1SD4A

Crystal structure of a semet derivative of blai at 2.0 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
QVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords PENICILLINASE REPRESSOR
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 37
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd4A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd4A02
1HSTA 1ZGJA 2IA1A 5FLXK 1WSUA 1FNNA 2JTVA 3ISPA 2JRTA 3K1NA 5KVRA 4KIFA 3TDUC 5D4SA 1LVAA 1G4DA 2CG4A 1FPQA 3KCCA 3GEZA 4UV8A 2ZNYA 2RGVA 3K2ZA 4KFCA 1L3LA 4M9XA 2XROA 1REPC 2BE5F 3LAJA 2HR3A 2IA2A 5ICGA 2DPDA 1RUOA 4GYGA 1I1GA 3K69A 1HKQA 3QU3A 4P5OA 4KN7X 2IRFG 4CICA 3ZQ7A 4XLPF 1TW2A 2O3FA 3E5QA 1JE8A 3F8BA 4M73A 3BWGA 2OBPA 2UZKA 1HKTA 5LHGA 3S2WA 2W24A 1OR7A 1X3UA 1Z05A 4UVCA 1MGTA 2PBIA 3KP7A 2AS5F 2W25A 1PDNC 4OIPF 3ZN1A 4HF2A 4HDUA 3Q9SA 2QQBA 3DEUA 4OMYA 5BOXA 3L2CA 1SFUA 2CWEA 1XSDA 6PAXA 3TOAA 4L18B 1WWXA 2MH9A 1OPCA 2YSRA 4XLNF 1ZN2A 1ZRDA 1HSJA 1OYYA 4ESFA 5LGNA 4HX7A 2GA2A 2W84A 5K1YA 3WTTC 1DPUA 2TDXA 4OIQF 3V4GA 3ZMVA 1YS6A 2DO7A 1BIAA 1I6XA 3W6KB 2IPQX 3E6BA 1XCBA 1FLIA 2UXNA 2O03A 2YR2A 1W5TA 4HLYA 2P5VA 2P8TA 3U2RA 1P4XA 2CW0F 1IXSB 1ZREA 1U5TA 3PQKA 1FBSA 3V7SA 4IRGA 1FZPB 4I7HA 2KJCA 3KEQA 1S3JA 3I5UA 4R79A 5EEHA 1SAXA 4EM0B 3J81K 2IVMA 3JSPA 1P2FA 3WE2A 5LGTA 2GA1A 1O3SA 3T8TA 3FMRA 3NEUA 3REOA 3EQLF 2G7UA 1KQ9A 2HQNA 2L54A 5F1RA 5AONA 2XVCA 4IRIA 1KQ0A 4M9SA 1ULYA 4HF1A 2XASA 4UVBA 5ERIA 2FNPA 4CHUA 5H6RA 3BY6A 1W5SA 4QLCU 4GGGA 1XCVA 1FP2A 4A2UA 3HSRA 4N9IA 3DPLC 2L01A 4ETSA 2ZJ2A 1VTNC 2EV5A 4MNUA 1BJAA 2ETHA 4MHGA 3HTSB 1BM9A 4LGWA 4BXUA 2HS5A 3JSOA 1EH7A 2LF8A 5LLQA 2Z3YA 1LB2A 2STWA 5AIQA 2FMLA 4LJZF 3TO9A 4IHTA 1XMKA 1LQ1A 3P9KA 1AOYA 2DQLA 4WF2A 3GLXA 3MEXA 4YIFA 5HS9A 1O3QA 1C0WA 3F6VA 1U2WA 2M1BA 5F64A 2RV8A 1JHHA 4P96A 3D5LA 1P4AA 4RGRA 1ZLJA 4ZZDA 4K2EA 1FSEA 4G7ZF 1XGSA 3TO7A 4BQAA 3FWEA 4D0PA 5A2QZ 3K1PA 4ESJA 4M74A 4MEYF 1EH6A 4YIIA 1ZLKA 1YW9A 1CF7B 1I5ZA 4A5NA 1QO0D 3MCZA 1QNTA 2DAOA 1RIOH 2PMUA 2X0LA 2CYYA 2E1NA 1KA8A 1T39A 2VODA 4CDGA 2VOOA 2V6CA 3T8RA 3RDIA 4HZFA 3BPXA 5H20A 2EFWA 2VBWA 2FEZA 3H3ZA 4KDPA 5HOOA 2Z9OA 3E6DA 1FP1D 4OMZA 4EJUA 4FX4A 1ODDA 1F1ZA 2HTSA 2JSCA 4EJVA 4HW0A 4CZZA 1J0RA 3ROUA 3VODA 2QWWA 2FMYA 1G3SA 3SXYA 3KFWX 4WWCA 3FZVA 1MDMB 2VE8A 3E5XA 4EJWA 4CYDA 1R7JA 4UHTA 5HLIA 4HAMA 2HEOA 1H9GA 5CYVA 2QM3A 3HRUA 3D0SA 3F6OA 5LRRA 1KQ8A 2XAFA 3Q9VA 1H9TA 1LEBA 4JBAA 3ZMZA 2L3DA 3R6SA 4M71A 3CO6C 1XB4A 3R4KA 5HDGA 1R1VA 2ESNA 2E1CA 3L09A 2M8EA 4YFNF 3RI4A 5CVUA 1WQ2A 1S8NA 3TO6A 3HRTA 4KT5C 5ILVA 2FQ3A 2W85A 3BJ6A 1U8RA 1YW7A 4E70A 3QRFF 4PGGA 1KYZA 1D3YA 5FD6A 2DFIA 3FMQA 3WTUC 5J6XA 1JXSA 5D6EA 1QQIA 4A6EA 1EH8A 2O8XA 3I54A 4IXAA 3MFKA 4LLNA 1R22A 4R8HA 2RDPA 5BS6A 4IPAA 4EGYA 5LBQA 1TTYA 2IP2A 1BBYA 1LJ9A 1IN5A 3QP5A 2DW4A 4RGXA 5L3FA 1BC7C 2XKOA 2FRHA 2FSWA 2MA3A 3L9FA 4GYIA 4ZH4F 2NS0A 4I02A 5ILSA 1ZRCA 2V9VA 1I1SA 4Y13A 1UHMA 2F5DA 3P9IA 4L5JA 3AAFA 5TRDA 2PI0A 5ILUA 4BHPA 3R0AA 3ECHA 3IWFA 1HKSA 4FHTA 4OU0A 1J7KA 5ICFA 1FOKA 1XMAA 1R58A 1P4WA 3L7WA 2J5OA 4WXHA 2EJRA 2ZKZA 3WTVC 2K86A 4LB5A 3F72A 3I0TA 5K5OA 1RUNA 3WGIA 4L0ZB 4A0ZA 1S7AA 2GXBA 2VT2A 2XV4S 2YX7A 3BJOA 1TQIA 3K1MA 3KEOA 1OKRA 3F8FA 3QPTA 4KA4A 2HZTA 3SHFA 4PZJA 2VBYA 4G6QA 1H0MA 1IXRC 4B09A 3ZMUA 2M87A 2MLKA 4BHCA 4KMFA 4BNCA 4BAYA 3PQJA 3KLOA 1P6RA 5JI6A 3F8NA 2K4BA 3RYPA 2V79A 5HS8A 1IN6A 5HDNA 2MLGA 3SQNA 1BC8C 2IW5A 2WC2A 4M6YA 4U7DA 2VE9A 4G7OF 1SMTA 1G3WA 5JHUA 3CUQA 2HQRA 3T5XA 3F23A 3DQVC 3V7RA 2Q2EA 1JGSA 2VOPA 1KU2A 1G6NA 5H6QA 2QBYA 2DPUA 5JVTA 3R0JA 3GW2A 5D5XB 4H0EA 5L3BA 4ASNA 4LK0F 1ZHFA 2FF4A 3BPVA 4S04A 3GXOA 2GXGA 2L02A 1Z9CA 2HWVA 3TDZC 4WX9A 5DD8A 3ABUA 3JW4A 5J8CA 5D5WB 1HBXG 1FYLA 1BI3A 2O6GE 3GFJA 4AWXB 3ML6A 4I01A 2AXLA 1WI9A 4L9TA 4L5IA 1XN7A 2R3SA 5IT9Z 2Y0MA 3N4MA 1R5HA 3WGGA 3BOQA 3FF5A 2ELHA 3C3WA 3F21A 1U3EM 3HIFA 4I0AA 3ELKA 3J7AO 2PFBA 3Q5FA 2UXXA 2QYOA 2IT0A 3MQ0A 4RGSA 3B73A 2MC3A 4HQEA 2JPBA 1KU7A 4RB3C 5E1ZB 3VFZA 3L00A 4ZZLA 2VXZA 1LDJA 1E17A 1LNWA 2BBYA 3F3XA 5FFZA 5K5RA 1U5TC 3ABTA 3IL2A 4MQVA 2VC1A 2HGCA 2H94A 2Q0OA 5LGUA 3O6BB 1IUYA 2LDUA 1BI0A 5E17F 1NHAA 3LQQA 2QVOA 5FB2A 3ZMSA 1V3FA 2L4MA 1EV7A 1B6AA 4HLXA 5E1WA 4RAZA 2ZBKA 2DLLA 2P7VB 1O3TA 2A61A 5A2QK 4XRFA 3O2PE 3K9TA 4XBFA 5L3DA 2ZO4A 1XSXA 2DT5A 2RKHA 3JTGA 2A6HF 4RS8A 4B8XA 3QAHA 3RIRA 3KP4A 2OQRA 3RYRA 2BEOA 3I4PA 4M72A 2XHKA 2FU4A 1BOAA 1W7PA 1IXCA 1BIBA 2FXAA 3OOPA 4ENMA 3G3ZA 3HRSA 2F5FA 3IKTA 5DYMA 2LNBA 5LHIA 1CGPA 1MZBA 4ENKA 3HUGA 3HOTA 4YFXF 1QPMA 3HYIA 2XRNA 3E3VA 1IN8A 4GO1A 3LAPA 4HDVA 3R60A 4ZYGA 5JR3A 4IVNA 1IN7A 2EFOA 3WE3A 4A6DA 3CO7C 2EV0A 3HSFA 2BGCA 5D6FA 4G7HF 2YU3A 1FYKA 2LKPA 4EQQA 1P92A 3BROA 4U0VA 3TQNA 2BV6A 3FMSA 3CUOA 3MZYA 4HQMA 2WV0A 2PJPA 5IT3A 4F7ZA 4CGZA 3COAC 1YW8A 2EFNA 3K0LA 4HV5A 4PGHA 3EUHA 3RPUA 1JHFA 3IC7A 3GFIA 4KYWA 2Y48A 2F2EA 1YS7A 2W57A 4R1HA 2ZFWA 1IZ1A 1OYIA 1TNSA 2EWNA 3VOEA 4I2OA 1HXDA 1UB9A 2P5KA 2P6SA 1ZH5A 5DD4A 4YFKF 1RZ4A 4Y17A 4L9VA 3VB2A 1YQAA 2RN7A 3H3UA 1FYMA 1Q1HA 2VBXA 3FXRA 1FSHA 1XSVA 4GXOA 3TKYA 4LLGF 2NAZA 3WG9A 3PFIA 3GFMA 4EV0A 1B59A 4Z2YA 4PCQA 3U1DA 2HKOA 4Q47A 4U0YA 2KRFA 2NNYA 2HTJA 3QP6A 1BN5A 3KP2A 4MTEA 2K7LA 4ENNA 1T0FA 3SFZA 3B02A 2OZ6A 2OD5A 4L9JA 1SD4A 2HYGD 1ZYRF 2A69F 3RTRA 3CJNA 3TGNA 3ERED 4I0BA 5HS7A 3F8CA 2KJBA 5CVRA 1YO5C 3JAMZ 2EV6A 3I58A 4HV6A 1K78A 4FT8A 1Z7UA 1A04A 2K4JA 2LSOA 5DCMA 3CTAA 4EJOA 3WTYC 4HBLA 1QGPA 1F5TA 1T98A 4AVPA 1E2XA 2HOEA 2COMA 3E6CC 2V1XA 4CXFA 3V8LA 1BI2A 1MJAA 1QZYA 3WTWC 1PP7U 4GCVA 4O5VA 4HOBA 4ZYEA 3M8FA 4AIJA 4UXNA 1ZG5A 2FOKA 2H09A 3DP7A 4LB6B 1FY7A 5HLHA 1R36A 3V8KA 1YG2A 3FXUA 2Z99A 1TBXA 4RAYA 1STZA 4G94A 1HQCA 5FO5A 4O6JA 2XAGA 2FE3A 3BZ6A 1D5VA 2QQ9A 3U9GA 1CF7A 3ZPLA 5TJJA 1IW7F 1SMYF 2DK8A 4ZYHA 2OAZA 5CVVA 1ZGAA 3I59A 2VBZA 2G7HA 2E7WA 1QZZA 2D2WA 3NRVA 5KK1A 2BYVE 1G3YA 3I64A 3IRQA 4M9ZA 3F8MA 3HSEA 5AIPA 2H27A 2GAUA 1TQPA 1S29A 4IF4A 3CUQB 4LG0A 3T0YA 3MAJA 1L0OC 1MKMA 1Z1DA 4O3MA 4OOIA 5DV5A 4EM1A 5E8GA 4KIBA 1TW3A 1KU9A 5LRSA 2NRAC 5HVQC 2EK5A 1ZG3A 1B9MA 4MGRA 1F4KA 1R1TA 1MDMA 3GZ5A 3CDHA 3I71A 4Q5SF 2L4AA 4KNYA 1RNLA 2PMHA 1FC3A 5EEGA 1T6SA 1ZAOA 1USTA 2PN6A 2QQAA 3DV8A 3TOBA 5D8KB 1DP7P 1SD6A 1GHCA 3KETA 3LA2A 1G3TA 2KIFA 4A12A 1IAWA 4HX4A 3BJAA 5IT9K 4EJTA 1O3RA 2FBHA 1J2XA 2K02A 1U5TB 2F5CA 1FT9A 1FX7A 3P9CA 3DKWA 3RPQA 5K5QA 4RGUA 1XGNA 3W6JB 1Z6RA 1U6GA 2Y75A 3F22A 2ZMEA 2V1DA 2OA4A 2DTRA 2V1UA 4CO8A 5E8IA 2JT1A 1KU3A 3OV8A 4S05A 5DCFA 5F6FA 2UWMA 3FX3A 1GXPA 5D8LB 2H6BA 2M30A 3DPTA 1ZG1A 2EA4A 2Q8KA 1YLFA 5CJ9A 3CUQC 3GYHX 1HW2A 4JK1X 1WKMA 1W7PD 2XKPA 5ICCA 4UV9A 5DEQA 3LA3A 3M9AA 2G9WA 1ONVA 4LFUA 5FFXA 5DUKA 3EYYA 1F9NA 2GIVA 4ZYDA 1XDUA 3J80Z 1SFXA 1TQMA 2HFHA 2WWYA 5DUIA 1UCRA 4HX8A 1W7PB 4P55A 4MTDA 4KMUX 2MD5A 2HDCA 1YYVA 2Z33A 3P7NA 3E6MA 1D8KA 3BDDA 2WTEA 1LDKB 4HA8A 3DFGA 1DPRA 1USSA 4ON0A 4BHBA 3GX4X 1LEAA 2VN2A 1SFEA 4UNOA 5FLXZ 2O61A 1FBUA 1YFHA 2H6CA 2FBIA 4N0BA 2D1VA 5D4RA 2DBBA 2XUBA 2HKXA 3QPHA 2FNAA 2CO5A 3N97A 1O7LA 3HHGA 3EYIA 3HTUA 3GFLA 4PDKA 4U88A 4IRHA 4LK1F 2STTA 4MQ9F 1R23A 2YPRA 4UUVA 2MBFA 1PP8F 4Q48A 4NB5A 3GO5A 2CSOA 4NQWA 2ZXJA 3RKYA 1LDDA 4LLLA 3EETA 1R5GA 1IN4A 1KGSA 1K7AA 1TNTA 5ICEA 2FBKA 1DDNA 5BPIA 3LWFA 3KZZA 3V8JA 4HF0A 5ED4A 4LD5A 1AWCA 5D5VB 4A5MA 1T38A 4AIHA 3GWZA 3MWMA 2RQPA 2P4WA 4XSXF 3SZPA 1O7FA 1BI1A 5FGMA 2E7XA 5JFRA 1XDSA 2O0YA 3MZHA 5BMZA 5HDKA 4OINF 2VC0A 4RB2C 2A5YB 3O3KA 4WK8F 3IHUA 2CFXA 4TV7A 5L3EA 2J5PA 5E1XA 5LEKA 2LF7A 1HW1A 3FXQA 2RNJA 3FM3A 4FX0A 2OU2A 1UHWA 2EFQA 1YIOA 3ZMTA 2XAHA 3ULQB 3KP3A 3WGHA 2M5WA 4Y15A 3C18A 1MJBA 3I53A 3LSTA 3ZMDA 4M6XA 1J59A 2CQKA 2R7FA 1W4MA 2NYXA 1J9IA 1K78B 2DU9A 1WRJA 3GVAA 3QOPA 4P9FA 3SZTA 3JAMK 3G73A 3LA7A 1S6LA 5E18F 4RB1A 5DCMB 2QENA 2FA5A 2YX4A 3M8EA 3WU1B 3J81Z 2ADUA 3FHZA 4EGZA 1B9NA 1ON1A 2RC4A 3DXJF 2GWRA 1SD7A 3GZ6A 1S7OA 4A0YA 4BYYA 2QLZA 2ZNZA 2JPCA 2PQ8A 5CVIA 2GZWA 2P7CB 2D1HA 4ENJA 4JQFA 1IF1A 2IJLA 2K27A 4BH9A 2KIUA 4LMYA 3KP5A 4WXDA 3QU6A 2DQRA 1OYWA 4KUMA 3LFKA 4RB0A 4Q4ZF 1Z6TA 4EMSA 2HYFA 5BPDA 3I59B 4U0WA 1K6OA 3CLOA 1UFMA 3T1BA 2OQGA 1KYWA 2VONA 2KKOA 2OZUA 5BQTA 1PUEE 1IRGA 2Z5UA 4N9HA 5E20A 2P5LC 1YTYA 4IJAA 2X4HA 4LG0B 2MH2A 2NNNA 3BP8A 3E97A 2ACJA 1XGOA 1V4RA 1HW5A 1R1UA 2C6YA 3RKWA 1IRFA 1Z91A 3RJPA 4I09A 4OIOF 2RVCA 3KE2A 4KIGA 1GXQA 1ZARA 2DI3A 4EM2A 3WTSC 1R00A 2XGXA 4QWQA 3ZP5A 3KP6A 2F5EA 1DUXC 4AIKA 1FBQA 2ISYA 2XAQA 3DF8A 1J5YA 3IKVA 2QUFA 2B0LA 3ZN0A 3HHHA 3KZYA 3R61A 1TLHB 3HOSA 2P6TA 4YG2F 2EB7A 1I27A 1XD7A 5CLSA 4DQ2A 2CGPA 3KLNA 2GQQA 1O57A 3RKXA 4WCGA 3C1DA 3WODF 1T2KA 4G6DA 3FM5A 5CVJA 3IRRA 4XSZF 2A3SA 1B1BA 4G8XA 3EDPA 4DNCA 1ON2A 4IHSA 1J75A 5FD5A 1SD5A 3GF2A 4MEXF 2JZYA 3LQRA 3E5UA 5HLGA 3JTHA 3WU0A 2ZMEB 3C7JA 1K79A 2DK5A 2KIMA 2A07F 2ZCWA 4NHJA 1RI7A 2A68F 2VT3A 2A6EF 1Y0UA 3WTXC 2R7DA 3HRMA 3ECOA 2XAJA 3M1EA 1B4AA 4P9UA 2IA0A 2XIGA 1QBJA 2EFPA 4OIRF 4I98B 4KN4X 1GVJA 2ESHA 4EVIA 2ISZA 2PLYA 2QZ8A 2QBYB 4KICA 3GUDA 2PEXA 3NQOA 3H92A 1MD0A 3M7GA 4U7BA 5D5UB 1FWZA 4ESBA 1ZRFA 3J80K 5L3CA 1XGMA 3WTZA 1D8JA 4UVAA 1OMIA 3VEPA 5DDGA 4L9NA 5LHHA 4WXCA 4G9YA 2EA2A 4L0YB 5LEJA 1MJ9A 2PG4A 4AD9A 3V7CA 5L3GA 3IWZA 5J8FA 1U78A 4HYEA 2M45A 2D45A 4A0XA
chains in the Genus database with same CATH superfamily
1HSTA 2LY2A 1ZGJA 2IA1A 2F4IA 1OCCH 1WSUA 5FLXK 4NNJA 1FNNA 3AG2H 2VB6A 1QU3A 1G8XA 2JTVA 3ISPA 2IS1A 2JRTA 3K1NA 5KVRA 4KIFA 2XRLA 3TDUC 4C3HJ 1GT0C 5D4SA 2IS4A 1IV8A 1LVAA 3I9V2 2A5WA 3ZRGA 2PX9A 1G4DA 5JLWA 3A2KA 2CG4A 1FPQA 2LBFB 3KCCA 3GEZA 2L7KA 4BQOA 2JA6J 4UV8A 2ZNYA 2RGVA 3X2QH 3K2ZA 4HSTA 4KFCA 5E79C 4XOTA 1L3LA 2R7WA 3KEYA 3KX2A 3HPGA 2BY2A 4M9XA 2XROA 1REPC 4C30A 2TRTA 2BE5F 3LAJA 2R5ZB 2ZMEC 5E3LA 2NOGA 2HR3A 2IA2A 4X0GA 1OISA 4NQWB 5ICGA 2WAQA 4KT6A 4HNTA 2DPDA 1MNDA 1RUOA 2ZB9A 4GYGA 3WHBA 1E3HA 1I1GA 3K69A 4I6ZA 4A3MJ 1HKQA 3QU3A 3ABLH 3OR2C 2EQRA 3C2GA 4P5OA 3QODA 4KN7X 2IRFG 4CICA 3ZQ7A 3AFHA 4XLPF 3CF5F 1TW2A 2O3FA 3E5QA 1JE8A 3F8BA 4M73A 4V2GA 2CW7A 1PVEA 5JHFA 3BWGA 2OBPA 2UZKA 1HKTA 1GDTA 2VQLA 5LHGA 4A3LJ 2YS9A 3S2WA 3JRHA 2MFZA 4IQJA 4BJ6C 2NS7A 2W24A 3G2BA 1OR7A 1X3UA 1VZ0A 1Z05A 4UVCA 1MGTA 2PBIA 2BVMA 2ZXWH 4BE1A 2JQ7A 3KP7A 3IH4A 3OR1C 2COBA 2X85A 2AS5F 2GLOA 2W25A 1PDNC 4OIPF 3ZN1A 4HF2A 2GBYA 4HDUA 1IGNA 4J19A 3Q9SA 2QQBA 2R5YB 3PSIA 2HZDA 3DEUA 4QSHA 4OMYA 5BOXA 4A3BJ 3L2CA 1YJNI 1SFUA 1N25A 2LKXA 2CWEA 1XSDA 3HUGB 6PAXA 3TOAA 4L18B 1WH5A 2V9KA 1WWXA 3S32A 5EZGA 2BW3A 3S2HJ 3L2WA 2MH9A 1UAAA 1OPCA 2X1DA 4RAGA 3ABKH 2DT7B 3KYCB 3ZR8X 1GVDA 2YSRA 4XLNF 1ZN2A 1K6YA 2JJ7A 1HSJA 1ZRDA 1OYYA 2IBDA 1RC9A 4ESFA 5LGNA 4HX7A 5B1AH 3GTMJ 2M2EA 2GA2A 2W4SA 2W84A 4D5FA 4LG3A 2DXIA 1GV2A 5K1YA 3WTTC 1ZKGA 1LKXA 3C2BA 1DPUA 2TDXA 4XONA 3V4GA 3ZMVA 5GTHC 4OIQF 2JA7J 1IV6A 1QRYA 2B63J 1YS6A 2DO7A 1BIAA 1I6XA 3W6KB 1QHGA 2IPQX 3E6BA 1UG0A 1XCBA 2M7BA 1JJ8C 1FLIA 1OJLA 2UXNA 2O03A 2ZXIA 2YR2A 1W5TA 3TW7A 4HLYA 2P5VA 2P8TA 3U2RA 1P4XA 2ZJQF 2HOTA 2CW0F 3ASOH 1IXSB 1ZREA 2CQ7A 2FX0A 1Y1VJ 1U5TA 3PQKA 3FK7A 1FBSA 2MW8A 3V7SA 4IRGA 1FZPB 3S2DJ 4I7HA 3ASNH 2KJCA 2K85A 2R4GA 1POGA 3KEQA 4ITVA 3CJTB 4RM2A 1N78A 1S3JA 1QZEA 3I5UA 2V6EA 1ZR2A 4R79A 5EEHA 1SAXA 4EM0B 3J81K 1ORKA 2IVMA 1I39A 2EIMH 1D5YA 3JSPA 4E4HA 2CUEA 1P2FA 2CUZA 3DBHB 3WE2A 3MZ8A 1FIPA 3DBLB 5LGTA 2GA1A 3GTKJ 1MNEA 1TWGJ 2BOLA 2X48A 1O3SA 2EZHA 3OIOA 2Y9YA 3UR3C 2TCTA 3T8TA 2OV7A 5EZHA 3FMRA 4ZDPA 2LFBA 3NEUA 2QF7A 1ETQA 2M7AA 3NAUA 3REOA 4BL0B 3JRFA 3E7LA 3EQLF 1W0TA 2G7UA 4BQQA 1KQ9A 4Y33A 1VNDA 2HQNA 2L54A 5F1RA 5AONA 2XVCA 4PJNA 1Z0XA 1JJ6C 