3S17J

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s17J00
4J19A 1IJWC 5F0FA 1EF4A 1X58A 1JKPC 2X48A 5EZGA 1AHDP 4Y52J 2DA4A 4MFDA 3TP0A 2XGCA 5EEAA 1OCPA 1WI3A 2EZLA 2LD5A 9ANTA 1HOMA 2XPVA 3Q3SA 4M3FA 2CUFA 1VFCA 4QSHA 1JUSA 5IP9J 1Y1VJ 2NVYJ 2XGDA 1IDYA 2LP0A 1BW6A 3HGGA 3HOYJ 1X2NA 2ZB9A 4DYQA 5IYBJ 2DA5A 1B8IB 1RR7A 2R5YA 3S1NJ 1DU0A 4NDLA 4MFEA 2DA2A 4A3JJ 4M6VA 4JX6A 4A3BJ 2E2HJ 3JRDA 2R5ZA 4BY7J 2D5VA 2YU9J 4DW6A 2XRLA 1VF9A 1TC3C 3JRBA 1OJLA 2HQ5A 3IH4A 1FJLA 1JJ8C 5EGOA 3F0CA 2W48A 1HDDC 3GBGA 1IGNA 3HDDA 3BG5A 2LTPA 3MN2A 2FQ4A 2DTZA 3S2DJ 1ETWA 4MLOA 1DU6A 1GVDA 2HOTA 1VI0A 3OSFA 2DMUA 2AO9A 1HF0A 4FE4A 1K83J 5F0CA 3G1MA 1T56A 2WB1N 1WH7A 2NVXJ 1IG7A 1QVUA 5M5WJ 1MBJA 1NK3P 5EG0A 5M5YJ 3HOWJ 4A93J 2ECBA 2L7MP 5J1UA 1GDTA 5C4JJ 1AU7A 1JTYA 5FKNA 2VI6A 3GTQJ 3G1OA 3HOZJ 5GPCA 1ZTRA 2JA5J 1QRYA 1WH5A 4IEJA 1MH3A 2ID3A 1PUFB 2KDZA 2DA1A 3BG9A 2P81A 2N8GA 5DTDA 2JA7J 5GPAA 1Z0XA 3K2AA 2TRTA 1FIAA 3JRCA 2DMPA 2RAEA 3IH3A 4DZPA 1ITYA 3BR6A 4LOCA 1JGGA 2DMNA 3OOUA 1H88C 1GT0C 2CUEA 3O8HA 1MBGA 2LVSA 3VPRA 5F1JA 3RKQA 4IHYA 3I4NJ 5C4XJ 3IV5A 2GBYA 3OSGA 2CU7A 4DYCA 5C44J 3K7AJ 4JX4A 3FK6A 3BTIA 1LFBA 1TWGJ 4UUSB 2IEKA 2XB5A 2OPTA 3JRHA 2O8KA 3GTMJ 3ZQIA 1F36A 1TWAJ 1ZQ3P 2XGEA 1LE8B 1JTXA 4BKXA 2VKVA 2JJ7A 2I10A 4V2GA 4XICA 3JRGA 1ORKA 4C3JJ 3ZQHA 3D1NI 1A5JA 5FLMJ 5J1RA 1RESA 2CQQA 2R5YB 4RDUA 4B3AA 4RBOA 3HBLA 3GTKJ 1LFUP 4M3BA 2M8GX 4D5FA 1YRNB 3M3YJ 2CJJA 3HM5A 4XIDA 3GTJJ 1S7EA 4C3HJ 4DZJA 1MBEA 2L9RA 4A3DJ 3Q0VA 4JP0A 4I6ZA 2K9SA 4B1RA 1FTZA 3SJMA 3HB9A 2Y31A 2MSYA 3A01A 2FJ1A 2NS7A 5IYDJ 1O4XA 2VKEA 2EH3A 5EDNA 1B72A 1ETKA 2H8RA 1ETVA 1WPKA 3GTOJ 1RKWA 1SFOJ 2NVTJ 3FKIJ 4S0HB 3ZQCA 1MH4A 3PM1A 2EQRA 1QPIA 1X2MA 3TP3A 4D5CA 5K7HA 2WAQN 1I3QJ 5FKKA 2HI3A 5GP9A 1U9OA 1G2HA 3HKZN 3LNQA 1ZGWA 4CYCB 2IBDA 3ZOBA 5E3MA 1UG2A 2AHQA 1FIPA 3M4OJ 1TWHJ 3HEFA 3LOCA 3UKGA 1RPWA 5EF6A 4BXXJ 5F27A 1TWFJ 2DJNA 1ZK8A 3GTGJ 4A3GJ 4I76A 2WV1A 2H1KA 4MIMA 3BQZA 2M9HA 1TWCJ 2X9DA 3NARA 2HDDA 2JMWA 3CQZJ 2KT0A 2Y9ZA 4W97A 1XC5A 2M34A 4A3CJ 5FJ8J 2HYJA 3GTLJ 2DA3A 1AKHA 2HOSA 3A03A 2CQXA 5FKMA 2R93J 2CRGA 3E7LA 4X6AJ 1F43A 2Y30A 3RZDJ 2LLKA 2MGQA 3TEDA 4IHWA 5M3FJ 2JK3A 5EYRA 2OF7A 3IH2A 1U78A 5DS9A 3S1QJ 4A3LJ 1OCTC 1ETQA 4BY1J 1ZR2A 2M2EA 4ABZA 2Y9YA 2E2JJ 1Z77A 2EZHA 2GLOA 3A02A 3SDGA 2EBIA 1SANA 5FKLA 2M0CA 3NAUA 2EZIA 4HNVA 5IP6A 1CQTA 1XG1A 4V2FA 4QTRA 3S17J 3S1MJ 2R7ZJ 1RKTA 1MBKA 1P7IA 4C2MJ 3WHCA 1JT0A 4M3DA 1MSFC 4XRSG 1JKRC 2YUSA 2Y0SN 1ZR4A 2NOGA 2K40A 3BT9A 2R0QC 2ELKA 1Q1VA 3BR3A 4AC0A 3HOXJ 4DYRA 3QPSA 5F0HA 4GFBA 4D7NA 2E19A 4Y7NJ 2LY9A 1BJZA 2XPUA 3PO2J 2DMQA 5HODA 4M3GA 3JRAA 1PUFA 4IHXA 3JREA 2X6OA 3Q0WA 4B4CA 5EZHA 4JYKA 2LR8A 1FEXA 1NTCA 2PMZN 5JLXA 1RETA 2O7OA 4AYBN 5J3LA 2E2IJ 3W6VA 2FX0A 4C3IJ 2DA6A 2LFBA 1JKQC 3BR0A 3H3VK 3BTLA 4MO7A 3S14J 2B63J 2DA7A 3ZQFA 3C2BA 3MKLA 2R5ZB 1ETOA 3FK7A 1I50J 1W0TA 1A6IA 3Q0UA 5IOYA 2QF7A 1P7JA 3MVPA 2NVQJ 3HOUJ 4UUSA 1ETYA 4XRSA 5EGOB 1JUPA 5E3NA 5E3LA 1D5YA 4JX5A 4IHVA 2GM4A 4W1UA 1I6HJ 2E1OA 4A3MJ 3WHBA 1IDZA 2QCOA 4X1EA 1LE8A 1WGXA 1MNMC 2XB0X 1BW5A 1MBFA 2LK2A 1H8AC 3LSJA 3PO3J 5BNGA 1WCMJ 4A3EJ 3O8GA 2K9QA 4BBSJ 2MW8A 1R9TJ 3I4MJ 4BBRJ 2L7ZA 2ID6A 1JJ6C 1YRNA 5F04A 3LSPA 2Y2ZA 3S1RJ 5FLVA 5EG0B 1K61A 1BL0A 1XS9A 2K9NA 1AKHB 3LSRA 2L7FP 3G1LA 1OFCX 2XPWA 3BR1A 5JLWA 1U8BA 1B8IA 5FKOA 1IUFA 4FISA 1UMQA 1UHSA 2O9LA 2NS8A 4EEFG 4AUXA 2DMTA 1IRZA 1ENHA 5IP7J 4XRMA 2R92J 3BTJA 5M5XJ 2JWTA 1E3OC 2HOAA 2HXOA 3JR9A 4L5EA 3CCYA 1POGA 3S15J 5F08A 1T33A 2G0EA 5IPAA 2VPRA 2LKXA 3OIOA 4CYCA 3QQAA 3HOVJ 5C3EJ 2HXIA 2ME6A 1HLVA 1NK2P 4FE7A 1JUMA 4UUTA 4FCYA 1IC8A 1VNDA 1FTTA 3DEWA 4XK4A 3BQYA 3H0GJ 3QPLA 5J1YA 3FISA 3BR2A 1JT6A 1GUUA 5M3MJ 2ECCA 2JA8J 2L0KA 4A3FJ 5IYCJ 3RZOJ 4QIWN 2COBA 2MG4A 3S16J 1JKOC 1ETXA 1W0UA 1U9NA 4D7MA 4A69C 3L1PA 4FTHA 1QVTA 3BR5A 2TCTA 1MBHA 2DN0A 2JA6J 5IOZA 3CDLA 2JN6A 1GV5A 1HCRA 1ZKGA 3ZQLA 5K7FA 3B6AA 3B6CA 2IAIA 1H89C 2VUMJ 3ZQGA 5K7ZA 4G12A 1BA5A 4A3IJ 1GV2A 2EZKA 3BTCA 3FIWA 3SFIA 3S2HJ 1Y1WJ 3BG3A 1MSEC 4M3EA 3TW6A 3TW7A 3LSGA 1HDPA 3JRFA 3GTPJ 3HGYA 3CMYA 2XSDC 2FD5A 3JRIA 3A01B 1IV6A 5E3OA 1APLC 2ME0A 2YS9A 4A3KJ 1B72B 3RQIA 3DCFA
chains in the Genus database with same CATH superfamily
4Q48A 1SFXA 3KP3A 2EV6A 2EIMH 2PJRA 1E2XA 2QVOA 1X58A 1WJCA 2X48A 3E5QA 1JKPC 2P8TA 1R1TA 2R7XA 4MFDA 2ZFUA 5DD4A 4S04A 1T0FC 5HVQC 2JQ7A 5E8GA 1EA3A 2F48A 2QKLB 4QPOA 2LD5A 4XMYA 1UELB 4BACA 1UG0A 4DIQA 1FYKA 3IWFA 3Q3SA 3PFIA 2MH9A 5ED4A 4L18B 4Y3OA 5B1AH 4IOCF 5FLXZ 3SZTA 1BW6A 4Y4RA 1S72I 1V54H 1A6QA 5B5EC 2PX9A 2R7VA 1X2NA 3JSPA 2DA5A 4BQNA 4MEXF 3TOAA 4CH7A 2CFXA 1RR7A 1OR7A 2CW7A 3IRQA 1CGPA 2R7OA 2NS0A 2HPMA 1FWZA 3H35A 3S1NJ 4NDLA 4MFEA 4CYDA 3FXLA 2VXZA 5BQTA 1YS6A 2WAEA 4JX6A 1HBXG 1SVMA 3F8FA 2OV7A 4IHTA 4BL0B 2R5ZA 2A07F 1Z91A 3CTAA 2YU9J 4DW6A 2ZKZA 4JBAA 2EWNA 5EEGA 2DT5A 1X1PA 2MD0A 2MFZA 3PNYA 3JRBA 3ERED 1FJLA 1JJ8C 2F5FA 4F91B 1X3UA 4PJNA 5J47A 2X1EA 4L9JA 1IGNA 3HDDA 2VBYA 4LIVA 2LTPA 3WODF 2JRMA 4P1WA 3T0YA 2HYFA 3SDBA 3HOTA 3FDYA 1WI9A 3S2DJ 3L2CA 4EV0A 1UZCA 3DU6A 4RM3A 1F9NA 1HF0A 1N25A 2IPQX 3FXKA 1T56A 3MAJA 4KIGA 4PFOA 2M45A 4BDZA 5E1XA 1IV8A 1SD5A 2XKPA 4CCOA 2NVXJ 1D0XA 3DEUA 3V8JA 1HW2A 3N97A 4PZJA 1QVUA 2YX7A 1O3TA 5JVTA 5M5YJ 3F3XA 2FRHA 2QGUA 4OAYA 3U1DA 4LG0B 4RM2A 4I2OA 3G1OA 2QSFX 2V6EA 1ZTRA 4MEYF 2BXZA 3F8NA 3OS1A 2JA5J 2K02A 4IXAA 2KQRA 4M71A 4PJLA 4I0BA 5JVGF 2XAUA 1WFXA 5L3FA 1FOYA 1OCZH 3OOPA 4UVBA 1HXDA 1V4RA 2BY3A 2N8GA 1X4OA 1LEAA 2OAZA 2RAEA 2E36A 4EJVA 3SEZA 4B47A 3OOUA 1RIOH 2WAQA 2CUEA 3PQJA 1W5SA 4B44A 1DPRA 4ENMA 1Z6RA 3E5XA 1O3SA 5F1JA 3I3LA 3IV5A 2GBYA 1FMVA 5JI6A 3OSGA 2OA4A 5J4VA 5A2QK 2WY7Q 4XNFA 4DYCA 1QZEA 5C44J 3K7AJ 1TNTA 2A05A 4O3MA 4CZCA 3FK6A 4F7ZA 3CCLI 3FZVA 5GTHC 3IWZA 3HHGA 2CUJA 1XSXA 3GTMJ 4HSTA 4RAFA 2MYSA 3K1PA 1LE8B 3FM5A 3CLOA 4RLQA 5D5WB 1EKEA 1ORKA 4B43A 1QZYA 3D1NI 5KNLA 2IGKA 3FF5A 1U8RA 4BE0A 3FX3A 4A5MA 2ISZA 4A0XA 2W00A 2QQ9A 1G59A 4RDUA 1RUOA 1G4DA 1MMNA 1LQ1A 4M3BA 2M8GX 5CQEA 4KNYA 4AWXB 3HM5A 4XIDA 3GTJJ 1IUYA 1DGRM 1TT0A 1MBEA 2L9RA 1SAXA 3QPHA 2E1NA 1JGSA 2K9SA 4B1RA 1MJ9A 5TISC 4G6QA 3CC2I 3HB9A 2Y31A 3JSOA 3M1CA 3VOEA 2FJ1A 1O4XA 2VKEA 5HLGA 1ETKA 4I02A 2H8RA 3Q9VA 1YYVA 3BJ6A 4BHPA 2BOLA 1ACIA 1MH4A 3PM1A 1FYMA 4D5CA 1V55H 1LUJB 1LVAA 2GIVA 2QWWA 1G2HA 1J9IA 2XC7A 4OAZA 2L4AA 4U0VA 1YJ9I 2HVRA 1ONVA 3DBHB 1M1EB 4UB6C 3HEFA 3MWMA 3I5UA 3TQNA 5L3GA 1RPWA 1P4AA 3KYCB 4NBQA 1UB9A 4L9TA 4MTEA 4BXXJ 3FXMA 3WGIA 4RGXA 1QGPA 3GTGJ 5F64A 2EPFA 1GXPA 2M9HA 4AYBA 4A5NA 2F5CA 1TWCJ 3NARA 4RGRA 1B9MA 4GO1A 3BZKA 3OIPA 1P4XA 2NVUB 2M4GA 2DA3A 3HRUA 3A03A 1Z7LA 4V19K 3QU3A 3W2WA 4X6AJ 2HQAA 3M9AA 1HC8A 3TEDA 1R4NB 2JK3A 5EYRA 5DDGA 4IVNA 1FSHA 3CF5F 1YQAA 2NOJB 3KYDB 4XKVA 5IT9K 1ZR2A 3OMYA 4ABZA 1OCOH 1XMXA 4HW0A 2I8DA 1XB4A 2UV1A 3KE2A 4GGGA 3A02A 2ELJA 2W24A 2EBIA 2IGNA 1KONA 3F8BA 3K70D 1SANA 5FKLA 3RSNA 2VASA 1FY7A 1CQTA 2CH0A 2V1NA 4V2FA 5CVRA 5ILSA 3S17J 2LOOA 1ERDA 2RDPA 4ENJA 1GLNA 4C2MJ 2LNBA 1QNTA 3KCCA 1S8NA 4M3DA 3U2RA 1F4KA 4LB6B 3ZMZA 5HNHA 2ELKA 4HG2A 2CV2A 2A5YB 3HOXJ 1WZ2A 2F5VA 2KIQA 5F0HA 1YE9A 1UAAA 1PP7U 2E7XA 4NC8A 3DKYA 3JRAA 1PUFA 3GVAA 4IHXA 3JREA 3SQNA 4JYKA 1V3FA 1YW8A 1XGSA 1NTCA 1PVEA 1R22A 1VZ0A 2PMZN 1L3LA 2A3SA 4F93B 1RNLA 2OTJI 3IKTA 3CCEI 3K4MA 4UY8I 5KAIC 4XL9A 3BR0A 1MDMA 3BTLA 1K4TA 1I3AA 1YIJI 1ZN2A 4LD5A 1T39A 4BYYA 2B63J 2H6BA 3ZQFA 4AVZA 2R5ZB 4J01A 3FK7A 1R5GA 2JT1A 5E20A 1W0TA 4FX0A 1A6IA 3Q0UA 4EGYA 4PFPA 2HFHA 4XRSA 2GA2A 4L0ZB 4GYGA 1D1BA 3ESWB 5CQGA 1JUPA 4HEA2 1R49A 5LRSA 1I1SA 2ZNYA 3ZQQA 3ZGKA 4U88A 3RDIA 2QCOA 3DLAA 3I58A 4BQOA 1MNMC 1FPQA 2XB0X 3MMYB 3MZ8A 1BW5A 3PIPF 2AXLA 3ZQ7A 2P5LC 2E1MC 4IRIA 3WU2C 2V4JC 2VKDA 1V5GA 5E79C 3OWTA 1T38A 1W36D 1WJBA 3GCMA 4C9YA 1VQ5I 1OR7C 4Z6YA 1OYIA 2KJCA 2IS2A 1IZ1A 3TL4X 3NQOA 4GYIA 2KHMA 3S1RJ 2CYYA 1K61A 2DDAA 3ZCOA 1AKHB 4CXFA 2XAGA 5HDGA 2L7FP 3C3WA 3G1LA 3E6BA 1YFHA 1WHUA 2BW3B 3G6EI 1UMQA 2JTVA 2ZC2A 4R79A 4AIKA 2Z99A 2DMTA 1AOYA 4KFCA 1ENHA 3T1BA 3R61A 4XRMA 4B3XA 4HBLA 2V1XA 3BTJA 4WXCA 2G7UA 5M5XJ 3GZ6A 5BMZA 1D1AA 4EQQA 2JWTA 3H5AA 3CCQI 4YG2F 4L5EA 4YIIA 4BDYA 1FT9A 3ONQA 5F08A 2O03A 4LGWA 1T6SA 2L02A 2VN2A 5JHUA 1BC7C 1EH7A 3OIOA 1HW5A 4HX7A 4CYCA 2IVMA 5C3EJ 1NK2P 1B59A 4FE7A 3DBRB 1WJAA 1JUMA 2J5PA 5ICEA 1O7LA 2BHZA 2BHYA 1ZYRF 5FD5A 1FTTA 5LLQA 2V9VA 1YHQI 5J1YA 1SD7A 3BR2A 3KYLA 1E3PA 4DJAA 5FB2A 2JA8J 4DOZA 4BAYA 1LPQA 1TLHB 1TQMA 3CLQA 5KHDA 4QIWN 1R4MB 3S16J 3KETA 3IRRA 3LAJA 4HRIA 2VBWA 2VQLA 1QVTA 3V8KA 2O61A 2TCTA 2KIUA 1MBHA 2DN0A 3G4SI 