3HHHA

Crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
102
Chain Sequence
KQTELLKGILEGLVLAIIQRKETYGYEITKILNDQGFTEIVEGTVYTILLRLEKNQWVIAEKKPSEPMRKFYRLTSSGEAELADFWQRWTLLSKQVNKMKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transcriptional regulator, a membar of PadR family, from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, PadR family
total genus 32
structure length 102
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hhhA00
4ENKA 1O3QA 3F72A 3SZPA 2DT5A 3FMRA 4MQ9F 4UVCA 5DV5A 5ILUA 1FSHA 4CHUA 3GFJA 4R8HA 3MWMA 4ON0A 2V1XA 2EV0A 2RVCA 4LLGF 1RIOH 5FD6A 2Z3YA 1EH8A 2VC0A 2EFWA 1FYMA 5K1YA 4Q48A 2K4BA 4P5OA 2EB7A 2YSRA 3QU3A 1ULYA 4M6XA 4P9FA 2D1HA 2L4AA 4L5JA 4MEXF 5F6FA 3GLXA 3WU1B 2LSOA 4CICA 2OBPA 1BM9A 2L3DA 1D8KA 2VT3A 3MAJA 3BZ6A 2TDXA 5D4SA 2HQRA 2EV5A 2QLZA 1G4DA 2H6CA 2HFHA 2M1BA 2IVMA 4XSXF 1J9IA 3JW4A 5D6EA 2EA4A 5DYMA 2M87A 3BP8A 3IL2A 1HKQA 5TRDA 2VE9A 1MJAA 2IRFG 2P6TA 2QBYA 2ELHA 5DD4A 3GYHX 1SD5A 3RI4A 4HX4A 4ESFA 1BI2A 4PCQA 4Z2YA 3HRTA 4ZH4F 1MJ9A 3DKWA 5CJ9A 2H94A 1W5TA 1ZRDA 2RGVA 3FM5A 4HAMA 1XMAA 1VTNC 1IRGA 4CYDA 4KT5C 3WODF 1R00A 3E5QA 3P9CA 2FE3A 1JHFA 4ZYEA 2A6HF 4LLNA 3R0AA 4DNCA 3CO7C 4D0PA 3DPLC 1JGSA 4G9YA 1SFXA 5JHUA 4ZYDA 4IHTA 3HOTA 2VOOA 1IN4A 4HV6A 2A07F 3HYIA 4EJWA 5HLGA 1R23A 2XROA 2Z99A 3IRRA 5D4RA 1T98A 2ZCWA 3QPHA 5FLXK 1TNSA 2KJBA 4KFCA 1CGPA 4I01A 5LHHA 4ENJA 3H3ZA 3GW2A 1QO0D 4A0ZA 4GCVA 1S29A 2GWRA 1WI9A 4HYEA 2M45A 2GXBA 2CFXA 3TO6A 4YFXF 2Z9OA 3NEUA 1OYWA 3F22A 4B8XA 5KVRA 3H3UA 3DQVC 3DF8A 3WE2A 1YQAA 1IAWA 2DO7A 3F8NA 5E1WA 2PN6A 3W6JB 4A5MA 1FWZA 4KYWA 4N0BA 3EUHA 4UV9A 3QPTA 3WTVC 4Y17A 2AS5F 4LB5A 4EJTA 4A0XA 3SQNA 1IN6A 3P7NA 5FD5A 1IN5A 4EMSA 3MQ0A 3KETA 2A5YB 2ESNA 1DP7P 4XSZF 4M74A 3ECOA 4L9NA 4KUMA 4HQMA 2L02A 1W7PA 4QLCU 1SMTA 1J0RA 4KIBA 2QENA 1XDSA 2E7WA 4NQWA 4I02A 2OAZA 3FMSA 2IPQX 4L5IA 4UVBA 5LLQA 1BI3A 1U6GA 3CUQC 3FF5A 2JPCA 2QZ8A 1FP2A 1FZPB 2X0LA 2J5OA 4XRFA 1S3JA 2W24A 2HTSA 2F5EA 2IW5A 1BJAA 1T2KA 3M1EA 3QAHA 5BQTA 4IRGA 5ICFA 4BAYA 3ABUA 2V6CA 1TQIA 2GAUA 1JE8A 1RUNA 2NYXA 3F8BA 2G7UA 1BOAA 4BXUA 2CO5A 2FSWA 4N9IA 3ZMSA 5FFZA 2OZUA 2QUFA 1HW2A 2P7CB 2GXGA 2VT2A 3F8FA 1XDUA 4CO8A 3K1MA 4RB0A 1DDNA 2M5WA 2XIGA 4RB3C 5LBQA 2PEXA 5FB2A 4G7HF 5DUKA 2DPDA 2ISZA 1FC3A 2DFIA 2ESHA 3HSFA 1CF7A 2R3SA 1ZN2A 2P5VA 2HGCA 2ZXJA 4EJVA 1YIOA 3JSPA 1B9MA 3WTXC 3J80K 2PLYA 4AIJA 3D5LA 4N9HA 1ZREA 3W6KB 2C6YA 2Y48A 4KN4X 1FBSA 3WTZA 3HRMA 1HSJA 3LAPA 2OD5A 4CDGA 1MJBA 3DPTA 2CSOA 2M8EA 4HLYA 3IRQA 3GFLA 3KP7A 3J81Z 4KA4A 2O0YA 5E8GA 1P2FA 5HS8A 4KDPA 4CXFA 3VFZA 1R1VA 1XN7A 2ZNYA 3U9GA 3M9AA 3GFIA 2LNBA 1W7PB 2XAFA 1RUOA 3BJOA 4NHJA 5D5XB 4HW0A 3ABTA 5JVTA 3KZYA 3B02A 4NB5A 1SFUA 3I59A 1YLFA 3I5UA 4A6DA 3M8FA 1W7PD 3WTSC 3TO7A 1MD0A 2Z33A 4EM1A 2HQNA 3HTUA 3HRUA 4GO1A 4JK1X 5L3BA 1ZGAA 1DUXC 4R1HA 2BV6A 2CYYA 3K69A 4A5NA 2DBBA 3N97A 4KIGA 4BHBA 2K86A 4L9JA 4M6YA 1LQ1A 3CLOA 2IP2A 2EFQA 2VBXA 1TNTA 1FP1D 1SMYF 4IRHA 4HBLA 2VBZA 3FXQA 3RKWA 4LB6B 1XCVA 4ZYGA 3WTYC 4YG2F 4AVPA 1TBXA 3MZHA 4GGGA 1TTYA 2V1UA 1USTA 2IT0A 1FPQA 3TDUC 2DW4A 2Y75A 2CQKA 2VBWA 4BHPA 2HWVA 1LEAA 1IUYA 2OZ6A 2AXLA 4ZZLA 5AIQA 3V7SA 3ML6A 1R1UA 3K1PA 3WU0A 2PJPA 5K5OA 3G73A 2ZO4A 4PGGA 1J59A 5A2QZ 3ZQ7A 3JSOA 4OIQF 2XV4S 5BPIA 5D5VB 2O6GE 3HSEA 3E6MA 3PQJA 2KIMA 3QP6A 5HDGA 2FOKA 2ZBKA 4JQFA 1BC8C 4FX0A 3GFMA 3E3VA 2A69F 3JTGA 1LJ9A 2YU3A 2Y0MA 2KIUA 2NAZA 2JZYA 4R79A 3E6BA 5TJJA 1UCRA 2P8TA 1SD7A 4ESBA 1ZG5A 5ICCA 2XKPA 5CVJA 5CYVA 3N4MA 3QRFF 5BPDA 2NNNA 3C1DA 1FX7A 3TDZC 1B1BA 1G3YA 1K78A 1IXRC 2O3FA 4IJAA 1O3RA 5F1RA 3BPVA 4HDVA 2NNYA 1H9TA 2FBHA 5LGTA 5E1XA 4HA8A 3V8JA 5J6XA 1LNWA 1G3SA 4TV7A 4RGUA 3GX4X 4HV5A 3E97A 4Y15A 2ZMEB 3I71A 3VB2A 1PP7U 4HF2A 2HTJA 3GEZA 3FZVA 4PZJA 5LHGA 5H6RA 5BMZA 1P6RA 3L9FA 2PFBA 4CGZA 5DCFA 5ILSA 1AWCA 3WE3A 3FXRA 5HS9A 2ZJ2A 3RIRA 1U78A 5E8IA 3P9IA 1IZ1A 3COAC 2O8XA 1OYYA 4P55A 1XMKA 3K2ZA 4M9XA 1SFEA 1I5ZA 2JPBA 5ERIA 2W84A 2Z5UA 3LWFA 5LGUA 4ASNA 1YS6A 3T8RA 3F8CA 2HKXA 2PI0A 2H27A 1R36A 1WQ2A 2ZKZA 3DXJF 4M9ZA 3CDHA 3C3WA 1OR7A 1XD7A 5J8CA 2WV0A 1Y0UA 3CUOA 3KEQA 1U8RA 1ZG3A 3H92A 2G7HA 2H6BA 1W5SA 2O03A 5BOXA 5LRSA 3F6VA 2FBIA 2ZMEA 3I54A 4WXDA 2CW0F 2QWWA 2HYGD 3I64A 1DPUA 4B09A 3GZ5A 1ON1A 4GYIA 1SAXA 3KP4A 3F23A 5E1ZB 5HVQC 1S6LA 4OOIA 4P9UA 2E1CA 2NS0A 3FX3A 3KP5A 4RAYA 5CVRA 1L3LA 1YTYA 1Z91A 2Q8KA 2P5LC 2P4WA 1HBXG 3ZP5A 5ILVA 1CF7B 3AAFA 2BYVE 2HS5A 3RJPA 3TQNA 3T1BA 4UVAA 2F5DA 2KKOA 1H0MA 4QWQA 2RN7A 4IXAA 2J5PA 2QYOA 2XGXA 4I09A 3E5UA 4Q47A 3RKXA 1XCBA 2QQAA 4KMUX 4XLPF 2Q2EA 3ROUA 4G6QA 1HW5A 2CG4A 1LVAA 3S2WA 2FA5A 4WXCA 1E2XA 3LA7A 1BI0A 2E1NA 1ZGJA 2HDCA 5DCMB 3ZPLA 1R1TA 3IKVA 4H0EA 1KU9A 2EV6A 1R5GA 4HLXA 4ESJA 1J7KA 2L4MA 1NHAA 3KLOA 1B4AA 2IJLA 2X4HA 2H09A 4GYGA 1YS7A 1GXQA 2GZWA 1K6OA 3CUQA 2MBFA 4EGZA 3NQOA 4LG0B 4WXHA 1F9NA 1UHMA 4UXNA 2DAOA 4HX7A 6PAXA 2JRTA 4MNUA 1J5YA 2HKOA 2QVOA 2VODA 4EGYA 3ZN0A 3WTTC 2LKPA 1I6XA 2ACJA 1ZLKA 5L3EA 2K27A 3ZMTA 3RPUA 5L3GA 5J8FA 1ON2A 3R4KA 4A0YA 4OU0A 2FRHA 5H20A 3F21A 2Q0OA 3IC7A 1LDJA 4BH9A 2XUBA 2JT1A 1KQ0A 3HUGA 2MH9A 3SFZA 1WKMA 1MGTA 4I98B 2YR2A 3IHUA 2A61A 3C18A 5EEGA 1G3TA 2D45A 4PGHA 3LA2A 1K78B 1I1SA 1T0FA 1FLIA 3L2CA 3E5XA 4S04A 2EFPA 1ZRCA 3KP3A 3OOPA 4EJUA 5FO5A 2STWA 1J2XA 3VEPA 4IRIA 3IWFA 3RYPA 4KNYA 1KU2A 3SZTA 1HQCA 3QU6A 4BNCA 2OQGA 2WWYA 4OMYA 1P92A 2EK5A 5L3FA 1ZLJA 1FY7A 5LGNA 4UNOA 5ED4A 1KA8A 3MCZA 3L7WA 1HXDA 2V79A 1YYVA 3HTSB 3ELKA 1R58A 2BBYA 2VE8A 3KEOA 3P9KA 2FNAA 5K5QA 1QNTA 3QOPA 4LLLA 4CZZA 2QBYB 3PFIA 1KYWA 3BWGA 2R7FA 5HDNA 1QZZA 1C0WA 2YPRA 2LF8A 1Z6RA 2COMA 3LFKA 4A6EA 3CTAA 5DUIA 1BIAA 2V1DA 5BS6A 2FNPA 4ZYHA 3I4PA 1RNLA 1P4XA 2VC1A 3WG9A 1S8NA 3GUDA 4E70A 3MZYA 4L0ZB 1HKSA 2OU2A 1REPC 2VBYA 2MC3A 3GWZA 1G6NA 3REOA 3V7RA 3MFKA 3BY6A 3KP6A 3EDPA 4XBFA 2A6EF 4I7HA 4AD9A 1O57A 2OQRA 3DFGA 4RB2C 2F5FA 1YO5C 3I59B 2HEOA 1IN7A 3T0YA 1KQ9A 1FYLA 4MTDA 1MDMA 2XRNA 1V3FA 2EJRA 1XGNA 1XSXA 4WX9A 3LQRA 2HZTA 1MKMA 1FT9A 2UXNA 4XLNF 1I1GA 1WRJA 3HIFA 3K1NA 4LK1F 1AOYA 4RGSA 1K79A 1YW9A 3F6OA 4HQEA 5H6QA 2XAHA 1U2WA 1YW8A 2VN2A 1TLHB 5KK1A 3E6CC 3M7GA 4FHTA 1BI1A 2EFNA 2O61A 4U88A 2XVCA 3ULQB 1XGOA 1IW7F 4RGRA 1QGPA 4M72A 3B73A 4RB1A 5D5UB 2E7XA 4LFUA 1A04A 4YIFA 4M9SA 2A3SA 1KYZA 3TKYA 1O3SA 5E18F 3DV8A 2BEOA 4I0AA 2EFOA 3ZN1A 1R5HA 2IA2A 3RDIA 1U3EM 1O3TA 1XB4A 4UV8A 2D1VA 1BN5A 4O5VA 5FFXA 1KGSA 3V7CA 4U7BA 5IT3A 5CVVA 3JAMK 3GO5A 1BBYA 4HX8A 2PMHA 4LK0F 1D5VA 2K7LA 4ENNA 5A2QK 2K4JA 1PP8F 2IA0A 3HOSA 3U2RA 4ETSA 2HR3A 4L9VA 2UZKA 1ONVA 2K02A 3GZ6A 2MH2A 2MA3A 4FX4A 3D0SA 4KIFA 5HOOA 2STTA 3EQLF 3EYIA 4M73A 3MEXA 1XGSA 3HHGA 5L3DA 4KMFA 4UHTA 2ISYA 4AIHA 1B59A 4KN7X 1BC7C 5AIPA 3IWZA 1TQMA 2M30A 4OMZA 2XAQA 1W4MA 5CLSA 3BROA 3O3KA 1FOKA 4U0VA 4HF0A 4HOBA 3WTWC 3JTHA 3I53A 1OKRA 2D2WA 1OMIA 3HSRA 3KE2A 1IXSB 3FM3A 4U0WA 2JTVA 4L0YB 1XSDA 1U5TB 3EYYA 3F8MA 2DU9A 3G3ZA 2JSCA 2UXXA 3KFWX 1ODDA 2W57A 1J75A 2HYFA 3BPXA 5K5RA 4G8XA 1TQPA 1B9NA 3TOAA 4G7OF 1GVJA 4K2EA 3TGNA 2KJCA 4RGXA 3L09A 1HW1A 2WC2A 2RKHA 3DEUA 2VONA 1IRFA 2GIVA 3TOBA 3BJ6A 5FLXZ 1KU7A 3LSTA 3V4GA 2PQ8A 3SHFA 4IF4A 4O3MA 1YG2A 4EJOA 1F1ZA 2ZNZA 5EEHA 1FSEA 2PMUA 3EETA 2XHKA 4EQQA 5FGMA 3L00A 3GF2A 4WF2A 3ZMUA 1UHWA 1LDKB 2BE5F 4IVNA 3ECHA 4MHGA 1YFHA 3GXOA 1ZHFA 1GHCA 3VODA 1D3YA 4HDUA 2EA2A 3VOEA 1DPRA 5LRRA 4HZFA 4EVIA 2P5KA 5HS7A 1IXCA 2FEZA 1Z7UA 1WSUA 4LD5A 1IN8A 3T8TA 5E17F 2YX4A 4MTEA 1K7AA 3WTUC 4RAZA 2XKOA 1S7AA 4IHSA 4YFNF 2P7VB 5D8KB 3ZMZA 5AONA 3KZZA 4Q4ZF 5D6FA 3KP2A 1RZ4A 5IT9K 1EH7A 3WGGA 3FXUA 4WCGA 1LB2A 1JXSA 5D5WB 4RS8A 4YIIA 2L54A 2L01A 3ZMVA 2CGPA 2MLKA 2G9WA 1GXPA 5D8LB 2MD5A 1KU3A 1QBJA 5LEJA 1Z9CA 2QQ9A 4BHCA 2A68F 4GXOA 1STZA 1RI7A 2UWMA 1D8JA 1QZYA 4I2OA 1YW7A 1OPCA 1OYIA 2FXAA 4IPAA 4OIPF 2DQRA 3Q9SA 1ZYRF 5JR3A 4OINF 1U5TC 2VOPA 1LDDA 3RPQA 4MEYF 2ETHA 4G7ZF 3M8EA 3RKYA 4YFKF 1Z1DA 2ADUA 2FMLA 4FT8A 1T38A 3C7JA 1T6SA 4KICA 1IF1A 1TW3A 1QQIA 3I0TA 1B6AA 5LHIA 2GQQA 4AIKA 1T39A 4L9TA 4A2UA 4M71A 2V9VA 5HDKA 2PBIA 4MQVA 2FBKA 3FWEA 4LMYA 3FHZA 4Y13A 3ZMDA 1ZG1A 3HRSA 1ZRFA 3R61A 3TO9A 4MGRA 1XGMA 3J7AO 1L0OC 2W25A 3GVAA 1HSTA 4G6DA 3CO6C 3PQKA 1FBQA 3KCCA 5CVIA 4L18B 5F64A 2W85A 1PUEE 3K0LA 5HLHA 2DK5A 2ZFWA 1Z05A 1FYKA 1XSVA 3T5XA 4P96A 2HOEA 5E20A 2F5CA 3CJNA 3FMQA 3Q5FA 4U0YA 3Q9VA 4ZZDA 2XAGA 3K9TA 1SD6A 3ISPA 2R7DA 1BIBA 5ICEA 3BOQA 1P4AA 1U5TA 4UUVA 3E6DA 3F3XA 3JAMZ 3OV8A 2EWNA 1PDNC 1USSA 4WWCA 4ENMA 4PDKA 1EV7A 4EM2A 1WWXA 2XASA 4EV0A 1MZBA 1SD4A 2QM3A 1ZARA 2YX7A 1MDMB 1P4WA 5DD8A 5DCMA 3LA3A 2NRAC 4S05A 2FMYA 2GA1A 5LEKA 1F4KA 2PG4A 3R6SA 2FQ3A 3U1DA 2LF7A 3ERED 1ZH5A 1V4RA 4EM0B 1FNNA 3O6BB 3BJAA 1S7OA 1TW2A 3R0JA 5IT9Z 2F2EA 3I58A 2BGCA 3DP7A 2FF4A 3BDDA 4OIRF 3WGIA 1Q1HA 3RTRA 1R7JA 1Z6TA 1EH6A 1FBUA 3J80Z 2MLGA 4BQAA 2IA1A 4I0BA 3HHHA 3NRVA 5JFRA 2RQPA 4JBAA 1H9GA 2DI3A 5HLIA 3QP5A 1I27A 1LEBA 1KQ8A 1ZAOA 5ICGA 3J81K 1O7LA 4U7DA 4BYYA 2RNJA 4F7ZA 2CWEA 1G3WA 4G94A 4Q5SF 2DK8A 2VXZA 4A12A 1HKTA 3V8LA 2KIFA 2WTEA 3IKTA 2QQBA 3WGHA 1UFMA 2FU4A 4LJZF 3V8KA 1R22A 3R60A 2DTRA 2KRFA 2RDPA 2DPUA 1F5TA 3SXYA 3KLNA 2P6SA 5L3CA 2OA4A 4HF1A 5JI6A 2GA2A 2RV8A 1QPMA 2B0LA 2XAJA 2DQLA 4LG0A 1O7FA 1JHHA 4DQ2A 1E17A 2LDUA 3CUQB 4OIOF 4WK8F 3O2PE 1UB9A 1X3UA 5DEQA 3RYRA 3LAJA 4O6JA 2RC4A 4LGWA 5CVUA 2DLLA 4AWXB 5DDGA 3LQQA
chains in the Genus database with same CATH superfamily
4ENKA 2E35A 1O3QA 3F72A 3GBGA 3SZPA 3FXJA 2DT5A 5HNFA 4DYCA 3FMRA 3CQZJ 3JR9A 4MQ9F 4UVCA 2R7OA 5DV5A 5ILUA 1FSHA 4CHUA 1MMAA 2XGEA 2L9SA 1LPQA 3DCFA 3GFJA 4XL9A 4R8HA 1B72B 3MWMA 4ON0A 2V1XA 2EV0A 4PSWA 4ZC3A 1TC3C 5B1BH 4QPOA 1BJZA 2RVCA 4LLGF 3DKYA 2L2OA 1RIOH 5FD6A 4HSTA 2LY2A 2Z3YA 5FKNA 1EH8A 2VC0A 2EFWA 1FYMA 5K1YA 3CLQA 4Q48A 3QYBA 2K4BA 4P5OA 4C30A 2EB7A 2YSRA 3TW7A 3QU3A 4CCJA 1ULYA 4M6XA 4P9FA 2D1HA 2VUMJ 2L4AA 4L5JA 1ETKA 5IP9J 2NVXJ 1M1EB 3CCQI 4MEXF 3FXOA 5F6FA 1AKHA 3GLXA 3WU1B 2BW3A 5GAEJ 3GTKJ 2LSOA 4CICA 3M3YJ 2OBPA 4Y52J 1BM9A 2L3DA 2M0CA 1D8KA 2OPTA 2VT3A 3MAJA 3BZ6A 2KRHA 2TDXA 5D4SA 2HQRA 1TWHJ 1LKXA 2O8KA 2EV5A 2QLZA 3OIOA 2KRCA 1G4DA 4BKXA 2H6CA 2HFHA 2M1BA 4E7IA 2IVMA 1VZ0A 4XSXF 2BY1A 2UV1A 1J9IA 3JW4A 2O7OA 5D6EA 2HXIA 2EA4A 2DT7B 5DYMA 2M87A 3BP8A 2XSJC 3IL2A 1HKQA 5TRDA 2I10A 4FE4A 2E36A 2VE9A 1MJAA 2EQRA 2IRFG 1NH3A 2P6TA 2QBYA 2ELHA 3TP3A 5DD4A 2HDWA 1X58A 3GYHX 1AU7A 1SD5A 3VYTB 3RI4A 3HBLA 1YE9A 4HX4A 4ESFA 1MSEC 1BI2A 1LFPA 2QA4I 2X6XA 4PCQA 4C9YA 4Z2YA 1B8IA 3HRTA 4ZH4F 1MJ9A 3DKWA 5CJ9A 2H94A 1W5TA 1ZRDA 4ANJA 2KQRA 4Y33A 2RGVA 1YIJI 2K9SA 3FM5A 3HJEA 4HAMA 1XMAA 3FDYA 4C3JJ 2JA2A 2Y31A 1VTNC 3HGYA 1IRGA 4CYDA 4KT5C 3WODF 1R00A 3E5QA 3OS1A 3P9CA 2FE3A 1JHFA 4ZYEA 3S15J 2A6HF 4LLNA 1X4OA 3G4SI 3R0AA 4DNCA 3CO7C 3QPSA 4D0PA 4IQ4A 1WGXA 3DPLC 2CV2A 1JGSA 2MD0A 3CMAI 4G9YA 2NXNB 3IAS2 3BR0A 1SFXA 3OL4A 4CCOA 5JHUA 4DYRA 4ZYDA 4IHTA 1OCOH 3HOTA 2VOOA 1Z3XA 1IN4A 4HV6A 2A07F 3HYIA 5LFAA 4EJWA 5HLGA 2DJNA 1R23A 2XROA 3FKJA 2Z99A 2OC6A 4AYBA 5D4RA 4E7SA 3IRRA 1IV6A 3EUAA 1T98A 2ZCWA 3QPHA 1TWFJ 5FLXK 4J19A 1DP3A 1TNSA 4BEHA 4BXXJ 3RSNA 2ELJA 2KJBA 3VWBA 4KFCA 1RKTA 4NBQA 1CGPA 4I01A 3BZCA 5LHHA 4ENJA 3H3ZA 3CF5F 2LK2A 3GW2A 1QO0D 5M3MJ 4A0ZA 4GCVA 1S29A 2GWRA 2X85A 1WI9A 4HYEA 2M45A 2WBMA 2GXBA 2EZKA 1D1AA 2CFXA 3TO6A 2QCOA 4YFXF 3CJQB 3NEUA 1OYWA 2Z9OA 3GTLJ 4S0HB 3F22A 4B8XA 5KVRA 4XKWA 3I9V2 2FX0A 3M1CA 3H3UA 3OR2C 3DQVC 3DF8A 2XC7A 3WE2A 4FE7A 1I3AA 2R5ZB 1VF9A 4XONA 3H5RA 4I99C 1YQAA 2CMPA 3HUGB 1IAWA 2DO7A 5J1YA 1Y39A 1BA5A 3F8NA 5E1WA 4RAGA 1WVRA 2PN6A 5J4YA 3W6JB 4A5MA 1FWZA 1I39A 4KYWA 4A3IJ 4N0BA 2GOMA 3EUHA 