2ZJPF

Thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
144
Chain Sequence
MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjpF02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2zjpF01
1Y39A 3G71I 1VQOI 3DLLF 1FOYA 1HC8A 5GAEJ 2ZJRF 3I55I 1YITI 4IO9F 1WIBA 1VQ8I 3CJQB 3CMEI 5GAHJ 3CCEI 1VQ5I 3PIOF 2E36A 2OTLI 3CJTB 1ACIA 1YIJI 4UY8I 3CCLI 2ZJQF 5DM7F 2QA4I 3CC7I 1YHQI 3CCSI 5DM6F 5JVGF 2E35A 3CCUI 3CMAI 2NXNB 2H8WA 3CCRI 3CCVI 1VQLI 2E34A 3G6EI 3CD6I 1VQPI 3CC2I 2QEXI 2OTJI 1YI2I 1FOXA 4IOAF 1QA6A 3J7ZI 2JQ7A 2K3FA 1VQNI 5GADJ 3CCQI 1FOWA 1VQ7I 1VQ6I 5GAGJ 3CF5F 1S72I 2FOWA 3EGVB 3CCMI 2ZJPF 1VQ4I 1VQMI 3J7YJ 1VQKI 3CC4I 3I56I 3CJRB 3G4SI 1VQ9I 4IOCF 1YJNI 1MMSA 3CCJI 1YJWI 4V19K 3CJSB 3PIPF 1YJ9I
chains in the Genus database with same CATH superfamily
1Y39A 1ON1A 3GBGA 1UMQA 3CLQA 1Q1HA 1IV6A 4FCYA 3BP8A 4A93J 2AHQA 4ESBA 3G73A 1MH3A 1ZRDA 5KVRA 4Y15A 2KL4A 3H0GJ 2VLAA 4NHJA 4GYIA 1USTA 3GWZA 3CCEI 5F0CA 3S14J 5CVRA 4EM2A 4EM1A 2JA5J 2WC2A 5L3GA 5E1ZB 3S17J 2XROA 2DMQA 4MNUA 4XLEA 1OCRH 3OIPA 3BG5A 3FXRA 2DT6A 1Y8RB 1ZN2A 3PFYA 3L1PA 3PO2J 1EA3A 4A6DA 4BKXA 3JAMK 2GWRA 4XLNF 5B1BH 5H2FC 4X1EA 1Z9CA 5K5OA 1IAWA 3D0SA 5AIQA 3I3LA 2JSPA 3K7AJ 2W48A 4I01A 3KEOA 3VOEA 1MBFA 1BW6A 1DP3A 3ABMH 2ZSHB 4FISA 3CC7I 2DK8A 3FXLA 2FOKA 1HXDA 4F93B 5LEJA 4XLCA 3SYTA 2DMTA 3CMAI 1BI3A 3F3XA 4ZYEA 2CFOA 3KE2A 3CD6I 2CQQA 2KP6A 1TWHJ 4OIOF 2RQQA 3HTSB 2IGOA 2LNBA 2NAZA 1LJ9A 1YS6A 4EJWA 1YX5A 5IP6A 4KIGA 4BE0A 4XN3A 4KIBA 2KRCA 3WGHA 2GIVA 3J81K 2XGEA 2V9KA 5GADJ 4MTDA 2LYCA 2DOAA 3BG9A 4HLXA 1LDKB 3ZQFA 2E1CA 1ZH5A 1IRGA 3ZRGA 3FHZA 3X2QH 5EG0A 1VQ6I 3Q5FA 3OYKA 1D8KA 2DJIA 3AAFA 3ZQHA 3I53A 2JRTA 4UVBA 1B9MA 2J5OA 2CG4A 5E1XA 3MFKA 2A07F 4P9FA 4B3AA 2STWA 4XORA 3HKZN 3H92A 3NEUA 3SEQA 2PI0A 1UHWA 2VXZA 4XRMA 1BM9A 1J5YA 4YIRX 3OSFA 3FK7A 1OMIA 2XSDC 2BW3B 1VFCA 1XGNA 1SAXA 2BEOA 2W24A 4P9UA 1K78A 3BT9A 3CJRB 3WG7H 4M9XA 1X19A 3WTWC 1YJNI 2LTPA 4KMFA 4RGSA 3PNVA 2A68F 4EJVA 1EF4A 4HA8A 4LG0A 5A2QK 1SFUA 4D5CA 2M8EA 2V1NA 3BR1A 1G6NA 4D7MA 4AWXB 3ZMZA 4N4NB 3MZHA 4EEFG 3F8NA 5LHHA 2JUGA 1YQAA 4MTEA 3SHFA 2HS5A 5LGTA 2KZGA 5C44J 3I55I 1PUFB 2LOOA 1PYVA 3IHUA 4KICA 3DXJF 2IA2A 1X1CA 1ODDA 1V3FA 1LB2A 2H6BA 1RPWA 3PIOF 2OC6A 2BXYA 2P4WA 4KN7X 4CXFA 2QSHX 2CV0A 3TP3A 1WJBA 4PJJA 3WODF 2MG4A 2KIUA 1JTYA 4LJZF 1QRYA 3HOSA 2DA2A 1PJRA 3MKLA 2CWEA 1GDTA 2DA3A 1YIOA 3FMRA 2XIGA 4PSXA 4BDYA 1S29A 4DIQA 2FEZA 3A02A 4AYBA 3OYMA 3E6MA 3RSNA 2R92J 2MABA 2QCOA 4OMYA 5GPAA 4YELA 4WX9A 3N97A 2XAUA 4FX0A 1WZ2A 4KT5C 4DYQA 1IXSB 4RAYA 1ZGJA 2QYOA 5K5QA 5JLXA 1SFKA 1ZR2A 2K4JA 4LK1F 5HDGA 4CSWA 4ENMA 3KX2A 4A3FJ 3T0YA 3D1NI 1Y56A 1MNMC 4EQQA 2FJ1A 3JW4A 2M4GA 1JKPC 3VODA 1IC8A 3I58A 1IO2A 1QZYA 1W0TA 4GO1A 4LD5A 4OOIA 1T8IA 3JRCA 2B9SA 1KQ8A 5HNHA 2H1KA 2BY0A 5M5WJ 3I59A 4ZC3A 1U8RA 3DV8A 3LAPA 2P8TA 3SXYA 4KN4X 5M3FJ 4RLQA 4G6DA 4H4KC 4RA2A 3WGGA 2ME6A 1WPKA 1LPQA 2EZHA 3RYRA 1O3QA 3LA3A 1X2MA 2WAQA 1VQ4I 4CGZA 2R7UA 4NC8A 4BXXJ 2Q2EB 4HV5A 1DPUA 5E18F 1XDSA 1Z0XA 1ONVA 2K9SA 2KZVA 1XSDA 4AD9A 3CC4I 3DP7A 2MSYA 3I64A 4XK4A 1E2XA 2LMDA 2R0QC 4QLCU 1MJBA 2EV5A 2XSJC 4IOCF 3CCJI 2OAZA 1BIAA 2V6CA 1YJWI 3O6BB 2LKXA 2XB5A 3HRMA 3OYEA 2MA3A 3OIOA 3UNGC 2ZB9A 3JRBA 2YPRA 3RJPA 2DT5A 2MGQA 5EGOA 1F9NA 1R71A 2MW8A 2OJED 1ZRFA 3E5UA 2H94A 2CUFA 1CGPA 5BQTA 4UUVA 1R4MB 4A3LJ 1HCRA 1ETXA 3ECOA 1U6GA 5J6XA 1GXQA 2GZWA 3NWTA 3ZCOA 1FPQA 1G3WA 1DDNA 1LFPA 4IO9F 2LFBA 3ZN1A 1WJDA 5HLGA 2QVOA 3QYFA 4YIIA 5GAHJ 1WSUA 2WTEA 2PMZA 2VB6A 5FLMJ 2RV8A 4ZJZA 4L9VA 4NQWA 2GA1A 1J7KA 2LDUA 1QVUA 3EUHA 5ED4A 3AKZA 5IT9Z 1PVEA 4B4CA 4IPAA 1QVTA 4E7KA 3OYLA 1GXPA 1YRNB 4OIPF 1NK3P 4PGHA 2LP0A 3H3ZA 1RNLA 2VKEA 4HRIA 2V1XA 2X85A 3RPQA 5LD2C 5EEAA 2PEXA 3RPUA 2ZJQF 4HNUA 2AS5F 1HA8A 1VI0A 5F27A 3FXMA 3BZ6A 3SZGA 2XAFA 5E3NA 2NVQJ 1K61A 4ZYDA 4HG2A 1IN7A 3E5QA 2QBYA 3VSLA 2XPWA 2R3SA 4ANJA 2JA2A 2KIMA 2UZKA 3G2BA 1MBHA 5DCMB 5M5XJ 3K4JA 4PFOA 3PUBA 4EJTA 3KP3A 2XB0X 1W7PB 3JREA 3V7CA 2E71A 3H3UA 5L3BA 4IF4A 2BY1A 1XS9A 3HRUA 3VB2A 2HVRA 2EV0A 2K3FA 5JHFA 4KFCA 1KYZA 4BL0B 4WK8F 1S7EA 2M8GX 2OV7A 2L2OA 2QQAA 3S3NA 5BPIA 4HNVA 2ISZA 2R5ZB 1VQ7I 4RMNA 1HKTA 4BYYA 2CO5A 4M3GA 2CMPA 3O3KA 3S3OA 4C3HJ 2ZBKA 2R93J 4A3DJ 2K27A 3CF2A 3M07A 3I4MJ 3LQRA 4CO8A 3Q0WA 4XLPF 1VQKI 4IRGA 2OBPA 2XUBA 2Y2ZA 3BJ6A 2ETHA 2HZDA 1IRFA 4BEHA 2L02A 3DPTA 1MSFC 1V55H 2Y0MA 1OPCA 4LB6B 4XQFA 4AM3A 2HWVA 2CQXA 2WADA 1A36A 2ELHA 4M6YA 4I2OA 4JP0A 5J3LA 3TBIA 3H36A 3LSHA 2K3PA 4XR6A 3QP5A 2XAJA 4C3IJ 3WTSC 2VI6A 4J01A 2X1CA 4UVCA 3FM5A 1ZG3A 2WA0A 3G1MA 4DJAA 2VIXA 3K2AA 2NYXA 2HTJA 3F72A 4M6XA 3W2WA 3F22A 1N75A 1AKHB 1JXSA 1J09A 2FMYA 2KFDA 2O8XA 3WG9A 3WU1B 3GTQJ 2K4BA 2IJLA 5F6FA 3MKZA 5LHGA 3HYIA 3SFZA 3OS2A 3TP0A 1TWAJ 3F8CA 2DMNA 1VQ5I 3BZKA 5BNGA 3O2PE 5KCMA 5M3MJ 3M9AA 4HF2A 3L2UA 5ICFA 2HPMA 2IA0A 4B44A 1MW7A 2HI3A 4HF1A 3KETA 3M8EA 2LF8A 4I0BA 3KEYA 4BNCA 2HQNA 5FRNA 4RS8A 4GCVA 3JRHA 4LLNA 1QNTA 3E7LA 3EUKL 1Y0UA 1YHQI 3KYCB 4LOCA 2E35A 1W5CC 3FISA 3L00A 4IHXA 4JBAA 1R1VA 1MGTA 1T6SA 2JK3A 2W85A 4C2UA 2PG4A 1V4RA 1LFUP 3LOCA 5TGTA 2XGCA 2KKOA 4PZJA 4BACA 2IT0A 1IG7A 2MH2A 5EYRA 4YG2F 2XAHA 3CUQA 4ZYAA 5F64A 2JVGA 5IYBJ 2QSGX 1OJLA 1WJAA 1RR7A 1ETOA 2DQLA 4QTRA 5LGNA 2V9VA 3OOPA 2WB1N 4HF0A 1WVRA 5FJ8J 2D1HA 3V7RA 4Q48A 4ENNA 4ZH4F 3HEFA 5KNLA 1O3TA 5B1AH 2ZJPF 1VQMI 3IH3A 1R4NB 3S1MJ 2VBYA 2EK5A 2RGVA 3M8JA 3S16J 5FFZA 2D2WA 4G8XA 4BHPA 5FKMA 5HS8A 1GT0C 2IS2A 5JR3A 1S8NA 3ASOH 4N9IA 2RREA 3V4GA 3TO6A 4XRSG 2GAUA 4I76A 1MMGA 1X3ZB 3OWTA 3ZMUA 5F1JA 1H9GA 1TWGJ 4LB5A 3LA2A 2IGNA 1KQ9A 2PMUA 1RKWA 4HDUA 3L2RA 4A3KJ 4UNOA 2YUSA 3T8TA 2VJJA 3I0TA 4ESJA 2MLKA 4DYRA 3OIQA 1J9IA 2ZKZA 2L3DA 3EUHC 3H0DA 3HOXJ 3U9GA 4PJMA 4L9JA 4A3JJ 1RZ4A 3WTVC 3E3VA 4BGDA 1UCRA 3K4BA 1MSEC 2KJCA 2X1DA 1O3SA 2GQQA 1SANA 4P5OA 1X4OA 4CYCB 3QAHA 5FO5A 2KISA 2EIJH 5CVJA 3U1DA 2JVHA 5F08A 4HX4A 2TDXA 4IJAA 1ZARA 3RI4A 4RGRA 1GVDA 3ECHA 3KCCA 1XGSA 3QYBA 1P4WA 4EM0B 1MBEA 1BI0A 2F5DA 3S1RJ 3KP7A 5DM6F 1YFHA 4RGUA 1HDDC 1LFBA 2V79A 2BGCA 3I71A 2LREA 3KFWX 2W7NA 2Z16A 3OR2C 3JRDA 1XD7A 2E34A 1XSVA 3DTEA 3WTXC 3A2KA 4HLYA 3KPHA 2X6XA 3JTHA 1R5HA 3S15J 2F5EA 2JT1A 1FYLA 5E3OA 3EQLF 1F1ZA 2DTZA 1R58A 4IOAF 3OOUA 5J8FA 2R5YA 2E1MC 1N77A 2EZIA 2Q0OA 2VC0A 4UV9A 1TP4A 3RQ4A 2LVSA 5LLQA 3CCQI 3CO7C 1TZLA 2XRNA 1T56A 2EFQA 5CVIA 