4A69C 5EEAA 2CW8A 1KQ0A 4M9SA 4IRIA 1ULYA 4JOMA 1SFOJ 4HF1A 4DBRA 2XASA 4UVBA 1QVTA 5ERIA 2FNPA 4CHUA 5H6RA 3BY6A 3GTQJ 1W5SA 2K9QA 3CDIA 4QLCU 4H4KC 4GGGA 1XCVA 1FP2A 4A2UA 3SZGA 3HSRA 1D1CA 4JYKA 4N9IA 1SANA 1X19A 1MMAA 2EINH 3DPLC 2L01A 4ETSA 2ZJ2A 1CQTA 1TT0A 1VTNC 2JA5J 2WB1N 2EV5A 4ABZA 1LFBA 1V5EA 3DLLF 2ECBA 3CJRB 4MNUA 4KJZA 2MC4A 1BJAA 2ETHA 4MHGA 4BEHA 3HTSB 3GCMA 2KLOA 2DODA 1SVOA 1BM9A 4LGWA 4BXUA 2HS5A 2R7RA 1TP4A 3JSOA 1EH7A 4ZTJA 2LF8A 3K4LA 5LLQA 2Z3YA 4RLQA 1LB2A 2STWA 1VI0A 5M3MJ 5AIQA 2FMLA 3RSNA 4LJZF 1ENHA 3TO9A 4UUSA 4IHTA 1XMKA 1OQYA 1LQ1A 2XPUA 3P9KA 1AOYA 2DQLA 4WF2A 3GLXA 2FOWA 3MEXA 2IS6A 1DQUA 4ZTFA 4YIFA 5HS9A 2VLAA 3S1RJ 1XG1A 1O3QA 3WG7H 2F4OB 1F43A 1C0WA 3S1MJ 1VF9A 3F6VA 4J01A 4RM3A 1U2WA 2M1BA 2KDOA 5F64A 4V19K 2RV8A 2LP0A 1JHHA 4NC7A 4P96A 3D5LA 1P4AA 2CQXA 4RGRA 1ZLJA 2VJ5A 1ETKA 1MBKA 4K2EA 3DBRB 4XM3A 1ETYA 1FSEA 3G1LA 4ZZDA 4G7ZF 3JR9A 1XGSA 1MSFC 3TO7A 5F0HA 4BQAA 3FWEA 4G6TB 4D0PA 3C2HA 5A2QZ 3K1PA 3Q0UA 1YJWI 2VJ4A 4ESJA 4M74A 2O9LA 5B3SH 3ZQLA 1WJEA 3L1PA 5EDNA 2XGEA 2Z1DA 4MEYF 1EH6A 1P7IA 4YIIA 3SDBA 3J7ZI 3QOEA 1ZLKA 1X2NA 1YW9A 1CF7B 3DCFA 3AKZA 3VWBA 2X1CA 1Z3XA 1I5ZA 3A01A 4A5NA 3GLLA 2EZIA 4B48A 1QO0D 2XDVA 3MCZA 1QNTA 2DAOA 1RIOH 2PMUA 2X0LA 2CYYA 4YIRX 4DW6A 3QYBA 2NVQJ 2E2JJ 2E1NA 4B3AA 1KA8A 1T39A 3IUOA 3ZOBA 5F08A 4Z6YA 2EIJH 4F55A 5KCMA 2MYSA 4CDGA 4XRSA 2VOOA 2VODA 3HXLA 3FBIB 3FIWA 4OAYA 2V6CA 5J4VA 4PSXA 3HPHA 2BZTA 3CMAI 3T8RA 5F0CA 3RDIA 2OCCH 3EUKL 4HZFA 3BPXA 3H1CA 1YX5A 3DKYA 5H20A 2KISA 3O8GA 2EFWA 2VBWA 2MSYA 2FEZA 2NOJB 3H3ZA 2K3FA 3KZIC 1VQPI 1S72I 3HOZJ 2DCEA 4KDPA 5HOOA 4FCYA 2Z9OA 2NVXJ 3J7AY 2BY1A 2W48A 3PNTA 3OYCA 4BQNA 4BU2A 1R5ID 2VPRA 3E6DA 1FP1D 4OMZA 4EJUA 1ZR4A 3PJRA 4FX4A 3MMYB 2LLKA 2HNHA 1ODDA 1F1ZA 2HTSA 2PMZN 3U21A 1JI8A 2JSCA 5LFAA 3DEWA 4EJVA 4HW0A 4CZZA 3ERMA 1J0RA 3ROUA 1ERDA 2E1OA 2AXTC 3VODA 3OMYA 2QWWA 4CSWA 2FMYA 3S15J 2R92J 1G3SA 3SXYA 2CV0A 2IEKA 3KFWX 2XSDC 1YRNB 5B1BH 4WWCA 3FZVA 1MDMB 2VE8A 3E5XA 4EJWA 4CYDA 1R7JA 5EYRA 3I4NJ 2XPWA 4UHTA 3HJEA 5HLIA 1VQ6I 4IO9F 4HAMA 2HEOA 3DWLE 2XPVA 3H35A 3JCUC 3LSPA 1ZGWA 1H9GA 5CYVA 2QM3A 3HRUA 1Z21A 3E0JB 3D0SA 3F6OA 2E36A 5LRRA 4Y52J 1KQ8A 3JRDA 2XAFA 3BLYA 2OC6A 4LOCA 4I99C 3Q9VA 1WHUA 1H9TA 1LEBA 3ZQQA 4JBAA 2HPMA 3ZMZA 3K10A 4XLCA 2L3DA 4M71A 3R6SA 3CO6C 3B6CA 1XB4A 3KYDB 3OIQA 3R4KA 1R49A 2DA2A 5HDGA 1R1VA 5CPRB 2ZFUA 1X4PA 1UMQA 2ESNA 2VL8A 1SC7A 3L09A 2E1CA 2JA8J 2XF5A 2M8EA 4CCNA 4YFNF 5BNGA 3RI4A 3GTOJ 5CVUA 4DZPA 4FE4A 1WQ2A 1S8NA 1MSEC 1D0XA 4CH7A 2XGCA 3TO6A 1UJ8A 3BQYA 3HRTA 4KT5C 5ILVA 2IGMA 3K4BA 2FQ3A 2VASA 2W85A 1NTCA 1G59A 2K9LA 3BJ6A 5C44J 1U8RA 2M9HA 3NWSA 3VYTB 1YW7A 3HGGA 4E70A 3QRFF 5J3LA 4PGGA 5EGOA 3PM1A 1KYZA 1D3YA 2KFDA 1IUFA 2DFIA 5KAIC 3FMQA 5FD6A 4DYQA 2BVLA 3WTUC 1MBGA 5J6XA 1JXSA 5D6EA 5C4XJ 3S14J 2N8GA 1QQIA 2VQCA 3IAM2 4A6EA 4M3EA 1EH8A 3OOUA 1ETVA 3HB9A 4BY7J 3W2VA 2O8XA 3I54A 4IXAA 3MFKA 4LLNA 3K4CA 1R22A 2HVSA 3I55I 4R8HA 3NARA 2F6CA 2RDPA 5BS6A 1OCPA 3RQIA 4IPAA 2DMQA 2EZKA 2DMPA 3BR1A 3I56I 4EGYA 1YHQI 5LBQA 1TTYA 2IP2A 3K4KA 1BBYA 1LJ9A 2GXAA 1IN5A 2Q1ZB 3VSLA 3QP5A 2DW4A 4XN3A 3QQAA 4RGXA 5L3FA 2QSHX 1IRZA 1BC7C 2WA0A 2FRHA 2XKOA 2FSWA 4V2FA 5IOZA 2MA3A 3L9FA 2E2HJ 2P0WA 3LSJA 4QPQA 4GYIA 1TWHJ 1RRJA 4ZH4F 3CLQA 2NS0A 4I02A 5ILSA 1ZRCA 3HOWJ 2V9VA 1I1SA 4XKWA 4Y13A 1JUSA 1UHMA 2F5DA 3GZNB 2OF7A 3PNYA 1X1BA 5M5YJ 1LVKA 2DOFA 3P9IA 1KONA 4L5JA 2LKSA 4E6KG 3AAFA 5GPAA 3H9JA 5TRDA 1S9HA 2PI0A 4BY1J 5ILUA 4BHPA 3R0AA 3ECHA 3IWFA 4A0XA 1HKSA 4FHTA 2A6TA 4OU0A 1J7KA 5ICFA 2HOSA 2W1OA 1FOKA 2KRHA 3G1OA 1X58A 1XMAA 3M8JA 3WU2C 2BXYA 1R58A 1P4WA 3L7WA 2J5OA 4WXHA 1SAUA 2EJRA 2BW3B 2M8GX 1S7EA 2ZKZA 4U87A 5GP9A 3WTVC 3CC2I 2K86A 4M6VA 1A31A 2E60A 3HGYA 1U9OA 4LB5A 3F72A 3OL4A 2H8RA 3K4MA 1QVUA 3I0TA 3DTIA 5K5OA 1RUNA 3WGIA 5FKMA 4L0ZB 3HOUJ 4A0ZA 2DFEA 3HDDA 1S7AA 2KZVA 2GXBA 2K3PA 2R7SA 3MVPA 2BXZA 2VT2A 2XV4S 2L9SA 2YX7A 3BJOA 2XF7A 1TQIA 3BTJA 3K1MA 3KEOA 1OKRA 2R7TA 1HDDC 2GIZA 3K70D 1H88C 3F8FA 3QPTA 4KA4A 2HZTA 3FKJA 3SHFA 4OWRB 4PZJA 1SVLA 2VBYA 1FMWA 4G6QA 5E3NA 3L2RA 3SJMA 1B72B 1H0MA 1IXRC 4B09A 3ZMUA 1WJAA 2M87A 2MLKA 4BHCA 4KMFA 1MBJA 4BNCA 2XGDA 4BAYA 3PQJA 4G12A 4B4CA 3KLOA 1B8IB 3OS1A 3M3YJ 1P6RA 4XLFA 5JI6A 3F8NA 3HKZN 4QIWN 2K4BA 3RYPA 4D7MA 1SFKA 2F48A 2V79A 1X3WB 5HS8A 4GRIA 4BGDA 1FMVA 2P81A 1IN6A 4DZJA 1EJ9A 5HDNA 2MLGA 3SQNA 1BC8C 2ZC2A 2IW5A 2VQGA 3KYLA 2JUGA 5FKNA 2WC2A 1MBFA 4M6YA 4U7DA 1AA7A 2VE9A 4G7OF 1SMTA 1G3WA 3BG6A 3LSGA 5JHUA 3CUQA 3AL0C 2HQRA 3T5XA 3BC8A 3F23A 3DQVC 2EILH 4KITB 1IDYA 2Q2EA 1ACIA 1OR7C 1JGSA 5GTIC 2L5QA 1KU2A 2VOPA 1G6NA 5H6QA 2QBYA 2DPUA 5JVTA 3R0JA 3GW2A 2GOXB 5D5XB 4H0EA 1V55H 5L3BA 4ASNA 4LK0F 1ZHFA 4XK4A 2FF4A 3BPVA 1FOYA 3ZGKA 4S04A 3GXOA 1D0YA 4HG2A 5FLMJ 1MMNA 4DBQA 2GXGA 1YIJI 1W5CC 2X6WA 2L02A 4D5CA 1TWFJ 2HWVA 1Z9CA 2KT0A 3TDZC 4IL6C 4WX9A 3CC4I 4N4OB 5DD8A 2I5UA 3H5NA 4CYCB 2L9NA 1PUFB 1FIAA 3ABUA 4JX5A 3OYEA 3JW4A 5J8CA 1HCRA 5D5WB 4ZC3A 1HBXG 1FYLA 4D1QA 1ETOA 1BI3A 2O6GE 3GFJA 4AWXB 2Y30A 1BA5A 3ML6A 4I01A 1LE8A 2AXLA 1WI9A 4CZCA 4ZDOA 4L9TA 1JT6A 4L5IA 1XN7A 3IH3A 1RKTA 4E7ZA 4XLEA 2Y0SN 2R3SA 5IT9Z 2Y0MA 3N4MA 1R5HA 3WGGA 3BOQA 3BR5A 3FF5A 2ELHA 3C3WA 2LD5A 2I8DA 3F21A 1JKOC 1U3EM 3HIFA 4I0AA 3ELKA 3J7AO 2PFBA 3Q5FA 1TC3C 2UXXA 2QYOA 3B6AA 2IT0A 3G6EI 3MQ0A 4RGSA 2F4MB 3B73A 5KAFC 2HOAA 2MC3A 3A4CA 2HI3A 4HQEA 1WZ2A 2JPBA 1KU7A 2HYJA 4RB3C 5E1ZB 4AVZA 3VFZA 3L00A 4FQGA 2O7OA 3BT9A 4LITA 4XICA 4ZZLA 2VXZA 4A3KJ 1MMDA 1LDJA 5LD2C 2F5VA 4MLOA 3PIOF 1E17A 3U1KA 4I76A 1LNWA 2BBYA 3F3XA 5FFZA 1OCTC 5K5RA 2NXNB 1U5TC 3ABTA 3BTLA 3HBLA 3IL2A 3K70C 4MQVA 2B9SA 2LH9A 2DA5A 2VC1A 3DKXA 4A3FJ 3J7YJ 4ZYAA 2HGCA 2O5RA 3ZCOA 2H94A 2Q0OA 3ZQFA 4OAZA 2L0KA 4BBRJ 5LGUA 3JRGA 3O6BB 2VPLA 1IUYA 1WI3A 1BI0A 2LDUA 2RQQA 5E17F 1NHAA 2V4JC 3H9QA 3LQQA 2QVOA 2CV1A 2QEXI 5FB2A 3ZMSA 1V3FA 1MBEA 2L4MA 1VQ9I 1EV7A 1B6AA 4HLXA 5E1WA 3ZQCA 4RAZA 1VQKI 2QCOA 2ZBKA 2DLLA 2P7VB 1O3TA 1XX5A 3HC7A 2A61A 5IYBJ 5A2QK 1YJ9I 4Y4RA 4J00A 4XRFA 3S3MA 2R7OA 3O2PE 2LRDA 3K9TA 4XBFA 3CMYA 2NVTJ 1UELB 5L3DA 2X6XA 1U0JA 2M0MA 2KDZA 2LY9A 4DYCA 2X6YA 2ZO4A 1HF0A 1FEXA 1XSXA 2LTPA 2OPTA 2DT5A 3A01B 1FTTA 2RKHA 2ELJA 2A6HF 3JTGA 4RS8A 4B8XA 3QAHA 3PIPF 3RIRA 1LFPA 3KP4A 2OQRA 3RYRA 2IGKA 4GFBA 2BEOA 5K7ZA 2ICWG 4CCLA 3OYAA 3I4PA 1VQOI 1Y39A 2MGQA 3CF2A 3QPLA 2K9MA 4M72A 2XHKA 2FU4A 1WFXA 1NH3A 1BOAA 1W7PA 5IYDJ 1IXCA 1BIBA 3HOVJ 2FXAA 3OOPA 4ENMA 3MD2A 2PJRB 4IOAF 3G3ZA 3HRSA 2R5YA 2EPFA 5C3EJ 4A3GJ 2F5FA 1NG7A 1Y1WJ 5GPCA 1PYVA 4ZDLA 3IKTA 3OYNA 3LMMA 5DYMA 2LNBA 5LHIA 1CGPA 1MZBA 4ENKA 3HUGA 3HOTA 3IAS2 4NC6A 4YFXF 2NVYJ 3CMEI 3Q0VA 3W2AA 1QPMA 2YUSA 4XR6A 1APLC 1DU0A 2LY1A 2WY8Q 3M4OJ 3HYIA 1W36D 2XRNA 3E3VA 3D5SC 2GOMA 1IN8A 1HDPA 4GO1A 3LAPA 4HDVA 3R60A 4LIVA 4IZZA 4ZYGA 4PJJA 5JR3A 4IVNA 3L2UA 1IN7A 2EFOA 3RKQA 2GM4A 5J4YA 3WE3A 4A6DA 3CO7C 1JKQC 4AIDA 2EV0A 3G71I 3A0HC 2K40A 3A02A 3DTKA 4N4NB 5CKTA 4PFPA 2A05A 1HC8A 2L7FP 2QGUA 3HSFA 4CCOA 1I3QJ 2BGCA 5D6FA 4G7HF 2YU3A 1FYKA 2LKPA 4EQQA 3O8HA 1P92A 5DM7F 2JWTA 3BROA 2ID6A 4U0VA 2V26A 1JKRC 5F0FA 4BJ5C 3TQNA 4IHVA 3A0BC 2BV6A 3FMSA 3ONQA 1BJZA 3CUOA 4XRMA 3MZYA 4HQMA 5F04A 2WV0A 2PJPA 4E7JA 3HOXJ 2WAQN 4RAFA 3TP0A 5IT3A 4F7ZA 4CGZA 2BY3A 4AYBA 3COAC 1YW8A 2EFNA 2ELKA 3K0LA 4HV5A 4PGHA 2KL4A 3EUHA 3RPUA 1JHFA 2DA1A 3IC7A 3GFIA 4KYWA 2Y48A 2V9PA 2O8KA 5JLXA 3HOYJ 2F2EA 1YS7A 2W57A 1GLNA 2IAIA 4R1HA 1XC5A 5EJCA 3RQ4A 2ZFWA 3EUHC 1IZ1A 1OYIA 1TNSA 2EWNA 3VOEA 2WBMA 4I2OA 1K4SA 2IS2A 4A3EJ 1HXDA 3FK6A 1UB9A 2B7EA 2P5KA 2P6SA 1ZH5A 5DD4A 2VJIA 3CCJI 3CCLI 1A6QA 4YFKF 1RZ4A 5IP6A 4Y17A 1Z3YA 4PJMA 5EGOB 4PJLA 5KNLA 4L9VA 4B44A 3VB2A 2DOEA 1UZCA 1WCMJ 1YQAA 2RN7A 3H3UA 1FYMA 5FRMA 1Q1HA 3P5JA 2L9VA 1HLVA 4XQFA 2VBXA 3FXRA 4IHWA 4C3JJ 1FSHA 1DGWY 1WH7A 3OYGA 1S5LC 1XSVA 4GXOA 2OJED 3TKYA 3PSFA 4LLGF 5M5XJ 2NAZA 3WG9A 2JK3A 3FBNB 3PFIA 2W7NA 2DMTA 4W97A 3GFMA 4EV0A 1B59A 3G1MA 4Z2YA 1ETXA 1U8BA 4PCQA 3U1DA 2QSFX 2JVGA 2HKOA 4Q47A 3ZQIA 4U0YA 1WVRA 2QA4I 2VJJA 2KRFA 2NNYA 2HTJA 2EBIA 4FETA 3QP6A 1BN5A 3KP2A 1IDZA 4MTEA 2K7LA 4PUSA 4ENNA 4BE0A 4B3XA 1T0FA 4E7LA 1AKHA 2IGNA 2KHMA 3SFZA 3B02A 2DJIA 2OZ6A 1OFCX 3LNQA 1JTXA 2Z16A 4QTRA 1TWCJ 2OD5A 1P9QC 4L9JA 3DU6A 1SD4A 1Y56A 2ZSIB 4X6AJ 1RR8C 2HYGD 2M34A 4FTHA 3OYBA 2HDDA 1ZYRF 2QKMB 2X1EA 4EATA 2A69F 3RTRA 3CJNA 3TGNA 3FHNA 1O4XA 2ECCA 4AUXA 3ERED 4I0BA 5HS7A 1W36C 3F8CA 3BG5A 2KJBA 5CVRA 1YO5C 3JAMZ 1Z7LA 2EV6A 2L7ZA 3I58A 4HV6A 4QPOA 1K78A 2LVSA 1UHSA 4FT8A 1Z7UA 1KZHA 3CC7I 3VYRB 4HSRA 1A04A 4L5EA 5J1RA 5HLTA 2K4JA 4Y7NJ 2LSOA 5DCMA 1R9TJ 3CTAA 4EJOA 3WTYC 2WV1A 4CCKA 3CJQB 4HBLA 1QGPA 5GAEJ 1T98A 4AVPA 1F5TA 1E2XA 2BHYA 4IEJA 2HOEA 2COMA 4ANJA 5M5WJ 3E6CC 2V1XA 2DTZA 4CXFA 2Y69H 3V8LA 2CH0A 1BI2A 1MJAA 1QZYA 3WTWC 1PP7U 2HVRA 1I6HJ 2DMUA 3FISA 4IX7A 4GCVA 4O5VA 4HOBA 4ZYEA 3M8FA 4AIJA 4UXNA 5J40A 1ZG5A 4M3FA 2FOKA 2H09A 3DP7A 2LG4A 2KQRA 4LB6B 1FY7A 5HLHA 3S16J 1R36A 3FDYA 3V8KA 3LSHA 1YG2A 2JMWA 1XTAA 3FXUA 2Z99A 1TBXA 2CUFA 3FXLA 2V1NA 1STZA 3Q3SA 4RAYA 4G94A 2E34A 1HQCA 5FO5A 3JRBA 1JKPC 4O6JA 3ESWB 2JN6A 2XAGA 4MIMA 2FE3A 1GV5A 3BZ6A 1D5VA 3CCQI 2QQ9A 3U9GA 2M4KA 1CF7A 2G0EA 3FXKA 2DMNA 1MW7A 3BZKA 3N05A 3ZPLA 5FLVA 5TJJA 4BBSJ 1IW7F 2I10A 1SMYF 2DK8A 2ME6A 3CCUI 2KP6A 3LSIA 1YE9A 3D1NI 4ZYHA 3CD6I 3OYIA 2OAZA 5CVVA 4BE2A 1ZGAA 3I59A 2DFHA 1MIJA 2VBZA 2G7HA 2E7WA 1QZZA 2D2WA 3QPSA 3NRVA 5KK1A 2BYVE 1G3YA 3I64A 3FKIJ 3IRQA 4M9ZA 4XLAA 3G4SI 3F8MA 3HSEA 4EEFG 4W1UA 5AIPA 3V42A 3IV5A 2H27A 3AL0B 2H1KA 4NBQA 5F27A 1ZK8A 2GAUA 1TQPA 1S29A 3ABMH 4IF4A 2Y2ZA 3CUQB 4LG0A 3T0YA 3MAJA 1IJWC 1BR1A 1L0OC 1MKMA 1Z1DA 4O3MA 4OOIA 3CZ6A 5DV5A 1JUMA 5E8GA 4KIBA 4EM1A 5FKKA 1SEUA 2XB0X 2HXOA 4RLFA 1TW3A 1KU9A 3H5AA 5KHDA 5LRSA 3EUAA 2NRAC 5HVQC 2L9RA 2EK5A 1ZG3A 1VQ8I 5DS9A 3VSKA 1B9MA 3I4MJ 4MGRA 4DOZA 2IGOA 1F4KA 5EG0A 5E3OA 1R1TA 3AG4H 5F1JA 3GZ5A 3CDHA 1MDMA 2XAUA 3I71A 1Y8RB 4Q5SF 3CCMI 2L4AA 3OYLA 4KNYA 4XIDA 2XB5A 1RNLA 3CCVI 1DP3A 1G2HA 1VQ5I 2PMHA 2VQHA 1FC3A 2E1MC 5EEGA 4PSWA 1T6SA 1ZAOA 1USTA 2L7MP 2PN6A 2QQAA 3PO2J 2CUJA 1MNMC 2WB1A 1LE8B 1YX3A 3DV8A 3TOBA 5D8KB 1DP7P 1SD6A 1GHCA 5IPAA 3KETA 3LA2A 1HOMA 1G3TA 2HQAA 3CP2A 2KIFA 1K4TA 3MKWB 4A12A 1XS9A 3SEZA 1IAWA 4HX4A 3BJAA 5IT9K 1RKWA 2JUCA 1D1BA 3A03A 1O3RA 4EJTA 2FBHA 4RBOA 3OL3A 1U9NA 2X6OA 4MFDA 1J2XA 2MABA 2K02A 3M1CA 3S3NA 2IXSA 3M07A 1U5TB 3QYFA 4BDYA 2CJJA 5J1UA 2F5CA 3GTJJ 1FOXA 2LC2A 1IO2A 3W2WA 1FT9A 3LSRA 1FX7A 3P9CA 3DKWA 3RPQA 3RZDJ 5FROA 5K5QA 2R7ZJ 4RGUA 3HG9A 4UB8C 1K83J 2KPMA 1XGNA 2DOAA 3W6JB 1Z6RA 1U6GA 2ID3A 3CCEI 1IRXA 1A5JA 3BR0A 2Y75A 3F22A 2ZMEA 2V1DA 2OA4A 2DTRA 1MMGA 2JA2A 2V1UA 4CO8A 3EPZA 3TP3A 4BJTA 5E8IA 2JT1A 1KU3A 2DA3A 3OV8A 3PUBA 4S05A 5DCFA 2V7FA 5F6FA 4UUTA 4NC8A 3W6VA 2UWMA 4NDLA 2QSGX 3FX3A 3E1SA 1GXPA 5D8LB 2H6BA 2M30A 3DPTA 1X1PA 2CFOA 4DIQA 1ZG1A 2EA4A 3PL8A 3H9GA 2Q8KA 3CQZJ 1YLFA 2EIKH 1A35A 4HPQA 3DU5A 5TISC 5CJ9A 3CUQC 3WHCA 3GYHX 1HW2A 4JK1X 1WKMA 1ITYA 3GBGA 4JP0A 1W7PD 2DA6A 2XKPA 5ICCA 4UV9A 5DEQA 5JVGF 5M3FJ 1T08B 5HNFA 1Q1VA 1IC8A 3LA3A 3M9AA 2G9WA 1ONVA 4LFUA 5FFXA 5IOYA 5DUKA 3EYYA 2XC7A 1BW5A 1F9NA 2GIVA 2WAFA 4C9YA 1X4OA 2X9DA 3S93A 1XDUA 4ZYDA 1SFXA 1TQMA 2VKDA 3J80Z 2HFHA 4BACA 2DDBA 3BTCA 1Y6IA 2WWYA 5DUIA 4E7IA 1UCRA 1X1CA 4UB6C 4HX8A 2M4GA 1W7PB 4DJAA 1BR2A 4P55A 1V5GA 4MTDA 4KMUX 2R7XA 2LK2A 2MD5A 1E0EA 2YU9J 3GTPJ 2HDCA 4A3DJ 2E5NA 3JRAA 1YYVA 2WAEA 1YITI 2Z33A 5DM6F 3P7NA 3FXJA 2VKEA 4CCMA 1H89C 4F3QA 3I3LA 2R93J 3S1NJ 3E6MA 1D8KA 3MKLA 4IHYA 3BDDA 4BEHB 2WTEA 1LDKB 4HA8A 