2ZKZA

Crystal structure of the transcriptional repressor pagr of bacillus anthracis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
YMSLEDDAELLKTMAHPMRLKIVNELYKHKALNVTQIIQILKLPQSTVSQHLCKMRGKVLKRNRQGLEIYYSINNPKVEGIIKLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional repressor pagR
publication title Crystal structure of the transcriptional repressor PagR of Bacillus anthracis
pubmed doi rcsb
source organism Bacillus anthracis
total genus 24
structure length 86
sequence length 86
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zkzA00
3QU3A 2LSOA 4P9UA 2FBIA 2FBKA 5LBQA 3LWFA 4HQEA 1SAXA 1Z6RA 1PP7U 4E70A 1B9NA 3EDPA 3IC7A 1W7PB 1ZG3A 2QQBA 1SFXA 5CYVA 5H20A 5KK1A 4YIIA 3KLNA 1RIOH 1R5GA 3QU6A 3J81Z 5F6FA 5TJJA 1O3QA 1MDMB 3COAC 4G7ZF 3Q9VA 3ZN0A 3O6BB 1R22A 2DT5A 2XAFA 5ILVA 1R23A 2XKOA 4WK8F 3PQJA 5H6RA 4FX0A 2YSRA 1ODDA 3DF8A 4GYIA 2PI0A 1B1BA 3E5XA 3QPHA 3V8JA 3HTSB 3S2WA 3WG9A 4XSZF 1V4RA 1KYZA 1OYIA 2IVMA 2IRFG 1EV7A 1FNNA 2EV5A 3JSOA 4A5MA 3HYIA 5D6EA 1R1TA 3WE2A 1QPMA 4KUMA 2HKOA 3ZMSA 1KA8A 3CO7C 2KIFA 1RNLA 5JVTA 3SFZA 3FMRA 1L0OC 2BV6A 4HF1A 1Z91A 2P8TA 2IP2A 1B4AA 3ZMDA 2QVOA 3GWZA 3DFGA 3V4GA 4WX9A 4L9NA 1H0MA 3LQRA 5J6XA 2A5YB 1QO0D 2K4BA 5FB2A 1IUYA 5CVVA 4JBAA 1FPQA 1P4AA 3EYIA 5BPDA 4UVCA 5CJ9A 4L0ZB 2VN2A 1MKMA 3MQ0A 2ACJA 1ZAOA 1PP8F 4DNCA 2R7DA 2E1NA 1IAWA 5IT3A 2ELHA 1TBXA 4NQWA 4KIFA 5LRRA 4U0VA 4KMUX 1S6LA 1CF7B 1L3LA 3DPTA 3WTTC 2HOEA 5CVUA 4WXHA 4ENKA 1KU7A 2HFHA 2DK8A 2XAGA 1BOAA 3RDIA 2FXAA 4KYWA 5J8FA 2KJCA 4OMYA 4KFCA 2DBBA 2QQ9A 2OQGA 2A6EF 4M9XA 3R0JA 2FU4A 3E97A 4BAYA 1ZGAA 2A61A 2MA3A 2F5CA 1UB9A 2RGVA 3V7SA 3CDHA 3C1DA 5FGMA 1IXRC 1H9TA 5L3DA 1TQIA 3LA3A 3SXYA 3MZHA 2QYOA 4BQAA 5L3BA 2FQ3A 3ABUA 3AAFA 1HKSA 5ICFA 4XLPF 4RB0A 1GVJA 4A2UA 5D5UB 2L02A 2FA5A 4P5OA 3F8CA 1H9GA 2HKXA 2MC3A 1SD5A 5E1XA 4EQQA 3N4MA 2XGXA 1YG2A 3GFJA 1FP2A 4I98B 3M8EA 2FEZA 2HR3A 2K86A 1HW1A 3KCCA 3V7RA 2VBZA 4CICA 2YX4A 4KICA 1GXPA 1R00A 2CO5A 1TNTA 1EH8A 1YS7A 3VEPA 1WI9A 3KFWX 3I58A 1KGSA 1O3TA 3HIFA 1ZARA 3CLOA 2VT3A 1RZ4A 3BY6A 1O57A 2DLLA 4EM2A 2GZWA 3KEOA 1XCBA 1E2XA 4LLLA 4I01A 2VONA 2NNNA 1R7JA 2DW4A 1LNWA 5JFRA 5L3GA 3KETA 3KEQA 5L3EA 2JPCA 2KIMA 2HYFA 4ETSA 2HGCA 2ZKZA 4Z2YA 3DPLC 4WXCA 1TW3A 2EV6A 4L0YB 5LEJA 4YFNF 3F22A 3ELKA 2EWNA 5DUKA 1ZREA 4CZZA 4KMFA 1O7LA 1XGOA 3JW4A 4N9HA 2LF8A 4AD9A 5ERIA 3QOPA 1SD6A 2XRNA 1CGPA 1G3SA 3ZMUA 1FWZA 3I54A 1XSXA 4DQ2A 3MCZA 4AIJA 2ESNA 4MEXF 4EJWA 4S05A 3WGIA 2M87A 3NQOA 4P96A 4IHSA 2KRFA 2JSCA 4R8HA 2V9VA 3O2PE 4HZFA 2PQ8A 3FMSA 2Y75A 2L54A 2O8XA 2IJLA 1LEBA 3ML6A 4HAMA 1BN5A 1WQ2A 3JAMK 2IA0A 4RB1A 3MAJA 4RS8A 1G6NA 4KIBA 2UWMA 5HDNA 2IPQX 4OMZA 3ZQ7A 1MDMA 4HOBA 3KE2A 3LA2A 1OPCA 4Y13A 3K69A 2NRAC 2BBYA 3HOTA 4U0WA 2WV0A 5HLGA 1MJBA 3TOBA 1XDSA 4L9VA 1IXCA 1IN8A 3E5UA 3TO7A 3T8TA 2VODA 4OOIA 3QP5A 1F1ZA 4MTDA 1TNSA 1XCVA 4EMSA 5FLXZ 5BS6A 2ZMEB 2DQRA 2E7XA 1G3YA 2XIGA 3GFLA 3I53A 3HTUA 3FX3A 5LGTA 3GLXA 4LMYA 1BC8C 2L01A 2VBWA 1KQ0A 4GXOA 5DCMB 4EGZA 2WWYA 1ON2A 1IW7F 2YR2A 5LRSA 4LB5A 3U1DA 4IRGA 3GFMA 3PFIA 4BHCA 1D3YA 5A2QZ 1BM9A 5KVRA 1D8JA 3FZVA 3ROUA 4NB5A 5EEHA 3ZMVA 3D0SA 2HWVA 4L5IA 3J81K 1G3WA 4BHPA 2H94A 5LHHA 3HSEA 4O6JA 3MEXA 3FWEA 5HOOA 2RN7A 2V1XA 5K5RA 1XSDA 3FHZA 3E6DA 4KA4A 1CF7A 1Z6TA 2P7CB 1BBYA 3G73A 2KJBA 3H3UA 3QP6A 2H6BA 1OYWA 3F8MA 5HLIA 3F8FA 4A6DA 1YLFA 2P5KA 1FT9A 4MGRA 4LD5A 1ZLKA 5LEKA 2ZXJA 3CUOA 4GYGA 3TKYA 2GQQA 4JK1X 4CO8A 3VFZA 3T1BA 1D5VA 3E6BA 3LA7A 2MD5A 4S04A 1BI3A 3R4KA 5L3FA 3M8FA 1NHAA 1T98A 4HYEA 3L9FA 3G3ZA 3I59B 4KT5C 2FE3A 4OU0A 3RYPA 1YIOA 1XGNA 1RUNA 1DPUA 2RNJA 4I02A 1HSJA 1IRFA 4R79A 1R36A 3HRTA 2CWEA 3ZMZA 2OZUA 2P4WA 2F5DA 3V8LA 1XGMA 4UV9A 3VODA 3KZZA 4ZZLA 1USTA 3EQLF 4HQMA 5E8GA 1DDNA 3T8RA 4LGWA 4MNUA 3IHUA 4HV5A 2BE5F 2DAOA 3BROA 2Z9OA 4XRFA 2HQRA 4A12A 5JHUA 1BI1A 1FBQA 2VT2A 4HX8A 1HBXG 4G8XA 4CHUA 3GF2A 1B59A 4AWXB 4MTEA 1Z7UA 2M1BA 2ZJ2A 4ZZDA 2RV8A 4ZH4F 2V1UA 2NAZA 1IN4A 3L2CA 5D4RA 2STTA 2ZNZA 2OZ6A 1J5YA 2WC2A 2JTVA 3J80Z 2Y0MA 4D0PA 2GXBA 5E1WA 3WODF 1FBUA 3P7NA 3P9CA 4FHTA 1U6GA 3BP8A 1R1UA 2P6TA 2DTRA 3HSRA 1P2FA 5LHGA 1W5SA 1RUOA 2MLGA 2PMUA 4HDUA 3EUHA 1ZH5A 3LFKA 4KDPA 2R3SA 4K2EA 2A6HF 4YFXF 1XB4A 1B6AA 1IN6A 3FXRA 3HRSA 4YG2F 2M8EA 3GUDA 5K5OA 3I71A 5ILSA 3IWZA 1ZG1A 2EFWA 2GXGA 1T2KA 1B9MA 2CG4A 2CW0F 2XAHA 3M1EA 1Z1DA 2EA2A 4IF4A 3EETA 4B8XA 5E8IA 2D1HA 3P9IA 3VB2A 2CGPA 1WWXA 3M7GA 2O3FA 2P5LC 1O3SA 4NHJA 3BJ6A 1TLHB 3GXOA 2H6CA 1R5HA 1K78B 2OQRA 3ERED 5HLHA 2YU3A 2GA2A 1SD7A 1WSUA 4G7HF 1KU3A 4ZYEA 2EB7A 1UHWA 3K0LA 1TW2A 3E6MA 1MGTA 2OD5A 4M71A 2Z5UA 1J59A 3R0AA 5TRDA 4FT8A 3F21A 1JHHA 1WRJA 3L7WA 3FF5A 2BGCA 4OINF 2XAQA 4UHTA 4Y15A 4U0YA 1K7AA 1YW8A 3C7JA 4KIGA 2QLZA 2B0LA 1ON1A 1YTYA 3HRUA 1MJ9A 3P9KA 2J5PA 1U78A 2XHKA 1UCRA 3LQQA 2H27A 1FY7A 3K1NA 2PLYA 3KP2A 4M9ZA 3BJAA 5ICCA 3QRFF 2P7VB 4LFUA 2W84A 1IN5A 4IRIA 4ESBA 3RKYA 4HDVA 1A04A 1F9NA 4AVPA 1IF1A 4I0BA 3DXJF 3RTRA 4ESFA 2K4JA 3PQKA 2A3SA 2D1VA 4RGSA 2STWA 1OKRA 1LJ9A 4R1HA 5DCFA 4HLYA 2ZMEA 3MZYA 3WGGA 2HTSA 3SHFA 3F3XA 3IWFA 5LGNA 3F8NA 3R60A 4HF0A 3IKTA 1RI7A 1SFUA 4G94A 3K1MA 1IN7A 3ZN1A 5DCMA 4P9FA 4M6XA 3GZ5A 3DKWA 4IRHA 1XD7A 2L4MA 1BC7C 2VC1A 1ZRCA 1XSVA 1T39A 1T38A 3ABTA 4RGXA 2DI3A 1FSHA 5CLSA 5K1YA 3R61A 3KP4A 1QQIA 1FBSA 2EK5A 2UXXA 4EM1A 2PBIA 2NYXA 4Q4ZF 1I6XA 2EV0A 4WF2A 2RKHA 1DPRA 5CVIA 5AONA 1U3EM 2DFIA 1OYYA 1OR7A 2D2WA 1AOYA 1J0RA 4H0EA 3MFKA 3RPUA 4L5JA 4ASNA 2PEXA 3LAJA 5BPIA 3WTSC 5BOXA 4QWQA 5FLXK 3F23A 1QNTA 4M72A 3JTGA 2IT0A 3DV8A 3HOSA 5LHIA 1S7OA 2G7UA 1LB2A 1W5TA 4CYDA 5DDGA 2IW5A 2X0LA 3I59A 3RYRA 2MH9A 2JT1A 4OIPF 2UXNA 4XBFA 3D5LA 1R58A 3F6VA 5H6QA 5ED4A 3WU0A 4HX7A 4I7HA 5F1RA 4FX4A 2P6SA 1S29A 4UVAA 4WXDA 2VBXA 1LQ1A 5D5VB 1LDKB 2XVCA 2PJPA 2IA2A 2CQKA 2EA4A 4PCQA 3CUQA 1P4XA 1EH6A 5A2QK 5BMZA 4MQVA 2CYYA 2QWWA 2EFPA 1P92A 5FFXA 3IL2A 2ZNYA 5DD4A 2DO7A 1I5ZA 1Y0UA 3T5XA 4U7BA 1ZRFA 2Q2EA 1QZZA 4BYYA 2TDXA 3L09A 2NNYA 3Q5FA 1YQAA 1KU9A 4IHTA 2YX7A 3GO5A 2DQLA 1PDNC 4YIFA 4M74A 4LG0B 1SMYF 1GXQA 3REOA 3NRVA 3FXQA 3T0YA 2MLKA 3M9AA 2HDCA 4JQFA 2EFQA 5CVRA 3TGNA 1FZPB 4HA8A 2MH2A 1S7AA 3HRMA 1VTNC 4WCGA 4ZYDA 3FMQA 2J5OA 5CVJA 2GWRA 3BPVA 5FO5A 1TQMA 3GW2A 2RC4A 5IT9Z 5DEQA 3TDZC 3E6CC 4RGRA 1BIAA 4EJUA 5HS8A 4RB2C 3WTYC 3CO6C 2Z33A 1T0FA 1FX7A 2GIVA 5F64A 3NEUA 5ICEA 3CUQC 4TV7A 1UHMA 3BWGA 2PG4A 3O3KA 1LVAA 1FYMA 1TQPA 2C6YA 2L3DA 3V8KA 1Q1HA 4I09A 1U8RA 2D45A 4KN4X 2A68F 2EJRA 4EJOA 4PDKA 3E3VA 5ILUA 1KQ8A 1ZLJA 4LJZF 5AIPA 2KKOA 3EYYA 1K78A 4IVNA 3VOEA 4RB3C 4B09A 1FSEA 1X3UA 4Y17A 1HKTA 2XROA 4MHGA 3IRRA 4O5VA 3TDUC 3CUQB 1XDUA 2W57A 2DPUA 4EJTA 1YO5C 1K6OA 1W7PD 3K2ZA 3ECHA 2FBHA 2M5WA 1QBJA 3QAHA 2DPDA 4A0YA 3J80K 3OOPA 1KYWA 4HV6A 3GVAA 3E5QA 1ZRDA 2K7LA 2ETHA 3BJOA 4ZYGA 1I1SA 1ZYRF 2ZFWA 3FXUA 4WWCA 3ZMTA 2ESHA 2A69F 2Z3YA 1AWCA 1JXSA 1O3RA 1P6RA 3DP7A 3L00A 1V3FA 3WGHA 2O61A 5HS7A 3FM3A 1XMAA 1U5TA 1MD0A 2W85A 4G9YA 2HQNA 2RDPA 2FMYA 2XAJA 2QUFA 5FD5A 5E20A 3KP3A 2M30A 2M45A 3GEZA 4RAYA 4L18B 5D8LB 3CJNA 1HQCA 4YFKF 3LAPA 4RGUA 4EJVA 1SD4A 1MZBA 3LSTA 2NS0A 5FD6A 2OBPA 4ESJA 1S3JA 3K1PA 2O0YA 2ADUA 3F8BA 4I2OA 1YYVA 4BXUA 1JE8A 4OIQF 1F4KA 1USSA 2Z99A 2BEOA 4CDGA 1DP7P 1Z9CA 1SFEA 2QENA 2AXLA 3GFIA 2XASA 3J7AO 5FFZA 3ECOA 3BDDA 4GGGA 5D6FA 2H09A 2HZTA 2OA4A 2BYVE 2COMA 2L4AA 3GYHX 2FMLA 2P5VA 4OIRF 6PAXA 1XN7A 5K5QA 4UVBA 2YPRA 3HHGA 1HW2A 4EGYA 3GX4X 4M73A 1I1GA 1YW9A 1U5TC 2A07F 1T6SA 4UXNA 1ULYA 1XMKA 3BPXA 1BJAA 1C0WA 4Q5SF 2XV4S 3JTHA 3K9TA 4A6EA 5E18F 3WTVC 5JI6A 2QBYA 4UNOA 3DQVC 4CGZA 5DD8A 3Q9SA 3OV8A 2QM3A 2G9WA 3WTXC 1LDJA 2V6CA 1FLIA 1GHCA 5E1ZB 1MJAA 3C3WA 1YS6A 5DYMA 3B73A 2RQPA 4ENJA 1O7FA 2KIUA 3U2RA 1IRGA 3RI4A 2K27A 1WKMA 4IXAA 2QQAA 2ZCWA 3N97A 1FYKA 5HDKA 1U5TB 2OU2A 4EV0A 2JZYA 1HW5A 2R7FA 1ZG5A 3MWMA 1PUEE 5L3CA 3F72A 1FYLA 3H3ZA 2PN6A 5LLQA 4A0ZA 1BI0A 1YFHA 2V79A 3F6OA 2GAUA 3KP6A 1IZ1A 4HX4A 1J2XA 5D5XB 4BNCA 2O03A 2JRTA 2K02A 5D4SA 5LGUA 4U7DA 3ZP5A 5HDGA 2HEOA 4A5NA 4AIKA 4EM0B 4LG0A 4ENNA 3C18A 2FOKA 1HSTA 2JPBA 1ZGJA 2F5EA 3KP7A 4PZJA 4P55A 4HLXA 2VOPA 1BI2A 2OAZA 2CSOA 4N0BA 4KN7X 4KNYA 4A0XA 4GO1A 1J7KA 2VXZA 3KP5A 1J9IA 3DEUA 2ISYA 4ENMA 2UZKA 3KLOA 3SZTA 2Q8KA 3ULQB 3HSFA 2E7WA 3TO9A 1QGPA 1J75A 1BIBA 2F5FA 2WTEA 3ISPA 2PMHA 3WTZA 3TOAA 4IJAA 2PFBA 1G3TA 2GA1A 2AS5F 3H92A 4IPAA 2E1CA 1U2WA 2HYGD 3HUGA 2ISZA 1JHFA 1IXSB 3HHHA 2VC0A 4UV8A 5ICGA 1YW7A 4PGHA 4F7ZA 4L9TA 2O6GE 2HTJA 3WU1B 2QBYB 1KU2A 3R6SA 5D8KB 3ZPLA 1HKQA 3V7CA 3RIRA 3SQNA 3CTAA 3FM5A 2F2EA 2FNPA 2ZO4A 4N9IA 2W25A 1ONVA 3BZ6A 3JSPA 3IRQA 3RJPA 4XLNF 1I27A 1W7PA 3WTWC 2G7HA 3RKXA 3WE3A 1G4DA 2ZBKA 3GZ6A 2V1DA 3W6KB 2DK5A 4RAZA 1HXDA 4EVIA 3I5UA 4MQ9F 5BQTA 4ZYHA 3WTUC 3IKVA 4Q48A 1LDDA 1ZHFA 2QZ8A 4ON0A 2MBFA 3KZYA 1JGSA 1XGSA 2LF7A 3QPTA 4AIHA 4G6DA 5JR3A 2VE9A 2CFXA 2DU9A 4PGGA 4HW0A 5HS9A 3W6JB 5DV5A 4LB6B 4MEYF 1EH7A 5D5WB 2FRHA 4G6QA 4BH9A 2XKPA 1ZN2A 2XUBA 3I64A 4BHBA 2VE8A 4L9JA 5AIQA 4U88A 5HVQC 2Y48A 3I0TA 4LLGF 1KQ9A 1TTYA 5EEGA 4UUVA 2VOOA 4GCVA 3JAMZ 4CXFA 2IA1A 1Z05A 3BOQA 2FNAA 4LK1F 4M9SA 5IT9K 1SMTA 2FF4A 2EFNA 5J8CA 2VBYA 3I4PA 3SZPA 1S8NA 4I0AA 2FSWA 1UFMA 1LEAA 1OMIA 1R1VA 1F5TA 3TQNA 1FP1D 2LKPA 5DUIA 4O3MA 4LK0F 4HBLA 1D8KA 3U9GA 4XSXF 4Q47A 2W24A 1REPC 4OIOF 2Q0OA 2LNBA 2HS5A 2X4HA 1E17A 3TO6A 1K79A 4G7OF 1QZYA 1FC3A 3RPQA 2RVCA 4LLNA 4HF2A 2EFOA 1P4WA 4QLCU 3RKWA 1W4MA 1STZA 3B02A 1DUXC 1FOKA 5E17F 4M6YA 2LDUA
chains in the Genus database with same CATH superfamily
3HJEA 3SFIA 1X1BA 5EG0A 2CU7A 3LOCA 4A3BJ 2FQ4A 2XGDA 3QU3A 2LSOA 4BQQA 3W2AA 4P9UA 1BR1A 1Z3YA 2FBIA 2CQNA 2K9LA 3SEZA 2FBKA 3D5SC 4S0HB 5LBQA 5FKMA 3LWFA 4HQEA 1SAXA 1Z6RA 4XRSA 1PP7U 4E70A 1B9NA 3EDPA 4A3LJ 3IC7A 1W7PB 1ZG3A 3PNTA 2QQBA 2X6OA 4A69C 1SFXA 2GM4A 3MZ8A 5CYVA 5H20A 5KK1A 2WB1A 4CA0A 4YIIA 3KLNA 1RIOH 1R5GA 3QU6A 3J81Z 1VQ8I 1S5LC 5F6FA 5FJ8J 5TJJA 4ZDPA 2KT0A 3FXLA 2XSDC 1O3QA 1MDMB 3COAC 4ENMA 4G7ZF 5IP6A 3Q9VA 1MNEA 3O6BB 3ZN0A 1R22A 2DFHA 2LD5A 3VYRB 2DT5A 4BBRJ 1ITYA 4IHWA 2XAFA 5ILVA 1Y0NA 3MMYB 1NTCA 1R23A 2JVHA 2XKOA 4WK8F 3PQJA 3RPUD 1FTTA 3K6GA 2M0CA 2DMTA 5H6RA 2E1MB 2VJ5A 4HNTA 4FX0A 3PO3J 3A03A 4RLQA 2LKSA 2A05A 1ODDA 2WA0A 2YSRA 3DF8A 5EZHA 2GOXB 4GYIA 2WY7Q 1U8BA 2PI0A 1FIAA 1B1BA 1Y1WJ 3S1MJ 3E5XA 3QPHA 3S93A 3V8JA 2V7FA 3HTSB 4B44A 3IH4A 3OL3A 3S2WA 3WG9A 4XSZF 1V4RA 3RSNA 1KYZA 1OYIA 2IVMA 3ASNH 2IRFG 1EV7A 3U1KA 1FNNA 2EV5A 3JSOA 4A5MA 3DWLE 2M7AA 3HYIA 5D6EA 5F04A 3TW6A 1R1TA 3WE2A 1QPMA 4C2UA 4ABZA 2HXIA 3LSHA 4D7NA 3H5NA 3HL2A 4A3IJ 2CH0A 4KUMA 5IYDJ 2HKOA 3ZMSA 1KA8A 5F08A 3GTPJ 3CO7C 2KIFA 1RNLA 5JVTA 3SFZA 3FMRA 4RDUA 3SZGA 3AG1H 5TGTA 2ZXHA 2HNHA 4A3KJ 3DCFA 4E7IA 5E3NA 4UB6C 5EF6A 3FBNB 1L0OC 3ONQA 2BV6A 1Z0XA 2NXNB 3ZQQA 3K7AJ 2DA2A 4HF1A 1Z91A 2P8TA 2IP2A 1B4AA 3BC8A 2EIMH 3ZMDA 2R7RA 1W0TA 2X1DA 2QVOA 3ABKH 4C2TA 3PSFA 3GWZA 3DFGA 3V4GA 4WX9A 2ELKA 2RNGA 4L9NA 1SFKA 1H0MA 2LBFA 3LQRA 5J6XA 2KQRA 2A5YB 1QO0D 2K4BA 3K4JA 5FB2A 5M5YJ 5CVVA 1IUYA 2YS9A 3TW7A 2HI3A 4JBAA 4E7JA 1FPQA 1P4AA 3EYIA 5BPDA 4UVCA 5CJ9A 2VPLA 1Q1VA 4BY1J 1JUSA 4L0ZB 1FJLA 4IZZA 2VN2A 1MKMA 2EIJH 3MQ0A 1DP3A 3S16J 1BA5A 2ACJA 1ETXA 1ZAOA 1PP8F 3G4SI 4DNCA 5EGOB 2R7DA 1V55H 1GDTA 2E1NA 1IAWA 5FKNA 5IT3A 2ELHA 1TBXA 2NVTJ 4XMYA 4NQWA 1WVRA 4KIFA 2HU9A 5LRRA 4D5FA 4U0VA 4KMUX 1S6LA 2MW8A 1CF7B 2E60A 1L3LA 3DPTA 3CF5F 3OIOA 2VIXA 3WTTC 2HOEA 5CVUA 4WXHA 3QQAA 4ENKA 2A6TA 2HFHA 2DK8A 5EG0B 1KU7A 2XAGA 1POGA 1BOAA 3OYHA 3RDIA 2FXAA 4XKWA 3QPLA 4KYWA 5J8FA 2KJCA 3LMMA 4OMYA 2CW8A 1TL8A 4KFCA 4PJLA 4RM2A 1E3HA 3ZXSA 3S32A 2M7BA 3S1NJ 2DBBA 3ZCOA 2QQ9A 