3HHHA

Crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
102
Chain Sequence
KQTELLKGILEGLVLAIIQRKETYGYEITKILNDQGFTEIVEGTVYTILLRLEKNQWVIAEKKPSEPMRKFYRLTSSGEAELADFWQRWTLLSKQVNKMKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, PadR family
publication title Crystal structure of transcriptional regulator, a membar of PadR family, from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
total genus 32
structure length 102
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hhhA00
2EK5A 1IZ1A 4B09A 1XMAA 3RI4A 2VT2A 1U78A 1Q1HA 3VODA 2FBHA 5HLHA 1BIBA 5FO5A 4GCVA 2CW0F 3KFWX 1R1UA 4ETSA 1HSTA 2F5EA 3HYIA 5LEKA 1R36A 3ZN0A 1ZH5A 4EV0A 1PP7U 3LFKA 2BBYA 3ZMSA 3F6OA 1U3EM 1ZG1A 1ZLJA 2FEZA 2BV6A 2GA2A 3FXUA 1ZG5A 4I98B 2A3SA 1KQ0A 3WE2A 3LA3A 3PQKA 4YFNF 3F72A 4RB2C 1ZN2A 1DPRA 2D1VA 4AIHA 2AS5F 1PDNC 3U9GA 5CVVA 2MA3A 3K69A 4LMYA 4BHPA 3SZPA 1B1BA 4UV8A 1DUXC 5LLQA 3GVAA 2Z99A 2MLKA 5D5WB 2XGXA 4D0PA 4ENJA 2QZ8A 1XMKA 2D2WA 4F7ZA 5ILVA 1CF7A 4H0EA 4GGGA 1XGOA 2FSWA 3C3WA 2D1HA 1ODDA 2D45A 3KZYA 3K1MA 4GYIA 5E20A 1K78A 3TGNA 2KRFA 2FOKA 1B9NA 2F5CA 1BC7C 3TOBA 4L0ZB 5HDGA 1U5TA 5CVJA 4A0XA 1XD7A 5ICEA 3M8FA 3O3KA 3T8RA 2RKHA 1KU9A 1FZPB 4FX0A 1R23A 2ESNA 1ZLKA 1R1VA 2OAZA 3I59A 3R61A 4HF2A 2NYXA 4A6DA 3BWGA 1T39A 3L9FA 4EJOA 1TW3A 2O6GE 1OMIA 3WODF 1J7KA 2IPQX 4KYWA 4OIQF 5LHHA 3V7SA 5FFXA 2AXLA 2FMLA 3HHGA 1FYMA 2VT3A 1QZYA 4HDVA 5HS7A 4AVPA 4U0VA 2YX7A 5EEHA 3CO6C 3NEUA 3RYRA 3I64A 4K2EA 2MLGA 4IJAA 5D5UB 2JTVA 2G7HA 4XSZF 4PZJA 4JQFA 4PDKA 5LHIA 2OA4A 1SMYF 1WRJA 1K6OA 3GW2A 2DPUA 2L4MA 2JRTA 5AONA 4ASNA 3GXOA 3QP5A 1RNLA 2KJCA 1I5ZA 5L3GA 2L4AA 3MAJA 2A61A 2F5DA 3U2RA 3JAMZ 3DV8A 5FB2A 2Y48A 4KIBA 4M74A 3JAMK 1QO0D 2EV0A 3HHHA 4M6YA 3CUQB 5BMZA 3F8CA 2LKPA 2VONA 2OZ6A 4KMUX 4IHSA 3K0LA 2P6TA 2YSRA 1ZAOA 4Y13A 3EYIA 2CO5A 2OU2A 2QWWA 2DPDA 5H6RA 1XDSA 3LAPA 1T38A 3J80Z 2XAFA 3K2ZA 2IT0A 1W5SA 2HDCA 2C6YA 3HTSB 1Z6RA 3J80K 3FX3A 3WU0A 3IHUA 4OIOF 1BIAA 1GHCA 1FT9A 2FE3A 5L3CA 2M8EA 3MEXA 3R0JA 4UVAA 1YQAA 4Y15A 4EM0B 4HLXA 1GXPA 3HSRA 2K4BA 4A12A 4KN4X 1U5TC 1JHFA 1S29A 2XAGA 4L9TA 1XCVA 1KGSA 3I54A 5DDGA 5JVTA 1RIOH 4KNYA 4UNOA 1JHHA 3WTUC 2LDUA 5HLIA 4EGYA 1G6NA 2DLLA 4QWQA 4HBLA 1TQPA 2DK8A 5AIPA 3RDIA 2ZMEA 2COMA 2KKOA 5JI6A 4Z2YA 1UB9A 1UHMA 3BOQA 3GZ6A 2UWMA 3C18A 2R7FA 4EM2A 1ONVA 3DFGA 3EDPA 3SQNA 1ZHFA 4M9ZA 1QZZA 2Z3YA 2IW5A 5L3EA 4QLCU 4UHTA 1SD4A 5D4SA 5D5VB 2L54A 4TV7A 3KEOA 2Z33A 1FSHA 3RYPA 4RB1A 3RPUA 4EJUA 3GEZA 5HS8A 4KICA 5E17F 4RB0A 3V4GA 3WTWC 1FBQA 1YYVA 2EWNA 3QPTA 3SZTA 3JW4A 5LEJA 1TTYA 3T1BA 2VODA 2GIVA 4LB5A 4MQVA 3ERED 3KP3A 4ESJA 2UXXA 4ENKA 1Z7UA 4M6XA 1FWZA 1MKMA 2RNJA 2OQGA 3IKVA 1FYKA 2V1UA 2EA4A 1FP2A 4LFUA 1W7PB 2W57A 3OOPA 3C7JA 3OV8A 4HX4A 3GYHX 4HZFA 1SFEA 2RGVA 1UFMA 4WXCA 4DQ2A 4P9FA 3DKWA 2GA1A 3C1DA 2BE5F 1TQMA 4LLNA 3SFZA 1DPUA 1YW7A 2VOOA 3KE2A 2WTEA 2CFXA 2CSOA 1LEBA 1E2XA 1F1ZA 2L01A 1G3TA 4G7ZF 3VFZA 2J5PA 1LDKB 3HUGA 4HV5A 5HS9A 3ECOA 1XSXA 3GUDA 1WQ2A 1R5GA 5E1ZB 3JTGA 4M72A 2P7VB 1O3RA 5AIQA 2PQ8A 1IXRC 2G7UA 4IRGA 2Z5UA 3CDHA 4P96A 5E18F 2QBYB 4EVIA 1ZYRF 3QRFF 2PMHA 3LSTA 1B9MA 1KU3A 5FGMA 1G3SA 4AD9A 3GFIA 4LK1F 1Z1DA 2NS0A 4PCQA 2HQNA 3LAJA 3WG9A 3FZVA 4KUMA 2VOPA 4NB5A 2Y75A 1YTYA 2HGCA 2IP2A 3M8EA 3ZN1A 2QENA 5CVRA 4WX9A 3I58A 1S8NA 3BJOA 4LLGF 4N0BA 1O3QA 2EFQA 2B0LA 1JGSA 2OQRA 4BNCA 3WGHA 4BQAA 3W6KB 2VE8A 4G7OF 2P7CB 1EV7A 1IW7F 4RGSA 2HTSA 1XGMA 4RS8A 2XRNA 2VBXA 1L3LA 2XV4S 1TW2A 1XGNA 4OOIA 2H6BA 1XB4A 4UV9A 1MJAA 2STWA 1Z6TA 4G6DA 2DFIA 3ZP5A 1H9GA 5L3DA 3BJAA 2XAQA 2M45A 1NHAA 4FX4A 1KQ9A 3QP6A 2FXAA 5ILUA 1BN5A 3WE3A 4MEYF 3PQJA 3SHFA 4A6EA 2A69F 3RTRA 1AOYA 3WTVC 1VTNC 3TDUC 5LGNA 2K27A 2MH9A 1FNNA 3BZ6A 3DP7A 3DF8A 1J75A 3WGGA 4KA4A 5EEGA 3FMQA 1YIOA 6PAXA 3F21A 4CZZA 3B73A 1UCRA 2JPCA 3Q9VA 2XVCA 2DTRA 2EV5A 1O57A 2ZJ2A 2BEOA 1J9IA 1J5YA 2H09A 2XKPA 4FT8A 4O5VA 2YPRA 2W25A 2JZYA 2EFWA 2V1XA 2HWVA 1Y0UA 4HAMA 2GXGA 5TJJA 4A0YA 3TO7A 2ZNZA 1IN5A 4L5JA 3V8LA 1H0MA 3H3ZA 3T0YA 1HBXG 4O3MA 2EJRA 3LA2A 4WWCA 2IA1A 3E5XA 2NNYA 5D5XB 4ESFA 1ZRFA 2XROA 1D5VA 3TO9A 4HF0A 4L9NA 4B8XA 4LJZF 3FMRA 5ILSA 1SD5A 1TNTA 5L3BA 4RAYA 3EETA 2ELHA 2FNPA 1QBJA 2V79A 3BROA 3D0SA 4ZH4F 2MD5A 3F6VA 2NAZA 2VC1A 4BYYA 1U2WA 1XN7A 4Q5SF 1CGPA 4ZZDA 1LEAA 1K78B 3KLNA 3QAHA 4BXUA 2XAJA 2WV0A 2FRHA 3IWFA 4A5NA 2P6SA 4EJVA 3LWFA 2E7XA 2ZO4A 1IXCA 1B4AA 2DQRA 5J8FA 2XIGA 2TDXA 3CO7C 2W85A 3I59B 1BI0A 1ZG3A 1KYZA 3MZYA 4RGXA 3W6JB 4WK8F 1HXDA 3WTTC 2K7LA 1P2FA 1FC3A 3GO5A 1B6AA 3HRSA 1QNTA 4I09A 4AIJA 3RPQA 4MNUA 4GXOA 2FNAA 2LF8A 1EH7A 1UHWA 2HYFA 4MHGA 2M30A 2E1NA 1RZ4A 2HZTA 3LQQA 1R1TA 1P92A 3J81Z 2ISYA 1R7JA 3CUQA 1P6RA 3KP5A 3HSFA 2EFNA 2KJBA 1JE8A 3V7RA 2QYOA 1HKTA 3LA7A 3T8TA 1XGSA 1KU7A 4WF2A 4Q4ZF 5F1RA 2UZKA 4G6QA 2E1CA 3ZMTA 2V1DA 4N9IA 1ZARA 3QPHA 1JXSA 2ZKZA 1IN6A 3P9KA 2ACJA 4CGZA 5H20A 2HR3A 4HOBA 4LLLA 1MDMA 5FLXZ 2JSCA 4EMSA 1K7AA 3Q5FA 1ZGJA 5DUIA 4L9VA 5FLXK 4RGUA 1I27A 3NQOA 2J5OA 1SD6A 4XRFA 2RVCA 5LGUA 3ZQ7A 1YFHA 2DI3A 3S2WA 3REOA 3H3UA 4IF4A 2H94A 2K4JA 5E8GA 1RI7A 3B02A 3E97A 4CXFA 2VBYA 4MTDA 1IAWA 3FMSA 5ICGA 3K1PA 4IXAA 1FBSA 2F5FA 1SD7A 5LHGA 1BI3A 3E6DA 1YLFA 1G3WA 5HVQC 4HV6A 5HDNA 4U7DA 3WU1B 4Y17A 3M7GA 4IVNA 3O6BB 5FD5A 4YIIA 3GFLA 3TO6A 5CVUA 4N9HA 3MCZA 3PFIA 1WSUA 4EJTA 1HQCA 1REPC 2KIMA 5DCMB 5HOOA 3P9IA 5DD8A 2JT1A 2CG4A 3IKTA 2ZCWA 1FP1D 3I53A 2P4WA 2NNNA 3FXRA 2MBFA 3ZMDA 3COAC 4RAZA 3MZHA 3P7NA 2EV6A 2ZMEB 2R7DA 4NHJA 4A2UA 1U8RA 4M71A 2PLYA 4XLNF 3KLOA 2CYYA 1V3FA 4E70A 3FHZA 2XAHA 1R22A 4OIPF 1BI2A 1W7PA 1EH8A 1ULYA 4YFKF 2P5VA 1IN4A 1DDNA 1R58A 2P5LC 3P9CA 1B59A 3ZMUA 4M9XA 3CLOA 5DYMA 3G73A 1YO5C 2YU3A 4L9JA 2GQQA 1ZRCA 2FU4A 2QQAA 3F8BA 5DUKA 5FD6A 1FPQA 3QU6A 3E6BA 1IF1A 2CQKA 4P5OA 2V6CA 4MTEA 4RGRA 1W4MA 2LF7A 1KYWA 2M87A 3IWZA 4ENNA 3R0AA 4I0BA 2IA0A 1LNWA 4YFXF 1D8JA 1WWXA 4GYGA 4MQ9F 4G94A 4CYDA 4CO8A 1IXSB 1YW9A 3M9AA 3GX4X 5A2QZ 1MJ9A 2A68F 5D8LB 2ETHA 5A2QK 5IT3A 1ZREA 4U7BA 4HQEA 4HDUA 2ESHA 4LB6B 5E1XA 3RKXA 3F8NA 3N4MA 2F2EA 4OIRF 2XKOA 3V8JA 1FX7A 2GZWA 3FXQA 3N97A 2DAOA 3R60A 4HW0A 5IT9Z 1USSA 5BPIA 5LRRA 2PEXA 2HEOA 3LQRA 4UXNA 5IT9K 2E7WA 3L2CA 4HLYA 1IN7A 2PN6A 3EYYA 3IRRA 2A5YB 2EFOA 1T6SA 2Q8KA 3V7CA 1U6GA 1OYYA 1I6XA 4IPAA 2VN2A 3WGIA 5F64A 2H27A 2HYGD 1S6LA 5DEQA 4R79A 1OKRA 2RN7A 2HKXA 2GAUA 5E8IA 2VE9A 4EM1A 1S7OA 4YIFA 1OYWA 4ZZLA 2X0LA 2EB7A 5ICCA 1AWCA 1F4KA 3HRMA 1Z9CA 3E6MA 4L5IA 3VOEA 4EGZA 4ZYDA 1OYIA 1BBYA 2M1BA 1V4RA 4KDPA 1O7FA 3U1DA 2OBPA 3E3VA 4AIKA 1KQ8A 1HSJA 4WXDA 2QLZA 4LG0B 3R6SA 3E5UA 2QQ9A 2RQPA 4OMYA 1BI1A 3TOAA 2PFBA 1SAXA 3D5LA 3T5XA 1O7LA 2A6EF 1LJ9A 4P9UA 3KCCA 3R4KA 4AWXB 3QU3A 2BGCA 3F22A 2VC0A 5CJ9A 1W7PD 5BPDA 3F8FA 1MZBA 3GWZA 4DNCA 1T98A 2ZXJA 1LQ1A 1FOKA 4Q47A 4XBFA 3O2PE 3V8KA 3KP2A 5KK1A 4I02A 1S3JA 2K02A 2MH2A 4NQWA 1O3SA 4ZYHA 3QOPA 1FSEA 1RUNA 3Q9SA 4ENMA 4WXHA 4PGGA 3KP7A 1R5HA 3TDZC 3FM3A 2A6HF 1BM9A 1TLHB 5LBQA 3ELKA 1XCBA 1Z05A 1STZA 4HQMA 3ROUA 3F8MA 3I0TA 3HSEA 1SFXA 1KA8A 3HOSA 1FLIA 2PG4A 4IRIA 1HKSA 2DK5A 4HX8A 2FBIA 1C0WA 4I0AA 5H6QA 3ZMZA 3K9TA 2HQRA 2DT5A 3CTAA 3MQ0A 2K86A 2QQBA 3HIFA 3NRVA 1HKQA 3GLXA 2PMUA 3GFJA 1F5TA 5JHUA 1LDDA 3DQVC 5HDKA 2GWRA 4Q48A 4UVBA 4G7HF 4CICA 2FQ3A 3L00A 1CF7B 3G3ZA 4OU0A 2CWEA 2Z9OA 3HRUA 2IA2A 5DCFA 4GO1A 2RC4A 4EQQA 1TNSA 2QVOA 4JBAA 3VEPA 3JTHA 4KFCA 3IRQA 2BYVE 2L3DA 2L02A 2HFHA 2W24A 1U5TB 2IJLA 1HW5A 4MGRA 2V9VA 3AAFA 3FF5A 1HW1A 3F23A 5K5OA 2Q2EA 5JFRA 1ZRDA 3BPVA 1IRGA 1IRFA 1IUYA 1ZGAA 3DPTA 1BOAA 1OR7A 3BPXA 3HTUA 1FY7A 2EA2A 2MC3A 3ISPA 3DEUA 1F9NA 2VXZA 1PUEE 4OMZA 1T0FA 1TBXA 2OZUA 2YX4A 3EQLF 4I01A 5F6FA 1DP7P 4JK1X 1OPCA 4M9SA 3ML6A 3J81K 1TQIA 3MFKA 1S7AA 2QM3A 2Y0MA 2ZFWA 3GF2A 2EFPA 3CJNA 3K1NA 5ICFA 2X4HA 2P8TA 4KMFA 4A5MA 4ZYGA 3FM5A 2XUBA 3HRTA 2LSOA 3BDDA 4I7HA 1ON2A 4HX7A 4LK0F 3JSOA 2O3FA 2WC2A 1I1SA 2G9WA 3ULQB 1YW8A 2W84A 2O8XA 4U0WA 1MDMB 4R8HA 4S04A 1XDUA 1MGTA 2KIFA 1WKMA 4MEXF 1FYLA 2O03A 2GXBA 4IRHA 3DPLC 4HF1A 3CUOA 4UUVA 3BJ6A 1J2XA 3TKYA 5DCMA 1BJAA 4HYEA 1LB2A 4ESBA 3J7AO 5LRSA 3FWEA 4BHCA 4BHBA 1P4XA 2IRFG 2NRAC 3IL2A 3I5UA 5KVRA 4XSXF 1QPMA 3KP6A 4O6JA 3BP8A 2DW4A 1KU2A 3RKWA 1H9TA 4S05A 1I1GA 5ED4A 2A07F 5DD4A 1P4WA 1ON1A 1LDJA 2PBIA 3ABUA 1MD0A 5D6FA 2XHKA 1WI9A 5LGTA 2R3SA 4U0YA 4U88A 1E17A 4YG2F 3WTXC 5J8CA 2ISZA 4I2OA 3HOTA 1HW2A 4KN7X 1K79A 2DQLA 2OD5A 1D3YA 3E6CC 1YS7A 2O0YA 3DXJF 3CUQC 5K5QA 2PI0A 5BQTA 2RV8A 4ZYEA 2LNBA 4L18B 2HS5A 2FBKA 1GXQA 2ADUA 1R00A 1SMTA 3IC7A 1XSVA 3KEQA 4A0ZA 3E5QA 5CYVA 1D8KA 1O3TA 2VBZA 5J6XA 1SFUA 1QQIA 2WWYA 4ON0A 2XASA 1T2KA 4OINF 4R1HA 4KIGA 4RB3C 4KIFA 3H92A 5JR3A 2KIUA 2YR2A 4XLPF 1J0RA 1EH6A 1YG2A 4G8XA 4BAYA 3WTZA 1FBUA 2DBBA 3I4PA 2QUFA 4BH9A 3KZZA 1W5TA 2FF4A 3TQNA 3L09A 3F3XA 2Q0OA 2O61A 3M1EA 2M5WA 2HKOA 5D8KB 1G3YA 1PP8F 3BY6A 1P4AA 3RJPA 1MJBA 2QBYA 3ZPLA 4CHUA 4M73A 3WTSC 5TRDA 4P55A 5BS6A 5L3FA 4UVCA 1G4DA 1XSDA 2FA5A 1IN8A 5E1WA 2VBWA 4FHTA 2CGPA 4G9YA 3L7WA 1RUOA 5K5RA 3KETA 5CLSA 2ZNYA 1A04A 5BOXA 2DU9A 3WTYC 1BC8C 5HLGA 1USTA 3GFMA 2STTA 4WCGA 4IHTA 1YS6A 3RKYA 2FMYA 1LVAA 5D4RA 1J59A 3I71A 2HOEA 1L0OC 2ZBKA 5D6EA 2RDPA 2DO7A 1QGPA 4KT5C 3JSPA 3ABTA 4LGWA 5DV5A 3SXYA 3GZ5A 1GVJA 5FFZA 2IVMA 5CVIA 5ERIA 4EJWA 5K1YA 3RIRA 4L0YB 4LG0A 4CDGA 3ZMVA 3MWMA 2P5KA 4PGHA 3VB2A 2JPBA 2PJPA 1X3UA 4HA8A 2UXNA 3EUHA 2H6CA 4LD5A 3ECHA 3KP4A 2HTJA 1Z91A
chains in the Genus database with same CATH superfamily
2EK5A 2KZGA 2VJ5A 3KYLA 1X4PA 1IZ1A 3BG3A 1HCRA 4B09A 1XMAA 3RI4A 2VT2A 1U78A 1Q1HA 3PSIA 3VODA 2VUMJ 4M3FA 3PO3J 2FBHA 5EGOB 1Y8QB 1MBFA 2MG4A 5HLHA 1BIBA 5FO5A 4GCVA 2CW0F 3DBHB 2VPLA 3OYJA 1R5ID 3KFWX 1R1UA 2OTJI 4ETSA 2NVQJ 3M3YJ 1HSTA 1LVKA 2F5EA 3HYIA 5LEKA 1TWFJ 1R36A 1Z77A 4ABZA 1X1BA 5J40A 3ZN0A 4E7JA 1ZH5A 5F0HA 2YU9J 4EV0A 1PP7U 5F08A 3H5RA 3TP3A 3LFKA 4MLOA 4FTHA 2BBYA 3ZMSA 3QYBA 2HYJA 3F6OA 1U3EM 5FKKA 1ZG1A 3NWSA 1ZLJA 1GT0C 2FEZA 2BV6A 2GA2A 4JOMA 2JUCA 3FXUA 1MIJA 1ZG5A 4I98B 2A3SA 1KQ0A 3WE2A 3HZJA 1B8IA 3LA3A 3JRCA 3PQKA 2X85A 4YFNF 1JI8A 3F72A 4AIDA 4RB2C 1MBGA 1ZN2A 2DFEA 1WH7A 1IJWC 1DPRA 2D1VA 4AIHA 2AS5F 1GV2A 1PDNC 4IQJA 3U9GA 2NVTJ 5CVVA 2MA3A 3K69A 4LMYA 2LREA 4BHPA 3ZQQA 2IEKA 3SZPA 1B1BA 4UV8A 1DUXC 2L9VA 5LLQA 3MD2A 3GVAA 2Z99A 1WJFA 2MLKA 2K9SA 4UUSA 5D5WB 1AHDP 2R0QC 2OCCH 2XGXA 4D0PA 1ETXA 4ENJA 2Y30A 1MMAA 2QZ8A 4KITB 1XMKA 2D2WA 1VQ6I 1MW7A 4F7ZA 5ILVA 1X1PA 4NQWB 2W00A 1CF7A 2K9LA 2H8RA 1OJLA 1IRZA 2HOAA 4H0EA 4GGGA 2DODA 2M2EA 1XGOA 2FSWA 2XPWA 1Z7LA 2Y31A 3C3WA 2BY1A 2D1HA 3M8JA 1ODDA 2D45A 3D1NI 1T56A 3KZYA 3C2HA 2YS9A 1RR7A 3K1MA 4LG3A 5C44J 4GYIA 5E20A 5FROA 4UUTA 1MNDA 2K40A 1I50J 1P9QC 1K78A 3TGNA 4QSHA 1ENHA 5B5EC 5KHDA 2KRFA 2FOKA 4CZCA 1B9NA 3A1YA 1JJ6C 2F5CA 2L7FP 2EQRA 3G1OA 1BC7C 3TOBA 4L0ZB 1K83J 3PNVA 1U5TA 1Q1VA 5HDGA 3SYTA 2KQRA 5CVJA 1U8BA 4A0XA 1XD7A 2JRMA 5ICEA 3M8FA 3O3KA 2X9DA 3T8RA 2RKHA 1ZTRA 4I6ZA 1KU9A 4ZDPA 4FASD 3CESA 1FZPB 4FX0A 5GPAA 2E5NA 1R23A 1OCCH 2R5YA 2ESNA 2R7OA 1ZLKA 1R1VA 1ZR2A 2OAZA 3I59A 5EYRA 3ZQFA 3R61A 4HF2A 3GTJJ 3TL4X 2NYXA 4RAFA 5HLTA 2JVGA 4A6DA 2XPUA 3BWGA 1T39A 3KEYA 3L9FA 4XLEA 1JUPA 2DA5A 3IAS2 4EJOA 1TW3A 1IGNA 2O6GE 1OMIA 3WODF 1J7KA 2IPQX 2OTLI 4KYWA 4OIQF 4B3XA 5LHHA 3OYGA 3V7SA 3BCAA 5FFXA 2AXLA 2FMLA 3HHGA 1FYMA 3OYAA 2VT3A 1MSEC 1QZYA 3EUHC 3FXKA 4HDVA 4Z6YA 5HS7A 4AVPA 4U0VA 2YX7A 5EEHA 3L1PA 3CO6C 2HOSA 3NEUA 3W6VA 3RYRA 4JX4A 2XDVA 3I64A 4XMYA 2Y9ZA 4K2EA 2MLGA 4IJAA 3X2QH 3HEFA 5D5UB 1X1CA 3IH2A 4RAGA 3JRIA 2JTVA 1PUFA 2G7HA 4XSZF 4PZJA 3CDLA 4JQFA 4DYQA 3PUFA 4PDKA 1JKQC 4X1EA 1KZHA 4CUGA 5LHIA 1WHUA 2OA4A 1SMYF 