1MBEA

Mouse c-myb dna-binding domain repeat 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
LGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
total genus 18
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbeA00
1MSEC 5M3MJ 5E3MA 4MO7A 2WAQN 3C2BA 1FTZA 4DYQA 4A3KJ 3TEDA 2M2EA 4V2GA 2NS8A 1ITYA 1IG7A 3S16J 2LR8A 1U9NA 2K9SA 5IP9J 2DTZA 1RETA 4D7NA 5J1RA 5EGOB 1Y1WJ 1MBEA 1GDTA 3TW6A 5IOZA 3S2DJ 1GUUA 1BJZA 3JRIA 5FLVA 1T56A 1VF9A 1WI3A 4I76A 1FTTA 2DJNA 5FKNA 1A5JA 4DW6A 3BG3A 5F08A 4RDUA 3RZOJ 3BR3A 5F1JA 2OF7A 1JGGA 2HOTA 5FJ8J 2ELKA 5JLXA 5K7FA 1WH5A 5F04A 4IHYA 1ZTRA 5IPAA 4GFBA 1X2NA 3H0GJ 4A3DJ 4Y52J 1JTYA 3UKGA 3CCYA 1AU7A 4UUSA 3VPRA 2M9HA 3L1PA 2PMZN 2E19A 4D5CA 3IH4A 2L0KA 1JKPC 3ZQLA 2X48A 1JUPA 3I4MJ 1MSFC 2DMQA 3BT9A 4JX4A 4QSHA 3HBLA 2R5YA 2EBIA 2LLKA 3NAUA 1FJLA 1LE8B 4G12A 1JUSA 3FKIJ 1K61A 1Z77A 1SANA 1XS9A 1JKQC 2KDZA 4M3BA 2HXOA 3GTMJ 1B72B 5J3LA 3B6AA 3DCFA 2CUEA 2E2JJ 1O4XA 3GTLJ 2JJ7A 3IH3A 3Q3SA 2XGCA 4C3IJ 2MGQA 1ETOA 3BR2A 2LK2A 1IV6A 2YUSA 2EH3A 4XICA 1ZGWA 4JX6A 5BNGA 1MBGA 2DN0A 2LVSA 5E3LA 1ZR2A 1U78A 3BG9A 2M8GX 4A3EJ 1VFCA 3HGGA 5J1UA 3WHBA 5K7ZA 2VKEA 4I6ZA 3S2HJ 1W0TA 2LFBA 2EQRA 2B63J 1JJ8C 4LOCA 5F0FA 3PO3J 1IC8A 2L7ZA 4A93J 2L7FP 3HM5A 3MVPA 2E2HJ 1FEXA 3HOYJ 5C4JJ 1HDPA 4DYRA 2R5ZB 1ZR4A 2LD5A 1DU0A 5DTDA 2NVTJ 2DMPA 1GV2A 2DA5A 3M3YJ 2VPRA 2EZIA 3QQAA 3HEFA 1PUFB 1E3OC 1IDYA 4XRSA 4XRSG 3JR9A 2O9LA 2AHQA 4XK4A 1ETVA 3S17J 4J19A 1NK3P 1WH7A 3CDLA 1P7JA 1TWCJ 2XPUA 2P81A 3A02A 5FKOA 4AC0A 2Y9ZA 3WHCA 4MFDA 1H8AC 3I4NJ 3SDGA 2VI6A 2QF7A 4DZPA 3HKZN 3TW7A 3Q0UA 5EG0A 3ZQGA 4IHWA 5IYCJ 3O8GA 3O8HA 5M5YJ 1Q1VA 2EZHA 2K40A 2I10A 2DA7A 1YRNA 2XB5A 2YS9A 4V2FA 2KT0A 2RAEA 5GPAA 3S14J 2Y2ZA 1H89C 1OFCX 2WB1N 1MNMC 2COBA 2XSDC 5IP7J 1JT6A 4EEFG 3JRCA 2R92J 1JUMA 2JA7J 4MFEA 2E2IJ 2JWTA 4HNVA 1JKRC 1IGNA 4A3BJ 5M5WJ 1MBJA 1MH4A 3NARA 3PO2J 2FX0A 2W48A 1QPIA 4ABZA 5EZHA 4M3EA 2O8KA 3JRAA 2H1KA 5C44J 4UUSB 3BR6A 3ZOBA 2CU7A 1SFOJ 2IAIA 2FJ1A 5K7HA 1EF4A 2DMNA 2Y9YA 3BQYA 4NDLA 2R5YB 1LFUP 1CQTA 2GM4A 1RKWA 3FK6A 4FCYA 2CQXA 1POGA 4C3HJ 2ECCA 1I50J 3Q0VA 4A3FJ 2NOGA 1QRYA 4JP0A 1HOMA 3FK7A 1ETWA 3BR5A 4A3CJ 4B4CA 3F0CA 4QIWN 1A6IA 4FE7A 4FTHA 1U8BA 3GTKJ 2Y0SN 2AO9A 4X6AJ 2MG4A 4IHXA 3MKLA 4B1RA 4DYCA 1MBFA 2JA6J 3BG5A 2DMUA 1WCMJ 2LP0A 3TP0A 2DA6A 2HXIA 1UG2A 4X1EA 3LNQA 4A3LJ 1I3QJ 4MIMA 1G2HA 2GBYA 1F36A 4XIDA 5GP9A 1RKTA 2XPVA 5C3EJ 1RR7A 1ETQA 1P7IA 1HDDC 2CQQA 1JT0A 5FLMJ 3RKQA 3HOVJ 2ID6A 2QCOA 3BTCA 1AHDP 1AKHA 4RBOA 5IP6A 1LFBA 1Y1VJ 4CYCA 4AUXA 2IEKA 5EEAA 1GV5A 1W0UA 2IBDA 2Y31A 3A01A 2DMTA 2CRGA 3IV5A 3S1QJ 2NVXJ 1BW6A 1GT0C 3OIOA 4IEJA 5IYDJ 4AYBN 5JLWA 1HCRA 3ZQCA 3TP3A 4C3JJ 2XGDA 5E3NA 5EYRA 3S1NJ 1Z0XA 1TWFJ 2MW8A 4DZJA 2H8RA 2NVYJ 3G1MA 3GTQJ 4A3JJ 1S7EA 2JN6A 1FIAA 2FQ4A 3CQZJ 2NVQJ 1JJ6C 4IHVA 5EG0B 3BQZA 2DA4A 5DS9A 5F27A 2K9QA 2XB0X 1RPWA 3MN2A 1MH3A 2L7MP 2NS7A 5FKKA 4XRMA 5M3FJ 1B8IA 1IJWC 2N8GA 1YRNB 1VI0A 2R0QC 2M34A 2HOAA 3JRFA 2L9RA 3HB9A 2DA1A 2MSYA 1X2MA 3DEWA 3JREA 5C4XJ 1I6HJ 3LSJA 3S1RJ 2EZLA 3LOCA 1TWAJ 3IH2A 3K2AA 5IOYA 2O7OA 3W6VA 3QPLA 3GTPJ 1ORKA 1QVUA 4M3DA 3OSFA 5EGOA 1WGXA 2CJJA 2ECBA 2FD5A 1ETKA 3GTJJ 2JK3A 3HGYA 2JA8J 2YU9J 4BXXJ 2WV1A 2JMWA 2HOSA 3M4OJ 4BKXA 2K9NA 1BW5A 1MBHA 4M6VA 5J1YA 2VKVA 3RQIA 3A03A 3G1OA 2LTPA 1H88C 2JA5J 1IUFA 1JTXA 3OOUA 2HYJA 1HF0A 3B6CA 1WPKA 4MLOA 4W1UA 2EZKA 3HOUJ 4S0HB 1OCTC 1ETXA 4M3FA 1XC5A 5FKLA 1GVDA 3SFIA 5GPCA 4C2MJ 2G0EA 1UHSA 3S1MJ 5HODA 3D1NI 3E7LA 4UUTA 1QVTA 2LY9A 1T33A 3QPSA 1ZKGA 4A3MJ 3CMYA 2CUFA 1TWGJ 2OPTA 5IYBJ 2LKXA 3GTOJ 1LE8A 1BA5A 3H3VK 3GBGA 1UMQA 4JX5A 3G1LA 4L5EA 5F0CA 4M3GA 2R93J 2TCTA 1TWHJ 4A3IJ 2Y30A 3BR1A 3S15J 1IRZA 1D5YA 2DA2A 3LSGA 3LSRA 1RESA 1B72A 3ZQIA 5EF6A 1TC3C 2XGEA 2HDDA 2DA3A 3PM1A 1VNDA 4A3GJ 4BY1J 1NTCA 1BL0A 3FIWA 3LSPA 2VUMJ 2XPWA 1X58A 2ME6A 1DU6A 5FKMA 3BTIA 2X6OA 1APLC 4D7MA 2E1OA 2ZB9A 1ZK8A 1NK2P 1HLVA 2D5VA 1OCPA 1IDZA 2R7ZJ 3BTJA 4W97A 1AKHB 3JRGA 1XG1A 3BR0A 3BTLA 3RZDJ 3ZQFA 4CYCB 5F0HA 3A01B 3ZQHA 5EDNA 2TRTA 3JRDA 3Q0WA 4JYKA 3GTGJ 4BBSJ 1FIPA 2M0CA 5M5XJ 3HDDA 4FE4A 2ME0A 3K7AJ 1R9TJ 1ENHA 5EZGA 4A69C 4D5FA 2ID3A 2X9DA 3JRHA 2R5ZA 3SJMA 5E3OA 1MBKA 1JKOC 3JRBA 2XRLA 1PUFA 1ETYA 9ANTA 3FISA 3HOXJ 1U9OA 4BBRJ 2GLOA 4QTRA 3HOZJ 3HOWJ 2HI3A 2HQ5A 4BY7J 4Y7NJ 3OSGA 4FISA 1ZQ3P 4B3AA 1B8IB 1F43A 1K83J 1OJLA
chains in the Genus database with same CATH superfamily
3LA7A 3VYRB 3SEZA 2MBFA 4F92B 1KA8A 2GIVA 3P5JA 2VC0A 4V2GA 3U21A 1IG7A 1QO0D 1QZEA 2K9SA 4A5MA 4U0YA 2RREA 3BCAA 4KYWA 5L3BA 4BL0B 4HLYA 3CC7I 5EGOB 1GDTA 3TW6A 1R71A 5IOZA 3S2DJ 4I0BA 4KJZA 5FLVA 4QPOA 5E1XA 2F5DA 1VF9A 4I76A 3O2PE 1DP3A 2CW8A 4AYBA 2XUBA 3ISPA 3BG3A 4Z2YA 1X1DA 3K4KA 3OYGA 2ZXJA 3BR3A 4BQQA 3R0AA 5LBQA 1WJEA 4BXFA 5JLXA 3VFZA 1MGTA 5EEGA 3M1CA 2DODA 1R4MB 3PIOF 5L3EA 2A07F 1BIBA 3H0GJ 3REOA 1G8XA 1HC8A 1Y39A 3BG7A 4Y52J 3J7AY 2ISYA 3VPRA 5K5OA 1VTNC 4XLEA 2HPIA 2X4HA 2PJRB 1LDDA 5DCMB 1JKPC 2QKLB 3EDPA 3BPXA 4LIUA 3DPLC 1JUPA 4O3MA 4GDFA 3I4MJ 2DMQA 2P5LC 4JX4A 4QSHA 2K3PA 3VDXA 2A6TA 2Z33A 2DCEA 2W4SA 3DBHB 2RNGA 1L3LA 3I64A 3CESA 1U5TC 1IV8A 1I3AA 4G12A 1O7LA 3L2WA 1K61A 1LEBA 1ZGAA 5IT9Z 2CV2A 5LEJA 1BR2A 3FMQA 4OINF 1PP7U 2H6BA 2BVLA 1TL8A 1WFXA 5J3LA 2E5NA 1SVMA 5D5XB 2CUEA 2LREA 5KAFC 1O4XA 1OR7A 2XGXA 3Q3SA 1TQMA 2XGCA 3RIRA 5A2QZ 3F22A 5JVTA 5K5RA 5ED4A 2VASA 4IXAA 4BS9A 2R7RA 2YUSA 4DQ2A 1JHFA 3D0SA 4XONA 1KU2A 3W2VA 4BDYA 2HTSA 1ZR2A 2CW0F 2YX4A 4KFCA 3DBLB 1WJFA 3J80K 4JBAA 1FBUA 4I6ZA 4YFXF 1W0TA 1XMKA 2LFBA 2B63J 1QZZA 2ZJPF 3K1NA 1JE8A 1SAUA 4L9NA 4RM3A 2QSGX 2A6HF 3S3MA 3C2GA 3MVPA 4DYRA 1T38A 3CCMI 2LD5A 1DU0A 4EJVA 2VJJA 2DMPA 5DYMA 4DBRA 2DA5A 2DBBA 2EZIA 1PUFB 3HEFA 1IDYA 2VBWA 4XRSG 4ZYHA 1R49A 4ZDOA 2O9LA 2BV6A 2WTEA 4ENNA 3S17J 2F4OB 1X4OA 2JQ7A 2KL4A 1TQIA 1LJ9A 1V3FA 3CZ6A 4BJ6C 4ZZLA 1TW2A 3RJPA 3I59B 4AC0A 2Y9ZA 1YHQI 1GVJA 1P4WA 1VQ6I 4FQGA 4ZYGA 3SDGA 1FC3A 2R3SA 4DZPA 2CQ7A 4U88A 4LJZF 2OZ6A 2FF4A 4XLFA 4BUPA 4IHWA 3O8GA 2W00A 2M30A 3K4LA 2ZC2A 2EZHA 3T8TA 3I3LA 2MABA 2K40A 4XNFA 3K70C 2BVMA 2GIZA 1GHCA 1E3PA 5B5EC 4UUVA 5TISC 4HQEA 3ZQQA 2Y2ZA 2TDXA 4EQQA 1OFCX 2WB1N 2DQRA 1KZHA 3FBIB 5AONA 3LSMA 2XSDC 5L3CA 3EUHA 3ULQB 5IP7J 3AL0C 4EEFG 3U1KA 4PFPA 5LEKA 3JRCA 2ISZA 3GZNB 2LH9A 2VBXA 1IGNA 1KQ0A 1V5GA 2FX0A 1N25A 3KP4A 4O6JA 3O6BB 4ABZA 2O8KA 2DPDA 5C44J 2CQNA 1VQ5I 2XHKA 4N4NB 5HOOA 3ZGKA 2KDOA 2EV0A 1QHHD 2QLZA 2CU7A 4AIKA 1EF4A 3J80Z 5L3GA 2DMNA 3BC8A 1R36A 2L2OA 1NG7A 3MAJA 2DT6A 2GM4A 1KQ8A 1FY7A 1YW8A 3FK6A 3BP8A 3FXLA 2CQXA 4Y15A 3LSHA 4PFOA 4C3HJ 4L5IA 1I50J 2RN7A 3V8KA 4RGXA 2NOGA 2NXNB 4ESFA 3PSFA 3AG4H 4CCLA 1ETWA 4RAFA 1WZ2A 3GWZA 3MZYA 4E70A 4IRIA 4A3CJ 2OTJI 4B4CA 5D4RA 1FSHA 1XGNA 3QPHA 2O6GE 4FE7A 2BOLA 2ADUA 1DGRM 3GUDA 3EQLF 2H27A 1FOWA 3BROA 2X6WA 4FT8A 4DYCA 1MBFA 1QPMA 5LLQA 3KETA 1ULYA 1SFXA 2DMUA 3QP5A 4X0GA 2M87A 2DA6A 2VBYA 3R6SA 3WU1B 3I9V2 4OIPF 5FFZA 4A3LJ 1LEAA 4A5NA 3ZR8X 4B44A 4IOAF 4UVCA 3AG3H 5FD5A 5F6FA 4XIDA 2OU2A 1G4DA 3F8CA 5E8IA 4ESBA 1ETQA 1D5VA 3ZN0A 2FMYA 4KA4A 1G6NA 2HQAA 3HOVJ 3OR2C 3BTCA 3DLLF 1AKHA 3ASNH 3S3OA 1TBXA 1W0UA 4GYIA 2F5EA 3A01A 1WHUA 2CRGA 3IV5A 2L4MA 3IP4B 4EJUA 4OMZA 4AIHA 1K7AA 3PUBA 4KT6A 2P4WA 3SQNA 2J5PA 3CP2A 3WTXC 2VT3A 2ZFWA 1OYIA 4IEJA 2W84A 5FGMA 1HCRA 2P8TA 2IJLA 2X1CA 3TP3A 5J4YA 1VQNI 3S1NJ 1EKEA 1BOBA 1IN4A 3P9CA 2HDCA 3CUQC 4HV6A 2A6EF 4OAYA 3G1MA 1D0XA 4A3JJ 3K10A 1MNEA 3CQZJ 2AS5F 1G59A 1TLHB 2KHMA 3E0JB 5DS9A 5D6EA 2K9QA 5F27A 4BHCA 4YIRX 2BY1A 3ONQA 2V1UA 4YFKF 2LSOA 1U2WA 2GOXB 5FKKA 3HHHA 1ZAOA 3E6BA 5M3FJ 1B8IA 1R23A 1IJWC 4AVPA 2IT0A 2EV5A 3ZP5A 4RB2C 2L3DA 2V1NA 1VQLI 2M34A 3E3VA 3RYRA 4AWXB 1Q1HA 3VYTB 3IWZA 2STWA 1PUEE 3C3WA 2Z5UA 1B9NA 1KU3A 1X2MA 3JREA 2HZTA 1ZN2A 2V9KA 3CF2A 5LHGA 5BMZA 1UAAA 4IKFA 5FD6A 1WGXA 4CICA 1G3SA 2CJJA 2XROA 1S7AA 4RM2A 1U3EM 4IX7A 3U2RA 1ETKA 2OBPA 4M6YA 4L18B 2EIMH 2DDBA 2KIQA 2HYFA 2JA8J 4ZYEA 3LWFA 2OCEA 4IO9F 4BKXA 1WJ5A 3FXRA 1A31A 2K9NA 3AAFA 5J1YA 5E17F 3G1OA 2JA5J 2X6XA 2K7LA 1OMIA 2K27A 2OAZA 3B6CA 3LFUA 3H3ZA 3Q5FA 4NB5A 2EZKA 4S0HB 1ERDA 2KIFA 1ETXA 4G7OF 2K85A 2Q1ZB 3HC7A 2CMPA 3S1MJ 1LVKA 5LD2C 4UUTA 3L2UA 1T33A 4HSTA 2CUFA 2LKXA 3DTEA 2R7TA 1LE8A 4E7KA 3BZKA 1YI2I 2R7QA 1UMQA 4JX5A 2JT1A 2KRCA 4PUSA 1XMXA 3G1LA 1X1CA 1FWZA 5F0CA 2EILH 4M3GA 3MKYB 3CDHA 2TCTA 4N9HA 4FETA 2Y30A 3BPVA 3KYCB 4R1HA 1IRZA 2KRHA 1FSEA 1TC3C 2UZKA 2DLLA 1ZARA 4EMSA 3DKWA 4BY1J 1BL0A 3N97A 1J75A 3LSPA 3PNTA 3A0BC 1DQUA 1KU7A 2X6OA 4XBFA 2XDVA 2E1OA 2ZB9A 4WXDA 2CQKA 3FXUA 3M07A 1IDZA 1HKQA 1AKHB 2NVUB 3QWLA 3RZDJ 4B47A 1O3TA 3G2BA 