1B8IA

Structure of the homeotic ubx/exd/dna ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
62
Chain Sequence
FYPWMARQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRRMKLKKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*TP*CP*GP*CP*CP*AP*TP*AP*AP*AP*TP*CP*AP*C)-3')
publication title Structure of a DNA-bound Ultrabithorax-Extradenticle homeodomain complex.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 21
structure length 62
sequence length 73
ec nomenclature
pdb deposition date 1999-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1b8iA00
1GV5A 4FE4A 1ETOA 2ID6A 1RETA 1OCTC 2AHQA 2R7ZJ 2IEKA 3Q0WA 4XK4A 2R92J 4FISA 3Q0UA 1E3OC 3M4OJ 2Y9YA 5EGOB 1IG7A 2L7FP 2NS8A 2XB0X 2QF7A 1NK3P 2GLOA 4A3BJ 4DYRA 5IPAA 4A3KJ 3HOWJ 2Y9ZA 5FJ8J 1WGXA 1FIAA 5C4JJ 3BG9A 3OSGA 4W1UA 3GTJJ 1AU7A 3BQYA 3TEDA 2DN0A 1HCRA 2LY9A 3IH2A 4QTRA 2CQQA 4A93J 4JYKA 2K40A 1U8BA 1ETXA 4AC0A 4XICA 5F0CA 4I6ZA 4MO7A 3GTKJ 2WV1A 1F43A 4MFDA 2MSYA 3RZOJ 5E3OA 3OOUA 1QVUA 4XIDA 1JTXA 1NTCA 4UUSA 1PUFB 1AHDP 3B6CA 4A3EJ 1DU6A 3QPSA 3G1MA 3CQZJ 3H0GJ 2KDZA 1JT0A 1WPKA 3IH4A 3IV5A 4JX5A 4M3DA 4AUXA 3JR9A 2E2JJ 1FTZA 1B8IA 1TWGJ 2ME0A 1W0TA 2DMQA 1H89C 2PMZN 2HQ5A 1POGA 1MH4A 3NAUA 5F0HA 2H1KA 1SANA 1I3QJ 2D5VA 2O7OA 1IUFA 4IHXA 1ZKGA 2LVSA 2R5YB 3OIOA 5FKKA 2M2EA 3GTGJ 4M3EA 2GM4A 2DTZA 2NVYJ 2XGDA 5E3MA 4AYBN 2EZHA 3WHCA 2NVQJ 2DMNA 2ZB9A 2JA5J 2JJ7A 1ETQA 3PO2J 1OJLA 2XB5A 1BL0A 4MLOA 3JRFA 2TRTA 5M3FJ 3HOXJ 3BG3A 2L7MP 3I4NJ 5FKLA 2ELKA 1MSEC 2VKEA 1W0UA 2EBIA 1VNDA 4RDUA 1MNMC 4A3JJ 2ME6A 3BR1A 4X1EA 3ZQLA 4BY7J 1JKOC 1XG1A 3G1OA 9ANTA 5EYRA 2CRGA 4CYCA 1A6IA 4D7NA 2O8KA 1RKTA 1LE8B 1YRNB 3S16J 2CQXA 2DMPA 1K83J 1Y1VJ 4HNVA 3TP3A 5IYCJ 2YU9J 4DYQA 3PO3J 2YS9A 3S14J 3LSJA 2N8GA 5E3NA 1JKQC 5J1RA 3VPRA 3S1QJ 2DA2A 2E2HJ 3MKLA 2DMUA 1JUPA 2K9SA 5F0FA 2JA8J 3TW7A 3HEFA 3BT9A 5F04A 2NOGA 1BW5A 4M3BA 1VI0A 5F1JA 4BBRJ 1FEXA 1ENHA 3CCYA 2JN6A 2HOTA 3BR3A 4I76A 3S17J 2EQRA 4IEJA 1G2HA 1SFOJ 4D5FA 1ITYA 5BNGA 4QIWN 2LTPA 2YUSA 3B6AA 1QRYA 4XRMA 5FLMJ 1BA5A 2KT0A 3JRIA 1QVTA 1IDYA 2Y30A 2EZIA 5EEAA 3JRBA 3QPLA 2VPRA 5JLXA 3GTQJ 1BW6A 1MBKA 2W48A 1U9OA 5C4XJ 2CUEA 4Y52J 4RBOA 5FKMA 5IP6A 3D1NI 3CMYA 3SJMA 5F27A 3S1RJ 2VI6A 2L0KA 2OPTA 3GTLJ 4L5EA 4NDLA 5J3LA 5GPAA 4C3JJ 1Y1WJ 5F08A 5GPCA 3BR5A 1ZGWA 1GDTA 2HOSA 2NS7A 5M5YJ 3A02A 1GV2A 3BR0A 4M6VA 2R5ZA 4LOCA 2B63J 1F36A 1VFCA 1K61A 4IHWA 1ETWA 2M8GX 3HGYA 2R93J 2DA4A 1JJ8C 4UUSB 1MSFC 2DA6A 4IHYA 3PM1A 3F0CA 2OF7A 2AO9A 1FJLA 3RQIA 2EZKA 4S0HB 1MBGA 4A3DJ 1WI3A 3HOVJ 5IOYA 1TWCJ 4BXXJ 1ZR4A 2L9RA 3HKZN 1AKHA 5J1YA 5J1UA 2QCOA 3BR6A 1B8IB 2K9NA 3FKIJ 1RPWA 4M3GA 3JRCA 2O9LA 1RESA 3JREA 2EZLA 3BR2A 3BG5A 3FISA 2DA5A 2XPWA 5EG0A 2IAIA 2JA7J 4MFEA 5FLVA 4A3GJ 3HM5A 2CUFA 2DJNA 2DMTA 3SDGA 3ZQFA 3JRAA 1TC3C 3A01A 3MN2A 2JMWA 4X6AJ 1JGGA 2XRLA 1H88C 2HI3A 4B4CA 2DA3A 1I50J 1MH3A 2FQ4A 2X9DA 2Y2ZA 4A3LJ 1QPIA 5IYBJ 2LK2A 1BJZA 3L1PA 5JLWA 3BTIA 5C44J 3JRDA 1JJ6C 4A3FJ 5GP9A 4FE7A 2E1OA 3MVPA 3Q0VA 3QQAA 1S7EA 1O4XA 1A5JA 3DCFA 3IH3A 1TWAJ 4D5CA 3S15J 1I6HJ 1IC8A 4J19A 3GTPJ 3H3VK 3O8GA 4V2FA 3ZQCA 1FTTA 5DS9A 1XS9A 1B72A 2LKXA 2LD5A 4DZJA 4FTHA 3UKGA 5IP7J 3GTOJ 3GBGA 1LFBA 2LR8A 2EH3A 5M5XJ 3NARA 1CQTA 4CYCB 3LSGA 1TWHJ 1T56A 5EGOA 3K7AJ 3E7LA 1UHSA 2MW8A 4GFBA 2HYJA 4M3FA 2TCTA 4W97A 1T33A 1ETKA 4Y7NJ 2DA7A 4V2GA 1LFUP 1MBJA 2VUMJ 2WAQN 3W6VA 3BTJA 4JX4A 1MBHA 3OSFA 3A03A 3BTCA 1ETYA 3LOCA 1D5YA 4A3CJ 2NVTJ 3JRHA 2VKVA 2G0EA 4XRSA 1JKPC 4B3AA 1ORKA 1RKWA 1MBEA 3HB9A 1Z0XA 2HOAA 4ABZA 1R9TJ 3DEWA 2LP0A 2XSDC 2R0QC 5K7FA 1ETVA 1PUFA 2LLKA 2ID3A 5DTDA 1NK2P 4QSHA 5HODA 1X2MA 3S2HJ 3JRGA 3HBLA 5M5WJ 2RAEA 4BY1J 1H8AC 1Q1VA 4A3MJ 3HOZJ 2DA1A 1IDZA 2M34A 1U78A 3BQZA 1JUMA 4FCYA 1RR7A 1U9NA 2X6OA 3O8HA 1OCPA 1ZR2A 4BKXA 4DYCA 1APLC 3ZQIA 4C3IJ 1MBFA 2M0CA 2R5YA 2JA6J 1EF4A 1HOMA 1XC5A 5IP9J 4A3IJ 1FIPA 1X58A 3K2AA 1P7IA 2M9HA 2I10A 2K9QA 3FK7A 2CU7A 1HDPA 3FIWA 2LFBA 2FD5A 4MIMA 3I4MJ 1IV6A 2MGQA 1JT6A 4IHVA 2R5ZB 3RKQA 1HF0A 2X48A 2CJJA 4C3HJ 3S1NJ 1GT0C 4UUTA 1JUSA 1X2NA 2FJ1A 5M3MJ 1JTYA 2E19A 1WH5A 2MG4A 1UG2A 5E3LA 2XPUA 5IOZA 4JX6A 1ZK8A 1GVDA 3FK6A 2JK3A 5K7ZA 3Q3SA 3GTMJ 4DW6A 1IJWC 2H8RA 1LE8A 1YRNA 5FKOA 4G12A 3HOYJ 3ZQGA 1OFCX 1AKHB 3ZOBA 2IBDA 1UMQA 1Z77A 1WCMJ 2WB1N 5EZGA 1HDDC 1IRZA 2GBYA 4JP0A 3HOUJ 5K7HA 5EG0B 4BBSJ 5C3EJ 2E2IJ 4XRSG 3BTLA 3ZQHA 3A01B 3CDLA 2XPVA 3TW6A 3S2DJ 2HXIA 1WH7A 1DU0A 3LSRA 1TWFJ 1GUUA 5FKNA 5EDNA 2Y31A 2HDDA 1P7JA 4D7MA 2L7ZA 3WHBA 5EF6A 2FX0A 2P81A 3LSPA 1HLVA 3M3YJ 5IYDJ 4EEFG 3SFIA 5EZHA 3C2BA 4C2MJ 3HDDA 4DZPA 2NVXJ 1JKRC 1ZTRA 2Y0SN 2HXOA 2ECBA 2XGCA 2XGEA 3HGGA 2COBA 3TP0A 1VF9A 2ECCA 2JWTA 4A69C 3RZDJ 3G1LA 3LNQA 3S1MJ 1B72B 1IGNA 1ZQ3P 4B1RA
chains in the Genus database with same CATH superfamily
2HKOA 4UUVA 1GV5A 1YHQI 4CICA 3K4CA 3C2HA 3T5XA 3CC2I 4AYBA 1RETA 5EJCA 3KYLA 2ZXHA 1LDJA 5FRNA 3MCZA 4XK4A 4RAFA 1OQYA 3A1YA 4BHPA 1JHHA 3MFKA 1NK3P 2XB0X 5IPAA 4F92B 3F21A 5K1YA 4Q47A 2IP2A 3CCLI 2AXLA 4I0AA 4Y4RA 1PJRA 3BG9A 5C4JJ 3ZMTA 2DFEA 4BHBA 3FHZA 1LPQA 1Y0UA 3IH2A 3HOTA 2HQNA 1I5ZA 4QTRA 3HPHA 2KFDA 2F6CA 2BGCA 2K40A 2BV6A 2GIVA 4MHGA 3GXOA 4I6ZA 5HVQC 2YPRA 1T0FC 3BPVA 1I3AA 4YG2F 5KAIC 3CCSI 1QVUA 3ZR8X 4XIDA 4UUSA 3BROA 4IZZA 3B6CA 4I02A 3DLAA 2F4OB 1R6RA 5HLTA 3J7ZI 3CQZJ 2Q2EB 1ZG5A 1D0YA 4NBQA 3V8LA 1G6NA 2X1CA 1UHMA 5TJJA 3L2VA 4NHJA 1N77A 1TWGJ 3M8FA 2QEXI 1I1GA 3BC8A 1BIAA 3WODF 2PMZN 1SVLA 3SEZA 2ZJ2A 3ZN1A 3DP7A 2RNJA 3RYPA 2D5VA 3VYRB 5EEHA 4A5NA 3M9AA 4HA8A 4BU2A 1BI1A 1ZKGA 2R5YB 4IHXA 2M2EA 3VYSB 4M3EA 4RAGA 5D5XB 2DTZA 5F1RA 1J5YA 2F4IA 2NVQJ 2P6TA 3RPUA 3IL2A 4AU7A 2D45A 4MEXF 4B09A 1EKEA 3OYMA 1OJLA 2XB5A 1MDMB 1OLTA 3JRFA 1HKSA 3M1EA 3BG3A 3I54A 1R71A 2XKOA 3KLOA 4KYWA 2BVMA 3M8JA 5CQGA 1W0UA 2OA4A 4O5VA 3AKZA 2UWMA 4G7OF 2NS0A 1X4PA 2VQHA 3H0DA 3K4KA 3AG3H 1MNMC 3ISPA 2JA2A 2DPUA 3GFJA 4N4NB 2DLLA 4KIBA 4BY7J 3WTXC 2CW8A 3LWFA 1RKTA 3S16J 3R0AA 2DMPA 3I53A 2EIMH 4ZC3A 5DDGA 2IA1A 1X3UA 3FX3A 4CXFA 4E4HA 1V3FA 1FC3A 2CW0F 3DQVC 3GZNB 1YITI 2PG4A 3WG9A 4WXDA 2DFIA 3E0JB 2OZ6A 5CYVA 2YS9A 1F4KA 5CJ9A 5K5RA 4UXNA 1FSEA 3PL8A 2HQAA 3KZYA 5J1RA 3CCEI 4EM2A 1LDDA 2DMUA 1JUPA 5F0FA 4ESJA 4EJWA 2PMHA 2LREA 4N9HA 3TW7A 2JA8J 5CVIA 1ZRDA 3E6MA 3TMOA 2H1LA 1AWCA 1QPMA 3HRSA 3BDDA 3CCYA 4E70A 2HOTA 2A5YB 1G2HA 2A05A 2QM3A 3PSFA 3FM3A 2K3PA 3HUGA 1HBXG 2V1UA 1S29A 5ILSA 3Q5FA 2I5UA 2WADA 1LVKA 1R4MB 5E20A 4CCJA 1BA5A 4L9NA 3L9FA 1G3SA 1YW8A 2Y30A 1DGRM 2EZIA 4BL0B 3JRBA 1TTYA 3QPLA 2VPRA 2KHMA 3CLQA 2MC4A 1T39A 2A68F 4XORA 1TNSA 5HLGA 1ZLJA 3KEQA 3G3ZA 4A6EA 2CUEA 4Y52J 1EH6A 1X19A 3L2CA 4I2OA 2WV0A 4YEJA 2P6SA 5J6XA 3CMYA 3FF5A 3SJMA 4IQ4A 5F27A 4BJ6C 3H1CA 3S1RJ 2FNPA 4PJJA 5B1BH 1Z91A 1IRFA 5DYMA 1J59A 5J3LA 2EIKH 5GPAA 5GPCA 3ABMH 4XOTA 2E5NA 3TOAA 3I59B 3CLOA 1IN5A 1ZGWA 2NS7A 2QLZA 4AIJA 3PFYA 2HYGD 4V19K 1S7AA 3A02A 3BR0A 3F8CA 4LG0B 4M6VA 4HSRA 1Q1HA 5LGTA 5LHGA 4M6XA 1R22A 1ETWA 4LD5A 1IN4A 3F22A 2R93J 1WRJA 2KJCA 1P4AA 3OYCA 4F91B 1QHGA 3MD2A 2R7QA 5CVJA 1TWCJ 3FXLA 2V9VA 1ZHFA 2K4BA 3P9IA 4I09A 3OR2C 3ONQA 1AKHA 2LF8A 1Y39A 5J1UA 1SD5A 2QCOA 3HG9A 3KZIC 3IKVA 1K78B 3DLLF 3F3XA 1RPWA 2IGOA 2Z16A 2W1OA 3ZMZA 2EZLA 4C9YA 1Z9CA 3BR2A 1ZELA 4KDPA 2DA5A 1Z3YA 2XPWA 4MFEA 5FLVA 2HWVA 3DEUA 3HM5A 4XLCA 2JVHA 1A36A 2DK5A 4DBRA 3QPHA 3A01A 3MN2A 2JMWA 4L5IA 1H88C 3QAHA 1FYMA 4U7BA 1YYVA 2UXXA 1I50J 3AG4H 1MH3A 2FQ4A 2Y2ZA 2ZKZA 1JI8A 4CZCA 2LK2A 1MMNA 1BJZA 1WKMA 3KEYA 4E7SA 3IKTA 4A3FJ 1J2XA 5EEGA 4BNCA 1FSHA 4PK4A 3Q0VA 3QQAA 1C0WA 3OS0A 4RB2C 1XB4A 3CJTB 1RRJA 1R58A 2EFWA 3NWTA 1BIBA 3FMSA 3MMYB 2M4KA 4RA2A 3L09A 3ZRGA 3S15J 1YX5A 3LA3A 2E36A 4A2UA 3GTPJ 3O8GA 3ZQCA 5GAGJ 2H8WA 5DS9A 1ZLKA 2CG4A 2XSJC 3K6GA 3F9KA 4HOBA 1LFBA 3JSOA 3DTKA 2LH9A 2E60A 1RUOA 1SD7A 5DV5A 1A35A 4ZDPA 3MZHA 4GCVA 2QKLB 2DODA 4PGGA 4C30A 1CF7B 1D5VA 1BM9A 3K7AJ 5EGOA 4HQMA 3CDIA 2B0LA 5FFZA 2IS1A 2CQNA 3D5RC 2LNBA 5L3CA 1O7FA 3SEQA 3V7SA 4Y7NJ 4V2GA 5KCMA 1MBJA 1LFUP 2VUMJ 3BTJA 4OIOF 1KGSA 3IAS2 3A03A 4LLGF 1K79A 4M71A 4XNFA 1D5YA 2NVTJ 3JRHA 1XCVA 5AIQA 5DM7F 1TBXA 3A4CA 3H5AA 4B3AA 3F6OA 4R79A 4KT6A 2EILH 3HB9A 3SQNA 1KQ8A 2W24A 3DEWA 1R9TJ 2LKSA 4E7IA 2GIZA 1NHAA 5LD2C 5K7FA 4RMNA 4EGZA 2XKPA 4L18B 2MA3A 2ID3A 2WB1A 4P5OA 3W3CA 5DTDA 2DJIA 1F9NA 3KETA 2P7CB 3EYIA 4ESBA 1XDUA 3CJQB 3S2HJ 1V5GA 1O7LA 2E35A 2RAEA 4WCGA 1X4OA 2EA4A 2CFXA 2JSPA 2JPBA 3ASNH 3EYYA 2DA1A 2Y0MA 1MGTA 2M34A 4CCKA 1O57A 2IPQX 4YIIA 3K9TA 3U1KA 2HVQA 1RR7A 4J01A 4GYIA 4G6DA 2LYCA 2OAZA 1ZR2A 3SXYA 4DYCA 3W6JB 4PSXA 1DPRA 1APLC 1DP7P 2FBKA 3ZCOA 3HTSB 4OAYA 5J4VA 3O3KA 5CLSA 1Y0NA 2MLKA 5LFAA 3KX2A 1EF4A 4OINF 2RDPA 