1PYVA 1WRJA 1K6OA 3GW2A 1WCMJ 2DPUA 4X6AJ 2L4MA 2JRTA 1N78A 5EZHA 2TCTA 5AONA 1VQ4I 2Q2EB 4ASNA 3QPSA 1ZGWA 3QOEA 3GXOA 3QP5A 4NBQA 2GOXB 1RNLA 2ZFUA 2KJCA 1I5ZA 1H88C 5L3GA 4RM3A 2L4AA 3MAJA 2A61A 3HC7A 2LRDA 4BJ5C 4BEHB 2ME6A 2F5DA 4E7LA 4AYBA 3U2RA 3JAMZ 2LY9A 3BR6A 3MN2A 3K4KA 3DV8A 2ECBA 3ZOBA 5FB2A 3G6EI 2Y48A 3D5RC 4KIBA 3JRAA 3DTEA 3CCLI 1NH3A 4M74A 3JAMK 4QPQA 1QO0D 2EV0A 2QCOA 2P0WA 3VWBA 3HHHA 1YI2I 4M6YA 3CUQB 1DU6A 5BMZA 3F8CA 2LKPA 4E7SA 2V1NA 5GAEJ 2VONA 2OZ6A 4KMUX 5M3MJ 1QVUA 1VFCA 4KT6A 4IHSA 3K0LA 2BHYA 2P6TA 3SDBA 5M5WJ 2YSRA 1BOBA 3L2VA 2W7NA 1D0XA 3OYFA 1R71A 3ABKH 1ZAOA 3HOUJ 2E36A 2FX0A 4Y13A 3EYIA 2CO5A 2OU2A 2QKLB 2QWWA 2DPDA 5H6RA 3FBNB 2E1MB 1XDSA 3LAPA 4HNVA 1T38A 3J80Z 3CCUI 1JJ8C 2XAFA 3K2ZA 2IT0A 1W5SA 2HDCA 2C6YA 2L7MP 3HTSB 1Z6RA 2XSDC 3J80K 3FX3A 2DT7B 2DMQA 2W1OA 3WU0A 2R92J 3IHUA 4HSRA 4OIOF 1BIAA 1GHCA 1FT9A 2FE3A 5J1RA 4AM3A 5L3CA 2M8EA 3MEXA 3R0JA 4UVAA 4PFOA 1YQAA 4Y15A 4EM0B 2MGQA 4HLXA 3W2WA 1N77A 1GXPA 2GXAA 3HSRA 2K4BA 3FDYA 4A12A 4KN4X 3Q0UA 1U5TC 5GAHJ 1JHFA 1S29A 1Y8RB 2FOWA 2XAGA 4L9TA 1XCVA 1UG2A 1KGSA 2LH9A 3I54A 3HG9A 5DDGA 5JVTA 1RIOH 4KNYA 4UNOA 2LY2A 2JA7J 1JHHA 1U9OA 2QQ8A 2KT0A 5FKMA 3JRBA 3BQZA 3BR5A 3WTUC 2LDUA 5HLIA 4XICA 4EGYA 3TBIA 1G6NA 1IO2A 2DLLA 3IH4A 4QWQA 4HBLA 4IHWA 3NWTA 1W5CC 1TQPA 2DCEA 2DK8A 2M0MA 2HXOA 2JJ7A 5AIPA 3RDIA 1IG7A 2ZMEA 4JX6A 1EKEA 3OOUA 2COMA 1U0JA 3M1CA 2GIZA 1XS9A 1OCTC 3PUBA 4F3QA 2L9NA 2KKOA 2IGNA 5JI6A 4C2UA 3HOWJ 4Z2YA 2IGKA 1UB9A 1MNMC 2XF7A 1UHMA 1JGGA 1BJZA 2V26A 3BOQA 3GZ6A 3U21A 1S9HA 4GFBA 2UWMA 3C18A 1QVTA 2R7FA 4XRMA 4EM2A 2K9NA 3G1LA 1ONVA 2R7VA 2DYRH 1AKHA 3BG6A 4Y3OA 5EDNA 2NVUB 1UMQA 4IHVA 3DFGA 3EDPA 3VYTB 1VNDA 4XQFA 3O8HA 3BG9A 3SQNA 2GBYA 4QTRA 2E2JJ 5EG0A 2EIMH 1ZHFA 3DKXA 4M9ZA 3L2RA 1RRJA 4AUXA 1E0EA 1QZZA 3AL0B 4P1WA 5HODA 2Z3YA 2IW5A 5L3EA 4QLCU 2BVMA 3ERMA 1SD4A 1XTAA 3AG1H 4UHTA 5D4SA 5D5VB 2K85A 2L54A 1B72A 1ETWA 4TV7A 3KEOA 2Z33A 1FSHA 2BXYA 1RKWA 3RYPA 3VSLA 2HOTA 1ETQA 4RB1A 3RPUA 1MMDA 4EJUA 3GEZA 5HS8A 2XC7A 4KICA 5J1YA 5E17F 4DBRA 4RB0A 3V4GA 3LSKA 1GDTA 3WTWC 5GP9A 3OS1A 3H9GA 1FBQA 1YYVA 5B1BH 2EWNA 4F92B 3QPTA 3SZTA 3JW4A 5LEJA 1TTYA 3T1BA 3CC7I 4PUSA 2VODA 2GIVA 3CJQB 5HNFA 4LB5A 4MQVA 3ERED 3KP3A 4ESJA 2UXXA 4ENKA 1Z7UA 4M6XA 1FWZA 4E7ZA 2DDBA 1MKMA 2ECCA 2RNJA 2OQGA 3IKVA 1NK2P 1FYKA 1QHHD 2WADA 2L0KA 2IXSA 3I56I 4FE4A 2K9QA 2BW3B 3WHBA 2EA4A 4IX7A 1FP2A 4LFUA 2V1UA 2KISA 5C4XJ 1W7PB 2W57A 3OOPA 1R49A 2LR8A 3C7JA 3OV8A 2Y0SA 4HX4A 3GYHX 4HZFA 3AG2H 2CUEA 2E2HJ 3WHCA 1MBEA 1SFEA 2RGVA 3UNGC 3OYCA 2R5ZA 1UFMA 2LBFA 4WXCA 4DYRA 3I55I 2MW8A 4P9FA 4DQ2A 3DKWA 3ZGKA 1A36A 2GA1A 2ZJPF 4F93B 1F43A 3C1DA 2JA6J 1ZK8A 1I6HJ 4LIUA 3S1MJ 3HM5A 3D5SC 2BE5F 5J1UA 1TQMA 2Y0SN 4LLNA 3SFZA 3I4NJ 3I3LA 4MFDA 5J4VA 1YW7A 2VOOA 1DPUA 3KE2A 2WTEA 2CFXA 2R7ZJ 2X6YA 2CSOA 2FJ1A 1LEBA 1E2XA 1F1ZA 2L01A 1G3TA 2X1CA 2ELJA 2DA6A 2CUZA 3OYDA 4W1UA 4G7ZF 2WAQA 2AQEA 5EZGA 3SFIA 4XRSG 3VFZA 2DN0A 1HA8A 2J5PA 1LDKB 3HUGA 4HV5A 5HS9A 2DMNA 2EZIA 2BZTA 3ECOA 1CQTA 1S7EA 3SZGA 1XSXA 3GUDA 3IP4B 1WQ2A 1R5GA 4CCJA 5E1ZB 4ZC3A 1YOVB 3JTGA 4M72A 4N4NB 2P7VB 1O3RA 3PSFA 5AIQA 5JLXA 2QEXI 2PQ8A 4B47A 1IXRC 2G7UA 4IRGA 2Z5UA 2JSPA 2V9KA 4M3GA 5KAIC 3CDHA 4P96A 5E18F 1MBKA 2QBYB 3B6AA 1MMGA 2WAQN 4CCKA 4CH7A 3HOXJ 4EVIA 3MKWB 4I99C 1ZYRF 3QRFF 5FLVA 1FIPA 2FUG2 2PMHA 3LSTA 2VJ4A 1B9MA 1KU3A 2W48A 5FGMA 3Q3SA 5DS9A 1G3SA 2BHZA 2OV7A 3CF2A 5B66C 2ZMEC 4AD9A 3GFIA 1SVMA 3S14J 1TWAJ 3P5JA 4LK1F 1Z1DA 2CQQA 2NS0A 1QZEA 2DOFA 3FXJA 4II3A 2HI3A 4PCQA 3K2AA 4YRVA 2HQNA 3KIOA 3LAJA 3G1MA 3WG9A 3FZVA 4KUMA 2ZJRF 2VOPA 4XKVA 4NB5A 2Y75A 4XOTA 1YTYA 1YJ9I 1YRNB 2HGCA 2HPMA 2VKEA 1V5FA 2IP2A 3DCFA 3M8EA 3TW7A 3ZN1A 2QENA 3CMMA 5CVRA 4WX9A 3I58A 1S8NA 2VQGA 3BJOA 3CMAI 4LLGF 1ZQ3P 3K4LA 1TP4A 3CMYA 4BE0A 4N0BA 3EUAA 1O3QA 1D1AA 2EFQA 2B0LA 1JGSA 4FE7A 2OQRA 4BNCA 3WGHA 4BQAA 3W6KB 2VE8A 4RLFA 2X48A 4G7OF 2KDOA 3AG3H 4H4KC 2P7CB 4IHYA 1SFKA 1EV7A 3OIPA 1IW7F 9ANTA 2L7KA 5M5YJ 4RGSA 2HTSA 3L2QA 1XGMA 1WJBA 4RS8A 2RNGA 2HXIA 2XRNA 2Y2ZA 5IYCJ 2WV1A 2VBXA 1X58A 2JN6A 1L3LA 2W4SA 2HQAA 2XF6A 1QPIA 2NS7A 1RR8C 2XV4S 1MSFC 1HDPA 1YE9A 1WPKA 1TW2A 1XGNA 4OOIA 1H89C 2H6BA 1QA6A 3FKJA 1XB4A 4UV9A 1MJAA 5IY5H 4XN3A 2IBDA 4XLCA 3LSIA 2CMPA 2XGEA 2STWA 1Z6TA 4G6DA 2DFIA 3ZP5A 3A02A 1H9GA 5L3DA 3CP2A 3BJAA 2XAQA 2M45A 1NHAA 2DA7A 4A3CJ 2CUJA 2LK2A 4FX4A 2ICWG 1G59A 1KQ9A 1MBJA 3QP6A 3RPUD 5DM6F 2FXAA 5ILUA 1BN5A 2P81A 3WE3A 4MEYF 1KONA 3PQJA 3CZ6A 3SHFA 4BACA 1OFCX 3A01A 3B6CA 3RKQA 1A6IA 5EF6A 4A6EA 2A69F 2FQ4A 3RTRA 3C2BA 3HBLA 1AOYA 3WTVC 1VTNC 3TDUC 5LGNA 1JKRC 2K27A 2MH9A 1FNNA 1YHQI 4F91B 3BZ6A 3DP7A 3OYHA 4CCMA 1JKOC 2DJIA 3DF8A 1J75A 2HVRA 3SEQA 2KL4A 3OMYA 3K70C 3WGGA 4KA4A 5EEGA 3FMQA 2CRGA 2Z1DA 3CCMI 1YIOA 6PAXA 4D9JA 2VASA 3F21A 4CZZA 3B73A 1UCRA 2JPCA 4XONA 3BTLA 3Q9VA 3C2GA 2XVCA 2DTRA 2EV5A 4G6TB 2E19A 2VXDA 1O57A 1VQ8I 2ZJ2A 2L2OA 3BR2A 1DQUA 2BEOA 1J9IA 1J5YA 5K7HA 2H09A 3EUKL 2XF5A 3QYEA 2XKPA 4FT8A 2JA8J 2F4MB 4O5VA 2YPRA 2W25A 2DOAA 5J47A 3KYCB 2JZYA 2X1EA 2EFWA 2V1XA 2HWVA 1Y0UA 4M3DA 4HAMA 2GXGA 5TJJA 4A0YA 2JA2A 3QODA 3TO7A 2ZNZA 2VQLA 1IN5A 2OPTA 3H5AA 2CW7A 4L5JA 3V8LA 3K70D 1H0MA 1B8IB 3H3ZA 1WJDA 3A03A 2LTPA 2CQ7A 3T0YA 3LSJA 1HBXG 2NOGA 3OYBA 2BOLA 2ZC2A 4O3MA 2EJRA 4HNTA 3LA2A 3GTKJ 4WWCA 1MH3A 3I4MJ 2IA1A 3S3OA 3E5XA 2NNYA 3PJRA 5D5XB 2TRTA 3BTIA 4ESFA 3JR9A 1ZRFA 4IOCF 2XROA 1WJ5A 3TMOA 3OYNA 1D5VA 3TO9A 2IAIA 4XIDA 4UUSB 4HF0A 2IS4A 2Y9YA 3CDIA 3LOCA 2E35A 4L9NA 3ZQIA 4LJZF 2UV1A 4B8XA 2R7XA 3FMRA 5ILSA 1BL0A 1SD5A 4PJMA 1TNTA 5L3BA 2O9LA 4RAYA 3EETA 2ELHA 3K4NA 4XKWA 2FNPA 2V4JC 1QBJA 3BLYA 2V79A 3BROA 1R4NB 3D0SA 3HJEA 4ZH4F 4C9YA 1WGXA 1H8AC 3ESWB 2MD5A 3F6VA 4CA0A 2LY1A 3ZR8X 5FJ8J 2NAZA 2VC1A 2LG4A 4BYYA 3HL2A 4AVZA 1U2WA 3M4OJ 1FOYA 1XN7A 3VPRA 4Q5SF 4IOAF 3JREA 1CGPA 5E3LA 4ZZDA 1LEAA 1K78B 3KLNA 3QAHA 3LSPA 4GRIA 4BXUA 1JT0A 2XAJA 2WV0A 4ZTJA 2FRHA 3IWFA 3VDXA 4A5NA 3TW6A 3CCYA 4DYCA 2KMUA 2L9RA 2P6SA 4EJVA 3LWFA 3MKZA 1VQPI 2LD5A 4XLFA 2XB0X 4AU7A 2E7XA 1R6RA 2ZO4A 1IXCA 1B4AA 2DQRA 5J8FA 3OR2C 2XIGA 2TDXA 4L5EA 5IPAA 3CO7C 2R5YB 2W85A 3I59B 1W36C 1BI0A 1ZG3A 2F6CA 2R7QA 1KYZA 3MZYA 4RGXA 3W6JB 4WK8F 1HXDA 3GLLA 3WTTC 1IV8A 2K7LA 1P2FA 3WG7H 4B43A 1DGRM 1FC3A 2DJNA 3GO5A 1B6AA 2EIJH 3HRSA 3JCUC 3Q0VA 4KISA 1QNTA 3LSMA 1VI0A 4I09A 4JX5A 3DEWA 1WJEA 4AIJA 3RPQA 4MNUA 4GXOA 4XL9A 2FNAA 2LF8A 1EH7A 3J7AY 2CV1A 1UHWA 2HYFA 4DJAA 4MHGA 1NG7A 4XRSA 2M30A 2E1NA 1RZ4A 1A6QA 2HZTA 2KIQA 4ZTFA 3LQQA 1GVDA 1R1TA 4B4CA 4I76A 1IRXA 1P92A 3PIOF 3J81Z 2ISYA 1RKTA 1R7JA 3CUQA 1P6RA 3KP5A 3HSFA 2EFNA 2KJBA 4YEJA 1JE8A 4CYCA 3V7RA 4CCNA 2QYOA 3QPLA 3LA7A 1HKTA 3T8TA 4C2MJ 1XGSA 1KU7A 4WF2A 4Q4ZF 2VI6A 4E7KA 5F1RA 2EH3A 2DDAA 3H36A 3ASOH 3HKZN 1W36D 1PUFB 2UZKA 1OCPA 4FISA 4G6QA 2E1CA 3ZMTA 2V1DA 4N9IA 1ZARA 4XR6A 5EJCA 2LYCA 3QPHA 3H3VK 1Z3XA 1JXSA 2XB5A 2ZKZA 5LFAA 1Y1VJ 1IN6A 2RREA 3FHNA 3P9KA 2ACJA 4CGZA 2AO9A 2ZB9A 3CLQA 5H20A 2HR3A 4HOBA 4Y33A 4LLLA 4DGWB 1MDMA 3E7LA 3KPHA 5FLXZ 3ZQLA 2JSCA 1OQYA 3PM1A 5KNLA 2CJJA 4EMSA 1K7AA 5CKTA 3RZOJ 3Q5FA 1ZGJA 2QSFX 1Z0XA 5DUIA 2JK3A 4L9VA 1AU7A 4Y52J 4IQ4A 5FLXK 1DGWY 4RGUA 1I27A 3LFUA 4A3LJ 1LE8A 5F04A 3GTGJ 3NQOA 4NC7A 2J5OA 1SD6A 4XRFA 1XC5A 4IL6C 2ZXIA 2RVCA 5LGUA 3GTQJ 3ZQ7A 2LOOA 3HPGA 3CC4I 1YFHA 2DI3A 4A3MJ 3S3MA 3S2WA 3PNTA 2VKDA 3REOA 3H3UA 2VJJA 2M0CA 3GZNB 4IF4A 2H94A 2VQHA 3QWLA 5IOYA 5FKNA 2K4JA 5E8GA 3E1SA 5FLMJ 1RI7A 3B02A 1D0ZA 5E79C 3UKGA 3E97A 2I8DA 5C3EJ 4CXFA 3M07A 2K9MA 2MFZA 2VBYA 4MTDA 3DTIA 1IAWA 1P7IA 2HQ5A 4V2FA 3FMSA 5ICGA 1UHSA 3K1PA 4IXAA 4DIQA 4ZYAA 1FBSA 2F5FA 1SD7A 3A0BC 5LHGA 4NNJA 1BI3A 2XRLA 1NG6A 3E6DA 4NC8A 1YLFA 1G3WA 4BUPA 3OWTA 5HVQC 4HV6A 4HRIA 5HDNA 4U7DA 3ZQHA 1P7JA 3RSNA 3WU1B 5FKLA 4IHXA 4Y17A 3M7GA 4IVNA 3O6BB 2M7BA 4PFPA 5FD5A 1FTTA 4M3BA 5JLWA 3S3NA 4YIIA 3GFLA 4W97A 3TO6A 4D1QA 4B48A 2HVSA 5CVUA 4UB8C 4N9HA 1BR4A 2KP6A 4V19K 3MCZA 3PFIA 2VKHA 1WSUA 2F4OB 3IUOA 3KYDB 5M3FJ 1HQCA 1REPC 2KIMA 5DCMB 5HOOA 4EJTA 3P9IA 5DD8A 2JT1A 2CG4A 4D7NA 3G71I 1I39A 3IKTA 2ZCWA 1FP1D 2EZHA 2L9SA 2ZXHA 3I53A 4BQQA 2CV2A 2P4WA 4RMNA 2NNNA 3FXRA 2MBFA 3ZMDA 2HNHA 4BXFA 3A0HC 2UUZA 3HXLA 5GPCA 1DP3A 3I9V2 3COAC 4RM2A 3CQZJ 3CCRI 5GTIC 4RAZA 3MZHA 2ID6A 3P7NA 2EPFA 5DTDA 1XPXA 4A3BJ 4MIMA 2EV6A 2GLOA 2EIKH 2ZMEB 1XG1A 2DT6A 2R7DA 4NHJA 1D1CA 1WJAA 4M3EA 4A2UA 1U8RA 1V5EA 1SANA 2PJRA 3DU6A 4M71A 2PLYA 1X3WB 1MH4A 4XLNF 2JMWA 1ETVA 3CJTB 2CYYA 3KLOA 1QHGA 3K4BA 4BXXJ 3ZXSA 1V3FA 2H1KA 4E70A 3FHZA 2XAHA 3H0GJ 2DMPA 1R22A 1WVRA 4BQNA 4OIPF 1IV6A 3BTJA 1BI2A 2MYSA 2BW3A 1AKHB 1W7PA 4NC6A 1EH8A 3E0JB 1F36A 4F52A 1ULYA 4YFKF 1GLNA 2P5VA 1A35A 5EG0B 3K6GA 1IN4A 4XKBA 1W0TA 4J00A 1DDNA 1R58A 2WY7Q 2P5LC 4Y4RA 2K3PA 1HC8A 1B72B 3P9CA 1B59A 2PMZN 2VB6A 2WB1A 3ZMUA 4M9XA 4PJ0C 2EZKA 1VQLI 3CLOA 1SC7A 5DYMA 4BGDA 5EEAA 3G73A 1YO5C 2YU3A 4L9JA 1BW6A 1FOXA 4OWRB 3BG7A 2GQQA 1ZRCA 2FU4A 4HG2A 2DFFA 2QQAA 3F8BA 2X6XA 2M3AA 3RQIA 2XGCA 3DKYA 3CCJI 1VQMI 2NS8A 5DUKA 3S2HJ 5FD6A 3S1QJ 1FPQA 1D1BA 2HPIA 3E6BA 3QU6A 2CV0A 2W82A 4C3JJ 1IF1A 3OS0A 2DA3A 4CCOA 1TC3C 2CQKA 4B44A 4P5OA 4A3GJ 2V6CA 2WB1N 4MTEA 1LFPA 4RGRA 5IYDJ 3LMMA 5J3LA 1W4MA 2HVQA 4ITVA 2LF7A 1KYWA 2M87A 3GTOJ 5FRNA 3IWZA 2LP0A 4ENNA 3R0AA 4I0BA 2IA0A 1IDZA 1LNWA 4YFXF 1K61A 1D8JA 2R7UA 4RBOA 1WWXA 1WFXA 4GYGA 4MQ9F 4G94A 4CYDA 4CO8A 1Y1WJ 3ZCOA 3K4JA 1IXSB 1YW9A 3M9AA 3VYRB 3GX4X 5A2QZ 3CMEI 1MJ9A 2A68F 2CH0A 5D8LB 2OUMA 2QA4I 3JRGA 1WJCA 2ETHA 2LBFB 5A2QK 5IT3A 3IV5A 5E3OA 2XGDA 4U7BA 4HQEA 1ZREA 4HDUA 2ESHA 4LB6B 5E1XA 3RKXA 4QIWN 3F8NA 3N4MA 2F2EA 4OIRF 2XKOA 2M9HA 1WZ2A 3CC2I 3V8JA 2VL8A 1FX7A 4XN0A 3HB9A 2GZWA 2HU9A 3FXQA 3N97A 2AQFA 2DAOA 3R60A 2CS3A 4XM3A 1LFUP 1TZLA 1YRNA 4HW0A 2F48A 3S1NJ 4XLAA 5IT9Z 3PIPF 1USSA 3ZQCA 1EF4A 1J09A 5BPIA 2NXNB 5LRRA 2PEXA 1I3QJ 4LIVA 1YJWI 2HEOA 1G8XA 3LQRA 5F0FA 1X1DA 4UXNA 5IT9K 2E7WA 3A4CA 3L2CA 4HLYA 2A5WA 2KFDA 2X1DA 4CCLA 4BDZA 1FTZA 4PK4A 1IN7A 2PN6A 3EYYA 3IRRA 2A5YB 3K4CA 1YJNI 1GV5A 5BNGA 2EFOA 1T6SA 2Q8KA 3V7CA 1U6GA 1OYYA 1I6XA 2COBA 3TP0A 4IPAA 2VN2A 3WGIA 5F64A 2R93J 2H27A 5IOZA 2HYGD 1HLVA 2CUFA 3OSGA 1S6LA 3KZIC 3ONQA 5DEQA 4R79A 4J19A 1OKRA 2RN7A 3DEEA 2HKXA 4E7HA 2GAUA 5E8IA 2WA0A 4PSWA 2VE9A 3S93A 4EM1A 1YITI 1S7OA 4YIFA 1HOMA 1BA5A 1FMWA 1OYWA 3OYEA 4ZZLA 5EGOA 1UAAA 2X0LA 2EB7A 5ICCA 5IP9J 1I3AA 1AWCA 1JKPC 2DA1A 4AC0A 1F4KA 3HRMA 1EJ9A 1K6YA 1Z9CA 3E6MA 4L5IA 1VQOI 3VOEA 4EGZA 1TT0A 4NDLA 1OYIA 1BBYA 4ZYDA 1OCOH 2M1BA 4RA2A 5F27A 4A3EJ 4II2A 1RETA 2EINH 1V4RA 4KDPA 4XKCA 1O7FA 3O8GA 3CD6I 1NK3P 3U1DA 3H0DA 2OBPA 3E3VA 1PJRA 1N75A 4AIKA 1KQ8A 3A2KA 1HSJA 4WXDA 2I5UA 3AKZA 4FQGA 2QLZA 4LG0B 1X2NA 3R6SA 3ABMH 2IS1A 3E5UA 4DW6A 4C3HJ 4M6VA 3TEDA 4BJTA 2QQ9A 5F0CA 1FMVA 3LSRA 1SEUA 2RQPA 4OMYA 1BI1A 3TOAA 2PFBA 3VYSB 4UY8I 1SAXA 4IZZA 3VSKA 3D5LA 5GTHC 4XK4A 3T5XA 4QPOA 1O7LA 1VZ0A 2VLAA 2A6EF 1LJ9A 4P9UA 3S8PA 3KCCA 3R4KA 2KPMA 4AWXB 3QU3A 2BGCA 3F22A 4E4HA 2VC0A 1YX3A 1DU0A 4OAYA 5CJ9A 4JP0A 1W7PD 4Y7NJ 5BPDA 2M8GX 3OIOA 3H35A 2LVSA 1PVEA 3F8FA 2KDZA 5E3NA 1MZBA 3VYUB 2BXZA 2R7RA 4G12A 4ANJA 3GWZA 2F5VA 1T98A 1LUJB 2ZXJA 4DNCA 1LQ1A 1FOKA 4Q47A 2WBMA 2O5RA 4XBFA 3CJRB 1A31A 3AG4H 3O2PE 3V8KA 3KP2A 5KK1A 4I02A 3GTPJ 3K4MA 3F0CA 1S3JA 2LFBA 2K02A 2MH2A 4NQWA 3LNQA 1O3SA 4ZYHA 3QOPA 4BJ6C 3CCVI 5IYBJ 1D0YA 1FSEA 1RUNA 1WI3A 3Q9SA 4ENMA 4DZPA 4WXHA 5M5XJ 1SVOA 4PGGA 3KP7A 4BE2A 1R5HA 3TDZC 3HGYA 3FM3A 5CQEA 4BE1A 3A01B 2WY8Q 2E34A 1E3HA 3S17J 2RQQA 2A6HF 3H9QA 1BM9A 1TWHJ 4KJZA 1TLHB 2CQNA 5LBQA 3ELKA 4BQOA 1ZELA 1JUSA 1XCBA 1Z05A 