3S17J

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s17J00
1R9TJ 2XB0X 3S1NJ 3CDLA 5DTDA 1VF9A 2R93J 1BA5A 1MH3A 3B6AA 2O8KA 1W0TA 1FIPA 2DA7A 4B3AA 1YRNA 5FJ8J 3BR6A 2AO9A 3HGYA 3ZOBA 2M34A 3PO2J 1HOMA 2ECBA 2ME6A 2FX0A 4M6VA 4FCYA 2JWTA 2XB5A 3ZQFA 5IOZA 2HOSA 3A02A 1UHSA 5FLVA 1VNDA 1MSEC 2B63J 4D7MA 2VUMJ 2LK2A 1K61A 1DU0A 5IOYA 4BKXA 5E3OA 2VI6A 3JRIA 1GDTA 3TP3A 3K2AA 1UMQA 4UUSB 1XS9A 3S1MJ 1TWAJ 4C2MJ 1NK2P 2E2HJ 1BJZA 1T33A 4A93J 5F27A 3BTIA 3JRFA 1JT6A 3S14J 1JKQC 4A3FJ 2JA5J 2E2JJ 1MBJA 5EG0B 1Y1VJ 3JRAA 2MGQA 1RETA 5K7HA 1TWHJ 5EZGA 4AC0A 3A03A 5J1UA 3Q0WA 4JYKA 3MVPA 5J1RA 4BY1J 1LFBA 2KDZA 2OPTA 1IG7A 1OCTC 5DS9A 3HOWJ 1K83J 4B4CA 2R5ZA 3HOZJ 3HGGA 1BW5A 1ETXA 1A6IA 4QIWN 1B72B 4XRMA 4A3JJ 5F0FA 4L5EA 5FKNA 2ECCA 2IAIA 5EDNA 1Y1WJ 2X9DA 3F0CA 1OCPA 4DYCA 3HOVJ 2JA8J 4A3BJ 1MH4A 4DZPA 4A3MJ 3LSGA 1POGA 2ID6A 5EGOA 1B8IA 2HOTA 2NS7A 2DN0A 5FKMA 3DCFA 4M3BA 4BY7J 3TP0A 2HXIA 5FLMJ 5BNGA 1E3OC 3B6CA 1FEXA 2DMPA 2EZLA 3LOCA 3FK7A 1ZTRA 1RKTA 4Y7NJ 2NVQJ 1GVDA 4C3IJ 1WH7A 2DMQA 1AKHA 5F08A 2CUFA 2M8GX 2DMUA 2VKVA 4XRSG 3BR0A 1TWGJ 2WV1A 2LP0A 2JA7J 3RKQA 1LE8B 3G1OA 4DYQA 4D7NA 1X2MA 1O4XA 2NVXJ 3JRDA 2CU7A 1JUMA 1NTCA 2K9SA 2YU9J 2M2EA 3BTLA 1GUUA 1LFUP 1H89C 5JLWA 3HDDA 1AHDP 1ZGWA 1APLC 3LSRA 3S1RJ 1QPIA 2ME0A 1VFCA 5C4JJ 2G0EA 2IBDA 1SFOJ 2DJNA 5JLXA 3HOXJ 3VPRA 4A3DJ 4M3GA 3JREA 5C44J 4CYCA 4A3IJ 2I10A 1MNMC 4JX5A 1FTTA 5M5YJ 2EBIA 2XRLA 2DA1A 4EEFG 3S15J 1QVUA 4X1EA 1JUPA 1CQTA 2L0KA 3SFIA 3H3VK 1ETOA 2ID3A 4XICA 4FE7A 4MIMA 1HF0A 2DA3A 2LLKA 2TCTA 3JR9A 1ETQA 3JRGA 5EZHA 3S1QJ 1Z0XA 1IDYA 3BQYA 4QTRA 4UUSA 2K9QA 4A3LJ 3BTJA 1JKPC 2W48A 5E3MA 3ZQLA 2MSYA 2P81A 5EG0A 3FKIJ 2O7OA 5IYCJ 2R5YB 4D5FA 3RQIA 4CYCB 2FQ4A 3BTCA 1NK3P 2O9LA 3G1LA 4J19A 1JJ8C 2Y31A 1MBEA 5E3NA 5M3FJ 3BG9A 1GT0C 4IHVA 4V2FA 1JJ6C 1ENHA 1RESA 4C3HJ 4I6ZA 2VPRA 3TW7A 2LFBA 3GTLJ 1B72A 3O8GA 2HDDA 3GTOJ 2X48A 1H8AC 1WH5A 2XPVA 3MN2A 2COBA 1HCRA 3BG3A 3QPLA 2PMZN 4A3GJ 4MFEA 3NARA 2EZHA 1RR7A 2CRGA 5F04A 1JT0A 1JKOC 3JRBA 4RBOA 1WI3A 1MSFC 2QCOA 3E7LA 3L1PA 5IP7J 4M3EA 4IHYA 3OSGA 2LTPA 3WHCA 3HOUJ 2N8GA 2NVYJ 3GBGA 2M0CA 1SANA 3PM1A 1LE8A 2X6OA 2E1OA 3IV5A 2L7MP 4FTHA 3Q0UA 3W6VA 4X6AJ 3BR3A 1JGGA 2R0QC 4A69C 1OFCX 1IJWC 2LKXA 4AUXA 3RZOJ 5M3MJ 5EF6A 3BR2A 1XG1A 1IRZA 2DMTA 1U9OA 1P7JA 2MG4A 1I6HJ 1A5JA 2KT0A 1HDDC 1Z77A 4QSHA 1ORKA 5C4XJ 3MKLA 4DW6A 1AU7A 2XGDA 4BXXJ 1VI0A 3GTMJ 3S17J 1BW6A 3LSJA 4A3EJ 2AHQA 2LR8A 2JMWA 1IUFA 1HDPA 3D1NI 1FTZA 1FJLA 2XGEA 4XIDA 1JTYA 2DA6A 2WB1N 5IPAA 3HOYJ 2EZIA 5HODA 3QPSA 4LOCA 1TWFJ 2JA6J 4W1UA 1D5YA 4JX4A 3O8HA 1PUFB 2CUEA 1I3QJ 5FKLA 3UKGA 2R5YA 1UG2A 5IP6A 3QQAA 2TRTA 2XPUA 4MO7A 4RDUA 4A3KJ 2Y9ZA 1F43A 1FIAA 3K7AJ 2EH3A 1ETYA 1RKWA 2NOGA 3Q3SA 4GFBA 5FKOA 4G12A 1XC5A 2XGCA 2ZB9A 4I76A 4UUTA 1IDZA 2HOAA 3Q0VA 3GTQJ 4A3CJ 1WPKA 5GPAA 1TWCJ 5F0CA 2K40A 1ITYA 1U8BA 4MLOA 1JTXA 3OIOA 5GPCA 3DEWA 4Y52J 1ZKGA 3LSPA 2E19A 2Y0SN 5K7ZA 2M9HA 5M5WJ 2XSDC 5GP9A 2L7ZA 3ZQGA 5IP9J 3WHBA 1P7IA 1U9NA 4AYBN 1ETWA 3GTKJ 3A01B 2HI3A 2EZKA 2NS8A 3FIWA 2GLOA 3IH2A 2EQRA 3HB9A 2LY9A 4NDLA 3FK6A 3NAUA 3BR1A 2Y2ZA 5FKKA 2YS9A 1ZK8A 2DA5A 2GM4A 1ZR4A 3BQZA 1HLVA 3HM5A 4FE4A 1EF4A 3BT9A 4ABZA 4MFDA 3ZQIA 4BBRJ 1GV2A 5M5XJ 1YRNB 1S7EA 2CJJA 1JKRC 2E2IJ 2JJ7A 3OSFA 2DA2A 1MBHA 4IHWA 2H1KA 5IYDJ 3TW6A 2NVTJ 1ETKA 1X58A 1T56A 3GTJJ 3M4OJ 3CQZJ 2DA4A 2DMNA 5J1YA 1TC3C 2CQQA 5IYBJ 5K7FA 2CQXA 1MBKA 4S0HB 3JRHA 4DYRA 3HKZN 1WGXA 3I4MJ 3SJMA 3BR5A 5F0HA 1X2NA 1PUFA 4JP0A 1OJLA 5F1JA 3HEFA 4V2GA 1MBGA 2GBYA 2WAQN 1Q1VA 4DZJA 2FJ1A 2YUSA 3S2DJ 2JN6A 3IH3A 3ZQCA 1ZR2A 2L7FP 1W0UA 3M3YJ 5E3LA 4IHXA 4BBSJ 1IC8A 2D5VA 1I50J 2L9RA 4FISA 2DTZA 1GV5A 2LVSA 2OF7A 3GTPJ 3S2HJ 2ELKA 2IEKA 4XK4A 5J3LA 1QRYA 1MBFA 4M3FA 2R5ZB 2Y30A 4D5CA 3GTGJ 2RAEA 1H88C 2HQ5A 5EYRA 1QVTA 2HYJA 4XRSA 2LD5A 1U78A 2HXOA 3IH4A 3ZQHA 2QF7A 2VKEA 9ANTA 3H0GJ 3LNQA 4W97A 1BL0A 3OOUA 3PO3J 3C2BA 2R92J 4M3DA 4IEJA 4C3JJ 1IV6A 2R7ZJ 2FD5A 1JUSA 4B1RA 3S16J 3G1MA 5EGOB 1B8IB 5C3EJ 3HBLA 3CCYA 3A01A 1G2HA 3RZDJ 3FISA 2MW8A 1ZQ3P 2Y9YA 1F36A 1IGNA 1ETVA 4JX6A 1DU6A 2JK3A 3I4NJ 2K9NA 5EEAA 3JRCA 2XPWA 3BG5A 1AKHB 3CMYA 3TEDA 2H8RA 3SDGA 1RPWA 1WCMJ 4HNVA
chains in the Genus database with same CATH superfamily
3OYKA 1R7JA 3K4MA 1R9TJ 4P1WA 1IRFA 1R58A 4PJNA 5CLSA 5DTDA 1VF9A 3ABUA 1BA5A 2E5NA 2Y69H 3QYBA 1MH3A 5J47A 3CF2A 3HHGA 3VFZA 4PUSA 2DTRA 1QBJA 2DA7A 3PQJA 1Z91A 4B3AA 2QZ8A 4B47A 2VT3A 3BR6A 2AO9A 3EYIA 2XF5A 1TLHB 2EFWA 2L2OA 3PO2J 5D5UB 3Q9VA 5B5EC 4XMYA 2QA4I 3ZQFA 3A02A 3QWLA 1UHSA 2EILH 4F7ZA 4A12A 3DF8A 3WTUC 1H9GA 2XKPA 2E7WA 4N4NB 1WHUA 2P7VB 3CCLI 2R7UA 5E3OA 1KQ9A 2FBIA 3NWTA 2WA0A 4UB8C 3HOSA 5DD4A 2V1UA 2L9SA 2DT5A 2FBKA 2PJPA 3ECHA 4HEA2 4Z6YA 1W1WE 4A93J 3ZMSA 5DD8A 3G6EI 5LEJA 3S14J 4BACA 1JKQC 4A3FJ 3OYGA 2CQKA 1ZELA 3VB2A 2X0LA 4TV7A 2VC1A 3RKXA 1TWHJ 3I53A 3MZYA 4AC0A 3FF5A 3KP7A 5DM6F 5J1UA 3Q0WA 5J1RA 4BY1J 2KDZA 2OPTA 4BQNA 4N9HA 2IGOA 3HOWJ 2OBPA 4B4CA 3WTWC 4G6DA 4UXNA 2A6TA 3KLNA 4OIPF 2BYVE 3PIPF 2QYOA 1M1EB 1QPMA 2MH2A 3FM5A 1UZCA 4G94A 5E17F 2HVQA 4L5EA 3GXOA 4A6EA 4ZYDA 3H0DA 2X9DA 3WTTC 4XLPF 5HLGA 4A3MJ 3CCMI 2LY2A 3WE2A 5EGOA 2HOTA 1P4AA 3G2BA 4LB5A 1ZRFA 2HXIA 5FLMJ 1P4XA 4RM3A 1E3OC 3LSHA 1FEXA 2LOOA 5DCMA 4UVAA 1Z6RA 4EJUA 4C3IJ 2DMQA 2ESNA 2DMUA 3OYBA 3WTZA 4XRSG 1OCOH 1TWGJ 2WV1A 2JA7J 1A31A 4A6DA 3G1OA 4PGGA 2CWEA 2G7HA 3OV8A 2ZXHA 1D1CA 4XSXF 4D7NA 4MTDA 3JRDA 2CGPA 2CU7A 2R7QA 3K4BA 2K9SA 5KCMA 4ZZDA 3F8NA 4HF2A 1HW1A 4YRVA 4E7JA 2GOXB 1ZGWA 3ABKH 2A68F 5LHIA 1YYVA 1SVOA 4FQGA 1VFCA 3OYLA 4KIFA 2A07F 1SFOJ 2DJNA 3FXMA 1Z9CA 5EJCA 1UB9A 5JLXA 3D0SA 5CPRB 3VPRA 4A3DJ 3E5XA 1IAWA 4RAFA 5C44J 1SD4A 2CFOA 2ISYA 3FDYA 3JTGA 4A3IJ 5TISC 2GIZA 4JX5A 4ESJA 5M5YJ 1FTTA 2EBIA 1FP1D 3BY6A 3O3KA 1YX5A 3KEYA 2XRNA 1GHCA 1CQTA 2L0KA 4BQAA 3H3VK 4AVPA 1FZPB 1S6LA 2H6CA 4KUMA 4CZCA 2X6XA 4FE7A 5JI6A 1HF0A 1R5GA 4YG2F 2FEZA 1IRXA 1BR2A 2WV0A 3KETA 5LGNA 2CW8A 1ETQA 2LKPA 2VLAA 3BQYA 4XLEA 4KISA 3FBNB 1VQNI 2UUZA 1DP7P 1QHGA 1OQYA 4A3LJ 3ZQ7A 3BTJA 1IN4A 1JKPC 2A6HF 2W48A 4LG0B 1D1AA 1HC8A 3ABLH 4Y3OA 4P55A 3FKIJ 4BS9A 1ERDA 3RQIA 3DU6A 5GADJ 1R23A 4ENJA 2VBZA 4RGRA 2Y31A 1SD6A 1MBEA 3W3CA 5E3NA 2QEXI 1HSTA 2ICWG 3I71A 1ONVA 3DEUA 1O3QA 3VWBA 2UXNA 5KK1A 2CSOA 1FT9A 4P9FA 5IT9K 2XAFA 4C3HJ 1YJ9I 2CUJA 4HOBA 1FYLA 4I6ZA 2VPRA 3RYPA 5KVRA 1IO2A 1GXQA 2K27A 3AKZA 3GZ6A 1HSJA 2XPVA 1ZARA 3MN2A 2COBA 1HCRA 3DEEA 2R7RA 3QPLA 4EVIA 4IOCF 1X19A 2V26A 4XSZF 4NHJA 4RB3C 2EZHA 1FBUA 3J7AO 2JVGA 3R60A 1WI3A 2STWA 3GZ5A 3MZ8A 3L1PA 5IP7J 1T6SA 4XOPA 3R0JA 4IHYA 1IXSB 1W4MA 2JRMA 2JQ7A 3KPHA 1SANA 3PM1A 3CMAI 2ZMEA 3WGHA 1VQ7I 5K1YA 3DPUA 1TNTA 2L7MP 2A05A 4U7BA 2JRTA 3TQNA 1IRGA 4CDGA 2E60A 5LLQA 2E1MC 3BR3A 3E0JB 4XLNF 3IAS2 4FHTA 1RC9A 1Y39A 5ILVA 1FSHA 3CCRI 4F55A 5EF6A 4L9JA 3ZMDA 1ZGAA 3GUDA 1XG1A 3BZ6A 3CESA 3V7CA 1ZLKA 1IRZA 4ZDLA 1BC7C 1ULYA 5ICFA 5E8IA 1TW2A 2LYCA 1I6HJ 4EV0A 5LRSA 2KT0A 3MAJA 4EM2A 1J09A 4A0YA 4OU0A 1B59A 3RPQA 1ZGJA 3KFWX 1ORKA 3H36A 3CMMA 1VI0A 2VIXA 2VN2A 3FHNA 3GTMJ 4BXXJ 4A3EJ 2AHQA 2Z1DA 4KJZA 4RMNA 4ZTFA 2OCEA 1QNTA 1XMKA 2DOEA 2P5VA 4NB5A 2DA6A 2W1OA 3DV8A 3HOYJ 1BJAA 5BPIA 1FNNA 3FHZA 2IJLA 4KNYA 4OAYA 1Q1HA 3KYCB 2JA6J 5J4YA 3AL0B 4AM3A 4W1UA 2A5WA 4JX4A 3RPUD 1X1BA 2NNNA 4YELA 5LHGA 4G6QA 1EH7A 4CCJA 1W7PB 3QQAA 2HQAA 3K4NA 3M7GA 4XNFA 4RDUA 3LSKA 1ZRCA 3GO5A 4DIQA 4DBRA 1F43A 4HQMA 2DLLA 4M73A 4XKWA 2V1XA 1T0FA 2L7KA 4CCKA 1XC5A 4DOZA 1IDZA 1WPKA 2WC2A 1OLTA 2CG4A 4KITB 1MNDA 3L09A 2HYFA 1PJRA 2XAGA 3HPGA 1ITYA 3DP7A 4EJWA 1YFHA 5GPCA 3DEWA 3M07A 2K4BA 3F8BA 3DFGA 4GO1A 2E19A 2KDOA 2M3AA 3O2PE 2FOWA 2Y0SN 5K7ZA 4MGRA 4FETA 1I1GA 5KNLA 5M5WJ 3H92A 3OL4A 5HS8A 2L7ZA 3ZQGA 2XSDC 1W36C 1KYZA 3I9V2 3M9AA 4IRHA 5H6RA 4AYBN 2QVOA 4XQFA 4HRIA 2EA4A 2NS0A 3I0TA 4EM1A 4BGDA 3T5XA 2O03A 3V7RA 3LSTA 4PCQA 2OZUA 2LY9A 2COMA 2XAHA 4NDLA 5FO5A 3FK6A 1DPRA 3PSIA 4HQEA 2X6WA 2GIVA 3BR1A 4OAZA 2A61A 2Y2ZA 3H3ZA 1BC8C 1FY7A 3FX3A 3E1SA 3FXRA 2NYXA 4HDUA 3FXJA 3H3UA 3BQZA 4IZZA 2F4MB 1HLVA 1QU3A 2FUG2 1I3AA 1MMAA 2WB1A 3F3XA 3BG6A 2DA2A 1NHAA 1D5VA 3TW6A 1WWXA 2KPMA 4M72A 3L2CA 1ETKA 2GA1A 1KU7A 4ENMA 4M71A 2BE5F 3K70C 4Q47A 5E8GA 2E36A 2DMNA 5J1YA 3B73A 3HSFA 3GLLA 3KP2A 3L2WA 1TNSA 2CQXA 4A2UA 3Q5FA 1D0YA 5ED4A 4XKCA 2AQEA 2IS6A 1YS7A 3SJMA 2H27A 4CZZA 5F0HA 3C1DA 5F1JA 3HEFA 1MBGA 2GBYA 2HYGD 3K1MA 4DZJA 4L9VA 2JN6A 1ZHFA 1O57A 3IH3A 4PDKA 1KA8A 5E3LA 2PJRA 5CVJA 2DBBA 2PN6A 3W6KB 3HPHA 4I7HA 3Q9SA 1GV5A 1X1PA 2DT6A 3G71I 2RNJA 4ZC3A 4XK4A 1KONA 2MA3A 4H4KC 5J3LA 3CUOA 1IN5A 2RDPA 2DDAA 3ZPLA 