3HHHA

Crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
102
Chain Sequence
b'KQTELLKGILEGLVLAIIQRKETYGYEITKILNDQGFTEIVEGTVYTILLRLEKNQWVIAEKKPSEPMRKFYRLTSSGEAELADFWQRWTLLSKQVNKMKKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, PadR family
publication title Crystal structure of transcriptional regulator, a membar of PadR family, from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Transcription regulator
total genus 32
structure length 102
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hhhA00
4HX4A 3IWZA 5CVRA 2GXGA 2HZTA 5TRDA 3ZMTA 2ZBKA 5FGMA 1U8RA 1FX7A 3ELKA 3E97A 3R0JA 2DU9A 1I1SA 3DPTA 1IXSB 4UVBA 4L5IA 2EJRA 1ON2A 2W84A 2MLKA 4LG0A 2DT5A 3ML6A 1ZYRF 1O3RA 4P55A 3DPLC 3I0TA 2V9VA 2M1BA 1YS7A 1XGOA 4KA4A 2HGCA 5JFRA 1W5TA 4UHTA 1YFHA 1MJBA 5JHUA 2QQ9A 3MQ0A 5D8LB 3NEUA 1O7FA 2QLZA 4ASNA 4HV5A 4NQWA 3IRQA 3MEXA 1PP7U 1K78B 3FM5A 4ON0A 4RB1A 4Y13A 2ELHA 3SQNA 1TLHB 2QVOA 4HA8A 2XKPA 4KMUX 2GWRA 2F5CA 1ULYA 2L01A 5E20A 1XB4A 1D8JA 3JSPA 3F3XA 4HLXA 4L9VA 2V1DA 3TO9A 1R5GA 2J5OA 1J5YA 5L3FA 1WWXA 5HOOA 2A07F 1TW3A 2XAHA 3ROUA 3RTRA 3HYIA 1KYZA 3BJAA 1TQIA 1SMTA 2ADUA 4CZZA 4GGGA 5FLXK 1JHHA 2EV5A 2HTJA 3LA7A 4LLLA 2BE5F 1B1BA 1QPMA 4D0PA 4M73A 1J75A 2EV6A 3O6BB 4L0ZB 3U9GA 2XAFA 1I27A 1HW2A 4L18B 4FX4A 1TW2A 4IRHA 5J8CA 2F5FA 2JPCA 2DPUA 4EM2A 2E1NA 1ZN2A 2KRFA 3WTWC 2VC0A 4YFNF 2CFXA 2FBIA 1YQAA 5F64A 1H9TA 2WWYA 3BY6A 1TQPA 5K5OA 4L5JA 2G9WA 2WV0A 2AS5F 1JXSA 3HSFA 4XBFA 1T98A 1IAWA 1ZG1A 3DXJF 2ZFWA 4OIPF 1JHFA 1ZAOA 3T8RA 4ZYHA 3VFZA 4HF1A 2DK5A 4AVPA 3CLOA 4I98B 3ZMVA 1FYKA 3F8CA 1XSXA 4IRGA 4O6JA 4HYEA 1WRJA 1LB2A 5LHHA 2RNJA 2XASA 1ZARA 2R7FA 1P4AA 5E8GA 1SD6A 1ZRCA 3M8FA 5HLIA 5D6EA 2O8XA 3T1BA 4EJUA 2V6CA 1U3EM 1WQ2A 3GFMA 3IWFA 5DUKA 3QP6A 3EETA 1XCBA 2AXLA 3SZPA 3E3VA 3FF5A 5L3DA 5FD5A 1R7JA 3K1NA 1U2WA 4OMZA 3PFIA 1MJAA 2M87A 3GYHX 4A5MA 3ZP5A 2JZYA 2HWVA 3TQNA 1QQIA 4MTDA 1Z6RA 1F1ZA 4Q48A 3ZN0A 4KN7X 3WTSC 2P7VB 1USTA 3F22A 2XGXA 3BJOA 3CDHA 3M8EA 2O3FA 2GA1A 1HW5A 3DKWA 4IXAA 3SHFA 5LGNA 1F9NA 1NHAA 1R00A 2NAZA 4KUMA 3IKTA 1S8NA 2EA4A 2FRHA 2X4HA 3JSOA 1F5TA 2HYFA 5D6FA 1CGPA 2EV0A 1LNWA 1RI7A 5DYMA 3V8JA 1FOKA 3MWMA 2PI0A 2HKOA 1MZBA 1Y0UA 1LEBA 3KLNA 3FMRA 4R1HA 2STWA 3MCZA 2XHKA 3R6SA 3FHZA 1ZLKA 4G94A 5LLQA 3RKXA 4A6EA 4U7DA 3TO7A 3B02A 2DLLA 4F7ZA 4UVCA 3HHHA 1E2XA 3MZHA 4N0BA 2HS5A 1D5VA 2YX4A 3W6JB 2ZJ2A 1D8KA 3LWFA 3GFIA 3GLXA 1KYWA 3FX3A 2IRFG 3L00A 3F21A 1IRGA 2C6YA 4KT5C 1B59A 3FXQA 3HRTA 5D5XB 5F1RA 5HVQC 2FA5A 4LK1F 3M7GA 2LDUA 2EK5A 1ZRFA 4CXFA 5K1YA 4L9NA 4A12A 1IXCA 3REOA 1S7OA 3MZYA 4LLGF 3BZ6A 4YFKF 4O3MA 3DP7A 3NRVA 4LD5A 4HF0A 4KNYA 1O3QA 1REPC 5ICFA 2P6SA 4RGRA 3IRRA 5H6QA 3O3KA 1K79A 1ZLJA 1XDUA 1XGMA 3F6VA 3IL2A 3N97A 2GAUA 2F5EA 1W7PA 3RPQA 3RI4A 1RIOH 1TNTA 4KDPA 3Q9VA 4EGYA 5CVIA 4HQEA 2EFWA 5E1WA 3LFKA 5AIQA 2L4MA 3GF2A 1MKMA 1PUEE 2DI3A 4EQQA 4DNCA 4EJVA 3BJ6A 3KLOA 4B8XA 5LRRA 3KCCA 1BIAA 1R1TA 3HSRA 1SFUA 1YS6A 4M72A 1G3TA 1R23A 1S3JA 4GXOA 4ZYDA 2VE9A 5HS7A 4WK8F 3IC7A 2UWMA 3SFZA 5DEQA 1LQ1A 2RDPA 3I4PA 2KIMA 3KP2A 3KZZA 4XRFA 1LDJA 1BI2A 2A69F 2RN7A 1O3SA 2VC1A 3GO5A 5HS9A 4PDKA 1S29A 3WTVC 4HZFA 5CYVA 1IN4A 2FMYA 1U5TB 2HEOA 4I2OA 1XD7A 3RDIA 2M30A 2FBHA 1T0FA 3ZMZA 3GXOA 3I71A 5DCFA 2Z33A 2K4JA 1J59A 2Q0OA 2VOPA 2UXXA 1W4MA 2JTVA 3BROA 2H27A 3GEZA 1S7AA 1C0WA 1TNSA 5FFXA 2DW4A 1R5HA 3K69A 3VODA 1TQMA 2PFBA 4P9FA 5FD6A 4BHPA 2IJLA 1K6OA 5HDKA 2ZNZA 5F6FA 1YW8A 3WU1B 3HOTA 2RV8A 2XRNA 3FM3A 2XAJA 2EFNA 2H6BA 5LEKA 2PMHA 1OYIA 1U5TC 2BGCA 4WXDA 1KU3A 3F8BA 2D2WA 1ODDA 3LQQA 2Z99A 2XAGA 5DCMA 1Z1DA 3FXRA 2CO5A 5K5QA 5K5RA 3S2WA 3KP3A 3CUQA 1V3FA 2ETHA 3WTYC 4Z2YA 3J80Z 1AWCA 4CO8A 3KEQA 1HQCA 3HSEA 3F6OA 4XSZF 5BQTA 2LKPA 3VOEA 1OPCA 2L02A 4EGZA 2L4AA 5LEJA 1U6GA 1QO0D 4JK1X 4EM0B 5BMZA 2JT1A 2HR3A 4U0WA 2CQKA 2CSOA 4HV6A 4PZJA 2IA0A 2E7WA 4LG0B 4I01A 1FBUA 2Z9OA 4ZZDA 1LVAA 5E1ZB 3QU3A 1SAXA 3QPHA 4H0EA 4WXCA 1FSEA 4MQ9F 1X3UA 3BPVA 1I1GA 1MD0A 3P7NA 2IA1A 1SD7A 2COMA 3KP4A 4U0VA 1SMYF 5CVUA 4BH9A 3I53A 4YIFA 4MNUA 4ENJA 2VT3A 1E17A 4RAZA 5ILVA 3NQOA 1MJ9A 2QZ8A 3ECHA 3E6BA 2K4BA 1BC7C 2PQ8A 1S6LA 2XV4S 2RGVA 5BPIA 2V1XA 4WX9A 4G8XA 2A68F 2Y75A 1KQ0A 3HIFA 2LF8A 3K2ZA 1FT9A 5CVJA 1P4WA 4P5OA 2NYXA 1D3YA 4WWCA 4A0ZA 1FP2A 4MTEA 4I0BA 1I6XA 4G9YA 3TKYA 3GZ5A 2MD5A 4GYIA 2D1HA 4OIRF 2O61A 2HDCA 4CGZA 2P8TA 2HQRA 3W6KB 1DPUA 2OBPA 3Q9SA 2D1VA 3WGHA 3QP5A 2F5DA 2ZMEA 2RVCA 5DD4A 1KU7A 4BAYA 3F23A 4HW0A 2BBYA 1J2XA 1IF1A 4IHSA 4BYYA 2HQNA 3DF8A 1QNTA 2EB7A 4OIQF 2Z5UA 1HSTA 2ZCWA 1P6RA 1UB9A 5KK1A 2QBYA 5ICCA 4ZYGA 4L9JA 4BXUA 3H3UA 4AD9A 2NNNA 1LEAA 1YO5C 4RS8A 2DO7A 1T39A 2LF7A 2A5YB 4N9HA 2KJBA 3D0SA 3RKYA 1FBSA 1LDDA 3QOPA 1YW7A 4EVIA 4EJTA 3BWGA 3COAC 3AAFA 2DPDA 3K9TA 4UNOA 4ESJA 1IXRC 1IN8A 4Q47A 2OA4A 2PN6A 1WKMA 2FF4A 1EV7A 1FY7A 4P96A 3RPUA 4ENMA 3E5QA 4HOBA 1K7AA 4PCQA 3I59A 4Q4ZF 4UXNA 2LNBA 1BN5A 4UV9A 2ESHA 1IZ1A 4RAYA 4LFUA 1O57A 2G7UA 3F8NA 3Q5FA 2KIFA 3WG9A 4FX0A 3ZMDA 1EH7A 5FO5A 3TDZC 1YTYA 2J5PA 1IRFA 4HDUA 1P4XA 2H6CA 1IW7F 5ILUA 1JGSA 1PP8F 2VT2A 3ZN1A 2FNAA 3I64A 2DTRA 1FZPB 1G3SA 3HRUA 3RIRA 4KMFA 1RUNA 4QLCU 4XSXF 2ZXJA 2VBWA 3C7JA 2PBIA 3WGGA 3R0AA 1FBQA 3I54A 1HKSA 3KE2A 4R8HA 4EM1A 1BI3A 3RKWA 3TOBA 1IN6A 4EJOA 3HHGA 3JAMZ 3KFWX 4BNCA 1TBXA 4RB2C 2FQ3A 4I02A 1B6AA 5E8IA 4DQ2A 1QZYA 2WC2A 1XN7A 4UV8A 2BEOA 2FMLA 4A5NA 4E70A 4A0XA 3ISPA 1Z9CA 4MGRA 3GFJA 1HKTA 4KIFA 5LGTA 2CWEA 4B09A 1OKRA 2ISYA 2UXNA 3WODF 1V4RA 2HYGD 4MHGA 5IT9Z 4ESBA 2GZWA 2CG4A 1CF7A 1KGSA 3HTUA 1G3WA 1FP1D 2Y48A 1KQ8A 2OZUA 5JI6A 1KU9A 3V7SA 3HOSA 4WF2A 2VBXA 4LB5A 3PQJA 2NNYA 5DD8A 2LSOA 2ZNYA 3ECOA 4HX8A 3J80K 3B73A 2VBZA 2D45A 1WI9A 4IPAA 5LHIA 5BOXA 4G6DA 6PAXA 1ZGJA 3DQVC 3KETA 1SD4A 3LAJA 2R7DA 4P9UA 5FFZA 4A0YA 4LGWA 2ZKZA 1BI1A 3QAHA 3QU6A 1R58A 2QQBA 4L9TA 4BHCA 3QRFF 4IVNA 1ONVA 3GZ6A 4TV7A 2JPBA 3TDUC 3JTHA 3ULQB 4HLYA 1OYWA 2B0LA 4BQAA 3R4KA 3ERED 4LK0F 1YG2A 3V8KA 2O03A 3HRMA 1XMKA 2HOEA 2RKHA 3I5UA 1MDMA 1R1VA 3C1DA 3D5LA 4BHBA 4N9IA 4OINF 2H94A 3PQKA 4EJWA 3WTUC 4M9XA 2VOOA 4ZYEA 1XGNA 4KIBA 2JRTA 3WTTC 2X0LA 2VXZA 4ENNA 3IHUA 4PGHA 3BOQA 3T5XA 2QYOA 1KQ9A 1W7PB 1J9IA 1FNNA 5J6XA 1T6SA 5E17F 3LA3A 4I09A 5JVTA 4K2EA 4U7BA 4HDVA 2V1UA 3LSTA 4U88A 3KEOA 2O6GE 4LJZF 2XROA 1A04A 2EA2A 4M9SA 3MFKA 4WXHA 2M5WA 1BM9A 2HTSA 3P9IA 2MBFA 4AIKA 2P5LC 1HKQA 4HQMA 5D4RA 4OIOF 2DK8A 3J81K 1B9MA 1LDKB 2JSCA 2F2EA 2A6EF 3ABTA 1Z6TA 2RQPA 2XAQA 2MC3A 4FHTA 1GXQA 3G3ZA 5L3GA 2EFPA 2K02A 1UHWA 4Y15A 3E5XA 3BP8A 4YG2F 1ON1A 3CTAA 4LMYA 3JW4A 4MQVA 2YSRA 4G7ZF 1AOYA 1IN5A 1TTYA 3G73A 3U1DA 2W57A 1K78A 3V7CA 3WU0A 5HS8A 4CICA 4I0AA 5ICEA 1H0MA 3DEUA 4YIIA 1F4KA 4RB3C 2XIGA 1MGTA 2YR2A 4ESFA 4AIHA 2NS0A 2VONA 3RYPA 1P2FA 3H92A 4IRIA 1Z7UA 3R60A 3V7RA 2CGPA 5BPDA 3H3ZA 4ETSA 5FB2A 2P6TA 2ACJA 2KJCA 1FYLA 1XMAA 1ZREA 3L7WA 4LB6B 3DV8A 1RNLA 4M6XA 3FMSA 4A2UA 1DP7P 4CHUA 2EFOA 1IN7A 4AWXB 5JR3A 5DUIA 4KIGA 2M45A 4G7HF 1PDNC 5D5WB 2KIUA 3RJPA 1GXPA 4S05A 5DCMB 1YLFA 1QGPA 1DUXC 3CUQB 3SZTA 2GQQA 2K27A 4KFCA 2K86A 1FWZA 1HXDA 1KU2A 2P5KA 3JAMK 2FOKA 2L3DA 2FU4A 2DFIA 2W85A 3BPXA 5EEGA 4OU0A 3EUHA 1Z05A 2DAOA 5IT3A 1HBXG 2IT0A 5A2QZ 1UCRA 1U78A 3LAPA 4ENKA 5L3BA 1LJ9A 2A3SA 5IT9K 5L3EA 1R36A 1G4DA 1P92A 5HLHA 4I7HA 3C18A 2STTA 4RB0A 2W24A 4JBAA 3KZYA 1RZ4A 4ZZLA 4NHJA 1B4AA 3C3WA 1ZG5A 1GHCA 2NRAC 2E7XA 5LRSA 3CO7C 3HUGA 4GCVA 4S04A 3CUQC 3N4MA 3GFLA 3L2CA 2OZ6A 3J81Z 4FT8A 1HSJA 3IKVA 2HFHA 2VBYA 1FSHA 1GVJA 2YX7A 5ED4A 3EQLF 3SXYA 1ZH5A 3F8MA 2QM3A 2ZO4A 1YW9A 4RGSA 1ZG3A 2A61A 4GO1A 3FMQA 3HRSA 3I58A 2OU2A 1XSVA 4PGGA 2YU3A 5TJJA 3GW2A 3E6MA 5KVRA 2FEZA 2FE3A 2KKOA 4IF4A 3CUOA 1BOAA 1XSDA 4Q5SF 4WCGA 2FBKA 2P7CB 2ZMEB 5ERIA 2QUFA 1L3LA 4M74A 2Q2EA 3ZMUA 1WSUA 1OYYA 2DQLA 1VTNC 1QBJA 4UVAA 3LA2A 2P4WA 1STZA 2BV6A 5ILSA 2QWWA 1SD5A 4IHTA 3TOAA 5E18F 1XGSA 1W7PD 3ZMSA 3P9CA 1I5ZA 4MEYF 3VEPA 2MH2A 2QBYB 1RUOA 5ICGA 3KP5A 1KA8A 1J0RA 5AONA 2IVMA 2XVCA 4M6YA 5L3CA 1EH6A 2R3SA 4HBLA 2A6HF 4CDGA 3GVAA 1YIOA 2FXAA 4OMYA 2PMUA 1R1UA 2WTEA 1BBYA 3OOPA 3P9KA 2M8EA 5AIPA 5CJ9A 1HW1A 1ZHFA 3FXUA 3QPTA 2FNPA 5DDGA 2OQRA 3WE3A 2CYYA 2GA2A 4RGXA 5HLGA 4LLNA 2DQRA 2E1CA 3EYYA 3I59B 1W5SA 5E1XA 1OR7A 5CVVA 5LGUA 3E5UA 3GUDA 5CLSA 3LQRA 5DV5A 4HF2A 5EEHA 3WGIA 3E6DA 4U0YA 1BJAA 5D5VB 1XCVA 5D5UB 3DFGA 1BC8C 1SFXA 4EMSA 4MEXF 5LHGA 5FLXZ 4R79A 2K7LA 3JTGA 2VODA 1SFEA 3J7AO 4AIJA 3V8LA 3V4GA 1T2KA 2VE8A 3M9AA 3O2PE 2HKXA 2IPQX 3F72A 5HDNA 4XLPF 3KP7A 2GXBA 4L0YB 3ZQ7A 2VN2A 3WTXC 1G6NA 1O7LA 4KN4X 2GIVA 2QENA 2UZKA 4EV0A 1OMIA 3CJNA 3EYIA 2OAZA 1FC3A 3K1MA 3R61A 5H20A 1Q1HA 4RGUA 3RYRA 4KICA 1FYMA 3T0YA 3K1PA 3HTSB 4GYGA 3M1EA 4ZH4F 1QZZA 2EWNA 3WE2A 1UFMA 3CO6C 4KYWA 1L0OC 2W25A 1CF7B 3TO6A 1USSA 2V79A 3FZVA 3T8TA 2Y0MA 3ABUA 1XDSA 5H6RA 3MAJA 2OQGA 2PJPA 2YPRA 3FWEA 3VB2A 1G3YA 1DDNA 5BS6A 1IUYA 4M71A 1BIBA 4HX7A 1FPQA 1B9NA 2RC4A 2QQAA 2FSWA 5HDGA 1UHMA 5J8FA 3L9FA 4QWQA 5A2QK 3OV8A 1U5TA 2IW5A 1ZGAA 3GX4X 2TDXA 2P5VA 2IA2A 2G7HA 2Q8KA 1FLIA 1JE8A 2XKOA 5D4SA 1DPRA 2EFQA 3KP6A 4JQFA 2DBBA 1EH8A 2CW0F 4IJAA 2Z3YA 1R22A 3L09A 4XLNF 1ZRDA 2L54A 4HAMA 1MDMB 5D8KB 3E6CC 2PLYA 2ISZA 3F8FA 4G6QA 1YYVA 1Z91A 2PEXA 3EDPA 2H09A 4Y17A 4G7OF 5LBQA 2MLGA 4CYDA 2O0YA 3K0LA 4O5VA 2OD5A 4OOIA 4NB5A 2BYVE 1O3TA 4UUVA 2MA3A 2PG4A 1J7KA 2MH9A 2IP2A 1H9GA 3GWZA 2ESNA 3TGNA 1BI0A 3U2RA 3WTZA 4YFXF 1T38A 4A6DA 3BDDA 3ZPLA 4M9ZA 2XUBA
chains in the Genus database with same CATH superfamily
3GTPJ 4HX4A 3IWZA 5CVRA 2GXGA 1T08B 2HZTA 5TRDA 5FKLA 1WGXA 1WH5A 2NS8A 3ZMTA 2ZBKA 5FGMA 1U8RA 1FX7A 3ELKA 5LD2C 2KFDA 2EZLA 2X1DA 1XX5A 3E97A 3FKJA 2DU9A 3R0JA 4DW6A 4BY1J 1I1SA 3DPTA 1IXSB 3RZOJ 3CF2A 4UVBA 3LNQA 4L5IA 4IZZA 4IKFA 2EJRA 1YX3A 1ON2A 1RKWA 2W84A 2MLKA 4QSHA 4LG0A 2DODA 3MKYB 1BJZA 1KONA 2DT5A 4XLFA 3ML6A 3G1MA 2NVQJ 1ZYRF 4JP0A 2L2OA 1HF0A 3K70C 1O3RA 4P55A 3DPLC 4AU7A 3S3NA 3I0TA 2V9VA 2HDWA 1IJWC 5M3MJ 2M1BA 1YS7A 3H5RA 1XGOA 4KA4A 4XOPA 2HGCA 5JFRA 4NUBA 1W5TA 4UHTA 5F27A 1YFHA 1MJBA 2DDBA 5JHUA 2QQ9A 1ZR2A 3MQ0A 4RA2A 3JRBA 5D8LB 3NEUA 2DA5A 2QGUA 3CZ6A 1O7FA 2IAIA 2QLZA 4HV5A 4NQWA 4ASNA 3IRQA 3MEXA 1PP7U 1K78B 4IO9F 3FM5A 4ON0A 2WV1A 9ANTA 5HODA 4RB1A 4Y13A 2ELHA 3SQNA 1TLHB 4XN0A 4B43A 4DGWB 3MKZA 2Y9YA 2QVOA 1X19A 2CUEA 2CW8A 2B7EA 4HA8A 2XKPA 3CJRB 1XTAA 2XF5A 3RKQA 1V5GA 3FXJA 2V6EA 4KMUX 2GWRA 2F5CA 1ULYA 2L01A 1JKRC 4D1QA 4M3FA 5E20A 3JCUC 4E7LA 3AL0B 1E3PA 1XB4A 1D8JA 1BOBA 2P81A 5FKNA 3JSPA 3CC7I 3F3XA 4HLXA 1X1PA 3CCSI 3TL4X 1OQYA 2HU9A 4L9VA 3FDYA 1SVOA 2V1DA 3BR2A 3TO9A 1ETWA 1W36D 1VQ9I 1X2MA 1R5GA 4IHWA 2J5OA 1J5YA 5L3FA 1WWXA 4OAYA 5HOOA 2A07F 2MYSA 2G0EA 3S1RJ 1TW3A 2XAHA 2KDZA 3ROUA 3RTRA 3HYIA 3IAM2 2HXOA 4XRMA 2DA3A 3CMAI 1KYZA 1MBJA 2BZTA 3BJAA 2DMUA 2HDDA 4YEJA 1TQIA 1N77A 2MGQA 1SMTA 3NWTA 2ADUA 1YI2I 1I3QJ 4CZZA 4GGGA 5FLXK 4V19K 1JHHA 1U0JA 2EV5A 2HTJA 3LA7A 4LLLA 3DU5A 4XKBA 2BE5F 4BJTA 2W00A 1B1BA 2R92J 4H4KC 4W1UA 5EEAA 1QPMA 4D0PA 4M73A 2COBA 5FRNA 1PJRA 1J75A 2JA5J 1TL8A 3ZQLA 3M3YJ 2CV1A 5CKTA 3PO2J 2EV6A 3O6BB 4L0ZB 3OYJA 3U9GA 2XAFA 1I27A 4HPQA 1MMGA 4AVZA 4GDFA 1HW2A 4ZDLA 2M7AA 2MG4A 4E4HA 4L18B 2ZXIA 1TZLA 1IDYA 4FX4A 1TW2A 4C2UA 4A3DJ 3B6AA 4YRVA 4IRHA 5J8CA 1EKEA 3PJRA 2F5FA 2JPCA 2DPUA 4EM2A 2E1NA 1T56A 2I5UA 1ZN2A 3AL0C 2KRFA 3WTWC 2VC0A 2LTPA 3HEFA 4YFNF 2CFXA 1JT0A 2FBIA 1YQAA 3W3CA 4ZTFA 5F64A 5JLWA 1H9TA 3CMEI 2YS9A 2WWYA 3BY6A 1TQPA 5IPAA 5K5OA 4L5JA 2G9WA 2WV0A 2AS5F 3NAUA 1JXSA 3HXLA 3HSFA 2XGCA 4XBFA 2XGEA 1ZGWA 4W97A 1T98A 1Y0NA 1IAWA 3VSKA 1ZG1A 3DXJF 5B1BH 2ZFWA 4OIPF 1JHFA 2DOFA 3DEEA 1ZAOA 2IXSA 3T8RA 2OPTA 4ZYHA 