5E3MA 4IO9F 2OQGA 1MMNA 2F4OB 1W0UA 3GTGJ 2A6EF 2VXDA 4M9XA 3NARA 3R0JA 2FU4A 3E97A 4BAYA 2L7ZA 2HOSA 2E34A 2M3AA 1OCCH 2G0EA 2IAIA 1ZGAA 2A61A 3O8GA 2R7TA 3ABLH 2MA3A 2F5CA 1JTXA 1N75A 1T56A 1UB9A 2XB5A 3DBLB 2RGVA 1HC8A 1IV8A 1U9OA 3V7SA 3CDHA 3C1DA 5FGMA 2XF6A 1IXRC 1H9TA 5L3DA 5K7HA 1TQIA 1NG7A 5GAHJ 3M8JA 3LA3A 3BR5A 3SXYA 2QYOA 3MZHA 3EPZA 4BQAA 5FRMA 5L3BA 3J7AY 1OLTA 2FQ3A 3ABUA 3AAFA 2KRHA 3CC7I 1MW7A 4A93J 3VYUB 3FDYA 1HKSA 5ICFA 4XLPF 4RB0A 2B7EA 3PFYA 4G6TB 1ORKA 4BXFA 1GVJA 1XMXA 4A2UA 5D5UB 2LY9A 3CCUI 3PUFA 2Y9ZA 4AYBN 2L02A 2FA5A 4P5OA 3F8CA 5HNHA 2W1OA 5C4XJ 2KP6A 1H9GA 2HKXA 2MC3A 1SD5A 2FOWA 5E1XA 4EQQA 3N4MA 5F0CA 2XGXA 2QF7A 1YG2A 3GFJA 5CQEA 4GDFA 1FP2A 2OV7A 3RZOJ 4I98B 3M8EA 2XGCA 3SDGA 3FXKA 4CSWA 2FEZA 2HR3A 3GZNB 5J4VA 1Z21A 2K86A 2Y31A 1HW1A 3D1NI 4CCMA 4IL6C 2EZLA 1MNMC 1W36D 3ZQLA 4FETA 3ZQCA 3KCCA 5GAGJ 1APLC 2F4IA 2AQEA 2VKVA 3V7RA 1WI3A 2VBZA 3HPHA 2YX4A 4CICA 4KICA 1VQNI 1GXPA 4MIMA 3EUHC 2OTJI 1R00A 3ERMA 2QEXI 2CO5A 2FJ1A 1YIJI 3LFUA 1TNTA 1EH8A 1YS7A 2JK3A 5KNLA 2DA4A 4B43A 4A3FJ 1OCTC 3K2AA 3VEPA 5GPCA 1AKHA 5GTIC 4M6VA 3BG6A 1WI9A 3KFWX 3I58A 2OCEA 1AHDP 2K9MA 1KGSA 1O3TA 1UG2A 4M3EA 3HIFA 4UB8C 1YX5A 1ZARA 3CLOA 2R7UA 2VT3A 1RZ4A 1ETKA 3BY6A 1O57A 2DLLA 3QWLA 4EM2A 2GZWA 3KEOA 3VSKA 4C30A 2LREA 1IRXA 1XCBA 1E2XA 1LFUP 4LLLA 4AUXA 4I01A 4BE0A 2VONA 2NNNA 1R7JA 2DW4A 1LNWA 2HXOA 4A3GJ 5JFRA 5L3GA 3KETA 2ZXWH 3KEQA 2R7QA 4AIDA 2L9SA 4JYKA 1YJWI 5HODA 5L3EA 1TZLA 4XOTA 5JVGF 2BY1A 2JPCA 2KIMA 2HYFA 1P7JA 4ETSA 2HGCA 2ZKZA 2X6XA 2XDVA 4Z2YA 1GLNA 3DPLC 4WXCA 2X85A 1TW3A 3CJQB 2EV6A 1OCRH 3B6AA 4L0YB 3AG4H 3KX2A 1D5YA 5LEJA 4RAGA 3DTIA 4BEHB 4YFNF 3F22A 3ELKA 1VQ7I 5JHFA 2EWNA 5DUKA 2R7OA 1ZREA 4CZZA 4KMFA 2XPVA 1B8IB 1X1CA 1O7LA 3FISA 1XGOA 5E79C 2CQQA 4ZJZA 2LYCA 3JW4A 4N9HA 2X1CA 5M5XJ 3RKQA 2I8DA 2JMWA 2LF8A 2ZFUA 4AD9A 5ERIA 5FLVA 1I6HJ 1VQ4I 2DJNA 3QOPA 3ASOH 4IQ4A 1SD6A 2XRNA 1CGPA 1G3SA 3ZMUA 3I56I 3AFHA 5FROA 3PJRA 1FWZA 3I54A 4HSRA 1XSXA 3FXOA 4DQ2A 3MCZA 4AIJA 2ESNA 4MEXF 4EJWA 1UG0A 4S05A 3WGIA 3DLLF 2MC4A 4PSXA 4XONA 1QRYA 5FKLA 5E3LA 1WJCA 2M87A 5C4JJ 3NQOA 2K40A 2MABA 5J3LA 2R7WA 4P96A 1UELB 1VZ0A 3FHNA 1XX5A 3L2UA 4IHSA 2KRFA 2JSCA 4R8HA 2V9VA 1RKTA 2OJED 5IYCJ 5LFAA 3IH2A 3BCAA 2BXYA 3O2PE 4HZFA 2PQ8A 2HQAA 4EEFG 3J7ZI 4BQOA 3H0DA 2CUEA 3FMSA 2Y75A 2L54A 4Y7NJ 2HPMA 2CS3A 2O8XA 1PVEA 2MD0A 1YJNI 2IJLA 3QYBA 4C3IJ 1LEBA 3GMEA 1K4SA 1UHSA 3CC2I 3ML6A 4DZJA 2KFDA 4HAMA 4YIRX 4KJZA 1BN5A 2L9RA 3GTOJ 3M3YJ 1WQ2A 3JAMK 1IDZA 2IA0A 3DTKA 4RB1A 3MAJA 4RS8A 5EJCA 1G6NA 3H9JA 3HZJA 4KIBA 2VL8A 1HF0A 2UWMA 5HDNA 2IPQX 4RA2A 1BL0A 2DMUA 4OMZA 2L7MP 4B4CA 2CQ7A 3ZQ7A 1MDMA 4E7HA 1MBFA 4HOBA 4ZYAA 1F43A 3OYIA 3HKZN 3AG2H 3KE2A 3LA2A 2CV2A 1OPCA 4Y13A 1IDYA 3K69A 3MKZA 2NRAC 4XN0A 2BBYA 2JUGA 3WU2C 4DOZA 4ZTJA 2D5VA 3HOTA 1LFPA 4U0WA 2WV0A 3VDXA 5C44J 5HLGA 1ZTRA 1WH7A 4J01A 1MJBA 4XN3A 1YITI 3OIQA 3TOBA 1VFCA 2R93J 3AL0C 1XDSA 2JN6A 1AKHB 3H0GJ 3H35A 4L9VA 1UAAA 1IXCA 1IN8A 2ECBA 4OWRB 1EA3A 1SAUA 1Y39A 3E5UA 3CCYA 3TO7A 3T8TA 3LSGA 1MMGA 3BR0A 1XPXA 1QPIA 2VODA 1Y8RB 4OOIA 3QP5A 2PMZA 2Y30A 1F1ZA 2V9KA 3QOEA 3N05A 4MTDA 1JKRC 1TNSA 1XCVA 4EMSA 5FLXZ 1WJ5A 2IS2A 5BS6A 3E1SA 2ZMEB 2E1OA 1OISA 2DQRA 2DFEA 1WPKA 2E7XA 3S2DJ 1MNDA 5BNGA 1RPWA 1G3YA 2XIGA 3GFLA 3OR2C 3I53A 3CZ6A 3HTUA 1IO2A 2NS7A 1P7IA 2QSHX 2K85A 5KAIC 1ETQA 3FX3A 5LGTA 2R7ZJ 3DPUA 1SC7A 3HOXJ 3L1PA 3GLXA 5IYBJ 4LMYA 2WAEA 1BC8C 2H1KA 2YU9J 1SANA 2L01A 2VBWA 1KQ0A 1GVDA 3KIOA 4HNVA 2HDDA 4GXOA 2QKMB 5DCMB 4EGZA 3AL0B 1T8IA 2WWYA 1ON2A 1SVMA 1T33A 1IW7F 2YR2A 1OR7C 5LRSA 3LL7A 2JA5J 4LB5A 1MBEA 3U1DA 4IRGA 3GFMA 4ZTFA 3PFIA 2QSGX 4BHCA 2TRTA 3OYMA 5GPAA 1D1BA 1D3YA 5A2QZ 1BM9A 2CW7A 2N8GA 4J00A 3F0CA 5KVRA 3CDIA 5TISC 3OSFA 1D8JA 3FZVA 1R49A 5B66C 4LG3A 2KRCA 3ROUA 3G6EI 4NB5A 2VB6A 5EEHA 3ZMVA 1QVTA 3D0SA 2HWVA 4L5IA 3J81K 2Y0SA 4FTHA 1G3WA 2FD5A 4BHPA 2H94A 5LHHA 5EGOA 2E35A 3HSEA 3RCOA 4O6JA 2LK2A 3MEXA 4J19A 3FWEA 5HOOA 5FRNA 4OAYA 4NDLA 2RN7A 2V1XA 4E7ZA 5K5RA 1XSDA 3FHZA 3E6DA 2DT6A 5DM6F 4KA4A 1CF7A 1Z6TA 4XLEA 2P7CB 3RQIA 1BBYA 3JRAA 2E1MC 3G73A 3W2WA 1T08B 2KJBA 3SDBA 3JRHA 1X19A 3H3UA 4RMNA 1DGRM 3QP6A 2H6BA 1OYWA 3F8MA 5HLIA 5EEAA 3F8FA 3H3VK 4LITA 1YLFA 4A6DA 2P5KA 1FT9A 4MGRA 4LD5A 1ZLKA 5LEKA 1I3AA 1E0EA 4LIUA 3MD2A 2ZXJA 4IHVA 3FKJA 4PJNA 2QKLB 4XLFA 1IG7A 3CUOA 2Y2ZA 4GYGA 3TKYA 2GQQA 2VKEA 4JK1X 4CO8A 1JKPC 2ZSIB 3VFZA 3T1BA 1HCRA 1ZELA 1D5VA 1X1DA 3E6BA 5F1JA 1FOWA 2LC2A 1TP4A 4XIDA 3I4MJ 3LA7A 1FTZA 2K9QA 2MD5A 4S04A 1BI3A 2XPUA 3BZCA 3R4KA 5L3FA 3M8FA 4DBRA 2V1NA 1NHAA 1T98A 2R4GA 4HYEA 3DU6A 3L9FA 1A6IA 1TWHJ 2P0WA 3FKIJ 3G3ZA 2OC6A 3PM1A 3I59B 2HVSA 4KT5C 4KT6A 2LR8A 3HC7A 3K70D 2VLAA 1VQPI 2FE3A 5FLMJ 4OU0A 1E3PA 2F48A 3RYPA 1YIOA 3G1OA 3HOVJ 4B48A 1XGNA 1QHHD 1G59A 1MH4A 3VPRA 1RUNA 1DPUA 2RNJA 4I02A 1HSJA 2R5YB 4I6ZA 3WHCA 1IRFA 3CMAI 4CCLA 4R79A 2XF7A 1R36A 4IHYA 3HRTA 2CWEA 3ZMZA 3G2BA 2OZUA 4F92B 4DYRA 2RAEA 4AYBA 1MH3A 2QA4I 2P4WA 4KITB 2F5DA 2LFBA 3V8LA 1XGMA 4UV9A 3B6CA 5K7FA 3VODA 3KZZA 3H36A 4ZZLA 1USTA 3EQLF 4HQMA 5E8GA 3BLYA 1DDNA 3T8RA 4LGWA 2VQGA 4MNUA 1WFXA 2B63J 3JREA 1JKQC 3IHUA 4HV5A 2QQ8A 4IEJA 3S3NA 2Y69H 2BE5F 5B3SH 2DAOA 2F6CA 2ELJA 3BROA 2Z9OA 4IOCF 3HPGA 1V5EA 4XRFA 2HQRA 3HGGA 4A12A 5JHUA 1BI1A 3UNGC 1FBQA 2VT2A 4HX8A 1HBXG 2LVSA 2DA3A 4AC0A 2OPTA 4G8XA 1AU7A 3GF2A 4CHUA 1B59A 4XORA 4AWXB 3LSJA 1OCZH 1MMDA 1WGXA 3CESA 3S3OA 1IC8A 3CC4I 4MTEA 1Z7UA 2M1BA 2ZJ2A 2E2IJ 4ZZDA 2RV8A 3S14J 4C9YA 2OTLI 4ZH4F 1Z77A 4XKCA 4PUSA 1VQOI 4CCJA 1ZQ3P 1Z7LA 2NAZA 2CUZA 1IN4A 4MO7A 2V1UA 3L2CA 2HOAA 2VJIA 5D4RA 3AG3H 2NOGA 2STTA 1K6YA 2ZNZA 2JVGA 2OZ6A 1HDPA 1J5YA 2R7SA 3E7LA 2NVQJ 2WC2A 2JUCA 1FMVA 3K4CA 1LKXA 2JTVA 3J80Z 3L2VA 3ZQHA 2ZJQF 2Y0MA 4D0PA 2GXBA 5E1WA 1RESA 3WODF 1FBUA 4HRIA 3P7NA 3P9CA 2JWTA 4FHTA 1U6GA 3BG9A 3BP8A 1R1UA 3RQ4A 3K4BA 2P6TA 1YOVB 2DTRA 2EZHA 3HSRA 4PFOA 2ZSHB 1P2FA 1X2NA 3BQYA 3I3LA 3SJMA 5LHGA 1W5SA 3S15J 3CCJI 1RUOA 2MLGA 2PMUA 2H8RA 4HDUA 3HB9A 3EUHA 3JRIA 1ZH5A 1VI0A 3LFKA 2DMNA 4KDPA 2JSPA 3OL4A 2R3SA 2VQLA 2W82A 4K2EA 2M0MA 2A6HF 4YFXF 1JGGA 4JOMA 1A36A 3HOWJ 1XB4A 2R0QC 3AKZA 1B6AA 1IN6A 3FXRA 3HRSA 4YG2F 5F0FA 2M8EA 3BCBA 2LY1A 3GUDA 1AA7A 1X1PA 1ENHA 5K5OA 5J4YA 1MMSA 3I71A 3BG7A 4MFDA 5ILSA 3TL4X 3IWZA 1ZG1A 4BEHA 3IAM2 3FBIB 4XM3A 2EFWA 3S1QJ 2GXGA 4F91B 3KYDB 2DN0A 1IGNA 2F4MB 4MFEA 1B8IA 1T2KA 1B9MA 2CG4A 2CW0F 2XAHA 3M1EA 1Z1DA 5LD2C 2EA2A 3LSMA 4JP0A 4IF4A 4E4HA 2GXAA 3EETA 2K9SA 3Q3SA 4B8XA 1LE8B 5E8IA 2D1HA 3P9IA 2ME6A 5M3FJ 3HM5A 3VB2A 2CGPA 1WWXA 2DDAA 3HEFA 3M7GA 1F36A 1MIJA 4DBQA 3CLQA 2EQRA 1K83J 2BY2A 2EBIA 1YX3A 3S1RJ 4BACA 1SFOJ 2O3FA 3K4LA 1IJWC 1WH5A 3DTEA 2P5LC 4I99C 3D5RC 4X1EA 2IXSA 3JR9A 1O3SA 1QU3A 3TP0A 4NHJA 3BJ6A 1YRNB 1TLHB 3GXOA 2H6CA 4BY7J 2YUSA 3BTIA 2IGKA 1R5HA 1B72B 2M4GA 3S2HJ 1K78B 2VJJA 2COBA 2BY0A 3IAS2 2AHQA 3LSIA 2OQRA 3ERED 5HLHA 2YU3A 2GA2A 1SD7A 1WSUA 4D9JA 4G7HF 1KU3A 1G8XA 2DT7B 1A6QA 3BTCA 4ZYEA 2JA7J 2E2JJ 2EB7A 4XLAA 1UHWA 3K0LA 4AM3A 1XG1A 2W4SA 1TW2A 3GCMA 2ID6A 1OFCX 3E6MA 1MGTA 2ZC2A 2LOOA 2OD5A 4M71A 2Z5UA 1J59A 3R0AA 1LUJB 3EUKL 4BKXA 5TRDA 4FT8A 2VQHA 3F21A 1ZR2A 1JHHA 1WRJA 3L7WA 1OCOH 3FF5A 4XKVA 2BGCA 4OINF 3HOUJ 2XAQA 4UHTA 4Y15A 4U0YA 1K7AA 1YW8A 1M1EB 1HA8A 3C7JA 2M34A 3A0BC 4KIGA 2QLZA 2B0LA 3DKYA 1H8AC 3OY9A 1ON1A 1YTYA 3HRUA 1MJ9A 3P9KA 5J40A 1PYVA 4EATA 2W48A 3A4CA 4NUBA 2J5PA 3QYFA 1U78A 2R92J 2XHKA 1UCRA 3LQQA 1V54H 4E6KG 2H27A 1FY7A 3K1NA 4V2GA 2PLYA 3KPHA 3KP2A 4M9ZA 4C3HJ 1W5CC 3BJAA 5ICCA 3QRFF 2LTPA 2WAQA 4NC6A 2GIZA 2P7VB 4LFUA 3VYTB 2W84A 2VKDA 1IN5A 3JCUC 4IRIA 3OYNA 1GV5A 3I55I 1JT0A 4ZDOA 1K61A 3UKGA 1G2HA 4Y4RA 4ESBA 3WG7H 3RKYA 4HDVA 1VNDA 3HDDA 1A04A 1MBHA 1F9NA 4AVPA 4PJJA 4I0BA 1IF1A 5M3MJ 2A5WA 2DA6A 3DXJF 3RTRA 4ESFA 1PUFB 1R4MB 2K4JA 3PQKA 1BOBA 1BW6A 2A3SA 2D1VA 3KEYA 4RGSA 2STWA 1OKRA 1LJ9A 1DU6A 2KISA 4R1HA 5DCFA 4HLYA 3BQZA 2ZMEA 5F0HA 4CZCA 5IP7J 4G12A 3DKXA 2E71A 3MZYA 3WGGA 2HTSA 3IP4B 3SHFA 3F3XA 3IWFA 2HOTA 5LGNA 1RC9A 1RKWA 3F8NA 3R60A 4HF0A 4XICA 3IKTA 1RI7A 1BR2A 2XPWA 1SFUA 4A3CJ 4G94A 3K1MA 1IN7A 4ZDLA 3ZN1A 5DCMA 4P9FA 3W3CA 3SYTA 1WJDA 1X2MA 4M6XA 1RETA 2X6WA 3GZ5A 3DKWA 4IRHA 1XD7A 2XB0X 2W7NA 2L4MA 1QA6A 3J7YJ 4X6AJ 1BC7C 2VC1A 3OYBA 2M9HA 1ZRCA 1XSVA 4BU2A 1T39A 1T38A 3WHBA 1GV2A 3ABTA 1U0JA 4DYQA 2HVQA 4RGXA 2DI3A 3OYDA 3OMYA 5KAFC 2O8KA 1FSHA 4CUGA 5CLSA 1LFBA 3G1LA 5K1YA 4UUSB 3CMYA 3R61A 3KP4A 2E19A 2BXZA 3W6VA 1FIPA 1QQIA 3C2HA 1R5ID 2L2OA 2PJRB 1FBSA 4IKFA 2EK5A 2UXXA 4EM1A 2ZJPF 2PBIA 2NYXA 4BBSJ 4Q4ZF 4ANJA 4F93B 1I6XA 2EV0A 3Q0UA 4WF2A 1IRZA 5IPAA 2RKHA 1DPRA 5CVIA 5AONA 1U3EM 2DFIA 3CMMA 1S72I 3DLAA 3KYLA 1XS9A 1WZ2A 1OYYA 1ACIA 4XR6A 4IX7A 1OR7A 1EKEA 2D2WA 1MBKA 4XQFA 1AOYA 1J0RA 4QPOA 4H0EA 4QTRA 3MFKA 3RPUA 2M2EA 3OYEA 4L5JA 1V5GA 4ASNA 3GTKJ 1R6RA 2PEXA 1R9TJ 3LAJA 5BPIA 4PJMA 1X4PA 3WTSC 5BOXA 4QWQA 2AXTC 1YJ9I 5FLXK 3F23A 2ZMEC 4B47A 1QNTA 4M72A 3JTGA 4I76A 3DV8A 2IT0A 3HOSA 1ERDA 2L9NA 1BR4A 5LHIA 1S7OA 3ABMH 2G7UA 1LB2A 1NG6A 1W5TA 4CYDA 5DDGA 2IW5A 2X0LA 3I59A 3RYRA 5J1UA 2MH9A 1YE9A 2JT1A 4OIPF 2UXNA 3ZRGA 4XBFA 3D5LA 3ZGKA 1R58A 3F6VA 5H6QA 3A01B 3CCLI 5ED4A 3WU0A 4HX7A 1W1WE 1KONA 4I7HA 5F1RA 4FX4A 1JUMA 2P6SA 1S29A 2KMUA 3ESWB 4UVAA 4WXDA 2R5YA 2VBXA 1LQ1A 4PSWA 5D5VB 4FQGA 1I3QJ 1LDKB 2DODA 3A02A 5CPRB 2XVCA 3JRDA 2E2HJ 2PJPA 2IA2A 2CQKA 3FK6A 2EA4A 2ID3A 1FEXA 4E7KA 2DMPA 4PCQA 3CUQA 2LH9A 1P4XA 1QHGA 4BDYA 3OYFA 1EH6A 4QIWN 5A2QK 3BTLA 5BMZA 4MQVA 2CYYA 2WV1A 3H1CA 2QWWA 2EFPA 1P92A 4NNJA 4RM3A 2V9PA 1CQTA 5FFXA 3IL2A 3FK7A 2ZNYA 5DD4A 2LKXA 2DO7A 1I5ZA 1Y0UA 3T5XA 4U7BA 1ZRFA 2Q2EA 1QZZA 4BYYA 2NVXJ 2TDXA 3L09A 2NNYA 3Q5FA 1YQAA 4M3DA 5DS9A 1KU9A 4IHTA 2PX9A 5EDNA 2YX7A 3GO5A 2DQLA 4C2MJ 3JRBA 4IQJA 1PDNC 4F55A 3QODA 5IP9J 4YIFA 4M74A 3OYJA 2CFOA 4LG0B 1SMYF 2NVYJ 1GXQA 3REOA 3NRVA 2CUFA 3FXQA 3T0YA 2MLKA 3DEWA 3M9AA 2HDCA 4JQFA 1EF4A 2EFQA 5CVRA 3K70C 2AQFA 3G1MA 1YI2I 5IY5H 3OYKA 2DA1A 3TGNA 3PIPF 3C2GA 3CCVI 1FZPB 1OQYA 3DEEA 4HEA2 4HA8A 4FCYA 2EPFA 4W97A 4D7MA 2MH2A 1S7AA 3HRMA 2KLOA 1VTNC 4FE7A 1LPQA 4WCGA 4ZYDA 3ZOBA 3FMQA 1A31A 2DOAA 3H5AA 2J5OA 1S7EA 5CVJA 5J47A 2GWRA 3BPVA 1ZK8A 4C3JJ 4F52A 4N4OB 2TCTA 5FO5A 1DGWY 4CCKA 1TQMA 3GW2A 2RC4A 5C3EJ 5IT9Z 2IBDA 3BR3A 5DEQA 3F9KA 1FOXA 3TDZC 3E6CC 4RGRA 1BIAA 5FKKA 1KZHA 3HUGB 4EJUA 1ETWA 4ITVA 5HS8A 1JJ6C 2XF5A 4RB2C 4BE2A 3WTYC 3CO6C 5J1YA 1U9NA 3K4KA 1T0FA 2Z33A 4V2FA 1FX7A 2ECCA 2GIVA 5F64A 4KISA 3NEUA 4NBQA 3MVPA 5ICEA 2KZVA 1Y1VJ 2NS8A 2DCEA 2XGEA 3CUQC 4TV7A 1VQMI 1UHMA 3BWGA 2PG4A 3O3KA 1X3WB 5F27A 3VWBA 2E36A 2O9LA 1LVAA 1QZEA 2UV1A 1FYMA 1TT5B 3PNVA 1TQPA 2C6YA 2EILH 2M8GX 1H89C 1LE8A 2L3DA 2R7VA 3V8KA 1Q1HA 4I09A 4BS9A 1HOMA 1U8RA 2D45A 3VYSB 3MN2A 3CF2A 2WBMA 2OF7A 3ZR8X 4KN4X 2A68F 1VQ6I 1JI8A 2EJRA 2AO9A 2EIKH 3A1YA 4EJOA 4PDKA 2MGQA 3E3VA 4XL9A 5ILUA 1KQ8A 2QSFX 2R5ZB 1ZLJA 2IGNA 4LJZF 3RZDJ 1GUUA 1YRNA 2ZB9A 5AIPA 3CCMI 2KKOA 1E3OC 3EYYA 1B72A 4UUTA 2R7XA 4Z6YA 4X0GA 1K78A 1RR7A 2LY2A 3FXMA 4IVNA 3CDLA 3VOEA 4RB3C 4B09A 1FSEA 1X3UA 4Y17A 3LSPA 1HKTA 3S3MA 2XROA 4MHGA 3IRRA 1A35A 4O5VA 2L0KA 3TDUC 3CUQB 3MKYB 2ICWG 3OSGA 4BUPA 4XRSG 2BY3A 1XDUA 2V4JC 2W57A 2DPUA 4M3GA 4EJTA 3FXJA 1YO5C 1K6OA 3CD6I 1W7PD 3M4OJ 3K2ZA 3ECHA 2FBHA 2M5WA 3H9GA 2XAUA 1UJ8A 1A5JA 1QBJA 3H5RA 3QAHA 1FMWA 2DPDA 2MSYA 3V42A 4A0YA 3CMEI 3J80K 2EINH 1KYWA 3OOPA 5J1RA 2Q1ZB 2XC7A 4HV6A 3GVAA 3E5QA 1ZRDA 4M3BA 2K7LA 2LLKA 2ETHA 3BJOA 1VQLI 2Q2EB 2QCOA 4ZYGA 2O7OA 2Y9YA 1I1SA 1ZYRF 1WCMJ 2ZFWA 3FXUA 2ESHA 3ZMTA 4WWCA 2A69F 3OS2A 3IV5A 2DYSH 2Z3YA 1SEUA 4FISA 