2E5ZA 2BY1A 4EMSA 1YJWI 2D45A 1SFUA 2Z16A 3A0BC 3GX4X 3CUQA 1J0RA 2RC4A 1XDUA 2VOOA 3LNQA 1BL0A 3PO3J 2JA2A 3C2BA 3RJPA 2F5DA 3U21A 2VXDA 3AG2H 1IV6A 4D1QA 4IRIA 2FD5A 5J4VA 3F23A 3G1MA 2MBFA 5BS6A 5EGOB 3A01A 1G2HA 2OQGA 1XSVA 1XCVA 2MW8A 4RGSA 1ZQ3P 1IGNA 2HKOA 1SC7A 5DCMB 1PYVA 4LITA 4IXAA 4HSRA 3DPLC 3JRCA 2XPWA 3CMYA 1IN6A 2R3SA 3A0HC 3J80Z 1YQAA 4GRIA 1QQIA 5HLTA 4BDZA 2EFPA 2YR2A 2R7DA 5F64A 5DEQA 4HLYA 2L3DA 3FBIB 3VYSB 3EYYA 5E1XA 4KDPA 1VQOI 3OYCA 4XRFA 4FX4A 4LIVA 1DQUA 2WY8Q 2MLGA 1FIPA 1YRNA 3AFHA 2XAUA 5FJ8J 3KZZA 3F72A 4E4HA 1TT0A 4BXFA 5A2QK 3I3LA 3LSIA 3WTSC 3U9GA 3KEQA 2V6EA 2CUZA 4M9SA 1YJNI 4BHPA 3K4CA 4M6VA 3HKZA 4FCYA 1K6OA 3DKYA 2VB6A 4HPQA 5FLVA 3GZNB 1VNDA 4EGYA 1LDKB 1UJ8A 3PUBA 2VUMJ 2LK2A 1MJAA 4Q5SF 2VXZA 1K61A 4IHSA 3JRIA 3QP6A 5LGUA 4PJJA 3TP3A 1F9NA 3CCQI 4UVCA 1XS9A 2HS5A 1TWAJ 2Y48A 3IKTA 1LEBA 1FX7A 1T33A 2ZJRF 3JRFA 2Y75A 2W25A 2ZSIB 3WGGA 4OINF 1MBJA 4DBQA 3OYEA 1A35A 3JRAA 3HSEA 1RETA 5K7HA 2PBIA 4E6KG 2ADUA 4CCOA 5KHDA 3MVPA 5FFZA 3HUGA 1J2XA 1G3WA 2OTLI 1OCTC 4UV8A 4JK1X 2VPLA 1BOBA 3GW2A 2R5ZA 1F5TA 1XGMA 3HOZJ 1R5ID 2VQHA 5CVIA 1LUJB 1OCCH 3LWFA 2IT0A 3PFYA 2EPFA 2PMHA 2XF6A 1XD7A 5BOXA 2VBYA 1YO5C 4AIHA 3FMSA 3P9IA 5F0FA 4FASD 3QU3A 4RGUA 2ECCA 5FKNA 3V4GA 1Y1WJ 5EDNA 2FSWA 3CUQC 3DBHB 3E6MA 3F0CA 4IJAA 3HOVJ 1S3JA 4KA4A 1MH4A 5ILUA 3LSGA 2EIJH 3MKYB 2A5YB 4ZYHA 2DN0A 1SD5A 2P5KA 4LK1F 4YIIA 3MMYB 4M3BA 1TQMA 1VTNC 3B6CA 4U0VA 2EZLA 3LOCA 5HNHA 1RKTA 2R7WA 3C2HA 2HKXA 3J7AY 3BLYA 2CUFA 2WAFA 2VKVA 3KIOA 1Y0UA 2L02A 1XPXA 3FKJA 3RKQA 2L4AA 2EINH 2ZMEB 3MKWB 4H0EA 1X2MA 3MD2A 2NVXJ 4IHTA 4ESFA 1D3YA 3BJOA 4OOIA 3LFUA 1N25A 4NNJA 1U8RA 1TBXA 1ZG3A 3BTLA 1LFUP 1H89C 2XDVA 3F22A 3LSRA 3D5RC 1FBSA 3E5QA 2DFFA 1QPIA 4HA8A 1OPCA 1EKEA 3ASOH 5ERIA 3VSLA 5E18F 1W7PD 2KQRA 3I59A 4CYCA 2I10A 1MNMC 2VQGA 1V3FA 3BCAA 2W24A 4HF1A 2WADA 1R1UA 2CYYA 4BJ5C 2DA1A 4EEFG 1QO0D 1JUPA 5JVGF 2MC4A 4R8HA 1SVLA 2OU2A 3DPTA 2AQFA 3WU2C 2O5RA 1WJAA 2IW5A 1SD7A 3TL4X 2HQNA 2CS3A 2LLKA 4PJ0C 2HNHA 3U1DA 3JRGA 2I8DA 3S1QJ 4QTRA 3HXLA 4AD9A 2DYSH 4ZYEA 2KHMA 3VYUB 3P9KA 4G9YA 5J8CA 5HS7A 2LDUA 3IWFA 5HS9A 2P81A 4CHUA 5EG0A 4HX4A 4CSWA 2BW3A 4HYEA 1Z67A 1V4RA 2FQ4A 5CQEA 1FLIA 3G1LA 3SZTA 1T98A 3GFMA 4RLFA 3T8TA 4J19A 2KP6A 3BG9A 4E7LA 2YU3A 4LK0F 5FGMA 3ELKA 4V2FA 4B48A 1JJ6C 4RB0A 3R6SA 2D1HA 3U1KA 4BUPA 2NNYA 5L3FA 2TDXA 1DUXC 3K4LA 2R7OA 1B72A 3O8GA 3BZCA 2RN7A 4G7ZF 3M8EA 3ESWB 1G4DA 4O3MA 3HZJA 2IVMA 3BG3A 1EJ9A 4NC6A 2NXNB 1VQPI 4I0AA 4E7HA 3EUHA 2PMZN 2LMDA 2V7FA 4MFEA 1Y8QB 2PLYA 3NARA 2CRGA 1JT0A 4EJVA 1JKOC 2GQQA 3S2WA 4RBOA 5TRDA 1FYMA 4A0ZA 2QCOA 2GOMA 3E7LA 3OYNA 3QRFF 2LTPA 3HC7A 4C30A 2IS4A 6PAXA 2N8GA 2YPRA 5D6FA 5BQTA 2UZKA 3NWSA 3CP8A 3H5RA 2OZ6A 2HZTA 3W6JB 1LDDA 4CUGA 1S8NA 2LF8A 4CO8A 2A3SA 1KQ0A 3SYTA 2E1OA 5B3SH 4Y17A 1WSUA 2BVLA 3Q0UA 4FTHA 4G6TB 3W6VA 1BR1A 2JPCA 3A4CA 2QENA 2J5PA 2OC6A 5D8KB 1OFCX 4KT6A 4J01A 5M3MJ 1BIAA 2O6GE 3C18A 3BR2A 2HQRA 4AU7A 2MD5A 2HVRA 1FMWA 2RNGA 2ZNZA 3R61A 1P7JA 1L3LA 4ESBA 1K79A 1YE9A 1BIBA 3ZMUA 2M5WA 1Z77A 1WI9A 5C4XJ 2DK8A 2ZNYA 3MKLA 1AU7A 4CXFA 2XGDA 1BW6A 1Z05A 2CO5A 5GAHJ 1IUFA 1FTZA 3DTIA 4XIDA 4HSTA 3OOPA 2F4IA 1ON1A 2WB1N 3ASNH 3FXUA 5AONA 5IPAA 4F93B 1LB2A 5HODA 3F21A 3QPSA 2CV0A 1S72I 2KRHA 1P4WA 1TWFJ 2FMYA 3ZN0A 3HIFA 1N75A 3JAMZ 3O8HA 5EEHA 4GCVA 4I98B 5FKLA 1J75A 3ZCOA 2BGCA 1UG2A 1JGSA 3VYRB 5IP6A 4GGGA 2M30A 4BJTA 4UY8I 2TRTA 2PJRB 1FIAA 2K5CA 2EH3A 4JBAA 4PFPA 4DGWB 1PUEE 4GFBA 1U3EM 1G3TA 2XASA 5HDNA 3V8LA 3OYIA 4IRGA 3EETA 4KMUX 2XGCA 3RQ4A 4I76A 5L3CA 2XAJA 3Q0VA 3QPTA 5GPAA 1TWCJ 2QWWA 3PFIA 2ZJ2A 2K40A 2R7SA 2XHKA 2EV6A 3E97A 5DUIA 2L4MA 1VQ8I 3WTYC 1XCBA 2X1EA 3U2RA 3ULQB 2BXZA 4Z2YA 5DDGA 2DJIA 2E1NA 4Y52J 2V1NA 3CUQB 3KCCA 5B66C 2OQRA 3BZKA 1BOAA 3EUHC 3I5UA 3BJ6A 3K0LA 3WG7H 5FLXZ 3FWEA 4HZFA 4XR6A 5F1RA 2J5OA 2DPDA 2F5EA 1ODDA 3GTKJ 3TOBA 3A01B 2FNPA 3FIWA 3BJAA 4GYIA 1IV8A 2EQRA 3DBRB 3D5LA 4R1HA 4AIJA 2O8XA 2ACJA 1RUOA 4HAMA 1IF1A 5FD5A 2CQ7A 2P0WA 2P4WA 2VBXA 1K7AA 2STTA 1B6AA 4ANJA 4LD5A 1K4TA 2XKOA 2P6TA 4I02A 3LL7A 3DXJF 1SVMA 4C2TA 2VQCA 2V6CA 4YFKF 3DWLE 3HM5A 4FE4A 3TKYA 4N0BA 4HNTA 3TDUC 4PJMA 1WQ2A 3GFLA 4ABZA 4PGHA 1GV2A 3PSFA 1YRNB 2PMUA 2JJ7A 4U87A 3W2WA 4ASNA 3VYTB 4PZJA 1MBHA 2GWRA 1RRJA 3ABMH 2H1KA 1X3ZB 4GYGA 1T39A 1GLNA 4PSXA 1UHWA 1T56A 3AG3H 3OMYA 1A04A 1TC3C 4KYWA 1REPC 5BMZA 3J81K 3ZQQA 3I58A 4ITVA 3HL2A 3I64A 4P96A 3HKZN 3I4MJ 1SEUA 2O61A 3AG1H 3BR5A 1XGNA 4JP0A 2ZJQF 3F6OA 4V2GA 1R36A 1BI3A 2WAQN 4U0YA 2W84A 2LG4A 1VQ6I 1ZR2A 1WJFA 2L7FP 1X3WB 2CQNA 1FPQA 1QZEA 2HPIA 1MIJA 1W36D 3OYFA 2D5VA 1JHHA 3CF5F 2B9SA 2LVSA 3JSPA 3GTPJ 2IEKA 2HWVA 3HUGB 3HJEA 4E7IA 1T2KA 3FXLA 1HA8A 3FXOA 1DP3A 1X1DA 4BQOA 1LDJA 2R5ZB 3N4MA 2R4GA 3PL8A 4D5CA 5ICGA 1H88C 1FBQA 3CC2I 2HQ5A 5EYRA 4HLXA 5LEKA 4XRSA 4LG3A 2LD5A 5TGTA 2HXOA 2K9MA 2V9KA 1G59A 3H0GJ 2VE9A 2R92J 1IZ1A 3CO7C 2R7ZJ 3M1CA 2W00A 4RAYA 2MH9A 1XTAA 3S8PA 2DYRH 1P9QC 3JCUC 2WAEA 2MFZA 1SMYF 1E17A 2KZVA 2PMZA 4JX6A 3LQQA 4D9JA 4BH9A 4PK4A 1QA6A 3I4NJ 1DU6A 5EEAA 3BG5A 2H8RA 1UCRA 5K5RA 3M1EA 3K70D 2K86A 1RPWA 3F8MA 3G73A 3ZMTA 5D5VB 1V5EA 4II2A 1O3RA 2BEOA 2DOFA 2QQAA 3REOA 2ETHA 3MZHA 4XLFA 2WTEA 1JHFA 2XB0X 1O3SA 5DYMA 4OIRF 3F6VA 4XLCA 2BBYA 2DT7B 3J7ZI 2Z2SB 4DJAA 4XLAA 2O8KA 1UFMA 2OCCH 2PEXA 1W0TA 1VQMI 1U5TC 2DW4A 4E7KA 5GAGJ 3HGYA 3ZOBA 1N77A 4L5IA 2IA0A 1G8XA 2M34A 1T38A 3I59B 1HOMA 2ME6A 3OY9A 2KLOA 1MJ9A 2DOAA 2XB5A 2F6CA 4MNUA 3H9JA 1MSEC 2VONA 1WJDA 3TO9A 3GFIA 1IXCA 2DFEA 3L7WA 4D7MA 5K5OA 1V54H 3KP5A 5IOYA 1O7FA 2VI6A 3SEZA 1I6XA 1GDTA 3K2AA 3G4SI 3FM3A 1UMQA 3ZGKA 4CCMA 2HVSA 1NH3A 3S1MJ 3P9CA 1NK2P 2E2HJ 1P92A 3SEQA 1BJZA 3TDZC 5F27A 3BTIA 1JT6A 2C6YA 3RSNA 2JA5J 1OCRH 4ZJZA 1Y8RB 5EG0B 1Y1VJ 2MGQA 2VOPA 2BW3B 3CP2A 3CJRB 1K78A 4KIGA 4B43A 5DUKA 3RIRA 1U0JA 3S93A 4XBFA 2LF7A 5DS9A 2F2EA 5HDGA 1K83J 3DKWA 2BV6A 1RNLA 3SHFA 4BDYA 3F8FA 1B72B 4XRMA 1YHQI 4A3JJ 1Y56A 4IVNA 1E3HA 2RGVA 3WTXC 4DYCA 3ZXSA 4DZPA 3KZYA 5H6QA 3W2VA 1POGA 2ID6A 2NRAC 1FC3A 1G6NA 2FA5A 1MD0A 4O5VA 3TP0A 3BROA 2IGKA 4ENKA 2DMPA 5FRNA 4E70A 2EFNA 4ZTJA 3FK7A 1E3PA 1GVJA 4Y7NJ 2NVQJ 1ZLJA 1J7KA 1ZYRF 2VJ4A 3CLQA 1AKHA 2M8GX 3ML6A 3BR0A 2H8WA 4HV5A 2LP0A 4U0WA 4MQVA 5E79C 3WGIA 1OYYA 5LGTA 2WBMA 5D8LB 5GAEJ 1WFXA 1JUMA 1NTCA 1L0OC 2RQQA 3D5SC 2PG4A 2ELHA 3LAPA 2YU9J 2OTJI 1AHDP 1APLC 3S1RJ 4PSWA 1G3YA 4YFXF 1SAUA 3IRRA 5C4JJ 2QSHX 3CO6C 1BI1A 1A6QA 2QQ9A 3QOPA 2NAZA 3ECOA 4M3GA 5IT9Z 3SQNA 1Z6TA 3S15J 4Q4ZF 4I09A 3V8JA 5BPDA 1YI2I 1QVUA 4X1EA 2K02A 3FXKA 1BR4A 1R5HA 4L5JA 1ETOA 2ID3A 3KP6A 4Y33A 2E1MB 4XICA 1WJEA 4G7OF 2DA3A 1V55H 2TCTA 4UB6C 3JR9A 1A36A 5EZHA 4RAGA 4UUSA 3CTAA 4LMYA 2Z33A 5HDKA 4F3QA 1E2XA 4MHGA 4RB1A 2K9LA 2LBFA 3FMQA 3PIOF 4L9NA 5FB2A 4WF2A 2MSYA 1WZ2A 3RKWA 3BPXA 1OYWA 2CV2A 3BTCA 4FT8A 1UHMA 3G3ZA 2O9LA 4BJ6C 5M3FJ 2WAQA 1GT0C 1ZAOA 1LNWA 4KICA 2CW0F 1RESA 4HDVA 1U6GA 4IQ4A 1EH8A 1CF7A 2XUBA 5B1AH 3LQRA 2YSRA 4E7ZA 2HDDA 3R4KA 3GTOJ 2P5LC 1WH5A 2EK5A 5KAIC 1UELB 4GDFA 3HRUA 4OMYA 1HKTA 1XDSA 2LNBA 2X1DA 2M87A 4GXOA 3LA3A 4LJZF 1U2WA 1RR7A 5F04A 1B9NA 3L2UA 4I01A 2EA2A 3JRBA 3BCBA 3K2ZA 2HDCA 1EV7A 4JQFA 2L9NA 3QPHA 3DKXA 4M3EA 1MDMA 4I2OA 3OSGA 2F4OB 2KMUA 3H35A 2NVYJ 2FQ3A 3GBGA 3OR1C 3OYHA 2DO7A 1ON2A 1NG7A 2FF4A 4ETSA 1LE8A 3QAHA 2R7VA 3IV5A 2DDBA 3A1YA 2DI3A 5KAFC 1XX5A 4XLHA 1YTYA 1Z3XA 3ZMZA 4X6AJ 2MD0A 1QGPA 3VODA 1R4NB 2BVMA 5L3GA 1KU2A 2EJRA 4EJOA 2R7FA 2R0QC 1B4AA 2FE3A 4AUXA 3RZOJ 1TT5B 2DQRA 5D4SA 2M8EA 4AIKA 2LKSA 3IL2A 2B0LA 1VQ5I 2DMTA 5LFAA 3GF2A 2BHYA 2MG4A 2K85A 3ZRGA 1F1ZA 1WJCA 3IUOA 4NBQA 1VZ0A 4WK8F 2BZTA 2HGCA 3K4KA 3GMEA 3AG4H 4KT5C 5E1ZB 4BHCA 1HKSA 4ON0A 3H1CA 5H2FC 1USTA 2FXAA 1FJLA 1WKMA 2XGEA 2F5CA 4WXCA 3TO6A 3IRQA 2G7UA 1JTYA 2V4JC 4IKFA 1OYIA 2ZC2A 4M6YA 2EFOA 2EZIA 2OV7A 3CCVI 5D6EA 2VC0A 2L01A 3CCSI 3OL3A 3CJNA 4BEHA 1BM9A 3GVAA 2CUEA 2W85A 5L3DA 1T8IA 3CC7I 2HU9A 3ZMVA 2R5YA 3LA7A 1RR8C 1DGWY 2DFIA 5JHFA 2EWNA 4KMFA 2HZDA 2XPUA 4KN7X 3DTKA 4MO7A 4BYYA 4A3KJ 1KQ8A 2Q2EA 1VQ4I 3BOQA 2GAUA 1ETYA 3DTEA 3RTRA 1G3SA 2NOGA 3Q3SA 5JVTA 1BI2A 2LH9A 2ZB9A 4B44A 3CDHA 4DNCA 4A3CJ 2H6BA 2RKHA 1TW3A 2M1BA 3T0YA 2QBYA 2CW7A 1K4SA 1U8BA 4LLNA 1J9IA 2BHZA 3LSPA 3CJTB 2KFDA 3SFZA 4BU2A 1W5CC 5FFXA 2XC7A 4CGZA 1FOKA 4L18B 3WU0A 2QKMB 1XGOA 4BXUA 3WHBA 4K2EA 1ETWA 3GCMA 3K10A 2PI0A 2NS8A 1WJBA 3IH2A 2GLOA 2KRFA 3HB9A 4N4OB 2M45A 2AS5F 1R71A 5L3EA 5E1WA 3PNYA 3LMMA 4O6JA 1UAAA 4CCNA 3DLAA 2V1DA 4II3A 3NAUA 4RGXA 1LVAA 2O0YA 3L00A 1H9TA 2DPUA 3T1BA 3H5AA 2GM4A 4Y4RA 4AWXB 1ZR4A 2DFHA 4B8XA 1CGPA 5D5WB 