1MBEA

Mouse c-myb dna-binding domain repeat 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
LGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 18
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbeA00
5C44J 5EF6A 1ZR2A 1X58A 1FTTA 1UMQA 2IAIA 2FQ4A 4IHWA 2HOAA 3BR2A 2MG4A 1JJ6C 2L7MP 5FKNA 2Y9YA 5EZHA 1H88C 3TW6A 1EF4A 5DTDA 5F04A 1WCMJ 1BA5A 1B72B 1ETWA 3QPSA 4D7NA 2DA4A 4IHYA 2COBA 3LSGA 2EH3A 2CQQA 3M4OJ 1JUPA 2XGCA 5K7ZA 1XC5A 5FJ8J 1VFCA 1LFUP 1IDZA 2VKVA 5C4JJ 1B8IA 3HDDA 2M8GX 1HF0A 2DA3A 2PMZN 3BT9A 2JJ7A 5C4XJ 4JX6A 4FCYA 1S7EA 1MH3A 4UUSB 1TWGJ 5EG0B 2XRLA 1MBEA 3CDLA 1U9OA 2XPWA 1QRYA 5JLWA 1NK3P 3HOYJ 1IRZA 5FLMJ 2H1KA 4MFEA 2GM4A 2M9HA 1WGXA 1WI3A 1R9TJ 1IDYA 2D5VA 3OSFA 1E3OC 5E3OA 3M3YJ 4B4CA 2NVQJ 3JRAA 2N8GA 1GT0C 1JGGA 2WAQN 3S1QJ 5DS9A 3ZOBA 3Q0WA 3I4NJ 3MKLA 1TWHJ 5F0HA 4S0HB 3IV5A 1JKPC 4A69C 4RDUA 2JA6J 1U9NA 2FD5A 4A3JJ 2K9QA 2O9LA 1HOMA 2DMQA 2DMTA 1D5YA 2LY9A 5C3EJ 3S17J 1X2MA 2NS7A 4A3CJ 1MBKA 2ECBA 2XGDA 1RKTA 5F08A 2R92J 3HB9A 1OJLA 3OOUA 1WH5A 2M34A 2ID6A 3HKZN 1T33A 3RZOJ 3GTGJ 5FKLA 2CJJA 5EGOB 1MH4A 2ZB9A 1ITYA 5IOZA 2EBIA 3TP0A 1GVDA 4C3JJ 3CMYA 2XB0X 3BR6A 2XPUA 1IUFA 3SDGA 1I6HJ 3WHBA 3FISA 3Q0VA 2LD5A 5IPAA 1FJLA 2YUSA 1Y1VJ 4B3AA 1GV5A 1AHDP 1HCRA 2M2EA 2QCOA 1TWCJ 1MSEC 3CCYA 3ZQIA 3HOWJ 5F1JA 1ORKA 5K7FA 1MBGA 1XS9A 1RKWA 4RBOA 5E3LA 1BL0A 1JKRC 4V2GA 1YRNB 3B6AA 1WPKA 1JKQC 1UHSA 3S15J 2JA5J 4CYCB 2JA7J 2Y9ZA 1ETXA 5GPAA 1TC3C 4I76A 1ZQ3P 5FLVA 4IHVA 2L9RA 3IH3A 1P7IA 2NVYJ 4MO7A 4V2FA 1LE8A 2ID3A 2NS8A 3RZDJ 1O4XA 1OCPA 2Y0SN 1NK2P 3OIOA 2QF7A 4FE7A 2E1OA 4XRSG 3BQZA 5J3LA 1F43A 3RQIA 1AU7A 3BR5A 3BR3A 1FEXA 2FJ1A 1AKHB 2E2JJ 3BG9A 4M3EA 5M5XJ 3BTJA 3GTQJ 1OCTC 4XICA 1ETYA 2DTZA 1RR7A 1JKOC 4A3EJ 2E2HJ 2I10A 2LTPA 2DJNA 3H3VK 2XPVA 1ZK8A 5GP9A 5E3NA 2JN6A 5IOYA 3WHCA 5M5YJ 2JWTA 1XG1A 1W0TA 2HOSA 1IGNA 3S14J 4XRMA 1ZGWA 3BTIA 1I3QJ 3A02A 4JP0A 1K61A 2NVXJ 2VUMJ 2HOTA 2K40A 2ELKA 2WV1A 2K9NA 4DYCA 2OPTA 2AO9A 1UG2A 2G0EA 3RKQA 4UUTA 3JRIA 1T56A 3BTCA 5JLXA 4QSHA 4GFBA 3ZQLA 4C3IJ 1B72A 4BKXA 4ABZA 3Q0UA 3TEDA 1JUSA 4C3HJ 4A93J 2NOGA 4B1RA 2CUEA 3FKIJ 4M3GA 3JR9A 4M3BA 2M0CA 2R5ZB 4QIWN 4A3BJ 4A3GJ 4EEFG 3C2BA 3ZQGA 2H8RA 1Z0XA 3HOUJ 2X48A 3A01B 1TWAJ 5J1UA 2LKXA 1ZTRA 1RPWA 2DA6A 3HBLA 4G12A 2VKEA 1U78A 2ECCA 2ME6A 5E3MA 3BR0A 5FKKA 4MIMA 3HGYA 4UUSA 2XB5A 2MGQA 5EG0A 1HDPA 3K7AJ 3G1LA 5IP9J 3PO3J 2JK3A 2YU9J 1VNDA 4AC0A 1OFCX 3SFIA 1H8AC 4IEJA 2EQRA 2ME0A 1IJWC 3HGGA 3GTOJ 3GTKJ 1A6IA 5K7HA 2HXIA 3FK7A 1ZKGA 2LFBA 4JYKA 4HNVA 3G1OA 4BXXJ 2R5ZA 4W97A 1BJZA 2R5YB 3HOVJ 1JTXA 4DYRA 2B63J 1JUMA 4FTHA 5FKOA 1GUUA 1ETQA 4D5FA 3BTLA 1MSFC 5M3FJ 4DYQA 1QVUA 1P7JA 3I4MJ 2IBDA 1LFBA 2XSDC 2TCTA 1JTYA 2EZKA 1RESA 1G2HA 5IP6A 3CQZJ 5F0FA 1DU0A 1GV2A 3LOCA 4C2MJ 2DA5A 5EGOA 1GDTA 2L7ZA 2DA2A 2DMUA 4BY7J 2VI6A 3NAUA 1CQTA 3JRFA 4A3MJ 2HXOA 4Y7NJ 3IH4A 3JRGA 3BG3A 3PM1A 4W1UA 4AUXA 5M3MJ 2R93J 4A3LJ 1I50J 2X9DA 5J1YA 3LSJA 1K83J 2LP0A 3O8HA 3O8GA 2L0KA 1JT6A 2JA8J 2Y30A 3GTPJ 1SFOJ 3LSPA 4IHXA 2LR8A 4DW6A 3HOXJ 3B6CA 4I6ZA 2DMPA 1MNMC 1H89C 3ZQHA 1MBJA 1HLVA 1YRNA 4LOCA 3OSGA 5FKMA 4CYCA 2TRTA 5BNGA 3QQAA 4A3FJ 2DMNA 3GBGA 1NTCA 2VPRA 2EZHA 5IYCJ 2R0QC 3NARA 2CRGA 5F27A 1U8BA 2CQXA 2JMWA 2L7FP 4MLOA 1ETKA 1IG7A 5EZGA 4X1EA 4NDLA 2E2IJ 3ZQCA 1TWFJ 2GBYA 2HYJA 2OF7A 3JRDA 1SANA 9ANTA 2Y31A 3S1MJ 1AKHA 5IYDJ 2O8KA 4DZPA 1DU6A 4M3DA 1VI0A 1JT0A 2WB1N 4AYBN 1A5JA 2KT0A 3K2AA 1BW6A 2CUFA 2HI3A 4JX4A 3PO2J 4D7MA 3BQYA 2KDZA 3LNQA 5F0CA 3HEFA 2W48A 2GLOA 1MBHA 2LLKA 2DN0A 3BR1A 4M6VA 2P81A 1VF9A 4FE4A 3JRHA 1JJ8C 1Q1VA 2DA1A 1PUFB 3JRCA 4D5CA 1APLC 4JX5A 3D1NI 2Y2ZA 2HQ5A 4BY1J 4XK4A 3L1PA 3H0GJ 4FISA 1ZR4A 3FK6A 3LSRA 1WH7A 5J1RA 2E19A 3S1NJ 3S2HJ 4X6AJ 2LK2A 4MFDA 1POGA 1Y1WJ 3A01A 4BBSJ 4A3KJ 1F36A 1RETA 2XGEA 4M3FA 4J19A 2R7ZJ 3Q3SA 4A3IJ 5M5WJ 4DZJA 2YS9A 3ZQFA 3S16J 2LVSA 5IP7J 1PUFA 3GTJJ 1W0UA 2NVTJ 3DEWA 3S1RJ 1QVTA 5EYRA 2HDDA 1ETOA 3MVPA 3HM5A 3QPLA 1FTZA 1MBFA 2AHQA 3UKGA 2X6OA 3A03A 4Y52J 4QTRA 2IEKA 1FIPA 1ETVA 3IH2A 5IYBJ 1LE8B 2RAEA 1IV6A 4A3DJ 1ENHA 1X2NA 2EZLA 2R5YA 4XRSA 2O7OA 2DA7A 3TP3A 4XIDA 2MSYA 3GTLJ 3HOZJ 3G1MA 4BBRJ 3S2DJ 2CU7A 5EEAA 3SJMA 3TW7A 5HODA 3MN2A 3JRBA 5EDNA 2EZIA 2FX0A 3FIWA 3W6VA 1HDDC 1BW5A 1IC8A 3GTMJ 1QPIA 1Z77A 4L5EA 3VPRA 3E7LA 1B8IB 5GPCA 1FIAA 3DCFA 3JREA 2MW8A 3F0CA 2K9SA 3BG5A
chains in the Genus database with same CATH superfamily
2Z16A 3GW2A 3BPXA 1QZEA 2KHMA 2RV8A 5EF6A 4ZYEA 2CW8A 4EJTA 3COAC 3CO7C 4CCOA 1HQCA 2M4KA 3Q9VA 2XUBA 2O3FA 2Y9YA 2E60A 2HFHA 1WCMJ 2HWVA 4GDFA 4EM2A 1B72B 4LMYA 3FM3A 2COBA 2DYRH 2IT0A 1MD0A 2CQQA 3PFYA 1WQ2A 1SD6A 4ZTJA 1VFCA 2Y0MA 2DA3A 3CF2A 2PMZN 1L0OC 2X85A 2JJ7A 4A2UA 1I1SA 2EIJH 1MH3A 2DQRA 2L4AA 2JVHA 4UUSB 2F6CA 2FRHA 2Y69H 4IX7A 2XRLA 2WC2A 3VYUB 1SC7A 3JAMK 1R1VA 1VQ8I 5B1BH 3RKWA 4BJ6C 1O57A 3ABKH 5JLWA 3HOYJ 1IRZA 3M7GA 1FYKA 2H1KA 3OYKA 1R4MB 2GM4A 4S05A 2X51A 1WGXA 2V1UA 4MTDA 2K3PA 1RUOA 5JR3A 1R9TJ 2VJ5A 1IDYA 4U88A 1E3OC 1V54H 3SEZA 2CFXA 2DTRA 4B4CA 1P2FA 1GT0C 4FX0A 4B8XA 3HOSA 1TWHJ 1EH7A 4MTEA 2V9KA 4S0HB 2DOAA 1ZRFA 3VEPA 4A69C 3K4LA 2JA6J 4N0BA 2Q8KA 5L3CA 1C0WA 5EEHA 1DDNA 4RLQA 5DV5A 3CCRI 1BIBA 2K9QA 3K1NA 2KIQA 2DMTA 5LGUA 4PCQA 4LG3A 1D5YA 2H27A 1X2MA 3TQNA 2E35A 3OYEA 3F8FA 5F08A 1RKTA 2R92J 3K4MA 3V7SA 1OJLA 5L3GA 4YFXF 1W1WE 2ID6A 3RZOJ 3GTGJ 4BXUA 3GMEA 1P4WA 1VQ7I 4XKCA 3TP0A 4Y3OA 5F6FA 2JRMA 5E1XA 4OU0A 4DGWB 2BE5F 5FLXK 1IUFA 2WAFA 3TO9A 1KA8A 5DM7F 3WHBA 1K6OA 2DO7A 3IAM2 2YUSA 3F23A 1SEUA 3REOA 3U9GA 3BG7A 2LYCA 1WFXA 3BJOA 4B3AA 1AHDP 5E79C 3KYDB 3EUHA 3HOWJ 4CZZA 4B43A 1MBGA 5ICFA 1HSJA 3NWSA 4RGRA 3TO6A 3CCJI 1H9TA 4CDGA 1Z6RA 4IPAA 4P55A 4LG0A 4XMYA 1BL0A 2XGXA 4LLNA 3FX3A 3H5NA 1WPKA 1Z7LA 5D6EA 3S15J 1FWZA 1TZLA 2JA7J 3M8JA 4BL0B 2O03A 4CA0A 3FKJA 3EETA 4I76A 4KIFA 3KCCA 3I59A 4BAYA 3RZDJ 3DTEA 3GLXA 1UG0A 2LC2A 1O4XA 2XF6A 4M73A 1YIOA 4XRSG 3RQIA 3KYCB 2V1NA 3WTXC 2K86A 1REPC 2JPCA 3TL4X 3V7CA 1GXQA 1OCTC 4XICA 4CCMA 2P5LC 1I1GA 2OQRA 3EPZA 2I10A 2LTPA 4KISA 1QZZA 3MQ0A 2CFOA 2XPVA 3I53A 1G59A 4ENKA 5M5YJ 2MA3A 4HF2A 2DFHA 2BHYA 2V6EA 4GYIA 3HSFA 3K0LA 2LBFB 1IGNA 2F4MB 1FC3A 2V4JC 3BTIA 3A02A 2NVXJ 2K4JA 2K40A 2ELKA 2WV1A 2K9NA 2QKMB 3LFKA 1K7AA 1J7KA 2OPTA 3NEUA 4ENNA 3KEYA 1O3QA 2QKLB 5K5QA 3CC7I 2XIGA 3JRIA 1T56A 2WTEA 2ZSHB 2F5FA 3BTCA 5AONA 1SVMA 4C3IJ 1Y6IA 3IC7A 1B72A 1LVKA 4ABZA 1PUEE 4BDZA 3F6VA 2WADA 1JUSA 1WJFA 2VKDA 3DPLC 3GX4X 2NOGA 2R3SA 2G7HA 3CF5F 1FOWA 2W57A 4M3BA 2P4WA 3WGIA 2R5ZB 4EEFG 3C2BA 5HDNA 1I39A 4O5VA 3UNGC 1PP7U 3OL4A 1RPWA 4UNOA 3JSPA 4AIDA 5LFAA 2A69F 4BDYA 2VBZA 5E3MA 4UUSA 2GQQA 2M7AA 1BN5A 2JZYA 3C18A 1VTNC 2L02A 2PEXA 2YU9J 1Z1DA 4UVAA 5D5VB 1FBQA 4AC0A 3L2VA 4IEJA 5HNHA 4QPOA 1LQ1A 2CV0A 2E7WA 1OR7A 4EJVA 2HXIA 4F55A 3G1OA 2LNBA 3VYTB 1BJZA 2CUZA 4LB5A 3HOVJ 1R7JA 1IF1A 3D5RC 1WI9A 1WJ5A 1JUMA 5AIQA 2E1MB 3D5SC 5HLTA 2COMA 4HSTA 1GUUA 1MDMA 3FXUA 3BTLA 1VQOI 2IGMA 1MZBA 1QVUA 1RIOH 4ZH4F 3LL7A 3BG6A 2FNAA 2G9WA 2PFBA 5DCMB 4XKBA 2IBDA 1LFBA 4ASNA 1T98A 3GXOA 3IKVA 5L3BA 5K5RA 3CQZJ 4U0WA 2WWYA 3LOCA 3KZYA 4WXHA 1YW7A 2DA5A 2XDVA 4A12A 3LSIA 4BE1A 2DXIA 4PUSA 2DMUA 2VI6A 3NAUA 3ONQA 3JRFA 2HXOA 1N75A 3HHGA 3IH4A 1S8NA 2OCEA 5M3MJ 5BPDA 1WRJA 5FROA 1HXDA 1XSVA 1I50J 2HQNA 4PJMA 2X9DA 3BZCA 4XLAA 5CYVA 2K85A 4FX4A 4P1WA 4EGYA 1A36A 1JT6A 2HZDA 4E4HA 3QP6A 1SFOJ 1U6GA 3LSPA 3BROA 1FY7A 4KYWA 2R7VA 4KFCA 2HVRA 2VOPA 3OYDA 3QYFA 4RB3C 4EQQA 4I6ZA 1XGNA 3F72A 3ZQHA 1A04A 1JGSA 1DGRM 4LOCA 2O61A 2M4GA 2NNNA 3CLOA 1T38A 4BJ5C 3CCUI 5BNGA 3IRQA 4A3FJ 4Y15A 4G6QA 4Q48A 1ZN2A 1KU2A 4XLNF 1KQ0A 1S5LC 2EZHA 5JHUA 5IYCJ 4IKFA 3F3XA 5F27A 2CQXA 2NYXA 2JMWA 1MMAA 2XAFA 2F5EA 3CTAA 5EZGA 4XKVA 1V55H 3G6EI 5BPIA 3G3ZA 5E1WA 4HNTA 2LF8A 3GZNB 1TWFJ 4UV8A 1SANA 3E0JB 9ANTA 3OR2C 3AL0B 5H20A 3LQQA 2RDPA 1BOBA 4A0XA 3L00A 5B66C 3H92A 1SFKA 1VI0A 2X1CA 3OWTA 1XCVA 3RKYA 1JT0A 2P7CB 1UB9A 4JX4A 2CUFA 4D7MA 3BQYA 1UELB 1F4KA 3LNQA 4IO9F 5BQTA 4U0VA 2DK8A 2QQAA 1X1PA 3OV8A 1WVRA 1G6NA 3BPVA 2P81A 5F1RA 5E17F 4B47A 2CUJA 2HZTA 3FXLA 2VT2A 1MNEA 3I0TA 1APLC 4Y17A 1BI2A 4OWRB 3VODA 3H0GJ 3SZTA 5JFRA 2STWA 4UVCA 1MJ9A 3CUQB 3OYLA 5LBQA 2E19A 2FA5A 2KIUA 1VQNI 2ESHA 3TGNA 2QBYB 4MFDA 1POGA 2W85A 3LSKA 3P5JA 4IJAA 4A3KJ 3LSMA 1X1DA 3SEQA 3Q3SA 4RB2C 4DZJA 1T2KA 3H1CA 1FMWA 3AL0C 1O3TA 2HDCA 4HEA2 1E2XA 2A6EF 4XQFA 2ZJRF 4WWCA 2Z9OA 2DBBA 1R71A 2NVTJ 3S1RJ 5EYRA 3QPHA 4XRFA 2F2EA 2UXXA 1WWXA 2W4SA 2AQEA 1IAWA 4Y52J 2IEKA 4BS9A 1O3RA 5IYBJ 2RAEA 3OYGA 4WXCA 5IT3A 2ELHA 5FRMA 1IXSB 2MC3A 2EZLA 3FF5A 4OOIA 5KK1A 4FT8A 4XIDA 4HLXA 1XB4A 2MSYA 5A2QZ 