3VSKA 1XC5A 5HLIA 4RAYA 1PUEE 3R6SA 1EH8A 2L9NA 2CUZA 1P7IA 3GFLA 1FPQA 3OYDA 2VBWA 3JAMZ 3RSNA 2L01A 1XDSA 3GWZA 3FIWA 4BACA 4L0YB 2FD5A 3WTVC 3KFWX 1IV6A 4A0XA 4XLHA 1B9MA 3I71A 2VKDA 2X48A 4ZDLA 2CWEA 4PDKA 2CJJA 2QZ8A 4LGWA 1GT0C 1R5ID 1JUSA 1X2NA 1SFKA 3WTTC 2J5PA 4FX4A 1YS7A 4UV8A 4EJUA 4RM2A 4IHTA 2KIQA 3EUHA 3K1PA 2Q8KA 2XPUA 5IOZA 2EV5A 4XKCA 3GTMJ 4KMUX 5GADJ 2QKMB 4N4OB 4G12A 3WGHA 1L3LA 2QQBA 1R1TA 5LGNA 3HOYJ 1RUNA 2WAFA 1XX5A 3F23A 1I27A 1TQIA 1XMKA 4BAYA 5JVTA 4F7ZA 4H0EA 5DD8A 4KITB 1TW2A 5EG0B 1XGOA 4PZJA 4JBAA 4XRSG 1O3RA 4HNTA 2MD5A 1ODDA 2HXIA 1BI2A 2JRMA 2B9SA 4L5JA 5D5VB 2OTJI 5F64A 5KAFC 5HS8A 3W2VA 2Y31A 3I5UA 1QHHD 1P7JA 2FA5A 2A6EF 3BZ6A 1XSVA 4EEFG 2NOJB 3SFIA 4TV7A 4Y33A 2FBHA 1HQCA 2NVXJ 1YW9A 1JKRC 3U21A 1N78A 2HXOA 2V6CA 3HYIA 1T6SA 1Z6RA 2G9WA 2BBYA 4WF2A 2ECCA 4A69C 3QRFF 3C2GA 3RZDJ 3LNQA 2XROA 1B72B 5D6EA 3J81Z 4LLLA 3TQNA 5ICCA 2DT6A 2ID6A 1IF1A 1M1EB 3OYFA 2R7ZJ 3Q0WA 3WE2A 1BC8C 2EIJH 1SFUA 3FZVA 4FISA 4EM0B 2Y9YA 1IG7A 3FXJA 4RAZA 4A3BJ 5L3BA 3D5LA 3MAJA 4N0BA 4DYRA 1ZARA 4A3KJ 1FOWA 5D6FA 3HOWJ 2LSOA 1VQLI 4G6QA 2HPIA 3CUQB 2H6BA 4W1UA 4QLCU 3GTJJ 2IGMA 1Z7UA 1ZYRF 2YX7A 3WE3A 2CSOA 3KP4A 1HCRA 2JTVA 2X6WA 3PSIA 1R1UA 2VJJA 1D3YA 2G7UA 2CQQA 3AL0C 3BG7A 2ZFWA 1ETXA 2RVCA 2CV0A 4UNOA 3OL3A 4I98B 2DOAA 4MO7A 1RNLA 3CC4I 2M87A 3A0BC 3P9CA 2WV1A 3L2UA 2W25A 2R7WA 4A6DA 2JQ7A 4IQJA 3I56I 5E3OA 4AIDA 3DTEA 4HF0A 1K4TA 1YTYA 1DU6A 3QPSA 2Q1ZB 3HSEA 3P5JA 2VODA 4MQ9F 5KHDA 1Y56A 2CUJA 2HOEA 2QQAA 1ZN2A 2CS3A 4XQFA 4KA4A 1A04A 1WPKA 3CTAA 2ZXIA 2EFQA 4IVNA 2VONA 3B02A 1D1BA 4UHTA 4CSWA 2E2JJ 5HS9A 2YX4A 2Z5UA 3FDYA 1W0TA 1A31A 4R1HA 2KJBA 1WZ2A 1H89C 5LRSA 2ZSIB 2HQ5A 3CJRB 4PGHA 3NAUA 3SDBA 3PIOF 2H1KA 3DBHB 1YG2A 1I1SA 4KMFA 1WJCA 2K86A 2O7OA 2L4AA 3HRUA 3OIOA 5FKKA 3T8TA 1YO5C 1IAWA 5E3MA 2K7LA 2P5VA 1IUYA 2QQ9A 4LB5A 2ZB9A 3OYBA 5D5UB 2VBZA 2CV2A 1PYVA 1R5GA 3LA7A 1ETQA 5DCMB 1IRXA 2A3SA 3AG2H 3VDXA 5HNHA 2NNNA 2YSRA 4KJZA 2LOOA 2KZGA 3I4NJ 1IV8A 1TZLA 1YOVB 2VBXA 2X0LA 2ELKA 4LIVA 2VKEA 2EBIA 2JSCA 3EUHC 1U0JA 2FMLA 4RDUA 5AIPA 4A3JJ 1E3HA 2ME6A 2HVRA 4PJMA 4F3QA 1T98A 1QGPA 3GZ5A 2QBYB 3SYTA 3G1OA 3CO7C 1LDKB 2CRGA 4GDFA 2E7WA 4D7NA 4IOCF 1LE8B 1IN8A 2DYSH 2O8KA 2Y69H 3ZP5A 3R61A 1Y1VJ 1FOXA 2JRTA 4OWRB 2HGCA 4C2UA 2YU9J 4DYQA 1K4SA 5E17F 3JAMK 2XIGA 1TNTA 3ELKA 2XC7A 2A69F 5J4YA 2O5RA 1JKQC 3MEXA 2VIXA 2RC4A 4ZYDA 4EJTA 3HTUA 2HEOA 4K2EA 1FY7A 3HIFA 3R0JA 2DDBA 2DQLA 3JCUC 5KNLA 4WK8F 1T95A 1B6AA 2BE5F 2ZMEA 4M3BA 3FXOA 5F1JA 3K1MA 1ONVA 1Y8QB 3HKZA 2JN6A 4XBFA 1QNTA 4IXAA 4EMSA 3LSHA 3BJOA 5H2FC 2JT1A 3GZ6A 1SFOJ 4DQ2A 1ITYA 4WWCA 5E79C 5A2QZ 4M6YA 3H9JA 3MKWB 2GAUA 1QRYA 3TL4X 3WTSC 1ON2A 5GAEJ 1SVOA 4O3MA 2R7UA 4A5MA 2DI3A 4EVIA 3K4NA 4AVZA 2LBFA 2NYXA 1XSDA 1ZG3A 2D1VA 1BW6A 1MBKA 1Y6IA 3QU6A 4DJAA 2VOPA 1U9OA 2M5WA 2MLGA 4B47A 1Y8RB 1D1AA 2V4JC 3BCBA 3VFZA 1HSTA 5FKMA 3E1SA 4HX8A 1RI7A 2J5OA 1LVAA 3FBIB 1IO2A 4EGYA 2MBFA 3ML6A 3PQJA 2PJRB 3LA2A 3OR1C 2K9LA 3RKWA 4E7ZA 2L2OA 2XASA 3M7GA 2QUFA 4C3JJ 5F08A 3ROUA 4HX7A 1GDTA 3PUFA 2VT3A 4J00A 5ILUA 2ZBKA 3CC7I 2WY8Q 1K7AA 3ZQQA 3ABUA 2R5ZA 4R8HA 1SFXA 4HDVA 4WXHA 2B63J 5FO5A 4AIKA 1VFCA 2XVCA 4KIFA 1VQ4I 3HGYA 3J81K 2DA4A 2HNHA 1QU3A 1J09A 4IHYA 2QYOA 3PM1A 3SZPA 3OYLA 4LLNA 3N4MA 4BQNA 2AO9A 3RQIA 1R1VA 3K2ZA 4OIPF 3RKXA 1FOYA 1WI3A 1X3WB 4B1RA 5E8IA 4DIQA 2L9RA 2BY0A 1YX3A 4PJNA 1STZA 4BE2A 4KN4X 1WJDA 4UY8I 3IRRA 2BOLA 1WSUA 1T8IA 2IS6A 3BR6A 1B8IB 3B73A 3BZKA 4M3GA 2EFPA 1RESA 3ERMA 3F8FA 3AFHA 2V7FA 4I0BA 2M4GA 2OD5A 4HBLA 3OYGA 4PJ0C 3TOBA 5LLQA 4A3GJ 1TC3C 2CUFA 2DJNA 3SDGA 2GOXB 1CGPA 4PFOA 1ZRFA 4KFCA 2AQFA 4IF4A 2C6YA 2ADUA 3FWEA 5IYBJ 3DFGA 3L1PA 5JLWA 1BI0A 2FF4A 3BTIA 2MH2A 1JJ6C 1G3TA 2ETHA 5ICEA 4CZZA 3LFUA 3O6BB 4FE7A 1FBSA 1O4XA 3VYUB 3KYCB 3IUOA 5BS6A 3IH3A 2E1MB 2DCEA 2NXNB 2R7FA 3L2RA 4HLYA 4BXFA 1G4DA 2ESHA 3LQRA 3H3VK 2HU9A 3S3NA 1XS9A 2XF6A 2DW4A 5CQEA 1UB9A 2LD5A 2RN7A 4HEA2 3FXMA 3EETA 1GXPA 5IP7J 3QWLA 2AQEA 1RR8C 2JUGA 2LR8A 1CQTA 4CYCB 4YRVA 1XMXA 2ZJRF 1FBQA 2Z1DA 4LMYA 4F93B 2X51A 1W4MA 2GZWA 2MW8A 4BH9A 4GFBA 2QQ8A 2TCTA 5JI6A 1ETKA 2DA7A 1G3WA 2WAQN 5HDGA 4GYGA 3RKYA 1AOYA 1OYYA 1AA7A 2F5VA 1SFEA 1HW1A 1ETYA 3BTCA 1WHUA 3I9V2 3LOCA 3REOA 3V7CA 4YFKF 4IJAA 3CCJI 1GLNA 3CCQI 4A3CJ 2LC2A 3PNTA 2ZNZA 1PVEA 2VKVA 4NNJA 2ZMEC 1ORKA 2DQRA 1RKWA 1E2XA 4ABZA 1D1CA 4XLFA 2E1NA 2LP0A 1VQOI 1ZH5A 4LB6B 4KUMA 3GFIA 2BYVE 4I7HA 1ZGJA 4DOZA 3D5SC 1PP7U 2MD0A 5BOXA 2IGKA 4BEHB 1LFPA 3DV8A 3EDPA 1QA6A 1X2MA 2HZDA 3H5RA 3ECOA 2OQRA 2BW3B 4D0PA 3JRGA 1U5TB 2FXAA 2Q2EA 5CKTA 3HOZJ 1YJNI 1VTNC 1VQPI 1IDZA 2VC0A 4O6JA 2HVSA 1JUMA 3CZ6A 2ELJA 4FCYA 1O3QA 2V26A 4RGRA 3O8HA 2EV0A 1OCPA 2QGUA 2P0WA 2E71A 3ERED 4E7HA 5FLXZ 4XM3A 5B1AH 1HKTA 2UXNA 4XL9A 5E18F 3T1BA 4CDGA 1W5CC 2K5CA 2R5YA 2WWYA 3VSLA 3ZQ7A 2DFFA 2JA6J 2DXIA 3H35A 2XAUA 3IC7A 2VN2A 2RQQA 3TDZC 1W36D 1FIPA 1UJ8A 1Z21A 1HKQA 2I10A 4PCQA 4RGXA 2A61A 4YIFA 3OV8A 3MZYA 5A2QK 1HDPA 4HSTA 4CYDA 1MDMA 4NC6A 1JT6A 2LY1A 2RQPA 3RCOA 3IWFA 2XF7A 1HF0A 4IHSA 2BHZA 2X4HA 1R7JA 2LKPA 4G9YA 4C3HJ 3WTZA 3Q9VA 1Z1DA 1P6RA 4B48A 4GRIA 1OR7A 1W7PB 2CGPA 3W2AA 3ABTA 2JUCA 3N97A 5L3EA 2KISA 1WH5A 3QU3A 1DQUA 4D1QA 5IT9Z 1ZK8A 2W57A 3FK6A 1RZ4A 2H8RA 3OYAA 3ZQGA 1OFCX 2LMDA 1UMQA 3CP2A 3GLXA 4MTEA 1HA8A 3PNVA 3S8PA 1IRZA 2XAFA 3QOPA 2HYFA 3OIQA 3JSPA 1YW7A 2QVOA 2GBYA 4JP0A 5CPRB 1U6GA 4BBSJ 3LQQA 5C3EJ 2F5EA 2GOMA 1RIOH 2Z9OA 3PFIA 2UZKA 1KU7A 1UHWA 3CDLA 2XPVA 3CP8A 3RIRA 1VQ5I 1WH7A 1USSA 1DU0A 5D8KB 3LSRA 2L7KA 2GQQA 1TWFJ 1ERDA 4S04A 4XLAA 5EDNA 1QZEA 3F8BA 4HF1A 2FX0A 2P81A 2O0YA 2Z99A 1HLVA 1V4RA 4LK0F 2O8XA 2ISYA 2XAQA 1ZTRA 2PMZA 3KE2A 4QPQA 2Q0OA 3CF2A 1VF9A 3KEOA 3TP0A 1YJ9I 4U7DA 3DPTA 2DT7B 4G6TB 3CMEI 1OYWA 4FX0A 3PQKA 1ZQ3P 4IKFA 2EB7A 3KCCA 2HPMA 3F8MA 3J7AY 2ZNYA 1OCTC 2AHQA 1IXCA 5HLHA 1WQ2A 1EH7A 2XGXA 1E3OC 4HRIA 2GLOA 2L7FP 2NS8A 2ACJA 2QF7A 1LQ1A 1O3TA 2ICWG 2Y9ZA 1JHFA 5FJ8J 5J47A 3ECHA 1WGXA 3RDIA 3OSGA 3T0YA 1XPXA 1AU7A 2EPFA 4XOPA 3GUDA 2DN0A 3MWMA 2LY9A 1LNWA 3H3ZA 3I0TA 3OYKA 3I59A 4YELA 2HTSA 2EK5A 2W84A 4L0ZB 1JGSA 1REPC 2VQGA 4NQWB 4JYKA 4CH7A 2A5WA 4LG0A 5F0CA 4AM3A 2PLYA 4A12A 3GTKJ 4EM1A 1GVJA 5BPIA 1F43A 4OMYA 3OOUA 4Y13A 3H5NA 1JTXA 1AHDP 1PUFB 2OQGA 3G4SI 1J75A 5HDKA 1P4WA 1HXDA 2RKHA 2Y0SA 3G1MA 2FE3A 3SFZA 4H4KC 1SD6A 3H0GJ 2KDZA 1DGWY 1JT0A 1YI2I 3QOEA 3H9GA 4ON0A 3QP6A 4JX5A 4M3DA 4X0GA 2V6EA 2VPLA 2L5QA 4AUXA 3JR9A 4ZTFA 1SVMA 3V8KA 1K78A 2RV8A 2XHKA 1VQKI 1OCOH 2HDWA 2ME0A 4EQQA 1BR4A 1MH4A 2VB6A 4B3XA 1D0ZA 1LB2A 3J7YJ 4Q4ZF 2VXZA 3CJNA 2A07F 2LVSA 2TDXA 2CQ7A 2IS2A 4II2A 3OYJA 3Q9SA 2NVYJ 2HZTA 2XGDA 3GVAA 4AYBN 2EZHA 2YU3A 1V5FA 3WHCA 1TP4A 1F1ZA 4UVBA 4WXCA 5BQTA 3HL2A 3PO2J 1T2KA 2XRNA 1W5SA 4MLOA 4UB6C 4PSWA 4CHUA 2VKHA 2TRTA 5IT3A 3QODA 1BN5A 1BR1A 4FASD 1OR7C 2VL8A 5FKLA 3L2QA 1MSEC 4RGSA 1VNDA 1FP1D 2EA2A 1XSXA 2IA2A 5LBQA 3W6KB 5K5OA 3BR1A 2D1HA 4X1EA 4DBQA 5FLXK 4CA0A 1HSJA 3ZQLA 3BOQA 1E0EA 5L3DA 1YJWI 4ETSA 1NH3A 1W36C 1KU9A 1YRNB 3K4LA 3I55I 1S6LA 2CQXA 1CF7A 3K4BA 4HLXA 1VQMI 4HQEA 1BI3A 4HNVA 1VQ8I 3LL7A 4N9IA 2X1DA 1WJFA 1UFMA 4LFUA 2L54A 3A0HC 5LEKA 3VPRA 1MMDA 2DA2A 2M1BA 3MKLA 3ZMDA 3U2RA 1ZAOA 4AVPA 3TO6A 3BT9A 5F04A 2DOFA 2NOGA 1BW5A 1X1DA 4IPAA 3BPXA 4BBRJ 4HV5A 4EJOA 1FEXA 3BR3A 4I76A 2WC2A 3F8NA 1OMIA 1KONA 1XD7A 3I64A 3R60A 4IEJA 2K9MA 2ZJQF 4D5FA 2K3FA 3OYIA 1KYZA 4QIWN 1S8NA 2LTPA 2YUSA 3FBNB 5DEQA 3DKWA 3B6AA 3RPQA 1NG6A 1IXSB 3GFMA 3GEZA 4XRMA 5JVGF 3KP3A 1FP2A 2CMPA 2X6YA 3DPLC 3HRTA 2KT0A 2OUMA 1QVTA 5LGUA 5EEAA 1T38A 5JLXA 1HW5A 1IXRC 1NG7A 3E5QA 4ITVA 2W48A 3LSMA 1VQ7I 1P4XA 2M7AA 4L9TA 5C4XJ 4BQOA 2F5CA 2JVGA 3IP4B 4RBOA 3VB2A 4B8XA 5IP6A 2XDVA 2BZTA 3GX4X 4XONA 5FD5A 2VQLA 1BOAA 5L3GA 2VI6A 3K4JA 2L0KA 2M0MA 3DKXA 3NEUA 2O6GE 2PI0A 3WU0A 2VLAA 3GTLJ 1V54H 4EATA 4KISA 3PIPF 4NDLA 1Y1WJ 2WAEA 1WVRA 4GGGA 3CO6C 2HOSA 1FWZA 5M5YJ 3D0SA 3RYRA 1LUJB 3S2WA 1MIJA 4RS8A 4E7JA 5H20A 2HFHA 4LOCA 2FSWA 4IHWA 4EJVA 2M8GX 3AAFA 1TQMA 5CVRA 3ZGKA 1JJ8C 3TBIA 4UUSB 2HS5A 2DA6A 3KP6A 2OV7A 4JQFA 1FJLA 1KQ0A 2EFNA 4S0HB 1MBGA 1MNDA 1KQ9A 4KT5C 4A3MJ 3WTWC 1MW7A 3HOVJ 4LG3A 1XGMA 3FM5A 4YFXF 5JR3A 1MZBA 2P7VB 3F6VA 5J1YA 3H36A 3NQOA 2XAJA 4F52A 3DBLB 1R23A 3CF5F 2K9NA 3FKIJ 1FYLA 3CMMA 2O9LA 1DP3A 2OCCH 3JREA 4RLQA 1PDNC 1JE8A 2MH9A 1ULYA 2LRDA 1FMVA 4M9SA 5GTHC 5EG0A 2JA7J 4NC8A 3JRAA 3IWZA 2ISZA 1BC7C 1QZYA 2XRLA 2HI3A 2OC6A 2CH0A 3EUAA 2DA3A 2X9DA 2DAOA 1QPIA 1T08B 2ZJPF 5C44J 1WJBA 5GP9A 2L9SA 1Z67A 3TDUC 3R4KA 2DTRA 5ERIA 2H09A 2K85A 1H9GA 2KZVA 1BOBA 3DCFA 1R5HA 3CD6I 3V42A 4D5CA 1TWAJ 3OWTA 3C1DA 4ENMA 2BY2A 2FOWA 3C3WA 2OCEA 4IRGA 3RI4A 4J19A 