1MBEA

Mouse c-myb dna-binding domain repeat 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
LGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords MYB PROTO-ONCOGENE PROTEIN
total genus 18
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbeA00
1I50J 2LD5A 1IRZA 1G2HA 4A3MJ 1LE8B 3D1NI 1UHSA 1VFCA 5FKOA 1R9TJ 4X6AJ 2NS8A 1U9OA 4A3IJ 4FCYA 2JWTA 1MBEA 1ETWA 1UG2A 2FX0A 2K9SA 4S0HB 3FKIJ 1O4XA 2EZKA 4AC0A 5F0FA 5J1UA 4XRSG 1RESA 4CYCA 1U8BA 3MVPA 1XC5A 1LFBA 2WAQN 1GV5A 1HCRA 5GPAA 4BY1J 3BR1A 1T33A 4M3EA 1VNDA 2CQXA 2NVXJ 1GT0C 2DA1A 3BG9A 1SANA 4MFDA 3Q0VA 1HOMA 1E3OC 1MBHA 1ITYA 1IV6A 3UKGA 1BW6A 5FKKA 1BW5A 2ELKA 1OCPA 2XGCA 1JUPA 3Q0WA 3SJMA 4M6VA 2X9DA 4XRMA 1X58A 5M5YJ 3JRBA 1JKRC 4IHYA 1DU6A 3JRHA 3CDLA 3CQZJ 3O8HA 2JA5J 1ZR2A 3S1MJ 2GBYA 1H89C 3A03A 1K83J 4C2MJ 1TWFJ 3BQZA 1Z77A 2Y9ZA 1IG7A 4JX5A 2DMQA 2XRLA 4QTRA 2YU9J 1ZGWA 5E3MA 5F27A 5E3NA 1JT6A 2L7ZA 1TC3C 1JKOC 2B63J 3HGGA 2DMTA 3BTIA 2YS9A 5M3MJ 1Y1WJ 3E7LA 3GTMJ 2TCTA 1GDTA 1OFCX 1BL0A 4A3GJ 3I4MJ 2LK2A 3BR2A 3K2AA 2DA6A 3GTJJ 1B8IA 2I10A 5EGOB 2EZHA 3S1QJ 1P7IA 2M8GX 4A93J 3JRIA 3IH2A 2R5ZA 2R92J 1WH5A 1NK3P 4BBSJ 1TWHJ 5EG0A 1JUSA 5C4JJ 5EZGA 1Z0XA 1B72B 1X2MA 3TP0A 4IEJA 3ZQHA 5IYDJ 1AKHB 5FLVA 2IBDA 3OSGA 3GTLJ 3A01B 1OJLA 5JLWA 4A3FJ 5F04A 2GLOA 4DW6A 3JR9A 3RKQA 3HEFA 4UUSA 5HODA 1ZR4A 3NARA 4QIWN 4M3DA 2R5YA 5IOZA 3FIWA 1YRNB 2ECBA 1BA5A 2WV1A 1FTZA 2LY9A 2M2EA 3JRCA 2NOGA 3BT9A 2XPVA 1P7JA 4BBRJ 5C4XJ 2R0QC 2ID6A 3BTJA 3BTLA 3FK7A 3I4NJ 2XB0X 2EBIA 4JYKA 1APLC 1RPWA 1ETYA 2Y31A 3MKLA 1IDZA 1JGGA 2EH3A 1RETA 2O7OA 1JTYA 3B6CA 3OSFA 3G1MA 4Y7NJ 1RKWA 2LR8A 3HKZN 4BKXA 4C3IJ 5IYCJ 2JK3A 4HNVA 3OOUA 5BNGA 3QPSA 2M34A 1IJWC 2NVYJ 2E2IJ 2VI6A 4I6ZA 1S7EA 3HOZJ 1K61A 1ZK8A 2EZLA 1U78A 2DN0A 2XB5A 3C2BA 9ANTA 2VUMJ 3GTPJ 5IPAA 1NTCA 3SDGA 2COBA 1OCTC 4A3EJ 4FE4A 1A6IA 1WI3A 2DTZA 4MFEA 3Q0UA 3HOYJ 2Y9YA 3O8GA 2E2HJ 1EF4A 5IP6A 3JRAA 1F43A 2NVQJ 2CUFA 1IGNA 1MH4A 5K7ZA 1QVTA 1HF0A 2L7FP 1MBFA 2R5ZB 3H3VK 2K9NA 4MIMA 1FIAA 1ENHA 2N8GA 3B6AA 3W6VA 1I3QJ 1FTTA 2ECCA 2M0CA 2PMZN 4L5EA 4DYQA 3RQIA 4D7NA 2P81A 1LFUP 3PO3J 3A01A 1ZTRA 2XGDA 1TWCJ 4M3FA 2CU7A 2DJNA 2MGQA 3ZQFA 2H1KA 3HM5A 5FKMA 1MBJA 1LE8A 1T56A 1ETXA 1YRNA 3BR6A 2OPTA 4G12A 5DTDA 3GTOJ 3IH4A 3CMYA 1ETQA 1QRYA 3G1OA 1PUFB 2R93J 1ETKA 4XIDA 4A3KJ 1WH7A 3GTGJ 2LLKA 5EF6A 3LSRA 2H8RA 3VPRA 4NDLA 1GV2A 4Y52J 4C3HJ 3BG3A 1RKTA 2XSDC 1JKPC 1H8AC 4AYBN 4DZJA 5M5XJ 2K9QA 1AHDP 2LVSA 4D5CA 3HOUJ 4A3CJ 1IDYA 2HI3A 3OIOA 4W1UA 2HOAA 1QVUA 2KT0A 2L9RA 1TWGJ 3K7AJ 2JJ7A 3LSJA 4UUSB 4DZPA 4IHXA 5FKLA 3JRGA 2JMWA 2R5YB 2G0EA 4C3JJ 3WHBA 4FE7A 1IUFA 2DA2A 2ME0A 3JRDA 1FIPA 3QQAA 4D5FA 4M3BA 5F0CA 1CQTA 5GPCA 4DYRA 2O8KA 1JT0A 5E3LA 1XS9A 1JKQC 1MBKA 1ZQ3P 5EDNA 1ETVA 2IEKA 4RBOA 3S16J 4CYCB 4X1EA 2E2JJ 4JP0A 5EEAA 3LOCA 2E19A 1JTXA 3NAUA 3M4OJ 3BQYA 3ZQLA 3S15J 5F08A 2VKVA 5J1RA 1MSFC 1I6HJ 5K7HA 4JX4A 5EGOA 4IHWA 1HDDC 2DA5A 1WGXA 4LOCA 2YUSA 1TWAJ 2NVTJ 3S1RJ 1ORKA 3G1LA 4JX6A 1VI0A 4EEFG 3GTQJ 3ZQCA 2FJ1A 1POGA 2HXOA 2O9LA 4ABZA 2VPRA 2Y2ZA 5F1JA 1NK2P 3S14J 2Y30A 1Q1VA 4XK4A 3CCYA 1QPIA 1A5JA 2XPWA 3Q3SA 1PUFA 3LNQA 5IP9J 1MH3A 1Y1VJ 3HGYA 3JRFA 5FLMJ 1ETOA 1WCMJ 3MN2A 4DYCA 2LFBA 2ID3A 5FJ8J 2R7ZJ 5C3EJ 1XG1A 4A3BJ 5EYRA 2E1OA 3IH3A 3PM1A 3RZDJ 2L7MP 1B8IB 2JA6J 3LSGA 1AU7A 5JLXA 4FISA 3FISA 1JUMA 2DMNA 1MNMC 4AUXA 2HDDA 2DA7A 3HOVJ 3HDDA 4W97A 2NS7A 2X48A 2LP0A 1IC8A 1W0UA 1AKHA 2EQRA 1FJLA 3DCFA 2HOTA 2ME6A 2WB1N 3TW7A 5K7FA 3LSPA 4GFBA 3BG5A 3A02A 2OF7A 1GVDA 1ZKGA 4A3JJ 1B72A 4UUTA 2JA7J 3PO2J 2XPUA 1U9NA 1MBGA 2LTPA 4B4CA 3S2HJ 3HBLA 3M3YJ 1JJ8C 2FD5A 4MLOA 3TP3A 2CUEA 1SFOJ 2DA3A 2DA4A 2D5VA 4QSHA 3HB9A 2CQQA 3DEWA 3BR0A 1D5YA 4D7MA 4B3AA 4XRSA 4V2FA 5FKNA 2IAIA 2W48A 5DS9A 5J3LA 3TEDA 3JREA 2EZIA 4I76A 5M5WJ 1H88C 5F0HA 2KDZA 4BXXJ 3S2DJ 1UMQA 3HOWJ 1FEXA 2ZB9A 2QCOA 3WHCA 2HXIA 2M9HA 1DU0A 2MG4A 1HDPA 3ZOBA 4FTHA 1VF9A 3H0GJ 2JA8J 2L0KA 4A69C 5IYBJ 3F0CA 4B1RA 1RR7A 2CRGA 4V2GA 4XICA 3ZQGA 3L1PA 2Y0SN 4A3LJ 3TW6A 1JJ6C 2GM4A 3ZQIA 5C44J 2TRTA 1MSEC 2CJJA 2DMUA 1BJZA 4BY7J 3BR3A 3S17J 5M3FJ 3HOXJ 3S1NJ 4A3DJ 5EG0B 4IHVA 2DMPA 2LKXA 2AO9A 2K40A 3IV5A 3QPLA 1F36A 5IP7J 4MO7A 3BR5A 3FK6A 4J19A 2QF7A 4M3GA 2MW8A 2VKEA 1HLVA 3RZOJ 5E3OA 1W0TA 5J1YA 1WPKA 5IOYA 1GUUA 3BTCA 2MSYA 1X2NA 2X6OA 2FQ4A 2HYJA 2JN6A 2RAEA 3SFIA 2HOSA 3GTKJ 5EZHA 4RDUA 2AHQA 3GBGA 5GP9A 2HQ5A 2XGEA
chains in the Genus database with same CATH superfamily
1I50J 4FQGA 1MJBA 2PQ8A 3AKZA 2L9VA 4BQAA 1FNNA 1G2HA 4A3MJ 3H0DA 4KMUX 1VFCA 5HOOA 1W4MA 2CW8A 2KKOA 2P4WA 2P6TA 4HBLA 2VJ4A 2NS8A 3C18A 3BCAA 4A3IJ 1MBEA 2ZXWH 1UG2A 2JRMA 4G6TB 2KHMA 4AC0A 3ZPLA 1H9GA 1RESA 2F5DA 1LNWA 5LBQA 3HTUA 1U8BA 3DBRB 3MVPA 5E17F 2RQQA 1ODDA 4AD9A 2IA1A 2P8TA 5TGTA 2KMUA 1FT9A 5GPAA 4BY1J 2L2OA 1JHFA 3S93A 1ZGJA 1U3EM 1TQIA 1GT0C 2RREA 2FU4A 2D2WA 2BY1A 3BOQA 1D1AA 1YITI 2EV5A 2HQNA 2A6EF 3M1EA 4AIHA 2HDWA 1MBHA 4ZYAA 3GYHX 4Q47A 3CCSI 5E79C 3HPGA 4GXOA 4LG0A 3GFIA 3PUBA 5FKKA 2EIKH 2MC3A 4FHTA 4CICA 1JUPA 3Q0WA 4EGYA 2W00A 4M6VA 2GIZA 5CJ9A 5M5YJ 1JKRC 1XGOA 2PFBA 4MEYF 3CQZJ 3LAJA 1B59A 3S1MJ 3F8CA 2O6GE 1TWFJ 3BQZA 1Z77A 2IA0A 2Y9ZA 3K1MA 4D1QA 4JX5A 2DMQA 3K0LA 5E3MA 5F27A 3VOEA 1XSDA 1VQ7I 4KMFA 2MC4A 1TC3C 2R7WA 3WGHA 2B63J 4ITVA 3SZTA 2QLZA 5J8FA 2HKOA 2J5OA 3M9AA 2YS9A 3C2GA 3SDBA 2AS5F 3FMQA 1XCVA 2ISZA 2PI0A 1GDTA 3K4CA 2X1EA 3HRTA 2DFHA 3FDYA 1KYWA 5GAGJ 5L3EA 5ILUA 3S1QJ 2JVGA 5EGOB 2EZHA 1P7IA 2OTJI 3DPLC 2R5ZA 3KZIC 3I55I 1WKMA 4BBSJ 1WFXA 4EJWA 5EZGA 3RIRA 2X6XA 2FQ3A 2EIJH 3EUHA 5EEGA 2L5QA 1AKHB 1HC8A 2NRAC 2LREA 2DFIA 4XLHA 1N77A 1IXRC 3KIOA 2DYSH 2A3SA 1MW7A 5HODA 2VONA 3LSMA 4QIWN 3JAMZ 3FIWA 2ECBA 2FEZA 1BIBA 3HXLA 3PFYA 3E5QA 2DODA 1MMAA 2E7XA 3ECOA 2NOGA 1VQ6I 2P0WA 2LBFB 2Q8KA 4BBRJ 3HKZA 4BS9A 1OCZH 3CD6I 4N4OB 4S05A 1A36A 4GCVA 2XB0X 2F5VA 3ML6A 3AL0C 2VQHA 4B47A 1XPXA 3K10A 3MKLA 3HUGB 1RETA 2VN2A 3B6CA 3OSFA 1RKWA 2NNYA 1BJAA 2GXAA 5HS8A 2AQFA 5DM7F 3TO9A 3ZP5A 4DQ2A 2VJJA 3RKWA 2JK3A 3F8NA 4HNVA 5BNGA 3NRVA 4BHBA 4OIRF 5E1ZB 4A0ZA 4EM0B 1LQ1A 4GDFA 3FMSA 4L18B 1UCRA 5H6QA 3QP5A 1ZK8A 3ZMVA 2MFZA 4BQNA 1U78A 4E7LA 3TL4X 1CF7B 3HTSB 3RYPA 2V1UA 1T6SA 5HS7A 3E97A 3F23A 9ANTA 1A35A 1SVOA 2M30A 5IPAA 1NTCA 2RC4A 2L9NA 1R71A 3ISPA 1OCTC 4AWXB 4M6XA 4E6KG 1WI3A 2DTZA 2IA2A 3F8MA 3MZYA 2UWMA 3O8GA 1EF4A 1HXDA 5IP6A 4XOPA 1F43A 5K5OA 1QVTA 3GEZA 3I5UA 3AFHA 1HW1A 1MBFA 4XR6A 2FOKA 5JVGF 3QAHA 3H3VK 3J7ZI 5CPRB 4MIMA 3M8EA 3PSFA 4F91B 1YLFA 1Z67A 3IAM2 2N8GA 2BOLA 3B6AA 4D0PA 2M0CA 2PMZN 2CUJA 2Y0SA 3GFJA 3RQIA 2CG4A 1LKXA 3CF5F 2XGDA 1TWCJ 4M3FA 2CU7A 2DJNA 1F5TA 2LDUA 2MGQA 3ZQFA 2RGVA 3FKJA 3HM5A 1V4RA 3TDUC 1MBJA 1LE8A 1FBSA 3WGIA 1ETXA 3BR6A 2OPTA 4UNOA 2VBXA 4G12A 3RSNA 2QSFX 5HLGA 3BLYA 2EFPA 3PUFA 3CDHA 2OZ6A 3V7CA 1YYVA 2XF5A 4B8XA 1MDMB 1FBUA 2LLKA 1XB4A 3TGNA 4NDLA 3HSRA 3FXLA 2IJLA 1WJBA 3BG3A 3H5NA 4XLNF 1T2KA 5L3BA 4ZC3A 2HVQA 1JKPC 2DLLA 3I4PA 2ZXHA 5M5XJ 4QPQA 1AHDP 3HOUJ 1LEBA 4HX4A 3EQLF 2RQPA 2W85A 1RR8C 3K4JA 2H27A 5BOXA 2L9RA 1MMNA 3KP4A 3VYTB 3KETA 4XLFA 4UUSB 4MNUA 3CC4I 1HKTA 3OYKA 2DT5A 3V8KA 2R5YB 3S8PA 2G0EA 4C3JJ 4BQQA 4FE7A 4MGRA 4ZYDA 1P2FA 3GZNB 1T98A 2GOXB 2ME0A 3JRDA 1FIPA 5IT3A 3QQAA 5IT9Z 1PYVA 5GPCA 4DYRA 3E0JB 3CCJI 1JT0A 5E3LA 4BUPA 4HYEA 1D0ZA 1FP1D 1WRJA 3BZCA 4RGUA 4E4HA 5EDNA 1TL8A 4KDPA 1BR4A 2ETHA 1TQMA 3LL7A 3ZXSA 1ZLKA 1P6RA 3QP6A 3RPQA 4G8XA 3K6GA 3ABTA 5EEAA 2IS1A 2KJBA 2E19A 3ZMDA 2FBHA 4PJLA 3PFIA 4OOIA 2WAEA 3OL3A 1S8NA 3R60A 2VKVA 1R5GA 5FO5A 5J1RA 1I6HJ 5EGOA 3AAFA 1G59A 4A12A 2ZCWA 1WGXA 1IRFA 2V6CA 2W1OA 2YUSA 1B4AA 4BE2A 1F9NA 2XROA 3ERMA 1TP4A 2K27A 1U2WA 3K2ZA 1ORKA 3GWZA 2A6HF 2CFOA 5CVUA 2NNNA 3ZQCA 2OUMA 2MD0A 3V7SA 2FJ1A 1POGA 2E71A 1LDJA 5CVVA 4ABZA 3HG9A 4ESFA 1HW2A 3S14J 1LVAA 4AIJA 1GLNA 1TT0A 2DI3A 4XK4A 4EMSA 4XKVA 1A5JA 3DLLF 2XPWA 2DQRA 3Q3SA 3QOPA 5JR3A 1O57A 5FLMJ 1A6QA 1MGTA 1R1VA 2KIUA 2X85A 3I59B 4PGGA 2CQNA 4DYCA 1V54H 5FJ8J 5IT9K 2IGKA 2LBFA 1W1WE 4HV6A 5KCMA 4NQWA 3I58A 2HNHA 2E1OA 3LSGA 5JLXA 1S29A 1I6XA 1XGNA 3JAMK 2EPFA 3HOVJ 2WBMA 2M1BA 3RTRA 4JOMA 2VXZA 1ULYA 3BJ6A 2XKPA 4ZYEA 1BIAA 3ASNH 2HQRA 1DUXC 1J9IA 4XORA 3TW7A 3WTTC 2QQAA 2ACJA 1K7AA 4A3JJ 4RLFA 1G3WA 2JA7J 1U9NA 1MBGA 2LTPA 3KPHA 4HQEA 1JHHA 4M6YA 2R7DA 4I09A 2Z5UA 3OYBA 2FD5A 3TP3A 3CCLI 2PJRB 2CUEA 2X6YA 4XKBA 2VKHA 3OYHA 1SAXA 3A2KA 4AIKA 3WG9A 1W36C 2E5NA 4XRSA 2IAIA 3K9TA 4G7ZF 5F0HA 4MTEA 3S2DJ 1EA3A 3HOWJ 2CS3A 3WHCA 1IZ1A 2M9HA 2XVCA 3VODA 1L3LA 2HVSA 1VF9A 2WA0A 4XBFA 2L0KA 4N9HA 4A69C 3F0CA 1RR7A 2LMDA 4I7HA 4MHGA 4QLCU 4OMYA 3ZQGA 4ENJA 3MAJA 3HRUA 2PMZA 2Y0SN 