2ZJPF

Thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
144
Chain Sequence
MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjpF02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2zjpF01
1VQPI 3EGVB 5GAGJ 5JVGF 2ZJPF 3J7ZI 2E34A 3CCUI 5GAEJ 1VQ4I 3CD6I 2FOWA 3CJTB 2JQ7A 3CCQI 1VQ7I 1FOYA 3G4SI 1VQLI 4IOAF 1YITI 3PIOF 1YJ9I 1FOWA 1VQKI 3CC7I 4UY8I 2OTLI 3CJSB 2K3FA 3DLLF 2ZJQF 3CCVI 2ZJRF 3CJRB 3CMEI 3PIPF 1YI2I 5DM6F 1YJNI 5DM7F 1VQ8I 1ACIA 3G6EI 2QA4I 2H8WA 3CCRI 3CC2I 1YIJI 1VQNI 2NXNB 2QEXI 3CCLI 3CJQB 3CMAI 1S72I 1MMSA 5GADJ 1QA6A 3G71I 1FOXA 3I56I 4IO9F 1VQOI 2OTJI 4IOCF 3CCSI 3CC4I 3CCEI 3J7YJ 1VQMI 3CCJI 1YHQI 1WIBA 2E36A 1HC8A 4V19K 3I55I 1VQ6I 5GAHJ 1Y39A 1VQ5I 3CCMI 1YJWI 3CF5F 1VQ9I 2E35A
chains in the Genus database with same CATH superfamily
2FU4A 2XF5A 3I4NJ 4OAZA 4LG0B 4A3KJ 2D2WA 3K1NA 3BQZA 5LGTA 1IW7F 1VI0A 1UB9A 4ZC3A 2A6TA 3TBIA 2DQLA 3OYLA 4A3LJ 1WH7A 1LFBA 1KU3A 1LE8A 3RKXA 2W24A 4EV0A 3H3VK 4KUMA 3H0DA 2V4JC 4HF1A 3EUHA 2R5ZA 2OCCH 3M8JA 5ERIA 3I5UA 3I58A 4A0XA 3QPLA 5IOZA 1IAWA 3LSRA 3BG7A 2WAQA 3IP4B 4XKVA 3J81K 2XROA 1JKQC 5K7FA 3G3ZA 1TLHB 4OIPF 1ETOA 2FOWA 2HU9A 4PDKA 4XIDA 2R7WA 1QQIA 3PO2J 4Q47A 2PMHA 1Z21A 2G9WA 2XAGA 4XL9A 3UNGC 2IGMA 3G4SI 2P5LC 1ON1A 4IVNA 1VQKI 3E0JB 1DP3A 3CLOA 1NK3P 4GO1A 1HDDC 2X6OA 4A3EJ 2Z3YA 2GM4A 1HLVA 1K7AA 1X1DA 5K1YA 3D5LA 2FE3A 4GYIA 3W6KB 3RJPA 1ODDA 1IRZA 2BW3A 2D5VA 1F1ZA 5DM6F 5DEQA 2QQ8A 3U21A 1IC8A 1ETKA 4EEFG 9ANTA 4C30A 1X1BA 4WX9A 2VXZA 5DD8A 5M5YJ 1UZCA 2Y0MA 3CCRI 1PDNC 1TT5B 3GX4X 3V7CA 2EK5A 1I1GA 2CUJA 1H89C 2YSRA 2WBMA 4R1HA 2M0MA 3BPXA 3FM3A 4XORA 1T0FA 3RPQA 3ZQQA 3RCOA 3DV8A 2XSJC 3JRIA 5H20A 4KN4X 3WGGA 1LEBA 3EYYA 2R0QC 2K9NA 2ZMEB 1SD7A 2BVLA 3KLOA 3PNYA 5K5OA 1Q1VA 3A0HC 5CVRA 3V8JA 3R61A 3J7YJ 1CQTA 2VQCA 3GW2A 4HF2A 4M6YA 1HKSA 2DN0A 2EV0A 3K70D 2CW7A 3QQAA 1W1WE 4Y7NJ 4D7NA 1N77A 4LB6B 3F6VA 3WHBA 1QZZA 3FDYA 4IRIA 3SFZA 4IHXA 3CDLA 1R5HA 2LKXA 1RRJA 1HF0A 1XSXA 1XGSA 3M9AA 2DXIA 1T6SA 3E5UA 4IXAA 4JYKA 1ZGAA 2L3DA 4JBAA 2F5DA 2M7AA 4HX4A 4XNFA 3F21A 1DP7P 2KL4A 2HYGD 3ECHA 3NRVA 3GTQJ 3C2BA 1OKRA 3A1YA 3JW4A 3OYJA 4XRSG 3DTKA 2A05A 2Z16A 4JX5A 2R92J 3A01A 1J75A 2GOMA 3OL3A 3W2AA 1UFMA 3CDIA 2P0WA 4KITB 1TQMA 5KVRA 5D8LB 2LFBA 2E1NA 3KP2A 2R7RA 2W82A 3IRRA 1EF4A 2STWA 2MH2A 1MH3A 1FBSA 4M74A 5FO5A 4ZYEA 5H6QA 1IUYA 1I39A 2AS5F 1HDPA 4RM2A 4XLFA 3NWSA 3ISPA 1MZBA 5LEJA 3AL0B 2H6CA 5FKMA 4FHTA 1OYWA 3VSKA 2CV0A 3DEEA 1WJCA 2EBIA 4AIJA 1JTXA 1KYWA 4UXNA 3NAUA 1FOWA 2IP2A 1O57A 5E3NA 2MD5A 3TEDA 3GZNB 1S9HA 1ZN2A 5LD2C 5HLGA 1FX7A 4P9FA 2LY9A 2YUSA 5DD4A 4BXUA 1YE9A 3HRSA 3FXOA 3HKZN 4EJTA 2P6TA 2MW8A 3QPTA 1G6NA 1SMTA 4BGDA 2HYJA 3BROA 3T0YA 2HZTA 4BJTA 2CUZA 2M4KA 3OYHA 1GVDA 2P7VB 2UV1A 5ILVA 3SZGA 3GTOJ 2BY1A 4IRGA 4CYDA 3FHZA 5AIPA 2HKOA 4A3BJ 1ZK8A 4RAZA 1FJLA 3HUGB 4HLXA 3B02A 2KIFA 1MMSA 1UG0A 3GTKJ 4A69C 1E17A 2LOOA 2L5QA 3L2RA 3IUOA 2CRGA 1B9NA 3LSGA 1MW7A 2BXZA 3R0AA 1MJ9A 5BOXA 3FX3A 2ZJ2A 2YS9A 5K7HA 3V7SA 1QO0D 3FM5A 1SVLA 2AXLA 4HSTA 1YHQI 3IL2A 1B4AA 1HC8A 1U9NA 1IV6A 1H88C 1E3OC 2OAZA 2DMPA 2IAIA 2KZVA 2X6YA 2Y30A 2LSOA 2O8XA 3U1DA 1D3YA 2KJBA 1K78A 1SFXA 2EPFA 1J09A 3QPHA 5FGMA 3H1CA 3IH3A 3ZN1A 5BMZA 2K27A 2KFDA 1MGTA 3JRCA 1O4XA 3TDZC 1H0MA 1XTAA 4NC8A 2GZWA 2VQLA 4I76A 3KFWX 2D1VA 2M34A 3FXLA 4EJWA 1L0OC 4OAYA 2Q8KA 2A69F 4XLHA 3I71A 4ON0A 4G7HF 3S3OA 2UUZA 4BE2A 3M1CA 4G12A 3VYSB 2HS5A 2FEZA 2HQRA 3K70C 1R22A 1BN5A 5L3BA 2R3SA 4KFCA 1ZARA 4B3AA 2XB0X 3HHHA 2DPDA 3K1MA 3FKIJ 1FIPA 1D0ZA 4XLCA 2O7OA 4AIKA 3EDPA 2RAEA 2L7ZA 4A2UA 4A3FJ 4A6DA 1RKWA 2JZYA 5HDNA 1W7PD 2CV2A 3BG6A 2GA2A 2HFHA 2DT7B 3DPTA 4CCLA 2HOSA 3CCQI 2EFNA 5JR3A 3GEZA 1XN7A 2XC7A 1WHUA 3LSPA 1XMXA 2IJLA 1U5TA 2ELKA 5E18F 2D45A 1Z7UA 1JHFA 1VZ0A 4BHPA 3WU0A 1V5EA 1IZ1A 2M0CA 2Y69H 3HL2A 1PP7U 1FP1D 2ZJQF 1G3SA 1S6LA 2JPCA 2X0LA 1FP2A 1WFXA 5E20A 2F5CA 2M8EA 2VQGA 1SAXA 1JUPA 1IRXA 2XV4S 1IG7A 2HOEA 4GYGA 3H3ZA 5DTDA 2DA1A 1LEAA 1W5CC 1R36A 1WJAA 3IH4A 2H8RA 4YRVA 5F6FA 5LLQA 2OBPA 4MFDA 4E7KA 4XBFA 2QQAA 1XX5A 2F6CA 2OZ6A 3K4NA 3CO7C 4EGZA 1LFPA 3JRFA 1R1VA 2A3SA 3BR5A 4KICA 4LLLA 4MQ9F 4RAGA 2PMZN 2M45A 3BLYA 2ZNZA 1ETQA 2G7UA 5KAFC 1HCRA 3OOUA 2R93J 1KU2A 4YFNF 4EJOA 3T8TA 4D7MA 4NBQA 3CCEI 1K4TA 1BC7C 2P4WA 3SFIA 4HW0A 1O7FA 3SZPA 3KPHA 2K40A 1EV7A 5ILSA 1AKHB 2ME0A 5J8CA 2DI3A 3I55I 3QOPA 1BOBA 2W84A 1OMIA 1W0UA 5BQTA 3CUOA 3D0SA 4QSHA 1VQ5I 5KNLA 2JN6A 3TO7A 1FSHA 2M2EA 5K7ZA 2L7MP 1YW9A 3L09A 2EJRA 3S3NA 4UNOA 1S3JA 1CF7B 3CP8A 2V1NA 3D5SC 2F5EA 3H5RA 5E3LA 4ASNA 3CO6C 3ULQB 3GUDA 2H1KA 4P96A 1NG7A 2L4MA 4L9JA 4HRIA 5B66C 1P4WA 3T5XA 4RLFA 3JCUC 2M7BA 4XRSA 1YFHA 3H9QA 3CCUI 1TZLA 3RTRA 3DQVC 3H9GA 5FKLA 1IDZA 2VXDA 2KDOA 1XGNA 3JTHA 2VT2A 2L7KA 3RYPA 1SVMA 3F3XA 1BW6A 3LSKA 4UUSB 3TOAA 2Y9ZA 4DYQA 1EJ9A 5M5WJ 3I54A 3HG9A 4IJAA 1PUFA 3P9KA 1YX3A 3MKYB 4IOAF 1YJ9I 3MQ0A 3IRQA 2EH3A 4BE0A 1UAAA 2JSCA 2K3FA 2WADA 3J7AO 2XRLA 2GIZA 2ZJRF 4F3QA 1APLC 1MD0A 2A61A 2BGCA 1J2XA 1ZGJA 1F9NA 2EB7A 3CJNA 4CDGA 1O3QA 3V7RA 2ACJA 2EIMH 3LSMA 2W1OA 2VJIA 1B59A 1S5LC 3LSHA 3EQLF 4PFPA 1EH7A 2EINH 2VBZA 5D8KB 2K02A 3O8HA 2FQ4A 4OOIA 2P8TA 4G7OF 3FK7A 2CQNA 1FOKA 2DK8A 2Y31A 1TP4A 4XN3A 1S72I 1SFEA 5JLXA 1MBJA 1KA8A 1BM9A 2H09A 1R9TJ 3I56I 1XCVA 1U3EM 4FQGA 5FB2A 4IOCF 2M3AA 5ICFA 2DA5A 1P7JA 2IRFG 3QP5A 4WXHA 1QBJA 1R00A 5M3MJ 4M72A 5IP6A 2RN7A 2XAUA 3MZ8A 2XGEA 1T08B 2KLOA 3LA2A 2OZUA 4E7SA 3ZQGA 3DBRB 4M3EA 3DBLB 2ME6A 2P5VA 3ELKA 2IS6A 1I27A 2YX4A 5LHGA 4CH7A 2WA0A 1LKXA 1HA8A 5J1YA 2COMA 2LR8A 1D5VA 2O8KA 1K79A 1MBKA 4G6DA 1Z9CA 3M1EA 5LHIA 2KZGA 2FQ3A 1XD7A 4F93B 1S7OA 1B8IA 3K4BA 2R7XA 3SEZA 2STTA 3MN2A 4LLGF 1ULYA 2TDXA 2ZXWH 2K3PA 4F52A 1T56A 2JRMA 2V1UA 3AAFA 3PQJA 2E71A 3TQNA 2JWTA 5EF6A 3TKYA 1ZG5A 1UELB 5J40A 4HNVA 2H1LA 5J8FA 4CYCB 3GWZA 1HQCA 2B7EA 2LG4A 3A4CA 1RR7A 2ID6A 5BS6A 1P4XA 3CC7I 2VKDA 2ZO4A 1RETA 5DCMA 1KU7A 3IC7A 4XLPF 4YFKF 1QGPA 2R7QA 5M3FJ 5HLHA 5HDKA 2BVMA 3A0BC 3DKYA 2GXAA 3LQQA 2BEOA 3MKLA 3ABTA 4PJJA 1UJ8A 2CYYA 4FT8A 4HDUA 2H27A 1QVTA 3BPVA 4L18B 3MKWB 1IN7A 3EYIA 3BC8A 1F43A 2ZCWA 3SJMA 2DOAA 4EQQA 3HSFA 1RC9A 2ID3A 3OIQA 5F1RA 2Q1ZB 2H8WA 2DMTA 3K7AJ 4O6JA 4XQFA 5E3OA 2LD5A 2HWVA 3S14J 1BR4A 2FNAA 1L3LA 3K4JA 2AXTC 1AU7A 4OINF 3S17J 4IHTA 2JVHA 3CMAI 3MCZA 4PSWA 3HDDA 2EV5A 1JKOC 4KDPA 4UUVA 3T1BA 1EKEA 1UHWA 1Z6RA 