1DDNA 2F5DA 4V2FA 1P9QC 5J8CA 1EV7A 3WTYC 2PBIA 1B72A 2LKXA 3LSKA 1WJAA 1VQ9I 2KL4A 3BY6A 3UKGA 3K0LA 3K70D 3E5XA 2PMUA 4XLEA 2PFBA 3UNGC 5LRRA 2EFOA 2DO7A 5M5XJ 3NARA 1VZ0A 4I01A 3G73A 2DPDA 1P92A 1T56A 2X1EA 4ENJA 2VQCA 5CVVA 1UHSA 4IOAF 3W2WA 3OYEA 1T33A 4P96A 3GW2A 3M07A 4U88A 5B66C 1W1WE 3IHUA 3CUQA 3W6VA 3FMRA 4JK1X 2PJPA 2ESNA 1QZZA 1X3ZB 2MABA 2GXGA 4Y3OA 5E1ZB 3P7NA 2IW5A 4CCNA 1A6QA 3TO9A 4G94A 2G0EA 4XRSA 2R7TA 1OPCA 5ICGA 3LSIA 4RM3A 4ASNA 1DPUA 1D8JA 1Z0XA 1N75A 3DEEA 4CCMA 4BE0A 2FBIA 2VT2A 2R0QC 2F5FA 5JHUA 4G7ZF 3G2BA 2LLKA 4E6KG 2X6XA 3HUGB 3HBLA 3ZXSA 2O03A 2E34A 1Q1VA 1VQ6I 3OY9A 2PQ8A 1BR2A 1U78A 4IL6C 3BQZA 2ZXJA 3VEPA 1HW2A 1WJEA 3KZZA 1U9NA 4BUPA 2X6OA 2VJIA 1QBJA 1IW7F 4HW0A 1DUXC 1UAAA 3ZQIA 1R36A 3K4MA 1TT0A 2IRFG 1OISA 2ZC2A 3HXLA 4IRHA 4C3IJ 1HOMA 3RPUD 2XUBA 1K6OA 1OCCH 2R7VA 4M9XA 5IP9J 4A3IJ 1LJ9A 1X58A 4XKVA 5KVRA 5DM6F 3K2AA 2JPCA 3KP2A 4A0YA 3ZN0A 4UB8C 1FNNA 1KU3A 2XF5A 3IRQA 2FEZA 4YFNF 2CU7A 1MJAA 2FOKA 3LSTA 2E1CA 5DCMA 4IRIA 2LFBA 1XMAA 3OL4A 3KLNA 4MIMA 4LJZF 2B7EA 3QYFA 2MGQA 1YQAA 2DU9A 4IHVA 4MGRA 1EA3A 3CUOA 4CCOA 3N05A 2O61A 4UUTA 3F72A 5M3MJ 3ABLH 2KRFA 2FRHA 1JTYA 3IAM2 1UG2A 1FOKA 2GXBA 4BHCA 2QBYA 4JX6A 2JK3A 1Z6TA 1TL8A 4DW6A 3A2KA 3L00A 1LE8A 5LHHA 3QP5A 3KP5A 2DBBA 3FKJA 4M74A 4U0YA 1AKHB 2NVUB 3C7JA 1TT5B 2IBDA 2R4GA 3G71I 1Z77A 3JTHA 1WCMJ 2WB1N 3PUBA 3VOEA 4HX4A 4G8XA 3DPUA 2KMUA 1LEBA 3HOUJ 5K7HA 3AG1H 2M3AA 4B43A 1TW3A 3BTLA 1MJBA 2P5KA 4Y17A 2W82A 3ZQHA 3A01B 4OIQF 3S2DJ 1KYWA 4M72A 2PEXA 5L3FA 3OYNA 5ILVA 4BQAA 1FT9A 3QYBA 2NAZA 2HDCA 4D7MA 2L7ZA 3WHBA 3LAPA 2HKXA 3LFKA 4PUSA 3LSPA 3M3YJ 5IYDJ 5E1WA 3C2BA 4C2MJ 3HDDA 2ZXWH 4DZPA 2HR3A 4M73A 3GF2A 2Y0SN 1YIJI 2ECBA 3S3MA 3HGGA 2COBA 5FB2A 2AS5F 2LDUA 4RGUA 5D4SA 1FZPB 3ABKH 3DU5A 4ZZDA 4XLPF 4ENKA 3MZ8A 3CCMI 4OU0A 2QSFX 1MNEA 5H6RA 4MNUA 1IGNA 5DUKA 3BJAA 2GA1A 4FE4A 1U2WA 4DNCA 2K02A 1ETOA 2O3FA 1GHCA 3OIPA 2EJRA 2DOEA 3BLYA 2IEKA 1H0MA 2W7NA 4OOIA 2R92J 3ZMUA 3WTUC 2MC3A 3Q0UA 3M4OJ 4HV6A 5EGOB 3FMQA 1FX7A 2NNYA 2KKOA 2QSHX 3CUQC 4QWQA 2PJRA 1B1BA 4ZYGA 2HTJA 1FIAA 4YIRX 4RB1A 3BQYA 2F2EA 3TEDA 2P5LC 1X1AA 2E7XA 2V1XA 2AXTC 4BYYA 1G8XA 4A93J 1YS6A 2ZO4A 1U8BA 4AC0A 3BJ6A 2EWNA 4XICA 2R7RA 2OU2A 2FU4A 3K70C 3AL0B 1G59A 2COMA 4JOMA 1N25A 1IN6A 4MFDA 2MSYA 2H94A 2M7BA 3GLLA 3RZOJ 2LG4A 1NTCA 3COAC 4BQQA 4BDZA 3H9QA 5J8FA 4A3EJ 3T8RA 1ON1A 4CGZA 3S93A 1O3SA 3V4GA 2W00A 1USTA 4UV9A 3C18A 3IH4A 3IV5A 3H3UA 3HSRA 3WG7H 4RB3C 2R7SA 2F48A 3K10A 1OCZH 4NUBA 1FTZA 1B8IA 3HC7A 2YR2A 5FFXA 3E5UA 2A6HF 5J40A 2DMQA 4ZJZA 1XN7A 3RQ4A 1POGA 3ULQB 3ZMVA 5F0HA 4P9UA 2BVLA 1SANA 4Z2YA 4OMZA 3VWBA 1EJ9A 1I3QJ 2VOOA 2BHYA 3GYHX 1IUFA 1JXSA 2CV1A 3GTGJ 3CMAI 2GM4A 1UG0A 4ZTJA 1YFHA 3FXQA 4LIUA 2DMNA 5BPDA 2JA5J 2JJ7A 3FXKA 5F6FA 1TQPA 2ZCWA 4HAMA 4B44A 5FD6A 1BL0A 1X1PA 4E7LA 2ELHA 5M3FJ 3SHFA 3HOXJ 3I4PA 3BWGA 2L7MP 2DT5A 2DDAA 3KP7A 4WX9A 2BY3A 2R3SA 2QENA 3G6EI 1S9HA 1L0OC 2VXDA 2BXYA 2XV4S 4BJTA 2IJLA 2FUG2 4ESFA 3S32A 3E6CC 2IS4A 4KIGA 2P4WA 1YIOA 1XG1A 3QPTA 1JKOC 9ANTA 5EYRA 4UVAA 4CYCA 3CESA 4XSZF 1X1BA 1A6IA 1J9IA 4HDUA 2EV6A 3OS1A 2CW7A 4IX7A 3ASOH 1K83J 4C2TA 4HZFA 5B3SH 2KDOA 2L3DA 3TP3A 4BXUA 5IYCJ 3PO3J 3S14J 3LSJA 2BY1A 1B4AA 2N8GA 4P55A 5E3NA 2GWRA 3S1QJ 2E2HJ 4MEYF 2Z33A 2GA2A 2K9SA 2V1NA 4UVCA 2DK8A 2VBYA 1XGSA 3SZGA 2LY2A 3HEFA 3NWSA 2GXAA 1VI0A 3WGGA 3CCRI 2KQRA 3GMEA 1ENHA 2V79A 3S17J 2EQRA 2KIFA 5FGMA 4CUGA 4AIHA 4BEHA 1R4NB 5BNGA 1KU2A 1XGNA 3O2PE 2VE9A 2BW3A 3KPHA 3J80Z 1ACIA 1U5TA 1YE9A 3U9GA 1MMGA 1SMTA 1WWXA 3OOPA 1D8KA 1SMYF 5FLMJ 3JRIA 4FT8A 4U87A 1IDYA 4F55A 3K69A 2R7XA 5E1XA 4OAZA 4ENNA 3GTQJ 5ICFA 5B5EC 1W7PD 1VQNI 1MD0A 1MMSA 2FQ3A 3RTRA 3LMMA 3WU1B 3D1NI 2FMYA 4RB0A 1R00A 4KNYA 2KRHA 3U1DA 5TRDA 2OPTA 3RJPA 1BJAA 2K27A 1WI9A 2UUZA 2P8TA 4ZYEA 4L5EA 5AONA 1R49A 3HJEA 3BR5A 1S3JA 2ZFUA 4U0VA 3V8JA 2IXSA 2M8EA 5HDNA 2VJ5A 6PAXA 5FROA 3KIOA 5LHIA 2L02A 1GV2A 4Q48A 1ZGAA 5TISC 1IZ1A 2MFZA 3ESWB 4BDYA 5D8LB 3JTGA 1F36A 1SD4A 2RGVA 3BG6A 1K61A 3EUKL 3I58A 1W7PA 1QO0D 3KYDB 2PX9A 1MSFC 3FXUA 2WA0A 4XR6A 2OJED 1FMWA 2Z3YA 3F0CA 2OF7A 1TLHB 2EZKA 4ZH4F 2V9PA 2WAQA 2KIUA 4A3DJ 5IOYA 3DXJF 1MKMA 4LK1F 4BXXJ 2UV1A 4XN3A 1ZR4A 3S3OA 1Z3XA 1V55H 1IRGA 3HKZN 1FBUA 1SC7A 2Z2SB 2V1DA 4M9ZA 4D9JA 3FHNA 2LF7A 3I3LA 3JRCA 4CCLA 2EINH 4ZYHA 4PJLA 5GAHJ 1LKXA 3BG5A 3FISA 1S72I 2E5ZA 4ANJA 3SZTA 3LAJA 5HOOA 1E17A 1B9NA 2IAIA 5JFRA 3ZQFA 4NB5A 2DMTA 5FRMA 5H6QA 5KK1A 4Q5SF 4X6AJ 3JW4A 4P9FA 1JGGA 5BMZA 4XRFA 4B4CA 2OZUA 2CFOA 4OIRF 4XN0A 2MYSA 4A3LJ 4LITA 2M45A 3HPGA 3OYHA 4HNUA 5TGTA 3JRDA 2L4MA 3ZMSA 2M30A 2E1OA 4KICA 3MVPA 4AWXB 2QSGX 2E1MC 1S7EA 1A5JA 1I6XA 2KPMA 5IY5H 5D5WB 1W5TA 1XCBA 2PN6A 2BEOA 3DWLE 1I6HJ 1IC8A 2RREA 1RC9A 4HF2A 3OS2A 1FTTA 4I99C 4XKBA 4HPQA 3V7RA 2CYYA 1I39A 4DZJA 4FTHA 1X1CA 4E7KA 3GTOJ 3GBGA 1H9TA 2IT0A 1P2FA 2EH3A 4IO9F 3VODA 4MTDA 1SEUA 1MMAA 3LSGA 1TWHJ 4EV0A 1ZREA 3EPZA 3HHGA 3E7LA 4II3A 2RNGA 3BCAA 5D4RA 5GTIC 2HYJA 4M3FA 2DYRH 2WBMA 4W97A 5IT9K 3E3VA 1U3EM 1ZRCA 3TKYA 4JX4A 2QA4I 2JZYA 1MBHA 4G7HF 3OSFA 3WU2C 4ZZLA 2R7OA 2NRAC 5DUIA 2KRCA 2VC1A 4NQWA 1JKPC 1FLIA 1Z7LA 2DFHA 2ZMEB 1MBEA 1Z05A 2X85A 3PJRA 2HOAA 3M1CA 4NC7A 2Y75A 4Y15A 5DCFA 2XSDC 2VASA 4FHTA 2H6CA 3DTIA 1T0FA 4U0WA 2H27A 3QYEA 4P1WA 1ETVA 1PUFA 3L2WA 1NK2P 4XLNF 3OMYA 4QSHA 2FNAA 1U5TC 2ZSHB 5HODA 1PP8F 1XTAA 4KN7X 3HOSA 4XSXF 1UZCA 5M5WJ 4BY1J 3TGNA 1H8AC 2QWWA 3P9KA 2HQRA 2W4SA 4A0ZA 2LBFB 5K5QA 1BBYA 4BKXA 4L9JA 1OCRH 2Y48A 4ZDOA 2KP6A 1GXQA 2CQKA 3CCVI 3CCUI 3DU6A 2IGNA 1OYIA 2KLOA 4GXOA 3HRMA 4QPOA 4BE1A 2CO5A 1MBFA 2M0CA 2IA0A 1E3PA 4GO1A 4BGDA 5LEJA 4XKWA 1WFXA 4DGWB 4FQGA 3DKYA 5JHFA 2M9HA 2K9QA 3FK7A 3H92A 2W85A 3HZJA 3MKZA 3L7WA 1S5LC 2D2WA 2OBPA 1K6YA 3GO5A 1QQIA 3J80K 2STWA 3I4MJ 5DD4A 3ZPLA 3WGIA 2R5ZB 2VE8A 4AD9A 3RKQA 3E97A 4ZYAA 2V9KA 2WTEA 3S1NJ 4L9VA 3E6DA 3DF8A 2FJ1A 1F5TA 3FXRA 1B59A 2R7DA 4S05A 2E19A 2MG4A 4MQVA 1OKRA 5E3LA 1MJ9A 2XAHA 1GVDA 2I8DA 5K7ZA 2A6TA 3Q3SA 1IJWC 4Z6YA 3J7AO 1YRNA 1UCRA 5FKOA 2VJ4A 1FYKA 1ZG1A 3K1NA 2XAGA 3ZOBA 4BS9A 1IN7A 5CVUA 2BXZA 5EZGA 3CDHA 1G3YA 3HHHA 1HDDC 2K4JA 3NRVA 1HC8A 1KA8A 3BP8A 4RLFA 1SAXA 5E8GA 4FETA 2WY7Q 1V5EA 1YLFA 2L9VA 2IVMA 3BZCA 1SAUA 4XMYA 5HS7A 1KZHA 3MQ0A 4BJ5C 2E2IJ 3TW6A 2F4MB 5ED4A 4PFPA 2STTA 3MKYB 3TO7A 1GUUA 3PNYA 5FKNA 2HDDA 1U8RA 3DBRB 5EF6A 2KIMA 3M8EA 5EZHA 5HNFA 1LEAA 2G7HA 3UR3C 2XGCA 4HG2A 1J7KA 1WJ5A 2XGEA 4HYEA 4CO8A 3HSFA 1J0RA 3GCMA 1UELB 2OTLI 1D0XA 2JWTA 1S7OA 3G1LA 3S1MJ 3VYTB 3E6BA 3X2QH 3EQLF
chains in the Genus database with same CATH topology
1GV5A 4FE4A 1ETOA 2ID6A 1RETA 1OCTC 2AHQA 2R7ZJ 2IEKA 3Q0WA 4XK4A 2R92J 4FISA 3Q0UA 1E3OC 3M4OJ 2Y9YA 5EGOB 1IG7A 2L7FP 2NS8A 2XB0X 2QF7A 1NK3P 2GLOA 4A3BJ 4DYRA 5IPAA 4A3KJ 3HOWJ 2Y9ZA 5FJ8J 1WGXA 1FIAA 5C4JJ 3BG9A 3OSGA 4W1UA 3GTJJ 1AU7A 3BQYA 3TEDA 2DN0A 1HCRA 2LY9A 3IH2A 4QTRA 2CQQA 4A93J 4JYKA 2K40A 1U8BA 1ETXA 4AC0A 4XICA 5F0CA 4I6ZA 4MO7A 3GTKJ 2WV1A 1F43A 4MFDA 2MSYA 3RZOJ 5E3OA 3OOUA 1QVUA 4XIDA 1JTXA 1NTCA 4UUSA 1PUFB 1AHDP 3B6CA 4A3EJ 1DU6A 3QPSA 3G1MA 3CQZJ 3H0GJ 2KDZA 1JT0A 1WPKA 3IH4A 3IV5A 4JX5A 4M3DA 4AUXA 3JR9A 2E2JJ 1FTZA 1B8IA 1TWGJ 2ME0A 1W0TA 2DMQA 1H89C 2PMZN 2HQ5A 1POGA 1MH4A 3NAUA 5F0HA 2H1KA 1SANA 1I3QJ 2D5VA 2O7OA 1IUFA 4IHXA 1ZKGA 2LVSA 2R5YB 3OIOA 5FKKA 2M2EA 3GTGJ 4M3EA 2GM4A 2DTZA 2NVYJ 2XGDA 5E3MA 4AYBN 2EZHA 3WHCA 2NVQJ 2DMNA 2ZB9A 2JA5J 2JJ7A 1ETQA 3PO2J 1OJLA 2XB5A 1BL0A 4MLOA 3JRFA 2TRTA 5M3FJ 3HOXJ 3BG3A 2L7MP 3I4NJ 5FKLA 2ELKA 1MSEC 2VKEA 1W0UA 2EBIA 1VNDA 4RDUA 1MNMC 4A3JJ 2ME6A 3BR1A 4X1EA 3ZQLA 4BY7J 1JKOC 1XG1A 3G1OA 9ANTA 5EYRA 2CRGA 4CYCA 1A6IA 4D7NA 2O8KA 1RKTA 1LE8B 1YRNB 3S16J 2CQXA 2DMPA 1K83J 1Y1VJ 4HNVA 3TP3A 5IYCJ 2YU9J 4DYQA 3PO3J 2YS9A 3S14J 3LSJA 2N8GA 5E3NA 1JKQC 5J1RA 3VPRA 3S1QJ 2DA2A 2E2HJ 3MKLA 2DMUA 1JUPA 2K9SA 5F0FA 2JA8J 3TW7A 3HEFA 3BT9A 5F04A 2NOGA 1BW5A 4M3BA 1VI0A 5F1JA 4BBRJ 1FEXA 1ENHA 3CCYA 2JN6A 2HOTA 3BR3A 4I76A 3S17J 2EQRA 4IEJA 1G2HA 1SFOJ 4D5FA 1ITYA 5BNGA 4QIWN 2LTPA 2YUSA 3B6AA 1QRYA 4XRMA 5FLMJ 1BA5A 2KT0A 3JRIA 1QVTA 1IDYA 2Y30A 2EZIA 5EEAA 3JRBA 3QPLA 2VPRA 5JLXA 3GTQJ 1BW6A 1MBKA 2W48A 1U9OA 5C4XJ 2CUEA 4Y52J 4RBOA 5FKMA 5IP6A 3D1NI 3CMYA 3SJMA 5F27A 3S1RJ 2VI6A 2L0KA 2OPTA 3GTLJ 4L5EA 4NDLA 5J3LA 5GPAA 4C3JJ 1Y1WJ 5F08A 5GPCA 3BR5A 1ZGWA 1GDTA 2HOSA 2NS7A 5M5YJ 3A02A 1GV2A 3BR0A 4M6VA 2R5ZA 4LOCA 2B63J 1F36A 1VFCA 1K61A 4IHWA 1ETWA 2M8GX 3HGYA 2R93J 2DA4A 1JJ8C 4UUSB 1MSFC 2DA6A 4IHYA 3PM1A 3F0CA 2OF7A 2AO9A 1FJLA 3RQIA 2EZKA 4S0HB 1MBGA 4A3DJ 1WI3A 3HOVJ 5IOYA 1TWCJ 4BXXJ 1ZR4A 2L9RA 3HKZN 1AKHA 5J1YA 5J1UA 2QCOA 3BR6A 1B8IB 2K9NA 3FKIJ 