3S17J

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s17J00
2E1OA 3BG3A 2L7ZA 1DU6A 1WH7A 2XPUA 5EGOA 2MW8A 4B3AA 2AHQA 4DYCA 3NARA 1I3QJ 5FKOA 1JUSA 1JTYA 1MBFA 2EZKA 1IV6A 4A3IJ 3PO2J 1ETOA 1AU7A 3G1MA 2LK2A 3TP0A 3FKIJ 1FTZA 3IV5A 2DA7A 1BJZA 1D5YA 2IAIA 3ZQCA 1B72A 3OSFA 3QQAA 3TP3A 3HOYJ 5M3MJ 4UUSA 1Y1VJ 3QPLA 3JRDA 3JR9A 5F04A 2E19A 1PUFA 4I76A 1MNMC 2YUSA 3SDGA 2DN0A 3G1OA 2H1KA 3TEDA 2IEKA 3O8GA 2K40A 4JYKA 2B63J 2P81A 3JRBA 3CDLA 2E2HJ 3S17J 3ZQFA 1QPIA 2COBA 3RKQA 4BKXA 5C4XJ 4JX6A 3HOZJ 2XPVA 2MG4A 4MFDA 1I6HJ 2ECCA 4S0HB 4IHXA 5F0HA 5IP7J 4D5FA 1OFCX 3VPRA 4Y52J 4BXXJ 2H8RA 4C3JJ 5EZHA 2R7ZJ 1TWCJ 2RAEA 4BBRJ 1ETKA 1BL0A 1VF9A 2AO9A 5M5XJ 1IDYA 2ID3A 2YU9J 4XRSG 4IHVA 4HNVA 1IRZA 4JX4A 3TW7A 5IPAA 3SFIA 4ABZA 1MH4A 5F27A 3A01B 4BBSJ 2R5YA 4C3HJ 2CUEA 3ZQLA 4X1EA 4XK4A 2FD5A 1LFBA 2DA3A 3C2BA 1T33A 1MSFC 3Q0WA 3ZQHA 3S16J 3HDDA 1W0TA 4CYCA 3LOCA 1Q1VA 3ZQGA 5EG0B 2Y9ZA 3BR0A 1CQTA 1FIAA 2IBDA 1MBEA 4MFEA 1APLC 4DYRA 2HYJA 4C3IJ 2LP0A 3B6CA 3UKGA 2Y9YA 1QVUA 4B1RA 5J1RA 2Y31A 5FKKA 2HQ5A 4A3MJ 3JRAA 4B4CA 3GTMJ 1ZK8A 2VPRA 1ORKA 3RZOJ 1HDPA 1XG1A 1Z77A 3HOUJ 5FJ8J 5E3LA 4W97A 5FKLA 3JRCA 2NVQJ 1NTCA 2N8GA 4MIMA 4IEJA 4AC0A 3HKZN 1ZQ3P 2TCTA 4AUXA 1BW5A 3GTPJ 1F36A 3L1PA 1JTXA 5M3FJ 3BTCA 1UG2A 4W1UA 3Q3SA 1ETXA 4M3FA 5F08A 3HM5A 5GPAA 4DYQA 1NK2P 1MBJA 4A3CJ 5DS9A 1HCRA 2ECBA 2LFBA 2MGQA 3BG5A 4FE4A 2E2IJ 2WAQN 2R92J 3BTIA 1MH3A 2X48A 5J1UA 2ME0A 3GTKJ 1TWGJ 1JUMA 2VI6A 3NAUA 1RKTA 1W0UA 3BT9A 4FCYA 1X58A 3I4NJ 1SANA 3JRIA 1ETVA 3G1LA 5GPCA 2HXIA 4QIWN 1VFCA 5IOZA 2ID6A 2ELKA 2LKXA 2EQRA 5IYDJ 5FLMJ 3B6AA 1EF4A 3S1QJ 5IP6A 1BW6A 1U9NA 3K7AJ 1TWAJ 2GLOA 1RR7A 2JK3A 1NK3P 5GP9A 1T56A 2VKVA 5IYCJ 5EDNA 2O7OA 5J1YA 2JA8J 2DJNA 2JN6A 4LOCA 3LSRA 1Y1WJ 1JT0A 2CJJA 4M3BA 2KDZA 1RESA 4MO7A 3MKLA 3A01A 3WHBA 1OCPA 1OJLA 2DTZA 1ENHA 2K9QA 1ZR4A 4UUTA 2R93J 2DA5A 4A3BJ 2M8GX 1IJWC 1SFOJ 1HLVA 3OIOA 2XSDC 5IYBJ 2HOSA 2OPTA 1AKHB 2NS7A 2EZIA 5EG0A 5EYRA 2NVTJ 1WPKA 5EEAA 1MBHA 2M9HA 1ITYA 2EH3A 1IGNA 3ZOBA 4A3JJ 2GBYA 4M6VA 3SJMA 3HEFA 1RETA 2XGCA 4EEFG 5K7HA 1LFUP 2I10A 3MVPA 5M5WJ 3S1RJ 1JJ8C 5E3NA 3BTJA 1YRNB 1GV2A 3H3VK 4A3EJ 2FQ4A 4Y7NJ 3LSGA 2K9NA 4A3LJ 1OCTC 5F0FA 2VUMJ 3JRFA 4DW6A 1IDZA 1R9TJ 1JKPC 5F1JA 5E3MA 2WV1A 3CQZJ 4A3GJ 3S1MJ 2EZLA 2ZB9A 4FISA 5K7FA 3GTJJ 1TC3C 5FLVA 2FX0A 2W48A 2HXOA 3BR2A 1H89C 2GM4A 4XICA 2KT0A 1WGXA 1B8IB 5K7ZA 1X2NA 2XGEA 1JT6A 3BQZA 2HI3A 2EZHA 2JWTA 3FK6A 1U8BA 3QPSA 4IHWA 2CUFA 2JMWA 3FIWA 4XRMA 4MLOA 4QTRA 4FTHA 2XPWA 1ZR2A 2XB0X 1VI0A 1MBGA 2QCOA 2CRGA 1U9OA 2L9RA 3JREA 1VNDA 3HOVJ 2LLKA 3FISA 2WB1N 3GTLJ 2DMTA 1IC8A 1UHSA 3WHCA 2EBIA 1LE8B 3O8HA 3LSJA 4V2FA 3K2AA 2DA2A 2YS9A 5M5YJ 1GUUA 2CU7A 3CMYA 3F0CA 4RDUA 1RPWA 4XRSA 2DMUA 3S1NJ 3JRGA 4A3FJ 4BY1J 3M3YJ 1ETYA 3IH4A 1H88C 5C44J 1AHDP 3S2HJ 2QF7A 2X9DA 4DZPA 2JJ7A 2CQQA 1P7JA 5J3LA 5IOYA 3BR1A 2DA4A 9ANTA 3JRHA 4A3DJ 1ETQA 2M2EA 1GVDA 4G12A 1ZGWA 2LTPA 2R5ZB 2Y30A 2LR8A 5C4JJ 3MN2A 1UMQA 4JP0A 5EGOB 3OOUA 5JLXA 1WH5A 3ZQIA 1HDDC 5FKMA 1TWFJ 1IG7A 1RKWA 3BQYA 2L7FP 1AKHA 1DU0A 3S14J 2LD5A 2R0QC 1MSEC 1ZKGA 2NS8A 5HODA 1P7IA 3HOWJ 3BR6A 3GTGJ 3FK7A 3BR5A 4A69C 1GDTA 1A5JA 1B72B 2L0KA 3BG9A 4D5CA 4IHYA 3OSGA 2NVYJ 4M3DA 2PMZN 1ZTRA 1TWHJ 4UUSB 5FKNA 2VKEA 1A6IA 4D7NA 3M4OJ 1IUFA 2MSYA 3BTLA 1JKOC 3LNQA 2HOTA 1XC5A 1PUFB 5BNGA 1YRNA 1O4XA 1MBKA 3D1NI 3RZDJ 1I50J 1HF0A 1JKQC 2ME6A 5C3EJ 3HGYA 2M34A 3CCYA 3A03A 2JA5J 2XRLA 4A3KJ 5F0CA 1H8AC 4QSHA 1X2MA 5DTDA 1FEXA 4BY7J 3LSPA 4GFBA 3HB9A 1WI3A 2X6OA 2DA6A 1G2HA 2JA6J 1K83J 2K9SA 1B8IA 3PO3J 4D7MA 3S15J 3E7LA 3Q0UA 4X6AJ 4JX5A 5E3OA 3IH2A 1JUPA 1U78A 1BA5A 1JKRC 5EZGA 2Y0SN 2OF7A 3I4MJ 2CQXA 4AYBN 2DA1A 1S7EA 1QVTA 3PM1A 2M0CA 3H0GJ 4RBOA 2R5YB 1FJLA 4M3GA 1XS9A 3Q0VA 5IP9J 3W6VA 2NOGA 4C2MJ 2HOAA 2XGDA 2NVXJ 2O9LA 3DEWA 1HOMA 4L5EA 4J19A 4FE7A 4CYCB 1JJ6C 1LE8A 3HOXJ 1F43A 1ETWA 2Y2ZA 4M3EA 1QRYA 1FTTA 2TRTA 3TW6A 5JLWA 1Z0XA 2L7MP 3HGGA 3RQIA 2DMNA 1E3OC 2JA7J 3GTQJ 3GTOJ 1K61A 2E2JJ 2O8KA 1FIPA 4NDLA 3HBLA 2LY9A 3GBGA 4XIDA 1WCMJ 1JGGA 4A93J 2XB5A 1GT0C 3S2DJ 2DMQA 2DMPA 2D5VA 3DCFA 2HDDA 3BR3A 1POGA 1GV5A 3A02A 2LVSA 3IH3A 4DZJA 4I6ZA 2R5ZA 5EF6A 4V2GA 2FJ1A 2G0EA
chains in the Genus database with same CATH superfamily
2YSRA 4YIRX 4MEXF 3BG3A 1WH7A 2MW8A 2Y75A 4B3AA 4N9IA 3CZ6A 1USSA 1JTYA 1EH6A 1KGSA 3PO2J 2HGCA 3KP5A 1ETOA 4G8XA 3JCUC 4BNCA 2LK2A 2R7WA 1HC8A 3TP0A 2ZSIB 1FTZA 3BZCA 1V5FA 3ECHA 1DP7P 5GAHJ 3GZ6A 5KAFC 4GYIA 3ZN1A 3JW4A 1Y1VJ 3HSFA 1ZREA 3Q5FA 4NC6A 3IRQA 3JR9A 5F04A 2ZC2A 2DN0A 2H1KA 5E79C 3O8GA 4G7ZF 2K40A 4FX4A 1HKQA 2P81A 4YIFA 1J75A 3CDLA 2E2HJ 3S17J 4PFOA 1TQIA 3CJRB 2VXDA 2VJ4A 1JGSA 3PFIA 2COBA 4BYYA 4BKXA 3OYHA 3RKQA 2XPVA 2XVCA 1KU3A 2ZJRF 4M73A 2KZVA 1MKMA 4I99C 4PJNA 2KP6A 4AD9A 5IP7J 4FASD 2XRNA 4XLHA 4BXXJ 2R7DA 3HG9A 3IRRA 2H8RA 2R3SA 2J5PA 3KFWX 5JHUA 3HRSA 3ECOA 5EZHA 1ZELA 3QOEA 3M1EA 5FGMA 2L54A 3OV8A 2FU4A 1QO0D 4UUVA 1WJEA 5FRNA 2QQBA 4ZZLA 1W36D 1X3ZB 4HNTA 3GFLA 3FZVA 3V42A 2K9LA 3SFIA 4XBFA 1MH4A 5F27A 3L2UA 3KE2A 3SYTA 2PJRA 1ERDA 1LDJA 1T0FC 3H5RA 3FX3A 2LOOA 3C2BA 1TLHB 1MSFC 1TNTA 2MH2A 3N05A 5FD6A 3WODF 3BR0A 2LC2A 4DJAA 2RQPA 1CQTA 3P7NA 2MFZA 2IBDA 2KRHA 2D1VA 4N0BA 2OTLI 2XIGA 5B5EC 4G7OF 3JRAA 4B4CA 2VPRA 3CLOA 1HQCA 3KYCB 2OJED 3DBHB 3F21A 3HRUA 2E1MB 3J81K 2PN6A 3HOUJ 2CO5A 2IGMA 2YR2A 2PFBA 2HVSA 5E3LA 3AG2H 1RNLA 1YQAA 1WSUA 2WBMA 1D1AA 3C2GA 4JK1X 3NWTA 1NTCA 4G6QA 4JQFA 4MQ9F 2BY1A 5CQEA 5J40A 2N8GA 1P9QC 3CMEI 1WI9A 4XKCA 4AC0A 3CDIA 1ZQ3P 3K70D 2KPMA 3EUHC 5M3FJ 3BTCA 1OR7A 4GDFA 4WXCA 4IQJA 2GZWA 5F08A 2HQAA 2JVHA 1BI2A 5DUKA 4M6XA 1RUOA 4E6KG 2V1DA 2KZGA 1FLIA 3H5NA 1BR4A 3RPQA 3VOEA 4L0YB 2R92J 1A6QA 3CUOA 4YG2F 1MH3A 3DTEA 3GTKJ 2ME0A 2NS0A 2IW5A 2O61A 2P6TA 1PYVA 3RIRA 1HW2A 1VQKI 1T6SA 1U8RA 1SANA 3GWZA 2MC3A 4KIBA 1TL8A 3G1LA 1JHHA 4RB0A 2DT5A 2HWVA 3FBIB 3CO7C 1KZHA 5IYDJ 5FLMJ 2ELHA 3S32A 1RIOH 2MA3A 2VE9A 1VZ0A 3F9KA 4BQOA 2IS1A 2ZFUA 3Q9SA 1T56A 3ZMUA 2E5NA 5EDNA 5J47A 4IKFA 2O7OA 3J80K 3DWLE 5CJ9A 4ASNA 4M3BA 2KDZA 3HZJA 1HSTA 1RC9A 1X19A 1FP2A 3A01A 1OCPA 1SAXA 1FOYA 2DTZA 2GOXB 2P0WA 4IJAA 4CCKA 4II2A 1SMYF 4ENJA 3DPTA 4ZYEA 3E6CC 1X3WB 4IZZA 3DBLB 5EG0A 3LA3A 1IV8A 1YG2A 4HEA2 4NUBA 3DQVC 4A5MA 3LAPA 1IN4A 1Z1DA 2M9HA 1ITYA 1RI7A 4XR6A 1P4XA 2F2EA 1XB4A 2IS6A 1R1TA 4CICA 2W57A 3GFIA 2E34A 2Z5UA 4M6VA 3SJMA 5HVQC 3WU0A 2D2WA 3FKJA 4L5IA 5HNFA 3FXKA 5LGNA 1FC3A 4BE2A 4LIUA 2IPQX 3W6KB 2X4HA 4BHBA 4ZYHA 1YRNB 4MNUA 1R36A 4A3EJ 2QQ9A 4OU0A 2V6EA 4A3LJ 3VSKA 5DCFA 1S7AA 1OCTC 5D5WB 1M1EB 3I0TA 4XNFA 5DCMA 2QBYB 1R9TJ 3WE2A 4L5JA 3H1CA 5AIPA 3F8NA 2JRTA 1ZLJA 3T1BA 5LLQA 5LEKA 2ZBKA 3MZYA 4OMYA 3VYRB 4I02A 2FX0A 3I4PA 3ISPA 2VXZA 5HS7A 2Y0MA 2QYOA 3CCJI 1VQOI 5HDKA 2EFPA 2GM4A 1A36A 3I9V2 5KHDA 2EFOA 2ZMEA 1B8IB 1Y8QB 2FNAA 4ETSA 2CV2A 1WQ2A 3PQJA 2XROA 1JT6A 4D0PA 2HI3A 4HX8A 2JWTA 3FK6A 2BY2A 4ENMA 2FBIA 3RKYA 1U8BA 4IHWA 2JMWA 3ZRGA 4XRMA 4MLOA 4F7ZA 3G6EI 1E2XA 1W5SA 3NRVA 4B44A 3LSTA 4OIOF 2CW8A 5E1WA 4NBQA 2XB0X 3HHGA 1VI0A 2LRDA 1R49A 1PJRA 1QPMA 2CRGA 3PNYA 3VSLA 1B9MA 2K02A 3CCMI 2L4AA 3ABUA 4KNYA 1L3LA 2WB1N 3AL0B 3DV8A 2MH9A 1D5VA 1SVMA 1P4WA 3WHCA 2L9SA 3LSJA 1T98A 2IRFG 3CCSI 3KYDB 3J7ZI 1TP4A 4RDUA 4XORA 3JRGA 3M3YJ 2P6SA 1ETYA 1H88C 5C44J 3DU5A 1AHDP 2WADA 1IN6A 1SFKA 2X9DA 4M74A 1P7JA 5J3LA 5TGTA 3F8MA 5LHHA 3CJQB 2CS3A 1XTAA 3C7JA 3TO6A 3GCMA 4BEHB 9ANTA 4IF4A 3MZHA 1REPC 2M2EA 3H35A 4G12A 2VIXA 1E3HA 1ZGWA 2RC4A 1HA8A 4Q5SF 1G8XA 4A12A 1EKEA 1XN7A 5CVIA 3MD2A 3MQ0A 2FEZA 2DPUA 2WTEA 2OCCH 3T8RA 3I58A 3OYLA 3DPLC 4ESJA 2KRCA 1AKHA 2C6YA 3S14J 2QLZA 3ELKA 4M9XA 2LD5A 3V8LA 3REOA 2STWA 2R0QC 1ZKGA 3GF2A 3J7AO 3HOWJ 4KN7X 1XDSA 2QUFA 3TL4X 1LPQA 5FO5A 3BR5A 4A69C 5HOOA 3GTGJ 2L0KA 3GW2A 4OIQF 3I59B 2NVYJ 3MWMA 2XDVA 5FB2A 4M3DA 4XONA 4LLLA 4UUSB 4Y33A 2EWNA 2E60A 3U2RA 2DO7A 3O6BB 2YX7A 2MSYA 1Y6IA 3CP8A 4EM0B 1MBKA 3CCQI 1I50J 3KP2A 4A5NA 2Q1ZB 2ME6A 2EINH 3ZMVA 4EM2A 5LRSA 1DDNA 2F5VA 3IWFA 1IW7F 3FXMA 2ZNZA 4MGRA 3CUQA 2L2OA 4OMZA 1WRJA 5ICCA 4BDZA 1H9TA 4A3KJ 3IC7A 5F0CA 4I98B 3W2WA 5DTDA 5FROA 4GFBA 3BWGA 2FQ3A 5BPIA 2L9NA 4GYGA 3CTAA 4Z6YA 1G2HA 5HS8A 2E35A 3PO3J 4LITA 4D7MA 4UY8I 3ERMA 1TQPA 3FMRA 3F72A 3E7LA 3Q0UA 3ZP5A 2J5OA 2XAHA 4KJZA 2R7RA 2ZXWH 1U78A 3T5XA 1BA5A 3WTXC 1WJDA 1XDUA 4WCGA 1MMDA 3K4NA 3OYFA 2Z33A 2LBFA 3I4MJ 1S7EA 4OINF 1SD4A 3MCZA 3PFYA 4IX7A 2DOEA 2VPLA 2R5YB 3RPUA 3Q0VA 5IP9J 2AXLA 3DF8A 3KEQA 2VKDA 3ML6A 4LFUA 2HOAA 3TDZC 3CO6C 2M45A 1JHFA 2PQ8A 4D9JA 2M4GA 5LHIA 4HZFA 5ILUA 3K4JA 1WZ2A 2IGKA 2P5LC 1ETWA 3OYBA 4PSXA 2VLAA 4BH9A 