIJ I;  3KYD B;  2CUZ A;  3L2U A;  2F4O B;  4IOA F;  3MCZ A;  3RIR A;  2QSH X;  1LEA A;  3CLQ A;  1QHG A;  1XG1 A;  2W84 A;  3LSG A;  2D45 A;  3BR3 A;  2KQR A;  2FBK A;  2JRM A;  5JHF A;  5GAE J;  4PJM A;  1FT9 A;  2FML A;  2JT1 A;  2KL4 A;  4RAF A;  2BVL A;  1HOM A;  2F6C A;  4AYB A;  2CV2 A;  4Y17 A;  4OAY A;  2P6S A;  5DD8 A;  4E7K A;  3K4K A;  4KUM A;  1GXP A;  4P96 A;  4G7Z F;  4Q47 A;  1HQC A;  2R7U A;  4RB3 C;  1WJE A;  4IRI A;  3MKL A;  3QQA A;  3DWL E;  2XGX A;  1JGG A;  4BDY A;  1H0M A;  5DDG A;  3VWB A;  1LDK B;  4BHB A;  1XC5 A;  5E1W A;  1YYV A;  4XOP A;  4X0G A;  3LNQ A;  1QZE A;  2BXZ A;  1ORK A;  4B47 A;  2DQR A;  4JK1 X;  4RGR A;  2ZXH A;  2OD5 A;  3DKW A;  3FM3 A;  2HDD A;  3PUB A;  4ETS A;  3LSR A;  1MZB A;  5E1X A;  4BEH A;  1OLT A;  1ETX A;  2QGU A;  3BJA A;  1XSV A;  1FPQ A;  4FT8 A;  3K4L A;  3AFH A;  2W48 A;  5H20 A;  3W2W A;  4QWQ A;  1USS A;  3MD2 A;  2EK5 A;  5LD2 C;  2MC4 A;  2CQN A;  3ZQH A;  2B9S A;  4I76 A;  4Q48 A;  3IH2 A;  2L2O A;  3Q5F A;  2HWV A;  4U88 A;  3CDL A;  5HS7 A;  4FE4 A;  4WXH A;  1HF0 A;  3FXR A;  1U8B A;  3OYL A;  4RAY A;  2FEZ A;  2L4A A;  2XRN A;  3ZGK A;  4G7H F;  4BL0 B;  2R7S A;  2PBI A;  2J5P A;  1BIB A;  3FMR A;  1WJ5 A;  3VYS B;  1MNM C;  1JUP A;  3BOQ A;  4PSX A;  1UJ8 A;  2LF8 A;  2OV7 A;  2FOW A;  4I99 C;  3OS0 A;  2V79 A;  5B1B H;  2R5Y A;  1X1B A;  1IXC A;  1TWA J;  3LWF A;  3QPS A;  1NK3 P;  4F55 A;  2ME6 A;  3WTS C;  1G3T A;  2GM4 A;  1WFX A;  2XF6 A;  3BTC A;  5HDG A;  1NG6 A;  4NUB A;  5L3D A;  3OR1 C;  4KJZ A;  4D7M A;  3E6B A;  5J8C A;  2VQC A;  5LGU A;  4MIM A;  3CJR B;  1U9N A;  2AO9 A;  2OCE A;  5HS9 A;  3J7Y J;  3BZ6 A;  3OMY A;  3C2H A;  2R7X A;  1VQ7 I;  1REP C;  2TDX A;  4Y52 J;  2DPD A;  5DV5 A;  4RAG A;  2M7B A;  3MQ0 A;  1EH7 A;  1TBX A;  4IHX A;  5TRD A;  2M2E A;  1YS7 A;  4HLX A;  5HLT A;  4HDU A;  2JK3 A;  3NWT A;  2IGO A;  2YPR A;  2ZCW A;  4XNF A;  1KGS A;  1X1P A;  1ERD A;  2NOG A;  