3GYHX 2H94A 2D2WA 1RZ4A 3AL0C 4A5MA 3UR3C 1R4MB 2P6SA 3BT9A 4MFDA 3ZQIA 4UV9A 5M5XJ 3I54A 2LSOA 1IN7A 2E2IJ 2FNAA 4LFUA 4L9TA 3OS1A 4IHWA 1HW5A 4L0YB 2MYSA 3BP8A 1X58A 1X4PA 3BC8A 1DPUA 2FOKA 2MLKA 3KX2A 3TMOA 3CCEI 3M4OJ 3HHHA 3KEOA 5K7FA 1MBKA 3JRHA 4EATA 1SFXA 3DQVC 1ZRDA 2P8TA 3ROUA 1PUFA 4NQWA 1OJLA 2ZXJA 3IKVA 1R1TA 2JUGA 2YUSA 4Y13A 3GLXA 3ZQCA 2KIMA 4IF4A 2IA1A 2OA4A 2XVCA 3O6BB 3OIQA 4QPQA 2F48A 3K1NA 5L3BA 4IHXA 4BBSJ 2R7XA 1IC8A 3M8FA 1KU3A 3QYEA 1ZN2A 2L9RA 1F4KA 2OF7A 2W4SA 3S2HJ 3E5UA 2ELKA 3NEUA 1OCZH 1K78B 2DXIA 4RAZA 1FOWA 1MBFA 3GFJA 4BAYA 1YIOA 1O3TA 2VE8A 4ENNA 4Y15A 5J8FA 2G9WA 5ICCA 2H1LA 3CCJI 1U78A 1JE8A 1AWCA 2VQLA 3ZQHA 4A5NA 4XM3A 2DU9A 2IXSA 3MEXA 3OOUA 2A6EF 5A2QZ 5LRRA 2VJIA 3BG7A 4C3JJ 2VJ5A 3BDDA 3KP4A 1JUSA 4NUBA 2XIGA 1QHHD 3V8KA 3CD6I 3R0AA 2P7CB 3S16J 5F6FA 2VASA 1D0ZA 1HQCA 3HBLA 3CCYA 3RZDJ 2BXYA 5LD2C 1ETVA 3E6BA 1XMXA 4BL0B 2JSCA 1LFPA 2JK3A 1PDNC 3SZGA 1VQKI 2V79A 1B9MA 5D4RA 3TEDA 1AKHB 2XGXA 3TO7A 2VKHA 3V42A 2ZKZA 3DLLF 1X1CA 2DAOA 5HLHA 4YIRX 4HV6A 1LPQA 2QKLB 4IL6C 4HF0A 3K6GA 4ZYGA 5CVUA 2OJED 3RYRA 2EV0A 3S1NJ 5HVQC 3CDLA 1XGSA 2R93J 4S05A 2JVHA 3TOAA 5ILSA 3B6AA 4IPAA 3KE2A 4RM2A 4ZYAA 4KFCA 1YW7A 1D1BA 4L0ZB 2F5VA 4UHTA 2NVUB 4BNCA 4IO9F 1K6YA 4OMZA 2VBWA 2ECBA 2FX0A 2JWTA 2HOSA 5IOZA 5B1BH 3TBIA 4RS8A 4AIDA 1SFKA 4ZDPA 2B63J 1T08B 1HKQA 2M0MA 1LVKA 1YS6A 1DU0A 1BN5A 4BKXA 3QOEA 3JSOA 1T95A 2PFBA 3WG9A 3RDIA 1MNEA 2ESHA 2QQBA 1U5TA 3J80K 4UUSB 2Q8KA 5JFRA 4BE2A 3ISPA 3QP5A 2UWMA 2HOEA 4C2MJ 1P6RA 2DK5A 2M7BA 3MQ0A 3QYFA 2LBFB 2HR3A 1QZZA 4XKBA 4XN0A 1IN8A 2YX7A 3NQOA 3QODA 4AVZA 4F52A 3E3VA 1MMSA 2E7XA 2VJJA 2E2JJ 2HTJA 4UVBA 4F91B 5EZGA 1PP8F 3A03A 3DBLB 1S9HA 2GXAA 4JYKA 1LFBA 2K3FA 2KRCA 2AXTC 1IG7A 2D1VA 4LB6B 3PUFA 3CLOA 5CVVA 1DGRM 1D8KA 2E71A 4EGZA 3HGGA 3OYJA 2KIQA 5FD6A 1BW5A 1CF7B 1ETXA 1A6IA 4QIWN 1R49A 4M6XA 1JXSA 4A0XA 1Z7UA 4X0GA 3RPUA 1Z3YA 3S3OA 3N05A 1TL8A 2LRDA 2IAIA 4BE0A 1TP4A 1ZREA 2MABA 1OCPA 3WE3A 2JA8J 2QGUA 4A3BJ 1R00A 4EJTA 1B8IA 1X3UA 4XN3A 2X4HA 3HTUA 2NS7A 5FKMA 3CCUI 3DCFA 3ONQA 4BY7J 1W5TA 1YIJI 2KL4A 1RIOH 1P2FA 5BNGA 3K4JA 3LA2A 4QWQA 2L54A 1ZTRA 3C3WA 4M9XA 1MDMB 1YG2A 3EUKL 1GVDA 5JHUA 2DCEA 1V5GA 1WH7A 3I4PA 2IS1A 5F08A 1Y6IA 1LE8B 2GA2A 1ZG5A 1B1BA 4DYQA 1O4XA 2HPMA 4HG2A 3RCOA 5TJJA 3N97A 2CV1A 2Z9OA 2LREA 2M2EA 1GUUA 1R1VA 3HDDA 3DU5A 5JLWA 1OISA 2WWYA 2ZCWA 1JI8A 2BOLA 2JUCA 2ME0A 3KP3A 2G0EA 2KIUA 2IBDA 3BPVA 2JTVA 1KYWA 4WWCA 1HW2A 3VSKA 4RA2A 3HOXJ 4XONA 2QSFX 4V19K 4QLCU 3JREA 5CYVA 3CJQB 1Z21A 2H09A 1MMNA 2XRLA 3ERED 2ISZA 1YW8A 2Q0OA 2JPBA 3SFIA 4ZDOA 4Q48A 3J7YJ 4RLQA 2Y0MA 3H5NA 4MIMA 4UNOA 3PJRA 4IOAF 1Z0XA 1IDYA 1N78A 3KYLA 2K9QA 3GEZA 3HRSA 3P5JA 3CDIA 1YOVB 4PJLA 3TGNA 3VEPA 5E3MA 4M9ZA 3HRMA 1MMGA 4HX7A 2ZO4A 3V7SA 4BEHB 5J6XA 5EEGA 4BE1A 3ZQLA 2O7OA 5IYCJ 2ZJPF 4D5FA 2R5YB 2Z99A 3OS0A 4CYCB 2ZXIA 2Q1ZB 1NK3P 3HG9A 4HNUA 2QLZA 1JJ8C 2Q2EB 1YITI 3ABTA 4IHVA 1QZYA 2W57A 3IP4B 4HX8A 2R7TA 3IHUA 1ZG1A 1ENHA 3KLOA 4KN4X 4LLGF 2XV4S 4G8XA 1X4OA 3TW7A 2LFBA 5HOOA 2XF7A 3GTLJ 1WVRA 1FP2A 3S3MA 2A69F 4HW0A 1UG0A 3PNTA 2QBYB 2X48A 2RREA 4U88A 1H8AC 2PX9A 3IC7A 3MCZA 4M74A 3F8CA 4WCGA 2X1CA 2ZMEC 3WTVC 1KU9A 1FWZA 3PNVA 4A3GJ 2FMLA 5CJ9A 3OS2A 1VQLI 2QSGX 4BQQA 3CZ6A 4ZH4F 1LJ9A 1SMTA 1MSFC 2ZBKA 4U7DA 1I27A 1XSXA 2QUFA 4CA0A 1FYKA 3FXQA 3ZR8X 1EA3A 3SXYA 3ERMA 2OUMA 3WHCA 4KIBA 3HOUJ 1D8JA 1NG6A 2JSPA 1YLFA 1ZH5A 1I5ZA 2M0CA 5LHHA 4LLLA 3JTHA 1I39A 2X6OA 4B09A 1IUYA 2MC3A 3C7JA 3F9KA 4S04A 2OD5A 1YX3A 5FROA 4B3XA 2O3FA 1JGGA 3S3NA 2V9PA 4A69C 2ZFWA 1IJWC 2CFXA 1IW7F 3K9TA 1OMIA 2LKXA 1FOXA 1WJ5A 4OWRB 1X1AA 4YEJA 4PFOA 4UUVA 2Z5UA 2UV1A 3E6CC 3K69A 1U9OA 3L2VA 4XKVA 4I0BA 5E20A 2GXBA 1A5JA 2EIKH 4EM0B 3EQLF 1HDDC 4QSHA 2LY1A 4HBLA 4DW6A 3LAJA 1Z1DA 3S17J 4N9IA 2AXLA 2GZWA 3LSJA 2LR8A 2JMWA 2HEOA 1HDPA 3D1NI 5AIPA 3KYDB 4R79A 2CMPA 1XN7A 1LKXA 2NOJB 4P9UA 4WXHA 1T0FC 2K3PA 4IX7A 1YW9A 1Y0NA 1IXRC 5HNFA 4LOCA 1C0WA 3HRTA 5DM7F 4CYDA 3B02A 4LG0A 1D5YA 5D5XB 1PUFB 2EV5A 4NQWB 2VT2A 1TZLA 1I3QJ 3T8RA 3UKGA 4P5OA 1RUNA 1MGTA 3I56I 4I99C 3QU6A 2IPQX 4MEXF 1D0XA 3C2GA 1PVEA 2Y9ZA 5DCFA 2XROA 4WXDA 2JT1A 1SAXA 1OR7A 3K7AJ 1RKWA 2PQ8A 1KGSA 3WU1B 5FKOA 4G12A 3M8JA 1VQ9I 2KISA 3MKZA 4UUTA 2DQLA 2HOAA 3OYAA 3X2QH 3GTQJ 1LQ1A 1BI0A 1HXDA 5F0CA 1MKMA 4RB2C 3SZPA 2W82A 4CH7A 1RI7A 3VDXA 1FMVA 2KZGA 1JTXA 4MLOA 4NC7A 3UNGC 1ACIA 4XOTA 2EFQA 3OIOA 3MWMA 4BHBA 3CMEI 2UXXA 3K1PA 4MTEA 1ZKGA 2XAQA 3E6DA 5ICEA 2BY3A 1Z7LA 1KZHA 4E7SA 4CCLA 2M9HA 1AA7A 3WODF 3ZN1A 3JAMK 5GP9A 2QQ8A 5IP9J 4F92B 2BY0A 1S5LC 2GXGA 1P7IA 1U9NA 3RKYA 2VODA 2HI3A 1W5SA 2EZKA 1HBXG 4FX0A 2X85A 2IGNA 2VL8A 4QPOA 3SDBA 5JR3A 3J81Z 3NRVA 4DQ2A 3A2KA 1FOYA 4MQ9F 2KKOA 2LC2A 2VKDA 4XL9A 3L2RA 1SFEA 1STZA 2FBHA 1E0EA 5FKKA 4G7HF 3W2AA 2YS9A 1ZK8A 1MZBA 5LBQA 2RVCA 2DA5A 2JZYA 3OIPA 2HFHA 1OKRA 5CQGA 1EH6A 3GWZA 2FRHA 2WY7Q 1DDNA 1J5YA 2M7AA 1EF4A 4XORA 4BBRJ 2M4GA 2K7LA 1S29A 1S7EA 2CJJA 1JKRC 2IRFG 2IA2A 3OSFA 1FSEA 2XSJC 5AIQA 5FLXK 5IYDJ 1MW7A 2HDWA 3LSMA 3HYIA 2ZSHB 3MFKA 3OYMA 2NVTJ 2E1CA 1TQPA 3IWZA 5K5QA 2E34A 3HTSB 3COAC 3GTJJ 5CVRA 3CQZJ 2DA4A 2CQQA 1MMDA 5IYBJ 4IQJA 4OIQF 3H9QA 2ZXWH 4S0HB 1TTYA 1AOYA 4YFNF 4DYRA 1WGXA 4ZZLA 2FU4A 3L2QA 1X2NA 1U5TB 1Q1VA 1H0MA 3PQKA 2FJ1A 3S2DJ 1W7PA 1BBYA 2HTSA 4J00A 3EPZA 1W0UA 2F5FA 2EIMH 4JOMA 3M3YJ 4LIUA 4NC8A 5GTHC 2KIFA 3P7NA 3FZVA 3VOEA 2K4JA 4YIFA 1I50J 3JW4A 5IT3A 4FISA 2DTZA 2I5UA 3RI4A 5CKTA 4CICA 1PP7U 1OR7C 3FMRA 4C2UA 1S7OA 2OAZA 3I55I 2IGMA 3HOTA 1V5FA 1QRYA 1USSA 4M3FA 3H9GA 1LEAA 2Y30A 3GTGJ 1I1SA 2KJBA 2RAEA 3OYDA 5DV5A 4C9YA 5J40A 2Y0SA 3EDPA 1QVTA 2HYJA 1S7AA 3BWGA 2RQPA 2X6YA 2QM3A 5H20A 1TQIA 3L9FA 3IH4A 2QF7A 2B7EA 2IS2A 2VKEA 4AYBA 9ANTA 2EB7A 3HSRA 3OR2C 4W97A 2Z3YA 3AAFA 3EUAA 4LGWA 5HLIA 1WRJA 3ZP5A 3CC4I 1XMAA 4M3DA 4IEJA 2W7NA 2L9VA 2BY2A 1MJBA 2DODA 4B1RA 5GTIC 4OIOF 2CH0A 2KJCA 2RV8A 4EQQA 5FRMA 2L5QA 1B8IB 5C3EJ 4MEYF 3IAM2 3FISA 2Y9YA 1F36A 1XB4A 5IY5H 3OWTA 2IP2A 1GXPA 2V9VA 3LFKA 4D0PA 2ZFUA 1O7LA 2K9NA 4WX9A 2M4KA 2YX4A 1R22A 2X51A 1J59A 3SDGA 1WCMJ 2ELJA 4HNVA 1XSDA 1R6RA 3S32A 2E35A 3KZIC
chains in the Genus database with same CATH topology
1R9TJ 2XB0X 3S1NJ 3CDLA 5DTDA 1VF9A 2R93J 1BA5A 1MH3A 3B6AA 2O8KA 1W0TA 1FIPA 2DA7A 4B3AA 1YRNA 5FJ8J 3BR6A 2AO9A 3HGYA 3ZOBA 2M34A 3PO2J 1HOMA 2ECBA 2ME6A 2FX0A 4M6VA 4FCYA 2JWTA 2XB5A 3ZQFA 5IOZA 2HOSA 3A02A 1UHSA 5FLVA 1VNDA 1MSEC 2B63J 4D7MA 2VUMJ 2LK2A 1K61A 1DU0A 5IOYA 4BKXA 5E3OA 2VI6A 3JRIA 1GDTA 3TP3A 3K2AA 1UMQA 4UUSB 1XS9A 3S1MJ 1TWAJ 4C2MJ 1NK2P 2E2HJ 1BJZA 1T33A 4A93J 5F27A 3BTIA 3JRFA 1JT6A 3S14J 1JKQC 4A3FJ 2JA5J 2E2JJ 1MBJA 5EG0B 1Y1VJ 3JRAA 2MGQA 1RETA 5K7HA 1TWHJ 5EZGA 4AC0A 3A03A 5J1UA 3Q0WA 4JYKA 3MVPA 5J1RA 4BY1J 1LFBA 2KDZA 2OPTA 1IG7A 1OCTC 5DS9A 3HOWJ 1K83J 4B4CA 2R5ZA 3HOZJ 3HGGA 1BW5A 1ETXA 1A6IA 4QIWN 1B72B 4XRMA 4A3JJ 5F0FA 4L5EA 5FKNA 2ECCA 2IAIA 5EDNA 1Y1WJ 2X9DA 3F0CA 1OCPA 4DYCA 3HOVJ 2JA8J 4A3BJ 1MH4A 4DZPA 4A3MJ 3LSGA 1POGA 2ID6A 5EGOA 1B8IA 2HOTA 2NS7A 2DN0A 5FKMA 3DCFA 4M3BA 4BY7J 3TP0A 2HXIA 5FLMJ 5BNGA 1E3OC 3B6CA 1FEXA 2DMPA 2EZLA 3LOCA 3FK7A 1ZTRA 1RKTA 4Y7NJ 2NVQJ 1GVDA 4C3IJ 1WH7A 2DMQA 1AKHA 5F08A 2CUFA 2M8GX 2DMUA 2VKVA 4XRSG 3BR0A 1TWGJ 2WV1A 2LP0A 2JA7J 3RKQA 1LE8B 3G1OA 4DYQA 4D7NA 1X2MA 1O4XA 2NVXJ 3JRDA 2CU7A 1JUMA 1NTCA 2K9SA 2YU9J 2M2EA 3BTLA 1GUUA 1LFUP 1H89C 5JLWA 3HDDA 1AHDP 1ZGWA 1APLC 3LSRA 3S1RJ 1QPIA 2ME0A 1VFCA 5C4JJ 2G0EA 2IBDA 1SFOJ 2DJNA 5JLXA 3HOXJ 3VPRA 4A3DJ 4M3GA 3JREA 5C44J 4CYCA 4A3IJ 2I10A 1MNMC 4JX5A 1FTTA 5M5YJ 2EBIA 2XRLA 2DA1A 4EEFG 3S15J 1QVUA 4X1EA 1JUPA 1CQTA 2L0KA 3SFIA 3H3VK 1ETOA 2ID3A 4XICA 4FE7A 4MIMA 1HF0A 2DA3A 2LLKA 2TCTA 3JR9A 1ETQA 3JRGA 5EZHA 3S1QJ 1Z0XA 1IDYA 3BQYA 4QTRA 4UUSA 2K9QA 4A3LJ 3BTJA 1JKPC 2W48A 5E3MA 3ZQLA 2MSYA 2P81A 5EG0A 3FKIJ 2O7OA 5IYCJ 2R5YB 4D5FA 3RQIA 4CYCB 2FQ4A 3BTCA 1NK3P 2O9LA 3G1LA 4J19A 1JJ8C 2Y31A 1MBEA 5E3NA 5M3FJ 3BG9A 1GT0C 4IHVA 4V2FA 1JJ6C 1ENHA 1RESA 4C3HJ 4I6ZA 2VPRA 3TW7A 2LFBA 3GTLJ 1B72A 3O8GA 2HDDA 3GTOJ 2X48A 1H8AC 1WH5A 2XPVA 3MN2A 2COBA 1HCRA 3BG3A 3QPLA 2PMZN 4A3GJ 4MFEA 3NARA 2EZHA 1RR7A 2CRGA 5F04A 1JT0A 1JKOC 3JRBA 4RBOA 1WI3A 1MSFC 2QCOA 3E7LA 3L1PA 5IP7J 4M3EA 4IHYA 3OSGA 2LTPA 3WHCA 3HOUJ 2N8GA 2NVYJ 3GBGA 2M0CA 1SANA 3PM1A 1LE8A 2X6OA 2E1OA 3IV5A 2L7MP 4FTHA 3Q0UA 3W6VA 4X6AJ 3BR3A 1JGGA 2R0QC 4A69C 1OFCX 1IJWC 2LKXA 4AUXA 3RZOJ 5M3MJ 5EF6A 3BR2A 1XG1A 1IRZA 2DMTA 1U9OA 1P7JA 2MG4A 1I6HJ 1A5JA 2KT0A 1HDDC 1Z77A 4QSHA 1ORKA 5C4XJ 3MKLA 4DW6A 1AU7A 2XGDA 4BXXJ 1VI0A 3GTMJ 3S17J 1BW6A 3LSJA 4A3EJ 