3S17J

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s17J00
2XGCA 3JRDA 3BR3A 3HKZN 2GM4A 4MLOA 1G2HA 5EF6A 1LE8A 3HEFA 2L0KA 1IC8A 2PMZN 4GFBA 1OCPA 2HI3A 1GVDA 1HF0A 2HOAA 2DTZA 2VI6A 1E3OC 2K9SA 3S1NJ 1A5JA 5IYDJ 1UG2A 2D5VA 5F27A 1QVUA 1IGNA 5IPAA 1OCTC 2DA7A 2CUFA 3FK7A 3HGGA 3HB9A 1VFCA 1W0UA 1TWGJ 1ZTRA 2XPVA 4DYRA 3JRFA 2Y31A 3PM1A 1I3QJ 2R5ZA 1B72B 1ZK8A 4XICA 2CQXA 2Y2ZA 3JRCA 4J19A 1DU0A 3LSJA 1R9TJ 5FKLA 3LSPA 2Y9YA 3LNQA 1JKRC 4BY1J 2X6OA 2EQRA 1H89C 2NS8A 2M2EA 2LP0A 3JRHA 4FE7A 3DCFA 1JT6A 5F04A 4MIMA 2JA6J 3BG3A 4UUTA 4X6AJ 2JJ7A 3BTLA 2VUMJ 3BQYA 2I10A 2MGQA 5IP7J 3ZQIA 1OJLA 4JX4A 4I6ZA 3TP3A 2G0EA 1ETQA 1MNMC 1WCMJ 1DU6A 2N8GA 5IP6A 3LSRA 2QCOA 2K9NA 2MW8A 2XGDA 5F0FA 4Y7NJ 5C44J 4B3AA 1D5YA 3HOXJ 1HOMA 2DA5A 3GTPJ 4I76A 3S17J 2DJNA 4V2FA 2ZB9A 3Q0VA 4QIWN 3JRGA 2XPWA 4A3CJ 3GTGJ 1H8AC 1Q1VA 1Z77A 2CRGA 3B6CA 5EGOA 1JUSA 1WGXA 3JR9A 4A3FJ 5IOYA 4UUSA 3HOWJ 4XRMA 3BG9A 1X58A 1I6HJ 2XGEA 1B8IB 1P7JA 4ABZA 2R5YA 3BTJA 2Y30A 1AHDP 4IHXA 2IEKA 3HGYA 2MG4A 4A3JJ 3ZQLA 3HBLA 1GUUA 4XK4A 1TWCJ 3GTQJ 5HODA 5J1RA 1XG1A 2M34A 3JRIA 1MBHA 5EYRA 2R0QC 3F0CA 1RR7A 1IUFA 1MBKA 5F0CA 2KT0A 1JKPC 1MBEA 2L7FP 4BBSJ 3IH4A 2XB0X 2CU7A 1LE8B 3LOCA 1B8IA 2YS9A 1TC3C 1LFBA 5F0HA 4DW6A 1LFUP 3VPRA 1S7EA 1U8BA 1ETWA 1GV5A 4QTRA 2O7OA 4FE4A 4DYCA 3A01B 1T33A 1RKTA 2GBYA 1VI0A 1GDTA 1HCRA 2DA3A 4HNVA 2E1OA 4IHYA 1TWFJ 3A02A 2DMPA 1OFCX 5K7HA 2NOGA 2R5ZB 3H3VK 5JLWA 1JJ6C 1H88C 1FJLA 1A6IA 3A03A 5IYBJ 5EZGA 2HYJA 3S16J 1W0TA 4A3LJ 2EH3A 3BR6A 3LSGA 2L9RA 1ZR4A 1IDYA 1RPWA 1IJWC 2LFBA 1FEXA 2EZKA 4XRSA 1JJ8C 3A01A 3DEWA 3HM5A 3HDDA 5JLXA 5E3OA 2HOSA 1POGA 3O8GA 2EBIA 4LOCA 1TWHJ 1JTYA 3GTMJ 1Z0XA 4G12A 3QQAA 5FJ8J 3S1QJ 2IAIA 2HOTA 3PO3J 4M3BA 2K9QA 3SJMA 3O8HA 4IEJA 1YRNB 3MKLA 3CCYA 4XIDA 2DA1A 1APLC 2JA5J 1BJZA 1MH4A 1ZGWA 2NVQJ 4A3IJ 1Y1WJ 3M4OJ 2HDDA 4RDUA 2RAEA 2OF7A 1HDDC 3MN2A 2JA8J 2LD5A 5M5YJ 1ZQ3P 3BQZA 3D1NI 4W97A 4A3KJ 3ZQGA 2VPRA 3TEDA 1ORKA 1SFOJ 1GV2A 2FJ1A 1YRNA 4B4CA 1NTCA 1JTXA 3NAUA 4DZJA 1RKWA 3L1PA 5FKNA 1SANA 1IRZA 1EF4A 5EGOB 5IP9J 2FQ4A 4JP0A 3S2HJ 4JYKA 2VKVA 2DA6A 2YU9J 4UUSB 2CUEA 4D5CA 2R92J 3JREA 4FCYA 3K7AJ 2JN6A 4BBRJ 3G1MA 2R5YB 1U9OA 5EG0B 2JMWA 3I4MJ 1F43A 4BXXJ 2E19A 5F08A 1JKQC 1ETYA 4DYQA 2LR8A 3HOUJ 3M3YJ 2KDZA 4A3MJ 4NDLA 2ID3A 1X2NA 2P81A 4S0HB 1NK2P 4CYCA 1MSEC 2DMNA 2XB5A 3RZOJ 2E2HJ 2Y9ZA 2ECBA 2R93J 1UHSA 4C3HJ 4A3EJ 1XC5A 3FKIJ 2E2JJ 1ETOA 3GTLJ 2VKEA 5EG0A 4M6VA 1BA5A 3HOZJ 3IH3A 4M3FA 5EZHA 2LK2A 4FISA 2M8GX 1ENHA 2GLOA 2ME0A 2JA7J 5C4XJ 2ME6A 5EDNA 4AC0A 2YUSA 1CQTA 3BG5A 4IHWA 3FIWA 2R7ZJ 5C3EJ 3PO2J 2O8KA 1Y1VJ 2EZHA 1FIPA 1U9NA 3WHBA 4C3IJ 1X2MA 5DS9A 3GBGA 4A93J 2IBDA 5K7ZA 2TRTA 2XPUA 1XS9A 3BR1A 1JUPA 4MFEA 2COBA 4RBOA 1QVTA 5J1UA 3IV5A 1QPIA 1I50J 2LVSA 5M5WJ 3BTCA 5M5XJ 1O4XA 3IH2A 5E3LA 2L7MP 5DTDA 5IOZA 5M3FJ 2H1KA 5FKOA 2LY9A 1JUMA 2FX0A 1ETVA 5GP9A 1MSFC 3OIOA 1VNDA 3S14J 4AYBN 3ZQCA 5FKMA 3ZQHA 1JKOC 1TWAJ 2L7ZA 1IV6A 3B6AA 3BR5A 2MSYA 3G1OA 4A3DJ 1K83J 2E2IJ 4W1UA 3RKQA 3SDGA 4Y52J 3CMYA 4MFDA 3FISA 1MBJA 1IDZA 2DMQA 1FTZA 4BY7J 2W48A 1U78A 3QPLA 2X48A 5J3LA 3E7LA 1K61A 2ID6A 2QF7A 4BKXA 1BW6A 1GT0C 3S15J 3BTIA 5M3MJ 1FTTA 2XRLA 2JWTA 2ELKA 2DA4A 5K7FA 4V2GA 3TP0A 4EEFG 3ZOBA 1WPKA 5F1JA 1PUFA 3Q0WA 3NARA 3I4NJ 3FK6A 3CDLA 4CYCB 4A3BJ 5BNGA 3WHCA 2HXOA 4IHVA 2LKXA 1JGGA 3S1MJ 2AHQA 4D5FA 3HOYJ 2X9DA 4JX6A 1HLVA 2M0CA 5FLVA 1AKHB 2NS7A 4C3JJ 4M3DA 1WH5A 1BL0A 2NVTJ 3G1LA 1ITYA 3ZQFA 1B72A 1ETKA 1P7IA 3Q3SA 5FLMJ 2WB1N 2LTPA 1RETA 1HDPA 4X1EA 4AUXA 3HOVJ 4A3GJ 1FIAA 2CQQA 5IYCJ 3BR0A 1F36A 2EZIA 4M3EA 1RESA 1QRYA 5EEAA 2WAQN 5J1YA 1MH3A 2ECCA 3BT9A 3Q0UA 3GTOJ 1AKHA 2JK3A 1AU7A 2DMUA 3W6VA 2WV1A 1IG7A 2Y0SN 1WI3A 3QPSA 1ZKGA 2DMTA 3K2AA 3TW7A 1UMQA 2M9HA 5FKKA 5GPCA 4FTHA 3S1RJ 3GTJJ 2AO9A 1ETXA 2HXIA 4XRSG 1JT0A 2FD5A 1VF9A 2LLKA 3JRBA 2NVYJ 3OOUA 4D7MA 2OPTA 5C4JJ 5E3MA 3UKGA 1T56A 4L5EA 1MBGA 2O9LA 2XSDC 3SFIA 3OSFA 3CQZJ 2DA2A 2DN0A 3GTKJ 4MO7A 5GPAA 2K40A 1ZR2A 1WH7A 2NVXJ 3RQIA 3MVPA 4D7NA 2H8RA 1BW5A 3TW6A 1NK3P 2B63J 3H0GJ 3S2DJ 1MBFA 3OSGA 4JX5A 4DZPA 2HQ5A 2EZLA 3BR2A 4A69C 4B1RA 3C2BA 3JRAA 4M3GA 3RZDJ 5E3NA 4C2MJ 2TCTA 2CJJA 4QSHA 9ANTA 1PUFB
chains in the Genus database with same CATH superfamily
2GM4A 3BR3A 4MLOA 3OYBA 1LE8A 4NC7A 4L9NA 4ZDOA 2DFFA 2L0KA 2RKHA 1IC8A 2DBBA 4M9XA 4ETSA 4TV7A 3ROUA 1SVOA 4UVCA 3JAMZ 5BPDA 1LDJA 2VI6A 1A5JA 5IYDJ 1K4SA 5F27A 3ZGKA 3H0DA 1QVUA 5ED4A 3OYMA 1IGNA 5IPAA 4E70A 2DA7A 1OCTC 3FK7A 2JUGA 4J01A 1ZTRA 2XPVA 3CCRI 2JT1A 2HEOA 1BI2A 3SZTA 4XOTA 3GFLA 3JRFA 5BPIA 2HTJA 2DFHA 1I3QJ 4LG0A 3NQOA 2NVUB 4S04A 1ZAOA 2A5WA 3X2QH 4XICA 4DOZA 2V1UA 4YIRX 3LA7A 2DQRA 4J19A 4ZYEA 2Y9YA 3LNQA 3HG9A 2X6OA 5AIPA 4F55A 4BY1J 3JTHA 4XLCA 1FP1D 3CF2A 2X6WA 2M2EA 2OCCH 4FE7A 1JT6A 1TNTA 1R5GA 3ZN1A 2JA6J 3BG3A 4L0YB 3G71I 4C2TA 3BTLA 5TRDA 3OWTA 4H4KC 3CLQA 2OD5A 3ZQIA 4I6ZA 4ZTFA 3TP3A 2JSPA 2DOAA 2P7VB 1ETQA 4U0WA 2XVCA 3ZQQA 1TZLA 1WCMJ 1ZRDA 3LSRA 1DP3A 1YO5C 1MMDA 3GW2A 3QPHA 2Z1DA 4BXFA 2V1DA 4B3AA 2PG4A 4DIQA 3GTPJ 3DBLB 4RA2A 4I76A 3KFWX 5AIQA 1IV8A 2BBYA 2O8XA 1R4NB 2WAEA 3PSFA 4G6DA 3E0JB 2ZB9A 3Q0VA 4QIWN 3OV8A 3K6GA 2M0MA 2KZVA 2ZMEB 3R6SA 3T8RA 2EV5A 2BZTA 2KQRA 1WGXA 4E4HA 3SFZA 4UUSA 2L7KA 3HOWJ 4XRMA 2KJBA 5FD5A 2QBYB 3DV8A 4LK0F 4ABZA 3BTJA 1D1BA 2Y30A 4IHXA 2IEKA 2UV1A 3HUGB 4A3JJ 3I53A 4ESBA 4IRIA 3TMOA 3QRFF 3EDPA 2DK8A 3GTQJ 2P5KA 2VJIA 5HODA 4CCOA 3H9GA 2M34A 4EJVA 1MBHA 3BZ6A 3JRIA 2R0QC 4N9HA 4LFUA 4XLAA 1RR7A 2ZMEA 1N77A 3CC7I 1AOYA 3PQJA 2KT0A 2EA4A 4LB6B 3BJ6A 4LLNA 3IUOA 3H9JA 3LA2A 4LITA 4EM1A 4E7HA 2W7NA 4ENNA 2QBYA 3E97A 1RI7A 4KIFA 4DW6A 4HNUA 3VPRA 3ZMUA 2CO5A 1ETWA 4ITVA 1Q1HA 2F5CA 2JPCA 1VZ0A 1B4AA 3IKVA 1RKTA 3S2WA 1Z6RA 2QSFX 3CCQI 4OMZA 3BY6A 1F9NA 3C2HA 3K10A 1GDTA 4GYGA 1ZGAA 3REOA 1XB4A 1L3LA 1I6XA 2E1OA 1B9NA 4L5IA 2K4BA 2DMPA 5J4VA 2BY3A 2O3FA 3HIFA 2R5ZB 4PGHA 4DGWB 3DPUA 5JLWA 3L2CA 1T0FC 4A5MA 4DQ2A 4EV0A 5B1AH 1JJ6C 1A6IA 3GYHX 4HG2A 4CDGA 2Z33A 2L9RA 1IJWC 1RPWA 5CVIA 2G7UA 3I5UA 3M8JA 4P9UA 4LK1F 4XLFA 3VYTB 5JHFA 3MFKA 2HOSA 1KONA 3FXOA 4G12A 2ZBKA 4IVNA 3S3NA 3CJTB 4EVIA 4F93B 2P4WA 3MKWB 3S1QJ 3SJMA 5FD6A 3V4GA 4DJAA 2IXSA 3CDIA 4LIUA 1BJZA 2DOFA 3BC8A 2K02A 4NC6A 2L02A 2COMA 2Z16A 3U1DA 2NVQJ 3MZ8A 3I58A 2DO7A 3WTTC 2CW7A 2BOLA 2DCEA 1Y1WJ 2R7WA 3GCMA 4XN0A 4RDUA 4AVPA 4N0BA 3OS1A 2OF7A 3MN2A 2LD5A 1EKEA 1ZQ3P 3T5XA 1PP8F 1U5TB 2L2OA 3ZQGA 2WA0A 1DPUA 2VPRA 2VBXA 2DT7B 2VT2A 3VOEA 2QYOA 2BYVE 4B4CA 1JTXA 2O5RA 2E1CA 2A3SA 1FLIA 4AVZA 5K5OA 4O3MA 4Q4ZF 4RLFA 5EGOB 4G7ZF 1U3EM 2CV1A 4JYKA 2OQGA 4PUSA 4U88A 2BHYA 2YSRA 3QYEA 3G3ZA 1ON1A 2CUEA 2R92J 4YIIA 2V7FA 3G1MA 1N78A 3E5XA 3I4MJ 3FMSA 2PX9A 1V5GA 1U5TA 1JKQC 1G3TA 1ETYA 1FWZA 4A3MJ 3WTWC 4DBRA 4AM3A 2G7HA 3IHUA 4CCNA 5HLGA 1MDMA 2P81A 4EM2A 2VBZA 4XRFA 5H2FC 1NK2P 4IRHA 1VQ4I 2DMNA 4NQWB 2E7WA 3R60A 2W00A 1LKXA 1XSVA 3I55I 4B09A 3IAS2 3RIRA 1WWXA 4C3HJ 1J09A 3JSPA 3C18A 3BG6A 2A05A 1ETOA 4BJTA 2C6YA 2BEOA 4Y17A 2OA4A 4M6VA 3RTRA 2RQQA 3IH3A 3K69A 4M3FA 2PFBA 1PVEA 5CVUA 2M8GX 5IY5H 2GLOA 2R7QA 2K27A 1YFHA 2EB7A 2ME0A 2VJ4A 2QQ9A 3GLLA 4A2UA 4B43A 3V7RA 1V4RA 3M1CA 2ME6A 4NQWA 3AKZA 1HBXG 3BG5A 4ENKA 5DD8A 2M45A 3TKYA 4IHWA 4C9YA 1VQ7I 2KHMA 4PK4A 3IL2A 2BV6A 4HSRA 5D4SA 2O8KA 1LDKB 2A6HF 1ZRCA 3VB2A 1DPRA 2QQBA 1XDSA 1FYKA 2IBDA 3PFYA 4N4NB 5K7ZA 4BXUA 3OYIA 1FMVA 3FX3A 2VOOA 2CW8A 3BR1A 1JUPA 4MFEA 2COBA 3CO6C 4ZYHA 1OISA 2E5ZA 1K78B 5TJJA 3DPTA 2VPLA 1I1GA 4MQ9F 3O3KA 1YJNI 3BTCA 1VQLI 2ELJA 2L7MP 5M3FJ 3DBRB 4G7OF 3I0TA 4RAZA 1F5TA 4NNJA 3TO9A 2ZXHA 1SFXA 3KEOA 5LFAA 2L7ZA 3ESWB 1JI8A 3LQRA 3TDUC 3QOEA 4A3DJ 1U8RA 1BOAA 4Y52J 1H9GA 3CJRB 4MFDA 1VQMI 1IDZA 3Q9SA 1FMWA 1P4WA 4XLNF 1X1DA 2DFIA 4XLPF 4I02A 1U78A 3QPLA 2A6TA 1R49A 1BBYA 1LDDA 5B1BH 3E7LA 5CPRB 3HHGA 4KIGA 2JA2A 5J40A 4CCLA 3F72A 5DCFA 3V42A 1U2WA 2NOJB 2ID6A 2LDUA 2IGMA 2WY7Q 3ZR8X 4BKXA 3JTGA 3BTIA 3JW4A 1XX5A 2DA4A 2ELKA 4A0XA 5K7FA 1BM9A 1SD4A 1XMKA 3DU6A 3RYPA 4BDZA 5F1JA 1WPKA 2VL8A 1IXRC 1I39A 1UB9A 2OU2A 2X0LA 1QZEA 3CDLA 4IHSA 2UWMA 4BE1A 2ZJRF 4A3BJ 3WE2A 4CHUA 2XUBA 4F52A 4IHVA 2VASA 4WF2A 4IPAA 4XSZF 3OYDA 3SXYA 4D5FA 4P5OA 3V8KA 3HOYJ 1P4XA 3J7AY 4OU0A 4JX6A 2M0CA 1HC8A 3I54A 3KCCA 1AKHB 4KFCA 3WG9A 4RGXA 1BL0A 2NVTJ 1OYIA 3G1LA 5L3FA 3ZQFA 1B72A 2VC0A 2ZMEC 1MJ9A 3GZ5A 3QODA 4ZDPA 4E7IA 3BR0A 1F36A 4FETA 4UXNA 2ZKZA 2AQEA 2OJED 1IUYA 5K1YA 4C2UA 2JRMA 1UAAA 2L5QA 2JVHA 4LJZF 5HDGA 4G6QA 3Q0UA 5FFZA 1AKHA 3QOPA 3ZP5A 4I0BA 3H92A 4M71A 4KNYA 1WI3A 2JSCA 3A1YA 5DCMB 2V79A 2EILH 3TW7A 4PJMA 1UMQA 2M9HA 3FKJA 3S1RJ 2XF7A 