2ZJPF

Thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
144
Chain Sequence
MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
total genus 17
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjpF02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2zjpF01
1VQNI 1VQKI 3CMAI 1YHQI 3G4SI 3CCEI 1VQ9I 3CF5F 3G71I 3CJSB 1VQMI 3PIOF 1YJ9I 2QEXI 3PIPF 3CCJI 3CCSI 3J7YJ 2OTLI 3CD6I 1VQ6I 3J7ZI 2E34A 3CC2I 3CCQI 5GAGJ 4V19K 4UY8I 5GADJ 3CCMI 2QA4I 3CJQB 3CMEI 1QA6A 2E36A 2OTJI 3CC7I 1VQOI 2NXNB 2JQ7A 1VQ4I 1VQLI 1YIJI 1YITI 1FOWA 3I55I 3CCLI 5DM7F 5JVGF 1FOXA 3CJTB 3CC4I 1FOYA 2ZJQF 1S72I 3CCVI 2ZJRF 3EGVB 1YJWI 1MMSA 3DLLF 4IOCF 1HC8A 1WIBA 1ACIA 2K3FA 2ZJPF 1YJNI 3I56I 4IO9F 2E35A 5DM6F 1VQ5I 3CCUI 1VQ7I 1YI2I 3CCRI 5GAHJ 4IOAF 1VQPI 2H8WA 1VQ8I 2FOWA 1Y39A 5GAEJ 3G6EI 3CJRB
chains in the Genus database with same CATH superfamily
2KMUA 1VQNI 1FTTA 2F2EA 1LB2A 2KRHA 2GA2A 3OYNA 1O3QA 2HOTA 3OYEA 1MBJA 2M7AA 1PDNC 2ADUA 2DPUA 1ETXA 5BMZA 4IL6C 4EJVA 3D5RC 3RYRA 1YJ9I 3S2HJ 2D2WA 5BNGA 3JRAA 2K4BA 3ROUA 1MMDA 4DGWB 3M9AA 4LGWA 3SZTA 4MNUA 4HF1A 5KAFC 5FGMA 5GAGJ 4O6JA 3VEPA 2LLKA 5IT3A 1W5SA 5FLMJ 1ZQ3P 2DMQA 1K79A 3IH4A 2KLOA 4ZJZA 4RB0A 1Q1HA 5CVRA 1O7LA 2YU3A 2KJCA 3QOEA 4G7ZF 5FFXA 3AG3H 1W7PB 3D5SC 3KLNA 3KETA 2P5LC 2XSDC 1MDMA 5GTIC 1RKWA 2KIMA 1TWAJ 2R7UA 1FTZA 3EDPA 2LKSA 3IV5A 3RPUA 3IWFA 3M4OJ 1V5EA 4C2MJ 3VYSB 4BQNA 2E19A 3QYFA 2HGCA 1K83J 2VIXA 1PVEA 4D9JA 1G2HA 3IRQA 1TL8A 1M1EB 3KP4A 3FIWA 2G9WA 3EUHC 4M3BA 4MEXF 1RI7A 5L3CA 3MFKA 3DV8A 5FKLA 4GO1A 3E6CC 2R5ZB 4BQAA 3HOWJ 3J81Z 1R4MB 2ELKA 3I4PA 3VODA 1P92A 4QPQA 4G6DA 2P0WA 2BZTA 3RYPA 2Y48A 4IHTA 4YELA 1KYZA 4MQ9F 1RETA 4OIQF 2DOFA 1OCPA 2IA2A 3K4CA 1APLC 4M74A 4LK0F 2FBIA 5LRRA 1PYVA 1D8KA 2M8GX 5K7HA 1J2XA 3L2VA 3M8EA 2W25A 3MKWB 1FIAA 3KZIC 5LRSA 3BR5A 1U5TB 