3ONQA 4UV9A 3QPTA 1X3ZB 4AWXB 3WTVC 1JKPC 1U0JA 1MMDA 2JUCA 4Y17A 3HB9A 2AS5F 4NC8A 4PFOA 2XB5A 1VQMI 2MW8A 2KLOA 3OL3A 3ZOBA 4LB5A 3FBIB 4EJTA 4A0XA 3SQNA 1IN6A 3P7NA 5FD5A 3HPHA 2M7BA 4FISA 1IN5A 4EMSA 3MQ0A 3KETA 2JA8J 2A5YB 2ESNA 1DP7P 4XSZF 4RMNA 3B6AA 3S3NA 4M74A 3ECOA 4L9NA 2COBA 4KUMA 4HQMA 1P9QC 2L02A 1W7PA 1SMTA 4KIBA 1J0RA 4QLCU 2QENA 1A6IA 4LG3A 4XLEA 1XDSA 2E7WA 4NQWA 4I02A 2OAZA 4M6VA 5F08A 4RM2A 3FMSA 2LD5A 1Z7LA 2IPQX 2ZJRF 4L5IA 4UVBA 5LLQA 1OCTC 1BI3A 3BTIA 3N05A 2X9DA 1U6GA 2DA7A 2RAEA 3CUQC 3FF5A 1VQ9I 3A1YA 2JPCA 4OAYA 2OJED 2QZ8A 1FP2A 1FZPB 2X0LA 1MNEA 2J5OA 4XRFA 1S3JA 4BJTA 4D5FA 2W24A 3OYFA 4YEJA 3QPLA 2HTSA 2F5EA 3OSFA 2IW5A 2PMZN 1BJAA 1T2KA 2DA3A 3M1EA 3QAHA 4D5CA 5BQTA 1Y8RB 4NC7A 1GUUA 3ZQHA 4IRGA 5ICFA 4BAYA 3ABUA 2JA7J 1MMSA 5J47A 4EEFG 2V6CA 3H1CA 1BW6A 3IH4A 3KYDB 3L1PA 1TQIA 3EUKL 2HDDA 2GAUA 3LSHA 1JE8A 2NYXA 1RUNA 3F8BA 2G7UA 3LOCA 1BOAA 2BY3A 3L2QA 4X1EA 2BY2A 2M2EA 2Z16A 2E60A 1T8IA 4BXUA 1IGNA 2CO5A 2FSWA 4XIDA 2L9RA 4N9IA 3ZMSA 1Y0NA 5FFZA 4UY8I 2OZUA 2QUFA 3H0DA 1HW2A 4F92B 2P7CB 2GXGA 2VT2A 3F8FA 3M8JA 2JSPA 1XDUA 4CO8A 3ASOH 3K1MA 4RB0A 1Y1VJ 1DDNA 2R7SA 2M5WA 2XIGA 4A3FJ 4F55A 4RB3C 5JLXA 5LBQA 3LSMA 2PEXA 5FB2A 4G7HF 5DUKA 4BACA 1XG1A 2DPDA 3OIPA 2ISZA 1FC3A 2DFIA 3PUFA 2LKSA 3K4MA 2ESHA 2WADA 3HSFA 1CF7A 2R3SA 4IKFA 2LOOA 1ZN2A 2P5VA 5B1AH 2HGCA 2ZXJA 4EJVA 1YIOA 2R4GA 1MH3A 3JSPA 3VDXA 1SEUA 1B9MA 2LC2A 3WTXC 3J80K 2PLYA 4AIJA 3D5LA 4N9HA 1GLNA 1ZREA 3J7ZI 3W6KB 2LRDA 3K4NA 2C6YA 2ZFUA 2Y48A 4DBQA 4W97A 3LSKA 3OOUA 4KN4X 1FBSA 5CQEA 3WTZA 3HRMA 4FTHA 2R92J 1HSJA 4AVZA 3LAPA 1MNMC 2OD5A 3SDBA 3GCMA 4CDGA 1YX5A 3TL4X 4BL0B 1MJBA 3DPTA 2CSOA 3MVPA 5IYBJ 2M8EA 1NG6A 4QSHA 2HVQA 4HLYA 3CD6I 3IRQA 3GFLA 3KP7A 5J3LA 3K2AA 3J81Z 4KA4A 3PNVA 1A35A 2O0YA 5E8GA 5IP6A 3JRAA 1P2FA 4BGDA 2E2JJ 5HS8A 5DM7F 4KDPA 4CXFA 1YX3A 3VFZA 3CJRB 3PNTA 1R1VA 1OCPA 1XN7A 5FKKA 3SFIA 2ZNYA 2CUZA 4A3EJ 1K6YA 2EIMH 3K70C 3U9GA 3M9AA 1APLC 3LSRA 1KZHA 3GFIA 2JK3A 2FJ1A 2LNBA 1W7PB 2NS7A 2XAFA 1LE8A 1RUOA 2LR8A 3BJOA 4NHJA 1R5ID 4HW0A 5D5XB 2VKVA 3ABTA 1WPKA 5JVTA 2R7VA 1A5JA 2QGUA 3KZYA 4IHXA 3B02A 1V55H 2OTJI 3H36A 2ZC2A 1QPIA 4NB5A 1SFUA 3I59A 1YLFA 1DU0A 2CJJA 3RPUD 3CCLI 2OCEA 3I5UA 1W36C 4A6DA 4Z6YA 1IV8A 2DODA 3M8FA 1W7PD 3WTSC 3TO7A 3FXKA 5FLMJ 1MD0A 2KFDA 4EM1A 2Z33A 2HQNA 3HTUA 3HRUA 4GO1A 4JK1X 5L3BA 1ZGAA 5FKMA 1DUXC 2DMTA 2ME6A 4R1HA 2BV6A 2CYYA 3ZQQA 4XM3A 1UAAA 3CMYA 1MIJA 3K69A 5F04A 4A5NA 4C2UA 1WJAA 1MBHA 1F43A 2LY9A 2DBBA 1ZQ3P 3NAUA 3N97A 3JRCA 2PMZA 2YU9J 1ETXA 4KIGA 1WFXA 2K86A 4L9JA 4BHBA 3JREA 4M6YA 3SYTA 1LQ1A 2A6TA 4A3CJ 3CLOA 1TWCJ 2A5WA 2IP2A 2EFQA 2ZJPF 2VBXA 2BXYA 1TNTA 2IS2A 1YJ9I 4Y3OA 3M4OJ 1FP1D 1EJ9A 1SMYF 4IRHA 4BY7J 3J7YJ 4HBLA 2RQQA 5J40A 2VBZA 3FXQA 3RKWA 4LB6B 4II3A 1XCVA 4DZJA 4ZYGA 3WTYC 1OCRH 4PJMA 3BT9A 2JWTA 4YG2F 4AVPA 1J09A 5DM6F 1TBXA 3ERMA 5KHDA 2AQEA 3MZHA 1SVOA 4GGGA 2LFBA 4II2A 1R9TJ 3DWLE 1TTYA 2V1UA 1USTA 5GADJ 2IT0A 1FPQA 2WA0A 3H0GJ 1V5EA 1AHDP 3TDUC 1MW7A 2DW4A 1ZR4A 2Y75A 3DPUA 2CQKA 2VBWA 2CFOA 4BHPA 3U21A 2HWVA 3HEFA 2NVQJ 3BLYA 2Y9ZA 1LEAA 1IUYA 2OZ6A 2AXLA 3C2HA 4ZZLA 5AIQA 3V7SA 2D5VA 2M8GX 2VKHA 3A01A 1WJCA 3ML6A 1R1UA 2W4SA 5F0CA 4CZCA 3K1PA 3WU0A 2PJPA 5K5OA 2R5YA 5FRMA 3G73A 2ZO4A 1E3PA 4PGGA 4XLFA 4CA0A 1UHSA 5A2QZ 2LTPA 3TW6A 3ZQ7A 3JSOA 4BDZA 4OIQF 1ORKA 2XV4S 2WY8Q 3HG9A 2NVUB 5D5VB 5BPIA 1VQ7I 3HSEA 2K9NA 2O6GE 3E6MA 1RC9A 3KX2A 3AG3H 3PQJA 1POGA 2KIMA 3QP6A 5HDGA 2FOKA 2ZBKA 4JQFA 1BC8C 4FX0A 3GFMA 2FOWA 2A69F 3E3VA 3JTGA 1LJ9A 2BHYA 2YU3A 1W1WE 2Y0MA 2KIUA 2NAZA 1PVEA 2DFHA 2JZYA 3PO2J 5C4JJ 1E3HA 4R79A 4XKBA 1QRYA 3E6BA 4I76A 2PJRB 5TJJA 1UCRA 2IAIA 2P8TA 2XB0X 1SD7A 4RLQA 4ESBA 4DYQA 1ZG5A 5ICCA 2XKPA 5CVJA 2VL8A 5CYVA 4RBOA 2CU7A 2VASA 3CCVI 1K61A 3N4MA 3QRFF 2DCEA 1ETVA 3CJTB 3BG9A 2NNNA 5BPDA 3GTMJ 3C1DA 1FX7A 4CH7A 3TDZC 4M3GA 1XC5A 2ZJQF 5IOYA 1B1BA 1G3YA 1K78A 1IXRC 2O3FA 4PJ0C 4IJAA 1O3RA 5F1RA 3MKZA 3BPVA 3VYUB 3KZIC 4HDVA 2NNYA 1OQYA 4I6ZA 1H9TA 2FBHA 2ELKA 3O8GA 3PUBA 5LGTA 5E1XA 4HA8A 3V8JA 3S2HJ 4XMYA 2W48A 5J6XA 1LNWA 1G3SA 4TV7A 1A6QA 4FASD 4UB6C 1NTCA 3PO3J 4RGUA 5B66C 3GX4X 1H8AC 4HV5A 3E97A 3A2KA 4B44A 1TT0A 2DOFA 1WJ5A 2ZMEB 4Y15A 1T33A 2H1KA 2OV7A 4CCKA 2W1OA 2LG4A 3I71A 2R7QA 3VB2A 3TMOA 2WAQA 2R5ZA 1WCMJ 2LP0A 1PP7U 3NWSA 4HF2A 1VQ5I 2DMPA 2HTJA 4E4HA 1H88C 2V7FA 3HZJA 5C4XJ 2KDOA 3GEZA 1K83J 3FZVA 2JVHA 4PZJA 5LHGA 3JRHA 2VQCA 5H6RA 5BMZA 2UUZA 4LIVA 1P6RA 1UG0A 3L9FA 3S1MJ 4FETA 3WU2C 1VQ8I 2PFBA 4CGZA 2EINH 5DCFA 2CQXA 2Z2SB 1YOVB 2XSDC 3H3VK 4HNUA 3KEYA 5ILSA 1AWCA 5JVGF 1IG7A 2WV1A 3WE3A 3OYNA 3EPZA 3FXRA 5HS9A 2ZJ2A 3CC7I 2KDZA 4NC6A 3RIRA 2VJ4A 1U78A 3GTQJ 2V9KA 5E8IA 4B3XA 3OYIA 3P9IA 4HNVA 3CDLA 1IZ1A 3COAC 2O8XA 5E3NA 1OYYA 4P55A 1R4NB 5IP7J 1XMKA 3K2ZA 2CV1A 1VFCA 1PUFB 3S1RJ 3QYFA 4M9XA 1GV5A 1SFEA 1I5ZA 2JPBA 2KP6A 5ERIA 3JRDA 1DU6A 2W84A 1HCRA 1TL8A 2Z5UA 2CH0A 2EIJH 3LWFA 5K7FA 2DTZA 3FK7A 1WH7A 2Q1ZB 2NVYJ 2CW8A 1JKOC 2L7ZA 5LGUA 4ASNA 1YS6A 3T8RA 4U87A 3F8CA 3MKYB 4FCYA 2HKXA 5EZGA 2PI0A 1VQPI 4CYCB 2H27A 1R36A 1JTXA 1WQ2A 5CPRB 2ZKZA 3DXJF 3DTIA 2X51A 4M9ZA 3CDHA 3C3WA 1OR7A 1XD7A 1S5LC 4XLCA 5J8CA 2WV0A 1Y0UA 3A02A 3CUOA 1R4MB 3KEQA 1U8RA 5FKLA 3WG7H 1ZG3A 3H92A 2G7HA 2H6BA 1W5SA 2GLOA 2LMDA 1UZCA 2O03A 4JP0A 5BOXA 3UR3C 3S93A 1B8IB 5LRSA 2HPMA 3ABKH 1WI3A 4UUSA 4QPQA 3F6VA 2FBIA 2ZMEA 3I54A 4WXDA 2CW0F 3W2AA 2QWWA 2HYGD 5GPCA 3I64A 2MABA 3K70D 1DPUA 4B09A 3GZ5A 3MN2A 4AM3A 1ON1A 1WHUA 4GYIA 4XRSA 2DA6A 1SAXA 1VQ6I 1X1AA 3KP4A 3F23A 2K5CA 1A36A 1WJEA 3TEDA 5E1ZB 2BXZA 5HVQC 1S6LA 3PNYA 4OOIA 3IV5A 4P9UA 4X0GA 3ZQIA 2R7WA 2NS0A 2E1CA 3FX3A 3KP5A 3CCEI 4EATA 3OR1C 4RAYA 5CVRA 4D9JA 2VPLA 3ASNH 2QQ8A 1L3LA 1YTYA 1Z91A 3GTGJ 3CP8A 2A05A 2Q8KA 2P5LC 3S8PA 2BVLA 2P4WA 3CC4I 2WY7Q 1WH5A 2JA5J 3L2WA 2LBFB 3DBHB 1FTTA 2DT6A 3A0HC 2AO9A 1HBXG 3ZP5A 2W00A 1ETOA 5ILVA 1CF7B 3AAFA 2L7FP 2BYVE 2HS5A 4GFBA 3RJPA 3Q3SA 3H5NA 3TQNA 3T1BA 4UVAA 2DOEA 2F5DA 2IBDA 2KHMA 4A3KJ 1DGWY 2PJRA 1MH4A 2KKOA 2NOJB 2F6CA 1H0MA 3Q0VA 4QWQA 2RN7A 4IXAA 5HODA 2J5PA 3OYJA 2QYOA 2JQ7A 2XGXA 4I09A 3E5UA 3VPRA 4Q47A 3RKXA 1QZEA 1XCBA 1KONA 2QQAA 4KMUX 1JUPA 4XLPF 2L0KA 4ZDPA 2Q2EA 2JRMA 3C2GA 3CESA 3ROUA 4XN3A 4G6QA 1HW5A 1EA3A 4AC0A 1R71A 4XQFA 2CG4A 3H9QA 1LVAA 3GZNB 2QSHX 4ZDLA 2GOXB 2F4MB 3Q0WA 3S2WA 2FA5A 2E19A 1E2XA 3LA7A 3P5JA 4WXCA 1BI0A 5BNGA 2ME0A 1ZELA 2E1NA 1ZGJA 2M34A 1ENHA 3PL8A 3AG4H 3CCRI 2HDCA 3FHNA 1UELB 4JYKA 2AXTC 1V54H 5DCMB 1Q1VA 3ZPLA 1R1TA 3IKVA 4F91B 2H1LA 4H0EA 1KU9A 2EV6A 1R5GA 3QQAA 1VI0A 4HLXA 4ESJA 1J7KA 1W0TA 2L4MA 2XDVA 3JRBA 4LOCA 1NHAA 3KLOA 1B4AA 3RKQA 1MSFC 2IJLA 2VKEA 2X4HA 3HL2A 2H09A 3FISA 2XGDA 4GYGA 2Y0SN 1MBGA 4IHYA 3PSIA 1YS7A 3CZ6A 1GXQA 2KISA 3BG5A 2HYJA 2GZWA 2WAEA 3OYGA 1K6OA 3CUQA 2MBFA 2ZXHA 3D1NI 4IO9F 4EGZA 3NQOA 4LG0B 4WXHA 1BR1A 4BBRJ 1SC7A 1F9NA 1UHMA 2K9LA 2WAFA 4UUTA 4UXNA 4QIWN 2DAOA 4HX7A 6PAXA 3ESWB 1E0EA 2JRTA 4MNUA 4AIDA 1FJLA 1J5YA 2IEKA 4BDYA 4A3LJ 2HKOA 2QVOA 4DOZA 2VODA 2LBFA 4EGYA 3DEWA 3ZN0A 3WTTC 3I3LA 4JX6A 2E2IJ 4PJLA 2FD5A 3ABMH 2LKPA 1JJ6C 1I6XA 3IP4B 2ACJA 2M3AA 1ZLKA 3LFUA 4F3QA 5L3EA 3K6GA 2Z1DA 3BQZA 2K27A 2BW3B 3ZMTA 4HEA2 2LH9A 3RPUA 4X6AJ 5L3GA 5J8FA 2JA6J 1ON2A 3R4KA 4A0YA 3GLLA 4OU0A 1QA6A 2FRHA 2GM4A 2OUMA 2DN0A 5H20A 3F21A 1FMWA 2Q0OA 1LDJA 2JJ7A 2XPVA 3BR6A 3IC7A 4BH9A 2WAQN 5M5WJ 2EZLA 4BBSJ 2XUBA 2JT1A 1KQ0A 3HUGA 2KZGA 2MH9A 4BE1A 4PUSA 3SFZA 4YIRX 4IHWA 1WKMA 1SVLA 1X1CA 2ZXIA 5GAGJ 4UUSB 2IGMA 1BR2A 2HPIA 1QU3A 2V6EA 2DYRH 1MGTA 4I98B 3C2BA 2YR2A 2L9VA 5EF6A 3QODA 1JJ8C 3IHUA 1AA7A 2A61A 4A3MJ 2XF5A 3C18A 5EEGA 3DBLB 1G3TA 4XOTA 2ECCA 2D45A 4PGHA 3LA2A 2E34A 3A0BC 1K78B 1I1SA 1T0FA 1FLIA 3L2CA 3ZXSA 1GDTA 3E5XA 2KL4A 1SAUA 3H35A 1MNDA 4S04A 2EFPA 1ZRCA 3MKLA 3KP3A 3OOPA 4CYCA 4EJUA 5J4VA 1XPXA 5FO5A 1TZLA 3HC7A 3ZRGA 1JUMA 2STWA 3HOZJ 4PFPA 4P1WA 4AU7A 1J2XA 3VEPA 3D5SC 4IRIA 4D7MA 3IWFA 4CCNA 3RYPA 2LKXA 4KNYA 4V19K 1KU2A 3SZTA 1HQCA 4FQGA 4QTRA 3IH3A 3O8HA 3QU6A 4Y7NJ 4BNCA 2OQGA 2WWYA 4PJJA 2DYSH 4OMYA 4MO7A 1P92A 2EK5A 4DGWB 4N4OB 5L3FA 5KNLA 3GTOJ 3OMYA 1RPWA 1ZLJA 1FY7A 2MYSA 5LGNA 4UNOA 2X1CA 2OCCH 1IC8A 5J1UA 5ED4A 3BG6A 1KA8A 2XGCA 3MCZA 3L7WA 1HXDA 2P81A 1Y8QB 4M3BA 3M07A 3LNQA 2V79A 4IL6C 3AG2H 3F9KA 3FIWA 2MSYA 3L2RA 1UMQA 1YYVA 4BY1J 1MBKA 3HTSB 3K10A 4NDLA 3ELKA 1R58A 2BBYA 2VE8A 4E6KG 2HOTA 1V5FA 4BS9A 3OYCA 3KEOA 1JI8A 3OIQA 3P9KA 4ZYAA 2Q2EB 3ZQCA 2FNAA 3CDIA 5K5QA 3G2BA 1QNTA 3QOPA 4LLLA 5IOZA 2AQFA 2X48A 2E5ZA 3AL0C 4BU2A 4CZZA 2QBYB 3FK6A 3LMMA 2HQAA 3PFIA 4C3HJ 1KYWA 1D0ZA 3BWGA 2R7FA 2Y69H 3HGGA 5HDNA 2YUSA 2Y2ZA 1TWGJ 3VYSB 1QZZA 1ZKGA 2ZSHB 3VYRB 1TWAJ 1C0WA 2DJIA 1FMVA 3LSGA 3K4KA 2YPRA 5EG0A 2LF8A 2HNHA 1XX5A 1IRZA 1Z6RA 2COMA 3LFKA 4ZTFA 1VQ4I 4A6EA 3CTAA 5DUIA 4A3DJ 4NNJA 4G6TB 3RZDJ 1Y1WJ 1BIAA 2V1DA 5BS6A 2B7EA 2FNPA 4ZYHA 3I4PA 1RNLA 2E71A 2F5VA 2VPRA 1P4XA 2VC1A 3WG9A 1S8NA 1YI2I 2VJIA 3HM5A 3GUDA 4E70A 3MZYA 3HOYJ 2X6OA 4L0ZB 3F0CA 1JT0A 3H5AA 3OYEA 3QOEA 1T0FC 1FIAA 1HKSA 2OU2A 1N75A 1REPC 2DMUA 2VBYA 2MC3A 3GWZA 3L2UA 1G6NA 3REOA 3V7RA 1H89C 1RR7A 1W36D 3BR5A 4BQNA 3MFKA 3BY6A 3KP6A 3HXLA 3EDPA 3NARA 1F36A 4XBFA 4KITB 5EGOB 1HA8A 3SZGA 2A6EF 1LFBA 4I7HA 4DW6A 2R93J 4AD9A 2KMUA 1O57A 2OQRA 3DFGA 4RB2C 2F5FA 1YO5C 3I59B 1HDDC 3PIOF 1X4PA 1X1DA 2ZSIB 3ZR8X 1RKWA 3TBIA 1IN7A 3T0YA 2HEOA 1KQ9A 2JMWA 1FYLA 4MTDA 1MDMA 3HKZN 2XRNA 2GXAA 1V3FA 2EJRA 1XGNA 2RREA 1XSXA 4WX9A 3LQRA 1N77A 1R6RA 4A3BJ 3E7LA 1S9HA 2HZTA 4DZPA 1MKMA 1FT9A 2UXNA 4XLNF 1I1GA 1WRJA 4DJAA 3S2DJ 1PUFA 3DKXA 2VQLA 3HIFA 3K1NA 4YRVA 1YITI 4LK1F 1AOYA 4RGSA 4A69C 5LD2C 1K79A 1YW9A 1ERDA 1HDPA 2XF6A 3F6OA 5H6QA 2XAHA 4HQEA 1U2WA 1YW8A 2VN2A 1TLHB 1X2MA 3EUHC 2I8DA 5KK1A 3E6CC 2IGNA 3M7GA 4KJZA 4FHTA 3UKGA 2BHZA 2JUGA 5FRNA 1BI1A 2EFNA 2O61A 4V2GA 4U88A 2XVCA 3MMYB 3G71I 2CUJA 3ULQB 5B5EC 1XGOA 1IW7F 4RGRA 1QGPA 1YRNA 1DQUA 4M72A 1VQLI 1X2NA 3B73A 5M3FJ 4RB1A 3WHCA 1SANA 5D5UB 2E7XA 5M5YJ 4LFUA 2RNGA 5F1JA 1A04A 4YIFA 4M9SA 2O5RA 2A3SA 2MG4A 1KYZA 5DS9A 3S3OA 3TKYA 2KPMA 3HDDA 4A93J 1O3SA 2K3PA 5E18F 3DV8A 2BEOA 2X1EA 2MFZA 4H4KC 2EFOA 4I0AA 3ZN1A 1R5HA 2IA2A 2LREA 3RDIA 4F93B 1U3EM 4A3GJ 1O3TA 1XB4A 3V42A 3I55I 2E1OA 2LLKA 2D1VA 4UV8A 2DMQA 1BN5A 2DXIA 4O5VA 3W6VA 2ID3A 4PK4A 5FFXA 3MD2A 1ZK8A 3OS2A 1KGSA 3V7CA 4U7BA 1YJNI 4M3FA 5KAFC 4B43A 5CVVA 2X6YA 5IT3A 5C44J 2JN6A 3JAMK 3UNGC 2I5UA 3GO5A 3AKZA 3BG7A 1X3WB 3G1MA 3A03A 1BBYA 4HX8A 2PMHA 4LK0F 4XICA 3OYAA 1D5VA 2K7LA 4ENNA 5A2QK 2K4JA 1PP8F 2IA0A 3HOSA 3IAM2 1SVMA 3U2RA 3S16J 4ETSA 2HR3A 1LE8B 4RDUA 4L9VA 2UZKA 2V26A 4XRMA 1E3OC 1ONVA 1XTAA 2K02A 3GZ6A 2MH2A 1MBEA 1IDYA 3W3CA 2QKLB 3ZQFA 2MA3A 3DBRB 3D0SA 4KIFA 4FX4A 2K9MA 1OISA 1W5CC 1P7IA 2ZB9A 5HOOA 2STTA 3DTKA 1U8BA 3EQLF 5EZHA 3S3MA 1OCCH 3EYIA 4M73A 3MEXA 5H2FC 3W2VA 2DDBA 1XGSA 3AG1H 3HHGA 2DOAA 5DTDA 5L3DA 4J00A 4KMFA 4UHTA 2ISYA 1LVKA 2ZXWH 4AIHA 4D1QA 2IS4A 1B59A 4CSWA 4KN7X 1GV2A 3BR3A 2R7UA 1BC7C 5AIPA 3DLAA 3IWZA 1JT6A 1TQMA 2M30A 3OYHA 3SJMA 1NG7A 4MFDA 1VQNI 4OMZA 1HLVA 4MLOA 1FOYA 2XAQA 4NQWB 5EDNA 1W4MA 1MMGA 5CLSA 3BROA 2R5YB 3O3KA 1FOKA 4OAZA 4U0VA 4HRIA 1FEXA 4HF0A 4HOBA 3WTWC 4IZZA 2XPWA 2NS8A 3JTHA 4UB8C 2ECBA 3HPGA 1BR4A 3I53A 3A01B 2K3FA 4M3DA 1HOMA 1OKRA 1Z3YA 2D2WA 2VQHA 1OMIA 2XRLA 3HSRA 1FOXA 3BTLA 4BQQA 3KE2A 1IXSB 1NK3P 2VXDA 3L2VA 3FM3A 1WJDA 2WB1A 5M5XJ 4U0WA 3Q0UA 2R7ZJ 1OFCX 2JTVA 4XOPA 4L0YB 1XSDA 5IY5H 3AL0B 2ZMEC 1U5TB 2VQGA 3E0JB 5F0HA 1T95A 1ZR2A 3EYYA 3CCYA 1J59A 1QHGA 3F8MA 3WHBA 4B47A 2DU9A 3G3ZA 2JSCA 2DA4A 2UXXA 3KFWX 1ODDA 2W57A 1J75A 4IOAF 3KPHA 3LL7A 