2XGE A;  5LEK A;  4J19 A;  1W7P B;  2FD5 A;  3TMO A;  1G3S A;  4E7J A;  4LB5 A;  2QBY A;  1U6G A;  3GTQ J;  2AHQ A;  1Z6T A;  4M3F A;  1VND A;  4A2U A;  3L1P A;  3HOZ J;  2KRF A;  3GFL A;  1R22 A;  2FUG 2;  1D8J A;  3S2D J;  1B9M A;  1V55 H;  3ZPL A;  1G59 A;  3BG9 A;  2XV4 S;  4CGZ A;  4XK4 A;  2A07 F;  4BXX J;  2ETH A;  3HIF A;  1Y56 A;  3V8J A;  2V1N A;  3JRB A;  2EFO A;  4GRI A;  2XPU A;  3CQZ J;  1B8I A;  2EIM H;  2QUF A;  2GXB A;  2FXA A;  2MW8 A;  2HKX A;  1ON1 A;  4C30 A;  2Y48 A;  1YX5 A;  3C3W A;  3ABL H;  2QYO A;  3BG3 A;  1F36 A;  4HNU A;  2VBZ A;  3J81 Z;  2K40 A;  2CH0 A; 
#chains in the Genus database with same CATH homology
 1KU9 A;  1FX7 A;  2XAF A;  3U9G A;  5K5O A;  3VOE A;  3RJP A;  2PG4 A;  2CFX A;  3ZP5 A;  2BEO A;  3RYP A;  3QP6 A;  4ZZL A;  3P9C A;  1HBX G;  5BS6 A;  4EJU A;  1WSU A;  3O6B B;  4ZZD A;  3IC7 A;  4GYI A;  2DU9 A;  4EGY A;  5A2Q Z;  4KIB A;  3IKT A;  4U0W A;  2XAS A;  4S04 A;  1OYW A;  2FNA A;  2L02 A;  3E3V A;  1FYL A;  1SD4 A;  5FGM A;  5BMZ A;  4KT5 C;  3BY6 A;  1HW1 A;  5CVJ A;  2QLZ A;  3ML6 A;  3HSR A;  2IA0 A;  3I71 A;  1P4X A;  2Z33 A;  1GXQ A;  3BDD A;  3K2Z A;  4I0A A;  3ZN0 A;  2V1X A;  4KIF A;  5AIP A;  1KYZ A;  1FSH A;  2M30 A;  1IN8 A;  3SZT A;  4U0Y A;  5TJJ A;  4TV7 A;  5A2Q K;  1LJ9 A;  1W7P D;  2FNP A;  2YX4 A;  1B1B A;  2O6G E;  1J5Y A;  4MQV A;  5D5W B;  2F2E A;  1XGS A;  2RQP A;  2P7C B;  2DW4 A;  1TQI A;  4G7O F;  1HXD A;  3M9A A;  1ZRD A;  4HF0 A;  1XSX A;  1D5V A;  5BOX A;  4EJT A;  2A6E F;  4EM1 A;  4HYE A;  1ON2 A;  2PMU A;  2M45 A;  2PI0 A;  4XRF A;  4PGH A;  3BJO A;  5JI6 A;  4DNC A;  1IRF A;  1YG2 A;  2E7X A;  4A0Y A;  4LB6 B;  3NRV A;  4M71 A;  4IF4 A;  2Y0M A;  3L09 A;  1PDN C;  1RUO A;  1UHM A;  3KCC A;  3HSE A;  2NRA C;  1OKR A;  2K4J A;  4EM0 B;  3MZH A;  1BI2 A;  1L0O C;  4LK0 F;  5HLI A;  2X0L A;  3QRF F;  5LLQ A;  1XD7 A;  2R7D A;  4EQQ A;  2M5W A;  2VE8 A;  3J7A O;  4UV9 A;  1I6X A;  3VFZ A;  