3TW6A 3FMQA 3DBRB 2M8EA 4JBAA 5HLHA 1VQ8I 1I6XA 1S72I 3GTQJ 4L9TA 2F48A 4NB5A 3OYIA 2H8WA 4RLFA 2CUZA 3O3KA 5BS6A 3HBLA 2LY9A 2HZDA 1GT0C 3V7RA 1SD5A 3OY9A 3ASNH 3I56I 3PL8A 4CZCA 2CW7A 3C2HA 1POGA 2L02A 3K0LA 3W2AA 2V6CA 3BDDA 2A61A 2E1OA 3K1NA 1J09A 2IA2A 2L7ZA 2XPUA 3P9IA 3TOBA 5D5XB 3OYJA 1EH7A 2XC7A 4DYCA 5EEGA 1OCOH 5E17F 2GXBA 2CFXA 4PCQA 2H6BA 3SEZA 3D5LA 1AU7A 2DLLA 3R60A 3A1YA 3G1MA 3BLYA 4U0YA 3AFHA 1W4MA 3BCBA 5DV5A 2M3AA 3PUFA 2IAIA 4LK1F 4MTEA 2ZO4A 4LD5A 1P2FA 5ILSA 1Y0NA 5ICGA 3TP3A 5LGTA 4GCVA 2P7VB 3PIOF 4EMSA 1EV7A 2ZNYA 2WC2A 4G94A 1G3WA 3QPLA 4HNUA 3JRDA 4HG2A 4A0YA 2YU3A 4EJTA 4F92B 3IL2A 4BHCA 1QA6A 1LJ9A 2G9WA 4ITVA 4BACA 3HSEA 1QZZA 2GWRA 4KIGA 2IEKA 2CUJA 3BZKA 3KP7A 4PJ0C 3JRBA 1FWZA 2W25A 3ABTA 5JFRA 2V1UA 5CLSA 1XCBA 1WKMA 3ROUA 1IXRC 4Q4ZF 4XKWA 2ECCA 3IKVA 4IHXA 5F0HA 1AA7A 4QLCU 3H3ZA 4IRIA 1U5TA 2VKHA 3FMSA 1W5CC 1FOKA 4C3JJ 5F6FA 4B09A 3HYIA 2R7ZJ 1HKSA 1KONA 1TWCJ 4IVNA 4P1WA 2F6CA 1ETKA 2JSPA 1YW9A 4RB1A 2E1CA 2AO9A 4AIJA 5M5XJ 1T95A 4XRSG 4DOZA 3PQKA 3S93A 2QEXI 1IRZA 4JX4A 5E1XA 3TW7A 3WTYC 4EQQA 4P9UA 2NOJB 4L0ZB 3SZTA 3K1MA 3RCOA 2KLOA 5K5QA 4BBSJ 2CUEA 3HOTA 2STTA 5HLIA 2M5WA 1XSDA 3ZCOA 4XK4A 2FD5A 1LFBA 2DA3A 1K4SA 5CPRB 1K6YA 3ZQHA 4BQQA 3HDDA 3OL3A 1W0TA 3LOCA 4NQWB 2OBPA 3ZQGA 2GXAA 1FIAA 1WJCA 2HFHA 2XAJA 1EJ9A 3K70C 1MBEA 1CF7A 2YPRA 3HUGB 1D0ZA 2DU9A 1V3FA 1APLC 4DYRA 1VQLI 4C3IJ 1LVAA 2LP0A 3B6CA 3UKGA 2BGCA 1JE8A 2HQ5A 4PDKA 4A3MJ 3J81Z 1S7OA 1ZHFA 4ESBA 1Z21A 2ETHA 3O2PE 3I53A 3QYFA 2RNGA 4UB8C 2A6EF 3CC4I 2K86A 1D1BA 2QENA 1XG1A 2DI3A 4BE1A 1BBYA 5FJ8J 4ON0A 1I5ZA 1YTYA 3OIPA 2HYFA 2KRFA 3OYKA 2A5WA 3CP2A 3JRCA 2WAFA 1QZEA 3OYEA 4EJWA 4E7SA 4IHTA 5IY5H 2OZUA 2VQHA 2JPBA 3U9GA 4YFNF 2ZJPF 1JTXA 1K78B 1YS7A 2VN2A 2XAQA 2GA1A 1ETXA 1EH8A 3Q3SA 3OS1A 2BW3B 2HR3A 2EV6A 1G3SA 4CCMA 1EA3A 4A3CJ 4CA0A 3OR2C 1HCRA 5H2FC 3QOPA 2HKOA 2RN7A 3C18A 3QU3A 4KN4X 3G2BA 2WAQN 1UZCA 2HOEA 3CC7I 3BTIA 1DPRA 5J1UA 5L3BA 2L4MA 4HSRA 1BI3A 1UJ8A 2VI6A 1VQNI 1W0UA 2GAUA 3FXOA 4RAFA 2ZCWA 5K5OA 1IRFA 3TDUC 2G7HA 1IN8A 4HV6A 5JVGF 1FPQA 3SHFA 3ZMSA 1FOWA 5IOZA 3CLQA 1LQ1A 2FOWA 3H9GA 2ELKA 3G3ZA 1PDNC 5HDGA 2EIJH 3WU2C 3L9FA 3LFKA 3S1QJ 2VONA 3K7AJ 1TWAJ 2GLOA 3FHZA 1MMGA 5GP9A 3J80Z 4CCOA 2Z16A 3NWSA 3H3UA 3F8BA 5AONA 2XAFA 3L2RA 3CD6I 5J1YA 2JA8J 2O03A 2DJNA 2LKSA 5CVVA 1MDMB 1JT0A 2DFHA 1G3YA 5KK1A 4HF1A 2ZJQF 1RESA 1QU3A 2EJRA 3D5SC 4MO7A 4LB5A 2H09A 2RGVA 3JSPA 3IKTA 1UFMA 2K3PA 2K9QA 1ZR4A 3DLLF 2R93J 2DOFA 3B73A 4EGYA 2FMYA 2FBKA 4LIVA 2PEXA 1SFOJ 1IJWC 6PAXA 5LHGA 3KP4A 2IXSA 2K3FA 2OPTA 2XV4S 3F6VA 3SXYA 1B6AA 1OISA 5EYRA 3J7AY 5D4RA 2NVTJ 4FX0A 2K27A 4MTDA 4DQ2A 3S3NA 5EEAA 1MBHA 2CV1A 5GTIC 2EH3A 2P5KA 2A68F 5CQGA 3ZOBA 5KCMA 1IGNA 1GLNA 2V4JC 4A3JJ 3COAC 2XKPA 5E20A 3FF5A 4ZYDA 3S3MA 4CXFA 1DP3A 2WY8Q 2IVMA 3VWBA 4QPQA 1Z6RA 2H1LA 4ZTFA 5E3NA 2QSGX 5DUIA 1TQMA 3KZYA 3W6JB 3LSGA 1W7PB 3HXLA 3JRFA 1V54H 3DEEA 1JKPC 3EDPA 2ISZA 3ONQA 5F1JA 2R7QA 2WV1A 2HVQA 4IL6C 2V1XA 4A3GJ 1HBXG 2BXZA 2LMDA 4M9ZA 3IP4B 2ZB9A 4PGHA 3GTJJ 3SEQA 2CFOA 3N97A 2HKXA 2L3DA 3HPGA 5FLVA 4BJ5C 2JPCA 2W48A 2VT2A 4RAGA 5JI6A 1Z05A 1XGOA 4E7ZA 2K9MA 5DDGA 5K7ZA 2DOAA 4GXOA 3H0DA 4RGRA 3E0JB 2QKMB 2CSOA 4ZYGA 3QPSA 3I5UA 2BVLA 4HLYA 4CZZA 2Z2SB 3LMMA 3CCLI 4QTRA 1LEAA 2KIQA 2BV6A 2ZKZA 4XLPF 1TW2A 2FXAA 2XPWA 3RSNA 3CESA 2P7CB 1YI2I 2QA4I 1MBGA 4AM3A 2QCOA 2X85A 5H20A 2X6WA 4L9NA 1ON1A 2L9RA 3OYDA 4ZTJA 3HOVJ 2LLKA 3R4KA 1J7KA 1BOBA 5D6EA 5FLXK 1UHSA 2PMZA 2I5UA 1FYKA 2RDPA 3O8HA 3TO9A 4V2FA 3K2AA 4A2UA 2DA2A 2YS9A 3CMYA 4XRSA 4B43A 3I55I 1R7JA 4YIIA 2CG4A 3ZPLA 3VYSB 3G4SI 1LNWA 3S2HJ 4DZPA 5HLTA 2JJ7A 2CQQA 4HLXA 4C9YA 3BR1A 3HOSA 4L18B 4K2EA 1FSHA 4A3DJ 3SQNA 2VJIA 4ZZDA 1ETQA 2RNJA 2ACJA 4B3XA 3KPHA 2Q8KA 3S2WA 4UVAA 3MKYB 2R5ZB 4HV5A 2COMA 2LR8A 1BC8C 5E18F 2H6CA 3MAJA 5C4JJ 1SFEA 3Q9VA 3MN2A 1ON2A 4M72A 1USTA 5EGOB 4IOCF 3OOUA 1TWFJ 3DTKA 3DU6A 3TKYA 3RTRA 1ULYA 1KA8A 1ZRCA 4HQEA 4HPQA 1UAAA 2FNPA 3CJTB 2VB6A 1HW5A 3BR6A 5LRRA 3FK7A 3QWLA 1A5JA 2JTVA 4CGZA 1B72B 1UCRA 2M30A 4F93B 1JI8A 3M4OJ 1IRXA 2HOTA 1MMSA 1PUFB 5BNGA 1YRNA 3QP6A 5H6QA 2Q2EB 3D1NI 3RZDJ 1Z3YA 3L2QA 1JKQC 1HF0A 2OV7A 1STZA 2IGNA 2QBYA 1N25A 3K1PA 3HGYA 3L09A 2EILH 1KU9A 2JA5J 2XRLA 1MJBA 2L7KA 1UG0A 4U87A 4XKVA 4Z2YA 1SD6A 2K7LA 4AWXB 4HOBA 3LAJA 1AOYA 1KYWA 1H8AC 2L9VA 1FEXA 4BY7J 3LSPA 2OD5A 2KJBA 3RQ4A 4OWRB 3M8JA 3WE3A 3M9AA 1K83J 5L3DA 4XMYA 3OOPA 2K9SA 3ZN0A 1B8IA 4NHJA 3S15J 4G6TB 1LFPA 1S3JA 2E36A 3WTVC 4E7HA 4YRVA 3IH2A 1JUPA 2OC6A 1JKRC 1Q1HA 3LL7A 4BU2A 1FYLA 3L2VA 5TISC 3VYUB 2CQXA 1QBJA 2DA1A 3SDBA 3K4BA 4RBOA 3NQOA 3GMEA 3I64A 1FJLA 1B1BA 1XS9A 3RPUD 1GXPA 2H27A 2OTJI 1DPUA 3ZQQA 3W6VA 4ZDLA 1S5LC 2XGDA 2O9LA 2DBBA 2TDXA 4CYCB 4L9JA 4WXDA 2F5DA 5ICEA 3NEUA 3MMYB 2K85A 4M3EA 1FYMA 2OU2A 3KETA 5IT3A 3JAMK 1VQPI 5JLWA 4E7KA 4A0XA 4CH7A 2L7MP 1WHUA 1E3OC 3DXJF 2DMNA 1ZLKA 3GTOJ 2FMLA 3CCVI 1K61A 1LKXA 1AWCA 4EATA 2DODA 4XIDA 2X51A 3HRTA 1JGGA 4BEHA 2YX4A 2W84A 1OYIA 3WU1B 1U6GA 4LGWA 1J5YA 4UVCA 3JTHA 2VJ5A 4V19K 4Q47A 4V2GA 1OPCA 1BW5A 4EV0A 3KYLA 2X1EA 4YEJA 5EJCA 5DM7F 1K79A 4PSWA 3DKXA 3NARA 1J9IA 3HIFA 2W82A 2FSWA 2QM3A 2EZKA 1IV6A 3OL4A 2R7OA 5KVRA 1D8JA 4A3IJ 1T8IA 2LREA 4UHTA 3K10A 1LUJB 5D8KB 4FHTA 4HX4A 3IV5A 2DA7A 1BJZA 4XN3A 4CHUA 5A2QK 1X1AA 2EV0A 1XSVA 2R7FA 3A4CA 4PJLA 3I59A 3OSFA 4KMUX 2ICWG 4F3QA 3KCCA 2IP2A 3LSMA 1MNEA 1TBXA 4UUSA 3HOYJ 3K4LA 3K2ZA 3RYPA 3A2KA 1P92A 4AYBA 3ZMZA 4I76A 2LY1A 4WK8F 1MNMC 3BCAA 5JHFA 1B4AA 4BQNA 2LNBA 2VC1A 2B63J 4OAYA 3H5AA 1V4RA 2EB7A 4FQGA 2V9KA 3ZQFA 5J8CA 1QPIA 5C4XJ 4JX6A 3HOZJ 4F55A 1I6HJ 3A0BC 5J6XA 5HS9A 3FXUA 1BR2A 1OFCX 3VPRA 5HLGA 3B02A 2IA1A 3C1DA 5LEJA 4MHGA 1WVRA 4M6YA 5CYVA 1BI1A 5LGUA 1Y39A 1X1PA 1XSXA 2PX9A 2WY7Q 4BBRJ 4UVBA 1BL0A 4RGXA 1VF9A 2LG4A 3AAFA 1IDYA 2UXNA 2WWYA 4Y4RA 2DT6A 2FUG2 3BPXA 1ZRDA 5IPAA 5B1AH 1V5GA 1IAWA 4ABZA 5ILVA 1BC7C 2R5YA 3M7GA 3D5RC 4XSZF 3MEXA 3ZQLA 4X1EA 3TBIA 3WTTC 1I3AA 4PGGA 2DQLA 5HDNA 1T33A 3QYEA 3ZQ7A 3Q0WA 3GFMA 1Q1VA 3GLLA 1R5HA 4BJTA 5AIQA 1YS6A 4N9HA 1ACIA 4MFEA 3HHHA 2EFNA 2NRAC 2HYJA 4KDPA 1YX5A 3WGGA 1OR7C 2RREA 4C30A 2F5FA 4XLFA 5J1RA 1FBUA 2JRMA 1R23A 1ZG5A 1YOVB 2JVGA 3UNGC 2DT7B 4XOTA 1O7FA 1XD7A 2XAGA 1I27A 4X0GA 1HDPA 2BBYA 2VBWA 2PLYA 4F52A 3U21A 1T0FA 1Z91A 4W97A 3E6BA 4XLEA 5FKLA 4QPOA 1Z7UA 1YO5C 1YFHA 2EPFA 4IEJA 2XHKA 2NAZA 2O0YA 1FOXA 4HX7A 3ZMDA 1N78A 1OCRH 2TCTA 2OQRA 4AUXA 3WGHA 2ZXJA 2HPIA 2RVCA 1SEUA 3GTPJ 3W2VA 2P4WA 2JA2A 4KT6A 4Y17A 5BMZA 3KLOA 4ZH4F 1X1DA 5F64A 3E5UA 3OIQA 3IAS2 5GPAA 1OQYA 3OS0A 2Y48A 4CCNA 2OZ6A 1FSEA 5DS9A 4BHPA 2LFBA 2HZTA 1IN5A 4PK4A 3VYTB 2MGQA 4IOAF 3BG5A 2HNHA 2E2IJ 5GTHC 3DLAA 2X48A 3SZGA 3ZXSA 4YFKF 1JUMA 5JR3A 1RKTA 2UV1A 3JRIA 4QIWN 4Y15A 2VBXA 1O3RA 2EQRA 1HKTA 4HF0A 1YX3A 3B6AA 1EF4A 1Z67A 3EUHA 1U9NA 1YE9A 2JK3A 5EEHA 4BDYA 3R61A 4UB6C 1OLTA 1IRGA 2LH9A 3H92A 2VKVA 5IYCJ 1H0MA 4P96A 4RGUA 2IS2A 4AIKA 3ULQB 1QHHD 3FXQA 1KYZA 4LOCA 1PP7U 3LWFA 2E1NA 3ERED 3LA2A 1I1SA 3MKLA 2IT0A 5DM6F 1IO2A 2A05A 3WHBA 1S6LA 2DXIA 1LDKB 3JTGA 4RMNA 2CMPA 3HC7A 1ENHA 1MJ9A 3BY6A 2M8GX 1ZH5A 3ABLH 3OIOA 5IYBJ 2KHMA 2W85A 3CMMA 2EFWA 2NS7A 4XLNF 1R5ID 2QKLB 3HKZA 4NQWA 3MKWB 3VB2A 3HUGA 4RAZA 2IS4A 3CCRI 3HTSB 4ENNA 3V8KA 2GBYA 3BJ6A 2FBHA 4U0VA 4RS8A 2ZMEC 3HEFA 1BJAA 2XGCA 5K7HA 5E8GA 1DGRM 2I10A 4RB3C 2GQQA 3MVPA 3HSRA 3A0HC 2D1HA 1KU2A 1DGWY 4HA8A 3S1RJ 1JJ8C 3OYCA 1GV2A 3KX2A 3H3VK 2FQ4A 4Y7NJ 2K9NA 2OAZA 2A6HF 2R7SA 3CCEI 3GZNB 4QWQA 2M1BA 1IDZA 1MMNA 2LKPA 3PNTA 4I01A 3V8JA 3CQZJ 1MGTA 1X3UA 3S1MJ 4KUMA 1Y56A 4FISA 5K7FA 1Z9CA 2O8XA 3WTUC 1E17A 2OUMA 1K78A 1YHQI 1BR1A 1H89C 1YIOA 2B7EA 2ISYA 4XICA 4KA4A 3H9JA 2MD0A 1D0XA 2BW3A 1FBQA 3BQZA 3QODA 3GEZA 3SZPA 1ZYRF 2A69F 4G9YA 1E0EA 5B66C 3EUAA 3E6MA 1VQ9I 5LFAA 4RAYA 3KP6A 2KQRA 1G3TA 4UXNA 1IF1A 4EJOA 5FLXZ 4CDGA 1ZAOA 1U9OA 2JUGA 2LDUA 3OYAA 5CKTA 4EGZA 2E7XA 3FISA 1R1UA 3OR1C 1WWXA 4HSTA 4KICA 1BOAA 3GTLJ 2DMTA 4A0ZA 5J8FA 2EBIA 1LE8B 2RQQA 1GUUA 4LJZF 3F0CA 1RPWA 2DMUA 1SFXA 4DGWB 3PNVA 3DPUA 2X6YA 4BY1J 1XGMA 1P6RA 4HYEA 4JOMA 2QF7A 3WG9A 3R0AA 2ZSHB 5IOYA 4IPAA 1O3TA 2XF6A 4LG0B 1BIBA 1WJAA 2XF5A 2KMUA 3RKXA 1MDMA 1ODDA 2L5QA 3UR3C 2VOPA 2DAOA 2KIFA 3DTIA 2Y30A 3U1KA 4AIDA 1R71A 1NH3A 1O3QA 4U7BA 1UMQA 4U88A 1G4DA 4G6DA 4HQMA 5JLXA 3F8CA 1WH5A 4Y13A 2QVOA 1IG7A 2R7VA 1RKWA 5BQTA 1HW1A 3M07A 1DU0A 3CUQC 1U2WA 2BEOA 5L3EA 1MSEC 4NNJA 2HQRA 4YFXF 4II3A 3CJNA 1GHCA 1TT5B 1GDTA 2V79A 1VQ4I 4IHYA 3OSGA 3DP7A 2FF4A 1TTYA 1KQ0A 2M0MA 3V7CA 1YJWI 2P8TA 4D7NA 2VL8A 3M8EA 3BTLA 1YLFA 2BHYA 2Z3YA 4O5VA 