2AHQA 2LR8A 2JMWA 1IUFA 1HDPA 3D1NI 1FTZA 1FJLA 2XGEA 4XIDA 1JTYA 2DA6A 2WB1N 5IPAA 3HOYJ 2EZIA 5HODA 3QPSA 4LOCA 1TWFJ 2JA6J 4W1UA 1D5YA 4JX4A 3O8HA 1PUFB 2CUEA 1I3QJ 5FKLA 3UKGA 2R5YA 1UG2A 5IP6A 3QQAA 2TRTA 2XPUA 4MO7A 4RDUA 4A3KJ 2Y9ZA 1F43A 1FIAA 3K7AJ 2EH3A 1ETYA 1RKWA 2NOGA 3Q3SA 4GFBA 5FKOA 4G12A 1XC5A 2XGCA 2ZB9A 4I76A 4UUTA 1IDZA 2HOAA 3Q0VA 3GTQJ 4A3CJ 1WPKA 5GPAA 1TWCJ 5F0CA 2K40A 1ITYA 1U8BA 4MLOA 1JTXA 3OIOA 5GPCA 3DEWA 4Y52J 1ZKGA 3LSPA 2E19A 2Y0SN 5K7ZA 2M9HA 5M5WJ 2XSDC 5GP9A 2L7ZA 3ZQGA 5IP9J 3WHBA 1P7IA 1U9NA 4AYBN 1ETWA 3GTKJ 3A01B 2HI3A 2EZKA 2NS8A 3FIWA 2GLOA 3IH2A 2EQRA 3HB9A 2LY9A 4NDLA 3FK6A 3NAUA 3BR1A 2Y2ZA 5FKKA 2YS9A 1ZK8A 2DA5A 2GM4A 1ZR4A 3BQZA 1HLVA 3HM5A 4FE4A 1EF4A 3BT9A 4ABZA 4MFDA 3ZQIA 4BBRJ 1GV2A 5M5XJ 1YRNB 1S7EA 2CJJA 1JKRC 2E2IJ 2JJ7A 3OSFA 2DA2A 1MBHA 4IHWA 2H1KA 5IYDJ 3TW6A 2NVTJ 1ETKA 1X58A 1T56A 3GTJJ 3M4OJ 3CQZJ 2DA4A 2DMNA 5J1YA 1TC3C 2CQQA 5IYBJ 5K7FA 2CQXA 1MBKA 4S0HB 3JRHA 4DYRA 3HKZN 1WGXA 3I4MJ 3SJMA 3BR5A 5F0HA 1X2NA 1PUFA 4JP0A 1OJLA 5F1JA 3HEFA 4V2GA 1MBGA 2GBYA 2WAQN 1Q1VA 4DZJA 2FJ1A 2YUSA 3S2DJ 2JN6A 3IH3A 3ZQCA 1ZR2A 2L7FP 1W0UA 3M3YJ 5E3LA 4IHXA 4BBSJ 1IC8A 2D5VA 1I50J 2L9RA 4FISA 2DTZA 1GV5A 2LVSA 2OF7A 3GTPJ 3S2HJ 2ELKA 2IEKA 4XK4A 5J3LA 1QRYA 1MBFA 4M3FA 2R5ZB 2Y30A 4D5CA 3GTGJ 2RAEA 1H88C 2HQ5A 5EYRA 1QVTA 2HYJA 4XRSA 2LD5A 1U78A 2HXOA 3IH4A 3ZQHA 2QF7A 2VKEA 9ANTA 3H0GJ 3LNQA 4W97A 1BL0A 3OOUA 3PO3J 3C2BA 2R92J 4M3DA 4IEJA 4C3JJ 1IV6A 2R7ZJ 2FD5A 1JUSA 4B1RA 3S16J 3G1MA 5EGOB 1B8IB 5C3EJ 3HBLA 3CCYA 3A01A 1G2HA 3RZDJ 3FISA 2MW8A 1ZQ3P 2Y9YA 1F36A 1IGNA 1ETVA 4JX6A 1DU6A 2JK3A 3I4NJ 2K9NA 5EEAA 3JRCA 2XPWA 3BG5A 1AKHB 3CMYA 3TEDA 2H8RA 3SDGA 1RPWA 1WCMJ 4HNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T J;  2XB0 X;  3S1N J;  3CDL A;  5DTD A;  1VF9 A;  2R93 J;  1BA5 A;  1MH3 A;  3B6A A;  2O8K A;  1W0T A;  1FIP A;  2DA7 A;  4B3A A;  1YRN A;  5FJ8 J;  3BR6 A;  2AO9 A;  3HGY A;  3ZOB A;  2M34 A;  3PO2 J;  1HOM A;  2ECB A;  2ME6 A;  2FX0 A;  4M6V A;  4FCY A;  2JWT A;  2XB5 A;  3ZQF A;  5IOZ A;  2HOS A;  3A02 A;  1UHS A;  5FLV A;  1VND A;  1MSE C;  2B63 J;  4D7M A;  2VUM J;  2LK2 A;  1K61 A;  1DU0 A;  5IOY A;  4BKX A;  5E3O A;  2VI6 A;  3JRI A;  1GDT A;  3TP3 A;  3K2A A;  1UMQ A;  4UUS B;  1XS9 A;  3S1M J;  1TWA J;  4C2M J;  1NK2 P;  2E2H J;  1BJZ A;  1T33 A;  4A93 J;  5F27 A;  3BTI A;  3JRF A;  1JT6 A;  3S14 J;  1JKQ C;  4A3F J;  2JA5 J;  2E2J J;  1MBJ A;  5EG0 B;  1Y1V J;  3JRA A;  2MGQ A;  1RET A;  5K7H A;  1TWH J;  5EZG A;  4AC0 A;  3A03 A;  5J1U A;  3Q0W A;  4JYK A;  3MVP A;  5J1R A;  4BY1 J;  1LFB A;  2KDZ A;  2OPT A;  1IG7 A;  1OCT C;  5DS9 A;  3HOW J;  1K83 J;  4B4C A;  2R5Z A;  3HOZ J;  3HGG A;  1BW5 A;  1ETX A;  1A6I A;  4QIW N;  1B72 B;  4XRM A;  4A3J J;  5F0F A;  4L5E A;  5FKN A;  2ECC A;  2IAI A;  5EDN A;  1Y1W J;  2X9D A;  3F0C A;  1OCP A;  4DYC A;  3HOV J;  2JA8 J;  4A3B J;  1MH4 A;  4DZP A;  4A3M J;  3LSG A;  1POG A;  2ID6 A;  5EGO A;  1B8I A;  2HOT A;  2NS7 A;  2DN0 A;  5FKM A;  3DCF A;  4M3B A;  4BY7 J;  3TP0 A;  2HXI A;  5FLM J;  5BNG A;  1E3O C;  3B6C A;  1FEX A;  2DMP A;  2EZL A;  3LOC A;  3FK7 A;  1ZTR A;  1RKT A;  4Y7N J;  2NVQ J;  1GVD A;  4C3I J;  1WH7 A;  2DMQ A;  1AKH A;  5F08 A;  2CUF A;  2M8G X;  2DMU A;  2VKV A;  4XRS G;  3BR0 A;  1TWG J;  2WV1 A;  2LP0 A;  2JA7 J;  3RKQ A;  1LE8 B;  3G1O A;  4DYQ A;  4D7N A;  1X2M A;  1O4X A;  2NVX J;  3JRD A;  2CU7 A;  1JUM A;  1NTC A;  2K9S A;  2YU9 J;  2M2E A;  3BTL A;  1GUU A;  1LFU P;  1H89 C;  5JLW A;  3HDD A;  1AHD P;  1ZGW A;  1APL C;  3LSR A;  3S1R J;  1QPI A;  2ME0 A;  1VFC A;  5C4J J;  2G0E A;  2IBD A;  1SFO J;  2DJN A;  5JLX A;  3HOX J;  3VPR A;  4A3D J;  4M3G A;  3JRE A;  5C44 J;  4CYC A;  4A3I J;  2I10 A;  1MNM C;  4JX5 A;  1FTT A;  5M5Y J;  2EBI A;  2XRL A;  2DA1 A;  4EEF G;  3S15 J;  1QVU A;  4X1E A;  1JUP A;  1CQT A;  2L0K A;  3SFI A;  3H3V K;  1ETO A;  2ID3 A;  4XIC A;  4FE7 A;  4MIM A;  1HF0 A;  2DA3 A;  2LLK A;  2TCT A;  3JR9 A;  1ETQ A;  3JRG A;  5EZH A;  3S1Q J;  1Z0X A;  1IDY A;  3BQY A;  4QTR A;  4UUS A;  2K9Q A;  4A3L J;  3BTJ A;  1JKP C;  2W48 A;  5E3M A;  3ZQL A;  2MSY A;  2P81 A;  5EG0 A;  3FKI J;  2O7O A;  5IYC J;  2R5Y B;  4D5F A;  3RQI A;  4CYC B;  2FQ4 A;  3BTC A;  1NK3 P;  2O9L A;  3G1L A;  4J19 A;  1JJ8 C;  2Y31 A;  1MBE A;  5E3N A;  5M3F J;  3BG9 A;  1GT0 C;  4IHV A;  4V2F A;  1JJ6 C;  1ENH A;  1RES A;  4C3H J;  4I6Z A;  2VPR A;  3TW7 A;  2LFB A;  3GTL J;  1B72 A;  3O8G A;  2HDD A;  3GTO J;  2X48 A;  1H8A C;  1WH5 A;  2XPV A;  3MN2 A;  2COB A;  1HCR A;  3BG3 A;  3QPL A;  2PMZ N;  4A3G J;  4MFE A;  3NAR A;  2EZH A;  1RR7 A;  2CRG A;  5F04 A;  1JT0 A;  1JKO C;  3JRB A;  4RBO A;  1WI3 A;  1MSF C;  2QCO A;  3E7L A;  3L1P A;  5IP7 J;  4M3E A;  4IHY A;  3OSG A;  2LTP A;  3WHC A;  3HOU J;  2N8G A;  2NVY J;  3GBG A;  2M0C A;  1SAN A;  3PM1 A;  1LE8 A;  2X6O A;  2E1O A;  3IV5 A;  2L7M P;  4FTH A;  3Q0U A;  3W6V A;  4X6A J;  3BR3 A;  1JGG A;  2R0Q C;  4A69 C;  1OFC X;  1IJW C;  2LKX A;  4AUX A;  3RZO J;  5M3M J;  5EF6 A;  3BR2 A;  1XG1 A;  1IRZ A;  2DMT A;  1U9O A;  1P7J A;  2MG4 A;  1I6H J;  1A5J A;  2KT0 A;  1HDD C;  1Z77 A;  4QSH A;  1ORK A;  5C4X J;  3MKL A;  4DW6 A;  1AU7 A;  2XGD A;  4BXX J;  1VI0 A;  3GTM J;  3S17 J;  1BW6 A;  3LSJ A;  4A3E J;  2AHQ A;  2LR8 A;  2JMW A;  1IUF A;  1HDP A;  3D1N I;  1FTZ A;  1FJL A;  2XGE A;  4XID A;  1JTY A;  2DA6 A;  2WB1 N;  5IPA A;  3HOY J;  2EZI A;  5HOD A;  3QPS A;  4LOC A;  1TWF J;  2JA6 J;  4W1U A;  1D5Y A;  4JX4 A;  3O8H A;  1PUF B;  2CUE A;  1I3Q J;  5FKL A;  3UKG A;  2R5Y A;  1UG2 A;  5IP6 A;  3QQA A;  2TRT A;  2XPU A;  4MO7 A;  4RDU A;  4A3K J;  2Y9Z A;  1F43 A;  1FIA A;  3K7A J;  2EH3 A;  1ETY A;  1RKW A;  2NOG A;  3Q3S A;  4GFB A;  5FKO A;  4G12 A;  1XC5 A;  2XGC A;  2ZB9 A;  4I76 A;  4UUT A;  1IDZ A;  2HOA A;  3Q0V A;  3GTQ J;  4A3C J;  1WPK A;  5GPA A;  1TWC J;  5F0C A;  2K40 A;  1ITY A;  1U8B A;  4MLO A;  1JTX A;  3OIO A;  5GPC A;  3DEW A;  4Y52 J;  1ZKG A;  3LSP A;  2E19 A;  2Y0S N;  5K7Z A;  2M9H A;  5M5W J;  2XSD C;  5GP9 A;  2L7Z A;  3ZQG A;  5IP9 J;  3WHB A;  1P7I A;  1U9N A;  4AYB N;  1ETW A;  3GTK J;  3A01 B;  2HI3 A;  2EZK A;  2NS8 A;  3FIW A;  2GLO A;  3IH2 A;  2EQR A;  3HB9 A;  2LY9 A;  4NDL A;  3FK6 A;  3NAU A;  3BR1 A;  2Y2Z A;  5FKK A;  2YS9 A;  1ZK8 A;  2DA5 A;  2GM4 A;  1ZR4 A;  3BQZ A;  1HLV A;  3HM5 A;  4FE4 A;  1EF4 A;  3BT9 A;  4ABZ A;  4MFD A;  3ZQI A;  4BBR J;  1GV2 A;  5M5X J;  1YRN B;  1S7E A;  2CJJ A;  1JKR C;  2E2I J;  2JJ7 A;  3OSF A;  2DA2 A;  1MBH A;  4IHW A;  2H1K A;  5IYD J;  3TW6 A;  2NVT J;  1ETK A;  1X58 A;  1T56 A;  3GTJ J;  3M4O J;  3CQZ J;  2DA4 A;  2DMN A;  5J1Y A;  1TC3 C;  2CQQ A;  5IYB J;  5K7F A;  2CQX A;  1MBK A;  4S0H B;  3JRH A;  4DYR A;  3HKZ N;  1WGX A;  3I4M J;  3SJM A;  3BR5 A;  5F0H A;  1X2N A;  1PUF A;  4JP0 A;  1OJL A;  5F1J A;  3HEF A;  4V2G A;  1MBG A;  2GBY A;  2WAQ N;  1Q1V A;  4DZJ A;  2FJ1 A;  2YUS A;  3S2D J;  2JN6 A;  3IH3 A;  3ZQC A;  1ZR2 A;  2L7F P;  1W0U A;  3M3Y J;  5E3L A;  4IHX A;  4BBS J;  1IC8 A;  2D5V A;  1I50 J;  2L9R A;  4FIS A;  2DTZ A;  1GV5 A;  2LVS A;  2OF7 A;  3GTP J;  3S2H J;  2ELK A;  2IEK A;  4XK4 A;  5J3L A;  1QRY A;  1MBF A;  4M3F A;  2R5Z B;  2Y30 A;  4D5C A;  3GTG J;  2RAE A;  1H88 C;  2HQ5 A;  5EYR A;  1QVT A;  2HYJ A;  4XRS A;  2LD5 A;  1U78 A;  2HXO A;  3IH4 A;  3ZQH A;  2QF7 A;  2VKE A;  9ANT A;  3H0G J;  3LNQ A;  4W97 A;  1BL0 A;  3OOU A;  3PO3 J;  3C2B A;  2R92 J;  4M3D A;  4IEJ A;  4C3J J;  1IV6 A;  2R7Z J;  2FD5 A;  1JUS A;  4B1R A;  3S16 J;  3G1M A;  5EGO B;  1B8I B;  5C3E J;  3HBL A;  3CCY A;  3A01 A;  1G2H A;  3RZD J;  3FIS A;  2MW8 A;  1ZQ3 P;  2Y9Y A;  1F36 A;  1IGN A;  1ETV A;  4JX6 A;  1DU6 A;  2JK3 A;  3I4N J;  2K9N A;  5EEA A;  3JRC A;  2XPW A;  3BG5 A;  1AKH B;  3CMY A;  3TED A;  2H8R A;  3SDG A;  1RPW A;  1WCM J;  4HNV A; 
#chains in the Genus database with same CATH topology