2Q2E A;  2WTE A;  4UHT A;  3WU0 A;  4FX4 A;  1XMK A;  2P5K A;  3I58 A;  2X4H A;  3FXU A;  3B73 A;  2Q8K A;  3H92 A;  3PFI A;  4OU0 A;  1XGO A;  3CLO A;  3WTZ A;  2G7H A;  2ZNY A;  1P6R A;  2QZ8 A;  1YW8 A;  2PJP A;  4I7H A;  1XSD A;  2BV6 A;  4I98 B;  1MDM B;  3ROU A;  3F6O A;  4UUV A;  4OOI A;  5JFR A;  3PQK A;  4OIR F;  3E6D A;  2JPB A;  3SZP A;  4RB2 C;  2E1N A;  2PMH A;  1BIA A;  3R6S A;  5ED4 A;  4G6Q A;  2V1U A;  2FOK A;  5EEH A;  1YIO A;  3GLX A;  4ZYE A;  1O3S A;  1B4A A;  4P5O A;  3CUQ A;  4M9S A;  3HTU A;  1G4D A;  1WQ2 A;  2R3S A;  5E8I A;  2E1C A;  1FNN A;  3KP6 A;  2P8T A;  5BPD A;  1DDN A;  3U1D A;  1UFM A;  2A61 A;  4KFC A;  3QAH A;  4NHJ A;  3RDI A;  3R61 A;  3WTT C;  3F22 A;  2QM3 A;  2BGC A;  3KEQ A;  2XAJ A;  2HS5 A;  2LSO A;  3HOT A;  3KZZ A;  4YFX F;  2WWY A;  1K78 A;  3KFW X;  2VBY A;  1FYM A;  2DK8 A;  4IVN A;  1T0F A;  3E97 A;  4KNY A;  2VON A;  2K4B A;  1MD0 A;  3C18 A;  3RI4 A;  4IXA A;  3P9I A;  3ULQ B;  1Z05 A;  3ABT A;  2KIM A;  3BPX A;  1FBS A;  3CJN A;  3ECO A;  1CGP A;  4Y13 A;  4RB1 A;  3RPU A;  3ECH A;  1S29 A;  3HSF A;  4P9F A;  3DPL C;  1HKS A;  4MEX F;  5HDK A;  1T98 A;  3W6J B;  5K1Y A;  2QBY B;  2BYV E;  2K02 A;  2HGC A;  4LLL A;  1F1Z A;  3I5U A;  4L5I A;  2DPU A;  3FF5 A;  1OR7 A;  1T6S A;  4RGX A;  3LQR A;  3HUG A;  1TQM A;  3RKX A;  4Z2Y A;  2ZME A;  4AWX B;  3ISP A;  2NS0 A;  4ON0 A;  2KJB A;  3KP5 A;  4I2O A;  1LEB A;  3T8T A;  1D3Y A;  3V7R A;  1ZYR F;  4IHS A;  4UNO A;  4L0Z B;  2ESH A;  3WU1 B;  1R00 A;  1SFX A;  1KQ0 A;  1U5T C;  3WTX C;  1ODD A;  4MEY F;  1J2X A;  3WTY C;  1J59 A;  4ENJ A;  1QBJ A;  3JAM K;  1UB9 A;  2H09 A;  4L5J A;  4MTE A;  2ELH A;  4WX9 A;  2DAO A;  3HTS B;  1SD7 A;  3NQO A;  3FX3 A;  1WKM A;  3NEU A;  3I0T A;  4GCV A;  3RKW A;  4PCQ A;  3DPT A;  1BBY A;  1XCV A;  3OOP A;  3GX4 X;  1G6N A;  3LAP A;  3BWG A;  3F6V A;  4LLN A;  4U0V A;  2UXX A;  2VXZ A;  3HHH A;  2CWE A;  5D6F A;  1U8R A;  1U5T A;  