1RPWA 4M3GA 3JRCA 2O9LA 1RESA 3JREA 2EZLA 3BR2A 3BG5A 3FISA 2DA5A 2XPWA 5EG0A 2IAIA 2JA7J 4MFEA 5FLVA 4A3GJ 3HM5A 2CUFA 2DJNA 2DMTA 3SDGA 3ZQFA 3JRAA 1TC3C 3A01A 3MN2A 2JMWA 4X6AJ 1JGGA 2XRLA 1H88C 2HI3A 4B4CA 2DA3A 1I50J 1MH3A 2FQ4A 2X9DA 2Y2ZA 4A3LJ 1QPIA 5IYBJ 2LK2A 1BJZA 3L1PA 5JLWA 3BTIA 5C44J 3JRDA 1JJ6C 4A3FJ 5GP9A 4FE7A 2E1OA 3MVPA 3Q0VA 3QQAA 1S7EA 1O4XA 1A5JA 3DCFA 3IH3A 1TWAJ 4D5CA 3S15J 1I6HJ 1IC8A 4J19A 3GTPJ 3H3VK 3O8GA 4V2FA 3ZQCA 1FTTA 5DS9A 1XS9A 1B72A 2LKXA 2LD5A 4DZJA 4FTHA 3UKGA 5IP7J 3GTOJ 3GBGA 1LFBA 2LR8A 2EH3A 5M5XJ 3NARA 1CQTA 4CYCB 3LSGA 1TWHJ 1T56A 5EGOA 3K7AJ 3E7LA 1UHSA 2MW8A 4GFBA 2HYJA 4M3FA 2TCTA 4W97A 1T33A 1ETKA 4Y7NJ 2DA7A 4V2GA 1LFUP 1MBJA 2VUMJ 2WAQN 3W6VA 3BTJA 4JX4A 1MBHA 3OSFA 3A03A 3BTCA 1ETYA 3LOCA 1D5YA 4A3CJ 2NVTJ 3JRHA 2VKVA 2G0EA 4XRSA 1JKPC 4B3AA 1ORKA 1RKWA 1MBEA 3HB9A 1Z0XA 2HOAA 4ABZA 1R9TJ 3DEWA 2LP0A 2XSDC 2R0QC 5K7FA 1ETVA 1PUFA 2LLKA 2ID3A 5DTDA 1NK2P 4QSHA 5HODA 1X2MA 3S2HJ 3JRGA 3HBLA 5M5WJ 2RAEA 4BY1J 1H8AC 1Q1VA 4A3MJ 3HOZJ 2DA1A 1IDZA 2M34A 1U78A 3BQZA 1JUMA 4FCYA 1RR7A 1U9NA 2X6OA 3O8HA 1OCPA 1ZR2A 4BKXA 4DYCA 1APLC 3ZQIA 4C3IJ 1MBFA 2M0CA 2R5YA 2JA6J 1EF4A 1HOMA 1XC5A 5IP9J 4A3IJ 1FIPA 1X58A 3K2AA 1P7IA 2M9HA 2I10A 2K9QA 3FK7A 2CU7A 1HDPA 3FIWA 2LFBA 2FD5A 4MIMA 3I4MJ 1IV6A 2MGQA 1JT6A 4IHVA 2R5ZB 3RKQA 1HF0A 2X48A 2CJJA 4C3HJ 3S1NJ 1GT0C 4UUTA 1JUSA 1X2NA 2FJ1A 5M3MJ 1JTYA 2E19A 1WH5A 2MG4A 1UG2A 5E3LA 2XPUA 5IOZA 4JX6A 1ZK8A 1GVDA 3FK6A 2JK3A 5K7ZA 3Q3SA 3GTMJ 4DW6A 1IJWC 2H8RA 1LE8A 1YRNA 5FKOA 4G12A 3HOYJ 3ZQGA 1OFCX 1AKHB 3ZOBA 2IBDA 1UMQA 1Z77A 1WCMJ 2WB1N 5EZGA 1HDDC 1IRZA 2GBYA 4JP0A 3HOUJ 5K7HA 5EG0B 4BBSJ 5C3EJ 2E2IJ 4XRSG 3BTLA 3ZQHA 3A01B 3CDLA 2XPVA 3TW6A 3S2DJ 2HXIA 1WH7A 1DU0A 3LSRA 1TWFJ 1GUUA 5FKNA 5EDNA 2Y31A 2HDDA 1P7JA 4D7MA 2L7ZA 3WHBA 5EF6A 2FX0A 2P81A 3LSPA 1HLVA 3M3YJ 5IYDJ 4EEFG 3SFIA 5EZHA 3C2BA 4C2MJ 3HDDA 4DZPA 2NVXJ 1JKRC 1ZTRA 2Y0SN 2HXOA 2ECBA 2XGCA 2XGEA 3HGGA 2COBA 3TP0A 1VF9A 2ECCA 2JWTA 4A69C 3RZDJ 3G1LA 3LNQA 3S1MJ 1B72B 1IGNA 1ZQ3P 4B1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GV5 A;  4FE4 A;  1ETO A;  2ID6 A;  1RET A;  1OCT C;  2AHQ A;  2R7Z J;  2IEK A;  3Q0W A;  4XK4 A;  2R92 J;  4FIS A;  3Q0U A;  1E3O C;  3M4O J;  2Y9Y A;  5EGO B;  1IG7 A;  2L7F P;  2NS8 A;  2XB0 X;  2QF7 A;  1NK3 P;  2GLO A;  4A3B J;  4DYR A;  5IPA A;  4A3K J;  3HOW J;  2Y9Z A;  5FJ8 J;  1WGX A;  1FIA A;  5C4J J;  3BG9 A;  3OSG A;  4W1U A;  3GTJ J;  1AU7 A;  3BQY A;  3TED A;  2DN0 A;  1HCR A;  2LY9 A;  3IH2 A;  4QTR A;  2CQQ A;  4A93 J;  4JYK A;  2K40 A;  1U8B A;  1ETX A;  4AC0 A;  4XIC A;  5F0C A;  4I6Z A;  4MO7 A;  3GTK J;  2WV1 A;  1F43 A;  4MFD A;  2MSY A;  3RZO J;  5E3O A;  3OOU A;  1QVU A;  4XID A;  1JTX A;  1NTC A;  4UUS A;  1PUF B;  1AHD P;  3B6C A;  4A3E J;  1DU6 A;  3QPS A;  3G1M A;  3CQZ J;  3H0G J;  2KDZ A;  1JT0 A;  1WPK A;  3IH4 A;  3IV5 A;  4JX5 A;  4M3D A;  4AUX A;  3JR9 A;  2E2J J;  1FTZ A;  1B8I A;  1TWG J;  2ME0 A;  1W0T A;  2DMQ A;  1H89 C;  2PMZ N;  2HQ5 A;  1POG A;  1MH4 A;  3NAU A;  5F0H A;  2H1K A;  1SAN A;  1I3Q J;  2D5V A;  2O7O A;  1IUF A;  4IHX A;  1ZKG A;  2LVS A;  2R5Y B;  3OIO A;  5FKK A;  2M2E A;  3GTG J;  4M3E A;  2GM4 A;  2DTZ A;  2NVY J;  2XGD A;  5E3M A;  4AYB N;  2EZH A;  3WHC A;  2NVQ J;  2DMN A;  2ZB9 A;  2JA5 J;  2JJ7 A;  1ETQ A;  3PO2 J;  1OJL A;  2XB5 A;  1BL0 A;  4MLO A;  3JRF A;  2TRT A;  5M3F J;  3HOX J;  3BG3 A;  2L7M P;  3I4N J;  5FKL A;  2ELK A;  1MSE C;  2VKE A;  1W0U A;  2EBI A;  1VND A;  4RDU A;  1MNM C;  4A3J J;  2ME6 A;  3BR1 A;  4X1E A;  3ZQL A;  4BY7 J;  1JKO C;  1XG1 A;  3G1O A;  9ANT A;  5EYR A;  2CRG A;  4CYC A;  1A6I A;  4D7N A;  2O8K A;  1RKT A;  1LE8 B;  1YRN B;  3S16 J;  2CQX A;  2DMP A;  1K83 J;  1Y1V J;  4HNV A;  3TP3 A;  5IYC J;  2YU9 J;  4DYQ A;  3PO3 J;  2YS9 A;  3S14 J;  3LSJ A;  2N8G A;  5E3N A;  1JKQ C;  5J1R A;  3VPR A;  3S1Q J;  2DA2 A;  2E2H J;  3MKL A;  2DMU A;  1JUP A;  2K9S A;  5F0F A;  2JA8 J;  3TW7 A;  3HEF A;  3BT9 A;  5F04 A;  2NOG A;  1BW5 A;  4M3B A;  1VI0 A;  5F1J A;  4BBR J;  1FEX A;  1ENH A;  3CCY A;  2JN6 A;  2HOT A;  3BR3 A;  4I76 A;  3S17 J;  2EQR A;  4IEJ A;  1G2H A;  1SFO J;  4D5F A;  1ITY A;  5BNG A;  4QIW N;  2LTP A;  2YUS A;  3B6A A;  1QRY A;  4XRM A;  5FLM J;  1BA5 A;  2KT0 A;  3JRI A;  1QVT A;  1IDY A;  2Y30 A;  2EZI A;  5EEA A;  3JRB A;  3QPL A;  2VPR A;  5JLX A;  3GTQ J;  1BW6 A;  1MBK A;  2W48 A;  1U9O A;  5C4X J;  2CUE A;  4Y52 J;  4RBO A;  5FKM A;  5IP6 A;  3D1N I;  3CMY A;  3SJM A;  5F27 A;  3S1R J;  2VI6 A;  2L0K A;  2OPT A;  3GTL J;  4L5E A;  4NDL A;  5J3L A;  5GPA A;  4C3J J;  1Y1W J;  5F08 A;  5GPC A;  3BR5 A;  1ZGW A;  1GDT A;  2HOS A;  2NS7 A;  5M5Y J;  3A02 A;  1GV2 A;  3BR0 A;  4M6V A;  2R5Z A;  4LOC A;  2B63 J;  1F36 A;  1VFC A;  1K61 A;  4IHW A;  1ETW A;  2M8G X;  3HGY A;  2R93 J;  2DA4 A;  1JJ8 C;  4UUS B;  1MSF C;  2DA6 A;  4IHY A;  3PM1 A;  3F0C A;  2OF7 A;  2AO9 A;  1FJL A;  3RQI A;  2EZK A;  4S0H B;  1MBG A;  4A3D J;  1WI3 A;  3HOV J;  5IOY A;  1TWC J;  4BXX J;  1ZR4 A;  2L9R A;  3HKZ N;  1AKH A;  5J1Y A;  5J1U A;  2QCO A;  3BR6 A;  1B8I B;  2K9N A;  3FKI J;  1RPW A;  4M3G A;  3JRC A;  2O9L A;  1RES A;  3JRE A;  2EZL A;  3BR2 A;  3BG5 A;  3FIS A;  2DA5 A;  2XPW A;  5EG0 A;  2IAI A;  2JA7 J;  4MFE A;  5FLV A;  4A3G J;  3HM5 A;  2CUF A;  2DJN A;  2DMT A;  3SDG A;  3ZQF A;  3JRA A;  1TC3 C;  3A01 A;  3MN2 A;  2JMW A;  4X6A J;  1JGG A;  2XRL A;  1H88 C;  2HI3 A;  4B4C A;  2DA3 A;  1I50 J;  1MH3 A;  2FQ4 A;  2X9D A;  2Y2Z A;  4A3L J;  1QPI A;  5IYB J;  2LK2 A;  1BJZ A;  3L1P A;  5JLW A;  3BTI A;  5C44 J;  3JRD A;  1JJ6 C;  4A3F J;  5GP9 A;  4FE7 A;  2E1O A;  3MVP A;  3Q0V A;  3QQA A;  1S7E A;  1O4X A;  1A5J A;  3DCF A;  3IH3 A;  1TWA J;  4D5C A;  3S15 J;  1I6H J;  1IC8 A;  4J19 A;  3GTP J;  3H3V K;  3O8G A;  4V2F A;  3ZQC A;  1FTT A;  5DS9 A;  1XS9 A;  1B72 A;  2LKX A;  2LD5 A;  4DZJ A;  4FTH A;  3UKG A;  5IP7 J;  3GTO J;  3GBG A;  1LFB A;  2LR8 A;  2EH3 A;  5M5X J;  3NAR A;  1CQT A;  4CYC B;  3LSG A;  1TWH J;  1T56 A;  5EGO A;  3K7A J;  3E7L A;  1UHS A;  2MW8 A;  4GFB A;  2HYJ A;  4M3F A;  2TCT A;  4W97 A;  1T33 A;  1ETK A;  4Y7N J;  2DA7 A;  4V2G A;  1LFU P;  1MBJ A;  2VUM J;  2WAQ N;  3W6V A;  3BTJ A;  4JX4 A;  1MBH A;  3OSF A;  3A03 A;  3BTC A;  1ETY A;  3LOC A;  1D5Y A;  4A3C J;  2NVT J;  3JRH A;  2VKV A;  2G0E A;  4XRS A;  1JKP C;  4B3A A;  1ORK A;  1RKW A;  1MBE A;  3HB9 A;  1Z0X A;  2HOA A;  4ABZ A;  1R9T J;  3DEW A;  2LP0 A;  2XSD C;  2R0Q C;  5K7F A;  1ETV A;  1PUF A;  2LLK A;  2ID3 A;  5DTD A;  1NK2 P;  4QSH A;  5HOD A;  1X2M A;  3S2H J;  3JRG A;  3HBL A;  5M5W J;  2RAE A;  4BY1 J;  1H8A C;  1Q1V A;  4A3M J;  3HOZ J;  2DA1 A;  1IDZ A;  2M34 A;  1U78 A;  3BQZ A;  1JUM A;  4FCY A;  1RR7 A;  1U9N A;  2X6O A;  3O8H A;  1OCP A;  1ZR2 A;  4BKX A;  4DYC A;  1APL C;  3ZQI A;  4C3I J;  1MBF A;  2M0C A;  2R5Y A;  2JA6 J;  1EF4 A;  1HOM A;  1XC5 A;  5IP9 J;  4A3I J;  1FIP A;  1X58 A;  3K2A A;  1P7I A;  2M9H A;  2I10 A;  2K9Q A;  3FK7 A;  2CU7 A;  1HDP A;  3FIW A;  2LFB A;  2FD5 A;  4MIM A;  3I4M J;  1IV6 A;  2MGQ A;  1JT6 A;  4IHV A;  2R5Z B;  3RKQ A;  1HF0 A;  2X48 A;  2CJJ A;  4C3H J;  3S1N J;  1GT0 C;  4UUT A;  1JUS A;  1X2N A;  2FJ1 A;  5M3M J;  1JTY A;  2E19 A;  1WH5 A;  2MG4 A;  1UG2 A;  5E3L A;  2XPU A;  5IOZ A;  4JX6 A;  1ZK8 A;  1GVD A;  3FK6 A;  2JK3 A;  5K7Z A;  3Q3S A;  3GTM J;  4DW6 A;  1IJW C;  2H8R A;  1LE8 A;  1YRN A;  5FKO A;  4G12 A;  3HOY J;  3ZQG A;  1OFC X;  1AKH B;  3ZOB A;  2IBD A;  1UMQ A;  1Z77 A;  1WCM J;  2WB1 N;  5EZG A;  1HDD C;  1IRZ A;  2GBY A;  4JP0 A;  3HOU J;  5K7H A;  5EG0 B;  4BBS J;  5C3E J;  2E2I J;  4XRS G;  3BTL A;  3ZQH A;  3A01 B;  3CDL A;  2XPV A;  3TW6 A;  3S2D J;  2HXI A;  1WH7 A;  1DU0 A;  3LSR A;  1TWF J;  1GUU A;  5FKN A;  5EDN A;  2Y31 A;  2HDD A;  1P7J A;  4D7M A;  2L7Z A;  3WHB A;  5EF6 A;  2FX0 A;  2P81 A;  3LSP A;  1HLV A;  3M3Y J;  5IYD J;  4EEF G;  3SFI A;  5EZH A;  3C2B A;  4C2M J;  3HDD A;  4DZP A;  2NVX J;  1JKR C;  1ZTR A;  2Y0S N;  2HXO A;  2ECB A;  2XGC A;  2XGE A;  3HGG A;  2COB A;  3TP0 A;  1VF9 A;  2ECC A;  2JWT A;  4A69 C;  3RZD J;  3G1L A;  3LNQ A;  3S1M J;  1B72 B;  1IGN A;  1ZQ3 P;  4B1R A; 
#chains in the Genus database with same CATH topology
 2HKO A;  4UUV A;  1GV5 A;  1YHQ I;  4CIC A;  3K4C A;  3C2H A;  3T5X A;  3CC2 I;  4AYB A;  1RET A;  5EJC A;  3KYL A;  2ZXH A;  1LDJ A;  5FRN A;  3MCZ A;  4XK4 A;  4RAF A;  1OQY A;  3A1Y A;  4BHP A;  1JHH A;  3MFK A;  1NK3 P;  2XB0 X;  5IPA A;  4F92 B;  3F21 A;  5K1Y A;  4Q47 A;  2IP2 A;  3CCL I;  2AXL A;  4I0A A;  4Y4R A;  1PJR A;  3BG9 A;  5C4J J;  3ZMT A;  2DFE A;  4BHB A;  3FHZ A;  1LPQ A;  1Y0U A;  3IH2 A;  3HOT A;  2HQN A;  1I5Z A;  4QTR A;  3HPH A;  2KFD A;  2F6C A;  2BGC A;  2K40 A;  2BV6 A;  2GIV A;  4MHG A;  3GXO A;  4I6Z A;  5HVQ C;  2YPR A;  1T0F C;  3BPV A;  1I3A A;  4YG2 F;  5KAI C;  3CCS I;  1QVU A;  3ZR8 X;  4XID A;  4UUS A;  3BRO A;  4IZZ A;  3B6C A;  4I02 A;  3DLA A;  2F4O B;  1R6R A;  5HLT A;  3J7Z I;  3CQZ J;  2Q2E B;  1ZG5 A;  1D0Y A;  4NBQ A;  3V8L A;  1G6N A;  2X1C A;  1UHM A;  5TJJ A;  3L2V A;  4NHJ A;  1N77 A;  1TWG J;  3M8F A;  2QEX I;  1I1G A;  3BC8 A;  1BIA A;  3WOD F;  2PMZ N;  1SVL A;  3SEZ A;  2ZJ2 A;  3ZN1 A;  3DP7 A;  2RNJ A;  3RYP A;  2D5V A;  3VYR B;  5EEH A;  4A5N A;  3M9A A;  4HA8 A;  4BU2 A;  1BI1 A;  1ZKG A;  2R5Y B;  4IHX A;  2M2E A;  3VYS B;  4M3E A;  4RAG A;  5D5X B;  2DTZ A;  5F1R A;  1J5Y A;  2F4I A;  2NVQ J;  2P6T A;  3RPU A;  3IL2 A;  4AU7 A;  2D45 A;  4MEX F;  4B09 A;  1EKE A;  3OYM A;  1OJL A;  2XB5 A;  1MDM B;  1OLT A;  3JRF A;  1HKS A;  3M1E A;  3BG3 A;  3I54 A;  1R71 A;  2XKO A;  3KLO A;  4KYW A;  2BVM A;  3M8J A;  5CQG A;  1W0U A;  2OA4 A;  4O5V A;  3AKZ A;  2UWM A;  4G7O F;  2NS0 A;  1X4P A;  2VQH A;  3H0D A;  3K4K A;  3AG3 H;  1MNM C;  3ISP A;  2JA2 A;  2DPU A;  3GFJ A;  4N4N B;  2DLL A;  4KIB A;  4BY7 J;  3WTX C;  2CW8 A;  3LWF A;  1RKT A;  3S16 J;  3R0A A;  2DMP A;  3I53 A;  2EIM H;  4ZC3 A;  5DDG A;  2IA1 A;  1X3U A;  3FX3 A;  4CXF A;  4E4H A;  1V3F A;  1FC3 A;  2CW0 F;  3DQV C;  3GZN B;  1YIT I;  2PG4 A;  3WG9 A;  4WXD A;  2DFI A;  3E0J B;  2OZ6 A;  5CYV A;  2YS9 A;  1F4K A;  5CJ9 A;  5K5R A;  4UXN A;  1FSE A;  3PL8 A;  2HQA A;  3KZY A;  5J1R A;  3CCE I;  4EM2 A;  1LDD A;  2DMU A;  1JUP A;  5F0F A;  4ESJ A;  4EJW A;  2PMH A;  2LRE A;  4N9H A;  3TW7 A;  2JA8 J;  5CVI A;  1ZRD A;  3E6M A;  3TMO A;  2H1L A;  1AWC A;  1QPM A;  3HRS A;  3BDD A;  3CCY A;  4E70 A;  2HOT A;  2A5Y B;  1G2H A;  2A05 A;  2QM3 A;  3PSF A;  3FM3 A;  2K3P A;  3HUG A;  1HBX G;  2V1U A;  1S29 A;  5ILS A;  3Q5F A;  2I5U A;  2WAD A;  1LVK A;  1R4M B;  5E20 A;  4CCJ A;  1BA5 A;  4L9N A;  3L9F A;  1G3S A;  1YW8 A;  2Y30 A;  1DGR M;  2EZI A;  4BL0 B;  3JRB A;  1TTY A;  3QPL A;  2VPR A;  2KHM A;  3CLQ A;  2MC4 A;  1T39 A;  2A68 F;  4XOR A;  1TNS A;  5HLG A;  1ZLJ A;  3KEQ A;  3G3Z A;  4A6E A;  2CUE A;  4Y52 J;  1EH6 A;  1X19 A;  3L2C A;  4I2O A;  2WV0 A;  4YEJ A;  2P6S A;  5J6X A;  3CMY A;  3FF5 A;  3SJM A;  4IQ4 A;  5F27 A;  4BJ6 C;  3H1C A;  3S1R J;  2FNP A;  4PJJ A;  5B1B H;  1Z91 A;  1IRF A;  5DYM A;  1J59 A;  5J3L A;  2EIK H;  5GPA A;  5GPC A;  3ABM H;  4XOT A;  2E5N A;  3TOA A;  3I59 B;  3CLO A;  1IN5 A;  1ZGW A;  2NS7 A;  2QLZ A;  4AIJ A;  3PFY A;  2HYG D;  4V19 K;  1S7A A;  3A02 A;  3BR0 A;  3F8C A;  4LG0 B;  4M6V A;  4HSR A;  1Q1H A;  5LGT A;  5LHG A;  4M6X A;  1R22 A;  1ETW A;  4LD5 A;  1IN4 A;  3F22 A;  2R93 J;  1WRJ A;  2KJC A;  1P4A A;  3OYC A;  4F91 B;  1QHG A;  3MD2 A;  2R7Q A;  5CVJ A;  1TWC J;  3FXL A;  2V9V A;  1ZHF A;  2K4B A;  3P9I A;  4I09 A;  3OR2 C;  3ONQ A;  1AKH A;  2LF8 A;  1Y39 A;  5J1U A;  1SD5 A;  2QCO A;  3HG9 A;  3KZI C;  3IKV A;  1K78 B;  3DLL F;  3F3X A;  1RPW A;  2IGO A;  2Z16 A;  2W1O A;  3ZMZ A;  2EZL A;  4C9Y A;  1Z9C A;  3BR2 A;  1ZEL A;  4KDP A;  2DA5 A;  1Z3Y A;  2XPW A;  4MFE A;  5FLV A;  2HWV A;  3DEU A;  3HM5 A;  4XLC A;  2JVH A;  1A36 A;  2DK5 A;  4DBR A;  3QPH A;  3A01 A;  3MN2 A;  2JMW A;  4L5I A;  1H88 C;  3QAH A;  1FYM A;  4U7B A;  1YYV A;  2UXX A;  1I50 J;  3AG4 H;  1MH3 A;  2FQ4 A;  2Y2Z A;  2ZKZ A;  1JI8 A;  4CZC A;  2LK2 A;  1MMN A;  1BJZ A;  1WKM A;  3KEY A;  4E7S A;  3IKT A;  4A3F J;  1J2X A;  5EEG A;  4BNC A;  1FSH A;  4PK4 A;  3Q0V A;  3QQA A;  1C0W A;  3OS0 A;  4RB2 C;  1XB4 A;  3CJT B;  1RRJ A;  1R58 A;  2EFW A;  3NWT A;  1BIB A;  3FMS A;  3MMY B;  2M4K A;  4RA2 A;  3L09 A;  3ZRG A;  3S15 J;  1YX5 A;  3LA3 A;  2E36 A;  4A2U A;  3GTP J;  3O8G A;  3ZQC A;  5GAG J;  2H8W A;  5DS9 A;  1ZLK A;  2CG4 A;  2XSJ C;  3K6G A;  3F9K A;  4HOB A;  1LFB A;  3JSO A;  3DTK A;  2LH9 A;  2E60 A;  1RUO A;  1SD7 A;  5DV5 A;  1A35 A;  4ZDP A;  3MZH A;  4GCV A;  2QKL B;  2DOD A;  4PGG A;  4C30 A;  1CF7 B;  1D5V A;  1BM9 A;  3K7A J;  5EGO A;  4HQM A;  3CDI A;  2B0L A;  5FFZ A;  2IS1 A;  2CQN A;  3D5R C;  2LNB A;  5L3C A;  1O7F A;  3SEQ A;  3V7S A;  4Y7N J;  4V2G A;  5KCM A;  1MBJ A;  1LFU P;  2VUM J;  3BTJ A;  4OIO F;  1KGS A;  3IAS 2;  3A03 A;  4LLG F;  1K79 A;  4M71 A;  4XNF A;  1D5Y A;  2NVT J;  3JRH A;  1XCV A;  5AIQ A;  5DM7 F;  1TBX A;  3A4C A;  3H5A A;  4B3A A;  3F6O A;  4R79 A;  4KT6 A;  2EIL H;  3HB9 A;  3SQN A;  1KQ8 A;  2W24 A;  3DEW A;  1R9T J;  2LKS A;  4E7I A;  2GIZ A;  1NHA A;  5LD2 C;  5K7F A;  4RMN A;  4EGZ A;  2XKP A;  4L18 B;  2MA3 A;  2ID3 A;  2WB1 A;  4P5O A;  3W3C A;  5DTD A;  2DJI A;  1F9N A;  3KET A;  2P7C B;  3EYI A;  4ESB A;  1XDU A;  3CJQ B;  3S2H J;  1V5G A;  1O7L A;  2E35 A;  2RAE A;  4WCG A;  1X4O A;  2EA4 A;  2CFX A;  2JSP A;  2JPB A;  3ASN H;  3EYY A;  2DA1 A;  2Y0M A;  1MGT A;  2M34 A;  4CCK A;  1O57 A;  2IPQ X;  4YII A;  3K9T A;  3U1K A;  2HVQ A;  1RR7 A;  4J01 A;  4GYI A;  4G6D A;  2LYC A;  2OAZ A;  1ZR2 A;  3SXY A;  4DYC A;  3W6J B;  4PSX A;  1DPR A;  1APL C;  1DP7 P;  2FBK A;  3ZCO A;  3HTS B;  4OAY A;  5J4V A;  3O3K A;  5CLS A;  1Y0N A;  2MLK A;  5LFA A;  3KX2 A;  1EF4 A;  4OIN F;  2RDP A;  3VSK A;  1XC5 A;  5HLI A;  4RAY A;  1PUE E;  3R6S A;  1EH8 A;  2L9N A;  2CUZ A;  1P7I A;  3GFL A;  1FPQ A;  3OYD A;  2VBW A;  3JAM Z;  3RSN A;  2L01 A;  1XDS A;  3GWZ A;  3FIW A;  4BAC A;  4L0Y B;  2FD5 A;  3WTV C;  3KFW X;  1IV6 A;  4A0X A;  4XLH A;  1B9M A;  3I71 A;  2VKD A;  2X48 A;  4ZDL A;  2CWE A;  4PDK A;  2CJJ A;  2QZ8 A;  4LGW A;  1GT0 C;  1R5I D;  1JUS A;  1X2N A;  1SFK A;  3WTT C;  2J5P A;  4FX4 A;  1YS7 A;  4UV8 A;  4EJU A;  4RM2 A;  4IHT A;  2KIQ A;  3EUH A;  3K1P A;  2Q8K A;  2XPU A;  5IOZ A;  2EV5 A;  4XKC A;  3GTM J;  4KMU X;  5GAD J;  2QKM B;  4N4O B;  4G12 A;  3WGH A;  1L3L A;  2QQB A;  1R1T A;  5LGN A;  3HOY J;  1RUN A;  2WAF A;  1XX5 A;  3F23 A;  1I27 A;  1TQI A;  1XMK A;  4BAY A;  5JVT A;  4F7Z A;  4H0E A;  5DD8 A;  4KIT B;  1TW2 A;  5EG0 B;  1XGO A;  4PZJ A;  4JBA A;  4XRS G;  1O3R A;  4HNT A;  2MD5 A;  1ODD A;  2HXI A;  1BI2 A;  2JRM A;  2B9S A;  4L5J A;  5D5V B;  2OTJ I;  5F64 A;  5KAF C;  5HS8 A;  3W2V A;  2Y31 A;  3I5U A;  1QHH D;  1P7J A;  2FA5 A;  2A6E F;  3BZ6 A;  1XSV A;  4EEF G;  2NOJ B;  3SFI A;  4TV7 A;  4Y33 A;  2FBH A;  1HQC A;  2NVX J;  1YW9 A;  1JKR C;  3U21 A;  1N78 A;  2HXO A;  2V6C A;  3HYI A;  1T6S A;  1Z6R A;  2G9W A;  2BBY A;  4WF2 A;  2ECC A;  4A69 C;  3QRF F;  3C2G A;  3RZD J;  3LNQ A;  2XRO A;  1B72 B;  5D6E A;  3J81 Z;  4LLL A;  3TQN A;  5ICC A;  2DT6 A;  2ID6 A;  1IF1 A;  1M1E B;  3OYF A;  2R7Z J;  3Q0W A;  3WE2 A;  1BC8 C;  2EIJ H;  1SFU A;  3FZV A;  4FIS A;  4EM0 B;  2Y9Y A;  1IG7 A;  3FXJ A;  4RAZ A;  4A3B J;  5L3B A;  3D5L A;  3MAJ A;  4N0B A;  4DYR A;  1ZAR A;  4A3K J;  1FOW A;  5D6F A;  3HOW J;  2LSO A;  1VQL I;  4G6Q A;  2HPI A;  3CUQ B;  2H6B A;  4W1U A;  4QLC U;  3GTJ J;  2IGM A;  1Z7U A;  1ZYR F;  2YX7 A;  3WE3 A;  2CSO A;  3KP4 A;  1HCR A;  2JTV A;  2X6W A;  3PSI A;  1R1U A;  2VJJ A;  1D3Y A;  2G7U A;  2CQQ A;  3AL0 C;  3BG7 A;  2ZFW A;  1ETX A;  2RVC A;  2CV0 A;  4UNO A;  3OL3 A;  4I98 B;  2DOA A;  4MO7 A;  1RNL A;  3CC4 I;  2M87 A;  3A0B C;  3P9C A;  2WV1 A;  3L2U A;  2W25 A;  2R7W A;  4A6D A;  2JQ7 A;  4IQJ A;  3I56 I;  5E3O A;  4AID A;  3DTE A;  4HF0 A;  1K4T A;  1YTY A;  1DU6 A;  3QPS A;  2Q1Z B;  3HSE A;  3P5J A;  2VOD A;  4MQ9 F;  5KHD A;  1Y56 A;  2CUJ A;  2HOE A;  2QQA A;  1ZN2 A;  2CS3 A;  4XQF A;  4KA4 A;  1A04 A;  1WPK A;  3CTA A;  2ZXI A;  2EFQ A;  4IVN A;  2VON A;  3B02 A;  1D1B A;  4UHT A;  4CSW A;  2E2J J;  5HS9 A;  2YX4 A;  2Z5U A;  3FDY A;  1W0T A;  1A31 A;  4R1H A;  2KJB A;  1WZ2 A;  1H89 C;  5LRS A;  2ZSI B;  2HQ5 A;  3CJR B;  4PGH A;  3NAU A;  3SDB A;  3PIO F;  2H1K A;  3DBH B;  1YG2 A;  1I1S A;  4KMF A;  1WJC A;  2K86 A;  2O7O A;  2L4A A;  3HRU A;  3OIO A;  5FKK A;  3T8T A;  1YO5 C;  1IAW A;  5E3M A;  2K7L A;  2P5V A;  1IUY A;  2QQ9 A;  4LB5 A;  2ZB9 A;  3OYB A;  5D5U B;  2VBZ A;  2CV2 A;  1PYV A;  1R5G A;  3LA7 A;  1ETQ A;  5DCM B;  1IRX A;  2A3S A;  3AG2 H;  3VDX A;  5HNH A;  2NNN A;  2YSR A;  4KJZ A;  2LOO A;  2KZG A;  3I4N J;  1IV8 A;  1TZL A;  1YOV B;  2VBX A;  2X0L A;  2ELK A;  4LIV A;  2VKE A;  2EBI A;  2JSC A;  3EUH C;  1U0J A;  2FML