1B8IA

Structure of the homeotic ubx/exd/dna ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
62
Chain Sequence
FYPWMARQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRRMKLKKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*GP*TP*CP*GP*CP*CP*AP*TP*AP*AP*AP*TP*CP*AP*C)-3')
publication title Structure of a DNA-bound Ultrabithorax-Extradenticle homeodomain complex.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 21
structure length 62
sequence length 73
ec nomenclature
pdb deposition date 1999-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1b8iA00
5EGOA 2DJNA 5JLWA 3BT9A 3BG3A 3GBGA 4Y7NJ 2JN6A 2JMWA 2E2JJ 4V2GA 2EBIA 4XRSA 2LR8A 2HXIA 3BR3A 3OSGA 2W48A 3PO3J 1JTXA 1X58A 3OSFA 2YUSA 2NS7A 4C3JJ 3S2DJ 5J1YA 2HOTA 3BTLA 3HEFA 1VNDA 3LSGA 2D5VA 2E2IJ 4A3BJ 2LY9A 1H88C 2DA1A 4BBRJ 4DZJA 2NVXJ 2DA3A 3TP3A 1VI0A 4RBOA 1QRYA 3HBLA 1MBJA 5GPAA 4W97A 2HOSA 4NDLA 3S1NJ 3GTMJ 5M3FJ 2ME6A 1UMQA 2DMTA 1IJWC 1T56A 2CU7A 2Y2ZA 2Y9YA 2LD5A 5F27A 2WV1A 2EZLA 2R5ZA 1F36A 2MW8A 3S1RJ 3FISA 1GUUA 4DYQA 2HYJA 2ECBA 1H8AC 3HOZJ 3A03A 1JT0A 1JJ6C 1B72B 4M3DA 2NOGA 2DA4A 2FX0A 1ETOA 2DMNA 3HKZN 5J3LA 1AHDP 3BR2A 3NAUA 1LFBA 3ZQCA 2M9HA 2X48A 1JUSA 5GPCA 1XG1A 3GTLJ 4GFBA 4JP0A 2ID6A 2CUFA 1AKHB 4D7MA 5DS9A 2R7ZJ 4M3EA 3CMYA 2AO9A 2XPUA 4D7NA 2AHQA 3ZOBA 3Q0UA 1BW5A 4C3IJ 3Q0VA 5FKKA 2VPRA 3JRFA 3M4OJ 1ZR4A 1ZTRA 1JKQC 3IV5A 2L7FP 1RKWA 3O8HA 3S15J 1JT6A 4A3MJ 1TWAJ 1P7IA 1MSEC 2DA2A 4UUTA 2L0KA 5GP9A 1YRNB 3BQZA 2K40A 4DYCA 1GV2A 3HGYA 4S0HB 2K9QA 1NK2P 2OF7A 2TCTA 2TRTA 1WPKA 4FTHA 4LOCA 1JKRC 3IH4A 4XK4A 4BY1J 3PM1A 2JA5J 2G0EA 2ZB9A 1QPIA 2NVYJ 5E3LA 1HCRA 2JA7J 2VKEA 3CQZJ 1FEXA 1APLC 3IH3A 2GBYA 4G12A 4UUSB 1GVDA 3S1MJ 2IBDA 1TWFJ 4J19A 2QF7A 1TWGJ 1ETYA 1XS9A 1MBKA 4IHVA 3C2BA 4FE7A 3GTQJ 1T33A 1F43A 1BJZA 1E3OC 4QSHA 5M3MJ 2LKXA 1RETA 1OCPA 3IH2A 3G1MA 1ORKA 1BL0A 3WHBA 4C2MJ 4IEJA 2XB5A 4CYCB 1RPWA 4BXXJ 1ZKGA 2JK3A 2CJJA 1TC3C 1IG7A 4QTRA 5F04A 1VF9A 1B8IB 1AU7A 3VPRA 2M0CA 3TW7A 4D5CA 2XRLA 3QQAA 1JUMA 3JRIA 1IRZA 2L7MP 3HGGA 4XRMA 3M3YJ 1BA5A 1I50J 1P7JA 3A01A 5EG0A 3LSJA 4B4CA 2GLOA 2Y0SN 1D5YA 1WH5A 5E3MA 2DA5A 2R0QC 2K9NA 4DZPA 2FD5A 4RDUA 1LE8A 3TP0A 2OPTA 1U8BA 1TWCJ 2DTZA 5EF6A 1EF4A 3MKLA 1U78A 5JLXA 3A02A 5EZGA 3JR9A 3DEWA 1ETKA 3BR5A 2COBA 4M6VA 3HM5A 4JX4A 2DMUA 1FJLA 3ZQHA 5F0CA 5IP7J 2HI3A 4IHWA 4X1EA 2CUEA 2IAIA 2HXOA 3BR0A 3FKIJ 1Y1VJ 1K83J 5IP9J 3DCFA 2VKVA 1MNMC 1PUFA 2MSYA 2R5YB 3JRBA 2DMPA 4A3JJ 2I10A 3HOWJ 3H3VK 2ELKA 3ZQIA 2M2EA 3Q3SA 5DTDA 4B3AA 2DN0A 1MBEA 5K7HA 3ZQGA 1VFCA 2NVQJ 5C4XJ 3BG9A 3OOUA 1IGNA 4IHXA 3GTPJ 1SFOJ 2XPVA 3ZQLA 3Q0WA 2DA7A 1ENHA 3LNQA 1IDZA 2EH3A 5IPAA 4MFDA 3S1QJ 2DMQA 1IUFA 4A3DJ 1SANA 2K9SA 5C4JJ 1ETQA 4MO7A 5J1RA 1JUPA 2JA8J 2XGCA 3S14J 3FK7A 2ECCA 4AC0A 3BG5A 3QPSA 4XRSG 2M8GX 3B6CA 5F1JA 3S2HJ 3S16J 1MH3A 2L7ZA 5FJ8J 3O8GA 4XIDA 4M3GA 5M5XJ 1WGXA 2HQ5A 1I6HJ 3FIWA 1QVTA 3I4MJ 3MN2A 5EEAA 2CQQA 4I76A 4L5EA 1ZQ3P 5IOYA 2O7OA 2IEKA 1MSFC 3HDDA 1OJLA 3CCYA 1Q1VA 4A3KJ 2B63J 1CQTA 2VUMJ 1LFUP 2X6OA 5FLMJ 4FISA 3BQYA 3I4NJ 5K7FA 2XSDC 4A3GJ 1FIAA 4M3BA 3B6AA 3CDLA 1I3QJ 2LTPA 1W0TA 2HDDA 1RKTA 3FK6A 5EGOB 3BR6A 2E19A 2XPWA 5F08A 1WI3A 1JGGA 4FCYA 2EZIA 3GTGJ 3BTJA 5BNGA 3A01B 5EG0B 2L9RA 5F0FA 3LOCA 4XICA 1FIPA 1HOMA 1ETXA 4JYKA 4JX5A 1LE8B 2N8GA 3W6VA 1HF0A 1HDPA 4A3CJ 5FKOA 1WCMJ 2JJ7A 1JJ8C 3HOUJ 1B8IA 4EEFG 2NVTJ 1MBGA 1MH4A 3H0GJ 3G1LA 4ABZA 2Y30A 5K7ZA 1GT0C 2JA6J 4V2FA 1OCTC 1WH7A 2LLKA 2XB0X 3GTKJ 5EDNA 3HOXJ 1K61A 1MBHA 4A3EJ 2GM4A 3NARA 4BKXA 3RKQA 2KT0A 3QPLA 4AYBN 4MFEA 2R5ZB 2MG4A 3RZOJ 4A3FJ 3TW6A 1POGA 1IC8A 3HB9A 1BW6A 1PUFB 5F0HA 3RZDJ 1RR7A 3K7AJ 2ID3A 1U9NA 4B1RA 1Z0XA 1NTCA 3GTJJ 2NS8A 1JKPC 3JRHA 1JKOC 1FTTA 2YU9J 1IV6A 5J1UA 3L1PA 1H89C 3K2AA 3SJMA 3HOYJ 1ZR2A 3ZQFA 4HNVA 5E3NA 4BBSJ 3F0CA 1HLVA 5C3EJ 5FKNA 2R92J 4A3LJ 2CQXA 4DW6A 1MBFA 2M34A 2RAEA 4DYRA 1ZGWA 3JRCA 4JX6A 2O9LA 2R5YA 1B72A 1GDTA 1ZK8A 2EZHA 3PO2J 3UKGA 1ETVA 1JTYA 1FTZA 4MLOA 5IOZA 2DA6A 3E7LA 2E1OA 2XGDA 2WAQN 5M5YJ 1TWHJ 3LSPA 1NK3P 5IYBJ 1AKHA 1X2NA 4M3FA 3HOVJ 1Z77A 3SFIA 2H1KA 5IYCJ 2VI6A 3D1NI 9ANTA 4MIMA 2P81A 3BR1A 1O4XA 2YS9A 4QIWN 5C44J 3S17J 5EZHA 4IHYA 1XC5A 3TEDA 4A93J 2X9DA 2QCOA 3G1OA 3OIOA 1YRNA 4D5FA 3JRDA 2R93J 3BTIA 2LFBA 4X6AJ 1UHSA 1G2HA 2WB1N 4C3HJ 3JREA 3JRGA 2LVSA 2EQRA 1RESA 1X2MA 2MGQA 3LSRA 2LP0A 5IYDJ 4W1UA 5FKMA 2ME0A 4I6ZA 1UG2A 2CRGA 1R9TJ 1DU6A 2Y31A 2LK2A 3JRAA 1QVUA 1W0UA 2Y9ZA 1OFCX 1IDYA 2XGEA 2H8RA 3SDGA 5EYRA 2FQ4A 3WHCA 5FKLA 5IP6A 4UUSA 4A3IJ 2KDZA 1Y1WJ 3RQIA 1S7EA 5M5WJ 4FE4A 2E2HJ 1HDDC 2O8KA 4A69C 1A6IA 2EZKA 2HOAA 4Y52J 2JWTA 5HODA 1U9OA 1GV5A 4BY7J 4AUXA 1A5JA 1DU0A 3BTCA 2FJ1A 1ETWA 2PMZN 4CYCA 5FLVA 3GTOJ 5E3OA 1ITYA 3MVPA
chains in the Genus database with same CATH superfamily
1JHHA 5E79C 2DDAA 2DJNA 3N97A 2CQNA 3MCZA 3BT9A 1V55H 3CP2A 3LQQA 5BS6A 3PFYA 3R0AA 3CMAI 2JN6A 3OS0A 2JMWA 2E2JJ 2MYSA 2VXDA 4OOIA 2X6YA 1BR4A 4XN0A 5J8CA 4XRSA 3EETA 3V8JA 3D5SC 3I0TA 2HXIA 5DV5A 5LBQA 4ESFA 4BNCA 1P6RA 1YIOA 4CZCA 3I53A 3OSFA 2YUSA 3NEUA 3AL0C 1SD4A 2NVUB 2E34A 1V5FA 1VNDA 3LSGA 2IGNA 2V6EA 1I3AA 3G3ZA 4P55A 2OD5A 2E2IJ 3WE3A 2BBYA 4XKBA 1B1BA 4BBRJ 2VQCA 1VI0A 3QU3A 4P9FA 5GPAA 3GZ6A 3S1NJ 2EB7A 3ESWB 4P9UA 2IA0A 3FWEA 2ME6A 3BWGA 2CU7A 2XGXA 3TGNA 1R36A 1WWXA 2EZLA 1TW3A 1Z6RA 5GADJ 3LSHA 2R5ZA 1VQOI 2ZXJA 3H92A 3WTZA 2EFNA 2KMUA 3CLQA 4AYBA 3GCMA 4F52A 5FD5A 4U0VA 2X1DA 3R0JA 1B72B 3C18A 3ZQQA 2PJRA 3I54A 2MH9A 2Y0MA 2VN2A 1LFBA 3BPXA 3BR2A 3RTRA 3PQKA 4G6TB 2HPIA 2M9HA 2X48A 3LSKA 5GPCA 3IP4B 2KIFA 3T0YA 4L5JA 3OYNA 2LC2A 3AG3H 4M3EA 3CMYA 4D7NA 2AHQA 3SEZA 3ZOBA 3Q0VA 2VONA 2QWWA 4M72A 1KU2A 4ZYAA 1UHWA 1ZR4A 4I02A 4CZZA 2Y75A 3FHNA 2OTLI 2EK5A 3L00A 3DFGA 1BN5A 3GMEA 1MMNA 1XTAA 1WHUA 2F2EA 4ANJA 1A31A 1VQNI 2IRFG 2KRCA 4A0YA 3B73A 1ZRCA 2QQ9A 3M07A 1MJBA 2KRHA 1YRNB 3SEQA 2K5CA 4RGRA 4S0HB 2OF7A 3U9GA 4PJMA 4CCKA 2H6CA 3QP6A 1K78A 1DQUA 2FE3A 3TOAA 3SZTA 1F5TA 2JA5J 2CQKA 1HCRA 2EV0A 4DGWB 2QBYA 4HNUA 2EFOA 2LOOA 4H4KC 4EMSA 5ILUA 2IS1A 2HTJA 3T1BA 1DPUA 3IH3A 5HLHA 4G12A 4UUSB 1FSHA 1E17A 1CF7B 3RYPA 1KU7A 3J80K 4IHVA 4A6EA 3DBRB 4MTEA 1OKRA 4FE7A 3EYYA 4IJAA 3GTQJ 1T33A 4V19K 4KA4A 1BJZA 2CO5A 3KYCB 1XSXA 5M3MJ 1V5GA 4N9HA 3V4GA 1JXSA 3HRMA 2WB1A 4OIPF 3HZJA 4U7BA 1SVMA 2YSRA 3IAM2 3QOPA 4S05A 1E0EA 2VT3A 1TL8A 5DM6F 4A0XA 2VC0A 2IW5A 1PP7U 1TC3C 3OMYA 2M0CA 1O57A 2HEOA 1FYMA 2P5KA 3OYGA 2CW7A 2L7MP 2ELHA 4WXCA 1B6AA 3HIFA 2K4BA 4XRMA 4U0YA 1I50J 1P7JA 3A01A 5EG0A 3M3YJ 2AXTC 2Y0SN 3L2VA 1Y8RB 3OYHA 1WH5A 2KLOA 2FD5A 3DWLE 3DPLC 4EJUA 3TP0A 4RDUA 1U8BA 2L9VA 1MMGA 2DTZA 4FT8A 3G6EI 3SXYA 2OCCH 3E5XA 4HAMA 5E20A 5JLXA 3A02A 3QOEA 1ETKA 5B5EC 4HX4A 2FU4A 2GA2A 4BHCA 3OYLA 1VQPI 1LEBA 2KPMA 5FRNA 4ENJA 2L5QA 3S3NA 1FJLA 3GYHX 3V7SA 4KITB 3C1DA 1DDNA 2BEOA 5HNFA 4IX7A 2PEXA 5B1BH 3M9AA 2E5ZA 4IHWA 2FNAA 3HHGA 4X1EA 2EA4A 3MQ0A 2HVQA 4IZZA 2BVLA 1Y1VJ 1K83J 2V26A 1YG2A 1ZG3A 4AVPA 2GWRA 2E60A 1MNMC 1SD7A 4OAYA 2MSYA 5FFZA 2VBZA 3CO6C 3JRBA 4P5OA 2DMPA 4LLLA 3A2KA 2I10A 1OPCA 2ZNYA 1YI2I 4OMYA 3KX2A 3P5JA 4L5IA 1MBEA 5LGNA 3PIPF 2K85A 2RC4A 1W5SA 3BG9A 2JSPA 2IGOA 2XPVA 4Z6YA 2P7VB 4AIHA 4LG3A 1SMTA 1J09A 2VQHA 2CV0A 1IDZA 1TBXA 1J2XA 2EH3A 4AVZA 1IUFA 4PJ0C 1JE8A 2X85A 2Z2SB 2ZFWA 1IN5A 5L3FA 2K3PA 3OWTA 2L2OA 4U7DA 1UAAA 4II2A 1BI1A 2LF7A 5KVRA 3KE2A 2JUCA 4CUGA 1P92A 3FM3A 1FP1D 5FJ8J 5GTIC 1W5TA 3H35A 3PUFA 1IRFA 1DGWY 2HGCA 3FIWA 1KU9A 2CQQA 3CC7I 2DU9A 4MEYF 4L5EA 4UY8I 1ZQ3P 5IOYA 2CGPA 4MTDA 1XGSA 2DT5A 4RGSA 3FBIB 3HDDA 3OYFA 1FPQA 4BQOA 2QGUA 3ZN1A 3VWBA 4G6DA 4Y13A 3E5QA 3I4NJ 5K7FA 1X4OA 2XSDC 2K3FA 2Y69H 3KYDB 2I5UA 1K6YA 1I3QJ 3OYIA 2LTPA 3BOQA 2L01A 1W0TA 3FF5A 3FBNB 1Z3YA 3LAJA 1X1BA 3HTUA 1R71A 3K4NA 4M9XA 4RLQA 3BR6A 1WJDA 2IA2A 4KUMA 1HQCA 5TISC 1IN4A 1EH8A 1WI3A 4U88A 3K10A 2XAUA 2EZIA 3KZYA 5JR3A 2JQ7A 4C2UA 2L9RA 4IQ4A 5F0FA 3M7GA 4WXHA 4MEXF 2M5WA 1GXQA 2W25A 1R5GA 3D0SA 4XM3A 1OMIA 1XDSA 2ZMEC 2IS4A 2KHMA 2A68F 5FKOA 3L2UA 3J7AO 3E6BA 4XOPA 3FHZA 2KIQA 1FOYA 3M8FA 5TJJA 2EILH 2ACJA 3G1LA 3TO6A 1GT0C 3ABLH 2LY1A 4HA8A 4V2FA 5BQTA 3E97A 5E1ZB 2XB0X 3GTKJ 1MNEA 3I59A 2LF8A 3ZPLA 4BKXA 2PX9A 2XKOA 3G4SI 1MD0A 3GXOA 3K4CA 4AD9A 3DPUA 3F23A 4LG0B 4EQQA 1Y8QB 1F9NA 2EFPA 2ZC2A 4EJVA 1O7FA 1AWCA 1DPRA 4RLFA 4G7ZF 5CPRB 4AIJA 5D5XB 1TNTA 3WTYC 1BW6A 4ZH4F 5F6FA 3RZDJ 4HDUA 3J81K 3ZGKA 3K7AJ 1I6XA 1IV8A 2HKOA 5KK1A 2R7VA 1Z0XA 3CJNA 3VFZA 1SFKA 1FT9A 5K1YA 2M7BA 3KZZA 3JRHA 2V1UA 1KQ8A 3F3XA 2W82A 3F72A 1D0YA 3CTAA 4KJZA 3K2AA 2RREA 5ERIA 1ZR2A 3ZQFA 1HC8A 1V3FA 2RNJA 4BBSJ 5C3EJ 3CMMA 3REOA 4A3LJ 4EJWA 2M34A 2RAEA 2NYXA 2EPFA 4OIRF 3V8LA 4JX6A 2O9LA 