4XNFA 1V54H 2Y31A 1BOBA 3DFGA 3LOCA 4IQ4A 3CCYA 2LREA 1DPRA 4UY8I 4F93B 2VKHA 1USSA 4ON0A 1FTZA 3BQZA 4BHBA 4B1RA 3GX4X 1LEAA 4RA2A 2AO9A 2VN2A 4PFOA 1K61A 1SFEA 2CU7A 4UNOA 1T56A 3DEEA 5FLXZ 2O61A 1FBUA 1YFHA 1R4NB 3L2QA 2OTJI 2H6CA 4UUSB 2FBIA 2PMZA 4N0BA 4DYRA 3GTLJ 2D1VA 1D0ZA 3S3OA 5D4RA 5B5EC 1VFCA 2DBBA 3KIOA 3K7AJ 2XUBA 2HKXA 5FRNA 3QPHA 1LPQA 3MN2A 3K4JA 2FNAA 2CO5A 1IG7A 3RPUD 3N97A 4KISA 1O7LA 3HHGA 3KPHA 3EYIA 1HA8A 2HPIA 2LBFA 2WY7Q 1PJRA 3HTUA 2D5VA 2DT6A 3GFLA 5FKOA 4HNVA 1OCOH 2K9SA 2NVUB 1B72A 3QWLA 4PDKA 4IHXA 1BW6A 4U88A 4CA0A 3PUFA 3JRCA 1V5FA 5CQEA 2ZJPF 2K5CA 4IRHA 4LK1F 2STTA 3CDLA 2FUG2 4A3CJ 4MQ9F 1R23A 2YPRA 2R5ZA 3CESA 4UUVA 1B8IA 2MBFA 1Z67A 1PP8F 4Q48A 4NB5A 3GO5A 2CSOA 2ZJRF 4NQWA 2ZXJA 3ZXSA 3RKYA 3UKGA 2KIQA 2JSPA 3OWTA 1LDDA 4LLLA 3EETA 1R5GA 1IN4A 3F0CA 1KGSA 1K7AA 1TNTA 2EH3A 3OYDA 4C2TA 5ICEA 1LUJB 2FBKA 1DDNA 1JTYA 5BPIA 3LWFA 4C2UA 4FE7A 1XMXA 1VQLI 3KZZA 2M0CA 3Q0WA 3V8JA 2JVHA 2CMPA 2VKVA 2MD0A 2K9NA 4HF0A 5ED4A 4GDFA 2DDAA 1R4MB 4LD5A 3BG7A 2Y9ZA 1AWCA 5D5VB 2UUZA 4PK4A 1N77A 2LR8A 2DN0A 4A5MA 3W3CA 2R7QA 9ANTA 3OYKA 4AIHA 1T38A 3F9KA 3GWZA 1AU7A 3MWMA 2RQPA 1QPIA 2P4WA 4XSXF 2CS3A 2ZXHA 3OY9A 1FJLA 3SZPA 2E35A 1GUUA 1O7FA 1BI1A 1I3AA 2X51A 4JX4A 5FGMA 2E7XA 5JFRA 1XDSA 3BG3A 2O0YA 3AG3H 1WJCA 1WJDA 3MZHA 3ZQHA 4X1EA 5BMZA 1DGRM 5HDKA 4OINF 2VC0A 3OSGA 5IYCJ 1OCZH 3GMEA 2A5YB 4RB2C 3BR2A 3O3KA 1R6RA 4WK8F 3IHUA 4BKXA 4F91B 5IP7J 2AQEA 4CYCA 2CFXA 4TV7A 5L3EA 1OCRH 1PUFA 1RETA 2KMUA 4XLHA 1JUPA 3LSKA 2J5PA 1J09A 5E1XA 5LEKA 2LF7A 3DPUA 1WJBA 3L2VA 5IY5H 1HW1A 3FXQA 2RAEA 2RNJA 4S0HB 1AKHB 4DGWB 2WADA 3FM3A 4FX0A 1I50J 1JGGA 2OU2A 1UHWA 3OS0A 2EFQA 2E5ZA 1WJFA 1YIOA 1H8AC 4M3DA 2HQ5A 2AQFA 3BCAA 2ZSHB 3ZMTA 2XAHA 3ULQB 3KP3A 4C3IJ 3WGHA 2M5WA 4Y15A 3C18A 1MJBA 3I53A 3H0GJ 3LSTA 3ZMDA 4MO7A 3FXOA 4M6XA 1J59A 2CQKA 3D5RC 2R7FA 1RPWA 1W4MA 2NYXA 2CV2A 4HRIA 4JX6A 1K78B 1J9IA 2DU9A 1WRJA 3GVAA 3QOPA 4P9FA 3SZTA 3JAMK 3G73A 1Z77A 3LA7A 3OIPA 1S6LA 5E18F 4RB1A 5DCMB 2CRGA 3DTEA 2DYRH 2QENA 2FA5A 2YX4A 5K7FA 3M8EA 3WU1B 2VI6A 3H5RA 3J81Z 2E19A 3H0DA 2ADUA 3FHZA 1DU6A 2HXIA 4EGZA 3MKYB 1B9NA 4NUBA 3VDXA 4E7SA 3H3VK 1ON1A 2RC4A 2OCEA 2HDWA 1EF4A 2KZGA 3DXJF 2GWRA 4XL9A 1T8IA 1SD7A 3GZ6A 3HEFA 1S7OA 2RNGA 2OUMA 4A0YA 3SFIA 4BYYA 5FJ8J 2QLZA 2ZNZA 2JPCA 2PQ8A 1TL8A 5CVIA 1VQNI 2GZWA 2P7CB 2D1HA 4ENJA 4JQFA 1IF1A 2LMDA 2IJLA 3FXMA 2K27A 5DTDA 5E3MA 4BH9A 5TGTA 3AG1H 5H2FC 2KIUA 4BXFA 3OS2A 4RDUA 4LMYA 4BS9A 2R7UA 2L2OA 3KP5A 2W00A 4WXDA 4Y3OA 2XF6A 3LL7A 3QU6A 2OTLI 2DQRA 1OYWA 2DFFA 4KUMA 2LOOA 3LFKA 4RB0A 4Q4ZF 1Z6TA 2H1LA 4EMSA 2HYFA 5BPDA 1A6IA 3I59B 1M1EB 1TZLA 2FD5A 4U0WA 1QA6A 3BR3A 3VYUB 1WJ5A 1ZTRA 4F52A 3CLOA 1K6OA 3DLAA 1BR4A 1UFMA 4YELA 2OQGA 3T1BA 1KYWA 2VONA 4B47A 1W0UA 2KKOA 2OZUA 5BQTA 1PUEE 4RMNA 3HM5A 1IRGA 3HKZA 1SVMA 2Z5UA 2PJRA 1Y8QB 1F36A 4N9HA 1OLTA 5E20A 2P5LC 1YTYA 4IJAA 3JREA 2HVQA 4IOCF 2X4HA 1MMSA 2E71A 4LG0B 3BZCA 3H36A 2MH2A 3PO3J 2NNNA 3BP8A 3E97A 1N75A 2ACJA 1T0FC 1XGOA 3BG9A 3S1QJ 1V4RA 3TL4X 1HW5A 1R1UA 3NWTA 4D7NA 2C6YA 3SDGA 3RKWA 1MH4A 5C4JJ 1IRFA 1Z91A 3RJPA 4I09A 2BHZA 4YEJA 4XOPA 2MG4A 4OIOF 2RVCA 3KE2A 1NK3P 4XN0A 4KIGA 5EG0B 1ETWA 2HU9A 1GXQA 1ZARA 2DI3A 1AHDP 5GAGJ 2E1MB 2W82A 2FQ4A 3BTIA 4EM2A 4FASD 3WTSC 1R00A 2XGXA 3IP4B 4QWQA 3ZP5A 3KP6A 2F5EA 1DUXC 4AIKA 4XKVA 3OSFA 3OYFA 2KRCA 3PFYA 1FBQA 2ISYA 4F92B 4II2A 1NG6A 2XAQA 3DF8A 1J5YA 3K4NA 1VQ4I 1E3PA 3IKVA 2QUFA 2DA4A 2M3AA 4C2MJ 4A93J 5GADJ 2B0LA 3ZN0A 3HHHA 4XORA 1LFUP 3KZYA 1TWAJ 3R61A 2RREA 1X3ZB 1TLHB 3HOSA 2P6TA 3JRIA 1YI2I 4YG2F 2EB7A 1VQMI 3K2AA 1I27A 1XD7A 5CLSA 4DQ2A 2CGPA 4D9JA 4HEA2 3KLNA 2GQQA 1O57A 3K6GA 3RKXA 4WCGA 2Y0SA 4CCJA 3C1DA 1X1AA 1MBHA 3WODF 4IKFA 1T2KA 3OYMA 4G6DA 3FM5A 5EF6A 5CVJA 3SYTA 1R71A 3IRRA 4XSZF 1TT5B 2A3SA 1B1BA 4G8XA 5HNHA 1FOWA 4E7KA 3EDPA 3ZQGA 4BDZA 3A1YA 4DNCA 3TEDA 5J47A 3TBIA 1ON2A 4IHSA 1EKEA 1J75A 3CP8A 5FD5A 1SD5A 3LSMA 2E2IJ 3GF2A 3HL2A 4MFEA 4MEXF 3BCBA 4LIUA 2JZYA 3LQRA 3E5UA 5HLGA 2LYCA 1QHHD 1P7JA 2UV1A 4PJ0C 3JTHA 4XKCA 3TMOA 2H8WA 4A3IJ 5HODA 3WU0A 2ZMEB 5IP9J 1ZELA 3PNVA 4ZJZA 3OYHA 3C7JA 1K79A 2DK5A 3VYSB 2KIMA 4M3GA 2A07F 2ZCWA 4NHJA 1RI7A 2FJ1A 2DJNA 2A68F 1BL0A 2VT3A 4XMYA 3GTGJ 2CQQA 2A6EF 1Y0UA 3WTXC 3LFUA 4YRVA 2VIXA 2R7DA 3HRMA 3QYEA 3S8PA 3CMMA 3ECOA 5GAHJ 1ZQ3P 2XAJA 3M1EA 1B4AA 4CUGA 2IA0A 4P9UA 2BY0A 2XIGA 1QBJA 5B66C 2EFPA 4BUPA 4OIRF 2DA7A 1X1DA 5CQGA 4M3BA 2VXDA 4I98B 4KN4X 4P1WA 3HZJA 2Q2EB 1UG2A 1GVJA 2ESHA 4EVIA 3OYJA 5J1YA 4AU7A 1EA3A 2ISZA 3RZOJ 1Y0NA 2PLYA 2QZ8A 2R0QC 2QBYB 1NK2P 2XSJC 1W1WE 4KICA 4B43A 3CCRI 3VPRA 3GUDA 2PEXA 2QQ8A 1VQ7I 3S17J 3NQOA 3H92A 5FKLA 1MD0A 1MH3A 2NS8A 1YRNA 2R7VA 3M7GA 1XPXA 4FISA 1RR7A 4II3A 2ME0A 2CQNA 4U7BA 5D5UB 4BXXJ 1FWZA 4ESBA 3SEQA 1ZRFA 3J80K 5L3CA 1XGMA 3RCOA 3WTZA 4XRSG 1T95A 1D8JA 4UVAA 1OMIA 3VEPA 4XKBA 4AC0A 2QKLB 5DDGA 4A3JJ 2VUMJ 2DYSH 1A36A 4L9NA 4AYBN 5LHHA 1D1AA 4WXCA 4G9YA 1E3OC 1X2MA 2EA2A 4L0YB 5LEJA 1MJ9A 5K7HA 1WGXA 1JT0A 2PG4A 4AD9A 3V7CA 5L3GA 4E7HA 3BR6A 3UNGC 1YOVB 2JRMA 2EZLA 1WPKA 3IWZA 5J8FA 1U78A 4HYEA 2AHQA 3TW6A 3MKZA 4HNUA 1RESA 2Z2SB 3CCSI 1T33A 2M45A 3IH2A 2D45A 3V7RA 4AM3A
chains in the Genus database with same CATH topology
1HSTA 1ZGJA 2IA1A 5FLXK 1WSUA 1FNNA 2JTVA 3ISPA 2JRTA 3K1NA 5KVRA 4KIFA 3TDUC 5D4SA 1LVAA 1G4DA 2CG4A 1FPQA 3KCCA 3GEZA 4UV8A 2ZNYA 2RGVA 3K2ZA 4KFCA 1L3LA 4M9XA 2XROA 1REPC 2BE5F 3LAJA 2HR3A 2IA2A 5ICGA 2DPDA 1RUOA 4GYGA 1I1GA 3K69A 1HKQA 3QU3A 4P5OA 4KN7X 2IRFG 4CICA 3ZQ7A 4XLPF 1TW2A 2O3FA 3E5QA 1JE8A 3F8BA 4M73A 3BWGA 2OBPA 2UZKA 1HKTA 5LHGA 3S2WA 2W24A 1OR7A 1X3UA 1Z05A 4UVCA 1MGTA 2PBIA 3KP7A 2AS5F 2W25A 1PDNC 4OIPF 3ZN1A 4HF2A 4HDUA 3Q9SA 2QQBA 3DEUA 4OMYA 5BOXA 3L2CA 1SFUA 2CWEA 1XSDA 6PAXA 3TOAA 4L18B 1WWXA 2MH9A 1OPCA 2YSRA 4XLNF 1ZN2A 1ZRDA 1HSJA 1OYYA 4ESFA 5LGNA 4HX7A 2GA2A 2W84A 5K1YA 3WTTC 1DPUA 2TDXA 4OIQF 3V4GA 3ZMVA 1YS6A 2DO7A 1BIAA 1I6XA 3W6KB 2IPQX 3E6BA 1XCBA 1FLIA 2UXNA 2O03A 2YR2A 1W5TA 4HLYA 2P5VA 2P8TA 3U2RA 1P4XA 2CW0F 1IXSB 1ZREA 1U5TA 3PQKA 1FBSA 3V7SA 4IRGA 1FZPB 4I7HA 2KJCA 3KEQA 1S3JA 3I5UA 4R79A 5EEHA 1SAXA 4EM0B 3J81K 2IVMA 3JSPA 1P2FA 3WE2A 5LGTA 2GA1A 1O3SA 3T8TA 3FMRA 3NEUA 3REOA 3EQLF 2G7UA 1KQ9A 2HQNA 2L54A 5F1RA 5AONA 2XVCA 4IRIA 1KQ0A 4M9SA 1ULYA 4HF1A 2XASA 4UVBA 5ERIA 2FNPA 4CHUA 5H6RA 3BY6A 1W5SA 4QLCU 4GGGA 1XCVA 1FP2A 4A2UA 3HSRA 4N9IA 3DPLC 2L01A 4ETSA 2ZJ2A 1VTNC 2EV5A 4MNUA 1BJAA 2ETHA 4MHGA 3HTSB 1BM9A 4LGWA 4BXUA 2HS5A 3JSOA 1EH7A 2LF8A 5LLQA 2Z3YA 1LB2A 2STWA 5AIQA 2FMLA 4LJZF 3TO9A 4IHTA 1XMKA 1LQ1A 3P9KA 1AOYA 2DQLA 4WF2A 3GLXA 3MEXA 4YIFA 5HS9A 1O3QA 1C0WA 3F6VA 1U2WA 2M1BA 5F64A 2RV8A 1JHHA 4P96A 3D5LA 1P4AA 4RGRA 1ZLJA 4ZZDA 4K2EA 1FSEA 4G7ZF 1XGSA 3TO7A 4BQAA 3FWEA 4D0PA 5A2QZ 3K1PA 4ESJA 4M74A 4MEYF 1EH6A 4YIIA 1ZLKA 1YW9A 1CF7B 1I5ZA 4A5NA 1QO0D 3MCZA 1QNTA 2DAOA 1RIOH 2PMUA 2X0LA 2CYYA 2E1NA 1KA8A 1T39A 2VODA 4CDGA 2VOOA 2V6CA 3T8RA 3RDIA 4HZFA 3BPXA 5H20A 2EFWA 2VBWA 2FEZA 3H3ZA 4KDPA 5HOOA 2Z9OA 3E6DA 1FP1D 4OMZA 4EJUA 4FX4A 1ODDA 1F1ZA 2HTSA 2JSCA 4EJVA 4HW0A 4CZZA 1J0RA 3ROUA 3VODA 2QWWA 2FMYA 1G3SA 3SXYA 3KFWX 4WWCA 3FZVA 1MDMB 2VE8A 3E5XA 4EJWA 4CYDA 1R7JA 4UHTA 5HLIA 4HAMA 2HEOA 1H9GA 5CYVA 2QM3A 3HRUA 3D0SA 3F6OA 5LRRA 1KQ8A 2XAFA 3Q9VA 1H9TA 1LEBA 4JBAA 3ZMZA 2L3DA 3R6SA 4M71A 3CO6C 1XB4A 3R4KA 5HDGA 1R1VA 2ESNA 2E1CA 3L09A 2M8EA 4YFNF 3RI4A 5CVUA 1WQ2A 1S8NA 3TO6A 3HRTA 4KT5C 5ILVA 2FQ3A 2W85A 3BJ6A 1U8RA 1YW7A 4E70A 3QRFF 4PGGA 1KYZA 1D3YA 5FD6A 2DFIA 3FMQA 3WTUC 5J6XA 1JXSA 5D6EA 1QQIA 4A6EA 1EH8A 2O8XA 3I54A 4IXAA 3MFKA 4LLNA 1R22A 4R8HA 2RDPA 5BS6A 4IPAA 4EGYA 5LBQA 1TTYA 2IP2A 1BBYA 1LJ9A 1IN5A 3QP5A 2DW4A 4RGXA 5L3FA 1BC7C 2XKOA 2FRHA 2FSWA 2MA3A 3L9FA 4GYIA 4ZH4F 2NS0A 4I02A 5ILSA 1ZRCA 2V9VA 1I1SA 4Y13A 1UHMA 2F5DA 3P9IA 4L5JA 3AAFA 5TRDA 2PI0A 5ILUA 4BHPA 3R0AA 3ECHA 3IWFA 1HKSA 4FHTA 4OU0A 1J7KA 5ICFA 1FOKA 1XMAA 1R58A 1P4WA 3L7WA 2J5OA 4WXHA 2EJRA 2ZKZA 3WTVC 2K86A 4LB5A 3F72A 3I0TA 5K5OA 1RUNA 3WGIA 4L0ZB 4A0ZA 1S7AA 2GXBA 2VT2A 2XV4S 2YX7A 3BJOA 1TQIA 3K1MA 3KEOA 1OKRA 3F8FA 3QPTA 4KA4A 2HZTA 3SHFA 4PZJA 2VBYA 4G6QA 1H0MA 1IXRC 4B09A 3ZMUA 2M87A 2MLKA 4BHCA 4KMFA 4BNCA 4BAYA 3PQJA 3KLOA 1P6RA 5JI6A 3F8NA 2K4BA 3RYPA 2V79A 5HS8A 1IN6A 5HDNA 2MLGA 3SQNA 1BC8C 2IW5A 2WC2A 4M6YA 4U7DA 2VE9A 4G7OF 1SMTA 1G3WA 5JHUA 3CUQA 2HQRA 3T5XA 3F23A 3DQVC 3V7RA 2Q2EA 1JGSA 2VOPA 1KU2A 1G6NA 5H6QA 2QBYA 2DPUA 5JVTA 3R0JA 3GW2A 5D5XB 4H0EA 5L3BA 4ASNA 4LK0F 1ZHFA 2FF4A 3BPVA 4S04A 3GXOA 2GXGA 2L02A 1Z9CA 2HWVA 3TDZC 4WX9A 5DD8A 3ABUA 3JW4A 5J8CA 5D5WB 1HBXG 1FYLA 1BI3A 2O6GE 3GFJA 4AWXB 3ML6A 4I01A 2AXLA 1WI9A 4L9TA 4L5IA 1XN7A 2R3SA 5IT9Z 2Y0MA 3N4MA 1R5HA 3WGGA 3BOQA 3FF5A 2ELHA 3C3WA 3F21A 1U3EM 3HIFA 4I0AA 3ELKA 3J7AO 2PFBA 3Q5FA 2UXXA 2QYOA 2IT0A 3MQ0A 4RGSA 3B73A 2MC3A 4HQEA 2JPBA 1KU7A 4RB3C 5E1ZB 3VFZA 3L00A 4ZZLA 2VXZA 1LDJA 1E17A 1LNWA 2BBYA 3F3XA 5FFZA 5K5RA 1U5TC 3ABTA 3IL2A 4MQVA 2VC1A 2HGCA 2H94A 2Q0OA 5LGUA 3O6BB 1IUYA 2LDUA 1BI0A 5E17F 1NHAA 3LQQA 2QVOA 5FB2A 3ZMSA 1V3FA 2L4MA 1EV7A 1B6AA 4HLXA 5E1WA 4RAZA 2ZBKA 2DLLA 2P7VB 1O3TA 2A61A 5A2QK 4XRFA 3O2PE 3K9TA 4XBFA 5L3DA 2ZO4A 1XSXA 2DT5A 2RKHA 3JTGA 2A6HF 4RS8A 4B8XA 3QAHA 3RIRA 3KP4A 2OQRA 3RYRA 2BEOA 3I4PA 4M72A 2XHKA 2FU4A 1BOAA 1W7PA 1IXCA 1BIBA 2FXAA 3OOPA 4ENMA 3G3ZA 3HRSA 2F5FA 3IKTA 5DYMA 2LNBA 5LHIA 1CGPA 1MZBA 4ENKA 3HUGA 3HOTA 4YFXF 1QPMA 3HYIA 2XRNA 3E3VA 1IN8A 4GO1A 3LAPA 4HDVA 3R60A 4ZYGA 5JR3A 4IVNA 1IN7A 2EFOA 3WE3A 4A6DA 3CO7C 2EV0A 3HSFA 2BGCA 5D6FA 4G7HF 2YU3A 1FYKA 2LKPA 4EQQA 1P92A 3BROA 4U0VA 3TQNA 2BV6A 3FMSA 3CUOA 3MZYA 4HQMA 2WV0A 2PJPA 5IT3A 4F7ZA 4CGZA 3COAC 1YW8A 2EFNA 3K0LA 4HV5A 4PGHA 3EUHA 3RPUA 1JHFA 3IC7A 3GFIA 4KYWA 2Y48A 2F2EA 1YS7A 2W57A 4R1HA 2ZFWA 1IZ1A 1OYIA 1TNSA 2EWNA 3VOEA 4I2OA 1HXDA 1UB9A 2P5KA 2P6SA 1ZH5A 5DD4A 4YFKF 1RZ4A 4Y17A 4L9VA 3VB2A 1YQAA 2RN7A 3H3UA 1FYMA 1Q1HA 2VBXA 3FXRA 1FSHA 1XSVA 4GXOA 3TKYA 4LLGF 2NAZA 3WG9A 3PFIA 3GFMA 4EV0A 1B59A 4Z2YA 4PCQA 3U1DA 2HKOA 4Q47A 4U0YA 2KRFA 2NNYA 2HTJA 3QP6A 1BN5A 3KP2A 4MTEA 2K7LA 4ENNA 1T0FA 3SFZA 3B02A 2OZ6A 2OD5A 4L9JA 1SD4A 2HYGD 1ZYRF 2A69F 3RTRA 3CJNA 3TGNA 3ERED 4I0BA 5HS7A 3F8CA 2KJBA 5CVRA 1YO5C 3JAMZ 2EV6A 3I58A 4HV6A 1K78A 4FT8A 1Z7UA 1A04A 2K4JA 2LSOA 5DCMA 3CTAA 4EJOA 3WTYC 4HBLA 1QGPA 1F5TA 1T98A 4AVPA 1E2XA 2HOEA 2COMA 3E6CC 2V1XA 4CXFA 3V8LA 1BI2A 1MJAA 1QZYA 3WTWC 1PP7U 4GCVA 4O5VA 4HOBA 4ZYEA 3M8FA 4AIJA 4UXNA 1ZG5A 2FOKA 2H09A 3DP7A 4LB6B 1FY7A 5HLHA 1R36A 3V8KA 1YG2A 3FXUA 2Z99A 1TBXA 4RAYA 1STZA 4G94A 1HQCA 5FO5A 4O6JA 2XAGA 2FE3A 3BZ6A 1D5VA 2QQ9A 3U9GA 1CF7A 3ZPLA 5TJJA 1IW7F 1SMYF 2DK8A 4ZYHA 2OAZA 5CVVA 1ZGAA 3I59A 2VBZA 2G7HA 2E7WA 1QZZA 2D2WA 3NRVA 5KK1A 2BYVE 1G3YA 3I64A 3IRQA 4M9ZA 3F8MA 3HSEA 5AIPA 2H27A 2GAUA 1TQPA 1S29A 4IF4A 3CUQB 4LG0A 3T0YA 3MAJA 1L0OC 1MKMA 1Z1DA 4O3MA 4OOIA 5DV5A 4EM1A 5E8GA 4KIBA 1TW3A 1KU9A 5LRSA 2NRAC 5HVQC 2EK5A 1ZG3A 1B9MA 4MGRA 1F4KA 1R1TA 1MDMA 3GZ5A 3CDHA 3I71A 4Q5SF 2L4AA 4KNYA 1RNLA 2PMHA 1FC3A 5EEGA 1T6SA 1ZAOA 1USTA 2PN6A 2QQAA 3DV8A 3TOBA 5D8KB 1DP7P 1SD6A 1GHCA 3KETA 3LA2A 1G3TA 2KIFA 4A12A 1IAWA 4HX4A 3BJAA 5IT9K 4EJTA 1O3RA 2FBHA 1J2XA 2K02A 1U5TB 2F5CA 1FT9A 1FX7A 3P9CA 3DKWA 3RPQA 5K5QA 4RGUA 1XGNA 3W6JB 1Z6RA 1U6GA 2Y75A 3F22A 2ZMEA 2V1DA 2OA4A 2DTRA 2V1UA 4CO8A 5E8IA 2JT1A 1KU3A 3OV8A 4S05A 5DCFA 5F6FA 2UWMA 3FX3A 1GXPA 5D8LB 2H6BA 2M30A 3DPTA 1ZG1A 2EA4A 2Q8KA 1YLFA 5CJ9A 3CUQC 3GYHX 1HW2A 4JK1X 1WKMA 1W7PD 2XKPA 5ICCA 4UV9A 5DEQA 3LA3A 3M9AA 2G9WA 1ONVA 4LFUA 5FFXA 5DUKA 3EYYA 1F9NA 