5GTHC 3A01B 1UFMA 3V7CA 4CHUA 3KZIC 4RLQA 3WTZA 1XMAA 2K9MA 3JRDA 4WWCA 1MIJA 3ABMH 2EFOA 5M5XJ 3HDDA 3ROUA 5DD4A 2ME0A 3K7AJ 1ENHA 2CFXA 2E1MB 5E79C 2K02A 4D5FA 3JRHA 4K2EA 1T08B 3KEOA 3SJMA 4BQAA 1HXDA 4EM1A 3CCVI 1IN5A 1RZ4A 2HU9A 3G71I 1XCBA 3FISA 2PQ8A 2PX9A 3KIOA 3KP5A 2GLOA 4QTRA 5D4SA 3J7ZI 2VN2A 3DBRB 4XMYA 2ZXHA 1UELB 2MLKA 4FISA 1FBQA 3I58A 4B3AA 1B8IB 4LD5A 3HPHA 1K83J 1S9HA 3EUKL 4YELA 1MSEC 1XSVA 2Y75A 2JSCA 2GAUA 4DYQA 3L00A 3TEDA 2CV0A 3BG6A 2VB6A 2LF8A 3S16J 2LR8A 3FXMA 2ZBKA 5IP9J 2RGVA 3PUFA 5BPIA 1RETA 4CZCA 5J1RA 2KZVA 3HTSB 3JTGA 4E7IA 2ICWG 2EFPA 5KAIC 3JRIA 5IT3A 1WI3A 5E1WA 2DJNA 3SZTA 4AM3A 3VEPA 1YIJI 1K4TA 2R7SA 4DNCA 5JI6A 1U5TA 5DV5A 1A5JA 4DW6A 3OYLA 1BI0A 1TT5B 2V1DA 4P5OA 1PJRA 3MEXA 2QUFA 3HRUA 2K9LA 2O5RA 3GLLA 3RKXA 1WH5A 1QQIA 2ELHA 4IHYA 3F8BA 3F8FA 1ZTRA 3QRFF 2WAEA 3LSKA 3VWBA 3L09A 4BE2A 1JTYA 3UKGA 1YOVB 3CCYA 1H9GA 2M9HA 3L1PA 1ZH5A 2PMZN 2H94A 1JI8A 4D5CA 2P7CB 2X48A 2OQRA 3OYBA 3H5RA 2KISA 3GXOA 3RCOA 2LLKA 1O3SA 3KZZA 6PAXA 2DK5A 2VQCA 1LE8B 4OIQF 2RKHA 2O8XA 3OS1A 2DI3A 3FKIJ 1SANA 4UNOA 4XRFA 5BS6A 1JKQC 1EV7A 1HKTA 3S3NA 3LQRA 2MC3A 4PJNA 3CD6I 3QYEA 2L54A 2M7AA 3KX2A 1K6OA 4M9XA 5HLGA 4DIQA 1SD7A 4I02A 2WAFA 2JJ7A 3RYPA 1SVOA 5HS9A 4U0VA 2KMUA 2XAGA 1YFHA 1ETOA 3BR2A 3DKXA 3QYFA 3TOBA 4HG2A 2KKOA 1LFPA 1IRFA 2EH3A 4A6EA 1FYKA 3AG1H 3RSNA 1Y56A 2IXSA 4D9JA 2DN0A 2HWVA 3DPTA 2ZSHB 3OWTA 3PNYA 2XC7A 3BG9A 1U78A 3HRTA 4A3EJ 5KK1A 2HPMA 1ACIA 3HGGA 4BJTA 2VKEA 2W1OA 5E8GA 4HDUA 4I0AA 4G8XA 5JR3A 1P6RA 3GF2A 3IUOA 3TBIA 4U87A 3MZ8A 3HHGA 3PO3J 4G7ZF 3TGNA 3OYIA 1MJAA 2CUJA 2IGMA 3QYBA 2KZGA 1G3WA 1NHAA 5IT9K 3KFWX 1IF1A 5C4JJ 2BXZA 1ZR4A 2ZXIA 1GXQA 4MQVA 2A5WA 2P6SA 1GV2A 4HX8A 4UXNA 2BYVE 2VPRA 3CJRB 4J00A 1E3OC 4EM0B 2D45A 2L4AA 3OY9A 3WTSC 2ZNZA 5B3SH 3GMEA 2V7FA 2J5OA 3KP7A 1WH7A 4EGYA 3CDLA 1P7JA 1S72I 1YJ9I 3ZMTA 2XAFA 3PQJA 2F4IA 2BY2A 4C2TA 3ABTA 1J09A 3MQ0A 5FKOA 4OIRF 2XF5A 3WHCA 5J6XA 4YRVA 1LB2A 3J7AO 4MFDA 2BBYA 3OL4A 4IRGA 3I4NJ 2CH0A 2VI6A 1R1VA 2QF7A 4U7DA 1HQCA 3ZMUA 2C6YA 1VQ8I 2MYSA 3IL2A 2DFFA 1YG2A 2RVCA 3A2KA 2JA2A 4EVIA 2W7NA 3JSPA 1Z3XA 1ZG3A 4G9YA 2DA7A 3CF5F 2XB5A 2MD0A 2KT0A 1FMWA 3L2RA 3S14J 1H89C 1TNTA 3OYHA 5KVRA 1DPUA 1FYLA 4XSZF 1SMTA 2HTJA 2UV1A 1U5TB 3MWMA 2FOWA 4CUGA 3PFYA 1JT6A 4HQMA 3CCJI 2BW3A 3V42A 1LQ1A 3OS2A 4LK1F 1JUMA 2ZJ2A 3ABKH 3ASOH 4NQWA 2QQ8A 3MZHA 3R0JA 3WE2A 2E2IJ 1FLIA 3JAMZ 2VODA 4BE0A 1EH6A 1JKRC 5M5WJ 4PJMA 1MH4A 2DYSH 5JVGF 4XOPA 2UUZA 4BU2A 2AXLA 3IWFA 2W48A 1QPIA 2OQGA 4M3EA 2AXTC 2F4MB 1MDMA 2IA2A 3BR6A 3KZYA 4L0YB 3OR1C 3CCLI 4Q48A 2M1BA 3J81K 2K5CA 2WAQA 4MEXF 4Q5SF 2O0YA 4XN3A 3K69A 4HYEA 4LMYA 2JUGA 1YITI 2ZJRF 4FX4A 1Y8RB 4PZJA 1BI1A 2MH2A 3DLAA 2MD5A 1FNNA 2LDUA 4IF4A 2M45A 2OUMA 3RTRA 1MMGA 2OTLI 3PL8A 2BHZA 1M1EB 2JZYA 3C18A 1A6IA 4L5JA 4FTHA 2WB1A 4XLAA 1U8BA 4F7ZA 3BWGA 2AO9A 3ABUA 4AU7A 4BHBA 3SDBA 4PJLA 3MKLA 3ZCOA 3ERMA 4YEJA 3E6DA 1XCVA 2M0MA 2L02A 3LNQA 4BHPA 2VXZA 4EJWA 4CCOA 3ELKA 3KE2A 1S29A 5GP9A 1RUNA 1IW7F 1RR7A 3CUQA 3M8FA 3CCRI 2CQQA 1JT0A 2XAJA 3RKQA 4LB5A 4NNJA 1SMYF 2QCOA 3CDIA 2Y0MA 1XGMA 3B73A 4LFUA 2W82A 4RBOA 1WRJA 5B66C 2E7XA 2V6CA 3WGIA 2Z1DA 3CLOA 4PK4A 5EEAA 1GV5A 4ENKA 4IQJA 2Y31A 4PJJA 2QGUA 1JHHA 3SHFA 1I27A 2ZMEC 2A69F 4MQ9F 4KN4X 1ODDA 2VQHA 1F1ZA 1RNLA 4S04A 2QKMB 1GT0C 3RKYA 3BOQA 2H09A 2IPQX 2RC4A 4AYBN 5JLWA 4ZYAA 2XGDA 3PIPF 3FBNB 3AL0B 3CMMA 2YX7A 4DZJA 1T98A 2DTRA 3DFGA 5B1BH 1YJNI 4FHTA 4LLLA 3GTQJ 3TOAA 1Y0UA 3FM5A 1BI2A 4I98B 3IRRA 1YJWI 1JJ6C 3I5UA 5TRDA 3J81Z 4CSWA 1IN8A 2W24A 3W6JB 3I55I 4EGZA 1RPWA 3LAPA 3CC4I 3MN2A 4MHGA 1MH3A 2L7MP 4XRMA 2KJCA 2V26A 3K1MA 5LFAA 2VIXA 1ZG5A 2N8GA 2R0QC 2HZDA 2H6CA 2JTVA 2VQLA 3CCSI 3OYKA 3HB9A 2DA1A 3A4CA 4G6QA 4EM2A 2ACJA 1LDJA 2F5CA 3DEWA 3ERED 3OYCA 3IKTA 4ON0A 3S1RJ 2EZLA 2A5YB 3K2AA 3WU2C 4YIFA 5IOYA 3W6VA 2BW3B 1Z6RA 3D5SC 4M3DA 4XR6A 3KPHA 4NQWB 3HPGA 5ILSA 4L9TA 3M7GA 1SD6A 4J01A 1KYZA 2LKSA 2F5FA 1TZLA 2GWRA 2I5UA 1B9MA 1PVEA 3HGYA 4U7BA 3SZGA 3X2QH 2UXXA 3E5XA 1C0WA 2NYXA 1MDMB 2WV1A 5L3DA 4B8XA 1XDUA 4FX0A 3N05A 1TQPA 4EV0A 3ZRGA 1Z67A 1VQPI 3HKZA 2HYJA 2KIMA 4YIIA 1HF0A 1WPKA 4A0YA 5ILUA 2Q2EA 1W5CC 2G9WA 1ZREA 1SFUA 3HOUJ 2IS4A 1Z91A 4P55A 5FO5A 4ITVA 1RIOH 2M5WA 5AIPA 3FHZA 2M4KA 1GVDA 3RPQA 4IOCF 4C2MJ 1B1BA 2LF7A 2G0EA 3E6CC 4OOIA 1CGPA 3I0TA 4KIFA 4KT5C 1Z3YA 2QWWA 3CUOA 1ZKGA 4I09A 4TV7A 5D5VB 4A3MJ 3CMYA 2OPTA 1TWGJ 1X19A 2JRTA 1U0JA 4RAZA 4I7HA 3GBGA 3H3VK 1FOKA 1D0ZA 1W7PD 3L2VA 2XSJC 1UZCA 4L5EA 4CCJA 2M7BA 1IXSB 1TWHJ 4Y17A 4A3IJ 3BR1A 2BE5F 4KIBA 3HXLA 2OA4A 3LSGA 3ZQIA 2XGEA 2HDDA 4PGGA 3PM1A 4ZH4F 3AFHA 1VNDA 3IKVA 1HA8A 5DDGA 5FFXA 3FIWA 2EFNA 1LNWA 3CUQB 2XPWA 5E18F 1QGPA 1HW5A 4L0ZB 1DU6A 1E0EA 3TO7A 3OV8A 3NQOA 3V8JA 1APLC 1Z05A 4D7MA 5EEHA 1HLVA 3H9QA 4HW0A 3TO6A 3UNGC 2QA4I 1REPC 4QWQA 1YS6A 1J59A 4M73A 4NUBA 1XG1A 2FA5A 1QZYA 4A6DA 1P4AA 4OMYA 5J47A 1R4NB 1BM9A 4JK1X 3DV8A 3F6VA 1X3WB 1Z1DA 1FIPA 2EJRA 2STTA 1KQ9A 3BJOA 4I99C 1YO5C 2DDAA 2YU3A 4KUMA 4PDKA 4FE4A 2VONA 1LPQA 5EZGA 3CJTB 3H0DA 2Y0SA 2R5ZA 3IHUA 4IJAA 1NG6A 1MJBA 5B1AH 1OCZH 4QPQA 1S3JA 4CYDA 3CP8A 3C2HA 9ANTA 3ZN1A 3WODF 3HOXJ 1U9OA 1E2XA 4HA8A 3C1DA 2ETHA 2QQBA 1Y8QB 4NC7A 4BY7J 1TW3A 3W2AA 4YG2F 1ZQ3P 2RV8A 5JHFA 2EK5A 2L7KA 5H6RA 4E6KG 5M3MJ 3COAC 2DFHA 2CG4A 5AIQA 4MO7A 2W85A 2VE9A 1FTZA 3WTWC 1I1SA 2HR3A 1PYVA 5LGUA 3F3XA 1WJCA 2NS8A 1K79A 1YLFA 3RPUD 1U9NA 1STZA 4NC8A 5CVIA 1RRJA 2V4JC 2XKOA 5DM6F 1N75A 4AD9A 2JUCA 2LY2A 4XQFA 3DXJF 1BJAA 5EJCA 2ZCWA 3QU3A 5ILVA 1VZ0A 2EA2A 4N9IA 1AA7A 2V79A 1A04A 3A1YA 4F3QA 2KP6A 4MTEA 4UV8A 2DO7A 4RDUA 1MW7A 1W4MA 3ECHA 3RZOJ 5F1JA 3MD2A 3Q9SA 2GA1A 2OF7A 1JGGA 5FJ8J 2GXAA 1R1UA 4M9SA 5D8LB 2FUG2 1X2NA 1JXSA 2Q2EB 1W5TA 4UUSA 1J7KA 2H8WA 1OKRA 4BACA 1PP8F 1SD5A 3I4PA 3F6OA 3ZQLA 2G7HA 2R4GA 4E7JA 2HKOA 3TO9A 3F21A 1XD7A 5FLXZ 3BT9A 4CA0A 3LQQA 1IN6A 3HBLA 4LG3A 2R5YA 2WV0A 1UCRA 3NAUA 5K5QA 4LIVA 1FJLA 2F2EA 3QPTA 3PNVA 3DEEA 2DXIA 5F64A 5H2FC 3FXOA 3GO5A 2EB7A 3W2WA 3K0LA 2HGCA 4ZTJA 2AQFA 3TQNA 2KDZA 5BPDA 2KRFA 1XB4A 2HXOA 3GTMJ 3ZMVA 1H0MA 1KONA 1WJDA 3B6AA 3DCFA 2IS2A 1R22A 4AIDA 2E2JJ 2R7FA 2XIGA 3GTLJ 1DGWY 2MH9A 5CPRB 3IH3A 2WWYA 2BZTA 2MGQA 1BOAA 3WG9A 5J4VA 2CWEA 4BAYA 4A2UA 4XICA 4JX6A 1LDKB 5BNGA 5E3LA 2HQNA 2LVSA 3M9AA 2BHYA 1J2XA 1FMVA 1K78A 2PMZA 1B59A 4ETSA 3FM3A 2ZXWH 1R58A 2A68F 2RQPA 1P2FA 3HTUA 1P92A 1JJ8C 4KMUX 4UY8I 3KEQA 2VBZA 1FOYA 2XF6A 4A93J 2L7FP 3HM5A 3HOYJ 1YQAA 1BC8C 4GYGA 2R5ZB 2IVMA 5TJJA 1Z7UA 5DTDA 2NVTJ 1MNDA 3FF5A 2XAQA 2VKHA 3M3YJ 3QQAA 1EJ9A 3OYFA 3CTAA 2K86A 1BR4A 4ZJZA 5CVJA 4LB6B 2F6CA 3FXQA 1VQ7I 1ETVA 1FBSA 2E35A 2QYOA 2P7VB 4P96A 2VLAA 4HNTA 3WE3A 4MTDA 2WADA 3TMOA 5DCFA 2IP2A 1D1BA 1GLNA 1YIOA 3HIFA 1FP1D 2X1EA 1S8NA 3Q0UA 2LG4A 5CQGA 3ZQGA 2E1NA 5IYCJ 1HSJA 1ON2A 4ZYDA 1Q1VA 4UB8C 3R4KA 2Q0OA 4II3A 2I10A 1Z9CA 2OZUA 1O57A 2EIJH 3CMAI 2QVOA 3UR3C 2BXYA 1WWXA 1R00A 2CGPA 3KLNA 2L9SA 2IA0A 2DT5A 2COBA 4EJTA 1K4SA 3K4JA 4U0WA 2HKXA 2DOAA 2QZ8A 4BH9A 2VOPA 4ANJA 2JA7J 5BOXA 4IRHA 4MFEA 2LYCA 1XN7A 2WC2A 4HNVA 3HYIA 1O7FA 5CVRA 3MFKA 3PO2J 1B6AA 3HL2A 1X1PA 1DDNA 3JRAA 1WJAA 4UUSB 1P4XA 5KHDA 1DPRA 5DUIA 2QEXI 2DFIA 4O5VA 4HEA2 4ENMA 1SFOJ 2IAIA 2VPLA 2FE3A 4MGRA 1QNTA 4CCNA 3LA2A 4RGUA 2FJ1A 5K7HA 2Y9YA 1I5ZA 2D1HA 2R5YB 1LFUP 4BQNA 2A61A 1FP2A 1XGSA 4DOZA 1RKWA 2DOFA 2FU4A 4CCMA 3V8LA 4R79A 2K3FA 4IZZA 4FCYA 3F8NA 1UJ8A 3Q0VA 3DWLE 4A3FJ 1UHMA 3TDUC 2XF7A 4JP0A 3FK7A 3NWSA 3V7RA 1U8RA 3PJRA 4RB3C 1ONVA 3BR5A 1IRGA 1X3UA 5D6FA 3FMRA 3GTKJ 1E17A 2KLOA 3HOTA 2OD5A 3JAMK 2MG4A 2QQAA 2B9SA 4Y13A 2ZMEA 3L7WA 3RDIA 4F55A 5D5UB 2IS1A 1Z21A 3MKWB 3NEUA 1I39A 2JA6J 1XSDA 1S6LA 4F52A 3VYSB 3GW2A 4ZDPA 4OIOF 3PSIA 4MIMA 1G2HA 2GBYA 1HW2A 2XPVA 5C3EJ 1K78B 3H35A 1P7IA 4II2A 4Q47A 3JTHA 5CVUA 5BQTA 2ID6A 1YW9A 1VQMI 1FPQA 1AHDP 2P5VA 3S2WA 2VJ4A 2DQLA 1LFBA 3OYEA 4CYCA 1DP7P 1I6XA 2FQ3A 2DMTA 3WTUC 3OYJA 4UB6C 2COMA 3S1QJ 3QOPA 3GFJA 4E7LA 3RI4A 1ON1A 3JSOA 5IYDJ 3S8PA 2ZJQF 3G6EI 3L9FA 1BIAA 1ZYRF 2LNBA 4RGSA 3ZQCA 1T8IA 4C3JJ 1OYWA 5E3NA 1VQ9I 1FX7A 2H1LA 2E34A 3T1BA 1Z0XA 2VKDA 2MW8A 2FXAA 2VL8A 4Z6YA 4E7ZA 4N0BA 3DTIA 3GYHX 2LC2A 2JN6A 3OYAA 4IHSA 2NVQJ 5H20A 5CQEA 2BEOA 1K6YA 1T95A 3BQZA 2CV1A 1EA3A 2NS0A 2R7DA 5GAHJ 4BGDA 2WA0A 4CGZA 1D0YA 2EINH 2NS7A 5HLTA 3EETA 3I71A 3N4MA 3OOPA 1IRXA 2W25A 1BC7C 1LKXA 3C7JA 4BQOA 3BZ6A 2HVQA 3K4CA 3VODA 1VI0A 3H36A 1OQYA 4ZC3A 1TP4A 3JRFA 4HDVA 2OV7A 1UG0A 2V1XA 3KYLA 5C4XJ 4XLPF 1I6HJ 3LOCA 3DEUA 3IH2A 1DUXC 2O7OA 4OWRB 1V4RA 3TDZC 2EFWA 3OSFA 2GOMA 1OCOH 4JOMA 3CMEI 3ZMDA 3LFKA 2ECBA 2KPMA 2FD5A 2JK3A 2X85A 