3CDLA 3CC7I 1HCRA 2VT2A 3N4MA 2L4MA 3K4KA 3HTUA 5LHHA 2VQHA 4IRHA 3FHZA 1ZRDA 4PCQA 3S3MA 3FIWA 3S2HJ 4F92B 2E5ZA 4M3EA 5J40A 3OYBA 5LFAA 2L9SA 2FSWA 2QQBA 1G6NA 3K69A 3DTEA 4KJZA 2AQFA 2XSDC 3JRIA 1IV6A 4A3KJ 1VQ9I 1IW7F 2K4BA 3RQIA 4LJZF 2FQ3A 5CKTA 4J19A 3KX2A 1T98A 1IJWC 1XSDA 3D5RC 1EF4A 1MIJA 1MD0A 1ON1A 2DA4A 3QWLA 5EEAA 4XKCA 2JSCA 2EZLA 4OMYA 2LDUA 3G71I 1W1WE 1GHCA 2PI0A 1G3SA 2MH2A 4L5JA 5F1RA 4DQ2A 2XPVA 4M3FA 2CUFA 2VXDA 2XV4S 3R0JA 4HLYA 1LJ9A 2EILH 2LMDA 3BJOA 5DUKA 3AAFA 3JAMK 3WTVC 4OWRB 1QHHD 2JPCA 2LP0A 3ERMA 2HKXA 1IN6A 4KYWA 3V7SA 4BNCA 2YU3A 2X51A 2NXNB 3HGGA 3CDIA 2GXBA 2LY2A 1K4SA 4OIQF 1Z1DA 2BY2A 1HSJA 3IAM2 3KEOA 1B8IB 3SYTA 2IP2A 2DFIA 1DU0A 2JVHA 3D5SC 3PNTA 2LC2A 2DA2A 5FROA 5FRMA 4YFXF 4M6VA 2LBFB 2CW0F 2V6CA 3HSEA 3JRDA 2WY8Q 4MHGA 4ZYHA 2HR3A 2RN7A 3U1KA 3W6KB 1OYYA 2ZXIA 1OYWA 1VF9A 4ZYGA 3A2KA 1S9HA 2XVCA 5ICFA 2DT7B 5D5VB 2FF4A 5J8FA 3F0CA 1IO2A 2W48A 2E34A 2CO5A 2W82A 3BG5A 4NHJA 3CCUI 2K9MA 2XAJA 1WQ2A 4PJMA 4MLOA 3BY6A 2XKOA 2X85A 4HV5A 5L3DA 2BXYA 3A0HC 2X6YA 3QPTA 2AO9A 1SVOA 4FE4A 5LGNA 6PAXA 3VSKA 4G7ZF 1K78A 4GRIA 1TP4A 3H0DA 2A6EF 2WB1N 2Z2SB 3ZMDA 3VYUB 3BROA 2PJPA 5K5OA 1KYWA 4MGRA 2PMUA 3H9GA 3HOWJ 3JCUC 2H27A 2ZJPF 4WWCA 1AU7A 3WTXC 3DXJF 1JTYA 2AS5F 2VI6A 4GCVA 3GTQJ 3HOZJ 1U2WA 4BQQA 5GPCA 3OY9A 5TGTA 3WGHA 2P6TA 4ZTJA 1N78A 1MH3A 4UVAA 2ID3A 1PUFB 2KDZA 2P81A 1IRFA 2JA7J 5GPAA 1Z0XA 1S29A 2EIJH 1VQKI 5E17F 3JRCA 1FIAA 1HKTA 3IH3A 4DZPA 4LK1F 1ITYA 3BR6A 2DMNA 2AQEA 2R4GA 4BQAA 2XSJC 4ZYDA 4QWQA 1EH6A 2AXTC 3HHHA 1MDMB 2W57A 2DJIA 3FKJA 3RKQA 3I4NJ 4K2EA 2KISA 4BJ6C 1YIOA 2L2OA 2LSOA 4PGGA 4HQEA 4J00A 3KZYA 2M5WA 3UNGC 1FBQA 3CJQB 1DPUA 4JK1X 4HA8A 3K4CA 4I0AA 3G73A 5D8KB 1X1CA 2DT6A 1TNSA 2K5CA 1D1CA 3G3ZA 1R1VA 1F36A 3SFZA 4HQMA 1KGSA 5H6RA 4BH9A 4BKXA 3RCOA 2EFWA 2JJ7A 5D6EA 2K9LA 3OV8A 2BV6A 2UUZA 2NNNA 5HLHA 3RI4A 2XAQA 1Z05A 1K6OA 4YFKF 4QLCU 3I53A 2BGCA 2FNAA 3OYDA 2M4KA 1T08B 2R7SA 3CCSI 2R3SA 4XKWA 5H6QA 2R5YB 1ZHFA 2A68F 1Z6TA 3HBLA 4UXNA 4B3AA 4EMSA 1LFUP 3GTKJ 2F6CA 3IP4B 2P5KA 1SC7A 3LL7A 3KEQA 1A04A 3GFLA 3H3UA 2VKHA 4DZJA 1S3JA 5J6XA 3Q0VA 4JP0A 2F4MB 4QPQA 3RPUA 3AG1H 4I6ZA 3VWBA 1D5VA 2RQPA 1FTZA 3SJMA 3BLYA 5DUIA 2MSYA 2K86A 3M07A 2L5QA 2ZCWA 4NC7A 5EDNA 1B72A 3QYBA 3V42A 3M1EA 3GTOJ 1SFOJ 3FKIJ 3ZQCA 3M7GA 1QPIA 2NRAC 3DWLE 4EM2A 2YX4A 3LWFA 3V4GA 5K7HA 3WG7H 2XF5A 1I3QJ 2KP6A 4XLPF 5FKKA 4Q4ZF 5GP9A 2LKSA 3TMOA 5AONA 1WJEA 1VTNC 3LNQA 4CYCB 2IBDA 5E3MA 1UG2A 2Z3YA 5B66C 3O6BB 4XN0A 2DFFA 4UV8A 3F23A 1KU2A 3HUGA 4N9HA 3E6MA 4HV6A 4ENKA 1TWHJ 4BGDA 1MW7A 3LOCA 3UKGA 4E7IA 3OR2C 5EF6A 3MKZA 5F27A 1KQ9A 2DJNA 2PMZA 3KPHA 2M7AA 4NC6A 3WG9A 4MIMA 2L54A 1JXSA 4CUGA 4A0ZA 2VOOA 2VT3A 2Y69H 4F3QA 2HDDA 3CQZJ 2Y9ZA 1A35A 2KPMA 4W97A 5IY5H 2DI3A 2M34A 3GLXA 3COAC 1AKHA 2CQXA 5FKMA 2R93J 2FA5A 3MZYA 1T8IA 2XUBA 1VQNI 1F43A 2FNPA 2QENA 2MGQA 4IHWA 3RQ4A 1U78A 3IH2A 2BW3A 5DS9A 1QA6A 3S1QJ 4A3LJ 1ETQA 1X1AA 2Y9YA 2E2JJ 2EZHA 2X1DA 5HDKA 4WCGA 3K1NA 2M0CA 4IOAF 3ISPA 5E1WA 3BZ6A 2IS4A 5HOOA 1RI7A 4KT6A 4DBRA 3G2BA 4HLXA 2KZVA 2VQCA 1BI2A 1S7OA 5LBQA 2PG4A 3IUOA 3QP6A 4XRSG 1JKRC 5AIQA 2Y0SN 1ZR4A 2FE3A 1A36A 2VPLA 2IJLA 1Z3YA 3OYAA 2VL8A 3BT9A 4ENNA 2R0QC 3GUDA 2PMHA 5HS8A 1SD6A 1MJBA 1RC9A 3BR3A 4AC0A 2P7CB 1STZA 2BY1A 4XLHA 5CVJA 2QSHX 4U7DA 2LY9A 3FBNB 3I59A 2DMQA 2JUCA 3DU5A 2CW8A 4XSXF 1AA7A 2GOXB 2BBYA 2ZXWH 3DPUA 1ON2A 3K70C 2OQRA 3KP7A 2MC4A 4ON0A 3IL2A 1FEXA 4E7LA 4I98B 3PQKA 1RETA 2O7OA 2G7HA 3IKVA 4OIRF 3W6VA 1EH8A 5JR3A 5KK1A 1JKQC 1J0RA 1KU3A 1U3EM 2XAHA 2DA7A 2EK5A 4WX9A 4P96A 4C2UA 1D0YA 3V7CA 1K6YA 2P4WA 3CMMA 2MD5A 2QF7A 1P7JA 2KL4A 3MVPA 2NVQJ 4UUSA 3NWSA 1TTYA 2XROA 1VQ4I 4ZDOA 3TGNA 5K5QA 5H20A 5E3NA 1BR4A 2ZJRF 4W1UA 4O6JA 4A3MJ 1WVRA 1KU7A 1IDZA 2KRFA 2BVLA 1P92A 3FBIB 3GFJA 3P5JA 4CCMA 1OKRA 3GEZA 5DCFA 2DLLA 1K78B 3K4NA 3CCJI 3LA7A 3O8GA 2MW8A 3I4MJ 2DCEA 2L7ZA 4L9VA 2ID6A 1KQ0A 2VQGA 2VC1A 2DYRH 2Y2ZA 2YSRA 1BJAA 5LGUA 3GXOA 3D0SA 2K9NA 4BJ5C 4ESBA 3I56I 3LSRA 2QSGX 3MEXA 3KLOA 5EJCA 2ZBKA 3BR1A 3J81Z 2DOAA 1Z3XA 3AG4H 1B8IA 2FMLA 1X19A 1IUFA 2QUFA 1KU9A 2ZJQF 1UHSA 2FBIA 4XOPA 2O9LA 1DDNA 2NS8A 4EEFG 5DM7F 3LSTA 3F9KA 4P9FA 2M8EA 2ZNZA 2R92J 2QZ8A 4ZC3A 2LBFA 4KISA 1FOWA 3REOA 3JR9A 2HVSA 1W36C 5H2FC 3DTKA 5FLXK 4ZH4F 1Z21A 5IPAA 3CCVI 1QU3A 2Y48A 1X1DA 3TO6A 3QQAA 1I6XA 2FU4A 4PK4A 3EPZA 2HXIA 1HLVA 1FX7A 4CCLA 1I39A 3F6VA 4UUTA 2RVCA 3VB2A 3WTYC 2VODA 5GAHJ 3CZ6A 1KA8A 3DEWA 3CD6I 4XK4A 4H4KC 4HX4A 2ZO4A 3FISA 3OYJA 3BCAA 4E6KG 3J80Z 3CCMI 2XAFA 4A3FJ 3SZGA 3MCZA 3BWGA 3GO5A 2CG4A 1H9GA 2OQGA 1O57A 3EUAA 1JKOC 2W84A 4G8XA 2OU2A 3E97A 1U9NA 4KN4X 3WE2A 4A69C 3E3VA 3S2WA 3P9IA 2LYCA 3BR5A 1Y6IA 4BJTA 4P9UA 3WTSC 4XLCA 1FP1D 1YTYA 2ZFWA 4FETA 5DYMA 2L01A 1ZKGA 1J75A 1SFKA 3B6CA 2EA4A 4G12A 5D4SA 4AU7A 4Q47A 3WU0A 1K79A 3BTCA 3SFIA 3W2VA 4CGZA 2XGXA 1Y1WJ 4ESJA 3PJRA 2IGMA 1MSEC 1TQIA 1WJFA 4HNTA 1HDPA 2F4IA 2XF7A 3J7AO 2HZDA 3CMYA 2NNYA 3LA2A 3OL4A 3W6JB 1UJ8A 3EETA 2LF8A 4G6TB 4G6DA 3L2UA 5TRDA 2Q0OA 2YS9A 1B72B 2Z33A 2JA6J 4ASNA 1ZGJA 2WB1A 4L0YB 5BPIA 1FOKA 3CDHA 4HNUA 1T0FA 4HAMA 3TP0A 2XGCA 4MQVA 3KP4A 2DTRA 3H5RA 1WI3A 4YRVA 2E60A 1HOMA 2MA3A 5LEKA 4HF2A 4NB5A 1L0OC 1JUSA 3E6CC 1Y1VJ 3HUGB 4A6DA 5E1ZB 2NVYJ 1IDYA 2DK8A 3AG2H 2DO7A 5D4RA 3L2QA 4XM3A 3BDDA 3AKZA 2V79A 4KMFA 1T2KA 2ZB9A 4DYQA 2XASA 2W85A 5GAGJ 2IS1A 1Y0UA 1XSVA 3NRVA 2YR2A 1ZG1A 2RNJA 2R5YA 2V7FA 1UCRA 4N0BA 2DOEA 3BP8A 1XCBA 2KIFA 2WV0A 5D6FA 4ZZLA 5ILVA 1ZARA 3CO7C 4GDFA 2CGPA 3VSLA 2V26A 4B8XA 4A3BJ 1OMIA 2E71A 1OISA 2FBHA 2XRLA 2R7UA 2J5OA 3FM3A 3ZXSA 1TC3C 1KQ8A 4MTDA 4IRGA 3B02A 2OUMA 3GW2A 2PN6A 5EGOA 4NQWA 2RGVA 5DV5A 1E0EA 3E6DA 4PSXA 3MZHA 3GBGA 2X4HA 1ZLKA 3LSMA 4G7HF 2CSOA 3MD2A 2FQ4A 2DTZA 5CVVA 2MC3A 5E18F 3U21A 2ZSIB 4XLAA 1DU6A 4M9SA 4OINF 2HOTA 1FNNA 4XSZF 2DMUA 4HYEA 4UV9A 2HDCA 5F0CA 2VOPA 3G1MA 2EB7A 1FBUA 3DP7A 1WH7A 3EDPA 4U0WA 1UFMA 1IRGA 2DFEA 1J5YA 3H92A 5KCMA 1XDSA 3VEPA 1YJNI 4HDUA 3K9TA 3HL2A 1NK3P 5EG0A 4A93J 2FXAA 2ECBA 4M9XA 4II2A 3I64A 2L7MP 4IZZA 1JE8A 1X4PA 2L3DA 3OS0A 2OCCH 4A6EA 3L2VA 5C4JJ 1ZG5A 1GDTA 4XONA 4KN7X 4D9JA 5CLSA 3S3OA 1QRYA 1R58A 3I59B 4IEJA 4XORA 4P5OA 2ZJ2A 1OCCH 4RAGA 3HTSB 5DTDA 5L3BA 5DEQA 3K2AA 2V1DA 5ICGA 4ZDLA 3F21A 2DMPA 3HZJA 3OIQA 2ELHA 4LOCA 1S6LA 1HQCA 3R0AA 4EATA 2K3PA 4MNUA 3MKWB 3O8HA 1MBGA 2GXAA 3WGGA 5JHFA 4L5IA 2LVSA 4AIJA 4E7HA 3TO7A 4IHYA 2WBMA 2OZUA 3TBIA 5C4XJ 4LG3A 1R23A 3TO9A 3ASNH 3HYIA 2RQQA 3BCBA 3K0LA 3SEQA 2F5EA 4CCNA 4KUMA 3J7AY 2IS6A 2BZTA 3BTIA 5CJ9A 1VQPI 1CF7A 1LFBA 3CP8A 1JHHA 3EUHA 4UUSB 2P6SA 2XB5A 1TQPA 2VE9A 2O8KA 3RYRA 3S8PA 1SMTA 2M87A 3E0JB 3HC7A 3QU6A 4LMYA 2IXSA 4XN3A 1HSTA 4Q5SF 2RNGA 1ZREA 2XGEA 2EINH 3FMQA 2VKVA 4PJ0C 4XICA 3K4JA 3JRGA 2EV5A 1E3HA 1QPMA 3ZQHA 2GOMA 4RB1A 1A5JA 2V1UA 3CMAI 1BIAA 3CC4I 4XQFA 5J1RA 5FFZA 1RESA 4LFUA 1PYVA 4EJTA 2E7WA 2VC0A 1R7JA 2CQQA 2C6YA 4RBOA 3PUFA 5KVRA 2RC4A 3PL8A 4Y17A 3RJPA 4EM1A 2Z9OA 4II3A 1J2XA 2CJJA 3RYPA 1R36A 3GZ5A 3RKXA 4C3HJ 3CCRI 2R7RA 5GAEJ 2HDWA 4H0EA 3S3NA 4BS9A 1LDJA 3V7RA 5ICCA 4A2UA 2EFNA 3M8FA 3QOPA 1W5TA 3FHNA 2H8WA 3FXUA 3DKWA 1ETVA 1YLFA 3BOQA 3KP6A 1RKWA 2NVTJ 4FX4A 3LFUA 2HPIA 2VONA 2VJ5A 2E5NA 2HS5A 1MJAA 1X2MA 4G94A 4GXOA 3C18A 1AWCA 2A61A 2ESHA 3T5XA 3HSRA 1YJWI 2HI3A 2Y0SA 3BPXA 4EM0B 1U9OA 2UXNA 2DXIA 3HKZN 3JW4A 2A69F 1B1BA 1OLTA 1ZGWA 2ICWG 5FO5A 3FXQA 4E4HA 1FIPA 3ULQB 2D45A 3M4OJ 2IA1A 2L9NA 3LQQA 1P2FA 2ADUA 1XMKA 3JTHA 3HSFA 1B4AA 3ZMSA 5A2QZ 4G9YA 4RS8A 1HW1A 1XCVA 4LK0F 2UZKA 2WC2A 4A3GJ 4I76A 2WV1A 1Z67A 1IXSB 2B7EA 1MZBA 5FFXA 1VQ7I 3HIFA 2HTSA 2DYSH 3I4PA 3IHUA 5HLIA 2KT0A 1XC5A 1HKQA 3FXOA 3O2PE 3TDUC 2VBXA 4A3CJ 5FJ8J 3EQLF 3DTIA 3PIOF 5EEHA 3GTLJ 3CP2A 3KFWX 2EJRA 3K4LA 3ABLH 1R71A 1FLIA 1ULYA 1VQLI 1XPXA 2Y30A 3BZCA 3T8TA 2HZTA 4HDVA 2HKOA 1XTAA 4OMZA 4XRFA 2CQ7A 1OCTC 4B48A 2X6WA 2M2EA 5HDNA 2ETHA 1Z77A 4LITA 4KA4A 4XLFA 3SDGA 4BHBA 5E8IA 2FOKA 3NAUA 4HNVA 1XG1A 1FZPB 4M72A 4QTRA 2JSPA 1TW2A 2V9KA 5DM6F 5LRRA 2R7ZJ 1RKTA 1MBKA 1P7IA 1WJ5A 4CICA 3AL0B 5HNFA 4M74A 5K1YA 3ZPLA 3LFKA 1TBXA 3WHCA 1JT0A 1USSA 3AFHA 3HRMA 3PFYA 1XD7A 2FUG2 1GVJA 2JUGA 3GYHX 2WWYA 4DYRA 2P0WA 3WTZA 4RAZA 1G8XA 4GFBA 1MMAA 4D7NA 4M6YA 2K7LA 4AVPA 4Y7NJ 3K10A 4PSWA 2VIXA 5HODA 4M3GA 2O5RA 3Q0WA 2XHKA 5HLTA 1XGOA 2LR8A 4NUBA 3RIRA 5DD8A 2UWMA 3W2AA 4XOTA 2A6HF 1DUXC 5J3LA 3F72A 2E2IJ 2O6GE 1LEBA 3WTWC 2FX0A 3U9GA 4C3IJ 2PLYA 4MO7A 2H94A 3S14J 4RGUA 4DBQA 3R6SA 3OYEA 3MKLA 4BEHA 1W7PD 3OYGA 5D5XB 4IKFA 2OCEA 3L2RA 3AL0C 3OL3A 3OYMA 4RB0A 1XX5A 1KZHA 4HX8A 3HOUJ 3IAS2 1NHAA 1ETYA 2PBIA 