4FE4A 1AWCA 1JXSA 4JX5A 3ZQIA 2HDWA 2PMZN 4UY8I 1O3RA 2X9DA 3CP8A 3PL8A 3LSKA 1P6RA 1FOYA 3OWTA 3DP7A 3L00A 1V3FA 4NC7A 3WGHA 4DJAA 2O61A 3A2KA 3OS0A 3MKLA 5HS7A 3FM3A 3OYAA 1XMAA 1T0FC 2K9NA 1U5TA 1MD0A 3GLLA 5KHDA 2W85A 4G9YA 2HQNA 2RDPA 3JRGA 3ZQFA 2FMYA 2VASA 2XAJA 2QUFA 2FX0A 3PIOF 5FD5A 5E20A 3DBHB 3KP3A 2M30A 2KPMA 2M45A 5HNFA 2X51A 4PFPA 1JJ8C 1WJFA 3GEZA 1VQKI 2X6YA 1XC5A 4RAYA 2Z16A 1BW5A 2BW3B 3HG9A 1PUFA 4BL0B 4L18B 3EUAA 5D8LB 4DIQA 3CJNA 1HQCA 4YFKF 1ZKGA 3BG3A 3LAPA 4RGUA 4EJVA 1WHUA 1SD4A 1MZBA 2IGOA 3LSTA 2DA7A 2NS0A 5FD6A 2IS4A 2OBPA 2GOMA 4ESJA 1S3JA 2UUZA 3K1PA 4HNUA 1ETOA 2O0YA 5E3OA 2ADUA 5HLTA 3F8BA 5K7ZA 4I2OA 1V5FA 1YYVA 2OUMA 4BXUA 1JE8A 4QPQA 3HBLA 3OOUA 4CYCA 4OIQF 1F4KA 1USSA 2Z99A 2BEOA 4M3FA 4CDGA 1DP7P 1Y8QB 2IEKA 1Z9CA 1SFEA 4FASD 4DGWB 4A3JJ 4YRVA 3PNYA 2KL4A 2RQQA 4QSHA 2QENA 1W36C 2Y0SN 4BJ6C 4XLCA 2AXLA 3OYGA 4OAZA 5JLXA 3MKWB 3U21A 2KDOA 2O5RA 3OR1C 3K10A 2CJJA 3GFIA 1P9QC 2LG4A 2P81A 2XASA 3J7AO 5FFZA 5FKOA 2DOFA 4A3DJ 2NOJB 2V26A 3ECOA 4JX6A 3BDDA 1DQUA 1JUPA 4GGGA 5D6FA 2H09A 4IOAF 2HZTA 2KDZA 2OA4A 2WAFA 2BYVE 3HGYA 1NH3A 2COMA 2L4AA 2ZXIA 3GYHX 4UUSA 2FMLA 2P5VA 2IS6A 4OIRF 2EZKA 4XK4A 2PJRA 6PAXA 2MYSA 1XN7A 5K5QA 2B9SA 4UVBA 3CCQI 2YPRA 4BQNA 1WJAA 3HHGA 2JA6J 2WY8Q 1HW2A 4EGYA 3GX4X 4M73A 1I1GA 4CH7A 1YW9A 2WB1N 2CUJA 4AU7A 3CCEI 4JX4A 1U5TC 2A07F 1T6SA 2BVLA 4UXNA 2RREA 3A0HC 1ULYA 1I39A 3SEQA 1VQ5I 1XMKA 3BPXA 1BJAA 1C0WA 3KYCB 5GP9A 4Q5SF 2XV4S 3JTHA 1Z67A 2OCCH 3K9TA 4A6EA 5E18F 3WTVC 1TWAJ 2X48A 1ETVA 5JI6A 2QBYA 4UNOA 3DQVC 4CGZA 5DD8A 3Q9SA 4P1WA 3OV8A 2DJIA 2QM3A 3CP2A 2DA5A 2LP0A 2G9WA 3NWSA 1D0XA 3WTXC 1LDJA 2V6CA 1FLIA 1GHCA 2X1EA 3HKZA 5E1ZB 2VJ4A 4HPQA 1T95A 1N78A 1MJAA 3C3WA 3S8PA 1YS6A 3IUOA 5DYMA 2LMDA 3B73A 4XKBA 2RQPA 4ENJA 5CKTA 1O7FA 2KIUA 3U2RA 2L9VA 4CCNA 1IRGA 2L7KA 3RI4A 4BDZA 2K27A 1WKMA 1N77A 4IXAA 2BHYA 2QQAA 5DTDA 2KZGA 1D1CA 4XLHA 2ZCWA 3N97A 1FYKA 1Y6IA 5HDKA 1U5TB 2OU2A 1R71A 4EV0A 1HDDC 2CV0A 2K3FA 3K4NA 1JT6A 2JZYA 1HW5A 2R7FA 3Q0WA 1ZG5A 3MWMA 4IHXA 1PUEE 3CQZJ 5L3CA 3F72A 3OYCA 3LSRA 1MSFC 1FYLA 3H3ZA 2PN6A 4PK4A 4A3MJ 2EH3A 1ZR4A 3H9QA 1O4XA 5LLQA 4A0ZA 3O8HA 4MLOA 1BI0A 3NWTA 1YFHA 1PJRA 2V79A 1UMQA 3F6OA 4XNFA 2GAUA 3UR3C 3KP6A 2LBFB 4AVZA 1IZ1A 4HSTA 2QGUA 4HX4A 3VSLA 4H4KC 1J2XA 5D5XB 4YELA 4BNCA 3HOZJ 3L2RA 2O03A 2JA8J 2JRTA 2K02A 4NC8A 1MSEC 5D4SA 5LGUA 4U7DA 2K5CA 4II3A 4CYCB 1ZGWA 3ZP5A 2VQCA 3GTMJ 3ZQGA 5HDGA 3BTJA 2HEOA 4A5NA 1DU0A 1N25A 1UZCA 4AIKA 4EM0B 3BZKA 2HPIA 4NQWB 4LG0A 4ENNA 3C18A 2FOKA 3KZIC 1HSTA 2JPBA 2LRDA 1ZGJA 2F5EA 3KP7A 4PZJA 4P55A 4HLXA 2VOPA 4Y3OA 1MMAA 1BJZA 1BI2A 1JKOC 1IV6A 2CMPA 2FUG2 2OAZA 2CSOA 3OYLA 4N0BA 2DDBA 4KN7X 5EYRA 3GTJJ 4XRMA 4KNYA 4A0XA 2DTZA 4GO1A 1J7KA 2VXZA 2Z1DA 3S17J 1XTAA 3BT9A 3KP5A 1J9IA 3DEUA 5GAEJ 2ISYA 4D1QA 2F5VA 4ZC3A 3L2WA 3KLOA 2UZKA 2ZJRF 1D0YA 3SZTA 2Q8KA 3ULQB 5H2FC 2V6EA 3I4NJ 3HSFA 2E7WA 3TO9A 3CCSI 4A3EJ 1QGPA 1NK3P 1J75A 1BIBA 4D5CA 2F5FA 2WTEA 2XRLA 3ISPA 3QYEA 1TWFJ 2PMHA 1MBGA 2M4KA 3BR2A 4W1UA 3WTZA 3TOAA 2IGMA 4Y52J 1X3ZB 3M07A 1GT0C 4IJAA 3OS1A 2PFBA 1G3TA 3HXLA 2GA1A 2AS5F 3BR1A 3H92A 4IPAA 2E1CA 1U2WA 4BE1A 1H88C 2HYGD 3HUGA 4PJ0C 4GRIA 5IOYA 2ISZA 1X1AA 2K3PA 1JHFA 1MBJA 2BZTA 1VQ9I 1R4NB 4BJTA 1IXSB 4U87A 4CCOA 2BHZA 3HHHA 2VC0A 4UV8A 5ICGA 5GADJ 1YW7A 4PGHA 1SVLA 4F7ZA 2CRGA 2W00A 2H1LA 4L9TA 1QVUA 1NK2P 2O6GE 2HTJA 2DFFA 3CJTB 3L2QA 3DBRB 3WU1B 1VF9A 1RRJA 1TC3C 2QBYB 2CV1A 3A01A 2L7FP 1KU2A 3R6SA 5D8KB 3ZPLA 1HKQA 3V7CA 3RIRA 3SQNA 3IH3A 3CTAA 2E5NA 3FM5A 1OCPA 2HQ5A 2F2EA 5JLWA 4RLFA 2FNPA 2GLOA 2ZO4A 4BXXJ 4N9IA 2W25A 3PUBA 1ONVA 3BZ6A 3JSPA 3IRQA 3RJPA 2MFZA 5DM7F 4XLNF 1I27A 1W7PA 2G7HA 3RKXA 3WTWC 3WE3A 1G4DA 2VPRA 2ZBKA 3GZ6A 2V1DA 3OIPA 3W6KB 1Y56A 2DK5A 3TBIA 2R5ZA 4RAZA 1HXDA 2HVRA 5CQGA 4EVIA 3I5UA 4MQ9F 5BQTA 3GTQJ 2ME0A 3E0JB 4ZYHA 4BGDA 3WTUC 3IKVA 4Q48A 2L5QA 1LDDA 1OJLA 1RR8C 1ZHFA 2QZ8A 4ON0A 2EZIA 2MBFA 3KZYA 1JGSA 1XGSA 2LF7A 2JJ7A 3QPTA 4L5EA 1ETYA 4DZPA 2KIQA 4AIHA 4G6DA 1WJEA 5JR3A 2VE9A 3JRFA 2CFXA 2DU9A 4RBOA 4PGGA 4HW0A 5HS9A 1IUFA 4LIVA 3DU5A 3W6JB 5DV5A 1LVKA 4LB6B 1X4OA 4N4NB 1EJ9A 2E5ZA 4MEYF 1EH7A 5EZGA 2VKHA 3X2QH 5D5WB 2FRHA 4G6QA 2VI6A 2DXIA 2DYRH 4BH9A 2XKPA 1ZN2A 2XUBA 3I64A 4BHBA 2HYJA 2VE8A 4L9JA 2WAQN 1D1AA 5AIQA 5B1AH 4U88A 5HVQC 2Y48A 3NAUA 3I0TA 4LLGF 1HLVA 3M1CA 1KQ9A 1TTYA 5EEGA 1X58A 2NVUB 3JRCA 4UUVA 2VOOA 4GCVA 3TMOA 3JAMZ 2CQXA 4CXFA 2IA1A 3I9V2 3LNQA 1Z05A 3BOQA 2FNAA 4LK1F 4M9SA 3CCRI 5IT9K 1SMTA 2FF4A 2EFNA 4DW6A 4GFBA 2I5UA 5J8CA 1TWCJ 2VBYA 3I4PA 4YEJA 3SZPA 4RAFA 4Y33A 1S9HA 4HG2A 1S8NA 4I0AA 4DYCA 2FSWA 1UFMA 3GTLJ 1LEAA 1OMIA 3BR6A 2H8WA 1R1VA 1F5TA 3TQNA 1FP1D 2I10A 2LKPA 2VUMJ 5DUIA 4O3MA 2XSJC 3Q0VA 4LK0F 2BW3A 4HBLA 1D8KA 3BG5A 4B3XA 5IOZA 5B1BH 2GBYA 2JA2A 3U9GA 5KCMA 1K4TA 9ANTA 2JRMA 4XSXF 4Q47A 3G71I 4V19K 2W24A 4E7LA 4II2A 4E7SA 1JTYA 2JQ7A 1REPC 3GBGA 1I50J 2KHMA 3K4MA 3PO2J 1YHQI 2BVMA 4OIOF 2Q0OA 2MG4A 5GTHC 3P5JA 1J09A 2HS5A 1Z3XA 2LNBA 2X4HA 4F3QA 1E17A 1WJBA 1SVOA 3TO6A 1K79A 1TT0A 4G7OF 3W2VA 1QZYA 1FC3A 3RPQA 1D0ZA 2RVCA 2DMQA 4LLNA 4HF2A 1TWGJ 4XOPA 3TEDA 2IS1A 2EFOA 3CJRB 4LOCA 1P4WA 3TP3A 3C2BA 2Z2SB 4QLCU 4B1RA 3RKWA 4B3AA 2HZDA 2WADA 2DOEA 4BJ5C 1W4MA 1STZA 5B5EC 3B02A 3FIWA 1DUXC 3HOYJ 1FOKA 5E17F 5M5WJ 3PSIA 2BOLA 3QPSA 4M6YA 2LDUA
chains in the Genus database with same CATH topology
3QU3A 2LSOA 4P9UA 2FBIA 2FBKA 5LBQA 3LWFA 4HQEA 1SAXA 1Z6RA 1PP7U 4E70A 1B9NA 3EDPA 3IC7A 1W7PB 1ZG3A 2QQBA 1SFXA 5CYVA 5H20A 5KK1A 4YIIA 3KLNA 1RIOH 1R5GA 3QU6A 3J81Z 5F6FA 5TJJA 1O3QA 1MDMB 3COAC 4G7ZF 3Q9VA 3ZN0A 3O6BB 1R22A 2DT5A 2XAFA 5ILVA 1R23A 2XKOA 4WK8F 3PQJA 5H6RA 4FX0A 2YSRA 1ODDA 3DF8A 4GYIA 2PI0A 1B1BA 3E5XA 3QPHA 3V8JA 3HTSB 3S2WA 3WG9A 4XSZF 1V4RA 1KYZA 1OYIA 2IVMA 2IRFG 1EV7A 1FNNA 2EV5A 3JSOA 4A5MA 3HYIA 5D6EA 1R1TA 3WE2A 1QPMA 4KUMA 2HKOA 3ZMSA 1KA8A 3CO7C 2KIFA 1RNLA 5JVTA 3SFZA 3FMRA 1L0OC 2BV6A 4HF1A 1Z91A 2P8TA 2IP2A 1B4AA 3ZMDA 2QVOA 3GWZA 3DFGA 3V4GA 4WX9A 4L9NA 1H0MA 3LQRA 5J6XA 2A5YB 1QO0D 2K4BA 5FB2A 1IUYA 5CVVA 4JBAA 1FPQA 1P4AA 3EYIA 5BPDA 4UVCA 5CJ9A 4L0ZB 2VN2A 1MKMA 3MQ0A 2ACJA 1ZAOA 1PP8F 4DNCA 2R7DA 2E1NA 1IAWA 5IT3A 2ELHA 1TBXA 4NQWA 4KIFA 5LRRA 4U0VA 4KMUX 1S6LA 1CF7B 1L3LA 3DPTA 3WTTC 2HOEA 5CVUA 4WXHA 4ENKA 1KU7A 2HFHA 2DK8A 2XAGA 1BOAA 3RDIA 2FXAA 4KYWA 5J8FA 2KJCA 4OMYA 4KFCA 2DBBA 2QQ9A 2OQGA 2A6EF 4M9XA 3R0JA 2FU4A 3E97A 4BAYA 1ZGAA 2A61A 2MA3A 2F5CA 1UB9A 2RGVA 3V7SA 3CDHA 3C1DA 5FGMA 1IXRC 1H9TA 5L3DA 1TQIA 3LA3A 3SXYA 3MZHA 2QYOA 4BQAA 5L3BA 2FQ3A 3ABUA 3AAFA 1HKSA 5ICFA 4XLPF 4RB0A 1GVJA 4A2UA 5D5UB 2L02A 2FA5A 4P5OA 3F8CA 1H9GA 2HKXA 2MC3A 1SD5A 5E1XA 4EQQA 3N4MA 2XGXA 1YG2A 3GFJA 1FP2A 4I98B 3M8EA 2FEZA 2HR3A 2K86A 1HW1A 3KCCA 3V7RA 2VBZA 4CICA 2YX4A 4KICA 1GXPA 1R00A 2CO5A 1TNTA 1EH8A 1YS7A 3VEPA 1WI9A 3KFWX 3I58A 1KGSA 1O3TA 3HIFA 1ZARA 3CLOA 2VT3A 1RZ4A 3BY6A 1O57A 2DLLA 4EM2A 2GZWA 3KEOA 1XCBA 1E2XA 4LLLA 4I01A 2VONA 2NNNA 1R7JA 2DW4A 1LNWA 5JFRA 5L3GA 3KETA 3KEQA 5L3EA 2JPCA 2KIMA 2HYFA 4ETSA 2HGCA 2ZKZA 4Z2YA 3DPLC 4WXCA 1TW3A 2EV6A 4L0YB 5LEJA 4YFNF 3F22A 3ELKA 2EWNA 5DUKA 1ZREA 4CZZA 4KMFA 1O7LA 1XGOA 3JW4A 4N9HA 2LF8A 4AD9A 5ERIA 3QOPA 1SD6A 2XRNA 1CGPA 1G3SA 3ZMUA 1FWZA 3I54A 1XSXA 4DQ2A 3MCZA 4AIJA 2ESNA 4MEXF 4EJWA 4S05A 3WGIA 2M87A 3NQOA 4P96A 4IHSA 2KRFA 2JSCA 4R8HA 2V9VA 3O2PE 4HZFA 2PQ8A 3FMSA 2Y75A 2L54A 2O8XA 2IJLA 1LEBA 3ML6A 4HAMA 1BN5A 1WQ2A 3JAMK 2IA0A 4RB1A 3MAJA 4RS8A 1G6NA 4KIBA 2UWMA 5HDNA 2IPQX 4OMZA 3ZQ7A 1MDMA 4HOBA 3KE2A 3LA2A 1OPCA 4Y13A 3K69A 2NRAC 2BBYA 3HOTA 4U0WA 2WV0A 5HLGA 1MJBA 3TOBA 1XDSA 4L9VA 1IXCA 1IN8A 3E5UA 3TO7A 3T8TA 2VODA 4OOIA 3QP5A 1F1ZA 4MTDA 1TNSA 1XCVA 4EMSA 5FLXZ 5BS6A 2ZMEB 2DQRA 2E7XA 1G3YA 2XIGA 3GFLA 3I53A 3HTUA 3FX3A 5LGTA 3GLXA 4LMYA 1BC8C 2L01A 2VBWA 1KQ0A 4GXOA 5DCMB 4EGZA 2WWYA 1ON2A 1IW7F 2YR2A 5LRSA 4LB5A 3U1DA 4IRGA 3GFMA 3PFIA 4BHCA 1D3YA 5A2QZ 1BM9A 5KVRA 1D8JA 3FZVA 3ROUA 4NB5A 5EEHA 3ZMVA 3D0SA 2HWVA 4L5IA 3J81K 1G3WA 4BHPA 2H94A 5LHHA 3HSEA 4O6JA 3MEXA 3FWEA 5HOOA 2RN7A 2V1XA 5K5RA 1XSDA 3FHZA 3E6DA 4KA4A 1CF7A 1Z6TA 2P7CB 1BBYA 3G73A 2KJBA 3H3UA 3QP6A 2H6BA 1OYWA 3F8MA 5HLIA 3F8FA 4A6DA 1YLFA 2P5KA 1FT9A 4MGRA 4LD5A 1ZLKA 5LEKA 2ZXJA 3CUOA 4GYGA 3TKYA 2GQQA 4JK1X 4CO8A 3VFZA 3T1BA 1D5VA 3E6BA 3LA7A 2MD5A 4S04A 1BI3A 3R4KA 5L3FA 3M8FA 1NHAA 1T98A 4HYEA 3L9FA 3G3ZA 3I59B 4KT5C 2FE3A 4OU0A 3RYPA 1YIOA 1XGNA 1RUNA 1DPUA 2RNJA 4I02A 1HSJA 1IRFA 4R79A 1R36A 3HRTA 2CWEA 3ZMZA 2OZUA 2P4WA 2F5DA 3V8LA 1XGMA 4UV9A 3VODA 3KZZA 4ZZLA 1USTA 3EQLF 4HQMA 5E8GA 1DDNA 3T8RA 4LGWA 4MNUA 3IHUA 4HV5A 2BE5F 2DAOA 3BROA 2Z9OA 4XRFA 2HQRA 4A12A 5JHUA 1BI1A 1FBQA 2VT2A 4HX8A 1HBXG 4G8XA 4CHUA 3GF2A 1B59A 4AWXB 4MTEA 1Z7UA 2M1BA 2ZJ2A 4ZZDA 2RV8A 4ZH4F 2V1UA 2NAZA 1IN4A 3L2CA 5D4RA 2STTA 2ZNZA 2OZ6A 1J5YA 2WC2A 2JTVA 3J80Z 2Y0MA 4D0PA 2GXBA 5E1WA 3WODF 1FBUA 3P7NA 3P9CA 4FHTA 1U6GA 3BP8A 1R1UA 2P6TA 2DTRA 3HSRA 1P2FA 5LHGA 1W5SA 1RUOA 2MLGA 2PMUA 4HDUA 3EUHA 1ZH5A 3LFKA 4KDPA 2R3SA 4K2EA 2A6HF 4YFXF 1XB4A 1B6AA 1IN6A 3FXRA 3HRSA 4YG2F 2M8EA 3GUDA 5K5OA 3I71A 5ILSA 3IWZA 1ZG1A 2EFWA 2GXGA 1T2KA 1B9MA 2CG4A 2CW0F 2XAHA 3M1EA 1Z1DA 2EA2A 4IF4A 3EETA 4B8XA 5E8IA 2D1HA 3P9IA 3VB2A 2CGPA 1WWXA 3M7GA 2O3FA 2P5LC 1O3SA 4NHJA 3BJ6A 1TLHB 3GXOA 2H6CA 1R5HA 1K78B 2OQRA 3ERED 5HLHA 2YU3A 2GA2A 1SD7A 1WSUA 4G7HF 1KU3A 4ZYEA 2EB7A 1UHWA 3K0LA 1TW2A 3E6MA 1MGTA 2OD5A 4M71A 2Z5UA 1J59A 3R0AA 5TRDA 4FT8A 3F21A 1JHHA 1WRJA 3L7WA 3FF5A 2BGCA 4OINF 2XAQA 4UHTA 4Y15A 4U0YA 1K7AA 1YW8A 3C7JA 4KIGA 2QLZA 2B0LA 1ON1A 1YTYA 3HRUA 1MJ9A 3P9KA 2J5PA 1U78A 2XHKA 1UCRA 3LQQA 2H27A 1FY7A 3K1NA 2PLYA 3KP2A 4M9ZA 3BJAA 5ICCA 3QRFF 2P7VB 4LFUA 2W84A 1IN5A 4IRIA 4ESBA 3RKYA 4HDVA 1A04A 1F9NA 4AVPA 1IF1A 4I0BA 3DXJF 3RTRA 4ESFA 2K4JA 3PQKA 2A3SA 2D1VA 4RGSA 2STWA 1OKRA 1LJ9A 4R1HA 5DCFA 4HLYA 2ZMEA 3MZYA 3WGGA 2HTSA 3SHFA 3F3XA 3IWFA 5LGNA 3F8NA 3R60A 4HF0A 3IKTA 1RI7A 1SFUA 4G94A 3K1MA 1IN7A 3ZN1A 5DCMA 4P9FA 4M6XA 3GZ5A 3DKWA 4IRHA 1XD7A 2L4MA 1BC7C 2VC1A 1ZRCA 1XSVA 1T39A 1T38A 3ABTA 4RGXA 2DI3A 1FSHA 5CLSA 5K1YA 3R61A 3KP4A 1QQIA 1FBSA 2EK5A 2UXXA 4EM1A 2PBIA 2NYXA 4Q4ZF 1I6XA 2EV0A 4WF2A 2RKHA 1DPRA 5CVIA 5AONA 1U3EM 2DFIA 1OYYA 1OR7A 2D2WA 1AOYA 1J0RA 4H0EA 3MFKA 3RPUA 4L5JA 4ASNA 2PEXA 3LAJA 5BPIA 3WTSC 5BOXA 4QWQA 5FLXK 3F23A 1QNTA 4M72A 3JTGA 2IT0A 3DV8A 3HOSA 5LHIA 1S7OA 2G7UA 1LB2A 1W5TA 4CYDA 5DDGA 2IW5A 2X0LA 3I59A 3RYRA 2MH9A 2JT1A 4OIPF 2UXNA 4XBFA 3D5LA 1R58A 3F6VA 5H6QA 5ED4A 3WU0A 4HX7A 4I7HA 5F1RA 4FX4A 2P6SA 1S29A 4UVAA 4WXDA 2VBXA 1LQ1A 5D5VB 1LDKB 2XVCA 2PJPA 2IA2A 2CQKA 2EA4A 4PCQA 3CUQA 1P4XA 1EH6A 5A2QK 5BMZA 4MQVA 2CYYA 2QWWA 2EFPA 1P92A 5FFXA 3IL2A 2ZNYA 5DD4A 2DO7A 1I5ZA 1Y0UA 3T5XA 4U7BA 1ZRFA 2Q2EA 1QZZA 4BYYA 2TDXA 3L09A 2NNYA 3Q5FA 1YQAA 1KU9A 4IHTA 2YX7A 3GO5A 2DQLA 1PDNC 4YIFA 4M74A 4LG0B 1SMYF 1GXQA 3REOA 3NRVA 3FXQA 3T0YA 2MLKA 3M9AA 2HDCA 4JQFA 2EFQA 5CVRA 3TGNA 1FZPB 4HA8A 2MH2A 1S7AA 3HRMA 1VTNC 4WCGA 4ZYDA 3FMQA 2J5OA 5CVJA 2GWRA 3BPVA 5FO5A 1TQMA 3GW2A 2RC4A 5IT9Z 5DEQA 3TDZC 3E6CC 4RGRA 1BIAA 4EJUA 5HS8A 4RB2C 3WTYC 3CO6C 2Z33A 1T0FA 1FX7A 2GIVA 5F64A 3NEUA 5ICEA 3CUQC 4TV7A 1UHMA 3BWGA 2PG4A 3O3KA 1LVAA 1FYMA 1TQPA 2C6YA 2L3DA 3V8KA 1Q1HA 4I09A 1U8RA 2D45A 4KN4X 2A68F 2EJRA 4EJOA 4PDKA 3E3VA 5ILUA 1KQ8A 1ZLJA 4LJZF 5AIPA 2KKOA 3EYYA 1K78A 4IVNA 3VOEA 4RB3C 4B09A 1FSEA 1X3UA 4Y17A 1HKTA 2XROA 4MHGA 3IRRA 4O5VA 3TDUC 3CUQB 1XDUA 2W57A 2DPUA 4EJTA 1YO5C 1K6OA 1W7PD 3K2ZA 3ECHA 2FBHA 2M5WA 1QBJA 3QAHA 2DPDA 4A0YA 3J80K 3OOPA 1KYWA 4HV6A 3GVAA 3E5QA 1ZRDA 2K7LA 2ETHA 3BJOA 