1SD4A

Crystal structure of a semet derivative of blai at 2.0 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
QVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
molecule keywords PENICILLINASE REPRESSOR
total genus 37
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd4A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd4A02
3CTAA 1P92A 4CHUA 2K27A 1XMAA 1RUNA 2B0LA 1SFUA 4RAYA 2W24A 5ILVA 5DDGA 4HA8A 4M9XA 3RYPA 4KN7X 5BS6A 2L3DA 1R5GA 3ELKA 3C7JA 1P6RA 1CF7A 3JSOA 3P7NA 3WGIA 3DEUA 4WXDA 5DYMA 3V8JA 4O3MA 3Q5FA 1I1SA 5J8CA 4ENMA 2IRFG 1USSA 4B8XA 1IN4A 1WSUA 2VBZA 4RB2C 1FZPB 6PAXA 1D8JA 4ENNA 1XMKA 4L0YB 3GX4X 3DP7A 2CWEA 4HBLA 3HHGA 3ZN0A 3HOTA 1JHHA 1BI2A 3WODF 2J5PA 3R4KA 3TO7A 3C18A 4ON0A 4XRFA 4GXOA 5DD8A 3KEQA 2FBHA 4I2OA 1HQCA 5KK1A 1RIOH 1F9NA 2IPQX 3EUHA 1J75A 2HGCA 2PBIA 2YX7A 3I0TA 3H92A 3MWMA 3WU1B 1MDMB 2HZTA 2RDPA 2VBYA 2O0YA 2E1NA 4DQ2A 4HAMA 5ICEA 2KRFA 3R0AA 4IHSA 2MC3A 4RGSA 1W5TA 2OQRA 2Z9OA 4WWCA 1XD7A 4EJTA 2YSRA 2K86A 1TLHB 2CW0F 4L0ZB 4IF4A 3FXRA 2FU4A 2NNYA 4LJZF 3GZ6A 2HTSA 5DCMB 4IRGA 5LEKA 2HEOA 3E5UA 3HIFA 2NS0A 2IT0A 2Q8KA 4IRIA 2WWYA 4BAYA 1WWXA 3F8CA 1O3RA 2VBXA 1YS7A 5D5UB 1A04A 3CUOA 3WTSC 2H6CA 1SFXA 3JW4A 4G7ZF 3E6BA 2STTA 2CYYA 1IN8A 4PGHA 2FBIA 4LFUA 5JVTA 3IKTA 4WK8F 4BHBA 5FB2A 2F5DA 4MNUA 1MD0A 3GVAA 2DT5A 1Z1DA 1MKMA 1UFMA 4ASNA 3J81K 1ZG5A 2NNNA 3F6VA 1WI9A 1I1GA 3I64A 1G3SA 4MTEA 3VFZA 2P8TA 4OIPF 1Z6TA 2WC2A 1B6AA 4S04A 4KMUX 1R23A 1XN7A 1T38A 3VOEA 3BZ6A 4CZZA 1YIOA 1ZHFA 2XKPA 2ACJA 4M9SA 2O3FA 2FNPA 4R8HA 2P5LC 3ML6A 1B9NA 1KU7A 2HQRA 5AIQA 2M30A 4JBAA 3LA3A 1AWCA 1UB9A 2NAZA 1ZREA 4I7HA 3K69A 2P7CB 3HOSA 3V7CA 5CVIA 3RPUA 1IXRC 1EV7A 5K1YA 1LDKB 3GFLA 3O2PE 4EGZA 1GXQA 3DQVC 1LDDA 4P9UA 2XAHA 4KIGA 4KICA 3SXYA 2VOOA 3I59B 5JFRA 4GYGA 2FXAA 3ZMVA 1IXSB 3KE2A 3M7GA 4A2UA 2Y0MA 2OA4A 4ZYGA 3CJNA 2F2EA 1YW7A 4LG0A 1U78A 1OMIA 3FMRA 2FRHA 4BHCA 2F5FA 3FWEA 4RAZA 2KJBA 5ICCA 1E2XA 2VT3A 3BPVA 1SAXA 1IN6A 4YIFA 4FHTA 4OU0A 3QU6A 2IJLA 1H9TA 3G73A 2GXBA 3L09A 4HYEA 2P5KA 5LEJA 3P9CA 4Q4ZF 2M5WA 4U0VA 3GZ5A 3F23A 5HS7A 3KP4A 4MGRA 4M6YA 5E20A 3RPQA 4P96A 3DV8A 2D2WA 2OBPA 3T8TA 2P5VA 5FD5A 5L3EA 2Y75A 3FX3A 2XAFA 5LHIA 1ONVA 1T39A 1P4AA 1LQ1A 3HRMA 2BGCA 2EFWA 2QLZA 3T0YA 3GFJA 1FBSA 1G6NA 4L5IA 1SD7A 3HRSA 2ZMEB 1J59A 3EYYA 4HW0A 1I6XA 2DW4A 3WGGA 2H27A 2GWRA 3G3ZA 1UHWA 1QO0D 2MLGA 1FC3A 2Z5UA 3GF2A 2J5OA 1W4MA 1KYZA 2W84A 3KP7A 4KA4A 2R7FA 3RDIA 1FOKA 3WE3A 1YLFA 4U7DA 2G9WA 3WE2A 2PQ8A 1R22A 3GFMA 5JHUA 5DCFA 4Y13A 2YR2A 4LLLA 1G3WA 1HXDA 4MQVA 3ZMZA 2LF7A 2ETHA 1JGSA 3HTUA 4A6EA 1X3UA 3IL2A 1FP2A 1XSXA 3V8LA 1WKMA 5D4SA 1R7JA 2K4BA 1HSJA 3PQJA 1OR7A 2GAUA 1GVJA 1XGNA 2HOEA 4LLGF 4O6JA 2DO7A 1F5TA 2EV6A 1FBUA 5BMZA 4IRHA 1O57A 1OYIA 2L4AA 2V1DA 4KNYA 1O3TA 4M73A 4XBFA 3KLOA 1HKQA 3I53A 2YPRA 1ZRCA 5CVUA 2PFBA 3V4GA 3T8RA 4H0EA 1TQPA 1Z9CA 2HQNA 3CUQC 4OIRF 4KT5C 2K4JA 1XGMA 1JXSA 3GLXA 5L3BA 1SFEA 3CDHA 3IWZA 2HYFA 3J7AO 5IT9K 3GO5A 3Q9VA 1BC7C 2EB7A 3IKVA 2FEZA 2RN7A 2V79A 3VB2A 2KIMA 1XB4A 1KU2A 2LKPA 1RZ4A 2CSOA 3JSPA 2LF8A 1R36A 4I0AA 4ZZDA 2QQBA 2RVCA 1FPQA 4TV7A 3SFZA 1LB2A 3TOBA 2VOPA 4FX4A 5EEGA 4QLCU 3F8NA 5FO5A 5HDKA 3LA2A 4R79A 5D6EA 1OYWA 1SMYF 4S05A 1BBYA 3MZYA 5KVRA 4AWXB 1R1UA 3CUQA 2XVCA 2KIUA 3K0LA 3EQLF 4FT8A 2VE8A 3F8FA 1QZYA 1TNSA 2VE9A 1IF1A 4A5MA 3EDPA 4OMZA 2D1VA 2G7HA 1OKRA 1TW3A 1Q1HA 5FFXA 4CO8A 3H3ZA 2W57A 2Z3YA 3BPXA 1MJBA 1XCVA 3ERED 4EVIA 4RGXA 4UVBA 1MJAA 4BYYA 1R1VA 2ZNZA 4HX8A 5LGUA 4YIIA 2Y48A 4ENJA 1SMTA 3K2ZA 1FT9A 4G7HF 1B1BA 5ILSA 5CVRA 4Q47A 5D5XB 2K7LA 1QNTA 3HSRA 2O61A 4HOBA 1QGPA 1FY7A 3GUDA 1R5HA 5FD6A 3ISPA 2M1BA 3CO7C 5ERIA 4XLPF 3F72A 2LSOA 1EH7A 5L3DA 1LJ9A 3NRVA 4IHTA 1PUEE 1IZ1A 3WTYC 1GXPA 4I02A 4JQFA 3HUGA 4RB1A 3P9KA 4EM2A 2OU2A 1O3SA 2VT2A 2PMUA 2HR3A 3C3WA 4HV5A 2TDXA 3BWGA 4LK1F 2D1HA 1YTYA 5E1WA 3B73A 3ZMSA 2Z33A 3NEUA 1ODDA 1ZRFA 4ZH4F 1EH8A 2Z99A 4GGGA 4KIFA 4I0BA 3U1DA 5L3GA 1XDUA 3I5UA 4G8XA 1ZRDA 2KIFA 3QP6A 2HTJA 5D8KB 1RNLA 3K1MA 2L54A 2PN6A 5HVQC 4WXCA 1RI7A 4EV0A 3KLNA 3E6CC 4LK0F 2EA4A 3JTHA 2OQGA 1QBJA 2VONA 1H0MA 2YX4A 3HRTA 4P9FA 1OYYA 2QBYB 5F64A 1T0FA 2ISZA 1KGSA 1K79A 4Y15A 1YO5C 3SZPA 3LA7A 2F5EA 2W25A 2R3SA 5IT3A 1STZA 2VC0A 4IXAA 4I98B 3DXJF 4PDKA 2G7UA 3LSTA 1S6LA 4BQAA 2M45A 4EGYA 5A2QZ 1S8NA 2ZJ2A 3MQ0A 1YW9A 3R0JA 5HOOA 1H9GA 3TOAA 3VODA 4U0WA 2RC4A 1KA8A 4QWQA 5HLIA 4HF1A 4MTDA 1J5YA 1O7FA 4WXHA 4OINF 2RV8A 4GYIA 1J9IA 2PJPA 2FSWA 3DPLC 4HX7A 3LWFA 1U2WA 1YG2A 1R58A 2A6EF 1P4XA 1W7PA 3DPTA 5LHHA 2E7WA 1S29A 1ZG3A 2DI3A 2QENA 3ROUA 5AIPA 3QP5A 1MJ9A 3L00A 3BROA 1BOAA 1KYWA 2ESHA 2DQRA 2NYXA 5H6RA 1ZH5A 4A0ZA 4L9NA 2DU9A 5JR3A 3RYRA 4HDUA 5D5VB 1RUOA 2MH2A 3MAJA 3WGHA 2HYGD 1YFHA 2Q0OA 1FBQA 1UHMA 1IRFA 4IJAA 1B59A 1S3JA 2A6HF 4OIQF 4KFCA 1J0RA 4ZYEA 4M74A 3ZP5A 2AS5F 3VEPA 2DAOA 2ZNYA 1BJAA 2IP2A 2DLLA 3P9IA 3RTRA 4NB5A 2QZ8A 4NQWA 4LG0B 4F7ZA 4LD5A 4M9ZA 1P4WA 1B4AA 5F1RA 5JI6A 3ZMDA 2X0LA 4MQ9F 1ZLKA 2HKOA 2JSCA 3GXOA 3BDDA 3GYHX 4G94A 4ESJA 1O7LA 4UNOA 5ILUA 3HSEA 3REOA 4LB5A 1V3FA 3J81Z 3AAFA 4EJOA 3KP5A 3RIRA 5LHGA 1E17A 1U5TA 3E5XA 1FP1D 2EFNA 3TQNA 2RGVA 3GW2A 3J80K 3L7WA 5AONA 3TDZC 2QQ9A 3M1EA 2L01A 4UXNA 3RI4A 4MEXF 3KFWX 3IWFA 2HDCA 1LVAA 2JTVA 3PFIA 4HX4A 4IVNA 4MHGA 3N4MA 1FX7A 1PP8F 5BPIA 3KP3A 2HFHA 2UXXA 2VN2A 2ZMEA 2JZYA 1U5TC 1BC8C 1KU3A 2GXGA 1Z05A 2H6BA 2RQPA 2CO5A 4G7OF 4CGZA 1HKSA 4LB6B 4U7BA 2PI0A 1ULYA 1IXCA 1IN7A 1HKTA 4UVAA 3RKXA 2EV0A 4LGWA 5FGMA 3KZYA 2PLYA 1MGTA 3S2WA 4ESFA 5E1XA 3RJPA 1BIAA 3TGNA 3C1DA 4M71A 1K7AA 1FYMA 3B02A 2P4WA 3CO6C 3SHFA 3ZQ7A 4UHTA 3FM3A 4PZJA 3I59A 2C6YA 2XUBA 3MEXA 5LGTA 2UZKA 3MFKA 2AXLA 4CICA 1ZLJA 4YFKF 1O3QA 4HQEA 3V7SA 1BM9A 2O8XA 2FE3A 5ICFA 2FQ3A 5H20A 4HLYA 2FBKA 3HRUA 2QWWA 3E6DA 1BI0A 3FXQA 3QRFF 1W7PB 2GA1A 4N9HA 3I54A 3BJAA 3SZTA 2JT1A 4Q48A 2V6CA 3LQQA 1K78A 3FZVA 4UVCA 3M8EA 4WF2A 1L0OC 3EYIA 3WTXC 1SD5A 1FLIA 4OMYA 2OD5A 4L9TA 3JAMK 2ZFWA 4I01A 1DP7P 3I4PA 5D8LB 3F21A 4E70A 1VTNC 3J80Z 2V9VA 1T2KA 5IT9Z 2ZO4A 3D0SA 4G6QA 5K5OA 1BIBA 3LFKA 1ZN2A 1B9MA 5TRDA 1JE8A 5DD4A 1LDJA 4YG2F 3PQKA 4U88A 5FLXZ 1ZYRF 2QM3A 3FMQA 5DUKA 3T5XA 2EFOA 3F8BA 1I5ZA 2ADUA 4GCVA 2DK8A 3K1NA 3WTZA 4KMFA 2HWVA 5F6FA 1WRJA 1MZBA 3V7RA 1XGOA 4GO1A 1IRGA 3WG9A 2WTEA 4PCQA 1S7AA 1SD4A 5E18F 1K6OA 3M8FA 4ZYHA 3DF8A 1C0WA 1XGSA 3K9TA 4A6DA 4RB3C 3Q9SA 1S7OA 4KUMA 4JK1X 2IW5A 2XHKA 5L3CA 2WV0A 1ZARA 2HS5A 3ZMTA 3L9FA 3FHZA 3BY6A 3IC7A 1XSVA 1KQ8A 4HLXA 1ZGAA 1IAWA 1K78B 1T98A 3EETA 2LNBA 1FYKA 5FFZA 2XRNA 1U5TB 3LAJA 2XV4S 2FMYA 4XSXF 1I27A 1TW2A 2ZBKA 2A69F 2ELHA 4YFNF 2HKXA 2XROA 1QQIA 2DFIA 5CLSA 2ISYA 2GA2A 2M8EA 2ZCWA 1ON2A 3OV8A 2GIVA 4OOIA 5CYVA 2RNJA 5HLGA 1U6GA 5TJJA 2CFXA 1ZG1A 1SD6A 3U2RA 1DDNA 3JTGA 4N0BA 1D8KA 3F3XA 5D6FA 2DK5A 4I09A 1XCBA 2MBFA 3KP6A 2GQQA 2L4MA 4G9YA 1F4KA 3LQRA 3QPHA 3ULQB 2DPDA 3E3VA 2OZ6A 5E17F 4AIJA 2OAZA 3F22A 3V8KA 5HDNA 3LAPA 3N97A 1G3YA 2GZWA 2H94A 5BQTA 1R00A 5LGNA 4L9JA 3OOPA 3CUQB 1NHAA 4WCGA 5K5QA 5BPDA 2L02A 4G6DA 4CYDA 4XSZF 3CLOA 2K02A 3GEZA 2UWMA 4Y17A 3DFGA 2CQKA 2QQAA 5L3FA 2W85A 1LEAA 5DEQA 4P5OA 1HW2A 4LMYA 1HSTA 1XSDA 2IA0A 2JPCA 2A61A 3ABTA 1YW8A 3NQOA 2E1CA 3ZPLA 2QBYA 3O6BB 4L5JA 1DPUA 3GWZA 5HLHA 4AIHA 2PEXA 5LLQA 1LEBA 4UV9A 3SQNA 2XAGA 3RKWA 2COMA 4L9VA 3ZN1A 4XLNF 2O6GE 2KJCA 3F6OA 5E8GA 4RGUA 2ZXJA 2R7DA 2EFPA 1T6SA 3MCZA 1QPMA 1Y0UA 4O5VA 3TO6A 1UCRA 1XDSA 4HF2A 3T1BA 1W5SA 1YQAA 1ZGJA 2FF4A 5CJ9A 3KCCA 2QUFA 2H09A 1FSEA 3D5LA 1U8RA 2XGXA 3QU3A 4HDVA 4HZFA 3WTUC 1KU9A 4P55A 1U3EM 1QZZA 3R60A 4RB0A 5D4RA 2ESNA 3F8MA 4U0YA 2MD5A 4RGRA 1P2FA 2V1XA 4D0PA 5J6XA 4NHJA 1F1ZA 4Z2YA 2A68F 4ESBA 3FMSA 1HW5A 4EM0B 4ETSA 4CXFA 3R6SA 1Z91A 2OZUA 1FYLA 2EA2A 3K1PA 4CDGA 4EQQA 5LRRA 2BYVE 4BHPA 5LRSA 3E5QA 5LBQA 3E6MA 4M72A 4HF0A 2UXNA 2X4HA 1USTA 4RS8A 2PMHA 1WQ2A 2IA2A 1BI1A 2MH9A 4UV8A 1J7KA 2V1UA 1CF7B 4AVPA 4A5NA 3W6JB 2FMLA 5BOXA 5FLXK 4M6XA 3DKWA 2RKHA 1TTYA 4ZZLA 5J8FA 1HW1A 2XIGA 5ED4A 3WTVC 3MZHA 2FNAA 1FSHA 4AD9A 3KETA 4EJVA 5K5RA 3QAHA 1Z7UA 5HS8A 4A12A 4N9IA 1FNNA 2EWNA 2LDUA 2BBYA 3TDUC 3HSFA 2VODA 3ZMUA 3WTWC 1FWZA 2DTRA 2XASA 1BN5A 4HV6A 3TO9A 1IN5A 2XAQA 3KZZA 1L3LA 3H3UA 2CG4A 5HS9A 5D5WB 4WX9A 3HYIA 3R61A 3WTTC 2P6TA 2M87A 2D45A 4AIKA 2NRAC 2P6SA 3QPTA 3ECOA 2IA1A 2MA3A 1YS6A 2FOKA 2VC1A 2XKOA 1DPRA 1KQ9A 1JHFA 5DV5A 3U9GA 1W7PD 3I71A 4YFXF 2VXZA 1PP7U 1ZAOA 1IUYA 3QOPA 3HHHA 1G3TA 3FM5A 1D3YA 3IRRA 1YYVA 5DCMA 1Z6RA 3M9AA 2EK5A 2O03A 2PG4A 1EH6A 3BJOA 1TNTA 4KDPA 1IW7F 5CVVA 1HBXG 1CGPA 1V4RA 2DPUA 4A0YA 4KYWA 4EMSA 1BI3A 1D5VA 1GHCA 1J2XA 3BJ6A 2DBBA 2BE5F 2MLKA 3GFIA 4ZYDA 2F5CA 4EM1A 3KP2A 3W6KB 5A2QK 5CVJA 2IVMA 3I58A 2XAJA 3HTSB 1DUXC 4HQMA 4BNCA 3JAMZ 3KEOA 5HDGA 2QVOA 4UUVA 1ON1A 2YU3A 3IHUA 4PGGA 3L2CA 2E7XA 4MEYF 2STWA 2BEOA 4EJWA 2QYOA 2P7VB 2DQLA 2Q2EA 2ZKZA 4FX0A 2A3SA 3E97A 3TKYA 4IPAA 2JPBA 4R1HA 2EFQA 4KIBA 2JRTA 1TQIA 4BXUA 1G4DA 2EV5A 3FXUA 2CGPA 2FA5A 4KN4X 1LNWA 3FF5A 2A07F 4OIOF 5DUIA 4ENKA 5ICGA 3IRQA 1REPC 3RKYA 3ABUA 3WU0A 5H6QA 2VBWA 4B09A 1PDNC 1TQMA 4LLNA 1TBXA 1KQ0A 4Q5SF 4K2EA 4BH9A 3ECHA 5E1ZB 2EJRA 1MDMA 2A5YB 3O3KA 3BP8A 3BOQA 4A0XA 3COAC 1R1TA 5EEHA 4EJUA 1OPCA 4L18B 2BV6A 2KKOA 4DNCA 1AOYA 5E8IA
chains in the Genus database with same CATH superfamily
3CTAA 3BLYA 3NAUA 5J1UA 1P92A 3ERMA 4CHUA 2R93J 2K27A 1XMAA 1RUNA 1SVMA 4M3FA 3FIWA 2B0LA 2DTZA 1SFUA 4RAYA 5EDNA 3KIOA 3DLAA 2W24A 3RQ4A 5ILVA 4F52A 5DDGA 3FK6A 4HA8A 4M9XA 4C3IJ 1IRZA 3RYPA 2R7TA 2QKMB 4E7ZA 4KN7X 5BS6A 2L3DA 4N4OB 5FJ8J 1OJLA 2X6YA 1R5GA 3ELKA 3C7JA 1P6RA 1CF7A 1WH7A 3JSOA 1T95A 3P7NA 3WGIA 3DEUA 2DFFA 3KYLA 4WXDA 1DGRM 5DYMA 4XLCA 4RAGA 3V8JA 1IV6A 3JRFA 1DP3A 4O3MA 3Q5FA 2XPUA 3K10A 1I1SA 2LD5A 3HKZA 5J8CA 4ENMA 4GDFA 2IRFG 1USSA 2EPFA 2LTPA 4B8XA 1IN4A 4DW6A 1T33A 1WSUA 2NVYJ 4HEA2 3FKJA 2VBZA 4RB2C 1FZPB 2L9VA 6PAXA 1D8JA 4ENNA 1XMKA 1I39A 4L0YB 1JTYA 3GX4X 3DP7A 1MSFC 2BXYA 2CWEA 4FISA 1JUMA 4HBLA 3BQZA 3HHGA 4BUPA 1YJ9I 1BA5A 3ZN0A 2EQRA 3HOTA 4QSHA 1JHHA 3KX2A 1BI2A 4IEJA 3WODF 2QSHX 2HPMA 1JGGA 2J5PA 5JLWA 3R4KA 1HDDC 3TO7A 4BXXJ 2O5RA 3C18A 4ON0A 4XRFA 2EIMH 4GXOA 5DD8A 4E7HA 3KEQA 3M1CA 2FBHA 4I2OA 1HQCA 5KK1A 1RIOH 1F9NA 3HXLA 3OL3A 2IPQX 2HU9A 2XF6A 3EUHA 2X6OA 5H2FC 1J75A 3J7AY 2XAUA 2HGCA 2JRMA 5GPAA 1X2NA 2PBIA 2YX7A 3I0TA 4PJNA 1FMVA 2DXIA 3H92A 1XS9A 3MWMA 3WU1B 1MDMB 2HZDA 5DS9A 4XICA 2HZTA 2RDPA 2VBYA 2O0YA 2E1NA 3K4JA 4DQ2A 3MKWB 3HOVJ 2CQXA 1B72B 5CKTA 4HAMA 3FXJA 2PMZN 3W6VA 1X4PA 1MBKA 2KRFA 5ICEA 4A93J 3R0AA 4IHSA 1X1AA 2MC3A 1AHDP 3I3LA 4RGSA 1W5TA 2OQRA 2Z9OA 4WWCA 4ZDPA 2M2EA 1XD7A 4EJTA 2LY1A 2YSRA 4ZDLA 3AG3H 3MKZA 2W7NA 2K86A 1TLHB 2CW0F 4H4KC 4L0ZB 1GUUA 1YHQI 4IF4A 3FXRA 4W1UA 3A0BC 2FU4A 2NNYA 4LJZF 3GZ6A 1R5ID 2HTSA 5DCMB 1BR2A 3BR5A 4IRGA 5LEKA 2O7OA 2HEOA 3E5UA 3KYDB 4UUSA 3HIFA 4XNFA 2WAQN 2NS0A 2H8WA 2IT0A 4NBQA 4A3GJ 3SEZA 4NUBA 2Q8KA 3VSLA 4IRIA 2WWYA 5E8IA 3BR6A 2KT0A 2GOMA 2TRTA 4XN3A 4BAYA 1X1DA 5EF6A 5FKOA 2BZTA 1WWXA 2M7AA 2ECBA 4IQJA 3CMYA 2XB0X 2ZSIB 3F8CA 1O3RA 2JVHA 3M4OJ 2VBXA 1YS7A 2L7MP 5D5UB 1ZGWA 3CC7I 2VQGA 5FLVA 1A04A 3CUOA 4EEFG 3GTQJ 3WTSC 2RQQA 3DKYA 3L2UA 2H6CA 1SFXA 2UUZA 1SANA 2P81A 5KNLA 2LR8A 3JW4A 2KL4A 3IH2A 5FKKA 4G7ZF 3E6BA 3VYRB 2STTA 2CYYA 2V9KA 1IN8A 3WHBA 5KAFC 2Y0SN 4PGHA 1TWHJ 2FBIA 1P7JA 1RETA 4LFUA 2HVRA 3OYEA 3HC7A 4XIDA 1ZR4A 5JVTA 4E6KG 3IKTA 4WK8F 4BHBA 1VQ5I 5FB2A 3A03A 2F5DA 4MNUA 1MD0A 3GVAA 2DT5A 1Z1DA 1MKMA 1R9TJ 4C2MJ 1UFMA 2EZHA 2E36A 4ASNA 3GBGA 3J81K 3CCLI 2NNNA 4BE1A 1ZG5A 3F6VA 1WCMJ 3DBHB 1WI9A 1I1GA 5KHDA 2VKVA 4UB6C 3I64A 2E34A 