3DU6A 2YU9J 4BXXJ 1R7JA 5J40A 2HOSA 1TT0A 2PFBA 4HBLA 4B48A 4KMFA 3M4OJ 3SYTA 1MBHA 4M6VA 2VKVA 5HDGA 3RQIA 3H5NA 5LRRA 1OPCA 4XKWA 3EPZA 2O3FA 1JTXA 3OOUA 3DU5A 2HQRA 1X4PA 2OC6A 1IXRC 3SXYA 4DJAA 2O03A 3BCBA 1T0FA 1SC7A 1OCTC 2W57A 2MLGA 4KICA 4M3FA 4ENJA 1JGSA 1FZPB 5FKLA 5GPCA 5E1ZB 2IGKA 5HODA 1D8KA 2LY9A 5J8FA 2DYRH 3F9KA 1A35A 4RB0A 1BA5A 5GADJ 3OL3A 4L9VA 2EFQA 3G3ZA 2ZMEB 1HKSA 2R93J 2JVGA 4KNYA 4IPAA 3S15J 1YE9A 4BDZA 5F1RA 4UVAA 5H6QA 3LSRA 1B72A 1D1AA 2DA3A 5TGTA 4B3XA 3ECOA 3HUGA 3E6MA 3VYUB 4A3GJ 1BI3A 1NTCA 2D2WA 3GZ6A 2DJIA 2PJPA 5CKTA 1X58A 3AG2H 2ME6A 3R60A 5FKMA 1XX5A 2EA4A 2P0WA 4KN7X 2JVHA 2Z99A 2Y48A 3V7SA 1QA6A 1RUOA 1ZK8A 1NK2P 1R5HA 2R7ZJ 5JFRA 2R7VA 1L0OC 5GTIC 1BR1A 3BR0A 1QHGA 3FKJA 4CYCB 5F0HA 5KNLA 3I53A 2EWNA 3FDYA 3K1PA 3ZQHA 5EDNA 1ZRFA 4RB1A 3DP7A 3Q0WA 4JYKA 2CUZA 2NRAC 3PFIA 2K4JA 2Z2SB 2M0CA 5HVQC 4LLGF 5HDNA 4C2UA 5CLSA 1R9TJ 3ABLH 4G6TB 4A69C 2ZFUA 2X9DA 1F5TA 2IGNA 5E3OA 2XRLA 3F8MA 3HG9A 2E1CA 1ETYA 1S5LC 4HF1A 3CJQB 3JW4A 2BY3A 2YSRA 3LSIA 2GA2A 3HSRA 2IA1A 3HOZJ 3HOWJ 3TKYA 2HI3A 2E71A 2HQ5A 3M1EA 4PJ0C 4Y7NJ 3OSGA 5DD8A 1SFKA 4LGWA 2XAUA 5DEQA 1OJLA 3OYMA 3EYYA 3T0YA 2L01A 5E3MA 2WAQN 2PI0A 3T5XA 4RLFA 3C2BA 4A3KJ 2NAZA 2M2EA 2R7XA 2ESHA 5J8CA 1ITYA 2DU9A 1MMSA 4NHJA 4WX9A 2DTZA 1OCRH 2L9NA 1FYMA 4D7NA 2ESNA 3NRVA 1Y1WJ 1MBEA 4CDGA 3G73A 5HLIA 1MMDA 1GUUA 1BJZA 2E5ZA 1T56A 2G7UA 2B7EA 1FTTA 4M74A 3FMSA 3SEQA 5FKNA 1X1AA 2M4GA 3KEYA 3GFIA 5F08A 1H9TA 2FRHA 2FNAA 3K4NA 1KU9A 3IAM2 2L5QA 1RC9A 3P7NA 2HOTA 2ELKA 5K7FA 2K4BA 2WY8Q 5F04A 2KQRA 4BJ5C 2XVCA 2LRDA 5IPAA 3B02A 3CCUI 4GFBA 3GX4X 2VJIA 1B4AA 2E7WA 4A3DJ 4ZTFA 1FOXA 3MCZA 1AU7A 3D5RC 4E7SA 2VJ5A 1OYYA 3K2ZA 4GXOA 1WSUA 1V5FA 2PBIA 3ESWB 1CF7A 2E19A 3LSTA 4M6XA 3RQ4A 2XAHA 2L0KA 3IH4A 1W7PA 3KYDB 1D1CA 4KISA 4KITB 3WU0A 4HX4A 1MSFC 2IS6A 4A0ZA 1OISA 2QBYA 4HZFA 2EBIA 1G3TA 3P9IA 4L9JA 3QOEA 1ZRCA 1MKMA 2FMLA 3H3UA 1TTYA 1ZGJA 2PG4A 2VQGA 2Z3YA 1JUSA 4RAYA 3CO7C 5CJ9A 3Q9VA 3LL7A 3M8JA 1LVAA 1Z77A 3CCQI 1XS9A 4M3BA 3IRQA 2BGCA 3H1CA 3ZXSA 4A12A 4E7HA 4HNUA 4PSXA 1B72B 1QU3A 3F23A 1T0FC 1WVRA 1J9IA 3HUGB 3K6GA 2FOKA 4C3IJ 3H9JA 3DF8A 2NNYA 3OIQA 1WJBA 3W3CA 5JHUA 1VQOI 2LK2A 1IV6A 3V4GA 3HJEA 1AOYA 1ZGWA 5LHHA 2DPUA 2KIUA 3U1DA 1MBGA 4HPQA 4DBQA 4M9ZA 2CYYA 1YX5A 2M8GX 1E3HA 1VFCA 5J1UA 5FLXK 3WHBA 5K7ZA 4QLCU 4XM3A 1ZG1A 3S32A 2UXNA 1RR8C 4A0XA 3S2HJ 1SD4A 2EQRA 4LOCA 5F0FA 4BEHA 4Y33A 3OYDA 1IC8A 4G7HF 4GCVA 3CCEI 2L7ZA 1XPXA 1FEXA 3KP6A 2E2HJ 3RKWA 3WG7H 3LMMA 1HDPA 1UHWA 3GEZA 3HOSA 4G94A 1OR7C 2LBFA 2P5KA 3VOEA 2E60A 2QQ9A 2X1DA 4E4HA 2F5VA 3MKZA 2HNHA 2KFDA 1X1BA 2ZKZA 3GFMA 3HRMA 4XRSA 3BY6A 3JR9A 2AHQA 4XK4A 3VSKA 4J19A 1NK3P 1YYVA 1ZRDA 2ZSIB 2FBIA 2CO5A 2OJED 4F93B 1TWCJ 2DK8A 2XPUA 4P1WA 1HSTA 4UHTA 2P81A 3CO6C 3A02A 1Z6TA 3RPUA 3S93A 1V54H 2LY1A 1H8AC 4GRIA 2R7OA 4WF2A 4EATA 5HDKA 3HKZN 1YX3A 3K4BA 2CS3A 3TW7A 5EG0A 4AIJA 1VQKI 1R5ID 2DOEA 4ZZDA 2HEOA 3O8HA 1AWCA 4IHTA 1XTAA 3T8RA 2EPFA 5M5YJ 3QAHA 1MMNA 2VXDA 3VSLA 2CW7A 3HZJA 4UV9A 4Y3OA 2M3AA 3LAJA 2X51A 4GO1A 3BLYA 2YS9A 1YRNA 4V2FA 2Q8KA 4HF2A 1KYWA 1W5SA 2RAEA 5GPAA 2Z16A 2PEXA 3WTVC 1MNMC 3H5AA 5HS7A 5HNFA 1O3RA 4MEYF 3W6KB 3MMYB 4LITA 2OCCH 2X6YA 4IQ4A 3IAS2 5FB2A 2R92J 3BZCA 3SFZA 1V55H 5CVVA 2JWTA 4D1QA 3CJNA 4A3BJ 1MBJA 3NARA 4B43A 4ASNA 2XASA 5LGNA 2HOEA 1IN7A 5EZHA 4PCQA 2H1KA 1ZHFA 2HFHA 4C9YA 3ZOBA 3GFLA 4RAGA 1CF7B 2I8DA 3FZVA 5DUKA 3E97A 1W7PB 2MFZA 2ELJA 1W36D 1Y0NA 2CFOA 2GZWA 2XRNA 1J5YA 4HOBA 4LK0F 1NH3A 3BQYA 4M72A 4NDLA 4WXHA 2QBYB 4BYYA 4M71A 4CZZA 1MZBA 1CQTA 3FXKA 3EUHC 3CLQA 4OAZA 1XGOA 1POGA 2FEZA 2ECCA 4KDPA 5L3FA 1I1GA 1Y6IA 4HLXA 5LGTA 1QRYA 2RDPA 4ESJA 2QSHX 1HOMA 1LUJB 2IRFG 4LG0A 5FRNA 4BXUA 2IGOA 3F0CA 4QIWN 3A0HC 3WTTC 2O61A 2IW5A 2Y0SN 3M8EA 1FT9A 2HS5A 3D5LA 4X6AJ 3VB2A 4XKCA 4IHXA 2DT7B 4R8HA 1D8JA 2DFEA 2BY0A 4XL9A 3DTKA 4RGRA 4MNUA 4B1RA 4EJOA 2E36A 3E1SA 4D0PA 2JSPA 4G6DA 1PDNC 3IC7A 4KIGA 3BG5A 2WY7Q 1YTYA 2DAOA 1WCMJ 2LP0A 1T6SA 4XLNF 3TP0A 1UB9A 3H9GA 2HXIA 1UG2A 1Z7LA 4X1EA 1I3QJ 1R5GA 1IXCA 1ZELA 4H4KC 3EYIA 1F36A 4AVZA 1MMAA 3R61A 1R1TA 1RKTA 1HDDC 5ICEA 5FLMJ 2JPCA 3DQVC 1SFEA 4BEHB 1MJ9A 3NWTA 4WXCA 4I2OA 2F48A 5IP6A 5GAEJ 2D1VA 1Y1VJ 4AUXA 2IEKA 2NOJB 4HSRA 1U6GA 2IBDA 2LBFB 2ZO4A 5K1YA 4WK8F 1ZLKA 4RS8A 4HV5A 2VC1A 2NVXJ 1BW6A 4HX7A 2QM3A 3OIOA 3H92A 4RMNA 2FBKA 3WGHA 3EUAA 1QBJA 4HAMA 5EYRA 2AQEA 2KJBA 2PN6A 1OLTA 2B0LA 1TWFJ 4XORA 1O3QA 2H8RA 2ZNYA 2NVYJ 5FRMA 3KCCA 1W1WE 1S7EA 5LRSA 1FIAA 2FQ4A 3QP6A 1USTA 2R7UA 4IHVA 3QODA 3FWEA 5EG0B 2DA4A 2QENA 4CO8A 2XB0X 3GZ5A 2HYGD 1VQ4I 2XV4S 4XKBA 2V9PA 4WCGA 2A05A 3J7YJ 3GCMA 4JQFA 2V6EA 1OCCH 3P9KA 1YRNB 3LA3A 1RI7A 5ICCA 3K4MA 2HOAA 1IUYA 2L9RA 3DKYA 4NC6A 4XLCA 2JRMA 2LOOA 2MSYA 3KLOA 5CYVA 3LSJA 4HRIA 2E1MC 1TWAJ 1G3YA 1P9QC 3OS0A 3OYNA 3GLXA 3QPLA 3ZMSA 3GTPJ 1ORKA 1QVUA 2HVSA 5EGOA 1TNSA 2FBHA 2LMDA 4NBQA 3SZPA 2GXGA 3K9TA 4YFNF 2P6TA 5GAGJ 4XOTA 3GTJJ 4CCKA 3WTYC 4CXFA 4XN0A 2MA3A 1X3ZB 3E5QA 3KP2A 3ML6A 2JMWA 2QSFX 4CH7A 3BDDA 1J0RA 1F4KA 3FXJA 5FROA 2A3SA 4V19K 4ZDLA 1BW5A 1BBYA 5HLHA 3A03A 1D3YA 2LTPA 4S05A 1H88C 1IUFA 4FASD 4RA2A 4IL6C 1USSA 4HF0A 4W1UA 4MLOA 5KCMA 2XKPA 3O3KA 5ICFA 3BJAA 3ZMZA 1XC5A 5D5WB 2WBMA 2PJRA 5IY5H 2VE8A 5HS8A 5DCMA 3SFIA 3PQKA 1UHSA 2RNJA 1MD0A 3TL4X 2CSOA 1XDSA 3D1NI 1WQ2A 3E7LA 1QVTA 3QPSA 1W36C 4LG0B 2EIKH 2M8EA 2HVRA 4H0EA 5IYBJ 5DM7F 4BE1A 3GTOJ 1EH8A 3L2CA 3L2QA 1IAWA 1F9NA 2RQQA 2DW4A 1EH7A 2JPBA 3OMYA 5ERIA 4C30A 5E20A 1WKMA 3ZQ7A 1SAXA 3QU6A 3FX3A 2EV6A 4XKVA 1D5YA 3HSFA 2HDWA 2DA2A 3AKZA 2MC4A 1RESA 3U9GA 3WGGA 5EF6A 3E5UA 1IO2A 2VOOA 1A6QA 2Y69H 1V5EA 2PMHA 3HRSA 2VUMJ 2PMUA 1SEUA 3HSEA 2V9VA 3JCUC 1N78A 3BTIA 1R6RA 1IZ1A 1A36A 2D5VA 2R7WA 1OCPA 4GGGA 3BTJA 4W97A 3G4SI 3JRGA 2X0LA 1XSXA 3BTLA 3ZQFA 1YS7A 1BN5A 1HBXG 2Z9OA 2UWMA 2VT2A 3I56I 4OU0A 1GXPA 5D8KB 2TRTA 3GVAA 3GTGJ 4BBSJ 2GXBA 4XSXF 1T2KA 4P9FA 2LKPA 4LLNA 4DGWB 3FHNA 2GQQA 3F72A 4B09A 4XLHA 2L9VA 4Q4ZF 2ID3A 1HW1A 1S7OA 5ICGA 1MBKA 3CC2I 1JKOC 3I54A 3OIPA 2NNNA 3BJ6A 3JRBA 3DPUA 2YR2A 1PUFA 1N77A 1KGSA 2YPRA 1ZLJA 4Y4RA 4IVNA 1T39A 4UVBA 4I01A 4BBRJ 4N4OB 5LHIA 4BNCA 4F91B 2FSWA 3KP3A 5A2QK 4PGHA 3K70D 1WI9A 5HNHA 3I59A 4PSWA 4P9UA 3ZPLA 1F43A 1SVLA 1YW7A 2PLYA 2FNPA
chains in the Genus database with same CATH topology
1MSEC 5M3MJ 5E3MA 4MO7A 2WAQN 3C2BA 1FTZA 4DYQA 4A3KJ 3TEDA 2M2EA 4V2GA 2NS8A 1ITYA 1IG7A 3S16J 2LR8A 1U9NA 2K9SA 5IP9J 2DTZA 1RETA 4D7NA 5J1RA 5EGOB 1Y1WJ 1MBEA 1GDTA 3TW6A 5IOZA 3S2DJ 1GUUA 1BJZA 3JRIA 5FLVA 1T56A 1VF9A 1WI3A 4I76A 1FTTA 2DJNA 5FKNA 1A5JA 4DW6A 3BG3A 5F08A 4RDUA 3RZOJ 3BR3A 5F1JA 2OF7A 1JGGA 2HOTA 5FJ8J 2ELKA 5JLXA 5K7FA 1WH5A 5F04A 4IHYA 1ZTRA 5IPAA 4GFBA 1X2NA 3H0GJ 4A3DJ 4Y52J 1JTYA 3UKGA 3CCYA 1AU7A 4UUSA 3VPRA 2M9HA 3L1PA 2PMZN 2E19A 4D5CA 3IH4A 2L0KA 1JKPC 3ZQLA 2X48A 1JUPA 3I4MJ 1MSFC 2DMQA 3BT9A 4JX4A 4QSHA 3HBLA 2R5YA 2EBIA 2LLKA 3NAUA 1FJLA 1LE8B 4G12A 1JUSA 3FKIJ 1K61A 1Z77A 1SANA 1XS9A 1JKQC 2KDZA 4M3BA 2HXOA 3GTMJ 1B72B 5J3LA 3B6AA 3DCFA 2CUEA 2E2JJ 1O4XA 3GTLJ 2JJ7A 3IH3A 3Q3SA 2XGCA 4C3IJ 2MGQA 1ETOA 3BR2A 2LK2A 1IV6A 2YUSA 2EH3A 4XICA 1ZGWA 4JX6A 5BNGA 1MBGA 2DN0A 2LVSA 5E3LA 1ZR2A 1U78A 3BG9A 2M8GX 4A3EJ 1VFCA 3HGGA 5J1UA 3WHBA 5K7ZA 2VKEA 4I6ZA 3S2HJ 1W0TA 2LFBA 2EQRA 2B63J 1JJ8C 4LOCA 5F0FA 3PO3J 1IC8A 2L7ZA 4A93J 2L7FP 3HM5A 3MVPA 2E2HJ 1FEXA 3HOYJ 5C4JJ 1HDPA 4DYRA 2R5ZB 1ZR4A 2LD5A 1DU0A 5DTDA 2NVTJ 2DMPA 1GV2A 2DA5A 3M3YJ 2VPRA 2EZIA 3QQAA 3HEFA 1PUFB 1E3OC 1IDYA 4XRSA 4XRSG 3JR9A 2O9LA 2AHQA 4XK4A 1ETVA 3S17J 4J19A 1NK3P 1WH7A 3CDLA 1P7JA 1TWCJ 2XPUA 2P81A 3A02A 5FKOA 4AC0A 2Y9ZA 3WHCA 4MFDA 1H8AC 3I4NJ 3SDGA 2VI6A 2QF7A 4DZPA 3HKZN 3TW7A 3Q0UA 5EG0A 3ZQGA 4IHWA 5IYCJ 3O8GA 3O8HA 5M5YJ 1Q1VA 2EZHA 2K40A 2I10A 2DA7A 1YRNA 2XB5A 2YS9A 4V2FA 2KT0A 2RAEA 5GPAA 3S14J 2Y2ZA 1H89C 1OFCX 2WB1N 1MNMC 2COBA 2XSDC 5IP7J 1JT6A 4EEFG 3JRCA 2R92J 1JUMA 2JA7J 4MFEA 2E2IJ 2JWTA 4HNVA 1JKRC 1IGNA 4A3BJ 5M5WJ 1MBJA 1MH4A 3NARA 3PO2J 2FX0A 2W48A 1QPIA 4ABZA 5EZHA 4M3EA 2O8KA 3JRAA 2H1KA 5C44J 4UUSB 3BR6A 3ZOBA 2CU7A 1SFOJ 2IAIA 2FJ1A 5K7HA 1EF4A 2DMNA 2Y9YA 3BQYA 4NDLA 2R5YB 1LFUP 1CQTA 2GM4A 1RKWA 3FK6A 4FCYA 2CQXA 1POGA 4C3HJ 2ECCA 1I50J 3Q0VA 4A3FJ 2NOGA 1QRYA 4JP0A 1HOMA 3FK7A 1ETWA 3BR5A 4A3CJ 4B4CA 3F0CA 4QIWN 1A6IA 4FE7A 4FTHA 1U8BA 3GTKJ 2Y0SN 2AO9A 4X6AJ 2MG4A 4IHXA 3MKLA 4B1RA 4DYCA 1MBFA 2JA6J 3BG5A 2DMUA 1WCMJ 2LP0A 3TP0A 2DA6A 2HXIA 1UG2A 4X1EA 3LNQA 4A3LJ 1I3QJ 4MIMA 1G2HA 2GBYA 1F36A 4XIDA 5GP9A 1RKTA 2XPVA 5C3EJ 1RR7A 1ETQA 1P7IA 1HDDC 2CQQA 1JT0A 5FLMJ 3RKQA 3HOVJ 2ID6A 2QCOA 3BTCA 1AHDP 