5CYVA 5D5WB 4G6TB 3LSMA 4RDUA 2ECBA 3IAM2 1WH5A 3FZVA 1L0OC 1U5TB 3PSIA 3ASNH 3KIOA 4JX6A 2TRTA 2DK5A 2FSWA 1JI8A 2DI3A 5EJCA 3EETA 2M4KA 2ME0A 5HDKA 3OL3A 3MAJA 1RRJA 4BE2A 3C7JA 2NS8A 1FSEA 2OZ6A 2R7OA 2K86A 1NTCA 5FROA 2P7CB 2CQKA 3F9KA 1GLNA 3QPTA 1P4AA 2OQGA 5E3LA 1G4DA 4IKFA 3JSPA 2XASA 2GOMA 1WWXA 4ZDOA 1QZZA 1USSA 4OINF 4P96A 2Y9YA 1DUXC 3DEWA 4M72A 4XSXF 5J47A 4PJLA 3BLYA 2K9MA 1BC7C 2I8DA 3FXJA 1Q1VA 2BBYA 4QIWN 3HG9A 2VC1A 2DXIA 1I39A 3CCYA 1TQPA 3CJQB 4HSRA 1FLIA 2CUEA 4Y3OA 4ZDLA 3O8HA 3OYBA 3PQJA 3PQKA 3F6VA 3HM5A 3NARA 4B43A 4BHCA 5LGUA 2JUCA 3GO5A 1ZREA 4N9HA 4Z2YA 1APLC 2A6TA 4RB1A 4GYGA 3AG3H 2ELKA 4XM3A 1YO5C 4FETA 3KP2A 1BJZA 4IHWA 2BV6A 1ZR4A 2HR3A 1UHMA 2HDWA 2E2HJ 2DLLA 4JK1X 1JKRC 2YS9A 1Z67A 3K4NA 2DFIA 2K7LA 5KHDA 3W2AA 5J40A 2EB7A 5JVGF 2FMLA 1HKSA 2QQ8A 2JA8J 3W3CA 1H88C 1YS7A 4WCGA 2BY2A 3QOEA 2HPIA 2F5FA 1G8XA 1Z77A 4S04A 3I4PA 3CUQC 3BTIA 5TJJA 3P9IA 3ABTA 3EYYA 1FP2A 1UB9A 4CH7A 3CC2I 3RYPA 1IDYA 5IPAA 2ACJA 5J8CA 5ERIA 1K4SA 1HQCA 1I1SA 2I5UA 3E1SA 4KT6A 4XOTA 1TNSA 3A03A 5JI6A 4BQAA 5D4RA 1E3PA 3ZQGA 3VDXA 4ENKA 5EZHA 2FQ4A 1U0JA 4OWRB 1FTTA 2CV2A 4NC6A 1X1PA 2BW3A 2EZKA 1LEAA 3FHNA 3C2GA 1YLFA 3LSKA 1FC3A 2VPRA 3P5JA 2VJIA 1HW5A 5HS7A 1BC8C 1HKQA 3OYCA 2L01A 4BY7J 2XKOA 3K1MA 4L9TA 4I0AA 2Z2SB 1IW7F 1XX5A 1R49A 2XAQA 1G59A 4GXOA 2B0LA 3OSGA 3BROA 1TBXA 3GFJA 2BVMA 1PUFA 1F5TA 3WHBA 1EH6A 3FXQA 1ZG1A 3DU5A 1IN8A 3DLAA 2L7ZA 2UWMA 4LIUA 2DA7A 1YJ9I 3S93A 4HX7A 2EJRA 1ZAOA 5GPCA 4Y33A 3WE2A 4N0BA 2HKOA 3GXOA 3DQVC 3HHHA 4A69C 2MD0A 3CLOA 2ZXHA 1KU2A 2XPVA 2ZMEA 3E6CC 2E19A 1D3YA 1PUEE 2C6YA 1VQ8I 4IQ4A 2BXZA 2Y48A 4DZJA 3R6SA 3CMEI 3WGIA 1P7JA 3HTUA 4F91B 3C1DA 4LMYA 4MEYF 2JMWA 2EFOA 1SFEA 1ZRCA 5JFRA 4CCJA 1MH4A 3CDIA 5J1UA 1LQ1A 3AFHA 5D8KB 4XLHA 1Z21A 4CYDA 5B5EC 3QU3A 1I6HJ 1LVKA 3PFIA 2PFBA 4DQ2A 1Z6TA 2P5LC 3VYRB 2GOXB 4NBQA 2HVSA 3BG6A 3WE3A 1HF0A 3SDGA 2DQRA 2YR2A 2DN0A 2RKHA 3K0LA 1TC3C 4M73A 5DTDA 3VYTB 1FIAA 1UHSA 2IAIA 2DPDA 4ITVA 3HOZJ 2R7VA 3JRGA 1B1BA 1D0ZA 1A6IA 2CYYA 3E97A 3ZP5A 3CZ6A 1ZLKA 2ZXWH 2WY8Q 1BBYA 4NC7A 4IHTA 4MO7A 4A5NA 3CCVI 2VT2A 4CCNA 2K9QA 4F55A 1BN5A 3FXKA 2A6HF 2UV1A 3TO7A 2M9HA 2V4JC 3DBHB 3MWMA 1QZEA 3GTJJ 1KU7A 4CA0A 5K7HA 3GTKJ 4IRIA 3HSEA 3KP5A 2Y75A 2JQ7A 4Y7NJ 2Q2EA 1VQNI 1R22A 2HNHA 1SFOJ 4G6QA 4ZDPA 2FF4A 2X4HA 5GAGJ 2M7BA 1ETQA 1BOAA 2FXAA 2P5VA 2O8KA 1E3OC 4M71A 2IBDA 4XICA 2HOEA 4MHGA 4NB5A 1W36C 5IP7J 3DPLC 3CO6C 1MD0A 2ZFWA 3BQYA 3GLXA 1T33A 2E2IJ 4HV6A 2X6OA 3L09A 4RAGA 1HW2A 1FMWA 1SMTA 5IP9J 2LF7A 1ZGAA 3EDPA 3LSTA 1K79A 2DDBA 3NWSA 3A01A 1VQ9I 1ETWA 2IGMA 3PL8A 2EFWA 3ONQA 4HAMA 1K4TA 2V26A 1P7IA 3LAJA 1W5SA 2DOFA 1D1CA 3V8LA 3BJAA 5C3EJ 3ULQB 4CZCA 3BOQA 5H6QA 3WU2C 4U87A 1R5GA 3GFIA 4EJUA 1H9TA 3MZ8A 4KNYA 4CCMA 2PBIA 3C18A 4TV7A 2HQAA 1FZPB 2IGKA 5GAEJ 3IKTA 3F21A 2ZJRF 2D1VA 3VWBA 4XIDA 2AO9A 3MKWB 4ZYHA 1FEXA 1YRNA 2M1BA 2BZTA 2MLGA 3K9TA 2CUJA 2O5RA 3LQQA 4E7HA 3Q0UA 2LY1A 1T0FA 3F0CA 3FBNB 2WWYA 4L0ZB 1B8IA 2COBA 4KDPA 4S0HB 2M0CA 4HQEA 1W5TA 5D4SA 4XMYA 4U7DA 1ZHFA 3HJEA 5HOOA 2WV1A 2NNYA 2HOTA 4P55A 1YX3A 2DU9A 4A3CJ 1T08B 4XKBA 5D6FA 1R7JA 3SZPA 2HTSA 4II3A 3DKWA 4CCOA 2O3FA 1MDMA 2NVTJ 4K2EA 4UB8C 5CQEA 3R4KA 3V42A 5CQGA 1B59A 5DCMA 2DO7A 4NNJA 1ZTRA 2NNNA 2LBFB 1JE8A 3K10A 1WRJA 3QPSA 3CDHA 1SD5A 4A5MA 1X4PA 4QWQA 3TOAA 1TL8A 2G0EA 4E7JA 4IHYA 1I3QJ 2PLYA 4F3QA 3IWZA 1Z7UA 2WV0A 1IN4A 1R9TJ 1CF7B 4KMUX 1OR7A 3QOPA 2NOJB 2ICWG 2R5ZA 1B6AA 3PO3J 1OCOH 4AVPA 2QEXI 1OISA 3D5SC 3I59B 4IVNA 1MJ9A 4NDLA 3LSGA 3OV8A 3KZYA 1OKRA 4XONA 1RR8C 4CUGA 3C2HA 4DZPA 5LHIA 2ESNA 2IA1A 4J19A 3OYFA 1D1AA 4LLGF 4OU0A 1D0YA 1S7OA 2P5KA 2Z5UA 2L7FP 2F2EA 1W36D 1U78A 3I5UA 3WTZA 3CQZJ 3ABUA 5E8IA 4HDVA 4BXFA 1P6RA 2FUG2 4A3MJ 2YU9J 1Y6IA 1QPIA 2FNAA 3P7NA 2HOAA 2IXSA 4J00A 5ICEA 2F48A 1OLTA 4OMZA 3ZMSA 2VASA 3HRSA 4XKWA 2DOEA 4G94A 2EINH 4JYKA 4PK4A 1OYIA 1JKOC 3I56I 2O03A 3G4SI 5HLHA 4PFPA 2HQ5A 1AKHA 4R8HA 5FLXZ 1FMVA 1UJ8A 3H5RA 4QPOA 4XRSA 3QRFF 4BUPA 3HSRA 2ZMEC 4A0XA 2Y31A 4MEXF 1G3TA 4BDZA 1FBUA 2LG4A 2LLKA 5DDGA 4RB2C 2L9NA 4B09A 1FOYA 1ZLJA 4NQWB 3VSKA 3N05A 1ZQ3P 3SJMA 2ZO4A 4M9ZA 2LY2A 1QGPA 4JX5A 4U0YA 2Z9OA 5B3SH 1U2WA 3ZGKA 1QBJA 2DT7B 1ENHA 1F43A 2DAOA 2KQRA 5DEQA 3M4OJ 2WAEA 2A5WA 3LSIA 4IEJA 2E1NA 1IDZA 3K4LA 4AIDA 3OYDA 3DKYA 4Z6YA 3E5XA 2QKLB 1QHGA 2JWTA 3IV5A 4A3EJ 3A0HC 2V7FA 3VYSB 3OYIA 3ZN0A 3CCLI 3IC7A 1ITYA 1XGMA 5LEKA 3GUDA 1N25A 4EV0A 3OL4A 1LE8B 3D5RC 1C0WA 3L2WA 3LSJA 2GXGA 1MMAA 1XMKA 5EEGA 4B1RA 1FYMA 3GMEA 2FBIA 3ESWB 3CCSI 3U1KA 1JJ6C 1HDPA 3CCUI 2E7XA 2OPTA 2X48A 5D8LB 1K7AA 4ON0A 2HFHA 2VE9A 3CCRI 4A12A 1XMAA 3ZXSA 3TO9A 1RKTA 2N8GA 4HNTA 3HDDA 2A05A 3F8MA 3ELKA 4FHTA 3GYHX 3S2DJ 2FX0A 1HLVA 4E7IA 1BL0A 1MMNA 2L5QA 1Z05A 2QWWA 1FBQA 2QLZA 2FD5A 2FE3A 3J7ZI 2JA6J 3FMSA 1FOKA 4UB6C 5LRRA 2QQBA 1RUOA 1FOWA 2EA2A 4U0VA 4EMSA 2DTRA 3UR3C 1FSHA 1FBSA 4WWCA 5DCFA 4L5JA 4RGXA 2WAQN 5F04A 4BEHB 2PJRA 2XKPA 1SD7A 2LD5A 5D5UB 4XN0A 1IGNA 1R23A 4CICA 3M1EA 3J7AO 1D5VA 3GFMA 2ZFUA 1XN7A 1MKMA 4L9NA 4XKVA 5JVTA 2XDVA 2HZTA 3CUOA 3GW2A 4Q5SF 3FIWA 3BTJA 4UUSB 4F92B 2B63J 1P9QC 2QENA 1T39A 5CLSA 3S2WA 3KYLA 2F5CA 3QP6A 2QGUA 3G1OA 4XKCA 2R7RA 2HOSA 1ORKA 3K1PA 3F8FA 4MFDA 3HBLA 1EV7A 1NG6A 2Y30A 3BR5A 2F4OB 1N78A 3MEXA 1IF1A 1FJLA 1PP8F 4ZYGA 3H5AA 2DCEA 3LSPA 2PMZN 2L7MP 2VN2A 4A6EA 3A4CA 3ZQQA 1R36A 2PN6A 4FE7A 3RZDJ 1UFMA 2K9LA 5FKNA 4W97A 4L5EA 3HC7A 3SQNA 3ZQIA 5DD4A 1ACIA 2OUMA 2R4GA 3BTLA 2QM3A 1CQTA 3HUGB 4KISA 2QUFA 4N4OB 3W6JB 3U21A 1TLHB 1LUJB 1J0RA 2M0MA 5EDNA 2FU4A 2VT3A 3J81Z 5DM7F 1WJEA 2X0LA 3DWLE 3K69A 1V5GA 3OS1A 2VE8A 1K83J 4C9YA 1M1EB 2CGPA 1XC5A 1NHAA 2G7UA 1G3YA 4G12A 2AXLA 3BQZA 2F5VA 2K02A 2PX9A 1OR7C 1YW9A 1Y8QB 3ZMVA 1VQLI 1WQ2A 3KZZA 5E8GA 3DEUA 2FNPA 2GM4A 5IT9K 1BR1A 1KZHA 3L7WA 3WHCA 2GA2A 1Z7LA 3Q9VA 2VONA 3OYNA 1BIBA 2Y69H 2H6CA 4XBFA 4X0GA 2GLOA 2Z99A 3IP4B 5ILUA 1XPXA 3RKQA 1T95A 1BJAA 1U5TA 1XDUA 1ZKGA 1P2FA 5A2QZ 1S5LC 3HXLA 3JR9A 1BA5A 2IPQX 3TMOA 3HL2A 1X58A 4C30A 1ETVA 1Y0NA 4QPQA 1JUPA 3DKXA 3M8FA 3RTRA 1B72A 1U9OA 1VTNC 3K70C 3LFKA 4HPQA 2RAEA 2TCTA 4E70A 4FT8A 4M74A 2QZ8A 2VJ5A 3IH4A 4GRIA 4KITB 5JHUA 1A35A 3S1QJ 3REOA 2Y0SN 1TTYA 2HYFA 3FBIB 4Y17A 4A3IJ 3K1NA 3GTPJ 3RZOJ 1B9NA 4D1QA 2IEKA 3HKZA 1TT5B 5ICCA 4BJ6C 4LIVA 1WCMJ 3E6BA 3VEPA 4YFKF 1BI1A 1IXCA 5HDNA 2O6GE 2GXAA 3PIPF 1SFXA 5HLTA 3GFLA 