2L4MA

Solution structure of the zbeta domain of human dai and its binding modes to b- and z-dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
69
structure length
69
Chain Sequence
SHMASPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Uncharacterized protein
publication title Solution structure of the Zbeta domain of human DNA-dependent activator of IFN-regulatory factors and its binding modes to B- and Z-DNA
rcsb
source organism Homo sapiens
total genus 22
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2l4mA00
3U1DA 5E1ZB 3BWGA 4AD9A 3LAPA 3F8FA 3HTUA 3HOSA 3REOA 4P9UA 3KEOA 1KYZA 2A61A 3J81K 4L0ZB 1BN5A 1A04A 4B09A 3R0AA 3ABTA 3J80Z 2M45A 1P4AA 5JR3A 2XROA 4MQVA 1HSTA 2ZJ2A 4U0VA 1WQ2A 4ENKA 1O3QA 1IW7F 3EQLF 3U9GA 1C0WA 1BOAA 1QO0D 3W6JB 2VBYA 3L2CA 4LG0A 5K5OA 3LQRA 2RVCA 4ETSA 2ZBKA 4LLNA 1K7AA 1RUOA 4K2EA 1H9TA 4RGSA 1LNWA 3V8LA 5L3CA 5LRRA 3DKWA 2CWEA 5FFZA 1G6NA 3WTSC 3CUOA 5CVJA 1QBJA 3KP4A 1YIOA 1O7LA 3R60A 2VBXA 4UV9A 1U8RA 2KRFA 2J5OA 4M9ZA 5A2QK 3WTUC 4KA4A 4M71A 3I53A 4L5JA 4P96A 2UWMA 3RDIA 4CGZA 2PI0A 1YW9A 1FYLA 3M1EA 1F9NA 1MZBA 2VXZA 5D4SA 1XGOA 2EA2A 3I4PA 5E8IA 2HKOA 1DPRA 4S04A 2GAUA 1W7PD 1JXSA 1USTA 2M87A 2VODA 2HWVA 3BDDA 4CXFA 3FXUA 2V1UA 5DV5A 1XGMA 1KQ0A 4IPAA 2W84A 1J7KA 2XAJA 2HOEA 4YFKF 1B59A 3B02A 3SZTA 1DUXC 4KIFA 3P9CA 1PUEE 2D45A 2EWNA 2EV5A 1TLHB 3IWFA 4HF0A 4JQFA 3DEUA 4WF2A 1S6LA 4G7ZF 3DP7A 3K69A 3BY6A 5LHGA 3GFMA 1T38A 4LGWA 3ML6A 3EUHA 2MLGA 1LEAA 4RS8A 1TW3A 1D8KA 4O6JA 2QYOA 3E5QA 1SAXA 2HYGD 1RZ4A 4ZH4F 3WTXC 2A69F 3D0SA 4KMUX 3HOTA 1B4AA 3HUGA 1UCRA 5FD6A 2XUBA 1R5GA 4PGHA 1B1BA 2OZ6A 2PMHA 3NEUA 4YIFA 1J0RA 4PDKA 3DXJF 2A6HF 2QZ8A 1SFUA 4YFNF 1W7PB 3V7CA 2W85A 5CVVA 2ZKZA 5K5QA 3F8MA 3F23A 1W5SA 2A68F 3HRTA 5CVUA 2DK5A 3PFIA 4HLXA 2LKPA 5FLXK 2QBYA 4I09A 2VN2A 2L3DA 2XGXA 3GF2A 2VC1A 3K0LA 5HDGA 2QM3A 1RNLA 2EV6A 1OYWA 4LG0B 4LK0F 2Z5UA 4WXDA 3TO7A 1J2XA 1Z7UA 1U6GA 3BPVA 4GO1A 2ZXJA 2Y48A 1DDNA 3ELKA 2K4JA 2EK5A 5IT3A 2AXLA 4S05A 1FPQA 1F1ZA 1ZLKA 2BE5F 2IPQX 4ZZDA 1Z9CA 2A3SA 1OYIA 1IN8A 2ADUA 3WTZA 4Q47A 1SFXA 2EFWA 1HSJA 2LDUA 2XV4S 5CJ9A 1BI3A 4HA8A 4XSXF 5HLGA 4EMSA 4U0WA 2BBYA 3M7GA 4LD5A 3CUQA 1I1GA 3BPXA 3E5XA 1VTNC 4M6YA 2OU2A 3MWMA 3QP5A 3TO6A 1SD7A 3V8JA 2HQNA 2P7VB 5JVTA 1AWCA 4E70A 4A5NA 1TQPA 4JBAA 4WXHA 4CHUA 1P6RA 1IAWA 4UNOA 4OIPF 5DUIA 4Z2YA 1BI2A 1S8NA 5DYMA 3KP7A 2RQPA 1WWXA 3IWZA 3VODA 3F21A 2FXAA 3WTWC 3WTVC 3G3ZA 5E1XA 4OIOF 5JI6A 3QOPA 3E97A 5CVRA 4HF2A 2RDPA 4RAZA 2KJCA 4OIQF 1KGSA 1HBXG 5LEKA 1BJAA 5K1YA 3VB2A 3RI4A 2DFIA 4BAYA 3T0YA 4YFXF 1BIAA 1O3SA 1Z05A 5TJJA 2HTSA 5E18F 4WX9A 2QQ9A 5LEJA 3KE2A 4NHJA 3H92A 3LA7A 4Q5SF 1HW2A 2AS5F 2KKOA 3RKYA 1IN7A 4EJVA 5L3DA 5D8LB 3E6DA 1ZN2A 2XAGA 1FYKA 2ZO4A 2OQGA 4AIKA 3WGIA 1P92A 4XBFA 4HLYA 2K27A 2HS5A 3M9AA 5JHUA 1OYYA 4PGGA 2HDCA 1KQ9A 3VEPA 3DPLC 2STWA 2CGPA 1W4MA 2W24A 1YW7A 3O3KA 4EQQA 3GFIA 2J5PA 2GZWA 3AAFA 4EJOA 1W5TA 4Q48A 1MJBA 3CO7C 3F6OA 3U2RA 1T39A 1EH8A 3IKVA 2ZNZA 1R00A 2F5EA 2X4HA 2O61A 2O0YA 2IT0A 3GYHX 1QQIA 2EFQA 2EFPA 4A2UA 2FRHA 1IRGA 1FP2A 3LA2A 3K2ZA 4EM2A 4AIHA 3Q9SA 3LA3A 1YW8A 1FZPB 4FX0A 3WG9A 2D2WA 2DPUA 3W6KB 3KCCA 1MDMB 4YIIA 4ENJA 4XSZF 5D5XB 3R4KA 2FOKA 2XAHA 5CYVA 4OMYA 4EGZA 4UVAA 4D0PA 2JSCA 2PLYA 4HYEA 2HR3A 4HX7A 2O3FA 3HSRA 1IF1A 4EJUA 2EFNA 4CYDA 3I71A 1TQMA 4HX8A 3K1NA 4UUVA 2HQRA 2TDXA 4GYIA 3JTGA 2OZUA 2VOPA 3T8TA 2PBIA 3COAC 1YYVA 3HRSA 4DNCA 4XRFA 4M9SA 2Z9OA 1STZA 1U78A 4BXUA 3FMRA 3HIFA 2ZMEB 4L9VA 1XSDA 4QWQA 1TNTA 3T1BA 1S3JA 3K9TA 5ILVA 3F8CA 3H3UA 2VBZA 2E7XA 1XB4A 3MZYA 5D6FA 3MEXA 2P8TA 2VBWA 3CJNA 3KP2A 1YFHA 3JTHA 1LDDA 2UZKA 1UFMA 5F64A 1E17A 1IN4A 5DUKA 1OR7A 2RKHA 2CYYA 5HLIA 1ZHFA 1W7PA 2FU4A 1FOKA 2EB7A 3LQQA 2XIGA 3QU3A 5F6FA 2BGCA 1O3TA 2Q8KA 4ASNA 1CGPA 1XDSA 3BJOA 4ENNA 3FMSA 2G7HA 2QWWA 1J59A 3F72A 3RPQA 4IRIA 4Y17A 5DD8A 2YX7A 3ECOA 2VT2A 1D8JA 5DD4A 3TO9A 4RB0A 2DT5A 2EFOA 4WXCA 4OINF 1SMYF 2FMYA 3JAMK 3C7JA 1PP7U 2G7UA 1BBYA 4L18B 1EV7A 2H27A 5J8FA 3ROUA 2GXBA 1FBQA 4CDGA 4ESFA 2FMLA 1H9GA 4LMYA 5FD5A 4KDPA 3TOAA 2A6EF 5BPDA 3RTRA 1PP8F 3PQJA 5ICEA 1ZRFA 2JRTA 5ICCA 1ZRDA 5BPIA 2DI3A 2FE3A 5FB2A 4LLGF 3JSPA 1IN6A 5FGMA 3FWEA 3QPTA 2FBHA 3FMQA 3LWFA 1TW2A 2GQQA 4I0AA 3KETA 1ZYRF 3VOEA 1JHFA 1FT9A 1E2XA 3M8EA 2WC2A 4PCQA 1SD6A 4HX4A 3RKWA 1K79A 1FP1D 1V3FA 2ELHA 3E6MA 2RGVA 5ILUA 2JZYA 2IRFG 5H6RA 2M30A 2X0LA 2F5DA 3KLOA 2O8XA 3H3ZA 4U7DA 5HS8A 5D6EA 3KLNA 3I59B 3F6VA 4IHSA 3T5XA 3ABUA 2FF4A 4GGGA 2OAZA 1ON1A 5E1WA 3GO5A 4U88A 2KIMA 1ULYA 2BEOA 3L9FA 1EH7A 3N97A 1R7JA 1YS6A 4N9HA 2H94A 4LB5A 5FLXZ 2ACJA 1MJ9A 4IRGA 3Q5FA 1FBSA 1XDUA 2VE8A 1ZH5A 1YTYA 2L4MA 1NHAA 4M72A 1JHHA 3ZN1A 1G3TA 5LRSA 3F8BA 2E7WA 3WTYC 2EV0A 2WWYA 1G3YA 2Q2EA 2Y75A 3HSFA 5HDKA 4ZYDA 1FWZA 3HHGA 4MNUA 3I64A 2NNNA 2P5KA 1PDNC 2ZFWA 2LF7A 1OMIA 4L0YB 3IKTA 1HXDA 1XCVA 4L5IA 5DDGA 2FBIA 1ZG1A 1YS7A 2WTEA 1MDMA 1SMTA 2A5YB 5L3EA 2FNPA 2DQRA 2M5WA 3JW4A 2DO7A 4A0ZA 2PMUA 4I98B 1XGNA 4HF1A 4I7HA 3ZMDA 4RGXA 1ZGAA 3GEZA 2NAZA 1LJ9A 3DFGA 3LSTA 3ISPA 1OKRA 3GXOA 3QU6A 2NNYA 4MHGA 1IRFA 4IVNA 4FX4A 4U0YA 4P5OA 4PZJA 3MZHA 1UHWA 2ZMEA 3P9KA 5IT9Z 2CG4A 5EEGA 5D8KB 4N0BA 3FM3A 1B6AA 2COMA 3KEQA 2ISZA 1B9MA 3SXYA 3TDZC 1Z91A 4HQMA 2XKPA 1BI0A 3MQ0A 1ZLJA 4KFCA 4R1HA 1IXCA 4RGUA 2R7DA 2DK8A 4IJAA 3MAJA 3QPHA 5AIPA 2JPBA 3QAHA 1R5HA 4FHTA 2HFHA 2VT3A 2HTJA 2GA2A 2Z33A 1U5TC 3ZMSA 2HEOA 5HOOA 3SFZA 1HKSA 1Y0UA 4OIRF 1BM9A 4UVCA 4BHPA 1HQCA 1WKMA 4CZZA 2PG4A 4OMZA 3E5UA 1IUYA 2L01A 3LAJA 1LVAA 3K1MA 2OQRA 1XSXA 4CICA 3I0TA 1BIBA 1G3SA 2DBBA 3GLXA 4EM1A 5BQTA 2STTA 1X3UA 3SHFA 4HDUA 4MTEA 3F8NA 3KZYA 4G7OF 2K86A 1I1SA 5F1RA 5E17F 4BHBA 4BQAA 3DQVC 1ZAOA 4G6DA 2GXGA 2HKXA 4IF4A 1CF7A 2IA2A 2VE9A 1OPCA 1KA8A 2UXNA 5ICGA 5FO5A 3N4MA 2MD5A 4JK1X 4A6DA 1FC3A 1FY7A 3FXQA 2HGCA 1U3EM 1EH6A 5LGTA 1K78A 2QVOA 4H0EA 4ZYEA 3CLOA 1LDKB 3HRMA 4RAYA 2JPCA 3V8KA 1XCBA 1WI9A 2MA3A 1T6SA 3CDHA 1MJAA 4MTDA 2DLLA 2ESNA 3HSEA 5LLQA 5KVRA 1JGSA 1XSVA 4AWXB 2L4AA 2JTVA 1LB2A 3SQNA 2V1XA 3ZPLA 4MGRA 2LNBA 2M1BA 3BROA 1RUNA 5BMZA 3RYRA 3BJ6A 1XMKA 3C18A 5CVIA 5ERIA 3O6BB 1P4WA 3WODF 1QZZA 3M8FA 3J7AO 2RC4A 1YQAA 3I59A 5E8GA 4NQWA 5JFRA 2MC3A 1YLFA 4GXOA 2D1HA 2GA1A 2PN6A 6PAXA 2P5LC 2BV6A 1G3WA 1D3YA 2Z99A 3D5LA 3J81Z 3WE2A 5DCFA 4WWCA 2QQAA 4I01A 1FNNA 4UV8A 5L3FA 2Z3YA 1KU7A 3EETA 5E20A 4G7HF 4WK8F 1R23A 3WU1B 3I54A 5HLHA 3HHHA 2P7CB 4KT5C 5J8CA 2UXXA 2LF8A 4A6EA 4KIGA 2FA5A 1MD0A 3MFKA 1YO5C 4RB2C 2Q0OA 4BNCA 3GFLA 3IRRA 3FF5A 2QLZA 1YG2A 4IHTA 2OBPA 3HYIA 4ENMA 3L7WA 1R1TA 2O6GE 3JAMZ 2G9WA 1FSEA 1KQ8A 3P7NA 1O3RA 1QNTA 4FT8A 2YX4A 1LQ1A 4QLCU 4XLNF 4N9IA 1S7AA 1T0FA 2IA0A 2PQ8A 2M8EA 2NYXA 3KP6A 2V1DA 2E1CA 3DV8A 2RN7A 2OA4A 3FM5A 4RB3C 5A2QZ 4O3MA 3KZZA 1F4KA 5ILSA 1I27A 3L00A 1TNSA 2H6CA 4I0BA 3ULQB 1FSHA 1IXRC 4LB6B 3J80K 4IRHA 4O5VA 1HKQA 3C3WA 3IL2A 4CO8A 2YSRA 1R1UA 1R1VA 1CF7B 3G73A 1QGPA 3BZ6A 3ERED 2EA4A 4HV6A 2W57A 3V7SA 4BYYA 4KN4X 2ESHA 3V7RA 1BC8C 4MEXF 1BI1A 1MKMA 3R6SA 4EM0B 4HQEA 3C1DA 4KN7X 3KP5A 1V4RA 3BOQA 4EJWA 2MH2A 2H6BA 3FXRA 1AOYA 1R22A 1K78B 2HZTA 3SZPA 2ETHA 1IXSB 1HW5A 1ODDA 2YPRA 1QZYA 1ZG5A 3PQKA 1S29A 3BJAA 5DEQA 2CO5A 2PEXA 3ZQ7A 3GFJA 1J9IA 4LFUA 3FHZA 5LHHA 2LSOA 4RB1A 2ZCWA 2VOOA 5L3BA 5ED4A 5BS6A 2JT1A 1SFEA 4KNYA 3E3VA 3O2PE 3KFWX 4ZZLA 1F5TA 5DCMB 2ISYA 2D1VA 5D5VB 1JE8A 2L02A 3R0JA 2V79A 4A5MA 1ZGJA 1SD4A 1P4XA 3P9IA 2QENA 2K02A 2RNJA 4HAMA 2DQLA 3RPUA 4Y15A 4BHCA 3L09A 4EVIA 3OV8A 4KIBA 4ESBA 3KP3A 1ON2A 3RYPA 2R7FA 2YR2A 4RGRA 4M9XA 4AIJA 4YG2F 3V4GA 1T98A 5H20A 1IZ1A 1KU2A 2XRNA 3DPTA 5HS7A 1WRJA 4UHTA 1IN5A 1XD7A 2V9VA 3E6CC 4HV5A 5HDNA 2CW0F 2KIUA 2KJBA 4L9JA 3VFZA 3T8RA 1LEBA 4G9YA 4EV0A 2FBKA 5CLSA 1Z1DA 2PFBA 1XN7A 4I02A 1Q1HA 2E1NA 3FX3A 3BP8A 3CO6C 3WGGA 5HS9A 4M6XA 3ZMUA 3GW2A 4MEYF 1RIOH 3GUDA 1ONVA 4A0YA 1REPC 2F5FA 4KMFA 1L0OC 2XAQA 3FZVA 4KYWA 2FEZA 2CQKA 3B73A 1L3LA 4HZFA 4A12A 1USSA 4LJZF 4NB5A 1MGTA 2MH9A 3WU0A 1I5ZA 4Y13A 2F2EA 2XKOA 4LLLA 1B9NA 2K7LA 4DQ2A 2H09A 2IVMA 4G8XA 3GZ5A 2IP2A 4EJTA 3I5UA 1QPMA 3QRFF 3ZMTA 1GVJA 2DTRA 3GX4X 3F3XA 1TTYA 2C6YA 1GXQA 2L54A 2DU9A 4LK1F 1LDJA 1U5TA 1O7FA 3CUQC 3EYYA 4A0XA 2P4WA 2EJRA 2CFXA 5BOXA 4BH9A 2F5CA 2BYVE 2ZNYA 1DPUA 1ZRCA 5IT9K 3HTSB 5AIQA 1O57A 1HW1A 2GWRA 1FYMA 5KK1A 3OOPA 2NS0A 3RKXA 5D4RA 1ZREA 4HOBA 2B0LA 3R61A 5LHIA 3K1PA 3NRVA 3F22A 1R36A 4MQ9F 5EEHA 3JSOA 1DP7P 2RV8A 1KU9A 1U2WA 3MCZA 4GCVA 4G6QA 1I6XA 4ZYGA 2XHKA 1ZARA 2IA1A 2CSOA 3Q9VA 3WTTC 2O03A 5TRDA 4IXAA 3NQOA 2FNAA 1XMAA 3ZMVA 2MLKA 2OD5A 3IHUA 3QP6A 4ESJA 4ZYHA 5ICFA 4UVBA 2XVCA 4R8HA 3TDUC 4F7ZA 1GHCA 3RIRA 1TQIA 1FX7A 2K4BA 4EGYA 1S7OA 3GWZA 5LGUA 3TOBA 4Q4ZF 2YU3A 2HYFA 2QQBA 1R58A 2FSWA 2MBFA 1K6OA 3TQNA 3IC7A 2IW5A 1ZG3A 1H0MA 2DPDA 4ON0A 4R79A 5L3GA 2IJLA 2Y0MA 3WE3A 4OOIA 4WCGA 3ZP5A 5D5UB 1SD5A 1WSUA 4M74A 4L9TA 4L9NA 2QBYB 4U7BA 3GZ6A 2QUFA 5K5RA 5AONA 4TV7A 4AVPA 2R3SA 3E6BA 2KIFA 1HKTA 2DW4A 1KU3A 3LFKA 1UB9A 5H6QA 3EDPA 2NRAC 4I2OA 2GIVA 2W25A 4OU0A 3CTAA 4P55A 2VC0A 3I58A 3DF8A 3RJPA 3TKYA 4HDVA 1GXPA 3ZN0A 1FBUA 1J75A 5DCMA 5D5WB 4G94A 1G4DA 2XAFA 3WGHA 3ZMZA 4XLPF 1D5VA 1Z6RA 4P9FA 2PJPA 1J5YA 1T2KA 3S2WA 1XGSA 1KYWA 1BC7C 2A07F 1FLIA 3GVAA 1Z6TA 5LGNA 2WV0A 2P6TA 3CUQB 4B8XA 2VONA 2FQ3A 5FFXA 3ECHA 3IRQA 4GYGA 2P5VA 3EYIA 1P2FA 2P6SA 4HW0A 5HVQC 2XASA 3HRUA 5LBQA 5J6XA 3TGNA 1UHMA 2DAOA 1U5TB 4KUMA 1RI7A 4KICA 1TBXA 4HBLA 2V6CA 4M73A 4UXNA
chains in the Genus database with same CATH superfamily
3U1DA 1G59A 2HNHA 3A2KA 5E1ZB 3BWGA 4AD9A 3LAPA 3F8FA 2EQRA 5EGOA 3HTUA 3HOSA 3REOA 4P9UA 3KEOA 1KYZA 4BJ6C 2A61A 3J81K 3HPGA 1JKOC 1OCRH 4L0ZB 1BN5A 3QQAA 2K40A 2K9QA 1A04A 3I9V2 1EJ9A 4B09A 3R0AA 3ABTA 2L7ZA 3OR2C 3UKGA 3J80Z 2M45A 1P4AA 1R4NB 3NAUA 3I56I 1VQ7I 4D5CA 5JR3A 1UAAA 1O4XA 2XROA 4MQVA 1HSTA 2ZJ2A 4U0VA 1WQ2A 4ENKA 1O3QA 1IW7F 3OYBA 4A69C 3EQLF 1VQ5I 3U9GA 2BXYA 2Z2SB 3GZNB 1OR7C 3OWTA 1C0WA 4CH7A 1NG6A 1UG0A 1BOAA 2OTLI 2MC4A 1QO0D 3W6JB 4BDYA 2VBYA 3L2CA 4LG0A 2XF6A 4XLAA 5K5OA 2LREA 1F43A 2L9VA 3LQRA 4C3JJ 2RVCA 2N8GA 2ZXWH 4ETSA 2ZBKA 2DMQA 4LLNA 1FIPA 1K7AA 1RUOA 3E7LA 2BY3A 4K2EA 3LSMA 3IAS2 1H9TA 4RGSA 1AA7A 2XGDA 3F9KA 1LNWA 3V8LA 3ZQLA 3CP2A 5B1BH 1A6QA 1WGXA 2BY0A 3CDIA 5LRRA 5L3CA 3DKWA 2CWEA 4QTRA 2CRGA 3H5RA 3PUFA 3O8HA 1ZTRA 5K7HA 1JKRC 5FFZA 3DKXA 3OS2A 1G6NA 1TWHJ 2K9LA 3BG5A 3WTSC 4N4NB 3ZQGA 3PSFA 1NK2P 5F27A 3CUOA 5CVJA 1QBJA 3KP4A 1YIOA 1O7LA 1SVLA 3R60A 2VBXA 4UV9A 5HODA 1U8RA 3S1NJ 2KRFA 1VQ6I 2J5OA 4M9ZA 2ECBA 5A2QK 1FMWA 3A02A 4HNTA 3WTUC 4PFOA 4DGWB 3NWTA 4KA4A 4M71A 3I53A 4DJAA 1MMNA 4L5JA 4P96A 2UWMA 2CS3A 2VKEA 3D5RC 3RDIA 4CGZA 3HOUJ 2PI0A 1X1AA 2NS7A 1YW9A 2HVQA 4A3EJ 2P0WA 2EIKH 1FYLA 1RKTA 3M1EA 3ZQCA 2K3FA 4F3QA 1ETXA 4IHXA 1F9NA 1MZBA 2VXZA 3QODA 2QA4I 2LH9A 5D4SA 1XGOA 2XB5A 2EA2A 3I4PA 3LSJA 3W2WA 5E8IA 1JTXA 2PJRB 2HKOA 1DPRA 4S04A 3GTOJ 2GAUA 1W7PD 1JXSA 1USTA 2M87A 2ZC2A 2VODA 1APLC 2HWVA 3BDDA 4CXFA 3FXUA 1F36A 3L2QA 2V1UA 1D0YA 2MSYA 2CMPA 1JT6A 4RAFA 5DV5A 4E4HA 1MIJA 1XGMA 2GOXB 1KQ0A 4JYKA 4IPAA 2W84A 1IO2A 4CA0A 1J7KA 2DT7B 2XAJA 1Z21A 2HOEA 3FDYA 4YFKF 2KMUA 3DCFA 1W1WE 2XF7A 1B59A 2WADA 3B02A 3SZTA 2DMNA 4ZTJA 1DUXC 1TT5B 3C2HA 4KIFA 3HOYJ 3P9CA 1PUEE 2D45A 2EWNA 3DTEA 4JP0A 1RKWA 2EV5A 1TLHB 1X19A 3IWFA 1MNDA 4HF0A 3VYSB 2E5NA 4JQFA 5FROA 3DEUA 4WF2A 1NH3A 2EINH 1S6LA 3CP8A 4G7ZF 4UUSB 3VSKA 4I6ZA 4XRSG 3DP7A 4N4OB 4RLFA 2GOMA 3K69A 3A1YA 4X0GA 1M1EB 3BY6A 3L1PA 3CCJI 5LHGA 4A93J 3GFMA 3BR2A 5DM7F 2CQXA 3OY9A 3G6EI 1T38A 4LGWA 1VQ4I 5IY5H 2E34A 5J1RA 5M5YJ 3ML6A 3EUHA 2HOTA 2MLGA 3BG7A 4V19K 1LEAA 5CKTA 4RS8A 1TW3A 