1AKHA 4RBOA 5IP6A 1LFBA 1Y1VJ 4CYCA 4AUXA 2IEKA 5EEAA 1GV5A 1W0UA 2IBDA 2Y31A 3A01A 2DMTA 2CRGA 3IV5A 3S1QJ 2NVXJ 1BW6A 1GT0C 3OIOA 4IEJA 5IYDJ 4AYBN 5JLWA 1HCRA 3ZQCA 3TP3A 4C3JJ 2XGDA 5E3NA 5EYRA 3S1NJ 1Z0XA 1TWFJ 2MW8A 4DZJA 2H8RA 2NVYJ 3G1MA 3GTQJ 4A3JJ 1S7EA 2JN6A 1FIAA 2FQ4A 3CQZJ 2NVQJ 1JJ6C 4IHVA 5EG0B 3BQZA 2DA4A 5DS9A 5F27A 2K9QA 2XB0X 1RPWA 3MN2A 1MH3A 2L7MP 2NS7A 5FKKA 4XRMA 5M3FJ 1B8IA 1IJWC 2N8GA 1YRNB 1VI0A 2R0QC 2M34A 2HOAA 3JRFA 2L9RA 3HB9A 2DA1A 2MSYA 1X2MA 3DEWA 3JREA 5C4XJ 1I6HJ 3LSJA 3S1RJ 2EZLA 3LOCA 1TWAJ 3IH2A 3K2AA 5IOYA 2O7OA 3W6VA 3QPLA 3GTPJ 1ORKA 1QVUA 4M3DA 3OSFA 5EGOA 1WGXA 2CJJA 2ECBA 2FD5A 1ETKA 3GTJJ 2JK3A 3HGYA 2JA8J 2YU9J 4BXXJ 2WV1A 2JMWA 2HOSA 3M4OJ 4BKXA 2K9NA 1BW5A 1MBHA 4M6VA 5J1YA 2VKVA 3RQIA 3A03A 3G1OA 2LTPA 1H88C 2JA5J 1IUFA 1JTXA 3OOUA 2HYJA 1HF0A 3B6CA 1WPKA 4MLOA 4W1UA 2EZKA 3HOUJ 4S0HB 1OCTC 1ETXA 4M3FA 1XC5A 5FKLA 1GVDA 3SFIA 5GPCA 4C2MJ 2G0EA 1UHSA 3S1MJ 5HODA 3D1NI 3E7LA 4UUTA 1QVTA 2LY9A 1T33A 3QPSA 1ZKGA 4A3MJ 3CMYA 2CUFA 1TWGJ 2OPTA 5IYBJ 2LKXA 3GTOJ 1LE8A 1BA5A 3H3VK 3GBGA 1UMQA 4JX5A 3G1LA 4L5EA 5F0CA 4M3GA 2R93J 2TCTA 1TWHJ 4A3IJ 2Y30A 3BR1A 3S15J 1IRZA 1D5YA 2DA2A 3LSGA 3LSRA 1RESA 1B72A 3ZQIA 5EF6A 1TC3C 2XGEA 2HDDA 2DA3A 3PM1A 1VNDA 4A3GJ 4BY1J 1NTCA 1BL0A 3FIWA 3LSPA 2VUMJ 2XPWA 1X58A 2ME6A 1DU6A 5FKMA 3BTIA 2X6OA 1APLC 4D7MA 2E1OA 2ZB9A 1ZK8A 1NK2P 1HLVA 2D5VA 1OCPA 1IDZA 2R7ZJ 3BTJA 4W97A 1AKHB 3JRGA 1XG1A 3BR0A 3BTLA 3RZDJ 3ZQFA 4CYCB 5F0HA 3A01B 3ZQHA 5EDNA 2TRTA 3JRDA 3Q0WA 4JYKA 3GTGJ 4BBSJ 1FIPA 2M0CA 5M5XJ 3HDDA 4FE4A 2ME0A 3K7AJ 1R9TJ 1ENHA 5EZGA 4A69C 4D5FA 2ID3A 2X9DA 3JRHA 2R5ZA 3SJMA 5E3OA 1MBKA 1JKOC 3JRBA 2XRLA 1PUFA 1ETYA 9ANTA 3FISA 3HOXJ 1U9OA 4BBRJ 2GLOA 4QTRA 3HOZJ 3HOWJ 2HI3A 2HQ5A 4BY7J 4Y7NJ 3OSGA 4FISA 1ZQ3P 4B3AA 1B8IB 1F43A 1K83J 1OJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSE C;  5M3M J;  5E3M A;  4MO7 A;  2WAQ N;  3C2B A;  1FTZ A;  4DYQ A;  4A3K J;  3TED A;  2M2E A;  4V2G A;  2NS8 A;  1ITY A;  1IG7 A;  3S16 J;  2LR8 A;  1U9N A;  2K9S A;  5IP9 J;  2DTZ A;  1RET A;  4D7N A;  5J1R A;  5EGO B;  1Y1W J;  1MBE A;  1GDT A;  3TW6 A;  5IOZ A;  3S2D J;  1GUU A;  1BJZ A;  3JRI A;  5FLV A;  1T56 A;  1VF9 A;  1WI3 A;  4I76 A;  1FTT A;  2DJN A;  5FKN A;  1A5J A;  4DW6 A;  3BG3 A;  5F08 A;  4RDU A;  3RZO J;  3BR3 A;  5F1J A;  2OF7 A;  1JGG A;  2HOT A;  5FJ8 J;  2ELK A;  5JLX A;  5K7F A;  1WH5 A;  5F04 A;  4IHY A;  1ZTR A;  5IPA A;  4GFB A;  1X2N A;  3H0G J;  4A3D J;  4Y52 J;  1JTY A;  3UKG A;  3CCY A;  1AU7 A;  4UUS A;  3VPR A;  2M9H A;  3L1P A;  2PMZ N;  2E19 A;  4D5C A;  3IH4 A;  2L0K A;  1JKP C;  3ZQL A;  2X48 A;  1JUP A;  3I4M J;  1MSF C;  2DMQ A;  3BT9 A;  4JX4 A;  4QSH A;  3HBL A;  2R5Y A;  2EBI A;  2LLK A;  3NAU A;  1FJL A;  1LE8 B;  4G12 A;  1JUS A;  3FKI J;  1K61 A;  1Z77 A;  1SAN A;  1XS9 A;  1JKQ C;  2KDZ A;  4M3B A;  2HXO A;  3GTM J;  1B72 B;  5J3L A;  3B6A A;  3DCF A;  2CUE A;  2E2J J;  1O4X A;  3GTL J;  2JJ7 A;  3IH3 A;  3Q3S A;  2XGC A;  4C3I J;  2MGQ A;  1ETO A;  3BR2 A;  2LK2 A;  1IV6 A;  2YUS A;  2EH3 A;  4XIC A;  1ZGW A;  4JX6 A;  5BNG A;  1MBG A;  2DN0 A;  2LVS A;  5E3L A;  1ZR2 A;  1U78 A;  3BG9 A;  2M8G X;  4A3E J;  1VFC A;  3HGG A;  5J1U A;  3WHB A;  5K7Z A;  2VKE A;  4I6Z A;  3S2H J;  1W0T A;  2LFB A;  2EQR A;  2B63 J;  1JJ8 C;  4LOC A;  5F0F A;  3PO3 J;  1IC8 A;  2L7Z A;  4A93 J;  2L7F P;  3HM5 A;  3MVP A;  2E2H J;  1FEX A;  3HOY J;  5C4J J;  1HDP A;  4DYR A;  2R5Z B;  1ZR4 A;  2LD5 A;  1DU0 A;  5DTD A;  2NVT J;  2DMP A;  1GV2 A;  2DA5 A;  3M3Y J;  2VPR A;  2EZI A;  3QQA A;  3HEF A;  1PUF B;  1E3O C;  1IDY A;  4XRS A;  4XRS G;  3JR9 A;  2O9L A;  2AHQ A;  4XK4 A;  1ETV A;  3S17 J;  4J19 A;  1NK3 P;  1WH7 A;  3CDL A;  1P7J A;  1TWC J;  2XPU A;  2P81 A;  3A02 A;  5FKO A;  4AC0 A;  2Y9Z A;  3WHC A;  4MFD A;  1H8A C;  3I4N J;  3SDG A;  2VI6 A;  2QF7 A;  4DZP A;  3HKZ N;  3TW7 A;  3Q0U A;  5EG0 A;  3ZQG A;  4IHW A;  5IYC J;  3O8G A;  3O8H A;  5M5Y J;  1Q1V A;  2EZH A;  2K40 A;  2I10 A;  2DA7 A;  1YRN A;  2XB5 A;  2YS9 A;  4V2F A;  2KT0 A;  2RAE A;  5GPA A;  3S14 J;  2Y2Z A;  1H89 C;  1OFC X;  2WB1 N;  1MNM C;  2COB A;  2XSD C;  5IP7 J;  1JT6 A;  4EEF G;  3JRC A;  2R92 J;  1JUM A;  2JA7 J;  4MFE A;  2E2I J;  2JWT A;  4HNV A;  1JKR C;  1IGN A;  4A3B J;  5M5W J;  1MBJ A;  1MH4 A;  3NAR A;  3PO2 J;  2FX0 A;  2W48 A;  1QPI A;  4ABZ A;  5EZH A;  4M3E A;  2O8K A;  3JRA A;  2H1K A;  5C44 J;  4UUS B;  3BR6 A;  3ZOB A;  2CU7 A;  1SFO J;  2IAI A;  2FJ1 A;  5K7H A;  1EF4 A;  2DMN A;  2Y9Y A;  3BQY A;  4NDL A;  2R5Y B;  1LFU P;  1CQT A;  2GM4 A;  1RKW A;  3FK6 A;  4FCY A;  2CQX A;  1POG A;  4C3H J;  2ECC A;  1I50 J;  3Q0V A;  4A3F J;  2NOG A;  1QRY A;  4JP0 A;  1HOM A;  3FK7 A;  1ETW A;  3BR5 A;  4A3C J;  4B4C A;  3F0C A;  4QIW N;  1A6I A;  4FE7 A;  4FTH A;  1U8B A;  3GTK J;  2Y0S N;  2AO9 A;  4X6A J;  2MG4 A;  4IHX A;  3MKL A;  4B1R A;  4DYC A;  1MBF A;  2JA6 J;  3BG5 A;  2DMU A;  1WCM J;  2LP0 A;  3TP0 A;  2DA6 A;  2HXI A;  1UG2 A;  4X1E A;  3LNQ A;  4A3L J;  1I3Q J;  4MIM A;  1G2H A;  2GBY A;  1F36 A;  4XID A;  5GP9 A;  1RKT A;  2XPV A;  5C3E J;  1RR7 A;  1ETQ A;  1P7I A;  1HDD C;  2CQQ A;  1JT0 A;  5FLM J;  3RKQ A;  3HOV J;  2ID6 A;  2QCO A;  3BTC A;  1AHD P;  1AKH A;  4RBO A;  5IP6 A;  1LFB A;  1Y1V J;  4CYC A;  4AUX A;  2IEK A;  5EEA A;  1GV5 A;  1W0U A;  2IBD A;  2Y31 A;  3A01 A;  2DMT A;  2CRG A;  3IV5 A;  3S1Q J;  2NVX J;  1BW6 A;  1GT0 C;  3OIO A;  4IEJ A;  5IYD J;  4AYB N;  5JLW A;  1HCR A;  3ZQC A;  3TP3 A;  4C3J J;  2XGD A;  5E3N A;  5EYR A;  3S1N J;  1Z0X A;  1TWF J;  2MW8 A;  4DZJ A;  2H8R A;  2NVY J;  3G1M A;  3GTQ J;  4A3J J;  1S7E A;  2JN6 A;  1FIA A;  2FQ4 A;  3CQZ J;  2NVQ J;  1JJ6 C;  4IHV A;  5EG0 B;  3BQZ A;  2DA4 A;  5DS9 A;  5F27 A;  2K9Q A;  2XB0 X;  1RPW A;  3MN2 A;  1MH3 A;  2L7M P;  2NS7 A;  5FKK A;  4XRM A;  5M3F J;  1B8I A;  1IJW C;  2N8G A;  1YRN B;  1VI0 A;  2R0Q C;  2M34 A;  2HOA A;  3JRF A;  2L9R A;  3HB9 A;  2DA1 A;  2MSY A;  1X2M A;  3DEW A;  3JRE A;  5C4X J;  1I6H J;  3LSJ A;  3S1R J;  2EZL A;  3LOC A;  1TWA J;  3IH2 A;  3K2A A;  5IOY A;  2O7O A;  3W6V A;  3QPL A;  3GTP J;  1ORK A;  1QVU A;  4M3D A;  3OSF A;  5EGO A;  1WGX A;  2CJJ A;  2ECB A;  2FD5 A;  1ETK A;  3GTJ J;  2JK3 A;  3HGY A;  2JA8 J;  2YU9 J;  4BXX J;  2WV1 A;  2JMW A;  2HOS A;  3M4O J;  4BKX A;  2K9N A;  1BW5 A;  1MBH A;  4M6V A;  5J1Y A;  2VKV A;  3RQI A;  3A03 A;  3G1O A;  2LTP A;  1H88 C;  2JA5 J;  1IUF A;  1JTX A;  3OOU A;  2HYJ A;  1HF0 A;  3B6C A;  1WPK A;  4MLO A;  4W1U A;  2EZK A;  3HOU J;  4S0H B;  1OCT C;  1ETX A;  4M3F A;  1XC5 A;  5FKL A;  1GVD A;  3SFI A;  5GPC A;  4C2M J;  2G0E A;  1UHS A;  3S1M J;  5HOD A;  3D1N I;  3E7L A;  4UUT A;  1QVT A;  2LY9 A;  1T33 A;  3QPS A;  1ZKG A;  4A3M J;  3CMY A;  2CUF A;  1TWG J;  2OPT A;  5IYB J;  2LKX A;  3GTO J;  1LE8 A;  1BA5 A;  3H3V K;  3GBG A;  1UMQ A;  4JX5 A;  3G1L A;  4L5E A;  5F0C A;  4M3G A;  2R93 J;  2TCT A;  1TWH J;  4A3I J;  2Y30 A;  3BR1 A;  3S15 J;  1IRZ A;  1D5Y A;  2DA2 A;  3LSG A;  3LSR A;  1RES A;  1B72 A;  3ZQI A;  5EF6 A;  1TC3 C;  2XGE A;  2HDD A;  2DA3 A;  3PM1 A;  1VND A;  4A3G J;  4BY1 J;  1NTC A;  1BL0 A;  3FIW A;  3LSP A;  2VUM J;  2XPW A;  1X58 A;  2ME6 A;  1DU6 A;  5FKM A;  3BTI A;  2X6O A;  1APL C;  4D7M A;  2E1O A;  2ZB9 A;  1ZK8 A;  1NK2 P;  1HLV A;  2D5V A;  1OCP A;  1IDZ A;  2R7Z J;  3BTJ A;  4W97 A;  1AKH B;  3JRG A;  1XG1 A;  3BR0 A;  3BTL A;  3RZD J;  3ZQF A;  4CYC B;  5F0H A;  3A01 B;  3ZQH A;  5EDN A;  2TRT A;  3JRD A;  3Q0W A;  4JYK A;  3GTG J;  4BBS J;  1FIP A;  2M0C A;  5M5X J;  3HDD A;  4FE4 A;  2ME0 A;  3K7A J;  1R9T J;  1ENH A;  5EZG A;  4A69 C;  4D5F A;  2ID3 A;  2X9D A;  3JRH A;  2R5Z A;  3SJM A;  5E3O A;  1MBK A;  1JKO C;  3JRB A;  2XRL A;  1PUF A;  1ETY A;  9ANT A;  3FIS A;  3HOX J;  1U9O A;  4BBR J;  2GLO A;  4QTR A;  3HOZ J;  3HOW J;  2HI3 A;  2HQ5 A;  4BY7 J;  4Y7N J;  3OSG A;  4FIS A;  1ZQ3 P;  4B3A A;  1B8I B;  1F43 A;  1K83 J;  1OJL A; 
#chains in the Genus database with same CATH topology