2FNPA 2NOJB 3GFJA 1GDTA 3PO2J 2YX4A 3DBHB 3L7WA 5BOXA 2KIUA 4BHBA 1ETVA 1XGMA 1FTZA 4MLOA 2DA6A 4ETSA 2XGDA 1NK3P 5IYBJ 1VQ6I 4YFNF 3LQRA 2QQBA 1D1BA 3VDXA 2LNBA 1X2NA 2ZMEA 3K2ZA 3MZHA 3IRRA 4I01A 3H9QA 3H9JA 1YFHA 2DLLA 5IYCJ 2VI6A 3D1NI 4M6YA 2FA5A 1TNSA 5L3DA 2FXAA 4OU0A 2P81A 3CCVI 3TL4X 1V4RA 1LEAA 2K9MA 3FX3A 3I64A 3IRQA 2A6HF 3OYKA 3TEDA 1MMDA 2B0LA 4A93J 1PP8F 2Z9OA 4GRIA 3LAPA 2R93J 2PLYA 2RGVA 2GAUA 1UHSA 3NWTA 2E1CA 5H20A 1TLHB 1SFUA 2LVSA 1R4NB 3LSRA 3CP8A 2VBWA 3U21A 3H36A 2VKDA 2ME0A 2P0WA 1R9TJ 3OS1A 3JRAA 1GHCA 1OFCX 1IDYA 1PYVA 1Z91A 2XGEA 3DLAA 4UB8C 3KYLA 3K4JA 5J4YA 5IP6A 4A3IJ 2KDZA 1XGOA 3MKYB 4QPQA 1BIAA 3A0HC 1ZRFA 2CW8A 3OV8A 2JWTA 1R1UA 2JT1A 3ZQ7A 1U9OA 2BOLA 2RN7A 1GV5A 2IGKA 4S04A 5CVJA 1A5JA 2KZVA 1DU0A 1UELB 3BTCA 2FJ1A 2A6TA 4CYCA 5FLVA 3G73A 5E3OA 1ITYA 3MVPA 5JLWA 4UVCA 3P9CA 3ULQB 2HQNA 1A6QA 2R7XA 3GZNB 5HS7A 2VB6A 1QHHD 2AQFA 4M71A 3KP6A 1HSTA 3OSGA 5D5VB 2V4JC 2W48A 3P9IA 1IN6A 3CCSI 1FSEA 4M73A 3FXMA 4F93B 2NS7A 3E0JB 3RKYA 1V54H 3K4KA 1BJAA 4BE2A 2BY2A 3GFLA 1LNWA 3LSTA 3OYAA 2A5YB 4NQWA 5DCMA 3E6MA 4A3BJ 3FKJA 4PFPA 1H88C 4DZJA 4PJJA 4DOZA 1K4SA 2DA3A 4HV6A 4EJTA 4E6KG 3HXLA 2HU9A 5A2QZ 5M3FJ 1IJWC 1WVRA 1T56A 2LD5A 2DT6A 2Y9YA 2NS0A 5E1WA 2VBXA 2WV1A 5F27A 3EDPA 2R7DA 4O5VA 1K4TA 4IOCF 2XC7A 2L54A 1ZGAA 3GWZA 5HDNA 1LJ9A 2HYJA 2V79A 1YJNI 3O2PE 1S72I 1HBXG 1KYZA 5KAFC 2XIGA 1YS6A 1KQ0A 3ABKH 3K4LA 1X1PA 2NOGA 2L9SA 1AHDP 3HKZN 3ZQCA 2K86A 4I98B 3TMOA 4L9VA 1G3TA 3KP4A 3JSOA 1W36C 3KIOA 3I4PA 2ID6A 3S93A 2XDVA 1AKHB 4MQ9F 4D7MA 2QQAA 4DBQA 2XPUA 5D6FA 3ZCOA 2CFXA 4WK8F 1U6GA 4OWRB 1FBQA 1FY7A 4I09A 5FKKA 3JRFA 2KZGA 1W4MA 3DU6A 1LB2A 1LDDA 1XCVA 1ZTRA 2HYGD 3ASOH 3SHFA 3L2WA 3T8TA 2L7FP 2YU3A 1RKWA 3S15J 3DPTA 5ICEA 3MKWB 1R23A 1MSEC 5K5OA 4UUTA 4XORA 2WY7Q 2L0KA 2ZFUA 5GP9A 3BQZA 1W7PA 4DYCA 2VLAA 4Z2YA 2LG4A 1R6RA 2KL4A 4LGWA 3J7AY 3K1NA 1STZA 3VOEA 2DTRA 4EM0B 3RYRA 1WPKA 4FTHA 2H6BA 2BW3A 2DCEA 3MZYA 1MGTA 2UXXA 2TDXA 3HUGB 4BY1J 2WAQA 5JHFA 4MNUA 1YLFA 3Q9VA 5E3LA 2AS5F 3ZMDA 1P4AA 3BG6A 4HNTA 2ZXIA 2ZNZA 5L3GA 1ZYRF 3U1DA 2ELJA 2HKXA 4LIUA 4O6JA 4J19A 1D0ZA 4PFOA 1ETYA 1XS9A 2STWA 4NHJA 2QVOA 3QYBA 1TZLA 4XLHA 2NNNA 3FXLA 3JSPA 4LLGF 4U0WA 3LL7A 2EIJH 2FMYA 5AIQA 4A5MA 3GX4X 1SD6A 3WHBA 3PIOF 4II3A 1P4XA 4G94A 2P7CB 1ZKGA 1IG7A 4QTRA 3CCMI 4NC8A 1B8IB 1AU7A 4NC7A 1LQ1A 4HEA2 5GTHC 5KHDA 1E2XA 2XRLA 3QQAA 1JUMA 3H1CA 5J47A 5LHHA 2A3SA 3IHUA 4ESJA 3RI4A 3GW2A 2Y48A 3DV8A 3HGGA 5BPDA 1T08B 2FRHA 2A61A 2ESNA 3KLNA 4WF2A 4B4CA 3KFWX 2JA2A 3V7RA 2GLOA 4P96A 2W7NA 3ASNH 2JRMA 1XMAA 4HQMA 5E3MA 2DA5A 2R0QC 1RR8C 2GIZA 2QSGX 3AG4H 4HDVA 2OPTA 3FXKA 4C30A 3EUAA 1H9TA 1TWCJ 4QWQA 5GAGJ 5B66C 3OS2A 2M30A 3MKLA 2D2WA 2GXGA 1P4WA 4LIVA 3JR9A 2PMZA 1PUEE 2ZJ2A 2R7QA 4M6VA 4ZYEA 2LH9A 4JX4A 3OYBA 2XSJC 4BQQA 5F0CA 1N78A 4EM2A 4EGYA 3KEYA 5IP7J 2CUZA 5IT9K 2XAQA 3IC7A 2GOXB 2R7WA 1KA8A 4BAYA 2VKVA 5LLQA 1PUFA 3L09A 4BQNA 1R1VA 5F64A 4A3JJ 4EM1A 3PUBA 4PJNA 2ELKA 2VQLA 1WQ2A 3ZQIA 2VOPA 1BOBA 3CMEI 4KDPA 5DTDA 3MMYB 3M8EA 4B3AA 2XROA 1FZPB 3AKZA 5K7HA 2NVQJ 3ELKA 1BI0A 5C4XJ 1IO2A 2VJ4A 2M87A 2QA4I 3ZQLA 2KP6A 3C7JA 2E7XA 2B7EA 1QZZA 1ENHA 2M45A 3TO9A 3DTIA 1GVJA 2LBFA 1CGPA 3S1QJ 1IXRC 3ML6A 1G4DA 1SANA 4E7ZA 4XSXF 1ETQA 1R1TA 3VYRB 1X19A 5E18F 3OIQA 3S14J 2Z1DA 4RM2A 3AL0B 5FLXK 1J75A 4RS8A 2JPCA 1K78B 1S8NA 2M8GX 3B6CA 3PL8A 1YE9A 5CYVA 4ENMA 2F5CA 3S16J 1EH6A 2L7ZA 1IAWA 5KCMA 4G9YA 1BIBA 1D1CA 3FXQA 4XIDA 5M5XJ 1WGXA 1IW7F 1Z3XA 2QBYB 4IHTA 3NWSA 4A5NA 1QVTA 2J5PA 3I4MJ 5JVGF 1FWZA 4J01A 1DGRM 4XNFA 3JW4A 2CSOA 4BE1A 1CQTA 2VUMJ 2FEZA 3FDYA 4MGRA 4F92B 2X6OA 3D5RC 5LRRA 5FLMJ 2WA0A 2DFHA 4ZZDA 1S5LC 3X2QH 1T0FC 4L0YB 1PVEA 4UVAA 3Q9SA 2F4OB 2VKHA 4BGDA 2IT0A 2PJPA 4BE0A 1X3UA 5EGOB 4Q48A 3FMQA 1B9MA 2E19A 3CD6I 2L9NA 3HPHA 5F08A 1CF7A 5FB2A 1BI2A 1YO5C 3SZGA 3HOTA 1JGGA 4FCYA 2DODA 3A01B 5EG0B 2A07F 4XLPF 2DW4A 4XKWA 1TQPA 4D0PA 1ETXA 4IHSA 3PNVA 3W6VA 2CG4A 1HDPA 1K7AA 2BZTA 2M7AA 3PJRA 2VJ5A 1JJ8C 4XKCA 1Z6TA 1RRJA 2NVTJ 4CCNA 4IOAF 2DO7A 2OJED 4C2TA 2LLKA 3HOXJ 3P9KA 3DU5A 1MBHA 1K61A 2GM4A 5DUIA 1D8JA 2X6XA 4I7HA 1RI7A 3RKQA 2KT0A 2WTEA 2X4HA 2Z16A 4AYBN 1I1GA 4YIRX 4X0GA 1ERDA 3W2AA 3RZOJ 1SMYF 3H5AA 4A3FJ 1UZCA 3TW6A 1HW2A 4KN7X 1G3YA 1IRGA 4CA0A 5B3SH 2DJIA 3DP7A 2JPBA 2V1NA 1G3WA 1RR7A 4HYEA 1VQLI 3E6CC 2OU2A 3A1YA 5HDKA 3ERMA 3GTJJ 2PBIA 1C0WA 3FZVA 3V8KA 4HPQA 4IRGA 1MIJA 1N25A 3GZ5A 1O7LA 2XVCA 3F8MA 1T0FA 2ZJRF 2YU9J 5J1UA 4LK1F 3WE2A 1RNLA 4RA2A 3OYMA 4HNVA 2A6EF 1QA6A 5D6EA 3F0CA 3GF2A 3K6GA 1DUXC 4A12A 1MBFA 2ZXHA 4DYRA 4A2UA 3QP5A 4NUBA 4KISA 4B8XA 1E3HA 3JRCA 5LHIA 4LB6B 1A36A 2LKPA 2HZTA 1J9IA 2DK8A 3VB2A 1WJ5A 1ZK8A 3PNTA 1QZYA 4LMYA 2M1BA 4GDFA 4OIOF 1VQ5I 1JTYA 2OV7A 3E7LA 2YPRA 4BUPA 5M5YJ 1Y56A 3G71I 2DYSH 2O3FA 2HZDA 1YIJI 4F55A 3O3KA 1X4PA 2KIMA 2KKOA 5ICGA 4M3FA 1Z77A 3SFIA 4ZYGA 3J7ZI 1FBSA 1WJFA 9ANTA 1UJ8A 4MIMA 4B47A 4KMUX 4HSRA 3BR1A 2E71A 1O4XA 3BC8A 4HOBA 5EZHA 1R22A 3OR1C 4HG2A 1J0RA 4ZTFA 2Z3YA 2ZXWH 3G1OA 3OIOA 1ZLJA 5E8GA 4A0ZA 3JRDA 2J5OA 3TDUC 5EEHA 2F5DA 3TDZC 3VYTB 1G2HA 2WB1N 5KNLA 1OR7C 2HWVA 1BR2A 4UHTA 3JREA 3F9KA 2BY1A 3L2CA 2EQRA 1RESA 1X2MA 3JAMZ 3GFIA 4CCOA 5J6XA 1FP2A 2LP0A 2P4WA 3BZKA 5IYDJ 1YOVB 3S32A 4I0BA 4IKFA 2EWNA 1R49A 4I6ZA 1UG2A 1YW9A 3ERED 3K1PA 4BEHA 3CESA 4LD5A 1QVUA 2IS2A 1W0UA 4OINF 1OISA 3HL2A 2H8RA 5EYRA 3S3MA 3WHCA 3HJEA 3RIRA 4IVNA 3VSKA 1L3LA 1E3PA 3JCUC 3FXUA 4ENNA 3BLYA 3WGHA 3DTKA 4BJ5C 2EV5A 2X1CA 1Y1WJ 4FE4A 2E2HJ 1HDDC 4A69C 4KMFA 2KQRA 1A6IA 3BJAA 4Y3OA 4IL6C 4E7JA 1XN7A 4L9NA 3PSFA 4XLAA 3RDIA 1G8XA 4EATA 1TTYA 1WJCA 2O0YA 2ISYA 4RAZA 1XD7A 1O3QA 1OCCH 4HSTA 4IPAA 2RQPA 5CQGA 3OYEA 3GTOJ 2DQLA 1VQ9I 4PCQA 2F6CA 4HF2A 4EV0A 5ICFA 1IN8A 3BG3A 5L3BA 5JI6A 1QU3A 3HRUA 4V2GA 1YTYA 4PDKA 2LREA 3MKZA 1UHMA 3EYIA 1YX3A 4B3XA 1U5TC 3V7CA 2W84A 3DQVC 2BHZA 5CVRA 1H9GA 1S7AA 1IUYA 1SAUA 1R5HA 1JTXA 3IWZA 1GXPA 3CUQC 2A5WA 3M1CA 1JGSA 4C3JJ 4KIGA 4RMNA 2UZKA 3S2DJ 1Y0NA 2VL8A 3U1KA 2O03A 4C9YA 2D5VA 1ZLKA 2QSHX 2DOAA 2ZJPF 1LVAA 2G7HA 3A4CA 2R7TA 3HSRA 2W1OA 2Z33A 2BY0A 1KGSA 3S3OA 1OR7A 4E4HA 1YJ9I 3I3LA 4TV7A 3HBLA 4UV8A 4NDLA 2CH0A 3C3WA 3GTMJ 3K0LA 3CCQI 3H9GA 4XLFA 3W3CA 5D8LB 4LG0A 4YELA 1Y39A 1OLTA 3S2WA 1MDMB 5EJCA 1F36A 4AWXB 5HLTA 3KP2A 3HSEA 1VQ8I 4DYQA 3K9TA 1FOXA 2ZCWA 3RSNA 2ZBKA 5J8FA 1H8AC 3DXJF 3PSIA 1JT0A 3HOZJ 1R58A 3ZMZA 3BG7A 3BDDA 2FX0A 3OL4A 1ETOA 3MZ8A 1HSJA 4GYIA 1OYWA 1BOAA 2WV0A 2K7LA 1JUSA 5H2FC 2RDPA 4Q47A 3WU2C 4RGXA 4GFBA 4JP0A 4E70A 2EINH 1JI8A 1MJAA 2MLGA 5DS9A 2ZMEB 2OCEA 5ILSA 2AO9A 2H94A 4C3IJ 5IY5H 2DQRA 1ODDA 1BR1A 4KYWA 5DD4A 1T98A 2IPQX 1JKQC 2H1LA 1N75A 2K4JA 1JT6A 3CUOA 2DA2A 1Y0UA 3I58A 2M8EA 1U5TA 3KP5A 4B48A 4ENKA 3E1SA 2ZKZA 1GV2A 4UXNA 4B09A 3CUQA 2K9QA 4H0EA 2KJBA 2Q2EA 3IH4A 5TGTA 4XK4A 3NRVA 2G0EA 2ZB9A 2NVYJ 4ITVA 2K9LA 3F8NA 2R7RA 2VKEA 2GXBA 2JA7J 3R61A 4E7KA 4WXDA 4KIFA 2PMHA 3N4MA 1APLC 2OA4A 2V1XA 4HX8A 4BJ6C 3CCUI 3S1MJ 1DP3A 2IBDA 2UV1A 3SDBA 2QF7A 1TWGJ 1MBKA 5D4SA 2P5LC 1R7JA 3MWMA 4R8HA 2M4GA 3C2BA 3SZPA 1YW8A 2VASA 5CVIA 1E3OC 4QSHA 1W7PD 2LKXA 1RETA 3IH2A 3L2QA 2HNHA 1ON1A 2O61A 3G1MA 1ORKA 4HX7A 3UNGC 1BL0A 3AG1H 2DFFA 4IEJA 2V1DA 3SQNA 4CYCB 1RPWA 4BXXJ 2EIMH 2XAJA 2JK3A 2CJJA 1J59A 1NHAA 2O5RA 4N4NB 3VPRA 3RJPA 4ZDOA 3JRIA 4L9JA 2M4KA 3K70D 3R6SA 3K69A 4J00A 4BDZA 2VQGA 4KN4X 2VPLA 5HLGA 2WAFA 3AG2H 1BA5A 1LFPA 2NNYA 1VTNC 1Z1DA 1D5YA 3DLLF 1MKMA 4IXAA 1XCBA 4XMYA 2K9NA 4DZPA 2FOKA 2L3DA 4BXFA 1LE8A 1YITI 1QO0D 5EF6A 4LB5A 1EF4A 4NQWB 5K5QA 1U78A 3DEWA 3BR5A 1ZARA 4L9TA 3D5LA 3K70C 2I8DA 2ADUA 1G3SA 2EJRA 3HM5A 5IT9Z 2LYCA 1TQMA 2HFHA 1W36D 1Z7UA 2MC3A 1EA3A 5GAHJ 2DMUA 3JTGA 1IRXA 4Q5SF 2P5VA 2FBKA 3AFHA 1XX5A 2E1MC 1WSUA 2FF4A 2GA1A 3QAHA 5HOOA 2HXOA 4XR6A 3HG9A 4BACA 2M0MA 5IP9J 3B02A 3GLXA 4PK4A 5HS9A 2XV4S 1LKXA 2QUFA 2RVCA 2W57A 2MC4A 4DQ2A 1FOWA 2R5YB 4YFKF 3DEEA 1S3JA 3HOWJ 3H3VK 3OOPA 2HR3A 4KT6A 1ZHFA 2A69F 3Q3SA 4RAGA 1HKQA 1HXDA 3FMSA 2DN0A 3LSMA 3KETA 1T38A 2G9WA 4P1WA 3ZQGA 1VFCA 3EUHC 4IRHA 2W4SA 2DPUA 3OOUA 3GTPJ 1U8RA 1SFOJ 2YR2A 5D8KB 2DA7A 2P6SA 3RKXA 3LNQA 3LWFA 4LITA 5FLXZ 5IPAA 2JTVA 4RAFA 2YX7A 4A3DJ 2KRFA 5H6RA 1J5YA 5C4JJ 4AIKA 4MO7A 3W2WA 5J1RA 5LEJA 1IF1A 1FYKA 2L02A 5LFAA 2XGCA 3RKWA 3OIPA 3IWFA 4PJLA 5HVQC 2BW3B 1X3WB 3BG5A 3QPSA 4XRSG 3CC2I 5F1JA 1USSA 3OY9A 1MH3A 3ONQA 2MABA 3O8GA 3JTHA 5ILVA 1AA7A 1I6HJ 3RCOA 4E7LA 3GO5A 4KICA 1REPC 1VQ4I 4ZYHA 3J80Z 4GO1A 2R7FA 3O6BB 2XHKA 4CXFA 3WTVC 3OYDA 5EEAA 2EFWA 5BMZA 1FLIA 2O7OA 3TO7A 2H27A 1U2WA 1YHQI 1MSFC 2L4MA 3GLLA 3CCYA 2IXSA 4PZJA 3UR3C 1MW7A 1RUNA 1ON2A 4FX4A 1LFUP 3QYEA 4M9ZA 2GQQA 4FASD 4FISA 3BQYA 