2MYSA 1LPQA 2V9PA 2GM4A 1TZLA 1AKHB 1G3SA 4MTEA 3VFZA 4F3QA 2P8TA 4OIPF 2R7XA 1BR4A 1XC5A 3JRIA 1Z6TA 2WC2A 1B6AA 1VQNI 2F4OB 2ZMEC 4IHVA 4S04A 4KMUX 4BXFA 2W4SA 1J09A 1GV5A 1R23A 1XN7A 5BNGA 3OS1A 1CQTA 1LKXA 1T38A 3VOEA 5GAHJ 3BZ6A 2WADA 4CZZA 1YIOA 1ZHFA 1TWGJ 1S7EA 3I9V2 2XKPA 3CCEI 2ACJA 4M9SA 2O3FA 2FNPA 4R8HA 2P5LC 4CCJA 3ML6A 1B9NA 2L5QA 3CDIA 1KU7A 3S17J 1PUFA 2JUGA 5IY5H 4HSTA 2HQRA 5AIQA 3AL0B 2M30A 4FETA 4JBAA 3LA3A 1AWCA 1UB9A 2NAZA 1ZREA 4I7HA 2O8KA 3K69A 2P7CB 3OIPA 3MKLA 2JA7J 3HOSA 1QHHD 2DA7A 3V7CA 1RKTA 2H1LA 2I5UA 4CCNA 2WA0A 2CQNA 5CVIA 5F1JA 3BG9A 3RPUA 2CFOA 1IXRC 1EV7A 1X58A 2K9MA 5K1YA 1LDKB 3GFLA 2X6WA 3O2PE 3NWTA 4C2UA 2V1NA 2Z16A 4EGZA 1GXQA 3DQVC 2MC4A 3SZGA 4AIDA 1LDDA 4P9UA 1MBHA 2KIQA 2XAHA 2OPTA 3EUKL 4KIGA 2L0KA 4KICA 3SXYA 1ZQ3P 2VOOA 3S3NA 4YELA 2OF7A 3I59B 5JFRA 4GYGA 2FXAA 5B5EC 3ZMVA 1IXSB 1MNEA 3KE2A 1TC3C 4MFEA 3M7GA 4D1QA 3H9GA 4A2UA 4C3JJ 2DMUA 3KZIC 3K4BA 3K4NA 2CQQA 2Y0MA 1PYVA 2OA4A 1D1CA 1R4MB 2ZXIA 2X48A 4PJLA 4ZYGA 3CJNA 2F2EA 1YW7A 1YRNA 3FKIJ 2R7QA 4LG0A 5EZHA 1U78A 1OMIA 3FMRA 2DMNA 1YOVB 2FRHA 4BHCA 1AKHA 2F5FA 2W48A 3FWEA 4RAZA 2KJBA 3TL4X 5ICCA 1X19A 1E2XA 3OR1C 2VT3A 3BPVA 1SAXA 1IN6A 3ONQA 1D1AA 5E3NA 4YIFA 2DT6A 4KITB 3CESA 3LSGA 4FHTA 4OU0A 3QU6A 2IJLA 3LSHA 4CA0A 3OYHA 2BY3A 2HXOA 4DZJA 3G73A 1H9TA 2XRLA 3L09A 2GXBA 3TW7A 4HYEA 4XLAA 2NVXJ 2P5KA 5J47A 5LEJA 3P9CA 4Q4ZF 3EUHC 3WU2C 1JJ8C 2M5WA 4U0VA 3GZ5A 3FXLA 3F23A 2W1OA 3G4SI 5HS7A 4E7LA 2NVQJ 2BY0A 3KP4A 3HPHA 3BTJA 4MGRA 4M6YA 5E20A 3RPQA 1W36D 4P96A 3DV8A 2D2WA 4UY8I 2OBPA 3T8TA 2P5VA 2DN0A 5FRNA 5FD5A 1JT6A 5L3EA 2Y75A 2KISA 3F9KA 3FX3A 4HRIA 2XAFA 3P5JA 1TT5B 5LHIA 4HSRA 3OYAA 1ONVA 2Q2EB 1T39A 4XORA 4XOTA 5IYBJ 1P4AA 2VIXA 1K83J 1LQ1A 2KRCA 3S32A 1UZCA 3HRMA 3HG9A 3L1PA 4PJ0C 2BGCA 4BBRJ 2EFWA 1UMQA 2R4GA 2QLZA 4B3AA 2GBYA 3T0YA 3GFJA 1XMXA 1FBSA 1G6NA 4L5IA 1SD7A 4D9JA 3HRSA 2M7BA 2ZMEB 1ZTRA 3RCOA 1J59A 3EYYA 4HW0A 1I6XA 2DW4A 3WGGA 4BDYA 2H27A 1M1EB 3G3ZA 2GWRA 1UHWA 3HUGB 1QO0D 2MLGA 3IH4A 4F93B 4FCYA 4XLEA 2VJ5A 1FC3A 2Z5UA 3GTGJ 2XPWA 3GF2A 3DBLB 1B8IA 5CQGA 1WH5A 2J5OA 1W4MA 4NNJA 1Y8QB 2DMQA 1F36A 4UUSB 1HA8A 1KYZA 2W84A 3KP7A 4KA4A 1ETVA 2R92J 2R7FA 3BC8A 3OYNA 3RDIA 1FOKA 3WE3A 1YLFA 4U7DA 3AKZA 1QA6A 5GPCA 2CRGA 3SFIA 1X1CA 2G9WA 1OISA 3A02A 3QWLA 4PJJA 3WE2A 2PQ8A 3DTIA 1R22A 2RNGA 2RREA 3GFMA 5JHUA 1FJLA 5DCFA 1KONA 4Y13A 4BEHA 4U87A 1Z21A 5F08A 2YR2A 4LLLA 3H35A 5HODA 3HJEA 1G3WA 1HXDA 1FTZA 4MQVA 4NQWB 3ZMZA 4IKFA 2DA4A 2DA5A 2ZJPF 3OYCA 1ETWA 2LF7A 2ETHA 1JGSA 4XLHA 3ZQLA 3HTUA 4A6EA 4XLFA 4DBRA 1VQMI 1X3UA 3IL2A 4DJAA 1FP2A 3CQZJ 1XSXA 3V8LA 1WKMA 3CCSI 5D4SA 1R7JA 1MBEA 2K4BA 1HSJA 4GRIA 1RPWA 4IX7A 3PQJA 1OR7A 2GAUA 1GVJA 1XGNA 3ZXSA 3PUFA 3LMMA 1D0ZA 2HOEA 3PNYA 4LLGF 4O6JA 1HF0A 2M4GA 2DO7A 3FXMA 4XMYA 1F5TA 3QPSA 2MD0A 5E79C 2EV6A 3SJMA 1E3PA 1FBUA 5BMZA 4IRHA 2ME6A 1O57A 1OYIA 2DDAA 2L4AA 2V1DA 4CH7A 4KNYA 3S14J 1O3TA 4M73A 3HOZJ 4XBFA 3KLOA 3PFYA 2ZJRF 1HKQA 3I53A 2YPRA 1ZRCA 5CVUA 1Y8RB 2PFBA 2YUSA 3V4GA 3T8RA 4H0EA 1TQPA 1Z9CA 2HQNA 3CUQC 4OIRF 4KT5C 2K4JA 1XGMA 3JREA 1JXSA 3GLXA 4OWRB 5GAEJ 5F0FA 2R7VA 1FTTA 5L3BA 1SFEA 3CDHA 3IWZA 1A36A 2HYFA 2V6EA 1OCRH 3J7AO 4D7MA 5GTIC 5IT9K 4BE0A 3GO5A 3Q9VA 1BC7C 3GTLJ 5IP6A 2EB7A 3IKVA 2QCOA 1UAAA 2F48A 2FEZA 2RN7A 2V79A 4MFDA 4PFPA 3VB2A 5LFAA 2KIMA 2KDOA 1XB4A 1KU2A 2LKPA 3VPRA 1RZ4A 2CSOA 3JSPA 3M07A 2LF8A 4M3BA 4A3FJ 2MFZA 1R36A 1NG7A 4I0AA 1R71A 4ZZDA 2QQBA 2RVCA 1FPQA 2VQLA 4TV7A 3SFZA 5M3MJ 1LB2A 3TOBA 2VOPA 4FX4A 5EEGA 1TWFJ 5LD2C 4QLCU 1MMNA 4UUTA 1VQ8I 3F8NA 2FQ4A 5FO5A 5HDKA 3LA2A 3H5AA 4R79A 5D6EA 3H9JA 1OYWA 1SMYF 3CDLA 4S05A 1BBYA 2PX9A 1MMSA 1HC8A 2XSJC 3MZYA 5KVRA 4AWXB 1R1UA 3ABKH 3CUQA 2XVCA 1X3WB 2KIUA 3EQLF 3K0LA 4FT8A 2VE8A 1Y6IA 4J00A 3F8FA 1K4TA 3C2HA 1G8XA 2JA8J 2DA2A 1QZYA 4KT6A 1TNSA 2YS9A 3BTLA 2VE9A 2Q1ZB 4RLQA 4D5FA 2WB1A 1MNMC 4QIWN 1IF1A 4A5MA 3EDPA 4DZPA 4OMZA 4DBQA 3EUAA 2D1VA 2G7HA 4A3EJ 2D5VA 1OKRA 2YU9J 1TW3A 1Q1HA 4XKVA 5FFXA 4CO8A 2AQEA 3H3ZA 2BOLA 2W57A 2Z3YA 3BPXA 1MJBA 1XCVA 3ERED 2DFHA 4EVIA 2PJRB 1YRNB 4RGXA 3Q0WA 4UVBA 2QSFX 1MJAA 3BZKA 1ZELA 4BYYA 1R1VA 2ZNZA 1YIJI 3S16J 4HX8A 5LGUA 1S5LC 3CLQA 3Q0VA 3JRHA 4JX6A 4YIIA 2Y48A 4ENJA 3BT9A 1SMTA 1X2MA 3K2ZA 1FT9A 2EZIA 3G6EI 4G7HF 1B1BA 5ILSA 4B1RA 2RAEA 5CVRA 4Q47A 5D5XB 2K7LA 2H8RA 1QNTA 3HSRA 2COBA 4JOMA 2O61A 5IOYA 3TEDA 4A69C 4HOBA 4RBOA 5EG0B 5TISC 1QGPA 3ZOBA 1FY7A 1U0JA 3QYBA 4II3A 5GP9A 3GUDA 1R5HA 5FD6A 1RR8C 3ISPA 2M1BA 3JCUC 3CO7C 5ERIA 4XLPF 2DOEA 1QVTA 2W00A 3F72A 4CCMA 4XQFA 2LSOA 5C4XJ 1EH7A 2IGKA 5L3DA 1LJ9A 5EZGA 3NRVA 4IHTA 1PUEE 1SAUA 1IZ1A 2E1MC 3WTYC 2XGEA 2ICWG 1GXPA 4I02A 1IG7A 4C30A 1XG1A 4JQFA 3HUGA 3PM1A 4RB1A 3NWSA 4XM3A 4NC6A 3P9KA 5C3EJ 4EM2A 2OU2A 4GFBA 2FJ1A 1O3SA 2VT2A 1GVDA 2PMUA 3E1SA 3HOYJ 2HR3A 2HXIA 4PJMA 3C3WA 4HV5A 2VQCA 4FASD 1OR7C 4NC8A 5KAIC 2TDXA 3IAS2 3BWGA 4LK1F 2D1HA 4XRMA 1YTYA 2XSDC 1FMWA 3LSJA 1S9HA 2JSPA 1FOXA 5E1WA 2BW3B 3B73A 3ZMSA 3AG2H 5C44J 2Z33A 1Z3XA 3NEUA 4BY7J 1R4NB 1ODDA 1NH3A 4BEHB 1ZRFA 3H5NA 1WJFA 4BJTA 3GTMJ 4QPQA 4ZH4F 3DBRB 3FHNA 1JUSA 1VQ9I 1MSEC 4XKCA 2JK3A 1EH8A 3SEQA 2Z99A 4GGGA 4KIFA 4I0BA 3U1DA 2R7SA 3SDBA 3A01A 2L7KA 3DU6A 2QA4I 5L3GA 3DU5A 3ZQFA 1XX5A 2HDDA 1XDUA 3I5UA 4G8XA 5IP9J 2BVMA 2VB6A 1ZRDA 3QQAA 2KIFA 4MO7A 3QP6A 2FUG2 2WV1A 2EZLA 4UB8C 2E60A 3HB9A 1FEXA 4I76A 2KQRA 4PFOA 1JKRC 1H89C 2LP0A 2HTJA 3TW6A 4XKBA 5D8KB 1RNLA 3K1MA 2Y9YA 3JRCA 5K7ZA 2ZSHB 3IP4B 4HNTA 1I6HJ 5JLXA 2L54A 3G1LA 2PN6A 2WY8Q 4WXCA 5B1BH 5HVQC 1W0TA 1RI7A 3ZQQA 4EV0A 3KLNA 3E6CC 4LK0F 3GTKJ 2O9LA 2CH0A 1HDPA 1WZ2A 2EA4A 3JTHA 5EG0A 2OQGA 3D5RC 2IEKA 4BE2A 1QBJA 2VONA 3BQYA 3ESWB 2L9SA 1H0MA 1AU7A 4Y52J 2DA6A 1VQOI 4JX5A 2YX4A 1WJCA 3DLLF 2VLAA 2K40A 3HRTA 4P9FA 1QVUA 2CUEA 2P0WA 1OYYA 2QBYB 5F64A 1NG6A 4HPQA 5M5WJ 2EZKA 1T0FA 2ISZA 1KGSA 3OOUA 4DGWB 1K79A 3H5RA 4Y15A 1YO5C 3SZPA 2ECCA 4YRVA 1WI3A 3LA7A 2F5EA 2W25A 2R3SA 5IT3A 4E7JA 1STZA 1ZK8A 4AVZA 1QHGA 2VC0A 3OIOA 4IXAA 4I98B 3H3VK 3DXJF 5J4YA 2X6XA 2G7UA 4PDKA 1QPIA 1V5EA 3LSTA 1S6LA 2JUCA 2VASA 4BQAA 2M45A 4II2A 4EGYA 5A2QZ 1S8NA 1K6YA 2ZJ2A 3MQ0A 1YW9A 3R0JA 1WHUA 5HOOA 1H9GA 3TOAA 2K3FA 2JMWA 1YI2I 3VODA 4U0WA 2OTLI 1UG2A 2RC4A 4JX4A 3O8GA 1KA8A 3U1KA 4QTRA 5B1AH 2LBFA 3CP2A 4QWQA 2K3PA 5HLIA 3I56I 4HF1A 4MTDA 1J5YA 4A3KJ 1O7FA 4XRSA 4NC7A 2V4JC 1N25A 2VKDA 4WXHA 5GTHC 3D1NI 4OINF 2RV8A 4GYIA 4CCKA 1J9IA 2PJPA 2FSWA 2R5YB 4CCLA 3DPLC 1VI0A 4LG3A 4HX7A 3LWFA 1U2WA 1YG2A 1PUFB 2OCCH 4LITA 1R58A 2A6EF 4CZCA 1P4XA 1W7PA 3DPTA 4RDUA 3DEEA 5LHHA 2E7WA 1MH4A 1S29A 1ZG3A 2LFBA 2DI3A 4JYKA 1GT0C 1WJBA 4L5EA 4C9YA 2QENA 3ROUA 5AIPA 1Y39A 3QP5A 1MJ9A 3HKZN 2QQ8A 2ID3A 3KEYA 4Y3OA 3L00A 3BROA 1BOAA 3M8JA 4RAFA 1KYWA 3QYEA 2V26A 5EGOA 2PMZA 1IV8A 4CYCA 2ESHA 2KFDA 2KRHA 4M3DA 2DQRA 2NYXA 5H6RA 1ZH5A 5FKNA 2HYJA 2XC7A 2ZXWH 1GV2A 4A0ZA 4BKXA 4L9NA 3S93A 2NS7A 3LSRA 2DU9A 4DOZA 5JR3A 3RYRA 1VFCA 5GAGJ 4HDUA 2M3AA 1Z0XA 4F91B 5D5VB 1RUOA 2MH2A 2ZJQF 1EF4A 2M0CA 3MAJA 3WGHA 2HYGD 3OY9A 4NDLA 1YFHA 3PNTA 2Q0OA 2L9NA 1FBQA 1A6IA 1UHMA 1IRFA 3BR3A 4IJAA 2PJRA 4OAYA 4MIMA 1B59A 2EBIA 3K4CA 2IS6A 1S3JA 1BJZA 2A6HF 3CJRB 4KFCA 1J0RA 4ZYEA 4OIQF 4M74A 3JRDA 3ZP5A 2FX0A 2AS5F 3VEPA 1G2HA 1HLVA 3IAM2 3OYBA 2DAOA 2ZNYA 1V55H 1BJAA 2IP2A 2DLLA 2K9LA 2CV1A 3OR2C 2DOAA 3P9IA 1T08B 1YE9A 2BVLA 3RTRA 4NB5A 2QZ8A 4NQWA 4LG0B 2JWTA 1UELB 5F27A 4BGDA 4F7ZA 2X1EA 3OS0A 3L2VA 1YJWI 4ZTJA 4LD5A 4M9ZA 1P4WA 1B4AA 5F1RA 5JI6A 2VPLA 5FLMJ 1X3ZB 1T8IA 3MN2A 1VQKI 3ZMDA 1ERDA 3IUOA 3BCBA 1P9QC 2X0LA 4MQ9F 1ZLKA 2HKOA 2JSCA 3GXOA 3BDDA 2X1DA 3K7AJ 4G94A 3GYHX 4ESJA 1O7LA 4UNOA 5ILUA 3BTIA 3HSEA 3REOA 4LB5A 1V3FA 2OC6A 3J81Z 3RZOJ 3AAFA 1SC7A 3GTOJ 4EJOA 3QODA 2IS1A 3SDGA 3KP5A 3LNQA 1MW7A 3Q3SA 3RIRA 5GADJ 5LHGA 4IOCF 1N77A 1E17A 2A05A 4XONA 3AG4H 5FROA 1U5TA 3E5XA 4EATA 1FP1D 1ETKA 4I6ZA 3ABMH 1WGXA 1FIPA 2AHQA 2EFNA 3G1OA 3TQNA 1DQUA 1OCCH 2NOGA 2RGVA 3GW2A 4Z6YA 4HNUA 3J80K 3L7WA 4XN0A 3FBNB 3IH3A 5AONA 3TDZC 1VQLI 2QQ9A 4AYBN 2AXTC 2EIJH 2L01A 3M1EA 4UXNA 4CCOA 2M8GX 3RI4A 4MEXF 3KFWX 3IWFA 3OYFA 1LVAA 2HDCA 1POGA 1E3HA 2JTVA 3PFIA 2TCTA 4HX4A 2BW3A 4IVNA 4MHGA 1IUFA 5IPAA 3N4MA 1AA7A 1FX7A 1PP8F 5BPIA 3KP3A 3B6CA 2HFHA 2WBMA 3FDYA 4F92B 1IDYA 1SEUA 2UXXA 3S1RJ 2VN2A 2ZMEA 2JZYA 1U5TC 1BC8C 1W1WE 1KU3A 2GXGA 1Z05A 3FXKA 1U9OA 2DT7B 3MVPA 2H6BA 2LY2A 4PSWA 2RQPA 1LVKA 2CO5A 4G7OF 2LY9A 4CGZA 1HKSA 2K5CA 4LB6B 5E3OA 1V54H 4U7BA 5IOZA 1ULYA 2PI0A 4E7SA 3J7ZI 1IXCA 1IN7A 2LYCA 1HKTA 4UVAA 3RKXA 4F55A 2EV0A 2CV0A 4LGWA 5FGMA 3KZYA 2QKLB 2UV1A 2M0MA 1RESA 2PLYA 1BL0A 3OYGA 1MGTA 3S2WA 4ESFA 1ITYA 5E1XA 2HOAA 3RJPA 3TBIA 3CC4I 1BIAA 4HNVA 2VPRA 3TGNA 2XF7A 1W0UA 3C1DA 4M71A 1K7AA 2LK2A 1FYMA 1I3AA 3AG1H 2E1MB 4BDZA 5DM6F 3B02A 3CCVI 2P4WA 2ME0A 2EILH 3CO6C 2GLOA 3SHFA 3ZQ7A 4UHTA 3OIQA 2JA6J 4AU7A 2HVQA 3FM3A 4PZJA 3D5SC 2HVSA 1VQ6I 3I59A 2L2OA 2C6YA 2XUBA 3MEXA 3DWLE 5LGTA 1SFKA 3K4MA 3HL2A 4C3HJ 2UZKA 2MGQA 3O8HA 3H0DA 3GTJJ 4BQNA 3OYIA 3A4CA 1RKWA 3A0HC 3MFKA 2JJ7A 4J01A 2AXLA 1DU6A 4CICA 1ZLJA 2DCEA 4YFKF 2DDBA 5J1YA 1MIJA 1O3QA 1NK2P 4HQEA 3V7SA 3DPUA 5KCMA 1BM9A 4P1WA 2O8XA 5HNFA 1JJ6C 1A5JA 2FE3A 1D0YA 1APLC 1ZR2A 3U21A 5ICFA 3OYLA 2HOTA 2CUZA 2FQ3A 2XGCA 5H20A 5E3MA 4HLYA 3VYSB 1ZKGA 2LMDA 2FBKA 3HRUA 3H9QA 2QWWA 3E6DA 1T0FC 3TP0A 3CP8A 1BI0A 3FXQA 3QRFF 4PSXA 3CD6I 1D0XA 1W7PB 2GA1A 4N9HA 3I54A 4RLFA 1UHSA 3BJAA 3SZTA 1IRXA 2JT1A 4Q48A 3C2BA 2V6CA 5B66C 3DTKA 1D5YA 3LQQA 3FZVA 1RR7A 4UVCA 3M8EA 2KZGA 5EYRA 1K78A 4WF2A 1L0OC 5K7FA 3EYIA 3WTXC 1SD5A 3TMOA 1FLIA 4OMYA 5DM7F 2OD5A 1VQ7I 3BTCA 4L9TA 3VDXA 3JAMK 2ZFWA 3K2AA 4JP0A 3CCYA 3W2AA 4AC0A 4I01A 1DP7P 1VZ0A 3I4PA 5D8LB 3F21A 2HOSA 4E70A 1VTNC 3J80Z 3ASNH 2V9VA 1T2KA 5IT9Z 1HOMA 5J3LA 2ZO4A 3PNVA 3VSKA 3D0SA 3S1QJ 4BY1J 1OLTA 4G6QA 1WJAA 4LIVA 5K5OA 1BIBA 3OYKA 2R7ZJ 2K9SA 2CU7A 2F5VA 3QOEA 3CF2A 3LFKA 4XR6A 1ZN2A 4J19A 3CF5F 2NOJB 4D7NA 1B9MA 5TRDA 1JE8A 1RC9A 2HPIA 5DD4A 1LDJA 3LL7A 4YG2F 3PQKA 2CUJA 3OWTA 4U88A 3PIOF 4B47A 5FLXZ 1ZYRF 4BBSJ 2Y31A 4BL0B 3CJQB 2QM3A 3FMQA 5DUKA 3T5XA 1Y1VJ 2EFOA 3N05A 3F8BA 2CJJA 5K7HA 1I5ZA 2ADUA 3IV5A 2LKSA 1ORKA 4GCVA 2DK8A 1T56A 4ZJZA 5IYDJ 4HG2A 3K1NA 3WTZA 4KMFA 3A01B 3ASOH 2HWVA 5M3FJ 2B7EA 1MMDA 1I3QJ 3HGYA 5F6FA 1WRJA 4A3MJ 1S72I 3M3YJ 3LSMA 3MZ8A 1MZBA 3V7RA 1XGOA 1WJ5A 1YJNI 2KHMA 4GO1A 2IAIA 1IRGA 3WG9A 2LVSA 2WTEA 1S7AA 4PCQA 4IZZA 2DFEA 4DYCA 1SD4A 2F4IA 5E18F 1K6OA 2WAFA 1D1BA 3RQIA 3M8FA 4ZYHA 3DF8A 1Z67A 1TT0A 2HQAA 1C0WA 1XGSA 3K9TA 4A6DA 2QGUA 4RB3C 4ZDOA 3Q9SA 3UR3C 1S7OA 4KUMA 4JK1X 2DOFA 2IW5A 1A6QA 2XHKA 3BR2A 1OCZH 5L3CA 2JVGA 2NVTJ 2CW8A 2WV0A 3CJTB 5B3SH 4X0GA 2CW7A 1RRJA 1ZARA 3HDDA 3HM5A 2R7UA 2HS5A 3ZMTA 1WFXA 3L9FA 3FHZA 4XRSG 3BY6A 5C4JJ 1WPKA 3IC7A 2K85A 1XSVA 3S2DJ 4HLXA 1KQ8A 1ZGAA 2VXDA 3RSNA 1IAWA 1K78B 1T98A 3EETA 1ETXA 5IP7J 4FE7A 2LNBA 4FQGA 5J4VA 1EJ9A 3JRGA 1O4XA 3BCAA 3CMAI 1FYKA 3L2RA 3BG5A 5FFZA 2XRNA 3L2QA 1U5TB 3LAJA 1MMGA 2XV4S 2FMYA 2EINH 2LLKA 4ZTFA 2X51A 4XSXF 1I27A 4BQQA 1TW2A 2ZBKA 2A69F 2ELHA 4YFNF 2DA1A 3MKYB 2HKXA 2KZVA 2F4MB 2I8DA 1FOWA 3MD2A 4RM2A 3ZGKA 2XROA 2NS8A 1Q1VA 1QQIA 2DFIA 2OV7A 5CLSA 2ISYA 1VQ4I 1W5CC 2GA2A 2M8EA 2ZCWA 1ON2A 3OV8A 2L7FP 4QPOA 2GIVA 4XKWA 2HQ5A 2L7ZA 3PSFA 4OOIA 5CYVA 2RNJA 5HLGA 1U6GA 1ETOA 1Z77A 2X1CA 4B48A 1BOBA 5TJJA 2JQ7A 3W2WA 1N78A 1OCPA 2KDZA 2CFXA 4I99C 1SD6A 1Y56A 1ZG1A 2GIZA 3OS2A 1TP4A 3U2RA 3I4MJ 1V5FA 4W97A 1DDNA 4A3CJ 1TWCJ 2FOWA 2BY2A 3ZR8X 3JTGA 5IYCJ 1EA3A 3EPZA 4N0BA 2IXSA 1D8KA 2BHYA 3F3XA 5J1RA 5D6FA 4M6VA 3UKGA 2DK5A 3AFHA 