3ZR8X 2IGNA 4ESJA 4C2UA 2P7CB 4ZDPA 1JKPC 2BE5F 4Y13A 4BH9A 5IT9Z 1U0JA 1XMKA 1MDMA 1ZYRF 4CO8A 2V9PA 2ZMEC 3S2WA 4ABZA 1TC3C 3TW6A 3OIPA 5EZGA 3MWMA 3LFUA 3BJAA 4EGYA 4BEHA 4ZYDA 1FYLA 4RGXA 2F4OB 3MZHA 1Z6TA 4L9VA 2G7HA 4B4CA 4XKBA 4KN7X 1REPC 4WK8F 2DFFA 4GDFA 2V9VA 2P81A 2BHYA 4M73A 2E1MC 1YJWI 4XKCA 1MJAA 2HXIA 3OSGA 2OUMA 4I09A 1P9QC 1TNSA 4ZTFA 4OIOF 4HNUA 3ESWB 2HR3A 4HPQA 1KQ9A 1OQYA 1JUSA 4UHTA 3VYUB 3LNQA 1NG6A 4U0VA 1HSJA 1MNDA 1S7EA 2OC6A 5CVVA 3WU1B 5JVGF 2NVUB 5C4XJ 2CQXA 3F8MA 4LIUA 1GV2A 1V5FA 2FRHA 1A36A 1WJBA 4F92B 1A6IA 4NNJA 1XDUA 3REOA 3OYIA 3QOEA 2LLKA 2MSYA 4HV6A 4DOZA 3R60A 3ASOH 5CKTA 1JI8A 1U8BA 1WPKA 3CF2A 5E8IA 2FD5A 2L9SA 5GTHC 1DGRM 4RGRA 2E2HJ 4S04A 4PJLA 2DODA 3OR1C 3AL0C 2QQ9A 3G1OA 2W48A 3IWZA 1UHMA 2IA2A 3JSPA 3FXMA 2OTLI 2FSWA 1YQAA 2HYFA 2VONA 1B72B 3DWLE 1YW7A 4Y33A 4BBSJ 3DLLF 4EJVA 4LITA 5EDNA 5IYBJ 3GMEA 1BR2A 2VIXA 4KNYA 3ZMDA 4V2FA 4RGUA 3MD2A 1LVKA 4U0WA 5IYDJ 1I6XA 1NHAA 4Q48A 5L3EA 3W6VA 3WE3A 3M8EA 1ZR4A 1YO5C 2IGOA 2ZB9A 2ISYA 3OIOA 3M8FA 4P55A 1VQ8I 1RESA 1JGGA 4MGRA 1J9IA 4BXFA 4I0BA 3B73A 3QU6A 2I5UA 1X1AA 2VQHA 4OMZA 2WY7Q 3LOCA 2NS7A 2R7SA 2KJCA 2HQNA 3ZOBA 2GA1A 3CUQB 2COBA 2QKLB 3OYAA 5K5RA 1LDKB 3RZDJ 2DFIA 1ZTRA 5DYMA 2Y75A 2O3FA 2UZKA 4HAMA 3DF8A 3PO3J 3S32A 3TDUC 4M6VA 2OJED 1XG1A 1GHCA 1OYYA 3BOQA 3QWLA 2UXNA 2XDVA 2MFZA 1SEUA 3AG4H 2E36A 1YTYA 1T8IA 5IT3A 1ZRCA 2LH9A 1J7KA 3WTZA 1Z77A 5IYCJ 2M1BA 3N97A 2ECCA 1U6GA 1W7PA 2VBYA 1IJWC 3CF5F 4NUBA 1SAUA 1QZEA 2WV0A 3GXOA 4I2OA 3BZ6A 3OOPA 2GXGA 1XGOA 5TJJA 3EUAA 3PNTA 4AM3A 3LL7A 4RLQA 3E6MA 5D6EA 3ERMA 2Z33A 2DK5A 4BBRJ 4AU7A 3HRMA 2IEKA 5JI6A 4HX7A 1BC8C 4AYBN 1Y8RB 2E1MB 1STZA 4A0YA 3J7ZI 3KP5A 1G4DA 4Y52J 3NWTA 4EJUA 4PUSA 2VKEA 3S2DJ 4YIRX 5J3LA 1B6AA 2E2JJ 1OR7C 4H4KC 3U1KA 3HIFA 2X1CA 3HZJA 4JOMA 3WG7H 1FOYA 3K4KA 3ZGKA 1POGA 2DLLA 1VQLI 2P6SA 1E3HA 2EV6A 4E7HA 3DTEA 2WB1N 1SD5A 5H6RA 3I59B 5IP9J 4IRHA 4GXOA 4E7IA 1SD6A 3ZQFA 2DMUA 3CCVI 2E1OA 1MMDA 2JUGA 2WAEA 3HB9A 3QP6A 1KYZA 1K4SA 1HW2A 2VB6A 4B44A 3AFHA 4RB1A 3CMEI 4L9TA 1IXRC 1FYKA 2UXXA 3GLLA 4P1WA 1K6OA 2HVRA 2X9DA 2PJPA 4HG2A 1X1CA 4LG0A 2DJNA 2DOFA 3IHUA 5GPAA 3SZTA 5GTIC 1ZGWA 2LNBA 4CZCA 4B48A 3F8CA 1ERDA 3BG9A 1LPQA 3CC2I 2B9SA 3D5RC 3BR2A 1LFUP 1IN6A 4MTDA 3OS1A 4KT5C 4EVIA 2PJRB 2GLOA 1OCZH 1XPXA 4Y4RA 1X2MA 3CJQB 4LMYA 3T8RA 3CMYA 5GADJ 1Z91A 2JT1A 5J4VA 4LK1F 3PQKA 4WWCA 5BPIA 2ETHA 4IX7A 2NVTJ 4RB2C 4YEJA 2FOKA 1VQOI 3FXQA 1A35A 1QZYA 3CC4I 2A68F 2L9NA 5EZHA 3NARA 2R4GA 2FNPA 2QUFA 1FZPB 5F04A 3LWFA 1D0YA 1GXQA 4N9IA 2LBFB 4G7ZF 3ROUA 1YOVB 3DP7A 2NVQJ 4QWQA 5DV5A 4U7BA 4KMFA 4Y15A 1RZ4A 4RM3A 1MBFA 3M3YJ 1H9GA 3GLXA 2VKHA 3BR0A 3FK6A 3V8KA 3WODF 4ZZLA 2CMPA 1A04A 1TWGJ 3VYTB 1N78A 3C18A 2QBYB 2ZXIA 2JA6J 2KRFA 2NS0A 1MBGA 1TQIA 1D1CA 3GTJJ 3WTTC 3MMYB 1DPRA 2QVOA 5L3GA 2DPUA 2X85A 4RA2A 4U88A 4BKXA 4ENKA 4FASD 1BW5A 5LHHA 1N75A 1YS7A 3HHGA 2JVGA 1HSTA 4Y17A 1Q1HA 2ZJPF 4BHCA 1I1SA 2PG4A 3DLAA 1JT6A 3HKZA 4BL0B 3L2UA 1X19A 1V5GA 2RC4A 2XKOA 3H9JA 2QSHX 3ZQLA 4LFUA 2RDPA 2MLGA 2PFBA 3HTUA 1OCTC 2DTRA 5CJ9A 2AO9A 3ZN0A 2ZMEA 2XIGA 2MGQA 4CUGA 2DTZA 4HLYA 4MEYF 2QKMB 5E79C 2AQEA 1P7IA 3KZYA 3I4PA 4C3JJ 2DYRH 4XKWA 4A3IJ 1JT0A 5TRDA 2OCEA 4DBQA 1MBHA 3GVAA 3CESA 3HYIA 1QHHD 4HNTA 2XPWA 4UV9A 3COAC 2Z2SB 4ZDOA 4D9JA 2R7DA 4XK4A 5IPAA 1SVOA 1H8AC 5JLWA 3R6SA 3BJ6A 1WRJA 5F27A 4CSWA 3E6BA 3GCMA 1Z05A 5HOOA 3V4GA 4XSZF 4BQAA 3TP0A 1YJNI 2HXOA 2EZKA 3RKWA 2WTEA 3VEPA 4HDVA 2QA4I 5H2FC 4L5JA 4FE4A 3L2CA 3CTAA 1UG2A 2J5OA 3I3LA 2ZKZA 5J6XA 1TWAJ 3RQ4A 2DOEA 4HQEA 1MIJA 1Y56A 3QAHA 5A2QZ 3WTSC 4DNCA 1ORKA 2LRDA 3F9KA 2VBWA 2X1EA 1ZHFA 5BNGA 3QYFA 3GO5A 4Q4ZF 4C2MJ 1H9TA 1C0WA 4R79A 3JRBA 1ZAOA 4PJ0C 1LNWA 1FSEA 2I8DA 5ILUA 5F1JA 1S7AA 2XAHA 2FJ1A 4C9YA 3LSTA 1I3QJ 5FKOA 4C3IJ 1YLFA 3J80Z 4UUTA 4ESBA 3LSJA 2XPVA 1WJDA 4KA4A 1WVRA 1VQ6I 3HBLA 2M4GA 5ED4A 3K10A 4IEJA 2W57A 4LG3A 2V9KA 1JJ8C 4K2EA 3TW7A 1YYVA 2HZDA 2VUMJ 2NNYA 2O6GE 4XMYA 3BG3A 5LFAA 3C2HA 2JSPA 3A02A 2HDCA 2JK3A 1LUJB 2O03A 2X6WA 2V26A 2KHMA 3SDBA 2LREA 2E2IJ 1BJAA 1UCRA 3L2VA 3BQYA 1Y1VJ 2L7FP 3OYFA 5HODA 2LKSA 1Z0XA 4HQMA 3W2VA 3KP4A 3HUGA 3HXLA 3PUFA 5JFRA 2V1DA 3FMSA 1RKTA 3QPSA 3ML6A 4U0YA 3OSFA 1Z67A 4E7JA 2JUCA 4IHVA 1V54H 4CCKA 3CJTB 3HSEA 1GV5A 3P5JA 2Y9YA 2H94A 5D5XB 1F5TA 3L9FA 2TCTA 4KMUX 3Q9VA 1D8JA 4GRIA 4RMNA 2YU9J 2QCOA 5CYVA 3X2QH 2QLZA 1O3TA 1HW5A 2KIMA 3F72A 3RSNA 3O2PE 4A3CJ 3HOVJ 3Q0UA 1IUFA 3NEUA 3DXJF 5HS8A 3JRDA 5A2QK 4IHYA 2HGCA 4ZZDA 1CGPA 3A03A 2XPUA 3CJRB 1OLTA 2X6XA 4XLNF 2BV6A 2CUFA 4DYCA 1HKQA 4MFEA 1TW3A 1OCPA 1V3FA 3PIPF 2Q2EB 4PGHA 2JMWA 2JJ7A 2HTJA 3E7LA 3ZQ7A 3IAM2 2RNJA 3K0LA 3L1PA 1XS9A 1RUNA 1ACIA 4L9NA 3N05A 2EFPA 3KX2A 3P9IA 1F4KA 1YIJI 1ZG3A 4U7DA 1VFCA 1ZRFA 1R23A 2NS8A 2XUBA 4UB8C 3LFKA 3Q0WA 1AHDP 1S29A 3E97A 3CDHA 2PQ8A 1PJRA 2KP6A 3KEOA 2IS2A 1OR7A 2IA0A 3FHNA 3DPLC 3V8LA 4LD5A 1R4MB 1ZLJA 2LY2A 5J1UA 2FF4A 3ZRGA 2AQFA 1XMAA 2RNGA 4E70A 1QVUA 2EFOA 2A5YB 4J00A 1E3PA 2RREA 4OIRF 3KP7A 1RNLA 4AUXA 4NB5A 2DT5A 3BCAA 3TL4X 4V19K 1WGXA 1ZKGA 4FETA 2WC2A 2MG4A 3ZQHA 2QSGX 3GTPJ 1AOYA 3JRAA 1ZELA 2UWMA 3CCYA 2CFOA 3ECOA 4KYWA 4NC7A 5EG0B 3PM1A 4H0EA 4IQ4A 3ZXSA 5AIQA 4QPOA 2DA3A 4HOBA 4UVBA 5IP7J 3JAMZ 4II3A 3OV8A 2BZTA 4G6QA 1PUEE 3K69A 3K4MA 4M71A 2FMYA 5LRRA 2X48A 2E60A 5B3SH 4A3MJ 2JA5J 4A3DJ 4N4OB 4PJMA 5HS9A 4L5IA 5FLXZ 2E5NA 1WJ5A 3LQRA 4WF2A 4P5OA 3NQOA 4UV8A 2R7OA 1FIAA 4MTEA 3KZIC 4AD9A 1DU0A 3KEYA 3PFIA 1YX5A 4XOTA 2HDWA 3JRGA 1TWHJ 2R7FA 3DKXA 4FX0A 3A2KA 3IKTA 1G3TA 4QTRA 4PK4A 3HPHA 1LB2A 2QYOA 4C3HJ 2RQQA 2JRTA 3KYCB 2BBYA 4B47A 3E3VA 1QPMA 4IQJA 2VN2A 2XRNA 2R5YB 4BQNA 4M3DA 2HQ5A 2ZSHB 4RGSA 2QWWA 1AKHA 3CJSB 2FMLA 2TRTA 4EM1A 2IT0A 1X1PA 1XCBA 3BR6A 2CU7A 5D6FA 2IXSA 1R1TA 3VODA 3E1SA 4P9UA 2IVMA 3OYDA 3K6GA 2K9LA 2XAFA 4WXCA 1CF7A 4HYEA 3SYTA 2VLAA 3OL4A 4BUPA 5CQGA 2HPMA 4A3JJ 1R58A 4I6ZA 5IY5H 2DA6A 5FD6A 4HF0A 3CZ6A 1LE8B 4BDYA 4CCOA 2NOGA 2DT6A 5K5QA 4GCVA 3GZ6A 3N4MA 2OD5A 1R7JA 3HOTA 1WJEA 2PMUA 1SANA 2NRAC 3VFZA 2HEOA 4JK1X 2GWRA 3OYGA 1KZHA 2L02A 2Y0SN 1SC7A 2PI0A 2FUG2 3CUQC 2FBHA 5DDGA 4UUSA 1GUUA 1FNNA 2DW4A 2GIVA 3BT9A 2ISZA 5FLMJ 3O3KA 3WG9A 2WAFA 3QU3A 2K85A 4TV7A 1RIOH 4PSXA 1T38A 3E6DA 1Y8QB 3W2WA 4KIFA 2ELJA 2CG4A 2V6CA 4PZJA 2R7VA 2HDDA 1P4AA 5FRMA 1D1BA 2LK2A 4E7ZA 1NTCA 4F55A 4XM3A 1BBYA 2BW3B 3FKJA 2M9HA 4HEA2 3PL8A 