2CRGA 2HYFA 1V5GA 2P0WA 2EPFA 1X1PA 2H8WA 3BPXA 3ZQLA 1SFOJ 2CV0A 2HOAA 5K5RA 4G8XA 1TQPA 2F4OB 3H9JA 1B9NA 3BR2A 3TOAA 3JCUC 4G7OF 1GVJA 2AHQA 3GMEA 3OYDA 3KYCB 1P7JA 4XRSG 4K2EA 3TGNA 2K85A 2KJCA 4RGXA 2FUG2 3L09A 1HW1A 2EH3A 2WC2A 2CQQA 2RKHA 3DEUA 4JX4A 2VONA 2R7XA 1IRFA 2W82A 4HG2A 2GIVA 3TOBA 3BJ6A 1IO2A 5FLXZ 2VB6A 1KU7A 3LSTA 3V4GA 2PQ8A 5TISC 1WJBA 1PYVA 4BEHB 1WJFA 3SHFA 2DDAA 2QKMB 4IF4A 2HVSA 2IXSA 4O3MA 1YG2A 2NVTJ 1JUSA 4EJOA 3S1QJ 1F1ZA 2ZNZA 5GP9A 5EEHA 3CCMI 1FSEA 1YHQI 1MBFA 2PMUA 4E7KA 3EETA 3U1KA 5HLTA 2B9SA 2XHKA 4EQQA 5FGMA 4CCLA 3L00A 1I3QJ 2TRTA 3GF2A 3S32A 4BXFA 4WF2A 1A31A 4IQJA 3ZMUA 3KYLA 1UHWA 1D0YA 2XPUA 4W1UA 1LDKB 2BE5F 3QYEA 5C3EJ 2VJJA 5TGTA 5GTHC 3K4JA 4IVNA 3ECHA 1JKRC 2E5NA 3K4CA 4CCMA 4MHGA 5E3LA 1YFHA 3GXOA 1ZHFA 3BTJA 1GHCA 2WB1N 5IPAA 3VODA 3BC8A 1D3YA 4HDUA 3DU6A 3QWLA 1OR7C 5CKTA 2EA2A 1OJLA 3VOEA 1DPRA 5LRRA 4HZFA 4AUXA 3JRIA 1EF4A 4EVIA 2HVRA 2P5KA 5HS7A 1IXCA 2FEZA 1Z7UA 1WSUA 4LD5A 5FROA 3CF2A 1IN8A 1I50J 3T8TA 5E17F 2YX4A 1D0XA 2EIKH 1I6HJ 4MTEA 1K7AA 3BZKA 4RAZA 2L7KA 3WTUC 4ABZA 2IS1A 2M9HA 1IRXA 2XKOA 1ZGWA 1S7AA 4IHSA 5JLWA 4LITA 4CUGA 4YFNF 2MGQA 2P7VB 5D8KB 3VSLA 3ZMZA 5AONA 3KZZA 2QSFX 4Q4ZF 5D6FA 1D1BA 3KP2A 1VQOI 1G59A 3RCOA 1RZ4A 5IT9K 1QHHD 1VNDA 4A3JJ 1EH7A 3WGGA 3JRGA 3FXUA 4WCGA 1PJRA 2VKDA 4G12A 3HOXJ 1LB2A 1ETYA 2O9LA 1JXSA 2V4JC 5D5WB 4RS8A 3BCBA 4YIIA 2EILH 2M4KA 2CQNA 2DA5A 2L54A 3BTCA 2X1DA 3DLLF 2L01A 1RETA 1HF0A 3ZMVA 5E3MA 2CGPA 2MLKA 1RR8C 1MBJA 5IYDJ 4Y4RA 1SFKA 2G9WA 1GXPA 4ZJZA 1WZ2A 2BZTA 1BW5A 5D8LB 1T56A 4ZDOA 2MD5A 3SEZA 1KU3A 2M4GA 1QBJA 1TP4A 5LEJA 1Z9CA 5K7HA 2R0QC 2QQ9A 4BHCA 2FQ4A 4C3IJ 2K40A 2A68F 4GXOA 4V2FA 2DA1A 3G1LA 2IS6A 1STZA 1RI7A 4XK4A 3D5RC 2UWMA 1D8JA 1QZYA 1Z0XA 4BUPA 1XS9A 1B72A 1IDZA 4I2OA 1YW7A 2IGKA 1ETWA 1OPCA 3I56I 1QVTA 4C2MJ 3S17J 1OYIA 2FXAA 1IUFA 4IPAA 4OIPF 2DQRA 3Q9SA 1ZYRF 2M7AA 5JR3A 3ABLH 3HKZA 1O4XA 4OINF 5E79C 1U5TC 2VOPA 4HNTA 1LDDA 3OYLA 3RPQA 1GVDA 4MEYF 1IJWC 2ETHA 1OLTA 3J7AY 4G7ZF 3M8EA 1X1BA 3RKYA 3OSGA 4YFKF 2QEXI 3CC2I 1Z1DA 2ADUA 3B6CA 1VQKI 1BL0A 1D5YA 2FMLA 2LY1A 4FT8A 3BR1A 3C7JA 1T38A 1T6SA 4KICA 1IF1A 3PSFA 2K9QA 1TW3A 4BE0A 1LFUP 1QQIA 5FKOA 3I0TA 1K4TA 1B6AA 2L5QA 3GTJJ 5LHIA 2EZHA 3S1NJ 2GQQA 4AIKA 1T39A 4L9TA 4A2UA 4M71A 2V9VA 5GAHJ 3PIPF 4BQOA 2XF7A 1NK2P 1Z77A 5HDKA 2E1MB 2MC4A 4IOCF 2PBIA 4MQVA 3LSIA 4HPQA 2CW7A 2FBKA 3FWEA 4LMYA 1N78A 3K7AJ 3ZCOA 3ZGKA 3FHZA 1JTYA 4DIQA 2TCTA 4Y13A 3ZMDA 1ZG1A 3HRSA 3GTPJ 1CQTA 3OYBA 1ZRFA 3R61A 3TO9A 3OS0A 2DMNA 3IH2A 3CP2A 1AKHB 3VSKA 1Y56A 2GIZA 4MGRA 2B63J 1XGMA 5KAIC 3J7AO 1L0OC 2W25A 3GVAA 3E1SA 1HSTA 4G6DA 1Z67A 4GRIA 3CO6C 3PQKA 2GBYA 1FBQA 3DU5A 4RA2A 3KCCA 1S72I 1G8XA 4C2TA 5CVIA 4L18B 3ZQGA 2HU9A 5F64A 5J1RA 2W85A 1PUEE 1X19A 2F4IA 3CMEI 5K7ZA 4XKCA 1G2HA 2HZDA 3K0LA 2KZVA 5F27A 3KIOA 5HLHA 3HOUJ 2DK5A 2ZFWA 1Z05A 4MFEA 4XLHA 3FXLA 1FYKA 1XSVA 3T5XA 2DA2A 2HI3A 3MZ8A 4P96A 2KT0A 2IGOA 2HOEA 4KT6A 2NOGA 1DGRM 5E20A 2XAUA 2QSGX 4PJNA 2F5CA 3CJNA 4GDFA 4MIMA 3HOWJ 5EG0B 2V1NA 3FMQA 3SEQA 5FJ8J 1FOWA 3Q5FA 4U0YA 3Q9VA 4AYBN 4ZZDA 2V9PA 2XAGA 3CMMA 3K9TA 1SD6A 2PX9A 4IHVA 3ISPA 3I4NJ 1FIPA 1BIBA 2R7DA 3BOQA 5ICEA 3G6EI 1P4AA 1ACIA 3I4MJ 1U5TA 2BVMA 4UUVA 3E6DA 3F3XA 3JAMZ 3OV8A 2EWNA 1PDNC 3RQ4A 1USSA 2ICWG 4WWCA 3PFYA 3JRFA 2JVGA 4ENMA 4PDKA 1ITYA 3H9GA 2G0EA 1T08B 2M0MA 4RAFA 1EV7A 1GT0C 4EM2A 1WWXA 2XASA 4ZTJA 1UG2A 4EV0A 1MZBA 4B48A 1SD4A 2QM3A 2CS3A 1ZARA 2YX7A 1MDMB 2ID6A 1P4WA 2EBIA 5DD8A 1U9OA 3LA3A 5DCMA 3SDGA 2DFEA 1R49A 3DTEA 4S05A 2NRAC 2FMYA 2GA1A 3HOVJ 5LEKA 1F4KA 3IUOA 4PSXA 2PG4A 3R6SA 2FQ3A 3DEEA 5B3SH 5HNHA 3PM1A 3K4LA 2VIXA 3U1DA 2CUFA 1UJ8A 2LF7A 3ERED 1S7EA 5EGOA 2CUEA 1V4RA 1ZH5A 2VLAA 5E3OA 5FLVA 3OYMA 9ANTA 2LVSA 2Y9YA 4EM0B 4BJ6C 3LSPA 2HOSA 4E7JA 4IX7A 1FNNA 2EZIA 3O6BB 4XN0A 2CQ7A 3BJAA 4IEJA 1S7OA 1TW2A 2Y0SA 4N4NB 1LUJB 5CQGA 1Z21A 3R0JA 5IT9Z 2F2EA 3I58A 2BGCA 2L9NA 3DP7A 2R7RA 1W0UA 4OWRB 4B4CA 2FF4A 4JX5A 3BDDA 4OIRF 4XKVA 2X6WA 3WGIA 1Q1HA 3RTRA 1R7JA 1Z6TA 2YS9A 2BY0A 1EH6A 1FBUA 4XNFA 4E7LA 3J80Z 3RZOJ 2QF7A 2OF7A 2MLGA 4BQAA 4KISA 4HSRA 1TT5B 4M3EA 2IA1A 3TP0A 4I0BA 3RQIA 1OCZH 2DFFA 4DBRA 3HHHA 3NRVA 3OYKA 1ETQA 2RQPA 4JBAA 1H9GA 5JFRA 2DI3A 5KCMA 3K4BA 1Y6IA 5HLIA 3QP5A 1XMXA 4D7NA 3CCJI 4YELA 1I27A 1LEBA 1KQ8A 1ZAOA 4XR6A 1MMNA 1QVUA 3LSJA 5ICGA 5GPAA 3J81K 1O7LA 4U7DA 2N8GA 4BYYA 4BE2A 5IYCJ 2RNJA 2HXOA 3A4CA 3AFHA 4NUBA 4F7ZA 2CWEA 1G3WA 4G94A 4F52A 4Q5SF 2DK8A 2VXZA 2E1MC 2HQ5A 4A12A 1HKTA 4RM3A 3V8LA 2KIFA 4B3AA 2WTEA 3IKTA 3PJRA 2QQBA 3WGHA 1UFMA 2FU4A 4LJZF 3V8KA 3MKWB 1R22A 4RLFA 2E2HJ 3R60A 2DTRA 1JKQC 2KRFA 5JHFA 2RDPA 5F0FA 4ITVA 2DPUA 5EEAA 1RESA 1F5TA 3G1OA 3SXYA 3CCUI 1BOBA 1YRNB 3KLNA 3S14J 2P6SA 3FKIJ 5L3CA 2KIQA 2OA4A 1D1CA 4BJ5C 1RRJA 5EYRA 4JOMA 4HF1A 3BQYA 5JI6A 4E7HA 4B1RA 2VI6A 2GA2A 3OY9A 3NWTA 2RV8A 4L5EA 1QPMA 2B0LA 5EJCA 2XAJA 3OWTA 4LIUA 2DQLA 1JGGA 4LG0A 2F48A 1K4SA 1U9NA 1O7FA 1JHHA 4DQ2A 1E17A 2LDUA 3CUQB 4OIOF 1HC8A 1YJWI 4E7ZA 3BG3A 4J01A 2OTLI 4XORA 4WK8F 3W2WA 2BOLA 3O2PE 1UB9A 3X2QH 1FTZA 1X3UA 2VJ5A 2LYCA 1N25A 2Y30A 3BCAA 2H8RA 2L7MP 5DEQA 3RYRA 2R7TA 4XLAA 3LAJA 4O6JA 2RC4A 1ZTRA 3FXMA 4LGWA 5CVUA 2DLLA 2W7NA 3CCSI 3FBNB 5DDGA 5GTIC 3LQQA 1EKEA
chains in the Genus database with same CATH topology
4ENKA 1O3QA 3F72A 3SZPA 2DT5A 3FMRA 4MQ9F 4UVCA 5DV5A 5ILUA 1FSHA 4CHUA 3GFJA 4R8HA 3MWMA 4ON0A 2V1XA 2EV0A 2RVCA 4LLGF 1RIOH 5FD6A 2Z3YA 1EH8A 2VC0A 2EFWA 1FYMA 5K1YA 4Q48A 2K4BA 4P5OA 2EB7A 2YSRA 3QU3A 1ULYA 4M6XA 4P9FA 2D1HA 2L4AA 4L5JA 4MEXF 5F6FA 3GLXA 3WU1B 2LSOA 4CICA 2OBPA 1BM9A 2L3DA 1D8KA 2VT3A 3MAJA 3BZ6A 2TDXA 5D4SA 2HQRA 2EV5A 2QLZA 1G4DA 2H6CA 2HFHA 2M1BA 2IVMA 4XSXF 1J9IA 3JW4A 5D6EA 2EA4A 5DYMA 2M87A 3BP8A 3IL2A 1HKQA 5TRDA 2VE9A 1MJAA 2IRFG 2P6TA 2QBYA 2ELHA 5DD4A 3GYHX 1SD5A 3RI4A 4HX4A 4ESFA 1BI2A 4PCQA 4Z2YA 3HRTA 4ZH4F 1MJ9A 3DKWA 5CJ9A 2H94A 1W5TA 1ZRDA 2RGVA 3FM5A 4HAMA 1XMAA 1VTNC 1IRGA 4CYDA 4KT5C 3WODF 1R00A 3E5QA 3P9CA 2FE3A 1JHFA 4ZYEA 2A6HF 4LLNA 3R0AA 4DNCA 3CO7C 4D0PA 3DPLC 1JGSA 4G9YA 1SFXA 5JHUA 4ZYDA 4IHTA 3HOTA 2VOOA 1IN4A 4HV6A 2A07F 3HYIA 4EJWA 5HLGA 1R23A 2XROA 2Z99A 3IRRA 5D4RA 1T98A 2ZCWA 3QPHA 5FLXK 1TNSA 2KJBA 4KFCA 1CGPA 4I01A 5LHHA 4ENJA 3H3ZA 3GW2A 1QO0D 4A0ZA 4GCVA 1S29A 2GWRA 1WI9A 4HYEA 2M45A 2GXBA 2CFXA 3TO6A 4YFXF 2Z9OA 3NEUA 1OYWA 3F22A 4B8XA 5KVRA 3H3UA 3DQVC 3DF8A 3WE2A 1YQAA 1IAWA 2DO7A 3F8NA 5E1WA 2PN6A 3W6JB 4A5MA 1FWZA 4KYWA 4N0BA 3EUHA 4UV9A 3QPTA 3WTVC 4Y17A 2AS5F 4LB5A 4EJTA 4A0XA 3SQNA 1IN6A 3P7NA 5FD5A 1IN5A 4EMSA 3MQ0A 3KETA 2A5YB 2ESNA 1DP7P 4XSZF 4M74A 3ECOA 4L9NA 4KUMA 4HQMA 2L02A 1W7PA 4QLCU 1SMTA 1J0RA 4KIBA 2QENA 1XDSA 2E7WA 4NQWA 4I02A 2OAZA 3FMSA 2IPQX 4L5IA 4UVBA 5LLQA 1BI3A 1U6GA 3CUQC 3FF5A 2JPCA 2QZ8A 1FP2A 1FZPB 2X0LA 2J5OA 4XRFA 1S3JA 2W24A 2HTSA 2F5EA 2IW5A 1BJAA 1T2KA 3M1EA 3QAHA 5BQTA 4IRGA 5ICFA 4BAYA 3ABUA 2V6CA 1TQIA 2GAUA 1JE8A 1RUNA 2NYXA 3F8BA 2G7UA 1BOAA 4BXUA 2CO5A 2FSWA 4N9IA 3ZMSA 5FFZA 2OZUA 2QUFA 1HW2A 2P7CB 2GXGA 2VT2A 3F8FA 1XDUA 4CO8A 3K1MA 4RB0A 1DDNA 2M5WA 2XIGA 4RB3C 5LBQA 2PEXA 5FB2A 4G7HF 5DUKA 2DPDA 2ISZA 1FC3A 2DFIA 2ESHA 3HSFA 1CF7A 2R3SA 1ZN2A 2P5VA 2HGCA 2ZXJA 4EJVA 1YIOA 3JSPA 1B9MA 3WTXC 3J80K 2PLYA 4AIJA 3D5LA 4N9HA 1ZREA 3W6KB 2C6YA 2Y48A 4KN4X 1FBSA 3WTZA 3HRMA 1HSJA 3LAPA 2OD5A 4CDGA 1MJBA 3DPTA 2CSOA 2M8EA 4HLYA 3IRQA 3GFLA 3KP7A 3J81Z 4KA4A 2O0YA 5E8GA 1P2FA 5HS8A 4KDPA 4CXFA 3VFZA 1R1VA 1XN7A 2ZNYA 3U9GA 3M9AA 3GFIA 2LNBA 1W7PB 2XAFA 1RUOA 3BJOA 4NHJA 5D5XB 4HW0A 3ABTA 5JVTA 3KZYA 3B02A 4NB5A 1SFUA 3I59A 1YLFA 3I5UA 4A6DA 3M8FA 1W7PD 3WTSC 3TO7A 1MD0A 2Z33A 4EM1A 2HQNA 3HTUA 3HRUA 4GO1A 4JK1X 5L3BA 1ZGAA 1DUXC 4R1HA 2BV6A 2CYYA 3K69A 4A5NA 2DBBA 3N97A 4KIGA 4BHBA 2K86A 4L9JA 4M6YA 1LQ1A 3CLOA 2IP2A 2EFQA 2VBXA 1TNTA 1FP1D 1SMYF 4IRHA 4HBLA 2VBZA 3FXQA 3RKWA 4LB6B 1XCVA 4ZYGA 3WTYC 4YG2F 4AVPA 1TBXA 3MZHA 4GGGA 1TTYA 2V1UA 1USTA 2IT0A 1FPQA 3TDUC 2DW4A 2Y75A 2CQKA 2VBWA 4BHPA 2HWVA 1LEAA 1IUYA 2OZ6A 2AXLA 4ZZLA 5AIQA 3V7SA 3ML6A 1R1UA 3K1PA 3WU0A 2PJPA 5K5OA 3G73A 2ZO4A 4PGGA 1J59A 5A2QZ 3ZQ7A 3JSOA 4OIQF 2XV4S 5BPIA 5D5VB 2O6GE 3HSEA 3E6MA 3PQJA 2KIMA 3QP6A 5HDGA 2FOKA 2ZBKA 4JQFA 1BC8C 4FX0A 3GFMA 3E3VA 2A69F 3JTGA 1LJ9A 2YU3A 2Y0MA 2KIUA 2NAZA 2JZYA 4R79A 3E6BA 5TJJA 1UCRA 2P8TA 1SD7A 4ESBA 1ZG5A 5ICCA 2XKPA 5CVJA 5CYVA 3N4MA 3QRFF 5BPDA 2NNNA 3C1DA 1FX7A 3TDZC 1B1BA 1G3YA 1K78A 1IXRC 2O3FA 4IJAA 1O3RA 5F1RA 3BPVA 4HDVA 2NNYA 1H9TA 2FBHA 5LGTA 5E1XA 4HA8A 3V8JA 5J6XA 1LNWA 1G3SA 4TV7A 4RGUA 3GX4X 4HV5A 3E97A 4Y15A 2ZMEB 3I71A 3VB2A 1PP7U 4HF2A 2HTJA 3GEZA 3FZVA 4PZJA 5LHGA 5H6RA 5BMZA 1P6RA 3L9FA 2PFBA 4CGZA 5DCFA 5ILSA 1AWCA 3WE3A 3FXRA 5HS9A 2ZJ2A 3RIRA 1U78A 5E8IA 3P9IA 1IZ1A 3COAC 2O8XA 1OYYA 4P55A 1XMKA 3K2ZA 4M9XA 1SFEA 1I5ZA 2JPBA 5ERIA 2W84A 2Z5UA 3LWFA 5LGUA 4ASNA 1YS6A 3T8RA 3F8CA 2HKXA 2PI0A 2H27A 1R36A 1WQ2A 2ZKZA 3DXJF 4M9ZA 3CDHA 3C3WA 1OR7A 1XD7A 5J8CA 2WV0A 1Y0UA 3CUOA 3KEQA 1U8RA 1ZG3A 3H92A 2G7HA 2H6BA 1W5SA 2O03A 5BOXA 5LRSA 3F6VA 2FBIA 2ZMEA 3I54A 4WXDA 2CW0F 2QWWA 2HYGD 3I64A 1DPUA 4B09A 3GZ5A 1ON1A 4GYIA 1SAXA 3KP4A 3F23A 5E1ZB 5HVQC 1S6LA 4OOIA 4P9UA 2E1CA 2NS0A 3FX3A 3KP5A 4RAYA 5CVRA 1L3LA 1YTYA 1Z91A 2Q8KA 2P5LC 2P4WA 1HBXG 3ZP5A 5ILVA 1CF7B 3AAFA 2BYVE 2HS5A 3RJPA 3TQNA 3T1BA 4UVAA 2F5DA 2KKOA 1H0MA 4QWQA 2RN7A 4IXAA 2J5PA 2QYOA 2XGXA 4I09A 3E5UA 4Q47A 3RKXA 1XCBA 2QQAA 4KMUX 4XLPF 2Q2EA 3ROUA 4G6QA 1HW5A 2CG4A 1LVAA 3S2WA 2FA5A 4WXCA 1E2XA 3LA7A 1BI0A 2E1NA 1ZGJA 2HDCA 5DCMB 3ZPLA 1R1TA 3IKVA 4H0EA 1KU9A 2EV6A 1R5GA 4HLXA 4ESJA 1J7KA 2L4MA 1NHAA 3KLOA 1B4AA 2IJLA 2X4HA 2H09A 4GYGA 1YS7A 1GXQA 2GZWA 1K6OA 3CUQA 2MBFA 4EGZA 3NQOA 4LG0B 4WXHA 1F9NA 1UHMA 4UXNA 2DAOA 4HX7A 6PAXA 2JRTA 4MNUA 1J5YA 2HKOA 2QVOA 2VODA 4EGYA 3ZN0A 3WTTC 2LKPA 1I6XA 2ACJA 1ZLKA 5L3EA 2K27A 3ZMTA 3RPUA 5L3GA 5J8FA 1ON2A 3R4KA 4A0YA 4OU0A 2FRHA 5H20A 3F21A 2Q0OA 3IC7A 1LDJA 4BH9A 2XUBA 2JT1A 1KQ0A 3HUGA 2MH9A 3SFZA 1WKMA 1MGTA 4I98B 2YR2A 3IHUA 2A61A 3C18A 5EEGA 1G3TA 2D45A 4PGHA 3LA2A 1K78B 1I1SA 1T0FA 1FLIA 3L2CA 3E5XA 4S04A 2EFPA 1ZRCA 3KP3A 3OOPA 4EJUA 5FO5A 2STWA 1J2XA 3VEPA 4IRIA 3IWFA 3RYPA 4KNYA 1KU2A 3SZTA 1HQCA 3QU6A 4BNCA 2OQGA 2WWYA 4OMYA 1P92A 2EK5A 5L3FA 1ZLJA 1FY7A 5LGNA 4UNOA 5ED4A 1KA8A 3MCZA 3L7WA 1HXDA 2V79A 1YYVA 3HTSB 3ELKA 1R58A 2BBYA 2VE8A 3KEOA 3P9KA 2FNAA 5K5QA 1QNTA 3QOPA 4LLLA 4CZZA 2QBYB 3PFIA 1KYWA 3BWGA 2R7FA 5HDNA 1QZZA 1C0WA 2YPRA 2LF8A 1Z6RA 2COMA 3LFKA 4A6EA 3CTAA 5DUIA 1BIAA 2V1DA 5BS6A 2FNPA 4ZYHA 3I4PA 1RNLA 1P4XA 2VC1A 3WG9A 1S8NA 3GUDA 4E70A 3MZYA 4L0ZB 1HKSA 2OU2A 1REPC 2VBYA 2MC3A 3GWZA 1G6NA 3REOA 3V7RA 3MFKA 3BY6A 3KP6A 3EDPA 4XBFA 2A6EF 4I7HA 4AD9A 1O57A 2OQRA 3DFGA 4RB2C 2F5FA 1YO5C 3I59B 2HEOA 1IN7A 3T0YA 1KQ9A 1FYLA 4MTDA 1MDMA 2XRNA 1V3FA 2EJRA 1XGNA 1XSXA 4WX9A 3LQRA 2HZTA 1MKMA 1FT9A 2UXNA 4XLNF 1I1GA 1WRJA 3HIFA 3K1NA 4LK1F 1AOYA 4RGSA 1K79A 1YW9A 3F6OA 4HQEA 5H6QA 2XAHA 1U2WA 1YW8A 2VN2A 1TLHB 5KK1A 3E6CC 3M7GA 4FHTA 1BI1A 2EFNA 2O61A 4U88A 2XVCA 3ULQB 1XGOA 1IW7F 4RGRA 1QGPA 4M72A 3B73A 4RB1A 5D5UB 2E7XA 4LFUA 1A04A 4YIFA 4M9SA 2A3SA 1KYZA 3TKYA 1O3SA 5E18F 3DV8A 2BEOA 4I0AA 2EFOA 3ZN1A 1R5HA 2IA2A 3RDIA 1U3EM 1O3TA 1XB4A 4UV8A 2D1VA 1BN5A 4O5VA 5FFXA 1KGSA 3V7CA 4U7BA 5IT3A 5CVVA 3JAMK 3GO5A 1BBYA 4HX8A 2PMHA 4LK0F 1D5VA 2K7LA 4ENNA 5A2QK 2K4JA 1PP8F 2IA0A 3HOSA 3U2RA 4ETSA 2HR3A 4L9VA 2UZKA 1ONVA 2K02A 3GZ6A 2MH2A 2MA3A 4FX4A 3D0SA 4KIFA 5HOOA 2STTA 3EQLF 3EYIA 4M73A 3MEXA 1XGSA 3HHGA 5L3DA 4KMFA 4UHTA 2ISYA 4AIHA 1B59A 4KN7X 1BC7C 5AIPA 3IWZA 1TQMA 2M30A 4OMZA 