1SD4A

Crystal structure of a semet derivative of blai at 2.0 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
QVEISMAEWDVMNIIWDKKSVSANEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
molecule keywords PENICILLINASE REPRESSOR
total genus 37
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd4A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd4A02
2P4WA 2MBFA 1TNTA 1YYVA 2E1CA 1EH7A 2M30A 2VONA 3S2WA 3C7JA 4XSZF 4HAMA 4KNYA 2VXZA 2FBIA 1HW5A 5JI6A 2P6SA 2RC4A 3ECOA 3U9GA 2H6BA 2ACJA 3I58A 4AD9A 4CICA 3VFZA 3JTHA 2CSOA 2R3SA 3GFIA 2BV6A 2VODA 3M7GA 4HOBA 3FXQA 1IN5A 1LEBA 3CO6C 1T6SA 2DTRA 1MDMB 1L0OC 2ZKZA 2NAZA 4KN7X 4ENNA 2XAGA 4JQFA 3MWMA 3V4GA 1HSJA 3G3ZA 2GA1A 3MQ0A 5D6FA 5FLXK 4P96A 4A0YA 4IRIA 3F72A 4IF4A 5K5RA 4MTDA 4MEYF 1U8RA 2MD5A 2J5OA 3FMRA 2YX4A 1F1ZA 2KJBA 4WWCA 5DUKA 1U5TA 3P9KA 1QZYA 2KRFA 5JFRA 1LQ1A 2A6HF 4KIFA 4KICA 4R79A 5CYVA 4HDUA 1FSHA 4LLNA 2IW5A 1FZPB 3TDUC 2BE5F 1ZLKA 3L9FA 1PP7U 3JAMK 4EGYA 4RGUA 1EH8A 2VBZA 3ERED 2RKHA 3T5XA 3I54A 3E5QA 5H6RA 5LEKA 3EDPA 3ZN1A 4LG0A 2DO7A 5L3FA 1L3LA 3DPLC 3D0SA 1YFHA 3E6CC 4M74A 3F21A 1O3SA 2DPDA 2IA2A 4UNOA 3J81K 3T8TA 3ZQ7A 5HLGA 5E1ZB 1XCVA 2IPQX 2HWVA 3N4MA 1IXSB 1JHFA 1BIBA 2DK8A 3BWGA 3HRMA 1MD0A 2ZMEB 4PZJA 1WKMA 3JTGA 1W5SA 3HHGA 3MZHA 3FWEA 2J5PA 2FXAA 6PAXA 2ESHA 4HBLA 1R7JA 4Q5SF 1SFUA 4AIKA 2Q2EA 2G7HA 1R36A 1ZRFA 5K1YA 1R1VA 4OOIA 4HQEA 2QBYA 1R22A 1F5TA 2JPCA 3IKVA 1BC7C 1U2WA 3ZMUA 1UFMA 4A5MA 4UHTA 2W84A 1J0RA 2H6CA 4ZZLA 1I1SA 3QPTA 2CYYA 1AOYA 1JHHA 2E7XA 2K7LA 1HSTA 3DPTA 4EMSA 1KYZA 1LDKB 5LBQA 2RQPA 2P6TA 2OD5A 1QO0D 1XSXA 4RAZA 1ZGAA 2R7DA 1Z6TA 3RTRA 3CTAA 3LAJA 1FNNA 2HTJA 3RPQA 4CXFA 3PFIA 1YG2A 1DPUA 3I59A 1X3UA 2P7CB 1FYLA 2M8EA 4O5VA 2LSOA 3RKYA 1HKQA 5A2QZ 4S04A 3LA7A 2PMHA 4BQAA 1HW1A 1WRJA 3RKWA 2RGVA 5LHIA 2Q0OA 3W6KB 3F3XA 4G7OF 2XGXA 2ESNA 2EK5A 1S6LA 3L7WA 3IC7A 5H6QA 2STTA 1YW7A 4M6XA 4BYYA 1KU9A 2GIVA 3JSOA 1IF1A 2B0LA 1D5VA 2QQBA 3K1PA 3GVAA 2H94A 3GFMA 2EFWA 4A12A 4EJTA 3TGNA 3LQQA 1J75A 2A07F 3O3KA 3GWZA 4A0XA 1XGNA 3N97A 2Z5UA 1K7AA 4BNCA 1Z9CA 1QGPA 3ZMTA 5E8IA 2IA1A 1V3FA 2EV0A 5F1RA 3P9IA 4MTEA 3LFKA 5DD8A 3WE3A 3IKTA 2COMA 2WV0A 4IRHA 1XCBA 1ZAOA 3HRUA 1ZYRF 1O7LA 2CG4A 5FGMA 4Z2YA 3KCCA 1MGTA 4JK1X 5F64A 1RZ4A 1ZH5A 4XRFA 1FP2A 3BJ6A 2AXLA 2H27A 1V4RA 1IRGA 2ZMEA 2QYOA 3M1EA 4FX0A 5IT9Z 3L00A 4ZYGA 1H9TA 5BQTA 3KLOA 1R5GA 4F7ZA 1LB2A 4G7HF 3QP5A 5BMZA 2HYGD 1FYKA 3G73A 5TJJA 2P5VA 2W25A 2XAQA 1S3JA 4EM2A 2F2EA 4KMUX 5L3GA 2LNBA 3VOEA 3RYRA 1W4MA 3C3WA 4NB5A 3ZN0A 2P7VB 1KU7A 2GZWA 1I6XA 1KU2A 5FD5A 2LDUA 3HTSB 1BI3A 1S29A 1W7PA 2YSRA 3I4PA 3T1BA 1J9IA 2K86A 1YTYA 4HA8A 2FBKA 5FLXZ 1A04A 3CUQC 1K6OA 3EYYA 4L5IA 3CUQA 3GYHX 1SMYF 1FYMA 4HZFA 4XLNF 1W7PB 1OMIA 4U0WA 2IRFG 2P5KA 2LF7A 1XMAA 2W24A 2XASA 3QRFF 1S8NA 3RIRA 3BJAA 1QZZA 1SMTA 2XAFA 4I02A 1TBXA 2ZCWA 4S05A 2FA5A 4ENMA 1HKSA 4HV6A 5K5OA 5CVIA 4RB3C 4L5JA 3KFWX 4M9XA 2PN6A 4ESBA 1UB9A 2HGCA 1FP1D 3E3VA 4JBAA 5DUIA 5KVRA 4LD5A 1F9NA 2O6GE 3EUHA 4LJZF 1IAWA 2C6YA 2OU2A 4PGGA 4MEXF 3PQKA 1G3WA 1YQAA 3R60A 4FT8A 4LK1F 1B1BA 2CW0F 2ELHA 2RVCA 3NQOA 3I71A 2XAHA 4IPAA 1LVAA 4M6YA 5D5WB 2FU4A 5LEJA 1B6AA 1G3SA 5AONA 1ZLJA 4L18B 2WTEA 4A5NA 4YIFA 3E97A 3L2CA 2BEOA 1USTA 2FSWA 5IT9K 4KFCA 2VE9A 2EWNA 4TV7A 3KETA 4B09A 1BM9A 5LGUA 1KQ0A 1J7KA 4U0VA 1XN7A 2HQRA 5D5XB 4EM1A 4N9IA 1T2KA 3I64A 2EA2A 3DF8A 1ONVA 1SD6A 2A68F 3KZZA 5CLSA 2DW4A 2EB7A 5L3EA 1I27A 1P4AA 3WTXC 2PI0A 4P9UA 4L9NA 3F6OA 3Q5FA 4IHSA 1B4AA 1B59A 2PBIA 1H0MA 2F5CA 3HOTA 4RB2C 1U6GA 2K27A 1Z91A 4N9HA 3WTZA 2XUBA 4UVBA 3ML6A 5BPIA 1IXRC 3M8FA 4EM0B 2QVOA 2V1XA 2YU3A 4OU0A 3ELKA 2GWRA 1G6NA 1FT9A 3WTVC 2STWA 4CYDA 3RJPA 4KA4A 2Z99A 2MLKA 3HRTA 1KA8A 4WX9A 5AIQA 3F8FA 3F8MA 4ON0A 3CDHA 3K1MA 5J8CA 4D0PA 5LRRA 4LG0B 3KP4A 1ZREA 2IA0A 2Z33A 4BHCA 1DUXC 4IXAA 1D8KA 4MGRA 3DV8A 4A2UA 2A61A 3REOA 4M9SA 1O57A 1FSEA 5HS9A 1IN4A 5JVTA 3IRRA 1J5YA 3BPXA 1QQIA 5L3CA 1Z1DA 4FX4A 3SQNA 1TQIA 3ABUA 3JW4A 2HKOA 2L02A 1R58A 1NHAA 1P92A 3FXRA 5LGTA 2G9WA 4OIRF 1J2XA 5DEQA 1ZG3A 4MQ9F 2GQQA 1IXCA 2IVMA 3GFJA 4LGWA 3DXJF 4KMFA 5TRDA 3Q9SA 4LLGF 4RGRA 1XGOA 5HS7A 3TQNA 2HYFA 2V1UA 5LRSA 1HW2A 4WXCA 1YW9A 1LDDA 2QENA 4Q48A 1HBXG 2M87A 4RB1A 4G8XA 4UXNA 5EEHA 4I2OA 2BYVE 1UHWA 4RAYA 1SD4A 2IT0A 4HV5A 2VC1A 1XSDA 2MA3A 1I5ZA 1T38A 2ISYA 2QM3A 2GAUA 3KP6A 1ON2A 1TTYA 3ZMDA 2HR3A 3GO5A 1OR7A 5D4SA 2K02A 4G6DA 3C1DA 4IRGA 3LAPA 4I0AA 3WE2A 3F22A 4R1HA 5H20A 4N0BA 1Z6RA 4O3MA 2XIGA 2VT2A 3I59B 2DQRA 4EGZA 3F6VA 1CF7A 2GXGA 4BAYA 2L3DA 3EQLF 2V1DA 3HSEA 4G9YA 3WGGA 5CJ9A 5FD6A 1FLIA 1HKTA 5DCMB 1SD7A 2PMUA 4WK8F 3R0AA 5HOOA 2NRAC 4PCQA 3J80K 3RKXA 3FX3A 3HSFA 1UCRA 2DT5A 4ESJA 4WXDA 4L9VA 3FF5A 2M5WA 4HQMA 3VEPA 1J59A 1QBJA 2GA2A 4HW0A 4QWQA 5ICFA 4P5OA 4OIOF 2EFNA 2R7FA 3F8BA 2XKOA 3GW2A 4GXOA 3V7SA 4BHPA 5E18F 3P7NA 2VBXA 2A5YB 2QUFA 2JZYA 1O7FA 2DAOA 1LJ9A 3VB2A 2VE8A 2FE3A 4Y15A 5AIPA 4U0YA 2V9VA 4IJAA 4YFXF 2X4HA 2GXBA 4A6DA 5HDKA 2HOEA 4UUVA 3IRQA 5DD4A 4I01A 2VBYA 3RI4A 2M45A 1Z05A 4Y13A 2D45A 2XVCA 2QBYB 3WTWC 2PQ8A 3H3UA 2XRNA 1ON1A 4I98B 1RI7A 3ABTA 2OZ6A 1W7PD 3HTUA 2O8XA 1PUEE 3HRSA 4OMZA 4EVIA 2WWYA 4U7BA 3J7AO 3T8RA 4KT5C 4NQWA 4Q47A 1SFEA 1FPQA 3OOPA 1Z7UA 4G7ZF 3GLXA 2DQLA 1ZARA 5ICEA 2NYXA 3O6BB 4M72A 3TDZC 4KDPA 3F23A 1IN7A 2HEOA 1G3TA 1U5TB 2KIMA 3DQVC 3GF2A 4OIPF 2D1VA 2IP2A 4CDGA 1PDNC 2FMLA 4UV8A 3WTTC 4Y17A 3K1NA 3TKYA 4QLCU 2XROA 3J81Z 5ICCA 1ZRDA 1U3EM 1JXSA 3JAMZ 2DLLA 3WTYC 1LDJA 3D5LA 4MHGA 2L4MA 2DU9A 3BZ6A 5DDGA 3QAHA 2FQ3A 2HKXA 4XSXF 1T98A 5BPDA 1IW7F 1FBSA 3GZ5A 4YIIA 3SXYA 4UVAA 1W5TA 3QU3A 4GCVA 3COAC 1ZG5A 1BI2A 3K9TA 3KP2A 1ZGJA 2K4BA 2VBWA 4M71A 3WODF 2KJCA 2RN7A 2OZUA 4OIQF 3H3ZA 2F5FA 4Q4ZF 3B73A 1RNLA 5BOXA 1GXQA 2QQ9A 4PDKA 4BHBA 2XHKA 3KEOA 4XLPF 5J6XA 5D5VB 4UV9A 2A6EF 5ERIA 1AWCA 2BBYA 2HS5A 5J8FA 3FZVA 1GHCA 3MAJA 1S7OA 3WGHA 2MLGA 4I09A 3V7CA 1BBYA 4U88A 5DV5A 5D5UB 3MEXA 2OAZA 3H92A 3ROUA 1U5TC 4CHUA 1C0WA 1FX7A 3V8KA 5ICGA 4UVCA 1D8JA 4WXHA 1B9MA 3RPUA 2UXXA 4EJUA 4RGSA 3KP5A 2X0LA 4AWXB 2L54A 5HLIA 1HQCA 3BDDA 3TO7A 2LF8A 3GX4X 3E6MA 2KKOA 1XB4A 2ZO4A 4YFNF 4AIHA 3V8JA 1LEAA 3KEQA 1BIAA 2YX7A 1ODDA 4E70A 3WTUC 2OQGA 5HDNA 3GZ6A 3B02A 5L3DA 3LQRA 2ADUA 1WWXA 1DDNA 1KGSA 4G94A 1TQPA 4GYIA 1XSVA 2HFHA 5KK1A 4M73A 1XMKA 2A69F 2EJRA 2ISZA 2DBBA 4MNUA 3PQJA 1BJAA 4AVPA 2XAJA 4ZH4F 3VODA 2V6CA 5FFZA 2PEXA 1IRFA 1R5HA 2XV4S 1OYWA 1XDSA 2PJPA 2Q8KA 4KIGA 1O3QA 3LWFA 2AS5F 2EA4A 3IWZA 1ZG1A 4GYGA 2PFBA 2PG4A 2HQNA 4RS8A 4EJOA 3CLOA 2E1NA 5E20A 5FFXA 1R23A 5HVQC 3BJOA 1EH6A 1GVJA 3HOSA 2D1HA 5D8KB 3FHZA 4O6JA 2Y48A 5K5QA 2O0YA 2RV8A 3LSTA 2M1BA 1Y0UA 3KP3A 4OMYA 1KQ8A 3K69A 1D3YA 3EETA 2HZTA 1IUYA 2MH9A 3DKWA 3QOPA 2EFQA 1O3RA 2TDXA 4NHJA 4FHTA 1MJ9A 4MQVA 3ZMSA 1TNSA 1USSA 3DEUA 5HDGA 3QPHA 2FBHA 1FOKA 2EV5A 4ASNA 1VTNC 2VN2A 3FXUA 1S7AA 3SZPA 1UHMA 4WCGA 4HLYA 1BN5A 2JT1A 2PLYA 5FB2A 3U2RA 4B8XA 3WU0A 1TW3A 5LGNA 1B9NA 2P5LC 3TO6A 3M8EA 5JHUA 5D6EA 4LMYA 2MH2A 3I53A 2OA4A 4KIBA 5CVUA 3WU1B 3I0TA 2XKPA 4L9TA 4WF2A 3CUOA 3ZMZA 4EQQA 2CGPA 3ECHA 1O3TA 2L4AA 2QWWA 4LK0F 5CVVA 1FY7A 4KUMA 3FMQA 1R1TA 4L9JA 2O03A 5L3BA 1TLHB 4A0ZA 1MJAA 1H9GA 1U78A 3R4KA 1SAXA 2JTVA 4ZYDA 3J80Z 5F6FA 3V7RA 3QP6A 4KN4X 1LNWA 5ILUA 4R8HA 3ISPA 3SZTA 2P8TA 2QLZA 5ED4A 3IWFA 2EFPA 1RUNA 4LB6B 4LLLA 2F5EA 5DCMA 2Z9OA 4PGHA 1IN8A 1XGSA 3KZYA 3F8CA 3L09A 1REPC 3IHUA 4EJWA 2VOOA 3E5UA 2FOKA 4HLXA 1R1UA 5D4RA 3HUGA 1WQ2A 3F8NA 3WG9A 5LLQA 2QQAA 3MCZA 1JE8A 4LB5A 1MZBA 1P4WA 2RDPA 2UWMA 1KYWA 4GGGA 1YW8A 3KLNA 2RNJA 4HF1A 3GFLA 3K0LA 1STZA 1KU3A 4G6QA 2LKPA 1K79A 3V8LA 3TO9A 2ZJ2A 1MJBA 5E1WA 4BH9A 3E5XA 3R6SA 1BOAA 1IZ1A 1HXDA 2UZKA 1EV7A 5JR3A 1YS7A 1G4DA 1OKRA 2E7WA 4RB0A 2O3FA 2YPRA 4U7DA 2FRHA 4HF2A 4ENKA 4HX7A 1MDMA 1SD5A 1E17A 3E6BA 1ZRCA 1P4XA 1G3YA 3FM3A 2OBPA 1T0FA 2QZ8A 3DP7A 5EEGA 3MZYA 2O61A 3GEZA 4L0ZB 4HF0A 4P55A 2UXNA 4ZYEA 3BY6A 1I1GA 1GXPA 2L01A 3ZPLA 3M9AA 3E6DA 1YIOA 2HTSA 4ETSA 2ZNYA 5ILVA 3R61A 3CUQB 4L0YB 2CQKA 5ILSA 2W85A 5DCFA 3HHHA 1YS6A 4ENJA 5HS8A 1TW2A 4BXUA 4OINF 1OYYA 1BC8C 3NRVA 1DP7P 4K2EA 2DK5A 2F5DA 1DPRA 2BGCA 1BI1A 1P6RA 5CVRA 4DQ2A 5HLHA 3ZMVA 3CO7C 1FWZA 2NS0A 2A3SA 2JSCA 2VOPA 4GO1A 3BROA 3ULQB 3I5UA 2Z3YA 3WGIA 4DNCA 2CWEA 3GXOA 1ULYA 2W57A 4CO8A 1R00A 1P2FA 2V79A 3CJNA 1F4KA 2YR2A 4HX8A 3IL2A 1ZHFA 3DFGA 1KQ9A 5BS6A 3R0JA 2ZBKA 2FF4A 1BI0A 5IT3A 5E1XA 1FC3A 4AIJA 2ZFWA 3BPVA 2NNNA 5FO5A 1WI9A 3FMSA 3P9CA 2H09A 1CGPA 4ESFA 2MC3A 1JGSA 1XD7A 5LHGA 2IJLA 3HIFA 4I0BA 1SFXA 2JPBA 4HX4A 3MFKA 1MKMA 1IN6A 1RUOA 4KYWA 3HYIA 5DYMA 4ZYHA 3RDIA 3Q9VA 4LFUA 4EV0A 1RIOH 4YG2F 3O2PE 3BP8A 3KE2A 1XDUA 1YLFA 3OV8A 1OPCA 2EFOA 3T0YA 3AAFA 5LHHA 2FNAA 2G7UA 4IHTA 3KP7A 2DI3A 2ZXJA 1FBUA 1YO5C 2DPUA 4XBFA 5CVJA 5E17F 4P9FA 2HDCA 2FNPA 1XGMA 2KIFA 1QNTA 2Y75A 4CGZA 3ZP5A 3W6JB 2D2WA 1WSUA 1FBQA 2FEZA 2ZNZA 1K78B 1TQMA 1OYIA 3QU6A 3C18A 3EYIA 2VT3A 3SFZA 2FMYA 2CO5A 5D8LB 2WC2A 5E8GA 3LA2A 5A2QK 3U1DA 4A6EA 1K78A 2DFIA 4RGXA 1CF7B 3TOAA 3RYPA 4HDVA 3GUDA 2NNYA 2EV6A 1PP8F 3HSRA 1Q1HA 3K2ZA 2VC0A 3TOBA 2K4JA 1T39A 3FM5A 4HYEA 1ZN2A 3SHFA 4I7HA 1E2XA 4IVNA 3NEUA 4YFKF 3JSPA 2CFXA 3BOQA 3WTSC 4ZZDA 2JRTA 2ETHA 2KIUA 4H0EA 3LA3A 1QPMA 2Y0MA 2OQRA 4M9ZA 4EJVA 4CZZA
chains in the Genus database with same CATH superfamily
4HG2A 2EH3A 2P4WA 2IGMA 2MBFA 2HOTA 1V54H 1TNTA 5B5EC 1YYVA 5HODA 2E1CA 1EH7A 2M30A 2VONA 4HSRA 3S2WA 3CLQA 4BGDA 3C7JA 4XSZF 4HAMA 5K7FA 1NK2P 2HPIA 3ZQLA 4KNYA 2JWTA 4F92B 2VXZA 2FBIA 1HW5A 1QA6A 5JI6A 1HA8A 4BE1A 1MH3A 2P6SA 1RESA 3CMMA 2RC4A 3ECOA 3GTPJ 3QPLA 3OYCA 3PSFA 3U9GA 4JX5A 2H6BA 3OYBA 2ACJA 3FXKA 3I58A 4AD9A 4CICA 3VFZA 1Y56A 3I56I 2OTLI 3JTHA 3E7LA 2CSOA 2R3SA 2P0WA 3GFIA 2BV6A 2HDDA 3HOVJ 3LL7A 2BXZA 2IS1A 2VODA 3M7GA 4HOBA 2V7FA 3FXQA 2HI3A 1BR1A 1IN5A 1YRNB 1OR7C 4PJMA 1LEBA 1MBJA 3CO6C 1T6SA 3GTJJ 2DTRA 1MDMB 3HOYJ 1FMVA 3H9JA 1L0OC 2ZKZA 2NAZA 3J7ZI 1P7IA 2M7AA 4KN7X 4XNFA 4AYBN 1ACIA 2MC4A 4ENNA 4F55A 2XAGA 5LFAA 3DTIA 4JQFA 1WZ2A 3MWMA 3V4GA 1HSJA 2CQ7A 3G3ZA 2Y9ZA 1YRNA 2GA1A 3EPZA 4F3QA 1JKPC 3MQ0A 5D6FA 5FLXK 4P96A 2BY3A 3PNYA 4A0YA 2XF6A 1LFUP 4IRIA 3F72A 4IF4A 2O9LA 5K5RA 4MTDA 4F52A 4MEYF 3GZNB 1U8RA 2AQEA 2MD5A 1K4SA 1W0UA 5FKNA 2J5OA 5KCMA 3FMRA 2YX4A 2OCCH 4G6TB 1FIAA 1F1ZA 1VQ4I 2M7BA 2DCEA 2CV2A 2KJBA 4WWCA 5DUKA 4KITB 1U5TA 3QWLA 3P9KA 2WY7Q 1QZYA 2CUJA 2KRFA 3PUBA 5JFRA 1E0EA 3GTOJ 1LQ1A 2TRTA 2A6HF 1UHSA 2AHQA 2X1CA 3E0JB 2R0QC 5CQEA 2HOSA 4KIFA 4C3HJ 3VYSB 5GTHC 2JJ7A 4KICA 3CCEI 4R79A 5CYVA 3JRIA 4HDUA 3FXOA 1MMSA 1LVKA 5HNFA 1FSHA 4M3EA 3ZRGA 1EA3A 3FISA 2K9MA 4DJAA 4LLNA 2PX9A 2IW5A 1FZPB 2KHMA 3TDUC 2BE5F 1ZLKA 2XPUA 4D5CA 4Z6YA 3L9FA 3G1OA 1PP7U 1W36C 3JAMK 3MVPA 2JA5J 4EGYA 3HPHA 4RGUA 1EH8A 3ZQFA 4OAZA 3OL4A 2VBZA 3IP4B 3ERED 1DP3A 2RKHA 3OSFA 3T5XA 3LFUA 1YITI 3I54A 2W00A 3E5QA 5H6RA 5LEKA 2XSDC 3JRCA 3EDPA 3ZN1A 4LG0A 1YJWI 5E3MA 2GOXB 2DO7A 5L3FA 1L3LA 4BQQA 1N78A 3DPLC 1VFCA 4UUTA 5J40A 3D0SA 4XKVA 1ZELA 1WJDA 1YFHA 1LE8A 3E6CC 4M74A 3F21A 1O3SA 2DPDA 2IA2A 1OCOH 5J1YA 3OYAA 1ZTRA 2E71A 4UNOA 4XRSG 2ME0A 1WHUA 2AXTC 2Y0SA 3NARA 3T8TA 3ZQ7A 3J81K 5HLGA 1Y39A 5E1ZB 1XCVA 2IPQX 4J01A 3K6GA 2HWVA 5DS9A 5C4XJ 3OMYA 4PJLA 3N4MA 1IXSB 1JHFA 3S2DJ 1BIBA 1SEUA 1ETYA 5EDNA 2DK8A 3ABMH 5EZHA 2E36A 3BWGA 3PNTA 3HRMA 4AYBA 1FOXA 1MD0A 2ZMEB 4AC0A 2XB0X 5GAGJ 4PZJA 4ZTJA 2M4KA 4D9JA 2HVQA 1WKMA 2H8WA 3JTGA 3KYCB 3HHGA 1W5SA 3MZHA 3FDYA 3FWEA 2J5PA 3EUHC 2FXAA 6PAXA 4ITVA 1X1PA 1X3WB 2V26A 2ESHA 2OC6A 1R7JA 3LSIA 4HBLA 4BJ5C 5JLXA 4Q5SF 1ENHA 2M9HA 3GTQJ 2HXIA 1SFUA 3WU2C 4AIKA 2LH9A 