4A3GJ 3OYJA 1FIAA 2IJLA 3HUGA 4UUVA 4M3BA 3B6AA 4XLNF 1F4KA 4LLNA 2ISZA 5DUKA 1I5ZA 2HDDA 1RKTA 2H09A 1XPXA 1IXSB 3WU0A 2VIXA 2CMPA 4CDGA 3S8PA 1O3RA 3ZP5A 1ZH5A 3FXJA 3EUHA 2E1NA 1B59A 1P2FA 3CJTB 3BTJA 2KFDA 3ROUA 3CF5F 3BCBA 3LOCA 1QPMA 3W6KB 4XN3A 3WODF 5D5UB 3CJQB 2N8GA 3WU1B 1HF0A 4A3CJ 4RB1A 1WCMJ 2JJ7A 2VT2A 2VODA 2BXZA 3HOUJ 3EQLF 1B8IA 2HYFA 4RGUA 1TQIA 2RNGA 4CGZA 1AOYA 1HKTA 3H0GJ 2K02A 5K7ZA 4ABZA 2Y30A 4YG2F 2JA6J 1YQAA 2VOOA 1WH7A 1Y6IA 5EDNA 2HQRA 4A3EJ 3DF8A 2DOEA 3EUKL 3OR2C 4QPOA 3M1EA 2R7OA 4YFXF 4ZYDA 4BDYA 4MFEA 2R5ZB 2HVSA 2RKHA 2R7SA 3QYFA 1UG0A 3BZCA 4N4OB 5IT3A 1YYVA 2Y0SA 1X3ZB 3IUOA 4PUSA 3F22A 1IC8A 3HB9A 1PUFB 5F0HA 1D5VA 3QWLA 2ID3A 1J7KA 2PJRB 1JHFA 2OZ6A 1TT5B 4B1RA 3GUDA 2XAGA 1NTCA 2NS8A 3H5NA 2JSCA 4O3MA 3ECHA 1BBYA 1JKOC 1T95A 1IV6A 2FQ3A 2JZYA 3I9V2 3F21A 1H89C 1EV7A 1S7OA 3IAS2 3HOYJ 1ZREA 4XSZF 2ESHA 3F6VA 4Y15A 5FKNA 5A2QK 3MFKA 1TT0A 2CQXA 4DW6A 3QU6A 2A05A 1KQ9A 2XF5A 4L18B 2XAFA 1D1AA 2LBFB 2B9SA 4L0ZB 4E7IA 4DJAA 1SFEA 3TOBA 3H3ZA 5DM7F 1B72A 3HTSB 5DDGA 1TW2A 2KISA 4HF0A 2ZJQF 5JVTA 1SEUA 3ISPA 2E1OA 2WAQN 3DKWA 1TWHJ 2AQEA 2IP2A 5JFRA 2FMLA 5LD2C 3VODA 3P7NA 1QNTA 2EA2A 4ZTJA 2WC2A 3HOVJ 1R00A 3FXRA 1ONVA 2FBHA 1KU3A 1PDNC 2BVMA 2HQAA 1USTA 2CS3A 1KZHA 4ZJZA 1QGPA 5H6QA 3CF2A 5E8IA 4QIWN 4IRIA 4IHYA 1XC5A 4E7HA 2X9DA 2EV6A 1YRNA 4I99C 3BTIA 4X6AJ 2XAHA 2V6CA 1WJAA 1EKEA 1ZGJA 4UVBA 1RIOH 4A6DA 2D1HA 2QZ8A 1A35A 2MGQA 1QQIA 5L3EA 2NAZA 1HA8A 5FKMA 1DU6A 2F5FA 2Y31A 2QQ8A 1TP4A 1LUJB 2Y9ZA 3CCEI 3SDGA 1G59A 2FQ4A 4UUSA 2R7UA 2IS6A 3H0DA 6PAXA 4GCVA 1Z7LA 2UUZA 5M5WJ 4G7OF 5E1XA 2QYOA 4Y52J 4N0BA 5D5WB 1Z05A 4BH9A 2EIKH 4HF1A 2DFIA 4G6QA 4BU2A 1B4AA 1XMKA 4XQFA 1ZRDA 3CCJI 2X6WA 4B44A 3J7YJ 4NC6A 2NRAC 4EVIA 1T8IA 4YRVA 4HRIA 1ETWA 1Z67A 2PMZN 3RPQA 5EGOA 2NXNB 2KDOA 4YIIA 2PN6A 2R3SA 2W85A 3GBGA 3H5RA 1X1DA 4Y7NJ 2BXYA 2IA1A 4BJTA 2OBPA 5AONA 2EBIA 2WY8Q 2LR8A 5EEGA 2HPMA 1MMAA 2PG4A 1OCZH 3BR3A 3GFMA 3PO3J 3J81Z 1X58A 1UCRA 2DYRH 4UB6C 5J1YA 3AAFA 2XKPA 2JRTA 3T5XA 2CW0F 3LSIA 4BYYA 3BTLA 4E7SA 3HEFA 4HLYA 2BGCA 2HOTA 3OL3A 3ABUA 4CYDA 5CQEA 4HV5A 1P9QC 3RQ4A 3SFZA 3BPVA 4ZZLA 2FBIA 2FOWA 4IO9F 3HHHA 2FSWA 1WKMA 2LY9A 1FMVA 2DA1A 4JK1X 1BM9A 4LJZF 5HDGA 2NVXJ 2F48A 3TP3A 4BL0B 4RBOA 1QRYA 4RB2C 1MBJA 4W97A 2HOSA 2PQ8A 1XB4A 2F5VA 1FNNA 3MAJA 1UMQA 2DMTA 2Y2ZA 3VSLA 2WBMA 2IVMA 4N9IA 5JHUA 3COAC 3R60A 4CO8A 2DK5A 2MW8A 3S1RJ 3FISA 2LKSA 1GUUA 3LFKA 3LA3A 4PSXA 5CVUA 2ECBA 4RB3C 3A03A 3I5UA 2GXAA 3BCAA 4XBFA 4M74A 2OQGA 1JJ6C 4M3DA 2DA4A 2DMNA 5J3LA 3NAUA 4D1QA 5CLSA 2OTJI 2F4IA 2V9KA 4WWCA 1EJ9A 3BZ6A 2G7UA 3WGIA 1S6LA 4JOMA 2WAEA 1XG1A 4IQJA 1F1ZA 3GTLJ 5ED4A 4XKVA 2CUFA 2Q8KA 3SYTA 2COMA 5J4VA 2R7ZJ 5HLIA 4CCMA 1BW5A 5HNHA 3Q0UA 1K79A 2VE8A 2DDBA 1LDKB 2VPRA 3BY6A 2EFQA 4AM3A 3FM5A 3PNYA 1NG6A 2QKLB 3M4OJ 2MBFA 2M3AA 2XASA 2ZO4A 4HZFA 3BJ6A 1YW7A 3IV5A 5D4RA 3O8HA 3ZMUA 4EJOA 4A3MJ 1TWAJ 4RM3A 1P7IA 2BHYA 3G2BA 4RB0A 2O6GE 2OQRA 2VBYA 2XRNA 2K40A 3I55I 3CCLI 4KFCA 1SVOA 1IZ1A 3HGYA 4LK0F 1SC7A 2RQQA 1NK2P 1ZN2A 2LY2A 2TCTA 2TRTA 3KLOA 1X1AA 1JKRC 4LOCA 3ZMVA 5FD6A 3HC7A 4FQGA 4GXOA 3PM1A 3VEPA 4XOTA 2X0LA 4PGGA 1QPIA 2HDCA 1WRJA 3CC4I 4HLXA 1V5EA 1YX5A 2Z99A 4BEHB 3HSFA 3CQZJ 2E7WA 2X51A 4ESBA 1FEXA 1W1WE 3CLOA 3ZXSA 2PFBA 4FHTA 2GBYA 4MQVA 1GVDA 2WWYA 1RZ4A 2DBBA 1TWFJ 4UNOA 3KEQA 1ULYA 3F6OA 4HQEA 2AXLA 3E3VA 2LMDA 1F43A 1N77A 2XF6A 4B43A 1OCPA 1R5ID 3KZIC 4CH7A 5LGTA 5FO5A 5F1RA 4C2MJ 1HW5A 4JQFA 2XB5A 4KIBA 3ECOA 3LFUA 5F04A 1VF9A 4NNJA 3IL2A 5GAEJ 5LHGA 3TW7A 4D5CA 5FRMA 1MJ9A 4BS9A 5E17F 1IRZA 1ZELA 3W2VA 5FFXA 3ZR8X 4Y33A 2HDWA 3MD2A 2H8WA 3I59B 1OYYA 3MEXA 1IXCA 4GGGA 4OMZA 3LSJA 2OUMA 3A0BC 2BY3A 4PSWA 2E36A 4I2OA 3OYCA 2QSFX 1HKSA 1R4MB 4NBQA 1FX7A 1UB9A 3WG9A 3ZMSA 5EZGA 4ON0A 5FROA 1WZ2A 2COBA 4NB5A 1FBUA 3K4BA 4R1HA 1XMXA 2MD0A 4XLCA 2DAOA 1U0JA 3ZQHA 1Q1HA 3ABTA 1WI9A 4XRFA 4M6XA 4DBRA 2HI3A 1LDJA 1SFXA 2CUEA 2IAIA 3KCCA 1OCRH 3BR0A 1B9NA 1XSDA 4OIQF 1NH3A 3FKIJ 2P8TA 3DCFA 3WTTC 1Z21A 2QEXI 1HW1A 1KYWA 3FXOA 2DT7B 1SVLA 2VJIA 1T39A 1QHGA 1T6SA 3I71A 4CCJA 1XSVA 2VJJA 3IKVA 2WADA 3U2RA 2M2EA 3M8JA 2MLKA 2GZWA 1MMSA 2QLZA 2IGMA 1MDMA 1IGNA 4IHXA 2LRDA 1I27A 3KPHA 3Q0WA 4JBAA 4RAYA 1BI3A 2OZUA 3C2GA 4MFDA 4PGHA 1BC7C 2DMQA 2KJCA 3FMRA 4K2EA 1U5TB 2HOEA 3E5UA 2K9SA 3LMMA 1T2KA 4M9SA 1JUPA 3GEZA 4U87A 2JA8J 3CUQB 3FK7A 2ECCA 2ZSHB 4AC0A 3HKZA 4BQAA 4EGZA 4ZDLA 4HBLA 2Q2EB 2LSOA 2PI0A 2CV1A 2X1EA 3S2HJ 3E6DA 4M3GA 3BROA 2HQ5A 4ZDPA 3HPGA 3PQJA 4BXUA 1WJBA 1FYLA 2Q1ZB 1BC8C 1YS7A 3MN2A 4I76A 3WGGA 2D1VA 2MH2A 1EH7A 2IEKA 3CO7C 4BHPA 3QPTA 1OJLA 2Q0OA 1Q1VA 4A3KJ 4F7ZA 2B63J 3L9FA 4DIQA 2OC6A 4KT5C 5LEKA 2Z5UA 3KP7A 4WX9A 3CDLA 1O3SA 5K5RA 2GIVA 3L2RA 3HYIA 4FX0A 3F8FA 1ACIA 2UXNA 3FK6A 3JAMK 3V42A 4AU7A 3HOSA 2XPWA 5B1AH 4F91B 4YIFA 2UWMA 2P6TA 3WTXC 2D45A 3C2HA 4MHGA 5KAIC 3GTGJ 1ZAOA 5BNGA 1L0OC 2K27A 5DD8A 4XICA 1FIPA 5CKTA 2L4AA 1HOMA 1KONA 3CDIA 3RPUD 1WFXA 5LRSA 2LDUA 4JYKA 4JX5A 4ZC3A 1K6OA 3EPZA 3H3UA 1LE8B 2F5EA 4HW0A 2ETHA 2JUGA 1UFMA 2JVGA 3LA7A 1ZG1A 3HRTA 1M1EB 4EEFG 1PJRA 5DCMB 1DP7P 5J40A 1MBGA 1MH4A 3IKTA 3WTWC 1OYIA 2O8XA 1OCTC 2BE5F 5HS8A 2L7KA 3LA2A 2ICWG 3NARA 3ABMH 2DXIA 2E35A 3DKYA 3QPLA 2BV6A 2MD5A 3QODA 1ZG5A 3TQNA 2MG4A 3GVAA 1A04A 4D9JA 1D8KA 4KNYA 4QLCU 1POGA 3CCRI 2W00A 4XONA 1I1SA 3WTUC 5CVVA 3ZRGA 5ICCA 1U9NA 3N05A 1IN7A 1JKPC 4WCGA 1FOKA 3DEUA 2HVRA 1FTTA 5FGMA 1SD5A 5L3CA 1X1CA 3L1PA 1MZBA 3SJMA 2GOMA 3F8BA 3WTSC 2W24A 3VYUB 5E3NA 3BP8A 3K4MA 1HLVA 1XGNA 2VXZA 4CICA 1OQYA 2R92J 2QENA 2MFZA 5LGUA 1ZGWA 2RV8A 1FMWA 2HTSA 2CUJA 1U3EM 1S29A 4ASNA 2R5YA 2DFEA 2EZHA 2F4MB 1W7PB 1YJWI 3UKGA 1QBJA 3I56I 1VZ0A 1VQKI 3QRFF 5IOZA 5BPIA 2DPDA 3F8CA 3KEOA 3LSPA 2HS5A 3T8RA 2QM3A 4CSWA 2DOFA 1AKHA 1QZEA 4I0AA 1LVKA 5TRDA 4Q4ZF 2CQ7A 4G8XA 2H1KA 4Y4RA 4UV9A 1RUOA 2MA3A 1NG7A 4CCLA 2VC1A 5DYMA 3CDHA 2CV2A 2V9PA 1D0XA 5CJ9A 2YS9A 3QPHA 5C44J 3S17J 4R79A 2PMUA 3DTEA 2QCOA 3CZ6A 3W6JB 3WG7H 3DKXA 1LPQA 1I39A 4D5FA 1H0MA 2STTA 1RC9A 2XF7A 2E1MB 4DNCA 2LFBA 3RPUA 3R4KA 2V9VA 2CFOA 4Y17A 4C3HJ 4G7HF 3VYSB 3BJOA 3JRGA 2VE9A 3Q5FA 1G6NA 3HRSA 4OAZA 3NQOA 1SAXA 4W1UA 4XL9A 5DCFA 5AIPA 1VQ7I 2CYYA 2CRGA 1W5CC 1FC3A 1S9HA 2LK2A 3KP3A 2XUBA 4GYGA 4YEJA 2DI3A 5FKLA 3TKYA 3ZMTA 2QKMB 5DEQA 1OCOH 3RQIA 1S7EA 1VQMI 4AIDA 2C6YA 2O8KA 2FUG2 2EZKA 2HOAA 3ZN0A 1O3TA 5HODA 4F3QA 3DBLB 1D3YA 1WJEA 3TBIA 2JVHA 2V7FA 1XDUA 4LFUA 1MNDA 3CJRB 4IF4A 2OAZA 4BY7J 4FETA 4AUXA 2CWEA 2E5NA 2R4GA 4XLEA 2BYVE 1GLNA 3K1MA 2ZSIB 4CHUA 1Z9CA 3PFIA
chains in the Genus database with same CATH topology
5EGOA 2DJNA 5JLWA 3BT9A 3BG3A 3GBGA 4Y7NJ 2JN6A 2JMWA 2E2JJ 4V2GA 2EBIA 4XRSA 2LR8A 2HXIA 3BR3A 3OSGA 2W48A 3PO3J 1JTXA 1X58A 3OSFA 2YUSA 2NS7A 4C3JJ 3S2DJ 5J1YA 2HOTA 3BTLA 3HEFA 1VNDA 3LSGA 2D5VA 2E2IJ 4A3BJ 2LY9A 1H88C 2DA1A 4BBRJ 4DZJA 2NVXJ 2DA3A 3TP3A 1VI0A 4RBOA 1QRYA 3HBLA 1MBJA 5GPAA 4W97A 2HOSA 4NDLA 3S1NJ 3GTMJ 5M3FJ 2ME6A 1UMQA 2DMTA 1IJWC 1T56A 2CU7A 2Y2ZA 2Y9YA 2LD5A 5F27A 2WV1A 2EZLA 2R5ZA 1F36A 2MW8A 3S1RJ 3FISA 1GUUA 4DYQA 2HYJA 2ECBA 1H8AC 3HOZJ 3A03A 1JT0A 1JJ6C 1B72B 4M3DA 2NOGA 2DA4A 2FX0A 1ETOA 2DMNA 3HKZN 5J3LA 1AHDP 3BR2A 3NAUA 1LFBA 3ZQCA 2M9HA 2X48A 1JUSA 5GPCA 1XG1A 3GTLJ 4GFBA 4JP0A 2ID6A 2CUFA 1AKHB 4D7MA 5DS9A 2R7ZJ 4M3EA 3CMYA 2AO9A 2XPUA 4D7NA 2AHQA 3ZOBA 3Q0UA 1BW5A 4C3IJ 3Q0VA 5FKKA 2VPRA 3JRFA 3M4OJ 1ZR4A 1ZTRA 1JKQC 3IV5A 2L7FP 1RKWA 3O8HA 3S15J 1JT6A 4A3MJ 1TWAJ 1P7IA 1MSEC 2DA2A 4UUTA 2L0KA 5GP9A 1YRNB 3BQZA 2K40A 4DYCA 1GV2A 3HGYA 4S0HB 2K9QA 1NK2P 2OF7A 2TCTA 2TRTA 1WPKA 4FTHA 4LOCA 1JKRC 3IH4A 4XK4A 4BY1J 3PM1A 2JA5J 2G0EA 2ZB9A 1QPIA 2NVYJ 5E3LA 1HCRA 2JA7J 2VKEA 3CQZJ 1FEXA 1APLC 3IH3A 2GBYA 4G12A 4UUSB 1GVDA 3S1MJ 2IBDA 1TWFJ 4J19A 2QF7A 1TWGJ 1ETYA 1XS9A 1MBKA 4IHVA 3C2BA 4FE7A 3GTQJ 1T33A 1F43A 1BJZA 1E3OC 4QSHA 5M3MJ 2LKXA 1RETA 1OCPA 3IH2A 3G1MA 1ORKA 1BL0A 3WHBA 4C2MJ 4IEJA 2XB5A 4CYCB 1RPWA 4BXXJ 1ZKGA 2JK3A 2CJJA 1TC3C 1IG7A 4QTRA 5F04A 1VF9A 1B8IB 1AU7A 3VPRA 2M0CA 3TW7A 4D5CA 2XRLA 3QQAA 1JUMA 3JRIA 1IRZA 2L7MP 3HGGA 4XRMA 3M3YJ 1BA5A 1I50J 1P7JA 3A01A 5EG0A 3LSJA 4B4CA 2GLOA 2Y0SN 1D5YA 1WH5A 5E3MA 2DA5A 2R0QC 2K9NA 4DZPA 2FD5A 4RDUA 1LE8A 3TP0A 2OPTA 1U8BA 1TWCJ 2DTZA 5EF6A 1EF4A 3MKLA 1U78A 5JLXA 3A02A 5EZGA 3JR9A 3DEWA 1ETKA 3BR5A 2COBA 4M6VA 3HM5A 4JX4A 2DMUA 1FJLA 3ZQHA 5F0CA 5IP7J 2HI3A 4IHWA 4X1EA 2CUEA 2IAIA 2HXOA 3BR0A 3FKIJ 1Y1VJ 1K83J 5IP9J 3DCFA 2VKVA 1MNMC 1PUFA 2MSYA 2R5YB 3JRBA 2DMPA 4A3JJ 2I10A 3HOWJ 3H3VK 2ELKA 3ZQIA 2M2EA 3Q3SA 5DTDA 4B3AA 2DN0A 1MBEA 5K7HA 3ZQGA 1VFCA 2NVQJ 5C4XJ 3BG9A 3OOUA 1IGNA 4IHXA 3GTPJ 1SFOJ 2XPVA 3ZQLA 3Q0WA 2DA7A 1ENHA 