1SD4A

Crystal structure of a semet derivative of blai at 2.0 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
QVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PENICILLINASE REPRESSOR
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
total genus 37
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd4A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd4A02
1HW5A 3IKVA 3RTRA 3F8CA 4FT8A 1LEAA 2DQLA 3WGGA 2VONA 4HV6A 1YIOA 2YPRA 3MWMA 1PP7U 2EJRA 2ZMEB 3U1DA 4XSXF 2HQRA 4CO8A 3K1NA 4FHTA 2LSOA 4EMSA 5DEQA 4LB6B 4P96A 3FXRA 3COAC 4HW0A 2YR2A 3DV8A 2P5KA 4UNOA 1FLIA 4XBFA 3BPXA 3CO7C 2EV6A 1Z6RA 3V7SA 2L02A 1R58A 4I02A 2V1DA 4WK8F 4A0ZA 5AIQA 4BHPA 3CTAA 3FXUA 2M8EA 2EV0A 4LG0B 1WKMA 1SD6A 3GXOA 4EM1A 4EV0A 1IRFA 2EA4A 3V7CA 2GA2A 4PGHA 2VN2A 3J7AO 4LD5A 1GXQA 5EEGA 4ZZLA 1ZAOA 4N0BA 1XSVA 1CGPA 3HRTA 2L4AA 2ZBKA 1ONVA 2DPDA 1IRGA 3B02A 5IT9K 4L9TA 3FXQA 3TOBA 1ZG3A 3GZ5A 4A6EA 3EYIA 3LA7A 2P8TA 3M1EA 4UUVA 2IRFG 4A6DA 3ZMTA 1R1UA 2H94A 1E17A 4IPAA 3DKWA 3C3WA 1S3JA 2DO7A 4AIKA 1RUNA 3WTSC 2EFNA 3ML6A 3QRFF 1GVJA 2A07F 5BS6A 4HYEA 3O2PE 3LA2A 4E70A 3C1DA 3Q9SA 1IAWA 2QWWA 1LEBA 1OYWA 2NNYA 1JE8A 3SXYA 2XAFA 3U2RA 1PP8F 5KK1A 1TW2A 1FPQA 3HSEA 4P9FA 2XASA 2H27A 3PFIA 4F7ZA 3I5UA 3HTSB 1X3UA 3IKTA 2W24A 1J75A 4BQAA 3BP8A 2NNNA 1KQ0A 5FLXZ 4KIGA 2P4WA 2A6HF 2ACJA 1G3SA 2JPBA 2GXBA 1KQ9A 1B9NA 2P5VA 1OYYA 4A2UA 2KJBA 2XVCA 1SFXA 3GVAA 4HQEA 1IW7F 3E5UA 2LKPA 2OD5A 3ZN1A 2CGPA 3BZ6A 1OMIA 2VOPA 3QP6A 3GYHX 2FRHA 4IJAA 4BHBA 2Z9OA 4G94A 2FNPA 1Z91A 4HX4A 2Y75A 2FSWA 1K7AA 5LHGA 3WTXC 4M72A 5E18F 1LJ9A 3T8TA 4CGZA 5CYVA 1U8RA 2DPUA 4HBLA 1DUXC 4A12A 5CLSA 3ZQ7A 1UHWA 3NQOA 1ZLJA 4JK1X 1G4DA 2V9VA 3CUQB 2UWMA 2HEOA 5BOXA 4I7HA 5K5RA 2HQNA 2Q8KA 3IHUA 4CHUA 1FBQA 4MEYF 3VOEA 1U2WA 5LHIA 2FE3A 2PG4A 3KP3A 5FO5A 3LFKA 1FNNA 2P7CB 1FWZA 4Y17A 2J5OA 2Z3YA 3H92A 1REPC 3IWZA 5LGTA 4PCQA 4KN4X 4UV8A 3HOSA 3MEXA 1G3TA 2ELHA 1BIAA 2O8XA 5FB2A 2ZO4A 4LMYA 2HKOA 3SZTA 4D0PA 4DQ2A 3O6BB 2RVCA 3E97A 2BV6A 1HXDA 5HDKA 2L3DA 1T39A 1Z7UA 5FFZA 3VODA 3SQNA 5D4SA 1MJ9A 2A68F 1HSJA 4U0VA 1TQPA 4RB1A 1UB9A 3J81Z 1O3TA 2V1UA 1D3YA 2ZCWA 1ZGAA 1XSXA 2JSCA 2A61A 4I0AA 4ZH4F 1WRJA 4RGSA 1XGOA 1KU3A 2VC0A 2FMLA 5ICEA 2FU4A 2XUBA 2HS5A 3R0AA 5LEKA 3V4GA 3KLOA 1IXCA 3TOAA 5D5WB 5L3BA 2HZTA 1TBXA 2MLKA 4MGRA 2H6CA 2CYYA 4P55A 4UVBA 3V8KA 1A04A 5L3DA 2D45A 1ZG1A 3P7NA 4OIQF 5BMZA 3CO6C 4KYWA 1R00A 2KJCA 1IXRC 1B1BA 2E7WA 3TQNA 5ERIA 2QENA 1SD5A 4WXCA 2VXZA 2PMUA 1H0MA 5JHUA 4IHTA 5BQTA 1LDDA 2CG4A 2L01A 4EVIA 2DBBA 3FM5A 4ENKA 3KEOA 3E3VA 1FZPB 1IN6A 3WG9A 1K78A 3C7JA 3EQLF 5JFRA 1CF7A 3V7RA 3K1MA 4LB5A 2NAZA 4RB0A 2L54A 3IWFA 1YW8A 1EH7A 3I58A 3F22A 1SMYF 2XHKA 1F1ZA 2WWYA 1PUEE 2NS0A 3F8NA 1RUOA 1IUYA 1IN5A 3E6BA 1TTYA 5CVIA 2E1CA 2HWVA 3M8EA 1KYZA 3ZMVA 1FP1D 4EJWA 3RYRA 1O57A 4N9IA 1QNTA 2M45A 2OA4A 4IRGA 4RB3C 5JR3A 4Q5SF 4JBAA 2F5EA 4P5OA 4LK1F 4CICA 2MA3A 4MQ9F 1W4MA 2MLGA 1QGPA 2YX7A 4O5VA 2AXLA 3GWZA 4GXOA 1F4KA 1DP7P 1ZG5A 1KA8A 2PJPA 1ZYRF 1T6SA 4BHCA 1B4AA 3GLXA 1LQ1A 1IN4A 4I01A 1CF7B 3HRSA 5ILSA 2VE9A 4HF1A 3L7WA 1J9IA 4HZFA 3F6OA 3TKYA 4IF4A 2FMYA 3KP5A 3MAJA 3M9AA 4ZZDA 2ZMEA 1HSTA 3EUHA 4OINF 1G3WA 2Z99A 3BY6A 2STTA 3JSOA 2G7UA 1FSEA 2COMA 2HTJA 2R7FA 5ICGA 1F9NA 3CLOA 1BN5A 2XV4S 3KZYA 4Z2YA 3J80K 3GEZA 2A3SA 3L9FA 4OOIA 3LQRA 1SD4A 4ASNA 1S29A 4ZYEA 1YW9A 4G9YA 3R4KA 4KNYA 4MTDA 3BJAA 2ZXJA 2V6CA 3K1PA 3ROUA 4HAMA 5FD5A 3T1BA 3MCZA 4HF0A 2XAQA 1QPMA 4LGWA 1Z6TA 1NHAA 2CSOA 1R22A 5F6FA 2A6EF 2O03A 3CJNA 2CO5A 1B59A 2VT3A 3JSPA 4GCVA 3CUQC 4U0WA 3RKWA 5IT9Z 1BM9A 5LGUA 2OAZA 2YSRA 5ICFA 4HDVA 2NRAC 1FYKA 1WQ2A 1Z1DA 3S2WA 2HDCA 2EK5A 2BYVE 4ENJA 5HOOA 3ZMUA 3ZN0A 1UFMA 2XAJA 1XCVA 4LK0F 3ZMDA 4BYYA 1U6GA 1ON1A 1MJAA 5BPDA 1W5SA 1C0WA 1G6NA 3TGNA 2P5LC 3RPQA 5DCMB 4L5JA 1DPRA 1WI9A 1P2FA 2H09A 5E1WA 4HF2A 4P9UA 3F8BA 4UVAA 1RNLA 5A2QK 3GFIA 3L2CA 2YX4A 5D8LB 3T0YA 3F3XA 3P9KA 2O61A 5E20A 4PDKA 1J2XA 3QPHA 4BXUA 1KQ8A 2VC1A 2GXGA 3KEQA 1FT9A 3L00A 3PQKA 1FBUA 1HKSA 5DYMA 3HUGA 2QYOA 1Z9CA 1YQAA 2Y0MA 4L9VA 4DNCA 2IJLA 1H9GA 1R1VA 3GF2A 4YG2F 1OPCA 3GZ6A 2EV5A 3VB2A 3D5LA 5EEHA 4MHGA 2J5PA 3I53A 2R7DA 4KIFA 1IXSB 2DTRA 2RQPA 4KN7X 1O3QA 2VBYA 3ULQB 2ESHA 2X4HA 5AIPA 3VFZA 4HA8A 5K5QA 2IA1A 4MTEA 5E17F 3DF8A 3RIRA 5LLQA 6PAXA 4I0BA 4O6JA 4A5MA 2TDXA 3ISPA 1P4WA 3JAMZ 2HOEA 3KETA 4L18B 4HX7A 2STWA 5HLGA 4N9HA 1HBXG 3CUQA 5L3CA 3JTGA 2PQ8A 3V8JA 3KFWX 3H3ZA 3L09A 1J5YA 2GIVA 2VBZA 2A5YB 5FD6A 1LDKB 4EJTA 3K9TA 1TQMA 1ZRDA 2VT2A 3QOPA 4WWCA 3EDPA 2ISYA 3LQQA 2JTVA 3EYYA 1U3EM 2R3SA 2KIFA 3AAFA 5D8KB 1YO5C 3NEUA 4ENMA 4UXNA 2FXAA 2V79A 2LF8A 3DP7A 3REOA 3K2ZA 3FHZA 3QPTA 1MJBA 4RS8A 2EA2A 2EFQA 3I4PA 3I59B 4L0ZB 2X0LA 3WTYC 4H0EA 2O0YA 5L3FA 3R61A 5ICCA 3DFGA 2HYGD 2IA2A 3K0LA 3HRMA 5HLHA 3HTUA 1R5HA 2OU2A 2ETHA 2UXXA 1QQIA 4EM0B 3LSTA 3LAPA 1F5TA 4R8HA 2BGCA 3MZYA 5HVQC 1JXSA 4HLXA 2HKXA 4G7ZF 2XAGA 2GZWA 2RC4A 3I0TA 4A5NA 4KMFA 2ISZA 1G3YA 4HOBA 3KLNA 2RGVA 1L3LA 4M9SA 1LB2A 2OZ6A 3G3ZA 2M1BA 3DEUA 2K7LA 3U9GA 1D8JA 2DI3A 2RN7A 1O7FA 4TV7A 2Z33A 2QQAA 3E6DA 2E1NA 5H6QA 3FWEA 3GFLA 1Y0UA 2HFHA 1B9MA 2XAHA 2GA1A 2VODA 1QZYA 2IP2A 1OR7A 4QLCU 1XDSA 3F21A 1Q1HA 1YW7A 3RKXA 3WE3A 3CDHA 5CJ9A 1W5TA 1XGSA 4LLGF 1P92A 2FBHA 1OKRA 2JRTA 5L3GA 4OIRF 4BNCA 5ILVA 2XIGA 3B73A 3ELKA 1XB4A 1T0FA 2FBKA 3WODF 2P7VB 4AD9A 1HW1A 1BOAA 3PQJA 3BWGA 3ECHA 2A69F 3HOTA 2JPCA 2PI0A 2WC2A 2DT5A 4R1HA 4GO1A 3TO6A 1XMKA 1U78A 4PGGA 4LLNA 4RGXA 1TNTA 1LDJA 3DPLC 3JTHA 4YFXF 2HR3A 2UZKA 3IL2A 2QM3A 5J6XA 4NHJA 2ZJ2A 4G8XA 3F72A 5F1RA 2JZYA 2F5FA 1RIOH 2EB7A 2DK8A 3I64A 3RJPA 5ILUA 2QBYA 1BJAA 2ESNA 3ERED 3FX3A 1JHFA 3WGHA 4RAZA 2XKPA 2ADUA 5TRDA 2MBFA 1WWXA 4HLYA 1YG2A 5CVUA 2C6YA 2MC3A 1IN8A 1J0RA 2PBIA 5E8IA 4I2OA 4FX4A 1E2XA 3ABUA 4XRFA 3MZHA 5DD8A 2KRFA 2FNAA 1IN7A 4OU0A 5K1YA 1USSA 1HKQA 3E5QA 3KP6A 2ZFWA 3OV8A 3FZVA 3ZMZA 3WTUC 3M7GA 4L9NA 4IHSA 1MKMA 2BE5F 2W25A 4Q47A 3QP5A 1U5TA 5D5VB 5LBQA 1PDNC 4HDUA 3HIFA 1TQIA 4MQVA 2QBYB 1KU9A 4LJZF 4GGGA 3FMRA 3GO5A 4IRHA 5KVRA 2GWRA 1BC8C 1ZH5A 4ESJA 2XKOA 2CFXA 1Z05A 3IRRA 1DPUA 2DK5A 2W57A 5LHHA 1R5GA 2IW5A 4Y15A 4L5IA 3VEPA 3E5XA 4S04A 1S6LA 2EWNA 5DUIA 1K79A 2FEZA 3ABTA 3HRUA 4UHTA 1BI2A 1ZHFA 1ULYA 1KGSA 5AONA 2IPQX 1STZA 2L4MA 1MZBA 4OMZA 3W6KB 5H6RA 4M73A 5IT3A 4S05A 3HSFA 4CYDA 3MQ0A 4ETSA 1P6RA 1U5TB 2HGCA 4AIHA 4WXHA 3FF5A 3RDIA 2OQGA 2PN6A 3R60A 5DCMA 3IRQA 1H9TA 2HTSA 1O3SA 4XLPF 4AWXB 2W85A 2MD5A 5CVVA 3R0JA 3BROA 1T38A 2PMHA 5LGNA 4CZZA 4HX8A 4B09A 2WTEA 3WE2A 2F2EA 5A2QZ 4XLNF 4KUMA 1QZZA 1YTYA 1BBYA 4L0YB 1R7JA 1DDNA 5JI6A 4LFUA 3Q5FA 3WU0A 3LWFA 1B6AA 3TO9A 2RNJA 1J59A 3E6MA 3WU1B 5HDNA 2DQRA 2EFPA 1KYWA 5JVTA 3F6VA 5K5OA 2K4JA 5DD4A 3HHGA 1XN7A 2BEOA 2Q0OA 1BI0A 5E8GA 3SFZA 3WGIA 1LVAA 3G73A 4RAYA 4U0YA 1KU2A 3F8MA 3F23A 2P6TA 1D5VA 3BJOA 5HS7A 2OBPA 3C18A 4EM2A 5DDGA 1MDMB 5HS8A 4QWQA 3RPUA 2OZUA 4FX0A 1QO0D 2Z5UA 3OOPA 2V1XA 2QQBA 3ZP5A 3BOQA 2IT0A 4HV5A 1BI3A 1S7OA 1YS6A 2BBYA 4AVPA 1WSUA 1UCRA 1FX7A 2VOOA 4EJVA 1R23A 1FYLA 1ZLKA 4UVCA 2PFBA 2IA0A 1YFHA 4G7HF 1ZREA 2LDUA 3W6JB 5E1XA 1I1GA 5TJJA 3SZPA 1J7KA 4G6QA 2GQQA 1S7AA 3LAJA 2MH2A 2UXNA 2YU3A 3WTVC 1HQCA 3I59A 4EJOA 1SFEA 1RZ4A 5BPIA 1O7LA 5D6FA 4M9ZA 3GX4X 1W7PD 2CQKA 4I98B 3K69A 2FQ3A 3EETA 4YFNF 3BPVA 5DUKA 3MFKA 2FF4A 4I09A 1T98A 2QQ9A 3KE2A 2QVOA 3KP4A 3ZMSA 3GFJA 5CVRA 3P9CA 4OMYA 3T8RA 2RV8A 2K86A 4EQQA 1O3RA 2LNBA 3T5XA 5D5XB 2B0LA 4R79A 4BH9A 3TDZC 5E1ZB 1I27A 3HHHA 4ZYGA 3KCCA 2K27A 1FY7A 4KICA 2DW4A 1I1SA 5LEJA 2JT1A 4OIOF 2VE8A 2M5WA 2RKHA 1AOYA 4XSZF 1MD0A 4CDGA 4U7BA 2D2WA 4YIFA 4WCGA 5DV5A 2FBIA 3HYIA 1XD7A 2NYXA 3WTTC 2P6SA 2KIUA 3JAMK 2QZ8A 3FMSA 1RI7A 5FGMA 4M71A 1AWCA 5LRSA 5J8CA 4AIJA 5HDGA 2CWEA 4ESBA 3WTZA 1ZRCA 5HS9A 3HSRA 5FLXK 4G6DA 1JGSA 2MH9A 1ZGJA 1R36A 4K2EA 4KMUX 2O3FA 3BJ6A 4Q48A 1L0OC 4PZJA 1FOKA 1FSHA 3D0SA 4ESFA 5J8FA 4RB2C 3SHFA 2ZNYA 2K4BA 1U5TC 2H6BA 5FFXA 2E7XA 4YIIA 4Y13A 1EV7A 1SAXA 3QAHA 2HYFA 4IRIA 3IC7A 3V8LA 1S8NA 1P4AA 2QUFA 3DPTA 2W84A 1VTNC 4WX9A 5D4RA 2XRNA 5LRRA 3KP2A 4CXFA 1FC3A 4JQFA 4HQMA 4KFCA 2G7HA 4KIBA 3LA3A 1EH6A 3Q9VA 1TW3A 4B8XA 1V4RA 3ZPLA 5DCFA 3M8FA 2DU9A 2FA5A 1XCBA 4IXAA 2F5CA 5F64A 5D5UB 4L9JA 4GYIA 1GXPA 4NQWA 2WV0A 1EH8A 4WF2A 3WTWC 2XGXA 2AS5F 2DFIA 2DAOA 1ODDA 2EFOA 2GAUA 4KDPA 1SD7A 1FBSA 4U7DA 1FYMA 5CVJA 2KKOA 1ZN2A 2PLYA 3BDDA 4M74A 3JW4A 1XSDA 1HW2A 1K6OA 2PEXA 5HLIA 1JHHA 2G9WA 3J81K 1SFUA 4UV9A 2K02A 2F5DA 2XROA 2OQRA 2CW0F 4KT5C 2M87A 3DXJF 3QU3A 1USTA 4ZYDA 3F8FA 1I5ZA 1XGMA 1YYVA 4GYGA 4ZYHA 3J80Z 2Q2EA 4U88A 3ECOA 3RYPA 1T2KA 1ZRFA 3FMQA 1ZARA 2RDPA 3TDUC 2VBWA 5ED4A 2M30A 4NB5A 1TNSA 4RGRA 1FP2A 1I6XA 4O3MA 3I54A 4RGUA 3TO7A 1IF1A 3O3KA 3P9IA 3I71A 1W7PA 4YFKF 3QU6A 4KA4A 4G7OF 4ENNA 4Q4ZF 2EFWA 3NRVA 2ZNZA 3DQVC 5D6EA 2D1HA 5H20A 2LF7A 2DLLA 1V3FA 1SMTA 4A0XA 1MGTA 2FOKA 1ON2A 4MEXF 1YLFA 1BIBA 3KP7A 2VBXA 3KZZA 1K78B 3RI4A 1D8KA 4OIPF 1GHCA 2O6GE 4M6YA 1R1TA 3CUOA 1UHMA 3N4MA 4M6XA 2IVMA 1XMAA 1LNWA 4ON0A 5L3EA 1XGNA 4LLLA 4M9XA 4EJUA 1QBJA 1BC7C 3R6SA 3E6CC 1HKTA 4WXDA 1OYIA 1P4XA 2Y48A 4EGYA 1MDMA 3N97A 1YS7A 3GUDA 4EGZA 4LG0A 1KU7A 2QLZA 4BAYA 1W7PB 1BI1A 2ZKZA 2D1VA 1TLHB 1XDUA 3FM3A 4MNUA 1IZ1A 4IVNA 3GFMA 3H3UA 4A0YA 3GW2A 2KIMA 3RKYA
chains in the Genus database with same CATH superfamily
4BBRJ 1HW5A 3IKVA 3B6CA 2V7FA 3RTRA 3JRGA 1UJ8A 3F8CA 1LEAA 2DQLA 4FT8A 3WGGA 3DCFA 2VONA 4HV6A 1YIOA 2YPRA 4E7LA 3MWMA 1PP7U 2EJRA 3CCMI 3FISA 2ZMEB 1B8IB 3CC4I 3VWBA 3U1DA 3ABLH 4XSXF 5TISC 2HQRA 2QSHX 4CO8A 1W1WE 1A36A 3Q0WA 1TWGJ 2TCTA 3K1NA 4FHTA 2LSOA 4EMSA 3BQYA 3FXJA 4PJJA 2F48A 4BACA 5DEQA 4RMNA 2CUZA 2Q1ZB 3IP4B 4LB6B 4XRMA 1I3AA 4P96A 1H8AC 3FXRA 3COAC 4HW0A 1HC8A 2YR2A 3OR2C 3DV8A 4MFEA 2P5KA 4BY7J 4UNOA 1FLIA 4XBFA 3BPXA 3CO7C 2EV6A 1Z6RA 3V7SA 3HKZA 2L02A 1R58A 4I02A 2V1DA 4WK8F 4A0ZA 5AIQA 4BHPA 3CTAA 3CCJI 3FXUA 2M8EA 2EV0A 4LG0B 3BG5A 4PFPA 3W3CA 1BL0A 2OV7A 3FK6A 1WKMA 1SD6A 3GXOA 3NWTA 4DYRA 3OOUA 2F5VA 4EM1A 4EV0A 1IRFA 1X19A 2EA4A 3V7CA 2EINH 2GA2A 4AM3A 2QGUA 1X1DA 3VSLA 4BJ6C 1CQTA 4PGHA 2VQLA 2VN2A 3J7AO 5KCMA 4LD5A 3ABMH 1GXQA 4E6KG 4M6VA 3JRBA 4OAYA 5EEGA 4ZZLA 1ZAOA 1JUMA 4QSHA 4N0BA 2L7MP 1XSVA 1JJ8C 1CGPA 3HRTA 1IDYA 2L4AA 2ZBKA 3HKZN 1NG7A 1ONVA 2DPDA 1IRGA 3B02A 3AG2H 3SFIA 5IT9K 2WA0A 4L9TA 3FXQA 3HOVJ 3TOBA 2OC6A 1ZG3A 1D0ZA 3GZ5A 4ZDLA 1DU6A 4A6EA 3EYIA 3LA7A 2X48A 4IZZA 2P8TA 3M1EA 4UUVA 5EDNA 3DPUA 1MMDA 2E34A 5DS9A 2IRFG 3RQIA 1X1CA 1T33A 2R7QA 4A6DA 4BBSJ 3L2QA 1WHUA 3ZMTA 2X6XA 3HM5A 3X2QH 1R1UA 4XKWA 5E3MA 4G12A 2H94A 1E17A 4IPAA 2IGMA 3DKWA 1VQ6I 5C3EJ 4YIRX 4DZPA 3C3WA 1S3JA 2CFOA 2DO7A 3VYSB 4AIKA 2DCEA 1RUNA 3WTSC 2EFNA 3ML6A 3QRFF 1GVJA 2ECBA 4D7MA 4BE2A 3CD6I 1SANA 2LFBA 3PUBA 2VJIA 1A31A 2A07F 1BW6A 1JT6A 2EH3A 5DM7F 1MBJA 2E35A 2HXIA 5BS6A 3PM1A 4HYEA 4U87A 3ZGKA 3O2PE 3PSIA 2IS6A 3LA2A 1FEXA 4E70A 3FBNB 1D0XA 3G2BA 3RKQA 3C1DA 3Q9SA 1MMGA 1IAWA 1TZLA 2WY7Q 4NBQA 4PFOA 3PNYA 2QWWA 2LR8A 1LEBA 1OYWA 3KYDB 3OYIA 2NNYA 2VIXA 2RQQA 3HOXJ 1JE8A 3SXYA 2XAFA 2R7UA 3U2RA 1UZCA 1PP8F 3L2VA 3H5AA 5KK1A 1N25A 2KMUA 1TW2A 3WG7H 1FPQA 3HSEA 3L2WA 4P9FA 2XASA 2H27A 1V5GA 3PFIA 2VUMJ 2JN6A 4F7ZA 3I5UA 3HTSB 1X3UA 3IKTA 2W24A 1J75A 3BG6A 1DP3A 4BQAA 2W82A 3BP8A 2NNNA 1KQ0A 3SEZA 5FLXZ 4C2MJ 3BR0A 4DBRA 4KIGA 4L5EA 2P4WA 2A6HF 2ACJA 3OYGA 3OS2A 1R5ID 3NAUA 1G3SA 2JPBA 2GXBA 4NC7A 3MKLA 1KQ9A 3OYNA 1B9NA 2P5VA 3ESWB 1TWHJ 1Y8QB 1OYYA 1WJBA 2HYJA 1ORKA 4A2UA 2KJBA 2XVCA 1SFXA 2EZIA 1IGNA 3GVAA 3O8GA 5IYBJ 1WZ2A 4HQEA 2PMZA 4XN3A 1IW7F 3E5UA 2LKPA 2OD5A 2DMNA 2X6WA 1T56A 3WU2C 3ZN1A 