5EGOB 4NQWB 1V5EA 1MKMA 2STTA 2LREA 3QYEA 5E3LA 4HF1A 1D5YA 4D1QA 1I6HJ 2E1CA 2CS3A 1N77A 1XDUA 4IL6C 3WHBA 2QBYB 4M73A 4KICA 1J7KA 3E1SA 5LGTA 2B9SA 4ZZDA 5IT9Z 4RB2C 4I01A 2Z16A 2KKOA 3PO3J 1YW7A 2P7VB 1Y8RB 5BNGA 1BC8C 4OIPF 1TT5B 3GZNB 3ASOH 4A3EJ 3E5UA 1BOAA 3PSFA 3I0TA 4BBSJ 2XF6A 1LB2A 3HJEA 3Q9SA 1MMSA 2KFDA 3KLNA 5FD6A 2EV0A 1JJ6C 5B1BH 1FSEA 1YRNA 4I09A 2Q1ZB 4CHUA 5FLVA 1TL8A 5EG0B 3BJAA 1BL0A 1PJRA 1OFCX 2XPWA 2CQNA 1GXQA 4BXUA 1U8BA 5AIPA 2BE5F 5L3CA 1Y56A 3GX4X 5JFRA 4FISA 4CA0A 4Y13A 4EJUA 4AUXA 5BOXA 4A12A 5IP7J 4Y33A 2FOWA 3FMRA 3CUOA 2VLAA 4BUPA 4ANJA 4ZTFA 3UR3C 1R5ID 3OYFA 1SAUA 3CESA 1E3OC 3L09A 2HXOA 4JQFA 1IN7A 2QEXI 3S15J 5GTIC 1T33A 1WKMA 2G0EA 2VPRA 4N9IA 1G3YA 1YX3A 3LA3A 2LKXA 1OQYA 1ZAOA 2H1LA 4I7HA 4N4NB 3HOVJ 2ZMEA 4R8HA 5J4YA 1SEUA 2OBPA 3B73A 1IC8A 1CF7B 4N4OB 1C0WA 2HQRA 3H0GJ 3O3KA 3QPLA 3J7ZI 2PEXA 4KIBA 2CMPA 3A4CA 4E7KA 3BC8A 1B9NA 4WXDA 1I27A 5LHIA 3RZOJ 2COBA 4DNCA 3H9QA 1BI1A 2MG4A 3OYIA 1MGTA 1IN8A 1W0UA 4L9NA 3S32A 1T95A 1PUEE 1LDKB 4ZDPA 4FTHA 3GWZA 2LF7A 3CJRB 3SHFA 1YI2I 3RPQA 4CZZA 1WRJA 1GV5A 3T8RA 3ZQLA 4UB8C 1H89C 2IAIA 1ZG3A 1U5TA 1QO0D 4BE1A 3VYTB 3ZQGA 4E7JA 1BA5A 1A31A 4A3IJ 2HGCA 2EZKA 3OS2A 2GA1A 2WA0A 4AIDA 3WU1B 3LSGA 4EGZA 2BYVE 4KMUX 3WE3A 2UXXA 3DEEA 1N75A 1BR2A 2CFOA 2VJIA 3TKYA 5E3OA 1APLC 3EUHC 2ME0A 1FBSA 2LRDA 2DAOA 2H6CA 3DCFA 5F0FA 1YS7A 4C30A 1IN5A 5EZGA 1AHDP 1BM9A 4Y52J 1YO5C 4LLGF 2K27A 2MABA 1V5FA 3DLLF 2GWRA 1OCPA 3ML6A 3ZP5A 1IN4A 9ANTA 3HOSA 3Q5FA 4LB5A 2MBFA 3DF8A 3OR1C 4E7SA 1VFCA 4QSHA 3ZN1A 5IP9J 1F5TA 4BXFA 2R7WA 1F1ZA 3WTTC 1IF1A 2OJED 2XGDA 5K5RA 2QA4I 1ZGAA 4OOIA 2JA2A 2W7NA 3CF2A 1EJ9A 3HOYJ 2DK5A 3GF2A 1IAWA 1YX5A 4HF0A 5IYBJ 1EV7A 2IGOA 2L9VA 2RREA 4E7ZA 3OYNA 5HS9A 3PUBA 1W7PA 3BPVA 1H0MA 3MKYB 2DQRA 3VFZA 4A3JJ 2K3FA 3V8LA 5IT3A 3LSIA 4CO8A 2E2HJ 2EFPA 1XN7A 4OIOF 4BY7J 2W1OA 2D5VA 4IQ4A 3FXRA 1MNDA 2IT0A 2OZ6A 3P9CA 3H9JA 1VQMI 1OJLA 3GFIA 2HQ5A 3IH4A 3DPLC 4R1HA 1SVLA 1RUNA 1HDDC 2VJ4A 2A6TA 5LD2C 2BEOA 2FEZA 4YIRX 2QQ8A 2G9WA 3MN2A 1PDNC 3RKWA 1ETWA 2EA2A 1USTA 1GVDA 1VI0A 3OSFA 1PP8F 2BY0A 4WF2A 1FP2A 1K83J 4F52A 1S5LC 1X3ZB 3ZN0A 4RGSA 3FWEA 1BBYA 3NEUA 1O7FA 2NAZA 1LNWA 5D8LB 4RB3C 1D8JA 1KYZA 2JRTA 1W4MA 2DOFA 1IG7A 3I54A 3LAPA 5M5WJ 2M3AA 1YITI 1MBJA 2HU9A 1P6RA 1DP7P 3GLLA 5FGMA 3CUQA 1XGNA 5J1UA 3DFGA 4ESFA 3LQRA 1P9QC 2LKPA 2LH9A 3L9FA 2O8XA 5FKNA 2Y75A 2CWEA 4Z2YA 4RAYA 1WWXA 4G7OF 5DCMA 3L7WA 1WH5A 4YEJA 1U6GA 2A5WA 3ELKA 2LY1A 2RKHA 2DA1A 3BG9A 5D5UB 2FBKA 4HOBA 2QQAA 1BIBA 3VDXA 4U87A 3JAMZ 2M30A 2TRTA 2DW4A 3R4KA 2X6XA 3K1MA 1JGGA 1H88C 1GT0C 1Z7UA 2ZXHA 3F6OA 1SD4A 2QKMB 3J7YJ 3KIOA 4PUSA 3VPRA 3HKZA 2PJRB 2HTJA 3LSKA 3BG7A 4BE2A 2CU7A 3C2GA 4BEHB 1TZLA 4JX4A 2EFQA 2HQNA 2K85A 3WTUC 2H09A 1JI8A 1W5CC 1TWGJ 3I9V2 3CO6C 2IEKA 3QP5A 3KP2A 1ZELA 2OPTA 4C2TA 4RA2A 1SFEA 3JRHA 2M7BA 5ERIA 3ZQIA 2VB6A 3SXYA 3KEYA 2QYOA 1TWAJ 1ZQ3P 1JTXA 2KRHA 1QQIA 2OD5A 2I10A 4V2GA 4U0YA 3ECOA 4IX7A 3W3CA 4C3JJ 4FQGA 3ABMH 1D0ZA 2E1MB 4OU0A 2O3FA 1RRJA 1P4WA 2GXGA 5FLMJ 1FMWA 2MLKA 1VQOI 2V9PA 1U0JA 2Z5UA 3F8MA 4PJJA 2B0LA 2O0YA 1J59A 1LVKA 2K4JA 1QBJA 3QOEA 3IC7A 4RLFA 1ZRFA 4D5FA 1YRNB 3M3YJ 2DFHA 1S7EA 4CCKA 4KT5C 1DQUA 3VYSB 4A3DJ 3DKXA 1ODDA 3QRFF 2D1VA 2PQ8A 2EIKH 4S05A 2XRNA 4IQJA 2P5VA 3S93A 1BN5A 3DBLB 3A01A 2NS7A 5IYDJ 1MMDA 1Q1HA 2KJBA 1TW3A 2EH3A 3C1DA 2Q2EA 1R00A 1WPKA 2L7KA 4UUVA 4S0HB 4IF4A 2EQRA 2F4OB 3HXLA 3TP3A 4CSWA 2LG4A 1YOVB 2WAQN 4P55A 4Y15A 4YIFA 2HOEA 2ACJA 2DPDA 3PSIA 1FOXA 3N05A 1YW9A 4XLEA 2PFBA 3ABUA 4UVCA 1YG2A 5F6FA 3ZOBA 2DODA 2WTEA 3ZMTA 2ZMEB 5J8CA 2AHQA 2R7FA 4O5VA 5CVIA 2CUZA 2IA2A 2QBYA 3ABKH 1IXCA 4EJWA 3C7JA 2KDOA 2EFOA 3TDZC 4XR6A 4PDKA 3CJTB 1I5ZA 1TWFJ 4YELA 1ZK8A 1XGMA 2RV8A 2H1KA 3BQZA 3NWTA 1VQ6I 1O3QA 2X9DA 2JMWA 2JPBA 5ILUA 2X0LA 2STWA 3GMEA 3I71A 3HG9A 2GIZA 3EYYA 1OCRH 2JZYA 3C2HA 2HYJA 2DPUA 2HOSA 4AM3A 4ITVA 4NNJA 2CRGA 3E7LA 4BU2A 2Q8KA 1U5TB 3P7NA 4KDPA 2DU9A 2WADA 3RZDJ 2LLKA 3ZR8X 4U7BA 4ZJZA 5M3FJ 2OF7A 3KZIC 4ETSA 3A0BC 5HS7A 3M8JA 4BY1J 2ZMEC 3EYIA 2CQKA 3CMEI 2OTLI 2GLOA 3RKYA 2R7TA 1X1BA 3K2ZA 1Y39A 4TV7A 2EZIA 4X0GA 5IP6A 2HVQA 3ABTA 3VODA 2R7QA 2KLOA 3S1MJ 4RMNA 3HRSA 1LFPA 2COMA 2HNHA 4LLNA 5KAFC 1BOBA 3J81K 3H3ZA 4XLNF 1OPCA 4AIHA 2CV0A 1MSFC 1I1GA 2YUSA 1S7AA 2NOGA 4FASD 1ZRCA 1IXRC 1VQ8I 3I55I 2K40A 4HZFA 3OYLA 1BI0A 1Q1VA 4E70A 4LG0A 1Z9CA 1SFUA 1BI3A 3HPGA 3QPSA 5GADJ 2Z1DA 1U5TC 2E19A 3R60A 1ZLJA 5CPRB 4DGWB 1BJZA 2XPUA 4PGHA 3PO2J 2R7DA 4BHCA 2GAUA 2MLGA 2X6OA 4B4CA 1NH3A 1H9TA 2F2EA 5EZHA 4B09A 1DP3A 3P9KA 5CYVA 5JLXA 2HWVA 4M9ZA 1HA8A 3VYRB 4KIFA 1W7PB 4AYBN 3RPUD 3A1YA 2DA6A 2LFBA 4UNOA 1Y0NA 1SMYF 2KIMA 3H3VK 1X3WB 1UHWA 1QZZA 1D8KA 3C2BA 3DQVC 5FRNA 2WAFA 1ETOA 3QAHA 3J80K 1I50J 2FMYA 3PNVA 3ZMUA 5IOYA 5L3EA 4LIUA 4JOMA 2BVMA 1RZ4A 1O3RA 1FC3A 2QLZA 2XDVA 3KZZA 4JX5A 3ZMVA 4IHVA 2GM4A 1K7AA 2E1OA 4X1EA 1LE8A 3TOBA 1WGXA 3BG6A 1FYLA 1MBFA 1DGWY 2W4SA 5TJJA 2LK2A 1H8AC 3K6GA 3D5LA 1E17A 2NYXA 3LSJA 1WCMJ 2GQQA 2QM3A 3HPHA 3DV8A 5LHGA 4MQ9F 1R5HA 2D1HA 2K9QA 3H1CA 1R9TJ 4BBRJ 2KMUA 4XKBA 5LEJA 3RTRA 1NG7A 4LLLA 5F04A 3LSPA 3DPTA 3FMSA 1WJDA 4F55A 4AD9A 4CCJA 1XS9A 3LMMA 1XMAA 3CUQB 2DDBA 1J09A 2CV1A 4YFNF 5JLWA 1LDDA 3KP5A 4EVIA 4HSRA 4M6XA 4D0PA 5FKOA 3H5NA 5DCMB 3F22A 1HKSA 1IRZA 2VJJA 2ESNA 2M1BA 2X1CA 4HPQA 5B3SH 3L2WA 3OYCA 3CJNA 1G3WA 3F8CA 1ZH5A 2W25A 3AG3H 1JHFA 2HOAA 1NG6A 3CCYA 1POGA 4WK8F 4IJAA 2VE8A 2M0MA 4IHSA 3H36A 2OC6A 1R6RA 4UHTA 2GZWA 4XBFA 5BS6A 4A0YA 2DBBA 2ME6A 4FHTA 2IRFG 3MFKA 4FCYA 3ZRGA 1VNDA 3HRTA 4CDGA 1G3TA 2KRCA 3LSHA 3BQYA 1JT6A 1D3YA 1B6AA 1GUUA 2ECCA 5M3MJ 2L0KA 3QODA 3CUQC 3K4BA 5BPDA 5CVUA 2Y0MA 3X2QH 5IYCJ 1MNEA 3QYFA 2XIGA 4ZYAA 2HYGD 2ZSHB 1ETXA 4I99C 1IRXA 4D7MA 2ISYA 2JVGA 3L1PA 3OYKA 2IA0A 4WXHA 1WSUA 5IOZA 2JN6A 4IPAA 1QHGA 3OYHA 5K7FA 3B6AA 4ZYEA 4FT8A 2D2WA 2VUMJ 2TDXA 4KITB 5K7ZA 3M8EA 4IO9F 1MMGA 3L00A 1Y8QB 1GV2A 2DQLA 2VBZA 1BR1A 2ZXJA 3BG3A 2F5DA 2I5UA 3SZPA 3TW6A 3TW7A 1LKXA 3GTPJ 3JRFA 3HGYA 1RR8C 2FD5A 3A01B 1R1UA 3FXJA 3JTGA 4EJOA 3GFMA 2YPRA 2HEOA 2E35A 3ROUA 2KZGA 3ECHA 3EUKL 1UHMA 1REPC 3MQ0A 2Q2EB 2IW5A
chains in the Genus database with same CATH topology
4J19A 1IJWC 5F0FA 1EF4A 1X58A 1JKPC 2X48A 5EZGA 1AHDP 4Y52J 2DA4A 4MFDA 3TP0A 2XGCA 5EEAA 1OCPA 1WI3A 2EZLA 2LD5A 9ANTA 1HOMA 2XPVA 3Q3SA 4M3FA 2CUFA 1VFCA 4QSHA 1JUSA 5IP9J 1Y1VJ 2NVYJ 2XGDA 1IDYA 2LP0A 1BW6A 3HGGA 3HOYJ 1X2NA 2ZB9A 4DYQA 5IYBJ 2DA5A 1B8IB 1RR7A 2R5YA 3S1NJ 1DU0A 4NDLA 4MFEA 2DA2A 4A3JJ 4M6VA 4JX6A 4A3BJ 2E2HJ 3JRDA 2R5ZA 4BY7J 2D5VA 2YU9J 4DW6A 2XRLA 1VF9A 1TC3C 3JRBA 1OJLA 2HQ5A 3IH4A 1FJLA 1JJ8C 5EGOA 3F0CA 2W48A 1HDDC 3GBGA 1IGNA 3HDDA 3BG5A 2LTPA 3MN2A 2FQ4A 2DTZA 3S2DJ 1ETWA 4MLOA 1DU6A 1GVDA 2HOTA 1VI0A 3OSFA 2DMUA 2AO9A 1HF0A 4FE4A 1K83J 5F0CA 3G1MA 1T56A 2WB1N 1WH7A 2NVXJ 1IG7A 1QVUA 5M5WJ 1MBJA 1NK3P 5EG0A 5M5YJ 3HOWJ 4A93J 2ECBA 2L7MP 5J1UA 1GDTA 5C4JJ 1AU7A 1JTYA 5FKNA 2VI6A 3GTQJ 3G1OA 3HOZJ 5GPCA 1ZTRA 2JA5J 1QRYA 1WH5A 4IEJA 1MH3A 2ID3A 1PUFB 2KDZA 2DA1A 3BG9A 2P81A 2N8GA 5DTDA 2JA7J 5GPAA 1Z0XA 3K2AA 2TRTA 1FIAA 3JRCA 2DMPA 2RAEA 3IH3A 4DZPA 1ITYA 3BR6A 4LOCA 1JGGA 2DMNA 3OOUA 1H88C 1GT0C 2CUEA 3O8HA 1MBGA 2LVSA 3VPRA 5F1JA 3RKQA 4IHYA 3I4NJ 5C4XJ 3IV5A 2GBYA 3OSGA 2CU7A 4DYCA 5C44J 3K7AJ 4JX4A 3FK6A 3BTIA 1LFBA 1TWGJ 4UUSB 2IEKA 2XB5A 2OPTA 3JRHA 2O8KA 3GTMJ 3ZQIA 1F36A 1TWAJ 1ZQ3P 2XGEA 1LE8B 1JTXA 4BKXA 2VKVA 2JJ7A 2I10A 4V2GA 4XICA 3JRGA 1ORKA 4C3JJ 3ZQHA 3D1NI 1A5JA 5FLMJ 5J1RA 1RESA 2CQQA 2R5YB 4RDUA 4B3AA 4RBOA 3HBLA 3GTKJ 1LFUP 4M3BA 2M8GX 4D5FA 1YRNB 3M3YJ 2CJJA 3HM5A 4XIDA 3GTJJ 1S7EA 4C3HJ 4DZJA 1MBEA 2L9RA 4A3DJ 3Q0VA 4JP0A 4I6ZA 2K9SA 4B1RA 1FTZA 3SJMA 3HB9A 2Y31A 2MSYA 3A01A 2FJ1A 2NS7A 5IYDJ 1O4XA 2VKEA 2EH3A 5EDNA 1B72A 1ETKA 2H8RA 1ETVA 1WPKA 3GTOJ 1RKWA 1SFOJ 2NVTJ 3FKIJ 4S0HB 3ZQCA 1MH4A 3PM1A 2EQRA 1QPIA 1X2MA 3TP3A 4D5CA 5K7HA 2WAQN 1I3QJ 5FKKA 2HI3A 5GP9A 1U9OA 1G2HA 3HKZN 3LNQA 1ZGWA 4CYCB 2IBDA 3ZOBA 5E3MA 1UG2A 2AHQA 1FIPA 3M4OJ 1TWHJ 3HEFA 3LOCA 3UKGA 1RPWA 5EF6A 4BXXJ 5F27A 1TWFJ 2DJNA 1ZK8A 3GTGJ 4A3GJ 4I76A 2WV1A 2H1KA 4MIMA 3BQZA 2M9HA 1TWCJ 2X9DA 3NARA 2HDDA 2JMWA 3CQZJ 2KT0A 2Y9ZA 4W97A 1XC5A 2M34A 4A3CJ 5FJ8J 2HYJA 3GTLJ 2DA3A 1AKHA 2HOSA 3A03A 2CQXA 5FKMA 2R93J 2CRGA 3E7LA 4X6AJ 1F43A 2Y30A 3RZDJ 2LLKA 2MGQA 3TEDA 4IHWA 5M3FJ 2JK3A 5EYRA 2OF7A 3IH2A 1U78A 5DS9A 3S1QJ 4A3LJ 1OCTC 1ETQA 4BY1J 1ZR2A 2M2EA 4ABZA 2Y9YA 2E2JJ 1Z77A 2EZHA 2GLOA 3A02A 3SDGA 2EBIA 1SANA 5FKLA 2M0CA 3NAUA 2EZIA 4HNVA 5IP6A 1CQTA 1XG1A 4V2FA 4QTRA 3S17J 3S1MJ 2R7ZJ 1RKTA 1MBKA 1P7IA 4C2MJ 