1VF9A 2DT6A 1D8KA 4O6JA 1Y1WJ 2QYOA 4A3MJ 1JGGA 4A3CJ 2ICWG 3E5QA 1SAXA 1LFUP 3DPUA 2HYGD 2M7AA 1RZ4A 4ZH4F 1VQLI 3WTXC 3CC2I 4X6AJ 2IGOA 1VFCA 2A69F 2F48A 2BVLA 3RQIA 3D0SA 4KMUX 1R4MB 3TP3A 3HOTA 2JRMA 1B4AA 3HUGA 2L7KA 1JKPC 3HB9A 1UCRA 5FD6A 2XUBA 4BBSJ 4IX7A 2NVXJ 1R5GA 1VQ8I 4S0HB 4PGHA 1B1BA 3TMOA 2OZ6A 2PMHA 3NEUA 4YIFA 4DZJA 1SC7A 2LTPA 1J0RA 1X4OA 1YRNB 4PDKA 3DXJF 5EDNA 3HC7A 2A6HF 3PNTA 3OYFA 2DMPA 2QZ8A 2XGCA 2Z1DA 1MNMC 3OYIA 1SFUA 4E7HA 4YFNF 1W7PB 3V7CA 2W85A 5CVVA 2LY1A 2Y9ZA 2ZKZA 3PL8A 4BJ5C 5K5QA 3OYDA 3F8MA 3F23A 1W5SA 3KEYA 2A68F 3HRTA 2X9DA 3BG9A 5CVUA 2DK5A 1HF0A 3PFIA 4HLXA 2LKPA 5FLXK 2QBYA 3BG3A 4I09A 2E1MC 3AG4H 2VN2A 2L3DA 2XGXA 3GF2A 2VC1A 3K0LA 5HDGA 2QM3A 1RNLA 2EV6A 1OYWA 3AFHA 4LG0B 1TWFJ 3K6GA 5FLMJ 3FXOA 3LSKA 2NVYJ 4LK0F 1OCCH 3CCVI 2Z5UA 2W00A 4WXDA 1OCTC 3TO7A 4XM3A 2ZJRF 1X1DA 1J2XA 3BTCA 1Z7UA 3ZOBA 5IP7J 1WJAA 1U6GA 3BPVA 4GO1A 2QQ8A 2ZXJA 2Y48A 1POGA 2DA5A 1DDNA 4II3A 3ELKA 2K4JA 2BVMA 2EK5A 3BQYA 2AXLA 5IT3A 4CCOA 4S05A 3OIQA 3S1MJ 1EF4A 3ZQFA 1IDZA 2DA4A 2DCEA 2LG4A 3CQZJ 1FPQA 5M3MJ 1F1ZA 1ZLKA 3DBLB 2BE5F 2IPQX 3CF2A 2LP0A 4MFEA 4ZZDA 2A3SA 1Z9CA 1OYIA 1IN8A 3H5NA 3U1KA 2ADUA 3WTZA 1K6YA 3UR3C 4Q47A 5J1UA 3BTIA 1SFXA 2EFWA 1HSJA 2LDUA 2XV4S 3CDLA 5CJ9A 1BI3A 4HA8A 4XSXF 4RMNA 5HLGA 1QU3A 2HZDA 4EMSA 1V5GA 2IBDA 1DP3A 4U0WA 2BBYA 4PJNA 3M7GA 4LD5A 1D1BA 2P81A 3BR3A 3CUQA 4M3DA 4JOMA 5GPCA 1I1GA 4RA2A 3BPXA 3E5XA 1VTNC 4M6YA 4A3FJ 2OU2A 5F0CA 4Y52J 1UG2A 2VASA 3QPLA 4II2A 1JUSA 2VL8A 3MWMA 3QP5A 3TO6A 1SD7A 2XPVA 3V8JA 2HQNA 3BR1A 3H36A 4MLOA 2A6TA 2P7VB 4BUPA 5JVTA 1AWCA 4A5NA 4E70A 1TQPA 4JBAA 4WXHA 4C2TA 5EEAA 4CHUA 2LK2A 1P6RA 1IAWA 4UNOA 1I3AA 4OIPF 5DUIA 2K9MA 2ZMEC 3IP4B 4HEA2 4Z2YA 5GAHJ 1BI2A 1S8NA 3GTKJ 2VPLA 2W4SA 5DYMA 5FKNA 2QGUA 3KP7A 2W82A 2RQPA 3OL3A 4DBRA 1WWXA 3F0CA 3GMEA 3IWZA 3VODA 2VKVA 3F21A 2FXAA 3WTWC 1G8XA 3WTVC 3G3ZA 3LSRA 5E1XA 4OIOF 5JI6A 1VZ0A 3QOPA 2IS6A 1J09A 3E97A 4V2FA 2DDBA 1LVKA 2KLOA 4Y7NJ 5CVRA 4HF2A 2RDPA 3BR0A 4RAZA 1SFKA 2KJCA 4OIQF 5CQEA 1IJWC 1KGSA 1HBXG 2K9NA 5LEKA 4D1QA 1BJAA 5K1YA 3VB2A 1HDPA 3HOZJ 4D7MA 2XDVA 3GTJJ 3RI4A 2DFIA 4BAYA 3T0YA 3S3MA 4YFXF 2R92J 1BIAA 1O3SA 1Z05A 3SZGA 5TJJA 2HTSA 1KONA 5E18F 1W0TA 4WX9A 3BZCA 2V7FA 2WY8Q 3CJQB 2QQ9A 5LEJA 3KE2A 4NHJA 2VQHA 3H92A 3LA7A 1HW2A 2AS5F 4Q5SF 1PVEA 2KKOA 4IOCF 1E3OC 4ZYAA 3RKYA 2L9RA 3HBLA 3KX2A 1IN7A 1BOBA 4EJVA 5L3DA 1K83J 2WAQN 2BZTA 5D8LB 3E6DA 1ZN2A 3DU5A 4Z6YA 4RM3A 2XAGA 2NVTJ 3QPSA 1FYKA 2ZO4A 2OQGA 4AIKA 2H8WA 3WGIA 2EBIA 1P92A 4XBFA 4HLYA 2K27A 2HS5A 3FBNB 3M9AA 2F6CA 5JHUA 2VB6A 1OYYA 3RZOJ 4PGGA 2HDCA 1KQ9A 3VEPA 2ZB9A 3HUGB 2Y0SN 3DPLC 4XLEA 2STWA 2CGPA 1W4MA 2KRCA 2R7SA 2W24A 5CQGA 1YW7A 3O3KA 1HLVA 4EQQA 3PIPF 3GFIA 2J5PA 2GZWA 2KZVA 2AQEA 2YU9J 3AAFA 3OR1C 2BY2A 4EJOA 1W5TA 4GFBA 4Q48A 1MW7A 1MJBA 4FCYA 3W6VA 2E1MB 3CO7C 2VUMJ 1Z77A 4BDZA 3M3YJ 3F6OA 4FETA 3G1MA 2A5WA 3U2RA 4BEHB 5M5WJ 2LYCA 1EH8A 3IKVA 1T39A 1MSEC 1DQUA 2ZNZA 1R00A 2F5EA 2X4HA 2G0EA 2O61A 1JT0A 2O0YA 2CFOA 2IT0A 5B5EC 3GYHX 1QQIA 2Q2EB 3AG1H 3CC7I 4PJ0C 2EFQA 2EFPA 4A2UA 1K4SA 4AU7A 2FRHA 1IRGA 1GV5A 4M3FA 4UB6C 1FP2A 2Y2ZA 3LA2A 3K2ZA 2X48A 3BC8A 4NC8A 1NK3P 1LUJB 4EM2A 3HL2A 3A0HC 5J3LA 5FRMA 2PJRA 3KYDB 3TBIA 4AIHA 2XC7A 3Q9SA 1ZKGA 3LA3A 3OS1A 1W36C 1D1CA 1YW8A 1FZPB 4FX0A 3WG9A 2D2WA 1P9QC 2Z16A 3SDBA 3M4OJ 2DPUA 2VKHA 3W6KB 3KCCA 1MDMB 5KHDA 3W3CA 2VIXA 4YIIA 2V26A 3PFYA 4ENJA 4IKFA 4XSZF 2BW3B 1U9OA 5D5XB 3R4KA 2FOKA 2XAHA 2M4KA 5CYVA 3X2QH 4OMYA 3HPHA 4EGZA 4UVAA 4D0PA 2JSCA 2JVHA 2LY9A 2PLYA 2HXIA 4HYEA 2HR3A 1JTYA 4HX7A 1R6RA 4XKVA 2O3FA 1XPXA 3HSRA 3CMYA 4E7JA 5CPRB 3FXKA 2MW8A 3GTMJ 3D5SC 1IF1A 1N25A 4EJUA 1RESA 3OS0A 2EFNA 4CYDA 3I71A 1TQMA 1A36A 4HX8A 3K1NA 4XLCA 1VQNI 1N78A 2WV1A 4UUVA 2HQRA 2TDXA 4GYIA 3JTGA 2E19A 2OZUA 3H3VK 3LSPA 1ETQA 2DA3A 2VOPA 3T8TA 2PBIA 4UUSA 2ZSIB 3COAC 3K4MA 2R7ZJ 1YYVA 3HRSA 4DNCA 4XRFA 4M9SA 2Z9OA 1BW5A 1DU0A 2LBFB 2EZLA 1STZA 2W1OA 1U78A 4BXUA 3FMRA 2NVQJ 3HIFA 2ZMEB 3J7AY 1MMDA 2I8DA 4L9VA 1V54H 1XSDA 4QWQA 1TNTA 1Y1VJ 5E3MA 1GDTA 3T1BA 1S3JA 2HQ5A 3K9TA 1RC9A 1YIJI 3I4NJ 2CUFA 4P1WA 5E3LA 2CH0A 3OYEA 5ILVA 3BQZA 3IV5A 3F8CA 3H3UA 4AYBA 2AO9A 2JSPA 2KQRA 3OYAA 2R5YB 2VBZA 5DTDA 2E7XA 4FE7A 3E1SA 2BHYA 4AIDA 2X6YA 3CESA 1XB4A 3RSNA 3MZYA 4NBQA 5D6FA 3G4SI 3MEXA 2P8TA 2VBWA 3CJNA 3KP2A 1YFHA 3M07A 3JTHA 1LDDA 5TISC 1BL0A 2UZKA 2LKXA 1UFMA 1YRNA 3OIOA 3DEWA 5EF6A 2FOWA 5F64A 4C3IJ 5EYRA 2EPFA 4BL0B 1E17A 2LLKA 2DA7A 2WBMA 1IN4A 5DUKA 1OR7A 2DTZA 2RKHA 3GTGJ 3AG3H 2CYYA 5HLIA 1ZHFA 1BR2A 1W7PA 3LOCA 2FU4A 2XPUA 2EB7A 1FOKA 3LQQA 2XIGA 3QU3A 1ERDA 4LIUA 5F04A 2H1KA 5F6FA 4A3GJ 4QPOA 2BGCA 5JLWA 5E3NA 1O3TA 1S72I 4JX4A 2Q8KA 4ASNA 3I3LA 1CGPA 1XDSA 5J47A 3BJOA 3MKLA 3B6AA 3OYJA 4ENNA 3FMSA 3S32A 4DOZA 3EUKL 2G7HA 2QWWA 1IG7A 4CCKA 3LFUA 1W5CC 3F72A 3RPQA 1J59A 2V9KA 4IRIA 3K4BA 4Y17A 5DD8A 1IV8A 2YX7A 3ECOA 2VT2A 2IGNA 1D8JA 2L7MP 5DD4A 4I76A 3TO9A 4U87A 4QIWN 4RB0A 2DT5A 1FIAA 2EFOA 4WXCA 4OINF 1BW6A 1SMYF 2FMYA 2X6WA 3JAMK 1P7JA 3C7JA 2KIQA 3I55I 1PP7U 2G7UA 2NVUB 1BBYA 1T0FC 2KL4A 3ZCOA 2LC2A 2E2HJ 4BJTA 4L18B 3NWSA 4A3DJ 1DU6A 1SVOA 1U0JA 2X1EA 1EV7A 1IV6A 1MBFA 2X51A 2H27A 5J8FA 3ROUA 2E2JJ 2GXBA 1FBQA 1X1BA 4CDGA 3FXJA 4ESFA 2HVRA 1TL8A 1AU7A 2FMLA 1H9GA 3L2UA 1VQ9I 4LMYA 4A3IJ 4A3BJ 5FD5A 4KDPA 3PO2J 1FYMA 2DFHA 2PX9A 1Y6IA 4XLFA 3TOAA 3CMAI 3ZGKA 2A6EF 2IEKA 5BPDA 2R7TA 3RTRA 4C3HJ 2F5VA 4E6KG 1PP8F 2V4JC 1OQYA 3PQJA 2NOGA 1RR7A 5ICEA 1ZRFA 3RKQA 4NUBA 4I99C 2JRTA 2R7QA 5ICCA 1B72B 1ZRDA 3K4NA 5BPIA 1XTAA 4C9YA 2DI3A 2FE3A 5FB2A 1H89C 2K9SA 4LLGF 5C4XJ 3JSPA 4G6TB 1IN6A 3B6CA 2XB0X 5FGMA 2I10A 3FWEA 2R5ZB 3QPTA 2FBHA 3S1RJ 3FMQA 4BE2A 4RDUA 4GDFA 4BU2A 2HXOA 1TW2A 3LWFA 4F55A 2X6OA 3FIWA 1WZ2A 3OMYA 4NNJA 2LOOA 2ZJPF 1D0XA 2GQQA 3L2RA 4I0AA 1WI3A 2VJ5A 3KETA 1AHDP 1ZYRF 3VOEA 1JHFA 1FT9A 1B8IA 1LE8B 1NTCA 1E2XA 2COBA 3JRAA 3CMMA 3M8EA 4FQGA 3JREA 2WC2A 2DFEA 1S5LC 4PCQA 1SD6A 4HX4A 1Z3XA 3PM1A 3RKWA 1K79A 4CYCA 2VJIA 3K70C 2IGKA 4RBOA 3M1CA 3FKIJ 3HG9A 1FP1D 1V3FA 5FJ8J 2ELHA 2DODA 3HDDA 3E6MA 1BR1A 2RGVA 1AKHA 5ILUA 2JZYA 2KZGA 3HGGA 2IRFG 2JWTA 2QF7A 3LSHA 5H6RA 2M30A 2F4MB 2X1DA 4C2UA 2X0LA 2AHQA 2F5DA 2O8XA 2ZXIA 3KLOA 4B3AA 3H3ZA 2EZIA 5J40A 1QVTA 4EEFG 4U7DA 1R5ID 5HS8A 2GM4A 5D6EA 3KLNA 1WVRA 2V1NA 2O8KA 3I59B 3F6VA 4NQWB 4IHSA 3T5XA 3ABUA 1Y56A 2FF4A 1MBHA 2R7RA 4GGGA 4IO9F 1YE9A 2FX0A 2WA0A 2OAZA 1ON1A 4IZZA 1T56A 3VSLA 1X58A 5EZGA 4M3BA 5E1WA 2MYSA 3GO5A 4NC7A 4IHWA 3BG6A 4U88A 2DN0A 2KIMA 1ULYA 2BEOA 3L9FA 1EH7A 3N97A 1TP4A 1R7JA 2VLAA 1YS6A 4F52A 4XR6A 4N9HA 4NDLA 2H94A 4LB5A 2HPIA 5FLXZ 3OYHA 3QYEA 3HOXJ 2ACJA 5H2FC 3ZR8X 4XKCA 1MJ9A 4IRGA 4CCJA 3Q5FA 1FBSA 4B3XA 4ANJA 1XDUA 4V2GA 2VE8A 4BEHA 1YTYA 1ZH5A 2L4MA 1NHAA 4M72A 1TT0A 1JHHA 3ZN1A 1G3TA 5LRSA 3F8BA 2E7WA 1QZEA 5C44J 3TL4X 2VJJA 3IAM2 3WTYC 2EV0A 2WWYA 1G3YA 2Q2EA 2Y75A 3HSFA 5HDKA 4ZYDA 1FWZA 4OAZA 3HHGA 3LMMA 1I39A 4MNUA 3I64A 3MMYB 2NNNA 2P5KA 2B7EA 1PDNC 2ZFWA 2BXZA 2LF7A 1OMIA 3ZQQA 4L0YB 3IKTA 2HU9A 3G1OA 2LMDA 1HXDA 3ABKH 2W48A 2LY2A 1XCVA 1WJBA 4B1RA 4L5IA 5DDGA 3CCEI 4OAYA 2FBIA 1ZG1A 1G2HA 1YS7A 2WTEA 3CCYA 3TW7A 3Q0WA 1MDMA 1SMTA 2A5YB 3JRDA 2Y69H 5L3EA 2FNPA 3K2AA 4HSTA 2EZHA 1R49A 4FTHA 1FOWA 1DGWY 2BW3A 2DQRA 2M5WA 2ME0A 3JW4A 2DO7A 1I3QJ 3GBGA 4A0ZA 4HNUA 2PMUA 1VNDA 4ZTFA 4W97A 2OPTA 4CZCA 2GLOA 2HQAA 1X4PA 4I98B 1XGNA 4HF1A 4I7HA 3ZMDA 4RGXA 5M5XJ 1ZGAA 1HCRA 3GEZA 1ZR4A 3S93A 4XQFA 2R93J 2NAZA 1LJ9A 2CQNA 4BKXA 2JVGA 3DFGA 3HOVJ 3ASNH 5E79C 3LSTA 3ISPA 1OKRA 4A3LJ 1E0EA 3OYLA 3GXOA 4E7ZA 5F0HA 3RPUD 5F1JA 2M3AA 3QU6A 4HG2A 1K61A 5IYCJ 2EIJH 2XRLA 4MHGA 2NNYA 2GXAA 4HRIA 3HM5A 2JA8J 1IRFA 2LBFA 4IVNA 5IOZA 3FK7A 2ZXHA 4FX4A 1YX5A 2O5RA 3HXLA 4P5OA 4U0YA 2CW8A 4PZJA 3DKYA 1UHWA 2ZMEA 3MZHA 4RLQA 3P9KA 2KDOA 1ZR2A 5IT9Z 2CG4A 2L5QA 5F08A 2M34A 4IHVA 1MMSA 1ETOA 5DS9A 5EEGA 5D8KB 4N0BA 3TP0A 3FM3A 2DXIA 1B6AA 4DBQA 2COMA 3ZXSA 2R5YA 3KEQA 2ISZA 1A5JA 1BJZA 4J19A 3CCLI 1B9MA 3SXYA 3TDZC 1Z91A 3HOWJ 1JI8A 1K4TA 2DYRH 4HQMA 2XKPA 2JA7J 3C2BA 1BI0A 3MQ0A 4X1EA 3WHCA 1MBKA 3HKZA 3BTJA 3OIPA 4F92B 3GTLJ 1EKEA 1ZLJA 3OYKA 3CCUI 4KFCA 1B8IB 2HOSA 4PK4A 4R1HA 1IXCA 4RGUA 2R7DA 2DK8A 1OFCX 2M8GX 4IJAA 3OYMA 4F93B 3OSGA 3A01B 2RAEA 3MAJA 1IC8A 2ECCA 2FQ4A 3QPHA 5AIPA 3CLQA 2QSHX 2JPBA 3DBHB 4E7LA 3QAHA 1R5HA 4FHTA 3QOEA 2HFHA 2VT3A 4B43A 2HTJA 2E2IJ 2GA2A 4CYCB 2Z33A 1U5TC 3ZMSA 1RPWA 2HEOA 5HOOA 3SFZA 4M3GA 1HKSA 3WU2C 1Y0UA 4OIRF 1BM9A 1ENHA 1AKHB 4UVCA 1KZHA 4XICA 4BHPA 5EZHA 1HQCA 3K4KA 3MN2A 2Y30A 1WKMA 3CJTB 2JUGA 2QEXI 2PMZA 5GAGJ 3IH2A 4CZZA 2FD5A 1OCZH 2PG4A 4OMZA 1VQPI 4PSWA 5KAIC 3E5UA 1IUYA 2L01A 3DU6A 3LAJA 1LVAA 5HNFA 1VQKI 3PJRA 4KT6A 2BOLA 3K1MA 2OQRA 3CMEI 1XSXA 2CUZA 4CICA 4E7IA 3I0TA 3Q3SA 1BIBA 1G3SA 2BHZA 2DBBA 3FXMA 3LL7A 3GLXA 3H1CA 4EM1A 2R7WA 1R71A 1Y39A 2KHMA 5BQTA 2STTA 1ITYA 1EA3A 1X3UA 1GLNA 3KIOA 3SHFA 1R9TJ 3VDXA 1PJRA 2F4IA 4MTEA 5JHFA 3F8NA 2XGEA 4HDUA 1YJNI 1LPQA 9ANTA 3KZYA 4G7OF 3H9QA 2K86A 2VQLA 1I1SA 5F1RA 2VPRA 3K4JA 5E17F 4BHBA 4BQAA 3DQVC 2E35A 1ZAOA 4G6DA 2GXGA 2JN6A 2HKXA 5FKMA 4IF4A 1CF7A 1UELB 3ZRGA 4YIRX 2AXTC 3BR6A 3CCMI 2IA2A 3FBIB 1H88C 3WG7H 3JRHA 2VE9A 3JRGA 1OPCA 5IYBJ 3CZ6A 3CD6I 2M0MA 1V5EA 1KA8A 1ETYA 4AM3A 2UXNA 1QHGA 4BS9A 1B72A 1XS9A 5ICGA 5FO5A 3N4MA 2IS1A 3P5JA 2OV7A 2MFZA 2MD5A 2WB1N 1WJEA 3BLYA 4JK1X 2OC6A 3JRIA 3ASOH 2XAUA 3HZJA 4QPQA 2R5ZA 4A6DA 1FC3A 1FY7A 3FXQA 3PNYA 4AYBN 3FISA 2HGCA 1U3EM 2H8RA 4BQQA 3Q0UA 4ABZA 1EH6A 5LGTA 1K78A 2QVOA 3AG2H 4H0EA 1DGRM 4ZYEA 3MD2A 3V42A 4A3KJ 3CLOA 1LDKB 3HRMA 4RAYA 2E1OA 2JPCA 3K4LA 2XSJC 3V8KA 3LSGA 4LG3A 1SFOJ 1XCBA 1WI9A 3SEQA 2V9PA 2MA3A 3K10A 1LE8A 1T6SA 3PO3J 3CDHA 1MJAA 2E71A 3QYBA 5E3OA 4MTDA 2Y31A 4ZDOA 2DLLA 1JUMA 1X2NA 2ESNA 3SFIA 3HSEA 5LLQA 3K7AJ 5KVRA 1JGSA 3LSIA 2LRDA 1XSVA 4AWXB 2L4AA 1GUUA 2JTVA 4PJLA 1LB2A 4B47A 3SQNA 2CV1A 2V1XA 3ZPLA 4MGRA 4XNFA 2R7VA 2LNBA 4XRMA 1VQOI 5C3EJ 2M1BA 3BROA 1OCOH 4XOTA 1RUNA 5BMZA 4DYCA 1V55H 1ETVA 3RYRA 3BJ6A 2E5ZA 1S7EA 1XMKA 1PUFB 2Y0SA 3C18A 5CVIA 5ERIA 3O6BB 1P4WA 3WODF 1QZZA 3M8FA 1Z7LA 3J7AO 2ZSHB 3A03A 2RREA 2RC4A 2EZKA 1YQAA 3I59A 5E8GA 4NQWA 1X3ZB 2MC3A 5JFRA 4D9JA 1YLFA 4GXOA 2D1HA 2GA1A 4CSWA 4PJMA 2PN6A 6PAXA 5J1YA 2P5LC 3KYLA 2BV6A 1G3WA 5GADJ 1IDYA 1D3YA 2Z99A 4ITVA 3D5LA 1D5YA 3J81Z 3LNQA 3WE2A 2CQQA 5DCFA 1VI0A 4WWCA 2QQAA 3OSFA 4I01A 4PFPA 3DEEA 1FNNA 2WAFA 4UV8A 2QKMB 5L3FA 5LD2C 2Z3YA 3VWBA 1KU7A 1YJ9I 5JVGF 2B63J 2DA6A 5KAFC 3EETA 4L5EA 5E20A 1HDDC 3QWLA 4M3EA 3S3NA 2LR8A 2ME6A 4D5FA 4G7HF 1W36D 3JRCA 4WK8F 1R23A 3WU1B 3CC4I 1IUFA 3I54A 5HLHA 3HHHA 2P7CB 1T95A 5IPAA 4KT5C 3MKWB 4AUXA 5J8CA 2UXXA 2LF8A 4XOPA 4A6EA 1OJLA 4IEJA 4KIGA 5J4YA 2FA5A 1MD0A 3MFKA 2KDZA 1YO5C 4RB2C 2Q0OA 4BNCA 3GFLA 4HSRA 3IRRA 3FF5A 2QLZA 1WPKA 1YG2A 5DM6F 2HYJA 3L2VA 2JJ7A 4IHTA 2OBPA 3HYIA 3W2AA 1HC8A 2XPWA 4ENMA 5GP9A 3L7WA 1R1TA 1ACIA 2O6GE 3JAMZ 2G9WA 1FSEA 1KQ8A 3P7NA 1O3RA 2VKDA 2DMTA 1QNTA 1N77A 2JQ7A 2MG4A 4FT8A 1TWGJ 2CU7A 2KP6A 2YX4A 5M3FJ 1LQ1A 4QLCU 4XLNF 1U9NA 4N9IA 1S7AA 1T0FA 2IA0A 2IS4A 3FHNA 2PQ8A 2M8EA 1WH5A 2NYXA 3KP6A 2V1DA 1JJ6C 2E1CA 4CUGA 3DV8A 2RN7A 3E0JB 2OA4A 3C2GA 3FM5A 4RB3C 5A2QZ 3BR5A 3KZZA 4O3MA 1F4KA 3D1NI 4XL9A 5ILSA 1Z3YA 5B1AH 1I27A 3L00A 2L9NA 1TNSA 2H6CA 4I0BA 1D0ZA 2QSGX 3H35A 3ULQB 1ETKA 4IHYA 5EG0A 1FSHA 4AVZA 1IXRC 4XN3A 4LB6B 3J80K 4IRHA 2OF7A 3SDGA 2Q1ZB 4O5VA 2KISA 1A31A 1HKQA 3C3WA 3IL2A 1MSFC 2VI6A 4CO8A 1XMXA 2YSRA 2HOAA 1I50J 1R1UA 2DMUA 1R1VA 3JR9A 2M9HA 3KYCB 1CF7B 4BY7J 5LFAA 1QGPA 3G73A 3BZ6A 3ERED 2EA4A 4HV6A 2MABA 2VQGA 3S15J 2M7BA 4E7KA 