2XAQA 1W4MA 5CLSA 3BROA 3O3KA 1FOKA 4U0VA 4HF0A 4HOBA 3WTWC 3JTHA 3I53A 1OKRA 2D2WA 1OMIA 3HSRA 3KE2A 1IXSB 3FM3A 4U0WA 2JTVA 4L0YB 1XSDA 1U5TB 3EYYA 3F8MA 2DU9A 3G3ZA 2JSCA 2UXXA 3KFWX 1ODDA 2W57A 1J75A 2HYFA 3BPXA 5K5RA 4G8XA 1TQPA 1B9NA 3TOAA 4G7OF 1GVJA 4K2EA 3TGNA 2KJCA 4RGXA 3L09A 1HW1A 2WC2A 2RKHA 3DEUA 2VONA 1IRFA 2GIVA 3TOBA 3BJ6A 5FLXZ 1KU7A 3LSTA 3V4GA 2PQ8A 3SHFA 4IF4A 4O3MA 1YG2A 4EJOA 1F1ZA 2ZNZA 5EEHA 1FSEA 2PMUA 3EETA 2XHKA 4EQQA 5FGMA 3L00A 3GF2A 4WF2A 3ZMUA 1UHWA 1LDKB 2BE5F 4IVNA 3ECHA 4MHGA 1YFHA 3GXOA 1ZHFA 1GHCA 3VODA 1D3YA 4HDUA 2EA2A 3VOEA 1DPRA 5LRRA 4HZFA 4EVIA 2P5KA 5HS7A 1IXCA 2FEZA 1Z7UA 1WSUA 4LD5A 1IN8A 3T8TA 5E17F 2YX4A 4MTEA 1K7AA 3WTUC 4RAZA 2XKOA 1S7AA 4IHSA 4YFNF 2P7VB 5D8KB 3ZMZA 5AONA 3KZZA 4Q4ZF 5D6FA 3KP2A 1RZ4A 5IT9K 1EH7A 3WGGA 3FXUA 4WCGA 1LB2A 1JXSA 5D5WB 4RS8A 4YIIA 2L54A 2L01A 3ZMVA 2CGPA 2MLKA 2G9WA 1GXPA 5D8LB 2MD5A 1KU3A 1QBJA 5LEJA 1Z9CA 2QQ9A 4BHCA 2A68F 4GXOA 1STZA 1RI7A 2UWMA 1D8JA 1QZYA 4I2OA 1YW7A 1OPCA 1OYIA 2FXAA 4IPAA 4OIPF 2DQRA 3Q9SA 1ZYRF 5JR3A 4OINF 1U5TC 2VOPA 1LDDA 3RPQA 4MEYF 2ETHA 4G7ZF 3M8EA 3RKYA 4YFKF 1Z1DA 2ADUA 2FMLA 4FT8A 1T38A 3C7JA 1T6SA 4KICA 1IF1A 1TW3A 1QQIA 3I0TA 1B6AA 5LHIA 2GQQA 4AIKA 1T39A 4L9TA 4A2UA 4M71A 2V9VA 5HDKA 2PBIA 4MQVA 2FBKA 3FWEA 4LMYA 3FHZA 4Y13A 3ZMDA 1ZG1A 3HRSA 1ZRFA 3R61A 3TO9A 4MGRA 1XGMA 3J7AO 1L0OC 2W25A 3GVAA 1HSTA 4G6DA 3CO6C 3PQKA 1FBQA 3KCCA 5CVIA 4L18B 5F64A 2W85A 1PUEE 3K0LA 5HLHA 2DK5A 2ZFWA 1Z05A 1FYKA 1XSVA 3T5XA 4P96A 2HOEA 5E20A 2F5CA 3CJNA 3FMQA 3Q5FA 4U0YA 3Q9VA 4ZZDA 2XAGA 3K9TA 1SD6A 3ISPA 2R7DA 1BIBA 5ICEA 3BOQA 1P4AA 1U5TA 4UUVA 3E6DA 3F3XA 3JAMZ 3OV8A 2EWNA 1PDNC 1USSA 4WWCA 4ENMA 4PDKA 1EV7A 4EM2A 1WWXA 2XASA 4EV0A 1MZBA 1SD4A 2QM3A 1ZARA 2YX7A 1MDMB 1P4WA 5DD8A 5DCMA 3LA3A 2NRAC 4S05A 2FMYA 2GA1A 5LEKA 1F4KA 2PG4A 3R6SA 2FQ3A 3U1DA 2LF7A 3ERED 1ZH5A 1V4RA 4EM0B 1FNNA 3O6BB 3BJAA 1S7OA 1TW2A 3R0JA 5IT9Z 2F2EA 3I58A 2BGCA 3DP7A 2FF4A 3BDDA 4OIRF 3WGIA 1Q1HA 3RTRA 1R7JA 1Z6TA 1EH6A 1FBUA 3J80Z 2MLGA 4BQAA 2IA1A 4I0BA 3HHHA 3NRVA 5JFRA 2RQPA 4JBAA 1H9GA 2DI3A 5HLIA 3QP5A 1I27A 1LEBA 1KQ8A 1ZAOA 5ICGA 3J81K 1O7LA 4U7DA 4BYYA 2RNJA 4F7ZA 2CWEA 1G3WA 4G94A 4Q5SF 2DK8A 2VXZA 4A12A 1HKTA 3V8LA 2KIFA 2WTEA 3IKTA 2QQBA 3WGHA 1UFMA 2FU4A 4LJZF 3V8KA 1R22A 3R60A 2DTRA 2KRFA 2RDPA 2DPUA 1F5TA 3SXYA 3KLNA 2P6SA 5L3CA 2OA4A 4HF1A 5JI6A 2GA2A 2RV8A 1QPMA 2B0LA 2XAJA 2DQLA 4LG0A 1O7FA 1JHHA 4DQ2A 1E17A 2LDUA 3CUQB 4OIOF 4WK8F 3O2PE 1UB9A 1X3UA 5DEQA 3RYRA 3LAJA 4O6JA 2RC4A 4LGWA 5CVUA 2DLLA 4AWXB 5DDGA 3LQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ENK A;  1O3Q A;  3F72 A;  3SZP A;  2DT5 A;  3FMR A;  4MQ9 F;  4UVC A;  5DV5 A;  5ILU A;  1FSH A;  4CHU A;  3GFJ A;  4R8H A;  3MWM A;  4ON0 A;  2V1X A;  2EV0 A;  2RVC A;  4LLG F;  1RIO H;  5FD6 A;  2Z3Y A;  1EH8 A;  2VC0 A;  2EFW A;  1FYM A;  5K1Y A;  4Q48 A;  2K4B A;  4P5O A;  2EB7 A;  2YSR A;  3QU3 A;  1ULY A;  4M6X A;  4P9F A;  2D1H A;  2L4A A;  4L5J A;  4MEX F;  5F6F A;  3GLX A;  3WU1 B;  2LSO A;  4CIC A;  2OBP A;  1BM9 A;  2L3D A;  1D8K A;  2VT3 A;  3MAJ A;  3BZ6 A;  2TDX A;  5D4S A;  2HQR A;  2EV5 A;  2QLZ A;  1G4D A;  2H6C A;  2HFH A;  2M1B A;  2IVM A;  4XSX F;  1J9I A;  3JW4 A;  5D6E A;  2EA4 A;  5DYM A;  2M87 A;  3BP8 A;  3IL2 A;  1HKQ A;  5TRD A;  2VE9 A;  1MJA A;  2IRF G;  2P6T A;  2QBY A;  2ELH A;  5DD4 A;  3GYH X;  1SD5 A;  3RI4 A;  4HX4 A;  4ESF A;  1BI2 A;  4PCQ A;  4Z2Y A;  3HRT A;  4ZH4 F;  1MJ9 A;  3DKW A;  5CJ9 A;  2H94 A;  1W5T A;  1ZRD A;  2RGV A;  3FM5 A;  4HAM A;  1XMA A;  1VTN C;  1IRG A;  4CYD A;  4KT5 C;  3WOD F;  1R00 A;  3E5Q A;  3P9C A;  2FE3 A;  1JHF A;  4ZYE A;  2A6H F;  4LLN A;  3R0A A;  4DNC A;  3CO7 C;  4D0P A;  3DPL C;  1JGS A;  4G9Y A;  1SFX A;  5JHU A;  4ZYD A;  4IHT A;  3HOT A;  2VOO A;  1IN4 A;  4HV6 A;  2A07 F;  3HYI A;  4EJW A;  5HLG A;  1R23 A;  2XRO A;  2Z99 A;  3IRR A;  5D4R A;  1T98 A;  2ZCW A;  3QPH A;  5FLX K;  1TNS A;  2KJB A;  4KFC A;  1CGP A;  4I01 A;  5LHH A;  4ENJ A;  3H3Z A;  3GW2 A;  1QO0 D;  4A0Z A;  4GCV A;  1S29 A;  2GWR A;  1WI9 A;  4HYE A;  2M45 A;  2GXB A;  2CFX A;  3TO6 A;  4YFX F;  2Z9O A;  3NEU A;  1OYW A;  3F22 A;  4B8X A;  5KVR A;  3H3U A;  3DQV C;  3DF8 A;  3WE2 A;  1YQA A;  1IAW A;  2DO7 A;  3F8N A;  5E1W A;  2PN6 A;  3W6J B;  4A5M A;  1FWZ A;  4KYW A;  4N0B A;  3EUH A;  4UV9 A;  3QPT A;  3WTV C;  4Y17 A;  2AS5 F;  4LB5 A;  4EJT A;  4A0X A;  3SQN A;  1IN6 A;  3P7N A;  5FD5 A;  1IN5 A;  4EMS A;  3MQ0 A;  3KET A;  2A5Y B;  2ESN A;  1DP7 P;  4XSZ F;  4M74 A;  3ECO A;  4L9N A;  4KUM A;  4HQM A;  2L02 A;  1W7P A;  4QLC U;  1SMT A;  1J0R A;  4KIB A;  2QEN A;  1XDS A;  2E7W A;  4NQW A;  4I02 A;  2OAZ A;  3FMS A;  2IPQ X;  4L5I A;  4UVB A;  5LLQ A;  1BI3 A;  1U6G A;  3CUQ C;  3FF5 A;  2JPC A;  2QZ8 A;  1FP2 A;  1FZP B;  2X0L A;  2J5O A;  4XRF A;  1S3J A;  2W24 A;  2HTS A;  2F5E A;  2IW5 A;  1BJA A;  1T2K A;  3M1E A;  3QAH A;  5BQT A;  4IRG A;  5ICF A;  4BAY A;  3ABU A;  2V6C A;  1TQI A;  2GAU A;  1JE8 A;  1RUN A;  2NYX A;  3F8B A;  2G7U A;  1BOA A;  4BXU A;  2CO5 A;  2FSW A;  4N9I A;  3ZMS A;  5FFZ A;  2OZU A;  2QUF A;  1HW2 A;  2P7C B;  2GXG A;  2VT2 A;  3F8F A;  1XDU A;  4CO8 A;  3K1M A;  4RB0 A;  1DDN A;  2M5W A;  2XIG A;  4RB3 C;  5LBQ A;  2PEX A;  5FB2 A;  4G7H F;  5DUK A;  2DPD A;  2ISZ A;  1FC3 A;  2DFI A;  2ESH A;  3HSF A;  1CF7 A;  2R3S A;  1ZN2 A;  2P5V A;  2HGC A;  2ZXJ A;  4EJV A;  1YIO A;  3JSP A;  1B9M A;  3WTX C;  3J80 K;  2PLY A;  4AIJ A;  3D5L A;  4N9H A;  1ZRE A;  3W6K B;  2C6Y A;  2Y48 A;  4KN4 X;  1FBS A;  3WTZ A;  3HRM A;  1HSJ A;  3LAP A;  2OD5 A;  4CDG A;  1MJB A;  3DPT A;  2CSO A;  2M8E A;  4HLY A;  3IRQ A;  3GFL A;  3KP7 A;  3J81 Z;  4KA4 A;  2O0Y A;  5E8G A;  1P2F A;  5HS8 A;  4KDP A;  4CXF A;  3VFZ A;  1R1V A;  1XN7 A;  2ZNY A;  3U9G A;  3M9A A;  3GFI A;  2LNB A;  1W7P B;  2XAF A;  1RUO A;  3BJO A;  4NHJ A;  5D5X B;  4HW0 A;  3ABT A;  5JVT A;  3KZY A;  3B02 A;  4NB5 A;  1SFU A;  3I59 A;  1YLF A;  3I5U A;  4A6D A;  3M8F A;  1W7P D;  3WTS C;  3TO7 A;  1MD0 A;  2Z33 A;  4EM1 A;  2HQN A;  3HTU A;  3HRU A;  4GO1 A;  4JK1 X;  5L3B A;  1ZGA A;  1DUX C;  4R1H A;  2BV6 A;  2CYY A;  3K69 A;  4A5N A;  2DBB A;  3N97 A;  4KIG A;  4BHB A;  2K86 A;  4L9J A;  4M6Y A;  1LQ1 A;  3CLO A;  2IP2 A;  2EFQ A;  2VBX A;  1TNT A;  1FP1 D;  1SMY F;  4IRH A;  4HBL A;  2VBZ A;  3FXQ A;  3RKW A;  4LB6 B;  1XCV A;  4ZYG A;  3WTY C;  4YG2 F;  4AVP A;  1TBX A;  3MZH A;  4GGG A;  1TTY A;  2V1U A;  1UST A;  2IT0 A;  1FPQ A;  3TDU C;  2DW4 A;  2Y75 A;  2CQK A;  2VBW A;  4BHP A;  2HWV A;  1LEA A;  1IUY A;  2OZ6 A;  2AXL A;  4ZZL A;  5AIQ A;  3V7S A;  3ML6 A;  1R1U A;  3K1P A;  3WU0 A;  2PJP A;  5K5O A;  3G73 A;  2ZO4 A;  4PGG A;  1J59 A;  5A2Q Z;  3ZQ7 A;  3JSO A;  4OIQ F;  2XV4 S;  5BPI A;  5D5V B;  2O6G E;  3HSE A;  3E6M A;  3PQJ A;  2KIM A;  3QP6 A;  5HDG A;  2FOK A;  2ZBK A;  4JQF A;  1BC8 C;  4FX0 A;  3GFM A;  3E3V A;  2A69 F;  3JTG A;  1LJ9 A;  2YU3 A;  2Y0M A;  2KIU A;  2NAZ A;  2JZY A;  4R79 A;  3E6B A;  5TJJ A;  1UCR A;  2P8T A;  1SD7 A;  4ESB A;  1ZG5 A;  5ICC A;  2XKP A;  5CVJ A;  5CYV A;  3N4M A;  3QRF F;  5BPD A;  2NNN A;  3C1D A;  1FX7 A;  3TDZ C;  1B1B A;  1G3Y A;  1K78 A;  1IXR C;  2O3F A;  4IJA A;  1O3R A;  5F1R A;  3BPV A;  4HDV A;  2NNY A;  1H9T A;  2FBH A;  5LGT A;  5E1X A;  4HA8 A;  3V8J A;  5J6X A;  1LNW A;  1G3S A;  4TV7 A;  4RGU A;  3GX4 X;  4HV5 A;  3E97 A;  4Y15 A;  2ZME B;  3I71 A;  3VB2 A;  1PP7 U;  4HF2 A;  2HTJ A;  3GEZ A;  3FZV A;  4PZJ A;  5LHG A;  5H6R A;  5BMZ A;  1P6R A;  3L9F A;  2PFB A;  4CGZ A;  5DCF A;  5ILS A;  1AWC A;  3WE3 A;  3FXR A;  5HS9 A;  2ZJ2 A;  3RIR A;  1U78 A;  5E8I A;  3P9I A;  1IZ1 A;  3COA C;  2O8X A;  1OYY A;  4P55 A;  1XMK A;  3K2Z A;  4M9X A;  1SFE A;  1I5Z A;  2JPB A;  5ERI A;  2W84 A;  2Z5U A;  3LWF A;  5LGU A;  4ASN A;  1YS6 A;  3T8R A;  3F8C A;  2HKX A;  2PI0 A;  2H27 A;  1R36 A;  1WQ2 A;  2ZKZ A;  3DXJ F;  4M9Z A;  3CDH A;  3C3W A;  1OR7 A;  1XD7 A;  5J8C A;  2WV0 A;  1Y0U A;  3CUO A;  3KEQ A;  1U8R A;  1ZG3 A;  3H92 A;  2G7H A;  2H6B A;  1W5S A;  2O03 A;  5BOX A;  5LRS A;  3F6V A;  2FBI A;  2ZME A;  3I54 A;  4WXD A;  2CW0 F;  2QWW A;  2HYG D;  3I64 A;  1DPU A;  4B09 A;  3GZ5 A;  1ON1 A;  4GYI A;  1SAX A;  3KP4 A;  3F23 A;  5E1Z B;  5HVQ C;  1S6L A;  4OOI A;  4P9U A;  2E1C A;  2NS0 A;  3FX3 A;  3KP5 A;  4RAY A;  5CVR A;  1L3L A;  1YTY A;  1Z91 A;  2Q8K A;  2P5L C;  2P4W A;  1HBX G;  3ZP5 A;  5ILV A;  1CF7 B;  3AAF A;  2BYV E;  2HS5 A;  3RJP A;  3TQN A;  3T1B A;  4UVA A;  2F5D A;  2KKO A;  1H0M A;  4QWQ A;  2RN7 A;  4IXA A;  2J5P A;  2QYO A;  2XGX A;  4I09 A;  3E5U A;  4Q47 A;  3RKX A;  1XCB A;  2QQA A;  4KMU X;  4XLP F;  2Q2E A;  3ROU A;  4G6Q A;  1HW5 A;  2CG4 A;  1LVA A;  3S2W A;  2FA5 A;  4WXC A;  1E2X A;  3LA7 A;  1BI0 A;  2E1N A;  1ZGJ A;  2HDC A;  5DCM B;  3ZPL A;  1R1T A;  3IKV A;  4H0E A;  1KU9 A;  2EV6 A;  1R5G A;  4HLX A;  4ESJ A;  1J7K A;  2L4M A;  1NHA A;  3KLO A;  1B4A A;  2IJL A;  2X4H A;  2H09 A;  4GYG A;  1YS7 A;  1GXQ A;  2GZW A;  1K6O A;  3CUQ A;  2MBF A;  4EGZ A;  3NQO A;  4LG0 B;  4WXH A;  1F9N A;  1UHM A;  4UXN A;  2DAO A;  4HX7 A;  6PAX A;  2JRT A;  4MNU A;  1J5Y A;  2HKO A;  2QVO A;  2VOD A;  4EGY A;  3ZN0 A;  3WTT C;  2LKP A;  1I6X A;  2ACJ A;  1ZLK A;  5L3E A;  2K27 A;  3ZMT A;  3RPU A;  5L3G A;  5J8F A;  1ON2 A;  3R4K A;  4A0Y A;  4OU0 A;  2FRH A;  5H20 A;  3F21 A;  2Q0O A;  3IC7 A;  1LDJ A;  4BH9 A;  2XUB A;  2JT1 A;  1KQ0 A;  3HUG A;  2MH9 A;  3SFZ A;  1WKM A;  1MGT A;  4I98 B;  2YR2 A;  3IHU A;  2A61 A;  3C18 A;  5EEG A;  1G3T A;  2D45 A;  4PGH A;  3LA2 A;  1K78 B;  1I1S A;  1T0F A;  1FLI A;  3L2C A;  3E5X A;  4S04 A;  2EFP A;  1ZRC A;  3KP3 A;  3OOP A;  4EJU A;  5FO5 A;  2STW A;  1J2X A;  3VEP A;  4IRI A;  3IWF A;  3RYP A;  4KNY A;  1KU2 A;  3SZT A;  1HQC A;  3QU6 A;  4BNC A;  2OQG A;  2WWY A;  4OMY A;  1P92 A;  2EK5 A;  5L3F A;  1ZLJ A;  1FY7 A;  5LGN A;  4UNO A;  5ED4 A;  1KA8 A;  3MCZ A;  3L7W A;  1HXD A;  2V79 A;  1YYV A;  3HTS B;  3ELK A;  1R58 A;  2BBY A;  2VE8 A;  3KEO A;  3P9K A;  2FNA A;  5K5Q A;  1QNT A;  3QOP A;  4LLL A;  4CZZ A;  2QBY B;  3PFI A;  1KYW A;  3BWG A;  2R7F A;  5HDN A;  1QZZ A;  1C0W A;  2YPR A;  2LF8 A;  1Z6R A;  2COM A;  3LFK A;  4A6E A;  3CTA A;  5DUI A;  1BIA A;  2V1D A;  5BS6 A;  2FNP A;  4ZYH A;  3I4P A;  1RNL A;  1P4X A;  2VC1 A;  3WG9 A;  1S8N A;  3GUD A;  4E70 A;  3MZY A;  4L0Z B;  1HKS A;  2OU2 A;  1REP C;  2VBY A;  2MC3 A;  3GWZ A;  1G6N A;  3REO A;  3V7R A;  3MFK A;  3BY6 A;  3KP6 A;  3EDP A;  4XBF A;  2A6E F;  4I7H A;  4AD9 A;  1O57 A;  2OQR A;  3DFG A;  4RB2 C;  2F5F A;  1YO5 C;  3I59 B;  2HEO A;  1IN7 A;  3T0Y A;  1KQ9 A;  1FYL A;  4MTD A;  1MDM A;  2XRN A;  1V3F A;  2EJR A;  1XGN A;  1XSX A;  4WX9 A;  3LQR A;  2HZT A;  1MKM A;  1FT9 A;  2UXN A;  4XLN F;  1I1G A;  1WRJ A;  3HIF A;  3K1N A;  4LK1 F;  1AOY A;  4RGS A;  1K79 A;  1YW9 A;  3F6O A;  4HQE A;  5H6Q A;  2XAH A;  1U2W A;  1YW8 A;  2VN2 A;  1TLH B;  5KK1 A;  3E6C C;  3M7G A;  4FHT A;  1BI1 A;  2EFN A;  2O61 A;  4U88 A;  2XVC A;  3ULQ B;  1XGO A;  1IW7 F;  4RGR A;  1QGP A;  4M72 A;  3B73 A;  4RB1 A;  5D5U B;  2E7X A;  4LFU A;  1A04 A;  4YIF A;  4M9S A;  2A3S A;  1KYZ A;  3TKY A;  1O3S A;  5E18 F;  3DV8 A;  2BEO A;  4I0A A;  2EFO A;  3ZN1 A;  1R5H A;  2IA2 A;  3RDI A;  1U3E M;  1O3T A;  1XB4 A;  4UV8 A;  2D1V A;  1BN5 A;  4O5V A;  5FFX A;  1KGS A;  3V7C A;  4U7B A;  5IT3 A;  5CVV A;  3JAM