4R1HA 1ZG3A 4A3LJ 4PGHA 3TW6A 1Y39A 2G7HA 4CCLA 2HR3A 2R3SA 1MSEC 3J80Z 2R7SA 2DAOA 1BJZA 2BEOA 1G4DA 5J4YA 5M3FJ 4ZZLA 2VBYA 4OIPF 5EG0B 2XAFA 4U0VA 2AO9A 2OV7A 2K85A 1YW9A 5BS6A 1R00A 1W36D 5CYVA 1MIJA 2MW8A 2A5WA 2LY1A 3M8JA 3KEQA 3TO6A 1VQPI 4M9SA 5CVJA 1XMXA 1UZCA 3FXRA 4PJNA 4IPAA 2CFXA 1W0TA 2ESHA 4JK1X 1WPKA 3ABLH 2H6CA 2MSYA 4YRVA 4E7JA 3EDPA 5JHFA 2EINH 5GAHJ 3QWLA 1YO5C 1KQ0A 1W5TA 4P9FA 2Z9OA 2PJPA 2CYYA 4IHSA 1VQKI 4MEXF 2JN6A 2RAEA 3RPUD 2KRHA 1G3SA 1YX5A 2AHQA 2HTSA 3PQJA 5GP9A 3PNYA 5FRNA 4IQ4A 2LD5A 4LK1F 3ABUA 1SMYF 3FXMA 2XAHA 3CCQI 1SFKA 5FKOA 1D5VA 2JZYA 1RI7A 3OYNA 2I8DA 4I02A 3S2WA 3CUQA 3ZMTA 1MNDA 3FKIJ 2EZKA 1D1CA 3QYEA 5CVRA 4LD5A 5AIQA 2LKSA 4XRSG 4E7ZA 2OTLI 3F21A 2CWEA 1VTNC 4CYCA 1LFBA 2X0LA 3P9KA 5CQGA 5FGMA 3HYIA 3MKZA 3W2AA 4WF2A 5HNHA 4E7IA 3BPVA 2ELHA 3HRSA 1T33A 3H35A 2JUGA 3WE3A 5H6RA 3J7YJ 3CC2I 5DCFA 1RRJA 5AIPA 1HOMA 2F48A 2HOEA 3CUOA 3LA3A 3I54A 2E7WA 1IV6A 3UKGA 1BW6A 4PJMA 2CV2A 1BW5A 5D5XB 2IGNA 2MD5A 4J01A 2Q1ZB 4BXFA 3HSEA 1IN6A 1X58A 2HYFA 2NS0A 1QNTA 2PMUA 1YTYA 1X1AA 2JA5J 2MH9A 3CDLA 3O8HA 2ESNA 3NWTA 2GBYA 2MABA 3CLQA 4C2MJ 4A6DA 4BL0B 2DCEA 5GADJ 5AONA 1Z9CA 3OS1A 1O3QA 2IS6A 1T0FA 1I39A 1ZGWA 4PUSA 2HZTA 1O7LA 3H9JA 3T0YA 1JT6A 1YW8A 3H1CA 4ASNA 3JSPA 1T39A 3HGGA 5BMZA 2CV1A 2DMTA 2QQ9A 2NXNB 1EJ9A 4BNCA 4HF1A 4ENMA 3E7LA 1OCOH 2EA2A 5GTIC 2TCTA 1TZLA 2F5EA 4KISA 3ZCOA 4A3GJ 2OQGA 1IXCA 3PIOF 2XAGA 3WTXC 4O6JA 4C2UA 3BR2A 4NQWB 5TISC 4NC7A 3RI4A 3N4MA 2XDVA 2W4SA 4NBQA 2R92J 3ROUA 3E5XA 1SD5A 2R7VA 1TWHJ 4P5OA 3EYYA 3CCEI 1PP8F 1Z0XA 1R58A 3JTGA 1B72B 2MH2A 1B6AA 3EPZA 2IBDA 4H4KC 3PNVA 1DPRA 1FC3A 1ZG5A 5F04A 2GLOA 1U5TA 2DOAA 1WJEA 3HSFA 1X1CA 2LRDA 2PG4A 2OC6A 2OCCH 3M07A 3M8FA 2HYGD 4ZYGA 4RAFA 3P7NA 4DGWB 5IOZA 4ZJZA 3OIPA 3AL0B 5D4SA 2WV1A 4ENKA 1USSA 1FTZA 5HLIA 1KU9A 3JRCA 3V42A 1ZHFA 3BT9A 1K78A 3GW2A 3WU0A 4XM3A 3RDIA 4B09A 2ID6A 3BTJA 2R0QC 2MYSA 3QRFF 2DDBA 3I4NJ 4YIFA 3ABKH 4JYKA 5LRSA 1RPWA 4BYYA 1IW7F 1P4WA 4WWCA 3ZQ7A 3R4KA 2D1HA 2Y31A 3AG1H 5K5QA 3LSKA 4XSZF 1AWCA 2VC0A 2KL4A 2A69F 4GRIA 1JGGA 2O7OA 1JTYA 4Y7NJ 3BC8A 2DFEA 2KIQA 2V6EA 4A5NA 2OA4A 3CUQB 1UELB 5IYCJ 3N97A 3K1NA 4Z6YA 1VQLI 1F1ZA 2LOOA 3O3KA 2ZNZA 3OYJA 1S7EA 4G7OF 3WGGA 5LGTA 4KFCA 2F4OB 2Q2EB 2HWVA 2ZFWA 4F55A 2Z1DA 5LEKA 2H1LA 2Y75A 2VQLA 2GIVA 3CCRI 1K6OA 5ERIA 4RMNA 1IO2A 5L3GA 2K02A 3L2CA 3SDGA 4A3EJ 3QU6A 4FE4A 3W2WA 2B9SA 1NH3A 4MFEA 2DT7B 3PIPF 4RAGA 4LB6B 3RYRA 3L7WA 5HDGA 5K7ZA 3H9QA 3KP2A 4M9ZA 1FOXA 2JQ7A 2H09A 2L7FP 1D0XA 5DV5A 4PJJA 1V5EA 4Y17A 4KN4X 4HV5A 3WTYC 2JSPA 2Z3YA 4RA2A 3ULQB 2FMLA 2LKPA 4R79A 4BDZA 5TRDA 1VQ4I 2VT2A 2ADUA 1I3QJ 4RGRA 3MQ0A 1USTA 4LIUA 1QQIA 4D7NA 2P81A 1UHWA 2IW5A 4X0GA 1H9TA 2O61A 4N9IA 2VQGA 3CDIA 3DBLB 2H1KA 2V9KA 2L02A 4HSRA 5FLXK 2XV4S 3VDXA 4A6EA 5D5WB 1JGSA 1YJ9I 2CMPA 3CJTB 1X3ZB 3GTOJ 1ETQA 5J4VA 4II2A 1RIOH 3E6MA 2WAQA 3HPHA 4ZZDA 4XIDA 2RDPA 1WH7A 2CSOA 5TJJA 3P9IA 4BACA 5EF6A 2H8RA 2Y48A 3E1SA 4EJTA 3P9CA 3P5JA 1GV2A 4XL9A 4C3HJ 4DJAA 1RKTA 1MMGA 1H8AC 4AYBN 4HNTA 2X1CA 4DZJA 2BY2A 5LEJA 3DU6A 2IRFG 2LVSA 4D5CA 2JPCA 2RNGA 2HI3A 3S3OA 2HOAA 4XN0A 5E18F 2FUG2 2JPBA 1TWGJ 2V9PA 1SVMA 4P96A 2XF7A 4BJTA 4IHXA 4RLQA 5FKLA 3JRGA 1Z91A 3IC7A 4ZYHA 4AM3A 3J81K 2X4HA 1FX7A 2VE8A 3C2HA 3QODA 3GO5A 3QPTA 1ZLJA 2OU2A 2Z33A 1IUFA 1CF7A 2J5PA 3K69A 3SXYA 5LLQA 3FBIB 4D5FA 1CQTA 3A4CA 2L01A 4BAYA 5ILVA 1DPUA 2XAJA 1VQOI 1JKQC 1N25A 4L9TA 1ZYRF 4RBOA 3DPUA 4TV7A 4X1EA 2EIMH 4P9UA 3LFUA 4BH9A 2E2JJ 3LOCA 1VQNI 3J7AY 1JTXA 1B9NA 3NAUA 3ZQLA 1FMWA 4HQMA 4AVZA 4IJAA 5HLTA 3VEPA 2VQCA 2K3FA 2LC2A 1YHQI 1FLIA 1IN7A 5HDNA 2K4BA 1OLTA 1HDDC 2HVRA 1S6LA 1YJWI 3BROA 3IL2A 1YQAA 2H6BA 1FY7A 4QPOA 3V8LA 2HXOA 2O9LA 5KAIC 2W24A 4IOCF 4NNJA 2DYRH 2KLOA 5JVTA 1ZARA 2VPRA 3BCBA 5HLHA 3OIQA 1QPIA 1Q1VA 2E35A 2EB7A 3BJOA 3CCYA 1DP3A 2HDCA 1I5ZA 1ZRFA 3LNQA 1PVEA 5IP9J 3HGYA 5J47A 4OMZA 1ERDA 3RPUA 3FM3A 3UNGC 1K78B 5C3EJ 3WG7H 2M4KA 5HVQC 2HU9A 3CCMI 4ZTJA 2LNBA 3CUQC 5J6XA 3PM1A 2L7MP 4HG2A 4BDYA 2P5KA 3EUAA 3J81Z 2WTEA 1MNMC 3GF2A 1QBJA 3HJEA 4KT6A 2FBKA 3G6EI 4HRIA 1IC8A 1J7KA 3W3CA 4KITB 1W0UA 1AKHA 2E34A 4HSTA 1FJLA 2WB1N 3GX4X 2KRFA 4GFBA 3JW4A 3CESA 2CW7A 1ZKGA 1IUYA 4UUTA 1R4MB 3PO2J 2XPUA 4HZFA 1TBXA 1STZA 2WY7Q 2FF4A 3ZQQA 2P7CB 4B4CA 2LF8A 3L2WA 3HBLA 1EV7A 1OR7C 1SEUA 4MLOA 4KNYA 1XX5A 4Y13A 1SFOJ 3LQQA 5L3CA 3OYGA 4LMYA 4U0YA 2HEOA 4QSHA 2CQQA 2DJIA 2XAUA 3M1CA 5EEHA 4D7MA 1Z05A 3N05A 2W48A 4KN7X 2EV6A 3K4NA 5J3LA 1V5FA 3EUHC 3W6KB 2UZKA 2YX4A 2Q2EA 4I76A 5M5WJ 3BP8A 3VSLA 4CZCA 1UMQA 3LSTA 1FEXA 2QCOA 3QYBA 4UB8C 2IPQX 1IN5A 2HXIA 5CQEA 4H0EA 2QBYA 1E17A 1YOVB 3T8RA 2P5VA 1HDPA 4FTHA 2GWRA 1W7PB 2BW3A 4RB1A 3CO6C 2JA8J 4HX7A 1BI0A 2QVOA 4V2GA 4XICA 1HW5A 3B73A 3TOBA 5CVIA 2M7BA 4KJZA 3SZPA 1WI9A 4RGSA 4KUMA 5DCMA 2F2EA 2QSHX 2TRTA 4UVAA 4II3A 2CJJA 1KZHA 3IRQA 1Y6IA 2QZ8A 3HOXJ 4HA8A 2CW0F 2PN6A 4V19K 2A6TA 5FRMA 4IHVA 4LLNA 4AU7A 3SQNA 1N78A 2K40A 3IV5A 2VOPA 4RB2C 1R4NB 2OBPA 4IX7A 1XGMA 1D8KA 5IP7J 3K1PA 3BR5A 1Y0UA 1RC9A 3FK6A 4XLPF 2IGOA 2NOJB 4M3GA 4J19A 2BXYA 4OU0A 2BZTA 5HDKA 4ON0A 3LA2A 3ECHA 1SFEA 2VASA 3DTKA 2E60A 4UHTA 4UY8I 4I0BA 3R61A 3TKYA 2DOFA 1ZN2A 2W84A 2XRNA 1Z6TA 1WVRA 4BHPA 3ABMH 1I3AA 3KP5A 1SVLA 1M1EB 3F3XA 2FQ4A 2HYJA 3PJRA 2WV0A 2DU9A 3F6VA 5EZHA 1XDSA 1WJFA 1X1PA 4RDUA 3JSOA 2NVQJ 3CF2A 2HQ5A 4I01A 3EYIA 3D0SA 4MQ9F 4XKWA 4RS8A 4IL6C 1SFUA 1EH8A 1LE8B 5IY5H 3OYAA 3D1NI 2L7KA 4CCJA 1R9TJ 2BY3A 2K3PA 2IS2A 3I3LA 4PFPA 2PJRA 1J75A 1GHCA 1U9OA 2A61A 1SFXA 1DP7P 1U5TB 1ETWA 4S0HB 3PNTA 2UV1A 1O4XA 4WK8F 1CGPA 5F0FA 5J1UA 4BXUA 2QGUA 4E70A 1BI1A 3WTWC 1XC5A 1KQ8A 2KJCA 3BR1A 4L9NA 3BWGA 1IF1A 1VNDA 2NVXJ 3IUOA 2DA1A 5CLSA 3G2BA 2YR2A 3OV8A 4MFDA 3Q0VA 5JFRA 3FXUA 3E6DA 4YG2F 2IP2A 3OYLA 1E3OC 3B02A 1ITYA 1KYZA 1X3UA 5E8IA 4AYBA 2LF7A 3K4KA 1R7JA 1OCPA 2XGCA 5GTHC 2UUZA 4M9XA 2X9DA 3AG3H 4XRMA 3PQKA 1P9QC 1D3YA 1QGPA 3DWLE 4A2UA 3JRBA 1K79A 1ZR2A 1PP7U 4UV9A 1I1SA 3WE2A 1G3YA 3A03A 1K83J 4BQOA 1HSJA 5D8KB 3JTHA 4JBAA 1J0RA 3VYUB 1FOWA 2QENA 2XRLA 1Y56A 4PZJA 2EFWA 3F6OA 4HDUA 2QBYB 2L7ZA 1E0EA 2W57A 3BDDA 2XKOA 1UFMA 3KEYA 3BTIA 1WJ5A 1R22A 2EWNA 5M3MJ 3OYCA 1OFCX 1BL0A 3KYLA 4B44A 5ILSA 1IRXA 1TLHB 2ELJA 2Z16A 3K2AA 2DA6A 3GTJJ 1B8IA 2I10A 4BEHA 2VJIA 4A93J 3JRIA 4L5JA 4UUVA 1TW2A 1WH5A 2VKDA 2ZJQF 3DEEA 2OJED 3KLNA 4LFUA 2QA4I 2WY8Q 1PDNC 4IEJA 3ZQHA 2EJRA 1DGRM 3CMMA 1S3JA 4CUGA 1JXSA 5LFAA 2QEXI 4XNFA 2D45A 3OSGA 1J5YA 3A01B 3GTLJ 1IN4A 1V5GA 1OJLA 4RM2A 5JLWA 1X4PA 1F4KA 2NAZA 3I0TA 3HEFA 4A5MA 4UUSA 1ZR4A 4XQFA 1BR2A 3NARA 3TDZC 4M3DA 2R5YA 1YRNB 2RVCA 3K4MA 3FX3A 2JVHA 3NWSA 4EGZA 4FASD 2I5UA 4C9YA 1MJAA 2LY9A 4PK4A 4WXDA 2M2EA 2W25A 3G3ZA 4BE0A 2DO7A 2PMHA 4DIQA 6PAXA 4J00A 5D4RA 3FMRA 1E2XA 1P7JA 4KIGA 5FROA 3K4LA 4HLXA 4Q4ZF 4CCMA 3RKYA 5H2FC 2F5FA 3FK7A 5LHIA 2BW3B 2EBIA 4G6DA 1Q1HA 2V1DA 2GXBA 4HF2A 1IDZA 2FNAA 3JCUC 2EH3A 1S7OA 2EV0A 3KP6A 3SHFA 3G1MA 4BJ5C 4ESJA 4OIOF 4KICA 2LR8A 3I56I 3HKZN 3CTAA 5GAEJ 4BKXA 2VE9A 4EQQA 2R7FA 5F6FA 2HPIA 4C3IJ 4ZDPA 4PCQA 2A5YB 1ZRDA 3OOUA 3QPSA 1K4SA 2R7XA 5KAFC 1SMTA 5ICFA 5DUIA 3HOZJ 3L00A 1MMSA 1SD7A 5KK1A 2BV6A 3W2VA 2EZLA 2VXDA 1G3TA 3OS2A 4CO8A 2XB5A 5HS9A 2LYCA 3GTPJ 1OYIA 1T08B 1R1UA 1KONA 2E36A 4KT5C 1SD4A 1A6IA 1YJNI 3Q0UA 3HOYJ 3NQOA 2E2HJ 4LG0B 4CCKA 4RM3A 3CP2A 2CUFA 1IGNA 1MH4A 1YFHA 1HBXG 1NHAA 4O5VA 5H20A 4LG3A 1NG6A 2K9NA 1O7FA 3BG7A 2VJ5A 2MA3A 3BJAA 3GFLA 4YFKF 1LB2A 1FIAA 1ENHA 2E1MC 2ZMEA 2CUZA 2V4JC 2DTRA 2ECCA 4L5EA 1OQYA 3ZMZA 3S3NA 1S9HA 2LSOA 5E1WA 5LGUA 1LFUP 1D8JA 3PO3J 2QM3A 1ZRCA 1Z3XA 3WTVC 1T95A 2QKMB 3OYFA 2FNPA 1BR1A 5BPIA 1XMAA 4FETA 4CZZA 3TBIA 2K5CA 1T56A 2QWWA 1W5CC 1SAUA 3K70D 4YFNF 1WQ2A 2EK5A 1YE9A 3IH4A 3HZJA 3C3WA 3G1OA 1Z6RA 2YSRA 4OWRB 1PUFB 4NHJA 4M71A 1R6RA 3A0BC 2EFNA 1R5HA 1YW7A 3S32A 2JUCA 5HNFA 1ACIA 4IZZA 2L4MA 3ZGKA 4LLLA 4Y52J 5LGNA 4DBRA 1MNEA 1P4AA 3OYIA 1Z21A 2Z99A 3HHHA 3HOTA 4ZTFA 1REPC 3BPXA 1OKRA 2FRHA 3VWBA 4A3CJ 1R5ID 1YG2A 1IDYA 4G9YA 3CJQB 4W1UA 1QVUA 3OWTA 3S3MA 1HKQA 2KT0A 3LSJA 1FWZA 4C30A 4DZPA 2JMWA 2PBIA 3FXKA 3AG2H 5FD6A 4G94A 2QQBA 3R6SA 4XMYA 5FFZA 1MKMA 4CCOA 1D0YA 1W7PD 2DA2A 4U87A 3BY6A 4XN3A 4D9JA 2E1MB 3DLAA 1E3PA 1XS9A 3F9KA 1H0MA 1MBKA 4HW0A 2KFDA 3OYEA 1VQ9I 2QQ8A 4WCGA 4CYCB 3F8FA 2OQRA 4IOAF 3R0AA 2V7FA 4JP0A 1UHMA 1FBQA 2JTVA 2RKHA 2RNJA 2KQRA 3UR3C 3E6CC 3CCVI 1HKSA 3DV8A 3BQYA 5F08A 1EKEA 2EA4A 2RV8A 3K4BA 2BHYA 5B3SH 1MSFC 4IRGA 1B9MA 5K7HA 4Q5SF 4JX4A 1GVJA 4BEHB 4GO1A 2ZJ2A 4IHWA 1YS7A 4CCNA 4HDVA 2DA5A 2R4GA 3TQNA 4LOCA 2NVTJ 4HNUA 5DM6F 3S1RJ 1Y8RB 5DCMB 2ZJPF 2OZUA 1L0OC 3GTQJ 