1MNEA 4I09A 5DS9A 2ID3A 4BQOA 2ZXIA 4RBOA 2DA4A 2CW0F 3BPXA 4Y4RA 5F0FA 1XMXA 1H8AC 1JT6A 5EZGA 1EH7A 2P6TA 2F6CA 4II2A 3ROUA 4FQGA 4B47A 1F4KA 4D7NA 2VOOA 3V8JA 4PJ0C 3OS0A 1YYVA 4BQQA 1TWCJ 4S05A 2K5CA 4PCQA 4LGWA 1KQ0A 4YFXF 2KRFA 1U3EM 3DTKA 4HQMA 2HGCA 2VXDA 3K4MA 5K1YA 5BMZA 1OCTC 3J7AY 3PSFA 3TOBA 4C2TA 2COMA 1MBKA 1OFCX 2UUZA 2Z33A 2MYSA 1XGOA 2XAGA 2P0WA 3GZNB 3B6AA 3HZJA 3TEDA 4B8XA 2JTVA 3CJNA 3FKIJ 3CESA 2Q8KA 5IY5H 2IS4A 2XRLA 1SMYF 1JUSA 1TQIA 4UVAA 3J80Z 5FFXA 3RPUD 4A0YA 1DGRM 2R7ZJ 4UUTA 3JCUC 1JUMA 1UG0A 3BCAA 5CVVA 3QU6A 1A5JA 2VUMJ 1X1AA 1WJFA 5EF6A 1F36A 5F0HA 1B4AA 3ERMA 1AA7A 2JSCA 1A04A 4EATA 2W25A 3LMMA 3F8BA 1YI2I 1FOXA 2X6WA 3RQIA 1RIOH 1AWCA 1EJ9A 3VFZA 3BR0A 3DU6A 2VKDA 4F52A 2ZSIB 3S1NJ 4BXUA 2MBFA 1D8JA 3K70D 1LVAA 3Q3SA 1QO0D 2M87A 3RKXA 4GGGA 2ZXJA 3CF5F 4G7HF 1S72I 2VJ4A 3IH2A 3W6VA 2W4SA 3HHGA 5D6EA 4A3BJ 4Q4ZF 2RNGA 2W00A 1MMDA 2R7SA 1X1BA 3ZMTA 4B3XA 2LK2A 2QF7A 4LITA 1MBGA 4XL9A 1WKMA 2A6EF 3FM3A 4XSZF 2DFEA 3ABLH 3PUFA 4MGRA 2V1UA 2LSOA 1DU0A 1FX7A 3BR2A 2HVQA 3Q0VA 4AUXA 5IYDJ 3ML6A 2MFZA 1SVOA 3M7GA 1OYYA 3LSRA 4HEA2 4EVIA 1VF9A 3EUAA 3GZ5A 3CTAA 3VPRA 5M5YJ 4AVZA 5HS9A 3PNTA 1HSJA 3ZQ7A 4YFNF 3DLLF 1POGA 4Y52J 2CRGA 1MBJA 1V5EA 1OCZH 1YITI 1E17A 2BHYA 2VQCA 1HW1A 4JQFA 4UV8A 4AIKA 3KP6A 2STTA 3RCOA 4BBSJ 5CJ9A 2CH0A 6PAXA 1O7FA 2LH9A 2ISYA 3N4MA 2EFPA 3H1CA 3CJTB 2EIKH 2ELJA 4YIFA 3QQAA 3ERED 3MZYA 3AG4H 2XF7A 2YX4A 4OAZA 5JLWA 1KGSA 3PM1A 5IYCJ 4FX4A 4E7LA 4RLFA 3BTCA 3CDLA 2XGXA 2HXOA 4E7SA 4G9YA 1BI2A 4I99C 5CKTA 1MZBA 4R1HA 3LNQA 3DBRB 3DBLB 4PDKA 2CQNA 3TW6A 1U8BA 1T98A 2EILH 1U9NA 3S3MA 2QA4I 2BVLA 2BOLA 5L3DA 3QODA 1JGSA 3MMYB 3IWFA 1AU7A 4L0YB 5E79C 4BY1J 5GP9A 3K4KA 4FTHA 2KPMA 4MQVA 4OIRF 2W57A 3JSOA 2AXTC 4R79A 3TDZC 2JPCA 1YTYA 2OZUA 1D1BA 1XCBA 4ZTJA 4G7OF 2AQFA 4GFBA 3RKWA 1ZG5A 5H6RA 4KYWA 1GV2A 2X1EA 4DOZA 5EEHA 2R7TA 2VKVA 4HW0A 4YEJA 1U5TC 4RM3A 4WF2A 2OTJI 2M2EA 2FQ3A 1E0EA 3UKGA 1A31A 1QU3A 2M7AA 2EPFA 2KDZA 1IRZA 3AL0C 2DA5A 1JGGA 2PMHA 3OYAA 5TISC 2RQPA 2NVUB 3BR3A 2NVXJ 4IHVA 2WAFA 2E1OA 4LK0F 3RKYA 3I4NJ 1RC9A 2EBIA 1LEBA 3L2QA 3HOWJ 2NS0A 1W1WE 3DFGA 3CMYA 1SAUA 3R0JA 3HPGA 2L54A 5C4XJ 1J59A 4HYEA 4CDGA 1IXRC 5FB2A 1Z3XA 1LKXA 4AU7A 4XOPA 2E2JJ 3B6CA 4AIHA 1I6XA 2X6YA 1WI9A 5EG0B 2OF7A 5E3MA 2H09A 2IP2A 2NOGA 5LRSA 2M3AA 3OYJA 1AOYA 2K9NA 5L3EA 2IW5A 1UZCA 2YSRA 3V8KA 1IJWC 4Y13A 2P7VB 4V19K 2ZMEB 4Q47A 3GTOJ 3ABKH 1I50J 2XV4S 2O0YA 3IRRA 1YE9A 4M3DA 3G71I 3S2HJ 4NUBA 1K78B 1WFXA 3FWEA 3HRTA 1REPC 5FKLA 3GLLA 1IZ1A 2FBKA 3DCFA 1Z6RA 5CPRB 3E6DA 3BG7A 1I5ZA 2QQ9A 3HSFA 2DODA 4LG0B 3MN2A 3PNYA 2WBMA 4BS9A 3FX3A 2I10A 2HKXA 1TQMA 1ZGWA 1JTXA 2LBFA 1O4XA 3BR6A 3CMMA 1VNDA 2P81A 2H8RA 4F7ZA 4ABZA 4I02A 2YU3A 4M3EA 1K6YA 2CW8A 2FRHA 4BJ5C 3A1YA 1Z3YA 1ETYA 2X9DA 2XF5A 4RM2A 1CF7A 4QSHA 3R60A 2DYRH 2JA7J 3IKVA 3JTGA 3BCBA 3MQ0A 3A0BC 3AG1H 2A69F 1WH7A 2EFNA 2HYGD 4DGWB 5E1WA 3MKYB 2LR8A 5K7FA 4MIMA 2VODA 3MCZA 1SVLA 1IN5A 2NS7A 2NXNB 4D9JA 1XG1A 2CQ7A 5DUKA 3J80K 2VQGA 5HNFA 1OCPA 3HPHA 2CSOA 1TW3A 1R6RA 1UG2A 5C4JJ 3AG2H 3TGNA 1D5YA 4UHTA 1DP7P 2GXBA 2L4AA 2R7WA 4WXDA 5IOYA 4HX8A 1QA6A 4U7BA 2D45A 2UXNA 1HBXG 1J75A 2KIQA 4LLLA 2R7XA 1W7PA 2H27A 5LBQA 1GHCA 1IRXA 2DA1A 3GVAA 1FYKA 2KMUA 3EYIA 4B48A 1EKEA 1MJAA 3H9QA 1R00A 2V1DA 2W82A 1RUNA 3ZQLA 2WB1A 3A01B 3EGVB 2GIZA 3F23A 3ZOBA 1YW7A 2KJBA 3ZPLA 2IS6A 3TL4X 1DGWY 1X3WB 2HQRA 4HZFA 1R5ID 3WTYC 4RAZA 2EWNA 3FDYA 1QPMA 3H9GA 2R7FA 4IL6C 3KP4A 4I98B 3SFIA 2HEOA 2EH3A 2D5VA 5BOXA 2R7DA 3K2ZA 2DA6A 4RAFA 4BE1A 3GCMA 4KJZA 1YG2A 4L5IA 2OD5A 3NAUA 4ETSA 4E6KG 3FK6A 1NH3A 3HGGA 2HU9A 4YRVA 3R0AA 3HGYA 2RC4A 2KDOA 1RETA 5KAFC 1B8IB 3Q9SA 4I7HA 2WY7Q 1NK2P 5FKOA 3HOVJ 2JRMA 3RDIA 2FBHA 1WIBA 3H35A 4D0PA 2LY9A 1IV8A 1TWFJ 2M30A 5GTIC 2ECCA 1ERDA 1ULYA 3MVPA 2MH9A 5EGOB 2Z3YA 3BJOA 1LE8A 2DFHA 4BHBA 1MDMB 5IT3A 2ZJ2A 3CP8A 2OQRA 3K4CA 4U88A 1ZK8A 2AQEA 2E60A 4E4HA 3OMYA 1PDNC 1X1DA 4GDFA 1KA8A 3GEZA 5GTHC 3BC8A 3B73A 2M45A 4U0WA 5E17F 2KLOA 3EPZA 1RI7A 1KYWA 1SD6A 3GZ6A 3BWGA 2JN6A 2VL8A 5K7ZA 3L2CA 2L9VA 5ILSA 3ISPA 3ZMDA 5B66C 3L9FA 5D5XB 3FXUA 4I6ZA 2ZCWA 2F4IA 3WTTC 1OQYA 1GUUA 2E7WA 4KIFA 1OCCH 4HOBA 1G2HA 2DBBA 2L9RA 1QHHD 4CZZA 3G6EI 3DEEA 1S7AA 2XC7A 1WJ5A 3HOTA 5IOZA 1KU9A 1J2XA 3FMQA 4AYBN 2E5ZA 1R1UA 4DYCA 2ZNYA 2MC4A 5D5VB 3LWFA 1L3LA 1RESA 2Y0SA 2QBYB 3OYGA 2LRDA 1WGXA 2YX7A 3HIFA 1LDJA 1FY7A 3COAC 3KYDB 1PP7U 1H0MA 4EGYA 2BE5F 4HBLA 2P6SA 3T8RA 4DBQA 3IAS2 2QKMB 1FNNA 4UUSA 2KRHA 3CCMI 1V5FA 3JRFA 4V2FA 1MNDA 4XLFA 3HOUJ 2G7HA 1O57A 3RIRA 2VBWA 1X2NA 2UXXA 2O9LA 2RNJA 3T5XA 1S3JA 1FIPA 2E1MB 2MD5A 3H5NA 2CV1A 1WJCA 1Z1DA 3U2RA 1WI3A 4PGGA 2IS1A 1W0UA 5FKKA 4MFEA 1GVJA 3H3VK 2OCEA 1NG7A 2XVCA 4V2GA 5HLIA 1XSXA 1TT0A 5J1RA 5J4YA 4OIQF 1K6OA 3K6GA 2E5NA 2NRAC 2OA4A 2A61A 1TNTA 1VQOI 4LFUA 4BQNA 2MC3A 2G9WA 3GTLJ 1HC8A 2DDAA 3BZCA 2ZC2A 3IRQA 1GV5A 1O7LA 1XB4A 2ID6A 1BR4A 1P92A 3HUGA 2Q1ZB 5LFAA 4M6VA 3OYHA 2DFFA 4O6JA 2ZNZA 1T2KA 4ASNA 1FWZA 2E36A 1ZELA 1JHHA 4DW6A 2OTLI 5J4VA 2H1LA 4X6AJ 1IUFA 1S9HA 4XLAA 3OR1C 2BY3A 3WTUC 1T38A 3JAMZ 1YIJI 5J1YA 1JKQC 1A6QA 4G7ZF 1UELB 3IL2A 4M3FA 1SVMA 4H0EA 2VKHA 1EH8A 5ICGA 1S6LA 2IVMA 2NVYJ 1T0FC 1Z91A 5AIPA 3CP2A 4PUSA 3O8GA 5FRMA 2VPLA 4CYCA 4UXNA 4FASD 2LKSA 3BY6A 3VYUB 2DMUA 4BBRJ 1QQIA 4BAYA 4ZZDA 5L3FA 2JJ7A 1X3UA 2VBZA 2X51A 2F4MB 2H8WA 1Y1WJ 4EGZA 1SEUA 3TKYA 3GF2A 4WXHA 1DQUA 2ESHA 5FGMA 1VQPI 2K40A 1WHUA 5CVUA 2IRFG 4KA4A 2O61A 4BH9A 3KLOA 1HOMA 2DW4A 3T1BA 3BPVA 1ZYRF 5DD8A 4AIJA 2PQ8A 2PJRB 4A2UA 3PJRA 2CS3A 2OU2A 1W4MA 2A5YB 3KLNA 4ZTFA 2JPBA 5AONA 2XHKA 2CJJA 2HDDA 1OYWA 4IXAA 3TW7A 2ADUA 2DPUA 4HSTA 2DYSH 4PSWA 4CCKA 1BR2A 1FTZA 3CUQB 1BOBA 5ILVA 2O7OA 1YOVB 1AHDP 1MIJA 3S8PA 3J7YJ 2A3SA 3P9CA 5E20A 2EIMH 3GTMJ 2XGDA 2BHZA 3FF5A 3I9V2 4C2MJ 3SDBA 5KK1A 4IZZA 1MMSA 4IHSA 3E0JB 4W1UA 2Z1DA 1TW2A 4CCLA 4D5FA 5FD6A 2L7KA 1JT0A 3LL7A 5F1RA 3CJSB 1IUYA 2QSFX 3DPUA 1D0XA 3SEZA 1G3SA 2HDCA 5FLVA 2HXIA 4DNCA 3TQNA 1I27A 4PJNA 1O3RA 9ANTA 4WXCA 3NQOA 1P4XA 5HVQC 2L0KA 4M3BA 3OY9A 3ZR8X 2KHMA 3ZQCA 4O3MA 1DU6A 4XNFA 5L3CA 5KAIC 2J5PA 4ENJA 2DJNA 4JOMA 4E7ZA 4EJOA 4CHUA 2CU7A 4C3JJ 2XPUA 2OCCH 3S32A 2EV6A 2CUZA 4L18B 3R61A 1H89C 4OAYA 5FLXK 2KIFA 2W1OA 2VBXA 4UY8I 3LFUA 3QYEA 4JX4A 1UAAA 3GX4X 3W6KB 5BPDA 2EZLA 2PJPA 4RB3C 3GTGJ 4A0ZA 3M1CA 3KEQA 2XF6A 1DPRA 3DTIA 2V6EA 1Y1VJ 1ON2A 5DV5A 4M9SA 3QWLA 1ETKA 3HB9A 4ESFA 4IX7A 5K5RA 1SC7A 1BW5A 3JRAA 4KUMA 4RB0A 1YW8A 2DMPA 2VQLA 1STZA 3TDUC 1I3AA 1LDDA 2VQHA 4O5VA 1XCVA 3M3YJ 1FP1D 2EA4A 4AC0A 2R7QA 5DYMA 4A3GJ 5FD5A 3IUOA 2RDPA 2W84A 1W7PD 5HODA 3QPLA 1XTAA 1IN6A 5DUIA 4ZZLA 3C2BA 3BG3A 5H20A 1JJ8C 1B72B 3FKJA 3AL0B 2CW7A 2L9SA 1SD4A 5BS6A 2K85A 2LC2A 2EQRA 3G3ZA 3LA7A 4MLOA 3WU0A 3SZTA 2CFXA 4XRFA 1JHFA 1V54H 3QPHA 3BDDA 3FXOA 4BU2A 5TRDA 2BYVE 3B02A 3F6OA 3HOYJ 2FOWA 1E3HA 2RVCA 1R1TA 3G1LA 3P9KA 2R5YB 4MQ9F 3L2VA 4LG3A 4BJTA 3KZIC 2LKPA 2V9PA 3D5LA 3NRVA 2L4MA 4P1WA 3JRIA 2RN7A 4DBRA 1VZ0A 2M34A 2GBYA 2B7EA 3W2VA 2M5WA 1LNWA 1KONA 4IQJA 4IRHA 3I54A 3MD2A 1FT9A 3V7SA 1I1GA 1KU3A 2HYJA 3H9JA 1HSTA 4FE4A 2VOPA 2KT0A 2Y9ZA 3C3WA 2JZYA 3DF8A 2FA5A