4I09A 2A5WA 4IOAF 1XCBA 2F6CA 2MBFA 3KP6A 2GQQA 1R6RA 1SVLA 3JRAA 4E7IA 1MMAA 2L9RA 1MH3A 1OCTC 2R5ZA 2NXNB 4RMNA 2L4MA 4A3DJ 2VI6A 3CCJI 3S3MA 4G9YA 2BXZA 1F4KA 2XF5A 4Y7NJ 3OSGA 3I4NJ 3LQRA 3QPHA 3ULQB 2DYSH 4BS9A 3BG7A 2DPDA 3E3VA 1TL8A 3HOUJ 2OZ6A 4YEJA 5E17F 4AIJA 2OCEA 2OAZA 3F22A 2DYRH 3Q0UA 3HBLA 3V8KA 5HDNA 3LAPA 3N97A 2XB5A 1G3YA 5M5YJ 3HEFA 2GZWA 2H94A 5BQTA 1QU3A 1R00A 5LGNA 4L9JA 5TGTA 3OOPA 2M9HA 2Y0SA 3CUQB 1NHAA 4WCGA 3CCQI 5K5QA 5BPDA 4M3EA 2VKHA 3A2KA 3RZDJ 2L02A 2KMUA 4G6DA 2MSYA 2IGOA 2GXAA 4CYDA 4XSZF 3CLOA 2K02A 2EIKH 3GEZA 2UWMA 4OAZA 2R7RA 4Y17A 1Y1WJ 3DFGA 2CQKA 2QQAA 2LG4A 5L3FA 2W85A 4LOCA 1LEAA 5DEQA 2ZB9A 4P5OA 1HW2A 1NK3P 4LMYA 1HSTA 3ZQIA 1XSDA 2IA0A 3ZQGA 2K9NA 2QEXI 1MBGA 2JPCA 1Z3YA 3BG6A 2A61A 3NARA 3ABTA 1YW8A 3NQOA 2E1CA 4XK4A 3CCRI 3ZPLA 3FBIB 1JKOC 3QPLA 2QBYA 2Y69H 3O6BB 4L5JA 1DPUA 3GWZA 5HLHA 3X2QH 4AIHA 2PEXA 2OUMA 3K4LA 5LLQA 1LEBA 1N75A 4UV9A 3SQNA 2XAGA 3RKWA 3LOCA 2COMA 3GLLA 4L9VA 3ZN1A 4XLNF 2O6GE 4E4HA 2KJCA 3F6OA 3UNGC 3S15J 2IGNA 5E8GA 2JN6A 1U8BA 4RGUA 3W2VA 1LE8A 5F04A 2ZXJA 3TP3A 2R7DA 2EFPA 1T6SA 2EH3A 3MCZA 1QPMA 1Y0UA 4ITVA 4O5VA 3TO6A 1UCRA 1XDSA 4MLOA 1OQYA 4HF2A 3T1BA 1W5SA 1YQAA 1ZGJA 2FF4A 4DIQA 2VQHA 5CJ9A 1H88C 3KCCA 2JA5J 3H1CA 2QUFA 2H09A 3DTEA 4DYQA 1FSEA 1GLNA 3D5LA 1U8RA 1JI8A 2XGXA 1JKQC 3QU3A 3CCMI 4HDVA 4HZFA 2I10A 2LBFB 3WTUC 1KU9A 1SVOA 4P55A 1GDTA 1U3EM 1QZZA 1NTCA 1BW5A 3R60A 4RB0A 5D4RA 2ESNA 3G71I 4A3LJ 2LC2A 3C2GA 3LSIA 2VKEA 3F8MA 4U0YA 1IDZA 2MD5A 3E0JB 2LH9A 1YITI 4RGRA 3OSFA 1DU0A 2WAEA 1P2FA 3LFUA 1YX3A 4AUXA 9ANTA 4N4NB 2V1XA 4D0PA 5J6XA 4NHJA 1JTXA 1F1ZA 2G0EA 3QYFA 2V7FA 4Z2YA 4S0HB 1DGWY 2A68F 3A1YA 4ESBA 3FMSA 1HW5A 3CZ6A 3S1MJ 4BQOA 4EM0B 1QRYA 4ETSA 4CXFA 2B63J 2JA2A 3R6SA 5HNHA 2ELJA 2NVUB 3CMEI 2X85A 1K61A 1Z91A 2OZUA 3HOXJ 1FYLA 3H36A 2EA2A 3ZCOA 3OL4A 3K1PA 3ZQHA 3OMYA 1A35A 4X6AJ 4CDGA 5F0HA 1QZEA 3S2HJ 4EQQA 4B3XA 3MMYB 4X1EA 5LRRA 1ENHA 2BYVE 3L2WA 4BHPA 4Y4RA 5LRSA 1W36C 2KLOA 3E5QA 2IGMA 2A6TA 3K70D 4B44A 5LBQA 2ID6A 1SFOJ 3E6MA 4M72A 2VJIA 4HF0A 2DODA 1ACIA 2UXNA 2X4HA 1USTA 4RS8A 2PMHA 5EGOB 1WQ2A 2IA2A 4CYCB 4XL9A 2N8GA 3KYCB 1BI1A 2LRDA 2MH9A 4UV8A 3OYJA 1J7KA 2CUFA 2V1UA 4AYBA 3B6AA 3H0GJ 1CF7B 3I55I 2XDVA 5FKLA 4AVPA 2GOXB 1UJ8A 4A5NA 3W6JB 4C2TA 5FKMA 4PUSA 1UG0A 1IO2A 2CQ7A 2FMLA 5BOXA 5FLXK 1VNDA 4M6XA 3FK7A 3DKWA 1VF9A 2QSGX 2RKHA 2M4KA 1TTYA 4ZZLA 1IJWC 3GTPJ 5J8FA 1HW1A 1MNDA 2XIGA 5ED4A 3WTVC 1H8AC 3K6GA 3MZHA 2FNAA 1F43A 1TWAJ 2B9SA 1FSHA 4AD9A 4CSWA 3KETA 2R0QC 4LIUA 4EJVA 3G1MA 5F0CA 5K5RA 5DTDA 4IL6C 3DCFA 4PK4A 1E0EA 4IO9F 3QAHA 2R7WA 1Z7UA 3LSPA 2Z1DA 5HS8A 4A12A 5J40A 2CS3A 2H1KA 4N9IA 4IHXA 2IBDA 2MG4A 3S1NJ 4ZYAA 1OCOH 1FNNA 2EWNA 2LDUA 2XGDA 4V2FA 3RPUD 2CMPA 2BBYA 3TDUC 3HSFA 2DMPA 2ELKA 1FIAA 3GZNB 2CV2A 2VODA 3ZMUA 4BU2A 2LKXA 3PO2J 3WTWC 3CCUI 1XPXA 2Z2SB 1FWZA 2DTRA 2XASA 2AO9A 2KPMA 1BN5A 1ETYA 4HV6A 3TO9A 1IN5A 1MBJA 2XAQA 3KZZA 1L3LA 1LFPA 3H3UA 2OTJI 2CG4A 5HS9A 5D5WB 4WX9A 3HYIA 3R61A 1E3OC 3K70C 2E2JJ 4DYRA 4IHYA 3WTTC 3PO3J 2P6TA 2M87A 2D45A 2HNHA 4AIKA 2NRAC 2P6SA 1X1BA 3QPTA 2WY7Q 3VYUB 3ECOA 2IA1A 2MA3A 1YS6A 2E1OA 1FOYA 5CPRB 2FOKA 2VC1A 3JRBA 1K4SA 2VJJA 1A31A 4IQ4A 2XKOA 1DPRA 1KQ9A 1JHFA 5DV5A 3U9GA 3OYMA 3HOWJ 1W7PD 3I71A 4YFXF 1LUJB 2VXZA 3OYDA 2R5ZB 3AL0C 5EJCA 1PP7U 2R5YA 2E5NA 1ZAOA 1IUYA 3LSKA 1VQPI 3QOPA 2ZC2A 3HHHA 3WG7H 3PJRA 2HI3A 1G3TA 3FM5A 1D3YA 3IRRA 1YYVA 5DCMA 1P7IA 1LFBA 1Z6RA 5EEAA 3M9AA 2EK5A 2O03A 2PG4A 1EH6A 1B72A 3BJOA 1TNTA 3BR0A 4KDPA 1IW7F 1XTAA 2E2HJ 3DKXA 4KJZA 5CVVA 3RKQA 4V2GA 1HBXG 5FRMA 1CGPA 4ABZA 1Z7LA 2DJIA 3ABLH 1V4RA 2DPUA 3E7LA 3FXOA 2LOOA 4A0YA 4KYWA 4RM3A 4EMSA 3PSIA 4G6TB 1BI3A 1D5VA 4ANJA 1GHCA 4AM3A 4YIRX 1J2XA 3BJ6A 2DBBA 2BE5F 2MLKA 2ZFUA 3GFIA 4ZYDA 2F5CA 5JVGF 4KISA 4V19K 1ETQA 4EM1A 4FE4A 1JKPC 2WB1N 3KP2A 3W6KB 1WVRA 3HGGA 5A2QK 5CVJA 1JT0A 2IVMA 2Y9ZA 3I58A 1LE8B 2XAJA 1V5GA 3ZQCA 1IGNA 4FTHA 3HTSB 1DUXC 3HZJA 3FISA 3PL8A 4HQMA 4BNCA 2AQFA 2FD5A 4A3BJ 2VJ4A 1KZHA 3JAMZ 3KEOA 3BG3A 2DJNA 4BACA 2MW8A 5HDGA 2QVOA 4UUVA 1ON1A 2E2IJ 4E7KA 2OJED 2DMTA 2YU3A 3BZCA 3W3CA 2LREA 3IHUA 4PGGA 3L2CA 2E7XA 4MEYF 2STWA 2VL8A 3BR1A 2BEOA 4IHWA 4EJWA 3ZRGA 3CC2I 2QYOA 3S8PA 2M34A 2ZXHA 4B4CA 2E19A 1WJEA 3PIPF 2P7VB 5CQEA 2DQLA 2Q2EA 2WAQA 2ZKZA 1BW6A 2E5ZA 3GMEA 4FX0A 4G12A 2VUMJ 1I50J 2K9QA 3E97A 2A3SA 2KP6A 4M3GA 3TKYA 4IPAA 2JPBA 2E35A 3PUBA 4R1HA 2EFQA 3CMMA 5E3LA 5JHFA 2HDWA 3DEWA 4KIBA 2JRTA 1TQIA 2BY1A 4BXUA 4RA2A 4A3JJ 4ZC3A 5M5XJ 1G4DA 3GCMA 2EV5A 3FXUA 2CGPA 2FA5A 1Y0NA 4KN4X 3JR9A 2DA3A 1LNWA 3FF5A 2E71A 3F0CA 1BR1A 2A07F 4OIOF 1X4OA 3G2BA 5HLTA 4Y33A 1MBFA 5DUIA 1HCRA 4ENKA 5ICGA 3IRQA 1U9NA 1REPC 4BJ5C 2IS4A 3RKYA 3ABUA 2MABA 3K4KA 3WU0A 4D5CA 5H6QA 2BHZA 2VBWA 1B8IB 4CUGA 4B09A 1PDNC 1PVEA 1TQMA 2XPVA 1OFCX 4LLNA 1JUPA 1TBXA 1KQ0A 2Y2ZA 3V42A 4XOPA 4Q5SF 3SYTA 4BJ6C 3KPHA 4A3IJ 1EKEA 1LFUP 4K2EA 3S3OA 3HPGA 1WJDA 2X9DA 4BH9A 1G59A 2R7OA 3ECHA 5E1ZB 2QF7A 1PJRA 3VYTB 2EJRA 1MDMA 2A5YB 3O3KA 3BP8A 3BOQA 1YX5A 4A0XA 2IS2A 2Y30A 3J7YJ 3COAC 2W82A 1R1TA 5EEHA 1IC8A 4EJUA 1X1PA 3WHCA 1OPCA 3VWBA 4L18B 2BV6A 1R49A 2KKOA 4DNCA 1AOYA 4B43A
chains in the Genus database with same CATH topology
3CTAA 1P92A 4CHUA 2K27A 1XMAA 1RUNA 2B0LA 1SFUA 4RAYA 2W24A 5ILVA 5DDGA 4HA8A 4M9XA 3RYPA 4KN7X 5BS6A 2L3DA 1R5GA 3ELKA 3C7JA 1P6RA 1CF7A 3JSOA 3P7NA 3WGIA 3DEUA 4WXDA 5DYMA 3V8JA 4O3MA 3Q5FA 1I1SA 5J8CA 4ENMA 2IRFG 1USSA 4B8XA 1IN4A 1WSUA 2VBZA 4RB2C 1FZPB 6PAXA 1D8JA 4ENNA 1XMKA 4L0YB 3GX4X 3DP7A 2CWEA 4HBLA 3HHGA 3ZN0A 3HOTA 1JHHA 1BI2A 3WODF 2J5PA 3R4KA 3TO7A 3C18A 4ON0A 4XRFA 4GXOA 5DD8A 3KEQA 2FBHA 4I2OA 1HQCA 5KK1A 1RIOH 1F9NA 2IPQX 3EUHA 1J75A 2HGCA 2PBIA 2YX7A 3I0TA 3H92A 3MWMA 3WU1B 1MDMB 2HZTA 2RDPA 2VBYA 2O0YA 2E1NA 4DQ2A 4HAMA 5ICEA 2KRFA 3R0AA 4IHSA 2MC3A 4RGSA 1W5TA 2OQRA 2Z9OA 4WWCA 1XD7A 4EJTA 2YSRA 2K86A 1TLHB 2CW0F 4L0ZB 4IF4A 3FXRA 2FU4A 2NNYA 4LJZF 3GZ6A 2HTSA 5DCMB 4IRGA 5LEKA 2HEOA 3E5UA 3HIFA 2NS0A 2IT0A 2Q8KA 4IRIA 2WWYA 4BAYA 1WWXA 3F8CA 1O3RA 2VBXA 1YS7A 5D5UB 1A04A 3CUOA 3WTSC 2H6CA 1SFXA 3JW4A 4G7ZF 3E6BA 2STTA 2CYYA 1IN8A 4PGHA 2FBIA 4LFUA 5JVTA 3IKTA 4WK8F 4BHBA 5FB2A 2F5DA 4MNUA 1MD0A 3GVAA 2DT5A 1Z1DA 1MKMA 1UFMA 4ASNA 3J81K 1ZG5A 2NNNA 3F6VA 1WI9A 1I1GA 3I64A 1G3SA 4MTEA 3VFZA 2P8TA 4OIPF 1Z6TA 2WC2A 1B6AA 4S04A 4KMUX 1R23A 1XN7A 1T38A 3VOEA 3BZ6A 4CZZA 1YIOA 1ZHFA 2XKPA 2ACJA 4M9SA 2O3FA 2FNPA 4R8HA 2P5LC 3ML6A 1B9NA 1KU7A 2HQRA 5AIQA 2M30A 4JBAA 3LA3A 1AWCA 1UB9A 2NAZA 1ZREA 4I7HA 3K69A 2P7CB 3HOSA 3V7CA 5CVIA 3RPUA 1IXRC 1EV7A 5K1YA 1LDKB 3GFLA 3O2PE 4EGZA 1GXQA 3DQVC 1LDDA 4P9UA 2XAHA 4KIGA 4KICA 3SXYA 2VOOA 3I59B 5JFRA 4GYGA 2FXAA 3ZMVA 1IXSB 3KE2A 3M7GA 4A2UA 2Y0MA 2OA4A 4ZYGA 3CJNA 2F2EA 1YW7A 4LG0A 1U78A 1OMIA 3FMRA 2FRHA 4BHCA 2F5FA 3FWEA 4RAZA 2KJBA 5ICCA 1E2XA 2VT3A 3BPVA 1SAXA 1IN6A 4YIFA 4FHTA 4OU0A 3QU6A 2IJLA 1H9TA 3G73A 2GXBA 3L09A 4HYEA 2P5KA 5LEJA 3P9CA 4Q4ZF 2M5WA 4U0VA 3GZ5A 3F23A 5HS7A 3KP4A 4MGRA 4M6YA 5E20A 3RPQA 4P96A 3DV8A 2D2WA 2OBPA 3T8TA 2P5VA 5FD5A 5L3EA 2Y75A 3FX3A 2XAFA 5LHIA 1ONVA 1T39A 1P4AA 1LQ1A 3HRMA 2BGCA 2EFWA 2QLZA 3T0YA 3GFJA 1FBSA 1G6NA 4L5IA 1SD7A 3HRSA 2ZMEB 1J59A 3EYYA 4HW0A 1I6XA 2DW4A 3WGGA 2H27A 2GWRA 3G3ZA 1UHWA 1QO0D 2MLGA 1FC3A 2Z5UA 3GF2A 2J5OA 1W4MA 1KYZA 2W84A 3KP7A 4KA4A 2R7FA 3RDIA 1FOKA 3WE3A 1YLFA 4U7DA 2G9WA 3WE2A 2PQ8A 1R22A 3GFMA 5JHUA 5DCFA 4Y13A 2YR2A 4LLLA 1G3WA 1HXDA 4MQVA 3ZMZA 2LF7A 2ETHA 1JGSA 3HTUA 4A6EA 1X3UA 3IL2A 1FP2A 1XSXA 3V8LA 1WKMA 5D4SA 1R7JA 2K4BA 1HSJA 3PQJA 1OR7A 2GAUA 1GVJA 1XGNA 2HOEA 4LLGF 4O6JA 2DO7A 1F5TA 2EV6A 1FBUA 5BMZA 4IRHA 1O57A 1OYIA 2L4AA 2V1DA 4KNYA 1O3TA 4M73A 4XBFA 3KLOA 1HKQA 3I53A 2YPRA 1ZRCA 5CVUA 2PFBA 3V4GA 3T8RA 4H0EA 1TQPA 1Z9CA 2HQNA 3CUQC 4OIRF 4KT5C 2K4JA 1XGMA 1JXSA 3GLXA 5L3BA 1SFEA 3CDHA 3IWZA 2HYFA 3J7AO 5IT9K 3GO5A 3Q9VA 1BC7C 2EB7A 3IKVA 2FEZA 2RN7A 2V79A 3VB2A 2KIMA 1XB4A 1KU2A 2LKPA 1RZ4A 2CSOA 3JSPA 2LF8A 1R36A 4I0AA 4ZZDA 2QQBA 2RVCA 1FPQA 4TV7A 3SFZA 1LB2A 3TOBA 2VOPA 4FX4A 5EEGA 4QLCU 3F8NA 5FO5A 5HDKA 3LA2A 4R79A 5D6EA 1OYWA 1SMYF 4S05A 1BBYA 3MZYA 5KVRA 4AWXB 1R1UA 3CUQA 2XVCA 2KIUA 3K0LA 3EQLF 4FT8A 2VE8A 3F8FA 1QZYA 1TNSA 2VE9A 1IF1A 4A5MA 3EDPA 4OMZA 2D1VA 2G7HA 1OKRA 1TW3A 1Q1HA 5FFXA 4CO8A 3H3ZA 2W57A 2Z3YA 3BPXA 1MJBA 1XCVA 3ERED 4EVIA 4RGXA 4UVBA 1MJAA 4BYYA 1R1VA 2ZNZA 4HX8A 5LGUA 4YIIA 2Y48A 4ENJA 1SMTA 3K2ZA 1FT9A 4G7HF 1B1BA 5ILSA 5CVRA 4Q47A 5D5XB 2K7LA 1QNTA 3HSRA 2O61A 4HOBA 1QGPA 1FY7A 3GUDA 1R5HA 5FD6A 3ISPA 2M1BA 3CO7C 5ERIA 4XLPF 3F72A 2LSOA 1EH7A 5L3DA 1LJ9A 3NRVA 4IHTA 1PUEE 1IZ1A 3WTYC 1GXPA 4I02A 4JQFA 3HUGA 4RB1A 3P9KA 4EM2A 2OU2A 1O3SA 2VT2A 2PMUA 2HR3A 3C3WA 4HV5A 2TDXA 3BWGA 4LK1F 2D1HA 1YTYA 5E1WA 3B73A 3ZMSA 2Z33A 3NEUA 1ODDA 1ZRFA 4ZH4F 1EH8A 2Z99A 4GGGA 4KIFA 4I0BA 3U1DA 5L3GA 1XDUA 3I5UA 4G8XA 1ZRDA 2KIFA 3QP6A 2HTJA 5D8KB 1RNLA 3K1MA 2L54A 2PN6A 5HVQC 4WXCA 1RI7A 4EV0A 3KLNA 3E6CC 4LK0F 2EA4A 3JTHA 2OQGA 1QBJA 2VONA 1H0MA 2YX4A 3HRTA 4P9FA 1OYYA 2QBYB 5F64A 1T0FA 2ISZA 1KGSA 1K79A 4Y15A 1YO5C 3SZPA 3LA7A 2F5EA 2W25A 2R3SA 5IT3A 1STZA 2VC0A 4IXAA 4I98B 3DXJF 4PDKA 2G7UA 3LSTA 1S6LA 4BQAA 2M45A 4EGYA 5A2QZ 1S8NA 2ZJ2A 3MQ0A 1YW9A 3R0JA 5HOOA 1H9GA 3TOAA 3VODA 4U0WA 2RC4A 1KA8A 4QWQA 5HLIA 4HF1A 4MTDA 1J5YA 1O7FA 4WXHA 4OINF 2RV8A 4GYIA 1J9IA 2PJPA 2FSWA 3DPLC 4HX7A 3LWFA 1U2WA 1YG2A 1R58A 2A6EF 1P4XA 1W7PA 3DPTA 5LHHA 2E7WA 1S29A 1ZG3A 2DI3A 2QENA 3ROUA 5AIPA 3QP5A 1MJ9A 3L00A 3BROA 1BOAA 1KYWA 2ESHA 2DQRA 2NYXA 5H6RA 1ZH5A 4A0ZA 4L9NA 2DU9A 5JR3A 3RYRA 4HDUA 5D5VB 1RUOA 2MH2A 3MAJA 3WGHA 2HYGD 1YFHA 2Q0OA 1FBQA 1UHMA 1IRFA 4IJAA 1B59A 1S3JA 2A6HF 4OIQF 4KFCA 1J0RA 4ZYEA 4M74A 3ZP5A 2AS5F 3VEPA 2DAOA 2ZNYA 1BJAA 2IP2A 2DLLA 3P9IA 3RTRA 4NB5A 2QZ8A 4NQWA 4LG0B 4F7ZA 4LD5A 4M9ZA 1P4WA 1B4AA 5F1RA 5JI6A 3ZMDA 2X0LA 4MQ9F 1ZLKA 2HKOA 2JSCA 3GXOA 3BDDA 3GYHX 4G94A 4ESJA 1O7LA 4UNOA 5ILUA 3HSEA 3REOA 4LB5A 1V3FA 3J81Z 3AAFA 4EJOA 3KP5A 3RIRA 5LHGA 1E17A 1U5TA 3E5XA 1FP1D 2EFNA 3TQNA 2RGVA 3GW2A 3J80K 3L7WA 5AONA 3TDZC 2QQ9A 3M1EA 2L01A 4UXNA 3RI4A 4MEXF 3KFWX 3IWFA 2HDCA 1LVAA 2JTVA 3PFIA 4HX4A 4IVNA 4MHGA 3N4MA 1FX7A 1PP8F 5BPIA 3KP3A 2HFHA 2UXXA 2VN2A 2ZMEA 2JZYA 1U5TC 1BC8C 1KU3A 2GXGA 1Z05A 2H6BA 2RQPA 2CO5A 4G7OF 4CGZA 1HKSA 4LB6B 4U7BA 2PI0A 1ULYA 1IXCA 1IN7A 1HKTA 4UVAA 3RKXA 2EV0A 4LGWA 5FGMA 3KZYA 2PLYA 1MGTA 3S2WA 4ESFA 5E1XA 3RJPA 1BIAA 3TGNA 3C1DA 4M71A 1K7AA 1FYMA 3B02A 2P4WA 3CO6C 3SHFA 3ZQ7A 4UHTA 3FM3A 4PZJA 3I59A 2C6YA 2XUBA 3MEXA 5LGTA 2UZKA 3MFKA 2AXLA 4CICA 1ZLJA 4YFKF 1O3QA 4HQEA 3V7SA 1BM9A 2O8XA 2FE3A 5ICFA 2FQ3A 5H20A 4HLYA 2FBKA 3HRUA 2QWWA 3E6DA 1BI0A 3FXQA 3QRFF 1W7PB 2GA1A 4N9HA 3I54A 3BJAA 3SZTA 2JT1A 4Q48A 2V6CA 3LQQA 1K78A 3FZVA 4UVCA 3M8EA 4WF2A 1L0OC 3EYIA 3WTXC 1SD5A 1FLIA 4OMYA 2OD5A 4L9TA 3JAMK 2ZFWA 4I01A 1DP7P 3I4PA 5D8LB 3F21A 4E70A 1VTNC 3J80Z 2V9VA 1T2KA 5IT9Z 2ZO4A 3D0SA 4G6QA 5K5OA 1BIBA 3LFKA 1ZN2A 1B9MA 5TRDA 1JE8A 5DD4A 1LDJA 4YG2F 3PQKA 4U88A 5FLXZ 1ZYRF 2QM3A 3FMQA 5DUKA 3T5XA 2EFOA 3F8BA 1I5ZA 2ADUA 4GCVA 2DK8A 3K1NA 3WTZA 4KMFA 2HWVA 5F6FA 1WRJA 1MZBA 3V7RA 1XGOA 4GO1A 1IRGA 3WG9A 2WTEA 4PCQA 1S7AA 1SD4A 5E18F 1K6OA 3M8FA 4ZYHA 3DF8A 1C0WA 1XGSA 3K9TA 4A6DA 4RB3C 3Q9SA 1S7OA 4KUMA 4JK1X 2IW5A 2XHKA 5L3CA 2WV0A 1ZARA 2HS5A 3ZMTA 3L9FA 3FHZA 3BY6A 3IC7A 1XSVA 1KQ8A 4HLXA 1ZGAA 1IAWA 1K78B 1T98A 3EETA 2LNBA 1FYKA 5FFZA 2XRNA 1U5TB 3LAJA 2XV4S 2FMYA 4XSXF 1I27A 1TW2A 2ZBKA 2A69F 2ELHA 4YFNF 2HKXA 2XROA 1QQIA 2DFIA 5CLSA 2ISYA 2GA2A 2M8EA 2ZCWA 1ON2A 3OV8A 2GIVA 4OOIA 5CYVA 2RNJA 