3LNQA 1IDZA 2EH3A 5IPAA 4MFDA 3S1QJ 2DMQA 1IUFA 4A3DJ 1SANA 2K9SA 5C4JJ 1ETQA 4MO7A 5J1RA 1JUPA 2JA8J 2XGCA 3S14J 3FK7A 2ECCA 4AC0A 3BG5A 3QPSA 4XRSG 2M8GX 3B6CA 5F1JA 3S2HJ 3S16J 1MH3A 2L7ZA 5FJ8J 3O8GA 4XIDA 4M3GA 5M5XJ 1WGXA 2HQ5A 1I6HJ 3FIWA 1QVTA 3I4MJ 3MN2A 5EEAA 2CQQA 4I76A 4L5EA 1ZQ3P 5IOYA 2O7OA 2IEKA 1MSFC 3HDDA 1OJLA 3CCYA 1Q1VA 4A3KJ 2B63J 1CQTA 2VUMJ 1LFUP 2X6OA 5FLMJ 4FISA 3BQYA 3I4NJ 5K7FA 2XSDC 4A3GJ 1FIAA 4M3BA 3B6AA 3CDLA 1I3QJ 2LTPA 1W0TA 2HDDA 1RKTA 3FK6A 5EGOB 3BR6A 2E19A 2XPWA 5F08A 1WI3A 1JGGA 4FCYA 2EZIA 3GTGJ 3BTJA 5BNGA 3A01B 5EG0B 2L9RA 5F0FA 3LOCA 4XICA 1FIPA 1HOMA 1ETXA 4JYKA 4JX5A 1LE8B 2N8GA 3W6VA 1HF0A 1HDPA 4A3CJ 5FKOA 1WCMJ 2JJ7A 1JJ8C 3HOUJ 1B8IA 4EEFG 2NVTJ 1MBGA 1MH4A 3H0GJ 3G1LA 4ABZA 2Y30A 5K7ZA 1GT0C 2JA6J 4V2FA 1OCTC 1WH7A 2LLKA 2XB0X 3GTKJ 5EDNA 3HOXJ 1K61A 1MBHA 4A3EJ 2GM4A 3NARA 4BKXA 3RKQA 2KT0A 3QPLA 4AYBN 4MFEA 2R5ZB 2MG4A 3RZOJ 4A3FJ 3TW6A 1POGA 1IC8A 3HB9A 1BW6A 1PUFB 5F0HA 3RZDJ 1RR7A 3K7AJ 2ID3A 1U9NA 4B1RA 1Z0XA 1NTCA 3GTJJ 2NS8A 1JKPC 3JRHA 1JKOC 1FTTA 2YU9J 1IV6A 5J1UA 3L1PA 1H89C 3K2AA 3SJMA 3HOYJ 1ZR2A 3ZQFA 4HNVA 5E3NA 4BBSJ 3F0CA 1HLVA 5C3EJ 5FKNA 2R92J 4A3LJ 2CQXA 4DW6A 1MBFA 2M34A 2RAEA 4DYRA 1ZGWA 3JRCA 4JX6A 2O9LA 2R5YA 1B72A 1GDTA 1ZK8A 2EZHA 3PO2J 3UKGA 1ETVA 1JTYA 1FTZA 4MLOA 5IOZA 2DA6A 3E7LA 2E1OA 2XGDA 2WAQN 5M5YJ 1TWHJ 3LSPA 1NK3P 5IYBJ 1AKHA 1X2NA 4M3FA 3HOVJ 1Z77A 3SFIA 2H1KA 5IYCJ 2VI6A 3D1NI 9ANTA 4MIMA 2P81A 3BR1A 1O4XA 2YS9A 4QIWN 5C44J 3S17J 5EZHA 4IHYA 1XC5A 3TEDA 4A93J 2X9DA 2QCOA 3G1OA 3OIOA 1YRNA 4D5FA 3JRDA 2R93J 3BTIA 2LFBA 4X6AJ 1UHSA 1G2HA 2WB1N 4C3HJ 3JREA 3JRGA 2LVSA 2EQRA 1RESA 1X2MA 2MGQA 3LSRA 2LP0A 5IYDJ 4W1UA 5FKMA 2ME0A 4I6ZA 1UG2A 2CRGA 1R9TJ 1DU6A 2Y31A 2LK2A 3JRAA 1QVUA 1W0UA 2Y9ZA 1OFCX 1IDYA 2XGEA 2H8RA 3SDGA 5EYRA 2FQ4A 3WHCA 5FKLA 5IP6A 4UUSA 4A3IJ 2KDZA 1Y1WJ 3RQIA 1S7EA 5M5WJ 4FE4A 2E2HJ 1HDDC 2O8KA 4A69C 1A6IA 2EZKA 2HOAA 4Y52J 2JWTA 5HODA 1U9OA 1GV5A 4BY7J 4AUXA 1A5JA 1DU0A 3BTCA 2FJ1A 1ETWA 2PMZN 4CYCA 5FLVA 3GTOJ 5E3OA 1ITYA 3MVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EGO A;  2DJN A;  5JLW A;  3BT9 A;  3BG3 A;  3GBG A;  4Y7N J;  2JN6 A;  2JMW A;  2E2J J;  4V2G A;  2EBI A;  4XRS A;  2LR8 A;  2HXI A;  3BR3 A;  3OSG A;  2W48 A;  3PO3 J;  1JTX A;  1X58 A;  3OSF A;  2YUS A;  2NS7 A;  4C3J J;  3S2D J;  5J1Y A;  2HOT A;  3BTL A;  3HEF A;  1VND A;  3LSG A;  2D5V A;  2E2I J;  4A3B J;  2LY9 A;  1H88 C;  2DA1 A;  4BBR J;  4DZJ A;  2NVX J;  2DA3 A;  3TP3 A;  1VI0 A;  4RBO A;  1QRY A;  3HBL A;  1MBJ A;  5GPA A;  4W97 A;  2HOS A;  4NDL A;  3S1N J;  3GTM J;  5M3F J;  2ME6 A;  1UMQ A;  2DMT A;  1IJW C;  1T56 A;  2CU7 A;  2Y2Z A;  2Y9Y A;  2LD5 A;  5F27 A;  2WV1 A;  2EZL A;  2R5Z A;  1F36 A;  2MW8 A;  3S1R J;  3FIS A;  1GUU A;  4DYQ A;  2HYJ A;  2ECB A;  1H8A C;  3HOZ J;  3A03 A;  1JT0 A;  1JJ6 C;  1B72 B;  4M3D A;  2NOG A;  2DA4 A;  2FX0 A;  1ETO A;  2DMN A;  3HKZ N;  5J3L A;  1AHD P;  3BR2 A;  3NAU A;  1LFB A;  3ZQC A;  2M9H A;  2X48 A;  1JUS A;  5GPC A;  1XG1 A;  3GTL J;  4GFB A;  4JP0 A;  2ID6 A;  2CUF A;  1AKH B;  4D7M A;  5DS9 A;  2R7Z J;  4M3E A;  3CMY A;  2AO9 A;  2XPU A;  4D7N A;  2AHQ A;  3ZOB A;  3Q0U A;  1BW5 A;  4C3I J;  3Q0V A;  5FKK A;  2VPR A;  3JRF A;  3M4O J;  1ZR4 A;  1ZTR A;  1JKQ C;  3IV5 A;  2L7F P;  1RKW A;  3O8H A;  3S15 J;  1JT6 A;  4A3M J;  1TWA J;  1P7I A;  1MSE C;  2DA2 A;  4UUT A;  2L0K A;  5GP9 A;  1YRN B;  3BQZ A;  2K40 A;  4DYC A;  1GV2 A;  3HGY A;  4S0H B;  2K9Q A;  1NK2 P;  2OF7 A;  2TCT A;  2TRT A;  1WPK A;  4FTH A;  4LOC A;  1JKR C;  3IH4 A;  4XK4 A;  4BY1 J;  3PM1 A;  2JA5 J;  2G0E A;  2ZB9 A;  1QPI A;  2NVY J;  5E3L A;  1HCR A;  2JA7 J;  2VKE A;  3CQZ J;  1FEX A;  1APL C;  3IH3 A;  2GBY A;  4G12 A;  4UUS B;  1GVD A;  3S1M J;  2IBD A;  1TWF J;  4J19 A;  2QF7 A;  1TWG J;  1ETY A;  1XS9 A;  1MBK A;  4IHV A;  3C2B A;  4FE7 A;  3GTQ J;  1T33 A;  1F43 A;  1BJZ A;  1E3O C;  4QSH A;  5M3M J;  2LKX A;  1RET A;  1OCP A;  3IH2 A;  3G1M A;  1ORK A;  1BL0 A;  3WHB A;  4C2M J;  4IEJ A;  2XB5 A;  4CYC B;  1RPW A;  4BXX J;  1ZKG A;  2JK3 A;  2CJJ A;  1TC3 C;  1IG7 A;  4QTR A;  5F04 A;  1VF9 A;  1B8I B;  1AU7 A;  3VPR A;  2M0C A;  3TW7 A;  4D5C A;  2XRL A;  3QQA A;  1JUM A;  3JRI A;  1IRZ A;  2L7M P;  3HGG A;  4XRM A;  3M3Y J;  1BA5 A;  1I50 J;  1P7J A;  3A01 A;  5EG0 A;  3LSJ A;  4B4C A;  2GLO A;  2Y0S N;  1D5Y A;  1WH5 A;  5E3M A;  2DA5 A;  2R0Q C;  2K9N A;  4DZP A;  2FD5 A;  4RDU A;  1LE8 A;  3TP0 A;  2OPT A;  1U8B A;  1TWC J;  2DTZ A;  5EF6 A;  1EF4 A;  3MKL A;  1U78 A;  5JLX A;  3A02 A;  5EZG A;  3JR9 A;  3DEW A;  1ETK A;  3BR5 A;  2COB A;  4M6V A;  3HM5 A;  4JX4 A;  2DMU A;  1FJL A;  3ZQH A;  5F0C A;  5IP7 J;  2HI3 A;  4IHW A;  4X1E A;  2CUE A;  2IAI A;  2HXO A;  3BR0 A;  3FKI J;  1Y1V J;  1K83 J;  5IP9 J;  3DCF A;  2VKV A;  1MNM C;  1PUF A;  2MSY A;  2R5Y B;  3JRB A;  2DMP A;  4A3J J;  2I10 A;  3HOW J;  3H3V K;  2ELK A;  3ZQI A;  2M2E A;  3Q3S A;  5DTD A;  4B3A A;  2DN0 A;  1MBE A;  5K7H A;  3ZQG A;  1VFC A;  2NVQ J;  5C4X J;  3BG9 A;  3OOU A;  1IGN A;  4IHX A;  3GTP J;  1SFO J;  2XPV A;  3ZQL A;  3Q0W A;  2DA7 A;  1ENH A;  3LNQ A;  1IDZ A;  2EH3 A;  5IPA A;  4MFD A;  3S1Q J;  2DMQ A;  1IUF A;  4A3D J;  1SAN A;  2K9S A;  5C4J J;  1ETQ A;  4MO7 A;  5J1R A;  1JUP A;  2JA8 J;  2XGC A;  3S14 J;  3FK7 A;  2ECC A;  4AC0 A;  3BG5 A;  3QPS A;  4XRS G;  2M8G X;  3B6C A;  5F1J A;  3S2H J;  3S16 J;  1MH3 A;  2L7Z A;  5FJ8 J;  3O8G A;  4XID A;  4M3G A;  5M5X J;  1WGX A;  2HQ5 A;  1I6H J;  3FIW A;  1QVT A;  3I4M J;  3MN2 A;  5EEA A;  2CQQ A;  4I76 A;  4L5E A;  1ZQ3 P;  5IOY A;  2O7O A;  2IEK A;  1MSF C;  3HDD A;  1OJL A;  3CCY A;  1Q1V A;  4A3K J;  2B63 J;  1CQT A;  2VUM J;  1LFU P;  2X6O A;  5FLM J;  4FIS A;  3BQY A;  3I4N J;  5K7F A;  2XSD C;  4A3G J;  1FIA A;  4M3B A;  3B6A A;  3CDL A;  1I3Q J;  2LTP A;  1W0T A;  2HDD A;  1RKT A;  3FK6 A;  5EGO B;  3BR6 A;  2E19 A;  2XPW A;  5F08 A;  1WI3 A;  1JGG A;  4FCY A;  2EZI A;  3GTG J;  3BTJ A;  5BNG A;  3A01 B;  5EG0 B;  2L9R A;  5F0F A;  3LOC A;  4XIC A;  1FIP A;  1HOM A;  1ETX A;  4JYK A;  4JX5 A;  1LE8 B;  2N8G A;  3W6V A;  1HF0 A;  1HDP A;  4A3C J;  5FKO A;  1WCM J;  2JJ7 A;  1JJ8 C;  3HOU J;  1B8I A;  4EEF G;  2NVT J;  1MBG A;  1MH4 A;  3H0G J;  3G1L A;  4ABZ A;  2Y30 A;  5K7Z A;  1GT0 C;  2JA6 J;  4V2F A;  1OCT C;  1WH7 A;  2LLK A;  2XB0 X;  3GTK J;  5EDN A;  3HOX J;  1K61 A;  1MBH A;  4A3E J;  2GM4 A;  3NAR A;  4BKX A;  3RKQ A;  2KT0 A;  3QPL A;  4AYB N;  4MFE A;  2R5Z B;  2MG4 A;  3RZO J;  4A3F J;  3TW6 A;  1POG A;  1IC8 A;  3HB9 A;  1BW6 A;  1PUF B;  5F0H A;  3RZD J;  1RR7 A;  3K7A J;  2ID3 A;  1U9N A;  4B1R A;  1Z0X A;  1NTC A;  3GTJ J;  2NS8 A;  1JKP C;  3JRH A;  1JKO C;  1FTT A;  2YU9 J;  1IV6 A;  5J1U A;  3L1P A;  1H89 C;  3K2A A;  3SJM A;  3HOY J;  1ZR2 A;  3ZQF A;  4HNV A;  5E3N A;  4BBS J;  3F0C A;  1HLV A;  5C3E J;  5FKN A;  2R92 J;  4A3L J;  2CQX A;  4DW6 A;  1MBF A;  2M34 A;  2RAE A;  4DYR A;  1ZGW A;  3JRC A;  4JX6 A;  2O9L A;  2R5Y A;  1B72 A;  1GDT A;  1ZK8 A;  2EZH A;  3PO2 J;  3UKG A;  1ETV A;  1JTY A;  1FTZ A;  4MLO A;  5IOZ A;  2DA6 A;  3E7L A;  2E1O A;  2XGD A;  2WAQ N;  5M5Y J;  1TWH J;  3LSP A;  1NK3 P;  5IYB J;  1AKH A;  1X2N A;  4M3F A;  3HOV J;  1Z77 A;  3SFI A;  2H1K A;  5IYC J;  2VI6 A;  3D1N I;  9ANT A;  4MIM A;  2P81 A;  3BR1 A;  1O4X A;  2YS9 A;  4QIW N;  5C44 J;  3S17 J;  5EZH A;  4IHY A;  1XC5 A;  3TED A;  4A93 J;  2X9D A;  2QCO A;  3G1O A;  3OIO A;  1YRN A;  4D5F A;  3JRD A;  2R93 J;  3BTI A;  2LFB A;  4X6A J;  1UHS A;  1G2H A;  2WB1 N;  4C3H J;  3JRE A;  3JRG A;  2LVS A;  2EQR A;  1RES A;  1X2M A;  2MGQ A;  3LSR A;  2LP0 A;  5IYD J;  4W1U A;  5FKM A;  2ME0 A;  4I6Z A;  1UG2 A;  2CRG A;  1R9T J;  1DU6 A;  2Y31 A;  2LK2 A;  3JRA A;  1QVU A;  1W0U A;  2Y9Z A;  1OFC X;  1IDY A;  2XGE A;  2H8R A;  3SDG A;  5EYR A;  2FQ4 A;  3WHC A;  5FKL A;  5IP6 A;  4UUS A;  4A3I J;  2KDZ A;  1Y1W J;  3RQI A;  1S7E A;  5M5W J;  4FE4 A;  2E2H J;  1HDD C;  2O8K A;  4A69 C;  1A6I A;  2EZK A;  2HOA A;  4Y52 J;  2JWT A;  5HOD A;  1U9O A;  1GV5 A;  4BY7 J;  4AUX A;  1A5J A;  1DU0 A;  3BTC A;  2FJ1 A;  1ETW A;  2PMZ N;  4CYC A;  5FLV A;  3GTO J;  5E3O A;  1ITY A;  3MVP A; 
#chains in the Genus database with same CATH topology