 3OYK A;  1R7J A;  3K4M A;  1R9T J;  4P1W A;  1IRF A;  1R58 A;  4PJN A;  5CLS A;  5DTD A;  1VF9 A;  3ABU A;  1BA5 A;  2E5N A;  2Y69 H;  3QYB A;  1MH3 A;  5J47 A;  3CF2 A;  3HHG A;  3VFZ A;  4PUS A;  2DTR A;  1QBJ A;  2DA7 A;  3PQJ A;  1Z91 A;  4B3A A;  2QZ8 A;  4B47 A;  2VT3 A;  3BR6 A;  2AO9 A;  3EYI A;  2XF5 A;  1TLH B;  2EFW A;  2L2O A;  3PO2 J;  5D5U B;  3Q9V A;  5B5E C;  4XMY A;  2QA4 I;  3ZQF A;  3A02 A;  3QWL A;  1UHS A;  2EIL H;  4F7Z A;  4A12 A;  3DF8 A;  3WTU C;  1H9G A;  2XKP A;  2E7W A;  4N4N B;  1WHU A;  2P7V B;  3CCL I;  2R7U A;  5E3O A;  1KQ9 A;  2FBI A;  3NWT A;  2WA0 A;  4UB8 C;  3HOS A;  5DD4 A;  2V1U A;  2L9S A;  2DT5 A;  2FBK A;  2PJP A;  3ECH A;  4HEA 2;  4Z6Y A;  1W1W E;  4A93 J;  3ZMS A;  5DD8 A;  3G6E I;  5LEJ A;  3S14 J;  4BAC A;  1JKQ C;  4A3F J;  3OYG A;  2CQK A;  1ZEL A;  3VB2 A;  2X0L A;  4TV7 A;  2VC1 A;  3RKX A;  1TWH J;  3I53 A;  3MZY A;  4AC0 A;  3FF5 A;  3KP7 A;  5DM6 F;  5J1U A;  3Q0W A;  5J1R A;  4BY1 J;  2KDZ A;  2OPT A;  4BQN A;  4N9H A;  2IGO A;  3HOW J;  2OBP A;  4B4C A;  3WTW C;  4G6D A;  4UXN A;  2A6T A;  3KLN A;  4OIP F;  2BYV E;  3PIP F;  2QYO A;  1M1E B;  1QPM A;  2MH2 A;  3FM5 A;  1UZC A;  4G94 A;  5E17 F;  2HVQ A;  4L5E A;  3GXO A;  4A6E A;  4ZYD A;  3H0D A;  2X9D A;  3WTT C;  4XLP F;  5HLG A;  4A3M J;  3CCM I;  2LY2 A;  3WE2 A;  5EGO A;  2HOT A;  1P4A A;  3G2B A;  4LB5 A;  1ZRF A;  2HXI A;  5FLM J;  1P4X A;  4RM3 A;  1E3O C;  3LSH A;  1FEX A;  2LOO A;  5DCM A;  4UVA A;  1Z6R A;  4EJU A;  4C3I J;  2DMQ A;  2ESN A;  2DMU A;  3OYB A;  3WTZ A;  4XRS G;  1OCO H;  1TWG J;  2WV1 A;  2JA7 J;  1A31 A;  4A6D A;  3G1O A;  4PGG A;  2CWE A;  2G7H A;  3OV8 A;  2ZXH A;  1D1C A;  4XSX F;  4D7N A;  4MTD A;  3JRD A;  2CGP A;  2CU7 A;  2R7Q A;  3K4B A;  2K9S A;  5KCM A;  4ZZD A;  3F8N A;  4HF2 A;  1HW1 A;  4YRV A;  4E7J A;  2GOX B;  1ZGW A;  3ABK H;  2A68 F;  5LHI A;  1YYV A;  1SVO A;  4FQG A;  1VFC A;  3OYL A;  4KIF A;  2A07 F;  1SFO J;  2DJN A;  3FXM A;  1Z9C A;  5EJC A;  1UB9 A;  5JLX A;  3D0S A;  5CPR B;  3VPR A;  4A3D J;  3E5X A;  1IAW A;  4RAF A;  5C44 J;  1SD4 A;  2CFO A;  2ISY A;  3FDY A;  3JTG A;  4A3I J;  5TIS C;  2GIZ A;  4JX5 A;  4ESJ A;  5M5Y J;  1FTT A;  2EBI A;  1FP1 D;  3BY6 A;  3O3K A;  1YX5 A;  3KEY A;  2XRN A;  1GHC A;  1CQT A;  2L0K A;  4BQA A;  3H3V K;  4AVP A;  1FZP B;  1S6L A;  2H6C A;  4KUM A;  4CZC A;  2X6X A;  4FE7 A;  5JI6 A;  1HF0 A;  1R5G A;  4YG2 F;  2FEZ A;  1IRX A;  1BR2 A;  2WV0 A;  3KET A;  5LGN A;  2CW8 A;  1ETQ A;  2LKP A;  2VLA A;  3BQY A;  4XLE A;  4KIS A;  3FBN B;  1VQN I;  2UUZ A;  1DP7 P;  1QHG A;  1OQY A;  4A3L J;  3ZQ7 A;  3BTJ A;  1IN4 A;  1JKP C;  2A6H F;  2W48 A;  4LG0 B;  1D1A A;  1HC8 A;  3ABL H;  4Y3O A;  4P55 A;  3FKI J;  4BS9 A;  1ERD A;  3RQI A;  3DU6 A;  5GAD J;  1R23 A;  4ENJ A;  2VBZ A;  4RGR A;  2Y31 A;  1SD6 A;  1MBE A;  3W3C A;  5E3N A;  2QEX I;  1HST A;  2ICW G;  3I71 A;  1ONV A;  3DEU A;  1O3Q A;  3VWB A;  2UXN A;  5KK1 A;  2CSO A;  1FT9 A;  4P9F A;  5IT9 K;  2XAF A;  4C3H J;  1YJ9 I;  2CUJ A;  4HOB A;  1FYL A;  4I6Z A;  2VPR A;  3RYP A;  5KVR A;  1IO2 A;  1GXQ A;  2K27 A;  3AKZ A;  3GZ6 A;  1HSJ A;  2XPV A;  1ZAR A;  3MN2 A;  2COB A;  1HCR A;  3DEE A;  2R7R A;  3QPL A;  4EVI A;  4IOC F;  1X19 A;  2V26 A;  4XSZ F;  4NHJ A;  4RB3 C;  2EZH A;  1FBU A;  3J7A O;  2JVG A;  3R60 A;  1WI3 A;  2STW A;  3GZ5 A;  3MZ8 A;  3L1P A;  5IP7 J;  1T6S A;  4XOP A;  3R0J A;  4IHY A;  1IXS B;  1W4M A;  2JRM A;  2JQ7 A;  3KPH A;  1SAN A;  3PM1 A;  3CMA I;  2ZME A;  3WGH A;  1VQ7 I;  5K1Y A;  3DPU A;  1TNT A;  2L7M P;  2A05 A;  4U7B A;  2JRT A;  3TQN A;  1IRG A;  4CDG A;  2E60 A;  5LLQ A;  2E1M C;  3BR3 A;  3E0J B;  4XLN F;  3IAS 2;  4FHT A;  1RC9 A;  1Y39 A;  5ILV A;  1FSH A;  3CCR I;  4F55 A;  5EF6 A;  4L9J A;  3ZMD A;  1ZGA A;  3GUD A;  1XG1 A;  3BZ6 A;  3CES A;  3V7C A;  1ZLK A;  1IRZ A;  4ZDL A;  1BC7 C;  1ULY A;  5ICF A;  5E8I A;  1TW2 A;  2LYC A;  1I6H J;  4EV0 A;  5LRS A;  2KT0 A;  3MAJ A;  4EM2 A;  1J09 A;  4A0Y A;  4OU0 A;  1B59 A;  3RPQ A;  1ZGJ A;  3KFW X;  1ORK A;  3H36 A;  3CMM A;  1VI0 A;  2VIX A;  2VN2 A;  3FHN A;  3GTM J;  4BXX J;  4A3E J;  2AHQ A;  2Z1D A;  4KJZ A;  4RMN A;  4ZTF A;  2OCE A;  1QNT A;  1XMK A;  2DOE A;  2P5V A;  4NB5 A;  2DA6 A;  2W1O A;  3DV8 A;  3HOY J;  1BJA A;  5BPI A;  1FNN A;  3FHZ A;  2IJL A;  4KNY A;  4OAY A;  1Q1H A;  3KYC B;  2JA6 J;  5J4Y A;  3AL0 B;  4AM3 A;  4W1U A;  2A5W A;  4JX4 A;  3RPU D;  1X1B A;  2NNN A;  4YEL A;  5LHG A;  4G6Q A;  1EH7 A;  4CCJ A;  1W7P B;  3QQA A;  2HQA A;  3K4N A;  3M7G A;  4XNF A;  4RDU A;  3LSK A;  1ZRC A;  3GO5 A;  4DIQ A;  4DBR A;  1F43 A;  4HQM A;  2DLL A;  4M73 A;  4XKW A;  2V1X A;  1T0F A;  2L7K A;  4CCK A;  1XC5 A;  4DOZ A;  1IDZ A;  1WPK A;  2WC2 A;  1OLT A;  2CG4 A;  4KIT B;  1MND A;  3L09 A;  2HYF A;  1PJR A;  2XAG A;  3HPG A;  1ITY A;  3DP7 A;  4EJW A;  1YFH A;  5GPC A;  3DEW A;  3M07 A;  2K4B A;  3F8B A;  3DFG A;  4GO1 A;  2E19 A;  2KDO A;  2M3A A;  3O2P E;  2FOW A;  2Y0S N;  5K7Z A;  4MGR A;  4FET A;  1I1G A;  5KNL A;  5M5W J;  3H92 A;  3OL4 A;  5HS8 A;  2L7Z A;  3ZQG A;  2XSD C;  1W36 C;  1KYZ A;  3I9V 2;  3M9A A;  4IRH A;  5H6R A;  4AYB N;  2QVO A;  4XQF A;  4HRI A;  2EA4 A;  2NS0 A;  3I0T A;  4EM1 A;  4BGD A;  3T5X A;  2O03 A;  3V7R A;  3LST A;  4PCQ A;  2OZU A;  2LY9 A;  2COM A;  2XAH A;  4NDL A;  5FO5 A;  3FK6 A;  1DPR A;  3PSI A;  4HQE A;  2X6W A;  2GIV A;  3BR1 A;  4OAZ A;  2A61 A;  2Y2Z A;  3H3Z A;  1BC8 C;  1FY7 A;  3FX3 A;  3E1S A;  3FXR A;  2NYX A;  4HDU A;  3FXJ A;  3H3U A;  3BQZ A;  4IZZ A;  2F4M B;  1HLV A;  1QU3 A;  2FUG 2;  1I3A A;  1MMA A;  2WB1 A;  3F3X A;  3BG6 A;  2DA2 A;  1NHA A;  1D5V A;  3TW6 A;  1WWX A;  2KPM A;  4M72 A;  3L2C A;  1ETK A;  2GA1 A;  1KU7 A;  4ENM A;  4M71 A;  2BE5 F;  3K70 C;  4Q47 A;  5E8G A;  2E36 A;  2DMN A;  5J1Y A;  3B73 A;  3HSF A;  3GLL A;  3KP2 A;  3L2W A;  1TNS A;  2CQX A;  4A2U A;  3Q5F A;  1D0Y A;  5ED4 A;  4XKC A;  2AQE A;  2IS6 A;  1YS7 A;  3SJM A;  2H27 A;  4CZZ A;  5F0H A;  3C1D A;  5F1J A;  3HEF A;  1MBG A;  2GBY A;  2HYG D;  3K1M A;  4DZJ A;  4L9V A;  2JN6 A;  1ZHF A;  1O57 A;  3IH3 A;  4PDK A;  1KA8 A;  5E3L A;  2PJR A;  5CVJ A;  2DBB A;  2PN6 A;  3W6K B;  3HPH A;  4I7H A;  3Q9S A;  1GV5 A;  1X1P A;  2DT6 A;  3G71 I;  2RNJ A;  4ZC3 A;  4XK4 A;  1KON A;  2MA3 A;  4H4K C;  5J3L A;  3CUO A;  1IN5 A;  2RDP A;  2DDA A;  3ZPL A;  2E5Z A;  2BY1 A;  4EMS A;  1YJW I;  2D45 A;  1SFU A;  2Z16 A;  3A0B C;  3GX4 X;  3CUQ A;  1J0R A;  2RC4 A;  1XDU A;  2VOO A;  3LNQ A;  1BL0 A;  3PO3 J;  2JA2 A;  3C2B A;  3RJP A;  2F5D A;  3U21 A;  2VXD A;  3AG2 H;  1IV6 A;  4D1Q A;  4IRI A;  2FD5 A;  5J4V A;  3F23 A;  3G1M A;  2MBF A;  5BS6 A;  5EGO B;  3A01 A;  1G2H A;  2OQG A;  1XSV A;  1XCV A;  2MW8 A;  4RGS A;  1ZQ3 P;  1IGN A;  2HKO A;  1SC7 A;  5DCM B;  1PYV A;  4LIT A;  4IXA A;  4HSR A;  3DPL C;  3JRC A;  2XPW A;  3CMY A;  1IN6 A;  2R3S A;  3A0H C;  3J80 Z;  1YQA A;  4GRI A;  1QQI A;  5HLT A;  4BDZ A;  2EFP A;  2YR2 A;  2R7D A;  5F64 A;  5DEQ A;  4HLY A;  2L3D A;  3FBI B;  3VYS B;  3EYY A;  5E1X A;  4KDP A;  1VQO I;  3OYC A;  4XRF A;  4FX4 A;  4LIV A;  1DQU A;  2WY8 Q;  2MLG A;  1FIP A;  1YRN A;  3AFH A;  2XAU A;  5FJ8 J;  3KZZ A;  3F72 A;  4E4H A;  1TT0 A;  4BXF A;  5A2Q K;  3I3L A;  3LSI A;  3WTS C;  3U9G A;  3KEQ A;  2V6E A;  2CUZ A;  4M9S A;  1YJN I;  4BHP A;  3K4C A;  4M6V A;  3HKZ A;  4FCY A;  1K6O A;  3DKY A;  2VB6 A;  4HPQ A;  5FLV A;  3GZN B;  1VND A;  4EGY A;  1LDK B;  1UJ8 A;  3PUB A;  2VUM J;  2LK2 A;  1MJA A;  4Q5S F;  2VXZ A;  1K61 A;  4IHS A;  3JRI A;  3QP6 A;  5LGU A;  4PJJ A;  3TP3 A;  1F9N A;  3CCQ I;  4UVC A;  1XS9 A;  2HS5 A;  1TWA J;  2Y48 A;  3IKT A;  1LEB A;  1FX7 A;  1T33 A;  2ZJR F;  3JRF A;  2Y75 A;  2W25 A;  2ZSI B;  3WGG A;  4OIN F;  1MBJ A;  4DBQ A;  3OYE A;  1A35 A;  3JRA A;  3HSE A;  1RET A;  5K7H A;  2PBI A;  4E6K G;  2ADU A;  4CCO A;  5KHD A;  3MVP A;  5FFZ A;  3HUG A;  1J2X A;  1G3W A;  2OTL I;  1OCT C;  4UV8 A;  4JK1 X;  2VPL A;  1BOB A;  3GW2 A;  2R5Z A;  1F5T A;  1XGM A;  3HOZ J;  1R5I D;  2VQH A;  5CVI A;  1LUJ B;  1OCC H;  3LWF A;  2IT0 A;  3PFY A;  2EPF A;  2PMH A;  2XF6 A;  1XD7 A;  5BOX A;  2VBY A;  1YO5 C;  4AIH A;  3FMS A;  3P9I A;  5F0F A;  4FAS D;  3QU3 A;  4RGU A;  2ECC A;  5FKN A;  3V4G A;  1Y1W J;  5EDN A;  2FSW A;  3CUQ C;  3DBH B;  3E6M A;  3F0C A;  4IJA A;  3HOV J;  1S3J A;  4KA4 A;  1MH4 A;  5ILU A;  3LSG A;  2EIJ H;  3MKY B;  2A5Y B;  4ZYH A;  2DN0 A;  1SD5 A;  2P5K A;  4LK1 F;  4YII A;  3MMY B;  4M3B A;  1TQM A;  1VTN C;  3B6C A;  4U0V A;  2EZL A;  3LOC A;  5HNH A;  1RKT A;  2R7W A;  3C2H A;  2HKX A;  3J7A Y;  3BLY A;  2CUF A;  2WAF A;  2VKV A;  3KIO A;  1Y0U A;  2L02 A;  1XPX A;  3FKJ A;  3RKQ A;  2L4A A;  2EIN H;  2ZME B;  3MKW B;  4H0E A;  1X2M A;  3MD2 A;  2NVX J;  4IHT A;  4ESF A;  1D3Y A;  3BJO A;  4OOI A;  3LFU A;  1N25 A;  4NNJ A;  1U8R A;  1TBX A;  1ZG3 A;  3BTL A;  1LFU P;  1H89 C;  2XDV A;  3F22 A;  3LSR A;  3D5R C;  1FBS A;  3E5Q A;  