5HLGA 1U6GA 5TJJA 2CFXA 1ZG1A 1SD6A 3U2RA 1DDNA 3JTGA 4N0BA 1D8KA 3F3XA 5D6FA 2DK5A 4I09A 1XCBA 2MBFA 3KP6A 2GQQA 2L4MA 4G9YA 1F4KA 3LQRA 3QPHA 3ULQB 2DPDA 3E3VA 2OZ6A 5E17F 4AIJA 2OAZA 3F22A 3V8KA 5HDNA 3LAPA 3N97A 1G3YA 2GZWA 2H94A 5BQTA 1R00A 5LGNA 4L9JA 3OOPA 3CUQB 1NHAA 4WCGA 5K5QA 5BPDA 2L02A 4G6DA 4CYDA 4XSZF 3CLOA 2K02A 3GEZA 2UWMA 4Y17A 3DFGA 2CQKA 2QQAA 5L3FA 2W85A 1LEAA 5DEQA 4P5OA 1HW2A 4LMYA 1HSTA 1XSDA 2IA0A 2JPCA 2A61A 3ABTA 1YW8A 3NQOA 2E1CA 3ZPLA 2QBYA 3O6BB 4L5JA 1DPUA 3GWZA 5HLHA 4AIHA 2PEXA 5LLQA 1LEBA 4UV9A 3SQNA 2XAGA 3RKWA 2COMA 4L9VA 3ZN1A 4XLNF 2O6GE 2KJCA 3F6OA 5E8GA 4RGUA 2ZXJA 2R7DA 2EFPA 1T6SA 3MCZA 1QPMA 1Y0UA 4O5VA 3TO6A 1UCRA 1XDSA 4HF2A 3T1BA 1W5SA 1YQAA 1ZGJA 2FF4A 5CJ9A 3KCCA 2QUFA 2H09A 1FSEA 3D5LA 1U8RA 2XGXA 3QU3A 4HDVA 4HZFA 3WTUC 1KU9A 4P55A 1U3EM 1QZZA 3R60A 4RB0A 5D4RA 2ESNA 3F8MA 4U0YA 2MD5A 4RGRA 1P2FA 2V1XA 4D0PA 5J6XA 4NHJA 1F1ZA 4Z2YA 2A68F 4ESBA 3FMSA 1HW5A 4EM0B 4ETSA 4CXFA 3R6SA 1Z91A 2OZUA 1FYLA 2EA2A 3K1PA 4CDGA 4EQQA 5LRRA 2BYVE 4BHPA 5LRSA 3E5QA 5LBQA 3E6MA 4M72A 4HF0A 2UXNA 2X4HA 1USTA 4RS8A 2PMHA 1WQ2A 2IA2A 1BI1A 2MH9A 4UV8A 1J7KA 2V1UA 1CF7B 4AVPA 4A5NA 3W6JB 2FMLA 5BOXA 5FLXK 4M6XA 3DKWA 2RKHA 1TTYA 4ZZLA 5J8FA 1HW1A 2XIGA 5ED4A 3WTVC 3MZHA 2FNAA 1FSHA 4AD9A 3KETA 4EJVA 5K5RA 3QAHA 1Z7UA 5HS8A 4A12A 4N9IA 1FNNA 2EWNA 2LDUA 2BBYA 3TDUC 3HSFA 2VODA 3ZMUA 3WTWC 1FWZA 2DTRA 2XASA 1BN5A 4HV6A 3TO9A 1IN5A 2XAQA 3KZZA 1L3LA 3H3UA 2CG4A 5HS9A 5D5WB 4WX9A 3HYIA 3R61A 3WTTC 2P6TA 2M87A 2D45A 4AIKA 2NRAC 2P6SA 3QPTA 3ECOA 2IA1A 2MA3A 1YS6A 2FOKA 2VC1A 2XKOA 1DPRA 1KQ9A 1JHFA 5DV5A 3U9GA 1W7PD 3I71A 4YFXF 2VXZA 1PP7U 1ZAOA 1IUYA 3QOPA 3HHHA 1G3TA 3FM5A 1D3YA 3IRRA 1YYVA 5DCMA 1Z6RA 3M9AA 2EK5A 2O03A 2PG4A 1EH6A 3BJOA 1TNTA 4KDPA 1IW7F 5CVVA 1HBXG 1CGPA 1V4RA 2DPUA 4A0YA 4KYWA 4EMSA 1BI3A 1D5VA 1GHCA 1J2XA 3BJ6A 2DBBA 2BE5F 2MLKA 3GFIA 4ZYDA 2F5CA 4EM1A 3KP2A 3W6KB 5A2QK 5CVJA 2IVMA 3I58A 2XAJA 3HTSB 1DUXC 4HQMA 4BNCA 3JAMZ 3KEOA 5HDGA 2QVOA 4UUVA 1ON1A 2YU3A 3IHUA 4PGGA 3L2CA 2E7XA 4MEYF 2STWA 2BEOA 4EJWA 2QYOA 2P7VB 2DQLA 2Q2EA 2ZKZA 4FX0A 2A3SA 3E97A 3TKYA 4IPAA 2JPBA 4R1HA 2EFQA 4KIBA 2JRTA 1TQIA 4BXUA 1G4DA 2EV5A 3FXUA 2CGPA 2FA5A 4KN4X 1LNWA 3FF5A 2A07F 4OIOF 5DUIA 4ENKA 5ICGA 3IRQA 1REPC 3RKYA 3ABUA 3WU0A 5H6QA 2VBWA 4B09A 1PDNC 1TQMA 4LLNA 1TBXA 1KQ0A 4Q5SF 4K2EA 4BH9A 3ECHA 5E1ZB 2EJRA 1MDMA 2A5YB 3O3KA 3BP8A 3BOQA 4A0XA 3COAC 1R1TA 5EEHA 4EJUA 1OPCA 4L18B 2BV6A 2KKOA 4DNCA 1AOYA 5E8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTA A;  1P92 A;  4CHU A;  2K27 A;  1XMA A;  1RUN A;  2B0L A;  1SFU A;  4RAY A;  2W24 A;  5ILV A;  5DDG A;  4HA8 A;  4M9X A;  3RYP A;  4KN7 X;  5BS6 A;  2L3D A;  1R5G A;  3ELK A;  3C7J A;  1P6R A;  1CF7 A;  3JSO A;  3P7N A;  3WGI A;  3DEU A;  4WXD A;  5DYM A;  3V8J A;  4O3M A;  3Q5F A;  1I1S A;  5J8C A;  4ENM A;  2IRF G;  1USS A;  4B8X A;  1IN4 A;  1WSU A;  2VBZ A;  4RB2 C;  1FZP B;  6PAX A;  1D8J A;  4ENN A;  1XMK A;  4L0Y B;  3GX4 X;  3DP7 A;  2CWE A;  4HBL A;  3HHG A;  3ZN0 A;  3HOT A;  1JHH A;  1BI2 A;  3WOD F;  2J5P A;  3R4K A;  3TO7 A;  3C18 A;  4ON0 A;  4XRF A;  4GXO A;  5DD8 A;  3KEQ A;  2FBH A;  4I2O A;  1HQC A;  5KK1 A;  1RIO H;  1F9N A;  2IPQ X;  3EUH A;  1J75 A;  2HGC A;  2PBI A;  2YX7 A;  3I0T A;  3H92 A;  3MWM A;  3WU1 B;  1MDM B;  2HZT A;  2RDP A;  2VBY A;  2O0Y A;  2E1N A;  4DQ2 A;  4HAM A;  5ICE A;  2KRF A;  3R0A A;  4IHS A;  2MC3 A;  4RGS A;  1W5T A;  2OQR A;  2Z9O A;  4WWC A;  1XD7 A;  4EJT A;  2YSR A;  2K86 A;  1TLH B;  2CW0 F;  4L0Z B;  4IF4 A;  3FXR A;  2FU4 A;  2NNY A;  4LJZ F;  3GZ6 A;  2HTS A;  5DCM B;  4IRG A;  5LEK A;  2HEO A;  3E5U A;  3HIF A;  2NS0 A;  2IT0 A;  2Q8K A;  4IRI A;  2WWY A;  4BAY A;  1WWX A;  3F8C A;  1O3R A;  2VBX A;  1YS7 A;  5D5U B;  1A04 A;  3CUO A;  3WTS C;  2H6C A;  1SFX A;  3JW4 A;  4G7Z F;  3E6B A;  2STT A;  2CYY A;  1IN8 A;  4PGH A;  2FBI A;  4LFU A;  5JVT A;  3IKT A;  4WK8 F;  4BHB A;  5FB2 A;  2F5D A;  4MNU A;  1MD0 A;  3GVA A;  2DT5 A;  1Z1D A;  1MKM A;  1UFM A;  4ASN A;  3J81 K;  1ZG5 A;  2NNN A;  3F6V A;  1WI9 A;  1I1G A;  3I64 A;  1G3S A;  4MTE A;  3VFZ A;  2P8T A;  4OIP F;  1Z6T A;  2WC2 A;  1B6A A;  4S04 A;  4KMU X;  1R23 A;  1XN7 A;  1T38 A;  3VOE A;  3BZ6 A;  4CZZ A;  1YIO A;  1ZHF A;  2XKP A;  2ACJ A;  4M9S A;  2O3F A;  2FNP A;  4R8H A;  2P5L C;  3ML6 A;  1B9N A;  1KU7 A;  2HQR A;  5AIQ A;  2M30 A;  4JBA A;  3LA3 A;  1AWC A;  1UB9 A;  2NAZ A;  1ZRE A;  4I7H A;  3K69 A;  2P7C B;  3HOS A;  3V7C A;  5CVI A;  3RPU A;  1IXR C;  1EV7 A;  5K1Y A;  1LDK B;  3GFL A;  3O2P E;  4EGZ A;  1GXQ A;  3DQV C;  1LDD A;  4P9U A;  2XAH A;  4KIG A;  4KIC A;  3SXY A;  2VOO A;  3I59 B;  5JFR A;  4GYG A;  2FXA A;  3ZMV A;  1IXS B;  3KE2 A;  3M7G A;  4A2U A;  2Y0M A;  2OA4 A;  4ZYG A;  3CJN A;  2F2E A;  1YW7 A;  4LG0 A;  1U78 A;  1OMI A;  3FMR A;  2FRH A;  4BHC A;  2F5F A;  3FWE A;  4RAZ A;  2KJB A;  5ICC A;  1E2X A;  2VT3 A;  3BPV A;  1SAX A;  1IN6 A;  4YIF A;  4FHT A;  4OU0 A;  3QU6 A;  2IJL A;  1H9T A;  3G73 A;  2GXB A;  3L09 A;  4HYE A;  2P5K A;  5LEJ A;  3P9C A;  4Q4Z F;  2M5W A;  4U0V A;  3GZ5 A;  3F23 A;  5HS7 A;  3KP4 A;  4MGR A;  4M6Y A;  5E20 A;  3RPQ A;  4P96 A;  3DV8 A;  2D2W A;  2OBP A;  3T8T A;  2P5V A;  5FD5 A;  5L3E A;  2Y75 A;  3FX3 A;  2XAF A;  5LHI A;  1ONV A;  1T39 A;  1P4A A;  1LQ1 A;  3HRM A;  2BGC A;  2EFW A;  2QLZ A;  3T0Y A;  3GFJ A;  1FBS A;  1G6N A;  4L5I A;  1SD7 A;  3HRS A;  2ZME B;  1J59 A;  3EYY A;  4HW0 A;  1I6X A;  2DW4 A;  3WGG A;  2H27 A;  2GWR A;  3G3Z A;  1UHW A;  1QO0 D;  2MLG A;  1FC3 A;  2Z5U A;  3GF2 A;  2J5O A;  1W4M A;  1KYZ A;  2W84 A;  3KP7 A;  4KA4 A;  2R7F A;  3RDI A;  1FOK A;  3WE3 A;  1YLF A;  4U7D A;  2G9W A;  3WE2 A;  2PQ8 A;  1R22 A;  3GFM A;  5JHU A;  5DCF A;  4Y13 A;  2YR2 A;  4LLL A;  1G3W A;  1HXD A;  4MQV A;  3ZMZ A;  2LF7 A;  2ETH A;  1JGS A;  3HTU A;  4A6E A;  1X3U A;  3IL2 A;  1FP2 A;  1XSX A;  3V8L A;  1WKM A;  5D4S A;  1R7J A;  2K4B A;  1HSJ A;  3PQJ A;  1OR7 A;  2GAU A;  1GVJ A;  1XGN A;  2HOE A;  4LLG F;  4O6J A;  2DO7 A;  1F5T A;  2EV6 A;  1FBU A;  5BMZ A;  4IRH A;  1O57 A;  1OYI A;  2L4A A;  2V1D A;  4KNY A;  1O3T A;  4M73 A;  4XBF A;  3KLO A;  1HKQ A;  3I53 A;  2YPR A;  1ZRC A;  5CVU A;  2PFB A;  3V4G A;  3T8R A;  4H0E A;  1TQP A;  1Z9C A;  2HQN A;  3CUQ C;  4OIR F;  4KT5 C;  2K4J A;  1XGM A;  1JXS A;  3GLX A;  5L3B A;  1SFE A;  3CDH A;  3IWZ A;  2HYF A;  3J7A O;  5IT9 K;  3GO5 A;  3Q9V A;  1BC7 C;  2EB7 A;  3IKV A;  2FEZ A;  2RN7 A;  2V79 A;  3VB2 A;  2KIM A;  1XB4 A;  1KU2 A;  2LKP A;  1RZ4 A;  2CSO A;  3JSP A;  2LF8 A;  1R36 A;  4I0A A;  4ZZD A;  2QQB A;  2RVC A;  1FPQ A;  4TV7 A;  3SFZ A;  1LB2 A;  3TOB A;  2VOP A;  4FX4 A;  5EEG A;  4QLC U;  3F8N A;  5FO5 A;  5HDK A;  3LA2 A;  4R79 A;  5D6E A;  1OYW A;  1SMY F;  4S05 A;  1BBY A;  3MZY A;  5KVR A;  4AWX B;  1R1U A;  3CUQ A;  2XVC A;  2KIU A;  3K0L A;  3EQL F;  4FT8 A;  2VE8 A;  3F8F A;  1QZY A;  1TNS A;  2VE9 A;  1IF1 A;  4A5M A;  3EDP A;  4OMZ A;  2D1V A;  2G7H A;  1OKR A;  1TW3 A;  1Q1H A;  5FFX A;  4CO8 A;  3H3Z A;  2W57 A;  2Z3Y A;  3BPX A;  1MJB A;  1XCV A;  3ERE D;  4EVI A;  4RGX A;  4UVB A;  1MJA A;  4BYY A;  1R1V A;  2ZNZ A;  4HX8 A;  5LGU A;  4YII A;  2Y48 A;  4ENJ A;  1SMT A;  3K2Z A;  1FT9 A;  4G7H F;  1B1B A;  5ILS A;  5CVR A;  4Q47 A;  5D5X B;  2K7L A;  1QNT A;  3HSR A;  2O61 A;  4HOB A;  1QGP A;  1FY7 A;  3GUD A;  1R5H A;  5FD6 A;  3ISP A;  2M1B A;  3CO7 C;  5ERI A;  4XLP F;  3F72 A;  2LSO A;  1EH7 A;  5L3D A;  1LJ9 A;  3NRV A;  4IHT A;  1PUE E;  1IZ1 A;  3WTY C;  1GXP A;  4I02 A;  4JQF A;  3HUG A;  4RB1 A;  3P9K A;  4EM2 A;  2OU2 A;  1O3S A;  2VT2 A;  2PMU A;  2HR3 A;  3C3W A;  4HV5 A;  2TDX A;  3BWG A;  4LK1 F;  2D1H A;  1YTY A;  5E1W A;  3B73 A;  3ZMS A;  2Z33 A;  3NEU A;  1ODD A;  1ZRF A;  4ZH4 F;  1EH8 A;  2Z99 A;  4GGG A;  4KIF A;  4I0B A;  3U1D A;  5L3G A;  1XDU A;  3I5U A;  4G8X A;  1ZRD A;  2KIF A;  3QP6 A;  2HTJ A;  5D8K B;  1RNL A;  3K1M A;  2L54 A;  2PN6 A;  5HVQ C;  4WXC A;  1RI7 A;  4EV0 A;  3KLN A;  3E6C C;  4LK0 F;  2EA4 A;  3JTH A;  2OQG A;  1QBJ A;  2VON A;  1H0M A;  2YX4 A;  3HRT A;  4P9F A;  1OYY A;  2QBY B;  5F64 A;  1T0F A;  2ISZ A;  1KGS A;  1K79 A;  4Y15 A;  1YO5 C;  3SZP A;  3LA7 A;  2F5E A;  2W25 A;  2R3S A;  5IT3 A;  1STZ A;  2VC0 A;  4IXA A;  4I98 B;  3DXJ F;  4PDK A;  2G7U A;  3LST A;  1S6L A;  4BQA A;  2M45 A;  4EGY A;  5A2Q Z;  1S8N A;  2ZJ2 A;  3MQ0 A;  1YW9 A;  3R0J A;  5HOO A;  1H9G A;  3TOA A;  3VOD A;  4U0W A;  2RC4 A;  1KA8 A;  4QWQ A;  5HLI A;  4HF1 A;  4MTD A;  1J5Y A;  1O7F A;  4WXH A;  4OIN F;  2RV8 A;  4GYI A;  1J9I A;  2PJP A;  2FSW A;  3DPL C;  4HX7 A;  3LWF A;  1U2W A;  1YG2 A;  1R58 A;  2A6E F;  1P4X A;  1W7P A;  3DPT A;  5LHH A;  2E7W A;  1S29 A;  1ZG3 A;  2DI3 A;  2QEN A;  3ROU A;  5AIP A;  3QP5 A;  1MJ9 A;  3L00 A;  3BRO A;  1BOA A;  1KYW A;  2ESH A;  2DQR A;  2NYX A;  5H6R A;  1ZH5 A;  4A0Z A;  4L9N A;  2DU9 A;  5JR3 A;  3RYR A;  4HDU A;  5D5V B;  1RUO A;  2MH2 A;  3MAJ A;  3WGH A;  2HYG D;  1YFH A;  2Q0O A;  1FBQ A;  1UHM A;  1IRF A;  4IJA A;  1B59 A;  1S3J A;  2A6H F;  4OIQ F;  4KFC A;  1J0R A;  4ZYE A;  4M74 A;  3ZP5 A;  2AS5 F;  3VEP A;  2DAO A;  2ZNY A;  1BJA A;  2IP2 A;  2DLL A;  3P9I A;  3RTR A;  4NB5 A;  2QZ8 A;  4NQW A;  4LG0 B;  4F7Z A;  4LD5 A;  4M9Z A;  1P4W A;  1B4A A;  5F1R A;  5JI6 A;  3ZMD A;  2X0L A;  4MQ9 F;  1ZLK A;  2HKO A;  2JSC A;  3GXO A;  3BDD A;  3GYH X;  4G94 A;  4ESJ A;  1O7L A;  4UNO A;  5ILU A;  3HSE A;  3REO A;  4LB5 A;  1V3F A;  3J81 Z;  3AAF A;  4EJO A;  3KP5 A;  3RIR A;  5LHG A;  1E17 A;  1U5T A;  3E5X A;  1FP1 D;  2EFN A;  3TQN A;  2RGV A;  3GW2 A;  3J80 K;  3L7W A;  5AON A;  3TDZ C;  2QQ9 A;  3M1E A;  2L01 A;  4UXN A;  3RI4 A;  4MEX F;  3KFW X;  3IWF A;  2HDC A;  1LVA A;  2JTV A;  3PFI A;  4HX4 A;  4IVN A;  4MHG A;  3N4M A;  1FX7 A;  1PP8 F;  5BPI A;  3KP3 A;  2HFH A;  2UXX A;  2VN2 A;  2ZME A;  2JZY A;  1U5T C;  1BC8 C;  1KU3 A;  2GXG A;  1Z05 A;  2H6B A;  2RQP A;  2CO5 A;  4G7O F;  4CGZ A;  1HKS A;  4LB6 B;  4U7B A;  2PI0 A;  1ULY A;  1IXC A;  1IN7 A;  1HKT A;  4UVA A;  3RKX A;  2EV0 A;  4LGW A;  5FGM A;  3KZY A;  2PLY A;  1MGT A;  3S2W A;  4ESF A;  5E1X A;  3RJP A;  1BIA A;  3TGN A;  3C1D A;  4M71 A;  1K7A A;  1FYM A;  3B02 A;  2P4W A;  3CO6 C;  3SHF A;  3ZQ7 A;  4UHT A;  3FM3 A;  4PZJ A;  3I59 A;  2C6Y A;  2XUB A;  3MEX A;  5LGT A;  2UZK A;  3MFK A;  2AXL A;  4CIC A;  1ZLJ A;  4YFK F;  1O3Q A;  4HQE A;  3V7S A;  1BM9 A;  2O8X A;  2FE3 A;  5ICF A;  2FQ3 A;  5H20 A;  4HLY A;  2FBK A;  3HRU A;  2QWW A;  3E6D A;  1BI0 A;  3FXQ A;  3QRF F;  1W7P B;  2GA1 A;  4N9H A;  3I54 A;  3BJA A;  3SZT A;  2JT1 A;  4Q48 A;  2V6C A;  3LQQ A;  1K78 A;  3FZV A;  4UVC A;  3M8E A;  4WF2 A;  1L0O C;  3EYI A;  3WTX C;  1SD5 A;  1FLI A;  4OMY A;  2OD5 A;  4L9T A;  3JAM K;  2ZFW A;  4I01 A;  1DP7 P;  3I4P A;  5D8L B;  3F21 A;  4E70 A;  1VTN C;  3J80 Z;  2V9V A;  1T2K A;  5IT9 Z;  2ZO4 A;  3D0S A;  4G6Q A;  5K5O A;  1BIB A;  3LFK A;  1ZN2 A;  1B9M A;  5TRD A;  1JE8 A;  5DD4 A;  1LDJ A;  4YG2 F;  3PQK A;  4U88 A;  5FLX Z;  1ZYR F;  2QM3 A;  3FMQ A;  5DUK A;  3T5X A;  2EFO A;  3F8B A;  1I5Z A;  2ADU A;  4GCV A;  2DK8 A;  3K1N A;  3WTZ A;  4KMF A;  2HWV A;  5F6F A;  1WRJ A;  1MZB A;  3V7R A;  1XGO A;  4GO1 A;  1IRG A;  3WG9 A;  2WTE A;  4PCQ A;  1S7A A;  1SD4 A;  5E18 F;  1K6O A;  3M8F A;  4ZYH A;  3DF8 A;  1C0W A;  1XGS A;  3K9T A;  4A6D A;  4RB3 C;  