1STZA 2MSYA 4HQMA 3ROUA 5LD2C 3F8MA 3I0TA 3HSEA 2E2IJ 4OAZA 2B9SA 1A5JA 1FOWA 1SFXA 1KA8A 3OY9A 1YX5A 3HOSA 3S2DJ 1FLIA 2PG4A 5GADJ 4D5CA 4IRIA 1HKSA 2DK5A 4HX8A 2FBIA 4GDFA 1C0WA 4I0AA 3NARA 5H6QA 4IO9F 1JTXA 3ZMZA 3K9TA 2HQRA 2DT5A 3CTAA 3MMYB 3U1KA 3EPZA 1HF0A 3MQ0A 3ZQGA 2M34A 1FJLA 1SFOJ 4LITA 2K86A 1JUMA 4V2GA 2QQBA 2M4KA 1MNEA 1UJ8A 2QSHX 3HIFA 2QF7A 3NRVA 3GTLJ 1HKQA 1BR1A 2DFHA 3GLXA 2PMUA 3GFJA 1F5TA 5JHUA 1LDDA 3DQVC 3GCMA 1SVLA 2XPVA 5HDKA 2GWRA 4Q48A 2WAFA 4UVBA 2LKSA 4G7HF 4CICA 2FQ3A 3L00A 1CF7B 1GUUA 3G3ZA 4OU0A 3L2UA 2OC6A 1FEXA 2NOJB 3WU2C 3FK7A 2CWEA 4PJNA 1TT5B 2Z9OA 1JT6A 3ZRGA 2O7OA 3QYFA 3HRUA 3DLLF 2IA2A 1T08B 5DCFA 4GO1A 2RC4A 3BCBA 4EATA 4PJLA 4EQQA 1TNSA 1X4OA 2R7SA 2QVOA 4JBAA 3VEPA 3JTHA 1OCRH 4KFCA 5E3MA 4XNFA 3K7AJ 3IRQA 5FRMA 2BYVE 2IGMA 4DOZA 2CQXA 2L3DA 1V55H 1V54H 2HFHA 2L02A 1U5TB 2W24A 2IJLA 1HW5A 1ACIA 1W1WE 2A05A 4MGRA 2JA5J 3W2VA 4HSTA 2V9VA 3AAFA 3FF5A 1HW1A 3F23A 5K5OA 5JVGF 2Q2EA 4HPQA 5JFRA 3JRDA 1ZRDA 5K7ZA 3BPVA 1IRGA 4MO7A 4RLQA 1IRFA 2JQ7A 5HNHA 2Q1ZB 1IUYA 1ZGAA 2HDDA 3DPTA 2QGUA 1BOAA 1OR7A 3BPXA 2E60A 3CP8A 4CSWA 1LPQA 3HTUA 4ZDOA 1FY7A 2EA2A 2MC3A 3ISPA 3CCEI 4BEHA 2K3FA 4J01A 3DEUA 1F9NA 4NUBA 1Y39A 3OYKA 2VQCA 4E6KG 2VXZA 1PUEE 4OMZA 2NVXJ 4IKFA 1T0FA 2JUGA 3HKZA 1FIAA 1TBXA 1UZCA 1OLTA 3FISA 3FBIB 2B63J 2OZUA 2YX4A 3MKLA 1K4SA 2BY2A 3OSFA 2M4GA 3Q0WA 3EQLF 3J7YJ 4I01A 5F6FA 3GBGA 1DP7P 4JK1X 1OPCA 4M9SA 3ML6A 3PL8A 3ASNH 3J81K 1ETYA 1TQIA 3MFKA 4A3KJ 4S0HB 2DMTA 2XAUA 1S7AA 3UR3C 3DU5A 3HOZJ 1IUFA 1RPWA 4HNUA 2QM3A 2Y0MA 1OISA 2ZFWA 3GF2A 3BG5A 2MD0A 2Z2SB 1VQ7I 3W2AA 1OCZH 2EFPA 3CJNA 5KAFC 1T8IA 3K1NA 1ETOA 4C3IJ 4YELA 5ICFA 2X4HA 1ZKGA 2P8TA 4BDYA 4XOPA 4KMFA 1X3ZB 2DOEA 4A5MA 3BR3A 4ZYGA 5FKOA 3FM5A 4XLHA 2XUBA 3DWLE 4CYCB 3G4SI 3HRTA 3DPUA 2LSOA 3BDDA 4I7HA 4MFEA 1ON2A 4HX7A 4LK0F 4AYBN 3JSOA 2CU7A 5TISC 3HOYJ 2O3FA 2VKVA 2WC2A 1I1SA 2G9WA 1S72I 1X19A 4B1RA 3ULQB 1YW8A 3N05A 2ID3A 2MC4A 3GTMJ 2HDWA 4U87A 2W84A 3FXMA 2ELKA 1V5GA 3H9JA 2O8XA 2V7FA 4B3AA 4U0WA 3MKYB 3LSHA 1ETKA 1MMSA 1MDMB 4R8HA 4S04A 4DZJA 1XDUA 1MGTA 3OYIA 2KIFA 3OR1C 4BY7J 1BR2A 1WKMA 4MEXF 3HPHA 1FYLA 3H1CA 4A69C 2O03A 2GXBA 4IRHA 3FXOA 3DPLC 3G2BA 4HF1A 3F9KA 1EA3A 3NAUA 2LC2A 3CUOA 3DBLB 4D7MA 4UUVA 3BJ6A 1LE8B 1J2XA 1LKXA 1VQKI 3DTKA 5H2FC 2NVYJ 3TKYA 2R7WA 2LLKA 5DCMA 1BJAA 4HYEA 1O4XA 5CPRB 4XORA 1LB2A 2M7AA 4ESBA 3J7AO 5LRSA 1E3PA 3FWEA 4DBQA 4BHCA 2GOMA 4PJJA 2O8KA 5IP7J 4BHBA 1P4XA 2IRFG 3LSGA 2NRAC 3IL2A 5F1JA 3SEZA 3I5UA 4A3DJ 1D5YA 5KVRA 4XSXF 3BZKA 1QPMA 2L7ZA 3CF5F 3KP6A 4BU2A 2YUSA 4O6JA 3BP8A 2R4GA 2DW4A 1KU2A 1WH5A 3RKWA 1H9TA 4S05A 3FK6A 1I1GA 2H1LA 5ED4A 2A07F 1Y0NA 1Z3YA 4X0GA 3OIQA 3SDGA 1JTYA 5DD4A 1P4WA 1ON1A 2Y69H 1MMNA 1LDJA 2RAEA 2PBIA 3ABUA 3FXLA 2V6EA 3OL3A 2E1OA 1MD0A 5D6FA 4FCYA 5TGTA 4E7IA 3L2WA 2XHKA 3BR0A 2BY3A 2KRCA 1OR7C 3SJMA 1WI9A 3J7ZI 5LGTA 3S1RJ 2R3SA 4U0YA 2HZDA 1X1AA 1UELB 1Y56A 4U88A 1E17A 3IH3A 4YG2F 3WTXC 4EEFG 1ERDA 5J8CA 2ISZA 3FKIJ 1NTCA 2MABA 4I2OA 3KX2A 3HOTA 1HW2A 1AA7A 1T0FC 4KN7X 3JRFA 1K79A 3DLAA 2DQLA 2V9PA 2LMDA 2OD5A 3RCOA 3V42A 1SAUA 4BS9A 1TWCJ 1D3YA 5IP6A 3BT9A 4BBSJ 2BVLA 3E6CC 1BW5A 1YS7A 2PMZA 2O0YA 4BKXA 3DXJF 5JHFA 3OYLA 2DA4A 3CUQC 5K5QA 2KLOA 2PI0A 2N8GA 2EILH 5BQTA 1G2HA 2RV8A 2EBIA 4ZYEA 2LNBA 2H8WA 4L18B 2HS5A 4BL0B 2FBKA 3CCSI 1APLC 1GXQA 2X51A 4FETA 2ADUA 2E71A 1R00A 1VQ5I 1SMTA 3IC7A 2D5VA 2GM4A 1VQ9I 2X6WA 1XSVA 3KEQA 3PO2J 2KHMA 4A0ZA 2IGOA 3E5QA 3DBRB 4RDUA 1XMXA 5CYVA 1D8KA 1O3TA 2VBZA 5J6XA 3S32A 4BBRJ 2ZJQF 2E1MC 1SFUA 2R7TA 1QQIA 2WWYA 1IDYA 4ON0A 2XASA 1T2KA 1U9NA 4OINF 4R1HA 2PJRB 3HOVJ 4KIGA 5B3SH 4RB3C 4N4OB 2ZXWH 4KIFA 3H92A 1TWGJ 1XX5A 5JR3A 2KIUA 2YR2A 4XLPF 1K4TA 2KRHA 1J0RA 1EH6A 2F4IA 1YG2A 4G8XA 3MVPA 4BAYA 3K10A 3HGGA 3LL7A 3WTZA 1T33A 3MZ8A 3H5NA 1FBUA 2DBBA 3I4PA 5GAGJ 1VQNI 1TL8A 5C4JJ 2QUFA 4BH9A 1Z21A 3KZZA 4BY1J 3CCQI 1W5TA 2FF4A 3TQNA 1ORKA 3L09A 1POGA 3F3XA 2Q0OA 1QU3A 2DMUA 2A6TA 3BR1A 3M1EA 2DYSH 2M5WA 2O61A 2JVHA 4ZDLA 3RZDJ 2HKOA 5D8KB 4YIRX 2VIXA 4A3JJ 1VF9A 1G3YA 1RESA 1PP8F 4C30A 3BY6A 1P4AA 1T95A 1IC8A 3RJPA 1X2MA 1MJBA 2QBYA 3ZPLA 4CHUA 4M73A 3WTSC 2IS6A 5TRDA 2E5ZA 4P55A 2AXTC 5BS6A 5L3FA 2PX9A 4UVCA 1G4DA 2R5ZB 3FIWA 2ZSHB 1XSDA 2FA5A 4A93J 3HDDA 2OJED 3OYMA 3JRHA 4A3IJ 1IN8A 5E1WA 2VBWA 2VJIA 4FHTA 2WAEA 2BY0A 3QQAA 2CGPA 4G9YA 5DM7F 3BZCA 3L7WA 2OCEA 1M1EB 1RUOA 5K5RA 1R9TJ 3AFHA 5J4YA 3KETA 4D5FA 5CLSA 1ITYA 2ZNYA 3W3CA 1A04A 5BOXA 2DU9A 4HEA2 3WTYC 1BC8C 5HLGA 2XSJC 1USTA 3S15J 1ZR4A 1Y6IA 4PSXA 5K7FA 4C2TA 3HUGB 4IEJA 2CW8A 2Z16A 3AL0C 3GFMA 3IAM2 5KCMA 3ABLH 2STTA 2CFOA 4WCGA 1HDDC 1YS6A 4IHTA 3RKYA 4A3FJ 2FMYA 1LVAA 2LKXA 2L5QA 3GMEA 5D4RA 1J59A 3OL4A 3OS2A 2JWTA 3I71A 2HOEA 2OF7A 1L0OC 2AHQA 2ZBKA 2ZSIB 3BTCA 3PNYA 5D6EA 3S16J 1S5LC 2RDPA 1R4MB 2K5CA 2DO7A 1QGPA 3BQYA 4KT5C 1E3OC 2DXIA 3JSPA 3ABTA 4LGWA 1MBHA 1RC9A 5DV5A 4ZJZA 2ME0A 3SXYA 1YIJI 3GZ5A 2DA2A 5B1AH 1UG0A 1GVJA 3RQ4A 5CQGA 3BC8A 5FFZA 2IVMA 5CVIA 5ERIA 4EJWA 5K1YA 1QRYA 3PFYA 3RIRA 4L0YB 4LG0A 1W0UA 2QSGX 4CDGA 3ZMVA 4UB6C 2IS2A 2KZVA 2I10A 3MWMA 2P5KA 4PGHA 3VB2A 4JYKA 2DTZA 2JPBA 1N25A 1Z67A 2QKMB 2PJPA 2G0EA 1LFBA 1X3UA 4HA8A 2UXNA 2FD5A 2B7EA 3EUHA 2H6CA 2X6OA 4LD5A 3ECHA 2VPRA 4F55A 2EZLA 3KP4A 4LOCA 2HTJA 1Z91A
chains in the Genus database with same CATH topology
2EK5A 1IZ1A 4B09A 1XMAA 3RI4A 2VT2A 1U78A 1Q1HA 3VODA 2FBHA 5HLHA 1BIBA 5FO5A 4GCVA 2CW0F 3KFWX 1R1UA 4ETSA 1HSTA 2F5EA 3HYIA 5LEKA 1R36A 3ZN0A 1ZH5A 4EV0A 1PP7U 3LFKA 2BBYA 3ZMSA 3F6OA 1U3EM 1ZG1A 1ZLJA 2FEZA 2BV6A 2GA2A 3FXUA 1ZG5A 4I98B 2A3SA 1KQ0A 3WE2A 3LA3A 3PQKA 4YFNF 3F72A 4RB2C 1ZN2A 1DPRA 2D1VA 4AIHA 2AS5F 1PDNC 3U9GA 5CVVA 2MA3A 3K69A 4LMYA 4BHPA 3SZPA 1B1BA 4UV8A 1DUXC 5LLQA 3GVAA 2Z99A 2MLKA 5D5WB 2XGXA 4D0PA 4ENJA 2QZ8A 1XMKA 2D2WA 4F7ZA 5ILVA 1CF7A 4H0EA 4GGGA 1XGOA 2FSWA 3C3WA 2D1HA 1ODDA 2D45A 3KZYA 3K1MA 4GYIA 5E20A 1K78A 3TGNA 2KRFA 2FOKA 1B9NA 2F5CA 1BC7C 3TOBA 4L0ZB 5HDGA 1U5TA 5CVJA 4A0XA 1XD7A 5ICEA 3M8FA 3O3KA 3T8RA 2RKHA 1KU9A 1FZPB 4FX0A 1R23A 2ESNA 1ZLKA 1R1VA 2OAZA 3I59A 3R61A 4HF2A 2NYXA 4A6DA 3BWGA 1T39A 3L9FA 4EJOA 1TW3A 2O6GE 1OMIA 3WODF 1J7KA 2IPQX 4KYWA 4OIQF 5LHHA 3V7SA 5FFXA 2AXLA 2FMLA 3HHGA 1FYMA 2VT3A 1QZYA 4HDVA 5HS7A 4AVPA 4U0VA 2YX7A 5EEHA 3CO6C 3NEUA 3RYRA 3I64A 4K2EA 2MLGA 4IJAA 5D5UB 2JTVA 2G7HA 4XSZF 4PZJA 4JQFA 4PDKA 5LHIA 2OA4A 1SMYF 1WRJA 1K6OA 3GW2A 2DPUA 2L4MA 2JRTA 5AONA 4ASNA 3GXOA 3QP5A 1RNLA 2KJCA 1I5ZA 5L3GA 2L4AA 3MAJA 2A61A 2F5DA 3U2RA 3JAMZ 3DV8A 5FB2A 2Y48A 4KIBA 4M74A 3JAMK 1QO0D 2EV0A 3HHHA 4M6YA 3CUQB 5BMZA 3F8CA 2LKPA 2VONA 2OZ6A 4KMUX 4IHSA 3K0LA 2P6TA 2YSRA 1ZAOA 4Y13A 3EYIA 2CO5A 2OU2A 2QWWA 2DPDA 5H6RA 1XDSA 3LAPA 1T38A 3J80Z 2XAFA 3K2ZA 2IT0A 1W5SA 2HDCA 2C6YA 3HTSB 1Z6RA 3J80K 3FX3A 3WU0A 3IHUA 4OIOF 1BIAA 1GHCA 1FT9A 2FE3A 5L3CA 2M8EA 3MEXA 3R0JA 4UVAA 1YQAA 4Y15A 4EM0B 4HLXA 1GXPA 3HSRA 2K4BA 4A12A 4KN4X 1U5TC 1JHFA 1S29A 2XAGA 4L9TA 1XCVA 1KGSA 3I54A 5DDGA 5JVTA 1RIOH 4KNYA 4UNOA 1JHHA 3WTUC 2LDUA 5HLIA 4EGYA 1G6NA 2DLLA 4QWQA 4HBLA 1TQPA 2DK8A 5AIPA 3RDIA 2ZMEA 2COMA 2KKOA 5JI6A 4Z2YA 1UB9A 1UHMA 3BOQA 3GZ6A 2UWMA 3C18A 2R7FA 4EM2A 1ONVA 3DFGA 3EDPA 3SQNA 1ZHFA 4M9ZA 1QZZA 2Z3YA 2IW5A 5L3EA 4QLCU 4UHTA 1SD4A 5D4SA 5D5VB 2L54A 4TV7A 3KEOA 2Z33A 1FSHA 3RYPA 4RB1A 3RPUA 4EJUA 3GEZA 5HS8A 4KICA 5E17F 4RB0A 3V4GA 3WTWC 1FBQA 1YYVA 2EWNA 3QPTA 3SZTA 3JW4A 5LEJA 1TTYA 3T1BA 2VODA 2GIVA 4LB5A 4MQVA 3ERED 3KP3A 4ESJA 2UXXA 4ENKA 1Z7UA 4M6XA 1FWZA 1MKMA 2RNJA 2OQGA 3IKVA 1FYKA 2V1UA 2EA4A 1FP2A 4LFUA 1W7PB 2W57A 3OOPA 3C7JA 3OV8A 4HX4A 3GYHX 4HZFA 1SFEA 2RGVA 1UFMA 4WXCA 4DQ2A 4P9FA 3DKWA 2GA1A 3C1DA 2BE5F 1TQMA 4LLNA 3SFZA 1DPUA 1YW7A 2VOOA 3KE2A 2WTEA 2CFXA 2CSOA 1LEBA 1E2XA 1F1ZA 2L01A 1G3TA 4G7ZF 3VFZA 2J5PA 1LDKB 3HUGA 4HV5A 5HS9A 3ECOA 1XSXA 3GUDA 1WQ2A 1R5GA 5E1ZB 3JTGA 4M72A 2P7VB 1O3RA 5AIQA 2PQ8A 1IXRC 2G7UA 4IRGA 2Z5UA 3CDHA 4P96A 5E18F 2QBYB 4EVIA 1ZYRF 3QRFF 2PMHA 3LSTA 1B9MA 1KU3A 5FGMA 1G3SA 4AD9A 3GFIA 4LK1F 1Z1DA 2NS0A 4PCQA 2HQNA 3LAJA 3WG9A 3FZVA 4KUMA 2VOPA 4NB5A 2Y75A 1YTYA 2HGCA 2IP2A 3M8EA 3ZN1A 2QENA 5CVRA 4WX9A 3I58A 1S8NA 3BJOA 4LLGF 4N0BA 1O3QA 2EFQA 2B0LA 1JGSA 2OQRA 4BNCA 3WGHA 4BQAA 3W6KB 2VE8A 4G7OF 2P7CB 1EV7A 1IW7F 4RGSA 2HTSA 1XGMA 4RS8A 2XRNA 2VBXA 1L3LA 2XV4S 1TW2A 1XGNA 4OOIA 2H6BA 1XB4A 4UV9A 1MJAA 2STWA 1Z6TA 4G6DA 2DFIA 3ZP5A 1H9GA 5L3DA 3BJAA 2XAQA 2M45A 1NHAA 4FX4A 1KQ9A 3QP6A 2FXAA 5ILUA 1BN5A 3WE3A 4MEYF 3PQJA 3SHFA 4A6EA 2A69F 3RTRA 1AOYA 3WTVC 1VTNC 3TDUC 5LGNA 2K27A 2MH9A 1FNNA 3BZ6A 3DP7A 3DF8A 1J75A 3WGGA 4KA4A 5EEGA 3FMQA 1YIOA 6PAXA 3F21A 4CZZA 3B73A 1UCRA 2JPCA 3Q9VA 2XVCA 2DTRA 2EV5A 1O57A 2ZJ2A 2BEOA 1J9IA 1J5YA 2H09A 2XKPA 4FT8A 4O5VA 2YPRA 2W25A 2JZYA 2EFWA 2V1XA 2HWVA 1Y0UA 4HAMA 2GXGA 5TJJA 4A0YA 3TO7A 2ZNZA 1IN5A 4L5JA 3V8LA 1H0MA 3H3ZA 3T0YA 1HBXG 4O3MA 2EJRA 3LA2A 4WWCA 2IA1A 3E5XA 2NNYA 5D5XB 4ESFA 1ZRFA 2XROA 1D5VA 3TO9A 4HF0A 4L9NA 4B8XA 4LJZF 3FMRA 5ILSA 1SD5A 1TNTA 5L3BA 4RAYA 3EETA 2ELHA 2FNPA 1QBJA 2V79A 3BROA 3D0SA 4ZH4F 2MD5A 3F6VA 2NAZA 2VC1A 4BYYA 1U2WA 1XN7A 4Q5SF 1CGPA 4ZZDA 1LEAA 1K78B 3KLNA 3QAHA 4BXUA 2XAJA 2WV0A 2FRHA 3IWFA 4A5NA 2P6SA 4EJVA 3LWFA 2E7XA 2ZO4A 1IXCA 1B4AA 2DQRA 5J8FA 2XIGA 2TDXA 3CO7C 2W85A 3I59B 1BI0A 1ZG3A 1KYZA 3MZYA 4RGXA 3W6JB 4WK8F 1HXDA 3WTTC 2K7LA 1P2FA 1FC3A 3GO5A 1B6AA 3HRSA 1QNTA 4I09A 4AIJA 3RPQA 4MNUA 4GXOA 2FNAA 2LF8A 1EH7A 1UHWA 2HYFA 4MHGA 2M30A 2E1NA 1RZ4A 2HZTA 3LQQA 1R1TA 1P92A 3J81Z 2ISYA 1R7JA 3CUQA 1P6RA 3KP5A 3HSFA 2EFNA 2KJBA 1JE8A 3V7RA 2QYOA 1HKTA 3LA7A 3T8TA 1XGSA 1KU7A 4WF2A 4Q4ZF 5F1RA 2UZKA 4G6QA 2E1CA 3ZMTA 2V1DA 4N9IA 1ZARA 3QPHA 1JXSA 2ZKZA 1IN6A 3P9KA 2ACJA 4CGZA 5H20A 2HR3A 4HOBA 4LLLA 1MDMA 5FLXZ 2JSCA 4EMSA 1K7AA 3Q5FA 1ZGJA 5DUIA 4L9VA 5FLXK 4RGUA 1I27A 3NQOA 2J5OA 1SD6A 4XRFA 2RVCA 5LGUA 3ZQ7A 1YFHA 2DI3A 3S2WA 3REOA 3H3UA 4IF4A 2H94A 2K4JA 5E8GA 1RI7A 3B02A 3E97A 4CXFA 2VBYA 4MTDA 1IAWA 3FMSA 5ICGA 3K1PA 4IXAA 1FBSA 2F5FA 1SD7A 5LHGA 1BI3A 3E6DA 1YLFA 1G3WA 5HVQC 4HV6A 5HDNA 4U7DA 3WU1B 4Y17A 3M7GA 4IVNA 3O6BB 5FD5A 4YIIA 3GFLA 3TO6A 5CVUA 4N9HA 3MCZA 3PFIA 1WSUA 4EJTA 1HQCA 1REPC 2KIMA 5DCMB 5HOOA 3P9IA 5DD8A 2JT1A 2CG4A 3IKTA 2ZCWA 1FP1D 3I53A 2P4WA 2NNNA 3FXRA 2MBFA 3ZMDA 3COAC 4RAZA 3MZHA 3P7NA 2EV6A 2ZMEB 2R7DA 4NHJA 4A2UA 1U8RA 4M71A 2PLYA 4XLNF 3KLOA 2CYYA 1V3FA 4E70A 3FHZA 2XAHA 1R22A 4OIPF 1BI2A 1W7PA 1EH8A 1ULYA 4YFKF 2P5VA 1IN4A 1DDNA 1R58A 2P5LC 3P9CA 1B59A 3ZMUA 4M9XA 3CLOA 5DYMA 3G73A 1YO5C 2YU3A 4L9JA 2GQQA 1ZRCA 2FU4A 2QQAA 3F8BA 5DUKA 5FD6A 1FPQA 3QU6A 3E6BA 1IF1A 2CQKA 4P5OA 2V6CA 4MTEA 4RGRA 1W4MA 2LF7A 1KYWA 2M87A 3IWZA 4ENNA 3R0AA 4I0BA 2IA0A 1LNWA 4YFXF 1D8JA 1WWXA 4GYGA 4MQ9F 4G94A 4CYDA 4CO8A 1IXSB 1YW9A 3M9AA 3GX4X 5A2QZ 1MJ9A 2A68F 5D8LB 2ETHA 5A2QK 5IT3A 1ZREA 4U7BA 4HQEA 4HDUA 2ESHA 4LB6B 5E1XA 3RKXA 3F8NA 3N4MA 2F2EA 4OIRF 2XKOA 3V8JA 1FX7A 2GZWA 3FXQA 3N97A 2DAOA 3R60A 4HW0A 5IT9Z 1USSA 5BPIA 5LRRA 2PEXA 2HEOA 3LQRA 4UXNA 5IT9K 2E7WA 3L2CA 4HLYA 1IN7A 2PN6A 3EYYA 3IRRA 2A5YB 2EFOA 1T6SA 2Q8KA 3V7CA 1U6GA 1OYYA 1I6XA 4IPAA 2VN2A 3WGIA 5F64A 2H27A 2HYGD 1S6LA 5DEQA 4R79A 1OKRA 2RN7A 2HKXA 2GAUA 5E8IA 2VE9A 4EM1A 1S7OA 4YIFA 1OYWA 4ZZLA 2X0LA 2EB7A 5ICCA 1AWCA 1F4KA 3HRMA 1Z9CA 3E6MA 4L5IA 3VOEA 4EGZA 4ZYDA 1OYIA 1BBYA 2M1BA 1V4RA 4KDPA 1O7FA 3U1DA 2OBPA 3E3VA 4AIKA 1KQ8A 1HSJA 4WXDA 2QLZA 4LG0B 3R6SA 3E5UA 2QQ9A 2RQPA 4OMYA 1BI1A 3TOAA 2PFBA 1SAXA 3D5LA 3T5XA 1O7LA 2A6EF 1LJ9A 4P9UA 3KCCA 3R4KA 4AWXB 3QU3A 2BGCA 3F22A 2VC0A 5CJ9A 1W7PD 5BPDA 3F8FA 1MZBA 3GWZA 4DNCA 1T98A 2ZXJA 1LQ1A 