1M1EB 1P6RA 1TQPA 2DDBA 2LREA 2RDPA 3PQKA 1IN4A 1X4OA 1YYVA 2ESHA 2HXIA 3MEXA 1JT0A 4D1QA 2LMDA 2NVYJ 1C0WA 2VE9A 3OOUA 2OPTA 5E3MA 1MBGA 3WGHA 2XSDC 3ZMSA 1O3SA 3I71A 1QA6A 3N97A 5DD4A 1MKMA 1O3QA 3LSTA 2Z3YA 1WFXA 2I8DA 3S8PA 3MD2A 2M4GA 1OMIA 3TOBA 3N4MA 3BWGA 1D1CA 2ZSIB 2FEZA 3MKZA 1BW5A 2ZXWH 4NC8A 2E34A 3TW6A 4E7SA 2FSWA 4WX9A 2DODA 2FQ3A 4P96A 3BP8A 3K4CA 3DKYA 4FX4A 2E7XA 3H0GJ 4XOPA 1HSJA 1W4MA 3COAC 2CSOA 4MEXF 4M3GA 3RZDJ 1YQAA 5E8IA 4C2MJ 1FYLA 1UZCA 1UELB 9ANTA 3JRDA 3IP4B 1R36A 2NYXA 5ICFA 1W1WE 1OCPA 2HOAA 3OYGA 4RB3C 1ZN2A 1UG2A 2MBFA 1T38A 1EA3A 3ML6A 2XSJC 4KICA 1EJ9A 2E35A 1U5TC 2FOWA 4KIBA 1LFPA 4Q47A 4DYRA 2NAZA 2Y31A 5JFRA 2ELHA 1ZK8A 5KAIC 1KGSA 3Q9VA 2A6EF 1OCOH 2BY1A 1F1ZA 3VYSB 1R9TJ 5FKLA 4ZZDA 2BVLA 2F4OB 3QU6A 3DFGA 3W2WA 3HSRA 5LHHA 2E1NA 2EINH 2YPRA 4ANJA 3D5LA 2LP0A 3W6KB 2IGNA 3JRHA 2IP2A 1A35A 3GXOA 3HKZA 1R5HA 2STTA 1IXCA 3HPGA 2JJ7A 2LSOA 2PMZA 1YG2A 3E5UA 2LC2A 3TQNA 1FYMA 2VUMJ 3I4PA 2MGQA 1E0EA 1OJLA 5KHDA 2G0EA 3FMQA 2VQHA 2CQKA 5LRRA 3CTAA 2V9VA 1RC9A 1G3WA 4KMFA 1HKSA 2FF4A 2N8GA 2JVGA 3CCJI 1TL8A 3U1KA 2K9NA 4IOCF 4NB5A 5TGTA 5F0FA 5C44J 1I27A 1D5YA 2WV0A 2H27A 3VFZA 2HYFA 5FO5A 4H0EA 1R1UA 2MABA 2XKPA 2KIFA 2DJNA 3OS2A 2P7CB 2P5VA 3PSIA 1B1BA 5HDNA 4UB6C 2V1XA 2XPWA 2EK5A 2J5OA 1SVMA 2MD0A 4RMNA 4IKFA 1BI0A 3DWLE 1YE9A 4A3FJ 1ZHFA 5ICCA 3CUOA 2KKOA 2L9NA 1X58A 1VQNI 2LYCA 2XASA 2R5YA 3OYKA 3ZQLA 2GIZA 4BQAA 1YJ9I 3K4NA 3HBLA 5A2QK 1TWCJ 2WTEA 3SZPA 2RC4A 5KCMA 3NWTA 2HQAA 4IJAA 5EYRA 4MHGA 4IHTA 4PFPA 3HSFA 6PAXA 2A68F 5FFXA 3BPXA 5KK1A 5F0CA 1A04A 4BBSJ 4XLHA 5FGMA 1KQ8A 2XB0X 1LE8B 2A61A 1Y8RB 4OAYA 1TC3C 3T1BA 2WC2A 4RS8A 1FSHA 1BI1A 4XORA 4M74A 5J47A 1U8BA 2IGKA 4QTRA 4DYCA 2LY1A 2ZNZA 4L5JA 2HZDA 1T33A 3QP6A 1HW2A 1PJRA 3C3WA 3DEEA 2ZJPF 1HCRA 1MJBA 5BS6A 2GXAA 4C30A 2BY2A 1KU2A 1W5TA 1DGRM 1TWFJ 1X1PA 2L9VA 4IF4A 4U0YA 3OYLA 3D5SC 1OFCX 2M1BA 3PL8A 2JQ7A 1UFMA 4BS9A 4S05A 1H88C 3D5RC 3KP5A 2HYJA 1W0TA 4A3LJ 3SEZA 5GADJ 1ZR4A 1IDYA 4R8HA 2Q2EA 4XRSA 2F5DA 2IA1A 5F1RA 1JJ8C 3C1DA 3ECOA 2IVMA 2HVRA 3HDDA 5E3OA 4NBQA 3MKYB 3DLAA 3G6EI 1R5ID 2ZXIA 1TWHJ 2VLAA 3HSEA 2EFWA 2F6CA 3KE2A 1Z0XA 1QHGA 3F21A 5FJ8J 2DW4A 4M3BA 2QSGX 2RNGA 2FU4A 1KA8A 3MKLA 4XL9A 3VSKA 1ERDA 1YW9A 1SAUA 3HOSA 1YJWI 2P6TA 4I7HA 1T39A 3ELKA 3FBNB 5FRMA 3KZZA 3SYTA 3M4OJ 3W2AA 2XV4S 4O5VA 4F92B 2RAEA 1ZG5A 3LAJA 2MC3A 1YS6A 2X4HA 1KYWA 4HDVA 3CJQB 3T0YA 3BQZA 3DQVC 2RGVA 1D3YA 3SQNA 1ORKA 2M8EA 2V1NA 3AG2H 1NTCA 3NAUA 3MWMA 3T8TA 2KRCA 2O6GE 2F2EA 4U0VA 2FRHA 2E36A 5DYMA 2CV2A 2OC6A 1FZPB 2VKVA 2YU9J 4UUSB 3UNGC 4RB1A 1QZZA 4KYWA 1XD7A 4BACA 2FE3A 3K7AJ 4KN4X 4BQQA 2JN6A 4YFNF 1LQ1A 2PJRB 5EG0B 4BDYA 1SD6A 4HNTA 3FHNA 2M7AA 1WKMA 2LR8A 3ASOH 1MNEA 4BEHB 1Z1DA 4NDLA 4IOAF 1Z21A 3WTZA 2XDVA 1OCRH 3LL7A 2MH9A 2ACJA 5LRSA 1UJ8A 1MSEC 3GMEA 2EWNA 1D0ZA 5CYVA 3FDYA 4P55A 2E2HJ 4F7ZA 2Y9ZA 4HYEA 1YOVB 2R93J 3NEUA 1UHSA 3QP5A 4PJ0C 2YX7A 4RB0A 2KISA 1XC5A 3FKIJ 2NS0A 2PJRA 1EH6A 2F5VA 5EG0A 2XGXA 4L9TA 3HOZJ 5IT9Z 2W25A 2ADUA 4KT6A 1D0YA 5EZHA 4BEHA 1WVRA 1MJAA 2DJIA 2OZ6A 1W36D 5D4RA 3KP4A 5C4XJ 3S93A 2HQNA 1CQTA 1J0RA 2FMYA 2UUZA 2VQCA 2EFOA 2JZYA 2RREA 1QNTA 3DBHB 5HLHA 5C3EJ 3OL3A 5HLIA 1Y1VJ 2EZHA 4HDUA 3OIQA 1U9NA 1MMNA 3WHBA 4BHCA 4C3IJ 4D9JA 4RGSA 1X2MA 5GTIC 2IA0A 4BL0B 1E3HA 3IRRA 2HWVA 1OKRA 2VOPA 3W6JB 2TRTA 4YIFA 2LF7A 1VQ6I 2I5UA 1BOBA 2KZGA 1FNNA 1QVTA 2WAQA 1H0MA 1HQCA 4N4OB 2XAGA 5CQGA 1S72I 3F3XA 4XN3A 4IX7A 5M5WJ 3RDIA 2A69F 1OQYA 3IH2A 5E3LA 1XSXA 4YG2F 2IS1A 2X1CA 2H1KA 1JUMA 2WWYA 4PZJA 3VODA 3GFMA 1YX5A 4BE2A 1L0OC 2MYSA 3OIOA 1P92A 1VNDA 3B02A 4AYBN 5D5XB 1TWAJ 1VQOI 3VDXA 2R3SA 1K83J 1I5ZA 3TGNA 4EM0B 4W1UA 1Y8QB 5GTHC 3GZNB 1S9HA 4XMYA 3ABUA 3M8EA 1HW5A 1JHFA 3ASNH 1SMTA 3ULQB 5IT9K 2AQFA 3E6MA 1FTZA 1A6QA 1SFKA 2LOOA 3K4MA 4BY7J 1REPC 2X48A 4OOIA 2W4SA 1ZREA 1ZARA 2CW0F 1LNWA 3O6BB 5ILVA 1K61A 3HRMA 3CCEI 4HX8A 4XKCA 2QF7A 4UV8A 1BW6A 4DBQA 3S15J 1FTTA 2JWTA 5ICGA 4G6TB 2BGCA 3KZYA 2D1VA 3HPHA 2ZJ2A 4V2GA 2OZUA 3TP0A 5EJCA 3ZOBA 4EEFG 4X0GA 3Q0WA 1PUFA 3I3LA 3NARA 4ZYAA 1MDMB 5FROA 3CP8A 1XCVA 3KP7A 2HYGD 2PMUA 5BNGA 2CG4A 5HVQC 1HA8A 4HW0A 2M7BA 1KU3A 4LLLA 1F4KA 1JGGA 4BJ5C 3S1MJ 3LAPA 1PUEE 3K2ZA 3ZCOA 2Y75A 1DQUA 4KMUX 3WTYC 3GVAA 4BJ6C 1MW7A 1FPQA 2NS7A 2B9SA 4M3DA 2FBHA 4IQ4A 4RAGA 4BHBA 3FXMA 2WAFA 3Q3SA 3OMYA 4HRIA 5FLMJ 2O61A 3F8MA 4O6JA 2GA2A 4X1EA 4AUXA 4CSWA 4HLYA 1FIAA 3QYFA 4EATA 2XHKA 5K5RA 2AXTC 2ZO4A 4E7LA 1XGSA 4BQNA 3WGIA 1QRYA 1TT5B 1ZLJA 4Z6YA 2K7LA 1MH3A 3GZ6A 4WXHA 2ECCA 4XBFA 2K5CA 5E8GA 4P9FA 5CVRA 3JSOA 2O03A 3LSHA 2FNAA 3W6VA 2QA4I 1Y39A 1ZKGA 1QPMA 3WG7H 3I59A 3H3UA 2FOKA 1ONVA 5CLSA 5LGTA 4FTHA 3GTJJ 4ZDLA 1ETXA 4XRSG 4UB8C 3KP3A 2FD5A 1VF9A 3RPQA 1KQ0A 1HKQA 2HPMA 3MAJA 3KETA 2NRAC 1X1AA 2MFZA 5C4JJ 5BQTA 3FF5A 3OSFA 4MNUA 1YLFA 2ZXJA 3CCUI 3RI4A 1FBSA 1OYYA 3L9FA 5GPAA 4ASNA 4U7DA 1BIBA 2K40A 3J80K 3K70D 4A12A 1ZR2A 5D5WB 4UHTA 1WH7A 5L3CA 3RQIA 3SDBA 3I56I 1XCBA 1TBXA 4PSXA 1XDUA 3MVPA 1IRFA 3QWLA 2H8RA 4HF0A 4II3A 4KA4A 5CVVA 3KLOA 4UNOA 1X3WB 1FY7A 2B63J 1V5FA 5EEGA 2ZNYA 3CC2I 2W1OA 3S2DJ 4OINF 4M73A 4M6XA 4EJUA 5LGUA 1QZYA 4CZZA 4PSWA 3OSGA 2TDXA 3KEYA 1UHMA 2UXNA 4WCGA 2EZLA 3J7YJ 5HS9A 4I01A 2X85A 2VQGA 3TO6A 1BI3A 2PLYA 3ISPA 5DDGA 1OLTA 1SD7A 1IXSB 1GXQA 2HZTA 4QSHA 3HRTA 2H6BA 4BU2A 1X1BA 3DP7A 3HKZN 2P8TA 5EF6A 4HLXA 5JHUA 1IAWA 2CV0A 2PMZN 4GFBA 3U2RA 1GVDA 1HF0A 3LSKA 1E3OC 3AG4H 3OOPA 5B5EC 3S1NJ 1FOYA 1AA7A 3HHHA 5KNLA 2D1HA 2KL4A 2CUFA 5L3EA 2V6CA 1ZG1A 1WZ2A 3U21A 1VFCA 1TWGJ 4B48A 3HTSB 3CDHA 2Q0OA 4AD9A 2HU9A 2HDWA 3PM1A 2KJCA 4BQOA 1B72B 2Y69H 4CICA 3L2UA 4OMYA 2L3DA 1CF7A 3DEUA 1B59A 3S32A 4CA0A 2Q1ZB 3JRCA 1IRGA 4G9YA 2GZWA 3ABMH 2IJLA 1DU0A 2OQRA 1QHHD 4BH9A 2HR3A 3A0BC 2O0YA 1PYVA 3P5JA 2EQRA 5E79C 1Z05A 5ERIA 2NS8A 3LSIA 2HVQA 4OIQF 3RJPA 4EJTA 3K4LA 3FXQA 5L3BA 1T95A 1W5CC 4B8XA 2R7DA 4UUTA 1KU7A 2EFPA 3BQYA 2I10A 1BR2A 2VC1A 3FXJA 3MZHA 5BMZA 1G59A 1DU6A 3RKYA 2W24A 5IP6A 4PJJA 2VE8A 2L01A 5E1ZB 2MW8A 2XGDA 4HQMA 1B6AA 4Y7NJ 3IAM2 3F22A 3R0AA 3HOXJ 1HKTA 1HOMA 1O57A 3Q5FA 4F91B 2DA5A 1U0JA 1S3JA 1NG7A 4V2FA 2XAUA 1YI2I 3SHFA 2R7SA 3JRGA 1FSEA 2QENA 2M5WA 2OV7A 3QAHA 4KUMA 3GTGJ 1G3SA 2DYRH 1Q1VA 1Z77A 2CRGA 4MEYF 4EMSA 1IN5A 1FX7A 5IOYA 2NXNB 4WK8F 2ZJQF 1WRJA 1USTA 1J75A 1P7JA 1B8IB 1J5YA 1AHDP 2MG4A 4XK4A 3JCUC 3AG3H 5D5VB 3J7AO 2FXAA 4BHPA 2FA5A 1N75A 2HNHA 2WADA 2MD5A 3F0CA 3K4BA 4UY8I 1ZGJA 1X4PA 1VQ9I 3PUFA 1MBKA 2JTVA 2L7FP 5F64A 3RCOA 3IH4A 5AONA 3L7WA 5LEKA 2CU7A 3DTEA 3ZQ7A 1SAXA 1B8IA 2YS9A 2IT0A 3DU5A 1LFUP 3EETA 1FOWA 5ILSA 3CCMI 1GV5A 2RV8A 2O7OA 4QLCU 2CUZA 3A01B 4KISA 1BR4A 2M30A 4RB2C 2GBYA 4LMYA 3SEQA 2R4GA 3V7SA 1LUJB 2EFQA 3L00A 2DA3A 2WY8Q 2DAOA 2F48A 2LKSA 4HNVA 4IHYA 4MTEA 2X51A 3A02A 1QO0D 1I3AA 1R7JA 3KPHA 5K7HA 3J7ZI 2V6EA 5DUIA 5EZGA 1SVLA 1Z3YA 2F4IA 5FRNA 2EH3A 3BR6A 3LSGA 5D6FA 3PUBA 4ZC3A 1K4TA 1RIOH 1FEXA 1NH3A 3A01A 3DEWA 1WQ2A 3HM5A 1DGWY 1WJEA 2HOEA 1TP4A 5JLXA 2GXBA 1TT0A 2G9WA 2K86A 1POGA 3LWFA 2EBIA 4YFXF 3CCVI 2MLKA 4M9SA 1JTYA 3U9GA 3P7NA 1DP7P 1HXDA 2HTSA 2MH2A 3QQAA 4Y33A 2IAIA 4II2A 1J2XA 2HOTA 2K9QA 4IEJA 4UUVA 1YIJI 1YRNB 1TQIA 1XGMA 3H5NA 4XIDA 1APLC 5A2QZ 2JA5J 4OWRB 1MH4A 1JE8A 1D0XA 2QSHX 1ZGWA 4A3IJ 1XN7A 2CYYA 2Z5UA 4RAYA 4M72A 4XONA 4G94A 3K4KA 1HDDC 2B0LA 2Z2SB 1R6RA 1USSA 4ZYDA 1GHCA 2PJPA 4A3KJ 3LQQA 2VJJA 2FJ1A 5H6RA 1YRNA 1RKWA 3P9KA 4ON0A 4CZCA 1EF4A 1VQ5I 2OCEA 3E6BA 3E3VA 3NWSA 2R7XA 2FQ4A 4JP0A 3ZN0A 3GO5A 1G4DA 2ISYA 3DF8A 5JVTA 1T98A 3ERMA 1JHHA 4FQGA 1RNLA 3DXJF 3FMRA 3JREA 1H9TA 5FLXZ 1GLNA 2PQ8A 1YITI 2R5YB 1OR7A 4L9VA 2JMWA 2AS5F 1F43A 4BXXJ 1S29A 5F08A 1MIJA 1R22A 1FBUA 2VQLA 2ID3A 3QPTA 4CYCA 4UVAA 1QQIA 1TNSA 2XB5A 3TL4X 2GXGA 1G3YA 2VBWA 3RZOJ 4B47A 3ABTA 2ECBA 3QYBA 2BE5F 4A6EA 4LG3A 1W7PD 2XAFA 4BGDA 2XAHA 3MQ0A 2FBIA 1TLHB 2VKEA 3WU0A 2ISZA 1X3UA 2IPQX 4HPQA 2LK2A 5F6FA 2DQLA 3KP6A 3KEQA 3WU2C 1R58A 2GWRA 5EDNA 3F23A 1BR1A 3J81Z 5HLTA 4HF2A 1EH7A 3CJNA 3OY9A 2KMUA 3L2RA 4RAFA 3FIWA 4CO8A 4GDFA 2KIMA 4V19K 3ERED 2EJRA 1R4MB 3H9QA 3PO2J 2X1DA 4MTDA 2Q2EB 1IRXA 4KN7X 2IRFG 1X1CA 3BZKA 2IW5A 4HF1A 4A93J 1Z67A 3EUAA 4PJLA 1K6YA 2Z99A 3GFJA 2XPUA 3P9CA 3DTKA 4NUBA 1XS9A 1IN8A 2XKOA 5HS7A 2IA2A 2H6CA 1QPIA 3IV5A 5FLXK 3VSLA 3KYLA 5IT3A 3LSMA 2KP6A 3FBIB 2CH0A 3LFUA 1O4XA 3CESA 4PCQA 3OYFA 2FX0A 2X6YA 1U6GA 4M6YA 4IO9F 2HS5A 3ZXSA 3MCZA 2R7VA 5GP9A 3WODF 2R7TA 2H1LA 1MSFC 2KIQA 5E18F 1BN5A 3ZQCA 3CLOA 1E3PA 3V7CA 2VKHA 3B6AA 3BR5A 1WI9A 2MSYA 3G1OA 1B9MA 2FNPA 2HVSA 2V9PA 4FHTA 2E2IJ 2JRTA 1X3ZB 2F5EA 3BCBA 1IN6A 1E2XA 2DMQA 