 1JHH A;  5E79 C;  2DDA A;  2DJN A;  3N97 A;  2CQN A;  3MCZ A;  3BT9 A;  1V55 H;  3CP2 A;  3LQQ A;  5BS6 A;  3PFY A;  3R0A A;  3CMA I;  2JN6 A;  3OS0 A;  2JMW A;  2E2J J;  2MYS A;  2VXD A;  4OOI A;  2X6Y A;  1BR4 A;  4XN0 A;  5J8C A;  4XRS A;  3EET A;  3V8J A;  3D5S C;  3I0T A;  2HXI A;  5DV5 A;  5LBQ A;  4ESF A;  4BNC A;  1P6R A;  1YIO A;  4CZC A;  3I53 A;  3OSF A;  2YUS A;  3NEU A;  3AL0 C;  1SD4 A;  2NVU B;  2E34 A;  1V5F A;  1VND A;  3LSG A;  2IGN A;  2V6E A;  1I3A A;  3G3Z A;  4P55 A;  2OD5 A;  2E2I J;  3WE3 A;  2BBY A;  4XKB A;  1B1B A;  4BBR J;  2VQC A;  1VI0 A;  3QU3 A;  4P9F A;  5GPA A;  3GZ6 A;  3S1N J;  2EB7 A;  3ESW B;  4P9U A;  2IA0 A;  3FWE A;  2ME6 A;  3BWG A;  2CU7 A;  2XGX A;  3TGN A;  1R36 A;  1WWX A;  2EZL A;  1TW3 A;  1Z6R A;  5GAD J;  3LSH A;  2R5Z A;  1VQO I;  2ZXJ A;  3H92 A;  3WTZ A;  2EFN A;  2KMU A;  3CLQ A;  4AYB A;  3GCM A;  4F52 A;  5FD5 A;  4U0V A;  2X1D A;  3R0J A;  1B72 B;  3C18 A;  3ZQQ A;  2PJR A;  3I54 A;  2MH9 A;  2Y0M A;  2VN2 A;  1LFB A;  3BPX A;  3BR2 A;  3RTR A;  3PQK A;  4G6T B;  2HPI A;  2M9H A;  2X48 A;  3LSK A;  5GPC A;  3IP4 B;  2KIF A;  3T0Y A;  4L5J A;  3OYN A;  2LC2 A;  3AG3 H;  4M3E A;  3CMY A;  4D7N A;  2AHQ A;  3SEZ A;  3ZOB A;  3Q0V A;  2VON A;  2QWW A;  4M72 A;  1KU2 A;  4ZYA A;  1UHW A;  1ZR4 A;  4I02 A;  4CZZ A;  2Y75 A;  3FHN A;  2OTL I;  2EK5 A;  3L00 A;  3DFG A;  1BN5 A;  3GME A;  1MMN A;  1XTA A;  1WHU A;  2F2E A;  4ANJ A;  1A31 A;  1VQN I;  2IRF G;  2KRC A;  4A0Y A;  3B73 A;  1ZRC A;  2QQ9 A;  3M07 A;  1MJB A;  2KRH A;  1YRN B;  3SEQ A;  2K5C A;  4RGR A;  4S0H B;  2OF7 A;  3U9G A;  4PJM A;  4CCK A;  2H6C A;  3QP6 A;  1K78 A;  1DQU A;  2FE3 A;  3TOA A;  3SZT A;  1F5T A;  2JA5 J;  2CQK A;  1HCR A;  2EV0 A;  4DGW B;  2QBY A;  4HNU A;  2EFO A;  2LOO A;  4H4K C;  4EMS A;  5ILU A;  2IS1 A;  2HTJ A;  3T1B A;  1DPU A;  3IH3 A;  5HLH A;  4G12 A;  4UUS B;  1FSH A;  1E17 A;  1CF7 B;  3RYP A;  1KU7 A;  3J80 K;  4IHV A;  4A6E A;  3DBR B;  4MTE A;  1OKR A;  4FE7 A;  3EYY A;  4IJA A;  3GTQ J;  1T33 A;  4V19 K;  4KA4 A;  1BJZ A;  2CO5 A;  3KYC B;  1XSX A;  5M3M J;  1V5G A;  4N9H A;  3V4G A;  1JXS A;  3HRM A;  2WB1 A;  4OIP F;  3HZJ A;  4U7B A;  1SVM A;  2YSR A;  3IAM 2;  3QOP A;  4S05 A;  1E0E A;  2VT3 A;  1TL8 A;  5DM6 F;  4A0X A;  2VC0 A;  2IW5 A;  1PP7 U;  1TC3 C;  3OMY A;  2M0C A;  1O57 A;  2HEO A;  1FYM A;  2P5K A;  3OYG A;  2CW7 A;  2L7M P;  2ELH A;  4WXC A;  1B6A A;  3HIF A;  2K4B A;  4XRM A;  4U0Y A;  1I50 J;  1P7J A;  3A01 A;  5EG0 A;  3M3Y J;  2AXT C;  2Y0S N;  3L2V A;  1Y8R B;  3OYH A;  1WH5 A;  2KLO A;  2FD5 A;  3DWL E;  3DPL C;  4EJU A;  3TP0 A;  4RDU A;  1U8B A;  2L9V A;  1MMG A;  2DTZ A;  4FT8 A;  3G6E I;  3SXY A;  2OCC H;  3E5X A;  4HAM A;  5E20 A;  5JLX A;  3A02 A;  3QOE A;  1ETK A;  5B5E C;  4HX4 A;  2FU4 A;  2GA2 A;  4BHC A;  3OYL A;  1VQP I;  1LEB A;  2KPM A;  5FRN A;  4ENJ A;  2L5Q A;  3S3N A;  1FJL A;  3GYH X;  3V7S A;  4KIT B;  3C1D A;  1DDN A;  2BEO A;  5HNF A;  4IX7 A;  2PEX A;  5B1B H;  3M9A A;  2E5Z A;  4IHW A;  2FNA A;  3HHG A;  4X1E A;  2EA4 A;  3MQ0 A;  2HVQ A;  4IZZ A;  2BVL A;  1Y1V J;  1K83 J;  2V26 A;  1YG2 A;  1ZG3 A;  4AVP A;  2GWR A;  2E60 A;  1MNM C;  1SD7 A;  4OAY A;  2MSY A;  5FFZ A;  2VBZ A;  3CO6 C;  3JRB A;  4P5O A;  2DMP A;  4LLL A;  3A2K A;  2I10 A;  1OPC A;  2ZNY A;  1YI2 I;  4OMY A;  3KX2 A;  3P5J A;  4L5I A;  1MBE A;  5LGN A;  3PIP F;  2K85 A;  2RC4 A;  1W5S A;  3BG9 A;  2JSP A;  2IGO A;  2XPV A;  4Z6Y A;  2P7V B;  4AIH A;  4LG3 A;  1SMT A;  1J09 A;  2VQH A;  2CV0 A;  1IDZ A;  1TBX A;  1J2X A;  2EH3 A;  4AVZ A;  1IUF A;  4PJ0 C;  1JE8 A;  2X85 A;  2Z2S B;  2ZFW A;  1IN5 A;  5L3F A;  2K3P A;  3OWT A;  2L2O A;  4U7D A;  1UAA A;  4II2 A;  1BI1 A;  2LF7 A;  5KVR A;  3KE2 A;  2JUC A;  4CUG A;  1P92 A;  3FM3 A;  1FP1 D;  5FJ8 J;  5GTI C;  1W5T A;  3H35 A;  3PUF A;  1IRF A;  1DGW Y;  2HGC A;  3FIW A;  1KU9 A;  2CQQ A;  3CC7 I;  2DU9 A;  4MEY F;  4L5E A;  4UY8 I;  1ZQ3 P;  5IOY A;  2CGP A;  4MTD A;  1XGS A;  2DT5 A;  4RGS A;  3FBI B;  3HDD A;  3OYF A;  1FPQ A;  4BQO A;  2QGU A;  3ZN1 A;  3VWB A;  4G6D A;  4Y13 A;  3E5Q A;  3I4N J;  5K7F A;  1X4O A;  2XSD C;  2K3F A;  2Y69 H;  3KYD B;  2I5U A;  1K6Y A;  1I3Q J;  3OYI A;  2LTP A;  3BOQ A;  2L01 A;  1W0T A;  3FF5 A;  3FBN B;  1Z3Y A;  3LAJ A;  1X1B A;  3HTU A;  1R71 A;  3K4N A;  4M9X A;  4RLQ A;  3BR6 A;  1WJD A;  2IA2 A;  4KUM A;  1HQC A;  5TIS C;  1IN4 A;  1EH8 A;  1WI3 A;  4U88 A;  3K10 A;  2XAU A;  2EZI A;  3KZY A;  5JR3 A;  2JQ7 A;  4C2U A;  2L9R A;  4IQ4 A;  5F0F A;  3M7G A;  4WXH A;  4MEX F;  2M5W A;  1GXQ A;  2W25 A;  1R5G A;  3D0S A;  4XM3 A;  1OMI A;  1XDS A;  2ZME C;  2IS4 A;  2KHM A;  2A68 F;  5FKO A;  3L2U A;  3J7A O;  3E6B A;  4XOP A;  3FHZ A;  2KIQ A;  1FOY A;  3M8F A;  5TJJ A;  2EIL H;  2ACJ A;  3G1L A;  3TO6 A;  1GT0 C;  3ABL H;  2LY1 A;  4HA8 A;  4V2F A;  5BQT A;  3E97 A;  5E1Z B;  2XB0 X;  3GTK J;  1MNE A;  3I59 A;  2LF8 A;  3ZPL A;  4BKX A;  2PX9 A;  2XKO A;  3G4S I;  1MD0 A;  3GXO A;  3K4C A;  4AD9 A;  3DPU A;  3F23 A;  4LG0 B;  4EQQ A;  1Y8Q B;  1F9N A;  2EFP A;  2ZC2 A;  4EJV A;  1O7F A;  1AWC A;  1DPR A;  4RLF A;  4G7Z F;  5CPR B;  4AIJ A;  5D5X B;  1TNT A;  3WTY C;  1BW6 A;  4ZH4 F;  5F6F A;  3RZD J;  4HDU A;  3J81 K;  3ZGK A;  3K7A J;  1I6X A;  1IV8 A;  2HKO A;  5KK1 A;  2R7V A;  1Z0X A;  3CJN A;  3VFZ A;  1SFK A;  1FT9 A;  5K1Y A;  2M7B A;  3KZZ A;  3JRH A;  2V1U A;  1KQ8 A;  3F3X A;  2W82 A;  3F72 A;  1D0Y A;  3CTA A;  4KJZ A;  3K2A A;  2RRE A;  5ERI A;  1ZR2 A;  3ZQF A;  1HC8 A;  1V3F A;  2RNJ A;  4BBS J;  5C3E J;  3CMM A;  3REO A;  4A3L J;  4EJW A;  2M34 A;  2RAE A;  2NYX A;  2EPF A;  4OIR F;  3V8L A;  4JX6 A;  2O9L A;  2FNP A;  2NOJ B;  3GFJ A;  1GDT A;  3PO2 J;  2YX4 A;  3DBH B;  3L7W A;  5BOX A;  2KIU A;  4BHB A;  1ETV A;  1XGM A;  1FTZ A;  4MLO A;  2DA6 A;  4ETS A;  2XGD A;  1NK3 P;  5IYB J;  1VQ6 I;  4YFN F;  3LQR A;  2QQB A;  1D1B A;  3VDX A;  2LNB A;  1X2N A;  2ZME A;  3K2Z A;  3MZH A;  3IRR A;  4I01 A;  3H9Q A;  3H9J A;  1YFH A;  2DLL A;  5IYC J;  2VI6 A;  3D1N I;  4M6Y A;  2FA5 A;  1TNS A;  5L3D A;  2FXA A;  4OU0 A;  2P81 A;  3CCV I;  3TL4 X;  1V4R A;  1LEA A;  2K9M A;  3FX3 A;  3I64 A;  3IRQ A;  2A6H F;  3OYK A;  3TED A;  1MMD A;  2B0L A;  4A93 J;  1PP8 F;  2Z9O A;  4GRI A;  3LAP A;  2R93 J;  2PLY A;  2RGV A;  2GAU A;  1UHS A;  3NWT A;  2E1C A;  5H20 A;  1TLH B;  1SFU A;  2LVS A;  1R4N B;  3LSR A;  3CP8 A;  2VBW A;  3U21 A;  3H36 A;  2VKD A;  2ME0 A;  2P0W A;  1R9T J;  3OS1 A;  3JRA A;  1GHC A;  1OFC X;  1IDY A;  1PYV A;  1Z91 A;  2XGE A;  3DLA A;  4UB8 C;  3KYL A;  3K4J A;  5J4Y A;  5IP6 A;  4A3I J;  2KDZ A;  1XGO A;  3MKY B;  4QPQ A;  1BIA A;  3A0H C;  1ZRF A;  2CW8 A;  3OV8 A;  2JWT A;  1R1U A;  2JT1 A;  3ZQ7 A;  1U9O A;  2BOL A;  2RN7 A;  1GV5 A;  2IGK A;  4S04 A;  5CVJ A;  1A5J A;  2KZV A;  1DU0 A;  1UEL B;  3BTC A;  2FJ1 A;  2A6T A;  4CYC A;  5FLV A;  3G73 A;  5E3O A;  1ITY A;  3MVP A;  5JLW A;  4UVC A;  3P9C A;  3ULQ B;  2HQN A;  1A6Q A;  2R7X A;  3GZN B;  5HS7 A;  2VB6 A;  1QHH D;  2AQF A;  4M71 A;  3KP6 A;  1HST A;  3OSG A;  5D5V B;  2V4J C;  2W48 A;  3P9I A;  1IN6 A;  3CCS I;  1FSE A;  4M73 A;  3FXM A;  4F93 B;  2NS7 A;  3E0J B;  3RKY A;  1V54 H;  3K4K A;  1BJA A;  4BE2 A;  2BY2 A;  3GFL A;  1LNW A;  3LST A;  3OYA A;  2A5Y B;  4NQW A;  5DCM A;  3E6M A;  4A3B J;  3FKJ A;  4PFP A;  1H88 C;  4DZJ A;  4PJJ A;  4DOZ A;  1K4S A;  2DA3 A;  4HV6 A;  4EJT A;  4E6K G;  3HXL A;  2HU9 A;  5A2Q Z;  5M3F J;  1IJW C;  1WVR A;  1T56 A;  2LD5 A;  2DT6 A;  2Y9Y A;  2NS0 A;  5E1W A;  2VBX A;  2WV1 A;  5F27 A;  3EDP A;  2R7D A;  4O5V A;  1K4T A;  4IOC F;  2XC7 A;  2L54 A;  1ZGA A;  3GWZ A;  5HDN A;  1LJ9 A;  2HYJ A;  2V79 A;  1YJN I;  3O2P E;  1S72 I;  1HBX G;  1KYZ A;  5KAF C;  2XIG A;  1YS6 A;  1KQ0 A;  3ABK H;  3K4L A;  1X1P A;  2NOG A;  2L9S A;  1AHD P;  3HKZ N;  3ZQC A;  2K86 A;  4I98 B;  3TMO A;  4L9V A;  1G3T A;  3KP4 A;  3JSO A;  1W36 C;  3KIO A;  3I4P A;  2ID6 A;  3S93 A;  2XDV A;  1AKH B;  4MQ9 F;  4D7M A;  2QQA A;  4DBQ A;  2XPU A;  5D6F A;  3ZCO A;  2CFX A;  4WK8 F;  1U6G A;  4OWR B;  1FBQ A;  1FY7 A;  4I09 A;  5FKK A;  3JRF A;  2KZG A;  1W4M A;  3DU6 A;  1LB2 A;  1LDD A;  1XCV A;  1ZTR A;  2HYG D;  3ASO H;  3SHF A;  3L2W A;  3T8T A;  2L7F P;  2YU3 A;  1RKW A;  3S15 J;  3DPT A;  5ICE A;  3MKW B;  1R23 A;  1MSE C;  5K5O A;  4UUT A;  4XOR A;  2WY7 Q;  2L0K A;  2ZFU A;  5GP9 A;  3BQZ A;  1W7P A;  4DYC A;  2VLA A;  4Z2Y A;  2LG4 A;  1R6R A;  2KL4 A;  4LGW A;  3J7A Y;  3K1N A;  1STZ A;  3VOE A;  2DTR A;  4EM0 B;  3RYR A;  1WPK A;  4FTH A;  2H6B A;  2BW3 A;  2DCE A;  3MZY A;  1MGT A;  2UXX A;  2TDX A;  3HUG B;  4BY1 J;  2WAQ A;  5JHF A;  4MNU A;  1YLF A;  3Q9V A;  5E3L A;  2AS5 F;  3ZMD A;  1P4A A;  3BG6 A;  4HNT A;  2ZXI A;  2ZNZ A;  5L3G A;  1ZYR F;  3U1D A;  2ELJ A;  2HKX A;  4LIU A;  4O6J A;  4J19 A;  1D0Z A;  4PFO A;  1ETY A;  1XS9 A;  2STW A;  4NHJ A;  2QVO A;  3QYB A;  1TZL A;  4XLH A;  2NNN A;  3FXL A;  3JSP A;  4LLG F;  4U0W A;  3LL7 A;  2EIJ H;  2FMY A;  5AIQ A;  4A5M A;  3GX4 X;  1SD6 A;  3WHB A;  3PIO F;  4II3 A;  1P4X A;  4G94 A;  2P7C B;  1ZKG A;  1IG7 A;  4QTR A;  3CCM I;  4NC8 A;  1B8I B;  1AU7 A;  4NC7 A;  1LQ1 A;  4HEA 2;  5GTH C;  5KHD A;  1E2X A;  2XRL A;  3QQA A;  1JUM A;  3H1C A;  5J47 A;  5LHH A;  2A3S A;  3IHU A;  4ESJ A;  3RI4 A;  3GW2 A;  2Y48 A;  3DV8 A;  3HGG A;  5BPD A;  1T08 B;  2FRH A;  2A61 A;  2ESN A;  3KLN A;  4WF2 A;  4B4C A;  3KFW X;  2JA2 A;  3V7R A;  2GLO A;  4P96 A;  2W7N A;  3ASN H;  2JRM A;  1XMA A;  4HQM A;  5E3M A;  2DA5 A;  2R0Q C;  1RR8 C;  2GIZ A;  2QSG X;  3AG4 H;  4HDV A;  2OPT A;  3FXK A;  4C30 A;  3EUA A;  1H9T A;  1TWC J;  4QWQ A;  5GAG J;  5B66 C;  3OS2 A;  2M30 A;  3MKL A;  2D2W A;  2GXG A;  1P4W A;  4LIV A;  3JR9 A;  2PMZ A;  1PUE E;  2ZJ2 A;  2R7Q A;  4M6V A;  4ZYE A;  2LH9 A;  4JX4 A;  3OYB A;  2XSJ C;  4BQQ A;  5F0C A;  1N78 A;  4EM2 A;  4EGY A;  3KEY A;  5IP7 J;  2CUZ A;  5IT9 K;  2XAQ A;  3IC7 A;  2GOX B;  2R7W A;  1KA8 A;  4BAY A;  2VKV A;  5LLQ A;  1PUF A;  3L09 A;  4BQN A;  1R1V A;  5F64 A;  4A3J J;  4EM1 A;  3PUB A;  4PJN A;  2ELK A;  2VQL A;  1WQ2 A;  3ZQI A;  2VOP A;  1BOB A;  3CME I;  4KDP A;  5DTD A;  3MMY B;  3M8E A;  4B3A A;  2XRO A;  1FZP B;  3AKZ A;  5K7H A;  2NVQ J;  3ELK A;  1BI0 A;  5C4X J;  1IO2 A;  2VJ4 A;  2M87 A;  2QA4 I;  3ZQL A;  2KP6 A;  3C7J A;  2E7X A;  2B7E A;  1QZZ A;  1ENH A;  2M45 A;  3TO9 A;  3DTI A;  1GVJ A;  2LBF A;  1CGP A;  3S1Q J;  1IXR C;  3ML6 A;  1G4D A;  1SAN A;  4E7Z A;  4XSX F;  1ETQ A;  1R1T A;  3VYR B;  1X19 A;  5E18 F;  3OIQ A;  3S14 J;  2Z1D A;  4RM2 A;  3AL0 B;  5FLX K;  1J75 A;  4RS8 A;  2JPC A;  1K78 B;  1S8N A;  2M8G X;  3B6C A;  3PL8 A;  1YE9 A;  5CYV A;  4ENM A;  2F5C A;  3S16 J;  1EH6 A;  2L7Z A;  1IAW A;  5KCM A;  4G9Y A;  1BIB A;  1D1C A;  3FXQ A;  4XID A;  5M5X J;  1WGX A;  1IW7 F;  1Z3X A;  2QBY B;  4IHT A;  3NWS A;  4A5N A;  1QVT A;  2J5P A;  3I4M J;  5JVG F;  1FWZ A;  4J01 A;  1DGR M;  4XNF A;  3JW4 A;  2CSO A;  4BE1 A;  1CQT A;  2VUM J;  2FEZ A;  3FDY A;  4MGR A;  4F92 B;  2X6O A;  3D5R C;  5LRR A;  5FLM J;  2WA0 A;  2DFH A;  4ZZD A;  1S5L C;  3X2Q H;  1T0F C;  4L0Y B;  1PVE A;  4UVA A;  3Q9S A;  2F4O B;  2VKH A;  4BGD A;  2IT0 A;  2PJP A;  4BE0 A;  1X3U A;  5EGO B;  4Q48 A;  3FMQ A;  1B9M A;  2E19 A;  3CD6 I;  2L9N A;  3HPH A;  5F08 A;  1CF7 A;  5FB2 A;  1BI2 A;  1YO5 C;  3SZG A;  3HOT A;  1JGG A;  4FCY A;  2DOD A;  3A01 B;  5EG0 B;  2A07 F;  4XLP F;  2DW4 A;  4XKW A;  1TQP A;  4D0P A;  1ETX A;  4IHS A;  3PNV A;  3W6V A;  2CG4 A;  1HDP A;  1K7A A;  2BZT A;  2M7A A;  3PJR A;  2VJ5 A;  1JJ8 C;  4XKC A;  1Z6T A;  1RRJ A;  2NVT J;  4CCN A;  4IOA F;  2DO7 A;  2OJE D;  4C2T A;  2LLK A;  3HOX J;  3P9K A;  3DU5 A;  1MBH A;  1K61 A;  2GM4 A;  5DUI A;  1D8J A;  2X6X A;  4I7H A;  1RI7 A;  3RKQ A;  2KT0 A;  2WTE A;  2X4H A;  2Z16 A;  4AYB N;  1I1G A;  4YIR X;  4X0G A;  1ERD A;  3W2A A;  3RZO J;  1SMY F;  3H5A A;  4A3F J;  1UZC A;  3TW6 A;  1HW2 A;  4KN7 X;  1G3Y A;  1IRG A;  4CA0 A;  5B3S H;  2DJI A;  3DP7 A;  2JPB A;  2V1N A;  1G3W A;  1RR7 A;  4HYE A;  1VQL I;  3E6C C;  2OU2 A;  3A1Y A;  5HDK A;  3ERM A;  3GTJ J;  2PBI A;  1C0W A;  3FZV A;  3V8K A;  4HPQ A;  4IRG A;  1MIJ A;  1N25 A;  3GZ5 A;  1O7L A;  2XVC A;  3F8M A;  1T0F A;  2ZJR F;  2YU9 J;  5J1U A;  4LK1 F;  3WE2 A;  1RNL A;  4RA2 A;  3OYM A;  4HNV A;  2A6E F;  1QA6 A;  5D6E A;  3F0C A;  3GF2 A;  3K6G A;  1DUX C;  4A12 A;  1MBF A;  2ZXH A;  4DYR A;  4A2U A;  3QP5 A;  4NUB A;  4KIS A;  4B8X A;  1E3H A;  3JRC A;  5LHI A;  4LB6 B;  1A36 A;  2LKP A;  2HZT A;  1J9I A;  2DK8 A;  3VB2 A;  1WJ5 A;  1ZK8 A;  3PNT A;  1QZY A;  4LMY A;  2M1B A;  4GDF A;  4OIO F;  1VQ5 I;  1JTY A;  2OV7 A;  3E7L A;  2YPR A;  4BUP A;  5M5Y J;  1Y56 A;  3G71 I;  2DYS H;  2O3F A;  2HZD A;  1YIJ I;  4F55 A;  3O3K A;  1X4P A;  2KIM A;  2KKO A;  5ICG A;  4M3F A;  1Z77 A;  3SFI A;  4ZYG A;  3J7Z I;  1FBS A;  1WJF A;  9ANT A;  1UJ8 A;  4MIM A;  4B47 A;  4KMU X;  4HSR A;  3BR1 A;  2E71 A;  1O4X A;  3BC8 A;  4HOB A;  5EZH A;  1R22 A;  3OR1 C;  4HG2 A;  1J0R A;  4ZTF A;  2Z3Y A;  2ZXW H;  3G1O A;  3OIO A;  1ZLJ A;  5E8G A;  4A0Z A;  3JRD A;  2J5O A;  3TDU C;  5EEH A;  2F5D A;  3TDZ C;  3VYT B;  1G2H A;  2WB1 N;  5KNL A;  1OR7 C;  2HWV A;  1BR2 A;  4UHT A;  3JRE A;  3F9K A;  2BY1 A;  3L2C A;  2EQR A;  1RES A;  1X2M A;  3JAM Z;  3GFI A;  4CCO A;  5J6X A;  1FP2 A;  2LP0 A;  2P4W A;  3BZK A;  5IYD J;  1YOV B;  3S32 A;  4I0B A;  4IKF A;  2EWN A;  1R49 A;  4I6Z A;  1UG2 A;  1YW9 A;  3ERE D;  3K1P A;  4BEH A;  3CES A;  4LD5 A;  1QVU A;  2IS2 A;  1W0U A;  4OIN F;  1OIS A;  3HL2 A;  2H8R A;  5EYR A;  3S3M A;  3WHC A;  3HJE A;  3RIR A;  4IVN A;  3VSK A;  1L3L A;  1E3P A;  3JCU C;  3FXU A;  4ENN A;  3BLY A;  3WGH A;  3DTK A;  4BJ5 C;  2EV5 A;  2X1C A;  1Y1W J;  4FE4 A;  2E2H J;  1HDD C;  4A69 C;  4KMF A;  2KQR A;  1A6I A;  3BJA A;  4Y3O A;  4IL6 C;  4E7J A;  1XN7 A;  4L9N A;  3PSF A;  4XLA A;  3RDI A;  1G8X A;  4EAT A;  1TTY A;  1WJC A;  2O0Y A;  2ISY A;  4RAZ A;  1XD7 A;  1O3Q A;  1OCC H;  4HST A;  4IPA A;  2RQP A;  5CQG A;  3OYE A;  3GTO J;  2DQL A;  1VQ9 I;  4PCQ A;  2F6C A;  4HF2 A;  4EV0 A;  5ICF A;  1IN8 A;  3BG3 A;  5L3B A;  5JI6 A;  1QU3 A;  3HRU A;  4V2G A;  1YTY A;  4PDK A;  2LRE A;  3MKZ A;  1UHM A;  3EYI A;  1YX3 A;  4B3X A;  1U5T C;  3V7C A;  2W84 A;  3DQV C;  2BHZ A;  5CVR A;  1H9G A;  1S7A A;  1IUY A;  1SAU A;  1R5H A;  1JTX A;  3IWZ A;  1GXP A;  3CUQ C;  2A5W A;  3M1C A;  1JGS A;  4C3J J;  4KIG A;  4RMN A;  2UZK A;  3S2D J;  1Y0N A;  2VL8 A;  3U1K A;  2O03 A;  4C9Y A;  2D5V A;  1ZLK A;  2QSH X;  2DOA A;  2ZJP F;  1LVA A;  2G7H A;  3A4C A;  2R7T A;  3HSR A;  2W1O A;  2Z33 A;  2BY0 A;  1KGS A;  3S3O A;  1OR7 A;  4E4H A;  1YJ9 I;  3I3L A;  4TV7 A;  3HBL A;  4UV8 A;  4NDL A;  2CH0 A;  3C3W A;  3GTM J;  3K0L A;  3CCQ I;  3H9G A;  4XLF A;  3W3C A;  5D8L B;  4LG0 A;  4YEL A;  1Y39 A;  1OLT A;  3S2W A;  1MDM B;  5EJC A;  1F36 A;  4AWX B;  5HLT A;  3KP2 A;  3HSE A;  1VQ8 I;  4DYQ A;  3K9T A;  1FOX A;  2ZCW A;  3RSN A;  2ZBK A;  5J8F A;  1H8A C;  3DXJ F;  3PSI A;  1JT0 A;  3HOZ J;  1R58 A;  3ZMZ A;  3BG7 A;  3BDD A;  2FX0 A;  3OL4 A;  1ETO A;  3MZ8 A;  1HSJ A;  4GYI A;  1OYW A;  1BOA A;  2WV0 A;  2K7L A;  1JUS A;  5H2F C;  2RDP A;  4Q47 A;  3WU2 C;  4RGX A;  4GFB A;  4JP0 A;  4E70 A;  2EIN H;  1JI8 A;  1MJA A;  2MLG A;  5DS9 A;  2ZME B;  2OCE A;  5ILS A;  2AO9 A;  2H94 A;  4C3I J;  5IY5 H;  2DQR A;  1ODD A;  1BR1 A;  4KYW A;  5DD4 A;  1T98 A;  2IPQ X;  1JKQ C;  2H1L A;  1N75 A;  2K4J A;  1JT6 A;  3CUO A;  2DA2 A;  1Y0U A;  3I58 A;  2M8E A;  1U5T A;  3KP5 A;  4B48 A;  4ENK A;  3E1S A;  2ZKZ A;  1GV2 A;  4UXN A;  4B09 A;  3CUQ A;  2K9Q A;  4H0E A;  2KJB A;  2Q2E A;  3IH4 A;  5TGT A;  4XK4 A;  3NRV A;  2G0E A;  2ZB9 A;  2NVY J;  4ITV A;  2K9L A;  3F8N A;  2R7R A;  2VKE A;  2GXB A;  2JA7 J;  3R61 A;  4E7K A;  4WXD A;  4KIF A;  2PMH A;  3N4M A;  1APL C;  2OA4 A;  2V1X A;  4HX8 A;  4BJ6 C;  3CCU I;  3S1M J;  1DP3 A;  2IBD A;  2UV1 A;  3SDB A;  2QF7 A;  1TWG J;  1MBK A;  5D4S A;  2P5L C;  1R7J A;  3MWM A;  4R8H A;  2M4G A;  3C2B A;  3SZP A;  1YW8 A;  2VAS A;  5CVI A;  1E3O C;  4QSH A;  1W7P D;  2LKX A;  1RET A;  3IH2 A;  3L2Q A;  2HNH A;  1ON1 A;  2O61 A;  3G1M A;  1ORK A;  4HX7 A;  3UNG C;  1BL0 A;  3AG1 H;  2DFF A;  4IEJ A;  2V1D A;  3SQN A;  4CYC B;  1RPW A;  4BXX J;  2EIM H;  2XAJ A;  2JK3 A;  2CJJ A;  1J59 A;  1NHA A;  2O5R A;  4N4N B;  3VPR A;  3RJP A;  4ZDO A;  3JRI A;  4L9J A;  2M4K A;  3K70 D;  3R6S A;  3K69 A;  4J00 A;  4BDZ A;  2VQG A;  4KN4 X;  2VPL A;  5HLG A;  2WAF A;  3AG2 H;  1BA5 A;  1LFP A;  2NNY A;  1VTN C;  1Z1D A;  1D5Y A;  3DLL F;  1MKM A;  4IXA A;  1XCB A;  4XMY A;  2K9N A;  4DZP A;  2FOK A;  2L3D A;  4BXF A;  1LE8 A;  1YIT I;  1QO0 D;  5EF6 A;  4LB5 A;  1EF4 A;  4NQW B;  5K5Q A;  1U78 A;  3DEW A;  3BR5 A;  1ZAR A;  4L9T A;  3D5L A;  3K70 C;  2I8D A;  2ADU A;  1G3S A;  2EJR A;  3HM5 A;  5IT9 Z;  2LYC A;  1TQM A;  2HFH A;  1W36 D;  1Z7U A;  2MC3 A;  1EA3 A;  5GAH J;  2DMU A;  3JTG A;  1IRX A;  4Q5S F;  2P5V A;  2FBK A;  3AFH A;  1XX5 A;  2E1M C;  1WSU A;  2FF4 A;  2GA1 A;  3QAH A;  5HOO A;  2HXO A;  4XR6 A;  3HG9 A;  4BAC A;  2M0M A;  5IP9 J;  3B02 A;  3GLX A;  4PK4 A;  5HS9 A;  2XV4 S;  1LKX A;  2QUF A;  2RVC A;  2W57 A;  2MC4 A;  4DQ2 A;  