3GO5 A;  4XLN F;  5FD5 A;  5KK1 A;  2ADU A;  1ZN2 A;  3HOS A;  1SD6 A;  2JPC A;  1MDM A;  4GYG A;  1R5H A;  1R1V A;  3MFK A;  2HFH A;  2XAQ A;  3FWE A;  5HOO A;  4ASN A;  3TDU C;  5D8K B;  4M72 A;  1LDJ A;  3RKY A;  2UZK A;  3BP8 A;  4HX8 A;  2PLY A;  3ZMD A;  1SFU A;  1GHC A;  1WRJ A;  4HA8 A;  3GF2 A;  3O2P E;  4Q4Z F;  5KVR A;  4RB0 A;  3GVA A;  2STW A;  2UXN A;  2XIG A;  3F8B A;  3WE3 A;  4EJW A;  1FZP B;  1T39 A;  3T1B A;  5K5R A;  4KA4 A;  4KN7 X;  4P9U A;  2VOO A;  2RV8 A;  4BH9 A;  1XGM A;  4N0B A;  4LG0 A;  3O3K A;  5F1R A;  2CYY A;  2A69 F;  1PP8 F;  2MA3 A;  3TGN A;  3L00 A;  5JHU A;  1IN4 A;  1ZH5 A;  2HTJ A;  4WCG A;  1R58 A;  2XAH A;  5E17 F;  2FQ3 A;  1C0W A;  2XRO A;  1OYI A;  1H9T A;  1I5Z A;  1SMY F;  3DQV C;  1ZHF A;  4O6J A;  5EEG A;  4WWC A;  1QNT A;  2D1V A;  2UWM A;  5CVI A;  4A12 A;  2ZKZ A;  3WTV C;  2IA1 A;  1LNW A;  2V1D A;  4UVB A;  1ZAO A;  2MBF A;  3HRS A;  1I1S A;  3E5U A;  1WI9 A;  1TTY A;  3WOD F;  2GA2 A;  1B6A A;  5LRS A;  3KP7 A;  4L18 B;  2ISZ A;  1XB4 A;  4HX7 A;  2RGV A;  1XCB A;  4RGS A;  2YSR A;  5E18 F;  1S7O A;  3V8K A;  2ZJ2 A;  2L01 A;  1SD5 A;  5DYM A;  5D5V B;  2P6T A;  4RS8 A;  3MEX A;  2EV0 A;  1EH8 A;  1QO0 D;  1BJA A;  4HLY A;  1SFE A;  1EH6 A;  4HV5 A;  1W5T A;  1K6O A;  1KYW A;  1UCR A;  3E5Q A;  3CUQ B;  2DTR A;  3RPQ A;  2OBP A;  1S8N A;  3V7S A;  4U7D A;  1P4W A;  1BC8 C;  3DP7 A;  3R0A A;  2H27 A;  2K86 A;  1FOK A;  4PGG A;  3ELK A;  1FBU A;  3I59 A;  2ZBK A;  3TOB A;  2EFN A;  4G94 A;  1T38 A;  3LAJ A;  1FLI A;  5ILS A;  3GXO A;  3M8E A;  1PP7 U;  5E8G A;  2AXL A;  1IAW A;  2IP2 A;  3MAJ A;  2HYG D;  1JGS A;  3P9K A;  5BPI A;  4KIC A;  2AS5 F;  4MHG A;  4AIK A;  1K78 B;  5BQT A;  4OIO F;  1TNS A;  3C7J A;  4HBL A;  5LGN A;  4M6Y A;  1UHW A;  2BE5 F;  4R79 A;  3KLO A;  4ENM A;  4MQ9 F;  1SMT A;  3CDH A;  2GAU A;  3QP5 A;  3WTW C;  1ZRC A;  4B09 A;  1ZRF A;  5E1Z B;  4CYD A;  1HSJ A;  1V3F A;  5DUK A;  4LJZ F;  