5CKTA 3HZJA 3PFIA 4G8XA 4HBLA 5HS8A 5HDKA 3K4JA 3CUQA 1G6NA 5J3LA 2P6SA 4XSXF 5EEHA 4LLGF 5J4YA 2HDCA 2BW3A 2QLZA 1BIAA 1GVJA 4GCVA 2BXYA 4HSTA 3J81K 4I0AA 1GT0C 1ODDA 3F6OA 2XRLA 4AIDA 3RPUD 1O7LA 3KX2A 4EGYA 2PMHA 4I2OA 3CCSI 3WGGA 2KRFA 4QPOA 1S7OA 4OIOF 3I4NJ 2L4AA 5DM7F 3FK6A 1LJ9A 3KIOA 4U87A 2AXLA 4R1HA 5JR3A 1IF1A 2W57A 2DYSH 3WHCA 2HXOA 2LKXA 2EPFA 1WJFA 1WJ5A 3FXUA 1MMAA 5HOOA 4A0YA 3I9V2 2X9DA 3OR2C 4BNCA 4Y15A 1HLVA 2ZCWA 3FZVA 1NHAA 3L2WA 1QBJA 4CCMA 2FBKA 4PFOA 3R0JA 1SD5A 2P0WA 4RM3A 3H36A 3F9KA 1RETA 4A3GJ 4MGRA 1P4AA 4I99C 1P9QC 2CQQA 2DI3A 4YFKF 5IYCJ 3P9IA 4M3EA 1T2KA 5DM6F 2PBIA 2X6XA 3B73A 1RESA 2GOXB 2QUFA 1D5VA 2UZKA 1UG0A 3LFKA 2DFEA 3BT9A 3O2PE 3BROA 1ZYRF 4IRGA 4ZJZA 1AU7A 2UXXA 3JAMK 2WV1A 3M07A 1IG7A 3WTUC 2DPUA 3QPSA 4CXFA 3E6CC 2JPBA 3K2AA 4P1WA 5FKKA 2QGUA 2HKOA 3FXLA 2AO9A 1XTAA 2QZ8A 4HX7A 4QPQA 3IWZA 1QGPA 2GAUA 2LLKA 3PNTA 4CCJA 3L09A 3RSNA 3JRBA 1RUOA 3PJRA 4I09A 1FP2A 2VIXA 3MZYA 3ECHA 2D45A 4L5EA 3CMMA 3ZMZA 3SFIA 4LB5A 2JUCA 2XAQA 5DUKA 3HJEA 5BOXA 2GQQA 2DA2A 3L2VA 1LPQA 4L9JA 2E1MB 2WB1A 4MO7A 3GEZA 4B44A 3SZGA 4EQQA 5GAGJ 1LB2A 1IZ1A 1D8KA 3H5RA 4ENMA 3V8JA 2A5YB 1I1SA 4D7NA 1KZHA 2YU3A 1G2HA 1ZRFA 2IGOA 1D1AA 1WJDA 2LH9A 4XKWA 1IO2A 2E5NA 3CO7C 3HUGA 2MLGA 2Y0SA 3F8FA 1JXSA 1X19A 1TTYA 2HQ5A 4B1RA 3C2BA 3JRAA 4ZH4F 3W3CA 1SEUA 2KPMA 2TCTA 3EPZA 3F6VA 1T08B 3ABKH 2CJJA 5GAEJ 4XLEA 1P2FA 1SMYF 4KJZA 4E7KA 1NG6A 1T6SA 2XGCA 1PUFB 3NRVA 3PNYA 3CP2A 3ZRGA 3HEFA 1OYWA 2HI3A 4YRVA 4K2EA 3BZCA 4A6DA 2KLOA 2DTZA 2EIKH 2K9SA 2D5VA 3OYNA 1OR7C 3EYIA 2ZFUA 1FOKA 3FXRA 2HKXA 3BJOA 3HGGA 3HB9A 3OR1C 4KT5C 3K9TA 1YTYA 1W0UA 3BG7A 3RKXA 2R7RA 2DXIA 3PIPF 2OUMA 5D5UB 2R5ZA 3TO7A 2P5LC 2NNNA 2FMLA 2CQXA 1LEAA 2Y2ZA 1K79A 1ZLKA 2DU9A 3J80Z 3LSJA 3KLNA 3K1MA 2LRDA 3LSPA 1JKRC 2A07F 2R7OA 5LEJA 3CC4I 4XQFA 1J9IA 4RLQA 3E5QA 2PI0A 1PP7U 1H89C 3RQ4A 4FASD 3AAFA 3IC7A 3DCFA 4AIKA 4ESFA 5F04A 4MIMA 5J6XA 2KIUA 2LG4A 5K5QA 4X6AJ 3LMMA 4YELA 1V3FA 5FB2A 1AWCA 5IP7J 3I59B 1TW2A 2HPIA 4JX4A 5J8FA 5D6EA 3BPVA 1RZ4A 3OYHA 2KRHA 3DLLF 1R23A 3AL0B 1MNMC 4HX4A 1KU9A 2QCOA 3K0LA 4Q5SF 3ZMTA 1YX3A 2V26A 1R00A 2E60A 3M1EA 4JK1X 4LGWA 2K9LA 5ILUA 2K9MA 4ZTJA 4NHJA 2K3FA 1PDNC 1OCCH 5LD2C 3S17J 1XGOA 2DPDA 2ETHA 1WSUA 2M87A 3FXKA 3RKWA 4A3CJ 1SC7A 2H09A 4I98B 3B6CA 5EGOA 2QM3A 1H8AC 3WTVC 1JUSA 4XKBA 3JR9A 2IS4A 3LA3A 3TDZC 5HNFA 1MGTA 4UV9A 3BG9A 1I6HJ 2XGEA 3K1NA 2CFOA 2L4MA 2Y48A 3HGYA 3I64A 5CVJA 1GUUA 2VT3A 2CMPA 1BC8C 3EQLF 1V5EA 3EUHA 5J1RA 1XG1A 1K7AA 5DV5A 3C2GA 3TBIA 3GX4X 1W36C 3DTIA 3VWBA 3HOTA 1IUFA 3W2VA 5LGNA 3AFHA 1XMXA 3CUQC 1JKPC 1MBEA 1MD0A 3E6DA 4HV6A 2BVMA 3BCAA 3LOCA 3CMAI 2DTRA 3HRUA 3BDDA 1LFBA 5F0HA 3TOAA 3E1SA 1UHWA 1S7EA 5H6QA 4FE4A 4LD5A 1WJCA 4RGUA 1V55H 1VI0A 1YW7A 3K1PA 1TW3A 2BXZA 5B3SH 2EIMH 1XGNA 1R1VA 4RM2A 4ZYGA 2EIJH 4ENJA 4CH7A 2V9KA 1S5LC 4OIPF 2NOGA 2RNJA 3H3VK 1YIOA 3CZ6A 3D0SA 1FJLA 1CF7B 3A03A 5IYBJ 3HL2A 4UVBA 3S16J 4E6KG 4CCKA 3V8LA 1OPCA 5H20A 1TQMA 2LFBA 4AIJA 5KAFC 4FX0A 2EZKA 1VQPI 2HQRA 2QKMB 2EA2A 1Y56A 2XF6A 5L3GA 2ESNA 4MQVA 3WE3A 4XNFA 3KZIC 3FM3A 5L3DA 3O8GA 2XROA 3A0HC 2W84A 3CF5F 4LOCA 1QU3A 1VQ8I 3GTMJ 2VN2A 4FT8A 2K3PA 3L2QA 1G8XA 1K78A 3PO3J 3O8HA 3CCYA 3FWEA 2DA1A 1UCRA 1ZH5A 3MMYB 3GUDA 3H3ZA 1S8NA 5B66C 3A2KA 1LEBA 2XC7A 2M3AA 5J8CA 2HDDA 1MMGA 2H8WA 3H35A 1JGSA 4XR6A 2JA8J 2DLLA 2L9SA 4XM3A 2XAJA 4CYDA 3WTXC 5M5YJ 1GXPA 4Y13A 2R7FA 3R4KA 3D1NI 4W97A 3CD6I 3ABLH 3TEDA 3F8NA 1SFOJ 3DKWA 4L18B 1GV2A 3L1PA 4DZJA 3G73A 4A5NA 2QVOA 5FKNA 1SANA 2OAZA 2KDOA 2VODA 1IRZA 4LIVA 4JQFA 4WXDA 5IP9J 4AYBA 2WBMA 3S2HJ 2V4JC 5E1WA 2DA6A 1ACIA 1XSDA 4D5CA 3R61A 4FCYA 2H94A 2ZSHB 3GLXA 4OAZA 1MMSA 4BBRJ 1YS7A 1U9OA 3HRSA 1S7AA 1O3TA 1KYZA 3VYUB 2E19A 1EV7A 3M3YJ 4DYQA 3HOUJ 2KDZA 2ZC2A 4KITB 3OYCA 4L0ZB 1X2NA 2BHZA 4S0HB 2CQNA 2ICWG 1ON2A 4AU7A 1J7KA 2CUJA 3M7GA 4Y3OA 2M4KA 1IW7F 1Z6TA 4Q48A 3AG1H 1MNDA 2CFXA 1RRJA 3IKTA 2DK5A 4A3EJ 4EJWA 1WHUA 3M9AA 3DKXA 2GIVA 2E1MC 4J00A 4ZZLA 1O3RA 4PDKA 2E2JJ 3A4CA 3GTLJ 1BA5A 3EYYA 4WWCA 1Y0NA 4FISA 3PIOF 1RR8C 1ENHA 4PGGA 5ICEA 5TISC 4CGZA 2JA7J 2MC4A 5LBQA 4RGRA 4AC0A 2YUSA 2IS6A 4BE0A 2LNBA 2RVCA 5JVGF 5E20A 1R71A 2CQ7A 2R7ZJ 2RQPA 5HNHA 5E1XA 1YW8A 1FIPA 4IXAA 5D8KB 2QEXI 1W7PB 3K70C 3H1CA 2VBYA 5DS9A 2K4JA 2CGPA 2EV0A 3GBGA 5DCMA 2R7UA 2OBPA 5JI6A 4HZFA 2PEXA 3N05A 3UR3C 1RUNA 1O7FA 4RBOA 5CJ9A 5CQEA 5J1UA 3CCLI 1I50J 1V54H 5D8LB 2CWEA 2LVSA 1ULYA 4A0ZA 4AWXB 1W5SA 5M5XJ 2LY2A 1ZG3A 1Y0UA 2XF5A 5DTDA 2Y0MA 3ZMDA 5IOZA 2E71A 4F3QA 5FKOA 2LY9A 1Z7LA 1ETVA 1ZELA 1W7PA 3KYCB 2VJ5A 4GO1A 3S14J 2VKDA 3BOQA 5FKMA 3ZQHA 1JKOC 3ZPLA 3C7JA 1IV6A 2DOEA 4QWQA 2QWWA 3S3OA 1STZA 1A31A 2Z9OA 3RKQA 3SDGA 3CMYA 1HW1A 1MBJA 3FISA 2OTLI 2CS3A 2VXZA 4GYIA 1S6LA 3BJAA 2W48A 2DDAA 4YEJA 4OIRF 2W85A 3M8FA 3FHZA 4E7ZA 1CGPA 4WXCA 4EJOA 5M3MJ 1LVKA 2K85A 4DNCA 3FM5A 3S3MA 2DT5A 2X1EA 5LLQA 3DPLC 3AL0C 2B7EA 3HYIA 4HOBA 4IL6C 2FUG2 4GGGA 4HA8A 4HEA2 4CYCB 1YHQI 2STWA 1T0FA 2W82A 2DT6A 3EUKL 4HAMA 3QU3A 1Y6IA 4XKVA 2AHQA 1HSTA 1R1TA 2LBFB 2GA1A 2MA3A 3F8CA 2Q8KA 2NNYA 5FLVA 1Z91A 5KVRA 1SFUA 3EUHC 4ESJA 4C3JJ 1WH5A 4JBAA 4B3XA 1ITYA 2LKPA 3CMEI 1ETKA 1P7IA 1LVAA 2WB1N 2LTPA 1HDPA 3H5AA 2QQAA 2D2WA 3HOVJ 2EFNA 3KYDB 1Z9CA 2F5FA 4JOMA 4R79A 2VONA 2EZIA 2QQ8A 1FC3A 2VXDA 2XIGA 2RN7A 2EV6A 4N9IA 4EGZA 4HQEA 3VEPA 1KQ9A 5EEAA 2WAQN 4BYYA 3VYRB 2HGCA 2LBFA 1N25A 5J1YA 1DUXC 3GTOJ 2JK3A 4E7JA 2DMUA 1E17A 1Z7UA 3WU1B 3RPUA 2Y0SN 4CUGA 1VTNC 4PJNA 2DMTA 3ZMVA 5GPCA 1MZBA 3HC7A 2OTJI 2YR2A 5LHGA 3IRQA 3OS0A 1Z3XA 3PNVA 4D7MA 5E17F 2GOMA 3WTSC 3UKGA 1T56A 1FOXA 3HTUA 2O9LA 2QKLB 3GWZA 3G2BA 4Z2YA 2KFDA 3RYRA 1IN7A 1K6OA 2BY0A 3CQZJ 3F8BA 3OIPA 1DDNA 1VQKI 2DN0A 3GTKJ 4AIHA 3OYAA 4Y4RA 4HV5A 3BLYA 4KDPA 1WJAA 2NVXJ 2J5PA 3KP2A 3OYJA 3OYEA 1D8JA 1WJBA 4GXOA 2XRNA 2IS2A 4GRIA 2LF8A 3G4SI 1BC7C 1A36A 1T8IA 1NK3P 5LHIA 2VB6A 4M9ZA 1SFEA 5DEQA 3CUQB 2ZFWA 4BUPA 4BAYA 4D0PA 1OCZH 1XMAA 2PN6A 1MBFA 2F4MB 4IZZA 3HXLA 2YX4A 4JX5A 2BW3B 2L54A 4DZPA 4G7HF 5GAHJ 1EH8A 3BR2A 4A69C 4IQJA 3OL4A 3ONQA 4U7BA 5E3NA 3IWFA 3GFIA 1J59A 1FBQA 1XPXA 1BJAA 1FT9A 4LG0B 2HFHA 3GF2A
chains in the Genus database with same CATH topology
2XGCA 3JRDA 3BR3A 3HKZN 2GM4A 4MLOA 1G2HA 5EF6A 1LE8A 3HEFA 2L0KA 1IC8A 2PMZN 4GFBA 1OCPA 2HI3A 1GVDA 1HF0A 2HOAA 2DTZA 2VI6A 1E3OC 2K9SA 3S1NJ 1A5JA 5IYDJ 1UG2A 2D5VA 5F27A 1QVUA 1IGNA 5IPAA 1OCTC 2DA7A 2CUFA 3FK7A 3HGGA 3HB9A 1VFCA 1W0UA 1TWGJ 1ZTRA 2XPVA 4DYRA 3JRFA 2Y31A 3PM1A 1I3QJ 2R5ZA 1B72B 1ZK8A 4XICA 2CQXA 2Y2ZA 3JRCA 4J19A 1DU0A 3LSJA 1R9TJ 5FKLA 3LSPA 2Y9YA 3LNQA 1JKRC 4BY1J 2X6OA 2EQRA 1H89C 2NS8A 2M2EA 2LP0A 3JRHA 4FE7A 3DCFA 1JT6A 5F04A 4MIMA 2JA6J 3BG3A 4UUTA 4X6AJ 2JJ7A 3BTLA 2VUMJ 3BQYA 2I10A 2MGQA 5IP7J 3ZQIA 1OJLA 4JX4A 4I6ZA 3TP3A 2G0EA 1ETQA 1MNMC 1WCMJ 1DU6A 2N8GA 5IP6A 3LSRA 2QCOA 2K9NA 2MW8A 2XGDA 5F0FA 4Y7NJ 5C44J 4B3AA 1D5YA 3HOXJ 1HOMA 2DA5A 3GTPJ 4I76A 3S17J 2DJNA 4V2FA 2ZB9A 3Q0VA 4QIWN 3JRGA 2XPWA 4A3CJ 3GTGJ 1H8AC 1Q1VA 1Z77A 2CRGA 3B6CA 5EGOA 1JUSA 1WGXA 3JR9A 4A3FJ 5IOYA 4UUSA 3HOWJ 4XRMA 3BG9A 1X58A 1I6HJ 2XGEA 1B8IB 1P7JA 4ABZA 2R5YA 3BTJA 2Y30A 1AHDP 4IHXA 2IEKA 3HGYA 2MG4A 4A3JJ 3ZQLA 3HBLA 1GUUA 4XK4A 1TWCJ 3GTQJ 5HODA 5J1RA 1XG1A 2M34A 3JRIA 1MBHA 5EYRA 2R0QC 3F0CA 1RR7A 1IUFA 1MBKA 5F0CA 2KT0A 1JKPC 1MBEA 2L7FP 4BBSJ 3IH4A 2XB0X 2CU7A 1LE8B 3LOCA 1B8IA 2YS9A 1TC3C 1LFBA 5F0HA 4DW6A 1LFUP 3VPRA 1S7EA 1U8BA 1ETWA 1GV5A 4QTRA 2O7OA 4FE4A 4DYCA 3A01B 1T33A 1RKTA 2GBYA 1VI0A 1GDTA 1HCRA 2DA3A 4HNVA 2E1OA 4IHYA 1TWFJ 3A02A 2DMPA 1OFCX 5K7HA 2NOGA 2R5ZB 3H3VK 5JLWA 1JJ6C 1H88C 1FJLA 1A6IA 3A03A 5IYBJ 5EZGA 2HYJA 3S16J 1W0TA 4A3LJ 2EH3A 3BR6A 3LSGA 2L9RA 1ZR4A 1IDYA 1RPWA 1IJWC 2LFBA 1FEXA 2EZKA 4XRSA 1JJ8C 3A01A 3DEWA 3HM5A 3HDDA 5JLXA 5E3OA 2HOSA 1POGA 3O8GA 2EBIA 4LOCA 1TWHJ 1JTYA 3GTMJ 1Z0XA 4G12A 3QQAA 5FJ8J 3S1QJ 2IAIA 2HOTA 3PO3J 4M3BA 2K9QA 3SJMA 3O8HA 4IEJA 1YRNB 3MKLA 3CCYA 4XIDA 2DA1A 1APLC 2JA5J 1BJZA 1MH4A 1ZGWA 2NVQJ 4A3IJ 1Y1WJ 3M4OJ 2HDDA 4RDUA 2RAEA 2OF7A 1HDDC 3MN2A 2JA8J 2LD5A 5M5YJ 1ZQ3P 3BQZA 3D1NI 4W97A 4A3KJ 3ZQGA 2VPRA 3TEDA 1ORKA 1SFOJ 1GV2A 2FJ1A 1YRNA 4B4CA 1NTCA 1JTXA 3NAUA 4DZJA 1RKWA 3L1PA 5FKNA 1SANA 1IRZA 1EF4A 5EGOB 5IP9J 2FQ4A 4JP0A 3S2HJ 4JYKA 2VKVA 2DA6A 2YU9J 4UUSB 2CUEA 4D5CA 2R92J 3JREA 4FCYA 3K7AJ 2JN6A 4BBRJ 3G1MA 2R5YB 1U9OA 5EG0B 2JMWA 3I4MJ 1F43A 4BXXJ 2E19A 5F08A 1JKQC 1ETYA 4DYQA 2LR8A 3HOUJ 3M3YJ 2KDZA 4A3MJ 4NDLA 2ID3A 1X2NA 2P81A 4S0HB 1NK2P 4CYCA 1MSEC 2DMNA 2XB5A 3RZOJ 2E2HJ 2Y9ZA 2ECBA 2R93J 1UHSA 4C3HJ 4A3EJ 1XC5A 3FKIJ 2E2JJ 1ETOA 3GTLJ 2VKEA 