 3LA7 A;  3VYR B;  3SEZ A;  2MBF A;  4F92 B;  1KA8 A;  2GIV A;  3P5J A;  2VC0 A;  4V2G A;  3U21 A;  1IG7 A;  1QO0 D;  1QZE A;  2K9S A;  4A5M A;  4U0Y A;  2RRE A;  3BCA A;  4KYW A;  5L3B A;  4BL0 B;  4HLY A;  3CC7 I;  5EGO B;  1GDT A;  3TW6 A;  1R71 A;  5IOZ A;  3S2D J;  4I0B A;  4KJZ A;  5FLV A;  4QPO A;  5E1X A;  2F5D A;  1VF9 A;  4I76 A;  3O2P E;  1DP3 A;  2CW8 A;  4AYB A;  2XUB A;  3ISP A;  3BG3 A;  4Z2Y A;  1X1D A;  3K4K A;  3OYG A;  2ZXJ A;  3BR3 A;  4BQQ A;  3R0A A;  5LBQ A;  1WJE A;  4BXF A;  5JLX A;  3VFZ A;  1MGT A;  5EEG A;  3M1C A;  2DOD A;  1R4M B;  3PIO F;  5L3E A;  2A07 F;  1BIB A;  3H0G J;  3REO A;  1G8X A;  1HC8 A;  1Y39 A;  3BG7 A;  4Y52 J;  3J7A Y;  2ISY A;  3VPR A;  5K5O A;  1VTN C;  4XLE A;  2HPI A;  2X4H A;  2PJR B;  1LDD A;  5DCM B;  1JKP C;  2QKL B;  3EDP A;  3BPX A;  4LIU A;  3DPL C;  1JUP A;  4O3M A;  4GDF A;  3I4M J;  2DMQ A;  2P5L C;  4JX4 A;  4QSH A;  2K3P A;  3VDX A;  2A6T A;  2Z33 A;  2DCE A;  2W4S A;  3DBH B;  2RNG A;  1L3L A;  3I64 A;  3CES A;  1U5T C;  1IV8 A;  1I3A A;  4G12 A;  1O7L A;  3L2W A;  1K61 A;  1LEB A;  1ZGA A;  5IT9 Z;  2CV2 A;  5LEJ A;  1BR2 A;  3FMQ A;  4OIN F;  1PP7 U;  2H6B A;  2BVL A;  1TL8 A;  1WFX A;  5J3L A;  2E5N A;  1SVM A;  5D5X B;  2CUE A;  2LRE A;  5KAF C;  1O4X A;  1OR7 A;  2XGX A;  3Q3S A;  1TQM A;  2XGC A;  3RIR A;  5A2Q Z;  3F22 A;  5JVT A;  5K5R A;  5ED4 A;  2VAS A;  4IXA A;  4BS9 A;  2R7R A;  2YUS A;  4DQ2 A;  1JHF A;  3D0S A;  4XON A;  1KU2 A;  3W2V A;  4BDY A;  2HTS A;  1ZR2 A;  2CW0 F;  2YX4 A;  4KFC A;  3DBL B;  1WJF A;  3J80 K;  4JBA A;  1FBU A;  4I6Z A;  4YFX F;  1W0T A;  1XMK A;  2LFB A;  2B63 J;  1QZZ A;  2ZJP F;  3K1N A;  1JE8 A;  1SAU A;  4L9N A;  4RM3 A;  2QSG X;  2A6H F;  3S3M A;  3C2G A;  3MVP A;  4DYR A;  1T38 A;  3CCM I;  2LD5 A;  1DU0 A;  4EJV A;  2VJJ A;  2DMP A;  5DYM A;  4DBR A;  2DA5 A;  2DBB A;  2EZI A;  1PUF B;  3HEF A;  1IDY A;  2VBW A;  4XRS G;  4ZYH A;  1R49 A;  4ZDO A;  2O9L A;  2BV6 A;  2WTE A;  4ENN A;  3S17 J;  2F4O B;  1X4O A;  2JQ7 A;  2KL4 A;  1TQI A;  1LJ9 A;  1V3F A;  3CZ6 A;  4BJ6 C;  4ZZL A;  1TW2 A;  3RJP A;  3I59 B;  4AC0 A;  2Y9Z A;  1YHQ I;  1GVJ A;  1P4W A;  1VQ6 I;  4FQG A;  4ZYG A;  3SDG A;  1FC3 A;  2R3S A;  4DZP A;  2CQ7 A;  4U88 A;  4LJZ F;  2OZ6 A;  2FF4 A;  4XLF A;  4BUP A;  4IHW A;  3O8G A;  2W00 A;  2M30 A;  3K4L A;  2ZC2 A;  2EZH A;  3T8T A;  3I3L A;  2MAB A;  2K40 A;  4XNF A;  3K70 C;  2BVM A;  2GIZ A;  1GHC A;  1E3P A;  5B5E C;  4UUV A;  5TIS C;  4HQE A;  3ZQQ A;  2Y2Z A;  2TDX A;  4EQQ A;  1OFC X;  2WB1 N;  2DQR A;  1KZH A;  3FBI B;  5AON A;  3LSM A;  2XSD C;  5L3C A;  3EUH A;  3ULQ B;  5IP7 J;  3AL0 C;  4EEF G;  3U1K A;  4PFP A;  5LEK A;  3JRC A;  2ISZ A;  3GZN B;  2LH9 A;  2VBX A;  1IGN A;  1KQ0 A;  1V5G A;  2FX0 A;  1N25 A;  3KP4 A;  4O6J A;  3O6B B;  4ABZ A;  2O8K A;  2DPD A;  5C44 J;  2CQN A;  1VQ5 I;  2XHK A;  4N4N B;  5HOO A;  3ZGK A;  2KDO A;  2EV0 A;  1QHH D;  2QLZ A;  2CU7 A;  4AIK A;  1EF4 A;  3J80 Z;  5L3G A;  2DMN A;  3BC8 A;  1R36 A;  2L2O A;  1NG7 A;  3MAJ A;  2DT6 A;  2GM4 A;  1KQ8 A;  1FY7 A;  1YW8 A;  3FK6 A;  3BP8 A;  3FXL A;  2CQX A;  4Y15 A;  3LSH A;  4PFO A;  4C3H J;  4L5I A;  1I50 J;  2RN7 A;  3V8K A;  4RGX A;  2NOG A;  2NXN B;  4ESF A;  3PSF A;  3AG4 H;  4CCL A;  1ETW A;  4RAF A;  1WZ2 A;  3GWZ A;  3MZY A;  4E70 A;  4IRI A;  4A3C J;  2OTJ I;  4B4C A;  5D4R A;  1FSH A;  1XGN A;  3QPH A;  2O6G E;  4FE7 A;  2BOL A;  2ADU A;  1DGR M;  3GUD A;  3EQL F;  2H27 A;  1FOW A;  3BRO A;  2X6W A;  4FT8 A;  4DYC A;  1MBF A;  1QPM A;  5LLQ A;  3KET A;  1ULY A;  1SFX A;  2DMU A;  3QP5 A;  4X0G A;  2M87 A;  2DA6 A;  2VBY A;  3R6S A;  3WU1 B;  3I9V 2;  4OIP F;  5FFZ A;  4A3L J;  1LEA A;  4A5N A;  3ZR8 X;  4B44 A;  4IOA F;  4UVC A;  3AG3 H;  5FD5 A;  5F6F A;  4XID A;  2OU2 A;  1G4D A;  3F8C A;  5E8I A;  4ESB A;  1ETQ A;  1D5V A;  3ZN0 A;  2FMY A;  4KA4 A;  1G6N A;  2HQA A;  3HOV J;  3OR2 C;  3BTC A;  3DLL F;  1AKH A;  3ASN H;  3S3O A;  1TBX A;  1W0U A;  4GYI A;  2F5E A;  3A01 A;  1WHU A;  2CRG A;  3IV5 A;  2L4M A;  3IP4 B;  4EJU A;  4OMZ A;  4AIH A;  1K7A A;  3PUB A;  4KT6 A;  2P4W A;  3SQN A;  2J5P A;  3CP2 A;  3WTX C;  2VT3 A;  2ZFW A;  1OYI A;  4IEJ A;  2W84 A;  5FGM A;  1HCR A;  2P8T A;  2IJL A;  2X1C A;  3TP3 A;  5J4Y A;  1VQN I;  3S1N J;  1EKE A;  1BOB A;  1IN4 A;  3P9C A;  2HDC A;  3CUQ C;  4HV6 A;  2A6E F;  4OAY A;  3G1M A;  1D0X A;  4A3J J;  3K10 A;  1MNE A;  3CQZ J;  2AS5 F;  1G59 A;  1TLH B;  2KHM A;  3E0J B;  5DS9 A;  5D6E A;  2K9Q A;  5F27 A;  4BHC A;  4YIR X;  2BY1 A;  3ONQ A;  2V1U A;  4YFK F;  2LSO A;  1U2W A;  2GOX B;  5FKK A;  3HHH A;  1ZAO A;  3E6B A;  5M3F J;  1B8I A;  1R23 A;  1IJW C;  4AVP A;  2IT0 A;  2EV5 A;  3ZP5 A;  4RB2 C;  2L3D A;  2V1N A;  1VQL I;  2M34 A;  3E3V A;  3RYR A;  4AWX B;  1Q1H A;  3VYT B;  3IWZ A;  2STW A;  1PUE E;  3C3W A;  2Z5U A;  1B9N A;  1KU3 A;  1X2M A;  3JRE A;  2HZT A;  1ZN2 A;  2V9K A;  3CF2 A;  5LHG A;  5BMZ A;  1UAA A;  4IKF A;  5FD6 A;  1WGX A;  4CIC A;  1G3S A;  2CJJ A;  2XRO A;  1S7A A;  4RM2 A;  1U3E M;  4IX7 A;  3U2R A;  1ETK A;  2OBP A;  4M6Y A;  4L18 B;  2EIM H;  2DDB A;  2KIQ A;  2HYF A;  2JA8 J;  4ZYE A;  3LWF A;  2OCE A;  4IO9 F;  4BKX A;  1WJ5 A;  3FXR A;  1A31 A;  2K9N A;  3AAF A;  5J1Y A;  5E17 F;  3G1O A;  2JA5 J;  2X6X A;  2K7L A;  1OMI A;  2K27 A;  2OAZ A;  3B6C A;  3LFU A;  3H3Z A;  3Q5F A;  4NB5 A;  2EZK A;  4S0H B;  1ERD A;  2KIF A;  1ETX A;  4G7O F;  2K85 A;  2Q1Z B;  3HC7 A;  2CMP A;  3S1M J;  1LVK A;  5LD2 C;  4UUT A;  3L2U A;  1T33 A;  4HST A;  2CUF A;  2LKX A;  3DTE A;  2R7T A;  1LE8 A;  4E7K A;  3BZK A;  1YI2 I;  2R7Q A;  1UMQ A;  4JX5 A;  2JT1 A;  2KRC A;  4PUS A;  1XMX A;  3G1L A;  1X1C A;  1FWZ A;  5F0C A;  2EIL H;  4M3G A;  3MKY B;  3CDH A;  2TCT A;  4N9H A;  4FET A;  2Y30 A;  3BPV A;  3KYC B;  4R1H A;  1IRZ A;  2KRH A;  1FSE A;  1TC3 C;  2UZK A;  2DLL A;  1ZAR A;  4EMS A;  3DKW A;  4BY1 J;  1BL0 A;  3N97 A;  1J75 A;  3LSP A;  3PNT A;  3A0B C;  1DQU A;  1KU7 A;  2X6O A;  4XBF A;  2XDV A;  2E1O A;  2ZB9 A;  4WXD A;  2CQK A;  3FXU A;  3M07 A;  1IDZ A;  1HKQ A;  1AKH B;  2NVU B;  3QWL A;  3RZD J;  4B47 A;  1O3T A;  3G2B A;  5GTH C;  3A01 B;  1UFM A;  3V7C A;  4CHU A;  3KZI C;  4RLQ A;  3WTZ A;  1XMA A;  2K9M A;  3JRD A;  4WWC A;  1MIJ A;  3ABM H;  2EFO A;  5M5X J;  3HDD A;  3ROU A;  5DD4 A;  2ME0 A;  3K7A J;  1ENH A;  2CFX A;  2E1M B;  5E79 C;  2K02 A;  4D5F A;  3JRH A;  4K2E A;  1T08 B;  3KEO A;  3SJM A;  4BQA A;  1HXD A;  4EM1 A;  3CCV I;  1IN5 A;  1RZ4 A;  2HU9 A;  3G71 I;  1XCB A;  3FIS A;  2PQ8 A;  2PX9 A;  3KIO A;  3KP5 A;  2GLO A;  4QTR A;  5D4S A;  3J7Z I;  2VN2 A;  3DBR B;  4XMY A;  2ZXH A;  1UEL B;  2MLK A;  4FIS A;  1FBQ A;  3I58 A;  4B3A A;  1B8I B;  4LD5 A;  3HPH A;  1K83 J;  1S9H A;  3EUK L;  4YEL A;  1MSE C;  1XSV A;  2Y75 A;  2JSC A;  2GAU A;  4DYQ A;  3L00 A;  3TED A;  2CV0 A;  3BG6 A;  2VB6 A;  2LF8 A;  3S16 J;  2LR8 A;  3FXM A;  2ZBK A;  5IP9 J;  2RGV A;  3PUF A;  5BPI A;  1RET A;  4CZC A;  5J1R A;  2KZV A;  3HTS B;  3JTG A;  4E7I A;  2ICW G;  2EFP A;  5KAI C;  3JRI A;  5IT3 A;  1WI3 A;  5E1W A;  2DJN A;  3SZT A;  4AM3 A;  3VEP A;  1YIJ I;  1K4T A;  2R7S A;  4DNC A;  5JI6 A;  1U5T A;  5DV5 A;  1A5J A;  4DW6 A;  3OYL A;  1BI0 A;  1TT5 B;  2V1D A;  4P5O A;  1PJR A;  3MEX A;  2QUF A;  3HRU A;  2K9L A;  2O5R A;  3GLL A;  3RKX A;  1WH5 A;  1QQI A;  2ELH A;  4IHY A;  3F8B A;  3F8F A;  1ZTR A;  3QRF F;  2WAE A;  3LSK A;  3VWB A;  3L09 A;  4BE2 A;  1JTY A;  3UKG A;  1YOV B;  3CCY A;  1H9G A;  2M9H A;  3L1P A;  1ZH5 A;  2PMZ N;  2H94 A;  1JI8 A;  4D5C A;  2P7C B;  2X48 A;  2OQR A;  3OYB A;  3H5R A;  2KIS A;  3GXO A;  3RCO A;  2LLK A;  1O3S A;  3KZZ A;  6PAX A;  2DK5 A;  2VQC A;  1LE8 B;  4OIQ F;  2RKH A;  2O8X A;  3OS1 A;  2DI3 A;  3FKI J;  1SAN A;  4UNO A;  4XRF A;  5BS6 A;  1JKQ C;  1EV7 A;  1HKT A;  3S3N A;  3LQR A;  2MC3 A;  4PJN A;  3CD6 I;  3QYE A;  2L54 A;  2M7A A;  3KX2 A;  1K6O A;  4M9X A;  5HLG A;  4DIQ A;  1SD7 A;  4I02 A;  2WAF A;  2JJ7 A;  3RYP A;  1SVO A;  5HS9 A;  4U0V A;  2KMU A;  2XAG A;  1YFH A;  1ETO A;  3BR2 A;  3DKX A;  3QYF A;  3TOB A;  4HG2 A;  2KKO A;  1LFP A;  1IRF A;  2EH3 A;  4A6E A;  1FYK A;  3AG1 H;  3RSN A;  1Y56 A;  2IXS A;  4D9J A;  2DN0 A;  2HWV A;  3DPT A;  2ZSH B;  3OWT A;  3PNY A;  2XC7 A;  3BG9 A;  1U78 A;  3HRT A;  4A3E J;  5KK1 A;  2HPM A;  1ACI A;  3HGG A;  4BJT A;  2VKE A;  2W1O A;  5E8G A;  4HDU A;  4I0A A;  4G8X A;  5JR3 A;  1P6R A;  3GF2 A;  3IUO A;  3TBI A;  4U87 A;  3MZ8 A;  3HHG A;  3PO3 J;  4G7Z F;  3TGN A;  3OYI A;  1MJA A;  2CUJ A;  2IGM A;  3QYB A;  2KZG A;  1G3W A;  1NHA A;  5IT9 K;  3KFW X;  1IF1 A;  5C4J J;  2BXZ A;  1ZR4 A;  2ZXI A;  1GXQ A;  4MQV A;  2A5W A;  2P6S A;  1GV2 A;  4HX8 A;  4UXN A;  2BYV E;  2VPR A;  3CJR B;  4J00 A;  1E3O C;  4EM0 B;  2D45 A;  2L4A A;  3OY9 A;  3WTS C;  2ZNZ A;  5B3S H;  3GME A;  2V7F A;  2J5O A;  3KP7 A;  1WH7 A;  4EGY A;  3CDL A;  