2DFF A;  1QPI A;  4HA8 A;  1OPC A;  1EKE A;  3ASO H;  5ERI A;  3VSL A;  5E18 F;  1W7P D;  2KQR A;  3I59 A;  4CYC A;  2I10 A;  1MNM C;  2VQG A;  1V3F A;  3BCA A;  2W24 A;  4HF1 A;  2WAD A;  1R1U A;  2CYY A;  4BJ5 C;  2DA1 A;  4EEF G;  1QO0 D;  1JUP A;  5JVG F;  2MC4 A;  4R8H A;  1SVL A;  2OU2 A;  3DPT A;  2AQF A;  3WU2 C;  2O5R A;  1WJA A;  2IW5 A;  1SD7 A;  3TL4 X;  2HQN A;  2CS3 A;  2LLK A;  4PJ0 C;  2HNH A;  3U1D A;  3JRG A;  2I8D A;  3S1Q J;  4QTR A;  3HXL A;  4AD9 A;  2DYS H;  4ZYE A;  2KHM A;  3VYU B;  3P9K A;  4G9Y A;  5J8C A;  5HS7 A;  2LDU A;  3IWF A;  5HS9 A;  2P81 A;  4CHU A;  5EG0 A;  4HX4 A;  4CSW A;  2BW3 A;  4HYE A;  1Z67 A;  1V4R A;  2FQ4 A;  5CQE A;  1FLI A;  3G1L A;  3SZT A;  1T98 A;  3GFM A;  4RLF A;  3T8T A;  4J19 A;  2KP6 A;  3BG9 A;  4E7L A;  2YU3 A;  4LK0 F;  5FGM A;  3ELK A;  4V2F A;  4B48 A;  1JJ6 C;  4RB0 A;  3R6S A;  2D1H A;  3U1K A;  4BUP A;  2NNY A;  5L3F A;  2TDX A;  1DUX C;  3K4L A;  2R7O A;  1B72 A;  3O8G A;  3BZC A;  2RN7 A;  4G7Z F;  3M8E A;  3ESW B;  1G4D A;  4O3M A;  3HZJ A;  2IVM A;  3BG3 A;  1EJ9 A;  4NC6 A;  2NXN B;  1VQP I;  4I0A A;  4E7H A;  3EUH A;  2PMZ N;  2LMD A;  2V7F A;  4MFE A;  1Y8Q B;  2PLY A;  3NAR A;  2CRG A;  1JT0 A;  4EJV A;  1JKO C;  2GQQ A;  3S2W A;  4RBO A;  5TRD A;  1FYM A;  4A0Z A;  2QCO A;  2GOM A;  3E7L A;  3OYN A;  3QRF F;  2LTP A;  3HC7 A;  4C30 A;  2IS4 A;  6PAX A;  2N8G A;  2YPR A;  5D6F A;  5BQT A;  2UZK A;  3NWS A;  3CP8 A;  3H5R A;  2OZ6 A;  2HZT A;  3W6J B;  1LDD A;  4CUG A;  1S8N A;  2LF8 A;  4CO8 A;  2A3S A;  1KQ0 A;  3SYT A;  2E1O A;  5B3S H;  4Y17 A;  1WSU A;  2BVL A;  3Q0U A;  4FTH A;  4G6T B;  3W6V A;  1BR1 A;  2JPC A;  3A4C A;  2QEN A;  2J5P A;  2OC6 A;  5D8K B;  1OFC X;  4KT6 A;  4J01 A;  5M3M J;  1BIA A;  2O6G E;  3C18 A;  3BR2 A;  2HQR A;  4AU7 A;  2MD5 A;  2HVR A;  1FMW A;  2RNG A;  2ZNZ A;  3R61 A;  1P7J A;  1L3L A;  4ESB A;  1K79 A;  1YE9 A;  1BIB A;  3ZMU A;  2M5W A;  1Z77 A;  1WI9 A;  5C4X J;  2DK8 A;  2ZNY A;  3MKL A;  1AU7 A;  4CXF A;  2XGD A;  1BW6 A;  1Z05 A;  2CO5 A;  5GAH J;  1IUF A;  1FTZ A;  3DTI A;  4XID A;  4HST A;  3OOP A;  2F4I A;  1ON1 A;  2WB1 N;  3ASN H;  3FXU A;  5AON A;  5IPA A;  4F93 B;  1LB2 A;  5HOD A;  3F21 A;  3QPS A;  2CV0 A;  1S72 I;  2KRH A;  1P4W A;  1TWF J;  2FMY A;  3ZN0 A;  3HIF A;  1N75 A;  3JAM Z;  3O8H A;  5EEH A;  4GCV A;  4I98 B;  5FKL A;  1J75 A;  3ZCO A;  2BGC A;  1UG2 A;  1JGS A;  3VYR B;  5IP6 A;  4GGG A;  2M30 A;  4BJT A;  4UY8 I;  2TRT A;  2PJR B;  1FIA A;  2K5C A;  2EH3 A;  4JBA A;  4PFP A;  4DGW B;  1PUE E;  4GFB A;  1U3E M;  1G3T A;  2XAS A;  5HDN A;  3V8L A;  3OYI A;  4IRG A;  3EET A;  4KMU X;  2XGC A;  3RQ4 A;  4I76 A;  5L3C A;  2XAJ A;  3Q0V A;  3QPT A;  5GPA A;  1TWC J;  2QWW A;  3PFI A;  2ZJ2 A;  2K40 A;  2R7S A;  2XHK A;  2EV6 A;  3E97 A;  5DUI A;  2L4M A;  1VQ8 I;  3WTY C;  1XCB A;  2X1E A;  3U2R A;  3ULQ B;  2BXZ A;  4Z2Y A;  5DDG A;  2DJI A;  2E1N A;  4Y52 J;  2V1N A;  3CUQ B;  3KCC A;  5B66 C;  2OQR A;  3BZK A;  1BOA A;  3EUH C;  3I5U A;  3BJ6 A;  3K0L A;  3WG7 H;  5FLX Z;  3FWE A;  4HZF A;  4XR6 A;  5F1R A;  2J5O A;  2DPD A;  2F5E A;  1ODD A;  3GTK J;  3TOB A;  3A01 B;  2FNP A;  3FIW A;  3BJA A;  4GYI A;  1IV8 A;  2EQR A;  3DBR B;  3D5L A;  4R1H A;  4AIJ A;  2O8X A;  2ACJ A;  1RUO A;  4HAM A;  1IF1 A;  5FD5 A;  2CQ7 A;  2P0W A;  2P4W A;  2VBX A;  1K7A A;  2STT A;  1B6A A;  4ANJ A;  4LD5 A;  1K4T A;  2XKO A;  2P6T A;  4I02 A;  3LL7 A;  3DXJ F;  1SVM A;  4C2T A;  2VQC A;  2V6C A;  4YFK F;  3DWL E;  3HM5 A;  4FE4 A;  3TKY A;  4N0B A;  4HNT A;  3TDU C;  4PJM A;  1WQ2 A;  3GFL A;  4ABZ A;  4PGH A;  1GV2 A;  3PSF A;  1YRN B;  2PMU A;  2JJ7 A;  4U87 A;  3W2W A;  4ASN A;  3VYT B;  4PZJ A;  1MBH A;  2GWR A;  1RRJ A;  3ABM H;  2H1K A;  1X3Z B;  4GYG A;  1T39 A;  1GLN A;  4PSX A;  1UHW A;  1T56 A;  3AG3 H;  3OMY A;  1A04 A;  1TC3 C;  4KYW A;  1REP C;  5BMZ A;  3J81 K;  3ZQQ A;  3I58 A;  4ITV A;  3HL2 A;  3I64 A;  4P96 A;  3HKZ N;  3I4M J;  1SEU A;  2O61 A;  3AG1 H;  3BR5 A;  1XGN A;  4JP0 A;  2ZJQ F;  3F6O A;  4V2G A;  1R36 A;  1BI3 A;  2WAQ N;  4U0Y A;  2W84 A;  2LG4 A;  1VQ6 I;  1ZR2 A;  1WJF A;  2L7F P;  1X3W B;  2CQN A;  1FPQ A;  1QZE A;  2HPI A;  1MIJ A;  1W36 D;  3OYF A;  2D5V A;  1JHH A;  3CF5 F;  2B9S A;  2LVS A;  3JSP A;  3GTP J;  2IEK A;  2HWV A;  3HUG B;  3HJE A;  4E7I A;  1T2K A;  3FXL A;  1HA8 A;  3FXO A;  1DP3 A;  1X1D A;  4BQO A;  1LDJ A;  2R5Z B;  3N4M A;  2R4G A;  3PL8 A;  4D5C A;  5ICG A;  1H88 C;  1FBQ A;  3CC2 I;  2HQ5 A;  5EYR A;  4HLX A;  5LEK A;  4XRS A;  4LG3 A;  2LD5 A;  5TGT A;  2HXO A;  2K9M A;  2V9K A;  1G59 A;  3H0G J;  2VE9 A;  2R92 J;  1IZ1 A;  3CO7 C;  2R7Z J;  3M1C A;  2W00 A;  4RAY A;  2MH9 A;  1XTA A;  3S8P A;  2DYR H;  1P9Q C;  3JCU C;  2WAE A;  2MFZ A;  1SMY F;  1E17 A;  2KZV A;  2PMZ A;  4JX6 A;  3LQQ A;  4D9J A;  4BH9 A;  4PK4 A;  1QA6 A;  3I4N J;  1DU6 A;  5EEA A;  3BG5 A;  2H8R A;  1UCR A;  5K5R A;  3M1E A;  3K70 D;  2K86 A;  1RPW A;  3F8M A;  3G73 A;  3ZMT A;  5D5V B;  1V5E A;  4II2 A;  1O3R A;  2BEO A;  2DOF A;  2QQA A;  3REO A;  2ETH A;  3MZH A;  4XLF A;  2WTE A;  1JHF A;  2XB0 X;  1O3S A;  5DYM A;  4OIR F;  3F6V A;  4XLC A;  2BBY A;  2DT7 B;  3J7Z I;  2Z2S B;  4DJA A;  4XLA A;  2O8K A;  1UFM A;  2OCC H;  2PEX A;  1W0T A;  1VQM I;  1U5T C;  2DW4 A;  4E7K A;  5GAG J;  3HGY A;  3ZOB A;  1N77 A;  4L5I A;  2IA0 A;  1G8X A;  2M34 A;  1T38 A;  3I59 B;  1HOM A;  2ME6 A;  3OY9 A;  2KLO A;  1MJ9 A;  2DOA A;  2XB5 A;  2F6C A;  4MNU A;  3H9J A;  1MSE C;  2VON A;  1WJD A;  3TO9 A;  3GFI A;  1IXC A;  2DFE A;  3L7W A;  4D7M A;  5K5O A;  1V54 H;  3KP5 A;  5IOY A;  1O7F A;  2VI6 A;  3SEZ A;  1I6X A;  1GDT A;  3K2A A;  3G4S I;  3FM3 A;  1UMQ A;  3ZGK A;  4CCM A;  2HVS A;  1NH3 A;  3S1M J;  3P9C A;  1NK2 P;  2E2H J;  1P92 A;  3SEQ A;  1BJZ A;  3TDZ C;  5F27 A;  3BTI A;  1JT6 A;  2C6Y A;  3RSN A;  2JA5 J;  1OCR H;  4ZJZ A;  1Y8R B;  5EG0 B;  1Y1V J;  2MGQ A;  2VOP A;  2BW3 B;  3CP2 A;  3CJR B;  1K78 A;  4KIG A;  4B43 A;  5DUK A;  3RIR A;  1U0J A;  3S93 A;  4XBF A;  2LF7 A;  5DS9 A;  2F2E A;  5HDG A;  1K83 J;  3DKW A;  2BV6 A;  1RNL A;  3SHF A;  4BDY A;  3F8F A;  1B72 B;  4XRM A;  1YHQ I;  4A3J J;  1Y56 A;  4IVN A;  1E3H A;  2RGV A;  3WTX C;  4DYC A;  3ZXS A;  4DZP A;  3KZY A;  5H6Q A;  3W2V A;  1POG A;  2ID6 A;  2NRA C;  1FC3 A;  1G6N A;  2FA5 A;  1MD0 A;  4O5V A;  3TP0 A;  3BRO A;  2IGK A;  4ENK A;  2DMP A;  5FRN A;  4E70 A;  2EFN A;  4ZTJ A;  3FK7 A;  1E3P A;  1GVJ A;  4Y7N J;  2NVQ J;  1ZLJ A;  1J7K A;  1ZYR F;  2VJ4 A;  3CLQ A;  1AKH A;  2M8G X;  3ML6 A;  3BR0 A;  2H8W A;  4HV5 A;  2LP0 A;  4U0W A;  4MQV A;  5E79 C;  3WGI A;  1OYY A;  5LGT A;  2WBM A;  5D8L B;  5GAE J;  1WFX A;  1JUM A;  1NTC A;  1L0O C;  2RQQ A;  3D5S C;  2PG4 A;  2ELH A;  3LAP A;  2YU9 J;  2OTJ I;  1AHD P;  1APL C;  3S1R J;  4PSW A;  1G3Y A;  4YFX F;  1SAU A;  3IRR A;  5C4J J;  2QSH X;  3CO6 C;  1BI1 A;  1A6Q A;  2QQ9 A;  3QOP A;  2NAZ A;  3ECO A;  4M3G A;  5IT9 Z;  3SQN A;  1Z6T A;  3S15 J;  4Q4Z F;  4I09 A;  3V8J A;  5BPD A;  1YI2 I;  1QVU A;  4X1E A;  2K02 A;  3FXK A;  1BR4 A;  1R5H A;  4L5J A;  1ETO A;  2ID3 A;  3KP6 A;  4Y33 A;  2E1M B;  4XIC A;  1WJE A;  4G7O F;  2DA3 A;  1V55 H;  2TCT A;  4UB6 C;  3JR9 A;  1A36 A;  5EZH A;  4RAG A;  4UUS A;  3CTA A;  4LMY A;  2Z33 A;  5HDK A;  4F3Q A;  1E2X A;  4MHG A;  4RB1 A;  2K9L A;  2LBF A;  3FMQ A;  3PIO F;  4L9N A;  5FB2 A;  4WF2 A;  2MSY A;  1WZ2 A;  3RKW A;  3BPX A;  1OYW A;  2CV2 A;  3BTC A;  4FT8 A;  1UHM A;  3G3Z A;  2O9L A;  4BJ6 C;  5M3F J;  2WAQ A;  1GT0 C;  1ZAO A;  1LNW A;  4KIC A;  2CW0 F;  1RES A;  4HDV A;  1U6G A;  4IQ4 A;  1EH8 A;  1CF7 A;  2XUB A;  5B1A H;  3LQR A;  2YSR A;  4E7Z A;  2HDD A;  3R4K A;  3GTO J;  2P5L C;  1WH5 A;  2EK5 A;  5KAI C;  1UEL B;  4GDF A;  3HRU A;  4OMY A;  1HKT A;  1XDS A;  2LNB A;  2X1D A;  2M87 A;  4GXO A;  3LA3 A;  4LJZ F;  1U2W A;  1RR7 A;  5F04 A;  1B9N A;  3L2U A;  4I01 A;  2EA2 A;  3JRB A;  3BCB A;  3K2Z A;  2HDC A;  1EV7 A;  4JQF A;  2L9N A;  3QPH A;  3DKX A;  4M3E A;  1MDM A;  4I2O A;  3OSG A;  2F4O B;  2KMU A;  3H35 A;  2NVY J;  2FQ3 A;  3GBG A;  3OR1 C;  3OYH A;  2DO7 A;  1ON2 A;  1NG7 A;  2FF4 A;  4ETS A;  1LE8 A;  3QAH A;  2R7V A;  3IV5 A;  2DDB A;  3A1Y A;  2DI3 A;  5KAF C;  1XX5 A;  4XLH A;  1YTY A;  1Z3X A;  3ZMZ A;  4X6A J;  2MD0 A;  1QGP A;  3VOD A;  1R4N B;  2BVM A;  5L3G A;  1KU2 A;  2EJR A;  4EJO A;  2R7F A;  2R0Q C;  1B4A A;  2FE3 A;  4AUX A;  3RZO J;  