3WHCA 1JT0A 4M3DA 1MSFC 4XRSG 1JKRC 2YUSA 2Y0SN 1ZR4A 2NOGA 2K40A 3BT9A 2R0QC 2ELKA 1Q1VA 3BR3A 4AC0A 3HOXJ 4DYRA 3QPSA 5F0HA 4GFBA 4D7NA 2E19A 4Y7NJ 2LY9A 1BJZA 2XPUA 3PO2J 2DMQA 5HODA 4M3GA 3JRAA 1PUFA 4IHXA 3JREA 2X6OA 3Q0WA 4B4CA 5EZHA 4JYKA 2LR8A 1FEXA 1NTCA 2PMZN 5JLXA 1RETA 2O7OA 4AYBN 5J3LA 2E2IJ 3W6VA 2FX0A 4C3IJ 2DA6A 2LFBA 1JKQC 3BR0A 3H3VK 3BTLA 4MO7A 3S14J 2B63J 2DA7A 3ZQFA 3C2BA 3MKLA 2R5ZB 1ETOA 3FK7A 1I50J 1W0TA 1A6IA 3Q0UA 5IOYA 2QF7A 1P7JA 3MVPA 2NVQJ 3HOUJ 4UUSA 1ETYA 4XRSA 5EGOB 1JUPA 5E3NA 5E3LA 1D5YA 4JX5A 4IHVA 2GM4A 4W1UA 1I6HJ 2E1OA 4A3MJ 3WHBA 1IDZA 2QCOA 4X1EA 1LE8A 1WGXA 1MNMC 2XB0X 1BW5A 1MBFA 2LK2A 1H8AC 3LSJA 3PO3J 5BNGA 1WCMJ 4A3EJ 3O8GA 2K9QA 4BBSJ 2MW8A 1R9TJ 3I4MJ 4BBRJ 2L7ZA 2ID6A 1JJ6C 1YRNA 5F04A 3LSPA 2Y2ZA 3S1RJ 5FLVA 5EG0B 1K61A 1BL0A 1XS9A 2K9NA 1AKHB 3LSRA 2L7FP 3G1LA 1OFCX 2XPWA 3BR1A 5JLWA 1U8BA 1B8IA 5FKOA 1IUFA 4FISA 1UMQA 1UHSA 2O9LA 2NS8A 4EEFG 4AUXA 2DMTA 1IRZA 1ENHA 5IP7J 4XRMA 2R92J 3BTJA 5M5XJ 2JWTA 1E3OC 2HOAA 2HXOA 3JR9A 4L5EA 3CCYA 1POGA 3S15J 5F08A 1T33A 2G0EA 5IPAA 2VPRA 2LKXA 3OIOA 4CYCA 3QQAA 3HOVJ 5C3EJ 2HXIA 2ME6A 1HLVA 1NK2P 4FE7A 1JUMA 4UUTA 4FCYA 1IC8A 1VNDA 1FTTA 3DEWA 4XK4A 3BQYA 3H0GJ 3QPLA 5J1YA 3FISA 3BR2A 1JT6A 1GUUA 5M3MJ 2ECCA 2JA8J 2L0KA 4A3FJ 5IYCJ 3RZOJ 4QIWN 2COBA 2MG4A 3S16J 1JKOC 1ETXA 1W0UA 1U9NA 4D7MA 4A69C 3L1PA 4FTHA 1QVTA 3BR5A 2TCTA 1MBHA 2DN0A 2JA6J 5IOZA 3CDLA 2JN6A 1GV5A 1HCRA 1ZKGA 3ZQLA 5K7FA 3B6AA 3B6CA 2IAIA 1H89C 2VUMJ 3ZQGA 5K7ZA 4G12A 1BA5A 4A3IJ 1GV2A 2EZKA 3BTCA 3FIWA 3SFIA 3S2HJ 1Y1WJ 3BG3A 1MSEC 4M3EA 3TW6A 3TW7A 3LSGA 1HDPA 3JRFA 3GTPJ 3HGYA 3CMYA 2XSDC 2FD5A 3JRIA 3A01B 1IV6A 5E3OA 1APLC 2ME0A 2YS9A 4A3KJ 1B72B 3RQIA 3DCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J19 A;  1IJW C;  5F0F A;  1EF4 A;  1X58 A;  1JKP C;  2X48 A;  5EZG A;  1AHD P;  4Y52 J;  2DA4 A;  4MFD A;  3TP0 A;  2XGC A;  5EEA A;  1OCP A;  1WI3 A;  2EZL A;  2LD5 A;  9ANT A;  1HOM A;  2XPV A;  3Q3S A;  4M3F A;  2CUF A;  1VFC A;  4QSH A;  1JUS A;  5IP9 J;  1Y1V J;  2NVY J;  2XGD A;  1IDY A;  2LP0 A;  1BW6 A;  3HGG A;  3HOY J;  1X2N A;  2ZB9 A;  4DYQ A;  5IYB J;  2DA5 A;  1B8I B;  1RR7 A;  2R5Y A;  3S1N J;  1DU0 A;  4NDL A;  4MFE A;  2DA2 A;  4A3J J;  4M6V A;  4JX6 A;  4A3B J;  2E2H J;  3JRD A;  2R5Z A;  4BY7 J;  2D5V A;  2YU9 J;  4DW6 A;  2XRL A;  1VF9 A;  1TC3 C;  3JRB A;  1OJL A;  2HQ5 A;  3IH4 A;  1FJL A;  1JJ8 C;  5EGO A;  3F0C A;  2W48 A;  1HDD C;  3GBG A;  1IGN A;  3HDD A;  3BG5 A;  2LTP A;  3MN2 A;  2FQ4 A;  2DTZ A;  3S2D J;  1ETW A;  4MLO A;  1DU6 A;  1GVD A;  2HOT A;  1VI0 A;  3OSF A;  2DMU A;  2AO9 A;  1HF0 A;  4FE4 A;  1K83 J;  5F0C A;  3G1M A;  1T56 A;  2WB1 N;  1WH7 A;  2NVX J;  1IG7 A;  1QVU A;  5M5W J;  1MBJ A;  1NK3 P;  5EG0 A;  5M5Y J;  3HOW J;  4A93 J;  2ECB A;  2L7M P;  5J1U A;  1GDT A;  5C4J J;  1AU7 A;  1JTY A;  5FKN A;  2VI6 A;  3GTQ J;  3G1O A;  3HOZ J;  5GPC A;  1ZTR A;  2JA5 J;  1QRY A;  1WH5 A;  4IEJ A;  1MH3 A;  2ID3 A;  1PUF B;  2KDZ A;  2DA1 A;  3BG9 A;  2P81 A;  2N8G A;  5DTD A;  2JA7 J;  5GPA A;  1Z0X A;  3K2A A;  2TRT A;  1FIA A;  3JRC A;  2DMP A;  2RAE A;  3IH3 A;  4DZP A;  1ITY A;  3BR6 A;  4LOC A;  1JGG A;  2DMN A;  3OOU A;  1H88 C;  1GT0 C;  2CUE A;  3O8H A;  1MBG A;  2LVS A;  3VPR A;  5F1J A;  3RKQ A;  4IHY A;  3I4N J;  5C4X J;  3IV5 A;  2GBY A;  3OSG A;  2CU7 A;  4DYC A;  5C44 J;  3K7A J;  4JX4 A;  3FK6 A;  3BTI A;  1LFB A;  1TWG J;  4UUS B;  2IEK A;  2XB5 A;  2OPT A;  3JRH A;  2O8K A;  3GTM J;  3ZQI A;  1F36 A;  1TWA J;  1ZQ3 P;  2XGE A;  1LE8 B;  1JTX A;  4BKX A;  2VKV A;  2JJ7 A;  2I10 A;  4V2G A;  4XIC A;  3JRG A;  1ORK A;  4C3J J;  3ZQH A;  3D1N I;  1A5J A;  5FLM J;  5J1R A;  1RES A;  2CQQ A;  2R5Y B;  4RDU A;  4B3A A;  4RBO A;  3HBL A;  3GTK J;  1LFU P;  4M3B A;  2M8G X;  4D5F A;  1YRN B;  3M3Y J;  2CJJ A;  3HM5 A;  4XID A;  3GTJ J;  1S7E A;  4C3H J;  4DZJ A;  1MBE A;  2L9R A;  4A3D J;  3Q0V A;  4JP0 A;  4I6Z A;  2K9S A;  4B1R A;  1FTZ A;  3SJM A;  3HB9 A;  2Y31 A;  2MSY A;  3A01 A;  2FJ1 A;  2NS7 A;  5IYD J;  1O4X A;  2VKE A;  2EH3 A;  5EDN A;  1B72 A;  1ETK A;  2H8R A;  1ETV A;  1WPK A;  3GTO J;  1RKW A;  1SFO J;  2NVT J;  3FKI J;  4S0H B;  3ZQC A;  1MH4 A;  3PM1 A;  2EQR A;  1QPI A;  1X2M A;  3TP3 A;  4D5C A;  5K7H A;  2WAQ N;  1I3Q J;  5FKK A;  2HI3 A;  5GP9 A;  1U9O A;  1G2H A;  3HKZ N;  3LNQ A;  1ZGW A;  4CYC B;  2IBD A;  3ZOB A;  5E3M A;  1UG2 A;  2AHQ A;  1FIP A;  3M4O J;  1TWH J;  3HEF A;  3LOC A;  3UKG A;  1RPW A;  5EF6 A;  4BXX J;  5F27 A;  1TWF J;  2DJN A;  1ZK8 A;  3GTG J;  4A3G J;  4I76 A;  2WV1 A;  2H1K A;  4MIM A;  3BQZ A;  2M9H A;  1TWC J;  2X9D A;  3NAR A;  2HDD A;  2JMW A;  3CQZ J;  2KT0 A;  2Y9Z A;  4W97 A;  1XC5 A;  2M34 A;  4A3C J;  5FJ8 J;  2HYJ A;  3GTL J;  2DA3 A;  1AKH A;  2HOS A;  3A03 A;  2CQX A;  5FKM A;  2R93 J;  2CRG A;  3E7L A;  4X6A J;  1F43 A;  2Y30 A;  3RZD J;  2LLK A;  2MGQ A;  3TED A;  4IHW A;  5M3F J;  2JK3 A;  5EYR A;  2OF7 A;  3IH2 A;  1U78 A;  5DS9 A;  3S1Q J;  4A3L J;  1OCT C;  1ETQ A;  4BY1 J;  1ZR2 A;  2M2E A;  4ABZ A;  2Y9Y A;  2E2J J;  1Z77 A;  2EZH A;  2GLO A;  3A02 A;  3SDG A;  2EBI A;  1SAN A;  5FKL A;  2M0C A;  3NAU A;  2EZI A;  4HNV A;  5IP6 A;  1CQT A;  1XG1 A;  4V2F A;  4QTR A;  3S17 J;  3S1M J;  2R7Z J;  1RKT A;  1MBK A;  1P7I A;  4C2M J;  3WHC A;  1JT0 A;  4M3D A;  1MSF C;  4XRS G;  1JKR C;  2YUS A;  2Y0S N;  1ZR4 A;  2NOG A;  2K40 A;  3BT9 A;  2R0Q C;  2ELK A;  1Q1V A;  3BR3 A;  4AC0 A;  3HOX J;  4DYR A;  3QPS A;  5F0H A;  4GFB A;  4D7N A;  2E19 A;  4Y7N J;  2LY9 A;  1BJZ A;  2XPU A;  3PO2 J;  2DMQ A;  5HOD A;  4M3G A;  3JRA A;  1PUF A;  4IHX A;  3JRE A;  2X6O A;  3Q0W A;  4B4C A;  5EZH A;  4JYK A;  2LR8 A;  1FEX A;  1NTC A;  2PMZ N;  5JLX A;  1RET A;  2O7O A;  4AYB N;  5J3L A;  2E2I J;  3W6V A;  2FX0 A;  4C3I J;  2DA6 A;  2LFB A;  1JKQ C;  3BR0 A;  3H3V K;  3BTL A;  4MO7 A;  3S14 J;  2B63 J;  2DA7 A;  3ZQF A;  3C2B A;  3MKL A;  2R5Z B;  1ETO A;  3FK7 A;  1I50 J;  1W0T A;  1A6I A;  3Q0U A;  5IOY A;  2QF7 A;  1P7J A;  3MVP A;  2NVQ J;  3HOU J;  4UUS A;  1ETY A;  4XRS A;  5EGO B;  1JUP A;  5E3N A;  5E3L A;  1D5Y A;  4JX5 A;  4IHV A;  2GM4 A;  4W1U A;  1I6H J;  2E1O A;  4A3M J;  3WHB A;  1IDZ A;  2QCO A;  4X1E A;  1LE8 A;  1WGX A;  1MNM C;  2XB0 X;  1BW5 A;  1MBF A;  2LK2 A;  1H8A C;  3LSJ A;  3PO3 J;  5BNG A;  1WCM J;  4A3E J;  3O8G A;  2K9Q A;  4BBS J;  2MW8 A;  1R9T J;  3I4M J;  4BBR J;  2L7Z A;  2ID6 A;  1JJ6 C;  1YRN A;  5F04 A;  3LSP A;  2Y2Z A;  3S1R J;  5FLV A;  5EG0 B;  1K61 A;  1BL0 A;  1XS9 A;  2K9N A;  1AKH B;  3LSR A;  2L7F P;  3G1L A;  1OFC X;  2XPW A;  3BR1 A;  5JLW A;  1U8B A;  1B8I A;  5FKO A;  1IUF A;  4FIS A;  1UMQ A;  1UHS A;  2O9L A;  2NS8 A;  4EEF G;  4AUX A;  2DMT A;  1IRZ A;  1ENH A;  5IP7 J;  4XRM A;  2R92 J;  3BTJ A;  5M5X J;  2JWT A;  1E3O C;  2HOA A;  2HXO A;  3JR9 A;  4L5E A;  3CCY A;  1POG A;  3S15 J;  5F08 A;  1T33 A;  2G0E A;  5IPA A;  2VPR A;  2LKX A;  3OIO A;  4CYC A;  3QQA A;  3HOV J;  5C3E J;  2HXI A;  2ME6 A;  1HLV A;  1NK2 P;  4FE7 A;  1JUM A;  4UUT A;  4FCY A;  1IC8 A;  1VND A;  1FTT A;  3DEW A;  4XK4 A;  3BQY A;  3H0G J;  3QPL A;  5J1Y A;  3FIS A;  3BR2 A;  1JT6 A;  1GUU A;  5M3M J;  2ECC A;  2JA8 J;  2L0K A;  4A3F J;  5IYC J;  3RZO J;  4QIW N;  2COB A;  2MG4 A;  3S16 J;  1JKO C;  1ETX A;  1W0U A;  1U9N A;  4D7M A;  4A69 C;  3L1P A;  4FTH A;  1QVT A;  3BR5 A;  2TCT A;  1MBH A;  2DN0 A;  2JA6 J;  5IOZ A;  3CDL A;  2JN6 A;  1GV5 A;  1HCR A;  1ZKG A;  3ZQL A;  5K7F A;  3B6A A;  3B6C A;  2IAI A;  1H89 C;  2VUM J;  3ZQG A;  5K7Z A;  4G12 A;  1BA5 A;  4A3I J;  1GV2 A;  2EZK A;  3BTC A;  3FIW A;  3SFI A;  3S2H J;  1Y1W J;  3BG3 A;  1MSE C;  4M3E A;  3TW6 A;  3TW7 A;  3LSG A;  1HDP A;  3JRF A;  3GTP J;  3HGY A;  3CMY A;  2XSD C;  2FD5 A;  3JRI A;  3A01 B;  1IV6 A;  5E3O A;  1APL C;  2ME0 A;  2YS9 A;  4A3K J;  1B72 B;  3RQI A;  3DCF A; 
#chains in the Genus database with same CATH topology