2E1CA 3JREA 1WI3A 3OYBA 2RGVA 4HA8A 3S1QJ 1QRYA 3HEFA 2DA2A 1OJLA 3DKWA 4G6TB 4BU2A 4AIDA 2BYVE 1FMVA 2DFHA 1I50J 2Z5UA 3FXRA 2XAQA 2DDBA 2OU2A 1RR8C 4LGWA 5D4SA 3KYDB 3TOBA 3AKZA 2L0KA 2V6EA 2LF7A 2MLKA 1EA3A 2XF7A 3BG5A 3FXKA 4D5FA 3TMOA 2GAUA 4F7ZA 5GAEJ 1U2WA 4EATA 4HSRA 3HOYJ 1E2XA 1VQ4I 3HC7A 5LRSA 1GVJA 2MABA 2LVSA 3W6JB 1VQ7I 4ZDLA 4DYRA 4M3BA 1TWFJ 1TL8A 3CLQA 1YITI 3B6CA 3DEUA 1XC5A 4Z2YA 3OS0A 2HVQA 3E6CC 4XLEA 3JSOA 4LIVA 3WTXC 1HOMA 3TGNA 2XHKA 1A5JA 4DZJA 2MC4A 2ZFUA 4NC6A 3SDGA 3L00A 3GFMA 3AG2H 1QPIA 3S15J 2D1HA 4HBLA 2ZSIB 3F0CA 4ENNA 3RI4A 1HBXG 5D4RA 1I5ZA 4PJNA 2ZC2A 1B1BA 2WAQN 4CZZA 3V42A 3BZKA 2EILH 5LGNA 1VTNC 4LB5A 1P92A 1MSFC 3JR9A 4N0BA 1PYVA 3A01B 1R4NB 1DUXC 3OR2C 3QODA 2JA8J 3OYKA 3L2WA 4HX8A 3WTUC 2GOXB 2CQKA 1MSEC 4BE1A 3MVPA 2HVSA 1USSA 1HXDA 3FISA 4W1UA 3G71I 1W0TA 1O3SA 1LVAA 2PEXA 4DBRA 3K1PA 3CCSI 1IGNA 3F8NA 5IT9K 1YW8A 3IAS2 3DBHB 1T39A 1X2NA 5CQEA 3ZPLA 2LKPA 4CYCA 1W36D 2BXYA 3W3CA 1WCMJ 4II2A 3Q5FA 2EWNA 5CVUA 2DA7A 4DZPA 1RI7A 2IPQX 2B63J 2DA4A 5TISC 2DYSH 1U9OA 1ON2A 4M3FA 3OY9A 1OCCH 5F64A 3VSLA 4AIHA 1V4RA 1ETWA 4I01A 1T2KA 4FTHA 1ZREA 2VKVA 3KYLA 3ZMSA 5E1ZB 1IV8A 2XGCA 4ZYAA 1VQPI 5GAGJ 2NOJB 2BHZA 3GF2A 2X1DA 2XGXA 2VJ4A 4I7HA 5F0FA 2KISA 2VJJA 4CA0A 1BIAA 2A6EF 3KZZA 3GTLJ 1G8XA 4M9XA 2VOOA 2CH0A 3AG3H 3U2RA 5HS7A 1XDSA 2JTVA 2Z9OA 4DGWB 1ETYA 1KU9A 2YU3A 1A6QA 2E34A 4LLNA 2XGDA 4BS9A 4FISA 2KQRA 3H0GJ 3ZMVA 2LC2A 4IHWA 5CPRB 3HM5A 2XKPA 2OPTA 4XN0A 2IW5A 5CLSA 4B3XA 5FKNA 2DAOA 5L3FA 3KP6A 2CUEA 4BQQA 3GFIA 3HOZJ 1VNDA 3HSRA 2VC0A 3LA7A 2PBIA 1I3AA 3G73A 1JHHA 1MMNA 1R1UA 3FBNB 2NVYJ 2OA4A 2KKOA 2XB5A 2B0LA 3DU5A 1IF1A 2KIUA 1WSUA 1D0XA 1Y0UA 2OQRA 3MAJA 4RB0A 3PNVA 5E8GA 5AONA 4KISA 3RPUD 3OWTA 1K78B 3MZYA 3RIRA 1MMGA 2PN6A 2QENA 3GZ5A 2E7WA 3H5AA 5F0CA 4N4NB 4M9SA 3C7JA 2K4BA 1W5SA 2VPRA 3K4CA 3H3UA 3H92A 4XLAA 3S1RJ 4ZYGA 2CSOA 4F91B 5DM7F 1ETVA 1W4MA 5CVIA 2HOTA 1GT0C 1X4PA 1O3RA 3M7GA 3RYRA 1BIBA 2OV7A 1GLNA 4AC0A 1YS6A 1VQNI 5HLTA 2QEXI 4J01A 1U8RA 2N8GA 3R0JA 4N9HA 2LP0A 2H6BA 4A5MA 5TGTA 3RDIA 3PUBA 4UVAA 4FCYA 1BL0A 4CICA 4KIBA 2VE9A 3R4KA 1VQMI 1FPQA 4AYBA 2VI6A 3RKYA 4QIWN 1GXPA 1U5TB 1XSVA 1ETXA 2VE8A 2V79A 3LSIA 3I64A 1JUMA 1B72A 3H5NA 2LYCA 1RUOA 2QZ8A 1WQ2A 4PCQA 5F0HA 4YIFA 3HTSB 2A6HF 3ABLH 3OYNA 4IHSA 3OS2A 4MO7A 4ANJA 3VPRA 2L9RA 3CCMI 2DFEA 1Y6IA 5L3DA 1XGMA 3BY6A 4Z6YA 1GDTA 5EJCA 2WB1A 2E35A 2K7LA 1WH5A 5FJ8J 5EEAA 5FROA 4BY7J 4FE7A 4OMYA 3FMQA 2ECBA 2CQQA 3BWGA 2MYSA 4I02A 3SEQA 3HRUA 4BQOA 3BJOA 1W36C 4G8XA 1J59A 4LOCA 4A93J 2M8GX 4ETSA 1V55H 4RBOA 2F4IA 3BDDA 5GP9A 2XVCA 2F48A 3MFKA 4XONA 2EA2A 3OYCA 2HOAA 3SXYA 2DDAA 4BNCA 2YR2A 4BY1J 3CUQA 2MC3A 3OMYA 3BTIA 3TO6A 2HNHA 2CW0F 3CQZJ 4RAFA 2K9SA 3M4OJ 2J5PA 5C3EJ 1IN4A 2V7FA 1OPCA 3H35A 3EETA 5D5VB 2F5FA 3WU2C 3H36A 2I10A 5E1WA 3I53A 1YIOA 4ITVA 4AVZA 5JVTA 2XSDC 4JP0A 3ABKH 3AG1H 2YX7A 3HOXJ 3F22A 3EPZA 5ICGA 4OU0A 4OWRB 1JTYA 3M07A 5HNFA 2CV1A 4NDLA 3HRTA 2W85A 5LGUA 2EZHA 4E4HA 2PLYA 2QF7A 3DTIA 4IZZA 1YI2I 4LK0F 1P6RA 3KE2A 4ENMA 2V1XA 1RPWA 5E1XA 3KIOA 5J1RA 1SFUA 1J0RA 3S2HJ 1HW1A 4PGGA 2O9LA 2BY3A 4MLOA 4XSXF 3I9V2 3CCLI 1BI2A 1QA6A 2KT0A 1T98A 3IWFA 1FWZA 4CCNA 2QGUA 2QM3A 2VL8A 2MBFA 1FOXA 1X58A 4IO9F 5B1BH 1SFOJ 1D8KA 2K86A 5CVJA 3K2ZA 2L2OA 1ZLKA 1XB4A 1OCOH 4YFXF 1MNEA 1IN8A 3GBGA 3S1MJ 2ADUA 4HV5A 4MQVA 5EEHA 4R8HA 3CP2A 4CCJA 1PP8F 1IN5A 3WGIA 1PUFB 5HLIA 4XRMA 2Y48A 1FEXA 1FBQA 3C2GA 5D5WB 3BR1A 3FBIB 3I59A 4ZTJA 5E3MA 1FYMA 1JXSA 2ZXHA 1VF9A 1PVEA 2G0EA 2KRHA 4NQWB 5F08A 2O61A 2O5RA 4BXXJ 2F5VA 1Y39A 3LMMA 1MBEA 1AA7A 1LDDA 1Z3YA 2JA2A 3ASNH 4IL6C 4BJ6C 5FKKA 4IKFA 3P9CA 2GXBA 1IXSB 2R7ZJ 1FBUA 1FMWA 5KHDA 1BA5A 2PX9A 2LF8A 2KRCA 1FTTA 3EGVB 2WWYA 2CGPA 2NNNA 3E5XA 2DMQA 2Y2ZA 2VJ5A 4GGGA 4W97A 4NHJA 2W00A 4KJZA 1BOAA 4Y3OA 2A07F 1X3WB 2ZNYA 3F23A 1MH4A 3HOUJ 1WZ2A 3ONQA 4DJAA 5J4YA 2C6YA 2PJRA 2R7TA 1IRGA 3UR3C 3FF5A 2ESHA 2EQRA 1LJ9A 1G3WA 2EFQA 4S0HB 4G9YA 2OQGA 4BDZA 5EGOB 1NK2P 1LDJA 3VOEA 4PFOA 3IKVA 4E6KG 3CMMA 3CD6I 2HKXA 1IDYA 1P2FA 4G94A 2E5ZA 4M3GA 2CS3A 4B09A 5J47A 5EYRA 2MD0A 3O8GA 1AWCA 2JQ7A 3HOWJ 2LTPA 3Q9SA 4M6XA 2LBFA 3E5QA 4XICA 3JRHA 3LAPA 5BPDA 5DCFA 4WXDA 2L9VA 2VC1A 4JX4A 2KPMA 3G2BA 4UVCA 1JE8A 1O7LA 1ZG1A 4EM0B 3DU6A 4XOPA 1MJBA 5IOYA 3F8BA 1MMAA 2ZFWA 3TO9A 2QBYA 3VWBA 4KIGA 1EH8A 1R5GA 5B1AH 2A5WA 3GFJA 2MA3A 4D1QA 2BOLA 5M5XJ 1UHSA 5DUKA 4WCGA 2DMNA 5FLVA 1Y0NA 4ENJA 1OYIA 3BR3A 4YIIA 2PMZA 3GYHX 3S93A 2BY0A 1BI1A 3Q3SA 1B8IB 2K9MA 3F6OA 1DU6A 4U87A 2M87A 3EUHC 2VT3A 2LMDA 2FX0A 1D5YA 1SMYF 4UB6C 4DQ2A 3KCCA 1B9MA 1OCRH 2M5WA 4M9ZA 2KIQA 3TP3A 4ZH4F 2JA7J 2NVXJ 4HZFA 4E7LA 5JHUA 2YPRA 3QYBA 1U78A 1E0EA 3ZCOA 5ICEA 2O0YA 4D0PA 4X0GA 1MKMA 1DQUA 3F8FA 3VB2A 5HDGA 4BAYA 5DCMB 2LDUA 3J80K 2L54A 1G59A 5FD5A 4GFBA 2W25A 4JQFA 1SFKA 2DJIA 2Z99A 1TTYA 3WHCA 4A6EA 3QYEA 3ERED 1IRFA 3ABMH 3WE2A 3VDXA 1WI9A 4J19A 3OYMA 1A31A 1DGWY 2ZBKA 4MNUA 2HQAA 2AHQA 3ZP5A 5LBQA 3IV5A 4CHUA 4CGZA 2ZXJA 4MEXF 1ZH5A 3FMRA 5L3CA 2R7UA 5GPCA 6PAXA 2LY1A 2WY8Q 4NQWA 1S8NA 1ZQ3P 4B8XA 1K83J 4AWXB 4AVPA 5FFZA 3L2QA 2K9QA 4L5EA 2NYXA 1IO2A 3WTYC 1DDNA 1T33A 4YELA 4YG2F 1T0FC 2W7NA 2JPBA 3SHFA 1QHGA 3L7WA 2F2EA 4A12A 1MDMB 3BP8A 1EH6A 3RQIA 2IGKA 1ZRDA 2HPIA 4C2TA 2OF7A 3MKZA 3PIOF 4L0YB 4A5NA 4BEHB 4I99C 2QSFX 3S1NJ 1R5ID 3GTGJ 3P7NA 5KK1A 3S16J 3DEWA 3IH2A 2DU9A 5HNHA 2ICWG 5B5EC 2CW8A 3ZMZA 3ZQIA 3I4MJ 2X51A 1TW2A 3BTCA 5EGOA 3BTJA 4RDUA 3I0TA 2RQPA 3KEQA 4OIQF 3KETA 1BI3A 3B6AA 1F36A 1TNTA 4V2GA 2IBDA 3DCFA 4MHGA 4X6AJ 3ABUA 4RS8A 3BCBA 4MIMA 4B1RA 3EUKL 2X4HA 3FXUA 2CWEA 1MNMC 2NXNB 2K4JA 4RB3C 1BI0A 2KMUA 1J5YA 4ZYHA 1QU3A 3OYEA 1HKTA 1YRNB 1XSDA 1K6YA 3FZVA 3HOSA 2K5CA 2EIKH 3HGGA 2VBXA 2OTJI 3ZMTA 5LEKA 2HI3A 3ZMUA 2EIJH 2L01A 2BY2A 2ELHA 1X3UA 3JTGA 4FX4A 1FC3A 3CCJI 5FRNA 1Z3XA 1QNTA 3ZQCA 1TQPA 3KLNA 2IS1A 1OFCX 4IF4A 2VASA 2R5ZB 1I6HJ 4BJ5C 1N25A 5GAHJ 3K2AA 4CCMA 5EEGA 4S05A 2Q0OA 5ICCA 1JGSA 2ESNA 1ENHA 2NAZA 4BYYA 1VQ9I 2Q2EA 3RKQA 3WTWC 1M1EB 2E7XA 1JKRC 2DCEA 3PSIA 2XASA 3JAMK 2RV8A 3UKGA 1SD4A 4O3MA 4QLCU 5D5UB 1D1AA 4I98B 2VPLA 5FLXK 1BJZA 2FBKA 1BR1A 1FT9A 1R6RA 2DQRA 2IS4A 3K9TA 3RPUA 1FY7A 3HPGA 3FWEA 1KGSA 5FFXA 1OISA 2KDZA 1R49A 4XRFA 1Z1DA 4JX6A 2IA1A 1USTA 3RZOJ 2EA4A 4CXFA 4ESFA 2CJJA 2L4AA 3J7AY 3KP3A 2VOPA 5DUIA 2GQQA 4L0ZB 3GFLA 3VYRB 2EFWA 2RVCA 3LAJA 3HGYA 3FIWA 5HVQC 1W5TA 1K61A 1TWCJ 3DFGA 3DPUA 1TT0A 3FXJA 4ZJZA 2E19A 4UY8I 2CFXA 3Q0VA 3GTMJ 2EZIA 3U9GA 1NH3A 4RAYA 2Y0SA 4D5CA 3PSFA 3D1NI 1T95A 5C44J 1W7PB 1Z7LA 4A0ZA 5EG0A 1FTZA 2MH9A 2QQBA 3J81Z 3G1LA 1ONVA 2WV1A 3G1MA 2F4MB 3LA3A 2FBIA 5JHFA 2DO7A 2XF6A 1KONA 2VODA 4EM2A 2CQ7A 2M30A 2CO5A 3G6EI 2EZLA 5KAIC 5KCMA 1WWXA 3WGHA 4A3GJ 3PFYA 1DPUA 3MEXA 4O5VA 4BHBA 4X1EA 3BTLA 5E17F 1WKMA 1ZR2A 1YG2A 1G3YA 3S8PA 3K4LA 1KQ8A 1WJFA 3WTVC 1G2HA 1JJ6C 3HJEA 2Z1DA 2FA5A 1TBXA 5C4JJ 2XAJA 2W4SA 2RKHA 3C3WA 3SQNA 1X4OA 2GBYA 4EMSA 1LQ1A 1ITYA 2R5YA 1FLIA 3O6BB 3QRFF 1IXCA 1R71A 1WIBA 2HTSA 3S3MA 4I0AA 4DIQA 1U5TC 1UMQA 2FXAA 4IPAA 4QPQA 2DBBA 5DS9A 1X3ZB 3C1DA 1YRNA 4BACA 2P5KA 3PJRA 4XR6A 4B43A 4DW6A 3BZCA 4Q5SF 1KQ0A 4KT6A 4LJZF 1Y1WJ