2COM A;  1ULY A;  1FSE A;  3I53 A;  1R1T A;  4U7B A;  3W6K B;  3QU6 A;  3GYH X;  1ZLJ A;  4R8H A;  1ZLK A;  4MNU A;  4HQE A;  2EFQ A;  1W4M A;  5IT9 Z;  2D1H A;  3QU3 A;  5CVR A;  3DEU A;  4IRG A;  2O3F A;  2VN2 A;  4ZYH A;  1Q1H A;  1IN6 A;  2CSO A;  3K0L A;  4WXD A;  3G73 A;  3M7G A;  2E7W A;  4I0B A;  2V6C A;  4OIP F;  3WE2 A;  2ZME B;  5DCF A;  5FB2 A;  5K5Q A;  3F8N A;  2CO5 A;  5L3G A;  2JZY A;  3EUH A;  5HLG A;  1CF7 B;  2GZW A;  3BPV A;  2Z5U A;  1J75 A;  4AIJ A;  4G8X A;  4YFK F;  5FO5 A;  2GXG A;  1L3L A;  4EJV A;  3DF8 A;  5IT9 K;  2PFB A;  2LF7 A;  2HZT A;  1BN5 A;  4N9I A;  4ENN A;  1YW9 A;  4EJO A;  3ZMT A;  2ISY A;  2FBH A;  3GFI A;  2VOD A;  3MWM A;  5CVU A;  3IWZ A;  4CXF A;  1LQ1 A;  2FE3 A;  3G3Z A;  3LST A;  3DV8 A;  1Z1D A;  5D6E A;  2EA2 A;  4K2E A;  2M87 A;  4OMY A;  1ZG3 A;  3TO9 A;  4I02 A;  2OZ6 A;  4JBA A;  1HST A;  2IVM A;  1U5T B;  4A5M A;  2IT0 A;  1B59 A;  4EVI A;  4IJA A;  4EMS A;  4ESJ A;  5ICC A;  1STZ A;  1LB2 A;  2A5Y B;  4L9T A;  4CZZ A;  2FSW A;  3OV8 A;  5J6X A;  2DI3 A;  4A0X A;  2MLK A;  2F5E A;  3VOD A;  2LNB A;  5L3C A;  1O3T A;  2KIF A;  1I1G A;  4AIH A;  5ERI A;  2ESN A;  1U2W A;  1Z7U A;  3FZV A;  3M8F A;  4AD9 A;  3F72 A;  2FU4 A;  1JXS A;  4IHT A;  2STT A;  4UV8 A;  1ONV A;  1YO5 C;  4ZYG A;  1GVJ A;  2J5O A;  4G9Y A;  2B0L A;  4LG0 B;  4LLG F;  3LA3 A;  1MGT A;  3I4P A;  3LA7 A;  4HW0 A;  2VBX A;  2A68 F;  2EA4 A;  5JR3 A;  1Z6R A;  2RDP A;  5JVT A;  2NNY A;  2F5F A;  3KLN A;  1KU2 A;  4ESF A;  2WC2 A;  2HEO A;  2QQ9 A;  3S2W A;  1ZGA A;  4Q5S F;  5F64 A;  1KQ9 A;  5HS8 A;  2EB7 A;  3ZMZ A;  2DT5 A;  3QOP A;  1RZ4 A;  4KN4 X;  4XLP F;  3T8R A;  1IF1 A;  2K27 A;  3GEZ A;  3JAM Z;  2XHK A;  2HOE A;  1YQA A;  1QZY A;  1IUY A;  3F3X A;  4PDK A;  4NQW A;  5DUI A;  5L3E A;  3EYI A;  4OIQ F;  3DXJ F;  4I01 A;  2VOP A;  2RN7 A;  1CF7 A;  4KIG A;  1G3Y A;  4CDG A;  2H94 A;  2EWN A;  2CQK A;  5H6Q A;  2KJC A;  3F21 A;  3ZMV A;  