4PJMA 1O4XA 2KFDA 2LSOA 1FNNA 2E7WA 5BOXA 1W7PA 3LFUA 1ZGJA 2W00A 3RDIA 1W1WE 1TNSA 1Y0UA 4LK0F 4WX9A 5C3EJ 4H4KC 3MKZA 2M34A 1WJBA 3CCYA 2ESNA 4KMFA 2DYSH 1U3EM 2PJPA 4HDUA 1VQMI 1MD0A 3IWZA 5DEQA 3HB9A 4AVPA 3CMAI 1WI3A 1A35A 5IT9K 1SFUA 2ZJ2A 1YW8A 3VFZA 2JA6J 1D0YA 2QQ8A 3K4MA 2DCEA 4U7DA 4P9FA 2EA4A 2CGPA 2DFFA 2BYVE 2P5VA 2V1NA 2CV0A 2VBZA 2KIUA 4R79A 5E3OA 2MD5A 4R8HA 1L0OC 2OF7A 4AYBN 4IRHA 1QVTA 3PM1A 3H0GJ 4EJVA 4WF2A 3H9QA 4ZJZA 3BG7A 1J0RA 3GXOA 4M3GA 5JVTA 5K1YA 2PJRB 2VODA 4LB6B 4IHSA 4CCJA 1BM9A 3L2WA 1Z6TA 2NVXJ 3X2QH 3DEWA 1HOMA 4L5EA 3MFKA 2EIKH 4ANJA 3BJOA 4ESFA 3JAMZ 3DKWA 1ZRFA 3HOXJ 1F43A 1BN5A 2CW0F 2ELJA 2HDWA 2CH0A 2HTJA 1QRYA 1ZG3A 2DK5A 2F5CA 4L9VA 3E3VA 1IN7A 1Z0XA 3RQIA 1FT9A 1Y8RB 1X1BA 1XMAA 1OKRA 2E2JJ 1J59A 4LLNA 2O8KA 1FIPA 3PUBA 3OMYA 3DFGA 2QWWA 4B48A 1UELB 1QQIA 4BXFA 4A93J 4DNCA 3S2DJ 2HPMA 2XF7A 1MW7A 2DMQA 4ENKA 2D5VA 3DCFA 2BHZA 3GZ5A 5CVJA 3BR3A 2E5ZA 3A02A 2LVSA 1VQ6I 4DZJA 3AG4H 5EF6A 2R5ZA 4HW0A 3OYGA 3QYBA 4FT8A 2AQFA 4RM2A 2FJ1A 5B3SH 3GFJA 4OOIA 1DU6A 5EGOA 1MMAA 3E1SA 2AHQA 1I3QJ 3ZR8X 5FKOA 1JUSA 1MBFA 3G73A 1SAUA 1R4NB 2V26A 1QNTA 3I54A 2W24A 5D5VB 1RZ4A 1P4AA 1RRJA 3M8FA 4PUSA 3T8TA 4BS9A 2K4JA 2LY2A 2F5EA 2H94A 2M87A 2R4GA 2W4SA 5A2QZ 5F1RA 3FKIJ 4AIHA 1NG6A 1U5TC 1K7AA 1D5YA 3ZQCA 3FHNA 1B72A 2JQ7A 3QQAA 3WGIA 2F4IA 3EETA 5M3MJ 3P5JA 5L3GA 2AXTC 2Y0SA 2O5RA 3GVAA 3T0YA 4E7IA 3ABMH 5L3CA 4MEYF 1W5TA 1QZYA 2E19A 1SVOA 4DBQA 1PUFA 2KJCA 2CQNA 2YUSA 3SDGA 3TOAA 1TT0A 2Q2EA 3G1OA 1BIAA 2FE3A 4EJUA 3TEDA 1TW3A 2GIVA 4JYKA 1OCCH 3AG3H 4C2UA 2R7TA 2UXXA 3WTWC 5K5RA 3ASOH 3S3OA 2LF8A 5DD4A 2A6TA 5FRMA 2MG4A 4CYDA 4MFDA 3JSOA 3S8PA 4S0HB 2IGOA 2VE8A 4KITB 4IXAA 4D5FA 1R5GA 3VEPA 2BVMA 2VASA 4UNOA 4Y52J 5KAIC 3ABKH 2PBIA 1D3YA 2ZXHA 3N4MA 2GA2A 2DYRH 2V9VA 3BZ6A 4I7HA 2KDOA 2DK8A 2RAEA 4M71A 3AKZA 5KNLA 1PUEE 3PSFA 1MJAA 3GLXA 4ZC3A 1B9NA 4A6DA 2ID3A 2YU9J 2XUBA 4IHVA 2F4OB 4HNVA 3FDYA 2UWMA 3EQLF 4ZYAA 3A01B 2XAUA 4HF2A 1YJNI 2DTRA 4C3HJ 3FXLA 4ZDPA 3GX4X 4F91B 1C0WA 3R6SA 1XMXA 3BPVA 2FA5A 2A07F 5D8LB 2G7UA 3S16J 2EFQA 4I09A 4CYCA 1FY7A 4FETA 5EG0B 2Y9ZA 2PMHA 5BPDA 4KFCA 1FBSA 2WAQA 3E6DA 2FRHA 2XASA 2OA4A 4RB2C 1KU7A 2M7BA 2NVUB 1N77A 3RKWA 4DBRA 1FZPB 3PSIA 4KISA 2O6GE 2Y9YA 1QVUA 4B1RA 2Y31A 5FKKA 2EV5A 2EA2A 5DD8A 2QQAA 4I0AA 4XRFA 3EPZA 1ZK8A 2GIZA 1ZN2A 3F3XA 3GTMJ 1S29A 1OCZH 5DYMA 1ORKA 3WTSC 3RZOJ 3V7SA 3PIPF 3CF2A 3D0SA 1Z77A 4GO1A 1ZARA 3CC2I 2WAEA 1JXSA 3CDHA 3DEUA 4R1HA 5DCMB 2VBYA 3FM3A 2NVQJ 2VOOA 1YW7A 1WJFA 4J01A 4MIMA 3QPTA 1O7LA 1R58A 2HYGD 4I2OA 3VODA 1O3SA 3HKZN 1F36A 2BY0A 3RJPA 3L1PA 2HVRA 3LSKA 1IUYA 2LYCA 1UG2A 4GRIA 2X1DA 4W1UA 2UZKA 1X1CA 2ZMEB 1MNDA 4M3FA 3HM5A 3OYNA 4DYQA 1NK2P 1MBJA 4A6EA 3F8FA 2ECBA 1YYVA 2RKHA 4FE4A 5E1ZB 1HXDA 1OMIA 2BOLA 1X4PA 4IO9F 1TWGJ 2A3SA 3K6GA 1J2XA 1QGPA 3NAUA 4OAZA 4N4NB 1O57A 3BT9A 1OYWA 4FCYA 1X58A 4LG3A 4H0EA 3I4NJ 1IZ1A 4XOPA 4B47A 2R7UA 1R00A 1ETVA 2B9SA 2WV0A 2W1OA 1G6NA 5GPCA 2HXIA 1VFCA 2ID6A 3W3CA 2LKXA 4IRGA 3L00A 2HDCA 3FBNB 3QP5A 2IA0A 4XSXF 2K5CA 5IP6A 1BW6A 1HSJA 2F4MB 3HPHA 2HTSA 2W7NA 3K69A 1RR7A 2DDBA 5E8IA 3WG7H 1NK3P 2Z9OA 4C2TA 2NNNA 3QRFF 2Z99A 3LQQA 1FP1D 1FX7A 1KQ8A 1YITI 4D1QA 1ONVA 1B59A 1FMVA 2BE5F 3K4CA 1XX5A 1F4KA 3HTUA 2JN6A 5TJJA 3LSRA 3L2CA 5FFXA 1Y1WJ 2CJJA 3HRMA 2MLKA 1SD7A 2E1MC 2KKOA 3QPHA 3H36A 4MQVA 1OJLA 5L3FA 3PJRA 5LBQA 3K4KA 1S9HA 4UUTA 2DA5A 2V7FA 4A3BJ 4PZJA 4S04A 1HLVA 3EYIA 1I39A 3RYRA 2XSDC 4E70A 1A04A 3TQNA 2HOSA 1AKHB 4XM3A 1N75A 1SVLA 3E5XA 5D5UB 2EZIA 1WPKA 2HU9A 2ESHA 1TZLA 3KP3A 3GYHX 3CF5F 1F9NA 5J4VA 4E7JA 2XGXA 2X1CA 4J00A 3HJEA 2AQEA 2FOKA 4XN0A 4BUPA 1RETA 5LD2C 2DFIA 4EEFG 1LFUP 2VQCA 3F22A 5M5WJ 2BZTA 2X6XA 1XCVA 3BTJA 3OWTA 4KT5C 2WA0A 4EVIA 2GXGA 2NYXA 1UHMA 3CCUI 2EIMH 1OYYA 2A5YB 4GGGA 2ADUA 5F0FA 1VQ5I 2PI0A 2VT3A 2VUMJ 4LMYA 4DW6A 3TO7A 1PP8F 5E3MA 1R6RA 4O6JA 4TV7A 4BJ6C 3CUQB 4UV9A 4HDVA 4KYWA 5ERIA 2DQRA 2EZLA 2XKOA 2HS5A 2MLGA 1PVEA 4EM1A 2LF7A 1R22A 3V4GA 4BE0A 5CVUA 1TC3C 1R1VA 3KLNA 2XSJC 5HNHA 1LB2A 2K4BA 3P9CA 1NG7A 1S8NA 2HXOA 3BR2A 3OYMA 3TGNA 2KT0A 2MC4A 4PJJA 1WGXA 1E3PA 2M4KA 1CGPA 1X2NA 2XGEA 1R4MB 2QSFX 1VQ7I 4CUGA 2EZHA 4B8XA 3BOQA 1XMKA 4LLGF 2CUFA 3FXRA 3FIWA 1F5TA 4RA2A 2HQNA 1K4TA 2I8DA 2LBFB 4FTHA 3IHUA 1ZR2A 2R7XA 2CWEA 1G59A 1WFXA 5J4YA 4Q48A 1VTNC 4AU7A 3E5QA 3JREA 3LQRA 2L01A 2ZFWA 1VNDA 1YJ9I 2RV8A 3J7YJ 1WJ5A 3P9KA 1IC8A 1T08B 3IAM2 1RR8C 1BI0A 3ZGKA 5GAEJ 5M5YJ 2CU7A 1GVJA 1LDDA 1LVKA 3S1NJ 4A3FJ 2PMUA 3IH4A 2PG4A 2IJLA 2JUCA 1UB9A 4XLAA 4OIPF 4ZDOA 2DW4A 1U0JA 1YIJI 2DA4A 4CO8A 4WXHA 3K9TA 3JRHA 1DQUA 3IUOA 2VQGA 4E7LA 3KIOA 2NNYA 1GVDA 3I71A 4HBLA 5B1BH 4G7HF 2LTPA 2BXYA 1V5EA 4NC8A 4CSWA 1XPXA 4HRIA 3TMOA 5TRDA 2QSHX 1Z7LA 4BXUA 4JP0A 2BY3A 3ZQIA 4XQFA 5FKMA 5H6RA 3ZMTA 1HDDC 3G71I 4CCLA 3DKYA 4DIQA 4BGDA 3QU6A 3BQYA 2L7FP 2CQKA 1A31A 3EYYA 3LSIA 3KEYA 1D8KA 2MBFA 4AVZA 1W36C 1XGNA 2CQ7A 2NS8A 2GOMA 2CYYA 4M9SA 5HODA 2DPDA 4O3MA 2E71A 1P7IA 4P5OA 4E4HA 3BG6A 2KISA 3FWEA 3U1DA 5ICFA 3BG9A 4D5CA 1FMWA 4N4OB 1SMTA 1Z3XA 2AS5F 2PMZN 3I3LA 2JT1A 1ZTRA 4RM3A 1MIJA 1TWHJ 1X4OA 5FKNA 1DUXC 2VKEA 1A6IA 2OCEA 3GUDA 1IUFA 1JKOC 3LNQA 1XC5A 3RI4A 1LEBA 2X0LA 5D6FA 4NC7A 1NHAA 1W7PD 5GAGJ 1V55H 4XL9A 3L7WA 3FXJA 4YELA 4BL0B 3EUKL 1SC7A 2QZ8A 2WB1A 4I0BA 3A03A 3MZ8A 3E97A 3AL0C 3VDXA 5IT9Z 4Y3OA 4BAYA 3KEOA 4UV8A 2VJJA 3KZIC 4QSHA 3WTZA 1X2MA 1XGSA 3BP8A 4HAMA 5ED4A 2DDAA 3QAHA 4RGSA 1D1CA 2ZXIA 2JSCA 2Q0OA 2X6OA 2UUZA 1U5TB 2DA6A 4XKBA 3SFZA 1MZBA 2KL4A 2Y69H 1QHGA 4IQ4A 4X6AJ 4JX5A 3LA7A 4XLCA 3OS2A 2Z1DA 3M1CA 5EZGA 2Y0SN 1RUNA 1H9GA 2O3FA 1T38A 3KZZA 3LSHA 2M0CA 2B0LA 2V9PA 2QGUA 2VC0A 2KIMA 4KIFA 2DFEA 2M7AA 2VQLA 2NOGA 1K6OA 3R0JA 4C2MJ 3GO5A 3FM5A 1ZGAA 4J19A 4FE7A 5FD5A 4PFPA 1JJ6C 1LE8A 4RLQA 4WWCA 2Y2ZA 3BROA 1GXQA 1KQ9A 1FTTA 1CF7B 2TRTA 1IXSB 1I1GA 3C3WA 1UHWA 2MYSA 4BQAA 3HGGA 2JA7J 5D4SA 2NXNB 2HEOA 2D45A 5CVRA 3F23A 4NDLA 2MABA 3GBGA 1WCMJ 4U0WA 4LG0A 1T2KA 2XB5A 2JZYA 4P55A 1T39A 2DJIA 2DMPA 2HDDA 3BJAA 3AG1H 1GV5A 5GADJ 1F1ZA 2OQGA 3ESWB 2EK5A 3IH3A 4I6ZA 3F6OA 3BC8A 5FFZA 3HL2A 1ZG1A 1IXCA 4S05A 2G0EA 4OIRF
chains in the Genus database with same CATH topology
2E1OA 3BG3A 2L7ZA 1DU6A 1WH7A 2XPUA 5EGOA 2MW8A 4B3AA 2AHQA 4DYCA 3NARA 1I3QJ 5FKOA 1JUSA 1JTYA 1MBFA 2EZKA 1IV6A 4A3IJ 3PO2J 1ETOA 1AU7A 3G1MA 2LK2A 3TP0A 3FKIJ 1FTZA 3IV5A 2DA7A 1BJZA 1D5YA 2IAIA 3ZQCA 1B72A 3OSFA 3QQAA 3TP3A 3HOYJ 5M3MJ 4UUSA 1Y1VJ 3QPLA 3JRDA 3JR9A 5F04A 2E19A 1PUFA 4I76A 1MNMC 2YUSA 3SDGA 2DN0A 3G1OA 2H1KA 3TEDA 2IEKA 3O8GA 2K40A 4JYKA 2B63J 2P81A 3JRBA 3CDLA 2E2HJ 3S17J 3ZQFA 1QPIA 2COBA 3RKQA 4BKXA 5C4XJ 4JX6A 3HOZJ 2XPVA 2MG4A 4MFDA 1I6HJ 2ECCA 4S0HB 4IHXA 5F0HA 5IP7J 4D5FA 1OFCX 3VPRA 4Y52J 4BXXJ 2H8RA 4C3JJ 5EZHA 2R7ZJ 1TWCJ 2RAEA 4BBRJ 1ETKA 1BL0A 1VF9A 2AO9A 5M5XJ 1IDYA 2ID3A 2YU9J 4XRSG 4IHVA 4HNVA 1IRZA 4JX4A 3TW7A 5IPAA 3SFIA 4ABZA 1MH4A 5F27A 3A01B 4BBSJ 2R5YA 4C3HJ 2CUEA 3ZQLA 4X1EA 4XK4A 2FD5A 1LFBA 2DA3A 3C2BA 1T33A 1MSFC 3Q0WA 3ZQHA 3S16J 3HDDA 1W0TA 4CYCA 3LOCA 1Q1VA 3ZQGA 5EG0B 2Y9ZA 3BR0A 1CQTA 1FIAA 2IBDA 1MBEA 4MFEA 1APLC 4DYRA 2HYJA 4C3IJ 2LP0A 3B6CA 3UKGA 2Y9YA 1QVUA 4B1RA 5J1RA 2Y31A 5FKKA 2HQ5A 4A3MJ 3JRAA 4B4CA 3GTMJ 1ZK8A 2VPRA 1ORKA 3RZOJ 1HDPA 1XG1A 1Z77A 3HOUJ 5FJ8J 5E3LA 4W97A 5FKLA 3JRCA 2NVQJ 1NTCA 2N8GA 4MIMA 4IEJA 4AC0A 3HKZN 1ZQ3P 2TCTA 4AUXA 1BW5A 3GTPJ 1F36A 3L1PA 1JTXA 5M3FJ 3BTCA 1UG2A 4W1UA 3Q3SA 1ETXA 4M3FA 5F08A 3HM5A 5GPAA 4DYQA 1NK2P 1MBJA 4A3CJ 5DS9A 1HCRA 2ECBA 2LFBA 2MGQA 3BG5A 4FE4A 2E2IJ 2WAQN 2R92J 3BTIA 1MH3A 2X48A 5J1UA 2ME0A 3GTKJ 1TWGJ 1JUMA 2VI6A 3NAUA 1RKTA 1W0UA 3BT9A 4FCYA 1X58A 3I4NJ 1SANA 3JRIA 1ETVA 3G1LA 5GPCA 2HXIA 4QIWN 1VFCA 5IOZA 2ID6A 2ELKA 2LKXA 2EQRA 5IYDJ 5FLMJ 3B6AA 1EF4A 3S1QJ 5IP6A 1BW6A 1U9NA 3K7AJ 1TWAJ 2GLOA 1RR7A 2JK3A 1NK3P 5GP9A 1T56A 2VKVA 5IYCJ 5EDNA 2O7OA 5J1YA 2JA8J 2DJNA 2JN6A 4LOCA 3LSRA 1Y1WJ 1JT0A 2CJJA 4M3BA 2KDZA 1RESA 4MO7A 3MKLA 3A01A 3WHBA 1OCPA 1OJLA 2DTZA 1ENHA 2K9QA 1ZR4A 4UUTA 2R93J 2DA5A 4A3BJ 2M8GX 1IJWC 1SFOJ 1HLVA 3OIOA 2XSDC 5IYBJ 2HOSA 2OPTA 1AKHB 2NS7A 2EZIA 5EG0A 5EYRA 2NVTJ 1WPKA 5EEAA 1MBHA 2M9HA 1ITYA 2EH3A 1IGNA 3ZOBA 4A3JJ 2GBYA 4M6VA 3SJMA 3HEFA 1RETA 2XGCA 4EEFG 5K7HA 1LFUP 2I10A 3MVPA 5M5WJ 3S1RJ 1JJ8C 5E3NA 3BTJA 1YRNB 1GV2A 3H3VK 4A3EJ 2FQ4A 4Y7NJ 3LSGA 2K9NA 4A3LJ 1OCTC 5F0FA 2VUMJ 3JRFA 4DW6A 1IDZA 1R9TJ 1JKPC 5F1JA 5E3MA 2WV1A 3CQZJ 4A3GJ 3S1MJ 2EZLA 2ZB9A 4FISA 5K7FA 3GTJJ 1TC3C 5FLVA 2FX0A 2W48A 2HXOA 3BR2A 1H89C 2GM4A 4XICA 2KT0A 1WGXA 1B8IB 5K7ZA 1X2NA 2XGEA 1JT6A 3BQZA 2HI3A 2EZHA 2JWTA 