2CGPA 3BZ6A 1OMIA 2VOPA 3QP6A 3GYHX 2LY1A 2FRHA 3GZNB 4IJAA 4HNVA 4BHBA 2Z9OA 4G94A 5DM6F 4BQOA 2FNPA 1WVRA 1Z91A 2DA4A 3V42A 4HX4A 1GVDA 1NK2P 2Y75A 2FSWA 2GBYA 4IL6C 1K7AA 1M1EB 5LHGA 3WTXC 4M72A 2LRDA 2LMDA 1LJ9A 3TW7A 5E18F 3T8TA 4CGZA 5CYVA 1U8RA 1ZELA 4HBLA 2DPUA 4CA0A 1OCPA 2DA2A 1X1AA 2R5YA 3S1RJ 2XSDC 4A12A 1DUXC 5CLSA 3ZQ7A 1VNDA 4XKBA 1TT5B 4CCOA 3K4NA 3IAS2 1UHWA 3NQOA 1DGWY 1ZLJA 3JRFA 4JK1X 1G4DA 2V9VA 4AYBA 1FIPA 3CUQB 2JA7J 3HOUJ 2CV0A 2UWMA 2Y0SA 2QSGX 1QRYA 4CH7A 2HEOA 5BOXA 4I7HA 2KT0A 4PJLA 5K5RA 2B7EA 2HQNA 4XONA 1R49A 3PL8A 2Q8KA 3IHUA 4CHUA 1FBQA 4MEYF 3VOEA 3HEFA 1OCZH 1U2WA 5LHIA 2FE3A 5F04A 2PG4A 1EA3A 4UUTA 3KP3A 2O9LA 5TGTA 2XB0X 3DKYA 3CMYA 5FO5A 3LFKA 1FNNA 2P7CB 1XTAA 3SEQA 3HOZJ 2ZC2A 3ZQIA 2N8GA 3CZ6A 1FWZA 2KHMA 4Y17A 3LSHA 2J5OA 2Z3YA 3H92A 1REPC 3IWZA 1E3PA 2CQXA 5LGTA 4PCQA 3S8PA 1ETQA 4KN4X 4UV8A 3A03A 3HOSA 4AU7A 3MEXA 1G3TA 4MO7A 2LY9A 4NC6A 3QODA 2KRCA 2ELHA 1BIAA 3BTJA 4AYBN 2CUJA 2O8XA 1BOBA 5FB2A 2GLOA 2ZO4A 2Y0SN 4LMYA 5EG0A 3PO3J 2HKOA 4XLEA 3L2UA 3SZTA 4D0PA 5EZHA 5BNGA 3OL3A 4DQ2A 2XF6A 2GIZA 2JUCA 3DU6A 1DQUA 3O6BB 2RVCA 3E97A 5F27A 2BV6A 1SVOA 3GTJJ 1HXDA 3FDYA 1B72B 4JX4A 4RBOA 1O4XA 5J1YA 1JT0A 2IGKA 5HDKA 3CDIA 5JVGF 2L3DA 2E5NA 1T39A 2ZSIB 1Z7UA 2NVUB 3HDDA 5FFZA 2ME0A 4XRSG 2EQRA 3VODA 4EEFG 2XF5A 4XKVA 3DBRB 4FETA 5GTHC 3SQNA 2DDAA 2KZGA 3LSIA 5D4SA 4J19A 4IHXA 5IYDJ 4FISA 5FKNA 1MJ9A 2A68F 4E7HA 1HSJA 3W6VA 4U0VA 1TQPA 2EILH 4RB1A 3AFHA 1VQMI 4C2UA 3H3VK 1UB9A 3J81Z 1O3TA 3LSMA 3G4SI 4A93J 2V1UA 1W0TA 1D3YA 5JLXA 2QQ8A 2ZCWA 1ZGAA 1XSXA 2JSCA 2X51A 3FKIJ 2AO9A 1GT0C 2A61A 2R93J 3FHNA 4I0AA 4ZH4F 1SVMA 2F4MB 1WRJA 5H2FC 3G6EI 1T95A 1XGOA 1KU3A 2DMUA 4RGSA 2VC0A 2FMLA 5ICEA 3ZR8X 1TC3C 2FU4A 2LVSA 4X1EA 3FKJA 5HNHA 2XUBA 2HS5A 2GOXB 3R0AA 2ZMEC 5LEKA 3V4GA 3KLOA 2WAQA 1ETOA 2R7WA 1IXCA 1EKEA 3TOAA 3A2KA 1XPXA 1JI8A 4F91B 3EUHC 2EPFA 5M5YJ 4C3JJ 5D5WB 5L3BA 2HZTA 4X6AJ 3HZJA 1TBXA 2MLKA 1D1CA 4LIVA 2H6CA 4MGRA 5GAEJ 5F1JA 2CYYA 2O8KA 2MC4A 4P55A 4UVBA 3V8KA 4FTHA 1OISA 4M3EA 4XR6A 1A04A 4XM3A 2VI6A 5L3DA 2XC7A 2D45A 1ZG1A 2JQ7A 4RA2A 2K5CA 1A6IA 3P7NA 5GTIC 3MZ8A 3ZCOA 4OIQF 5BMZA 3CO6C 4A3JJ 3RCOA 4KYWA 1R00A 2KJCA 1E3HA 1IXRC 1UHSA 1B1BA 2E7WA 1XX5A 3TQNA 3HGYA 5ERIA 3PFYA 2QENA 1SD5A 4WXCA 3OIPA 3AL0B 2VXZA 2PMUA 2BXYA 2XGCA 3CCYA 1H0MA 2WAQN 4XLFA 5JHUA 3K70C 4IHTA 1LDDA 2XPVA 2CG4A 2L01A 4EVIA 5BQTA 3H0DA 2DBBA 3FM5A 4ENKA 3KEOA 3E3VA 1FZPB 2TRTA 1IN6A 2V9KA 1MNMC 3WG9A 2DTZA 1K78A 3C7JA 3EQLF 5JFRA 2L9RA 1CF7A 4XQFA 3OWTA 4A3GJ 1R4NB 4HSRA 3V7RA 5FJ8J 1MNEA 2DYSH 4Y7NJ 4KISA 3K1MA 4QIWN 4LB5A 2NAZA 2OPTA 2XGDA 3IV5A 2R7XA 4RB0A 3HL2A 5FKMA 5K7HA 2JMWA 2L54A 2M4KA 3IWFA 1YW8A 2KDZA 1EH7A 1Z7LA 3I58A 3F22A 3BLYA 2LOOA 1MMNA 1SMYF 2XHKA 1F1ZA 4B3XA 2WWYA 1PUEE 1MBGA 2NS0A 2E2JJ 4PK4A 3F8NA 1RUOA 2WBMA 3D1NI 2FX0A 4I76A 2NVXJ 1IUYA 1IN5A 1RR8C 4C30A 3GTKJ 3E6BA 4HSTA 1TTYA 5CVIA 1SAUA 2E1CA 4X0GA 5C44J 1ACIA 2F4OB 2HWVA 4F52A 3M8EA 3HG9A 1KYZA 3ZMVA 1FP1D 3BTLA 4EJWA 3RYRA 3OYMA 1X4OA 1O57A 4N9IA 1QNTA 3PUFA 5IP7J 1YI2I 2M45A 3A0HC 2OA4A 4D9JA 4BE0A 4IRGA 3A02A 4RB3C 1IDZA 5JR3A 4Q5SF 4JBAA 2F5EA 4P5OA 4LK1F 4CICA 3OL4A 2MA3A 1YRNB 4MQ9F 1W4MA 3SDGA 2IEKA 2BY3A 2MLGA 1QGPA 4EATA 2YX7A 3C2BA 4O5VA 3LFUA 2AXLA 3GWZA 4GXOA 1F4KA 4XNFA 1DP7P 1ZG5A 1QA6A 1KA8A 2DXIA 2PJPA 1ZYRF 4V2GA 2WV1A 1T6SA 4BHCA 1B4AA 4A3EJ 1TWCJ 3GLXA 1LQ1A 2L9VA 1IN4A 4I01A 1CF7B 3HRSA 5ILSA 2VE9A 1QVUA 3L7WA 4HF1A 4II2A 1J9IA 4HZFA 3F6OA 4Z6YA 3TKYA 4IF4A 2FMYA 3KP5A 5F0HA 2HOAA 2ZJRF 3MAJA 3M9AA 4ZZDA 2ZMEA 1B8IA 2WB1N 1HSTA 2Z2SB 1X58A 2L7FP 3GTQJ 3EUHA 3CCSI 4OINF 2W48A 4ZTJA 1VQ4I 5KHDA 1G3WA 2CQQA 2Z99A 3BY6A 3CESA 3CF2A 2STTA 3JSOA 4CZCA 2G7UA 1FSEA 2COMA 2HTJA 2R7FA 5ICGA 1F9NA 3CLOA 4II3A 1BN5A 2XDVA 2XV4S 2XAUA 3KZYA 4Z2YA 3J80K 3CC2I 2P81A 3GEZA 1MMAA 2KL4A 1I6HJ 2A3SA 3L9FA 2CQ7A 3DEWA 4P1WA 1Y56A 2KZVA 3S1NJ 4OOIA 2BOLA 2ZB9A 3LQRA 1VQLI 1SD4A 4ASNA 1S29A 4ZYEA 1YW9A 3PJRA 1K6YA 2H1LA 5LD2C 2ZXHA 2WADA 4G9YA 3K4KA 3R4KA 1K4TA 3A0BC 4MTDA 4KNYA 3BJAA 2ZXJA 1PYVA 2V6CA 3B6AA 3K1PA 3I56I 3ROUA 2EBIA 4AUXA 4HAMA 5FD5A 2H8RA 3T1BA 3MCZA 4E7ZA 1QHHD 4HF0A 2HZDA 2XAQA 4AVZA 2NVTJ 1V5FA 4A3CJ 5GAHJ 1SFOJ 2DA3A 1QPMA 4LGWA 2JA5J 2JSPA 5FRMA 4A69C 1VI0A 2NVYJ 3Q0UA 3EPZA 1Z6TA 1NHAA 3S14J 2CSOA 4RM2A 1R22A 2ID6A 5IYCJ 3KYCB 3QPSA 1Z77A 5F6FA 5C4XJ 2LBFA 2A6EF 2O03A 3CJNA 1VQKI 2M2EA 1P7IA 2CO5A 1B59A 2VT3A 3LMMA 3JSPA 1TT0A 4GCVA 1VQPI 3CUQC 4U0WA 3RKWA 2VKVA 5IT9Z 1Z21A 1BM9A 4AC0A 3CP8A 5LGUA 2OAZA 2YSRA 5ICFA 4E7JA 4HDVA 5IPAA 4ABZA 2NRAC 1FYKA 1WQ2A 1Z1DA 4RAFA 4GFBA 2JUGA 3S2WA 2I5UA 5IOYA 2HDCA 2PJRB 2HVSA 2EK5A 2BYVE 3S17J 1JKRC 1HCRA 4M3GA 4ENJA 5HOOA 1X3ZB 3ZMUA 1RRJA 2COBA 3H5RA 3ZN0A 3GTGJ 1UFMA 2XAJA 1XCVA 4LK0F 3ZMDA 1WJ5A 3OMYA 4BYYA 1U6GA 3CJQB 1HA8A 2F4IA 3WHBA 1TL8A 1ON1A 1MJAA 5BPDA 1W5SA 1C0WA 2X1DA 2LY2A 4F92B 3HOWJ 2ELKA 1G6NA 2QA4I 5EGOB 3MKYB 1IRZA 3HPGA 5GPAA 3TGNA 2P5LC 2DMPA 1K4SA 3J7YJ 3RPQA 5DCMB 4IHVA 4L5JA 2BY1A 2K3PA 1DPRA 1WI9A 1P2FA 2H09A 5E1WA 5B1BH 4HF2A 4P9UA 3F8BA 4UVAA 4ZJZA 5B1AH 1RNLA 2QEXI 4BDYA 5A2QK 3GFIA 3L2CA 2YX4A 2LLKA 3OYEA 2MFZA 5D8LB 2BVLA 3T0YA 1FMVA 2QKLB 3Q0VA 3S32A 3M3YJ 3F3XA 3P9KA 3TMOA 3AKZA 5DTDA 4DBQA 2O61A 3HBLA 2OTLI 5E20A 4PDKA 2LBFB 3A1YA 1BW5A 1J2XA 1S7EA 4OWRB 4KJZA 3QPHA 4BXUA 2GM4A 1XS9A 3BG9A 1I3QJ 1KQ8A 2VC1A 2GXGA 3KEQA 4BU2A 2K9NA 1FT9A 1LKXA 3L00A 3PQKA 2VKEA 3QYBA 1FBUA 1HKSA 2OUMA 5DYMA 3HUGA 1ZTRA 2QYOA 1Z9CA 1YQAA 2KDOA 3LSJA 1BR2A 2Y0MA 3IAM2 4L9VA 3OYAA 4DNCA 2NS7A 3S1QJ 2IJLA 3RZDJ 1H9GA 4XOTA 1R1VA 3GF2A 3P5JA 4YG2F 1OPCA 3GZ6A 2EV5A 3VB2A 3D5LA 5EEHA 4MHGA 3K4JA 3FXLA 3J7ZI 2GXAA 2J5PA 2XGEA 3I53A 4GDFA 2R7DA 2BW3A 2M4GA 3A4CA 3FIWA 4KIFA 5EF6A 1IXSB 2K9SA 5FKOA 2DTRA 2RQPA 4KN7X 3OYKA 1O3QA 2VBYA 2W7NA 3EUKL 1MBFA 2ELJA 3ULQB 1WPKA 2JJ7A 2ESHA 2X4HA 5AIPA 3VFZA 5EZGA 4HA8A 5EYRA 5K5QA 5J1RA 4LITA 2IA1A 4Y33A 1VQOI 4MTEA 5E17F 3DF8A 3RIRA 5LLQA 6PAXA 4I0BA 4O6JA 3DBLB 1OR7C 1UELB 2G0EA 4A5MA 3KX2A 2TDXA 3HPHA 1W36D 2LH9A 3ISPA 2CMPA 1P4WA 3JAMZ 1ETXA 2HOEA 3KETA 1ETVA 4L18B 1H88C 3ASNH 4HX7A 4QPOA 2STWA 1MBHA 5HLGA 3CQZJ 5J40A 4N9HA 1HBXG 3CUQA 1JTXA 5L3CA 1V55H 3JTGA 2ZJPF 3AL0C 4B43A 2PQ8A 3V8JA 3KFWX 1RESA 3H3ZA 1SEUA 1MNDA 3L09A 1Y1VJ 5FRNA 1J5YA 2GIVA 3VDXA 2VBZA 3SJMA 2A5YB 2M0CA 2V6EA 1R4MB 3H9JA 4XLHA 4ANJA 5FD6A 1LDKB 1T0FC 2E36A 2QF7A 3HUGB 5E3NA 4EJTA 2V9PA 1SVLA 3K9TA 1TQMA 1WJAA 1VQ5I 1ZRDA 2VT2A 3QOPA 1ENHA 4WWCA 3EDPA 4C9YA 2Y69H 2ISYA 3LQQA 1G8XA 2JTVA 3EYYA 3BCBA 1U3EM 2R3SA 2KIFA 3AAFA 5D8KB 3CLQA 2BW3B 1YO5C 3NEUA 4ENMA 4UXNA 3I4MJ 5KAIC 1MW7A 2X85A 1X4PA 3K4BA 4GRIA 2IS4A 1WH7A 2FXAA 2AHQA 2V79A 4CYCA 2VQHA 1GLNA 2KPMA 2O5RA 1X3WB 2LF8A 3DP7A 3REOA 3K2ZA 3ZXSA 3M8JA 3FHZA 3QPTA 2X6YA 1MJBA 3D5RC 4RS8A 4UUSA 2EA2A 2EFQA 3DWLE 3I4PA 3I59B 1B72A 4L0ZB 2X0LA 2L2OA 1PUFA 3ZQQA 3LNQA 1XC5A 4FCYA 1I39A 4W97A 3WTYC 2EZKA 4H0EA 2O0YA 5L3FA 3R61A 3RZOJ 5ICCA 3DFGA 2HYGD 3FXMA 4JX6A 1JKOC 1WJDA 2IA2A 3K0LA 1SC7A 2HOSA 3HRMA 3VYRB 5HLHA 3HTUA 1Y6IA 1R5HA 3F0CA 1DU0A 3ZOBA 3GTMJ 2OU2A 2ETHA 2B63J 2HNHA 1ERDA 2UXXA 3MKZA 1QQIA 3MVPA 4EM0B 3SYTA 3LSTA 3DLAA 3LAPA 1F5TA 1APLC 4R8HA 2BGCA 3OYJA 2KFDA 2ZSHB 3MZYA 2MSYA 5HVQC 1JXSA 3S93A 4HLXA 2HKXA 2LK2A 2XAGA 2M0MA 3WHCA 4G7ZF 2GZWA 2RC4A 3I0TA 2DYRH 4BY1J 4A5NA 4KMFA 2ISZA 1G3YA 1RC9A 4HOBA 3KLNA 2RGVA 1F36A 1L3LA 3Q3SA 4M9SA 5HODA 1ZQ3P 2VKHA 4J00A 1LB2A 4NDLA 1Z67A 2OZ6A 3G3ZA 1G59A 2M1BA 3DEUA 1IG7A 3GTLJ 4QPQA 1A5JA 2K7LA 3U9GA 2YU9J 1VQNI 1D8JA 2DI3A 2RN7A 1O7FA 4TV7A 2Z33A 4BKXA 3HOYJ 1OQYA 2QQAA 1ZGWA 3BC8A 2K40A 3E6DA 2E1NA 5H6QA 1FTTA 3FWEA 4YELA 2K9LA 2L7KA 3GFLA 1Y0UA 2HFHA 1B9MA 2XAHA 2GA1A 2VODA 1QZYA 2R7SA 2IP2A 1OR7A 4CYCB 1Y8RB 4DIQA 4QLCU 1XDSA 4I6ZA 5JHFA 1MH4A 2E1OA 3F21A 1Q1HA 1YW7A 3RKXA 4E7IA 3WE3A 3CDHA 5CJ9A 4UUSB 2X1EA 1GV2A 1W5TA 1XGSA 4LLGF 1P92A 1PUFB 3GTPJ 2V4JC 2FBHA 3RPUD 1OKRA 2JRTA 2V1NA 5L3GA 4XMYA 4OIRF 4BNCA 5ILVA 2XIGA 3CCVI 1YX5A 3B73A 3ELKA 1FIAA 3CCRI 1XB4A 1T0FA 2E1MB 2FBKA 2P7VB 3WODF 4AD9A 4BQQA 1HW1A 2IXSA 3SZGA 1BOAA 3GBGA 3ZQLA 3PQJA 3IH3A 3BWGA 2Z16A 4E7KA 3ECHA 2A69F 4IO9F 3HOTA 2JPCA 3G1LA 2EIJH 2PI0A 2DMTA 2WC2A 1LFBA 2I8DA 4CCKA 2DT5A 2YUSA 1GDTA 2KIQA 2DFHA 4R1HA 4GO1A 4XOPA 2HQ5A 3TO6A 4F93B 3TEDA 1XMKA 1LPQA 2XSJC 1U78A 3E7LA 4HG2A 3TL4X 2R7VA 1IC8A 4PGGA 1HDPA 4LLNA 1Y1WJ 4RGXA 1KZHA 3KZIC 1TNTA 3ZQHA 1LDJA 3JRCA 3DPLC 3HGGA 2OTJI 3JTHA 3W2VA 4YFXF 2OCCH 2HR3A 2UZKA 3FK7A 3UNGC 4BE1A 4ITVA 4NUBA 2QM3A 3IL2A 5J6XA 1TP4A 4NHJA 2ZJ2A 2IGNA 2UUZA 4IQJA 4G8XA 3F72A 3BZKA 5F1RA 2JZYA 4D1QA 4CCNA 3S1MJ 2F5FA 3DTEA 1RIOH 4IHWA 4MLOA 2EB7A 1YX3A 3TBIA 2DK8A 3I64A 3RJPA 5ILUA 2R7ZJ 3MKWB 2QBYA 1BJAA 1YRNA 5LFAA 1QVTA 3H9GA 2ESNA 3ERED 3FX3A 1JHFA 2R7TA 3BT9A 1FTZA 3WGHA 4RAZA 2XKPA 3LL7A 1OCTC 2A05A 2X1CA 4HNUA 2ADUA 5TRDA 1JUSA 2BXZA 3BR5A 1MBKA 2ZXIA 3C2GA 2LC2A 1YOVB 3CCEI 3S3OA 2MBFA 4UB6C 1R6RA 1VFCA 1WWXA 4HLYA 1YG2A 5CVUA 3QOEA 2C6YA 1XG1A 2M7BA 3ERMA 3FBIB 4PJ0C 4BL0B 2MC3A 3BTCA 1IN8A 4LOCA 2JVHA 1S5LC 2WY8Q 1J0RA 3M4OJ 2LD5A 3OYBA 2PBIA 5E8IA 4I2OA 5IP6A 1E2XA 4FX4A 2Y2ZA 1R9TJ 3ABUA 4W1UA 2HQAA 1LVKA 4XRFA 2DT7B 1OFCX 3LSGA 5DD8A 3MZHA 4PJNA 3ZQCA 4HNTA 5E3OA 2XRLA 2CJJA 2FNAA 2KRFA 4PUSA 2L5QA 4XK4A 1IN7A 4OU0A 5K1YA 1D1BA 1USSA 3IUOA 3VYUB 1P9QC 1HKQA 2KLOA 3E5QA 2AQEA 3KP6A 2ZFWA 1V5EA 3OV8A 3FZVA 5B5EC 3KIOA 3ZMZA 3LSPA 3M7GA 3WTUC 4L9NA 4IHSA 1MKMA 2BE5F 2W25A 4Q47A 3BR1A 3QP5A 4KT6A 1G2HA 1U5TA 5D5VB 5LBQA 2WB1A 1PDNC 2CV2A 4HDUA 3DTIA 3HIFA 4A3KJ 1TQIA 4MQVA 2LKSA 2BZTA 2FOWA 3AG3H 4RAGA 4IQ4A 2QBYB 3I55I 3GLLA 1KU9A 4LJZF 1I50J 2IS2A 3KEYA 1Y39A 4GGGA 3FMRA 3NWSA 4YRVA 3GO5A 4IRHA 5KVRA 2RREA 1W5CC 2NVQJ 2GWRA 3HB9A 1BC8C 1ZH5A 3L2RA 3DTKA 4ESJA 2XKOA 5J3LA 2CFXA 4B48A 1Z05A 3IRRA 1WI3A 1DPUA 2DK5A 2W57A 2M3AA 3H36A 1R5GA 5LHHA 3OYCA 2IW5A 4Y15A 4L5IA 5KNLA 3VEPA 3E5XA 4S04A 1S6LA 2EWNA 5DUIA 1HDDC 1IV8A 1K79A 2FEZA 1HOMA 3ABTA 3HRUA 4UHTA 1BI2A 1ZHFA 4CUGA 2H1KA 1ULYA 1KGSA 5AONA 2IPQX 1STZA 2E5ZA 1J09A 3OYLA 2PJRA 2L4MA 3ZRGA 1MZBA 1AKHB 1POGA 4OMZA 3W6KB 1X2MA 1K83J 5H6RA 4M73A 4E7SA 4G6TB 2DA5A 2M8GX 3JREA 1DGRM 5IT3A 4S05A 3HSFA 4CYDA 3MMYB 3MQ0A 2CU7A 4BXFA 4ETSA 2DN0A 1P6RA 1U5TB 4CCMA 2FD5A 1AHDP 2HGCA 3BR2A 3K2AA 4AIHA 4WXHA 4DW6A 3FF5A 2LREA 3PIOF 4A3MJ 4UB8C 3OS1A 3RDIA 2VLAA 2OQGA 5EGOA 4PSWA 1U9OA 2PN6A 5M3MJ 3R60A 5DCMA 3M07A 4B1RA 3IRQA 2HTSA 1H9TA 4BXXJ 1O3SA 4XLPF 4AWXB 4BGDA 2W85A 2MD5A 5CVVA 3H35A 3LSRA 3R0JA 3OIQA 3BROA 1T38A 2PMHA 3BTIA 4HX8A 4CZZA 5LGNA 4B09A 2WTEA 4DYCA 3WE2A 2F2EA 3VPRA 5A2QZ 4FE4A 2HU9A 4XLNF 1QZZA 4KUMA 2QKMB 1YTYA 1BBYA 3IH4A 5FKLA 4L0YB 2XB5A 1QPIA 1R7JA 1DDNA 5JI6A 1IRXA 5J47A 4F55A 4LFUA 1GV5A 3CMMA 3Q5FA 3PSFA 3WU0A 3H0GJ 2P0WA 2CW7A 3LWFA 1B6AA 2IGOA 2CH0A 2VASA 3TO9A 5FLMJ 3OY9A 4OAZA 1Z3YA 2RNJA 1J59A 4IX7A 4XLAA 3E6MA 3KYLA 3WU1B 2OF7A 5HDNA 2AQFA 2CS3A 2DQRA 3CDLA 3DBHB 2EFPA 4S0HB 1KYWA 5B3SH 5JVTA 4DOZA 3F6VA 1YJ9I 1BR1A 5K5OA 3EUAA 3OYHA 3JR9A 1N78A 2MW8A 1VF9A 2EZLA 4DYQA 2K4JA 5DD4A 3QWLA 2VQGA 3HHGA 4ZTFA 1XN7A 2BEOA 2Q0OA 1BI0A 2JVGA 5E8GA 3SFZA 1LVAA 2L7ZA 3WGIA 4RAYA 4U0YA 3G73A 1S9HA 1IUFA 1KU2A 3A01B 3F8MA 3AG4H 2Y30A 3F23A 2P6TA 2HXOA 1D5VA 3BJOA 3DU5A 5HS7A 2OBPA 2BY0A 4BS9A 2L0KA 2BHZA 3E1SA 3C18A 4EM2A 5GAGJ 5DDGA 2R92J 2QCOA 5CQEA 1MDMB 5HS8A 4QWQA 1ITYA 3RPUA 2DA7A 2OZUA 4FX0A 1LE8A 1R71A 1QO0D 2Z5UA 3OOPA 2FQ4A 4XORA 2LG4A 2V1XA 2QQBA 2L9NA 2HI3A 4RDUA 3CJRB 3ZP5A 3MN2A 3BOQA 2L9SA 2IT0A 4HV5A 1BI3A 4NNJA 2RNGA 1VQ8I 1S7OA 4N4NB 1YS6A 2ZJQF 2BBYA 4AVPA 1WSUA 1UCRA 2K85A 