 4Q48 A;  1SFX A;  3KP3 A;  2EV6 A;  2EIM H;  2PJR A;  1E2X A;  2QVO A;  1X58 A;  1WJC A;  2X48 A;  3E5Q A;  1JKP C;  2P8T A;  1R1T A;  2R7X A;  4MFD A;  2ZFU A;  5DD4 A;  4S04 A;  1T0F C;  5HVQ C;  2JQ7 A;  5E8G A;  1EA3 A;  2F48 A;  2QKL B;  4QPO A;  2LD5 A;  4XMY A;  1UEL B;  4BAC A;  1UG0 A;  4DIQ A;  1FYK A;  3IWF A;  3Q3S A;  3PFI A;  2MH9 A;  5ED4 A;  4L18 B;  4Y3O A;  5B1A H;  4IOC F;  5FLX Z;  3SZT A;  1BW6 A;  4Y4R A;  1S72 I;  1V54 H;  1A6Q A;  5B5E C;  2PX9 A;  2R7V A;  1X2N A;  3JSP A;  2DA5 A;  4BQN A;  4MEX F;  3TOA A;  4CH7 A;  2CFX A;  1RR7 A;  1OR7 A;  2CW7 A;  3IRQ A;  1CGP A;  2R7O A;  2NS0 A;  2HPM A;  1FWZ A;  3H35 A;  3S1N J;  4NDL A;  4MFE A;  4CYD A;  3FXL A;  2VXZ A;  5BQT A;  1YS6 A;  2WAE A;  4JX6 A;  1HBX G;  1SVM A;  3F8F A;  2OV7 A;  4IHT A;  4BL0 B;  2R5Z A;  2A07 F;  1Z91 A;  3CTA A;  2YU9 J;  4DW6 A;  2ZKZ A;  4JBA A;  2EWN A;  5EEG A;  2DT5 A;  1X1P A;  2MD0 A;  2MFZ A;  3PNY A;  3JRB A;  3ERE D;  1FJL A;  1JJ8 C;  2F5F A;  4F91 B;  1X3U A;  4PJN A;  5J47 A;  2X1E A;  4L9J A;  1IGN A;  3HDD A;  2VBY A;  4LIV A;  2LTP A;  3WOD F;  2JRM A;  4P1W A;  3T0Y A;  2HYF A;  3SDB A;  3HOT A;  3FDY A;  1WI9 A;  3S2D J;  3L2C A;  4EV0 A;  1UZC A;  3DU6 A;  4RM3 A;  1F9N A;  1HF0 A;  1N25 A;  2IPQ X;  3FXK A;  1T56 A;  3MAJ A;  4KIG A;  4PFO A;  2M45 A;  4BDZ A;  5E1X A;  1IV8 A;  1SD5 A;  2XKP A;  4CCO A;  2NVX J;  1D0X A;  3DEU A;  3V8J A;  1HW2 A;  3N97 A;  4PZJ A;  1QVU A;  2YX7 A;  1O3T A;  5JVT A;  5M5Y J;  3F3X A;  2FRH A;  2QGU A;  4OAY A;  3U1D A;  4LG0 B;  4RM2 A;  4I2O A;  3G1O A;  2QSF X;  2V6E A;  1ZTR A;  4MEY F;  2BXZ A;  3F8N A;  3OS1 A;  2JA5 J;  2K02 A;  4IXA A;  2KQR A;  4M71 A;  4PJL A;  4I0B A;  5JVG F;  2XAU A;  1WFX A;  5L3F A;  1FOY A;  1OCZ H;  3OOP A;  4UVB A;  1HXD A;  1V4R A;  2BY3 A;  2N8G A;  1X4O A;  1LEA A;  2OAZ A;  2RAE A;  2E36 A;  4EJV A;  3SEZ A;  4B47 A;  3OOU A;  1RIO H;  2WAQ A;  2CUE A;  3PQJ A;  1W5S A;  4B44 A;  1DPR A;  4ENM A;  1Z6R A;  3E5X A;  1O3S A;  5F1J A;  3I3L A;  3IV5 A;  2GBY A;  1FMV A;  5JI6 A;  3OSG A;  2OA4 A;  5J4V A;  5A2Q K;  2WY7 Q;  4XNF A;  4DYC A;  1QZE A;  5C44 J;  3K7A J;  1TNT A;  2A05 A;  4O3M A;  4CZC A;  3FK6 A;  4F7Z A;  3CCL I;  3FZV A;  5GTH C;  3IWZ A;  3HHG A;  2CUJ A;  1XSX A;  3GTM J;  4HST A;  4RAF A;  2MYS A;  3K1P A;  1LE8 B;  3FM5 A;  3CLO A;  4RLQ A;  5D5W B;  1EKE A;  1ORK A;  4B43 A;  1QZY A;  3D1N I;  5KNL A;  2IGK A;  3FF5 A;  1U8R A;  4BE0 A;  3FX3 A;  4A5M A;  2ISZ A;  4A0X A;  2W00 A;  2QQ9 A;  1G59 A;  4RDU A;  1RUO A;  1G4D A;  1MMN A;  1LQ1 A;  4M3B A;  2M8G X;  5CQE A;  4KNY A;  4AWX B;  3HM5 A;  4XID A;  3GTJ J;  1IUY A;  1DGR M;  1TT0 A;  1MBE A;  2L9R A;  1SAX A;  3QPH A;  2E1N A;  1JGS A;  2K9S A;  4B1R A;  1MJ9 A;  5TIS C;  4G6Q A;  3CC2 I;  3HB9 A;  2Y31 A;  3JSO A;  3M1C A;  3VOE A;  2FJ1 A;  1O4X A;  2VKE A;  5HLG A;  1ETK A;  4I02 A;  2H8R A;  3Q9V A;  1YYV A;  3BJ6 A;  4BHP A;  2BOL A;  1ACI A;  1MH4 A;  3PM1 A;  1FYM A;  4D5C A;  1V55 H;  1LUJ B;  1LVA A;  2GIV A;  2QWW A;  1G2H A;  1J9I A;  2XC7 A;  4OAZ A;  2L4A A;  4U0V A;  1YJ9 I;  2HVR A;  1ONV A;  3DBH B;  1M1E B;  4UB6 C;  3HEF A;  3MWM A;  3I5U A;  3TQN A;  5L3G A;  1RPW A;  1P4A A;  3KYC B;  4NBQ A;  1UB9 A;  4L9T A;  4MTE A;  4BXX J;  3FXM A;  3WGI A;  4RGX A;  1QGP A;  3GTG J;  5F64 A;  2EPF A;  1GXP A;  2M9H A;  4AYB A;  4A5N A;  2F5C A;  1TWC J;  3NAR A;  4RGR A;  1B9M A;  4GO1 A;  3BZK A;  3OIP A;  1P4X A;  2NVU B;  2M4G A;  2DA3 A;  3HRU A;  3A03 A;  1Z7L A;  4V19 K;  3QU3 A;  3W2W A;  4X6A J;  2HQA A;  3M9A A;  1HC8 A;  3TED A;  1R4N B;  2JK3 A;  5EYR A;  5DDG A;  4IVN A;  1FSH A;  3CF5 F;  1YQA A;  2NOJ B;  3KYD B;  4XKV A;  5IT9 K;  1ZR2 A;  3OMY A;  4ABZ A;  1OCO H;  1XMX A;  4HW0 A;  2I8D A;  1XB4 A;  2UV1 A;  3KE2 A;  4GGG A;  3A02 A;  2ELJ A;  2W24 A;  2EBI A;  2IGN A;  1KON A;  3F8B A;  3K70 D;  1SAN A;  5FKL A;  3RSN A;  2VAS A;  1FY7 A;  1CQT A;  2CH0 A;  2V1N A;  4V2F A;  5CVR A;  5ILS A;  3S17 J;  2LOO A;  1ERD A;  2RDP A;  4ENJ A;  1GLN A;  4C2M J;  2LNB A;  1QNT A;  3KCC A;  1S8N A;  4M3D A;  3U2R A;  1F4K A;  4LB6 B;  3ZMZ A;  5HNH A;  2ELK A;  4HG2 A;  2CV2 A;  2A5Y B;  3HOX J;  1WZ2 A;  2F5V A;  2KIQ A;  5F0H A;  1YE9 A;  1UAA A;  1PP7 U;  2E7X A;  4NC8 A;  3DKY A;  3JRA A;  1PUF A;  3GVA A;  4IHX A;  3JRE A;  3SQN A;  4JYK A;  1V3F A;  1YW8 A;  1XGS A;  1NTC A;  1PVE A;  1R22 A;  1VZ0 A;  2PMZ N;  1L3L A;  2A3S A;  4F93 B;  1RNL A;  2OTJ I;  3IKT A;  3CCE I;  3K4M A;  4UY8 I;  5KAI C;  4XL9 A;  3BR0 A;  1MDM A;  3BTL A;  1K4T A;  1I3A A;  1YIJ I;  1ZN2 A;  4LD5 A;  1T39 A;  4BYY A;  2B63 J;  2H6B A;  3ZQF A;  4AVZ A;  2R5Z B;  4J01 A;  3FK7 A;  1R5G A;  2JT1 A;  5E20 A;  1W0T A;  4FX0 A;  1A6I A;  3Q0U A;  4EGY A;  4PFP A;  2HFH A;  4XRS A;  2GA2 A;  4L0Z B;  4GYG A;  1D1B A;  3ESW B;  5CQG A;  1JUP A;  4HEA 2;  1R49 A;  5LRS A;  1I1S A;  2ZNY A;  3ZQQ A;  3ZGK A;  4U88 A;  3RDI A;  2QCO A;  3DLA A;  3I58 A;  4BQO A;  1MNM C;  1FPQ A;  2XB0 X;  3MMY B;  3MZ8 A;  1BW5 A;  3PIP F;  2AXL A;  3ZQ7 A;  2P5L C;  2E1M C;  4IRI A;  3WU2 C;  2V4J C;  2VKD A;  1V5G A;  5E79 C;  3OWT A;  1T38 A;  1W36 D;  1WJB A;  3GCM A;  4C9Y A;  1VQ5 I;  1OR7 C;  4Z6Y A;  1OYI A;  2KJC A;  2IS2 A;  1IZ1 A;  3TL4 X;  3NQO A;  4GYI A;  2KHM A;  3S1R J;  2CYY A;  1K61 A;  2DDA A;  3ZCO A;  1AKH B;  4CXF A;  2XAG A;  5HDG A;  2L7F P;  3C3W A;  3G1L A;  3E6B A;  1YFH A;  1WHU A;  2BW3 B;  3G6E I;  1UMQ A;  2JTV A;  2ZC2 A;  4R79 A;  4AIK A;  2Z99 A;  2DMT A;  1AOY A;  4KFC A;  1ENH A;  3T1B A;  3R61 A;  4XRM A;  4B3X A;  4HBL A;  2V1X A;  3BTJ A;  4WXC A;  2G7U A;  5M5X J;  3GZ6 A;  5BMZ A;  1D1A A;  4EQQ A;  2JWT A;  3H5A A;  3CCQ I;  4YG2 F;  4L5E A;  4YII A;  4BDY A;  1FT9 A;  3ONQ A;  5F08 A;  2O03 A;  4LGW A;  1T6S A;  2L02 A;  2VN2 A;  5JHU A;  1BC7 C;  1EH7 A;  3OIO A;  1HW5 A;  4HX7 A;  4CYC A;  2IVM A;  5C3E J;  1NK2 P;  1B59 A;  4FE7 A;  3DBR B;  1WJA A;  1JUM A;  2J5P A;  5ICE A;  1O7L A;  2BHZ A;  2BHY A;  1ZYR F;  5FD5 A;  1FTT A;  5LLQ A;  2V9V A;  1YHQ I;  5J1Y A;  1SD7 A;  3BR2 A;  3KYL A;  1E3P A;  4DJA A;  5FB2 A;  2JA8 J;  4DOZ A;  4BAY A;  1LPQ A;  1TLH B;  1TQM A;  3CLQ A;  5KHD A;  4QIW N;  1R4M B;  3S16 J;  3KET A;  3IRR A;  3LAJ A;  4HRI A;  2VBW A;  2VQL A;  1QVT A;  3V8K A;  2O61 A;  2TCT A;  2KIU A;  1MBH A;  2DN0 A;  3G4S I;  3CDL A;  3CC7 I;  1HCR A;  2VT2 A;  3N4M A;  2L4M A;  3K4K A;  3HTU A;  5LHH A;  2VQH A;  4IRH A;  3FHZ A;  1ZRD A;  4PCQ A;  3S3M A;  3FIW A;  3S2H J;  4F92 B;  2E5Z A;  4M3E A;  5J40 A;  3OYB A;  5LFA A;  2L9S A;  2FSW A;  2QQB A;  1G6N A;  3K69 A;  3DTE A;  4KJZ A;  2AQF A;  2XSD C;  3JRI A;  1IV6 A;  4A3K J;  1VQ9 I;  1IW7 F;  2K4B A;  3RQI A;  4LJZ F;  2FQ3 A;  5CKT A;  4J19 A;  3KX2 A;  1T98 A;  1IJW C;  1XSD A;  3D5R C;  1EF4 A;  1MIJ A;  1MD0 A;  1ON1 A;  2DA4 A;  3QWL A;  5EEA A;  4XKC A;  2JSC A;  2EZL A;  4OMY A;  2LDU A;  3G71 I;  1W1W E;  1GHC A;  2PI0 A;  1G3S A;  2MH2 A;  4L5J A;  5F1R A;  4DQ2 A;  2XPV A;  4M3F A;  2CUF A;  2VXD A;  2XV4 S;  3R0J A;  4HLY A;  1LJ9 A;  2EIL H;  2LMD A;  3BJO A;  5DUK A;  3AAF A;  3JAM K;  3WTV C;  4OWR B;  1QHH D;  2JPC A;  2LP0 A;  3ERM A;  2HKX A;  1IN6 A;  4KYW A;  3V7S A;  4BNC A;  2YU3 A;  2X51 A;  2NXN B;  3HGG A;  3CDI A;  2GXB A;  2LY2 A;  1K4S A;  4OIQ F;  1Z1D A;  2BY2 A;  1HSJ A;  3IAM 2;  3KEO A;  1B8I B;  3SYT A;  2IP2 A;  2DFI A;  1DU0 A;  2JVH A;  3D5S C;  3PNT A;  2LC2 A;  2DA2 A;  5FRO A;  5FRM A;  4YFX F;  4M6V A;  2LBF B;  2CW0 F;  2V6C A;  3HSE A;  3JRD A;  2WY8 Q;  4MHG A;  4ZYH A;  2HR3 A;  2RN7 A;  3U1K A;  3W6K B;  1OYY A;  2ZXI A;  1OYW A;  1VF9 A;  4ZYG A;  3A2K A;  1S9H A;  2XVC A;  5ICF A;  2DT7 B;  5D5V B;  2FF4 A;  5J8F A;  3F0C A;  1IO2 A;  2W48 A;  2E34 A;  2CO5 A;  2W82 A;  3BG5 A;  4NHJ A;  3CCU I;  2K9M A;  2XAJ A;  1WQ2 A;  4PJM A;  4MLO A;  3BY6 A;  2XKO A;  2X85 A;  4HV5 A;  5L3D A;  2BXY A;  3A0H C;  2X6Y A;  3QPT A;  2AO9 A;  1SVO A;  4FE4 A;  5LGN A;  6PAX A;  3VSK A;  4G7Z F;  1K78 A;  4GRI A;  1TP4 A;  3H0D A;  2A6E F;  2WB1 N;  2Z2S B;  3ZMD A;  3VYU B;  3BRO A;  2PJP A;  5K5O A;  1KYW A;  4MGR A;  2PMU A;  3H9G A;  3HOW J;  3JCU C;  2H27 A;  2ZJP F;  4WWC A;  1AU7 A;  3WTX C;  3DXJ F;  1JTY A;  2AS5 F;  2VI6 A;  4GCV A;  3GTQ J;  3HOZ J;  1U2W A;  4BQQ A;  5GPC A;  3OY9 A;  5TGT A;  3WGH A;  2P6T A;  4ZTJ A;  1N78 A;  1MH3 A;  4UVA A;  2ID3 A;  1PUF B;  2KDZ A;  2P81 A;  1IRF A;  2JA7 J;  5GPA A;  1Z0X A;  1S29 A;  2EIJ H;  1VQK I;  5E17 F;  3JRC A;  1FIA A;  1HKT A;  3IH3 A;  4DZP A;  4LK1 F;  1ITY A;  3BR6 A;  2DMN A;  2AQE A;  2R4G A;  4BQA A;  2XSJ C;  4ZYD A;  4QWQ A;  1EH6 A;  2AXT C;  3HHH A;  1MDM B;  2W57 A;  2DJI A;  3FKJ A;  3RKQ A;  3I4N J;  4K2E A;  2KIS A;  4BJ6 C;  1YIO A;  2L2O A;  2LSO A;  4PGG A;  4HQE A;  4J00 A;  3KZY A;  2M5W A;  3UNG C;  1FBQ A;  3CJQ B;  1DPU A;  4JK1 X;  4HA8 A;  3K4C A;  4I0A A;  3G73 A;  5D8K B;  1X1C A;  2DT6 A;  1TNS