2Q2EA 4A3FJ 1R36A 2G7HA 2KRHA 1X1BA 1ZRFA 4E7SA 2W48A 5K1YA 1R1VA 3RQIA 2XAUA 4BBRJ 4OOIA 4HQEA 2QBYA 5M5WJ 1R22A 2WAQA 4A3DJ 1F5TA 2JPCA 3OIOA 2KLOA 3IKVA 2CFOA 2D5VA 1BC7C 1U2WA 5FKKA 3BR6A 3ZMUA 3OS2A 2VJJA 4I99C 1UFMA 1VZ0A 4A5MA 3DTKA 2W84A 1S5LC 2VJIA 4UHTA 1HF0A 1J0RA 2H6CA 4ZZLA 1I1SA 2L9VA 3QPTA 1TT0A 2CYYA 3HEFA 1AOYA 1JHHA 2E7XA 2ME6A 2K7LA 1HSTA 4CCOA 1UJ8A 2BY2A 2XF5A 3DPTA 4EMSA 1KYZA 1LDKB 4PJJA 4HNVA 5LBQA 2RQPA 2P6TA 1FJLA 1JTXA 2OD5A 3FXLA 1QO0D 1XSXA 4RAZA 1HOMA 3KEYA 1D1AA 1ZGAA 2R7DA 4JX4A 2MW8A 1Z6TA 3RTRA 3CTAA 3ZQQA 3SZGA 4JX6A 2Y9YA 1WJAA 3LAJA 3OWTA 4LIUA 1FNNA 3A01A 2M3AA 4H4KC 2HTJA 3RPQA 4CXFA 3PFIA 1YG2A 3CJTB 4QPOA 2X6XA 3VYRB 4BE2A 3S15J 3VSKA 4XOTA 1PUFB 1DPUA 2DA5A 4C2MJ 3I59A 1CQTA 1X3UA 3HB9A 5J47A 4V2GA 2P7CB 1FYLA 2M8EA 4O5VA 4BL0B 1VNDA 2LSOA 3A0HC 3OIPA 3RKYA 1HKQA 4RAGA 1JUMA 5A2QZ 1MNEA 2R7SA 4S04A 4D5FA 1A6IA 3LA7A 2PMHA 3PFYA 1VF9A 5KAIC 4BQAA 1HW1A 1WRJA 2PJRA 2E1OA 3QYFA 3RKWA 5GAHJ 3ZXSA 2DA1A 2RGVA 5LHIA 2Q0OA 2VKDA 3W6KB 3F3XA 4G7OF 2XGXA 4RLFA 2ESNA 1LE8B 2EK5A 1S6LA 3L7WA 4FE7A 2MSYA 3IC7A 5H6QA 2STTA 1Z77A 2KFDA 1S72I 1U0JA 1YW7A 4IHYA 2MYSA 4AM3A 1N77A 4M6XA 4UB8C 1WI3A 2PJRB 2BY1A 4BYYA 1KU9A 2GIVA 2WAQN 1E3OC 3JSOA 1IF1A 3AL0C 2B0LA 4C30A 4XIDA 1D5VA 3QODA 4XQFA 2MGQA 3KZIC 5EF6A 2QQBA 4DBQA 2IEKA 3K1PA 2VQGA 3H5AA 3GVAA 4W97A 2H94A 2DMUA 1TWAJ 3GFMA 4XICA 2EFWA 4A12A 4EJTA 3TGNA 3LQQA 1J75A 1M1EB 3CZ6A 2A07F 2X51A 3O3KA 1T0FC 3GWZA 4A0XA 1XGNA 3QYBA 3N97A 4GFBA 4XK4A 3K4CA 2Z5UA 1K7AA 4BNCA 1Z9CA 1P7JA 3BLYA 1QGPA 5FLMJ 2LY2A 3ZMTA 4BDZA 5E8IA 2IA1A 1V3FA 3BTJA 3K4NA 1LFPA 3JRFA 1SANA 4BE0A 2EV0A 5F1RA 3OR2C 3P9IA 4MTEA 3LFKA 4XKBA 2KIQA 5DD8A 2AO9A 3PJRA 1MMNA 2F48A 3S2HJ 1X4OA 3WE3A 4YIRX 2QQ8A 2GOMA 3IKTA 1XTAA 2COMA 2CMPA 2WV0A 1UG0A 2ECCA 3CCMI 4IRHA 1XCBA 1X4PA 2KZGA 1ZAOA 2LBFB 3HRUA 1ZYRF 1O7LA 2CG4A 5FGMA 3OYKA 2ZJQF 4Z2YA 3S3MA 3KCCA 1MGTA 1V5EA 4JK1X 5F64A 1RZ4A 1ZH5A 4XRFA 3ZQHA 1FP2A 3OOUA 3BJ6A 1FTZA 3S14J 1FEXA 2AXLA 2ZC2A 2R7UA 1AKHB 4YEJA 3OS1A 2BOLA 1GVDA 1V4RA 2H27A 1IRGA 2ZMEA 3VPRA 4Y52J 1UELB 2IXSA 1WJFA 1QPIA 2QYOA 3FKJA 2ZXHA 1MNDA 3M1EA 3FHNA 1QHHD 4FX0A 5IT9Z 3L00A 3M1CA 4BQNA 3I9V2 4ZYGA 1H9TA 1TP4A 4XKWA 2NOJB 3OR1C 3H0DA 2PMZA 2B7EA 3UNGC 5BQTA 3F0CA 3KLOA 1R5GA 4LITA 4D1QA 2QEXI 3CJQB 4F7ZA 1LB2A 4G7HF 1B8IB 4XMYA 3QP5A 5E3NA 2DMPA 5BMZA 2HYGD 3G73A 3NWSA 3G6EI 5TJJA 1FYKA 2P5VA 2W25A 2XAQA 2HVRA 1S3JA 4EM2A 5FRMA 4RMNA 2F2EA 5EG0B 2FX0A 4KMUX 1BOBA 5L3GA 1I3AA 4DIQA 4A3CJ 2VB6A 3SDBA 2LNBA 2OUMA 3VOEA 3RYRA 1W4MA 3C3WA 4NB5A 4UB6C 3ZN0A 1BW6A 3DBHB 2KRCA 1OFCX 3N05A 2P7VB 1Z3XA 1KU7A 4I76A 2GZWA 1I6XA 1KU2A 5FD5A 2LDUA 3HTSB 1K83J 2X6OA 2E60A 4XKCA 1BI3A 5EG0A 1S29A 1TWHJ 2LTPA 2BW3B 1W7PA 2YSRA 3I4PA 1MW7A 3T1BA 4XRSA 1J9IA 2K86A 1YTYA 4HA8A 2FBKA 5FLXZ 1A04A 1UMQA 2WAEA 3CUQC 4B44A 4E4HA 1K6OA 3EYYA 1VQKI 1YX5A 4L5IA 2V9KA 1HLVA 4EEFG 3HL2A 3CUQA 3GYHX 1SMYF 3ZQCA 1FYMA 4HZFA 2DJNA 4XLNF 4PFPA 1W7PB 1OMIA 1D0YA 4U0WA 3NAUA 3CC2I 2X1DA 3CQZJ 4EJVA 2IRFG 2P5KA 2LF7A 1XMAA 2L7ZA 2W24A 2XASA 3S32A 3QRFF 1S8NA 3RIRA 3ZQGA 2KISA 3BJAA 1QZZA 1SMTA 2XAFA 2DA6A 4I02A 1TBXA 2ZCWA 4S05A 2FA5A 3JRAA 5BNGA 4BY1J 4ENMA 2JA6J 1QHGA 1HKSA 4HV6A 5K5OA 5CVIA 3SEZA 4RB3C 3ABLH 4L5JA 3KFWX 4M9XA 2PN6A 4E6KG 4ESBA 3LNQA 1MBGA 1UB9A 2HGCA 3JRGA 5M3MJ 1FP1D 3E3VA 4JBAA 2K5CA 2DOEA 2RQQA 3NWTA 3LSMA 5DUIA 4B43A 2XGDA 5KVRA 1T8IA 4LD5A 1F9NA 1BL0A 3DWLE 2O6GE 2DN0A 3EUHA 4LJZF 1IAWA 2C6YA 2OU2A 4PGGA 4MEXF 3PQKA 1G3WA 1YQAA 3R60A 1YJ9I 5IP9J 4M3DA 2KZVA 2XRLA 3K7AJ 4FT8A 4LK1F 3OIQA 3OYMA 1B1BA 1OISA 2G0EA 2O5RA 4IHVA 2EILH 1IV6A 2CW0F 2ELHA 2RVCA 3NQOA 3I71A 2XAHA 4IPAA 1T08B 4IHXA 2H8RA 2W1OA 1LVAA 4M6YA 1FOWA 1YI2I 4RAFA 3HOUJ 3BQYA 2OF7A 5D5WB 5E3OA 2FU4A 3LSHA 3PUFA 5IOZA 5LEJA 1B6AA 1G3SA 5AONA 1ZLJA 4L18B 2WTEA 4A5NA 4YIFA 3E97A 3L2CA 2BEOA 2L0KA 1K6YA 4IZZA 1USTA 2FSWA 5J4YA 5IT9K 1A6QA 4KFCA 1VQ8I 2VE9A 3J7AY 3CCRI 4XLAA 4XORA 4XONA 2EWNA 2KPMA 4TV7A 5FLVA 3L1PA 3KETA 1RR7A 1U9OA 1IUFA 2VUMJ 4B09A 1R71A 2OV7A 2E5NA 1BM9A 2IS4A 3VDXA 4N4OB 1KQ0A 5LGUA 3CCLI 1J7KA 1YE9A 4E7LA 3M3YJ 3DCFA 4U0VA 3S1QJ 1XN7A 2HQRA 5D5XB 4GDFA 2Y2ZA 4YELA 2X6YA 4EM1A 4N9IA 2NVYJ 2JQ7A 1T2KA 1J09A 3I64A 4CZZA 2EA2A 1TWCJ 4L5EA 3DF8A 1ONVA 1SD6A 4CYCB 2A68F 4CUGA 4A3LJ 3KZZA 5CKTA 5CLSA 4OWRB 2DW4A 2EB7A 3K70D 2EZHA 1IDYA 4BEHB 5L3EA 1I27A 1P4AA 2JK3A 2LBFA 1Z3YA 3WTXC 3CC4I 2PI0A 4P9UA 4CSWA 4L9NA 1FMWA 3C2BA 3F6OA 3Q5FA 4IHSA 1BJZA 2WA0A 2VL8A 1ZR4A 3VYUB 1B4AA 2BY0A 3RSNA 1JKOC 4PSWA 1B59A 2Y30A 1H89C 3L2RA 1X58A 2PBIA 1H0MA 2F5CA 2ID3A 3HOTA 4BEHA 3VSLA 5J4VA 3A01B 4RB2C 3A0BC 1OCRH 4I6ZA 1U6GA 2K27A 1Z91A 4N9HA 3WTZA 2VASA 2E2HJ 2DJIA 2XUBA 4UVBA 2L9RA 3ML6A 5BPIA 1IXRC 3M8FA 2ICWG 1R4NB 4EM0B 3GBGA 3FBIB 1VQ6I 1X1AA 2QVOA 2V1XA 2YU3A 2H1LA 4OU0A 3ELKA 4IHWA 4DZJA 2CS3A 2GWRA 1GT0C 1ORKA 2YS9A 4FETA 1G6NA 5B1AH 3JCUC 2R7QA 1Y8QB 2R7XA 1FT9A 3WTVC 2STWA 4CYDA 2QSHX 1IRZA 3RJPA 4KA4A 2Z99A 2MLKA 2K9NA 3W2WA 2F6CA 3HRTA 1KA8A 3BZKA 3L2UA 2HOAA 4WX9A 5AIQA 1W36D 3M8JA 2W82A 3F8FA 4X6AJ 3F8MA 4ON0A 2KMUA 3GCMA 3BR2A 5FKLA 3CDHA 4PJ0C 3K1MA 5J8CA 4D0PA 2X85A 4ZC3A 5LRRA 3JRHA 4LG0B 2R92J 3KP4A 1WPKA 1ZREA 2IA0A 1VQOI 2Z33A 4BHCA 1DUXC 4QIWN 1WFXA 4IXAA 1D8KA 4KT6A 1MNMC 4MGRA 2ELKA 3DV8A 4A2UA 1SVLA 3CJRB 2A61A 5DTDA 3REOA 1RPWA 4M9SA 2MG4A 4PJNA 2LKXA 1O57A 1FSEA 3ASOH 1ETQA 4MFDA 4CCMA 1W1WE 5HS9A 2EIMH 1DGRM 1IN4A 5JVTA 2JRMA 3DKXA 3IRRA 4B3AA 1J5YA 3BPXA 1QQIA 1AHDP 5L3CA 3U21A 3EUKL 1Z1DA 2R7RA 4FX4A 3SQNA 1TQIA 3HOWJ 2DODA 1P9QC 3ABUA 4M3BA 3JW4A 4NBQA 2HKOA 2L02A 4C3JJ 3DBLB 4C3IJ 1R58A 1ETOA 1ITYA 1NHAA 1P92A 5E79C 3FXRA 4CCKA 5LGTA 2G9WA 3BTLA 4QTRA 2FD5A 4OIRF 3SFIA 1J2XA 4Y4RA 5DEQA 1ZG3A 4MQ9F 2GQQA 1IXCA 4B47A 2NOGA 2ID6A 4FISA 3CCJI 5K7HA 2GBYA 3OS0A 2IVMA 3GFJA 4A69C 3A1YA 4LGWA 1UZCA 3DXJF 4XLFA 4KMFA 4QPQA 5TRDA 3K70C 1QVUA 4A3IJ 3Q9SA 4LLGF 4RGRA 1XGOA 3GLLA 5HS7A 2Y69H 5F0CA 3TQNA 2HYFA 2V1UA 5LRSA 1HW2A 4WXCA 1YW9A 5IP7J 2ZFUA 2LFBA 1LDDA 2QENA 1MH4A 4Q48A 1HBXG 4BXFA 2M87A 4RB1A 4G8XA 4UXNA 2DYRH 5EEHA 4I2OA 2EBIA 2BYVE 1UHWA 1BW5A 4RAYA 1SD4A 1Z21A 2F4OB 4ZDPA 4ABZA 3V42A 2IT0A 2DMTA 4HV5A 4XOPA 2VC1A 3W3CA 1XSDA 2MA3A 4BBSJ 2HQAA 1G8XA 4PUSA 1I5ZA 1MBFA 2OJED 1Y1VJ 2VLAA 2CUZA 4E7JA 1T38A 2XGCA 5CQGA 2CV0A 2ISYA 4CCLA 2QM3A 2KDZA 1X3ZB 4LG3A 2GAUA 3KP6A 1E3PA 1ON2A 1TTYA 3ZMDA 3ZR8X 1D1BA 2HR3A 3GO5A 1OR7A 5D4SA 2WB1N 2RAEA 5GAEJ 2K02A 4G6DA 2LC2A 5LD2C 3C1DA 4IRGA 3LAPA 4E7ZA 4I0AA 3WE2A 3C2GA 3F22A 4R1HA 4FQGA 1ETXA 4N0BA 5H20A 1Z6RA 4O3MA 2XIGA 2R7WA 2VT2A 3I59B 2DQRA 4EGZA 3F6VA 2Y0SN 3FXJA 2JN6A 3FK6A 1D5YA 4II3A 1CF7A 2GXGA 4BAYA 1Z0XA 2L3DA 3EQLF 3KX2A 2V1DA 2E34A 3HSEA 4G9YA 3WGGA 5CJ9A 1HDPA 1S7EA 2VXDA 5FD6A 1FLIA 3BR3A 1HKTA 4XLHA 5DCMB 3FKIJ 1G59A 3LSJA 1JI8A 1SD7A 2PMUA 4WK8F 1OLTA 3R0AA 3LSRA 2WB1A 5HOOA 4F91B 4PCQA 3J80K 3RKXA 2NRAC 3FX3A 2Q1ZB 5JLWA 2W4SA 2EZIA 3AFHA 2LG4A 1TT5B 4IEJA 3B6CA 5F08A 2LR8A 3HSFA 2N8GA 2QSGX 2IS6A 4E7KA 1ZR2A 1UCRA 2DT5A 1HCRA 4ESJA 1QU3A 4WXDA 4HSTA 4L9VA 3LSPA 2QCOA 4MO7A 3BR5A 2NS8A 3FF5A 3CP2A 1EF4A 2EPFA 2EIKH 2M5WA 2MD0A 4HQMA 1TWFJ 3VEPA 1J59A 2GA2A 1QBJA 4HW0A 4QWQA 5EZGA 2LVSA 3IAM2 2NXNB 5H2FC 4MIMA 2XPVA 1MSEC 5ICFA 2LREA 4P5OA 4OIOF 4LIVA 1RC9A 1JT6A 2EFNA 5C3EJ 2R7FA 3F8BA 1Y8RB 2DA2A 2XKOA 3GW2A 3HC7A 4GXOA 3V7SA 4BHPA 5E18F 4BDYA 3OYIA 2XDVA 3P7NA 4NC6A 2VBXA 3OYDA 2LYCA 2A5YB 2QUFA 3W2AA 2JZYA 5EJCA 2M0CA 1O7FA 2DAOA 4FASD 3L2VA 1ZQ3P 2V6EA 2VKHA 1LJ9A 3VB2A 1BR2A 1H88C 2VE8A 3ZOBA 2FE3A 4Y15A 1XX5A 5AIPA 4U0YA 2FQ4A 5FJ8J 3JRBA 2V9VA 5B3SH 3K4BA 1JJ8C 4IJAA 4YFXF 3U1KA 3PIOF 2X4HA 3X2QH 2CJJA 4DGWB 2GXBA 1ETKA 1Y0NA 4A6DA 1WJ5A 5HDKA 2HOEA 4UUVA 3BR0A 3IRQA 4IKFA 3IUOA 5DD4A 4I01A 1ZKGA 2VBYA 4FE4A 3RI4A 2M45A 1Z05A 2JA7J 3ABKH 3WHBA 1MMAA 1DU0A 2Q2EB 4Y13A 3TBIA 3MD2A 2D45A 1NK3P 2XVCA 4MFEA 2WY8Q 2QBYB 3WTWC 2PQ8A 3H3UA 2XRNA 3RZOJ 5IPAA 1ON1A 2KQRA 2LRDA 4PK4A 2QKMB 4I98B 1RI7A 3ABTA 2OZ6A 1W7PD 2TCTA 1NG6A 3HPGA 3HTUA 3K4LA 2O8XA 3BC8A 1PUEE 2RNGA 3HRSA 4YRVA 3G71I 1Q1VA 4OMZA 4D7NA 4EVIA 2WWYA 4U7BA 3J7AO 3T8RA 4KT5C 4NQWA 4Q47A 1SFEA 1FPQA 3OOPA 2X9DA 4NDLA 3E1SA 1MMGA 4AU7A 1Z7UA 5HLTA 4BU2A 4G7ZF 3C2HA 1OCPA 3GLXA 1YHQI 2OTJI 1JTYA 2DQLA 1ZARA 5ICEA 2NYXA 3O6BB 3KYDB 4M72A 4RA2A 3TDZC 4A3BJ 1VQ5I 2QGUA 2LY1A 4KDPA 4UUSB 3TL4X 2L9SA 3F23A 5DM7F 4M3FA 1IN7A 4XM3A 5FRNA 2HEOA 1G3TA 1U5TB 4A3KJ 2KIMA 5IYCJ 3VYTB 3DQVC 2X6WA 2R7TA 3GF2A 4OIPF 3HKZA 5TISC 2D1VA 1WCMJ 1V55H 2IP2A 4CDGA 1PDNC 2FMLA 4UV8A 3WTTC 4Y17A 3K1NA 3TKYA 3QQAA 3H35A 3M07A 2V9PA 5GADJ 2A05A 4QLCU 5M5YJ 2XROA 1A5JA 3LMMA 3J81Z 5ICCA 1ZRDA 1U3EM 2I5UA 1XG1A 1JXSA 3JAMZ 2DLLA 1SC7A 4GRIA 1BR4A 2NVUB 3WTYC 3CESA 5F1JA 1LDJA 3DTEA 3D5LA 1KONA 4MHGA 5TGTA 3CMEI 2L4MA 2DU9A 3BZ6A 5CPRB 5DDGA 3QAHA 3GTGJ 2FQ3A 2HKXA 4XSXF 3H9QA 2WAFA 1T98A 3BCAA 5BPDA 2R4GA 1IW7F 1FBSA 2UUZA 3GZ5A 4YIIA 3SXYA 4DYRA 5IY5H 4UVAA 1W5TA 3QU3A 4GCVA 3COAC 3RZDJ 5B1BH 1ZG5A 2LLKA 5EGOB 3SYTA 3G4SI 1BI2A 3K9TA 3KP2A 2R5YA 5IYDJ 3I55I 4AIDA 3S1RJ 2HYJA 1ZGJA 4ZDOA 3PNVA 4XN3A 2K4BA 5JVGF 2DT7B 2M0MA 2VBWA 4M71A 3WODF 2KJCA 2RN7A 2OZUA 4OIQF 4ZTFA 2QF7A 3H3ZA 2F5FA 3DKYA 4Q4ZF 3B73A 4P1WA 1RNLA 2ZSIB 5BOXA 3HXLA 1WH5A 1GXQA 2QQ9A 4PDKA 4BJ6C 3CF5F 4BHBA 4IQJA 2XHKA 3KEOA 3ONQA 4XLPF 1YIJI 5J6XA 5D5VB 3A02A 3S1MJ 2R7VA 4UV9A 2NVTJ 2A6EF 3H1CA 5ERIA 2F4IA 1AWCA 2BBYA 2HS5A 2BVLA 1FOYA 5J8FA 3PSIA 3FZVA 1GHCA 3MAJA 2JSPA 4DBRA 1S7OA 2E35A 3WGHA 2P81A 2MLGA 4HEA2 1R9TJ 4I09A 3V7CA 1BBYA 4U88A 5DV5A 5D5UB 3MEXA 2OAZA 3H92A 3ROUA 2A5WA 1U5TC 4CHUA 1U9NA 1C0WA 1FX7A 1SVOA 3V8KA 2VJ5A 2IGOA 5ICGA 2HPMA 3LSKA 4UVCA 5JHFA 1D8JA 4WXHA 2I10A 4HPQA 1B9MA 2LK2A 3RPUA 2UXXA 2DA3A 3UKGA 4EJUA 4RGSA 3UR3C 3OYLA 4BKXA 3AKZA 3KP5A 2X0LA 4AWXB 2DOAA 2V1NA 2L54A 2E1MC 2LY9A 5HLIA 3CCQI 1IV8A 1HQCA 3BDDA 4IX7A 3CCVI 2V4JC 3TO7A 2LF8A 3GX4X 1POGA 3E6MA 2KKOA 1XB4A 2ZO4A 1B72A 1D1CA 1VQPI 3AG3H 3ASNH 4YFNF 4AIHA 3GTMJ 4IL6C 3V8JA 1LEAA 5GTIC 1LPQA 3KEQA 1BIAA 1ETWA 2YX7A 1ODDA 1X2NA 4NC7A 4A3MJ 3BQZA 4E70A 2KL4A 2IGKA 2MABA 1ZGWA 2XGEA 3WTUC 2OQGA 5HDNA 5FROA 3B02A 3GZ6A 1V5GA 2JA8J 3DEWA 1WJEA 5L3DA 3LQRA 2ADUA 1WWXA 1DDNA 4B4CA 2CH0A 2VJ4A 1KGSA 4G94A 1TQPA 4GYIA 3G2BA 4Y7NJ 1XSVA 1LFBA 1A35A 2HFHA 5KK1A 4M73A 4D7MA 3HG9A 1XMKA 3EUAA 2A69F 2EJRA 2LKSA 2ISZA 2DBBA 4MNUA 2FOWA 2QKLB 4RDUA 1VI0A 3PQJA 3HZJA 3W6VA 1BJAA 2DFEA 3H5NA 2L7KA 1BA5A 2ZMEC 4A3EJ 1V5FA 2XAJA 4II2A 4AVPA 4ZH4F 5KAFC 3ESWB 3BTCA 3GTKJ 2DT6A 3VODA 2V6CA 3H36A 5FFZA 1XS9A 2PEXA 1IRFA 1R5HA 3D5SC 3O8GA 2XV4S 1OYWA 1XDSA 3S93A 3IH2A 2PJPA 2Q8KA 4KIGA 4ZDLA 2ZSHB 1O3QA 3LWFA 3QOEA 3CCUI 1HC8A 4NUBA 2Y31A 5F04A 4Y33A 2AS5F 1R4MB 1MBEA 2R5YB 1RR8C 2DXIA 2EZLA 2EA4A 1IRXA 1W0TA 3IWZA 5GP9A 1ZG1A 4GYGA 2K9SA 3GTLJ 2PFBA 1D0ZA 3BCBA 1S9HA 4RM2A 2PG4A 3CMYA 1GV2A 2E19A 1I39A 2F5VA 1Z7LA 2HQNA 3TEDA 3Q0UA 2WADA 1I50J 1FTTA 4J19A 1MBHA 4RS8A 3MKWB 3H5RA 4XLCA 4EJOA 4XR6A 1DGWY 1RKWA 3CLOA 4XN0A 2E1NA 5E20A 1GLNA 5FFXA 1R23A 5HVQC 3BJOA 1EH6A 1GVJA 3HOSA 4XRMA 1XC5A 2D1HA 5D8KB 3FHZA 4O6JA 3K2AA 2Y48A 5K5QA 2O0YA 2RV8A 3LSTA 4JYKA 3TP3A 2M1BA 2W7NA 1Y0UA 3KP3A 5IOYA 4OMYA 4M3GA 1KQ8A 2R93J 3K69A 1D3YA 1NTCA 2HZTA 3EETA 2GXAA 4V2FA 5J1UA 1IUYA 2MH9A 3DKWA 3ZGKA 3QOPA 2EFQA 3FK7A 1O3RA 1DU6A 3D1NI 2TDXA 2DYSH 1MBKA 1RETA 4NHJA 3QPSA 4C9YA 4FHTA 3DU5A 1OCTC 1HDDC 1MJ9A 1K61A 4MQVA 3ZMSA 1TNSA 1SVMA 1USSA 3DEUA 5C4JJ 1OJLA 1ZK8A 1YX3A 5HDGA 2DDBA 2CU7A 3BG9A 1PJRA 3QPHA 2FBHA 3ERMA 1FOKA 4IOAF 2EV5A 2KT0A 4ASNA 1JJ6C 3I4NJ 1VTNC 2VN2A 3FXUA 3DEEA 1S7AA 3SZPA 2JVGA 