K;  3GO5 A;  1BBY A;  4HX8 A;  2PMH A;  4LK0 F;  1D5V A;  2K7L A;  4ENN A;  5A2Q K;  2K4J A;  1PP8 F;  2IA0 A;  3HOS A;  3U2R A;  4ETS A;  2HR3 A;  4L9V A;  2UZK A;  1ONV A;  2K02 A;  3GZ6 A;  2MH2 A;  2MA3 A;  4FX4 A;  3D0S A;  4KIF A;  5HOO A;  2STT A;  3EQL F;  3EYI A;  4M73 A;  3MEX A;  1XGS A;  3HHG A;  5L3D A;  4KMF A;  4UHT A;  2ISY A;  4AIH A;  1B59 A;  4KN7 X;  1BC7 C;  5AIP A;  3IWZ A;  1TQM A;  2M30 A;  4OMZ A;  2XAQ A;  1W4M A;  5CLS A;  3BRO A;  3O3K A;  1FOK A;  4U0V A;  4HF0 A;  4HOB A;  3WTW C;  3JTH A;  3I53 A;  1OKR A;  2D2W A;  1OMI A;  3HSR A;  3KE2 A;  1IXS B;  3FM3 A;  4U0W A;  2JTV A;  4L0Y B;  1XSD A;  1U5T B;  3EYY A;  3F8M A;  2DU9 A;  3G3Z A;  2JSC A;  2UXX A;  3KFW X;  1ODD A;  2W57 A;  1J75 A;  2HYF A;  3BPX A;  5K5R A;  4G8X A;  1TQP A;  1B9N A;  3TOA A;  4G7O F;  1GVJ A;  4K2E A;  3TGN A;  2KJC A;  4RGX A;  3L09 A;  1HW1 A;  2WC2 A;  2RKH A;  3DEU A;  2VON A;  1IRF A;  2GIV A;  3TOB A;  3BJ6 A;  5FLX Z;  1KU7 A;  3LST A;  3V4G A;  2PQ8 A;  3SHF A;  4IF4 A;  4O3M A;  1YG2 A;  4EJO A;  1F1Z A;  2ZNZ A;  5EEH A;  1FSE A;  2PMU A;  3EET A;  2XHK A;  4EQQ A;  5FGM A;  3L00 A;  3GF2 A;  4WF2 A;  3ZMU A;  1UHW A;  1LDK B;  2BE5 F;  4IVN A;  3ECH A;  4MHG A;  1YFH A;  3GXO A;  1ZHF A;  1GHC A;  3VOD A;  1D3Y A;  4HDU A;  2EA2 A;  3VOE A;  1DPR A;  5LRR A;  4HZF A;  4EVI A;  2P5K A;  5HS7 A;  1IXC A;  2FEZ A;  1Z7U A;  1WSU A;  4LD5 A;  1IN8 A;  3T8T A;  5E17 F;  2YX4 A;  4MTE A;  1K7A A;  3WTU C;  4RAZ A;  2XKO A;  1S7A A;  4IHS A;  4YFN F;  2P7V B;  5D8K B;  3ZMZ A;  5AON A;  3KZZ A;  4Q4Z F;  5D6F A;  3KP2 A;  1RZ4 A;  5IT9 K;  1EH7 A;  3WGG A;  3FXU A;  4WCG A;  1LB2 A;  1JXS A;  5D5W B;  4RS8 A;  4YII A;  2L54 A;  2L01 A;  3ZMV A;  2CGP A;  2MLK A;  2G9W A;  1GXP A;  5D8L B;  2MD5 A;  1KU3 A;  1QBJ A;  5LEJ A;  1Z9C A;  2QQ9 A;  4BHC A;  2A68 F;  4GXO A;  1STZ A;  1RI7 A;  2UWM A;  1D8J A;  1QZY A;  4I2O A;  1YW7 A;  1OPC A;  1OYI A;  2FXA A;  4IPA A;  4OIP F;  2DQR A;  3Q9S A;  1ZYR F;  5JR3 A;  4OIN F;  1U5T C;  2VOP A;  1LDD A;  3RPQ A;  4MEY F;  2ETH A;  4G7Z F;  3M8E A;  3RKY A;  4YFK F;  1Z1D A;  2ADU A;  2FML A;  4FT8 A;  1T38 A;  3C7J A;  1T6S A;  4KIC A;  1IF1 A;  1TW3 A;  1QQI A;  3I0T A;  1B6A A;  5LHI A;  2GQQ A;  4AIK A;  1T39 A;  4L9T A;  4A2U A;  4M71 A;  2V9V A;  5HDK A;  2PBI A;  4MQV A;  2FBK A;  3FWE A;  4LMY A;  3FHZ A;  4Y13 A;  3ZMD A;  1ZG1 A;  3HRS A;  1ZRF A;  3R61 A;  3TO9 A;  4MGR A;  1XGM A;  3J7A O;  1L0O C;  2W25 A;  3GVA A;  1HST A;  4G6D A;  3CO6 C;  3PQK A;  1FBQ A;  3KCC A;  5CVI A;  4L18 B;  5F64 A;  2W85 A;  1PUE E;  3K0L A;  5HLH A;  2DK5 A;  2ZFW A;  1Z05 A;  1FYK A;  1XSV A;  3T5X A;  4P96 A;  2HOE A;  5E20 A;  2F5C A;  3CJN A;  3FMQ A;  3Q5F A;  4U0Y A;  3Q9V A;  4ZZD A;  2XAG A;  3K9T A;  1SD6 A;  3ISP A;  2R7D A;  1BIB A;  5ICE A;  3BOQ A;  1P4A A;  1U5T A;  4UUV A;  3E6D A;  3F3X A;  3JAM Z;  3OV8 A;  2EWN A;  1PDN C;  1USS A;  4WWC A;  4ENM A;  4PDK A;  1EV7 A;  4EM2 A;  1WWX A;  2XAS A;  4EV0 A;  1MZB A;  1SD4 A;  2QM3 A;  1ZAR A;  2YX7 A;  1MDM B;  1P4W A;  5DD8 A;  5DCM A;  3LA3 A;  2NRA C;  4S05 A;  2FMY A;  2GA1 A;  5LEK A;  1F4K A;  2PG4 A;  3R6S A;  2FQ3 A;  3U1D A;  2LF7 A;  3ERE D;  1ZH5 A;  1V4R A;  4EM0 B;  1FNN A;  3O6B B;  3BJA A;  1S7O A;  1TW2 A;  3R0J A;  5IT9 Z;  2F2E A;  3I58 A;  2BGC A;  3DP7 A;  2FF4 A;  3BDD A;  4OIR F;  3WGI A;  1Q1H A;  3RTR A;  1R7J A;  1Z6T A;  1EH6 A;  1FBU A;  3J80 Z;  2MLG A;  4BQA A;  2IA1 A;  4I0B A;  3HHH A;  3NRV A;  5JFR A;  2RQP A;  4JBA A;  1H9G A;  2DI3 A;  5HLI A;  3QP5 A;  1I27 A;  1LEB A;  1KQ8 A;  1ZAO A;  5ICG A;  3J81 K;  1O7L A;  4U7D A;  4BYY A;  2RNJ A;  4F7Z A;  2CWE A;  1G3W A;  4G94 A;  4Q5S F;  2DK8 A;  2VXZ A;  4A12 A;  1HKT A;  3V8L A;  2KIF A;  2WTE A;  3IKT A;  2QQB A;  3WGH A;  1UFM A;  2FU4 A;  4LJZ F;  3V8K A;  1R22 A;  3R60 A;  2DTR A;  2KRF A;  2RDP A;  2DPU A;  1F5T A;  3SXY A;  3KLN A;  2P6S A;  5L3C A;  2OA4 A;  4HF1 A;  5JI6 A;  2GA2 A;  2RV8 A;  1QPM A;  2B0L A;  2XAJ A;  2DQL A;  4LG0 A;  1O7F A;  1JHH A;  4DQ2 A;  1E17 A;  2LDU A;  3CUQ B;  4OIO F;  4WK8 F;  3O2P E;  1UB9 A;  1X3U A;  5DEQ A;  3RYR A;  3LAJ A;  4O6J A;  2RC4 A;  4LGW A;  5CVU A;  2DLL A;  4AWX B;  5DDG A;  3LQQ A; 
#chains in the Genus database with same CATH topology
 4ENK A;  2E35 A;  1O3Q A;  3F72 A;  3GBG A;  3SZP A;  3FXJ A;  2DT5 A;  5HNF A;  4DYC A;  3FMR A;  3CQZ J;  3JR9 A;  4MQ9 F;  4UVC A;  2R7O A;  5DV5 A;  5ILU A;  1FSH A;  4CHU A;  1MMA A;  2XGE A;  2L9S A;  1LPQ A;  3DCF A;  3GFJ A;  4XL9 A;  4R8H A;  1B72 B;  3MWM A;  4ON0 A;  2V1X A;  2EV0 A;  4PSW A;  4ZC3 A;  1TC3 C;  5B1B H;  4QPO A;  1BJZ A;  2RVC A;  4LLG F;  3DKY A;  2L2O A;  1RIO H;  5FD6 A;  4HST A;  2LY2 A;  2Z3Y A;  5FKN A;  1EH8 A;  2VC0 A;  2EFW A;  1FYM A;  5K1Y A;  3CLQ A;  4Q48 A;  3QYB A;  2K4B A;  4P5O A;  4C30 A;  2EB7 A;  2YSR A;  3TW7 A;  3QU3 A;  4CCJ A;  1ULY A;  4M6X A;  4P9F A;  2D1H A;  2VUM J;  2L4A A;  4L5J A;  1ETK A;  5IP9 J;  2NVX J;  1M1E B;  3CCQ I;  4MEX F;  3FXO A;  5F6F A;  1AKH A;  3GLX A;  3WU1 B;  2BW3 A;  5GAE J;  3GTK J;  2LSO A;  4CIC A;  3M3Y J;  2OBP A;  4Y52 J;  1BM9 A;  2L3D A;  2M0C A;  1D8K A;  2OPT A;  2VT3 A;  3MAJ A;  3BZ6 A;  2KRH A;  2TDX A;  5D4S A;  2HQR A;  1TWH J;  1LKX A;  2O8K A;  2EV5 A;  2QLZ A;  3OIO A;  2KRC A;  1G4D A;  4BKX A;  2H6C A;  2HFH A;  2M1B A;  4E7I A;  2IVM A;  1VZ0 A;  4XSX F;  2BY1 A;  2UV1 A;  1J9I A;  3JW4 A;  2O7O A;  5D6E A;  2HXI A;  2EA4 A;  2DT7 B;  5DYM A;  2M87 A;  3BP8 A;  2XSJ C;  3IL2 A;  1HKQ A;  5TRD A;  2I10 A;  4FE4 A;  2E36 A;  2VE9 A;  1MJA A;  2EQR A;  2IRF G;  1NH3 A;  2P6T A;  2QBY A;  2ELH A;  3TP3 A;  5DD4 A;  2HDW A;  1X58 A;  3GYH X;  1AU7 A;  1SD5 A;  3VYT B;  3RI4 A;  3HBL A;  1YE9 A;  4HX4 A;  4ESF A;  1MSE C;  1BI2 A;  1LFP A;  2QA4 I;  2X6X A;  4PCQ A;  4C9Y A;  4Z2Y A;  1B8I A;  3HRT A;  4ZH4 F;  1MJ9 A;  3DKW A;  5CJ9 A;  2H94 A;  1W5T A;  1ZRD A;  4ANJ A;  2KQR A;  4Y33 A;  2RGV A;  1YIJ I;  2K9S A;  3FM5 A;  3HJE A;  4HAM A;  1XMA A;  3FDY A;  4C3J J;  2JA2 A;  2Y31 A;  1VTN C;  3HGY A;  1IRG A;  4CYD A;  4KT5 C;  3WOD F;  1R00 A;  3E5Q A;  3OS1 A;  3P9C A;  2FE3 A;  1JHF A;  4ZYE A;  3S15 J;  2A6H F;  4LLN A;  1X4O A;  3G4S I;  3R0A A;  4DNC A;  3CO7 C;  3QPS A;  4D0P A;  4IQ4 A;  1WGX A;  3DPL C;  2CV2 A;  1JGS A;  2MD0 A;  3CMA I;  4G9Y A;  2NXN B;  3IAS 2;  3BR0 A;  1SFX A;  3OL4 A;  4CCO A;  5JHU A;  4DYR A;  4ZYD A;  4IHT A;  1OCO H;  3HOT A;  2VOO A;  1Z3X A;  1IN4 A;  4HV6 A;  2A07 F;  3HYI A;  5LFA A;  4EJW A;  5HLG A;  2DJN A;  1R23 A;  2XRO A;  3FKJ A;  2Z99 A;  2OC6 A;  4AYB A;  5D4R A;  4E7S A;  3IRR A;  1IV6 A;  3EUA A;  1T98 A;  2ZCW A;  3QPH A;  1TWF J;  5FLX K;  4J19 A;  1DP3 A;  1TNS A;  4BEH A;  4BXX J;  3RSN A;  2ELJ A;  2KJB A;  3VWB A;  4KFC A;  1RKT A;  4NBQ A;  1CGP A;  4I01 A;  3BZC A;  5LHH A;  4ENJ A;  3H3Z A;  3CF5 F;  2LK2 A;  3GW2 A;  1QO0 D;  5M3M J;  4A0Z A;  4GCV A;  1S29 A;  2GWR A;  2X85 A;  1WI9 A;  4HYE A;  2M45 A;  2WBM A;  2GXB A;  2EZK A;  1D1A A;  2CFX A;  3TO6 A;  2QCO A;  4YFX F;  3CJQ B;  3NEU A;  1OYW A;  2Z9O A;  3GTL J;  4S0H B;  3F22 A;  4B8X A;  5KVR A;  4XKW A;  3I9V 2;  2FX0 A;  3M1C A;  3H3U A;  3OR2 C;  3DQV C;  3DF8 A;  2XC7 A;  3WE2 A;  4FE7 A;  1I3A A;  2R5Z B;  1VF9 A;  4XON A;  3H5R A;  4I99 C;  1YQA A;  2CMP A;  3HUG B;  1IAW A;  2DO7 A;  5J1Y A;  1Y39 A;  1BA5 A;  3F8N A;  5E1W A;  4RAG A;  1WVR A;  2PN6 A;  5J4Y A;  3W6J B;  4A5M A;  1FWZ A;  1I39 A;  4KYW A;  4A3I J;  4N0B A;  2GOM A;  3EUH A;  3ONQ A;  4UV9 A;  3QPT A;  1X3Z B;  4AWX B;  3WTV C;  1JKP C;  1U0J A;  1MMD A;  2JUC A;  4Y17 A;  3HB9 A;  2AS5 F;  4NC8 A;  4PFO A;  2XB5 A;  1VQM I;  2MW8 A;  2KLO A;  3OL3 A;  3ZOB A;  4LB5 A;  3FBI B;  4EJT A;  4A0X A;  3SQN A;  1IN6 A;  3P7N A;  5FD5 A;  3HPH A;  2M7B A;  4FIS A;  1IN5 A;  4EMS A;  3MQ0 A;  3KET A;  2JA8 J;  2A5Y B;  2ESN A;  1DP7 P;  4XSZ F;  4RMN A;  3B6A A;  3S3N A;  4M74 A;  3ECO A;  4L9N A;  2COB A;  4KUM A;  4HQM A;  1P9Q C;  2L02 A;  1W7P A;  1SMT A;  4KIB A;  1J0R A;  4QLC U;  2QEN A;  1A6I A;  4LG3 A;  4XLE A;  1XDS A;  2E7W A;  4NQW A;  4I02 A;  2OAZ A;  4M6V A;  5F08 A;  4RM2 A;  3FMS A;  2LD5 A;  1Z7L A;  2IPQ X;  2ZJR F;  4L5I A;  4UVB A;  5LLQ A;  1OCT C;  1BI3 A;  3BTI A;  3N05 A;  2X9D A;  1U6G A;  2DA7 A;  2RAE A;  3CUQ C;  3FF5 A;  1VQ9 I;  3A1Y A;  2JPC A;  4OAY A;  2OJE D;  2QZ8 A;  1FP2 A;  1FZP B;  2X0L A;  1MNE A;  2J5O A;  4XRF A;  1S3J A;  4BJT A;  4D5F A;  2W24 A;  3OYF A;  4YEJ A;  3QPL A;  2HTS A;  2F5E A;  3OSF A;  2IW5 A;  2PMZ N;  1BJA A;  1T2K A;  2DA3 A;  3M1E A;  3QAH A;  4D5C A;  5BQT A;  1Y8R B;  4NC7 A;  1GUU A;  3ZQH A;  4IRG A;  5ICF A;  4BAY A;  3ABU A;  2JA7 J;  1MMS A;  5J47 A;  4EEF G;  2V6C A;  3H1C A;  1BW6 A;  3IH4 A;  3KYD B;  3L1P A;  1TQI A;  3EUK L;  2HDD A;  2GAU A;  3LSH A;  1JE8 A;  2NYX A;  1RUN A;  3F8B A;  2G7U A;  3LOC A;  1BOA A;  2BY3 A;  3L2Q A;  4X1E A;  2BY2 A;  2M2E A;  2Z16 A;  2E60 A;  1T8I A;  4BXU A;  1IGN A;  2CO5 A;  2FSW A;  4XID A;  2L9R A;  4N9I A;  3ZMS A;  1Y0N A;  5FFZ A;  4UY8 I;  2OZU A;  2QUF A;  3H0D A;  1HW2 A;  4F92 B;  2P7C B;  2GXG A;  2VT2 A;  3F8F A;  3M8J A;  2JSP A;  1XDU A;  4CO8 A;  3ASO H;  3K1M A;  4RB0 A;  1Y1V J;  1DDN A;  2R7S A;  2M5W A;  2XIG A;  4A3F J;  4F55 A;  4RB3 C;  5JLX A;  5LBQ A;  3LSM A;  2PEX A;  5FB2 A;  4G7H F;  5DUK A;  4BAC A;  1XG1 A;  2DPD A;  3OIP A;  2ISZ A;  1FC3 A;  2DFI A;  3PUF A;  2LKS A;  3K4M A;  2ESH A;  2WAD A;  3HSF A;  1CF7 A;  2R3S A;  4IKF A;  2LOO A;  1ZN2 A;  2P5V A;  5B1A H;  2HGC A;  2ZXJ A;  4EJV A;  1YIO A;  2R4G A;  1MH3 A;  3JSP A;  3VDX A;  1SEU A;  1B9M A;  2LC2 A;  3WTX C;  3J80 K;  2PLY A;  4AIJ A;  3D5L A;  4N9H A;  1GLN A;  1ZRE A;  3J7Z I;  3W6K B;  2LRD A;  3K4N A;  2C6Y A;  2ZFU A;  2Y48 A;  4DBQ A;  4W97 A;  3LSK A;  3OOU A;  4KN4 X;  1FBS A;  5CQE A;  3WTZ A;  3HRM A;  4FTH A;  2R92 J;  1HSJ A;  4AVZ A;  3LAP A;  1MNM C;  2OD5 A;  3SDB A;  3GCM A;  4CDG A;  1YX5 A;  3TL4 X;  4BL0 B;  1MJB A;  3DPT A;  2CSO A;  3MVP A;  5IYB J;  2M8E A;  1NG6 A;  4QSH A;  2HVQ A;  4HLY A;  3CD6 I;  3IRQ A;  3GFL A;  3KP7 A;  5J3L A;  3K2A A;  3J81 Z;  4KA4 A;  3PNV A;  1A35 A;  2O0Y A;  5E8G A;  5IP6 A;  3JRA A;  1P2F A;  4BGD A;  2E2J J;  5HS8 A;  5DM7 F;  4KDP A;  4CXF A;  1YX3 A;  3VFZ A;  3CJR B;  3PNT A;  1R1V A;  1OCP A;  1XN7 A;  5FKK A;  3SFI A;  2ZNY A;  2CUZ A;  4A3E J;  1K6Y A;  2EIM H;  3K70 C;  3U9G A;  3M9A A;  1APL C;  3LSR A;  1KZH A;  3GFI A;  2JK3 A;  2FJ1 A;  2LNB A;  1W7P B;  2NS7 A;  2XAF A;  1LE8 A;  1RUO A;  2LR8 A;  3BJO A;  4NHJ A;  1R5I D;  4HW0 A;  5D5X B;  2VKV A;  3ABT A;  1WPK A;  5JVT A;  2R7V A;  1A5J A;  2QGU A;  3KZY A;  4IHX A;  3B02 A;  1V55 H;  2OTJ I;  3H36 A;  2ZC2 A;  1QPI A;  4NB5 A;  1SFU A;  3I59 A;  1YLF A;  1DU0 A;  2CJJ A;  3RPU D;  3CCL I;  2OCE A;  3I5U A;  1W36 C;  4A6D A;  4Z6Y A;  1IV8 A;  2DOD A;  3M8F A;  1W7P D;  3WTS C;  3TO7 A;  3FXK A;  5FLM J;  1MD0 A;  2KFD A;  4EM1 A;  2Z33 A;  2HQN A;  3HTU A;  3HRU A;  4GO1 A;  4JK1 X;  5L3B A;  1ZGA A;  5FKM A;  1DUX C;  2DMT A;  2ME6 A;  4R1H A;  2BV6 A;  2CYY A;  3ZQQ A;  4XM3 A;  1UAA A;  3CMY A;  1MIJ A;  3K69 A;  5F04 A;  4A5N A;  4C2U A;  1WJA A;  1MBH A;  1F43 A;  2LY9 A;  2DBB A;  1ZQ3 P;  3NAU A;  3N97 A;  3JRC A;  2PMZ A;  2YU9 J;  1ETX A;  4KIG A;  1WFX A;  2K86 A;  4L9J A;  