2W57A 3V7SA 4BYYA 4Y4RA 4KN4X 2ESHA 3V7RA 1BC8C 1YITI 4MEXF 1OCPA 2K5CA 1BI1A 1MKMA 3OL4A 3AKZA 3R6SA 4EM0B 3DTKA 4HQEA 3C1DA 1FMVA 4KN7X 4ZJZA 1SANA 1XC5A 2NOJB 3KP5A 1V4RA 3BOQA 4IQJA 1LFPA 4EJWA 1FJLA 2MH2A 3U21A 2H6BA 3WHBA 1LKXA 3FXRA 4NC6A 5GTIC 3ESWB 1AOYA 2ZFUA 2XF5A 1U8BA 1E3PA 1R22A 1K78B 2HZTA 5C4JJ 2Y9YA 1UMQA 3SZPA 2R7UA 2ETHA 3H9GA 5KNLA 3PIOF 1S9HA 2CV0A 1QVUA 1IXSB 1TC3C 1FTTA 1YX3A 4CCLA 2L2OA 2L9SA 4DW6A 4XLHA 1HW5A 2QKLB 1ODDA 2YPRA 1QZYA 1Y8QB 1ZG5A 3PQKA 1S29A 4PUSA 1BA5A 2JUCA 3BJAA 5DEQA 3A01A 1CQTA 2CO5A 4B44A 2PEXA 3ZQ7A 2M0CA 3GFJA 1J9IA 3GTPJ 4LFUA 4KJZA 3FHZA 5LHHA 3SEZA 2VXDA 2LSOA 2ZCWA 4RB1A 2VOOA 5L3BA 1X1PA 5ED4A 5BS6A 2JT1A 1SFEA 3ZQHA 3CCRI 4KNYA 3TW6A 3E3VA 3O2PE 1RETA 3KFWX 4KITB 4ZZLA 5HLTA 2DFFA 2DA2A 3DWLE 4BE0A 5DCMB 1F5TA 2DA1A 4F91B 2ISYA 2D1VA 5D5VB 4XRSA 1JE8A 2IAIA 3HJEA 1NG7A 2L02A 3R0JA 3S17J 5KCMA 2V79A 1WJFA 4A5MA 3H5AA 1ZGJA 2L7FP 3JCUC 1SD4A 1P4XA 5BNGA 2OUMA 1HOMA 1FOXA 3P9IA 3JRFA 3S2DJ 2QENA 2K02A 2RNJA 4HAMA 2DQLA 3OYNA 3RPUA 1ORKA 1LFBA 4Y15A 4BHCA 3L09A 5IP6A 2OCCH 1I6HJ 4EVIA 5GTHC 3OV8A 1ZQ3P 2R7OA 4YRVA 1RR8C 2JA5J 3VYUB 4KIBA 4ZDPA 1T8IA 4ESBA 1QRYA 3FXLA 3DLAA 3KP3A 4G12A 2O7OA 4BQOA 1ON2A 4LIVA 3RYPA 2VQCA 2R7FA 3H0GJ 2YR2A 1Y0NA 1UHSA 4RGRA 4M9XA 4JX6A 4AIJA 3S3OA 2CW7A 2DJIA 4YG2F 4UB8C 3V4GA 4XIDA 4HPQA 1MH3A 3OYCA 1T98A 1X1CA 3ZQIA 5H20A 1MBEA 3ABMH 4IL6C 3DLLF 3GLLA 2HDWA 3QYFA 3EUHC 1IZ1A 1KU2A 3S16J 2XRNA 3DPTA 2LKSA 3NARA 4BXXJ 2RNGA 5HS7A 1QA6A 1WRJA 4UHTA 5EGOB 3K70D 1IN5A 3O8GA 1XD7A 2V9VA 3KZIC 3E6CC 4HV5A 1WH7A 3ERMA 5HDNA 3UNGC 3CF5F 4BE1A 2CW0F 4C2MJ 2KIUA 2KJBA 2M4GA 4OWRB 2KRHA 4L9JA 3K4CA 3VFZA 3T8RA 1TWAJ 2UUZA 5FKLA 2YS9A 5K7FA 3SJMA 3TEDA 1JKQC 1LEBA 4G9YA 4EV0A 2FBKA 3BT9A 5CLSA 1Z1DA 2PFBA 1XN7A 4I02A 1Q1HA 2BY1A 3HKZN 2E60A 2E1NA 2OCEA 3W2VA 3FX3A 4XN0A 2E36A 3BP8A 3GCMA 1QPIA 1FTZA 2TCTA 3CO6C 4LITA 3WGGA 5HS9A 4FASD 4M6XA 2WY7Q 3ZMUA 5EG0B 2EILH 3GW2A 4MEYF 1RIOH 1IGNA 1GVDA 3GUDA 1ONVA 2DOEA 4UUTA 4A0YA 4D7NA 1REPC 2F5FA 4KMFA 1P7IA 3G1LA 1L0OC 2XAQA 4CCNA 3FZVA 1WFXA 3S2HJ 4PSXA 4KYWA 2IS2A 2FEZA 2CQKA 1HA8A 1ETWA 2LFBA 4BY1J 3B73A 1PUFA 1L3LA 1YOVB 2R4GA 1USSA 4HZFA 4LJZF 4A12A 4NB5A 4B4CA 1D1AA 1MGTA 2MH9A 3WU0A 1I5ZA 4Y13A 1ZK8A 4RAGA 2F2EA 2X85A 4BBRJ 2XKOA 4LLLA 1B9NA 4C30A 2GIZA 5TGTA 2H1LA 2K7LA 2PMZN 3BCBA 4DQ2A 1MMGA 2H09A 2IVMA 4G8XA 4BACA 4XORA 2KFDA 3GZ5A 4IQ4A 5K7ZA 3DBRB 2KT0A 4QSHA 4XONA 2IP2A 3EPZA 4EJTA 3I5UA 1QPMA 5B3SH 3QRFF 3ZMTA 1GVJA 2DTRA 2JA6J 1QHHD 1XG1A 1H8AC 1MBGA 2CQ7A 4DIQA 3GX4X 1TWCJ 3F3XA 1TTYA 2C6YA 1GXQA 1YJWI 2L54A 3AL0C 3BTLA 2DU9A 1SEUA 2O9LA 4LK1F 3S1QJ 1LDJA 1U5TA 4FE4A 5FLVA 1O7FA 1WJDA 1XX5A 2RQQA 1A35A 3CUQC 4KISA 3MKZA 3EYYA 2DDAA 4A0XA 2P4WA 2EJRA 2CFXA 1IRZA 3FK6A 2IXSA 1UZCA 4BH9A 3PNVA 5BOXA 2F5CA 4J00A 2CV2A 2BYVE 2HVSA 3SYTA 1MNEA 4RM2A 1OLTA 2ZNYA 3J7YJ 2ZJQF 2GBYA 3MZ8A 1DPUA 1PYVA 1ZRCA 3OYGA 5IYDJ 4A3JJ 4M6VA 2YUSA 5IT9K 3HTSB 2NXNB 5AIQA 3MKYB 1O57A 1HW1A 2GWRA 2IGMA 1W0UA 4B48A 2X1CA 3G2BA 5KK1A 3OOPA 3H0DA 3CJRB 2NS0A 3RKXA 5D4RA 1ZREA 4IOAF 2DOFA 4HOBA 2B0LA 2ID6A 4ZC3A 1Z0XA 3R61A 5B66C 1RRJA 5LHIA 3K1PA 1Q1VA 2JMWA 1Z67A 3NRVA 1VQMI 3S8PA 1R36A 4MQ9F 5EEHA 3JSOA 3F22A 1DP7P 2RV8A 1KU9A 1U2WA 2MD0A 2QCOA 3MCZA 4GCVA 4GRIA 4G6QA 2DOAA 1I6XA 4ZYGA 1IRXA 2XHKA 3H9JA 1ZARA 2IA1A 4BXFA 2CSOA 3Q9VA 1FEXA 4XMYA 3WTTC 1Y8RB 4FISA 3L2WA 2DYSH 3FKJA 2O03A 3IH4A 5TRDA 4IXAA 4XKWA 3NQOA 2FNAA 3M8JA 1XMAA 3ZMVA 2MLKA 4UY8I 2OD5A 3IHUA 3QP6A 1X2MA 1OISA 5EJCA 3J7ZI 1TZLA 3ONQA 4ZYHA 4ESJA 3DTIA 5ICFA 4UVBA 2XVCA 4R8HA 3TDUC 4F7ZA 4W1UA 3HGYA 2K85A 1YHQI 1GHCA 3BCAA 3RIRA 5FKOA 1TQIA 3KPHA 4E7SA 2B9SA 1FX7A 2K4BA 2R0QC 5IP9J 4EGYA 1X3WB 1S7OA 1WHUA 1JUPA 2LD5A 3GWZA 5J4VA 2JA2A 3TOBA 5LGUA 4Q4ZF 2YU3A 2HYFA 2QQBA 1R58A 2FSWA 2MBFA 4JX5A 2K3PA 3MVPA 2ELJA 1K6OA 3TQNA 3RQ4A 1E3HA 3IC7A 2IW5A 1ZG3A 2AQFA 2CJJA 1H0MA 4BGDA 2DPDA 4ON0A 3VYRB 4HNVA 4R79A 3OOUA 5L3GA 3HEFA 2IJLA 2Y0MA 1GT0C 4MO7A 3JRBA 2HDDA 3WE3A 4OOIA 2OTJI 4Y33A 3VYTB 3S14J 4WCGA 3ZP5A 1WJCA 5D5UB 4J01A 1SD5A 2A05A 1WSUA 4M74A 4L9TA 1V5FA 4LOCA 3RZDJ 1WCMJ 4L9NA 2M2EA 2WAEA 1ZGWA 2QBYB 2TRTA 4U7BA 3GZ6A 2I5UA 2R7XA 2QUFA 1BR4A 5K5RA 5HNHA 4MIMA 4YELA 1T08B 1UJ8A 1ZELA 5AONA 4TV7A 2CUEA 4AVPA 2R3SA 2MGQA 3E6BA 2KIFA 1HKTA 2UV1A 4XK4A 2XSDC 2DW4A 1KU3A 2DJNA 3LFKA 5JLXA 1UB9A 5FKKA 5H6QA 3EDPA 2NRAC 4I2OA 4BQNA 2X6XA 2WAQA 2GIVA 2W25A 4OU0A 3IH3A 2L0KA 2F4OB 3CTAA 3G71I 4P55A 2VC0A 3I58A 3DF8A 3A4CA 1FOYA 3RJPA 3TKYA 4HDVA 1GXPA 2ID3A 4CCMA 3ZN0A 1WJ5A 1FBUA 2VJ4A 1J75A 5DCMA 2CUJA 5D5WB 4G94A 1JJ8C 1G4DA 2EH3A 2XAFA 2W7NA 4YEJA 3WGHA 3ZMZA 4MFDA 4EATA 4XLPF 2HPMA 4H4KC 1D5VA 1Z6RA 4P9FA 4DZPA 2PJPA 1J5YA 2ELKA 1T2KA 3Q0VA 1SVMA 3AL0B 1T33A 3VPRA 3S2WA 1XGSA 1MBJA 3IUOA 1KYWA 1BC7C 2A07F 1FLIA 3GVAA 1Z6TA 4AC0A 3PSIA 5LGNA 2WV0A 2P6TA 3CCSI 3CUQB 3PUBA 4B8XA 3ABLH 4DYQA 2FJ1A 2VONA 2FQ3A 5FFXA 5IOYA 3ECHA 3IRQA 4GYGA 2P5VA 3EYIA 1P2FA 1MH4A 2WB1A 2P6SA 3EUAA 4HW0A 4DYRA 5HVQC 5GAEJ 4Y3OA 2XASA 2FUG2 2V6EA 3RCOA 2HI3A 1MMAA 3HRUA 5LBQA 5J6XA 5F0FA 3TGNA 3N05A 1UHMA 2DAOA 1U5TB 2EIMH 3CCQI 2D5VA 4KUMA 5GPAA 1GV2A 1RI7A 1SAUA 3BZKA 2QSFX 3GTQJ 4KICA 2NS8A 2LVSA 3A0BC 2KPMA 1TBXA 3I4MJ 1YI2I 2OJED 1A6IA 4HBLA 4XKBA 4ZDLA 5FRNA 1N75A 2V6CA 4M73A 4UXNA 2JK3A 4PJJA
chains in the Genus database with same CATH topology
3U1DA 5E1ZB 3BWGA 4AD9A 3LAPA 3F8FA 3HTUA 3HOSA 3REOA 4P9UA 3KEOA 1KYZA 2A61A 3J81K 4L0ZB 1BN5A 1A04A 4B09A 3R0AA 3ABTA 3J80Z 2M45A 1P4AA 5JR3A 2XROA 4MQVA 1HSTA 2ZJ2A 4U0VA 1WQ2A 4ENKA 1O3QA 1IW7F 3EQLF 3U9GA 1C0WA 1BOAA 1QO0D 3W6JB 2VBYA 3L2CA 4LG0A 5K5OA 3LQRA 2RVCA 4ETSA 2ZBKA 4LLNA 1K7AA 1RUOA 4K2EA 1H9TA 4RGSA 1LNWA 3V8LA 5L3CA 5LRRA 3DKWA 2CWEA 5FFZA 1G6NA 3WTSC 3CUOA 5CVJA 1QBJA 3KP4A 1YIOA 1O7LA 3R60A 2VBXA 4UV9A 1U8RA 2KRFA 2J5OA 4M9ZA 5A2QK 3WTUC 4KA4A 4M71A 3I53A 4L5JA 4P96A 2UWMA 3RDIA 4CGZA 2PI0A 1YW9A 1FYLA 3M1EA 1F9NA 1MZBA 2VXZA 5D4SA 1XGOA 2EA2A 3I4PA 5E8IA 2HKOA 1DPRA 4S04A 2GAUA 1W7PD 1JXSA 1USTA 2M87A 2VODA 2HWVA 3BDDA 4CXFA 3FXUA 2V1UA 5DV5A 1XGMA 1KQ0A 4IPAA 2W84A 1J7KA 2XAJA 2HOEA 4YFKF 1B59A 3B02A 3SZTA 1DUXC 4KIFA 3P9CA 1PUEE 2D45A 2EWNA 2EV5A 1TLHB 3IWFA 4HF0A 4JQFA 3DEUA 4WF2A 1S6LA 4G7ZF 3DP7A 3K69A 3BY6A 5LHGA 3GFMA 1T38A 4LGWA 3ML6A 3EUHA 2MLGA 1LEAA 4RS8A 1TW3A 1D8KA 4O6JA 2QYOA 3E5QA 1SAXA 2HYGD 1RZ4A 4ZH4F 3WTXC 2A69F 3D0SA 4KMUX 3HOTA 1B4AA 3HUGA 1UCRA 5FD6A 2XUBA 1R5GA 4PGHA 1B1BA 2OZ6A 2PMHA 3NEUA 4YIFA 1J0RA 4PDKA 3DXJF 2A6HF 2QZ8A 1SFUA 4YFNF 1W7PB 3V7CA 2W85A 5CVVA 2ZKZA 5K5QA 3F8MA 3F23A 1W5SA 2A68F 3HRTA 5CVUA 2DK5A 3PFIA 4HLXA 2LKPA 5FLXK 2QBYA 4I09A 2VN2A 2L3DA 2XGXA 3GF2A 2VC1A 3K0LA 5HDGA 2QM3A 1RNLA 2EV6A 1OYWA 4LG0B 4LK0F 2Z5UA 4WXDA 3TO7A 1J2XA 1Z7UA 1U6GA 3BPVA 4GO1A 2ZXJA 2Y48A 1DDNA 3ELKA 2K4JA 2EK5A 5IT3A 2AXLA 4S05A 1FPQA 1F1ZA 1ZLKA 2BE5F 2IPQX 4ZZDA 1Z9CA 2A3SA 1OYIA 1IN8A 2ADUA 3WTZA 4Q47A 1SFXA 2EFWA 1HSJA 2LDUA 2XV4S 5CJ9A 1BI3A 4HA8A 4XSXF 5HLGA 4EMSA 4U0WA 2BBYA 3M7GA 4LD5A 3CUQA 1I1GA 3BPXA 3E5XA 1VTNC 4M6YA 2OU2A 3MWMA 3QP5A 3TO6A 1SD7A 3V8JA 2HQNA 2P7VB 5JVTA 1AWCA 4E70A 4A5NA 1TQPA 4JBAA 4WXHA 4CHUA 1P6RA 1IAWA 4UNOA 4OIPF 5DUIA 4Z2YA 1BI2A 1S8NA 5DYMA 3KP7A 2RQPA 1WWXA 3IWZA 3VODA 3F21A 2FXAA 3WTWC 3WTVC 3G3ZA 5E1XA 4OIOF 5JI6A 3QOPA 3E97A 5CVRA 4HF2A 2RDPA 4RAZA 2KJCA 4OIQF 1KGSA 1HBXG 5LEKA 1BJAA 5K1YA 3VB2A 3RI4A 2DFIA 4BAYA 3T0YA 4YFXF 1BIAA 1O3SA 1Z05A 5TJJA 2HTSA 5E18F 4WX9A 2QQ9A 5LEJA 3KE2A 4NHJA 3H92A 3LA7A 4Q5SF 1HW2A 2AS5F 2KKOA 3RKYA 1IN7A 4EJVA 5L3DA 5D8LB 3E6DA 1ZN2A 2XAGA 1FYKA 2ZO4A 2OQGA 4AIKA 3WGIA 1P92A 4XBFA 4HLYA 2K27A 2HS5A 3M9AA 5JHUA 1OYYA 4PGGA 2HDCA 1KQ9A 3VEPA 3DPLC 2STWA 2CGPA 1W4MA 2W24A 1YW7A 3O3KA 4EQQA 3GFIA 2J5PA 2GZWA 3AAFA 4EJOA 1W5TA 4Q48A 1MJBA 3CO7C 3F6OA 3U2RA 1T39A 1EH8A 3IKVA 2ZNZA 1R00A 2F5EA 2X4HA 2O61A 2O0YA 2IT0A 3GYHX 1QQIA 2EFQA 2EFPA 4A2UA 2FRHA 1IRGA 1FP2A 3LA2A 3K2ZA 4EM2A 4AIHA 3Q9SA 3LA3A 1YW8A 1FZPB 4FX0A 3WG9A 2D2WA 2DPUA 3W6KB 3KCCA 1MDMB 4YIIA 4ENJA 4XSZF 5D5XB 3R4KA 2FOKA 2XAHA 5CYVA 4OMYA 4EGZA 4UVAA 4D0PA 2JSCA 2PLYA 4HYEA 2HR3A 4HX7A 2O3FA 3HSRA 1IF1A 4EJUA 2EFNA 4CYDA 3I71A 1TQMA 4HX8A 3K1NA 4UUVA 2HQRA 2TDXA 4GYIA 3JTGA 2OZUA 2VOPA 3T8TA 2PBIA 3COAC 1YYVA 3HRSA 4DNCA 4XRFA 4M9SA 2Z9OA 1STZA 1U78A 4BXUA 3FMRA 3HIFA 2ZMEB 4L9VA 1XSDA 4QWQA 1TNTA 3T1BA 1S3JA 3K9TA 5ILVA 3F8CA 3H3UA 2VBZA 2E7XA 1XB4A 3MZYA 5D6FA 3MEXA 2P8TA 2VBWA 3CJNA 3KP2A 1YFHA 3JTHA 1LDDA 2UZKA 1UFMA 5F64A 1E17A 1IN4A 5DUKA 1OR7A 2RKHA 2CYYA 5HLIA 1ZHFA 1W7PA 2FU4A 1FOKA 2EB7A 3LQQA 2XIGA 3QU3A 5F6FA 2BGCA 1O3TA 2Q8KA 4ASNA 1CGPA 1XDSA 3BJOA 4ENNA 3FMSA 2G7HA 2QWWA 1J59A 3F72A 3RPQA 4IRIA 4Y17A 5DD8A 2YX7A 3ECOA 2VT2A 1D8JA 5DD4A 3TO9A 4RB0A 2DT5A 2EFOA 4WXCA 4OINF 1SMYF 2FMYA 3JAMK 3C7JA 1PP7U 2G7UA 1BBYA 4L18B 1EV7A 2H27A 5J8FA 3ROUA 2GXBA 1FBQA 4CDGA 4ESFA 2FMLA 1H9GA 4LMYA 5FD5A 4KDPA 3TOAA 2A6EF 5BPDA 3RTRA 1PP8F 3PQJA 5ICEA 1ZRFA 2JRTA 5ICCA 1ZRDA 5BPIA 2DI3A 2FE3A 5FB2A 4LLGF 3JSPA 1IN6A 5FGMA 3FWEA 3QPTA 2FBHA 3FMQA 3LWFA 1TW2A 2GQQA 4I0AA 3KETA 1ZYRF 3VOEA 1JHFA 1FT9A 1E2XA 3M8EA 2WC2A 4PCQA 1SD6A 4HX4A 3RKWA 1K79A 1FP1D 1V3FA 2ELHA 3E6MA 2RGVA 5ILUA 2JZYA 2IRFG 5H6RA 2M30A 2X0LA 2F5DA 3KLOA 2O8XA 3H3ZA 4U7DA 5HS8A 5D6EA 3KLNA 3I59B 3F6VA 4IHSA 3T5XA 3ABUA 2FF4A 4GGGA 2OAZA 1ON1A 5E1WA 3GO5A 4U88A 2KIMA 1ULYA 2BEOA 3L9FA 1EH7A 3N97A 1R7JA 1YS6A 4N9HA 2H94A 4LB5A 5FLXZ 2ACJA 1MJ9A 4IRGA 3Q5FA 1FBSA 1XDUA 2VE8A 1ZH5A 1YTYA 2L4MA 1NHAA 4M72A 1JHHA 3ZN1A 1G3TA 5LRSA 3F8BA 2E7WA 3WTYC 2EV0A 2WWYA 1G3YA 2Q2EA 2Y75A 3HSFA 5HDKA 4ZYDA 1FWZA 3HHGA 4MNUA 3I64A 2NNNA 2P5KA 1PDNC 2ZFWA 2LF7A 1OMIA 4L0YB 3IKTA 1HXDA 1XCVA 4L5IA 5DDGA 2FBIA 1ZG1A 1YS7A 2WTEA 1MDMA 1SMTA 2A5YB 5L3EA 2FNPA 2DQRA 2M5WA 3JW4A 2DO7A 4A0ZA 2PMUA 4I98B 1XGNA 4HF1A 4I7HA 3ZMDA 4RGXA 1ZGAA 3GEZA 2NAZA 1LJ9A 3DFGA 3LSTA 3ISPA 1OKRA 3GXOA 3QU6A 2NNYA 4MHGA 1IRFA 4IVNA 4FX4A 4U0YA 4P5OA 4PZJA 3MZHA 1UHWA 2ZMEA 3P9KA 5IT9Z 2CG4A 5EEGA 5D8KB 4N0BA 3FM3A 1B6AA 2COMA 3KEQA 2ISZA 1B9MA 3SXYA 3TDZC 1Z91A 4HQMA 2XKPA 1BI0A 3MQ0A 1ZLJA 4KFCA 4R1HA 1IXCA 4RGUA 2R7DA 2DK8A 4IJAA 3MAJA 3QPHA 5AIPA 2JPBA 3QAHA 1R5HA 4FHTA 2HFHA 2VT3A 2HTJA 2GA2A 2Z33A 1U5TC 3ZMSA 2HEOA 5HOOA 3SFZA 1HKSA 1Y0UA 4OIRF 1BM9A 4UVCA 4BHPA 1HQCA 1WKMA 4CZZA 2PG4A 4OMZA 3E5UA 1IUYA 2L01A 3LAJA 1LVAA 3K1MA 2OQRA 1XSXA 4CICA 3I0TA 1BIBA 1G3SA 2DBBA 3GLXA 4EM1A 5BQTA 2STTA 1X3UA 3SHFA 4HDUA 4MTEA 3F8NA 3KZYA 4G7OF 2K86A 1I1SA 5F1RA 5E17F 4BHBA 4BQAA 3DQVC 1ZAOA 4G6DA 2GXGA 2HKXA 4IF4A 1CF7A 2IA2A 2VE9A 1OPCA 1KA8A 2UXNA 5ICGA 5FO5A 3N4MA 2MD5A 4JK1X 4A6DA 1FC3A 1FY7A 3FXQA 2HGCA 1U3EM 1EH6A 5LGTA 1K78A 2QVOA 4H0EA 4ZYEA 3CLOA 1LDKB 3HRMA 4RAYA 2JPCA 3V8KA 1XCBA 1WI9A 2MA3A 1T6SA 3CDHA 1MJAA 4MTDA 2DLLA 2ESNA 3HSEA 5LLQA 5KVRA 1JGSA 1XSVA 4AWXB 2L4AA 2JTVA 1LB2A 3SQNA 2V1XA 3ZPLA 4MGRA 2LNBA 2M1BA 3BROA 1RUNA 5BMZA 3RYRA 3BJ6A 1XMKA 3C18A 5CVIA 5ERIA 3O6BB 1P4WA 3WODF 1QZZA 3M8FA 3J7AO 2RC4A 1YQAA 3I59A 5E8GA 4NQWA 5JFRA 2MC3A 1YLFA 4GXOA 2D1HA 2GA1A 2PN6A 6PAXA 2P5LC 2BV6A 1G3WA 1D3YA 2Z99A 3D5LA 3J81Z 3WE2A 5DCFA 4WWCA 2QQAA 4I01A 1FNNA 4UV8A 5L3FA 2Z3YA 1KU7A 3EETA 5E20A 4G7HF 4WK8F 1R23A 3WU1B 3I54A 5HLHA 3HHHA 2P7CB 4KT5C 5J8CA 2UXXA 2LF8A 4A6EA 4KIGA 2FA5A 1MD0A 3MFKA 1YO5C 4RB2C 2Q0OA 4BNCA 3GFLA 3IRRA 3FF5A 2QLZA 1YG2A 4IHTA 2OBPA 3HYIA 4ENMA 3L7WA 1R1TA 2O6GE 3JAMZ 2G9WA 1FSEA 1KQ8A 3P7NA 1O3RA 1QNTA 4FT8A 2YX4A 1LQ1A 4QLCU 4XLNF 4N9IA 1S7AA 1T0FA 2IA0A 2PQ8A 2M8EA 2NYXA 3KP6A 2V1DA 2E1CA 3DV8A 2RN7A 2OA4A 3FM5A 4RB3C 5A2QZ 4O3MA 3KZZA 1F4KA 5ILSA 1I27A 