1UHMA 3MKLA 4WCGA 3MKYB 4HLYA 1BN5A 1TZLA 2JT1A 4B3XA 1MMDA 2PLYA 5FB2A 2NVQJ 3H9GA 3PM1A 3U2RA 3JREA 1U8BA 3F9KA 4B8XA 4HRIA 4M6VA 3WU0A 1TW3A 3Q0VA 5IYBJ 5LGNA 3BTIA 5EYRA 1B9NA 3TO6A 3M8EA 5JHUA 3OY9A 2P5LC 5D6EA 4LMYA 2MH2A 3Q0WA 3I53A 2R7OA 2OA4A 1GV5A 4KIBA 2DMNA 2LOOA 1IO2A 3OL3A 4OAYA 5CVUA 3WU1B 1WJBA 3I0TA 5KNLA 4V19K 2XKPA 1N75A 1MIJA 1R6RA 4L9TA 3BG7A 4WF2A 5J1RA 3CUOA 3ZMZA 4EQQA 2CGPA 3ECHA 2M2EA 3BG6A 2ZJRF 4J00A 3IH3A 1O3TA 1PUFA 5C44J 2L4AA 2QWWA 4LK0F 3BT9A 3L2WA 5CVVA 2BW3A 2HXOA 1FY7A 4KUMA 3FMQA 1R1TA 4E7IA 4L9JA 5GPCA 2E5ZA 2QSFX 1Z67A 3CF2A 2O03A 3TP0A 1R5ID 4DOZA 5L3BA 1TLHB 3DU6A 4CA0A 2K9LA 1MJAA 1H9GA 3HM5A 3R4KA 4XL9A 4A0ZA 4DW6A 1U78A 1SAXA 1H8AC 4CCJA 1F36A 3A03A 2MFZA 1MSFC 3K10A 2HNHA 2JTVA 4ZYDA 3J80Z 5F6FA 3V7RA 3BR1A 3QP6A 3CDIA 3K4KA 4KN4X 1LNWA 5ILUA 4R8HA 3HGYA 3ISPA 3SZTA 2P8TA 2QLZA 5ED4A 1PVEA 3ZCOA 3G1MA 3IWFA 2LD5A 2EFPA 3MKZA 1RUNA 4LB6B 3DPUA 4LLLA 4U87A 1NG7A 2F5EA 5DCMA 1APLC 2YUSA 2Z9OA 3A2KA 2CQNA 4IOCF 4N4NB 4ANJA 1Y1WJ 4G12A 4PGHA 2VIXA 4A93J 1XGSA 3OYGA 3KZYA 3F8CA 2GLOA 3CP8A 3L09A 1REPC 2XC7A 2L5QA 3IHUA 4EJWA 3PO3J 2VOOA 2JA2A 2K85A 3OSGA 2XPWA 1SFOJ 3E5UA 2F4MB 2FOKA 1WJCA 4HLXA 2VPRA 1R1UA 5D4RA 3HUGA 3I4MJ 5DM6F 1WQ2A 3F8NA 5EGOA 4XLEA 4CH7A 1T95A 3WG9A 5LLQA 9ANTA 2QQAA 3MCZA 1JE8A 2DTZA 4LB5A 3DBRB 1MZBA 1P4WA 2RDPA 3OYNA 5F0FA 2UWMA 1KYWA 2ZB9A 3S17J 3M4OJ 1X2MA 4GGGA 3FBNB 3SEQA 4DYCA 2EZKA 3TW7A 1VQNI 4LOCA 1YW8A 3KLNA 2RNJA 4HF1A 1I6HJ 3GFLA 3K0LA 3KIOA 1STZA 2K40A 1EKEA 1KU3A 1W5CC 2L7MP 4G6QA 3IH4A 2Z2SB 3AL0B 2LKPA 2XF7A 5FKOA 1SFKA 1K79A 1JUSA 1OCCH 3V8LA 2KP6A 2ZJ2A 3TO9A 1MJBA 3P5JA 5E1WA 3SJMA 4BH9A 2E2JJ 3E5XA 4AUXA 4EATA 3R6SA 1BOAA 2GM4A 2CUFA 1IZ1A 3ZQIA 1HXDA 3W2VA 2UZKA 2DFFA 1EV7A 3DLLF 5JR3A 1YS7A 1G4DA 4BS9A 1RKTA 1OKRA 2E7WA 4RB0A 2O3FA 2YPRA 4U7DA 2FRHA 4HF2A 4ENKA 4HX7A 4Y3OA 1VQLI 2CV1A 4BXXJ 1MDMA 2GIZA 2K3PA 2HDWA 1SD5A 2YU9J 4UY8I 4A3GJ 1E17A 3E6BA 3HGGA 1TC3C 2Z16A 1ZRCA 4DYQA 3AG2H 1AU7A 5M3FJ 3RCOA 4ZJZA 1RRJA 3GMEA 3AG4H 1XMXA 1P4XA 2FJ1A 1G3YA 3FM3A 3RKQA 3CDLA 2BHYA 3BG3A 1B72B 2OBPA 3AG1H 3D5RC 1T0FA 2WBMA 2HVSA 3WG7H 1JGGA 2BZTA 1KZHA 2QZ8A 2M34A 3DP7A 3MZYA 5EEGA 2O61A 3GEZA 4L0ZB 2A6TA 2X1EA 4HF0A 4P55A 5GPAA 2CQXA 2UXNA 3H0GJ 4ZYEA 3BY6A 1I3QJ 1I1GA 1GXPA 2L01A 1GDTA 1G2HA 1OCZH 3ZPLA 3M9AA 2KDOA 3TW6A 1QZEA 3E6DA 2BHZA 1YIOA 4NQWB 2HTSA 1VQ7I 4ETSA 4CYCA 2ZNYA 2EIJH 1AKHA 2DA4A 2JMWA 3QYEA 5ILVA 2DFHA 3S16J 3JR9A 2O8KA 3R61A 2JUCA 1IG7A 3CUQB 4L0YB 5E3LA 4FCYA 2CQKA 3L2QA 5ILSA 2W85A 5DCFA 1YJNI 3HHHA 1YS6A 3LSGA 4ENJA 5HS8A 4HNTA 2L7FP 1TW2A 4BXUA 4OINF 1OYYA 1XPXA 1BC8C 1A36A 3NRVA 3O8HA 1DP7P 3G1LA 1PYVA 1WGXA 5FKMA 4ZYAA 4S0HB 2X48A 2RREA 2DK5A 2LP0A 4K2EA 1IC8A 1VQMI 2F5DA 3HOZJ 1R49A 1DPRA 4B48A 4A3JJ 2BGCA 2PMZN 3CD6I 3CCYA 1BI1A 1P6RA 2EINH 4JP0A 5CVRA 4DQ2A 2VPLA 5HLHA 5K7ZA 2VKVA 3ZMVA 1FWZA 2NS0A 2A3SA 3CO7C 2JSCA 4E7HA 3CC7I 2VOPA 4BY7J 3HOXJ 4GO1A 1X19A 3BROA 3ULQB 5F0HA 3I5UA 2Z3YA 2FUG2 3I3LA 3WGIA 4DNCA 2CWEA 5B66C 3GXOA 3MZ8A 1VQ9I 2K9QA 1ULYA 2DMQA 2VQLA 4NC8A 3JRDA 4BJTA 5EEAA 3PL8A 1QRYA 2W57A 4FTHA 4CO8A 3FXMA 1R00A 1TL8A 1P2FA 2V79A 3CJNA 1F4KA 2YR2A 4HX8A 3IL2A 1ZHFA 2OCEA 2VQCA 1KQ9A 3DFGA 5BS6A 3R0JA 2ZBKA 3RQ4A 3OYHA 1F43A 4C2UA 2FF4A 2VI6A 1JT0A 1BI0A 3KPHA 5IT3A 5E1XA 1UAAA 1E3HA 2XSJC 1FC3A 4AIJA 5KHDA 1ETVA 2ZFWA 1O4XA 2DDAA 3BPVA 2E2IJ 3A4CA 2NNNA 2NVXJ 2HZDA 5FO5A 3K4JA 4IO9F 1WI9A 3FMSA 4MLOA 4JOMA 3P9CA 2H09A 4HNUA 1CGPA 4ESFA 2ELJA 3VWBA 2MC3A 1JGSA 1XD7A 3BG5A 2JVHA 2B9SA 2BXYA 2CRGA 4B1RA 5LHGA 2IJLA 3HIFA 1X1DA 2CQQA 2CW7A 4I0BA 2H1KA 2ECBA 2K3FA 3TMOA 1EJ9A 1IJWC 3J7YJ 4BACA 1SFXA 2JPBA 4HX4A 3MFKA 1MKMA 1TWGJ 1IN6A 3H3VK 2E1MB 3LOCA 1ERDA 1IDZA 4KISA 2UV1A 2ZXIA 1RUOA 4KYWA 3HYIA 1NH3A 5DYMA 4ZYHA 3RDIA 3Q9VA 4LFUA 3IV5A 4EV0A 3HKZN 3SDGA 2O7OA 1RIOH 2HQ5A 4YG2F 3OYEA 3PIPF 3O2PE 5J3LA 2QA4I 3BP8A 3KE2A 4W1UA 2IBDA 1XDUA 1YLFA 3K4MA 2DA7A 4F93B 3CMAI 2VQHA 3IAS2 3OV8A 1OPCA 2VKEA 2WV1A 2OPTA 4KJZA 2EFOA 3CCSI 4PSXA 3T0YA 1IGNA 1X1CA 2IS2A 3WHCA 4AVZA 3AAFA 3FIWA 2M8GX 2FNAA 2G7UA 5LHHA 4IHTA 3S3NA 4BUPA 3DLAA 3KP7A 2B63J 2DI3A 1B8IA 3HDDA 2AQFA 2ZXJA 1FBUA 2IAIA 1JKQC 3KYLA 1YO5C 4RM3A 4RBOA 2DPUA 4XBFA 1T56A 3S1NJ 5CVJA 5E17F 3HBLA 1AA7A 4P9FA 2HDCA 4RLQA 2FNPA 4CCNA 1XGMA 2KIFA 2L2OA 4DZPA 3OYJA 1WVRA 1QNTA 2Y75A 3RPUD 1A31A 1UG2A 3B6AA 4CGZA 3ZP5A 4CZCA 3W6JB 2D2WA 2HU9A 5M5XJ 1WSUA 2CW8A 3MN2A 4BQOA 1FBQA 2FEZA 2ZNZA 4X1EA 2I8DA 1K78B 1TQMA 3OYFA 1OYIA 1SAUA 2L9NA 3QU6A 3C18A 3EYIA 2VT3A 1FIPA 1OQYA 4QSHA 2COBA 4UUSA 3SFZA 2FMYA 2Z1DA 4X0GA 2CO5A 1JUPA 4NNJA 3Q3SA 5D8LB 3S8PA 2WC2A 4C2TA 5E8GA 3PO2J 3LA2A 1LUJB 3U1DA 4A6EA 5A2QK 1Y6IA 2DOFA 2LMDA 1K78A 2BVMA 2DFIA 1N25A 4RGXA 1CF7B 1WH7A 3TOAA 3RYPA 4HDVA 3GUDA 2ZJPF 2NNYA 2EV6A 1PP8F 3HSRA 3BZCA 2CUEA 3MMYB 1Q1HA 3K2ZA 2VC0A 3TOBA 2K4JA 3FM5A 1T39A 1QVTA 4HYEA 1ZN2A 3SHFA 1YOVB 4I7HA 1K4TA 1E2XA 4IVNA 5IP6A 3NEUA 1DQUA 4YFKF 3JSPA 2CFXA 1D0XA 2IGNA 2R5ZB 3BOQA 3HJEA 3WTSC 3HUGB 4IQ4A 2NS7A 2M4GA 4ZZDA 1JKRC 1T33A 3S3OA 1LKXA 2JRTA 4PFOA 2JUGA 2ETHA 2KIUA 5F27A 4H0EA 3LA3A 1QPMA 2Y0MA 2OQRA 4M9ZA 5HNHA 2ZXWH 2EQRA 2R7ZJ 2R5ZA 2XB5A 1IN8A 1GUUA
chains in the Genus database with same CATH topology
2P4WA 2MBFA 1TNTA 1YYVA 2E1CA 1EH7A 2M30A 2VONA 3S2WA 3C7JA 4XSZF 4HAMA 4KNYA 2VXZA 2FBIA 1HW5A 5JI6A 2P6SA 2RC4A 3ECOA 3U9GA 2H6BA 2ACJA 3I58A 4AD9A 4CICA 3VFZA 3JTHA 2CSOA 2R3SA 3GFIA 2BV6A 2VODA 3M7GA 4HOBA 3FXQA 1IN5A 1LEBA 3CO6C 1T6SA 2DTRA 1MDMB 1L0OC 2ZKZA 2NAZA 4KN7X 4ENNA 2XAGA 4JQFA 3MWMA 3V4GA 1HSJA 3G3ZA 2GA1A 3MQ0A 5D6FA 5FLXK 4P96A 4A0YA 4IRIA 3F72A 4IF4A 5K5RA 4MTDA 4MEYF 1U8RA 2MD5A 2J5OA 3FMRA 2YX4A 1F1ZA 2KJBA 4WWCA 5DUKA 1U5TA 3P9KA 1QZYA 2KRFA 5JFRA 1LQ1A 2A6HF 4KIFA 4KICA 4R79A 5CYVA 4HDUA 1FSHA 4LLNA 2IW5A 1FZPB 3TDUC 2BE5F 1ZLKA 3L9FA 1PP7U 3JAMK 4EGYA 4RGUA 1EH8A 2VBZA 3ERED 2RKHA 3T5XA 3I54A 3E5QA 5H6RA 5LEKA 3EDPA 3ZN1A 4LG0A 2DO7A 5L3FA 1L3LA 3DPLC 3D0SA 1YFHA 3E6CC 4M74A 3F21A 1O3SA 2DPDA 2IA2A 4UNOA 3J81K 3T8TA 3ZQ7A 5HLGA 5E1ZB 1XCVA 2IPQX 2HWVA 3N4MA 1IXSB 1JHFA 1BIBA 2DK8A 3BWGA 3HRMA 1MD0A 2ZMEB 4PZJA 1WKMA 3JTGA 1W5SA 3HHGA 3MZHA 3FWEA 2J5PA 2FXAA 6PAXA 2ESHA 4HBLA 1R7JA 4Q5SF 1SFUA 4AIKA 2Q2EA 2G7HA 1R36A 1ZRFA 5K1YA 1R1VA 4OOIA 4HQEA 2QBYA 1R22A 1F5TA 2JPCA 3IKVA 1BC7C 1U2WA 3ZMUA 1UFMA 4A5MA 4UHTA 2W84A 1J0RA 2H6CA 4ZZLA 1I1SA 3QPTA 2CYYA 1AOYA 1JHHA 2E7XA 2K7LA 1HSTA 3DPTA 4EMSA 1KYZA 1LDKB 5LBQA 2RQPA 2P6TA 2OD5A 1QO0D 1XSXA 4RAZA 1ZGAA 2R7DA 1Z6TA 3RTRA 3CTAA 3LAJA 1FNNA 2HTJA 3RPQA 4CXFA 3PFIA 1YG2A 1DPUA 3I59A 1X3UA 2P7CB 1FYLA 2M8EA 4O5VA 2LSOA 3RKYA 1HKQA 5A2QZ 4S04A 3LA7A 2PMHA 4BQAA 1HW1A 1WRJA 3RKWA 2RGVA 5LHIA 2Q0OA 3W6KB 3F3XA 4G7OF 2XGXA 2ESNA 2EK5A 1S6LA 3L7WA 3IC7A 5H6QA 2STTA 1YW7A 4M6XA 4BYYA 1KU9A 2GIVA 3JSOA 1IF1A 2B0LA 1D5VA 2QQBA 3K1PA 3GVAA 2H94A 3GFMA 2EFWA 4A12A 4EJTA 3TGNA 3LQQA 1J75A 2A07F 3O3KA 3GWZA 4A0XA 1XGNA 3N97A 2Z5UA 1K7AA 4BNCA 1Z9CA 1QGPA 3ZMTA 5E8IA 2IA1A 1V3FA 2EV0A 5F1RA 3P9IA 4MTEA 3LFKA 5DD8A 3WE3A 3IKTA 2COMA 2WV0A 4IRHA 1XCBA 1ZAOA 3HRUA 1ZYRF 1O7LA 2CG4A 5FGMA 4Z2YA 3KCCA 1MGTA 4JK1X 5F64A 1RZ4A 1ZH5A 4XRFA 1FP2A 3BJ6A 2AXLA 2H27A 1V4RA 1IRGA 2ZMEA 2QYOA 3M1EA 4FX0A 5IT9Z 3L00A 4ZYGA 1H9TA 5BQTA 3KLOA 1R5GA 4F7ZA 1LB2A 4G7HF 3QP5A 5BMZA 2HYGD 1FYKA 3G73A 5TJJA 2P5VA 2W25A 2XAQA 1S3JA 4EM2A 2F2EA 4KMUX 5L3GA 2LNBA 3VOEA 3RYRA 1W4MA 3C3WA 4NB5A 3ZN0A 2P7VB 1KU7A 2GZWA 1I6XA 1KU2A 5FD5A 2LDUA 3HTSB 1BI3A 1S29A 1W7PA 2YSRA 3I4PA 3T1BA 1J9IA 2K86A 1YTYA 4HA8A 2FBKA 5FLXZ 1A04A 3CUQC 1K6OA 3EYYA 4L5IA 3CUQA 3GYHX 1SMYF 1FYMA 4HZFA 4XLNF 1W7PB 1OMIA 4U0WA 2IRFG 2P5KA 2LF7A 1XMAA 2W24A 2XASA 3QRFF 1S8NA 3RIRA 3BJAA 1QZZA 1SMTA 2XAFA 4I02A 1TBXA 2ZCWA 4S05A 2FA5A 4ENMA 1HKSA 4HV6A 5K5OA 5CVIA 4RB3C 4L5JA 3KFWX 4M9XA 2PN6A 4ESBA 1UB9A 2HGCA 1FP1D 3E3VA 4JBAA 5DUIA 5KVRA 4LD5A 1F9NA 2O6GE 3EUHA 4LJZF 1IAWA 2C6YA 2OU2A 4PGGA 4MEXF 3PQKA 1G3WA 1YQAA 3R60A 4FT8A 4LK1F 1B1BA 2CW0F 2ELHA 2RVCA 3NQOA 3I71A 2XAHA 4IPAA 1LVAA 4M6YA 5D5WB 2FU4A 5LEJA 1B6AA 1G3SA 5AONA 1ZLJA 4L18B 2WTEA 4A5NA 4YIFA 3E97A 3L2CA 2BEOA 1USTA 2FSWA 5IT9K 4KFCA 2VE9A 2EWNA 4TV7A 3KETA 4B09A 1BM9A 5LGUA 1KQ0A 1J7KA 4U0VA 1XN7A 2HQRA 5D5XB 4EM1A 4N9IA 1T2KA 3I64A 2EA2A 3DF8A 1ONVA 1SD6A 2A68F 3KZZA 5CLSA 2DW4A 2EB7A 5L3EA 1I27A 1P4AA 3WTXC 2PI0A 4P9UA 4L9NA 3F6OA 3Q5FA 4IHSA 1B4AA 1B59A 2PBIA 1H0MA 2F5CA 3HOTA 4RB2C 1U6GA 2K27A 1Z91A 4N9HA 3WTZA 2XUBA 4UVBA 3ML6A 5BPIA 1IXRC 3M8FA 4EM0B 2QVOA 2V1XA 2YU3A 4OU0A 3ELKA 2GWRA 1G6NA 1FT9A 3WTVC 2STWA 4CYDA 3RJPA 4KA4A 2Z99A 2MLKA 3HRTA 1KA8A 4WX9A 5AIQA 3F8FA 3F8MA 4ON0A 3CDHA 3K1MA 5J8CA 4D0PA 5LRRA 4LG0B 3KP4A 1ZREA 2IA0A 2Z33A 4BHCA 1DUXC 4IXAA 1D8KA 4MGRA 3DV8A 4A2UA 2A61A 3REOA 4M9SA 1O57A 1FSEA 5HS9A 1IN4A 5JVTA 3IRRA 1J5YA 3BPXA 1QQIA 5L3CA 1Z1DA 4FX4A 3SQNA 1TQIA 3ABUA 3JW4A 2HKOA 2L02A 1R58A 1NHAA 1P92A 3FXRA 5LGTA 2G9WA 4OIRF 1J2XA 5DEQA 1ZG3A 4MQ9F 2GQQA 1IXCA 2IVMA 3GFJA 4LGWA 3DXJF 4KMFA 5TRDA 3Q9SA 4LLGF 4RGRA 1XGOA 5HS7A 3TQNA 2HYFA 2V1UA 5LRSA 1HW2A 4WXCA 1YW9A 1LDDA 2QENA 4Q48A 1HBXG 2M87A 4RB1A 4G8XA 4UXNA 5EEHA 4I2OA 2BYVE 1UHWA 4RAYA 1SD4A 2IT0A 4HV5A 2VC1A 1XSDA 2MA3A 1I5ZA 1T38A 2ISYA 2QM3A 2GAUA 3KP6A 1ON2A 1TTYA 3ZMDA 2HR3A 3GO5A 1OR7A 5D4SA 2K02A 4G6DA 3C1DA 4IRGA 3LAPA 4I0AA 3WE2A 3F22A 4R1HA 5H20A 4N0BA 1Z6RA 4O3MA 2XIGA 2VT2A 3I59B 2DQRA 4EGZA 3F6VA 1CF7A 2GXGA 4BAYA 2L3DA 3EQLF 2V1DA 3HSEA 4G9YA 3WGGA 5CJ9A 5FD6A 1FLIA 1HKTA 5DCMB 1SD7A 2PMUA 4WK8F 3R0AA 5HOOA 2NRAC 4PCQA 3J80K 3RKXA 3FX3A 3HSFA 1UCRA 2DT5A 4ESJA 4WXDA 4L9VA 3FF5A 2M5WA 4HQMA 3VEPA 1J59A 1QBJA 2GA2A 4HW0A 4QWQA 5ICFA 4P5OA 4OIOF 2EFNA 2R7FA 3F8BA 2XKOA 3GW2A 4GXOA 3V7SA 4BHPA 5E18F 3P7NA 2VBXA 2A5YB 2QUFA 2JZYA 1O7FA 2DAOA 1LJ9A 3VB2A 2VE8A 2FE3A 4Y15A 5AIPA 4U0YA 2V9VA 4IJAA 4YFXF 2X4HA 2GXBA 4A6DA 5HDKA 2HOEA 4UUVA 3IRQA 5DD4A 4I01A 2VBYA 3RI4A 2M45A 1Z05A 4Y13A 2D45A 2XVCA 2QBYB 3WTWC 2PQ8A 3H3UA 2XRNA 1ON1A 4I98B 1RI7A 3ABTA 2OZ6A 1W7PD 3HTUA 2O8XA 1PUEE 3HRSA 4OMZA 4EVIA 2WWYA 4U7BA 3J7AO 3T8RA 4KT5C 4NQWA 4Q47A 1SFEA 1FPQA 3OOPA 1Z7UA 4G7ZF 3GLXA 2DQLA 1ZARA 5ICEA 2NYXA 3O6BB 4M72A 3TDZC 4KDPA 3F23A 1IN7A 2HEOA 1G3TA 1U5TB 2KIMA 3DQVC 3GF2A 4OIPF 2D1VA 2IP2A 4CDGA 1PDNC 2FMLA 4UV8A 3WTTC 4Y17A 3K1NA 3TKYA 4QLCU 2XROA 3J81Z 5ICCA 1ZRDA 1U3EM 1JXSA 3JAMZ 2DLLA 3WTYC 1LDJA 3D5LA 4MHGA 2L4MA 2DU9A 3BZ6A 5DDGA 3QAHA 2FQ3A 2HKXA 4XSXF 1T98A 5BPDA 1IW7F 1FBSA 3GZ5A 4YIIA 3SXYA 4UVAA 1W5TA 3QU3A 4GCVA 3COAC 1ZG5A 1BI2A 3K9TA 3KP2A 1ZGJA 2K4BA 2VBWA 4M71A 3WODF 2KJCA 2RN7A 2OZUA 4OIQF 3H3ZA 2F5FA 4Q4ZF 3B73A 1RNLA 5BOXA 1GXQA 2QQ9A 4PDKA 4BHBA 2XHKA 3KEOA 4XLPF 5J6XA 5D5VB 4UV9A 2A6EF 5ERIA 1AWCA 2BBYA 2HS5A 5J8FA 3FZVA 1GHCA 3MAJA 1S7OA 3WGHA 2MLGA 4I09A 3V7CA 1BBYA 4U88A 5DV5A 5D5UB 3MEXA 2OAZA 3H92A 3ROUA 1U5TC 4CHUA 1C0WA 1FX7A 3V8KA 5ICGA 4UVCA 1D8JA 4WXHA 1B9MA 3RPUA 2UXXA 4EJUA 4RGSA 3KP5A 2X0LA 4AWXB 2L54A 5HLIA 1HQCA 3BDDA 3TO7A 2LF8A 3GX4X 3E6MA 2KKOA 1XB4A 2ZO4A 4YFNF 4AIHA 3V8JA 1LEAA 3KEQA 1BIAA 2YX7A 1ODDA 4E70A 3WTUC 2OQGA 5HDNA 3GZ6A 3B02A 5L3DA 3LQRA 2ADUA 1WWXA 1DDNA 1KGSA 4G94A 1TQPA 4GYIA 1XSVA 2HFHA 5KK1A 4M73A 1XMKA 2A69F 2EJRA 2ISZA 2DBBA 4MNUA 3PQJA 1BJAA 4AVPA 2XAJA 4ZH4F 3VODA 2V6CA 5FFZA 2PEXA 1IRFA 1R5HA 2XV4S 1OYWA 1XDSA 2PJPA 2Q8KA 4KIGA 1O3QA 3LWFA 2AS5F 2EA4A 3IWZA 1ZG1A 4GYGA 2PFBA 2PG4A 2HQNA 4RS8A 4EJOA 3CLOA 2E1NA 5E20A 5FFXA 1R23A 5HVQC 3BJOA 1EH6A 1GVJA 3HOSA 2D1HA 5D8KB 3FHZA 4O6JA 2Y48A 5K5QA 2O0YA 2RV8A 3LSTA 2M1BA 1Y0UA 3KP3A 4OMYA 1KQ8A 3K69A 1D3YA 3EETA 2HZTA 1IUYA 2MH9A 