3FK6A 1U8BA 3QPSA 4IHWA 2CUFA 2JMWA 3FIWA 4XRMA 4MLOA 4QTRA 4FTHA 2XPWA 1ZR2A 2XB0X 1VI0A 1MBGA 2QCOA 2CRGA 1U9OA 2L9RA 3JREA 1VNDA 3HOVJ 2LLKA 3FISA 2WB1N 3GTLJ 2DMTA 1IC8A 1UHSA 3WHCA 2EBIA 1LE8B 3O8HA 3LSJA 4V2FA 3K2AA 2DA2A 2YS9A 5M5YJ 1GUUA 2CU7A 3CMYA 3F0CA 4RDUA 1RPWA 4XRSA 2DMUA 3S1NJ 3JRGA 4A3FJ 4BY1J 3M3YJ 1ETYA 3IH4A 1H88C 5C44J 1AHDP 3S2HJ 2QF7A 2X9DA 4DZPA 2JJ7A 2CQQA 1P7JA 5J3LA 5IOYA 3BR1A 2DA4A 9ANTA 3JRHA 4A3DJ 1ETQA 2M2EA 1GVDA 4G12A 1ZGWA 2LTPA 2R5ZB 2Y30A 2LR8A 5C4JJ 3MN2A 1UMQA 4JP0A 5EGOB 3OOUA 5JLXA 1WH5A 3ZQIA 1HDDC 5FKMA 1TWFJ 1IG7A 1RKWA 3BQYA 2L7FP 1AKHA 1DU0A 3S14J 2LD5A 2R0QC 1MSEC 1ZKGA 2NS8A 5HODA 1P7IA 3HOWJ 3BR6A 3GTGJ 3FK7A 3BR5A 4A69C 1GDTA 1A5JA 1B72B 2L0KA 3BG9A 4D5CA 4IHYA 3OSGA 2NVYJ 4M3DA 2PMZN 1ZTRA 1TWHJ 4UUSB 5FKNA 2VKEA 1A6IA 4D7NA 3M4OJ 1IUFA 2MSYA 3BTLA 1JKOC 3LNQA 2HOTA 1XC5A 1PUFB 5BNGA 1YRNA 1O4XA 1MBKA 3D1NI 3RZDJ 1I50J 1HF0A 1JKQC 2ME6A 5C3EJ 3HGYA 2M34A 3CCYA 3A03A 2JA5J 2XRLA 4A3KJ 5F0CA 1H8AC 4QSHA 1X2MA 5DTDA 1FEXA 4BY7J 3LSPA 4GFBA 3HB9A 1WI3A 2X6OA 2DA6A 1G2HA 2JA6J 1K83J 2K9SA 1B8IA 3PO3J 4D7MA 3S15J 3E7LA 3Q0UA 4X6AJ 4JX5A 5E3OA 3IH2A 1JUPA 1U78A 1BA5A 1JKRC 5EZGA 2Y0SN 2OF7A 3I4MJ 2CQXA 4AYBN 2DA1A 1S7EA 1QVTA 3PM1A 2M0CA 3H0GJ 4RBOA 2R5YB 1FJLA 4M3GA 1XS9A 3Q0VA 5IP9J 3W6VA 2NOGA 4C2MJ 2HOAA 2XGDA 2NVXJ 2O9LA 3DEWA 1HOMA 4L5EA 4J19A 4FE7A 4CYCB 1JJ6C 1LE8A 3HOXJ 1F43A 1ETWA 2Y2ZA 4M3EA 1QRYA 1FTTA 2TRTA 3TW6A 5JLWA 1Z0XA 2L7MP 3HGGA 3RQIA 2DMNA 1E3OC 2JA7J 3GTQJ 3GTOJ 1K61A 2E2JJ 2O8KA 1FIPA 4NDLA 3HBLA 2LY9A 3GBGA 4XIDA 1WCMJ 1JGGA 4A93J 2XB5A 1GT0C 3S2DJ 2DMQA 2DMPA 2D5VA 3DCFA 2HDDA 3BR3A 1POGA 1GV5A 3A02A 2LVSA 3IH3A 4DZJA 4I6ZA 2R5ZA 5EF6A 4V2GA 2FJ1A 2G0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1O A;  3BG3 A;  2L7Z A;  1DU6 A;  1WH7 A;  2XPU A;  5EGO A;  2MW8 A;  4B3A A;  2AHQ A;  4DYC A;  3NAR A;  1I3Q J;  5FKO A;  1JUS A;  1JTY A;  1MBF A;  2EZK A;  1IV6 A;  4A3I J;  3PO2 J;  1ETO A;  1AU7 A;  3G1M A;  2LK2 A;  3TP0 A;  3FKI J;  1FTZ A;  3IV5 A;  2DA7 A;  1BJZ A;  1D5Y A;  2IAI A;  3ZQC A;  1B72 A;  3OSF A;  3QQA A;  3TP3 A;  3HOY J;  5M3M J;  4UUS A;  1Y1V J;  3QPL A;  3JRD A;  3JR9 A;  5F04 A;  2E19 A;  1PUF A;  4I76 A;  1MNM C;  2YUS A;  3SDG A;  2DN0 A;  3G1O A;  2H1K A;  3TED A;  2IEK A;  3O8G A;  2K40 A;  4JYK A;  2B63 J;  2P81 A;  3JRB A;  3CDL A;  2E2H J;  3S17 J;  3ZQF A;  1QPI A;  2COB A;  3RKQ A;  4BKX A;  5C4X J;  4JX6 A;  3HOZ J;  2XPV A;  2MG4 A;  4MFD A;  1I6H J;  2ECC A;  4S0H B;  4IHX A;  5F0H A;  5IP7 J;  4D5F A;  1OFC X;  3VPR A;  4Y52 J;  4BXX J;  2H8R A;  4C3J J;  5EZH A;  2R7Z J;  1TWC J;  2RAE A;  4BBR J;  1ETK A;  1BL0 A;  1VF9 A;  2AO9 A;  5M5X J;  1IDY A;  2ID3 A;  2YU9 J;  4XRS G;  4IHV A;  4HNV A;  1IRZ A;  4JX4 A;  3TW7 A;  5IPA A;  3SFI A;  4ABZ A;  1MH4 A;  5F27 A;  3A01 B;  4BBS J;  2R5Y A;  4C3H J;  2CUE A;  3ZQL A;  4X1E A;  4XK4 A;  2FD5 A;  1LFB A;  2DA3 A;  3C2B A;  1T33 A;  1MSF C;  3Q0W A;  3ZQH A;  3S16 J;  3HDD A;  1W0T A;  4CYC A;  3LOC A;  1Q1V A;  3ZQG A;  5EG0 B;  2Y9Z A;  3BR0 A;  1CQT A;  1FIA A;  2IBD A;  1MBE A;  4MFE A;  1APL C;  4DYR A;  2HYJ A;  4C3I J;  2LP0 A;  3B6C A;  3UKG A;  2Y9Y A;  1QVU A;  4B1R A;  5J1R A;  2Y31 A;  5FKK A;  2HQ5 A;  4A3M J;  3JRA A;  4B4C A;  3GTM J;  1ZK8 A;  2VPR A;  1ORK A;  3RZO J;  1HDP A;  1XG1 A;  1Z77 A;  3HOU J;  5FJ8 J;  5E3L A;  4W97 A;  5FKL A;  3JRC A;  2NVQ J;  1NTC A;  2N8G A;  4MIM A;  4IEJ A;  4AC0 A;  3HKZ N;  1ZQ3 P;  2TCT A;  4AUX A;  1BW5 A;  3GTP J;  1F36 A;  3L1P A;  1JTX A;  5M3F J;  3BTC A;  1UG2 A;  4W1U A;  3Q3S A;  1ETX A;  4M3F A;  5F08 A;  3HM5 A;  5GPA A;  4DYQ A;  1NK2 P;  1MBJ A;  4A3C J;  5DS9 A;  1HCR A;  2ECB A;  2LFB A;  2MGQ A;  3BG5 A;  4FE4 A;  2E2I J;  2WAQ N;  2R92 J;  3BTI A;  1MH3 A;  2X48 A;  5J1U A;  2ME0 A;  3GTK J;  1TWG J;  1JUM A;  2VI6 A;  3NAU A;  1RKT A;  1W0U A;  3BT9 A;  4FCY A;  1X58 A;  3I4N J;  1SAN A;  3JRI A;  1ETV A;  3G1L A;  5GPC A;  2HXI A;  4QIW N;  1VFC A;  5IOZ A;  2ID6 A;  2ELK A;  2LKX A;  2EQR A;  5IYD J;  5FLM J;  3B6A A;  1EF4 A;  3S1Q J;  5IP6 A;  1BW6 A;  1U9N A;  3K7A J;  1TWA J;  2GLO A;  1RR7 A;  2JK3 A;  1NK3 P;  5GP9 A;  1T56 A;  2VKV A;  5IYC J;  5EDN A;  2O7O A;  5J1Y A;  2JA8 J;  2DJN A;  2JN6 A;  4LOC A;  3LSR A;  1Y1W J;  1JT0 A;  2CJJ A;  4M3B A;  2KDZ A;  1RES A;  4MO7 A;  3MKL A;  3A01 A;  3WHB A;  1OCP A;  1OJL A;  2DTZ A;  1ENH A;  2K9Q A;  1ZR4 A;  4UUT A;  2R93 J;  2DA5 A;  4A3B J;  2M8G X;  1IJW C;  1SFO J;  1HLV A;  3OIO A;  2XSD C;  5IYB J;  2HOS A;  2OPT A;  1AKH B;  2NS7 A;  2EZI A;  5EG0 A;  5EYR A;  2NVT J;  1WPK A;  5EEA A;  1MBH A;  2M9H A;  1ITY A;  2EH3 A;  1IGN A;  3ZOB A;  4A3J J;  2GBY A;  4M6V A;  3SJM A;  3HEF A;  1RET A;  2XGC A;  4EEF G;  5K7H A;  1LFU P;  2I10 A;  3MVP A;  5M5W J;  3S1R J;  1JJ8 C;  5E3N A;  3BTJ A;  1YRN B;  1GV2 A;  3H3V K;  4A3E J;  2FQ4 A;  4Y7N J;  3LSG A;  2K9N A;  4A3L J;  1OCT C;  5F0F A;  2VUM J;  3JRF A;  4DW6 A;  1IDZ A;  1R9T J;  1JKP C;  5F1J A;  5E3M A;  2WV1 A;  3CQZ J;  4A3G J;  3S1M J;  2EZL A;  2ZB9 A;  4FIS A;  5K7F A;  3GTJ J;  1TC3 C;  5FLV A;  2FX0 A;  2W48 A;  2HXO A;  3BR2 A;  1H89 C;  2GM4 A;  4XIC A;  2KT0 A;  1WGX A;  1B8I B;  5K7Z A;  1X2N A;  2XGE A;  1JT6 A;  3BQZ A;  2HI3 A;  2EZH A;  2JWT A;  3FK6 A;  1U8B A;  3QPS A;  4IHW A;  2CUF A;  2JMW A;  3FIW A;  4XRM A;  4MLO A;  4QTR A;  4FTH A;  2XPW A;  1ZR2 A;  2XB0 X;  1VI0 A;  1MBG A;  2QCO A;  2CRG A;  1U9O A;  2L9R A;  3JRE A;  1VND A;  3HOV J;  2LLK A;  3FIS A;  2WB1 N;  3GTL J;  2DMT A;  1IC8 A;  1UHS A;  3WHC A;  2EBI A;  1LE8 B;  3O8H A;  3LSJ A;  4V2F A;  3K2A A;  2DA2 A;  2YS9 A;  5M5Y J;  1GUU A;  2CU7 A;  3CMY A;  3F0C A;  4RDU A;  1RPW A;  4XRS A;  2DMU A;  3S1N J;  3JRG A;  4A3F J;  4BY1 J;  3M3Y J;  1ETY A;  3IH4 A;  1H88 C;  5C44 J;  1AHD P;  3S2H J;  2QF7 A;  2X9D A;  4DZP A;  2JJ7 A;  2CQQ A;  1P7J A;  5J3L A;  5IOY A;  3BR1 A;  2DA4 A;  9ANT A;  3JRH A;  4A3D J;  1ETQ A;  2M2E A;  1GVD A;  4G12 A;  1ZGW A;  2LTP A;  2R5Z B;  2Y30 A;  2LR8 A;  5C4J J;  3MN2 A;  1UMQ A;  4JP0 A;  5EGO B;  3OOU A;  5JLX A;  1WH5 A;  3ZQI A;  1HDD C;  5FKM A;  1TWF J;  1IG7 A;  1RKW A;  3BQY A;  2L7F P;  1AKH A;  1DU0 A;  3S14 J;  2LD5 A;  2R0Q C;  1MSE C;  1ZKG A;  2NS8 A;  5HOD A;  1P7I A;  3HOW J;  3BR6 A;  3GTG J;  3FK7 A;  3BR5 A;  4A69 C;  1GDT A;  1A5J A;  1B72 B;  2L0K A;  3BG9 A;  4D5C A;  4IHY A;  3OSG A;  2NVY J;  4M3D A;  2PMZ N;  1ZTR A;  1TWH J;  4UUS B;  5FKN A;  2VKE A;  1A6I A;  4D7N A;  3M4O J;  1IUF A;  2MSY A;  3BTL A;  1JKO C;  3LNQ A;  2HOT A;  1XC5 A;  1PUF B;  5BNG A;  1YRN A;  1O4X A;  1MBK A;  3D1N I;  3RZD J;  1I50 J;  1HF0 A;  1JKQ C;  2ME6 A;  5C3E J;  3HGY A;  2M34 A;  3CCY A;  3A03 A;  2JA5 J;  2XRL A;  4A3K J;  5F0C A;  1H8A C;  4QSH A;  1X2M A;  5DTD A;  1FEX A;  4BY7 J;  3LSP A;  4GFB A;  3HB9 A;  1WI3 A;  2X6O A;  2DA6 A;  1G2H A;  2JA6 J;  1K83 J;  2K9S A;  1B8I A;  3PO3 J;  4D7M A;  3S15 J;  3E7L A;  3Q0U A;  4X6A J;  4JX5 A;  5E3O A;  3IH2 A;  1JUP A;  1U78 A;  1BA5 A;  1JKR C;  5EZG A;  2Y0S N;  2OF7 A;  3I4M J;  2CQX A;  4AYB N;  2DA1 A;  1S7E A;  1QVT A;  3PM1 A;  2M0C A;  3H0G J;  4RBO A;  2R5Y B;  1FJL A;  4M3G A;  1XS9 A;  3Q0V A;  5IP9 J;  3W6V A;  2NOG A;  4C2M J;  2HOA A;  2XGD A;  2NVX J;  2O9L A;  3DEW A;  1HOM A;  4L5E A;  4J19 A;  4FE7 A;  4CYC B;  1JJ6 C;  1LE8 A;  3HOX J;  1F43 A;  1ETW A;  2Y2Z A;  4M3E A;  1QRY A;  1FTT A;  2TRT A;  3TW6 A;  5JLW A;  1Z0X A;  2L7M P;  3HGG A;  3RQI A;  2DMN A;  1E3O C;  2JA7 J;  3GTQ J;  3GTO J;  1K61 A;  2E2J J;  2O8K A;  1FIP A;  4NDL A;  3HBL A;  2LY9 A;  3GBG A;  4XID A;  1WCM J;  1JGG A;  4A93 J;  2XB5 A;  1GT0 C;  3S2D J;  2DMQ A;  2DMP A;  2D5V A;  3DCF A;  2HDD A;  3BR3 A;  1POG A;  1GV5 A;  3A02 A;  2LVS A;  3IH3 A;  4DZJ A;  4I6Z A;  2R5Z A;  5EF6 A;  4V2G A;  2FJ1 A;  2G0E A; 
#chains in the Genus database with same CATH topology