1FOKA 4Q47A 4XBFA 3O2PE 3V8KA 3KP2A 5KK1A 4I02A 1S3JA 2K02A 2MH2A 4NQWA 1O3SA 4ZYHA 3QOPA 1FSEA 1RUNA 3Q9SA 4ENMA 4WXHA 4PGGA 3KP7A 1R5HA 3TDZC 3FM3A 2A6HF 1BM9A 1TLHB 5LBQA 3ELKA 1XCBA 1Z05A 1STZA 4HQMA 3ROUA 3F8MA 3I0TA 3HSEA 1SFXA 1KA8A 3HOSA 1FLIA 2PG4A 4IRIA 1HKSA 2DK5A 4HX8A 2FBIA 1C0WA 4I0AA 5H6QA 3ZMZA 3K9TA 2HQRA 2DT5A 3CTAA 3MQ0A 2K86A 2QQBA 3HIFA 3NRVA 1HKQA 3GLXA 2PMUA 3GFJA 1F5TA 5JHUA 1LDDA 3DQVC 5HDKA 2GWRA 4Q48A 4UVBA 4G7HF 4CICA 2FQ3A 3L00A 1CF7B 3G3ZA 4OU0A 2CWEA 2Z9OA 3HRUA 2IA2A 5DCFA 4GO1A 2RC4A 4EQQA 1TNSA 2QVOA 4JBAA 3VEPA 3JTHA 4KFCA 3IRQA 2BYVE 2L3DA 2L02A 2HFHA 2W24A 1U5TB 2IJLA 1HW5A 4MGRA 2V9VA 3AAFA 3FF5A 1HW1A 3F23A 5K5OA 2Q2EA 5JFRA 1ZRDA 3BPVA 1IRGA 1IRFA 1IUYA 1ZGAA 3DPTA 1BOAA 1OR7A 3BPXA 3HTUA 1FY7A 2EA2A 2MC3A 3ISPA 3DEUA 1F9NA 2VXZA 1PUEE 4OMZA 1T0FA 1TBXA 2OZUA 2YX4A 3EQLF 4I01A 5F6FA 1DP7P 4JK1X 1OPCA 4M9SA 3ML6A 3J81K 1TQIA 3MFKA 1S7AA 2QM3A 2Y0MA 2ZFWA 3GF2A 2EFPA 3CJNA 3K1NA 5ICFA 2X4HA 2P8TA 4KMFA 4A5MA 4ZYGA 3FM5A 2XUBA 3HRTA 2LSOA 3BDDA 4I7HA 1ON2A 4HX7A 4LK0F 3JSOA 2O3FA 2WC2A 1I1SA 2G9WA 3ULQB 1YW8A 2W84A 2O8XA 4U0WA 1MDMB 4R8HA 4S04A 1XDUA 1MGTA 2KIFA 1WKMA 4MEXF 1FYLA 2O03A 2GXBA 4IRHA 3DPLC 4HF1A 3CUOA 4UUVA 3BJ6A 1J2XA 3TKYA 5DCMA 1BJAA 4HYEA 1LB2A 4ESBA 3J7AO 5LRSA 3FWEA 4BHCA 4BHBA 1P4XA 2IRFG 2NRAC 3IL2A 3I5UA 5KVRA 4XSXF 1QPMA 3KP6A 4O6JA 3BP8A 2DW4A 1KU2A 3RKWA 1H9TA 4S05A 1I1GA 5ED4A 2A07F 5DD4A 1P4WA 1ON1A 1LDJA 2PBIA 3ABUA 1MD0A 5D6FA 2XHKA 1WI9A 5LGTA 2R3SA 4U0YA 4U88A 1E17A 4YG2F 3WTXC 5J8CA 2ISZA 4I2OA 3HOTA 1HW2A 4KN7X 1K79A 2DQLA 2OD5A 1D3YA 3E6CC 1YS7A 2O0YA 3DXJF 3CUQC 5K5QA 2PI0A 5BQTA 2RV8A 4ZYEA 2LNBA 4L18B 2HS5A 2FBKA 1GXQA 2ADUA 1R00A 1SMTA 3IC7A 1XSVA 3KEQA 4A0ZA 3E5QA 5CYVA 1D8KA 1O3TA 2VBZA 5J6XA 1SFUA 1QQIA 2WWYA 4ON0A 2XASA 1T2KA 4OINF 4R1HA 4KIGA 4RB3C 4KIFA 3H92A 5JR3A 2KIUA 2YR2A 4XLPF 1J0RA 1EH6A 1YG2A 4G8XA 4BAYA 3WTZA 1FBUA 2DBBA 3I4PA 2QUFA 4BH9A 3KZZA 1W5TA 2FF4A 3TQNA 3L09A 3F3XA 2Q0OA 2O61A 3M1EA 2M5WA 2HKOA 5D8KB 1G3YA 1PP8F 3BY6A 1P4AA 3RJPA 1MJBA 2QBYA 3ZPLA 4CHUA 4M73A 3WTSC 5TRDA 4P55A 5BS6A 5L3FA 4UVCA 1G4DA 1XSDA 2FA5A 1IN8A 5E1WA 2VBWA 4FHTA 2CGPA 4G9YA 3L7WA 1RUOA 5K5RA 3KETA 5CLSA 2ZNYA 1A04A 5BOXA 2DU9A 3WTYC 1BC8C 5HLGA 1USTA 3GFMA 2STTA 4WCGA 4IHTA 1YS6A 3RKYA 2FMYA 1LVAA 5D4RA 1J59A 3I71A 2HOEA 1L0OC 2ZBKA 5D6EA 2RDPA 2DO7A 1QGPA 4KT5C 3JSPA 3ABTA 4LGWA 5DV5A 3SXYA 3GZ5A 1GVJA 5FFZA 2IVMA 5CVIA 5ERIA 4EJWA 5K1YA 3RIRA 4L0YB 4LG0A 4CDGA 3ZMVA 3MWMA 2P5KA 4PGHA 3VB2A 2JPBA 2PJPA 1X3UA 4HA8A 2UXNA 3EUHA 2H6CA 4LD5A 3ECHA 3KP4A 2HTJA 1Z91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK5 A;  1IZ1 A;  4B09 A;  1XMA A;  3RI4 A;  2VT2 A;  1U78 A;  1Q1H A;  3VOD A;  2FBH A;  5HLH A;  1BIB A;  5FO5 A;  4GCV A;  2CW0 F;  3KFW X;  1R1U A;  4ETS A;  1HST A;  2F5E A;  3HYI A;  5LEK A;  1R36 A;  3ZN0 A;  1ZH5 A;  4EV0 A;  1PP7 U;  3LFK A;  2BBY A;  3ZMS A;  3F6O A;  1U3E M;  1ZG1 A;  1ZLJ A;  2FEZ A;  2BV6 A;  2GA2 A;  3FXU A;  1ZG5 A;  4I98 B;  2A3S A;  1KQ0 A;  3WE2 A;  3LA3 A;  3PQK A;  4YFN F;  3F72 A;  4RB2 C;  1ZN2 A;  1DPR A;  2D1V A;  4AIH A;  2AS5 F;  1PDN C;  3U9G A;  5CVV A;  2MA3 A;  3K69 A;  4LMY A;  4BHP A;  3SZP A;  1B1B A;  4UV8 A;  1DUX C;  5LLQ A;  3GVA A;  2Z99 A;  2MLK A;  5D5W B;  2XGX A;  4D0P A;  4ENJ A;  2QZ8 A;  1XMK A;  2D2W A;  4F7Z A;  5ILV A;  1CF7 A;  4H0E A;  4GGG A;  1XGO A;  2FSW A;  3C3W A;  2D1H A;  1ODD A;  2D45 A;  3KZY A;  3K1M A;  4GYI A;  5E20 A;  1K78 A;  3TGN A;  2KRF A;  2FOK A;  1B9N A;  2F5C A;  1BC7 C;  3TOB A;  4L0Z B;  5HDG A;  1U5T A;  5CVJ A;  4A0X A;  1XD7 A;  5ICE A;  3M8F A;  3O3K A;  3T8R A;  2RKH A;  1KU9 A;  1FZP B;  4FX0 A;  1R23 A;  2ESN A;  1ZLK A;  1R1V A;  2OAZ A;  3I59 A;  3R61 A;  4HF2 A;  2NYX A;  4A6D A;  3BWG A;  1T39 A;  3L9F A;  4EJO A;  1TW3 A;  2O6G E;  1OMI A;  3WOD F;  1J7K A;  2IPQ X;  4KYW A;  4OIQ F;  5LHH A;  3V7S A;  5FFX A;  2AXL A;  2FML A;  3HHG A;  1FYM A;  2VT3 A;  1QZY A;  4HDV A;  5HS7 A;  4AVP A;  4U0V A;  2YX7 A;  5EEH A;  3CO6 C;  3NEU A;  3RYR A;  3I64 A;  4K2E A;  2MLG A;  4IJA A;  5D5U B;  2JTV A;  2G7H A;  4XSZ F;  4PZJ A;  4JQF A;  4PDK A;  5LHI A;  2OA4 A;  1SMY F;  1WRJ A;  1K6O A;  3GW2 A;  2DPU A;  2L4M A;  2JRT A;  5AON A;  4ASN A;  3GXO A;  3QP5 A;  1RNL A;  2KJC A;  1I5Z A;  5L3G A;  2L4A A;  3MAJ A;  2A61 A;  2F5D A;  3U2R A;  3JAM Z;  3DV8 A;  5FB2 A;  2Y48 A;  4KIB A;  4M74 A;  3JAM K;  1QO0 D;  2EV0 A;  3HHH A;  4M6Y A;  3CUQ B;  5BMZ A;  3F8C A;  2LKP A;  2VON A;  2OZ6 A;  4KMU X;  4IHS A;  3K0L A;  2P6T A;  2YSR A;  1ZAO A;  4Y13 A;  3EYI A;  2CO5 A;  2OU2 A;  2QWW A;  2DPD A;  5H6R A;  1XDS A;  3LAP A;  1T38 A;  3J80 Z;  2XAF A;  3K2Z A;  2IT0 A;  1W5S A;  2HDC A;  2C6Y A;  3HTS B;  1Z6R A;  3J80 K;  3FX3 A;  3WU0 A;  3IHU A;  4OIO F;  1BIA A;  1GHC A;  1FT9 A;  2FE3 A;  5L3C A;  2M8E A;  3MEX A;  3R0J A;  4UVA A;  1YQA A;  4Y15 A;  4EM0 B;  4HLX A;  1GXP A;  3HSR A;  2K4B A;  4A12 A;  4KN4 X;  1U5T C;  1JHF A;  1S29 A;  2XAG A;  4L9T A;  1XCV A;  1KGS A;  3I54 A;  5DDG A;  5JVT A;  1RIO H;  4KNY A;  4UNO A;  1JHH A;  3WTU C;  2LDU A;  5HLI A;  4EGY A;  1G6N A;  2DLL A;  4QWQ A;  4HBL A;  1TQP A;  2DK8 A;  5AIP A;  3RDI A;  2ZME A;  2COM A;  2KKO A;  5JI6 A;  4Z2Y A;  1UB9 A;  1UHM A;  3BOQ A;  3GZ6 A;  2UWM A;  3C18 A;  2R7F A;  4EM2 A;  1ONV A;  3DFG A;  3EDP A;  3SQN A;  1ZHF A;  4M9Z A;  1QZZ A;  2Z3Y A;  2IW5 A;  5L3E A;  4QLC U;  4UHT A;  1SD4 A;  5D4S A;  5D5V B;  2L54 A;  4TV7 A;  3KEO A;  2Z33 A;  1FSH A;  3RYP A;  4RB1 A;  3RPU A;  4EJU A;  3GEZ A;  5HS8 A;  4KIC A;  5E17 F;  4RB0 A;  3V4G A;  3WTW C;  1FBQ A;  1YYV A;  2EWN A;  3QPT A;  3SZT A;  3JW4 A;  5LEJ A;  1TTY A;  3T1B A;  2VOD A;  2GIV A;  4LB5 A;  4MQV A;  3ERE D;  3KP3 A;  4ESJ A;  2UXX A;  4ENK A;  1Z7U A;  4M6X A;  1FWZ A;  1MKM A;  2RNJ A;  2OQG A;  3IKV A;  1FYK A;  2V1U A;  2EA4 A;  1FP2 A;  4LFU A;  1W7P B;  2W57 A;  3OOP A;  3C7J A;  3OV8 A;  4HX4 A;  3GYH X;  4HZF A;  1SFE A;  2RGV A;  1UFM A;  4WXC A;  4DQ2 A;  4P9F A;  3DKW A;  2GA1 A;  3C1D A;  2BE5 F;  1TQM A;  4LLN A;  3SFZ A;  1DPU A;  1YW7 A;  2VOO A;  3KE2 A;  2WTE A;  2CFX A;  2CSO A;  1LEB A;  1E2X A;  1F1Z A;  2L01 A;  1G3T A;  4G7Z F;  3VFZ A;  2J5P A;  1LDK B;  3HUG A;  4HV5 A;  5HS9 A;  3ECO A;  1XSX A;  3GUD A;  1WQ2 A;  1R5G A;  5E1Z B;  3JTG A;  4M72 A;  2P7V B;  1O3R A;  5AIQ A;  2PQ8 A;  1IXR C;  2G7U A;  4IRG A;  2Z5U A;  3CDH A;  4P96 A;  5E18 F;  2QBY B;  4EVI A;  1ZYR F;  3QRF F;  2PMH A;  3LST A;  1B9M A;  1KU3 A;  5FGM A;  1G3S A;  4AD9 A;  3GFI A;  4LK1 F;  1Z1D A;  2NS0 A;  4PCQ A;  2HQN A;  3LAJ A;  3WG9 A;  3FZV A;  4KUM A;  2VOP A;  4NB5 A;  2Y75 A;  1YTY A;  2HGC A;  2IP2 A;  3M8E A;  3ZN1 A;  2QEN A;  5CVR A;  4WX9 A;  3I58 A;  1S8N A;  3BJO A;  4LLG F;  4N0B A;  1O3Q A;  2EFQ A;  2B0L A;  1JGS A;  2OQR A;  4BNC A;  3WGH A;  4BQA A;  3W6K B;  2VE8 A;  4G7O F;  2P7C B;  1EV7 A;  1IW7 F;  4RGS A;  2HTS A;  1XGM A;  4RS8 A;  2XRN A;  2VBX A;  1L3L A;  2XV4 S;  1TW2 A;  1XGN A;  4OOI A;  2H6B A;  1XB4 A;  4UV9 A;  1MJA A;  2STW A;  1Z6T A;  4G6D A;  2DFI A;  3ZP5 A;  1H9G A;  5L3D A;  3BJA A;  2XAQ A;  2M45 A;  1NHA A;  4FX4 A;  1KQ9 A;  3QP6 A;  2FXA A;  5ILU A;  1BN5 A;  3WE3 A;  4MEY F;  3PQJ A;  3SHF A;  4A6E A;  2A69 F;  3RTR A;  1AOY A;  3WTV C;  1VTN C;  3TDU C;  5LGN A;  2K27 A;  2MH9 A;  1FNN A;  3BZ6 A;  3DP7 A;  3DF8 A;  1J75 A;  3WGG A;  4KA4 A;  5EEG A;  3FMQ A;  1YIO A;  6PAX A;  3F21 A;  4CZZ A;  3B73 A;  1UCR A;  2JPC A;  3Q9V A;  2XVC A;  2DTR A;  2EV5 A;  1O57 A;  2ZJ2 A;  2BEO A;  1J9I A;  1J5Y A;  2H09 A;  2XKP A;  4FT8 A;  4O5V A;  2YPR A;  2W25 A;  2JZY A;  2EFW A;  2V1X A;  2HWV A;  1Y0U A;  4HAM A;  2GXG A;  5TJJ A;  4A0Y A;  3TO7 A;  2ZNZ A;  1IN5 A;  4L5J A;  3V8L A;  1H0M A;  3H3Z A;  3T0Y A;  1HBX G;  4O3M A;  2EJR A;  3LA2 A;  4WWC A;  2IA1 A;  3E5X A;  2NNY A;  5D5X B;  4ESF A;  1ZRF A;  2XRO A;  1D5V A;  3TO9 A;  4HF0 A;  4L9N A;  4B8X A;  4LJZ F;  3FMR A;  5ILS A;  1SD5 A;  1TNT A;  5L3B A;  4RAY A;  3EET A;  2ELH A;  2FNP A;  1QBJ A;  2V79 A;  3BRO A;  3D0S A;  4ZH4 F;  2MD5 A;  3F6V A;  2NAZ A;  2VC1 A;  4BYY A;  1U2W A;  1XN7 A;  4Q5S F;  1CGP A;  4ZZD A;  1LEA A;  1K78 B;  3KLN A;  3QAH A;  4BXU A;  2XAJ A;  2WV0 A;  2FRH A;  3IWF A;  4A5N A;  2P6S A;  4EJV A;  3LWF A;  2E7X A;  2ZO4 A;  1IXC A;  1B4A A;  2DQR A;  5J8F A;  2XIG A;  2TDX A;  3CO7 C;  2W85 A;  3I59 B;  1BI0 A;  1ZG3 A;  1KYZ A;  3MZY A;  4RGX A;  3W6J B;  4WK8 F;  1HXD A;  3WTT C;  2K7L A;  1P2F A;  1FC3 A;  3GO5 A;  1B6A A;  3HRS A;  1QNT A;  4I09 A;  4AIJ A;  3RPQ A;  4MNU A;  4GXO A;  2FNA A;  2LF8 A;  1EH7 A;  1UHW A;  2HYF A;  4MHG A;  2M30 A;  2E1N A;  1RZ4 A;  2HZT A;  3LQQ A;  1R1T A;  1P92 A;  3J81 Z;  2ISY A;  1R7J A;  3CUQ A;  1P6R A;  3KP5 A;  3HSF A;  2EFN A;  2KJB A;  1JE8 A;  3V7R A;  2QYO A;  1HKT A;  3LA7 A;  3T8T A;  1XGS A;  1KU7 A;  4WF2 A;  4Q4Z F;  5F1R A;  2UZK A;  4G6Q A;  2E1C A;  3ZMT A;  2V1D A;  4N9I A;  1ZAR A;  3QPH A;  1JXS A;  2ZKZ A;  1IN6 A;  3P9K A;  2ACJ A;  4CGZ A;  5H20 A;  2HR3 A;  4HOB A;  4LLL A;  1MDM A;  5FLX Z;  2JSC A;  4EMS A;  1K7A A;  3Q5F A;  1ZGJ A;  5DUI A;  4L9V A;  5FLX K;  4RGU A;  1I27 A;  3NQO A;  2J5O A;  1SD6 A;  4XRF A;  2RVC A;  5LGU A;  3ZQ7 A;  1YFH A;  2DI3 A;  3S2W A;  3REO A;  3H3U A;  4IF4 A;  2H94 A;  2K4J A;  5E8G A;  1RI7 A;  3B02 A;  3E97 A;  4CXF A;  2VBY A;  4MTD A;  1IAW A;  3FMS A;  5ICG A;  3K1P A;  4IXA A;  1FBS A;  2F5F A;  1SD7 A;  5LHG A;  1BI3 A;  3E6D A;  1YLF A;  1G3W A;  5HVQ C;  4HV6 A;  5HDN A;  4U7D A;  3WU1 B;  4Y17 A;  3M7G A;  4IVN A;  3O6B B;  5FD5 A;  4YII A;  3GFL A;  3TO6 A;  5CVU A;  4N9H A;  3MCZ A;  3PFI A;  1WSU A;  4EJT A;  1HQC A;  1REP C;  2KIM A;  5DCM B;  5HOO A;  3P9I A;  5DD8 A;  2JT1 A;  2CG4 A;  3IKT A;  2ZCW A;  1FP1 D;  3I53 A;  2P4W A;  2NNN A;  3FXR A;  2MBF A;  3ZMD A;  3COA C;  4RAZ A;  3MZH A;  3P7N A;  2EV6 A;  2ZME B;  2R7D A;  4NHJ A;  4A2U A;  1U8R A;  4M71 A;  2PLY A;  4XLN F;  3KLO A;  2CYY A;  1V3F A;  4E70 A;  3FHZ A;  2XAH A;  1R22 A;  4OIP F;  1BI2 A;  1W7P A;  1EH8 A;  1ULY A;  4YFK F;  2P5V A;  1IN4 A;  1DDN A;  1R58 A;  2P5L C;  3P9C A;  1B59 A;  3ZMU A;  4M9X A;  3CLO A;  5DYM A;  3G73 A;  1YO5 C;  2YU3 A;  4L9J A;  2GQQ A;  1ZRC A;  2FU4 A;  2QQA A;  3F8B A;  5DUK A;  5FD6 A;  1FPQ A;  3QU6 A;  3E6B A;  1IF1 A;  2CQK A;  4P5O A;  2V6C A;  4MTE A;  4RGR A;  1W4M A;  2LF7 A;  1KYW A;  2M87 A;  3IWZ A;  4ENN A;  3R0A A;  4I0B A;  2IA0 A;  1LNW A;  4YFX F;  1D8J A;  1WWX A;  4GYG A;  4MQ9 F;  4G94 A;  4CYD A;  4CO8 A;  1IXS B;  1YW9 A;  3M9A A;  3GX4 X;  5A2Q Z;  1MJ9 A;  2A68 F;  5D8L B;  2ETH A;  5A2Q K;  5IT3 A;  1ZRE A;  4U7B A;  4HQE A;  4HDU A;  2ESH A;  4LB6 B;  5E1X A;  3RKX A;  3F8N A;  3N4M A;  2F2E A;  4OIR F;  2XKO A;  3V8J A;  1FX7 A;  2GZW A;  3FXQ A;  3N97 A;  2DAO A;  3R60 A;  4HW0 A;  5IT9 Z;  1USS A;  5BPI A;  5LRR A;  2PEX A;  2HEO A;  3LQR A;  4UXN A;  5IT9 K;  2E7W A;  3L2C A;  4HLY A;  1IN7 A;  2PN6 A;  3EYY A;  3IRR A;  2A5Y B;  2EFO A;  1T6S A;  2Q8K A;  3V7C A;  1U6G A;  1OYY A;  1I6X A;  4IPA A;  2VN2 A;  3WGI A;  5F64 A;  2H27 A;  2HYG D;  1S6L A;  5DEQ A;  4R79 A;  1OKR A;  2RN7 A;  2HKX A;  2GAU A;  5E8I A;  2VE9 A;  4EM1 A;  1S7O A;  4YIF A;  1OYW A;  4ZZL A;  2X0L A;  2EB7 A;  5ICC A;  1AWC A;  1F4K A;  3HRM A;  1Z9C A;  3E6M A;  4L5I A;  3VOE A;  4EGZ A;  4ZYD A;  1OYI A;  1BBY