3HOZJ 2Y48A 2XF5A 3BC8A 1IRXA 3L09A 4PJLA 3TW7A 5HODA 3MN2A 3JRBA 3GYHX 2CMPA 4RGUA 3SZPA 5CQGA 2EZIA 4KT6A 2FX0A 2YSRA 1T0FC 3QAHA 3ZQQA 5DYMA 4AIHA 2CWEA 2AQFA 1Z77A 3IRRA 3VPRA 2XROA 1XCBA 4OINF 4U0YA 4YIRX 1UHMA 2CS3A 3CUQC 2MW8A 3OYNA 2K9SA 1YG2A 4F7ZA 5C44J 1YJWI 1OMIA 1X58A 2P0WA 4I7HA 1VQMI 2O6GE 2FQ4A 3MZ8A 3BR2A 2MG4A 2DYSH 2UV1A 1FBSA 1JJ6C 4DBRA 4YFKF 3KP7A 5EZHA 1U8RA 5DTDA 1LNWA 4NBQA 5F04A 1K4SA 3WU0A 1KQ9A 1WHUA 4IHYA 5L3EA 3PJRA 1QA6A 1W5SA 3LSGA 5JVTA 3CCEI 2EH3A 2R7DA 2V9PA 3W6KB 3M4OJ 4PFPA 3E6MA 1XC5A 2LKSA 5FJ8J 1IRGA 1IDZA 3VDXA 1B8IA 2O8XA 2EFPA 3HDDA 4F91B 1F5TA 4CCJA 1UHWA 3FXQA 2IGKA 3CLQA 1XN7A 2Z1DA 5D5XB 2VBXA 4JX6A 4M6YA 4WF2A 4FCYA 1P6RA 1Y8RB 4RB0A 1LEBA 3BLYA 2QEXI 3GZ5A 3DBRB 3FXKA 3HL2A 4AWXB 2F5DA 2GA2A 4G7OF 5EG0B 2GIZA 3QPTA 1J2XA 3CDLA 3TOAA 3S93A 2M45A 4QWQA 1YTYA 3OIQA 2XPWA 1QRYA 4HDVA 2IS2A 2HQAA 1TT0A 3T1BA 1WZ2A 3N05A 2P6SA 2Y75A 4BQNA 4ESJA 3L7WA 1WI3A 3WTZA 2QA4I 4NB5A 1KQ8A 3KEOA 2D5VA 2OV7A 1E0EA 1W4MA 4ZTFA 2BXYA 3KFWX 5E3OA 2ISYA 2BXZA 2FOWA 3FBNB 5J8CA 2EB7A 1Z6TA 2WAQN 1YI2I 1JGGA 3S1QJ 5DS9A 1QU3A 3I4NJ 5F0HA 3CZ6A 4HV6A 4ZYAA 3R4KA 1FSHA 1KYWA 4ITVA 4PFOA 4YG2F 2VN2A 1BI3A 4M71A 1MGTA 4L9NA 1HA8A 2LY9A 3S17J 4A3CJ 1OYWA 3WGGA 3ZMZA 2UWMA 3CP8A 2OC6A 1QHGA 3TKYA 2LRDA 4XORA 5B3SH 3K9TA 3OYJA 2W84A 3HKZN 3QOPA 1JI8A 3KIOA 5FKLA 1MH4A 3JW4A 3CMEI 4XM3A 2X1DA 1ZRDA 2ZB9A 3OYCA 2EBIA 3GFLA 1KU3A 2W25A 2ZXJA 4RAGA 4PZJA 2E5ZA 3HRSA 1B59A 2XB0X 2XPUA 5B1AH 1UJ8A 4YEJA 1ACIA 1VQ4I 2IJLA 2M87A 3SDGA 1I6HJ 1P4XA 5ILUA 3RQ4A 3Q0VA 1FJLA 3CP2A 3ASOH 1LEAA 1Y1VJ 1J9IA 2QCOA 2QWWA 3C3WA 3CCYA 2QBYA 3CJRB 1WJEA 4XL9A 5K7FA 4MHGA 4HBLA 3ZMDA 2XVCA 4LJZF 4RBOA 2L9SA 3G71I 2IP2A 5E3LA 1JKRC 1S29A 3K4KA 4PJ0C 4H0EA 1YRNB 1F9NA 2JA5J 4CYCB 2Y9ZA 5GPAA 3F22A 2OTJI 2A3SA 3I58A 1ZQ3P 1FP1D 4IHVA 2VONA 1I3AA 4O6JA 3CMAI 2ID3A 2DLLA 2NS8A 2HGCA 2NNYA 3K4JA 3EUHC 5LEJA 3OIOA 5J4YA 1OCRH 3S3OA 2E1OA 5J3LA 5E8IA 2DAOA 2CG4A 3V8KA 3ABUA 3H9GA 5CJ9A 4RA2A 1ONVA 1JHFA 1U0JA 4AYBA 3GTQJ 3PSIA 2P6TA 1RR7A 3DPUA 1JKOC 2STTA 1UCRA 3RPQA 2Z2SB 3S32A 2YR2A 4M9XA 1ZK8A 5E3NA 4BEHB 4OIQF 2EFQA 1FZPB 4KDPA 1QHHD 3GCMA 2R7UA 2HYGD 3P7NA 1OPCA 4RLFA 1W0TA 4KT5C 2KRFA 4E7HA 1I3QJ 2E7XA 2PMUA 3G2BA 4RM3A 4XKWA 5LLQA 2P7VB 1K61A 2VUMJ 3IHUA 2HOTA 4DYCA 4F3QA 2OZUA 3OYAA 4IL6C 3IUOA 4K2EA 1KZHA 1SD7A 2DU9A 4MQ9F 3L9FA 4L5JA 1O7LA 1LVAA 3S2WA 5JLXA 2RNGA 1V5GA 2DJIA 4IRIA 4BKXA 3Q0UA 1R5HA 3VB2A 3TEDA 4E7IA 2JA2A 4A5MA 1QNTA 1P92A 2QVOA 4BHCA 4LB6B 4IOCF 4HRIA 3MFKA 2IVMA 2BW3B 4CUGA 4A3GJ 1IRFA 3ZQGA 3A01B 3FXRA 5J1UA 5DDGA 2VL8A 2LKXA 2CYYA 1MDMB 1K6YA 1SMYF 5KAFC 3WTVC 2P8TA 3KP5A 4UXNA 1FNNA 5EG0A 5IP9J 3AAFA 1S7AA 2RGVA 2J5PA 4G6DA 1R58A 2IS1A 1OFCX 1H8AC 1IN6A 1IJWC 2A6HF 2KLOA 1V4RA 4HG2A 2XAQA 3GTKJ 3HRUA 1J59A 1HW1A 4D0PA 3FK7A 4LFUA 3OYFA 1XGSA 3BZ6A 3PQJA 5ILSA 4HQEA 3M1EA 2L4MA 2VOOA 3DBLB 4BXXJ 4W97A 2BY1A 1BR4A 2EA2A 4DYRA 3N4MA 4XLCA 4G9YA 4FTHA 5FKOA 3ERED 3VYRB 1FMVA 4AD9A 4CZCA 3PNVA 1BR2A 1MSFC 3ROUA 5FGMA 3E3VA 4IHTA 2BV6A 2J5OA 2QYOA 5ICEA 2YPRA 3V7RA 3GUDA 2W24A 1MKMA 1IZ1A 1OR7C 3MZHA 2GZWA 1A35A 1U3EM 2BEOA 1RESA 1G2HA 5F0FA 1WKMA 1GDTA 5ERIA 3HRTA 2EIKH 4UV9A 4BY7J 2CSOA 4KA4A 4A3MJ 2VXZA 4Y7NJ 4PSXA 3F8NA 1XMAA 1ZELA 3JRGA 2X6YA 5J40A 2W1OA 3MEXA 3MMYB 4CCLA 4Q4ZF 2ETHA 4B48A 2FEZA 3LSJA 2LP0A 5BMZA 2XAUA 3JTGA 2ADUA 5A2QK 2Y30A 3GTPJ 2EINH 1NG7A 2M5WA 3O3KA 3R6SA 4IQJA 2LR8A 2GOMA 3GF2A 4DW6A 4P5OA 4F52A 1G3TA 5HLGA 3B6CA 3WGHA 2CW0F 4L9VA 3KETA 1AWCA 2BZTA 1FP2A 2PMHA 1EJ9A 4KUMA 2JUCA 1YRNA 3W3CA 4XSZF 4CYCA 4Q5SF 2X6WA 3H5RA 4LLLA 2VXDA 2TRTA 3DU5A 3GO5A 1W5CC 3A2KA 3GBGA 1NTCA 3KZZA 2A07F 3NARA 3U2RA 2DT7B 1ZG5A 1ZLJA 3LA7A 4L9TA 1D8KA 4MLOA 2MBFA 2OU2A 3DBHB 3U1KA 1MMSA 2V7FA 3ZQCA 2L7KA 3PNYA 2Y31A 3S1MJ 5IYDJ 2LF7A 2DI3A 1Y39A 4YIIA 2VQCA 2F5CA 3HSRA 3KZIC 4ZDLA 3TOBA 2VODA 2GXGA 1IO2A 2HKOA 4NC6A 4GXOA 2OAZA 1ON2A 4BEHA 1Z9CA 1A5JA 4IRHA 5CQEA 1BW6A 1N25A 2HI3A 3K69A 4EGZA 3BCAA 2DFIA 3DF8A 3DKWA 2FQ3A 1Z3YA 4BNCA 2LOOA 3O2PE 1EH8A 4MQVA 4HSRA 2DN0A 2JQ7A 3PIOF 2NRAC 4M6VA 1Z21A 3HPHA 4LGWA 4DIQA 4QLCU 2FBKA 2Q2EB 3KX2A 5DM6F 2WY8Q 2A6TA 1PJRA 1Q1VA 2DA1A 3OMYA 1LDKB 2DK5A 4D5CA 4JX5A 4FASD 3WTUC 1YX3A 2Y2ZA 3A0BC 4XR6A 2O5RA 3MD2A 3ZR8X 2FUG2 4AVPA 3CCVI 3IP4B 3MKZA 2ZXIA 2CQNA 1W7PD 2G7UA 3FK6A 5LRSA 1YFHA 3C1DA 4HA8A 4HF0A 2MYSA 2EIMH 2FU4A 2K3FA 1DQUA 2BW3A 3S2HJ 1RZ4A 2M8EA 2LK2A 2VBWA 4A0YA 3A01A 1Y1WJ 2PN6A 4BBSJ 1F36A 1S7OA 2ZFUA 4GO1A 3SYTA 3T8RA 4G7ZF 3P9IA 3RPUA 1TTYA 4A3IJ 2B9SA 5TGTA 3KLOA 3B73A 4N4OB 2XKOA 3ZPLA 3RDIA 1PUFA 5ILVA 2BY2A 1W0UA 2GIVA 2M3AA 4EM0B 2RQQA 2ZFWA 2RKHA 1FTZA 2DCEA 2Y0SA 2FNPA 1MBFA 2RVCA 5DUKA 3A03A 4IZZA 4QTRA 4LITA 1LE8B 3IH2A 2YX7A 2HQRA 1IV6A 2EV5A 1K4TA 5ICGA 2O7OA 3BOQA 4M9SA 5HS9A 2DA7A 3TP3A 1HBXG 4N9HA 3EQLF 4R8HA 3KP4A 4A0ZA 4HX8A 4BBRJ 1HC8A 1SVOA 4ZC3A 2OD5A 2MD0A 5EDNA 1X3ZB 4ZDPA 2QSGX 1E3PA 4LD5A 3FIWA 5HVQC 3FXOA 1R4NB 4HNUA 2KIMA 2E1CA 1XD7A 2LREA 1QPIA 3GTMJ 4FQGA 3PL8A 4L5EA 5LHIA 2VKHA 1RI7A 4OMYA 4EV0A 3E7LA 1B8IB 1G3WA 2IS4A 3W2VA 1FIAA 2IA1A 2B7EA 3EYYA 4E7JA 3JREA 1SVLA 3F0CA 4QSHA 3ECHA 1VQLI 2KPMA 2Z3YA 1ZR2A 1QBJA 1FTTA 1UMQA 1A31A 2IAIA 4IHWA 5E20A 4ETSA 2ZNYA 2NXNB 2F5VA 5FKNA 3BJ6A 5GADJ 4EJUA 1H88C 3TW6A 3RPUD 3F8BA 5CLSA 5HDGA 1BA5A 3R60A 3OYMA 4I02A 3QPSA 4BE0A 2DA4A 3BJAA 4WX9A 3OYHA 1MIJA 2ZSIB 3ERMA 1OCOH 3K2ZA 4UY8I 4YRVA 4JBAA 2D2WA 4NC8A 4Y13A 1ERDA 4F92B 1B9NA 1GHCA 5LHHA 5C4JJ 3CMMA 1R5GA 4H4KC 2VBYA 3LA2A 3A0HC 2CV1A 2JSCA 2R7XA 4JQFA 1YS7A 4AIJA 1TWGJ 3GFJA 1UAAA 4XLHA 3WG9A 5E18F 3RCOA 3CJQB 2R7RA 3H9JA 1MJBA 4XSXF 4MFEA 5TJJA 2M9HA 1IN8A 1B6AA 1G3SA 1TNSA 4IXAA 3HRMA 1EKEA 1YOVB 4NNJA 3FM5A 4D9JA 4PK4A 4I98B 2EFNA 5D4RA 3W6JB 5JHFA 2NVQJ 2N8GA 1LKXA 2L54A 3KEQA 1Z7UA 4I09A 4RAYA 3Q0WA 3ZOBA 3MKLA 3VSKA 4XNFA 1JKPC 4RDUA 2FD5A 2OUMA 4A3JJ 3I71A 3OIPA 4HLYA 1R49A 1WJBA 3CCMI 2O9LA 1YW8A 2DMQA 1HOMA 1YO5C 3T0YA 5C3EJ 3DFGA 2NS7A 4TV7A 1LPQA 2DPDA 2Q2EA 2ECBA 3BY6A 1WJDA 1DUXC 3HB9A 3ZMTA 3OOUA 1WH5A 2QM3A 4CSWA 1HKSA 1T33A 2MC4A 1W36D 2KJBA 4LIUA 1ITYA 1CF7B 4R1HA 1FX7A 2UUZA 5D8KB 1Z05A 4C3JJ 3OYIA 3K70D 3GFMA 3SZGA 1XX5A 1QGPA 3R0AA 2YX4A 3HPGA 1GVJA 1QQIA 2K02A 3E97A 2M7BA 4LK0F 3IL2A 3IWFA 3DP7A 1HCRA 2JSPA 1MSEC 3ZQIA 1JHHA 2QSFX 5F1JA 1VQPI 2K9MA 3FDYA 1YX5A 1BIAA 2OQGA 1RKWA 2LKPA 2X6XA 4O3MA 4V2GA 2KFDA 4P9FA 2H6BA 2RNJA 1FLIA 1ETXA 1YJNI 2K5CA 1BOAA 4LIVA 1IN5A 3C2GA 4JK1X 1FOXA 5ICCA 1ULYA 3E1SA 2IA0A 1TC3C 2KKOA 3IH3A 4MO7A 4PGHA 4V2FA 3ML6A 2W7NA 2OBPA 1LE8A 1FOKA 4L0YB 3HZJA 4HX7A 1OCPA 2VJIA 1I6XA 4FE7A 3CO6C 1F43A 5HLHA 2FE3A 3BR5A 3BR3A 1XMXA 3DQVC 2FJ1A 4KN4X 4DOZA 2E2JJ 1FEXA 2ESNA 1KU7A 2FF4A 5M5XJ 4YIFA 2P5VA 3BTJA 2L9VA 2WB1A 1D1AA 4BQQA 3I9V2 5E8GA 1ETYA 2DTZA 3DTKA 3EDPA 4CH7A 2HVQA 4E70A 4A3EJ 2E2HJ 3ZCOA 1FBUA 2DJNA 5H2FC 3WG7H 4KIGA 1QO0D 5AIPA 5GP9A 4A6EA 2NOJB 4BYYA 5J47A 3WHCA 4ENJA 1LUJB 3HJEA 5CVRA 3KP2A 1USSA 1XG1A 1Y56A 2PBIA 2OJED 2HOSA 3S14J 4XRMA 2KZGA 2PQ8A 1JE8A 4D1QA 2R7TA 2ZMEB 4JP0A 3VYSB 4WK8F 5LRRA 1FOYA 2PI0A 3L2CA 2VQHA 2AO9A 2G0EA 4QPQA 2F48A 4KNYA 1T95A 2JTVA 4ZJZA 4GFBA 5TRDA 1G3YA 2WBMA 5D5WB 5ED4A 3OL3A 2R7FA 4ESBA 3RI4A 1Z91A 1R1UA 3DXJF 4I2OA 2ACJA 4C3HJ 2E5NA 2H09A 2CUEA 3FKIJ 4MGRA 3JCUC 5BS6A 2DODA 1D5VA 2M0CA 4UHTA 4KN7X 2VC0A 1X4OA 2KZVA 3EYIA 1XGMA 3PUFA 3AKZA 3MKWB 4MNUA 2H8RA 5CKTA 3HOUJ 3GWZA 5K5OA 1TWAJ 3GZ6A 1ZTRA 3HBLA 2VKEA 2ZKZA 1LJ9A 2ME6A 2E1NA 3BR0A 3H5AA 5FKKA 4MIMA 3CUOA 3EUKL 5GAEJ 1U5TA 1YJ9I 2R7WA 1KONA 3QYBA 1HDPA 3K7AJ 3G1LA 3E6CC 4Z6YA 1VNDA 2ZJPF 2EQRA 2ME0A 3LA3A 5HDKA 3V8LA 1WJAA 3K4CA 3WTYC 2B0LA 2XAHA 3T8TA 1ZKGA 2LFBA 4ANJA 4BQAA 1XDSA 5DEQA 2MH2A 3OY9A 2XF7A 4CO8A 4RS8A 2AXLA 2R5YB 1JTXA 4MEYF 3I55I 2ZO4A 4UB8C 2ZMEC 3BZKA 1R5ID 1M1EB 2XRNA 4IQ4A 4D5FA 4I01A 3QU3A 2DOEA 3KP6A 1TP4A 1RRJA 6PAXA 2FSWA 1MJAA 1SMTA 4IF4A 3I4MJ 3AG1H 2ZXWH 2EILH 1IN4A 2KL4A 2GOXB 4ZYHA 1LDJA 2LDUA 2TCTA 2KJCA 3WE2A 4BE2A 3M8EA 1ZG1A 1GV2A 4E7KA 1KU9A 3FMQA 2L7ZA 1NH3A 3L2QA 1W7PB 4CYDA 2IA2A 1ZAOA 4RB1A 1J5YA 1CF7A 3MAJA 4KITB 3CJNA 3QOEA 3GLLA 3V42A 3PM1A 3FHZA 4W1UA 2R93J 1D0XA 1MW7A 3TDUC 4XOPA 1SFEA 4M6XA 4EJOA 3ISPA 5J1YA 3O8HA 3EUAA 3O8GA 3W2WA 2PG4A 2VE8A 1SAUA 2BGCA 3IKTA 3QU6A 2PMZA 3L2UA 4IHXA 2EK5A 3E6BA 2VLAA 3TDZC 5EEGA 2FXAA 2DMPA 2K9LA 3K10A 1H89C 1ON1A 1ZARA 1S3JA 2X4HA 1HLVA 1UZCA 5KAIC 3OSGA 3VWBA 1W5TA 1ZYRF 4YFNF 3K4BA 4GRIA 2YU3A 1OCZH 3ZQ7A 1R23A 2DMNA 2FBHA 4XLEA 2BVLA 1ZLKA 2MD5A 3F21A 2R0QC 2E71A 2CRGA 3F9KA 2CH0A 2QENA 1U8BA 2UZKA 1K79A 1Y8QB 5FB2A 1SFXA 3IAS2 1IG7A 3CCLI 1O3SA 3HIFA 3MCZA 2VE9A 