 2YSR A;  4YIR X;  4MEX F;  3BG3 A;  1WH7 A;  2MW8 A;  2Y75 A;  4B3A A;  4N9I A;  3CZ6 A;  1USS A;  1JTY A;  1EH6 A;  1KGS A;  3PO2 J;  2HGC A;  3KP5 A;  1ETO A;  4G8X A;  3JCU C;  4BNC A;  2LK2 A;  2R7W A;  1HC8 A;  3TP0 A;  2ZSI B;  1FTZ A;  3BZC A;  1V5F A;  3ECH A;  1DP7 P;  5GAH J;  3GZ6 A;  5KAF C;  4GYI A;  3ZN1 A;  3JW4 A;  1Y1V J;  3HSF A;  1ZRE A;  3Q5F A;  4NC6 A;  3IRQ A;  3JR9 A;  5F04 A;  2ZC2 A;  2DN0 A;  2H1K A;  5E79 C;  3O8G A;  4G7Z F;  2K40 A;  4FX4 A;  1HKQ A;  2P81 A;  4YIF A;  1J75 A;  3CDL A;  2E2H J;  3S17 J;  4PFO A;  1TQI A;  3CJR B;  2VXD A;  2VJ4 A;  1JGS A;  3PFI A;  2COB A;  4BYY A;  4BKX A;  3OYH A;  3RKQ A;  2XPV A;  2XVC A;  1KU3 A;  2ZJR F;  4M73 A;  2KZV A;  1MKM A;  4I99 C;  4PJN A;  2KP6 A;  4AD9 A;  5IP7 J;  4FAS D;  2XRN A;  4XLH A;  4BXX J;  2R7D A;  3HG9 A;  3IRR A;  2H8R A;  2R3S A;  2J5P A;  3KFW X;  5JHU A;  3HRS A;  3ECO A;  5EZH A;  1ZEL A;  3QOE A;  3M1E A;  5FGM A;  2L54 A;  3OV8 A;  2FU4 A;  1QO0 D;  4UUV A;  1WJE A;  5FRN A;  2QQB A;  4ZZL A;  1W36 D;  1X3Z B;  4HNT A;  3GFL A;  3FZV A;  3V42 A;  2K9L A;  3SFI A;  4XBF A;  1MH4 A;  5F27 A;  3L2U A;  3KE2 A;  3SYT A;  2PJR A;  1ERD A;  1LDJ A;  1T0F C;  3H5R A;  3FX3 A;  2LOO A;  3C2B A;  1TLH B;  1MSF C;  1TNT A;  2MH2 A;  3N05 A;  5FD6 A;  3WOD F;  3BR0 A;  2LC2 A;  4DJA A;  2RQP A;  1CQT A;  3P7N A;  2MFZ A;  2IBD A;  2KRH A;  2D1V A;  4N0B A;  2OTL I;  2XIG A;  5B5E C;  4G7O F;  3JRA A;  4B4C A;  2VPR A;  3CLO A;  1HQC A;  3KYC B;  2OJE D;  3DBH B;  3F21 A;  3HRU A;  2E1M B;  3J81 K;  2PN6 A;  3HOU J;  2CO5 A;  2IGM A;  2YR2 A;  2PFB A;  2HVS A;  5E3L A;  3AG2 H;  1RNL A;  1YQA A;  1WSU A;  2WBM A;  1D1A A;  3C2G A;  4JK1 X;  3NWT A;  1NTC A;  4G6Q A;  4JQF A;  4MQ9 F;  2BY1 A;  5CQE A;  5J40 A;  2N8G A;  1P9Q C;  3CME I;  1WI9 A;  4XKC A;  4AC0 A;  3CDI A;  1ZQ3 P;  3K70 D;  2KPM A;  3EUH C;  5M3F J;  3BTC A;  1OR7 A;  4GDF A;  4WXC A;  4IQJ A;  2GZW A;  5F08 A;  2HQA A;  2JVH A;  1BI2 A;  5DUK A;  4M6X A;  1RUO A;  4E6K G;  2V1D A;  2KZG A;  1FLI A;  3H5N A;  1BR4 A;  3RPQ A;  3VOE A;  4L0Y B;  2R92 J;  1A6Q A;  3CUO A;  4YG2 F;  1MH3 A;  3DTE A;  3GTK J;  2ME0 A;  2NS0 A;  2IW5 A;  2O61 A;  2P6T A;  1PYV A;  3RIR A;  1HW2 A;  1VQK I;  1T6S A;  1U8R A;  1SAN A;  3GWZ A;  2MC3 A;  4KIB A;  1TL8 A;  3G1L A;  1JHH A;  4RB0 A;  2DT5 A;  2HWV A;  3FBI B;  3CO7 C;  1KZH A;  5IYD J;  5FLM J;  2ELH A;  3S32 A;  1RIO H;  2MA3 A;  2VE9 A;  1VZ0 A;  3F9K A;  4BQO A;  2IS1 A;  2ZFU A;  3Q9S A;  1T56 A;  3ZMU A;  2E5N A;  5EDN A;  5J47 A;  4IKF A;  2O7O A;  3J80 K;  3DWL E;  5CJ9 A;  4ASN A;  4M3B A;  2KDZ A;  3HZJ A;  1HST A;  1RC9 A;  1X19 A;  1FP2 A;  3A01 A;  1OCP A;  1SAX A;  1FOY A;  2DTZ A;  2GOX B;  2P0W A;  4IJA A;  4CCK A;  4II2 A;  1SMY F;  4ENJ A;  3DPT A;  4ZYE A;  3E6C C;  1X3W B;  4IZZ A;  3DBL B;  5EG0 A;  3LA3 A;  1IV8 A;  1YG2 A;  4HEA 2;  4NUB A;  3DQV C;  4A5M A;  3LAP A;  1IN4 A;  1Z1D A;  2M9H A;  1ITY A;  1RI7 A;  4XR6 A;  1P4X A;  2F2E A;  1XB4 A;  2IS6 A;  1R1T A;  4CIC A;  2W57 A;  3GFI A;  2E34 A;  2Z5U A;  4M6V A;  3SJM A;  5HVQ C;  3WU0 A;  2D2W A;  3FKJ A;  4L5I A;  5HNF A;  3FXK A;  5LGN A;  1FC3 A;  4BE2 A;  4LIU A;  2IPQ X;  3W6K B;  2X4H A;  4BHB A;  4ZYH A;  1YRN B;  4MNU A;  1R36 A;  4A3E J;  2QQ9 A;  4OU0 A;  2V6E A;  4A3L J;  3VSK A;  5DCF A;  1S7A A;  1OCT C;  5D5W B;  1M1E B;  3I0T A;  4XNF A;  5DCM A;  2QBY B;  1R9T J;  3WE2 A;  4L5J A;  3H1C A;  5AIP A;  3F8N A;  2JRT A;  1ZLJ A;  3T1B A;  5LLQ A;  5LEK A;  2ZBK A;  3MZY A;  4OMY A;  3VYR B;  4I02 A;  2FX0 A;  3I4P A;  3ISP A;  2VXZ A;  5HS7 A;  2Y0M A;  2QYO A;  3CCJ I;  1VQO I;  5HDK A;  2EFP A;  2GM4 A;  1A36 A;  3I9V 2;  5KHD A;  2EFO A;  2ZME A;  1B8I B;  1Y8Q B;  2FNA A;  4ETS A;  2CV2 A;  1WQ2 A;  3PQJ A;  2XRO A;  1JT6 A;  4D0P A;  2HI3 A;  4HX8 A;  2JWT A;  3FK6 A;  2BY2 A;  4ENM A;  2FBI A;  3RKY A;  1U8B A;  4IHW A;  2JMW A;  3ZRG A;  4XRM A;  4MLO A;  4F7Z A;  3G6E I;  1E2X A;  1W5S A;  3NRV A;  4B44 A;  3LST A;  4OIO F;  2CW8 A;  5E1W A;  4NBQ A;  2XB0 X;  3HHG A;  1VI0 A;  2LRD A;  1R49 A;  1PJR A;  1QPM A;  2CRG A;  3PNY A;  3VSL A;  1B9M A;  2K02 A;  3CCM I;  2L4A A;  3ABU A;  4KNY A;  1L3L A;  2WB1 N;  3AL0 B;  3DV8 A;  2MH9 A;  1D5V A;  1SVM A;  1P4W A;  3WHC A;  2L9S A;  3LSJ A;  1T98 A;  2IRF G;  3CCS I;  3KYD B;  3J7Z I;  1TP4 A;  4RDU A;  4XOR A;  3JRG A;  3M3Y J;  2P6S A;  1ETY A;  1H88 C;  5C44 J;  3DU5 A;  1AHD P;  2WAD A;  1IN6 A;  1SFK A;  2X9D A;  4M74 A;  1P7J A;  5J3L A;  5TGT A;  3F8M A;  5LHH A;  3CJQ B;  2CS3 A;  1XTA A;  3C7J A;  3TO6 A;  3GCM A;  4BEH B;  9ANT A;  4IF4 A;  3MZH A;  1REP C;  2M2E A;  3H35 A;  4G12 A;  2VIX A;  1E3H A;  1ZGW A;  2RC4 A;  1HA8 A;  4Q5S F;  1G8X A;  4A12 A;  1EKE A;  1XN7 A;  5CVI A;  3MD2 A;  3MQ0 A;  2FEZ A;  2DPU A;  2WTE A;  2OCC H;  3T8R A;  3I58 A;  3OYL A;  3DPL C;  4ESJ A;  2KRC A;  1AKH A;  2C6Y A;  3S14 J;  2QLZ A;  3ELK A;  4M9X A;  2LD5 A;  3V8L A;  3REO A;  2STW A;  2R0Q C;  1ZKG A;  3GF2 A;  3J7A O;  3HOW J;  4KN7 X;  1XDS A;  2QUF A;  3TL4 X;  1LPQ A;  5FO5 A;  3BR5 A;  4A69 C;  5HOO A;  3GTG J;  2L0K A;  3GW2 A;  4OIQ F;  3I59 B;  2NVY J;  3MWM A;  2XDV A;  5FB2 A;  4M3D A;  4XON A;  4LLL A;  4UUS B;  4Y33 A;  2EWN A;  2E60 A;  3U2R A;  2DO7 A;  3O6B B;  2YX7 A;  2MSY A;  1Y6I A;  3CP8 A;  4EM0 B;  1MBK A;  3CCQ I;  1I50 J;  3KP2 A;  4A5N A;  2Q1Z B;  2ME6 A;  2EIN H;  3ZMV A;  4EM2 A;  5LRS A;  1DDN A;  2F5V A;  3IWF A;  1IW7 F;  3FXM A;  2ZNZ A;  4MGR A;  3CUQ A;  2L2O A;  4OMZ A;  1WRJ A;  5ICC A;  4BDZ A;  1H9T A;  4A3K J;  3IC7 A;  5F0C A;  4I98 B;  3W2W A;  5DTD A;  5FRO A;  4GFB A;  3BWG A;  2FQ3 A;  5BPI A;  2L9N A;  4GYG A;  3CTA A;  4Z6Y A;  1G2H A;  5HS8 A;  2E35 A;  3PO3 J;  4LIT A;  4D7M A;  4UY8 I;  3ERM A;  1TQP A;  3FMR A;  3F72 A;  3E7L A;  3Q0U A;  3ZP5 A;  2J5O A;  2XAH A;  4KJZ A;  2R7R A;  2ZXW H;  1U78 A;  3T5X A;  1BA5 A;  3WTX C;  1WJD A;  1XDU A;  4WCG A;  1MMD A;  3K4N A;  3OYF A;  2Z33 A;  2LBF A;  3I4M J;  1S7E A;  4OIN F;  1SD4 A;  3MCZ A;  3PFY A;  4IX7 A;  2DOE A;  2VPL A;  2R5Y B;  3RPU A;  3Q0V A;  5IP9 J;  2AXL A;  3DF8 A;  3KEQ A;  2VKD A;  3ML6 A;  4LFU A;  2HOA A;  3TDZ C;  3CO6 C;  2M45 A;  1JHF A;  2PQ8 A;  4D9J A;  2M4G A;  5LHI A;  4HZF A;  5ILU A;  3K4J A;  1WZ2 A;  2IGK A;  2P5L C;  1ETW A;  3OYB A;  4PSX A;  2VLA A;  4BH9 A;  3TW6 A;  3FMQ A;  3DBR B;  2M8E A;  4JBA A;  5HLH A;  1VQ8 I;  1I6X A;  1S72 I;  3GTQ J;  4L9T A;  2F48 A;  4NB5 A;  3OYI A;  2H8W A;  4RLF A;  2CUZ A;  3O3K A;  5BS6 A;  3HBL A;  2LY9 A;  2HZD A;  1GT0 C;  3V7R A;  1SD5 A;  3OY9 A;  3ASN H;  3I56 I;  3PL8 A;  4CZC A;  2CW7 A;  3C2H A;  1POG A;  2L02 A;  3K0L A;  3W2A A;  2V6C A;  3BDD A;  2A61 A;  2E1O A;  3K1N A;  1J09 A;  2IA2 A;  2L7Z A;  2XPU A;  3P9I A;  3TOB A;  5D5X B;  3OYJ A;  1EH7 A;  2XC7 A;  4DYC A;  5EEG A;  1OCO H;  5E17 F;  2GXB A;  2CFX A;  4PCQ A;  2H6B A;  3SEZ A;  3D5L A;  1AU7 A;  2DLL A;  3R60 A;  3A1Y A;  3G1M A;  3BLY A;  4U0Y A;  3AFH A;  1W4M A;  3BCB A;  5DV5 A;  2M3A A;  3PUF A;  2IAI A;  4LK1 F;  4MTE A;  2ZO4 A;  4LD5 A;  1P2F A;  5ILS A;  1Y0N A;  5ICG A;  3TP3 A;  5LGT A;  4GCV A;  2P7V B;  3PIO F;  4EMS A;  1EV7 A;  2ZNY A;  2WC2 A;  4G94 A;  1G3W A;  3QPL A;  4HNU A;  3JRD A;  4HG2 A;  4A0Y A;  2YU3 A;  4EJT A;  4F92 B;  3IL2 A;  4BHC A;  1QA6 A;  1LJ9 A;  2G9W A;  4ITV A;  4BAC A;  3HSE A;  1QZZ A;  2GWR A;  4KIG A;  2IEK A;  2CUJ A;  3BZK A;  3KP7 A;  4PJ0 C;  3JRB A;  1FWZ A;  2W25 A;  3ABT A;  5JFR A;  2V1U A;  5CLS A;  1XCB A;  1WKM A;  3ROU A;  1IXR C;  4Q4Z F;  4XKW A;  2ECC A;  3IKV A;  4IHX A;  5F0H A;  1AA7 A;  4QLC U;  3H3Z A;  4IRI A;  1U5T A;  2VKH A;  3FMS A;  1W5C C;  1FOK A;  4C3J J;  5F6F A;  4B09 A;  3HYI A;  2R7Z J;  1HKS A;  1KON A;  1TWC J;  4IVN A;  4P1W A;  2F6C A;  1ETK A;  2JSP A;  1YW9 A;  4RB1 A;  2E1C A;  2AO9 A;  4AIJ A;  5M5X J;  1T95 A;  4XRS G;  4DOZ A;  3PQK A;  3S93 A;  2QEX I;  1IRZ A;  4JX4 A;  5E1X A;  3TW7 A;  3WTY C;  4EQQ A;  4P9U A;  2NOJ B;  4L0Z B;  3SZT A;  3K1M A;  3RCO A;  2KLO A;  5K5Q A;  4BBS J;  2CUE A;  3HOT A;  2STT A;  5HLI A;  2M5W A;  1XSD A;  3ZCO A;  4XK4 A;  2FD5 A;  1LFB A;  2DA3 A;  1K4S A;  5CPR B;  1K6Y A;  3ZQH A;  4BQQ A;  3HDD A;  3OL3 A;  1W0T A;  3LOC A;  4NQW B;  2OBP A;  3ZQG A;  2GXA A;  1FIA A;  1WJC A;  2HFH A;  2XAJ A;  1EJ9 A;  3K70 C;  1MBE A;  1CF7 A;  2YPR A;  3HUG B;  1D0Z A;  2DU9 A;  1V3F A;  1APL C;  4DYR A;  1VQL I;  4C3I J;  1LVA A;  2LP0 A;  3B6C A;  3UKG A;  2BGC A;  1JE8 A;  2HQ5 A;  4PDK A;  4A3M J;  3J81 Z;  1S7O A;  1ZHF A;  4ESB A;  1Z21 A;  2ETH A;  3O2P E;  3I53 A;  3QYF A;  2RNG A;  4UB8 C;  2A6E F;  3CC4 I;  2K86 A;  1D1B A;  2QEN A;  1XG1 A;  2DI3 A;  4BE1 A;  1BBY A;  5FJ8 J;  4ON0 A;  1I5Z A;  1YTY A;  3OIP A;  2HYF A;  2KRF A;  3OYK A;  2A5W A;  3CP2 A;  3JRC A;  2WAF A;  1QZE A;  3OYE A;  4EJW A;  4E7S A;  4IHT A;  5IY5 H;  2OZU A;  2VQH A;  2JPB A;  3U9G A;  4YFN F;  2ZJP F;  