3L00A 1TNSA 2H6CA 4I0BA 3ULQB 1FSHA 1IXRC 4LB6B 3J80K 4IRHA 4O5VA 1HKQA 3C3WA 3IL2A 4CO8A 2YSRA 1R1UA 1R1VA 1CF7B 3G73A 1QGPA 3BZ6A 3ERED 2EA4A 4HV6A 2W57A 3V7SA 4BYYA 4KN4X 2ESHA 3V7RA 1BC8C 4MEXF 1BI1A 1MKMA 3R6SA 4EM0B 4HQEA 3C1DA 4KN7X 3KP5A 1V4RA 3BOQA 4EJWA 2MH2A 2H6BA 3FXRA 1AOYA 1R22A 1K78B 2HZTA 3SZPA 2ETHA 1IXSB 1HW5A 1ODDA 2YPRA 1QZYA 1ZG5A 3PQKA 1S29A 3BJAA 5DEQA 2CO5A 2PEXA 3ZQ7A 3GFJA 1J9IA 4LFUA 3FHZA 5LHHA 2LSOA 4RB1A 2ZCWA 2VOOA 5L3BA 5ED4A 5BS6A 2JT1A 1SFEA 4KNYA 3E3VA 3O2PE 3KFWX 4ZZLA 1F5TA 5DCMB 2ISYA 2D1VA 5D5VB 1JE8A 2L02A 3R0JA 2V79A 4A5MA 1ZGJA 1SD4A 1P4XA 3P9IA 2QENA 2K02A 2RNJA 4HAMA 2DQLA 3RPUA 4Y15A 4BHCA 3L09A 4EVIA 3OV8A 4KIBA 4ESBA 3KP3A 1ON2A 3RYPA 2R7FA 2YR2A 4RGRA 4M9XA 4AIJA 4YG2F 3V4GA 1T98A 5H20A 1IZ1A 1KU2A 2XRNA 3DPTA 5HS7A 1WRJA 4UHTA 1IN5A 1XD7A 2V9VA 3E6CC 4HV5A 5HDNA 2CW0F 2KIUA 2KJBA 4L9JA 3VFZA 3T8RA 1LEBA 4G9YA 4EV0A 2FBKA 5CLSA 1Z1DA 2PFBA 1XN7A 4I02A 1Q1HA 2E1NA 3FX3A 3BP8A 3CO6C 3WGGA 5HS9A 4M6XA 3ZMUA 3GW2A 4MEYF 1RIOH 3GUDA 1ONVA 4A0YA 1REPC 2F5FA 4KMFA 1L0OC 2XAQA 3FZVA 4KYWA 2FEZA 2CQKA 3B73A 1L3LA 4HZFA 4A12A 1USSA 4LJZF 4NB5A 1MGTA 2MH9A 3WU0A 1I5ZA 4Y13A 2F2EA 2XKOA 4LLLA 1B9NA 2K7LA 4DQ2A 2H09A 2IVMA 4G8XA 3GZ5A 2IP2A 4EJTA 3I5UA 1QPMA 3QRFF 3ZMTA 1GVJA 2DTRA 3GX4X 3F3XA 1TTYA 2C6YA 1GXQA 2L54A 2DU9A 4LK1F 1LDJA 1U5TA 1O7FA 3CUQC 3EYYA 4A0XA 2P4WA 2EJRA 2CFXA 5BOXA 4BH9A 2F5CA 2BYVE 2ZNYA 1DPUA 1ZRCA 5IT9K 3HTSB 5AIQA 1O57A 1HW1A 2GWRA 1FYMA 5KK1A 3OOPA 2NS0A 3RKXA 5D4RA 1ZREA 4HOBA 2B0LA 3R61A 5LHIA 3K1PA 3NRVA 3F22A 1R36A 4MQ9F 5EEHA 3JSOA 1DP7P 2RV8A 1KU9A 1U2WA 3MCZA 4GCVA 4G6QA 1I6XA 4ZYGA 2XHKA 1ZARA 2IA1A 2CSOA 3Q9VA 3WTTC 2O03A 5TRDA 4IXAA 3NQOA 2FNAA 1XMAA 3ZMVA 2MLKA 2OD5A 3IHUA 3QP6A 4ESJA 4ZYHA 5ICFA 4UVBA 2XVCA 4R8HA 3TDUC 4F7ZA 1GHCA 3RIRA 1TQIA 1FX7A 2K4BA 4EGYA 1S7OA 3GWZA 5LGUA 3TOBA 4Q4ZF 2YU3A 2HYFA 2QQBA 1R58A 2FSWA 2MBFA 1K6OA 3TQNA 3IC7A 2IW5A 1ZG3A 1H0MA 2DPDA 4ON0A 4R79A 5L3GA 2IJLA 2Y0MA 3WE3A 4OOIA 4WCGA 3ZP5A 5D5UB 1SD5A 1WSUA 4M74A 4L9TA 4L9NA 2QBYB 4U7BA 3GZ6A 2QUFA 5K5RA 5AONA 4TV7A 4AVPA 2R3SA 3E6BA 2KIFA 1HKTA 2DW4A 1KU3A 3LFKA 1UB9A 5H6QA 3EDPA 2NRAC 4I2OA 2GIVA 2W25A 4OU0A 3CTAA 4P55A 2VC0A 3I58A 3DF8A 3RJPA 3TKYA 4HDVA 1GXPA 3ZN0A 1FBUA 1J75A 5DCMA 5D5WB 4G94A 1G4DA 2XAFA 3WGHA 3ZMZA 4XLPF 1D5VA 1Z6RA 4P9FA 2PJPA 1J5YA 1T2KA 3S2WA 1XGSA 1KYWA 1BC7C 2A07F 1FLIA 3GVAA 1Z6TA 5LGNA 2WV0A 2P6TA 3CUQB 4B8XA 2VONA 2FQ3A 5FFXA 3ECHA 3IRQA 4GYGA 2P5VA 3EYIA 1P2FA 2P6SA 4HW0A 5HVQC 2XASA 3HRUA 5LBQA 5J6XA 3TGNA 1UHMA 2DAOA 1U5TB 4KUMA 1RI7A 4KICA 1TBXA 4HBLA 2V6CA 4M73A 4UXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1D A;  5E1Z B;  3BWG A;  4AD9 A;  3LAP A;  3F8F A;  3HTU A;  3HOS A;  3REO A;  4P9U A;  3KEO A;  1KYZ A;  2A61 A;  3J81 K;  4L0Z B;  1BN5 A;  1A04 A;  4B09 A;  3R0A A;  3ABT A;  3J80 Z;  2M45 A;  1P4A A;  5JR3 A;  2XRO A;  4MQV A;  1HST A;  2ZJ2 A;  4U0V A;  1WQ2 A;  4ENK A;  1O3Q A;  1IW7 F;  3EQL F;  3U9G A;  1C0W A;  1BOA A;  1QO0 D;  3W6J B;  2VBY A;  3L2C A;  4LG0 A;  5K5O A;  3LQR A;  2RVC A;  4ETS A;  2ZBK A;  4LLN A;  1K7A A;  1RUO A;  4K2E A;  1H9T A;  4RGS A;  1LNW A;  3V8L A;  5L3C A;  5LRR A;  3DKW A;  2CWE A;  5FFZ A;  1G6N A;  3WTS C;  3CUO A;  5CVJ A;  1QBJ A;  3KP4 A;  1YIO A;  1O7L A;  3R60 A;  2VBX A;  4UV9 A;  1U8R A;  2KRF A;  2J5O A;  4M9Z A;  5A2Q K;  3WTU C;  4KA4 A;  4M71 A;  3I53 A;  4L5J A;  4P96 A;  2UWM A;  3RDI A;  4CGZ A;  2PI0 A;  1YW9 A;  1FYL A;  3M1E A;  1F9N A;  1MZB A;  2VXZ A;  5D4S A;  1XGO A;  2EA2 A;  3I4P A;  5E8I A;  2HKO A;  1DPR A;  4S04 A;  2GAU A;  1W7P D;  1JXS A;  1UST A;  2M87 A;  2VOD A;  2HWV A;  3BDD A;  4CXF A;  3FXU A;  2V1U A;  5DV5 A;  1XGM A;  1KQ0 A;  4IPA A;  2W84 A;  1J7K A;  2XAJ A;  2HOE A;  4YFK F;  1B59 A;  3B02 A;  3SZT A;  1DUX C;  4KIF A;  3P9C A;  1PUE E;  2D45 A;  2EWN A;  2EV5 A;  1TLH B;  3IWF A;  4HF0 A;  4JQF A;  3DEU A;  4WF2 A;  1S6L A;  4G7Z F;  3DP7 A;  3K69 A;  3BY6 A;  5LHG A;  3GFM A;  1T38 A;  4LGW A;  3ML6 A;  3EUH A;  2MLG A;  1LEA A;  4RS8 A;  1TW3 A;  1D8K A;  4O6J A;  2QYO A;  3E5Q A;  1SAX A;  2HYG D;  1RZ4 A;  4ZH4 F;  3WTX C;  2A69 F;  3D0S A;  4KMU X;  3HOT A;  1B4A A;  3HUG A;  1UCR A;  5FD6 A;  2XUB A;  1R5G A;  4PGH A;  1B1B A;  2OZ6 A;  2PMH A;  3NEU A;  4YIF A;  1J0R A;  4PDK A;  3DXJ F;  2A6H F;  2QZ8 A;  1SFU A;  4YFN F;  1W7P B;  3V7C A;  2W85 A;  5CVV A;  2ZKZ A;  5K5Q A;  3F8M A;  3F23 A;  1W5S A;  2A68 F;  3HRT A;  5CVU A;  2DK5 A;  3PFI A;  4HLX A;  2LKP A;  5FLX K;  2QBY A;  4I09 A;  2VN2 A;  2L3D A;  2XGX A;  3GF2 A;  2VC1 A;  3K0L A;  5HDG A;  2QM3 A;  1RNL A;  2EV6 A;  1OYW A;  4LG0 B;  4LK0 F;  2Z5U A;  4WXD A;  3TO7 A;  1J2X A;  1Z7U A;  1U6G A;  3BPV A;  4GO1 A;  2ZXJ A;  2Y48 A;  1DDN A;  3ELK A;  2K4J A;  2EK5 A;  5IT3 A;  2AXL A;  4S05 A;  1FPQ A;  1F1Z A;  1ZLK A;  2BE5 F;  2IPQ X;  4ZZD A;  1Z9C A;  2A3S A;  1OYI A;  1IN8 A;  2ADU A;  3WTZ A;  4Q47 A;  1SFX A;  2EFW A;  1HSJ A;  2LDU A;  2XV4 S;  5CJ9 A;  1BI3 A;  4HA8 A;  4XSX F;  5HLG A;  4EMS A;  4U0W A;  2BBY A;  3M7G A;  4LD5 A;  3CUQ A;  1I1G A;  3BPX A;  3E5X A;  1VTN C;  4M6Y A;  2OU2 A;  3MWM A;  3QP5 A;  3TO6 A;  1SD7 A;  3V8J A;  2HQN A;  2P7V B;  5JVT A;  1AWC A;  4E70 A;  4A5N A;  1TQP A;  4JBA A;  4WXH A;  4CHU A;  1P6R A;  1IAW A;  4UNO A;  4OIP F;  5DUI A;  4Z2Y A;  1BI2 A;  1S8N A;  5DYM A;  3KP7 A;  2RQP A;  1WWX A;  3IWZ A;  3VOD A;  3F21 A;  2FXA A;  3WTW C;  3WTV C;  3G3Z A;  5E1X A;  4OIO F;  5JI6 A;  3QOP A;  3E97 A;  5CVR A;  4HF2 A;  2RDP A;  4RAZ A;  2KJC A;  4OIQ F;  1KGS A;  1HBX G;  5LEK A;  1BJA A;  5K1Y A;  3VB2 A;  3RI4 A;  2DFI A;  4BAY A;  3T0Y A;  4YFX F;  1BIA A;  1O3S A;  1Z05 A;  5TJJ A;  2HTS A;  5E18 F;  4WX9 A;  2QQ9 A;  5LEJ A;  3KE2 A;  4NHJ A;  3H92 A;  3LA7 A;  4Q5S F;  1HW2 A;  2AS5 F;  2KKO A;  3RKY A;  1IN7 A;  4EJV A;  5L3D A;  5D8L B;  3E6D A;  1ZN2 A;  2XAG A;  1FYK A;  2ZO4 A;  2OQG A;  4AIK A;  3WGI A;  1P92 A;  4XBF A;  4HLY A;  2K27 A;  2HS5 A;  3M9A A;  5JHU A;  1OYY A;  4PGG A;  2HDC A;  1KQ9 A;  3VEP A;  3DPL C;  2STW A;  2CGP A;  1W4M A;  2W24 A;  1YW7 A;  3O3K A;  4EQQ A;  3GFI A;  2J5P A;  2GZW A;  3AAF A;  4EJO A;  1W5T A;  4Q48 A;  1MJB A;  3CO7 C;  3F6O A;  3U2R A;  1T39 A;  1EH8 A;  3IKV A;  2ZNZ A;  1R00 A;  2F5E A;  2X4H A;  2O61 A;  2O0Y A;  2IT0 A;  3GYH X;  1QQI A;  2EFQ A;  2EFP A;  4A2U A;  2FRH A;  1IRG A;  1FP2 A;  3LA2 A;  3K2Z A;  4EM2 A;  4AIH A;  3Q9S A;  3LA3 A;  1YW8 A;  1FZP B;  4FX0 A;  3WG9 A;  2D2W A;  2DPU A;  3W6K B;  3KCC A;  1MDM B;  4YII A;  4ENJ A;  4XSZ F;  5D5X B;  3R4K A;  2FOK A;  2XAH A;  5CYV A;  4OMY A;  4EGZ A;  4UVA A;  4D0P A;  2JSC A;  2PLY A;  4HYE A;  2HR3 A;  4HX7 A;  2O3F A;  3HSR A;  1IF1 A;  4EJU A;  2EFN A;  4CYD A;  3I71 A;  1TQM A;  4HX8 A;  3K1N A;  4UUV A;  2HQR A;  2TDX A;  4GYI A;  3JTG A;  2OZU A;  2VOP A;  3T8T A;  2PBI A;  3COA C;  1YYV A;  3HRS A;  4DNC A;  4XRF A;  4M9S A;  2Z9O A;  1STZ A;  1U78 A;  4BXU A;  3FMR A;  3HIF A;  2ZME B;  4L9V A;  1XSD A;  4QWQ A;  1TNT A;  3T1B A;  1S3J A;  3K9T A;  5ILV A;  3F8C A;  3H3U A;  2VBZ A;  2E7X A;  1XB4 A;  3MZY A;  5D6F A;  3MEX A;  2P8T A;  2VBW A;  3CJN A;  3KP2 A;  1YFH A;  3JTH A;  1LDD A;  2UZK A;  1UFM A;  5F64 A;  1E17 A;  1IN4 A;  5DUK A;  1OR7 A;  2RKH A;  2CYY A;  5HLI A;  1ZHF A;  1W7P A;  2FU4 A;  1FOK A;  2EB7 A;  3LQQ A;  2XIG A;  3QU3 A;  5F6F A;  2BGC A;  1O3T A;  2Q8K A;  4ASN A;  1CGP A;  1XDS A;  3BJO A;  4ENN A;  3FMS A;  2G7H A;  2QWW A;  1J59 A;  3F72 A;  3RPQ A;  4IRI A;  4Y17 A;  5DD8 A;  2YX7 A;  3ECO A;  2VT2 A;  1D8J A;  5DD4 A;  3TO9 A;  4RB0 A;  2DT5 A;  2EFO A;  4WXC A;  4OIN F;  1SMY F;  2FMY A;  3JAM K;  3C7J A;  1PP7 U;  2G7U A;  1BBY A;  4L18 B;  1EV7 A;  2H27 A;  5J8F A;  3ROU A;  2GXB A;  1FBQ A;  4CDG A;  4ESF A;  2FML A;  1H9G A;  4LMY A;  5FD5 A;  4KDP A;  3TOA A;  2A6E F;  5BPD A;  3RTR A;  1PP8 F;  3PQJ A;  5ICE A;  1ZRF A;  2JRT A;  5ICC A;  1ZRD A;  5BPI A;  2DI3 A;  2FE3 A;  5FB2 A;  4LLG F;  3JSP A;  1IN6 A;  5FGM A;  3FWE A;  3QPT A;  2FBH A;  3FMQ A;  3LWF A;  1TW2 A;  2GQQ A;  4I0A A;  3KET A;  1ZYR F;  3VOE A;  1JHF A;  1FT9 A;  1E2X A;  3M8E A;  2WC2 A;  4PCQ A;  1SD6 A;  4HX4 A;  3RKW A;  1K79 A;  1FP1 D;  1V3F A;  2ELH A;  3E6M A;  2RGV A;  5ILU A;  2JZY A;  2IRF G;  5H6R A;  2M30 A;  2X0L A;  2F5D A;  3KLO A;  2O8X A;  3H3Z A;  4U7D A;  5HS8 A;  5D6E A;  3KLN A;  3I59 B;  3F6V A;  4IHS A;  3T5X A;  3ABU A;  2FF4 A;  4GGG A;  2OAZ A;  1ON1 A;  5E1W A;  3GO5 A;  4U88 A;  2KIM A;  1ULY A;  2BEO A;  3L9F A;  1EH7 A;  3N97 A;  1R7J A;  1YS6 A;  4N9H A;  2H94 A;  4LB5 A;  5FLX Z;  2ACJ A;  1MJ9 A;  4IRG A;  3Q5F A;  1FBS A;  1XDU A;  2VE8 A;  1ZH5 A;  1YTY A;  2L4M A;  1NHA A;  4M72 A;  1JHH A;  3ZN1 A;  1G3T A;  5LRS A;  3F8B A;  2E7W A;  3WTY C;  2EV0 A;  2WWY A;  1G3Y A;  2Q2E A;  2Y75 A;  3HSF A;  5HDK A;  4ZYD A;  1FWZ A;  3HHG A;  4MNU A;  3I64 A;  2NNN A;  2P5K A;  1PDN C;  2ZFW A;  2LF7 A;  1OMI A;  4L0Y B;  3IKT A;  1HXD A;  1XCV A;  4L5I A;  5DDG A;  2FBI A;  1ZG1 A;  1YS7 A;  2WTE A;  1MDM A;  1SMT A;  2A5Y B;  5L3E A;  2FNP A;  2DQR A;  2M5W A;  3JW4 A;  2DO7 A;  4A0Z A;  2PMU A;  4I98 B;  1XGN A;  4HF1 A;  4I7H A;  3ZMD A;  4RGX A;  1ZGA A;  3GEZ A;  2NAZ A;  1LJ9 A;  3DFG A;  3LST A;  3ISP A;  1OKR A;  3GXO A;  3QU6 A;  2NNY A;  4MHG A;  1IRF A;  4IVN A;  4FX4 A;  4U0Y A;  4P5O A;  4PZJ A;  3MZH A;  1UHW A;  2ZME A;  3P9K A;  5IT9 Z;  2CG4 A;  5EEG A;  5D8K B;  4N0B A;  3FM3 A;  1B6A A;  2COM A;  3KEQ A;  2ISZ A;  1B9M A;  3SXY A;  3TDZ C;  1Z91 A;  4HQM A;  2XKP A;  1BI0 A;  3MQ0 A;  1ZLJ A;  4KFC A;  4R1H A;  1IXC A;  4RGU A;  2R7D A;  2DK8 A;  4IJA A;  3MAJ A;  3QPH A;  5AIP A;  2JPB A;  3QAH A;  1R5H A;  4FHT A;  2HFH A;  2VT3 A;  2HTJ A;  2GA2 A;  2Z33 A;  1U5T C;  3ZMS A;  2HEO A;  5HOO A;  3SFZ A;  1HKS A;  1Y0U A;  4OIR F;  1BM9 A;  4UVC A;  4BHP A;  1HQC A;  1WKM A;  4CZZ A;  2PG4 A;  4OMZ A;  3E5U A;  1IUY A;  2L01 A;  3LAJ A;  1LVA A;  3K1M A;  2OQR A;  1XSX A;  4CIC A;  3I0T A;  1BIB A;  1G3S A;  2DBB A;  3GLX A;  4EM1 A;  5BQT A;  2STT A;  1X3U A;  3SHF A;  4HDU A;  4MTE A;  3F8N A;  3KZY A;  4G7O F;  2K86 A;  1I1S A;  5F1R A;  5E17 F;  4BHB A;  4BQA A;  3DQV C;  1ZAO A;  4G6D A;  2GXG A;  2HKX A;  4IF4 A;  1CF7 A;  2IA2 A;  2VE9 A;  1OPC A;  1KA8 A;  2UXN A;  5ICG A;  5FO5 A;  3N4M A;  2MD5 A;  4JK1 X;  4A6D A;  1FC3 A;  1FY7 A;  3FXQ A;  2HGC A;  1U3E M;  1EH6 A;  5LGT A;  1K78 A;  2QVO A;  4H0E A;  4ZYE A;  3CLO A;  1LDK B;  3HRM A;  4RAY A;  2JPC A;  3V8K A;  1XCB A;  1WI9 A;  2MA3 A;  1T6S A;  3CDH A;  1MJA A;  4MTD A;  2DLL A;  2ESN A;  3HSE A;  5LLQ A;  5KVR A;  1JGS A;  1XSV A;  4AWX B;  2L4A A;  2JTV A;  1LB2 A;  3SQN A;  2V1X A;  3ZPL A;  4MGR A;  2LNB A;  2M1B A;  3BRO A;  1RUN A;  5BMZ A;  3RYR A;  3BJ6 A;  1XMK A;  3C18 A;  5CVI A;  5ERI A;  3O6B B;  1P4W A;  3WOD F;  1QZZ A;  3M8F A;  3J7A O;  2RC4 A;  1YQA A;  3I59 A;  5E8G A;  4NQW A;  5JFR A;  2MC3 A;  1YLF A;  4GXO A;  2D1H A;  2GA1 A;  2PN6 A;  6PAX A;  2P5L C;  2BV6 A;  1G3W A;  1D3Y A;  2Z99 A;  3D5L A;  3J81 Z;  3WE2 A;  5DCF A;  4WWC A;  2QQA A;  4I01 A;  1FNN A;  4UV8 A;  5L3F A;  2Z3Y A;  1KU7 A;  3EET A;  5E20 A;  4G7H F;  4WK8 F;  1R23 A;  3WU1 B;  3I54 A;  5HLH A;  3HHH A;  2P7C B;  4KT5 C;  5J8C A;  2UXX A;  2LF8 A;  4A6E A;  4KIG A;  2FA5 A;  1MD0 A;  3MFK A;  1YO5 C;  4RB2 C;  2Q0O A;  4BNC A;  3GFL A;  3IRR