5D4R A;  1U78 A;  3COA C;  1AOY A;  1S7A A;  4OIN F;  3K9T A;  4N9H A;  3GZ5 A;  4M6X A;  3VEP A;  1BC7 C;  2M8E A;  5AIQ A;  1FWZ A;  5FD6 A;  3I59 B;  2W25 A;  2RKH A;  5FFX A;  2ZFW A;  1E2X A;  3C1D A;  4A5N A;  3F8F A;  5ICF A;  5J8F A;  1ZAR A;  2M1B A;  2D2W A;  3E6C C;  4GXO A;  2W85 A;  3REO A;  5ILV A;  3WTU C;  3BRO A;  1U3E M;  2MH9 A;  2IA2 A;  3B02 A;  4L9J A;  3SHF A;  2JSC A;  3TOA A;  3SXY A;  4O5V A;  2GWR A;  2Z9O A;  4RGU A;  3TO7 A;  4HX4 A;  2A3S A;  4Y15 A;  5ICG A;  4HV6 A;  4NB5 A;  2OQG A;  5DCM A;  1P92 A;  4UVA A;  4S05 A;  2JTV A;  2RNJ A;  3J80 K;  2DK5 A;  4KMF A;  2O03 A;  3V8L A;  2EFP A;  2HKO A;  1TLH B;  2FF4 A;  2IJL A;  3L7W A;  2L54 A;  3JSP A;  1DUX C;  4LK1 F;  1K79 A;  1BI0 A;  2OA4 A;  2O0Y A;  3CO7 C;  3EQL F;  3R4K A;  1OPC A;  5HLH A;  1JHF A;  3RTR A;  2FMY A;  3CTA A;  3K1N A;  1XGN A;  1YS6 A;  4BAY A;  1Z9C A;  2O61 A;  2NAZ A;  3R0J A;  3Q9S A;  2EJR A;  4G6D A;  1TW3 A;  3GZ6 A;  4LFU A;  2YU3 A;  3HRT A;  1Y0U A;  2P5V A;  2V9V A;  3GFJ A;  1WWX A;  3H3U A;  2PN6 A;  5H6R A;  2OAZ A;  3FMQ A;  2RC4 A;  4D0P A;  3FM5 A;  1JHH A;  2WV0 A;  1H9G A;  5L3B A;  3N4M A;  4HF1 A;  2QWW A;  5D5X B;  3E5X A;  2CG4 A;  1FBQ A;  1S6L A;  4A0Z A;  2W57 A;  5L3F A;  4AVP A;  3D0S A;  1NHA A;  3F23 A;  4IRH A;  3D5L A;  5IT3 A;  4M73 A;  3P7N A;  1KQ8 A;  3I64 A;  4ZYD A;  3FXQ A;  4M9Z A;  4BXU A;  2H6C A;  1J0R A;  3F8M A;  1XMA A;  4P55 A;  3JTG A;  4XSZ F;  2LKP A;  2QEN A;  4YII A;  2XUB A;  2MLG A;  3IRR A;  1DP7 P;  1XDU A;  2Y75 A;  3N97 A;  3GUD A;  2GIV A;  4ESB A;  1D8K A;  2F5C A;  2LDU A;  4IPA A;  1R1U A;  3HRM A;  1O7L A;  1AWC A;  4LGW A;  2YR2 A;  3QPT A;  4L9N A;  2NYX A;  3HHG A;  4EV0 A;  2RVC A;  2XAG A;  2Q0O A;  3KP4 A;  5LBQ A;  1OMI A;  3ZMS A;  2P4W A;  2JRT A;  1BM9 A;  4HZF A;  5FLX Z;  5LHH A;  2KIU A;  3K1M A;  1SAX A;  4DQ2 A;  2IPQ X;  1IXR C;  1W5S A;  1HKQ A;  3K1P A;  1J9I A;  3H3Z A;  3I54 A;  