1FX7A 2VOOA 5M5XJ 2BHYA 4EJVA 5J4VA 5FLVA 1R23A 5IP9J 4IOCF 1FYLA 3PNVA 1ZLKA 2E1MC 4RLFA 4AIDA 4UVCA 3TW6A 3JRIA 1RPWA 4BJ5C 2CUFA 2PFBA 1A6QA 1Z3XA 3E0JB 3DEEA 1EF4A 2CRGA 2IA0A 1YFHA 3CCQI 4G7HF 1ZREA 3TP3A 2LDUA 1BR4A 4IOAF 3H9QA 3W6JB 5E1XA 1NTCA 1I1GA 4A3DJ 3BZCA 3U21A 5TJJA 3SZPA 1J7KA 2X6OA 3ZQFA 4G6QA 4N4OB 2GQQA 1S7AA 2DJIA 5E3LA 3LAJA 2MH2A 2UXNA 2YU3A 4QTRA 3WTVC 1VQ7I 2NOGA 3BG7A 4RLQA 1XMXA 1HQCA 3GCMA 1T08B 2K9MA 2OJED 4UY8I 1TWFJ 3I59A 4EJOA 1V54H 3K7AJ 1SFEA 1RZ4A 5BPIA 2MABA 2XF7A 1O7LA 1LE8B 2B9SA 1AU7A 5D6FA 3BR6A 4M9ZA 2DDBA 2WAFA 3GX4X 4M3BA 4KITB 1W7PD 2CQKA 1X1PA 1X2NA 3AG1H 4I98B 3K69A 2OCEA 4BEHA 5C4JJ 5J1UA 4ZDPA 3JRDA 3PO2J 5FROA 1D5YA 4E4HA 2DODA 2FQ3A 3EETA 3OS0A 2QSFX 4YFNF 3JRHA 3BPVA 1W0UA 1WJCA 1PVEA 5DUKA 1ZKGA 3HC7A 3MFKA 3S2DJ 3SDBA 2FF4A 4BUPA 2PX9A 4LG3A 4I09A 1T98A 3CJTB 2QQ9A 4RM3A 3KE2A 9ANTA 2QVOA 2VQCA 3KP4A 3ZMSA 2UV1A 3GFJA 5CVRA 3CF5F 4B3AA 4CCLA 4B4CA 3P9CA 4OMYA 3T8RA 2RV8A 2K86A 4Y4RA 5GADJ 4EQQA 2IBDA 2LNBA 1O3RA 3T5XA 5D5XB 1RKTA 2B0LA 1LFPA 1OCRH 1OLTA 4XN0A 4R79A 4BH9A 3TDZC 4JOMA 3RSNA 4A3LJ 4JYKA 1I27A 5E1ZB 3CC7I 5CPRB 3HHHA 1ETKA 4ZYGA 3K4MA 3KCCA 2Y9YA 2K27A 3CP2A 2RAEA 3OSFA 1FY7A 4JP0A 4KICA 2DW4A 2E2HJ 1I1SA 5LEJA 4B47A 1MSEC 2JT1A 4OIOF 2JWTA 2ZXWH 2ICWG 4DZJA 2VE8A 2E71A 3K4CA 2M5WA 2RKHA 3RQ4A 1AOYA 2R7RA 2DA6A 3HJEA 2EIMH 4XSZF 1MD0A 4CDGA 1EJ9A 4U7BA 2D2WA 3S3NA 3J7AY 4YIFA 4WCGA 5DV5A 3W2WA 4BEHB 3OSGA 2FBIA 3HYIA 4DJAA 3K70D 1XD7A 1A35A 2HPIA 2NYXA 3WTTC 2DFFA 2P6SA 2KIUA 3JAMK 2QZ8A 3KPHA 3FMSA 1RI7A 4I99C 5FGMA 4XRSA 4M71A 1AWCA 5LRSA 5J8CA 3I9V2 2JA6J 4AIJA 5JLWA 3G1MA 5HDGA 4C3IJ 2CWEA 4ESBA 4HRIA 1MMSA 3WTZA 1ETWA 2VKDA 2PMZN 1ZRCA 1E0EA 4YEJA 2IAIA 2FUG2 2IS1A 5HS9A 5KAFC 3C2HA 4D5FA 3HSRA 5FLXK 4G6DA 3GMEA 1N77A 1JGSA 1P7JA 2Z1DA 1U9NA 2MH9A 1JKQC 5F08A 1ZGJA 2M34A 1R36A 2MD0A 3QYFA 1PJRA 3ZQGA 4K2EA 4KMUX 2O3FA 2HVQA 1HLVA 3BJ6A 3LSKA 2DJNA 4Q48A 3DLLF 3TP0A 3OYDA 1NH3A 4C2TA 1L0OC 5GP9A 4PZJA 1FOKA 1IO2A 2W4SA 3BR3A 1MBEA 1FSHA 1D1AA 3D0SA 1Y0NA 4Y3OA 4ESFA 5J8FA 4XKCA 4RB2C 3S16J 1SFKA 2M9HA 2A6TA 3IH2A 2MYSA 3OIOA 2JK3A 3SHFA 2ZNYA 2K4BA 1U5TC 2H6BA 2GOMA 1ETYA 1WGXA 5FFXA 4B44A 2E7XA 4YIIA 4Y13A 1EV7A 1SAXA 3W2AA 3QAHA 2HOTA 2HYFA 1YJWI 1YITI 2R7OA 4IRIA 3IC7A 3S15J 3V8LA 1UAAA 1S8NA 3H5NA 1IV6A 1YE9A 5CKTA 1P4AA 2QUFA 3DPTA 1BJZA 2W84A 4M3DA 2KP6A 3GTOJ 4M3FA 3D5SC 3U1KA 4WX9A 5D4RA 2VJ4A 1VTNC 1W36C 1RKWA 1D0YA 1QZEA 2E19A 4H4KC 2XRNA 4NC8A 1OJLA 1VZ0A 2AXTC 2R5YB 5LRRA 3KP2A 4CXFA 1FC3A 1FMWA 4JQFA 4HQMA 2VPRA 5HNFA 2G7HA 4KIBA 4KFCA 4MIMA 3CMAI 3LA3A 1EH6A 3Q9VA 3VYTB 1TW3A 4B8XA 5IOZA 4MFDA 1V4RA 3ZPLA 4XL9A 5DCFA 2BY2A 3M8FA 3PIPF 2DU9A 2FA5A 1FOXA 3BQZA 1XCBA 2VXDA 3QYEA 2EIKH 4IXAA 2F5CA 5F64A 5D5UB 3UKGA 1TWAJ 4L9JA 4GYIA 1RR7A 3G1OA 1WJEA 1GXPA 1WJFA 2DMQA 5J4YA 3K4LA 4NQWA 2WV0A 1Q1VA 3FXKA 2LYCA 1EH8A 4WF2A 3WTWC 1FOWA 4J01A 2MG4A 2XGXA 2D5VA 3S3MA 2AS5F 5IY5H 2DFIA 3F9KA 5F0CA 2DOFA 2LKXA 4PSXA 2EZHA 2DAOA 4JX5A 2FJ1A 1ODDA 5HLTA 1U8BA 5EG0B 2EFOA 2GAUA 2YS9A 1JGGA 1WFXA 5F0FA 5K7ZA 4KDPA 1SD7A 2DA1A 2VJJA 2K9QA 2O7OA 3MD2A 5EJCA 4F3QA 1FBSA 3HXLA 2DT6A 4U7DA 1FYMA 1E3OC 1UG0A 4PJMA 5CVJA 1UMQA 2KKOA 4XLCA 1ZN2A 2E2IJ 1WCMJ 2DFEA 3BDDA 4M74A 3JW4A 2PLYA 1XSDA 1H89C 3G71I 1ZR2A 1HW2A 1K6OA 3S2HJ 2PEXA 5CQGA 2W1OA 4A3IJ 2DOAA 2HVRA 5HLIA 1QU3A 5M5WJ 1JHHA 2G9WA 2NS8A 3LOCA 3J81K 1SFUA 4UV9A 1JUPA 2K02A 2F5DA 3CMEI 2R5ZA 1LUJB 2I10A 2W00A 4BDZA 1MH3A 2XROA 2OQRA 2CW0F 3DXJF 2M87A 3QU3A 4KT5C 1USTA 4ZYDA 3F8FA 1GUUA 2VB6A 1S72I 3N05A 3JRAA 4D5CA 1I5ZA 1XGMA 1YYVA 1AKHA 1IJWC 4GYGA 5EEAA 2JRMA 4ZYHA 1F43A 2VJ5A 4Y52J 3J80Z 4NQWB 2Q2EA 2ECCA 4U88A 3ECOA 2HDWA 3RYPA 1NG6A 4IEJA 4DGWB 1T2KA 4CSWA 4HEA2 3BG3A 5K7FA 1ZRFA 3FMQA 1ZARA 2RDPA 2CV1A 3TDUC 3O8HA 2VBWA 5ED4A 1T8IA 4ZDOA 3K10A 1FJLA 2M30A 4NB5A 1TNSA 2ME6A 2LP0A 2M7AA 4RGRA 1FP2A 1VQ9I 1ZR4A 3QPLA 1I6XA 4FE7A 3UR3C 3I4NJ 4O3MA 2JA2A 3I54A 4RGUA 3TO7A 1IF1A 2XPUA 3O3KA 1NK3P 3I3LA 3P9IA 3I71A 1W7PA 1RETA 4HPQA 4YFKF 3CCUI 3QU6A 2VPLA 4A3BJ 4KA4A 4G7OF 2CUEA 3JCUC 4ENNA 2ZFUA 5B66C 4Q4ZF 2EFWA 3NRVA 1MIJA 2ZNZA 3DQVC 3M1CA 5D6EA 3VSKA 2D1HA 3L1PA 5H20A 2R0QC 2LF7A 2DLLA 1V3FA 1MSFC 1SMTA 4A0XA 2KRHA 2HDDA 1MGTA 1OCCH 1BA5A 4IKFA 2FOKA 1ON2A 1UG2A 2X9DA 1YHQI 2R4GA 3OR1C 1JJ6C 1YLFA 1BIBA 4MEXF 2BVMA 2JA8J 3KP7A 2CW8A 2Y9ZA 2VBXA 2R5ZB 3PNTA 1N75A 1LFUP 3KZZA 3DKXA 1K78B 2NXNB 1D8KA 3RI4A 4OIPF 1GHCA 2K3FA 1YJNI 2O6GE 4FQGA 4M6YA 1R1TA 5FKKA 3CUOA 1U0JA 1UHMA 4C3HJ 3ABKH 4M6XA 3N4MA 2IVMA 4V19K 1HF0A 2MGQA 3K6GA 4IHYA 2XPWA 1FOYA 3NARA 1XMAA 1X1BA 1LNWA 2ID3A 2Q2EB 4ON0A 5L3EA 1XGNA 4LLLA 2V26A 2Y31A 3OYFA 2NOJB 4M9XA 1WH5A 4EJUA 4ZYAA 3A01A 1QBJA 1Z0XA 1BC7C 3R6SA 4BQNA 3E6CC 1HKTA 4BJTA 4WXDA 3CCLI 1OYIA 3BCAA 2DOEA 4D7NA 2CQNA 1P4XA 2Y48A 4LIUA 4V2FA 3ONQA 4FASD 4EGYA 2E60A 1MDMA 4XIDA 3N97A 1YS7A 5E79C 2KQRA 3GUDA 4CCJA 1OCOH 3ASOH 4LG0A 4EGZA 2KISA 2H8WA 1KU7A 1JTYA 2QLZA 4BAYA 1W7PB 3FXOA 1BI1A 2ZKZA 3QQAA 2A5WA 2D1VA 3H1CA 1QHGA 5GPCA 1TLHB 2WAEA 1XDUA 3FM3A 4MNUA 2VL8A 1IZ1A 2LTPA 5M3FJ 1YIJI 1ZK8A 4IVNA 1AA7A 4ZC3A 3GFMA 1JKPC 1KONA 2HPMA 2F6CA 1K61A 3H3UA 4A0YA 3GW2A 4XICA 2KIMA 4A3FJ 3RKYA
chains in the Genus database with same CATH topology
1HW5A 3IKVA 3RTRA 3F8CA 4FT8A 1LEAA 2DQLA 3WGGA 2VONA 4HV6A 1YIOA 2YPRA 3MWMA 1PP7U 2EJRA 2ZMEB 3U1DA 4XSXF 2HQRA 4CO8A 3K1NA 4FHTA 2LSOA 4EMSA 5DEQA 4LB6B 4P96A 3FXRA 3COAC 4HW0A 2YR2A 3DV8A 2P5KA 4UNOA 1FLIA 4XBFA 3BPXA 3CO7C 2EV6A 1Z6RA 3V7SA 2L02A 1R58A 4I02A 2V1DA 4WK8F 4A0ZA 5AIQA 4BHPA 3CTAA 3FXUA 2M8EA 2EV0A 4LG0B 1WKMA 1SD6A 3GXOA 4EM1A 4EV0A 1IRFA 2EA4A 3V7CA 2GA2A 4PGHA 2VN2A 3J7AO 4LD5A 1GXQA 5EEGA 4ZZLA 1ZAOA 4N0BA 1XSVA 1CGPA 3HRTA 2L4AA 2ZBKA 1ONVA 2DPDA 1IRGA 3B02A 5IT9K 4L9TA 3FXQA 3TOBA 1ZG3A 3GZ5A 4A6EA 3EYIA 3LA7A 2P8TA 3M1EA 4UUVA 2IRFG 4A6DA 3ZMTA 1R1UA 2H94A 1E17A 4IPAA 3DKWA 3C3WA 1S3JA 2DO7A 4AIKA 1RUNA 3WTSC 2EFNA 3ML6A 3QRFF 1GVJA 2A07F 5BS6A 4HYEA 3O2PE 3LA2A 4E70A 3C1DA 3Q9SA 1IAWA 2QWWA 1LEBA 1OYWA 2NNYA 1JE8A 3SXYA 2XAFA 3U2RA 1PP8F 5KK1A 1TW2A 1FPQA 3HSEA 4P9FA 2XASA 2H27A 3PFIA 4F7ZA 3I5UA 3HTSB 1X3UA 3IKTA 2W24A 1J75A 4BQAA 3BP8A 2NNNA 1KQ0A 5FLXZ 4KIGA 2P4WA 2A6HF 2ACJA 1G3SA 2JPBA 2GXBA 1KQ9A 1B9NA 2P5VA 1OYYA 4A2UA 2KJBA 2XVCA 1SFXA 3GVAA 4HQEA 1IW7F 3E5UA 2LKPA 2OD5A 3ZN1A 2CGPA 3BZ6A 1OMIA 2VOPA 3QP6A 3GYHX 2FRHA 4IJAA 4BHBA 2Z9OA 4G94A 2FNPA 1Z91A 4HX4A 2Y75A 2FSWA 1K7AA 5LHGA 3WTXC 4M72A 5E18F 1LJ9A 3T8TA 4CGZA 5CYVA 1U8RA 2DPUA 4HBLA 1DUXC 4A12A 5CLSA 3ZQ7A 1UHWA 3NQOA 1ZLJA 4JK1X 1G4DA 2V9VA 3CUQB 2UWMA 2HEOA 5BOXA 4I7HA 5K5RA 2HQNA 2Q8KA 3IHUA 4CHUA 1FBQA 4MEYF 3VOEA 1U2WA 5LHIA 2FE3A 2PG4A 3KP3A 5FO5A 3LFKA 1FNNA 2P7CB 1FWZA 4Y17A 2J5OA 2Z3YA 3H92A 1REPC 3IWZA 5LGTA 4PCQA 4KN4X 4UV8A 3HOSA 3MEXA 1G3TA 2ELHA 1BIAA 2O8XA 5FB2A 2ZO4A 4LMYA 2HKOA 3SZTA 4D0PA 4DQ2A 3O6BB 2RVCA 3E97A 2BV6A 1HXDA 5HDKA 2L3DA 1T39A 1Z7UA 5FFZA 3VODA 3SQNA 5D4SA 1MJ9A 2A68F 1HSJA 4U0VA 1TQPA 4RB1A 1UB9A 3J81Z 1O3TA 2V1UA 1D3YA 2ZCWA 1ZGAA 1XSXA 2JSCA 2A61A 4I0AA 4ZH4F 1WRJA 4RGSA 1XGOA 1KU3A 2VC0A 2FMLA 5ICEA 2FU4A 2XUBA 2HS5A 3R0AA 5LEKA 3V4GA 3KLOA 1IXCA 3TOAA 5D5WB 5L3BA 2HZTA 1TBXA 2MLKA 4MGRA 2H6CA 2CYYA 4P55A 4UVBA 3V8KA 1A04A 5L3DA 2D45A 1ZG1A 3P7NA 4OIQF 5BMZA 3CO6C 4KYWA 1R00A 2KJCA 1IXRC 1B1BA 2E7WA 3TQNA 5ERIA 2QENA 1SD5A 4WXCA 2VXZA 2PMUA 1H0MA 5JHUA 4IHTA 5BQTA 1LDDA 2CG4A 2L01A 4EVIA 2DBBA 3FM5A 4ENKA 3KEOA 3E3VA 1FZPB 1IN6A 3WG9A 1K78A 3C7JA 3EQLF 5JFRA 1CF7A 3V7RA 3K1MA 4LB5A 2NAZA 4RB0A 2L54A 3IWFA 1YW8A 1EH7A 3I58A 3F22A 1SMYF 2XHKA 1F1ZA 2WWYA 1PUEE 2NS0A 3F8NA 1RUOA 1IUYA 1IN5A 3E6BA 1TTYA 5CVIA 2E1CA 2HWVA 3M8EA 1KYZA 3ZMVA 1FP1D 4EJWA 3RYRA 1O57A 4N9IA 1QNTA 2M45A 2OA4A 4IRGA 4RB3C 5JR3A 4Q5SF 4JBAA 2F5EA 4P5OA 4LK1F 4CICA 2MA3A 4MQ9F 1W4MA 2MLGA 1QGPA 2YX7A 4O5VA 2AXLA 3GWZA 4GXOA 1F4KA 1DP7P 1ZG5A 1KA8A 2PJPA 1ZYRF 1T6SA 4BHCA 1B4AA 3GLXA 1LQ1A 1IN4A 4I01A 1CF7B 3HRSA 5ILSA 2VE9A 4HF1A 3L7WA 1J9IA 4HZFA 3F6OA 3TKYA 4IF4A 2FMYA 3KP5A 3MAJA 3M9AA 4ZZDA 2ZMEA 1HSTA 3EUHA 4OINF 1G3WA 2Z99A 3BY6A 2STTA 3JSOA 2G7UA 1FSEA 2COMA 2HTJA 2R7FA 5ICGA 1F9NA 3CLOA 1BN5A 2XV4S 3KZYA 4Z2YA 3J80K 3GEZA 2A3SA 3L9FA 4OOIA 3LQRA 1SD4A 4ASNA 1S29A 4ZYEA 1YW9A 4G9YA 3R4KA 4KNYA 4MTDA 3BJAA 2ZXJA 2V6CA 3K1PA 3ROUA 4HAMA 5FD5A 3T1BA 3MCZA 4HF0A 2XAQA 1QPMA 4LGWA 1Z6TA 1NHAA 2CSOA 1R22A 5F6FA 2A6EF 2O03A 3CJNA 2CO5A 1B59A 2VT3A 3JSPA 4GCVA 3CUQC 4U0WA 3RKWA 5IT9Z 1BM9A 5LGUA 2OAZA 2YSRA 5ICFA 4HDVA 2NRAC 1FYKA 1WQ2A 1Z1DA 3S2WA 2HDCA 2EK5A 2BYVE 4ENJA 5HOOA 3ZMUA 3ZN0A 1UFMA 2XAJA 1XCVA 4LK0F 3ZMDA 4BYYA 1U6GA 1ON1A 1MJAA 5BPDA 1W5SA 1C0WA 1G6NA 3TGNA 2P5LC 3RPQA 5DCMB 4L5JA 1DPRA 1WI9A 1P2FA 2H09A 5E1WA 4HF2A 4P9UA 3F8BA 4UVAA 1RNLA 5A2QK 3GFIA 3L2CA 2YX4A 5D8LB 3T0YA 3F3XA 3P9KA 2O61A 5E20A 4PDKA 1J2XA 3QPHA 4BXUA 1KQ8A 2VC1A 2GXGA 3KEQA 1FT9A 3L00A 3PQKA 1FBUA 1HKSA 5DYMA 3HUGA 2QYOA 1Z9CA 1YQAA 2Y0MA 4L9VA 4DNCA 2IJLA 1H9GA 1R1VA 3GF2A 4YG2F 1OPCA 3GZ6A 2EV5A 3VB2A 3D5LA 5EEHA 4MHGA 2J5PA 3I53A 2R7DA 4KIFA 1IXSB 2DTRA 2RQPA 4KN7X 1O3QA 2VBYA 3ULQB 2ESHA 2X4HA 5AIPA 3VFZA 4HA8A 5K5QA 2IA1A 4MTEA 5E17F 3DF8A 3RIRA 5LLQA 6PAXA 4I0BA 4O6JA 4A5MA 2TDXA 3ISPA 1P4WA 3JAMZ 2HOEA 3KETA 4L18B 4HX7A 2STWA 5HLGA 4N9HA 1HBXG 3CUQA 5L3CA 3JTGA 2PQ8A 3V8JA 3KFWX 3H3ZA 3L09A 1J5YA 2GIVA 2VBZA 2A5YB 5FD6A 1LDKB 4EJTA 3K9TA 1TQMA 1ZRDA 2VT2A 3QOPA 4WWCA 3EDPA 2ISYA 3LQQA 2JTVA 3EYYA 1U3EM 2R3SA 2KIFA 3AAFA 5D8KB 1YO5C 3NEUA 4ENMA 4UXNA 2FXAA 2V79A 2LF8A 3DP7A 3REOA 3K2ZA 3FHZA 3QPTA 1MJBA 4RS8A 2EA2A 2EFQA 3I4PA 3I59B 4L0ZB 2X0LA 3WTYC 4H0EA 2O0YA 5L3FA 3R61A 5ICCA 3DFGA 2HYGD 2IA2A 3K0LA 3HRMA 5HLHA 3HTUA 1R5HA 2OU2A 2ETHA 2UXXA 1QQIA 4EM0B 3LSTA 3LAPA 1F5TA 4R8HA 2BGCA 3MZYA 5HVQC 1JXSA 4HLXA 2HKXA 4G7ZF 2XAGA 2GZWA 2RC4A 3I0TA 4A5NA 4KMFA 2ISZA 1G3YA 4HOBA 3KLNA 2RGVA 1L3LA 4M9SA 1LB2A 2OZ6A 3G3ZA 2M1BA 3DEUA 2K7LA 3U9GA 1D8JA 2DI3A 2RN7A 1O7FA 4TV7A 2Z33A 2QQAA 3E6DA 2E1NA 5H6QA 3FWEA 3GFLA 1Y0UA 2HFHA 1B9MA 2XAHA 2GA1A 2VODA 1QZYA 2IP2A 1OR7A 4QLCU 1XDSA 3F21A 1Q1HA 1YW7A 3RKXA 3WE3A 3CDHA 5CJ9A 1W5TA 1XGSA 4LLGF 1P92A 2FBHA 1OKRA 2JRTA 5L3GA 4OIRF 4BNCA 5ILVA 2XIGA 3B73A 3ELKA 1XB4A 1T0FA 2FBKA 3WODF 2P7VB 4AD9A 1HW1A 1BOAA 3PQJA 3BWGA 3ECHA 2A69F 3HOTA 2JPCA 2PI0A 2WC2A 2DT5A 4R1HA 4GO1A 3TO6A 1XMKA 1U78A 4PGGA 4LLNA 4RGXA 1TNTA 1LDJA 3DPLC 3JTHA 4YFXF 2HR3A 2UZKA 3IL2A 2QM3A 5J6XA 4NHJA 2ZJ2A 4G8XA 3F72A 5F1RA 2JZYA 2F5FA 1RIOH 2EB7A 2DK8A 3I64A 3RJPA 5ILUA 2QBYA 1BJAA 2ESNA 3ERED 3FX3A 1JHFA 3WGHA 4RAZA 2XKPA 2ADUA 5TRDA 2MBFA 1WWXA 4HLYA 1YG2A 5CVUA 2C6YA 2MC3A 1IN8A 1J0RA 2PBIA 5E8IA 4I2OA 4FX4A 1E2XA 3ABUA 4XRFA 3MZHA 5DD8A 2KRFA 2FNAA 1IN7A 4OU0A 5K1YA 1USSA 1HKQA 3E5QA 3KP6A 2ZFWA 3OV8A 3FZVA 3ZMZA 3WTUC 3M7GA 4L9NA 4IHSA 1MKMA 2BE5F 2W25A 4Q47A 3QP5A 1U5TA 5D5VB 5LBQA 1PDNC 4HDUA 3HIFA 1TQIA 4MQVA 2QBYB 1KU9A 4LJZF 4GGGA 3FMRA 3GO5A 4IRHA 5KVRA 2GWRA 1BC8C 1ZH5A 4ESJA 2XKOA 2CFXA 1Z05A 3IRRA 1DPUA 2DK5A 2W57A 5LHHA 1R5GA 2IW5A 4Y15A 4L5IA 3VEPA 3E5XA 4S04A 1S6LA 2EWNA 5DUIA 1K79A 2FEZA 3ABTA 3HRUA 4UHTA 1BI2A 1ZHFA 1ULYA 1KGSA 5AONA 2IPQX 1STZA 2L4MA 1MZBA 4OMZA 3W6KB 5H6RA 4M73A 5IT3A 4S05A 3HSFA 4CYDA 3MQ0A 4ETSA 1P6RA 1U5TB 2HGCA 4AIHA 4WXHA 3FF5A 3RDIA 2OQGA 2PN6A 3R60A 5DCMA 3IRQA 1H9TA 2HTSA 1O3SA 4XLPF 4AWXB 2W85A 2MD5A 5CVVA 3R0JA 3BROA 1T38A 2PMHA 5LGNA 4CZZA 4HX8A 4B09A 2WTEA 3WE2A 2F2EA 5A2QZ 4XLNF 4KUMA 1QZZA 1YTYA 1BBYA 4L0YB 1R7JA 1DDNA 5JI6A 4LFUA 3Q5FA 3WU0A 3LWFA 1B6AA 3TO9A 2RNJA 1J59A 3E6MA 3WU1B 5HDNA 2DQRA 2EFPA 1KYWA 5JVTA 3F6VA 5K5OA 