A;  4RDU A;  5AIP A;  4A3J J;  1E3H A;  2ME6 A;  2HVR A;  4PJM A;  4F3Q A;  1T98 A;  1QGP A;  3GZ5 A;  2QBY B;  3SYT A;  3G1O A;  3CO7 C;  1LDK B;  2CRG A;  4GDF A;  2E7W A;  4D7N A;  4IOC F;  1LE8 B;  1IN8 A;  2DYS H;  2O8K A;  2Y69 H;  3ZP5 A;  3R61 A;  1Y1V J;  1FOX A;  2JRT A;  4OWR B;  2HGC A;  4C2U A;  2YU9 J;  4DYQ A;  1K4S A;  5E17 F;  3JAM K;  2XIG A;  1TNT A;  3ELK A;  2XC7 A;  2A69 F;  5J4Y A;  2O5R A;  1JKQ C;  3MEX A;  2VIX A;  2RC4 A;  4ZYD A;  4EJT A;  3HTU A;  2HEO A;  4K2E A;  1FY7 A;  3HIF A;  3R0J A;  2DDB A;  2DQL A;  3JCU C;  5KNL A;  4WK8 F;  1T95 A;  1B6A A;  2BE5 F;  2ZME A;  4M3B A;  3FXO A;  5F1J A;  3K1M A;  1ONV A;  1Y8Q B;  3HKZ A;  2JN6 A;  4XBF A;  1QNT A;  4IXA A;  4EMS A;  3LSH A;  3BJO A;  5H2F C;  2JT1 A;  3GZ6 A;  1SFO J;  4DQ2 A;  1ITY A;  4WWC A;  5E79 C;  5A2Q Z;  4M6Y A;  3H9J A;  3MKW B;  2GAU A;  1QRY A;  3TL4 X;  3WTS C;  1ON2 A;  5GAE J;  1SVO A;  4O3M A;  2R7U A;  4A5M A;  2DI3 A;  4EVI A;  3K4N A;  4AVZ A;  2LBF A;  2NYX A;  1XSD A;  1ZG3 A;  2D1V A;  1BW6 A;  1MBK A;  1Y6I A;  3QU6 A;  4DJA A;  2VOP A;  1U9O A;  2M5W A;  2MLG A;  4B47 A;  1Y8R B;  1D1A A;  2V4J C;  3BCB A;  3VFZ A;  1HST A;  5FKM A;  3E1S A;  4HX8 A;  1RI7 A;  2J5O A;  1LVA A;  3FBI B;  1IO2 A;  4EGY A;  2MBF A;  3ML6 A;  3PQJ A;  2PJR B;  3LA2 A;  3OR1 C;  2K9L A;  3RKW A;  4E7Z A;  2L2O A;  2XAS A;  3M7G A;  2QUF A;  4C3J J;  5F08 A;  3ROU A;  4HX7 A;  1GDT A;  3PUF A;  2VT3 A;  4J00 A;  5ILU A;  2ZBK A;  3CC7 I;  2WY8 Q;  1K7A A;  3ZQQ A;  3ABU A;  2R5Z A;  4R8H A;  1SFX A;  4HDV A;  4WXH A;  2B63 J;  5FO5 A;  4AIK A;  1VFC A;  2XVC A;  4KIF A;  1VQ4 I;  3HGY A;  3J81 K;  2DA4 A;  2HNH A;  1QU3 A;  1J09 A;  4IHY A;  2QYO A;  3PM1 A;  3SZP A;  3OYL A;  4LLN A;  3N4M A;  4BQN A;  2AO9 A;  3RQI A;  1R1V A;  3K2Z A;  4OIP F;  3RKX A;  1FOY A;  1WI3 A;  1X3W B;  4B1R A;  5E8I A;  4DIQ A;  2L9R A;  2BY0 A;  1YX3 A;  4PJN A;  1STZ A;  4BE2 A;  4KN4 X;  1WJD A;  4UY8 I;  3IRR A;  2BOL A;  1WSU A;  1T8I A;  2IS6 A;  3BR6 A;  1B8I B;  3B73 A;  3BZK A;  4M3G A;  2EFP A;  1RES A;  3ERM A;  3F8F A;  3AFH A;  2V7F A;  4I0B A;  2M4G A;  2OD5 A;  4HBL A;  3OYG A;  4PJ0 C;  3TOB A;  5LLQ A;  4A3G J;  1TC3 C;  2CUF A;  2DJN A;  3SDG A;  2GOX B;  1CGP A;  4PFO A;  1ZRF A;  4KFC A;  2AQF A;  4IF4 A;  2C6Y A;  2ADU A;  3FWE A;  5IYB J;  3DFG A;  3L1P A;  5JLW A;  1BI0 A;  2FF4 A;  3BTI A;  2MH2 A;  1JJ6 C;  1G3T A;  2ETH A;  5ICE A;  4CZZ A;  3LFU A;  3O6B B;  4FE7 A;  1FBS A;  1O4X A;  3VYU B;  3KYC B;  3IUO A;  5BS6 A;  3IH3 A;  2E1M B;  2DCE A;  2NXN B;  2R7F A;  3L2R A;  4HLY A;  4BXF A;  1G4D A;  2ESH A;  3LQR A;  3H3V K;  2HU9 A;  3S3N A;  1XS9 A;  2XF6 A;  2DW4 A;  5CQE A;  1UB9 A;  2LD5 A;  2RN7 A;  4HEA 2;  3FXM A;  3EET A;  1GXP A;  5IP7 J;  3QWL A;  2AQE A;  1RR8 C;  2JUG A;  2LR8 A;  1CQT A;  4CYC B;  4YRV A;  1XMX A;  2ZJR F;  1FBQ A;  2Z1D A;  4LMY A;  4F93 B;  2X51 A;  1W4M A;  2GZW A;  2MW8 A;  4BH9 A;  4GFB A;  2QQ8 A;  2TCT A;  5JI6 A;  1ETK A;  2DA7 A;  1G3W A;  2WAQ N;  5HDG A;  4GYG A;  3RKY A;  1AOY A;  1OYY A;  1AA7 A;  2F5V A;  1SFE A;  1HW1 A;  1ETY A;  3BTC A;  1WHU A;  3I9V 2;  3LOC A;  3REO A;  3V7C A;  4YFK F;  4IJA A;  3CCJ I;  1GLN A;  3CCQ I;  4A3C J;  2LC2 A;  3PNT A;  2ZNZ A;  1PVE A;  2VKV A;  4NNJ A;  2ZME C;  1ORK A;  2DQR A;  1RKW A;  1E2X A;  4ABZ A;  1D1C A;  4XLF A;  2E1N A;  2LP0 A;  1VQO I;  1ZH5 A;  4LB6 B;  4KUM A;  3GFI A;  2BYV E;  4I7H A;  1ZGJ A;  4DOZ A;  3D5S C;  1PP7 U;  2MD0 A;  5BOX A;  2IGK A;  4BEH B;  1LFP A;  3DV8 A;  3EDP A;  1QA6 A;  1X2M A;  2HZD A;  3H5R A;  3ECO A;  2OQR A;  2BW3 B;  4D0P A;  3JRG A;  1U5T B;  2FXA A;  2Q2E A;  5CKT A;  3HOZ J;  1YJN I;  1VTN C;  1VQP I;  1IDZ A;  2VC0 A;  4O6J A;  2HVS A;  1JUM A;  3CZ6 A;  2ELJ A;  4FCY A;  1O3Q A;  2V26 A;  4RGR A;  3O8H A;  2EV0 A;  1OCP A;  2QGU A;  2P0W A;  2E71 A;  3ERE D;  4E7H A;  5FLX Z;  4XM3 A;  5B1A H;  1HKT A;  2UXN A;  4XL9 A;  5E18 F;  3T1B A;  4CDG A;  1W5C C;  2K5C A;  2R5Y A;  2WWY A;  3VSL A;  3ZQ7 A;  2DFF A;  2JA6 J;  2DXI A;  3H35 A;  2XAU A;  3IC7 A;  2VN2 A;  2RQQ A;  3TDZ C;  1W36 D;  1FIP A;  1UJ8 A;  1Z21 A;  1HKQ A;  2I10 A;  4PCQ A;  4RGX A;  2A61 A;  4YIF A;  3OV8 A;  3MZY A;  5A2Q K;  1HDP A;  4HST A;  4CYD A;  1MDM A;  4NC6 A;  1JT6 A;  2LY1 A;  2RQP A;  3RCO A;  3IWF A;  2XF7 A;  1HF0 A;  4IHS A;  2BHZ A;  2X4H A;  1R7J A;  2LKP A;  4G9Y A;  4C3H J;  3WTZ A;  3Q9V A;  1Z1D A;  1P6R A;  4B48 A;  4GRI A;  1OR7 A;  1W7P B;  2CGP A;  3W2A A;  3ABT A;  2JUC A;  3N97 A;  5L3E A;  2KIS A;  1WH5 A;  3QU3 A;  1DQU A;  4D1Q A;  5IT9 Z;  1ZK8 A;  2W57 A;  3FK6 A;  1RZ4 A;  2H8R A;  3OYA A;  3ZQG A;  1OFC X;  2LMD A;  1UMQ A;  3CP2 A;  3GLX A;  4MTE A;  1HA8 A;  3PNV A;  3S8P A;  1IRZ A;  2XAF A;  3QOP A;  2HYF A;  3OIQ A;  3JSP A;  1YW7 A;  2QVO A;  2GBY A;  4JP0 A;  5CPR B;  1U6G A;  4BBS J;  3LQQ A;  5C3E J;  2F5E A;  2GOM A;  1RIO H;  2Z9O A;  3PFI A;  2UZK A;  1KU7 A;  1UHW A;  3CDL A;  2XPV A;  3CP8 A;  3RIR A;  1VQ5 I;  1WH7 A;  1USS A;  1DU0 A;  5D8K B;  3LSR A;  2L7K A;  2GQQ A;  1TWF J;  1ERD A;  4S04 A;  4XLA A;  5EDN A;  1QZE A;  3F8B A;  4HF1 A;  2FX0 A;  2P81 A;  2O0Y A;  2Z99 A;  1HLV A;  1V4R A;  4LK0 F;  2O8X A;  2ISY A;  2XAQ A;  1ZTR A;  2PMZ A;  3KE2 A;  4QPQ A;  2Q0O A;  3CF2 A;  1VF9 A;  3KEO A;  3TP0 A;  1YJ9 I;  4U7D A;  3DPT A;  2DT7 B;  4G6T B;  3CME I;  1OYW A;  4FX0 A;  3PQK A;  1ZQ3 P;  4IKF A;  2EB7 A;  3KCC A;  2HPM A;  3F8M A;  3J7A Y;  2ZNY A;  1OCT C;  2AHQ A;  1IXC A;  5HLH A;  1WQ2 A;  1EH7 A;  2XGX A;  1E3O C;  4HRI A;  2GLO A;  2L7F P;  2NS8 A;  2ACJ A;  2QF7 A;  1LQ1 A;  1O3T A;  2ICW G;  2Y9Z A;  1JHF A;  5FJ8 J;  5J47 A;  3ECH A;  1WGX A;  3RDI A;  3OSG A;  3T0Y A;  1XPX A;  1AU7 A;  2EPF A;  4XOP A;  3GUD A;  2DN0 A;  3MWM A;  2LY9 A;  1LNW A;  3H3Z A;  3I0T A;  3OYK A;  3I59 A;  4YEL A;  2HTS A;  2EK5 A;  2W84 A;  4L0Z B;  1JGS A;  1REP C;  2VQG A;  4NQW B;  4JYK A;  4CH7 A;  2A5W A;  4LG0 A;  5F0C A;  4AM3 A;  2PLY A;  4A12 A;  3GTK J;  4EM1 A;  1GVJ A;  5BPI A;  1F43 A;  4OMY A;  3OOU A;  4Y13 A;  3H5N A;  1JTX A;  1AHD P;  1PUF B;  2OQG A;  3G4S I;  1J75 A;  5HDK A;  1P4W A;  1HXD A;  2RKH A;  2Y0S A;  3G1M A;  2FE3 A;  3SFZ A;  4H4K C;  1SD6 A;  3H0G J;  2KDZ A;  1DGW Y;  1JT0 A;  1YI2 I;  3QOE A;  3H9G A;  4ON0 A;  3QP6 A;  4JX5 A;  4M3D A;  4X0G A;  2V6E A;  2VPL A;  2L5Q A;  4AUX A;  3JR9 A;  4ZTF A;  1SVM A;  3V8K A;  1K78 A;  2RV8 A;  2XHK A;  1VQK I;  1OCO H;  2HDW A;  2ME0 A;  4EQQ A;  1BR4 A;  1MH4 A;  2VB6 A;  4B3X A;  1D0Z A;  1LB2 A;  3J7Y J;  4Q4Z F;  2VXZ A;  3CJN A;  2A07 F;  2LVS A;  2TDX A;  2CQ7 A;  2IS2 A;  4II2 A;  3OYJ A;  3Q9S A;  2NVY J;  2HZT A;  2XGD A;  3GVA A;  4AYB N;  2EZH A;  2YU3 A;  1V5F A;  3WHC A;  1TP4 A;  1F1Z A;  4UVB A;  4WXC A;  5BQT A;  3HL2 A;  3PO2 J;  1T2K A;  2XRN A;  1W5S A;  4MLO A;  4UB6 C;  4PSW A;  4CHU A;  2VKH A;  2TRT A;  5IT3 A;  3QOD A;  1BN5 A;  1BR1 A;  4FAS D;  1OR7 C;  2VL8 A;  5FKL A;  3L2Q A;  1MSE C;  4RGS A;  1VND A;  1FP1 D;  2EA2 A;  1XSX A;  2IA2 A;  5LBQ A;  3W6K B;  5K5O A;  3BR1 A;  2D1H A;  4X1E A;  4DBQ A;  5FLX K;  4CA0 A;  1HSJ A;  3ZQL A;  3BOQ A;  1E0E A;  5L3D A;  1YJW I;  4ETS A;  1NH3 A;  1W36 C;  1KU9 A;  1YRN B;  3K4L A;  3I55 I;  1S6L A;  2CQX A;  1CF7 A;  3K4B A;  4HLX A;  1VQM I;  4HQE A;  1BI3 A;  4HNV A;  1VQ8 I;  3LL7 A;  4N9I A;  2X1D A;  1WJF A;  1UFM A;  4LFU A;  2L54 A;  3A0H C;  5LEK A;  3VPR A;  1MMD A;  2DA2 A;  2M1B A;  3MKL A;  3ZMD A;  3U2R A;  1ZAO A;  4AVP A;  3TO6 A;  3BT9 A;  5F04 A;  2DOF A;  2NOG A;  1BW5 A;  1X1D A;  4IPA A;  3BPX A;  4BBR J;  4HV5 A;  4EJO A;  1FEX A;  3BR3 A;  4I76 A;  2WC2 A;  3F8N A;  1OMI A;  1KON A;  1XD7 A;  3I64 A;  3R60 A;  4IEJ A;  2K9M A;  2ZJQ F;  4D5F A;  2K3F A;  3OYI A;  1KYZ A;  4QIW N;  1S8N A;  2LTP A;  2YUS A;  3FBN B;  5DEQ A;  3DKW A;  3B6A A;  3RPQ A;  1NG6 A;  1IXS B;  3GFM A;  3GEZ A;  4XRM A;  5JVG F;  3KP3 A;  1FP2 A;  2CMP A;  2X6Y A;  3DPL C;  3HRT A;  2KT0 A;  2OUM A;  1QVT A;  5LGU A;  5EEA A;  1T38 A;  5JLX A;  1HW5 A;  1IXR C;  1NG7 A;  3E5Q A;  4ITV A;  2W48 A;  3LSM A;  1VQ7 I;  1P4X A;  2M7A A;  4L9T A;  5C4X J;  4BQO A;  2F5C A;  2JVG A;  3IP4 B;  4RBO A;  3VB2 A;  4B8X A;  5IP6 A;  2XDV A;  2BZT A;  3GX4 X;  4XON A;  5FD5 A;  2VQL A;  1BOA A;  5L3G A;  2VI6 A;  3K4J A;  2L0K A;  2M0M A;  3DKX A;  3NEU A;  2O6G E;  2PI0 A;  3WU0 A;  2VLA A;  3GTL J;  1V54 H;  4EAT A;  4KIS A;  3PIP F;  4NDL A;  1Y1W J;  2WAE A;  1WVR A;  