3F9KA 5EF6A 3ASOH 3VFZA 4HF1A 2DK5A 1MH3A 4AVPA 3CLOA 4I98B 3CCLI 3ZMVA 1FYKA 2QCOA 3F8CA 1XSXA 1WPKA 2GOXB 4IRGA 4O6JA 4HYEA 3H0DA 3NARA 1HOMA 4GFBA 4XLCA 1WRJA 1LB2A 4B4CA 2Y9ZA 3J7YJ 2BHYA 3OR2C 5LHHA 2OTLI 5E79C 2RNJA 2XASA 1ZARA 2R7FA 1P4AA 5E8GA 1WJBA 1SD6A 1ZRCA 3L2QA 2L5QA 3HUGB 3M8FA 5HLIA 5D6EA 3ZGKA 2O8XA 3T1BA 4EJUA 2V6CA 1U3EM 1WQ2A 3GFMA 3S93A 2KRCA 3IWFA 5DUKA 1MBHA 3QP6A 1G8XA 5EGOB 3CMYA 4C2TA 3EETA 1XCBA 2E60A 1LUJB 2AXLA 3SZPA 4DYQA 3E3VA 3FF5A 5L3DA 5FD5A 3MVPA 2FD5A 2KL4A 1R7JA 1WHUA 3K1NA 1NTCA 3S3OA 1P9QC 1IG7A 1U2WA 3EUHC 4OMZA 4BDYA 3PFIA 5HNHA 1MJAA 2M87A 3GYHX 4A5MA 2KMUA 3ZP5A 2H8RA 2JZYA 3OOUA 1Y1WJ 3OYDA 3WHBA 2HWVA 4LIUA 3AG3H 2L7ZA 2R0QC 1EA3A 3TQNA 2L7KA 4QIWN 2CU7A 1QQIA 1X4PA 2ZC2A 4MTDA 2P0WA 1LE8A 4XORA 1QVTA 1GDTA 1Z6RA 3C2BA 1F1ZA 4Q48A 3ZN0A 4OWRB 3SDGA 4KN7X 1D1AA 5J1YA 1MMNA 3WTSC 3Q0WA 4F55A 3HOYJ 2P7VB 1USTA 3X2QH 3F22A 2BXYA 2XGXA 3RQ4A 3JRDA 3BJOA 1MMDA 3CDHA 3M8EA 2CUZA 2V4JC 2E71A 2GA1A 2O3FA 1HW5A 1DQUA 3DKWA 4IXAA 1LFPA 3SHFA 5LGNA 4Y7NJ 1F9NA 1NHAA 1R00A 1RRJA 2NAZA 1R6RA 2JN6A 4KUMA 4HRIA 2NVUB 3IKTA 2XGDA 1S8NA 2K3PA 2GM4A 4DZJA 2EA4A 2FRHA 2Q2EB 2X4HA 2LBFA 3JSOA 2PX9A 2HYFA 1F5TA 3AG1H 1XMXA 5D6FA 4D7MA 1CGPA 2EV0A 3OS1A 1LNWA 4XNFA 1RI7A 5DYMA 3V8JA 1FOKA 3MWMA 2PI0A 2HKOA 1MZBA 2V1NA 3ABMH 3DPUA 2RQQA 1Y0UA 1AU7A 1G2HA 1X3WB 3K70D 1LEBA 2BW3B 3KLNA 3GLLA 2KISA 3FMRA 4R1HA 2STWA 3MCZA 2XHKA 2O9LA 3R6SA 3FHZA 1ZLKA 3FK7A 4G94A 1MMSA 4D5CA 2KQRA 1W1WE 2E1MB 5LLQA 4PK4A 3RKXA 4A6EA 1F36A 1Y8RB 2JMWA 4U7DA 1MSEC 5C4XJ 3TO7A 3B02A 4PJJA 2DLLA 4F7ZA 4RAFA 4UVCA 3OYHA 5EZHA 1I6HJ 3HHHA 2LMDA 2R7ZJ 4IQJA 1E2XA 1QPIA 3MZHA 4MFEA 2L0KA 1MBGA 2V9PA 4XKVA 4N0BA 2HS5A 1D5VA 5FLMJ 2YX4A 3W6JB 2Y30A 4F92B 5K7ZA 2ZJ2A 3KYCB 1D8KA 3LWFA 3A01B 3GFIA 3GLXA 1KYWA 1HDDC 2L9NA 3FX3A 2IRFG 1XC5A 2JJ7A 4FISA 3BTIA 2FX0A 3H35A 3L00A 4XM3A 3F21A 1R71A 1IRGA 2C6YA 2VJ4A 2IEKA 2R7VA 4JX4A 4C3HJ 2VLAA 4KT5C 1B59A 2RREA 3FISA 1UELB 3FXQA 1LKXA 3HRTA 2HOSA 5D5XB 4BQOA 3RSNA 3BLYA 2FA5A 5F1RA 5HVQC 4LK1F 3M7GA 4B3AA 2LDUA 2EK5A 4QPOA 1VZ0A 1ZRFA 4CXFA 5K1YA 3OYCA 4NC6A 4L9NA 4A12A 4C9YA 1S7EA 1IXCA 3REOA 4IHYA 3PNTA 1S7OA 2HQ5A 3MZYA 4LLGF 3BZ6A 4YFKF 4O3MA 2E1MC 4HG2A 2HNHA 3DP7A 3NRVA 2R4GA 4P1WA 1EF4A 4LD5A 4HF0A 2LVSA 1ETXA 1TWHJ 2F4IA 3HG9A 4KNYA 2A5WA 1O3QA 1REPC 2FJ1A 5ICFA 2P6SA 1QHGA 4RGRA 2V26A 3IRRA 4BBSJ 2EBIA 5H6QA 3QYEA 2ECCA 3W2AA 3O3KA 4M3DA 5CQGA 3FXMA 1K79A 1ZLJA 1XDUA 1OJLA 1XGMA 3F6VA 3IL2A 3N97A 2GAUA 2F5EA 5HNFA 1W7PA 3RPQA 4BBRJ 5DTDA 3RI4A 2KPMA 3Q0UA 3WG7H 1RIOH 4M3BA 1TNTA 3G6EI 2CV2A 4KDPA 2R7XA 3MKWB 3Q9VA 4DBQA 4EGYA 5CVIA 4HQEA 2R5YB 3S1QJ 2EFWA 1TWFJ 5E1WA 3LFKA 3M8JA 5AIQA 5EG0A 2L4MA 3CCUI 3GF2A 1MKMA 3G1LA 4PJ0C 1PUEE 2DI3A 2W7NA 3A02A 3FHNA 3A0HC 4EQQA 4DNCA 2LLKA 2BOLA 1A6QA 4EJVA 1WJAA 3BJ6A 5EDNA 3KLOA 2LRDA 4B8XA 5LRRA 4UUSB 3HOVJ 1I39A 3KCCA 1OR7C 2ELJA 2VKDA 1BA5A 2M9HA 3C2GA 1TWAJ 2E1OA 1BIAA 2K5CA 1R1TA 3Q3SA 3M1CA 3WU2C 4XIDA 1WJFA 3KYDB 3HSRA 1SFUA 1V55H 1YS6A 2H8WA 4M72A 2O5RA 4C3IJ 2X85A 2HZDA 1G3TA 1WJ5A 4N4NB 1JTYA 1R23A 2DT6A 2QKMB 1S3JA 1ZR4A 4CYCA 4ZDOA 2XDVA 3HGYA 4GXOA 2ZJPF 4ZYDA 2R7RA 2VE9A 5HS7A 4WK8F 1TWCJ 3IC7A 2UWMA 5M5YJ 3SFZA 5J1UA 5DEQA 4A3IJ 1LQ1A 2M4GA 2PJRB 2RDPA 3I4PA 2KIMA 3HPHA 2A6TA 3KP2A 3ZQCA 4XL9A 3KZZA 3DLAA 2XSJC 3DEWA 4XRFA 2XB0X 2K40A 2VIXA 1WZ2A 1LDJA 4LG3A 3OYMA 1BI2A 2R5ZA 2A69F 4CCOA 2RN7A 2VQLA 1O3SA 3CC2I 4NC7A 2VKEA 2VC1A 4J01A 4Y4RA 3GO5A 5HS9A 4PDKA 2EZKA 3BQZA 1S29A 4BL0B 4NBQA 3WTVC 4HZFA 3DCFA 4N4OB 5CYVA 1IN4A 2R7UA 2FMYA 2WY7Q 3LOCA 3I4MJ 1VQNI 1U5TB 3L2WA 2VB6A 2DMPA 5KAFC 3Q0VA 2HEOA 2CW7A 1OCOH 2ID6A 4J00A 2GOMA 4KITB 4I2OA 1XD7A 4AC0A 3EPZA 2M30A 3RDIA 1V5EA 1WJDA 2HOAA 1H88C 4UB6C 3DTIA 3IH2A 1VFCA 2FBHA 2LKXA 1VQKI 2DMNA 1T0FA 3ZMZA 3GXOA 1YRNA 3I71A 5DCFA 2Z33A 2DMQA 2K4JA 1MBKA 3JRCA 1J59A 2Q0OA 2DFEA 4XOTA 2KP6A 1ZKGA 2VOPA 2OTJI 2UXXA 1W4MA 4FTHA 2CQ7A 4PUSA 2F6CA 2JTVA 4NDLA 1SVMA 3BROA 2H27A 3GEZA 1S7AA 4DYRA 1C0WA 2WADA 3PIPF 1TNSA 5FFXA 2DW4A 1MBEA 1R5HA 1YX5A 3K69A 2WAEA 3VODA 3BG6A 1TQMA 3DBLB 2PFBA 1O4XA 4P9FA 5FD6A 4HSTA 2QSGX 4BHPA 2IJLA 5J4VA 3O8GA 1K6OA 3DTEA 1VF9A 5HDKA 5M3FJ 2XPUA 4CUGA 2ZNZA 3ASNH 2LK2A 2K9NA 5F6FA 1YW8A 3WU1B 5IYDJ 3HOTA 1UJ8A 3S14J 2RV8A 4KT6A 2DOAA 2XRNA 4BGDA 3FM3A 2XAJA 4ZJZA 2EFNA 2H6BA 5LEKA 1W0TA 1HCRA 2PMHA 1U8BA 1OYIA 4V2FA 3BQYA 1U5TC 2BGCA 3AFHA 3VYUB 1D5YA 4L5EA 4WXDA 1YJWI 3PNYA 1KU3A 3F8BA 2D2WA 1Y56A 1ODDA 3LQQA 5KNLA 5DS9A 4QTRA 1YE9A 2Z99A 1YRNB 1LVKA 2XAGA 2HVSA 5DCMA 1Z1DA 3FXRA 1WVRA 2CO5A 5K5QA 5K5RA 2IS6A 1SFKA 3S2WA 3KP3A 1D0XA 4NC8A 2VI6A 3CUQA 1V3FA 2ETHA 3WTYC 3K4BA 4BU2A 4Z2YA 5FROA 2VJ5A 3J80Z 1AWCA 1ETVA 4NNJA 2E35A 3L2RA 1VNDA 4CO8A 3KEQA 3ZR8X 4DOZA 1HQCA 2AO9A 3HSEA 3F6OA 1MW7A 4MFDA 4XSZF 2LKPA 3VOEA 5BQTA 2QSHX 1OPCA 2L02A 4EGZA 2L4AA 4B47A 5LEJA 1U6GA 1QO0D 3M07A 4FASD 4JK1X 4EM0B 5BMZA 4Y33A 1X58A 2JT1A 2HR3A 4U0WA 3PL8A 4KJZA 2CQKA 2HOTA 2CSOA 2XSDC 3BTLA 4HV6A 4PZJA 1Z77A 2IA0A 3ZXSA 2E7WA 1KZHA 4LG0B 4I01A 5LFAA 1FBUA 4M3EA 4AM3A 2Z9OA 4ZZDA 1LVAA 2LY2A 2IGMA 5B3SH 5E1ZB 3SEZA 1WI3A 3QU3A 3RPUD 1XPXA 1SAXA 3QPHA 3HM5A 4H0EA 1JKOC 4WXCA 1TC3C 1FSEA 4MQ9F 5IP7J 2VASA 1X3UA 3BPVA 3O8HA 1I1GA 5TGTA 2KHMA 1Z3YA 1MD0A 3P7NA 2IA1A 3CDIA 1SD7A 4ZTJA 4FQGA 3HGGA 2COMA 3ZRGA 3KP4A 2XF6A 4U0VA 4OAZA 1SMYF 4M6VA 5CVUA 4BH9A 5H2FC 3I53A 2JA7J 4YIFA 4MNUA 2ELKA 4CCMA 3GTGJ 4NQWB 4ENJA 2VT3A 1E17A 3CLQA 2TRTA 4RAZA 5ILVA 3NQOA 5K7FA 1JT6A 1MJ9A 2QZ8A 2X6WA 1NH3A 1XS9A 3ECHA 3E6BA 2K4BA 3P5JA 1BC7C 2PQ8A 1S6LA 2KLOA 2XV4S 2B63J 1SVLA 4A3FJ 2RGVA 5BPIA 2V1XA 1ZELA 4WX9A 2JUGA 2A68F 2JA2A 3CESA 3BZKA 2Y75A 4G8XA 4AYBA 3LL7A 2H1LA 1KQ0A 3HIFA 2LF8A 3K2ZA 5GP9A 4A3JJ 1FT9A 4X1EA 5FJ8J 5CVJA 2Z2SB 1IV8A 1P4WA 4P5OA 2NYXA 1D3YA 4WWCA 3S1MJ 3AG4H 1WJEA 4A0ZA 2VUMJ 1FP2A 2IBDA 4MTEA 3FBIB 4XRSG 2JVGA 1GT0C 3W6VA 4I0BA 4CCNA 1I6XA 2HQAA 4G9YA 2OCCH 3H36A 2OJED 2TCTA 3TKYA 3GZ5A 2F4MB 3H1CA 4CSWA 2MD5A 1H8AC 4GYIA 2D1HA 4PSWA 4OIRF 4UY8I 2O61A 2XPVA 2HDCA 5F0FA 4CGZA 2R7SA 2P8TA 2HQRA 3W6KB 3MD2A 1DPUA 2OBPA 3Q9SA 2D1VA 3WGHA 4C30A 1TT0A 3QP5A 2F5DA 4RDUA 3OWTA 2DJNA 2X6YA 2ZMEA 2QA4I 2RVCA 5DD4A 1KU7A 1Z3XA 3RCOA 4BAYA 3F23A 4HW0A 2EIKH 3VYTB 3ERMA 2BBYA 1OFCX 1J2XA 1IF1A 3OS2A 1AHDP 4IHSA 4KISA 3CJQB 4BYYA 2HVRA 3S15J 2HQNA 3DF8A 5C3EJ 2LR8A 3HC7A 1QNTA 2EB7A 3CCQI 4OIQF 1SANA 2DA1A 2Z5UA 3HL2A 4A3CJ 3HKZA 1NG6A 1HSTA 2ZCWA 1P6RA 1UB9A 3CCJI 3GZNB 5KK1A 5JHFA 1GVDA 2E5NA 4XN3A 2QBYA 1X1CA 1K4SA 2VPLA 1UG0A 4S0HB 4A3LJ 5ICCA 4ZYGA 4L9JA 4BXUA 3H3UA 4AD9A 4A3EJ 2NNNA 4LITA 2RNGA 1LEAA 2HVQA 3QYBA 1YO5C 4RS8A 3MMYB 2DO7A 1T39A 3VSLA 4Y52J 5FKKA 2N8GA 1R5ID 2Z1DA 2KZVA 2LF7A 2A5YB 4N9HA 1BR2A 2KJBA 1K4TA 3D0SA 3RKYA 3HOWJ 3OYAA 1FBSA 1LDDA 3W2WA 3GTKJ 3QOPA 1Y8QB 1YW7A 4EVIA 5F04A 4EJTA 1QRYA 1J09A 3OYGA 3BWGA 3COAC 4E7ZA 4CCKA 3AAFA 2DPDA 4BQNA 3K9TA 4UNOA 1R4MB 2LKSA 4FETA 4ESJA 3HOXJ 1IXRC 1IN8A 4Q47A 1HLVA 2OA4A 2PN6A 1WKMA 2FF4A 1EV7A 1FY7A 3QODA 1RR8C 4P96A 3RPUA 1QA6A 4ENMA 3E5QA 4HOBA 3QOEA 1K7AA 4PCQA 5E3MA 1OLTA 3JRFA 4DYCA 1LFUP 2E2IJ 1U9OA 4AIDA 1ACIA 3I59A 1YITI 4Q4ZF 1VQ6I 4UXNA 4II3A 2DMTA 1B72A 2LNBA 1BN5A 3BTCA 4UV9A 2ESHA 1IZ1A 4RAYA 3OS0A 4LFUA 3JR9A 1O57A 2G7UA 1QZEA 3IH3A 3F8NA 3TW6A 4PFPA 3OL3A 1HA8A 3Q5FA 2KIFA 3WG9A 3S3MA 4FX0A 3ZMDA 4ANJA 2LD5A 1EH7A 2CUJA 1ERDA 5FO5A 3TDZC 3ONQA 4PSXA 3VYRB 1YTYA 2J5PA 1IRFA 2NOGA 4HDUA 3G2BA 1IO2A 1P4XA 2H6CA 1IW7F 2ZJRF 4JOMA 3ZQGA 1QVUA 5ILUA 1JGSA 4BEHA 1PP8F 2VT2A 3ZN1A 2VQCA 3CQZJ 2FNAA 2DT7B 3A1YA 3I64A 2DTRA 1FZPB 1EJ9A 3S2DJ 5EJCA 2CMPA 4JX5A 4CA0A 1G3SA 1MNDA 3HRUA 3RIRA 4KMFA 2Y69H 1RUNA 4QLCU 2O8KA 1M1EB 4XSXF 2ZXJA 2VBWA 3C7JA 2HYJA 3E0JB 1V5FA 1Z21A 2PBIA 5C4JJ 3WGGA 3R0AA 1LE8B 1FBQA 3OYIA 3I54A 2M8GX 1HKSA 2M0CA 3KE2A 5M5XJ 4ZC3A 4R8HA 1VQMI 4EM1A 3ZQHA 1BI3A 3RKWA 2GXAA 5B66C 3TOBA 1IN6A 4EJOA 3HHGA 2ZSHB 4A3GJ 2DA7A 3GTJJ 3JAMZ 3PNVA 2Y2ZA 2DDAA 3KFWX 4BNCA 1TBXA 2EH3A 1Y6IA 2MC4A 4RB2C 2FQ3A 1FTZA 4I02A 1B6AA 5E8IA 2F48A 4DQ2A 4D9JA 2K9LA 1QZYA 2WC2A 3RQIA 1XN7A 4UV8A 2BEOA 3CD6I 4QPQA 2FMLA 4JYKA 4A5NA 4E70A 4A0XA 3ISPA 2KT0A 3PSFA 4MGRA 1Z9CA 3GFJA 1HKTA 4KIFA 2LBFB 2CWEA 5LGTA 4B09A 2VKVA 1OKRA 2ISYA 2UXNA 3LSIA 1NG7A 2L9RA 1MBFA 3K4LA 2X6XA 3WODF 1V4RA 2XF7A 3CCYA 2HYGD 4MHGA 5IT9Z 4ESBA 2GZWA 3CDLA 2CG4A 3KIOA 1CF7A 1KGSA 3HTUA 1G3WA 1FP1D 1MIJA 2Y48A 3ZQQA 1BR4A 2VPRA 1JGGA 1KQ8A 4AYBN 2OZUA 1IRZA 4ABZA 5JI6A 2CQQA 3BR6A 4IQ4A 1ORKA 1A35A 1KU9A 3V7SA 3HOSA 1QHHD 4WF2A 2VBXA 1UAAA 3KEYA 4LB5A 3PQJA 2NNYA 3OSFA 4U87A 2X6OA 5DD8A 4HNVA 2LSOA 3JRIA 2ZNYA 3ECOA 3L2VA 4HX8A 3J80K 3B73A 2L9SA 2VBZA 2D45A 1WI9A 4YELA 4IPAA 5KAIC 4BQQA 5LHIA 5BOXA 2VQHA 2BVMA 1G59A 4G6DA 6PAXA 2IS1A 1K6YA 1ZGJA 3DQVC 4IEJA 1W5CC 4V2GA 3KETA 2MSYA 1ETOA 2M0MA 3NWSA 3SZGA 1SD4A 3BR5A 2I10A 3LAJA 3VYSB 1OCRH 4RAGA 2JA6J 2LC2A 2R7DA 4P9UA 4IHXA 4BJ6C 5FFZA 3GBGA 4A0YA 4LGWA 2LP0A 2ZKZA 1BI1A 1SEUA 3QAHA 3QU6A 1R58A 3OYBA 3S2HJ 1R49A 2QQBA 3CP2A 1RC9A 4L9TA 4BHCA 3QRFF 3H9GA 4IVNA 1HDPA 1BW5A 2IGNA 1ONVA 3BG9A 3GZ6A 1PYVA 2JPBA 4TV7A 3JTHA 3TDUC 3ULQB 1CQTA 4HLYA 1GV2A 1OYWA 2B0LA 3BC8A 4BQAA 1E0EA 3GTMJ 1RKTA 3R4KA 3I3LA 3ERED 4LK0F 2XC7A 3HB9A 1UHSA 1DGRM 2CS3A 4RM3A 3JRHA 1YG2A 3V8KA 2O03A 4XKCA 3HRMA 3HKZN 5JLXA 1XMKA 2HOEA 2RKHA 3I5UA 1MDMA 1R1VA 3C1DA 3D5LA 3BR3A 3BCAA 4BHBA 4A3BJ 3I4NJ 4N9IA 2DXIA 1AKHA 4OINF 3OYKA 2DFFA 2H94A 4UB8C 1JKPC 3CCVI 2O7OA 2VKHA 2B9SA 4XRSA 4YIRX 2R7QA 3PQKA 4EJWA 3WTUC 3CC4I 3H5AA 4M9XA 1MSFC 3K7AJ 2VOOA 2DA6A 5KHDA 1X1BA 2AQEA 4X0GA 1Y39A 4ZYEA 1XGNA 4KIBA 2JRTA 3WTTC 3GTQJ 2X0LA 2VXZA 4ENNA 3IHUA 1B8IA 4PGHA 3BOQA 3T5XA 2QYOA 3TBIA 1KQ9A 1JTXA 1W7PB 2HXIA 1J9IA 1FNNA 5J6XA 2Y0SA 1RR7A 1T6SA 3K6GA 3HOUJ 3ZQFA 5E17F 2X9DA 3LA3A 4I09A 5JVTA 4XKWA 4K2EA 5EZGA 4U7BA 1VQ5I 1WCMJ 1ZQ3P 1ETQA 5EG0B 1A5JA 5F1JA 4HDVA 2V1UA 3LSTA 3U21A 2CJJA 4U88A 3SJMA 1S72I 3KEOA 2O6GE 2AHQA 4LJZF 3GTOJ 3J7AY 5DM7F 3HPGA 2R7WA 2XROA 3LFUA 1A04A 1N75A 2DYSH 4B1RA 2EA2A 4M9SA 3MFKA 1VQPI 4WXHA 5J47A 2M5WA 1BM9A 3LSKA 2HTSA 1WJCA 3P9IA 1FEXA 2MBFA 2ID3A 2NVTJ 4AIKA 2P5LC 2HPIA 2X51A 1VQOI 2EQRA 1HKQA 5BNGA 4HQMA 2DOEA 5D4RA 3OMYA 2ME6A 4OIOF 2DK8A 3J81K 1B9MA 1LDKB 2JSCA 5GAHJ 3DBRB 3JRGA 2EILH 2F2EA 4LIVA 4CYCB 2A6EF 4PJLA 3ABTA 4E7SA 1Z6TA 2RQPA 2M7BA 2XAQA 4I99C 2MC3A 4FHTA 1GXQA 2LH9A 3G3ZA 2OV7A 2A05A 3BT9A 1GV5A 5L3GA 3A2KA 2EFPA 4ITVA 3PUFA 3DWLE 2K02A 1UHWA 3MZ8A 4Y15A 3E5XA 5HLTA 3BP8A 2W48A 4YG2F 1ON1A 1XG1A 4RLFA 3CTAA 4RM2A 2IS4A 3H9QA 3JW4A 4LMYA 3H9JA 4MQVA 2ZXHA 3D5RC 2W1OA 3CCEI 1ITYA 1F43A 2YSRA 2R5ZB 3G71I 4G7ZF 3PO3J 1VQ8I 2CV0A 3EUAA 1IUFA 1AOYA 1IN5A 2CUFA 1TTYA 3G73A 3U1DA 2GIZA 4F3QA 1WH7A 5FKOA 5F0HA 2W57A 5GAGJ 3V7CA 3RZDJ 1K78A 2WY8Q 3TW7A 3WU0A 5GAEJ 5HS8A 2M4KA 4CICA 3OIPA 4I0AA 3PUBA 5ICEA 2NS7A 3M4OJ 3VPRA 1H0MA 3DEUA 5IP6A 2V7FA 2AQFA 1N25A 3BG5A 4YIIA 1F4KA 4RB3C 2XIGA 3TMOA 1MGTA 3CCRI 2YR2A 4ESFA 4AIHA 2NS0A 2XB5A 2VONA 3RYPA 1VQ4I 1P2FA 4E7IA 3H92A 4IRIA 5DM6F 1Z7UA 3R60A 5IOYA 1SC7A 3V7RA 2CGPA 5GADJ 3PIOF 5BPDA 3H3ZA 4A3KJ 4ETSA 1Z7LA 3W2VA 5FB2A 3GMEA 4BE2A 2P6TA 5J40A 3BG3A 1FTTA 2ACJA 1FOWA 2KJCA 1FYLA 3I56I 1XMAA 1T95A 3IAS2 2EZIA 1ZREA 3L7WA 2WB1A 4MLOA 4LB6B 3DV8A 1R9TJ 2MABA 2K3FA 2MFZA 3DLLF 1Y1VJ 2WBMA 1RNLA 2E34A 4M6XA 3FK6A 3ABKH 3FMSA 1JUPA 3DKYA 4A2UA 4D5FA 1DP7P 4CHUA 3FXLA 3MN2A 4CCLA 1NK3P 1I50J 4EATA 3S32A 2EFOA 1IN7A 4DZPA 4BY7J 1W0UA 2LG4A 4AWXB 5GPAA 3JREA 5JR3A 5DUIA 4KIGA 2M45A 4G7HF 1PDNC 1U9NA 1ETYA 5D5WB 1GUUA 3CF5F 4G12A 2BY1A 1H89C 2V9KA 1BL0A 2KIUA 3PSIA 4RLQA 3RJPA 1GXPA 4S05A 5DCMB 5E3LA 