4ZZLA 4NDLA 2E2IJ 3BWGA 1HW5A 2HYJA 3LQRA 2VPLA 1R6RA 1V5FA 2ZJQF 4J01A 3C7JA 3SQNA 4KMUX 1LB2A 2QQ8A 1TQMA 2O8KA 1BJAA 4DQ2A 3P9CA 4DZPA 1I5ZA 5DD4A 2NVUB 1BI0A 1DU6A 3GVAA 3ZRGA 2L9NA 3BCBA 5CVIA 4AYBN 1XPXA 1MMDA 1OISA 3K2AA 3V4GA 3LAJA 4ON0A 1DP7P 4HYEA 2JUGA 3PUBA 1X3UA 2W48A 5J8FA 2PJRB 2LLKA 1I27A 4UUVA 2NS0A 2HKXA 2ZMEA 5F64A 1IV8A 1WSUA 4XOTA 3BR1A 1L3LA 1X19A 1FYLA 1OKRA 4L5IA 4II2A 2EJRA 2IW5A 2XASA 4FE4A 3JRHA 1JJ8C 3BP8A 3A4CA 1PUFB 3D1NI 4HZFA 4BY1J 2MH9A 3H36A 3L1PA 3OS0A 2K7LA 1IN7A 4FISA 2LH9A 2M30A 4HOBA 3DKXA 1ZR4A 5E1ZB 3V8JA 3LSRA 3VOEA 5J1RA 4ENMA 2A5WA 2H6CA 2H1LA 4XBFA 1ODDA 1RETA 2XGEA 3HYIA 4M3FA 4J19A 5FFXA 5D4SA 1SD4A 4C30A 1QPMA 1YS6A 5M5WJ 2XC7A 1BI1A 2YS9A 3TBIA 3ZQFA 3S16J 2LVSA 5IT9Z 4UVBA 2EA4A 2DW4A 2CO5A 1K78A 3P9KA 3MKYB 1IUYA 1QVTA 2HDDA 1ETOA 5HLIA 3UKGA 3TO7A 2X6OA 2P5KA 2JPBA 2HPIA 2QLZA 4ZDOA 2HTJA 1J0RA 1FIPA 1TBXA 5D6FA 1H0MA 3G4SI 4A3DJ 1ENHA 2MLKA 2R5YA 1F1ZA 3LWFA 4GYGA 4E7ZA 4CCKA 2JRTA 3C2HA 4RAZA 4IHSA 2FMYA 1XSDA 5HOOA 1OLTA 5H6QA 1FPQA 3G1MA 1U2WA 3S2DJ 2EFOA 2ELJA 3R61A 3NRVA 1SD5A 3PQKA 1SFUA 1J75A 3WU2C 4ZZDA 3WU1B 1D1BA 1IC8A 2OCCH 1Z67A 3J81Z 3D5LA 5GPCA 1XMKA 4HPQA 4B3XA 3ECOA 2KQRA 2EFWA 3K1PA 4BXFA 4KICA 4AIKA 2HNHA 4LLGF 2OZ6A 5LEKA 3S3NA 1W7PA 1P4AA 3E6DA 5BOXA 3BG5A 3VSLA 1DU0A 4XN3A 4AM3A 4NQWA 2HOAA 4YELA 4HV5A 4PGGA 3GFIA 2L7MP 1FSEA 3H3UA 3KPHA 1EF4A 5CVUA 2XAJA 4OIRF 3WTWC 4PDKA 1YE9A 1ETWA 4D7NA 1VQ9I 2IS6A 1TQIA 2ZJ2A 2EWNA 4DJAA 3ESWB 1MMGA 2LY1A 4RGXA 3RYPA 1JUPA 2XGCA 5K7ZA 2R7SA 1LFUP 2VKVA 3J80Z 4P9UA 2M8GX 1HF0A 3QWLA 3BT9A 3LSTA 4A5NA 5LHGA 3QYEA 5C4XJ 3CESA 1V5EA 2BYVE 2GXAA 1S7EA 2KDOA 3I54A 5KNLA 2XV4S 5FO5A 2QSHX 2D1VA 1P9QC 2AXTC 3AG4H 4B44A 1JXSA 3OS1A 1MBEA 1TNTA 1Q1HA 3FXJA 5CPRB 1U9OA 4M74A 3AFHA 1NK3P 5FD5A 3HUGB 2HOEA 2VQLA 5FLMJ 1KGSA 1B1BA 1YLFA 5KVRA 4EJWA 1S6LA 3G73A 4BHBA 1W36C 2ZC2A 3WODF 3OSFA 1PDNC 1RC9A 2V6CA 3VFZA 3K70C 1EV7A 2K27A 3M3YJ 3PFIA 1BC7C 3JRAA 2OA4A 1TW3A 1TL8A 5DCFA 2PLYA 2XSJC 2NAZA 3HSEA 1B9MA 4G8XA 3IV5A 2LY2A 1T08B 2C6YA 4V19K 1NHAA 1U9NA 2A61A 2HU9A 2WV0A 3CDIA 4EM1A 3BDDA 2PJRA 1ZGAA 1BBYA 1PP8F 1BM9A 2DT5A 2WA0A 3HTSB 2KMUA 1SAXA 1MBKA 2XGDA 3ZMVA 2BHZA 1X4PA 4RMNA 3FZVA 3S8PA 2M34A 3ABMH 1D0YA 3U1DA 3CC2I 1YITI 5EGOB 2CJJA 3I4PA 3LSHA 5IOZA 1UFMA 1HSTA 1GVDA 2ZXHA 2Q0OA 4CICA 2VASA 3SXYA 2KIFA 3CMYA 3BR6A 1ZG3A 2BY0A 2V26A 2HS5A 2OTLI 2QQ9A 3O6BB 3QRFF 1N77A 3FISA 3SFZA 2LD5A 5IPAA 3Q9SA 4NC7A 2CQ7A 2RREA 1GV5A 3ZMSA 4J00A 2M2EA 3I5UA 1TWCJ 5D8LB 1ORKA 2RC4A 3DTIA 3W2AA 2ZBKA 3RKXA 4DBQA 1XS9A 1Y0UA 3NQOA 5GAGJ 2VC1A 2PJPA 4IVNA 3CD6I 2TDXA 5GTIC 1T8IA 4FHTA 3B6AA 1JKQC 1UHSA 3J7AO 2I8DA 1KYZA 2BVMA 3ABTA 4OIOF 2D1HA 2VQGA 3K1MA 2VT3A 4Q47A 1OQYA 2JVGA 3U21A 4PJJA 5D5UB 1LFPA 3FHNA 2Z33A 1D1CA 5FLVA 3QODA 2CQKA 2L9RA 1P7IA 2NVYJ 2V79A 3FMRA 3MWMA 3NWTA 1H9GA 2DPUA 1AOYA 4ZYGA 3R0JA 1NK2P 2Y0SN 1ZH5A 5LGTA 1O7FA 2QF7A 4GGGA 3BQZA 2Z99A 2DQLA 1AU7A 4C9YA 3SHFA 1WJCA 3F8CA 1AKHB 3BG9A 4HAMA 4M3EA 3OS2A 1LDDA 3N97A 2CV2A 3Q5FA 1TT5B 3KYLA 3CJTB 3ZMUA 3H3VK 2JN6A 4BUPA 5IOYA 4C2TA 5LGNA 2JWTA 4L18B 2CW7A 2E1MC 3H3ZA 4WXDA 3OR1C 3DPTA 3CCSI 4BHPA 2QUFA 1OCCH 1ZGWA 1E3HA 1HKQA 3ABLH 4A6DA 4N4NB 3HHHA 4E7SA 4IRGA 3JAMZ 2MLGA 2LSOA 2ZCWA 1U5TB 1ZRCA 2QGUA 4Y4RA 1UG2A 3H35A 4HW0A 1ZGJA 4P96A 3J7ZI 2GXBA 2WAEA 3RKQA 4UUTA 1XGOA 3DV8A 3ZQLA 1DP3A 3DEEA 1IW7F 4U7DA 3AG2H 1BC8C 1HW2A 1GLNA 2M0MA 2IRFG 1G4DA 4A93J 1MMNA 4B1RA 2EPFA 3RJPA 4BACA 3LFUA 4M3GA 3JR9A 4L9JA 2O0YA 2IGOA 1DGWY 2MFZA 4QIWN 2L2OA 1ZHFA 4A3BJ 2LBFA 1V3FA 4OAYA 1VQKI 3HXLA 3DLLF 4L0ZB 4KJZA 1Z0XA 4GCVA 2X48A 4X0GA 3PNTA 3ZGKA 5GAHJ 1YHQI 3F8MA 4BH9A 2DA6A 4G12A 1U78A 2ECCA 4XN0A 4CHUA 5HS8A 2V1DA 3B02A 3HGYA 2XB5A 1R36A 2MGQA 3HOTA 4UB6C 3LAPA 4BJTA 2DFEA 3PO3J 1VZ0A 1PYVA 3PIPF 3OOPA 1T6SA 1FT9A 2EV0A 2JK3A 3DLAA 4JOMA 2KISA 1D3YA 1S9HA 3SFIA 2HTSA 3X2QH 3HUGA 5GTHC 3HGGA 3FBIB 4XONA 3ASNH 3GTOJ 4EVIA 1A6IA 5JI6A 5K7HA 4HQMA 5FLXZ 4JYKA 1D8JA 3TMOA 4HNVA 3RTRA 2VJJA 2R5ZA 4U87A 1XSXA 2VJ4A 4DNCA 2AS5F 1BR1A 4U7BA 2B63J 3F6OA 1B4AA 1YW9A 4I0AA 3M8FA 5B5EC 2HYFA 1ETQA 2DOFA 1U5TC 2LG4A 1VQ5I 4HX4A 3ZN0A 3MZYA 4RGSA 5HNFA 5H6RA 5M3FJ 4DYQA 3KLNA 1P7JA 4LK1F 4MEXF 3S3MA 3FXMA 2XHKA 2KRCA 1PVEA 1N78A 4ZYDA 2XSDC 2W00A 2FBIA 4OAZA 3CC4I 2HVSA 2R7OA 2M1BA 1JTYA 2EZKA 2WY7Q 4KIBA 1AA7A 5IP6A 4II3A 5IT9K 5FRNA 4M9ZA 4C2MJ 4NUBA 2F4IA 3A1YA 5EGOA 4RM2A 3LMMA 3HTUA 2DA2A 2ZNZA 1CQTA 3GEZA 3D0SA 2A68F 3SDBA 2KRHA 4F93B 3BG3A 4AUXA 5JVGF 2VB6A 4ESFA 1RUNA 4CXFA 2RN7A 2ICWG 3RIRA 4S04A 4A3LJ 4PSWA 2IPQX 1Z3XA 1CGPA 1QZYA 1K83J 2BOLA 2L0KA 4CGZA 2FMLA 2JA8J 4AU7A 4IOAF 2DT6A 3ELKA 4B09A 5DCMA 2DFFA 2D45A 2XKPA 4G7HF 3ZP5A 4E7LA 5LD2C 3HOXJ 1MNDA 1EA3A 4AVZA 1YQAA 1DPRA 1MNMC 3DU6A 4XLFA 1IXCA 1X1AA 1MBJA 2GA1A 5FKMA 3J7AY 2FOKA 1YYVA 3J81K 5FD6A 3QQAA 3JSOA 3ZN1A 3L2RA 3DKYA 5EJCA 2VPRA 2R7QA 2HEOA 2MABA 2Q1ZB 5DUIA 2IXSA 4KMFA 2L7FP 3K6GA 4Z2YA 5L3DA 1ETKA 5J6XA 3JTHA 5IY5H 3DWLE 2L5QA 4X1EA 2X0LA 3T5XA 2ISZA 1HKTA 3PSFA 2GBYA 2OF7A 3JRDA 2I5UA 4M72A 1E17A 2KP6A 3K4NA 3H0DA 1AKHA 3I3LA 3FMSA 1R00A 2WAQA 3CDHA 2QZ8A 2LMDA 3RSNA 2A05A 4M3DA 4OMZA 3H9QA 3WTSC 2WB1N 3ULQB 4E6KG 2KT0A 4I99C 1TQPA 2K4BA 3M07A 3PO2J 3J80K 2KDZA 2CGPA 1D0ZA 1XTAA 2V9VA 5F0CA 3HEFA 5L3FA 1ZREA 2GLOA 1MBHA 2H8WA 3RYRA 3UR3C 1FYMA 2H94A 1STZA 1TW2A 1Y0NA 3DEUA 2L01A 1YIJI 4WCGA 2Z5UA 3HKZA 4PJNA 4RAFA 5K1YA 3KE2A 1T39A 1VF9A 4EATA 5FFZA 3JRCA 1OYIA 1X3WB 5KHDA 3M1CA 2BY3A 1K78B 4N9IA 2HDWA 4G94A 1OYYA 4C2UA 2HQ5A 4BU2A 4XK4A 2GWRA 4Y33A 4EMSA 1R22A 2A5YB 2HR3A 5HS7A 1WH7A 3J7YJ 1X1CA 1R1TA 5CVVA 3S1NJ 3I64A 4X6AJ 1USTA 3E5QA 3ZXSA 4G6TB 5CVJA 2R7ZJ 4LG0B 1A6QA 4XLPF 1RNLA 4R79A 4BQOA 2UXNA 5TISC 5IP7J 2GAUA 3GTJJ 1T0FA 2DDBA 1GXPA 2QQBA 3DEWA 3IWZA 4HDUA 4OIPF 3MVPA 3HM5A 2IGNA 3QPLA 1IXRC 2AHQA 1RR8C 2X1EA 1X1BA 4BGDA 3WTTC 2HPMA 2EV6A 2PX9A 1ETVA 3I59B 3FWEA 3CUQA 2JT1A 2BBYA 3HC7A 1X2NA 2XAGA 4FETA 4XRSA 4NQWB 2DDAA 2V1XA 4CCNA 2R4GA 1EH6A 3L2WA 3GTLJ 1DPUA 4I0BA 2CU7A 2W82A 5EEAA 3SJMA 3QP5A 2L3DA 1S72I 3E5XA 3WE3A 3OYBA 3W6VA 1HDDC 1BW5A 2E36A 2F4OB 1TLHB 1J09A 5DD8A 3CCQI 3E5UA 4NHJA 4HF1A 3M9AA 1VQ6I 1G8XA 3I56I 2E34A 1NG6A 2VIXA 3DCFA 2RQPA 3KP3A 5KCMA 1XDUA 5J4VA 3AG3H 3HG9A
chains in the Genus database with same CATH topology
5C44J 5EF6A 1ZR2A 1X58A 1FTTA 1UMQA 2IAIA 2FQ4A 4IHWA 2HOAA 3BR2A 2MG4A 1JJ6C 2L7MP 5FKNA 2Y9YA 5EZHA 1H88C 3TW6A 1EF4A 5DTDA 5F04A 1WCMJ 1BA5A 1B72B 1ETWA 3QPSA 4D7NA 2DA4A 4IHYA 2COBA 3LSGA 2EH3A 2CQQA 3M4OJ 1JUPA 2XGCA 5K7ZA 1XC5A 5FJ8J 1VFCA 1LFUP 1IDZA 2VKVA 5C4JJ 1B8IA 3HDDA 2M8GX 1HF0A 2DA3A 2PMZN 3BT9A 2JJ7A 5C4XJ 4JX6A 4FCYA 1S7EA 1MH3A 4UUSB 1TWGJ 5EG0B 2XRLA 1MBEA 3CDLA 1U9OA 2XPWA 1QRYA 5JLWA 1NK3P 3HOYJ 1IRZA 5FLMJ 2H1KA 4MFEA 2GM4A 2M9HA 1WGXA 1WI3A 1R9TJ 1IDYA 2D5VA 3OSFA 1E3OC 5E3OA 3M3YJ 4B4CA 2NVQJ 3JRAA 2N8GA 1GT0C 1JGGA 2WAQN 3S1QJ 5DS9A 3ZOBA 3Q0WA 3I4NJ 3MKLA 1TWHJ 5F0HA 4S0HB 3IV5A 1JKPC 4A69C 4RDUA 2JA6J 1U9NA 2FD5A 4A3JJ 2K9QA 2O9LA 1HOMA 2DMQA 2DMTA 1D5YA 2LY9A 5C3EJ 3S17J 1X2MA 2NS7A 4A3CJ 1MBKA 2ECBA 2XGDA 1RKTA 5F08A 2R92J 3HB9A 1OJLA 3OOUA 1WH5A 2M34A 2ID6A 3HKZN 1T33A 3RZOJ 3GTGJ 5FKLA 2CJJA 5EGOB 1MH4A 2ZB9A 1ITYA 5IOZA 2EBIA 3TP0A 1GVDA 4C3JJ 3CMYA 2XB0X 3BR6A 2XPUA 1IUFA 3SDGA 1I6HJ 3WHBA 3FISA 3Q0VA 2LD5A 5IPAA 1FJLA 2YUSA 1Y1VJ 4B3AA 1GV5A 1AHDP 1HCRA 2M2EA 2QCOA 1TWCJ 1MSEC 3CCYA 3ZQIA 3HOWJ 5F1JA 1ORKA 5K7FA 1MBGA 1XS9A 1RKWA 4RBOA 5E3LA 1BL0A 1JKRC 4V2GA 1YRNB 3B6AA 1WPKA 1JKQC 1UHSA 3S15J 2JA5J 4CYCB 2JA7J 2Y9ZA 1ETXA 5GPAA 1TC3C 4I76A 1ZQ3P 5FLVA 4IHVA 2L9RA 3IH3A 1P7IA 2NVYJ 4MO7A 4V2FA 1LE8A 2ID3A 2NS8A 3RZDJ 1O4XA 1OCPA 2Y0SN 1NK2P 3OIOA 2QF7A 4FE7A 2E1OA 4XRSG 3BQZA 5J3LA 1F43A 3RQIA 1AU7A 3BR5A 3BR3A 1FEXA 2FJ1A 1AKHB 2E2JJ 3BG9A 4M3EA 5M5XJ 3BTJA 3GTQJ 1OCTC 4XICA 1ETYA 2DTZA 1RR7A 1JKOC 4A3EJ 2E2HJ 2I10A 2LTPA 2DJNA 3H3VK 2XPVA 1ZK8A 5GP9A 5E3NA 2JN6A 5IOYA 3WHCA 5M5YJ 2JWTA 1XG1A 1W0TA 2HOSA 1IGNA 3S14J 4XRMA 1ZGWA 3BTIA 1I3QJ 3A02A 4JP0A 1K61A 2NVXJ 2VUMJ 2HOTA 2K40A 2ELKA 2WV1A 2K9NA 4DYCA 2OPTA 2AO9A 1UG2A 2G0EA 3RKQA 4UUTA 3JRIA 1T56A 3BTCA 5JLXA 4QSHA 4GFBA 3ZQLA 4C3IJ 1B72A 4BKXA 4ABZA 3Q0UA 3TEDA 1JUSA 4C3HJ 4A93J 2NOGA 4B1RA 2CUEA 3FKIJ 4M3GA 3JR9A 4M3BA 2M0CA 2R5ZB 4QIWN 4A3BJ 4A3GJ 4EEFG 3C2BA 3ZQGA 2H8RA 1Z0XA 3HOUJ 2X48A 3A01B 1TWAJ 5J1UA 2LKXA 1ZTRA 1RPWA 2DA6A 3HBLA 4G12A 2VKEA 1U78A 2ECCA 2ME6A 5E3MA 3BR0A 5FKKA 4MIMA 3HGYA 4UUSA 2XB5A 2MGQA 5EG0A 1HDPA 3K7AJ 3G1LA 5IP9J 3PO3J 2JK3A 2YU9J 1VNDA 4AC0A 1OFCX 3SFIA 1H8AC 4IEJA 2EQRA 2ME0A 1IJWC 3HGGA 3GTOJ 3GTKJ 1A6IA 5K7HA 