3DKWA 3QOPA 2EFQA 1O3RA 2TDXA 4NHJA 4FHTA 1MJ9A 4MQVA 3ZMSA 1TNSA 1USSA 3DEUA 5HDGA 3QPHA 2FBHA 1FOKA 2EV5A 4ASNA 1VTNC 2VN2A 3FXUA 1S7AA 3SZPA 1UHMA 4WCGA 4HLYA 1BN5A 2JT1A 2PLYA 5FB2A 3U2RA 4B8XA 3WU0A 1TW3A 5LGNA 1B9NA 2P5LC 3TO6A 3M8EA 5JHUA 5D6EA 4LMYA 2MH2A 3I53A 2OA4A 4KIBA 5CVUA 3WU1B 3I0TA 2XKPA 4L9TA 4WF2A 3CUOA 3ZMZA 4EQQA 2CGPA 3ECHA 1O3TA 2L4AA 2QWWA 4LK0F 5CVVA 1FY7A 4KUMA 3FMQA 1R1TA 4L9JA 2O03A 5L3BA 1TLHB 4A0ZA 1MJAA 1H9GA 1U78A 3R4KA 1SAXA 2JTVA 4ZYDA 3J80Z 5F6FA 3V7RA 3QP6A 4KN4X 1LNWA 5ILUA 4R8HA 3ISPA 3SZTA 2P8TA 2QLZA 5ED4A 3IWFA 2EFPA 1RUNA 4LB6B 4LLLA 2F5EA 5DCMA 2Z9OA 4PGHA 1IN8A 1XGSA 3KZYA 3F8CA 3L09A 1REPC 3IHUA 4EJWA 2VOOA 3E5UA 2FOKA 4HLXA 1R1UA 5D4RA 3HUGA 1WQ2A 3F8NA 3WG9A 5LLQA 2QQAA 3MCZA 1JE8A 4LB5A 1MZBA 1P4WA 2RDPA 2UWMA 1KYWA 4GGGA 1YW8A 3KLNA 2RNJA 4HF1A 3GFLA 3K0LA 1STZA 1KU3A 4G6QA 2LKPA 1K79A 3V8LA 3TO9A 2ZJ2A 1MJBA 5E1WA 4BH9A 3E5XA 3R6SA 1BOAA 1IZ1A 1HXDA 2UZKA 1EV7A 5JR3A 1YS7A 1G4DA 1OKRA 2E7WA 4RB0A 2O3FA 2YPRA 4U7DA 2FRHA 4HF2A 4ENKA 4HX7A 1MDMA 1SD5A 1E17A 3E6BA 1ZRCA 1P4XA 1G3YA 3FM3A 2OBPA 1T0FA 2QZ8A 3DP7A 5EEGA 3MZYA 2O61A 3GEZA 4L0ZB 4HF0A 4P55A 2UXNA 4ZYEA 3BY6A 1I1GA 1GXPA 2L01A 3ZPLA 3M9AA 3E6DA 1YIOA 2HTSA 4ETSA 2ZNYA 5ILVA 3R61A 3CUQB 4L0YB 2CQKA 5ILSA 2W85A 5DCFA 3HHHA 1YS6A 4ENJA 5HS8A 1TW2A 4BXUA 4OINF 1OYYA 1BC8C 3NRVA 1DP7P 4K2EA 2DK5A 2F5DA 1DPRA 2BGCA 1BI1A 1P6RA 5CVRA 4DQ2A 5HLHA 3ZMVA 3CO7C 1FWZA 2NS0A 2A3SA 2JSCA 2VOPA 4GO1A 3BROA 3ULQB 3I5UA 2Z3YA 3WGIA 4DNCA 2CWEA 3GXOA 1ULYA 2W57A 4CO8A 1R00A 1P2FA 2V79A 3CJNA 1F4KA 2YR2A 4HX8A 3IL2A 1ZHFA 3DFGA 1KQ9A 5BS6A 3R0JA 2ZBKA 2FF4A 1BI0A 5IT3A 5E1XA 1FC3A 4AIJA 2ZFWA 3BPVA 2NNNA 5FO5A 1WI9A 3FMSA 3P9CA 2H09A 1CGPA 4ESFA 2MC3A 1JGSA 1XD7A 5LHGA 2IJLA 3HIFA 4I0BA 1SFXA 2JPBA 4HX4A 3MFKA 1MKMA 1IN6A 1RUOA 4KYWA 3HYIA 5DYMA 4ZYHA 3RDIA 3Q9VA 4LFUA 4EV0A 1RIOH 4YG2F 3O2PE 3BP8A 3KE2A 1XDUA 1YLFA 3OV8A 1OPCA 2EFOA 3T0YA 3AAFA 5LHHA 2FNAA 2G7UA 4IHTA 3KP7A 2DI3A 2ZXJA 1FBUA 1YO5C 2DPUA 4XBFA 5CVJA 5E17F 4P9FA 2HDCA 2FNPA 1XGMA 2KIFA 1QNTA 2Y75A 4CGZA 3ZP5A 3W6JB 2D2WA 1WSUA 1FBQA 2FEZA 2ZNZA 1K78B 1TQMA 1OYIA 3QU6A 3C18A 3EYIA 2VT3A 3SFZA 2FMYA 2CO5A 5D8LB 2WC2A 5E8GA 3LA2A 5A2QK 3U1DA 4A6EA 1K78A 2DFIA 4RGXA 1CF7B 3TOAA 3RYPA 4HDVA 3GUDA 2NNYA 2EV6A 1PP8F 3HSRA 1Q1HA 3K2ZA 2VC0A 3TOBA 2K4JA 1T39A 3FM5A 4HYEA 1ZN2A 3SHFA 4I7HA 1E2XA 4IVNA 3NEUA 4YFKF 3JSPA 2CFXA 3BOQA 3WTSC 4ZZDA 2JRTA 2ETHA 2KIUA 4H0EA 3LA3A 1QPMA 2Y0MA 2OQRA 4M9ZA 4EJVA 4CZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P4W A;  2MBF A;  1TNT A;  1YYV A;  2E1C A;  1EH7 A;  2M30 A;  2VON A;  3S2W A;  3C7J A;  4XSZ F;  4HAM A;  4KNY A;  2VXZ A;  2FBI A;  1HW5 A;  5JI6 A;  2P6S A;  2RC4 A;  3ECO A;  3U9G A;  2H6B A;  2ACJ A;  3I58 A;  4AD9 A;  4CIC A;  3VFZ A;  3JTH A;  2CSO A;  2R3S A;  3GFI A;  2BV6 A;  2VOD A;  3M7G A;  4HOB A;  3FXQ A;  1IN5 A;  1LEB A;  3CO6 C;  1T6S A;  2DTR A;  1MDM B;  1L0O C;  2ZKZ A;  2NAZ A;  4KN7 X;  4ENN A;  2XAG A;  4JQF A;  3MWM A;  3V4G A;  1HSJ A;  3G3Z A;  2GA1 A;  3MQ0 A;  5D6F A;  5FLX K;  4P96 A;  4A0Y A;  4IRI A;  3F72 A;  4IF4 A;  5K5R A;  4MTD A;  4MEY F;  1U8R A;  2MD5 A;  2J5O A;  3FMR A;  2YX4 A;  1F1Z A;  2KJB A;  4WWC A;  5DUK A;  1U5T A;  3P9K A;  1QZY A;  2KRF A;  5JFR A;  1LQ1 A;  2A6H F;  4KIF A;  4KIC A;  4R79 A;  5CYV A;  4HDU A;  1FSH A;  4LLN A;  2IW5 A;  1FZP B;  3TDU C;  2BE5 F;  1ZLK A;  3L9F A;  1PP7 U;  3JAM K;  4EGY A;  4RGU A;  1EH8 A;  2VBZ A;  3ERE D;  2RKH A;  3T5X A;  3I54 A;  3E5Q A;  5H6R A;  5LEK A;  3EDP A;  3ZN1 A;  4LG0 A;  2DO7 A;  5L3F A;  1L3L A;  3DPL C;  3D0S A;  1YFH A;  3E6C C;  4M74 A;  3F21 A;  1O3S A;  2DPD A;  2IA2 A;  4UNO A;  3J81 K;  3T8T A;  3ZQ7 A;  5HLG A;  5E1Z B;  1XCV A;  2IPQ X;  2HWV A;  3N4M A;  1IXS B;  1JHF A;  1BIB A;  2DK8 A;  3BWG A;  3HRM A;  1MD0 A;  2ZME B;  4PZJ A;  1WKM A;  3JTG A;  1W5S A;  3HHG A;  3MZH A;  3FWE A;  2J5P A;  2FXA A;  6PAX A;  2ESH A;  4HBL A;  1R7J A;  4Q5S F;  1SFU A;  4AIK A;  2Q2E A;  2G7H A;  1R36 A;  1ZRF A;  5K1Y A;  1R1V A;  4OOI A;  4HQE A;  2QBY A;  1R22 A;  1F5T A;  2JPC A;  3IKV A;  1BC7 C;  1U2W A;  3ZMU A;  1UFM A;  4A5M A;  4UHT A;  2W84 A;  1J0R A;  2H6C A;  4ZZL A;  1I1S A;  3QPT A;  2CYY A;  1AOY A;  1JHH A;  2E7X A;  2K7L A;  1HST A;  3DPT A;  4EMS A;  1KYZ A;  1LDK B;  5LBQ A;  2RQP A;  2P6T A;  2OD5 A;  1QO0 D;  1XSX A;  4RAZ A;  1ZGA A;  2R7D A;  1Z6T A;  3RTR A;  3CTA A;  3LAJ A;  1FNN A;  2HTJ A;  3RPQ A;  4CXF A;  3PFI A;  1YG2 A;  1DPU A;  3I59 A;  1X3U A;  2P7C B;  1FYL A;  2M8E A;  4O5V A;  2LSO A;  3RKY A;  1HKQ A;  5A2Q Z;  4S04 A;  3LA7 A;  2PMH A;  4BQA A;  1HW1 A;  1WRJ A;  3RKW A;  2RGV A;  5LHI A;  2Q0O A;  3W6K B;  3F3X A;  4G7O F;  2XGX A;  2ESN A;  2EK5 A;  1S6L A;  3L7W A;  3IC7 A;  5H6Q A;  2STT A;  1YW7 A;  4M6X A;  4BYY A;  1KU9 A;  2GIV A;  3JSO A;  1IF1 A;  2B0L A;  1D5V A;  2QQB A;  3K1P A;  3GVA A;  2H94 A;  3GFM A;  2EFW A;  4A12 A;  4EJT A;  3TGN A;  3LQQ A;  1J75 A;  2A07 F;  3O3K A;  3GWZ A;  4A0X A;  1XGN A;  3N97 A;  2Z5U A;  1K7A A;  4BNC A;  1Z9C A;  1QGP A;  3ZMT A;  5E8I A;  2IA1 A;  1V3F A;  2EV0 A;  5F1R A;  3P9I A;  4MTE A;  3LFK A;  5DD8 A;  3WE3 A;  3IKT A;  2COM A;  2WV0 A;  4IRH A;  1XCB A;  1ZAO A;  3HRU A;  1ZYR F;  1O7L A;  2CG4 A;  5FGM A;  4Z2Y A;  3KCC A;  1MGT A;  4JK1 X;  5F64 A;  1RZ4 A;  1ZH5 A;  4XRF A;  1FP2 A;  3BJ6 A;  2AXL A;  2H27 A;  1V4R A;  1IRG A;  2ZME A;  2QYO A;  3M1E A;  4FX0 A;  5IT9 Z;  3L00 A;  4ZYG A;  1H9T A;  5BQT A;  3KLO A;  1R5G A;  4F7Z A;  1LB2 A;  4G7H F;  3QP5 A;  5BMZ A;  2HYG D;  1FYK A;  3G73 A;  5TJJ A;  2P5V A;  2W25 A;  2XAQ A;  1S3J A;  4EM2 A;  2F2E A;  4KMU X;  5L3G A;  2LNB A;  3VOE A;  3RYR A;  1W4M A;  3C3W A;  4NB5 A;  3ZN0 A;  2P7V B;  1KU7 A;  2GZW A;  1I6X A;  1KU2 A;  5FD5 A;  2LDU A;  3HTS B;  1BI3 A;  1S29 A;  1W7P A;  2YSR A;  3I4P A;  3T1B A;  1J9I A;  2K86 A;  1YTY A;  4HA8 A;  2FBK A;  5FLX Z;  1A04 A;  3CUQ C;  1K6O A;  3EYY A;  4L5I A;  3CUQ A;  3GYH X;  1SMY F;  1FYM A;  4HZF A;  4XLN F;  1W7P B;  1OMI A;  4U0W A;  2IRF G;  2P5K A;  2LF7 A;  1XMA A;  2W24 A;  2XAS A;  3QRF F;  1S8N A;  3RIR A;  3BJA A;  1QZZ A;  1SMT A;  2XAF A;  4I02 A;  1TBX A;  2ZCW A;  4S05 A;  2FA5 A;  4ENM A;  1HKS A;  4HV6 A;  5K5O A;  5CVI A;  4RB3 C;  4L5J A;  3KFW X;  4M9X A;  2PN6 A;  4ESB A;  1UB9 A;  2HGC A;  1FP1 D;  3E3V A;  4JBA A;  5DUI A;  5KVR A;  4LD5 A;  1F9N A;  2O6G E;  3EUH A;  4LJZ F;  1IAW A;  2C6Y A;  2OU2 A;  4PGG A;  4MEX F;  3PQK A;  1G3W A;  1YQA A;  3R60 A;  4FT8 A;  4LK1 F;  1B1B A;  2CW0 F;  2ELH A;  2RVC A;  3NQO A;  3I71 A;  2XAH A;  4IPA A;  1LVA A;  4M6Y A;  5D5W B;  2FU4 A;  5LEJ A;  1B6A A;  1G3S A;  5AON A;  1ZLJ A;  4L18 B;  2WTE A;  4A5N A;  4YIF A;  3E97 A;  3L2C A;  2BEO A;  1UST A;  2FSW A;  5IT9 K;  4KFC A;  2VE9 A;  2EWN A;  4TV7 A;  3KET A;  4B09 A;  1BM9 A;  5LGU A;  1KQ0 A;  1J7K A;  4U0V A;  1XN7 A;  2HQR A;  5D5X B;  4EM1 A;  4N9I A;  1T2K A;  3I64 A;  2EA2 A;  3DF8 A;  1ONV A;  1SD6 A;  2A68 F;  3KZZ A;  5CLS A;  2DW4 A;  2EB7 A;  5L3E A;  1I27 A;  1P4A A;  3WTX C;  2PI0 A;  4P9U A;  4L9N A;  3F6O A;  3Q5F A;  4IHS A;  1B4A A;  1B59 A;  2PBI A;  1H0M A;  2F5C A;  3HOT A;  4RB2 C;  1U6G A;  2K27 A;  1Z91 A;  4N9H A;  3WTZ A;  2XUB A;  4UVB A;  3ML6 A;  5BPI A;  1IXR C;  3M8F A;  4EM0 B;  2QVO A;  2V1X A;  2YU3 A;  4OU0 A;  3ELK A;  2GWR A;  1G6N A;  1FT9 A;  3WTV C;  2STW A;  4CYD A;  3RJP A;  4KA4 A;  2Z99 A;  2MLK A;  3HRT A;  1KA8 A;  4WX9 A;  5AIQ A;  3F8F A;  3F8M A;  4ON0 A;  3CDH A;  3K1M A;  5J8C A;  4D0P A;  5LRR A;  4LG0 B;  3KP4 A;  1ZRE A;  2IA0 A;  2Z33 A;  4BHC A;  1DUX C;  4IXA A;  1D8K A;  4MGR A;  3DV8 A;  4A2U A;  2A61 A;  3REO A;  4M9S A;  1O57 A;  1FSE A;  5HS9 A;  1IN4 A;  5JVT A;  3IRR A;  1J5Y A;  3BPX A;  1QQI A;  5L3C A;  1Z1D A;  4FX4 A;  3SQN A;  1TQI A;  3ABU A;  3JW4 A;  2HKO A;  2L02 A;  1R58 A;  1NHA A;  1P92 A;  3FXR A;  5LGT A;  2G9W A;  4OIR F;  1J2X A;  5DEQ A;  1ZG3 A;  4MQ9 F;  2GQQ A;  1IXC A;  2IVM A;  3GFJ A;  4LGW A;  3DXJ F;  4KMF A;  5TRD A;  3Q9S A;  4LLG F;  4RGR A;  1XGO A;  5HS7 A;  3TQN A;  2HYF A;  2V1U A;  5LRS A;  1HW2 A;  4WXC A;  1YW9 A;  1LDD A;  2QEN A;  4Q48 A;  1HBX G;  2M87 A;  4RB1 A;  4G8X A;  4UXN A;  5EEH A;  4I2O A;  2BYV E;  1UHW A;  4RAY A;  1SD4 A;  2IT0 A;  4HV5 A;  2VC1 A;  1XSD A;  2MA3 A;  1I5Z A;  1T38 A;  2ISY A;  2QM3 A;  2GAU A;  3KP6 A;  1ON2 A;  1TTY A;  3ZMD A;  2HR3 A;  3GO5 A;  1OR7 A;  5D4S A;  2K02 A;  4G6D A;  3C1D A;  4IRG A;  3LAP A;  4I0A A;  3WE2 A;  3F22 A;  4R1H A;  5H20 A;  4N0B A;  1Z6R A;  4O3M A;  2XIG A;  2VT2 A;  3I59 B;  2DQR A;  4EGZ A;  3F6V A;  1CF7 A;  2GXG A;  4BAY A;  2L3D A;  3EQL F;  2V1D A;  3HSE A;  4G9Y A;  3WGG A;  5CJ9 A;  5FD6 A;  1FLI A;  1HKT A;  5DCM B;  1SD7 A;  2PMU A;  4WK8 F;  3R0A A;  5HOO A;  2NRA C;  4PCQ A;  3J80 K;  3RKX A;  3FX3 A;  3HSF A;  1UCR A;  2DT5 A;  4ESJ A;  4WXD A;  4L9V A;  3FF5 A;  2M5W A;  4HQM A;  3VEP A;  1J59 A;  1QBJ A;  2GA2 A;  4HW0 A;  4QWQ A;  5ICF A;  4P5O A;  4OIO F;  2EFN A;  2R7F A;  3F8B A;  2XKO A;  3GW2 A;  4GXO A;  3V7S A;  4BHP A;  5E18 F;  3P7N A;  2VBX A;  2A5Y B;  2QUF A;  2JZY A;  1O7F A;  2DAO A;  1LJ9 A;  3VB2 A;  2VE8 A;  2FE3 A;  4Y15 A;  5AIP A;  4U0Y A;  2V9V A;  4IJA A;  4YFX F;  2X4H A;  2GXB A;  4A6D A;  5HDK A;  2HOE A;  4UUV A;  3IRQ A;  5DD4 A;  4I01 A;  2VBY A;  3RI4 A;  2M45 A;  1Z05 A;  4Y13 A;  2D45 A;  2XVC A;  2QBY B;  3WTW C;  2PQ8 A;  3H3U A;  2XRN A;  1ON1 A;  4I98 B;  1RI7 A;  3ABT A;  2OZ6 A;  1W7P D;  3HTU A;  2O8X A;  1PUE E;  3HRS A;  4OMZ A;  4EVI A;  2WWY A;  4U7B A;  3J7A O;  3T8R A;  4KT5 C;  4NQW A;  4Q47 A;  1SFE A;  1FPQ A;  3OOP A;  1Z7U A;  4G7Z F;  3GLX A;  2DQL A;  1ZAR A;  5ICE A;  2NYX A;  3O6B B;  4M72 A;  3TDZ C;  4KDP A;  3F23 A;  1IN7 A;  2HEO A;  1G3T A;  1U5T B;  2KIM A;  3DQV C;  3GF2 A;  4OIP F;  2D1V A;  2IP2 A;  4CDG A;  1PDN C;  2FML A;  4UV8 A;  3WTT C;  4Y17 A;  3K1N A;  3TKY A;  4QLC U;  2XRO A;  3J81 Z;  5ICC A;  1ZRD A;  1U3E M;  1JXS A;  3JAM Z;  2DLL A;  3WTY C;  1LDJ A;  3D5L A;  4MHG A;  2L4M A;  2DU9 A;  3BZ6 A;  5DDG A;  3QAH A;  2FQ3 A;  2HKX A;  4XSX F;  1T98 A;  5BPD A;  1IW7 F;  1FBS A;  3GZ5 A;  4YII A;  3SXY A;  4UVA A;  1W5T A;  3QU3 A;  4GCV A;  3COA C;  1ZG5 A;  1BI2 A;  3K9T A;  3KP2 A;  1ZGJ A;  2K4B A;  2VBW A;  4M71 A;  3WOD F;  2KJC A;  2RN7 A;  2OZU A;  4OIQ F;  3H3Z A;  2F5F A;  4Q4Z F;  3B73 A;  1RNL A;  5BOX A;  1GXQ A;  2QQ9 A;  4PDK A;  4BHB A;  2XHK A;  3KEO A;  4XLP F;  5J6X A;  5D5V B;  4UV9 A;  2A6E F;  5ERI A;  1AWC A;  2BBY A;  2HS5 A;  5J8F A;  3FZV A;  1GHC A;  3MAJ A;  1S7O A;  3WGH A;  2MLG A;  4I09 A;  3V7C A;  1BBY A;  4U88 A;  5DV5 A;  5D5U B;  3MEX A;  2OAZ A;  3H92 A;  3ROU A;  1U5T C;  4CHU A;  1C0W A;  1FX7 A;  3V8K A;  5ICG A;  4UVC A;  1D8J A;  4WXH A;  1B9M A;  3RPU A;  2UXX A;  4EJU A;  4RGS A;  3KP5 A;  2X0L A;  4AWX B;  2L54 A;  5HLI A;  1HQC A;  3BDD A;  3TO7 A;  2LF8 A;  3GX4 X;  3E6M A;  2KKO A;  1XB4 A;  2ZO4 A;  4YFN F;  4AIH A;  3V8J A;  1LEA A;  3KEQ A;  1BIA A;  2YX7 A;  1ODD A;  4E70 A;  3WTU C;  2OQG A;  5HDN A;  3GZ6 A;  3B02 A;  5L3D A;  3LQR A;  2ADU A;  1WWX A;  1DDN A;  1KGS A;  4G94 A;  1TQP A;  4GYI A;  1XSV A;  2HFH A;  5KK1 A;  4M73 A;  1XMK A;  2A69 F;  2EJR A;  2ISZ A;  2DBB A;  4MNU A;  3PQJ A;  1BJA A;  4AVP A;  2XAJ A;  4ZH4 F;  3VOD A;  2V6C