A;  2K5C A;  1D1C A;  3G3Z A;  1R1V A;  1F36 A;  3SFZ A;  4HQM A;  1KGS A;  5H6R A;  4BH9 A;  4BKX A;  3RCO A;  2EFW A;  2JJ7 A;  5D6E A;  2K9L A;  3OV8 A;  2BV6 A;  2UUZ A;  2NNN A;  5HLH A;  3RI4 A;  2XAQ A;  1Z05 A;  1K6O A;  4YFK F;  4QLC U;  3I53 A;  2BGC A;  2FNA A;  3OYD A;  2M4K A;  1T08 B;  2R7S A;  3CCS I;  2R3S A;  4XKW A;  5H6Q A;  2R5Y B;  1ZHF A;  2A68 F;  1Z6T A;  3HBL A;  4UXN A;  4B3A A;  4EMS A;  1LFU P;  3GTK J;  2F6C A;  3IP4 B;  2P5K A;  1SC7 A;  3LL7 A;  3KEQ A;  1A04 A;  3GFL A;  3H3U A;  2VKH A;  4DZJ A;  1S3J A;  5J6X A;  3Q0V A;  4JP0 A;  2F4M B;  4QPQ A;  3RPU A;  3AG1 H;  4I6Z A;  3VWB A;  1D5V A;  2RQP A;  1FTZ A;  3SJM A;  3BLY A;  5DUI A;  2MSY A;  2K86 A;  3M07 A;  2L5Q A;  2ZCW A;  4NC7 A;  5EDN A;  1B72 A;  3QYB A;  3V42 A;  3M1E A;  3GTO J;  1SFO J;  3FKI J;  3ZQC A;  3M7G A;  1QPI A;  2NRA C;  3DWL E;  4EM2 A;  2YX4 A;  3LWF A;  3V4G A;  5K7H A;  3WG7 H;  2XF5 A;  1I3Q J;  2KP6 A;  4XLP F;  5FKK A;  4Q4Z F;  5GP9 A;  2LKS A;  3TMO A;  5AON A;  1WJE A;  1VTN C;  3LNQ A;  4CYC B;  2IBD A;  5E3M A;  1UG2 A;  2Z3Y A;  5B66 C;  3O6B B;  4XN0 A;  2DFF A;  4UV8 A;  3F23 A;  1KU2 A;  3HUG A;  4N9H A;  3E6M A;  4HV6 A;  4ENK A;  1TWH J;  4BGD A;  1MW7 A;  3LOC A;  3UKG A;  4E7I A;  3OR2 C;  5EF6 A;  3MKZ A;  5F27 A;  1KQ9 A;  2DJN A;  2PMZ A;  3KPH A;  2M7A A;  4NC6 A;  3WG9 A;  4MIM A;  2L54 A;  1JXS A;  4CUG A;  4A0Z A;  2VOO A;  2VT3 A;  2Y69 H;  4F3Q A;  2HDD A;  3CQZ J;  2Y9Z A;  1A35 A;  2KPM A;  4W97 A;  5IY5 H;  2DI3 A;  2M34 A;  3GLX A;  3COA C;  1AKH A;  2CQX A;  5FKM A;  2R93 J;  2FA5 A;  3MZY A;  1T8I A;  2XUB A;  1VQN I;  1F43 A;  2FNP A;  2QEN A;  2MGQ A;  4IHW A;  3RQ4 A;  1U78 A;  3IH2 A;  2BW3 A;  5DS9 A;  1QA6 A;  3S1Q J;  4A3L J;  1ETQ A;  1X1A A;  2Y9Y A;  2E2J J;  2EZH A;  2X1D A;  5HDK A;  4WCG A;  3K1N A;  2M0C A;  4IOA F;  3ISP A;  5E1W A;  3BZ6 A;  2IS4 A;  5HOO A;  1RI7 A;  4KT6 A;  4DBR A;  3G2B A;  4HLX A;  2KZV A;  2VQC A;  1BI2 A;  1S7O A;  5LBQ A;  2PG4 A;  3IUO A;  3QP6 A;  4XRS G;  1JKR C;  5AIQ A;  2Y0S N;  1ZR4 A;  2FE3 A;  1A36 A;  2VPL A;  2IJL A;  1Z3Y A;  3OYA A;  2VL8 A;  3BT9 A;  4ENN A;  2R0Q C;  3GUD A;  2PMH A;  5HS8 A;  1SD6 A;  1MJB A;  1RC9 A;  3BR3 A;  4AC0 A;  2P7C B;  1STZ A;  2BY1 A;  4XLH A;  5CVJ A;  2QSH X;  4U7D A;  2LY9 A;  3FBN B;  3I59 A;  2DMQ A;  2JUC A;  3DU5 A;  2CW8 A;  4XSX F;  1AA7 A;  2GOX B;  2BBY A;  2ZXW H;  3DPU A;  1ON2 A;  3K70 C;  2OQR A;  3KP7 A;  2MC4 A;  4ON0 A;  3IL2 A;  1FEX A;  4E7L A;  4I98 B;  3PQK A;  1RET A;  2O7O A;  2G7H A;  3IKV A;  4OIR F;  3W6V A;  1EH8 A;  5JR3 A;  5KK1 A;  1JKQ C;  1J0R A;  1KU3 A;  1U3E M;  2XAH A;  2DA7 A;  2EK5 A;  4WX9 A;  4P96 A;  4C2U A;  1D0Y A;  3V7C A;  1K6Y A;  2P4W A;  3CMM A;  2MD5 A;  2QF7 A;  1P7J A;  2KL4 A;  3MVP A;  2NVQ J;  4UUS A;  3NWS A;  1TTY A;  2XRO A;  1VQ4 I;  4ZDO A;  3TGN A;  5K5Q A;  5H20 A;  5E3N A;  1BR4 A;  2ZJR F;  4W1U A;  4O6J A;  4A3M J;  1WVR A;  1KU7 A;  1IDZ A;  2KRF A;  2BVL A;  1P92 A;  3FBI B;  3GFJ A;  3P5J A;  4CCM A;  1OKR A;  3GEZ A;  5DCF A;  2DLL A;  1K78 B;  3K4N A;  3CCJ I;  3LA7 A;  3O8G A;  2MW8 A;  3I4M J;  2DCE A;  2L7Z A;  4L9V A;  2ID6 A;  1KQ0 A;  2VQG A;  2VC1 A;  2DYR H;  2Y2Z A;  2YSR A;  1BJA A;  5LGU A;  3GXO A;  3D0S A;  2K9N A;  4BJ5 C;  4ESB A;  3I56 I;  3LSR A;  2QSG X;  3MEX A;  3KLO A;  5EJC A;  2ZBK A;  3BR1 A;  3J81 Z;  2DOA A;  1Z3X A;  3AG4 H;  1B8I A;  2FML A;  1X19 A;  1IUF A;  2QUF A;  1KU9 A;  2ZJQ F;  1UHS A;  2FBI A;  4XOP A;  2O9L A;  1DDN A;  2NS8 A;  4EEF G;  5DM7 F;  3LST A;  3F9K A;  4P9F A;  2M8E A;  2ZNZ A;  2R92 J;  2QZ8 A;  4ZC3 A;  2LBF A;  4KIS A;  1FOW A;  3REO A;  3JR9 A;  2HVS A;  1W36 C;  5H2F C;  3DTK A;  5FLX K;  4ZH4 F;  1Z21 A;  5IPA A;  3CCV I;  1QU3 A;  2Y48 A;  1X1D A;  3TO6 A;  3QQA A;  1I6X A;  2FU4 A;  4PK4 A;  3EPZ A;  2HXI A;  1HLV A;  1FX7 A;  4CCL A;  1I39 A;  3F6V A;  4UUT A;  2RVC A;  3VB2 A;  3WTY C;  2VOD A;  5GAH J;  3CZ6 A;  1KA8 A;  3DEW A;  3CD6 I;  4XK4 A;  4H4K C;  4HX4 A;  2ZO4 A;  3FIS A;  3OYJ A;  3BCA A;  4E6K G;  3J80 Z;  3CCM I;  2XAF A;  4A3F J;  3SZG A;  3MCZ A;  3BWG A;  3GO5 A;  2CG4 A;  1H9G A;  2OQG A;  1O57 A;  3EUA A;  1JKO C;  2W84 A;  4G8X A;  2OU2 A;  3E97 A;  1U9N A;  4KN4 X;  3WE2 A;  4A69 C;  3E3V A;  3S2W A;  3P9I A;  2LYC A;  3BR5 A;  1Y6I A;  4BJT A;  4P9U A;  3WTS C;  4XLC A;  1FP1 D;  1YTY A;  2ZFW A;  4FET A;  5DYM A;  2L01 A;  1ZKG A;  1J75 A;  1SFK A;  3B6C A;  2EA4 A;  4G12 A;  5D4S A;  4AU7 A;  4Q47 A;  3WU0 A;  1K79 A;  3BTC A;  3SFI A;  3W2V A;  4CGZ A;  2XGX A;  1Y1W J;  4ESJ A;  3PJR A;  2IGM A;  1MSE C;  1TQI A;  1WJF A;  4HNT A;  1HDP A;  2F4I A;  2XF7 A;  3J7A O;  2HZD A;  3CMY A;  2NNY A;  3LA2 A;  3OL4 A;  3W6J B;  1UJ8 A;  3EET A;  2LF8 A;  4G6T B;  4G6D A;  3L2U A;  5TRD A;  2Q0O A;  2YS9 A;  1B72 B;  2Z33 A;  2JA6 J;  4ASN A;  1ZGJ A;  2WB1 A;  4L0Y B;  5BPI A;  1FOK A;  3CDH A;  4HNU A;  1T0F A;  4HAM A;  3TP0 A;  2XGC A;  4MQV A;  3KP4 A;  2DTR A;  3H5R A;  1WI3 A;  4YRV A;  2E60 A;  1HOM A;  2MA3 A;  5LEK A;  4HF2 A;  4NB5 A;  1L0O C;  1JUS A;  3E6C C;  1Y1V J;  3HUG B;  4A6D A;  5E1Z B;  2NVY J;  1IDY A;  2DK8 A;  3AG2 H;  2DO7 A;  5D4R A;  3L2Q A;  4XM3 A;  3BDD A;  3AKZ A;  2V79 A;  4KMF A;  1T2K A;  2ZB9 A;  4DYQ A;  2XAS A;  2W85 A;  5GAG J;  2IS1 A;  1Y0U A;  1XSV A;  3NRV A;  2YR2 A;  1ZG1 A;  2RNJ A;  2R5Y A;  2V7F A;  1UCR A;  4N0B A;  2DOE A;  3BP8 A;  1XCB A;  2KIF A;  2WV0 A;  5D6F A;  4ZZL A;  5ILV A;  1ZAR A;  3CO7 C;  4GDF A;  2CGP A;  3VSL A;  2V26 A;  4B8X A;  4A3B J;  1OMI A;  2E71 A;  1OIS A;  2FBH A;  2XRL A;  2R7U A;  2J5O A;  3FM3 A;  3ZXS A;  1TC3 C;  1KQ8 A;  4MTD A;  4IRG A;  3B02 A;  2OUM A;  3GW2 A;  2PN6 A;  5EGO A;  4NQW A;  2RGV A;  5DV5 A;  1E0E A;  3E6D A;  4PSX A;  3MZH A;  3GBG A;  2X4H A;  1ZLK A;  3LSM A;  4G7H F;  2CSO A;  3MD2 A;  2FQ4 A;  2DTZ A;  5CVV A;  2MC3 A;  5E18 F;  3U21 A;  2ZSI B;  4XLA A;  1DU6 A;  4M9S A;  4OIN F;  2HOT A;  1FNN A;  4XSZ F;  2DMU A;  4HYE A;  4UV9 A;  2HDC A;  5F0C A;  2VOP A;  3G1M A;  2EB7 A;  1FBU A;  3DP7 A;  1WH7 A;  3EDP A;  4U0W A;  1UFM A;  1IRG A;  2DFE A;  1J5Y A;  3H92 A;  5KCM A;  1XDS A;  3VEP A;  1YJN I;  4HDU A;  3K9T A;  3HL2 A;  1NK3 P;  5EG0 A;  4A93 J;  2FXA A;  2ECB A;  4M9X A;  4II2 A;  3I64 A;  2L7M P;  4IZZ A;  1JE8 A;  1X4P A;  2L3D A;  3OS0 A;  2OCC H;  4A6E A;  3L2V A;  5C4J J;  1ZG5 A;  1GDT A;  4XON A;  4KN7 X;  4D9J A;  5CLS A;  3S3O A;  1QRY A;  1R58 A;  3I59 B;  4IEJ A;  4XOR A;  4P5O A;  2ZJ2 A;  1OCC H;  4RAG A;  3HTS B;  5DTD A;  5L3B A;  5DEQ A;  3K2A A;  2V1D A;  5ICG A;  4ZDL A;  3F21 A;  2DMP A;  3HZJ A;  3OIQ A;  2ELH A;  4LOC A;  1S6L A;  1HQC A;  3R0A A;  4EAT A;  2K3P A;  4MNU A;  3MKW B;  3O8H A;  1MBG A;  2GXA A;  3WGG A;  5JHF A;  4L5I A;  2LVS A;  4AIJ A;  4E7H A;  3TO7 A;  4IHY A;  2WBM A;  2OZU A;  3TBI A;  5C4X J;  4LG3 A;  1R23 A;  3TO9 A;  3ASN H;  3HYI A;  2RQQ A;  3BCB A;  3K0L A;  3SEQ A;  2F5E A;  4CCN A;  4KUM A;  3J7A Y;  2IS6 A;  2BZT A;  3BTI A;  5CJ9 A;  1VQP I;  1CF7 A;  1LFB A;  3CP8 A;  1JHH A;  3EUH A;  4UUS B;  2P6S A;  2XB5 A;  1TQP A;  2VE9 A;  2O8K A;  3RYR A;  3S8P A;  1SMT A;  2M87 A;  3E0J B;  3HC7 A;  3QU6 A;  4LMY A;  2IXS A;  4XN3 A;  1HST A;  4Q5S F;  2RNG A;  1ZRE A;  2XGE A;  2EIN H;  3FMQ A;  2VKV A;  4PJ0 C;  4XIC A;  3K4J A;  3JRG A;  2EV5 A;  1E3H A;  1QPM A;  3ZQH A;  2GOM A;  4RB1 A;  1A5J A;  2V1U A;  3CMA I;  1BIA A;  3CC4 I;  4XQF A;  5J1R A;  5FFZ A;  1RES A;  4LFU A;  1PYV A;  4EJT A;  2E7W A;  2VC0 A;  1R7J A;  2CQQ A;  2C6Y A;  4RBO A;  3PUF A;  5KVR A;  2RC4 A;  3PL8 A;  4Y17 A;  3RJP A;  4EM1 A;  2Z9O A;  4II3 A;  1J2X A;  2CJJ A;  3RYP A;  1R36 A;  3GZ5 A;  3RKX A;  4C3H J;  3CCR I;  2R7R A;  5GAE J;  2HDW A;  4H0E A;  3S3N A;  4BS9 A;  1LDJ A;  3V7R A;  5ICC A;  4A2U A;  2EFN A;  3M8F A;  3QOP A;  1W5T A;  3FHN A;  2H8W A;  3FXU A;  3DKW A;  1ETV A;  1YLF A;  3BOQ A;  3KP6 A;  1RKW A;  2NVT J;  4FX4 A;  3LFU A;  2HPI A;  2VON A;  2VJ5 A;  2E5N A;  2HS5 A;  1MJA A;  1X2M A;  4G94 A;  4GXO A;  3C18 A;  1AWC A;  2A61 A;  2ESH A;  3T5X A;  3HSR A;  1YJW I;  2HI3 A;  2Y0S A;  3BPX A;  4EM0 B;  1U9O A;  2UXN A;  2DXI A;  3HKZ N;  3JW4 A;  2A69 F;  1B1B A;  1OLT A;  1ZGW A;  2ICW G;  5FO5 A;  3FXQ A;  4E4H A;  1FIP A;  3ULQ B;  2D45 A;  3M4O J;  2IA1 A;  2L9N A;  3LQQ A;  1P2F A;  2ADU A;  1XMK A;  3JTH A;  3HSF A;  1B4A A;  3ZMS A;  5A2Q Z;  