2HXIA 3FK7A 1ZKGA 2LFBA 4JYKA 4HNVA 3G1OA 4BXXJ 2R5ZA 4W97A 1BJZA 2R5YB 3HOVJ 1JTXA 4DYRA 2B63J 1JUMA 4FTHA 5FKOA 1GUUA 1ETQA 4D5FA 3BTLA 1MSFC 5M3FJ 4DYQA 1QVUA 1P7JA 3I4MJ 2IBDA 1LFBA 2XSDC 2TCTA 1JTYA 2EZKA 1RESA 1G2HA 5IP6A 3CQZJ 5F0FA 1DU0A 1GV2A 3LOCA 4C2MJ 2DA5A 5EGOA 1GDTA 2L7ZA 2DA2A 2DMUA 4BY7J 2VI6A 3NAUA 1CQTA 3JRFA 4A3MJ 2HXOA 4Y7NJ 3IH4A 3JRGA 3BG3A 3PM1A 4W1UA 4AUXA 5M3MJ 2R93J 4A3LJ 1I50J 2X9DA 5J1YA 3LSJA 1K83J 2LP0A 3O8HA 3O8GA 2L0KA 1JT6A 2JA8J 2Y30A 3GTPJ 1SFOJ 3LSPA 4IHXA 2LR8A 4DW6A 3HOXJ 3B6CA 4I6ZA 2DMPA 1MNMC 1H89C 3ZQHA 1MBJA 1HLVA 1YRNA 4LOCA 3OSGA 5FKMA 4CYCA 2TRTA 5BNGA 3QQAA 4A3FJ 2DMNA 3GBGA 1NTCA 2VPRA 2EZHA 5IYCJ 2R0QC 3NARA 2CRGA 5F27A 1U8BA 2CQXA 2JMWA 2L7FP 4MLOA 1ETKA 1IG7A 5EZGA 4X1EA 4NDLA 2E2IJ 3ZQCA 1TWFJ 2GBYA 2HYJA 2OF7A 3JRDA 1SANA 9ANTA 2Y31A 3S1MJ 1AKHA 5IYDJ 2O8KA 4DZPA 1DU6A 4M3DA 1VI0A 1JT0A 2WB1N 4AYBN 1A5JA 2KT0A 3K2AA 1BW6A 2CUFA 2HI3A 4JX4A 3PO2J 4D7MA 3BQYA 2KDZA 3LNQA 5F0CA 3HEFA 2W48A 2GLOA 1MBHA 2LLKA 2DN0A 3BR1A 4M6VA 2P81A 1VF9A 4FE4A 3JRHA 1JJ8C 1Q1VA 2DA1A 1PUFB 3JRCA 4D5CA 1APLC 4JX5A 3D1NI 2Y2ZA 2HQ5A 4BY1J 4XK4A 3L1PA 3H0GJ 4FISA 1ZR4A 3FK6A 3LSRA 1WH7A 5J1RA 2E19A 3S1NJ 3S2HJ 4X6AJ 2LK2A 4MFDA 1POGA 1Y1WJ 3A01A 4BBSJ 4A3KJ 1F36A 1RETA 2XGEA 4M3FA 4J19A 2R7ZJ 3Q3SA 4A3IJ 5M5WJ 4DZJA 2YS9A 3ZQFA 3S16J 2LVSA 5IP7J 1PUFA 3GTJJ 1W0UA 2NVTJ 3DEWA 3S1RJ 1QVTA 5EYRA 2HDDA 1ETOA 3MVPA 3HM5A 3QPLA 1FTZA 1MBFA 2AHQA 3UKGA 2X6OA 3A03A 4Y52J 4QTRA 2IEKA 1FIPA 1ETVA 3IH2A 5IYBJ 1LE8B 2RAEA 1IV6A 4A3DJ 1ENHA 1X2NA 2EZLA 2R5YA 4XRSA 2O7OA 2DA7A 3TP3A 4XIDA 2MSYA 3GTLJ 3HOZJ 3G1MA 4BBRJ 3S2DJ 2CU7A 5EEAA 3SJMA 3TW7A 5HODA 3MN2A 3JRBA 5EDNA 2EZIA 2FX0A 3FIWA 3W6VA 1HDDC 1BW5A 1IC8A 3GTMJ 1QPIA 1Z77A 4L5EA 3VPRA 3E7LA 1B8IB 5GPCA 1FIAA 3DCFA 3JREA 2MW8A 3F0CA 2K9SA 3BG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 J;  5EF6 A;  1ZR2 A;  1X58 A;  1FTT A;  1UMQ A;  2IAI A;  2FQ4 A;  4IHW A;  2HOA A;  3BR2 A;  2MG4 A;  1JJ6 C;  2L7M P;  5FKN A;  2Y9Y A;  5EZH A;  1H88 C;  3TW6 A;  1EF4 A;  5DTD A;  5F04 A;  1WCM J;  1BA5 A;  1B72 B;  1ETW A;  3QPS A;  4D7N A;  2DA4 A;  4IHY A;  2COB A;  3LSG A;  2EH3 A;  2CQQ A;  3M4O J;  1JUP A;  2XGC A;  5K7Z A;  1XC5 A;  5FJ8 J;  1VFC A;  1LFU P;  1IDZ A;  2VKV A;  5C4J J;  1B8I A;  3HDD A;  2M8G X;  1HF0 A;  2DA3 A;  2PMZ N;  3BT9 A;  2JJ7 A;  5C4X J;  4JX6 A;  4FCY A;  1S7E A;  1MH3 A;  4UUS B;  1TWG J;  5EG0 B;  2XRL A;  1MBE A;  3CDL A;  1U9O A;  2XPW A;  1QRY A;  5JLW A;  1NK3 P;  3HOY J;  1IRZ A;  5FLM J;  2H1K A;  4MFE A;  2GM4 A;  2M9H A;  1WGX A;  1WI3 A;  1R9T J;  1IDY A;  2D5V A;  3OSF A;  1E3O C;  5E3O A;  3M3Y J;  4B4C A;  2NVQ J;  3JRA A;  2N8G A;  1GT0 C;  1JGG A;  2WAQ N;  3S1Q J;  5DS9 A;  3ZOB A;  3Q0W A;  3I4N J;  3MKL A;  1TWH J;  5F0H A;  4S0H B;  3IV5 A;  1JKP C;  4A69 C;  4RDU A;  2JA6 J;  1U9N A;  2FD5 A;  4A3J J;  2K9Q A;  2O9L A;  1HOM A;  2DMQ A;  2DMT A;  1D5Y A;  2LY9 A;  5C3E J;  3S17 J;  1X2M A;  2NS7 A;  4A3C J;  1MBK A;  2ECB A;  2XGD A;  1RKT A;  5F08 A;  2R92 J;  3HB9 A;  1OJL A;  3OOU A;  1WH5 A;  2M34 A;  2ID6 A;  3HKZ N;  1T33 A;  3RZO J;  3GTG J;  5FKL A;  2CJJ A;  5EGO B;  1MH4 A;  2ZB9 A;  1ITY A;  5IOZ A;  2EBI A;  3TP0 A;  1GVD A;  4C3J J;  3CMY A;  2XB0 X;  3BR6 A;  2XPU A;  1IUF A;  3SDG A;  1I6H J;  3WHB A;  3FIS A;  3Q0V A;  2LD5 A;  5IPA A;  1FJL A;  2YUS A;  1Y1V J;  4B3A A;  1GV5 A;  1AHD P;  1HCR A;  2M2E A;  2QCO A;  1TWC J;  1MSE C;  3CCY A;  3ZQI A;  3HOW J;  5F1J A;  1ORK A;  5K7F A;  1MBG A;  1XS9 A;  1RKW A;  4RBO A;  5E3L A;  1BL0 A;  1JKR C;  4V2G A;  1YRN B;  3B6A A;  1WPK A;  1JKQ C;  1UHS A;  3S15 J;  2JA5 J;  4CYC B;  2JA7 J;  2Y9Z A;  1ETX A;  5GPA A;  1TC3 C;  4I76 A;  1ZQ3 P;  5FLV A;  4IHV A;  2L9R A;  3IH3 A;  1P7I A;  2NVY J;  4MO7 A;  4V2F A;  1LE8 A;  2ID3 A;  2NS8 A;  3RZD J;  1O4X A;  1OCP A;  2Y0S N;  1NK2 P;  3OIO A;  2QF7 A;  4FE7 A;  2E1O A;  4XRS G;  3BQZ A;  5J3L A;  1F43 A;  3RQI A;  1AU7 A;  3BR5 A;  3BR3 A;  1FEX A;  2FJ1 A;  1AKH B;  2E2J J;  3BG9 A;  4M3E A;  5M5X J;  3BTJ A;  3GTQ J;  1OCT C;  4XIC A;  1ETY A;  2DTZ A;  1RR7 A;  1JKO C;  4A3E J;  2E2H J;  2I10 A;  2LTP A;  2DJN A;  3H3V K;  2XPV A;  1ZK8 A;  5GP9 A;  5E3N A;  2JN6 A;  5IOY A;  3WHC A;  5M5Y J;  2JWT A;  1XG1 A;  1W0T A;  2HOS A;  1IGN A;  3S14 J;  4XRM A;  1ZGW A;  3BTI A;  1I3Q J;  3A02 A;  4JP0 A;  1K61 A;  2NVX J;  2VUM J;  2HOT A;  2K40 A;  2ELK A;  2WV1 A;  2K9N A;  4DYC A;  2OPT A;  2AO9 A;  1UG2 A;  2G0E A;  3RKQ A;  4UUT A;  3JRI A;  1T56 A;  3BTC A;  5JLX A;  4QSH A;  4GFB A;  3ZQL A;  4C3I J;  1B72 A;  4BKX A;  4ABZ A;  3Q0U A;  3TED A;  1JUS A;  4C3H J;  4A93 J;  2NOG A;  4B1R A;  2CUE A;  3FKI J;  4M3G A;  3JR9 A;  4M3B A;  2M0C A;  2R5Z B;  4QIW N;  4A3B J;  4A3G J;  4EEF G;  3C2B A;  3ZQG A;  2H8R A;  1Z0X A;  3HOU J;  2X48 A;  3A01 B;  1TWA J;  5J1U A;  2LKX A;  1ZTR A;  1RPW A;  2DA6 A;  3HBL A;  4G12 A;  2VKE A;  1U78 A;  2ECC A;  2ME6 A;  5E3M A;  3BR0 A;  5FKK A;  4MIM A;  3HGY A;  4UUS A;  2XB5 A;  2MGQ A;  5EG0 A;  1HDP A;  3K7A J;  3G1L A;  5IP9 J;  3PO3 J;  2JK3 A;  2YU9 J;  1VND A;  4AC0 A;  1OFC X;  3SFI A;  1H8A C;  4IEJ A;  2EQR A;  2ME0 A;  1IJW C;  3HGG A;  3GTO J;  3GTK J;  1A6I A;  5K7H A;  2HXI A;  3FK7 A;  1ZKG A;  2LFB A;  4JYK A;  4HNV A;  3G1O A;  4BXX J;  2R5Z A;  4W97 A;  1BJZ A;  2R5Y B;  3HOV J;  1JTX A;  4DYR A;  2B63 J;  1JUM A;  4FTH A;  5FKO A;  1GUU A;  1ETQ A;  4D5F A;  3BTL A;  1MSF C;  5M3F J;  4DYQ A;  1QVU A;  1P7J A;  3I4M J;  2IBD A;  1LFB A;  2XSD C;  2TCT A;  1JTY A;  2EZK A;  1RES A;  1G2H A;  5IP6 A;  3CQZ J;  5F0F A;  1DU0 A;  1GV2 A;  3LOC A;  4C2M J;  2DA5 A;  5EGO A;  1GDT A;  2L7Z A;  2DA2 A;  2DMU A;  4BY7 J;  2VI6 A;  3NAU A;  1CQT A;  3JRF A;  4A3M J;  2HXO A;  4Y7N J;  3IH4 A;  3JRG A;  3BG3 A;  3PM1 A;  4W1U A;  4AUX A;  5M3M J;  2R93 J;  4A3L J;  1I50 J;  2X9D A;  5J1Y A;  3LSJ A;  1K83 J;  2LP0 A;  3O8H A;  3O8G A;  2L0K A;  1JT6 A;  2JA8 J;  2Y30 A;  3GTP J;  1SFO J;  3LSP A;  4IHX A;  2LR8 A;  4DW6 A;  3HOX J;  3B6C A;  4I6Z A;  2DMP A;  1MNM C;  1H89 C;  3ZQH A;  1MBJ A;  1HLV A;  1YRN A;  4LOC A;  3OSG A;  5FKM A;  4CYC A;  2TRT A;  5BNG A;  3QQA A;  4A3F J;  2DMN A;  3GBG A;  1NTC A;  2VPR A;  2EZH A;  5IYC J;  2R0Q C;  3NAR A;  2CRG A;  5F27 A;  1U8B A;  2CQX A;  2JMW A;  2L7F P;  4MLO A;  1ETK A;  1IG7 A;  5EZG A;  4X1E A;  4NDL A;  2E2I J;  3ZQC A;  1TWF J;  2GBY A;  2HYJ A;  2OF7 A;  3JRD A;  1SAN A;  9ANT A;  2Y31 A;  3S1M J;  1AKH A;  5IYD J;  2O8K A;  4DZP A;  1DU6 A;  4M3D A;  1VI0 A;  1JT0 A;  2WB1 N;  4AYB N;  1A5J A;  2KT0 A;  3K2A A;  1BW6 A;  2CUF A;  2HI3 A;  4JX4 A;  3PO2 J;  4D7M A;  3BQY A;  2KDZ A;  3LNQ A;  5F0C A;  3HEF A;  2W48 A;  2GLO A;  1MBH A;  2LLK A;  2DN0 A;  3BR1 A;  4M6V A;  2P81 A;  1VF9 A;  4FE4 A;  3JRH A;  1JJ8 C;  1Q1V A;  2DA1 A;  1PUF B;  3JRC A;  4D5C A;  1APL C;  4JX5 A;  3D1N I;  2Y2Z A;  2HQ5 A;  4BY1 J;  4XK4 A;  3L1P A;  3H0G J;  4FIS A;  1ZR4 A;  3FK6 A;  3LSR A;  1WH7 A;  5J1R A;  2E19 A;  3S1N J;  3S2H J;  4X6A J;  2LK2 A;  4MFD A;  1POG A;  1Y1W J;  3A01 A;  4BBS J;  4A3K J;  1F36 A;  1RET A;  2XGE A;  4M3F A;  4J19 A;  2R7Z J;  3Q3S A;  4A3I J;  5M5W J;  4DZJ A;  2YS9 A;  3ZQF A;  3S16 J;  2LVS A;  5IP7 J;  1PUF A;  3GTJ J;  1W0U A;  2NVT J;  3DEW A;  3S1R J;  1QVT A;  5EYR A;  2HDD A;  1ETO A;  3MVP A;  3HM5 A;  3QPL A;  1FTZ A;  1MBF A;  2AHQ A;  3UKG A;  2X6O A;  3A03 A;  4Y52 J;  4QTR A;  2IEK A;  1FIP A;  1ETV A;  3IH2 A;  5IYB J;  1LE8 B;  2RAE A;  1IV6 A;  4A3D J;  1ENH A;  1X2N A;  2EZL A;  2R5Y A;  4XRS A;  2O7O A;  2DA7 A;  3TP3 A;  4XID A;  2MSY A;  3GTL J;  3HOZ J;  3G1M A;  4BBR J;  3S2D J;  2CU7 A;  5EEA A;  3SJM A;  3TW7 A;  5HOD A;  3MN2 A;  3JRB A;  5EDN A;  2EZI A;  2FX0 A;  3FIW A;  3W6V A;  1HDD C;  1BW5 A;  1IC8 A;  3GTM J;  1QPI A;  1Z77 A;  4L5E A;  3VPR A;  3E7L A;  1B8I B;  5GPC A;  1FIA A;  3DCF A;  3JRE A;  2MW8 A;  3F0C A;  2K9S A;  3BG5 A; 
#chains in the Genus database with same CATH topology