A;  3FF5 A;  2QLZ A;  1YG2 A;  4IHT A;  2OBP A;  3HYI A;  4ENM A;  3L7W A;  1R1T A;  2O6G E;  3JAM Z;  2G9W A;  1FSE A;  1KQ8 A;  3P7N A;  1O3R A;  1QNT A;  4FT8 A;  2YX4 A;  1LQ1 A;  4QLC U;  4XLN F;  4N9I A;  1S7A A;  1T0F A;  2IA0 A;  2PQ8 A;  2M8E A;  2NYX A;  3KP6 A;  2V1D A;  2E1C A;  3DV8 A;  2RN7 A;  2OA4 A;  3FM5 A;  4RB3 C;  5A2Q Z;  4O3M A;  3KZZ A;  1F4K A;  5ILS A;  1I27 A;  3L00 A;  1TNS A;  2H6C A;  4I0B A;  3ULQ B;  1FSH A;  1IXR C;  4LB6 B;  3J80 K;  4IRH A;  4O5V A;  1HKQ A;  3C3W A;  3IL2 A;  4CO8 A;  2YSR A;  1R1U A;  1R1V A;  1CF7 B;  3G73 A;  1QGP A;  3BZ6 A;  3ERE D;  2EA4 A;  4HV6 A;  2W57 A;  3V7S A;  4BYY A;  4KN4 X;  2ESH A;  3V7R A;  1BC8 C;  4MEX F;  1BI1 A;  1MKM A;  3R6S A;  4EM0 B;  4HQE A;  3C1D A;  4KN7 X;  3KP5 A;  1V4R A;  3BOQ A;  4EJW A;  2MH2 A;  2H6B A;  3FXR A;  1AOY A;  1R22 A;  1K78 B;  2HZT A;  3SZP A;  2ETH A;  1IXS B;  1HW5 A;  1ODD A;  2YPR A;  1QZY A;  1ZG5 A;  3PQK A;  1S29 A;  3BJA A;  5DEQ A;  2CO5 A;  2PEX A;  3ZQ7 A;  3GFJ A;  1J9I A;  4LFU A;  3FHZ A;  5LHH A;  2LSO A;  4RB1 A;  2ZCW A;  2VOO A;  5L3B A;  5ED4 A;  5BS6 A;  2JT1 A;  1SFE A;  4KNY A;  3E3V A;  3O2P E;  3KFW X;  4ZZL A;  1F5T A;  5DCM B;  2ISY A;  2D1V A;  5D5V B;  1JE8 A;  2L02 A;  3R0J A;  2V79 A;  4A5M A;  1ZGJ A;  1SD4 A;  1P4X A;  3P9I A;  2QEN A;  2K02 A;  2RNJ A;  4HAM A;  2DQL A;  3RPU A;  4Y15 A;  4BHC A;  3L09 A;  4EVI A;  3OV8 A;  4KIB A;  4ESB A;  3KP3 A;  1ON2 A;  3RYP A;  2R7F A;  2YR2 A;  4RGR A;  4M9X A;  4AIJ A;  4YG2 F;  3V4G A;  1T98 A;  5H20 A;  1IZ1 A;  1KU2 A;  2XRN A;  3DPT A;  5HS7 A;  1WRJ A;  4UHT A;  1IN5 A;  1XD7 A;  2V9V A;  3E6C C;  4HV5 A;  5HDN A;  2CW0 F;  2KIU A;  2KJB A;  4L9J A;  3VFZ A;  3T8R A;  1LEB A;  4G9Y A;  4EV0 A;  2FBK A;  5CLS A;  1Z1D A;  2PFB A;  1XN7 A;  4I02 A;  1Q1H A;  2E1N A;  3FX3 A;  3BP8 A;  3CO6 C;  3WGG A;  5HS9 A;  4M6X A;  3ZMU A;  3GW2 A;  4MEY F;  1RIO H;  3GUD A;  1ONV A;  4A0Y A;  1REP C;  2F5F A;  4KMF A;  1L0O C;  2XAQ A;  3FZV A;  4KYW A;  2FEZ A;  2CQK A;  3B73 A;  1L3L A;  4HZF A;  4A12 A;  1USS A;  4LJZ F;  4NB5 A;  1MGT A;  2MH9 A;  3WU0 A;  1I5Z A;  4Y13 A;  2F2E A;  2XKO A;  4LLL A;  1B9N A;  2K7L A;  4DQ2 A;  2H09 A;  2IVM A;  4G8X A;  3GZ5 A;  2IP2 A;  4EJT A;  3I5U A;  1QPM A;  3QRF F;  3ZMT A;  1GVJ A;  2DTR A;  3GX4 X;  3F3X A;  1TTY A;  2C6Y A;  1GXQ A;  2L54 A;  2DU9 A;  4LK1 F;  1LDJ A;  1U5T A;  1O7F A;  3CUQ C;  3EYY A;  4A0X A;  2P4W A;  2EJR A;  2CFX A;  5BOX A;  4BH9 A;  2F5C A;  2BYV E;  2ZNY A;  1DPU A;  1ZRC A;  5IT9 K;  3HTS B;  5AIQ A;  1O57 A;  1HW1 A;  2GWR A;  1FYM A;  5KK1 A;  3OOP A;  2NS0 A;  3RKX A;  5D4R A;  1ZRE A;  4HOB A;  2B0L A;  3R61 A;  5LHI A;  3K1P A;  3NRV A;  3F22 A;  1R36 A;  4MQ9 F;  5EEH A;  3JSO A;  1DP7 P;  2RV8 A;  1KU9 A;  1U2W A;  3MCZ A;  4GCV A;  4G6Q A;  1I6X A;  4ZYG A;  2XHK A;  1ZAR A;  2IA1 A;  2CSO A;  3Q9V A;  3WTT C;  2O03 A;  5TRD A;  4IXA A;  3NQO A;  2FNA A;  1XMA A;  3ZMV A;  2MLK A;  2OD5 A;  3IHU A;  3QP6 A;  4ESJ A;  4ZYH A;  5ICF A;  4UVB A;  2XVC A;  4R8H A;  3TDU C;  4F7Z A;  1GHC A;  3RIR A;  1TQI A;  1FX7 A;  2K4B A;  4EGY A;  1S7O A;  3GWZ A;  5LGU A;  3TOB A;  4Q4Z F;  2YU3 A;  2HYF A;  2QQB A;  1R58 A;  2FSW A;  2MBF A;  1K6O A;  3TQN A;  3IC7 A;  2IW5 A;  1ZG3 A;  1H0M A;  2DPD A;  4ON0 A;  4R79 A;  5L3G A;  2IJL A;  2Y0M A;  3WE3 A;  4OOI A;  4WCG A;  3ZP5 A;  5D5U B;  1SD5 A;  1WSU A;  4M74 A;  4L9T A;  4L9N A;  2QBY B;  4U7B A;  3GZ6 A;  2QUF A;  5K5R A;  5AON A;  4TV7 A;  4AVP A;  2R3S A;  3E6B A;  2KIF A;  1HKT A;  2DW4 A;  1KU3 A;  3LFK A;  1UB9 A;  5H6Q A;  3EDP A;  2NRA C;  4I2O A;  2GIV A;  2W25 A;  4OU0 A;  3CTA A;  4P55 A;  2VC0 A;  3I58 A;  3DF8 A;  3RJP A;  3TKY A;  4HDV A;  1GXP A;  3ZN0 A;  1FBU A;  1J75 A;  5DCM A;  5D5W B;  4G94 A;  1G4D A;  2XAF A;  3WGH A;  3ZMZ A;  4XLP F;  1D5V A;  1Z6R A;  4P9F A;  2PJP A;  1J5Y A;  1T2K A;  3S2W A;  1XGS A;  1KYW A;  1BC7 C;  2A07 F;  1FLI A;  3GVA A;  1Z6T A;  5LGN A;  2WV0 A;  2P6T A;  3CUQ B;  4B8X A;  2VON A;  2FQ3 A;  5FFX A;  3ECH A;  3IRQ A;  4GYG A;  2P5V A;  3EYI A;  1P2F A;  2P6S A;  4HW0 A;  5HVQ C;  2XAS A;  3HRU A;  5LBQ A;  5J6X A;  3TGN A;  1UHM A;  2DAO A;  1U5T B;  4KUM A;  1RI7 A;  4KIC A;  1TBX A;  4HBL A;  2V6C A;  4M73 A;  4UXN A; 
#chains in the Genus database with same CATH topology
 3U1D A;  1G59 A;  2HNH A;  3A2K A;  5E1Z B;  3BWG A;  4AD9 A;  3LAP A;  3F8F A;  2EQR A;  5EGO A;  3HTU A;  3HOS A;  3REO A;  4P9U A;  3KEO A;  1KYZ A;  4BJ6 C;  2A61 A;  3J81 K;  3HPG A;  1JKO C;  1OCR H;  4L0Z B;  1BN5 A;  3QQA A;  2K40 A;  2K9Q A;  1A04 A;  3I9V 2;  1EJ9 A;  4B09 A;  3R0A A;  3ABT A;  2L7Z A;  3OR2 C;  3UKG A;  3J80 Z;  2M45 A;  1P4A A;  1R4N B;  3NAU A;  3I56 I;  1VQ7 I;  4D5C A;  5JR3 A;  1UAA A;  1O4X A;  2XRO A;  4MQV A;  1HST A;  2ZJ2 A;  4U0V A;  1WQ2 A;  4ENK A;  1O3Q A;  1IW7 F;  3OYB A;  4A69 C;  3EQL F;  1VQ5 I;  3U9G A;  2BXY A;  2Z2S B;  3GZN B;  1OR7 C;  3OWT A;  1C0W A;  4CH7 A;  1NG6 A;  1UG0 A;  1BOA A;  2OTL I;  2MC4 A;  1QO0 D;  3W6J B;  4BDY A;  2VBY A;  3L2C A;  4LG0 A;  2XF6 A;  4XLA A;  5K5O A;  2LRE A;  1F43 A;  2L9V A;  3LQR A;  4C3J J;  2RVC A;  2N8G A;  2ZXW H;  4ETS A;  2ZBK A;  2DMQ A;  4LLN A;  1FIP A;  1K7A A;  1RUO A;  3E7L A;  2BY3 A;  4K2E A;  3LSM A;  3IAS 2;  1H9T A;  4RGS A;  1AA7 A;  2XGD A;  3F9K A;  1LNW A;  3V8L A;  3ZQL A;  3CP2 A;  5B1B H;  1A6Q A;  1WGX A;  2BY0 A;  3CDI A;  5LRR A;  5L3C A;  3DKW A;  2CWE A;  4QTR A;  2CRG A;  3H5R A;  3PUF A;  3O8H A;  1ZTR A;  5K7H A;  1JKR C;  5FFZ A;  3DKX A;  3OS2 A;  1G6N A;  1TWH J;  2K9L A;  3BG5 A;  3WTS C;  4N4N B;  3ZQG A;  3PSF A;  1NK2 P;  5F27 A;  3CUO A;  5CVJ A;  1QBJ A;  3KP4 A;  1YIO A;  1O7L A;  1SVL A;  3R60 A;  2VBX A;  4UV9 A;  5HOD A;  1U8R A;  3S1N J;  2KRF A;  1VQ6 I;  2J5O A;  4M9Z A;  2ECB A;  5A2Q K;  1FMW A;  3A02 A;  4HNT A;  3WTU C;  4PFO A;  4DGW B;  3NWT A;  4KA4 A;  4M71 A;  3I53 A;  4DJA A;  1MMN A;  4L5J A;  4P96 A;  2UWM A;  2CS3 A;  2VKE A;  3D5R C;  3RDI A;  4CGZ A;  3HOU J;  2PI0 A;  1X1A A;  2NS7 A;  1YW9 A;  2HVQ A;  4A3E J;  2P0W A;  2EIK H;  1FYL A;  1RKT A;  3M1E A;  3ZQC A;  2K3F A;  4F3Q A;  1ETX A;  4IHX A;  1F9N A;  1MZB A;  2VXZ A;  3QOD A;  2QA4 I;  2LH9 A;  5D4S A;  1XGO A;  2XB5 A;  2EA2 A;  3I4P A;  3LSJ A;  3W2W A;  5E8I A;  1JTX A;  2PJR B;  2HKO A;  1DPR A;  4S04 A;  3GTO J;  2GAU A;  1W7P D;  1JXS A;  1UST A;  2M87 A;  2ZC2 A;  2VOD A;  1APL C;  2HWV A;  3BDD A;  4CXF A;  3FXU A;  1F36 A;  3L2Q A;  2V1U A;  1D0Y A;  2MSY A;  2CMP A;  1JT6 A;  4RAF A;  5DV5 A;  4E4H A;  1MIJ A;  1XGM A;  2GOX B;  1KQ0 A;  4JYK A;  4IPA A;  2W84 A;  1IO2 A;  4CA0 A;  1J7K A;  2DT7 B;  2XAJ A;  1Z21 A;  2HOE A;  3FDY A;  4YFK F;  2KMU A;  3DCF A;  1W1W E;  2XF7 A;  1B59 A;  2WAD A;  3B02 A;  3SZT A;  2DMN A;  4ZTJ A;  1DUX C;  1TT5 B;  3C2H A;  4KIF A;  3HOY J;  3P9C A;  1PUE E;  2D45 A;  2EWN A;  3DTE A;  4JP0 A;  1RKW A;  2EV5 A;  1TLH B;  1X19 A;  3IWF A;  1MND A;  4HF0 A;  3VYS B;  2E5N A;  4JQF A;  5FRO A;  3DEU A;  4WF2 A;  1NH3 A;  2EIN H;  1S6L A;  3CP8 A;  4G7Z F;  4UUS B;  3VSK A;  4I6Z A;  4XRS G;  3DP7 A;  4N4O B;  4RLF A;  2GOM A;  3K69 A;  3A1Y A;  4X0G A;  1M1E B;  3BY6 A;  3L1P A;  3CCJ I;  5LHG A;  4A93 J;  3GFM A;  3BR2 A;  5DM7 F;  2CQX A;  3OY9 A;  3G6E I;  1T38 A;  4LGW A;  1VQ4 I;  5IY5 H;  2E34 A;  5J1R A;  5M5Y J;  3ML6 A;  3EUH A;  2HOT A;  2MLG A;  3BG7 A;  4V19 K;  1LEA A;  5CKT A;  4RS8 A;  1TW3 A;  1VF9 A;  2DT6 A;  1D8K A;  4O6J A;  1Y1W J;  2QYO A;  4A3M J;  1JGG A;  4A3C J;  2ICW G;  3E5Q A;  1SAX A;  1LFU P;  3DPU A;  2HYG D;  2M7A A;  1RZ4 A;  4ZH4 F;  1VQL I;  3WTX C;  3CC2 I;  4X6A J;  2IGO A;  1VFC A;  2A69 F;  2F48 A;  2BVL A;  3RQI A;  3D0S A;  4KMU X;  1R4M B;  3TP3 A;  3HOT A;  2JRM A;  1B4A A;  3HUG A;  2L7K A;  1JKP C;  3HB9 A;  1UCR A;  5FD6 A;  2XUB A;  4BBS J;  4IX7 A;  2NVX J;  1R5G A;  1VQ8 I;  4S0H B;  4PGH A;  1B1B A;  3TMO A;  2OZ6 A;  2PMH A;  3NEU A;  4YIF A;  4DZJ A;  1SC7 A;  2LTP A;  1J0R A;  1X4O A;  1YRN B;  4PDK A;  3DXJ F;  5EDN A;  3HC7 A;  2A6H F;  3PNT A;  3OYF A;  2DMP A;  2QZ8 A;  2XGC A;  2Z1D A;  1MNM C;  3OYI A;  1SFU A;  4E7H A;  4YFN F;  1W7P B;  3V7C A;  2W85 A;  5CVV A;  2LY1 A;  2Y9Z A;  2ZKZ A;  3PL8 A;  4BJ5 C;  5K5Q A;  3OYD A;  3F8M A;  3F23 A;  1W5S A;  3KEY A;  2A68 F;  3HRT A;  2X9D A;  3BG9 A;  5CVU A;  2DK5 A;  1HF0 A;  3PFI A;  4HLX A;  2LKP A;  5FLX K;  2QBY A;  3BG3 A;  4I09 A;  2E1M C;  3AG4 H;  2VN2 A;  2L3D A;  2XGX A;  3GF2 A;  2VC1 A;  3K0L A;  5HDG A;  2QM3 A;  1RNL A;  2EV6 A;  1OYW A;  3AFH A;  4LG0 B;  1TWF J;  3K6G A;  5FLM J;  3FXO A;  3LSK A;  2NVY J;  4LK0 F;  1OCC H;  3CCV I;  2Z5U A;  2W00 A;  4WXD A;  1OCT C;  3TO7 A;  4XM3 A;  2ZJR F;  1X1D A;  1J2X A;  3BTC A;  1Z7U A;  3ZOB A;  5IP7 J;  1WJA A;  1U6G A;  3BPV A;  4GO1 A;  2QQ8 A;  2ZXJ A;  2Y48 A;  1POG A;  2DA5 A;  1DDN A;  4II3 A;  3ELK A;  2K4J A;  2BVM A;  2EK5 A;  3BQY A;  2AXL A;  5IT3 A;  4CCO A;  4S05 A;  3OIQ A;  3S1M J;  1EF4 A;  3ZQF A;  1IDZ A;  2DA4 A;  2DCE A;  2LG4 A;  3CQZ J;  1FPQ A;  5M3M J;  1F1Z A;  1ZLK A;  3DBL B;  2BE5 F;  2IPQ X;  3CF2 A;  2LP0 A;  4MFE A;  4ZZD A;  2A3S A;  1Z9C A;  1OYI A;  1IN8 A;  3H5N A;  3U1K A;  2ADU A;  3WTZ A;  1K6Y A;  3UR3 C;  4Q47 A;  5J1U A;  3BTI A;  1SFX A;  2EFW A;  1HSJ A;  2LDU A;  2XV4 S;  3CDL A;  5CJ9 A;  1BI3 A;  4HA8 A;  4XSX F;  4RMN A;  5HLG A;  1QU3 A;  2HZD A;  4EMS A;  1V5G A;  2IBD A;  1DP3 A;  4U0W A;  2BBY A;  4PJN A;  3M7G A;  4LD5 A;  1D1B A;  2P81 A;  3BR3 A;  3CUQ A;  4M3D A;  4JOM A;  5GPC A;  1I1G A;  4RA2 A;  3BPX A;  3E5X A;  1VTN C;  4M6Y A;  4A3F J;  2OU2 A;  5F0C A;  4Y52 J;  1UG2 A;  2VAS A;  3QPL A;  4II2 A;  1JUS A;  2VL8 A;  3MWM A;  3QP5 A;  3TO6 A;  1SD7 A;  2XPV A;  3V8J A;  2HQN A;  3BR1 A;  3H36 A;  4MLO A;  2A6T A;  2P7V B;  4BUP A;  5JVT A;  1AWC A;  4A5N A;  4E70 A;  1TQP A;  4JBA A;  4WXH A;  4C2T A;  5EEA A;  4CHU A;  2LK2 A;  1P6R A;  1IAW A;  4UNO A;  1I3A A;  4OIP F;  5DUI A;  2K9M A;  2ZME C;  3IP4 B;  4HEA 2;  4Z2Y A;  5GAH J;  1BI2 A;  1S8N A;  3GTK J;  2VPL A;  2W4S A;  5DYM A;  5FKN A;  2QGU A;  3KP7 A;  2W82 A;  2RQP A;  3OL3 A;  4DBR A;  1WWX A;  3F0C A;  3GME A;  3IWZ A;  3VOD A;  2VKV A;  3F21 A;  2FXA A;  3WTW C;  1G8X A;  3WTV C;  3G3Z A;  3LSR A;  5E1X A;  4OIO F;  5JI6 A;  1VZ0 A;  3QOP A;  2IS6 A;  1J09 A;  3E97 A;  4V2F A;  2DDB A;  1LVK A;  2KLO A;  4Y7N J;  5CVR A;  4HF2 A;  2RDP A;  3BR0 A;  4RAZ A;  1SFK A;  2KJC A;  4OIQ F;  5CQE A;  1IJW C;  1KGS A;  1HBX G;  2K9N A;  5LEK A;  4D1Q A;  1BJA A;  5K1Y A;  3VB2 A;  1HDP A;  3HOZ J;  4D7M A;  2XDV A;  3GTJ J;  3RI4 A;  2DFI A;  4BAY A;  3T0Y A;  3S3M A;  4YFX F;  2R92 J;  1BIA A;  1O3S A;  1Z05 A;  3SZG A;  5TJJ A;  2HTS A;  1KON A;  5E18 F;  1W0T A;  4WX9 A;  3BZC A;  2V7F A;  2WY8 Q;  3CJQ B;  2QQ9 A;  5LEJ A;  3KE2 A;  4NHJ A;  2VQH A;  3H92 A;  3LA7 A;  1HW2 A;  2AS5 F;  4Q5S F;  1PVE A;  2KKO A;  4IOC F;  1E3O C;  4ZYA A;  3RKY A;  2L9R A;  3HBL A;  3KX2 A;  1IN7 A;  1BOB A;  4EJV A;  5L3D A;  1K83 J;  2WAQ N;  2BZT A;  5D8L B;  3E6D A;  1ZN2 A;  3DU5 A;  4Z6Y A;  4RM3 A;  2XAG A;  2NVT J;  3QPS A;  1FYK A;  2ZO4 A;  2OQG A;  4AIK A;  2H8W A;  3WGI A;  2EBI A;  1P92 A;  4XBF A;  4HLY A;  2K27 A;  2HS5 A;  3FBN B;  3M9A A;  2F6C A;  5JHU A;  2VB6 A;  1OYY A;  3RZO J;  4PGG A;  2HDC A;  1KQ9 A;  3VEP A;  2ZB9 A;  