chains in the Genus database with same CATH topology
1Y39A 3G71I 1VQOI 3DLLF 1FOYA 1HC8A 5GAEJ 2ZJRF 3I55I 1YITI 4IO9F 1WIBA 1VQ8I 3CJQB 3CMEI 5GAHJ 3CCEI 1VQ5I 3PIOF 2E36A 2OTLI 3CJTB 1ACIA 1YIJI 4UY8I 3CCLI 2ZJQF 5DM7F 2QA4I 3CC7I 1YHQI 3CCSI 5DM6F 5JVGF 2E35A 3CCUI 3CMAI 2NXNB 2H8WA 3CCRI 3CCVI 1VQLI 2E34A 3G6EI 3CD6I 1VQPI 3CC2I 2QEXI 2OTJI 1YI2I 1FOXA 4IOAF 1QA6A 3J7ZI 2JQ7A 2K3FA 1VQNI 5GADJ 3CCQI 1FOWA 1VQ7I 1VQ6I 5GAGJ 3CF5F 1S72I 2FOWA 3EGVB 3CCMI 2ZJPF 1VQ4I 1VQMI 3J7YJ 1VQKI 3CC4I 3I56I 3CJRB 3G4SI 1VQ9I 4IOCF 1YJNI 1MMSA 3CCJI 1YJWI 4V19K 3CJSB 3PIPF 1YJ9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y39 A;  3G71 I;  1VQO I;  3DLL F;  1FOY A;  1HC8 A;  5GAE J;  2ZJR F;  3I55 I;  1YIT I;  4IO9 F;  1WIB A;  1VQ8 I;  3CJQ B;  3CME I;  5GAH J;  3CCE I;  1VQ5 I;  3PIO F;  2E36 A;  2OTL I;  3CJT B;  1ACI A;  1YIJ I;  4UY8 I;  3CCL I;  2ZJQ F;  5DM7 F;  2QA4 I;  3CC7 I;  1YHQ I;  3CCS I;  5DM6 F;  5JVG F;  2E35 A;  3CCU I;  3CMA I;  2NXN B;  2H8W A;  3CCR I;  3CCV I;  1VQL I;  2E34 A;  3G6E I;  3CD6 I;  1VQP I;  3CC2 I;  2QEX I;  2OTJ I;  1YI2 I;  1FOX A;  4IOA F;  1QA6 A;  3J7Z I;  2JQ7 A;  2K3F A;  1VQN I;  5GAD J;  3CCQ I;  1FOW A;  1VQ7 I;  1VQ6 I;  5GAG J;  3CF5 F;  1S72 I;  2FOW A;  3EGV B;  3CCM I;  2ZJP F;  1VQ4 I;  1VQM I;  3J7Y J;  1VQK I;  3CC4 I;  3I56 I;  3CJR B;  3G4S I;  1VQ9 I;  4IOC F;  1YJN I;  1MMS A;  3CCJ I;  1YJW I;  4V19 K;  3CJS B;  3PIP F;  1YJ9 I; 
#chains in the Genus database with same CATH topology
 1Y39 A;  1ON1 A;  3GBG A;  1UMQ A;  3CLQ A;  1Q1H A;  1IV6 A;  4FCY A;  3BP8 A;  4A93 J;  2AHQ A;  4ESB A;  3G73 A;  1MH3 A;  1ZRD A;  5KVR A;  4Y15 A;  2KL4 A;  3H0G J;  2VLA A;  4NHJ A;  4GYI A;  1UST A;  3GWZ A;  3CCE I;  5F0C A;  3S14 J;  5CVR A;  4EM2 A;  4EM1 A;  2JA5 J;  2WC2 A;  5L3G A;  5E1Z B;  3S17 J;  2XRO A;  2DMQ A;  4MNU A;  4XLE A;  1OCR H;  3OIP A;  3BG5 A;  3FXR A;  2DT6 A;  1Y8R B;  1ZN2 A;  3PFY A;  3L1P A;  3PO2 J;  1EA3 A;  4A6D A;  4BKX A;  3JAM K;  2GWR A;  4XLN F;  5B1B H;  5H2F C;  4X1E A;  1Z9C A;  5K5O A;  1IAW A;  3D0S A;  5AIQ A;  3I3L A;  2JSP A;  3K7A J;  2W48 A;  4I01 A;  3KEO A;  3VOE A;  1MBF A;  1BW6 A;  1DP3 A;  3ABM H;  2ZSH B;  4FIS A;  3CC7 I;  2DK8 A;  3FXL A;  2FOK A;  1HXD A;  4F93 B;  5LEJ A;  4XLC A;  3SYT A;  2DMT A;  3CMA I;  1BI3 A;  3F3X A;  4ZYE A;  2CFO A;  3KE2 A;  3CD6 I;  2CQQ A;  2KP6 A;  1TWH J;  4OIO F;  2RQQ A;  3HTS B;  2IGO A;  2LNB A;  2NAZ A;  1LJ9 A;  1YS6 A;  4EJW A;  1YX5 A;  5IP6 A;  4KIG A;  4BE0 A;  4XN3 A;  4KIB A;  2KRC A;  3WGH A;  2GIV A;  3J81 K;  2XGE A;  2V9K A;  5GAD J;  4MTD A;  2LYC A;  2DOA A;  3BG9 A;  4HLX A;  1LDK B;  3ZQF A;  2E1C A;  1ZH5 A;  1IRG A;  3ZRG A;  3FHZ A;  3X2Q H;  5EG0 A;  1VQ6 I;  3Q5F A;  3OYK A;  1D8K A;  2DJI A;  3AAF A;  3ZQH A;  3I53 A;  2JRT A;  4UVB A;  1B9M A;  2J5O A;  2CG4 A;  5E1X A;  3MFK A;  2A07 F;  4P9F A;  4B3A A;  2STW A;  4XOR A;  3HKZ N;  3H92 A;  3NEU A;  3SEQ A;  2PI0 A;  1UHW A;  2VXZ A;  4XRM A;  1BM9 A;  1J5Y A;  4YIR X;  3OSF A;  3FK7 A;  1OMI A;  2XSD C;  2BW3 B;  1VFC A;  1XGN A;  1SAX A;  2BEO A;  2W24 A;  4P9U A;  1K78 A;  3BT9 A;  3CJR B;  3WG7 H;  4M9X A;  1X19 A;  3WTW C;  1YJN I;  2LTP A;  4KMF A;  4RGS A;  3PNV A;  2A68 F;  4EJV A;  1EF4 A;  4HA8 A;  4LG0 A;  5A2Q K;  1SFU A;  4D5C A;  2M8E A;  2V1N A;  3BR1 A;  1G6N A;  4D7M A;  4AWX B;  3ZMZ A;  4N4N B;  3MZH A;  4EEF G;  3F8N A;  5LHH A;  2JUG A;  1YQA A;  4MTE A;  3SHF A;  2HS5 A;  5LGT A;  2KZG A;  5C44 J;  3I55 I;  1PUF B;  2LOO A;  1PYV A;  3IHU A;  4KIC A;  3DXJ F;  2IA2 A;  1X1C A;  1ODD A;  1V3F A;  1LB2 A;  2H6B A;  1RPW A;  3PIO F;  2OC6 A;  2BXY A;  2P4W A;  4KN7 X;  4CXF A;  2QSH X;  2CV0 A;  3TP3 A;  1WJB A;  4PJJ A;  3WOD F;  2MG4 A;  2KIU A;  1JTY A;  4LJZ F;  1QRY A;  3HOS A;  2DA2 A;  1PJR A;  3MKL A;  2CWE A;  1GDT A;  2DA3 A;  1YIO A;  3FMR A;  2XIG A;  4PSX A;  4BDY A;  1S29 A;  4DIQ A;  2FEZ A;  3A02 A;  4AYB A;  3OYM A;  3E6M A;  3RSN A;  2R92 J;  2MAB A;  2QCO A;  4OMY A;  5GPA A;  4YEL A;  4WX9 A;  3N97 A;  2XAU A;  4FX0 A;  1WZ2 A;  4KT5 C;  4DYQ A;  1IXS B;  4RAY A;  1ZGJ A;  2QYO A;  5K5Q A;  5JLX A;  1SFK A;  1ZR2 A;  2K4J A;  4LK1 F;  5HDG A;  4CSW A;  4ENM A;  3KX2 A;  4A3F J;  3T0Y A;  3D1N I;  1Y56 A;  1MNM C;  4EQQ A;  2FJ1 A;  3JW4 A;  2M4G A;  1JKP C;  3VOD A;  1IC8 A;  3I58 A;  1IO2 A;  1QZY A;  1W0T A;  4GO1 A;  4LD5 A;  4OOI A;  1T8I A;  3JRC A;  2B9S A;  1KQ8 A;  5HNH A;  2H1K A;  2BY0 A;  5M5W J;  3I59 A;  4ZC3 A;  1U8R A;  3DV8 A;  3LAP A;  2P8T A;  3SXY A;  4KN4 X;  5M3F J;  4RLQ A;  4G6D A;  4H4K C;  4RA2 A;  3WGG A;  2ME6 A;  1WPK A;  1LPQ A;  2EZH A;  3RYR A;  1O3Q A;  3LA3 A;  1X2M A;  2WAQ A;  1VQ4 I;  4CGZ A;  2R7U A;  4NC8 A;  4BXX J;  2Q2E B;  4HV5 A;  1DPU A;  5E18 F;  1XDS A;  1Z0X A;  1ONV A;  2K9S A;  2KZV A;  1XSD A;  4AD9 A;  3CC4 I;  3DP7 A;  2MSY A;  3I64 A;  4XK4 A;  1E2X A;  2LMD A;  2R0Q C;  4QLC U;  1MJB A;  2EV5 A;  2XSJ C;  4IOC F;  3CCJ I;  2OAZ A;  1BIA A;  2V6C A;  1YJW I;  3O6B B;  2LKX A;  2XB5 A;  3HRM A;  3OYE A;  2MA3 A;  3OIO A;  3UNG C;  2ZB9 A;  3JRB A;  2YPR A;  3RJP A;  2DT5 A;  2MGQ A;  5EGO A;  1F9N A;  1R71 A;  2MW8 A;  2OJE D;  1ZRF A;  3E5U A;  2H94 A;  2CUF A;  1CGP A;  5BQT A;  4UUV A;  1R4M B;  4A3L J;  1HCR A;  1ETX A;  3ECO A;  1U6G A;  5J6X A;  1GXQ A;  2GZW A;  3NWT A;  3ZCO A;  1FPQ A;  1G3W A;  1DDN A;  1LFP A;  4IO9 F;  2LFB A;  3ZN1 A;  1WJD A;  5HLG A;  2QVO A;  3QYF A;  4YII A;  5GAH J;  1WSU