4GGG A;  3CO6 C;  2HOS A;  1FWZ A;  5M5Y J;  3D0S A;  3RYR A;  1LUJ B;  3S2W A;  1MIJ A;  4RS8 A;  4E7J A;  5H20 A;  2HFH A;  4LOC A;  2FSW A;  4IHW A;  4EJV A;  2M8G X;  3AAF A;  1TQM A;  5CVR A;  3ZGK A;  1JJ8 C;  3TBI A;  4UUS B;  2HS5 A;  2DA6 A;  3KP6 A;  2OV7 A;  4JQF A;  1FJL A;  1KQ0 A;  2EFN A;  4S0H B;  1MBG A;  1MND A;  1KQ9 A;  4KT5 C;  4A3M J;  3WTW C;  1MW7 A;  3HOV J;  4LG3 A;  1XGM A;  3FM5 A;  4YFX F;  5JR3 A;  1MZB A;  2P7V B;  3F6V A;  5J1Y A;  3H36 A;  3NQO A;  2XAJ A;  4F52 A;  3DBL B;  1R23 A;  3CF5 F;  2K9N A;  3FKI J;  1FYL A;  3CMM A;  2O9L A;  1DP3 A;  2OCC H;  3JRE A;  4RLQ A;  1PDN C;  1JE8 A;  2MH9 A;  1ULY A;  2LRD A;  1FMV A;  4M9S A;  5GTH C;  5EG0 A;  2JA7 J;  4NC8 A;  3JRA A;  3IWZ A;  2ISZ A;  1BC7 C;  1QZY A;  2XRL A;  2HI3 A;  2OC6 A;  2CH0 A;  3EUA A;  2DA3 A;  2X9D A;  2DAO A;  1QPI A;  1T08 B;  2ZJP F;  5C44 J;  1WJB A;  5GP9 A;  2L9S A;  1Z67 A;  3TDU C;  3R4K A;  2DTR A;  5ERI A;  2H09 A;  2K85 A;  1H9G A;  2KZV A;  1BOB A;  3DCF A;  1R5H A;  3CD6 I;  3V42 A;  4D5C A;  1TWA J;  3OWT A;  3C1D A;  4ENM A;  2BY2 A;  2FOW A;  3C3W A;  2OCE A;  4IRG A;  3RI4 A;  4J19 A;  1DDN A;  2F5D A;  4V2F A;  1P9Q C;  5J8C A;  1EV7 A;  3WTY C;  2PBI A;  1B72 A;  2LKX A;  3LSK A;  1WJA A;  1VQ9 I;  2KL4 A;  3BY6 A;  3UKG A;  3K0L A;  3K70 D;  3E5X A;  2PMU A;  4XLE A;  2PFB A;  3UNG C;  5LRR A;  2EFO A;  2DO7 A;  5M5X J;  3NAR A;  1VZ0 A;  4I01 A;  3G73 A;  2DPD A;  1P92 A;  1T56 A;  2X1E A;  4ENJ A;  2VQC A;  5CVV A;  1UHS A;  4IOA F;  3W2W A;  3OYE A;  1T33 A;  4P96 A;  3GW2 A;  3M07 A;  4U88 A;  5B66 C;  1W1W E;  3IHU A;  3CUQ A;  3W6V A;  3FMR A;  4JK1 X;  2PJP A;  2ESN A;  1QZZ A;  1X3Z B;  2MAB A;  2GXG A;  4Y3O A;  5E1Z B;  3P7N A;  2IW5 A;  4CCN A;  1A6Q A;  3TO9 A;  4G94 A;  2G0E A;  4XRS A;  2R7T A;  1OPC A;  5ICG A;  3LSI A;  4RM3 A;  4ASN A;  1DPU A;  1D8J A;  1Z0X A;  1N75 A;  3DEE A;  4CCM A;  4BE0 A;  2FBI A;  2VT2 A;  2R0Q C;  2F5F A;  5JHU A;  4G7Z F;  3G2B A;  2LLK A;  4E6K G;  2X6X A;  3HUG B;  3HBL A;  3ZXS A;  2O03 A;  2E34 A;  1Q1V A;  1VQ6 I;  3OY9 A;  2PQ8 A;  1BR2 A;  1U78 A;  4IL6 C;  3BQZ A;  2ZXJ A;  3VEP A;  1HW2 A;  1WJE A;  3KZZ A;  1U9N A;  4BUP A;  2X6O A;  2VJI A;  1QBJ A;  1IW7 F;  4HW0 A;  1DUX C;  1UAA A;  3ZQI A;  1R36 A;  3K4M A;  1TT0 A;  2IRF G;  1OIS A;  2ZC2 A;  3HXL A;  4IRH A;  4C3I J;  1HOM A;  3RPU D;  2XUB A;  1K6O A;  1OCC H;  2R7V A;  4M9X A;  5IP9 J;  4A3I J;  1LJ9 A;  1X58 A;  4XKV A;  5KVR A;  5DM6 F;  3K2A A;  2JPC A;  3KP2 A;  4A0Y A;  3ZN0 A;  4UB8 C;  1FNN A;  1KU3 A;  2XF5 A;  3IRQ A;  2FEZ A;  4YFN F;  2CU7 A;  1MJA A;  2FOK A;  3LST A;  2E1C A;  5DCM A;  4IRI A;  2LFB A;  1XMA A;  3OL4 A;  3KLN A;  4MIM A;  4LJZ F;  2B7E A;  3QYF A;  2MGQ A;  1YQA A;  2DU9 A;  4IHV A;  4MGR A;  1EA3 A;  3CUO A;  4CCO A;  3N05 A;  2O61 A;  4UUT A;  3F72 A;  5M3M J;  3ABL H;  2KRF A;  2FRH A;  1JTY A;  3IAM 2;  1UG2 A;  1FOK A;  2GXB A;  4BHC A;  2QBY A;  4JX6 A;  2JK3 A;  1Z6T A;  1TL8 A;  4DW6 A;  3A2K A;  3L00 A;  1LE8 A;  5LHH A;  3QP5 A;  3KP5 A;  2DBB A;  3FKJ A;  4M74 A;  4U0Y A;  1AKH B;  2NVU B;  3C7J A;  1TT5 B;  2IBD A;  2R4G A;  3G71 I;  1Z77 A;  3JTH A;  1WCM J;  2WB1 N;  3PUB A;  3VOE A;  4HX4 A;  4G8X A;  3DPU A;  2KMU A;  1LEB A;  3HOU J;  5K7H A;  3AG1 H;  2M3A A;  4B43 A;  1TW3 A;  3BTL A;  1MJB A;  2P5K A;  4Y17 A;  2W82 A;  3ZQH A;  3A01 B;  4OIQ F;  3S2D J;  1KYW A;  4M72 A;  2PEX A;  5L3F A;  3OYN A;  5ILV A;  4BQA A;  1FT9 A;  3QYB A;  2NAZ A;  2HDC A;  4D7M A;  2L7Z A;  3WHB A;  3LAP A;  2HKX A;  3LFK A;  4PUS A;  3LSP A;  3M3Y J;  5IYD J;  5E1W A;  3C2B A;  4C2M J;  3HDD A;  2ZXW H;  4DZP A;  2HR3 A;  4M73 A;  3GF2 A;  2Y0S N;  1YIJ I;  2ECB A;  3S3M A;  3HGG A;  2COB A;  5FB2 A;  2AS5 F;  2LDU A;  4RGU A;  5D4S A;  1FZP B;  3ABK H;  3DU5 A;  4ZZD A;  4XLP F;  4ENK A;  3MZ8 A;  3CCM I;  4OU0 A;  2QSF X;  1MNE A;  5H6R A;  4MNU A;  1IGN A;  5DUK A;  3BJA A;  2GA1 A;  4FE4 A;  1U2W A;  4DNC A;  2K02 A;  1ETO A;  2O3F A;  1GHC A;  3OIP A;  2EJR A;  2DOE A;  3BLY A;  2IEK A;  1H0M A;  2W7N A;  4OOI A;  2R92 J;  3ZMU A;  3WTU C;  2MC3 A;  3Q0U A;  3M4O J;  4HV6 A;  5EGO B;  3FMQ A;  1FX7 A;  2NNY A;  2KKO A;  2QSH X;  3CUQ C;  4QWQ A;  2PJR A;  1B1B A;  4ZYG A;  2HTJ A;  1FIA A;  4YIR X;  4RB1 A;  3BQY A;  2F2E A;  3TED A;  2P5L C;  1X1A A;  2E7X A;  2V1X A;  2AXT C;  4BYY A;  1G8X A;  4A93 J;  1YS6 A;  2ZO4 A;  1U8B A;  4AC0 A;  3BJ6 A;  2EWN A;  4XIC A;  2R7R A;  2OU2 A;  2FU4 A;  3K70 C;  3AL0 B;  1G59 A;  2COM A;  4JOM A;  1N25 A;  1IN6 A;  4MFD A;  2MSY A;  2H94 A;  2M7B A;  3GLL A;  3RZO J;  2LG4 A;  1NTC A;  3COA C;  4BQQ A;  4BDZ A;  3H9Q A;  5J8F A;  4A3E J;  3T8R A;  1ON1 A;  4CGZ A;  3S93 A;  1O3S A;  3V4G A;  2W00 A;  1UST A;  4UV9 A;  3C18 A;  3IH4 A;  3IV5 A;  3H3U A;  3HSR A;  3WG7 H;  4RB3 C;  2R7S A;  2F48 A;  3K10 A;  1OCZ H;  4NUB A;  1FTZ A;  1B8I A;  3HC7 A;  2YR2 A;  5FFX A;  3E5U A;  2A6H F;  5J40 A;  2DMQ A;  4ZJZ A;  1XN7 A;  3RQ4 A;  1POG A;  3ULQ B;  3ZMV A;  5F0H A;  4P9U A;  2BVL A;  1SAN A;  4Z2Y A;  4OMZ A;  3VWB A;  1EJ9 A;  1I3Q J;  2VOO A;  2BHY A;  3GYH X;  1IUF A;  1JXS A;  2CV1 A;  3GTG J;  3CMA I;  2GM4 A;  1UG0 A;  4ZTJ A;  1YFH A;  3FXQ A;  4LIU A;  2DMN A;  5BPD A;  2JA5 J;  2JJ7 A;  3FXK A;  5F6F A;  1TQP A;  2ZCW A;  4HAM A;  4B44 A;  5FD6 A;  1BL0 A;  1X1P A;  4E7L A;  2ELH A;  5M3F J;  3SHF A;  3HOX J;  3I4P A;  3BWG A;  2L7M P;  2DT5 A;  2DDA A;  3KP7 A;  4WX9 A;  2BY3 A;  2R3S A;  2QEN A;  3G6E I;  1S9H A;  1L0O C;  2VXD A;  2BXY A;  2XV4 S;  4BJT A;  2IJL A;  2FUG 2;  4ESF A;  3S32 A;  3E6C C;  2IS4 A;  4KIG A;  2P4W A;  1YIO A;  1XG1 A;  3QPT A;  1JKO C;  9ANT A;  5EYR A;  4UVA A;  4CYC A;  3CES A;  4XSZ F;  1X1B A;  1A6I A;  1J9I A;  4HDU A;  2EV6 A;  3OS1 A;  2CW7 A;  4IX7 A;  3ASO H;  1K83 J;  4C2T A;  4HZF A;  5B3S H;  2KDO A;  2L3D A;  3TP3 A;  4BXU A;  5IYC J;  3PO3 J;  3S14 J;  3LSJ A;  2BY1 A;  1B4A A;  2N8G A;  4P55 A;  5E3N A;  2GWR A;  3S1Q J;  2E2H J;  4MEY F;  2Z33 A;  2GA2 A;  2K9S A;  2V1N A;  4UVC A;  2DK8 A;  2VBY A;  1XGS A;  3SZG A;  2LY2 A;  3HEF A;  3NWS A;  2GXA A;  1VI0 A;  3WGG A;  3CCR I;  2KQR A;  3GME A;  1ENH A;  2V79 A;  3S17 J;  2EQR A;  2KIF A;  5FGM A;  4CUG A;  4AIH A;  4BEH A;  1R4N B;  5BNG A;  1KU2 A;  1XGN A;  3O2P E;  2VE9 A;  2BW3 A;  3KPH A;  3J80 Z;  1ACI A;  1U5T A;  1YE9 A;  3U9G A;  1MMG A;  1SMT A;  1WWX A;  3OOP A;  1D8K A;  1SMY F;  5FLM J;  3JRI A;  4FT8 A;  4U87 A;  1IDY A;  4F55 A;  3K69 A;  2R7X A;  5E1X A;  4OAZ A;  4ENN A;  3GTQ J;  5ICF A;  5B5E C;  1W7P D;  1VQN I;  1MD0 A;  1MMS A;  2FQ3 A;  3RTR A;  3LMM A;  3WU1 B;  3D1N I;  2FMY A;  4RB0 A;  1R00 A;  4KNY A;  2KRH A;  3U1D A;  5TRD A;  2OPT A;  3RJP A;  1BJA A;  2K27 A;  1WI9 A;  2UUZ A;  2P8T A;  4ZYE A;  4L5E A;  5AON A;  1R49 A;  3HJE A;  3BR5 A;  1S3J A;  2ZFU A;  4U0V A;  3V8J A;  2IXS A;  2M8E A;  5HDN A;  2VJ5 A;  6PAX A;  5FRO A;  3KIO A;  5LHI A;  2L02 A;  1GV2 A;  4Q48 A;  1ZGA A;  5TIS C;  1IZ1 A;  2MFZ A;  3ESW B;  4BDY A;  5D8L B;  3JTG A;  1F36 A;  1SD4 A;  2RGV A;  3BG6 A;  1K61 A;  3EUK L;  3I58 A;  1W7P A;  1QO0 D;  3KYD B;  2PX9 A;  1MSF C;  3FXU A;  2WA0 A;  4XR6 A;  2OJE D;  1FMW A;  2Z3Y A;  3F0C A;  2OF7 A;  1TLH B;  2EZK A;  4ZH4 F;  2V9P A;  2WAQ A;  2KIU A;  4A3D J;  5IOY A;  3DXJ F;  1MKM A;  4LK1 F;  4BXX J;  2UV1 A;  4XN3 A;  1ZR4 A;  3S3O A;  1Z3X A;  1V55 H;  1IRG A;  3HKZ N;  1FBU A;  1SC7 A;  2Z2S B;  2V1D A;  4M9Z A;  4D9J A;  3FHN A;  2LF7 A;  3I3L A;  3JRC A;  4CCL A;  2EIN H;  4ZYH A;  4PJL A;  5GAH J;  1LKX A;  3BG5 A;  3FIS A;  1S72 I;  2E5Z A;  4ANJ A;  3SZT A;  3LAJ A;  5HOO A;  1E17 A;  1B9N A;  2IAI A;  5JFR A;  3ZQF A;  4NB5 A;  2DMT A;  5FRM A;  5H6Q A;  5KK1 A;  4Q5S F;  4X6A J;  3JW4 A;  4P9F A;  1JGG A;  5BMZ A;  4XRF A;  4B4C A;  2OZU A;  2CFO A;  4OIR F;  4XN0 A;  2MYS A;  4A3L J;  4LIT A;  2M45 A;  3HPG A;  3OYH A;  4HNU A;  5TGT A;  3JRD A;  2L4M A;  3ZMS A;  2M30 A;  2E1O A;  4KIC A;  3MVP A;  4AWX B;  2QSG X;  2E1M C;  1S7E A;  1A5J A;  1I6X A;  2KPM A;  5IY5 H;  5D5W B;  1W5T A;  1XCB A;  2PN6 A;  2BEO A;  3DWL E;  1I6H J;  1IC8 A;  2RRE A;  1RC9 A;  4HF2 A;  3OS2 A;  1FTT A;  4I99 C;  4XKB A;  4HPQ A;  3V7R A;  2CYY A;  1I39 A;  4DZJ A;  4FTH A;  1X1C A;  4E7K A;  3GTO J;  3GBG A;  1H9T A;  2IT0 A;  1P2F A;  2EH3 A;  4IO9 F;  3VOD A;  4MTD A;  1SEU A;  1MMA A;  3LSG A;  1TWH J;  4EV0 A;  1ZRE A;  3EPZ A;  3HHG A;  3E7L A;  4II3 A;  2RNG A;  3BCA A;  5D4R