3HUG B;  2Y0S N;  3DPL C;  4XLE A;  2STW A;  2CGP A;  1W4M A;  2KRC A;  2R7S A;  2W24 A;  5CQG A;  1YW7 A;  3O3K A;  1HLV A;  4EQQ A;  3PIP F;  3GFI A;  2J5P A;  2GZW A;  2KZV A;  2AQE A;  2YU9 J;  3AAF A;  3OR1 C;  2BY2 A;  4EJO A;  1W5T A;  4GFB A;  4Q48 A;  1MW7 A;  1MJB A;  4FCY A;  3W6V A;  2E1M B;  3CO7 C;  2VUM J;  1Z77 A;  4BDZ A;  3M3Y J;  3F6O A;  4FET A;  3G1M A;  2A5W A;  3U2R A;  4BEH B;  5M5W J;  2LYC A;  1EH8 A;  3IKV A;  1T39 A;  1MSE C;  1DQU A;  2ZNZ A;  1R00 A;  2F5E A;  2X4H A;  2G0E A;  2O61 A;  1JT0 A;  2O0Y A;  2CFO A;  2IT0 A;  5B5E C;  3GYH X;  1QQI A;  2Q2E B;  3AG1 H;  3CC7 I;  4PJ0 C;  2EFQ A;  2EFP A;  4A2U A;  1K4S A;  4AU7 A;  2FRH A;  1IRG A;  1GV5 A;  4M3F A;  4UB6 C;  1FP2 A;  2Y2Z A;  3LA2 A;  3K2Z A;  2X48 A;  3BC8 A;  4NC8 A;  1NK3 P;  1LUJ B;  4EM2 A;  3HL2 A;  3A0H C;  5J3L A;  5FRM A;  2PJR A;  3KYD B;  3TBI A;  4AIH A;  2XC7 A;  3Q9S A;  1ZKG A;  3LA3 A;  3OS1 A;  1W36 C;  1D1C A;  1YW8 A;  1FZP B;  4FX0 A;  3WG9 A;  2D2W A;  1P9Q C;  2Z16 A;  3SDB A;  3M4O J;  2DPU A;  2VKH A;  3W6K B;  3KCC A;  1MDM B;  5KHD A;  3W3C A;  2VIX A;  4YII A;  2V26 A;  3PFY A;  4ENJ A;  4IKF A;  4XSZ F;  2BW3 B;  1U9O A;  5D5X B;  3R4K A;  2FOK A;  2XAH A;  2M4K A;  5CYV A;  3X2Q H;  4OMY A;  3HPH A;  4EGZ A;  4UVA A;  4D0P A;  2JSC A;  2JVH A;  2LY9 A;  2PLY A;  2HXI A;  4HYE A;  2HR3 A;  1JTY A;  4HX7 A;  1R6R A;  4XKV A;  2O3F A;  1XPX A;  3HSR A;  3CMY A;  4E7J A;  5CPR B;  3FXK A;  2MW8 A;  3GTM J;  3D5S C;  1IF1 A;  1N25 A;  4EJU A;  1RES A;  3OS0 A;  2EFN A;  4CYD A;  3I71 A;  1TQM A;  1A36 A;  4HX8 A;  3K1N A;  4XLC A;  1VQN I;  1N78 A;  2WV1 A;  4UUV A;  2HQR A;  2TDX A;  4GYI A;  3JTG A;  2E19 A;  2OZU A;  3H3V K;  3LSP A;  1ETQ A;  2DA3 A;  2VOP A;  3T8T A;  2PBI A;  4UUS A;  2ZSI B;  3COA C;  3K4M A;  2R7Z J;  1YYV A;  3HRS A;  4DNC A;  4XRF A;  4M9S A;  2Z9O A;  1BW5 A;  1DU0 A;  2LBF B;  2EZL A;  1STZ A;  2W1O A;  1U78 A;  4BXU A;  3FMR A;  2NVQ J;  3HIF A;  2ZME B;  3J7A Y;  1MMD A;  2I8D A;  4L9V A;  1V54 H;  1XSD A;  4QWQ A;  1TNT A;  1Y1V J;  5E3M A;  1GDT A;  3T1B A;  1S3J A;  2HQ5 A;  3K9T A;  1RC9 A;  1YIJ I;  3I4N J;  2CUF A;  4P1W A;  5E3L A;  2CH0 A;  3OYE A;  5ILV A;  3BQZ A;  3IV5 A;  3F8C A;  3H3U A;  4AYB A;  2AO9 A;  2JSP A;  2KQR A;  3OYA A;  2R5Y B;  2VBZ A;  5DTD A;  2E7X A;  4FE7 A;  3E1S A;  2BHY A;  4AID A;  2X6Y A;  3CES A;  1XB4 A;  3RSN A;  3MZY A;  4NBQ A;  5D6F A;  3G4S I;  3MEX A;  2P8T A;  2VBW A;  3CJN A;  3KP2 A;  1YFH A;  3M07 A;  3JTH A;  1LDD A;  5TIS C;  1BL0 A;  2UZK A;  2LKX A;  1UFM A;  1YRN A;  3OIO A;  3DEW A;  5EF6 A;  2FOW A;  5F64 A;  4C3I J;  5EYR A;  2EPF A;  4BL0 B;  1E17 A;  2LLK A;  2DA7 A;  2WBM A;  1IN4 A;  5DUK A;  1OR7 A;  2DTZ A;  2RKH A;  3GTG J;  3AG3 H;  2CYY A;  5HLI A;  1ZHF A;  1BR2 A;  1W7P A;  3LOC A;  2FU4 A;  2XPU A;  2EB7 A;  1FOK A;  3LQQ A;  2XIG A;  3QU3 A;  1ERD A;  4LIU A;  5F04 A;  2H1K A;  5F6F A;  4A3G J;  4QPO A;  2BGC A;  5JLW A;  5E3N A;  1O3T A;  1S72 I;  4JX4 A;  2Q8K A;  4ASN A;  3I3L A;  1CGP A;  1XDS A;  5J47 A;  3BJO A;  3MKL A;  3B6A A;  3OYJ A;  4ENN A;  3FMS A;  3S32 A;  4DOZ A;  3EUK L;  2G7H A;  2QWW A;  1IG7 A;  4CCK A;  3LFU A;  1W5C C;  3F72 A;  3RPQ A;  1J59 A;  2V9K A;  4IRI A;  3K4B A;  4Y17 A;  5DD8 A;  1IV8 A;  2YX7 A;  3ECO A;  2VT2 A;  2IGN A;  1D8J A;  2L7M P;  5DD4 A;  4I76 A;  3TO9 A;  4U87 A;  4QIW N;  4RB0 A;  2DT5 A;  1FIA A;  2EFO A;  4WXC A;  4OIN F;  1BW6 A;  1SMY F;  2FMY A;  2X6W A;  3JAM K;  1P7J A;  3C7J A;  2KIQ A;  3I55 I;  1PP7 U;  2G7U A;  2NVU B;  1BBY A;  1T0F C;  2KL4 A;  3ZCO A;  2LC2 A;  2E2H J;  4BJT A;  4L18 B;  3NWS A;  4A3D J;  1DU6 A;  1SVO A;  1U0J A;  2X1E A;  1EV7 A;  1IV6 A;  1MBF A;  2X51 A;  2H27 A;  5J8F A;  3ROU A;  2E2J J;  2GXB A;  1FBQ A;  1X1B A;  4CDG A;  3FXJ A;  4ESF A;  2HVR A;  1TL8 A;  1AU7 A;  2FML A;  1H9G A;  3L2U A;  1VQ9 I;  4LMY A;  4A3I J;  4A3B J;  5FD5 A;  4KDP A;  3PO2 J;  1FYM A;  2DFH A;  2PX9 A;  1Y6I A;  4XLF A;  3TOA A;  3CMA I;  3ZGK A;  2A6E F;  2IEK A;  5BPD A;  2R7T A;  3RTR A;  4C3H J;  2F5V A;  4E6K G;  1PP8 F;  2V4J C;  1OQY A;  3PQJ A;  2NOG A;  1RR7 A;  5ICE A;  1ZRF A;  3RKQ A;  4NUB A;  4I99 C;  2JRT A;  2R7Q A;  5ICC A;  1B72 B;  1ZRD A;  3K4N A;  5BPI A;  1XTA A;  4C9Y A;  2DI3 A;  2FE3 A;  5FB2 A;  1H89 C;  2K9S A;  4LLG F;  5C4X J;  3JSP A;  4G6T B;  1IN6 A;  3B6C A;  2XB0 X;  5FGM A;  2I10 A;  3FWE A;  2R5Z B;  3QPT A;  2FBH A;  3S1R J;  3FMQ A;  4BE2 A;  4RDU A;  4GDF A;  4BU2 A;  2HXO A;  1TW2 A;  3LWF A;  4F55 A;  2X6O A;  3FIW A;  1WZ2 A;  3OMY A;  4NNJ A;  2LOO A;  2ZJP F;  1D0X A;  2GQQ A;  3L2R A;  4I0A A;  1WI3 A;  2VJ5 A;  3KET A;  1AHD P;  1ZYR F;  3VOE A;  1JHF A;  1FT9 A;  1B8I A;  1LE8 B;  1NTC A;  1E2X A;  2COB A;  3JRA A;  3CMM A;  3M8E A;  4FQG A;  3JRE A;  2WC2 A;  2DFE A;  1S5L C;  4PCQ A;  1SD6 A;  4HX4 A;  1Z3X A;  3PM1 A;  3RKW A;  1K79 A;  4CYC A;  2VJI A;  3K70 C;  2IGK A;  4RBO A;  3M1C A;  3FKI J;  3HG9 A;  1FP1 D;  1V3F A;  5FJ8 J;  2ELH A;  2DOD A;  3HDD A;  3E6M A;  1BR1 A;  2RGV A;  1AKH A;  5ILU A;  2JZY A;  2KZG A;  3HGG A;  2IRF G;  2JWT A;  2QF7 A;  3LSH A;  5H6R A;  2M30 A;  2F4M B;  2X1D A;  4C2U A;  2X0L A;  2AHQ A;  2F5D A;  2O8X A;  2ZXI A;  3KLO A;  4B3A A;  3H3Z A;  2EZI A;  5J40 A;  1QVT A;  4EEF G;  4U7D A;  1R5I D;  5HS8 A;  2GM4 A;  5D6E A;  3KLN A;  1WVR A;  2V1N A;  2O8K A;  3I59 B;  3F6V A;  4NQW B;  4IHS A;  3T5X A;  3ABU A;  1Y56 A;  2FF4 A;  1MBH A;  2R7R A;  4GGG A;  4IO9 F;  1YE9 A;  2FX0 A;  2WA0 A;  2OAZ A;  1ON1 A;  4IZZ A;  1T56 A;  3VSL A;  1X58 A;  5EZG A;  4M3B A;  5E1W A;  2MYS A;  3GO5 A;  4NC7 A;  4IHW A;  3BG6 A;  4U88 A;  2DN0 A;  2KIM A;  1ULY A;  2BEO A;  3L9F A;  1EH7 A;  3N97 A;  1TP4 A;  1R7J A;  2VLA A;  1YS6 A;  4F52 A;  4XR6 A;  4N9H A;  4NDL A;  2H94 A;  4LB5 A;  2HPI A;  5FLX Z;  3OYH A;  3QYE A;  3HOX J;  2ACJ A;  5H2F C;  3ZR8 X;  4XKC A;  1MJ9 A;  4IRG A;  4CCJ A;  3Q5F A;  1FBS A;  4B3X A;  4ANJ A;  1XDU A;  4V2G A;  2VE8 A;  4BEH A;  1YTY A;  1ZH5 A;  2L4M A;  1NHA A;  4M72 A;  1TT0 A;  1JHH A;  3ZN1 A;  1G3T A;  5LRS A;  3F8B A;  2E7W A;  1QZE A;  5C44 J;  3TL4 X;  2VJJ A;  3IAM 2;  3WTY C;  2EV0 A;  2WWY A;  1G3Y A;  2Q2E A;  2Y75 A;  3HSF A;  5HDK A;  4ZYD A;  1FWZ A;  4OAZ A;  3HHG A;  3LMM A;  1I39 A;  4MNU A;  3I64 A;  3MMY B;  2NNN A;  2P5K A;  2B7E A;  1PDN C;  2ZFW A;  2BXZ A;  2LF7 A;  1OMI A;  3ZQQ A;  4L0Y B;  3IKT A;  2HU9 A;  3G1O A;  2LMD A;  1HXD A;  3ABK H;  2W48 A;  2LY2 A;  1XCV A;  1WJB A;  4B1R A;  4L5I A;  5DDG A;  3CCE I;  4OAY A;  2FBI A;  1ZG1 A;  1G2H A;  1YS7 A;  2WTE A;  3CCY A;  3TW7 A;  3Q0W A;  1MDM A;  1SMT A;  2A5Y B;  3JRD A;  2Y69 H;  5L3E A;  2FNP A;  3K2A A;  4HST A;  2EZH A;  1R49 A;  4FTH A;  1FOW A;  1DGW Y;  2BW3 A;  2DQR A;  2M5W A;  2ME0 A;  3JW4 A;  2DO7 A;  1I3Q J;  3GBG A;  4A0Z A;  4HNU A;  2PMU A;  1VND A;  4ZTF A;  4W97 A;  2OPT A;  4CZC A;  2GLO A;  2HQA A;  1X4P A;  4I98 B;  1XGN A;  4HF1 A;  4I7H A;  3ZMD A;  4RGX A;  5M5X J;  1ZGA A;  1HCR A;  3GEZ A;  1ZR4 A;  3S93 A;  4XQF A;  2R93 J;  2NAZ A;  1LJ9 A;  2CQN A;  4BKX A;  2JVG A;  3DFG A;  3HOV J;  3ASN H;  5E79 C;  3LST A;  3ISP A;  1OKR A;  4A3L J;  1E0E A;  3OYL A;  3GXO A;  4E7Z A;  5F0H A;  3RPU D;  5F1J A;  2M3A A;  3QU6 A;  4HG2 A;  1K61 A;  5IYC J;  2EIJ H;  2XRL A;  4MHG A;  2NNY A;  2GXA A;  4HRI A;  3HM5 A;  2JA8 J;  1IRF A;  2LBF A;  4IVN A;  5IOZ A;  3FK7 A;  2ZXH A;  4FX4 A;  1YX5 A;  2O5R A;  3HXL A;  4P5O A;  4U0Y A;  2CW8 A;  4PZJ A;  3DKY A;  1UHW A;  2ZME A;  3MZH A;  4RLQ A;  3P9K A;  2KDO A;  1ZR2 A;  5IT9 Z;  2CG4 A;  2L5Q A;  5F08 A;  2M34 A;  4IHV A;  1MMS A;  1ETO A;  5DS9 A;  5EEG A;  5D8K B;  4N0B A;  3TP0 A;  3FM3 A;  2DXI A;  1B6A A;  4DBQ A;  2COM A;  3ZXS A;  2R5Y A;  3KEQ A;  2ISZ A;  1A5J A;  1BJZ A;  4J19 A;  3CCL I;  1B9M A;  3SXY A;  3TDZ C;  1Z91 A;  3HOW J;  1JI8 A;  1K4T A;  2DYR H;  4HQM A;  2XKP A;  2JA7 J;  3C2B A;  1BI0 A;  3MQ0 A;  4X1E A;  3WHC A;  1MBK A;  3HKZ A;  3BTJ A;  3OIP A;  4F92 B;  3GTL J;  1EKE A;  1ZLJ A;  3OYK A;  3CCU I;  4KFC A;  1B8I B;  2HOS A;  4PK4 A;  4R1H A;  1IXC A;  4RGU A;  2R7D A;  2DK8 A;  1OFC X;  2M8G X;  4IJA A;  3OYM A;  4F93 B;  3OSG A;  3A01 B;  2RAE A;  3MAJ A;  1IC8 A;  2ECC A;  2FQ4 A;  3QPH A;  5AIP A;  3CLQ A;  2QSH X;  2JPB A;  3DBH B;  4E7L A;  3QAH A;  1R5H A;  4FHT A;  3QOE A;  2HFH A;  2VT3 A;  4B43 A;  2HTJ A;  2E2I J;  2GA2 A;  4CYC B;  2Z33 A;  1U5T C;  3ZMS A;  1RPW A;  2HEO A;  5HOO A;  3SFZ A;  4M3G A;  1HKS A;  3WU2 C;  1Y0U A;  4OIR F;  1BM9 A;  1ENH A;  1AKH B;  4UVC A;  1KZH A;  4XIC A;  4BHP A;  5EZH A;  1HQC A;  3K4K A;  3MN2 A;  2Y30 A;  1WKM A;  3CJT B;  2JUG A;  2QEX I;  2PMZ A;  5GAG J;  3IH2 A;  4CZZ A;  2FD5 A;  1OCZ H;  2PG4 A;  4OMZ A;  1VQP I;  4PSW A;  5KAI C;  3E5U A;  1IUY A;  2L01 A;  3DU6 A;  3LAJ A;  1LVA A;  5HNF A;  1VQK I;  3PJR A;  4KT6 A;  2BOL A;  3K1M A;  2OQR A;  3CME I;  1XSX A;  2CUZ A;  4CIC A;  4E7I A;  3I0T A;  3Q3S A;  1BIB A;  1G3S A;  2BHZ A;  2DBB A;  3FXM A;  3LL7 A;  3GLX A;  3H1C A;  4EM1 A;  2R7W A;  1R71 A;  1Y39 A;  2KHM A;  5BQT A;  2STT A;  1ITY A;  1EA3 A;  1X3U A;  1GLN A;  3KIO A;  3SHF A;  1R9T J;  3VDX A;  1PJR A;  2F4I A;  4MTE A;  5JHF A;  3F8N A;  2XGE A;  4HDU A;  1YJN I;  1LPQ A;  9ANT A;  3KZY A;  4G7O F;  3H9Q A;  2K86 A;  2VQL A;  1I1S A;  5F1R A;  2VPR A;  3K4J A;  5E17 F;  4BHB A;  4BQA A;  3DQV C;  2E35 A;  1ZAO A;  4G6D A;  2GXG A;  2JN6 A;  2HKX A;  5FKM A;  4IF4 A;  1CF7 A;  1UEL B;  3ZRG A;  4YIR X;  2AXT C;  3BR6 A;  3CCM I;  2IA2 A;  3FBI B;  1H88 C;  3WG7 H;  3JRH A;  2VE9 A;  3JRG A;  1OPC A;  5IYB J;  3CZ6 A;  3CD6 I;  2M0M A;  1V5E A;  1KA8 A;  1ETY A;  4AM3 A;  2UXN A;  1QHG A;  4BS9 A;  1B72 A;  1XS9 A;  5ICG A;  5FO5 A;  3N4M A;  2IS1 A;  3P5J A;  2OV7 A;  2MFZ A;  2MD5 A;  2WB1 N;  1WJE A;  3BLY A;  4JK1 X;  2OC6 A;  3JRI A;  3ASO H;  2XAU A;  3HZJ A;  4QPQ A;  2R5Z A;  4A6D A;  1FC3 A;  1FY7 A;  3FXQ A;  3PNY A;  4AYB N;  3FIS A;  2HGC A;  1U3E M;  2H8R A;  4BQQ A;  3Q0U A;  4ABZ A;  1EH6 A;  5LGT A;  1K78 A;  2QVO A;  3AG2 H;  4H0E A;  1DGR M;  4ZYE A;  3MD2 A;  3V42 A;  4A3K J;  3CLO A;  1LDK B;  3HRM A;  4RAY A;  2E1O A;  2JPC A;  3K4L A;  2XSJ C;  3V8K A;  3LSG A;  4LG3 A;  1SFO J;  1XCB A;  1WI9 A;  3SEQ A;  2V9P A;  2MA3 A;  3K10 A;  1LE8 A;  1T6S A;  3PO3 J;  3CDH A;  1MJA A;  2E71 A;  3QYB A;  5E3O A;  4MTD A;  2Y31 A;  4ZDO A;  2DLL A;  1JUM A;  1X2N A;  2ESN A;  3SFI A;  3HSE A;  5LLQ A;  3K7A J;  5KVR A;  1JGS A;  3LSI A;  2LRD A;  1XSV A;  4AWX B;  2L4A A;  1GUU A;  2JTV A;  4PJL A;  1LB2 A;  4B47 A;  3SQN A;  2CV1 A;  2V1X A;  3ZPL A;  4MGR A;  4XNF A;  2R7V A;  2LNB A;  4XRM A;  1VQO I;  5C3E J;  2M1B A;  3BRO A;  1OCO H;  4XOT A;  1RUN A;  5BMZ A;  4DYC A;  1V55 H;  1ETV A;  3RYR A;  3BJ6 A;  2E5Z A;  1S7E A;  1XMK A;  1PUF B;  2Y0S A;  3C18 A;  5CVI A;  5ERI A;  3O6B B;  1P4W A;  3WOD F;  1QZZ A;  3M8F A;  1Z7L A;  3J7A O;  2ZSH B;  3A03 A;  2RRE A;  2RC4 A;  2EZK A;  1YQA A;  3I59 A;  5E8G A;  4NQW A;  1X3Z B;  2MC3 A;  5JFR A;  4D9J A;  1YLF A;  4GXO A;  2D1H A;  2GA1 A;  4CSW A;  4PJM A;  2PN6 A;  6PAX A;  5J1Y A;  2P5L C;  3KYL A;  2BV6 A;  1G3W A;  5GAD J;  1IDY A;  1D3Y A;  2Z99 A;  4ITV A;  3D5L A;  1D5Y A;  3J81 Z;  3LNQ A;  3WE2 A;  2CQQ A;  5DCF A;  1VI0 A;  4WWC A;  2QQA A;  3OSF A;  4I01 A;  4PFP A;  3DEE