chains in the Genus database with same CATH topology
1VQPI 3EGVB 5GAGJ 5JVGF 2ZJPF 3J7ZI 2E34A 3CCUI 5GAEJ 1VQ4I 3CD6I 2FOWA 3CJTB 2JQ7A 3CCQI 1VQ7I 1FOYA 3G4SI 1VQLI 4IOAF 1YITI 3PIOF 1YJ9I 1FOWA 1VQKI 3CC7I 4UY8I 2OTLI 3CJSB 2K3FA 3DLLF 2ZJQF 3CCVI 2ZJRF 3CJRB 3CMEI 3PIPF 1YI2I 5DM6F 1YJNI 5DM7F 1VQ8I 1ACIA 3G6EI 2QA4I 2H8WA 3CCRI 3CC2I 1YIJI 1VQNI 2NXNB 2QEXI 3CCLI 3CJQB 3CMAI 1S72I 1MMSA 5GADJ 1QA6A 3G71I 1FOXA 3I56I 4IO9F 1VQOI 2OTJI 4IOCF 3CCSI 3CC4I 3CCEI 3J7YJ 1VQMI 3CCJI 1YHQI 1WIBA 2E36A 1HC8A 4V19K 3I55I 1VQ6I 5GAHJ 1Y39A 1VQ5I 3CCMI 1YJWI 3CF5F 1VQ9I 2E35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP I;  3EGV B;  5GAG J;  5JVG F;  2ZJP F;  3J7Z I;  2E34 A;  3CCU I;  5GAE J;  1VQ4 I;  3CD6 I;  2FOW A;  3CJT B;  2JQ7 A;  3CCQ I;  1VQ7 I;  1FOY A;  3G4S I;  1VQL I;  4IOA F;  1YIT I;  3PIO F;  1YJ9 I;  1FOW A;  1VQK I;  3CC7 I;  4UY8 I;  2OTL I;  3CJS B;  2K3F A;  3DLL F;  2ZJQ F;  3CCV I;  2ZJR F;  3CJR B;  3CME I;  3PIP F;  1YI2 I;  5DM6 F;  1YJN I;  5DM7 F;  1VQ8 I;  1ACI A;  3G6E I;  2QA4 I;  2H8W A;  3CCR I;  3CC2 I;  1YIJ I;  1VQN I;  2NXN B;  2QEX I;  3CCL I;  3CJQ B;  3CMA I;  1S72 I;  1MMS A;  5GAD J;  1QA6 A;  3G71 I;  1FOX A;  3I56 I;  4IO9 F;  1VQO I;  2OTJ I;  4IOC F;  3CCS I;  3CC4 I;  3CCE I;  3J7Y J;  1VQM I;  3CCJ I;  1YHQ I;  1WIB A;  2E36 A;  1HC8 A;  4V19 K;  3I55 I;  1VQ6 I;  5GAH J;  1Y39 A;  1VQ5 I;  3CCM I;  1YJW I;  3CF5 F;  1VQ9 I;  2E35 A; 
#chains in the Genus database with same CATH topology
 2FU4 A;  2XF5 A;  3I4N J;  4OAZ A;  4LG0 B;  4A3K J;  2D2W A;  3K1N A;  3BQZ A;  5LGT A;  1IW7 F;  1VI0 A;  1UB9 A;  4ZC3 A;  2A6T A;  3TBI A;  2DQL A;  3OYL A;  4A3L J;  1WH7 A;  1LFB A;  1KU3 A;  1LE8 A;  3RKX A;  2W24 A;  4EV0 A;  3H3V K;  4KUM A;  3H0D A;  2V4J C;  4HF1 A;  3EUH A;  2R5Z A;  2OCC H;  3M8J A;  5ERI A;  3I5U A;  3I58 A;  4A0X A;  3QPL A;  5IOZ A;  1IAW A;  3LSR A;  3BG7 A;  2WAQ A;  3IP4 B;  4XKV A;  3J81 K;  2XRO A;  1JKQ C;  5K7F A;  3G3Z A;  1TLH B;  4OIP F;  1ETO A;  2FOW A;  2HU9 A;  4PDK A;  4XID A;  2R7W A;  1QQI A;  3PO2 J;  4Q47 A;  2PMH A;  1Z21 A;  2G9W A;  2XAG A;  4XL9 A;  3UNG C;  2IGM A;  3G4S I;  2P5L C;  1ON1 A;  4IVN A;  1VQK I;  3E0J B;  1DP3 A;  3CLO A;  1NK3 P;  4GO1 A;  1HDD C;  2X6O A;  4A3E J;  2Z3Y A;  2GM4 A;  1HLV A;  1K7A A;  1X1D A;  5K1Y A;  3D5L A;  2FE3 A;  4GYI A;  3W6K B;  3RJP A;  1ODD A;  1IRZ A;  2BW3 A;  2D5V A;  1F1Z A;  5DM6 F;  5DEQ A;  2QQ8 A;  3U21 A;  1IC8 A;  1ETK A;  4EEF G;  9ANT A;  4C30 A;  1X1B A;  4WX9 A;  2VXZ A;  5DD8 A;  5M5Y J;  1UZC A;  2Y0M A;  3CCR I;  1PDN C;  1TT5 B;  3GX4 X;  3V7C A;  2EK5 A;  1I1G A;  2CUJ A;  1H89 C;  2YSR A;  2WBM A;  4R1H A;  2M0M A;  3BPX A;  3FM3 A;  4XOR A;  1T0F A;  3RPQ A;  3ZQQ A;  3RCO A;  3DV8 A;  2XSJ C;  3JRI A;  5H20 A;  4KN4 X;  3WGG A;  1LEB A;  3EYY A;  2R0Q C;  2K9N A;  2ZME B;  1SD7 A;  2BVL A;  3KLO A;  3PNY A;  5K5O A;  1Q1V A;  3A0H C;  5CVR A;  3V8J A;  3R61 A;  3J7Y J;  1CQT A;  2VQC A;  3GW2 A;  4HF2 A;  4M6Y A;  1HKS A;  2DN0 A;  2EV0 A;  3K70 D;  2CW7 A;  3QQA A;  1W1W E;  4Y7N J;  4D7N A;  1N77 A;  4LB6 B;  3F6V A;  3WHB A;  1QZZ A;  3FDY A;  4IRI A;  3SFZ A;  4IHX A;  3CDL A;  1R5H A;  2LKX A;  1RRJ A;  1HF0 A;  1XSX A;  1XGS A;  3M9A A;  2DXI A;  1T6S A;  3E5U A;  4IXA A;  4JYK A;  1ZGA A;  2L3D A;  4JBA A;  2F5D A;  2M7A A;  4HX4 A;  4XNF A;  3F21 A;  1DP7 P;  2KL4 A;  2HYG D;  3ECH A;  3NRV A;  3GTQ J;  3C2B A;  1OKR A;  3A1Y A;  3JW4 A;  3OYJ A;  4XRS G;  3DTK A;  2A05 A;  2Z16 A;  4JX5 A;  2R92 J;  3A01 A;  1J75 A;  2GOM A;  3OL3 A;  3W2A A;  1UFM A;  3CDI A;  2P0W A;  4KIT B;  1TQM A;  5KVR A;  5D8L B;  2LFB A;  2E1N A;  3KP2 A;  2R7R A;  2W82 A;  3IRR A;  1EF4 A;  2STW A;  2MH2 A;  1MH3 A;  1FBS A;  4M74 A;  5FO5 A;  4ZYE A;  5H6Q A;  1IUY A;  1I39 A;  2AS5 F;  1HDP A;  4RM2 A;  4XLF A;  3NWS A;  3ISP A;  1MZB A;  5LEJ A;  3AL0 B;  2H6C A;  5FKM A;  4FHT A;  1OYW A;  3VSK A;  2CV0 A;  3DEE A;  1WJC A;  2EBI A;  4AIJ A;  1JTX A;  1KYW A;  4UXN A;  3NAU A;  1FOW A;  2IP2 A;  1O57 A;  5E3N A;  2MD5 A;  3TED A;  3GZN B;  1S9H A;  1ZN2 A;  5LD2 C;  5HLG A;  1FX7 A;  4P9F A;  2LY9 A;  2YUS A;  5DD4 A;  4BXU A;  1YE9 A;  3HRS A;  3FXO A;  3HKZ N;  4EJT A;  2P6T A;  2MW8 A;  3QPT A;  1G6N A;  1SMT A;  4BGD A;  2HYJ A;  3BRO A;  3T0Y A;  2HZT A;  4BJT A;  2CUZ A;  2M4K A;  3OYH A;  1GVD A;  2P7V B;  2UV1 A;  5ILV A;  3SZG A;  3GTO J;  2BY1 A;  4IRG A;  4CYD A;  3FHZ A;  5AIP A;  2HKO A;  4A3B J;  1ZK8 A;  4RAZ A;  1FJL A;  3HUG B;  4HLX A;  3B02 A;  2KIF A;  1MMS A;  1UG0 A;  3GTK J;  4A69 C;  1E17 A;  2LOO A;  2L5Q A;  3L2R A;  3IUO A;  2CRG A;  1B9N A;  3LSG A;  1MW7 A;  2BXZ A;  3R0A A;  1MJ9 A;  5BOX A;  3FX3 A;  2ZJ2 A;  2YS9 A;  5K7H A;  3V7S A;  1QO0 D;  3FM5 A;  1SVL A;  2AXL A;  4HST A;  1YHQ I;  3IL2 A;  1B4A A;  1HC8 A;  1U9N A;  1IV6 A;  1H88 C;  1E3O C;  2OAZ A;  2DMP A;  2IAI A;  2KZV A;  2X6Y A;  2Y30 A;  2LSO A;  2O8X A;  3U1D A;  1D3Y A;  2KJB A;  1K78 A;  1SFX A;  2EPF A;  1J09 A;  3QPH A;  5FGM A;  3H1C A;  3IH3 A;  3ZN1 A;  5BMZ A;  2K27 A;  2KFD A;  1MGT A;  3JRC A;  1O4X A;  3TDZ C;  1H0M A;  1XTA A;  4NC8 A;  2GZW A;  2VQL A;  4I76 A;  3KFW X;  2D1V A;  2M34 A;  3FXL A;  4EJW A;  1L0O C;  4OAY A;  2Q8K A;  2A69 F;  4XLH A;  3I71 A;  4ON0 A;  4G7H F;  3S3O A;  2UUZ A;  4BE2 A;  3M1C A;  4G12 A;  3VYS B;  2HS5 A;  2FEZ A;  2HQR A;  3K70 C;  1R22 A;  1BN5 A;  5L3B A;  2R3S A;  4KFC A;  1ZAR A;  4B3A A;  2XB0 X;  3HHH A;  2DPD A;  