2GIVA 4ZYDA 1XDUA 3J80Z 1SFXA 1TQMA 2HFHA 2WWYA 5DUIA 1UCRA 4HX8A 1W7PB 4P55A 4MTDA 4KMUX 2MD5A 2HDCA 1YYVA 2Z33A 3P7NA 3E6MA 1D8KA 3BDDA 2WTEA 1LDKB 4HA8A 3DFGA 1DPRA 1USSA 4ON0A 4BHBA 3GX4X 1LEAA 2VN2A 1SFEA 4UNOA 5FLXZ 2O61A 1FBUA 1YFHA 2H6CA 2FBIA 4N0BA 2D1VA 5D4RA 2DBBA 2XUBA 2HKXA 3QPHA 2FNAA 2CO5A 3N97A 1O7LA 3HHGA 3EYIA 3HTUA 3GFLA 4PDKA 4U88A 4IRHA 4LK1F 2STTA 4MQ9F 1R23A 2YPRA 4UUVA 2MBFA 1PP8F 4Q48A 4NB5A 3GO5A 2CSOA 4NQWA 2ZXJA 3RKYA 1LDDA 4LLLA 3EETA 1R5GA 1IN4A 1KGSA 1K7AA 1TNTA 5ICEA 2FBKA 1DDNA 5BPIA 3LWFA 3KZZA 3V8JA 4HF0A 5ED4A 4LD5A 1AWCA 5D5VB 4A5MA 1T38A 4AIHA 3GWZA 3MWMA 2RQPA 2P4WA 4XSXF 3SZPA 1O7FA 1BI1A 5FGMA 2E7XA 5JFRA 1XDSA 2O0YA 3MZHA 5BMZA 5HDKA 4OINF 2VC0A 4RB2C 2A5YB 3O3KA 4WK8F 3IHUA 2CFXA 4TV7A 5L3EA 2J5PA 5E1XA 5LEKA 2LF7A 1HW1A 3FXQA 2RNJA 3FM3A 4FX0A 2OU2A 1UHWA 2EFQA 1YIOA 3ZMTA 2XAHA 3ULQB 3KP3A 3WGHA 2M5WA 4Y15A 3C18A 1MJBA 3I53A 3LSTA 3ZMDA 4M6XA 1J59A 2CQKA 2R7FA 1W4MA 2NYXA 1J9IA 1K78B 2DU9A 1WRJA 3GVAA 3QOPA 4P9FA 3SZTA 3JAMK 3G73A 3LA7A 1S6LA 5E18F 4RB1A 5DCMB 2QENA 2FA5A 2YX4A 3M8EA 3WU1B 3J81Z 2ADUA 3FHZA 4EGZA 1B9NA 1ON1A 2RC4A 3DXJF 2GWRA 1SD7A 3GZ6A 1S7OA 4A0YA 4BYYA 2QLZA 2ZNZA 2JPCA 2PQ8A 5CVIA 2GZWA 2P7CB 2D1HA 4ENJA 4JQFA 1IF1A 2IJLA 2K27A 4BH9A 2KIUA 4LMYA 3KP5A 4WXDA 3QU6A 2DQRA 1OYWA 4KUMA 3LFKA 4RB0A 4Q4ZF 1Z6TA 4EMSA 2HYFA 5BPDA 3I59B 4U0WA 1K6OA 3CLOA 1UFMA 3T1BA 2OQGA 1KYWA 2VONA 2KKOA 2OZUA 5BQTA 1PUEE 1IRGA 2Z5UA 4N9HA 5E20A 2P5LC 1YTYA 4IJAA 2X4HA 4LG0B 2MH2A 2NNNA 3BP8A 3E97A 2ACJA 1XGOA 1V4RA 1HW5A 1R1UA 2C6YA 3RKWA 1IRFA 1Z91A 3RJPA 4I09A 4OIOF 2RVCA 3KE2A 4KIGA 1GXQA 1ZARA 2DI3A 4EM2A 3WTSC 1R00A 2XGXA 4QWQA 3ZP5A 3KP6A 2F5EA 1DUXC 4AIKA 1FBQA 2ISYA 2XAQA 3DF8A 1J5YA 3IKVA 2QUFA 2B0LA 3ZN0A 3HHHA 3KZYA 3R61A 1TLHB 3HOSA 2P6TA 4YG2F 2EB7A 1I27A 1XD7A 5CLSA 4DQ2A 2CGPA 3KLNA 2GQQA 1O57A 3RKXA 4WCGA 3C1DA 3WODF 1T2KA 4G6DA 3FM5A 5CVJA 3IRRA 4XSZF 2A3SA 1B1BA 4G8XA 3EDPA 4DNCA 1ON2A 4IHSA 1J75A 5FD5A 1SD5A 3GF2A 4MEXF 2JZYA 3LQRA 3E5UA 5HLGA 3JTHA 3WU0A 2ZMEB 3C7JA 1K79A 2DK5A 2KIMA 2A07F 2ZCWA 4NHJA 1RI7A 2A68F 2VT3A 2A6EF 1Y0UA 3WTXC 2R7DA 3HRMA 3ECOA 2XAJA 3M1EA 1B4AA 4P9UA 2IA0A 2XIGA 1QBJA 2EFPA 4OIRF 4I98B 4KN4X 1GVJA 2ESHA 4EVIA 2ISZA 2PLYA 2QZ8A 2QBYB 4KICA 3GUDA 2PEXA 3NQOA 3H92A 1MD0A 3M7GA 4U7BA 5D5UB 1FWZA 4ESBA 1ZRFA 3J80K 5L3CA 1XGMA 3WTZA 1D8JA 4UVAA 1OMIA 3VEPA 5DDGA 4L9NA 5LHHA 4WXCA 4G9YA 2EA2A 4L0YB 5LEJA 1MJ9A 2PG4A 4AD9A 3V7CA 5L3GA 3IWZA 5J8FA 1U78A 4HYEA 2M45A 2D45A 4A0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HST A;  1ZGJ A;  2IA1 A;  5FLX K;  1WSU A;  1FNN A;  2JTV A;  3ISP A;  2JRT A;  3K1N A;  5KVR A;  4KIF A;  3TDU C;  5D4S A;  1LVA A;  1G4D A;  2CG4 A;  1FPQ A;  3KCC A;  3GEZ A;  4UV8 A;  2ZNY A;  2RGV A;  3K2Z A;  4KFC A;  1L3L A;  4M9X A;  2XRO A;  1REP C;  2BE5 F;  3LAJ A;  2HR3 A;  2IA2 A;  5ICG A;  2DPD A;  1RUO A;  4GYG A;  1I1G A;  3K69 A;  1HKQ A;  3QU3 A;  4P5O A;  4KN7 X;  2IRF G;  4CIC A;  3ZQ7 A;  4XLP F;  1TW2 A;  2O3F A;  3E5Q A;  1JE8 A;  3F8B A;  4M73 A;  3BWG A;  2OBP A;  2UZK A;  1HKT A;  5LHG A;  3S2W A;  2W24 A;  1OR7 A;  1X3U A;  1Z05 A;  4UVC A;  1MGT A;  2PBI A;  3KP7 A;  2AS5 F;  2W25 A;  1PDN C;  4OIP F;  3ZN1 A;  4HF2 A;  4HDU A;  3Q9S A;  2QQB A;  3DEU A;  4OMY A;  5BOX A;  3L2C A;  1SFU A;  2CWE A;  1XSD A;  6PAX A;  3TOA A;  4L18 B;  1WWX A;  2MH9 A;  1OPC A;  2YSR A;  4XLN F;  1ZN2 A;  1ZRD A;  1HSJ A;  1OYY A;  4ESF A;  5LGN A;  4HX7 A;  2GA2 A;  2W84 A;  5K1Y A;  3WTT C;  1DPU A;  2TDX A;  4OIQ F;  3V4G A;  3ZMV A;  1YS6 A;  2DO7 A;  1BIA A;  1I6X A;  3W6K B;  2IPQ X;  3E6B A;  1XCB A;  1FLI A;  2UXN A;  2O03 A;  2YR2 A;  1W5T A;  4HLY A;  2P5V A;  2P8T A;  3U2R A;  1P4X A;  2CW0 F;  1IXS B;  1ZRE A;  1U5T A;  3PQK A;  1FBS A;  3V7S A;  4IRG A;  1FZP B;  4I7H A;  2KJC A;  3KEQ A;  1S3J A;  3I5U A;  4R79 A;  5EEH A;  1SAX A;  4EM0 B;  3J81 K;  2IVM A;  3JSP A;  1P2F A;  3WE2 A;  5LGT A;  2GA1 A;  1O3S A;  3T8T A;  3FMR A;  3NEU A;  3REO A;  3EQL F;  2G7U A;  1KQ9 A;  2HQN A;  2L54 A;  5F1R A;  5AON A;  2XVC A;  4IRI A;  1KQ0 A;  4M9S A;  1ULY A;  4HF1 A;  2XAS A;  4UVB A;  5ERI A;  2FNP A;  4CHU A;  5H6R A;  3BY6 A;  1W5S A;  4QLC U;  4GGG A;  1XCV A;  1FP2 A;  4A2U A;  3HSR A;  4N9I A;  3DPL C;  2L01 A;  4ETS A;  2ZJ2 A;  1VTN C;  2EV5 A;  4MNU A;  1BJA A;  2ETH A;  4MHG A;  3HTS B;  1BM9 A;  4LGW A;  4BXU A;  2HS5 A;  3JSO A;  1EH7 A;  2LF8 A;  5LLQ A;  2Z3Y A;  1LB2 A;  2STW A;  5AIQ A;  2FML A;  4LJZ F;  3TO9 A;  4IHT A;  1XMK A;  1LQ1 A;  3P9K A;  1AOY A;  2DQL A;  4WF2 A;  3GLX A;  3MEX A;  4YIF A;  5HS9 A;  1O3Q A;  1C0W A;  3F6V A;  1U2W A;  2M1B A;  5F64 A;  2RV8 A;  1JHH A;  4P96 A;  3D5L A;  1P4A A;  4RGR A;  1ZLJ A;  4ZZD A;  4K2E A;  1FSE A;  4G7Z F;  1XGS A;  3TO7 A;  4BQA A;  3FWE A;  4D0P A;  5A2Q Z;  3K1P A;  4ESJ A;  4M74 A;  4MEY F;  1EH6 A;  4YII A;  1ZLK A;  1YW9 A;  1CF7 B;  1I5Z A;  4A5N A;  1QO0 D;  3MCZ A;  1QNT A;  2DAO A;  1RIO H;  2PMU A;  2X0L A;  2CYY A;  2E1N A;  1KA8 A;  1T39 A;  2VOD A;  4CDG A;  2VOO A;  2V6C A;  3T8R A;  3RDI A;  4HZF A;  3BPX A;  5H20 A;  2EFW A;  2VBW A;  2FEZ A;  3H3Z A;  4KDP A;  5HOO A;  2Z9O A;  3E6D A;  1FP1 D;  4OMZ A;  4EJU A;  4FX4 A;  1ODD A;  1F1Z A;  2HTS A;  2JSC A;  4EJV A;  4HW0 A;  4CZZ A;  1J0R A;  3ROU A;  3VOD A;  2QWW A;  2FMY A;  1G3S A;  3SXY A;  3KFW X;  4WWC A;  3FZV A;  1MDM B;  2VE8 A;  3E5X A;  4EJW A;  4CYD A;  1R7J A;  4UHT A;  5HLI A;  4HAM A;  2HEO A;  1H9G A;  5CYV A;  2QM3 A;  3HRU A;  3D0S A;  3F6O A;  5LRR A;  1KQ8 A;  2XAF A;  3Q9V A;  1H9T A;  1LEB A;  4JBA A;  3ZMZ A;  2L3D A;  3R6S A;  4M71 A;  3CO6 C;  1XB4 A;  3R4K A;  5HDG A;  1R1V A;  2ESN A;  2E1C A;  3L09 A;  2M8E A;  4YFN F;  3RI4 A;  5CVU A;  1WQ2 A;  1S8N A;  3TO6 A;  3HRT A;  4KT5 C;  5ILV A;  2FQ3 A;  2W85 A;  3BJ6 A;  1U8R A;  1YW7 A;  4E70 A;  3QRF F;  4PGG A;  1KYZ A;  1D3Y A;  5FD6 A;  2DFI A;  3FMQ A;  3WTU C;  5J6X A;  1JXS A;  5D6E A;  1QQI A;  4A6E A;  1EH8 A;  2O8X A;  3I54 A;  4IXA A;  3MFK A;  4LLN A;  1R22 A;  4R8H A;  2RDP A;  5BS6 A;  4IPA A;  4EGY A;  5LBQ A;  1TTY A;  2IP2 A;  1BBY A;  1LJ9 A;  1IN5 A;  3QP5 A;  2DW4 A;  4RGX A;  5L3F A;  1BC7 C;  2XKO A;  2FRH A;  2FSW A;  2MA3 A;  3L9F A;  4GYI A;  4ZH4 F;  2NS0 A;  4I02 A;  5ILS A;  1ZRC A;  2V9V A;  1I1S A;  4Y13 A;  1UHM A;  2F5D A;  3P9I A;  4L5J A;  3AAF A;  5TRD A;  2PI0 A;  5ILU A;  4BHP A;  3R0A A;  3ECH A;  3IWF A;  1HKS A;  4FHT A;  4OU0 A;  1J7K A;  5ICF A;  1FOK A;  1XMA A;  1R58 A;  1P4W A;  3L7W A;  2J5O A;  4WXH A;  2EJR A;  2ZKZ A;  3WTV C;  2K86 A;  4LB5 A;  3F72 A;  3I0T A;  5K5O A;  1RUN A;  3WGI A;  4L0Z B;  4A0Z A;  1S7A A;  2GXB A;  2VT2 A;  2XV4 S;  2YX7 A;  3BJO A;  1TQI A;  3K1M A;  3KEO A;  1OKR A;  3F8F A;  3QPT A;  4KA4 A;  2HZT A;  3SHF A;  4PZJ A;  2VBY A;  4G6Q A;  1H0M A;  1IXR C;  4B09 A;  3ZMU A;  2M87 A;  2MLK A;  4BHC A;  4KMF A;  4BNC A;  4BAY A;  3PQJ A;  3KLO A;  1P6R A;  5JI6 A;  3F8N A;  2K4B A;  3RYP A;  2V79 A;  5HS8 A;  1IN6 A;  5HDN A;  2MLG A;  3SQN A;  1BC8 C;  2IW5 A;  2WC2 A;  4M6Y A;  4U7D A;  2VE9 A;  4G7O F;  1SMT A;  1G3W A;  5JHU A;  3CUQ A;  2HQR A;  3T5X A;  3F23 A;  3DQV C;  3V7R A;  2Q2E A;  1JGS A;  2VOP A;  1KU2 A;  1G6N A;  5H6Q A;  2QBY A;  2DPU A;  5JVT A;  3R0J A;  3GW2 A;  5D5X B;  4H0E A;  5L3B A;  4ASN A;  4LK0 F;  1ZHF A;  2FF4 A;  3BPV A;  4S04 A;  3GXO A;  2GXG A;  2L02 A;  1Z9C A;  2HWV A;  3TDZ C;  4WX9 A;  5DD8 A;  3ABU A;  3JW4 A;  5J8C A;  5D5W B;  1HBX G;  1FYL A;  1BI3 A;  2O6G E;  3GFJ A;  4AWX B;  3ML6 A;  4I01 A;  2AXL A;  1WI9 A;  4L9T A;  4L5I A;  1XN7 A;  2R3S A;  5IT9 Z;  2Y0M A;  3N4M A;  1R5H A;  3WGG A;  3BOQ A;  3FF5 A;  2ELH A;  3C3W A;  3F21 A;  1U3E M;  3HIF A;  4I0A A;  3ELK A;  3J7A O;  2PFB A;  3Q5F A;  2UXX A;  2QYO A;  2IT0 A;  3MQ0 A;  4RGS A;  3B73 A;  2MC3 A;  4HQE A;  2JPB A;  1KU7 A;  4RB3 C;  5E1Z B;  3VFZ A;  3L00 A;  4ZZL A;  2VXZ A;  1LDJ A;  1E17 A;  1LNW A;  2BBY A;  3F3X A;  5FFZ A;  5K5R A;  1U5T C;  3ABT A;  3IL2 A;  4MQV A;  2VC1 A;  2HGC A;  2H94 A;  2Q0O A;  5LGU A;  3O6B B;  1IUY A;  2LDU A;  1BI0 A;  5E17 F;  1NHA A;  3LQQ A;  2QVO A;  5FB2 A;  3ZMS A;  1V3F A;  2L4M A;  1EV7 A;  1B6A A;  4HLX A;  5E1W A;  4RAZ A;  2ZBK A;  2DLL A;  2P7V B;  1O3T A;  2A61 A;  5A2Q K;  4XRF A;  3O2P E;  3K9T A;  4XBF A;  5L3D A;  2ZO4 A;  1XSX A;  2DT5 A;  2RKH A;  3JTG A;  2A6H F;  4RS8 A;  4B8X A;  3QAH A;  3RIR A;  3KP4 A;  2OQR A;  3RYR A;  2BEO A;  3I4P A;  4M72 A;  2XHK A;  2FU4 A;  1BOA A;  1W7P A;  1IXC A;  1BIB A;  2FXA A;  3OOP A;  4ENM A;  3G3Z A;  3HRS A;  2F5F A;  3IKT A;  5DYM A;  2LNB A;  5LHI A;  1CGP A;  1MZB A;  4ENK A;  3HUG A;  3HOT A;  4YFX F;  1QPM A;  3HYI A;  2XRN A;  3E3V A;  1IN8 A;  4GO1 A;  3LAP A;  4HDV A;  3R60 A;  4ZYG A;  5JR3 A;  4IVN A;  1IN7 A;  2EFO A;  3WE3 A;  4A6D A;  3CO7 C;  2EV0 A;  3HSF A;  2BGC A;  5D6F A;  4G7H F;  2YU3 A;  1FYK A;  2LKP A;  4EQQ A;  1P92 A;  3BRO A;  4U0V A;  3TQN A;  2BV6 A;  3FMS A;  3CUO A;  3MZY A;  4HQM A;  2WV0 A;  2PJP A;  5IT3 A;  4F7Z A;  4CGZ A;  3COA C;  1YW8 A;  2EFN A;  3K0L A;  4HV5 A;  4PGH A;  3EUH A;  3RPU A;  1JHF A;  3IC7 A;  3GFI A;  4KYW A;  2Y48 A;  2F2E A;  1YS7 A;  2W57 A;  4R1H A;  2ZFW A;  1IZ1 A;  1OYI A;  1TNS A;  2EWN A;  3VOE A;  4I2O A;  1HXD A;  1UB9 A;  2P5K A;  2P6S A;  1ZH5 A;  5DD4 A;  4YFK F;  1RZ4 A;  4Y17 A;  4L9V A;  3VB2 A;  1YQA A;  2RN7 A;  3H3U A;  1FYM A;  1Q1H A;  2VBX A;  3FXR A;  1FSH A;  1XSV A;  4GXO A;  3TKY A;  4LLG F;  2NAZ A;  3WG9 A;  3PFI A;  3GFM A;  4EV0 A;  1B59 A;  4Z2Y A;  4PCQ A;  3U1D A;  2HKO A;  4Q47 A;  4U0Y A;  2KRF A;  2NNY A;  2HTJ A;  3QP6 A;  1BN5 A;  3KP2 A;  4MTE A;  2K7L A;  4ENN A;  1T0F A;  3SFZ A;  3B02 A;  2OZ6 A;  2OD5 A;  4L9J A;  1SD4 A;  2HYG D;  1ZYR F;  2A69 F;  3RTR A;  3CJN A;  3TGN A;  3ERE D;  4I0B A;  5HS7 A;  3F8C A;  2KJB A;  5CVR A;  1YO5 C;  3JAM Z;  2EV6 A;  3I58 A;  4HV6 A;  1K78 A;  4FT8 A;  1Z7U A;  1A04 A;  2K4J A;  2LSO A;  5DCM A;  3CTA A;  4EJO A;  3WTY C;  4HBL A;  1QGP A;  1F5T A;  1T98 A;  4AVP A;  1E2X A;  2HOE A;  2COM A;  3E6C C;  2V1X A;  4CXF A;  3V8L A;  1BI2 A;  1MJA A;  1QZY A;  3WTW C;  1PP7 U;  4GCV A;  4O5V A;  4HOB A;  4ZYE A;  3M8F A;  4AIJ A;  4UXN A;  1ZG5 A;  2FOK A;  2H09 A;  3DP7 A;  4LB6 B;  1FY7 A;  5HLH A;  1R36 A;  3V8K A;  1YG2 A;  3FXU A;  2Z99 A;  1TBX A;  4RAY A;  1STZ A;  4G94 A;  1HQC A;  5FO5 A;  4O6J A;  2XAG A;  2FE3 A;  3BZ6 A;  1D5V A;  2QQ9 A;  3U9G A;  1CF7 A;  3ZPL A;  5TJJ A;  1IW7 F;  1SMY F;  2DK8 A;  4ZYH A;  2OAZ A;  5CVV A;  1ZGA A;  3I59 A;  2VBZ A;  2G7H A;  2E7W A;  1QZZ A;  2D2W A;  3NRV A;  5KK1 A;  2BYV E;  1G3Y A;  3I64 A;  3IRQ A;  4M9Z A;  3F8M A;  3HSE A;  5AIP A;  2H27 A;  2GAU A;  1TQP A;  1S29 A;  4IF4 A;  3CUQ B;  4LG0 A;  3T0Y A;  3MAJ A;  1L0O C;  1MKM A;  1Z1D A;  4O3M A;  4OOI A;  5DV5 A;  4EM1 A;  5E8G A;  4KIB A;  1TW3 A;  1KU9 A;  5LRS A;  2NRA C;  5HVQ C;  2EK5 A;  1ZG3 A;  1B9M A;  4MGR A;  1F4K A;  1R1T A;  1MDM A;  3GZ5 A;  3CDH A;  3I71 A;  4Q5S F;  2L4A A;  4KNY A;  1RNL A;  2PMH A;  1FC3 A;  5EEG A;  1T6S A;  1ZAO A;  1UST A;  2PN6 A;  2QQA A;  3DV8 A;  3TOB A;  5D8K B;  1DP7 P;  1SD6 A;  1GHC A;  3KET A;  3LA2 A;  1G3T A;  2KIF A;  4A12 A;  1IAW A;  4HX4 A;  3BJA A;  5IT9 K;  4EJT A;  1O3R A;  2FBH A;  1J2X A;  2K02 A;  1U5T B;  2F5C A;  1FT9 A;  1FX7 A;  3P9C A;  3DKW A;  3RPQ A;  