2K4JA 5DD4A 3HHGA 1XN7A 2BEOA 2Q0OA 1BI0A 5E8GA 3SFZA 3WGIA 1LVAA 3G73A 4RAYA 4U0YA 1KU2A 3F8MA 3F23A 2P6TA 1D5VA 3BJOA 5HS7A 2OBPA 3C18A 4EM2A 5DDGA 1MDMB 5HS8A 4QWQA 3RPUA 2OZUA 4FX0A 1QO0D 2Z5UA 3OOPA 2V1XA 2QQBA 3ZP5A 3BOQA 2IT0A 4HV5A 1BI3A 1S7OA 1YS6A 2BBYA 4AVPA 1WSUA 1UCRA 1FX7A 2VOOA 4EJVA 1R23A 1FYLA 1ZLKA 4UVCA 2PFBA 2IA0A 1YFHA 4G7HF 1ZREA 2LDUA 3W6JB 5E1XA 1I1GA 5TJJA 3SZPA 1J7KA 4G6QA 2GQQA 1S7AA 3LAJA 2MH2A 2UXNA 2YU3A 3WTVC 1HQCA 3I59A 4EJOA 1SFEA 1RZ4A 5BPIA 1O7LA 5D6FA 4M9ZA 3GX4X 1W7PD 2CQKA 4I98B 3K69A 2FQ3A 3EETA 4YFNF 3BPVA 5DUKA 3MFKA 2FF4A 4I09A 1T98A 2QQ9A 3KE2A 2QVOA 3KP4A 3ZMSA 3GFJA 5CVRA 3P9CA 4OMYA 3T8RA 2RV8A 2K86A 4EQQA 1O3RA 2LNBA 3T5XA 5D5XB 2B0LA 4R79A 4BH9A 3TDZC 5E1ZB 1I27A 3HHHA 4ZYGA 3KCCA 2K27A 1FY7A 4KICA 2DW4A 1I1SA 5LEJA 2JT1A 4OIOF 2VE8A 2M5WA 2RKHA 1AOYA 4XSZF 1MD0A 4CDGA 4U7BA 2D2WA 4YIFA 4WCGA 5DV5A 2FBIA 3HYIA 1XD7A 2NYXA 3WTTC 2P6SA 2KIUA 3JAMK 2QZ8A 3FMSA 1RI7A 5FGMA 4M71A 1AWCA 5LRSA 5J8CA 4AIJA 5HDGA 2CWEA 4ESBA 3WTZA 1ZRCA 5HS9A 3HSRA 5FLXK 4G6DA 1JGSA 2MH9A 1ZGJA 1R36A 4K2EA 4KMUX 2O3FA 3BJ6A 4Q48A 1L0OC 4PZJA 1FOKA 1FSHA 3D0SA 4ESFA 5J8FA 4RB2C 3SHFA 2ZNYA 2K4BA 1U5TC 2H6BA 5FFXA 2E7XA 4YIIA 4Y13A 1EV7A 1SAXA 3QAHA 2HYFA 4IRIA 3IC7A 3V8LA 1S8NA 1P4AA 2QUFA 3DPTA 2W84A 1VTNC 4WX9A 5D4RA 2XRNA 5LRRA 3KP2A 4CXFA 1FC3A 4JQFA 4HQMA 4KFCA 2G7HA 4KIBA 3LA3A 1EH6A 3Q9VA 1TW3A 4B8XA 1V4RA 3ZPLA 5DCFA 3M8FA 2DU9A 2FA5A 1XCBA 4IXAA 2F5CA 5F64A 5D5UB 4L9JA 4GYIA 1GXPA 4NQWA 2WV0A 1EH8A 4WF2A 3WTWC 2XGXA 2AS5F 2DFIA 2DAOA 1ODDA 2EFOA 2GAUA 4KDPA 1SD7A 1FBSA 4U7DA 1FYMA 5CVJA 2KKOA 1ZN2A 2PLYA 3BDDA 4M74A 3JW4A 1XSDA 1HW2A 1K6OA 2PEXA 5HLIA 1JHHA 2G9WA 3J81K 1SFUA 4UV9A 2K02A 2F5DA 2XROA 2OQRA 2CW0F 4KT5C 2M87A 3DXJF 3QU3A 1USTA 4ZYDA 3F8FA 1I5ZA 1XGMA 1YYVA 4GYGA 4ZYHA 3J80Z 2Q2EA 4U88A 3ECOA 3RYPA 1T2KA 1ZRFA 3FMQA 1ZARA 2RDPA 3TDUC 2VBWA 5ED4A 2M30A 4NB5A 1TNSA 4RGRA 1FP2A 1I6XA 4O3MA 3I54A 4RGUA 3TO7A 1IF1A 3O3KA 3P9IA 3I71A 1W7PA 4YFKF 3QU6A 4KA4A 4G7OF 4ENNA 4Q4ZF 2EFWA 3NRVA 2ZNZA 3DQVC 5D6EA 2D1HA 5H20A 2LF7A 2DLLA 1V3FA 1SMTA 4A0XA 1MGTA 2FOKA 1ON2A 4MEXF 1YLFA 1BIBA 3KP7A 2VBXA 3KZZA 1K78B 3RI4A 1D8KA 4OIPF 1GHCA 2O6GE 4M6YA 1R1TA 3CUOA 1UHMA 3N4MA 4M6XA 2IVMA 1XMAA 1LNWA 4ON0A 5L3EA 1XGNA 4LLLA 4M9XA 4EJUA 1QBJA 1BC7C 3R6SA 3E6CC 1HKTA 4WXDA 1OYIA 1P4XA 2Y48A 4EGYA 1MDMA 3N97A 1YS7A 3GUDA 4EGZA 4LG0A 1KU7A 2QLZA 4BAYA 1W7PB 1BI1A 2ZKZA 2D1VA 1TLHB 1XDUA 3FM3A 4MNUA 1IZ1A 4IVNA 3GFMA 3H3UA 4A0YA 3GW2A 2KIMA 3RKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HW5 A;  3IKV A;  3RTR A;  3F8C A;  4FT8 A;  1LEA A;  2DQL A;  3WGG A;  2VON A;  4HV6 A;  1YIO A;  2YPR A;  3MWM A;  1PP7 U;  2EJR A;  2ZME B;  3U1D A;  4XSX F;  2HQR A;  4CO8 A;  3K1N A;  4FHT A;  2LSO A;  4EMS A;  5DEQ A;  4LB6 B;  4P96 A;  3FXR A;  3COA C;  4HW0 A;  2YR2 A;  3DV8 A;  2P5K A;  4UNO A;  1FLI A;  4XBF A;  3BPX A;  3CO7 C;  2EV6 A;  1Z6R A;  3V7S A;  2L02 A;  1R58 A;  4I02 A;  2V1D A;  4WK8 F;  4A0Z A;  5AIQ A;  4BHP A;  3CTA A;  3FXU A;  2M8E A;  2EV0 A;  4LG0 B;  1WKM A;  1SD6 A;  3GXO A;  4EM1 A;  4EV0 A;  1IRF A;  2EA4 A;  3V7C A;  2GA2 A;  4PGH A;  2VN2 A;  3J7A O;  4LD5 A;  1GXQ A;  5EEG A;  4ZZL A;  1ZAO A;  4N0B A;  1XSV A;  1CGP A;  3HRT A;  2L4A A;  2ZBK A;  1ONV A;  2DPD A;  1IRG A;  3B02 A;  5IT9 K;  4L9T A;  3FXQ A;  3TOB A;  1ZG3 A;  3GZ5 A;  4A6E A;  3EYI A;  3LA7 A;  2P8T A;  3M1E A;  4UUV A;  2IRF G;  4A6D A;  3ZMT A;  1R1U A;  2H94 A;  1E17 A;  4IPA A;  3DKW A;  3C3W A;  1S3J A;  2DO7 A;  4AIK A;  1RUN A;  3WTS C;  2EFN A;  3ML6 A;  3QRF F;  1GVJ A;  2A07 F;  5BS6 A;  4HYE A;  3O2P E;  3LA2 A;  4E70 A;  3C1D A;  3Q9S A;  1IAW A;  2QWW A;  1LEB A;  1OYW A;  2NNY A;  1JE8 A;  3SXY A;  2XAF A;  3U2R A;  1PP8 F;  5KK1 A;  1TW2 A;  1FPQ A;  3HSE A;  4P9F A;  2XAS A;  2H27 A;  3PFI A;  4F7Z A;  3I5U A;  3HTS B;  1X3U A;  3IKT A;  2W24 A;  1J75 A;  4BQA A;  3BP8 A;  2NNN A;  1KQ0 A;  5FLX Z;  4KIG A;  2P4W A;  2A6H F;  2ACJ A;  1G3S A;  2JPB A;  2GXB A;  1KQ9 A;  1B9N A;  2P5V A;  1OYY A;  4A2U A;  2KJB A;  2XVC A;  1SFX A;  3GVA A;  4HQE A;  1IW7 F;  3E5U A;  2LKP A;  2OD5 A;  3ZN1 A;  2CGP A;  3BZ6 A;  1OMI A;  2VOP A;  3QP6 A;  3GYH X;  2FRH A;  4IJA A;  4BHB A;  2Z9O A;  4G94 A;  2FNP A;  1Z91 A;  4HX4 A;  2Y75 A;  2FSW A;  1K7A A;  5LHG A;  3WTX C;  4M72 A;  5E18 F;  1LJ9 A;  3T8T A;  4CGZ A;  5CYV A;  1U8R A;  2DPU A;  4HBL A;  1DUX C;  4A12 A;  5CLS A;  3ZQ7 A;  1UHW A;  3NQO A;  1ZLJ A;  4JK1 X;  1G4D A;  2V9V A;  3CUQ B;  2UWM A;  2HEO A;  5BOX A;  4I7H A;  5K5R A;  2HQN A;  2Q8K A;  3IHU A;  4CHU A;  1FBQ A;  4MEY F;  3VOE A;  1U2W A;  5LHI A;  2FE3 A;  2PG4 A;  3KP3 A;  5FO5 A;  3LFK A;  1FNN A;  2P7C B;  1FWZ A;  4Y17 A;  2J5O A;  2Z3Y A;  3H92 A;  1REP C;  3IWZ A;  5LGT A;  4PCQ A;  4KN4 X;  4UV8 A;  3HOS A;  3MEX A;  1G3T A;  2ELH A;  1BIA A;  2O8X A;  5FB2 A;  2ZO4 A;  4LMY A;  2HKO A;  3SZT A;  4D0P A;  4DQ2 A;  3O6B B;  2RVC A;  3E97 A;  2BV6 A;  1HXD A;  5HDK A;  2L3D A;  1T39 A;  1Z7U A;  5FFZ A;  3VOD A;  3SQN A;  5D4S A;  1MJ9 A;  2A68 F;  1HSJ A;  4U0V A;  1TQP A;  4RB1 A;  1UB9 A;  3J81 Z;  1O3T A;  2V1U A;  1D3Y A;  2ZCW A;  1ZGA A;  1XSX A;  2JSC A;  2A61 A;  4I0A A;  4ZH4 F;  1WRJ A;  4RGS A;  1XGO A;  1KU3 A;  2VC0 A;  2FML A;  5ICE A;  2FU4 A;  2XUB A;  2HS5 A;  3R0A A;  5LEK A;  3V4G A;  3KLO A;  1IXC A;  3TOA A;  5D5W B;  5L3B A;  2HZT A;  1TBX A;  2MLK A;  4MGR A;  2H6C A;  2CYY A;  4P55 A;  4UVB A;  3V8K A;  1A04 A;  5L3D A;  2D45 A;  1ZG1 A;  3P7N A;  4OIQ F;  5BMZ A;  3CO6 C;  4KYW A;  1R00 A;  2KJC A;  1IXR C;  1B1B A;  2E7W A;  3TQN A;  5ERI A;  2QEN A;  1SD5 A;  4WXC A;  2VXZ A;  2PMU A;  1H0M A;  5JHU A;  4IHT A;  5BQT A;  1LDD A;  2CG4 A;  2L01 A;  4EVI A;  2DBB A;  3FM5 A;  4ENK A;  3KEO A;  3E3V A;  1FZP B;  1IN6 A;  3WG9 A;  1K78 A;  3C7J A;  3EQL F;  5JFR A;  1CF7 A;  3V7R A;  3K1M A;  4LB5 A;  2NAZ A;  4RB0 A;  2L54 A;  3IWF A;  1YW8 A;  1EH7 A;  3I58 A;  3F22 A;  1SMY F;  2XHK A;  1F1Z A;  2WWY A;  1PUE E;  2NS0 A;  3F8N A;  1RUO A;  1IUY A;  1IN5 A;  3E6B A;  1TTY A;  5CVI A;  2E1C A;  2HWV A;  3M8E A;  1KYZ A;  3ZMV A;  1FP1 D;  4EJW A;  3RYR A;  1O57 A;  4N9I A;  1QNT A;  2M45 A;  2OA4 A;  4IRG A;  4RB3 C;  5JR3 A;  4Q5S F;  4JBA A;  2F5E A;  4P5O A;  4LK1 F;  4CIC A;  2MA3 A;  4MQ9 F;  1W4M A;  2MLG A;  1QGP A;  2YX7 A;  4O5V A;  2AXL A;  3GWZ A;  4GXO A;  1F4K A;  1DP7 P;  1ZG5 A;  1KA8 A;  2PJP A;  1ZYR F;  1T6S A;  4BHC A;  1B4A A;  3GLX A;  1LQ1 A;  1IN4 A;  4I01 A;  1CF7 B;  3HRS A;  5ILS A;  2VE9 A;  4HF1 A;  3L7W A;  1J9I A;  4HZF A;  3F6O A;  3TKY A;  4IF4 A;  2FMY A;  3KP5 A;  3MAJ A;  3M9A A;  4ZZD A;  2ZME A;  1HST A;  3EUH A;  4OIN F;  1G3W A;  2Z99 A;  3BY6 A;  2STT A;  3JSO A;  2G7U A;  1FSE A;  2COM A;  2HTJ A;  2R7F A;  5ICG A;  1F9N A;  3CLO A;  1BN5 A;  2XV4 S;  3KZY A;  4Z2Y A;  3J80 K;  3GEZ A;  2A3S A;  3L9F A;  4OOI A;  3LQR A;  1SD4 A;  4ASN A;  1S29 A;  4ZYE A;  1YW9 A;  4G9Y A;  3R4K A;  4KNY A;  4MTD A;  3BJA A;  2ZXJ A;  2V6C A;  3K1P A;  3ROU A;  4HAM A;  5FD5 A;  3T1B A;  3MCZ A;  4HF0 A;  2XAQ A;  1QPM A;  4LGW A;  1Z6T A;  1NHA A;  2CSO A;  1R22 A;  5F6F A;  2A6E F;  2O03 A;  3CJN A;  2CO5 A;  1B59 A;  2VT3 A;  3JSP A;  4GCV A;  3CUQ C;  4U0W A;  3RKW A;  5IT9 Z;  1BM9 A;  5LGU A;  2OAZ A;  2YSR A;  5ICF A;  4HDV A;  2NRA C;  1FYK A;  1WQ2 A;  1Z1D A;  3S2W A;  2HDC A;  2EK5 A;  2BYV E;  4ENJ A;  5HOO A;  3ZMU A;  3ZN0 A;  1UFM A;  2XAJ A;  1XCV A;  4LK0 F;  3ZMD A;  4BYY A;  1U6G A;  1ON1 A;  1MJA A;  5BPD A;  1W5S A;  1C0W A;  1G6N A;  3TGN A;  2P5L C;  3RPQ A;  5DCM B;  4L5J A;  1DPR A;  1WI9 A;  1P2F A;  2H09 A;  5E1W A;  4HF2 A;  4P9U A;  3F8B A;  4UVA A;  1RNL A;  5A2Q K;  3GFI A;  3L2C A;  2YX4 A;  5D8L B;  3T0Y A;  3F3X A;  3P9K A;  2O61 A;  5E20 A;  4PDK A;  1J2X A;  3QPH A;  4BXU A;  1KQ8 A;  2VC1 A;  2GXG A;  3KEQ A;  1FT9 A;  3L00 A;  3PQK A;  1FBU A;  1HKS A;  5DYM A;  3HUG A;  2QYO A;  1Z9C A;  1YQA A;  2Y0M A;  4L9V A;  4DNC A;  2IJL A;  1H9G A;  1R1V A;  3GF2 A;  4YG2 F;  1OPC A;  3GZ6 A;  2EV5 A;  3VB2 A;  3D5L A;  5EEH A;  4MHG A;  2J5P A;  3I53 A;  2R7D A;  4KIF A;  1IXS B;  2DTR A;  2RQP A;  4KN7 X;  1O3Q A;  2VBY A;  3ULQ B;  2ESH A;  2X4H A;  5AIP A;  3VFZ A;  4HA8 A;  5K5Q A;  2IA1 A;  4MTE A;  5E17 F;  3DF8 A;  3RIR A;  5LLQ A;  6PAX A;  4I0B A;  4O6J A;  4A5M A;  2TDX A;  3ISP A;  1P4W A;  3JAM Z;  2HOE A;  3KET A;  4L18 B;  4HX7 A;  2STW A;  5HLG A;  4N9H A;  1HBX G;  3CUQ A;  5L3C A;  3JTG A;  2PQ8 A;  3V8J A;  3KFW X;  3H3Z A;  3L09 A;  1J5Y A;  2GIV A;  2VBZ A;  2A5Y B;  5FD6 A;  1LDK B;  4EJT A;  3K9T A;  1TQM A;  1ZRD A;  2VT2 A;  3QOP A;  4WWC A;  3EDP A;  2ISY A;  3LQQ A;  2JTV A;  3EYY A;  1U3E M;  2R3S A;  2KIF A;  3AAF A;  5D8K B;  1YO5 C;  3NEU A;  4ENM A;  4UXN A;  2FXA A;  2V79 A;  2LF8 A;  3DP7 A;  3REO A;  3K2Z A;  3FHZ A;  3QPT A;  1MJB A;  4RS8 A;  2EA2 A;  2EFQ A;  3I4P A;  3I59 B;  4L0Z B;  2X0L A;  3WTY C;  4H0E A;  2O0Y A;  5L3F A;  3R61 A;  5ICC A;  3DFG A;  2HYG D;  2IA2 A;  3K0L A;  3HRM A;  5HLH A;  3HTU A;  1R5H A;  2OU2 A;  2ETH A;  2UXX A;  1QQI A;  4EM0 B;  3LST A;  3LAP A;  1F5T A;  4R8H A;  2BGC A;  3MZY A;  5HVQ C;  1JXS A;  4HLX A;  2HKX A;  4G7Z F;  2XAG A;  2GZW A;  2RC4 A;  3I0T A;  4A5N A;  4KMF A;  2ISZ A;  1G3Y A;  4HOB A;  3KLN A;  2RGV A;  1L3L A;  4M9S A;  1LB2 A;  2OZ6 A;  3G3Z A;  2M1B A;  3DEU A;  2K7L A;  3U9G A;  1D8J A;  2DI3 A;  2RN7 A;  1O7F A;  4TV7 A;  2Z33 A;  2QQA A;  3E6D A;  2E1N A;  5H6Q A;  3FWE A;  3GFL A;  1Y0U A;  2HFH A;  1B9M A;  2XAH A;  2GA1 A;  2VOD A;  1QZY A;  2IP2 A;  1OR7 A;  4QLC U;  1XDS A;  3F21 A;  1Q1H A;  1YW7 A;  3RKX A;  3WE3 A;  3CDH A;  5CJ9 A;  1W5T A;  1XGS A;  4LLG F;  1P92 A;  2FBH A;  1OKR A;  2JRT A;  5L3G A;  4OIR F;  4BNC A;  5ILV A;  2XIG A;  3B73 A;  3ELK A;  1XB4 A;  1T0F A;  2FBK A;  3WOD F;  2P7V B;  4AD9 A;  1HW1 A;  1BOA A;  3PQJ A;  3BWG A;  3ECH A;  2A69 F;  3HOT A;  2JPC A;  2PI0 A;  2WC2 A;  2DT5 A;  4R1H A;  4GO1 A;  3TO6 A;  1XMK A;  1U78 A;  4PGG A;  4LLN A;  4RGX A;  1TNT A;  1LDJ A;  3DPL C;  3JTH A;  4YFX F;  2HR3 A;  2UZK A;  3IL2 A;  2QM3 A;  5J6X A;  4NHJ A;  2ZJ2 A;  4G8X A;  3F72 A;  5F1R A;  2JZY A;  2F5F A;  1RIO H;  2EB7 A;  2DK8 A;  3I64 A;  3RJP A;  5ILU A;  2QBY A;  1BJA A;  2ESN A;  3ERE D;  3FX3 A;  1JHF A;  3WGH A;  4RAZ A;  2XKP A;  2ADU A;  5TRD A;  2MBF A;  1WWX A;  4HLY A;  1YG2 A;  5CVU A;  2C6Y A;  2MC3 A;  1IN8 A;  1J0R A;  2PBI A;  5E8I A;  4I2O A;  4FX4 A;  1E2X A;  3ABU A;  4XRF A;  3MZH A;  5DD8 A;  2KRF A;  2FNA A;  1IN7 A;  4OU0 A;  5K1Y A;  1USS A;  1HKQ A;  3E5Q A;  3KP6 A;  2ZFW A;  3OV8 A;  3FZV A;  3ZMZ A;  3WTU C;  3M7G A;  4L9N A;  4IHS A;  1MKM A;  2BE5 F;  2W25 A;  4Q47 A;  3QP5 A;  1U5T A;  5D5V B;  5LBQ A;  1PDN C;  4HDU A;  3HIF A;  1TQI A;  4MQV A;  2QBY B;  1KU9 A;  4LJZ F;  4GGG A;  3FMR A;  3GO5 A;  4IRH A;  5KVR A;  2GWR A;  1BC8 C;  1ZH5 A;  4ESJ A;  2XKO A;  2CFX A;  1Z05 A;  3IRR A;  1DPU A;  2DK5 A;  2W57 A;  5LHH A;  1R5G A;  2IW5 A;  4Y15 A;  4L5I A;  3VEP A;  3E5X A;  4S04 A;  1S6L A;  2EWN A;  5DUI A;  1K79 A;  2FEZ A;  3ABT A;  3HRU A;  4UHT A;  1BI2 A;  1ZHF A;  1ULY A;  1KGS A;  5AON A;  2IPQ X;  1STZ A;  2L4M A;  1MZB A;  4OMZ A;  3W6K B;  5H6R A;  4M73 A;  5IT3 A;  4S05 A;  3HSF A;  4CYD A;  3MQ0 A;  4ETS A;  1P6R A;  1U5T B;  2HGC A;  4AIH A;  4WXH A;  3FF5 A;  3RDI A;  