A;  5FFZ A;  2PEX A;  1IRF A;  1R5H A;  2XV4 S;  1OYW A;  1XDS A;  2PJP A;  2Q8K A;  4KIG A;  1O3Q A;  3LWF A;  2AS5 F;  2EA4 A;  3IWZ A;  1ZG1 A;  4GYG A;  2PFB A;  2PG4 A;  2HQN A;  4RS8 A;  4EJO A;  3CLO A;  2E1N A;  5E20 A;  5FFX A;  1R23 A;  5HVQ C;  3BJO A;  1EH6 A;  1GVJ A;  3HOS A;  2D1H A;  5D8K B;  3FHZ A;  4O6J A;  2Y48 A;  5K5Q A;  2O0Y A;  2RV8 A;  3LST A;  2M1B A;  1Y0U A;  3KP3 A;  4OMY A;  1KQ8 A;  3K69 A;  1D3Y A;  3EET A;  2HZT A;  1IUY A;  2MH9 A;  3DKW A;  3QOP A;  2EFQ A;  1O3R A;  2TDX A;  4NHJ A;  4FHT A;  1MJ9 A;  4MQV A;  3ZMS A;  1TNS A;  1USS A;  3DEU A;  5HDG A;  3QPH A;  2FBH A;  1FOK A;  2EV5 A;  4ASN A;  1VTN C;  2VN2 A;  3FXU A;  1S7A A;  3SZP A;  1UHM A;  4WCG A;  4HLY A;  1BN5 A;  2JT1 A;  2PLY A;  5FB2 A;  3U2R A;  4B8X A;  3WU0 A;  1TW3 A;  5LGN A;  1B9N A;  2P5L C;  3TO6 A;  3M8E A;  5JHU A;  5D6E A;  4LMY A;  2MH2 A;  3I53 A;  2OA4 A;  4KIB A;  5CVU A;  3WU1 B;  3I0T A;  2XKP A;  4L9T A;  4WF2 A;  3CUO A;  3ZMZ A;  4EQQ A;  2CGP A;  3ECH A;  1O3T A;  2L4A A;  2QWW A;  4LK0 F;  5CVV A;  1FY7 A;  4KUM A;  3FMQ A;  1R1T A;  4L9J A;  2O03 A;  5L3B A;  1TLH B;  4A0Z A;  1MJA A;  1H9G A;  1U78 A;  3R4K A;  1SAX A;  2JTV A;  4ZYD A;  3J80 Z;  5F6F A;  3V7R A;  3QP6 A;  4KN4 X;  1LNW A;  5ILU A;  4R8H A;  3ISP A;  3SZT A;  2P8T A;  2QLZ A;  5ED4 A;  3IWF A;  2EFP A;  1RUN A;  4LB6 B;  4LLL A;  2F5E A;  5DCM A;  2Z9O A;  4PGH A;  1IN8 A;  1XGS A;  3KZY A;  3F8C A;  3L09 A;  1REP C;  3IHU A;  4EJW A;  2VOO A;  3E5U A;  2FOK A;  4HLX A;  1R1U A;  5D4R A;  3HUG A;  1WQ2 A;  3F8N A;  3WG9 A;  5LLQ A;  2QQA A;  3MCZ A;  1JE8 A;  4LB5 A;  1MZB A;  1P4W A;  2RDP A;  2UWM A;  1KYW A;  4GGG A;  1YW8 A;  3KLN A;  2RNJ A;  4HF1 A;  3GFL A;  3K0L A;  1STZ A;  1KU3 A;  4G6Q A;  2LKP A;  1K79 A;  3V8L A;  3TO9 A;  2ZJ2 A;  1MJB A;  5E1W A;  4BH9 A;  3E5X A;  3R6S A;  1BOA A;  1IZ1 A;  1HXD A;  2UZK A;  1EV7 A;  5JR3 A;  1YS7 A;  1G4D A;  1OKR A;  2E7W A;  4RB0 A;  2O3F A;  2YPR A;  4U7D A;  2FRH A;  4HF2 A;  4ENK A;  4HX7 A;  1MDM A;  1SD5 A;  1E17 A;  3E6B A;  1ZRC A;  1P4X A;  1G3Y A;  3FM3 A;  2OBP A;  1T0F A;  2QZ8 A;  3DP7 A;  5EEG A;  3MZY A;  2O61 A;  3GEZ A;  4L0Z B;  4HF0 A;  4P55 A;  2UXN A;  4ZYE A;  3BY6 A;  1I1G A;  1GXP A;  2L01 A;  3ZPL A;  3M9A A;  3E6D A;  1YIO A;  2HTS A;  4ETS A;  2ZNY A;  5ILV A;  3R61 A;  3CUQ B;  4L0Y B;  2CQK A;  5ILS A;  2W85 A;  5DCF A;  3HHH A;  1YS6 A;  4ENJ A;  5HS8 A;  1TW2 A;  4BXU A;  4OIN F;  1OYY A;  1BC8 C;  3NRV A;  1DP7 P;  4K2E A;  2DK5 A;  2F5D A;  1DPR A;  2BGC A;  1BI1 A;  1P6R A;  5CVR A;  4DQ2 A;  5HLH A;  3ZMV A;  3CO7 C;  1FWZ A;  2NS0 A;  2A3S A;  2JSC A;  2VOP A;  4GO1 A;  3BRO A;  3ULQ B;  3I5U A;  2Z3Y A;  3WGI A;  4DNC A;  2CWE A;  3GXO A;  1ULY A;  2W57 A;  4CO8 A;  1R00 A;  1P2F A;  2V79 A;  3CJN A;  1F4K A;  2YR2 A;  4HX8 A;  3IL2 A;  1ZHF A;  3DFG A;  1KQ9 A;  5BS6 A;  3R0J A;  2ZBK A;  2FF4 A;  1BI0 A;  5IT3 A;  5E1X A;  1FC3 A;  4AIJ A;  2ZFW A;  3BPV A;  2NNN A;  5FO5 A;  1WI9 A;  3FMS A;  3P9C A;  2H09 A;  1CGP A;  4ESF A;  2MC3 A;  1JGS A;  1XD7 A;  5LHG A;  2IJL A;  3HIF A;  4I0B A;  1SFX A;  2JPB A;  4HX4 A;  3MFK A;  1MKM A;  1IN6 A;  1RUO A;  4KYW A;  3HYI A;  5DYM A;  4ZYH A;  3RDI A;  3Q9V A;  4LFU A;  4EV0 A;  1RIO H;  4YG2 F;  3O2P E;  3BP8 A;  3KE2 A;  1XDU A;  1YLF A;  3OV8 A;  1OPC A;  2EFO A;  3T0Y A;  3AAF A;  5LHH A;  2FNA A;  2G7U A;  4IHT A;  3KP7 A;  2DI3 A;  2ZXJ A;  1FBU A;  1YO5 C;  2DPU A;  4XBF A;  5CVJ A;  5E17 F;  4P9F A;  2HDC A;  2FNP A;  1XGM A;  2KIF A;  1QNT A;  2Y75 A;  4CGZ A;  3ZP5 A;  3W6J B;  2D2W A;  1WSU A;  1FBQ A;  2FEZ A;  2ZNZ A;  1K78 B;  1TQM A;  1OYI A;  3QU6 A;  3C18 A;  3EYI A;  2VT3 A;  3SFZ A;  2FMY A;  2CO5 A;  5D8L B;  2WC2 A;  5E8G A;  3LA2 A;  5A2Q K;  3U1D A;  4A6E A;  1K78 A;  2DFI A;  4RGX A;  1CF7 B;  3TOA A;  3RYP A;  4HDV A;  3GUD A;  2NNY A;  2EV6 A;  1PP8 F;  3HSR A;  1Q1H A;  3K2Z A;  2VC0 A;  3TOB A;  2K4J A;  1T39 A;  3FM5 A;  4HYE A;  1ZN2 A;  3SHF A;  4I7H A;  1E2X A;  4IVN A;  3NEU A;  4YFK F;  3JSP A;  2CFX A;  3BOQ A;  3WTS C;  4ZZD A;  2JRT A;  2ETH A;  2KIU A;  4H0E A;  3LA3 A;  1QPM A;  2Y0M A;  2OQR A;  4M9Z A;  4EJV A;  4CZZ A; 
#chains in the Genus database with same CATH topology
 4HG2 A;  2EH3 A;  2P4W A;  2IGM A;  2MBF A;  2HOT A;  1V54 H;  1TNT A;  5B5E C;  1YYV A;  5HOD A;  2E1C A;  1EH7 A;  2M30 A;  2VON A;  4HSR A;  3S2W A;  3CLQ A;  4BGD A;  3C7J A;  4XSZ F;  4HAM A;  5K7F A;  1NK2 P;  2HPI A;  3ZQL A;  4KNY A;  2JWT A;  4F92 B;  2VXZ A;  2FBI A;  1HW5 A;  1QA6 A;  5JI6 A;  1HA8 A;  4BE1 A;  1MH3 A;  2P6S A;  1RES A;  3CMM A;  2RC4 A;  3ECO A;  3GTP J;  3QPL A;  3OYC A;  3PSF A;  3U9G A;  4JX5 A;  2H6B A;  3OYB A;  2ACJ A;  3FXK A;  3I58 A;  4AD9 A;  4CIC A;  3VFZ A;  1Y56 A;  3I56 I;  2OTL I;  3JTH A;  3E7L A;  2CSO A;  2R3S A;  2P0W A;  3GFI A;  2BV6 A;  2HDD A;  3HOV J;  3LL7 A;  2BXZ A;  2IS1 A;  2VOD A;  3M7G A;  4HOB A;  2V7F A;  3FXQ A;  2HI3 A;  1BR1 A;  1IN5 A;  1YRN B;  1OR7 C;  4PJM A;  1LEB A;  1MBJ A;  3CO6 C;  1T6S A;  3GTJ J;  2DTR A;  1MDM B;  3HOY J;  1FMV A;  3H9J A;  1L0O C;  2ZKZ A;  2NAZ A;  3J7Z I;  1P7I A;  2M7A A;  4KN7 X;  4XNF A;  4AYB N;  1ACI A;  2MC4 A;  4ENN A;  4F55 A;  2XAG A;  5LFA A;  3DTI A;  4JQF A;  1WZ2 A;  3MWM A;  3V4G A;  1HSJ A;  2CQ7 A;  3G3Z A;  2Y9Z A;  1YRN A;  2GA1 A;  3EPZ A;  4F3Q A;  1JKP C;  3MQ0 A;  5D6F A;  5FLX K;  4P96 A;  2BY3 A;  3PNY A;  4A0Y A;  2XF6 A;  1LFU P;  4IRI A;  3F72 A;  4IF4 A;  2O9L A;  5K5R A;  4MTD A;  4F52 A;  4MEY F;  3GZN B;  1U8R A;  2AQE A;  2MD5 A;  1K4S A;  1W0U A;  5FKN A;  2J5O A;  5KCM A;  3FMR A;  2YX4 A;  2OCC H;  4G6T B;  1FIA A;  1F1Z A;  1VQ4 I;  2M7B A;  2DCE A;  2CV2 A;  2KJB A;  4WWC A;  5DUK A;  4KIT B;  1U5T A;  3QWL A;  3P9K A;  2WY7 Q;  1QZY A;  2CUJ A;  2KRF A;  3PUB A;  5JFR A;  1E0E A;  3GTO J;  1LQ1 A;  2TRT A;  2A6H F;  1UHS A;  2AHQ A;  2X1C A;  3E0J B;  2R0Q C;  5CQE A;  2HOS A;  4KIF A;  4C3H J;  3VYS B;  5GTH C;  2JJ7 A;  4KIC A;  3CCE I;  4R79 A;  5CYV A;  3JRI A;  4HDU A;  3FXO A;  1MMS A;  1LVK A;  5HNF A;  1FSH A;  4M3E A;  3ZRG A;  1EA3 A;  3FIS A;  2K9M A;  4DJA A;  4LLN A;  2PX9 A;  2IW5 A;  1FZP B;  2KHM A;  3TDU C;  2BE5 F;  1ZLK A;  2XPU A;  4D5C A;  4Z6Y A;  3L9F A;  3G1O A;  1PP7 U;  1W36 C;  3JAM K;  3MVP A;  2JA5 J;  4EGY A;  3HPH A;  4RGU A;  1EH8 A;  3ZQF A;  4OAZ A;  3OL4 A;  2VBZ A;  3IP4 B;  3ERE D;  1DP3 A;  2RKH A;  3OSF A;  3T5X A;  3LFU A;  1YIT I;  3I54 A;  2W00 A;  3E5Q A;  5H6R A;  5LEK A;  2XSD C;  3JRC A;  3EDP A;  3ZN1 A;  4LG0 A;  1YJW I;  5E3M A;  2GOX B;  2DO7 A;  5L3F A;  1L3L A;  4BQQ A;  1N78 A;  3DPL C;  1VFC A;  4UUT A;  5J40 A;  3D0S A;  4XKV A;  1ZEL A;  1WJD A;  1YFH A;  1LE8 A;  3E6C C;  4M74 A;  3F21 A;  1O3S A;  2DPD A;  2IA2 A;  1OCO H;  5J1Y A;  3OYA A;  1ZTR A;  2E71 A;  4UNO A;  4XRS G;  2ME0 A;  1WHU A;  2AXT C;  2Y0S A;  3NAR A;  3T8T A;  3ZQ7 A;  3J81 K;  5HLG A;  1Y39 A;  5E1Z B;  1XCV A;  2IPQ X;  4J01 A;  3K6G A;  2HWV A;  5DS9 A;  5C4X J;  3OMY A;  4PJL A;  3N4M A;  1IXS B;  1JHF A;  3S2D J;  1BIB A;  1SEU A;  1ETY A;  5EDN A;  2DK8 A;  3ABM H;  5EZH A;  2E36 A;  3BWG A;  3PNT A;  3HRM A;  4AYB A;  1FOX A;  1MD0 A;  2ZME B;  4AC0 A;  2XB0 X;  5GAG J;  4PZJ A;  4ZTJ A;  2M4K A;  4D9J A;  2HVQ A;  1WKM A;  2H8W A;  3JTG A;  3KYC B;  3HHG A;  1W5S A;  3MZH A;  3FDY A;  3FWE A;  2J5P A;  3EUH C;  2FXA A;  6PAX A;  4ITV A;  1X1P A;  1X3W B;  2V26 A;  2ESH A;  2OC6 A;  1R7J A;  3LSI A;  4HBL A;  4BJ5 C;  5JLX A;  4Q5S F;  1ENH A;  2M9H A;  3GTQ J;  2HXI A;  1SFU A;  3WU2 C;  4AIK A;  2LH9 A;  2Q2E A;  4A3F J;  1R36 A;  2G7H A;  2KRH A;  1X1B A;  1ZRF A;  4E7S A;  2W48 A;  5K1Y A;  1R1V A;  3RQI A;  2XAU A;  4BBR J;  4OOI A;  4HQE A;  2QBY A;  5M5W J;  1R22 A;  2WAQ A;  4A3D J;  1F5T A;  2JPC A;  3OIO A;  2KLO A;  3IKV A;  2CFO A;  2D5V A;  1BC7 C;  1U2W A;  5FKK A;  3BR6 A;  3ZMU A;  3OS2 A;  2VJJ A;  4I99 C;  1UFM A;  1VZ0 A;  4A5M A;  3DTK A;  2W84 A;  1S5L C;  2VJI A;  4UHT A;  1HF0 A;  1J0R A;  2H6C A;  4ZZL A;  1I1S A;  2L9V A;  3QPT A;  1TT0 A;  2CYY A;  3HEF A;  1AOY A;  1JHH A;  2E7X A;  2ME6 A;  2K7L A;  1HST A;  4CCO A;  1UJ8 A;  2BY2 A;  2XF5 A;  3DPT A;  4EMS A;  1KYZ A;  1LDK B;  4PJJ A;  4HNV A;  5LBQ A;  2RQP A;  2P6T A;  1FJL A;  1JTX A;  2OD5 A;  3FXL A;  1QO0 D;  1XSX A;  4RAZ A;  1HOM A;  3KEY A;  1D1A A;  1ZGA A;  2R7D A;  4JX4 A;  2MW8 A;  1Z6T A;  3RTR A;  3CTA A;  3ZQQ A;  3SZG A;  4JX6 A;  2Y9Y A;  1WJA A;  3LAJ A;  3OWT A;  4LIU A;  1FNN A;  3A01 A;  2M3A A;  4H4K C;  2HTJ A;  3RPQ A;  4CXF A;  3PFI A;  1YG2 A;  3CJT B;  4QPO A;  2X6X A;  3VYR B;  4BE2 A;  3S15 J;  3VSK A;  4XOT A;  1PUF B;  1DPU A;  2DA5 A;  4C2M J;  3I59 A;  1CQT A;  1X3U A;  3HB9 A;  5J47 A;  4V2G A;  2P7C B;  1FYL A;  2M8E A;  4O5V A;  4BL0 B;  1VND A;  2LSO A;  3A0H C;  3OIP A;  3RKY A;  1HKQ A;  4RAG A;  1JUM A;  5A2Q Z;  1MNE A;  2R7S A;  4S04 A;  4D5F A;  1A6I A;  3LA7 A;  2PMH A;  3PFY A;  1VF9 A;  5KAI C;  4BQA A;  1HW1 A;  1WRJ A;  2PJR A;  2E1O A;  3QYF A;  3RKW A;  5GAH J;  3ZXS A;  2DA1 A;  2RGV A;  5LHI A;  2Q0O A;  2VKD A;  3W6K B;  3F3X A;  4G7O F;  2XGX A;  4RLF A;  2ESN A;  1LE8 B;  2EK5 A;  1S6L A;  3L7W A;  4FE7 A;  2MSY A;  3IC7 A;  5H6Q A;  2STT A;  1Z77 A;  2KFD A;  1S72 I;  1U0J A;  1YW7 A;  4IHY A;  2MYS A;  4AM3 A;  1N77 A;  4M6X A;  4UB8 C;  1WI3 A;  2PJR B;  2BY1 A;  4BYY A;  1KU9 A;  2GIV A;  2WAQ N;  1E3O C;  3JSO A;  1IF1 A;  3AL0 C;  2B0L A;  4C30 A;  4XID A;  1D5V A;  3QOD A;  4XQF A;  2MGQ A;  3KZI C;  5EF6 A;  2QQB A;  4DBQ A;  2IEK A;  3K1P A;  2VQG A;  3H5A A;  3GVA A;  4W97 A;  2H94 A;  2DMU A;  1TWA J;  3GFM A;  4XIC A;  2EFW A;  4A12 A;  4EJT A;  3TGN A;  3LQQ A;  1J75 A;  1M1E B;  3CZ6 A;  2A07 F;  2X51 A;  3O3K A;  1T0F C;  3GWZ A;  4A0X A;  1XGN A;  3QYB A;  3N97 A;  4GFB A;  4XK4 A;  3K4C A;  2Z5U A;  1K7A A;  4BNC A;  1Z9C A;  1P7J A;  3BLY A;  1QGP A;  5FLM J;  2LY2 A;  3ZMT A;  4BDZ A;  5E8I A;  2IA1 A;  1V3F A;  3BTJ A;  3K4N A;  1LFP A;  3JRF A;  1SAN A;  4BE0 A;  2EV0 A;  5F1R A;  3OR2 C;  3P9I A;  4MTE A;  3LFK A;  4XKB A;  2KIQ A;  5DD8 A;  2AO9 A;  3PJR A;  1MMN A;  2F48 A;  3S2H J;  1X4O A;  3WE3 A;  4YIR X;  2QQ8 A;  2GOM A;  3IKT A;  1XTA A;  2COM A;  2CMP A;  2WV0 A;  1UG0 A;  2ECC A;  3CCM I;  4IRH A;  1XCB A;  1X4P A;  2KZG A;  1ZAO A;  2LBF B;  3HRU A;  1ZYR F;  1O7L A;  2CG4 A;  5FGM A;  3OYK A;  2ZJQ F;  4Z2Y A;  3S3M A;  3KCC A;  1MGT A;  1V5E A;  4JK1 X;  5F64 A;  1RZ4 A;  1ZH5 A;  4XRF A;  3ZQH A;  1FP2 A;  3OOU A;  3BJ6 A;  1FTZ A;  3S14 J;  1FEX A;  2AXL A;  2ZC2 A;  2R7U A;  1AKH B;  4YEJ A;  3OS1 A;  2BOL A;  1GVD A;  1V4R A;  2H27 A;  1IRG A;  2ZME A;  3VPR A;  4Y52 J;  1UEL B;  2IXS A;  1WJF A;  1QPI A;  2QYO A;  3FKJ A;  2ZXH A;  1MND A;  3M1E A;  3FHN A;  1QHH D;  4FX0 A;  5IT9 Z;  3L00 A;  3M1C A;  4BQN A;  3I9V 2;  4ZYG A;  1H9T A;  1TP4 A;  4XKW A;  2NOJ B;  3OR1 C;  3H0D A;  2PMZ A;  2B7E A;  3UNG C;  5BQT A;  3F0C A;  3KLO A;  1R5G A;  4LIT A;  4D1Q A;  2QEX I;  3CJQ B;  4F7Z A;  1LB2 A;  4G7H F;  1B8I B;  4XMY A;  3QP5 A;  5E3N A;  2DMP A;  5BMZ A;  2HYG D;  3G73 A;  3NWS A;  3G6E I;  5TJJ A;  1FYK A;  2P5V A;  2W25 A;  2XAQ A;  2HVR A;  1S3J A;  4EM2 A;  5FRM A;  4RMN A;  2F2E A;  5EG0 B;  2FX0 A;  4KMU X;  1BOB A;  5L3G A;  1I3A A;  4DIQ A;  4A3C J;  2VB6 A;  3SDB A;  2LNB