A;  5GTI C;  2HYJ A;  4M3F A;  2DYR H;  2WBM A;  4W97 A;  5IT9 K;  3E3V A;  1U3E M;  1ZRC A;  3TKY A;  4JX4 A;  2QA4 I;  2JZY A;  1MBH A;  4G7H F;  3OSF A;  3WU2 C;  4ZZL A;  2R7O A;  2NRA C;  5DUI A;  2KRC A;  2VC1 A;  4NQW A;  1JKP C;  1FLI A;  1Z7L A;  2DFH A;  2ZME B;  1MBE A;  1Z05 A;  2X85 A;  3PJR A;  2HOA A;  3M1C A;  4NC7 A;  2Y75 A;  4Y15 A;  5DCF A;  2XSD C;  2VAS A;  4FHT A;  2H6C A;  3DTI A;  1T0F A;  4U0W A;  2H27 A;  3QYE A;  4P1W A;  1ETV A;  1PUF A;  3L2W A;  1NK2 P;  4XLN F;  3OMY A;  4QSH A;  2FNA A;  1U5T C;  2ZSH B;  5HOD A;  1PP8 F;  1XTA A;  4KN7 X;  3HOS A;  4XSX F;  1UZC A;  5M5W J;  4BY1 J;  3TGN A;  1H8A C;  2QWW A;  3P9K A;  2HQR A;  2W4S A;  4A0Z A;  2LBF B;  5K5Q A;  1BBY A;  4BKX A;  4L9J A;  1OCR H;  2Y48 A;  4ZDO A;  2KP6 A;  1GXQ A;  2CQK A;  3CCV I;  3CCU I;  3DU6 A;  2IGN A;  1OYI A;  2KLO A;  4GXO A;  3HRM A;  4QPO A;  4BE1 A;  2CO5 A;  1MBF A;  2M0C A;  2IA0 A;  1E3P A;  4GO1 A;  4BGD A;  5LEJ A;  4XKW A;  1WFX A;  4DGW B;  4FQG A;  3DKY A;  5JHF A;  2M9H A;  2K9Q A;  3FK7 A;  3H92 A;  2W85 A;  3HZJ A;  3MKZ A;  3L7W A;  1S5L C;  2D2W A;  2OBP A;  1K6Y A;  3GO5 A;  1QQI A;  3J80 K;  2STW A;  3I4M J;  5DD4 A;  3ZPL A;  3WGI A;  2R5Z B;  2VE8 A;  4AD9 A;  3RKQ A;  3E97 A;  4ZYA A;  2V9K A;  2WTE A;  3S1N J;  4L9V A;  3E6D A;  3DF8 A;  2FJ1 A;  1F5T A;  3FXR A;  1B59 A;  2R7D A;  4S05 A;  2E19 A;  2MG4 A;  4MQV A;  1OKR A;  5E3L A;  1MJ9 A;  2XAH A;  1GVD A;  2I8D A;  5K7Z A;  2A6T A;  3Q3S A;  1IJW C;  4Z6Y A;  3J7A O;  1YRN A;  1UCR A;  5FKO A;  2VJ4 A;  1FYK A;  1ZG1 A;  3K1N A;  2XAG A;  3ZOB A;  4BS9 A;  1IN7 A;  5CVU A;  2BXZ A;  5EZG A;  3CDH A;  1G3Y A;  3HHH A;  1HDD C;  2K4J A;  3NRV A;  1HC8 A;  1KA8 A;  3BP8 A;  4RLF A;  1SAX A;  5E8G A;  4FET A;  2WY7 Q;  1V5E A;  1YLF A;  2L9V A;  2IVM A;  3BZC A;  1SAU A;  4XMY A;  5HS7 A;  1KZH A;  3MQ0 A;  4BJ5 C;  2E2I J;  3TW6 A;  2F4M B;  5ED4 A;  4PFP A;  2STT A;  3MKY B;  3TO7 A;  1GUU A;  3PNY A;  5FKN A;  2HDD A;  1U8R A;  3DBR B;  5EF6 A;  2KIM A;  3M8E A;  5EZH A;  5HNF A;  1LEA A;  2G7H A;  3UR3 C;  2XGC A;  4HG2 A;  1J7K A;  1WJ5 A;  2XGE A;  4HYE A;  4CO8 A;  3HSF A;  1J0R A;  3GCM A;  1UEL B;  2OTL I;  1D0X A;  2JWT A;  1S7O A;  3G1L A;  3S1M J;  3VYT B;  3E6B A;  3X2Q H;  3EQL F; 
#chains in the Genus database with same CATH homology
 1GV5 A;  4FE4 A;  1ETO A;  2ID6 A;  1RET A;  1OCT C;  2AHQ A;  2R7Z J;  2IEK A;  3Q0W A;  4XK4 A;  2R92 J;  4FIS A;  3Q0U A;  1E3O C;  3M4O J;  2Y9Y A;  5EGO B;  1IG7 A;  2L7F P;  2NS8 A;  2XB0 X;  2QF7 A;  1NK3 P;  2GLO A;  4A3B J;  4DYR A;  5IPA A;  4A3K J;  3HOW J;  2Y9Z A;  5FJ8 J;  1WGX A;  1FIA A;  5C4J J;  3BG9 A;  3OSG A;  4W1U A;  3GTJ J;  1AU7 A;  3BQY A;  3TED A;  2DN0 A;  1HCR A;  2LY9 A;  3IH2 A;  4QTR A;  2CQQ A;  4A93 J;  4JYK A;  2K40 A;  1U8B A;  1ETX A;  4AC0 A;  4XIC A;  5F0C A;  4I6Z A;  4MO7 A;  3GTK J;  2WV1 A;  1F43 A;  4MFD A;  2MSY A;  3RZO J;  5E3O A;  3OOU A;  1QVU A;  4XID A;  1JTX A;  1NTC A;  4UUS A;  1PUF B;  1AHD P;  3B6C A;  4A3E J;  1DU6 A;  3QPS A;  3G1M A;  3CQZ J;  3H0G J;  2KDZ A;  1JT0 A;  1WPK A;  3IH4 A;  3IV5 A;  4JX5 A;  4M3D A;  4AUX A;  3JR9 A;  2E2J J;  1FTZ A;  1B8I A;  1TWG J;  2ME0 A;  1W0T A;  2DMQ A;  1H89 C;  2PMZ N;  2HQ5 A;  1POG A;  1MH4 A;  3NAU A;  5F0H A;  2H1K A;  1SAN A;  1I3Q J;  2D5V A;  2O7O A;  1IUF A;  4IHX A;  1ZKG A;  2LVS A;  2R5Y B;  3OIO A;  5FKK A;  2M2E A;  3GTG J;  4M3E A;  2GM4 A;  2DTZ A;  2NVY J;  2XGD A;  5E3M A;  4AYB N;  2EZH A;  3WHC A;  2NVQ J;  2DMN A;  2ZB9 A;  2JA5 J;  2JJ7 A;  1ETQ A;  3PO2 J;  1OJL A;  2XB5 A;  1BL0 A;  4MLO A;  3JRF A;  2TRT A;  5M3F J;  3HOX J;  3BG3 A;  2L7M P;  3I4N J;  5FKL A;  2ELK A;  1MSE C;  2VKE A;  1W0U A;  2EBI A;  1VND A;  4RDU A;  1MNM C;  4A3J J;  2ME6 A;  3BR1 A;  4X1E A;  3ZQL A;  4BY7 J;  1JKO C;  1XG1 A;  3G1O A;  9ANT A;  5EYR A;  2CRG A;  4CYC A;  1A6I A;  4D7N A;  2O8K A;  1RKT A;  1LE8 B;  1YRN B;  3S16 J;  2CQX A;  2DMP A;  1K83 J;  1Y1V J;  4HNV A;  3TP3 A;  5IYC J;  2YU9 J;  4DYQ A;  3PO3 J;  2YS9 A;  3S14 J;  3LSJ A;  2N8G A;  5E3N A;  1JKQ C;  5J1R A;  3VPR A;  3S1Q J;  2DA2 A;  2E2H J;  3MKL A;  2DMU A;  1JUP A;  2K9S A;  5F0F A;  2JA8 J;  3TW7 A;  3HEF A;  3BT9 A;  5F04 A;  2NOG A;  1BW5 A;  4M3B A;  1VI0 A;  5F1J A;  4BBR J;  1FEX A;  1ENH A;  3CCY A;  2JN6 A;  2HOT A;  3BR3 A;  4I76 A;  3S17 J;  2EQR A;  4IEJ A;  1G2H A;  1SFO J;  4D5F A;  1ITY A;  5BNG A;  4QIW N;  2LTP A;  2YUS A;  3B6A A;  1QRY A;  4XRM A;  5FLM J;  1BA5 A;  2KT0 A;  3JRI A;  1QVT A;  1IDY A;  2Y30 A;  2EZI A;  5EEA A;  3JRB A;  3QPL A;  2VPR A;  5JLX A;  3GTQ J;  1BW6 A;  1MBK A;  2W48 A;  1U9O A;  5C4X J;  2CUE A;  4Y52 J;  4RBO A;  5FKM A;  5IP6 A;  3D1N I;  3CMY A;  3SJM A;  5F27 A;  3S1R J;  2VI6 A;  2L0K A;  2OPT A;  3GTL J;  4L5E A;  4NDL A;  5J3L A;  5GPA A;  4C3J J;  1Y1W J;  5F08 A;  5GPC A;  3BR5 A;  1ZGW A;  1GDT A;  2HOS A;  2NS7 A;  5M5Y J;  3A02 A;  1GV2 A;  3BR0 A;  4M6V A;  2R5Z A;  4LOC A;  2B63 J;  1F36 A;  1VFC A;  1K61 A;  4IHW A;  1ETW A;  2M8G X;  3HGY A;  2R93 J;  2DA4 A;  1JJ8 C;  4UUS B;  1MSF C;  2DA6 A;  4IHY A;  3PM1 A;  3F0C A;  2OF7 A;  2AO9 A;  1FJL A;  3RQI A;  2EZK A;  4S0H B;  1MBG A;  4A3D J;  1WI3 A;  3HOV J;  5IOY A;  1TWC J;  4BXX J;  1ZR4 A;  2L9R A;  3HKZ N;  1AKH A;  5J1Y A;  5J1U A;  2QCO A;  3BR6 A;  1B8I B;  2K9N A;  3FKI J;  1RPW A;  4M3G A;  3JRC A;  2O9L A;  1RES A;  3JRE A;  2EZL A;  3BR2 A;  3BG5 A;  3FIS A;  2DA5 A;  2XPW A;  5EG0 A;  2IAI A;  2JA7 J;  4MFE A;  5FLV A;  4A3G J;  3HM5 A;  2CUF A;  2DJN A;  2DMT A;  3SDG A;  3ZQF A;  3JRA A;  1TC3 C;  3A01 A;  3MN2 A;  2JMW A;  4X6A J;  1JGG A;  2XRL A;  1H88 C;  2HI3 A;  4B4C A;  2DA3 A;  1I50 J;  1MH3 A;  2FQ4 A;  2X9D A;  2Y2Z A;  4A3L J;  1QPI A;  5IYB J;  2LK2 A;  1BJZ A;  3L1P A;  5JLW A;  3BTI A;  5C44 J;  3JRD A;  1JJ6 C;  4A3F J;  5GP9 A;  4FE7 A;  2E1O A;  3MVP A;  3Q0V A;  3QQA A;  1S7E A;  1O4X A;  1A5J A;  3DCF A;  3IH3 A;  1TWA J;  4D5C A;  3S15 J;  1I6H J;  1IC8 A;  4J19 A;  3GTP J;  3H3V K;  3O8G A;  4V2F A;  3ZQC A;  1FTT A;  5DS9 A;  1XS9 A;  1B72 A;  2LKX A;  2LD5 A;  4DZJ A;  4FTH A;  3UKG A;  5IP7 J;  3GTO J;  3GBG A;  1LFB A;  2LR8 A;  2EH3 A;  5M5X J;  3NAR A;  1CQT A;  4CYC B;  3LSG A;  1TWH J;  1T56 A;  5EGO A;  3K7A J;  3E7L A;  1UHS A;  2MW8 A;  4GFB A;  2HYJ A;  4M3F A;  2TCT A;  4W97 A;  1T33 A;  1ETK A;  4Y7N J;  2DA7 A;  4V2G A;  1LFU P;  1MBJ A;  2VUM J;  2WAQ N;  3W6V A;  3BTJ A;  4JX4 A;  1MBH A;  3OSF A;  3A03 A;  3BTC A;  1ETY A;  3LOC A;  1D5Y A;  4A3C J;  2NVT J;  3JRH A;  2VKV A;  2G0E A;  4XRS A;  1JKP C;  4B3A A;  1ORK A;  1RKW A;  1MBE A;  3HB9 A;  1Z0X A;  2HOA A;  4ABZ A;  1R9T J;  3DEW A;  2LP0 A;  2XSD C;  2R0Q C;  5K7F A;  1ETV A;  1PUF A;  2LLK A;  2ID3 A;  5DTD A;  1NK2 P;  4QSH A;  5HOD A;  1X2M A;  3S2H J;  3JRG A;  3HBL A;  5M5W J;  2RAE A;  4BY1 J;  1H8A C;  1Q1V A;  4A3M J;  3HOZ J;  2DA1 A;  1IDZ A;  2M34 A;  1U78 A;  3BQZ A;  1JUM A;  4FCY A;  1RR7 A;  1U9N A;  2X6O A;  3O8H A;  1OCP A;  1ZR2 A;  4BKX A;  4DYC A;  1APL C;  3ZQI A;  4C3I J;  1MBF A;  2M0C A;  2R5Y A;  2JA6 J;  1EF4 A;  1HOM A;  1XC5 A;  5IP9 J;  4A3I J;  1FIP A;  1X58 A;  3K2A A;  1P7I A;  2M9H A;  2I10 A;  2K9Q A;  3FK7 A;  2CU7 A;  1HDP A;  3FIW A;  2LFB A;  2FD5 A;  4MIM A;  3I4M J;  1IV6 A;  2MGQ A;  1JT6 A;  4IHV A;  2R5Z B;  3RKQ A;  1HF0 A;  2X48 A;  2CJJ A;  4C3H J;  3S1N J;  1GT0 C;  4UUT A;  1JUS A;  1X2N A;  2FJ1 A;  5M3M J;  1JTY A;  2E19 A;  1WH5 A;  2MG4 A;  1UG2 A;  5E3L A;  2XPU A;  5IOZ A;  4JX6 A;  1ZK8 A;  1GVD A;  3FK6 A;  2JK3 A;  5K7Z A;  3Q3S A;  3GTM J;  4DW6 A;  1IJW C;  2H8R A;  1LE8 A;  1YRN A;  5FKO A;  4G12 A;  3HOY J;  3ZQG A;  1OFC X;  1AKH B;  3ZOB A;  2IBD A;  1UMQ A;  1Z77 A;  1WCM J;  2WB1 N;  5EZG A;  1HDD C;  1IRZ A;  2GBY A;  4JP0 A;  3HOU J;  5K7H A;  5EG0 B;  4BBS J;  5C3E J;  2E2I J;  4XRS G;  3BTL A;  3ZQH A;  3A01 B;  3CDL A;  2XPV A;  3TW6 A;  3S2D J;  2HXI A;  1WH7 A;  1DU0 A;  3LSR A;  1TWF J;  1GUU A;  5FKN A;  5EDN A;  2Y31 A;  2HDD A;  1P7J A;  4D7M A;  2L7Z A;  3WHB A;  5EF6 A;  2FX0 A;  2P81 A;  3LSP A;  1HLV A;  3M3Y J;  5IYD J;  4EEF G;  3SFI A;  5EZH A;  3C2B A;  4C2M J;  3HDD A;  4DZP A;  2NVX J;  1JKR C;  1ZTR A;  2Y0S N;  2HXO A;  2ECB A;  2XGC A;  2XGE A;  3HGG A;  2COB A;  3TP0 A;  1VF9 A;  2ECC A;  2JWT A;  4A69 C;  3RZD J;  3G1L A;  3LNQ A;  3S1M J;  1B72 B;  1IGN A;  1ZQ3 P;  4B1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...