 2Z16 A;  3GW2 A;  3BPX A;  1QZE A;  2KHM A;  2RV8 A;  5EF6 A;  4ZYE A;  2CW8 A;  4EJT A;  3COA C;  3CO7 C;  4CCO A;  1HQC A;  2M4K A;  3Q9V A;  2XUB A;  2O3F A;  2Y9Y A;  2E60 A;  2HFH A;  1WCM J;  2HWV A;  4GDF A;  4EM2 A;  1B72 B;  4LMY A;  3FM3 A;  2COB A;  2DYR H;  2IT0 A;  1MD0 A;  2CQQ A;  3PFY A;  1WQ2 A;  1SD6 A;  4ZTJ A;  1VFC A;  2Y0M A;  2DA3 A;  3CF2 A;  2PMZ N;  1L0O C;  2X85 A;  2JJ7 A;  4A2U A;  1I1S A;  2EIJ H;  1MH3 A;  2DQR A;  2L4A A;  2JVH A;  4UUS B;  2F6C A;  2FRH A;  2Y69 H;  4IX7 A;  2XRL A;  2WC2 A;  3VYU B;  1SC7 A;  3JAM K;  1R1V A;  1VQ8 I;  5B1B H;  3RKW A;  4BJ6 C;  1O57 A;  3ABK H;  5JLW A;  3HOY J;  1IRZ A;  3M7G A;  1FYK A;  2H1K A;  3OYK A;  1R4M B;  2GM4 A;  4S05 A;  2X51 A;  1WGX A;  2V1U A;  4MTD A;  2K3P A;  1RUO A;  5JR3 A;  1R9T J;  2VJ5 A;  1IDY A;  4U88 A;  1E3O C;  1V54 H;  3SEZ A;  2CFX A;  2DTR A;  4B4C A;  1P2F A;  1GT0 C;  4FX0 A;  4B8X A;  3HOS A;  1TWH J;  1EH7 A;  4MTE A;  2V9K A;  4S0H B;  2DOA A;  1ZRF A;  3VEP A;  4A69 C;  3K4L A;  2JA6 J;  4N0B A;  2Q8K A;  5L3C A;  1C0W A;  5EEH A;  1DDN A;  4RLQ A;  5DV5 A;  3CCR I;  1BIB A;  2K9Q A;  3K1N A;  2KIQ A;  2DMT A;  5LGU A;  4PCQ A;  4LG3 A;  1D5Y A;  2H27 A;  1X2M A;  3TQN A;  2E35 A;  3OYE A;  3F8F A;  5F08 A;  1RKT A;  2R92 J;  3K4M A;  3V7S A;  1OJL A;  5L3G A;  4YFX F;  1W1W E;  2ID6 A;  3RZO J;  3GTG J;  4BXU A;  3GME A;  1P4W A;  1VQ7 I;  4XKC A;  3TP0 A;  4Y3O A;  5F6F A;  2JRM A;  5E1X A;  4OU0 A;  4DGW B;  2BE5 F;  5FLX K;  1IUF A;  2WAF A;  3TO9 A;  1KA8 A;  5DM7 F;  3WHB A;  1K6O A;  2DO7 A;  3IAM 2;  2YUS A;  3F23 A;  1SEU A;  3REO A;  3U9G A;  3BG7 A;  2LYC A;  1WFX A;  3BJO A;  4B3A A;  1AHD P;  5E79 C;  3KYD B;  3EUH A;  3HOW J;  4CZZ A;  4B43 A;  1MBG A;  5ICF A;  1HSJ A;  3NWS A;  4RGR A;  3TO6 A;  3CCJ I;  1H9T A;  4CDG A;  1Z6R A;  4IPA A;  4P55 A;  4LG0 A;  4XMY A;  1BL0 A;  2XGX A;  4LLN A;  3FX3 A;  3H5N A;  1WPK A;  1Z7L A;  5D6E A;  3S15 J;  1FWZ A;  1TZL A;  2JA7 J;  3M8J A;  4BL0 B;  2O03 A;  4CA0 A;  3FKJ A;  3EET A;  4I76 A;  4KIF A;  3KCC A;  3I59 A;  4BAY A;  3RZD J;  3DTE A;  3GLX A;  1UG0 A;  2LC2 A;  1O4X A;  2XF6 A;  4M73 A;  1YIO A;  4XRS G;  3RQI A;  3KYC B;  2V1N A;  3WTX C;  2K86 A;  1REP C;  2JPC A;  3TL4 X;  3V7C A;  1GXQ A;  1OCT C;  4XIC A;  4CCM A;  2P5L C;  1I1G A;  2OQR A;  3EPZ A;  2I10 A;  2LTP A;  4KIS A;  1QZZ A;  3MQ0 A;  2CFO A;  2XPV A;  3I53 A;  1G59 A;  4ENK A;  5M5Y J;  2MA3 A;  4HF2 A;  2DFH A;  2BHY A;  2V6E A;  4GYI A;  3HSF A;  3K0L A;  2LBF B;  1IGN A;  2F4M B;  1FC3 A;  2V4J C;  3BTI A;  3A02 A;  2NVX J;  2K4J A;  2K40 A;  2ELK A;  2WV1 A;  2K9N A;  2QKM B;  3LFK A;  1K7A A;  1J7K A;  2OPT A;  3NEU A;  4ENN A;  3KEY A;  1O3Q A;  2QKL B;  5K5Q A;  3CC7 I;  2XIG A;  3JRI A;  1T56 A;  2WTE A;  2ZSH B;  2F5F A;  3BTC A;  5AON A;  1SVM A;  4C3I J;  1Y6I A;  3IC7 A;  1B72 A;  1LVK A;  4ABZ A;  1PUE E;  4BDZ A;  3F6V A;  2WAD A;  1JUS A;  1WJF A;  2VKD A;  3DPL C;  3GX4 X;  2NOG A;  2R3S A;  2G7H A;  3CF5 F;  1FOW A;  2W57 A;  4M3B A;  2P4W A;  3WGI A;  2R5Z B;  4EEF G;  3C2B A;  5HDN A;  1I39 A;  4O5V A;  3UNG C;  1PP7 U;  3OL4 A;  1RPW A;  4UNO A;  3JSP A;  4AID A;  5LFA A;  2A69 F;  4BDY A;  2VBZ A;  5E3M A;  4UUS A;  2GQQ A;  2M7A A;  1BN5 A;  2JZY A;  3C18 A;  1VTN C;  2L02 A;  2PEX A;  2YU9 J;  1Z1D A;  4UVA A;  5D5V B;  1FBQ A;  4AC0 A;  3L2V A;  4IEJ A;  5HNH A;  4QPO A;  1LQ1 A;  2CV0 A;  2E7W A;  1OR7 A;  4EJV A;  2HXI A;  4F55 A;  3G1O A;  2LNB A;  3VYT B;  1BJZ A;  2CUZ A;  4LB5 A;  3HOV J;  1R7J A;  1IF1 A;  3D5R C;  1WI9 A;  1WJ5 A;  1JUM A;  5AIQ A;  2E1M B;  3D5S C;  5HLT A;  2COM A;  4HST A;  1GUU A;  1MDM A;  3FXU A;  3BTL A;  1VQO I;  2IGM A;  1MZB A;  1QVU A;  1RIO H;  4ZH4 F;  3LL7 A;  3BG6 A;  2FNA A;  2G9W A;  2PFB A;  5DCM B;  4XKB A;  2IBD A;  1LFB A;  4ASN A;  1T98 A;  3GXO A;  3IKV A;  5L3B A;  5K5R A;  3CQZ J;  4U0W A;  2WWY A;  3LOC A;  3KZY A;  4WXH A;  1YW7 A;  2DA5 A;  2XDV A;  4A12 A;  3LSI A;  4BE1 A;  2DXI A;  4PUS A;  2DMU A;  2VI6 A;  3NAU A;  3ONQ A;  3JRF A;  2HXO A;  1N75 A;  3HHG A;  3IH4 A;  1S8N A;  2OCE A;  5M3M J;  5BPD A;  1WRJ A;  5FRO A;  1HXD A;  1XSV A;  1I50 J;  2HQN A;  4PJM A;  2X9D A;  3BZC A;  4XLA A;  5CYV A;  2K85 A;  4FX4 A;  4P1W A;  4EGY A;  1A36 A;  1JT6 A;  2HZD A;  4E4H A;  3QP6 A;  1SFO J;  1U6G A;  3LSP A;  3BRO A;  1FY7 A;  4KYW A;  2R7V A;  4KFC A;  2HVR A;  2VOP A;  3OYD A;  3QYF A;  4RB3 C;  4EQQ A;  4I6Z A;  1XGN A;  3F72 A;  3ZQH A;  1A04 A;  1JGS A;  1DGR M;  4LOC A;  2O61 A;  2M4G A;  2NNN A;  3CLO A;  1T38 A;  4BJ5 C;  3CCU I;  5BNG A;  3IRQ A;  4A3F J;  4Y15 A;  4G6Q A;  4Q48 A;  1ZN2 A;  1KU2 A;  4XLN F;  1KQ0 A;  1S5L C;  2EZH A;  5JHU A;  5IYC J;  4IKF A;  3F3X A;  5F27 A;  2CQX A;  2NYX A;  2JMW A;  1MMA A;  2XAF A;  2F5E A;  3CTA A;  5EZG A;  4XKV A;  1V55 H;  3G6E I;  5BPI A;  3G3Z A;  5E1W A;  4HNT A;  2LF8 A;  3GZN B;  1TWF J;  4UV8 A;  1SAN A;  3E0J B;  9ANT A;  3OR2 C;  3AL0 B;  5H20 A;  3LQQ A;  2RDP A;  1BOB A;  4A0X A;  3L00 A;  5B66 C;  3H92 A;  1SFK A;  1VI0 A;  2X1C A;  3OWT A;  1XCV A;  3RKY A;  1JT0 A;  2P7C B;  1UB9 A;  4JX4 A;  2CUF A;  4D7M A;  3BQY A;  1UEL B;  1F4K A;  3LNQ A;  4IO9 F;  5BQT A;  4U0V A;  2DK8 A;  2QQA A;  1X1P A;  3OV8 A;  1WVR A;  1G6N A;  3BPV A;  2P81 A;  5F1R A;  5E17 F;  4B47 A;  2CUJ A;  2HZT A;  3FXL A;  2VT2 A;  1MNE A;  3I0T A;  1APL C;  4Y17 A;  1BI2 A;  4OWR B;  3VOD A;  3H0G J;  3SZT A;  5JFR A;  2STW A;  4UVC A;  1MJ9 A;  3CUQ B;  3OYL A;  5LBQ A;  2E19 A;  2FA5 A;  2KIU A;  1VQN I;  2ESH A;  3TGN A;  2QBY B;  4MFD A;  1POG A;  2W85 A;  3LSK A;  3P5J A;  4IJA A;  4A3K J;  3LSM A;  1X1D A;  3SEQ A;  3Q3S A;  4RB2 C;  4DZJ A;  1T2K A;  3H1C A;  1FMW A;  3AL0 C;  1O3T A;  2HDC A;  4HEA 2;  1E2X A;  2A6E F;  4XQF A;  2ZJR F;  4WWC A;  2Z9O A;  2DBB A;  1R71 A;  2NVT J;  3S1R J;  5EYR A;  3QPH A;  4XRF A;  2F2E A;  2UXX A;  1WWX A;  2W4S A;  2AQE A;  1IAW A;  4Y52 J;  2IEK A;  4BS9 A;  1O3R A;  5IYB J;  2RAE A;  3OYG A;  4WXC A;  5IT3 A;  2ELH A;  5FRM A;  1IXS B;  2MC3 A;  2EZL A;  3FF5 A;  4OOI A;  5KK1 A;  4FT8 A;  4XID A;  4HLX A;  1XB4 A;  2MSY A;  5A2Q Z;  3HOZ J;  2Y48 A;  2XF5 A;  3BC8 A;  1IRX A;  3L09 A;  4PJL A;  3TW7 A;  5HOD A;  3MN2 A;  3JRB A;  3GYH X;  2CMP A;  4RGU A;  3SZP A;  5CQG A;  2EZI A;  4KT6 A;  2FX0 A;  2YSR A;  1T0F C;  3QAH A;  3ZQQ A;  5DYM A;  4AIH A;  2CWE A;  2AQF A;  1Z77 A;  3IRR A;  3VPR A;  2XRO A;  1XCB A;  4OIN F;  4U0Y A;  4YIR X;  1UHM A;  2CS3 A;  3CUQ C;  2MW8 A;  3OYN A;  2K9S A;  1YG2 A;  4F7Z A;  5C44 J;  1YJW I;  1OMI A;  1X58 A;  2P0W A;  4I7H A;  1VQM I;  2O6G E;  2FQ4 A;  3MZ8 A;  3BR2 A;  2MG4 A;  2DYS H;  2UV1 A;  1FBS A;  1JJ6 C;  4DBR A;  4YFK F;  3KP7 A;  5EZH A;  1U8R A;  5DTD A;  1LNW A;  4NBQ A;  5F04 A;  1K4S A;  3WU0 A;  1KQ9 A;  1WHU A;  4IHY A;  5L3E A;  3PJR A;  1QA6 A;  1W5S A;  3LSG A;  5JVT A;  3CCE I;  2EH3 A;  2R7D A;  2V9P A;  3W6K B;  3M4O J;  4PFP A;  3E6M A;  1XC5 A;  2LKS A;  5FJ8 J;  1IRG A;  1IDZ A;  3VDX A;  1B8I A;  2O8X A;  2EFP A;  3HDD A;  4F91 B;  1F5T A;  4CCJ A;  1UHW A;  3FXQ A;  2IGK A;  3CLQ A;  1XN7 A;  2Z1D A;  5D5X B;  2VBX A;  4JX6 A;  4M6Y A;  4WF2 A;  4FCY A;  1P6R A;  1Y8R B;  4RB0 A;  1LEB A;  3BLY A;  2QEX I;  3GZ5 A;  3DBR B;  3FXK A;  3HL2 A;  4AWX B;  2F5D A;  2GA2 A;  4G7O F;  5EG0 B;  2GIZ A;  3QPT A;  1J2X A;  3CDL A;  3TOA A;  3S93 A;  2M45 A;  4QWQ A;  1YTY A;  3OIQ A;  2XPW A;  1QRY A;  4HDV A;  2IS2 A;  2HQA A;  1TT0 A;  3T1B A;  1WZ2 A;  3N05 A;  2P6S A;  2Y75 A;  4BQN A;  4ESJ A;  3L7W A;  1WI3 A;  3WTZ A;  2QA4 I;  4NB5 A;  1KQ8 A;  3KEO A;  2D5V A;  2OV7 A;  1E0E A;  1W4M A;  4ZTF A;  2BXY A;  3KFW X;  5E3O A;  2ISY A;  2BXZ A;  2FOW A;  3FBN B;  5J8C A;  2EB7 A;  1Z6T A;  2WAQ N;  1YI2 I;  1JGG A;  3S1Q J;  5DS9 A;  1QU3 A;  3I4N J;  5F0H A;  3CZ6 A;  4HV6 A;  4ZYA A;  3R4K A;  1FSH A;  1KYW A;  4ITV A;  4PFO A;  4YG2 F;  2VN2 A;  1BI3 A;  4M71 A;  1MGT A;  4L9N A;  1HA8 A;  2LY9 A;  3S17 J;  4A3C J;  1OYW A;  3WGG A;  3ZMZ A;  2UWM A;  3CP8 A;  2OC6 A;  1QHG A;  3TKY A;  2LRD A;  4XOR A;  5B3S H;  3K9T A;  3OYJ A;  2W84 A;  3HKZ N;  3QOP A;  1JI8 A;  3KIO A;  5FKL A;  1MH4 A;  3JW4 A;  3CME I;  4XM3 A;  2X1D A;  1ZRD A;  2ZB9 A;  3OYC A;  2EBI A;  3GFL A;  1KU3 A;  2W25 A;  2ZXJ A;  4RAG A;  4PZJ A;  2E5Z A;  3HRS A;  1B59 A;  2XB0 X;  2XPU A;  5B1A H;  1UJ8 A;  4YEJ A;  1ACI A;  1VQ4 I;  2IJL A;  2M87 A;  3SDG A;  1I6H J;  1P4X A;  5ILU A;  3RQ4 A;  3Q0V A;  1FJL A;  3CP2 A;  3ASO H;  1LEA A;  1Y1V J;  1J9I A;  2QCO A;  2QWW A;  3C3W A;  3CCY A;  2QBY A;  3CJR B;  1WJE A;  4XL9 A;  5K7F A;  4MHG A;  4HBL A;  3ZMD A;  2XVC A;  4LJZ F;  4RBO A;  2L9S A;  3G71 I;  2IP2 A;  5E3L A;  1JKR C;  1S29 A;  3K4K A;  4PJ0 C;  4H0E A;  1YRN B;  1F9N A;  2JA5 J;  4CYC B;  2Y9Z A;  5GPA A;  3F22 A;  2OTJ I;  2A3S A;  3I58 A;  1ZQ3 P;  1FP1 D;  4IHV A;  2VON