2OQG A;  2PN6 A;  3R60 A;  5DCM A;  3IRQ A;  1H9T A;  2HTS A;  1O3S A;  4XLP F;  4AWX B;  2W85 A;  2MD5 A;  5CVV A;  3R0J A;  3BRO A;  1T38 A;  2PMH A;  5LGN A;  4CZZ A;  4HX8 A;  4B09 A;  2WTE A;  3WE2 A;  2F2E A;  5A2Q Z;  4XLN F;  4KUM A;  1QZZ A;  1YTY A;  1BBY A;  4L0Y B;  1R7J A;  1DDN A;  5JI6 A;  4LFU A;  3Q5F A;  3WU0 A;  3LWF A;  1B6A A;  3TO9 A;  2RNJ A;  1J59 A;  3E6M A;  3WU1 B;  5HDN A;  2DQR A;  2EFP A;  1KYW A;  5JVT A;  3F6V A;  5K5O A;  2K4J A;  5DD4 A;  3HHG A;  1XN7 A;  2BEO A;  2Q0O A;  1BI0 A;  5E8G A;  3SFZ A;  3WGI A;  1LVA A;  3G73 A;  4RAY A;  4U0Y A;  1KU2 A;  3F8M A;  3F23 A;  2P6T A;  1D5V A;  3BJO A;  5HS7 A;  2OBP A;  3C18 A;  4EM2 A;  5DDG A;  1MDM B;  5HS8 A;  4QWQ A;  3RPU A;  2OZU A;  4FX0 A;  1QO0 D;  2Z5U A;  3OOP A;  2V1X A;  2QQB A;  3ZP5 A;  3BOQ A;  2IT0 A;  4HV5 A;  1BI3 A;  1S7O A;  1YS6 A;  2BBY A;  4AVP A;  1WSU A;  1UCR A;  1FX7 A;  2VOO A;  4EJV A;  1R23 A;  1FYL A;  1ZLK A;  4UVC A;  2PFB A;  2IA0 A;  1YFH A;  4G7H F;  1ZRE A;  2LDU A;  3W6J B;  5E1X A;  1I1G A;  5TJJ A;  3SZP A;  1J7K A;  4G6Q A;  2GQQ A;  1S7A A;  3LAJ A;  2MH2 A;  2UXN A;  2YU3 A;  3WTV C;  1HQC A;  3I59 A;  4EJO A;  1SFE A;  1RZ4 A;  5BPI A;  1O7L A;  5D6F A;  4M9Z A;  3GX4 X;  1W7P D;  2CQK A;  4I98 B;  3K69 A;  2FQ3 A;  3EET A;  4YFN F;  3BPV A;  5DUK A;  3MFK A;  2FF4 A;  4I09 A;  1T98 A;  2QQ9 A;  3KE2 A;  2QVO A;  3KP4 A;  3ZMS A;  3GFJ A;  5CVR A;  3P9C A;  4OMY A;  3T8R A;  2RV8 A;  2K86 A;  4EQQ A;  1O3R A;  2LNB A;  3T5X A;  5D5X B;  2B0L A;  4R79 A;  4BH9 A;  3TDZ C;  5E1Z B;  1I27 A;  3HHH A;  4ZYG A;  3KCC A;  2K27 A;  1FY7 A;  4KIC A;  2DW4 A;  1I1S A;  5LEJ A;  2JT1 A;  4OIO F;  2VE8 A;  2M5W A;  2RKH A;  1AOY A;  4XSZ F;  1MD0 A;  4CDG A;  4U7B A;  2D2W A;  4YIF A;  4WCG A;  5DV5 A;  2FBI A;  3HYI A;  1XD7 A;  2NYX A;  3WTT C;  2P6S A;  2KIU A;  3JAM K;  2QZ8 A;  3FMS A;  1RI7 A;  5FGM A;  4M71 A;  1AWC A;  5LRS A;  5J8C A;  4AIJ A;  5HDG A;  2CWE A;  4ESB A;  3WTZ A;  1ZRC A;  5HS9 A;  3HSR A;  5FLX K;  4G6D A;  1JGS A;  2MH9 A;  1ZGJ A;  1R36 A;  4K2E A;  4KMU X;  2O3F A;  3BJ6 A;  4Q48 A;  1L0O C;  4PZJ A;  1FOK A;  1FSH A;  3D0S A;  4ESF A;  5J8F A;  4RB2 C;  3SHF A;  2ZNY A;  2K4B A;  1U5T C;  2H6B A;  5FFX A;  2E7X A;  4YII A;  4Y13 A;  1EV7 A;  1SAX A;  3QAH A;  2HYF A;  4IRI A;  3IC7 A;  3V8L A;  1S8N A;  1P4A A;  2QUF A;  3DPT A;  2W84 A;  1VTN C;  4WX9 A;  5D4R A;  2XRN A;  5LRR A;  3KP2 A;  4CXF A;  1FC3 A;  4JQF A;  4HQM A;  4KFC A;  2G7H A;  4KIB A;  3LA3 A;  1EH6 A;  3Q9V A;  1TW3 A;  4B8X A;  1V4R A;  3ZPL A;  5DCF A;  3M8F A;  2DU9 A;  2FA5 A;  1XCB A;  4IXA A;  2F5C A;  5F64 A;  5D5U B;  4L9J A;  4GYI A;  1GXP A;  4NQW A;  2WV0 A;  1EH8 A;  4WF2 A;  3WTW C;  2XGX A;  2AS5 F;  2DFI A;  2DAO A;  1ODD A;  2EFO A;  2GAU A;  4KDP A;  1SD7 A;  1FBS A;  4U7D A;  1FYM A;  5CVJ A;  2KKO A;  1ZN2 A;  2PLY A;  3BDD A;  4M74 A;  3JW4 A;  1XSD A;  1HW2 A;  1K6O A;  2PEX A;  5HLI A;  1JHH A;  2G9W A;  3J81 K;  1SFU A;  4UV9 A;  2K02 A;  2F5D A;  2XRO A;  2OQR A;  2CW0 F;  4KT5 C;  2M87 A;  3DXJ F;  3QU3 A;  1UST A;  4ZYD A;  3F8F A;  1I5Z A;  1XGM A;  1YYV A;  4GYG A;  4ZYH A;  3J80 Z;  2Q2E A;  4U88 A;  3ECO A;  3RYP A;  1T2K A;  1ZRF A;  3FMQ A;  1ZAR A;  2RDP A;  3TDU C;  2VBW A;  5ED4 A;  2M30 A;  4NB5 A;  1TNS A;  4RGR A;  1FP2 A;  1I6X A;  4O3M A;  3I54 A;  4RGU A;  3TO7 A;  1IF1 A;  3O3K A;  3P9I A;  3I71 A;  1W7P A;  4YFK F;  3QU6 A;  4KA4 A;  4G7O F;  4ENN A;  4Q4Z F;  2EFW A;  3NRV A;  2ZNZ A;  3DQV C;  5D6E A;  2D1H A;  5H20 A;  2LF7 A;  2DLL A;  1V3F A;  1SMT A;  4A0X A;  1MGT A;  2FOK A;  1ON2 A;  4MEX F;  1YLF A;  1BIB A;  3KP7 A;  2VBX A;  3KZZ A;  1K78 B;  3RI4 A;  1D8K A;  4OIP F;  1GHC A;  2O6G E;  4M6Y A;  1R1T A;  3CUO A;  1UHM A;  3N4M A;  4M6X A;  2IVM A;  1XMA A;  1LNW A;  4ON0 A;  5L3E A;  1XGN A;  4LLL A;  4M9X A;  4EJU A;  1QBJ A;  1BC7 C;  3R6S A;  3E6C C;  1HKT A;  4WXD A;  1OYI A;  1P4X A;  2Y48 A;  4EGY A;  1MDM A;  3N97 A;  1YS7 A;  3GUD A;  4EGZ A;  4LG0 A;  1KU7 A;  2QLZ A;  4BAY A;  1W7P B;  1BI1 A;  2ZKZ A;  2D1V A;  1TLH B;  1XDU A;  3FM3 A;  4MNU A;  1IZ1 A;  4IVN A;  3GFM A;  3H3U A;  4A0Y A;  3GW2 A;  2KIM A;  3RKY A; 
#chains in the Genus database with same CATH topology
 4BBR J;  1HW5 A;  3IKV A;  3B6C A;  2V7F A;  3RTR A;  3JRG A;  1UJ8 A;  3F8C A;  1LEA A;  2DQL A;  4FT8 A;  3WGG A;  3DCF A;  2VON A;  4HV6 A;  1YIO A;  2YPR A;  4E7L A;  3MWM A;  1PP7 U;  2EJR A;  3CCM I;  3FIS A;  2ZME B;  1B8I B;  3CC4 I;  3VWB A;  3U1D A;  3ABL H;  4XSX F;  5TIS C;  2HQR A;  2QSH X;  4CO8 A;  1W1W E;  1A36 A;  3Q0W A;  1TWG J;  2TCT A;  3K1N A;  4FHT A;  2LSO A;  4EMS A;  3BQY A;  3FXJ A;  4PJJ A;  2F48 A;  4BAC A;  5DEQ A;  4RMN A;  2CUZ A;  2Q1Z B;  3IP4 B;  4LB6 B;  4XRM A;  1I3A A;  4P96 A;  1H8A C;  3FXR A;  3COA C;  4HW0 A;  1HC8 A;  2YR2 A;  3OR2 C;  3DV8 A;  4MFE A;  2P5K A;  4BY7 J;  4UNO A;  1FLI A;  4XBF A;  3BPX A;  3CO7 C;  2EV6 A;  1Z6R A;  3V7S A;  3HKZ A;  2L02 A;  1R58 A;  4I02 A;  2V1D A;  4WK8 F;  4A0Z A;  5AIQ A;  4BHP A;  3CTA A;  3CCJ I;  3FXU A;  2M8E A;  2EV0 A;  4LG0 B;  3BG5 A;  4PFP A;  3W3C A;  1BL0 A;  2OV7 A;  3FK6 A;  1WKM A;  1SD6 A;  3GXO A;  3NWT A;  4DYR A;  3OOU A;  2F5V A;  4EM1 A;  4EV0 A;  1IRF A;  1X19 A;  2EA4 A;  3V7C A;  2EIN H;  2GA2 A;  4AM3 A;  2QGU A;  1X1D A;  3VSL A;  4BJ6 C;  1CQT A;  4PGH A;  2VQL A;  2VN2 A;  3J7A O;  5KCM A;  4LD5 A;  3ABM H;  1GXQ A;  4E6K G;  4M6V A;  3JRB A;  4OAY A;  5EEG A;  4ZZL A;  1ZAO A;  1JUM A;  4QSH A;  4N0B A;  2L7M P;  1XSV A;  1JJ8 C;  1CGP A;  3HRT A;  1IDY A;  2L4A A;  2ZBK A;  3HKZ N;  1NG7 A;  1ONV A;  2DPD A;  1IRG A;  3B02 A;  3AG2 H;  3SFI A;  5IT9 K;  2WA0 A;  4L9T A;  3FXQ A;  3HOV J;  3TOB A;  2OC6 A;  1ZG3 A;  1D0Z A;  3GZ5 A;  4ZDL A;  1DU6 A;  4A6E A;  3EYI A;  3LA7 A;  2X48 A;  4IZZ A;  2P8T A;  3M1E A;  4UUV A;  5EDN A;  3DPU A;  1MMD A;  2E34 A;  5DS9 A;  2IRF G;  3RQI A;  1X1C A;  1T33 A;  2R7Q A;  4A6D A;  4BBS J;  3L2Q A;  1WHU A;  3ZMT A;  2X6X A;  3HM5 A;  3X2Q H;  1R1U A;  4XKW A;  5E3M A;  4G12 A;  2H94 A;  1E17 A;  4IPA A;  2IGM A;  3DKW A;  1VQ6 I;  5C3E J;  4YIR X;  4DZP A;  3C3W A;  1S3J A;  2CFO A;  2DO7 A;  3VYS B;  4AIK A;  2DCE A;  1RUN A;  3WTS C;  2EFN A;  3ML6 A;  3QRF F;  1GVJ A;  2ECB A;  4D7M A;  4BE2 A;  3CD6 I;  1SAN A;  2LFB A;  3PUB A;  2VJI A;  1A31 A;  2A07 F;  1BW6 A;  1JT6 A;  2EH3 A;  5DM7 F;  1MBJ A;  2E35 A;  2HXI A;  5BS6 A;  3PM1 A;  4HYE A;  4U87 A;  3ZGK A;  3O2P E;  3PSI A;  2IS6 A;  3LA2 A;  1FEX A;  4E70 A;  3FBN B;  1D0X A;  3G2B A;  3RKQ A;  3C1D A;  3Q9S A;  1MMG A;  1IAW A;  1TZL A;  2WY7 Q;  4NBQ A;  4PFO A;  3PNY A;  2QWW A;  2LR8 A;  1LEB A;  1OYW A;  3KYD B;  3OYI A;  2NNY A;  2VIX A;  2RQQ A;  3HOX J;  1JE8 A;  3SXY A;  2XAF A;  2R7U A;  3U2R A;  1UZC A;  1PP8 F;  3L2V A;  3H5A A;  5KK1 A;  1N25 A;  2KMU A;  1TW2 A;  3WG7 H;  1FPQ A;  3HSE A;  3L2W A;  4P9F A;  2XAS A;  2H27 A;  1V5G A;  3PFI A;  2VUM J;  2JN6 A;  4F7Z A;  3I5U A;  3HTS B;  1X3U A;  3IKT A;  2W24 A;  1J75 A;  3BG6 A;  1DP3 A;  4BQA A;  2W82 A;  3BP8 A;  2NNN A;  1KQ0 A;  3SEZ A;  5FLX Z;  4C2M J;  3BR0 A;  4DBR A;  4KIG A;  4L5E A;  2P4W A;  2A6H F;  2ACJ A;  3OYG A;  3OS2 A;  1R5I D;  3NAU A;  1G3S A;  2JPB A;  2GXB A;  4NC7 A;  3MKL A;  1KQ9 A;  3OYN A;  1B9N A;  2P5V A;  3ESW B;  1TWH J;  1Y8Q B;  1OYY A;  1WJB A;  2HYJ A;  1ORK A;  4A2U A;  2KJB A;  2XVC A;  1SFX A;  2EZI A;  1IGN A;  3GVA A;  3O8G A;  5IYB J;  1WZ2 A;  4HQE A;  2PMZ A;  4XN3 A;  1IW7 F;  3E5U A;  2LKP A;  2OD5 A;  2DMN A;  2X6W A;  1T56 A;  3WU2 C;  3ZN1 A;  2CGP A;  3BZ6 A;  1OMI A;  2VOP A;  3QP6 A;  3GYH X;  2LY1 A;  2FRH A;  3GZN B;  4IJA A;  4HNV A;  4BHB A;  2Z9O A;  4G94 A;  5DM6 F;  4BQO A;  2FNP A;  1WVR A;  1Z91 A;  2DA4 A;  3V42 A;  4HX4 A;  1GVD A;  1NK2 P;  2Y75 A;  2FSW A;  2GBY A;  4IL6 C;  1K7A A;  1M1E B;  5LHG A;  3WTX C;  4M72 A;  2LRD A;  2LMD A;  1LJ9 A;  3TW7 A;  5E18 F;  3T8T A;  4CGZ A;  5CYV A;  1U8R A;  1ZEL A;  4HBL A;  2DPU A;  4CA0 A;  1OCP A;  2DA2 A;  1X1A A;  2R5Y A;  3S1R J;  2XSD C;  4A12 A;  1DUX C;  5CLS A;  3ZQ7 A;  1VND A;  4XKB A;  1TT5 B;  4CCO A;  3K4N A;  3IAS 2;  1UHW A;  3NQO A;  1DGW Y;  1ZLJ A;  3JRF A;  4JK1 X;  1G4D A;  2V9V A;  4AYB A;  1FIP A;  3CUQ B;  2JA7 J;  3HOU J;  2CV0 A;  2UWM A;  2Y0S A;  2QSG X;  1QRY A;  4CH7 A;  2HEO A;  5BOX A;  4I7H A;  2KT0 A;  4PJL A;  5K5R A;  2B7E A;  2HQN A;  4XON A;  1R49 A;  3PL8 A;  2Q8K A;  3IHU A;  4CHU A;  1FBQ A;  4MEY F;  3VOE A;  3HEF A;  1OCZ H;  1U2W A;  5LHI A;  2FE3 A;  5F04 A;  2PG4 A;  1EA3 A;  4UUT A;  3KP3 A;  2O9L A;  5TGT A;  2XB0 X;  3DKY A;  3CMY A;  5FO5 A;  3LFK A;  1FNN A;  2P7C B;  1XTA A;  3SEQ A;  3HOZ J;  2ZC2 A;  3ZQI A;  2N8G A;  3CZ6 A;  1FWZ A;  2KHM A;  4Y17 A;  3LSH A;  2J5O A;  2Z3Y A;  3H92 A;  1REP C;  3IWZ A;  1E3P A;  2CQX A;  5LGT A;  4PCQ A;  3S8P A;  1ETQ A;  4KN4 X;  4UV8 A;  3A03 A;  3HOS A;  4AU7 A;  3MEX A;  1G3T A;  4MO7 A;  2LY9 A;  4NC6 A;  3QOD A;  2KRC A;  2ELH A;  1BIA A;  3BTJ A;  4AYB N;  2CUJ A;  2O8X A;  1BOB A;  5FB2 A;  2GLO A;  2ZO4 A;  2Y0S N;  4LMY A;  5EG0 A;  3PO3 J;  2HKO A;  4XLE A;  3L2U A;  3SZT A;  4D0P A;  5EZH A;  5BNG A;  3OL3 A;  4DQ2 A;  2XF6 A;  2GIZ A;  2JUC A;  3DU6 A;  1DQU A;  3O6B B;  2RVC A;  3E97 A;  5F27 A;  2BV6 A;  1SVO A;  3GTJ J;  1HXD A;  3FDY A;  1B72 B;  4JX4 A;  4RBO A;  1O4X A;  5J1Y A;  1JT0 A;  2IGK A;  5HDK A;  3CDI A;  5JVG F;  2L3D A;  2E5N A;  1T39 A;  2ZSI B;  1Z7U A;  2NVU B;  3HDD A;  5FFZ A;  2ME0 A;  4XRS G;  2EQR A;  3VOD A;  4EEF G;  2XF5 A;  4XKV A;  3DBR B;  4FET A;  5GTH C;  3SQN A;  2DDA A;  2KZG A;  3LSI A;  5D4S A;  4J19 A;  4IHX A;  5IYD J;  4FIS A;  5FKN A;  1MJ9 A;  2A68 F;  4E7H A;  1HSJ A;  3W6V A;  4U0V A;  1TQP A;  2EIL H;  4RB1 A;  3AFH A;  1VQM I;  4C2U A;  3H3V K;  1UB9 A;  3J81 Z;  1O3T A;  3LSM A;  3G4S I;  4A93 J;  2V1U A;  1W0T A;  1D3Y A;  5JLX A;  2QQ8 A;  2ZCW A;  1ZGA A;  1XSX A;  2JSC A;  2X51 A;  3FKI J;  2AO9 A;  1GT0 C;  2A61 A;  2R93 J;  3FHN A;  4I0A A;  4ZH4 F;  1SVM A;  2F4M B;  1WRJ A;  5H2F C;  3G6E I;  1T95 A;  1XGO A;  1KU3 A;  2DMU A;  4RGS A;  2VC0 A;  2FML A;  5ICE A;  3ZR8 X;  1TC3 C;  2FU4 A;  2LVS A;  4X1E A;  3FKJ A;  5HNH A;  2XUB A;  2HS5 A;  2GOX B;  3R0A A;  2ZME C;  5LEK A;  3V4G A;  3KLO A;  2WAQ A;  1ETO A;  2R7W A;  1IXC A;  1EKE A;  3TOA A;  3A2K A;  1XPX A;  1JI8 A;  4F91 B;  3EUH C;  2EPF A;  5M5Y J;  4C3J J;  5D5W B;  5L3B A;  2HZT A;  4X6A J;  3HZJ A;  1TBX A;  2MLK A;  1D1C A;  4LIV A;  2H6C A;  4MGR A;  5GAE J;  5F1J A;  2CYY A;  2O8K A;  2MC4 A;  4P55 A;  4UVB A;  3V8K A;  4FTH A;  1OIS A;  4M3E A;  4XR6 A;  1A04 A;  4XM3 A;  2VI6 A;  5L3D A;  2XC7 A;  2D45 A;  1ZG1 A;  2JQ7 A;  4RA2 A;  2K5C A;  1A6I A;  3P7N A;  5GTI C;  3MZ8 A;  3ZCO A;  4OIQ F;  5BMZ A;  3CO6 C;  4A3J J;  3RCO A;  4KYW A;  1R00 A;  2KJC A;  1E3H A;  1IXR C;  1UHS A;  1B1B A;  2E7W A;  1XX5 A;  3TQN A;  3HGY A;  5ERI A;  3PFY A;  2QEN A;  1SD5 A;  4WXC A;  3OIP A;  3AL0 B;  2VXZ A;  2PMU A;  2BXY A;  2XGC A;  3CCY A;  1H0M A;  2WAQ N;  4XLF A;  5JHU A;  3K70 C;  4IHT A;  1LDD A;  2XPV A;  2CG4 A;  2L01 A;  4EVI A;  5BQT A;  3H0D A;  2DBB A;  3FM5 A;  4ENK A;  3KEO A;  3E3V A;  1FZP B;  2TRT A;  1IN6 A;  2V9K A;  1MNM C;  3WG9 A;  2DTZ A;  1K78 A;  3C7J A;  3EQL F;  5JFR A;  2L9R A;  1CF7 A;  4XQF A;  