A;  2WTE A;  2PMZ A;  2VB6 A;  5FLM J;  2RV8 A;  4ZJZ A;  4L9V A;  4NQW A;  2GA1 A;  1J7K A;  2LDU A;  1QVU A;  3EUH A;  5ED4 A;  3AKZ A;  5IT9 Z;  1PVE A;  4B4C A;  4IPA A;  1QVT A;  4E7K A;  3OYL A;  1GXP A;  1YRN B;  4OIP F;  1NK3 P;  4PGH A;  2LP0 A;  3H3Z A;  1RNL A;  2VKE A;  4HRI A;  2V1X A;  2X85 A;  3RPQ A;  5LD2 C;  5EEA A;  2PEX A;  3RPU A;  2ZJQ F;  4HNU A;  2AS5 F;  1HA8 A;  1VI0 A;  5F27 A;  3FXM A;  3BZ6 A;  3SZG A;  2XAF A;  5E3N A;  2NVQ J;  1K61 A;  4ZYD A;  4HG2 A;  1IN7 A;  3E5Q A;  2QBY A;  3VSL A;  2XPW A;  2R3S A;  4ANJ A;  2JA2 A;  2KIM A;  2UZK A;  3G2B A;  1MBH A;  5DCM B;  5M5X J;  3K4J A;  4PFO A;  3PUB A;  4EJT A;  3KP3 A;  2XB0 X;  1W7P B;  3JRE A;  3V7C A;  2E71 A;  3H3U A;  5L3B A;  4IF4 A;  2BY1 A;  1XS9 A;  3HRU A;  3VB2 A;  2HVR A;  2EV0 A;  2K3F A;  5JHF A;  4KFC A;  1KYZ A;  4BL0 B;  4WK8 F;  1S7E A;  2M8G X;  2OV7 A;  2L2O A;  2QQA A;  3S3N A;  5BPI A;  4HNV A;  2ISZ A;  2R5Z B;  1VQ7 I;  4RMN A;  1HKT A;  4BYY A;  2CO5 A;  4M3G A;  2CMP A;  3O3K A;  3S3O A;  4C3H J;  2ZBK A;  2R93 J;  4A3D J;  2K27 A;  3CF2 A;  3M07 A;  3I4M J;  3LQR A;  4CO8 A;  3Q0W A;  4XLP F;  1VQK I;  4IRG A;  2OBP A;  2XUB A;  2Y2Z A;  3BJ6 A;  2ETH A;  2HZD A;  1IRF A;  4BEH A;  2L02 A;  3DPT A;  1MSF C;  1V55 H;  2Y0M A;  1OPC A;  4LB6 B;  4XQF A;  4AM3 A;  2HWV A;  2CQX A;  2WAD A;  1A36 A;  2ELH A;  4M6Y A;  4I2O A;  4JP0 A;  5J3L A;  3TBI A;  3H36 A;  3LSH A;  2K3P A;  4XR6 A;  3QP5 A;  2XAJ A;  4C3I J;  3WTS C;  2VI6 A;  4J01 A;  2X1C A;  4UVC A;  3FM5 A;  1ZG3 A;  2WA0 A;  3G1M A;  4DJA A;  2VIX A;  3K2A A;  2NYX A;  2HTJ A;  3F72 A;  4M6X A;  3W2W A;  3F22 A;  1N75 A;  1AKH B;  1JXS A;  1J09 A;  2FMY A;  2KFD A;  2O8X A;  3WG9 A;  3WU1 B;  3GTQ J;  2K4B A;  2IJL A;  5F6F A;  3MKZ A;  5LHG A;  3HYI A;  3SFZ A;  3OS2 A;  3TP0 A;  1TWA J;  3F8C A;  2DMN A;  1VQ5 I;  3BZK A;  5BNG A;  3O2P E;  5KCM A;  5M3M J;  3M9A A;  4HF2 A;  3L2U A;  5ICF A;  2HPM A;  2IA0 A;  4B44 A;  1MW7 A;  2HI3 A;  4HF1 A;  3KET A;  3M8E A;  2LF8 A;  4I0B A;  3KEY A;  4BNC A;  2HQN A;  5FRN A;  4RS8 A;  4GCV A;  3JRH A;  4LLN A;  1QNT A;  3E7L A;  3EUK L;  1Y0U A;  1YHQ I;  3KYC B;  4LOC A;  2E35 A;  1W5C C;  3FIS A;  3L00 A;  4IHX A;  4JBA A;  1R1V A;  1MGT A;  1T6S A;  2JK3 A;  2W85 A;  4C2U A;  2PG4 A;  1V4R A;  1LFU P;  3LOC A;  5TGT A;  2XGC A;  2KKO A;  4PZJ A;  4BAC A;  2IT0 A;  1IG7 A;  2MH2 A;  5EYR A;  4YG2 F;  2XAH A;  3CUQ A;  4ZYA A;  5F64 A;  2JVG A;  5IYB J;  2QSG X;  1OJL A;  1WJA A;  1RR7 A;  1ETO A;  2DQL A;  4QTR A;  5LGN A;  2V9V A;  3OOP A;  2WB1 N;  4HF0 A;  1WVR A;  5FJ8 J;  2D1H A;  3V7R A;  4Q48 A;  4ENN A;  4ZH4 F;  3HEF A;  5KNL A;  1O3T A;  5B1A H;  2ZJP F;  1VQM I;  3IH3 A;  1R4N B;  3S1M J;  2VBY A;  2EK5 A;  2RGV A;  3M8J A;  3S16 J;  5FFZ A;  2D2W A;  4G8X A;  4BHP A;  5FKM A;  5HS8 A;  1GT0 C;  2IS2 A;  5JR3 A;  1S8N A;  3ASO H;  4N9I A;  2RRE A;  3V4G A;  3TO6 A;  4XRS G;  2GAU A;  4I76 A;  1MMG A;  1X3Z B;  3OWT A;  3ZMU A;  5F1J A;  1H9G A;  1TWG J;  4LB5 A;  3LA2 A;  2IGN A;  1KQ9 A;  2PMU A;  1RKW A;  4HDU A;  3L2R A;  4A3K J;  4UNO A;  2YUS A;  3T8T A;  2VJJ A;  3I0T A;  4ESJ A;  2MLK A;  4DYR A;  3OIQ A;  1J9I A;  2ZKZ A;  2L3D A;  3EUH C;  3H0D A;  3HOX J;  3U9G A;  4PJM A;  4L9J A;  4A3J J;  1RZ4 A;  3WTV C;  3E3V A;  4BGD A;  1UCR A;  3K4B A;  1MSE C;  2KJC A;  2X1D A;  1O3S A;  2GQQ A;  1SAN A;  4P5O A;  1X4O A;  4CYC B;  3QAH A;  5FO5 A;  2KIS A;  2EIJ H;  5CVJ A;  3U1D A;  2JVH A;  5F08 A;  4HX4 A;  2TDX A;  4IJA A;  1ZAR A;  3RI4 A;  4RGR A;  1GVD A;  3ECH A;  3KCC A;  1XGS A;  3QYB A;  1P4W A;  4EM0 B;  1MBE A;  1BI0 A;  2F5D A;  3S1R J;  3KP7 A;  5DM6 F;  1YFH A;  4RGU A;  1HDD C;  1LFB A;  2V79 A;  2BGC A;  3I71 A;  2LRE A;  3KFW X;  2W7N A;  2Z16 A;  3OR2 C;  3JRD A;  1XD7 A;  2E34 A;  1XSV A;  3DTE A;  3WTX C;  3A2K A;  4HLY A;  3KPH A;  2X6X A;  3JTH A;  1R5H A;  3S15 J;  2F5E A;  2JT1 A;  1FYL A;  5E3O A;  3EQL F;  1F1Z A;  2DTZ A;  1R58 A;  4IOA F;  3OOU A;  5J8F A;  2R5Y A;  2E1M C;  1N77 A;  2EZI A;  2Q0O A;  2VC0 A;  4UV9 A;  1TP4 A;  3RQ4 A;  2LVS A;  5LLQ A;  3CCQ I;  3CO7 C;  1TZL A;  2XRN A;  1T56 A;  2EFQ A;  5CVI A;  5CYV A;  5D5W B;  4G6T B;  3LSM A;  4RDU A;  2ECB A;  3IAM 2;  1WH5 A;  3FZV A;  1L0O C;  1U5T B;  3PSI A;  3ASN H;  3KIO A;  4JX6 A;  2TRT A;  2DK5 A;  2FSW A;  1JI8 A;  2DI3 A;  5EJC A;  3EET A;  2M4K A;  2ME0 A;  5HDK A;  3OL3 A;  3MAJ A;  1RRJ A;  4BE2 A;  3C7J A;  2NS8 A;  1FSE A;  2OZ6 A;  2R7O A;  2K86 A;  1NTC A;  5FRO A;  2P7C B;  2CQK A;  3F9K A;  1GLN A;  3QPT A;  1P4A A;  2OQG A;  5E3L A;  1G4D A;  4IKF A;  3JSP A;  2XAS A;  2GOM A;  1WWX A;  4ZDO A;  1QZZ A;  1USS A;  4OIN F;  4P96 A;  2Y9Y A;  1DUX C;  3DEW A;  4M72 A;  4XSX F;  5J47 A;  4PJL A;  3BLY A;  2K9M A;  1BC7 C;  2I8D A;  3FXJ A;  1Q1V A;  2BBY A;  4QIW N;  3HG9 A;  2VC1 A;  2DXI A;  1I39 A;  3CCY A;  1TQP A;  3CJQ B;  4HSR A;  1FLI A;  2CUE A;  4Y3O A;  4ZDL A;  3O8H A;  3OYB A;  3PQJ A;  3PQK A;  3F6V A;  3HM5 A;  3NAR A;  4B43 A;  4BHC A;  5LGU A;  2JUC A;  3GO5 A;  1ZRE A;  4N9H A;  4Z2Y A;  1APL C;  2A6T A;  4RB1 A;  4GYG A;  3AG3 H;  2ELK A;  4XM3 A;  1YO5 C;  4FET A;  3KP2 A;  1BJZ A;  4IHW A;  2BV6 A;  1ZR4 A;  2HR3 A;  1UHM A;  2HDW A;  2E2H J;  2DLL A;  4JK1 X;  1JKR C;  2YS9 A;  1Z67 A;  3K4N A;  2DFI A;  2K7L A;  5KHD A;  3W2A A;  5J40 A;  2EB7 A;  5JVG F;  2FML A;  1HKS A;  2QQ8 A;  2JA8 J;  3W3C A;  1H88 C;  1YS7 A;  4WCG A;  2BY2 A;  3QOE A;  2HPI A;  2F5F A;  1G8X A;  1Z77 A;  4S04 A;  3I4P A;  3CUQ C;  3BTI A;  5TJJ A;  3P9I A;  3ABT A;  3EYY A;  1FP2 A;  1UB9 A;  4CH7 A;  3CC2 I;  3RYP A;  1IDY A;  5IPA A;  2ACJ A;  5J8C A;  5ERI A;  1K4S A;  1HQC A;  1I1S A;  2I5U A;  3E1S A;  4KT6 A;  4XOT A;  1TNS A;  3A03 A;  5JI6 A;  4BQA A;  5D4R A;  1E3P A;  3ZQG A;  3VDX A;  4ENK A;  5EZH A;  2FQ4 A;  1U0J A;  4OWR B;  1FTT A;  2CV2 A;  4NC6 A;  1X1P A;  2BW3 A;  2EZK A;  1LEA A;  3FHN A;  3C2G A;  1YLF A;  3LSK A;  1FC3 A;  2VPR A;  3P5J A;  2VJI A;  1HW5 A;  5HS7 A;  1BC8 C;  1HKQ A;  3OYC A;  2L01 A;  4BY7 J;  2XKO A;  3K1M A;  4L9T A;  4I0A A;  2Z2S B;  1IW7 F;  1XX5 A;  1R49 A;  2XAQ A;  1G59 A;  4GXO A;  2B0L A;  3OSG A;  3BRO A;  1TBX A;  3GFJ A;  2BVM A;  1PUF A;  1F5T