2GA1A 1TNSA 1YX3A 2DW4A 2CO5A 2G9WA 2M3AA 2Y2ZA 1NK2P 2KPMA 1N75A 2M5WA 4CDGA 1Y0NA 1YS6A 4OIQF 3ZMSA 2EFQA 5ED4A 3JRFA 2A07F 3ERED 3WODF 3R0JA 1WCMJ 3MN2A 3NEUA 3FM5A 4BE1A 2MBFA 2CH0A 3HL2A 2R7ZJ 1XG1A 2R7OA 5BQTA 4A3BJ 5EYRA 3VB2A 3IH3A 3RZDJ 3CLOA 1RUOA 2FOWA 2VBWA 4FISA 1UAAA 2DMNA 5A2QZ 4AUXA 4CYDA 3RKXA 2UXXA 2DA7A 2WADA 4L5IA 4FX4A 1TTYA 2HZDA 1YI2I 4W97A 2NS7A 2X48A 1OCCH 3EUKL 3BZKA 1T38A 2HOTA 4M73A 2ME6A 1XMKA 5K7FA 2CQKA 3BG5A 3A02A 2OF7A 3L2RA 4MTDA 4RGXA 1B72A 3KEOA 3COAC 1FOYA 2KZVA 3M3YJ 2PLYA 1JJ8C 1FYKA 4U0WA 4U88A 1LFPA 2P5LC 2F4IA 3U1KA 1TQPA 2JSCA 3IWFA 4Y4RA 4RAZA 4F92B 2W7NA 4PSWA 1FPQA 4KIBA 5B1BH 3DEWA 2UXNA 3BR0A 5KNLA 4CHUA 4QWQA 4B3AA 3BZ6A 4M74A 3MFKA 2Y69H 4L9VA 5KVRA 3JREA 2EZIA 2KDZA 3GFMA 4U7DA 2ZB9A 3A1YA 3GZ5A 3IKVA 4IO9F 3F22A 2GA2A 2GXGA 3H0GJ 3TOAA 4EATA 2QKLB 2VB6A 3GVAA 3F72A 4L0YB 2A05A 2ZMEB 5D5VB 4IQJA 4OINF 3MZ8A 4IF4A 2X1DA 1JJ6C 3MD2A 1KA8A 2GM4A 1J09A 4L0ZB 3CP8A 4Y15A 2DPDA 2JT1A 3E5UA 5D8LB 1QZYA 3BR3A 3ZMUA 3S17J 2L54A 1A04A 2TDXA 2V9VA 3L9FA 2OAZA 2YPRA 4I0AA 1B1BA 2HFHA 3MWMA 2MLKA 4A3DJ 2LKXA 4S04A 5JI6A 1BOBA 4MO7A 1ZGAA 1VQ5I 2VKEA 3RZOJ 2LG4A 3GMEA 1WWXA 2L3DA 3FHNA 5E3OA 2P6SA 1D1BA 5J1YA 1BC8C 5IOYA 4BHCA 4Q48A 3DF8A 1K4TA 3T1BA 4Z2YA 2K7LA 3T8TA 3G71I 1IXSB 4YELA 1QZZA 1XDUA 1X1BA 4NC6A 2HOSA 2R7TA 4N0BA 1TT5B 3GTKJ 1EH7A 3M7GA 1DQUA 1U6GA 4M3EA 2Z2SB 3GUDA 2XGEA 3C7JA 3CCUI 2IVMA 1X3WB 3EETA 3FHZA 1T8IA 1IRZA 2L4AA 4EJVA 3Q9SA 4GGGA 4WXCA 1UHSA 1P4XA 5EJCA 4A0YA 4LB5A 4X6AJ 2XF6A 1NG7A 2BY0A 3QPHA 4XOTA 4EVIA 2ZSHB 2DXIA 3L2VA 2ZBKA 4FCYA 3KYCB 1UB9A 2JWTA 5ICEA 2FX0A 2K9SA 4E7SA 1J59A 5KHDA 1VZ0A 3U9GA 3WTUC 3OR1C 1BOAA 2H94A 2OD5A 2WAQN 4IVNA 2VOOA 1GV5A 4LLGF 1HCRA 4E7KA 1C0WA 2ZJRF 2CQXA 3DU5A 5B66C 1W7PA 3FXOA 1K6YA 3BG9A 1FP2A 1SANA 2GZWA 3GZ6A 1LUJB 3RQ4A 1WZ2A 3FXJA 3H9GA 3H3ZA 4B48A 3KE2A 4F52A 2ELKA 4ESBA 2QUFA 3SJMA 2QSGX 3MCZA 2IGMA 2KIFA 3ELKA 1XN7A 4IHYA 2WAFA 4FX0A 1DU6A 3JRHA 5E20A 1KU2A 2QYOA 1H89C 1FZPB 4YIIA 1S72I 1QZEA 1FYLA 4UVBA 5E1XA 3ZRGA 2WC2A 1J2XA 2DBBA 1IG7A 5DUKA 2WB1A 4QTRA 4MQVA 3OYDA 2D1VA 2YU9J 2XGXA 2VODA 2HTJA 5LHHA 5E3NA 2JA2A 3DQVC 1JKOC 4P55A 2W82A 2KDOA 2Y0MA 2HQAA 3MMYB 4RB0A 2VLAA 5K5RA 1BI2A 2ZFUA 1Y1WJ 1ON1A 4ZDLA 3GTMJ 1FMVA 5B5EC 3I71A 1QHGA 3ONQA 3LAPA 3DEUA 2LK2A 1X1DA 2FBIA 1OISA 2ZSIB 3CJNA 1RUNA 2M8GX 4I2OA 3IH2A 2PEXA 1OR7A 1IN8A 1NK3P 4F3QA 4YFXF 5LHGA 5EG0A 1ON2A 1JUSA 2O8XA 3I53A 5C4JJ 1U5TC 4OAYA 1Z1DA 3CMAI 1X2MA 2E5ZA 4L9JA 3TP0A 1O3TA 5IYDJ 1Z7UA 1ZAOA 5ICCA 5FLVA 3WTSC 2V26A 3VSKA 4A3FJ 4WXHA 4XLEA 3KZZA 4E7HA 4DW6A 3JR9A 3ZN0A 3RKQA 1BM9A 4PSXA 2R7QA 2XHKA 3SYTA 3DFGA 1IV8A 4EM2A 2DPUA 1OMIA 4DNCA 4B43A 3IHUA 1BA5A 4RB3C 3PSIA 2BHZA 4XLCA 1R23A 3CZ6A 2HGCA 1MJ9A 1UG0A 5L3DA 1WHUA 2XPVA 1LJ9A 4IRHA 5C4XJ 1YIJI 3BTLA 1X19A 3V7RA 1Z7LA 1MZBA 2LY2A 1O3SA 2F5CA 3Q5FA 1APLC 2ISYA 4EM1A 3QOEA 1Y8QB 4EJOA 1ETYA 4R8HA 3LMMA 1R36A 3X2QH 3VYRB 2COMA 2BYVE 1BC7C 1GXPA 2L9SA 2OCEA 2DOEA 2EILH 2GQQA 3HC7A 2DK8A 3PL8A 2X6WA 2B0LA 3DP7A 4UXNA 1LEAA 3FBNB 2YU3A 2M34A 1IJWC 2NVYJ 2STTA 2E2IJ 2VI6A 4I6ZA 4DBQA 3HRMA 2VIXA 1LPQA 4PDKA 3DTEA 2R7UA 1A31A 1K61A 3H36A 3SEZA 3A0HC 4F7ZA 4JQFA 1XSVA 2DN0A 5L3FA 4DOZA 1BBYA 3AG4H 3C2BA 1U8RA 2VUMJ 2K86A 3VYSB 3ASOH 1FSEA 3MEXA 2COBA 4BJ6C 3KCCA 4NB5A 4LITA 1LVKA 5JHUA 2Q0OA 5LRRA 4LIVA 2B7EA 2Y9YA 3JRAA 2ZXJA 5F1RA 2ZXIA 4CGZA 3IRRA 1HF0A 1MMDA 1DDNA 3QYFA 3J80K 2R5ZB 1G6NA 4ETSA 2AXLA 3V4GA 1SC7A 2O03A 1KU3A 1V55H 2ZNYA 3W6VA 1FTTA 5BPDA 3IAS2 3L2QA 1XSXA 2E1CA 1DGWY 3OYMA 4DYQA 4CXFA 3DBHB 3MKYB 3A01A 1ZTRA 2DDAA 4NC8A 5F64A 3HOSA 3W6JB 2XUBA 2CGPA 4M72A 4HEA2 4PFOA 5FKMA 1E3HA 1RNLA 1XTAA 1YRNA 1HQCA 4XKCA 5DTDA 3MKWB 1OYWA 3KYDB 5J40A 3CMYA 1QRYA 4CA0A 2R93J 3LFKA 1QU3A 5DDGA 1ETKA 4A3KJ 4ANJA 3GTGJ 3FXQA 3LA7A 2FXAA 1XGSA 3ZN1A 3LSRA 4CSWA 3OL4A 3VPRA 3FWEA 3IP4B 3U21A 2XSDC 4Y3OA 3L09A 5J8CA 4P1WA 2BGCA 4LJZF 2JRTA 1P92A 3HUGA 4N4NB 2FMYA 2K9QA 2XSJC 4Y33A 1HA8A 4EJUA 3OIOA 5D5UB 4YEJA 4G7HF 3G73A 1LDKB 2FE3A 2V79A 4XRFA 3K7AJ 5FFXA 2JJ7A 1S5LC 5LD2C 3H5RA 1BI3A 2HKXA 5A2QK 4IKFA 2GOMA 2H8WA 1O3RA 3Q9VA 3WHBA 5DYMA 5ICGA 3U2RA 3I64A 4M3BA 5F0CA 2O8KA 2A68F 2KRCA 2BBYA 1QHHD 1ZQ3P 4KA4A 4IHTA 3ESWB 2NVUB 2M87A 1ETVA 2IEKA 3DTIA 3S16J 1SD6A 4G6QA 2ZO4A 4LGWA 2DK5A 1KGSA 2PX9A 3LQRA 1WSUA 4IXAA 4ENNA 2VT3A 4ZDOA 3M4OJ 3S15J 1PUEE 3GCMA 3H5AA 2CQ7A 2F6CA 4OAZA 3H92A 1GXQA 2KP6A 3IKTA 1KU7A 3MZHA 3CC7I 3SFZA 3SZGA 3T5XA 1TWAJ 3O2PE 2IT0A 1Z3YA 4FT8A 3LWFA 3WU2C 3CO7C 3KFWX 3G1LA 4RAYA 4JX6A 5FD5A 1VI0A 4EEFG 1TNTA 3VFZA 2DT6A 5CKTA 2IXSA 1WJAA 5F1JA 4HF0A 4B3XA 1VQ8I 2Y30A 4XONA 1AOYA 4LK0F 2XAQA 2STWA 3GLXA 3ZR8X 4WX9A 1PUFA 1ZREA 1IAWA 3KP7A 1MH3A 1T0FC 1EH6A 1Y1VJ 2BXZA 2MLGA 1MDMA 1ETOA 5D6FA 3DPTA 2LFBA 1QA6A 2ID3A 3OY9A 4K2EA 3U1DA 4HOBA 4I98B 1MD0A 2ZC2A 2V1NA 2HPMA 3WTZA 4AIDA 2CV0A 4KYWA 5E8GA 1B8IB 2JA6J 1AU7A 4ZH4F 4F93B 1JUMA 3FISA 3RJPA 2VL8A 1R49A 2C6YA 2HDDA 3HDDA 4I99C 1OPCA 4A0XA 2M45A 3D5LA 4HLYA 3E6BA 4HX8A 2LP0A 3GLLA 2EQRA 1QO0D 4U7BA 3DCFA 2AQEA 2M7AA 3LSPA 3QU3A 2V1XA 3I4MJ 1AA7A 1GVDA 2M8EA 3G4SI 2VPLA 3SEQA 2P7VB 1X4OA 3KZYA 3O6BB 1OCRH 2IS4A 2O5RA 3KP3A 3LSIA 3OMYA 3REOA 1FSHA 3S2HJ 2O3FA 2ICWG 2DQLA 3F8BA 1OYYA 2LH9A 4PJ0C 2DA3A 2X51A 3V8JA 2DA4A 3IWZA 2R7RA 4YIRX 2AXTC 2D5VA 3E3VA 1S7AA 1TW3A 3HB9A 1YIOA 1D5YA 2VBZA 4UV8A 4V2FA 5FKNA 3TEDA 5DS9A 1FOKA 4EV0A 1ZH5A 5DD4A 3HHGA 3TMOA 2HS5A 1H88C 3D5RC 5DD8A 4BXXJ 2BVLA 3GXOA 1FYMA 3J7AO 1UJ8A 4XLAA 4BGDA 5FLXZ 2K4JA 2O0YA 5DEQA 1DU0A 2F4MB 2MG4A 1ZG1A 3ZOBA 1U0JA 4XSXF 5B1AH 2EFOA 5IYBJ 4B1RA 2ZKZA 3K70C 2CRGA 1LDDA 1BN5A 2VC1A 3DKWA 1XD7A 4CH7A 5FB2A 4UB6C 1JI8A 3L1PA 2BVMA 1W5SA 3OOPA 1QPMA 1XCBA 4UVCA 3C1DA 3CJRB 4HPQA 4NUBA 3ZQIA 5C44J 3D5SC 3H3UA 2GAUA 1HSTA 2DMUA 3WU1B 4BY7J 4C2TA 2DFFA 1WJDA 1ONVA 1PJRA 3S1NJ 2E1NA 3BG6A 2XC7A 2DMPA 3FZVA 2BE5F 2FA5A 3I9V2 2ZMEC 2KZGA 3QPLA 2K9LA 5D6EA 1F36A 2YX7A 1VQMI 2XIGA 2QF7A 1IRGA 1WJCA 1G8XA 3I59A 3DKXA 4IRIA 2FSWA 4KIFA 1HLVA 3OR2C 3FF5A 3TO7A 2WWYA 2M0MA 2KIMA 1ZELA 3LSHA 2KISA 2G7UA 4AVPA 4GYIA 1I27A 1V3FA 1R1TA 2NYXA 2XASA 4HAMA 1GUUA 3BTCA 3DKYA 1I1GA 1JE8A 1X2NA 4O3MA 5K1YA 2X6OA 3RCOA 3L2UA 2K9MA 3OS0A 2RN7A 1RZ4A 3KLOA 3CMEI 3SFIA 3HIFA 2M4GA 3KX2A 3GBGA 4BU2A 4GYGA 1KQ9A 3DXJF
chains in the Genus database with same CATH topology
1I50J 2LD5A 1IRZA 1G2HA 4A3MJ 1LE8B 3D1NI 1UHSA 1VFCA 5FKOA 1R9TJ 4X6AJ 2NS8A 1U9OA 4A3IJ 4FCYA 2JWTA 1MBEA 1ETWA 1UG2A 2FX0A 2K9SA 4S0HB 3FKIJ 1O4XA 2EZKA 4AC0A 5F0FA 5J1UA 4XRSG 1RESA 4CYCA 1U8BA 3MVPA 1XC5A 1LFBA 2WAQN 1GV5A 1HCRA 5GPAA 4BY1J 3BR1A 1T33A 4M3EA 1VNDA 2CQXA 2NVXJ 1GT0C 2DA1A 3BG9A 1SANA 4MFDA 3Q0VA 1HOMA 1E3OC 1MBHA 1ITYA 1IV6A 3UKGA 1BW6A 5FKKA 1BW5A 2ELKA 1OCPA 2XGCA 1JUPA 3Q0WA 3SJMA 4M6VA 2X9DA 4XRMA 1X58A 5M5YJ 3JRBA 1JKRC 4IHYA 1DU6A 3JRHA 3CDLA 3CQZJ 3O8HA 2JA5J 1ZR2A 3S1MJ 2GBYA 1H89C 3A03A 1K83J 4C2MJ 1TWFJ 3BQZA 1Z77A 2Y9ZA 1IG7A 4JX5A 2DMQA 2XRLA 4QTRA 2YU9J 1ZGWA 5E3MA 5F27A 5E3NA 1JT6A 2L7ZA 1TC3C 1JKOC 2B63J 3HGGA 2DMTA 3BTIA 2YS9A 5M3MJ 1Y1WJ 3E7LA 3GTMJ 2TCTA 1GDTA 1OFCX 1BL0A 4A3GJ 3I4MJ 2LK2A 3BR2A 3K2AA 2DA6A 3GTJJ 1B8IA 2I10A 5EGOB 2EZHA 3S1QJ 1P7IA 2M8GX 4A93J 3JRIA 3IH2A 2R5ZA 2R92J 1WH5A 1NK3P 4BBSJ 1TWHJ 5EG0A 1JUSA 5C4JJ 5EZGA 1Z0XA 1B72B 1X2MA 3TP0A 4IEJA 3ZQHA 5IYDJ 1AKHB 5FLVA 2IBDA 3OSGA 3GTLJ 3A01B 1OJLA 5JLWA 4A3FJ 5F04A 2GLOA 4DW6A 3JR9A 3RKQA 3HEFA 4UUSA 5HODA 1ZR4A 3NARA 4QIWN 4M3DA 2R5YA 5IOZA 3FIWA 1YRNB 2ECBA 1BA5A 2WV1A 1FTZA 2LY9A 2M2EA 3JRCA 2NOGA 3BT9A 2XPVA 1P7JA 4BBRJ 5C4XJ 2R0QC 2ID6A 3BTJA 3BTLA 3FK7A 3I4NJ 2XB0X 2EBIA 4JYKA 1APLC 1RPWA 1ETYA 2Y31A 3MKLA 1IDZA 1JGGA 2EH3A 1RETA 2O7OA 1JTYA 3B6CA 3OSFA 3G1MA 4Y7NJ 1RKWA 2LR8A 3HKZN 4BKXA 4C3IJ 5IYCJ 2JK3A 4HNVA 3OOUA 5BNGA 3QPSA 2M34A 1IJWC 2NVYJ 2E2IJ 2VI6A 4I6ZA 1S7EA 3HOZJ 1K61A 1ZK8A 2EZLA 1U78A 2DN0A 2XB5A 3C2BA 9ANTA 2VUMJ 3GTPJ 5IPAA 1NTCA 3SDGA 2COBA 1OCTC 4A3EJ 4FE4A 1A6IA 1WI3A 2DTZA 4MFEA 3Q0UA 3HOYJ 2Y9YA 3O8GA 2E2HJ 1EF4A 5IP6A 3JRAA 1F43A 2NVQJ 2CUFA 1IGNA 1MH4A 5K7ZA 1QVTA 1HF0A 2L7FP 1MBFA 2R5ZB 3H3VK 2K9NA 4MIMA 1FIAA 1ENHA 2N8GA 3B6AA 3W6VA 1I3QJ 1FTTA 2ECCA 2M0CA 2PMZN 4L5EA 4DYQA 3RQIA 4D7NA 2P81A 1LFUP 3PO3J 3A01A 1ZTRA 2XGDA 1TWCJ 4M3FA 2CU7A 2DJNA 2MGQA 3ZQFA 2H1KA 3HM5A 5FKMA 1MBJA 1LE8A 1T56A 1ETXA 1YRNA 3BR6A 2OPTA 4G12A 5DTDA 3GTOJ 3IH4A 3CMYA 1ETQA 1QRYA 3G1OA 1PUFB 2R93J 1ETKA 4XIDA 4A3KJ 1WH7A 3GTGJ 2LLKA 5EF6A 3LSRA 2H8RA 3VPRA 4NDLA 1GV2A 4Y52J 4C3HJ 3BG3A 1RKTA 2XSDC 1JKPC 1H8AC 4AYBN 4DZJA 5M5XJ 2K9QA 1AHDP 2LVSA 4D5CA 3HOUJ 4A3CJ 1IDYA 2HI3A 3OIOA 4W1UA 2HOAA 1QVUA 