3OWT A;  4A3G J;  1R4N B;  4HSR A;  3V7R A;  5FJ8 J;  1MNE A;  2DYS H;  4Y7N J;  4KIS A;  3K1M A;  4QIW N;  4LB5 A;  2NAZ A;  2OPT A;  2XGD A;  3IV5 A;  2R7X A;  4RB0 A;  3HL2 A;  5FKM A;  5K7H A;  2JMW A;  2L54 A;  2M4K A;  3IWF A;  1YW8 A;  2KDZ A;  1EH7 A;  1Z7L A;  3I58 A;  3F22 A;  3BLY A;  2LOO A;  1MMN A;  1SMY F;  2XHK A;  1F1Z A;  4B3X A;  2WWY A;  1PUE E;  1MBG A;  2NS0 A;  2E2J J;  4PK4 A;  3F8N A;  1RUO A;  2WBM A;  3D1N I;  2FX0 A;  4I76 A;  2NVX J;  1IUY A;  1IN5 A;  1RR8 C;  4C30 A;  3GTK J;  3E6B A;  4HST A;  1TTY A;  5CVI A;  1SAU A;  2E1C A;  4X0G A;  5C44 J;  1ACI A;  2F4O B;  2HWV A;  4F52 A;  3M8E A;  3HG9 A;  1KYZ A;  3ZMV A;  1FP1 D;  3BTL A;  4EJW A;  3RYR A;  3OYM A;  1X4O A;  1O57 A;  4N9I A;  1QNT A;  3PUF A;  5IP7 J;  1YI2 I;  2M45 A;  3A0H C;  2OA4 A;  4D9J A;  4BE0 A;  4IRG A;  3A02 A;  4RB3 C;  1IDZ A;  5JR3 A;  4Q5S F;  4JBA A;  2F5E A;  4P5O A;  4LK1 F;  4CIC A;  3OL4 A;  2MA3 A;  1YRN B;  4MQ9 F;  1W4M A;  3SDG A;  2IEK A;  2BY3 A;  2MLG A;  1QGP A;  4EAT A;  2YX7 A;  3C2B A;  4O5V A;  3LFU A;  2AXL A;  3GWZ A;  4GXO A;  1F4K A;  4XNF A;  1DP7 P;  1ZG5 A;  1QA6 A;  1KA8 A;  2DXI A;  2PJP A;  1ZYR F;  4V2G A;  2WV1 A;  1T6S A;  4BHC A;  1B4A A;  4A3E J;  1TWC J;  3GLX A;  1LQ1 A;  2L9V A;  1IN4 A;  4I01 A;  1CF7 B;  3HRS A;  5ILS A;  2VE9 A;  1QVU A;  3L7W A;  4HF1 A;  4II2 A;  1J9I A;  4HZF A;  3F6O A;  4Z6Y A;  3TKY A;  4IF4 A;  2FMY A;  3KP5 A;  5F0H A;  2HOA A;  2ZJR F;  3MAJ A;  3M9A A;  4ZZD A;  2ZME A;  1B8I A;  2WB1 N;  1HST A;  2Z2S B;  1X58 A;  2L7F P;  3GTQ J;  3EUH A;  3CCS I;  4OIN F;  2W48 A;  4ZTJ A;  1VQ4 I;  5KHD A;  1G3W A;  2CQQ A;  2Z99 A;  3BY6 A;  3CES A;  3CF2 A;  2STT A;  3JSO A;  4CZC A;  2G7U A;  1FSE A;  2COM A;  2HTJ A;  2R7F A;  5ICG A;  1F9N A;  3CLO A;  4II3 A;  1BN5 A;  2XDV A;  2XV4 S;  2XAU A;  3KZY A;  4Z2Y A;  3J80 K;  3CC2 I;  2P81 A;  3GEZ A;  1MMA A;  2KL4 A;  1I6H J;  2A3S A;  3L9F A;  2CQ7 A;  3DEW A;  4P1W A;  1Y56 A;  2KZV A;  3S1N J;  4OOI A;  2BOL A;  2ZB9 A;  3LQR A;  1VQL I;  1SD4 A;  4ASN A;  1S29 A;  4ZYE A;  1YW9 A;  3PJR A;  1K6Y A;  2H1L A;  5LD2 C;  2ZXH A;  2WAD A;  4G9Y A;  3K4K A;  3R4K A;  1K4T A;  3A0B C;  4MTD A;  4KNY A;  3BJA A;  2ZXJ A;  1PYV A;  2V6C A;  3B6A A;  3K1P A;  3I56 I;  3ROU A;  2EBI A;  4AUX A;  4HAM A;  5FD5 A;  2H8R A;  3T1B A;  3MCZ A;  4E7Z A;  1QHH D;  4HF0 A;  2HZD A;  2XAQ A;  4AVZ A;  2NVT J;  1V5F A;  4A3C J;  5GAH J;  1SFO J;  2DA3 A;  1QPM A;  4LGW A;  2JA5 J;  2JSP A;  5FRM A;  4A69 C;  1VI0 A;  2NVY J;  3Q0U A;  3EPZ A;  1Z6T A;  1NHA A;  3S14 J;  2CSO A;  4RM2 A;  1R22 A;  2ID6 A;  5IYC J;  3KYC B;  3QPS A;  1Z77 A;  5F6F A;  5C4X J;  2LBF A;  2A6E F;  2O03 A;  3CJN A;  1VQK I;  2M2E A;  1P7I A;  2CO5 A;  1B59 A;  2VT3 A;  3LMM A;  3JSP A;  1TT0 A;  4GCV A;  1VQP I;  3CUQ C;  4U0W A;  3RKW A;  2VKV A;  5IT9 Z;  1Z21 A;  1BM9 A;  4AC0 A;  3CP8 A;  5LGU A;  2OAZ A;  2YSR A;  5ICF A;  4E7J A;  4HDV A;  5IPA A;  4ABZ A;  2NRA C;  1FYK A;  1WQ2 A;  1Z1D A;  4RAF A;  4GFB A;  2JUG A;  3S2W A;  2I5U A;  5IOY A;  2HDC A;  2PJR B;  2HVS A;  2EK5 A;  2BYV E;  3S17 J;  1JKR C;  1HCR A;  4M3G A;  4ENJ A;  5HOO A;  1X3Z B;  3ZMU A;  1RRJ A;  2COB A;  3H5R A;  3ZN0 A;  3GTG J;  1UFM A;  2XAJ A;  1XCV A;  4LK0 F;  3ZMD A;  1WJ5 A;  3OMY A;  4BYY A;  1U6G A;  3CJQ B;  1HA8 A;  2F4I A;  3WHB A;  1TL8 A;  1ON1 A;  1MJA A;  5BPD A;  1W5S A;  1C0W A;  2X1D A;  2LY2 A;  4F92 B;  3HOW J;  2ELK A;  1G6N A;  2QA4 I;  5EGO B;  3MKY B;  1IRZ A;  3HPG A;  5GPA A;  3TGN A;  2P5L C;  2DMP A;  1K4S A;  3J7Y J;  3RPQ A;  5DCM B;  4IHV A;  4L5J A;  2BY1 A;  2K3P A;  1DPR A;  1WI9 A;  1P2F A;  2H09 A;  5E1W A;  5B1B H;  4HF2 A;  4P9U A;  3F8B A;  4UVA A;  4ZJZ A;  5B1A H;  1RNL A;  2QEX I;  4BDY A;  5A2Q K;  3GFI A;  3L2C A;  2YX4 A;  2LLK A;  3OYE A;  2MFZ A;  5D8L B;  2BVL A;  3T0Y A;  1FMV A;  2QKL B;  3Q0V A;  3S32 A;  3M3Y J;  3F3X A;  3P9K A;  3TMO A;  3AKZ A;  5DTD A;  4DBQ A;  2O61 A;  3HBL A;  2OTL I;  5E20 A;  4PDK A;  2LBF B;  3A1Y A;  1BW5 A;  1J2X A;  1S7E A;  4OWR B;  4KJZ A;  3QPH A;  4BXU A;  2GM4 A;  1XS9 A;  3BG9 A;  1I3Q J;  1KQ8 A;  2VC1 A;  2GXG A;  3KEQ A;  4BU2 A;  2K9N A;  1FT9 A;  1LKX A;  3L00 A;  3PQK A;  2VKE A;  3QYB A;  1FBU A;  1HKS A;  2OUM A;  5DYM A;  3HUG A;  1ZTR A;  2QYO A;  1Z9C A;  1YQA A;  2KDO A;  3LSJ A;  1BR2 A;  2Y0M A;  3IAM 2;  4L9V A;  3OYA A;  4DNC A;  2NS7 A;  3S1Q J;  2IJL A;  3RZD J;  1H9G A;  4XOT A;  1R1V A;  3GF2 A;  3P5J A;  4YG2 F;  1OPC A;  3GZ6 A;  2EV5 A;  3VB2 A;  3D5L A;  5EEH A;  4MHG A;  3K4J A;  3FXL A;  3J7Z I;  2GXA A;  2J5P A;  2XGE A;  3I53 A;  4GDF A;  2R7D A;  2BW3 A;  2M4G A;  3A4C A;  3FIW A;  4KIF A;  5EF6 A;  1IXS B;  2K9S A;  5FKO A;  2DTR A;  2RQP A;  4KN7 X;  3OYK A;  1O3Q A;  2VBY A;  2W7N A;  3EUK L;  1MBF A;  2ELJ A;  3ULQ B;  1WPK A;  2JJ7 A;  2ESH A;  2X4H A;  5AIP A;  3VFZ A;  5EZG A;  4HA8 A;  5EYR A;  5K5Q A;  5J1R A;  4LIT A;  2IA1 A;  4Y33 A;  1VQO I;  4MTE A;  5E17 F;  3DF8 A;  3RIR A;  5LLQ A;  6PAX A;  4I0B A;  4O6J A;  3DBL B;  1OR7 C;  1UEL B;  2G0E A;  4A5M A;  3KX2 A;  2TDX A;  3HPH A;  1W36 D;  2LH9 A;  3ISP A;  2CMP A;  1P4W A;  3JAM Z;  1ETX A;  2HOE A;  3KET A;  1ETV A;  4L18 B;  1H88 C;  3ASN H;  4HX7 A;  4QPO A;  2STW A;  1MBH A;  5HLG A;  3CQZ J;  5J40 A;  4N9H A;  1HBX G;  3CUQ A;  1JTX A;  5L3C A;  1V55 H;  3JTG A;  2ZJP F;  3AL0 C;  4B43 A;  2PQ8 A;  3V8J A;  3KFW X;  1RES A;  3H3Z A;  1SEU A;  1MND A;  3L09 A;  1Y1V J;  5FRN A;  1J5Y A;  2GIV A;  3VDX A;  2VBZ A;  3SJM A;  2A5Y B;  2M0C A;  2V6E A;  1R4M B;  3H9J A;  4XLH A;  4ANJ A;  5FD6 A;  1LDK B;  1T0F C;  2E36 A;  2QF7 A;  3HUG B;  5E3N A;  4EJT A;  2V9P A;  1SVL A;  3K9T A;  1TQM A;  1WJA A;  1VQ5 I;  1ZRD A;  2VT2 A;  3QOP A;  1ENH A;  4WWC A;  3EDP A;  4C9Y A;  2Y69 H;  2ISY A;  3LQQ A;  1G8X A;  2JTV A;  3EYY A;  3BCB A;  1U3E M;  2R3S A;  2KIF A;  3AAF A;  5D8K B;  3CLQ A;  2BW3 B;  1YO5 C;  3NEU A;  4ENM A;  4UXN A;  3I4M J;  5KAI C;  1MW7 A;  2X85 A;  1X4P A;  3K4B A;  4GRI A;  2IS4 A;  1WH7 A;  2FXA A;  2AHQ A;  2V79 A;  4CYC A;  2VQH A;  1GLN A;  2KPM A;  2O5R A;  1X3W B;  2LF8 A;  3DP7 A;  3REO A;  3K2Z A;  3ZXS A;  3M8J A;  3FHZ A;  3QPT A;  2X6Y A;  1MJB A;  3D5R C;  4RS8 A;  4UUS A;  2EA2 A;  2EFQ A;  3DWL E;  3I4P A;  3I59 B;  1B72 A;  4L0Z B;  2X0L A;  2L2O A;  1PUF A;  3ZQQ A;  3LNQ A;  1XC5 A;  4FCY A;  1I39 A;  4W97 A;  3WTY C;  2EZK A;  4H0E A;  2O0Y A;  5L3F A;  3R61 A;  3RZO J;  5ICC A;  3DFG A;  2HYG D;  3FXM A;  4JX6 A;  1JKO C;  1WJD A;  2IA2 A;  3K0L A;  1SC7 A;  2HOS A;  3HRM A;  3VYR B;  5HLH A;  3HTU A;  1Y6I A;  1R5H A;  3F0C A;  1DU0 A;  3ZOB A;  3GTM J;  2OU2 A;  2ETH A;  2B63 J;  2HNH A;  1ERD A;  2UXX A;  3MKZ A;  1QQI A;  3MVP A;  4EM0 B;  3SYT A;  3LST A;  3DLA A;  3LAP A;  1F5T A;  1APL C;  4R8H A;  2BGC A;  3OYJ A;  2KFD A;  2ZSH B;  3MZY A;  2MSY A;  5HVQ C;  1JXS A;  3S93 A;  4HLX A;  2HKX A;  2LK2 A;  2XAG A;  2M0M A;  3WHC A;  4G7Z F;  2GZW A;  2RC4 A;  3I0T A;  2DYR H;  4BY1 J;  4A5N A;  4KMF A;  2ISZ A;  1G3Y A;  1RC9 A;  4HOB A;  3KLN A;  2RGV A;  1F36 A;  1L3L A;  3Q3S A;  4M9S A;  5HOD A;  1ZQ3 P;  2VKH A;  4J00 A;  1LB2 A;  4NDL A;  1Z67 A;  2OZ6 A;  3G3Z A;  1G59 A;  2M1B A;  3DEU A;  1IG7 A;  3GTL J;  4QPQ A;  1A5J A;  2K7L A;  3U9G A;  2YU9 J;  1VQN I;  1D8J A;  2DI3 A;  2RN7 A;  1O7F A;  4TV7 A;  2Z33 A;  4BKX A;  3HOY J;  1OQY A;  2QQA A;  1ZGW A;  3BC8 A;  2K40 A;  3E6D A;  2E1N A;  5H6Q A;  1FTT A;  3FWE A;  4YEL A;  2K9L A;  2L7K A;  3GFL A;  1Y0U A;  2HFH A;  1B9M A;  2XAH A;  2GA1 A;  2VOD A;  1QZY A;  2R7S A;  2IP2 A;  1OR7 A;  4CYC B;  1Y8R B;  4DIQ A;  4QLC U;  1XDS A;  4I6Z A;  5JHF A;  1MH4 A;  2E1O A;  3F21 A;  1Q1H A;  1YW7 A;  3RKX A;  4E7I A;  3WE3 A;  3CDH A;  5CJ9 A;  4UUS B;  2X1E A;  1GV2 A;  1W5T A;  1XGS A;  4LLG F;  1P92 A;  1PUF B;  3GTP J;  2V4J C;  2FBH A;  3RPU D;  1OKR A;  2JRT A;  2V1N A;  5L3G A;  4XMY A;  4OIR F;  4BNC A;  5ILV A;  2XIG A;  3CCV I;  1YX5 A;  3B73 A;  3ELK A;  1FIA A;  3CCR I;  1XB4 A;  1T0F A;  2E1M B;  2FBK A;  2P7V B;  3WOD F;  4AD9 A;  4BQQ A;  1HW1 A;  2IXS A;  3SZG A;  1BOA A;  3GBG A;  3ZQL A;  3PQJ A;  3IH3 A;  3BWG A;  2Z16 A;  4E7K A;  3ECH A;  2A69 F;  4IO9 F;  3HOT A;  2JPC A;  3G1L A;  2EIJ H;  2PI0 A;  2DMT A;  2WC2 A;  1LFB A;  2I8D A;  4CCK A;  2DT5 A;  2YUS A;  1GDT A;  2KIQ A;  2DFH A;  4R1H A;  4GO1 A;  4XOP A;  2HQ5 A;  3TO6 A;  4F93 B;  3TED A;  1XMK A;  1LPQ A;  2XSJ C;  1U78 A;  3E7L A;  4HG2 A;  3TL4 X;  2R7V A;  1IC8 A;  4PGG A;  1HDP A;  4LLN A;  1Y1W J;  4RGX A;  1KZH A;  3KZI C;  1TNT A;  3ZQH A;  1LDJ A;  3JRC A;  3DPL C;  3HGG A;  2OTJ I;  3JTH A;  3W2V A;  4YFX F;  2OCC H;  2HR3 A;  2UZK A;  3FK7 A;  3UNG C;  4BE1 A;  4ITV A;  4NUB A;  2QM3 A;  3IL2 A;  5J6X A;  1TP4 A;  4NHJ A;  2ZJ2 A;  2IGN A;  2UUZ A;  4IQJ A;  4G8X A;  3F72 A;  3BZK A;  5F1R A;  2JZY A;  4D1Q A;  4CCN A;  3S1M J;  2F5F A;  3DTE A;  1RIO H;  4IHW A;  4MLO A;  2EB7 A;  1YX3 A;  3TBI A;  2DK8 A;  3I64 A;  3RJP A;  5ILU A;  2R7Z J;  3MKW B;  2QBY A;  1BJA A;  1YRN A;  5LFA A;  1QVT A;  3H9G A;  2ESN A;  3ERE D;  3FX3 A;  1JHF A;  2R7T A;  3BT9 A;  1FTZ A;  3WGH A;  4RAZ A;  2XKP A;  3LL7 A;  1OCT C;  2A05 A;  2X1C A;  4HNU A;  2ADU A;  5TRD A;  1JUS A;  2BXZ A;  3BR5 A;  1MBK A;  2ZXI A;  3C2G A;  2LC2 A;  1YOV B;  3CCE I;  3S3O A;  2MBF A;  4UB6 C;  1R6R A;  1VFC A;  1WWX A;  4HLY A;  1YG2 A;  5CVU A;  3QOE A;  2C6Y A;  1XG1 A;  2M7B A;  3ERM A;  3FBI B;  4PJ0 C;  4BL0 B;  2MC3 A;  3BTC A;  1IN8 A;  4LOC A;  2JVH A;  1S5L C;  2WY8 Q;  1J0R A;  3M4O J;  2LD5 A;  3OYB A;  2PBI A;  5E8I A;  4I2O A;  5IP6 A;  1E2X A;  4FX4 A;  2Y2Z A;  1R9T J;  3ABU A;  4W1U A;  2HQA A;  1LVK A;  4XRF A;  2DT7 B;  1OFC X;  3LSG A;  5DD8 A;  3MZH A;  4PJN A;  3ZQC A;  4HNT A;  5E3O A;  2XRL A;  2CJJ A;  2FNA A;  2KRF A;  4PUS A;  2L5Q A;  4XK4 A;  1IN7 A;  4OU0 A;  5K1Y A;  1D1B A;  1USS A;  3IUO A;  3VYU B;  1P9Q C;  1HKQ A;  2KLO A;  3E5Q A;  2AQE A;  3KP6 A;  2ZFW A;  1V5E A;  3OV8 A;  3FZV A;  5B5E C;  3KIO A;  3ZMZ A;  3LSP A;  3M7G A;  3WTU C;  4L9N A;  4IHS A;  1MKM A;  2BE5 F;  2W25 A;  4Q47 A;  3BR1 A;  3QP5 A;  4KT6 A;  1G2H A;  1U5T A;  5D5V B;  5LBQ A;  2WB1 A;  1PDN C;  2CV2 A;  4HDU A;  3DTI A;  3HIF A;  4A3K J;  1TQI A;  4MQV A;  2LKS A;  2BZT A;  2FOW A;  3AG3 H;  4RAG A;  4IQ4 A;  2QBY B;  3I55 I;  3GLL A;  1KU9 A;  4LJZ F;  1I50 J;  2IS2 A;  3KEY A;  1Y39 A;  4GGG A;  3FMR A;  3NWS A;  4YRV A;  3GO5 A;  4IRH A;  5KVR A;  2RRE A;  1W5C C;  2NVQ J;  2GWR A;  3HB9 A;  1BC8 C;  1ZH5 A;  3L2R A;  3DTK A;  4ESJ A;  2XKO A;  5J3L A;  2CFX A;  4B48 A;  1Z05 A;  3IRR A;  1WI3 A;  1DPU A;  2DK5 A;  2W57 A;  2M3A A;  3H36 A;  1R5G A;  5LHH A;  3OYC A;  2IW5 A;  4Y15 A;  4L5I A;  5KNL A;  3VEP A;  3E5X A;  4S04 A;  1S6L A;  2EWN A;  5DUI A;  1HDD C;  1IV8 A;  1K79 A;  2FEZ A;  1HOM A;  3ABT A;  3HRU A;  4UHT A;  1BI2 A;  1ZHF A;  4CUG A;  2H1K A;  1ULY A;  1KGS A;  5AON A;  2IPQ X;  1STZ A;  2E5Z A;  1J09 A;  3OYL A;  2PJR A;  2L4M A;  3ZRG A;  1MZB A;  1AKH B;  1POG A;  4OMZ A;  3W6K B;  1X2M A;  1K83 J;  5H6R A;  4M73 A;  4E7S A;  4G6T B;  2DA5 A;  2M8G X;  3JRE A;  1DGR M;  5IT3 A;  4S05 A;  3HSF A;  4CYD A;  3MMY B;  3MQ0 A;  2CU7 A;  4BXF A;  4ETS A;  2DN0 A;  1P6R A;  1U5T B;  4CCM A;  2FD5 A;  1AHD P;  2HGC A;  3BR2 A;  3K2A A;  4AIH