3Q9S A;  1S7O A;  4KUM A;  4JK1 X;  2IW5 A;  2XHK A;  5L3C A;  2WV0 A;  1ZAR A;  2HS5 A;  3ZMT A;  3L9F A;  3FHZ A;  3BY6 A;  3IC7 A;  1XSV A;  1KQ8 A;  4HLX A;  1ZGA A;  1IAW A;  1K78 B;  1T98 A;  3EET A;  2LNB A;  1FYK A;  5FFZ A;  2XRN A;  1U5T B;  3LAJ A;  2XV4 S;  2FMY A;  4XSX F;  1I27 A;  1TW2 A;  2ZBK A;  2A69 F;  2ELH A;  4YFN F;  2HKX A;  2XRO A;  1QQI A;  2DFI A;  5CLS A;  2ISY A;  2GA2 A;  2M8E A;  2ZCW A;  1ON2 A;  3OV8 A;  2GIV A;  4OOI A;  5CYV A;  2RNJ A;  5HLG A;  1U6G A;  5TJJ A;  2CFX A;  1ZG1 A;  1SD6 A;  3U2R A;  1DDN A;  3JTG A;  4N0B A;  1D8K A;  3F3X A;  5D6F A;  2DK5 A;  4I09 A;  1XCB A;  2MBF A;  3KP6 A;  2GQQ A;  2L4M A;  4G9Y A;  1F4K A;  3LQR A;  3QPH A;  3ULQ B;  2DPD A;  3E3V A;  2OZ6 A;  5E17 F;  4AIJ A;  2OAZ A;  3F22 A;  3V8K A;  5HDN A;  3LAP A;  3N97 A;  1G3Y A;  2GZW A;  2H94 A;  5BQT A;  1R00 A;  5LGN A;  4L9J A;  3OOP A;  3CUQ B;  1NHA A;  4WCG A;  5K5Q A;  5BPD A;  2L02 A;  4G6D A;  4CYD A;  4XSZ F;  3CLO A;  2K02 A;  3GEZ A;  2UWM A;  4Y17 A;  3DFG A;  2CQK A;  2QQA A;  5L3F A;  2W85 A;  1LEA A;  5DEQ A;  4P5O A;  1HW2 A;  4LMY A;  1HST A;  1XSD A;  2IA0 A;  2JPC A;  2A61 A;  3ABT A;  1YW8 A;  3NQO A;  2E1C A;  3ZPL A;  2QBY A;  3O6B B;  4L5J A;  1DPU A;  3GWZ A;  5HLH A;  4AIH A;  2PEX A;  5LLQ A;  1LEB A;  4UV9 A;  3SQN A;  2XAG A;  3RKW A;  2COM A;  4L9V A;  3ZN1 A;  4XLN F;  2O6G E;  2KJC A;  3F6O A;  5E8G A;  4RGU A;  2ZXJ A;  2R7D A;  2EFP A;  1T6S A;  3MCZ A;  1QPM A;  1Y0U A;  4O5V A;  3TO6 A;  1UCR A;  1XDS A;  4HF2 A;  3T1B A;  1W5S A;  1YQA A;  1ZGJ A;  2FF4 A;  5CJ9 A;  3KCC A;  2QUF A;  2H09 A;  1FSE A;  3D5L A;  1U8R A;  2XGX A;  3QU3 A;  4HDV A;  4HZF A;  3WTU C;  1KU9 A;  4P55 A;  1U3E M;  1QZZ A;  3R60 A;  4RB0 A;  5D4R A;  2ESN A;  3F8M A;  4U0Y A;  2MD5 A;  4RGR A;  1P2F A;  2V1X A;  4D0P A;  5J6X A;  4NHJ A;  1F1Z A;  4Z2Y A;  2A68 F;  4ESB A;  3FMS A;  1HW5 A;  4EM0 B;  4ETS A;  4CXF A;  3R6S A;  1Z91 A;  2OZU A;  1FYL A;  2EA2 A;  3K1P A;  4CDG A;  4EQQ A;  5LRR A;  2BYV E;  4BHP A;  5LRS A;  3E5Q A;  5LBQ A;  3E6M A;  4M72 A;  4HF0 A;  2UXN A;  2X4H A;  1UST A;  4RS8 A;  2PMH A;  1WQ2 A;  2IA2 A;  1BI1 A;  2MH9 A;  4UV8 A;  1J7K A;  2V1U A;  1CF7 B;  4AVP A;  4A5N A;  3W6J B;  2FML A;  5BOX A;  5FLX K;  4M6X A;  3DKW A;  2RKH A;  1TTY A;  4ZZL A;  5J8F A;  1HW1 A;  2XIG A;  5ED4 A;  3WTV C;  3MZH A;  2FNA A;  1FSH A;  4AD9 A;  3KET A;  4EJV A;  5K5R A;  3QAH A;  1Z7U A;  5HS8 A;  4A12 A;  4N9I A;  1FNN A;  2EWN A;  2LDU A;  2BBY A;  3TDU C;  3HSF A;  2VOD A;  3ZMU A;  3WTW C;  1FWZ A;  2DTR A;  2XAS A;  1BN5 A;  4HV6 A;  3TO9 A;  1IN5 A;  2XAQ A;  3KZZ A;  1L3L A;  3H3U A;  2CG4 A;  5HS9 A;  5D5W B;  4WX9 A;  3HYI A;  3R61 A;  3WTT C;  2P6T A;  2M87 A;  2D45 A;  4AIK A;  2NRA C;  2P6S A;  3QPT A;  3ECO A;  2IA1 A;  2MA3 A;  1YS6 A;  2FOK A;  2VC1 A;  2XKO A;  1DPR A;  1KQ9 A;  1JHF A;  5DV5 A;  3U9G A;  1W7P D;  3I71 A;  4YFX F;  2VXZ A;  1PP7 U;  1ZAO A;  1IUY A;  3QOP A;  3HHH A;  1G3T A;  3FM5 A;  1D3Y A;  3IRR A;  1YYV A;  5DCM A;  1Z6R A;  3M9A A;  2EK5 A;  2O03 A;  2PG4 A;  1EH6 A;  3BJO A;  1TNT A;  4KDP A;  1IW7 F;  5CVV A;  1HBX G;  1CGP A;  1V4R A;  2DPU A;  4A0Y A;  4KYW A;  4EMS A;  1BI3 A;  1D5V A;  1GHC A;  1J2X A;  3BJ6 A;  2DBB A;  2BE5 F;  2MLK A;  3GFI A;  4ZYD A;  2F5C A;  4EM1 A;  3KP2 A;  3W6K B;  5A2Q K;  5CVJ A;  2IVM A;  3I58 A;  2XAJ A;  3HTS B;  1DUX C;  4HQM A;  4BNC A;  3JAM Z;  3KEO A;  5HDG A;  2QVO A;  4UUV A;  1ON1 A;  2YU3 A;  3IHU A;  4PGG A;  3L2C A;  2E7X A;  4MEY F;  2STW A;  2BEO A;  4EJW A;  2QYO A;  2P7V B;  2DQL A;  2Q2E A;  2ZKZ A;  4FX0 A;  2A3S A;  3E97 A;  3TKY A;  4IPA A;  2JPB A;  4R1H A;  2EFQ A;  4KIB A;  2JRT A;  1TQI A;  4BXU A;  1G4D A;  2EV5 A;  3FXU A;  2CGP A;  2FA5 A;  4KN4 X;  1LNW A;  3FF5 A;  2A07 F;  4OIO F;  5DUI A;  4ENK A;  5ICG A;  3IRQ A;  1REP C;  3RKY A;  3ABU A;  3WU0 A;  5H6Q A;  2VBW A;  4B09 A;  1PDN C;  1TQM A;  4LLN A;  1TBX A;  1KQ0 A;  4Q5S F;  4K2E A;  4BH9 A;  3ECH A;  5E1Z B;  2EJR A;  1MDM A;  2A5Y B;  3O3K A;  3BP8 A;  3BOQ A;  4A0X A;  3COA C;  1R1T A;  5EEH A;  4EJU A;  1OPC A;  4L18 B;  2BV6 A;  2KKO A;  4DNC A;  1AOY A;  5E8I A; 
#chains in the Genus database with same CATH topology
 3CTA A;  3BLY A;  3NAU A;  5J1U A;  1P92 A;  3ERM A;  4CHU A;  2R93 J;  2K27 A;  1XMA A;  1RUN A;  1SVM A;  4M3F A;  3FIW A;  2B0L A;  2DTZ A;  1SFU A;  4RAY A;  5EDN A;  3KIO A;  3DLA A;  2W24 A;  3RQ4 A;  5ILV A;  4F52 A;  5DDG A;  3FK6 A;  4HA8 A;  4M9X A;  4C3I J;  1IRZ A;  3RYP A;  2R7T A;  2QKM B;  4E7Z A;  4KN7 X;  5BS6 A;  2L3D A;  4N4O B;  5FJ8 J;  1OJL A;  2X6Y A;  1R5G A;  3ELK A;  3C7J A;  1P6R A;  1CF7 A;  1WH7 A;  3JSO A;  1T95 A;  3P7N A;  3WGI A;  3DEU A;  2DFF A;  3KYL A;  4WXD A;  1DGR M;  5DYM A;  4XLC A;  4RAG A;  3V8J A;  1IV6 A;  3JRF A;  1DP3 A;  4O3M A;  3Q5F A;  2XPU A;  3K10 A;  1I1S A;  2LD5 A;  3HKZ A;  5J8C A;  4ENM A;  4GDF A;  2IRF G;  1USS A;  2EPF A;  2LTP A;  4B8X A;  1IN4 A;  4DW6 A;  1T33 A;  1WSU A;  2NVY J;  4HEA 2;  3FKJ A;  2VBZ A;  4RB2 C;  1FZP B;  2L9V A;  6PAX A;  1D8J A;  4ENN A;  1XMK A;  1I39 A;  4L0Y B;  1JTY A;  3GX4 X;  3DP7 A;  1MSF C;  2BXY A;  2CWE A;  4FIS A;  1JUM A;  4HBL A;  3BQZ A;  3HHG A;  4BUP A;  1YJ9 I;  1BA5 A;  3ZN0 A;  2EQR A;  3HOT A;  4QSH A;  1JHH A;  3KX2 A;  1BI2 A;  4IEJ A;  3WOD F;  2QSH X;  2HPM A;  1JGG A;  2J5P A;  5JLW A;  3R4K A;  1HDD C;  3TO7 A;  4BXX J;  2O5R A;  3C18 A;  4ON0 A;  4XRF A;  2EIM H;  4GXO A;  5DD8 A;  4E7H A;  3KEQ A;  3M1C A;  2FBH A;  4I2O A;  1HQC A;  5KK1 A;  1RIO H;  1F9N A;  3HXL A;  3OL3 A;  2IPQ X;  2HU9 A;  2XF6 A;  3EUH A;  2X6O A;  5H2F C;  1J75 A;  3J7A Y;  2XAU A;  2HGC A;  2JRM A;  5GPA A;  1X2N A;  2PBI A;  2YX7 A;  3I0T A;  4PJN A;  1FMV A;  2DXI A;  3H92 A;  1XS9 A;  3MWM A;  3WU1 B;  1MDM B;  2HZD A;  5DS9 A;  4XIC A;  2HZT A;  2RDP A;  2VBY A;  2O0Y A;  2E1N A;  3K4J A;  4DQ2 A;  3MKW B;  3HOV J;  2CQX A;  1B72 B;  5CKT A;  4HAM A;  3FXJ A;  2PMZ N;  3W6V A;  1X4P A;  1MBK A;  2KRF A;  5ICE A;  4A93 J;  3R0A A;  4IHS A;  1X1A A;  2MC3 A;  1AHD P;  3I3L A;  4RGS A;  1W5T A;  2OQR A;  2Z9O A;  4WWC A;  4ZDP A;  2M2E A;  1XD7 A;  4EJT A;  2LY1 A;  2YSR A;  4ZDL A;  3AG3 H;  3MKZ A;  2W7N A;  2K86 A;  1TLH B;  2CW0 F;  4H4K C;  4L0Z B;  1GUU A;  1YHQ I;  4IF4 A;  3FXR A;  4W1U A;  3A0B C;  2FU4 A;  2NNY A;  4LJZ F;  3GZ6 A;  1R5I D;  2HTS A;  5DCM B;  1BR2 A;  3BR5 A;  4IRG A;  5LEK A;  2O7O A;  2HEO A;  3E5U A;  3KYD B;  4UUS A;  3HIF A;  4XNF A;  2WAQ N;  2NS0 A;  2H8W A;  2IT0 A;  4NBQ A;  4A3G J;  3SEZ A;  4NUB A;  2Q8K A;  3VSL A;  4IRI A;  2WWY A;  5E8I A;  3BR6 A;  2KT0 A;  2GOM A;  2TRT A;  4XN3 A;  4BAY A;  1X1D A;  5EF6 A;  5FKO A;  2BZT A;  1WWX A;  2M7A A;  2ECB A;  4IQJ A;  3CMY A;  2XB0 X;  2ZSI B;  3F8C A;  1O3R A;  2JVH A;  3M4O J;  2VBX A;  1YS7 A;  2L7M P;  5D5U B;  1ZGW A;  3CC7 I;  2VQG A;  5FLV A;  1A04 A;  3CUO A;  4EEF G;  3GTQ J;  3WTS C;  2RQQ A;  3DKY A;  3L2U A;  2H6C A;  1SFX A;  2UUZ A;  1SAN A;  2P81 A;  5KNL A;  2LR8 A;  3JW4 A;  2KL4 A;  3IH2 A;  5FKK A;  4G7Z F;  3E6B A;  3VYR B;  2STT A;  2CYY A;  2V9K A;  1IN8 A;  3WHB A;  5KAF C;  2Y0S N;  4PGH A;  1TWH J;  2FBI A;  1P7J A;  1RET A;  4LFU A;  2HVR A;  3OYE A;  3HC7 A;  4XID A;  1ZR4 A;  5JVT A;  4E6K G;  3IKT A;  4WK8 F;  4BHB A;  1VQ5 I;  5FB2 A;  3A03 A;  2F5D A;  4MNU A;  1MD0 A;  3GVA A;  2DT5 A;  1Z1D A;  1MKM A;  1R9T J;  4C2M J;  1UFM A;  2EZH A;  2E36 A;  4ASN A;  3GBG A;  3J81 K;  3CCL I;  2NNN A;  4BE1 A;  1ZG5 A;  3F6V A;  1WCM J;  3DBH B;  1WI9 A;  1I1G A;  5KHD A;  2VKV A;  4UB6 C;  3I64 A;  2E34 A;  2MYS A;  1LPQ A;  2V9P A;  2GM4 A;  1TZL A;  1AKH B;  1G3S A;  4MTE A;  3VFZ A;  4F3Q A;  2P8T A;  4OIP F;  2R7X A;  1BR4 A;  1XC5 A;  3JRI A;  1Z6T A;  2WC2 A;  1B6A A;  1VQN I;  2F4O B;  2ZME C;  4IHV A;  4S04 A;  4KMU X;  4BXF A;  2W4S A;  1J09 A;  1GV5 A;  1R23 A;  1XN7 A;  5BNG A;  3OS1 A;  1CQT A;  1LKX A;  1T38 A;  3VOE A;  5GAH J;  3BZ6 A;  2WAD A;  4CZZ A;  1YIO A;  1ZHF A;  1TWG J;  1S7E A;  3I9V 2;  2XKP A;  3CCE I;  2ACJ A;  4M9S A;  2O3F A;  2FNP A;  4R8H A;  2P5L C;  4CCJ A;  3ML6 A;  1B9N A;  2L5Q A;  3CDI A;  1KU7 A;  3S17 J;  1PUF A;  2JUG A;  5IY5 H;  4HST A;  2HQR A;  5AIQ A;  3AL0 B;  2M30 A;  4FET A;  4JBA A;  3LA3 A;  1AWC A;  1UB9 A;  2NAZ A;  1ZRE A;  4I7H A;  2O8K A;  3K69 A;  2P7C B;  3OIP A;  3MKL A;  2JA7 J;  3HOS A;  1QHH D;  2DA7 A;  3V7C A;  1RKT A;  2H1L A;  2I5U A;  4CCN A;  2WA0 A;  2CQN A;  5CVI A;  5F1J A;  3BG9 A;  3RPU A;  2CFO A;  1IXR C;  1EV7 A;  1X58 A;  2K9M A;  5K1Y A;  1LDK B;  3GFL A;  2X6W A;  3O2P E;  3NWT A;  4C2U A;  2V1N A;  2Z16 A;  4EGZ A;  1GXQ A;  3DQV C;  2MC4 A;  3SZG A;  4AID A;  1LDD A;  4P9U A;  1MBH A;  2KIQ A;  2XAH A;  2OPT A;  3EUK L;  4KIG A;  2L0K A;  4KIC A;  3SXY A;  1ZQ3 P;  2VOO A;  3S3N A;  4YEL A;  2OF7 A;  3I59 B;  5JFR A;  4GYG A;  2FXA A;  5B5E C;  3ZMV A;  1IXS B;  1MNE A;  3KE2 A;  1TC3 C;  4MFE A;  3M7G A;  4D1Q A;  3H9G A;  4A2U A;  4C3J J;  2DMU A;  3KZI C;  3K4B A;  3K4N A;  2CQQ A;  2Y0M A;  1PYV A;  2OA4 A;  1D1C A;  1R4M B;  2ZXI A;  2X48 A;  4PJL A;  4ZYG A;  3CJN A;  2F2E A;  1YW7 A;  1YRN A;  3FKI J;  2R7Q A;  4LG0 A;  5EZH A;  1U78 A;  1OMI A;  3FMR A;  2DMN A;  1YOV B;  2FRH A;  4BHC A;  1AKH A;  2F5F A;  2W48 A;  3FWE A;  4RAZ A;  2KJB A;  3TL4 X;  5ICC A;  1X19 A;  1E2X A;  3OR1 C;  2VT3 A;  3BPV A;  1SAX A;  1IN6 A;  3ONQ A;  1D1A A;  5E3N A;  4YIF A;  2DT6 A;  4KIT B;  3CES A;  3LSG A;  4FHT A;  4OU0 A;  3QU6 A;  2IJL A;  3LSH A;  4CA0 A;  3OYH A;  2BY3 A;  2HXO A;  4DZJ A;  3G73 A;  1H9T A;  2XRL A;  3L09 A;  2GXB A;  3TW7 A;  4HYE A;  4XLA A;  2NVX J;  2P5K A;  5J47 A;  5LEJ A;  3P9C A;  4Q4Z F;  3EUH C;  3WU2 C;  1JJ8 C;  2M5W A;  4U0V A;  3GZ5 A;  3FXL A;  3F23 A;  2W1O A;  3G4S I;  5HS7 A;  4E7L A;  2NVQ J;  2BY0 A;  3KP4 A;  3HPH A;  3BTJ A;  4MGR A;  4M6Y A;  5E20 A;  3RPQ A;  1W36 D;  4P96 A;  3DV8 A;  2D2W A;  4UY8 I;  2OBP A;  3T8T A;  2P5V A;  2DN0 A;  5FRN A;  5FD5 A;  1JT6 A;  5L3E A;  2Y75 A;  2KIS A;  3F9K A;  3FX3 A;  4HRI A;  2XAF A;  3P5J A;  1TT5 B;  5LHI A;  4HSR A;  3OYA A;  1ONV A;  2Q2E B;  1T39 A;  4XOR A;  4XOT A;  5IYB J;  1P4A A;  2VIX A;  1K83 J;  1LQ1 A;  2KRC A;  3S32 A;  1UZC A;  3HRM A;  3HG9 A;  3L1P A;  4PJ0 C;  2BGC A;  4BBR J;  2EFW A;  1UMQ A;  2R4G A;  2QLZ A;  4B3A A;  2GBY A;  3T0Y A;  3GFJ A;  1XMX A;  1FBS A;  1G6N A;  4L5I A;  1SD7 A;  4D9J A;  3HRS A;  2M7B A;  2ZME B;  1ZTR A;  3RCO A;  1J59 A;  3EYY A;  4HW0 A;  1I6X A;  2DW4 A;  3WGG A;  4BDY A;  2H27 A;  1M1E B;  3G3Z A;  2GWR A;  1UHW A;  3HUG B;  1QO0 D;  2MLG A;  3IH4 A;  4F93 B;  4FCY A;  4XLE A;  2VJ5 A;  1FC3 A;  2Z5U A;  3GTG J;  2XPW A;  3GF2 A;  3DBL B;  1B8I A;  5CQG A;  1WH5 A;  2J5O A;  1W4M A;  4NNJ A;  1Y8Q B;  2DMQ A;  1F36 A;  4UUS B;  1HA8 A;  1KYZ A;  2W84 A;  3KP7 A;  4KA4 A;  1ETV A;  2R92 J;  2R7F A;  3BC8 A;  3OYN A;  3RDI A;  1FOK A;  3WE3 A;  1YLF A;  4U7D A;  3AKZ A;  1QA6 A;  5GPC A;  2CRG A;  3SFI A;  1X1C A;  2G9W A;  1OIS A;  3A02 A;  3QWL A;  4PJJ A;  3WE2 A;  2PQ8 A;  3DTI A;  1R22 A;  2RNG A;  2RRE A;  3GFM A;  5JHU A;  1FJL A;  5DCF A;  1KON A;  4Y13 A;  4BEH A;  4U87 A;  1Z21 A;  5F08 A;  2YR2 A;  4LLL A;  3H35 A;  5HOD A;  3HJE A;  1G3W A;  1HXD A;  1FTZ A;  4MQV A;  4NQW B;  3ZMZ A;  4IKF A;  2DA4 A;  2DA5 