5EG0A 4M6VA 1BA5A 3HOZJ 3IH3A 4M3FA 5EZHA 2LK2A 4FISA 2M8GX 1ENHA 2GLOA 2ME0A 2JA7J 5C4XJ 2ME6A 5EDNA 4AC0A 2YUSA 1CQTA 3BG5A 4IHWA 3FIWA 2R7ZJ 5C3EJ 3PO2J 2O8KA 1Y1VJ 2EZHA 1FIPA 1U9NA 3WHBA 4C3IJ 1X2MA 5DS9A 3GBGA 4A93J 2IBDA 5K7ZA 2TRTA 2XPUA 1XS9A 3BR1A 1JUPA 4MFEA 2COBA 4RBOA 1QVTA 5J1UA 3IV5A 1QPIA 1I50J 2LVSA 5M5WJ 3BTCA 5M5XJ 1O4XA 3IH2A 5E3LA 2L7MP 5DTDA 5IOZA 5M3FJ 2H1KA 5FKOA 2LY9A 1JUMA 2FX0A 1ETVA 5GP9A 1MSFC 3OIOA 1VNDA 3S14J 4AYBN 3ZQCA 5FKMA 3ZQHA 1JKOC 1TWAJ 2L7ZA 1IV6A 3B6AA 3BR5A 2MSYA 3G1OA 4A3DJ 1K83J 2E2IJ 4W1UA 3RKQA 3SDGA 4Y52J 3CMYA 4MFDA 3FISA 1MBJA 1IDZA 2DMQA 1FTZA 4BY7J 2W48A 1U78A 3QPLA 2X48A 5J3LA 3E7LA 1K61A 2ID6A 2QF7A 4BKXA 1BW6A 1GT0C 3S15J 3BTIA 5M3MJ 1FTTA 2XRLA 2JWTA 2ELKA 2DA4A 5K7FA 4V2GA 3TP0A 4EEFG 3ZOBA 1WPKA 5F1JA 1PUFA 3Q0WA 3NARA 3I4NJ 3FK6A 3CDLA 4CYCB 4A3BJ 5BNGA 3WHCA 2HXOA 4IHVA 2LKXA 1JGGA 3S1MJ 2AHQA 4D5FA 3HOYJ 2X9DA 4JX6A 1HLVA 2M0CA 5FLVA 1AKHB 2NS7A 4C3JJ 4M3DA 1WH5A 1BL0A 2NVTJ 3G1LA 1ITYA 3ZQFA 1B72A 1ETKA 1P7IA 3Q3SA 5FLMJ 2WB1N 2LTPA 1RETA 1HDPA 4X1EA 4AUXA 3HOVJ 4A3GJ 1FIAA 2CQQA 5IYCJ 3BR0A 1F36A 2EZIA 4M3EA 1RESA 1QRYA 5EEAA 2WAQN 5J1YA 1MH3A 2ECCA 3BT9A 3Q0UA 3GTOJ 1AKHA 2JK3A 1AU7A 2DMUA 3W6VA 2WV1A 1IG7A 2Y0SN 1WI3A 3QPSA 1ZKGA 2DMTA 3K2AA 3TW7A 1UMQA 2M9HA 5FKKA 5GPCA 4FTHA 3S1RJ 3GTJJ 2AO9A 1ETXA 2HXIA 4XRSG 1JT0A 2FD5A 1VF9A 2LLKA 3JRBA 2NVYJ 3OOUA 4D7MA 2OPTA 5C4JJ 5E3MA 3UKGA 1T56A 4L5EA 1MBGA 2O9LA 2XSDC 3SFIA 3OSFA 3CQZJ 2DA2A 2DN0A 3GTKJ 4MO7A 5GPAA 2K40A 1ZR2A 1WH7A 2NVXJ 3RQIA 3MVPA 4D7NA 2H8RA 1BW5A 3TW6A 1NK3P 2B63J 3H0GJ 3S2DJ 1MBFA 3OSGA 4JX5A 4DZPA 2HQ5A 2EZLA 3BR2A 4A69C 4B1RA 3C2BA 3JRAA 4M3GA 3RZDJ 5E3NA 4C2MJ 2TCTA 2CJJA 4QSHA 9ANTA 1PUFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGC A;  3JRD A;  3BR3 A;  3HKZ N;  2GM4 A;  4MLO A;  1G2H A;  5EF6 A;  1LE8 A;  3HEF A;  2L0K A;  1IC8 A;  2PMZ N;  4GFB A;  1OCP A;  2HI3 A;  1GVD A;  1HF0 A;  2HOA A;  2DTZ A;  2VI6 A;  1E3O C;  2K9S A;  3S1N J;  1A5J A;  5IYD J;  1UG2 A;  2D5V A;  5F27 A;  1QVU A;  1IGN A;  5IPA A;  1OCT C;  2DA7 A;  2CUF A;  3FK7 A;  3HGG A;  3HB9 A;  1VFC A;  1W0U A;  1TWG J;  1ZTR A;  2XPV A;  4DYR A;  3JRF A;  2Y31 A;  3PM1 A;  1I3Q J;  2R5Z A;  1B72 B;  1ZK8 A;  4XIC A;  2CQX A;  2Y2Z A;  3JRC A;  4J19 A;  1DU0 A;  3LSJ A;  1R9T J;  5FKL A;  3LSP A;  2Y9Y A;  3LNQ A;  1JKR C;  4BY1 J;  2X6O A;  2EQR A;  1H89 C;  2NS8 A;  2M2E A;  2LP0 A;  3JRH A;  4FE7 A;  3DCF A;  1JT6 A;  5F04 A;  4MIM A;  2JA6 J;  3BG3 A;  4UUT A;  4X6A J;  2JJ7 A;  3BTL A;  2VUM J;  3BQY A;  2I10 A;  2MGQ A;  5IP7 J;  3ZQI A;  1OJL A;  4JX4 A;  4I6Z A;  3TP3 A;  2G0E A;  1ETQ A;  1MNM C;  1WCM J;  1DU6 A;  2N8G A;  5IP6 A;  3LSR A;  2QCO A;  2K9N A;  2MW8 A;  2XGD A;  5F0F A;  4Y7N J;  5C44 J;  4B3A A;  1D5Y A;  3HOX J;  1HOM A;  2DA5 A;  3GTP J;  4I76 A;  3S17 J;  2DJN A;  4V2F A;  2ZB9 A;  3Q0V A;  4QIW N;  3JRG A;  2XPW A;  4A3C J;  3GTG J;  1H8A C;  1Q1V A;  1Z77 A;  2CRG A;  3B6C A;  5EGO A;  1JUS A;  1WGX A;  3JR9 A;  4A3F J;  5IOY A;  4UUS A;  3HOW J;  4XRM A;  3BG9 A;  1X58 A;  1I6H J;  2XGE A;  1B8I B;  1P7J A;  4ABZ A;  2R5Y A;  3BTJ A;  2Y30 A;  1AHD P;  4IHX A;  2IEK A;  3HGY A;  2MG4 A;  4A3J J;  3ZQL A;  3HBL A;  1GUU A;  4XK4 A;  1TWC J;  3GTQ J;  5HOD A;  5J1R A;  1XG1 A;  2M34 A;  3JRI A;  1MBH A;  5EYR A;  2R0Q C;  3F0C A;  1RR7 A;  1IUF A;  1MBK A;  5F0C A;  2KT0 A;  1JKP C;  1MBE A;  2L7F P;  4BBS J;  3IH4 A;  2XB0 X;  2CU7 A;  1LE8 B;  3LOC A;  1B8I A;  2YS9 A;  1TC3 C;  1LFB A;  5F0H A;  4DW6 A;  1LFU P;  3VPR A;  1S7E A;  1U8B A;  1ETW A;  1GV5 A;  4QTR A;  2O7O A;  4FE4 A;  4DYC A;  3A01 B;  1T33 A;  1RKT A;  2GBY A;  1VI0 A;  1GDT A;  1HCR A;  2DA3 A;  4HNV A;  2E1O A;  4IHY A;  1TWF J;  3A02 A;  2DMP A;  1OFC X;  5K7H A;  2NOG A;  2R5Z B;  3H3V K;  5JLW A;  1JJ6 C;  1H88 C;  1FJL A;  1A6I A;  3A03 A;  5IYB J;  5EZG A;  2HYJ A;  3S16 J;  1W0T A;  4A3L J;  2EH3 A;  3BR6 A;  3LSG A;  2L9R A;  1ZR4 A;  1IDY A;  1RPW A;  1IJW C;  2LFB A;  1FEX A;  2EZK A;  4XRS A;  1JJ8 C;  3A01 A;  3DEW A;  3HM5 A;  3HDD A;  5JLX A;  5E3O A;  2HOS A;  1POG A;  3O8G A;  2EBI A;  4LOC A;  1TWH J;  1JTY A;  3GTM J;  1Z0X A;  4G12 A;  3QQA A;  5FJ8 J;  3S1Q J;  2IAI A;  2HOT A;  3PO3 J;  4M3B A;  2K9Q A;  3SJM A;  3O8H A;  4IEJ A;  1YRN B;  3MKL A;  3CCY A;  4XID A;  2DA1 A;  1APL C;  2JA5 J;  1BJZ A;  1MH4 A;  1ZGW A;  2NVQ J;  4A3I J;  1Y1W J;  3M4O J;  2HDD A;  4RDU A;  2RAE A;  2OF7 A;  1HDD C;  3MN2 A;  2JA8 J;  2LD5 A;  5M5Y J;  1ZQ3 P;  3BQZ A;  3D1N I;  4W97 A;  4A3K J;  3ZQG A;  2VPR A;  3TED A;  1ORK A;  1SFO J;  1GV2 A;  2FJ1 A;  1YRN A;  4B4C A;  1NTC A;  1JTX A;  3NAU A;  4DZJ A;  1RKW A;  3L1P A;  5FKN A;  1SAN A;  1IRZ A;  1EF4 A;  5EGO B;  5IP9 J;  2FQ4 A;  4JP0 A;  3S2H J;  4JYK A;  2VKV A;  2DA6 A;  2YU9 J;  4UUS B;  2CUE A;  4D5C A;  2R92 J;  3JRE A;  4FCY A;  3K7A J;  2JN6 A;  4BBR J;  3G1M A;  2R5Y B;  1U9O A;  5EG0 B;  2JMW A;  3I4M J;  1F43 A;  4BXX J;  2E19 A;  5F08 A;  1JKQ C;  1ETY A;  4DYQ A;  2LR8 A;  3HOU J;  3M3Y J;  2KDZ A;  4A3M J;  4NDL A;  2ID3 A;  1X2N A;  2P81 A;  4S0H B;  1NK2 P;  4CYC A;  1MSE C;  2DMN A;  2XB5 A;  3RZO J;  2E2H J;  2Y9Z A;  2ECB A;  2R93 J;  1UHS A;  4C3H J;  4A3E J;  1XC5 A;  3FKI J;  2E2J J;  1ETO A;  3GTL J;  2VKE A;  5EG0 A;  4M6V A;  1BA5 A;  3HOZ J;  3IH3 A;  4M3F A;  5EZH A;  2LK2 A;  4FIS A;  2M8G X;  1ENH A;  2GLO A;  2ME0 A;  2JA7 J;  5C4X J;  2ME6 A;  5EDN A;  4AC0 A;  2YUS A;  1CQT A;  3BG5 A;  4IHW A;  3FIW A;  2R7Z J;  5C3E J;  3PO2 J;  2O8K A;  1Y1V J;  2EZH A;  1FIP A;  1U9N A;  3WHB A;  4C3I J;  1X2M A;  5DS9 A;  3GBG A;  4A93 J;  2IBD A;  5K7Z A;  2TRT A;  2XPU A;  1XS9 A;  3BR1 A;  1JUP A;  4MFE A;  2COB A;  4RBO A;  1QVT A;  5J1U A;  3IV5 A;  1QPI A;  1I50 J;  2LVS A;  5M5W J;  3BTC A;  5M5X J;  1O4X A;  3IH2 A;  5E3L A;  2L7M P;  5DTD A;  5IOZ A;  5M3F J;  2H1K A;  5FKO A;  2LY9 A;  1JUM A;  2FX0 A;  1ETV A;  5GP9 A;  1MSF C;  3OIO A;  1VND A;  3S14 J;  4AYB N;  3ZQC A;  5FKM A;  3ZQH A;  1JKO C;  1TWA J;  2L7Z A;  1IV6 A;  3B6A A;  3BR5 A;  2MSY A;  3G1O A;  4A3D J;  1K83 J;  2E2I J;  4W1U A;  3RKQ A;  3SDG A;  4Y52 J;  3CMY A;  4MFD A;  3FIS A;  1MBJ A;  1IDZ A;  2DMQ A;  1FTZ A;  4BY7 J;  2W48 A;  1U78 A;  3QPL A;  2X48 A;  5J3L A;  3E7L A;  1K61 A;  2ID6 A;  2QF7 A;  4BKX A;  1BW6 A;  1GT0 C;  3S15 J;  3BTI A;  5M3M J;  1FTT A;  2XRL A;  2JWT A;  2ELK A;  2DA4 A;  5K7F A;  4V2G A;  3TP0 A;  4EEF G;  3ZOB A;  1WPK A;  5F1J A;  1PUF A;  3Q0W A;  3NAR A;  3I4N J;  3FK6 A;  3CDL A;  4CYC B;  4A3B J;  5BNG A;  3WHC A;  2HXO A;  4IHV A;  2LKX A;  1JGG A;  3S1M J;  2AHQ A;  4D5F A;  3HOY J;  2X9D A;  4JX6 A;  1HLV A;  2M0C A;  5FLV A;  1AKH B;  2NS7 A;  4C3J J;  4M3D A;  1WH5 A;  1BL0 A;  2NVT J;  3G1L A;  1ITY A;  3ZQF A;  1B72 A;  1ETK A;  1P7I A;  3Q3S A;  5FLM J;  2WB1 N;  2LTP A;  1RET A;  1HDP A;  4X1E A;  4AUX A;  3HOV J;  4A3G J;  1FIA A;  2CQQ A;  5IYC J;  3BR0 A;  1F36 A;  2EZI A;  4M3E A;  1RES A;  1QRY A;  5EEA A;  2WAQ N;  5J1Y A;  1MH3 A;  2ECC A;  3BT9 A;  3Q0U A;  3GTO J;  1AKH A;  2JK3 A;  1AU7 A;  2DMU A;  3W6V A;  2WV1 A;  1IG7 A;  2Y0S N;  1WI3 A;  3QPS A;  1ZKG A;  2DMT A;  3K2A A;  3TW7 A;  1UMQ A;  2M9H A;  5FKK A;  5GPC A;  4FTH A;  3S1R J;  3GTJ J;  2AO9 A;  1ETX A;  2HXI A;  4XRS G;  1JT0 A;  2FD5 A;  1VF9 A;  2LLK A;  3JRB A;  2NVY J;  3OOU A;  4D7M A;  2OPT A;  5C4J J;  5E3M A;  3UKG A;  1T56 A;  4L5E A;  1MBG A;  2O9L A;  2XSD C;  3SFI A;  3OSF A;  3CQZ J;  2DA2 A;  2DN0 A;  3GTK J;  4MO7 A;  5GPA A;  2K40 A;  1ZR2 A;  1WH7 A;  2NVX J;  3RQI A;  3MVP A;  4D7N A;  2H8R A;  1BW5 A;  3TW6 A;  1NK3 P;  2B63 J;  3H0G J;  3S2D J;  1MBF A;  3OSG A;  4JX5 A;  4DZP A;  2HQ5 A;  2EZL A;  3BR2 A;  4A69 C;  4B1R A;  3C2B A;  3JRA A;  4M3G A;  3RZD J;  5E3N A;  4C2M J;  2TCT A;  2CJJ A;  4QSH A;  9ANT A;  1PUF B; 
#chains in the Genus database with same CATH topology