5E20 A;  3KE2 A;  2QQB A;  3TO6 A;  5LHG A;  4GO1 A;  3SQN A;  3V4G A;  4A6D A;  1YTY A;  1I27 A;  1XN7 A;  2A6H F;  4M9X A;  2GQQ A;  1LVA A;  1F4K A;  3J81 K;  4WXC A;  2C6Y A;  2QVO A;  2QQA A;  5CJ9 A;  2CW0 F;  3R60 A;  2DLL A;  1QPM A;  1VTN C;  1MJ9 A;  2G9W A;  2PQ8 A;  3GFM A;  3V7C A;  2VC0 A;  2OZU A;  5D5U B;  2L3D A;  3ERE D;  4A6E A;  5FLX K;  4R1H A;  4CIC A;  1O3R A;  3HRU A;  1XDS A;  3ZQ7 A;  2H6B A;  5D8L B;  3T5X A;  1FP1 D;  1HW5 A;  1R7J A;  2ZXJ A;  1O57 A;  3KET A;  4XSX F;  4ENK A;  1TNT A;  4I09 A;  3GWZ A;  3E6M A;  3TKY A;  3F8C A;  1R5G A;  1X3U A;  2Z3Y A;  2W24 A;  3T0Y A;  1KA8 A;  2VC1 A;  2P5L C;  4BYY A;  2BBY A;  1R23 A;  4ZH4 F;  2Z99 A;  1MJA A;  4XBF A;  5HDN A;  2DBB A;  4JQF A;  3LA2 A;  2VE9 A;  5LRR A;  1YFH A;  4O3M A;  2EV5 A;  4CO8 A;  3K69 A;  1FP2 A;  5CYV A;  2ZO4 A;  2HYF A;  2HTS A;  1ZGJ A;  1RUN A;  3CUO A;  3M1E A;  3MZY A;  3CO6 C;  1LDD A;  1RNL A;  2ZNZ A;  2NNN A;  4EGZ A;  3QPH A;  2L4M A;  4FX0 A;  4RAZ A;  3LFK A;  4OMZ A;  3IRQ A;  4H0E A;  2R7F A;  4L9V A;  2EFW A;  2ACJ A;  1UST A;  1QZZ A;  3ZMU A;  3EDP A;  4YG2 F;  1V4R A;  1G3W A;  1HKT A;  3CUQ C;  2XKO A;  4M74 A;  4L0Y B;  1O7F A;  1W7P A;  3GW2 A;  4YIF A;  3KZY A;  1TW2 A;  2G7U A;  3BJ6 A;  1IN5 A;  3KP3 A;  3WGI A;  2CGP A;  2OQR A;  2IRF G;  4LD5 A;  2OU2 A;  5DCM B;  2EV6 A;  4HOB A;  4YFN F;  1PUE E;  5ICE A;  3WGH A;  2FBI A;  6PAX A;  1QGP A;  5ILU A;  2PEX A;  4F7Z A;  2HDC A;  4WF2 A;  3JTH A;  1DPU A;  3L2C A;  1YLF A;  2IW5 A;  4BHC A;  3JW4 A;  2O8X A;  1MKM A;  1F9N A;  2GA1 A;  1R36 A;  3TQN A;  3IKV A;  3VB2 A;  2MD5 A;  3L9F A;  5HVQ C;  3FHZ A;  3KEO A;  5LGT A;  3WG9 A;  1JE8 A;  1RI7 A;  2HQR A;  2K7L A;  2VBW A;  4EM2 A;  1KU7 A;  4KYW A;  5FFZ A;  3JSO A;  1F5T A;  2XKP A;  2DO7 A;  4E70 A;  1RIO H;  3RYR A;  3SFZ A;  1FC3 A;  5LEJ A;  1J7K A;  4HAM A;  1A04 A;  2MH2 A;  4UXN A;  4LMY A;  5DEQ A;  3U2R A;  4MGR A;  4UVC A;  