4ZYGA 1I1SA 1ZYRF 2ZFWA 3FXUA 4WWCA 3ZMTA 2ESHA 2A69F 2Z3YA 1AWCA 1JXSA 1O3RA 1P6RA 3DP7A 3L00A 1V3FA 3WGHA 2O61A 5HS7A 3FM3A 1XMAA 1U5TA 1MD0A 2W85A 4G9YA 2HQNA 2RDPA 2FMYA 2XAJA 2QUFA 5FD5A 5E20A 3KP3A 2M30A 2M45A 3GEZA 4RAYA 4L18B 5D8LB 3CJNA 1HQCA 4YFKF 3LAPA 4RGUA 4EJVA 1SD4A 1MZBA 3LSTA 2NS0A 5FD6A 2OBPA 4ESJA 1S3JA 3K1PA 2O0YA 2ADUA 3F8BA 4I2OA 1YYVA 4BXUA 1JE8A 4OIQF 1F4KA 1USSA 2Z99A 2BEOA 4CDGA 1DP7P 1Z9CA 1SFEA 2QENA 2AXLA 3GFIA 2XASA 3J7AO 5FFZA 3ECOA 3BDDA 4GGGA 5D6FA 2H09A 2HZTA 2OA4A 2BYVE 2COMA 2L4AA 3GYHX 2FMLA 2P5VA 4OIRF 6PAXA 1XN7A 5K5QA 4UVBA 2YPRA 3HHGA 1HW2A 4EGYA 3GX4X 4M73A 1I1GA 1YW9A 1U5TC 2A07F 1T6SA 4UXNA 1ULYA 1XMKA 3BPXA 1BJAA 1C0WA 4Q5SF 2XV4S 3JTHA 3K9TA 4A6EA 5E18F 3WTVC 5JI6A 2QBYA 4UNOA 3DQVC 4CGZA 5DD8A 3Q9SA 3OV8A 2QM3A 2G9WA 3WTXC 1LDJA 2V6CA 1FLIA 1GHCA 5E1ZB 1MJAA 3C3WA 1YS6A 5DYMA 3B73A 2RQPA 4ENJA 1O7FA 2KIUA 3U2RA 1IRGA 3RI4A 2K27A 1WKMA 4IXAA 2QQAA 2ZCWA 3N97A 1FYKA 5HDKA 1U5TB 2OU2A 4EV0A 2JZYA 1HW5A 2R7FA 1ZG5A 3MWMA 1PUEE 5L3CA 3F72A 1FYLA 3H3ZA 2PN6A 5LLQA 4A0ZA 1BI0A 1YFHA 2V79A 3F6OA 2GAUA 3KP6A 1IZ1A 4HX4A 1J2XA 5D5XB 4BNCA 2O03A 2JRTA 2K02A 5D4SA 5LGUA 4U7DA 3ZP5A 5HDGA 2HEOA 4A5NA 4AIKA 4EM0B 4LG0A 4ENNA 3C18A 2FOKA 1HSTA 2JPBA 1ZGJA 2F5EA 3KP7A 4PZJA 4P55A 4HLXA 2VOPA 1BI2A 2OAZA 2CSOA 4N0BA 4KN7X 4KNYA 4A0XA 4GO1A 1J7KA 2VXZA 3KP5A 1J9IA 3DEUA 2ISYA 4ENMA 2UZKA 3KLOA 3SZTA 2Q8KA 3ULQB 3HSFA 2E7WA 3TO9A 1QGPA 1J75A 1BIBA 2F5FA 2WTEA 3ISPA 2PMHA 3WTZA 3TOAA 4IJAA 2PFBA 1G3TA 2GA1A 2AS5F 3H92A 4IPAA 2E1CA 1U2WA 2HYGD 3HUGA 2ISZA 1JHFA 1IXSB 3HHHA 2VC0A 4UV8A 5ICGA 1YW7A 4PGHA 4F7ZA 4L9TA 2O6GE 2HTJA 3WU1B 2QBYB 1KU2A 3R6SA 5D8KB 3ZPLA 1HKQA 3V7CA 3RIRA 3SQNA 3CTAA 3FM5A 2F2EA 2FNPA 2ZO4A 4N9IA 2W25A 1ONVA 3BZ6A 3JSPA 3IRQA 3RJPA 4XLNF 1I27A 1W7PA 3WTWC 2G7HA 3RKXA 3WE3A 1G4DA 2ZBKA 3GZ6A 2V1DA 3W6KB 2DK5A 4RAZA 1HXDA 4EVIA 3I5UA 4MQ9F 5BQTA 4ZYHA 3WTUC 3IKVA 4Q48A 1LDDA 1ZHFA 2QZ8A 4ON0A 2MBFA 3KZYA 1JGSA 1XGSA 2LF7A 3QPTA 4AIHA 4G6DA 5JR3A 2VE9A 2CFXA 2DU9A 4PGGA 4HW0A 5HS9A 3W6JB 5DV5A 4LB6B 4MEYF 1EH7A 5D5WB 2FRHA 4G6QA 4BH9A 2XKPA 1ZN2A 2XUBA 3I64A 4BHBA 2VE8A 4L9JA 5AIQA 4U88A 5HVQC 2Y48A 3I0TA 4LLGF 1KQ9A 1TTYA 5EEGA 4UUVA 2VOOA 4GCVA 3JAMZ 4CXFA 2IA1A 1Z05A 3BOQA 2FNAA 4LK1F 4M9SA 5IT9K 1SMTA 2FF4A 2EFNA 5J8CA 2VBYA 3I4PA 3SZPA 1S8NA 4I0AA 2FSWA 1UFMA 1LEAA 1OMIA 1R1VA 1F5TA 3TQNA 1FP1D 2LKPA 5DUIA 4O3MA 4LK0F 4HBLA 1D8KA 3U9GA 4XSXF 4Q47A 2W24A 1REPC 4OIOF 2Q0OA 2LNBA 2HS5A 2X4HA 1E17A 3TO6A 1K79A 4G7OF 1QZYA 1FC3A 3RPQA 2RVCA 4LLNA 4HF2A 2EFOA 1P4WA 4QLCU 3RKWA 1W4MA 1STZA 3B02A 1DUXC 1FOKA 5E17F 4M6YA 2LDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QU3 A;  2LSO A;  4P9U A;  2FBI A;  2FBK A;  5LBQ A;  3LWF A;  4HQE A;  1SAX A;  1Z6R A;  1PP7 U;  4E70 A;  1B9N A;  3EDP A;  3IC7 A;  1W7P B;  1ZG3 A;  2QQB A;  1SFX A;  5CYV A;  5H20 A;  5KK1 A;  4YII A;  3KLN A;  1RIO H;  1R5G A;  3QU6 A;  3J81 Z;  5F6F A;  5TJJ A;  1O3Q A;  1MDM B;  3COA C;  4G7Z F;  3Q9V A;  3ZN0 A;  3O6B B;  1R22 A;  2DT5 A;  2XAF A;  5ILV A;  1R23 A;  2XKO A;  4WK8 F;  3PQJ A;  5H6R A;  4FX0 A;  2YSR A;  1ODD A;  3DF8 A;  4GYI A;  2PI0 A;  1B1B A;  3E5X A;  3QPH A;  3V8J A;  3HTS B;  3S2W A;  3WG9 A;  4XSZ F;  1V4R A;  1KYZ A;  1OYI A;  2IVM A;  2IRF G;  1EV7 A;  1FNN A;  2EV5 A;  3JSO A;  4A5M A;  3HYI A;  5D6E A;  1R1T A;  3WE2 A;  1QPM A;  4KUM A;  2HKO A;  3ZMS A;  1KA8 A;  3CO7 C;  2KIF A;  1RNL A;  5JVT A;  3SFZ A;  3FMR A;  1L0O C;  2BV6 A;  4HF1 A;  1Z91 A;  2P8T A;  2IP2 A;  1B4A A;  3ZMD A;  2QVO A;  3GWZ A;  3DFG A;  3V4G A;  4WX9 A;  4L9N A;  1H0M A;  3LQR A;  5J6X A;  2A5Y B;  1QO0 D;  2K4B A;  5FB2 A;  1IUY A;  5CVV A;  4JBA A;  1FPQ A;  1P4A A;  3EYI A;  5BPD A;  4UVC A;  5CJ9 A;  4L0Z B;  2VN2 A;  1MKM A;  3MQ0 A;  2ACJ A;  1ZAO A;  1PP8 F;  4DNC A;  2R7D A;  2E1N A;  1IAW A;  5IT3 A;  2ELH A;  1TBX A;  4NQW A;  4KIF A;  5LRR A;  4U0V A;  4KMU X;  1S6L A;  1CF7 B;  1L3L A;  3DPT A;  3WTT C;  2HOE A;  5CVU A;  4WXH A;  4ENK A;  1KU7 A;  2HFH A;  2DK8 A;  2XAG A;  1BOA A;  3RDI A;  2FXA A;  4KYW A;  5J8F A;  2KJC A;  4OMY A;  4KFC A;  2DBB A;  2QQ9 A;  2OQG A;  2A6E F;  4M9X A;  3R0J A;  2FU4 A;  3E97 A;  4BAY A;  1ZGA A;  2A61 A;  2MA3 A;  2F5C A;  1UB9 A;  2RGV A;  3V7S A;  3CDH A;  3C1D A;  5FGM A;  1IXR C;  1H9T A;  5L3D A;  1TQI A;  3LA3 A;  3SXY A;  3MZH A;  2QYO A;  4BQA A;  5L3B A;  2FQ3 A;  3ABU A;  3AAF A;  1HKS A;  5ICF A;  4XLP F;  4RB0 A;  1GVJ A;  4A2U A;  5D5U B;  2L02 A;  2FA5 A;  4P5O A;  3F8C A;  1H9G A;  2HKX A;  2MC3 A;  1SD5 A;  5E1X A;  4EQQ A;  3N4M A;  2XGX A;  1YG2 A;  3GFJ A;  1FP2 A;  4I98 B;  3M8E A;  2FEZ A;  2HR3 A;  2K86 A;  1HW1 A;  3KCC A;  3V7R A;  2VBZ A;  4CIC A;  2YX4 A;  4KIC A;  1GXP A;  1R00 A;  2CO5 A;  1TNT A;  1EH8 A;  1YS7 A;  3VEP A;  1WI9 A;  3KFW X;  3I58 A;  1KGS A;  1O3T A;  3HIF A;  1ZAR A;  3CLO A;  2VT3 A;  1RZ4 A;  3BY6 A;  1O57 A;  2DLL A;  4EM2 A;  2GZW A;  3KEO A;  1XCB A;  1E2X A;  4LLL A;  4I01 A;  2VON A;  2NNN A;  1R7J A;  2DW4 A;  1LNW A;  5JFR A;  5L3G A;  3KET A;  3KEQ A;  5L3E A;  2JPC A;  2KIM A;  2HYF A;  4ETS A;  2HGC A;  2ZKZ A;  4Z2Y A;  3DPL C;  4WXC A;  1TW3 A;  2EV6 A;  4L0Y B;  5LEJ A;  4YFN F;  3F22 A;  3ELK A;  2EWN A;  5DUK A;  1ZRE A;  4CZZ A;  4KMF A;  1O7L A;  1XGO A;  3JW4 A;  4N9H A;  2LF8 A;  4AD9 A;  5ERI A;  3QOP A;  1SD6 A;  2XRN A;  1CGP A;  1G3S A;  3ZMU A;  1FWZ A;  3I54 A;  1XSX A;  4DQ2 A;  3MCZ A;  4AIJ A;  2ESN A;  4MEX F;  4EJW A;  4S05 A;  3WGI A;  2M87 A;  3NQO A;  4P96 A;  4IHS A;  2KRF A;  2JSC A;  4R8H A;  2V9V A;  3O2P E;  4HZF A;  2PQ8 A;  3FMS A;  2Y75 A;  2L54 A;  2O8X A;  2IJL A;  1LEB A;  3ML6 A;  4HAM A;  1BN5 A;  1WQ2 A;  3JAM K;  2IA0 A;  4RB1 A;  3MAJ A;  4RS8 A;  1G6N A;  4KIB A;  2UWM A;  5HDN A;  2IPQ X;  4OMZ A;  3ZQ7 A;  1MDM A;  4HOB A;  3KE2 A;  3LA2 A;  1OPC A;  4Y13 A;  3K69 A;  2NRA C;  2BBY A;  3HOT A;  4U0W A;  2WV0 A;  5HLG A;  1MJB A;  3TOB A;  1XDS A;  4L9V A;  1IXC A;  1IN8 A;  3E5U A;  3TO7 A;  3T8T A;  2VOD A;  4OOI A;  3QP5 A;  1F1Z A;  4MTD A;  1TNS A;  1XCV A;  4EMS A;  5FLX Z;  5BS6 A;  2ZME B;  2DQR A;  2E7X A;  1G3Y A;  2XIG A;  3GFL A;  3I53 A;  3HTU A;  3FX3 A;  5LGT A;  3GLX A;  4LMY A;  1BC8 C;  2L01 A;  2VBW A;  1KQ0 A;  4GXO A;  5DCM B;  4EGZ A;  2WWY A;  1ON2 A;  1IW7 F;  2YR2 A;  5LRS A;  4LB5 A;  3U1D A;  4IRG A;  3GFM A;  3PFI A;  4BHC A;  1D3Y A;  5A2Q Z;  1BM9 A;  5KVR A;  1D8J A;  3FZV A;  3ROU A;  4NB5 A;  5EEH A;  3ZMV A;  3D0S A;  2HWV A;  4L5I A;  3J81 K;  1G3W A;  4BHP A;  2H94 A;  5LHH A;  3HSE A;  4O6J A;  3MEX A;  3FWE A;  5HOO A;  2RN7 A;  2V1X A;  5K5R A;  1XSD A;  3FHZ A;  3E6D A;  4KA4 A;  1CF7 A;  1Z6T A;  2P7C B;  1BBY A;  3G73 A;  2KJB A;  3H3U A;  3QP6 A;  2H6B A;  1OYW A;  3F8M A;  5HLI A;  3F8F A;  4A6D A;  1YLF A;  2P5K A;  1FT9 A;  4MGR A;  4LD5 A;  1ZLK A;  5LEK A;  2ZXJ A;  3CUO A;  4GYG A;  3TKY A;  2GQQ A;  4JK1 X;  4CO8 A;  3VFZ A;  3T1B A;  1D5V A;  3E6B A;  3LA7 A;  2MD5 A;  4S04 A;  1BI3 A;  3R4K A;  5L3F A;  3M8F A;  1NHA A;  1T98 A;  4HYE A;  3L9F A;  3G3Z A;  3I59 B;  4KT5 C;  2FE3 A;  4OU0 A;  3RYP A;  1YIO A;  1XGN A;  1RUN A;  1DPU A;  2RNJ A;  4I02 A;  1HSJ A;  1IRF A;  4R79 A;  1R36 A;  3HRT A;  2CWE A;  3ZMZ A;  2OZU A;  2P4W A;  2F5D A;  3V8L A;  1XGM A;  4UV9 A;  3VOD A;  3KZZ A;  4ZZL A;  1UST A;  3EQL F;  4HQM A;  5E8G A;  1DDN A;  3T8R A;  4LGW A;  4MNU A;  3IHU A;  4HV5 A;  2BE5 F;  2DAO A;  3BRO A;  2Z9O A;  4XRF A;  2HQR A;  4A12 A;  5JHU A;  1BI1 A;  1FBQ A;  2VT2 A;  4HX8 A;  1HBX G;  4G8X A;  4CHU A;  3GF2 A;  1B59 A;  4AWX B;  4MTE A;  1Z7U A;  2M1B A;  2ZJ2 A;  4ZZD A;  2RV8 A;  4ZH4 F;  2V1U A;  2NAZ A;  1IN4 A;  3L2C A;  5D4R A;  2STT A;  2ZNZ A;  2OZ6 A;  1J5Y A;  2WC2 A;  2JTV A;  3J80 Z;  2Y0M A;  4D0P A;  2GXB A;  5E1W A;  3WOD F;  1FBU A;  3P7N A;  3P9C A;  4FHT A;  1U6G A;  3BP8 A;  1R1U A;  2P6T A;  2DTR A;  3HSR A;  1P2F A;  5LHG A;  1W5S A;  1RUO A;  2MLG A;  2PMU A;  4HDU A;  3EUH A;  1ZH5 A;  3LFK A;  4KDP A;  2R3S A;  4K2E A;  2A6H F;  4YFX F;  1XB4 A;  1B6A A;  1IN6 A;  3FXR A;  3HRS A;  4YG2 F;  2M8E A;  3GUD A;  5K5O A;  3I71 A;  5ILS A;  3IWZ A;  1ZG1 A;  2EFW A;  2GXG A;  1T2K A;  1B9M A;  2CG4 A;  2CW0 F;  2XAH A;  3M1E A;  1Z1D A;  2EA2 A;  4IF4 A;  3EET A;  4B8X A;  5E8I A;  2D1H A;  3P9I A;  3VB2 A;  2CGP A;  1WWX A;  3M7G A;  2O3F A;  2P5L C;  1O3S A;  4NHJ A;  3BJ6 A;  1TLH B;  3GXO A;  2H6C A;  1R5H A;  1K78 B;  2OQR A;  3ERE D;  5HLH A;  2YU3 A;  2GA2 A;  1SD7 A;  1WSU A;  4G7H F;  1KU3 A;  4ZYE A;  2EB7 A;  1UHW A;  3K0L A;  1TW2 A;  3E6M A;  1MGT A;  2OD5 A;  4M71 A;  2Z5U A;  1J59 A;  3R0A A;  5TRD A;  4FT8 A;  3F21 A;  1JHH A;  1WRJ A;  3L7W A;  3FF5 A;  2BGC A;  4OIN F;  2XAQ A;  4UHT A;  4Y15 A;  4U0Y A;  1K7A A;  1YW8 A;  3C7J A;  4KIG A;  2QLZ A;  2B0L A;  1ON1 A;  1YTY A;  3HRU A;  1MJ9 A;  3P9K A;  2J5P A;  1U78 A;  2XHK A;  1UCR A;  3LQQ A;  2H27 A;  1FY7 A;  3K1N A;  2PLY A;  3KP2 A;  4M9Z A;  3BJA A;  5ICC A;  3QRF F;  2P7V B;  4LFU A;  2W84 A;  1IN5 A;  4IRI A;  4ESB A;  3RKY A;  4HDV A;  1A04 A;  1F9N A;  4AVP A;  1IF1 A;  4I0B A;  3DXJ F;  3RTR A;  4ESF A;  2K4J A;  3PQK A;  2A3S A;  2D1V A;  4RGS A;  2STW A;  1OKR A;  1LJ9 A;  4R1H A;  5DCF A;  4HLY A;  2ZME A;  3MZY A;  3WGG A;  2HTS A;  3SHF A;  3F3X A;  3IWF A;  5LGN A;  3F8N A;  3R60 A;  4HF0 A;  3IKT A;  1RI7 A;  1SFU A;  4G94 A;  3K1M A;  1IN7 A;  3ZN1 A;  5DCM A;  4P9F A;  4M6X A;  3GZ5 A;  3DKW A;  4IRH A;  1XD7 A;  2L4M A;  1BC7 C;  2VC1 A;  1ZRC A;  1XSV A;  1T39 A;  1T38 A;  3ABT A;  4RGX A;  2DI3 A;  1FSH A;  5CLS A;  5K1Y A;  3R61 A;  3KP4 A;  1QQI A;  1FBS A;  2EK5 A;  2UXX A;  4EM1 A;  2PBI A;  2NYX A;  4Q4Z F;  1I6X A;  2EV0 A;  4WF2 A;  2RKH A;  1DPR A;  5CVI A;  5AON A;  1U3E M;  2DFI A;  1OYY A;  1OR7 A;  2D2W A;  1AOY A;  1J0R A;  4H0E A;  3MFK A;  3RPU A;  4L5J A;  4ASN A;  2PEX A;  3LAJ A;  5BPI A;  3WTS C;  5BOX A;  4QWQ A;  5FLX K;  3F23 A;  1QNT A;  4M72 A;  3JTG A;  2IT0 A;  3DV8 A;  3HOS A;  5LHI A;  1S7O A;  2G7U A;  1LB2 A;  1W5T A;  4CYD A;  5DDG A;  2IW5 A;  2X0L A;  3I59 A;  3RYR A;  2MH9 A;  2JT1 A;  4OIP F;  2UXN A;  4XBF A;  3D5L A;  1R58 A;  3F6V A;  5H6Q A;  5ED4 A;  3WU0 A;  4HX7 A;  4I7H A;  5F1R A;  4FX4 A;  2P6S A;  1S29 A;  4UVA A;  4WXD A;  2VBX A;  1LQ1 A;  5D5V B;  1LDK B;  2XVC A;  2PJP A;  2IA2 A;  2CQK A;  2EA4 A;  4PCQ A;  3CUQ A;  1P4X A;  1EH6 A;  5A2Q K;  5BMZ A;  4MQV A;  2CYY A;  2QWW A;  2EFP A;  1P92 A;  5FFX A;  3IL2 A;  2ZNY A;  5DD4 A;  2DO7 A;  1I5Z A;  1Y0U A;  3T5X A;  4U7B A;  1ZRF A;  2Q2E A;  1QZZ A;  4BYY A;  2TDX A;  3L09 A;  2NNY A;  3Q5F A;  1YQA A;  1KU9 A;  4IHT A;  2YX7 A;  3GO5 A;  2DQL A;  1PDN C;  4YIF A;  4M74 A;  4LG0 B;  1SMY F;  1GXQ A;  3REO A;  3NRV A;  3FXQ A;  3T0Y A;  2MLK A;  3M9A A;  2HDC A;  4JQF A;  2EFQ A;  5CVR A;  3TGN A;  1FZP B;  4HA8 A;  2MH2 A;  1S7A A;  3HRM A;  1VTN C;  4WCG A;  4ZYD A;  3FMQ A;  2J5O A;  5CVJ A;  2GWR A;  3BPV A;  5FO5 A;  1TQM A;  3GW2 A;  2RC4 A;  5IT9 Z;  5DEQ A;  3TDZ C;  3E6C C;  4RGR A;  1BIA A;  4EJU A;  5HS8 A;  4RB2 C;  3WTY C;  3CO6 C;  2Z33 A;  1T0F A;  1FX7 A;  2GIV A;  5F64 A;  3NEU A;  5ICE A;  3CUQ C;  4TV7 A;  1UHM A;  3BWG A;  2PG4 A;  3O3K A;  1LVA A;  1FYM A;  1TQP A;  2C6Y A;  2L3D A;  3V8K A;  1Q1H A;  4I09 A;  1U8R A;  2D45 A;  4KN4 X;  2A68 F;  2EJR A;  4EJO A;  4PDK A;  3E3V A;  5ILU A;  1KQ8 A;  1ZLJ A;  4LJZ F;  