A;  2ZJP F;  3OYC A;  1ETW A;  2LF7 A;  2ETH A;  1JGS A;  4XLH A;  3ZQL A;  3HTU A;  4A6E A;  4XLF A;  4DBR A;  1VQM I;  1X3U A;  3IL2 A;  4DJA A;  1FP2 A;  3CQZ J;  1XSX A;  3V8L A;  1WKM A;  3CCS I;  5D4S A;  1R7J A;  1MBE A;  2K4B A;  1HSJ A;  4GRI A;  1RPW A;  4IX7 A;  3PQJ A;  1OR7 A;  2GAU A;  1GVJ A;  1XGN A;  3ZXS A;  3PUF A;  3LMM A;  1D0Z A;  2HOE A;  3PNY A;  4LLG F;  4O6J A;  1HF0 A;  2M4G A;  2DO7 A;  3FXM A;  4XMY A;  1F5T A;  3QPS A;  2MD0 A;  5E79 C;  2EV6 A;  3SJM A;  1E3P A;  1FBU A;  5BMZ A;  4IRH A;  2ME6 A;  1O57 A;  1OYI A;  2DDA A;  2L4A A;  2V1D A;  4CH7 A;  4KNY A;  3S14 J;  1O3T A;  4M73 A;  3HOZ J;  4XBF A;  3KLO A;  3PFY A;  2ZJR F;  1HKQ A;  3I53 A;  2YPR A;  1ZRC A;  5CVU A;  1Y8R B;  2PFB A;  2YUS A;  3V4G A;  3T8R A;  4H0E A;  1TQP A;  1Z9C A;  2HQN A;  3CUQ C;  4OIR F;  4KT5 C;  2K4J A;  1XGM A;  3JRE A;  1JXS A;  3GLX A;  4OWR B;  5GAE J;  5F0F A;  2R7V A;  1FTT A;  5L3B A;  1SFE A;  3CDH A;  3IWZ A;  1A36 A;  2HYF A;  2V6E A;  1OCR H;  3J7A O;  4D7M A;  5GTI C;  5IT9 K;  4BE0 A;  3GO5 A;  3Q9V A;  1BC7 C;  3GTL J;  5IP6 A;  2EB7 A;  3IKV A;  2QCO A;  1UAA A;  2F48 A;  2FEZ A;  2RN7 A;  2V79 A;  4MFD A;  4PFP A;  3VB2 A;  5LFA A;  2KIM A;  2KDO A;  1XB4 A;  1KU2 A;  2LKP A;  3VPR A;  1RZ4 A;  2CSO A;  3JSP A;  3M07 A;  2LF8 A;  4M3B A;  4A3F J;  2MFZ A;  1R36 A;  1NG7 A;  4I0A A;  1R71 A;  4ZZD A;  2QQB A;  2RVC A;  1FPQ A;  2VQL A;  4TV7 A;  3SFZ A;  5M3M J;  1LB2 A;  3TOB A;  2VOP A;  4FX4 A;  5EEG A;  1TWF J;  5LD2 C;  4QLC U;  1MMN A;  4UUT A;  1VQ8 I;  3F8N A;  2FQ4 A;  5FO5 A;  5HDK A;  3LA2 A;  3H5A A;  4R79 A;  5D6E A;  3H9J A;  1OYW A;  1SMY F;  3CDL A;  4S05 A;  1BBY A;  2PX9 A;  1MMS A;  1HC8 A;  2XSJ C;  3MZY A;  5KVR A;  4AWX B;  1R1U A;  3ABK H;  3CUQ A;  2XVC A;  1X3W B;  2KIU A;  3EQL F;  3K0L A;  4FT8 A;  2VE8 A;  1Y6I A;  4J00 A;  3F8F A;  1K4T A;  3C2H A;  1G8X A;  2JA8 J;  2DA2 A;  1QZY A;  4KT6 A;  1TNS A;  2YS9 A;  3BTL A;  2VE9 A;  2Q1Z B;  4RLQ A;  4D5F A;  2WB1 A;  1MNM C;  4QIW N;  1IF1 A;  4A5M A;  3EDP A;  4DZP A;  4OMZ A;  4DBQ A;  3EUA A;  2D1V A;  2G7H A;  4A3E J;  2D5V A;  1OKR A;  2YU9 J;  1TW3 A;  1Q1H A;  4XKV A;  5FFX A;  4CO8 A;  2AQE A;  3H3Z A;  2BOL A;  2W57 A;  2Z3Y A;  3BPX A;  1MJB A;  1XCV A;  3ERE D;  2DFH A;  4EVI A;  2PJR B;  1YRN B;  4RGX A;  3Q0W A;  4UVB A;  2QSF X;  1MJA A;  3BZK A;  1ZEL A;  4BYY A;  1R1V A;  2ZNZ A;  1YIJ I;  3S16 J;  4HX8 A;  5LGU A;  1S5L C;  3CLQ A;  3Q0V A;  3JRH A;  4JX6 A;  4YII A;  2Y48 A;  4ENJ A;  3BT9 A;  1SMT A;  1X2M A;  3K2Z A;  1FT9 A;  2EZI A;  3G6E I;  4G7H F;  1B1B A;  5ILS A;  4B1R A;  2RAE A;  5CVR A;  4Q47 A;  5D5X B;  2K7L A;  2H8R A;  1QNT A;  3HSR A;  2COB A;  4JOM A;  2O61 A;  5IOY A;  3TED A;  4A69 C;  4HOB A;  4RBO A;  5EG0 B;  5TIS C;  1QGP A;  3ZOB A;  1FY7 A;  1U0J A;  3QYB A;  4II3 A;  5GP9 A;  3GUD A;  1R5H A;  5FD6 A;  1RR8 C;  3ISP A;  2M1B A;  3JCU C;  3CO7 C;  5ERI A;  4XLP F;  2DOE A;  1QVT A;  2W00 A;  3F72 A;  4CCM A;  4XQF A;  2LSO A;  5C4X J;  1EH7 A;  2IGK A;  5L3D A;  1LJ9 A;  5EZG A;  3NRV A;  4IHT A;  1PUE E;  1SAU A;  1IZ1 A;  2E1M C;  3WTY C;  2XGE A;  2ICW G;  1GXP A;  4I02 A;  1IG7 A;  4C30 A;  1XG1 A;  4JQF A;  3HUG A;  3PM1 A;  4RB1 A;  3NWS A;  4XM3 A;  4NC6 A;  3P9K A;  5C3E J;  4EM2 A;  2OU2 A;  4GFB A;  2FJ1 A;  1O3S A;  2VT2 A;  1GVD A;  2PMU A;  3E1S A;  3HOY J;  2HR3 A;  2HXI A;  4PJM A;  3C3W A;  4HV5 A;  2VQC A;  4FAS D;  1OR7 C;  4NC8 A;  5KAI C;  2TDX A;  3IAS 2;  3BWG A;  4LK1 F;  2D1H A;  4XRM A;  1YTY A;  2XSD C;  1FMW A;  3LSJ A;  1S9H A;  2JSP A;  1FOX A;  5E1W A;  2BW3 B;  3B73 A;  3ZMS A;  3AG2 H;  5C44 J;  2Z33 A;  1Z3X A;  3NEU A;  4BY7 J;  1R4N B;  1ODD A;  1NH3 A;  4BEH B;  1ZRF A;  3H5N A;  1WJF A;  4BJT A;  3GTM J;  4QPQ A;  4ZH4 F;  3DBR B;  3FHN A;  1JUS A;  1VQ9 I;  1MSE C;  4XKC A;  2JK3 A;  1EH8 A;  3SEQ A;  2Z99 A;  4GGG A;  4KIF A;  4I0B A;  3U1D A;  2R7S A;  3SDB A;  3A01 A;  2L7K A;  3DU6 A;  2QA4 I;  5L3G A;  3DU5 A;  3ZQF A;  1XX5 A;  2HDD A;  1XDU A;  3I5U A;  4G8X A;  5IP9 J;  2BVM A;  2VB6 A;  1ZRD A;  3QQA A;  2KIF A;  4MO7 A;  3QP6 A;  2FUG 2;  2WV1 A;  2EZL A;  4UB8 C;  2E60 A;  3HB9 A;  1FEX A;  4I76 A;  2KQR A;  4PFO A;  1JKR C;  1H89 C;  2LP0 A;  2HTJ A;  3TW6 A;  4XKB A;  5D8K B;  1RNL A;  3K1M A;  2Y9Y A;  3JRC A;  5K7Z A;  2ZSH B;  3IP4 B;  4HNT A;  1I6H J;  5JLX A;  2L54 A;  3G1L A;  2PN6 A;  2WY8 Q;  4WXC A;  5B1B H;  5HVQ C;  1W0T A;  1RI7 A;  3ZQQ A;  4EV0 A;  3KLN A;  3E6C C;  4LK0 F;  3GTK J;  2O9L A;  2CH0 A;  1HDP A;  1WZ2 A;  2EA4 A;  3JTH A;  5EG0 A;  2OQG A;  3D5R C;  2IEK A;  4BE2 A;  1QBJ A;  2VON A;  3BQY A;  3ESW B;  2L9S A;  1H0M A;  1AU7 A;  4Y52 J;  2DA6 A;  1VQO I;  4JX5 A;  2YX4 A;  1WJC A;  3DLL F;  2VLA A;  2K40 A;  3HRT A;  4P9F A;  1QVU A;  2CUE A;  2P0W A;  1OYY A;  2QBY B;  5F64 A;  1NG6 A;  4HPQ A;  5M5W J;  2EZK A;  1T0F A;  2ISZ A;  1KGS A;  3OOU A;  4DGW B;  1K79 A;  3H5R A;  4Y15 A;  1YO5 C;  3SZP A;  2ECC A;  4YRV A;  1WI3 A;  3LA7 A;  2F5E A;  2W25 A;  2R3S A;  5IT3 A;  4E7J A;  1STZ A;  1ZK8 A;  4AVZ A;  1QHG A;  2VC0 A;  3OIO A;  4IXA A;  4I98 B;  3H3V K;  3DXJ F;  5J4Y A;  2X6X A;  2G7U A;  4PDK A;  1QPI A;  1V5E A;  3LST A;  1S6L A;  2JUC A;  2VAS A;  4BQA A;  2M45 A;  4II2 A;  4EGY A;  5A2Q Z;  1S8N A;  1K6Y A;  2ZJ2 A;  3MQ0 A;  1YW9 A;  3R0J A;  1WHU A;  5HOO A;  1H9G A;  3TOA A;  2K3F A;  2JMW A;  1YI2 I;  3VOD A;  4U0W A;  2OTL I;  1UG2 A;  2RC4 A;  4JX4 A;  3O8G A;  1KA8 A;  3U1K A;  4QTR A;  5B1A H;  2LBF A;  3CP2 A;  4QWQ A;  2K3P A;  5HLI A;  3I56 I;  4HF1 A;  4MTD A;  1J5Y A;  4A3K J;  1O7F A;  4XRS A;  4NC7 A;  2V4J C;  1N25 A;  2VKD A;  4WXH A;  5GTH C;  3D1N I;  4OIN F;  2RV8 A;  4GYI A;  4CCK A;  1J9I A;  2PJP A;  2FSW A;  2R5Y B;  4CCL A;  3DPL C;  1VI0 A;  4LG3 A;  4HX7 A;  3LWF A;  1U2W A;  1YG2 A;  1PUF B;  2OCC H;  4LIT A;  1R58 A;  2A6E F;  4CZC A;  1P4X A;  1W7P A;  3DPT A;  4RDU A;  3DEE A;  5LHH A;  2E7W A;  1MH4 A;  1S29 A;  1ZG3 A;  2LFB A;  2DI3 A;  4JYK A;  1GT0 C;  1WJB A;  4L5E A;  4C9Y A;  2QEN A;  3ROU A;  5AIP A;  1Y39 A;  3QP5 A;  1MJ9 A;  3HKZ N;  2QQ8 A;  2ID3 A;  3KEY A;  4Y3O A;  3L00 A;  3BRO A;  1BOA A;  3M8J A;  4RAF A;  1KYW A;  3QYE A;  2V26 A;  5EGO A;  2PMZ A;  1IV8 A;  4CYC A;  2ESH A;  2KFD A;  2KRH A;  4M3D A;  2DQR A;  2NYX A;  5H6R A;  1ZH5 A;  5FKN A;  2HYJ A;  2XC7 A;  2ZXW H;  1GV2 A;  4A0Z A;  4BKX A;  4L9N A;  3S93 A;  2NS7 A;  3LSR A;  2DU9 A;  4DOZ A;  5JR3 A;  3RYR A;  1VFC A;  5GAG J;  4HDU A;  2M3A A;  1Z0X A;  4F91 B;  5D5V B;  1RUO A;  2MH2 A;  2ZJQ F;  1EF4 A;  2M0C A;  3MAJ A;  3WGH A;  2HYG D;  3OY9 A;  4NDL A;  1YFH A;  3PNT A;  2Q0O A;  2L9N A;  1FBQ A;  1A6I A;  1UHM A;  1IRF A;  3BR3 A;  4IJA A;  2PJR A;  4OAY A;  4MIM A;  1B59 A;  2EBI A;  3K4C A;  2IS6 A;  1S3J A;  1BJZ A;  2A6H F;  3CJR B;  4KFC A;  1J0R A;  4ZYE A;  4OIQ F;  4M74 A;  3JRD A;  3ZP5 A;  2FX0 A;  2AS5 F;  3VEP A;  1G2H A;  1HLV A;  3IAM 2;  3OYB A;  2DAO A;  2ZNY A;  1V55 H;  1BJA A;  2IP2 A;  2DLL A;  2K9L A;  2CV1 A;  3OR2 C;  2DOA A;  3P9I A;  1T08 B;  1YE9 A;  2BVL A;  3RTR A;  4NB5 A;  2QZ8 A;  4NQW A;  4LG0 B;  2JWT A;  1UEL B;  5F27 A;  4BGD A;  4F7Z A;  2X1E A;  3OS0 A;  3L2V A;  1YJW I;  4ZTJ A;  4LD5 A;  4M9Z A;  1P4W A;  1B4A A;  5F1R A;  5JI6 A;  2VPL A;  5FLM J;  1X3Z B;  1T8I A;  3MN2 A;  1VQK I;  3ZMD A;  1ERD A;  3IUO A;  3BCB A;  1P9Q C;  2X0L A;  4MQ9 F;  1ZLK A;  2HKO A;  2JSC A;  3GXO A;  3BDD A;  2X1D A;  3K7A J;  4G94 A;  3GYH X;  4ESJ A;  1O7L A;  4UNO A;  5ILU A;  3BTI A;  3HSE A;  3REO A;  4LB5 A;  1V3F A;  2OC6 A;  3J81 Z;  3RZO J;  3AAF A;  1SC7 A;  3GTO J;  4EJO A;  3QOD A;  2IS1 A;  3SDG A;  3KP5 A;  3LNQ A;  1MW7 A;  3Q3S A;  3RIR A;  5GAD J;  5LHG A;  4IOC F;  1N77 A;  1E17 A;  2A05 A;  4XON A;  3AG4 H;  5FRO A;  1U5T A;  3E5X A;  4EAT A;  1FP1 D;  1ETK A;  4I6Z A;  3ABM H;  1WGX A;  1FIP A;  2AHQ A;  2EFN A;  3G1O A;  3TQN A;  1DQU A;  1OCC H;  2NOG A;  2RGV A;  3GW2 A;  4Z6Y A;  4HNU A;  3J80 K;  3L7W A;  4XN0 A;  3FBN B;  3IH3 A;  5AON A;  3TDZ C;  1VQL I;  2QQ9 A;  4AYB N;  2AXT C;  2EIJ H;  2L01 A;  3M1E A;  4UXN A;  4CCO A;  2M8G X;  3RI4 A;  4MEX F;  3KFW X;  3IWF A;  3OYF A;  1LVA A;  2HDC A;  1POG A;  1E3H A;  2JTV A;  3PFI A;  2TCT A;  4HX4 A;  2BW3 A;  4IVN A;  4MHG A;  1IUF A;  5IPA A;  3N4M A;  1AA7 A;  1FX7 A;  1PP8 F;  5BPI A;  3KP3 A;  3B6C A;  2HFH A;  2WBM A;  3FDY A;  4F92 B;  1IDY A;  1SEU A;  2UXX A;  3S1R J;  2VN2 A;  2ZME A;  2JZY A;  1U5T C;  1BC8 C;  1W1W E;  1KU3 A;  2GXG A;  1Z05 A;  3FXK A;  1U9O A;  2DT7 B;  3MVP A;  2H6B A;  2LY2 A;  4PSW A;  2RQP A;  1LVK A;  2CO5 A;  4G7O F;  2LY9 A;  4CGZ A;  1HKS A;  2K5C A;  4LB6 B;  5E3O A;  1V54 H;  4U7B A;  5IOZ A;  1ULY A;  2PI0 A;  4E7S A;  3J7Z I;  1IXC A;  1IN7 A;  2LYC A;  1HKT A;  4UVA A;  3RKX A;  4F55 A;  2EV0 A;  2CV0 A;  4LGW A;  5FGM A;  3KZY A;  2QKL B;  2UV1 A;  2M0M A;  1RES A;  2PLY A;  1BL0 A;  3OYG A;  1MGT A;  3S2W A;  4ESF A;  1ITY A;  5E1X A;  2HOA A;  3RJP A;  3TBI A;  3CC4 I;  1BIA A;  4HNV A;  2VPR A;  3TGN A;  2XF7 A;  1W0U A;  3C1D A;  4M71 A;  1K7A A;  2LK2 A;  1FYM A;  1I3A A;  3AG1 H;  2E1M B;  4BDZ A;  5DM6 F;  3B02 A;  3CCV I;  2P4W A;  2ME0 A;  2EIL H;  3CO6 C;  2GLO A;  3SHF A;  3ZQ7 A;  4UHT A;  3OIQ A;  2JA6 J;  4AU7 A;  2HVQ A;  3FM3 A;  4PZJ A;  3D5S C;  2HVS A;  1VQ6 I;  3I59 A;  2L2O A;  2C6Y A;  2XUB A;  3MEX A;  3DWL E;  5LGT A;  1SFK A;  3K4M A;  3HL2 A;  4C3H J;  2UZK A;  2MGQ A;  3O8H A;  3H0D A;  3GTJ J;  4BQN A;  3OYI A;  3A4C A;  1RKW A;  3A0H C;  3MFK A;  2JJ7 A;  4J01 A;  2AXL A;  1DU6 A;  4CIC A;  1ZLJ A;  2DCE A;  4YFK F;  2DDB A;  5J1Y A;  1MIJ A;  1O3Q A;  1NK2 P;  4HQE A;  3V7S A;  3DPU A;  5KCM A;  1BM9 A;  4P1W A;  2O8X A;  5HNF A;  1JJ6 C;  1A5J A;  2FE3 A;  1D0Y A;  1APL C;  1ZR2 A;  3U21 A;  5ICF A;  3OYL A;  2HOT A;  2CUZ A;  2FQ3 A;  2XGC A;  5H20 A;  5E3M A;  4HLY A;  3VYS B;  1ZKG A;  2LMD A;  2FBK A;  3HRU A;  3H9Q A;  2QWW A;  3E6D A;  1T0F C;  3TP0 A;  3CP8 A;  1BI0 A;  3FXQ A;  3QRF F;  4PSX A;  3CD6 I;  1D0X A;  1W7P B;  2GA1 A;  4N9H A;  3I54 A;  4RLF A;  1UHS A;  3BJA A;  3SZT A;  1IRX A;  2JT1 A;  4Q48 A;  3C2B A;  2V6C A;  5B66 C;  3DTK A;  1D5Y A;  3LQQ A;  3FZV A;  1RR7 A;  4UVC A;  3M8E A;  2KZG A;  5EYR A;  1K78 A;  4WF2 A;  1L0O C;  5K7F A;  3EYI A;  3WTX C;  1SD5 A;  3TMO A;  1FLI A;  4OMY A;  5DM7 F;  2OD5 A;  1VQ7 I;  3BTC A;  4L9T A;  3VDX A;  3JAM K;  2ZFW A;  3K2A A;  4JP0 A;  3CCY A;  3W2A A;  4AC0 A;  4I01 A;  1DP7 P;  1VZ0 A;  3I4P A;  5D8L B;  3F21 A;  2HOS A;  4E70 A;  1VTN C;  3J80 Z;  3ASN H;  2V9V A;  1T2K A;  5IT9 Z;  1HOM A;  5J3L A;  2ZO4 A;  3PNV A;  3VSK A;  3D0S A;  3S1Q J;  4BY1 J;  1OLT A;  4G6Q A;  1WJA A;  4LIV A;  5K5O A;  1BIB A;  3OYK A;  2R7Z J;  2K9S A;  2CU7 A;  2F5V A;  3QOE A;  3CF2 A;  3LFK A;  4XR6 A;  1ZN2 A;  4J19 A;  3CF5 F;  2NOJ B;  4D7N A;  1B9M A;  5TRD A;  1JE8 A;  1RC9 A;  2HPI A;  5DD4 A;  1LDJ A;  3LL7 A;  4YG2 F;  3PQK A;  2CUJ A;  3OWT A;  4U88 A;  3PIO F;  4B47 A;  5FLX Z;  1ZYR F;  4BBS J;  2Y31 A;  4BL0 B;  3CJQ B;  2QM3 A;  3FMQ A;  5DUK A;  3T5X A;  1Y1V J;  2EFO A;  3N05 A;  3F8B A;  2CJJ A;  5K7H A;  1I5Z A;  2ADU A;  3IV5 A;  2LKS A;  1ORK A;  4GCV A;  2DK8 A;  1T56 A;  4ZJZ A;  5IYD J;  4HG2 A;  3K1N A;  3WTZ A;  4KMF A;  3A01 B;  3ASO H;  2HWV A;  5M3F J;  2B7E