1FOW A;  2R5Y B;  4YFK F;  3DEE A;  1S3J A;  3HOW J;  3H3V K;  3OOP A;  2HR3 A;  4KT6 A;  1ZHF A;  2A69 F;  3Q3S A;  4RAG A;  1HKQ A;  1HXD A;  3FMS A;  2DN0 A;  3LSM A;  3KET A;  1T38 A;  2G9W A;  4P1W A;  3ZQG A;  1VFC A;  3EUH C;  4IRH A;  2W4S A;  2DPU A;  3OOU A;  3GTP J;  1U8R A;  1SFO J;  2YR2 A;  5D8K B;  2DA7 A;  2P6S A;  3RKX A;  3LNQ A;  3LWF A;  4LIT A;  5FLX Z;  5IPA A;  2JTV A;  4RAF A;  2YX7 A;  4A3D J;  2KRF A;  5H6R A;  1J5Y A;  5C4J J;  4AIK A;  4MO7 A;  3W2W A;  5J1R A;  5LEJ A;  1IF1 A;  1FYK A;  2L02 A;  5LFA A;  2XGC A;  3RKW A;  3OIP A;  3IWF A;  4PJL A;  5HVQ C;  2BW3 B;  1X3W B;  3BG5 A;  3QPS A;  4XRS G;  3CC2 I;  5F1J A;  1USS A;  3OY9 A;  1MH3 A;  3ONQ A;  2MAB A;  3O8G A;  3JTH A;  5ILV A;  1AA7 A;  1I6H J;  3RCO A;  4E7L A;  3GO5 A;  4KIC A;  1REP C;  1VQ4 I;  4ZYH A;  3J80 Z;  4GO1 A;  2R7F A;  3O6B B;  2XHK A;  4CXF A;  3WTV C;  3OYD A;  5EEA A;  2EFW A;  5BMZ A;  1FLI A;  2O7O A;  3TO7 A;  2H27 A;  1U2W A;  1YHQ I;  1MSF C;  2L4M A;  3GLL A;  3CCY A;  2IXS A;  4PZJ A;  3UR3 C;  1MW7 A;  1RUN A;  1ON2 A;  4FX4 A;  1LFU P;  3QYE A;  4M9Z A;  2GQQ A;  4FAS D;  4FIS A;  3BQY A;  4A3G J;  3OYJ A;  1FIA A;  2IJL A;  3HUG A;  4UUV A;  4M3B A;  3B6A A;  4XLN F;  1F4K A;  4LLN A;  2ISZ A;  5DUK A;  1I5Z A;  2HDD A;  1RKT A;  2H09 A;  1XPX A;  1IXS B;  3WU0 A;  2VIX A;  2CMP A;  4CDG A;  3S8P A;  1O3R A;  3ZP5 A;  1ZH5 A;  3FXJ A;  3EUH A;  2E1N A;  1B59 A;  1P2F A;  3CJT B;  3BTJ A;  2KFD A;  3ROU A;  3CF5 F;  3BCB A;  3LOC A;  1QPM A;  3W6K B;  4XN3 A;  3WOD F;  5D5U B;  3CJQ B;  2N8G A;  3WU1 B;  1HF0 A;  4A3C J;  4RB1 A;  1WCM J;  2JJ7 A;  2VT2 A;  2VOD A;  2BXZ A;  3HOU J;  3EQL F;  1B8I A;  2HYF A;  4RGU A;  1TQI A;  2RNG A;  4CGZ A;  1AOY A;  1HKT A;  3H0G J;  2K02 A;  5K7Z A;  4ABZ A;  2Y30 A;  4YG2 F;  2JA6 J;  1YQA A;  2VOO A;  1WH7 A;  1Y6I A;  5EDN A;  2HQR A;  4A3E J;  3DF8 A;  2DOE A;  3EUK L;  3OR2 C;  4QPO A;  3M1E A;  2R7O A;  4YFX F;  4ZYD A;  4BDY A;  4MFE A;  2R5Z B;  2HVS A;  2RKH A;  2R7S A;  3QYF A;  1UG0 A;  3BZC A;  4N4O B;  5IT3 A;  1YYV A;  2Y0S A;  1X3Z B;  3IUO A;  4PUS A;  3F22 A;  1IC8 A;  3HB9 A;  1PUF B;  5F0H A;  1D5V A;  3QWL A;  2ID3 A;  1J7K A;  2PJR B;  1JHF A;  2OZ6 A;  1TT5 B;  4B1R A;  3GUD A;  2XAG A;  1NTC A;  2NS8 A;  3H5N A;  2JSC A;  4O3M A;  3ECH A;  1BBY A;  1JKO C;  1T95 A;  1IV6 A;  2FQ3 A;  2JZY A;  3I9V 2;  3F21 A;  1H89 C;  1EV7 A;  1S7O A;  3IAS 2;  3HOY J;  1ZRE A;  4XSZ F;  2ESH A;  3F6V A;  4Y15 A;  5FKN A;  5A2Q K;  3MFK A;  1TT0 A;  2CQX A;  4DW6 A;  3QU6 A;  2A05 A;  1KQ9 A;  2XF5 A;  4L18 B;  2XAF A;  1D1A A;  2LBF B;  2B9S A;  4L0Z B;  4E7I A;  4DJA A;  1SFE A;  3TOB A;  3H3Z A;  5DM7 F;  1B72 A;  3HTS B;  5DDG A;  1TW2 A;  2KIS A;  4HF0 A;  2ZJQ F;  5JVT A;  1SEU A;  3ISP A;  2E1O A;  2WAQ N;  3DKW A;  1TWH J;  2AQE A;  2IP2 A;  5JFR A;  2FML A;  5LD2 C;  3VOD A;  3P7N A;  1QNT A;  2EA2 A;  4ZTJ A;  2WC2 A;  3HOV J;  1R00 A;  3FXR A;  1ONV A;  2FBH A;  1KU3 A;  1PDN C;  2BVM A;  2HQA A;  1UST A;  2CS3 A;  1KZH A;  4ZJZ A;  1QGP A;  5H6Q A;  3CF2 A;  5E8I A;  4QIW N;  4IRI A;  4IHY A;  1XC5 A;  4E7H A;  2X9D A;  2EV6 A;  1YRN A;  4I99 C;  3BTI A;  4X6A J;  2XAH A;  2V6C A;  1WJA A;  1EKE A;  1ZGJ A;  4UVB A;  1RIO H;  4A6D A;  2D1H A;  2QZ8 A;  1A35 A;  2MGQ A;  1QQI A;  5L3E A;  2NAZ A;  1HA8 A;  5FKM A;  1DU6 A;  2F5F A;  2Y31 A;  2QQ8 A;  1TP4 A;  1LUJ B;  2Y9Z A;  3CCE I;  3SDG A;  1G59 A;  2FQ4 A;  4UUS A;  2R7U A;  2IS6 A;  3H0D A;  6PAX A;  4GCV A;  1Z7L A;  2UUZ A;  5M5W J;  4G7O F;  5E1X A;  2QYO A;  4Y52 J;  4N0B A;  5D5W B;  1Z05 A;  4BH9 A;  2EIK H;  4HF1 A;  2DFI A;  4G6Q A;  4BU2 A;  1B4A A;  1XMK A;  4XQF A;  1ZRD A;  3CCJ I;  2X6W A;  4B44 A;  3J7Y J;  4NC6 A;  2NRA C;  4EVI A;  1T8I A;  4YRV A;  4HRI A;  1ETW A;  1Z67 A;  2PMZ N;  3RPQ A;  5EGO A;  2NXN B;  2KDO A;  4YII A;  2PN6 A;  2R3S A;  2W85 A;  3GBG A;  3H5R A;  1X1D A;  4Y7N J;  2BXY A;  2IA1 A;  4BJT A;  2OBP A;  5AON A;  2EBI A;  2WY8 Q;  2LR8 A;  5EEG A;  2HPM A;  1MMA A;  2PG4 A;  1OCZ H;  3BR3 A;  3GFM A;  3PO3 J;  3J81 Z;  1X58 A;  1UCR A;  2DYR H;  4UB6 C;  5J1Y A;  3AAF A;  2XKP A;  2JRT A;  3T5X A;  2CW0 F;  3LSI A;  4BYY A;  3BTL A;  4E7S A;  3HEF A;  4HLY A;  2BGC A;  2HOT A;  3OL3 A;  3ABU A;  4CYD A;  5CQE A;  4HV5 A;  1P9Q C;  3RQ4 A;  3SFZ A;  3BPV A;  4ZZL A;  2FBI A;  2FOW A;  4IO9 F;  3HHH A;  2FSW A;  1WKM A;  2LY9 A;  1FMV A;  2DA1 A;  4JK1 X;  1BM9 A;  4LJZ F;  5HDG A;  2NVX J;  2F48 A;  3TP3 A;  4BL0 B;  4RBO A;  1QRY A;  4RB2 C;  1MBJ A;  4W97 A;  2HOS A;  2PQ8 A;  1XB4 A;  2F5V A;  1FNN A;  3MAJ A;  1UMQ A;  2DMT A;  2Y2Z A;  3VSL A;  2WBM A;  2IVM A;  4N9I A;  5JHU A;  3COA C;  3R60 A;  4CO8 A;  2DK5 A;  2MW8 A;  3S1R J;  3FIS A;  2LKS A;  1GUU A;  3LFK A;  3LA3 A;  4PSX A;  5CVU A;  2ECB A;  4RB3 C;  3A03 A;  3I5U A;  2GXA A;  3BCA A;  4XBF A;  4M74 A;  2OQG A;  1JJ6 C;  4M3D A;  2DA4 A;  2DMN A;  5J3L A;  3NAU A;  4D1Q A;  5CLS A;  2OTJ I;  2F4I A;  2V9K A;  4WWC A;  1EJ9 A;  3BZ6 A;  2G7U A;  3WGI A;  1S6L A;  4JOM A;  2WAE A;  1XG1 A;  4IQJ A;  1F1Z A;  3GTL J;  5ED4 A;  4XKV A;  2CUF A;  2Q8K A;  3SYT A;  2COM A;  5J4V A;  2R7Z J;  5HLI A;  4CCM A;  1BW5 A;  5HNH A;  3Q0U A;  1K79 A;  2VE8 A;  2DDB A;  1LDK B;  2VPR A;  3BY6 A;  2EFQ A;  4AM3 A;  3FM5 A;  3PNY A;  1NG6 A;  2QKL B;  3M4O J;  2MBF A;  2M3A A;  2XAS A;  2ZO4 A;  4HZF A;  3BJ6 A;  1YW7 A;  3IV5 A;  5D4R A;  3O8H A;  3ZMU A;  4EJO A;  4A3M J;  1TWA J;  4RM3 A;  1P7I A;  2BHY A;  3G2B A;  4RB0 A;  2O6G E;  2OQR A;  2VBY A;  2XRN A;  2K40 A;  3I55 I;  3CCL I;  4KFC A;  1SVO A;  1IZ1 A;  3HGY A;  4LK0 F;  1SC7 A;  2RQQ A;  1NK2 P;  1ZN2 A;  2LY2 A;  2TCT A;  2TRT A;  3KLO A;  1X1A A;  1JKR C;  4LOC A;  3ZMV A;  5FD6 A;  3HC7 A;  4FQG A;  4GXO A;  3PM1 A;  3VEP A;  4XOT A;  2X0L A;  4PGG A;  1QPI A;  2HDC A;  1WRJ A;  3CC4 I;  4HLX A;  1V5E A;  1YX5 A;  2Z99 A;  4BEH B;  3HSF A;  3CQZ J;  2E7W A;  2X51 A;  4ESB A;  1FEX A;  1W1W E;  3CLO A;  3ZXS A;  2PFB A;  4FHT A;  2GBY A;  4MQV A;  1GVD A;  2WWY A;  1RZ4 A;  2DBB A;  1TWF J;  4UNO A;  3KEQ A;  1ULY A;  3F6O A;  4HQE A;  2AXL A;  3E3V A;  2LMD A;  1F43 A;  1N77 A;  2XF6 A;  4B43 A;  1OCP A;  1R5I D;  3KZI C;  4CH7 A;  5LGT A;  5FO5 A;  5F1R A;  4C2M J;  1HW5 A;  4JQF A;  2XB5 A;  4KIB A;  3ECO A;  3LFU A;  5F04 A;  1VF9 A;  4NNJ A;  3IL2 A;  5GAE J;  5LHG A;  3TW7 A;  4D5C A;  5FRM A;  1MJ9 A;  4BS9 A;  5E17 F;  1IRZ A;  1ZEL A;  3W2V A;  5FFX A;  3ZR8 X;  4Y33 A;  2HDW A;  3MD2 A;  2H8W A;  3I59 B;  1OYY A;  3MEX A;  1IXC A;  4GGG A;  4OMZ A;  3LSJ A;  2OUM A;  3A0B C;  2BY3 A;  4PSW A;  2E36 A;  4I2O A;  3OYC A;  2QSF X;  1HKS A;  1R4M B;  4NBQ A;  1FX7 A;  1UB9 A;  3WG9 A;  3ZMS A;  5EZG A;  4ON0 A;  5FRO A;  1WZ2 A;  2COB A;  4NB5 A;  1FBU A;  3K4B A;  4R1H A;  1XMX A;  2MD0 A;  4XLC A;  2DAO A;  1U0J A;  3ZQH A;  1Q1H A;  3ABT A;  1WI9 A;  4XRF A;  4M6X A;  4DBR A;  2HI3 A;  1LDJ A;  1SFX A;  2CUE A;  2IAI A;  3KCC A;  1OCR H;  3BR0 A;  1B9N A;  1XSD A;  4OIQ F;  1NH3 A;  3FKI J;  2P8T A;  3DCF A;  3WTT C;  1Z21 A;  2QEX I;  1HW1 A;  1KYW A;  3FXO A;  2DT7 B;  1SVL A;  2VJI A;  1T39 A;  1QHG A;  1T6S A;  3I71 A;  4CCJ A;  1XSV A;  2VJJ A;  3IKV A;  2WAD A;  3U2R A;  2M2E A;  3M8J A;  2MLK A;  2GZW A;  1MMS A;  2QLZ A;  2IGM A;  1MDM A;  1IGN A;  4IHX A;  2LRD A;  1I27 A;  3KPH A;  3Q0W A;  4JBA A;  4RAY A;  1BI3 A;  2OZU A;  3C2G A;  4MFD A;  4PGH A;  1BC7 C;  2DMQ A;  2KJC A;  3FMR A;  4K2E A;  1U5T B;  2HOE A;  3E5U A;  2K9S A;  3LMM A;  1T2K A;  4M9S A;  1JUP A;  3GEZ A;  4U87 A;  2JA8 J;  3CUQ B;  3FK7 A;  2ECC A;  2ZSH B;  4AC0 A;  3HKZ A;  4BQA A;  4EGZ A;  4ZDL A;  4HBL A;  2Q2E B;  2LSO A;  2PI0 A;  2CV1 A;  2X1E A;  3S2H J;  3E6D A;  4M3G A;  3BRO A;  2HQ5 A;  4ZDP A;  3HPG A;  3PQJ A;  4BXU A;  1WJB A;  1FYL A;  2Q1Z B;  1BC8 C;  1YS7 A;  3MN2 A;  4I76 A;  3WGG A;  2D1V A;  2MH2 A;  1EH7 A;  2IEK A;  3CO7 C;  4BHP A;  3QPT A;  1OJL A;  2Q0O A;  1Q1V A;  4A3K J;  4F7Z A;  2B63 J;  3L9F A;  4DIQ A;  2OC6 A;  4KT5 C;  5LEK A;  2Z5U A;  3KP7 A;  4WX9 A;  3CDL A;  1O3S A;  5K5R A;  2GIV A;  3L2R A;  3HYI A;  4FX0 A;  3F8F A;  1ACI A;  2UXN A;  3FK6 A;  3JAM K;  3V42 A;  4AU7 A;  3HOS A;  2XPW A;  5B1A H;  4F91 B;  4YIF A;  2UWM A;  2P6T A;  3WTX C;  2D45 A;  3C2H A;  4MHG A;  5KAI C;  3GTG J;  1ZAO A;  5BNG A;  1L0O C;  2K27 A;  5DD8 A;  4XIC A;  1FIP A;  5CKT A;  2L4A A;  1HOM A;  1KON A;  3CDI A;  3RPU D;  1WFX A;  5LRS A;  2LDU A;  