5AIP A;  2KKO A;  3EYY A;  1K78 A;  4IVN A;  3VOE A;  4RB3 C;  4B09 A;  1FSE A;  1X3U A;  4Y17 A;  1HKT A;  2XRO A;  4MHG A;  3IRR A;  4O5V A;  3TDU C;  3CUQ B;  1XDU A;  2W57 A;  2DPU A;  4EJT A;  1YO5 C;  1K6O A;  1W7P D;  3K2Z A;  3ECH A;  2FBH A;  2M5W A;  1QBJ A;  3QAH A;  2DPD A;  4A0Y A;  3J80 K;  3OOP A;  1KYW A;  4HV6 A;  3GVA A;  3E5Q A;  1ZRD A;  2K7L A;  2ETH A;  3BJO A;  4ZYG A;  1I1S A;  1ZYR F;  2ZFW A;  3FXU A;  4WWC A;  3ZMT A;  2ESH A;  2A69 F;  2Z3Y A;  1AWC A;  1JXS A;  1O3R A;  1P6R A;  3DP7 A;  3L00 A;  1V3F A;  3WGH A;  2O61 A;  5HS7 A;  3FM3 A;  1XMA A;  1U5T A;  1MD0 A;  2W85 A;  4G9Y A;  2HQN A;  2RDP A;  2FMY A;  2XAJ A;  2QUF A;  5FD5 A;  5E20 A;  3KP3 A;  2M30 A;  2M45 A;  3GEZ A;  4RAY A;  4L18 B;  5D8L B;  3CJN A;  1HQC A;  4YFK F;  3LAP A;  4RGU A;  4EJV A;  1SD4 A;  1MZB A;  3LST A;  2NS0 A;  5FD6 A;  2OBP A;  4ESJ A;  1S3J A;  3K1P A;  2O0Y A;  2ADU A;  3F8B A;  4I2O A;  1YYV A;  4BXU A;  1JE8 A;  4OIQ F;  1F4K A;  1USS A;  2Z99 A;  2BEO A;  4CDG A;  1DP7 P;  1Z9C A;  1SFE A;  2QEN A;  2AXL A;  3GFI A;  2XAS A;  3J7A O;  5FFZ A;  3ECO A;  3BDD A;  4GGG A;  5D6F A;  2H09 A;  2HZT A;  2OA4 A;  2BYV E;  2COM A;  2L4A A;  3GYH X;  2FML A;  2P5V A;  4OIR F;  6PAX A;  1XN7 A;  5K5Q A;  4UVB A;  2YPR A;  3HHG A;  1HW2 A;  4EGY A;  3GX4 X;  4M73 A;  1I1G A;  1YW9 A;  1U5T C;  2A07 F;  1T6S A;  4UXN A;  1ULY A;  1XMK A;  3BPX A;  1BJA A;  1C0W A;  4Q5S F;  2XV4 S;  3JTH A;  3K9T A;  4A6E A;  5E18 F;  3WTV C;  5JI6 A;  2QBY A;  4UNO A;  3DQV C;  4CGZ A;  5DD8 A;  3Q9S A;  3OV8 A;  2QM3 A;  2G9W A;  3WTX C;  1LDJ A;  2V6C A;  1FLI A;  1GHC A;  5E1Z B;  1MJA A;  3C3W A;  1YS6 A;  5DYM A;  3B73 A;  2RQP A;  4ENJ A;  1O7F A;  2KIU A;  3U2R A;  1IRG A;  3RI4 A;  2K27 A;  1WKM A;  4IXA A;  2QQA A;  2ZCW A;  3N97 A;  1FYK A;  5HDK A;  1U5T B;  2OU2 A;  4EV0 A;  2JZY A;  1HW5 A;  2R7F A;  1ZG5 A;  3MWM A;  1PUE E;  5L3C A;  3F72 A;  1FYL A;  3H3Z A;  2PN6 A;  5LLQ A;  4A0Z A;  1BI0 A;  1YFH A;  2V79 A;  3F6O A;  2GAU A;  3KP6 A;  1IZ1 A;  4HX4 A;  1J2X A;  5D5X B;  4BNC A;  2O03 A;  2JRT A;  2K02 A;  5D4S A;  5LGU A;  4U7D A;  3ZP5 A;  5HDG A;  2HEO A;  4A5N A;  4AIK A;  4EM0 B;  4LG0 A;  4ENN A;  3C18 A;  2FOK A;  1HST A;  2JPB A;  1ZGJ A;  2F5E A;  3KP7 A;  4PZJ A;  4P55 A;  4HLX A;  2VOP A;  1BI2 A;  2OAZ A;  2CSO A;  4N0B A;  4KN7 X;  4KNY A;  4A0X A;  4GO1 A;  1J7K A;  2VXZ A;  3KP5 A;  1J9I A;  3DEU A;  2ISY A;  4ENM A;  2UZK A;  3KLO A;  3SZT A;  2Q8K A;  3ULQ B;  3HSF A;  2E7W A;  3TO9 A;  1QGP A;  1J75 A;  1BIB A;  2F5F A;  2WTE A;  3ISP A;  2PMH A;  3WTZ A;  3TOA A;  4IJA A;  2PFB A;  1G3T A;  2GA1 A;  2AS5 F;  3H92 A;  4IPA A;  2E1C A;  1U2W A;  2HYG D;  3HUG A;  2ISZ A;  1JHF A;  1IXS B;  3HHH A;  2VC0 A;  4UV8 A;  5ICG A;  1YW7 A;  4PGH A;  4F7Z A;  4L9T A;  2O6G E;  2HTJ A;  3WU1 B;  2QBY B;  1KU2 A;  3R6S A;  5D8K B;  3ZPL A;  1HKQ A;  3V7C A;  3RIR A;  3SQN A;  3CTA A;  3FM5 A;  2F2E A;  2FNP A;  2ZO4 A;  4N9I A;  2W25 A;  1ONV A;  3BZ6 A;  3JSP A;  3IRQ A;  3RJP A;  4XLN F;  1I27 A;  1W7P A;  3WTW C;  2G7H A;  3RKX A;  3WE3 A;  1G4D A;  2ZBK A;  3GZ6 A;  2V1D A;  3W6K B;  2DK5 A;  4RAZ A;  1HXD A;  4EVI A;  3I5U A;  4MQ9 F;  5BQT A;  4ZYH A;  3WTU C;  3IKV A;  4Q48 A;  1LDD A;  1ZHF A;  2QZ8 A;  4ON0 A;  2MBF A;  3KZY A;  1JGS A;  1XGS A;  2LF7 A;  3QPT A;  4AIH A;  4G6D A;  5JR3 A;  2VE9 A;  2CFX A;  2DU9 A;  4PGG A;  4HW0 A;  5HS9 A;  3W6J B;  5DV5 A;  4LB6 B;  4MEY F;  1EH7 A;  5D5W B;  2FRH A;  4G6Q A;  4BH9 A;  2XKP A;  1ZN2 A;  2XUB A;  3I64 A;  4BHB A;  2VE8 A;  4L9J A;  5AIQ A;  4U88 A;  5HVQ C;  2Y48 A;  3I0T A;  4LLG F;  1KQ9 A;  1TTY A;  5EEG A;  4UUV A;  2VOO A;  4GCV A;  3JAM Z;  4CXF A;  2IA1 A;  1Z05 A;  3BOQ A;  2FNA A;  4LK1 F;  4M9S A;  5IT9 K;  1SMT A;  2FF4 A;  2EFN A;  5J8C A;  2VBY A;  3I4P A;  3SZP A;  1S8N A;  4I0A A;  2FSW A;  1UFM A;  1LEA A;  1OMI A;  1R1V A;  1F5T A;  3TQN A;  1FP1 D;  2LKP A;  5DUI A;  4O3M A;  4LK0 F;  4HBL A;  1D8K A;  3U9G A;  4XSX F;  4Q47 A;  2W24 A;  1REP C;  4OIO F;  2Q0O A;  2LNB A;  2HS5 A;  2X4H A;  1E17 A;  3TO6 A;  1K79 A;  4G7O F;  1QZY A;  1FC3 A;  3RPQ A;  2RVC A;  4LLN A;  4HF2 A;  2EFO A;  1P4W A;  4QLC U;  3RKW A;  1W4M A;  1STZ A;  3B02 A;  1DUX C;  1FOK A;  5E17 F;  4M6Y A;  2LDU A; 
#chains in the Genus database with same CATH topology
 3HJE A;  3SFI A;  1X1B A;  5EG0 A;  2CU7 A;  3LOC A;  4A3B J;  2FQ4 A;  2XGD A;  3QU3 A;  2LSO A;  4BQQ A;  3W2A A;  4P9U A;  1BR1 A;  1Z3Y A;  2FBI A;  2CQN A;  2K9L A;  3SEZ A;  2FBK A;  3D5S C;  4S0H B;  5LBQ A;  5FKM A;  3LWF A;  4HQE A;  1SAX A;  1Z6R A;  4XRS A;  1PP7 U;  4E70 A;  1B9N A;  3EDP A;  4A3L J;  3IC7 A;  1W7P B;  1ZG3 A;  3PNT A;  2QQB A;  2X6O A;  4A69 C;  1SFX A;  2GM4 A;  3MZ8 A;  5CYV A;  5H20 A;  5KK1 A;  2WB1 A;  4CA0 A;  4YII A;  3KLN A;  1RIO H;  1R5G A;  3QU6 A;  3J81 Z;  1VQ8 I;  1S5L C;  5F6F A;  5FJ8 J;  5TJJ A;  4ZDP A;  2KT0 A;  3FXL A;  2XSD C;  1O3Q A;  1MDM B;  3COA C;  4ENM A;  4G7Z F;  5IP6 A;  3Q9V A;  1MNE A;  3O6B B;  3ZN0 A;  1R22 A;  2DFH A;  2LD5 A;  3VYR B;  2DT5 A;  4BBR J;  1ITY A;  4IHW A;  2XAF A;  5ILV A;  1Y0N A;  3MMY B;  1NTC A;  1R23 A;  2JVH A;  2XKO A;  4WK8 F;  3PQJ A;  3RPU D;  1FTT A;  3K6G A;  2M0C A;  2DMT A;  5H6R A;  2E1M B;  2VJ5 A;  4HNT A;  4FX0 A;  3PO3 J;  3A03 A;  4RLQ A;  2LKS A;  2A05 A;  1ODD A;  2WA0 A;  2YSR A;  3DF8 A;  5EZH A;  2GOX B;  4GYI A;  2WY7 Q;  1U8B A;  2PI0 A;  1FIA A;  1B1B A;  1Y1W J;  3S1M J;  3E5X A;  3QPH A;  3S93 A;  3V8J A;  2V7F A;  3HTS B;  4B44 A;  3IH4 A;  3OL3 A;  3S2W A;  3WG9 A;  4XSZ F;  1V4R A;  3RSN A;  1KYZ A;  1OYI A;  2IVM A;  3ASN H;  2IRF G;  1EV7 A;  3U1K A;  1FNN A;  2EV5 A;  3JSO A;  4A5M A;  3DWL E;  2M7A A;  3HYI A;  5D6E A;  5F04 A;  3TW6 A;  1R1T A;  3WE2 A;  1QPM A;  4C2U A;  4ABZ A;  2HXI A;  3LSH A;  4D7N A;  3H5N A;  3HL2 A;  4A3I J;  2CH0 A;  4KUM A;  5IYD J;  2HKO A;  3ZMS A;  1KA8 A;  5F08 A;  3GTP J;  3CO7 C;  2KIF A;  1RNL A;  5JVT A;  3SFZ A;  3FMR A;  4RDU A;  3SZG A;  3AG1 H;  5TGT A;  2ZXH A;  2HNH A;  4A3K J;  3DCF A;  4E7I A;  5E3N A;  4UB6 C;  5EF6 A;  3FBN B;  1L0O C;  3ONQ A;  2BV6 A;  1Z0X A;  2NXN B;  3ZQQ A;  3K7A J;  2DA2 A;  4HF1 A;  1Z91 A;  2P8T A;  2IP2 A;  1B4A A;  3BC8 A;  2EIM H;  3ZMD A;  2R7R A;  1W0T A;  2X1D A;  2QVO A;  3ABK H;  4C2T A;  3PSF A;  3GWZ A;  3DFG A;  3V4G A;  4WX9 A;  2ELK A;  2RNG A;  4L9N A;  1SFK A;  1H0M A;  2LBF A;  3LQR A;  5J6X A;  2KQR A;  2A5Y B;  1QO0 D;  2K4B A;  3K4J A;  5FB2 A;  5M5Y J;  5CVV A;  1IUY A;  2YS9 A;  3TW7 A;  2HI3 A;  4JBA A;  4E7J A;  1FPQ A;  1P4A A;  3EYI A;  5BPD A;  4UVC A;  5CJ9 A;  2VPL A;  1Q1V A;  4BY1 J;  1JUS A;  4L0Z B;  1FJL A;  4IZZ A;  2VN2 A;  1MKM A;  2EIJ H;  3MQ0 A;  1DP3 A;  3S16 J;  1BA5 A;  2ACJ A;  1ETX A;  1ZAO A;  1PP8 F;  3G4S I;  4DNC A;  5EGO B;  2R7D A;  1V55 H;  1GDT A;  2E1N A;  1IAW A;  5FKN A;  5IT3 A;  2ELH A;  1TBX A;  2NVT J;  4XMY A;  4NQW A;  1WVR A;  4KIF A;  2HU9 A;  5LRR A;  4D5F A;  4U0V A;  4KMU X;  1S6L A;  2MW8 A;  1CF7 B;  2E60 A;  1L3L A;  3DPT A;  3CF5 F;  3OIO A;  2VIX A;  3WTT C;  2HOE A;  5CVU A;  4WXH A;  3QQA A;  4ENK A;  2A6T A;  2HFH A;  2DK8 A;  5EG0 B;  1KU7 A;  2XAG A;  1POG A;  1BOA A;  3OYH A;  3RDI A;  2FXA A;  4XKW A;  3QPL A;  4KYW A;  5J8F A;  2KJC A;  3LMM A;  4OMY A;  2CW8 A;  1TL8 A;  4KFC A;  4PJL A;  4RM2 A;  1E3H A;  3ZXS A;  3S32 A;  2M7B A;  3S1N J;  2DBB A;  3ZCO A;  2QQ9 A;  5E3M A;  4IO9 F;  2OQG A;  1MMN A;  2F4O B;  1W0U A;  3GTG J;  2A6E F;  2VXD A;  4M9X A;  3NAR A;  3R0J A;  2FU4 A;  3E97 A;  4BAY A;  2L7Z A;  2HOS A;  2E34 A;  2M3A A;  1OCC H;  2G0E A;  2IAI A;  1ZGA A;  2A61 A;  3O8G A;  2R7T A;  3ABL H;  2MA3 A;  2F5C A;  1JTX A;  1N75 A;  1T56 A;  1UB9 A;  2XB5 A;  3DBL B;  2RGV A;  1HC8 A;  1IV8 A;  1U9O A;  3V7S A;  3CDH A;  3C1D A;  5FGM A;  2XF6 A;  1IXR C;  1H9T A;  5L3D A;  5K7H A;  1TQI A;  1NG7 A;  5GAH J;  3M8J A;  3LA3 A;  3BR5 A;  3SXY A;  2QYO A;  3MZH A;  3EPZ A;  4BQA A;  5FRM A;  5L3B A;  3J7A Y;  1OLT A;  2FQ3 A;  3ABU A;  3AAF A;  2KRH A;  3CC7 I;  1MW7 A;  4A93 J;  3VYU B;  3FDY A;  1HKS A;  5ICF A;  4XLP F;  4RB0 A;  2B7E A;  3PFY A;  4G6T B;  1ORK A;  4BXF A;  1GVJ A;  1XMX A;  4A2U A;  5D5U B;  2LY9 A;  3CCU I;  3PUF A;  2Y9Z A;  4AYB N;  2L02 A;  2FA5 A;  4P5O A;  3F8C A;  5HNH A;  2W1O A;  5C4X J;  2KP6 A;  1H9G A;  2HKX A;  2MC3 A;  1SD5 A;  2FOW A;  5E1X A;  4EQQ A;  3N4M A;  5F0C A;  2XGX A;  2QF7 A;  1YG2 A;  3GFJ A;  5CQE A;  4GDF A;  1FP2 A;  2OV7 A;  3RZO J;  4I98 B;  3M8E A;  2XGC A;  3SDG A;  3FXK A;  4CSW A;  2FEZ A;  2HR3 A;  3GZN B;  5J4V A;  1Z21 A;  2K86 A;  2Y31 A;  1HW1 A;  3D1N I;  4CCM A;  4IL6 C;  2EZL A;  1MNM C;  1W36 D;  3ZQL A;  4FET A;  3ZQC A;  3KCC A;  5GAG J;  1APL C;  2F4I A;  2AQE A;  2VKV A;  3V7R A;  1WI3 A;  2VBZ A;  3HPH A;  2YX4 A;  4CIC A;  4KIC A;  1VQN I;  1GXP A;  4MIM A;  3EUH C;  2OTJ I;  1R00 A;  3ERM A;  2QEX I;  2CO5 A;  2FJ1 A;  1YIJ I;  3LFU A;  1TNT A;  1EH8 A;  1YS7 A;  2JK3 A;  5KNL A;  2DA4 A;  4B43 A;  4A3F J;  1OCT C;  3K2A A;  3VEP A;  5GPC A;  1AKH A;  5GTI C;  4M6V A;  3BG6 A;  1WI9 A;  3KFW X;  3I58 A;  2OCE A;  1AHD P;  2K9M A;  1KGS A;  1O3T A;  1UG2 A;  4M3E A;  3HIF A;  4UB8 C;  1YX5 A;  1ZAR A;  3CLO A;  2R7U A;  2VT3 A;  1RZ4 A;  1ETK A;  3BY6 A;  1O57 A;  2DLL A;  3QWL A;  4EM2 A;  2GZW A;  3KEO A;  3VSK A;  4C30 A;  2LRE A;  1IRX A;  1XCB A;  1E2X A;  1LFU P;  4LLL A;  4AUX A;  4I01 A;  4BE0 A;  2VON A;  2NNN A;  1R7J A;  2DW4 A;  1LNW A;  2HXO A;  4A3G J;  5JFR A;  5L3G A;  3KET A;  2ZXW H;  3KEQ A;  2R7Q A;  4AID A;  2L9S A;  4JYK A;  1YJW I;  5HOD A;  5L3E A;  1TZL A;  4XOT A;  5JVG F;  2BY1 A;  2JPC A;  2KIM A;  2HYF A;  1P7J A;  4ETS A;  2HGC A;  2ZKZ A;  2X6X A;  2XDV A;  4Z2Y A;  1GLN A;  3DPL C;  4WXC A;  2X85 A;  1TW3 A;  3CJQ B;  2EV6 A;  1OCR H;  3B6A A;  4L0Y B;  3AG4 H;  3KX2 A;  1D5Y A;  5LEJ A;  4RAG A;  3DTI A;  4BEH B;  4YFN F;  3F22 A;  3ELK A;  1VQ7 I;  5JHF A;  2EWN A;  5DUK A;  2R7O A;  1ZRE A;  4CZZ A;  4KMF A;  2XPV A;  1B8I B;  1X1C A;  1O7L A;  3FIS A;  1XGO A;  5E79 C;  2CQQ A;  4ZJZ A;  2LYC A;  3JW4 A;  4N9H A;  2X1C A;  5M5X J;  3RKQ A;  2I8D A;  2JMW A;  2LF8 A;  2ZFU A;  4AD9 A;  5ERI A;  5FLV A;  1I6H J;  1VQ4 I;  2DJN A;  3QOP A;  3ASO H;  4IQ4 A;  1SD6 A;  2XRN A;  1CGP A;  1G3S A;  3ZMU A;  3I56 I;  3AFH A;  5FRO A;  3PJR A;  1FWZ A;  3I54 A;  4HSR A;  1XSX A;  3FXO A;  4DQ2 A;  3MCZ A;  4AIJ A;  2ESN A;  4MEX F;  4EJW A;  1UG0 A;  4S05 A;  3WGI A;  3DLL F;  2MC4 A;  4PSX A;  4XON A;  1QRY A;  5FKL A;  5E3L A;  1WJC A;  2M87 A;  5C4J J;  3NQO A;  2K40 A;  2MAB A;  5J3L A;  2R7W A;  4P96 A;  1UEL B;  1VZ0 A;  3FHN A;  1XX5 A;  3L2U A;  4IHS A;  2KRF A;  2JSC A;  4R8H A;  2V9V A;  1RKT A;  2OJE D;  5IYC J;  5LFA A;  3IH2 A;  3BCA A;  2BXY A;  3O2P E;  4HZF A;  2PQ8 A;  2HQA A;  4EEF G;  3J7Z I;  4BQO A;  3H0D A;  2CUE A;  3FMS A;  2Y75 A;  2L54 A;  4Y7N J;  2HPM A;  2CS3 A;  2O8X A;  1PVE A;  2MD0 A;  1YJN I;  2IJL A;  3QYB A;  4C3I J;  1LEB A;  3GME A;  1K4S A;  1UHS A;  3CC2 I;  3ML6 A;  4DZJ A;  2KFD A;  4HAM A;  4YIR X;  4KJZ A;  1BN5 A;  2L9R A;  3GTO J;  3M3Y J;  1WQ2 A;  3JAM K;  1IDZ A;  2IA0 A;  3DTK A;  4RB1 A;  3MAJ A;  4RS8 A;  5EJC A;  1G6N A;  3H9J A;  3HZJ A;  4KIB A;  2VL8 A;  1HF0 A;  2UWM A;  5HDN A;  2IPQ X;  4RA2 A;  1BL0 A;  2DMU A;  4OMZ A;  2L7M P;  