A;  1FNN A;  2WAF A;  4UV8 A;  2QKM B;  5L3F A;  5LD2 C;  2Z3Y A;  3VWB A;  1KU7 A;  1YJ9 I;  5JVG F;  2B63 J;  2DA6 A;  5KAF C;  3EET A;  4L5E A;  5E20 A;  1HDD C;  3QWL A;  4M3E A;  3S3N A;  2LR8 A;  2ME6 A;  4D5F A;  4G7H F;  1W36 D;  3JRC A;  4WK8 F;  1R23 A;  3WU1 B;  3CC4 I;  1IUF A;  3I54 A;  5HLH A;  3HHH A;  2P7C B;  1T95 A;  5IPA A;  4KT5 C;  3MKW B;  4AUX A;  5J8C A;  2UXX A;  2LF8 A;  4XOP A;  4A6E A;  1OJL A;  4IEJ A;  4KIG A;  5J4Y A;  2FA5 A;  1MD0 A;  3MFK A;  2KDZ A;  1YO5 C;  4RB2 C;  2Q0O A;  4BNC A;  3GFL A;  4HSR A;  3IRR A;  3FF5 A;  2QLZ A;  1WPK A;  1YG2 A;  5DM6 F;  2HYJ A;  3L2V A;  2JJ7 A;  4IHT A;  2OBP A;  3HYI A;  3W2A A;  1HC8 A;  2XPW A;  4ENM A;  5GP9 A;  3L7W A;  1R1T A;  1ACI A;  2O6G E;  3JAM Z;  2G9W A;  1FSE A;  1KQ8 A;  3P7N A;  1O3R A;  2VKD A;  2DMT A;  1QNT A;  1N77 A;  2JQ7 A;  2MG4 A;  4FT8 A;  1TWG J;  2CU7 A;  2KP6 A;  2YX4 A;  5M3F J;  1LQ1 A;  4QLC U;  4XLN F;  1U9N A;  4N9I A;  1S7A A;  1T0F A;  2IA0 A;  2IS4 A;  3FHN A;  2PQ8 A;  2M8E A;  1WH5 A;  2NYX A;  3KP6 A;  2V1D A;  1JJ6 C;  2E1C A;  4CUG A;  3DV8 A;  2RN7 A;  3E0J B;  2OA4 A;  3C2G A;  3FM5 A;  4RB3 C;  5A2Q Z;  3BR5 A;  3KZZ A;  4O3M A;  1F4K A;  3D1N I;  4XL9 A;  5ILS A;  1Z3Y A;  5B1A H;  1I27 A;  3L00 A;  2L9N A;  1TNS A;  2H6C A;  4I0B A;  1D0Z A;  2QSG X;  3H35 A;  3ULQ B;  1ETK A;  4IHY A;  5EG0 A;  1FSH A;  4AVZ A;  1IXR C;  4XN3 A;  4LB6 B;  3J80 K;  4IRH A;  2OF7 A;  3SDG A;  2Q1Z B;  4O5V A;  2KIS A;  1A31 A;  1HKQ A;  3C3W A;  3IL2 A;  1MSF C;  2VI6 A;  4CO8 A;  1XMX A;  2YSR A;  2HOA A;  1I50 J;  1R1U A;  2DMU A;  1R1V A;  3JR9 A;  2M9H A;  3KYC B;  1CF7 B;  4BY7 J;  5LFA A;  1QGP A;  3G73 A;  3BZ6 A;  3ERE D;  2EA4 A;  4HV6 A;  2MAB A;  2VQG A;  3S15 J;  2M7B A;  4E7K A;  2W57 A;  3V7S A;  4BYY A;  4Y4R A;  4KN4 X;  2ESH A;  3V7R A;  1BC8 C;  1YIT I;  4MEX F;  1OCP A;  2K5C A;  1BI1 A;  1MKM A;  3OL4 A;  3AKZ A;  3R6S A;  4EM0 B;  3DTK A;  4HQE A;  3C1D A;  1FMV A;  4KN7 X;  4ZJZ A;  1SAN A;  1XC5 A;  2NOJ B;  3KP5 A;  1V4R A;  3BOQ A;  4IQJ A;  1LFP A;  4EJW A;  1FJL A;  2MH2 A;  3U21 A;  2H6B A;  3WHB A;  1LKX A;  3FXR A;  4NC6 A;  5GTI C;  3ESW B;  1AOY A;  2ZFU A;  2XF5 A;  1U8B A;  1E3P A;  1R22 A;  1K78 B;  2HZT A;  5C4J J;  2Y9Y A;  1UMQ A;  3SZP A;  2R7U A;  2ETH A;  3H9G A;  5KNL A;  3PIO F;  1S9H A;  2CV0 A;  1QVU A;  1IXS B;  1TC3 C;  1FTT A;  1YX3 A;  4CCL A;  2L2O A;  2L9S A;  4DW6 A;  4XLH A;  1HW5 A;  2QKL B;  1ODD A;  2YPR A;  1QZY A;  1Y8Q B;  1ZG5 A;  3PQK A;  1S29 A;  4PUS A;  1BA5 A;  2JUC A;  3BJA A;  5DEQ A;  3A01 A;  1CQT A;  2CO5 A;  4B44 A;  2PEX A;  3ZQ7 A;  2M0C A;  3GFJ A;  1J9I A;  3GTP J;  4LFU A;  4KJZ A;  3FHZ A;  5LHH A;  3SEZ A;  2VXD A;  2LSO A;  2ZCW A;  4RB1 A;  2VOO A;  5L3B A;  1X1P A;  5ED4 A;  5BS6 A;  2JT1 A;  1SFE A;  3ZQH A;  3CCR I;  4KNY A;  3TW6 A;  3E3V A;  3O2P E;  1RET A;  3KFW X;  4KIT B;  4ZZL A;  5HLT A;  2DFF A;  2DA2 A;  3DWL E;  4BE0 A;  5DCM B;  1F5T A;  2DA1 A;  4F91 B;  2ISY A;  2D1V A;  5D5V B;  4XRS A;  1JE8 A;  2IAI A;  3HJE A;  1NG7 A;  2L02 A;  3R0J A;  3S17 J;  5KCM A;  2V79 A;  1WJF A;  4A5M A;  3H5A A;  1ZGJ A;  2L7F P;  3JCU C;  1SD4 A;  1P4X A;  5BNG A;  2OUM A;  1HOM A;  1FOX A;  3P9I A;  3JRF A;  3S2D J;  2QEN A;  2K02 A;  2RNJ A;  4HAM A;  2DQL A;  3OYN A;  3RPU A;  1ORK A;  1LFB A;  4Y15 A;  4BHC A;  3L09 A;  5IP6 A;  2OCC H;  1I6H J;  4EVI A;  5GTH C;  3OV8 A;  1ZQ3 P;  2R7O A;  4YRV A;  1RR8 C;  2JA5 J;  3VYU B;  4KIB A;  4ZDP A;  1T8I A;  4ESB A;  1QRY A;  3FXL A;  3DLA A;  3KP3 A;  4G12 A;  2O7O A;  4BQO A;  1ON2 A;  4LIV A;  3RYP A;  2VQC A;  2R7F A;  3H0G J;  2YR2 A;  1Y0N A;  1UHS A;  4RGR A;  4M9X A;  4JX6 A;  4AIJ A;  3S3O A;  2CW7 A;  2DJI A;  4YG2 F;  4UB8 C;  3V4G A;  4XID A;  4HPQ A;  1MH3 A;  3OYC A;  1T98 A;  1X1C A;  3ZQI A;  5H20 A;  1MBE A;  3ABM H;  4IL6 C;  3DLL F;  3GLL A;  2HDW A;  3QYF A;  3EUH C;  1IZ1 A;  1KU2 A;  3S16 J;  2XRN A;  3DPT A;  2LKS A;  3NAR A;  4BXX J;  2RNG A;  5HS7 A;  1QA6 A;  1WRJ A;  4UHT A;  5EGO B;  3K70 D;  1IN5 A;  3O8G A;  1XD7 A;  2V9V A;  3KZI C;  3E6C C;  4HV5 A;  1WH7 A;  3ERM A;  5HDN A;  3UNG C;  3CF5 F;  4BE1 A;  2CW0 F;  4C2M J;  2KIU A;  2KJB A;  2M4G A;  4OWR B;  2KRH A;  4L9J A;  3K4C A;  3VFZ A;  3T8R A;  1TWA J;  2UUZ A;  5FKL A;  2YS9 A;  5K7F A;  3SJM A;  3TED A;  1JKQ C;  1LEB A;  4G9Y A;  4EV0 A;  2FBK A;  3BT9 A;  5CLS A;  1Z1D A;  2PFB A;  1XN7 A;  4I02 A;  1Q1H A;  2BY1 A;  3HKZ N;  2E60 A;  2E1N A;  2OCE A;  3W2V A;  3FX3 A;  4XN0 A;  2E36 A;  3BP8 A;  3GCM A;  1QPI A;  1FTZ A;  2TCT A;  3CO6 C;  4LIT A;  3WGG A;  5HS9 A;  4FAS D;  4M6X A;  2WY7 Q;  3ZMU A;  5EG0 B;  2EIL H;  3GW2 A;  4MEY F;  1RIO H;  1IGN A;  1GVD A;  3GUD A;  1ONV A;  2DOE A;  4UUT A;  4A0Y A;  4D7N A;  1REP C;  2F5F A;  4KMF A;  1P7I A;  3G1L A;  1L0O C;  2XAQ A;  4CCN A;  3FZV A;  1WFX A;  3S2H J;  4PSX A;  4KYW A;  2IS2 A;  2FEZ A;  2CQK A;  1HA8 A;  1ETW A;  2LFB A;  4BY1 J;  3B73 A;  1PUF A;  1L3L A;  1YOV B;  2R4G A;  1USS A;  4HZF A;  4LJZ F;  4A12 A;  4NB5 A;  4B4C A;  1D1A A;  1MGT A;  2MH9 A;  3WU0 A;  1I5Z A;  4Y13 A;  1ZK8 A;  4RAG A;  2F2E A;  2X85 A;  4BBR J;  2XKO A;  4LLL A;  1B9N A;  4C30 A;  2GIZ A;  5TGT A;  2H1L A;  2K7L A;  2PMZ N;  3BCB A;  4DQ2 A;  1MMG A;  2H09 A;  2IVM A;  4G8X A;  4BAC A;  4XOR A;  2KFD A;  3GZ5 A;  4IQ4 A;  5K7Z A;  3DBR B;  2KT0 A;  4QSH A;  4XON A;  2IP2 A;  3EPZ A;  4EJT A;  3I5U A;  1QPM A;  5B3S H;  3QRF F;  3ZMT A;  1GVJ A;  2DTR A;  2JA6 J;  1QHH D;  1XG1 A;  1H8A C;  1MBG A;  2CQ7 A;  4DIQ A;  3GX4 X;  1TWC J;  3F3X A;  1TTY A;  2C6Y A;  1GXQ A;  1YJW I;  2L54 A;  3AL0 C;  3BTL A;  2DU9 A;  1SEU A;  2O9L A;  4LK1 F;  3S1Q J;  1LDJ A;  1U5T A;  4FE4 A;  5FLV A;  1O7F A;  1WJD A;  1XX5 A;  2RQQ A;  1A35 A;  3CUQ C;  4KIS A;  3MKZ A;  3EYY A;  2DDA A;  4A0X A;  2P4W A;  2EJR A;  2CFX A;  1IRZ A;  3FK6 A;  2IXS A;  1UZC A;  4BH9 A;  3PNV A;  5BOX A;  2F5C A;  4J00 A;  2CV2 A;  2BYV E;  2HVS A;  3SYT A;  1MNE A;  4RM2 A;  1OLT A;  2ZNY A;  3J7Y J;  2ZJQ F;  2GBY A;  3MZ8 A;  1DPU A;  1PYV A;  1ZRC A;  3OYG A;  5IYD J;  4A3J J;  4M6V A;  2YUS A;  5IT9 K;  3HTS B;  2NXN B;  5AIQ A;  3MKY B;  1O57 A;  1HW1 A;  2GWR A;  2IGM A;  1W0U A;  4B48 A;  2X1C A;  3G2B A;  5KK1 A;  3OOP A;  3H0D A;  3CJR B;  2NS0 A;  3RKX A;  5D4R A;  1ZRE A;  4IOA F;  2DOF A;  4HOB A;  2B0L A;  2ID6 A;  4ZC3 A;  1Z0X A;  3R61 A;  5B66 C;  1RRJ A;  5LHI A;  3K1P A;  1Q1V A;  2JMW A;  1Z67 A;  3NRV A;  1VQM I;  3S8P A;  1R36 A;  4MQ9 F;  5EEH A;  3JSO A;  3F22 A;  1DP7 P;  2RV8 A;  1KU9 A;  1U2W A;  2MD0 A;  2QCO A;  3MCZ A;  4GCV A;  4GRI A;  4G6Q A;  2DOA A;  1I6X A;  4ZYG A;  1IRX A;  2XHK A;  3H9J A;  1ZAR A;  2IA1 A;  4BXF A;  2CSO A;  3Q9V A;  1FEX A;  4XMY A;  3WTT C;  1Y8R B;  4FIS A;  3L2W A;  2DYS H;  3FKJ A;  2O03 A;  3IH4 A;  5TRD A;  4IXA A;  4XKW A;  3NQO A;  2FNA A;  3M8J A;  1XMA A;  3ZMV A;  2MLK A;  4UY8 I;  2OD5 A;  3IHU A;  3QP6 A;  1X2M A;  1OIS A;  5EJC A;  3J7Z I;  1TZL A;  3ONQ A;  4ZYH A;  4ESJ A;  3DTI A;  5ICF A;  4UVB A;  2XVC A;  4R8H A;  3TDU C;  4F7Z A;  4W1U A;  3HGY A;  2K85 A;  1YHQ I;  1GHC A;  3BCA A;  3RIR A;  5FKO A;  1TQI A;  3KPH A;  4E7S A;  2B9S A;  1FX7 A;  2K4B A;  2R0Q C;  5IP9 J;  4EGY A;  1X3W B;  1S7O A;  1WHU A;  1JUP A;  2LD5 A;  3GWZ A;  5J4V A;  2JA2 A;  3TOB A;  5LGU A;  4Q4Z F;  2YU3 A;  2HYF A;  2QQB A;  1R58 A;  2FSW A;  2MBF A;  4JX5 A;  2K3P A;  3MVP A;  2ELJ A;  1K6O A;  3TQN A;  3RQ4 A;  1E3H A;  3IC7 A;  2IW5 A;  1ZG3 A;  2AQF A;  2CJJ A;  1H0M A;  4BGD A;  2DPD A;  4ON0 A;  3VYR B;  4HNV A;  4R79 A;  3OOU A;  5L3G A;  3HEF A;  2IJL A;  2Y0M A;  1GT0 C;  4MO7 A;  3JRB A;  2HDD A;  3WE3 A;  4OOI A;  2OTJ I;  4Y33 A;  3VYT B;  3S14 J;  4WCG A;  3ZP5 A;  1WJC A;  5D5U B;  4J01 A;  1SD5 A;  2A05 A;  1WSU A;  4M74 A;  4L9T A;  1V5F A;  4LOC A;  3RZD J;  1WCM J;  4L9N A;  2M2E A;  2WAE A;  1ZGW A;  2QBY B;  2TRT A;  4U7B A;  3GZ6 A;  2I5U A;  2R7X A;  2QUF A;  1BR4 A;  5K5R A;  5HNH A;  4MIM A;  4YEL A;  1T08 B;  1UJ8 A;  1ZEL A;  5AON A;  4TV7 A;  2CUE A;  4AVP A;  2R3S A;  2MGQ A;  3E6B A;  2KIF A;  1HKT A;  2UV1 A;  4XK4 A;  2XSD C;  2DW4 A;  1KU3 A;  2DJN A;  3LFK A;  5JLX A;  1UB9 A;  5FKK A;  5H6Q A;  3EDP A;  2NRA C;  4I2O A;  4BQN A;  2X6X A;  2WAQ A;  2GIV A;  2W25 A;  4OU0 A;  3IH3 A;  2L0K A;  2F4O B;  3CTA A;  3G71 I;  4P55 A;  2VC0 A;  3I58 A;  3DF8 A;  3A4C A;  1FOY A;  3RJP A;  3TKY A;  4HDV A;  1GXP A;  2ID3 A;  4CCM A;  3ZN0 A;  1WJ5 A;  1FBU A;  2VJ4 A;  1J75 A;  5DCM A;  2CUJ A;  5D5W B;  4G94 A;  1JJ8 C;  1G4D A;  2EH3 A;  2XAF A;  2W7N A;  4YEJ A;  3WGH A;  3ZMZ A;  4MFD A;  4EAT A;  4XLP F;  2HPM A;  4H4K C;  1D5V A;  1Z6R A;  4P9F A;  4DZP A;  2PJP A;  1J5Y A;  2ELK A;  1T2K A;  3Q0V A;  1SVM A;  3AL0 B;  1T33 A;  3VPR A;  3S2W A;  1XGS A;  1MBJ A;  3IUO A;  1KYW A;  1BC7 C;  2A07 F;  1FLI A;  3GVA A;  1Z6T A;  4AC0 A;  3PSI A;  5LGN A;  2WV0 A;  2P6T A;  3CCS I;  3CUQ B;  3PUB A;  4B8X A;  3ABL H;  4DYQ A;  2FJ1 A;  2VON A;  2FQ3 A;  5FFX A;  5IOY A;  3ECH A;  3IRQ A;  4GYG A;  2P5V A;  3EYI A;  1P2F A;  1MH4 A;  2WB1 A;  2P6S A;  3EUA A;  4HW0 A;  4DYR A;  5HVQ C;  5GAE J;  4Y3O A;  2XAS A;  2FUG 2;  2V6E A;  3RCO A;  2HI3 A;  1MMA A;  3HRU A;  5LBQ A;  5J6X A;  5F0F A;  3TGN A;  3N05 A;  1UHM A;  2DAO A;  1U5T B;  2EIM H;  3CCQ I;  2D5V A;  4KUM A;  5GPA A;  1GV2 A;  1RI7 A;  1SAU A;  3BZK A;  2QSF X;  3GTQ J;  4KIC A;  2NS8 A;  2LVS A;  3A0B C;  2KPM A;  1TBX A;  3I4M J;  1YI2 I;  2OJE D;  1A6I A;  4HBL A;  4XKB A;  4ZDL A;  5FRN A;  1N75 A;  2V6C A;  4M73 A;  4UXN A;  2JK3 A;  4PJJ A; 
#chains in the Genus database with same CATH homology