A;  3WHB A;  1EH6 A;  3FXQ A;  1ZG1 A;  3DU5 A;  1IN8 A;  3DLA A;  2L7Z A;  2UWM A;  4LIU A;  2DA7 A;  1YJ9 I;  3S93 A;  4HX7 A;  2EJR A;  1ZAO A;  5GPC A;  4Y33 A;  3WE2 A;  4N0B A;  2HKO A;  3GXO A;  3DQV C;  3HHH A;  4A69 C;  2MD0 A;  3CLO A;  2ZXH A;  1KU2 A;  2XPV A;  2ZME A;  3E6C C;  2E19 A;  1D3Y A;  1PUE E;  2C6Y A;  1VQ8 I;  4IQ4 A;  2BXZ A;  2Y48 A;  4DZJ A;  3R6S A;  3CME I;  3WGI A;  1P7J A;  3HTU A;  4F91 B;  3C1D A;  4LMY A;  4MEY F;  2JMW A;  2EFO A;  1SFE A;  1ZRC A;  5JFR A;  4CCJ A;  1MH4 A;  3CDI A;  5J1U A;  1LQ1 A;  3AFH A;  5D8K B;  4XLH A;  1Z21 A;  4CYD A;  5B5E C;  3QU3 A;  1I6H J;  1LVK A;  3PFI A;  2PFB A;  4DQ2 A;  1Z6T A;  2P5L C;  3VYR B;  2GOX B;  4NBQ A;  2HVS A;  3BG6 A;  3WE3 A;  1HF0 A;  3SDG A;  2DQR A;  2YR2 A;  2DN0 A;  2RKH A;  3K0L A;  1TC3 C;  4M73 A;  5DTD A;  3VYT B;  1FIA A;  1UHS A;  2IAI A;  2DPD A;  4ITV A;  3HOZ J;  2R7V A;  3JRG A;  1B1B A;  1D0Z A;  1A6I A;  2CYY A;  3E97 A;  3ZP5 A;  3CZ6 A;  1ZLK A;  2ZXW H;  2WY8 Q;  1BBY A;  4NC7 A;  4IHT A;  4MO7 A;  4A5N A;  3CCV I;  2VT2 A;  4CCN A;  2K9Q A;  4F55 A;  1BN5 A;  3FXK A;  2A6H F;  2UV1 A;  3TO7 A;  2M9H A;  2V4J C;  3DBH B;  3MWM A;  1QZE A;  3GTJ J;  1KU7 A;  4CA0 A;  5K7H A;  3GTK J;  4IRI A;  3HSE A;  3KP5 A;  2Y75 A;  2JQ7 A;  4Y7N J;  2Q2E A;  1VQN I;  1R22 A;  2HNH A;  1SFO J;  4G6Q A;  4ZDP A;  2FF4 A;  2X4H A;  5GAG J;  2M7B A;  1ETQ A;  1BOA A;  2FXA A;  2P5V A;  2O8K A;  1E3O C;  4M71 A;  2IBD A;  4XIC A;  2HOE A;  4MHG A;  4NB5 A;  1W36 C;  5IP7 J;  3DPL C;  3CO6 C;  1MD0 A;  2ZFW A;  3BQY A;  3GLX A;  1T33 A;  2E2I J;  4HV6 A;  2X6O A;  3L09 A;  4RAG A;  1HW2 A;  1FMW A;  1SMT A;  5IP9 J;  2LF7 A;  1ZGA A;  3EDP A;  3LST A;  1K79 A;  2DDB A;  3NWS A;  3A01 A;  1VQ9 I;  1ETW A;  2IGM A;  3PL8 A;  2EFW A;  3ONQ A;  4HAM A;  1K4T A;  2V26 A;  1P7I A;  3LAJ A;  1W5S A;  2DOF A;  1D1C A;  3V8L A;  3BJA A;  5C3E J;  3ULQ B;  4CZC A;  3BOQ A;  5H6Q A;  3WU2 C;  4U87 A;  1R5G A;  3GFI A;  4EJU A;  1H9T A;  3MZ8 A;  4KNY A;  4CCM A;  2PBI A;  3C18 A;  4TV7 A;  2HQA A;  1FZP B;  2IGK A;  5GAE J;  3IKT A;  3F21 A;  2ZJR F;  2D1V A;  3VWB A;  4XID A;  2AO9 A;  3MKW B;  4ZYH A;  1FEX A;  1YRN A;  2M1B A;  2BZT A;  2MLG A;  3K9T A;  2CUJ A;  2O5R A;  3LQQ A;  4E7H A;  3Q0U A;  2LY1 A;  1T0F A;  3F0C A;  3FBN B;  2WWY A;  4L0Z B;  1B8I A;  2COB A;  4KDP A;  4S0H B;  2M0C A;  4HQE A;  1W5T A;  5D4S A;  4XMY A;  4U7D A;  1ZHF A;  3HJE A;  5HOO A;  2WV1 A;  2NNY A;  2HOT A;  4P55 A;  1YX3 A;  2DU9 A;  4A3C J;  1T08 B;  4XKB A;  5D6F A;  1R7J A;  3SZP A;  2HTS A;  4II3 A;  3DKW A;  4CCO A;  2O3F A;  1MDM A;  2NVT J;  4K2E A;  4UB8 C;  5CQE A;  3R4K A;  3V42 A;  5CQG A;  1B59 A;  5DCM A;  2DO7 A;  4NNJ A;  1ZTR A;  2NNN A;  2LBF B;  1JE8 A;  3K10 A;  1WRJ A;  3QPS A;  3CDH A;  1SD5 A;  4A5M A;  1X4P A;  4QWQ A;  3TOA A;  1TL8 A;  2G0E A;  4E7J A;  4IHY A;  1I3Q J;  2PLY A;  4F3Q A;  3IWZ A;  1Z7U A;  2WV0 A;  1IN4 A;  1R9T J;  1CF7 B;  4KMU X;  1OR7 A;  3QOP A;  2NOJ B;  2ICW G;  2R5Z A;  1B6A A;  3PO3 J;  1OCO H;  4AVP A;  2QEX I;  1OIS A;  3D5S C;  3I59 B;  4IVN A;  1MJ9 A;  4NDL A;  3LSG A;  3OV8 A;  3KZY A;  1OKR A;  4XON A;  1RR8 C;  4CUG A;  3C2H A;  4DZP A;  5LHI A;  2ESN A;  2IA1 A;  4J19 A;  3OYF A;  1D1A A;  4LLG F;  4OU0 A;  1D0Y A;  1S7O A;  2P5K A;  2Z5U A;  2L7F P;  2F2E A;  1W36 D;  1U78 A;  3I5U A;  3WTZ A;  3CQZ J;  3ABU A;  5E8I A;  4HDV A;  4BXF A;  1P6R A;  2FUG 2;  4A3M J;  2YU9 J;  1Y6I A;  1QPI A;  2FNA A;  3P7N A;  2HOA A;  2IXS A;  4J00 A;  5ICE A;  2F48 A;  1OLT A;  4OMZ A;  3ZMS A;  2VAS A;  3HRS A;  4XKW A;  2DOE A;  4G94 A;  2EIN H;  4JYK A;  4PK4 A;  1OYI A;  1JKO C;  3I56 I;  2O03 A;  3G4S I;  5HLH A;  4PFP A;  2HQ5 A;  1AKH A;  4R8H A;  5FLX Z;  1FMV A;  1UJ8 A;  3H5R A;  4QPO A;  4XRS A;  3QRF F;  4BUP A;  3HSR A;  2ZME C;  4A0X A;  2Y31 A;  4MEX F;  1G3T A;  4BDZ A;  1FBU A;  2LG4 A;  2LLK A;  5DDG A;  4RB2 C;  2L9N A;  4B09 A;  1FOY A;  1ZLJ A;  4NQW B;  3VSK A;  3N05 A;  1ZQ3 P;  3SJM A;  2ZO4 A;  4M9Z A;  2LY2 A;  1QGP A;  4JX5 A;  4U0Y A;  2Z9O A;  5B3S H;  1U2W A;  3ZGK A;  1QBJ A;  2DT7 B;  1ENH A;  1F43 A;  2DAO A;  2KQR A;  5DEQ A;  3M4O J;  2WAE A;  2A5W A;  3LSI A;  4IEJ A;  2E1N A;  1IDZ A;  3K4L A;  4AID A;  3OYD A;  3DKY A;  4Z6Y A;  3E5X A;  2QKL B;  1QHG A;  2JWT A;  3IV5 A;  4A3E J;  3A0H C;  2V7F A;  3VYS B;  3OYI A;  3ZN0 A;  3CCL I;  3IC7 A;  1ITY A;  1XGM A;  5LEK A;  3GUD A;  1N25 A;  4EV0 A;  3OL4 A;  1LE8 B;  3D5R C;  1C0W A;  3L2W A;  3LSJ A;  2GXG A;  1MMA A;  1XMK A;  5EEG A;  4B1R A;  1FYM A;  3GME A;  2FBI A;  3ESW B;  3CCS I;  3U1K A;  1JJ6 C;  1HDP A;  3CCU I;  2E7X A;  2OPT A;  2X48 A;  5D8L B;  1K7A A;  4ON0 A;  2HFH A;  2VE9 A;  3CCR I;  4A12 A;  1XMA A;  3ZXS A;  3TO9 A;  1RKT A;  2N8G A;  4HNT A;  3HDD A;  2A05 A;  3F8M A;  3ELK A;  4FHT A;  3GYH X;  3S2D J;  2FX0 A;  1HLV A;  4E7I A;  1BL0 A;  1MMN A;  2L5Q A;  1Z05 A;  2QWW A;  1FBQ A;  2QLZ A;  2FD5 A;  2FE3 A;  3J7Z I;  2JA6 J;  3FMS A;  1FOK A;  4UB6 C;  5LRR A;  2QQB A;  1RUO A;  1FOW A;  2EA2 A;  4U0V A;  4EMS A;  2DTR A;  3UR3 C;  1FSH A;  1FBS A;  4WWC A;  5DCF A;  4L5J A;  4RGX A;  2WAQ N;  5F04 A;  4BEH B;  2PJR A;  2XKP A;  1SD7 A;  2LD5 A;  5D5U B;  4XN0 A;  1IGN A;  1R23 A;  4CIC A;  3M1E A;  3J7A O;  1D5V A;  3GFM A;  2ZFU A;  1XN7 A;  1MKM A;  4L9N A;  4XKV A;  5JVT A;  2XDV A;  2HZT A;  3CUO A;  3GW2 A;  4Q5S F;  3FIW A;  3BTJ A;  4UUS B;  4F92 B;  2B63 J;  1P9Q C;  2QEN A;  1T39 A;  5CLS A;  3S2W A;  3KYL A;  2F5C A;  3QP6 A;  2QGU A;  3G1O A;  4XKC A;  2R7R A;  2HOS A;  1ORK A;  3K1P A;  3F8F A;  4MFD A;  3HBL A;  1EV7 A;  1NG6 A;  2Y30 A;  3BR5 A;  2F4O B;  1N78 A;  3MEX A;  1IF1 A;  1FJL A;  1PP8 F;  4ZYG A;  3H5A A;  2DCE A;  3LSP A;  2PMZ N;  2L7M P;  2VN2 A;  4A6E A;  3A4C A;  3ZQQ A;  1R36 A;  2PN6 A;  4FE7 A;  3RZD J;  1UFM A;  2K9L A;  5FKN A;  4W97 A;  4L5E A;  3HC7 A;  3SQN A;  3ZQI A;  5DD4 A;  1ACI A;  2OUM A;  2R4G A;  3BTL A;  2QM3 A;  1CQT A;  3HUG B;  4KIS A;  2QUF A;  4N4O B;  3W6J B;  3U21 A;  1TLH B;  1LUJ B;  1J0R A;  2M0M A;  5EDN A;  2FU4 A;  2VT3 A;  3J81 Z;  5DM7 F;  1WJE A;  2X0L A;  3DWL E;  3K69 A;  1V5G A;  3OS1 A;  2VE8 A;  1K83 J;  4C9Y A;  1M1E B;  2CGP A;  1XC5 