1P7J A;  1S72 I;  1YJ9 I;  3ZMT A;  2XAF A;  3PQJ A;  2F4I A;  2BY2 A;  4C2T A;  3ABT A;  1J09 A;  3MQ0 A;  5FKO A;  4OIR F;  2XF5 A;  3WHC A;  5J6X A;  4YRV A;  1LB2 A;  3J7A O;  4MFD A;  2BBY A;  3OL4 A;  4IRG A;  3I4N J;  2CH0 A;  2VI6 A;  1R1V A;  2QF7 A;  4U7D A;  1HQC A;  3ZMU A;  2C6Y A;  1VQ8 I;  2MYS A;  3IL2 A;  2DFF A;  1YG2 A;  2RVC A;  3A2K A;  2JA2 A;  4EVI A;  2W7N A;  3JSP A;  1Z3X A;  1ZG3 A;  4G9Y A;  2DA7 A;  3CF5 F;  2XB5 A;  2MD0 A;  2KT0 A;  1FMW A;  3L2R A;  3S14 J;  1H89 C;  1TNT A;  3OYH A;  5KVR A;  1DPU A;  1FYL A;  4XSZ F;  1SMT A;  2HTJ A;  2UV1 A;  1U5T B;  3MWM A;  2FOW A;  4CUG A;  3PFY A;  1JT6 A;  4HQM A;  3CCJ I;  2BW3 A;  3V42 A;  1LQ1 A;  3OS2 A;  4LK1 F;  1JUM A;  2ZJ2 A;  3ABK H;  3ASO H;  4NQW A;  2QQ8 A;  3MZH A;  3R0J A;  3WE2 A;  2E2I J;  1FLI A;  3JAM Z;  2VOD A;  4BE0 A;  1EH6 A;  1JKR C;  5M5W J;  4PJM A;  1MH4 A;  2DYS H;  5JVG F;  4XOP A;  2UUZ A;  4BU2 A;  2AXL A;  3IWF A;  2W48 A;  1QPI A;  2OQG A;  4M3E A;  2AXT C;  2F4M B;  1MDM A;  2IA2 A;  3BR6 A;  3KZY A;  4L0Y B;  3OR1 C;  3CCL I;  4Q48 A;  2M1B A;  3J81 K;  2K5C A;  2WAQ A;  4MEX F;  4Q5S F;  2O0Y A;  4XN3 A;  3K69 A;  4HYE A;  4LMY A;  2JUG A;  1YIT I;  2ZJR F;  4FX4 A;  1Y8R B;  4PZJ A;  1BI1 A;  2MH2 A;  3DLA A;  2MD5 A;  1FNN A;  2LDU A;  4IF4 A;  2M45 A;  2OUM A;  3RTR A;  1MMG A;  2OTL I;  3PL8 A;  2BHZ A;  1M1E B;  2JZY A;  3C18 A;  1A6I A;  4L5J A;  4FTH A;  2WB1 A;  4XLA A;  1U8B A;  4F7Z A;  3BWG A;  2AO9 A;  3ABU A;  4AU7 A;  4BHB A;  3SDB A;  4PJL A;  3MKL A;  3ZCO A;  3ERM A;  4YEJ A;  3E6D A;  1XCV A;  2M0M A;  2L02 A;  3LNQ A;  4BHP A;  2VXZ A;  4EJW A;  4CCO A;  3ELK A;  3KE2 A;  1S29 A;  5GP9 A;  1RUN A;  1IW7 F;  1RR7 A;  3CUQ A;  3M8F A;  3CCR I;  2CQQ A;  1JT0 A;  2XAJ A;  3RKQ A;  4LB5 A;  4NNJ A;  1SMY F;  2QCO A;  3CDI A;  2Y0M A;  1XGM A;  3B73 A;  4LFU A;  2W82 A;  4RBO A;  1WRJ A;  5B66 C;  2E7X A;  2V6C A;  3WGI A;  2Z1D A;  3CLO A;  4PK4 A;  5EEA A;  1GV5 A;  4ENK A;  4IQJ A;  2Y31 A;  4PJJ A;  2QGU A;  1JHH A;  3SHF A;  1I27 A;  2ZME C;  2A69 F;  4MQ9 F;  4KN4 X;  1ODD A;  2VQH A;  1F1Z A;  1RNL A;  4S04 A;  2QKM B;  1GT0 C;  3RKY A;  3BOQ A;  2H09 A;  2IPQ X;  2RC4 A;  4AYB N;  5JLW A;  4ZYA A;  2XGD A;  3PIP F;  3FBN B;  3AL0 B;  3CMM A;  2YX7 A;  4DZJ A;  1T98 A;  2DTR A;  3DFG A;  5B1B H;  1YJN I;  4FHT A;  4LLL A;  3GTQ J;  3TOA A;  1Y0U A;  3FM5 A;  1BI2 A;  4I98 B;  3IRR A;  1YJW I;  1JJ6 C;  3I5U A;  5TRD A;  3J81 Z;  4CSW A;  1IN8 A;  2W24 A;  3W6J B;  3I55 I;  4EGZ A;  1RPW A;  3LAP A;  3CC4 I;  3MN2 A;  4MHG A;  1MH3 A;  2L7M P;  4XRM A;  2KJC A;  2V26 A;  3K1M A;  5LFA A;  2VIX A;  1ZG5 A;  2N8G A;  2R0Q C;  2HZD A;  2H6C A;  2JTV A;  2VQL A;  3CCS I;  3OYK A;  3HB9 A;  2DA1 A;  3A4C A;  4G6Q A;  4EM2 A;  2ACJ A;  1LDJ A;  2F5C A;  3DEW A;  3ERE D;  3OYC A;  3IKT A;  4ON0 A;  3S1R J;  2EZL A;  2A5Y B;  3K2A A;  3WU2 C;  4YIF A;  5IOY A;  3W6V A;  2BW3 B;  1Z6R A;  3D5S C;  4M3D A;  4XR6 A;  3KPH A;  4NQW B;  3HPG A;  5ILS A;  4L9T A;  3M7G A;  1SD6 A;  4J01 A;  1KYZ A;  2LKS A;  2F5F A;  1TZL A;  2GWR A;  2I5U A;  1B9M A;  1PVE A;  3HGY A;  4U7B A;  3SZG A;  3X2Q H;  2UXX A;  3E5X A;  1C0W A;  2NYX A;  1MDM B;  2WV1 A;  5L3D A;  4B8X A;  1XDU A;  4FX0 A;  3N05 A;  1TQP A;  4EV0 A;  3ZRG A;  1Z67 A;  1VQP I;  3HKZ A;  2HYJ A;  2KIM A;  4YII A;  1HF0 A;  1WPK A;  4A0Y A;  5ILU A;  2Q2E A;  1W5C C;  2G9W A;  1ZRE A;  1SFU A;  3HOU J;  2IS4 A;  1Z91 A;  4P55 A;  5FO5 A;  4ITV A;  1RIO H;  2M5W A;  5AIP A;  3FHZ A;  2M4K A;  1GVD A;  3RPQ A;  4IOC F;  4C2M J;  1B1B A;  2LF7 A;  2G0E A;  3E6C C;  4OOI A;  1CGP A;  3I0T A;  4KIF A;  4KT5 C;  1Z3Y A;  2QWW A;  3CUO A;  1ZKG A;  4I09 A;  4TV7 A;  5D5V B;  4A3M J;  3CMY A;  2OPT A;  1TWG J;  1X19 A;  2JRT A;  1U0J A;  4RAZ A;  4I7H A;  3GBG A;  3H3V K;  1FOK A;  1D0Z A;  1W7P D;  3L2V A;  2XSJ C;  1UZC A;  4L5E A;  4CCJ A;  2M7B A;  1IXS B;  1TWH J;  4Y17 A;  4A3I J;  3BR1 A;  2BE5 F;  4KIB A;  3HXL A;  2OA4 A;  3LSG A;  3ZQI A;  2XGE A;  2HDD A;  4PGG A;  3PM1 A;  4ZH4 F;  3AFH A;  1VND A;  3IKV A;  1HA8 A;  5DDG A;  5FFX A;  3FIW A;  2EFN A;  1LNW A;  3CUQ B;  2XPW A;  5E18 F;  1QGP A;  1HW5 A;  4L0Z B;  1DU6 A;  1E0E A;  3TO7 A;  3OV8 A;  3NQO A;  3V8J A;  1APL C;  1Z05 A;  4D7M A;  5EEH A;  1HLV A;  3H9Q A;  4HW0 A;  3TO6 A;  3UNG C;  2QA4 I;  1REP C;  4QWQ A;  1YS6 A;  1J59 A;  4M73 A;  4NUB A;  1XG1 A;  2FA5 A;  1QZY A;  4A6D A;  1P4A A;  4OMY A;  5J47 A;  1R4N B;  1BM9 A;  4JK1 X;  3DV8 A;  3F6V A;  1X3W B;  1Z1D A;  1FIP A;  2EJR A;  2STT A;  1KQ9 A;  3BJO A;  4I99 C;  1YO5 C;  2DDA A;  2YU3 A;  4KUM A;  4PDK A;  4FE4 A;  2VON A;  1LPQ A;  5EZG A;  3CJT B;  3H0D A;  2Y0S A;  2R5Z A;  3IHU A;  4IJA A;  1NG6 A;  1MJB A;  5B1A H;  1OCZ H;  4QPQ A;  1S3J A;  4CYD A;  3CP8 A;  3C2H A;  9ANT A;  3ZN1 A;  3WOD F;  3HOX J;  1U9O A;  1E2X A;  4HA8 A;  3C1D A;  2ETH A;  2QQB A;  1Y8Q B;  4NC7 A;  4BY7 J;  1TW3 A;  3W2A A;  4YG2 F;  1ZQ3 P;  2RV8 A;  5JHF A;  2EK5 A;  2L7K A;  5H6R A;  4E6K G;  5M3M J;  3COA C;  2DFH A;  2CG4 A;  5AIQ A;  4MO7 A;  2W85 A;  2VE9 A;  1FTZ A;  3WTW C;  1I1S A;  2HR3 A;  1PYV A;  5LGU A;  3F3X A;  1WJC A;  2NS8 A;  1K79 A;  1YLF A;  3RPU D;  1U9N A;  1STZ A;  4NC8 A;  5CVI A;  1RRJ A;  2V4J C;  2XKO A;  5DM6 F;  1N75 A;  4AD9 A;  2JUC A;  2LY2 A;  4XQF A;  3DXJ F;  1BJA A;  5EJC A;  2ZCW A;  3QU3 A;  5ILV A;  1VZ0 A;  2EA2 A;  4N9I A;  1AA7 A;  2V79 A;  1A04 A;  3A1Y A;  4F3Q A;  2KP6 A;  4MTE A;  4UV8 A;  2DO7 A;  4RDU A;  1MW7 A;  1W4M A;  3ECH A;  3RZO J;  5F1J A;  3MD2 A;  3Q9S A;  2GA1 A;  2OF7 A;  1JGG A;  5FJ8 J;  2GXA A;  1R1U A;  4M9S A;  5D8L B;  2FUG 2;  1X2N A;  1JXS A;  2Q2E B;  1W5T A;  4UUS A;  1J7K A;  2H8W A;  1OKR A;  4BAC A;  1PP8 F;  1SD5 A;  3I4P A;  3F6O A;  3ZQL A;  2G7H A;  2R4G A;  4E7J A;  2HKO A;  3TO9 A;  3F21 A;  1XD7 A;  5FLX Z;  3BT9 A;  4CA0 A;  3LQQ A;  1IN6 A;  3HBL A;  4LG3 A;  2R5Y A;  2WV0 A;  1UCR A;  3NAU A;  5K5Q A;  4LIV A;  1FJL A;  2F2E A;  3QPT A;  3PNV A;  3DEE A;  2DXI A;  5F64 A;  5H2F C;  3FXO A;  3GO5 A;  2EB7 A;  3W2W A;  3K0L A;  2HGC A;  4ZTJ A;  2AQF A;  3TQN A;  2KDZ A;  5BPD A;  2KRF A;  1XB4 A;  2HXO A;  3GTM J;  3ZMV A;  1H0M A;  1KON A;  1WJD A;  3B6A A;  3DCF A;  2IS2 A;  1R22 A;  4AID A;  2E2J J;  2R7F A;  2XIG A;  3GTL J;  1DGW Y;  2MH9 A;  5CPR B;  3IH3 A;  2WWY A;  2BZT A;  2MGQ A;  1BOA A;  3WG9 A;  5J4V A;  2CWE A;  4BAY A;  4A2U A;  4XIC A;  4JX6 A;  1LDK B;  5BNG A;  5E3L A;  2HQN A;  2LVS A;  3M9A A;  2BHY A;  1J2X A;  1FMV A;  1K78 A;  2PMZ A;  1B59 A;  4ETS A;  3FM3 A;  2ZXW H;  1R58 A;  2A68 F;  2RQP A;  1P2F A;  3HTU A;  1P92 A;  1JJ8 C;  4KMU X;  4UY8 I;  3KEQ A;  2VBZ A;  1FOY A;  2XF6 A;  4A93 J;  2L7F P;  3HM5 A;  3HOY J;  1YQA A;  1BC8 C;  4GYG A;  2R5Z B;  2IVM A;  5TJJ A;  1Z7U A;  5DTD A;  2NVT J;  1MND A;  3FF5 A;  2XAQ A;  2VKH A;  3M3Y J;  3QQA A;  1EJ9 A;  3OYF A;  3CTA A;  2K86 A;  1BR4 A;  4ZJZ A;  5CVJ A;  4LB6 B;  2F6C A;  3FXQ A;  1VQ7 I;  1ETV A;  1FBS A;  2E35 A;  2QYO A;  2P7V B;  4P96 A;  2VLA A;  4HNT A;  3WE3 A;  4MTD A;  2WAD A;  3TMO A;  5DCF A;  2IP2 A;  1D1B A;  1GLN A;  1YIO A;  3HIF A;  1FP1 D;  2X1E A;  1S8N A;  3Q0U A;  2LG4 A;  5CQG A;  3ZQG A;  2E1N A;  5IYC J;  1HSJ A;  1ON2 A;  4ZYD A;  1Q1V A;  4UB8 C;  3R4K A;  2Q0O A;  4II3 A;  2I10 A;  1Z9C A;  2OZU A;  1O57 A;  2EIJ H;  3CMA I;  2QVO A;  3UR3 C;  2BXY A;  1WWX A;  1R00 A;  2CGP A;  3KLN A;  2L9S A;  2IA0 A;  2DT5 A;  2COB A;  4EJT A;  1K4S A;  3K4J A;  4U0W A;  2HKX A;  2DOA A;  2QZ8 A;  4BH9 A;  2VOP A;  4ANJ A;  2JA7 J;  5BOX A;  4IRH A;  4MFE A;  2LYC A;  1XN7 A;  2WC2 A;  4HNV A;  3HYI A;  1O7F A;  5CVR A;  3MFK A;  3PO2 J;  1B6A A;  3HL2 A;  1X1P A;  1DDN A;  3JRA A;  1WJA A;  4UUS B;  1P4X A;  5KHD A;  1DPR A;  5DUI A;  2QEX I;  2DFI A;  4O5V A;  4HEA 2;  4ENM A;  1SFO J;  2IAI A;  2VPL A;  2FE3 A;  4MGR A;  1QNT A;  4CCN A;  3LA2 A;  4RGU A;  2FJ1 A;  5K7H A;  2Y9Y A;  1I5Z A;  2D1H A;  2R5Y B;  1LFU P;  4BQN A;  2A61 A;  1FP2 A;  1XGS A;  4DOZ A;  1RKW A;  2DOF A;  2FU4 A;  4CCM A;  3V8L A;  4R79 A;  2K3F A;  4IZZ A;  4FCY A;  3F8N A;  1UJ8 A;  3Q0V A;  3DWL E;  4A3F J;  1UHM A;  3TDU C;  2XF7 A;  4JP0 A;  3FK7 A;  3NWS A;  3V7R A;  1U8R A;  3PJR A;  4RB3 C;  1ONV A;  3BR5 A;  1IRG A;  1X3U A;  5D6F A;  3FMR A;  3GTK J;  1E17 A;  2KLO A;  3HOT A;  2OD5 A;  3JAM K;  2MG4 A;  2QQA A;  2B9S A;  4Y13 A;  2ZME A;  3L7W A;  3RDI