3K1M A;  3FKI J;  1FIP A;  1D0Z A;  4XLC A;  2O7O A;  4AIK A;  3EDP A;  2RAE A;  2L7Z A;  4A2U A;  4A3F J;  4A6D A;  1RKW A;  2JZY A;  5HDN A;  1W7P D;  2CV2 A;  3BG6 A;  2GA2 A;  2HFH A;  2DT7 B;  3DPT A;  4CCL A;  2HOS A;  3CCQ I;  2EFN A;  5JR3 A;  3GEZ A;  1XN7 A;  2XC7 A;  1WHU A;  3LSP A;  1XMX A;  2IJL A;  1U5T A;  2ELK A;  5E18 F;  2D45 A;  1Z7U A;  1JHF A;  1VZ0 A;  4BHP A;  3WU0 A;  1V5E A;  1IZ1 A;  2M0C A;  2Y69 H;  3HL2 A;  1PP7 U;  1FP1 D;  2ZJQ F;  1G3S A;  1S6L A;  2JPC A;  2X0L A;  1FP2 A;  1WFX A;  5E20 A;  2F5C A;  2M8E A;  2VQG A;  1SAX A;  1JUP A;  1IRX A;  2XV4 S;  1IG7 A;  2HOE A;  4GYG A;  3H3Z A;  5DTD A;  2DA1 A;  1LEA A;  1W5C C;  1R36 A;  1WJA A;  3IH4 A;  2H8R A;  4YRV A;  5F6F A;  5LLQ A;  2OBP A;  4MFD A;  4E7K A;  4XBF A;  2QQA A;  1XX5 A;  2F6C A;  2OZ6 A;  3K4N A;  3CO7 C;  4EGZ A;  1LFP A;  3JRF A;  1R1V A;  2A3S A;  3BR5 A;  4KIC A;  4LLL A;  4MQ9 F;  4RAG A;  2PMZ N;  2M45 A;  3BLY A;  2ZNZ A;  1ETQ A;  2G7U A;  5KAF C;  1HCR A;  3OOU A;  2R93 J;  1KU2 A;  4YFN F;  4EJO A;  3T8T A;  4D7M A;  4NBQ A;  3CCE I;  1K4T A;  1BC7 C;  2P4W A;  3SFI A;  4HW0 A;  1O7F A;  3SZP A;  3KPH A;  2K40 A;  1EV7 A;  5ILS A;  1AKH B;  2ME0 A;  5J8C A;  2DI3 A;  3I55 I;  3QOP A;  1BOB A;  2W84 A;  1OMI A;  1W0U A;  5BQT A;  3CUO A;  3D0S A;  4QSH A;  1VQ5 I;  5KNL A;  2JN6 A;  3TO7 A;  1FSH A;  2M2E A;  5K7Z A;  2L7M P;  1YW9 A;  3L09 A;  2EJR A;  3S3N A;  4UNO A;  1S3J A;  1CF7 B;  3CP8 A;  2V1N A;  3D5S C;  2F5E A;  3H5R A;  5E3L A;  4ASN A;  3CO6 C;  3ULQ B;  3GUD A;  2H1K A;  4P96 A;  1NG7 A;  2L4M A;  4L9J A;  4HRI A;  5B66 C;  1P4W A;  3T5X A;  4RLF A;  3JCU C;  2M7B A;  4XRS A;  1YFH A;  3H9Q A;  3CCU I;  1TZL A;  3RTR A;  3DQV C;  3H9G A;  5FKL A;  1IDZ A;  2VXD A;  2KDO A;  1XGN A;  3JTH A;  2VT2 A;  2L7K A;  3RYP A;  1SVM A;  3F3X A;  1BW6 A;  3LSK A;  4UUS B;  3TOA A;  2Y9Z A;  4DYQ A;  1EJ9 A;  5M5W J;  3I54 A;  3HG9 A;  4IJA A;  1PUF A;  3P9K A;  1YX3 A;  3MKY B;  4IOA F;  1YJ9 I;  3MQ0 A;  3IRQ A;  2EH3 A;  4BE0 A;  1UAA A;  2JSC A;  2K3F A;  2WAD A;  3J7A O;  2XRL A;  2GIZ A;  2ZJR F;  4F3Q A;  1APL C;  1MD0 A;  2A61 A;  2BGC A;  1J2X A;  1ZGJ A;  1F9N A;  2EB7 A;  3CJN A;  4CDG A;  1O3Q A;  3V7R A;  2ACJ A;  2EIM H;  3LSM A;  2W1O A;  2VJI A;  1B59 A;  1S5L C;  3LSH A;  3EQL F;  4PFP A;  1EH7 A;  2EIN H;  2VBZ A;  5D8K B;  2K02 A;  3O8H A;  2FQ4 A;  4OOI A;  2P8T A;  4G7O F;  3FK7 A;  2CQN A;  1FOK A;  2DK8 A;  2Y31 A;  1TP4 A;  4XN3 A;  1S72 I;  1SFE A;  5JLX A;  1MBJ A;  1KA8 A;  1BM9 A;  2H09 A;  1R9T J;  3I56 I;  1XCV A;  1U3E M;  4FQG A;  5FB2 A;  4IOC F;  2M3A A;  5ICF A;  2DA5 A;  1P7J A;  2IRF G;  3QP5 A;  4WXH A;  1QBJ A;  1R00 A;  5M3M J;  4M72 A;  5IP6 A;  2RN7 A;  2XAU A;  3MZ8 A;  2XGE A;  1T08 B;  2KLO A;  3LA2 A;  2OZU A;  4E7S A;  3ZQG A;  3DBR B;  4M3E A;  3DBL B;  2ME6 A;  2P5V A;  3ELK A;  2IS6 A;  1I27 A;  2YX4 A;  5LHG A;  4CH7 A;  2WA0 A;  1LKX A;  1HA8 A;  5J1Y A;  2COM A;  2LR8 A;  1D5V A;  2O8K A;  1K79 A;  1MBK A;  4G6D A;  1Z9C A;  3M1E A;  5LHI A;  2KZG A;  2FQ3 A;  1XD7 A;  4F93 B;  1S7O A;  1B8I A;  3K4B A;  2R7X A;  3SEZ A;  2STT A;  3MN2 A;  4LLG F;  1ULY A;  2TDX A;  2ZXW H;  2K3P A;  4F52 A;  1T56 A;  2JRM A;  2V1U A;  3AAF A;  3PQJ A;  2E71 A;  3TQN A;  2JWT A;  5EF6 A;  3TKY A;  1ZG5 A;  1UEL B;  5J40 A;  4HNV A;  2H1L A;  5J8F A;  4CYC B;  3GWZ A;  1HQC A;  2B7E A;  2LG4 A;  3A4C A;  1RR7 A;  2ID6 A;  5BS6 A;  1P4X A;  3CC7 I;  2VKD A;  2ZO4 A;  1RET A;  5DCM A;  1KU7 A;  3IC7 A;  4XLP F;  4YFK F;  1QGP A;  2R7Q A;  5M3F J;  5HLH A;  5HDK A;  2BVM A;  3A0B C;  3DKY A;  2GXA A;  3LQQ A;  2BEO A;  3MKL A;  3ABT A;  4PJJ A;  1UJ8 A;  2CYY A;  4FT8 A;  4HDU A;  2H27 A;  1QVT A;  3BPV A;  4L18 B;  3MKW B;  1IN7 A;  3EYI A;  3BC8 A;  1F43 A;  2ZCW A;  3SJM A;  2DOA A;  4EQQ A;  3HSF A;  1RC9 A;  2ID3 A;  3OIQ A;  5F1R A;  2Q1Z B;  2H8W A;  2DMT A;  3K7A J;  4O6J A;  4XQF A;  5E3O A;  2LD5 A;  2HWV A;  3S14 J;  1BR4 A;  2FNA A;  1L3L A;  3K4J A;  2AXT C;  1AU7 A;  4OIN F;  3S17 J;  4IHT A;  2JVH A;  3CMA I;  3MCZ A;  4PSW A;  3HDD A;  2EV5 A;  1JKO C;  4KDP A;  4UUV A;  3T1B A;  1EKE A;  1UHW A;  1Z6R A;  3ZR8 X;  2IGN A;  4ESJ A;  4C2U A;  2P7C B;  4ZDP A;  1JKP C;  2BE5 F;  4Y13 A;  4BH9 A;  5IT9 Z;  1U0J A;  1XMK A;  1MDM A;  1ZYR F;  4CO8 A;  2V9P A;  2ZME C;  3S2W A;  4ABZ A;  1TC3 C;  3TW6 A;  3OIP A;  5EZG A;  3MWM A;  3LFU A;  3BJA A;  4EGY A;  4BEH A;  4ZYD A;  1FYL A;  4RGX A;  2F4O B;  3MZH A;  1Z6T A;  4L9V A;  2G7H A;  4B4C A;  4XKB A;  4KN7 X;  1REP C;  4WK8 F;  2DFF A;  4GDF A;  2V9V A;  2P81 A;  2BHY A;  4M73 A;  2E1M C;  1YJW I;  4XKC A;  1MJA A;  2HXI A;  3OSG A;  2OUM A;  4I09 A;  1P9Q C;  1TNS A;  4ZTF A;  4OIO F;  4HNU A;  3ESW B;  2HR3 A;  4HPQ A;  1KQ9 A;  1OQY A;  1JUS A;  4UHT A;  3VYU B;  3LNQ A;  1NG6 A;  4U0V A;  1HSJ A;  1MND A;  1S7E A;  2OC6 A;  5CVV A;  3WU1 B;  5JVG F;  2NVU B;  5C4X J;  2CQX A;  3F8M A;  4LIU A;  1GV2 A;  1V5F A;  2FRH A;  1A36 A;  1WJB A;  4F92 B;  1A6I A;  4NNJ A;  1XDU A;  3REO A;  3OYI A;  3QOE A;  2LLK A;  2MSY A;  4HV6 A;  4DOZ A;  3R60 A;  3ASO H;  5CKT A;  1JI8 A;  1U8B A;  1WPK A;  3CF2 A;  5E8I A;  2FD5 A;  2L9S A;  5GTH C;  1DGR M;  4RGR A;  2E2H J;  4S04 A;  4PJL A;  2DOD A;  3OR1 C;  3AL0 C;  2QQ9 A;  3G1O A;  2W48 A;  3IWZ A;  1UHM A;  2IA2 A;  3JSP A;  3FXM A;  2OTL I;  2FSW A;  1YQA A;  2HYF A;  2VON A;  1B72 B;  3DWL E;  1YW7 A;  4Y33 A;  4BBS J;  3DLL F;  4EJV A;  4LIT A;  5EDN A;  5IYB J;  3GME A;  1BR2 A;  2VIX A;  4KNY A;  3ZMD A;  4V2F A;  4RGU A;  3MD2 A;  1LVK A;  4U0W A;  5IYD J;  1I6X A;  1NHA A;  4Q48 A;  5L3E A;  3W6V A;  3WE3 A;  3M8E A;  1ZR4 A;  1YO5 C;  2IGO A;  2ZB9 A;  2ISY A;  3OIO A;  3M8F A;  4P55 A;  1VQ8 I;  1RES A;  1JGG A;  4MGR A;  1J9I A;  4BXF A;  4I0B A;  3B73 A;  3QU6 A;  2I5U A;  1X1A A;  2VQH A;  4OMZ A;  2WY7 Q;  3LOC A;  2NS7 A;  2R7S A;  2KJC A;  2HQN A;  3ZOB A;  2GA1 A;  3CUQ B;  2COB A;  2QKL B;  3OYA A;  5K5R A;  1LDK B;  3RZD J;  2DFI A;  1ZTR A;  5DYM A;  2Y75 A;  2O3F A;  2UZK A;  4HAM A;  3DF8 A;  3PO3 J;  3S32 A;  3TDU C;  4M6V A;  2OJE D;  1XG1 A;  1GHC A;  1OYY A;  3BOQ A;  3QWL A;  2UXN A;  2XDV A;  2MFZ A;  1SEU A;  3AG4 H;  2E36 A;  1YTY A;  1T8I A;  