A;  2OUM A;  3VOE A;  3RYR A;  1W4M A;  3C3W A;  4NB5 A;  4UB6 C;  3ZN0 A;  1BW6 A;  3DBH B;  2KRC A;  1OFC X;  3N05 A;  2P7V B;  1Z3X A;  1KU7 A;  4I76 A;  2GZW A;  1I6X A;  1KU2 A;  5FD5 A;  2LDU A;  3HTS B;  1K83 J;  2X6O A;  2E60 A;  4XKC A;  1BI3 A;  5EG0 A;  1S29 A;  1TWH J;  2LTP A;  2BW3 B;  1W7P A;  2YSR A;  3I4P A;  1MW7 A;  3T1B A;  4XRS A;  1J9I A;  2K86 A;  1YTY A;  4HA8 A;  2FBK A;  5FLX Z;  1A04 A;  1UMQ A;  2WAE A;  3CUQ C;  4B44 A;  4E4H A;  1K6O A;  3EYY A;  1VQK I;  1YX5 A;  4L5I A;  2V9K A;  1HLV A;  4EEF G;  3HL2 A;  3CUQ A;  3GYH X;  1SMY F;  3ZQC A;  1FYM A;  4HZF A;  2DJN A;  4XLN F;  4PFP A;  1W7P B;  1OMI A;  1D0Y A;  4U0W A;  3NAU A;  3CC2 I;  2X1D A;  3CQZ J;  4EJV A;  2IRF G;  2P5K A;  2LF7 A;  1XMA A;  2L7Z A;  2W24 A;  2XAS A;  3S32 A;  3QRF F;  1S8N A;  3RIR A;  3ZQG A;  2KIS A;  3BJA A;  1QZZ A;  1SMT A;  2XAF A;  2DA6 A;  4I02 A;  1TBX A;  2ZCW A;  4S05 A;  2FA5 A;  3JRA A;  5BNG A;  4BY1 J;  4ENM A;  2JA6 J;  1QHG A;  1HKS A;  4HV6 A;  5K5O A;  5CVI A;  3SEZ A;  4RB3 C;  3ABL H;  4L5J A;  3KFW X;  4M9X A;  2PN6 A;  4E6K G;  4ESB A;  3LNQ A;  1MBG A;  1UB9 A;  2HGC A;  3JRG A;  5M3M J;  1FP1 D;  3E3V A;  4JBA A;  2K5C A;  2DOE A;  2RQQ A;  3NWT A;  3LSM A;  5DUI A;  4B43 A;  2XGD A;  5KVR A;  1T8I A;  4LD5 A;  1F9N A;  1BL0 A;  3DWL E;  2O6G E;  2DN0 A;  3EUH A;  4LJZ F;  1IAW A;  2C6Y A;  2OU2 A;  4PGG A;  4MEX F;  3PQK A;  1G3W A;  1YQA A;  3R60 A;  1YJ9 I;  5IP9 J;  4M3D A;  2KZV A;  2XRL A;  3K7A J;  4FT8 A;  4LK1 F;  3OIQ A;  3OYM A;  1B1B A;  1OIS A;  2G0E A;  2O5R A;  4IHV A;  2EIL H;  1IV6 A;  2CW0 F;  2ELH A;  2RVC A;  3NQO A;  3I71 A;  2XAH A;  4IPA A;  1T08 B;  4IHX A;  2H8R A;  2W1O A;  1LVA A;  4M6Y A;  1FOW A;  1YI2 I;  4RAF A;  3HOU J;  3BQY A;  2OF7 A;  5D5W B;  5E3O A;  2FU4 A;  3LSH A;  3PUF A;  5IOZ A;  5LEJ A;  1B6A A;  1G3S A;  5AON A;  1ZLJ A;  4L18 B;  2WTE A;  4A5N A;  4YIF A;  3E97 A;  3L2C A;  2BEO A;  2L0K A;  1K6Y A;  4IZZ A;  1UST A;  2FSW A;  5J4Y A;  5IT9 K;  1A6Q A;  4KFC A;  1VQ8 I;  2VE9 A;  3J7A Y;  3CCR I;  4XLA A;  4XOR A;  4XON A;  2EWN A;  2KPM A;  4TV7 A;  5FLV A;  3L1P A;  3KET A;  1RR7 A;  1U9O A;  1IUF A;  2VUM J;  4B09 A;  1R71 A;  2OV7 A;  2E5N A;  1BM9 A;  2IS4 A;  3VDX A;  4N4O B;  1KQ0 A;  5LGU A;  3CCL I;  1J7K A;  1YE9 A;  4E7L A;  3M3Y J;  3DCF A;  4U0V A;  3S1Q J;  1XN7 A;  2HQR A;  5D5X B;  4GDF A;  2Y2Z A;  4YEL A;  2X6Y A;  4EM1 A;  4N9I A;  2NVY J;  2JQ7 A;  1T2K A;  1J09 A;  3I64 A;  4CZZ A;  2EA2 A;  1TWC J;  4L5E A;  3DF8 A;  1ONV A;  1SD6 A;  4CYC B;  2A68 F;  4CUG A;  4A3L J;  3KZZ A;  5CKT A;  5CLS A;  4OWR B;  2DW4 A;  2EB7 A;  3K70 D;  2EZH A;  1IDY A;  4BEH B;  5L3E A;  1I27 A;  1P4A A;  2JK3 A;  2LBF A;  1Z3Y A;  3WTX C;  3CC4 I;  2PI0 A;  4P9U A;  4CSW A;  4L9N A;  1FMW A;  3C2B A;  3F6O A;  3Q5F A;  4IHS A;  1BJZ A;  2WA0 A;  2VL8 A;  1ZR4 A;  3VYU B;  1B4A A;  2BY0 A;  3RSN A;  1JKO C;  4PSW A;  1B59 A;  2Y30 A;  1H89 C;  3L2R A;  1X58 A;  2PBI A;  1H0M A;  2F5C A;  2ID3 A;  3HOT A;  4BEH A;  3VSL A;  5J4V A;  3A01 B;  4RB2 C;  3A0B C;  1OCR H;  4I6Z A;  1U6G A;  2K27 A;  1Z91 A;  4N9H A;  3WTZ A;  2VAS A;  2E2H J;  2DJI A;  2XUB A;  4UVB A;  2L9R A;  3ML6 A;  5BPI A;  1IXR C;  3M8F A;  2ICW G;  1R4N B;  4EM0 B;  3GBG A;  3FBI B;  1VQ6 I;  1X1A A;  2QVO A;  2V1X A;  2YU3 A;  2H1L A;  4OU0 A;  3ELK A;  4IHW A;  4DZJ A;  2CS3 A;  2GWR A;  1GT0 C;  1ORK A;  2YS9 A;  4FET A;  1G6N A;  5B1A H;  3JCU C;  2R7Q A;  1Y8Q B;  2R7X A;  1FT9 A;  3WTV C;  2STW A;  4CYD A;  2QSH X;  1IRZ A;  3RJP A;  4KA4 A;  2Z99 A;  2MLK A;  2K9N A;  3W2W A;  2F6C A;  3HRT A;  1KA8 A;  3BZK A;  3L2U A;  2HOA A;  4WX9 A;  5AIQ A;  1W36 D;  3M8J A;  2W82 A;  3F8F A;  4X6A J;  3F8M A;  4ON0 A;  2KMU A;  3GCM A;  3BR2 A;  5FKL A;  3CDH A;  4PJ0 C;  3K1M A;  5J8C A;  4D0P A;  2X85 A;  4ZC3 A;  5LRR A;  3JRH A;  4LG0 B;  2R92 J;  3KP4 A;  1WPK A;  1ZRE A;  2IA0 A;  1VQO I;  2Z33 A;  4BHC A;  1DUX C;  4QIW N;  1WFX A;  4IXA A;  1D8K A;  4KT6 A;  1MNM C;  4MGR A;  2ELK A;  3DV8 A;  4A2U A;  1SVL A;  3CJR B;  2A61 A;  5DTD A;  3REO A;  1RPW A;  4M9S A;  2MG4 A;  4PJN A;  2LKX A;  1O57 A;  1FSE A;  3ASO H;  1ETQ A;  4MFD A;  4CCM A;  1W1W E;  5HS9 A;  2EIM H;  1DGR M;  1IN4 A;  5JVT A;  2JRM A;  3DKX A;  3IRR A;  4B3A A;  1J5Y A;  3BPX A;  1QQI A;  1AHD P;  5L3C A;  3U21 A;  3EUK L;  1Z1D A;  2R7R A;  4FX4 A;  3SQN A;  1TQI A;  3HOW J;  2DOD A;  1P9Q C;  3ABU A;  4M3B A;  3JW4 A;  4NBQ A;  2HKO A;  2L02 A;  4C3J J;  3DBL B;  4C3I J;  1R58 A;  1ETO A;  1ITY A;  1NHA A;  1P92 A;  5E79 C;  3FXR A;  4CCK A;  5LGT A;  2G9W A;  3BTL A;  4QTR A;  2FD5 A;  4OIR F;  3SFI A;  1J2X A;  4Y4R A;  5DEQ A;  1ZG3 A;  4MQ9 F;  2GQQ A;  1IXC A;  4B47 A;  2NOG A;  2ID6 A;  4FIS A;  3CCJ I;  5K7H A;  2GBY A;  3OS0 A;  2IVM A;  3GFJ A;  4A69 C;  3A1Y A;  4LGW A;  1UZC A;  3DXJ F;  4XLF A;  4KMF A;  4QPQ A;  5TRD A;  3K70 C;  1QVU A;  4A3I J;  3Q9S A;  4LLG F;  4RGR A;  1XGO A;  3GLL A;  5HS7 A;  2Y69 H;  5F0C A;  3TQN A;  2HYF A;  2V1U A;  5LRS A;  1HW2 A;  4WXC A;  1YW9 A;  5IP7 J;  2ZFU A;  2LFB A;  1LDD A;  2QEN A;  1MH4 A;  4Q48 A;  1HBX G;  4BXF A;  2M87 A;  4RB1 A;  4G8X A;  4UXN A;  2DYR H;  5EEH A;  4I2O A;  2EBI A;  2BYV E;  1UHW A;  1BW5 A;  4RAY A;  1SD4 A;  1Z21 A;  2F4O B;  4ZDP A;  4ABZ A;  3V42 A;  2IT0 A;  2DMT A;  4HV5 A;  4XOP A;  2VC1 A;  3W3C A;  1XSD A;  2MA3 A;  4BBS J;  2HQA A;  1G8X A;  4PUS A;  1I5Z A;  1MBF A;  2OJE D;  1Y1V J;  2VLA A;  2CUZ A;  4E7J A;  1T38 A;  2XGC A;  5CQG A;  2CV0 A;  2ISY A;  4CCL A;  2QM3 A;  2KDZ A;  1X3Z B;  4LG3 A;  2GAU A;  3KP6 A;  1E3P A;  1ON2 A;  1TTY A;  3ZMD A;  3ZR8 X;  1D1B A;  2HR3 A;  3GO5 A;  1OR7 A;  5D4S A;  2WB1 N;  2RAE A;  5GAE J;  2K02 A;  4G6D A;  2LC2 A;  5LD2 C;  3C1D A;  4IRG A;  3LAP A;  4E7Z A;  4I0A A;  3WE2 A;  3C2G A;  3F22 A;  4R1H A;  4FQG A;  1ETX A;  4N0B A;  5H20 A;  1Z6R A;  4O3M A;  2XIG A;  2R7W A;  2VT2 A;  3I59 B;  2DQR A;  4EGZ A;  3F6V A;  2Y0S N;  3FXJ A;  2JN6 A;  3FK6 A;  1D5Y A;  4II3 A;  1CF7 A;  2GXG A;  4BAY A;  1Z0X A;  2L3D A;  3EQL F;  3KX2 A;  2V1D A;  2E34 A;  3HSE A;  4G9Y A;  3WGG A;  5CJ9 A;  1HDP A;  1S7E A;  2VXD A;  5FD6 A;  1FLI A;  3BR3 A;  1HKT A;  4XLH A;  5DCM B;  3FKI J;  1G59 A;  3LSJ A;  1JI8 A;  1SD7 A;  2PMU A;  4WK8 F;  1OLT A;  3R0A A;  3LSR A;  2WB1 A;  5HOO A;  4F91 B;  4PCQ A;  3J80 K;  3RKX A;  2NRA C;  3FX3 A;  2Q1Z B;  5JLW A;  2W4S A;  2EZI A;  3AFH A;  2LG4 A;  1TT5 B;  4IEJ A;  3B6C A;  5F08 A;  2LR8 A;  3HSF A;  2N8G A;  2QSG X;  2IS6 A;  4E7K A;  1ZR2 A;  1UCR A;  2DT5 A;  1HCR A;  4ESJ A;  1QU3 A;  4WXD A;  4HST A;  4L9V A;  3LSP A;  2QCO A;  4MO7 A;  3BR5 A;  2NS8 A;  3FF5 A;  3CP2 A;  1EF4 A;  2EPF A;  2EIK H;  2M5W A;  2MD0 A;  4HQM A;  1TWF J;  3VEP A;  1J59 A;  2GA2 A;  1QBJ A;  4HW0 A;  4QWQ A;  5EZG A;  2LVS A;  3IAM 2;  2NXN B;  5H2F C;  4MIM A;  2XPV A;  1MSE C;  5ICF A;  2LRE A;  4P5O A;  4OIO F;  4LIV A;  1RC9 A;  1JT6 A;  2EFN A;  5C3E J;  2R7F A;  3F8B A;  1Y8R B;  2DA2 A;  2XKO A;  3GW2 A;  3HC7 A;  4GXO A;  3V7S A;  4BHP A;  5E18 F;  4BDY A;  3OYI A;  2XDV A;  3P7N A;  4NC6 A;  2VBX A;  3OYD A;  2LYC A;  2A5Y B;  2QUF A;  3W2A A;  2JZY A;  5EJC A;  2M0C A;  1O7F A;  2DAO A;  4FAS D;  3L2V A;  1ZQ3 P;  2V6E A;  2VKH A;  1LJ9 A;  3VB2 A;  1BR2 A;  1H88 C;  2VE8 A;  3ZOB A;  2FE3 A;  4Y15 A;  1XX5 A;  5AIP A;  4U0Y A;  2FQ4 A;  5FJ8 J;  3JRB A;  2V9V A;  5B3S H;  3K4B A;  1JJ8 C;  4IJA A;  4YFX F;  3U1K A;  3PIO F;  2X4H A;  3X2Q H;  2CJJ A;  4DGW B;  2GXB A;  1ETK A;  1Y0N A;  4A6D A;  1WJ5 A;  5HDK A;  2HOE A;  4UUV A;  3BR0 A;  3IRQ A;  4IKF A;  3IUO A;  5DD4 A;  4I01 A;  1ZKG A;  2VBY A;  4FE4 A;  3RI4 A;  2M45 A;  1Z05 A;  2JA7 J;  3ABK H;  3WHB A;  1MMA A;  1DU0 A;  2Q2E B;  4Y13 A;  3TBI A;  3MD2 A;  2D45 A;  1NK3 P;  2XVC A;  4MFE A;  2WY8 Q;  2QBY B;  3WTW C;  2PQ8 A;  3H3U A;  2XRN A;  3RZO J;  5IPA A;  1ON1 A;  2KQR A;  2LRD A;  4PK4 A;  2QKM B;  4I98 B;  1RI7 A;  3ABT A;  2OZ6 A;  1W7P D;  2TCT A;  1NG6 A;  3HPG A;  3HTU A;  3K4L A;  2O8X A;  3BC8 A;  1PUE E;  2RNG A;  3HRS A;  4YRV A;  3G71 I;  1Q1V A;  4OMZ A;  4D7N A;  4EVI A;  2WWY A;  4U7B A;  3J7A O;  3T8R A;  4KT5 C;  4NQW A;  4Q47 A;  1SFE A;  1FPQ A;  3OOP A;  2X9D A;  4NDL A;  3E1S A;  1MMG A;  4AU7 A;  1Z7U A;  5HLT A;  4BU2 A;  4G7Z F;  3C2H A;  1OCP A;  3GLX A;  1YHQ I;  2OTJ I;  1JTY A;  2DQL A;  1ZAR A;  5ICE A;  2NYX A;  3O6B B;  3KYD B;  4M72 A;  4RA2 A;  3TDZ C;  4A3B J;  1VQ5 I;  2QGU A;  2LY1 A;  4KDP A;  4UUS B;  3TL4 X;  2L9S A;  3F23 A;  5DM7 F;  4M3F A;  1IN7 A;  4XM3 A;  5FRN A;  2HEO A;  1G3T A;  1U5T B;  4A3K J;  2KIM A;  5IYC J;  3VYT B;  3DQV C;  2X6W A;  2R7T A;  3GF2 A;  4OIP F;  3HKZ A;  5TIS C;  2D1V A;  1WCM J;  1V55 H;  2IP2 A;  4CDG A;  1PDN C;  2FML A;  4UV8 A;  3WTT C;  4Y17 A;  3K1N A;  3TKY A;  3QQA A;  3H35 A;  3M07 A;  2V9P A;  5GAD J;  2A05 A;  4QLC U;  5M5Y J;  2XRO A;  1A5J A;  3LMM A;  3J81 Z;  5ICC A;  1ZRD A;  1U3E M;  2I5U A;  1XG1 A;  1JXS A;  3JAM Z;  2DLL A;  1SC7 A;  4GRI A;  1BR4 A;  2NVU B;  3WTY C;  3CES A;  5F1J A;  1LDJ A;  3DTE A;  3D5L A;  1KON A;  4MHG A;  5TGT A;  3CME I;  2L4M A;  2DU9 A;  3BZ6 A;  5CPR B;  5DDG A;  3QAH A;  3GTG J;  2FQ3 A;  2HKX A;  4XSX F;  3H9Q A;  2WAF A;  1T98 A;  3BCA A;  5BPD A;  2R4G A;  1IW7 F;  1FBS A;  2UUZ A;  3GZ5 A;  4YII A;  3SXY A;  4DYR A;  5IY5 H;  4UVA A;  1W5T A;  3QU3 A;  4GCV A;  3COA C;  3RZD J;  5B1B H;  1ZG5 A;  2LLK A;  5EGO B;  3SYT A;  3G4S I;  1BI2 A;  3K9T A;  3KP2 A;  2R5Y A;  5IYD J;  3I55 I;  4AID A;  3S1R J;  2HYJ A;  1ZGJ A;  4ZDO A;  3PNV A;  4XN3 A;  2K4B A;  5JVG F;  2DT7 B;  2M0M A;  2VBW A;  4M71 A;  3WOD F;  2KJC A;  2RN7 A;  2OZU A;  4OIQ F;  4ZTF A;  2QF7 A;  3H3Z A;  2F5F A;  3DKY A;  4Q4Z F;  3B73 A;  4P1W A;  1RNL A;  2ZSI B;  5BOX A;  3HXL A;  1WH5 A;  1GXQ A;  2QQ9 A;  4PDK A;  4BJ6 C;  3CF5 F;  4BHB A;  4IQJ A;  2XHK A;  3KEO A;  3ONQ A;  4XLP F;  1YIJ I;  5J6X A;  5D5V B;  3A02 A;  3S1M J;  2R7V A;  4UV9 A;  2NVT J;  2A6E F;  3H1C A;  5ERI A;  2F4I A;  1AWC A;  2BBY A;  2HS5 A;  2BVL A;  1FOY A;  5J8F A;  3PSI A;  3FZV A;  1GHC A;  3MAJ A;  2JSP A;  4DBR A;  1S7O A;  2E35 A;  3WGH A;  2P81 A;  2MLG A;  4HEA 2;  1R9T J;  4I09 A;  3V7C A;  1BBY A;  4U88 A;  5DV5 A;  5D5U B;  3MEX A;  2OAZ A;  3H92 A;  3ROU A;  2A5W A;  1U5T C;  4CHU A;  1U9N A;  1C0W A;  1FX7 A;  1SVO A;  3V8K A;  2VJ5 A;  2IGO A;  5ICG A;  2HPM A;  3LSK A;  4UVC A;  5JHF A;  1D8J A;  4WXH A;  2I10 A;  4HPQ A;  1B9M A;  2LK2 A;  3RPU A;  2UXX A;  2DA3 A;  3UKG A;  4EJU A;  4RGS A;  3UR3 C;  3OYL A;  4BKX A;  3AKZ A;  3KP5 A;  2X0L A;  4AWX B;  2DOA A;  2V1N A;  2L54 A;  2E1M C;  2LY9 A;  5HLI A;  3CCQ I;  1IV8 A;  1HQC A;  3BDD A;  4IX7 A;  3CCV I;  2V4J C;  3TO7 A;  2LF8 A;  3GX4 X;  1POG A;  3E6M A;  2KKO A;  1XB4 A;  2ZO4 A;  1B72 A;  1D1C A;  1VQP I;  3AG3 H;  3ASN H;  4YFN F;  4AIH A;  3GTM J;  4IL6 C;  3V8J A;  1LEA A;  5GTI C;  1LPQ A;  3KEQ A;  1BIA A;  1ETW A;  2YX7 A;  1ODD A;  1X2N A;  4NC7 A;  4A3M J;  3BQZ A;  4E70 A;  2KL4 A;  2IGK A;  2MAB A;  1ZGW A;  2XGE A;  3WTU C;  2OQG A;  5HDN A;  5FRO A;  3B02 A;  3GZ6 A;  1V5G A;  2JA8 J;  3DEW A;  1WJE A;  5L3D A;  3LQR A;  2ADU A;  1WWX A;  1DDN A;  4B4C A;  2CH0 A;  2VJ4 A;  1KGS A;  4G94 A;  1TQP A;  4GYI A;  3G2B A;  4Y7N J;  1XSV A;  1LFB A;  1A35 A;  2HFH A;  