A;  4WXH A;  4DW6 A;  3FF5 A;  2LRE A;  3PIO F;  4A3M J;  4UB8 C;  3OS1 A;  3RDI A;  2VLA A;  2OQG A;  5EGO A;  4PSW A;  1U9O A;  2PN6 A;  5M3M J;  3R60 A;  5DCM A;  3M07 A;  4B1R A;  3IRQ A;  2HTS A;  1H9T A;  4BXX J;  1O3S A;  4XLP F;  4AWX B;  4BGD A;  2W85 A;  2MD5 A;  5CVV A;  3H35 A;  3LSR A;  3R0J A;  3OIQ A;  3BRO A;  1T38 A;  2PMH A;  3BTI A;  4HX8 A;  4CZZ A;  5LGN A;  4B09 A;  2WTE A;  4DYC A;  3WE2 A;  2F2E A;  3VPR A;  5A2Q Z;  4FE4 A;  2HU9 A;  4XLN F;  1QZZ A;  4KUM A;  2QKM B;  1YTY A;  1BBY A;  3IH4 A;  5FKL A;  4L0Y B;  2XB5 A;  1QPI A;  1R7J A;  1DDN A;  5JI6 A;  1IRX A;  5J47 A;  4F55 A;  4LFU A;  1GV5 A;  3CMM A;  3Q5F A;  3PSF A;  3WU0 A;  3H0G J;  2P0W A;  2CW7 A;  3LWF A;  1B6A A;  2IGO A;  2CH0 A;  2VAS A;  3TO9 A;  5FLM J;  3OY9 A;  4OAZ A;  1Z3Y A;  2RNJ A;  1J59 A;  4IX7 A;  4XLA A;  3E6M A;  3KYL A;  3WU1 B;  2OF7 A;  5HDN A;  2AQF A;  2CS3 A;  2DQR A;  3CDL A;  3DBH B;  2EFP A;  4S0H B;  1KYW A;  5B3S H;  5JVT A;  4DOZ A;  3F6V A;  1YJ9 I;  1BR1 A;  5K5O A;  3EUA A;  3OYH A;  3JR9 A;  1N78 A;  2MW8 A;  1VF9 A;  2EZL A;  4DYQ A;  2K4J A;  5DD4 A;  3QWL A;  2VQG A;  3HHG A;  4ZTF A;  1XN7 A;  2BEO A;  2Q0O A;  1BI0 A;  2JVG A;  5E8G A;  3SFZ A;  1LVA A;  2L7Z A;  3WGI A;  4RAY A;  4U0Y A;  3G73 A;  1S9H A;  1IUF A;  1KU2 A;  3A01 B;  3F8M A;  3AG4 H;  2Y30 A;  3F23 A;  2P6T A;  2HXO A;  1D5V A;  3BJO A;  3DU5 A;  5HS7 A;  2OBP A;  2BY0 A;  4BS9 A;  2L0K A;  2BHZ A;  3E1S A;  3C18 A;  4EM2 A;  5GAG J;  5DDG A;  2R92 J;  2QCO A;  5CQE A;  1MDM B;  5HS8 A;  4QWQ A;  1ITY A;  3RPU A;  2DA7 A;  2OZU A;  4FX0 A;  1LE8 A;  1R71 A;  1QO0 D;  2Z5U A;  3OOP A;  2FQ4 A;  4XOR A;  2LG4 A;  2V1X A;  2QQB A;  2L9N A;  2HI3 A;  4RDU A;  3CJR B;  3ZP5 A;  3MN2 A;  3BOQ A;  2L9S A;  2IT0 A;  4HV5 A;  1BI3 A;  4NNJ A;  2RNG A;  1VQ8 I;  1S7O A;  4N4N B;  1YS6 A;  2ZJQ F;  2BBY A;  4AVP A;  1WSU A;  1UCR A;  2K85 A;  1FX7 A;  2VOO A;  5M5X J;  2BHY A;  4EJV A;  5J4V A;  5FLV A;  1R23 A;  5IP9 J;  4IOC F;  1FYL A;  3PNV A;  1ZLK A;  2E1M C;  4RLF A;  4AID A;  4UVC A;  3TW6 A;  3JRI A;  1RPW A;  4BJ5 C;  2CUF A;  2PFB A;  1A6Q A;  1Z3X A;  3E0J B;  3DEE A;  1EF4 A;  2CRG A;  2IA0 A;  1YFH A;  3CCQ I;  4G7H F;  1ZRE A;  3TP3 A;  2LDU A;  1BR4 A;  4IOA F;  3H9Q A;  3W6J B;  5E1X A;  1NTC A;  1I1G A;  4A3D J;  3BZC A;  3U21 A;  5TJJ A;  3SZP A;  1J7K A;  2X6O A;  3ZQF A;  4G6Q A;  4N4O B;  2GQQ A;  1S7A A;  2DJI A;  5E3L A;  3LAJ A;  2MH2 A;  2UXN A;  2YU3 A;  4QTR A;  3WTV C;  1VQ7 I;  2NOG A;  3BG7 A;  4RLQ A;  1XMX A;  1HQC A;  3GCM A;  1T08 B;  2K9M A;  2OJE D;  4UY8 I;  1TWF J;  3I59 A;  4EJO A;  1V54 H;  3K7A J;  1SFE A;  1RZ4 A;  5BPI A;  2MAB A;  2XF7 A;  1O7L A;  1LE8 B;  2B9S A;  1AU7 A;  5D6F A;  3BR6 A;  4M9Z A;  2DDB A;  2WAF A;  3GX4 X;  4M3B A;  4KIT B;  1W7P D;  2CQK A;  1X1P A;  1X2N A;  3AG1 H;  4I98 B;  3K69 A;  2OCE A;  4BEH A;  5C4J J;  5J1U A;  4ZDP A;  3JRD A;  3PO2 J;  5FRO A;  1D5Y A;  4E4H A;  2DOD A;  2FQ3 A;  3EET A;  3OS0 A;  2QSF X;  4YFN F;  3JRH A;  3BPV A;  1W0U A;  1WJC A;  1PVE A;  5DUK A;  1ZKG A;  3HC7 A;  3MFK A;  3S2D J;  3SDB A;  2FF4 A;  4BUP A;  2PX9 A;  4LG3 A;  4I09 A;  1T98 A;  3CJT B;  2QQ9 A;  4RM3 A;  3KE2 A;  9ANT A;  2QVO A;  2VQC A;  3KP4 A;  3ZMS A;  2UV1 A;  3GFJ A;  5CVR A;  3CF5 F;  4B3A A;  4CCL A;  4B4C A;  3P9C A;  4OMY A;  3T8R A;  2RV8 A;  2K86 A;  4Y4R A;  5GAD J;  4EQQ A;  2IBD A;  2LNB A;  1O3R A;  3T5X A;  5D5X B;  1RKT A;  2B0L A;  1LFP A;  1OCR H;  1OLT A;  4XN0 A;  4R79 A;  4BH9 A;  3TDZ C;  4JOM A;  3RSN A;  4A3L J;  4JYK A;  1I27 A;  5E1Z B;  3CC7 I;  5CPR B;  3HHH A;  1ETK A;  4ZYG A;  3K4M A;  3KCC A;  2Y9Y A;  2K27 A;  3CP2 A;  2RAE A;  3OSF A;  1FY7 A;  4JP0 A;  4KIC A;  2DW4 A;  2E2H J;  1I1S A;  5LEJ A;  4B47 A;  1MSE C;  2JT1 A;  4OIO F;  2JWT A;  2ZXW H;  2ICW G;  4DZJ A;  2VE8 A;  2E71 A;  3K4C A;  2M5W A;  2RKH A;  3RQ4 A;  1AOY A;  2R7R A;  2DA6 A;  3HJE A;  2EIM H;  4XSZ F;  1MD0 A;  4CDG A;  1EJ9 A;  4U7B A;  2D2W A;  3S3N A;  3J7A Y;  4YIF A;  4WCG A;  5DV5 A;  3W2W A;  4BEH B;  3OSG A;  2FBI A;  3HYI A;  4DJA A;  3K70 D;  1XD7 A;  1A35 A;  2HPI A;  2NYX A;  3WTT C;  2DFF A;  2P6S A;  2KIU A;  3JAM K;  2QZ8 A;  3KPH A;  3FMS A;  1RI7 A;  4I99 C;  5FGM A;  4XRS A;  4M71 A;  1AWC A;  5LRS A;  5J8C A;  3I9V 2;  2JA6 J;  4AIJ A;  5JLW A;  3G1M A;  5HDG A;  4C3I J;  2CWE A;  4ESB A;  4HRI A;  1MMS A;  3WTZ A;  1ETW A;  2VKD A;  2PMZ N;  1ZRC A;  1E0E A;  4YEJ A;  2IAI A;  2FUG 2;  2IS1 A;  5HS9 A;  5KAF C;  3C2H A;  4D5F A;  3HSR A;  5FLX K;  4G6D A;  3GME A;  1N77 A;  1JGS A;  1P7J A;  2Z1D A;  1U9N A;  2MH9 A;  1JKQ C;  5F08 A;  1ZGJ A;  2M34 A;  1R36 A;  2MD0 A;  3QYF A;  1PJR A;  3ZQG A;  4K2E A;  4KMU X;  2O3F A;  2HVQ A;  1HLV A;  3BJ6 A;  3LSK A;  2DJN A;  4Q48 A;  3DLL F;  3TP0 A;  3OYD A;  1NH3 A;  4C2T A;  1L0O C;  5GP9 A;  4PZJ A;  1FOK A;  1IO2 A;  2W4S A;  3BR3 A;  1MBE A;  1FSH A;  1D1A A;  3D0S A;  1Y0N A;  4Y3O A;  4ESF A;  5J8F A;  4XKC A;  4RB2 C;  3S16 J;  1SFK A;  2M9H A;  2A6T A;  3IH2 A;  2MYS A;  3OIO A;  2JK3 A;  3SHF A;  2ZNY A;  2K4B A;  1U5T C;  2H6B A;  2GOM A;  1ETY A;  1WGX A;  5FFX A;  4B44 A;  2E7X A;  4YII A;  4Y13 A;  1EV7 A;  1SAX A;  3W2A A;  3QAH A;  2HOT A;  2HYF A;  1YJW I;  1YIT I;  2R7O A;  4IRI A;  3IC7 A;  3S15 J;  3V8L A;  1UAA A;  1S8N A;  3H5N A;  1IV6 A;  1YE9 A;  5CKT A;  1P4A A;  2QUF A;  3DPT A;  1BJZ A;  2W84 A;  4M3D A;  2KP6 A;  3GTO J;  4M3F A;  3D5S C;  3U1K A;  4WX9 A;  5D4R A;  2VJ4 A;  1VTN C;  1W36 C;  1RKW A;  1D0Y A;  1QZE A;  2E19 A;  4H4K C;  2XRN A;  4NC8 A;  1OJL A;  1VZ0 A;  2AXT C;  2R5Y B;  5LRR A;  3KP2 A;  4CXF A;  1FC3 A;  1FMW A;  4JQF A;  4HQM A;  2VPR A;  5HNF A;  2G7H A;  4KIB A;  4KFC A;  4MIM A;  3CMA I;  3LA3 A;  1EH6 A;  3Q9V A;  3VYT B;  1TW3 A;  4B8X A;  5IOZ A;  4MFD A;  1V4R A;  3ZPL A;  4XL9 A;  5DCF A;  2BY2 A;  3M8F A;  3PIP F;  2DU9 A;  2FA5 A;  1FOX A;  3BQZ A;  1XCB A;  2VXD A;  3QYE A;  2EIK H;  4IXA A;  2F5C A;  5F64 A;  5D5U B;  3UKG A;  1TWA J;  4L9J A;  4GYI A;  1RR7 A;  3G1O A;  1WJE A;  1GXP A;  1WJF A;  2DMQ A;  5J4Y A;  3K4L A;  4NQW A;  2WV0 A;  1Q1V A;  3FXK A;  2LYC A;  1EH8 A;  4WF2 A;  3WTW C;  1FOW A;  4J01 A;  2MG4 A;  2XGX A;  2D5V A;  3S3M A;  2AS5 F;  5IY5 H;  2DFI A;  3F9K A;  5F0C A;  2DOF A;  2LKX A;  4PSX A;  2EZH A;  2DAO A;  4JX5 A;  2FJ1 A;  1ODD A;  5HLT A;  1U8B A;  5EG0 B;  2EFO A;  2GAU A;  2YS9 A;  1JGG A;  1WFX A;  5F0F A;  5K7Z A;  4KDP A;  1SD7 A;  2DA1 A;  2VJJ A;  2K9Q A;  2O7O A;  3MD2 A;  5EJC A;  4F3Q A;  1FBS A;  3HXL A;  2DT6 A;  4U7D A;  1FYM A;  1E3O C;  1UG0 A;  4PJM A;  5CVJ A;  1UMQ A;  2KKO A;  4XLC A;  1ZN2 A;  2E2I J;  1WCM J;  2DFE A;  3BDD A;  4M74 A;  3JW4 A;  2PLY A;  1XSD A;  1H89 C;  3G71 I;  1ZR2 A;  1HW2 A;  1K6O A;  3S2H J;  2PEX A;  5CQG A;  2W1O A;  4A3I J;  2DOA A;  2HVR A;  5HLI A;  1QU3 A;  5M5W J;  1JHH A;  2G9W A;  2NS8 A;  3LOC A;  3J81 K;  1SFU A;  4UV9 A;  1JUP A;  2K02 A;  2F5D A;  3CME I;  2R5Z A;  1LUJ B;  2I10 A;  2W00 A;  4BDZ A;  1MH3 A;  2XRO A;  2OQR A;  2CW0 F;  3DXJ F;  2M87 A;  3QU3 A;  4KT5 C;  1UST A;  4ZYD A;  3F8F A;  1GUU A;  2VB6 A;  1S72 I;  3N05 A;  3JRA A;  4D5C A;  1I5Z A;  1XGM A;  1YYV A;  1AKH A;  1IJW C;  4GYG A;  5EEA A;  2JRM A;  4ZYH A;  1F43 A;  2VJ5 A;  4Y52 J;  3J80 Z;  4NQW B;  2Q2E A;  2ECC A;  4U88 A;  3ECO A;  2HDW A;  3RYP A;  1NG6 A;  4IEJ A;  4DGW B;  1T2K A;  4CSW A;  4HEA 2;  3BG3 A;  5K7F A;  1ZRF A;  3FMQ A;  1ZAR A;  2RDP A;  2CV1 A;  3TDU C;  3O8H A;  2VBW A;  5ED4 A;  1T8I A;  4ZDO A;  3K10 A;  1FJL A;  2M30 A;  4NB5 A;  1TNS A;  2ME6 A;  2LP0 A;  2M7A A;  4RGR A;  1FP2 A;  1VQ9 I;  1ZR4 A;  3QPL A;  1I6X A;  4FE7 A;  3UR3 C;  3I4N J;  4O3M A;  2JA2 A;  3I54 A;  4RGU A;  3TO7 A;  1IF1 A;  2XPU A;  3O3K A;  1NK3 P;  3I3L A;  3P9I A;  3I71 A;  1W7P A;  1RET A;  4HPQ A;  4YFK F;  3CCU I;  3QU6 A;  2VPL A;  4A3B J;  4KA4 A;  4G7O F;  2CUE A;  3JCU C;  4ENN A;  2ZFU A;  5B66 C;  4Q4Z F;  2EFW A;  3NRV A;  1MIJ A;  2ZNZ A;  3DQV C;  3M1C A;  5D6E A;  3VSK A;  2D1H A;  3L1P A;  5H20 A;  2R0Q C;  2LF7 A;  2DLL A;  1V3F A;  1MSF C;  1SMT A;  4A0X A;  2KRH A;  2HDD A;  1MGT A;  1OCC H;  1BA5 A;  4IKF A;  2FOK A;  1ON2 A;  1UG2 A;  2X9D A;  1YHQ I;  2R4G A;  3OR1 C;  1JJ6 C;  1YLF A;  1BIB A;  4MEX F;  2BVM A;  2JA8 J;  3KP7 A;  2CW8 A;  2Y9Z A;  2VBX A;  2R5Z B;  3PNT A;  1N75 A;  1LFU P;  3KZZ A;  3DKX A;  1K78 B;  2NXN B;  1D8K A;  3RI4 A;  4OIP F;  1GHC A;  2K3F A;  1YJN I;  2O6G E;  4FQG A;  4M6Y A;  1R1T A;  5FKK A;  3CUO A;  1U0J A;  1UHM A;  4C3H J;  3ABK H;  4M6X A;  3N4M A;  2IVM A;  4V19 K;  1HF0 A;  2MGQ A;  3K6G A;  4IHY A;  2XPW A;  1FOY A;  3NAR A;  1XMA A;  1X1B A;  1LNW A;  2ID3 A;  2Q2E B;  4ON0 A;  5L3E A;  1XGN A;  4LLL A;  2V26 A;  2Y31 A;  3OYF A;  2NOJ B;  4M9X A;  1WH5 A;  4EJU A;  4ZYA A;  3A01 A;  1QBJ A;  1Z0X A;  1BC7 C;  3R6S A;  4BQN A;  3E6C C;  1HKT A;  4BJT A;  4WXD A;  3CCL I;  1OYI A;  3BCA A;  2DOE A;  4D7N A;  2CQN A;  1P4X A;  2Y48 A;  4LIU A;  4V2F A;  3ONQ A;  4FAS D;  4EGY A;  2E60 A;  1MDM A;  4XID A;  3N97 A;  1YS7 A;  5E79 C;  2KQR A;  3GUD A;  4CCJ A;  1OCO H;  3ASO H;  4LG0 A;  4EGZ A;  2KIS A;  2H8W A;  1KU7 A;  1JTY A;  2QLZ A;  4BAY A;  1W7P B;  3FXO A;  1BI1 A;  2ZKZ A;  3QQA A;  2A5W A;  2D1V A;  3H1C A;  1QHG A;  5GPC A;  1TLH B;  2WAE A;  1XDU A;  3FM3 A;  4MNU A;  2VL8 A;  1IZ1 A;  2LTP A;  5M3F J;  1YIJ I;  1ZK8 A;  4IVN A;  1AA7 A;  4ZC3 A;  3GFM A;  1JKP C;  1KON A;  2HPM A;  2F6C A;  1K61 A;  3H3U A;  4A0Y A;  3GW2 A;  4XIC A;  2KIM A;  4A3F J;  3RKY A; 
#chains in the Genus database with same CATH homology
 1HW5 A;  3IKV A;  3RTR A;  3F8C A;  4FT8 A;  1LEA A;  2DQL A;  3WGG A;  2VON A;  4HV6 A;  1YIO A;  2YPR A;  3MWM A;  1PP7 U;  2EJR A;  2ZME B;  3U1D A;  4XSX F;  2HQR A;  4CO8 A;  3K1N A;  4FHT A;  2LSO A;  4EMS A;  5DEQ A;  4LB6 B;  4P96 A;  3FXR A;  3COA C;  4HW0 A;  2YR2 A;  3DV8 A;  2P5K A;  4UNO A;  1FLI A;  4XBF A;  3BPX A;  3CO7 C;  2EV6 A;  1Z6R A;  3V7S A;  2L02 A;  1R58 A;  4I02 A;  2V1D A;  4WK8 F;  4A0Z A;  5AIQ A;  4BHP A;  3CTA A;  3FXU A;  2M8E A;  2EV0 A;  4LG0 B;  1WKM A;  1SD6 A;  3GXO A;  4EM1 A;  4EV0 A;  1IRF A;  2EA4 A;  3V7C A;  2GA2 A;  4PGH A;  2VN2 A;  3J7A O;  4LD5 A;  1GXQ A;  5EEG A;  4ZZL A;  1ZAO A;  4N0B A;  1XSV A;  1CGP A;  3HRT A;  2L4A A;  2ZBK A;  1ONV A;  2DPD A;  1IRG A;  3B02 A;  5IT9 K;  4L9T A;  3FXQ A;  3TOB A;  1ZG3 A;  3GZ5 A;  4A6E A;  3EYI A;  3LA7 A;  2P8T A;  3M1E A;  4UUV A;  2IRF G;  4A6D A;  3ZMT A;  1R1U A;  2H94 A;  1E17 A;  4IPA A;  3DKW A;  3C3W A;  1S3J A;  2DO7 A;  4AIK A;  1RUN A;  3WTS C;  2EFN A;  3ML6 A;  3QRF F;  1GVJ A;  2A07 F;  5BS6 A;  4HYE A;  3O2P E;  3LA2 A;  4E70 A;  3C1D A;  3Q9S A;  1IAW A;  2QWW A;  1LEB A;  1OYW A;  2NNY A;  1JE8 A;  3SXY A;  2XAF A;  3U2R A;  1PP8 F;  5KK1 A;  1TW2 A;  1FPQ A;  3HSE A;  4P9F A;  2XAS A;  2H27 A;  3PFI A;  4F7Z A;  3I5U A;  3HTS B;  1X3U A;  3IKT A;  2W24 A;  1J75 A;  4BQA A;  3BP8 A;  2NNN A;  1KQ0 A;  5FLX Z;  4KIG A;  2P4W A;  2A6H F;  2ACJ A;  1G3S A;  2JPB A;  2GXB A;  1KQ9 A;  1B9N A;  2P5V A;  1OYY A;  4A2U A;  2KJB A;  2XVC A;  1SFX A;  3GVA A;  4HQE A;  1IW7 F;  3E5U A;  2LKP A;  2OD5 A;  3ZN1 A;  2CGP A;  3BZ6 A;  1OMI A;  2VOP A;  3QP6 A;  3GYH X;  2FRH A;  4IJA A;  4BHB A;  2Z9O A;  4G94 A;  2FNP A;  1Z91 A;  4HX4 A;  