A;  1MMD A;  1I3Q J;  3HGY A;  5F6F A;  1WRJ A;  4A3M J;  1S72 I;  3M3Y J;  3LSM A;  3MZ8 A;  1MZB A;  3V7R A;  1XGO A;  1WJ5 A;  1YJN I;  2KHM A;  4GO1 A;  2IAI A;  1IRG A;  3WG9 A;  2LVS A;  2WTE A;  1S7A A;  4PCQ A;  4IZZ A;  2DFE A;  4DYC A;  1SD4 A;  2F4I A;  5E18 F;  1K6O A;  2WAF A;  1D1B A;  3RQI A;  3M8F A;  4ZYH A;  3DF8 A;  1Z67 A;  1TT0 A;  2HQA A;  1C0W A;  1XGS A;  3K9T A;  4A6D A;  2QGU A;  4RB3 C;  4ZDO A;  3Q9S A;  3UR3 C;  1S7O A;  4KUM A;  4JK1 X;  2DOF A;  2IW5 A;  1A6Q A;  2XHK A;  3BR2 A;  1OCZ H;  5L3C A;  2JVG A;  2NVT J;  2CW8 A;  2WV0 A;  3CJT B;  5B3S H;  4X0G A;  2CW7 A;  1RRJ A;  1ZAR A;  3HDD A;  3HM5 A;  2R7U A;  2HS5 A;  3ZMT A;  1WFX A;  3L9F A;  3FHZ A;  4XRS G;  3BY6 A;  5C4J J;  1WPK A;  3IC7 A;  2K85 A;  1XSV A;  3S2D J;  4HLX A;  1KQ8 A;  1ZGA A;  2VXD A;  3RSN A;  1IAW A;  1K78 B;  1T98 A;  3EET A;  1ETX A;  5IP7 J;  4FE7 A;  2LNB A;  4FQG A;  5J4V A;  1EJ9 A;  3JRG A;  1O4X A;  3BCA A;  3CMA I;  1FYK A;  3L2R A;  3BG5 A;  5FFZ A;  2XRN A;  3L2Q A;  1U5T B;  3LAJ A;  1MMG A;  2XV4 S;  2FMY A;  2EIN H;  2LLK A;  4ZTF A;  2X51 A;  4XSX F;  1I27 A;  4BQQ A;  1TW2 A;  2ZBK A;  2A69 F;  2ELH A;  4YFN F;  2DA1 A;  3MKY B;  2HKX A;  2KZV A;  2F4M B;  2I8D A;  1FOW A;  3MD2 A;  4RM2 A;  3ZGK A;  2XRO A;  2NS8 A;  1Q1V A;  1QQI A;  2DFI A;  2OV7 A;  5CLS A;  2ISY A;  1VQ4 I;  1W5C C;  2GA2 A;  2M8E A;  2ZCW A;  1ON2 A;  3OV8 A;  2L7F P;  4QPO A;  2GIV A;  4XKW A;  2HQ5 A;  2L7Z A;  3PSF A;  4OOI A;  5CYV A;  2RNJ A;  5HLG A;  1U6G A;  1ETO A;  1Z77 A;  2X1C A;  4B48 A;  1BOB A;  5TJJ A;  2JQ7 A;  3W2W A;  1N78 A;  1OCP A;  2KDZ A;  2CFX A;  4I99 C;  1SD6 A;  1Y56 A;  1ZG1 A;  2GIZ A;  3OS2 A;  1TP4 A;  3U2R A;  3I4M J;  1V5F A;  4W97 A;  1DDN A;  4A3C J;  1TWC J;  2FOW A;  2BY2 A;  3ZR8 X;  3JTG A;  5IYC J;  1EA3 A;  3EPZ A;  4N0B A;  2IXS A;  1D8K A;  2BHY A;  3F3X A;  5J1R A;  5D6F A;  4M6V A;  3UKG A;  2DK5 A;  3AFH A;  4I09 A;  2A5W A;  4IOA F;  1XCB A;  2F6C A;  2MBF A;  3KP6 A;  2GQQ A;  1R6R A;  1SVL A;  3JRA A;  4E7I A;  1MMA A;  2L9R A;  1MH3 A;  1OCT C;  2R5Z A;  2NXN B;  4RMN A;  2L4M A;  4A3D J;  2VI6 A;  3CCJ I;  3S3M A;  4G9Y A;  2BXZ A;  1F4K A;  2XF5 A;  4Y7N J;  3OSG A;  3I4N J;  3LQR A;  3QPH A;  3ULQ B;  2DYS H;  4BS9 A;  3BG7 A;  2DPD A;  3E3V A;  1TL8 A;  3HOU J;  2OZ6 A;  4YEJ A;  5E17 F;  4AIJ A;  2OCE A;  2OAZ A;  3F22 A;  2DYR H;  3Q0U A;  3HBL A;  3V8K A;  5HDN A;  3LAP A;  3N97 A;  2XB5 A;  1G3Y A;  5M5Y J;  3HEF A;  2GZW A;  2H94 A;  5BQT A;  1QU3 A;  1R00 A;  5LGN A;  4L9J A;  5TGT A;  3OOP A;  2M9H A;  2Y0S A;  3CUQ B;  1NHA A;  4WCG A;  3CCQ I;  5K5Q A;  5BPD A;  4M3E A;  2VKH A;  3A2K A;  3RZD J;  2L02 A;  2KMU A;  4G6D A;  2MSY A;  2IGO A;  2GXA A;  4CYD A;  4XSZ F;  3CLO A;  2K02 A;  2EIK H;  3GEZ A;  2UWM A;  4OAZ A;  2R7R A;  4Y17 A;  1Y1W J;  3DFG A;  2CQK A;  2QQA A;  2LG4 A;  5L3F A;  2W85 A;  4LOC A;  1LEA A;  5DEQ A;  2ZB9 A;  4P5O A;  1HW2 A;  1NK3 P;  4LMY A;  1HST A;  3ZQI A;  1XSD A;  2IA0 A;  3ZQG A;  2K9N A;  2QEX I;  1MBG A;  2JPC A;  1Z3Y A;  3BG6 A;  2A61 A;  3NAR A;  3ABT A;  1YW8 A;  3NQO A;  2E1C A;  4XK4 A;  3CCR I;  3ZPL A;  3FBI B;  1JKO C;  3QPL A;  2QBY A;  2Y69 H;  3O6B B;  4L5J A;  1DPU A;  3GWZ A;  5HLH A;  3X2Q H;  4AIH A;  2PEX A;  2OUM A;  3K4L A;  5LLQ A;  1LEB A;  1N75 A;  4UV9 A;  3SQN A;  2XAG A;  3RKW A;  3LOC A;  2COM A;  3GLL A;  4L9V A;  3ZN1 A;  4XLN F;  2O6G E;  4E4H A;  2KJC A;  3F6O A;  3UNG C;  3S15 J;  2IGN A;  5E8G A;  2JN6 A;  1U8B A;  4RGU A;  3W2V A;  1LE8 A;  5F04 A;  2ZXJ A;  3TP3 A;  2R7D A;  2EFP A;  1T6S A;  2EH3 A;  3MCZ A;  1QPM A;  1Y0U A;  4ITV A;  4O5V A;  3TO6 A;  1UCR A;  1XDS A;  4MLO A;  1OQY A;  4HF2 A;  3T1B A;  1W5S A;  1YQA A;  1ZGJ A;  2FF4 A;  4DIQ A;  2VQH A;  5CJ9 A;  1H88 C;  3KCC A;  2JA5 J;  3H1C A;  2QUF A;  2H09 A;  3DTE A;  4DYQ A;  1FSE A;  1GLN A;  3D5L A;  1U8R A;  1JI8 A;  2XGX A;  1JKQ C;  3QU3 A;  3CCM I;  4HDV A;  4HZF A;  2I10 A;  2LBF B;  3WTU C;  1KU9 A;  1SVO A;  4P55 A;  1GDT A;  1U3E M;  1QZZ A;  1NTC A;  1BW5 A;  3R60 A;  4RB0 A;  5D4R A;  2ESN A;  3G71 I;  4A3L J;  2LC2 A;  3C2G A;  3LSI A;  2VKE A;  3F8M A;  4U0Y A;  1IDZ A;  2MD5 A;  3E0J B;  2LH9 A;  1YIT I;  4RGR A;  3OSF A;  1DU0 A;  2WAE A;  1P2F A;  3LFU A;  1YX3 A;  4AUX A;  9ANT A;  4N4N B;  2V1X A;  4D0P A;  5J6X A;  4NHJ A;  1JTX A;  1F1Z A;  2G0E A;  3QYF A;  2V7F A;  4Z2Y A;  4S0H B;  1DGW Y;  2A68 F;  3A1Y A;  4ESB A;  3FMS A;  1HW5 A;  3CZ6 A;  3S1M J;  4BQO A;  4EM0 B;  1QRY A;  4ETS A;  4CXF A;  2B63 J;  2JA2 A;  3R6S A;  5HNH A;  2ELJ A;  2NVU B;  3CME I;  2X85 A;  1K61 A;  1Z91 A;  2OZU A;  3HOX J;  1FYL A;  3H36 A;  2EA2 A;  3ZCO A;  3OL4 A;  3K1P A;  3ZQH A;  3OMY A;  1A35 A;  4X6A J;  4CDG A;  5F0H A;  1QZE A;  3S2H J;  4EQQ A;  4B3X A;  3MMY B;  4X1E A;  5LRR A;  1ENH A;  2BYV E;  3L2W A;  4BHP A;  4Y4R A;  5LRS A;  1W36 C;  2KLO A;  3E5Q A;  2IGM A;  2A6T A;  3K70 D;  4B44 A;  5LBQ A;  2ID6 A;  1SFO J;  3E6M A;  4M72 A;  2VJI A;  4HF0 A;  2DOD A;  1ACI A;  2UXN A;  2X4H A;  1UST A;  4RS8 A;  2PMH A;  5EGO B;  1WQ2 A;  2IA2 A;  4CYC B;  4XL9 A;  2N8G A;  3KYC B;  1BI1 A;  2LRD A;  2MH9 A;  4UV8 A;  3OYJ A;  1J7K A;  2CUF A;  2V1U A;  4AYB A;  3B6A A;  3H0G J;  1CF7 B;  3I55 I;  2XDV A;  5FKL A;  4AVP A;  2GOX B;  1UJ8 A;  4A5N A;  3W6J B;  4C2T A;  5FKM A;  4PUS A;  1UG0 A;  1IO2 A;  2CQ7 A;  2FML A;  5BOX A;  5FLX K;  1VND A;  4M6X A;  3FK7 A;  3DKW A;  1VF9 A;  2QSG X;  2RKH A;  2M4K A;  1TTY A;  4ZZL A;  1IJW C;  3GTP J;  5J8F A;  1HW1 A;  1MND A;  2XIG A;  5ED4 A;  3WTV C;  1H8A C;  3K6G A;  3MZH A;  2FNA A;  1F43 A;  1TWA J;  2B9S A;  1FSH A;  4AD9 A;  4CSW A;  3KET A;  2R0Q C;  4LIU A;  4EJV A;  3G1M A;  5F0C A;  5K5R A;  5DTD A;  4IL6 C;  3DCF A;  4PK4 A;  1E0E A;  4IO9 F;  3QAH A;  2R7W A;  1Z7U A;  3LSP A;  2Z1D A;  5HS8 A;  4A12 A;  5J40 A;  2CS3 A;  2H1K A;  4N9I A;  4IHX A;  2IBD A;  2MG4 A;  3S1N J;  4ZYA A;  1OCO H;  1FNN A;  2EWN A;  2LDU A;  2XGD A;  4V2F A;  3RPU D;  2CMP A;  2BBY A;  3TDU C;  3HSF A;  2DMP A;  2ELK A;  1FIA A;  3GZN B;  2CV2 A;  2VOD A;  3ZMU A;  4BU2 A;  2LKX A;  3PO2 J;  3WTW C;  3CCU I;  1XPX A;  2Z2S B;  1FWZ A;  2DTR A;  2XAS A;  2AO9 A;  2KPM A;  1BN5 A;  1ETY A;  4HV6 A;  3TO9 A;  1IN5 A;  1MBJ A;  2XAQ A;  3KZZ A;  1L3L A;  1LFP A;  3H3U A;  2OTJ I;  2CG4 A;  5HS9 A;  5D5W B;  4WX9 A;  3HYI A;  3R61 A;  1E3O C;  3K70 C;  2E2J J;  4DYR A;  4IHY A;  3WTT C;  3PO3 J;  2P6T A;  2M87 A;  2D45 A;  2HNH A;  4AIK A;  2NRA C;  2P6S A;  1X1B A;  3QPT A;  2WY7 Q;  3VYU B;  3ECO A;  2IA1 A;  2MA3 A;  1YS6 A;  2E1O A;  1FOY A;  5CPR B;  2FOK A;  2VC1 A;  3JRB A;  1K4S A;  2VJJ A;  1A31 A;  4IQ4 A;  2XKO A;  1DPR A;  1KQ9 A;  1JHF A;  5DV5 A;  3U9G A;  3OYM A;  3HOW J;  1W7P D;  3I71 A;  4YFX F;  1LUJ B;  2VXZ A;  3OYD A;  2R5Z B;  3AL0 C;  5EJC A;  1PP7 U;  2R5Y A;  2E5N A;  1ZAO A;  1IUY A;  3LSK A;  1VQP I;  3QOP A;  2ZC2 A;  3HHH A;  3WG7 H;  3PJR A;  2HI3 A;  1G3T A;  3FM5 A;  1D3Y A;  3IRR A;  1YYV A;  5DCM A;  1P7I A;  1LFB A;  1Z6R A;  5EEA A;  3M9A A;  2EK5 A;  2O03 A;  2PG4 A;  1EH6 A;  1B72 A;  3BJO A;  1TNT A;  3BR0 A;  4KDP A;  1IW7 F;  1XTA A;  2E2H J;  3DKX A;  4KJZ A;  5CVV A;  3RKQ A;  4V2G A;  1HBX G;  5FRM A;  1CGP A;  4ABZ A;  1Z7L A;  2DJI A;  3ABL H;  1V4R A;  2DPU A;  3E7L A;  3FXO A;  2LOO A;  4A0Y A;  4KYW A;  4RM3 A;  4EMS A;  3PSI A;  4G6T B;  1BI3 A;  1D5V A;  4ANJ A;  1GHC A;  4AM3 A;  4YIR X;  1J2X A;  3BJ6 A;  2DBB A;  2BE5 F;  2MLK A;  2ZFU A;  3GFI A;  4ZYD A;  2F5C A;  5JVG F;  4KIS A;  4V19 K;  1ETQ A;  4EM1 A;  4FE4 A;  1JKP C;  2WB1 N;  3KP2 A;  3W6K B;  1WVR A;  3HGG A;  5A2Q K;  5CVJ A;  1JT0 A;  2IVM A;  2Y9Z A;  3I58 A;  1LE8 B;  2XAJ A;  1V5G A;  3ZQC A;  1IGN A;  4FTH A;  3HTS B;  1DUX C;  3HZJ A;  3FIS A;  3PL8 A;  4HQM A;  4BNC A;  2AQF A;  2FD5 A;  4A3B J;  2VJ4 A;  1KZH A;  3JAM Z;  3KEO A;  3BG3 A;  2DJN A;  4BAC A;  2MW8 A;  5HDG A;  2QVO A;  4UUV A;  1ON1 A;  2E2I J;  4E7K A;  2OJE D;  2DMT A;  2YU3 A;  3BZC A;  3W3C A;  2LRE A;  3IHU A;  4PGG A;  3L2C A;  2E7X A;  4MEY F;  2STW A;  2VL8 A;  3BR1 A;  2BEO A;  4IHW A;  4EJW A;  3ZRG A;  3CC2 I;  2QYO A;  3S8P A;  2M34 A;  2ZXH A;  4B4C A;  2E19 A;  1WJE A;  3PIP F;  2P7V B;  5CQE A;  2DQL A;  2Q2E A;  2WAQ A;  2ZKZ A;  1BW6 A;  2E5Z A;  3GME A;  4FX0 A;  4G12 A;  2VUM J;  1I50 J;  2K9Q A;  3E97 A;  2A3S A;  2KP6 A;  4M3G A;  3TKY A;  4IPA A;  2JPB A;  2E35 A;  3PUB A;  4R1H A;  2EFQ A;  3CMM A;  5E3L A;  5JHF A;  2HDW A;  3DEW A;  4KIB A;  2JRT A;  1TQI A;  2BY1 A;  4BXU A;  4RA2 A;  4A3J J;  4ZC3 A;  5M5X J;  1G4D A;  3GCM A;  2EV5 A;  3FXU A;  2CGP A;  2FA5 A;  1Y0N A;  4KN4 X;  3JR9 A;  2DA3 A;  1LNW A;  3FF5 A;  2E71 A;  3F0C A;  1BR1 A;  2A07 F;  4OIO F;  1X4O A;  3G2B A;  5HLT A;  4Y33 A;  1MBF A;  5DUI A;  1HCR A;  4ENK A;  5ICG A;  3IRQ A;  1U9N A;  1REP C;  4BJ5 C;  2IS4 A;  3RKY A;  3ABU A;  2MAB A;  3K4K A;  3WU0 A;  4D5C A;  5H6Q A;  2BHZ A;  2VBW A;  1B8I B;  4CUG A;  4B09 A;  1PDN C;  1PVE A;  1TQM A;  2XPV A;  1OFC X;  4LLN A;  1JUP A;  1TBX A;  1KQ0 A;  2Y2Z A;  3V42 A;  4XOP A;  4Q5S F;  3SYT A;  4BJ6 C;  3KPH A;  4A3I J;  1EKE A;  1LFU P;  4K2E A;  3S3O A;  3HPG A;  1WJD A;  2X9D A;  4BH9 A;  1G59 A;  2R7O A;  3ECH A;  5E1Z B;  2QF7 A;  1PJR A;  3VYT B;  2EJR A;  1MDM A;  2A5Y B;  3O3K A;  3BP8 A;  3BOQ A;  1YX5 A;  4A0X A;  2IS2 A;  2Y30 A;  3J7Y J;  3COA C;  2W82 A;  1R1T A;  5EEH A;  1IC8 A;  4EJU A;  1X1P A;  3WHC A;  1OPC A;  3VWB A;  4L18 B;  2BV6 A;  1R49 A;  2KKO A;  4DNC A;  1AOY A;  4B43 A; 
#chains in the Genus database with same CATH homology
 3CTA A;  1P92 A;  4CHU A;  2K27 A;  1XMA A;  1RUN A;  2B0L A;  1SFU A;  4RAY A;  2W24 A;  5ILV A;  5DDG A;  4HA8 A;  4M9X A;  3RYP A;  4KN7 X;  5BS6 A;  2L3D A;  1R5G A;  3ELK A;  3C7J A;  1P6R A;  1CF7 A;  3JSO A;  3P7N A;  3WGI A;  3DEU A;  4WXD A;  5DYM A;  3V8J A;  4O3M A;  3Q5F A;  1I1S A;  5J8C A;  4ENM A;  2IRF G;  1USS A;  4B8X A;  1IN4 A;  1WSU A;  2VBZ A;  4RB2 C;  1FZP B;  6PAX A;  1D8J A;  4ENN A;  1XMK A;  4L0Y B;  3GX4 X;  3DP7 A;  2CWE A;  4HBL A;  3HHG A;  3ZN0 A;  3HOT A;  1JHH A;  1BI2 A;  3WOD F;  2J5P A;  3R4K A;  3TO7 A;  3C18 A;  4ON0 A;  4XRF A;  4GXO A;  5DD8 A;  3KEQ A;  2FBH A;  4I2O A;  1HQC A;  5KK1 A;  1RIO H;  1F9N A;  2IPQ X;  3EUH A;  1J75 A;  2HGC A;  2PBI A;  2YX7 A;  3I0T A;  3H92 A;  3MWM A;  3WU1 B;  1MDM B;  2HZT A;  2RDP A;  2VBY A;  2O0Y A;  2E1N A;  4DQ2 A;  4HAM A;  5ICE A;  2KRF A;  3R0A A;  4IHS A;  2MC3 A;  4RGS A;  1W5T A;  2OQR A;  2Z9O A;  4WWC A;  1XD7 A;  4EJT A;  2YSR A;  2K86 A;  1TLH B;  2CW0 F;  4L0Z B;  4IF4 A;  3FXR A;  2FU4 A;  2NNY A;  4LJZ F;  3GZ6 A;  2HTS A;  5DCM B;  4IRG A;  5LEK A;  2HEO A;  3E5U A;  3HIF A;  2NS0 A;  2IT0 A;  2Q8K A;  4IRI A;  2WWY A;  4BAY A;  1WWX A;  3F8C A;  1O3R A;  2VBX A;  1YS7 A;  5D5U B;  1A04 A;  3CUO A;  3WTS C;  2H6C A;  1SFX A;  3JW4 A;  4G7Z F;  3E6B A;  2STT A;  2CYY A;  1IN8 A;  4PGH A;  2FBI A;  4LFU A;  5JVT A;  3IKT A;  4WK8 F;  4BHB A;  5FB2 A;  2F5D A;  4MNU A;  1MD0 A;  3GVA A;  2DT5 A;  1Z1D A;  1MKM A;  1UFM A;  4ASN A;  3J81 K;  1ZG5 A;  2NNN A;  3F6V A;  1WI9 A;  1I1G A;  3I64 A;  1G3S A;  4MTE A;  3VFZ A;  2P8T A;  4OIP F;  1Z6T A;  2WC2 A;  1B6A A;  4S04 A;  4KMU X;  1R23 A;  1XN7 A;  1T38 A;  3VOE A;  3BZ6 A;  4CZZ A;  1YIO A;  1ZHF