5IT3 A;  1ZRC A;  2LH9 A;  1J7K A;  3WTZ A;  1Z77 A;  5IYC J;  2M1B A;  3N97 A;  2ECC A;  1U6G A;  1W7P A;  2VBY A;  1IJW C;  3CF5 F;  4NUB A;  1SAU A;  1QZE A;  2WV0 A;  3GXO A;  4I2O A;  3BZ6 A;  3OOP A;  2GXG A;  1XGO A;  5TJJ A;  3EUA A;  3PNT A;  4AM3 A;  3LL7 A;  4RLQ A;  3E6M A;  5D6E A;  3ERM A;  2Z33 A;  2DK5 A;  4BBR J;  4AU7 A;  3HRM A;  2IEK A;  5JI6 A;  4HX7 A;  1BC8 C;  4AYB N;  1Y8R B;  2E1M B;  1STZ A;  4A0Y A;  3J7Z I;  3KP5 A;  1G4D A;  4Y52 J;  3NWT A;  4EJU A;  4PUS A;  2VKE A;  3S2D J;  4YIR X;  5J3L A;  1B6A A;  2E2J J;  1OR7 C;  4H4K C;  3U1K A;  3HIF A;  2X1C A;  3HZJ A;  4JOM A;  3WG7 H;  1FOY A;  3K4K A;  3ZGK A;  1POG A;  2DLL A;  1VQL I;  2P6S A;  1E3H A;  2EV6 A;  4E7H A;  3DTE A;  2WB1 N;  1SD5 A;  5H6R A;  3I59 B;  5IP9 J;  4IRH A;  4GXO A;  4E7I A;  1SD6 A;  3ZQF A;  2DMU A;  3CCV I;  2E1O A;  1MMD A;  2JUG A;  2WAE A;  3HB9 A;  3QP6 A;  1KYZ A;  1K4S A;  1HW2 A;  2VB6 A;  4B44 A;  3AFH A;  4RB1 A;  3CME I;  4L9T A;  1IXR C;  1FYK A;  2UXX A;  3GLL A;  4P1W A;  1K6O A;  2HVR A;  2X9D A;  2PJP A;  4HG2 A;  1X1C A;  4LG0 A;  2DJN A;  2DOF A;  3IHU A;  5GPA A;  3SZT A;  5GTI C;  1ZGW A;  2LNB A;  4CZC A;  4B48 A;  3F8C A;  1ERD A;  3BG9 A;  1LPQ A;  3CC2 I;  2B9S A;  3D5R C;  3BR2 A;  1LFU P;  1IN6 A;  4MTD A;  3OS1 A;  4KT5 C;  4EVI A;  2PJR B;  2GLO A;  1OCZ H;  1XPX A;  4Y4R A;  1X2M A;  3CJQ B;  4LMY A;  3T8R A;  3CMY A;  5GAD J;  1Z91 A;  2JT1 A;  5J4V A;  4LK1 F;  3PQK A;  4WWC A;  5BPI A;  2ETH A;  4IX7 A;  2NVT J;  4RB2 C;  4YEJ A;  2FOK A;  1VQO I;  3FXQ A;  1A35 A;  1QZY A;  3CC4 I;  2A68 F;  2L9N A;  5EZH A;  3NAR A;  2R4G A;  2FNP A;  2QUF A;  1FZP B;  5F04 A;  3LWF A;  1D0Y A;  1GXQ A;  4N9I A;  2LBF B;  4G7Z F;  3ROU A;  1YOV B;  3DP7 A;  2NVQ J;  4QWQ A;  5DV5 A;  4U7B A;  4KMF A;  4Y15 A;  1RZ4 A;  4RM3 A;  1MBF A;  3M3Y J;  1H9G A;  3GLX A;  2VKH A;  3BR0 A;  3FK6 A;  3V8K A;  3WOD F;  4ZZL A;  2CMP A;  1A04 A;  1TWG J;  3VYT B;  1N78 A;  3C18 A;  2QBY B;  2ZXI A;  2JA6 J;  2KRF A;  2NS0 A;  1MBG A;  1TQI A;  1D1C A;  3GTJ J;  3WTT C;  3MMY B;  1DPR A;  2QVO A;  5L3G A;  2DPU A;  2X85 A;  4RA2 A;  4U88 A;  4BKX A;  4ENK A;  4FAS D;  1BW5 A;  5LHH A;  1N75 A;  1YS7 A;  3HHG A;  2JVG A;  1HST A;  4Y17 A;  1Q1H A;  2ZJP F;  4BHC A;  1I1S A;  2PG4 A;  3DLA A;  1JT6 A;  3HKZ A;  4BL0 B;  3L2U A;  1X19 A;  1V5G A;  2RC4 A;  2XKO A;  3H9J A;  2QSH X;  3ZQL A;  4LFU A;  2RDP A;  2MLG A;  2PFB A;  3HTU A;  1OCT C;  2DTR A;  5CJ9 A;  2AO9 A;  3ZN0 A;  2ZME A;  2XIG A;  2MGQ A;  4CUG A;  2DTZ A;  4HLY A;  4MEY F;  2QKM B;  5E79 C;  2AQE A;  1P7I A;  3KZY A;  3I4P A;  4C3J J;  2DYR H;  4XKW A;  4A3I J;  1JT0 A;  5TRD A;  2OCE A;  4DBQ A;  1MBH A;  3GVA A;  3CES A;  3HYI A;  1QHH D;  4HNT A;  2XPW A;  4UV9 A;  3COA C;  2Z2S B;  4ZDO A;  4D9J A;  2R7D A;  4XK4 A;  5IPA A;  1SVO A;  1H8A C;  5JLW A;  3R6S A;  3BJ6 A;  1WRJ A;  5F27 A;  4CSW A;  3E6B A;  3GCM A;  1Z05 A;  5HOO A;  3V4G A;  4XSZ F;  4BQA A;  3TP0 A;  1YJN I;  2HXO A;  2EZK A;  3RKW A;  2WTE A;  3VEP A;  4HDV A;  2QA4 I;  5H2F C;  4L5J A;  4FE4 A;  3L2C A;  3CTA A;  1UG2 A;  2J5O A;  3I3L A;  2ZKZ A;  5J6X A;  1TWA J;  3RQ4 A;  2DOE A;  4HQE A;  1MIJ A;  1Y56 A;  3QAH A;  5A2Q Z;  3WTS C;  4DNC A;  1ORK A;  2LRD A;  3F9K A;  2VBW A;  2X1E A;  1ZHF A;  5BNG A;  3QYF A;  3GO5 A;  4Q4Z F;  4C2M J;  1H9T A;  1C0W A;  4R79 A;  3JRB A;  1ZAO A;  4PJ0 C;  1LNW A;  1FSE A;  2I8D A;  5ILU A;  5F1J A;  1S7A A;  2XAH A;  2FJ1 A;  4C9Y A;  3LST A;  1I3Q J;  5FKO A;  4C3I J;  1YLF A;  3J80 Z;  4UUT A;  4ESB A;  3LSJ A;  2XPV A;  1WJD A;  4KA4 A;  1WVR A;  1VQ6 I;  3HBL A;  2M4G A;  5ED4 A;  3K10 A;  4IEJ A;  2W57 A;  4LG3 A;  2V9K A;  1JJ8 C;  4K2E A;  3TW7 A;  1YYV A;  2HZD A;  2VUM J;  2NNY A;  2O6G E;  4XMY A;  3BG3 A;  5LFA A;  3C2H A;  2JSP A;  3A02 A;  2HDC A;  2JK3 A;  1LUJ B;  2O03 A;  2X6W A;  2V26 A;  2KHM A;  3SDB A;  2LRE A;  2E2I J;  1BJA A;  1UCR A;  3L2V A;  3BQY A;  1Y1V J;  2L7F P;  3OYF A;  5HOD A;  2LKS A;  1Z0X A;  4HQM A;  3W2V A;  3KP4 A;  3HUG A;  3HXL A;  3PUF A;  5JFR A;  2V1D A;  3FMS A;  1RKT A;  3QPS A;  3ML6 A;  4U0Y A;  3OSF A;  1Z67 A;  4E7J A;  2JUC A;  4IHV A;  1V54 H;  4CCK A;  3CJT B;  3HSE A;  1GV5 A;  3P5J A;  2Y9Y A;  2H94 A;  5D5X B;  1F5T A;  3L9F A;  2TCT A;  4KMU X;  3Q9V A;  1D8J A;  4GRI A;  4RMN A;  2YU9 J;  2QCO A;  5CYV A;  3X2Q H;  2QLZ A;  1O3T A;  1HW5 A;  2KIM A;  3F72 A;  3RSN A;  3O2P E;  4A3C J;  3HOV J;  3Q0U A;  1IUF A;  3NEU A;  3DXJ F;  5HS8 A;  3JRD A;  5A2Q K;  4IHY A;  2HGC A;  4ZZD A;  1CGP A;  3A03 A;  2XPU A;  3CJR B;  1OLT A;  2X6X A;  4XLN F;  2BV6 A;  2CUF A;  4DYC A;  1HKQ A;  4MFE A;  1TW3 A;  1OCP A;  1V3F A;  3PIP F;  2Q2E B;  4PGH A;  2JMW A;  2JJ7 A;  2HTJ A;  3E7L A;  3ZQ7 A;  3IAM 2;  2RNJ A;  3K0L A;  3L1P A;  1XS9 A;  1RUN A;  1ACI A;  4L9N A;  3N05 A;  2EFP A;  3KX2 A;  3P9I A;  1F4K A;  1YIJ I;  1ZG3 A;  4U7D A;  1VFC A;  1ZRF A;  1R23 A;  2NS8 A;  2XUB A;  4UB8 C;  3LFK A;  3Q0W A;  1AHD P;  1S29 A;  3E97 A;  3CDH A;  2PQ8 A;  1PJR A;  2KP6 A;  3KEO A;  2IS2 A;  1OR7 A;  2IA0 A;  3FHN A;  3DPL C;  3V8L A;  4LD5 A;  1R4M B;  1ZLJ A;  2LY2 A;  5J1U A;  2FF4 A;  3ZRG A;  2AQF A;  1XMA A;  2RNG A;  4E70 A;  1QVU A;  2EFO A;  2A5Y B;  4J00 A;  1E3P A;  2RRE A;  4OIR F;  3KP7 A;  1RNL A;  4AUX A;  4NB5 A;  2DT5 A;  3BCA A;  3TL4 X;  4V19 K;  1WGX A;  1ZKG A;  4FET A;  2WC2 A;  2MG4 A;  3ZQH A;  2QSG X;  3GTP J;  1AOY A;  3JRA A;  1ZEL A;  2UWM A;  3CCY A;  2CFO A;  3ECO A;  4KYW A;  4NC7 A;  5EG0 B;  3PM1 A;  4H0E A;  4IQ4 A;  3ZXS A;  5AIQ A;  4QPO A;  2DA3 A;  4HOB A;  4UVB A;  5IP7 J;  3JAM Z;  4II3 A;  3OV8 A;  2BZT A;  4G6Q A;  1PUE E;  3K69 A;  3K4M A;  4M71 A;  2FMY A;  5LRR A;  2X48 A;  2E60 A;  5B3S H;  4A3M J;  2JA5 J;  4A3D J;  4N4O B;  4PJM A;  5HS9 A;  4L5I A;  5FLX Z;  2E5N A;  1WJ5 A;  3LQR A;  4WF2 A;  4P5O A;  3NQO A;  4UV8 A;  2R7O A;  1FIA A;  4MTE A;  3KZI C;  4AD9 A;  1DU0 A;  3KEY A;  3PFI A;  1YX5 A;  4XOT A;  2HDW A;  3JRG A;  1TWH J;  2R7F A;  3DKX A;  4FX0 A;  3A2K A;  3IKT A;  1G3T A;  4QTR A;  4PK4 A;  3HPH A;  1LB2 A;  2QYO A;  4C3H J;  2RQQ A;  2JRT A;  3KYC B;  2BBY A;  4B47 A;  3E3V A;  1QPM A;  4IQJ A;  2VN2 A;  2XRN A;  2R5Y B;  4BQN A;  