2KT0A 2L9RA 1TWGJ 3K7AJ 2JJ7A 3LSJA 4UUSB 4DZPA 4IHXA 5FKLA 3JRGA 2JMWA 2R5YB 2G0EA 4C3JJ 3WHBA 4FE7A 1IUFA 2DA2A 2ME0A 3JRDA 1FIPA 3QQAA 4D5FA 4M3BA 5F0CA 1CQTA 5GPCA 4DYRA 2O8KA 1JT0A 5E3LA 1XS9A 1JKQC 1MBKA 1ZQ3P 5EDNA 1ETVA 2IEKA 4RBOA 3S16J 4CYCB 4X1EA 2E2JJ 4JP0A 5EEAA 3LOCA 2E19A 1JTXA 3NAUA 3M4OJ 3BQYA 3ZQLA 3S15J 5F08A 2VKVA 5J1RA 1MSFC 1I6HJ 5K7HA 4JX4A 5EGOA 4IHWA 1HDDC 2DA5A 1WGXA 4LOCA 2YUSA 1TWAJ 2NVTJ 3S1RJ 1ORKA 3G1LA 4JX6A 1VI0A 4EEFG 3GTQJ 3ZQCA 2FJ1A 1POGA 2HXOA 2O9LA 4ABZA 2VPRA 2Y2ZA 5F1JA 1NK2P 3S14J 2Y30A 1Q1VA 4XK4A 3CCYA 1QPIA 1A5JA 2XPWA 3Q3SA 1PUFA 3LNQA 5IP9J 1MH3A 1Y1VJ 3HGYA 3JRFA 5FLMJ 1ETOA 1WCMJ 3MN2A 4DYCA 2LFBA 2ID3A 5FJ8J 2R7ZJ 5C3EJ 1XG1A 4A3BJ 5EYRA 2E1OA 3IH3A 3PM1A 3RZDJ 2L7MP 1B8IB 2JA6J 3LSGA 1AU7A 5JLXA 4FISA 3FISA 1JUMA 2DMNA 1MNMC 4AUXA 2HDDA 2DA7A 3HOVJ 3HDDA 4W97A 2NS7A 2X48A 2LP0A 1IC8A 1W0UA 1AKHA 2EQRA 1FJLA 3DCFA 2HOTA 2ME6A 2WB1N 3TW7A 5K7FA 3LSPA 4GFBA 3BG5A 3A02A 2OF7A 1GVDA 1ZKGA 4A3JJ 1B72A 4UUTA 2JA7J 3PO2J 2XPUA 1U9NA 1MBGA 2LTPA 4B4CA 3S2HJ 3HBLA 3M3YJ 1JJ8C 2FD5A 4MLOA 3TP3A 2CUEA 1SFOJ 2DA3A 2DA4A 2D5VA 4QSHA 3HB9A 2CQQA 3DEWA 3BR0A 1D5YA 4D7MA 4B3AA 4XRSA 4V2FA 5FKNA 2IAIA 2W48A 5DS9A 5J3LA 3TEDA 3JREA 2EZIA 4I76A 5M5WJ 1H88C 5F0HA 2KDZA 4BXXJ 3S2DJ 1UMQA 3HOWJ 1FEXA 2ZB9A 2QCOA 3WHCA 2HXIA 2M9HA 1DU0A 2MG4A 1HDPA 3ZOBA 4FTHA 1VF9A 3H0GJ 2JA8J 2L0KA 4A69C 5IYBJ 3F0CA 4B1RA 1RR7A 2CRGA 4V2GA 4XICA 3ZQGA 3L1PA 2Y0SN 4A3LJ 3TW6A 1JJ6C 2GM4A 3ZQIA 5C44J 2TRTA 1MSEC 2CJJA 2DMUA 1BJZA 4BY7J 3BR3A 3S17J 5M3FJ 3HOXJ 3S1NJ 4A3DJ 5EG0B 4IHVA 2DMPA 2LKXA 2AO9A 2K40A 3IV5A 3QPLA 1F36A 5IP7J 4MO7A 3BR5A 3FK6A 4J19A 2QF7A 4M3GA 2MW8A 2VKEA 1HLVA 3RZOJ 5E3OA 1W0TA 5J1YA 1WPKA 5IOYA 1GUUA 3BTCA 2MSYA 1X2NA 2X6OA 2FQ4A 2HYJA 2JN6A 2RAEA 3SFIA 2HOSA 3GTKJ 5EZHA 4RDUA 2AHQA 3GBGA 5GP9A 2HQ5A 2XGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I50 J;  2LD5 A;  1IRZ A;  1G2H A;  4A3M J;  1LE8 B;  3D1N I;  1UHS A;  1VFC A;  5FKO A;  1R9T J;  4X6A J;  2NS8 A;  1U9O A;  4A3I J;  4FCY A;  2JWT A;  1MBE A;  1ETW A;  1UG2 A;  2FX0 A;  2K9S A;  4S0H B;  3FKI J;  1O4X A;  2EZK A;  4AC0 A;  5F0F A;  5J1U A;  4XRS G;  1RES A;  4CYC A;  1U8B A;  3MVP A;  1XC5 A;  1LFB A;  2WAQ N;  1GV5 A;  1HCR A;  5GPA A;  4BY1 J;  3BR1 A;  1T33 A;  4M3E A;  1VND A;  2CQX A;  2NVX J;  1GT0 C;  2DA1 A;  3BG9 A;  1SAN A;  4MFD A;  3Q0V A;  1HOM A;  1E3O C;  1MBH A;  1ITY A;  1IV6 A;  3UKG A;  1BW6 A;  5FKK A;  1BW5 A;  2ELK A;  1OCP A;  2XGC A;  1JUP A;  3Q0W A;  3SJM A;  4M6V A;  2X9D A;  4XRM A;  1X58 A;  5M5Y J;  3JRB A;  1JKR C;  4IHY A;  1DU6 A;  3JRH A;  3CDL A;  3CQZ J;  3O8H A;  2JA5 J;  1ZR2 A;  3S1M J;  2GBY A;  1H89 C;  3A03 A;  1K83 J;  4C2M J;  1TWF J;  3BQZ A;  1Z77 A;  2Y9Z A;  1IG7 A;  4JX5 A;  2DMQ A;  2XRL A;  4QTR A;  2YU9 J;  1ZGW A;  5E3M A;  5F27 A;  5E3N A;  1JT6 A;  2L7Z A;  1TC3 C;  1JKO C;  2B63 J;  3HGG A;  2DMT A;  3BTI A;  2YS9 A;  5M3M J;  1Y1W J;  3E7L A;  3GTM J;  2TCT A;  1GDT A;  1OFC X;  1BL0 A;  4A3G J;  3I4M J;  2LK2 A;  3BR2 A;  3K2A A;  2DA6 A;  3GTJ J;  1B8I A;  2I10 A;  5EGO B;  2EZH A;  3S1Q J;  1P7I A;  2M8G X;  4A93 J;  3JRI A;  3IH2 A;  2R5Z A;  2R92 J;  1WH5 A;  1NK3 P;  4BBS J;  1TWH J;  5EG0 A;  1JUS A;  5C4J J;  5EZG A;  1Z0X A;  1B72 B;  1X2M A;  3TP0 A;  4IEJ A;  3ZQH A;  5IYD J;  1AKH B;  5FLV A;  2IBD A;  3OSG A;  3GTL J;  3A01 B;  1OJL A;  5JLW A;  4A3F J;  5F04 A;  2GLO A;  4DW6 A;  3JR9 A;  3RKQ A;  3HEF A;  4UUS A;  5HOD A;  1ZR4 A;  3NAR A;  4QIW N;  4M3D A;  2R5Y A;  5IOZ A;  3FIW A;  1YRN B;  2ECB A;  1BA5 A;  2WV1 A;  1FTZ A;  2LY9 A;  2M2E A;  3JRC A;  2NOG A;  3BT9 A;  2XPV A;  1P7J A;  4BBR J;  5C4X J;  2R0Q C;  2ID6 A;  3BTJ A;  3BTL A;  3FK7 A;  3I4N J;  2XB0 X;  2EBI A;  4JYK A;  1APL C;  1RPW A;  1ETY A;  2Y31 A;  3MKL A;  1IDZ A;  1JGG A;  2EH3 A;  1RET A;  2O7O A;  1JTY A;  3B6C A;  3OSF A;  3G1M A;  4Y7N J;  1RKW A;  2LR8 A;  3HKZ N;  4BKX A;  4C3I J;  5IYC J;  2JK3 A;  4HNV A;  3OOU A;  5BNG A;  3QPS A;  2M34 A;  1IJW C;  2NVY J;  2E2I J;  2VI6 A;  4I6Z A;  1S7E A;  3HOZ J;  1K61 A;  1ZK8 A;  2EZL A;  1U78 A;  2DN0 A;  2XB5 A;  3C2B A;  9ANT A;  2VUM J;  3GTP J;  5IPA A;  1NTC A;  3SDG A;  2COB A;  1OCT C;  4A3E J;  4FE4 A;  1A6I A;  1WI3 A;  2DTZ A;  4MFE A;  3Q0U A;  3HOY J;  2Y9Y A;  3O8G A;  2E2H J;  1EF4 A;  5IP6 A;  3JRA A;  1F43 A;  2NVQ J;  2CUF A;  1IGN A;  1MH4 A;  5K7Z A;  1QVT A;  1HF0 A;  2L7F P;  1MBF A;  2R5Z B;  3H3V K;  2K9N A;  4MIM A;  1FIA A;  1ENH A;  2N8G A;  3B6A A;  3W6V A;  1I3Q J;  1FTT A;  2ECC A;  2M0C A;  2PMZ N;  4L5E A;  4DYQ A;  3RQI A;  4D7N A;  2P81 A;  1LFU P;  3PO3 J;  3A01 A;  1ZTR A;  2XGD A;  1TWC J;  4M3F A;  2CU7 A;  2DJN A;  2MGQ A;  3ZQF A;  2H1K A;  3HM5 A;  5FKM A;  1MBJ A;  1LE8 A;  1T56 A;  1ETX A;  1YRN A;  3BR6 A;  2OPT A;  4G12 A;  5DTD A;  3GTO J;  3IH4 A;  3CMY A;  1ETQ A;  1QRY A;  3G1O A;  1PUF B;  2R93 J;  1ETK A;  4XID A;  4A3K J;  1WH7 A;  3GTG J;  2LLK A;  5EF6 A;  3LSR A;  2H8R A;  3VPR A;  4NDL A;  1GV2 A;  4Y52 J;  4C3H J;  3BG3 A;  1RKT A;  2XSD C;  1JKP C;  1H8A C;  4AYB N;  4DZJ A;  5M5X J;  2K9Q A;  1AHD P;  2LVS A;  4D5C A;  3HOU J;  4A3C J;  1IDY A;  2HI3 A;  3OIO A;  4W1U A;  2HOA A;  1QVU A;  2KT0 A;  2L9R A;  1TWG J;  3K7A J;  2JJ7 A;  3LSJ A;  4UUS B;  4DZP A;  4IHX A;  5FKL A;  3JRG A;  2JMW A;  2R5Y B;  2G0E A;  4C3J J;  3WHB A;  4FE7 A;  1IUF A;  2DA2 A;  2ME0 A;  3JRD A;  1FIP A;  3QQA A;  4D5F A;  4M3B A;  5F0C A;  1CQT A;  5GPC A;  4DYR A;  2O8K A;  1JT0 A;  5E3L A;  1XS9 A;  1JKQ C;  1MBK A;  1ZQ3 P;  5EDN A;  1ETV A;  2IEK A;  4RBO A;  3S16 J;  4CYC B;  4X1E A;  2E2J J;  4JP0 A;  5EEA A;  3LOC A;  2E19 A;  1JTX A;  3NAU A;  3M4O J;  3BQY A;  3ZQL A;  3S15 J;  5F08 A;  2VKV A;  5J1R A;  1MSF C;  1I6H J;  5K7H A;  4JX4 A;  5EGO A;  4IHW A;  1HDD C;  2DA5 A;  1WGX A;  4LOC A;  2YUS A;  1TWA J;  2NVT J;  3S1R J;  1ORK A;  3G1L A;  4JX6 A;  1VI0 A;  4EEF G;  3GTQ J;  3ZQC A;  2FJ1 A;  1POG A;  2HXO A;  2O9L A;  4ABZ A;  2VPR A;  2Y2Z A;  5F1J A;  1NK2 P;  3S14 J;  2Y30 A;  1Q1V A;  4XK4 A;  3CCY A;  1QPI A;  1A5J A;  2XPW A;  3Q3S A;  1PUF A;  3LNQ A;  5IP9 J;  1MH3 A;  1Y1V J;  3HGY A;  3JRF A;  5FLM J;  1ETO A;  1WCM J;  3MN2 A;  4DYC A;  2LFB A;  2ID3 A;  5FJ8 J;  2R7Z J;  5C3E J;  1XG1 A;  4A3B J;  5EYR A;  2E1O A;  3IH3 A;  3PM1 A;  3RZD J;  2L7M P;  1B8I B;  2JA6 J;  3LSG A;  1AU7 A;  5JLX A;  4FIS A;  3FIS A;  1JUM A;  2DMN A;  1MNM C;  4AUX A;  2HDD A;  2DA7 A;  3HOV J;  3HDD A;  4W97 A;  2NS7 A;  2X48 A;  2LP0 A;  1IC8 A;  1W0U A;  1AKH A;  2EQR A;  1FJL A;  3DCF A;  2HOT A;  2ME6 A;  2WB1 N;  3TW7 A;  5K7F A;  3LSP A;  4GFB A;  3BG5 A;  3A02 A;  2OF7 A;  1GVD A;  1ZKG A;  4A3J J;  1B72 A;  4UUT A;  2JA7 J;  3PO2 J;  2XPU A;  1U9N A;  1MBG A;  2LTP A;  4B4C A;  3S2H J;  3HBL A;  3M3Y J;  1JJ8 C;  2FD5 A;  4MLO A;  3TP3 A;  2CUE A;  1SFO J;  2DA3 A;  2DA4 A;  2D5V A;  4QSH A;  3HB9 A;  2CQQ A;  3DEW A;  3BR0 A;  1D5Y A;  4D7M A;  4B3A A;  4XRS A;  4V2F A;  5FKN A;  2IAI A;  2W48 A;  5DS9 A;  5J3L A;  3TED A;  3JRE A;  2EZI A;  4I76 A;  5M5W J;  1H88 C;  5F0H A;  2KDZ A;  4BXX J;  3S2D J;  1UMQ A;  3HOW J;  1FEX A;  2ZB9 A;  2QCO A;  3WHC A;  2HXI A;  2M9H A;  1DU0 A;  2MG4 A;  1HDP A;  3ZOB A;  4FTH A;  1VF9 A;  3H0G J;  2JA8 J;  2L0K A;  4A69 C;  5IYB J;  3F0C A;  4B1R A;  1RR7 A;  2CRG A;  4V2G A;  4XIC A;  3ZQG A;  3L1P A;  2Y0S N;  4A3L J;  3TW6 A;  1JJ6 C;  2GM4 A;  3ZQI A;  5C44 J;  2TRT A;  1MSE C;  2CJJ A;  2DMU A;  1BJZ A;  4BY7 J;  3BR3 A;  3S17 J;  5M3F J;  3HOX J;  3S1N J;  4A3D J;  5EG0 B;  4IHV A;  2DMP A;  2LKX A;  2AO9 A;  2K40 A;  3IV5 A;  3QPL A;  1F36 A;  5IP7 J;  4MO7 A;  3BR5 A;  3FK6 A;  4J19 A;  2QF7 A;  4M3G A;  2MW8 A;  2VKE A;  1HLV A;  3RZO J;  5E3O A;  1W0T A;  5J1Y A;  1WPK A;  5IOY A;  1GUU A;  3BTC A;  2MSY A;  1X2N A;  2X6O A;  2FQ4 A;  2HYJ A;  2JN6 A;  2RAE A;  3SFI A;  2HOS A;  3GTK J;  5EZH A;  4RDU A;  2AHQ A;  3GBG A;  5GP9 A;  2HQ5 A;  2XGE A; 
#chains in the Genus database with same CATH topology