 2GM4 A;  3BR3 A;  4MLO A;  3OYB A;  1LE8 A;  4NC7 A;  4L9N A;  4ZDO A;  2DFF A;  2L0K A;  2RKH A;  1IC8 A;  2DBB A;  4M9X A;  4ETS A;  4TV7 A;  3ROU A;  1SVO A;  4UVC A;  3JAM Z;  5BPD A;  1LDJ A;  2VI6 A;  1A5J A;  5IYD J;  1K4S A;  5F27 A;  3ZGK A;  3H0D A;  1QVU A;  5ED4 A;  3OYM A;  1IGN A;  5IPA A;  4E70 A;  2DA7 A;  1OCT C;  3FK7 A;  2JUG A;  4J01 A;  1ZTR A;  2XPV A;  3CCR I;  2JT1 A;  2HEO A;  1BI2 A;  3SZT A;  4XOT A;  3GFL A;  3JRF A;  5BPI A;  2HTJ A;  2DFH A;  1I3Q J;  4LG0 A;  3NQO A;  2NVU B;  4S04 A;  1ZAO A;  2A5W A;  3X2Q H;  4XIC A;  4DOZ A;  2V1U A;  4YIR X;  3LA7 A;  2DQR A;  4J19 A;  4ZYE A;  2Y9Y A;  3LNQ A;  3HG9 A;  2X6O A;  5AIP A;  4F55 A;  4BY1 J;  3JTH A;  4XLC A;  1FP1 D;  3CF2 A;  2X6W A;  2M2E A;  2OCC H;  4FE7 A;  1JT6 A;  1TNT A;  1R5G A;  3ZN1 A;  2JA6 J;  3BG3 A;  4L0Y B;  3G71 I;  4C2T A;  3BTL A;  5TRD A;  3OWT A;  4H4K C;  3CLQ A;  2OD5 A;  3ZQI A;  4I6Z A;  4ZTF A;  3TP3 A;  2JSP A;  2DOA A;  2P7V B;  1ETQ A;  4U0W A;  2XVC A;  3ZQQ A;  1TZL A;  1WCM J;  1ZRD A;  3LSR A;  1DP3 A;  1YO5 C;  1MMD A;  3GW2 A;  3QPH A;  2Z1D A;  4BXF A;  2V1D A;  4B3A A;  2PG4 A;  4DIQ A;  3GTP J;  3DBL B;  4RA2 A;  4I76 A;  3KFW X;  5AIQ A;  1IV8 A;  2BBY A;  2O8X A;  1R4N B;  2WAE A;  3PSF A;  4G6D A;  3E0J B;  2ZB9 A;  3Q0V A;  4QIW N;  3OV8 A;  3K6G A;  2M0M A;  2KZV A;  2ZME B;  3R6S A;  3T8R A;  2EV5 A;  2BZT A;  2KQR A;  1WGX A;  4E4H A;  3SFZ A;  4UUS A;  2L7K A;  3HOW J;  4XRM A;  2KJB A;  5FD5 A;  2QBY B;  3DV8 A;  4LK0 F;  4ABZ A;  3BTJ A;  1D1B A;  2Y30 A;  4IHX A;  2IEK A;  2UV1 A;  3HUG B;  4A3J J;  3I53 A;  4ESB A;  4IRI A;  3TMO A;  3QRF F;  3EDP A;  2DK8 A;  3GTQ J;  2P5K A;  2VJI A;  5HOD A;  4CCO A;  3H9G A;  2M34 A;  4EJV A;  1MBH A;  3BZ6 A;  3JRI A;  2R0Q C;  4N9H A;  4LFU A;  4XLA A;  1RR7 A;  2ZME A;  1N77 A;  3CC7 I;  1AOY A;  3PQJ A;  2KT0 A;  2EA4 A;  4LB6 B;  3BJ6 A;  4LLN A;  3IUO A;  3H9J A;  3LA2 A;  4LIT A;  4EM1 A;  4E7H A;  2W7N A;  4ENN A;  2QBY A;  3E97 A;  1RI7 A;  4KIF A;  4DW6 A;  4HNU A;  3VPR A;  3ZMU A;  2CO5 A;  1ETW A;  4ITV A;  1Q1H A;  2F5C A;  2JPC A;  1VZ0 A;  1B4A A;  3IKV A;  1RKT A;  3S2W A;  1Z6R A;  2QSF X;  3CCQ I;  4OMZ A;  3BY6 A;  1F9N A;  3C2H A;  3K10 A;  1GDT A;  4GYG A;  1ZGA A;  3REO A;  1XB4 A;  1L3L A;  1I6X A;  2E1O A;  1B9N A;  4L5I A;  2K4B A;  2DMP A;  5J4V A;  2BY3 A;  2O3F A;  3HIF A;  2R5Z B;  4PGH A;  4DGW B;  3DPU A;  5JLW A;  3L2C A;  1T0F C;  4A5M A;  4DQ2 A;  4EV0 A;  5B1A H;  1JJ6 C;  1A6I A;  3GYH X;  4HG2 A;  4CDG A;  2Z33 A;  2L9R A;  1IJW C;  1RPW A;  5CVI A;  2G7U A;  3I5U A;  3M8J A;  4P9U A;  4LK1 F;  4XLF A;  3VYT B;  5JHF A;  3MFK A;  2HOS A;  1KON A;  3FXO A;  4G12 A;  2ZBK A;  4IVN A;  3S3N A;  3CJT B;  4EVI A;  4F93 B;  2P4W A;  3MKW B;  3S1Q J;  3SJM A;  5FD6 A;  3V4G A;  4DJA A;  2IXS A;  3CDI A;  4LIU A;  1BJZ A;  2DOF A;  3BC8 A;  2K02 A;  4NC6 A;  2L02 A;  2COM A;  2Z16 A;  3U1D A;  2NVQ J;  3MZ8 A;  3I58 A;  2DO7 A;  3WTT C;  2CW7 A;  2BOL A;  2DCE A;  1Y1W J;  2R7W A;  3GCM A;  4XN0 A;  4RDU A;  4AVP A;  4N0B A;  3OS1 A;  2OF7 A;  3MN2 A;  2LD5 A;  1EKE A;  1ZQ3 P;  3T5X A;  1PP8 F;  1U5T B;  2L2O A;  3ZQG A;  2WA0 A;  1DPU A;  2VPR A;  2VBX A;  2DT7 B;  2VT2 A;  3VOE A;  2QYO A;  2BYV E;  4B4C A;  1JTX A;  2O5R A;  2E1C A;  2A3S A;  1FLI A;  4AVZ A;  5K5O A;  4O3M A;  4Q4Z F;  4RLF A;  5EGO B;  4G7Z F;  1U3E M;  2CV1 A;  4JYK A;  2OQG A;  4PUS A;  4U88 A;  2BHY A;  2YSR A;  3QYE A;  3G3Z A;  1ON1 A;  2CUE A;  2R92 J;  4YII A;  2V7F A;  3G1M A;  1N78 A;  3E5X A;  3I4M J;  3FMS A;  2PX9 A;  1V5G A;  1U5T A;  1JKQ C;  1G3T A;  1ETY A;  1FWZ A;  4A3M J;  3WTW C;  4DBR A;  4AM3 A;  2G7H A;  3IHU A;  4CCN A;  5HLG A;  1MDM A;  2P81 A;  4EM2 A;  2VBZ A;  4XRF A;  5H2F C;  1NK2 P;  4IRH A;  1VQ4 I;  2DMN A;  4NQW B;  2E7W A;  3R60 A;  2W00 A;  1LKX A;  1XSV A;  3I55 I;  4B09 A;  3IAS 2;  3RIR A;  1WWX A;  4C3H J;  1J09 A;  3JSP A;  3C18 A;  3BG6 A;  2A05 A;  1ETO A;  4BJT A;  2C6Y A;  2BEO A;  4Y17 A;  2OA4 A;  4M6V A;  3RTR A;  2RQQ A;  3IH3 A;  3K69 A;  4M3F A;  2PFB A;  1PVE A;  5CVU A;  2M8G X;  5IY5 H;  2GLO A;  2R7Q A;  2K27 A;  1YFH A;  2EB7 A;  2ME0 A;  2VJ4 A;  2QQ9 A;  3GLL A;  4A2U A;  4B43 A;  3V7R A;  1V4R A;  3M1C A;  2ME6 A;  4NQW A;  3AKZ A;  1HBX G;  3BG5 A;  4ENK A;  5DD8 A;  2M45 A;  3TKY A;  4IHW A;  4C9Y A;  1VQ7 I;  2KHM A;  4PK4 A;  3IL2 A;  2BV6 A;  4HSR A;  5D4S A;  2O8K A;  1LDK B;  2A6H F;  1ZRC A;  3VB2 A;  1DPR A;  2QQB A;  1XDS A;  1FYK A;  2IBD A;  3PFY A;  4N4N B;  5K7Z A;  4BXU A;  3OYI A;  1FMV A;  3FX3 A;  2VOO A;  2CW8 A;  3BR1 A;  1JUP A;  4MFE A;  2COB A;  3CO6 C;  4ZYH A;  1OIS A;  2E5Z A;  1K78 B;  5TJJ A;  3DPT A;  2VPL A;  1I1G A;  4MQ9 F;  3O3K A;  1YJN I;  3BTC A;  1VQL I;  2ELJ A;  2L7M P;  5M3F J;  3DBR B;  4G7O F;  3I0T A;  4RAZ A;  1F5T A;  4NNJ A;  3TO9 A;  2ZXH A;  1SFX A;  3KEO A;  5LFA A;  2L7Z A;  3ESW B;  1JI8 A;  3LQR A;  3TDU C;  3QOE A;  4A3D J;  1U8R A;  1BOA A;  4Y52 J;  1H9G A;  3CJR B;  4MFD A;  1VQM I;  1IDZ A;  3Q9S A;  1FMW A;  1P4W A;  4XLN F;  1X1D A;  2DFI A;  4XLP F;  4I02 A;  1U78 A;  3QPL A;  2A6T A;  1R49 A;  1BBY A;  1LDD A;  5B1B H;  3E7L A;  5CPR B;  3HHG A;  4KIG A;  2JA2 A;  5J40 A;  4CCL A;  3F72 A;  5DCF A;  3V42 A;  1U2W A;  2NOJ B;  2ID6 A;  2LDU A;  2IGM A;  2WY7 Q;  3ZR8 X;  4BKX A;  3JTG A;  3BTI A;  3JW4 A;  1XX5 A;  2DA4 A;  2ELK A;  4A0X A;  5K7F A;  1BM9 A;  1SD4 A;  1XMK A;  3DU6 A;  3RYP A;  4BDZ A;  5F1J A;  1WPK A;  2VL8 A;  1IXR C;  1I39 A;  1UB9 A;  2OU2 A;  2X0L A;  1QZE A;  3CDL A;  4IHS A;  2UWM A;  4BE1 A;  2ZJR F;  4A3B J;  3WE2 A;  4CHU A;  2XUB A;  4F52 A;  4IHV A;  2VAS A;  4WF2 A;  4IPA A;  4XSZ F;  3OYD A;  3SXY A;  4D5F A;  4P5O A;  3V8K A;  3HOY J;  1P4X A;  3J7A Y;  4OU0 A;  4JX6 A;  2M0C A;  1HC8 A;  3I54 A;  3KCC A;  1AKH B;  4KFC A;  3WG9 A;  4RGX A;  1BL0 A;  2NVT J;  1OYI A;  3G1L A;  5L3F A;  3ZQF A;  1B72 A;  2VC0 A;  2ZME C;  1MJ9 A;  3GZ5 A;  3QOD A;  4ZDP A;  4E7I A;  3BR0 A;  1F36 A;  4FET A;  4UXN A;  2ZKZ A;  2AQE A;  2OJE D;  1IUY A;  5K1Y A;  4C2U A;  2JRM A;  1UAA A;  2L5Q A;  2JVH A;  4LJZ F;  5HDG A;  4G6Q A;  3Q0U A;  5FFZ A;  1AKH A;  3QOP A;  3ZP5 A;  4I0B A;  3H92 A;  4M71 A;  4KNY A;  1WI3 A;  2JSC A;  3A1Y A;  5DCM B;  2V79 A;  2EIL H;  3TW7 A;  4PJM A;  1UMQ A;  2M9H A;  3FKJ A;  3S1R J;  2XF7 A;  1M1E B;  1P6R A;  1TQP A;  2DDB A;  2LRE A;  2RDP A;  3PQK A;  1IN4 A;  1X4O A;  1YYV A;  2ESH A;  2HXI A;  3MEX A;  1JT0 A;  4D1Q A;  2LMD A;  2NVY J;  1C0W A;  2VE9 A;  3OOU A;  2OPT A;  5E3M A;  1MBG A;  3WGH A;  2XSD C;  3ZMS A;  1O3S A;  3I71 A;  1QA6 A;  3N97 A;  5DD4 A;  1MKM A;  1O3Q A;  3LST A;  2Z3Y A;  1WFX A;  2I8D A;  3S8P A;  3MD2 A;  2M4G A;  1OMI A;  3TOB A;  3N4M A;  3BWG A;  1D1C A;  2ZSI B;  2FEZ A;  3MKZ A;  1BW5 A;  2ZXW H;  4NC8 A;  2E34 A;  3TW6 A;  4E7S A;  2FSW A;  4WX9 A;  2DOD A;  2FQ3 A;  4P96 A;  3BP8 A;  3K4C A;  3DKY A;  4FX4 A;  2E7X A;  3H0G J;  4XOP A;  1HSJ A;  1W4M A;  3COA C;  2CSO A;  4MEX F;  4M3G A;  3RZD J;  1YQA A;  5E8I A;  4C2M J;  1FYL A;  1UZC A;  1UEL B;  9ANT A;  3JRD A;  3IP4 B;  1R36 A;  2NYX A;  5ICF A;  1W1W E;  1OCP A;  2HOA A;  3OYG A;  4RB3 C;  1ZN2 A;  1UG2 A;  2MBF A;  1T38 A;  1EA3 A;  3ML6 A;  2XSJ C;  4KIC A;  1EJ9 A;  2E35 A;  1U5T C;  2FOW A;  4KIB A;  1LFP A;  4Q47 A;  4DYR A;  2NAZ A;  2Y31 A;  5JFR A;  2ELH A;  1ZK8 A;  5KAI C;  1KGS A;  3Q9V A;  2A6E F;  1OCO H;  2BY1 A;  1F1Z A;  3VYS B;  1R9T J;  5FKL A;  4ZZD A;  2BVL A;  2F4O B;  3QU6 A;  3DFG A;  3W2W A;  3HSR A;  5LHH A;  2E1N A;  2EIN H;  2YPR A;  4ANJ A;  3D5L A;  2LP0 A;  3W6K B;  2IGN A;  3JRH A;  2IP2 A;  1A35 A;  3GXO A;  3HKZ A;  1R5H A;  2STT A;  1IXC A;  3HPG A;  2JJ7 A;  2LSO A;  2PMZ A;  1YG2 A;  3E5U A;  2LC2 A;  3TQN A;  1FYM A;  2VUM J;  3I4P A;  2MGQ A;  1E0E A;  1OJL A;  5KHD A;  2G0E A;  3FMQ A;  2VQH A;  2CQK A;  5LRR A;  3CTA A;  2V9V A;  1RC9 A;  1G3W A;  4KMF A;  1HKS A;  2FF4 A;  2N8G A;  2JVG A;  3CCJ I;  1TL8 A;  3U1K A;  2K9N A;  4IOC F;  4NB5 A;  5TGT A;  5F0F A;  5C44 J;  1I27 A;  1D5Y A;  2WV0 A;  2H27 A;  3VFZ A;  2HYF A;  5FO5 A;  4H0E A;  1R1U A;  2MAB A;  2XKP A;  2KIF A;  2DJN A;  3OS2 A;  2P7C B;  2P5V A;  3PSI A;  1B1B A;  5HDN A;  4UB6 C;  2V1X A;  2XPW A;  2EK5 A;  2J5O A;  1SVM A;  2MD0 A;  4RMN A;  4IKF A;  1BI0 A;  3DWL E;  1YE9 A;  4A3F J;  1ZHF A;  5ICC A;  3CUO A;  2KKO A;  2L9N A;  1X58 A;  1VQN I;  2LYC A;  2XAS A;  2R5Y A;  3OYK A;  3ZQL A;  2GIZ A;  4BQA A;  1YJ9 I;  3K4N A;  3HBL A;  5A2Q K;  1TWC J;  2WTE A;  3SZP A;  2RC4 A;  5KCM A;  3NWT A;  2HQA A;  4IJA A;  5EYR A;  4MHG A;  4IHT A;  4PFP A;  3HSF A;  6PAX A;  2A68 F;  5FFX A;  3BPX A;  5KK1 A;  5F0C A;  1A04 A;  4BBS J;  4XLH A;  5FGM A;  1KQ8 A;  2XB0 X;  1LE8 B;  2A61 A;  1Y8R B;  4OAY A;  1TC3 C;  3T1B A;  2WC2 A;  4RS8 A;  1FSH A;  1BI1 A;  4XOR A;  4M74 A;  5J47 A;  1U8B A;  2IGK A;  4QTR A;  4DYC A;  2LY1 A;  2ZNZ A;  4L5J A;  