1YLFA 1QGPA 1T0FC 1DUXC 3ESWB 3CUQB 3SZTA 2GQQA 1JI8A 3OL4A 3OYFA 2K27A 4KFCA 3SYTA 3QWLA 2K86A 1FWZA 1HXDA 3D1NI 1A31A 2ME0A 1KU2A 2P5KA 3JAMK 2EINH 2FOKA 2L3DA 4E7KA 4GRIA 3OR1C 2FU4A 2OCEA 2DFIA 2LOOA 2W85A 2IGOA 2XPWA 3BPXA 4CCJA 4I6ZA 1IC8A 5EEGA 4B44A 4OU0A 3EUHA 1Z05A 2DAOA 5IT3A 4A69C 3CP8A 1HBXG 2IT0A 5A2QZ 1UCRA 1U78A 2EIJH 4BE0A 3CMMA 3LAPA 2JQ7A 4AUXA 4ENKA 1FIAA 5F0CA 1JJ8C 3G1OA 1D0ZA 5FRMA 5L3BA 3SEQA 4BUPA 2M2EA 1LJ9A 2A3SA 5IT9K 5L3EA 3LSHA 1R36A 2RAEA 4XMYA 4EEFG 4FE7A 1G4DA 1P92A 5HLHA 4I7HA 1YIJI 3C18A 3H5NA 2STTA 4RB0A 4XLAA 4BJ5C 2W24A 3MKLA 2BY0A 3HOZJ 2F5VA 4HEA2 4JBAA 3KZYA 2K9QA 1RZ4A 3A03A 3DU6A 2VQGA 4ZZLA 4NHJA 3I55I 1B4AA 3C3WA 3E7LA 2QF7A 2Y0SN 1ZG5A 2KDOA 3ZOBA 1GHCA 4BDZA 2NRAC 2E7XA 3L1PA 5LRSA 1FMWA 3ZCOA 3CO7C 2ZFUA 3A0BC 3HUGA 3FIWA 4GCVA 1JKQC 2CQNA 4S04A 4IOCF 2OF7A 3CUQC 3LSRA 2D5VA 3N4MA 3GFLA 3AG2H 1OCPA 3L2CA 1YHQI 2E5ZA 5EGOA 2E19A 5M5WJ 1DGWY 2L9VA 2OZ6A 3J81Z 3J7ZI 2KZGA 2DA2A 3OIQA 3OIOA 2EPFA 4FT8A 1HSJA 3IKVA 1N78A 2HFHA 2DA4A 1RPWA 1AA7A 2VBYA 1FSHA 3BTJA 2LY1A 1GVJA 2YX7A 3OYNA 2ICWG 3EQLF 3SXYA 1ENHA 5ED4A 1D0YA 3S17J 4IX7A 1ZH5A 1TP4A 5TISC 3F8MA 2QM3A 3H0GJ 2ZO4A 4I76A 1FIPA 1LFBA 2EZHA 2Q1ZB 2QKLB 1YW9A 4IL6C 3DBHB 3K4MA 1MH4A 4B48A 4RGSA 1ZG3A 1X1AA 3ABLH 2X48A 1APLC 2A61A 3I9V2 4GO1A 3FMQA 3HRSA 3I58A 2KIQA 2OU2A 4XLHA 4A3MJ 1XSVA 4PGGA 2YU3A 3OSGA 5TJJA 3GW2A 3S8PA 3E6MA 5KVRA 4HNUA 2FEZA 5F08A 2ZXWH 2F4OB 2FE3A 2KKOA 4IF4A 5J1RA 3CUOA 2CQXA 2E36A 5IY5H 1BOAA 1P7IA 3FBNB 1XSDA 4Q5SF 2E2HJ 3JRAA 4WCGA 5CPRB 2FBKA 1YJ9I 2XRLA 1IDZA 2QQ8A 2P7CB 4A93J 2ZMEB 5ERIA 4XQFA 2QUFA 2CH0A 3BR0A 1L3LA 4M74A 2Q2EA 2ECBA 2MD0A 3ZMUA 3TEDA 1WSUA 2FQ4A 1OYYA 3K10A 2DQLA 1VTNC 4XR6A 4UVAA 1QBJA 3LA2A 2P4WA 1X1DA 2YU9J 1STZA 3S16J 2BV6A 3FXOA 5ILSA 1T8IA 2QWWA 4CZCA 1SD5A 3KZIC 4IHTA 2JUCA 3TOAA 5E18F 1XGSA 2BW3A 2WAFA 4F93B 1HC8A 1W7PD 2M3AA 2I8DA 3P9CA 3ZMSA 1DU0A 2PMZA 1I5ZA 1X3ZB 4MEYF 3LSPA 3KPHA 3VEPA 2MH2A 2QBYB 4JX6A 2VL8A 1RUOA 5ICGA 3U1KA 3KP5A 5FLVA 1KA8A 1J0RA 3QQAA 2JRMA 4IOAF 5AONA 3IV5A 2IVMA 2X1CA 2XVCA 4M6YA 5EYRA 2R7TA 5L3CA 1LPQA 1EH6A 1E3OC 2R3SA 4HBLA 2A6HF 4CDGA 3GVAA 1YIOA 1DU6A 2KRHA 1T33A 2FXAA 4OMYA 4BE1A 1D1CA 2PMUA 1FMVA 1R1UA 1WFXA 2WTEA 3FXKA 1BBYA 3CCMI 4ZDPA 4Y3OA 4PJNA 4DJAA 3OOPA 3P9KA 2M8EA 2VJIA 4D7NA 5AIPA 1DP3A 3WHCA 5CJ9A 5C44J 3S1NJ 2WB1N 1HW1A 1ZHFA 3FXUA 4DBRA 3BCBA 5KCMA 3QPTA 3A01A 1OCTC 4Z6YA 5IP9J 2FNPA 5GPCA 5DDGA 2OQRA 2W82A 2ZMEC 2JVHA 3WE3A 5J4YA 4G6TB 3HJEA 2CYYA 2K9MA 2GA2A 3F0CA 4RGXA 4BS9A 5HLGA 4LLNA 2DQRA 2WAQA 2E1CA 2BY3A 3OYEA 4F52A 2QEXI 1UG2A 2UUZA 4C3JJ 3EYYA 3I59B 1W5SA 1RESA 2GBYA 5E1XA 2LFBA 4ZYAA 1B72B 1VQ7I 4FE4A 4E7JA 1OR7A 2HI3A 5CVVA 4HNTA 2ZSIB 2XAUA 1S5LC 5LGUA 2Z16A 3E5UA 2GLOA 3GUDA 5CLSA 1IRXA 3LQRA 5DV5A 2HPMA 5GTHC 3K2AA 4HF2A 1TT5B 3BZCA 5EEHA 3E6DA 4U0YA 3WGIA 1BJAA 5D5VB 1XCVA 3ZQIA 5D5UB 2ZJQF 1PUFA 2JWTA 2DFHA 1SFXA 3DFGA 4EMSA 1IV6A 4MEXF 1BC8C 4CH7A 2R7OA 3D5SC 5LHGA 1GLNA 5FLXZ 4R79A 2K7LA 3JTGA 2VODA 1E3HA 2X1EA 2BY2A 5J3LA 2NVYJ 4BEHB 1SFEA 4XONA 3J7AO 1BW6A 4AIJA 1X2NA 5E3NA 2K85A 3BR1A 3V8LA 3V4GA 1T2KA 2VE8A 3IH4A 3M9AA 3O2PE 3LMMA 1K61A 3TP3A 1MNMC 2HKXA 2IPQX 3F72A 5HDNA 4XLPF 3VDXA 3KP7A 2GXBA 4PFOA 4XLEA 4L0YB 1FOYA 3ZQ7A 3BG7A 2VN2A 3WTXC 2R93J 2R5YA 1G6NA 1A6IA 3QPSA 4X6AJ 2WA0A 1BR1A 2W4SA 1O7LA 4KN4X 2DN0A 3EUKL 4B3XA 1W36C 2GIVA 2QENA 2UZKA 1ZK8A 3IP4B 1OCZH 3LSJA 1OMIA 3CJNA 4LOCA 4EV0A 3EYIA 3CJTB 2OAZA 1K83J 5JVGF 4UUSA 1FC3A 3K1MA 3R61A 4MO7A 2QSFX 1I3AA 4XICA 1X4OA 5H20A 1Q1HA 4RGUA 1NK2P 1Z67A 3LSGA 1IGNA 2DTZA 3RYRA 3TP0A 4KICA 2LREA 1FYMA 3T0YA 5IYBJ 2OUMA 1PUFB 1A36A 3K1PA 3K4CA 3SFIA 3HTSB 4GYGA 3M1EA 3DKXA 2BXZA 4ZH4F 1QZZA 2EWNA 1OISA 1UFMA 2M34A 3WE2A 3CO6C 3K4NA 4KYWA 1L0OC 2YUSA 2E2JJ 3OYLA 1JUSA 2W25A 1CF7B 3TO6A 1MMAA 1USSA 2V79A 3FZVA 3HZJA 3T8TA 3HBLA 1VQLI 2Y0MA 1YJNI 2NXNB 3ABUA 1XDSA 3QYFA 5H6RA 3MAJA 2OQGA 1Z0XA 2AXTC 2PJPA 2Y31A 2PJRA 1V54H 2YPRA 3VWBA 1S9HA 3FWEA 3VB2A 1G3YA 1DDNA 1FJLA 5BS6A 3K4JA 4RMNA 2OC6A 2ZB9A 2LYCA 1IUYA 2FOWA 1ZTRA 4M71A 1BIBA 4HX7A 1FPQA 2BHZA 3A4CA 3B6CA 1B9NA 2JSPA 2RC4A 4E6KG 2QQAA 5IYCJ 2FSWA 5HDGA 2UV1A 1D1BA 3PM1A 1UHMA 5FKMA 2K9SA 5J8FA 3L9FA 2BVLA 4QWQA 3DTKA 5A2QK 3OV8A 1U5TA 2IW5A 3UKGA 3IUOA 1ETKA 3K4KA 2DYRH 1ZGAA 3GX4X 2TDXA 4E7HA 2IGKA 2P5VA 4F91B 4BACA 3L2UA 2IA2A 2G7HA 2Q8KA 1FOXA 1FLIA 1JUMA 1JE8A 4XK4A 2XKOA 3SDBA 2MW8A 4BKXA 5D4SA 5GTIC 4BXFA 2FUG2 1DPRA 1R4NB 2EFQA 3KP6A 2DCEA 4JQFA 4PJMA 2DBBA 3HDDA 1EH8A 2DJIA 3KYLA 1Q1VA 2CW0F 4IJAA 1TWGJ 1POGA 2Z3YA 1QU3A 1PVEA 1RETA 5K7HA 1R22A 3L09A 4XLNF 2NVXJ 1OCCH 4BXXJ 2NOJB 4FCYA 1ZRDA 2L54A 4HAMA 1MDMB 5D8KB 3FKIJ 4RBOA 1P7JA 2PMZN 4IHVA 2H1KA 3C2HA 3E6CC 4HSRA 2PLYA 1VI0A 5B5EC 2ISZA 3F8FA 1AKHB 3E1SA 4DIQA 1SAUA 4G6QA 1YYVA 1Z91A 2VXDA 1MNEA 2PEXA 3EDPA 1JJ6C 2H09A 1UMQA 3GCMA 4Y17A 4G7OF 5CQEA 5LBQA 3QPLA 2CRGA 2MLGA 4CYDA 2O0YA 3K0LA 4O5VA 2OD5A 4OOIA 4UUTA 4NB5A 1B8IB 2BYVE 1O3TA 2CFOA 4UUVA 2MA3A 3V42A 4C2MJ 2L7MP 2JA8J 4J19A 2PG4A 3H3VK 1J7KA 4MIMA 4II2A 1SFOJ 5B1AH 2MH9A 3AKZA 2IP2A 1H9GA 3GWZA 3KX2A 2JK3A 2ESNA 3OY9A 5E3OA 3TGNA 3UR3C 1BI0A 4M3GA 5IOZA 2VJJA 3U2RA 1YOVB 3WTZA 4YFXF 3LSMA 2EIMH 3PFYA 1T38A 4A6DA 3BDDA 1UZCA 3G4SI 3ZPLA 2WAQN 3UNGC 2IS2A 3GTLJ 4M9ZA 2LY9A 2XUBA 2L7FP 3N05A
chains in the Genus database with same CATH topology
4HX4A 3IWZA 5CVRA 2GXGA 2HZTA 5TRDA 3ZMTA 2ZBKA 5FGMA 1U8RA 1FX7A 3ELKA 3E97A 3R0JA 2DU9A 1I1SA 3DPTA 1IXSB 4UVBA 4L5IA 2EJRA 1ON2A 2W84A 2MLKA 4LG0A 2DT5A 3ML6A 1ZYRF 1O3RA 4P55A 3DPLC 3I0TA 2V9VA 2M1BA 1YS7A 1XGOA 4KA4A 2HGCA 5JFRA 1W5TA 4UHTA 1YFHA 1MJBA 5JHUA 2QQ9A 3MQ0A 5D8LB 3NEUA 1O7FA 2QLZA 4ASNA 4HV5A 4NQWA 3IRQA 3MEXA 1PP7U 1K78B 3FM5A 4ON0A 4RB1A 4Y13A 2ELHA 3SQNA 1TLHB 2QVOA 4HA8A 2XKPA 4KMUX 2GWRA 2F5CA 1ULYA 2L01A 5E20A 1XB4A 1D8JA 3JSPA 3F3XA 4HLXA 4L9VA 2V1DA 3TO9A 1R5GA 2J5OA 1J5YA 5L3FA 1WWXA 5HOOA 2A07F 1TW3A 2XAHA 3ROUA 3RTRA 3HYIA 1KYZA 3BJAA 1TQIA 1SMTA 2ADUA 4CZZA 4GGGA 5FLXK 1JHHA 2EV5A 2HTJA 3LA7A 4LLLA 2BE5F 1B1BA 1QPMA 4D0PA 4M73A 1J75A 2EV6A 3O6BB 4L0ZB 3U9GA 2XAFA 1I27A 1HW2A 4L18B 4FX4A 1TW2A 4IRHA 5J8CA 2F5FA 2JPCA 2DPUA 4EM2A 2E1NA 1ZN2A 2KRFA 3WTWC 2VC0A 4YFNF 2CFXA 2FBIA 1YQAA 5F64A 1H9TA 2WWYA 3BY6A 1TQPA 5K5OA 4L5JA 2G9WA 2WV0A 2AS5F 1JXSA 3HSFA 4XBFA 1T98A 1IAWA 1ZG1A 3DXJF 2ZFWA 4OIPF 1JHFA 1ZAOA 3T8RA 4ZYHA 3VFZA 4HF1A 2DK5A 4AVPA 3CLOA 4I98B 3ZMVA 1FYKA 3F8CA 1XSXA 4IRGA 4O6JA 4HYEA 1WRJA 1LB2A 5LHHA 2RNJA 2XASA 1ZARA 2R7FA 1P4AA 5E8GA 1SD6A 1ZRCA 3M8FA 5HLIA 5D6EA 2O8XA 3T1BA 4EJUA 2V6CA 1U3EM 1WQ2A 3GFMA 3IWFA 5DUKA 3QP6A 3EETA 1XCBA 2AXLA 3SZPA 3E3VA 3FF5A 5L3DA 5FD5A 1R7JA 3K1NA 1U2WA 4OMZA 3PFIA 1MJAA 2M87A 3GYHX 4A5MA 3ZP5A 2JZYA 2HWVA 3TQNA 1QQIA 4MTDA 1Z6RA 1F1ZA 4Q48A 3ZN0A 4KN7X 3WTSC 2P7VB 1USTA 3F22A 2XGXA 3BJOA 3CDHA 3M8EA 2O3FA 2GA1A 1HW5A 3DKWA 4IXAA 3SHFA 5LGNA 1F9NA 1NHAA 1R00A 2NAZA 4KUMA 3IKTA 1S8NA 2EA4A 2FRHA 2X4HA 3JSOA 1F5TA 2HYFA 5D6FA 1CGPA 2EV0A 1LNWA 1RI7A 5DYMA 3V8JA 1FOKA 3MWMA 2PI0A 2HKOA 1MZBA 1Y0UA 1LEBA 3KLNA 3FMRA 4R1HA 2STWA 3MCZA 2XHKA 3R6SA 3FHZA 1ZLKA 4G94A 5LLQA 3RKXA 4A6EA 4U7DA 3TO7A 3B02A 2DLLA 4F7ZA 4UVCA 3HHHA 1E2XA 3MZHA 4N0BA 2HS5A 1D5VA 2YX4A 3W6JB 2ZJ2A 1D8KA 3LWFA 3GFIA 3GLXA 1KYWA 3FX3A 2IRFG 3L00A 3F21A 1IRGA 2C6YA 4KT5C 1B59A 3FXQA 3HRTA 5D5XB 5F1RA 5HVQC 2FA5A 4LK1F 3M7GA 2LDUA 2EK5A 1ZRFA 4CXFA 5K1YA 4L9NA 4A12A 1IXCA 3REOA 1S7OA 3MZYA 4LLGF 3BZ6A 4YFKF 4O3MA 3DP7A 3NRVA 4LD5A 4HF0A 4KNYA 1O3QA 1REPC 5ICFA 2P6SA 4RGRA 3IRRA 5H6QA 3O3KA 1K79A 1ZLJA 1XDUA 1XGMA 3F6VA 3IL2A 3N97A 2GAUA 2F5EA 1W7PA 3RPQA 3RI4A 1RIOH 1TNTA 4KDPA 3Q9VA 4EGYA 5CVIA 4HQEA 2EFWA 5E1WA 3LFKA 5AIQA 2L4MA 3GF2A 1MKMA 1PUEE 2DI3A 4EQQA 4DNCA 4EJVA 3BJ6A 3KLOA 4B8XA 5LRRA 3KCCA 1BIAA 1R1TA 3HSRA 1SFUA 1YS6A 4M72A 1G3TA 1R23A 1S3JA 4GXOA 4ZYDA 2VE9A 5HS7A 4WK8F 3IC7A 2UWMA 3SFZA 5DEQA 1LQ1A 2RDPA 3I4PA 2KIMA 3KP2A 3KZZA 4XRFA 1LDJA 1BI2A 2A69F 2RN7A 1O3SA 2VC1A 3GO5A 5HS9A 4PDKA 1S29A 3WTVC 4HZFA 5CYVA 1IN4A 2FMYA 1U5TB 2HEOA 4I2OA 1XD7A 3RDIA 2M30A 2FBHA 1T0FA 3ZMZA 3GXOA 3I71A 5DCFA 2Z33A 2K4JA 1J59A 2Q0OA 2VOPA 2UXXA 1W4MA 2JTVA 3BROA 2H27A 3GEZA 1S7AA 1C0WA 1TNSA 5FFXA 2DW4A 1R5HA 3K69A 3VODA 1TQMA 2PFBA 4P9FA 5FD6A 4BHPA 2IJLA 1K6OA 5HDKA 2ZNZA 5F6FA 1YW8A 3WU1B 3HOTA 2RV8A 2XRNA 3FM3A 2XAJA 2EFNA 2H6BA 5LEKA 2PMHA 1OYIA 1U5TC 2BGCA 4WXDA 1KU3A 3F8BA 2D2WA 1ODDA 3LQQA 2Z99A 2XAGA 5DCMA 1Z1DA 3FXRA 2CO5A 5K5QA 5K5RA 3S2WA 3KP3A 3CUQA 1V3FA 2ETHA 3WTYC 4Z2YA 3J80Z 1AWCA 4CO8A 3KEQA 1HQCA 3HSEA 3F6OA 4XSZF 5BQTA 2LKPA 3VOEA 1OPCA 2L02A 4EGZA 2L4AA 5LEJA 1U6GA 1QO0D 4JK1X 4EM0B 5BMZA 2JT1A 2HR3A 4U0WA 2CQKA 2CSOA 4HV6A 4PZJA 2IA0A 2E7WA 4LG0B 4I01A 1FBUA 2Z9OA 4ZZDA 1LVAA 5E1ZB 3QU3A 1SAXA 3QPHA 4H0EA 4WXCA 1FSEA 4MQ9F 1X3UA 3BPVA 1I1GA 1MD0A 3P7NA 2IA1A 1SD7A 2COMA 3KP4A 4U0VA 1SMYF 5CVUA 4BH9A 3I53A 4YIFA 4MNUA 4ENJA 2VT3A 1E17A 4RAZA 5ILVA 3NQOA 1MJ9A 2QZ8A 3ECHA 3E6BA 2K4BA 1BC7C 2PQ8A 1S6LA 2XV4S 2RGVA 5BPIA 2V1XA 4WX9A 4G8XA 2A68F 2Y75A 1KQ0A 3HIFA 2LF8A 3K2ZA 1FT9A 5CVJA 1P4WA 4P5OA 2NYXA 1D3YA 4WWCA 4A0ZA 1FP2A 4MTEA 4I0BA 1I6XA 4G9YA 3TKYA 3GZ5A 2MD5A 4GYIA 2D1HA 4OIRF 2O61A 2HDCA 4CGZA 2P8TA 2HQRA 3W6KB 1DPUA 2OBPA 3Q9SA 2D1VA 3WGHA 3QP5A 2F5DA 2ZMEA 2RVCA 5DD4A 1KU7A 4BAYA 3F23A 4HW0A 2BBYA 1J2XA 1IF1A 4IHSA 4BYYA 2HQNA 3DF8A 1QNTA 2EB7A 4OIQF 2Z5UA 1HSTA 2ZCWA 1P6RA 1UB9A 5KK1A 2QBYA 5ICCA 4ZYGA 4L9JA 4BXUA 3H3UA 4AD9A 2NNNA 1LEAA 1YO5C 4RS8A 2DO7A 1T39A 2LF7A 2A5YB 4N9HA 2KJBA 3D0SA 3RKYA 1FBSA 1LDDA 3QOPA 1YW7A 4EVIA 4EJTA 3BWGA 3COAC 3AAFA 2DPDA 3K9TA 4UNOA 4ESJA 1IXRC 1IN8A 4Q47A 2OA4A 2PN6A 1WKMA 2FF4A 1EV7A 1FY7A 4P96A 3RPUA 4ENMA 3E5QA 4HOBA 1K7AA 4PCQA 3I59A 4Q4ZF 4UXNA 2LNBA 1BN5A 4UV9A 2ESHA 1IZ1A 4RAYA 4LFUA 1O57A 2G7UA 3F8NA 3Q5FA 2KIFA 3WG9A 4FX0A 3ZMDA 1EH7A 5FO5A 3TDZC 1YTYA 2J5PA 1IRFA 4HDUA 1P4XA 2H6CA 1IW7F 5ILUA 1JGSA 1PP8F 2VT2A 3ZN1A 2FNAA 3I64A 2DTRA 1FZPB 1G3SA 3HRUA 3RIRA 4KMFA 1RUNA 4QLCU 4XSXF 2ZXJA 2VBWA 3C7JA 2PBIA 3WGGA 3R0AA 1FBQA 3I54A 1HKSA 3KE2A 4R8HA 4EM1A 1BI3A 3RKWA 3TOBA 1IN6A 4EJOA 3HHGA 3JAMZ 3KFWX 4BNCA 1TBXA 4RB2C 2FQ3A 4I02A 1B6AA 5E8IA 4DQ2A 1QZYA 2WC2A 1XN7A 4UV8A 2BEOA 2FMLA 4A5NA 4E70A 4A0XA 3ISPA 1Z9CA 4MGRA 3GFJA 1HKTA 4KIFA 5LGTA 2CWEA 4B09A 1OKRA 2ISYA 2UXNA 3WODF 1V4RA 2HYGD 4MHGA 5IT9Z 4ESBA 2GZWA 2CG4A 1CF7A 1KGSA 3HTUA 1G3WA 1FP1D 2Y48A 1KQ8A 2OZUA 5JI6A 1KU9A 3V7SA 3HOSA 4WF2A 2VBXA 4LB5A 3PQJA 2NNYA 5DD8A 2LSOA 2ZNYA 3ECOA 4HX8A 3J80K 3B73A 2VBZA 2D45A 1WI9A 4IPAA 5LHIA 5BOXA 4G6DA 6PAXA 1ZGJA 3DQVC 3KETA 1SD4A 3LAJA 2R7DA 4P9UA 5FFZA 4A0YA 4LGWA 2ZKZA 1BI1A 3QAHA 3QU6A 1R58A 2QQBA 4L9TA 4BHCA 3QRFF 4IVNA 1ONVA 3GZ6A 4TV7A 2JPBA 3TDUC 3JTHA 3ULQB 4HLYA 1OYWA 2B0LA 4BQAA 3R4KA 3ERED 4LK0F 1YG2A 3V8KA 2O03A 3HRMA 1XMKA 2HOEA 2RKHA 3I5UA 1MDMA 1R1VA 3C1DA 3D5LA 4BHBA 4N9IA 4OINF 2H94A 3PQKA 4EJWA 3WTUC 4M9XA 2VOOA 4ZYEA 1XGNA 4KIBA 2JRTA 3WTTC 2X0LA 2VXZA 4ENNA 3IHUA 4PGHA 3BOQA 3T5XA 2QYOA 1KQ9A 1W7PB 1J9IA 1FNNA 5J6XA 1T6SA 5E17F 3LA3A 4I09A 5JVTA 4K2EA 4U7BA 4HDVA 2V1UA 3LSTA 4U88A 3KEOA 2O6GE 4LJZF 2XROA 1A04A 2EA2A 4M9SA 3MFKA 4WXHA 2M5WA 1BM9A 2HTSA 3P9IA 2MBFA 4AIKA 2P5LC 1HKQA 4HQMA 5D4RA 4OIOF 2DK8A 3J81K 1B9MA 1LDKB 2JSCA 2F2EA 2A6EF 3ABTA 1Z6TA 2RQPA 2XAQA 2MC3A 4FHTA 1GXQA 3G3ZA 5L3GA 2EFPA 2K02A 1UHWA 4Y15A 3E5XA 3BP8A 4YG2F 1ON1A 3CTAA 4LMYA 3JW4A 4MQVA 2YSRA 4G7ZF 1AOYA 1IN5A 1TTYA 3G73A 3U1DA 2W57A 1K78A 3V7CA 3WU0A 5HS8A 4CICA 4I0AA 5ICEA 1H0MA 3DEUA 4YIIA 1F4KA 4RB3C 2XIGA 1MGTA 2YR2A 4ESFA 4AIHA 2NS0A 2VONA 3RYPA 1P2FA 3H92A 4IRIA 1Z7UA 3R60A 3V7RA 