4G9Y A;  4RS8 A;  1HW1 A;  1XCV A;  4LK0 F;  2UZK A;  2WC2 A;  4A3G J;  4I76 A;  2WV1 A;  1Z67 A;  1IXS B;  2B7E A;  1MZB A;  5FFX A;  1VQ7 I;  3HIF A;  2HTS A;  2DYS H;  3I4P A;  3IHU A;  5HLI A;  2KT0 A;  1XC5 A;  1HKQ A;  3FXO A;  3O2P E;  3TDU C;  2VBX A;  4A3C J;  5FJ8 J;  3EQL F;  3DTI A;  3PIO F;  5EEH A;  3GTL J;  3CP2 A;  3KFW X;  2EJR A;  3K4L A;  3ABL H;  1R71 A;  1FLI A;  1ULY A;  1VQL I;  1XPX A;  2Y30 A;  3BZC A;  3T8T A;  2HZT A;  4HDV A;  2HKO A;  1XTA A;  4OMZ A;  4XRF A;  2CQ7 A;  1OCT C;  4B48 A;  2X6W A;  2M2E A;  5HDN A;  2ETH A;  1Z77 A;  4LIT A;  4KA4 A;  4XLF A;  3SDG A;  4BHB A;  5E8I A;  2FOK A;  3NAU A;  4HNV A;  1XG1 A;  1FZP B;  4M72 A;  4QTR A;  2JSP A;  1TW2 A;  2V9K A;  5DM6 F;  5LRR A;  2R7Z J;  1RKT A;  1MBK A;  1P7I A;  1WJ5 A;  4CIC A;  3AL0 B;  5HNF A;  4M74 A;  5K1Y A;  3ZPL A;  3LFK A;  1TBX A;  3WHC A;  1JT0 A;  1USS A;  3AFH A;  3HRM A;  3PFY A;  1XD7 A;  2FUG 2;  1GVJ A;  2JUG A;  3GYH X;  2WWY A;  4DYR A;  2P0W A;  3WTZ A;  4RAZ A;  1G8X A;  4GFB A;  1MMA A;  4D7N A;  4M6Y A;  2K7L A;  4AVP A;  4Y7N J;  3K10 A;  4PSW A;  2VIX A;  5HOD A;  4M3G A;  2O5R A;  3Q0W A;  2XHK A;  5HLT A;  1XGO A;  2LR8 A;  4NUB A;  3RIR A;  5DD8 A;  2UWM A;  3W2A A;  4XOT A;  2A6H F;  1DUX C;  5J3L A;  3F72 A;  2E2I J;  2O6G E;  1LEB A;  3WTW C;  2FX0 A;  3U9G A;  4C3I J;  2PLY A;  4MO7 A;  2H94 A;  3S14 J;  4RGU A;  4DBQ A;  3R6S A;  3OYE A;  3MKL A;  4BEH A;  1W7P D;  3OYG A;  5D5X B;  4IKF A;  2OCE A;  3L2R A;  3AL0 C;  3OL3 A;  3OYM A;  4RB0 A;  1XX5 A;  1KZH A;  4HX8 A;  3HOU J;  3IAS 2;  1NHA A;  1ETY A;  2PBI A;  5EGO B;  4NQW B;  1V5E A;  1MKM A;  2STT A;  2LRE A;  3QYE A;  5E3L A;  4HF1 A;  1D5Y A;  4D1Q A;  1I6H J;  2E1C A;  2CS3 A;  1N77 A;  1XDU A;  4IL6 C;  3WHB A;  2QBY B;  4M73 A;  4KIC A;  1J7K A;  3E1S A;  5LGT A;  2B9S A;  4ZZD A;  5IT9 Z;  4RB2 C;  4I01 A;  2Z16 A;  2KKO A;  3PO3 J;  1YW7 A;  2P7V B;  1Y8R B;  5BNG A;  1BC8 C;  4OIP F;  1TT5 B;  3GZN B;  3ASO H;  4A3E J;  3E5U A;  1BOA A;  3PSF A;  3I0T A;  4BBS J;  2XF6 A;  1LB2 A;  3HJE A;  3Q9S A;  1MMS A;  2KFD A;  3KLN A;  5FD6 A;  2EV0 A;  1JJ6 C;  5B1B H;  1FSE A;  1YRN A;  4I09 A;  2Q1Z B;  4CHU A;  5FLV A;  1TL8 A;  5EG0 B;  3BJA A;  1BL0 A;  1PJR A;  1OFC X;  2XPW A;  2CQN A;  1GXQ A;  4BXU A;  1U8B A;  5AIP A;  2BE5 F;  5L3C A;  1Y56 A;  3GX4 X;  5JFR A;  4FIS A;  4CA0 A;  4Y13 A;  4EJU A;  4AUX A;  5BOX A;  4A12 A;  5IP7 J;  4Y33 A;  2FOW A;  3FMR A;  3CUO A;  2VLA A;  4BUP A;  4ANJ A;  4ZTF A;  3UR3 C;  1R5I D;  3OYF A;  1SAU A;  3CES A;  1E3O C;  3L09 A;  2HXO A;  4JQF A;  1IN7 A;  2QEX I;  3S15 J;  5GTI C;  1T33 A;  1WKM A;  2G0E A;  2VPR A;  4N9I A;  1G3Y A;  1YX3 A;  3LA3 A;  2LKX A;  1OQY A;  1ZAO A;  2H1L A;  4I7H A;  4N4N B;  3HOV J;  2ZME A;  4R8H A;  5J4Y A;  1SEU A;  2OBP A;  3B73 A;  1IC8 A;  1CF7 B;  4N4O B;  1C0W A;  2HQR A;  3H0G J;  3O3K A;  3QPL A;  3J7Z I;  2PEX A;  4KIB A;  2CMP A;  3A4C A;  4E7K A;  3BC8 A;  1B9N A;  4WXD A;  1I27 A;  5LHI A;  3RZO J;  2COB A;  4DNC A;  3H9Q A;  1BI1 A;  2MG4 A;  3OYI A;  1MGT A;  1IN8 A;  1W0U A;  4L9N A;  3S32 A;  1T95 A;  1PUE E;  1LDK B;  4ZDP A;  4FTH A;  3GWZ A;  2LF7 A;  3CJR B;  3SHF A;  1YI2 I;  3RPQ A;  4CZZ A;  1WRJ A;  1GV5 A;  3T8R A;  3ZQL A;  4UB8 C;  1H89 C;  2IAI A;  1ZG3 A;  1U5T A;  1QO0 D;  4BE1 A;  3VYT B;  3ZQG A;  4E7J A;  1BA5 A;  1A31 A;  4A3I J;  2HGC A;  2EZK A;  3OS2 A;  2GA1 A;  2WA0 A;  4AID A;  3WU1 B;  3LSG A;  4EGZ A;  2BYV E;  4KMU X;  3WE3 A;  2UXX A;  3DEE A;  1N75 A;  1BR2 A;  2CFO A;  2VJI A;  3TKY A;  5E3O A;  1APL C;  3EUH C;  2ME0 A;  1FBS A;  2LRD A;  2DAO A;  2H6C A;  3DCF A;  5F0F A;  1YS7 A;  4C30 A;  1IN5 A;  5EZG A;  1AHD P;  1BM9 A;  4Y52 J;  1YO5 C;  4LLG F;  2K27 A;  2MAB A;  1V5F A;  3DLL F;  2GWR A;  1OCP A;  3ML6 A;  3ZP5 A;  1IN4 A;  9ANT A;  3HOS A;  3Q5F A;  4LB5 A;  2MBF A;  3DF8 A;  3OR1 C;  4E7S A;  1VFC A;  4QSH A;  3ZN1 A;  5IP9 J;  1F5T A;  4BXF A;  2R7W A;  1F1Z A;  3WTT C;  1IF1 A;  2OJE D;  2XGD A;  5K5R A;  2QA4 I;  1ZGA A;  4OOI A;  2JA2 A;  2W7N A;  3CF2 A;  1EJ9 A;  3HOY J;  2DK5 A;  3GF2 A;  1IAW A;  1YX5 A;  4HF0 A;  5IYB J;  1EV7 A;  2IGO A;  2L9V A;  2RRE A;  4E7Z A;  3OYN A;  5HS9 A;  3PUB A;  1W7P A;  3BPV A;  1H0M A;  3MKY B;  2DQR A;  3VFZ A;  4A3J J;  2K3F A;  3V8L A;  5IT3 A;  3LSI A;  4CO8 A;  2E2H J;  2EFP A;  1XN7 A;  4OIO F;  4BY7 J;  2W1O A;  2D5V A;  4IQ4 A;  3FXR A;  1MND A;  2IT0 A;  2OZ6 A;  3P9C A;  3H9J A;  1VQM I;  1OJL A;  3GFI A;  2HQ5 A;  3IH4 A;  3DPL C;  4R1H A;  1SVL A;  1RUN A;  1HDD C;  2VJ4 A;  2A6T A;  5LD2 C;  2BEO A;  2FEZ A;  4YIR X;  2QQ8 A;  2G9W A;  3MN2 A;  1PDN C;  3RKW A;  1ETW A;  2EA2 A;  1UST A;  1GVD A;  1VI0 A;  3OSF A;  1PP8 F;  2BY0 A;  4WF2 A;  1FP2 A;  1K83 J;  4F52 A;  1S5L C;  1X3Z B;  3ZN0 A;  4RGS A;  3FWE A;  1BBY A;  3NEU A;  1O7F A;  2NAZ A;  1LNW A;  5D8L B;  4RB3 C;  1D8J A;  1KYZ A;  2JRT A;  1W4M A;  2DOF A;  1IG7 A;  3I54 A;  3LAP A;  5M5W J;  2M3A A;  1YIT I;  1MBJ A;  2HU9 A;  1P6R A;  1DP7 P;  3GLL A;  5FGM A;  3CUQ A;  1XGN A;  5J1U A;  3DFG A;  4ESF A;  3LQR A;  1P9Q C;  2LKP A;  2LH9 A;  3L9F A;  2O8X A;  5FKN A;  2Y75 A;  2CWE A;  4Z2Y A;  4RAY A;  1WWX A;  4G7O F;  5DCM A;  3L7W A;  1WH5 A;  4YEJ A;  1U6G A;  2A5W A;  3ELK A;  2LY1 A;  2RKH A;  2DA1 A;  3BG9 A;  5D5U B;  2FBK A;  4HOB A;  2QQA A;  1BIB A;  3VDX A;  4U87 A;  3JAM Z;  2M30 A;  2TRT A;  2DW4 A;  3R4K A;  2X6X A;  3K1M A;  1JGG A;  1H88 C;  1GT0 C;  1Z7U A;  2ZXH A;  3F6O A;  1SD4 A;  2QKM B;  3J7Y J;  3KIO A;  4PUS A;  3VPR A;  3HKZ A;  2PJR B;  2HTJ A;  3LSK A;  3BG7 A;  4BE2 A;  2CU7 A;  3C2G A;  4BEH B;  1TZL A;  4JX4 A;  2EFQ A;  2HQN A;  2K85 A;  3WTU C;  2H09 A;  1JI8 A;  1W5C C;  1TWG J;  3I9V 2;  3CO6 C;  2IEK A;  3QP5 A;  3KP2 A;  1ZEL A;  2OPT A;  4C2T A;  4RA2 A;  1SFE A;  3JRH A;  2M7B A;  5ERI A;  3ZQI A;  2VB6 A;  3SXY A;  3KEY A;  2QYO A;  1TWA J;  1ZQ3 P;  1JTX A;  2KRH A;  1QQI A;  2OD5 A;  2I10 A;  4V2G A;  4U0Y A;  3ECO A;  4IX7 A;  3W3C A;  4C3J J;  4FQG A;  3ABM H;  1D0Z A;  2E1M B;  4OU0 A;  2O3F A;  1RRJ A;  1P4W A;  2GXG A;  5FLM J;  1FMW A;  2MLK A;  1VQO I;  2V9P A;  1U0J A;  2Z5U A;  3F8M A;  4PJJ A;  2B0L A;  2O0Y A;  1J59 A;  1LVK A;  2K4J A;  1QBJ A;  3QOE A;  3IC7 A;  4RLF A;  1ZRF A;  4D5F A;  1YRN B;  3M3Y J;  2DFH A;  1S7E A;  4CCK A;  4KT5 C;  1DQU A;  3VYS B;  4A3D J;  3DKX A;  1ODD A;  3QRF F;  2D1V A;  2PQ8 A;  2EIK H;  4S05 A;  2XRN A;  4IQJ A;  2P5V A;  3S93 A;  1BN5 A;  3DBL B;  3A01 A;  2NS7 A;  5IYD J;  1MMD A;  1Q1H A;  2KJB A;  1TW3 A;  2EH3 A;  3C1D A;  2Q2E A;  1R00 A;  1WPK A;  2L7K A;  4UUV A;  4S0H B;  4IF4 A;  2EQR A;  2F4O B;  3HXL A;  3TP3 A;  4CSW A;  2LG4 A;  1YOV B;  2WAQ N;  4P55 A;  4Y15 A;  4YIF A;  2HOE A;  2ACJ A;  2DPD A;  3PSI A;  1FOX A;  3N05 A;  1YW9 A;  4XLE A;  2PFB A;  3ABU A;  4UVC A;  1YG2 A;  5F6F A;  3ZOB A;  2DOD A;  2WTE A;  3ZMT A;  2ZME B;  5J8C A;  2AHQ A;  2R7F A;  4O5V A;  5CVI A;  2CUZ A;  2IA2 A;  2QBY A;  3ABK H;  1IXC A;  4EJW A;  3C7J A;  2KDO A;  2EFO A;  3TDZ C;  4XR6 A;  4PDK A;  3CJT B;  1I5Z A;  1TWF J;  4YEL A;  1ZK8 A;  1XGM A;  2RV8 A;  2H1K A;  3BQZ A;  3NWT A;  1VQ6 I;  1O3Q A;  2X9D A;  2JMW A;  2JPB A;  5ILU A;  2X0L A;  2STW A;  3GME A;  3I71 A;  3HG9 A;  2GIZ A;  3EYY A;  1OCR H;  2JZY A;  3C2H A;  2HYJ A;  2DPU A;  2HOS A;  4AM3 A;  4ITV A;  4NNJ A;  2CRG A;  3E7L A;  4BU2 A;  2Q8K A;  1U5T B;  3P7N A;  4KDP A;  2DU9 A;  2WAD A;  3RZD J;  2LLK A;  3ZR8 X;  4U7B A;  4ZJZ A;  5M3F J;  2OF7 A;  3KZI C;  4ETS A;  3A0B C;  5HS7 A;  3M8J A;  4BY1 J;  2ZME C;  3EYI A;  2CQK A;  3CME I;  2OTL I;  2GLO A;  3RKY A;  2R7T A;  1X1B A;  3K2Z A;  1Y39 A;  4TV7 A;  2EZI A;  4X0G A;  5IP6 A;  2HVQ A;  3ABT A;  3VOD A;  2R7Q A;  2KLO A;  3S1M J;  4RMN A;  3HRS A;  1LFP A;  2COM A;  2HNH A;  4LLN A;  5KAF C;  1BOB A;  3J81 K;  3H3Z A;  4XLN F;  1OPC A;  4AIH A;  2CV0 A;  1MSF C;  1I1G A;  2YUS A;  1S7A A;  2NOG A;  4FAS D;  1ZRC A;  1IXR C;  1VQ8 I;  3I55 I;  2K40 A;  4HZF A;  3OYL A;  1BI0 A;  1Q1V A;  4E70 A;  4LG0 A;  1Z9C A;  1SFU A;  1BI3 A;  3HPG A;  3QPS A;  5GAD J;  2Z1D A;  1U5T C;  2E19 A;  3R60 A;  1ZLJ A;  5CPR B;  4DGW B;  1BJZ A;  2XPU A;  4PGH A;  3PO2 J;  2R7D A;  4BHC A;  2GAU A;  2MLG A;  2X6O A;  4B4C A;  1NH3 A;  1H9T A;  2F2E A;  5EZH A;  4B09 A;  1DP3 A;  3P9K A;  5CYV A;  5JLX A;  2HWV A;  4M9Z A;  1HA8 A;  3VYR B;  4KIF A;  1W7P