A;  2M1B A;  1V4R A;  4KDP A;  1O7F A;  3U1D A;  2OBP A;  3E3V A;  4AIK A;  1KQ8 A;  1HSJ A;  4WXD A;  2QLZ A;  4LG0 B;  3R6S A;  3E5U A;  2QQ9 A;  2RQP A;  4OMY A;  1BI1 A;  3TOA A;  2PFB A;  1SAX A;  3D5L A;  3T5X A;  1O7L A;  2A6E F;  1LJ9 A;  4P9U A;  3KCC A;  3R4K A;  4AWX B;  3QU3 A;  2BGC A;  3F22 A;  2VC0 A;  5CJ9 A;  1W7P D;  5BPD A;  3F8F A;  1MZB A;  3GWZ A;  4DNC A;  1T98 A;  2ZXJ A;  1LQ1 A;  1FOK A;  4Q47 A;  4XBF A;  3O2P E;  3V8K A;  3KP2 A;  5KK1 A;  4I02 A;  1S3J A;  2K02 A;  2MH2 A;  4NQW A;  1O3S A;  4ZYH A;  3QOP A;  1FSE A;  1RUN A;  3Q9S A;  4ENM A;  4WXH A;  4PGG A;  3KP7 A;  1R5H A;  3TDZ C;  3FM3 A;  2A6H F;  1BM9 A;  1TLH B;  5LBQ A;  3ELK A;  1XCB A;  1Z05 A;  1STZ A;  4HQM A;  3ROU A;  3F8M A;  3I0T A;  3HSE A;  1SFX A;  1KA8 A;  3HOS A;  1FLI A;  2PG4 A;  4IRI A;  1HKS A;  2DK5 A;  4HX8 A;  2FBI A;  1C0W A;  4I0A A;  5H6Q A;  3ZMZ A;  3K9T A;  2HQR A;  2DT5 A;  3CTA A;  3MQ0 A;  2K86 A;  2QQB A;  3HIF A;  3NRV A;  1HKQ A;  3GLX A;  2PMU A;  3GFJ A;  1F5T A;  5JHU A;  1LDD A;  3DQV C;  5HDK A;  2GWR A;  4Q48 A;  4UVB A;  4G7H F;  4CIC A;  2FQ3 A;  3L00 A;  1CF7 B;  3G3Z A;  4OU0 A;  2CWE A;  2Z9O A;  3HRU A;  2IA2 A;  5DCF A;  4GO1 A;  2RC4 A;  4EQQ A;  1TNS A;  2QVO A;  4JBA A;  3VEP A;  3JTH A;  4KFC A;  3IRQ A;  2BYV E;  2L3D A;  2L02 A;  2HFH A;  2W24 A;  1U5T B;  2IJL A;  1HW5 A;  4MGR A;  2V9V A;  3AAF A;  3FF5 A;  1HW1 A;  3F23 A;  5K5O A;  2Q2E A;  5JFR A;  1ZRD A;  3BPV A;  1IRG A;  1IRF A;  1IUY A;  1ZGA A;  3DPT A;  1BOA A;  1OR7 A;  3BPX A;  3HTU A;  1FY7 A;  2EA2 A;  2MC3 A;  3ISP A;  3DEU A;  1F9N A;  2VXZ A;  1PUE E;  4OMZ A;  1T0F A;  1TBX A;  2OZU A;  2YX4 A;  3EQL F;  4I01 A;  5F6F A;  1DP7 P;  4JK1 X;  1OPC A;  4M9S A;  3ML6 A;  3J81 K;  1TQI A;  3MFK A;  1S7A A;  2QM3 A;  2Y0M A;  2ZFW A;  3GF2 A;  2EFP A;  3CJN A;  3K1N A;  5ICF A;  2X4H A;  2P8T A;  4KMF A;  4A5M A;  4ZYG A;  3FM5 A;  2XUB A;  3HRT A;  2LSO A;  3BDD A;  4I7H A;  1ON2 A;  4HX7 A;  4LK0 F;  3JSO A;  2O3F A;  2WC2 A;  1I1S A;  2G9W A;  3ULQ B;  1YW8 A;  2W84 A;  2O8X A;  4U0W A;  1MDM B;  4R8H A;  4S04 A;  1XDU A;  1MGT A;  2KIF A;  1WKM A;  4MEX F;  1FYL A;  2O03 A;  2GXB A;  4IRH A;  3DPL C;  4HF1 A;  3CUO A;  4UUV A;  3BJ6 A;  1J2X A;  3TKY A;  5DCM A;  1BJA A;  4HYE A;  1LB2 A;  4ESB A;  3J7A O;  5LRS A;  3FWE A;  4BHC A;  4BHB A;  1P4X A;  2IRF G;  2NRA C;  3IL2 A;  3I5U A;  5KVR A;  4XSX F;  1QPM A;  3KP6 A;  4O6J A;  3BP8 A;  2DW4 A;  1KU2 A;  3RKW A;  1H9T A;  4S05 A;  1I1G A;  5ED4 A;  2A07 F;  5DD4 A;  1P4W A;  1ON1 A;  1LDJ A;  2PBI A;  3ABU A;  1MD0 A;  5D6F A;  2XHK A;  1WI9 A;  5LGT A;  2R3S A;  4U0Y A;  4U88 A;  1E17 A;  4YG2 F;  3WTX C;  5J8C A;  2ISZ A;  4I2O A;  3HOT A;  1HW2 A;  4KN7 X;  1K79 A;  2DQL A;  2OD5 A;  1D3Y A;  3E6C C;  1YS7 A;  2O0Y A;  3DXJ F;  3CUQ C;  5K5Q A;  2PI0 A;  5BQT A;  2RV8 A;  4ZYE A;  2LNB A;  4L18 B;  2HS5 A;  2FBK A;  1GXQ A;  2ADU A;  1R00 A;  1SMT A;  3IC7 A;  1XSV A;  3KEQ A;  4A0Z A;  3E5Q A;  5CYV A;  1D8K A;  1O3T A;  2VBZ A;  5J6X A;  1SFU A;  1QQI A;  2WWY A;  4ON0 A;  2XAS A;  1T2K A;  4OIN F;  4R1H A;  4KIG A;  4RB3 C;  4KIF A;  3H92 A;  5JR3 A;  2KIU A;  2YR2 A;  4XLP F;  1J0R A;  1EH6 A;  1YG2 A;  4G8X A;  4BAY A;  3WTZ A;  1FBU A;  2DBB A;  3I4P A;  2QUF A;  4BH9 A;  3KZZ A;  1W5T A;  2FF4 A;  3TQN A;  3L09 A;  3F3X A;  2Q0O A;  2O61 A;  3M1E A;  2M5W A;  2HKO A;  5D8K B;  1G3Y A;  1PP8 F;  3BY6 A;  1P4A A;  3RJP A;  1MJB A;  2QBY A;  3ZPL A;  4CHU A;  4M73 A;  3WTS C;  5TRD A;  4P55 A;  5BS6 A;  5L3F A;  4UVC A;  1G4D A;  1XSD A;  2FA5 A;  1IN8 A;  5E1W A;  2VBW A;  4FHT A;  2CGP A;  4G9Y A;  3L7W A;  1RUO A;  5K5R A;  3KET A;  5CLS A;  2ZNY A;  1A04 A;  5BOX A;  2DU9 A;  3WTY C;  1BC8 C;  5HLG A;  1UST A;  3GFM A;  2STT A;  4WCG A;  4IHT A;  1YS6 A;  3RKY A;  2FMY A;  1LVA A;  5D4R A;  1J59 A;  3I71 A;  2HOE A;  1L0O C;  2ZBK A;  5D6E A;  2RDP A;  2DO7 A;  1QGP A;  4KT5 C;  3JSP A;  3ABT A;  4LGW A;  5DV5 A;  3SXY A;  3GZ5 A;  1GVJ A;  5FFZ A;  2IVM A;  5CVI A;  5ERI A;  4EJW A;  5K1Y A;  3RIR A;  4L0Y B;  4LG0 A;  4CDG A;  3ZMV A;  3MWM A;  2P5K A;  4PGH A;  3VB2 A;  2JPB A;  2PJP A;  1X3U A;  4HA8 A;  2UXN A;  3EUH A;  2H6C A;  4LD5 A;  3ECH A;  3KP4 A;  2HTJ A;  1Z91 A; 
#chains in the Genus database with same CATH topology
 2EK5 A;  2KZG A;  2VJ5 A;  3KYL A;  1X4P A;  1IZ1 A;  3BG3 A;  1HCR A;  4B09 A;  1XMA A;  3RI4 A;  2VT2 A;  1U78 A;  1Q1H A;  3PSI A;  3VOD A;  2VUM J;  4M3F A;  3PO3 J;  2FBH A;  5EGO B;  1Y8Q B;  1MBF A;  2MG4 A;  5HLH A;  1BIB A;  5FO5 A;  4GCV A;  2CW0 F;  3DBH B;  2VPL A;  3OYJ A;  1R5I D;  3KFW X;  1R1U A;  2OTJ I;  4ETS A;  2NVQ J;  3M3Y J;  1HST A;  1LVK A;  2F5E A;  3HYI A;  5LEK A;  1TWF J;  1R36 A;  1Z77 A;  4ABZ A;  1X1B A;  5J40 A;  3ZN0 A;  4E7J A;  1ZH5 A;  5F0H A;  2YU9 J;  4EV0 A;  1PP7 U;  5F08 A;  3H5R A;  3TP3 A;  3LFK A;  4MLO A;  4FTH A;  2BBY A;  3ZMS A;  3QYB A;  2HYJ A;  3F6O A;  1U3E M;  5FKK A;  1ZG1 A;  3NWS A;  1ZLJ A;  1GT0 C;  2FEZ A;  2BV6 A;  2GA2 A;  4JOM A;  2JUC A;  3FXU A;  1MIJ A;  1ZG5 A;  4I98 B;  2A3S A;  1KQ0 A;  3WE2 A;  3HZJ A;  1B8I A;  3LA3 A;  3JRC A;  3PQK A;  2X85 A;  4YFN F;  1JI8 A;  3F72 A;  4AID A;  4RB2 C;  1MBG A;  1ZN2 A;  2DFE A;  1WH7 A;  1IJW C;  1DPR A;  2D1V A;  4AIH A;  2AS5 F;  1GV2 A;  1PDN C;  4IQJ A;  3U9G A;  2NVT J;  5CVV A;  2MA3 A;  3K69 A;  4LMY A;  2LRE A;  4BHP A;  3ZQQ A;  2IEK A;  3SZP A;  1B1B A;  4UV8 A;  1DUX C;  2L9V A;  5LLQ A;  3MD2 A;  3GVA A;  2Z99 A;  1WJF A;  2MLK A;  2K9S A;  4UUS A;  5D5W B;  1AHD P;  2R0Q C;  2OCC H;  2XGX A;  4D0P A;  1ETX A;  4ENJ A;  2Y30 A;  1MMA A;  2QZ8 A;  4KIT B;  1XMK A;  2D2W A;  1VQ6 I;  1MW7 A;  4F7Z A;  5ILV A;  1X1P A;  4NQW B;  2W00 A;  1CF7 A;  2K9L A;  2H8R A;  1OJL A;  1IRZ A;  2HOA A;  4H0E A;  4GGG A;  2DOD A;  2M2E A;  1XGO A;  2FSW A;  2XPW A;  1Z7L A;  2Y31 A;  3C3W A;  2BY1 A;  2D1H A;  3M8J A;  1ODD A;  2D45 A;  3D1N I;  1T56 A;  3KZY A;  3C2H A;  2YS9 A;  1RR7 A;  3K1M A;  4LG3 A;  5C44 J;  4GYI A;  5E20 A;  5FRO A;  4UUT A;  1MND A;  2K40 A;  1I50 J;  1P9Q C;  1K78 A;  3TGN A;  4QSH A;  1ENH A;  5B5E C;  5KHD A;  2KRF A;  2FOK A;  4CZC A;  1B9N A;  3A1Y A;  1JJ6 C;  2F5C A;  2L7F P;  2EQR A;  3G1O A;  1BC7 C;  3TOB A;  4L0Z B;  1K83 J;  3PNV A;  1U5T A;  1Q1V A;  5HDG A;  3SYT A;  2KQR A;  5CVJ A;  1U8B A;  4A0X A;  1XD7 A;  2JRM A;  5ICE A;  3M8F A;  3O3K A;  2X9D A;  3T8R A;  2RKH A;  1ZTR A;  4I6Z A;  1KU9 A;  4ZDP A;  4FAS D;  3CES A;  1FZP B;  4FX0 A;  5GPA A;  2E5N A;  1R23 A;  1OCC H;  2R5Y A;  2ESN A;  2R7O A;  1ZLK A;  1R1V A;  1ZR2 A;  2OAZ A;  3I59 A;  5EYR A;  3ZQF A;  3R61 A;  4HF2 A;  3GTJ J;  3TL4 X;  2NYX A;  4RAF A;  5HLT A;  2JVG A;  4A6D A;  2XPU A;  3BWG A;  1T39 A;  3KEY A;  3L9F A;  4XLE A;  1JUP A;  2DA5 A;  3IAS 2;  4EJO A;  1TW3 A;  1IGN A;  2O6G E;  1OMI A;  3WOD F;  1J7K A;  2IPQ X;  2OTL I;  4KYW A;  4OIQ F;  4B3X A;  5LHH A;  3OYG A;  3V7S A;  3BCA A;  5FFX A;  2AXL A;  2FML A;  3HHG A;  1FYM A;  3OYA A;  2VT3 A;  1MSE C;  1QZY A;  3EUH C;  3FXK A;  4HDV A;  4Z6Y A;  5HS7 A;  4AVP A;  4U0V A;  2YX7 A;  5EEH A;  3L1P A;  3CO6 C;  2HOS A;  3NEU A;  3W6V A;  3RYR A;  4JX4 A;  2XDV A;  3I64 A;  4XMY A;  2Y9Z A;  4K2E A;  2MLG A;  4IJA A;  3X2Q H;  3HEF A;  5D5U B;  1X1C A;  3IH2 A;  4RAG A;  3JRI A;  2JTV A;  1PUF A;  2G7H A;  4XSZ F;  4PZJ A;  3CDL A;  4JQF A;  4DYQ A;  3PUF A;  4PDK A;  1JKQ C;  4X1E A;  1KZH A;  4CUG A;  5LHI A;  1WHU A;  2OA4 A;  1SMY F;  1PYV A;  1WRJ A;  1K6O A;  3GW2 A;  1WCM J;  2DPU A;  4X6A J;  2L4M A;  2JRT A;  1N78 A;  5EZH A;  2TCT A;  5AON A;  1VQ4 I;  2Q2E B;  4ASN A;  3QPS A;  1ZGW A;  3QOE A;  3GXO A;  3QP5 A;  4NBQ A;  2GOX B;  1RNL A;  2ZFU A;  2KJC A;  1I5Z A;  1H88 C;  5L3G A;  4RM3 A;  2L4A A;  3MAJ A;  2A61 A;  3HC7 A;  2LRD A;  4BJ5 C;  4BEH B;  2ME6 A;  2F5D A;  4E7L A;  4AYB A;  3U2R A;  3JAM Z;  2LY9 A;  3BR6 A;  3MN2 A;  3K4K A;  3DV8 A;  2ECB A;  3ZOB A;  5FB2 A;  3G6E I;  2Y48 A;  3D5R C;  4KIB A;  3JRA A;  3DTE A;  3CCL I;  1NH3 A;  4M74 A;  3JAM K;  4QPQ A;  1QO0 D;  2EV0 A;  2QCO A;  2P0W A;  3VWB A;  3HHH A;  1YI2 I;  4M6Y A;  3CUQ B;  1DU6 A;  5BMZ A;  3F8C A;  2LKP A;  4E7S A;  2V1N A;  5GAE J;  2VON A;  2OZ6 A;  4KMU X;  5M3M J;  1QVU A;  1VFC A;  4KT6 A;  4IHS A;  3K0L A;  2BHY A;  2P6T A;  3SDB A;  5M5W J;  2YSR A;  1BOB A;  3L2V A;  2W7N A;  1D0X A;  3OYF A;  1R71 A;  3ABK H;  1ZAO A;  3HOU J;  2E36 A;  2FX0 A;  4Y13 A;  3EYI A;  2CO5 A;  2OU2 A;  2QKL B;  2QWW A;  2DPD A;  5H6R A;  3FBN B;  2E1M B;  1XDS A;  3LAP A;  4HNV A;  1T38 A;  3J80 Z;  3CCU I;  1JJ8 C;  2XAF A;  3K2Z A;  2IT0 A;  1W5S A;  2HDC A;  2C6Y A;  2L7M P;  3HTS B;  1Z6R A;  2XSD C;  3J80 K;  3FX3 A;  2DT7 B;  2DMQ A;  2W1O A;  3WU0 A;  2R92 J;  3IHU A;  4HSR A;  4OIO F;  1BIA A;  1GHC A;  1FT9 A;  2FE3 A;  5J1R A;  4AM3 A;  5L3C A;  2M8E A;  3MEX A;  3R0J A;  4UVA A;  4PFO A;  1YQA A;  4Y15 A;  4EM0 B;  2MGQ A;  4HLX A;  3W2W A;  1N77 A;  1GXP A;  2GXA A;  3HSR A;  2K4B A;  3FDY A;  4A12 A;  4KN4 X;  3Q0U A;  1U5T C;  5GAH J;  1JHF A;  1S29 A;  1Y8R B;  2FOW A;  2XAG A;  4L9T A;  1XCV A;  1UG2 A;  1KGS A;  2LH9 A;  3I54 A;  3HG9 A;  5DDG A;  5JVT A;  1RIO H;  4KNY A;  4UNO A;  2LY2 A;  2JA7 J;  1JHH A;  1U9O A;  2QQ8 A;  2KT0 A;  5FKM A;  3JRB A;  3BQZ A;  3BR5 A;  3WTU C;  2LDU A;  5HLI A;  4XIC A;  4EGY A;  3TBI A;  1G6N A;  1IO2 A;  2DLL A;  3IH4 A;  4QWQ A;  4HBL A;  4IHW A;  3NWT A;  1W5C C;  1TQP A;  2DCE A;  2DK8 A;  2M0M A;  2HXO A;  2JJ7 A;  5AIP A;  3RDI A;  1IG7 A;  2ZME A;  4JX6 A;  1EKE A;  3OOU A;  2COM A;  1U0J A;  3M1C A;  2GIZ A;  1XS9 A;  1OCT C;  3PUB A;  4F3Q A;  2L9N A;  2KKO A;  2IGN A;  5JI6 A;  4C2U A;  3HOW J;  4Z2Y A;  2IGK A;  1UB9 A;  1MNM C;  2XF7 A;  1UHM A;  1JGG A;  1BJZ A;  2V26 A;  3BOQ A;  3GZ6 A;  3U21 A;  1S9H A;  4GFB A;  2UWM A;  3C18 A;  1QVT A;  2R7F A;  4XRM A;  4EM2 A;  2K9N A;  3G1L A;  1ONV A;  2R7V A;  2DYR H;  1AKH A;  3BG6 A;  4Y3O A;  5EDN A;  2NVU B;  1UMQ A;  4IHV A;  3DFG A;  3EDP A;  3VYT B;  1VND A;  4XQF A;  3O8H A;  3BG9 A;  3SQN A;  2GBY A;  4QTR A;  2E2J J;  5EG0 A;  2EIM H;  1ZHF A;  3DKX A;  4M9Z A;  3L2R A;  1RRJ A;  4AUX A;  1E0E A;  1QZZ A;  3AL0 B;  4P1W A;  5HOD A;  2Z3Y A;  2IW5 A;  5L3E A;  4QLC U;  2BVM A;  3ERM A;  1SD4 A;  1XTA A;  3AG1 H;  4UHT A;  5D4S A;  5D5V B;  2K85 A;  2L54 A;  1B72 A;  1ETW A;  4TV7 A;  3KEO A;  2Z33 A;  1FSH A;  2BXY A;  1RKW A;  3RYP A;  3VSL A;  2HOT A;  1ETQ A;  4RB1 A;  3RPU A;  1MMD A;  4EJU A;  3GEZ A;  5HS8 A;  2XC7 A;  4KIC A;  5J1Y A;  5E17 F;  4DBR A;  4RB0 A;  3V4G A;  3LSK A;  1GDT A;  3WTW C;  5GP9 A;  3OS1 A;  3H9G A;  1FBQ A;  1YYV A;  5B1B H;  2EWN A;  4F92 B;  3QPT A;  3SZT A;  3JW4 A;  5LEJ A;  1TTY A;  3T1B A;  3CC7 I;  4PUS A;  2VOD A;  2GIV A;  3CJQ B;  5HNF A;  4LB5 A;  4MQV A;  3ERE D;  3KP3 A;  4ESJ A;  2UXX A;  4ENK A;  1Z7U A;  4M6X A;  1FWZ A;  4E7Z A;  2DDB A;  1MKM A;  2ECC A;  2RNJ A;  2OQG A;  3IKV A;  1NK2 P;  1FYK A;  1QHH D;  2WAD A;  2L0K A;  2IXS A;  3I56 I;  4FE4 A;  2K9Q A;  2BW3 B;  3WHB A;  2EA4 A;  4IX7 A;  1FP2 A;  4LFU A;  2V1U A;  2KIS A;  5C4X J;  1W7P B;  2W57 A;  3OOP A;  1R49 A;  2LR8 A;  3C7J A;  3OV8 A;  2Y0S A;  4HX4 A;  3GYH X;  4HZF A;  3AG2 H;  2CUE A;  2E2H J;  3WHC A;  1MBE A;  1SFE A;  2RGV A;  3UNG C;  3OYC A;  2R5Z A;  1UFM A;  2LBF A;  4WXC A;  4DYR