5KK1 A;  4M73 A;  4D7M A;  3HG9 A;  1XMK A;  3EUA A;  2A69 F;  2EJR A;  2LKS A;  2ISZ A;  2DBB A;  4MNU A;  2FOW A;  2QKL B;  4RDU A;  1VI0 A;  3PQJ A;  3HZJ A;  3W6V A;  1BJA A;  2DFE A;  3H5N A;  2L7K A;  1BA5 A;  2ZME C;  4A3E J;  1V5F A;  2XAJ A;  4II2 A;  4AVP A;  4ZH4 F;  5KAF C;  3ESW B;  3BTC A;  3GTK J;  2DT6 A;  3VOD A;  2V6C A;  3H36 A;  5FFZ A;  1XS9 A;  2PEX A;  1IRF A;  1R5H A;  3D5S C;  3O8G A;  2XV4 S;  1OYW A;  1XDS A;  3S93 A;  3IH2 A;  2PJP A;  2Q8K A;  4KIG A;  4ZDL A;  2ZSH B;  1O3Q A;  3LWF A;  3QOE A;  3CCU I;  1HC8 A;  4NUB A;  2Y31 A;  5F04 A;  4Y33 A;  2AS5 F;  1R4M B;  1MBE A;  2R5Y B;  1RR8 C;  2DXI A;  2EZL A;  2EA4 A;  1IRX A;  1W0T A;  3IWZ A;  5GP9 A;  1ZG1 A;  4GYG A;  2K9S A;  3GTL J;  2PFB A;  1D0Z A;  3BCB A;  1S9H A;  4RM2 A;  2PG4 A;  3CMY A;  1GV2 A;  2E19 A;  1I39 A;  2F5V A;  1Z7L A;  2HQN A;  3TED A;  3Q0U A;  2WAD A;  1I50 J;  1FTT A;  4J19 A;  1MBH A;  4RS8 A;  3MKW B;  3H5R A;  4XLC A;  4EJO A;  4XR6 A;  1DGW Y;  1RKW A;  3CLO A;  4XN0 A;  2E1N A;  5E20 A;  1GLN A;  5FFX A;  1R23 A;  5HVQ C;  3BJO A;  1EH6 A;  1GVJ A;  3HOS A;  4XRM A;  1XC5 A;  2D1H A;  5D8K B;  3FHZ A;  4O6J A;  3K2A A;  2Y48 A;  5K5Q A;  2O0Y A;  2RV8 A;  3LST A;  4JYK A;  3TP3 A;  2M1B A;  2W7N A;  1Y0U A;  3KP3 A;  5IOY A;  4OMY A;  4M3G A;  1KQ8 A;  2R93 J;  3K69 A;  1D3Y A;  1NTC A;  2HZT A;  3EET A;  2GXA A;  4V2F A;  5J1U A;  1IUY A;  2MH9 A;  3DKW A;  3ZGK A;  3QOP A;  2EFQ A;  3FK7 A;  1O3R A;  1DU6 A;  3D1N I;  2TDX A;  2DYS H;  1MBK A;  1RET A;  4NHJ A;  3QPS A;  4C9Y A;  4FHT A;  3DU5 A;  1OCT C;  1HDD C;  1MJ9 A;  1K61 A;  4MQV A;  3ZMS A;  1TNS A;  1SVM A;  1USS A;  3DEU A;  5C4J J;  1OJL A;  1ZK8 A;  1YX3 A;  5HDG A;  2DDB A;  2CU7 A;  3BG9 A;  1PJR A;  3QPH A;  2FBH A;  3ERM A;  1FOK A;  4IOA F;  2EV5 A;  2KT0 A;  4ASN A;  1JJ6 C;  3I4N J;  1VTN C;  2VN2 A;  3FXU A;  3DEE A;  1S7A A;  3SZP A;  2JVG A;  1UHM A;  3MKL A;  4WCG A;  3MKY B;  4HLY A;  1BN5 A;  1TZL A;  2JT1 A;  4B3X A;  1MMD A;  2PLY A;  5FB2 A;  2NVQ J;  3H9G A;  3PM1 A;  3U2R A;  3JRE A;  1U8B A;  3F9K A;  4B8X A;  4HRI A;  4M6V A;  3WU0 A;  1TW3 A;  3Q0V A;  5IYB J;  5LGN A;  3BTI A;  5EYR A;  1B9N A;  3TO6 A;  3M8E A;  5JHU A;  3OY9 A;  2P5L C;  5D6E A;  4LMY A;  2MH2 A;  3Q0W A;  3I53 A;  2R7O A;  2OA4 A;  1GV5 A;  4KIB A;  2DMN A;  2LOO A;  1IO2 A;  3OL3 A;  4OAY A;  5CVU A;  3WU1 B;  1WJB A;  3I0T A;  5KNL A;  4V19 K;  2XKP A;  1N75 A;  1MIJ A;  1R6R A;  4L9T A;  3BG7 A;  4WF2 A;  5J1R A;  3CUO A;  3ZMZ A;  4EQQ A;  2CGP A;  3ECH A;  2M2E A;  3BG6 A;  2ZJR F;  4J00 A;  3IH3 A;  1O3T A;  1PUF A;  5C44 J;  2L4A A;  2QWW A;  4LK0 F;  3BT9 A;  3L2W A;  5CVV A;  2BW3 A;  2HXO A;  1FY7 A;  4KUM A;  3FMQ A;  1R1T A;  4E7I A;  4L9J A;  5GPC A;  2E5Z A;  2QSF X;  1Z67 A;  3CF2 A;  2O03 A;  3TP0 A;  1R5I D;  4DOZ A;  5L3B A;  1TLH B;  3DU6 A;  4CA0 A;  2K9L A;  1MJA A;  1H9G A;  3HM5 A;  3R4K A;  4XL9 A;  4A0Z A;  4DW6 A;  1U78 A;  1SAX A;  1H8A C;  4CCJ A;  1F36 A;  3A03 A;  2MFZ A;  1MSF C;  3K10 A;  2HNH A;  2JTV A;  4ZYD A;  3J80 Z;  5F6F A;  3V7R A;  3BR1 A;  3QP6 A;  3CDI A;  3K4K A;  4KN4 X;  1LNW A;  5ILU A;  4R8H A;  3HGY A;  3ISP A;  3SZT A;  2P8T A;  2QLZ A;  5ED4 A;  1PVE A;  3ZCO A;  3G1M A;  3IWF A;  2LD5 A;  2EFP A;  3MKZ A;  1RUN A;  4LB6 B;  3DPU A;  4LLL A;  4U87 A;  1NG7 A;  2F5E A;  5DCM A;  1APL C;  2YUS A;  2Z9O A;  3A2K A;  2CQN A;  4IOC F;  4N4N B;  4ANJ A;  1Y1W J;  4G12 A;  4PGH A;  2VIX A;  4A93 J;  1XGS A;  3OYG A;  3KZY A;  3F8C A;  2GLO A;  3CP8 A;  3L09 A;  1REP C;  2XC7 A;  2L5Q A;  3IHU A;  4EJW A;  3PO3 J;  2VOO A;  2JA2 A;  2K85 A;  3OSG A;  2XPW A;  1SFO J;  3E5U A;  2F4M B;  2FOK A;  1WJC A;  4HLX A;  2VPR A;  1R1U A;  5D4R A;  3HUG A;  3I4M J;  5DM6 F;  1WQ2 A;  3F8N A;  5EGO A;  4XLE A;  4CH7 A;  1T95 A;  3WG9 A;  5LLQ A;  9ANT A;  2QQA A;  3MCZ A;  1JE8 A;  2DTZ A;  4LB5 A;  3DBR B;  1MZB A;  1P4W A;  2RDP A;  3OYN A;  5F0F A;  2UWM A;  1KYW A;  2ZB9 A;  3S17 J;  3M4O J;  1X2M A;  4GGG A;  3FBN B;  3SEQ A;  4DYC A;  2EZK A;  3TW7 A;  1VQN I;  4LOC A;  1YW8 A;  3KLN A;  2RNJ A;  4HF1 A;  1I6H J;  3GFL A;  3K0L A;  3KIO A;  1STZ A;  2K40 A;  1EKE A;  1KU3 A;  1W5C C;  2L7M P;  4G6Q A;  3IH4 A;  2Z2S B;  3AL0 B;  2LKP A;  2XF7 A;  5FKO A;  1SFK A;  1K79 A;  1JUS A;  1OCC H;  3V8L A;  2KP6 A;  2ZJ2 A;  3TO9 A;  1MJB A;  3P5J A;  5E1W A;  3SJM A;  4BH9 A;  2E2J J;  3E5X A;  4AUX A;  4EAT A;  3R6S A;  1BOA A;  2GM4 A;  2CUF A;  1IZ1 A;  3ZQI A;  1HXD A;  3W2V A;  2UZK A;  2DFF A;  1EV7 A;  3DLL F;  5JR3 A;  1YS7 A;  1G4D A;  4BS9 A;  1RKT A;  1OKR A;  2E7W A;  4RB0 A;  2O3F A;  2YPR A;  4U7D A;  2FRH A;  4HF2 A;  4ENK A;  4HX7 A;  4Y3O A;  1VQL I;  2CV1 A;  4BXX J;  1MDM A;  2GIZ A;  2K3P A;  2HDW A;  1SD5 A;  2YU9 J;  4UY8 I;  4A3G J;  1E17 A;  3E6B A;  3HGG A;  1TC3 C;  2Z16 A;  1ZRC A;  4DYQ A;  3AG2 H;  1AU7 A;  5M3F J;  3RCO A;  4ZJZ A;  1RRJ A;  3GME A;  3AG4 H;  1XMX A;  1P4X A;  2FJ1 A;  1G3Y A;  3FM3 A;  3RKQ A;  3CDL A;  2BHY A;  3BG3 A;  1B72 B;  2OBP A;  3AG1 H;  3D5R C;  1T0F A;  2WBM A;  2HVS A;  3WG7 H;  1JGG A;  2BZT A;  1KZH A;  2QZ8 A;  2M34 A;  3DP7 A;  3MZY A;  5EEG A;  2O61 A;  3GEZ A;  4L0Z B;  2A6T A;  2X1E A;  4HF0 A;  4P55 A;  5GPA A;  2CQX A;  2UXN A;  3H0G J;  4ZYE A;  3BY6 A;  1I3Q J;  1I1G A;  1GXP A;  2L01 A;  1GDT A;  1G2H A;  1OCZ H;  3ZPL A;  3M9A A;  2KDO A;  3TW6 A;  1QZE A;  3E6D A;  2BHZ A;  1YIO A;  4NQW B;  2HTS A;  1VQ7 I;  4ETS A;  4CYC A;  2ZNY A;  2EIJ H;  1AKH A;  2DA4 A;  2JMW A;  3QYE A;  5ILV A;  2DFH A;  3S16 J;  3JR9 A;  2O8K A;  3R61 A;  2JUC A;  1IG7 A;  3CUQ B;  4L0Y B;  5E3L A;  4FCY A;  2CQK A;  3L2Q A;  5ILS A;  2W85 A;  5DCF A;  1YJN I;  3HHH A;  1YS6 A;  3LSG A;  4ENJ A;  5HS8 A;  4HNT A;  2L7F P;  1TW2 A;  4BXU A;  4OIN F;  1OYY A;  1XPX A;  1BC8 C;  1A36 A;  3NRV A;  3O8H A;  1DP7 P;  3G1L A;  1PYV A;  1WGX A;  5FKM A;  4ZYA A;  4S0H B;  2X48 A;  2RRE A;  2DK5 A;  2LP0 A;  4K2E A;  1IC8 A;  1VQM I;  2F5D A;  3HOZ J;  1R49 A;  1DPR A;  4B48 A;  4A3J J;  2BGC A;  2PMZ N;  3CD6 I;  3CCY A;  1BI1 A;  1P6R A;  2EIN H;  4JP0 A;  5CVR A;  4DQ2 A;  2VPL A;  5HLH A;  5K7Z A;  2VKV A;  3ZMV A;  1FWZ A;  2NS0 A;  2A3S A;  3CO7 C;  2JSC A;  4E7H A;  3CC7 I;  2VOP A;  4BY7 J;  3HOX J;  4GO1 A;  1X19 A;  3BRO A;  3ULQ B;  5F0H A;  3I5U A;  2Z3Y A;  2FUG 2;  3I3L A;  3WGI A;  4DNC A;  2CWE A;  5B66 C;  3GXO A;  3MZ8 A;  1VQ9 I;  2K9Q A;  1ULY A;  2DMQ A;  2VQL A;  4NC8 A;  3JRD A;  4BJT A;  5EEA A;  3PL8 A;  1QRY A;  2W57 A;  4FTH A;  4CO8 A;  3FXM A;  1R00 A;  1TL8 A;  1P2F A;  2V79 A;  3CJN A;  1F4K A;  2YR2 A;  4HX8 A;  3IL2 A;  1ZHF A;  2OCE A;  2VQC A;  1KQ9 A;  3DFG A;  5BS6 A;  3R0J A;  2ZBK A;  3RQ4 A;  3OYH A;  1F43 A;  4C2U A;  2FF4 A;  2VI6 A;  1JT0 A;  1BI0 A;  3KPH A;  5IT3 A;  5E1X A;  1UAA A;  1E3H A;  2XSJ C;  1FC3 A;  4AIJ A;  5KHD A;  1ETV A;  2ZFW A;  1O4X A;  2DDA A;  3BPV A;  2E2I J;  3A4C A;  2NNN A;  2NVX J;  2HZD A;  5FO5 A;  3K4J A;  4IO9 F;  1WI9 A;  3FMS A;  4MLO A;  4JOM A;  3P9C A;  2H09 A;  4HNU A;  1CGP A;  4ESF A;  2ELJ A;  3VWB A;  2MC3 A;  1JGS A;  1XD7 A;  3BG5 A;  2JVH A;  2B9S A;  2BXY A;  2CRG A;  4B1R A;  5LHG A;  2IJL A;  3HIF A;  1X1D A;  2CQQ A;  2CW7 A;  4I0B A;  2H1K A;  2ECB A;  2K3F A;  3TMO A;  1EJ9 A;  1IJW C;  3J7Y J;  4BAC A;  1SFX A;  2JPB A;  4HX4 A;  3MFK A;  1MKM A;  1TWG J;  1IN6 A;  3H3V K;  2E1M B;  3LOC A;  1ERD A;  1IDZ A;  4KIS A;  2UV1 A;  2ZXI A;  1RUO A;  4KYW A;  3HYI A;  1NH3 A;  5DYM A;  4ZYH A;  3RDI A;  3Q9V A;  4LFU A;  3IV5 A;  4EV0 A;  3HKZ N;  3SDG A;  2O7O A;  1RIO H;  2HQ5 A;  4YG2 F;  3OYE A;  3PIP F;  3O2P E;  5J3L A;  2QA4 I;  3BP8 A;  3KE2 A;  4W1U A;  2IBD A;  1XDU A;  1YLF A;  3K4M A;  2DA7 A;  4F93 B;  3CMA I;  2VQH A;  3IAS 2;  3OV8 A;  1OPC A;  2VKE A;  2WV1 A;  2OPT A;  4KJZ A;  2EFO A;  3CCS I;  4PSX A;  3T0Y A;  1IGN A;  1X1C A;  2IS2 A;  3WHC A;  4AVZ A;  3AAF A;  3FIW A;  2M8G X;  2FNA A;  2G7U A;  5LHH A;  4IHT A;  3S3N A;  4BUP A;  3DLA A;  3KP7 A;  2B63 J;  2DI3 A;  1B8I A;  3HDD A;  2AQF A;  2ZXJ A;  1FBU A;  2IAI A;  1JKQ C;  3KYL A;  1YO5 C;  4RM3 A;  4RBO A;  2DPU A;  4XBF A;  1T56 A;  3S1N J;  5CVJ A;  5E17 F;  3HBL A;  1AA7 A;  4P9F A;  2HDC A;  4RLQ A;  2FNP A;  4CCN A;  1XGM A;  2KIF A;  2L2O A;  4DZP A;  3OYJ A;  1WVR A;  1QNT A;  2Y75 A;  3RPU D;  1A31 A;  1UG2 A;  3B6A A;  4CGZ A;  3ZP5 A;  4CZC A;  3W6J B;  2D2W A;  2HU9 A;  5M5X J;  1WSU A;  2CW8 A;  3MN2 A;  4BQO A;  1FBQ A;  2FEZ A;  2ZNZ A;  4X1E A;  2I8D A;  1K78 B;  1TQM A;  3OYF A;  1OYI A;  1SAU A;  2L9N A;  3QU6 A;  3C18 A;  3EYI A;  2VT3 A;  1FIP A;  1OQY A;  4QSH A;  2COB A;  4UUS A;  3SFZ A;  2FMY A;  2Z1D A;  4X0G A;  2CO5 A;  1JUP A;  4NNJ A;  3Q3S A;  5D8L B;  3S8P A;  2WC2 A;  4C2T A;  5E8G A;  3PO2 J;  3LA2 A;  1LUJ B;  3U1D A;  4A6E A;  5A2Q K;  1Y6I A;  2DOF A;  2LMD A;  1K78 A;  2BVM A;  2DFI A;  1N25 A;  4RGX A;  1CF7 B;  1WH7 A;  3TOA A;  3RYP A;  4HDV A;  3GUD A;  2ZJP F;  2NNY A;  2EV6 A;  1PP8 F;  3HSR A;  3BZC A;  2CUE A;  3MMY B;  1Q1H A;  3K2Z A;  2VC0 A;  3TOB A;  2K4J A;  3FM5 A;  1T39 A;  1QVT A;  4HYE A;  1ZN2 A;  3SHF A;  1YOV B;  4I7H A;  1K4T A;  1E2X A;  4IVN A;  5IP6 A;  3NEU A;  1DQU A;  4YFK F;  3JSP A;  2CFX A;  1D0X A;  2IGN A;  2R5Z B;  3BOQ A;  3HJE A;  3WTS C;  3HUG B;  4IQ4 A;  2NS7 A;  2M4G A;  4ZZD A;  1JKR C;  1T33 A;  3S3O A;  1LKX A;  2JRT A;  4PFO A;  2JUG A;  2ETH A;  2KIU A;  5F27 A;  4H0E A;  3LA3 A;  1QPM A;  2Y0M A;  2OQR A;  4M9Z A;  5HNH A;  2ZXW H;  2EQR A;  2R7Z J;  2R5Z A;  2XB5 A;  1IN8 A;  1GUU A; 
#chains in the Genus database with same CATH homology
 2P4W A;  2MBF A;  1TNT A;  1YYV A;  2E1C A;  1EH7 A;  2M30 A;  2VON A;  3S2W A;  3C7J A;  4XSZ F;  4HAM A;  4KNY A;  2VXZ A;  2FBI A;  1HW5 A;  5JI6 A;  2P6S A;  2RC4 A;  3ECO A;  3U9G A;  2H6B A;  2ACJ A;  3I58 A;  4AD9 A;  4CIC A;  3VFZ A;  3JTH A;  2CSO A;  2R3S A;  3GFI A;  2BV6 A;  2VOD A;  3M7G A;  4HOB A;  3FXQ A;  1IN5 A;  1LEB A;  3CO6 C;  1T6S A;  2DTR A;  1MDM B;  1L0O C;  2ZKZ A;  2NAZ A;  4KN7 X;  4ENN A;  2XAG A;  4JQF A;  3MWM A;  3V4G A;  1HSJ A;  3G3Z A;  2GA1 A;  3MQ0 A;  5D6F A;  5FLX K;  4P96 A;  4A0Y A;  4IRI A;  3F72 A;  4IF4 A;  5K5R A;  4MTD A;  4MEY F;  1U8R A;  2MD5 A;  2J5O A;  3FMR A;  2YX4 A;  1F1Z A;  2KJB A;  4WWC A;  5DUK A;  1U5T A;  3P9K A;  1QZY A;  2KRF A;  5JFR A;  1LQ1 A;  2A6H F;  4KIF A;  4KIC A;  4R79 A;  5CYV A;  4HDU A;  1FSH A;  4LLN A;  2IW5 A;  1FZP B;  3TDU C;  2BE5 F;  1ZLK A;  3L9F A;  1PP7 U;  3JAM K;  4EGY A;  4RGU A;  1EH8 A;  2VBZ A;  3ERE D;  2RKH A;  3T5X A;  3I54 A;  3E5Q A;  5H6R A;  5LEK A;  3EDP A;  3ZN1 A;  4LG0 A;  2DO7 A;  5L3F A;  1L3L A;  3DPL C;  3D0S A;  1YFH A;  3E6C C;  4M74 A;  3F21 A;  1O3S A;  2DPD A;  2IA2 A;  4UNO A;  3J81 K;  3T8T A;  3ZQ7 A;  5HLG A;  5E1Z B;  1XCV A;  2IPQ X;  2HWV A;  3N4M A;  1IXS B;  1JHF A;  1BIB A;  2DK8 A;  3BWG A;  3HRM A;  1MD0 A;  2ZME B;  4PZJ A;  1WKM A;  3JTG A;  1W5S A;  3HHG A;  3MZH A;  3FWE A;  2J5P A;  2FXA A;  6PAX A;  2ESH A;  4HBL A;  1R7J A;  4Q5S F;  1SFU A;  4AIK A;  2Q2E A;  2G7H A;  1R36 A;  1ZRF A;  5K1Y A;  1R1V A;  4OOI A;  4HQE A;  2QBY A;  1R22 A;  1F5T A;  2JPC A;  3IKV A;  1BC7 C;  1U2W A;  3ZMU A;  1UFM A;  4A5M A;  4UHT A;  2W84 A;  1J0R A;  2H6C A;  4ZZL A;  1I1S A;  3QPT A;  2CYY A;  1AOY A;  1JHH A;  2E7X A;  