2HZD A;  1T33 A;  3QP6 A;  1HW2 A;  1PJR A;  3C3W A;  3DEE A;  2ZJP F;  1HCR A;  1MJB A;  5BS6 A;  2GXA A;  4C30 A;  2BY2 A;  1KU2 A;  1W5T A;  1DGR M;  1TWF J;  1X1P A;  2L9V A;  4IF4 A;  4U0Y A;  3OYL A;  3D5S C;  1OFC X;  2M1B A;  3PL8 A;  2JQ7 A;  1UFM A;  4BS9 A;  4S05 A;  1H88 C;  3D5R C;  3KP5 A;  2HYJ A;  1W0T A;  4A3L J;  3SEZ A;  5GAD J;  1ZR4 A;  1IDY A;  4R8H A;  2Q2E A;  4XRS A;  2F5D A;  2IA1 A;  5F1R A;  1JJ8 C;  3C1D A;  3ECO A;  2IVM A;  2HVR A;  3HDD A;  5E3O A;  4NBQ A;  3MKY B;  3DLA A;  3G6E I;  1R5I D;  2ZXI A;  1TWH J;  2VLA A;  3HSE A;  2EFW A;  2F6C A;  3KE2 A;  1Z0X A;  1QHG A;  3F21 A;  5FJ8 J;  2DW4 A;  4M3B A;  2QSG X;  2RNG A;  2FU4 A;  1KA8 A;  3MKL A;  4XL9 A;  3VSK A;  1ERD A;  1YW9 A;  1SAU A;  3HOS A;  1YJW I;  2P6T A;  4I7H A;  1T39 A;  3ELK A;  3FBN B;  5FRM A;  3KZZ A;  3SYT A;  3M4O J;  3W2A A;  2XV4 S;  4O5V A;  4F92 B;  2RAE A;  1ZG5 A;  3LAJ A;  2MC3 A;  1YS6 A;  2X4H A;  1KYW A;  4HDV A;  3CJQ B;  3T0Y A;  3BQZ A;  3DQV C;  2RGV A;  1D3Y A;  3SQN A;  1ORK A;  2M8E A;  2V1N A;  3AG2 H;  1NTC A;  3NAU A;  3MWM A;  3T8T A;  2KRC A;  2O6G E;  2F2E A;  4U0V A;  2FRH A;  2E36 A;  5DYM A;  2CV2 A;  2OC6 A;  1FZP B;  2VKV A;  2YU9 J;  4UUS B;  3UNG C;  4RB1 A;  1QZZ A;  4KYW A;  1XD7 A;  4BAC A;  2FE3 A;  3K7A J;  4KN4 X;  4BQQ A;  2JN6 A;  4YFN F;  1LQ1 A;  2PJR B;  5EG0 B;  4BDY A;  1SD6 A;  4HNT A;  3FHN A;  2M7A A;  1WKM A;  2LR8 A;  3ASO H;  1MNE A;  4BEH B;  1Z1D A;  4NDL A;  4IOA F;  1Z21 A;  3WTZ A;  2XDV A;  1OCR H;  3LL7 A;  2MH9 A;  2ACJ A;  5LRS A;  1UJ8 A;  1MSE C;  3GME A;  2EWN A;  1D0Z A;  5CYV A;  3FDY A;  4P55 A;  2E2H J;  4F7Z A;  2Y9Z A;  4HYE A;  1YOV B;  2R93 J;  3NEU A;  1UHS A;  3QP5 A;  4PJ0 C;  2YX7 A;  4RB0 A;  2KIS A;  1XC5 A;  3FKI J;  2NS0 A;  2PJR A;  1EH6 A;  2F5V A;  5EG0 A;  2XGX A;  4L9T A;  3HOZ J;  5IT9 Z;  2W25 A;  2ADU A;  4KT6 A;  1D0Y A;  5EZH A;  4BEH A;  1WVR A;  1MJA A;  2DJI A;  2OZ6 A;  1W36 D;  5D4R A;  3KP4 A;  5C4X J;  3S93 A;  2HQN A;  1CQT A;  1J0R A;  2FMY A;  2UUZ A;  2VQC A;  2EFO A;  2JZY A;  2RRE A;  1QNT A;  3DBH B;  5HLH A;  5C3E J;  3OL3 A;  5HLI A;  1Y1V J;  2EZH A;  4HDU A;  3OIQ A;  1U9N A;  1MMN A;  3WHB A;  4BHC A;  4C3I J;  4D9J A;  4RGS A;  1X2M A;  5GTI C;  2IA0 A;  4BL0 B;  1E3H A;  3IRR A;  2HWV A;  1OKR A;  2VOP A;  3W6J B;  2TRT A;  4YIF A;  2LF7 A;  1VQ6 I;  2I5U A;  1BOB A;  2KZG A;  1FNN A;  1QVT A;  2WAQ A;  1H0M A;  1HQC A;  4N4O B;  2XAG A;  5CQG A;  1S72 I;  3F3X A;  4XN3 A;  4IX7 A;  5M5W J;  3RDI A;  2A69 F;  1OQY A;  3IH2 A;  5E3L A;  1XSX A;  4YG2 F;  2IS1 A;  2X1C A;  2H1K A;  1JUM A;  2WWY A;  4PZJ A;  3VOD A;  3GFM A;  1YX5 A;  4BE2 A;  1L0O C;  2MYS A;  3OIO A;  1P92 A;  1VND A;  3B02 A;  4AYB N;  5D5X B;  1TWA J;  1VQO I;  3VDX A;  2R3S A;  1K83 J;  1I5Z A;  3TGN A;  4EM0 B;  4W1U A;  1Y8Q B;  5GTH C;  3GZN B;  1S9H A;  4XMY A;  3ABU A;  3M8E A;  1HW5 A;  1JHF A;  3ASN H;  1SMT A;  3ULQ B;  5IT9 K;  2AQF A;  3E6M A;  1FTZ A;  1A6Q A;  1SFK A;  2LOO A;  3K4M A;  4BY7 J;  1REP C;  2X48 A;  4OOI A;  2W4S A;  1ZRE A;  1ZAR A;  2CW0 F;  1LNW A;  3O6B B;  5ILV A;  1K61 A;  3HRM A;  3CCE I;  4HX8 A;  4XKC A;  2QF7 A;  4UV8 A;  1BW6 A;  4DBQ A;  3S15 J;  1FTT A;  2JWT A;  5ICG A;  4G6T B;  2BGC A;  3KZY A;  2D1V A;  3HPH A;  2ZJ2 A;  4V2G A;  2OZU A;  3TP0 A;  5EJC A;  3ZOB A;  4EEF G;  4X0G A;  3Q0W A;  1PUF A;  3I3L A;  3NAR A;  4ZYA A;  1MDM B;  5FRO A;  3CP8 A;  1XCV A;  3KP7 A;  2HYG D;  2PMU A;  5BNG A;  2CG4 A;  5HVQ C;  1HA8 A;  4HW0 A;  2M7B A;  1KU3 A;  4LLL A;  1F4K A;  1JGG A;  4BJ5 C;  3S1M J;  3LAP A;  1PUE E;  3K2Z A;  3ZCO A;  2Y75 A;  1DQU A;  4KMU X;  3WTY C;  3GVA A;  4BJ6 C;  1MW7 A;  1FPQ A;  2NS7 A;  2B9S A;  4M3D A;  2FBH A;  4IQ4 A;  4RAG A;  4BHB A;  3FXM A;  2WAF A;  3Q3S A;  3OMY A;  4HRI A;  5FLM J;  2O61 A;  3F8M A;  4O6J A;  2GA2 A;  4X1E A;  4AUX A;  4CSW A;  4HLY A;  1FIA A;  3QYF A;  4EAT A;  2XHK A;  5K5R A;  2AXT C;  2ZO4 A;  4E7L A;  1XGS A;  4BQN A;  3WGI A;  1QRY A;  1TT5 B;  1ZLJ A;  4Z6Y A;  2K7L A;  1MH3 A;  3GZ6 A;  4WXH A;  2ECC A;  4XBF A;  2K5C A;  5E8G A;  4P9F A;  5CVR A;  3JSO A;  2O03 A;  3LSH A;  2FNA A;  3W6V A;  2QA4 I;  1Y39 A;  1ZKG A;  1QPM A;  3WG7 H;  3I59 A;  3H3U A;  2FOK A;  1ONV A;  5CLS A;  5LGT A;  4FTH A;  3GTJ J;  4ZDL A;  1ETX A;  4XRS G;  4UB8 C;  3KP3 A;  2FD5 A;  1VF9 A;  3RPQ A;  1KQ0 A;  1HKQ A;  2HPM A;  3MAJ A;  3KET A;  2NRA C;  1X1A A;  2MFZ A;  5C4J J;  5BQT A;  3FF5 A;  3OSF A;  4MNU A;  1YLF A;  2ZXJ A;  3CCU I;  3RI4 A;  1FBS A;  1OYY A;  3L9F A;  5GPA A;  4ASN A;  4U7D A;  1BIB A;  2K40 A;  3J80 K;  3K70 D;  4A12 A;  1ZR2 A;  5D5W B;  4UHT A;  1WH7 A;  5L3C A;  3RQI A;  3SDB A;  3I56 I;  1XCB A;  1TBX A;  4PSX A;  1XDU A;  3MVP A;  1IRF A;  3QWL A;  2H8R A;  4HF0 A;  4II3 A;  4KA4 A;  5CVV A;  3KLO A;  4UNO A;  1X3W B;  1FY7 A;  2B63 J;  1V5F A;  5EEG A;  2ZNY A;  3CC2 I;  2W1O A;  3S2D J;  4OIN F;  4M73 A;  4M6X A;  4EJU A;  5LGU A;  1QZY A;  4CZZ A;  4PSW A;  3OSG A;  2TDX A;  3KEY A;  1UHM A;  2UXN A;  4WCG A;  2EZL A;  3J7Y J;  5HS9 A;  4I01 A;  2X85 A;  2VQG A;  3TO6 A;  1BI3 A;  2PLY A;  3ISP A;  5DDG A;  1OLT A;  1SD7 A;  1IXS B;  1GXQ A;  2HZT A;  4QSH A;  3HRT A;  2H6B A;  4BU2 A;  1X1B A;  3DP7 A;  3HKZ N;  2P8T A;  5EF6 A;  4HLX A;  5JHU A;  1IAW A;  2CV0 A;  2PMZ N;  4GFB A;  3U2R A;  1GVD A;  1HF0 A;  3LSK A;  1E3O C;  3AG4 H;  3OOP A;  5B5E C;  3S1N J;  1FOY A;  1AA7 A;  3HHH A;  5KNL A;  2D1H A;  2KL4 A;  2CUF A;  5L3E A;  2V6C A;  1ZG1 A;  1WZ2 A;  3U21 A;  1VFC A;  1TWG J;  4B48 A;  3HTS B;  3CDH A;  2Q0O A;  4AD9 A;  2HU9 A;  2HDW A;  3PM1 A;  2KJC A;  4BQO A;  1B72 B;  2Y69 H;  4CIC A;  3L2U A;  4OMY A;  2L3D A;  1CF7 A;  3DEU A;  1B59 A;  3S32 A;  4CA0 A;  2Q1Z B;  3JRC A;  1IRG A;  4G9Y A;  2GZW A;  3ABM H;  2IJL A;  1DU0 A;  2OQR A;  1QHH D;  4BH9 A;  2HR3 A;  3A0B C;  2O0Y A;  1PYV A;  3P5J A;  2EQR A;  5E79 C;  1Z05 A;  5ERI A;  2NS8 A;  3LSI A;  2HVQ A;  4OIQ F;  3RJP A;  4EJT A;  3K4L A;  3FXQ A;  5L3B A;  1T95 A;  1W5C C;  4B8X A;  2R7D A;  4UUT A;  1KU7 A;  2EFP A;  3BQY A;  2I10 A;  1BR2 A;  2VC1 A;  3FXJ A;  3MZH A;  5BMZ A;  1G59 A;  1DU6 A;  3RKY A;  2W24 A;  5IP6 A;  4PJJ A;  2VE8 A;  2L01 A;  5E1Z B;  2MW8 A;  2XGD A;  4HQM A;  1B6A A;  4Y7N J;  3IAM 2;  3F22 A;  3R0A A;  3HOX J;  1HKT A;  1HOM A;  1O57 A;  3Q5F A;  4F91 B;  2DA5 A;  1U0J A;  1S3J A;  1NG7 A;  4V2F A;  2XAU A;  1YI2 I;  3SHF A;  2R7S A;  3JRG A;  1FSE A;  2QEN A;  2M5W A;  2OV7 A;  3QAH A;  4KUM A;  3GTG J;  1G3S A;  2DYR H;  1Q1V A;  1Z77 A;  2CRG A;  4MEY F;  4EMS A;  1IN5 A;  1FX7 A;  5IOY A;  2NXN B;  4WK8 F;  2ZJQ F;  1WRJ A;  1UST A;  1J75 A;  1P7J A;  1B8I B;  1J5Y A;  1AHD P;  2MG4 A;  4XK4 A;  3JCU C;  3AG3 H;  5D5V B;  3J7A O;  2FXA A;  4BHP A;  2FA5 A;  1N75 A;  2HNH A;  2WAD A;  2MD5 A;  3F0C A;  3K4B A;  4UY8 I;  1ZGJ A;  1X4P A;  1VQ9 I;  3PUF A;  1MBK A;  2JTV A;  2L7F P;  5F64 A;  3RCO A;  3IH4 A;  5AON A;  3L7W A;  5LEK A;  2CU7 A;  3DTE A;  3ZQ7 A;  1SAX A;  1B8I A;  2YS9 A;  2IT0 A;  3DU5 A;  1LFU P;  3EET A;  1FOW A;  5ILS A;  3CCM I;  1GV5 A;  2RV8 A;  2O7O A;  4QLC U;  2CUZ A;  3A01 B;  4KIS A;  1BR4 A;  2M30 A;  4RB2 C;  2GBY A;  4LMY A;  3SEQ A;  2R4G A;  3V7S A;  1LUJ B;  2EFQ A;  3L00 A;  2DA3 A;  2WY8 Q;  2DAO A;  2F48 A;  2LKS A;  4HNV A;  4IHY A;  4MTE A;  2X51 A;  3A02 A;  1QO0 D;  1I3A A;  1R7J A;  3KPH A;  5K7H A;  3J7Z I;  2V6E A;  5DUI A;  5EZG A;  1SVL A;  1Z3Y A;  2F4I A;  5FRN A;  2EH3 A;  3BR6 A;  3LSG A;  5D6F A;  3PUB A;  4ZC3 A;  1K4T A;  1RIO H;  1FEX A;  1NH3 A;  3A01 A;  3DEW A;  1WQ2 A;  3HM5 A;  1DGW Y;  1WJE A;  2HOE A;  1TP4 A;  5JLX A;  2GXB A;  1TT0 A;  2G9W A;  2K86 A;  1POG A;  3LWF A;  2EBI A;  4YFX F;  3CCV I;  2MLK A;  4M9S A;  1JTY A;  3U9G A;  3P7N A;  1DP7 P;  1HXD A;  2HTS A;  2MH2 A;  3QQA A;  4Y33 A;  2IAI A;  4II2 A;  1J2X A;  2HOT A;  2K9Q A;  4IEJ A;  4UUV A;  1YIJ I;  1YRN B;  1TQI A;  1XGM A;  3H5N A;  4XID A;  1APL C;  5A2Q Z;  2JA5 J;  4OWR B;  1MH4 A;  1JE8 A;  1D0X A;  2QSH X;  1ZGW A;  4A3I J;  1XN7 A;  2CYY A;  2Z5U A;  4RAY A;  4M72 A;  4XON A;  4G94 A;  3K4K A;  1HDD C;  2B0L A;  2Z2S B;  1R6R A;  1USS A;  4ZYD A;  1GHC A;  2PJP A;  4A3K J;  3LQQ A;  2VJJ A;  2FJ1 A;  5H6R A;  1YRN A;  1RKW A;  3P9K A;  4ON0 A;  4CZC A;  1EF4 A;  1VQ5 I;  2OCE A;  3E6B A;  3E3V A;  3NWS A;  2R7X A;  2FQ4 A;  4JP0 A;  3ZN0 A;  3GO5 A;  