A;  1I3A A;  4O6J A;  3CMA I;  2ID3 A;  2DLL A;  2NS8 A;  2HGC A;  2NNY A;  3K4J A;  3EUH C;  5LEJ A;  3OIO A;  5J4Y A;  1OCR H;  3S3O A;  2E1O A;  5J3L A;  5E8I A;  2DAO A;  2CG4 A;  3V8K A;  3ABU A;  3H9G A;  5CJ9 A;  4RA2 A;  1ONV A;  1JHF A;  1U0J A;  4AYB A;  3GTQ J;  3PSI A;  2P6T A;  1RR7 A;  3DPU A;  1JKO C;  2STT A;  1UCR A;  3RPQ A;  2Z2S B;  3S32 A;  2YR2 A;  4M9X A;  1ZK8 A;  5E3N A;  4BEH B;  4OIQ F;  2EFQ A;  1FZP B;  4KDP A;  1QHH D;  3GCM A;  2R7U A;  2HYG D;  3P7N A;  1OPC A;  4RLF A;  1W0T A;  4KT5 C;  2KRF A;  4E7H A;  1I3Q J;  2E7X A;  2PMU A;  3G2B A;  4RM3 A;  4XKW A;  5LLQ A;  2P7V B;  1K61 A;  2VUM J;  3IHU A;  2HOT A;  4DYC A;  4F3Q A;  2OZU A;  3OYA A;  4IL6 C;  3IUO A;  4K2E A;  1KZH A;  1SD7 A;  2DU9 A;  4MQ9 F;  3L9F A;  4L5J A;  1O7L A;  1LVA A;  3S2W A;  5JLX A;  2RNG A;  1V5G A;  2DJI A;  4IRI A;  4BKX A;  3Q0U A;  1R5H A;  3VB2 A;  3TED A;  4E7I A;  2JA2 A;  4A5M A;  1QNT A;  1P92 A;  2QVO A;  4BHC A;  4LB6 B;  4IOC F;  4HRI A;  3MFK A;  2IVM A;  2BW3 B;  4CUG A;  4A3G J;  1IRF A;  3ZQG A;  3A01 B;  3FXR A;  5J1U A;  5DDG A;  2VL8 A;  2LKX A;  2CYY A;  1MDM B;  1K6Y A;  1SMY F;  5KAF C;  3WTV C;  2P8T A;  3KP5 A;  4UXN A;  1FNN A;  5EG0 A;  5IP9 J;  3AAF A;  1S7A A;  2RGV A;  2J5P A;  4G6D A;  1R58 A;  2IS1 A;  1OFC X;  1H8A C;  1IN6 A;  1IJW C;  2A6H F;  2KLO A;  1V4R A;  4HG2 A;  2XAQ A;  3GTK J;  3HRU A;  1J59 A;  1HW1 A;  4D0P A;  3FK7 A;  4LFU A;  3OYF A;  1XGS A;  3BZ6 A;  3PQJ A;  5ILS A;  4HQE A;  3M1E A;  2L4M A;  2VOO A;  3DBL B;  4BXX J;  4W97 A;  2BY1 A;  1BR4 A;  2EA2 A;  4DYR A;  3N4M A;  4XLC A;  4G9Y A;  4FTH A;  5FKO A;  3ERE D;  3VYR B;  1FMV A;  4AD9 A;  4CZC A;  3PNV A;  1BR2 A;  1MSF C;  3ROU A;  5FGM A;  3E3V A;  4IHT A;  2BV6 A;  2J5O A;  2QYO A;  5ICE A;  2YPR A;  3V7R A;  3GUD A;  2W24 A;  1MKM A;  1IZ1 A;  1OR7 C;  3MZH A;  2GZW A;  1A35 A;  1U3E M;  2BEO A;  1RES A;  1G2H A;  5F0F A;  1WKM A;  1GDT A;  5ERI A;  3HRT A;  2EIK H;  4UV9 A;  4BY7 J;  2CSO A;  4KA4 A;  4A3M J;  2VXZ A;  4Y7N J;  4PSX A;  3F8N A;  1XMA A;  1ZEL A;  3JRG A;  2X6Y A;  5J40 A;  2W1O A;  3MEX A;  3MMY B;  4CCL A;  4Q4Z F;  2ETH A;  4B48 A;  2FEZ A;  3LSJ A;  2LP0 A;  5BMZ A;  2XAU A;  3JTG A;  2ADU A;  5A2Q K;  2Y30 A;  3GTP J;  2EIN H;  1NG7 A;  2M5W A;  3O3K A;  3R6S A;  4IQJ A;  2LR8 A;  2GOM A;  3GF2 A;  4DW6 A;  4P5O A;  4F52 A;  1G3T A;  5HLG A;  3B6C A;  3WGH A;  2CW0 F;  4L9V A;  3KET A;  1AWC A;  2BZT A;  1FP2 A;  2PMH A;  1EJ9 A;  4KUM A;  2JUC A;  1YRN A;  3W3C A;  4XSZ F;  4CYC A;  4Q5S F;  2X6W A;  3H5R A;  4LLL A;  2VXD A;  2TRT A;  3DU5 A;  3GO5 A;  1W5C C;  3A2K A;  3GBG A;  1NTC A;  3KZZ A;  2A07 F;  3NAR A;  3U2R A;  2DT7 B;  1ZG5 A;  1ZLJ A;  3LA7 A;  4L9T A;  1D8K A;  4MLO A;  2MBF A;  2OU2 A;  3DBH B;  3U1K A;  1MMS A;  2V7F A;  3ZQC A;  2L7K A;  3PNY A;  2Y31 A;  3S1M J;  5IYD J;  2LF7 A;  2DI3 A;  1Y39 A;  4YII A;  2VQC A;  2F5C A;  3HSR A;  3KZI C;  4ZDL A;  3TOB A;  2VOD A;  2GXG A;  1IO2 A;  2HKO A;  4NC6 A;  4GXO A;  2OAZ A;  1ON2 A;  4BEH A;  1Z9C A;  1A5J A;  4IRH A;  5CQE A;  1BW6 A;  1N25 A;  2HI3 A;  3K69 A;  4EGZ A;  3BCA A;  2DFI A;  3DF8 A;  3DKW A;  2FQ3 A;  1Z3Y A;  4BNC A;  2LOO A;  3O2P E;  1EH8 A;  4MQV A;  4HSR A;  2DN0 A;  2JQ7 A;  3PIO F;  2NRA C;  4M6V A;  1Z21 A;  3HPH A;  4LGW A;  4DIQ A;  4QLC U;  2FBK A;  2Q2E B;  3KX2 A;  5DM6 F;  2WY8 Q;  2A6T A;  1PJR A;  1Q1V A;  2DA1 A;  3OMY A;  1LDK B;  2DK5 A;  4D5C A;  4JX5 A;  4FAS D;  3WTU C;  1YX3 A;  2Y2Z A;  3A0B C;  4XR6 A;  2O5R A;  3MD2 A;  3ZR8 X;  2FUG 2;  4AVP A;  3CCV I;  3IP4 B;  3MKZ A;  2ZXI A;  2CQN A;  1W7P D;  2G7U A;  3FK6 A;  5LRS A;  1YFH A;  3C1D A;  4HA8 A;  4HF0 A;  2MYS A;  2EIM H;  2FU4 A;  2K3F A;  1DQU A;  2BW3 A;  3S2H J;  1RZ4 A;  2M8E A;  2LK2 A;  2VBW A;  4A0Y A;  3A01 A;  1Y1W J;  2PN6 A;  4BBS J;  1F36 A;  1S7O A;  2ZFU A;  4GO1 A;  3SYT A;  3T8R A;  4G7Z F;  3P9I A;  3RPU A;  1TTY A;  4A3I J;  2B9S A;  5TGT A;  3KLO A;  3B73 A;  4N4O B;  2XKO A;  3ZPL A;  3RDI A;  1PUF A;  5ILV A;  2BY2 A;  1W0U A;  2GIV A;  2M3A A;  4EM0 B;  2RQQ A;  2ZFW A;  2RKH A;  1FTZ A;  2DCE A;  2Y0S A;  2FNP A;  1MBF A;  2RVC A;  5DUK A;  3A03 A;  4IZZ A;  4QTR A;  4LIT A;  1LE8 B;  3IH2 A;  2YX7 A;  2HQR A;  1IV6 A;  2EV5 A;  1K4T A;  5ICG A;  2O7O A;  3BOQ A;  4M9S A;  5HS9 A;  2DA7 A;  3TP3 A;  1HBX G;  4N9H A;  3EQL F;  4R8H A;  3KP4 A;  4A0Z A;  4HX8 A;  4BBR J;  1HC8 A;  1SVO A;  4ZC3 A;  2OD5 A;  2MD0 A;  5EDN A;  1X3Z B;  4ZDP A;  2QSG X;  1E3P A;  4LD5 A;  3FIW A;  5HVQ C;  3FXO A;  1R4N B;  4HNU A;  2KIM A;  2E1C A;  1XD7 A;  2LRE A;  1QPI A;  3GTM J;  4FQG A;  3PL8 A;  4L5E A;  5LHI A;  2VKH A;  1RI7 A;  4OMY A;  4EV0 A;  3E7L A;  1B8I B;  1G3W A;  2IS4 A;  3W2V A;  1FIA A;  2IA1 A;  2B7E A;  3EYY A;  4E7J A;  3JRE A;  1SVL A;  3F0C A;  4QSH A;  3ECH A;  1VQL I;  2KPM A;  2Z3Y A;  1ZR2 A;  1QBJ A;  1FTT A;  1UMQ A;  1A31 A;  2IAI A;  4IHW A;  5E20 A;  4ETS A;  2ZNY A;  2NXN B;  2F5V A;  5FKN A;  3BJ6 A;  5GAD J;  4EJU A;  1H88 C;  3TW6 A;  3RPU D;  3F8B A;  5CLS A;  5HDG A;  1BA5 A;  3R60 A;  3OYM A;  4I02 A;  3QPS A;  4BE0 A;  2DA4 A;  3BJA A;  4WX9 A;  3OYH A;  1MIJ A;  2ZSI B;  3ERM A;  1OCO H;  3K2Z A;  4UY8 I;  4YRV A;  4JBA A;  2D2W A;  4NC8 A;  4Y13 A;  1ERD A;  4F92 B;  1B9N A;  1GHC A;  5LHH A;  5C4J J;  3CMM A;  1R5G A;  4H4K C;  2VBY A;  3LA2 A;  3A0H C;  2CV1 A;  2JSC A;  2R7X A;  4JQF A;  1YS7 A;  4AIJ A;  1TWG J;  3GFJ A;  1UAA A;  4XLH A;  3WG9 A;  5E18 F;  3RCO A;  3CJQ B;  2R7R A;  3H9J A;  1MJB A;  4XSX F;  4MFE A;  5TJJ A;  2M9H A;  1IN8 A;  1B6A A;  1G3S A;  1TNS A;  4IXA A;  3HRM A;  1EKE A;  1YOV B;  4NNJ A;  3FM5 A;  4D9J A;  4PK4 A;  4I98 B;  2EFN A;  5D4R A;  3W6J B;  5JHF A;  2NVQ J;  2N8G A;  1LKX A;  2L54 A;  3KEQ A;  1Z7U A;  4I09 A;  4RAY A;  3Q0W A;  3ZOB A;  3MKL A;  3VSK A;  4XNF A;  1JKP C;  4RDU A;  2FD5 A;  2OUM A;  4A3J J;  3I71 A;  3OIP A;  4HLY A;  1R49 A;  1WJB A;  3CCM I;  2O9L A;  1YW8 A;  2DMQ A;  1HOM A;  1YO5 C;  3T0Y A;  5C3E J;  3DFG A;  2NS7 A;  4TV7 A;  1LPQ A;  2DPD A;  2Q2E A;  2ECB A;  3BY6 A;  1WJD A;  1DUX C;  3HB9 A;  3ZMT A;  3OOU A;  1WH5 A;  2QM3 A;  4CSW A;  1HKS A;  1T33 A;  2MC4 A;  1W36 D;  2KJB A;  4LIU A;  1ITY A;  1CF7 B;  4R1H A;  1FX7 A;  2UUZ A;  5D8K B;  1Z05 A;  4C3J J;  3OYI A;  3K70 D;  3GFM A;  3SZG A;  1XX5 A;  1QGP A;  3R0A A;  2YX4 A;  3HPG A;  1GVJ A;  1QQI A;  2K02 A;  3E97 A;  2M7B A;  4LK0 F;  3IL2 A;  3IWF A;  3DP7 A;  1HCR A;  2JSP A;  1MSE C;  3ZQI A;  1JHH A;  2QSF X;  5F1J A;  1VQP I;  2K9M A;  3FDY A;  1YX5 A;  1BIA A;  2OQG A;  1RKW A;  2LKP A;  2X6X A;  4O3M A;  4V2G A;  2KFD A;  4P9F A;  2H6B A;  2RNJ A;  1FLI A;  1ETX A;  1YJN I;  2K5C A;  1BOA A;  4LIV A;  1IN5 A;  3C2G A;  4JK1 X;  1FOX A;  5ICC A;  1ULY A;  3E1S A;  2IA0 A;  1TC3 C;  2KKO A;  3IH3 A;  4MO7 A;  4PGH A;  4V2F A;  3ML6 A;  2W7N A;  2OBP A;  1LE8 A;  1FOK A;  4L0Y B;  3HZJ A;  4HX7 A;  1OCP A;  2VJI A;  1I6X A;  4FE7 A;  3CO6 C;  1F43 A;  5HLH A;  2FE3 A;  3BR5 A;  3BR3 A;  1XMX A;  3DQV C;  2FJ1 A;  4KN4 X;  4DOZ A;  2E2J J;  1FEX A;  2ESN A;  1KU7 A;  2FF4 A;  5M5X J;  4YIF A;  2P5V A;  3BTJ A;  2L9V A;  2WB1 A;  1D1A A;  4BQQ A;  3I9V 2;  5E8G A;  1ETY A;  2DTZ A;  3DTK A;  3EDP A;  4CH7 A;  2HVQ A;  4E70 A;  4A3E J;  2E2H J;  3ZCO A;  1FBU A;  2DJN A;  5H2F C;  3WG7 H;  4KIG A;  1QO0 D;  5AIP A;  5GP9 A;  4A6E A;  2NOJ B;  4BYY A;  5J47 A;  3WHC A;  4ENJ A;  1LUJ B;  3HJE A;  5CVR A;  3KP2 A;  1USS A;  1XG1 A;  1Y56 A;  2PBI A;  2OJE D;  2HOS A;  3S14 J;  4XRM A;  2KZG A;  2PQ8 A;  1JE8 A;  4D1Q A;  2R7T A;  2ZME B;  4JP0 A;  3VYS B;  4WK8 F;  5LRR A;  1FOY A;  2PI0 A;  3L2C A;  2VQH A;  2AO9 A;  2G0E A;  4QPQ A;  2F48 A;  4KNY A;  1T95 A;  2JTV A;  4ZJZ A;  4GFB A;  5TRD A;  1G3Y A;  2WBM A;  5D5W B;  5ED4 A;  3OL3 A;  2R7F A;  4ESB A;  3RI4 A;  1Z91 A;  1R1U A;  3DXJ F;  4I2O A;  2ACJ A;  4C3H J;  2E5N A;  2H09 A;  2CUE A;  3FKI J;  4MGR A;  3JCU C;  5BS6 A;  2DOD A;  1D5V A;  2M0C A;  4UHT A;  4KN7 X;  2VC0 A;  1X4O A;  2KZV A;  3EYI A;  1XGM A;  3PUF A;  3AKZ A;  3MKW B;  4MNU A;  2H8R A;  5CKT A;  3HOU J;  3GWZ A;  5K5O A;  1TWA J;  3GZ6 A;  1ZTR A;  3HBL A;  2VKE A;  2ZKZ A;  1LJ9 A;  2ME6 A;  2E1N A;  3BR0 A;  3H5A A;  5FKK A;  4MIM A;  3CUO A;  3EUK L;  5GAE J;  1U5T A;  1YJ9 I;  2R7W A;  1KON A;  3QYB A;  1HDP A;  3K7A J;  3G1L A;  3E6C C;  4Z6Y A;  1VND A;  2ZJP F;  2EQR A;  2ME0 A;  3LA3 A;  