4B8X A;  2FA5 A;  1YW7 A;  2FRH A;  5AON A;  2F5D A;  4HQM A;  1B9N A;  3IWF A;  1K7A A;  2DQL A;  2XVC A;  2P7V B;  2DFI A;  5F6F A;  1BI3 A;  4BHP A;  1S3J A;  3EET A;  1T2K A;  2HR3 A;  1IN7 A;  2VT2 A;  4BQA A;  3WGG A;  1BI1 A;  4FHT A;  3TDZ C;  1IZ1 A;  1E17 A;  2YX7 A;  1IRG A;  1MJB A;  2VT3 A;  1IW7 F;  3IL2 A;  3Q9V A;  1HW2 A;  1FYK A;  4MTD A;  3KP2 A;  1BOA A;  3PQJ A;  4QLC U;  1KU3 A;  2HQN A;  4KDP A;  4PZJ A;  2MC3 A;  4HF2 A;  5D4S A;  4KMU X;  5CVV A;  1P4A A;  1TQP A;  3FMS A;  1O3Q A;  4WK8 F;  1EV7 A;  3EYY A;  1DPR A;  1ZG1 A;  3HYI A;  3J80 Z;  3DFG A;  4CHU A;  1FY7 A;  1QQI A;  3LQQ A;  3ABU A;  4HDV A;  1P2F A;  3ZN1 A;  5DD4 A;  5LHI A;  1ZRE A;  3AAF A;  3IHU A;  1ZG5 A;  4BNC A;  1Z91 A;  5CLS A;  1OYY A;  4GGG A;  1IXS B;  2KKO A;  3MCZ A;  3RIR A;  1LEA A;  2W84 A;  2D45 A;  2FBK A;  1FT9 A;  2FML A;  2JT1 A;  4Y17 A;  2P6S A;  5DD8 A;  4KUM A;  1GXP A;  4P96 A;  4G7Z F;  4Q47 A;  1HQC A;  4RB3 C;  4IRI A;  2XGX A;  1H0M A;  5DDG A;  1LDK B;  4BHB A;  5E1W A;  1YYV A;  2DQR A;  4JK1 X;  4RGR A;  3DKW A;  2OD5 A;  3FM3 A;  4ETS A;  1MZB A;  5E1X A;  3BJA A;  1XSV A;  1FPQ A;  4FT8 A;  5H20 A;  4QWQ A;  1USS A;  2EK5 A;  4Q48 A;  3Q5F A;  2HWV A;  4U88 A;  5HS7 A;  4WXH A;  3FXR A;  4RAY A;  2FEZ A;  2L4A A;  2XRN A;  4G7H F;  2PBI A;  2J5P A;  1BIB A;  3FMR A;  3BOQ A;  2LF8 A;  2V79 A;  1IXC A;  3LWF A;  3WTS C;  1G3T A;  5HDG A;  5L3D A;  3E6B A;  5J8C A;  5LGU A;  5HS9 A;  3BZ6 A;  1REP C;  2TDX A;  2DPD A;  5DV5 A;  3MQ0 A;  1EH7 A;  1TBX A;  5TRD A;  1YS7 A;  4HLX A;  4HDU A;  2YPR A;  2ZCW A;  1KGS A;  5LEK A;  1W7P B;  1G3S A;  4LB5 A;  2QBY A;  1U6G A;  1Z6T A;  4A2U A;  2KRF A;  3GFL A;  1R22 A;  1D8J A;  1B9M A;  3ZPL A;  2XV4 S;  4CGZ A;  2A07 F;  2ETH A;  3HIF A;  3V8J A;  2EFO A;  2QUF A;  2GXB A;  2FXA A;  2HKX A;  1ON1 A;  2Y48 A;  3C3W A;  2QYO A;  2VBZ A;  3J81 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...