 3U1D A;  5E1Z B;  3BWG A;  4AD9 A;  3LAP A;  3F8F A;  3HTU A;  3HOS A;  3REO A;  4P9U A;  3KEO A;  1KYZ A;  2A61 A;  3J81 K;  4L0Z B;  1BN5 A;  1A04 A;  4B09 A;  3R0A A;  3ABT A;  3J80 Z;  2M45 A;  1P4A A;  5JR3 A;  2XRO A;  4MQV A;  1HST A;  2ZJ2 A;  4U0V A;  1WQ2 A;  4ENK A;  1O3Q A;  1IW7 F;  3EQL F;  3U9G A;  1C0W A;  1BOA A;  1QO0 D;  3W6J B;  2VBY A;  3L2C A;  4LG0 A;  5K5O A;  3LQR A;  2RVC A;  4ETS A;  2ZBK A;  4LLN A;  1K7A A;  1RUO A;  4K2E A;  1H9T A;  4RGS A;  1LNW A;  3V8L A;  5L3C A;  5LRR A;  3DKW A;  2CWE A;  5FFZ A;  1G6N A;  3WTS C;  3CUO A;  5CVJ A;  1QBJ A;  3KP4 A;  1YIO A;  1O7L A;  3R60 A;  2VBX A;  4UV9 A;  1U8R A;  2KRF A;  2J5O A;  4M9Z A;  5A2Q K;  3WTU C;  4KA4 A;  4M71 A;  3I53 A;  4L5J A;  4P96 A;  2UWM A;  3RDI A;  4CGZ A;  2PI0 A;  1YW9 A;  1FYL A;  3M1E A;  1F9N A;  1MZB A;  2VXZ A;  5D4S A;  1XGO A;  2EA2 A;  3I4P A;  5E8I A;  2HKO A;  1DPR A;  4S04 A;  2GAU A;  1W7P D;  1JXS A;  1UST A;  2M87 A;  2VOD A;  2HWV A;  3BDD A;  4CXF A;  3FXU A;  2V1U A;  5DV5 A;  1XGM A;  1KQ0 A;  4IPA A;  2W84 A;  1J7K A;  2XAJ A;  2HOE A;  4YFK F;  1B59 A;  3B02 A;  3SZT A;  1DUX C;  4KIF A;  3P9C A;  1PUE E;  2D45 A;  2EWN A;  2EV5 A;  1TLH B;  3IWF A;  4HF0 A;  4JQF A;  3DEU A;  4WF2 A;  1S6L A;  4G7Z F;  3DP7 A;  3K69 A;  3BY6 A;  5LHG A;  3GFM A;  1T38 A;  4LGW A;  3ML6 A;  3EUH A;  2MLG A;  1LEA A;  4RS8 A;  1TW3 A;  1D8K A;  4O6J A;  2QYO A;  3E5Q A;  1SAX A;  2HYG D;  1RZ4 A;  4ZH4 F;  3WTX C;  2A69 F;  3D0S A;  4KMU X;  3HOT A;  1B4A A;  3HUG A;  1UCR A;  5FD6 A;  2XUB A;  1R5G A;  4PGH A;  1B1B A;  2OZ6 A;  2PMH A;  3NEU A;  4YIF A;  1J0R A;  4PDK A;  3DXJ F;  2A6H F;  2QZ8 A;  1SFU A;  4YFN F;  1W7P B;  3V7C A;  2W85 A;  5CVV A;  2ZKZ A;  5K5Q A;  3F8M A;  3F23 A;  1W5S A;  2A68 F;  3HRT A;  5CVU A;  2DK5 A;  3PFI A;  4HLX A;  2LKP A;  5FLX K;  2QBY A;  4I09 A;  2VN2 A;  2L3D A;  2XGX A;  3GF2 A;  2VC1 A;  3K0L A;  5HDG A;  2QM3 A;  1RNL A;  2EV6 A;  1OYW A;  4LG0 B;  4LK0 F;  2Z5U A;  4WXD A;  3TO7 A;  1J2X A;  1Z7U A;  1U6G A;  3BPV A;  4GO1 A;  2ZXJ A;  2Y48 A;  1DDN A;  3ELK A;  2K4J A;  2EK5 A;  5IT3 A;  2AXL A;  4S05 A;  1FPQ A;  1F1Z A;  1ZLK A;  2BE5 F;  2IPQ X;  4ZZD A;  1Z9C A;  2A3S A;  1OYI A;  1IN8 A;  2ADU A;  3WTZ A;  4Q47 A;  1SFX A;  2EFW A;  1HSJ A;  2LDU A;  2XV4 S;  5CJ9 A;  1BI3 A;  4HA8 A;  4XSX F;  5HLG A;  4EMS A;  4U0W A;  2BBY A;  3M7G A;  4LD5 A;  3CUQ A;  1I1G A;  3BPX A;  3E5X A;  1VTN C;  4M6Y A;  2OU2 A;  3MWM A;  3QP5 A;  3TO6 A;  1SD7 A;  3V8J A;  2HQN A;  2P7V B;  5JVT A;  1AWC A;  4E70 A;  4A5N A;  1TQP A;  4JBA A;  4WXH A;  4CHU A;  1P6R A;  1IAW A;  4UNO A;  4OIP F;  5DUI A;  4Z2Y A;  1BI2 A;  1S8N A;  5DYM A;  3KP7 A;  2RQP A;  1WWX A;  3IWZ A;  3VOD A;  3F21 A;  2FXA A;  3WTW C;  3WTV C;  3G3Z A;  5E1X A;  4OIO F;  5JI6 A;  3QOP A;  3E97 A;  5CVR A;  4HF2 A;  2RDP A;  4RAZ A;  2KJC A;  4OIQ F;  1KGS A;  1HBX G;  5LEK A;  1BJA A;  5K1Y A;  3VB2 A;  3RI4 A;  2DFI A;  4BAY A;  3T0Y A;  4YFX F;  1BIA A;  1O3S A;  1Z05 A;  5TJJ A;  2HTS A;  5E18 F;  4WX9 A;  2QQ9 A;  5LEJ A;  3KE2 A;  4NHJ A;  3H92 A;  3LA7 A;  4Q5S F;  1HW2 A;  2AS5 F;  2KKO A;  3RKY A;  1IN7 A;  4EJV A;  5L3D A;  5D8L B;  3E6D A;  1ZN2 A;  2XAG A;  1FYK A;  2ZO4 A;  2OQG A;  4AIK A;  3WGI A;  1P92 A;  4XBF A;  4HLY A;  2K27 A;  2HS5 A;  3M9A A;  5JHU A;  1OYY A;  4PGG A;  2HDC A;  1KQ9 A;  3VEP A;  3DPL C;  2STW A;  2CGP A;  1W4M A;  2W24 A;  1YW7 A;  3O3K A;  4EQQ A;  3GFI A;  2J5P A;  2GZW A;  3AAF A;  4EJO A;  1W5T A;  4Q48 A;  1MJB A;  3CO7 C;  3F6O A;  3U2R A;  1T39 A;  1EH8 A;  3IKV A;  2ZNZ A;  1R00 A;  2F5E A;  2X4H A;  2O61 A;  2O0Y A;  2IT0 A;  3GYH X;  1QQI A;  2EFQ A;  2EFP A;  4A2U A;  2FRH A;  1IRG A;  1FP2 A;  3LA2 A;  3K2Z A;  4EM2 A;  4AIH A;  3Q9S A;  3LA3 A;  1YW8 A;  1FZP B;  4FX0 A;  3WG9 A;  2D2W A;  2DPU A;  3W6K B;  3KCC A;  1MDM B;  4YII A;  4ENJ A;  4XSZ F;  5D5X B;  3R4K A;  2FOK A;  2XAH A;  5CYV A;  4OMY A;  4EGZ A;  4UVA A;  4D0P A;  2JSC A;  2PLY A;  4HYE A;  2HR3 A;  4HX7 A;  2O3F A;  3HSR A;  1IF1 A;  4EJU A;  2EFN A;  4CYD A;  3I71 A;  1TQM A;  4HX8 A;  3K1N A;  4UUV A;  2HQR A;  2TDX A;  4GYI A;  3JTG A;  2OZU A;  2VOP A;  3T8T A;  2PBI A;  3COA C;  1YYV A;  3HRS A;  4DNC A;  4XRF A;  4M9S A;  2Z9O A;  1STZ A;  1U78 A;  4BXU A;  3FMR A;  3HIF A;  2ZME B;  4L9V A;  1XSD A;  4QWQ A;  1TNT A;  3T1B A;  1S3J A;  3K9T A;  5ILV A;  3F8C A;  3H3U A;  2VBZ A;  2E7X A;  1XB4 A;  3MZY A;  5D6F A;  3MEX A;  2P8T A;  2VBW A;  3CJN A;  3KP2 A;  1YFH A;  3JTH A;  1LDD A;  2UZK A;  1UFM A;  5F64 A;  1E17 A;  1IN4 A;  5DUK A;  1OR7 A;  2RKH A;  2CYY A;  5HLI A;  1ZHF A;  1W7P A;  2FU4 A;  1FOK A;  2EB7 A;  3LQQ A;  2XIG A;  3QU3 A;  5F6F A;  2BGC A;  1O3T A;  2Q8K A;  4ASN A;  1CGP A;  1XDS A;  3BJO A;  4ENN A;  3FMS A;  2G7H A;  2QWW A;  1J59 A;  3F72 A;  3RPQ A;  4IRI A;  4Y17 A;  5DD8 A;  2YX7 A;  3ECO A;  2VT2 A;  1D8J A;  5DD4 A;  3TO9 A;  4RB0 A;  2DT5 A;  2EFO A;  4WXC A;  4OIN F;  1SMY F;  2FMY A;  3JAM K;  3C7J A;  1PP7 U;  2G7U A;  1BBY A;  4L18 B;  1EV7 A;  2H27 A;  5J8F A;  3ROU A;  2GXB A;  1FBQ A;  4CDG A;  4ESF A;  2FML A;  1H9G A;  4LMY A;  5FD5 A;  4KDP A;  3TOA A;  2A6E F;  5BPD A;  3RTR A;  1PP8 F;  3PQJ A;  5ICE A;  1ZRF A;  2JRT A;  5ICC A;  1ZRD A;  5BPI A;  2DI3 A;  2FE3 A;  5FB2 A;  4LLG F;  3JSP A;  1IN6 A;  5FGM A;  3FWE A;  3QPT A;  2FBH A;  3FMQ A;  3LWF A;  1TW2 A;  2GQQ A;  4I0A A;  3KET A;  1ZYR F;  3VOE A;  1JHF A;  1FT9 A;  1E2X A;  3M8E A;  2WC2 A;  4PCQ A;  1SD6 A;  4HX4 A;  3RKW A;  1K79 A;  1FP1 D;  1V3F A;  2ELH A;  3E6M A;  2RGV A;  5ILU A;  2JZY A;  2IRF G;  5H6R A;  2M30 A;  2X0L A;  2F5D A;  3KLO A;  2O8X A;  3H3Z A;  4U7D A;  5HS8 A;  5D6E A;  3KLN A;  3I59 B;  3F6V A;  4IHS A;  3T5X A;  3ABU A;  2FF4 A;  4GGG A;  2OAZ A;  1ON1 A;  5E1W A;  3GO5 A;  4U88 A;  2KIM A;  1ULY A;  2BEO A;  3L9F A;  1EH7 A;  3N97 A;  1R7J A;  1YS6 A;  4N9H A;  2H94 A;  4LB5 A;  5FLX Z;  2ACJ A;  1MJ9 A;  4IRG A;  3Q5F A;  1FBS A;  1XDU A;  2VE8 A;  1ZH5 A;  1YTY A;  2L4M A;  1NHA A;  4M72 A;  1JHH A;  3ZN1 A;  1G3T A;  5LRS A;  3F8B A;  2E7W A;  3WTY C;  2EV0 A;  2WWY A;  1G3Y A;  2Q2E A;  2Y75 A;  3HSF A;  5HDK A;  4ZYD A;  1FWZ A;  3HHG A;  4MNU A;  3I64 A;  2NNN A;  2P5K A;  1PDN C;  2ZFW A;  2LF7 A;  1OMI A;  4L0Y B;  3IKT A;  1HXD A;  1XCV A;  4L5I A;  5DDG A;  2FBI A;  1ZG1 A;  1YS7 A;  2WTE A;  1MDM A;  1SMT A;  2A5Y B;  5L3E A;  2FNP A;  2DQR A;  2M5W A;  3JW4 A;  2DO7 A;  4A0Z A;  2PMU A;  4I98 B;  1XGN A;  4HF1 A;  4I7H A;  3ZMD A;  4RGX A;  1ZGA A;  3GEZ A;  2NAZ A;  1LJ9 A;  3DFG A;  3LST A;  3ISP A;  1OKR A;  3GXO A;  3QU6 A;  2NNY A;  4MHG A;  1IRF A;  4IVN A;  4FX4 A;  4U0Y A;  4P5O A;  4PZJ A;  3MZH A;  1UHW A;  2ZME A;  3P9K A;  5IT9 Z;  2CG4 A;  5EEG A;  5D8K B;  4N0B A;  3FM3 A;  1B6A A;  2COM A;  3KEQ A;  2ISZ A;  1B9M A;  3SXY A;  3TDZ C;  1Z91 A;  4HQM A;  2XKP A;  1BI0 A;  3MQ0 A;  1ZLJ A;  4KFC A;  4R1H A;  1IXC A;  4RGU A;  2R7D A;  2DK8 A;  4IJA A;  3MAJ A;  3QPH A;  5AIP A;  2JPB A;  3QAH A;  1R5H A;  4FHT A;  2HFH A;  2VT3 A;  2HTJ A;  2GA2 A;  2Z33 A;  1U5T C;  3ZMS A;  2HEO A;  5HOO A;  3SFZ A;  1HKS A;  1Y0U A;  4OIR F;  1BM9 A;  4UVC A;  4BHP A;  1HQC A;  1WKM A;  4CZZ A;  2PG4 A;  4OMZ A;  3E5U A;  1IUY A;  2L01 A;  3LAJ A;  1LVA A;  3K1M A;  2OQR A;  1XSX A;  4CIC A;  3I0T A;  1BIB A;  1G3S A;  2DBB A;  3GLX A;  4EM1 A;  5BQT A;  2STT A;  1X3U A;  3SHF A;  4HDU A;  4MTE A;  3F8N A;  3KZY A;  4G7O F;  2K86 A;  1I1S A;  5F1R A;  5E17 F;  4BHB A;  4BQA A;  3DQV C;  1ZAO A;  4G6D A;  2GXG A;  2HKX A;  4IF4 A;  1CF7 A;  2IA2 A;  2VE9 A;  1OPC A;  1KA8 A;  2UXN A;  5ICG A;  5FO5 A;  3N4M A;  2MD5 A;  4JK1 X;  4A6D A;  1FC3 A;  1FY7 A;  3FXQ A;  2HGC A;  1U3E M;  1EH6 A;  5LGT A;  1K78 A;  2QVO A;  4H0E A;  4ZYE A;  3CLO A;  1LDK B;  3HRM A;  4RAY A;  2JPC A;  3V8K A;  1XCB A;  1WI9 A;  2MA3 A;  1T6S A;  3CDH A;  1MJA A;  4MTD A;  2DLL A;  2ESN A;  3HSE A;  5LLQ A;  5KVR A;  1JGS A;  1XSV A;  4AWX B;  2L4A A;  2JTV A;  1LB2 A;  3SQN A;  2V1X A;  3ZPL A;  4MGR A;  2LNB A;  2M1B A;  3BRO A;  1RUN A;  5BMZ A;  3RYR A;  3BJ6 A;  1XMK A;  3C18 A;  5CVI A;  5ERI A;  3O6B B;  1P4W A;  3WOD F;  1QZZ A;  3M8F A;  3J7A O;  2RC4 A;  1YQA A;  3I59 A;  5E8G A;  4NQW A;  5JFR A;  2MC3 A;  1YLF A;  4GXO A;  2D1H A;  2GA1 A;  2PN6 A;  6PAX A;  2P5L C;  2BV6 A;  1G3W A;  1D3Y A;  2Z99 A;  3D5L A;  3J81 Z;  3WE2 A;  5DCF A;  4WWC A;  2QQA A;  4I01 A;  1FNN A;  4UV8 A;  5L3F A;  2Z3Y A;  1KU7 A;  3EET A;  5E20 A;  4G7H F;  4WK8 F;  1R23 A;  3WU1 B;  3I54 A;  5HLH A;  3HHH A;  2P7C B;  4KT5 C;  5J8C A;  2UXX A;  2LF8 A;  4A6E A;  4KIG A;  2FA5 A;  1MD0 A;  3MFK A;  1YO5 C;  4RB2 C;  2Q0O A;  4BNC A;  3GFL A;  3IRR A;  3FF5 A;  2QLZ A;  1YG2 A;  4IHT A;  2OBP A;  3HYI A;  4ENM A;  3L7W A;  1R1T A;  2O6G E;  3JAM Z;  2G9W A;  1FSE A;  1KQ8 A;  3P7N A;  1O3R A;  1QNT A;  4FT8 A;  2YX4 A;  1LQ1 A;  4QLC U;  4XLN F;  4N9I A;  1S7A A;  1T0F A;  2IA0 A;  2PQ8 A;  2M8E A;  2NYX A;  3KP6 A;  2V1D A;  2E1C A;  3DV8 A;  2RN7 A;  2OA4 A;  3FM5 A;  4RB3 C;  5A2Q Z;  4O3M A;  3KZZ A;  1F4K A;  5ILS A;  1I27 A;  3L00 A;  1TNS A;  2H6C A;  4I0B A;  3ULQ B;  1FSH A;  1IXR C;  4LB6 B;  3J80 K;  4IRH A;  4O5V A;  1HKQ A;  3C3W A;  3IL2 A;  4CO8 A;  2YSR A;  1R1U A;  1R1V A;  1CF7 B;  3G73 A;  1QGP A;  3BZ6 A;  3ERE D;  2EA4 A;  4HV6 A;  2W57 A;  3V7S A;  4BYY A;  4KN4 X;  2ESH A;  3V7R A;  1BC8 C;  4MEX F;  1BI1 A;  1MKM A;  3R6S A;  4EM0 B;  4HQE A;  3C1D A;  4KN7 X;  3KP5 A;  1V4R A;  3BOQ A;  4EJW A;  2MH2 A;  2H6B A;  3FXR A;  1AOY A;  1R22 A;  1K78 B;  2HZT A;  3SZP A;  2ETH A;  1IXS B;  1HW5 A;  1ODD A;  2YPR A;  1QZY A;  1ZG5 A;  3PQK A;  1S29 A;  3BJA A;  5DEQ A;  2CO5 A;  2PEX A;  3ZQ7 A;  3GFJ A;  1J9I A;  4LFU A;  3FHZ A;  5LHH A;  2LSO A;  4RB1 A;  2ZCW A;  2VOO A;  5L3B A;  5ED4 A;  5BS6 A;  2JT1 A;  1SFE A;  4KNY A;  3E3V A;  3O2P E;  3KFW X;  4ZZL A;  1F5T A;  5DCM B;  2ISY A;  2D1V A;  5D5V B;  1JE8 A;  2L02 A;  3R0J A;  2V79 A;  4A5M A;  1ZGJ A;  1SD4 A;  1P4X A;  3P9I A;  2QEN A;  2K02 A;  2RNJ A;  4HAM A;  2DQL A;  3RPU A;  4Y15 A;  4BHC A;  3L09 A;  4EVI A;  3OV8 A;  4KIB A;  4ESB A;  3KP3 A;  1ON2 A;  3RYP A;  2R7F A;  2YR2 A;  4RGR A;  4M9X A;  4AIJ A;  4YG2 F;  3V4G A;  1T98 A;  5H20 A;  1IZ1 A;  1KU2 A;  2XRN A;  3DPT A;  5HS7 A;  1WRJ A;  4UHT A;  1IN5 A;  1XD7 A;  2V9V A;  3E6C C;  4HV5 A;  5HDN A;  2CW0 F;  2KIU A;  2KJB A;  4L9J A;  3VFZ A;  3T8R A;  1LEB A;  4G9Y A;  4EV0 A;  2FBK A;  5CLS A;  1Z1D A;  2PFB A;  1XN7 A;  4I02 A;  1Q1H A;  2E1N A;  3FX3 A;  3BP8 A;  3CO6 C;  3WGG A;  5HS9 A;  4M6X A;  3ZMU A;  3GW2 A;  4MEY F;  1RIO H;  3GUD A;  1ONV A;  4A0Y A;  1REP C;  2F5F A;  4KMF A;  1L0O C;  2XAQ A;  3FZV A;  4KYW A;  2FEZ A;  2CQK A;  3B73 A;  1L3L A;  4HZF A;  4A12 A;  1USS A;  4LJZ F;  4NB5 A;  1MGT A;  2MH9 A;  3WU0 A;  1I5Z A;  4Y13 A;  2F2E A;  2XKO A;  4LLL A;  1B9N A;  2K7L A;  4DQ2 A;  2H09 A;  2IVM A;  4G8X A;  3GZ5 A;  2IP2 A;  4EJT A;  3I5U A;  1QPM A;  3QRF F;  3ZMT A;  1GVJ A;  2DTR A;  3GX4 X;  3F3X A;  1TTY A;  2C6Y A;  1GXQ A;  2L54 A;  2DU9 A;  4LK1 F;  1LDJ A;  1U5T A;  1O7F A;  3CUQ C;  3EYY A;  4A0X A;  2P4W A;  2EJR A;  2CFX A;  5BOX A;  4BH9 A;  2F5C A;  2BYV E;  2ZNY A;  1DPU A;  1ZRC A;  5IT9 K;  3HTS B;  5AIQ A;  1O57 A;  1HW1 A;  2GWR A;  1FYM A;  5KK1 A;  3OOP A;  2NS0 A;  3RKX A;  5D4R A;  1ZRE A;  4HOB A;  2B0L A;  3R61 A;  5LHI A;  3K1P A;  3NRV A;  3F22 A;  1R36 A;  4MQ9 F;  5EEH A;  3JSO A;  1DP7 P;  2RV8 A;  1KU9 A;  1U2W A;  3MCZ A;  4GCV A;  4G6Q A;  1I6X A;  4ZYG A;  2XHK A;  1ZAR A;  2IA1 A;  2CSO A;  3Q9V A;  3WTT C;  2O03 A;  5TRD A;  4IXA A;  3NQO A;  2FNA A;  1XMA A;  3ZMV A;  2MLK A;  2OD5 A;  3IHU A;  3QP6 A;  4ESJ A;  4ZYH A;  5ICF A;  4UVB A;  2XVC A;  4R8H A;  3TDU C;  4F7Z A;  1GHC A;  3RIR A;  1TQI A;  1FX7 A;  2K4B A;  4EGY A;  1S7O A;  3GWZ A;  5LGU A;  3TOB A;  4Q4Z F;  2YU3 A;  2HYF A;  2QQB A;  1R58 A;  2FSW A;  2MBF A;  1K6O A;  3TQN A;  3IC7 A;  2IW5 A;  1ZG3 A;  1H0M A;  2DPD A;  4ON0 A;  4R79 A;  5L3G A;  2IJL A;  2Y0M A;  3WE3 A;  4OOI A;  4WCG A;  3ZP5 A;  5D5U B;  1SD5 A;  1WSU A;  4M74 A;  4L9T A;  4L9N A;  2QBY B;  4U7B A;  3GZ6 A;  2QUF A;  5K5R A;  5AON A;  4TV7 A;  4AVP A;  2R3S A;  3E6B A;  2KIF A;  1HKT A;  2DW4 A;  1KU3 A;  3LFK A;  1UB9 A;  5H6Q A;  3EDP A;  2NRA C;  4I2O A;  2GIV A;  2W25 A;  4OU0 A;  3CTA A;  4P55 A;  2VC0 A;  3I58 A;  3DF8 A;  3RJP A;  3TKY A;  4HDV A;  1GXP A;  3ZN0 A;  1FBU A;  1J75 A;  5DCM A;  5D5W B;  4G94 A;  1G4D A;  2XAF A;  3WGH A;  3ZMZ A;  4XLP F;  1D5V A;  1Z6R A;  4P9F A;  2PJP A;  1J5Y A;  1T2K A;  3S2W A;  1XGS A;  1KYW A;  1BC7 C;  2A07 F;  1FLI A;  3GVA A;  1Z6T A;  5LGN A;  2WV0 A;  2P6T A;  3CUQ B;  4B8X A;  2VON A;  2FQ3 A;  5FFX A;  3ECH A;  3IRQ A;  4GYG A;  2P5V A;  3EYI A;  1P2F A;  2P6S A;  4HW0 A;  5HVQ C;  2XAS A;  3HRU A;  5LBQ A;  5J6X A;  3TGN A;  1UHM A;  2DAO A;  1U5T B;  4KUM A;  1RI7 A;  4KIC A;  1TBX A;  4HBL A;  2V6C A;  4M73 A;  4UXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...