 1I50 J;  4FQG A;  1MJB A;  2PQ8 A;  3AKZ A;  2L9V A;  4BQA A;  1FNN A;  1G2H A;  4A3M J;  3H0D A;  4KMU X;  1VFC A;  5HOO A;  1W4M A;  2CW8 A;  2KKO A;  2P4W A;  2P6T A;  4HBL A;  2VJ4 A;  2NS8 A;  3C18 A;  3BCA A;  4A3I J;  1MBE A;  2ZXW H;  1UG2 A;  2JRM A;  4G6T B;  2KHM A;  4AC0 A;  3ZPL A;  1H9G A;  1RES A;  2F5D A;  1LNW A;  5LBQ A;  3HTU A;  1U8B A;  3DBR B;  3MVP A;  5E17 F;  2RQQ A;  1ODD A;  4AD9 A;  2IA1 A;  2P8T A;  5TGT A;  2KMU A;  1FT9 A;  5GPA A;  4BY1 J;  2L2O A;  1JHF A;  3S93 A;  1ZGJ A;  1U3E M;  1TQI A;  1GT0 C;  2RRE A;  2FU4 A;  2D2W A;  2BY1 A;  3BOQ A;  1D1A A;  1YIT I;  2EV5 A;  2HQN A;  2A6E F;  3M1E A;  4AIH A;  2HDW A;  1MBH A;  4ZYA A;  3GYH X;  4Q47 A;  3CCS I;  5E79 C;  3HPG A;  4GXO A;  4LG0 A;  3GFI A;  3PUB A;  5FKK A;  2EIK H;  2MC3 A;  4FHT A;  4CIC A;  1JUP A;  3Q0W A;  4EGY A;  2W00 A;  4M6V A;  2GIZ A;  5CJ9 A;  5M5Y J;  1JKR C;  1XGO A;  2PFB A;  4MEY F;  3CQZ J;  3LAJ A;  1B59 A;  3S1M J;  3F8C A;  2O6G E;  1TWF J;  3BQZ A;  1Z77 A;  2IA0 A;  2Y9Z A;  3K1M A;  4D1Q A;  4JX5 A;  2DMQ A;  3K0L A;  5E3M A;  5F27 A;  3VOE A;  1XSD A;  1VQ7 I;  4KMF A;  2MC4 A;  1TC3 C;  2R7W A;  3WGH A;  2B63 J;  4ITV A;  3SZT A;  2QLZ A;  5J8F A;  2HKO A;  2J5O A;  3M9A A;  2YS9 A;  3C2G A;  3SDB A;  2AS5 F;  3FMQ A;  1XCV A;  2ISZ A;  2PI0 A;  1GDT A;  3K4C A;  2X1E A;  3HRT A;  2DFH A;  3FDY A;  1KYW A;  5GAG J;  5L3E A;  5ILU A;  3S1Q J;  2JVG A;  5EGO B;  2EZH A;  1P7I A;  2OTJ I;  3DPL C;  2R5Z A;  3KZI C;  3I55 I;  1WKM A;  4BBS J;  1WFX A;  4EJW A;  5EZG A;  3RIR A;  2X6X A;  2FQ3 A;  2EIJ H;  3EUH A;  5EEG A;  2L5Q A;  1AKH B;  1HC8 A;  2NRA C;  2LRE A;  2DFI A;  4XLH A;  1N77 A;  1IXR C;  3KIO A;  2DYS H;  2A3S A;  1MW7 A;  5HOD A;  2VON A;  3LSM A;  4QIW N;  3JAM Z;  3FIW A;  2ECB A;  2FEZ A;  1BIB A;  3HXL A;  3PFY A;  3E5Q A;  2DOD A;  1MMA A;  2E7X A;  3ECO A;  2NOG A;  1VQ6 I;  2P0W A;  2LBF B;  2Q8K A;  4BBR J;  3HKZ A;  4BS9 A;  1OCZ H;  3CD6 I;  4N4O B;  4S05 A;  1A36 A;  4GCV A;  2XB0 X;  2F5V A;  3ML6 A;  3AL0 C;  2VQH A;  4B47 A;  1XPX A;  3K10 A;  3MKL A;  3HUG B;  1RET A;  2VN2 A;  3B6C A;  3OSF A;  1RKW A;  2NNY A;  1BJA A;  2GXA A;  5HS8 A;  2AQF A;  5DM7 F;  3TO9 A;  3ZP5 A;  4DQ2 A;  2VJJ A;  3RKW A;  2JK3 A;  3F8N A;  4HNV A;  5BNG A;  3NRV A;  4BHB A;  4OIR F;  5E1Z B;  4A0Z A;  4EM0 B;  1LQ1 A;  4GDF A;  3FMS A;  4L18 B;  1UCR A;  5H6Q A;  3QP5 A;  1ZK8 A;  3ZMV A;  2MFZ A;  4BQN A;  1U78 A;  4E7L A;  3TL4 X;  1CF7 B;  3HTS B;  3RYP A;  2V1U A;  1T6S A;  5HS7 A;  3E97 A;  3F23 A;  9ANT A;  1A35 A;  1SVO A;  2M30 A;  5IPA A;  1NTC A;  2RC4 A;  2L9N A;  1R71 A;  3ISP A;  1OCT C;  4AWX B;  4M6X A;  4E6K G;  1WI3 A;  2DTZ A;  2IA2 A;  3F8M A;  3MZY A;  2UWM A;  3O8G A;  1EF4 A;  1HXD A;  5IP6 A;  4XOP A;  1F43 A;  5K5O A;  1QVT A;  3GEZ A;  3I5U A;  3AFH A;  1HW1 A;  1MBF A;  4XR6 A;  2FOK A;  5JVG F;  3QAH A;  3H3V K;  3J7Z I;  5CPR B;  4MIM A;  3M8E A;  3PSF A;  4F91 B;  1YLF A;  1Z67 A;  3IAM 2;  2N8G A;  2BOL A;  3B6A A;  4D0P A;  2M0C A;  2PMZ N;  2CUJ A;  2Y0S A;  3GFJ A;  3RQI A;  2CG4 A;  1LKX A;  3CF5 F;  2XGD A;  1TWC J;  4M3F A;  2CU7 A;  2DJN A;  1F5T A;  2LDU A;  2MGQ A;  3ZQF A;  2RGV A;  3FKJ A;  3HM5 A;  1V4R A;  3TDU C;  1MBJ A;  1LE8 A;  1FBS A;  3WGI A;  1ETX A;  3BR6 A;  2OPT A;  4UNO A;  2VBX A;  4G12 A;  3RSN A;  2QSF X;  5HLG A;  3BLY A;  2EFP A;  3PUF A;  3CDH A;  2OZ6 A;  3V7C A;  1YYV A;  2XF5 A;  4B8X A;  1MDM B;  1FBU A;  2LLK A;  1XB4 A;  3TGN A;  4NDL A;  3HSR A;  3FXL A;  2IJL A;  1WJB A;  3BG3 A;  3H5N A;  4XLN F;  1T2K A;  5L3B A;  4ZC3 A;  2HVQ A;  1JKP C;  2DLL A;  3I4P A;  2ZXH A;  5M5X J;  4QPQ A;  1AHD P;  3HOU J;  1LEB A;  4HX4 A;  3EQL F;  2RQP A;  2W85 A;  1RR8 C;  3K4J A;  2H27 A;  5BOX A;  2L9R A;  1MMN A;  3KP4 A;  3VYT B;  3KET A;  4XLF A;  4UUS B;  4MNU A;  3CC4 I;  1HKT A;  3OYK A;  2DT5 A;  3V8K A;  2R5Y B;  3S8P A;  2G0E A;  4C3J J;  4BQQ A;  4FE7 A;  4MGR A;  4ZYD A;  1P2F A;  3GZN B;  1T98 A;  2GOX B;  2ME0 A;  3JRD A;  1FIP A;  5IT3 A;  3QQA A;  5IT9 Z;  1PYV A;  5GPC A;  4DYR A;  3E0J B;  3CCJ I;  1JT0 A;  5E3L A;  4BUP A;  4HYE A;  1D0Z A;  1FP1 D;  1WRJ A;  3BZC A;  4RGU A;  4E4H A;  5EDN A;  1TL8 A;  4KDP A;  1BR4 A;  2ETH A;  1TQM A;  3LL7 A;  3ZXS A;  1ZLK A;  1P6R A;  3QP6 A;  3RPQ A;  4G8X A;  3K6G A;  3ABT A;  5EEA A;  2IS1 A;  2KJB A;  2E19 A;  3ZMD A;  2FBH A;  4PJL A;  3PFI A;  4OOI A;  2WAE A;  3OL3 A;  1S8N A;  3R60 A;  2VKV A;  1R5G A;  5FO5 A;  5J1R A;  1I6H J;  5EGO A;  3AAF A;  1G59 A;  4A12 A;  2ZCW A;  1WGX A;  1IRF A;  2V6C A;  2W1O A;  2YUS A;  1B4A A;  4BE2 A;  1F9N A;  2XRO A;  3ERM A;  1TP4 A;  2K27 A;  1U2W A;  3K2Z A;  1ORK A;  3GWZ A;  2A6H F;  2CFO A;  5CVU A;  2NNN A;  3ZQC A;  2OUM A;  2MD0 A;  3V7S A;  2FJ1 A;  1POG A;  2E71 A;  1LDJ A;  5CVV A;  4ABZ A;  3HG9 A;  4ESF A;  1HW2 A;  3S14 J;  1LVA A;  4AIJ A;  1GLN A;  1TT0 A;  2DI3 A;  4XK4 A;  4EMS A;  4XKV A;  1A5J A;  3DLL F;  2XPW A;  2DQR A;  3Q3S A;  3QOP A;  5JR3 A;  1O57 A;  5FLM J;  1A6Q A;  1MGT A;  1R1V A;  2KIU A;  2X85 A;  3I59 B;  4PGG A;  2CQN A;  4DYC A;  1V54 H;  5FJ8 J;  5IT9 K;  2IGK A;  2LBF A;  1W1W E;  4HV6 A;  5KCM A;  4NQW A;  3I58 A;  2HNH A;  2E1O A;  3LSG A;  5JLX A;  1S29 A;  1I6X A;  1XGN A;  3JAM K;  2EPF A;  3HOV J;  2WBM A;  2M1B A;  3RTR A;  4JOM A;  2VXZ A;  1ULY A;  3BJ6 A;  2XKP A;  4ZYE A;  1BIA A;  3ASN H;  2HQR A;  1DUX C;  1J9I A;  4XOR A;  3TW7 A;  3WTT C;  2QQA A;  2ACJ A;  1K7A A;  4A3J J;  4RLF A;  1G3W A;  2JA7 J;  1U9N A;  1MBG A;  2LTP A;  3KPH A;  4HQE A;  1JHH A;  4M6Y A;  2R7D A;  4I09 A;  2Z5U A;  3OYB A;  2FD5 A;  3TP3 A;  3CCL I;  2PJR B;  2CUE A;  2X6Y A;  4XKB A;  2VKH A;  3OYH A;  1SAX A;  3A2K A;  4AIK A;  3WG9 A;  1W36 C;  2E5N A;  4XRS A;  2IAI A;  3K9T A;  4G7Z F;  5F0H A;  4MTE A;  3S2D J;  1EA3 A;  3HOW J;  2CS3 A;  3WHC A;  1IZ1 A;  2M9H A;  2XVC A;  3VOD A;  1L3L A;  2HVS A;  1VF9 A;  2WA0 A;  4XBF A;  2L0K A;  4N9H A;  4A69 C;  3F0C A;  1RR7 A;  2LMD A;  4I7H A;  4MHG A;  4QLC U;  4OMY A;  3ZQG A;  4ENJ A;  3MAJ A;  3HRU A;  2PMZ A;  2Y0S N;  4R1H A;  1ZG3 A;  4A3L J;  4PGH A;  3TW6 A;  1Y39 A;  2G7H A;  4CCL A;  2HR3 A;  2R3S A;  1MSE C;  3J80 Z;  2R7S A;  2DAO A;  1BJZ A;  2BEO A;  1G4D A;  5J4Y A;  5M3F J;  4ZZL A;  2VBY A;  4OIP F;  5EG0 B;  2XAF A;  4U0V A;  2AO9 A;  2OV7 A;  2K85 A;  1YW9 A;  5BS6 A;  1R00 A;  1W36 D;  5CYV A;  1MIJ A;  2MW8 A;  2A5W A;  2LY1 A;  3M8J A;  3KEQ A;  3TO6 A;  1VQP I;  4M9S A;  5CVJ A;  1XMX A;  1UZC A;  3FXR A;  4PJN A;  4IPA A;  2CFX A;  1W0T A;  2ESH A;  4JK1 X;  1WPK A;  3ABL H;  2H6C A;  2MSY A;  4YRV A;  4E7J A;  3EDP A;  5JHF A;  2EIN H;  5GAH J;  3QWL A;  1YO5 C;  1KQ0 A;  1W5T A;  4P9F A;  2Z9O A;  2PJP A;  2CYY A;  4IHS A;  1VQK I;  4MEX F;  2JN6 A;  2RAE A;  3RPU D;  2KRH A;  1G3S A;  1YX5 A;  2AHQ A;  2HTS A;  3PQJ A;  5GP9 A;  3PNY A;  5FRN A;  4IQ4 A;  2LD5 A;  4LK1 F;  3ABU A;  1SMY F;  3FXM A;  2XAH A;  3CCQ I;  1SFK A;  5FKO A;  1D5V A;  2JZY A;  1RI7 A;  3OYN A;  2I8D A;  4I02 A;  3S2W A;  3CUQ A;  3ZMT A;  1MND A;  3FKI J;  2EZK A;  1D1C A;  3QYE A;  5CVR A;  4LD5 A;  5AIQ A;  2LKS A;  4XRS G;  4E7Z A;  2OTL I;  3F21 A;  2CWE A;  1VTN C;  4CYC A;  1LFB A;  2X0L A;  3P9K A;  5CQG A;  5FGM A;  3HYI A;  3MKZ A;  3W2A A;  4WF2 A;  5HNH A;  4E7I A;  3BPV A;  2ELH A;  3HRS A;  1T33 A;  3H35 A;  2JUG A;  3WE3 A;  5H6R A;  3J7Y J;  3CC2 I;  5DCF A;  1RRJ A;  5AIP A;  1HOM A;  2F48 A;  2HOE A;  3CUO A;  3LA3 A;  3I54 A;  2E7W A;  1IV6 A;  3UKG A;  1BW6 A;  4PJM A;  2CV2 A;  1BW5 A;  5D5X B;  2IGN A;  2MD5 A;  4J01 A;  2Q1Z B;  4BXF A;  3HSE A;  1IN6 A;  1X58 A;  2HYF A;  2NS0 A;  1QNT A;  2PMU A;  1YTY A;  1X1A A;  2JA5 J;  2MH9 A;  3CDL A;  3O8H A;  2ESN A;  3NWT A;  2GBY A;  2MAB A;  3CLQ A;  4C2M J;  4A6D A;  4BL0 B;  2DCE A;  5GAD J;  5AON A;  1Z9C A;  3OS1 A;  1O3Q A;  2IS6 A;  1T0F A;  1I39 A;  1ZGW A;  4PUS A;  2HZT A;  1O7L A;  3H9J A;  3T0Y A;  1JT6 A;  1YW8 A;  3H1C A;  4ASN A;  3JSP A;  1T39 A;  3HGG A;  5BMZ A;  2CV1 A;  2DMT A;  2QQ9 A;  2NXN B;  1EJ9 A;  4BNC A;  4HF1 A;  4ENM A;  3E7L A;  1OCO H;  2EA2 A;  5GTI C;  2TCT A;  1TZL A;  2F5E A;  4KIS A;  3ZCO A;  4A3G J;  2OQG A;  1IXC A;  3PIO F;  2XAG A;  3WTX C;  4O6J A;  4C2U A;  3BR2 A;  4NQW B;  5TIS C;  4NC7 A;  3RI4 A;  3N4M A;  2XDV A;  2W4S A;  4NBQ A;  2R92 J;  3ROU A;  3E5X A;  1SD5 A;  2R7V A;  1TWH J;  4P5O A;  3EYY A;  3CCE I;  1PP8 F;  1Z0X A;  1R58 A;  3JTG A;  1B72 B;  2MH2 A;  1B6A A;  3EPZ A;  2IBD A;  4H4K C;  3PNV A;  1DPR A;  1FC3 A;  1ZG5 A;  5F04 A;  2GLO A;  1U5T A;  2DOA A;  1WJE A;  3HSF A;  1X1C A;  2LRD A;  2PG4 A;  2OC6 A;  2OCC H;  3M07 A;  3M8F A;  2HYG D;  4ZYG A;  4RAF A;  3P7N A;  4DGW B;  5IOZ A;  4ZJZ A;  3OIP A;  3AL0 B;  5D4S A;  2WV1 A;  4ENK A;  1USS A;  1FTZ A;  5HLI A;  1KU9 A;  3JRC A;  3V42 A;  1ZHF A;  3BT9 A;  1K78 