1G4D A;  2ISY A;  3DF8 A;  5JVT A;  1T98 A;  3ERM A;  1JHH A;  4FQG A;  1RNL A;  3DXJ F;  3FMR A;  3JRE A;  1H9T A;  5FLX Z;  1GLN A;  2PQ8 A;  1YIT I;  2R5Y B;  1OR7 A;  4L9V A;  2JMW A;  2AS5 F;  1F43 A;  4BXX J;  1S29 A;  5F08 A;  1MIJ A;  1R22 A;  1FBU A;  2VQL A;  2ID3 A;  3QPT A;  4CYC A;  4UVA A;  1QQI A;  1TNS A;  2XB5 A;  3TL4 X;  2GXG A;  1G3Y A;  2VBW A;  3RZO J;  4B47 A;  3ABT A;  2ECB A;  3QYB A;  2BE5 F;  4A6E A;  4LG3 A;  1W7P D;  2XAF A;  4BGD A;  2XAH A;  3MQ0 A;  2FBI A;  1TLH B;  2VKE A;  3WU0 A;  2ISZ A;  1X3U A;  2IPQ X;  4HPQ A;  2LK2 A;  5F6F A;  2DQL A;  3KP6 A;  3KEQ A;  3WU2 C;  1R58 A;  2GWR A;  5EDN A;  3F23 A;  1BR1 A;  3J81 Z;  5HLT A;  4HF2 A;  1EH7 A;  3CJN A;  3OY9 A;  2KMU A;  3L2R A;  4RAF A;  3FIW A;  4CO8 A;  4GDF A;  2KIM A;  4V19 K;  3ERE D;  2EJR A;  1R4M B;  3H9Q A;  3PO2 J;  2X1D A;  4MTD A;  2Q2E B;  1IRX A;  4KN7 X;  2IRF G;  1X1C A;  3BZK A;  2IW5 A;  4HF1 A;  4A93 J;  1Z67 A;  3EUA A;  4PJL A;  1K6Y A;  2Z99 A;  3GFJ A;  2XPU A;  3P9C A;  3DTK A;  4NUB A;  1XS9 A;  1IN8 A;  2XKO A;  5HS7 A;  2IA2 A;  2H6C A;  1QPI A;  3IV5 A;  5FLX K;  3VSL A;  3KYL A;  5IT3 A;  3LSM A;  2KP6 A;  3FBI B;  2CH0 A;  3LFU A;  1O4X A;  3CES A;  4PCQ A;  3OYF A;  2FX0 A;  2X6Y A;  1U6G A;  4M6Y A;  4IO9 F;  2HS5 A;  3ZXS A;  3MCZ A;  2R7V A;  5GP9 A;  3WOD F;  2R7T A;  2H1L A;  1MSF C;  2KIQ A;  5E18 F;  1BN5 A;  3ZQC A;  3CLO A;  1E3P A;  3V7C A;  2VKH A;  3B6A A;  3BR5 A;  1WI9 A;  2MSY A;  3G1O A;  1B9M A;  2FNP A;  2HVS A;  2V9P A;  4FHT A;  2E2I J;  2JRT A;  1X3Z B;  2F5E A;  3BCB A;  1IN6 A;  1E2X A;  2DMQ A;  5CKT A;  3HZJ A;  3PFI A;  4G8X A;  4HBL A;  5HS8 A;  5HDK A;  3K4J A;  3CUQ A;  1G6N A;  5J3L A;  2P6S A;  4XSX F;  5EEH A;  4LLG F;  5J4Y A;  2HDC A;  2BW3 A;  2QLZ A;  1BIA A;  1GVJ A;  4GCV A;  2BXY A;  4HST A;  3J81 K;  4I0A A;  1GT0 C;  1ODD A;  3F6O A;  2XRL A;  4AID A;  3RPU D;  1O7L A;  3KX2 A;  4EGY A;  2PMH A;  4I2O A;  3CCS I;  3WGG A;  2KRF A;  4QPO A;  1S7O A;  4OIO F;  3I4N J;  2L4A A;  5DM7 F;  3FK6 A;  1LJ9 A;  3KIO A;  4U87 A;  2AXL A;  4R1H A;  5JR3 A;  1IF1 A;  2W57 A;  2DYS H;  3WHC A;  2HXO A;  2LKX A;  2EPF A;  1WJF A;  1WJ5 A;  3FXU A;  1MMA A;  5HOO A;  4A0Y A;  3I9V 2;  2X9D A;  3OR2 C;  4BNC A;  4Y15 A;  1HLV A;  2ZCW A;  3FZV A;  1NHA A;  3L2W A;  1QBJ A;  4CCM A;  2FBK A;  4PFO A;  3R0J A;  1SD5 A;  2P0W A;  4RM3 A;  3H36 A;  3F9K A;  1RET A;  4A3G J;  4MGR A;  1P4A A;  4I99 C;  1P9Q C;  2CQQ A;  2DI3 A;  4YFK F;  5IYC J;  3P9I A;  4M3E A;  1T2K A;  5DM6 F;  2PBI A;  2X6X A;  3B73 A;  1RES A;  2GOX B;  2QUF A;  1D5V A;  2UZK A;  1UG0 A;  3LFK A;  2DFE A;  3BT9 A;  3O2P E;  3BRO A;  1ZYR F;  4IRG A;  4ZJZ A;  1AU7 A;  2UXX A;  3JAM K;  2WV1 A;  3M07 A;  1IG7 A;  3WTU C;  2DPU A;  3QPS A;  4CXF A;  3E6C C;  2JPB A;  3K2A A;  4P1W A;  5FKK A;  2QGU A;  2HKO A;  3FXL A;  2AO9 A;  1XTA A;  2QZ8 A;  4HX7 A;  4QPQ A;  3IWZ A;  1QGP A;  2GAU A;  2LLK A;  3PNT A;  4CCJ A;  3L09 A;  3RSN A;  3JRB A;  1RUO A;  3PJR A;  4I09 A;  1FP2 A;  2VIX A;  3MZY A;  3ECH A;  2D45 A;  4L5E A;  3CMM A;  3ZMZ A;  3SFI A;  4LB5 A;  2JUC A;  2XAQ A;  5DUK A;  3HJE A;  5BOX A;  2GQQ A;  2DA2 A;  3L2V A;  1LPQ A;  4L9J A;  2E1M B;  2WB1 A;  4MO7 A;  3GEZ A;  4B44 A;  3SZG A;  4EQQ A;  5GAG J;  1LB2 A;  1IZ1 A;  1D8K A;  3H5R A;  4ENM A;  3V8J A;  2A5Y B;  1I1S A;  4D7N A;  1KZH A;  2YU3 A;  1G2H A;  1ZRF A;  2IGO A;  1D1A A;  1WJD A;  2LH9 A;  4XKW A;  1IO2 A;  2E5N A;  3CO7 C;  3HUG A;  2MLG A;  2Y0S A;  3F8F A;  1JXS A;  1X19 A;  1TTY A;  2HQ5 A;  4B1R A;  3C2B A;  3JRA A;  4ZH4 F;  3W3C A;  1SEU A;  2KPM A;  2TCT A;  3EPZ A;  3F6V A;  1T08 B;  3ABK H;  2CJJ A;  5GAE J;  4XLE A;  1P2F A;  1SMY F;  4KJZ A;  4E7K A;  1NG6 A;  1T6S A;  2XGC A;  1PUF B;  3NRV A;  3PNY A;  3CP2 A;  3ZRG A;  3HEF A;  1OYW A;  2HI3 A;  4YRV A;  4K2E A;  3BZC A;  4A6D A;  2KLO A;  2DTZ A;  2EIK H;  2K9S A;  2D5V A;  3OYN A;  1OR7 C;  3EYI A;  2ZFU A;  1FOK A;  3FXR A;  2HKX A;  3BJO A;  3HGG A;  3HB9 A;  3OR1 C;  4KT5 C;  3K9T A;  1YTY A;  1W0U A;  3BG7 A;  3RKX A;  2R7R A;  2DXI A;  3PIP F;  2OUM A;  5D5U B;  2R5Z A;  3TO7 A;  2P5L C;  2NNN A;  2FML A;  2CQX A;  1LEA A;  2Y2Z A;  1K79 A;  1ZLK A;  2DU9 A;  3J80 Z;  3LSJ A;  3KLN A;  3K1M A;  2LRD A;  3LSP A;  1JKR C;  2A07 F;  2R7O A;  5LEJ A;  3CC4 I;  4XQF A;  1J9I A;  4RLQ A;  3E5Q A;  2PI0 A;  1PP7 U;  1H89 C;  3RQ4 A;  4FAS D;  3AAF A;  3IC7 A;  3DCF A;  4AIK A;  4ESF A;  5F04 A;  4MIM A;  5J6X A;  2KIU A;  2LG4 A;  5K5Q A;  4X6A J;  3LMM A;  4YEL A;  1V3F A;  5FB2 A;  1AWC A;  5IP7 J;  3I59 B;  1TW2 A;  2HPI A;  4JX4 A;  5J8F A;  5D6E A;  3BPV A;  1RZ4 A;  3OYH A;  2KRH A;  3DLL F;  1R23 A;  3AL0 B;  1MNM C;  4HX4 A;  1KU9 A;  2QCO A;  3K0L A;  4Q5S F;  3ZMT A;  1YX3 A;  2V26 A;  1R00 A;  2E60 A;  3M1E A;  4JK1 X;  4LGW A;  2K9L A;  5ILU A;  2K9M A;  4ZTJ A;  4NHJ A;  2K3F A;  1PDN C;  1OCC H;  5LD2 C;  3S17 J;  1XGO A;  2DPD A;  2ETH A;  1WSU A;  2M87 A;  3FXK A;  3RKW A;  4A3C J;  1SC7 A;  2H09 A;  4I98 B;  3B6C A;  5EGO A;  2QM3 A;  1H8A C;  3WTV C;  1JUS A;  4XKB A;  3JR9 A;  2IS4 A;  3LA3 A;  3TDZ C;  5HNF A;  1MGT A;  4UV9 A;  3BG9 A;  1I6H J;  2XGE A;  3K1N A;  2CFO A;  2L4M A;  2Y48 A;  3HGY A;  3I64 A;  5CVJ A;  1GUU A;  2VT3 A;  2CMP A;  1BC8 C;  3EQL F;  1V5E A;  3EUH A;  5J1R A;  1XG1 A;  1K7A A;  5DV5 A;  3C2G A;  3TBI A;  3GX4 X;  1W36 C;  3DTI A;  3VWB A;  3HOT A;  1IUF A;  3W2V A;  5LGN A;  3AFH A;  1XMX A;  3CUQ C;  1JKP C;  1MBE A;  1MD0 A;  3E6D A;  4HV6 A;  2BVM A;  3BCA A;  3LOC A;  3CMA I;  2DTR A;  3HRU A;  3BDD A;  1LFB A;  5F0H A;  3TOA A;  3E1S A;  1UHW A;  1S7E A;  5H6Q A;  4FE4 A;  4LD5 A;  1WJC A;  4RGU A;  1V55 H;  1VI0 A;  1YW7 A;  3K1P A;  1TW3 A;  2BXZ A;  5B3S H;  2EIM H;  1XGN A;  1R1V A;  4RM2 A;  4ZYG A;  2EIJ H;  4ENJ A;  4CH7 A;  2V9K A;  1S5L C;  4OIP F;  2NOG A;  2RNJ A;  3H3V K;  1YIO A;  3CZ6 A;  3D0S A;  1FJL A;  1CF7 B;  3A03 A;  5IYB J;  3HL2 A;  4UVB A;  3S16 J;  4E6K G;  4CCK A;  3V8L A;  1OPC A;  5H20 A;  1TQM A;  2LFB A;  4AIJ A;  5KAF C;  4FX0 A;  2EZK A;  1VQP I;  2HQR A;  2QKM B;  2EA2 A;  1Y56 A;  2XF6 A;  5L3G A;  2ESN A;  4MQV A;  3WE3 A;  4XNF A;  3KZI C;  3FM3 A;  5L3D A;  3O8G A;  2XRO A;  3A0H C;  2W84 A;  3CF5 F;  4LOC A;  1QU3 A;  1VQ8 I;  3GTM J;  2VN2 A;  4FT8 A;  2K3P A;  3L2Q A;  1G8X A;  1K78 A;  3PO3 J;  3O8H A;  3CCY A;  3FWE A;  2DA1 A;  1UCR A;  1ZH5 A;  3MMY B;  3GUD A;  3H3Z A;  1S8N A;  5B66 C;  3A2K A;  1LEB A;  2XC7 A;  2M3A A;  5J8C A;  2HDD A;  1MMG A;  2H8W A;  3H35 A;  1JGS A;  4XR6 A;  2JA8 J;  2DLL A;  2L9S A;  4XM3 A;  2XAJ A;  4CYD A;  3WTX C;  5M5Y J;  1GXP A;  4Y13 A;  2R7F A;  3R4K A;  3D1N I;  4W97 A;  3CD6 I;  3ABL H;  3TED A;  3F8N A;  1SFO J;  3DKW A;  4L18 B;  1GV2 A;  3L1P A;  4DZJ A;  3G73 A;  4A5N A;  2QVO A;  5FKN A;  1SAN A;  2OAZ A;  2KDO A;  2VOD A;  1IRZ A;  4LIV A;  4JQF A;  4WXD A;  5IP9 J;  4AYB A;  2WBM A;  3S2H J;  2V4J C;  5E1W A;  2DA6 A;  1ACI A;  1XSD A;  4D5C A;  3R61 A;  4FCY A;  2H94 A;  2ZSH B;  3GLX A;  4OAZ A;  1MMS A;  4BBR J;  1YS7 A;  1U9O A;  3HRS A;  1S7A A;  1O3T A;  1KYZ A;  3VYU B;  2E19 A;  1EV7 A;  3M3Y J;  4DYQ A;  3HOU J;  2KDZ A;  2ZC2 A;  4KIT B;  3OYC A;  4L0Z B;  1X2N A;  2BHZ A;  4S0H B;  2CQN A;  2ICW G;  1ON2 A;  4AU7 A;  1J7K A;  2CUJ A;  3M7G A;  4Y3O A;  2M4K A;  1IW7 F;  1Z6T A;  4Q48 A;  3AG1 H;  1MND A;  2CFX A;  1RRJ A;  3IKT A;  2DK5 A;  4A3E J;  4EJW A;  1WHU A;  3M9A A;  3DKX A;  2GIV A;  2E1M C;  4J00 A;  4ZZL A;  1O3R A;  4PDK A;  2E2J J;  3A4C A;  3GTL J;  1BA5 A;  3EYY A;  4WWC A;  1Y0N A;  4FIS A;  3PIO F;  1RR8 C;  1ENH A;  4PGG A;  5ICE A;  5TIS C;  4CGZ A;  2JA7 J;  2MC4 A;  5LBQ A;  4RGR A;  4AC0 A;  2YUS A;  2IS6 A;  4BE0 A;  2LNB A;  2RVC A;  5JVG F;  5E20 A;  1R71 A;  2CQ7 A;  2R7Z J;  2RQP A;  5HNH A;  5E1X A;  1YW8 A;  1FIP A;  4IXA A;  5D8K B;  2QEX I;  1W7P B;  3K70 C;  3H1C A;  2VBY A;  5DS9 A;  2K4J A;  2CGP A;  2EV0 A;  3GBG A;  5DCM A;  2R7U A;  2OBP A;  5JI6 A;  4HZF A;  2PEX A;  3N05 A;  3UR3 C;  1RUN A;  1O7F A;  4RBO A;  5CJ9 A;  5CQE A;  5J1U A;  3CCL I;  1I50 J;  1V54 H;  5D8L B;  2CWE A;  2LVS A;  1ULY A;  4A0Z A;  4AWX B;  1W5S A;  5M5X J;  2LY2 A;  1ZG3 A;  1Y0U A;  2XF5 A;  5DTD A;  2Y0M A;  3ZMD A;  5IOZ A;  2E71 A;  4F3Q A;  5FKO A;  2LY9 A;  1Z7L A;  1ETV A;  1ZEL A;  1W7P A;  3KYC B;  2VJ5 A;  4GO1 A;  3S14 J;  2VKD A;  3BOQ A;  5FKM A;  3ZQH