4B4C A;  2CQ7 A;  3ZQ7 A;  1MDM A;  4E7H A;  1MBF A;  4HOB A;  4ZYA A;  1F43 A;  3OYI A;  3HKZ N;  3AG2 H;  3KE2 A;  3LA2 A;  2CV2 A;  1OPC A;  4Y13 A;  1IDY A;  3K69 A;  3MKZ A;  2NRA C;  4XN0 A;  2BBY A;  2JUG A;  3WU2 C;  4DOZ A;  4ZTJ A;  2D5V A;  3HOT A;  1LFP A;  4U0W A;  2WV0 A;  3VDX A;  5C44 J;  5HLG A;  1ZTR A;  1WH7 A;  4J01 A;  1MJB A;  4XN3 A;  1YIT I;  3OIQ A;  3TOB A;  1VFC A;  2R93 J;  3AL0 C;  1XDS A;  2JN6 A;  1AKH B;  3H0G J;  3H35 A;  4L9V A;  1UAA A;  1IXC A;  1IN8 A;  2ECB A;  4OWR B;  1EA3 A;  1SAU A;  1Y39 A;  3E5U A;  3CCY A;  3TO7 A;  3T8T A;  3LSG A;  1MMG A;  3BR0 A;  1XPX A;  1QPI A;  2VOD A;  1Y8R B;  4OOI A;  3QP5 A;  2PMZ A;  2Y30 A;  1F1Z A;  2V9K A;  3QOE A;  3N05 A;  4MTD A;  1JKR C;  1TNS A;  1XCV A;  4EMS A;  5FLX Z;  1WJ5 A;  2IS2 A;  5BS6 A;  3E1S A;  2ZME B;  2E1O A;  1OIS A;  2DQR A;  2DFE A;  1WPK A;  2E7X A;  3S2D J;  1MND A;  5BNG A;  1RPW A;  1G3Y A;  2XIG A;  3GFL A;  3OR2 C;  3I53 A;  3CZ6 A;  3HTU A;  1IO2 A;  2NS7 A;  1P7I A;  2QSH X;  2K85 A;  5KAI C;  1ETQ A;  3FX3 A;  5LGT A;  2R7Z J;  3DPU A;  1SC7 A;  3HOX J;  3L1P A;  3GLX A;  5IYB J;  4LMY A;  2WAE A;  1BC8 C;  2H1K A;  2YU9 J;  1SAN A;  2L01 A;  2VBW A;  1KQ0 A;  1GVD A;  3KIO A;  4HNV A;  2HDD A;  4GXO A;  2QKM B;  5DCM B;  4EGZ A;  3AL0 B;  1T8I A;  2WWY A;  1ON2 A;  1SVM A;  1T33 A;  1IW7 F;  2YR2 A;  1OR7 C;  5LRS A;  3LL7 A;  2JA5 J;  4LB5 A;  1MBE A;  3U1D A;  4IRG A;  3GFM A;  4ZTF A;  3PFI A;  2QSG X;  4BHC A;  2TRT A;  3OYM A;  5GPA A;  1D1B A;  1D3Y A;  5A2Q Z;  1BM9 A;  2CW7 A;  2N8G A;  4J00 A;  3F0C A;  5KVR A;  3CDI A;  5TIS C;  3OSF A;  1D8J A;  3FZV A;  1R49 A;  5B66 C;  4LG3 A;  2KRC A;  3ROU A;  3G6E I;  4NB5 A;  2VB6 A;  5EEH A;  3ZMV A;  1QVT A;  3D0S A;  2HWV A;  4L5I A;  3J81 K;  2Y0S A;  4FTH A;  1G3W A;  2FD5 A;  4BHP A;  2H94 A;  5LHH A;  5EGO A;  2E35 A;  3HSE A;  3RCO A;  4O6J A;  2LK2 A;  3MEX A;  4J19 A;  3FWE A;  5HOO A;  5FRN A;  4OAY A;  4NDL A;  2RN7 A;  2V1X A;  4E7Z A;  5K5R A;  1XSD A;  3FHZ A;  3E6D A;  2DT6 A;  5DM6 F;  4KA4 A;  1CF7 A;  1Z6T A;  4XLE A;  2P7C B;  3RQI A;  1BBY A;  3JRA A;  2E1M C;  3G73 A;  3W2W A;  1T08 B;  2KJB A;  3SDB A;  3JRH A;  1X19 A;  3H3U A;  4RMN A;  1DGR M;  3QP6 A;  2H6B A;  1OYW A;  3F8M A;  5HLI A;  5EEA A;  3F8F A;  3H3V K;  4LIT A;  1YLF A;  4A6D A;  2P5K A;  1FT9 A;  4MGR A;  4LD5 A;  1ZLK A;  5LEK A;  1I3A A;  1E0E A;  4LIU A;  3MD2 A;  2ZXJ A;  4IHV A;  3FKJ A;  4PJN A;  2QKL B;  4XLF A;  1IG7 A;  3CUO A;  2Y2Z A;  4GYG A;  3TKY A;  2GQQ A;  2VKE A;  4JK1 X;  4CO8 A;  1JKP C;  2ZSI B;  3VFZ A;  3T1B A;  1HCR A;  1ZEL A;  1D5V A;  1X1D A;  3E6B A;  5F1J A;  1FOW A;  2LC2 A;  1TP4 A;  4XID A;  3I4M J;  3LA7 A;  1FTZ A;  2K9Q A;  2MD5 A;  4S04 A;  1BI3 A;  2XPU A;  3BZC A;  3R4K A;  5L3F A;  3M8F A;  4DBR A;  2V1N A;  1NHA A;  1T98 A;  2R4G A;  4HYE A;  3DU6 A;  3L9F A;  1A6I A;  1TWH J;  2P0W A;  3FKI J;  3G3Z A;  2OC6 A;  3PM1 A;  3I59 B;  2HVS A;  4KT5 C;  4KT6 A;  2LR8 A;  3HC7 A;  3K70 D;  2VLA A;  1VQP I;  2FE3 A;  5FLM J;  4OU0 A;  1E3P A;  2F48 A;  3RYP A;  1YIO A;  3G1O A;  3HOV J;  4B48 A;  1XGN A;  1QHH D;  1G59 A;  1MH4 A;  3VPR A;  1RUN A;  1DPU A;  2RNJ A;  4I02 A;  1HSJ A;  2R5Y B;  4I6Z A;  3WHC A;  1IRF A;  3CMA I;  4CCL A;  4R79 A;  2XF7 A;  1R36 A;  4IHY A;  3HRT A;  2CWE A;  3ZMZ A;  3G2B A;  2OZU A;  4F92 B;  4DYR A;  2RAE A;  4AYB A;  1MH3 A;  2QA4 I;  2P4W A;  4KIT B;  2F5D A;  2LFB A;  3V8L A;  1XGM A;  4UV9 A;  3B6C A;  5K7F A;  3VOD A;  3KZZ A;  3H36 A;  4ZZL A;  1UST A;  3EQL F;  4HQM A;  5E8G A;  3BLY A;  1DDN A;  3T8R A;  4LGW A;  2VQG A;  4MNU A;  1WFX A;  2B63 J;  3JRE A;  1JKQ C;  3IHU A;  4HV5 A;  2QQ8 A;  4IEJ A;  3S3N A;  2Y69 H;  2BE5 F;  5B3S H;  2DAO A;  2F6C A;  2ELJ A;  3BRO A;  2Z9O A;  4IOC F;  3HPG A;  1V5E A;  4XRF A;  2HQR A;  3HGG A;  4A12 A;  5JHU A;  1BI1 A;  3UNG C;  1FBQ A;  2VT2 A;  4HX8 A;  1HBX G;  2LVS A;  2DA3 A;  4AC0 A;  2OPT A;  4G8X A;  1AU7 A;  3GF2 A;  4CHU A;  1B59 A;  4XOR A;  4AWX B;  3LSJ A;  1OCZ H;  1MMD A;  1WGX A;  3CES A;  3S3O A;  1IC8 A;  3CC4 I;  4MTE A;  1Z7U A;  2M1B A;  2ZJ2 A;  2E2I J;  4ZZD A;  2RV8 A;  3S14 J;  4C9Y A;  2OTL I;  4ZH4 F;  1Z77 A;  4XKC A;  4PUS A;  1VQO I;  4CCJ A;  1ZQ3 P;  1Z7L A;  2NAZ A;  2CUZ A;  1IN4 A;  4MO7 A;  2V1U A;  3L2C A;  2HOA A;  2VJI A;  5D4R A;  3AG3 H;  2NOG A;  2STT A;  1K6Y A;  2ZNZ A;  2JVG A;  2OZ6 A;  1HDP A;  1J5Y A;  2R7S A;  3E7L A;  2NVQ J;  2WC2 A;  2JUC A;  1FMV A;  3K4C A;  1LKX A;  2JTV A;  3J80 Z;  3L2V A;  3ZQH A;  2ZJQ F;  2Y0M A;  4D0P A;  2GXB A;  5E1W A;  1RES A;  3WOD F;  1FBU A;  4HRI A;  3P7N A;  3P9C A;  2JWT A;  4FHT A;  1U6G A;  3BG9 A;  3BP8 A;  1R1U A;  3RQ4 A;  3K4B A;  2P6T A;  1YOV B;  2DTR A;  2EZH A;  3HSR A;  4PFO A;  2ZSH B;  1P2F A;  1X2N A;  3BQY A;  3I3L A;  3SJM A;  5LHG A;  1W5S A;  3S15 J;  3CCJ I;  1RUO A;  2MLG A;  2PMU A;  2H8R A;  4HDU A;  3HB9 A;  3EUH A;  3JRI A;  1ZH5 A;  1VI0 A;  3LFK A;  2DMN A;  4KDP A;  2JSP A;  3OL4 A;  2R3S A;  2VQL A;  2W82 A;  4K2E A;  2M0M A;  2A6H F;  4YFX F;  1JGG A;  4JOM A;  1A36 A;  3HOW J;  1XB4 A;  2R0Q C;  3AKZ A;  1B6A A;  1IN6 A;  3FXR A;  3HRS A;  4YG2 F;  5F0F A;  2M8E A;  3BCB A;  2LY1 A;  3GUD A;  1AA7 A;  1X1P A;  1ENH A;  5K5O A;  5J4Y A;  1MMS A;  3I71 A;  3BG7 A;  4MFD A;  5ILS A;  3TL4 X;  3IWZ A;  1ZG1 A;  4BEH A;  3IAM 2;  3FBI B;  4XM3 A;  2EFW A;  3S1Q J;  2GXG A;  4F91 B;  3KYD B;  2DN0 A;  1IGN A;  2F4M B;  4MFE A;  1B8I A;  1T2K A;  1B9M A;  2CG4 A;  2CW0 F;  2XAH A;  3M1E A;  1Z1D A;  5LD2 C;  2EA2 A;  3LSM A;  4JP0 A;  4IF4 A;  4E4H A;  2GXA A;  3EET A;  2K9S A;  3Q3S A;  4B8X A;  1LE8 B;  5E8I A;  2D1H A;  3P9I A;  2ME6 A;  5M3F J;  3HM5 A;  3VB2 A;  2CGP A;  1WWX A;  2DDA A;  3HEF A;  3M7G A;  1F36 A;  1MIJ A;  4DBQ A;  3CLQ A;  2EQR A;  1K83 J;  2BY2 A;  2EBI A;  1YX3 A;  3S1R J;  4BAC A;  1SFO J;  2O3F A;  3K4L A;  1IJW C;  1WH5 A;  3DTE A;  2P5L C;  4I99 C;  3D5R C;  4X1E A;  2IXS A;  3JR9 A;  1O3S A;  1QU3 A;  3TP0 A;  4NHJ A;  3BJ6 A;  1YRN B;  1TLH B;  3GXO A;  2H6C A;  4BY7 J;  2YUS A;  3BTI A;  2IGK A;  1R5H A;  1B72 B;  2M4G A;  3S2H J;  1K78 B;  2VJJ A;  2COB A;  2BY0 A;  3IAS 2;  2AHQ A;  3LSI A;  2OQR A;  3ERE D;  5HLH A;  2YU3 A;  2GA2 A;  1SD7 A;  1WSU A;  4D9J A;  4G7H F;  1KU3 A;  1G8X A;  2DT7 B;  1A6Q A;  3BTC A;  4ZYE A;  2JA7 J;  2E2J J;  2EB7 A;  4XLA A;  1UHW A;  3K0L A;  4AM3 A;  1XG1 A;  2W4S A;  1TW2 A;  3GCM A;  2ID6 A;  1OFC X;  3E6M A;  1MGT A;  2ZC2 A;  2LOO A;  2OD5 A;  4M71 A;  2Z5U A;  1J59 A;  3R0A A;  1LUJ B;  3EUK L;  4BKX A;  5TRD A;  4FT8 A;  2VQH A;  3F21 A;  1ZR2 A;  1JHH A;  1WRJ A;  3L7W A;  1OCO H;  3FF5 A;  4XKV A;  2BGC A;  4OIN F;  3HOU J;  2XAQ A;  4UHT A;  4Y15 A;  4U0Y A;  1K7A A;  1YW8 A;  1M1E B;  1HA8 A;  3C7J A;  2M34 A;  3A0B C;  4KIG A;  2QLZ A;  2B0L A;  3DKY A;  1H8A C;  3OY9 A;  1ON1 A;  1YTY A;  3HRU A;  1MJ9 A;  3P9K A;  5J40 A;  1PYV A;  4EAT A;  2W48 A;  3A4C A;  4NUB A;  2J5P A;  3QYF A;  1U78 A;  2R92 J;  2XHK A;  1UCR A;  3LQQ A;  1V54 H;  4E6K G;  2H27 A;  1FY7 A;  3K1N A;  4V2G A;  2PLY A;  3KPH A;  3KP2 A;  4M9Z A;  4C3H J;  1W5C C;  3BJA A;  5ICC A;  3QRF F;  2LTP A;  2WAQ A;  4NC6 A;  2GIZ A;  2P7V B;  4LFU A;  3VYT B;  2W84 A;  2VKD A;  1IN5 A;  3JCU C;  4IRI A;  3OYN A;  1GV5 A;  3I55 I;  1JT0 A;  4ZDO A;  1K61 A;  3UKG A;  1G2H A;  4Y4R A;  4ESB A;  3WG7 H;  3RKY A;  4HDV A;  1VND A;  3HDD A;  1A04 A;  1MBH A;  1F9N A;  4AVP A;  4PJJ A;  4I0B A;  1IF1 A;  5M3M J;  2A5W A;  2DA6 A;  3DXJ F;  3RTR A;  4ESF A;  1PUF B;  1R4M B;  2K4J A;  3PQK A;  1BOB A;  1BW6 A;  2A3S A;  2D1V A;  3KEY A;  4RGS A;  2STW A;  1OKR A;  1LJ9 A;  1DU6 A;  2KIS A;  4R1H A;  5DCF A;  4HLY A;  3BQZ A;  2ZME A;  5F0H A;  4CZC A;  5IP7 J;  4G12 A;  3DKX A;  2E71 A;  3MZY A;  3WGG A;  2HTS A;  3IP4 B;  3SHF A;  3F3X A;  3IWF A;  2HOT A;  5LGN A;  1RC9 A;  1RKW A;  3F8N A;  3R60 A;  4HF0 A;  4XIC A;  3IKT A;  1RI7 A;  1BR2 A;  2XPW A;  1SFU A;  4A3C J;  4G94 A;  3K1M A;  1IN7 A;  4ZDL A;  3ZN1 A;  5DCM A;  4P9F A;  3W3C A;  3SYT A;  1WJD A;  1X2M A;  4M6X A;  1RET A;  2X6W A;  3GZ5 A;  3DKW A;  4IRH A;  1XD7 A;  2XB0 X;  2W7N A;  2L4M A;  1QA6 A;  3J7Y J;  4X6A J;  1BC7 C;  2VC1 A;  3OYB A;  2M9H A;  1ZRC A;  1XSV A;  4BU2 A;  1T39 A;  1T38 A;  3WHB A;  1GV2 A;  3ABT A;  1U0J A;  4DYQ A;  2HVQ A;  4RGX A;  2DI3 A;  3OYD A;  3OMY A;  5KAF C;  2O8K A;  1FSH A;  4CUG A;  5CLS A;  1LFB A;  3G1L A;  5K1Y A;  4UUS B;  3CMY A;  3R61 A;  3KP4 A;  2E19 A;  2BXZ A;  3W6V A;  1FIP A;  1QQI A;  3C2H A;  1R5I D;  2L2O A;  2PJR B;  1FBS A;  4IKF A;  2EK5 A;  2UXX A;  4EM1 A;  2ZJP F;  2PBI A;  2NYX A;  4BBS J;  4Q4Z F;  4ANJ A;  4F93 B;  1I6X A;  2EV0 A;  3Q0U A;  4WF2 A;  1IRZ A;  5IPA A;  2RKH A;  1DPR A;  5CVI A;  5AON A;  1U3E M;  2DFI A;  3CMM A;  1S72 I;  3DLA A;  3KYL A;  1XS9 A;  1WZ2 A;  1OYY A;  1ACI A;  4XR6 A;  4IX7 A;  1OR7 A;  1EKE A;  2D2W A;  1MBK A;  4XQF A;  1AOY A;  1J0R A;  4QPO A;  4H0E A;  4QTR A;  3MFK A;  3RPU A;  2M2E A;  3OYE A;  4L5J A;  1V5G A;  4ASN A;  3GTK J;  1R6R A;  2PEX A;  1R9T J;  3LAJ A;  5BPI A;  4PJM A;  1X4P A;  3WTS C;  5BOX A;  4QWQ A;  2AXT C;  1YJ9 I;  5FLX K;  3F23 A;  2ZME C;  4B47 A;  1QNT A;  4M72 A;  3JTG A;  4I76 A;  3DV8 A;  2IT0 A;  3HOS A;  1ERD A;  2L9N A;  1BR4 A;  5LHI A;  1S7O A;  3ABM H;  2G7U A;  1LB2 A;  1NG6 A;  1W5T A;  4CYD A;  5DDG A;  2IW5 A;  2X0L A;  3I59 A;  3RYR A;  5J1U A;  2MH9 A;  1YE9 A;  2JT1 A;  4OIP F;  2UXN A;  3ZRG A;  4XBF A;  3D5L A;  3ZGK A;  1R58 A;  3F6V A;  5H6Q A;  3A01 B;  3CCL I;  5ED4 A;  3WU0 A;  4HX7 A;  1W1W E;  1KON A;  4I7H A;  5F1R A;  4FX4 A;  1JUM A;  2P6S A;  1S29 A;  2KMU A;  3ESW B;  4UVA A;  4WXD A;  2R5Y A;  2VBX A;  1LQ1 A;  4PSW A;  5D5V B;  4FQG A;  1I3Q J;  1LDK B;  2DOD A;  3A02 A;  5CPR B;  2XVC A;  3JRD A;  2E2H J;  2PJP A;  2IA2 A;  2CQK A;  3FK6 A;  2EA4 A;  2ID3 A;  1FEX A;  4E7K A;  2DMP A;  4PCQ A;  3CUQ A;  2LH9 A;  1P4X A;  1QHG A;  4BDY A;  3OYF A;  1EH6 A;  4QIW N;  5A2Q K;  3BTL A;  5BMZ A;  4MQV A;  2CYY A;  2WV1 A;  3H1C A;  2QWW A;  2EFP A;  1P92 A;  4NNJ A;  4RM3 A;  2V9P A;  1CQT A;  5FFX A;  3IL2 A;  3FK7 A;  2ZNY A;  5DD4 A;  2LKX A;  2DO7 A;  1I5Z A;  1Y0U A;  3T5X A;  4U7B A;  1ZRF A;  2Q2E A;  1QZZ A;  4BYY A;  2NVX J;  2TDX A;  3L09 A;  2NNY A;  3Q5F A;  1YQA A;  4M3D A;  5DS9 A;  1KU9 A;  4IHT A;  2PX9 A;  5EDN A;  2YX7 A;  3GO5 A;  2DQL A;  4C2M J;  3JRB A;  4IQJ A;  1PDN C;  4F55 A;  3QOD A;  5IP9 J;  4YIF A;  4M74 A;  3OYJ A;  2CFO A;  4LG0 B;  1SMY F;  2NVY J;  1GXQ A;  3REO A;  3NRV A;  2CUF A;  3FXQ A;  3T0Y A;  2MLK A;  3DEW A;  3M9A A;  2HDC A;  4JQF A;  1EF4 A;  2EFQ A;  5CVR A;  3K70 C;  2AQF A;  3G1M A;  1YI2 I;  5IY5 H;  3OYK A;  2DA1 A;  3TGN A;  3PIP F;  3C2G A;  3CCV I;  1FZP B;  1OQY A;  3DEE A;  4HEA 2;  4HA8 A;  4FCY A;  2EPF A;  4W97 A;  4D7M A;  2MH2 A;  1S7A A;  3HRM A;  2KLO A;  1VTN C;  4FE7 A;  1LPQ A;  4WCG A;  4ZYD A;  3ZOB A;  3FMQ A;  1A31 A;  2DOA A;  3H5A A;  2J5O A;  1S7E A;  5CVJ A;  5J47 A;  2GWR A;  3BPV A;  1ZK8 A;  4C3J J;  4F52 A;  4N4O B;  2TCT A;  5FO5 A;  1DGW Y;  4CCK A;  1TQM A;  3GW2 A;  2RC4 A;  5C3E J;  5IT9 Z;  2IBD A;  3BR3 A;  5DEQ A;  3F9K A;  1FOX A;  3TDZ C;  3E6C C;  4RGR A;  1BIA A;  5FKK A;  1KZH A;  3HUG B;  4EJU A;  1ETW A;  4ITV A;  5HS8 A;  1JJ6 C;  2XF5 A;  4RB2 C;  4BE2 A;  3WTY