5HDK A;  3V8L A;  1WJA A;  3K4C A;  3WTY C;  2B0L A;  2XAH A;  3T8T A;  1ZKG A;  2LFB A;  4ANJ A;  4BQA A;  1XDS A;  5DEQ A;  2MH2 A;  3OY9 A;  2XF7 A;  4CO8 A;  4RS8 A;  2AXL A;  2R5Y B;  1JTX A;  4MEY F;  3I55 I;  2ZO4 A;  4UB8 C;  2ZME C;  3BZK A;  1R5I D;  1M1E B;  2XRN A;  4IQ4 A;  4D5F A;  4I01 A;  3QU3 A;  2DOE A;  3KP6 A;  1TP4 A;  1RRJ A;  6PAX A;  2FSW A;  1MJA A;  1SMT A;  4IF4 A;  3I4M J;  3AG1 H;  2ZXW H;  2EIL H;  1IN4 A;  2KL4 A;  2GOX B;  4ZYH A;  1LDJ A;  2LDU A;  2TCT A;  2KJC A;  3WE2 A;  4BE2 A;  3M8E A;  1ZG1 A;  1GV2 A;  4E7K A;  1KU9 A;  3FMQ A;  2L7Z A;  1NH3 A;  3L2Q A;  1W7P B;  4CYD A;  2IA2 A;  1ZAO A;  4RB1 A;  1J5Y A;  1CF7 A;  3MAJ A;  4KIT B;  3CJN A;  3QOE A;  3GLL A;  3V42 A;  3PM1 A;  3FHZ A;  4W1U A;  2R93 J;  1D0X A;  1MW7 A;  3TDU C;  4XOP A;  1SFE A;  4M6X A;  4EJO A;  3ISP A;  5J1Y A;  3O8H A;  3EUA A;  3O8G A;  3W2W A;  2PG4 A;  2VE8 A;  1SAU A;  2BGC A;  3IKT A;  3QU6 A;  2PMZ A;  3L2U A;  4IHX A;  2EK5 A;  3E6B A;  2VLA A;  3TDZ C;  5EEG A;  2FXA A;  2DMP A;  2K9L A;  3K10 A;  1H89 C;  1ON1 A;  1ZAR A;  1S3J A;  2X4H A;  1HLV A;  1UZC A;  5KAI C;  3OSG A;  3VWB A;  1W5T A;  1ZYR F;  4YFN F;  3K4B A;  4GRI A;  2YU3 A;  1OCZ H;  3ZQ7 A;  1R23 A;  2DMN A;  2FBH A;  4XLE A;  2BVL A;  1ZLK A;  2MD5 A;  3F21 A;  2R0Q C;  2E71 A;  2CRG A;  3F9K A;  2CH0 A;  2QEN A;  1U8B A;  2UZK A;  1K79 A;  1Y8Q B;  5FB2 A;  1SFX A;  3IAS 2;  1IG7 A;  3CCL I;  1O3S A;  3HIF A;  3MCZ A;  2VE9 A;  4ZZL A;  4NDL A;  2E2I J;  3BWG A;  1HW5 A;  2HYJ A;  3LQR A;  2VPL A;  1R6R A;  1V5F A;  2ZJQ F;  4J01 A;  3C7J A;  3SQN A;  4KMU X;  1LB2 A;  2QQ8 A;  1TQM A;  2O8K A;  1BJA A;  4DQ2 A;  3P9C A;  4DZP A;  1I5Z A;  5DD4 A;  2NVU B;  1BI0 A;  1DU6 A;  3GVA A;  3ZRG A;  2L9N A;  3BCB A;  5CVI A;  4AYB N;  1XPX A;  1MMD A;  1OIS A;  3K2A A;  3V4G A;  3LAJ A;  4ON0 A;  1DP7 P;  4HYE A;  2JUG A;  3PUB A;  1X3U A;  2W48 A;  5J8F A;  2PJR B;  2LLK A;  1I27 A;  4UUV A;  2NS0 A;  2HKX A;  2ZME A;  5F64 A;  1IV8 A;  1WSU A;  4XOT A;  3BR1 A;  1L3L A;  1X19 A;  1FYL A;  1OKR A;  4L5I A;  4II2 A;  2EJR A;  2IW5 A;  2XAS A;  4FE4 A;  3JRH A;  1JJ8 C;  3BP8 A;  3A4C A;  1PUF B;  3D1N I;  4HZF A;  4BY1 J;  2MH9 A;  3H36 A;  3L1P A;  3OS0 A;  2K7L A;  1IN7 A;  4FIS A;  2LH9 A;  2M30 A;  4HOB A;  3DKX A;  1ZR4 A;  5E1Z B;  3V8J A;  3LSR A;  3VOE A;  5J1R A;  4ENM A;  2A5W A;  2H6C A;  2H1L A;  4XBF A;  1ODD A;  1RET A;  2XGE A;  3HYI A;  4M3F A;  4J19 A;  5FFX A;  5D4S A;  1SD4 A;  4C30 A;  1QPM A;  1YS6 A;  5M5W J;  2XC7 A;  1BI1 A;  2YS9 A;  3TBI A;  3ZQF A;  3S16 J;  2LVS A;  5IT9 Z;  4UVB A;  2EA4 A;  2DW4 A;  2CO5 A;  1K78 A;  3P9K A;  3MKY B;  1IUY A;  1QVT A;  2HDD A;  1ETO A;  5HLI A;  3UKG A;  3TO7 A;  2X6O A;  2P5K A;  2JPB A;  2HPI A;  2QLZ A;  4ZDO A;  2HTJ A;  1J0R A;  1FIP A;  1TBX A;  5D6F A;  1H0M A;  3G4S I;  4A3D J;  1ENH A;  2MLK A;  2R5Y A;  1F1Z A;  3LWF A;  4GYG A;  4E7Z A;  4CCK A;  2JRT A;  3C2H A;  4RAZ A;  4IHS A;  2FMY A;  1XSD A;  5HOO A;  1OLT A;  5H6Q A;  1FPQ A;  3G1M A;  1U2W A;  3S2D J;  2EFO A;  2ELJ A;  3R61 A;  3NRV A;  1SD5 A;  3PQK A;  1SFU A;  1J75 A;  3WU2 C;  4ZZD A;  3WU1 B;  1D1B A;  1IC8 A;  2OCC H;  1Z67 A;  3J81 Z;  3D5L A;  5GPC A;  1XMK A;  4HPQ A;  4B3X A;  3ECO A;  2KQR A;  2EFW A;  3K1P A;  4BXF A;  4KIC A;  4AIK A;  2HNH A;  4LLG F;  2OZ6 A;  5LEK A;  3S3N A;  1W7P A;  1P4A A;  3E6D A;  5BOX A;  3BG5 A;  3VSL A;  1DU0 A;  4XN3 A;  4AM3 A;  4NQW A;  2HOA A;  4YEL A;  4HV5 A;  4PGG A;  3GFI A;  2L7M P;  1FSE A;  3H3U A;  3KPH A;  1EF4 A;  5CVU A;  2XAJ A;  4OIR F;  3WTW C;  4PDK A;  1YE9 A;  1ETW A;  4D7N A;  1VQ9 I;  2IS6 A;  1TQI A;  2ZJ2 A;  2EWN A;  4DJA A;  3ESW B;  1MMG A;  2LY1 A;  4RGX A;  3RYP A;  1JUP A;  2XGC A;  5K7Z A;  2R7S A;  1LFU P;  2VKV A;  3J80 Z;  4P9U A;  2M8G X;  1HF0 A;  3QWL A;  3BT9 A;  3LST A;  4A5N A;  5LHG A;  3QYE A;  5C4X J;  3CES A;  1V5E A;  2BYV E;  2GXA A;  1S7E A;  2KDO A;  3I54 A;  5KNL A;  2XV4 S;  5FO5 A;  2QSH X;  2D1V A;  1P9Q C;  2AXT C;  3AG4 H;  4B44 A;  1JXS A;  3OS1 A;  1MBE A;  1TNT A;  1Q1H A;  3FXJ A;  5CPR B;  1U9O A;  4M74 A;  3AFH A;  1NK3 P;  5FD5 A;  3HUG B;  2HOE A;  2VQL A;  5FLM J;  1KGS A;  1B1B A;  1YLF A;  5KVR A;  4EJW A;  1S6L A;  3G73 A;  4BHB A;  1W36 C;  2ZC2 A;  3WOD F;  3OSF A;  1PDN C;  1RC9 A;  2V6C A;  3VFZ A;  3K70 C;  1EV7 A;  2K27 A;  3M3Y J;  3PFI A;  1BC7 C;  3JRA A;  2OA4 A;  1TW3 A;  1TL8 A;  5DCF A;  2PLY A;  2XSJ C;  2NAZ A;  3HSE A;  1B9M A;  4G8X A;  3IV5 A;  2LY2 A;  1T08 B;  2C6Y A;  4V19 K;  1NHA A;  1U9N A;  2A61 A;  2HU9 A;  2WV0 A;  3CDI A;  4EM1 A;  3BDD A;  2PJR A;  1ZGA A;  1BBY A;  1PP8 F;  1BM9 A;  2DT5 A;  2WA0 A;  3HTS B;  2KMU A;  1SAX A;  1MBK A;  2XGD A;  3ZMV A;  2BHZ A;  1X4P A;  4RMN A;  3FZV A;  3S8P A;  2M34 A;  3ABM H;  1D0Y A;  3U1D A;  3CC2 I;  1YIT I;  5EGO B;  2CJJ A;  3I4P A;  3LSH A;  5IOZ A;  1UFM A;  1HST A;  1GVD A;  2ZXH A;  2Q0O A;  4CIC A;  2VAS A;  3SXY A;  2KIF A;  3CMY A;  3BR6 A;  1ZG3 A;  2BY0 A;  2V26 A;  2HS5 A;  2OTL I;  2QQ9 A;  3O6B B;  3QRF F;  1N77 A;  3FIS A;  3SFZ A;  2LD5 A;  5IPA A;  3Q9S A;  4NC7 A;  2CQ7 A;  2RRE A;  1GV5 A;  3ZMS A;  4J00 A;  2M2E A;  3I5U A;  1TWC J;  5D8L B;  1ORK A;  2RC4 A;  3DTI A;  3W2A A;  2ZBK A;  3RKX A;  4DBQ A;  1XS9 A;  1Y0U A;  3NQO A;  5GAG J;  2VC1 A;  2PJP A;  4IVN A;  3CD6 I;  2TDX A;  5GTI C;  1T8I A;  4FHT A;  3B6A A;  1JKQ C;  1UHS A;  3J7A O;  2I8D A;  1KYZ A;  2BVM A;  3ABT A;  4OIO F;  2D1H A;  2VQG A;  3K1M A;  2VT3 A;  4Q47 A;  1OQY A;  2JVG A;  3U21 A;  4PJJ A;  5D5U B;  1LFP A;  3FHN A;  2Z33 A;  1D1C A;  5FLV A;  3QOD A;  2CQK A;  2L9R A;  1P7I A;  2NVY J;  2V79 A;  3FMR A;  3MWM A;  3NWT A;  1H9G A;  2DPU A;  1AOY A;  4ZYG A;  3R0J A;  1NK2 P;  2Y0S N;  1ZH5 A;  5LGT A;  1O7F A;  2QF7 A;  4GGG A;  3BQZ A;  2Z99 A;  2DQL A;  1AU7 A;  4C9Y A;  3SHF A;  1WJC A;  3F8C A;  1AKH B;  3BG9 A;  4HAM A;  4M3E A;  3OS2 A;  1LDD A;  3N97 A;  2CV2 A;  3Q5F A;  1TT5 B;  3KYL A;  3CJT B;  3ZMU A;  3H3V K;  2JN6 A;  4BUP A;  5IOY A;  4C2T A;  5LGN A;  2JWT A;  4L18 B;  2CW7 A;  2E1M C;  3H3Z A;  4WXD A;  3OR1 C;  3DPT A;  3CCS I;  4BHP A;  2QUF A;  1OCC H;  1ZGW A;  1E3H A;  1HKQ A;  3ABL H;  4A6D A;  4N4N B;  3HHH A;  4E7S A;  4IRG A;  3JAM Z;  2MLG A;  2LSO A;  2ZCW A;  1U5T B;  1ZRC A;  2QGU A;  4Y4R A;  1UG2 A;  3H35 A;  4HW0 A;  1ZGJ A;  4P96 A;  3J7Z I;  2GXB A;  2WAE A;  3RKQ A;  4UUT A;  1XGO A;  3DV8 A;  3ZQL A;  1DP3 A;  3DEE A;  1IW7 F;  4U7D A;  3AG2 H;  1BC8 C;  1HW2 A;  1GLN A;  2M0M A;  2IRF G;  1G4D A;  4A93 J;  1MMN A;  4B1R A;  2EPF A;  3RJP A;  4BAC A;  3LFU A;  4M3G A;  3JR9 A;  4L9J A;  2O0Y A;  2IGO A;  1DGW Y;  2MFZ A;  4QIW N;  2L2O A;  1ZHF A;  4A3B J;  2LBF A;  1V3F A;  4OAY A;  1VQK I;  3HXL A;  3DLL F;  4L0Z B;  4KJZ A;  1Z0X A;  4GCV A;  2X48 A;  4X0G A;  3PNT A;  3ZGK A;  5GAH J;  1YHQ I;  3F8M A;  4BH9 A;  2DA6 A;  4G12 A;  1U78 A;  2ECC A;  4XN0 A;  4CHU A;  5HS8 A;  2V1D A;  3B02 A;  3HGY A;  2XB5 A;  1R36 A;  2MGQ A;  3HOT A;  4UB6 C;  3LAP A;  4BJT A;  2DFE A;  3PO3 J;  1VZ0 A;  1PYV A;  3PIP F;  3OOP A;  1T6S A;  1FT9 A;  2EV0 A;  2JK3 A;  3DLA A;  4JOM A;  2KIS A;  1D3Y A;  1S9H A;  3SFI A;  2HTS A;  3X2Q H;  3HUG A;  5GTH C;  3HGG A;  3FBI B;  4XON A;  3ASN H;  3GTO J;  4EVI A;  1A6I A;  5JI6 A;  5K7H A;  4HQM A;  5FLX Z;  4JYK A;  1D8J A;  3TMO A;  4HNV A;  3RTR A;  2VJJ A;  2R5Z A;  4U87 A;  1XSX A;  2VJ4 A;  4DNC A;  2AS5 F;  1BR1 A;  4U7B A;  2B63 J;  3F6O A;  1B4A A;  1YW9 A;  4I0A A;  3M8F A;  5B5E C;  2HYF A;  1ETQ A;  2DOF A;  1U5T C;  2LG4 A;  1VQ5 I;  4HX4 A;  3ZN0 A;  3MZY A;  4RGS A;  5HNF A;  5H6R A;  5M3F J;  4DYQ A;  3KLN A;  1P7J A;  4LK1 F;  4MEX F;  3S3M A;  3FXM A;  2XHK A;  2KRC A;  1PVE A;  1N78 A;  4ZYD A;  2XSD C;  2W00 A;  2FBI A;  4OAZ A;  3CC4 I;  2HVS A;  2R7O A;  2M1B A;  1JTY A;  2EZK A;  2WY7 Q;  4KIB A;  1AA7 A;  5IP6 A;  4II3 A;  5IT9 K;  5FRN A;  4M9Z A;  4C2M J;  4NUB A;  2F4I A;  3A1Y A;  5EGO A;  4RM2 A;  3LMM A;  3HTU A;  2DA2 A;  2ZNZ A;  1CQT A;  3GEZ A;  3D0S A;  2A68 F;  3SDB A;  2KRH A;  4F93 B;  3BG3 A;  4AUX A;  5JVG F;  2VB6 A;  4ESF A;  1RUN A;  4CXF A;  2RN7 A;  2ICW G;  3RIR A;  4S04 A;  4A3L J;  4PSW A;  2IPQ X;  1Z3X A;  1CGP A;  1QZY A;  1K83 J;  2BOL A;  2L0K A;  4CGZ A;  2FML A;  2JA8 J;  4AU7 A;  4IOA F;  2DT6 A;  3ELK A;  4B09 A;  5DCM A;  2DFF A;  2D45 A;  2XKP A;  4G7H F;  3ZP5 A;  4E7L A;  5LD2 C;  3HOX