4M3D A;  2HQ5 A;  2ZSH B;  4RGS A;  2QWW A;  1AKH A;  3CJS B;  2FML A;  2TRT A;  4EM1 A;  2IT0 A;  1X1P A;  1XCB A;  3BR6 A;  2CU7 A;  5D6F A;  2IXS A;  1R1T A;  3VOD A;  3E1S A;  4P9U A;  2IVM A;  3OYD A;  3K6G A;  2K9L A;  2XAF A;  4WXC A;  1CF7 A;  4HYE A;  3SYT A;  2VLA A;  3OL4 A;  4BUP A;  5CQG A;  2HPM A;  4A3J J;  1R58 A;  4I6Z A;  5IY5 H;  2DA6 A;  5FD6 A;  4HF0 A;  3CZ6 A;  1LE8 B;  4BDY A;  4CCO A;  2NOG A;  2DT6 A;  5K5Q A;  4GCV A;  3GZ6 A;  3N4M A;  2OD5 A;  1R7J A;  3HOT A;  1WJE A;  2PMU A;  1SAN A;  2NRA C;  3VFZ A;  2HEO A;  4JK1 X;  2GWR A;  3OYG A;  1KZH A;  2L02 A;  2Y0S N;  1SC7 A;  2PI0 A;  2FUG 2;  3CUQ C;  2FBH A;  5DDG A;  4UUS A;  1GUU A;  1FNN A;  2DW4 A;  2GIV A;  3BT9 A;  2ISZ A;  5FLM J;  3O3K A;  3WG9 A;  2WAF A;  3QU3 A;  2K85 A;  4TV7 A;  1RIO H;  4PSX A;  1T38 A;  3E6D A;  1Y8Q B;  3W2W A;  4KIF A;  2ELJ A;  2CG4 A;  2V6C A;  4PZJ A;  2R7V A;  2HDD A;  1P4A A;  5FRM A;  1D1B A;  2LK2 A;  4E7Z A;  1NTC A;  4F55 A;  4XM3 A;  1BBY A;  2BW3 B;  3FKJ A;  2M9H A;  4HEA 2;  3PL8 A;  2E1C A;  3JRE A;  1WI3 A;  3OYB A;  2RGV A;  4HA8 A;  3S1Q J;  1QRY A;  3HEF A;  2DA2 A;  1OJL A;  3DKW A;  4G6T B;  4BU2 A;  4AID A;  2BYV E;  1FMV A;  2DFH A;  1I50 J;  2Z5U A;  3FXR A;  2XAQ A;  2DDB A;  2OU2 A;  1RR8 C;  4LGW A;  5D4S A;  3KYD B;  3TOB A;  3AKZ A;  2L0K A;  2V6E A;  2LF7 A;  2MLK A;  1EA3 A;  2XF7 A;  3BG5 A;  3FXK A;  4D5F A;  3TMO A;  2GAU A;  4F7Z A;  5GAE J;  1U2W A;  4EAT A;  4HSR A;  3HOY J;  1E2X A;  1VQ4 I;  3HC7 A;  5LRS A;  1GVJ A;  2MAB A;  2LVS A;  3W6J B;  1VQ7 I;  4ZDL A;  4DYR A;  4M3B A;  1TWF J;  1TL8 A;  3CLQ A;  1YIT I;  3B6C A;  3DEU A;  1XC5 A;  4Z2Y A;  3OS0 A;  2HVQ A;  3E6C C;  4XLE A;  3JSO A;  4LIV A;  3WTX C;  1HOM A;  3TGN A;  2XHK A;  1A5J A;  4DZJ A;  2MC4 A;  2ZFU A;  4NC6 A;  3SDG A;  3L00 A;  3GFM A;  3AG2 H;  1QPI A;  3S15 J;  2D1H A;  4HBL A;  2ZSI B;  3F0C A;  4ENN A;  3RI4 A;  1HBX G;  5D4R A;  1I5Z A;  4PJN A;  2ZC2 A;  1B1B A;  2WAQ N;  4CZZ A;  3V42 A;  3BZK A;  2EIL H;  5LGN A;  1VTN C;  4LB5 A;  1P92 A;  1MSF C;  3JR9 A;  4N0B A;  1PYV A;  3A01 B;  1R4N B;  1DUX C;  3OR2 C;  3QOD A;  2JA8 J;  3OYK A;  3L2W A;  4HX8 A;  3WTU C;  2GOX B;  2CQK A;  1MSE C;  4BE1 A;  3MVP A;  2HVS A;  1USS A;  1HXD A;  3FIS A;  4W1U A;  3G71 I;  1W0T A;  1O3S A;  1LVA A;  2PEX A;  4DBR A;  3K1P A;  3CCS I;  1IGN A;  3F8N A;  5IT9 K;  1YW8 A;  3IAS 2;  3DBH B;  1T39 A;  1X2N A;  5CQE A;  3ZPL A;  2LKP A;  4CYC A;  1W36 D;  2BXY A;  3W3C A;  1WCM J;  4II2 A;  3Q5F A;  2EWN A;  5CVU A;  2DA7 A;  4DZP A;  1RI7 A;  2IPQ X;  2B63 J;  2DA4 A;  5TIS C;  2DYS H;  1U9O A;  1ON2 A;  4M3F A;  3OY9 A;  1OCC H;  5F64 A;  3VSL A;  4AIH A;  1V4R A;  1ETW A;  4I01 A;  1T2K A;  4FTH A;  1ZRE A;  2VKV A;  3KYL A;  3ZMS A;  5E1Z B;  1IV8 A;  2XGC A;  4ZYA A;  1VQP I;  5GAG J;  2NOJ B;  2BHZ A;  3GF2 A;  2X1D A;  2XGX A;  2VJ4 A;  4I7H A;  5F0F A;  2KIS A;  2VJJ A;  4CA0 A;  1BIA A;  2A6E F;  3KZZ A;  3GTL J;  1G8X A;  4M9X A;  2VOO A;  2CH0 A;  3AG3 H;  3U2R A;  5HS7 A;  1XDS A;  2JTV A;  2Z9O A;  4DGW B;  1ETY A;  1KU9 A;  2YU3 A;  1A6Q A;  2E34 A;  4LLN A;  2XGD A;  4BS9 A;  4FIS A;  2KQR A;  3H0G J;  3ZMV A;  2LC2 A;  4IHW A;  5CPR B;  3HM5 A;  2XKP A;  2OPT A;  4XN0 A;  2IW5 A;  5CLS A;  4B3X A;  5FKN A;  2DAO A;  5L3F A;  3KP6 A;  2CUE A;  4BQQ A;  3GFI A;  3HOZ J;  1VND A;  3HSR A;  2VC0 A;  3LA7 A;  2PBI A;  1I3A A;  3G73 A;  1JHH A;  1MMN A;  1R1U A;  3FBN B;  2NVY J;  2OA4 A;  2KKO A;  2XB5 A;  2B0L A;  3DU5 A;  1IF1 A;  2KIU A;  1WSU A;  1D0X A;  1Y0U A;  2OQR A;  3MAJ A;  4RB0 A;  3PNV A;  5E8G A;  5AON A;  4KIS A;  3RPU D;  3OWT A;  1K78 B;  3MZY A;  3RIR A;  1MMG A;  2PN6 A;  2QEN A;  3GZ5 A;  2E7W A;  3H5A A;  5F0C A;  4N4N B;  4M9S A;  3C7J A;  2K4B A;  1W5S A;  2VPR A;  3K4C A;  3H3U A;  3H92 A;  4XLA A;  3S1R J;  4ZYG A;  2CSO A;  4F91 B;  5DM7 F;  1ETV A;  1W4M A;  5CVI A;  2HOT A;  1GT0 C;  1X4P A;  1O3R A;  3M7G A;  3RYR A;  1BIB A;  2OV7 A;  1GLN A;  4AC0 A;  1YS6 A;  1VQN I;  5HLT A;  2QEX I;  4J01 A;  1U8R A;  2N8G A;  3R0J A;  4N9H A;  2LP0 A;  2H6B A;  4A5M A;  5TGT A;  3RDI A;  3PUB A;  4UVA A;  4FCY A;  1BL0 A;  4CIC A;  4KIB A;  2VE9 A;  3R4K A;  1VQM I;  1FPQ A;  4AYB A;  2VI6 A;  3RKY A;  4QIW N;  1GXP A;  1U5T B;  1XSV A;  1ETX A;  2VE8 A;  2V79 A;  3LSI A;  3I64 A;  1JUM A;  1B72 A;  3H5N A;  2LYC A;  1RUO A;  2QZ8 A;  1WQ2 A;  4PCQ A;  5F0H A;  4YIF A;  3HTS B;  2A6H F;  3ABL H;  3OYN A;  4IHS A;  3OS2 A;  4MO7 A;  4ANJ A;  3VPR A;  2L9R A;  3CCM I;  2DFE A;  1Y6I A;  5L3D A;  1XGM A;  3BY6 A;  4Z6Y A;  1GDT A;  5EJC A;  2WB1 A;  2E35 A;  2K7L A;  1WH5 A;  5FJ8 J;  5EEA A;  5FRO A;  4BY7 J;  4FE7 A;  4OMY A;  3FMQ A;  2ECB A;  2CQQ A;  3BWG A;  2MYS A;  4I02 A;  3SEQ A;  3HRU A;  4BQO A;  3BJO A;  1W36 C;  4G8X A;  1J59 A;  4LOC A;  4A93 J;  2M8G X;  4ETS A;  1V55 H;  4RBO A;  2F4I A;  3BDD A;  5GP9 A;  2XVC A;  2F48 A;  3MFK A;  4XON A;  2EA2 A;  3OYC A;  2HOA A;  3SXY A;  2DDA A;  4BNC A;  2YR2 A;  4BY1 J;  3CUQ A;  2MC3 A;  3OMY A;  3BTI A;  3TO6 A;  2HNH A;  2CW0 F;  3CQZ J;  4RAF A;  2K9S A;  3M4O J;  2J5P A;  5C3E J;  1IN4 A;  2V7F A;  1OPC A;  3H35 A;  3EET A;  5D5V B;  2F5F A;  3WU2 C;  3H36 A;  2I10 A;  5E1W A;  3I53 A;  1YIO A;  4ITV A;  4AVZ A;  5JVT A;  2XSD C;  4JP0 A;  3ABK H;  3AG1 H;  2YX7 A;  3HOX J;  3F22 A;  3EPZ A;  5ICG A;  4OU0 A;  4OWR B;  1JTY A;  3M07 A;  5HNF A;  2CV1 A;  4NDL A;  3HRT A;  2W85 A;  5LGU A;  2EZH A;  4E4H A;  2PLY A;  2QF7 A;  3DTI A;  4IZZ A;  1YI2 I;  4LK0 F;  1P6R A;  3KE2 A;  4ENM A;  2V1X A;  1RPW A;  5E1X A;  3KIO A;  5J1R A;  1SFU A;  1J0R A;  3S2H J;  1HW1 A;  4PGG A;  2O9L A;  2BY3 A;  4MLO A;  4XSX F;  3I9V 2;  3CCL I;  1BI2 A;  1QA6 A;  2KT0 A;  1T98 A;  3IWF A;  1FWZ A;  4CCN A;  2QGU A;  2QM3 A;  2VL8 A;  2MBF A;  1FOX A;  1X58 A;  4IO9 F;  5B1B H;  1SFO J;  1D8K A;  2K86 A;  5CVJ A;  3K2Z A;  2L2O A;  1ZLK A;  1XB4 A;  1OCO H;  4YFX F;  1MNE A;  1IN8 A;  3GBG A;  3S1M J;  2ADU A;  4HV5 A;  4MQV A;  5EEH A;  4R8H A;  3CP2 A;  4CCJ A;  1PP8 F;  1IN5 A;  3WGI A;  1PUF B;  5HLI A;  4XRM A;  2Y48 A;  1FEX A;  1FBQ A;  3C2G A;  5D5W B;  3BR1 A;  3FBI B;  3I59 A;  4ZTJ A;  5E3M A;  1FYM A;  1JXS A;  2ZXH A;  1VF9 A;  