1TT5 B;  2DQR A;  5D4S A;  2M8E A;  4AIK A;  2LKS A;  3IL2 A;  2B0L A;  1VQ5 I;  2DMT A;  5LFA A;  3GF2 A;  2BHY A;  2MG4 A;  2K85 A;  3ZRG A;  1F1Z A;  1WJC A;  3IUO A;  4NBQ A;  1VZ0 A;  4WK8 F;  2BZT A;  2HGC A;  3K4K A;  3GME A;  3AG4 H;  4KT5 C;  5E1Z B;  4BHC A;  1HKS A;  4ON0 A;  3H1C A;  5H2F C;  1UST A;  2FXA A;  1FJL A;  1WKM A;  2XGE A;  2F5C A;  4WXC A;  3TO6 A;  3IRQ A;  2G7U A;  1JTY A;  2V4J C;  4IKF A;  1OYI A;  2ZC2 A;  4M6Y A;  2EFO A;  2EZI A;  2OV7 A;  3CCV I;  5D6E A;  2VC0 A;  2L01 A;  3CCS I;  3OL3 A;  3CJN A;  4BEH A;  1BM9 A;  3GVA A;  2CUE A;  2W85 A;  5L3D A;  1T8I A;  3CC7 I;  2HU9 A;  3ZMV A;  2R5Y A;  3LA7 A;  1RR8 C;  1DGW Y;  2DFI A;  5JHF A;  2EWN A;  4KMF A;  2HZD A;  2XPU A;  4KN7 X;  3DTK A;  4MO7 A;  4BYY A;  4A3K J;  1KQ8 A;  2Q2E A;  1VQ4 I;  3BOQ A;  2GAU A;  1ETY A;  3DTE A;  3RTR A;  1G3S A;  2NOG A;  3Q3S A;  5JVT A;  1BI2 A;  2LH9 A;  2ZB9 A;  4B44 A;  3CDH A;  4DNC A;  4A3C J;  2H6B A;  2RKH A;  1TW3 A;  2M1B A;  3T0Y A;  2QBY A;  2CW7 A;  1K4S A;  1U8B A;  4LLN A;  1J9I A;  2BHZ A;  3LSP A;  3CJT B;  2KFD A;  3SFZ A;  4BU2 A;  1W5C C;  5FFX A;  2XC7 A;  4CGZ A;  1FOK A;  4L18 B;  3WU0 A;  2QKM B;  1XGO A;  4BXU A;  3WHB A;  4K2E A;  1ETW A;  3GCM A;  3K10 A;  2PI0 A;  2NS8 A;  1WJB A;  3IH2 A;  2GLO A;  2KRF A;  3HB9 A;  4N4O B;  2M45 A;  2AS5 F;  1R71 A;  5L3E A;  5E1W A;  3PNY A;  3LMM A;  4O6J A;  1UAA A;  4CCN A;  3DLA A;  2V1D A;  4II3 A;  3NAU A;  4RGX A;  1LVA A;  2O0Y A;  3L00 A;  1H9T A;  2DPU A;  3T1B A;  3H5A A;  2GM4 A;  4Y4R A;  4AWX B;  1ZR4 A;  2DFH A;  4B8X A;  1CGP A;  5D5W B;  3GYH X;  2H94 A;  2D2W A;  1RZ4 A;  3AL0 C;  4A5M A;  3UR3 C;  1R4M B;  2P6S A;  3BT9 A;  4MFD A;  3ZQI A;  4UV9 A;  5M5X J;  3I54 A;  2LSO A;  1IN7 A;  2E2I J;  2FNA A;  4LFU A;  4L9T A;  3OS1 A;  4IHW A;  1HW5 A;  4L0Y B;  2MYS A;  3BP8 A;  1X58 A;  1X4P A;  3BC8 A;  1DPU A;  2FOK A;  2MLK A;  3KX2 A;  3TMO A;  3CCE I;  3M4O J;  3HHH A;  3KEO A;  5K7F A;  1MBK A;  3JRH A;  4EAT A;  1SFX A;  3DQV C;  1ZRD A;  2P8T A;  3ROU A;  1PUF A;  4NQW A;  1OJL A;  2ZXJ A;  3IKV A;  1R1T A;  2JUG A;  2YUS A;  4Y13 A;  3GLX A;  3ZQC A;  2KIM A;  4IF4 A;  2IA1 A;  2OA4 A;  2XVC A;  3O6B B;  3OIQ A;  4QPQ A;  2F48 A;  3K1N A;  5L3B A;  4IHX A;  4BBS J;  2R7X A;  1IC8 A;  3M8F A;  1KU3 A;  3QYE A;  1ZN2 A;  2L9R A;  1F4K A;  2OF7 A;  2W4S A;  3S2H J;  3E5U A;  2ELK A;  3NEU A;  1OCZ H;  1K78 B;  2DXI A;  4RAZ A;  1FOW A;  1MBF A;  3GFJ A;  4BAY A;  1YIO A;  1O3T A;  2VE8 A;  4ENN A;  4Y15 A;  5J8F A;  2G9W A;  5ICC A;  2H1L A;  3CCJ I;  1U78 A;  1JE8 A;  1AWC A;  2VQL A;  3ZQH A;  4A5N A;  4XM3 A;  2DU9 A;  2IXS A;  3MEX A;  3OOU A;  2A6E F;  5A2Q Z;  5LRR A;  2VJI A;  3BG7 A;  4C3J J;  2VJ5 A;  3BDD A;  3KP4 A;  1JUS A;  4NUB A;  2XIG A;  1QHH D;  3V8K A;  3CD6 I;  3R0A A;  2P7C B;  3S16 J;  5F6F A;  2VAS A;  1D0Z A;  1HQC A;  3HBL A;  3CCY A;  3RZD J;  2BXY A;  5LD2 C;  1ETV A;  3E6B A;  1XMX A;  4BL0 B;  2JSC A;  1LFP A;  2JK3 A;  1PDN C;  3SZG A;  1VQK I;  2V79 A;  1B9M A;  5D4R A;  3TED A;  1AKH B;  2XGX A;  3TO7 A;  2VKH A;  3V42 A;  2ZKZ A;  3DLL F;  1X1C A;  2DAO A;  5HLH A;  4YIR X;  4HV6 A;  1LPQ A;  2QKL B;  4IL6 C;  4HF0 A;  3K6G A;  4ZYG A;  5CVU A;  2OJE D;  3RYR A;  2EV0 A;  3S1N J;  5HVQ C;  3CDL A;  1XGS A;  2R93 J;  4S05 A;  2JVH A;  3TOA A;  5ILS A;  3B6A A;  4IPA A;  3KE2 A;  4RM2 A;  4ZYA A;  4KFC A;  1YW7 A;  1D1B A;  4L0Z B;  2F5V A;  4UHT A;  2NVU B;  4BNC A;  4IO9 F;  1K6Y A;  4OMZ A;  2VBW A;  2ECB A;  2FX0 A;  2JWT A;  2HOS A;  5IOZ A;  5B1B H;  3TBI A;  4RS8 A;  4AID A;  1SFK A;  4ZDP A;  2B63 J;  1T08 B;  1HKQ A;  2M0M A;  1LVK A;  1YS6 A;  1DU0 A;  1BN5 A;  4BKX A;  3QOE A;  3JSO A;  1T95 A;  2PFB A;  3WG9 A;  3RDI A;  1MNE A;  2ESH A;  2QQB A;  1U5T A;  3J80 K;  4UUS B;  2Q8K A;  5JFR A;  4BE2 A;  3ISP A;  3QP5 A;  2UWM A;  2HOE A;  4C2M J;  1P6R A;  2DK5 A;  2M7B A;  3MQ0 A;  3QYF A;  2LBF B;  2HR3 A;  1QZZ A;  4XKB A;  4XN0 A;  1IN8 A;  2YX7 A;  3NQO A;  3QOD A;  4AVZ A;  4F52 A;  3E3V A;  1MMS A;  2E7X A;  2VJJ A;  2E2J J;  2HTJ A;  4UVB A;  4F91 B;  5EZG A;  1PP8 F;  3A03 A;  3DBL B;  1S9H A;  2GXA A;  4JYK A;  1LFB A;  2K3F A;  2KRC A;  2AXT C;  1IG7 A;  2D1V A;  4LB6 B;  3PUF A;  3CLO A;  5CVV A;  1DGR M;  1D8K A;  2E71 A;  4EGZ A;  3HGG A;  3OYJ A;  2KIQ A;  5FD6 A;  1BW5 A;  1CF7 B;  1ETX A;  1A6I A;  4QIW N;  1R49 A;  4M6X A;  1JXS A;  4A0X A;  1Z7U A;  4X0G A;  3RPU A;  1Z3Y A;  3S3O A;  3N05 A;  1TL8 A;  2LRD A;  2IAI A;  4BE0 A;  1TP4 A;  1ZRE A;  2MAB A;  1OCP A;  3WE3 A;  2JA8 J;  2QGU A;  4A3B J;  1R00 A;  4EJT A;  1B8I A;  1X3U A;  4XN3 A;  2X4H A;  3HTU A;  2NS7 A;  5FKM A;  3CCU I;  3DCF A;  3ONQ A;  4BY7 J;  1W5T A;  1YIJ I;  2KL4 A;  1RIO H;  1P2F A;  5BNG A;  3K4J A;  3LA2 A;  4QWQ A;  2L54 A;  1ZTR A;  3C3W A;  4M9X A;  1MDM B;  1YG2 A;  3EUK L;  1GVD A;  5JHU A;  2DCE A;  1V5G A;  1WH7 A;  3I4P A;  2IS1 A;  5F08 A;  1Y6I A;  1LE8 B;  2GA2 A;  1ZG5 A;  1B1B A;  4DYQ A;  1O4X A;  2HPM A;  4HG2 A;  3RCO A;  5TJJ A;  3N97 A;  2CV1 A;  2Z9O A;  2LRE A;  2M2E A;  1GUU A;  1R1V A;  3HDD A;  3DU5 A;  5JLW A;  1OIS A;  2WWY A;  2ZCW A;  1JI8 A;  2BOL A;  2JUC A;  2ME0 A;  3KP3 A;  2G0E A;  2KIU A;  2IBD A;  3BPV A;  2JTV A;  1KYW A;  4WWC A;  1HW2 A;  3VSK A;  4RA2 A;  3HOX J;  4XON A;  2QSF X;  4V19 K;  4QLC U;  3JRE A;  5CYV A;  3CJQ B;  1Z21 A;  2H09 A;  1MMN A;  2XRL A;  3ERE D;  2ISZ A;  1YW8 A;  2Q0O A;  2JPB A;  3SFI A;  4ZDO A;  4Q48 A;  3J7Y J;  4RLQ A;  2Y0M A;  3H5N A;  4MIM A;  4UNO A;  3PJR A;  4IOA F;  1Z0X A;  1IDY A;  1N78 A;  3KYL A;  2K9Q A;  3GEZ A;  3HRS A;  3P5J A;  3CDI A;  1YOV B;  4PJL A;  3TGN A;  3VEP A;  5E3M A;  4M9Z A;  3HRM A;  1MMG A;  4HX7 A;  2ZO4 A;  3V7S A;  4BEH B;  5J6X A;  5EEG A;  4BE1 A;  3ZQL A;  2O7O A;  5IYC J;  2ZJP F;  4D5F A;  2R5Y B;  2Z99 A;  3OS0 A;  4CYC B;  2ZXI A;  2Q1Z B;  1NK3 P;  3HG9 A;  4HNU A;  2QLZ A;  1JJ8 C;  2Q2E B;  1YIT I;  3ABT A;  4IHV A;  1QZY A;  2W57 A;  3IP4 B;  4HX8 A;  2R7T A;  3IHU A;  1ZG1 A;  1ENH A;  3KLO A;  4KN4 X;  4LLG F;  2XV4 S;  4G8X A;  1X4O A;  3TW7 A;  2LFB A;  5HOO A;  2XF7 A;  3GTL J;  1WVR A;  1FP2 A;  3S3M A;  2A69 F;  4HW0 A;  1UG0 A;  3PNT A;  2QBY B;  2X48 A;  2RRE A;  4U88 A;  1H8A C;  2PX9 A;  3IC7 A;  3MCZ A;  4M74 A;  3F8C A;  4WCG A;  2X1C A;  2ZME C;  3WTV C;  1KU9 A;  1FWZ A;  3PNV A;  4A3G J;  2FML A;  5CJ9 A;  3OS2 A;  1VQL I;  2QSG X;  4BQQ A;  3CZ6 A;  4ZH4 F;  1LJ9 A;  1SMT A;  1MSF C;  2ZBK A;  4U7D A;  1I27 A;  1XSX A;  2QUF A;  4CA0 A;  1FYK A;  3FXQ A;  3ZR8 X;  1EA3 A;  3SXY A;  3ERM A;  2OUM A;  3WHC A;  4KIB A;  3HOU J;  1D8J A;  1NG6 A;  2JSP A;  1YLF A;  1ZH5 A;  1I5Z A;  2M0C A;  5LHH A;  4LLL A;  3JTH A;  1I39 A;  2X6O A;  4B09 A;  1IUY A;  2MC3 A;  3C7J A;  3F9K A;  4S04 A;  2OD5 A;  1YX3 A;  5FRO A;  4B3X A;  2O3F A;  1JGG A;  3S3N A;  2V9P A;  4A69 C;  2ZFW A;  1IJW C;  2CFX A;  1IW7 F;  3K9T A;  1OMI A;  2LKX A;  1FOX A;  1WJ5 A;  4OWR B;  1X1A A;  4YEJ A;  4PFO A;  4UUV A;  2Z5U A;  2UV1 A;  3E6C C;  3K69 A;  1U9O A;  3L2V A;  4XKV A;  4I0B A;  5E20 A;  2GXB A;  1A5J A;  2EIK H;  4EM0 B;  3EQL F;  1HDD C;  4QSH A;  2LY1 A;  4HBL A;  4DW6 A;  3LAJ A;  1Z1D A;  3S17 J;  4N9I A;  2AXL A;  2GZW A;  3LSJ A;  2LR8 A;  2JMW A;  2HEO A;  1HDP A;  3D1N I;  5AIP A;  3KYD B;  4R79 A;  2CMP A;  1XN7 A;  1LKX A;  2NOJ B;  4P9U A;  4WXH A;  1T0F C;  2K3P A;  4IX7 A;  1YW9 A;  1Y0N A;  1IXR C;  5HNF A;  4LOC A;  1C0W A;  3HRT A;  5DM7 F;  4CYD A;  3B02 A;  4LG0 A;  1D5Y A;  5D5X B;  1PUF B;  2EV5 A;  4NQW B;  2VT2 A;  1TZL A;  1I3Q J;  3T8R A;  3UKG A;  4P5O A;  1RUN A;  1MGT A;  3I56 I;  4I99 C;  3QU6 A;  2IPQ X;  4MEX F;  1D0X A;  3C2G A;  1PVE A;  2Y9Z A;  5DCF A;  2XRO A;  4WXD A;  2JT1 A;  1SAX A;  1OR7 A;  3K7A J;  1RKW A;  2PQ8 A;  1KGS A;  3WU1 B;  5FKO A;  4G12 A;  3M8J A;  1VQ9 I;  2KIS A;  3MKZ A;  4UUT A;  2DQL A;  2HOA A;  3OYA A;  3X2Q H;  3GTQ J;  1LQ1 A;  1BI0 A;  1HXD A;  5F0C A;  1MKM A;  4RB2 C;  3SZP A;  2W82 A;  4CH7 A;  1RI7 A;  3VDX A;  1FMV A;  2KZG A;  1JTX A;  4MLO A;  4NC7 A;  3UNG C;  1ACI A;  4XOT A;  2EFQ A;  3OIO A;  3MWM A;  4BHB A;  3CME I;  2UXX A;  3K1P A;  4MTE A;  1ZKG A;  2XAQ A;  3E6D A;  5ICE A;  2BY3 A;  1Z7L A;  1KZH A;  4E7S A;  4CCL A;  2M9H A;  1AA7 A;  3WOD F;  3ZN1 A;  3JAM K;  5GP9 A;  2QQ8 A;  5IP9 J;  4F92 B;  2BY0 A;  1S5L C;  2GXG A;  1P7I A;  1U9N A;  3RKY A;  2VOD