2CGPA 5BPDA 3H3ZA 4ETSA 5FB2A 2P6TA 2ACJA 2KJCA 1FYLA 1XMAA 1ZREA 3L7WA 4LB6B 3DV8A 1RNLA 4M6XA 3FMSA 4A2UA 1DP7P 4CHUA 2EFOA 1IN7A 4AWXB 5JR3A 5DUIA 4KIGA 2M45A 4G7HF 1PDNC 5D5WB 2KIUA 3RJPA 1GXPA 4S05A 5DCMB 1YLFA 1QGPA 1DUXC 3CUQB 3SZTA 2GQQA 2K27A 4KFCA 2K86A 1FWZA 1HXDA 1KU2A 2P5KA 3JAMK 2FOKA 2L3DA 2FU4A 2DFIA 2W85A 3BPXA 5EEGA 4OU0A 3EUHA 1Z05A 2DAOA 5IT3A 1HBXG 2IT0A 5A2QZ 1UCRA 1U78A 3LAPA 4ENKA 5L3BA 1LJ9A 2A3SA 5IT9K 5L3EA 1R36A 1G4DA 1P92A 5HLHA 4I7HA 3C18A 2STTA 4RB0A 2W24A 4JBAA 3KZYA 1RZ4A 4ZZLA 4NHJA 1B4AA 3C3WA 1ZG5A 1GHCA 2NRAC 2E7XA 5LRSA 3CO7C 3HUGA 4GCVA 4S04A 3CUQC 3N4MA 3GFLA 3L2CA 2OZ6A 3J81Z 4FT8A 1HSJA 3IKVA 2HFHA 2VBYA 1FSHA 1GVJA 2YX7A 5ED4A 3EQLF 3SXYA 1ZH5A 3F8MA 2QM3A 2ZO4A 1YW9A 4RGSA 1ZG3A 2A61A 4GO1A 3FMQA 3HRSA 3I58A 2OU2A 1XSVA 4PGGA 2YU3A 5TJJA 3GW2A 3E6MA 5KVRA 2FEZA 2FE3A 2KKOA 4IF4A 3CUOA 1BOAA 1XSDA 4Q5SF 4WCGA 2FBKA 2P7CB 2ZMEB 5ERIA 2QUFA 1L3LA 4M74A 2Q2EA 3ZMUA 1WSUA 1OYYA 2DQLA 1VTNC 1QBJA 4UVAA 3LA2A 2P4WA 1STZA 2BV6A 5ILSA 2QWWA 1SD5A 4IHTA 3TOAA 5E18F 1XGSA 1W7PD 3ZMSA 3P9CA 1I5ZA 4MEYF 3VEPA 2MH2A 2QBYB 1RUOA 5ICGA 3KP5A 1KA8A 1J0RA 5AONA 2IVMA 2XVCA 4M6YA 5L3CA 1EH6A 2R3SA 4HBLA 2A6HF 4CDGA 3GVAA 1YIOA 2FXAA 4OMYA 2PMUA 1R1UA 2WTEA 1BBYA 3OOPA 3P9KA 2M8EA 5AIPA 5CJ9A 1HW1A 1ZHFA 3FXUA 3QPTA 2FNPA 5DDGA 2OQRA 3WE3A 2CYYA 2GA2A 4RGXA 5HLGA 4LLNA 2DQRA 2E1CA 3EYYA 3I59B 1W5SA 5E1XA 1OR7A 5CVVA 5LGUA 3E5UA 3GUDA 5CLSA 3LQRA 5DV5A 4HF2A 5EEHA 3WGIA 3E6DA 4U0YA 1BJAA 5D5VB 1XCVA 5D5UB 3DFGA 1BC8C 1SFXA 4EMSA 4MEXF 5LHGA 5FLXZ 4R79A 2K7LA 3JTGA 2VODA 1SFEA 3J7AO 4AIJA 3V8LA 3V4GA 1T2KA 2VE8A 3M9AA 3O2PE 2HKXA 2IPQX 3F72A 5HDNA 4XLPF 3KP7A 2GXBA 4L0YB 3ZQ7A 2VN2A 3WTXC 1G6NA 1O7LA 4KN4X 2GIVA 2QENA 2UZKA 4EV0A 1OMIA 3CJNA 3EYIA 2OAZA 1FC3A 3K1MA 3R61A 5H20A 1Q1HA 4RGUA 3RYRA 4KICA 1FYMA 3T0YA 3K1PA 3HTSB 4GYGA 3M1EA 4ZH4F 1QZZA 2EWNA 3WE2A 1UFMA 3CO6C 4KYWA 1L0OC 2W25A 1CF7B 3TO6A 1USSA 2V79A 3FZVA 3T8TA 2Y0MA 3ABUA 1XDSA 5H6RA 3MAJA 2OQGA 2PJPA 2YPRA 3FWEA 3VB2A 1G3YA 1DDNA 5BS6A 1IUYA 4M71A 1BIBA 4HX7A 1FPQA 1B9NA 2RC4A 2QQAA 2FSWA 5HDGA 1UHMA 5J8FA 3L9FA 4QWQA 5A2QK 3OV8A 1U5TA 2IW5A 1ZGAA 3GX4X 2TDXA 2P5VA 2IA2A 2G7HA 2Q8KA 1FLIA 1JE8A 2XKOA 5D4SA 1DPRA 2EFQA 3KP6A 4JQFA 2DBBA 1EH8A 2CW0F 4IJAA 2Z3YA 1R22A 3L09A 4XLNF 1ZRDA 2L54A 4HAMA 1MDMB 5D8KB 3E6CC 2PLYA 2ISZA 3F8FA 4G6QA 1YYVA 1Z91A 2PEXA 3EDPA 2H09A 4Y17A 4G7OF 5LBQA 2MLGA 4CYDA 2O0YA 3K0LA 4O5VA 2OD5A 4OOIA 4NB5A 2BYVE 1O3TA 4UUVA 2MA3A 2PG4A 1J7KA 2MH9A 2IP2A 1H9GA 3GWZA 2ESNA 3TGNA 1BI0A 3U2RA 3WTZA 4YFXF 1T38A 4A6DA 3BDDA 3ZPLA 4M9ZA 2XUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HX4 A;  3IWZ A;  5CVR A;  2GXG A;  2HZT A;  5TRD A;  3ZMT A;  2ZBK A;  5FGM A;  1U8R A;  1FX7 A;  3ELK A;  3E97 A;  3R0J A;  2DU9 A;  1I1S A;  3DPT A;  1IXS B;  4UVB A;  4L5I A;  2EJR A;  1ON2 A;  2W84 A;  2MLK A;  4LG0 A;  2DT5 A;  3ML6 A;  1ZYR F;  1O3R A;  4P55 A;  3DPL C;  3I0T A;  2V9V A;  2M1B A;  1YS7 A;  1XGO A;  4KA4 A;  2HGC A;  5JFR A;  1W5T A;  4UHT A;  1YFH A;  1MJB A;  5JHU A;  2QQ9 A;  3MQ0 A;  5D8L B;  3NEU A;  1O7F A;  2QLZ A;  4ASN A;  4HV5 A;  4NQW A;  3IRQ A;  3MEX A;  1PP7 U;  1K78 B;  3FM5 A;  4ON0 A;  4RB1 A;  4Y13 A;  2ELH A;  3SQN A;  1TLH B;  2QVO A;  4HA8 A;  2XKP A;  4KMU X;  2GWR A;  2F5C A;  1ULY A;  2L01 A;  5E20 A;  1XB4 A;  1D8J A;  3JSP A;  3F3X A;  4HLX A;  4L9V A;  2V1D A;  3TO9 A;  1R5G A;  2J5O A;  1J5Y A;  5L3F A;  1WWX A;  5HOO A;  2A07 F;  1TW3 A;  2XAH A;  3ROU A;  3RTR A;  3HYI A;  1KYZ A;  3BJA A;  1TQI A;  1SMT A;  2ADU A;  4CZZ A;  4GGG A;  5FLX K;  1JHH A;  2EV5 A;  2HTJ A;  3LA7 A;  4LLL A;  2BE5 F;  1B1B A;  1QPM A;  4D0P A;  4M73 A;  1J75 A;  2EV6 A;  3O6B B;  4L0Z B;  3U9G A;  2XAF A;  1I27 A;  1HW2 A;  4L18 B;  4FX4 A;  1TW2 A;  4IRH A;  5J8C A;  2F5F A;  2JPC A;  2DPU A;  4EM2 A;  2E1N A;  1ZN2 A;  2KRF A;  3WTW C;  2VC0 A;  4YFN F;  2CFX A;  2FBI A;  1YQA A;  5F64 A;  1H9T A;  2WWY A;  3BY6 A;  1TQP A;  5K5O A;  4L5J A;  2G9W A;  2WV0 A;  2AS5 F;  1JXS A;  3HSF A;  4XBF A;  1T98 A;  1IAW A;  1ZG1 A;  3DXJ F;  2ZFW A;  4OIP F;  1JHF A;  1ZAO A;  3T8R A;  4ZYH A;  3VFZ A;  4HF1 A;  2DK5 A;  4AVP A;  3CLO A;  4I98 B;  3ZMV A;  1FYK A;  3F8C A;  1XSX A;  4IRG A;  4O6J A;  4HYE A;  1WRJ A;  1LB2 A;  5LHH A;  2RNJ A;  2XAS A;  1ZAR A;  2R7F A;  1P4A A;  5E8G A;  1SD6 A;  1ZRC A;  3M8F A;  5HLI A;  5D6E A;  2O8X A;  3T1B A;  4EJU A;  2V6C A;  1U3E M;  1WQ2 A;  3GFM A;  3IWF A;  5DUK A;  3QP6 A;  3EET A;  1XCB A;  2AXL A;  3SZP A;  3E3V A;  3FF5 A;  5L3D A;  5FD5 A;  1R7J A;  3K1N A;  1U2W A;  4OMZ A;  3PFI A;  1MJA A;  2M87 A;  3GYH X;  4A5M A;  3ZP5 A;  2JZY A;  2HWV A;  3TQN A;  1QQI A;  4MTD A;  1Z6R A;  1F1Z A;  4Q48 A;  3ZN0 A;  4KN7 X;  3WTS C;  2P7V B;  1UST A;  3F22 A;  2XGX A;  3BJO A;  3CDH A;  3M8E A;  2O3F A;  2GA1 A;  1HW5 A;  3DKW A;  4IXA A;  3SHF A;  5LGN A;  1F9N A;  1NHA A;  1R00 A;  2NAZ A;  4KUM A;  3IKT A;  1S8N A;  2EA4 A;  2FRH A;  2X4H A;  3JSO A;  1F5T A;  2HYF A;  5D6F A;  1CGP A;  2EV0 A;  1LNW A;  1RI7 A;  5DYM A;  3V8J A;  1FOK A;  3MWM A;  2PI0 A;  2HKO A;  1MZB A;  1Y0U A;  1LEB A;  3KLN A;  3FMR A;  4R1H A;  2STW A;  3MCZ A;  2XHK A;  3R6S A;  3FHZ A;  1ZLK A;  4G94 A;  5LLQ A;  3RKX A;  4A6E A;  4U7D A;  3TO7 A;  3B02 A;  2DLL A;  4F7Z A;  4UVC A;  3HHH A;  1E2X A;  3MZH A;  4N0B A;  2HS5 A;  1D5V A;  2YX4 A;  3W6J B;  2ZJ2 A;  1D8K A;  3LWF A;  3GFI A;  3GLX A;  1KYW A;  3FX3 A;  2IRF G;  3L00 A;  3F21 A;  1IRG A;  2C6Y A;  4KT5 C;  1B59 A;  3FXQ A;  3HRT A;  5D5X B;  5F1R A;  5HVQ C;  2FA5 A;  4LK1 F;  3M7G A;  2LDU A;  2EK5 A;  1ZRF A;  4CXF A;  5K1Y A;  4L9N A;  4A12 A;  1IXC A;  3REO A;  1S7O A;  3MZY A;  4LLG F;  3BZ6 A;  4YFK F;  4O3M A;  3DP7 A;  3NRV A;  4LD5 A;  4HF0 A;  4KNY A;  1O3Q A;  1REP C;  5ICF A;  2P6S A;  4RGR A;  3IRR A;  5H6Q A;  3O3K A;  1K79 A;  1ZLJ A;  1XDU A;  1XGM A;  3F6V A;  3IL2 A;  3N97 A;  2GAU A;  2F5E A;  1W7P A;  3RPQ A;  3RI4 A;  1RIO H;  1TNT A;  4KDP A;  3Q9V A;  4EGY A;  5CVI A;  4HQE A;  2EFW A;  5E1W A;  3LFK A;  5AIQ A;  2L4M A;  3GF2 A;  1MKM A;  1PUE E;  2DI3 A;  4EQQ A;  4DNC A;  4EJV A;  3BJ6 A;  3KLO A;  4B8X A;  5LRR A;  3KCC A;  1BIA A;  1R1T A;  3HSR A;  1SFU A;  1YS6 A;  4M72 A;  1G3T A;  1R23 A;  1S3J A;  4GXO A;  4ZYD A;  2VE9 A;  5HS7 A;  4WK8 F;  3IC7 A;  2UWM A;  3SFZ A;  5DEQ A;  1LQ1 A;  2RDP A;  3I4P A;  2KIM A;  3KP2 A;  3KZZ A;  4XRF A;  1LDJ A;  1BI2 A;  2A69 F;  2RN7 A;  1O3S A;  2VC1 A;  3GO5 A;  5HS9 A;  4PDK A;  1S29 A;  3WTV C;  4HZF A;  5CYV A;  1IN4 A;  2FMY A;  1U5T B;  2HEO A;  4I2O A;  1XD7 A;  3RDI A;  2M30 A;  2FBH A;  1T0F A;  3ZMZ A;  3GXO A;  3I71 A;  5DCF A;  2Z33 A;  2K4J A;  1J59 A;  2Q0O A;  2VOP A;  2UXX A;  1W4M A;  2JTV A;  3BRO A;  2H27 A;  3GEZ A;  1S7A A;  1C0W A;  1TNS A;  5FFX A;  2DW4 A;  1R5H A;  3K69 A;  3VOD A;  1TQM A;  2PFB A;  4P9F A;  5FD6 A;  4BHP A;  2IJL A;  1K6O A;  5HDK A;  2ZNZ A;  5F6F A;  1YW8 A;  3WU1 B;  3HOT A;  2RV8 A;  2XRN A;  3FM3 A;  2XAJ A;  2EFN A;  2H6B A;  5LEK A;  2PMH A;  1OYI A;  1U5T C;  2BGC A;  4WXD A;  1KU3 A;  3F8B A;  2D2W A;  1ODD A;  3LQQ A;  2Z99 A;  2XAG A;  5DCM A;  1Z1D A;  3FXR A;  2CO5 A;  5K5Q A;  5K5R A;  3S2W A;  3KP3 A;  3CUQ A;  1V3F A;  2ETH A;  3WTY C;  4Z2Y A;  3J80 Z;  1AWC A;  4CO8 A;  3KEQ A;  1HQC A;  3HSE A;  3F6O A;  4XSZ F;  5BQT A;  2LKP A;  3VOE A;  1OPC A;  2L02 A;  4EGZ A;  2L4A A;  5LEJ A;  1U6G A;  1QO0 D;  4JK1 X;  4EM0 B;  5BMZ A;  2JT1 A;  2HR3 A;  4U0W A;  2CQK A;  2CSO A;  4HV6 A;  4PZJ A;  2IA0 A;  2E7W A;  4LG0 B;  4I01 A;  1FBU A;  2Z9O A;  4ZZD A;  1LVA A;  5E1Z B;  3QU3 A;  1SAX A;  3QPH A;  4H0E A;  4WXC A;  1FSE A;  4MQ9 F;  1X3U A;  3BPV A;  1I1G A;  1MD0 A;  3P7N A;  2IA1 A;  1SD7 A;  2COM A;  3KP4 A;  4U0V A;  1SMY F;  5CVU A;  4BH9 A;  3I53 A;  4YIF A;  4MNU A;  4ENJ A;  2VT3 A;  1E17 A;  4RAZ A;  5ILV A;  3NQO A;  1MJ9 A;  2QZ8 A;  3ECH A;  3E6B A;  2K4B A;  1BC7 C;  2PQ8 A;  1S6L A;  2XV4 S;  2RGV A;  5BPI A;  2V1X A;  4WX9 A;  4G8X A;  2A68 F;  2Y75 A;  1KQ0 A;  3HIF A;  2LF8 A;  3K2Z A;  1FT9 A;  5CVJ A;  1P4W A;  4P5O A;  2NYX A;  1D3Y A;  4WWC A;  4A0Z A;  1FP2 A;  4MTE A;  4I0B A;  1I6X A;  4G9Y A;  3TKY A;  3GZ5 A;  2MD5 A;  4GYI A;  2D1H A;  4OIR F;  2O61 A;  2HDC A;  4CGZ A;  2P8T A;  2HQR A;  3W6K B;  1DPU A;  2OBP A;  3Q9S A;  2D1V A;  3WGH A;  3QP5 A;  2F5D A;  2ZME A;  2RVC A;  5DD4 A;  1KU7 A;  4BAY A;  3F23 A;  4HW0 A;  2BBY A;  1J2X A;  1IF1 A;  4IHS A;  4BYY A;  2HQN A;  3DF8 A;  1QNT A;  2EB7 A;  4OIQ F;  2Z5U A;  1HST A;  2ZCW A;  1P6R A;  1UB9 A;  5KK1 A;  2QBY A;  5ICC A;  4ZYG A;  4L9J A;  4BXU A;  3H3U A;  4AD9 A;  2NNN A;  1LEA A;  1YO5 C;  4RS8 A;  2DO7 A;  1T39 A;  2LF7 A;  2A5Y B;  4N9H A;  2KJB A;  3D0S A;  3RKY A;  1FBS A;  1LDD A;  3QOP A;  1YW7 A;  4EVI A;  4EJT A;  3BWG A;  3COA C;  3AAF A;  2DPD A;  3K9T A;  4UNO A;  4ESJ A;  1IXR C;  1IN8 A;  4Q47 A;  2OA4 A;  2PN6 A;  1WKM A;  2FF4 A;  1EV7 A;  1FY7 A;  4P96 A;  3RPU A;  4ENM A;  3E5Q A;  4HOB A;  1K7A A;  4PCQ A;  3I59 A;  4Q4Z F;  4UXN A;  2LNB A;  1BN5 A;  4UV9 A;  2ESH A;  1IZ1 A;  4RAY A;  4LFU A;  1O57 A;  2G7U A;  3F8N A;  3Q5F A;  2KIF A;  3WG9 A;  4FX0 A;  3ZMD A;  1EH7 A;  5FO5 A;  3TDZ C;  1YTY A;  2J5P A;  1IRF A;  4HDU A;  1P4X A;  2H6C A;  1IW7 F;  5ILU A;  1JGS A;  1PP8 F;  2VT2 A;  3ZN1 A;  2FNA A;  3I64 A;  2DTR A;  1FZP B;  1G3S A;  3HRU A;  3RIR A;  4KMF A;  1RUN A;  4QLC U;  4XSX F;  2ZXJ A;  2VBW A;  3C7J A;  2PBI A;  3WGG A;  3R0A A;  1FBQ A;  3I54 A;  1HKS A;  3KE2 A;  4R8H A;  4EM1 A;  1BI3 A;  3RKW A;  3TOB A;  1IN6 A;  4EJO A;  3HHG A;  3JAM Z;  3KFW X;  4BNC A;  1TBX A;  4RB2 C;  2FQ3 A;  4I02 A;  1B6A A;  5E8I A;  4DQ2 A;  1QZY A;  2WC2 A;  1XN7 A;  4UV8 A;  2BEO A;  2FML A;  4A5N A;  4E70 A;  4A0X A;  3ISP A;  1Z9C A;  4MGR A;  3GFJ A;  1HKT A;  4KIF A;  5LGT A;  2CWE A;  4B09 A;  1OKR A;  2ISY A;  2UXN A;  3WOD F;  1V4R A;  2HYG D;  4MHG A;  5IT9 Z;  4ESB A;  2GZW A;  2CG4 A;  1CF7 A;  1KGS A;  3HTU A;  1G3W A;  1FP1 D;  2Y48 A;  1KQ8 A;  2OZU A;  5JI6 A;  1KU9 A;  3V7S A;  3HOS A;  4WF2 A;  2VBX A;  4LB5 A;  3PQJ A;  2NNY A;  5DD8 A;  2LSO A;  2ZNY A;  3ECO A;  4HX8 A;  3J80 K;  3B73 A;  2VBZ A;  2D45 A;  1WI9 A;  4IPA A;  5LHI A;  5BOX A;  4G6D A;  6PAX A;  1ZGJ A;  3DQV C;  3KET A;  1SD4 A;  3LAJ A;  2R7D A;  4P9U A;  5FFZ A;  4A0Y A;  4LGW A;  2ZKZ A;  1BI1 A;  3QAH A;  3QU6 A;  1R58 A;  2QQB A;  4L9T A;  4BHC A;  3QRF F;  4IVN A;  1ONV A;  3GZ6 A;  4TV7 A;  2JPB A;  3TDU C;  3JTH A;  3ULQ B;  4HLY A;  1OYW A;  2B0L A;  4BQA A;  3R4K A;  3ERE D;  4LK0 F;  1YG2 A;  3V8K A;  2O03 A;  3HRM A;  1XMK A;  2HOE A;  2RKH A;  3I5U A;  1MDM A;  1R1V A;  3C1D A;  3D5L A;  4BHB A;  4N9I A;  4OIN F;  2H94 A;  3PQK A;  4EJW A;  3WTU C;  4M9X A;  2VOO A;  4ZYE A;  1XGN A;  4KIB A;  2JRT A;  3WTT C;  2X0L A;  2VXZ A;  4ENN A;  3IHU A;  4PGH A;  3BOQ A;  3T5X A;  2QYO A;  1KQ9 A;  1W7P B;  1J9I A;  1FNN A;  5J6X A;  1T6S A;  5E17 F;  3LA3 A;  4I09 A;  5JVT A;  4K2E A;  4U7B A;  4HDV A;  2V1U A;  3LST A;  4U88 A;  3KEO A;  2O6G E;  4LJZ F;  2XRO A;  1A04 A;  2EA2 A;  4M9S A;  3MFK A;  4WXH A;  2M5W A;  1BM9 A;  2HTS A;  3P9I A;  2MBF A;  4AIK A;  2P5L C;  1HKQ A;  4HQM A;  5D4R A;  4OIO F;  2DK8 A;  3J81 K;  1B9M A;  1LDK B;  2JSC A;  2F2E A;  2A6E F;  3ABT A;  1Z6T A;  2RQP A;  2XAQ A;  2MC3 A;  4FHT A;  1GXQ A;  3G3Z A;  5L3G A;  2EFP A;  