A;  3GW2 A;  3WU0 A;  4XM3 A;  3RDI A;  4B09 A;  2ID6 A;  3BTJ A;  2R0Q C;  2MYS A;  3QRF F;  2DDB A;  3I4N J;  4YIF A;  3ABK H;  4JYK A;  5LRS A;  1RPW A;  4BYY A;  1IW7 F;  1P4W A;  4WWC A;  3ZQ7 A;  3R4K A;  2D1H A;  2Y31 A;  3AG1 H;  5K5Q A;  3LSK A;  4XSZ F;  1AWC A;  2VC0 A;  2KL4 A;  2A69 F;  4GRI A;  1JGG A;  2O7O A;  1JTY A;  4Y7N J;  3BC8 A;  2DFE A;  2KIQ A;  2V6E A;  4A5N A;  2OA4 A;  3CUQ B;  1UEL B;  5IYC J;  3N97 A;  3K1N A;  4Z6Y A;  1VQL I;  1F1Z A;  2LOO A;  3O3K A;  2ZNZ A;  3OYJ A;  1S7E A;  4G7O F;  3WGG A;  5LGT A;  4KFC A;  2F4O B;  2Q2E B;  2HWV A;  2ZFW A;  4F55 A;  2Z1D A;  5LEK A;  2H1L A;  2Y75 A;  2VQL A;  2GIV A;  3CCR I;  1K6O A;  5ERI A;  4RMN A;  1IO2 A;  5L3G A;  2K02 A;  3L2C A;  3SDG A;  4A3E J;  3QU6 A;  4FE4 A;  3W2W A;  2B9S A;  1NH3 A;  4MFE A;  2DT7 B;  3PIP F;  4RAG A;  4LB6 B;  3RYR A;  3L7W A;  5HDG A;  5K7Z A;  3H9Q A;  3KP2 A;  4M9Z A;  1FOX A;  2JQ7 A;  2H09 A;  2L7F P;  1D0X A;  5DV5 A;  4PJJ A;  1V5E A;  4Y17 A;  4KN4 X;  4HV5 A;  3WTY C;  2JSP A;  2Z3Y A;  4RA2 A;  3ULQ B;  2FML A;  2LKP A;  4R79 A;  4BDZ A;  5TRD A;  1VQ4 I;  2VT2 A;  2ADU A;  1I3Q J;  4RGR A;  3MQ0 A;  1UST A;  4LIU A;  1QQI A;  4D7N A;  2P81 A;  1UHW A;  2IW5 A;  4X0G A;  1H9T A;  2O61 A;  4N9I A;  2VQG A;  3CDI A;  3DBL B;  2H1K A;  2V9K A;  2L02 A;  4HSR A;  5FLX K;  2XV4 S;  3VDX A;  4A6E A;  5D5W B;  1JGS A;  1YJ9 I;  2CMP A;  3CJT B;  1X3Z B;  3GTO J;  1ETQ A;  5J4V A;  4II2 A;  1RIO H;  3E6M A;  2WAQ A;  3HPH A;  4ZZD A;  4XID A;  2RDP A;  1WH7 A;  2CSO A;  5TJJ A;  3P9I A;  4BAC A;  5EF6 A;  2H8R A;  2Y48 A;  3E1S A;  4EJT A;  3P9C A;  3P5J A;  1GV2 A;  4XL9 A;  4C3H J;  4DJA A;  1RKT A;  1MMG A;  1H8A C;  4AYB N;  4HNT A;  2X1C A;  4DZJ A;  2BY2 A;  5LEJ A;  3DU6 A;  2IRF G;  2LVS A;  4D5C A;  2JPC A;  2RNG A;  2HI3 A;  3S3O A;  2HOA A;  4XN0 A;  5E18 F;  2FUG 2;  2JPB A;  1TWG J;  2V9P A;  1SVM A;  4P96 A;  2XF7 A;  4BJT A;  4IHX A;  4RLQ A;  5FKL A;  3JRG A;  1Z91 A;  3IC7 A;  4ZYH A;  4AM3 A;  3J81 K;  2X4H A;  1FX7 A;  2VE8 A;  3C2H A;  3QOD A;  3GO5 A;  3QPT A;  1ZLJ A;  2OU2 A;  2Z33 A;  1IUF A;  1CF7 A;  2J5P A;  3K69 A;  3SXY A;  5LLQ A;  3FBI B;  4D5F A;  1CQT A;  3A4C A;  2L01 A;  4BAY A;  5ILV A;  1DPU A;  2XAJ A;  1VQO I;  1JKQ C;  1N25 A;  4L9T A;  1ZYR F;  4RBO A;  3DPU A;  4TV7 A;  4X1E A;  2EIM H;  4P9U A;  3LFU A;  4BH9 A;  2E2J J;  3LOC A;  1VQN I;  3J7A Y;  1JTX A;  1B9N A;  3NAU A;  3ZQL A;  1FMW A;  4HQM A;  4AVZ A;  4IJA A;  5HLT A;  3VEP A;  2VQC A;  2K3F A;  2LC2 A;  1YHQ I;  1FLI A;  1IN7 A;  5HDN A;  2K4B A;  1OLT A;  1HDD C;  2HVR A;  1S6L A;  1YJW I;  3BRO A;  3IL2 A;  1YQA A;  2H6B A;  1FY7 A;  4QPO A;  3V8L A;  2HXO A;  2O9L A;  5KAI C;  2W24 A;  4IOC F;  4NNJ A;  2DYR H;  2KLO A;  5JVT A;  1ZAR A;  2VPR A;  3BCB A;  5HLH A;  3OIQ A;  1QPI A;  1Q1V A;  2E35 A;  2EB7 A;  3BJO A;  3CCY A;  1DP3 A;  2HDC A;  1I5Z A;  1ZRF A;  3LNQ A;  1PVE A;  5IP9 J;  3HGY A;  5J47 A;  4OMZ A;  1ERD A;  3RPU A;  3FM3 A;  3UNG C;  1K78 B;  5C3E J;  3WG7 H;  2M4K A;  5HVQ C;  2HU9 A;  3CCM I;  4ZTJ A;  2LNB A;  3CUQ C;  5J6X A;  3PM1 A;  2L7M P;  4HG2 A;  4BDY A;  2P5K A;  3EUA A;  3J81 Z;  2WTE A;  1MNM C;  3GF2 A;  1QBJ A;  3HJE A;  4KT6 A;  2FBK A;  3G6E I;  4HRI A;  1IC8 A;  1J7K A;  3W3C A;  4KIT B;  1W0U A;  1AKH A;  2E34 A;  4HST A;  1FJL A;  2WB1 N;  3GX4 X;  2KRF A;  4GFB A;  3JW4 A;  3CES A;  2CW7 A;  1ZKG A;  1IUY A;  4UUT A;  1R4M B;  3PO2 J;  2XPU A;  4HZF A;  1TBX A;  1STZ A;  2WY7 Q;  2FF4 A;  3ZQQ A;  2P7C B;  4B4C A;  2LF8 A;  3L2W A;  3HBL A;  1EV7 A;  1OR7 C;  1SEU A;  4MLO A;  4KNY A;  1XX5 A;  4Y13 A;  1SFO J;  3LQQ A;  5L3C A;  3OYG A;  4LMY A;  4U0Y A;  2HEO A;  4QSH A;  2CQQ A;  2DJI A;  2XAU A;  3M1C A;  5EEH A;  4D7M A;  1Z05 A;  3N05 A;  2W48 A;  4KN7 X;  2EV6 A;  3K4N A;  5J3L A;  1V5F A;  3EUH C;  3W6K B;  2UZK A;  2YX4 A;  2Q2E A;  4I76 A;  5M5W J;  3BP8 A;  3VSL A;  4CZC A;  1UMQ A;  3LST A;  1FEX A;  2QCO A;  3QYB A;  4UB8 C;  2IPQ X;  1IN5 A;  2HXI A;  5CQE A;  4H0E A;  2QBY A;  1E17 A;  1YOV B;  3T8R A;  2P5V A;  1HDP A;  4FTH A;  2GWR A;  1W7P B;  2BW3 A;  4RB1 A;  3CO6 C;  2JA8 J;  4HX7 A;  1BI0 A;  2QVO A;  4V2G A;  4XIC A;  1HW5 A;  3B73 A;  3TOB A;  5CVI A;  2M7B A;  4KJZ A;  3SZP A;  1WI9 A;  4RGS A;  4KUM A;  5DCM A;  2F2E A;  2QSH X;  2TRT A;  4UVA A;  4II3 A;  2CJJ A;  1KZH A;  3IRQ A;  1Y6I A;  2QZ8 A;  3HOX J;  4HA8 A;  2CW0 F;  2PN6 A;  4V19 K;  2A6T A;  5FRM A;  4IHV A;  4LLN A;  4AU7 A;  3SQN A;  1N78 A;  2K40 A;  3IV5 A;  2VOP A;  4RB2 C;  1R4N B;  2OBP A;  4IX7 A;  1XGM A;  1D8K A;  5IP7 J;  3K1P A;  3BR5 A;  1Y0U A;  1RC9 A;  3FK6 A;  4XLP F;  2IGO A;  2NOJ B;  4M3G A;  4J19 A;  2BXY A;  4OU0 A;  2BZT A;  5HDK A;  4ON0 A;  3LA2 A;  3ECH A;  1SFE A;  2VAS A;  3DTK A;  2E60 A;  4UHT A;  4UY8 I;  4I0B A;  3R61 A;  3TKY A;  2DOF A;  1ZN2 A;  2W84 A;  2XRN A;  1Z6T A;  1WVR A;  4BHP A;  3ABM H;  1I3A A;  3KP5 A;  1SVL A;  1M1E B;  3F3X A;  2FQ4 A;  2HYJ A;  3PJR A;  2WV0 A;  2DU9 A;  3F6V A;  5EZH A;  1XDS A;  1WJF A;  1X1P A;  4RDU A;  3JSO A;  2NVQ J;  3CF2 A;  2HQ5 A;  4I01 A;  3EYI A;  3D0S A;  4MQ9 F;  4XKW A;  4RS8 A;  4IL6 C;  1SFU A;  1EH8 A;  1LE8 B;  5IY5 H;  3OYA A;  3D1N I;  2L7K A;  4CCJ A;  1R9T J;  2BY3 A;  2K3P A;  2IS2 A;  3I3L A;  4PFP A;  2PJR A;  1J75 A;  1GHC A;  1U9O A;  2A61 A;  1SFX A;  1DP7 P;  1U5T B;  1ETW A;  4S0H B;  3PNT A;  2UV1 A;  1O4X A;  4WK8 F;  1CGP A;  5F0F A;  5J1U A;  4BXU A;  2QGU A;  4E70 A;  1BI1 A;  3WTW C;  1XC5 A;  1KQ8 A;  2KJC A;  3BR1 A;  4L9N A;  3BWG A;  1IF1 A;  1VND A;  2NVX J;  3IUO A;  2DA1 A;  5CLS A;  3G2B A;  2YR2 A;  3OV8 A;  4MFD A;  3Q0V A;  5JFR A;  3FXU A;  3E6D A;  4YG2 F;  2IP2 A;  3OYL A;  1E3O C;  3B02 A;  1ITY A;  1KYZ A;  1X3U A;  5E8I A;  4AYB A;  2LF7 A;  3K4K A;  1R7J A;  1OCP A;  2XGC A;  5GTH C;  2UUZ A;  4M9X A;  2X9D A;  3AG3 H;  4XRM A;  3PQK A;  1P9Q C;  1D3Y A;  1QGP A;  3DWL E;  4A2U A;  3JRB A;  1K79 A;  1ZR2 A;  1PP7 U;  4UV9 A;  1I1S A;  3WE2 A;  1G3Y A;  3A03 A;  1K83 J;  4BQO A;  1HSJ A;  5D8K B;  3JTH A;  4JBA A;  1J0R A;  3VYU B;  1FOW A;  2QEN A;  2XRL A;  1Y56 A;  4PZJ A;  2EFW A;  3F6O A;  4HDU A;  2QBY B;  2L7Z A;  1E0E A;  2W57 A;  3BDD A;  2XKO A;  1UFM A;  3KEY A;  3BTI A;  1WJ5 A;  1R22 A;  2EWN A;  5M3M J;  3OYC A;  1OFC X;  1BL0 A;  3KYL A;  4B44 A;  5ILS A;  1IRX A;  1TLH B;  2ELJ A;  2Z16 A;  3K2A A;  2DA6 A;  3GTJ J;  1B8I A;  2I10 A;  4BEH A;  2VJI A;  4A93 J;  3JRI A;  4L5J A;  4UUV A;  1TW2 A;  1WH5 A;  2VKD A;  2ZJQ F;  3DEE A;  2OJE D;  3KLN A;  4LFU A;  2QA4 I;  2WY8 Q;  1PDN C;  4IEJ A;  3ZQH A;  2EJR A;  1DGR M;  3CMM A;  1S3J A;  4CUG A;  1JXS A;  5LFA A;  2QEX I;  4XNF A;  2D45 A;  3OSG A;  1J5Y A;  3A01 B;  3GTL J;  1IN4 A;  1V5G A;  1OJL A;  4RM2 A;  5JLW A;  1X4P A;  1F4K A;  2NAZ A;  3I0T A;  3HEF A;  4A5M A;  4UUS A;  1ZR4 A;  4XQF A;  1BR2 A;  3NAR A;  3TDZ C;  4M3D A;  2R5Y A;  1YRN B;  2RVC A;  3K4M A;  3FX3 A;  2JVH A;  3NWS A;  4EGZ A;  4FAS D;  2I5U A;  4C9Y A;  1MJA A;  2LY9 A;  4PK4 A;  4WXD A;  2M2E A;  2W25 A;  3G3Z A;  4BE0 A;  2DO7 A;  2PMH A;  4DIQ A;  6PAX A;  4J00 A;  5D4R A;  3FMR A;  1E2X A;  1P7J A;  4KIG A;  5FRO A;  3K4L A;  4HLX A;  4Q4Z F;  4CCM A;  3RKY A;  5H2F C;  2F5F A;  3FK7 A;  5LHI A;  2BW3 B;  2EBI A;  4G6D A;  1Q1H A;  2V1D A;  2GXB A;  4HF2 A;  1IDZ A;  2FNA A;  3JCU C;  2EH3 A;  1S7O A;  2EV0 A;  3KP6 A;  3SHF A;  3G1M A;  4BJ5 C;  4ESJ A;  4OIO F;  4KIC A;  2LR8 A;  3I56 I;  3HKZ N;  3CTA A;  5GAE J;  4BKX A;  2VE9 A;  4EQQ A;  2R7F A;  5F6F A;  2HPI A;  4C3I J;  4ZDP A;  4PCQ A;  2A5Y B;  1ZRD A;  3OOU A;  3QPS A;  1K4S A;  2R7X A;  5KAF C;  1SMT A;  5ICF A;  5DUI A;  3HOZ J;  3L00 A;  1MMS A;  1SD7 A;  5KK1 A;  2BV6 A;  3W2V A;  2EZL A;  2VXD A;  1G3T A;  3OS2 A;  4CO8 A;  2XB5 A;  5HS9 A;  2LYC A;  3GTP J;  1OYI A;  1T08 B;  1R1U A;  1KON A;  2E36 A;  4KT5 C;  1SD4 A;  1A6I A;  1YJN I;  3Q0U A;  3HOY J;  3NQO A;  2E2H J;  4LG0 B;  4CCK A;  4RM3 A;  3CP2 A;  2CUF A;  1IGN A;  1MH4 A;  1YFH A;  1HBX G;  1NHA A;  4O5V A;  5H20 A;  4LG3 A;  1NG6 A;  2K9N A;  1O7F A;  3BG7 A;  2VJ5 A;  2MA3 A;  3BJA A;  3GFL A;  4YFK F;  1LB2 A;  1FIA A;  1ENH A;  2E1M C;  2ZME A;  2CUZ A;  2V4J C;  2DTR A;  2ECC A;  4L5E A;  1OQY A;  3ZMZ A;  3S3N A;  1S9H A;  2LSO A;  5E1W A;  5LGU A;  1LFU P;  1D8J A;  3PO3 J;  2QM3 A;  1ZRC A;  1Z3X A;  3WTV C;  1T95 A;  2QKM B;  3OYF A;  2FNP A;  1BR1 A;  5BPI