A;  1NHA A;  2G7U A;  1G3Y A;  4G12 A;  2AXL A;  3BQZ A;  2F5V A;  2K02 A;  2PX9 A;  1OR7 C;  1YW9 A;  1Y8Q B;  3ZMV A;  1VQL I;  1WQ2 A;  3KZZ A;  5E8G A;  3DEU A;  2FNP A;  2GM4 A;  5IT9 K;  1BR1 A;  1KZH A;  3L7W A;  3WHC A;  2GA2 A;  1Z7L A;  3Q9V A;  2VON A;  3OYN A;  1BIB A;  2Y69 H;  2H6C A;  4XBF A;  4X0G A;  2GLO A;  2Z99 A;  3IP4 B;  5ILU A;  1XPX A;  3RKQ A;  1T95 A;  1BJA A;  1U5T A;  1XDU A;  1ZKG A;  1P2F A;  5A2Q Z;  1S5L C;  3HXL A;  3JR9 A;  1BA5 A;  2IPQ X;  3TMO A;  3HL2 A;  1X58 A;  4C30 A;  1ETV A;  1Y0N A;  4QPQ A;  1JUP A;  3DKX A;  3M8F A;  3RTR A;  1B72 A;  1U9O A;  1VTN C;  3K70 C;  3LFK A;  4HPQ A;  2RAE A;  2TCT A;  4E70 A;  4FT8 A;  4M74 A;  2QZ8 A;  2VJ5 A;  3IH4 A;  4GRI A;  4KIT B;  5JHU A;  1A35 A;  3S1Q J;  3REO A;  2Y0S N;  1TTY A;  2HYF A;  3FBI B;  4Y17 A;  4A3I J;  3K1N A;  3GTP J;  3RZO J;  1B9N A;  4D1Q A;  2IEK A;  3HKZ A;  1TT5 B;  5ICC A;  4BJ6 C;  4LIV A;  1WCM J;  3E6B A;  3VEP A;  4YFK F;  1BI1 A;  1IXC A;  5HDN A;  2O6G E;  2GXA A;  3PIP F;  1SFX A;  5HLT A;  3GFL A;  1MNE A;  4I09 A;  5DS9 A;  2ID3 A;  4BQO A;  2ZXI A;  4RBO A;  2DA4 A;  2CW0 F;  3BPX A;  4Y4R A;  5F0F A;  1XMX A;  1H8A C;  1JT6 A;  5EZG A;  1EH7 A;  2P6T A;  2F6C A;  4II2 A;  3ROU A;  4FQG A;  4B47 A;  1F4K A;  4D7N A;  2VOO A;  3V8J A;  4PJ0 C;  3OS0 A;  1YYV A;  4BQQ A;  1TWC J;  4S05 A;  2K5C A;  4PCQ A;  4LGW A;  1KQ0 A;  4YFX F;  2KRF A;  1U3E M;  3DTK A;  4HQM A;  2HGC A;  2VXD A;  3K4M A;  5K1Y A;  5BMZ A;  1OCT C;  3J7A Y;  3PSF A;  3TOB A;  4C2T A;  2COM A;  1MBK A;  1OFC X;  2UUZ A;  2Z33 A;  2MYS A;  1XGO A;  2XAG A;  2P0W A;  3GZN B;  3B6A A;  3HZJ A;  3TED A;  4B8X A;  2JTV A;  3CJN A;  3FKI J;  3CES A;  2Q8K A;  5IY5 H;  2IS4 A;  2XRL A;  1SMY F;  1JUS A;  1TQI A;  4UVA A;  3J80 Z;  5FFX A;  3RPU D;  4A0Y A;  1DGR M;  2R7Z J;  4UUT A;  3JCU C;  1JUM A;  1UG0 A;  3BCA A;  5CVV A;  3QU6 A;  1A5J A;  2VUM J;  1X1A A;  1WJF A;  5EF6 A;  1F36 A;  5F0H A;  1B4A A;  3ERM A;  1AA7 A;  2JSC A;  1A04 A;  4EAT A;  2W25 A;  3LMM A;  3F8B A;  1YI2 I;  1FOX A;  2X6W A;  3RQI A;  1RIO H;  1AWC A;  1EJ9 A;  3VFZ A;  3BR0 A;  3DU6 A;  2VKD A;  4F52 A;  2ZSI B;  3S1N J;  4BXU A;  2MBF A;  1D8J A;  3K70 D;  1LVA A;  3Q3S A;  1QO0 D;  2M87 A;  3RKX A;  4GGG A;  2ZXJ A;  3CF5 F;  4G7H F;  1S72 I;  2VJ4 A;  3IH2 A;  3W6V A;  2W4S A;  3HHG A;  5D6E A;  4A3B J;  4Q4Z F;  2RNG A;  2W00 A;  1MMD A;  2R7S A;  1X1B A;  3ZMT A;  4B3X A;  2LK2 A;  2QF7 A;  4LIT A;  1MBG A;  4XL9 A;  1WKM A;  2A6E F;  3FM3 A;  4XSZ F;  2DFE A;  3ABL H;  3PUF A;  4MGR A;  2V1U A;  2LSO A;  1DU0 A;  1FX7 A;  3BR2 A;  2HVQ A;  3Q0V A;  4AUX A;  5IYD J;  3ML6 A;  2MFZ A;  1SVO A;  3M7G A;  1OYY A;  3LSR A;  4HEA 2;  4EVI A;  1VF9 A;  3EUA A;  3GZ5 A;  3CTA A;  3VPR A;  5M5Y J;  4AVZ A;  5HS9 A;  3PNT A;  1HSJ A;  3ZQ7 A;  4YFN F;  3DLL F;  1POG A;  4Y52 J;  2CRG A;  1MBJ A;  1V5E A;  1OCZ H;  1YIT I;  1E17 A;  2BHY A;  2VQC A;  1HW1 A;  4JQF A;  4UV8 A;  4AIK A;  3KP6 A;  2STT A;  3RCO A;  4BBS J;  5CJ9 A;  2CH0 A;  6PAX A;  1O7F A;  2LH9 A;  2ISY A;  3N4M A;  2EFP A;  3H1C A;  3CJT B;  2EIK H;  2ELJ A;  4YIF A;  3QQA A;  3ERE D;  3MZY A;  3AG4 H;  2XF7 A;  2YX4 A;  4OAZ A;  5JLW A;  1KGS A;  3PM1 A;  5IYC J;  4FX4 A;  4E7L A;  4RLF A;  3BTC A;  3CDL A;  2XGX A;  2HXO A;  4E7S A;  4G9Y A;  1BI2 A;  4I99 C;  5CKT A;  1MZB A;  4R1H A;  3LNQ A;  3DBR B;  3DBL B;  4PDK A;  2CQN A;  3TW6 A;  1U8B A;  1T98 A;  2EIL H;  1U9N A;  3S3M A;  2QA4 I;  2BVL A;  2BOL A;  5L3D A;  3QOD A;  1JGS A;  3MMY B;  3IWF A;  1AU7 A;  4L0Y B;  5E79 C;  4BY1 J;  5GP9 A;  3K4K A;  4FTH A;  2KPM A;  4MQV A;  4OIR F;  2W57 A;  3JSO A;  2AXT C;  4R79 A;  3TDZ C;  2JPC A;  1YTY A;  2OZU A;  1D1B A;  1XCB A;  4ZTJ A;  4G7O F;  2AQF A;  4GFB A;  3RKW A;  1ZG5 A;  5H6R A;  4KYW A;  1GV2 A;  2X1E A;  4DOZ A;  5EEH A;  2R7T A;  2VKV A;  4HW0 A;  4YEJ A;  1U5T C;  4RM3 A;  4WF2 A;  2OTJ I;  2M2E A;  2FQ3 A;  1E0E A;  3UKG A;  1A31 A;  1QU3 A;  2M7A A;  2EPF A;  2KDZ A;  1IRZ A;  3AL0 C;  2DA5 A;  1JGG A;  2PMH A;  3OYA A;  5TIS C;  2RQP A;  2NVU B;  3BR3 A;  2NVX J;  4IHV A;  2WAF A;  2E1O A;  4LK0 F;  3RKY A;  3I4N J;  1RC9 A;  2EBI A;  1LEB A;  3L2Q A;  3HOW J;  2NS0 A;  1W1W E;  3DFG A;  3CMY A;  1SAU A;  3R0J A;  3HPG A;  2L54 A;  5C4X J;  1J59 A;  4HYE A;  4CDG A;  1IXR C;  5FB2 A;  1Z3X A;  1LKX A;  4AU7 A;  4XOP A;  2E2J J;  3B6C A;  4AIH A;  1I6X A;  2X6Y A;  1WI9 A;  5EG0 B;  2OF7 A;  5E3M A;  2H09 A;  2IP2 A;  2NOG A;  5LRS A;  2M3A A;  3OYJ A;  1AOY A;  2K9N A;  5L3E A;  2IW5 A;  1UZC A;  2YSR A;  3V8K A;  1IJW C;  4Y13 A;  2P7V B;  4V19 K;  2ZME B;  4Q47 A;  3GTO J;  3ABK H;  1I50 J;  2XV4 S;  2O0Y A;  3IRR A;  1YE9 A;  4M3D A;  3G71 I;  3S2H J;  4NUB A;  1K78 B;  1WFX A;  3FWE A;  3HRT A;  1REP C;  5FKL A;  3GLL A;  1IZ1 A;  2FBK A;  3DCF A;  1Z6R A;  5CPR B;  3E6D A;  3BG7 A;  1I5Z A;  2QQ9 A;  3HSF A;  2DOD A;  4LG0 B;  3MN2 A;  3PNY A;  2WBM A;  4BS9 A;  3FX3 A;  2I10 A;  2HKX A;  1TQM A;  1ZGW A;  1JTX A;  2LBF A;  1O4X A;  3BR6 A;  3CMM A;  1VND A;  2P81 A;  2H8R A;  4F7Z A;  4ABZ A;  4I02 A;  2YU3 A;  4M3E A;  1K6Y A;  2CW8 A;  2FRH A;  4BJ5 C;  3A1Y A;  1Z3Y A;  1ETY A;  2X9D A;  2XF5 A;  4RM2 A;  1CF7 A;  4QSH A;  3R60 A;  2DYR H;  2JA7 J;  3IKV A;  3JTG A;  3BCB A;  3MQ0 A;  3A0B C;  3AG1 H;  2A69 F;  1WH7 A;  2EFN A;  2HYG D;  4DGW B;  5E1W A;  3MKY B;  2LR8 A;  5K7F A;  4MIM A;  2VOD A;  3MCZ A;  1SVL A;  1IN5 A;  2NS7 A;  2NXN B;  4D9J A;  1XG1 A;  2CQ7 A;  5DUK A;  3J80 K;  2VQG A;  5HNF A;  1OCP A;  3HPH A;  2CSO A;  1TW3 A;  1R6R A;  1UG2 A;  5C4J J;  3AG2 H;  3TGN A;  1D5Y A;  4UHT A;  1DP7 P;  2GXB A;  2L4A A;  2R7W A;  4WXD A;  5IOY A;  4HX8 A;  1QA6 A;  4U7B A;  2D45 A;  2UXN A;  1HBX G;  1J75 A;  2KIQ A;  4LLL A;  2R7X A;  1W7P A;  2H27 A;  5LBQ A;  1GHC A;  1IRX A;  2DA1 A;  3GVA A;  1FYK A;  2KMU A;  3EYI A;  4B48 A;  1EKE A;  1MJA A;  3H9Q A;  1R00 A;  2V1D A;  2W82 A;  1RUN A;  3ZQL A;  2WB1 A;  3A01 B;  3EGV B;  2GIZ A;  3F23 A;  3ZOB A;  1YW7 A;  2KJB A;  3ZPL A;  2IS6 A;  3TL4 X;  1DGW Y;  1X3W B;  2HQR A;  4HZF A;  1R5I D;  3WTY C;  4RAZ A;  2EWN A;  3FDY A;  1QPM A;  3H9G A;  2R7F A;  4IL6 C;  3KP4 A;  4I98 B;  3SFI A;  2HEO A;  2EH3 A;  2D5V