1PVE A;  2G0E A;  2KRH A;  4NQW B;  5F08 A;  2O61 A;  2O5R A;  4BXX J;  2F5V A;  1Y39 A;  3LMM A;  1MBE A;  1AA7 A;  1LDD A;  1Z3Y A;  2JA2 A;  3ASN H;  4IL6 C;  4BJ6 C;  5FKK A;  4IKF A;  3P9C A;  2GXB A;  1IXS B;  2R7Z J;  1FBU A;  1FMW A;  5KHD A;  1BA5 A;  2PX9 A;  2LF8 A;  2KRC A;  1FTT A;  3EGV B;  2WWY A;  2CGP A;  2NNN A;  3E5X A;  2DMQ A;  2Y2Z A;  2VJ5 A;  4GGG A;  4W97 A;  4NHJ A;  2W00 A;  4KJZ A;  1BOA A;  4Y3O A;  2A07 F;  1X3W B;  2ZNY A;  3F23 A;  1MH4 A;  3HOU J;  1WZ2 A;  3ONQ A;  4DJA A;  5J4Y A;  2C6Y A;  2PJR A;  2R7T A;  1IRG A;  3UR3 C;  3FF5 A;  2ESH A;  2EQR A;  1LJ9 A;  1G3W A;  2EFQ A;  4S0H B;  4G9Y A;  2OQG A;  4BDZ A;  5EGO B;  1NK2 P;  1LDJ A;  3VOE A;  4PFO A;  3IKV A;  4E6K G;  3CMM A;  3CD6 I;  2HKX A;  1IDY A;  1P2F A;  4G94 A;  2E5Z A;  4M3G A;  2CS3 A;  4B09 A;  5J47 A;  5EYR A;  2MD0 A;  3O8G A;  1AWC A;  2JQ7 A;  3HOW J;  2LTP A;  3Q9S A;  4M6X A;  2LBF A;  3E5Q A;  4XIC A;  3JRH A;  3LAP A;  5BPD A;  5DCF A;  4WXD A;  2L9V A;  2VC1 A;  4JX4 A;  2KPM A;  3G2B A;  4UVC A;  1JE8 A;  1O7L A;  1ZG1 A;  4EM0 B;  3DU6 A;  4XOP A;  1MJB A;  5IOY A;  3F8B A;  1MMA A;  2ZFW A;  3TO9 A;  2QBY A;  3VWB A;  4KIG A;  1EH8 A;  1R5G A;  5B1A H;  2A5W A;  3GFJ A;  2MA3 A;  4D1Q A;  2BOL A;  5M5X J;  1UHS A;  5DUK A;  4WCG A;  2DMN A;  5FLV A;  1Y0N A;  4ENJ A;  1OYI A;  3BR3 A;  4YII A;  2PMZ A;  3GYH X;  3S93 A;  2BY0 A;  1BI1 A;  3Q3S A;  1B8I B;  2K9M A;  3F6O A;  1DU6 A;  4U87 A;  2M87 A;  3EUH C;  2VT3 A;  2LMD A;  2FX0 A;  1D5Y A;  1SMY F;  4UB6 C;  4DQ2 A;  3KCC A;  1B9M A;  1OCR H;  2M5W A;  4M9Z A;  2KIQ A;  3TP3 A;  4ZH4 F;  2JA7 J;  2NVX J;  4HZF A;  4E7L A;  5JHU A;  2YPR A;  3QYB A;  1U78 A;  1E0E A;  3ZCO A;  5ICE A;  2O0Y A;  4D0P A;  4X0G A;  1MKM A;  1DQU A;  3F8F A;  3VB2 A;  5HDG A;  4BAY A;  5DCM B;  2LDU A;  3J80 K;  2L54 A;  1G59 A;  5FD5 A;  4GFB A;  2W25 A;  4JQF A;  1SFK A;  2DJI A;  2Z99 A;  1TTY A;  3WHC A;  4A6E A;  3QYE A;  3ERE D;  1IRF A;  3ABM H;  3WE2 A;  3VDX A;  1WI9 A;  4J19 A;  3OYM A;  1A31 A;  1DGW Y;  2ZBK A;  4MNU A;  2HQA A;  2AHQ A;  3ZP5 A;  5LBQ A;  3IV5 A;  4CHU A;  4CGZ A;  2ZXJ A;  4MEX F;  1ZH5 A;  3FMR A;  5L3C A;  2R7U A;  5GPC A;  6PAX A;  2LY1 A;  2WY8 Q;  4NQW A;  1S8N A;  1ZQ3 P;  4B8X A;  1K83 J;  4AWX B;  4AVP A;  5FFZ A;  3L2Q A;  2K9Q A;  4L5E A;  2NYX A;  1IO2 A;  3WTY C;  1DDN A;  1T33 A;  4YEL A;  4YG2 F;  1T0F C;  2W7N A;  2JPB A;  3SHF A;  1QHG A;  3L7W A;  2F2E A;  4A12 A;  1MDM B;  3BP8 A;  1EH6 A;  3RQI A;  2IGK A;  1ZRD A;  2HPI A;  4C2T A;  2OF7 A;  3MKZ A;  3PIO F;  4L0Y B;  4A5N A;  4BEH B;  4I99 C;  2QSF X;  3S1N J;  1R5I D;  3GTG J;  3P7N A;  5KK1 A;  3S16 J;  3DEW A;  3IH2 A;  2DU9 A;  5HNH A;  2ICW G;  5B5E C;  2CW8 A;  3ZMZ A;  3ZQI A;  3I4M J;  2X51 A;  1TW2 A;  3BTC A;  5EGO A;  3BTJ A;  4RDU A;  3I0T A;  2RQP A;  3KEQ A;  4OIQ F;  3KET A;  1BI3 A;  3B6A A;  1F36 A;  1TNT A;  4V2G A;  2IBD A;  3DCF A;  4MHG A;  4X6A J;  3ABU A;  4RS8 A;  3BCB A;  4MIM A;  4B1R A;  3EUK L;  2X4H A;  3FXU A;  2CWE A;  1MNM C;  2NXN B;  2K4J A;  4RB3 C;  1BI0 A;  2KMU A;  1J5Y A;  4ZYH A;  1QU3 A;  3OYE A;  1HKT A;  1YRN B;  1XSD A;  1K6Y A;  3FZV A;  3HOS A;  2K5C A;  2EIK H;  3HGG A;  2VBX A;  2OTJ I;  3ZMT A;  5LEK A;  2HI3 A;  3ZMU A;  2EIJ H;  2L01 A;  2BY2 A;  2ELH A;  1X3U A;  3JTG A;  4FX4 A;  1FC3 A;  3CCJ I;  5FRN A;  1Z3X A;  1QNT A;  3ZQC A;  1TQP A;  3KLN A;  2IS1 A;  1OFC X;  4IF4 A;  2VAS A;  2R5Z B;  1I6H J;  4BJ5 C;  1N25 A;  5GAH J;  3K2A A;  4CCM A;  5EEG A;  4S05 A;  2Q0O A;  5ICC A;  1JGS A;  2ESN A;  1ENH A;  2NAZ A;  4BYY A;  1VQ9 I;  2Q2E A;  3RKQ A;  3WTW C;  1M1E B;  2E7X A;  1JKR C;  2DCE A;  3PSI A;  2XAS A;  3JAM K;  2RV8 A;  3UKG A;  1SD4 A;  4O3M A;  4QLC U;  5D5U B;  1D1A A;  4I98 B;  2VPL A;  5FLX K;  1BJZ A;  2FBK A;  1BR1 A;  1FT9 A;  1R6R A;  2DQR A;  2IS4 A;  3K9T A;  3RPU A;  1FY7 A;  3HPG A;  3FWE A;  1KGS A;  5FFX A;  1OIS A;  2KDZ A;  1R49 A;  4XRF A;  1Z1D A;  4JX6 A;  2IA1 A;  1UST A;  3RZO J;  2EA4 A;  4CXF A;  4ESF A;  2CJJ A;  2L4A A;  3J7A Y;  3KP3 A;  2VOP A;  5DUI A;  2GQQ A;  4L0Z B;  3GFL A;  3VYR B;  2EFW A;  2RVC A;  3LAJ A;  3HGY A;  3FIW A;  5HVQ C;  1W5T A;  1K61 A;  1TWC J;  3DFG A;  3DPU A;  1TT0 A;  3FXJ A;  4ZJZ A;  2E19 A;  4UY8 I;  2CFX A;  3Q0V A;  3GTM J;  2EZI A;  3U9G A;  1NH3 A;  4RAY A;  2Y0S A;  4D5C A;  3PSF A;  3D1N I;  1T95 A;  5C44 J;  1W7P B;  1Z7L A;  4A0Z A;  5EG0 A;  1FTZ A;  2MH9 A;  2QQB A;  3J81 Z;  3G1L A;  1ONV A;  2WV1 A;  3G1M A;  2F4M B;  3LA3 A;  2FBI A;  5JHF A;  2DO7 A;  2XF6 A;  1KON A;  2VOD A;  4EM2 A;  2CQ7 A;  2M30 A;  2CO5 A;  3G6E I;  2EZL A;  5KAI C;  5KCM A;  1WWX A;  3WGH A;  4A3G J;  3PFY A;  1DPU A;  3MEX A;  4O5V A;  4BHB A;  4X1E A;  3BTL A;  5E17 F;  1WKM A;  1ZR2 A;  1YG2 A;  1G3Y A;  3S8P A;  3K4L A;  1KQ8 A;  1WJF A;  3WTV C;  1G2H A;  1JJ6 C;  3HJE A;  2Z1D A;  2FA5 A;  1TBX A;  5C4J J;  2XAJ A;  2W4S A;  2RKH A;  3C3W A;  3SQN A;  1X4O A;  2GBY A;  4EMS A;  1LQ1 A;  1ITY A;  2R5Y A;  1FLI A;  3O6B B;  3QRF F;  1IXC A;  1R71 A;  1WIB A;  2HTS A;  3S3M A;  4I0A A;  4DIQ A;  1U5T C;  1UMQ A;  2FXA A;  4IPA A;  4QPQ A;  2DBB A;  5DS9 A;  1X3Z B;  3C1D A;  1YRN A;  4BAC A;  2P5K A;  3PJR A;  4XR6 A;  4B43 A;  4DW6 A;  3BZC A;  4Q5S F;  1KQ0 A;  4KT6 A;  4LJZ F;  1Y1W J; 
#chains in the Genus database with same CATH homology
 1VQP I;  3EGV B;  5GAG J;  5JVG F;  2ZJP F;  3J7Z I;  2E34 A;  3CCU I;  5GAE J;  1VQ4 I;  3CD6 I;  2FOW A;  3CJT B;  2JQ7 A;  3CCQ I;  1VQ7 I;  1FOY A;  3G4S I;  1VQL I;  4IOA F;  1YIT I;  3PIO F;  1YJ9 I;  1FOW A;  1VQK I;  3CC7 I;  4UY8 I;  2OTL I;  3CJS B;  2K3F A;  3DLL F;  2ZJQ F;  3CCV I;  2ZJR F;  3CJR B;  3CME I;  3PIP F;  1YI2 I;  5DM6 F;  1YJN I;  5DM7 F;  1VQ8 I;  1ACI A;  3G6E I;  2QA4 I;  2H8W A;  3CCR I;  3CC2 I;  1YIJ I;  1VQN I;  2NXN B;  2QEX I;  3CCL I;  3CJQ B;  3CMA I;  1S72 I;  1MMS A;  5GAD J;  1QA6 A;  3G71 I;  1FOX A;  3I56 I;  4IO9 F;  1VQO I;  2OTJ I;  4IOC F;  3CCS I;  3CC4 I;  3CCE I;  3J7Y J;  1VQM I;  3CCJ I;  1YHQ I;  1WIB A;  2E36 A;  1HC8 A;  4V19 K;  3I55 I;  1VQ6 I;  5GAH J;  1Y39 A;  1VQ5 I;  3CCM I;  1YJW I;  3CF5 F;  1VQ9 I;  2E35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...