5K5Q A;  4RGU A;  1XGN A;  3W6J B;  1Z6R A;  1U6G A;  2Y75 A;  3F22 A;  2ZME A;  2V1D A;  2OA4 A;  2DTR A;  2V1U A;  4CO8 A;  5E8I A;  2JT1 A;  1KU3 A;  3OV8 A;  4S05 A;  5DCF A;  5F6F A;  2UWM A;  3FX3 A;  1GXP A;  5D8L B;  2H6B A;  2M30 A;  3DPT A;  1ZG1 A;  2EA4 A;  2Q8K A;  1YLF A;  5CJ9 A;  3CUQ C;  3GYH X;  1HW2 A;  4JK1 X;  1WKM A;  1W7P D;  2XKP A;  5ICC A;  4UV9 A;  5DEQ A;  3LA3 A;  3M9A A;  2G9W A;  1ONV A;  4LFU A;  5FFX A;  5DUK A;  3EYY A;  1F9N A;  2GIV A;  4ZYD A;  1XDU A;  3J80 Z;  1SFX A;  1TQM A;  2HFH A;  2WWY A;  5DUI A;  1UCR A;  4HX8 A;  1W7P B;  4P55 A;  4MTD A;  4KMU X;  2MD5 A;  2HDC A;  1YYV A;  2Z33 A;  3P7N A;  3E6M A;  1D8K A;  3BDD A;  2WTE A;  1LDK B;  4HA8 A;  3DFG A;  1DPR A;  1USS A;  4ON0 A;  4BHB A;  3GX4 X;  1LEA A;  2VN2 A;  1SFE A;  4UNO A;  5FLX Z;  2O61 A;  1FBU A;  1YFH A;  2H6C A;  2FBI A;  4N0B A;  2D1V A;  5D4R A;  2DBB A;  2XUB A;  2HKX A;  3QPH A;  2FNA A;  2CO5 A;  3N97 A;  1O7L A;  3HHG A;  3EYI A;  3HTU A;  3GFL A;  4PDK A;  4U88 A;  4IRH A;  4LK1 F;  2STT A;  4MQ9 F;  1R23 A;  2YPR A;  4UUV A;  2MBF A;  1PP8 F;  4Q48 A;  4NB5 A;  3GO5 A;  2CSO A;  4NQW A;  2ZXJ A;  3RKY A;  1LDD A;  4LLL A;  3EET A;  1R5G A;  1IN4 A;  1KGS A;  1K7A A;  1TNT A;  5ICE A;  2FBK A;  1DDN A;  5BPI A;  3LWF A;  3KZZ A;  3V8J A;  4HF0 A;  5ED4 A;  4LD5 A;  1AWC A;  5D5V B;  4A5M A;  1T38 A;  4AIH A;  3GWZ A;  3MWM A;  2RQP A;  2P4W A;  4XSX F;  3SZP A;  1O7F A;  1BI1 A;  5FGM A;  2E7X A;  5JFR A;  1XDS A;  2O0Y A;  3MZH A;  5BMZ A;  5HDK A;  4OIN F;  2VC0 A;  4RB2 C;  2A5Y B;  3O3K A;  4WK8 F;  3IHU A;  2CFX A;  4TV7 A;  5L3E A;  2J5P A;  5E1X A;  5LEK A;  2LF7 A;  1HW1 A;  3FXQ A;  2RNJ A;  3FM3 A;  4FX0 A;  2OU2 A;  1UHW A;  2EFQ A;  1YIO A;  3ZMT A;  2XAH A;  3ULQ B;  3KP3 A;  3WGH A;  2M5W A;  4Y15 A;  3C18 A;  1MJB A;  3I53 A;  3LST A;  3ZMD A;  4M6X A;  1J59 A;  2CQK A;  2R7F A;  1W4M A;  2NYX A;  1J9I A;  1K78 B;  2DU9 A;  1WRJ A;  3GVA A;  3QOP A;  4P9F A;  3SZT A;  3JAM K;  3G73 A;  3LA7 A;  1S6L A;  5E18 F;  4RB1 A;  5DCM B;  2QEN A;  2FA5 A;  2YX4 A;  3M8E A;  3WU1 B;  3J81 Z;  2ADU A;  3FHZ A;  4EGZ A;  1B9N A;  1ON1 A;  2RC4 A;  3DXJ F;  2GWR A;  1SD7 A;  3GZ6 A;  1S7O A;  4A0Y A;  4BYY A;  2QLZ A;  2ZNZ A;  2JPC A;  2PQ8 A;  5CVI A;  2GZW A;  2P7C B;  2D1H A;  4ENJ A;  4JQF A;  1IF1 A;  2IJL A;  2K27 A;  4BH9 A;  2KIU A;  4LMY A;  3KP5 A;  4WXD A;  3QU6 A;  2DQR A;  1OYW A;  4KUM A;  3LFK A;  4RB0 A;  4Q4Z F;  1Z6T A;  4EMS A;  2HYF A;  5BPD A;  3I59 B;  4U0W A;  1K6O A;  3CLO A;  1UFM A;  3T1B A;  2OQG A;  1KYW A;  2VON A;  2KKO A;  2OZU A;  5BQT A;  1PUE E;  1IRG A;  2Z5U A;  4N9H A;  5E20 A;  2P5L C;  1YTY A;  4IJA A;  2X4H A;  4LG0 B;  2MH2 A;  2NNN A;  3BP8 A;  3E97 A;  2ACJ A;  1XGO A;  1V4R A;  1HW5 A;  1R1U A;  2C6Y A;  3RKW A;  1IRF A;  1Z91 A;  3RJP A;  4I09 A;  4OIO F;  2RVC A;  3KE2 A;  4KIG A;  1GXQ A;  1ZAR A;  2DI3 A;  4EM2 A;  3WTS C;  1R00 A;  2XGX A;  4QWQ A;  3ZP5 A;  3KP6 A;  2F5E A;  1DUX C;  4AIK A;  1FBQ A;  2ISY A;  2XAQ A;  3DF8 A;  1J5Y A;  3IKV A;  2QUF A;  2B0L A;  3ZN0 A;  3HHH A;  3KZY A;  3R61 A;  1TLH B;  3HOS A;  2P6T A;  4YG2 F;  2EB7 A;  1I27 A;  1XD7 A;  5CLS A;  4DQ2 A;  2CGP A;  3KLN A;  2GQQ A;  1O57 A;  3RKX A;  4WCG A;  3C1D A;  3WOD F;  1T2K A;  4G6D A;  3FM5 A;  5CVJ A;  3IRR A;  4XSZ F;  2A3S A;  1B1B A;  4G8X A;  3EDP A;  4DNC A;  1ON2 A;  4IHS A;  1J75 A;  5FD5 A;  1SD5 A;  3GF2 A;  4MEX F;  2JZY A;  3LQR A;  3E5U A;  5HLG A;  3JTH A;  3WU0 A;  2ZME B;  3C7J A;  1K79 A;  2DK5 A;  2KIM A;  2A07 F;  2ZCW A;  4NHJ A;  1RI7 A;  2A68 F;  2VT3 A;  2A6E F;  1Y0U A;  3WTX C;  2R7D A;  3HRM A;  3ECO A;  2XAJ A;  3M1E A;  1B4A A;  4P9U A;  2IA0 A;  2XIG A;  1QBJ A;  2EFP A;  4OIR F;  4I98 B;  4KN4 X;  1GVJ A;  2ESH A;  4EVI A;  2ISZ A;  2PLY A;  2QZ8 A;  2QBY B;  4KIC A;  3GUD A;  2PEX A;  3NQO A;  3H92 A;  1MD0 A;  3M7G A;  4U7B A;  5D5U B;  1FWZ A;  4ESB A;  1ZRF A;  3J80 K;  5L3C A;  1XGM A;  3WTZ A;  1D8J A;  4UVA A;  1OMI A;  3VEP A;  5DDG A;  4L9N A;  5LHH A;  4WXC A;  4G9Y A;  2EA2 A;  4L0Y B;  5LEJ A;  1MJ9 A;  2PG4 A;  4AD9 A;  3V7C A;  5L3G A;  3IWZ A;  5J8F A;  1U78 A;  4HYE A;  2M45 A;  2D45 A;  4A0X A; 
#chains in the Genus database with same CATH topology
 1HST A;  2LY2 A;  1ZGJ A;  2IA1 A;  2F4I A;  1OCC H;  1WSU A;  5FLX K;  4NNJ A;  1FNN A;  3AG2 H;  2VB6 A;  1QU3 A;  1G8X A;  2JTV A;  3ISP A;  2IS1 A;  2JRT A;  3K1N A;  5KVR A;  4KIF A;  2XRL A;  3TDU C;  4C3H J;  1GT0 C;  5D4S A;  2IS4 A;  1IV8 A;  1LVA A;  3I9V 2;  2A5W A;  3ZRG A;  2PX9 A;  1G4D A;  5JLW A;  3A2K A;  2CG4 A;  1FPQ A;  2LBF B;  3KCC A;  3GEZ A;  2L7K A;  4BQO A;  2JA6 J;  4UV8 A;  2ZNY A;  2RGV A;  3X2Q H;  3K2Z A;  4HST A;  4KFC A;  5E79 C;  4XOT A;  1L3L A;  2R7W A;  3KEY A;  3KX2 A;  3HPG A;  2BY2 A;  4M9X A;  2XRO A;  1REP C;  4C30 A;  2TRT A;  2BE5 F;  3LAJ A;  2R5Z B;  2ZME C;  5E3L A;  2NOG A;  2HR3 A;  2IA2 A;  4X0G A;  1OIS A;  4NQW B;  5ICG A;  2WAQ A;  4KT6 A;  4HNT A;  2DPD A;  1MND A;  1RUO A;  2ZB9 A;  4GYG A;  3WHB A;  1E3H A;  1I1G A;  3K69 A;  4I6Z A;  4A3M J;  1HKQ A;  3QU3 A;  3ABL H;  3OR2 C;  2EQR A;  3C2G A;  4P5O A;  3QOD A;  4KN7 X;  2IRF G;  4CIC A;  3ZQ7 A;  3AFH A;  4XLP F;  3CF5 F;  1TW2 A;  2O3F A;  3E5Q A;  1JE8 A;  3F8B A;  4M73 A;  4V2G A;  2CW7 A;  1PVE A;  5JHF A;  3BWG A;  2OBP A;  2UZK A;  1HKT A;  1GDT A;  2VQL A;  5LHG A;  4A3L J;  2YS9 A;  3S2W A;  3JRH A;  2MFZ A;  4IQJ A;  4BJ6 C;  2NS7 A;  2W24 A;  3G2B A;  1OR7 A;  1X3U A;  1VZ0 A;  1Z05 A;  4UVC A;  1MGT A;  2PBI A;  2BVM A;  2ZXW H;  4BE1 A;  2JQ7 A;  3KP7 A;  3IH4 A;  3OR1 C;  2COB A;  2X85 A;  2AS5 F;  2GLO A;  2W25 A;  1PDN C;  4OIP F;  3ZN1 A;  4HF2 A;  2GBY A;  4HDU A;  1IGN A;  4J19 A;  3Q9S A;  2QQB A;  2R5Y B;  3PSI A;  2HZD A;  3DEU A;  4QSH A;  4OMY A;  5BOX A;  4A3B J;  3L2C A;  1YJN I;  1SFU A;  1N25 A;  2LKX A;  2CWE A;  1XSD A;  3HUG B;  6PAX A;  3TOA A;  4L18 B;  1WH5 A;  2V9K A;  1WWX A;  3S32 A;  5EZG A;  2BW3 A;  3S2H J;  3L2W A;  2MH9 A;  1UAA A;  1OPC A;  2X1D A;  4RAG A;  3ABK H;  2DT7 B;  3KYC B;  3ZR8 X;  1GVD A;  2YSR A;  4XLN F;  1ZN2 A;  1K6Y A;  2JJ7 A;  1HSJ A;  1ZRD A;  1OYY A;  2IBD A;  1RC9 A;  4ESF A;  5LGN A;  4HX7 A;  5B1A H;  3GTM J;  2M2E A;  2GA2 A;  2W4S A;  2W84 A;  4D5F A;  4LG3 A;  2DXI A;  1GV2 A;  5K1Y A;  3WTT C;  1ZKG A;  1LKX A;  3C2B A;  1DPU A;  2TDX A;  4XON A;  3V4G A;  3ZMV A;  5GTH C;  4OIQ F;  2JA7 J;  1IV6 A;  1QRY A;  2B63 J;  1YS6 A;  2DO7 A;  1BIA A;  1I6X A;  3W6K B;  1QHG A;  2IPQ X;  3E6B A;  1UG0 A;  1XCB A;  2M7B A;  1JJ8 C;  1FLI A;  1OJL A;  2UXN A;  2O03 A;  2ZXI A;  2YR2 A;  1W5T A;  3TW7 A;  4HLY A;  2P5V A;  2P8T A;  3U2R A;  1P4X A;  2ZJQ F;  2HOT A;  2CW0 F;  3ASO H;  1IXS B;  1ZRE A;  2CQ7 A;  2FX0 A;  1Y1V J;  1U5T A;  3PQK A;  3FK7 A;  1FBS A;  2MW8 A;  3V7S A;  4IRG A;  1FZP B;  3S2D J;  4I7H A;  3ASN H;  2KJC A;  2K85 A;  2R4G A;  1POG A;  3KEQ A;  4ITV A;  3CJT B;  4RM2 A;  1N78 A;  1S3J A;  1QZE A;  3I5U A;  2V6E A;  1ZR2 A;  4R79 A;  5EEH A;  1SAX A;  4EM0 B;  3J81 K;  1ORK A;  2IVM A;  1I39 A;  2EIM H;  1D5Y A;  3JSP A;  4E4H A;  2CUE A;  1P2F A;  2CUZ A;  3DBH B;  3WE2 A;  3MZ8 A;  1FIP A;  3DBL B;  5LGT A;  2GA1 A;  3GTK J;  1MNE A;  1TWG J;  2BOL A;  2X48 A;  1O3S A;  2EZH A;  3OIO A;  2Y9Y A;  3UR3 C;  2TCT A;  3T8T A;  2OV7 A;  5EZH A;  3FMR A;  4ZDP A;  2LFB A;  3NEU A;  2QF7 A;  1ETQ A;  2M7A A;  3NAU A;  3REO A;  4BL0 B;  3JRF A;  3E7L A;  3EQL F;  1W0T A;  2G7U A;  4BQQ A;  1KQ9 A;  4Y33 A;  1VND A;  2HQN A;  2L54 A;  5F1R A;  5AON A;  2XVC A;  4PJN A;  1Z0X A;  1JJ6 C;  4A69 C;  5EEA A;  2CW8 A;  1KQ0 A;  4M9S A;  4IRI A;  1ULY A;  4JOM A;  1SFO J;  4HF1 A;  4DBR A;  2XAS A;  4UVB A;  1QVT A;  5ERI A;  2FNP A;  4CHU A;  5H6R A;  3BY6 A;  3GTQ J;  1W5S A;  2K9Q A;  3CDI A;  4QLC U;  4H4K C;  4GGG A;  1XCV A;  1FP2 A;  4A2U A;  3SZG A;  3HSR A;  1D1C A;  4JYK A;  4N9I A;  1SAN A;  1X19 A;  1MMA A;  2EIN H;  3DPL C;  2L01 A;  4ETS A;  2ZJ2 A;  1CQT A;  1TT0 A;  1VTN C;  2JA5 J;  2WB1 N;  2EV5 A;  4ABZ A;  1LFB A;  1V5E A;  3DLL F;  2ECB A;  3CJR B;  4MNU A;  4KJZ A;  2MC4 A;  1BJA A;  2ETH A;  4MHG A;  4BEH A;  3HTS B;  3GCM A;  2KLO A;  2DOD A;  1SVO A;  1BM9 A;  4LGW A;  4BXU A;  2HS5 A;  2R7R A;  1TP4 A;  3JSO A;  1EH7 A;  4ZTJ A;  2LF8 A;  3K4L A;  5LLQ A;  2Z3Y A;  4RLQ A;  1LB2 A;  2STW A;  1VI0 A;  5M3M J;  5AIQ A;  2FML A;  3RSN A;  4LJZ F;  1ENH A;  3TO9 A;  4UUS A;  4IHT A;  1XMK A;  1OQY A;  1LQ1 A;  2XPU A;  3P9K A;  1AOY A;  2DQL A;  4WF2 A;  3GLX A;  2FOW A;  3MEX A;  2IS6 A;  1DQU A;  4ZTF A;  4YIF A;  5HS9 A;  2VLA A;  3S1R J;  1XG1 A;  1O3Q A;  3WG7 H;  2F4O B;  1F43 A;  1C0W A;  3S1M J;  1VF9 A;  3F6V A;  4J01 A;  4RM3 A;  1U2W A;  2M1B A;  2KDO A;  5F64 A;  4V19 K;  2RV8 A;  2LP0 A;  1JHH A;  4NC7 A;  4P96 A;  3D5L A;  1P4A A;  2CQX A;  4RGR A;  1ZLJ A;  2VJ5 A;  1ETK A;  1MBK A;  4K2E A;  3DBR B;  4XM3 A;  1ETY A;  1FSE A;  3G1L A;  4ZZD A;  4G7Z F;  3JR9 A;  1XGS A;  1MSF C;  3TO7 A;  5F0H A;  4BQA A;  3FWE A;  4G6T B;  4D0P A;  3C2H A;  5A2Q Z;  3K1P A;  3Q0U A;  1YJW I;  2VJ4 A;  4ESJ A;  4M74 A;  2O9L A;  5B3S H;  3ZQL A;  1WJE A;  3L1P A;  5EDN A;  2XGE A;  2Z1D A;  4MEY F;  1EH6 A;  1P7I A;  4YII A;  3SDB A;  3J7Z I;  3QOE A;  1ZLK A;  1X2N A;  1YW9 A;  1CF7 B;  3DCF A;  3AKZ A;  3VWB A;  2X1C A;  1Z3X A;  1I5Z A;  3A01 A;  4A5N A;  3GLL A;  2EZI A;  4B48 A;  1QO0 D;  2XDV A;  3MCZ A;  1QNT A;  2DAO A;  1RIO H;  2PMU A;  2X0L A;  2CYY A;  4YIR X;  4DW6 A;  3QYB A;  2NVQ J;  2E2J J;  2E1N A;  4B3A A;  1KA8 A;  1T39 A;  3IUO A;  3ZOB A;  5F08 A;  4Z6Y A;  2EIJ H;  4F55 A;  5KCM A;  2MYS A;  4CDG A;  4XRS A;  2VOO A;  2VOD A;  3HXL A;  3FBI B;  3FIW A;  4OAY A;  2V6C A;  5J4V A;  4PSX A;  3HPH A;  2BZT A;  3CMA I;  3T8R A;  5F0C A;  3RDI A;  2OCC H;  3EUK L;  4HZF A;  3BPX A;  3H1C A;  1YX5 A;  3DKY A;  5H20 A;  2KIS A;  3O8G A;  2EFW A;  2VBW A;  2MSY A;  2FEZ A;  2NOJ B;  3H3Z A;  2K3F A;  3KZI C;  1VQP I;  1S72 I;  3HOZ J;  2DCE A;  4KDP A;  5HOO A;  4FCY A;  2Z9O A;  2NVX J;  3J7A Y;  2BY1 A;  2W48 A;  3PNT A;  3OYC A;  4BQN A;  4BU2 A;  1R5I D;  2VPR A;  3E6D A;  1FP1 D;  4OMZ A;  4EJU A;  1ZR4 A;  3PJR A;  4FX4 A;  3MMY B;  2LLK A;  2HNH A;  1ODD A;  1F1Z A;  2HTS A;  2PMZ N;  3U21 A;  1JI8 A;  2JSC A;  5LFA A;  3DEW A;  4EJV A;  4HW0 A;  4CZZ A;  3ERM A;  1J0R A;  3ROU A;  1ERD A;  2E1O A;  2AXT C;  3VOD A;  3OMY A;  2QWW A;  4CSW A;  2FMY A;  3S15 J;  2R92 J;  1G3S A;  3SXY A;  2CV0 A;  2IEK A;  3KFW X;  2XSD C;  1YRN B;  5B1B H;  4WWC A;  3FZV A;  1MDM B;  2VE8 A;  3E5X A;  4EJW A;  4CYD A;  1R7J A;  5EYR A;  3I4N J;  2XPW A;  4UHT A;  3HJE A;  5HLI A;  1VQ6 I;  4IO9 F;  4HAM A;  2HEO A;  3DWL E;  2XPV A;  3H35 A;  3JCU C;  3LSP A;  1ZGW A;  1H9G A;  5CYV A;  2QM3 A;  3HRU A;  1Z21 A;  3E0J B;  3D0S A;  3F6O A;  2E36 A;  5LRR A;  4Y52 J;  1KQ8 A;  3JRD A;  2XAF A;  3BLY A;  2OC6 A;  4LOC A;  4I99 C;  3Q9V A;  1WHU A;  1H9T A;  1LEB A;  3ZQQ A;  4JBA A;  2HPM A;  3ZMZ A;  3K10 A;  4XLC A;  2L3D A;  4M71 A;  3R6S A;  3CO6 C;  3B6C A;  1XB4 A;  3KYD B;  3OIQ A;  3R4K A;  1R49 A;  2DA2 A;  5HDG A;  1R1V A;  5CPR B;  2ZFU A;  1X4P A;  1UMQ A;  2ESN A;  2VL8 A;  1SC7 A;  3L09 A;  2E1C A;  2JA8 J;  2XF5 A;  2M8E A;  4CCN A;  4YFN F;  5BNG A;  3RI4 A;  3GTO J;  5CVU A;  4DZP A;  4FE4 A;  1WQ2 A;  1S8N