5K5QA 2Z99A 4I2OA 5EDNA 3S32A 2EZKA 3DBRB 3RDIA 1IXSB 2FMYA 5LHGA 2MABA 1DGWY 1O57A 1OR7A 3FKIJ 3LQQA 5TRDA 2ZBKA 2A05A 4UB8C 2UUZA 3BP8A 2W24A 2O61A 2OF7A 3G4SI 2E1MB 3S1NJ 2PJRA 1SD7A 2VI6A 4MFEA 3BJAA 2E5ZA 1HKTA 2NS7A 4Q4ZF 4I02A 2K4JA 4A3IJ 2VQCA 1W0TA 1U6GA 2Y30A 5B1AH 3BR2A 2WA0A 3QQAA 4YEJA 1HF0A 2FXAA 4XOTA 3M3YJ 3WTYC 1UG2A 2EZHA 5D5VB 2X6OA 2H1LA 3HC7A 3OR1C 4ZZLA 4A3DJ 1F5TA 2VBZA 4EJUA 2L9RA 1A35A 5J1YA 2EIMH 1WQ2A 3TMOA 2JT1A 3HIFA 1U8BA 2PJRB 3MZYA 3VFZA 4WXCA 1FSHA 4HA8A 3SFIA 4L0YB 4UV9A 3JRGA 1PJRA 2RQQA 2ZXHA 2K5CA 1I6HJ 5K1YA 1X4PA 4NC8A 4ZYDA 4Y17A 4F55A 3CMYA 3BTJA 1IJWC 4GYIA 3ABLH 2MYSA 5FKMA 1MKMA 3IKVA 3PFYA 5F08A 4E70A 3CDLA 4HW0A 1HW5A 3TW7A 2D1HA 2EFNA 4HLXA 2VQLA 4FASD 2BVLA 1V5FA 5CLSA 2BHZA 1OPCA 4N0BA 1H9GA 3I4MJ 3GFLA 2ISZA 4B48A 1G3SA 3LAJA 3CP8A 3HL2A 2W48A 1IXCA 4Y52J 3CDIA 4D1QA 3MCZA 2IT0A 2CS3A 1GUUA 2M3AA 3ZQGA 1SD4A 2MSYA 4BJ6C 1R36A 2P4WA 4QWQA 3A1YA 1J09A 3R4KA 2B7EA 4QTRA 1DP3A 4Q5SF 2JVGA 5J4VA 4BL0B 4O3MA 1IC8A 2BGCA 2CUZA 1FBQA 2W4SA 4ZTJA 3A01B 5BPDA 3GZNB 2BY2A 2Y9YA 1U5TC 1X1DA 4E7JA 1JXSA 3O8GA 4M3EA 4R1HA 5HDNA 2PI0A 4HBLA 1WSUA 1TWGJ 2OA4A 2WY7Q 3WTZA 4DIQA 2VBWA 1K61A 3C1DA 1RR8C 3VOEA 3SEQA 2E1MC 2KISA 3ZQ7A 3GFMA 2CV0A 3LSHA 1Z67A 1WRJA 1FP2A 3ASOH 3B6AA 4P9FA 4YIIA 1PUFA 1YIOA 1VQ8I 3KPHA 2WC2A 3S1QJ 4B3XA 4J00A 3ELKA 3DPUA 4PZJA 1FYKA 4LG0B 3S16J 3VSKA 3KP5A 2V9VA 1YHQI 2E1CA 2FD5A 2XB0X 3W3CA 1FMWA 2JPCA 1MMNA 4RGUA 1N75A 2LYCA 1MMAA 3TQNA 1CF7A 2XGDA 1ZLJA 2CMPA 1P4XA 3L7WA 5E1WA 1HKQA 2V1NA 3HRTA 3LA7A 5F0HA 3S2DJ 1PUFB 2JK3A 3DTEA 4W97A 2OD5A 3V8LA 1BW5A 1WCMJ 2KIUA 2FSWA 4BE2A 3BG6A 3HUGA 3M07A 3KLOA 2CJJA 4V2GA 2H1KA 3L2UA 2K40A 4XNFA 1O3SA 2JA5J 1LFBA 1G3TA 4AYBN 2KPMA 3LSMA 4U7DA 3S17J 2NS0A 2MBFA 1W36C 4P1WA 2W57A 3MKLA 4M6XA 3IAS2 2OUMA 4BKXA 4FE7A 2IW5A 3ULQB 2XC7A 