4BHB A;  3JRE A;  4M6Y A;  3SYT A;  1LQ1 A;  2A6T A;  4A3C J;  3CLO A;  1TWC J;  2A5W A;  2IP2 A;  2EFQ A;  2ZJP F;  2VBX A;  2BXY A;  1TNT A;  2IS2 A;  1YJ9 I;  4Y3O A;  3M4O J;  1FP1 D;  1EJ9 A;  1SMY F;  4IRH A;  4BY7 J;  3J7Y J;  4HBL A;  2RQQ A;  5J40 A;  2VBZ A;  3FXQ A;  3RKW A;  4LB6 B;  4II3 A;  1XCV A;  4DZJ A;  4ZYG A;  3WTY C;  1OCR H;  4PJM A;  3BT9 A;  2JWT A;  4YG2 F;  4AVP A;  1J09 A;  5DM6 F;  1TBX A;  3ERM A;  5KHD A;  2AQE A;  3MZH A;  1SVO A;  4GGG A;  2LFB A;  4II2 A;  1R9T J;  3DWL E;  1TTY A;  2V1U A;  1UST A;  5GAD J;  2IT0 A;  1FPQ A;  2WA0 A;  3H0G J;  1V5E A;  1AHD P;  3TDU C;  1MW7 A;  2DW4 A;  1ZR4 A;  2Y75 A;  3DPU A;  2CQK A;  2VBW A;  2CFO A;  4BHP A;  3U21 A;  2HWV A;  3HEF A;  2NVQ J;  3BLY A;  2Y9Z A;  1LEA A;  1IUY A;  2OZ6 A;  2AXL A;  3C2H A;  4ZZL A;  5AIQ A;  3V7S A;  2D5V A;  2M8G X;  2VKH A;  3A01 A;  1WJC A;  3ML6 A;  1R1U A;  2W4S A;  5F0C A;  4CZC A;  3K1P A;  3WU0 A;  2PJP A;  5K5O A;  2R5Y A;  5FRM A;  3G73 A;  2ZO4 A;  1E3P A;  4PGG A;  4XLF A;  4CA0 A;  1UHS A;  5A2Q Z;  2LTP A;  3TW6 A;  3ZQ7 A;  3JSO A;  4BDZ A;  4OIQ F;  1ORK A;  2XV4 S;  2WY8 Q;  3HG9 A;  2NVU B;  5D5V B;  5BPI A;  1VQ7 I;  3HSE A;  2K9N A;  2O6G E;  3E6M A;  1RC9 A;  3KX2 A;  3AG3 H;  3PQJ A;  1POG A;  2KIM A;  3QP6 A;  5HDG A;  2FOK A;  2ZBK A;  4JQF A;  1BC8 C;  4FX0 A;  3GFM A;  2FOW A;  2A69 F;  3E3V A;  3JTG A;  1LJ9 A;  2BHY A;  2YU3 A;  1W1W E;  2Y0M A;  2KIU A;  2NAZ A;  1PVE A;  2DFH A;  2JZY A;  3PO2 J;  5C4J J;  1E3H A;  4R79 A;  4XKB A;  1QRY A;  3E6B A;  4I76 A;  2PJR B;  5TJJ A;  1UCR A;  2IAI A;  2P8T A;  2XB0 X;  1SD7 A;  4RLQ A;  4ESB A;  4DYQ A;  1ZG5 A;  5ICC A;  2XKP A;  5CVJ A;  2VL8 A;  5CYV A;  4RBO A;  2CU7 A;  2VAS A;  3CCV I;  1K61 A;  3N4M A;  3QRF F;  2DCE A;  1ETV A;  3CJT B;  3BG9 A;  2NNN A;  5BPD A;  3GTM J;  3C1D A;  1FX7 A;  4CH7 A;  3TDZ C;  4M3G A;  1XC5 A;  2ZJQ F;  5IOY A;  1B1B A;  1G3Y A;  1K78 A;  1IXR C;  2O3F A;  4PJ0 C;  4IJA A;  1O3R A;  5F1R A;  3MKZ A;  3BPV A;  3VYU B;  3KZI C;  4HDV A;  2NNY A;  1OQY A;  4I6Z A;  1H9T A;  2FBH A;  2ELK A;  3O8G A;  3PUB A;  5LGT A;  5E1X A;  4HA8 A;  3V8J A;  3S2H J;  4XMY A;  2W48 A;  5J6X A;  1LNW A;  1G3S A;  4TV7 A;  1A6Q A;  4FAS D;  4UB6 C;  1NTC A;  3PO3 J;  4RGU A;  5B66 C;  3GX4 X;  1H8A C;  4HV5 A;  3E97 A;  3A2K A;  4B44 A;  1TT0 A;  2DOF A;  1WJ5 A;  2ZME B;  4Y15 A;  1T33 A;  2H1K A;  2OV7 A;  4CCK A;  2W1O A;  2LG4 A;  3I71 A;  2R7Q A;  3VB2 A;  3TMO A;  2WAQ A;  2R5Z A;  1WCM J;  2LP0 A;  1PP7 U;  3NWS A;  4HF2 A;  1VQ5 I;  2DMP A;  2HTJ A;  4E4H A;  1H88 C;  2V7F A;  3HZJ A;  5C4X J;  2KDO A;  3GEZ A;  1K83 J;  3FZV A;  2JVH A;  4PZJ A;  5LHG A;  3JRH A;  2VQC A;  5H6R A;  5BMZ A;  2UUZ A;  4LIV A;  1P6R A;  1UG0 A;  3L9F A;  3S1M J;  4FET A;  3WU2 C;  1VQ8 I;  2PFB A;  4CGZ A;  2EIN H;  5DCF A;  2CQX A;  2Z2S B;  1YOV B;  2XSD C;  3H3V K;  4HNU A;  3KEY A;  5ILS A;  1AWC A;  5JVG F;  1IG7 A;  2WV1 A;  3WE3 A;  3OYN A;  3EPZ A;  3FXR A;  5HS9 A;  2ZJ2 A;  3CC7 I;  2KDZ A;  4NC6 A;  3RIR A;  2VJ4 A;  1U78 A;  3GTQ J;  2V9K A;  5E8I A;  4B3X A;  3OYI A;  3P9I A;  4HNV A;  3CDL A;  1IZ1 A;  3COA C;  2O8X A;  5E3N A;  1OYY A;  4P55 A;  1R4N B;  5IP7 J;  1XMK A;  3K2Z A;  2CV1 A;  1VFC A;  1PUF B;  3S1R J;  3QYF A;  4M9X A;  1GV5 A;  1SFE A;  1I5Z A;  2JPB A;  2KP6 A;  5ERI A;  3JRD A;  1DU6 A;  2W84 A;  1HCR A;  1TL8 A;  2Z5U A;  2CH0 A;  2EIJ H;  3LWF A;  5K7F A;  2DTZ A;  3FK7 A;  1WH7 A;  2Q1Z B;  2NVY J;  2CW8 A;  1JKO C;  2L7Z A;  5LGU A;  4ASN A;  1YS6 A;  3T8R A;  4U87 A;  3F8C A;  3MKY B;  4FCY A;  2HKX A;  5EZG A;  2PI0 A;  1VQP I;  4CYC B;  2H27 A;  1R36 A;  1JTX A;  1WQ2 A;  5CPR B;  2ZKZ A;  3DXJ F;  3DTI A;  2X51 A;  4M9Z A;  3CDH A;  3C3W A;  1OR7 A;  1XD7 A;  1S5L C;  4XLC A;  5J8C A;  2WV0 A;  1Y0U A;  3A02 A;  3CUO A;  1R4M B;  3KEQ A;  1U8R A;  5FKL A;  3WG7 H;  1ZG3 A;  3H92 A;  2G7H A;  2H6B A;  1W5S A;  2GLO A;  2LMD A;  1UZC A;  2O03 A;  4JP0 A;  5BOX A;  3UR3 C;  3S93 A;  1B8I B;  5LRS A;  2HPM A;  3ABK H;  1WI3 A;  4UUS A;  4QPQ A;  3F6V A;  2FBI A;  2ZME A;  3I54 A;  4WXD A;  2CW0 F;  3W2A A;  2QWW A;  2HYG D;  5GPC A;  3I64 A;  2MAB A;  3K70 D;  1DPU A;  4B09 A;  3GZ5 A;  3MN2 A;  4AM3 A;  1ON1 A;  1WHU A;  4GYI A;  4XRS A;  2DA6 A;  1SAX A;  1VQ6 I;  1X1A A;  3KP4 A;  3F23 A;  2K5C A;  1A36 A;  1WJE A;  3TED A;  5E1Z B;  2BXZ A;  5HVQ C;  1S6L A;  3PNY A;  4OOI A;  3IV5 A;  4P9U A;  4X0G A;  3ZQI A;  2R7W A;  2NS0 A;  2E1C A;  3FX3 A;  3KP5 A;  3CCE I;  4EAT A;  3OR1 C;  4RAY A;  5CVR A;  4D9J A;  2VPL A;  3ASN H;  2QQ8 A;  1L3L A;  1YTY A;  1Z91 A;  3GTG J;  3CP8 A;  2A05 A;  2Q8K A;  2P5L C;  3S8P A;  2BVL A;  2P4W A;  3CC4 I;  2WY7 Q;  1WH5 A;  2JA5 J;  3L2W A;  2LBF B;  3DBH B;  1FTT A;  2DT6 A;  3A0H C;  2AO9 A;  1HBX G;  3ZP5 A;  2W00 A;  1ETO A;  5ILV A;  1CF7 B;  3AAF A;  2L7F P;  2BYV E;  2HS5 A;  4GFB A;  3RJP A;  3Q3S A;  3H5N A;  3TQN A;  3T1B A;  4UVA A;  2DOE A;  2F5D A;  2IBD A;  2KHM A;  4A3K J;  1DGW Y;  2PJR A;  1MH4 A;  2KKO A;  2NOJ B;  2F6C A;  1H0M A;  3Q0V A;  4QWQ A;  2RN7 A;  4IXA A;  5HOD A;  2J5P A;  3OYJ A;  2QYO A;  2JQ7 A;  2XGX A;  4I09 A;  3E5U A;  3VPR A;  4Q47 A;  3RKX A;  1QZE A;  1XCB A;  1KON A;  2QQA A;  4KMU X;  1JUP A;  4XLP F;  2L0K A;  4ZDP A;  2Q2E A;  2JRM A;  3C2G A;  3CES A;  3ROU A;  4XN3 A;  4G6Q A;  1HW5 A;  1EA3 A;  4AC0 A;  1R71 A;  4XQF A;  2CG4 A;  3H9Q A;  1LVA A;  3GZN B;  2QSH X;  4ZDL A;  2GOX B;  2F4M B;  3Q0W A;  3S2W A;  2FA5 A;  2E19 A;  1E2X A;  3LA7 A;  3P5J A;  4WXC A;  1BI0 A;  5BNG A;  2ME0 A;  1ZEL A;  2E1N A;  1ZGJ A;  2M34 A;  1ENH A;  3PL8 A;  3AG4 H;  3CCR I;  2HDC A;  3FHN A;  1UEL B;  4JYK A;  2AXT C;  1V54 H;  5DCM B;  1Q1V A;  3ZPL A;  1R1T A;  3IKV A;  4F91 B;  2H1L A;  4H0E A;  1KU9 A;  2EV6 A;  1R5G A;  3QQA A;  1VI0 A;  4HLX A;  4ESJ A;  1J7K A;  1W0T A;  2L4M A;  2XDV A;  3JRB A;  4LOC A;  1NHA A;  3KLO A;  1B4A A;  3RKQ A;  1MSF C;  2IJL A;  2VKE A;  2X4H A;  3HL2 A;  2H09 A;  3FIS A;  2XGD A;  4GYG A;  2Y0S N;  1MBG A;  4IHY A;  3PSI A;  1YS7 A;  3CZ6 A;  1GXQ A;  2KIS A;  3BG5 A;  2HYJ A;  2GZW A;  2WAE A;  3OYG A;  1K6O A;  3CUQ A;  2MBF A;  2ZXH A;  3D1N I;  4IO9 F;  4EGZ A;  3NQO A;  4LG0 B;  4WXH A;  1BR1 A;  4BBR J;  1SC7 A;  1F9N A;  1UHM A;  2K9L A;  2WAF A;  4UUT A;  4UXN A;  4QIW N;  2DAO A;  4HX7 A;  6PAX A;  3ESW B;  1E0E A;  2JRT A;  4MNU A;  4AID A;  1FJL A;  1J5Y A;  2IEK A;  4BDY A;  4A3L J;  2HKO A;  2QVO A;  4DOZ A;  2VOD A;  2LBF A;  4EGY A;  3DEW A;  3ZN0 A;  3WTT C;  3I3L A;  4JX6 A;  2E2I J;  4PJL A;  2FD5 A;  3ABM H;  2LKP A;  1JJ6 C;  1I6X A;  3IP4 B;  2ACJ A;  2M3A A;  1ZLK A;  3LFU A;  4F3Q A;  5L3E A;  3K6G A;  2Z1D A;  3BQZ A;  2K27 A;  2BW3 B;  3ZMT A;  4HEA 2;  2LH9 A;  3RPU A;  4X6A J;  5L3G A;  5J8F A;  2JA6 J;  1ON2 A;  3R4K A;  4A0Y A;  3GLL A;  4OU0 A;  1QA6 A;  2FRH A;  2GM4 A;  2OUM A;  2DN0 A;  5H20 A;  3F21 A;  1FMW A;  2Q0O A;  1LDJ A;  2JJ7 A;  2XPV A;  3BR6 A;  3IC7 A;  4BH9 A;  2WAQ N;  5M5W J;  2EZL A;  4BBS J;  2XUB A;  2JT1 A;  1KQ0 A;  3HUG A;  2KZG A;  2MH9 A;  4BE1 A;  4PUS A;  3SFZ A;  4YIR X;  4IHW A;  1WKM A;  1SVL A;  1X1C A;  2ZXI A;  5GAG J;  4UUS B;  2IGM A;  1BR2 A;  2HPI A;  1QU3 A;  2V6E A;  2DYR H;  1MGT A;  4I98 B;  3C2B A;  2YR2 A;  2L9V A;  5EF6 A;  3QOD A;  1JJ8 C;  3IHU A;  1AA7 A;  2A61 A;  4A3M J;  2XF5 A;  3C18 A;  5EEG A;  3DBL B;  1G3T A;  4XOT A;  2ECC A;  2D45 A;  4PGH A;  3LA2 A;  2E34 A;  3A0B C;  1K78 B;  1I1S A;  1T0F A;  1FLI A;  3L2C A;  3ZXS A;  1GDT A;  3E5X A;  2KL4 A;  1SAU A;  3H35 A;  1MND A;  4S04 A;  2EFP A;  1ZRC A;  3MKL A;  3KP3 A;  3OOP A;  4CYC A;  4EJU A;  5J4V A;  1XPX A;  5FO5 A;  1TZL A;  3HC7 A;  3ZRG A;  1JUM A;  2STW A;  3HOZ J;  4PFP A;  4P1W A;  4AU7 A;  1J2X A;  3VEP A;  3D5S C;  4IRI A;  4D7M A;  3IWF A;  4CCN A;  3RYP A;  2LKX A;  4KNY A;  4V19 K;  1KU2 A;  3SZT A;  1HQC A;  4FQG A;  4QTR A;  3IH3 A;  3O8H A;  3QU6 A;  4Y7N J;  4BNC A;  2OQG A;  2WWY A;  4PJJ A;  2DYS H;  4OMY A;  4MO7 A;  1P92 A;  2EK5 A;  4DGW B;  4N4O B;  5L3F A;  5KNL A;  3GTO J;  3OMY A;  1RPW A;  1ZLJ A;  1FY7 A;  2MYS A;  5LGN A;  4UNO A;  2X1C A;  2OCC H;  1IC8 A;  5J1U A;  5ED4 A;  3BG6 A;  1KA8 A;  2XGC A;  3MCZ A;  3L7W A;  1HXD A;  2P81 A;  1Y8Q B;  4M3B A;  3M07 A;  3LNQ A;  2V79 A;  4IL6 C;  3AG2 H;  3F9K A;  3FIW A;  2MSY A;  3L2R A;  1UMQ A;  1YYV A;  4BY1 J;  1MBK A;  3HTS B;  3K10 A;  4NDL A;  3ELK A;  1R58 A;  2BBY A;  2VE8 A;  4E6K G;  2HOT A;  1V5F A;  4BS9 A;  3OYC A;  3KEO A;  1JI8 A;  3OIQ A;  3P9K A;  4ZYA A;  2Q2E B;  3ZQC A;  2FNA A;  3CDI A;  5K5Q A;  3G2B A;  1QNT A;  3QOP A;  4LLL A;  5IOZ A;  2AQF A;  2X48 A;  2E5Z A;  3AL0 C;  4BU2 A;  4CZZ A;  2QBY B;  3FK6 A;  3LMM A;  2HQA A;  3PFI A;  4C3H J;  1KYW A;  1D0Z A;  3BWG A;  2R7F A;  2Y69 H;  3HGG A;  5HDN A;  2YUS A;  2Y2Z A;  1TWG J;  3VYS B;  1QZZ A;  1ZKG A;  2ZSH B;  3VYR B;  1TWA J;  1C0W A;  2DJI A;  1FMV A;  3LSG A;  3K4K A;  2YPR A;  5EG0 A;  2LF8 A;  2HNH A;  1XX5 A;  1IRZ A;  1Z6R A;  2COM A;  3LFK A;  4ZTF A;  1VQ4 I;  4A6E A;  3CTA A;  5DUI A;  4A3D J;  4NNJ A;  4G6T B;  3RZD J;  1Y1W J;  1BIA A;  2V1D A;  5BS6 A;  2B7E A;  2FNP A;  4ZYH A;  3I4P A;  1RNL A;  2E71 A;  2F5V A;  2VPR A;  1P4X A;  2VC1 A;  3WG9 A;  1S8N A;  1YI2 I;  2VJI A;  3HM5 A;  3GUD A;  4E70 A;  3MZY A;  3HOY J;  2X6O A;  4L0Z B;  3F0C A;  1JT0 A;  3H5A A;  3OYE A;  3QOE A;  1T0F C;  1FIA A;  1HKS A;  2OU2 A;  1N75 A;  1REP C;  2DMU A;  2VBY A;  2MC3 A;  3GWZ A;  3L2U A;  1G6N A;  3REO A;  3V7R A;  1H89 C;  1RR7 A;  1W36 D;  3BR5 A;  4BQN A;  3MFK A;  3BY6 A;  3KP6 A;  3HXL A;  3EDP A;  3NAR A;  1F36 A;  4XBF A;  4KIT B;  5EGO B;  1HA8 A;  3SZG A;  2A6E F;  1LFB A;  4I7H A;  4DW6 A;  2R93 J;  4AD9 A;  2KMU A;  1O57 A;  2OQR A;  3DFG A;  4RB2 C;  2F5F A;  1YO5 C;  3I59 B;  1HDD C;  3PIO F;  1X4P A;  1X1D A;  2ZSI B;  3ZR8 X;  1RKW A;  3TBI A;  1IN7 A;  3T0Y A;  2HEO A;  1KQ9 A;  2JMW A;  1FYL A;  4MTD A;  1MDM A;  3HKZ N;  2XRN A;  2GXA A;  1V3F A;  2EJR A;  1XGN A;  2RRE A;  1XSX A;  4WX9 A;  3LQR A;  1N77 A;  1R6R A;  4A3B J;  3E7L A;  1S9H A;  2HZT A;  4DZP A;  1MKM A;  1FT9 A;  2UXN A;  4XLN F;  1I1G A;  1WRJ A;  4DJA A;  3S2D J;  1PUF A;  3DKX A;  2VQL A;  3HIF A;  3K1N A;  4YRV A;  1YIT I;  4LK1 F;  1AOY A;  4RGS A;  4A69 C;  5LD2 C;  1K79 A;  1YW9 A;  1ERD A;  1HDP A;  2XF6 A;  3F6O A;  5H6Q A;  2XAH A;  4HQE A;  1U2W A;  1YW8 A;  2VN2 A;  1TLH B;  1X2M A;  3EUH C;  2I8D A;  5KK1 A;  3E6C C;  2IGN A;  3M7G A;  4KJZ A;  4FHT A;  3UKG A;  2BHZ A;  2JUG A;  5FRN A;  1BI1 A;  2EFN A;  2O61 A;  4V2G A;  4U88 A;  2XVC A;  3MMY B;  3G71 I;  2CUJ A;  3ULQ B;  5B5E C;  1XGO A;  1IW7 F;  4RGR A;  1QGP A;  1YRN A;  1DQU A;  4M72 A;  1VQL I;  1X2N A;  3B73 A;  5M3F J;  4RB1 A;  3WHC A;  1SAN A;  5D5U B;  2E7X A;  5M5Y J;  4LFU A;  2RNG A;  5F1J A;  1A04 A;  4YIF A;  4M9S A;  2O5R A;  2A3S A;  2MG4 A;  1KYZ A;  5DS9 A;  3S3O A;  3TKY A;  2KPM A;  3HDD A;  4A93 J;  1O3S A;  2K3P A;  5E18 F;  3DV8 A;  2BEO A;  2X1E A;  2MFZ A;  4H4K C;  2EFO A;  4I0A A;  3ZN1 A;  1R5H A;  2IA2 A;  2LRE A;  3RDI A;  4F93 B;  1U3E M;  4A3G J;  1O3T A;  1XB4 A;  3V42 A;  3I55 I;  2E1O A;  2LLK A;  2D1V A;  4UV8 A;  2DMQ A;  1BN5 A;  2DXI A;  4O5V A;  3W6V A;  2ID3 A;  4PK4 A;  5FFX A;  3MD2 A;  1ZK8 A;  3OS2 A;  1KGS A;  3V7C A;  4U7B A;  1YJN I;  4M3F