2K02 A;  1UHW A;  4Y15 A;  3E5X A;  3BP8 A;  4YG2 F;  1ON1 A;  3CTA A;  4LMY A;  3JW4 A;  4MQV A;  2YSR A;  4G7Z F;  1AOY A;  1IN5 A;  1TTY A;  3G73 A;  3U1D A;  2W57 A;  1K78 A;  3V7C A;  3WU0 A;  5HS8 A;  4CIC A;  4I0A A;  5ICE A;  1H0M A;  3DEU A;  4YII A;  1F4K A;  4RB3 C;  2XIG A;  1MGT A;  2YR2 A;  4ESF A;  4AIH A;  2NS0 A;  2VON A;  3RYP A;  1P2F A;  3H92 A;  4IRI A;  1Z7U A;  3R60 A;  3V7R A;  2CGP A;  5BPD A;  3H3Z A;  4ETS A;  5FB2 A;  2P6T A;  2ACJ A;  2KJC A;  1FYL A;  1XMA A;  1ZRE A;  3L7W A;  4LB6 B;  3DV8 A;  1RNL A;  4M6X A;  3FMS A;  4A2U A;  1DP7 P;  4CHU A;  2EFO A;  1IN7 A;  4AWX B;  5JR3 A;  5DUI A;  4KIG A;  2M45 A;  4G7H F;  1PDN C;  5D5W B;  2KIU A;  3RJP A;  1GXP A;  4S05 A;  5DCM B;  1YLF A;  1QGP A;  1DUX C;  3CUQ B;  3SZT A;  2GQQ A;  2K27 A;  4KFC A;  2K86 A;  1FWZ A;  1HXD A;  1KU2 A;  2P5K A;  3JAM K;  2FOK A;  2L3D A;  2FU4 A;  2DFI A;  2W85 A;  3BPX A;  5EEG A;  4OU0 A;  3EUH A;  1Z05 A;  2DAO A;  5IT3 A;  1HBX G;  2IT0 A;  5A2Q Z;  1UCR A;  1U78 A;  3LAP A;  4ENK A;  5L3B A;  1LJ9 A;  2A3S A;  5IT9 K;  5L3E A;  1R36 A;  1G4D A;  1P92 A;  5HLH A;  4I7H A;  3C18 A;  2STT A;  4RB0 A;  2W24 A;  4JBA A;  3KZY A;  1RZ4 A;  4ZZL A;  4NHJ A;  1B4A A;  3C3W A;  1ZG5 A;  1GHC A;  2NRA C;  2E7X A;  5LRS A;  3CO7 C;  3HUG A;  4GCV A;  4S04 A;  3CUQ C;  3N4M A;  3GFL A;  3L2C A;  2OZ6 A;  3J81 Z;  4FT8 A;  1HSJ A;  3IKV A;  2HFH A;  2VBY A;  1FSH A;  1GVJ A;  2YX7 A;  5ED4 A;  3EQL F;  3SXY A;  1ZH5 A;  3F8M A;  2QM3 A;  2ZO4 A;  1YW9 A;  4RGS A;  1ZG3 A;  2A61 A;  4GO1 A;  3FMQ A;  3HRS A;  3I58 A;  2OU2 A;  1XSV A;  4PGG A;  2YU3 A;  5TJJ A;  3GW2 A;  3E6M A;  5KVR A;  2FEZ A;  2FE3 A;  2KKO A;  4IF4 A;  3CUO A;  1BOA A;  1XSD A;  4Q5S F;  4WCG A;  2FBK A;  2P7C B;  2ZME B;  5ERI A;  2QUF A;  1L3L A;  4M74 A;  2Q2E A;  3ZMU A;  1WSU A;  1OYY A;  2DQL A;  1VTN C;  1QBJ A;  4UVA A;  3LA2 A;  2P4W A;  1STZ A;  2BV6 A;  5ILS A;  2QWW A;  1SD5 A;  4IHT A;  3TOA A;  5E18 F;  1XGS A;  1W7P D;  3ZMS A;  3P9C A;  1I5Z A;  4MEY F;  3VEP A;  2MH2 A;  2QBY B;  1RUO A;  5ICG A;  3KP5 A;  1KA8 A;  1J0R A;  5AON A;  2IVM A;  2XVC A;  4M6Y A;  5L3C A;  1EH6 A;  2R3S A;  4HBL A;  2A6H F;  4CDG A;  3GVA A;  1YIO A;  2FXA A;  4OMY A;  2PMU A;  1R1U A;  2WTE A;  1BBY A;  3OOP A;  3P9K A;  2M8E A;  5AIP A;  5CJ9 A;  1HW1 A;  1ZHF A;  3FXU A;  3QPT A;  2FNP A;  5DDG A;  2OQR A;  3WE3 A;  2CYY A;  2GA2 A;  4RGX A;  5HLG A;  4LLN A;  2DQR A;  2E1C A;  3EYY A;  3I59 B;  1W5S A;  5E1X A;  1OR7 A;  5CVV A;  5LGU A;  3E5U A;  3GUD A;  5CLS A;  3LQR A;  5DV5 A;  4HF2 A;  5EEH A;  3WGI A;  3E6D A;  4U0Y A;  1BJA A;  5D5V B;  1XCV A;  5D5U B;  3DFG A;  1BC8 C;  1SFX A;  4EMS A;  4MEX F;  5LHG A;  5FLX Z;  4R79 A;  2K7L A;  3JTG A;  2VOD A;  1SFE A;  3J7A O;  4AIJ A;  3V8L A;  3V4G A;  1T2K A;  2VE8 A;  3M9A A;  3O2P E;  2HKX A;  2IPQ X;  3F72 A;  5HDN A;  4XLP F;  3KP7 A;  2GXB A;  4L0Y B;  3ZQ7 A;  2VN2 A;  3WTX C;  1G6N A;  1O7L A;  4KN4 X;  2GIV A;  2QEN A;  2UZK A;  4EV0 A;  1OMI A;  3CJN A;  3EYI A;  2OAZ A;  1FC3 A;  3K1M A;  3R61 A;  5H20 A;  1Q1H A;  4RGU A;  3RYR A;  4KIC A;  1FYM A;  3T0Y A;  3K1P A;  3HTS B;  4GYG A;  3M1E A;  4ZH4 F;  1QZZ A;  2EWN A;  3WE2 A;  1UFM A;  3CO6 C;  4KYW A;  1L0O C;  2W25 A;  1CF7 B;  3TO6 A;  1USS A;  2V79 A;  3FZV A;  3T8T A;  2Y0M A;  3ABU A;  1XDS A;  5H6R A;  3MAJ A;  2OQG A;  2PJP A;  2YPR A;  3FWE A;  3VB2 A;  1G3Y A;  1DDN A;  5BS6 A;  1IUY A;  4M71 A;  1BIB A;  4HX7 A;  1FPQ A;  1B9N A;  2RC4 A;  2QQA A;  2FSW A;  5HDG A;  1UHM A;  5J8F A;  3L9F A;  4QWQ A;  5A2Q K;  3OV8 A;  1U5T A;  2IW5 A;  1ZGA A;  3GX4 X;  2TDX A;  2P5V A;  2IA2 A;  2G7H A;  2Q8K A;  1FLI A;  1JE8 A;  2XKO A;  5D4S A;  1DPR A;  2EFQ A;  3KP6 A;  4JQF A;  2DBB A;  1EH8 A;  2CW0 F;  4IJA A;  2Z3Y A;  1R22 A;  3L09 A;  4XLN F;  1ZRD A;  2L54 A;  4HAM A;  1MDM B;  5D8K B;  3E6C C;  2PLY A;  2ISZ A;  3F8F A;  4G6Q A;  1YYV A;  1Z91 A;  2PEX A;  3EDP A;  2H09 A;  4Y17 A;  4G7O F;  5LBQ A;  2MLG A;  4CYD A;  2O0Y A;  3K0L A;  4O5V A;  2OD5 A;  4OOI A;  4NB5 A;  2BYV E;  1O3T A;  4UUV A;  2MA3 A;  2PG4 A;  1J7K A;  2MH9 A;  2IP2 A;  1H9G A;  3GWZ A;  2ESN A;  3TGN A;  1BI0 A;  3U2R A;  3WTZ A;  4YFX F;  1T38 A;  4A6D A;  3BDD A;  3ZPL A;  4M9Z A;  2XUB A; 
#chains in the Genus database with same CATH topology
 3GTP J;  4HX4 A;  3IWZ A;  5CVR A;  2GXG A;  1T08 B;  2HZT A;  5TRD A;  5FKL A;  1WGX A;  1WH5 A;  2NS8 A;  3ZMT A;  2ZBK A;  5FGM A;  1U8R A;  1FX7 A;  3ELK A;  5LD2 C;  2KFD A;  2EZL A;  2X1D A;  1XX5 A;  3E97 A;  3FKJ A;  2DU9 A;  3R0J A;  4DW6 A;  4BY1 J;  1I1S A;  3DPT A;  1IXS B;  3RZO J;  3CF2 A;  4UVB A;  3LNQ A;  4L5I A;  4IZZ A;  4IKF A;  2EJR A;  1YX3 A;  1ON2 A;  1RKW A;  2W84 A;  2MLK A;  4QSH A;  4LG0 A;  2DOD A;  3MKY B;  1BJZ A;  1KON A;  2DT5 A;  4XLF A;  3ML6 A;  3G1M A;  2NVQ J;  1ZYR F;  4JP0 A;  2L2O A;  1HF0 A;  3K70 C;  1O3R A;  4P55 A;  3DPL C;  4AU7 A;  3S3N A;  3I0T A;  2V9V A;  2HDW A;  1IJW C;  5M3M J;  2M1B A;  1YS7 A;  3H5R A;  1XGO A;  4KA4 A;  4XOP A;  2HGC A;  5JFR A;  4NUB A;  1W5T A;  4UHT A;  5F27 A;  1YFH A;  1MJB A;  2DDB A;  5JHU A;  2QQ9 A;  1ZR2 A;  3MQ0 A;  4RA2 A;  3JRB A;  5D8L B;  3NEU A;  2DA5 A;  2QGU A;  3CZ6 A;  1O7F A;  2IAI A;  2QLZ A;  4HV5 A;  4NQW A;  4ASN A;  3IRQ A;  3MEX A;  1PP7 U;  1K78 B;  4IO9 F;  3FM5 A;  4ON0 A;  2WV1 A;  9ANT A;  5HOD A;  4RB1 A;  4Y13 A;  2ELH A;  3SQN A;  1TLH B;  4XN0 A;  4B43 A;  4DGW B;  3MKZ A;  2Y9Y A;  2QVO A;  1X19 A;  2CUE A;  2CW8 A;  2B7E A;  4HA8 A;  2XKP A;  3CJR B;  1XTA A;  2XF5 A;  3RKQ A;  1V5G A;  3FXJ A;  2V6E A;  4KMU X;  2GWR A;  2F5C A;  1ULY A;  2L01 A;  1JKR C;  4D1Q A;  4M3F A;  5E20 A;  3JCU C;  4E7L A;  3AL0 B;  1E3P A;  1XB4 A;  1D8J A;  1BOB A;  2P81 A;  5FKN A;  3JSP A;  3CC7 I;  3F3X A;  4HLX A;  1X1P A;  3CCS I;  3TL4 X;  1OQY A;  2HU9 A;  4L9V A;  3FDY A;  1SVO A;  2V1D A;  3BR2 A;  3TO9 A;  1ETW A;  1W36 D;  1VQ9 I;  1X2M A;  1R5G A;  4IHW A;  2J5O A;  1J5Y A;  5L3F A;  1WWX A;  4OAY A;  5HOO A;  2A07 F;  2MYS A;  2G0E A;  3S1R J;  1TW3 A;  2XAH A;  2KDZ A;  3ROU A;  3RTR A;  3HYI A;  3IAM 2;  2HXO A;  4XRM A;  2DA3 A;  3CMA I;  1KYZ A;  1MBJ A;  2BZT A;  3BJA A;  2DMU A;  2HDD A;  4YEJ A;  1TQI A;  1N77 A;  2MGQ A;  1SMT A;  3NWT A;  2ADU A;  1YI2 I;  1I3Q J;  4CZZ A;  4GGG A;  5FLX K;  4V19 K;  1JHH A;  1U0J A;  2EV5 A;  2HTJ A;  3LA7 A;  4LLL A;  3DU5 A;  4XKB A;  2BE5 F;  4BJT A;  2W00 A;  1B1B A;  2R92 J;  4H4K C;  4W1U A;  5EEA A;  1QPM A;  4D0P A;  4M73 A;  2COB A;  5FRN A;  1PJR A;  1J75 A;  2JA5 J;  1TL8 A;  3ZQL A;  3M3Y J;  2CV1 A;  5CKT A;  3PO2 J;  2EV6 A;  3O6B B;  4L0Z B;  3OYJ A;  3U9G A;  2XAF A;  1I27 A;  4HPQ A;  1MMG A;  4AVZ A;  4GDF A;  1HW2 A;  4ZDL A;  2M7A A;  2MG4 A;  4E4H A;  4L18 B;  2ZXI A;  1TZL A;  1IDY A;  4FX4 A;  1TW2 A;  4C2U A;  4A3D J;  3B6A A;  4YRV A;  4IRH A;  5J8C A;  1EKE A;  3PJR A;  2F5F A;  2JPC A;  2DPU A;  4EM2 A;  2E1N A;  1T56 A;  2I5U A;  1ZN2 A;  3AL0 C;  2KRF A;  3WTW C;  2VC0 A;  2LTP A;  3HEF A;  4YFN F;  2CFX A;  1JT0 A;  2FBI A;  1YQA A;  3W3C A;  4ZTF A;  5F64 A;  5JLW A;  1H9T A;  3CME I;  2YS9 A;  2WWY A;  3BY6 A;  1TQP A;  5IPA A;  5K5O A;  4L5J A;  2G9W A;  2WV0 A;  2AS5 F;  3NAU A;  1JXS A;  3HXL A;  3HSF A;  2XGC A;  4XBF A;  2XGE A;  1ZGW A;  4W97 A;  1T98 A;  1Y0N A;  1IAW A;  3VSK A;  1ZG1 A;  3DXJ F;  5B1B H;  2ZFW A;  4OIP F;  1JHF A;  2DOF A;  3DEE A;  1ZAO A;  2IXS A;  3T8R A;  2OPT A;  4ZYH A;  3F9K A;  5EF6 A;  3ASO H;  3VFZ A;  4HF1 A;  2DK5 A;  1MH3 A;  4AVP A;  3CLO A;  4I98 B;  3CCL I;  3ZMV A;  1FYK A;  2QCO A;  3F8C A;  1XSX A;  1WPK A;  2GOX B;  4IRG A;  4O6J A;  4HYE A;  3H0D A;  3NAR A;  1HOM A;  4GFB A;  4XLC A;  1WRJ A;  1LB2 A;  4B4C A;  2Y9Z A;  3J7Y J;  2BHY A;  3OR2 C;  5LHH A;  2OTL I;  5E79 C;  2RNJ A;  2XAS A;  1ZAR A;  2R7F A;  1P4A A;  5E8G A;  1WJB A;  1SD6 A;  1ZRC A;  3L2Q A;  2L5Q A;  3HUG B;  3M8F A;  5HLI A;  5D6E A;  3ZGK A;  2O8X A;  3T1B A;  4EJU A;  2V6C A;  1U3E M;  1WQ2 A;  3GFM A;  3S93 A;  2KRC A;  3IWF A;  5DUK A;  1MBH A;  3QP6 A;  1G8X A;  5EGO B;  3CMY A;  4C2T A;  3EET A;  1XCB A;  2E60 A;  1LUJ B;  2AXL A;  3SZP A;  4DYQ A;  3E3V A;  3FF5 A;  5L3D A;  5FD5 A;  3MVP A;  2FD5 A;  2KL4 A;  1R7J A;  1WHU A;  3K1N A;  1NTC A;  3S3O A;  1P9Q C;  1IG7 A;  1U2W A;  3EUH C;  4OMZ A;  4BDY A;  3PFI A;  5HNH A;  1MJA A;  2M87 A;  3GYH X;  4A5M A;  2KMU A;  3ZP5 A;  2H8R A;  2JZY A;  3OOU A;  1Y1W J;  3OYD A;  3WHB A;  2HWV A;  4LIU A;  3AG3 H;  2L7Z A;  2R0Q C;  1EA3 A;  3TQN A;  2L7K A;  4QIW N;  2CU7 A;  1QQI A;  1X4P A;  2ZC2 A;  4MTD A;  2P0W A;  1LE8 A;  4XOR A;  1QVT A;  1GDT A;  1Z6R A;  3C2B A;  1F1Z A;  4Q48 A;  3ZN0 A;  4OWR B;  3SDG A;  4KN7 X;  1D1A A;  5J1Y A;  1MMN A;  3WTS C;  3Q0W A;  4F55 A;  3HOY J;  2P7V B;  1UST A;  3X2Q H;  3F22 A;  2BXY A;  2XGX A;  3RQ4 A;  3JRD A;  3BJO A;  1MMD A;  3CDH A;  3M8E A;  2CUZ A;  2V4J C;  2E71 A;  2GA1 A;  2O3F A;  1HW5 A;  1DQU A;  3DKW A;  4IXA A;  1LFP A;  3SHF A;  5LGN A;  4Y7N J;  1F9N A;  1NHA A;  1R00 A;  1RRJ A;  2NAZ A;  1R6R A;  2JN6 A;  4KUM A;  4HRI A;  2NVU B;  3IKT A;  2XGD A;  1S8N A;  2K3P A;  2GM4 A;  4DZJ A;  2EA4 A;  2FRH A;  2Q2E B;  2X4H A;  2LBF A;  3JSO A;  2PX9 A;  2HYF A;  1F5T A;  3AG1 H;  1XMX A;  5D6F A;  4D7M A;  1CGP A;  2EV0 A;  3OS1 A;  1LNW A;  4XNF A;  1RI7 A;  5DYM A;  3V8J A;  1FOK A;  3MWM A;  2PI0 A;  2HKO A;  1MZB A;  2V1N A;  3ABM H;  3DPU A;  2RQQ A;  1Y0U A;  1AU7 A;  1G2H A;  1X3W B;  3K70 D;  1LEB A;  2BW3 B;  3KLN A;  3GLL A;  2KIS A;  3FMR A;  4R1H A;  2STW A;  3MCZ A;  2XHK A;  2O9L A;  3R6S A;  3FHZ A;  1ZLK A;  3FK7 A;  4G94 A;  1MMS A;  4D5C A;  2KQR A;  1W1W E;  2E1M B;  5LLQ A;  4PK4 A;  3RKX A;  4A6E A;  1F36 A;  1Y8R B;  2JMW A;  4U7D A;  1MSE C;  5C4X J;  3TO7 A;  3B02 A;  4PJJ A;  2DLL A;  4F7Z A;  4RAF A;  4UVC A;  3OYH A;  5EZH A;  1I6H J;  3HHH A;  2LMD A;  2R7Z J;  4IQJ A;  1E2X A;  1QPI A;  3MZH A;  4MFE A;  2L0K A;  1MBG A;  2V9P A;  4XKV A;  4N0B A;  2HS5 A;  1D5V A;  5FLM J;  2YX4 A;  3W6J B;  2Y30 A;  4F92 B;  5K7Z A;  2ZJ2 A;  3KYC B;  1D8K A;  3LWF A;  3A01 B;  3GFI A;  3GLX A;  1KYW A;  1HDD C;  2L9N A;  3FX3 A;  2IRF G;  1XC5 A;  2JJ7 A;  4FIS A;  3BTI A;  2FX0 A;  3H35 A;  3L00 A;  4XM3 A;  3F21 A;  1R71 A;  1IRG A;  2C6Y A;  2VJ4 A;  2IEK A;  2R7V A;  4JX4 A;  4C3H J;  2VLA A;  4KT5 C;  1B59 A;  2RRE A;  3FIS A;  1UEL B;  3FXQ A;  1LKX A;  3HRT A;  2HOS A;  5D5X B;  4BQO A;  3RSN A;  3BLY A;  2FA5 A;  5F1R A;  5HVQ C;  4LK1 F;  3M7G A;  4B3A A;  2LDU A;  2EK5 A;  4QPO A;  1VZ0 A;  1ZRF A;  4CXF A;  5K1Y A;  3OYC A;  4NC6 A;  4L9N A;  4A12 A;  4C9Y A;  1S7E A;  1IXC A;  3REO A;  4IHY A;  3PNT A;  1S7O A;  2HQ5 A;  3MZY A;  4LLG F;  3BZ6 A;  4YFK F;  4O3M A;  2E1M C;  4HG2 A;  2HNH A;  3DP7 A;  3NRV A;  2R4G A;  4P1W A;  1EF4 A;  4LD5 A;  4HF0 A;  2LVS A;  1ETX A;  1TWH J;  2F4I A;  3HG9 A;  4KNY A;  2A5W A;  1O3Q A;  1REP C;  2FJ1 A;  5ICF A;  2P6S A;  1QHG A;  4RGR A;  2V26 A;  3IRR A;  4BBS J;  2EBI A;  5H6Q A;  3QYE A;  2ECC A;  3W2A A;  3O3K A;  4M3D A;  5CQG A;  3FXM A;  1K79 A;  1ZLJ A;  1XDU A;  1OJL A;  1XGM A;  3F6V A;  3IL2 A;  3N97 A;  2GAU A;  2F5E A;  5HNF A;  1W7P A;  3RPQ A;  4BBR J;  5DTD A;  3RI4 A;  2KPM A;  3Q0U A;  3WG7 H;  1RIO H;  4M3B A;  1TNT A;  3G6E I;  2CV2 A;  4KDP A;  2R7X A;  3MKW B;  3Q9V A;  4DBQ A;  4EGY