2Y75 A;  2FSW A;  1K7A A;  5LHG A;  3WTX C;  4M72 A;  5E18 F;  1LJ9 A;  3T8T A;  4CGZ A;  5CYV A;  1U8R A;  2DPU A;  4HBL A;  1DUX C;  4A12 A;  5CLS A;  3ZQ7 A;  1UHW A;  3NQO A;  1ZLJ A;  4JK1 X;  1G4D A;  2V9V A;  3CUQ B;  2UWM A;  2HEO A;  5BOX A;  4I7H A;  5K5R A;  2HQN A;  2Q8K A;  3IHU A;  4CHU A;  1FBQ A;  4MEY F;  3VOE A;  1U2W A;  5LHI A;  2FE3 A;  2PG4 A;  3KP3 A;  5FO5 A;  3LFK A;  1FNN A;  2P7C B;  1FWZ A;  4Y17 A;  2J5O A;  2Z3Y A;  3H92 A;  1REP C;  3IWZ A;  5LGT A;  4PCQ A;  4KN4 X;  4UV8 A;  3HOS A;  3MEX A;  1G3T A;  2ELH A;  1BIA A;  2O8X A;  5FB2 A;  2ZO4 A;  4LMY A;  2HKO A;  3SZT A;  4D0P A;  4DQ2 A;  3O6B B;  2RVC A;  3E97 A;  2BV6 A;  1HXD A;  5HDK A;  2L3D A;  1T39 A;  1Z7U A;  5FFZ A;  3VOD A;  3SQN A;  5D4S A;  1MJ9 A;  2A68 F;  1HSJ A;  4U0V A;  1TQP A;  4RB1 A;  1UB9 A;  3J81 Z;  1O3T A;  2V1U A;  1D3Y A;  2ZCW A;  1ZGA A;  1XSX A;  2JSC A;  2A61 A;  4I0A A;  4ZH4 F;  1WRJ A;  4RGS A;  1XGO A;  1KU3 A;  2VC0 A;  2FML A;  5ICE A;  2FU4 A;  2XUB A;  2HS5 A;  3R0A A;  5LEK A;  3V4G A;  3KLO A;  1IXC A;  3TOA A;  5D5W B;  5L3B A;  2HZT A;  1TBX A;  2MLK A;  4MGR A;  2H6C A;  2CYY A;  4P55 A;  4UVB A;  3V8K A;  1A04 A;  5L3D A;  2D45 A;  1ZG1 A;  3P7N A;  4OIQ F;  5BMZ A;  3CO6 C;  4KYW A;  1R00 A;  2KJC A;  1IXR C;  1B1B A;  2E7W A;  3TQN A;  5ERI A;  2QEN A;  1SD5 A;  4WXC A;  2VXZ A;  2PMU A;  1H0M A;  5JHU A;  4IHT A;  5BQT A;  1LDD A;  2CG4 A;  2L01 A;  4EVI A;  2DBB A;  3FM5 A;  4ENK A;  3KEO A;  3E3V A;  1FZP B;  1IN6 A;  3WG9 A;  1K78 A;  3C7J A;  3EQL F;  5JFR A;  1CF7 A;  3V7R A;  3K1M A;  4LB5 A;  2NAZ A;  4RB0 A;  2L54 A;  3IWF A;  1YW8 A;  1EH7 A;  3I58 A;  3F22 A;  1SMY F;  2XHK A;  1F1Z A;  2WWY A;  1PUE E;  2NS0 A;  3F8N A;  1RUO A;  1IUY A;  1IN5 A;  3E6B A;  1TTY A;  5CVI A;  2E1C A;  2HWV A;  3M8E A;  1KYZ A;  3ZMV A;  1FP1 D;  4EJW A;  3RYR A;  1O57 A;  4N9I A;  1QNT A;  2M45 A;  2OA4 A;  4IRG A;  4RB3 C;  5JR3 A;  4Q5S F;  4JBA A;  2F5E A;  4P5O A;  4LK1 F;  4CIC A;  2MA3 A;  4MQ9 F;  1W4M A;  2MLG A;  1QGP A;  2YX7 A;  4O5V A;  2AXL A;  3GWZ A;  4GXO A;  1F4K A;  1DP7 P;  1ZG5 A;  1KA8 A;  2PJP A;  1ZYR F;  1T6S A;  4BHC A;  1B4A A;  3GLX A;  1LQ1 A;  1IN4 A;  4I01 A;  1CF7 B;  3HRS A;  5ILS A;  2VE9 A;  4HF1 A;  3L7W A;  1J9I A;  4HZF A;  3F6O A;  3TKY A;  4IF4 A;  2FMY A;  3KP5 A;  3MAJ A;  3M9A A;  4ZZD A;  2ZME A;  1HST A;  3EUH A;  4OIN F;  1G3W A;  2Z99 A;  3BY6 A;  2STT A;  3JSO A;  2G7U A;  1FSE A;  2COM A;  2HTJ A;  2R7F A;  5ICG A;  1F9N A;  3CLO A;  1BN5 A;  2XV4 S;  3KZY A;  4Z2Y A;  3J80 K;  3GEZ A;  2A3S A;  3L9F A;  4OOI A;  3LQR A;  1SD4 A;  4ASN A;  1S29 A;  4ZYE A;  1YW9 A;  4G9Y A;  3R4K A;  4KNY A;  4MTD A;  3BJA A;  2ZXJ A;  2V6C A;  3K1P A;  3ROU A;  4HAM A;  5FD5 A;  3T1B A;  3MCZ A;  4HF0 A;  2XAQ A;  1QPM A;  4LGW A;  1Z6T A;  1NHA A;  2CSO A;  1R22 A;  5F6F A;  2A6E F;  2O03 A;  3CJN A;  2CO5 A;  1B59 A;  2VT3 A;  3JSP A;  4GCV A;  3CUQ C;  4U0W A;  3RKW A;  5IT9 Z;  1BM9 A;  5LGU A;  2OAZ A;  2YSR A;  5ICF A;  4HDV A;  2NRA C;  1FYK A;  1WQ2 A;  1Z1D A;  3S2W A;  2HDC A;  2EK5 A;  2BYV E;  4ENJ A;  5HOO A;  3ZMU A;  3ZN0 A;  1UFM A;  2XAJ A;  1XCV A;  4LK0 F;  3ZMD A;  4BYY A;  1U6G A;  1ON1 A;  1MJA A;  5BPD A;  1W5S A;  1C0W A;  1G6N A;  3TGN A;  2P5L C;  3RPQ A;  5DCM B;  4L5J A;  1DPR A;  1WI9 A;  1P2F A;  2H09 A;  5E1W A;  4HF2 A;  4P9U A;  3F8B A;  4UVA A;  1RNL A;  5A2Q K;  3GFI A;  3L2C A;  2YX4 A;  5D8L B;  3T0Y A;  3F3X A;  3P9K A;  2O61 A;  5E20 A;  4PDK A;  1J2X A;  3QPH A;  4BXU A;  1KQ8 A;  2VC1 A;  2GXG A;  3KEQ A;  1FT9 A;  3L00 A;  3PQK A;  1FBU A;  1HKS A;  5DYM A;  3HUG A;  2QYO A;  1Z9C A;  1YQA A;  2Y0M A;  4L9V A;  4DNC A;  2IJL A;  1H9G A;  1R1V A;  3GF2 A;  4YG2 F;  1OPC A;  3GZ6 A;  2EV5 A;  3VB2 A;  3D5L A;  5EEH A;  4MHG A;  2J5P A;  3I53 A;  2R7D A;  4KIF A;  1IXS B;  2DTR A;  2RQP A;  4KN7 X;  1O3Q A;  2VBY A;  3ULQ B;  2ESH A;  2X4H A;  5AIP A;  3VFZ A;  4HA8 A;  5K5Q A;  2IA1 A;  4MTE A;  5E17 F;  3DF8 A;  3RIR A;  5LLQ A;  6PAX A;  4I0B A;  4O6J A;  4A5M A;  2TDX A;  3ISP A;  1P4W A;  3JAM Z;  2HOE A;  3KET A;  4L18 B;  4HX7 A;  2STW A;  5HLG A;  4N9H A;  1HBX G;  3CUQ A;  5L3C A;  3JTG A;  2PQ8 A;  3V8J A;  3KFW X;  3H3Z A;  3L09 A;  1J5Y A;  2GIV A;  2VBZ A;  2A5Y B;  5FD6 A;  1LDK B;  4EJT A;  3K9T A;  1TQM A;  1ZRD A;  2VT2 A;  3QOP A;  4WWC A;  3EDP A;  2ISY A;  3LQQ A;  2JTV A;  3EYY A;  1U3E M;  2R3S A;  2KIF A;  3AAF A;  5D8K B;  1YO5 C;  3NEU A;  4ENM A;  4UXN A;  2FXA A;  2V79 A;  2LF8 A;  3DP7 A;  3REO A;  3K2Z A;  3FHZ A;  3QPT A;  1MJB A;  4RS8 A;  2EA2 A;  2EFQ A;  3I4P A;  3I59 B;  4L0Z B;  2X0L A;  3WTY C;  4H0E A;  2O0Y A;  5L3F A;  3R61 A;  5ICC A;  3DFG A;  2HYG D;  2IA2 A;  3K0L A;  3HRM A;  5HLH A;  3HTU A;  1R5H A;  2OU2 A;  2ETH A;  2UXX A;  1QQI A;  4EM0 B;  3LST A;  3LAP A;  1F5T A;  4R8H A;  2BGC A;  3MZY A;  5HVQ C;  1JXS A;  4HLX A;  2HKX A;  4G7Z F;  2XAG A;  2GZW A;  2RC4 A;  3I0T A;  4A5N A;  4KMF A;  2ISZ A;  1G3Y A;  4HOB A;  3KLN A;  2RGV A;  1L3L A;  4M9S A;  1LB2 A;  2OZ6 A;  3G3Z A;  2M1B A;  3DEU A;  2K7L A;  3U9G A;  1D8J A;  2DI3 A;  2RN7 A;  1O7F A;  4TV7 A;  2Z33 A;  2QQA A;  3E6D A;  2E1N A;  5H6Q A;  3FWE A;  3GFL A;  1Y0U A;  2HFH A;  1B9M A;  2XAH A;  2GA1 A;  2VOD A;  1QZY A;  2IP2 A;  1OR7 A;  4QLC U;  1XDS A;  3F21 A;  1Q1H A;  1YW7 A;  3RKX A;  3WE3 A;  3CDH A;  5CJ9 A;  1W5T A;  1XGS A;  4LLG F;  1P92 A;  2FBH A;  1OKR A;  2JRT A;  5L3G A;  4OIR F;  4BNC A;  5ILV A;  2XIG A;  3B73 A;  3ELK A;  1XB4 A;  1T0F A;  2FBK A;  3WOD F;  2P7V B;  4AD9 A;  1HW1 A;  1BOA A;  3PQJ A;  3BWG A;  3ECH A;  2A69 F;  3HOT A;  2JPC A;  2PI0 A;  2WC2 A;  2DT5 A;  4R1H A;  4GO1 A;  3TO6 A;  1XMK A;  1U78 A;  4PGG A;  4LLN A;  4RGX A;  1TNT A;  1LDJ A;  3DPL C;  3JTH A;  4YFX F;  2HR3 A;  2UZK A;  3IL2 A;  2QM3 A;  5J6X A;  4NHJ A;  2ZJ2 A;  4G8X A;  3F72 A;  5F1R A;  2JZY A;  2F5F A;  1RIO H;  2EB7 A;  2DK8 A;  3I64 A;  3RJP A;  5ILU A;  2QBY A;  1BJA A;  2ESN A;  3ERE D;  3FX3 A;  1JHF A;  3WGH A;  4RAZ A;  2XKP A;  2ADU A;  5TRD A;  2MBF A;  1WWX A;  4HLY A;  1YG2 A;  5CVU A;  2C6Y A;  2MC3 A;  1IN8 A;  1J0R A;  2PBI A;  5E8I A;  4I2O A;  4FX4 A;  1E2X A;  3ABU A;  4XRF A;  3MZH A;  5DD8 A;  2KRF A;  2FNA A;  1IN7 A;  4OU0 A;  5K1Y A;  1USS A;  1HKQ A;  3E5Q A;  3KP6 A;  2ZFW A;  3OV8 A;  3FZV A;  3ZMZ A;  3WTU C;  3M7G A;  4L9N A;  4IHS A;  1MKM A;  2BE5 F;  2W25 A;  4Q47 A;  3QP5 A;  1U5T A;  5D5V B;  5LBQ A;  1PDN C;  4HDU A;  3HIF A;  1TQI A;  4MQV A;  2QBY B;  1KU9 A;  4LJZ F;  4GGG A;  3FMR A;  3GO5 A;  4IRH A;  5KVR A;  2GWR A;  1BC8 C;  1ZH5 A;  4ESJ A;  2XKO A;  2CFX A;  1Z05 A;  3IRR A;  1DPU A;  2DK5 A;  2W57 A;  5LHH A;  1R5G A;  2IW5 A;  4Y15 A;  4L5I A;  3VEP A;  3E5X A;  4S04 A;  1S6L A;  2EWN A;  5DUI A;  1K79 A;  2FEZ A;  3ABT A;  3HRU A;  4UHT A;  1BI2 A;  1ZHF A;  1ULY A;  1KGS A;  5AON A;  2IPQ X;  1STZ A;  2L4M A;  1MZB A;  4OMZ A;  3W6K B;  5H6R A;  4M73 A;  5IT3 A;  4S05 A;  3HSF A;  4CYD A;  3MQ0 A;  4ETS A;  1P6R A;  1U5T B;  2HGC A;  4AIH A;  4WXH A;  3FF5 A;  3RDI A;  2OQG A;  2PN6 A;  3R60 A;  5DCM A;  3IRQ A;  1H9T A;  2HTS A;  1O3S A;  4XLP F;  4AWX B;  2W85 A;  2MD5 A;  5CVV A;  3R0J A;  3BRO A;  1T38 A;  2PMH A;  5LGN A;  4CZZ A;  4HX8 A;  4B09 A;  2WTE A;  3WE2 A;  2F2E A;  5A2Q Z;  4XLN F;  4KUM A;  1QZZ A;  1YTY A;  1BBY A;  4L0Y B;  1R7J A;  1DDN A;  5JI6 A;  4LFU A;  3Q5F A;  3WU0 A;  3LWF A;  1B6A A;  3TO9 A;  2RNJ A;  1J59 A;  3E6M A;  3WU1 B;  5HDN A;  2DQR A;  2EFP A;  1KYW A;  5JVT A;  3F6V A;  5K5O A;  2K4J A;  5DD4 A;  3HHG A;  1XN7 A;  2BEO A;  2Q0O A;  1BI0 A;  5E8G A;  3SFZ A;  3WGI A;  1LVA A;  3G73 A;  4RAY A;  4U0Y A;  1KU2 A;  3F8M A;  3F23 A;  2P6T A;  1D5V A;  3BJO A;  5HS7 A;  2OBP A;  3C18 A;  4EM2 A;  5DDG A;  1MDM B;  5HS8 A;  4QWQ A;  3RPU A;  2OZU A;  4FX0 A;  1QO0 D;  2Z5U A;  3OOP A;  2V1X A;  2QQB A;  3ZP5 A;  3BOQ A;  2IT0 A;  4HV5 A;  1BI3 A;  1S7O A;  1YS6 A;  2BBY A;  4AVP A;  1WSU A;  1UCR A;  1FX7 A;  2VOO A;  4EJV A;  1R23 A;  1FYL A;  1ZLK A;  4UVC A;  2PFB A;  2IA0 A;  1YFH A;  4G7H F;  1ZRE A;  2LDU A;  3W6J B;  5E1X A;  1I1G A;  5TJJ A;  3SZP A;  1J7K A;  4G6Q A;  2GQQ A;  1S7A A;  3LAJ A;  2MH2 A;  2UXN A;  2YU3 A;  3WTV C;  1HQC A;  3I59 A;  4EJO A;  1SFE A;  1RZ4 A;  5BPI A;  1O7L A;  5D6F A;  4M9Z A;  3GX4 X;  1W7P D;  2CQK A;  4I98 B;  3K69 A;  2FQ3 A;  3EET A;  4YFN F;  3BPV A;  5DUK A;  3MFK A;  2FF4 A;  4I09 A;  1T98 A;  2QQ9 A;  3KE2 A;  2QVO A;  3KP4 A;  3ZMS A;  3GFJ A;  5CVR A;  3P9C A;  4OMY A;  3T8R A;  2RV8 A;  2K86 A;  4EQQ A;  1O3R A;  2LNB A;  3T5X A;  5D5X B;  2B0L A;  4R79 A;  4BH9 A;  3TDZ C;  5E1Z B;  1I27 A;  3HHH A;  4ZYG A;  3KCC A;  2K27 A;  1FY7 A;  4KIC A;  2DW4 A;  1I1S A;  5LEJ A;  2JT1 A;  4OIO F;  2VE8 A;  2M5W A;  2RKH A;  1AOY A;  4XSZ F;  1MD0 A;  4CDG A;  4U7B A;  2D2W A;  4YIF A;  4WCG A;  5DV5 A;  2FBI A;  3HYI A;  1XD7 A;  2NYX A;  3WTT C;  2P6S A;  2KIU A;  3JAM K;  2QZ8 A;  3FMS A;  1RI7 A;  5FGM A;  4M71 A;  1AWC A;  5LRS A;  5J8C A;  4AIJ A;  5HDG A;  2CWE A;  4ESB A;  3WTZ A;  1ZRC A;  5HS9 A;  3HSR A;  5FLX K;  4G6D A;  1JGS A;  2MH9 A;  1ZGJ A;  1R36 A;  4K2E A;  4KMU X;  2O3F A;  3BJ6 A;  4Q48 A;  1L0O C;  4PZJ A;  1FOK A;  1FSH A;  3D0S A;  4ESF A;  5J8F A;  4RB2 C;  3SHF A;  2ZNY A;  2K4B A;  1U5T C;  2H6B A;  5FFX A;  2E7X A;  4YII A;  4Y13 A;  1EV7 A;  1SAX A;  3QAH A;  2HYF A;  4IRI A;  3IC7 A;  3V8L A;  1S8N A;  1P4A A;  2QUF A;  3DPT A;  2W84 A;  1VTN C;  4WX9 A;  5D4R A;  2XRN A;  5LRR A;  3KP2 A;  4CXF A;  1FC3 A;  4JQF A;  4HQM A;  4KFC A;  2G7H A;  4KIB A;  3LA3 A;  1EH6 A;  3Q9V A;  1TW3 A;  4B8X A;  1V4R A;  3ZPL A;  5DCF A;  3M8F A;  2DU9 A;  2FA5 A;  1XCB A;  4IXA A;  2F5C A;  5F64 A;  5D5U B;  4L9J A;  4GYI A;  1GXP A;  4NQW A;  2WV0 A;  1EH8 A;  4WF2 A;  3WTW C;  2XGX A;  2AS5 F;  2DFI A;  2DAO A;  1ODD A;  2EFO A;  2GAU A;  4KDP A;  1SD7 A;  1FBS A;  4U7D A;  1FYM A;  5CVJ A;  2KKO A;  1ZN2 A;  2PLY A;  3BDD A;  4M74 A;  3JW4 A;  1XSD A;  1HW2 A;  1K6O A;  2PEX A;  5HLI A;  1JHH A;  2G9W A;  3J81 K;  1SFU A;  4UV9 A;  2K02 A;  2F5D A;  2XRO A;  2OQR A;  2CW0 F;  4KT5 C;  2M87 A;  3DXJ F;  3QU3 A;  1UST A;  4ZYD A;  3F8F A;  1I5Z A;  1XGM A;  1YYV A;  4GYG A;  4ZYH A;  3J80 Z;  2Q2E A;  4U88 A;  3ECO A;  3RYP A;  1T2K A;  1ZRF A;  3FMQ A;  1ZAR A;  2RDP A;  3TDU C;  2VBW A;  5ED4 A;  2M30 A;  4NB5 A;  1TNS A;  4RGR A;  1FP2 A;  1I6X A;  4O3M A;  3I54 A;  4RGU A;  3TO7 A;  1IF1 A;  3O3K A;  3P9I A;  3I71 A;  1W7P A;  4YFK F;  3QU6 A;  4KA4 A;  4G7O F;  4ENN A;  4Q4Z F;  2EFW A;  3NRV A;  2ZNZ A;  3DQV C;  5D6E A;  2D1H A;  5H20 A;  2LF7 A;  2DLL A;  1V3F A;  1SMT A;  4A0X A;  1MGT A;  2FOK A;  1ON2 A;  4MEX F;  1YLF A;  1BIB A;  3KP7 A;  2VBX A;  3KZZ A;  1K78 B;  3RI4 A;  1D8K A;  4OIP F;  1GHC A;  2O6G E;  4M6Y A;  1R1T A;  3CUO A;  1UHM A;  3N4M A;  4M6X A;  2IVM A;  1XMA A;  1LNW A;  4ON0 A;  5L3E A;  1XGN A;  4LLL A;  4M9X A;  4EJU A;  1QBJ A;  1BC7 C;  3R6S A;  3E6C C;  1HKT A;  4WXD A;  1OYI A;  1P4X A;  2Y48 A;  4EGY A;  1MDM A;  3N97 A;  1YS7 A;  3GUD A;  4EGZ A;  4LG0 A;  1KU7 A;  2QLZ A;  4BAY A;  1W7P B;  1BI1 A;  2ZKZ A;  2D1V A;  1TLH B;  1XDU A;  3FM3 A;  4MNU A;  1IZ1 A;  4IVN A;  3GFM A;  3H3U A;  4A0Y A;  3GW2 A;  2KIM A;  3RKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...