2K7L A;  1HST A;  3DPT A;  4EMS A;  1KYZ A;  1LDK B;  5LBQ A;  2RQP A;  2P6T A;  2OD5 A;  1QO0 D;  1XSX A;  4RAZ A;  1ZGA A;  2R7D A;  1Z6T A;  3RTR A;  3CTA A;  3LAJ A;  1FNN A;  2HTJ A;  3RPQ A;  4CXF A;  3PFI A;  1YG2 A;  1DPU A;  3I59 A;  1X3U A;  2P7C B;  1FYL A;  2M8E A;  4O5V A;  2LSO A;  3RKY A;  1HKQ A;  5A2Q Z;  4S04 A;  3LA7 A;  2PMH A;  4BQA A;  1HW1 A;  1WRJ A;  3RKW A;  2RGV A;  5LHI A;  2Q0O A;  3W6K B;  3F3X A;  4G7O F;  2XGX A;  2ESN A;  2EK5 A;  1S6L A;  3L7W A;  3IC7 A;  5H6Q A;  2STT A;  1YW7 A;  4M6X A;  4BYY A;  1KU9 A;  2GIV A;  3JSO A;  1IF1 A;  2B0L A;  1D5V A;  2QQB A;  3K1P A;  3GVA A;  2H94 A;  3GFM A;  2EFW A;  4A12 A;  4EJT A;  3TGN A;  3LQQ A;  1J75 A;  2A07 F;  3O3K A;  3GWZ A;  4A0X A;  1XGN A;  3N97 A;  2Z5U A;  1K7A A;  4BNC A;  1Z9C A;  1QGP A;  3ZMT A;  5E8I A;  2IA1 A;  1V3F A;  2EV0 A;  5F1R A;  3P9I A;  4MTE A;  3LFK A;  5DD8 A;  3WE3 A;  3IKT A;  2COM A;  2WV0 A;  4IRH A;  1XCB A;  1ZAO A;  3HRU A;  1ZYR F;  1O7L A;  2CG4 A;  5FGM A;  4Z2Y A;  3KCC A;  1MGT A;  4JK1 X;  5F64 A;  1RZ4 A;  1ZH5 A;  4XRF A;  1FP2 A;  3BJ6 A;  2AXL A;  2H27 A;  1V4R A;  1IRG A;  2ZME A;  2QYO A;  3M1E A;  4FX0 A;  5IT9 Z;  3L00 A;  4ZYG A;  1H9T A;  5BQT A;  3KLO A;  1R5G A;  4F7Z A;  1LB2 A;  4G7H F;  3QP5 A;  5BMZ A;  2HYG D;  1FYK A;  3G73 A;  5TJJ A;  2P5V A;  2W25 A;  2XAQ A;  1S3J A;  4EM2 A;  2F2E A;  4KMU X;  5L3G A;  2LNB A;  3VOE A;  3RYR A;  1W4M A;  3C3W A;  4NB5 A;  3ZN0 A;  2P7V B;  1KU7 A;  2GZW A;  1I6X A;  1KU2 A;  5FD5 A;  2LDU A;  3HTS B;  1BI3 A;  1S29 A;  1W7P A;  2YSR A;  3I4P A;  3T1B A;  1J9I A;  2K86 A;  1YTY A;  4HA8 A;  2FBK A;  5FLX Z;  1A04 A;  3CUQ C;  1K6O A;  3EYY A;  4L5I A;  3CUQ A;  3GYH X;  1SMY F;  1FYM A;  4HZF A;  4XLN F;  1W7P B;  1OMI A;  4U0W A;  2IRF G;  2P5K A;  2LF7 A;  1XMA A;  2W24 A;  2XAS A;  3QRF F;  1S8N A;  3RIR A;  3BJA A;  1QZZ A;  1SMT A;  2XAF A;  4I02 A;  1TBX A;  2ZCW A;  4S05 A;  2FA5 A;  4ENM A;  1HKS A;  4HV6 A;  5K5O A;  5CVI A;  4RB3 C;  4L5J A;  3KFW X;  4M9X A;  2PN6 A;  4ESB A;  1UB9 A;  2HGC A;  1FP1 D;  3E3V A;  4JBA A;  5DUI A;  5KVR A;  4LD5 A;  1F9N A;  2O6G E;  3EUH A;  4LJZ F;  1IAW A;  2C6Y A;  2OU2 A;  4PGG A;  4MEX F;  3PQK A;  1G3W A;  1YQA A;  3R60 A;  4FT8 A;  4LK1 F;  1B1B A;  2CW0 F;  2ELH A;  2RVC A;  3NQO A;  3I71 A;  2XAH A;  4IPA A;  1LVA A;  4M6Y A;  5D5W B;  2FU4 A;  5LEJ A;  1B6A A;  1G3S A;  5AON A;  1ZLJ A;  4L18 B;  2WTE A;  4A5N A;  4YIF A;  3E97 A;  3L2C A;  2BEO A;  1UST A;  2FSW A;  5IT9 K;  4KFC A;  2VE9 A;  2EWN A;  4TV7 A;  3KET A;  4B09 A;  1BM9 A;  5LGU A;  1KQ0 A;  1J7K A;  4U0V A;  1XN7 A;  2HQR A;  5D5X B;  4EM1 A;  4N9I A;  1T2K A;  3I64 A;  2EA2 A;  3DF8 A;  1ONV A;  1SD6 A;  2A68 F;  3KZZ A;  5CLS A;  2DW4 A;  2EB7 A;  5L3E A;  1I27 A;  1P4A A;  3WTX C;  2PI0 A;  4P9U A;  4L9N A;  3F6O A;  3Q5F A;  4IHS A;  1B4A A;  1B59 A;  2PBI A;  1H0M A;  2F5C A;  3HOT A;  4RB2 C;  1U6G A;  2K27 A;  1Z91 A;  4N9H A;  3WTZ A;  2XUB A;  4UVB A;  3ML6 A;  5BPI A;  1IXR C;  3M8F A;  4EM0 B;  2QVO A;  2V1X A;  2YU3 A;  4OU0 A;  3ELK A;  2GWR A;  1G6N A;  1FT9 A;  3WTV C;  2STW A;  4CYD A;  3RJP A;  4KA4 A;  2Z99 A;  2MLK A;  3HRT A;  1KA8 A;  4WX9 A;  5AIQ A;  3F8F A;  3F8M A;  4ON0 A;  3CDH A;  3K1M A;  5J8C A;  4D0P A;  5LRR A;  4LG0 B;  3KP4 A;  1ZRE A;  2IA0 A;  2Z33 A;  4BHC A;  1DUX C;  4IXA A;  1D8K A;  4MGR A;  3DV8 A;  4A2U A;  2A61 A;  3REO A;  4M9S A;  1O57 A;  1FSE A;  5HS9 A;  1IN4 A;  5JVT A;  3IRR A;  1J5Y A;  3BPX A;  1QQI A;  5L3C A;  1Z1D A;  4FX4 A;  3SQN A;  1TQI A;  3ABU A;  3JW4 A;  2HKO A;  2L02 A;  1R58 A;  1NHA A;  1P92 A;  3FXR A;  5LGT A;  2G9W A;  4OIR F;  1J2X A;  5DEQ A;  1ZG3 A;  4MQ9 F;  2GQQ A;  1IXC A;  2IVM A;  3GFJ A;  4LGW A;  3DXJ F;  4KMF A;  5TRD A;  3Q9S A;  4LLG F;  4RGR A;  1XGO A;  5HS7 A;  3TQN A;  2HYF A;  2V1U A;  5LRS A;  1HW2 A;  4WXC A;  1YW9 A;  1LDD A;  2QEN A;  4Q48 A;  1HBX G;  2M87 A;  4RB1 A;  4G8X A;  4UXN A;  5EEH A;  4I2O A;  2BYV E;  1UHW A;  4RAY A;  1SD4 A;  2IT0 A;  4HV5 A;  2VC1 A;  1XSD A;  2MA3 A;  1I5Z A;  1T38 A;  2ISY A;  2QM3 A;  2GAU A;  3KP6 A;  1ON2 A;  1TTY A;  3ZMD A;  2HR3 A;  3GO5 A;  1OR7 A;  5D4S A;  2K02 A;  4G6D A;  3C1D A;  4IRG A;  3LAP A;  4I0A A;  3WE2 A;  3F22 A;  4R1H A;  5H20 A;  4N0B A;  1Z6R A;  4O3M A;  2XIG A;  2VT2 A;  3I59 B;  2DQR A;  4EGZ A;  3F6V A;  1CF7 A;  2GXG A;  4BAY A;  2L3D A;  3EQL F;  2V1D A;  3HSE A;  4G9Y A;  3WGG A;  5CJ9 A;  5FD6 A;  1FLI A;  1HKT A;  5DCM B;  1SD7 A;  2PMU A;  4WK8 F;  3R0A A;  5HOO A;  2NRA C;  4PCQ A;  3J80 K;  3RKX A;  3FX3 A;  3HSF A;  1UCR A;  2DT5 A;  4ESJ A;  4WXD A;  4L9V A;  3FF5 A;  2M5W A;  4HQM A;  3VEP A;  1J59 A;  1QBJ A;  2GA2 A;  4HW0 A;  4QWQ A;  5ICF A;  4P5O A;  4OIO F;  2EFN A;  2R7F A;  3F8B A;  2XKO A;  3GW2 A;  4GXO A;  3V7S A;  4BHP A;  5E18 F;  3P7N A;  2VBX A;  2A5Y B;  2QUF A;  2JZY A;  1O7F A;  2DAO A;  1LJ9 A;  3VB2 A;  2VE8 A;  2FE3 A;  4Y15 A;  5AIP A;  4U0Y A;  2V9V A;  4IJA A;  4YFX F;  2X4H A;  2GXB A;  4A6D A;  5HDK A;  2HOE A;  4UUV A;  3IRQ A;  5DD4 A;  4I01 A;  2VBY A;  3RI4 A;  2M45 A;  1Z05 A;  4Y13 A;  2D45 A;  2XVC A;  2QBY B;  3WTW C;  2PQ8 A;  3H3U A;  2XRN A;  1ON1 A;  4I98 B;  1RI7 A;  3ABT A;  2OZ6 A;  1W7P D;  3HTU A;  2O8X A;  1PUE E;  3HRS A;  4OMZ A;  4EVI A;  2WWY A;  4U7B A;  3J7A O;  3T8R A;  4KT5 C;  4NQW A;  4Q47 A;  1SFE A;  1FPQ A;  3OOP A;  1Z7U A;  4G7Z F;  3GLX A;  2DQL A;  1ZAR A;  5ICE A;  2NYX A;  3O6B B;  4M72 A;  3TDZ C;  4KDP A;  3F23 A;  1IN7 A;  2HEO A;  1G3T A;  1U5T B;  2KIM A;  3DQV C;  3GF2 A;  4OIP F;  2D1V A;  2IP2 A;  4CDG A;  1PDN C;  2FML A;  4UV8 A;  3WTT C;  4Y17 A;  3K1N A;  3TKY A;  4QLC U;  2XRO A;  3J81 Z;  5ICC A;  1ZRD A;  1U3E M;  1JXS A;  3JAM Z;  2DLL A;  3WTY C;  1LDJ A;  3D5L A;  4MHG A;  2L4M A;  2DU9 A;  3BZ6 A;  5DDG A;  3QAH A;  2FQ3 A;  2HKX A;  4XSX F;  1T98 A;  5BPD A;  1IW7 F;  1FBS A;  3GZ5 A;  4YII A;  3SXY A;  4UVA A;  1W5T A;  3QU3 A;  4GCV A;  3COA C;  1ZG5 A;  1BI2 A;  3K9T A;  3KP2 A;  1ZGJ A;  2K4B A;  2VBW A;  4M71 A;  3WOD F;  2KJC A;  2RN7 A;  2OZU A;  4OIQ F;  3H3Z A;  2F5F A;  4Q4Z F;  3B73 A;  1RNL A;  5BOX A;  1GXQ A;  2QQ9 A;  4PDK A;  4BHB A;  2XHK A;  3KEO A;  4XLP F;  5J6X A;  5D5V B;  4UV9 A;  2A6E F;  5ERI A;  1AWC A;  2BBY A;  2HS5 A;  5J8F A;  3FZV A;  1GHC A;  3MAJ A;  1S7O A;  3WGH A;  2MLG A;  4I09 A;  3V7C A;  1BBY A;  4U88 A;  5DV5 A;  5D5U B;  3MEX A;  2OAZ A;  3H92 A;  3ROU A;  1U5T C;  4CHU A;  1C0W A;  1FX7 A;  3V8K A;  5ICG A;  4UVC A;  1D8J A;  4WXH A;  1B9M A;  3RPU A;  2UXX A;  4EJU A;  4RGS A;  3KP5 A;  2X0L A;  4AWX B;  2L54 A;  5HLI A;  1HQC A;  3BDD A;  3TO7 A;  2LF8 A;  3GX4 X;  3E6M A;  2KKO A;  1XB4 A;  2ZO4 A;  4YFN F;  4AIH A;  3V8J A;  1LEA A;  3KEQ A;  1BIA A;  2YX7 A;  1ODD A;  4E70 A;  3WTU C;  2OQG A;  5HDN A;  3GZ6 A;  3B02 A;  5L3D A;  3LQR A;  2ADU A;  1WWX A;  1DDN A;  1KGS A;  4G94 A;  1TQP A;  4GYI A;  1XSV A;  2HFH A;  5KK1 A;  4M73 A;  1XMK A;  2A69 F;  2EJR A;  2ISZ A;  2DBB A;  4MNU A;  3PQJ A;  1BJA A;  4AVP A;  2XAJ A;  4ZH4 F;  3VOD A;  2V6C A;  5FFZ A;  2PEX A;  1IRF A;  1R5H A;  2XV4 S;  1OYW A;  1XDS A;  2PJP A;  2Q8K A;  4KIG A;  1O3Q A;  3LWF A;  2AS5 F;  2EA4 A;  3IWZ A;  1ZG1 A;  4GYG A;  2PFB A;  2PG4 A;  2HQN A;  4RS8 A;  4EJO A;  3CLO A;  2E1N A;  5E20 A;  5FFX A;  1R23 A;  5HVQ C;  3BJO A;  1EH6 A;  1GVJ A;  3HOS A;  2D1H A;  5D8K B;  3FHZ A;  4O6J A;  2Y48 A;  5K5Q A;  2O0Y A;  2RV8 A;  3LST A;  2M1B A;  1Y0U A;  3KP3 A;  4OMY A;  1KQ8 A;  3K69 A;  1D3Y A;  3EET A;  2HZT A;  1IUY A;  2MH9 A;  3DKW A;  3QOP A;  2EFQ A;  1O3R A;  2TDX A;  4NHJ A;  4FHT A;  1MJ9 A;  4MQV A;  3ZMS A;  1TNS A;  1USS A;  3DEU A;  5HDG A;  3QPH A;  2FBH A;  1FOK A;  2EV5 A;  4ASN A;  1VTN C;  2VN2 A;  3FXU A;  1S7A A;  3SZP A;  1UHM A;  4WCG A;  4HLY A;  1BN5 A;  2JT1 A;  2PLY A;  5FB2 A;  3U2R A;  4B8X A;  3WU0 A;  1TW3 A;  5LGN A;  1B9N A;  2P5L C;  3TO6 A;  3M8E A;  5JHU A;  5D6E A;  4LMY A;  2MH2 A;  3I53 A;  2OA4 A;  4KIB A;  5CVU A;  3WU1 B;  3I0T A;  2XKP A;  4L9T A;  4WF2 A;  3CUO A;  3ZMZ A;  4EQQ A;  2CGP A;  3ECH A;  1O3T A;  2L4A A;  2QWW A;  4LK0 F;  5CVV A;  1FY7 A;  4KUM A;  3FMQ A;  1R1T A;  4L9J A;  2O03 A;  5L3B A;  1TLH B;  4A0Z A;  1MJA A;  1H9G A;  1U78 A;  3R4K A;  1SAX A;  2JTV A;  4ZYD A;  3J80 Z;  5F6F A;  3V7R A;  3QP6 A;  4KN4 X;  1LNW A;  5ILU A;  4R8H A;  3ISP A;  3SZT A;  2P8T A;  2QLZ A;  5ED4 A;  3IWF A;  2EFP A;  1RUN A;  4LB6 B;  4LLL A;  2F5E A;  5DCM A;  2Z9O A;  4PGH A;  1IN8 A;  1XGS A;  3KZY A;  3F8C A;  3L09 A;  1REP C;  3IHU A;  4EJW A;  2VOO A;  3E5U A;  2FOK A;  4HLX A;  1R1U A;  5D4R A;  3HUG A;  1WQ2 A;  3F8N A;  3WG9 A;  5LLQ A;  2QQA A;  3MCZ A;  1JE8 A;  4LB5 A;  1MZB A;  1P4W A;  2RDP A;  2UWM A;  1KYW A;  4GGG A;  1YW8 A;  3KLN A;  2RNJ A;  4HF1 A;  3GFL A;  3K0L A;  1STZ A;  1KU3 A;  4G6Q A;  2LKP A;  1K79 A;  3V8L A;  3TO9 A;  2ZJ2 A;  1MJB A;  5E1W A;  4BH9 A;  3E5X A;  3R6S A;  1BOA A;  1IZ1 A;  1HXD A;  2UZK A;  1EV7 A;  5JR3 A;  1YS7 A;  1G4D A;  1OKR A;  2E7W A;  4RB0 A;  2O3F A;  2YPR A;  4U7D A;  2FRH A;  4HF2 A;  4ENK A;  4HX7 A;  1MDM A;  1SD5 A;  1E17 A;  3E6B A;  1ZRC A;  1P4X A;  1G3Y A;  3FM3 A;  2OBP A;  1T0F A;  2QZ8 A;  3DP7 A;  5EEG A;  3MZY A;  2O61 A;  3GEZ A;  4L0Z B;  4HF0 A;  4P55 A;  2UXN A;  4ZYE A;  3BY6 A;  1I1G A;  1GXP A;  2L01 A;  3ZPL A;  3M9A A;  3E6D A;  1YIO A;  2HTS A;  4ETS A;  2ZNY A;  5ILV A;  3R61 A;  3CUQ B;  4L0Y B;  2CQK A;  5ILS A;  2W85 A;  5DCF A;  3HHH A;  1YS6 A;  4ENJ A;  5HS8 A;  1TW2 A;  4BXU A;  4OIN F;  1OYY A;  1BC8 C;  3NRV A;  1DP7 P;  4K2E A;  2DK5 A;  2F5D A;  1DPR A;  2BGC A;  1BI1 A;  1P6R A;  5CVR A;  4DQ2 A;  5HLH A;  3ZMV A;  3CO7 C;  1FWZ A;  2NS0 A;  2A3S A;  2JSC A;  2VOP A;  4GO1 A;  3BRO A;  3ULQ B;  3I5U A;  2Z3Y A;  3WGI A;  4DNC A;  2CWE A;  3GXO A;  1ULY A;  2W57 A;  4CO8 A;  1R00 A;  1P2F A;  2V79 A;  3CJN A;  1F4K A;  2YR2 A;  4HX8 A;  3IL2 A;  1ZHF A;  3DFG A;  1KQ9 A;  5BS6 A;  3R0J A;  2ZBK A;  2FF4 A;  1BI0 A;  5IT3 A;  5E1X A;  1FC3 A;  4AIJ A;  2ZFW A;  3BPV A;  2NNN A;  5FO5 A;  1WI9 A;  3FMS A;  3P9C A;  2H09 A;  1CGP A;  4ESF A;  2MC3 A;  1JGS A;  1XD7 A;  5LHG A;  2IJL A;  3HIF A;  4I0B A;  1SFX A;  2JPB A;  4HX4 A;  3MFK A;  1MKM A;  1IN6 A;  1RUO A;  4KYW A;  3HYI A;  5DYM A;  4ZYH A;  3RDI A;  3Q9V A;  4LFU A;  4EV0 A;  1RIO H;  4YG2 F;  3O2P E;  3BP8 A;  3KE2 A;  1XDU A;  1YLF A;  3OV8 A;  1OPC A;  2EFO A;  3T0Y A;  3AAF A;  5LHH A;  2FNA A;  2G7U A;  4IHT A;  3KP7 A;  2DI3 A;  2ZXJ A;  1FBU A;  1YO5 C;  2DPU A;  4XBF A;  5CVJ A;  5E17 F;  4P9F A;  2HDC A;  2FNP A;  1XGM A;  2KIF A;  1QNT A;  2Y75 A;  4CGZ A;  3ZP5 A;  3W6J B;  2D2W A;  1WSU A;  1FBQ A;  2FEZ A;  2ZNZ A;  1K78 B;  1TQM A;  1OYI A;  3QU6 A;  3C18 A;  3EYI A;  2VT3 A;  3SFZ A;  2FMY A;  2CO5 A;  5D8L B;  2WC2 A;  5E8G A;  3LA2 A;  5A2Q K;  3U1D A;  4A6E A;  1K78 A;  2DFI A;  4RGX A;  1CF7 B;  3TOA A;  3RYP A;  4HDV A;  3GUD A;  2NNY A;  2EV6 A;  1PP8 F;  3HSR A;  1Q1H A;  3K2Z A;  2VC0 A;  3TOB A;  2K4J A;  1T39 A;  3FM5 A;  4HYE A;  1ZN2 A;  3SHF A;  4I7H A;  1E2X A;  4IVN A;  3NEU A;  4YFK F;  3JSP A;  2CFX A;  3BOQ A;  3WTS C;  4ZZD A;  2JRT A;  2ETH A;  2KIU A;  4H0E A;  3LA3 A;  1QPM A;  2Y0M A;  2OQR A;  4M9Z A;  4EJV A;  4CZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...