1JTX A;  1K78 B;  1YS7 A;  2VN2 A;  2XAQ A;  2GA1 A;  1ETX A;  1EH8 A;  3Q3S A;  3OS1 A;  2BW3 B;  2HR3 A;  2EV6 A;  1G3S A;  4CCM A;  1EA3 A;  4A3C J;  4CA0 A;  3OR2 C;  1HCR A;  5H2F C;  3QOP A;  2HKO A;  2RN7 A;  3C18 A;  3QU3 A;  4KN4 X;  3G2B A;  2WAQ N;  1UZC A;  2HOE A;  3CC7 I;  3BTI A;  1DPR A;  5J1U A;  5L3B A;  2L4M A;  4HSR A;  1BI3 A;  1UJ8 A;  2VI6 A;  1VQN I;  1W0U A;  2GAU A;  3FXO A;  4RAF A;  2ZCW A;  5K5O A;  1IRF A;  3TDU C;  2G7H A;  1IN8 A;  4HV6 A;  5JVG F;  1FPQ A;  3SHF A;  3ZMS A;  1FOW A;  5IOZ A;  3CLQ A;  1LQ1 A;  2FOW A;  3H9G A;  2ELK A;  3G3Z A;  1PDN C;  5HDG A;  2EIJ H;  3WU2 C;  3L9F A;  3LFK A;  3S1Q J;  2VON A;  3K7A J;  1TWA J;  2GLO A;  3FHZ A;  1MMG A;  5GP9 A;  3J80 Z;  4CCO A;  2Z16 A;  3NWS A;  3H3U A;  3F8B A;  5AON A;  2XAF A;  3L2R A;  3CD6 I;  5J1Y A;  2JA8 J;  2O03 A;  2DJN A;  2LKS A;  5CVV A;  1MDM B;  1JT0 A;  2DFH A;  1G3Y A;  5KK1 A;  4HF1 A;  2ZJQ F;  1RES A;  1QU3 A;  2EJR A;  3D5S C;  4MO7 A;  4LB5 A;  2H09 A;  2RGV A;  3JSP A;  3IKT A;  1UFM A;  2K3P A;  2K9Q A;  1ZR4 A;  3DLL F;  2R93 J;  2DOF A;  3B73 A;  4EGY A;  2FMY A;  2FBK A;  4LIV A;  2PEX A;  1SFO J;  1IJW C;  6PAX A;  5LHG A;  3KP4 A;  2IXS A;  2K3F A;  2OPT A;  2XV4 S;  3F6V A;  3SXY A;  1B6A A;  1OIS A;  5EYR A;  3J7A Y;  5D4R A;  2NVT J;  4FX0 A;  2K27 A;  4MTD A;  4DQ2 A;  3S3N A;  5EEA A;  1MBH A;  2CV1 A;  5GTI C;  2EH3 A;  2P5K A;  2A68 F;  5CQG A;  3ZOB A;  5KCM A;  1IGN A;  1GLN A;  2V4J C;  4A3J J;  3COA C;  2XKP A;  5E20 A;  3FF5 A;  4ZYD A;  3S3M A;  4CXF A;  1DP3 A;  2WY8 Q;  2IVM A;  3VWB A;  4QPQ A;  1Z6R A;  2H1L A;  4ZTF A;  5E3N A;  2QSG X;  5DUI A;  1TQM A;  3KZY A;  3W6J B;  3LSG A;  1W7P B;  3HXL A;  3JRF A;  1V54 H;  3DEE A;  1JKP C;  3EDP A;  2ISZ A;  3ONQ A;  5F1J A;  2R7Q A;  2WV1 A;  2HVQ A;  4IL6 C;  2V1X A;  4A3G J;  1HBX G;  2BXZ A;  2LMD A;  4M9Z A;  3IP4 B;  2ZB9 A;  4PGH A;  3GTJ J;  3SEQ A;  2CFO A;  3N97 A;  2HKX A;  2L3D A;  3HPG A;  5FLV A;  4BJ5 C;  2JPC A;  2W48 A;  2VT2 A;  4RAG A;  5JI6 A;  1Z05 A;  1XGO A;  4E7Z A;  2K9M A;  5DDG A;  5K7Z A;  2DOA A;  4GXO A;  3H0D A;  4RGR A;  3E0J B;  2QKM B;  2CSO A;  4ZYG A;  3QPS A;  3I5U A;  2BVL A;  4HLY A;  4CZZ A;  2Z2S B;  3LMM A;  3CCL I;  4QTR A;  1LEA A;  2KIQ A;  2BV6 A;  2ZKZ A;  4XLP F;  1TW2 A;  2FXA A;  2XPW A;  3RSN A;  3CES A;  2P7C B;  1YI2 I;  2QA4 I;  1MBG A;  4AM3 A;  2QCO A;  2X85 A;  5H20 A;  2X6W A;  4L9N A;  1ON1 A;  2L9R A;  3OYD A;  4ZTJ A;  3HOV J;  2LLK A;  3R4K A;  1J7K A;  1BOB A;  5D6E A;  5FLX K;  1UHS A;  2PMZ A;  2I5U A;  1FYK A;  2RDP A;  3O8H A;  3TO9 A;  4V2F A;  3K2A A;  4A2U A;  2DA2 A;  2YS9 A;  3CMY A;  4XRS A;  4B43 A;  3I55 I;  1R7J A;  4YII A;  2CG4 A;  3ZPL A;  3VYS B;  3G4S I;  1LNW A;  3S2H J;  4DZP A;  5HLT A;  2JJ7 A;  2CQQ A;  4HLX A;  4C9Y A;  3BR1 A;  3HOS A;  4L18 B;  4K2E A;  1FSH A;  4A3D J;  3SQN A;  2VJI A;  4ZZD A;  1ETQ A;  2RNJ A;  2ACJ A;  4B3X A;  3KPH A;  2Q8K A;  3S2W A;  4UVA A;  3MKY B;  2R5Z B;  4HV5 A;  2COM A;  2LR8 A;  1BC8 C;  5E18 F;  2H6C A;  3MAJ A;  5C4J J;  1SFE A;  3Q9V A;  3MN2 A;  1ON2 A;  4M72 A;  1UST A;  5EGO B;  4IOC F;  3OOU A;  1TWF J;  3DTK A;  3DU6 A;  3TKY A;  3RTR A;  1ULY A;  1KA8 A;  1ZRC A;  4HQE A;  4HPQ A;  1UAA A;  2FNP A;  3CJT B;  2VB6 A;  1HW5 A;  3BR6 A;  5LRR A;  3FK7 A;  3QWL A;  1A5J A;  2JTV A;  4CGZ A;  1B72 B;  1UCR A;  2M30 A;  4F93 B;  1JI8 A;  3M4O J;  1IRX A;  2HOT A;  1MMS A;  1PUF B;  5BNG A;  1YRN A;  3QP6 A;  5H6Q A;  2Q2E B;  3D1N I;  3RZD J;  1Z3Y A;  3L2Q A;  1JKQ C;  1HF0 A;  2OV7 A;  1STZ A;  2IGN A;  2QBY A;  1N25 A;  3K1P A;  3HGY A;  3L09 A;  2EIL H;  1KU9 A;  2JA5 J;  2XRL A;  1MJB A;  2L7K A;  1UG0 A;  4U87 A;  4XKV A;  4Z2Y A;  1SD6 A;  2K7L A;  4AWX B;  4HOB A;  3LAJ A;  1AOY A;  1KYW A;  1H8A C;  2L9V A;  1FEX A;  4BY7 J;  3LSP A;  2OD5 A;  2KJB A;  3RQ4 A;  4OWR B;  3M8J A;  3WE3 A;  3M9A A;  1K83 J;  5L3D A;  4XMY A;  3OOP A;  2K9S A;  3ZN0 A;  1B8I A;  4NHJ A;  3S15 J;  4G6T B;  1LFP A;  1S3J A;  2E36 A;  3WTV C;  4E7H A;  4YRV A;  3IH2 A;  1JUP A;  2OC6 A;  1JKR C;  1Q1H A;  3LL7 A;  4BU2 A;  1FYL A;  3L2V A;  5TIS C;  3VYU B;  2CQX A;  1QBJ A;  2DA1 A;  3SDB A;  3K4B A;  4RBO A;  3NQO A;  3GME A;  3I64 A;  1FJL A;  1B1B A;  1XS9 A;  3RPU D;  1GXP A;  2H27 A;  2OTJ I;  1DPU A;  3ZQQ A;  3W6V A;  4ZDL A;  1S5L C;  2XGD A;  2O9L A;  2DBB A;  2TDX A;  4CYC B;  4L9J A;  4WXD A;  2F5D A;  5ICE A;  3NEU A;  3MMY B;  2K85 A;  4M3E A;  1FYM A;  2OU2 A;  3KET A;  5IT3 A;  3JAM K;  1VQP I;  5JLW A;  4E7K A;  4A0X A;  4CH7 A;  2L7M P;  1WHU A;  1E3O C;  3DXJ F;  2DMN A;  1ZLK A;  3GTO J;  2FML A;  3CCV I;  1K61 A;  1LKX A;  1AWC A;  4EAT A;  2DOD A;  4XID A;  2X51 A;  3HRT A;  1JGG A;  4BEH A;  2YX4 A;  2W84 A;  1OYI A;  3WU1 B;  1U6G A;  4LGW A;  1J5Y A;  4UVC A;  3JTH A;  2VJ5 A;  4V19 K;  4Q47 A;  4V2G A;  1OPC A;  1BW5 A;  4EV0 A;  3KYL A;  2X1E A;  4YEJ A;  5EJC A;  5DM7 F;  1K79 A;  4PSW A;  3DKX A;  3NAR A;  1J9I A;  3HIF A;  2W82 A;  2FSW A;  2QM3 A;  2EZK A;  1IV6 A;  3OL4 A;  2R7O A;  5KVR A;  1D8J A;  4A3I J;  1T8I A;  2LRE A;  4UHT A;  3K10 A;  1LUJ B;  5D8K B;  4FHT A;  4HX4 A;  3IV5 A;  2DA7 A;  1BJZ A;  4XN3 A;  4CHU A;  5A2Q K;  1X1A A;  2EV0 A;  1XSV A;  2R7F A;  3A4C A;  4PJL A;  3I59 A;  3OSF A;  4KMU X;  2ICW G;  4F3Q A;  3KCC A;  2IP2 A;  3LSM A;  1MNE A;  1TBX A;  4UUS A;  3HOY J;  3K4L A;  3K2Z A;  3RYP A;  3A2K A;  1P92 A;  4AYB A;  3ZMZ A;  4I76 A;  2LY1 A;  4WK8 F;  1MNM C;  3BCA A;  5JHF A;  1B4A A;  4BQN A;  2LNB A;  2VC1 A;  2B63 J;  4OAY A;  3H5A A;  1V4R A;  2EB7 A;  4FQG A;  2V9K A;  3ZQF A;  5J8C A;  1QPI A;  5C4X J;  4JX6 A;  3HOZ J;  4F55 A;  1I6H J;  3A0B C;  5J6X A;  5HS9 A;  3FXU A;  1BR2 A;  1OFC X;  3VPR A;  5HLG A;  3B02 A;  2IA1 A;  3C1D A;  5LEJ A;  4MHG A;  1WVR A;  4M6Y A;  5CYV A;  1BI1 A;  5LGU A;  1Y39 A;  1X1P A;  1XSX A;  2PX9 A;  2WY7 Q;  4BBR J;  4UVB A;  1BL0 A;  4RGX A;  1VF9 A;  2LG4 A;  3AAF A;  1IDY A;  2UXN A;  2WWY A;  4Y4R A;  2DT6 A;  2FUG 2;  3BPX A;  1ZRD A;  5IPA A;  5B1A H;  1V5G A;  1IAW A;  4ABZ A;  5ILV A;  1BC7 C;  2R5Y A;  3M7G A;  3D5R C;  4XSZ F;  3MEX A;  3ZQL A;  4X1E A;  3TBI A;  3WTT C;  1I3A A;  4PGG A;  2DQL A;  5HDN A;  1T33 A;  3QYE A;  3ZQ7 A;  3Q0W A;  3GFM A;  1Q1V A;  3GLL A;  1R5H A;  4BJT A;  5AIQ A;  1YS6 A;  4N9H A;  1ACI A;  4MFE A;  3HHH A;  2EFN A;  2NRA C;  2HYJ A;  4KDP A;  1YX5 A;  3WGG A;  1OR7 C;  2RRE A;  4C30 A;  2F5F A;  4XLF A;  5J1R A;  1FBU A;  2JRM A;  1R23 A;  1ZG5 A;  1YOV B;  2JVG A;  3UNG C;  2DT7 B;  4XOT A;  1O7F A;  1XD7 A;  2XAG A;  1I27 A;  4X0G A;  1HDP A;  2BBY A;  2VBW A;  2PLY A;  4F52 A;  3U21 A;  1T0F A;  1Z91 A;  4W97 A;  3E6B A;  4XLE A;  5FKL A;  4QPO A;  1Z7U A;  1YO5 C;  1YFH A;  2EPF A;  4IEJ A;  2XHK A;  2NAZ A;  2O0Y A;  1FOX A;  4HX7 A;  3ZMD A;  1N78 A;  1OCR H;  2TCT A;  2OQR A;  4AUX A;  3WGH A;  2ZXJ A;  2HPI A;  2RVC A;  1SEU A;  3GTP J;  3W2V A;  2P4W A;  2JA2 A;  4KT6 A;  4Y17 A;  5BMZ A;  3KLO A;  4ZH4 F;  1X1D A;  5F64 A;  3E5U A;  3OIQ A;  3IAS 2;  5GPA A;  1OQY A;  3OS0 A;  2Y48 A;  4CCN A;  2OZ6 A;  1FSE A;  5DS9 A;  4BHP A;  2LFB A;  2HZT A;  1IN5 A;  4PK4 A;  3VYT B;  2MGQ A;  4IOA F;  3BG5 A;  2HNH A;  2E2I J;  5GTH C;  3DLA A;  2X48 A;  3SZG A;  3ZXS A;  4YFK F;  1JUM A;  5JR3 A;  1RKT A;  2UV1 A;  3JRI A;  4QIW N;  4Y15 A;  2VBX A;  1O3R A;  2EQR A;  1HKT A;  4HF0 A;  1YX3 A;  3B6A A;  1EF4 A;  1Z67 A;  3EUH A;  1U9N A;  1YE9 A;  2JK3 A;  5EEH A;  4BDY A;  3R61 A;  4UB6 C;  1OLT A;  1IRG A;  2LH9 A;  3H92 A;  2VKV A;  5IYC J;  1H0M A;  4P96 A;  4RGU A;  2IS2 A;  4AIK A;  3ULQ B;  1QHH D;  3FXQ A;  1KYZ A;  4LOC A;  1PP7 U;  3LWF A;  2E1N A;  3ERE D;  3LA2 A;  1I1S A;  3MKL A;  2IT0 A;  5DM6 F;  1IO2 A;  2A05 A;  3WHB A;  1S6L A;  2DXI A;  1LDK B;  3JTG A;  4RMN A;  2CMP A;  3HC7 A;  1ENH A;  1MJ9 A;  3BY6 A;  2M8G X;  1ZH5 A;  3ABL H;  3OIO A;  5IYB J;  2KHM A;  2W85 A;  3CMM A;  2EFW A;  2NS7 A;  4XLN F;  1R5I D;  2QKL B;  3HKZ A;  4NQW A;  3MKW B;  3VB2 A;  3HUG A;  4RAZ A;  2IS4 A;  3CCR I;  3HTS B;  4ENN A;  3V8K A;  2GBY A;  3BJ6 A;  2FBH A;  4U0V A;  4RS8 A;  2ZME C;  3HEF A;  1BJA A;  2XGC A;  5K7H A;  5E8G A;  1DGR M;  2I10 A;  4RB3 C;  2GQQ A;  3MVP A;  3HSR A;  3A0H C;  2D1H A;  1KU2 A;  1DGW Y;  4HA8 A;  3S1R J;  1JJ8 C;  3OYC A;  1GV2 A;  3KX2 A;  3H3V K;  2FQ4 A;  4Y7N J;  2K9N A;  2OAZ A;  2A6H F;  2R7S A;  3CCE I;  