1HBXG 1OFCX 1ZYRF 2GBYA 2XGCA 4DBRA 3BQZA 2DLLA 3H9GA 1T08B 3QPTA 3P7NA 3SEZA 2PJPA 2HQ5A 4M6YA 1XD7A 4GXOA 3CC7I 1ZTRA 2MC3A 1U0JA 1W5TA 3GW2A 2CQKA 4H0EA 2HS5A 2DT5A 2XKPA 3OMYA 5E1ZB 4WX9A 3LA3A 4M3DA 4YG2F 5DM7F 2FOKA 4OMZA 3ZP5A 5B3SH 3BCBA 5B5EC 1BI1A 3K2ZA 4IX7A 1Z21A 1I3QJ 4V2FA 3JR9A 1P4WA 2KKOA 4M9ZA 3MVPA 2RC4A 3Q0WA 2XPWA 5E17F 5FB2A 1TC3C 2M30A 2IBDA 2OCCH 4N9IA 1IRZA 3RZDJ 1VI0A 2XUBA 4YIFA 1B1BA 2NOJB 2Y69H 3KP6A 4BYYA 4KFCA 2EPFA 3PNYA 3OYBA 2WB1A 1JKQC 3PJRA 1O4XA 1JGSA 2JA7J 2HXOA 4KJZA 1KQ0A 5D8KB 5ICGA 3HOVJ 1LFUP 5LGTA 2XRLA 4XIDA 1LNWA 1HDPA 2O6GE 2X9DA 2QSGX 5KNLA 1RUOA 3A2KA 4U87A 1V55H 3CP2A 1A31A 2FOWA 2Z9OA 2A3SA 1VNDA 1LVKA 2QQ9A 3BTIA 4K2EA 4IQJA 1J59A 2LF8A 2GQQA 4D5CA 1VQKI 3BG9A 1QBJA 1V4RA 1SVLA 5CYVA 3JTHA 3ZGKA 3OYKA 4RBOA 4HX4A 3CLQA 1YRNA 1QGPA 2KHMA 3V7SA 3JREA 5J8FA 3KYLA 1IUYA 2ME0A 2VJ5A 1BR1A 2WTEA 1DDNA 1IRFA 5DEQA 5L3EA 1FLIA 4BEHB 5HLIA 3NWSA 4ZYGA 3AAFA 2HYJA 2FBKA 3WTSC 1KU9A 3BDDA 1JHFA 1XGSA 1RESA 2FE3A 1E3HA 3SZPA 1A36A 5FO5A 1X19A 2FEZA 1SFKA 4R8HA 4KYWA 1FWZA 2PMHA 3IAM2 2XF6A 3I71A 3P9IA 4A0YA 1POGA 3BR0A 2BXZA 2PN6A 3SJMA 1A04A 1IV6A 3F0CA 3CCMI 4IEJA 2DA7A 2JSCA 1SD5A 3ZQFA 2L0KA 2KRFA 4RMNA 3S14J 2DTZA 1RIOH 2QUFA 3QU3A 3ABKH 3HRMA 4KT6A 4KT5C 4C3JJ 1YIJI 4CYCA 1JGGA 2DAOA 3I55I 2QSFX 2XSJC 4AU7A 2DYRH 3HZJA 1J5YA 4M6VA 5TISC 4GDFA 1U9NA 3CCYA 3GZ6A 1FOXA 2D45A 1GLNA 3SYTA 3H0GJ 3LA2A 5K7FA 2VBYA 4XLCA 1TWCJ 2VT3A 4MFDA 1WH7A 1R49A 1X58A 3HGYA 1K6OA 4KIBA 3DEUA 3QPSA 3FXUA 3MD2A 3SDBA 1MBHA 5FKOA 2CFXA 3KFWX 3IHUA 1EF4A 2A61A 4XN0A 1BOBA 3PUFA 1F4KA 2IJLA 3I58A 1PP7U 1XB4A 3LSRA 2I10A 3K4NA 1R22A 4DOZA 2E2JJ 3REOA 1R9TJ 3CCUI 4CYDA 2ISYA 3DKXA 1P7IA 2E5NA 5LFAA 3OIQA 3ZQIA 1MJAA 3HEFA 3TGNA 4BXFA 1SMYF 4KDPA 1MH4A 2CU7A 3HM5A 3NQOA 2EBIA 4I6ZA 2IS1A 4QSHA 4I99C 2HDWA 2BXYA 2CW7A 