A;  3I55 I;  2MW8 A;  4P9F A;  4DQ2 A;  3DKW A;  3ZGK A;  1A36 A;  2GA1 A;  2ZJP F;  4F93 B;  1F43 A;  3C1D A;  2JA6 J;  1ZK8 A;  1I6H J;  4LIU A;  3S1M J;  3HM5 A;  3D5S C;  2BE5 F;  5J1U A;  1TQM A;  2Y0S N;  4LLN A;  3SFZ A;  3I4N J;  3I3L A;  4MFD A;  5J4V A;  1YW7 A;  2VOO A;  1DPU A;  3KE2 A;  2WTE A;  2CFX A;  2R7Z J;  2X6Y A;  2CSO A;  2FJ1 A;  1LEB A;  1E2X A;  1F1Z A;  2L01 A;  1G3T A;  2X1C A;  2ELJ A;  2DA6 A;  2CUZ A;  3OYD A;  4W1U A;  4G7Z F;  2WAQ A;  2AQE A;  5EZG A;  3SFI A;  4XRS G;  3VFZ A;  2DN0 A;  1HA8 A;  2J5P A;  1LDK B;  3HUG A;  4HV5 A;  5HS9 A;  2DMN A;  2EZI A;  2BZT A;  3ECO A;  1CQT A;  1S7E A;  3SZG A;  1XSX A;  3GUD A;  3IP4 B;  1WQ2 A;  1R5G A;  4CCJ A;  5E1Z B;  4ZC3 A;  1YOV B;  3JTG A;  4M72 A;  4N4N B;  2P7V B;  1O3R A;  3PSF A;  5AIQ A;  5JLX A;  2QEX I;  2PQ8 A;  4B47 A;  1IXR C;  2G7U A;  4IRG A;  2Z5U A;  2JSP A;  2V9K A;  4M3G A;  5KAI C;  3CDH A;  4P96 A;  5E18 F;  1MBK A;  2QBY B;  3B6A A;  1MMG A;  2WAQ N;  4CCK A;  4CH7 A;  3HOX J;  4EVI A;  3MKW B;  4I99 C;  1ZYR F;  3QRF F;  5FLV A;  1FIP A;  2FUG 2;  2PMH A;  3LST A;  2VJ4 A;  1B9M A;  1KU3 A;  2W48 A;  5FGM A;  3Q3S A;  5DS9 A;  1G3S A;  2BHZ A;  2OV7 A;  3CF2 A;  5B66 C;  2ZME C;  4AD9 A;  3GFI A;  1SVM A;  3S14 J;  1TWA J;  3P5J A;  4LK1 F;  1Z1D A;  2CQQ A;  2NS0 A;  1QZE A;  2DOF A;  3FXJ A;  4II3 A;  2HI3 A;  4PCQ A;  3K2A A;  4YRV A;  2HQN A;  3KIO A;  3LAJ A;  3G1M A;  3WG9 A;  3FZV A;  4KUM A;  2ZJR F;  2VOP A;  4XKV A;  4NB5 A;  2Y75 A;  4XOT A;  1YTY A;  1YJ9 I;  1YRN B;  2HGC A;  2HPM A;  2VKE A;  1V5F A;  2IP2 A;  3DCF A;  3M8E A;  3TW7 A;  3ZN1 A;  2QEN A;  3CMM A;  5CVR A;  4WX9 A;  3I58 A;  1S8N A;  2VQG A;  3BJO A;  3CMA I;  4LLG F;  1ZQ3 P;  3K4L A;  1TP4 A;  3CMY A;  4BE0 A;  4N0B A;  3EUA A;  1O3Q A;  1D1A A;  2EFQ A;  2B0L A;  1JGS A;  4FE7 A;  2OQR A;  4BNC A;  3WGH A;  4BQA A;  3W6K B;  2VE8 A;  4RLF A;  2X48 A;  4G7O F;  2KDO A;  3AG3 H;  4H4K C;  2P7C B;  4IHY A;  1SFK A;  1EV7 A;  3OIP A;  1IW7 F;  9ANT A;  2L7K A;  5M5Y J;  4RGS A;  2HTS A;  3L2Q A;  1XGM A;  1WJB A;  4RS8 A;  2RNG A;  2HXI A;  2XRN A;  2Y2Z A;  5IYC J;  2WV1 A;  2VBX A;  1X58 A;  2JN6 A;  1L3L A;  2W4S A;  2HQA A;  2XF6 A;  1QPI A;  2NS7 A;  1RR8 C;  2XV4 S;  1MSF C;  1HDP A;  1YE9 A;  1WPK A;  1TW2 A;  1XGN A;  4OOI A;  1H89 C;  2H6B A;  1QA6 A;  3FKJ A;  1XB4 A;  4UV9 A;  1MJA A;  5IY5 H;  4XN3 A;  2IBD A;  4XLC A;  3LSI A;  2CMP A;  2XGE A;  2STW A;  1Z6T A;  4G6D A;  2DFI A;  3ZP5 A;  3A02 A;  1H9G A;  5L3D A;  3CP2 A;  3BJA A;  2XAQ A;  2M45 A;  1NHA A;  2DA7 A;  4A3C J;  2CUJ A;  2LK2 A;  4FX4 A;  2ICW G;  1G59 A;  1KQ9 A;  1MBJ A;  3QP6 A;  3RPU D;  5DM6 F;  2FXA A;  5ILU A;  1BN5 A;  2P81 A;  3WE3 A;  4MEY F;  1KON A;  3PQJ A;  3CZ6 A;  3SHF A;  4BAC A;  1OFC X;  3A01 A;  3B6C A;  3RKQ A;  1A6I A;  5EF6 A;  4A6E A;  2A69 F;  2FQ4 A;  3RTR A;  3C2B A;  3HBL A;  1AOY A;  3WTV C;  1VTN C;  3TDU C;  5LGN A;  1JKR C;  2K27 A;  2MH9 A;  1FNN A;  1YHQ I;  4F91 B;  3BZ6 A;  3DP7 A;  3OYH A;  4CCM A;  1JKO C;  2DJI A;  3DF8 A;  1J75 A;  2HVR A;  3SEQ A;  2KL4 A;  3OMY A;  3K70 C;  3WGG A;  4KA4 A;  5EEG A;  3FMQ A;  2CRG A;  2Z1D A;  3CCM I;  1YIO A;  6PAX A;  4D9J A;  2VAS A;  3F21 A;  4CZZ A;  3B73 A;  1UCR A;  2JPC A;  4XON A;  3BTL A;  3Q9V A;  3C2G A;  2XVC A;  2DTR A;  2EV5 A;  4G6T B;  2E19 A;  2VXD A;  1O57 A;  1VQ8 I;  2ZJ2 A;  2L2O A;  3BR2 A;  1DQU A;  2BEO A;  1J9I A;  1J5Y A;  5K7H A;  2H09 A;  3EUK L;  2XF5 A;  3QYE A;  2XKP A;  4FT8 A;  2JA8 J;  2F4M B;  4O5V A;  2YPR A;  2W25 A;  2DOA A;  5J47 A;  3KYC B;  2JZY A;  2X1E A;  2EFW A;  2V1X A;  2HWV A;  1Y0U A;  4M3D A;  4HAM A;  2GXG A;  5TJJ A;  4A0Y A;  2JA2 A;  3QOD A;  3TO7 A;  2ZNZ A;  2VQL A;  1IN5 A;  2OPT A;  3H5A A;  2CW7 A;  4L5J A;  3V8L A;  3K70 D;  1H0M A;  1B8I B;  3H3Z A;  1WJD A;  3A03 A;  2LTP A;  2CQ7 A;  3T0Y A;  3LSJ A;  1HBX G;  2NOG A;  3OYB A;  2BOL A;  2ZC2 A;  4O3M A;  2EJR A;  4HNT A;  3LA2 A;  3GTK J;  4WWC A;  1MH3 A;  3I4M J;  2IA1 A;  3S3O A;  3E5X A;  2NNY A;  3PJR A;  5D5X B;  2TRT A;  3BTI A;  4ESF A;  3JR9 A;  1ZRF A;  4IOC F;  2XRO A;  1WJ5 A;  3TMO A;  3OYN A;  1D5V A;  3TO9 A;  2IAI A;  4XID A;  4UUS B;  4HF0 A;  2IS4 A;  2Y9Y A;  3CDI A;  3LOC A;  2E35 A;  4L9N A;  3ZQI A;  4LJZ F;  2UV1 A;  4B8X A;  2R7X A;  3FMR A;  5ILS A;  1BL0 A;  1SD5 A;  4PJM A;  1TNT A;  5L3B A;  2O9L A;  4RAY A;  3EET A;  2ELH A;  3K4N A;  4XKW A;  2FNP A;  2V4J C;  1QBJ A;  3BLY A;  2V79 A;  3BRO A;  1R4N B;  3D0S A;  3HJE A;  4ZH4 F;  4C9Y A;  1WGX A;  1H8A C;  3ESW B;  2MD5 A;  3F6V A;  4CA0 A;  2LY1 A;  3ZR8 X;  5FJ8 J;  2NAZ A;  2VC1 A;  2LG4 A;  4BYY A;  3HL2 A;  4AVZ A;  1U2W A;  3M4O J;  1FOY A;  1XN7 A;  3VPR A;  4Q5S F;  4IOA F;  3JRE A;  1CGP A;  5E3L A;  4ZZD A;  1LEA A;  1K78 B;  3KLN A;  3QAH A;  3LSP A;  4GRI A;  4BXU A;  1JT0 A;  2XAJ A;  2WV0 A;  4ZTJ A;  2FRH A;  3IWF A;  3VDX A;  4A5N A;  3TW6 A;  3CCY A;  4DYC A;  2KMU A;  2L9R A;  2P6S A;  4EJV A;  3LWF A;  3MKZ A;  1VQP I;  2LD5 A;  4XLF A;  2XB0 X;  4AU7 A;  2E7X A;  1R6R A;  2ZO4 A;  1IXC A;  1B4A A;  2DQR A;  5J8F A;  3OR2 C;  2XIG A;  2TDX A;  4L5E A;  5IPA A;  3CO7 C;  2R5Y B;  2W85 A;  3I59 B;  1W36 C;  1BI0 A;  1ZG3 A;  2F6C A;  2R7Q A;  1KYZ A;  3MZY A;  4RGX A;  3W6J B;  4WK8 F;  1HXD A;  3GLL A;  3WTT C;  1IV8 A;  2K7L A;  1P2F A;  3WG7 H;  4B43 A;  1DGR M;  1FC3 A;  2DJN A;  3GO5 A;  1B6A A;  2EIJ H;  3HRS A;  3JCU C;  3Q0V A;  4KIS A;  1QNT A;  3LSM A;  1VI0 A;  4I09 A;  4JX5 A;  3DEW A;  1WJE A;  4AIJ A;  3RPQ A;  4MNU A;  4GXO A;  4XL9 A;  2FNA A;  2LF8 A;  1EH7 A;  3J7A Y;  2CV1 A;  1UHW A;  2HYF A;  4DJA A;  4MHG A;  1NG7 A;  4XRS A;  2M30 A;  2E1N A;  1RZ4 A;  1A6Q A;  2HZT A;  2KIQ A;  4ZTF A;  3LQQ A;  1GVD A;  1R1T A;  4B4C A;  4I76 A;  1IRX A;  1P92 A;  3PIO F;  3J81 Z;  2ISY A;  1RKT A;  1R7J A;  3CUQ A;  1P6R A;  3KP5 A;  3HSF A;  2EFN A;  2KJB A;  4YEJ A;  1JE8 A;  4CYC A;  3V7R A;  4CCN A;  2QYO A;  3QPL A;  3LA7 A;  1HKT A;  3T8T A;  4C2M J;  1XGS A;  1KU7 A;  4WF2 A;  4Q4Z F;  2VI6 A;  4E7K A;  5F1R A;  2EH3 A;  2DDA A;  3H36 A;  3ASO H;  3HKZ N;  1W36 D;  1PUF B;  2UZK A;  1OCP A;  4FIS A;  4G6Q A;  2E1C A;  3ZMT A;  2V1D A;  4N9I A;  1ZAR A;  4XR6 A;  5EJC A;  2LYC A;  3QPH A;  3H3V K;  1Z3X A;  1JXS A;  2XB5 A;  2ZKZ A;  5LFA A;  1Y1V J;  1IN6 A;  2RRE A;  3FHN A;  3P9K A;  2ACJ A;  4CGZ A;  2AO9 A;  2ZB9 A;  3CLQ A;  5H20 A;  2HR3 A;  4HOB A;  4Y33 A;  4LLL A;  4DGW B;  1MDM A;  3E7L A;  3KPH A;  5FLX Z;  3ZQL A;  2JSC A;  1OQY A;  3PM1 A;  5KNL A;  2CJJ A;  4EMS A;  1K7A A;  5CKT A;  3RZO J;  3Q5F A;  1ZGJ A;  2QSF X;  1Z0X A;  5DUI A;  2JK3 A;  4L9V A;  1AU7 A;  4Y52 J;  4IQ4 A;  5FLX K;  1DGW Y;  4RGU A;  1I27 A;  3LFU A;  4A3L J;  1LE8 A;  5F04 A;  3GTG J;  3NQO A;  4NC7 A;  2J5O A;  1SD6 A;  4XRF A;  1XC5 A;  4IL6 C;  2ZXI A;  2RVC A;  5LGU A;  3GTQ J;  3ZQ7 A;  2LOO A;  3HPG A;  3CC4 I;  1YFH A;  2DI3 A;  4A3M J;  3S3M A;  3S2W A;  3PNT A;  2VKD A;  3REO A;  3H3U A;  2VJJ A;  2M0C A;  3GZN B;  4IF4 A;  2H94 A;  2VQH A;  3QWL A;  5IOY A;  5FKN A;  2K4J A;  5E8G A;  3E1S A;  5FLM J;  1RI7 A;  3B02 A;  1D0Z A;  5E79 C;  3UKG A;  3E97 A;  2I8D A;  5C3E J;  4CXF A;  3M07 A;  2K9M A;  2MFZ A;  2VBY A;  4MTD A;  3DTI A;  1IAW A;  1P7I A;  2HQ5 A;  4V2F A;  3FMS A;  5ICG A;  1UHS A;  3K1P A;  4IXA A;  4DIQ A;  4ZYA A;  1FBS A;  2F5F A;  1SD7 A;  3A0B C;  5LHG A;  4NNJ A;  1BI3 A;  2XRL A;  1NG6 A;  3E6D A;  4NC8 A;  1YLF A;  1G3W A;  4BUP A;  3OWT A;  5HVQ C;  4HV6 A;  4HRI A;  5HDN A;  4U7D A;  3ZQH A;  1P7J A;  3RSN A;  3WU1 B;  5FKL A;  4IHX A;  4Y17 A;  3M7G A;  4IVN A;  3O6B B;  2M7B A;  4PFP A;  5FD5 A;  1FTT A;  4M3B A;  5JLW A;  3S3N A;  4YII A;  3GFL A;  4W97 A;  3TO6 A;  4D1Q A;  4B48 A;  2HVS A;  5CVU A;  4UB8 C;  4N9H A;  1BR4 A;  2KP6 A;  4V19 K;  3MCZ A;  3PFI A;  2VKH A;  1WSU A;  2F4O B;  3IUO A;  3KYD B;  5M3F J;  1HQC A;  1REP C;  2KIM A;  5DCM B;  5HOO A;  4EJT A;  3P9I A;  5DD8 A;  2JT1 A;  2CG4 A;  4D7N A;  3G71 I;  1I39 A;  3IKT A;  2ZCW A;  1FP1 D;  2EZH A;  2L9S A;  2ZXH A;  3I53 A;  4BQQ A;  2CV2 A;  2P4W A;  4RMN A;  2NNN A;  3FXR A;  2MBF A;  3ZMD A;  2HNH A;  4BXF A;  3A0H C;  2UUZ A;  3HXL A;  5GPC A;  1DP3 A;  3I9V 2;  3COA C;  4RM2 A;  3CQZ J;  3CCR I;  5GTI C;  4RAZ A;  3MZH A;  2ID6 A;  3P7N A;  2EPF A;  5DTD A;  1XPX A;  4A3B J;  4MIM A;  2EV6 A;  2GLO A;  2EIK H;  2ZME B;  1XG1 A;  2DT6 A;  2R7D A;  4NHJ A;  1D1C A;  1WJA A;  4M3E A;  4A2U A;  1U8R A;  1V5E A;  1SAN A;  2PJR A;  3DU6 A;  4M71 A;  2PLY A;  1X3W B;  1MH4 A;  4XLN F;  2JMW A;  1ETV A;  3CJT B;  2CYY A;  3KLO A;  1QHG A;  3K4B A;  4BXX J;  3ZXS A;  1V3F A;  2H1K A;  4E70 A;  3FHZ A;  2XAH A;  3H0G J;  2DMP A;  1R22 A;  1WVR A;  4BQN A;  4OIP F;  1IV6 A;  3BTJ A;  1BI2 A;  2MYS A;  2BW3 A;  1AKH B;  1W7P A;  4NC6 A;  1EH8 A;  3E0J B;  1F36 A;  4F52 A;  1ULY A;  4YFK F;  1GLN A;  2P5V A;  1A35 A;  5EG0 B;  3K6G A;  1IN4 A;  4XKB A;  1W0T A;  4J00 A;  1DDN A;  1R58 A;  2WY7 Q;  2P5L C;  4Y4R A;  2K3P A;  1HC8 A;  1B72 B;  3P9C A;  1B59 A;  2PMZ N;  2VB6 A;  2WB1 A;  3ZMU A;  4M9X A;  4PJ0 C;  2EZK A;  1VQL I;  3CLO A;  1SC7 A;  5DYM A;  4BGD A;  5EEA A;  3G73 A;  1YO5 C;  2YU3 A;  4L9J A;  1BW6 A;  1FOX A;  4OWR B;  3BG7 A;  2GQQ A;  1ZRC A;  2FU4 A;  4HG2 A;  2DFF A;  2QQA A;  3F8B A;  2X6X A;  2M3A A;  3RQI A;  2XGC A;  3DKY A;  3CCJ I;  1VQM I;  2NS8 A;  5DUK A;  3S2H J;  5FD6 A;  3S1Q J;  1FPQ A;  1D1B A;  2HPI A;  3E6B A;  3QU6 A;  2CV0 A;  2W82 A;  4C3J J;  1IF1 A;  3OS0 A;  2DA3 A;  4CCO A;  1TC3 C;  2CQK A;  4B44 A;  4P5O A;  4A3G J;  2V6C A;  2WB1 N;  4MTE A;  1LFP A;  4RGR A;  5IYD J;  3LMM A;  5J3L A;  1W4M A;  2HVQ A;  4ITV A;  2LF7 A;  1KYW A;  2M87 A;  3GTO J;  5FRN A;  3IWZ A;  2LP0 A;  4ENN A;  3R0A A;  4I0B A;  2IA0 A;  1IDZ A;  1LNW A;  4YFX F;  1K61 A;  1D8J A;  2R7U A;  4RBO A;  1WWX A;  1WFX A;  4GYG A;  4MQ9 F;  4G94 A;  4CYD A;  4CO8 A;  1Y1W J;  3ZCO A;  3K4J A;  1IXS B;  1YW9 A;  3M9A A;  3VYR B;  3GX4 X;  5A2Q Z;  3CME I;  1MJ9 A;  2A68 F;  2CH0 A;  5D8L B;  2OUM A;  2QA4 I;  3JRG A;  1WJC A;  2ETH A;  2LBF B;  5A2Q K;  5IT3 A;  3IV5 A;  5E3O A;  2XGD A;  4U7B A;  4HQE A;  1ZRE A;  4HDU A;  2ESH A;  4LB6 B;  5E1X A;  3RKX A;  4QIW N;  3F8N A;  3N4M A;  2F2E A;  4OIR F;  2XKO A;  2M9H A;  1WZ2 A;  3CC2 I;  3V8J A;  2VL8 A;  1FX7 A;  4XN0 A;  3HB9 A;  2GZW A;  2HU9 A;  3FXQ A;  3N97 A;  2AQF A;  2DAO A;  3R60 A;  2CS3 A;  4XM3 A;  1LFU P;  1TZL A;  1YRN A;  4HW0 A;  2F48 A;  3S1N J;  4XLA A;  5IT9 Z;  3PIP F;  1USS A;  3ZQC A;  1EF4 A;  1J09 A;  5BPI A;  2NXN B;  5LRR A;  2PEX A;  1I3Q J;  4LIV A;  1YJW I;  2HEO A;  1G8X A;  3LQR A;  5F0F A;  1X1D A;  4UXN A;  5IT9 K;  2E7W A;  3A4C A;  3L2C A;  4HLY A;  2A5W A;  2KFD A;  2X1D A;  4CCL A;  4BDZ A;  1FTZ A;  4PK4 A;  1IN7 A;  2PN6 A;  3EYY A;  3IRR A;  2A5Y B;  3K4C A;  1YJN I;  1GV5 A;  5BNG A;  2EFO A;  1T6S A;  2Q8K A;  3V7C A;  1U6G A;  1OYY A;  1I6X A;  2COB A;  3TP0 A;  4IPA A;  2VN2 A;  3WGI A;  5F64 A;  2R93 J;  2H27 A;  5IOZ A;  2HYG D;  1HLV A;  2CUF A;  3OSG A;  1S6L A;  3KZI C;  3ONQ A;  5DEQ A;  4R79 A;  4J19 A;  1OKR A;  2RN7 A;  3DEE A;  2HKX A;  4E7H A;  2GAU A;  5E8I A;  2WA0 A;  4PSW A;  2VE9 A;  3S93 A;  4EM1 A;  1YIT I;  1S7O A;  4YIF A;  1HOM A;  1BA5 A;  1FMW A;  1OYW A;  3OYE A;  4ZZL A;  5EGO A;  1UAA A;  2X0L A;  2EB7 