A;  1MSE C;  1D0X A;  4CH7 A;  2XGC A;  3TO6 A;  1UJ8 A;  3BQY A;  3HRT A;  4KT5 C;  5ILV A;  2IGM A;  3K4B A;  2FQ3 A;  2VAS A;  2W85 A;  1NTC A;  1G59 A;  2K9L A;  3BJ6 A;  5C44 J;  1U8R A;  2M9H A;  3NWS A;  3VYT B;  1YW7 A;  3HGG A;  4E70 A;  3QRF F;  5J3L A;  4PGG A;  5EGO A;  3PM1 A;  1KYZ A;  1D3Y A;  2KFD A;  1IUF A;  2DFI A;  5KAI C;  3FMQ A;  5FD6 A;  4DYQ A;  2BVL A;  3WTU C;  1MBG A;  5J6X A;  1JXS A;  5D6E A;  5C4X J;  3S14 J;  2N8G A;  1QQI A;  2VQC A;  3IAM 2;  4A6E A;  4M3E A;  1EH8 A;  3OOU A;  1ETV A;  3HB9 A;  4BY7 J;  3W2V A;  2O8X A;  3I54 A;  4IXA A;  3MFK A;  4LLN A;  3K4C A;  1R22 A;  2HVS A;  3I55 I;  4R8H A;  3NAR A;  2F6C A;  2RDP A;  5BS6 A;  1OCP A;  3RQI A;  4IPA A;  2DMQ A;  2EZK A;  2DMP A;  3BR1 A;  3I56 I;  4EGY A;  1YHQ I;  5LBQ A;  1TTY A;  2IP2 A;  3K4K A;  1BBY A;  1LJ9 A;  2GXA A;  1IN5 A;  2Q1Z B;  3VSL A;  3QP5 A;  2DW4 A;  4XN3 A;  3QQA A;  4RGX A;  5L3F A;  2QSH X;  1IRZ A;  1BC7 C;  2WA0 A;  2FRH A;  2XKO A;  2FSW A;  4V2F A;  5IOZ A;  2MA3 A;  3L9F A;  2E2H J;  2P0W A;  3LSJ A;  4QPQ A;  4GYI A;  1TWH J;  1RRJ A;  4ZH4 F;  3CLQ A;  2NS0 A;  4I02 A;  5ILS A;  1ZRC A;  3HOW J;  2V9V A;  1I1S A;  4XKW A;  4Y13 A;  1JUS A;  1UHM A;  2F5D A;  3GZN B;  2OF7 A;  3PNY A;  1X1B A;  5M5Y J;  1LVK A;  2DOF A;  3P9I A;  1KON A;  4L5J A;  2LKS A;  4E6K G;  3AAF A;  5GPA A;  3H9J A;  5TRD A;  1S9H A;  2PI0 A;  4BY1 J;  5ILU A;  4BHP A;  3R0A A;  3ECH A;  3IWF A;  4A0X A;  1HKS A;  4FHT A;  2A6T A;  4OU0 A;  1J7K A;  5ICF A;  2HOS A;  2W1O A;  1FOK A;  2KRH A;  3G1O A;  1X58 A;  1XMA A;  3M8J A;  3WU2 C;  2BXY A;  1R58 A;  1P4W A;  3L7W A;  2J5O A;  4WXH A;  1SAU A;  2EJR A;  2BW3 B;  2M8G X;  1S7E A;  2ZKZ A;  4U87 A;  5GP9 A;  3WTV C;  3CC2 I;  2K86 A;  4M6V A;  1A31 A;  2E60 A;  3HGY A;  1U9O A;  4LB5 A;  3F72 A;  3OL4 A;  2H8R A;  3K4M A;  1QVU A;  3I0T A;  3DTI A;  5K5O A;  1RUN A;  3WGI A;  5FKM A;  4L0Z B;  3HOU J;  4A0Z A;  2DFE A;  3HDD A;  1S7A A;  2KZV A;  2GXB A;  2K3P A;  2R7S A;  3MVP A;  2BXZ A;  2VT2 A;  2XV4 S;  2L9S A;  2YX7 A;  3BJO A;  2XF7 A;  1TQI A;  3BTJ A;  3K1M A;  3KEO A;  1OKR A;  2R7T A;  1HDD C;  2GIZ A;  3K70 D;  1H88 C;  3F8F A;  3QPT A;  4KA4 A;  2HZT A;  3FKJ A;  3SHF A;  4OWR B;  4PZJ A;  1SVL A;  2VBY A;  1FMW A;  4G6Q A;  5E3N A;  3L2R A;  3SJM A;  1B72 B;  1H0M A;  1IXR C;  4B09 A;  3ZMU A;  1WJA A;  2M87 A;  2MLK A;  4BHC A;  4KMF A;  1MBJ A;  4BNC A;  2XGD A;  4BAY A;  3PQJ A;  4G12 A;  4B4C A;  3KLO A;  1B8I B;  3OS1 A;  3M3Y J;  1P6R A;  4XLF A;  5JI6 A;  3F8N A;  3HKZ N;  4QIW N;  2K4B A;  3RYP A;  4D7M A;  1SFK A;  2F48 A;  2V79 A;  1X3W B;  5HS8 A;  4GRI A;  4BGD A;  1FMV A;  2P81 A;  1IN6 A;  4DZJ A;  1EJ9 A;  5HDN A;  2MLG A;  3SQN A;  1BC8 C;  2ZC2 A;  2IW5 A;  2VQG A;  3KYL A;  2JUG A;  5FKN A;  2WC2 A;  1MBF A;  4M6Y A;  4U7D A;  1AA7 A;  2VE9 A;  4G7O F;  1SMT A;  1G3W A;  3BG6 A;  3LSG A;  5JHU A;  3CUQ A;  3AL0 C;  2HQR A;  3T5X A;  3BC8 A;  3F23 A;  3DQV C;  2EIL H;  4KIT B;  1IDY A;  2Q2E A;  1ACI A;  1OR7 C;  1JGS A;  5GTI C;  2L5Q A;  1KU2 A;  2VOP A;  1G6N A;  5H6Q A;  2QBY A;  2DPU A;  5JVT A;  3R0J A;  3GW2 A;  2GOX B;  5D5X B;  4H0E A;  1V55 H;  5L3B A;  4ASN A;  4LK0 F;  1ZHF A;  4XK4 A;  2FF4 A;  3BPV A;  1FOY A;  3ZGK A;  4S04 A;  3GXO A;  1D0Y A;  4HG2 A;  5FLM J;  1MMN A;  4DBQ A;  2GXG A;  1YIJ I;  1W5C C;  2X6W A;  2L02 A;  4D5C A;  1TWF J;  2HWV A;  1Z9C A;  2KT0 A;  3TDZ C;  4IL6 C;  4WX9 A;  3CC4 I;  4N4O B;  5DD8 A;  2I5U A;  3H5N A;  4CYC B;  2L9N A;  1PUF B;  1FIA A;  3ABU A;  4JX5 A;  3OYE A;  3JW4 A;  5J8C A;  1HCR A;  5D5W B;  4ZC3 A;  1HBX G;  1FYL A;  4D1Q A;  1ETO A;  1BI3 A;  2O6G E;  3GFJ A;  4AWX B;  2Y30 A;  1BA5 A;  3ML6 A;  4I01 A;  1LE8 A;  2AXL A;  1WI9 A;  4CZC A;  4ZDO A;  4L9T A;  1JT6 A;  4L5I A;  1XN7 A;  3IH3 A;  1RKT A;  4E7Z A;  4XLE A;  2Y0S N;  2R3S A;  5IT9 Z;  2Y0M A;  3N4M A;  1R5H A;  3WGG A;  3BOQ A;  3BR5 A;  3FF5 A;  2ELH A;  3C3W A;  2LD5 A;  2I8D A;  3F21 A;  1JKO C;  1U3E M;  3HIF A;  4I0A A;  3ELK A;  3J7A O;  2PFB A;  3Q5F A;  1TC3 C;  2UXX A;  2QYO A;  3B6A A;  2IT0 A;  3G6E I;  3MQ0 A;  4RGS A;  2F4M B;  3B73 A;  5KAF C;  2HOA A;  2MC3 A;  3A4C A;  2HI3 A;  4HQE A;  1WZ2 A;  2JPB A;  1KU7 A;  2HYJ A;  4RB3 C;  5E1Z B;  4AVZ A;  3VFZ A;  3L00 A;  4FQG A;  2O7O A;  3BT9 A;  4LIT A;  4XIC A;  4ZZL A;  2VXZ A;  4A3K J;  1MMD A;  1LDJ A;  5LD2 C;  2F5V A;  4MLO A;  3PIO F;  1E17 A;  3U1K A;  4I76 A;  1LNW A;  2BBY A;  3F3X A;  5FFZ A;  1OCT C;  5K5R A;  2NXN B;  1U5T C;  3ABT A;  3BTL A;  3HBL A;  3IL2 A;  3K70 C;  4MQV A;  2B9S A;  2LH9 A;  2DA5 A;  2VC1 A;  3DKX A;  4A3F J;  3J7Y J;  4ZYA A;  2HGC A;  2O5R A;  3ZCO A;  2H94 A;  2Q0O A;  3ZQF A;  4OAZ A;  2L0K A;  4BBR J;  5LGU A;  3JRG A;  3O6B B;  2VPL A;  1IUY A;  1WI3 A;  1BI0 A;  2LDU A;  2RQQ A;  5E17 F;  1NHA A;  2V4J C;  3H9Q A;  3LQQ A;  2QVO A;  2CV1 A;  2QEX I;  5FB2 A;  3ZMS A;  1V3F A;  1MBE A;  2L4M A;  1VQ9 I;  1EV7 A;  1B6A A;  4HLX A;  5E1W A;  3ZQC A;  4RAZ A;  1VQK I;  2QCO A;  2ZBK A;  2DLL A;  2P7V B;  1O3T A;  1XX5 A;  3HC7 A;  2A61 A;  5IYB J;  5A2Q K;  1YJ9 I;  4Y4R A;  4J00 A;  4XRF A;  3S3M A;  2R7O A;  3O2P E;  2LRD A;  3K9T A;  4XBF A;  3CMY A;  2NVT J;  1UEL B;  5L3D A;  2X6X A;  1U0J A;  2M0M A;  2KDZ A;  2LY9 A;  4DYC A;  2X6Y A;  2ZO4 A;  1HF0 A;  1FEX A;  1XSX A;  2LTP A;  2OPT A;  2DT5 A;  3A01 B;  1FTT A;  2RKH A;  2ELJ A;  2A6H F;  3JTG A;  4RS8 A;  4B8X A;  3QAH A;  3PIP F;  3RIR A;  1LFP A;  3KP4 A;  2OQR A;  3RYR A;  2IGK A;  4GFB A;  2BEO A;  5K7Z A;  2ICW G;  4CCL A;  3OYA A;  3I4P A;  1VQO I;  1Y39 A;  2MGQ A;  3CF2 A;  3QPL A;  2K9M A;  4M72 A;  2XHK A;  2FU4 A;  1WFX A;  1NH3 A;  1BOA A;  1W7P A;  5IYD J;  1IXC A;  1BIB A;  3HOV J;  2FXA A;  3OOP A;  4ENM A;  3MD2 A;  2PJR B;  4IOA F;  3G3Z A;  3HRS A;  2R5Y A;  2EPF A;  5C3E J;  4A3G J;  2F5F A;  1NG7 A;  1Y1W J;  5GPC A;  1PYV A;  4ZDL A;  3IKT A;  3OYN A;  3LMM A;  5DYM A;  2LNB A;  5LHI A;  1CGP A;  1MZB A;  4ENK A;  3HUG A;  3HOT A;  3IAS 2;  4NC6 A;  4YFX F;  2NVY J;  3CME I;  3Q0V A;  3W2A A;  1QPM A;  2YUS A;  4XR6 A;  1APL C;  1DU0 A;  2LY1 A;  2WY8 Q;  3M4O J;  3HYI A;  1W36 D;  2XRN A;  3E3V A;  3D5S C;  2GOM A;  1IN8 A;  1HDP A;  4GO1 A;  3LAP A;  4HDV A;  3R60 A;  4LIV A;  4IZZ A;  4ZYG A;  4PJJ A;  5JR3 A;  4IVN A;  3L2U A;  1IN7 A;  2EFO A;  3RKQ A;  2GM4 A;  5J4Y A;  3WE3 A;  4A6D A;  3CO7 C;  1JKQ C;  4AID A;  2EV0 A;  3G71 I;  3A0H C;  2K40 A;  3A02 A;  3DTK A;  4N4N B;  5CKT A;  4PFP A;  2A05 A;  1HC8 A;  2L7F P;  2QGU A;  3HSF A;  4CCO A;  1I3Q J;  2BGC A;  5D6F A;  4G7H F;  2YU3 A;  1FYK A;  2LKP A;  4EQQ A;  3O8H A;  1P92 A;  5DM7 F;  2JWT A;  3BRO A;  2ID6 A;  4U0V A;  2V26 A;  1JKR C;  5F0F A;  4BJ5 C;  3TQN A;  4IHV A;  3A0B C;  2BV6 A;  3FMS A;  3ONQ A;  1BJZ A;  3CUO A;  4XRM A;  3MZY A;  4HQM A;  5F04 A;  2WV0 A;  2PJP A;  4E7J A;  3HOX J;  2WAQ N;  4RAF A;  3TP0 A;  5IT3 A;  4F7Z A;  4CGZ A;  2BY3 A;  4AYB A;  3COA C;  1YW8 A;  2EFN A;  2ELK A;  3K0L A;  4HV5 A;  4PGH A;  2KL4 A;  3EUH A;  3RPU A;  1JHF A;  2DA1 A;  3IC7 A;  3GFI A;  4KYW A;  2Y48 A;  2V9P A;  2O8K A;  5JLX A;  3HOY J;  2F2E A;  1YS7 A;  2W57 A;  1GLN A;  2IAI A;  4R1H A;  1XC5 A;  5EJC A;  3RQ4 A;  2ZFW A;  3EUH C;  1IZ1 A;  1OYI A;  1TNS A;  2EWN A;  3VOE A;  2WBM A;  4I2O A;  1K4S A;  2IS2 A;  4A3E J;  1HXD A;  3FK6 A;  1UB9 A;  2B7E A;  2P5K A;  2P6S A;  1ZH5 A;  5DD4 A;  2VJI A;  3CCJ I;  3CCL I;  1A6Q A;  4YFK F;  1RZ4 A;  5IP6 A;  4Y17 A;  1Z3Y A;  4PJM A;  5EGO B;  4PJL A;  5KNL A;  4L9V A;  4B44 A;  3VB2 A;  2DOE A;  1UZC A;  1WCM J;  1YQA A;  2RN7 A;  3H3U A;  1FYM A;  5FRM A;  1Q1H A;  3P5J A;  2L9V A;  1HLV A;  4XQF A;  2VBX A;  3FXR A;  4IHW A;  4C3J J;  1FSH A;  1DGW Y;  1WH7 A;  3OYG A;  1S5L C;  1XSV A;  4GXO A;  2OJE D;  3TKY A;  3PSF A;  4LLG F;  5M5X J;  2NAZ A;  3WG9 A;  2JK3 A;  3FBN B;  3PFI A;  2W7N A;  2DMT A;  4W97 A;  3GFM A;  4EV0 A;  1B59 A;  3G1M A;  4Z2Y A;  1ETX A;  1U8B A;  4PCQ A;  3U1D A;  2QSF X;  2JVG A;  2HKO A;  4Q47 A;  3ZQI A;  4U0Y A;  1WVR A;  2QA4 I;  2VJJ A;  2KRF A;  2NNY A;  2HTJ A;  2EBI A;  4FET A;  3QP6 A;  1BN5 A;  3KP2 A;  1IDZ A;  4MTE A;  2K7L A;  4PUS A;  4ENN A;  4BE0 A;  4B3X A;  1T0F A;  4E7L A;  1AKH A;  2IGN A;  2KHM A;  3SFZ A;  3B02 A;  2DJI A;  2OZ6 A;  1OFC X;  3LNQ A;  1JTX A;  2Z16 A;  4QTR A;  1TWC J;  2OD5 A;  1P9Q C;  4L9J A;  3DU6 A;  1SD4 A;  1Y56 A;  2ZSI B;  4X6A J;  1RR8 C;  2HYG D;  2M34 A;  4FTH A;  3OYB A;  2HDD A;  1ZYR F;  2QKM B;  2X1E A;  4EAT A;  2A69 F;  3RTR A;  3CJN A;  3TGN A;  3FHN A;  1O4X A;  2ECC A;  4AUX A;  3ERE D;  4I0B A;  5HS7 A;  1W36 C;  3F8C A;  3BG5 A;  2KJB A;  5CVR A;  1YO5 C;  3JAM Z;  1Z7L A;  2EV6 A;  2L7Z A;  3I58 A;  4HV6 A;  4QPO A;  1K78 A;  2LVS A;  1UHS A;  4FT8 A;  1Z7U A;  1KZH A;  3CC7 I;  3VYR B;  4HSR A;  1A04 A;  4L5E A;  5J1R A;  5HLT A;  2K4J A;  4Y7N J;  2LSO A;  5DCM A;  1R9T J;  3CTA A;  4EJO A;  3WTY C;  2WV1 A;  4CCK A;  3CJQ B;  4HBL A;  1QGP A;  5GAE J;  1T98 A;  4AVP A;  1F5T A;  1E2X A;  2BHY A;  4IEJ A;  2HOE A;  2COM A;  4ANJ A;  5M5W J;  3E6C C;  2V1X A;  2DTZ A;  4CXF A;  2Y69 H;  3V8L A;  2CH0 A;  1BI2 A;  1MJA A;  1QZY A;  3WTW C;  1PP7 U;  2HVR A;  1I6H J;  2DMU A;  3FIS A;  4IX7 A;  4GCV A;  4O5V A;  4HOB A;  4ZYE A;  3M8F A;  4AIJ A;  4UXN A;  5J40 A;  1ZG5 A;  4M3F A;  2FOK A;  2H09 A;  3DP7 A;  2LG4 A;  2KQR A;  4LB6 B;  1FY7 A;  5HLH A;  3S16 J;  1R36 A;  3FDY A;  3V8K A;  3LSH A;  1YG2 A;  2JMW A;  1XTA A;  3FXU A;  2Z99 A;  1TBX A;  2CUF A;  3FXL A;  2V1N A;  1STZ A;  3Q3S A;  4RAY A;  4G94 A;  2E34 A;  1HQC A;  5FO5 A;  3JRB A;  1JKP C;  4O6J A;  3ESW B;  2JN6 A;  2XAG A;  4MIM A;  2FE3 A;  1GV5 A;  3BZ6 A;  1D5V A;  3CCQ I;  2QQ9 A;  3U9G A;  2M4K A;  1CF7 A;  2G0E A;  3FXK A;  2DMN A;  1MW7 A;  3BZK A;  3N05 A;  3ZPL A;  5FLV A;  5TJJ A;  4BBS J;  1IW7 F;  2I10 A;  1SMY F;  2DK8 A;  2ME6 A;  3CCU I;  2KP6 A;  3LSI A;  1YE9 A;  3D1N I;  4ZYH A;  3CD6 I;  3OYI A;  2OAZ A;  5CVV A;  4BE2 A;  1ZGA A;  3I59 A;  2DFH A;  1MIJ A;  2VBZ A;  2G7H A;  2E7W A;  1QZZ A;  2D2W A;  3QPS A;  3NRV A;  5KK1 A;  2BYV E;  1G3Y A;  3I64 A;  3FKI J;  3IRQ A;  4M9Z A;  4XLA A;  3G4S I;  3F8M A;  3HSE A;  4EEF G;  4W1U A;  5AIP A;  3V42 A;  3IV5 A;  2H27 A;  3AL0 B;  2H1K A;  4NBQ A;  5F27 A;  1ZK8 A;  2GAU A;  1TQP A;  1S29 A;  3ABM H;  4IF4 A;  2Y2Z A;  3CUQ B;  4LG0 A;  3T0Y A;  3MAJ A;  1IJW C;  1BR1 A;  1L0O C;  1MKM A;  1Z1D A;  4O3M A;  4OOI A;  3CZ6 A;  5DV5 A;  1JUM A;  5E8G A;  4KIB A;  4EM1 A;  5FKK A;  1SEU A;  2XB0 X;  2HXO A;  4RLF A;  1TW3 A;  1KU9 A;  3H5A A;  5KHD A;  5LRS A;  3EUA A;  2NRA C;  5HVQ C;  2L9R A;  2EK5 A;  1ZG3 A;  1VQ8 I;  5DS9 A;  3VSK A;  1B9M A;  3I4M J;  4MGR A;  4DOZ A;  2IGO A;  1F4K A;  5EG0 A;  5E3O A;  1R1T A;  3AG4 H;  5F1J A;  3GZ5 A;  3CDH A;  1MDM A;  2XAU A;  3I71 A;  1Y8R B;  4Q5S F;  3CCM I;  2L4A A;  3OYL A;  4KNY A;  4XID A;  2XB5 A;  1RNL A;  3CCV I;  1DP3 A;  1G2H A;  1VQ5 I;  2PMH A;  2VQH A;  1FC3 A;  2E1M C;  5EEG A;  4PSW A;  1T6S A;  1ZAO A;  1UST A;  2L7M P;  2PN6 A;  2QQA A;  3PO2 J;  2CUJ A;  1MNM C;  2WB1 A;  1LE8 B;  1YX3 A;  3DV8 A;  3TOB A;  5D8K B;  1DP7 P;  1SD6 A;  1GHC A;  5IPA A;  3KET A;  3LA2 A;  1HOM A;  1G3T A;  2HQA A;  3CP2 A;  2KIF A;  1K4T A;  3MKW B;  4A12 A;  1XS9 A;  3SEZ A;  1IAW A;  4HX4 A;  