J;  1MND A;  1EA3 A;  4AVZ A;  1YQA A;  1DPR A;  1MNM C;  3DU6 A;  4XLF A;  1IXC A;  1X1A A;  1MBJ A;  2GA1 A;  5FKM A;  3J7A Y;  2FOK A;  1YYV A;  3J81 K;  5FD6 A;  3QQA A;  3JSO A;  3ZN1 A;  3L2R A;  3DKY A;  5EJC A;  2VPR A;  2R7Q A;  2HEO A;  2MAB A;  2Q1Z B;  5DUI A;  2IXS A;  4KMF A;  2L7F P;  3K6G A;  4Z2Y A;  5L3D A;  1ETK A;  5J6X A;  3JTH A;  5IY5 H;  3DWL E;  2L5Q A;  4X1E A;  2X0L A;  3T5X A;  2ISZ A;  1HKT A;  3PSF A;  2GBY A;  2OF7 A;  3JRD A;  2I5U A;  4M72 A;  1E17 A;  2KP6 A;  3K4N A;  3H0D A;  1AKH A;  3I3L A;  3FMS A;  1R00 A;  2WAQ A;  3CDH A;  2QZ8 A;  2LMD A;  3RSN A;  2A05 A;  4M3D A;  4OMZ A;  3H9Q A;  3WTS C;  2WB1 N;  3ULQ B;  4E6K G;  2KT0 A;  4I99 C;  1TQP A;  2K4B A;  3M07 A;  3PO2 J;  3J80 K;  2KDZ A;  2CGP A;  1D0Z A;  1XTA A;  2V9V A;  5F0C A;  3HEF A;  5L3F A;  1ZRE A;  2GLO A;  1MBH A;  2H8W A;  3RYR A;  3UR3 C;  1FYM A;  2H94 A;  1STZ A;  1TW2 A;  1Y0N A;  3DEU A;  2L01 A;  1YIJ I;  4WCG A;  2Z5U A;  3HKZ A;  4PJN A;  4RAF A;  5K1Y A;  3KE2 A;  1T39 A;  1VF9 A;  4EAT A;  5FFZ A;  3JRC A;  1OYI A;  1X3W B;  5KHD A;  3M1C A;  2BY3 A;  1K78 B;  4N9I A;  2HDW A;  4G94 A;  1OYY A;  4C2U A;  2HQ5 A;  4BU2 A;  4XK4 A;  2GWR A;  4Y33 A;  4EMS A;  1R22 A;  2A5Y B;  2HR3 A;  5HS7 A;  1WH7 A;  3J7Y J;  1X1C A;  1R1T A;  5CVV A;  3S1N J;  3I64 A;  4X6A J;  1UST A;  3E5Q A;  3ZXS A;  4G6T B;  5CVJ A;  2R7Z J;  4LG0 B;  1A6Q A;  4XLP F;  1RNL A;  4R79 A;  4BQO A;  2UXN A;  5TIS C;  5IP7 J;  2GAU A;  3GTJ J;  1T0F A;  2DDB A;  1GXP A;  2QQB A;  3DEW A;  3IWZ A;  4HDU A;  4OIP F;  3MVP A;  3HM5 A;  2IGN A;  3QPL A;  1IXR C;  2AHQ A;  1RR8 C;  2X1E A;  1X1B A;  4BGD A;  3WTT C;  2HPM A;  2EV6 A;  2PX9 A;  1ETV A;  3I59 B;  3FWE A;  3CUQ A;  2JT1 A;  2BBY A;  3HC7 A;  1X2N A;  2XAG A;  4FET A;  4XRS A;  4NQW B;  2DDA A;  2V1X A;  4CCN A;  2R4G A;  1EH6 A;  3L2W A;  3GTL J;  1DPU A;  4I0B A;  2CU7 A;  2W82 A;  5EEA A;  3SJM A;  3QP5 A;  2L3D A;  1S72 I;  3E5X A;  3WE3 A;  3OYB A;  3W6V A;  1HDD C;  1BW5 A;  2E36 A;  2F4O B;  1TLH B;  1J09 A;  5DD8 A;  3CCQ I;  3E5U A;  4NHJ A;  4HF1 A;  3M9A A;  1VQ6 I;  1G8X A;  3I56 I;  2E34 A;  1NG6 A;  2VIX A;  3DCF A;  2RQP A;  3KP3 A;  5KCM A;  1XDU A;  5J4V A;  3AG3 H;  3HG9 A; 
#chains in the Genus database with same CATH homology
 5C44 J;  5EF6 A;  1ZR2 A;  1X58 A;  1FTT A;  1UMQ A;  2IAI A;  2FQ4 A;  4IHW A;  2HOA A;  3BR2 A;  2MG4 A;  1JJ6 C;  2L7M P;  5FKN A;  2Y9Y A;  5EZH A;  1H88 C;  3TW6 A;  1EF4 A;  5DTD A;  5F04 A;  1WCM J;  1BA5 A;  1B72 B;  1ETW A;  3QPS A;  4D7N A;  2DA4 A;  4IHY A;  2COB A;  3LSG A;  2EH3 A;  2CQQ A;  3M4O J;  1JUP A;  2XGC A;  5K7Z A;  1XC5 A;  5FJ8 J;  1VFC A;  1LFU P;  1IDZ A;  2VKV A;  5C4J J;  1B8I A;  3HDD A;  2M8G X;  1HF0 A;  2DA3 A;  2PMZ N;  3BT9 A;  2JJ7 A;  5C4X J;  4JX6 A;  4FCY A;  1S7E A;  1MH3 A;  4UUS B;  1TWG J;  5EG0 B;  2XRL A;  1MBE A;  3CDL A;  1U9O A;  2XPW A;  1QRY A;  5JLW A;  1NK3 P;  3HOY J;  1IRZ A;  5FLM J;  2H1K A;  4MFE A;  2GM4 A;  2M9H A;  1WGX A;  1WI3 A;  1R9T J;  1IDY A;  2D5V A;  3OSF A;  1E3O C;  5E3O A;  3M3Y J;  4B4C A;  2NVQ J;  3JRA A;  2N8G A;  1GT0 C;  1JGG A;  2WAQ N;  3S1Q J;  5DS9 A;  3ZOB A;  3Q0W A;  3I4N J;  3MKL A;  1TWH J;  5F0H A;  4S0H B;  3IV5 A;  1JKP C;  4A69 C;  4RDU A;  2JA6 J;  1U9N A;  2FD5 A;  4A3J J;  2K9Q A;  2O9L A;  1HOM A;  2DMQ A;  2DMT A;  1D5Y A;  2LY9 A;  5C3E J;  3S17 J;  1X2M A;  2NS7 A;  4A3C J;  1MBK A;  2ECB A;  2XGD A;  1RKT A;  5F08 A;  2R92 J;  3HB9 A;  1OJL A;  3OOU A;  1WH5 A;  2M34 A;  2ID6 A;  3HKZ N;  1T33 A;  3RZO J;  3GTG J;  5FKL A;  2CJJ A;  5EGO B;  1MH4 A;  2ZB9 A;  1ITY A;  5IOZ A;  2EBI A;  3TP0 A;  1GVD A;  4C3J J;  3CMY A;  2XB0 X;  3BR6 A;  2XPU A;  1IUF A;  3SDG A;  1I6H J;  3WHB A;  3FIS A;  3Q0V A;  2LD5 A;  5IPA A;  1FJL A;  2YUS A;  1Y1V J;  4B3A A;  1GV5 A;  1AHD P;  1HCR A;  2M2E A;  2QCO A;  1TWC J;  1MSE C;  3CCY A;  3ZQI A;  3HOW J;  5F1J A;  1ORK A;  5K7F A;  1MBG A;  1XS9 A;  1RKW A;  4RBO A;  5E3L A;  1BL0 A;  1JKR C;  4V2G A;  1YRN B;  3B6A A;  1WPK A;  1JKQ C;  1UHS A;  3S15 J;  2JA5 J;  4CYC B;  2JA7 J;  2Y9Z A;  1ETX A;  5GPA A;  1TC3 C;  4I76 A;  1ZQ3 P;  5FLV A;  4IHV A;  2L9R A;  3IH3 A;  1P7I A;  2NVY J;  4MO7 A;  4V2F A;  1LE8 A;  2ID3 A;  2NS8 A;  3RZD J;  1O4X A;  1OCP A;  2Y0S N;  1NK2 P;  3OIO A;  2QF7 A;  4FE7 A;  2E1O A;  4XRS G;  3BQZ A;  5J3L A;  1F43 A;  3RQI A;  1AU7 A;  3BR5 A;  3BR3 A;  1FEX A;  2FJ1 A;  1AKH B;  2E2J J;  3BG9 A;  4M3E A;  5M5X J;  3BTJ A;  3GTQ J;  1OCT C;  4XIC A;  1ETY A;  2DTZ A;  1RR7 A;  1JKO C;  4A3E J;  2E2H J;  2I10 A;  2LTP A;  2DJN A;  3H3V K;  2XPV A;  1ZK8 A;  5GP9 A;  5E3N A;  2JN6 A;  5IOY A;  3WHC A;  5M5Y J;  2JWT A;  1XG1 A;  1W0T A;  2HOS A;  1IGN A;  3S14 J;  4XRM A;  1ZGW A;  3BTI A;  1I3Q J;  3A02 A;  4JP0 A;  1K61 A;  2NVX J;  2VUM J;  2HOT A;  2K40 A;  2ELK A;  2WV1 A;  2K9N A;  4DYC A;  2OPT A;  2AO9 A;  1UG2 A;  2G0E A;  3RKQ A;  4UUT A;  3JRI A;  1T56 A;  3BTC A;  5JLX A;  4QSH A;  4GFB A;  3ZQL A;  4C3I J;  1B72 A;  4BKX A;  4ABZ A;  3Q0U A;  3TED A;  1JUS A;  4C3H J;  4A93 J;  2NOG A;  4B1R A;  2CUE A;  3FKI J;  4M3G A;  3JR9 A;  4M3B A;  2M0C A;  2R5Z B;  4QIW N;  4A3B J;  4A3G J;  4EEF G;  3C2B A;  3ZQG A;  2H8R A;  1Z0X A;  3HOU J;  2X48 A;  3A01 B;  1TWA J;  5J1U A;  2LKX A;  1ZTR A;  1RPW A;  2DA6 A;  3HBL A;  4G12 A;  2VKE A;  1U78 A;  2ECC A;  2ME6 A;  5E3M A;  3BR0 A;  5FKK A;  4MIM A;  3HGY A;  4UUS A;  2XB5 A;  2MGQ A;  5EG0 A;  1HDP A;  3K7A J;  3G1L A;  5IP9 J;  3PO3 J;  2JK3 A;  2YU9 J;  1VND A;  4AC0 A;  1OFC X;  3SFI A;  1H8A C;  4IEJ A;  2EQR A;  2ME0 A;  1IJW C;  3HGG A;  3GTO J;  3GTK J;  1A6I A;  5K7H A;  2HXI A;  3FK7 A;  1ZKG A;  2LFB A;  4JYK A;  4HNV A;  3G1O A;  4BXX J;  2R5Z A;  4W97 A;  1BJZ A;  2R5Y B;  3HOV J;  1JTX A;  4DYR A;  2B63 J;  1JUM A;  4FTH A;  5FKO A;  1GUU A;  1ETQ A;  4D5F A;  3BTL A;  1MSF C;  5M3F J;  4DYQ A;  1QVU A;  1P7J A;  3I4M J;  2IBD A;  1LFB A;  2XSD C;  2TCT A;  1JTY A;  2EZK A;  1RES A;  1G2H A;  5IP6 A;  3CQZ J;  5F0F A;  1DU0 A;  1GV2 A;  3LOC A;  4C2M J;  2DA5 A;  5EGO A;  1GDT A;  2L7Z A;  2DA2 A;  2DMU A;  4BY7 J;  2VI6 A;  3NAU A;  1CQT A;  3JRF A;  4A3M J;  2HXO A;  4Y7N J;  3IH4 A;  3JRG A;  3BG3 A;  3PM1 A;  4W1U A;  4AUX A;  5M3M J;  2R93 J;  4A3L J;  1I50 J;  2X9D A;  5J1Y A;  3LSJ A;  1K83 J;  2LP0 A;  3O8H A;  3O8G A;  2L0K A;  1JT6 A;  2JA8 J;  2Y30 A;  3GTP J;  1SFO J;  3LSP A;  4IHX A;  2LR8 A;  4DW6 A;  3HOX J;  3B6C A;  4I6Z A;  2DMP A;  1MNM C;  1H89 C;  3ZQH A;  1MBJ A;  1HLV A;  1YRN A;  4LOC A;  3OSG A;  5FKM A;  4CYC A;  2TRT A;  5BNG A;  3QQA A;  4A3F J;  2DMN A;  3GBG A;  1NTC A;  2VPR A;  2EZH A;  5IYC J;  2R0Q C;  3NAR A;  2CRG A;  5F27 A;  1U8B A;  2CQX A;  2JMW A;  2L7F P;  4MLO A;  1ETK A;  1IG7 A;  5EZG A;  4X1E A;  4NDL A;  2E2I J;  3ZQC A;  1TWF J;  2GBY A;  2HYJ A;  2OF7 A;  3JRD A;  1SAN A;  9ANT A;  2Y31 A;  3S1M J;  1AKH A;  5IYD J;  2O8K A;  4DZP A;  1DU6 A;  4M3D A;  1VI0 A;  1JT0 A;  2WB1 N;  4AYB N;  1A5J A;  2KT0 A;  3K2A A;  1BW6 A;  2CUF A;  2HI3 A;  4JX4 A;  3PO2 J;  4D7M A;  3BQY A;  2KDZ A;  3LNQ A;  5F0C A;  3HEF A;  2W48 A;  2GLO A;  1MBH A;  2LLK A;  2DN0 A;  3BR1 A;  4M6V A;  2P81 A;  1VF9 A;  4FE4 A;  3JRH A;  1JJ8 C;  1Q1V A;  2DA1 A;  1PUF B;  3JRC A;  4D5C A;  1APL C;  4JX5 A;  3D1N I;  2Y2Z A;  2HQ5 A;  4BY1 J;  4XK4 A;  3L1P A;  3H0G J;  4FIS A;  1ZR4 A;  3FK6 A;  3LSR A;  1WH7 A;  5J1R A;  2E19 A;  3S1N J;  3S2H J;  4X6A J;  2LK2 A;  4MFD A;  1POG A;  1Y1W J;  3A01 A;  4BBS J;  4A3K J;  1F36 A;  1RET A;  2XGE A;  4M3F A;  4J19 A;  2R7Z J;  3Q3S A;  4A3I J;  5M5W J;  4DZJ A;  2YS9 A;  3ZQF A;  3S16 J;  2LVS A;  5IP7 J;  1PUF A;  3GTJ J;  1W0U A;  2NVT J;  3DEW A;  3S1R J;  1QVT A;  5EYR A;  2HDD A;  1ETO A;  3MVP A;  3HM5 A;  3QPL A;  1FTZ A;  1MBF A;  2AHQ A;  3UKG A;  2X6O A;  3A03 A;  4Y52 J;  4QTR A;  2IEK A;  1FIP A;  1ETV A;  3IH2 A;  5IYB J;  1LE8 B;  2RAE A;  1IV6 A;  4A3D J;  1ENH A;  1X2N A;  2EZL A;  2R5Y A;  4XRS A;  2O7O A;  2DA7 A;  3TP3 A;  4XID A;  2MSY A;  3GTL J;  3HOZ J;  3G1M A;  4BBR J;  3S2D J;  2CU7 A;  5EEA A;  3SJM A;  3TW7 A;  5HOD A;  3MN2 A;  3JRB A;  5EDN A;  2EZI A;  2FX0 A;  3FIW A;  3W6V A;  1HDD C;  1BW5 A;  1IC8 A;  3GTM J;  1QPI A;  1Z77 A;  4L5E A;  3VPR A;  3E7L A;  1B8I B;  5GPC A;  1FIA A;  3DCF A;  3JRE A;  2MW8 A;  3F0C A;  2K9S A;  3BG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...