A;  5ICC A;  5IP9 J;  1I3A A;  1AWC A;  1JKP C;  2DA1 A;  4AC0 A;  1F4K A;  3HRM A;  1EJ9 A;  1K6Y A;  1Z9C A;  3E6M A;  4L5I A;  1VQO I;  3VOE A;  4EGZ A;  1TT0 A;  4NDL A;  1OYI A;  1BBY A;  4ZYD A;  1OCO H;  2M1B A;  4RA2 A;  5F27 A;  4A3E J;  4II2 A;  1RET A;  2EIN H;  1V4R A;  4KDP A;  4XKC A;  1O7F A;  3O8G A;  3CD6 I;  1NK3 P;  3U1D A;  3H0D A;  2OBP A;  3E3V A;  1PJR A;  1N75 A;  4AIK A;  1KQ8 A;  3A2K A;  1HSJ A;  4WXD A;  2I5U A;  3AKZ A;  4FQG A;  2QLZ A;  4LG0 B;  1X2N A;  3R6S A;  3ABM H;  2IS1 A;  3E5U A;  4DW6 A;  4C3H J;  4M6V A;  3TED A;  4BJT A;  2QQ9 A;  5F0C A;  1FMV A;  3LSR A;  1SEU A;  2RQP A;  4OMY A;  1BI1 A;  3TOA A;  2PFB A;  3VYS B;  4UY8 I;  1SAX A;  4IZZ A;  3VSK A;  3D5L A;  5GTH C;  4XK4 A;  3T5X A;  4QPO A;  1O7L A;  1VZ0 A;  2VLA A;  2A6E F;  1LJ9 A;  4P9U A;  3S8P A;  3KCC A;  3R4K A;  2KPM A;  4AWX B;  3QU3 A;  2BGC A;  3F22 A;  4E4H A;  2VC0 A;  1YX3 A;  1DU0 A;  4OAY A;  5CJ9 A;  4JP0 A;  1W7P D;  4Y7N J;  5BPD A;  2M8G X;  3OIO A;  3H35 A;  2LVS A;  1PVE A;  3F8F A;  2KDZ A;  5E3N A;  1MZB A;  3VYU B;  2BXZ A;  2R7R A;  4G12 A;  4ANJ A;  3GWZ A;  2F5V A;  1T98 A;  1LUJ B;  2ZXJ A;  4DNC A;  1LQ1 A;  1FOK A;  4Q47 A;  2WBM A;  2O5R A;  4XBF A;  3CJR B;  1A31 A;  3AG4 H;  3O2P E;  3V8K A;  3KP2 A;  5KK1 A;  4I02 A;  3GTP J;  3K4M A;  3F0C A;  1S3J A;  2LFB A;  2K02 A;  2MH2 A;  4NQW A;  3LNQ A;  1O3S A;  4ZYH A;  3QOP A;  4BJ6 C;  3CCV I;  5IYB J;  1D0Y A;  1FSE A;  1RUN A;  1WI3 A;  3Q9S A;  4ENM A;  4DZP A;  4WXH A;  5M5X J;  1SVO A;  4PGG A;  3KP7 A;  4BE2 A;  1R5H A;  3TDZ C;  3HGY A;  3FM3 A;  5CQE A;  4BE1 A;  3A01 B;  2WY8 Q;  2E34 A;  1E3H A;  3S17 J;  2RQQ A;  2A6H F;  3H9Q A;  1BM9 A;  1TWH J;  4KJZ A;  1TLH B;  2CQN A;  5LBQ A;  3ELK A;  4BQO A;  1ZEL A;  1JUS A;  1XCB A;  1Z05 A;  1STZ A;  2MSY A;  4HQM A;  3ROU A;  5LD2 C;  3F8M A;  3I0T A;  3HSE A;  2E2I J;  4OAZ A;  2B9S A;  1A5J A;  1FOW A;  1SFX A;  1KA8 A;  3OY9 A;  1YX5 A;  3HOS A;  3S2D J;  1FLI A;  2PG4 A;  5GAD J;  4D5C A;  4IRI A;  1HKS A;  2DK5 A;  4HX8 A;  2FBI A;  4GDF A;  1C0W A;  4I0A A;  3NAR A;  5H6Q A;  4IO9 F;  1JTX A;  3ZMZ A;  3K9T A;  2HQR A;  2DT5 A;  3CTA A;  3MMY B;  3U1K A;  3EPZ A;  1HF0 A;  3MQ0 A;  3ZQG A;  2M34 A;  1FJL A;  1SFO J;  4LIT A;  2K86 A;  1JUM A;  4V2G A;  2QQB A;  2M4K A;  1MNE A;  1UJ8 A;  2QSH X;  3HIF A;  2QF7 A;  3NRV A;  3GTL J;  1HKQ A;  1BR1 A;  2DFH A;  3GLX A;  2PMU A;  3GFJ A;  1F5T A;  5JHU A;  1LDD A;  3DQV C;  3GCM A;  1SVL A;  2XPV A;  5HDK A;  2GWR A;  4Q48 A;  2WAF A;  4UVB A;  2LKS A;  4G7H F;  4CIC A;  2FQ3 A;  3L00 A;  1CF7 B;  1GUU A;  3G3Z A;  4OU0 A;  3L2U A;  2OC6 A;  1FEX A;  2NOJ B;  3WU2 C;  3FK7 A;  2CWE A;  4PJN A;  1TT5 B;  2Z9O A;  1JT6 A;  3ZRG A;  2O7O A;  3QYF A;  3HRU A;  3DLL F;  2IA2 A;  1T08 B;  5DCF A;  4GO1 A;  2RC4 A;  3BCB A;  4EAT A;  4PJL A;  4EQQ A;  1TNS A;  1X4O A;  2R7S A;  2QVO A;  4JBA A;  3VEP A;  3JTH A;  1OCR H;  4KFC A;  5E3M A;  4XNF A;  3K7A J;  3IRQ A;  5FRM A;  2BYV E;  2IGM A;  4DOZ A;  2CQX A;  2L3D A;  1V55 H;  1V54 H;  2HFH A;  2L02 A;  1U5T B;  2W24 A;  2IJL A;  1HW5 A;  1ACI A;  1W1W E;  2A05 A;  4MGR A;  2JA5 J;  3W2V A;  4HST A;  2V9V A;  3AAF A;  3FF5 A;  1HW1 A;  3F23 A;  5K5O A;  5JVG F;  2Q2E A;  4HPQ A;  5JFR A;  3JRD A;  1ZRD A;  5K7Z A;  3BPV A;  1IRG A;  4MO7 A;  4RLQ A;  1IRF A;  2JQ7 A;  5HNH A;  2Q1Z B;  1IUY A;  1ZGA A;  2HDD A;  3DPT A;  2QGU A;  1BOA A;  1OR7 A;  3BPX A;  2E60 A;  3CP8 A;  4CSW A;  1LPQ A;  3HTU A;  4ZDO A;  1FY7 A;  2EA2 A;  2MC3 A;  3ISP A;  3CCE I;  4BEH A;  2K3F A;  4J01 A;  3DEU A;  1F9N A;  4NUB A;  1Y39 A;  3OYK A;  2VQC A;  4E6K G;  2VXZ A;  1PUE E;  4OMZ A;  2NVX J;  4IKF A;  1T0F A;  2JUG A;  3HKZ A;  1FIA A;  1TBX A;  1UZC A;  1OLT A;  3FIS A;  3FBI B;  2B63 J;  2OZU A;  2YX4 A;  3MKL A;  1K4S A;  2BY2 A;  3OSF A;  2M4G A;  3Q0W A;  3EQL F;  3J7Y J;  4I01 A;  5F6F A;  3GBG A;  1DP7 P;  4JK1 X;  1OPC A;  4M9S A;  3ML6 A;  3PL8 A;  3ASN H;  3J81 K;  1ETY A;  1TQI A;  3MFK A;  4A3K J;  4S0H B;  2DMT A;  2XAU A;  1S7A A;  3UR3 C;  3DU5 A;  3HOZ J;  1IUF A;  1RPW A;  4HNU A;  2QM3 A;  2Y0M A;  1OIS A;  2ZFW A;  3GF2 A;  3BG5 A;  2MD0 A;  2Z2S B;  1VQ7 I;  3W2A A;  1OCZ H;  2EFP A;  3CJN A;  5KAF C;  1T8I A;  3K1N A;  1ETO A;  4C3I J;  4YEL A;  5ICF A;  2X4H A;  1ZKG A;  2P8T A;  4BDY A;  4XOP A;  4KMF A;  1X3Z B;  2DOE A;  4A5M A;  3BR3 A;  4ZYG A;  5FKO A;  3FM5 A;  4XLH A;  2XUB A;  3DWL E;  4CYC B;  3G4S I;  3HRT A;  3DPU A;  2LSO A;  3BDD A;  4I7H A;  4MFE A;  1ON2 A;  4HX7 A;  4LK0 F;  4AYB N;  3JSO A;  2CU7 A;  5TIS C;  3HOY J;  2O3F A;  2VKV A;  2WC2 A;  1I1S A;  2G9W A;  1S72 I;  1X19 A;  4B1R A;  3ULQ B;  1YW8 A;  3N05 A;  2ID3 A;  2MC4 A;  3GTM J;  2HDW A;  4U87 A;  2W84 A;  3FXM A;  2ELK A;  1V5G A;  3H9J A;  2O8X A;  2V7F A;  4B3A A;  4U0W A;  3MKY B;  3LSH A;  1ETK A;  1MMS A;  1MDM B;  4R8H A;  4S04 A;  4DZJ A;  1XDU A;  1MGT A;  3OYI A;  2KIF A;  3OR1 C;  4BY7 J;  1BR2 A;  1WKM A;  4MEX F;  3HPH A;  1FYL A;  3H1C A;  4A69 C;  2O03 A;  2GXB A;  4IRH A;  3FXO A;  3DPL C;  3G2B A;  4HF1 A;  3F9K A;  1EA3 A;  3NAU A;  2LC2 A;  3CUO A;  3DBL B;  4D7M A;  4UUV A;  3BJ6 A;  1LE8 B;  1J2X A;  1LKX A;  1VQK I;  3DTK A;  5H2F C;  2NVY J;  3TKY A;  2R7W A;  2LLK A;  5DCM A;  1BJA A;  4HYE A;  1O4X A;  5CPR B;  4XOR A;  1LB2 A;  2M7A A;  4ESB A;  3J7A O;  5LRS A;  1E3P A;  3FWE A;  4DBQ A;  4BHC A;  2GOM A;  4PJJ A;  2O8K A;  5IP7 J;  4BHB A;  1P4X A;  2IRF G;  3LSG A;  2NRA C;  3IL2 A;  5F1J A;  3SEZ A;  3I5U A;  4A3D J;  1D5Y A;  5KVR A;  4XSX F;  3BZK A;  1QPM A;  2L7Z A;  3CF5 F;  3KP6 A;  4BU2 A;  2YUS A;  4O6J A;  3BP8 A;  2R4G A;  2DW4 A;  1KU2 A;  1WH5 A;  3RKW A;  1H9T A;  4S05 A;  3FK6 A;  1I1G A;  2H1L A;  5ED4 A;  2A07 F;  1Y0N A;  1Z3Y A;  4X0G A;  3OIQ A;  3SDG A;  1JTY A;  5DD4 A;  1P4W A;  1ON1 A;  2Y69 H;  1MMN A;  1LDJ A;  2RAE A;  2PBI A;  3ABU A;  3FXL A;  2V6E A;  3OL3 A;  2E1O A;  1MD0 A;  5D6F A;  4FCY A;  5TGT A;  4E7I A;  3L2W A;  2XHK A;  3BR0 A;  2BY3 A;  2KRC A;  1OR7 C;  3SJM A;  1WI9 A;  3J7Z I;  5LGT A;  3S1R J;  2R3S A;  4U0Y A;  2HZD A;  1X1A A;  1UEL B;  1Y56 A;  4U88 A;  1E17 A;  3IH3 A;  4YG2 F;  3WTX C;  4EEF G;  1ERD A;  5J8C A;  2ISZ A;  3FKI J;  1NTC A;  2MAB A;  4I2O A;  3KX2 A;  3HOT A;  1HW2 A;  1AA7 A;  1T0F C;  4KN7 X;  3JRF A;  1K79 A;  3DLA A;  2DQL A;  2V9P A;  2LMD A;  2OD5 A;  3RCO A;  3V42 A;  1SAU A;  4BS9 A;  1TWC J;  1D3Y A;  5IP6 A;  3BT9 A;  4BBS J;  2BVL A;  3E6C C;  1BW5 A;  1YS7 A;  2PMZ A;  2O0Y A;  4BKX A;  3DXJ F;  5JHF A;  3OYL A;  2DA4 A;  3CUQ C;  5K5Q A;  2KLO A;  2PI0 A;  2N8G A;  2EIL H;  5BQT A;  1G2H A;  2RV8 A;  2EBI A;  4ZYE A;  2LNB A;  2H8W A;  4L18 B;  2HS5 A;  4BL0 B;  2FBK A;  3CCS I;  1APL C;  1GXQ A;  2X51 A;  4FET A;  2ADU A;  2E71 A;  1R00 A;  1VQ5 I;  1SMT A;  3IC7 A;  2D5V A;  2GM4 A;  1VQ9 I;  2X6W A;  1XSV A;  3KEQ A;  3PO2 J;  2KHM A;  4A0Z A;  2IGO A;  3E5Q A;  3DBR B;  4RDU A;  1XMX A;  5CYV A;  1D8K A;  1O3T A;  2VBZ A;  5J6X A;  3S32 A;  4BBR J;  2ZJQ F;  2E1M C;  1SFU A;  2R7T A;  1QQI A;  2WWY A;  1IDY A;  4ON0 A;  2XAS A;  1T2K A;  1U9N A;  4OIN F;  4R1H A;  2PJR B;  3HOV J;  4KIG A;  5B3S H;  4RB3 C;  4N4O B;  2ZXW H;  4KIF A;  3H92 A;  1TWG J;  1XX5 A;  5JR3 A;  2KIU A;  2YR2 A;  4XLP F;  1K4T A;  2KRH A;  1J0R A;  1EH6 A;  2F4I A;  1YG2 A;  4G8X A;  3MVP A;  4BAY A;  3K10 A;  3HGG A;  3LL7 A;  3WTZ A;  1T33 A;  3MZ8 A;  3H5N A;  1FBU A;  2DBB A;  3I4P A;  5GAG J;  1VQN I;  1TL8 A;  5C4J J;  2QUF A;  4BH9 A;  1Z21 A;  3KZZ A;  4BY1 J;  3CCQ I;  1W5T A;  2FF4 A;  3TQN A;  1ORK A;  3L09 A;  1POG A;  3F3X A;  2Q0O A;  1QU3 A;  2DMU A;  2A6T A;  3BR1 A;  3M1E A;  2DYS H;  2M5W A;  2O61 A;  2JVH A;  4ZDL A;  3RZD J;  2HKO A;  5D8K B;  4YIR X;  2VIX A;  4A3J J;  1VF9 A;  1G3Y A;  1RES A;  1PP8 F;  4C30 A;  3BY6 A;  1P4A A;  1T95 A;  1IC8 A;  3RJP A;  1X2M A;  1MJB A;  2QBY A;  3ZPL A;  4CHU A;  4M73 A;  3WTS C;  2IS6 A;  5TRD A;  2E5Z A;  4P55 A;  2AXT C;  5BS6 A;  5L3F A;  2PX9 A;  4UVC A;  1G4D A;  2R5Z B;  3FIW A;  2ZSH B;  1XSD A;  2FA5 A;  4A93 J;  3HDD A;  2OJE D;  3OYM A;  3JRH A;  4A3I J;  1IN8 A;  5E1W A;  2VBW A;  2VJI A;  4FHT A;  2WAE A;  2BY0 A;  3QQA A;  2CGP A;  4G9Y A;  5DM7 F;  3BZC A;  3L7W A;  2OCE A;  1M1E B;  1RUO A;  5K5R A;  1R9T J;  3AFH A;  5J4Y A;  3KET A;  4D5F A;  5CLS A;  1ITY A;  2ZNY A;  3W3C A;  1A04 A;  5BOX A;  2DU9 A;  4HEA 2;  3WTY C;  1BC8 C;  5HLG A;  2XSJ C;  1UST A;  3S15 J;  1ZR4 A;  1Y6I A;  4PSX A;  5K7F A;  4C2T A;  3HUG B;  4IEJ A;  2CW8 A;  2Z16 A;  3AL0 C;  3GFM A;  3IAM 2;  5KCM A;  3ABL H;  2STT A;  2CFO A;  4WCG A;  1HDD C;  1YS6 A;  4IHT A;  3RKY A;  4A3F J;  2FMY A;  1LVA A;  2LKX A;  2L5Q A;  3GME A;  5D4R A;  1J59 A;  3OL4 A;  3OS2 A;  2JWT A;  3I71 A;  2HOE A;  2OF7 A;  1L0O C;  2AHQ A;  2ZBK A;  2ZSI B;  3BTC A;  3PNY A;  5D6E A;  3S16 J;  1S5L C;  2RDP A;  1R4M B;  2K5C A;  2DO7 A;  1QGP A;  3BQY A;  4KT5 C;  1E3O C;  2DXI A;  3JSP A;  3ABT A;  4LGW A;  1MBH A;  1RC9 A;  5DV5 A;  4ZJZ A;  2ME0 A;  3SXY A;  1YIJ I;  3GZ5 A;  2DA2 A;  5B1A H;  1UG0 A;  1GVJ A;  3RQ4 A;  5CQG A;  3BC8 A;  5FFZ A;  2IVM A;  5CVI A;  5ERI A;  4EJW A;  5K1Y A;  1QRY A;  3PFY A;  3RIR A;  4L0Y B;  4LG0 A;  1W0U A;  2QSG X;  4CDG A;  3ZMV A;  4UB6 C;  2IS2 A;  2KZV A;  2I10 A;  3MWM A;  2P5K A;  4PGH A;  3VB2 A;  4JYK A;  2DTZ A;  2JPB A;  1N25 A;  1Z67 A;  2QKM B;  2PJP A;  2G0E A;  1LFB A;  1X3U A;  4HA8 A;  2UXN A;  2FD5 A;  2B7E A;  3EUH A;  2H6C A;  2X6O A;  4LD5 A;  3ECH A;  2VPR A;  4F55 A;  2EZL A;  3KP4 A;  4LOC A;  2HTJ A;  1Z91 A; 
#chains in the Genus database with same CATH homology
 2EK5 A;  1IZ1 A;  4B09 A;  1XMA A;  3RI4 A;  2VT2 A;  1U78 A;  1Q1H A;  3VOD A;  2FBH A;  5HLH A;  1BIB A;  5FO5 A;  4GCV A;  2CW0 F;  3KFW X;  1R1U A;  4ETS A;  1HST A;  2F5E A;  3HYI A;  5LEK A;  1R36 A;  3ZN0 A;  1ZH5 A;  4EV0 A;  1PP7 U;  3LFK A;  2BBY A;  3ZMS A;  3F6O A;  1U3E M;  1ZG1 A;  1ZLJ A;  2FEZ A;  2BV6 A;  2GA2 A;  3FXU A;  1ZG5 A;  4I98 B;  2A3S A;  1KQ0 A;  3WE2 A;  3LA3 A;  3PQK A;  4YFN F;  3F72 A;  4RB2 C;  1ZN2 A;  1DPR A;  2D1V A;  4AIH A;  2AS5 F;  1PDN C;  3U9G A;  5CVV A;  2MA3 A;  3K69 A;  4LMY A;  4BHP A;  3SZP A;  1B1B A;  4UV8 A;  1DUX C;  5LLQ A;  3GVA A;  2Z99 A;  2MLK A;  5D5W B;  2XGX A;  4D0P A;  4ENJ A;  2QZ8 A;  1XMK A;  2D2W A;  4F7Z A;  5ILV A;  1CF7 A;  4H0E A;  4GGG A;  1XGO A;  2FSW A;  3C3W A;  2D1H A;  1ODD A;  2D45 A;  3KZY A;  3K1M A;  4GYI A;  5E20 A;  1K78 A;  3TGN A;  2KRF A;  2FOK A;  1B9N A;  2F5C A;  1BC7 C;  3TOB A;  4L0Z B;  5HDG A;  1U5T A;  5CVJ A;  4A0X A;  1XD7 A;  5ICE A;  3M8F A;  3O3K A;  3T8R A;  2RKH A;  1KU9 A;  1FZP B;  4FX0 A;  1R23 A;  2ESN A;  1ZLK A;  1R1V A;  2OAZ A;  3I59 A;  3R61 A;  4HF2 A;  2NYX A;  4A6D A;  3BWG A;  1T39 A;  3L9F A;  4EJO A;  1TW3 A;  2O6G E;  1OMI A;  3WOD F;  1J7K A;  2IPQ X;  4KYW A;  4OIQ F;  5LHH A;  3V7S A;  5FFX A;  2AXL A;  2FML A;  3HHG A;  1FYM A;  2VT3 A;  1QZY A;  4HDV A;  5HS7 A;  4AVP A;  4U0V A;  2YX7 A;  5EEH A;  3CO6 C;  3NEU A;  3RYR A;  3I64 A;  4K2E A;  2MLG A;  4IJA A;  5D5U B;  2JTV A;  2G7H A;  4XSZ F;  4PZJ A;  4JQF A;  4PDK A;  5LHI A;  2OA4 A;  1SMY F;  1WRJ A;  1K6O A;  3GW2 A;  2DPU A;  2L4M A;  2JRT A;  5AON A;  4ASN A;  3GXO A;  3QP5 A;  1RNL A;  2KJC A;  1I5Z A;  5L3G A;  2L4A A;  3MAJ A;  2A61 A;  2F5D