A;  5CVI A;  4HQE A;  2R5Y B;  3S1Q J;  2EFW A;  1TWF J;  5E1W A;  3LFK A;  3M8J A;  5AIQ A;  5EG0 A;  2L4M A;  3CCU I;  3GF2 A;  1MKM A;  3G1L A;  4PJ0 C;  1PUE E;  2DI3 A;  2W7N A;  3A02 A;  3FHN A;  3A0H C;  4EQQ A;  4DNC A;  2LLK A;  2BOL A;  1A6Q A;  4EJV A;  1WJA A;  3BJ6 A;  5EDN A;  3KLO A;  2LRD A;  4B8X A;  5LRR A;  4UUS B;  3HOV J;  1I39 A;  3KCC A;  1OR7 C;  2ELJ A;  2VKD A;  1BA5 A;  2M9H A;  3C2G A;  1TWA J;  2E1O A;  1BIA A;  2K5C A;  1R1T A;  3Q3S A;  3M1C A;  3WU2 C;  4XID A;  1WJF A;  3KYD B;  3HSR A;  1SFU A;  1V55 H;  1YS6 A;  2H8W A;  4M72 A;  2O5R A;  4C3I J;  2X85 A;  2HZD A;  1G3T A;  1WJ5 A;  4N4N B;  1JTY A;  1R23 A;  2DT6 A;  2QKM B;  1S3J A;  1ZR4 A;  4CYC A;  4ZDO A;  2XDV A;  3HGY A;  4GXO A;  2ZJP F;  4ZYD A;  2R7R A;  2VE9 A;  5HS7 A;  4WK8 F;  1TWC J;  3IC7 A;  2UWM A;  5M5Y J;  3SFZ A;  5J1U A;  5DEQ A;  4A3I J;  1LQ1 A;  2M4G A;  2PJR B;  2RDP A;  3I4P A;  2KIM A;  3HPH A;  2A6T A;  3KP2 A;  3ZQC A;  4XL9 A;  3KZZ A;  3DLA A;  2XSJ C;  3DEW A;  4XRF A;  2XB0 X;  2K40 A;  2VIX A;  1WZ2 A;  1LDJ A;  4LG3 A;  3OYM A;  1BI2 A;  2R5Z A;  2A69 F;  4CCO A;  2RN7 A;  2VQL A;  1O3S A;  3CC2 I;  4NC7 A;  2VKE A;  2VC1 A;  4J01 A;  4Y4R A;  3GO5 A;  5HS9 A;  4PDK A;  2EZK A;  3BQZ A;  1S29 A;  4BL0 B;  4NBQ A;  3WTV C;  4HZF A;  3DCF A;  4N4O B;  5CYV A;  1IN4 A;  2R7U A;  2FMY A;  2WY7 Q;  3LOC A;  3I4M J;  1VQN I;  1U5T B;  3L2W A;  2VB6 A;  2DMP A;  5KAF C;  3Q0V A;  2HEO A;  2CW7 A;  1OCO H;  2ID6 A;  4J00 A;  2GOM A;  4KIT B;  4I2O A;  1XD7 A;  4AC0 A;  3EPZ A;  2M30 A;  3RDI A;  1V5E A;  1WJD A;  2HOA A;  1H88 C;  4UB6 C;  3DTI A;  3IH2 A;  1VFC A;  2FBH A;  2LKX A;  1VQK I;  2DMN A;  1T0F A;  3ZMZ A;  3GXO A;  1YRN A;  3I71 A;  5DCF A;  2Z33 A;  2DMQ A;  2K4J A;  1MBK A;  3JRC A;  1J59 A;  2Q0O A;  2DFE A;  4XOT A;  2KP6 A;  1ZKG A;  2VOP A;  2OTJ I;  2UXX A;  1W4M A;  4FTH A;  2CQ7 A;  4PUS A;  2F6C A;  2JTV A;  4NDL A;  1SVM A;  3BRO A;  2H27 A;  3GEZ A;  1S7A A;  4DYR A;  1C0W A;  2WAD A;  3PIP F;  1TNS A;  5FFX A;  2DW4 A;  1MBE A;  1R5H A;  1YX5 A;  3K69 A;  2WAE A;  3VOD A;  3BG6 A;  1TQM A;  3DBL B;  2PFB A;  1O4X A;  4P9F A;  5FD6 A;  4HST A;  2QSG X;  4BHP A;  2IJL A;  5J4V A;  3O8G A;  1K6O A;  3DTE A;  1VF9 A;  5HDK A;  5M3F J;  2XPU A;  4CUG A;  2ZNZ A;  3ASN H;  2LK2 A;  2K9N A;  5F6F A;  1YW8 A;  3WU1 B;  5IYD J;  3HOT A;  1UJ8 A;  3S14 J;  2RV8 A;  4KT6 A;  2DOA A;  2XRN A;  4BGD A;  3FM3 A;  2XAJ A;  4ZJZ A;  2EFN A;  2H6B A;  5LEK A;  1W0T A;  1HCR A;  2PMH A;  1U8B A;  1OYI A;  4V2F A;  3BQY A;  1U5T C;  2BGC A;  3AFH A;  3VYU B;  1D5Y A;  4L5E A;  4WXD A;  1YJW I;  3PNY A;  1KU3 A;  3F8B A;  2D2W A;  1Y56 A;  1ODD A;  3LQQ A;  5KNL A;  5DS9 A;  4QTR A;  1YE9 A;  2Z99 A;  1YRN B;  1LVK A;  2XAG A;  2HVS A;  5DCM A;  1Z1D A;  3FXR A;  1WVR A;  2CO5 A;  5K5Q A;  5K5R A;  2IS6 A;  1SFK A;  3S2W A;  3KP3 A;  1D0X A;  4NC8 A;  2VI6 A;  3CUQ A;  1V3F A;  2ETH A;  3WTY C;  3K4B A;  4BU2 A;  4Z2Y A;  5FRO A;  2VJ5 A;  3J80 Z;  1AWC A;  1ETV A;  4NNJ A;  2E35 A;  3L2R A;  1VND A;  4CO8 A;  3KEQ A;  3ZR8 X;  4DOZ A;  1HQC A;  2AO9 A;  3HSE A;  3F6O A;  1MW7 A;  4MFD A;  4XSZ F;  2LKP A;  3VOE A;  5BQT A;  2QSH X;  1OPC A;  2L02 A;  4EGZ A;  2L4A A;  4B47 A;  5LEJ A;  1U6G A;  1QO0 D;  3M07 A;  4FAS D;  4JK1 X;  4EM0 B;  5BMZ A;  4Y33 A;  1X58 A;  2JT1 A;  2HR3 A;  4U0W A;  3PL8 A;  4KJZ A;  2CQK A;  2HOT A;  2CSO A;  2XSD C;  3BTL A;  4HV6 A;  4PZJ A;  1Z77 A;  2IA0 A;  3ZXS A;  2E7W A;  1KZH A;  4LG0 B;  4I01 A;  5LFA A;  1FBU A;  4M3E A;  4AM3 A;  2Z9O A;  4ZZD A;  1LVA A;  2LY2 A;  2IGM A;  5B3S H;  5E1Z B;  3SEZ A;  1WI3 A;  3QU3 A;  3RPU D;  1XPX A;  1SAX A;  3QPH A;  3HM5 A;  4H0E A;  1JKO C;  4WXC A;  1TC3 C;  1FSE A;  4MQ9 F;  5IP7 J;  2VAS A;  1X3U A;  3BPV A;  3O8H A;  1I1G A;  5TGT A;  2KHM A;  1Z3Y A;  1MD0 A;  3P7N A;  2IA1 A;  3CDI A;  1SD7 A;  4ZTJ A;  4FQG A;  3HGG A;  2COM A;  3ZRG A;  3KP4 A;  2XF6 A;  4U0V A;  4OAZ A;  1SMY F;  4M6V A;  5CVU A;  4BH9 A;  5H2F C;  3I53 A;  2JA7 J;  4YIF A;  4MNU A;  2ELK A;  4CCM A;  3GTG J;  4NQW B;  4ENJ A;  2VT3 A;  1E17 A;  3CLQ A;  2TRT A;  4RAZ A;  5ILV A;  3NQO A;  5K7F A;  1JT6 A;  1MJ9 A;  2QZ8 A;  2X6W A;  1NH3 A;  1XS9 A;  3ECH A;  3E6B A;  2K4B A;  3P5J A;  1BC7 C;  2PQ8 A;  1S6L A;  2KLO A;  2XV4 S;  2B63 J;  1SVL A;  4A3F J;  2RGV A;  5BPI A;  2V1X A;  1ZEL A;  4WX9 A;  2JUG A;  2A68 F;  2JA2 A;  3CES A;  3BZK A;  2Y75 A;  4G8X A;  4AYB A;  3LL7 A;  2H1L A;  1KQ0 A;  3HIF A;  2LF8 A;  3K2Z A;  5GP9 A;  4A3J J;  1FT9 A;  4X1E A;  5FJ8 J;  5CVJ A;  2Z2S B;  1IV8 A;  1P4W A;  4P5O A;  2NYX A;  1D3Y A;  4WWC A;  3S1M J;  3AG4 H;  1WJE A;  4A0Z A;  2VUM J;  1FP2 A;  2IBD A;  4MTE A;  3FBI B;  4XRS G;  2JVG A;  1GT0 C;  3W6V A;  4I0B A;  4CCN A;  1I6X A;  2HQA A;  4G9Y A;  2OCC H;  3H36 A;  2OJE D;  2TCT A;  3TKY A;  3GZ5 A;  2F4M B;  3H1C A;  4CSW A;  2MD5 A;  1H8A C;  4GYI A;  2D1H A;  4PSW A;  4OIR F;  4UY8 I;  2O61 A;  2XPV A;  2HDC A;  5F0F A;  4CGZ A;  2R7S A;  2P8T A;  2HQR A;  3W6K B;  3MD2 A;  1DPU A;  2OBP A;  3Q9S A;  2D1V A;  3WGH A;  4C30 A;  1TT0 A;  3QP5 A;  2F5D A;  4RDU A;  3OWT A;  2DJN A;  2X6Y A;  2ZME A;  2QA4 I;  2RVC A;  5DD4 A;  1KU7 A;  1Z3X A;  3RCO A;  4BAY A;  3F23 A;  4HW0 A;  2EIK H;  3VYT B;  3ERM A;  2BBY A;  1OFC X;  1J2X A;  1IF1 A;  3OS2 A;  1AHD P;  4IHS A;  4KIS A;  3CJQ B;  4BYY A;  2HVR A;  3S15 J;  2HQN A;  3DF8 A;  5C3E J;  2LR8 A;  3HC7 A;  1QNT A;  2EB7 A;  3CCQ I;  4OIQ F;  1SAN A;  2DA1 A;  2Z5U A;  3HL2 A;  4A3C J;  3HKZ A;  1NG6 A;  1HST A;  2ZCW A;  1P6R A;  1UB9 A;  3CCJ I;  3GZN B;  5KK1 A;  5JHF A;  1GVD A;  2E5N A;  4XN3 A;  2QBY A;  1X1C A;  1K4S A;  2VPL A;  1UG0 A;  4S0H B;  4A3L J;  5ICC A;  4ZYG A;  4L9J A;  4BXU A;  3H3U A;  4AD9 A;  4A3E J;  2NNN A;  4LIT A;  2RNG A;  1LEA A;  2HVQ A;  3QYB A;  1YO5 C;  4RS8 A;  3MMY B;  2DO7 A;  1T39 A;  3VSL A;  4Y52 J;  5FKK A;  2N8G A;  1R5I D;  2Z1D A;  2KZV A;  2LF7 A;  2A5Y B;  4N9H A;  1BR2 A;  2KJB A;  1K4T A;  3D0S A;  3RKY A;  3HOW J;  3OYA A;  1FBS A;  1LDD A;  3W2W A;  3GTK J;  3QOP A;  1Y8Q B;  1YW7 A;  4EVI A;  5F04 A;  4EJT A;  1QRY A;  1J09 A;  3OYG A;  3BWG A;  3COA C;  4E7Z A;  4CCK A;  3AAF A;  2DPD A;  4BQN A;  3K9T A;  4UNO A;  1R4M B;  2LKS A;  4FET A;  4ESJ A;  3HOX J;  1IXR C;  1IN8 A;  4Q47 A;  1HLV A;  2OA4 A;  2PN6 A;  1WKM A;  2FF4 A;  1EV7 A;  1FY7 A;  3QOD A;  1RR8 C;  4P96 A;  3RPU A;  1QA6 A;  4ENM A;  3E5Q A;  4HOB A;  3QOE A;  1K7A A;  4PCQ A;  5E3M A;  1OLT A;  3JRF A;  4DYC A;  1LFU P;  2E2I J;  1U9O A;  4AID A;  1ACI A;  3I59 A;  1YIT I;  4Q4Z F;  1VQ6 I;  4UXN A;  4II3 A;  2DMT A;  1B72 A;  2LNB A;  1BN5 A;  3BTC A;  4UV9 A;  2ESH A;  1IZ1 A;  4RAY A;  3OS0 A;  4LFU A;  3JR9 A;  1O57 A;  2G7U A;  1QZE A;  3IH3 A;  3F8N A;  3TW6 A;  4PFP A;  3OL3 A;  1HA8 A;  3Q5F A;  2KIF A;  3WG9 A;  3S3M A;  4FX0 A;  3ZMD A;  4ANJ A;  2LD5 A;  1EH7 A;  2CUJ A;  1ERD A;  5FO5 A;  3TDZ C;  3ONQ A;  4PSX A;  3VYR B;  1YTY A;  2J5P A;  1IRF A;  2NOG A;  4HDU A;  3G2B A;  1IO2 A;  1P4X A;  2H6C A;  1IW7 F;  2ZJR F;  4JOM A;  3ZQG A;  1QVU A;  5ILU A;  1JGS A;  4BEH A;  1PP8 F;  2VT2 A;  3ZN1 A;  2VQC A;  3CQZ J;  2FNA A;  2DT7 B;  3A1Y A;  3I64 A;  2DTR A;  1FZP B;  1EJ9 A;  3S2D J;  5EJC A;  2CMP A;  4JX5 A;  4CA0 A;  1G3S A;  1MND A;  3HRU A;  3RIR A;  4KMF A;  2Y69 H;  1RUN A;  4QLC U;  2O8K A;  1M1E B;  4XSX F;  2ZXJ A;  2VBW A;  3C7J A;  2HYJ A;  3E0J B;  1V5F A;  1Z21 A;  2PBI A;  5C4J J;  3WGG A;  3R0A A;  1LE8 B;  1FBQ A;  3OYI A;  3I54 A;  2M8G X;  1HKS A;  2M0C A;  3KE2 A;  5M5X J;  4ZC3 A;  4R8H A;  1VQM I;  4EM1 A;  3ZQH A;  1BI3 A;  3RKW A;  2GXA A;  5B66 C;  3TOB A;  1IN6 A;  4EJO A;  3HHG A;  2ZSH B;  4A3G J;  2DA7 A;  3GTJ J;  3JAM Z;  3PNV A;  2Y2Z A;  2DDA A;  3KFW X;  4BNC A;  1TBX A;  2EH3 A;  1Y6I A;  2MC4 A;  4RB2 C;  2FQ3 A;  1FTZ A;  4I02 A;  1B6A A;  5E8I A;  2F48 A;  4DQ2 A;  4D9J A;  2K9L A;  1QZY A;  2WC2 A;  3RQI A;  1XN7 A;  4UV8 A;  2BEO A;  3CD6 I;  4QPQ A;  2FML A;  4JYK A;  4A5N A;  4E70 A;  4A0X A;  3ISP A;  2KT0 A;  3PSF A;  4MGR A;  1Z9C A;  3GFJ A;  1HKT A;  4KIF A;  2LBF B;  2CWE A;  5LGT A;  4B09 A;  2VKV A;  1OKR A;  2ISY A;  2UXN A;  3LSI A;  1NG7 A;  2L9R A;  1MBF A;  3K4L A;  2X6X A;  3WOD F;  1V4R A;  2XF7 A;  3CCY A;  2HYG D;  4MHG A;  5IT9 Z;  4ESB A;  2GZW A;  3CDL A;  2CG4 A;  3KIO A;  1CF7 A;  1KGS A;  3HTU A;  1G3W A;  1FP1 D;  1MIJ A;  2Y48 A;  3ZQQ A;  1BR4 A;  2VPR A;  1JGG A;  1KQ8 A;  4AYB N;  2OZU A;  1IRZ A;  4ABZ A;  5JI6 A;  2CQQ A;  3BR6 A;  4IQ4 A;  1ORK A;  1A35 A;  1KU9 A;  3V7S A;  3HOS A;  1QHH D;  4WF2 A;  2VBX A;  1UAA A;  3KEY A;  4LB5 A;  3PQJ A;  2NNY A;  3OSF A;  4U87 A;  2X6O A;  5DD8 A;  4HNV A;  2LSO A;  3JRI A;  2ZNY A;  3ECO A;  3L2V A;  4HX8 A;  3J80 K;  3B73 A;  2L9S A;  2VBZ A;  2D45 A;  1WI9 A;  4YEL A;  4IPA A;  5KAI C;  4BQQ A;  5LHI A;  5BOX A;  2VQH A;  2BVM A;  1G59 A;  4G6D A;  6PAX A;  2IS1 A;  1K6Y A;  1ZGJ A;  3DQV C;  4IEJ A;  1W5C C;  4V2G A;  3KET A;  2MSY A;  1ETO A;  2M0M A;  3NWS A;  3SZG A;  1SD4 A;  3BR5 A;  2I10 A;  3LAJ A;  3VYS B;  1OCR H;  4RAG A;  2JA6 J;  2LC2 A;  2R7D A;  4P9U A;  4IHX A;  4BJ6 C;  5FFZ A;  3GBG A;  4A0Y A;  4LGW A;  2LP0 A;  2ZKZ A;  1BI1 A;  1SEU A;  3QAH A;  3QU6 A;  1R58 A;  3OYB A;  3S2H J;  1R49 A;  2QQB A;  3CP2 A;  1RC9 A;  4L9T A;  4BHC A;  3QRF F;  3H9G A;  4IVN A;  1HDP A;  1BW5 A;  2IGN A;  1ONV A;  3BG9 A;  3GZ6 A;  1PYV A;  2JPB A;  4TV7 A;  3JTH A;  3TDU C;  3ULQ B;  1CQT A;  4HLY A;  1GV2 A;  1OYW A;  2B0L A;  3BC8 A;  4BQA A;  1E0E A;  3GTM J;  1RKT A;  3R4K A;  3I3L A;  3ERE D;  4LK0 F;  2XC7 A;  3HB9 A;  1UHS A;  1DGR M;  2CS3 A;  4RM3 A;  3JRH A;  1YG2 A;  3V8K A;  2O03 A;  4XKC A;  3HRM A;  3HKZ N;  5JLX A;  1XMK A;  2HOE A;  2RKH A;  3I5U A;  1MDM A;  1R1V A;  3C1D A;  3D5L A;  3BR3 A;  3BCA A;  4BHB A;  4A3B J;  3I4N J;  4N9I A;  2DXI A;  1AKH A;  4OIN F;  3OYK A;  2DFF A;  2H94 A;  4UB8 C;  1JKP C;  3CCV I;  2O7O A;  2VKH A;  2B9S A;  4XRS A;  4YIR X;  2R7Q A;  3PQK A;  4EJW A;  3WTU C;  3CC4 I;  3H5A A;  4M9X A;  1MSF C;  3K7A J;  2VOO A;  2DA6 A;  5KHD A;  1X1B A;  2AQE A;  4X0G A;  1Y39 A;  4ZYE A;  1XGN A;  4KIB A;  2JRT A;  3WTT C;  3GTQ J;  2X0L A;  2VXZ A;  4ENN A;  3IHU A;  1B8I A;  4PGH A;  3BOQ A;  3T5X A;  2QYO A;  3TBI A;  1KQ9 A;  1JTX A;  1W7P B;  2HXI A;  1J9I A;  1FNN A;  5J6X A;  2Y0S A;  1RR7 A;  1T6S A;  3K6G A;  3HOU J;  3ZQF A;  5E17 F;  2X9D A;  3LA3 A;  4I09 A;  5JVT A;  4XKW A;  4K2E A;  5EZG A;  4U7B A;  1VQ5 I;  1WCM J;  1ZQ3 P;  1ETQ A;  5EG0 B;  1A5J A;  5F1J A;  4HDV A;  2V1U A;  3LST A;  3U21 A;  2CJJ A;  4U88 A;  3SJM A;  1S72 I;  3KEO A;  2O6G E;  2AHQ A;  4LJZ F;  3GTO J;  3J7A Y;  5DM7 F;  3HPG A;  2R7W A;  2XRO A;  3LFU A;  1A04 A;  1N75 A;  2DYS H;  4B1R A;  2EA2 A;  4M9S A;  3MFK A;  1VQP I;  4WXH A;  5J47 A;  2M5W A;  1BM9 A;  3LSK A;  2HTS A;  1WJC A;  3P9I A;  1FEX A;  2MBF A;  2ID3 A;  2NVT J;  4AIK A;  2P5L C;  2HPI A;  2X51 A;  1VQO I;  2EQR A;  1HKQ A;  5BNG A;  4HQM A;  2DOE A;  5D4R A;  3OMY A;  2ME6 A;  4OIO F;  2DK8 A;  3J81 K;  1B9M A;  1LDK B;  2JSC A;  5GAH J;  3DBR B;  3JRG A;  2EIL H;  2F2E A;  4LIV A;  4CYC B;  2A6E F;  4PJL A;  3ABT A;  4E7S A;  1Z6T A;  2RQP A;  2M7B A;  2XAQ A;  4I99 C;  2MC3 A;  4FHT A;  1GXQ A;  2LH9 A;  3G3Z A;  2OV7 A;  2A05 A;  3BT9 A;  1GV5 A;  5L3G A;  