A;  5BOX A;  2R7D A;  3K2Z A;  2DA6 A;  4RAF A;  4BE1 A;  3GCM A;  4KJZ A;  1YG2 A;  4L5I A;  2OD5 A;  3NAU A;  4ETS A;  4E6K G;  3FK6 A;  1NH3 A;  3HGG A;  2HU9 A;  4YRV A;  3R0A A;  3HGY A;  2RC4 A;  2KDO A;  1RET A;  5KAF C;  1B8I B;  3Q9S A;  4I7H A;  2WY7 Q;  1NK2 P;  5FKO A;  3HOV J;  2JRM A;  3RDI A;  2FBH A;  1WIB A;  3H35 A;  4D0P A;  2LY9 A;  1IV8 A;  1TWF J;  2M30 A;  5GTI C;  2ECC A;  1ERD A;  1ULY A;  3MVP A;  2MH9 A;  5EGO B;  2Z3Y A;  3BJO A;  1LE8 A;  2DFH A;  4BHB A;  1MDM B;  5IT3 A;  2ZJ2 A;  3CP8 A;  2OQR A;  3K4C A;  4U88 A;  1ZK8 A;  2AQE A;  2E60 A;  4E4H A;  3OMY A;  1PDN C;  1X1D A;  4GDF A;  1KA8 A;  3GEZ A;  5GTH C;  3BC8 A;  3B73 A;  2M45 A;  4U0W A;  5E17 F;  2KLO A;  3EPZ A;  1RI7 A;  1KYW A;  1SD6 A;  3GZ6 A;  3BWG A;  2JN6 A;  2VL8 A;  5K7Z A;  3L2C A;  2L9V A;  5ILS A;  3ISP A;  3ZMD A;  5B66 C;  3L9F A;  5D5X B;  3FXU A;  4I6Z A;  2ZCW A;  2F4I A;  3WTT C;  1OQY A;  1GUU A;  2E7W A;  4KIF A;  1OCC H;  4HOB A;  1G2H A;  2DBB A;  2L9R A;  1QHH D;  4CZZ A;  3G6E I;  3DEE A;  1S7A A;  2XC7 A;  1WJ5 A;  3HOT A;  5IOZ A;  1KU9 A;  1J2X A;  3FMQ A;  4AYB N;  2E5Z A;  1R1U A;  4DYC A;  2ZNY A;  2MC4 A;  5D5V B;  3LWF A;  1L3L A;  1RES A;  2Y0S A;  2QBY B;  3OYG A;  2LRD A;  1WGX A;  2YX7 A;  3HIF A;  1LDJ A;  1FY7 A;  3COA C;  3KYD B;  1PP7 U;  1H0M A;  4EGY A;  2BE5 F;  4HBL A;  2P6S A;  3T8R A;  4DBQ A;  3IAS 2;  2QKM B;  1FNN A;  4UUS A;  2KRH A;  3CCM I;  1V5F A;  3JRF A;  4V2F A;  1MND A;  4XLF A;  3HOU J;  2G7H A;  1O57 A;  3RIR A;  2VBW A;  1X2N A;  2UXX A;  2O9L A;  2RNJ A;  3T5X A;  1S3J A;  1FIP A;  2E1M B;  2MD5 A;  3H5N A;  2CV1 A;  1WJC A;  1Z1D A;  3U2R A;  1WI3 A;  4PGG A;  2IS1 A;  1W0U A;  5FKK A;  4MFE A;  1GVJ A;  3H3V K;  2OCE A;  1NG7 A;  2XVC A;  4V2G A;  5HLI A;  1XSX A;  1TT0 A;  5J1R A;  5J4Y A;  4OIQ F;  1K6O A;  3K6G A;  2E5N A;  2NRA C;  2OA4 A;  2A61 A;  1TNT A;  1VQO I;  4LFU A;  4BQN A;  2MC3 A;  2G9W A;  3GTL J;  1HC8 A;  2DDA A;  3BZC A;  2ZC2 A;  3IRQ A;  1GV5 A;  1O7L A;  1XB4 A;  2ID6 A;  1BR4 A;  1P92 A;  3HUG A;  2Q1Z B;  5LFA A;  4M6V A;  3OYH A;  2DFF A;  4O6J A;  2ZNZ A;  1T2K A;  4ASN A;  1FWZ A;  2E36 A;  1ZEL A;  1JHH A;  4DW6 A;  2OTL I;  5J4V A;  2H1L A;  4X6A J;  1IUF A;  1S9H A;  4XLA A;  3OR1 C;  2BY3 A;  3WTU C;  1T38 A;  3JAM Z;  1YIJ I;  5J1Y A;  1JKQ C;  1A6Q A;  4G7Z F;  1UEL B;  3IL2 A;  4M3F A;  1SVM A;  4H0E A;  2VKH A;  1EH8 A;  5ICG A;  1S6L A;  2IVM A;  2NVY J;  1T0F C;  1Z91 A;  5AIP A;  3CP2 A;  4PUS A;  3O8G A;  5FRM A;  2VPL A;  4CYC A;  4UXN A;  4FAS D;  2LKS A;  3BY6 A;  3VYU B;  2DMU A;  4BBR J;  1QQI A;  4BAY A;  4ZZD A;  5L3F A;  2JJ7 A;  1X3U A;  2VBZ A;  2X51 A;  2F4M B;  2H8W A;  1Y1W J;  4EGZ A;  1SEU A;  3TKY A;  3GF2 A;  4WXH A;  1DQU A;  2ESH A;  5FGM A;  1VQP I;  2K40 A;  1WHU A;  5CVU A;  2IRF G;  4KA4 A;  2O61 A;  4BH9 A;  3KLO A;  1HOM A;  2DW4 A;  3T1B A;  3BPV A;  1ZYR F;  5DD8 A;  4AIJ A;  2PQ8 A;  2PJR B;  4A2U A;  3PJR A;  2CS3 A;  2OU2 A;  1W4M A;  2A5Y B;  3KLN A;  4ZTF A;  2JPB A;  5AON A;  2XHK A;  2CJJ A;  2HDD A;  1OYW A;  4IXA A;  3TW7 A;  2ADU A;  2DPU A;  4HST A;  2DYS H;  4PSW A;  4CCK A;  1BR2 A;  1FTZ A;  3CUQ B;  1BOB A;  5ILV A;  2O7O A;  1YOV B;  1AHD P;  1MIJ A;  3S8P A;  3J7Y J;  2A3S A;  3P9C A;  5E20 A;  2EIM H;  3GTM J;  2XGD A;  2BHZ A;  3FF5 A;  3I9V 2;  4C2M J;  3SDB A;  5KK1 A;  4IZZ A;  1MMS A;  4IHS A;  3E0J B;  4W1U A;  2Z1D A;  1TW2 A;  4CCL A;  4D5F A;  5FD6 A;  2L7K A;  1JT0 A;  3LL7 A;  5F1R A;  3CJS B;  1IUY A;  2QSF X;  3DPU A;  1D0X A;  3SEZ A;  1G3S A;  2HDC A;  5FLV A;  2HXI A;  4DNC A;  3TQN A;  1I27 A;  4PJN A;  1O3R A;  9ANT A;  4WXC A;  3NQO A;  1P4X A;  5HVQ C;  2L0K A;  4M3B A;  3OY9 A;  3ZR8 X;  2KHM A;  3ZQC A;  4O3M A;  1DU6 A;  4XNF A;  5L3C A;  5KAI C;  2J5P A;  4ENJ A;  2DJN A;  4JOM A;  4E7Z A;  4EJO A;  4CHU A;  2CU7 A;  4C3J J;  2XPU A;  2OCC H;  3S32 A;  2EV6 A;  2CUZ A;  4L18 B;  3R61 A;  1H89 C;  4OAY A;  5FLX K;  2KIF A;  2W1O A;  2VBX A;  4UY8 I;  3LFU A;  3QYE A;  4JX4 A;  1UAA A;  3GX4 X;  3W6K B;  5BPD A;  2EZL A;  2PJP A;  4RB3 C;  3GTG J;  4A0Z A;  3M1C A;  3KEQ A;  2XF6 A;  1DPR A;  3DTI A;  2V6E A;  1Y1V J;  1ON2 A;  5DV5 A;  4M9S A;  3QWL A;  1ETK A;  3HB9 A;  4ESF A;  4IX7 A;  5K5R A;  1SC7 A;  1BW5 A;  3JRA A;  4KUM A;  4RB0 A;  1YW8 A;  2DMP A;  2VQL A;  1STZ A;  3TDU C;  1I3A A;  1LDD A;  2VQH A;  4O5V A;  1XCV A;  3M3Y J;  1FP1 D;  2EA4 A;  4AC0 A;  2R7Q A;  5DYM A;  4A3G J;  5FD5 A;  3IUO A;  2RDP A;  2W84 A;  1W7P D;  5HOD A;  3QPL A;  1XTA A;  1IN6 A;  5DUI A;  4ZZL A;  3C2B A;  3BG3 A;  5H20 A;  1JJ8 C;  1B72 B;  3FKJ A;  3AL0 B;  2CW7 A;  2L9S A;  1SD4 A;  5BS6 A;  2K85 A;  2LC2 A;  2EQR A;  3G3Z A;  3LA7 A;  4MLO A;  3WU0 A;  3SZT A;  2CFX A;  4XRF A;  1JHF A;  1V54 H;  3QPH A;  3BDD A;  3FXO A;  4BU2 A;  5TRD A;  2BYV E;  3B02 A;  3F6O A;  3HOY J;  2FOW A;  1E3H A;  2RVC A;  1R1T A;  3G1L A;  3P9K A;  2R5Y B;  4MQ9 F;  3L2V A;  4LG3 A;  4BJT A;  3KZI C;  2LKP A;  2V9P A;  3D5L A;  3NRV A;  2L4M A;  4P1W A;  3JRI A;  2RN7 A;  4DBR A;  1VZ0 A;  2M34 A;  2GBY A;  2B7E A;  3W2V A;  2M5W A;  1LNW A;  1KON A;  4IQJ A;  4IRH A;  3I54 A;  3MD2 A;  1FT9 A;  3V7S A;  1I1G A;  1KU3 A;  2HYJ A;  3H9J A;  1HST A;  4FE4 A;  2VOP A;  2KT0 A;  2Y9Z A;  3C3W A;  2JZY A;  3DF8 A;  2FA5 A; 
#chains in the Genus database with same CATH homology
 1Y39 A;  3G71 I;  1VQO I;  3DLL F;  1FOY A;  1HC8 A;  5GAE J;  2ZJR F;  3I55 I;  1YIT I;  4IO9 F;  1WIB A;  1VQ8 I;  3CJQ B;  3CME I;  5GAH J;  3CCE I;  1VQ5 I;  3PIO F;  2E36 A;  2OTL I;  3CJT B;  1ACI A;  1YIJ I;  4UY8 I;  3CCL I;  2ZJQ F;  5DM7 F;  2QA4 I;  3CC7 I;  1YHQ I;  3CCS I;  5DM6 F;  5JVG F;  2E35 A;  3CCU I;  3CMA I;  2NXN B;  2H8W A;  3CCR I;  3CCV I;  1VQL I;  2E34 A;  3G6E I;  3CD6 I;  1VQP I;  3CC2 I;  2QEX I;  2OTJ I;  1YI2 I;  1FOX A;  4IOA F;  1QA6 A;  3J7Z I;  2JQ7 A;  2K3F A;  1VQN I;  5GAD J;  3CCQ I;  1FOW A;  1VQ7 I;  1VQ6 I;  5GAG J;  3CF5 F;  1S72 I;  2FOW A;  3EGV B;  3CCM I;  2ZJP F;  1VQ4 I;  1VQM I;  3J7Y J;  1VQK I;  3CC4 I;  3I56 I;  3CJR B;  3G4S I;  1VQ9 I;  4IOC F;  1YJN I;  1MMS A;  3CCJ I;  1YJW I;  4V19 K;  3CJS B;  3PIP F;  1YJ9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...