B;  4AYB N;  3RPU D;  3A1Y A;  2DA6 A;  2LFB A;  4UNO A;  1Y0N A;  1SMY F;  2KIM A;  3H3V K;  1X3W B;  1UHW A;  1QZZ A;  1D8K A;  3C2B A;  3DQV C;  5FRN A;  2WAF A;  1ETO A;  3QAH A;  3J80 K;  1I50 J;  2FMY A;  3PNV A;  3ZMU A;  5IOY A;  5L3E A;  4LIU A;  4JOM A;  2BVM A;  1RZ4 A;  1O3R A;  1FC3 A;  2QLZ A;  2XDV A;  3KZZ A;  4JX5 A;  3ZMV A;  4IHV A;  2GM4 A;  1K7A A;  2E1O A;  4X1E A;  1LE8 A;  3TOB A;  1WGX A;  3BG6 A;  1FYL A;  1MBF A;  1DGW Y;  2W4S A;  5TJJ A;  2LK2 A;  1H8A C;  3K6G A;  3D5L A;  1E17 A;  2NYX A;  3LSJ A;  1WCM J;  2GQQ A;  2QM3 A;  3HPH A;  3DV8 A;  5LHG A;  4MQ9 F;  1R5H A;  2D1H A;  2K9Q A;  3H1C A;  1R9T J;  4BBR J;  2KMU A;  4XKB A;  5LEJ A;  3RTR A;  1NG7 A;  4LLL A;  5F04 A;  3LSP A;  3DPT A;  3FMS A;  1WJD A;  4F55 A;  4AD9 A;  4CCJ A;  1XS9 A;  3LMM A;  1XMA A;  3CUQ B;  2DDB A;  1J09 A;  2CV1 A;  4YFN F;  5JLW A;  1LDD A;  3KP5 A;  4EVI A;  4HSR A;  4M6X A;  4D0P A;  5FKO A;  3H5N A;  5DCM B;  3F22 A;  1HKS A;  1IRZ A;  2VJJ A;  2ESN A;  2M1B A;  2X1C A;  4HPQ A;  5B3S H;  3L2W A;  3OYC A;  3CJN A;  1G3W A;  3F8C A;  1ZH5 A;  2W25 A;  3AG3 H;  1JHF A;  2HOA A;  1NG6 A;  3CCY A;  1POG A;  4WK8 F;  4IJA A;  2VE8 A;  2M0M A;  4IHS A;  3H36 A;  2OC6 A;  1R6R A;  4UHT A;  2GZW A;  4XBF A;  5BS6 A;  4A0Y A;  2DBB A;  2ME6 A;  4FHT A;  2IRF G;  3MFK A;  4FCY A;  3ZRG A;  1VND A;  3HRT A;  4CDG A;  1G3T A;  2KRC A;  3LSH A;  3BQY A;  1JT6 A;  1D3Y A;  1B6A A;  1GUU A;  2ECC A;  5M3M J;  2L0K A;  3QOD A;  3CUQ C;  3K4B A;  5BPD A;  5CVU A;  2Y0M A;  3X2Q H;  5IYC J;  1MNE A;  3QYF A;  2XIG A;  4ZYA A;  2HYG D;  2ZSH B;  1ETX A;  4I99 C;  1IRX A;  4D7M A;  2ISY A;  2JVG A;  3L1P A;  3OYK A;  2IA0 A;  4WXH A;  1WSU A;  5IOZ A;  2JN6 A;  4IPA A;  1QHG A;  3OYH A;  5K7F A;  3B6A A;  4ZYE A;  4FT8 A;  2D2W A;  2VUM J;  2TDX A;  4KIT B;  5K7Z A;  3M8E A;  4IO9 F;  1MMG A;  3L00 A;  1Y8Q B;  1GV2 A;  2DQL A;  2VBZ A;  1BR1 A;  2ZXJ A;  3BG3 A;  2F5D A;  2I5U A;  3SZP A;  3TW6 A;  3TW7 A;  1LKX A;  3GTP J;  3JRF A;  3HGY A;  1RR8 C;  2FD5 A;  3A01 B;  1R1U A;  3FXJ A;  3JTG A;  4EJO A;  3GFM A;  2YPR A;  2HEO A;  2E35 A;  3ROU A;  2KZG A;  3ECH A;  3EUK L;  1UHM A;  1REP C;  3MQ0 A;  2Q2E B;  2IW5 A; 
#chains in the Genus database with same CATH homology
 4J19 A;  1IJW C;  5F0F A;  1EF4 A;  1X58 A;  1JKP C;  2X48 A;  5EZG A;  1AHD P;  4Y52 J;  2DA4 A;  4MFD A;  3TP0 A;  2XGC A;  5EEA A;  1OCP A;  1WI3 A;  2EZL A;  2LD5 A;  9ANT A;  1HOM A;  2XPV A;  3Q3S A;  4M3F A;  2CUF A;  1VFC A;  4QSH A;  1JUS A;  5IP9 J;  1Y1V J;  2NVY J;  2XGD A;  1IDY A;  2LP0 A;  1BW6 A;  3HGG A;  3HOY J;  1X2N A;  2ZB9 A;  4DYQ A;  5IYB J;  2DA5 A;  1B8I B;  1RR7 A;  2R5Y A;  3S1N J;  1DU0 A;  4NDL A;  4MFE A;  2DA2 A;  4A3J J;  4M6V A;  4JX6 A;  4A3B J;  2E2H J;  3JRD A;  2R5Z A;  4BY7 J;  2D5V A;  2YU9 J;  4DW6 A;  2XRL A;  1VF9 A;  1TC3 C;  3JRB A;  1OJL A;  2HQ5 A;  3IH4 A;  1FJL A;  1JJ8 C;  5EGO A;  3F0C A;  2W48 A;  1HDD C;  3GBG A;  1IGN A;  3HDD A;  3BG5 A;  2LTP A;  3MN2 A;  2FQ4 A;  2DTZ A;  3S2D J;  1ETW A;  4MLO A;  1DU6 A;  1GVD A;  2HOT A;  1VI0 A;  3OSF A;  2DMU A;  2AO9 A;  1HF0 A;  4FE4 A;  1K83 J;  5F0C A;  3G1M A;  1T56 A;  2WB1 N;  1WH7 A;  2NVX J;  1IG7 A;  1QVU A;  5M5W J;  1MBJ A;  1NK3 P;  5EG0 A;  5M5Y J;  3HOW J;  4A93 J;  2ECB A;  2L7M P;  5J1U A;  1GDT A;  5C4J J;  1AU7 A;  1JTY A;  5FKN A;  2VI6 A;  3GTQ J;  3G1O A;  3HOZ J;  5GPC A;  1ZTR A;  2JA5 J;  1QRY A;  1WH5 A;  4IEJ A;  1MH3 A;  2ID3 A;  1PUF B;  2KDZ A;  2DA1 A;  3BG9 A;  2P81 A;  2N8G A;  5DTD A;  2JA7 J;  5GPA A;  1Z0X A;  3K2A A;  2TRT A;  1FIA A;  3JRC A;  2DMP A;  2RAE A;  3IH3 A;  4DZP A;  1ITY A;  3BR6 A;  4LOC A;  1JGG A;  2DMN A;  3OOU A;  1H88 C;  1GT0 C;  2CUE A;  3O8H A;  1MBG A;  2LVS A;  3VPR A;  5F1J A;  3RKQ A;  4IHY A;  3I4N J;  5C4X J;  3IV5 A;  2GBY A;  3OSG A;  2CU7 A;  4DYC A;  5C44 J;  3K7A J;  4JX4 A;  3FK6 A;  3BTI A;  1LFB A;  1TWG J;  4UUS B;  2IEK A;  2XB5 A;  2OPT A;  3JRH A;  2O8K A;  3GTM J;  3ZQI A;  1F36 A;  1TWA J;  1ZQ3 P;  2XGE A;  1LE8 B;  1JTX A;  4BKX A;  2VKV A;  2JJ7 A;  2I10 A;  4V2G A;  4XIC A;  3JRG A;  1ORK A;  4C3J J;  3ZQH A;  3D1N I;  1A5J A;  5FLM J;  5J1R A;  1RES A;  2CQQ A;  2R5Y B;  4RDU A;  4B3A A;  4RBO A;  3HBL A;  3GTK J;  1LFU P;  4M3B A;  2M8G X;  4D5F A;  1YRN B;  3M3Y J;  2CJJ A;  3HM5 A;  4XID A;  3GTJ J;  1S7E A;  4C3H J;  4DZJ A;  1MBE A;  2L9R A;  4A3D J;  3Q0V A;  4JP0 A;  4I6Z A;  2K9S A;  4B1R A;  1FTZ A;  3SJM A;  3HB9 A;  2Y31 A;  2MSY A;  3A01 A;  2FJ1 A;  2NS7 A;  5IYD J;  1O4X A;  2VKE A;  2EH3 A;  5EDN A;  1B72 A;  1ETK A;  2H8R A;  1ETV A;  1WPK A;  3GTO J;  1RKW A;  1SFO J;  2NVT J;  3FKI J;  4S0H B;  3ZQC A;  1MH4 A;  3PM1 A;  2EQR A;  1QPI A;  1X2M A;  3TP3 A;  4D5C A;  5K7H A;  2WAQ N;  1I3Q J;  5FKK A;  2HI3 A;  5GP9 A;  1U9O A;  1G2H A;  3HKZ N;  3LNQ A;  1ZGW A;  4CYC B;  2IBD A;  3ZOB A;  5E3M A;  1UG2 A;  2AHQ A;  1FIP A;  3M4O J;  1TWH J;  3HEF A;  3LOC A;  3UKG A;  1RPW A;  5EF6 A;  4BXX J;  5F27 A;  1TWF J;  2DJN A;  1ZK8 A;  3GTG J;  4A3G J;  4I76 A;  2WV1 A;  2H1K A;  4MIM A;  3BQZ A;  2M9H A;  1TWC J;  2X9D A;  3NAR A;  2HDD A;  2JMW A;  3CQZ J;  2KT0 A;  2Y9Z A;  4W97 A;  1XC5 A;  2M34 A;  4A3C J;  5FJ8 J;  2HYJ A;  3GTL J;  2DA3 A;  1AKH A;  2HOS A;  3A03 A;  2CQX A;  5FKM A;  2R93 J;  2CRG A;  3E7L A;  4X6A J;  1F43 A;  2Y30 A;  3RZD J;  2LLK A;  2MGQ A;  3TED A;  4IHW A;  5M3F J;  2JK3 A;  5EYR A;  2OF7 A;  3IH2 A;  1U78 A;  5DS9 A;  3S1Q J;  4A3L J;  1OCT C;  1ETQ A;  4BY1 J;  1ZR2 A;  2M2E A;  4ABZ A;  2Y9Y A;  2E2J J;  1Z77 A;  2EZH A;  2GLO A;  3A02 A;  3SDG A;  2EBI A;  1SAN A;  5FKL A;  2M0C A;  3NAU A;  2EZI A;  4HNV A;  5IP6 A;  1CQT A;  1XG1 A;  4V2F A;  4QTR A;  3S17 J;  3S1M J;  2R7Z J;  1RKT A;  1MBK A;  1P7I A;  4C2M J;  3WHC A;  1JT0 A;  4M3D A;  1MSF C;  4XRS G;  1JKR C;  2YUS A;  2Y0S N;  1ZR4 A;  2NOG A;  2K40 A;  3BT9 A;  2R0Q C;  2ELK A;  1Q1V A;  3BR3 A;  4AC0 A;  3HOX J;  4DYR A;  3QPS A;  5F0H A;  4GFB A;  4D7N A;  2E19 A;  4Y7N J;  2LY9 A;  1BJZ A;  2XPU A;  3PO2 J;  2DMQ A;  5HOD A;  4M3G A;  3JRA A;  1PUF A;  4IHX A;  3JRE A;  2X6O A;  3Q0W A;  4B4C A;  5EZH A;  4JYK A;  2LR8 A;  1FEX A;  1NTC A;  2PMZ N;  5JLX A;  1RET A;  2O7O A;  4AYB N;  5J3L A;  2E2I J;  3W6V A;  2FX0 A;  4C3I J;  2DA6 A;  2LFB A;  1JKQ C;  3BR0 A;  3H3V K;  3BTL A;  4MO7 A;  3S14 J;  2B63 J;  2DA7 A;  3ZQF A;  3C2B A;  3MKL A;  2R5Z B;  1ETO A;  3FK7 A;  1I50 J;  1W0T A;  1A6I A;  3Q0U A;  5IOY A;  2QF7 A;  1P7J A;  3MVP A;  2NVQ J;  3HOU J;  4UUS A;  1ETY A;  4XRS A;  5EGO B;  1JUP A;  5E3N A;  5E3L A;  1D5Y A;  4JX5 A;  4IHV A;  2GM4 A;  4W1U A;  1I6H J;  2E1O A;  4A3M J;  3WHB A;  1IDZ A;  2QCO A;  4X1E A;  1LE8 A;  1WGX A;  1MNM C;  2XB0 X;  1BW5 A;  1MBF A;  2LK2 A;  1H8A C;  3LSJ A;  3PO3 J;  5BNG A;  1WCM J;  4A3E J;  3O8G A;  2K9Q A;  4BBS J;  2MW8 A;  1R9T J;  3I4M J;  4BBR J;  2L7Z A;  2ID6 A;  1JJ6 C;  1YRN A;  5F04 A;  3LSP A;  2Y2Z A;  3S1R J;  5FLV A;  5EG0 B;  1K61 A;  1BL0 A;  1XS9 A;  2K9N A;  1AKH B;  3LSR A;  2L7F P;  3G1L A;  1OFC X;  2XPW A;  3BR1 A;  5JLW A;  1U8B A;  1B8I A;  5FKO A;  1IUF A;  4FIS A;  1UMQ A;  1UHS A;  2O9L A;  2NS8 A;  4EEF G;  4AUX A;  2DMT A;  1IRZ A;  1ENH A;  5IP7 J;  4XRM A;  2R92 J;  3BTJ A;  5M5X J;  2JWT A;  1E3O C;  2HOA A;  2HXO A;  3JR9 A;  4L5E A;  3CCY A;  1POG A;  3S15 J;  5F08 A;  1T33 A;  2G0E A;  5IPA A;  2VPR A;  2LKX A;  3OIO A;  4CYC A;  3QQA A;  3HOV J;  5C3E J;  2HXI A;  2ME6 A;  1HLV A;  1NK2 P;  4FE7 A;  1JUM A;  4UUT A;  4FCY A;  1IC8 A;  1VND A;  1FTT A;  3DEW A;  4XK4 A;  3BQY A;  3H0G J;  3QPL A;  5J1Y A;  3FIS A;  3BR2 A;  1JT6 A;  1GUU A;  5M3M J;  2ECC A;  2JA8 J;  2L0K A;  4A3F J;  5IYC J;  3RZO J;  4QIW N;  2COB A;  2MG4 A;  3S16 J;  1JKO C;  1ETX A;  1W0U A;  1U9N A;  4D7M A;  4A69 C;  3L1P A;  4FTH A;  1QVT A;  3BR5 A;  2TCT A;  1MBH A;  2DN0 A;  2JA6 J;  5IOZ A;  3CDL A;  2JN6 A;  1GV5 A;  1HCR A;  1ZKG A;  3ZQL A;  5K7F A;  3B6A A;  3B6C A;  2IAI A;  1H89 C;  2VUM J;  3ZQG A;  5K7Z A;  4G12 A;  1BA5 A;  4A3I J;  1GV2 A;  2EZK A;  3BTC A;  3FIW A;  3SFI A;  3S2H J;  1Y1W J;  3BG3 A;  1MSE C;  4M3E A;  3TW6 A;  3TW7 A;  3LSG A;  1HDP A;  3JRF A;  3GTP J;  3HGY A;  3CMY A;  2XSD C;  2FD5 A;  3JRI A;  3A01 B;  1IV6 A;  5E3O A;  1APL C;  2ME0 A;  2YS9 A;  4A3K J;  1B72 B;  3RQI A;  3DCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...