C;  3CO6 C;  5J1Y A;  1U9N A;  3K4K A;  1T0F A;  2Z33 A;  4V2F A;  1FX7 A;  2ECC A;  2GIV A;  5F64 A;  4KIS A;  3NEU A;  4NBQ A;  3MVP A;  5ICE A;  2KZV A;  1Y1V J;  2NS8 A;  2DCE A;  2XGE A;  3CUQ C;  4TV7 A;  1VQM I;  1UHM A;  3BWG A;  2PG4 A;  3O3K A;  1X3W B;  5F27 A;  3VWB A;  2E36 A;  2O9L A;  1LVA A;  1QZE A;  2UV1 A;  1FYM A;  1TT5 B;  3PNV A;  1TQP A;  2C6Y A;  2EIL H;  2M8G X;  1H89 C;  1LE8 A;  2L3D A;  2R7V A;  3V8K A;  1Q1H A;  4I09 A;  4BS9 A;  1HOM A;  1U8R A;  2D45 A;  3VYS B;  3MN2 A;  3CF2 A;  2WBM A;  2OF7 A;  3ZR8 X;  4KN4 X;  2A68 F;  1VQ6 I;  1JI8 A;  2EJR A;  2AO9 A;  2EIK H;  3A1Y A;  4EJO A;  4PDK A;  2MGQ A;  3E3V A;  4XL9 A;  5ILU A;  1KQ8 A;  2QSF X;  2R5Z B;  1ZLJ A;  2IGN A;  4LJZ F;  3RZD J;  1GUU A;  1YRN A;  2ZB9 A;  5AIP A;  3CCM I;  2KKO A;  1E3O C;  3EYY A;  1B72 A;  4UUT A;  2R7X A;  4Z6Y A;  4X0G A;  1K78 A;  1RR7 A;  2LY2 A;  3FXM A;  4IVN A;  3CDL A;  3VOE A;  4RB3 C;  4B09 A;  1FSE A;  1X3U A;  4Y17 A;  3LSP A;  1HKT A;  3S3M A;  2XRO A;  4MHG A;  3IRR A;  1A35 A;  4O5V A;  2L0K A;  3TDU C;  3CUQ B;  3MKY B;  2ICW G;  3OSG A;  4BUP A;  4XRS G;  2BY3 A;  1XDU A;  2V4J C;  2W57 A;  2DPU A;  4M3G A;  4EJT A;  3FXJ A;  1YO5 C;  1K6O A;  3CD6 I;  1W7P D;  3M4O J;  3K2Z A;  3ECH A;  2FBH A;  2M5W A;  3H9G A;  2XAU A;  1UJ8 A;  1A5J A;  1QBJ A;  3H5R A;  3QAH A;  1FMW A;  2DPD A;  2MSY A;  3V42 A;  4A0Y A;  3CME I;  3J80 K;  2EIN H;  1KYW A;  3OOP A;  5J1R A;  2Q1Z B;  2XC7 A;  4HV6 A;  3GVA A;  3E5Q A;  1ZRD A;  4M3B A;  2K7L A;  2LLK A;  2ETH A;  3BJO A;  1VQL I;  2Q2E B;  2QCO A;  4ZYG A;  2O7O A;  2Y9Y A;  1I1S A;  1ZYR F;  1WCM J;  2ZFW A;  3FXU A;  2ESH A;  3ZMT A;  4WWC A;  2A69 F;  3OS2 A;  3IV5 A;  2DYS H;  2Z3Y A;  1SEU A;  4FIS A;  4FE4 A;  1AWC A;  1JXS A;  4JX5 A;  3ZQI A;  2HDW A;  2PMZ N;  4UY8 I;  1O3R A;  2X9D A;  3CP8 A;  3PL8 A;  3LSK A;  1P6R A;  1FOY A;  3OWT A;  3DP7 A;  3L00 A;  1V3F A;  4NC7 A;  3WGH A;  4DJA A;  2O61 A;  3A2K A;  3OS0 A;  3MKL A;  5HS7 A;  3FM3 A;  3OYA A;  1XMA A;  1T0F C;  2K9N A;  1U5T A;  1MD0 A;  3GLL A;  5KHD A;  2W85 A;  4G9Y A;  2HQN A;  2RDP A;  3JRG A;  3ZQF A;  2FMY A;  2VAS A;  2XAJ A;  2QUF A;  2FX0 A;  3PIO F;  5FD5 A;  5E20 A;  3DBH B;  3KP3 A;  2M30 A;  2KPM A;  2M45 A;  5HNF A;  2X51 A;  4PFP A;  1JJ8 C;  1WJF A;  3GEZ A;  1VQK I;  2X6Y A;  1XC5 A;  4RAY A;  2Z16 A;  1BW5 A;  2BW3 B;  3HG9 A;  1PUF A;  4BL0 B;  4L18 B;  3EUA A;  5D8L B;  4DIQ A;  3CJN A;  1HQC A;  4YFK F;  1ZKG A;  3BG3 A;  3LAP A;  4RGU A;  4EJV A;  1WHU A;  1SD4 A;  1MZB A;  2IGO A;  3LST A;  2DA7 A;  2NS0 A;  5FD6 A;  2IS4 A;  2OBP A;  2GOM A;  4ESJ A;  1S3J A;  2UUZ A;  3K1P A;  4HNU A;  1ETO A;  2O0Y A;  5E3O A;  2ADU A;  5HLT A;  3F8B A;  5K7Z A;  4I2O A;  1V5F A;  1YYV A;  2OUM A;  4BXU A;  1JE8 A;  4QPQ A;  3HBL A;  3OOU A;  4CYC A;  4OIQ F;  1F4K A;  1USS A;  2Z99 A;  2BEO A;  4M3F A;  4CDG A;  1DP7 P;  1Y8Q B;  2IEK A;  1Z9C A;  1SFE A;  4FAS D;  4DGW B;  4A3J J;  4YRV A;  3PNY A;  2KL4 A;  2RQQ A;  4QSH A;  2QEN A;  1W36 C;  2Y0S N;  4BJ6 C;  4XLC A;  2AXL A;  3OYG A;  4OAZ A;  5JLX A;  3MKW B;  3U21 A;  2KDO A;  2O5R A;  3OR1 C;  3K10 A;  2CJJ A;  3GFI A;  1P9Q C;  2LG4 A;  2P81 A;  2XAS A;  3J7A O;  5FFZ A;  5FKO A;  2DOF A;  4A3D J;  2NOJ B;  2V26 A;  3ECO A;  4JX6 A;  3BDD A;  1DQU A;  1JUP A;  4GGG A;  5D6F A;  2H09 A;  4IOA F;  2HZT A;  2KDZ A;  2OA4 A;  2WAF A;  2BYV E;  3HGY A;  1NH3 A;  2COM A;  2L4A A;  2ZXI A;  3GYH X;  4UUS A;  2FML A;  2P5V A;  2IS6 A;  4OIR F;  2EZK A;  4XK4 A;  2PJR A;  6PAX A;  2MYS A;  1XN7 A;  5K5Q A;  2B9S A;  4UVB A;  3CCQ I;  2YPR A;  4BQN A;  1WJA A;  3HHG A;  2JA6 J;  2WY8 Q;  1HW2 A;  4EGY A;  3GX4 X;  4M73 A;  1I1G A;  4CH7 A;  1YW9 A;  2WB1 N;  2CUJ A;  4AU7 A;  3CCE I;  4JX4 A;  1U5T C;  2A07 F;  1T6S A;  2BVL A;  4UXN A;  2RRE A;  3A0H C;  1ULY A;  1I39 A;  3SEQ A;  1VQ5 I;  1XMK A;  3BPX A;  1BJA A;  1C0W A;  3KYC B;  5GP9 A;  4Q5S F;  2XV4 S;  3JTH A;  1Z67 A;  2OCC H;  3K9T A;  4A6E A;  5E18 F;  3WTV C;  1TWA J;  2X48 A;  1ETV A;  5JI6 A;  2QBY A;  4UNO A;  3DQV C;  4CGZ A;  5DD8 A;  3Q9S A;  4P1W A;  3OV8 A;  2DJI A;  2QM3 A;  3CP2 A;  2DA5 A;  2LP0 A;  2G9W A;  3NWS A;  1D0X A;  3WTX C;  1LDJ A;  2V6C A;  1FLI A;  1GHC A;  2X1E A;  3HKZ A;  5E1Z B;  2VJ4 A;  4HPQ A;  1T95 A;  1N78 A;  1MJA A;  3C3W A;  3S8P A;  1YS6 A;  3IUO A;  5DYM A;  2LMD A;  3B73 A;  4XKB A;  2RQP A;  4ENJ A;  5CKT A;  1O7F A;  2KIU A;  3U2R A;  2L9V A;  4CCN A;  1IRG A;  2L7K A;  3RI4 A;  4BDZ A;  2K27 A;  1WKM A;  1N77 A;  4IXA A;  2BHY A;  2QQA A;  5DTD A;  2KZG A;  1D1C A;  4XLH A;  2ZCW A;  3N97 A;  1FYK A;  1Y6I A;  5HDK A;  1U5T B;  2OU2 A;  1R71 A;  4EV0 A;  1HDD C;  2CV0 A;  2K3F A;  3K4N A;  1JT6 A;  2JZY A;  1HW5 A;  2R7F A;  3Q0W A;  1ZG5 A;  3MWM A;  4IHX A;  1PUE E;  3CQZ J;  5L3C A;  3F72 A;  3OYC A;  3LSR A;  1MSF C;  1FYL A;  3H3Z A;  2PN6 A;  4PK4 A;  4A3M J;  2EH3 A;  1ZR4 A;  3H9Q A;  1O4X A;  5LLQ A;  4A0Z A;  3O8H A;  4MLO A;  1BI0 A;  3NWT A;  1YFH A;  1PJR A;  2V79 A;  1UMQ A;  3F6O A;  4XNF A;  2GAU A;  3UR3 C;  3KP6 A;  2LBF B;  4AVZ A;  1IZ1 A;  4HST A;  2QGU A;  4HX4 A;  3VSL A;  4H4K C;  1J2X A;  5D5X B;  4YEL A;  4BNC A;  3HOZ J;  3L2R A;  2O03 A;  2JA8 J;  2JRT A;  2K02 A;  4NC8 A;  1MSE C;  5D4S A;  5LGU A;  4U7D A;  2K5C A;  4II3 A;  4CYC B;  1ZGW A;  3ZP5 A;  2VQC A;  3GTM J;  3ZQG A;  5HDG A;  3BTJ A;  2HEO A;  4A5N A;  1DU0 A;  1N25 A;  1UZC A;  4AIK A;  4EM0 B;  3BZK A;  2HPI A;  4NQW B;  4LG0 A;  4ENN A;  3C18 A;  2FOK A;  3KZI C;  1HST A;  2JPB A;  2LRD A;  1ZGJ A;  2F5E A;  3KP7 A;  4PZJ A;  4P55 A;  4HLX A;  2VOP A;  4Y3O A;  1MMA A;  1BJZ A;  1BI2 A;  1JKO C;  1IV6 A;  2CMP A;  2FUG 2;  2OAZ A;  2CSO A;  3OYL A;  4N0B A;  2DDB A;  4KN7 X;  5EYR A;  3GTJ J;  4XRM A;  4KNY A;  4A0X A;  2DTZ A;  4GO1 A;  1J7K A;  2VXZ A;  2Z1D A;  3S17 J;  1XTA A;  3BT9 A;  3KP5 A;  1J9I A;  3DEU A;  5GAE J;  2ISY A;  4D1Q A;  2F5V A;  4ZC3 A;  3L2W A;  3KLO A;  2UZK A;  2ZJR F;  1D0Y A;  3SZT A;  2Q8K A;  3ULQ B;  5H2F C;  2V6E A;  3I4N J;  3HSF A;  2E7W A;  3TO9 A;  3CCS I;  4A3E J;  1QGP A;  1NK3 P;  1J75 A;  1BIB A;  4D5C A;  2F5F A;  2WTE A;  2XRL A;  3ISP A;  3QYE A;  1TWF J;  2PMH A;  1MBG A;  2M4K A;  3BR2 A;  4W1U A;  3WTZ A;  3TOA A;  2IGM A;  4Y52 J;  1X3Z B;  3M07 A;  1GT0 C;  4IJA A;  3OS1 A;  2PFB A;  1G3T A;  3HXL A;  2GA1 A;  2AS5 F;  3BR1 A;  3H92 A;  4IPA A;  2E1C A;  1U2W A;  4BE1 A;  1H88 C;  2HYG D;  3HUG A;  4PJ0 C;  4GRI A;  5IOY A;  2ISZ A;  1X1A A;  2K3P A;  1JHF A;  1MBJ A;  2BZT A;  1VQ9 I;  1R4N B;  4BJT A;  1IXS B;  4U87 A;  4CCO A;  2BHZ A;  3HHH A;  2VC0 A;  4UV8 A;  5ICG A;  5GAD J;  1YW7 A;  4PGH A;  1SVL A;  4F7Z A;  2CRG A;  2W00 A;  2H1L A;  4L9T A;  1QVU A;  1NK2 P;  2O6G E;  2HTJ A;  2DFF A;  3CJT B;  3L2Q A;  3DBR B;  3WU1 B;  1VF9 A;  1RRJ A;  1TC3 C;  2QBY B;  2CV1 A;  3A01 A;  2L7F P;  1KU2 A;  3R6S A;  5D8K B;  3ZPL A;  1HKQ A;  3V7C A;  3RIR A;  3SQN A;  3IH3 A;  3CTA A;  2E5N A;  3FM5 A;  1OCP A;  2HQ5 A;  2F2E A;  5JLW A;  4RLF A;  2FNP A;  2GLO A;  2ZO4 A;  4BXX J;  4N9I A;  2W25 A;  3PUB A;  1ONV A;  3BZ6 A;  3JSP A;  3IRQ A;  3RJP A;  2MFZ A;  5DM7 F;  4XLN F;  1I27 A;  1W7P A;  2G7H A;  3RKX A;  3WTW C;  3WE3 A;  1G4D A;  2VPR A;  2ZBK A;  3GZ6 A;  2V1D A;  3OIP A;  3W6K B;  1Y56 A;  2DK5 A;  3TBI A;  2R5Z A;  4RAZ A;  1HXD A;  2HVR A;  5CQG A;  4EVI A;  3I5U A;  4MQ9 F;  5BQT A;  3GTQ J;  2ME0 A;  3E0J B;  4ZYH A;  4BGD A;  3WTU C;  3IKV A;  4Q48 A;  2L5Q A;  1LDD A;  1OJL A;  1RR8 C;  1ZHF A;  2QZ8 A;  4ON0 A;  2EZI A;  2MBF A;  3KZY A;  1JGS A;  1XGS A;  2LF7 A;  2JJ7 A;  3QPT A;  4L5E A;  1ETY A;  4DZP A;  2KIQ A;  4AIH A;  4G6D A;  1WJE A;  5JR3 A;  2VE9 A;  3JRF A;  2CFX A;  2DU9 A;  4RBO A;  4PGG A;  4HW0 A;  5HS9 A;  1IUF A;  4LIV A;  3DU5 A;  3W6J B;  5DV5 A;  1LVK A;  4LB6 B;  1X4O A;  4N4N B;  1EJ9 A;  2E5Z A;  4MEY F;  1EH7 A;  5EZG A;  2VKH A;  3X2Q H;  5D5W B;  2FRH A;  4G6Q A;  2VI6 A;  2DXI A;  2DYR H;  4BH9 A;  2XKP A;  1ZN2 A;  2XUB A;  3I64 A;  4BHB A;  2HYJ A;  2VE8 A;  4L9J A;  2WAQ N;  1D1A A;  5AIQ A;  5B1A H;  4U88 A;  5HVQ C;  2Y48 A;  3NAU A;  3I0T A;  4LLG F;  1HLV A;  3M1C A;  1KQ9 A;  1TTY A;  5EEG A;  1X58 A;  2NVU B;  3JRC A;  4UUV A;  2VOO A;  4GCV A;  3TMO A;  3JAM Z;  2CQX A;  4CXF A;  2IA1 A;  3I9V 2;  3LNQ A;  1Z05 A;  3BOQ A;  2FNA A;  4LK1 F;  4M9S A;  3CCR I;  5IT9 K;  1SMT A;  2FF4 A;  2EFN A;  4DW6 A;  4GFB A;  2I5U A;  5J8C A;  1TWC J;  2VBY A;  3I4P A;  4YEJ A;  3SZP A;  4RAF A;  4Y33 A;  1S9H A;  4HG2 A;  1S8N A;  4I0A A;  4DYC A;  2FSW A;  1UFM A;  3GTL J;  1LEA A;  1OMI A;  3BR6 A;  2H8W A;  1R1V A;  1F5T A;  3TQN A;  1FP1 D;  2I10 A;  2LKP A;  2VUM J;  5DUI A;  4O3M A;  2XSJ C;  3Q0V A;  4LK0 F;  2BW3 A;  4HBL A;  1D8K A;  3BG5 A;  4B3X A;  5IOZ A;  5B1B H;  2GBY A;  2JA2 A;  3U9G A;  5KCM A;  1K4T A;  9ANT A;  2JRM A;  4XSX F;  4Q47 A;  3G71 I;  4V19 K;  2W24 A;  4E7L A;  4II2 A;  4E7S A;  1JTY A;  2JQ7 A;  1REP C;  3GBG A;  1I50 J;  2KHM A;  3K4M A;  3PO2 J;  1YHQ I;  2BVM A;  4OIO F;  2Q0O A;  2MG4 A;  5GTH C;  3P5J A;  1J09 A;  2HS5 A;  1Z3X A;  2LNB A;  2X4H A;  4F3Q A;  1E17 A;  1WJB A;  1SVO A;  3TO6 A;  1K79 A;  1TT0 A;  4G7O F;  3W2V A;  1QZY A;  1FC3 A;  3RPQ A;  1D0Z A;  2RVC A;  2DMQ A;  4LLN A;  4HF2 A;  1TWG J;  4XOP A;  3TED A;  2IS1 A;  2EFO A;  3CJR B;  4LOC A;  1P4W A;  3TP3 A;  3C2B A;  2Z2S B;  4QLC U;  4B1R A;  3RKW A;  4B3A A;  2HZD A;  2WAD A;  2DOE A;  4BJ5 C;  1W4M A;  1STZ A;  5B5E C;  3B02 A;  3FIW A;  1DUX C;  3HOY J;  1FOK A;  5E17 F;  5M5W J;  3PSI A;  2BOL A;  3QPS A;  4M6Y A;  2LDU A; 
#chains in the Genus database with same CATH homology