A;  2XKP A;  2ACJ A;  4M9S A;  2O3F A;  2FNP A;  4R8H A;  2P5L C;  3ML6 A;  1B9N A;  1KU7 A;  2HQR A;  5AIQ A;  2M30 A;  4JBA A;  3LA3 A;  1AWC A;  1UB9 A;  2NAZ A;  1ZRE A;  4I7H A;  3K69 A;  2P7C B;  3HOS A;  3V7C A;  5CVI A;  3RPU A;  1IXR C;  1EV7 A;  5K1Y A;  1LDK B;  3GFL A;  3O2P E;  4EGZ A;  1GXQ A;  3DQV C;  1LDD A;  4P9U A;  2XAH A;  4KIG A;  4KIC A;  3SXY A;  2VOO A;  3I59 B;  5JFR A;  4GYG A;  2FXA A;  3ZMV A;  1IXS B;  3KE2 A;  3M7G A;  4A2U A;  2Y0M A;  2OA4 A;  4ZYG A;  3CJN A;  2F2E A;  1YW7 A;  4LG0 A;  1U78 A;  1OMI A;  3FMR A;  2FRH A;  4BHC A;  2F5F A;  3FWE A;  4RAZ A;  2KJB A;  5ICC A;  1E2X A;  2VT3 A;  3BPV A;  1SAX A;  1IN6 A;  4YIF A;  4FHT A;  4OU0 A;  3QU6 A;  2IJL A;  1H9T A;  3G73 A;  2GXB A;  3L09 A;  4HYE A;  2P5K A;  5LEJ A;  3P9C A;  4Q4Z F;  2M5W A;  4U0V A;  3GZ5 A;  3F23 A;  5HS7 A;  3KP4 A;  4MGR A;  4M6Y A;  5E20 A;  3RPQ A;  4P96 A;  3DV8 A;  2D2W A;  2OBP A;  3T8T A;  2P5V A;  5FD5 A;  5L3E A;  2Y75 A;  3FX3 A;  2XAF A;  5LHI A;  1ONV A;  1T39 A;  1P4A A;  1LQ1 A;  3HRM A;  2BGC A;  2EFW A;  2QLZ A;  3T0Y A;  3GFJ A;  1FBS A;  1G6N A;  4L5I A;  1SD7 A;  3HRS A;  2ZME B;  1J59 A;  3EYY A;  4HW0 A;  1I6X A;  2DW4 A;  3WGG A;  2H27 A;  2GWR A;  3G3Z A;  1UHW A;  1QO0 D;  2MLG A;  1FC3 A;  2Z5U A;  3GF2 A;  2J5O A;  1W4M A;  1KYZ A;  2W84 A;  3KP7 A;  4KA4 A;  2R7F A;  3RDI A;  1FOK A;  3WE3 A;  1YLF A;  4U7D A;  2G9W A;  3WE2 A;  2PQ8 A;  1R22 A;  3GFM A;  5JHU A;  5DCF A;  4Y13 A;  2YR2 A;  4LLL A;  1G3W A;  1HXD A;  4MQV A;  3ZMZ A;  2LF7 A;  2ETH A;  1JGS A;  3HTU A;  4A6E A;  1X3U A;  3IL2 A;  1FP2 A;  1XSX A;  3V8L A;  1WKM A;  5D4S A;  1R7J A;  2K4B A;  1HSJ A;  3PQJ A;  1OR7 A;  2GAU A;  1GVJ A;  1XGN A;  2HOE A;  4LLG F;  4O6J A;  2DO7 A;  1F5T A;  2EV6 A;  1FBU A;  5BMZ A;  4IRH A;  1O57 A;  1OYI A;  2L4A A;  2V1D A;  4KNY A;  1O3T A;  4M73 A;  4XBF A;  3KLO A;  1HKQ A;  3I53 A;  2YPR A;  1ZRC A;  5CVU A;  2PFB A;  3V4G A;  3T8R A;  4H0E A;  1TQP A;  1Z9C A;  2HQN A;  3CUQ C;  4OIR F;  4KT5 C;  2K4J A;  1XGM A;  1JXS A;  3GLX A;  5L3B A;  1SFE A;  3CDH A;  3IWZ A;  2HYF A;  3J7A O;  5IT9 K;  3GO5 A;  3Q9V A;  1BC7 C;  2EB7 A;  3IKV A;  2FEZ A;  2RN7 A;  2V79 A;  3VB2 A;  2KIM A;  1XB4 A;  1KU2 A;  2LKP A;  1RZ4 A;  2CSO A;  3JSP A;  2LF8 A;  1R36 A;  4I0A A;  4ZZD A;  2QQB A;  2RVC A;  1FPQ A;  4TV7 A;  3SFZ A;  1LB2 A;  3TOB A;  2VOP A;  4FX4 A;  5EEG A;  4QLC U;  3F8N A;  5FO5 A;  5HDK A;  3LA2 A;  4R79 A;  5D6E A;  1OYW A;  1SMY F;  4S05 A;  1BBY A;  3MZY A;  5KVR A;  4AWX B;  1R1U A;  3CUQ A;  2XVC A;  2KIU A;  3K0L A;  3EQL F;  4FT8 A;  2VE8 A;  3F8F A;  1QZY A;  1TNS A;  2VE9 A;  1IF1 A;  4A5M A;  3EDP A;  4OMZ A;  2D1V A;  2G7H A;  1OKR A;  1TW3 A;  1Q1H A;  5FFX A;  4CO8 A;  3H3Z A;  2W57 A;  2Z3Y A;  3BPX A;  1MJB A;  1XCV A;  3ERE D;  4EVI A;  4RGX A;  4UVB A;  1MJA A;  4BYY A;  1R1V A;  2ZNZ A;  4HX8 A;  5LGU A;  4YII A;  2Y48 A;  4ENJ A;  1SMT A;  3K2Z A;  1FT9 A;  4G7H F;  1B1B A;  5ILS A;  5CVR A;  4Q47 A;  5D5X B;  2K7L A;  1QNT A;  3HSR A;  2O61 A;  4HOB A;  1QGP A;  1FY7 A;  3GUD A;  1R5H A;  5FD6 A;  3ISP A;  2M1B A;  3CO7 C;  5ERI A;  4XLP F;  3F72 A;  2LSO A;  1EH7 A;  5L3D A;  1LJ9 A;  3NRV A;  4IHT A;  1PUE E;  1IZ1 A;  3WTY C;  1GXP A;  4I02 A;  4JQF A;  3HUG A;  4RB1 A;  3P9K A;  4EM2 A;  2OU2 A;  1O3S A;  2VT2 A;  2PMU A;  2HR3 A;  3C3W A;  4HV5 A;  2TDX A;  3BWG A;  4LK1 F;  2D1H A;  1YTY A;  5E1W A;  3B73 A;  3ZMS A;  2Z33 A;  3NEU A;  1ODD A;  1ZRF A;  4ZH4 F;  1EH8 A;  2Z99 A;  4GGG A;  4KIF A;  4I0B A;  3U1D A;  5L3G A;  1XDU A;  3I5U A;  4G8X A;  1ZRD A;  2KIF A;  3QP6 A;  2HTJ A;  5D8K B;  1RNL A;  3K1M A;  2L54 A;  2PN6 A;  5HVQ C;  4WXC A;  1RI7 A;  4EV0 A;  3KLN A;  3E6C C;  4LK0 F;  2EA4 A;  3JTH A;  2OQG A;  1QBJ A;  2VON A;  1H0M A;  2YX4 A;  3HRT A;  4P9F A;  1OYY A;  2QBY B;  5F64 A;  1T0F A;  2ISZ A;  1KGS A;  1K79 A;  4Y15 A;  1YO5 C;  3SZP A;  3LA7 A;  2F5E A;  2W25 A;  2R3S A;  5IT3 A;  1STZ A;  2VC0 A;  4IXA A;  4I98 B;  3DXJ F;  4PDK A;  2G7U A;  3LST A;  1S6L A;  4BQA A;  2M45 A;  4EGY A;  5A2Q Z;  1S8N A;  2ZJ2 A;  3MQ0 A;  1YW9 A;  3R0J A;  5HOO A;  1H9G A;  3TOA A;  3VOD A;  4U0W A;  2RC4 A;  1KA8 A;  4QWQ A;  5HLI A;  4HF1 A;  4MTD A;  1J5Y A;  1O7F A;  4WXH A;  4OIN F;  2RV8 A;  4GYI A;  1J9I A;  2PJP A;  2FSW A;  3DPL C;  4HX7 A;  3LWF A;  1U2W A;  1YG2 A;  1R58 A;  2A6E F;  1P4X A;  1W7P A;  3DPT A;  5LHH A;  2E7W A;  1S29 A;  1ZG3 A;  2DI3 A;  2QEN A;  3ROU A;  5AIP A;  3QP5 A;  1MJ9 A;  3L00 A;  3BRO A;  1BOA A;  1KYW A;  2ESH A;  2DQR A;  2NYX A;  5H6R A;  1ZH5 A;  4A0Z A;  4L9N A;  2DU9 A;  5JR3 A;  3RYR A;  4HDU A;  5D5V B;  1RUO A;  2MH2 A;  3MAJ A;  3WGH A;  2HYG D;  1YFH A;  2Q0O A;  1FBQ A;  1UHM A;  1IRF A;  4IJA A;  1B59 A;  1S3J A;  2A6H F;  4OIQ F;  4KFC A;  1J0R A;  4ZYE A;  4M74 A;  3ZP5 A;  2AS5 F;  3VEP A;  2DAO A;  2ZNY A;  1BJA A;  2IP2 A;  2DLL A;  3P9I A;  3RTR A;  4NB5 A;  2QZ8 A;  4NQW A;  4LG0 B;  4F7Z A;  4LD5 A;  4M9Z A;  1P4W A;  1B4A A;  5F1R A;  5JI6 A;  3ZMD A;  2X0L A;  4MQ9 F;  1ZLK A;  2HKO A;  2JSC A;  3GXO A;  3BDD A;  3GYH X;  4G94 A;  4ESJ A;  1O7L A;  4UNO A;  5ILU A;  3HSE A;  3REO A;  4LB5 A;  1V3F A;  3J81 Z;  3AAF A;  4EJO A;  3KP5 A;  3RIR A;  5LHG A;  1E17 A;  1U5T A;  3E5X A;  1FP1 D;  2EFN A;  3TQN A;  2RGV A;  3GW2 A;  3J80 K;  3L7W A;  5AON A;  3TDZ C;  2QQ9 A;  3M1E A;  2L01 A;  4UXN A;  3RI4 A;  4MEX F;  3KFW X;  3IWF A;  2HDC A;  1LVA A;  2JTV A;  3PFI A;  4HX4 A;  4IVN A;  4MHG A;  3N4M A;  1FX7 A;  1PP8 F;  5BPI A;  3KP3 A;  2HFH A;  2UXX A;  2VN2 A;  2ZME A;  2JZY A;  1U5T C;  1BC8 C;  1KU3 A;  2GXG A;  1Z05 A;  2H6B A;  2RQP A;  2CO5 A;  4G7O F;  4CGZ A;  1HKS A;  4LB6 B;  4U7B A;  2PI0 A;  1ULY A;  1IXC A;  1IN7 A;  1HKT A;  4UVA A;  3RKX A;  2EV0 A;  4LGW A;  5FGM A;  3KZY A;  2PLY A;  1MGT A;  3S2W A;  4ESF A;  5E1X A;  3RJP A;  1BIA A;  3TGN A;  3C1D A;  4M71 A;  1K7A A;  1FYM A;  3B02 A;  2P4W A;  3CO6 C;  3SHF A;  3ZQ7 A;  4UHT A;  3FM3 A;  4PZJ A;  3I59 A;  2C6Y A;  2XUB A;  3MEX A;  5LGT A;  2UZK A;  3MFK A;  2AXL A;  4CIC A;  1ZLJ A;  4YFK F;  1O3Q A;  4HQE A;  3V7S A;  1BM9 A;  2O8X A;  2FE3 A;  5ICF A;  2FQ3 A;  5H20 A;  4HLY A;  2FBK A;  3HRU A;  2QWW A;  3E6D A;  1BI0 A;  3FXQ A;  3QRF F;  1W7P B;  2GA1 A;  4N9H A;  3I54 A;  3BJA A;  3SZT A;  2JT1 A;  4Q48 A;  2V6C A;  3LQQ A;  1K78 A;  3FZV A;  4UVC A;  3M8E A;  4WF2 A;  1L0O C;  3EYI A;  3WTX C;  1SD5 A;  1FLI A;  4OMY A;  2OD5 A;  4L9T A;  3JAM K;  2ZFW A;  4I01 A;  1DP7 P;  3I4P A;  5D8L B;  3F21 A;  4E70 A;  1VTN C;  3J80 Z;  2V9V A;  1T2K A;  5IT9 Z;  2ZO4 A;  3D0S A;  4G6Q A;  5K5O A;  1BIB A;  3LFK A;  1ZN2 A;  1B9M A;  5TRD A;  1JE8 A;  5DD4 A;  1LDJ A;  4YG2 F;  3PQK A;  4U88 A;  5FLX Z;  1ZYR F;  2QM3 A;  3FMQ A;  5DUK A;  3T5X A;  2EFO A;  3F8B A;  1I5Z A;  2ADU A;  4GCV A;  2DK8 A;  3K1N A;  3WTZ A;  4KMF A;  2HWV A;  5F6F A;  1WRJ A;  1MZB A;  3V7R A;  1XGO A;  4GO1 A;  1IRG A;  3WG9 A;  2WTE A;  4PCQ A;  1S7A A;  1SD4 A;  5E18 F;  1K6O A;  3M8F A;  4ZYH A;  3DF8 A;  1C0W A;  1XGS A;  3K9T A;  4A6D A;  4RB3 C;  3Q9S A;  1S7O A;  4KUM A;  4JK1 X;  2IW5 A;  2XHK A;  5L3C A;  2WV0 A;  1ZAR A;  2HS5 A;  3ZMT A;  3L9F A;  3FHZ A;  3BY6 A;  3IC7 A;  1XSV A;  1KQ8 A;  4HLX A;  1ZGA A;  1IAW A;  1K78 B;  1T98 A;  3EET A;  2LNB A;  1FYK A;  5FFZ A;  2XRN A;  1U5T B;  3LAJ A;  2XV4 S;  2FMY A;  4XSX F;  1I27 A;  1TW2 A;  2ZBK A;  2A69 F;  2ELH A;  4YFN F;  2HKX A;  2XRO A;  1QQI A;  2DFI A;  5CLS A;  2ISY A;  2GA2 A;  2M8E A;  2ZCW A;  1ON2 A;  3OV8 A;  2GIV A;  4OOI A;  5CYV A;  2RNJ A;  5HLG A;  1U6G A;  5TJJ A;  2CFX A;  1ZG1 A;  1SD6 A;  3U2R A;  1DDN A;  3JTG A;  4N0B A;  1D8K A;  3F3X A;  5D6F A;  2DK5 A;  4I09 A;  1XCB A;  2MBF A;  3KP6 A;  2GQQ A;  2L4M A;  4G9Y A;  1F4K A;  3LQR A;  3QPH A;  3ULQ B;  2DPD A;  3E3V A;  2OZ6 A;  5E17 F;  4AIJ A;  2OAZ A;  3F22 A;  3V8K A;  5HDN A;  3LAP A;  3N97 A;  1G3Y A;  2GZW A;  2H94 A;  5BQT A;  1R00 A;  5LGN A;  4L9J A;  3OOP A;  3CUQ B;  1NHA A;  4WCG A;  5K5Q A;  5BPD A;  2L02 A;  4G6D A;  4CYD A;  4XSZ F;  3CLO A;  2K02 A;  3GEZ A;  2UWM A;  4Y17 A;  3DFG A;  2CQK A;  2QQA A;  5L3F A;  2W85 A;  1LEA A;  5DEQ A;  4P5O A;  1HW2 A;  4LMY A;  1HST A;  1XSD A;  2IA0 A;  2JPC A;  2A61 A;  3ABT A;  1YW8 A;  3NQO A;  2E1C A;  3ZPL A;  2QBY A;  3O6B B;  4L5J A;  1DPU A;  3GWZ A;  5HLH A;  4AIH A;  2PEX A;  5LLQ A;  1LEB A;  4UV9 A;  3SQN A;  2XAG A;  3RKW A;  2COM A;  4L9V A;  3ZN1 A;  4XLN F;  2O6G E;  2KJC A;  3F6O A;  5E8G A;  4RGU A;  2ZXJ A;  2R7D A;  2EFP A;  1T6S A;  3MCZ A;  1QPM A;  1Y0U A;  4O5V A;  3TO6 A;  1UCR A;  1XDS A;  4HF2 A;  3T1B A;  1W5S A;  1YQA A;  1ZGJ A;  2FF4 A;  5CJ9 A;  3KCC A;  2QUF A;  2H09 A;  1FSE A;  3D5L A;  1U8R A;  2XGX A;  3QU3 A;  4HDV A;  4HZF A;  3WTU C;  1KU9 A;  4P55 A;  1U3E M;  1QZZ A;  3R60 A;  4RB0 A;  5D4R A;  2ESN A;  3F8M A;  4U0Y A;  2MD5 A;  4RGR A;  1P2F A;  2V1X A;  4D0P A;  5J6X A;  4NHJ A;  1F1Z A;  4Z2Y A;  2A68 F;  4ESB A;  3FMS A;  1HW5 A;  4EM0 B;  4ETS A;  4CXF A;  3R6S A;  1Z91 A;  2OZU A;  1FYL A;  2EA2 A;  3K1P A;  4CDG A;  4EQQ A;  5LRR A;  2BYV E;  4BHP A;  5LRS A;  3E5Q A;  5LBQ A;  3E6M A;  4M72 A;  4HF0 A;  2UXN A;  2X4H A;  1UST A;  4RS8 A;  2PMH A;  1WQ2 A;  2IA2 A;  1BI1 A;  2MH9 A;  4UV8 A;  1J7K A;  2V1U A;  1CF7 B;  4AVP A;  4A5N A;  3W6J B;  2FML A;  5BOX A;  5FLX K;  4M6X A;  3DKW A;  2RKH A;  1TTY A;  4ZZL A;  5J8F A;  1HW1 A;  2XIG A;  5ED4 A;  3WTV C;  3MZH A;  2FNA A;  1FSH A;  4AD9 A;  3KET A;  4EJV A;  5K5R A;  3QAH A;  1Z7U A;  5HS8 A;  4A12 A;  4N9I A;  1FNN A;  2EWN A;  2LDU A;  2BBY A;  3TDU C;  3HSF A;  2VOD A;  3ZMU A;  3WTW C;  1FWZ A;  2DTR A;  2XAS A;  1BN5 A;  4HV6 A;  3TO9 A;  1IN5 A;  2XAQ A;  3KZZ A;  1L3L A;  3H3U A;  2CG4 A;  5HS9 A;  5D5W B;  4WX9 A;  3HYI A;  3R61 A;  3WTT C;  2P6T A;  2M87 A;  2D45 A;  4AIK A;  2NRA C;  2P6S A;  3QPT A;  3ECO A;  2IA1 A;  2MA3 A;  1YS6 A;  2FOK A;  2VC1 A;  2XKO A;  1DPR A;  1KQ9 A;  1JHF A;  5DV5 A;  3U9G A;  1W7P D;  3I71 A;  4YFX F;  2VXZ A;  1PP7 U;  1ZAO A;  1IUY A;  3QOP A;  3HHH A;  1G3T A;  3FM5 A;  1D3Y A;  3IRR A;  1YYV A;  5DCM A;  1Z6R A;  3M9A A;  2EK5 A;  2O03 A;  2PG4 A;  1EH6 A;  3BJO A;  1TNT A;  4KDP A;  1IW7 F;  5CVV A;  1HBX G;  1CGP A;  1V4R A;  2DPU A;  4A0Y A;  4KYW A;  4EMS A;  1BI3 A;  1D5V A;  1GHC A;  1J2X A;  3BJ6 A;  2DBB A;  2BE5 F;  2MLK A;  3GFI A;  4ZYD A;  2F5C A;  4EM1 A;  3KP2 A;  3W6K B;  5A2Q K;  5CVJ A;  2IVM A;  3I58 A;  2XAJ A;  3HTS B;  1DUX C;  4HQM A;  4BNC A;  3JAM Z;  3KEO A;  5HDG A;  2QVO A;  4UUV A;  1ON1 A;  2YU3 A;  3IHU A;  4PGG A;  3L2C A;  2E7X A;  4MEY F;  2STW A;  2BEO A;  4EJW A;  2QYO A;  2P7V B;  2DQL A;  2Q2E A;  2ZKZ A;  4FX0 A;  2A3S A;  3E97 A;  3TKY A;  4IPA A;  2JPB A;  4R1H A;  2EFQ A;  4KIB A;  2JRT A;  1TQI A;  4BXU A;  1G4D A;  2EV5 A;  3FXU A;  2CGP A;  2FA5 A;  4KN4 X;  1LNW A;  3FF5 A;  2A07 F;  4OIO F;  5DUI A;  4ENK A;  5ICG A;  3IRQ A;  1REP C;  3RKY A;  3ABU A;  3WU0 A;  5H6Q A;  2VBW A;  4B09 A;  1PDN C;  1TQM A;  4LLN A;  1TBX A;  1KQ0 A;  4Q5S F;  4K2E A;  4BH9 A;  3ECH A;  5E1Z B;  2EJR A;  1MDM A;  2A5Y B;  3O3K A;  3BP8 A;  3BOQ A;  4A0X A;  3COA C;  1R1T A;  5EEH A;  4EJU A;  1OPC A;  4L18 B;  2BV6 A;  2KKO A;  4DNC A;  1AOY A;  5E8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...