A;  3U2R A;  3JAM Z;  3DV8 A;  5FB2 A;  2Y48 A;  4KIB A;  4M74 A;  3JAM K;  1QO0 D;  2EV0 A;  3HHH A;  4M6Y A;  3CUQ B;  5BMZ A;  3F8C A;  2LKP A;  2VON A;  2OZ6 A;  4KMU X;  4IHS A;  3K0L A;  2P6T A;  2YSR A;  1ZAO A;  4Y13 A;  3EYI A;  2CO5 A;  2OU2 A;  2QWW A;  2DPD A;  5H6R A;  1XDS A;  3LAP A;  1T38 A;  3J80 Z;  2XAF A;  3K2Z A;  2IT0 A;  1W5S A;  2HDC A;  2C6Y A;  3HTS B;  1Z6R A;  3J80 K;  3FX3 A;  3WU0 A;  3IHU A;  4OIO F;  1BIA A;  1GHC A;  1FT9 A;  2FE3 A;  5L3C A;  2M8E A;  3MEX A;  3R0J A;  4UVA A;  1YQA A;  4Y15 A;  4EM0 B;  4HLX A;  1GXP A;  3HSR A;  2K4B A;  4A12 A;  4KN4 X;  1U5T C;  1JHF A;  1S29 A;  2XAG A;  4L9T A;  1XCV A;  1KGS A;  3I54 A;  5DDG A;  5JVT A;  1RIO H;  4KNY A;  4UNO A;  1JHH A;  3WTU C;  2LDU A;  5HLI A;  4EGY A;  1G6N A;  2DLL A;  4QWQ A;  4HBL A;  1TQP A;  2DK8 A;  5AIP A;  3RDI A;  2ZME A;  2COM A;  2KKO A;  5JI6 A;  4Z2Y A;  1UB9 A;  1UHM A;  3BOQ A;  3GZ6 A;  2UWM A;  3C18 A;  2R7F A;  4EM2 A;  1ONV A;  3DFG A;  3EDP A;  3SQN A;  1ZHF A;  4M9Z A;  1QZZ A;  2Z3Y A;  2IW5 A;  5L3E A;  4QLC U;  4UHT A;  1SD4 A;  5D4S A;  5D5V B;  2L54 A;  4TV7 A;  3KEO A;  2Z33 A;  1FSH A;  3RYP A;  4RB1 A;  3RPU A;  4EJU A;  3GEZ A;  5HS8 A;  4KIC A;  5E17 F;  4RB0 A;  3V4G A;  3WTW C;  1FBQ A;  1YYV A;  2EWN A;  3QPT A;  3SZT A;  3JW4 A;  5LEJ A;  1TTY A;  3T1B A;  2VOD A;  2GIV A;  4LB5 A;  4MQV A;  3ERE D;  3KP3 A;  4ESJ A;  2UXX A;  4ENK A;  1Z7U A;  4M6X A;  1FWZ A;  1MKM A;  2RNJ A;  2OQG A;  3IKV A;  1FYK A;  2V1U A;  2EA4 A;  1FP2 A;  4LFU A;  1W7P B;  2W57 A;  3OOP A;  3C7J A;  3OV8 A;  4HX4 A;  3GYH X;  4HZF A;  1SFE A;  2RGV A;  1UFM A;  4WXC A;  4DQ2 A;  4P9F A;  3DKW A;  2GA1 A;  3C1D A;  2BE5 F;  1TQM A;  4LLN A;  3SFZ A;  1DPU A;  1YW7 A;  2VOO A;  3KE2 A;  2WTE A;  2CFX A;  2CSO A;  1LEB A;  1E2X A;  1F1Z A;  2L01 A;  1G3T A;  4G7Z F;  3VFZ A;  2J5P A;  1LDK B;  3HUG A;  4HV5 A;  5HS9 A;  3ECO A;  1XSX A;  3GUD A;  1WQ2 A;  1R5G A;  5E1Z B;  3JTG A;  4M72 A;  2P7V B;  1O3R A;  5AIQ A;  2PQ8 A;  1IXR C;  2G7U A;  4IRG A;  2Z5U A;  3CDH A;  4P96 A;  5E18 F;  2QBY B;  4EVI A;  1ZYR F;  3QRF F;  2PMH A;  3LST A;  1B9M A;  1KU3 A;  5FGM A;  1G3S A;  4AD9 A;  3GFI A;  4LK1 F;  1Z1D A;  2NS0 A;  4PCQ A;  2HQN A;  3LAJ A;  3WG9 A;  3FZV A;  4KUM A;  2VOP A;  4NB5 A;  2Y75 A;  1YTY A;  2HGC A;  2IP2 A;  3M8E A;  3ZN1 A;  2QEN A;  5CVR A;  4WX9 A;  3I58 A;  1S8N A;  3BJO A;  4LLG F;  4N0B A;  1O3Q A;  2EFQ A;  2B0L A;  1JGS A;  2OQR A;  4BNC A;  3WGH A;  4BQA A;  3W6K B;  2VE8 A;  4G7O F;  2P7C B;  1EV7 A;  1IW7 F;  4RGS A;  2HTS A;  1XGM A;  4RS8 A;  2XRN A;  2VBX A;  1L3L A;  2XV4 S;  1TW2 A;  1XGN A;  4OOI A;  2H6B A;  1XB4 A;  4UV9 A;  1MJA A;  2STW A;  1Z6T A;  4G6D A;  2DFI A;  3ZP5 A;  1H9G A;  5L3D A;  3BJA A;  2XAQ A;  2M45 A;  1NHA A;  4FX4 A;  1KQ9 A;  3QP6 A;  2FXA A;  5ILU A;  1BN5 A;  3WE3 A;  4MEY F;  3PQJ A;  3SHF A;  4A6E A;  2A69 F;  3RTR A;  1AOY A;  3WTV C;  1VTN C;  3TDU C;  5LGN A;  2K27 A;  2MH9 A;  1FNN A;  3BZ6 A;  3DP7 A;  3DF8 A;  1J75 A;  3WGG A;  4KA4 A;  5EEG A;  3FMQ A;  1YIO A;  6PAX A;  3F21 A;  4CZZ A;  3B73 A;  1UCR A;  2JPC A;  3Q9V A;  2XVC A;  2DTR A;  2EV5 A;  1O57 A;  2ZJ2 A;  2BEO A;  1J9I A;  1J5Y A;  2H09 A;  2XKP A;  4FT8 A;  4O5V A;  2YPR A;  2W25 A;  2JZY A;  2EFW A;  2V1X A;  2HWV A;  1Y0U A;  4HAM A;  2GXG A;  5TJJ A;  4A0Y A;  3TO7 A;  2ZNZ A;  1IN5 A;  4L5J A;  3V8L A;  1H0M A;  3H3Z A;  3T0Y A;  1HBX G;  4O3M A;  2EJR A;  3LA2 A;  4WWC A;  2IA1 A;  3E5X A;  2NNY A;  5D5X B;  4ESF A;  1ZRF A;  2XRO A;  1D5V A;  3TO9 A;  4HF0 A;  4L9N A;  4B8X A;  4LJZ F;  3FMR A;  5ILS A;  1SD5 A;  1TNT A;  5L3B A;  4RAY A;  3EET A;  2ELH A;  2FNP A;  1QBJ A;  2V79 A;  3BRO A;  3D0S A;  4ZH4 F;  2MD5 A;  3F6V A;  2NAZ A;  2VC1 A;  4BYY A;  1U2W A;  1XN7 A;  4Q5S F;  1CGP A;  4ZZD A;  1LEA A;  1K78 B;  3KLN A;  3QAH A;  4BXU A;  2XAJ A;  2WV0 A;  2FRH A;  3IWF A;  4A5N A;  2P6S A;  4EJV A;  3LWF A;  2E7X A;  2ZO4 A;  1IXC A;  1B4A A;  2DQR A;  5J8F A;  2XIG A;  2TDX A;  3CO7 C;  2W85 A;  3I59 B;  1BI0 A;  1ZG3 A;  1KYZ A;  3MZY A;  4RGX A;  3W6J B;  4WK8 F;  1HXD A;  3WTT C;  2K7L A;  1P2F A;  1FC3 A;  3GO5 A;  1B6A A;  3HRS A;  1QNT A;  4I09 A;  4AIJ A;  3RPQ A;  4MNU A;  4GXO A;  2FNA A;  2LF8 A;  1EH7 A;  1UHW A;  2HYF A;  4MHG A;  2M30 A;  2E1N A;  1RZ4 A;  2HZT A;  3LQQ A;  1R1T A;  1P92 A;  3J81 Z;  2ISY A;  1R7J A;  3CUQ A;  1P6R A;  3KP5 A;  3HSF A;  2EFN A;  2KJB A;  1JE8 A;  3V7R A;  2QYO A;  1HKT A;  3LA7 A;  3T8T A;  1XGS A;  1KU7 A;  4WF2 A;  4Q4Z F;  5F1R A;  2UZK A;  4G6Q A;  2E1C A;  3ZMT A;  2V1D A;  4N9I A;  1ZAR A;  3QPH A;  1JXS A;  2ZKZ A;  1IN6 A;  3P9K A;  2ACJ A;  4CGZ A;  5H20 A;  2HR3 A;  4HOB A;  4LLL A;  1MDM A;  5FLX Z;  2JSC A;  4EMS A;  1K7A A;  3Q5F A;  1ZGJ A;  5DUI A;  4L9V A;  5FLX K;  4RGU A;  1I27 A;  3NQO A;  2J5O A;  1SD6 A;  4XRF A;  2RVC A;  5LGU A;  3ZQ7 A;  1YFH A;  2DI3 A;  3S2W A;  3REO A;  3H3U A;  4IF4 A;  2H94 A;  2K4J A;  5E8G A;  1RI7 A;  3B02 A;  3E97 A;  4CXF A;  2VBY A;  4MTD A;  1IAW A;  3FMS A;  5ICG A;  3K1P A;  4IXA A;  1FBS A;  2F5F A;  1SD7 A;  5LHG A;  1BI3 A;  3E6D A;  1YLF A;  1G3W A;  5HVQ C;  4HV6 A;  5HDN A;  4U7D A;  3WU1 B;  4Y17 A;  3M7G A;  4IVN A;  3O6B B;  5FD5 A;  4YII A;  3GFL A;  3TO6 A;  5CVU A;  4N9H A;  3MCZ A;  3PFI A;  1WSU A;  4EJT A;  1HQC A;  1REP C;  2KIM A;  5DCM B;  5HOO A;  3P9I A;  5DD8 A;  2JT1 A;  2CG4 A;  3IKT A;  2ZCW A;  1FP1 D;  3I53 A;  2P4W A;  2NNN A;  3FXR A;  2MBF A;  3ZMD A;  3COA C;  4RAZ A;  3MZH A;  3P7N A;  2EV6 A;  2ZME B;  2R7D A;  4NHJ A;  4A2U A;  1U8R A;  4M71 A;  2PLY A;  4XLN F;  3KLO A;  2CYY A;  1V3F A;  4E70 A;  3FHZ A;  2XAH A;  1R22 A;  4OIP F;  1BI2 A;  1W7P A;  1EH8 A;  1ULY A;  4YFK F;  2P5V A;  1IN4 A;  1DDN A;  1R58 A;  2P5L C;  3P9C A;  1B59 A;  3ZMU A;  4M9X A;  3CLO A;  5DYM A;  3G73 A;  1YO5 C;  2YU3 A;  4L9J A;  2GQQ A;  1ZRC A;  2FU4 A;  2QQA A;  3F8B A;  5DUK A;  5FD6 A;  1FPQ A;  3QU6 A;  3E6B A;  1IF1 A;  2CQK A;  4P5O A;  2V6C A;  4MTE A;  4RGR A;  1W4M A;  2LF7 A;  1KYW A;  2M87 A;  3IWZ A;  4ENN A;  3R0A A;  4I0B A;  2IA0 A;  1LNW A;  4YFX F;  1D8J A;  1WWX A;  4GYG A;  4MQ9 F;  4G94 A;  4CYD A;  4CO8 A;  1IXS B;  1YW9 A;  3M9A A;  3GX4 X;  5A2Q Z;  1MJ9 A;  2A68 F;  5D8L B;  2ETH A;  5A2Q K;  5IT3 A;  1ZRE A;  4U7B A;  4HQE A;  4HDU A;  2ESH A;  4LB6 B;  5E1X A;  3RKX A;  3F8N A;  3N4M A;  2F2E A;  4OIR F;  2XKO A;  3V8J A;  1FX7 A;  2GZW A;  3FXQ A;  3N97 A;  2DAO A;  3R60 A;  4HW0 A;  5IT9 Z;  1USS A;  5BPI A;  5LRR A;  2PEX A;  2HEO A;  3LQR A;  4UXN A;  5IT9 K;  2E7W A;  3L2C A;  4HLY A;  1IN7 A;  2PN6 A;  3EYY A;  3IRR A;  2A5Y B;  2EFO A;  1T6S A;  2Q8K A;  3V7C A;  1U6G A;  1OYY A;  1I6X A;  4IPA A;  2VN2 A;  3WGI A;  5F64 A;  2H27 A;  2HYG D;  1S6L A;  5DEQ A;  4R79 A;  1OKR A;  2RN7 A;  2HKX A;  2GAU A;  5E8I A;  2VE9 A;  4EM1 A;  1S7O A;  4YIF A;  1OYW A;  4ZZL A;  2X0L A;  2EB7 A;  5ICC A;  1AWC A;  1F4K A;  3HRM A;  1Z9C A;  3E6M A;  4L5I A;  3VOE A;  4EGZ A;  4ZYD A;  1OYI A;  1BBY A;  2M1B A;  1V4R A;  4KDP A;  1O7F A;  3U1D A;  2OBP A;  3E3V A;  4AIK A;  1KQ8 A;  1HSJ A;  4WXD A;  2QLZ A;  4LG0 B;  3R6S A;  3E5U A;  2QQ9 A;  2RQP A;  4OMY A;  1BI1 A;  3TOA A;  2PFB A;  1SAX A;  3D5L A;  3T5X A;  1O7L A;  2A6E F;  1LJ9 A;  4P9U A;  3KCC A;  3R4K A;  4AWX B;  3QU3 A;  2BGC A;  3F22 A;  2VC0 A;  5CJ9 A;  1W7P D;  5BPD A;  3F8F A;  1MZB A;  3GWZ A;  4DNC A;  1T98 A;  2ZXJ A;  1LQ1 A;  1FOK A;  4Q47 A;  4XBF A;  3O2P E;  3V8K A;  3KP2 A;  5KK1 A;  4I02 A;  1S3J A;  2K02 A;  2MH2 A;  4NQW A;  1O3S A;  4ZYH A;  3QOP A;  1FSE A;  1RUN A;  3Q9S A;  4ENM A;  4WXH A;  4PGG A;  3KP7 A;  1R5H A;  3TDZ C;  3FM3 A;  2A6H F;  1BM9 A;  1TLH B;  5LBQ A;  3ELK A;  1XCB A;  1Z05 A;  1STZ A;  4HQM A;  3ROU A;  3F8M A;  3I0T A;  3HSE A;  1SFX A;  1KA8 A;  3HOS A;  1FLI A;  2PG4 A;  4IRI A;  1HKS A;  2DK5 A;  4HX8 A;  2FBI A;  1C0W A;  4I0A A;  5H6Q A;  3ZMZ A;  3K9T A;  2HQR A;  2DT5 A;  3CTA A;  3MQ0 A;  2K86 A;  2QQB A;  3HIF A;  3NRV A;  1HKQ A;  3GLX A;  2PMU A;  3GFJ A;  1F5T A;  5JHU A;  1LDD A;  3DQV C;  5HDK A;  2GWR A;  4Q48 A;  4UVB A;  4G7H F;  4CIC A;  2FQ3 A;  3L00 A;  1CF7 B;  3G3Z A;  4OU0 A;  2CWE A;  2Z9O A;  3HRU A;  2IA2 A;  5DCF A;  4GO1 A;  2RC4 A;  4EQQ A;  1TNS A;  2QVO A;  4JBA A;  3VEP A;  3JTH A;  4KFC A;  3IRQ A;  2BYV E;  2L3D A;  2L02 A;  2HFH A;  2W24 A;  1U5T B;  2IJL A;  1HW5 A;  4MGR A;  2V9V A;  3AAF A;  3FF5 A;  1HW1 A;  3F23 A;  5K5O A;  2Q2E A;  5JFR A;  1ZRD A;  3BPV A;  1IRG A;  1IRF A;  1IUY A;  1ZGA A;  3DPT A;  1BOA A;  1OR7 A;  3BPX A;  3HTU A;  1FY7 A;  2EA2 A;  2MC3 A;  3ISP A;  3DEU A;  1F9N A;  2VXZ A;  1PUE E;  4OMZ A;  1T0F A;  1TBX A;  2OZU A;  2YX4 A;  3EQL F;  4I01 A;  5F6F A;  1DP7 P;  4JK1 X;  1OPC A;  4M9S A;  3ML6 A;  3J81 K;  1TQI A;  3MFK A;  1S7A A;  2QM3 A;  2Y0M A;  2ZFW A;  3GF2 A;  2EFP A;  3CJN A;  3K1N A;  5ICF A;  2X4H A;  2P8T A;  4KMF A;  4A5M A;  4ZYG A;  3FM5 A;  2XUB A;  3HRT A;  2LSO A;  3BDD A;  4I7H A;  1ON2 A;  4HX7 A;  4LK0 F;  3JSO A;  2O3F A;  2WC2 A;  1I1S A;  2G9W A;  3ULQ B;  1YW8 A;  2W84 A;  2O8X A;  4U0W A;  1MDM B;  4R8H A;  4S04 A;  1XDU A;  1MGT A;  2KIF A;  1WKM A;  4MEX F;  1FYL A;  2O03 A;  2GXB A;  4IRH A;  3DPL C;  4HF1 A;  3CUO A;  4UUV A;  3BJ6 A;  1J2X A;  3TKY A;  5DCM A;  1BJA A;  4HYE A;  1LB2 A;  4ESB A;  3J7A O;  5LRS A;  3FWE A;  4BHC A;  4BHB A;  1P4X A;  2IRF G;  2NRA C;  3IL2 A;  3I5U A;  5KVR A;  4XSX F;  1QPM A;  3KP6 A;  4O6J A;  3BP8 A;  2DW4 A;  1KU2 A;  3RKW A;  1H9T A;  4S05 A;  1I1G A;  5ED4 A;  2A07 F;  5DD4 A;  1P4W A;  1ON1 A;  1LDJ A;  2PBI A;  3ABU A;  1MD0 A;  5D6F A;  2XHK A;  1WI9 A;  5LGT A;  2R3S A;  4U0Y A;  4U88 A;  1E17 A;  4YG2 F;  3WTX C;  5J8C A;  2ISZ A;  4I2O A;  3HOT A;  1HW2 A;  4KN7 X;  1K79 A;  2DQL A;  2OD5 A;  1D3Y A;  3E6C C;  1YS7 A;  2O0Y A;  3DXJ F;  3CUQ C;  5K5Q A;  2PI0 A;  5BQT A;  2RV8 A;  4ZYE A;  2LNB A;  4L18 B;  2HS5 A;  2FBK A;  1GXQ A;  2ADU A;  1R00 A;  1SMT A;  3IC7 A;  1XSV A;  3KEQ A;  4A0Z A;  3E5Q A;  5CYV A;  1D8K A;  1O3T A;  2VBZ A;  5J6X A;  1SFU A;  1QQI A;  2WWY A;  4ON0 A;  2XAS A;  1T2K A;  4OIN F;  4R1H A;  4KIG A;  4RB3 C;  4KIF A;  3H92 A;  5JR3 A;  2KIU A;  2YR2 A;  4XLP F;  1J0R A;  1EH6 A;  1YG2 A;  4G8X A;  4BAY A;  3WTZ A;  1FBU A;  2DBB A;  3I4P A;  2QUF A;  4BH9 A;  3KZZ A;  1W5T A;  2FF4 A;  3TQN A;  3L09 A;  3F3X A;  2Q0O A;  2O61 A;  3M1E A;  2M5W A;  2HKO A;  5D8K B;  1G3Y A;  1PP8 F;  3BY6 A;  1P4A A;  3RJP A;  1MJB A;  2QBY A;  3ZPL A;  4CHU A;  4M73 A;  3WTS C;  5TRD A;  4P55 A;  5BS6 A;  5L3F A;  4UVC A;  1G4D A;  1XSD A;  2FA5 A;  1IN8 A;  5E1W A;  2VBW A;  4FHT A;  2CGP A;  4G9Y A;  3L7W A;  1RUO A;  5K5R A;  3KET A;  5CLS A;  2ZNY A;  1A04 A;  5BOX A;  2DU9 A;  3WTY C;  1BC8 C;  5HLG A;  1UST A;  3GFM A;  2STT A;  4WCG A;  4IHT A;  1YS6 A;  3RKY A;  2FMY A;  1LVA A;  5D4R A;  1J59 A;  3I71 A;  2HOE A;  1L0O C;  2ZBK A;  5D6E A;  2RDP A;  2DO7 A;  1QGP A;  4KT5 C;  3JSP A;  3ABT A;  4LGW A;  5DV5 A;  3SXY A;  3GZ5 A;  1GVJ A;  5FFZ A;  2IVM A;  5CVI A;  5ERI A;  4EJW A;  5K1Y A;  3RIR A;  4L0Y B;  4LG0 A;  4CDG A;  3ZMV A;  3MWM A;  2P5K A;  4PGH A;  3VB2 A;  2JPB A;  2PJP A;  1X3U A;  4HA8 A;  2UXN A;  3EUH A;  2H6C A;  4LD5 A;  3ECH A;  3KP4 A;  2HTJ A;  1Z91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...