A;  2HI3 A;  1W5S A;  2EZK A;  1HBX G;  4FX0 A;  2X85 A;  2IGN A;  2VL8 A;  4QPO A;  3SDB A;  5JR3 A;  3J81 Z;  3NRV A;  4DQ2 A;  3A2K A;  1FOY A;  4MQ9 F;  2KKO A;  2LC2 A;  2VKD A;  4XL9 A;  3L2R A;  1SFE A;  1STZ A;  2FBH A;  1E0E A;  5FKK A;  4G7H F;  3W2A A;  2YS9 A;  1ZK8 A;  1MZB A;  5LBQ A;  2RVC A;  2DA5 A;  2JZY A;  3OIP A;  2HFH A;  1OKR A;  5CQG A;  1EH6 A;  3GWZ A;  2FRH A;  2WY7 Q;  1DDN A;  1J5Y A;  2M7A A;  1EF4 A;  4XOR A;  4BBR J;  2M4G A;  2K7L A;  1S29 A;  1S7E A;  2CJJ A;  1JKR C;  2IRF G;  2IA2 A;  3OSF A;  1FSE A;  2XSJ C;  5AIQ A;  5FLX K;  5IYD J;  1MW7 A;  2HDW A;  3LSM A;  3HYI A;  2ZSH B;  3MFK A;  3OYM A;  2NVT J;  2E1C A;  1TQP A;  3IWZ A;  5K5Q A;  2E34 A;  3HTS B;  3COA C;  3GTJ J;  5CVR A;  3CQZ J;  2DA4 A;  2CQQ A;  1MMD A;  5IYB J;  4IQJ A;  4OIQ F;  3H9Q A;  2ZXW H;  4S0H B;  1TTY A;  1AOY A;  4YFN F;  4DYR A;  1WGX A;  4ZZL A;  2FU4 A;  3L2Q A;  1X2N A;  1U5T B;  1Q1V A;  1H0M A;  3PQK A;  2FJ1 A;  3S2D J;  1W7P A;  1BBY A;  2HTS A;  4J00 A;  3EPZ A;  1W0U A;  2F5F A;  2EIM H;  4JOM A;  3M3Y J;  4LIU A;  4NC8 A;  5GTH C;  2KIF A;  3P7N A;  3FZV A;  3VOE A;  2K4J A;  4YIF A;  1I50 J;  3JW4 A;  5IT3 A;  4FIS A;  2DTZ A;  2I5U A;  3RI4 A;  5CKT A;  4CIC A;  1PP7 U;  1OR7 C;  3FMR A;  4C2U A;  1S7O A;  2OAZ A;  3I55 I;  2IGM A;  3HOT A;  1V5F A;  1QRY A;  1USS A;  4M3F A;  3H9G A;  1LEA A;  2Y30 A;  3GTG J;  1I1S A;  2KJB A;  2RAE A;  3OYD A;  5DV5 A;  4C9Y A;  5J40 A;  2Y0S A;  3EDP A;  1QVT A;  2HYJ A;  1S7A A;  3BWG A;  2RQP A;  2X6Y A;  2QM3 A;  5H20 A;  1TQI A;  3L9F A;  3IH4 A;  2QF7 A;  2B7E A;  2IS2 A;  2VKE A;  4AYB A;  9ANT A;  2EB7 A;  3HSR A;  3OR2 C;  4W97 A;  2Z3Y A;  3AAF A;  3EUA A;  4LGW A;  5HLI A;  1WRJ A;  3ZP5 A;  3CC4 I;  1XMA A;  4M3D A;  4IEJ A;  2W7N A;  2L9V A;  2BY2 A;  1MJB A;  2DOD A;  4B1R A;  5GTI C;  4OIO F;  2CH0 A;  2KJC A;  2RV8 A;  4EQQ A;  5FRM A;  2L5Q A;  1B8I B;  5C3E J;  4MEY F;  3IAM 2;  3FIS A;  2Y9Y A;  1F36 A;  1XB4 A;  5IY5 H;  3OWT A;  2IP2 A;  1GXP A;  2V9V A;  3LFK A;  4D0P A;  2ZFU A;  1O7L A;  2K9N A;  4WX9 A;  2M4K A;  2YX4 A;  1R22 A;  2X51 A;  1J59 A;  3SDG A;  1WCM J;  2ELJ A;  4HNV A;  1XSD A;  1R6R A;  3S32 A;  2E35 A;  3KZI C; 
#chains in the Genus database with same CATH homology
 1R9T J;  2XB0 X;  3S1N J;  3CDL A;  5DTD A;  1VF9 A;  2R93 J;  1BA5 A;  1MH3 A;  3B6A A;  2O8K A;  1W0T A;  1FIP A;  2DA7 A;  4B3A A;  1YRN A;  5FJ8 J;  3BR6 A;  2AO9 A;  3HGY A;  3ZOB A;  2M34 A;  3PO2 J;  1HOM A;  2ECB A;  2ME6 A;  2FX0 A;  4M6V A;  4FCY A;  2JWT A;  2XB5 A;  3ZQF A;  5IOZ A;  2HOS A;  3A02 A;  1UHS A;  5FLV A;  1VND A;  1MSE C;  2B63 J;  4D7M A;  2VUM J;  2LK2 A;  1K61 A;  1DU0 A;  5IOY A;  4BKX A;  5E3O A;  2VI6 A;  3JRI A;  1GDT A;  3TP3 A;  3K2A A;  1UMQ A;  4UUS B;  1XS9 A;  3S1M J;  1TWA J;  4C2M J;  1NK2 P;  2E2H J;  1BJZ A;  1T33 A;  4A93 J;  5F27 A;  3BTI A;  3JRF A;  1JT6 A;  3S14 J;  1JKQ C;  4A3F J;  2JA5 J;  2E2J J;  1MBJ A;  5EG0 B;  1Y1V J;  3JRA A;  2MGQ A;  1RET A;  5K7H A;  1TWH J;  5EZG A;  4AC0 A;  3A03 A;  5J1U A;  3Q0W A;  4JYK A;  3MVP A;  5J1R A;  4BY1 J;  1LFB A;  2KDZ A;  2OPT A;  1IG7 A;  1OCT C;  5DS9 A;  3HOW J;  1K83 J;  4B4C A;  2R5Z A;  3HOZ J;  3HGG A;  1BW5 A;  1ETX A;  1A6I A;  4QIW N;  1B72 B;  4XRM A;  4A3J J;  5F0F A;  4L5E A;  5FKN A;  2ECC A;  2IAI A;  5EDN A;  1Y1W J;  2X9D A;  3F0C A;  1OCP A;  4DYC A;  3HOV J;  2JA8 J;  4A3B J;  1MH4 A;  4DZP A;  4A3M J;  3LSG A;  1POG A;  2ID6 A;  5EGO A;  1B8I A;  2HOT A;  2NS7 A;  2DN0 A;  5FKM A;  3DCF A;  4M3B A;  4BY7 J;  3TP0 A;  2HXI A;  5FLM J;  5BNG A;  1E3O C;  3B6C A;  1FEX A;  2DMP A;  2EZL A;  3LOC A;  3FK7 A;  1ZTR A;  1RKT A;  4Y7N J;  2NVQ J;  1GVD A;  4C3I J;  1WH7 A;  2DMQ A;  1AKH A;  5F08 A;  2CUF A;  2M8G X;  2DMU A;  2VKV A;  4XRS G;  3BR0 A;  1TWG J;  2WV1 A;  2LP0 A;  2JA7 J;  3RKQ A;  1LE8 B;  3G1O A;  4DYQ A;  4D7N A;  1X2M A;  1O4X A;  2NVX J;  3JRD A;  2CU7 A;  1JUM A;  1NTC A;  2K9S A;  2YU9 J;  2M2E A;  3BTL A;  1GUU A;  1LFU P;  1H89 C;  5JLW A;  3HDD A;  1AHD P;  1ZGW A;  1APL C;  3LSR A;  3S1R J;  1QPI A;  2ME0 A;  1VFC A;  5C4J J;  2G0E A;  2IBD A;  1SFO J;  2DJN A;  5JLX A;  3HOX J;  3VPR A;  4A3D J;  4M3G A;  3JRE A;  5C44 J;  4CYC A;  4A3I J;  2I10 A;  1MNM C;  4JX5 A;  1FTT A;  5M5Y J;  2EBI A;  2XRL A;  2DA1 A;  4EEF G;  3S15 J;  1QVU A;  4X1E A;  1JUP A;  1CQT A;  2L0K A;  3SFI A;  3H3V K;  1ETO A;  2ID3 A;  4XIC A;  4FE7 A;  4MIM A;  1HF0 A;  2DA3 A;  2LLK A;  2TCT A;  3JR9 A;  1ETQ A;  3JRG A;  5EZH A;  3S1Q J;  1Z0X A;  1IDY A;  3BQY A;  4QTR A;  4UUS A;  2K9Q A;  4A3L J;  3BTJ A;  1JKP C;  2W48 A;  5E3M A;  3ZQL A;  2MSY A;  2P81 A;  5EG0 A;  3FKI J;  2O7O A;  5IYC J;  2R5Y B;  4D5F A;  3RQI A;  4CYC B;  2FQ4 A;  3BTC A;  1NK3 P;  2O9L A;  3G1L A;  4J19 A;  1JJ8 C;  2Y31 A;  1MBE A;  5E3N A;  5M3F J;  3BG9 A;  1GT0 C;  4IHV A;  4V2F A;  1JJ6 C;  1ENH A;  1RES A;  4C3H J;  4I6Z A;  2VPR A;  3TW7 A;  2LFB A;  3GTL J;  1B72 A;  3O8G A;  2HDD A;  3GTO J;  2X48 A;  1H8A C;  1WH5 A;  2XPV A;  3MN2 A;  2COB A;  1HCR A;  3BG3 A;  3QPL A;  2PMZ N;  4A3G J;  4MFE A;  3NAR A;  2EZH A;  1RR7 A;  2CRG A;  5F04 A;  1JT0 A;  1JKO C;  3JRB A;  4RBO A;  1WI3 A;  1MSF C;  2QCO A;  3E7L A;  3L1P A;  5IP7 J;  4M3E A;  4IHY A;  3OSG A;  2LTP A;  3WHC A;  3HOU J;  2N8G A;  2NVY J;  3GBG A;  2M0C A;  1SAN A;  3PM1 A;  1LE8 A;  2X6O A;  2E1O A;  3IV5 A;  2L7M P;  4FTH A;  3Q0U A;  3W6V A;  4X6A J;  3BR3 A;  1JGG A;  2R0Q C;  4A69 C;  1OFC X;  1IJW C;  2LKX A;  4AUX A;  3RZO J;  5M3M J;  5EF6 A;  3BR2 A;  1XG1 A;  1IRZ A;  2DMT A;  1U9O A;  1P7J A;  2MG4 A;  1I6H J;  1A5J A;  2KT0 A;  1HDD C;  1Z77 A;  4QSH A;  1ORK A;  5C4X J;  3MKL A;  4DW6 A;  1AU7 A;  2XGD A;  4BXX J;  1VI0 A;  3GTM J;  3S17 J;  1BW6 A;  3LSJ A;  4A3E J;  2AHQ A;  2LR8 A;  2JMW A;  1IUF A;  1HDP A;  3D1N I;  1FTZ A;  1FJL A;  2XGE A;  4XID A;  1JTY A;  2DA6 A;  2WB1 N;  5IPA A;  3HOY J;  2EZI A;  5HOD A;  3QPS A;  4LOC A;  1TWF J;  2JA6 J;  4W1U A;  1D5Y A;  4JX4 A;  3O8H A;  1PUF B;  2CUE A;  1I3Q J;  5FKL A;  3UKG A;  2R5Y A;  1UG2 A;  5IP6 A;  3QQA A;  2TRT A;  2XPU A;  4MO7 A;  4RDU A;  4A3K J;  2Y9Z A;  1F43 A;  1FIA A;  3K7A J;  2EH3 A;  1ETY A;  1RKW A;  2NOG A;  3Q3S A;  4GFB A;  5FKO A;  4G12 A;  1XC5 A;  2XGC A;  2ZB9 A;  4I76 A;  4UUT A;  1IDZ A;  2HOA A;  3Q0V A;  3GTQ J;  4A3C J;  1WPK A;  5GPA A;  1TWC J;  5F0C A;  2K40 A;  1ITY A;  1U8B A;  4MLO A;  1JTX A;  3OIO A;  5GPC A;  3DEW A;  4Y52 J;  1ZKG A;  3LSP A;  2E19 A;  2Y0S N;  5K7Z A;  2M9H A;  5M5W J;  2XSD C;  5GP9 A;  2L7Z A;  3ZQG A;  5IP9 J;  3WHB A;  1P7I A;  1U9N A;  4AYB N;  1ETW A;  3GTK J;  3A01 B;  2HI3 A;  2EZK A;  2NS8 A;  3FIW A;  2GLO A;  3IH2 A;  2EQR A;  3HB9 A;  2LY9 A;  4NDL A;  3FK6 A;  3NAU A;  3BR1 A;  2Y2Z A;  5FKK A;  2YS9 A;  1ZK8 A;  2DA5 A;  2GM4 A;  1ZR4 A;  3BQZ A;  1HLV A;  3HM5 A;  4FE4 A;  1EF4 A;  3BT9 A;  4ABZ A;  4MFD A;  3ZQI A;  4BBR J;  1GV2 A;  5M5X J;  1YRN B;  1S7E A;  2CJJ A;  1JKR C;  2E2I J;  2JJ7 A;  3OSF A;  2DA2 A;  1MBH A;  4IHW A;  2H1K A;  5IYD J;  3TW6 A;  2NVT J;  1ETK A;  1X58 A;  1T56 A;  3GTJ J;  3M4O J;  3CQZ J;  2DA4 A;  2DMN A;  5J1Y A;  1TC3 C;  2CQQ A;  5IYB J;  5K7F A;  2CQX A;  1MBK A;  4S0H B;  3JRH A;  4DYR A;  3HKZ N;  1WGX A;  3I4M J;  3SJM A;  3BR5 A;  5F0H A;  1X2N A;  1PUF A;  4JP0 A;  1OJL A;  5F1J A;  3HEF A;  4V2G A;  1MBG A;  2GBY A;  2WAQ N;  1Q1V A;  4DZJ A;  2FJ1 A;  2YUS A;  3S2D J;  2JN6 A;  3IH3 A;  3ZQC A;  1ZR2 A;  2L7F P;  1W0U A;  3M3Y J;  5E3L A;  4IHX A;  4BBS J;  1IC8 A;  2D5V A;  1I50 J;  2L9R A;  4FIS A;  2DTZ A;  1GV5 A;  2LVS A;  2OF7 A;  3GTP J;  3S2H J;  2ELK A;  2IEK A;  4XK4 A;  5J3L A;  1QRY A;  1MBF A;  4M3F A;  2R5Z B;  2Y30 A;  4D5C A;  3GTG J;  2RAE A;  1H88 C;  2HQ5 A;  5EYR A;  1QVT A;  2HYJ A;  4XRS A;  2LD5 A;  1U78 A;  2HXO A;  3IH4 A;  3ZQH A;  2QF7 A;  2VKE A;  9ANT A;  3H0G J;  3LNQ A;  4W97 A;  1BL0 A;  3OOU A;  3PO3 J;  3C2B A;  2R92 J;  4M3D A;  4IEJ A;  4C3J J;  1IV6 A;  2R7Z J;  2FD5 A;  1JUS A;  4B1R A;  3S16 J;  3G1M A;  5EGO B;  1B8I B;  5C3E J;  3HBL A;  3CCY A;  3A01 A;  1G2H A;  3RZD J;  3FIS A;  2MW8 A;  1ZQ3 P;  2Y9Y A;  1F36 A;  1IGN A;  1ETV A;  4JX6 A;  1DU6 A;  2JK3 A;  3I4N J;  2K9N A;  5EEA A;  3JRC A;  2XPW A;  3BG5 A;  1AKH B;  3CMY A;  3TED A;  2H8R A;  3SDG A;  1RPW A;  1WCM J;  4HNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...