A;  1JKO C;  3ZPL A;  3C7J A;  1IV6 A;  2DOE A;  4QWQ A;  2QWW A;  3S3O A;  1STZ A;  1A31 A;  2Z9O A;  3RKQ A;  3SDG A;  3CMY A;  1HW1 A;  1MBJ A;  3FIS A;  2OTL I;  2CS3 A;  2VXZ A;  4GYI A;  1S6L A;  3BJA A;  2W48 A;  2DDA A;  4YEJ A;  4OIR F;  2W85 A;  3M8F A;  3FHZ A;  4E7Z A;  1CGP A;  4WXC A;  4EJO A;  5M3M J;  1LVK A;  2K85 A;  4DNC A;  3FM5 A;  3S3M A;  2DT5 A;  2X1E A;  5LLQ A;  3DPL C;  3AL0 C;  2B7E A;  3HYI A;  4HOB A;  4IL6 C;  2FUG 2;  4GGG A;  4HA8 A;  4HEA 2;  4CYC B;  1YHQ I;  2STW A;  1T0F A;  2W82 A;  2DT6 A;  3EUK L;  4HAM A;  3QU3 A;  1Y6I A;  4XKV A;  2AHQ A;  1HST A;  1R1T A;  2LBF B;  2GA1 A;  2MA3 A;  3F8C A;  2Q8K A;  2NNY A;  5FLV A;  1Z91 A;  5KVR A;  1SFU A;  3EUH C;  4ESJ A;  4C3J J;  1WH5 A;  4JBA A;  4B3X A;  1ITY A;  2LKP A;  3CME I;  1ETK A;  1P7I A;  1LVA A;  2WB1 N;  2LTP A;  1HDP A;  3H5A A;  2QQA A;  2D2W A;  3HOV J;  2EFN A;  3KYD B;  1Z9C A;  2F5F A;  4JOM A;  4R79 A;  2VON A;  2EZI A;  2QQ8 A;  1FC3 A;  2VXD A;  2XIG A;  2RN7 A;  2EV6 A;  4N9I A;  4EGZ A;  4HQE A;  3VEP A;  1KQ9 A;  5EEA A;  2WAQ N;  4BYY A;  3VYR B;  2HGC A;  2LBF A;  1N25 A;  5J1Y A;  1DUX C;  3GTO J;  2JK3 A;  4E7J A;  2DMU A;  1E17 A;  1Z7U A;  3WU1 B;  3RPU A;  2Y0S N;  4CUG A;  1VTN C;  4PJN A;  2DMT A;  3ZMV A;  5GPC A;  1MZB A;  3HC7 A;  2OTJ I;  2YR2 A;  5LHG A;  3IRQ A;  3OS0 A;  1Z3X A;  3PNV A;  4D7M A;  5E17 F;  2GOM A;  3WTS C;  3UKG A;  1T56 A;  1FOX A;  3HTU A;  2O9L A;  2QKL B;  3GWZ A;  3G2B A;  4Z2Y A;  2KFD A;  3RYR A;  1IN7 A;  1K6O A;  2BY0 A;  3CQZ J;  3F8B A;  3OIP A;  1DDN A;  1VQK I;  2DN0 A;  3GTK J;  4AIH A;  3OYA A;  4Y4R A;  4HV5 A;  3BLY A;  4KDP A;  1WJA A;  2NVX J;  2J5P A;  3KP2 A;  3OYJ A;  3OYE A;  1D8J A;  1WJB A;  4GXO A;  2XRN A;  2IS2 A;  4GRI A;  2LF8 A;  3G4S I;  1BC7 C;  1A36 A;  1T8I A;  1NK3 P;  5LHI A;  2VB6 A;  4M9Z A;  1SFE A;  5DEQ A;  3CUQ B;  2ZFW A;  4BUP A;  4BAY A;  4D0P A;  1OCZ H;  1XMA A;  2PN6 A;  1MBF A;  2F4M B;  4IZZ A;  3HXL A;  2YX4 A;  4JX5 A;  2BW3 B;  2L54 A;  4DZP A;  4G7H F;  5GAH J;  1EH8 A;  3BR2 A;  4A69 C;  4IQJ A;  3OL4 A;  3ONQ A;  4U7B A;  5E3N A;  3IWF A;  3GFI A;  1J59 A;  1FBQ A;  1XPX A;  1BJA A;  1FT9 A;  4LG0 B;  2HFH A;  3GF2 A; 
#chains in the Genus database with same CATH homology
 2XGC A;  3JRD A;  3BR3 A;  3HKZ N;  2GM4 A;  4MLO A;  1G2H A;  5EF6 A;  1LE8 A;  3HEF A;  2L0K A;  1IC8 A;  2PMZ N;  4GFB A;  1OCP A;  2HI3 A;  1GVD A;  1HF0 A;  2HOA A;  2DTZ A;  2VI6 A;  1E3O C;  2K9S A;  3S1N J;  1A5J A;  5IYD J;  1UG2 A;  2D5V A;  5F27 A;  1QVU A;  1IGN A;  5IPA A;  1OCT C;  2DA7 A;  2CUF A;  3FK7 A;  3HGG A;  3HB9 A;  1VFC A;  1W0U A;  1TWG J;  1ZTR A;  2XPV A;  4DYR A;  3JRF A;  2Y31 A;  3PM1 A;  1I3Q J;  2R5Z A;  1B72 B;  1ZK8 A;  4XIC A;  2CQX A;  2Y2Z A;  3JRC A;  4J19 A;  1DU0 A;  3LSJ A;  1R9T J;  5FKL A;  3LSP A;  2Y9Y A;  3LNQ A;  1JKR C;  4BY1 J;  2X6O A;  2EQR A;  1H89 C;  2NS8 A;  2M2E A;  2LP0 A;  3JRH A;  4FE7 A;  3DCF A;  1JT6 A;  5F04 A;  4MIM A;  2JA6 J;  3BG3 A;  4UUT A;  4X6A J;  2JJ7 A;  3BTL A;  2VUM J;  3BQY A;  2I10 A;  2MGQ A;  5IP7 J;  3ZQI A;  1OJL A;  4JX4 A;  4I6Z A;  3TP3 A;  2G0E A;  1ETQ A;  1MNM C;  1WCM J;  1DU6 A;  2N8G A;  5IP6 A;  3LSR A;  2QCO A;  2K9N A;  2MW8 A;  2XGD A;  5F0F A;  4Y7N J;  5C44 J;  4B3A A;  1D5Y A;  3HOX J;  1HOM A;  2DA5 A;  3GTP J;  4I76 A;  3S17 J;  2DJN A;  4V2F A;  2ZB9 A;  3Q0V A;  4QIW N;  3JRG A;  2XPW A;  4A3C J;  3GTG J;  1H8A C;  1Q1V A;  1Z77 A;  2CRG A;  3B6C A;  5EGO A;  1JUS A;  1WGX A;  3JR9 A;  4A3F J;  5IOY A;  4UUS A;  3HOW J;  4XRM A;  3BG9 A;  1X58 A;  1I6H J;  2XGE A;  1B8I B;  1P7J A;  4ABZ A;  2R5Y A;  3BTJ A;  2Y30 A;  1AHD P;  4IHX A;  2IEK A;  3HGY A;  2MG4 A;  4A3J J;  3ZQL A;  3HBL A;  1GUU A;  4XK4 A;  1TWC J;  3GTQ J;  5HOD A;  5J1R A;  1XG1 A;  2M34 A;  3JRI A;  1MBH A;  5EYR A;  2R0Q C;  3F0C A;  1RR7 A;  1IUF A;  1MBK A;  5F0C A;  2KT0 A;  1JKP C;  1MBE A;  2L7F P;  4BBS J;  3IH4 A;  2XB0 X;  2CU7 A;  1LE8 B;  3LOC A;  1B8I A;  2YS9 A;  1TC3 C;  1LFB A;  5F0H A;  4DW6 A;  1LFU P;  3VPR A;  1S7E A;  1U8B A;  1ETW A;  1GV5 A;  4QTR A;  2O7O A;  4FE4 A;  4DYC A;  3A01 B;  1T33 A;  1RKT A;  2GBY A;  1VI0 A;  1GDT A;  1HCR A;  2DA3 A;  4HNV A;  2E1O A;  4IHY A;  1TWF J;  3A02 A;  2DMP A;  1OFC X;  5K7H A;  2NOG A;  2R5Z B;  3H3V K;  5JLW A;  1JJ6 C;  1H88 C;  1FJL A;  1A6I A;  3A03 A;  5IYB J;  5EZG A;  2HYJ A;  3S16 J;  1W0T A;  4A3L J;  2EH3 A;  3BR6 A;  3LSG A;  2L9R A;  1ZR4 A;  1IDY A;  1RPW A;  1IJW C;  2LFB A;  1FEX A;  2EZK A;  4XRS A;  1JJ8 C;  3A01 A;  3DEW A;  3HM5 A;  3HDD A;  5JLX A;  5E3O A;  2HOS A;  1POG A;  3O8G A;  2EBI A;  4LOC A;  1TWH J;  1JTY A;  3GTM J;  1Z0X A;  4G12 A;  3QQA A;  5FJ8 J;  3S1Q J;  2IAI A;  2HOT A;  3PO3 J;  4M3B A;  2K9Q A;  3SJM A;  3O8H A;  4IEJ A;  1YRN B;  3MKL A;  3CCY A;  4XID A;  2DA1 A;  1APL C;  2JA5 J;  1BJZ A;  1MH4 A;  1ZGW A;  2NVQ J;  4A3I J;  1Y1W J;  3M4O J;  2HDD A;  4RDU A;  2RAE A;  2OF7 A;  1HDD C;  3MN2 A;  2JA8 J;  2LD5 A;  5M5Y J;  1ZQ3 P;  3BQZ A;  3D1N I;  4W97 A;  4A3K J;  3ZQG A;  2VPR A;  3TED A;  1ORK A;  1SFO J;  1GV2 A;  2FJ1 A;  1YRN A;  4B4C A;  1NTC A;  1JTX A;  3NAU A;  4DZJ A;  1RKW A;  3L1P A;  5FKN A;  1SAN A;  1IRZ A;  1EF4 A;  5EGO B;  5IP9 J;  2FQ4 A;  4JP0 A;  3S2H J;  4JYK A;  2VKV A;  2DA6 A;  2YU9 J;  4UUS B;  2CUE A;  4D5C A;  2R92 J;  3JRE A;  4FCY A;  3K7A J;  2JN6 A;  4BBR J;  3G1M A;  2R5Y B;  1U9O A;  5EG0 B;  2JMW A;  3I4M J;  1F43 A;  4BXX J;  2E19 A;  5F08 A;  1JKQ C;  1ETY A;  4DYQ A;  2LR8 A;  3HOU J;  3M3Y J;  2KDZ A;  4A3M J;  4NDL A;  2ID3 A;  1X2N A;  2P81 A;  4S0H B;  1NK2 P;  4CYC A;  1MSE C;  2DMN A;  2XB5 A;  3RZO J;  2E2H J;  2Y9Z A;  2ECB A;  2R93 J;  1UHS A;  4C3H J;  4A3E J;  1XC5 A;  3FKI J;  2E2J J;  1ETO A;  3GTL J;  2VKE A;  5EG0 A;  4M6V A;  1BA5 A;  3HOZ J;  3IH3 A;  4M3F A;  5EZH A;  2LK2 A;  4FIS A;  2M8G X;  1ENH A;  2GLO A;  2ME0 A;  2JA7 J;  5C4X J;  2ME6 A;  5EDN A;  4AC0 A;  2YUS A;  1CQT A;  3BG5 A;  4IHW A;  3FIW A;  2R7Z J;  5C3E J;  3PO2 J;  2O8K A;  1Y1V J;  2EZH A;  1FIP A;  1U9N A;  3WHB A;  4C3I J;  1X2M A;  5DS9 A;  3GBG A;  4A93 J;  2IBD A;  5K7Z A;  2TRT A;  2XPU A;  1XS9 A;  3BR1 A;  1JUP A;  4MFE A;  2COB A;  4RBO A;  1QVT A;  5J1U A;  3IV5 A;  1QPI A;  1I50 J;  2LVS A;  5M5W J;  3BTC A;  5M5X J;  1O4X A;  3IH2 A;  5E3L A;  2L7M P;  5DTD A;  5IOZ A;  5M3F J;  2H1K A;  5FKO A;  2LY9 A;  1JUM A;  2FX0 A;  1ETV A;  5GP9 A;  1MSF C;  3OIO A;  1VND A;  3S14 J;  4AYB N;  3ZQC A;  5FKM A;  3ZQH A;  1JKO C;  1TWA J;  2L7Z A;  1IV6 A;  3B6A A;  3BR5 A;  2MSY A;  3G1O A;  4A3D J;  1K83 J;  2E2I J;  4W1U A;  3RKQ A;  3SDG A;  4Y52 J;  3CMY A;  4MFD A;  3FIS A;  1MBJ A;  1IDZ A;  2DMQ A;  1FTZ A;  4BY7 J;  2W48 A;  1U78 A;  3QPL A;  2X48 A;  5J3L A;  3E7L A;  1K61 A;  2ID6 A;  2QF7 A;  4BKX A;  1BW6 A;  1GT0 C;  3S15 J;  3BTI A;  5M3M J;  1FTT A;  2XRL A;  2JWT A;  2ELK A;  2DA4 A;  5K7F A;  4V2G A;  3TP0 A;  4EEF G;  3ZOB A;  1WPK A;  5F1J A;  1PUF A;  3Q0W A;  3NAR A;  3I4N J;  3FK6 A;  3CDL A;  4CYC B;  4A3B J;  5BNG A;  3WHC A;  2HXO A;  4IHV A;  2LKX A;  1JGG A;  3S1M J;  2AHQ A;  4D5F A;  3HOY J;  2X9D A;  4JX6 A;  1HLV A;  2M0C A;  5FLV A;  1AKH B;  2NS7 A;  4C3J J;  4M3D A;  1WH5 A;  1BL0 A;  2NVT J;  3G1L A;  1ITY A;  3ZQF A;  1B72 A;  1ETK A;  1P7I A;  3Q3S A;  5FLM J;  2WB1 N;  2LTP A;  1RET A;  1HDP A;  4X1E A;  4AUX A;  3HOV J;  4A3G J;  1FIA A;  2CQQ A;  5IYC J;  3BR0 A;  1F36 A;  2EZI A;  4M3E A;  1RES A;  1QRY A;  5EEA A;  2WAQ N;  5J1Y A;  1MH3 A;  2ECC A;  3BT9 A;  3Q0U A;  3GTO J;  1AKH A;  2JK3 A;  1AU7 A;  2DMU A;  3W6V A;  2WV1 A;  1IG7 A;  2Y0S N;  1WI3 A;  3QPS A;  1ZKG A;  2DMT A;  3K2A A;  3TW7 A;  1UMQ A;  2M9H A;  5FKK A;  5GPC A;  4FTH A;  3S1R J;  3GTJ J;  2AO9 A;  1ETX A;  2HXI A;  4XRS G;  1JT0 A;  2FD5 A;  1VF9 A;  2LLK A;  3JRB A;  2NVY J;  3OOU A;  4D7M A;  2OPT A;  5C4J J;  5E3M A;  3UKG A;  1T56 A;  4L5E A;  1MBG A;  2O9L A;  2XSD C;  3SFI A;  3OSF A;  3CQZ J;  2DA2 A;  2DN0 A;  3GTK J;  4MO7 A;  5GPA A;  2K40 A;  1ZR2 A;  1WH7 A;  2NVX J;  3RQI A;  3MVP A;  4D7N A;  2H8R A;  1BW5 A;  3TW6 A;  1NK3 P;  2B63 J;  3H0G J;  3S2D J;  1MBF A;  3OSG A;  4JX5 A;  4DZP A;  2HQ5 A;  2EZL A;  3BR2 A;  4A69 C;  4B1R A;  3C2B A;  3JRA A;  4M3G A;  3RZD J;  5E3N A;  4C2M J;  2TCT A;  2CJJ A;  4QSH A;  9ANT A;  1PUF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...