3GZN B;  4QWQ A;  2M1B A;  1IDZ A;  1MMN A;  2LKP A;  3PNT A;  4I01 A;  3V8J A;  3CQZ J;  1MGT A;  1X3U A;  3S1M J;  4KUM A;  1Y56 A;  4FIS A;  5K7F A;  1Z9C A;  2O8X A;  3WTU C;  1E17 A;  2OUM A;  1K78 A;  1YHQ I;  1BR1 A;  1H89 C;  1YIO A;  2B7E A;  2ISY A;  4XIC A;  4KA4 A;  3H9J A;  2MD0 A;  1D0X A;  2BW3 A;  1FBQ A;  3BQZ A;  3QOD A;  3GEZ A;  3SZP A;  1ZYR F;  2A69 F;  4G9Y A;  1E0E A;  5B66 C;  3EUA A;  3E6M A;  1VQ9 I;  5LFA A;  4RAY A;  3KP6 A;  2KQR A;  1G3T A;  4UXN A;  1IF1 A;  4EJO A;  5FLX Z;  4CDG A;  1ZAO A;  1U9O A;  2JUG A;  2LDU A;  3OYA A;  5CKT A;  4EGZ A;  2E7X A;  3FIS A;  1R1U A;  3OR1 C;  1WWX A;  4HST A;  4KIC A;  1BOA A;  3GTL J;  2DMT A;  4A0Z A;  5J8F A;  2EBI A;  1LE8 B;  2RQQ A;  1GUU A;  4LJZ F;  3F0C A;  1RPW A;  2DMU A;  1SFX A;  4DGW B;  3PNV A;  3DPU A;  2X6Y A;  4BY1 J;  1XGM A;  1P6R A;  4HYE A;  4JOM A;  2QF7 A;  3WG9 A;  3R0A A;  2ZSH B;  5IOY A;  4IPA A;  1O3T A;  2XF6 A;  4LG0 B;  1BIB A;  1WJA A;  2XF5 A;  2KMU A;  3RKX A;  1MDM A;  1ODD A;  2L5Q A;  3UR3 C;  2VOP A;  2DAO A;  2KIF A;  3DTI A;  2Y30 A;  3U1K A;  4AID A;  1R71 A;  1NH3 A;  1O3Q A;  4U7B A;  1UMQ A;  4U88 A;  1G4D A;  4G6D A;  4HQM A;  5JLX A;  3F8C A;  1WH5 A;  4Y13 A;  2QVO A;  1IG7 A;  2R7V A;  1RKW A;  5BQT A;  1HW1 A;  3M07 A;  1DU0 A;  3CUQ C;  1U2W A;  2BEO A;  5L3E A;  1MSE C;  4NNJ A;  2HQR A;  4YFX F;  4II3 A;  3CJN A;  1GHC A;  1TT5 B;  1GDT A;  2V79 A;  1VQ4 I;  4IHY A;  3OSG A;  3DP7 A;  2FF4 A;  1TTY A;  1KQ0 A;  2M0M A;  3V7C A;  1YJW I;  2P8T A;  4D7N A;  2VL8 A;  3M8E A;  3BTL A;  1YLF A;  2BHY A;  2Z3Y A;  4O5V A;  4PJM A;  1O4X A;  2KFD A;  2LSO A;  1FNN A;  2E7W A;  5BOX A;  1W7P A;  3LFU A;  1ZGJ A;  2W00 A;  3RDI A;  1W1W E;  1TNS A;  1Y0U A;  4LK0 F;  4WX9 A;  5C3E J;  4H4K C;  3MKZ A;  2M34 A;  1WJB A;  3CCY A;  2ESN A;  4KMF A;  2DYS H;  1U3E M;  2PJP A;  4HDU A;  1VQM I;  1MD0 A;  3IWZ A;  5DEQ A;  3HB9 A;  4AVP A;  3CMA I;  1WI3 A;  1A35 A;  5IT9 K;  1SFU A;  2ZJ2 A;  1YW8 A;  3VFZ A;  2JA6 J;  1D0Y A;  2QQ8 A;  3K4M A;  2DCE A;  4U7D A;  4P9F A;  2EA4 A;  2CGP A;  2DFF A;  2BYV E;  2P5V A;  2V1N A;  2CV0 A;  2VBZ A;  2KIU A;  4R79 A;  5E3O A;  2MD5 A;  4R8H A;  1L0O C;  2OF7 A;  4AYB N;  4IRH A;  1QVT A;  3PM1 A;  3H0G J;  4EJV A;  4WF2 A;  3H9Q A;  4ZJZ A;  3BG7 A;  1J0R A;  3GXO A;  4M3G A;  5JVT A;  5K1Y A;  2PJR B;  2VOD A;  4LB6 B;  4IHS A;  4CCJ A;  1BM9 A;  3L2W A;  1Z6T A;  2NVX J;  3X2Q H;  3DEW A;  1HOM A;  4L5E A;  3MFK A;  2EIK H;  4ANJ A;  3BJO A;  4ESF A;  3JAM Z;  3DKW A;  1ZRF A;  3HOX J;  1F43 A;  1BN5 A;  2CW0 F;  2ELJ A;  2HDW A;  2CH0 A;  2HTJ A;  1QRY A;  1ZG3 A;  2DK5 A;  2F5C A;  4L9V A;  3E3V A;  1IN7 A;  1Z0X A;  3RQI A;  1FT9 A;  1Y8R B;  1X1B A;  1XMA A;  1OKR A;  2E2J J;  1J59 A;  4LLN A;  2O8K A;  1FIP A;  3PUB A;  3OMY A;  3DFG A;  2QWW A;  4B48 A;  1UEL B;  1QQI A;  4BXF A;  4A93 J;  4DNC A;  3S2D J;  2HPM A;  2XF7 A;  1MW7 A;  2DMQ A;  4ENK A;  2D5V A;  3DCF A;  2BHZ A;  3GZ5 A;  5CVJ A;  3BR3 A;  2E5Z A;  3A02 A;  2LVS A;  1VQ6 I;  4DZJ A;  3AG4 H;  5EF6 A;  2R5Z A;  4HW0 A;  3OYG A;  3QYB A;  4FT8 A;  2AQF A;  4RM2 A;  2FJ1 A;  5B3S H;  3GFJ A;  4OOI A;  1DU6 A;  5EGO A;  1MMA A;  3E1S A;  2AHQ A;  1I3Q J;  3ZR8 X;  5FKO A;  1JUS A;  1MBF A;  3G73 A;  1SAU A;  1R4N B;  2V26 A;  1QNT A;  3I54 A;  2W24 A;  5D5V B;  1RZ4 A;  1P4A A;  1RRJ A;  3M8F A;  4PUS A;  3T8T A;  4BS9 A;  2K4J A;  2LY2 A;  2F5E A;  2H94 A;  2M87 A;  2R4G A;  2W4S A;  5A2Q Z;  5F1R A;  3FKI J;  4AIH A;  1NG6 A;  1U5T C;  1K7A A;  1D5Y A;  3ZQC A;  3FHN A;  1B72 A;  2JQ7 A;  3QQA A;  3WGI A;  2F4I A;  3EET A;  5M3M J;  3P5J A;  5L3G A;  2AXT C;  2Y0S A;  2O5R A;  3GVA A;  3T0Y A;  4E7I A;  3ABM H;  5L3C A;  4MEY F;  1W5T A;  1QZY A;  2E19 A;  1SVO A;  4DBQ A;  1PUF A;  2KJC A;  2CQN A;  2YUS A;  3SDG A;  3TOA A;  1TT0 A;  2Q2E A;  3G1O A;  1BIA A;  2FE3 A;  4EJU A;  3TED A;  1TW3 A;  2GIV A;  4JYK A;  1OCC H;  3AG3 H;  4C2U A;  2R7T A;  2UXX A;  3WTW C;  5K5R A;  3ASO H;  3S3O A;  2LF8 A;  5DD4 A;  2A6T A;  5FRM A;  2MG4 A;  4CYD A;  4MFD A;  3JSO A;  3S8P A;  4S0H B;  2IGO A;  2VE8 A;  4KIT B;  4IXA A;  4D5F A;  1R5G A;  3VEP A;  2BVM A;  2VAS A;  4UNO A;  4Y52 J;  5KAI C;  3ABK H;  2PBI A;  1D3Y A;  2ZXH A;  3N4M A;  2GA2 A;  2DYR H;  2V9V A;  3BZ6 A;  4I7H A;  2KDO A;  2DK8 A;  2RAE A;  4M71 A;  3AKZ A;  5KNL A;  1PUE E;  3PSF A;  1MJA A;  3GLX A;  4ZC3 A;  1B9N A;  4A6D A;  2ID3 A;  2YU9 J;  2XUB A;  4IHV A;  2F4O B;  4HNV A;  3FDY A;  2UWM A;  3EQL F;  4ZYA A;  3A01 B;  2XAU A;  4HF2 A;  1YJN I;  2DTR A;  4C3H J;  3FXL A;  4ZDP A;  3GX4 X;  4F91 B;  1C0W A;  3R6S A;  1XMX A;  3BPV A;  2FA5 A;  2A07 F;  5D8L B;  2G7U A;  3S16 J;  2EFQ A;  4I09 A;  4CYC A;  1FY7 A;  4FET A;  5EG0 B;  2Y9Z A;  2PMH A;  5BPD A;  4KFC A;  1FBS A;  2WAQ A;  3E6D A;  2FRH A;  2XAS A;  2OA4 A;  4RB2 C;  1KU7 A;  2M7B A;  2NVU B;  1N77 A;  3RKW A;  4DBR A;  1FZP B;  3PSI A;  4KIS A;  2O6G E;  2Y9Y A;  1QVU A;  4B1R A;  2Y31 A;  5FKK A;  2EV5 A;  2EA2 A;  5DD8 A;  2QQA A;  4I0A A;  4XRF A;  3EPZ A;  1ZK8 A;  2GIZ A;  1ZN2 A;  3F3X A;  3GTM J;  1S29 A;  1OCZ H;  5DYM A;  1ORK A;  3WTS C;  3RZO J;  3V7S A;  3PIP F;  3CF2 A;  3D0S A;  1Z77 A;  4GO1 A;  1ZAR A;  3CC2 I;  2WAE A;  1JXS A;  3CDH A;  3DEU A;  4R1H A;  5DCM B;  2VBY A;  3FM3 A;  2NVQ J;  2VOO A;  1YW7 A;  1WJF A;  4J01 A;  4MIM A;  3QPT A;  1O7L A;  1R58 A;  2HYG D;  4I2O A;  3VOD A;  1O3S A;  3HKZ N;  1F36 A;  2BY0 A;  3RJP A;  3L1P A;  2HVR A;  3LSK A;  1IUY A;  2LYC A;  1UG2 A;  4GRI A;  2X1D A;  4W1U A;  2UZK A;  1X1C A;  2ZME B;  1MND A;  4M3F A;  3HM5 A;  3OYN A;  4DYQ A;  1NK2 P;  1MBJ A;  4A6E A;  3F8F A;  2ECB A;  1YYV A;  2RKH A;  4FE4 A;  5E1Z B;  1HXD A;  1OMI A;  2BOL A;  1X4P A;  4IO9 F;  1TWG J;  2A3S A;  3K6G A;  1J2X A;  1QGP A;  3NAU A;  4OAZ A;  4N4N B;  1O57 A;  3BT9 A;  1OYW A;  4FCY A;  1X58 A;  4LG3 A;  4H0E A;  3I4N J;  1IZ1 A;  4XOP A;  4B47 A;  2R7U A;  1R00 A;  1ETV A;  2B9S A;  2WV0 A;  2W1O A;  1G6N A;  5GPC A;  2HXI A;  1VFC A;  2ID6 A;  3W3C A;  2LKX A;  4IRG A;  3L00 A;  2HDC A;  3FBN B;  3QP5 A;  2IA0 A;  4XSX F;  2K5C A;  5IP6 A;  1BW6 A;  1HSJ A;  2F4M B;  3HPH A;  2HTS A;  2W7N A;  3K69 A;  1RR7 A;  2DDB A;  5E8I A;  3WG7 H;  1NK3 P;  2Z9O A;  4C2T A;  2NNN A;  3QRF F;  2Z99 A;  3LQQ A;  1FP1 D;  1FX7 A;  1KQ8 A;  1YIT I;  4D1Q A;  1ONV A;  1B59 A;  1FMV A;  2BE5 F;  3K4C A;  1XX5 A;  1F4K A;  3HTU A;  2JN6 A;  5TJJ A;  3LSR A;  3L2C A;  5FFX A;  1Y1W J;  2CJJ A;  3HRM A;  2MLK A;  1SD7 A;  2E1M C;  2KKO A;  3QPH A;  3H36 A;  4MQV A;  1OJL A;  5L3F A;  3PJR A;  5LBQ A;  3K4K A;  1S9H A;  4UUT A;  2DA5 A;  2V7F A;  4A3B J;  4PZJ A;  4S04 A;  1HLV A;  3EYI A;  1I39 A;  3RYR A;  2XSD C;  4E70 A;  1A04 A;  3TQN A;  2HOS A;  1AKH B;  4XM3 A;  1N75 A;  1SVL A;  3E5X A;  5D5U B;  2EZI A;  1WPK A;  2HU9 A;  2ESH A;  1TZL A;  3KP3 A;  3GYH X;  3CF5 F;  1F9N A;  5J4V A;  4E7J A;  2XGX A;  2X1C A;  4J00 A;  3HJE A;  2AQE A;  2FOK A;  4XN0 A;  4BUP A;  1RET A;  5LD2 C;  2DFI A;  4EEF G;  1LFU P;  2VQC A;  3F22 A;  5M5W J;  2BZT A;  2X6X A;  1XCV A;  3BTJ A;  3OWT A;  4KT5 C;  2WA0 A;  4EVI A;  2GXG A;  2NYX A;  1UHM A;  3CCU I;  2EIM H;  1OYY A;  2A5Y B;  4GGG A;  2ADU A;  5F0F A;  1VQ5 I;  2PI0 A;  2VT3 A;  2VUM J;  4LMY A;  4DW6 A;  3TO7 A;  1PP8 F;  5E3M A;  1R6R A;  4O6J A;  4TV7 A;  4BJ6 C;  3CUQ B;  4UV9 A;  4HDV A;  4KYW A;  5ERI A;  2DQR A;  2EZL A;  2XKO A;  2HS5 A;  2MLG A;  1PVE A;  4EM1 A;  2LF7 A;  1R22 A;  3V4G A;  4BE0 A;  5CVU A;  1TC3 C;  1R1V A;  3KLN A;  2XSJ C;  5HNH A;  1LB2 A;  2K4B A;  3P9C A;  1NG7 A;  1S8N A;  2HXO A;  3BR2 A;  3OYM A;  3TGN A;  2KT0 A;  2MC4 A;  4PJJ A;  1WGX A;  1E3P A;  2M4K A;  1CGP A;  1X2N A;  2XGE A;  1R4M B;  2QSF X;  1VQ7 I;  4CUG A;  2EZH A;  4B8X A;  3BOQ A;  1XMK A;  4LLG F;  2CUF A;  3FXR A;  3FIW A;  1F5T A;  4RA2 A;  2HQN A;  1K4T A;  2I8D A;  2LBF B;  4FTH A;  3IHU A;  1ZR2 A;  2R7X A;  2CWE A;  1G59 A;  1WFX A;  5J4Y A;  4Q48 A;  1VTN C;  4AU7 A;  3E5Q A;  3JRE A;  3LQR A;  2L01 A;  2ZFW A;  1VND A;  1YJ9 I;  2RV8 A;  3J7Y J;  1WJ5 A;  3P9K A;  1IC8 A;  1T08 B;  3IAM 2;  1RR8 C;  1BI0 A;  3ZGK A;  5GAE J;  5M5Y J;  2CU7 A;  1GVJ A;  1LDD A;  1LVK A;  3S1N J;  4A3F J;  2PMU A;  3IH4 A;  2PG4 A;  2IJL A;  2JUC A;  1UB9 A;  4XLA A;  4OIP F;  4ZDO A;  2DW4 A;  1U0J A;  1YIJ I;  2DA4 A;  4CO8 A;  4WXH A;  3K9T A;  3JRH A;  1DQU A;  3IUO