A;  1XMA A;  4FET A;  4CZZ A;  3TBI A;  2K5C A;  1T56 A;  2QWW A;  1W5C C;  1SAU A;  3K70 D;  4YFN F;  1WQ2 A;  2EK5 A;  1YE9 A;  3IH4 A;  3HZJ A;  3C3W A;  3G1O A;  1Z6R A;  2YSR A;  4OWR B;  1PUF B;  4NHJ A;  4M71 A;  1R6R A;  3A0B C;  2EFN A;  1R5H A;  1YW7 A;  3S32 A;  2JUC A;  5HNF A;  1ACI A;  4IZZ A;  2L4M A;  3ZGK A;  4LLL A;  4Y52 J;  5LGN A;  4DBR A;  1MNE A;  1P4A A;  3OYI A;  1Z21 A;  2Z99 A;  3HHH A;  3HOT A;  4ZTF A;  1REP C;  3BPX A;  1OKR A;  2FRH A;  3VWB A;  4A3C J;  1R5I D;  1YG2 A;  1IDY A;  4G9Y A;  3CJQ B;  4W1U A;  1QVU A;  3OWT A;  3S3M A;  1HKQ A;  2KT0 A;  3LSJ A;  1FWZ A;  4C30 A;  4DZP A;  2JMW A;  2PBI A;  3FXK A;  3AG2 H;  5FD6 A;  4G94 A;  2QQB A;  3R6S A;  4XMY A;  5FFZ A;  1MKM A;  4CCO A;  1D0Y A;  1W7P D;  2DA2 A;  4U87 A;  3BY6 A;  4XN3 A;  4D9J A;  2E1M B;  3DLA A;  1E3P A;  1XS9 A;  3F9K A;  1H0M A;  1MBK A;  4HW0 A;  2KFD A;  3OYE A;  1VQ9 I;  2QQ8 A;  4WCG A;  4CYC B;  3F8F A;  2OQR A;  4IOA F;  3R0A A;  2V7F A;  4JP0 A;  1UHM A;  1FBQ A;  2JTV A;  2RKH A;  2RNJ A;  2KQR A;  3UR3 C;  3E6C C;  3CCV I;  1HKS A;  3DV8 A;  3BQY A;  5F08 A;  1EKE A;  2EA4 A;  2RV8 A;  3K4B A;  2BHY A;  5B3S H;  1MSF C;  4IRG A;  1B9M A;  5K7H A;  4Q5S F;  4JX4 A;  1GVJ A;  4BEH B;  4GO1 A;  2ZJ2 A;  4IHW A;  1YS7 A;  4CCN A;  4HDV A;  2DA5 A;  2R4G A;  3TQN A;  4LOC A;  2NVT J;  4HNU A;  5DM6 F;  3S1R J;  1Y8R B;  5DCM B;  2ZJP F;  2OZU A;  1L0O C;  3GTQ J;  2GA1 A;  1TNS A;  1YX3 A;  2DW4 A;  2CO5 A;  2G9W A;  2M3A A;  2Y2Z A;  1NK2 P;  2KPM A;  1N75 A;  2M5W A;  4CDG A;  1Y0N A;  1YS6 A;  4OIQ F;  3ZMS A;  2EFQ A;  5ED4 A;  3JRF A;  2A07 F;  3ERE D;  3WOD F;  3R0J A;  1WCM J;  3MN2 A;  3NEU A;  3FM5 A;  4BE1 A;  2MBF A;  2CH0 A;  3HL2 A;  2R7Z J;  1XG1 A;  2R7O A;  5BQT A;  4A3B J;  5EYR A;  3VB2 A;  3IH3 A;  3RZD J;  3CLO A;  1RUO A;  2FOW A;  2VBW A;  4FIS A;  1UAA A;  2DMN A;  5A2Q Z;  4AUX A;  4CYD A;  3RKX A;  2UXX A;  2DA7 A;  2WAD A;  4L5I A;  4FX4 A;  1TTY A;  2HZD A;  1YI2 I;  4W97 A;  2NS7 A;  2X48 A;  1OCC H;  3EUK L;  3BZK A;  1T38 A;  2HOT A;  4M73 A;  2ME6 A;  1XMK A;  5K7F A;  2CQK A;  3BG5 A;  3A02 A;  2OF7 A;  3L2R A;  4MTD A;  4RGX A;  1B72 A;  3KEO A;  3COA C;  1FOY A;  2KZV A;  3M3Y J;  2PLY A;  1JJ8 C;  1FYK A;  4U0W A;  4U88 A;  1LFP A;  2P5L C;  2F4I A;  3U1K A;  1TQP A;  2JSC A;  3IWF A;  4Y4R A;  4RAZ A;  4F92 B;  2W7N A;  4PSW A;  1FPQ A;  4KIB A;  5B1B H;  3DEW A;  2UXN A;  3BR0 A;  5KNL A;  4CHU A;  4QWQ A;  4B3A A;  3BZ6 A;  4M74 A;  3MFK A;  2Y69 H;  4L9V A;  5KVR A;  3JRE A;  2EZI A;  2KDZ A;  3GFM A;  4U7D A;  2ZB9 A;  3A1Y A;  3GZ5 A;  3IKV A;  4IO9 F;  3F22 A;  2GA2 A;  2GXG A;  3H0G J;  3TOA A;  4EAT A;  2QKL B;  2VB6 A;  3GVA A;  3F72 A;  4L0Y B;  2A05 A;  2ZME B;  5D5V B;  4IQJ A;  4OIN F;  3MZ8 A;  4IF4 A;  2X1D A;  1JJ6 C;  3MD2 A;  1KA8 A;  2GM4 A;  1J09 A;  4L0Z B;  3CP8 A;  4Y15 A;  2DPD A;  2JT1 A;  3E5U A;  5D8L B;  1QZY A;  3BR3 A;  3ZMU A;  3S17 J;  2L54 A;  1A04 A;  2TDX A;  2V9V A;  3L9F A;  2OAZ A;  2YPR A;  4I0A A;  1B1B A;  2HFH A;  3MWM A;  2MLK A;  4A3D J;  2LKX A;  4S04 A;  5JI6 A;  1BOB A;  4MO7 A;  1ZGA A;  1VQ5 I;  2VKE A;  3RZO J;  2LG4 A;  3GME A;  1WWX A;  2L3D A;  3FHN A;  5E3O A;  2P6S A;  1D1B A;  5J1Y A;  1BC8 C;  5IOY A;  4BHC A;  4Q48 A;  3DF8 A;  1K4T A;  3T1B A;  4Z2Y A;  2K7L A;  3T8T A;  3G71 I;  1IXS B;  4YEL A;  1QZZ A;  1XDU A;  1X1B A;  4NC6 A;  2HOS A;  2R7T A;  4N0B A;  1TT5 B;  3GTK J;  1EH7 A;  3M7G A;  1DQU A;  1U6G A;  4M3E A;  2Z2S B;  3GUD A;  2XGE A;  3C7J A;  3CCU I;  2IVM A;  1X3W B;  3EET A;  3FHZ A;  1T8I A;  1IRZ A;  2L4A A;  4EJV A;  3Q9S A;  4GGG A;  4WXC A;  1UHS A;  1P4X A;  5EJC A;  4A0Y A;  4LB5 A;  4X6A J;  2XF6 A;  1NG7 A;  2BY0 A;  3QPH A;  4XOT A;  4EVI A;  2ZSH B;  2DXI A;  3L2V A;  2ZBK A;  4FCY A;  3KYC B;  1UB9 A;  2JWT A;  5ICE A;  2FX0 A;  2K9S A;  4E7S A;  1J59 A;  5KHD A;  1VZ0 A;  3U9G A;  3WTU C;  3OR1 C;  1BOA A;  2H94 A;  2OD5 A;  2WAQ N;  4IVN A;  2VOO A;  1GV5 A;  4LLG F;  1HCR A;  4E7K A;  1C0W A;  2ZJR F;  2CQX A;  3DU5 A;  5B66 C;  1W7P A;  3FXO A;  1K6Y A;  3BG9 A;  1FP2 A;  1SAN A;  2GZW A;  3GZ6 A;  1LUJ B;  3RQ4 A;  1WZ2 A;  3FXJ A;  3H9G A;  3H3Z A;  4B48 A;  3KE2 A;  4F52 A;  2ELK A;  4ESB A;  2QUF A;  3SJM A;  2QSG X;  3MCZ A;  2IGM A;  2KIF A;  3ELK A;  1XN7 A;  4IHY A;  2WAF A;  4FX0 A;  1DU6 A;  3JRH A;  5E20 A;  1KU2 A;  2QYO A;  1H89 C;  1FZP B;  4YII A;  1S72 I;  1QZE A;  1FYL A;  4UVB A;  5E1X A;  3ZRG A;  2WC2 A;  1J2X A;  2DBB A;  1IG7 A;  5DUK A;  2WB1 A;  4QTR A;  4MQV A;  3OYD A;  2D1V A;  2YU9 J;  2XGX A;  2VOD A;  2HTJ A;  5LHH A;  5E3N A;  2JA2 A;  3DQV C;  1JKO C;  4P55 A;  2W82 A;  2KDO A;  2Y0M A;  2HQA A;  3MMY B;  4RB0 A;  2VLA A;  5K5R A;  1BI2 A;  2ZFU A;  1Y1W J;  1ON1 A;  4ZDL A;  3GTM J;  1FMV A;  5B5E C;  3I71 A;  1QHG A;  3ONQ A;  3LAP A;  3DEU A;  2LK2 A;  1X1D A;  2FBI A;  1OIS A;  2ZSI B;  3CJN A;  1RUN A;  2M8G X;  4I2O A;  3IH2 A;  2PEX A;  1OR7 A;  1IN8 A;  1NK3 P;  4F3Q A;  4YFX F;  5LHG A;  5EG0 A;  1ON2 A;  1JUS A;  2O8X A;  3I53 A;  5C4J J;  1U5T C;  4OAY A;  1Z1D A;  3CMA I;  1X2M A;  2E5Z A;  4L9J A;  3TP0 A;  1O3T A;  5IYD J;  1Z7U A;  1ZAO A;  5ICC A;  5FLV A;  3WTS C;  2V26 A;  3VSK A;  4A3F J;  4WXH A;  4XLE A;  3KZZ A;  4E7H A;  4DW6 A;  3JR9 A;  3ZN0 A;  3RKQ A;  1BM9 A;  4PSX A;  2R7Q A;  2XHK A;  3SYT A;  3DFG A;  1IV8 A;  4EM2 A;  2DPU A;  1OMI A;  4DNC A;  4B43 A;  3IHU A;  1BA5 A;  4RB3 C;  3PSI A;  2BHZ A;  4XLC A;  1R23 A;  3CZ6 A;  2HGC A;  1MJ9 A;  1UG0 A;  5L3D A;  1WHU A;  2XPV A;  1LJ9 A;  4IRH A;  5C4X J;  1YIJ I;  3BTL A;  1X19 A;  3V7R A;  1Z7L A;  1MZB A;  2LY2 A;  1O3S A;  2F5C A;  3Q5F A;  1APL C;  2ISY A;  4EM1 A;  3QOE A;  1Y8Q B;  4EJO A;  1ETY A;  4R8H A;  3LMM A;  1R36 A;  3X2Q H;  3VYR B;  2COM A;  2BYV E;  1BC7 C;  1GXP A;  2L9S A;  2OCE A;  2DOE A;  2EIL H;  2GQQ A;  3HC7 A;  2DK8 A;  3PL8 A;  2X6W A;  2B0L A;  3DP7 A;  4UXN A;  1LEA A;  3FBN B;  2YU3 A;  2M34 A;  1IJW C;  2NVY J;  2STT A;  2E2I J;  2VI6 A;  4I6Z A;  4DBQ A;  3HRM A;  2VIX A;  1LPQ A;  4PDK A;  3DTE A;  2R7U A;  1A31 A;  1K61 A;  3H36 A;  3SEZ A;  3A0H C;  4F7Z A;  4JQF A;  1XSV A;  2DN0 A;  5L3F A;  4DOZ A;  1BBY A;  3AG4 H;  3C2B A;  1U8R A;  2VUM J;  2K86 A;  3VYS B;  3ASO H;  1FSE A;  3MEX A;  2COB A;  4BJ6 C;  3KCC A;  4NB5 A;  4LIT A;  1LVK A;  5JHU A;  2Q0O A;  5LRR A;  4LIV A;  2B7E A;  2Y9Y A;  3JRA A;  2ZXJ A;  5F1R A;  2ZXI A;  4CGZ A;  3IRR A;  1HF0 A;  1MMD A;  1DDN A;  3QYF A;  3J80 K;  2R5Z B;  1G6N A;  4ETS A;  2AXL A;  3V4G A;  1SC7 A;  2O03 A;  1KU3 A;  1V55 H;  2ZNY A;  3W6V A;  1FTT A;  5BPD A;  3IAS 2;  3L2Q A;  1XSX A;  2E1C A;  1DGW Y;  3OYM A;  4DYQ A;  4CXF A;  3DBH B;  3MKY B;  3A01 A;  1ZTR A;  2DDA A;  4NC8 A;  5F64 A;  3HOS A;  3W6J B;  2XUB A;  2CGP A;  4M72 A;  4HEA 2;  4PFO A;  5FKM A;  1E3H A;  1RNL A;  1XTA A;  1YRN A;  1HQC A;  4XKC A;  5DTD A;  3MKW B;  1OYW A;  3KYD B;  5J40 A;  3CMY A;  1QRY A;  4CA0 A;  2R93 J;  3LFK A;  1QU3 A;  5DDG A;  1ETK A;  4A3K J;  4ANJ A;  3GTG J;  3FXQ A;  3LA7 A;  2FXA A;  1XGS A;  3ZN1 A;  3LSR A;  4CSW A;  3OL4 A;  3VPR A;  3FWE A;  3IP4 B;  3U21 A;  2XSD C;  4Y3O A;  3L09 A;  5J8C A;  4P1W A;  2BGC A;  4LJZ F;  2JRT A;  1P92 A;  3HUG A;  4N4N B;  2FMY A;  2K9Q A;  2XSJ C;  4Y33 A;  1HA8 A;  4EJU A;  3OIO A;  5D5U B;  4YEJ A;  4G7H F;  3G73 A;  1LDK B;  2FE3 A;  2V79 A;  4XRF A;  3K7A J;  5FFX A;  2JJ7 A;  1S5L C;  5LD2 C;  3H5R A;  1BI3 A;  2HKX A;  5A2Q K;  4IKF A;  2GOM A;  2H8W A;  1O3R A;  3Q9V A;  3WHB A;  5DYM A;  5ICG A;  3U2R A;  3I64 A;  4M3B A;  5F0C A;  2O8K A;  2A68 F;  2KRC A;  2BBY A;  1QHH D;  1ZQ3 P;  4KA4 A;  4IHT A;  3ESW B;  2NVU B;  2M87 A;  1ETV A;  2IEK A;  3DTI A;  3S16 J;  1SD6 A;  4G6Q A;  2ZO4 A;  4LGW A;  2DK5 A;  1KGS A;  2PX9 A;  3LQR A;  1WSU A;  4IXA A;  4ENN A;  2VT3 A;  4ZDO A;  3M4O J;  3S15 J;  1PUE E;  3GCM A;  3H5A A;  2CQ7 A;  2F6C A;  4OAZ A;  3H92 A;  1GXQ A;  2KP6 A;  3IKT A;  1KU7 A;  3MZH A;  3CC7 I;  3SFZ A;  3SZG A;  3T5X A;  1TWA J;  3O2P E;  2IT0 A;  1Z3Y A;  4FT8 A;  3LWF A;  3WU2 C;  3CO7 C;  3KFW X;  3G1L A;  4RAY A;  4JX6 A;  5FD5 A;  1VI0 A;  4EEF G;  1TNT A;  3VFZ A;  2DT6 A;  5CKT A;  2IXS A;  1WJA A;  5F1J A;  4HF0 A;  4B3X A;  1VQ8 I;  2Y30 A;  4XON A;  1AOY A;  4LK0 F;  2XAQ A;  2STW A;  3GLX A;  3ZR8 X;  4WX9 A;  1PUF A;  1ZRE A;  1IAW A;  3KP7 A;  1MH3 A;  1T0F C;  1EH6 A;  1Y1V J;  2BXZ A;  2MLG A;  1MDM