A;  5KAF C;  4B43 A;  5CVV A;  2X6Y A;  5IT3 A;  5C44 J;  2JN6 A;  3JAM K;  3UNG C;  2I5U A;  3GO5 A;  3AKZ A;  3BG7 A;  1X3W B;  3G1M A;  3A03 A;  1BBY A;  4HX8 A;  2PMH A;  4LK0 F;  4XIC A;  3OYA A;  1D5V A;  2K7L A;  4ENN A;  5A2Q K;  2K4J A;  1PP8 F;  2IA0 A;  3HOS A;  3IAM 2;  1SVM A;  3U2R A;  3S16 J;  4ETS A;  2HR3 A;  1LE8 B;  4RDU A;  4L9V A;  2UZK A;  2V26 A;  4XRM A;  1E3O C;  1ONV A;  1XTA A;  2K02 A;  3GZ6 A;  2MH2 A;  1MBE A;  1IDY A;  3W3C A;  2QKL B;  3ZQF A;  2MA3 A;  3DBR B;  3D0S A;  4KIF A;  4FX4 A;  2K9M A;  1OIS A;  1W5C C;  1P7I A;  2ZB9 A;  5HOO A;  2STT A;  3DTK A;  1U8B A;  3EQL F;  5EZH A;  3S3M A;  1OCC H;  3EYI A;  4M73 A;  3MEX A;  5H2F C;  3W2V A;  2DDB A;  1XGS A;  3AG1 H;  3HHG A;  2DOA A;  5DTD A;  5L3D A;  4J00 A;  4KMF A;  4UHT A;  2ISY A;  1LVK A;  2ZXW H;  4AIH A;  4D1Q A;  2IS4 A;  1B59 A;  4CSW A;  4KN7 X;  1GV2 A;  3BR3 A;  2R7U A;  1BC7 C;  5AIP A;  3DLA A;  3IWZ A;  1JT6 A;  1TQM A;  2M30 A;  3OYH A;  3SJM A;  1NG7 A;  4MFD A;  1VQN I;  4OMZ A;  1HLV A;  4MLO A;  1FOY A;  2XAQ A;  4NQW B;  5EDN A;  1W4M A;  1MMG A;  5CLS A;  3BRO A;  2R5Y B;  3O3K A;  1FOK A;  4OAZ A;  4U0V A;  4HRI A;  1FEX A;  4HF0 A;  4HOB A;  3WTW C;  4IZZ A;  2XPW A;  2NS8 A;  3JTH A;  4UB8 C;  2ECB A;  3HPG A;  1BR4 A;  3I53 A;  3A01 B;  2K3F A;  4M3D A;  1HOM A;  1OKR A;  1Z3Y A;  2D2W A;  2VQH A;  1OMI A;  2XRL A;  3HSR A;  1FOX A;  3BTL A;  4BQQ A;  3KE2 A;  1IXS B;  1NK3 P;  2VXD A;  3L2V A;  3FM3 A;  1WJD A;  2WB1 A;  5M5X J;  4U0W A;  3Q0U A;  2R7Z J;  1OFC X;  2JTV A;  4XOP A;  4L0Y B;  1XSD A;  5IY5 H;  3AL0 B;  2ZME C;  1U5T B;  2VQG A;  3E0J B;  5F0H A;  1T95 A;  1ZR2 A;  3EYY A;  3CCY A;  1J59 A;  1QHG A;  3F8M A;  3WHB A;  4B47 A;  2DU9 A;  3G3Z A;  2JSC A;  2DA4 A;  2UXX A;  3KFW X;  1ODD A;  2W57 A;  1J75 A;  4IOA F;  3KPH A;  3LL7 A;  2CRG A;  2HYF A;  1V5G A;  2P0W A;  2EPF A;  1X1P A;  2H8W A;  3BPX A;  3ZQL A;  1SFO J;  2CV0 A;  2HOA A;  5K5R A;  4G8X A;  1TQP A;  2F4O B;  3H9J A;  1B9N A;  3BR2 A;  3TOA A;  3JCU C;  4G7O F;  1GVJ A;  2AHQ A;  3GME A;  3OYD A;  3KYC B;  1P7J A;  4XRS G;  4K2E A;  3TGN A;  2K85 A;  2KJC A;  4RGX A;  2FUG 2;  3L09 A;  1HW1 A;  2EH3 A;  2WC2 A;  2CQQ A;  2RKH A;  3DEU A;  4JX4 A;  2VON A;  2R7X A;  1IRF A;  2W82 A;  4HG2 A;  2GIV A;  3TOB A;  3BJ6 A;  1IO2 A;  5FLX Z;  2VB6 A;  1KU7 A;  3LST A;  3V4G A;  2PQ8 A;  5TIS C;  1WJB A;  1PYV A;  4BEH B;  1WJF A;  3SHF A;  2DDA A;  2QKM B;  4IF4 A;  2HVS A;  2IXS A;  4O3M A;  1YG2 A;  2NVT J;  1JUS A;  4EJO A;  3S1Q J;  1F1Z A;  2ZNZ A;  5GP9 A;  5EEH A;  3CCM I;  1FSE A;  1YHQ I;  1MBF A;  2PMU A;  4E7K A;  3EET A;  3U1K A;  5HLT A;  2B9S A;  2XHK A;  4EQQ A;  5FGM A;  4CCL A;  3L00 A;  1I3Q J;  2TRT A;  3GF2 A;  3S32 A;  4BXF A;  4WF2 A;  1A31 A;  4IQJ A;  3ZMU A;  3KYL A;  1UHW A;  1D0Y A;  2XPU A;  4W1U A;  1LDK B;  2BE5 F;  3QYE A;  5C3E J;  2VJJ A;  5TGT A;  5GTH C;  3K4J A;  4IVN A;  3ECH A;  1JKR C;  2E5N A;  3K4C A;  4CCM A;  4MHG A;  5E3L A;  1YFH A;  3GXO A;  1ZHF A;  3BTJ A;  1GHC A;  2WB1 N;  5IPA A;  3VOD A;  3BC8 A;  1D3Y A;  4HDU A;  3DU6 A;  3QWL A;  1OR7 C;  5CKT A;  2EA2 A;  1OJL A;  3VOE A;  1DPR A;  5LRR A;  4HZF A;  4AUX A;  3JRI A;  1EF4 A;  4EVI A;  2HVR A;  2P5K A;  5HS7 A;  1IXC A;  2FEZ A;  1Z7U A;  1WSU A;  4LD5 A;  5FRO A;  3CF2 A;  1IN8 A;  1I50 J;  3T8T A;  5E17 F;  2YX4 A;  1D0X A;  2EIK H;  1I6H J;  4MTE A;  1K7A A;  3BZK A;  4RAZ A;  2L7K A;  3WTU C;  4ABZ A;  2IS1 A;  2M9H A;  1IRX A;  2XKO A;  1ZGW A;  1S7A A;  4IHS A;  5JLW A;  4LIT A;  4CUG A;  4YFN F;  2MGQ A;  2P7V B;  5D8K B;  3VSL A;  3ZMZ A;  5AON A;  3KZZ A;  2QSF X;  4Q4Z F;  5D6F A;  1D1B A;  3KP2 A;  1VQO I;  1G59 A;  3RCO A;  1RZ4 A;  5IT9 K;  1QHH D;  1VND A;  4A3J J;  1EH7 A;  3WGG A;  3JRG A;  3FXU A;  4WCG A;  1PJR A;  2VKD A;  4G12 A;  3HOX J;  1LB2 A;  1ETY A;  2O9L A;  1JXS A;  2V4J C;  5D5W B;  4RS8 A;  3BCB A;  4YII A;  2EIL H;  2M4K A;  2CQN A;  2DA5 A;  2L54 A;  3BTC A;  2X1D A;  3DLL F;  2L01 A;  1RET A;  1HF0 A;  3ZMV A;  5E3M A;  2CGP A;  2MLK A;  1RR8 C;  1MBJ A;  5IYD J;  4Y4R A;  1SFK A;  2G9W A;  1GXP A;  4ZJZ A;  1WZ2 A;  2BZT A;  1BW5 A;  5D8L B;  1T56 A;  4ZDO A;  2MD5 A;  3SEZ A;  1KU3 A;  2M4G A;  1QBJ A;  1TP4 A;  5LEJ A;  1Z9C A;  5K7H A;  2R0Q C;  2QQ9 A;  4BHC A;  2FQ4 A;  4C3I J;  2K40 A;  2A68 F;  4GXO A;  4V2F A;  2DA1 A;  3G1L A;  2IS6 A;  1STZ A;  1RI7 A;  4XK4 A;  3D5R C;  2UWM A;  1D8J A;  1QZY A;  1Z0X A;  4BUP A;  1XS9 A;  1B72 A;  1IDZ A;  4I2O A;  1YW7 A;  2IGK A;  1ETW A;  1OPC A;  3I56 I;  1QVT A;  4C2M J;  3S17 J;  1OYI A;  2FXA A;  1IUF A;  4IPA A;  4OIP F;  2DQR A;  3Q9S A;  1ZYR F;  2M7A A;  5JR3 A;  3ABL H;  3HKZ A;  1O4X A;  4OIN F;  5E79 C;  1U5T C;  2VOP A;  4HNT A;  1LDD A;  3OYL A;  3RPQ A;  1GVD A;  4MEY F;  1IJW C;  2ETH A;  1OLT A;  3J7A Y;  4G7Z F;  3M8E A;  1X1B A;  3RKY A;  3OSG A;  4YFK F;  2QEX I;  3CC2 I;  1Z1D A;  2ADU A;  3B6C A;  1VQK I;  1BL0 A;  1D5Y A;  2FML A;  2LY1 A;  4FT8 A;  3BR1 A;  3C7J A;  1T38 A;  1T6S A;  4KIC A;  1IF1 A;  3PSF A;  2K9Q A;  1TW3 A;  4BE0 A;  1LFU P;  1QQI A;  5FKO A;  3I0T A;  1K4T A;  1B6A A;  2L5Q A;  3GTJ J;  5LHI A;  2EZH A;  3S1N J;  2GQQ A;  4AIK A;  1T39 A;  4L9T A;  4A2U A;  4M71 A;  2V9V A;  5GAH J;  3PIP F;  4BQO A;  2XF7 A;  1NK2 P;  1Z77 A;  5HDK A;  2E1M B;  2MC4 A;  4IOC F;  2PBI A;  4MQV A;  3LSI A;  4HPQ A;  2CW7 A;  2FBK A;  3FWE A;  4LMY A;  1N78 A;  3K7A J;  3ZCO A;  3ZGK A;  3FHZ A;  1JTY A;  4DIQ A;  2TCT A;  4Y13 A;  3ZMD A;  1ZG1 A;  3HRS A;  3GTP J;  1CQT A;  3OYB A;  1ZRF A;  3R61 A;  3TO9 A;  3OS0 A;  2DMN A;  3IH2 A;  3CP2 A;  1AKH B;  3VSK A;  1Y56 A;  2GIZ A;  4MGR A;  2B63 J;  1XGM A;  5KAI C;  3J7A O;  1L0O C;  2W25 A;  3GVA A;  3E1S A;  1HST A;  4G6D A;  1Z67 A;  4GRI A;  3CO6 C;  3PQK A;  2GBY A;  1FBQ A;  3DU5 A;  4RA2 A;  3KCC A;  1S72 I;  1G8X A;  4C2T A;  5CVI A;  4L18 B;  3ZQG A;  2HU9 A;  5F64 A;  5J1R A;  2W85 A;  1PUE E;  1X19 A;  2F4I A;  3CME I;  5K7Z A;  4XKC A;  1G2H A;  2HZD A;  3K0L A;  2KZV A;  5F27 A;  3KIO A;  5HLH A;  3HOU J;  2DK5 A;  2ZFW A;  1Z05 A;  4MFE A;  4XLH A;  3FXL A;  1FYK A;  1XSV A;  3T5X A;  2DA2 A;  2HI3 A;  3MZ8 A;  4P96 A;  2KT0 A;  2IGO A;  2HOE A;  4KT6 A;  2NOG A;  1DGR M;  5E20 A;  2XAU A;  2QSG X;  4PJN A;  2F5C A;  3CJN A;  4GDF A;  4MIM A;  3HOW J;  5EG0 B;  2V1N A;  3FMQ A;  3SEQ A;  5FJ8 J;  1FOW A;  3Q5F A;  4U0Y A;  3Q9V A;  4AYB N;  4ZZD A;  2V9P A;  2XAG A;  3CMM A;  3K9T A;  1SD6 A;  2PX9 A;  4IHV A;  3ISP A;  3I4N J;  1FIP A;  1BIB A;  2R7D A;  3BOQ A;  5ICE A;  3G6E I;  1P4A A;  1ACI A;  3I4M J;  1U5T A;  2BVM A;  4UUV A;  3E6D A;  3F3X A;  3JAM Z;  3OV8 A;  2EWN A;  1PDN C;  3RQ4 A;  1USS A;  2ICW G;  4WWC A;  3PFY A;  3JRF A;  2JVG A;  4ENM A;  4PDK A;  1ITY A;  3H9G A;  2G0E A;  1T08 B;  2M0M A;  4RAF A;  1EV7 A;  1GT0 C;  4EM2 A;  1WWX A;  2XAS A;  4ZTJ A;  1UG2 A;  4EV0 A;  1MZB A;  4B48 A;  1SD4 A;  2QM3 A;  2CS3 A;  1ZAR A;  2YX7 A;  1MDM B;  2ID6 A;  1P4W A;  2EBI A;  5DD8 A;  1U9O A;  3LA3 A;  5DCM A;  3SDG A;  2DFE A;  1R49 A;  3DTE A;  4S05 A;  2NRA C;  2FMY A;  2GA1 A;  3HOV J;  5LEK A;  1F4K A;  3IUO A;  4PSX A;  2PG4 A;  3R6S A;  2FQ3 A;  3DEE A;  5B3S H;  5HNH A;  3PM1 A;  3K4L A;  2VIX A;  3U1D A;  2CUF A;  1UJ8 A;  2LF7 A;  3ERE D;  1S7E A;  5EGO A;  2CUE A;  1V4R A;  1ZH5 A;  2VLA A;  5E3O A;  5FLV A;  3OYM A;  9ANT A;  2LVS A;  2Y9Y A;  4EM0 B;  4BJ6 C;  3LSP A;  2HOS A;  4E7J A;  4IX7 A;  1FNN A;  2EZI A;  3O6B B;  4XN0 A;  2CQ7 A;  3BJA A;  4IEJ A;  1S7O A;  1TW2 A;  2Y0S A;  4N4N B;  1LUJ B;  5CQG A;  1Z21 A;  3R0J A;  5IT9 Z;  2F2E A;  3I58 A;  2BGC A;  2L9N A;  3DP7 A;  2R7R A;  1W0U A;  4OWR B;  4B4C A;  2FF4 A;  4JX5 A;  3BDD A;  4OIR F;  4XKV A;  2X6W A;  3WGI A;  1Q1H A;  3RTR A;  1R7J A;  1Z6T A;  2YS9 A;  2BY0 A;  1EH6 A;  1FBU A;  4XNF A;  4E7L A;  3J80 Z;  3RZO J;  2QF7 A;  2OF7 A;  2MLG A;  4BQA A;  4KIS A;  4HSR A;  1TT5 B;  4M3E A;  2IA1 A;  3TP0 A;  4I0B A;  3RQI A;  1OCZ H;  2DFF A;  4DBR A;  3HHH A;  3NRV A;  3OYK A;  1ETQ A;  2RQP A;  4JBA A;  1H9G A;  5JFR A;  2DI3 A;  5KCM A;  3K4B A;  1Y6I A;  5HLI A;  3QP5 A;  1XMX A;  4D7N A;  3CCJ I;  4YEL A;  1I27 A;  1LEB A;  1KQ8 A;  1ZAO A;  4XR6 A;  1MMN A;  1QVU A;  3LSJ A;  5ICG A;  5GPA A;  3J81 K;  1O7L A;  4U7D A;  2N8G A;  4BYY A;  4BE2 A;  5IYC J;  2RNJ A;  2HXO A;  3A4C A;  3AFH A;  4NUB A;  4F7Z A;  2CWE A;  1G3W A;  4G94 A;  4F52 A;  4Q5S F;  2DK8 A;  2VXZ A;  2E1M C;  2HQ5 A;  4A12 A;  1HKT A;  4RM3 A;  3V8L A;  2KIF A;  4B3A A;  2WTE A;  3IKT A;  3PJR A;  2QQB A;  3WGH A;  1UFM A;  2FU4 A;  4LJZ F;  3V8K A;  3MKW B;  1R22 A;  4RLF A;  2E2H J;  3R60 A;  2DTR A;  1JKQ C;  2KRF A;  5JHF A;  2RDP A;  5F0F A;  4ITV A;  2DPU A;  5EEA A;  1RES A;  1F5T A;  3G1O A;  3SXY A;  3CCU I;  1BOB A;  1YRN B;  3KLN A;  3S14 J;  2P6S A;  3FKI J;  5L3C A;  2KIQ A;  2OA4 A;  1D1C A;  4BJ5 C;  1RRJ A;  5EYR A;  4JOM A;  4HF1 A;  3BQY A;  5JI6 A;  4E7H A;  4B1R A;  2VI6 A;  2GA2 A;  3OY9 A;  3NWT A;  2RV8 A;  4L5E A;  1QPM A;  2B0L A;  5EJC A;  2XAJ A;  3OWT A;  4LIU A;  2DQL A;  1JGG A;  4LG0 A;  2F48 A;  1K4S A;  1U9N A;  1O7F A;  1JHH A;  4DQ2 A;  1E17 A;  2LDU A;  3CUQ B;  4OIO F;  1HC8 A;  1YJW I;  4E7Z A;  3BG3 A;  4J01 A;  2OTL I;  4XOR A;  4WK8 F;  3W2W A;  2BOL A;  3O2P E;  1UB9 A;  3X2Q H;  1FTZ A;  1X3U A;  2VJ5 A;  2LYC A;  1N25 A;  2Y30 A;  3BCA A;  2H8R A;  2L7M P;  5DEQ A;  3RYR A;  2R7T A;  4XLA A;  3LAJ A;  4O6J A;  2RC4 A;  1ZTR A;  3FXM A;  4LGW A;  5CVU A;  2DLL A;  2W7N A;  3CCS I;  3FBN B;  5DDG A;  5GTI C;  3LQQ A;  1EKE A; 
#chains in the Genus database with same CATH homology
 4ENK A;  1O3Q A;  3F72 A;  3SZP A;  2DT5 A;  3FMR A;  4MQ9 F;  4UVC A;  5DV5 A;  5ILU A;  1FSH A;  4CHU A;  3GFJ A;  4R8H A;  3MWM A;  4ON0 A;  2V1X A;  2EV0 A;  2RVC A;  4LLG F;  1RIO H;  5FD6 A;  2Z3Y A;  1EH8 A;  2VC0 A;  2EFW A;  1FYM A;  5K1Y A;  4Q48 A;  2K4B A;  4P5O A;  2EB7 A;  2YSR A;  3QU3 A;  1ULY A;  4M6X A;  4P9F A;  2D1H A;  2L4A A;  4L5J A;  4MEX F;  5F6F A;  3GLX A;  3WU1 B;  2LSO A;  4CIC A;  2OBP A;  1BM9 A;  2L3D A;  1D8K A;  2VT3 A;  3MAJ A;  3BZ6 A;  2TDX A;  5D4S A;  2HQR A;  2EV5 A;  2QLZ A;  1G4D A;  2H6C A;  2HFH A;  2M1B A;  2IVM A;  4XSX F;  1J9I A;  3JW4 A;  5D6E A;  2EA4 A;  5DYM A;  2M87 A;  3BP8 A;  3IL2 A;  1HKQ A;  5TRD A;  2VE9 A;  1MJA A;  2IRF G;  2P6T A;  2QBY A;  2ELH A;  5DD4 A;  3GYH X;  1SD5 A;  3RI4 A;  4HX4 A;  4ESF A;  1BI2 A;  4PCQ A;  4Z2Y A;  3HRT A;  4ZH4 F;  1MJ9 A;  3DKW A;  5CJ9 A;  2H94 A;  1W5T A;  1ZRD A;  2RGV A;  3FM5 A;  4HAM A;  1XMA A;  1VTN C;  1IRG A;  4CYD A;  4KT5 C;  3WOD F;  1R00 A;  3E5Q A;  3P9C A;  2FE3 A;  1JHF A;  4ZYE A;  2A6H F;  4LLN A;  3R0A A;  4DNC A;  3CO7 C;  4D0P A;  3DPL C;  1JGS A;  4G9Y A;  1SFX A;  5JHU A;  4ZYD A;  4IHT A;  3HOT A;  2VOO A;  1IN4 A;  4HV6 A;  2A07 F;  3HYI A;  4EJW A;  5HLG A;  1R23 A;  2XRO A;  2Z99 A;  3IRR A;  5D4R A;  1T98 A;  2ZCW A;  3QPH A;  5FLX K;  1TNS A;  2KJB A;  4KFC A;  1CGP A;  4I01 A;  5LHH A;  4ENJ A;  3H3Z A;  3GW2 A;  1QO0 D;  4A0Z A;  4GCV A;  1S29 A;  2GWR A;  1WI9 A;  4HYE A;  2M45 A;  2GXB A;  2CFX A;  3TO6 A;  4YFX F;  2Z9O A;  3NEU A;  1OYW A;  3F22 A;  4B8X A;  5KVR A;  3H3U A;  3DQV C;  3DF8 A;  3WE2 A;  1YQA A;  1IAW A;  2DO7 A;  3F8N A;  5E1W A;  2PN6 A;  3W6J B;  4A5M A;  1FWZ A;  4KYW A;  4N0B A;  