A;  2VQG A;  4E7L A;  3KIO A;  2NNY A;  1GVD A;  3I71 A;  4HBL A;  5B1B H;  4G7H F;  2LTP A;  2BXY A;  1V5E A;  4NC8 A;  4CSW A;  1XPX A;  4HRI A;  3TMO A;  5TRD A;  2QSH X;  1Z7L A;  4BXU A;  4JP0 A;  2BY3 A;  3ZQI A;  4XQF A;  5FKM A;  5H6R A;  3ZMT A;  1HDD C;  3G71 I;  4CCL A;  3DKY A;  4DIQ A;  4BGD A;  3QU6 A;  3BQY A;  2L7F P;  2CQK A;  1A31 A;  3EYY A;  3LSI A;  3KEY A;  1D8K A;  2MBF A;  4AVZ A;  1W36 C;  1XGN A;  2CQ7 A;  2NS8 A;  2GOM A;  2CYY A;  4M9S A;  5HOD A;  2DPD A;  4O3M A;  2E71 A;  1P7I A;  4P5O A;  4E4H A;  3BG6 A;  2KIS A;  3FWE A;  3U1D A;  5ICF A;  3BG9 A;  4D5C A;  1FMW A;  4N4O B;  1SMT A;  1Z3X A;  2AS5 F;  2PMZ N;  3I3L A;  2JT1 A;  1ZTR A;  4RM3 A;  1MIJ A;  1TWH J;  1X4O A;  5FKN A;  1DUX C;  2VKE A;  1A6I A;  2OCE A;  3GUD A;  1IUF A;  1JKO C;  3LNQ A;  1XC5 A;  3RI4 A;  1LEB A;  2X0L A;  5D6F A;  4NC7 A;  1NHA A;  1W7P D;  5GAG J;  1V55 H;  4XL9 A;  3L7W A;  3FXJ A;  4YEL A;  4BL0 B;  3EUK L;  1SC7 A;  2QZ8 A;  2WB1 A;  4I0B A;  3A03 A;  3MZ8 A;  3E97 A;  3AL0 C;  3VDX A;  5IT9 Z;  4Y3O A;  4BAY A;  3KEO A;  4UV8 A;  2VJJ A;  3KZI C;  4QSH A;  3WTZ A;  1X2M A;  1XGS A;  3BP8 A;  4HAM A;  5ED4 A;  2DDA A;  3QAH A;  4RGS A;  1D1C A;  2ZXI A;  2JSC A;  2Q0O A;  2X6O A;  2UUZ A;  1U5T B;  2DA6 A;  4XKB A;  3SFZ A;  1MZB A;  2KL4 A;  2Y69 H;  1QHG A;  4IQ4 A;  4X6A J;  4JX5 A;  3LA7 A;  4XLC A;  3OS2 A;  2Z1D A;  3M1C A;  5EZG A;  2Y0S N;  1RUN A;  1H9G A;  2O3F A;  1T38 A;  3KZZ A;  3LSH A;  2M0C A;  2B0L A;  2V9P A;  2QGU A;  2VC0 A;  2KIM A;  4KIF A;  2DFE A;  2M7A A;  2VQL A;  2NOG A;  1K6O A;  3R0J A;  4C2M J;  3GO5 A;  3FM5 A;  1ZGA A;  4J19 A;  4FE7 A;  5FD5 A;  4PFP A;  1JJ6 C;  1LE8 A;  4RLQ A;  4WWC A;  2Y2Z A;  3BRO A;  1GXQ A;  1KQ9 A;  1FTT A;  1CF7 B;  2TRT A;  1IXS B;  1I1G A;  3C3W A;  1UHW A;  2MYS A;  4BQA A;  3HGG A;  2JA7 J;  5D4S A;  2NXN B;  2HEO A;  2D45 A;  5CVR A;  3F23 A;  4NDL A;  2MAB A;  3GBG A;  1WCM J;  4U0W A;  4LG0 A;  1T2K A;  2XB5 A;  2JZY A;  4P55 A;  1T39 A;  2DJI A;  2DMP A;  2HDD A;  3BJA A;  3AG1 H;  1GV5 A;  5GAD J;  1F1Z A;  2OQG A;  3ESW B;  2EK5 A;  3IH3 A;  4I6Z A;  3F6O A;  3BC8 A;  5FFZ A;  3HL2 A;  1ZG1 A;  1IXC A;  4S05 A;  2G0E A;  4OIR F; 
#chains in the Genus database with same CATH homology
 2E1O A;  3BG3 A;  2L7Z A;  1DU6 A;  1WH7 A;  2XPU A;  5EGO A;  2MW8 A;  4B3A A;  2AHQ A;  4DYC A;  3NAR A;  1I3Q J;  5FKO A;  1JUS A;  1JTY A;  1MBF A;  2EZK A;  1IV6 A;  4A3I J;  3PO2 J;  1ETO A;  1AU7 A;  3G1M A;  2LK2 A;  3TP0 A;  3FKI J;  1FTZ A;  3IV5 A;  2DA7 A;  1BJZ A;  1D5Y A;  2IAI A;  3ZQC A;  1B72 A;  3OSF A;  3QQA A;  3TP3 A;  3HOY J;  5M3M J;  4UUS A;  1Y1V J;  3QPL A;  3JRD A;  3JR9 A;  5F04 A;  2E19 A;  1PUF A;  4I76 A;  1MNM C;  2YUS A;  3SDG A;  2DN0 A;  3G1O A;  2H1K A;  3TED A;  2IEK A;  3O8G A;  2K40 A;  4JYK A;  2B63 J;  2P81 A;  3JRB A;  3CDL A;  2E2H J;  3S17 J;  3ZQF A;  1QPI A;  2COB A;  3RKQ A;  4BKX A;  5C4X J;  4JX6 A;  3HOZ J;  2XPV A;  2MG4 A;  4MFD A;  1I6H J;  2ECC A;  4S0H B;  4IHX A;  5F0H A;  5IP7 J;  4D5F A;  1OFC X;  3VPR A;  4Y52 J;  4BXX J;  2H8R A;  4C3J J;  5EZH A;  2R7Z J;  1TWC J;  2RAE A;  4BBR J;  1ETK A;  1BL0 A;  1VF9 A;  2AO9 A;  5M5X J;  1IDY A;  2ID3 A;  2YU9 J;  4XRS G;  4IHV A;  4HNV A;  1IRZ A;  4JX4 A;  3TW7 A;  5IPA A;  3SFI A;  4ABZ A;  1MH4 A;  5F27 A;  3A01 B;  4BBS J;  2R5Y A;  4C3H J;  2CUE A;  3ZQL A;  4X1E A;  4XK4 A;  2FD5 A;  1LFB A;  2DA3 A;  3C2B A;  1T33 A;  1MSF C;  3Q0W A;  3ZQH A;  3S16 J;  3HDD A;  1W0T A;  4CYC A;  3LOC A;  1Q1V A;  3ZQG A;  5EG0 B;  2Y9Z A;  3BR0 A;  1CQT A;  1FIA A;  2IBD A;  1MBE A;  4MFE A;  1APL C;  4DYR A;  2HYJ A;  4C3I J;  2LP0 A;  3B6C A;  3UKG A;  2Y9Y A;  1QVU A;  4B1R A;  5J1R A;  2Y31 A;  5FKK A;  2HQ5 A;  4A3M J;  3JRA A;  4B4C A;  3GTM J;  1ZK8 A;  2VPR A;  1ORK A;  3RZO J;  1HDP A;  1XG1 A;  1Z77 A;  3HOU J;  5FJ8 J;  5E3L A;  4W97 A;  5FKL A;  3JRC A;  2NVQ J;  1NTC A;  2N8G A;  4MIM A;  4IEJ A;  4AC0 A;  3HKZ N;  1ZQ3 P;  2TCT A;  4AUX A;  1BW5 A;  3GTP J;  1F36 A;  3L1P A;  1JTX A;  5M3F J;  3BTC A;  1UG2 A;  4W1U A;  3Q3S A;  1ETX A;  4M3F A;  5F08 A;  3HM5 A;  5GPA A;  4DYQ A;  1NK2 P;  1MBJ A;  4A3C J;  5DS9 A;  1HCR A;  2ECB A;  2LFB A;  2MGQ A;  3BG5 A;  4FE4 A;  2E2I J;  2WAQ N;  2R92 J;  3BTI A;  1MH3 A;  2X48 A;  5J1U A;  2ME0 A;  3GTK J;  1TWG J;  1JUM A;  2VI6 A;  3NAU A;  1RKT A;  1W0U A;  3BT9 A;  4FCY A;  1X58 A;  3I4N J;  1SAN A;  3JRI A;  1ETV A;  3G1L A;  5GPC A;  2HXI A;  4QIW N;  1VFC A;  5IOZ A;  2ID6 A;  2ELK A;  2LKX A;  2EQR A;  5IYD J;  5FLM J;  3B6A A;  1EF4 A;  3S1Q J;  5IP6 A;  1BW6 A;  1U9N A;  3K7A J;  1TWA J;  2GLO A;  1RR7 A;  2JK3 A;  1NK3 P;  5GP9 A;  1T56 A;  2VKV A;  5IYC J;  5EDN A;  2O7O A;  5J1Y A;  2JA8 J;  2DJN A;  2JN6 A;  4LOC A;  3LSR A;  1Y1W J;  1JT0 A;  2CJJ A;  4M3B A;  2KDZ A;  1RES A;  4MO7 A;  3MKL A;  3A01 A;  3WHB A;  1OCP A;  1OJL A;  2DTZ A;  1ENH A;  2K9Q A;  1ZR4 A;  4UUT A;  2R93 J;  2DA5 A;  4A3B J;  2M8G X;  1IJW C;  1SFO J;  1HLV A;  3OIO A;  2XSD C;  5IYB J;  2HOS A;  2OPT A;  1AKH B;  2NS7 A;  2EZI A;  5EG0 A;  5EYR A;  2NVT J;  1WPK A;  5EEA A;  1MBH A;  2M9H A;  1ITY A;  2EH3 A;  1IGN A;  3ZOB A;  4A3J J;  2GBY A;  4M6V A;  3SJM A;  3HEF A;  1RET A;  2XGC A;  4EEF G;  5K7H A;  1LFU P;  2I10 A;  3MVP A;  5M5W J;  3S1R J;  1JJ8 C;  5E3N A;  3BTJ A;  1YRN B;  1GV2 A;  3H3V K;  4A3E J;  2FQ4 A;  4Y7N J;  3LSG A;  2K9N A;  4A3L J;  1OCT C;  5F0F A;  2VUM J;  3JRF A;  4DW6 A;  1IDZ A;  1R9T J;  1JKP C;  5F1J A;  5E3M A;  2WV1 A;  3CQZ J;  4A3G J;  3S1M J;  2EZL A;  2ZB9 A;  4FIS A;  5K7F A;  3GTJ J;  1TC3 C;  5FLV A;  2FX0 A;  2W48 A;  2HXO A;  3BR2 A;  1H89 C;  2GM4 A;  4XIC A;  2KT0 A;  1WGX A;  1B8I B;  5K7Z A;  1X2N A;  2XGE A;  1JT6 A;  3BQZ A;  2HI3 A;  2EZH A;  2JWT A;  3FK6 A;  1U8B A;  3QPS A;  4IHW A;  2CUF A;  2JMW A;  3FIW A;  4XRM A;  4MLO A;  4QTR A;  4FTH A;  2XPW A;  1ZR2 A;  2XB0 X;  1VI0 A;  1MBG A;  2QCO A;  2CRG A;  1U9O A;  2L9R A;  3JRE A;  1VND A;  3HOV J;  2LLK A;  3FIS A;  2WB1 N;  3GTL J;  2DMT A;  1IC8 A;  1UHS A;  3WHC A;  2EBI A;  1LE8 B;  3O8H A;  3LSJ A;  4V2F A;  3K2A A;  2DA2 A;  2YS9 A;  5M5Y J;  1GUU A;  2CU7 A;  3CMY A;  3F0C A;  4RDU A;  1RPW A;  4XRS A;  2DMU A;  3S1N J;  3JRG A;  4A3F J;  4BY1 J;  3M3Y J;  1ETY A;  3IH4 A;  1H88 C;  5C44 J;  1AHD P;  3S2H J;  2QF7 A;  2X9D A;  4DZP A;  2JJ7 A;  2CQQ A;  1P7J A;  5J3L A;  5IOY A;  3BR1 A;  2DA4 A;  9ANT A;  3JRH A;  4A3D J;  1ETQ A;  2M2E A;  1GVD A;  4G12 A;  1ZGW A;  2LTP A;  2R5Z B;  2Y30 A;  2LR8 A;  5C4J J;  3MN2 A;  1UMQ A;  4JP0 A;  5EGO B;  3OOU A;  5JLX A;  1WH5 A;  3ZQI A;  1HDD C;  5FKM A;  1TWF J;  1IG7 A;  1RKW A;  3BQY A;  2L7F P;  1AKH A;  1DU0 A;  3S14 J;  2LD5 A;  2R0Q C;  1MSE C;  1ZKG A;  2NS8 A;  5HOD A;  1P7I A;  3HOW J;  3BR6 A;  3GTG J;  3FK7 A;  3BR5 A;  4A69 C;  1GDT A;  1A5J A;  1B72 B;  2L0K A;  3BG9 A;  4D5C A;  4IHY A;  3OSG A;  2NVY J;  4M3D A;  2PMZ N;  1ZTR A;  1TWH J;  4UUS B;  5FKN A;  2VKE A;  1A6I A;  4D7N A;  3M4O J;  1IUF A;  2MSY A;  3BTL A;  1JKO C;  3LNQ A;  2HOT A;  1XC5 A;  1PUF B;  5BNG A;  1YRN A;  1O4X A;  1MBK A;  3D1N I;  3RZD J;  1I50 J;  1HF0 A;  1JKQ C;  2ME6 A;  5C3E J;  3HGY A;  2M34 A;  3CCY A;  3A03 A;  2JA5 J;  2XRL A;  4A3K J;  5F0C A;  1H8A C;  4QSH A;  1X2M A;  5DTD A;  1FEX A;  4BY7 J;  3LSP A;  4GFB A;  3HB9 A;  1WI3 A;  2X6O A;  2DA6 A;  1G2H A;  2JA6 J;  1K83 J;  2K9S A;  1B8I A;  3PO3 J;  4D7M A;  3S15 J;  3E7L A;  3Q0U A;  4X6A J;  4JX5 A;  5E3O A;  3IH2 A;  1JUP A;  1U78 A;  1BA5 A;  1JKR C;  5EZG A;  2Y0S N;  2OF7 A;  3I4M J;  2CQX A;  4AYB N;  2DA1 A;  1S7E A;  1QVT A;  3PM1 A;  2M0C A;  3H0G J;  4RBO A;  2R5Y B;  1FJL A;  4M3G A;  1XS9 A;  3Q0V A;  5IP9 J;  3W6V A;  2NOG A;  4C2M J;  2HOA A;  2XGD A;  2NVX J;  2O9L A;  3DEW A;  1HOM A;  4L5E A;  4J19 A;  4FE7 A;  4CYC B;  1JJ6 C;  1LE8 A;  3HOX J;  1F43 A;  1ETW A;  2Y2Z A;  4M3E A;  1QRY A;  1FTT A;  2TRT A;  3TW6 A;  5JLW A;  1Z0X A;  2L7M P;  3HGG A;  3RQI A;  2DMN A;  1E3O C;  2JA7 J;  3GTQ J;  3GTO J;  1K61 A;  2E2J J;  2O8K A;  1FIP A;  4NDL A;  3HBL A;  2LY9 A;  3GBG A;  4XID A;  1WCM J;  1JGG A;  4A93 J;  2XB5 A;  1GT0 C;  3S2D J;  2DMQ A;  2DMP A;  2D5V A;  3DCF A;  2HDD A;  3BR3 A;  1POG A;  1GV5 A;  3A02 A;  2LVS A;  3IH3 A;  4DZJ A;  4I6Z A;  2R5Z A;  5EF6 A;  4V2G A;  2FJ1 A;  2G0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...