A;  1ETO A;  5D6F A;  3DPT A;  2LFB A;  1QA6 A;  2ID3 A;  3OY9 A;  4K2E A;  3U1D A;  4HOB A;  4I98 B;  1MD0 A;  2ZC2 A;  2V1N A;  2HPM A;  3WTZ A;  4AID A;  2CV0 A;  4KYW A;  5E8G A;  1B8I B;  2JA6 J;  1AU7 A;  4ZH4 F;  4F93 B;  1JUM A;  3FIS A;  3RJP A;  2VL8 A;  1R49 A;  2C6Y A;  2HDD A;  3HDD A;  4I99 C;  1OPC A;  4A0X A;  2M45 A;  3D5L A;  4HLY A;  3E6B A;  4HX8 A;  2LP0 A;  3GLL A;  2EQR A;  1QO0 D;  4U7B A;  3DCF A;  2AQE A;  2M7A A;  3LSP A;  3QU3 A;  2V1X A;  3I4M J;  1AA7 A;  1GVD A;  2M8E A;  3G4S I;  2VPL A;  3SEQ A;  2P7V B;  1X4O A;  3KZY A;  3O6B B;  1OCR H;  2IS4 A;  2O5R A;  3KP3 A;  3LSI A;  3OMY A;  3REO A;  1FSH A;  3S2H J;  2O3F A;  2ICW G;  2DQL A;  3F8B A;  1OYY A;  2LH9 A;  4PJ0 C;  2DA3 A;  2X51 A;  3V8J A;  2DA4 A;  3IWZ A;  2R7R A;  4YIR X;  2AXT C;  2D5V A;  3E3V A;  1S7A A;  1TW3 A;  3HB9 A;  1YIO A;  1D5Y A;  2VBZ A;  4UV8 A;  4V2F A;  5FKN A;  3TED A;  5DS9 A;  1FOK A;  4EV0 A;  1ZH5 A;  5DD4 A;  3HHG A;  3TMO A;  2HS5 A;  1H88 C;  3D5R C;  5DD8 A;  4BXX J;  2BVL A;  3GXO A;  1FYM A;  3J7A O;  1UJ8 A;  4XLA A;  4BGD A;  5FLX Z;  2K4J A;  2O0Y A;  5DEQ A;  1DU0 A;  2F4M B;  2MG4 A;  1ZG1 A;  3ZOB A;  1U0J A;  4XSX F;  5B1A H;  2EFO A;  5IYB J;  4B1R A;  2ZKZ A;  3K70 C;  2CRG A;  1LDD A;  1BN5 A;  2VC1 A;  3DKW A;  1XD7 A;  4CH7 A;  5FB2 A;  4UB6 C;  1JI8 A;  3L1P A;  2BVM A;  1W5S A;  3OOP A;  1QPM A;  1XCB A;  4UVC A;  3C1D A;  3CJR B;  4HPQ A;  4NUB A;  3ZQI A;  5C44 J;  3D5S C;  3H3U A;  2GAU A;  1HST A;  2DMU A;  3WU1 B;  4BY7 J;  4C2T A;  2DFF A;  1WJD A;  1ONV A;  1PJR A;  3S1N J;  2E1N A;  3BG6 A;  2XC7 A;  2DMP A;  3FZV A;  2BE5 F;  2FA5 A;  3I9V 2;  2ZME C;  2KZG A;  3QPL A;  2K9L A;  5D6E A;  1F36 A;  2YX7 A;  1VQM I;  2XIG A;  2QF7 A;  1IRG A;  1WJC A;  1G8X A;  3I59 A;  3DKX A;  4IRI A;  2FSW A;  4KIF A;  1HLV A;  3OR2 C;  3FF5 A;  3TO7 A;  2WWY A;  2M0M A;  2KIM A;  1ZEL A;  3LSH A;  2KIS A;  2G7U A;  4AVP A;  4GYI A;  1I27 A;  1V3F A;  1R1T A;  2NYX A;  2XAS A;  4HAM A;  1GUU A;  3BTC A;  3DKY A;  1I1G A;  1JE8 A;  1X2N A;  4O3M A;  5K1Y A;  2X6O A;  3RCO A;  3L2U A;  2K9M A;  3OS0 A;  2RN7 A;  1RZ4 A;  3KLO A;  3CME I;  3SFI A;  3HIF A;  2M4G A;  3KX2 A;  3GBG A;  4BU2 A;  4GYG A;  1KQ9 A;  3DXJ F; 
#chains in the Genus database with same CATH homology
 1I50 J;  2LD5 A;  1IRZ A;  1G2H A;  4A3M J;  1LE8 B;  3D1N I;  1UHS A;  1VFC A;  5FKO A;  1R9T J;  4X6A J;  2NS8 A;  1U9O A;  4A3I J;  4FCY A;  2JWT A;  1MBE A;  1ETW A;  1UG2 A;  2FX0 A;  2K9S A;  4S0H B;  3FKI J;  1O4X A;  2EZK A;  4AC0 A;  5F0F A;  5J1U A;  4XRS G;  1RES A;  4CYC A;  1U8B A;  3MVP A;  1XC5 A;  1LFB A;  2WAQ N;  1GV5 A;  1HCR A;  5GPA A;  4BY1 J;  3BR1 A;  1T33 A;  4M3E A;  1VND A;  2CQX A;  2NVX J;  1GT0 C;  2DA1 A;  3BG9 A;  1SAN A;  4MFD A;  3Q0V A;  1HOM A;  1E3O C;  1MBH A;  1ITY A;  1IV6 A;  3UKG A;  1BW6 A;  5FKK A;  1BW5 A;  2ELK A;  1OCP A;  2XGC A;  1JUP A;  3Q0W A;  3SJM A;  4M6V A;  2X9D A;  4XRM A;  1X58 A;  5M5Y J;  3JRB A;  1JKR C;  4IHY A;  1DU6 A;  3JRH A;  3CDL A;  3CQZ J;  3O8H A;  2JA5 J;  1ZR2 A;  3S1M J;  2GBY A;  1H89 C;  3A03 A;  1K83 J;  4C2M J;  1TWF J;  3BQZ A;  1Z77 A;  2Y9Z A;  1IG7 A;  4JX5 A;  2DMQ A;  2XRL A;  4QTR A;  2YU9 J;  1ZGW A;  5E3M A;  5F27 A;  5E3N A;  1JT6 A;  2L7Z A;  1TC3 C;  1JKO C;  2B63 J;  3HGG A;  2DMT A;  3BTI A;  2YS9 A;  5M3M J;  1Y1W J;  3E7L A;  3GTM J;  2TCT A;  1GDT A;  1OFC X;  1BL0 A;  4A3G J;  3I4M J;  2LK2 A;  3BR2 A;  3K2A A;  2DA6 A;  3GTJ J;  1B8I A;  2I10 A;  5EGO B;  2EZH A;  3S1Q J;  1P7I A;  2M8G X;  4A93 J;  3JRI A;  3IH2 A;  2R5Z A;  2R92 J;  1WH5 A;  1NK3 P;  4BBS J;  1TWH J;  5EG0 A;  1JUS A;  5C4J J;  5EZG A;  1Z0X A;  1B72 B;  1X2M A;  3TP0 A;  4IEJ A;  3ZQH A;  5IYD J;  1AKH B;  5FLV A;  2IBD A;  3OSG A;  3GTL J;  3A01 B;  1OJL A;  5JLW A;  4A3F J;  5F04 A;  2GLO A;  4DW6 A;  3JR9 A;  3RKQ A;  3HEF A;  4UUS A;  5HOD A;  1ZR4 A;  3NAR A;  4QIW N;  4M3D A;  2R5Y A;  5IOZ A;  3FIW A;  1YRN B;  2ECB A;  1BA5 A;  2WV1 A;  1FTZ A;  2LY9 A;  2M2E A;  3JRC A;  2NOG A;  3BT9 A;  2XPV A;  1P7J A;  4BBR J;  5C4X J;  2R0Q C;  2ID6 A;  3BTJ A;  3BTL A;  3FK7 A;  3I4N J;  2XB0 X;  2EBI A;  4JYK A;  1APL C;  1RPW A;  1ETY A;  2Y31 A;  3MKL A;  1IDZ A;  1JGG A;  2EH3 A;  1RET A;  2O7O A;  1JTY A;  3B6C A;  3OSF A;  3G1M A;  4Y7N J;  1RKW A;  2LR8 A;  3HKZ N;  4BKX A;  4C3I J;  5IYC J;  2JK3 A;  4HNV A;  3OOU A;  5BNG A;  3QPS A;  2M34 A;  1IJW C;  2NVY J;  2E2I J;  2VI6 A;  4I6Z A;  1S7E A;  3HOZ J;  1K61 A;  1ZK8 A;  2EZL A;  1U78 A;  2DN0 A;  2XB5 A;  3C2B A;  9ANT A;  2VUM J;  3GTP J;  5IPA A;  1NTC A;  3SDG A;  2COB A;  1OCT C;  4A3E J;  4FE4 A;  1A6I A;  1WI3 A;  2DTZ A;  4MFE A;  3Q0U A;  3HOY J;  2Y9Y A;  3O8G A;  2E2H J;  1EF4 A;  5IP6 A;  3JRA A;  1F43 A;  2NVQ J;  2CUF A;  1IGN A;  1MH4 A;  5K7Z A;  1QVT A;  1HF0 A;  2L7F P;  1MBF A;  2R5Z B;  3H3V K;  2K9N A;  4MIM A;  1FIA A;  1ENH A;  2N8G A;  3B6A A;  3W6V A;  1I3Q J;  1FTT A;  2ECC A;  2M0C A;  2PMZ N;  4L5E A;  4DYQ A;  3RQI A;  4D7N A;  2P81 A;  1LFU P;  3PO3 J;  3A01 A;  1ZTR A;  2XGD A;  1TWC J;  4M3F A;  2CU7 A;  2DJN A;  2MGQ A;  3ZQF A;  2H1K A;  3HM5 A;  5FKM A;  1MBJ A;  1LE8 A;  1T56 A;  1ETX A;  1YRN A;  3BR6 A;  2OPT A;  4G12 A;  5DTD A;  3GTO J;  3IH4 A;  3CMY A;  1ETQ A;  1QRY A;  3G1O A;  1PUF B;  2R93 J;  1ETK A;  4XID A;  4A3K J;  1WH7 A;  3GTG J;  2LLK A;  5EF6 A;  3LSR A;  2H8R A;  3VPR A;  4NDL A;  1GV2 A;  4Y52 J;  4C3H J;  3BG3 A;  1RKT A;  2XSD C;  1JKP C;  1H8A C;  4AYB N;  4DZJ A;  5M5X J;  2K9Q A;  1AHD P;  2LVS A;  4D5C A;  3HOU J;  4A3C J;  1IDY A;  2HI3 A;  3OIO A;  4W1U A;  2HOA A;  1QVU A;  2KT0 A;  2L9R A;  1TWG J;  3K7A J;  2JJ7 A;  3LSJ A;  4UUS B;  4DZP A;  4IHX A;  5FKL A;  3JRG A;  2JMW A;  2R5Y B;  2G0E A;  4C3J J;  3WHB A;  4FE7 A;  1IUF A;  2DA2 A;  2ME0 A;  3JRD A;  1FIP A;  3QQA A;  4D5F A;  4M3B A;  5F0C A;  1CQT A;  5GPC A;  4DYR A;  2O8K A;  1JT0 A;  5E3L A;  1XS9 A;  1JKQ C;  1MBK A;  1ZQ3 P;  5EDN A;  1ETV A;  2IEK A;  4RBO A;  3S16 J;  4CYC B;  4X1E A;  2E2J J;  4JP0 A;  5EEA A;  3LOC A;  2E19 A;  1JTX A;  3NAU A;  3M4O J;  3BQY A;  3ZQL A;  3S15 J;  5F08 A;  2VKV A;  5J1R A;  1MSF C;  1I6H J;  5K7H A;  4JX4 A;  5EGO A;  4IHW A;  1HDD C;  2DA5 A;  1WGX A;  4LOC A;  2YUS A;  1TWA J;  2NVT J;  3S1R J;  1ORK A;  3G1L A;  4JX6 A;  1VI0 A;  4EEF G;  3GTQ J;  3ZQC A;  2FJ1 A;  1POG A;  2HXO A;  2O9L A;  4ABZ A;  2VPR A;  2Y2Z A;  5F1J A;  1NK2 P;  3S14 J;  2Y30 A;  1Q1V A;  4XK4 A;  3CCY A;  1QPI A;  1A5J A;  2XPW A;  3Q3S A;  1PUF A;  3LNQ A;  5IP9 J;  1MH3 A;  1Y1V J;  3HGY A;  3JRF A;  5FLM J;  1ETO A;  1WCM J;  3MN2 A;  4DYC A;  2LFB A;  2ID3 A;  5FJ8 J;  2R7Z J;  5C3E J;  1XG1 A;  4A3B J;  5EYR A;  2E1O A;  3IH3 A;  3PM1 A;  3RZD J;  2L7M P;  1B8I B;  2JA6 J;  3LSG A;  1AU7 A;  5JLX A;  4FIS A;  3FIS A;  1JUM A;  2DMN A;  1MNM C;  4AUX A;  2HDD A;  2DA7 A;  3HOV J;  3HDD A;  4W97 A;  2NS7 A;  2X48 A;  2LP0 A;  1IC8 A;  1W0U A;  1AKH A;  2EQR A;  1FJL A;  3DCF A;  2HOT A;  2ME6 A;  2WB1 N;  3TW7 A;  5K7F A;  3LSP A;  4GFB A;  3BG5 A;  3A02 A;  2OF7 A;  1GVD A;  1ZKG A;  4A3J J;  1B72 A;  4UUT A;  2JA7 J;  3PO2 J;  2XPU A;  1U9N A;  1MBG A;  2LTP A;  4B4C A;  3S2H J;  3HBL A;  3M3Y J;  1JJ8 C;  2FD5 A;  4MLO A;  3TP3 A;  2CUE A;  1SFO J;  2DA3 A;  2DA4 A;  2D5V A;  4QSH A;  3HB9 A;  2CQQ A;  3DEW A;  3BR0 A;  1D5Y A;  4D7M A;  4B3A A;  4XRS A;  4V2F A;  5FKN A;  2IAI A;  2W48 A;  5DS9 A;  5J3L A;  3TED A;  3JRE A;  2EZI A;  4I76 A;  5M5W J;  1H88 C;  5F0H A;  2KDZ A;  4BXX J;  3S2D J;  1UMQ A;  3HOW J;  1FEX A;  2ZB9 A;  2QCO A;  3WHC A;  2HXI A;  2M9H A;  1DU0 A;  2MG4 A;  1HDP A;  3ZOB A;  4FTH A;  1VF9 A;  3H0G J;  2JA8 J;  2L0K A;  4A69 C;  5IYB J;  3F0C A;  4B1R A;  1RR7 A;  2CRG A;  4V2G A;  4XIC A;  3ZQG A;  3L1P A;  2Y0S N;  4A3L J;  3TW6 A;  1JJ6 C;  2GM4 A;  3ZQI A;  5C44 J;  2TRT A;  1MSE C;  2CJJ A;  2DMU A;  1BJZ A;  4BY7 J;  3BR3 A;  3S17 J;  5M3F J;  3HOX J;  3S1N J;  4A3D J;  5EG0 B;  4IHV A;  2DMP A;  2LKX A;  2AO9 A;  2K40 A;  3IV5 A;  3QPL A;  1F36 A;  5IP7 J;  4MO7 A;  3BR5 A;  3FK6 A;  4J19 A;  2QF7 A;  4M3G A;  2MW8 A;  2VKE A;  1HLV A;  3RZO J;  5E3O A;  1W0T A;  5J1Y A;  1WPK A;  5IOY A;  1GUU A;  3BTC A;  2MSY A;  1X2N A;  2X6O A;  2FQ4 A;  2HYJ A;  2JN6 A;  2RAE A;  3SFI A;  2HOS A;  3GTK J;  5EZH A;  4RDU A;  2AHQ A;  3GBG A;  5GP9 A;  2HQ5 A;  2XGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...