 3QU3 A;  2LSO A;  4P9U A;  2FBI A;  2FBK A;  5LBQ A;  3LWF A;  4HQE A;  1SAX A;  1Z6R A;  1PP7 U;  4E70 A;  1B9N A;  3EDP A;  3IC7 A;  1W7P B;  1ZG3 A;  2QQB A;  1SFX A;  5CYV A;  5H20 A;  5KK1 A;  4YII A;  3KLN A;  1RIO H;  1R5G A;  3QU6 A;  3J81 Z;  5F6F A;  5TJJ A;  1O3Q A;  1MDM B;  3COA C;  4G7Z F;  3Q9V A;  3ZN0 A;  3O6B B;  1R22 A;  2DT5 A;  2XAF A;  5ILV A;  1R23 A;  2XKO A;  4WK8 F;  3PQJ A;  5H6R A;  4FX0 A;  2YSR A;  1ODD A;  3DF8 A;  4GYI A;  2PI0 A;  1B1B A;  3E5X A;  3QPH A;  3V8J A;  3HTS B;  3S2W A;  3WG9 A;  4XSZ F;  1V4R A;  1KYZ A;  1OYI A;  2IVM A;  2IRF G;  1EV7 A;  1FNN A;  2EV5 A;  3JSO A;  4A5M A;  3HYI A;  5D6E A;  1R1T A;  3WE2 A;  1QPM A;  4KUM A;  2HKO A;  3ZMS A;  1KA8 A;  3CO7 C;  2KIF A;  1RNL A;  5JVT A;  3SFZ A;  3FMR A;  1L0O C;  2BV6 A;  4HF1 A;  1Z91 A;  2P8T A;  2IP2 A;  1B4A A;  3ZMD A;  2QVO A;  3GWZ A;  3DFG A;  3V4G A;  4WX9 A;  4L9N A;  1H0M A;  3LQR A;  5J6X A;  2A5Y B;  1QO0 D;  2K4B A;  5FB2 A;  1IUY A;  5CVV A;  4JBA A;  1FPQ A;  1P4A A;  3EYI A;  5BPD A;  4UVC A;  5CJ9 A;  4L0Z B;  2VN2 A;  1MKM A;  3MQ0 A;  2ACJ A;  1ZAO A;  1PP8 F;  4DNC A;  2R7D A;  2E1N A;  1IAW A;  5IT3 A;  2ELH A;  1TBX A;  4NQW A;  4KIF A;  5LRR A;  4U0V A;  4KMU X;  1S6L A;  1CF7 B;  1L3L A;  3DPT A;  3WTT C;  2HOE A;  5CVU A;  4WXH A;  4ENK A;  1KU7 A;  2HFH A;  2DK8 A;  2XAG A;  1BOA A;  3RDI A;  2FXA A;  4KYW A;  5J8F A;  2KJC A;  4OMY A;  4KFC A;  2DBB A;  2QQ9 A;  2OQG A;  2A6E F;  4M9X A;  3R0J A;  2FU4 A;  3E97 A;  4BAY A;  1ZGA A;  2A61 A;  2MA3 A;  2F5C A;  1UB9 A;  2RGV A;  3V7S A;  3CDH A;  3C1D A;  5FGM A;  1IXR C;  1H9T A;  5L3D A;  1TQI A;  3LA3 A;  3SXY A;  3MZH A;  2QYO A;  4BQA A;  5L3B A;  2FQ3 A;  3ABU A;  3AAF A;  1HKS A;  5ICF A;  4XLP F;  4RB0 A;  1GVJ A;  4A2U A;  5D5U B;  2L02 A;  2FA5 A;  4P5O A;  3F8C A;  1H9G A;  2HKX A;  2MC3 A;  1SD5 A;  5E1X A;  4EQQ A;  3N4M A;  2XGX A;  1YG2 A;  3GFJ A;  1FP2 A;  4I98 B;  3M8E A;  2FEZ A;  2HR3 A;  2K86 A;  1HW1 A;  3KCC A;  3V7R A;  2VBZ A;  4CIC A;  2YX4 A;  4KIC A;  1GXP A;  1R00 A;  2CO5 A;  1TNT A;  1EH8 A;  1YS7 A;  3VEP A;  1WI9 A;  3KFW X;  3I58 A;  1KGS A;  1O3T A;  3HIF A;  1ZAR A;  3CLO A;  2VT3 A;  1RZ4 A;  3BY6 A;  1O57 A;  2DLL A;  4EM2 A;  2GZW A;  3KEO A;  1XCB A;  1E2X A;  4LLL A;  4I01 A;  2VON A;  2NNN A;  1R7J A;  2DW4 A;  1LNW A;  5JFR A;  5L3G A;  3KET A;  3KEQ A;  5L3E A;  2JPC A;  2KIM A;  2HYF A;  4ETS A;  2HGC A;  2ZKZ A;  4Z2Y A;  3DPL C;  4WXC A;  1TW3 A;  2EV6 A;  4L0Y B;  5LEJ A;  4YFN F;  3F22 A;  3ELK A;  2EWN A;  5DUK A;  1ZRE A;  4CZZ A;  4KMF A;  1O7L A;  1XGO A;  3JW4 A;  4N9H A;  2LF8 A;  4AD9 A;  5ERI A;  3QOP A;  1SD6 A;  2XRN A;  1CGP A;  1G3S A;  3ZMU A;  1FWZ A;  3I54 A;  1XSX A;  4DQ2 A;  3MCZ A;  4AIJ A;  2ESN A;  4MEX F;  4EJW A;  4S05 A;  3WGI A;  2M87 A;  3NQO A;  4P96 A;  4IHS A;  2KRF A;  2JSC A;  4R8H A;  2V9V A;  3O2P E;  4HZF A;  2PQ8 A;  3FMS A;  2Y75 A;  2L54 A;  2O8X A;  2IJL A;  1LEB A;  3ML6 A;  4HAM A;  1BN5 A;  1WQ2 A;  3JAM K;  2IA0 A;  4RB1 A;  3MAJ A;  4RS8 A;  1G6N A;  4KIB A;  2UWM A;  5HDN A;  2IPQ X;  4OMZ A;  3ZQ7 A;  1MDM A;  4HOB A;  3KE2 A;  3LA2 A;  1OPC A;  4Y13 A;  3K69 A;  2NRA C;  2BBY A;  3HOT A;  4U0W A;  2WV0 A;  5HLG A;  1MJB A;  3TOB A;  1XDS A;  4L9V A;  1IXC A;  1IN8 A;  3E5U A;  3TO7 A;  3T8T A;  2VOD A;  4OOI A;  3QP5 A;  1F1Z A;  4MTD A;  1TNS A;  1XCV A;  4EMS A;  5FLX Z;  5BS6 A;  2ZME B;  2DQR A;  2E7X A;  1G3Y A;  2XIG A;  3GFL A;  3I53 A;  3HTU A;  3FX3 A;  5LGT A;  3GLX A;  4LMY A;  1BC8 C;  2L01 A;  2VBW A;  1KQ0 A;  4GXO A;  5DCM B;  4EGZ A;  2WWY A;  1ON2 A;  1IW7 F;  2YR2 A;  5LRS A;  4LB5 A;  3U1D A;  4IRG A;  3GFM A;  3PFI A;  4BHC A;  1D3Y A;  5A2Q Z;  1BM9 A;  5KVR A;  1D8J A;  3FZV A;  3ROU A;  4NB5 A;  5EEH A;  3ZMV A;  3D0S A;  2HWV A;  4L5I A;  3J81 K;  1G3W A;  4BHP A;  2H94 A;  5LHH A;  3HSE A;  4O6J A;  3MEX A;  3FWE A;  5HOO A;  2RN7 A;  2V1X A;  5K5R A;  1XSD A;  3FHZ A;  3E6D A;  4KA4 A;  1CF7 A;  1Z6T A;  2P7C B;  1BBY A;  3G73 A;  2KJB A;  3H3U A;  3QP6 A;  2H6B A;  1OYW A;  3F8M A;  5HLI A;  3F8F A;  4A6D A;  1YLF A;  2P5K A;  1FT9 A;  4MGR A;  4LD5 A;  1ZLK A;  5LEK A;  2ZXJ A;  3CUO A;  4GYG A;  3TKY A;  2GQQ A;  4JK1 X;  4CO8 A;  3VFZ A;  3T1B A;  1D5V A;  3E6B A;  3LA7 A;  2MD5 A;  4S04 A;  1BI3 A;  3R4K A;  5L3F A;  3M8F A;  1NHA A;  1T98 A;  4HYE A;  3L9F A;  3G3Z A;  3I59 B;  4KT5 C;  2FE3 A;  4OU0 A;  3RYP A;  1YIO A;  1XGN A;  1RUN A;  1DPU A;  2RNJ A;  4I02 A;  1HSJ A;  1IRF A;  4R79 A;  1R36 A;  3HRT A;  2CWE A;  3ZMZ A;  2OZU A;  2P4W A;  2F5D A;  3V8L A;  1XGM A;  4UV9 A;  3VOD A;  3KZZ A;  4ZZL A;  1UST A;  3EQL F;  4HQM A;  5E8G A;  1DDN A;  3T8R A;  4LGW A;  4MNU A;  3IHU A;  4HV5 A;  2BE5 F;  2DAO A;  3BRO A;  2Z9O A;  4XRF A;  2HQR A;  4A12 A;  5JHU A;  1BI1 A;  1FBQ A;  2VT2 A;  4HX8 A;  1HBX G;  4G8X A;  4CHU A;  3GF2 A;  1B59 A;  4AWX B;  4MTE A;  1Z7U A;  2M1B A;  2ZJ2 A;  4ZZD A;  2RV8 A;  4ZH4 F;  2V1U A;  2NAZ A;  1IN4 A;  3L2C A;  5D4R A;  2STT A;  2ZNZ A;  2OZ6 A;  1J5Y A;  2WC2 A;  2JTV A;  3J80 Z;  2Y0M A;  4D0P A;  2GXB A;  5E1W A;  3WOD F;  1FBU A;  3P7N A;  3P9C A;  4FHT A;  1U6G A;  3BP8 A;  1R1U A;  2P6T A;  2DTR A;  3HSR A;  1P2F A;  5LHG A;  1W5S A;  1RUO A;  2MLG A;  2PMU A;  4HDU A;  3EUH A;  1ZH5 A;  3LFK A;  4KDP A;  2R3S A;  4K2E A;  2A6H F;  4YFX F;  1XB4 A;  1B6A A;  1IN6 A;  3FXR A;  3HRS A;  4YG2 F;  2M8E A;  3GUD A;  5K5O A;  3I71 A;  5ILS A;  3IWZ A;  1ZG1 A;  2EFW A;  2GXG A;  1T2K A;  1B9M A;  2CG4 A;  2CW0 F;  2XAH A;  3M1E A;  1Z1D A;  2EA2 A;  4IF4 A;  3EET A;  4B8X A;  5E8I A;  2D1H A;  3P9I A;  3VB2 A;  2CGP A;  1WWX A;  3M7G A;  2O3F A;  2P5L C;  1O3S A;  4NHJ A;  3BJ6 A;  1TLH B;  3GXO A;  2H6C A;  1R5H A;  1K78 B;  2OQR A;  3ERE D;  5HLH A;  2YU3 A;  2GA2 A;  1SD7 A;  1WSU A;  4G7H F;  1KU3 A;  4ZYE A;  2EB7 A;  1UHW A;  3K0L A;  1TW2 A;  3E6M A;  1MGT A;  2OD5 A;  4M71 A;  2Z5U A;  1J59 A;  3R0A A;  5TRD A;  4FT8 A;  3F21 A;  1JHH A;  1WRJ A;  3L7W A;  3FF5 A;  2BGC A;  4OIN F;  2XAQ A;  4UHT A;  4Y15 A;  4U0Y A;  1K7A A;  1YW8 A;  3C7J A;  4KIG A;  2QLZ A;  2B0L A;  1ON1 A;  1YTY A;  3HRU A;  1MJ9 A;  3P9K A;  2J5P A;  1U78 A;  2XHK A;  1UCR A;  3LQQ A;  2H27 A;  1FY7 A;  3K1N A;  2PLY A;  3KP2 A;  4M9Z A;  3BJA A;  5ICC A;  3QRF F;  2P7V B;  4LFU A;  2W84 A;  1IN5 A;  4IRI A;  4ESB A;  3RKY A;  4HDV A;  1A04 A;  1F9N A;  4AVP A;  1IF1 A;  4I0B A;  3DXJ F;  3RTR A;  4ESF A;  2K4J A;  3PQK A;  2A3S A;  2D1V A;  4RGS A;  2STW A;  1OKR A;  1LJ9 A;  4R1H A;  5DCF A;  4HLY A;  2ZME A;  3MZY A;  3WGG A;  2HTS A;  3SHF A;  3F3X A;  3IWF A;  5LGN A;  3F8N A;  3R60 A;  4HF0 A;  3IKT A;  1RI7 A;  1SFU A;  4G94 A;  3K1M A;  1IN7 A;  3ZN1 A;  5DCM A;  4P9F A;  4M6X A;  3GZ5 A;  3DKW A;  4IRH A;  1XD7 A;  2L4M A;  1BC7 C;  2VC1 A;  1ZRC A;  1XSV A;  1T39 A;  1T38 A;  3ABT A;  4RGX A;  2DI3 A;  1FSH A;  5CLS A;  5K1Y A;  3R61 A;  3KP4 A;  1QQI A;  1FBS A;  2EK5 A;  2UXX A;  4EM1 A;  2PBI A;  2NYX A;  4Q4Z F;  1I6X A;  2EV0 A;  4WF2 A;  2RKH A;  1DPR A;  5CVI A;  5AON A;  1U3E M;  2DFI A;  1OYY A;  1OR7 A;  2D2W A;  1AOY A;  1J0R A;  4H0E A;  3MFK A;  3RPU A;  4L5J A;  4ASN A;  2PEX A;  3LAJ A;  5BPI A;  3WTS C;  5BOX A;  4QWQ A;  5FLX K;  3F23 A;  1QNT A;  4M72 A;  3JTG A;  2IT0 A;  3DV8 A;  3HOS A;  5LHI A;  1S7O A;  2G7U A;  1LB2 A;  1W5T A;  4CYD A;  5DDG A;  2IW5 A;  2X0L A;  3I59 A;  3RYR A;  2MH9 A;  2JT1 A;  4OIP F;  2UXN A;  4XBF A;  3D5L A;  1R58 A;  3F6V A;  5H6Q A;  5ED4 A;  3WU0 A;  4HX7 A;  4I7H A;  5F1R A;  4FX4 A;  2P6S A;  1S29 A;  4UVA A;  4WXD A;  2VBX A;  1LQ1 A;  5D5V B;  1LDK B;  2XVC A;  2PJP A;  2IA2 A;  2CQK A;  2EA4 A;  4PCQ A;  3CUQ A;  1P4X A;  1EH6 A;  5A2Q K;  5BMZ A;  4MQV A;  2CYY A;  2QWW A;  2EFP A;  1P92 A;  5FFX A;  3IL2 A;  2ZNY A;  5DD4 A;  2DO7 A;  1I5Z A;  1Y0U A;  3T5X A;  4U7B A;  1ZRF A;  2Q2E A;  1QZZ A;  4BYY A;  2TDX A;  3L09 A;  2NNY A;  3Q5F A;  1YQA A;  1KU9 A;  4IHT A;  2YX7 A;  3GO5 A;  2DQL A;  1PDN C;  4YIF A;  4M74 A;  4LG0 B;  1SMY F;  1GXQ A;  3REO A;  3NRV A;  3FXQ A;  3T0Y A;  2MLK A;  3M9A A;  2HDC A;  4JQF A;  2EFQ A;  5CVR A;  3TGN A;  1FZP B;  4HA8 A;  2MH2 A;  1S7A A;  3HRM A;  1VTN C;  4WCG A;  4ZYD A;  3FMQ A;  2J5O A;  5CVJ A;  2GWR A;  3BPV A;  5FO5 A;  1TQM A;  3GW2 A;  2RC4 A;  5IT9 Z;  5DEQ A;  3TDZ C;  3E6C C;  4RGR A;  1BIA A;  4EJU A;  5HS8 A;  4RB2 C;  3WTY C;  3CO6 C;  2Z33 A;  1T0F A;  1FX7 A;  2GIV A;  5F64 A;  3NEU A;  5ICE A;  3CUQ C;  4TV7 A;  1UHM A;  3BWG A;  2PG4 A;  3O3K A;  1LVA A;  1FYM A;  1TQP A;  2C6Y A;  2L3D A;  3V8K A;  1Q1H A;  4I09 A;  1U8R A;  2D45 A;  4KN4 X;  2A68 F;  2EJR A;  4EJO A;  4PDK A;  3E3V A;  5ILU A;  1KQ8 A;  1ZLJ A;  4LJZ F;  5AIP A;  2KKO A;  3EYY A;  1K78 A;  4IVN A;  3VOE A;  4RB3 C;  4B09 A;  1FSE A;  1X3U A;  4Y17 A;  1HKT A;  2XRO A;  4MHG A;  3IRR A;  4O5V A;  3TDU C;  3CUQ B;  1XDU A;  2W57 A;  2DPU A;  4EJT A;  1YO5 C;  1K6O A;  1W7P D;  3K2Z A;  3ECH A;  2FBH A;  2M5W A;  1QBJ A;  3QAH A;  2DPD A;  4A0Y A;  3J80 K;  3OOP A;  1KYW A;  4HV6 A;  3GVA A;  3E5Q A;  1ZRD A;  2K7L A;  2ETH A;  3BJO A;  4ZYG A;  1I1S A;  1ZYR F;  2ZFW A;  3FXU A;  4WWC A;  3ZMT A;  2ESH A;  2A69 F;  2Z3Y A;  1AWC A;  1JXS A;  1O3R A;  1P6R A;  3DP7 A;  3L00 A;  1V3F A;  3WGH A;  2O61 A;  5HS7 A;  3FM3 A;  1XMA A;  1U5T A;  1MD0 A;  2W85 A;  4G9Y A;  2HQN A;  2RDP A;  2FMY A;  2XAJ A;  2QUF A;  5FD5 A;  5E20 A;  3KP3 A;  2M30 A;  2M45 A;  3GEZ A;  4RAY A;  4L18 B;  5D8L B;  3CJN A;  1HQC A;  4YFK F;  3LAP A;  4RGU A;  4EJV A;  1SD4 A;  1MZB A;  3LST A;  2NS0 A;  5FD6 A;  2OBP A;  4ESJ A;  1S3J A;  3K1P A;  2O0Y A;  2ADU A;  3F8B A;  4I2O A;  1YYV A;  4BXU A;  1JE8 A;  4OIQ F;  1F4K A;  1USS A;  2Z99 A;  2BEO A;  4CDG A;  1DP7 P;  1Z9C A;  1SFE A;  2QEN A;  2AXL A;  3GFI A;  2XAS A;  3J7A O;  5FFZ A;  3ECO A;  3BDD A;  4GGG A;  5D6F A;  2H09 A;  2HZT A;  2OA4 A;  2BYV E;  2COM A;  2L4A A;  3GYH X;  2FML A;  2P5V A;  4OIR F;  6PAX A;  1XN7 A;  5K5Q A;  4UVB A;  2YPR A;  3HHG A;  1HW2 A;  4EGY A;  3GX4 X;  4M73 A;  1I1G A;  1YW9 A;  1U5T C;  2A07 F;  1T6S A;  4UXN A;  1ULY A;  1XMK A;  3BPX A;  1BJA A;  1C0W A;  4Q5S F;  2XV4 S;  3JTH A;  3K9T A;  4A6E A;  5E18 F;  3WTV C;  5JI6 A;  2QBY A;  4UNO A;  3DQV C;  4CGZ A;  5DD8 A;  3Q9S A;  3OV8 A;  2QM3 A;  2G9W A;  3WTX C;  1LDJ A;  2V6C A;  1FLI A;  1GHC A;  5E1Z B;  1MJA A;  3C3W A;  1YS6 A;  5DYM A;  3B73 A;  2RQP A;  4ENJ A;  1O7F A;  2KIU A;  3U2R A;  1IRG A;  3RI4 A;  2K27 A;  1WKM A;  4IXA A;  2QQA A;  2ZCW A;  3N97 A;  1FYK A;  5HDK A;  1U5T B;  2OU2 A;  4EV0 A;  2JZY A;  1HW5 A;  2R7F A;  1ZG5 A;  3MWM A;  1PUE E;  5L3C A;  3F72 A;  1FYL A;  3H3Z A;  2PN6 A;  5LLQ A;  4A0Z A;  1BI0 A;  1YFH A;  2V79 A;  3F6O A;  2GAU A;  3KP6 A;  1IZ1 A;  4HX4 A;  1J2X A;  5D5X B;  4BNC A;  2O03 A;  2JRT A;  2K02 A;  5D4S A;  5LGU A;  4U7D A;  3ZP5 A;  5HDG A;  2HEO A;  4A5N A;  4AIK A;  4EM0 B;  4LG0 A;  4ENN A;  3C18 A;  2FOK A;  1HST A;  2JPB A;  1ZGJ A;  2F5E A;  3KP7 A;  4PZJ A;  4P55 A;  4HLX A;  2VOP A;  1BI2 A;  2OAZ A;  2CSO A;  4N0B A;  4KN7 X;  4KNY A;  4A0X A;  4GO1 A;  1J7K A;  2VXZ A;  3KP5 A;  1J9I A;  3DEU A;  2ISY A;  4ENM A;  2UZK A;  3KLO A;  3SZT A;  2Q8K A;  3ULQ B;  3HSF A;  2E7W A;  3TO9 A;  1QGP A;  1J75 A;  1BIB A;  2F5F A;  2WTE A;  3ISP A;  2PMH A;  3WTZ A;  3TOA A;  4IJA A;  2PFB A;  1G3T A;  2GA1 A;  2AS5 F;  3H92 A;  4IPA A;  2E1C A;  1U2W A;  2HYG D;  3HUG A;  2ISZ A;  1JHF A;  1IXS B;  3HHH A;  2VC0 A;  4UV8 A;  5ICG A;  1YW7 A;  4PGH A;  4F7Z A;  4L9T A;  2O6G E;  2HTJ A;  3WU1 B;  2QBY B;  1KU2 A;  3R6S A;  5D8K B;  3ZPL A;  1HKQ A;  3V7C A;  3RIR A;  3SQN A;  3CTA A;  3FM5 A;  2F2E A;  2FNP A;  2ZO4 A;  4N9I A;  2W25 A;  1ONV A;  3BZ6 A;  3JSP A;  3IRQ A;  3RJP A;  4XLN F;  1I27 A;  1W7P A;  3WTW C;  2G7H A;  3RKX A;  3WE3 A;  1G4D A;  2ZBK A;  3GZ6 A;  2V1D A;  3W6K B;  2DK5 A;  4RAZ A;  1HXD A;  4EVI A;  3I5U A;  4MQ9 F;  5BQT A;  4ZYH A;  3WTU C;  3IKV A;  4Q48 A;  1LDD A;  1ZHF A;  2QZ8 A;  4ON0 A;  2MBF A;  3KZY A;  1JGS A;  1XGS A;  2LF7 A;  3QPT A;  4AIH A;  4G6D A;  5JR3 A;  2VE9 A;  2CFX A;  2DU9 A;  4PGG A;  4HW0 A;  5HS9 A;  3W6J B;  5DV5 A;  4LB6 B;  4MEY F;  1EH7 A;  5D5W B;  2FRH A;  4G6Q A;  4BH9 A;  2XKP A;  1ZN2 A;  2XUB A;  3I64 A;  4BHB A;  2VE8 A;  4L9J A;  5AIQ A;  4U88 A;  5HVQ C;  2Y48 A;  3I0T A;  4LLG F;  1KQ9 A;  1TTY A;  5EEG A;  4UUV A;  2VOO A;  4GCV A;  3JAM Z;  4CXF A;  2IA1 A;  1Z05 A;  3BOQ A;  2FNA A;  4LK1 F;  4M9S A;  5IT9 K;  1SMT A;  2FF4 A;  2EFN A;  5J8C A;  2VBY A;  3I4P A;  3SZP A;  1S8N A;  4I0A A;  2FSW A;  1UFM A;  1LEA A;  1OMI A;  1R1V A;  1F5T A;  3TQN A;  1FP1 D;  2LKP A;  5DUI A;  4O3M A;  4LK0 F;  4HBL A;  1D8K A;  3U9G A;  4XSX F;  4Q47 A;  2W24 A;  1REP C;  4OIO F;  2Q0O A;  2LNB A;  2HS5 A;  2X4H A;  1E17 A;  3TO6 A;  1K79 A;  4G7O F;  1QZY A;  1FC3 A;  3RPQ A;  2RVC A;  4LLN A;  4HF2 A;  2EFO A;  1P4W A;  4QLC U;  3RKW A;  1W4M A;  1STZ A;  3B02 A;  1DUX C;  1FOK A;  5E17 F;  4M6Y A;  2LDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...