3BJA A;  5IT9 K;  1RKW A;  2JUC A;  1D1B A;  3A03 A;  1O3R A;  4EJT A;  2FBH A;  4RBO A;  3OL3 A;  1U9N A;  2X6O A;  4MFD A;  1J2X A;  2MAB A;  2K02 A;  3M1C A;  3S3N A;  2IXS A;  3M07 A;  1U5T B;  3QYF A;  4BDY A;  2CJJ A;  5J1U A;  2F5C A;  3GTJ J;  1FOX A;  2LC2 A;  1IO2 A;  3W2W A;  1FT9 A;  3LSR A;  1FX7 A;  3P9C A;  3DKW A;  3RPQ A;  3RZD J;  5FRO A;  5K5Q A;  2R7Z J;  4RGU A;  3HG9 A;  4UB8 C;  1K83 J;  2KPM A;  1XGN A;  2DOA A;  3W6J B;  1Z6R A;  1U6G A;  2ID3 A;  3CCE I;  1IRX A;  1A5J A;  3BR0 A;  2Y75 A;  3F22 A;  2ZME A;  2V1D A;  2OA4 A;  2DTR A;  1MMG A;  2JA2 A;  2V1U A;  4CO8 A;  3EPZ A;  3TP3 A;  4BJT A;  5E8I A;  2JT1 A;  1KU3 A;  2DA3 A;  3OV8 A;  3PUB A;  4S05 A;  5DCF A;  2V7F A;  5F6F A;  4UUT A;  4NC8 A;  3W6V A;  2UWM A;  4NDL A;  2QSG X;  3FX3 A;  3E1S A;  1GXP A;  5D8L B;  2H6B A;  2M30 A;  3DPT A;  1X1P A;  2CFO A;  4DIQ A;  1ZG1 A;  2EA4 A;  3PL8 A;  3H9G A;  2Q8K A;  3CQZ J;  1YLF A;  2EIK H;  1A35 A;  4HPQ A;  3DU5 A;  5TIS C;  5CJ9 A;  3CUQ C;  3WHC A;  3GYH X;  1HW2 A;  4JK1 X;  1WKM A;  1ITY A;  3GBG A;  4JP0 A;  1W7P D;  2DA6 A;  2XKP A;  5ICC A;  4UV9 A;  5DEQ A;  5JVG F;  5M3F J;  1T08 B;  5HNF A;  1Q1V A;  1IC8 A;  3LA3 A;  3M9A A;  2G9W A;  1ONV A;  4LFU A;  5FFX A;  5IOY A;  5DUK A;  3EYY A;  2XC7 A;  1BW5 A;  1F9N A;  2GIV A;  2WAF A;  4C9Y A;  1X4O A;  2X9D A;  3S93 A;  1XDU A;  4ZYD A;  1SFX A;  1TQM A;  2VKD A;  3J80 Z;  2HFH A;  4BAC A;  2DDB A;  3BTC A;  1Y6I A;  2WWY A;  5DUI A;  4E7I A;  1UCR A;  1X1C A;  4UB6 C;  4HX8 A;  2M4G A;  1W7P B;  4DJA A;  1BR2 A;  4P55 A;  1V5G A;  4MTD A;  4KMU X;  2R7X A;  2LK2 A;  2MD5 A;  1E0E A;  2YU9 J;  3GTP J;  2HDC A;  4A3D J;  2E5N A;  3JRA A;  1YYV A;  2WAE A;  1YIT I;  2Z33 A;  5DM6 F;  3P7N A;  3FXJ A;  2VKE A;  4CCM A;  1H89 C;  4F3Q A;  3I3L A;  2R93 J;  3S1N J;  3E6M A;  1D8K A;  3MKL A;  4IHY A;  3BDD A;  4BEH B;  2WTE A;  1LDK B;  4HA8 A;  4XNF A;  1V54 H;  2Y31 A;  1BOB A;  3DFG A;  3LOC A;  4IQ4 A;  3CCY A;  2LRE A;  1DPR A;  4UY8 I;  4F93 B;  2VKH A;  1USS A;  4ON0 A;  1FTZ A;  3BQZ A;  4BHB A;  4B1R A;  3GX4 X;  1LEA A;  4RA2 A;  2AO9 A;  2VN2 A;  4PFO A;  1K61 A;  1SFE A;  2CU7 A;  4UNO A;  1T56 A;  3DEE A;  5FLX Z;  2O61 A;  1FBU A;  1YFH A;  1R4N B;  3L2Q A;  2OTJ I;  2H6C A;  4UUS B;  2FBI A;  2PMZ A;  4N0B A;  4DYR A;  3GTL J;  2D1V A;  1D0Z A;  3S3O A;  5D4R A;  5B5E C;  1VFC A;  2DBB A;  3KIO A;  3K7A J;  2XUB A;  2HKX A;  5FRN A;  3QPH A;  1LPQ A;  3MN2 A;  3K4J A;  2FNA A;  2CO5 A;  1IG7 A;  3RPU D;  3N97 A;  4KIS A;  1O7L A;  3HHG A;  3KPH A;  3EYI A;  1HA8 A;  2HPI A;  2LBF A;  2WY7 Q;  1PJR A;  3HTU A;  2D5V A;  2DT6 A;  3GFL A;  5FKO A;  4HNV A;  1OCO H;  2K9S A;  2NVU B;  1B72 A;  3QWL A;  4PDK A;  4IHX A;  1BW6 A;  4U88 A;  4CA0 A;  3PUF A;  3JRC A;  1V5F A;  5CQE A;  2ZJP F;  2K5C A;  4IRH A;  4LK1 F;  2STT A;  3CDL A;  2FUG 2;  4A3C J;  4MQ9 F;  1R23 A;  2YPR A;  2R5Z A;  3CES A;  4UUV A;  1B8I A;  2MBF A;  1Z67 A;  1PP8 F;  4Q48 A;  4NB5 A;  3GO5 A;  2CSO A;  2ZJR F;  4NQW A;  2ZXJ A;  3ZXS A;  3RKY A;  3UKG A;  2KIQ A;  2JSP A;  3OWT A;  1LDD A;  4LLL A;  3EET A;  1R5G A;  1IN4 A;  3F0C A;  1KGS A;  1K7A A;  1TNT A;  2EH3 A;  3OYD A;  4C2T A;  5ICE A;  1LUJ B;  2FBK A;  1DDN A;  1JTY A;  5BPI A;  3LWF A;  4C2U A;  4FE7 A;  1XMX A;  1VQL I;  3KZZ A;  2M0C A;  3Q0W A;  3V8J A;  2JVH A;  2CMP A;  2VKV A;  2MD0 A;  2K9N A;  4HF0 A;  5ED4 A;  4GDF A;  2DDA A;  1R4M B;  4LD5 A;  3BG7 A;  2Y9Z A;  1AWC A;  5D5V B;  2UUZ A;  4PK4 A;  1N77 A;  2LR8 A;  2DN0 A;  4A5M A;  3W3C A;  2R7Q A;  9ANT A;  3OYK A;  4AIH A;  1T38 A;  3F9K A;  3GWZ A;  1AU7 A;  3MWM A;  2RQP A;  1QPI A;  2P4W A;  4XSX F;  2CS3 A;  2ZXH A;  3OY9 A;  1FJL A;  3SZP A;  2E35 A;  1GUU A;  1O7F A;  1BI1 A;  1I3A A;  2X51 A;  4JX4 A;  5FGM A;  2E7X A;  5JFR A;  1XDS A;  3BG3 A;  2O0Y A;  3AG3 H;  1WJC A;  1WJD A;  3MZH A;  3ZQH A;  4X1E A;  5BMZ A;  1DGR M;  5HDK A;  4OIN F;  2VC0 A;  3OSG A;  5IYC J;  1OCZ H;  3GME A;  2A5Y B;  4RB2 C;  3BR2 A;  3O3K A;  1R6R A;  4WK8 F;  3IHU A;  4BKX A;  4F91 B;  5IP7 J;  2AQE A;  4CYC A;  2CFX A;  4TV7 A;  5L3E A;  1OCR H;  1PUF A;  1RET A;  2KMU A;  4XLH A;  1JUP A;  3LSK A;  2J5P A;  1J09 A;  5E1X A;  5LEK A;  2LF7 A;  3DPU A;  1WJB A;  3L2V A;  5IY5 H;  1HW1 A;  3FXQ A;  2RAE A;  2RNJ A;  4S0H B;  1AKH B;  4DGW B;  2WAD A;  3FM3 A;  4FX0 A;  1I50 J;  1JGG A;  2OU2 A;  1UHW A;  3OS0 A;  2EFQ A;  2E5Z A;  1WJF A;  1YIO A;  1H8A C;  4M3D A;  2HQ5 A;  2AQF A;  3BCA A;  2ZSH B;  3ZMT A;  2XAH A;  3ULQ B;  3KP3 A;  4C3I J;  3WGH A;  2M5W A;  4Y15 A;  3C18 A;  1MJB A;  3I53 A;  3H0G J;  3LST A;  3ZMD A;  4MO7 A;  3FXO A;  4M6X A;  1J59 A;  2CQK A;  3D5R C;  2R7F A;  1RPW A;  1W4M A;  2NYX A;  2CV2 A;  4HRI A;  4JX6 A;  1K78 B;  1J9I A;  2DU9 A;  1WRJ A;  3GVA A;  3QOP A;  4P9F A;  3SZT A;  3JAM K;  3G73 A;  1Z77 A;  3LA7 A;  3OIP A;  1S6L A;  5E18 F;  4RB1 A;  5DCM B;  2CRG A;  3DTE A;  2DYR H;  2QEN A;  2FA5 A;  2YX4 A;  5K7F A;  3M8E A;  3WU1 B;  2VI6 A;  3H5R A;  3J81 Z;  2E19 A;  3H0D A;  2ADU A;  3FHZ A;  1DU6 A;  2HXI A;  4EGZ A;  3MKY B;  1B9N A;  4NUB A;  3VDX A;  4E7S A;  3H3V K;  1ON1 A;  2RC4 A;  2OCE A;  2HDW A;  1EF4 A;  2KZG A;  3DXJ F;  2GWR A;  4XL9 A;  1T8I A;  1SD7 A;  3GZ6 A;  3HEF A;  1S7O A;  2RNG A;  2OUM A;  4A0Y A;  3SFI A;  4BYY A;  5FJ8 J;  2QLZ A;  2ZNZ A;  2JPC A;  2PQ8 A;  1TL8 A;  5CVI A;  1VQN I;  2GZW A;  2P7C B;  2D1H A;  4ENJ A;  4JQF A;  1IF1 A;  2LMD A;  2IJL A;  3FXM A;  2K27 A;  5DTD A;  5E3M A;  4BH9 A;  5TGT A;  3AG1 H;  5H2F C;  2KIU A;  4BXF A;  3OS2 A;  4RDU A;  4LMY A;  4BS9 A;  2R7U A;  2L2O A;  3KP5 A;  2W00 A;  4WXD A;  4Y3O A;  2XF6 A;  3LL7 A;  3QU6 A;  2OTL I;  2DQR A;  1OYW A;  2DFF A;  4KUM A;  2LOO A;  3LFK A;  4RB0 A;  4Q4Z F;  1Z6T A;  2H1L A;  4EMS A;  2HYF A;  5BPD A;  1A6I A;  3I59 B;  1M1E B;  1TZL A;  2FD5 A;  4U0W A;  1QA6 A;  3BR3 A;  3VYU B;  1WJ5 A;  1ZTR A;  4F52 A;  3CLO A;  1K6O A;  3DLA A;  1BR4 A;  1UFM A;  4YEL A;  2OQG A;  3T1B A;  1KYW A;  2VON A;  4B47 A;  1W0U A;  2KKO A;  2OZU A;  5BQT A;  1PUE E;  4RMN A;  3HM5 A;  1IRG A;  3HKZ A;  1SVM A;  2Z5U A;  2PJR A;  1Y8Q B;  1F36 A;  4N9H A;  1OLT A;  5E20 A;  2P5L C;  1YTY A;  4IJA A;  3JRE A;  2HVQ A;  4IOC F;  2X4H A;  1MMS A;  2E71 A;  4LG0 B;  3BZC A;  3H36 A;  2MH2 A;  3PO3 J;  2NNN A;  3BP8 A;  3E97 A;  1N75 A;  2ACJ A;  1T0F C;  1XGO A;  3BG9 A;  3S1Q J;  1V4R A;  3TL4 X;  1HW5 A;  1R1U A;  3NWT A;  4D7N A;  2C6Y A;  3SDG A;  3RKW A;  1MH4 A;  5C4J J;  1IRF A;  1Z91 A;  3RJP A;  4I09 A;  2BHZ A;  4YEJ A;  4XOP A;  2MG4 A;  4OIO F;  2RVC A;  3KE2 A;  1NK3 P;  4XN0 A;  4KIG A;  5EG0 B;  1ETW A;  2HU9 A;  1GXQ A;  1ZAR A;  2DI3 A;  1AHD P;  5GAG J;  2E1M B;  2W82 A;  2FQ4 A;  3BTI A;  4EM2 A;  4FAS D;  3WTS C;  1R00 A;  2XGX A;  3IP4 B;  4QWQ A;  3ZP5 A;  3KP6 A;  2F5E A;  1DUX C;  4AIK A;  4XKV A;  3OSF A;  3OYF A;  2KRC A;  3PFY A;  1FBQ A;  2ISY A;  4F92 B;  4II2 A;  1NG6 A;  2XAQ A;  3DF8 A;  1J5Y A;  3K4N A;  1VQ4 I;  1E3P A;  3IKV A;  2QUF A;  2DA4 A;  2M3A A;  4C2M J;  4A93 J;  5GAD J;  2B0L A;  3ZN0 A;  3HHH A;  4XOR A;  1LFU P;  3KZY A;  1TWA J;  3R61 A;  2RRE A;  1X3Z B;  1TLH B;  3HOS A;  2P6T A;  3JRI A;  1YI2 I;  4YG2 F;  2EB7 A;  1VQM I;  3K2A A;  1I27 A;  1XD7 A;  5CLS A;  4DQ2 A;  2CGP A;  4D9J A;  4HEA 2;  3KLN A;  2GQQ A;  1O57 A;  3K6G A;  3RKX A;  4WCG A;  2Y0S A;  4CCJ A;  3C1D A;  1X1A A;  1MBH A;  3WOD F;  4IKF A;  1T2K A;  3OYM A;  4G6D A;  3FM5 A;  5EF6 A;  5CVJ A;  3SYT A;  1R71 A;  3IRR A;  4XSZ F;  1TT5 B;  2A3S A;  1B1B A;  4G8X A;  5HNH A;  1FOW A;  4E7K A;  3EDP A;  3ZQG A;  4BDZ A;  3A1Y A;  4DNC A;  3TED A;  5J47 A;  3TBI A;  1ON2 A;  4IHS A;  1EKE A;  1J75 A;  3CP8 A;  5FD5 A;  1SD5 A;  3LSM A;  2E2I J;  3GF2 A;  3HL2 A;  4MFE A;  4MEX F;  3BCB A;  4LIU A;  2JZY A;  3LQR A;  3E5U A;  5HLG A;  2LYC A;  1QHH D;  1P7J A;  2UV1 A;  4PJ0 C;  3JTH A;  4XKC A;  3TMO A;  2H8W A;  4A3I J;  5HOD A;  3WU0 A;  2ZME B;  5IP9 J;  1ZEL A;  3PNV A;  4ZJZ A;  3OYH A;  3C7J A;  1K79 A;  2DK5 A;  3VYS B;  2KIM A;  4M3G A;  2A07 F;  2ZCW A;  4NHJ A;  1RI7 A;  2FJ1 A;  2DJN A;  2A68 F;  1BL0 A;  2VT3 A;  4XMY A;  3GTG J;  2CQQ A;  2A6E F;  1Y0U A;  3WTX C;  3LFU A;  4YRV A;  2VIX A;  2R7D A;  3HRM A;  3QYE A;  3S8P A;  3CMM A;  3ECO A;  5GAH J;  1ZQ3 P;  2XAJ A;  3M1E A;  1B4A A;  4CUG A;  2IA0 A;  4P9U A;  2BY0 A;  2XIG A;  1QBJ A;  5B66 C;  2EFP A;  4BUP A;  4OIR F;  2DA7 A;  1X1D A;  5CQG A;  4M3B A;  2VXD A;  4I98 B;  4KN4 X;  4P1W A;  3HZJ A;  2Q2E B;  1UG2 A;  1GVJ A;  2ESH A;  4EVI A;  3OYJ A;  5J1Y A;  4AU7 A;  1EA3 A;  2ISZ A;  3RZO J;  1Y0N A;  2PLY A;  2QZ8 A;  2R0Q C;  2QBY B;  1NK2 P;  2XSJ C;  1W1W E;  4KIC A;  4B43 A;  3CCR I;  3VPR A;  3GUD A;  2PEX A;  2QQ8 A;  1VQ7 I;  3S17 J;  3NQO A;  3H92 A;  5FKL A;  1MD0 A;  1MH3 A;  2NS8 A;  1YRN A;  2R7V A;  3M7G A;  1XPX A;  4FIS A;  1RR7 A;  4II3 A;  2ME0 A;  2CQN A;  4U7B A;  5D5U B;  4BXX J;  1FWZ A;  4ESB A;  3SEQ A;  1ZRF A;  3J80 K;  5L3C A;  1XGM A;  3RCO A;  3WTZ A;  4XRS G;  1T95 A;  1D8J A;  4UVA A;  1OMI A;  3VEP A;  4XKB A;  4AC0 A;  2QKL B;  5DDG A;  4A3J J;  2VUM J;  2DYS H;  1A36 A;  4L9N A;  4AYB N;  5LHH A;  1D1A A;  4WXC A;  4G9Y A;  1E3O C;  1X2M A;  2EA2 A;  4L0Y B;  5LEJ A;  1MJ9 A;  5K7H A;  1WGX A;  1JT0 A;  2PG4 A;  4AD9 A;  3V7C A;  5L3G A;  4E7H A;  3BR6 A;  3UNG C;  1YOV B;  2JRM A;  2EZL A;  1WPK A;  3IWZ A;  5J8F A;  1U78 A;  4HYE A;  2AHQ A;  3TW6 A;  3MKZ A;  4HNU A;  1RES A;  2Z2S B;  3CCS I;  1T33 A;  2M45 A;  3IH2 A;  2D45 A;  3V7R A;  4AM3 A; 
#chains in the Genus database with same CATH homology
 1HST A;  1ZGJ A;  2IA1 A;  5FLX K;  1WSU A;  1FNN A;  2JTV A;  3ISP A;  2JRT A;  3K1N A;  5KVR A;  4KIF A;  3TDU C;  5D4S A;  1LVA A;  1G4D A;  2CG4 A;  1FPQ A;  3KCC A;  3GEZ A;  4UV8 A;  2ZNY A;  2RGV A;  3K2Z A;  4KFC A;  1L3L A;  4M9X A;  2XRO A;  1REP C;  2BE5 F;  3LAJ A;  2HR3 A;  2IA2 A;  5ICG A;  2DPD A;  1RUO A;  4GYG A;  1I1G A;  3K69 A;  1HKQ A;  3QU3 A;  4P5O A;  4KN7 X;  2IRF G;  4CIC A;  3ZQ7 A;  4XLP F;  1TW2 A;  2O3F A;  3E5Q A;  1JE8 A;  3F8B A;  4M73 A;  3BWG A;  2OBP A;  2UZK A;  1HKT A;  5LHG A;  3S2W A;  2W24 A;  1OR7 A;  1X3U A;  1Z05 A;  4UVC A;  1MGT A;  2PBI A;  3KP7 A;  2AS5 F;  2W25 A;  1PDN C;  4OIP F;  3ZN1 A;  4HF2 A;  4HDU A;  3Q9S A;  2QQB A;  3DEU A;  4OMY A;  5BOX A;  3L2C A;  1SFU A;  2CWE A;  1XSD A;  6PAX A;  3TOA A;  4L18 B;  1WWX A;  2MH9 A;  1OPC A;  2YSR A;  4XLN F;  1ZN2 A;  1ZRD A;  1HSJ A;  1OYY A;  4ESF A;  5LGN A;  4HX7 A;  2GA2 A;  2W84 A;  5K1Y A;  3WTT C;  1DPU A;  2TDX A;  4OIQ F;  3V4G A;  3ZMV A;  1YS6 A;  2DO7 A;  1BIA A;  1I6X A;  3W6K B;  2IPQ X;  3E6B A;  1XCB A;  1FLI A;  2UXN A;  2O03 A;  2YR2 A;  1W5T A;  4HLY A;  2P5V A;  2P8T A;  3U2R A;  1P4X A;  2CW0 F;  1IXS B;  1ZRE A;  1U5T A;  3PQK A;  1FBS A;  3V7S A;  4IRG A;  1FZP B;  4I7H A;  2KJC A;  3KEQ A;  1S3J A;  3I5U A;  4R79 A;  5EEH A;  1SAX A;  4EM0 B;  3J81 K;  2IVM A;  3JSP A;  1P2F A;  3WE2 A;  5LGT A;  2GA1 A;  1O3S A;  3T8T A;  3FMR A;  3NEU A;  3REO A;  3EQL F;  2G7U A;  1KQ9 A;  2HQN A;  2L54 A;  5F1R A;  5AON A;  2XVC A;  4IRI A;  1KQ0 A;  4M9S A;  1ULY A;  4HF1 A;  2XAS A;  4UVB A;  5ERI A;  2FNP A;  4CHU A;  5H6R A;  3BY6 A;  1W5S A;  4QLC U;  4GGG A;  1XCV A;  1FP2 A;  4A2U A;  3HSR A;  4N9I A;  3DPL C;  2L01 A;  