A;  4F55 A;  5D5U B;  2IS1 A;  1Z21 A;  3MKW B;  3NEU A;  1I39 A;  2JA6 J;  1XSD A;  1S6L A;  4F52 A;  3VYS B;  3GW2 A;  4ZDP A;  4OIO F;  3PSI A;  4MIM A;  1G2H A;  2GBY A;  1HW2 A;  2XPV A;  5C3E J;  1K78 B;  3H35 A;  1P7I A;  4II2 A;  4Q47 A;  3JTH A;  5CVU A;  5BQT A;  2ID6 A;  1YW9 A;  1VQM I;  1FPQ A;  1AHD P;  2P5V A;  3S2W A;  2VJ4 A;  2DQL A;  1LFB A;  3OYE A;  4CYC A;  1DP7 P;  1I6X A;  2FQ3 A;  2DMT A;  3WTU C;  3OYJ A;  4UB6 C;  2COM A;  3S1Q J;  3QOP A;  3GFJ A;  4E7L A;  3RI4 A;  1ON1 A;  3JSO A;  5IYD J;  3S8P A;  2ZJQ F;  3G6E I;  3L9F A;  1BIA A;  1ZYR F;  2LNB A;  4RGS A;  3ZQC A;  1T8I A;  4C3J J;  1OYW A;  5E3N A;  1VQ9 I;  1FX7 A;  2H1L A;  2E34 A;  3T1B A;  1Z0X A;  2VKD A;  2MW8 A;  2FXA A;  2VL8 A;  4Z6Y A;  4E7Z A;  4N0B A;  3DTI A;  3GYH X;  2LC2 A;  2JN6 A;  3OYA A;  4IHS A;  2NVQ J;  5H20 A;  5CQE A;  2BEO A;  1K6Y A;  1T95 A;  3BQZ A;  2CV1 A;  1EA3 A;  2NS0 A;  2R7D A;  5GAH J;  4BGD A;  2WA0 A;  4CGZ A;  1D0Y A;  2EIN H;  2NS7 A;  5HLT A;  3EET A;  3I71 A;  3N4M A;  3OOP A;  1IRX A;  2W25 A;  1BC7 C;  1LKX A;  3C7J A;  4BQO A;  3BZ6 A;  2HVQ A;  3K4C A;  3VOD A;  1VI0 A;  3H36 A;  1OQY A;  4ZC3 A;  1TP4 A;  3JRF A;  4HDV A;  2OV7 A;  1UG0 A;  2V1X A;  3KYL A;  5C4X J;  4XLP F;  1I6H J;  3LOC A;  3DEU A;  3IH2 A;  1DUX C;  2O7O A;  4OWR B;  1V4R A;  3TDZ C;  2EFW A;  3OSF A;  2GOM A;  1OCO H;  4JOM A;  3CME I;  3ZMD A;  3LFK A;  2ECB A;  2KPM A;  2FD5 A;  2JK3 A;  2X85 A;  3DU6 A;  2YU9 J;  4BXX J;  1R7J A;  5J40 A;  2HOS A;  1TT0 A;  2PFB A;  4HBL A;  4B48 A;  4KMF A;  3M4O J;  3SYT A;  1MBH A;  4M6V A;  2VKV A;  5HDG A;  3RQI A;  3H5N A;  5LRR A;  1OPC A;  4XKW A;  3EPZ A;  2O3F A;  1JTX A;  3OOU A;  3DU5 A;  2HQR A;  1X4P A;  2OC6 A;  1IXR C;  3SXY A;  4DJA A;  2O03 A;  3BCB A;  1T0F A;  1SC7 A;  1OCT C;  2W57 A;  2MLG A;  4KIC A;  4M3F A;  4ENJ A;  1JGS A;  1FZP B;  5FKL A;  5GPC A;  5E1Z B;  2IGK A;  5HOD A;  1D8K A;  2LY9 A;  5J8F A;  2DYR H;  3F9K A;  1A35 A;  4RB0 A;  1BA5 A;  5GAD J;  3OL3 A;  4L9V A;  2EFQ A;  3G3Z A;  2ZME B;  1HKS A;  2R93 J;  2JVG A;  4KNY A;  4IPA A;  3S15 J;  1YE9 A;  4BDZ A;  5F1R A;  4UVA A;  5H6Q A;  3LSR A;  1B72 A;  1D1A A;  2DA3 A;  5TGT A;  4B3X A;  3ECO A;  3HUG A;  3E6M A;  3VYU B;  4A3G J;  1BI3 A;  1NTC A;  2D2W A;  3GZ6 A;  2DJI A;  2PJP A;  5CKT A;  1X58 A;  3AG2 H;  2ME6 A;  3R60 A;  5FKM A;  1XX5 A;  2EA4 A;  2P0W A;  4KN7 X;  2JVH A;  2Z99 A;  2Y48 A;  3V7S A;  1QA6 A;  1RUO A;  1ZK8 A;  1NK2 P;  1R5H A;  2R7Z J;  5JFR A;  2R7V A;  1L0O C;  5GTI C;  1BR1 A;  3BR0 A;  1QHG A;  3FKJ A;  4CYC B;  5F0H A;  5KNL A;  3I53 A;  2EWN A;  3FDY A;  3K1P A;  3ZQH A;  5EDN A;  1ZRF A;  4RB1 A;  3DP7 A;  3Q0W A;  4JYK A;  2CUZ A;  2NRA C;  3PFI A;  2K4J A;  2Z2S B;  2M0C A;  5HVQ C;  4LLG F;  5HDN A;  4C2U A;  5CLS A;  1R9T J;  3ABL H;  4G6T B;  4A69 C;  2ZFU A;  2X9D A;  1F5T A;  2IGN A;  5E3O A;  2XRL A;  3F8M A;  3HG9 A;  2E1C A;  1ETY A;  1S5L C;  4HF1 A;  3CJQ B;  3JW4 A;  2BY3 A;  2YSR A;  3LSI A;  2GA2 A;  3HSR A;  2IA1 A;  3HOZ J;  3HOW J;  3TKY A;  2HI3 A;  2E71 A;  2HQ5 A;  3M1E A;  4PJ0 C;  4Y7N J;  3OSG A;  5DD8 A;  1SFK A;  4LGW A;  2XAU A;  5DEQ A;  1OJL A;  3OYM A;  3EYY A;  3T0Y A;  2L01 A;  5E3M A;  2WAQ N;  2PI0 A;  3T5X A;  4RLF A;  3C2B A;  4A3K J;  2NAZ A;  2M2E A;  2R7X A;  2ESH A;  5J8C A;  1ITY A;  2DU9 A;  1MMS A;  4NHJ A;  4WX9 A;  2DTZ A;  1OCR H;  2L9N A;  1FYM A;  4D7N A;  2ESN A;  3NRV A;  1Y1W J;  1MBE A;  4CDG A;  3G73 A;  5HLI A;  1MMD A;  1GUU A;  1BJZ A;  2E5Z A;  1T56 A;  2G7U A;  2B7E A;  1FTT A;  4M74 A;  3FMS A;  3SEQ A;  5FKN A;  1X1A A;  2M4G A;  3KEY A;  3GFI A;  5F08 A;  1H9T A;  2FRH A;  2FNA A;  3K4N A;  1KU9 A;  3IAM 2;  2L5Q A;  1RC9 A;  3P7N A;  2HOT A;  2ELK A;  5K7F A;  2K4B A;  2WY8 Q;  5F04 A;  2KQR A;  4BJ5 C;  2XVC A;  2LRD A;  5IPA A;  3B02 A;  3CCU I;  4GFB A;  3GX4 X;  2VJI A;  1B4A A;  2E7W A;  4A3D J;  4ZTF A;  1FOX A;  3MCZ A;  1AU7 A;  3D5R C;  4E7S A;  2VJ5 A;  1OYY A;  3K2Z A;  4GXO A;  1WSU A;  1V5F A;  2PBI A;  3ESW B;  1CF7 A;  2E19 A;  3LST A;  4M6X A;  3RQ4 A;  2XAH A;  2L0K A;  3IH4 A;  1W7P A;  3KYD B;  1D1C A;  4KIS A;  4KIT B;  3WU0 A;  4HX4 A;  1MSF C;  2IS6 A;  4A0Z A;  1OIS A;  2QBY A;  4HZF A;  2EBI A;  1G3T A;  3P9I A;  4L9J A;  3QOE A;  1ZRC A;  1MKM A;  2FML A;  3H3U A;  1TTY A;  1ZGJ A;  2PG4 A;  2VQG A;  2Z3Y A;  1JUS A;  4RAY A;  3CO7 C;  5CJ9 A;  3Q9V A;  3LL7 A;  3M8J A;  1LVA A;  1Z77 A;  3CCQ I;  1XS9 A;  4M3B A;  3IRQ A;  2BGC A;  3H1C A;  3ZXS A;  4A12 A;  4E7H A;  4HNU A;  4PSX A;  1B72 B;  1QU3 A;  3F23 A;  1T0F C;  1WVR A;  1J9I A;  3HUG B;  3K6G A;  2FOK A;  4C3I J;  3H9J A;  3DF8 A;  2NNY A;  3OIQ A;  1WJB A;  3W3C A;  5JHU A;  1VQO I;  2LK2 A;  1IV6 A;  3V4G A;  3HJE A;  1AOY A;  1ZGW A;  5LHH A;  2DPU A;  2KIU A;  3U1D A;  1MBG A;  4HPQ A;  4DBQ A;  4M9Z A;  2CYY A;  1YX5 A;  2M8G X;  1E3H A;  1VFC A;  5J1U A;  5FLX K;  3WHB A;  5K7Z A;  4QLC U;  4XM3 A;  1ZG1 A;  3S32 A;  2UXN A;  1RR8 C;  4A0X A;  3S2H J;  1SD4 A;  2EQR A;  4LOC A;  5F0F A;  4BEH A;  4Y33 A;  3OYD A;  1IC8 A;  4G7H F;  4GCV A;  3CCE I;  2L7Z A;  1XPX A;  1FEX A;  3KP6 A;  2E2H J;  3RKW A;  3WG7 H;  3LMM A;  1HDP A;  1UHW A;  3GEZ A;  3HOS A;  4G94 A;  1OR7 C;  2LBF A;  2P5K A;  3VOE A;  2E60 A;  2QQ9 A;  2X1D A;  4E4H A;  2F5V A;  3MKZ A;  2HNH A;  2KFD A;  1X1B A;  2ZKZ A;  3GFM A;  3HRM A;  4XRS A;  3BY6 A;  3JR9 A;  2AHQ A;  4XK4 A;  3VSK A;  4J19 A;  1NK3 P;  1YYV A;  1ZRD A;  2ZSI B;  2FBI A;  2CO5 A;  2OJE D;  4F93 B;  1TWC J;  2DK8 A;  2XPU A;  4P1W A;  1HST A;  4UHT A;  2P81 A;  3CO6 C;  3A02 A;  1Z6T A;  3RPU A;  3S93 A;  1V54 H;  2LY1 A;  1H8A C;  4GRI A;  2R7O A;  4WF2 A;  4EAT A;  5HDK A;  3HKZ N;  1YX3 A;  3K4B A;  2CS3 A;  3TW7 A;  5EG0 A;  4AIJ A;  1VQK I;  1R5I D;  2DOE A;  4ZZD A;  2HEO A;  3O8H A;  1AWC A;  4IHT A;  1XTA A;  3T8R A;  2EPF A;  5M5Y J;  3QAH A;  1MMN A;  2VXD A;  3VSL A;  2CW7 A;  3HZJ A;  4UV9 A;  4Y3O A;  2M3A A;  3LAJ A;  2X51 A;  4GO1 A;  3BLY A;  2YS9 A;  1YRN A;  4V2F A;  2Q8K A;  4HF2 A;  1KYW A;  1W5S A;  2RAE A;  5GPA A;  2Z16 A;  2PEX A;  3WTV C;  1MNM C;  3H5A A;  5HS7 A;  5HNF A;  1O3R A;  4MEY F;  3W6K B;  3MMY B;  4LIT A;  2OCC H;  2X6Y A;  4IQ4 A;  3IAS 2;  5FB2 A;  2R92 J;  3BZC A;  3SFZ A;  1V55 H;  5CVV A;  2JWT A;  4D1Q A;  3CJN A;  4A3B J;  1MBJ A;  3NAR A;  4B43 A;  4ASN A;  2XAS A;  5LGN A;  2HOE A;  1IN7 A;  5EZH A;  4PCQ A;  2H1K A;  1ZHF A;  2HFH A;  4C9Y A;  3ZOB A;  3GFL A;  4RAG A;  1CF7 B;  2I8D A;  3FZV A;  5DUK A;  3E97 A;  1W7P B;  2MFZ A;  2ELJ A;  1W36 D;  1Y0N A;  2CFO A;  2GZW A;  2XRN A;  1J5Y A;  4HOB A;  4LK0 F;  1NH3 A;  3BQY A;  4M72 A;  4NDL A;  4WXH A;  2QBY B;  4BYY A;  4M71 A;  4CZZ A;  1MZB A;  1CQT A;  3FXK A;  3EUH C;  3CLQ A;  4OAZ A;  1XGO A;  1POG A;  2FEZ A;  2ECC A;  4KDP A;  5L3F A;  1I1G A;  1Y6I A;  4HLX A;  5LGT A;  1QRY A;  2RDP A;  4ESJ A;  2QSH X;  1HOM A;  1LUJ B;  2IRF G;  4LG0 A;  5FRN A;  4BXU A;  2IGO A;  3F0C A;  4QIW N;  3A0H C;  3WTT C;  2O61 A;  2IW5 A;  2Y0S N;  3M8E A;  1FT9 A;  2HS5 A;  3D5L A;  4X6A J;  3VB2 A;  4XKC A;  4IHX A;  2DT7 B;  4R8H A;  1D8J A;  2DFE A;  2BY0 A;  4XL9 A;  3DTK A;  4RGR A;  4MNU A;  4B1R A;  4EJO A;  2E36 A;  3E1S A;  4D0P A;  2JSP A;  4G6D A;  1PDN C;  3IC7 A;  4KIG A;  3BG5 A;  2WY7 Q;  1YTY A;  2DAO A;  1WCM J;  2LP0 A;  1T6S A;  4XLN F;  3TP0 A;  1UB9 A;  3H9G A;  2HXI A;  1UG2 A;  1Z7L A;  4X1E A;  1I3Q J;  1R5G A;  1IXC A;  1ZEL A;  4H4K C;  3EYI A;  1F36 A;  4AVZ A;  1MMA A;  3R61 A;  1R1T A;  1RKT A;  1HDD C;  5ICE A;  5FLM J;  2JPC A;  3DQV C;  1SFE A;  4BEH B;  1MJ9 A;  3NWT A;  4WXC A;  4I2O A;  2F48 A;  5IP6 A;  5GAE J;  2D1V A;  1Y1V J;  4AUX A;  2IEK A;  2NOJ B;  4HSR A;  1U6G A;  2IBD A;  2LBF B;  2ZO4 A;  5K1Y A;  4WK8 F;  1ZLK A;  4RS8 A;  4HV5 A;  2VC1 A;  2NVX J;  1BW6 A;  4HX7 A;  2QM3 A;  3OIO A;  3H92 A;  4RMN A;  2FBK A;  3WGH A;  3EUA A;  1QBJ A;  4HAM A;  5EYR A;  2AQE A;  2KJB A;  2PN6 A;  1OLT A;  2B0L A;  1TWF J;  4XOR A;  1O3Q A;  2H8R A;  2ZNY A;  2NVY J;  5FRM A;  3KCC A;  1W1W E;  1S7E A;  5LRS A;  1FIA A;  2FQ4 A;  3QP6 A;  1UST A;  2R7U A;  4IHV A;  3QOD A;  3FWE A;  5EG0 B;  2DA4 A;  2QEN A;  4CO8 A;  2XB0 X;  3GZ5 A;  2HYG D;  1VQ4 I;  2XV4 S;  4XKB A;  2V9P A;  4WCG A;  2A05 A;  3J7Y J;  3GCM A;  4JQF A;  2V6E A;  1OCC H;  3P9K A;  1YRN B;  3LA3 A;  1RI7 A;  5ICC A;  3K4M A;  2HOA A;  1IUY A;  2L9R A;  3DKY A;  