4JYK A;  4JX5 A;  4ZC3 A;  1K6O A;  3EPZ A;  3H3U A;  1LE8 B;  2F5E A;  4HW0 A;  2ETH A;  2JUG A;  1UFM A;  2JVG A;  3LA7 A;  1ZG1 A;  3HRT A;  1M1E B;  4EEF G;  1PJR A;  5DCM B;  1DP7 P;  5J40 A;  1MBG A;  1MH4 A;  3IKT A;  3WTW C;  1OYI A;  2O8X A;  1OCT C;  2BE5 F;  5HS8 A;  2L7K A;  3LA2 A;  2ICW G;  3NAR A;  3ABM H;  2DXI A;  2E35 A;  3DKY A;  3QPL A;  2BV6 A;  2MD5 A;  3QOD A;  1ZG5 A;  3TQN A;  2MG4 A;  3GVA A;  1A04 A;  4D9J A;  1D8K A;  4KNY A;  4QLC U;  1POG A;  3CCR I;  2W00 A;  4XON A;  1I1S A;  3WTU C;  5CVV A;  3ZRG A;  5ICC A;  1U9N A;  3N05 A;  1IN7 A;  1JKP C;  4WCG A;  1FOK A;  3DEU A;  2HVR A;  1FTT A;  5FGM A;  1SD5 A;  5L3C A;  1X1C A;  3L1P A;  1MZB A;  3SJM A;  2GOM A;  3F8B A;  3WTS C;  2W24 A;  3VYU B;  5E3N A;  3BP8 A;  3K4M A;  1HLV A;  1XGN A;  2VXZ A;  4CIC A;  1OQY A;  2R92 J;  2QEN A;  2MFZ A;  5LGU A;  1ZGW A;  2RV8 A;  1FMW A;  2HTS A;  2CUJ A;  1U3E M;  1S29 A;  4ASN A;  2R5Y A;  2DFE A;  2EZH A;  2F4M B;  1W7P B;  1YJW I;  3UKG A;  1QBJ A;  3I56 I;  1VZ0 A;  1VQK I;  3QRF F;  5IOZ A;  5BPI A;  2DPD A;  3F8C A;  3KEO A;  3LSP A;  2HS5 A;  3T8R A;  2QM3 A;  4CSW A;  2DOF A;  1AKH A;  1QZE A;  4I0A A;  1LVK A;  5TRD A;  4Q4Z F;  2CQ7 A;  4G8X A;  2H1K A;  4Y4R A;  4UV9 A;  1RUO A;  2MA3 A;  1NG7 A;  4CCL A;  2VC1 A;  5DYM A;  3CDH A;  2CV2 A;  2V9P A;  1D0X A;  5CJ9 A;  2YS9 A;  3QPH A;  5C44 J;  3S17 J;  4R79 A;  2PMU A;  3DTE A;  2QCO A;  3CZ6 A;  3W6J B;  3WG7 H;  3DKX A;  1LPQ A;  1I39 A;  4D5F A;  1H0M A;  2STT A;  1RC9 A;  2XF7 A;  2E1M B;  4DNC A;  2LFB A;  3RPU A;  3R4K A;  2V9V A;  2CFO A;  4Y17 A;  4C3H J;  4G7H F;  3VYS B;  3BJO A;  3JRG A;  2VE9 A;  3Q5F A;  1G6N A;  3HRS A;  4OAZ A;  3NQO A;  1SAX A;  4W1U A;  4XL9 A;  5DCF A;  5AIP A;  1VQ7 I;  2CYY A;  2CRG A;  1W5C C;  1FC3 A;  1S9H A;  2LK2 A;  3KP3 A;  2XUB A;  4GYG A;  4YEJ A;  2DI3 A;  5FKL A;  3TKY A;  3ZMT A;  2QKM B;  5DEQ A;  1OCO H;  3RQI A;  1S7E A;  1VQM I;  4AID A;  2C6Y A;  2O8K A;  2FUG 2;  2EZK A;  2HOA A;  3ZN0 A;  1O3T A;  5HOD A;  4F3Q A;  3DBL B;  1D3Y A;  1WJE A;  3TBI A;  2JVH A;  2V7F A;  1XDU A;  4LFU A;  1MND A;  3CJR B;  4IF4 A;  2OAZ A;  4BY7 J;  4FET A;  4AUX A;  2CWE A;  2E5N A;  2R4G A;  4XLE A;  2BYV E;  1GLN A;  3K1M A;  2ZSI B;  4CHU A;  1Z9C A;  3PFI A; 
#chains in the Genus database with same CATH homology
 5EGO A;  2DJN A;  5JLW A;  3BT9 A;  3BG3 A;  3GBG A;  4Y7N J;  2JN6 A;  2JMW A;  2E2J J;  4V2G A;  2EBI A;  4XRS A;  2LR8 A;  2HXI A;  3BR3 A;  3OSG A;  2W48 A;  3PO3 J;  1JTX A;  1X58 A;  3OSF A;  2YUS A;  2NS7 A;  4C3J J;  3S2D J;  5J1Y A;  2HOT A;  3BTL A;  3HEF A;  1VND A;  3LSG A;  2D5V A;  2E2I J;  4A3B J;  2LY9 A;  1H88 C;  2DA1 A;  4BBR J;  4DZJ A;  2NVX J;  2DA3 A;  3TP3 A;  1VI0 A;  4RBO A;  1QRY A;  3HBL A;  1MBJ A;  5GPA A;  4W97 A;  2HOS A;  4NDL A;  3S1N J;  3GTM J;  5M3F J;  2ME6 A;  1UMQ A;  2DMT A;  1IJW C;  1T56 A;  2CU7 A;  2Y2Z A;  2Y9Y A;  2LD5 A;  5F27 A;  2WV1 A;  2EZL A;  2R5Z A;  1F36 A;  2MW8 A;  3S1R J;  3FIS A;  1GUU A;  4DYQ A;  2HYJ A;  2ECB A;  1H8A C;  3HOZ J;  3A03 A;  1JT0 A;  1JJ6 C;  1B72 B;  4M3D A;  2NOG A;  2DA4 A;  2FX0 A;  1ETO A;  2DMN A;  3HKZ N;  5J3L A;  1AHD P;  3BR2 A;  3NAU A;  1LFB A;  3ZQC A;  2M9H A;  2X48 A;  1JUS A;  5GPC A;  1XG1 A;  3GTL J;  4GFB A;  4JP0 A;  2ID6 A;  2CUF A;  1AKH B;  4D7M A;  5DS9 A;  2R7Z J;  4M3E A;  3CMY A;  2AO9 A;  2XPU A;  4D7N A;  2AHQ A;  3ZOB A;  3Q0U A;  1BW5 A;  4C3I J;  3Q0V A;  5FKK A;  2VPR A;  3JRF A;  3M4O J;  1ZR4 A;  1ZTR A;  1JKQ C;  3IV5 A;  2L7F P;  1RKW A;  3O8H A;  3S15 J;  1JT6 A;  4A3M J;  1TWA J;  1P7I A;  1MSE C;  2DA2 A;  4UUT A;  2L0K A;  5GP9 A;  1YRN B;  3BQZ A;  2K40 A;  4DYC A;  1GV2 A;  3HGY A;  4S0H B;  2K9Q A;  1NK2 P;  2OF7 A;  2TCT A;  2TRT A;  1WPK A;  4FTH A;  4LOC A;  1JKR C;  3IH4 A;  4XK4 A;  4BY1 J;  3PM1 A;  2JA5 J;  2G0E A;  2ZB9 A;  1QPI A;  2NVY J;  5E3L A;  1HCR A;  2JA7 J;  2VKE A;  3CQZ J;  1FEX A;  1APL C;  3IH3 A;  2GBY A;  4G12 A;  4UUS B;  1GVD A;  3S1M J;  2IBD A;  1TWF J;  4J19 A;  2QF7 A;  1TWG J;  1ETY A;  1XS9 A;  1MBK A;  4IHV A;  3C2B A;  4FE7 A;  3GTQ J;  1T33 A;  1F43 A;  1BJZ A;  1E3O C;  4QSH A;  5M3M J;  2LKX A;  1RET A;  1OCP A;  3IH2 A;  3G1M A;  1ORK A;  1BL0 A;  3WHB A;  4C2M J;  4IEJ A;  2XB5 A;  4CYC B;  1RPW A;  4BXX J;  1ZKG A;  2JK3 A;  2CJJ A;  1TC3 C;  1IG7 A;  4QTR A;  5F04 A;  1VF9 A;  1B8I B;  1AU7 A;  3VPR A;  2M0C A;  3TW7 A;  4D5C A;  2XRL A;  3QQA A;  1JUM A;  3JRI A;  1IRZ A;  2L7M P;  3HGG A;  4XRM A;  3M3Y J;  1BA5 A;  1I50 J;  1P7J A;  3A01 A;  5EG0 A;  3LSJ A;  4B4C A;  2GLO A;  2Y0S N;  1D5Y A;  1WH5 A;  5E3M A;  2DA5 A;  2R0Q C;  2K9N A;  4DZP A;  2FD5 A;  4RDU A;  1LE8 A;  3TP0 A;  2OPT A;  1U8B A;  1TWC J;  2DTZ A;  5EF6 A;  1EF4 A;  3MKL A;  1U78 A;  5JLX A;  3A02 A;  5EZG A;  3JR9 A;  3DEW A;  1ETK A;  3BR5 A;  2COB A;  4M6V A;  3HM5 A;  4JX4 A;  2DMU A;  1FJL A;  3ZQH A;  5F0C A;  5IP7 J;  2HI3 A;  4IHW A;  4X1E A;  2CUE A;  2IAI A;  2HXO A;  3BR0 A;  3FKI J;  1Y1V J;  1K83 J;  5IP9 J;  3DCF A;  2VKV A;  1MNM C;  1PUF A;  2MSY A;  2R5Y B;  3JRB A;  2DMP A;  4A3J J;  2I10 A;  3HOW J;  3H3V K;  2ELK A;  3ZQI A;  2M2E A;  3Q3S A;  5DTD A;  4B3A A;  2DN0 A;  1MBE A;  5K7H A;  3ZQG A;  1VFC A;  2NVQ J;  5C4X J;  3BG9 A;  3OOU A;  1IGN A;  4IHX A;  3GTP J;  1SFO J;  2XPV A;  3ZQL A;  3Q0W A;  2DA7 A;  1ENH A;  3LNQ A;  1IDZ A;  2EH3 A;  5IPA A;  4MFD A;  3S1Q J;  2DMQ A;  1IUF A;  4A3D J;  1SAN A;  2K9S A;  5C4J J;  1ETQ A;  4MO7 A;  5J1R A;  1JUP A;  2JA8 J;  2XGC A;  3S14 J;  3FK7 A;  2ECC A;  4AC0 A;  3BG5 A;  3QPS A;  4XRS G;  2M8G X;  3B6C A;  5F1J A;  3S2H J;  3S16 J;  1MH3 A;  2L7Z A;  5FJ8 J;  3O8G A;  4XID A;  4M3G A;  5M5X J;  1WGX A;  2HQ5 A;  1I6H J;  3FIW A;  1QVT A;  3I4M J;  3MN2 A;  5EEA A;  2CQQ A;  4I76 A;  4L5E A;  1ZQ3 P;  5IOY A;  2O7O A;  2IEK A;  1MSF C;  3HDD A;  1OJL A;  3CCY A;  1Q1V A;  4A3K J;  2B63 J;  1CQT A;  2VUM J;  1LFU P;  2X6O A;  5FLM J;  4FIS A;  3BQY A;  3I4N J;  5K7F A;  2XSD C;  4A3G J;  1FIA A;  4M3B A;  3B6A A;  3CDL A;  1I3Q J;  2LTP A;  1W0T A;  2HDD A;  1RKT A;  3FK6 A;  5EGO B;  3BR6 A;  2E19 A;  2XPW A;  5F08 A;  1WI3 A;  1JGG A;  4FCY A;  2EZI A;  3GTG J;  3BTJ A;  5BNG A;  3A01 B;  5EG0 B;  2L9R A;  5F0F A;  3LOC A;  4XIC A;  1FIP A;  1HOM A;  1ETX A;  4JYK A;  4JX5 A;  1LE8 B;  2N8G A;  3W6V A;  1HF0 A;  1HDP A;  4A3C J;  5FKO A;  1WCM J;  2JJ7 A;  1JJ8 C;  3HOU J;  1B8I A;  4EEF G;  2NVT J;  1MBG A;  1MH4 A;  3H0G J;  3G1L A;  4ABZ A;  2Y30 A;  5K7Z A;  1GT0 C;  2JA6 J;  4V2F A;  1OCT C;  1WH7 A;  2LLK A;  2XB0 X;  3GTK J;  5EDN A;  3HOX J;  1K61 A;  1MBH A;  4A3E J;  2GM4 A;  3NAR A;  4BKX A;  3RKQ A;  2KT0 A;  3QPL A;  4AYB N;  4MFE A;  2R5Z B;  2MG4 A;  3RZO J;  4A3F J;  3TW6 A;  1POG A;  1IC8 A;  3HB9 A;  1BW6 A;  1PUF B;  5F0H A;  3RZD J;  1RR7 A;  3K7A J;  2ID3 A;  1U9N A;  4B1R A;  1Z0X A;  1NTC A;  3GTJ J;  2NS8 A;  1JKP C;  3JRH A;  1JKO C;  1FTT A;  2YU9 J;  1IV6 A;  5J1U A;  3L1P A;  1H89 C;  3K2A A;  3SJM A;  3HOY J;  1ZR2 A;  3ZQF A;  4HNV A;  5E3N A;  4BBS J;  3F0C A;  1HLV A;  5C3E J;  5FKN A;  2R92 J;  4A3L J;  2CQX A;  4DW6 A;  1MBF A;  2M34 A;  2RAE A;  4DYR A;  1ZGW A;  3JRC A;  4JX6 A;  2O9L A;  2R5Y A;  1B72 A;  1GDT A;  1ZK8 A;  2EZH A;  3PO2 J;  3UKG A;  1ETV A;  1JTY A;  1FTZ A;  4MLO A;  5IOZ A;  2DA6 A;  3E7L A;  2E1O A;  2XGD A;  2WAQ N;  5M5Y J;  1TWH J;  3LSP A;  1NK3 P;  5IYB J;  1AKH A;  1X2N A;  4M3F A;  3HOV J;  1Z77 A;  3SFI A;  2H1K A;  5IYC J;  2VI6 A;  3D1N I;  9ANT A;  4MIM A;  2P81 A;  3BR1 A;  1O4X A;  2YS9 A;  4QIW N;  5C44 J;  3S17 J;  5EZH A;  4IHY A;  1XC5 A;  3TED A;  4A93 J;  2X9D A;  2QCO A;  3G1O A;  3OIO A;  1YRN A;  4D5F A;  3JRD A;  2R93 J;  3BTI A;  2LFB A;  4X6A J;  1UHS A;  1G2H A;  2WB1 N;  4C3H J;  3JRE A;  3JRG A;  2LVS A;  2EQR A;  1RES A;  1X2M A;  2MGQ A;  3LSR A;  2LP0 A;  5IYD J;  4W1U A;  5FKM A;  2ME0 A;  4I6Z A;  1UG2 A;  2CRG A;  1R9T J;  1DU6 A;  2Y31 A;  2LK2 A;  3JRA A;  1QVU A;  1W0U A;  2Y9Z A;  1OFC X;  1IDY A;  2XGE A;  2H8R A;  3SDG A;  5EYR A;  2FQ4 A;  3WHC A;  5FKL A;  5IP6 A;  4UUS A;  4A3I J;  2KDZ A;  1Y1W J;  3RQI A;  1S7E A;  5M5W J;  4FE4 A;  2E2H J;  1HDD C;  2O8K A;  4A69 C;  1A6I A;  2EZK A;  2HOA A;  4Y52 J;  2JWT A;  5HOD A;  1U9O A;  1GV5 A;  4BY7 J;  4AUX A;  1A5J A;  1DU0 A;  3BTC A;  2FJ1 A;  1ETW A;  2PMZ N;  4CYC A;  5FLV A;  3GTO J;  5E3O A;  1ITY A;  3MVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...