3A2K A;  2EFP A;  4ITV A;  3PUF A;  3DWL E;  2K02 A;  1UHW A;  3MZ8 A;  4Y15 A;  3E5X A;  5HLT A;  3BP8 A;  2W48 A;  4YG2 F;  1ON1 A;  1XG1 A;  4RLF A;  3CTA A;  4RM2 A;  2IS4 A;  3H9Q A;  3JW4 A;  4LMY A;  3H9J A;  4MQV A;  2ZXH A;  3D5R C;  2W1O A;  3CCE I;  1ITY A;  1F43 A;  2YSR A;  2R5Z B;  3G71 I;  4G7Z F;  3PO3 J;  1VQ8 I;  2CV0 A;  3EUA A;  1IUF A;  1AOY A;  1IN5 A;  2CUF A;  1TTY A;  3G73 A;  3U1D A;  2GIZ A;  4F3Q A;  1WH7 A;  5FKO A;  5F0H A;  2W57 A;  5GAG J;  3V7C A;  3RZD J;  1K78 A;  2WY8 Q;  3TW7 A;  3WU0 A;  5GAE J;  5HS8 A;  2M4K A;  4CIC A;  3OIP A;  4I0A A;  3PUB A;  5ICE A;  2NS7 A;  3M4O J;  3VPR A;  1H0M A;  3DEU A;  5IP6 A;  2V7F A;  2AQF A;  1N25 A;  3BG5 A;  4YII A;  1F4K A;  4RB3 C;  2XIG A;  3TMO A;  1MGT A;  3CCR I;  2YR2 A;  4ESF A;  4AIH A;  2NS0 A;  2XB5 A;  2VON A;  3RYP A;  1VQ4 I;  1P2F A;  4E7I A;  3H92 A;  4IRI A;  5DM6 F;  1Z7U A;  3R60 A;  5IOY A;  1SC7 A;  3V7R A;  2CGP A;  5GAD J;  3PIO F;  5BPD A;  3H3Z A;  4A3K J;  4ETS A;  1Z7L A;  3W2V A;  5FB2 A;  3GME A;  4BE2 A;  2P6T A;  5J40 A;  3BG3 A;  1FTT A;  2ACJ A;  1FOW A;  2KJC A;  1FYL A;  3I56 I;  1XMA A;  1T95 A;  3IAS 2;  2EZI A;  1ZRE A;  3L7W A;  2WB1 A;  4MLO A;  4LB6 B;  3DV8 A;  1R9T J;  2MAB A;  2K3F A;  2MFZ A;  3DLL F;  1Y1V J;  2WBM A;  1RNL A;  2E34 A;  4M6X A;  3FK6 A;  3ABK H;  3FMS A;  1JUP A;  3DKY A;  4A2U A;  4D5F A;  1DP7 P;  4CHU A;  3FXL A;  3MN2 A;  4CCL A;  1NK3 P;  1I50 J;  4EAT A;  3S32 A;  2EFO A;  1IN7 A;  4DZP A;  4BY7 J;  1W0U A;  2LG4 A;  4AWX B;  5GPA A;  3JRE A;  5JR3 A;  5DUI A;  4KIG A;  2M45 A;  4G7H F;  1PDN C;  1U9N A;  1ETY A;  5D5W B;  1GUU A;  3CF5 F;  4G12 A;  2BY1 A;  1H89 C;  2V9K A;  1BL0 A;  2KIU A;  3PSI A;  4RLQ A;  3RJP A;  1GXP A;  4S05 A;  5DCM B;  5E3L A;  1YLF A;  1QGP A;  1T0F C;  1DUX C;  3ESW B;  3CUQ B;  3SZT A;  2GQQ A;  1JI8 A;  3OL4 A;  3OYF A;  2K27 A;  4KFC A;  3SYT A;  3QWL A;  2K86 A;  1FWZ A;  1HXD A;  3D1N I;  1A31 A;  2ME0 A;  1KU2 A;  2P5K A;  3JAM K;  2EIN H;  2FOK A;  2L3D A;  4E7K A;  4GRI A;  3OR1 C;  2FU4 A;  2OCE A;  2DFI A;  2LOO A;  2W85 A;  2IGO A;  2XPW A;  3BPX A;  4CCJ A;  4I6Z A;  1IC8 A;  5EEG A;  4B44 A;  4OU0 A;  3EUH A;  1Z05 A;  2DAO A;  5IT3 A;  4A69 C;  3CP8 A;  1HBX G;  2IT0 A;  5A2Q Z;  1UCR A;  1U78 A;  2EIJ H;  4BE0 A;  3CMM A;  3LAP A;  2JQ7 A;  4AUX A;  4ENK A;  1FIA A;  5F0C A;  1JJ8 C;  3G1O A;  1D0Z A;  5FRM A;  5L3B A;  3SEQ A;  4BUP A;  2M2E A;  1LJ9 A;  2A3S A;  5IT9 K;  5L3E A;  3LSH A;  1R36 A;  2RAE A;  4XMY A;  4EEF G;  4FE7 A;  1G4D A;  1P92 A;  5HLH A;  4I7H A;  1YIJ I;  3C18 A;  3H5N A;  2STT A;  4RB0 A;  4XLA A;  4BJ5 C;  2W24 A;  3MKL A;  2BY0 A;  3HOZ J;  2F5V A;  4HEA 2;  4JBA A;  3KZY A;  2K9Q A;  1RZ4 A;  3A03 A;  3DU6 A;  2VQG A;  4ZZL A;  4NHJ A;  3I55 I;  1B4A A;  3C3W A;  3E7L A;  2QF7 A;  2Y0S N;  1ZG5 A;  2KDO A;  3ZOB A;  1GHC A;  4BDZ A;  2NRA C;  2E7X A;  3L1P A;  5LRS A;  1FMW A;  3ZCO A;  3CO7 C;  2ZFU A;  3A0B C;  3HUG A;  3FIW A;  4GCV A;  1JKQ C;  2CQN A;  4S04 A;  4IOC F;  2OF7 A;  3CUQ C;  3LSR A;  2D5V A;  3N4M A;  3GFL A;  3AG2 H;  1OCP A;  3L2C A;  1YHQ I;  2E5Z A;  5EGO A;  2E19 A;  5M5W J;  1DGW Y;  2L9V A;  2OZ6 A;  3J81 Z;  3J7Z I;  2KZG A;  2DA2 A;  3OIQ A;  3OIO A;  2EPF A;  4FT8 A;  1HSJ A;  3IKV A;  1N78 A;  2HFH A;  2DA4 A;  1RPW A;  1AA7 A;  2VBY A;  1FSH A;  3BTJ A;  2LY1 A;  1GVJ A;  2YX7 A;  3OYN A;  2ICW G;  3EQL F;  3SXY A;  1ENH A;  5ED4 A;  1D0Y A;  3S17 J;  4IX7 A;  1ZH5 A;  1TP4 A;  5TIS C;  3F8M A;  2QM3 A;  3H0G J;  2ZO4 A;  4I76 A;  1FIP A;  1LFB A;  2EZH A;  2Q1Z B;  2QKL B;  1YW9 A;  4IL6 C;  3DBH B;  3K4M A;  1MH4 A;  4B48 A;  4RGS A;  1ZG3 A;  1X1A A;  3ABL H;  2X48 A;  1APL C;  2A61 A;  3I9V 2;  4GO1 A;  3FMQ A;  3HRS A;  3I58 A;  2KIQ A;  2OU2 A;  4XLH A;  4A3M J;  1XSV A;  4PGG A;  2YU3 A;  3OSG A;  5TJJ A;  3GW2 A;  3S8P A;  3E6M A;  5KVR A;  4HNU A;  2FEZ A;  5F08 A;  2ZXW H;  2F4O B;  2FE3 A;  2KKO A;  4IF4 A;  5J1R A;  3CUO A;  2CQX A;  2E36 A;  5IY5 H;  1BOA A;  1P7I A;  3FBN B;  1XSD A;  4Q5S F;  2E2H J;  3JRA A;  4WCG A;  5CPR B;  2FBK A;  1YJ9 I;  2XRL A;  1IDZ A;  2QQ8 A;  2P7C B;  4A93 J;  2ZME B;  5ERI A;  4XQF A;  2QUF A;  2CH0 A;  3BR0 A;  1L3L A;  4M74 A;  2Q2E A;  2ECB A;  2MD0 A;  3ZMU A;  3TED A;  1WSU A;  2FQ4 A;  1OYY A;  3K10 A;  2DQL A;  1VTN C;  4XR6 A;  4UVA A;  1QBJ A;  3LA2 A;  2P4W A;  1X1D A;  2YU9 J;  1STZ A;  3S16 J;  2BV6 A;  3FXO A;  5ILS A;  1T8I A;  2QWW A;  4CZC A;  1SD5 A;  3KZI C;  4IHT A;  2JUC A;  3TOA A;  5E18 F;  1XGS A;  2BW3 A;  2WAF A;  4F93 B;  1HC8 A;  1W7P D;  2M3A A;  2I8D A;  3P9C A;  3ZMS A;  1DU0 A;  2PMZ A;  1I5Z A;  1X3Z B;  4MEY F;  3LSP A;  3KPH A;  3VEP A;  2MH2 A;  2QBY B;  4JX6 A;  2VL8 A;  1RUO A;  5ICG A;  3U1K A;  3KP5 A;  5FLV A;  1KA8 A;  1J0R A;  3QQA A;  2JRM A;  4IOA F;  5AON A;  3IV5 A;  2IVM A;  2X1C A;  2XVC A;  4M6Y A;  5EYR A;  2R7T A;  5L3C A;  1LPQ A;  1EH6 A;  1E3O C;  2R3S A;  4HBL A;  2A6H F;  4CDG A;  3GVA A;  1YIO A;  1DU6 A;  2KRH A;  1T33 A;  2FXA A;  4OMY A;  4BE1 A;  1D1C A;  2PMU A;  1FMV A;  1R1U A;  1WFX A;  2WTE A;  3FXK A;  1BBY A;  3CCM I;  4ZDP A;  4Y3O A;  4PJN A;  4DJA A;  3OOP A;  3P9K A;  2M8E A;  2VJI A;  4D7N A;  5AIP A;  1DP3 A;  3WHC A;  5CJ9 A;  5C44 J;  3S1N J;  2WB1 N;  1HW1 A;  1ZHF A;  3FXU A;  4DBR A;  3BCB A;  5KCM A;  3QPT A;  3A01 A;  1OCT C;  4Z6Y A;  5IP9 J;  2FNP A;  5GPC A;  5DDG A;  2OQR A;  2W82 A;  2ZME C;  2JVH A;  3WE3 A;  5J4Y A;  4G6T B;  3HJE A;  2CYY A;  2K9M A;  2GA2 A;  3F0C A;  4RGX A;  4BS9 A;  5HLG A;  4LLN A;  2DQR A;  2WAQ A;  2E1C A;  2BY3 A;  3OYE A;  4F52 A;  2QEX I;  1UG2 A;  2UUZ A;  4C3J J;  3EYY A;  3I59 B;  1W5S A;  1RES A;  2GBY A;  5E1X A;  2LFB A;  4ZYA A;  1B72 B;  1VQ7 I;  4FE4 A;  4E7J A;  1OR7 A;  2HI3 A;  5CVV A;  4HNT A;  2ZSI B;  2XAU A;  1S5L C;  5LGU A;  2Z16 A;  3E5U A;  2GLO A;  3GUD A;  5CLS A;  1IRX A;  3LQR A;  5DV5 A;  2HPM A;  5GTH C;  3K2A A;  4HF2 A;  1TT5 B;  3BZC A;  5EEH A;  3E6D A;  4U0Y A;  3WGI A;  1BJA A;  5D5V B;  1XCV A;  3ZQI A;  5D5U B;  2ZJQ F;  1PUF A;  2JWT A;  2DFH A;  1SFX A;  3DFG A;  4EMS A;  1IV6 A;  4MEX F;  1BC8 C;  4CH7 A;  2R7O A;  3D5S C;  5LHG A;  1GLN A;  5FLX Z;  4R79 A;  2K7L A;  3JTG A;  2VOD A;  1E3H A;  2X1E A;  2BY2 A;  5J3L A;  2NVY J;  4BEH B;  1SFE A;  4XON A;  3J7A O;  1BW6 A;  4AIJ A;  1X2N A;  5E3N A;  2K85 A;  3BR1 A;  3V8L A;  3V4G A;  1T2K A;  2VE8 A;  3IH4 A;  3M9A A;  3O2P E;  3LMM A;  1K61 A;  3TP3 A;  1MNM C;  2HKX A;  2IPQ X;  3F72 A;  5HDN A;  4XLP F;  3VDX A;  3KP7 A;  2GXB A;  4PFO A;  4XLE A;  4L0Y B;  1FOY A;  3ZQ7 A;  3BG7 A;  2VN2 A;  3WTX C;  2R93 J;  2R5Y A;  1G6N A;  1A6I A;  3QPS A;  4X6A J;  2WA0 A;  1BR1 A;  2W4S A;  1O7L A;  4KN4 X;  2DN0 A;  3EUK L;  4B3X A;  1W36 C;  2GIV A;  2QEN A;  2UZK A;  1ZK8 A;  3IP4 B;  1OCZ H;  3LSJ A;  1OMI A;  3CJN A;  4LOC A;  4EV0 A;  3EYI A;  3CJT B;  2OAZ A;  1K83 J;  5JVG F;  4UUS A;  1FC3 A;  3K1M A;  3R61 A;  4MO7 A;  2QSF X;  1I3A A;  4XIC A;  1X4O A;  5H20 A;  1Q1H A;  4RGU A;  1NK2 P;  1Z67 A;  3LSG A;  1IGN A;  2DTZ A;  3RYR A;  3TP0 A;  4KIC A;  2LRE A;  1FYM A;  3T0Y A;  5IYB J;  2OUM A;  1PUF B;  1A36 A;  3K1P A;  3K4C A;  3SFI A;  3HTS B;  4GYG A;  3M1E A;  3DKX A;  2BXZ A;  4ZH4 F;  1QZZ A;  2EWN A;  1OIS A;  1UFM A;  2M34 A;  3WE2 A;  3CO6 C;  3K4N A;  4KYW A;  1L0O C;  2YUS A;  2E2J J;  3OYL A;  1JUS A;  2W25 A;  1CF7 B;  3TO6 A;  1MMA A;  1USS A;  2V79 A;  3FZV A;  3HZJ A;  3T8T A;  3HBL A;  1VQL I;  2Y0M A;  1YJN I;  2NXN B;  3ABU A;  1XDS A;  3QYF A;  5H6R A;  3MAJ A;  2OQG A;  1Z0X A;  2AXT C;  2PJP A;  2Y31 A;  2PJR A;  1V54 H;  2YPR A;  3VWB A;  1S9H A;  3FWE A;  3VB2 A;  1G3Y A;  1DDN A;  1FJL A;  5BS6 A;  3K4J A;  4RMN A;  2OC6 A;  2ZB9 A;  2LYC A;  1IUY A;  2FOW A;  1ZTR A;  4M71 A;  1BIB A;  4HX7 A;  1FPQ A;  2BHZ A;  3A4C A;  3B6C A;  1B9N A;  2JSP A;  2RC4 A;  4E6K G;  2QQA A;  5IYC J;  2FSW A;  5HDG A;  2UV1 A;  1D1B A;  3PM1 A;  1UHM A;  5FKM A;  2K9S A;  5J8F A;  3L9F A;  2BVL A;  4QWQ A;  3DTK A;  5A2Q K;  3OV8 A;  1U5T A;  2IW5 A;  3UKG A;  3IUO A;  1ETK A;  3K4K A;  2DYR H;  1ZGA A;  3GX4 X;  2TDX A;  4E7H A;  2IGK A;  2P5V A;  4F91 B;  4BAC A;  3L2U A;  2IA2 A;  2G7H A;  2Q8K A;  1FOX A;  1FLI A;  1JUM A;  1JE8 A;  4XK4 A;  2XKO A;  3SDB A;  2MW8 A;  4BKX A;  5D4S A;  5GTI C;  4BXF A;  2FUG 2;  1DPR A;  1R4N B;  2EFQ A;  3KP6 A;  2DCE A;  4JQF A;  4PJM A;  2DBB A;  3HDD A;  1EH8 A;  2DJI A;  3KYL A;  1Q1V A;  2CW0 F;  4IJA A;  1TWG J;  1POG A;  2Z3Y A;  1QU3 A;  1PVE A;  1RET A;  5K7H A;  1R22 A;  3L09 A;  4XLN F;  2NVX J;  1OCC H;  4BXX J;  2NOJ B;  4FCY A;  1ZRD A;  2L54 A;  4HAM A;  1MDM B;  5D8K B;  3FKI J;  4RBO A;  1P7J A;  2PMZ N;  4IHV A;  2H1K A;  3C2H A;  3E6C C;  4HSR A;  2PLY A;  1VI0 A;  5B5E C;  2ISZ A;  3F8F A;  1AKH B;  3E1S A;  4DIQ A;  1SAU A;  4G6Q A;  1YYV A;  1Z91 A;  2VXD A;  1MNE A;  2PEX A;  3EDP A;  1JJ6 C;  2H09 A;  1UMQ A;  3GCM A;  4Y17 A;  4G7O F;  5CQE A;  5LBQ A;  3QPL A;  2CRG A;  2MLG A;  4CYD A;  2O0Y A;  3K0L A;  4O5V A;  2OD5 A;  4OOI A;  4UUT A;  4NB5 A;  1B8I B;  2BYV E;  1O3T A;  2CFO A;  4UUV A;  2MA3 A;  3V42 A;  4C2M J;  2L7M P;  2JA8 J;  4J19 A;  2PG4 A;  3H3V K;  1J7K A;  4MIM A;  4II2 A;  1SFO J;  5B1A H;  2MH9 A;  3AKZ A;  2IP2 A;  1H9G A;  3GWZ A;  3KX2 A;  2JK3 A;  2ESN A;  3OY9 A;  5E3O A;  3TGN A;  3UR3 C;  1BI0 A;  4M3G A;  5IOZ A;  2VJJ A;  3U2R A;  1YOV B;  3WTZ A;  4YFX F;  3LSM A;  2EIM H;  3PFY A;  1T38 A;  4A6D A;  3BDD A;  1UZC A;  3G4S I;  3ZPL A;  2WAQ N;  3UNG C;  2IS2 A;  3GTL J;  4M9Z A;  2LY9 A;  2XUB A;  2L7F P;  3N05 A; 
#chains in the Genus database with same CATH homology
 4HX4 A;  3IWZ A;  5CVR A;  2GXG A;  2HZT A;  5TRD A;  3ZMT A;  2ZBK A;  5FGM A;  1U8R A;  1FX7 A;  3ELK A;  3E97 A;  3R0J A;  2DU9 A;  1I1S A;  3DPT A;  1IXS B;  4UVB A;  4L5I A;  2EJR A;  1ON2 A;  2W84 A;  2MLK A;  4LG0 A;  2DT5 A;  3ML6 A;  1ZYR F;  1O3R A;  4P55 A;  3DPL C;  3I0T A;  2V9V A;  2M1B A;  1YS7 A;  1XGO A;  4KA4 A;  2HGC A;  5JFR A;  1W5T A;  4UHT A;  1YFH A;  1MJB A;  5JHU A;  2QQ9 A;  3MQ0 A;  5D8L B;  3NEU A;  1O7F A;  2QLZ A;  4ASN A;  4HV5 A;  4NQW A;  3IRQ A;  3MEX A;  1PP7 U;  1K78 B;  3FM5 A;  4ON0 A;  4RB1 A;  4Y13 A;  2ELH A;  3SQN A;  1TLH B;  2QVO A;  4HA8 A;  2XKP A;  4KMU X;  2GWR A;  2F5C A;  1ULY A;  2L01 A;  5E20 A;  1XB4 A;  1D8J A;  3JSP A;  3F3X A;  4HLX A;  4L9V A;  2V1D A;  3TO9 A;  1R5G A;  2J5O A;  1J5Y A;  5L3F A;  1WWX A;  5HOO A;  2A07 F;  1TW3 A;  2XAH A;  3ROU A;  3RTR A;  3HYI A;  1KYZ A;  3BJA A;  1TQI A;  1SMT A;  2ADU A;  4CZZ A;  4GGG A;  5FLX K;  1JHH A;  2EV5 A;  2HTJ A;  3LA7 A;  4LLL A;  2BE5 F;  1B1B A;  1QPM A;  4D0P A;  4M73 A;  1J75 A;  2EV6 A;  3O6B B;  4L0Z B;  3U9G A;  2XAF A;  1I27 A;  1HW2 A;  4L18 B;  4FX4 A;  1TW2 A;  4IRH A;  5J8C A;  2F5F A;  2JPC A;  2DPU A;  4EM2 A;  2E1N A;  1ZN2 A;  2KRF A;  3WTW C;  2VC0 A;  4YFN F;  2CFX A;  2FBI A;  1YQA A;  5F64 A;  1H9T A;  2WWY A;  3BY6 A;  1TQP A;  5K5O A;  4L5J A;  2G9W A;  2WV0 A;  2AS5 F;  1JXS A;  3HSF A;  4XBF A;  1T98 A;  1IAW A;  1ZG1 A;  3DXJ F;  2ZFW A;  4OIP F;  1JHF A;  1ZAO A;  3T8R A;  4ZYH A;  3VFZ A;  4HF1 A;  2DK5 A;  4AVP A;  3CLO A;  4I98 B;  3ZMV A;  1FYK A;  3F8C A;  1XSX A;  4IRG A;  4O6J A;  4HYE A;  1WRJ A;  1LB2 A;  5LHH A;  2RNJ A;  2XAS A;  1ZAR A;  2R7F A;  1P4A A;  5E8G A;  1SD6 A;  