4NC6 A;  4XLC A;  2JRM A;  2LOO A;  2MSY A;  3KLO A;  5CYV A;  3LSJ A;  4HRI A;  2E1M C;  1TWA J;  1G3Y A;  1P9Q C;  3OS0 A;  3OYN A;  3GLX A;  3QPL A;  3ZMS A;  3GTP J;  1ORK A;  1QVU A;  2HVS A;  5EGO A;  1TNS A;  2FBH A;  2LMD A;  4NBQ A;  3SZP A;  2GXG A;  3K9T A;  4YFN F;  2P6T A;  5GAG J;  4XOT A;  3GTJ J;  4CCK A;  3WTY C;  4CXF A;  4XN0 A;  2MA3 A;  1X3Z B;  3E5Q A;  3KP2 A;  3ML6 A;  2JMW A;  2QSF X;  4CH7 A;  3BDD A;  1J0R A;  1F4K A;  3FXJ A;  5FRO A;  2A3S A;  4V19 K;  4ZDL A;  1BW5 A;  1BBY A;  5HLH A;  3A03 A;  1D3Y A;  2LTP A;  4S05 A;  1H88 C;  1IUF A;  4FAS D;  4RA2 A;  4IL6 C;  1USS A;  4HF0 A;  4W1U A;  4MLO A;  5KCM A;  2XKP A;  3O3K A;  5ICF A;  3BJA A;  3ZMZ A;  1XC5 A;  5D5W B;  2WBM A;  2PJR A;  5IY5 H;  2VE8 A;  5HS8 A;  5DCM A;  3SFI A;  3PQK A;  1UHS A;  2RNJ A;  1MD0 A;  3TL4 X;  2CSO A;  1XDS A;  3D1N I;  1WQ2 A;  3E7L A;  1QVT A;  3QPS A;  1W36 C;  4LG0 B;  2EIK H;  2M8E A;  2HVR A;  4H0E A;  5IYB J;  5DM7 F;  4BE1 A;  3GTO J;  1EH8 A;  3L2C A;  3L2Q A;  1IAW A;  1F9N A;  2RQQ A;  2DW4 A;  1EH7 A;  2JPB A;  3OMY A;  5ERI A;  4C30 A;  5E20 A;  1WKM A;  3ZQ7 A;  1SAX A;  3QU6 A;  3FX3 A;  2EV6 A;  4XKV A;  1D5Y A;  3HSF A;  2HDW A;  2DA2 A;  3AKZ A;  2MC4 A;  1RES A;  3U9G A;  3WGG A;  5EF6 A;  3E5U A;  1IO2 A;  2VOO A;  1A6Q A;  2Y69 H;  1V5E A;  2PMH A;  3HRS A;  2VUM J;  2PMU A;  1SEU A;  3HSE A;  2V9V A;  3JCU C;  1N78 A;  3BTI A;  1R6R A;  1IZ1 A;  1A36 A;  2D5V A;  2R7W A;  1OCP A;  4GGG A;  3BTJ A;  4W97 A;  3G4S I;  3JRG A;  2X0L A;  1XSX A;  3BTL A;  3ZQF A;  1YS7 A;  1BN5 A;  1HBX G;  2Z9O A;  2UWM A;  2VT2 A;  3I56 I;  4OU0 A;  1GXP A;  5D8K B;  2TRT A;  3GVA A;  3GTG J;  4BBS J;  2GXB A;  4XSX F;  1T2K A;  4P9F A;  2LKP A;  4LLN A;  4DGW B;  3FHN A;  2GQQ A;  3F72 A;  4B09 A;  4XLH A;  2L9V A;  4Q4Z F;  2ID3 A;  1HW1 A;  1S7O A;  5ICG A;  1MBK A;  3CC2 I;  1JKO C;  3I54 A;  3OIP A;  2NNN A;  3BJ6 A;  3JRB A;  3DPU A;  2YR2 A;  1PUF A;  1N77 A;  1KGS A;  2YPR A;  1ZLJ A;  4Y4R A;  4IVN A;  1T39 A;  4UVB A;  4I01 A;  4BBR J;  4N4O B;  5LHI A;  4BNC A;  4F91 B;  2FSW A;  3KP3 A;  5A2Q K;  4PGH A;  3K70 D;  1WI9 A;  5HNH A;  3I59 A;  4PSW A;  4P9U A;  3ZPL A;  1F43 A;  1SVL A;  1YW7 A;  2PLY A;  2FNP A; 
#chains in the Genus database with same CATH homology
 1MSE C;  5M3M J;  5E3M A;  4MO7 A;  2WAQ N;  3C2B A;  1FTZ A;  4DYQ A;  4A3K J;  3TED A;  2M2E A;  4V2G A;  2NS8 A;  1ITY A;  1IG7 A;  3S16 J;  2LR8 A;  1U9N A;  2K9S A;  5IP9 J;  2DTZ A;  1RET A;  4D7N A;  5J1R A;  5EGO B;  1Y1W J;  1MBE A;  1GDT A;  3TW6 A;  5IOZ A;  3S2D J;  1GUU A;  1BJZ A;  3JRI A;  5FLV A;  1T56 A;  1VF9 A;  1WI3 A;  4I76 A;  1FTT A;  2DJN A;  5FKN A;  1A5J A;  4DW6 A;  3BG3 A;  5F08 A;  4RDU A;  3RZO J;  3BR3 A;  5F1J A;  2OF7 A;  1JGG A;  2HOT A;  5FJ8 J;  2ELK A;  5JLX A;  5K7F A;  1WH5 A;  5F04 A;  4IHY A;  1ZTR A;  5IPA A;  4GFB A;  1X2N A;  3H0G J;  4A3D J;  4Y52 J;  1JTY A;  3UKG A;  3CCY A;  1AU7 A;  4UUS A;  3VPR A;  2M9H A;  3L1P A;  2PMZ N;  2E19 A;  4D5C A;  3IH4 A;  2L0K A;  1JKP C;  3ZQL A;  2X48 A;  1JUP A;  3I4M J;  1MSF C;  2DMQ A;  3BT9 A;  4JX4 A;  4QSH A;  3HBL A;  2R5Y A;  2EBI A;  2LLK A;  3NAU A;  1FJL A;  1LE8 B;  4G12 A;  1JUS A;  3FKI J;  1K61 A;  1Z77 A;  1SAN A;  1XS9 A;  1JKQ C;  2KDZ A;  4M3B A;  2HXO A;  3GTM J;  1B72 B;  5J3L A;  3B6A A;  3DCF A;  2CUE A;  2E2J J;  1O4X A;  3GTL J;  2JJ7 A;  3IH3 A;  3Q3S A;  2XGC A;  4C3I J;  2MGQ A;  1ETO A;  3BR2 A;  2LK2 A;  1IV6 A;  2YUS A;  2EH3 A;  4XIC A;  1ZGW A;  4JX6 A;  5BNG A;  1MBG A;  2DN0 A;  2LVS A;  5E3L A;  1ZR2 A;  1U78 A;  3BG9 A;  2M8G X;  4A3E J;  1VFC A;  3HGG A;  5J1U A;  3WHB A;  5K7Z A;  2VKE A;  4I6Z A;  3S2H J;  1W0T A;  2LFB A;  2EQR A;  2B63 J;  1JJ8 C;  4LOC A;  5F0F A;  3PO3 J;  1IC8 A;  2L7Z A;  4A93 J;  2L7F P;  3HM5 A;  3MVP A;  2E2H J;  1FEX A;  3HOY J;  5C4J J;  1HDP A;  4DYR A;  2R5Z B;  1ZR4 A;  2LD5 A;  1DU0 A;  5DTD A;  2NVT J;  2DMP A;  1GV2 A;  2DA5 A;  3M3Y J;  2VPR A;  2EZI A;  3QQA A;  3HEF A;  1PUF B;  1E3O C;  1IDY A;  4XRS A;  4XRS G;  3JR9 A;  2O9L A;  2AHQ A;  4XK4 A;  1ETV A;  3S17 J;  4J19 A;  1NK3 P;  1WH7 A;  3CDL A;  1P7J A;  1TWC J;  2XPU A;  2P81 A;  3A02 A;  5FKO A;  4AC0 A;  2Y9Z A;  3WHC A;  4MFD A;  1H8A C;  3I4N J;  3SDG A;  2VI6 A;  2QF7 A;  4DZP A;  3HKZ N;  3TW7 A;  3Q0U A;  5EG0 A;  3ZQG A;  4IHW A;  5IYC J;  3O8G A;  3O8H A;  5M5Y J;  1Q1V A;  2EZH A;  2K40 A;  2I10 A;  2DA7 A;  1YRN A;  2XB5 A;  2YS9 A;  4V2F A;  2KT0 A;  2RAE A;  5GPA A;  3S14 J;  2Y2Z A;  1H89 C;  1OFC X;  2WB1 N;  1MNM C;  2COB A;  2XSD C;  5IP7 J;  1JT6 A;  4EEF G;  3JRC A;  2R92 J;  1JUM A;  2JA7 J;  4MFE A;  2E2I J;  2JWT A;  4HNV A;  1JKR C;  1IGN A;  4A3B J;  5M5W J;  1MBJ A;  1MH4 A;  3NAR A;  3PO2 J;  2FX0 A;  2W48 A;  1QPI A;  4ABZ A;  5EZH A;  4M3E A;  2O8K A;  3JRA A;  2H1K A;  5C44 J;  4UUS B;  3BR6 A;  3ZOB A;  2CU7 A;  1SFO J;  2IAI A;  2FJ1 A;  5K7H A;  1EF4 A;  2DMN A;  2Y9Y A;  3BQY A;  4NDL A;  2R5Y B;  1LFU P;  1CQT A;  2GM4 A;  1RKW A;  3FK6 A;  4FCY A;  2CQX A;  1POG A;  4C3H J;  2ECC A;  1I50 J;  3Q0V A;  4A3F J;  2NOG A;  1QRY A;  4JP0 A;  1HOM A;  3FK7 A;  1ETW A;  3BR5 A;  4A3C J;  4B4C A;  3F0C A;  4QIW N;  1A6I A;  4FE7 A;  4FTH A;  1U8B A;  3GTK J;  2Y0S N;  2AO9 A;  4X6A J;  2MG4 A;  4IHX A;  3MKL A;  4B1R A;  4DYC A;  1MBF A;  2JA6 J;  3BG5 A;  2DMU A;  1WCM J;  2LP0 A;  3TP0 A;  2DA6 A;  2HXI A;  1UG2 A;  4X1E A;  3LNQ A;  4A3L J;  1I3Q J;  4MIM A;  1G2H A;  2GBY A;  1F36 A;  4XID A;  5GP9 A;  1RKT A;  2XPV A;  5C3E J;  1RR7 A;  1ETQ A;  1P7I A;  1HDD C;  2CQQ A;  1JT0 A;  5FLM J;  3RKQ A;  3HOV J;  2ID6 A;  2QCO A;  3BTC A;  1AHD P;  1AKH A;  4RBO A;  5IP6 A;  1LFB A;  1Y1V J;  4CYC A;  4AUX A;  2IEK A;  5EEA A;  1GV5 A;  1W0U A;  2IBD A;  2Y31 A;  3A01 A;  2DMT A;  2CRG A;  3IV5 A;  3S1Q J;  2NVX J;  1BW6 A;  1GT0 C;  3OIO A;  4IEJ A;  5IYD J;  4AYB N;  5JLW A;  1HCR A;  3ZQC A;  3TP3 A;  4C3J J;  2XGD A;  5E3N A;  5EYR A;  3S1N J;  1Z0X A;  1TWF J;  2MW8 A;  4DZJ A;  2H8R A;  2NVY J;  3G1M A;  3GTQ J;  4A3J J;  1S7E A;  2JN6 A;  1FIA A;  2FQ4 A;  3CQZ J;  2NVQ J;  1JJ6 C;  4IHV A;  5EG0 B;  3BQZ A;  2DA4 A;  5DS9 A;  5F27 A;  2K9Q A;  2XB0 X;  1RPW A;  3MN2 A;  1MH3 A;  2L7M P;  2NS7 A;  5FKK A;  4XRM A;  5M3F J;  1B8I A;  1IJW C;  2N8G A;  1YRN B;  1VI0 A;  2R0Q C;  2M34 A;  2HOA A;  3JRF A;  2L9R A;  3HB9 A;  2DA1 A;  2MSY A;  1X2M A;  3DEW A;  3JRE A;  5C4X J;  1I6H J;  3LSJ A;  3S1R J;  2EZL A;  3LOC A;  1TWA J;  3IH2 A;  3K2A A;  5IOY A;  2O7O A;  3W6V A;  3QPL A;  3GTP J;  1ORK A;  1QVU A;  4M3D A;  3OSF A;  5EGO A;  1WGX A;  2CJJ A;  2ECB A;  2FD5 A;  1ETK A;  3GTJ J;  2JK3 A;  3HGY A;  2JA8 J;  2YU9 J;  4BXX J;  2WV1 A;  2JMW A;  2HOS A;  3M4O J;  4BKX A;  2K9N A;  1BW5 A;  1MBH A;  4M6V A;  5J1Y A;  2VKV A;  3RQI A;  3A03 A;  3G1O A;  2LTP A;  1H88 C;  2JA5 J;  1IUF A;  1JTX A;  3OOU A;  2HYJ A;  1HF0 A;  3B6C A;  1WPK A;  4MLO A;  4W1U A;  2EZK A;  3HOU J;  4S0H B;  1OCT C;  1ETX A;  4M3F A;  1XC5 A;  5FKL A;  1GVD A;  3SFI A;  5GPC A;  4C2M J;  2G0E A;  1UHS A;  3S1M J;  5HOD A;  3D1N I;  3E7L A;  4UUT A;  1QVT A;  2LY9 A;  1T33 A;  3QPS A;  1ZKG A;  4A3M J;  3CMY A;  2CUF A;  1TWG J;  2OPT A;  5IYB J;  2LKX A;  3GTO J;  1LE8 A;  1BA5 A;  3H3V K;  3GBG A;  1UMQ A;  4JX5 A;  3G1L A;  4L5E A;  5F0C A;  4M3G A;  2R93 J;  2TCT A;  1TWH J;  4A3I J;  2Y30 A;  3BR1 A;  3S15 J;  1IRZ A;  1D5Y A;  2DA2 A;  3LSG A;  3LSR A;  1RES A;  1B72 A;  3ZQI A;  5EF6 A;  1TC3 C;  2XGE A;  2HDD A;  2DA3 A;  3PM1 A;  1VND A;  4A3G J;  4BY1 J;  1NTC A;  1BL0 A;  3FIW A;  3LSP A;  2VUM J;  2XPW A;  1X58 A;  2ME6 A;  1DU6 A;  5FKM A;  3BTI A;  2X6O A;  1APL C;  4D7M A;  2E1O A;  2ZB9 A;  1ZK8 A;  1NK2 P;  1HLV A;  2D5V A;  1OCP A;  1IDZ A;  2R7Z J;  3BTJ A;  4W97 A;  1AKH B;  3JRG A;  1XG1 A;  3BR0 A;  3BTL A;  3RZD J;  3ZQF A;  4CYC B;  5F0H A;  3A01 B;  3ZQH A;  5EDN A;  2TRT A;  3JRD A;  3Q0W A;  4JYK A;  3GTG J;  4BBS J;  1FIP A;  2M0C A;  5M5X J;  3HDD A;  4FE4 A;  2ME0 A;  3K7A J;  1R9T J;  1ENH A;  5EZG A;  4A69 C;  4D5F A;  2ID3 A;  2X9D A;  3JRH A;  2R5Z A;  3SJM A;  5E3O A;  1MBK A;  1JKO C;  3JRB A;  2XRL A;  1PUF A;  1ETY A;  9ANT A;  3FIS A;  3HOX J;  1U9O A;  4BBR J;  2GLO A;  4QTR A;  3HOZ J;  3HOW J;  2HI3 A;  2HQ5 A;  4BY7 J;  4Y7N J;  3OSG A;  4FIS A;  1ZQ3 P;  4B3A A;  1B8I B;  1F43 A;  1K83 J;  1OJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...