3EUH A;  4UV9 A;  3QPT A;  3WTV C;  4Y17 A;  2AS5 F;  4LB5 A;  4EJT A;  4A0X A;  3SQN A;  1IN6 A;  3P7N A;  5FD5 A;  1IN5 A;  4EMS A;  3MQ0 A;  3KET A;  2A5Y B;  2ESN A;  1DP7 P;  4XSZ F;  4M74 A;  3ECO A;  4L9N A;  4KUM A;  4HQM A;  2L02 A;  1W7P A;  4QLC U;  1SMT A;  1J0R A;  4KIB A;  2QEN A;  1XDS A;  2E7W A;  4NQW A;  4I02 A;  2OAZ A;  3FMS A;  2IPQ X;  4L5I A;  4UVB A;  5LLQ A;  1BI3 A;  1U6G A;  3CUQ C;  3FF5 A;  2JPC A;  2QZ8 A;  1FP2 A;  1FZP B;  2X0L A;  2J5O A;  4XRF A;  1S3J A;  2W24 A;  2HTS A;  2F5E A;  2IW5 A;  1BJA A;  1T2K A;  3M1E A;  3QAH A;  5BQT A;  4IRG A;  5ICF A;  4BAY A;  3ABU A;  2V6C A;  1TQI A;  2GAU A;  1JE8 A;  1RUN A;  2NYX A;  3F8B A;  2G7U A;  1BOA A;  4BXU A;  2CO5 A;  2FSW A;  4N9I A;  3ZMS A;  5FFZ A;  2OZU A;  2QUF A;  1HW2 A;  2P7C B;  2GXG A;  2VT2 A;  3F8F A;  1XDU A;  4CO8 A;  3K1M A;  4RB0 A;  1DDN A;  2M5W A;  2XIG A;  4RB3 C;  5LBQ A;  2PEX A;  5FB2 A;  4G7H F;  5DUK A;  2DPD A;  2ISZ A;  1FC3 A;  2DFI A;  2ESH A;  3HSF A;  1CF7 A;  2R3S A;  1ZN2 A;  2P5V A;  2HGC A;  2ZXJ A;  4EJV A;  1YIO A;  3JSP A;  1B9M A;  3WTX C;  3J80 K;  2PLY A;  4AIJ A;  3D5L A;  4N9H A;  1ZRE A;  3W6K B;  2C6Y A;  2Y48 A;  4KN4 X;  1FBS A;  3WTZ A;  3HRM A;  1HSJ A;  3LAP A;  2OD5 A;  4CDG A;  1MJB A;  3DPT A;  2CSO A;  2M8E A;  4HLY A;  3IRQ A;  3GFL A;  3KP7 A;  3J81 Z;  4KA4 A;  2O0Y A;  5E8G A;  1P2F A;  5HS8 A;  4KDP A;  4CXF A;  3VFZ A;  1R1V A;  1XN7 A;  2ZNY A;  3U9G A;  3M9A A;  3GFI A;  2LNB A;  1W7P B;  2XAF A;  1RUO A;  3BJO A;  4NHJ A;  5D5X B;  4HW0 A;  3ABT A;  5JVT A;  3KZY A;  3B02 A;  4NB5 A;  1SFU A;  3I59 A;  1YLF A;  3I5U A;  4A6D A;  3M8F A;  1W7P D;  3WTS C;  3TO7 A;  1MD0 A;  2Z33 A;  4EM1 A;  2HQN A;  3HTU A;  3HRU A;  4GO1 A;  4JK1 X;  5L3B A;  1ZGA A;  1DUX C;  4R1H A;  2BV6 A;  2CYY A;  3K69 A;  4A5N A;  2DBB A;  3N97 A;  4KIG A;  4BHB A;  2K86 A;  4L9J A;  4M6Y A;  1LQ1 A;  3CLO A;  2IP2 A;  2EFQ A;  2VBX A;  1TNT A;  1FP1 D;  1SMY F;  4IRH A;  4HBL A;  2VBZ A;  3FXQ A;  3RKW A;  4LB6 B;  1XCV A;  4ZYG A;  3WTY C;  4YG2 F;  4AVP A;  1TBX A;  3MZH A;  4GGG A;  1TTY A;  2V1U A;  1UST A;  2IT0 A;  1FPQ A;  3TDU C;  2DW4 A;  2Y75 A;  2CQK A;  2VBW A;  4BHP A;  2HWV A;  1LEA A;  1IUY A;  2OZ6 A;  2AXL A;  4ZZL A;  5AIQ A;  3V7S A;  3ML6 A;  1R1U A;  3K1P A;  3WU0 A;  2PJP A;  5K5O A;  3G73 A;  2ZO4 A;  4PGG A;  1J59 A;  5A2Q Z;  3ZQ7 A;  3JSO A;  4OIQ F;  2XV4 S;  5BPI A;  5D5V B;  2O6G E;  3HSE A;  3E6M A;  3PQJ A;  2KIM A;  3QP6 A;  5HDG A;  2FOK A;  2ZBK A;  4JQF A;  1BC8 C;  4FX0 A;  3GFM A;  3E3V A;  2A69 F;  3JTG A;  1LJ9 A;  2YU3 A;  2Y0M A;  2KIU A;  2NAZ A;  2JZY A;  4R79 A;  3E6B A;  5TJJ A;  1UCR A;  2P8T A;  1SD7 A;  4ESB A;  1ZG5 A;  5ICC A;  2XKP A;  5CVJ A;  5CYV A;  3N4M A;  3QRF F;  5BPD A;  2NNN A;  3C1D A;  1FX7 A;  3TDZ C;  1B1B A;  1G3Y A;  1K78 A;  1IXR C;  2O3F A;  4IJA A;  1O3R A;  5F1R A;  3BPV A;  4HDV A;  2NNY A;  1H9T A;  2FBH A;  5LGT A;  5E1X A;  4HA8 A;  3V8J A;  5J6X A;  1LNW A;  1G3S A;  4TV7 A;  4RGU A;  3GX4 X;  4HV5 A;  3E97 A;  4Y15 A;  2ZME B;  3I71 A;  3VB2 A;  1PP7 U;  4HF2 A;  2HTJ A;  3GEZ A;  3FZV A;  4PZJ A;  5LHG A;  5H6R A;  5BMZ A;  1P6R A;  3L9F A;  2PFB A;  4CGZ A;  5DCF A;  5ILS A;  1AWC A;  3WE3 A;  3FXR A;  5HS9 A;  2ZJ2 A;  3RIR A;  1U78 A;  5E8I A;  3P9I A;  1IZ1 A;  3COA C;  2O8X A;  1OYY A;  4P55 A;  1XMK A;  3K2Z A;  4M9X A;  1SFE A;  1I5Z A;  2JPB A;  5ERI A;  2W84 A;  2Z5U A;  3LWF A;  5LGU A;  4ASN A;  1YS6 A;  3T8R A;  3F8C A;  2HKX A;  2PI0 A;  2H27 A;  1R36 A;  1WQ2 A;  2ZKZ A;  3DXJ F;  4M9Z A;  3CDH A;  3C3W A;  1OR7 A;  1XD7 A;  5J8C A;  2WV0 A;  1Y0U A;  3CUO A;  3KEQ A;  1U8R A;  1ZG3 A;  3H92 A;  2G7H A;  2H6B A;  1W5S A;  2O03 A;  5BOX A;  5LRS A;  3F6V A;  2FBI A;  2ZME A;  3I54 A;  4WXD A;  2CW0 F;  2QWW A;  2HYG D;  3I64 A;  1DPU A;  4B09 A;  3GZ5 A;  1ON1 A;  4GYI A;  1SAX A;  3KP4 A;  3F23 A;  5E1Z B;  5HVQ C;  1S6L A;  4OOI A;  4P9U A;  2E1C A;  2NS0 A;  3FX3 A;  3KP5 A;  4RAY A;  5CVR A;  1L3L A;  1YTY A;  1Z91 A;  2Q8K A;  2P5L C;  2P4W A;  1HBX G;  3ZP5 A;  5ILV A;  1CF7 B;  3AAF A;  2BYV E;  2HS5 A;  3RJP A;  3TQN A;  3T1B A;  4UVA A;  2F5D A;  2KKO A;  1H0M A;  4QWQ A;  2RN7 A;  4IXA A;  2J5P A;  2QYO A;  2XGX A;  4I09 A;  3E5U A;  4Q47 A;  3RKX A;  1XCB A;  2QQA A;  4KMU X;  4XLP F;  2Q2E A;  3ROU A;  4G6Q A;  1HW5 A;  2CG4 A;  1LVA A;  3S2W A;  2FA5 A;  4WXC A;  1E2X A;  3LA7 A;  1BI0 A;  2E1N A;  1ZGJ A;  2HDC A;  5DCM B;  3ZPL A;  1R1T A;  3IKV A;  4H0E A;  1KU9 A;  2EV6 A;  1R5G A;  4HLX A;  4ESJ A;  1J7K A;  2L4M A;  1NHA A;  3KLO A;  1B4A A;  2IJL A;  2X4H A;  2H09 A;  4GYG A;  1YS7 A;  1GXQ A;  2GZW A;  1K6O A;  3CUQ A;  2MBF A;  4EGZ A;  3NQO A;  4LG0 B;  4WXH A;  1F9N A;  1UHM A;  4UXN A;  2DAO A;  4HX7 A;  6PAX A;  2JRT A;  4MNU A;  1J5Y A;  2HKO A;  2QVO A;  2VOD A;  4EGY A;  3ZN0 A;  3WTT C;  2LKP A;  1I6X A;  2ACJ A;  1ZLK A;  5L3E A;  2K27 A;  3ZMT A;  3RPU A;  5L3G A;  5J8F A;  1ON2 A;  3R4K A;  4A0Y A;  4OU0 A;  2FRH A;  5H20 A;  3F21 A;  2Q0O A;  3IC7 A;  1LDJ A;  4BH9 A;  2XUB A;  2JT1 A;  1KQ0 A;  3HUG A;  2MH9 A;  3SFZ A;  1WKM A;  1MGT A;  4I98 B;  2YR2 A;  3IHU A;  2A61 A;  3C18 A;  5EEG A;  1G3T A;  2D45 A;  4PGH A;  3LA2 A;  1K78 B;  1I1S A;  1T0F A;  1FLI A;  3L2C A;  3E5X A;  4S04 A;  2EFP A;  1ZRC A;  3KP3 A;  3OOP A;  4EJU A;  5FO5 A;  2STW A;  1J2X A;  3VEP A;  4IRI A;  3IWF A;  3RYP A;  4KNY A;  1KU2 A;  3SZT A;  1HQC A;  3QU6 A;  4BNC A;  2OQG A;  2WWY A;  4OMY A;  1P92 A;  2EK5 A;  5L3F A;  1ZLJ A;  1FY7 A;  5LGN A;  4UNO A;  5ED4 A;  1KA8 A;  3MCZ A;  3L7W A;  1HXD A;  2V79 A;  1YYV A;  3HTS B;  3ELK A;  1R58 A;  2BBY A;  2VE8 A;  3KEO A;  3P9K A;  2FNA A;  5K5Q A;  1QNT A;  3QOP A;  4LLL A;  4CZZ A;  2QBY B;  3PFI A;  1KYW A;  3BWG A;  2R7F A;  5HDN A;  1QZZ A;  1C0W A;  2YPR A;  2LF8 A;  1Z6R A;  2COM A;  3LFK A;  4A6E A;  3CTA A;  5DUI A;  1BIA A;  2V1D A;  5BS6 A;  2FNP A;  4ZYH A;  3I4P A;  1RNL A;  1P4X A;  2VC1 A;  3WG9 A;  1S8N A;  3GUD A;  4E70 A;  3MZY A;  4L0Z B;  1HKS A;  2OU2 A;  1REP C;  2VBY A;  2MC3 A;  3GWZ A;  1G6N A;  3REO A;  3V7R A;  3MFK A;  3BY6 A;  3KP6 A;  3EDP A;  4XBF A;  2A6E F;  4I7H A;  4AD9 A;  1O57 A;  2OQR A;  3DFG A;  4RB2 C;  2F5F A;  1YO5 C;  3I59 B;  2HEO A;  1IN7 A;  3T0Y A;  1KQ9 A;  1FYL A;  4MTD A;  1MDM A;  2XRN A;  1V3F A;  2EJR A;  1XGN A;  1XSX A;  4WX9 A;  3LQR A;  2HZT A;  1MKM A;  1FT9 A;  2UXN A;  4XLN F;  1I1G A;  1WRJ A;  3HIF A;  3K1N A;  4LK1 F;  1AOY A;  4RGS A;  1K79 A;  1YW9 A;  3F6O A;  4HQE A;  5H6Q A;  2XAH A;  1U2W A;  1YW8 A;  2VN2 A;  1TLH B;  5KK1 A;  3E6C C;  3M7G A;  4FHT A;  1BI1 A;  2EFN A;  2O61 A;  4U88 A;  2XVC A;  3ULQ B;  1XGO A;  1IW7 F;  4RGR A;  1QGP A;  4M72 A;  3B73 A;  4RB1 A;  5D5U B;  2E7X A;  4LFU A;  1A04 A;  4YIF A;  4M9S A;  2A3S A;  1KYZ A;  3TKY A;  1O3S A;  5E18 F;  3DV8 A;  2BEO A;  4I0A A;  2EFO A;  3ZN1 A;  1R5H A;  2IA2 A;  3RDI A;  1U3E M;  1O3T A;  1XB4 A;  4UV8 A;  2D1V A;  1BN5 A;  4O5V A;  5FFX A;  1KGS A;  3V7C A;  4U7B A;  5IT3 A;  5CVV A;  3JAM K;  3GO5 A;  1BBY A;  4HX8 A;  2PMH A;  4LK0 F;  1D5V A;  2K7L A;  4ENN A;  5A2Q K;  2K4J A;  1PP8 F;  2IA0 A;  3HOS A;  3U2R A;  4ETS A;  2HR3 A;  4L9V A;  2UZK A;  1ONV A;  2K02 A;  3GZ6 A;  2MH2 A;  2MA3 A;  4FX4 A;  3D0S A;  4KIF A;  5HOO A;  2STT A;  3EQL F;  3EYI A;  4M73 A;  3MEX A;  1XGS A;  3HHG A;  5L3D A;  4KMF A;  4UHT A;  2ISY A;  4AIH A;  1B59 A;  4KN7 X;  1BC7 C;  5AIP A;  3IWZ A;  1TQM A;  2M30 A;  4OMZ A;  2XAQ A;  1W4M A;  5CLS A;  3BRO A;  3O3K A;  1FOK A;  4U0V A;  4HF0 A;  4HOB A;  3WTW C;  3JTH A;  3I53 A;  1OKR A;  2D2W A;  1OMI A;  3HSR A;  3KE2 A;  1IXS B;  3FM3 A;  4U0W A;  2JTV A;  4L0Y B;  1XSD A;  1U5T B;  3EYY A;  3F8M A;  2DU9 A;  3G3Z A;  2JSC A;  2UXX A;  3KFW X;  1ODD A;  2W57 A;  1J75 A;  2HYF A;  3BPX A;  5K5R A;  4G8X A;  1TQP A;  1B9N A;  3TOA A;  4G7O F;  1GVJ A;  4K2E A;  3TGN A;  2KJC A;  4RGX A;  3L09 A;  1HW1 A;  2WC2 A;  2RKH A;  3DEU A;  2VON A;  1IRF A;  2GIV A;  3TOB A;  3BJ6 A;  5FLX Z;  1KU7 A;  3LST A;  3V4G A;  2PQ8 A;  3SHF A;  4IF4 A;  4O3M A;  1YG2 A;  4EJO A;  1F1Z A;  2ZNZ A;  5EEH A;  1FSE A;  2PMU A;  3EET A;  2XHK A;  4EQQ A;  5FGM A;  3L00 A;  3GF2 A;  4WF2 A;  3ZMU A;  1UHW A;  1LDK B;  2BE5 F;  4IVN A;  3ECH A;  4MHG A;  1YFH A;  3GXO A;  1ZHF A;  1GHC A;  3VOD A;  1D3Y A;  4HDU A;  2EA2 A;  3VOE A;  1DPR A;  5LRR A;  4HZF A;  4EVI A;  2P5K A;  5HS7 A;  1IXC A;  2FEZ A;  1Z7U A;  1WSU A;  4LD5 A;  1IN8 A;  3T8T A;  5E17 F;  2YX4 A;  4MTE A;  1K7A A;  3WTU C;  4RAZ A;  2XKO A;  1S7A A;  4IHS A;  4YFN F;  2P7V B;  5D8K B;  3ZMZ A;  5AON A;  3KZZ A;  4Q4Z F;  5D6F A;  3KP2 A;  1RZ4 A;  5IT9 K;  1EH7 A;  3WGG A;  3FXU A;  4WCG A;  1LB2 A;  1JXS A;  5D5W B;  4RS8 A;  4YII A;  2L54 A;  2L01 A;  3ZMV A;  2CGP A;  2MLK A;  2G9W A;  1GXP A;  5D8L B;  2MD5 A;  1KU3 A;  1QBJ A;  5LEJ A;  1Z9C A;  2QQ9 A;  4BHC A;  2A68 F;  4GXO A;  1STZ A;  1RI7 A;  2UWM A;  1D8J A;  1QZY A;  4I2O A;  1YW7 A;  1OPC A;  1OYI A;  2FXA A;  4IPA A;  4OIP F;  2DQR A;  3Q9S A;  1ZYR F;  5JR3 A;  4OIN F;  1U5T C;  2VOP A;  1LDD A;  3RPQ A;  4MEY F;  2ETH A;  4G7Z F;  3M8E A;  3RKY A;  4YFK F;  1Z1D A;  2ADU A;  2FML A;  4FT8 A;  1T38 A;  3C7J A;  1T6S A;  4KIC A;  1IF1 A;  1TW3 A;  1QQI A;  3I0T A;  1B6A A;  5LHI A;  2GQQ A;  4AIK A;  1T39 A;  4L9T A;  4A2U A;  4M71 A;  2V9V A;  5HDK A;  2PBI A;  4MQV A;  2FBK A;  3FWE A;  4LMY A;  3FHZ A;  4Y13 A;  3ZMD A;  1ZG1 A;  3HRS A;  1ZRF A;  3R61 A;  3TO9 A;  4MGR A;  1XGM A;  3J7A O;  1L0O C;  2W25 A;  3GVA A;  1HST A;  4G6D A;  3CO6 C;  3PQK A;  1FBQ A;  3KCC A;  5CVI A;  4L18 B;  5F64 A;  2W85 A;  1PUE E;  3K0L A;  5HLH A;  2DK5 A;  2ZFW A;  1Z05 A;  1FYK A;  1XSV A;  3T5X A;  4P96 A;  2HOE A;  5E20 A;  2F5C A;  3CJN A;  3FMQ A;  3Q5F A;  4U0Y A;  3Q9V A;  4ZZD A;  2XAG A;  3K9T A;  1SD6 A;  3ISP A;  2R7D A;  1BIB A;  5ICE A;  3BOQ A;  1P4A A;  1U5T A;  4UUV A;  3E6D A;  3F3X A;  3JAM Z;  3OV8 A;  2EWN A;  1PDN C;  1USS A;  4WWC A;  4ENM A;  4PDK A;  1EV7 A;  4EM2 A;  1WWX A;  2XAS A;  4EV0 A;  1MZB A;  1SD4 A;  2QM3 A;  1ZAR A;  2YX7 A;  1MDM B;  1P4W A;  5DD8 A;  5DCM A;  3LA3 A;  2NRA C;  4S05 A;  2FMY A;  2GA1 A;  5LEK A;  1F4K A;  2PG4 A;  3R6S A;  2FQ3 A;  3U1D A;  2LF7 A;  3ERE D;  1ZH5 A;  1V4R A;  4EM0 B;  1FNN A;  3O6B B;  3BJA A;  1S7O A;  1TW2 A;  3R0J A;  5IT9 Z;  2F2E A;  3I58 A;  2BGC A;  3DP7 A;  2FF4 A;  3BDD A;  4OIR F;  3WGI A;  1Q1H A;  3RTR A;  1R7J A;  1Z6T A;  1EH6 A;  1FBU A;  3J80 Z;  2MLG A;  4BQA A;  2IA1 A;  4I0B A;  3HHH A;  3NRV A;  5JFR A;  2RQP A;  4JBA A;  1H9G A;  2DI3 A;  5HLI A;  3QP5 A;  1I27 A;  1LEB A;  1KQ8 A;  1ZAO A;  5ICG A;  3J81 K;  1O7L A;  4U7D A;  4BYY A;  2RNJ A;  4F7Z A;  2CWE A;  1G3W A;  4G94 A;  4Q5S F;  2DK8 A;  2VXZ A;  4A12 A;  1HKT A;  3V8L A;  2KIF A;  2WTE A;  3IKT A;  2QQB A;  3WGH A;  1UFM A;  2FU4 A;  4LJZ F;  3V8K A;  1R22 A;  3R60 A;  2DTR A;  2KRF A;  2RDP A;  2DPU A;  1F5T A;  3SXY A;  3KLN A;  2P6S A;  5L3C A;  2OA4 A;  4HF1 A;  5JI6 A;  2GA2 A;  2RV8 A;  1QPM A;  2B0L A;  2XAJ A;  2DQL A;  4LG0 A;  1O7F A;  1JHH A;  4DQ2 A;  1E17 A;  2LDU A;  3CUQ B;  4OIO F;  4WK8 F;  3O2P E;  1UB9 A;  1X3U A;  5DEQ A;  3RYR A;  3LAJ A;  4O6J A;  2RC4 A;  4LGW A;  5CVU A;  2DLL A;  4AWX B;  5DDG A;  3LQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...