1ZRC A;  3M8F A;  5HLI A;  5D6E A;  2O8X A;  3T1B A;  4EJU A;  2V6C A;  1U3E M;  1WQ2 A;  3GFM A;  3IWF A;  5DUK A;  3QP6 A;  3EET A;  1XCB A;  2AXL A;  3SZP A;  3E3V A;  3FF5 A;  5L3D A;  5FD5 A;  1R7J A;  3K1N A;  1U2W A;  4OMZ A;  3PFI A;  1MJA A;  2M87 A;  3GYH X;  4A5M A;  3ZP5 A;  2JZY A;  2HWV A;  3TQN A;  1QQI A;  4MTD A;  1Z6R A;  1F1Z A;  4Q48 A;  3ZN0 A;  4KN7 X;  3WTS C;  2P7V B;  1UST A;  3F22 A;  2XGX A;  3BJO A;  3CDH A;  3M8E A;  2O3F A;  2GA1 A;  1HW5 A;  3DKW A;  4IXA A;  3SHF A;  5LGN A;  1F9N A;  1NHA A;  1R00 A;  2NAZ A;  4KUM A;  3IKT A;  1S8N A;  2EA4 A;  2FRH A;  2X4H A;  3JSO A;  1F5T A;  2HYF A;  5D6F A;  1CGP A;  2EV0 A;  1LNW A;  1RI7 A;  5DYM A;  3V8J A;  1FOK A;  3MWM A;  2PI0 A;  2HKO A;  1MZB A;  1Y0U A;  1LEB A;  3KLN A;  3FMR A;  4R1H A;  2STW A;  3MCZ A;  2XHK A;  3R6S A;  3FHZ A;  1ZLK A;  4G94 A;  5LLQ A;  3RKX A;  4A6E A;  4U7D A;  3TO7 A;  3B02 A;  2DLL A;  4F7Z A;  4UVC A;  3HHH A;  1E2X A;  3MZH A;  4N0B A;  2HS5 A;  1D5V A;  2YX4 A;  3W6J B;  2ZJ2 A;  1D8K A;  3LWF A;  3GFI A;  3GLX A;  1KYW A;  3FX3 A;  2IRF G;  3L00 A;  3F21 A;  1IRG A;  2C6Y A;  4KT5 C;  1B59 A;  3FXQ A;  3HRT A;  5D5X B;  5F1R A;  5HVQ C;  2FA5 A;  4LK1 F;  3M7G A;  2LDU A;  2EK5 A;  1ZRF A;  4CXF A;  5K1Y A;  4L9N A;  4A12 A;  1IXC A;  3REO A;  1S7O A;  3MZY A;  4LLG F;  3BZ6 A;  4YFK F;  4O3M A;  3DP7 A;  3NRV A;  4LD5 A;  4HF0 A;  4KNY A;  1O3Q A;  1REP C;  5ICF A;  2P6S A;  4RGR A;  3IRR A;  5H6Q A;  3O3K A;  1K79 A;  1ZLJ A;  1XDU A;  1XGM A;  3F6V A;  3IL2 A;  3N97 A;  2GAU A;  2F5E A;  1W7P A;  3RPQ A;  3RI4 A;  1RIO H;  1TNT A;  4KDP A;  3Q9V A;  4EGY A;  5CVI A;  4HQE A;  2EFW A;  5E1W A;  3LFK A;  5AIQ A;  2L4M A;  3GF2 A;  1MKM A;  1PUE E;  2DI3 A;  4EQQ A;  4DNC A;  4EJV A;  3BJ6 A;  3KLO A;  4B8X A;  5LRR A;  3KCC A;  1BIA A;  1R1T A;  3HSR A;  1SFU A;  1YS6 A;  4M72 A;  1G3T A;  1R23 A;  1S3J A;  4GXO A;  4ZYD A;  2VE9 A;  5HS7 A;  4WK8 F;  3IC7 A;  2UWM A;  3SFZ A;  5DEQ A;  1LQ1 A;  2RDP A;  3I4P A;  2KIM A;  3KP2 A;  3KZZ A;  4XRF A;  1LDJ A;  1BI2 A;  2A69 F;  2RN7 A;  1O3S A;  2VC1 A;  3GO5 A;  5HS9 A;  4PDK A;  1S29 A;  3WTV C;  4HZF A;  5CYV A;  1IN4 A;  2FMY A;  1U5T B;  2HEO A;  4I2O A;  1XD7 A;  3RDI A;  2M30 A;  2FBH A;  1T0F A;  3ZMZ A;  3GXO A;  3I71 A;  5DCF A;  2Z33 A;  2K4J A;  1J59 A;  2Q0O A;  2VOP A;  2UXX A;  1W4M A;  2JTV A;  3BRO A;  2H27 A;  3GEZ A;  1S7A A;  1C0W A;  1TNS A;  5FFX A;  2DW4 A;  1R5H A;  3K69 A;  3VOD A;  1TQM A;  2PFB A;  4P9F A;  5FD6 A;  4BHP A;  2IJL A;  1K6O A;  5HDK A;  2ZNZ A;  5F6F A;  1YW8 A;  3WU1 B;  3HOT A;  2RV8 A;  2XRN A;  3FM3 A;  2XAJ A;  2EFN A;  2H6B A;  5LEK A;  2PMH A;  1OYI A;  1U5T C;  2BGC A;  4WXD A;  1KU3 A;  3F8B A;  2D2W A;  1ODD A;  3LQQ A;  2Z99 A;  2XAG A;  5DCM A;  1Z1D A;  3FXR A;  2CO5 A;  5K5Q A;  5K5R A;  3S2W A;  3KP3 A;  3CUQ A;  1V3F A;  2ETH A;  3WTY C;  4Z2Y A;  3J80 Z;  1AWC A;  4CO8 A;  3KEQ A;  1HQC A;  3HSE A;  3F6O A;  4XSZ F;  5BQT A;  2LKP A;  3VOE A;  1OPC A;  2L02 A;  4EGZ A;  2L4A A;  5LEJ A;  1U6G A;  1QO0 D;  4JK1 X;  4EM0 B;  5BMZ A;  2JT1 A;  2HR3 A;  4U0W A;  2CQK A;  2CSO A;  4HV6 A;  4PZJ A;  2IA0 A;  2E7W A;  4LG0 B;  4I01 A;  1FBU A;  2Z9O A;  4ZZD A;  1LVA A;  5E1Z B;  3QU3 A;  1SAX A;  3QPH A;  4H0E A;  4WXC A;  1FSE A;  4MQ9 F;  1X3U A;  3BPV A;  1I1G A;  1MD0 A;  3P7N A;  2IA1 A;  1SD7 A;  2COM A;  3KP4 A;  4U0V A;  1SMY F;  5CVU A;  4BH9 A;  3I53 A;  4YIF A;  4MNU A;  4ENJ A;  2VT3 A;  1E17 A;  4RAZ A;  5ILV A;  3NQO A;  1MJ9 A;  2QZ8 A;  3ECH A;  3E6B A;  2K4B A;  1BC7 C;  2PQ8 A;  1S6L A;  2XV4 S;  2RGV A;  5BPI A;  2V1X A;  4WX9 A;  4G8X A;  2A68 F;  2Y75 A;  1KQ0 A;  3HIF A;  2LF8 A;  3K2Z A;  1FT9 A;  5CVJ A;  1P4W A;  4P5O A;  2NYX A;  1D3Y A;  4WWC A;  4A0Z A;  1FP2 A;  4MTE A;  4I0B A;  1I6X A;  4G9Y A;  3TKY A;  3GZ5 A;  2MD5 A;  4GYI A;  2D1H A;  4OIR F;  2O61 A;  2HDC A;  4CGZ A;  2P8T A;  2HQR A;  3W6K B;  1DPU A;  2OBP A;  3Q9S A;  2D1V A;  3WGH A;  3QP5 A;  2F5D A;  2ZME A;  2RVC A;  5DD4 A;  1KU7 A;  4BAY A;  3F23 A;  4HW0 A;  2BBY A;  1J2X A;  1IF1 A;  4IHS A;  4BYY A;  2HQN A;  3DF8 A;  1QNT A;  2EB7 A;  4OIQ F;  2Z5U A;  1HST A;  2ZCW A;  1P6R A;  1UB9 A;  5KK1 A;  2QBY A;  5ICC A;  4ZYG A;  4L9J A;  4BXU A;  3H3U A;  4AD9 A;  2NNN A;  1LEA A;  1YO5 C;  4RS8 A;  2DO7 A;  1T39 A;  2LF7 A;  2A5Y B;  4N9H A;  2KJB A;  3D0S A;  3RKY A;  1FBS A;  1LDD A;  3QOP A;  1YW7 A;  4EVI A;  4EJT A;  3BWG A;  3COA C;  3AAF A;  2DPD A;  3K9T A;  4UNO A;  4ESJ A;  1IXR C;  1IN8 A;  4Q47 A;  2OA4 A;  2PN6 A;  1WKM A;  2FF4 A;  1EV7 A;  1FY7 A;  4P96 A;  3RPU A;  4ENM A;  3E5Q A;  4HOB A;  1K7A A;  4PCQ A;  3I59 A;  4Q4Z F;  4UXN A;  2LNB A;  1BN5 A;  4UV9 A;  2ESH A;  1IZ1 A;  4RAY A;  4LFU A;  1O57 A;  2G7U A;  3F8N A;  3Q5F A;  2KIF A;  3WG9 A;  4FX0 A;  3ZMD A;  1EH7 A;  5FO5 A;  3TDZ C;  1YTY A;  2J5P A;  1IRF A;  4HDU A;  1P4X A;  2H6C A;  1IW7 F;  5ILU A;  1JGS A;  1PP8 F;  2VT2 A;  3ZN1 A;  2FNA A;  3I64 A;  2DTR A;  1FZP B;  1G3S A;  3HRU A;  3RIR A;  4KMF A;  1RUN A;  4QLC U;  4XSX F;  2ZXJ A;  2VBW A;  3C7J A;  2PBI A;  3WGG A;  3R0A A;  1FBQ A;  3I54 A;  1HKS A;  3KE2 A;  4R8H A;  4EM1 A;  1BI3 A;  3RKW A;  3TOB A;  1IN6 A;  4EJO A;  3HHG A;  3JAM Z;  3KFW X;  4BNC A;  1TBX A;  4RB2 C;  2FQ3 A;  4I02 A;  1B6A A;  5E8I A;  4DQ2 A;  1QZY A;  2WC2 A;  1XN7 A;  4UV8 A;  2BEO A;  2FML A;  4A5N A;  4E70 A;  4A0X A;  3ISP A;  1Z9C A;  4MGR A;  3GFJ A;  1HKT A;  4KIF A;  5LGT A;  2CWE A;  4B09 A;  1OKR A;  2ISY A;  2UXN A;  3WOD F;  1V4R A;  2HYG D;  4MHG A;  5IT9 Z;  4ESB A;  2GZW A;  2CG4 A;  1CF7 A;  1KGS A;  3HTU A;  1G3W A;  1FP1 D;  2Y48 A;  1KQ8 A;  2OZU A;  5JI6 A;  1KU9 A;  3V7S A;  3HOS A;  4WF2 A;  2VBX A;  4LB5 A;  3PQJ A;  2NNY A;  5DD8 A;  2LSO A;  2ZNY A;  3ECO A;  4HX8 A;  3J80 K;  3B73 A;  2VBZ A;  2D45 A;  1WI9 A;  4IPA A;  5LHI A;  5BOX A;  4G6D A;  6PAX A;  1ZGJ A;  3DQV C;  3KET A;  1SD4 A;  3LAJ A;  2R7D A;  4P9U A;  5FFZ A;  4A0Y A;  4LGW A;  2ZKZ A;  1BI1 A;  3QAH A;  3QU6 A;  1R58 A;  2QQB A;  4L9T A;  4BHC A;  3QRF F;  4IVN A;  1ONV A;  3GZ6 A;  4TV7 A;  2JPB A;  3TDU C;  3JTH A;  3ULQ B;  4HLY A;  1OYW A;  2B0L A;  4BQA A;  3R4K A;  3ERE D;  4LK0 F;  1YG2 A;  3V8K A;  2O03 A;  3HRM A;  1XMK A;  2HOE A;  2RKH A;  3I5U A;  1MDM A;  1R1V A;  3C1D A;  3D5L A;  4BHB A;  4N9I A;  4OIN F;  2H94 A;  3PQK A;  4EJW A;  3WTU C;  4M9X A;  2VOO A;  4ZYE A;  1XGN A;  4KIB A;  2JRT A;  3WTT C;  2X0L A;  2VXZ A;  4ENN A;  3IHU A;  4PGH A;  3BOQ A;  3T5X A;  2QYO A;  1KQ9 A;  1W7P B;  1J9I A;  1FNN A;  5J6X A;  1T6S A;  5E17 F;  3LA3 A;  4I09 A;  5JVT A;  4K2E A;  4U7B A;  4HDV A;  2V1U A;  3LST A;  4U88 A;  3KEO A;  2O6G E;  4LJZ F;  2XRO A;  1A04 A;  2EA2 A;  4M9S A;  3MFK A;  4WXH A;  2M5W A;  1BM9 A;  2HTS A;  3P9I A;  2MBF A;  4AIK A;  2P5L C;  1HKQ A;  4HQM A;  5D4R A;  4OIO F;  2DK8 A;  3J81 K;  1B9M A;  1LDK B;  2JSC A;  2F2E A;  2A6E F;  3ABT A;  1Z6T A;  2RQP A;  2XAQ A;  2MC3 A;  4FHT A;  1GXQ A;  3G3Z A;  5L3G A;  2EFP A;  2K02 A;  1UHW A;  4Y15 A;  3E5X A;  3BP8 A;  4YG2 F;  1ON1 A;  3CTA A;  4LMY A;  3JW4 A;  4MQV A;  2YSR A;  4G7Z F;  1AOY A;  1IN5 A;  1TTY A;  3G73 A;  3U1D A;  2W57 A;  1K78 A;  3V7C A;  3WU0 A;  5HS8 A;  4CIC A;  4I0A A;  5ICE A;  1H0M A;  3DEU A;  4YII A;  1F4K A;  4RB3 C;  2XIG A;  1MGT A;  2YR2 A;  4ESF A;  4AIH A;  2NS0 A;  2VON A;  3RYP A;  1P2F A;  3H92 A;  4IRI A;  1Z7U A;  3R60 A;  3V7R A;  2CGP A;  5BPD A;  3H3Z A;  4ETS A;  5FB2 A;  2P6T A;  2ACJ A;  2KJC A;  1FYL A;  1XMA A;  1ZRE A;  3L7W A;  4LB6 B;  3DV8 A;  1RNL A;  4M6X A;  3FMS A;  4A2U A;  1DP7 P;  4CHU A;  2EFO A;  1IN7 A;  4AWX B;  5JR3 A;  5DUI A;  4KIG A;  2M45 A;  4G7H F;  1PDN C;  5D5W B;  2KIU A;  3RJP A;  1GXP A;  4S05 A;  5DCM B;  1YLF A;  1QGP A;  1DUX C;  3CUQ B;  3SZT A;  2GQQ A;  2K27 A;  4KFC A;  2K86 A;  1FWZ A;  1HXD A;  1KU2 A;  2P5K A;  3JAM K;  2FOK A;  2L3D A;  2FU4 A;  2DFI A;  2W85 A;  3BPX A;  5EEG A;  4OU0 A;  3EUH A;  1Z05 A;  2DAO A;  5IT3 A;  1HBX G;  2IT0 A;  5A2Q Z;  1UCR A;  1U78 A;  3LAP A;  4ENK A;  5L3B A;  1LJ9 A;  2A3S A;  5IT9 K;  5L3E A;  1R36 A;  1G4D A;  1P92 A;  5HLH A;  4I7H A;  3C18 A;  2STT A;  4RB0 A;  2W24 A;  4JBA A;  3KZY A;  1RZ4 A;  4ZZL A;  4NHJ A;  1B4A A;  3C3W A;  1ZG5 A;  1GHC A;  2NRA C;  2E7X A;  5LRS A;  3CO7 C;  3HUG A;  4GCV A;  4S04 A;  3CUQ C;  3N4M A;  3GFL A;  3L2C A;  2OZ6 A;  3J81 Z;  4FT8 A;  1HSJ A;  3IKV A;  2HFH A;  2VBY A;  1FSH A;  1GVJ A;  2YX7 A;  5ED4 A;  3EQL F;  3SXY A;  1ZH5 A;  3F8M A;  2QM3 A;  2ZO4 A;  1YW9 A;  4RGS A;  1ZG3 A;  2A61 A;  4GO1 A;  3FMQ A;  3HRS A;  3I58 A;  2OU2 A;  1XSV A;  4PGG A;  2YU3 A;  5TJJ A;  3GW2 A;  3E6M A;  5KVR A;  2FEZ A;  2FE3 A;  2KKO A;  4IF4 A;  3CUO A;  1BOA A;  1XSD A;  4Q5S F;  4WCG A;  2FBK A;  2P7C B;  2ZME B;  5ERI A;  2QUF A;  1L3L A;  4M74 A;  2Q2E A;  3ZMU A;  1WSU A;  1OYY A;  2DQL A;  1VTN C;  1QBJ A;  4UVA A;  3LA2 A;  2P4W A;  1STZ A;  2BV6 A;  5ILS A;  2QWW A;  1SD5 A;  4IHT A;  3TOA A;  5E18 F;  1XGS A;  1W7P D;  3ZMS A;  3P9C A;  1I5Z A;  4MEY F;  3VEP A;  2MH2 A;  2QBY B;  1RUO A;  5ICG A;  3KP5 A;  1KA8 A;  1J0R A;  5AON A;  2IVM A;  2XVC A;  4M6Y A;  5L3C A;  1EH6 A;  2R3S A;  4HBL A;  2A6H F;  4CDG A;  3GVA A;  1YIO A;  2FXA A;  4OMY A;  2PMU A;  1R1U A;  2WTE A;  1BBY A;  3OOP A;  3P9K A;  2M8E A;  5AIP A;  5CJ9 A;  1HW1 A;  1ZHF A;  3FXU A;  3QPT A;  2FNP A;  5DDG A;  2OQR A;  3WE3 A;  2CYY A;  2GA2 A;  4RGX A;  5HLG A;  4LLN A;  2DQR A;  2E1C A;  3EYY A;  3I59 B;  1W5S A;  5E1X A;  1OR7 A;  5CVV A;  5LGU A;  3E5U A;  3GUD A;  5CLS A;  3LQR A;  5DV5 A;  4HF2 A;  5EEH A;  3WGI A;  3E6D A;  4U0Y A;  1BJA A;  5D5V B;  1XCV A;  5D5U B;  3DFG A;  1BC8 C;  1SFX A;  4EMS A;  4MEX F;  5LHG A;  5FLX Z;  4R79 A;  2K7L A;  3JTG A;  2VOD A;  1SFE A;  3J7A O;  4AIJ A;  3V8L A;  3V4G A;  1T2K A;  2VE8 A;  3M9A A;  3O2P E;  2HKX A;  2IPQ X;  3F72 A;  5HDN A;  4XLP F;  3KP7 A;  2GXB A;  4L0Y B;  3ZQ7 A;  2VN2 A;  3WTX C;  1G6N A;  1O7L A;  4KN4 X;  2GIV A;  2QEN A;  2UZK A;  4EV0 A;  1OMI A;  3CJN A;  3EYI A;  2OAZ A;  1FC3 A;  3K1M A;  3R61 A;  5H20 A;  1Q1H A;  4RGU A;  3RYR A;  4KIC A;  1FYM A;  3T0Y A;  3K1P A;  3HTS B;  4GYG A;  3M1E A;  4ZH4 F;  1QZZ A;  2EWN A;  3WE2 A;  1UFM A;  3CO6 C;  4KYW A;  1L0O C;  2W25 A;  1CF7 B;  3TO6 A;  1USS A;  2V79 A;  3FZV A;  3T8T A;  2Y0M A;  3ABU A;  1XDS A;  5H6R A;  3MAJ A;  2OQG A;  2PJP A;  2YPR A;  3FWE A;  3VB2 A;  1G3Y A;  1DDN A;  5BS6 A;  1IUY A;  4M71 A;  1BIB A;  4HX7 A;  1FPQ A;  1B9N A;  2RC4 A;  2QQA A;  2FSW A;  5HDG A;  1UHM A;  5J8F A;  3L9F A;  4QWQ A;  5A2Q K;  3OV8 A;  1U5T A;  2IW5 A;  1ZGA A;  3GX4 X;  2TDX A;  2P5V A;  2IA2 A;  2G7H A;  2Q8K A;  1FLI A;  1JE8 A;  2XKO A;  5D4S A;  1DPR A;  2EFQ A;  3KP6 A;  4JQF A;  2DBB A;  1EH8 A;  2CW0 F;  4IJA A;  2Z3Y A;  1R22 A;  3L09 A;  4XLN F;  1ZRD A;  2L54 A;  4HAM A;  1MDM B;  5D8K B;  3E6C C;  2PLY A;  2ISZ A;  3F8F A;  4G6Q A;  1YYV A;  1Z91 A;  2PEX A;  3EDP A;  2H09 A;  4Y17 A;  4G7O F;  5LBQ A;  2MLG A;  4CYD A;  2O0Y A;  3K0L A;  4O5V A;  2OD5 A;  4OOI A;  4NB5 A;  2BYV E;  1O3T A;  4UUV A;  2MA3 A;  2PG4 A;  1J7K A;  2MH9 A;  2IP2 A;  1H9G A;  3GWZ A;  2ESN A;  3TGN A;  1BI0 A;  3U2R A;  3WTZ A;  4YFX F;  1T38 A;  4A6D A;  3BDD A;  3ZPL A;  4M9Z A;  2XUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...