4ETS A;  2ZJ2 A;  1VTN C;  2EV5 A;  4MNU A;  1BJA A;  2ETH A;  4MHG A;  3HTS B;  1BM9 A;  4LGW A;  4BXU A;  2HS5 A;  3JSO A;  1EH7 A;  2LF8 A;  5LLQ A;  2Z3Y A;  1LB2 A;  2STW A;  5AIQ A;  2FML A;  4LJZ F;  3TO9 A;  4IHT A;  1XMK A;  1LQ1 A;  3P9K A;  1AOY A;  2DQL A;  4WF2 A;  3GLX A;  3MEX A;  4YIF A;  5HS9 A;  1O3Q A;  1C0W A;  3F6V A;  1U2W A;  2M1B A;  5F64 A;  2RV8 A;  1JHH A;  4P96 A;  3D5L A;  1P4A A;  4RGR A;  1ZLJ A;  4ZZD A;  4K2E A;  1FSE A;  4G7Z F;  1XGS A;  3TO7 A;  4BQA A;  3FWE A;  4D0P A;  5A2Q Z;  3K1P A;  4ESJ A;  4M74 A;  4MEY F;  1EH6 A;  4YII A;  1ZLK A;  1YW9 A;  1CF7 B;  1I5Z A;  4A5N A;  1QO0 D;  3MCZ A;  1QNT A;  2DAO A;  1RIO H;  2PMU A;  2X0L A;  2CYY A;  2E1N A;  1KA8 A;  1T39 A;  2VOD A;  4CDG A;  2VOO A;  2V6C A;  3T8R A;  3RDI A;  4HZF A;  3BPX A;  5H20 A;  2EFW A;  2VBW A;  2FEZ A;  3H3Z A;  4KDP A;  5HOO A;  2Z9O A;  3E6D A;  1FP1 D;  4OMZ A;  4EJU A;  4FX4 A;  1ODD A;  1F1Z A;  2HTS A;  2JSC A;  4EJV A;  4HW0 A;  4CZZ A;  1J0R A;  3ROU A;  3VOD A;  2QWW A;  2FMY A;  1G3S A;  3SXY A;  3KFW X;  4WWC A;  3FZV A;  1MDM B;  2VE8 A;  3E5X A;  4EJW A;  4CYD A;  1R7J A;  4UHT A;  5HLI A;  4HAM A;  2HEO A;  1H9G A;  5CYV A;  2QM3 A;  3HRU A;  3D0S A;  3F6O A;  5LRR A;  1KQ8 A;  2XAF A;  3Q9V A;  1H9T A;  1LEB A;  4JBA A;  3ZMZ A;  2L3D A;  3R6S A;  4M71 A;  3CO6 C;  1XB4 A;  3R4K A;  5HDG A;  1R1V A;  2ESN A;  2E1C A;  3L09 A;  2M8E A;  4YFN F;  3RI4 A;  5CVU A;  1WQ2 A;  1S8N A;  3TO6 A;  3HRT A;  4KT5 C;  5ILV A;  2FQ3 A;  2W85 A;  3BJ6 A;  1U8R A;  1YW7 A;  4E70 A;  3QRF F;  4PGG A;  1KYZ A;  1D3Y A;  5FD6 A;  2DFI A;  3FMQ A;  3WTU C;  5J6X A;  1JXS A;  5D6E A;  1QQI A;  4A6E A;  1EH8 A;  2O8X A;  3I54 A;  4IXA A;  3MFK A;  4LLN A;  1R22 A;  4R8H A;  2RDP A;  5BS6 A;  4IPA A;  4EGY A;  5LBQ A;  1TTY A;  2IP2 A;  1BBY A;  1LJ9 A;  1IN5 A;  3QP5 A;  2DW4 A;  4RGX A;  5L3F A;  1BC7 C;  2XKO A;  2FRH A;  2FSW A;  2MA3 A;  3L9F A;  4GYI A;  4ZH4 F;  2NS0 A;  4I02 A;  5ILS A;  1ZRC A;  2V9V A;  1I1S A;  4Y13 A;  1UHM A;  2F5D A;  3P9I A;  4L5J A;  3AAF A;  5TRD A;  2PI0 A;  5ILU A;  4BHP A;  3R0A A;  3ECH A;  3IWF A;  1HKS A;  4FHT A;  4OU0 A;  1J7K A;  5ICF A;  1FOK A;  1XMA A;  1R58 A;  1P4W A;  3L7W A;  2J5O A;  4WXH A;  2EJR A;  2ZKZ A;  3WTV C;  2K86 A;  4LB5 A;  3F72 A;  3I0T A;  5K5O A;  1RUN A;  3WGI A;  4L0Z B;  4A0Z A;  1S7A A;  2GXB A;  2VT2 A;  2XV4 S;  2YX7 A;  3BJO A;  1TQI A;  3K1M A;  3KEO A;  1OKR A;  3F8F A;  3QPT A;  4KA4 A;  2HZT A;  3SHF A;  4PZJ A;  2VBY A;  4G6Q A;  1H0M A;  1IXR C;  4B09 A;  3ZMU A;  2M87 A;  2MLK A;  4BHC A;  4KMF A;  4BNC A;  4BAY A;  3PQJ A;  3KLO A;  1P6R A;  5JI6 A;  3F8N A;  2K4B A;  3RYP A;  2V79 A;  5HS8 A;  1IN6 A;  5HDN A;  2MLG A;  3SQN A;  1BC8 C;  2IW5 A;  2WC2 A;  4M6Y A;  4U7D A;  2VE9 A;  4G7O F;  1SMT A;  1G3W A;  5JHU A;  3CUQ A;  2HQR A;  3T5X A;  3F23 A;  3DQV C;  3V7R A;  2Q2E A;  1JGS A;  2VOP A;  1KU2 A;  1G6N A;  5H6Q A;  2QBY A;  2DPU A;  5JVT A;  3R0J A;  3GW2 A;  5D5X B;  4H0E A;  5L3B A;  4ASN A;  4LK0 F;  1ZHF A;  2FF4 A;  3BPV A;  4S04 A;  3GXO A;  2GXG A;  2L02 A;  1Z9C A;  2HWV A;  3TDZ C;  4WX9 A;  5DD8 A;  3ABU A;  3JW4 A;  5J8C A;  5D5W B;  1HBX G;  1FYL A;  1BI3 A;  2O6G E;  3GFJ A;  4AWX B;  3ML6 A;  4I01 A;  2AXL A;  1WI9 A;  4L9T A;  4L5I A;  1XN7 A;  2R3S A;  5IT9 Z;  2Y0M A;  3N4M A;  1R5H A;  3WGG A;  3BOQ A;  3FF5 A;  2ELH A;  3C3W A;  3F21 A;  1U3E M;  3HIF A;  4I0A A;  3ELK A;  3J7A O;  2PFB A;  3Q5F A;  2UXX A;  2QYO A;  2IT0 A;  3MQ0 A;  4RGS A;  3B73 A;  2MC3 A;  4HQE A;  2JPB A;  1KU7 A;  4RB3 C;  5E1Z B;  3VFZ A;  3L00 A;  4ZZL A;  2VXZ A;  1LDJ A;  1E17 A;  1LNW A;  2BBY A;  3F3X A;  5FFZ A;  5K5R A;  1U5T C;  3ABT A;  3IL2 A;  4MQV A;  2VC1 A;  2HGC A;  2H94 A;  2Q0O A;  5LGU A;  3O6B B;  1IUY A;  2LDU A;  1BI0 A;  5E17 F;  1NHA A;  3LQQ A;  2QVO A;  5FB2 A;  3ZMS A;  1V3F A;  2L4M A;  1EV7 A;  1B6A A;  4HLX A;  5E1W A;  4RAZ A;  2ZBK A;  2DLL A;  2P7V B;  1O3T A;  2A61 A;  5A2Q K;  4XRF A;  3O2P E;  3K9T A;  4XBF A;  5L3D A;  2ZO4 A;  1XSX A;  2DT5 A;  2RKH A;  3JTG A;  2A6H F;  4RS8 A;  4B8X A;  3QAH A;  3RIR A;  3KP4 A;  2OQR A;  3RYR A;  2BEO A;  3I4P A;  4M72 A;  2XHK A;  2FU4 A;  1BOA A;  1W7P A;  1IXC A;  1BIB A;  2FXA A;  3OOP A;  4ENM A;  3G3Z A;  3HRS A;  2F5F A;  3IKT A;  5DYM A;  2LNB A;  5LHI A;  1CGP A;  1MZB A;  4ENK A;  3HUG A;  3HOT A;  4YFX F;  1QPM A;  3HYI A;  2XRN A;  3E3V A;  1IN8 A;  4GO1 A;  3LAP A;  4HDV A;  3R60 A;  4ZYG A;  5JR3 A;  4IVN A;  1IN7 A;  2EFO A;  3WE3 A;  4A6D A;  3CO7 C;  2EV0 A;  3HSF A;  2BGC A;  5D6F A;  4G7H F;  2YU3 A;  1FYK A;  2LKP A;  4EQQ A;  1P92 A;  3BRO A;  4U0V A;  3TQN A;  2BV6 A;  3FMS A;  3CUO A;  3MZY A;  4HQM A;  2WV0 A;  2PJP A;  5IT3 A;  4F7Z A;  4CGZ A;  3COA C;  1YW8 A;  2EFN A;  3K0L A;  4HV5 A;  4PGH A;  3EUH A;  3RPU A;  1JHF A;  3IC7 A;  3GFI A;  4KYW A;  2Y48 A;  2F2E A;  1YS7 A;  2W57 A;  4R1H A;  2ZFW A;  1IZ1 A;  1OYI A;  1TNS A;  2EWN A;  3VOE A;  4I2O A;  1HXD A;  1UB9 A;  2P5K A;  2P6S A;  1ZH5 A;  5DD4 A;  4YFK F;  1RZ4 A;  4Y17 A;  4L9V A;  3VB2 A;  1YQA A;  2RN7 A;  3H3U A;  1FYM A;  1Q1H A;  2VBX A;  3FXR A;  1FSH A;  1XSV A;  4GXO A;  3TKY A;  4LLG F;  2NAZ A;  3WG9 A;  3PFI A;  3GFM A;  4EV0 A;  1B59 A;  4Z2Y A;  4PCQ A;  3U1D A;  2HKO A;  4Q47 A;  4U0Y A;  2KRF A;  2NNY A;  2HTJ A;  3QP6 A;  1BN5 A;  3KP2 A;  4MTE A;  2K7L A;  4ENN A;  1T0F A;  3SFZ A;  3B02 A;  2OZ6 A;  2OD5 A;  4L9J A;  1SD4 A;  2HYG D;  1ZYR F;  2A69 F;  3RTR A;  3CJN A;  3TGN A;  3ERE D;  4I0B A;  5HS7 A;  3F8C A;  2KJB A;  5CVR A;  1YO5 C;  3JAM Z;  2EV6 A;  3I58 A;  4HV6 A;  1K78 A;  4FT8 A;  1Z7U A;  1A04 A;  2K4J A;  2LSO A;  5DCM A;  3CTA A;  4EJO A;  3WTY C;  4HBL A;  1QGP A;  1F5T A;  1T98 A;  4AVP A;  1E2X A;  2HOE A;  2COM A;  3E6C C;  2V1X A;  4CXF A;  3V8L A;  1BI2 A;  1MJA A;  1QZY A;  3WTW C;  1PP7 U;  4GCV A;  4O5V A;  4HOB A;  4ZYE A;  3M8F A;  4AIJ A;  4UXN A;  1ZG5 A;  2FOK A;  2H09 A;  3DP7 A;  4LB6 B;  1FY7 A;  5HLH A;  1R36 A;  3V8K A;  1YG2 A;  3FXU A;  2Z99 A;  1TBX A;  4RAY A;  1STZ A;  4G94 A;  1HQC A;  5FO5 A;  4O6J A;  2XAG A;  2FE3 A;  3BZ6 A;  1D5V A;  2QQ9 A;  3U9G A;  1CF7 A;  3ZPL A;  5TJJ A;  1IW7 F;  1SMY F;  2DK8 A;  4ZYH A;  2OAZ A;  5CVV A;  1ZGA A;  3I59 A;  2VBZ A;  2G7H A;  2E7W A;  1QZZ A;  2D2W A;  3NRV A;  5KK1 A;  2BYV E;  1G3Y A;  3I64 A;  3IRQ A;  4M9Z A;  3F8M A;  3HSE A;  5AIP A;  2H27 A;  2GAU A;  1TQP A;  1S29 A;  4IF4 A;  3CUQ B;  4LG0 A;  3T0Y A;  3MAJ A;  1L0O C;  1MKM A;  1Z1D A;  4O3M A;  4OOI A;  5DV5 A;  4EM1 A;  5E8G A;  4KIB A;  1TW3 A;  1KU9 A;  5LRS A;  2NRA C;  5HVQ C;  2EK5 A;  1ZG3 A;  1B9M A;  4MGR A;  1F4K A;  1R1T A;  1MDM A;  3GZ5 A;  3CDH A;  3I71 A;  4Q5S F;  2L4A A;  4KNY A;  1RNL A;  2PMH A;  1FC3 A;  5EEG A;  1T6S A;  1ZAO A;  1UST A;  2PN6 A;  2QQA A;  3DV8 A;  3TOB A;  5D8K B;  1DP7 P;  1SD6 A;  1GHC A;  3KET A;  3LA2 A;  1G3T A;  2KIF A;  4A12 A;  1IAW A;  4HX4 A;  3BJA A;  5IT9 K;  4EJT A;  1O3R A;  2FBH A;  1J2X A;  2K02 A;  1U5T B;  2F5C A;  1FT9 A;  1FX7 A;  3P9C A;  3DKW A;  3RPQ A;  5K5Q A;  4RGU A;  1XGN A;  3W6J B;  1Z6R A;  1U6G A;  2Y75 A;  3F22 A;  2ZME A;  2V1D A;  2OA4 A;  2DTR A;  2V1U A;  4CO8 A;  5E8I A;  2JT1 A;  1KU3 A;  3OV8 A;  4S05 A;  5DCF A;  5F6F A;  2UWM A;  3FX3 A;  1GXP A;  5D8L B;  2H6B A;  2M30 A;  3DPT A;  1ZG1 A;  2EA4 A;  2Q8K A;  1YLF A;  5CJ9 A;  3CUQ C;  3GYH X;  1HW2 A;  4JK1 X;  1WKM A;  1W7P D;  2XKP A;  5ICC A;  4UV9 A;  5DEQ A;  3LA3 A;  3M9A A;  2G9W A;  1ONV A;  4LFU A;  5FFX A;  5DUK A;  3EYY A;  1F9N A;  2GIV A;  4ZYD A;  1XDU A;  3J80 Z;  1SFX A;  1TQM A;  2HFH A;  2WWY A;  5DUI A;  1UCR A;  4HX8 A;  1W7P B;  4P55 A;  4MTD A;  4KMU X;  2MD5 A;  2HDC A;  1YYV A;  2Z33 A;  3P7N A;  3E6M A;  1D8K A;  3BDD A;  2WTE A;  1LDK B;  4HA8 A;  3DFG A;  1DPR A;  1USS A;  4ON0 A;  4BHB A;  3GX4 X;  1LEA A;  2VN2 A;  1SFE A;  4UNO A;  5FLX Z;  2O61 A;  1FBU A;  1YFH A;  2H6C A;  2FBI A;  4N0B A;  2D1V A;  5D4R A;  2DBB A;  2XUB A;  2HKX A;  3QPH A;  2FNA A;  2CO5 A;  3N97 A;  1O7L A;  3HHG A;  3EYI A;  3HTU A;  3GFL A;  4PDK A;  4U88 A;  4IRH A;  4LK1 F;  2STT A;  4MQ9 F;  1R23 A;  2YPR A;  4UUV A;  2MBF A;  1PP8 F;  4Q48 A;  4NB5 A;  3GO5 A;  2CSO A;  4NQW A;  2ZXJ A;  3RKY A;  1LDD A;  4LLL A;  3EET A;  1R5G A;  1IN4 A;  1KGS A;  1K7A A;  1TNT A;  5ICE A;  2FBK A;  1DDN A;  5BPI A;  3LWF A;  3KZZ A;  3V8J A;  4HF0 A;  5ED4 A;  4LD5 A;  1AWC A;  5D5V B;  4A5M A;  1T38 A;  4AIH A;  3GWZ A;  3MWM A;  2RQP A;  2P4W A;  4XSX F;  3SZP A;  1O7F A;  1BI1 A;  5FGM A;  2E7X A;  5JFR A;  1XDS A;  2O0Y A;  3MZH A;  5BMZ A;  5HDK A;  4OIN F;  2VC0 A;  4RB2 C;  2A5Y B;  3O3K A;  4WK8 F;  3IHU A;  2CFX A;  4TV7 A;  5L3E A;  2J5P A;  5E1X A;  5LEK A;  2LF7 A;  1HW1 A;  3FXQ A;  2RNJ A;  3FM3 A;  4FX0 A;  2OU2 A;  1UHW A;  2EFQ A;  1YIO A;  3ZMT A;  2XAH A;  3ULQ B;  3KP3 A;  3WGH A;  2M5W A;  4Y15 A;  3C18 A;  1MJB A;  3I53 A;  3LST A;  3ZMD A;  4M6X A;  1J59 A;  2CQK A;  2R7F A;  1W4M A;  2NYX A;  1J9I A;  1K78 B;  2DU9 A;  1WRJ A;  3GVA A;  3QOP A;  4P9F A;  3SZT A;  3JAM K;  3G73 A;  3LA7 A;  1S6L A;  5E18 F;  4RB1 A;  5DCM B;  2QEN A;  2FA5 A;  2YX4 A;  3M8E A;  3WU1 B;  3J81 Z;  2ADU A;  3FHZ A;  4EGZ A;  1B9N A;  1ON1 A;  2RC4 A;  3DXJ F;  2GWR A;  1SD7 A;  3GZ6 A;  1S7O A;  4A0Y A;  4BYY A;  2QLZ A;  2ZNZ A;  2JPC A;  2PQ8 A;  5CVI A;  2GZW A;  2P7C B;  2D1H A;  4ENJ A;  4JQF A;  1IF1 A;  2IJL A;  2K27 A;  4BH9 A;  2KIU A;  4LMY A;  3KP5 A;  4WXD A;  3QU6 A;  2DQR A;  1OYW A;  4KUM A;  3LFK A;  4RB0 A;  4Q4Z F;  1Z6T A;  4EMS A;  2HYF A;  5BPD A;  3I59 B;  4U0W A;  1K6O A;  3CLO A;  1UFM A;  3T1B A;  2OQG A;  1KYW A;  2VON A;  2KKO A;  2OZU A;  5BQT A;  1PUE E;  1IRG A;  2Z5U A;  4N9H A;  5E20 A;  2P5L C;  1YTY A;  4IJA A;  2X4H A;  4LG0 B;  2MH2 A;  2NNN A;  3BP8 A;  3E97 A;  2ACJ A;  1XGO A;  1V4R A;  1HW5 A;  1R1U A;  2C6Y A;  3RKW A;  1IRF A;  1Z91 A;  3RJP A;  4I09 A;  4OIO F;  2RVC A;  3KE2 A;  4KIG A;  1GXQ A;  1ZAR A;  2DI3 A;  4EM2 A;  3WTS C;  1R00 A;  2XGX A;  4QWQ A;  3ZP5 A;  3KP6 A;  2F5E A;  1DUX C;  4AIK A;  1FBQ A;  2ISY A;  2XAQ A;  3DF8 A;  1J5Y A;  3IKV A;  2QUF A;  2B0L A;  3ZN0 A;  3HHH A;  3KZY A;  3R61 A;  1TLH B;  3HOS A;  2P6T A;  4YG2 F;  2EB7 A;  1I27 A;  1XD7 A;  5CLS A;  4DQ2 A;  2CGP A;  3KLN A;  2GQQ A;  1O57 A;  3RKX A;  4WCG A;  3C1D A;  3WOD F;  1T2K A;  4G6D A;  3FM5 A;  5CVJ A;  3IRR A;  4XSZ F;  2A3S A;  1B1B A;  4G8X A;  3EDP A;  4DNC A;  1ON2 A;  4IHS A;  1J75 A;  5FD5 A;  1SD5 A;  3GF2 A;  4MEX F;  2JZY A;  3LQR A;  3E5U A;  5HLG A;  3JTH A;  3WU0 A;  2ZME B;  3C7J A;  1K79 A;  2DK5 A;  2KIM A;  2A07 F;  2ZCW A;  4NHJ A;  1RI7 A;  2A68 F;  2VT3 A;  2A6E F;  1Y0U A;  3WTX C;  2R7D A;  3HRM A;  3ECO A;  2XAJ A;  3M1E A;  1B4A A;  4P9U A;  2IA0 A;  2XIG A;  1QBJ A;  2EFP A;  4OIR F;  4I98 B;  4KN4 X;  1GVJ A;  2ESH A;  4EVI A;  2ISZ A;  2PLY A;  2QZ8 A;  2QBY B;  4KIC A;  3GUD A;  2PEX A;  3NQO A;  3H92 A;  1MD0 A;  3M7G A;  4U7B A;  5D5U B;  1FWZ A;  4ESB A;  1ZRF A;  3J80 K;  5L3C A;  1XGM A;  3WTZ A;  1D8J A;  4UVA A;  1OMI A;  3VEP A;  5DDG A;  4L9N A;  5LHH A;  4WXC A;  4G9Y A;  2EA2 A;  4L0Y B;  5LEJ A;  1MJ9 A;  2PG4 A;  4AD9 A;  3V7C A;  5L3G A;  3IWZ A;  5J8F A;  1U78 A;  4HYE A;  2M45 A;  2D45 A;  4A0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...