1KU7A 3K9TA 4E4HA 1ZRDA 4DYCA 4YFXF 3HOYJ 2QQBA 4Q47A 4WF2A 3TW6A 3H3ZA 2MA3A 3K70D 2STTA 1MH3A 2AQEA 4A93J 5H6RA 5CVVA 1VQ9I 1TTYA 5LEJA 4NB5A 2YX4A 1LEAA 2X6XA 2ZMEA 2DA6A 3R0JA 4RS8A 5IP7J 3WTWC 1IG7A 2R7RA 4F7ZA 4HDVA 2ID6A 2HVSA 2GIVA 1ITYA 5IYDJ 4FCYA 2QF7A 5GPAA 1LQ1A 4A3KJ 2E7WA 3FM3A 2EFQA 3KIOA 3UR3C 5DS9A 1MJ9A 2NOGA 1HKSA 2DT7B 4ZC3A 3R6SA 3F9KA 3BCAA 1WJDA 1S5LC 2BHYA 3QPHA 2AO9A 3ZMUA 3OY9A 1UJ8A 2YR2A 1ODDA 4KN4X 3G73A 3HB9A 1YYVA 1S7EA 3VB2A 3DXJF 3CO6C 4A0ZA 4PJJA 2ZXJA 1GDTA 2WAEA 2KIFA 5IYCJ 3QAHA 1FZPB 5E79C 1HSJA 2XAGA 1QVTA 4M73A 1QZZA 3OWTA 2R7OA 4UVAA 1JE8A 4KIFA 5E3NA 2W82A 3RCOA 4A69C 2YPRA 5E3LA 1VQOI 4JP0A 5E8IA 1XCVA 2FUG2 1ONVA 2LKXA 1DUXC 3W2VA 2DA2A 5LGUA 5D5WB 3HRSA 2O9LA 1B4AA 4LIVA 1MNMC 2K9QA 2XAQA 3ASNH 1H8AC 2CW8A 5J40A 1TBXA 1XSXA 2ZJRF 2OZUA 1HDDC 1LKXA 2CQ7A 1TLHB 2IPQX 3BZKA 1WIBA 5CVIA 2DXIA 2LK2A 3AKZA 3LSPA 1VTNC 3I59A 3K10A 1YJNI 2WADA 3K7AJ 4RGRA 2FF4A 2OV7A 2UV1A 5EYRA 4R79A 5KCMA 3ZMZA 3DEEA 5KVRA 3U2RA 4G6TB 4XLFA 1VQ5I 3TL4X 1WJBA 1ZGAA 3FDYA 5EF6A 2WWYA 2L3DA 4HV6A 1TQIA 3VWBA 4H4KC 5IOYA 3NEUA 1D0XA 3JAMK 3CCRI 1T0FC 2DFIA 2JJ7A 3L2RA 3ZMSA 3ZR8X 4A6DA 4ZZDA 3WTVC 2RREA 5HS8A 3CUQA 1X1BA 2HR3A 2BY3A 1IN5A 1OCRH 3FX3A 2NVYJ 1EH7A 3CZ6A 4MTDA 4PSXA 3E5QA 3TP0A 2E1NA 1E2XA 3HOUJ 3JSOA 2IAIA 4X1EA 2WBMA 1QNTA 5E8GA 3C3WA 3CCEI 2ZJ2A 5FLXK 3CF5F 1IW7F 2Q2EB 3PQKA 4U88A 4HOBA 3GZ5A 3CTAA 4B8XA 2XROA 4EEFG 1WJAA 2EIJH 2X51A 1YW8A 3F8BA 3CCJI 4PFPA 1GHCA 3CCSI 2X6YA 2DA3A 1OYIA 2L7ZA 4RAZA 2VOOA 1R5ID 1ZHFA 2OCEA 2X6WA 2QM3A 3P9KA 4DYQA 4IZZA 2E34A 4G12A 1ETKA 2CV2A 2TRTA 3BG3A 2PMUA 3GTKJ 3LOCA 5H6QA 1DGRM 3TO9A 4IKFA 2W84A 2L9NA 2FNAA 3U1KA 3TDUC 1P6RA 2ECCA 4ENJA 2CFOA 1BI3A 4XRFA 2XAHA 2HQAA 2OZ6A 3ISPA 4HZFA 5C4JJ 1WKMA 3O3KA 3OYCA 2B63J 2CW0F 1OCZH 1T2KA 3TBIA 2DMTA 5ILUA 5ILVA 1QA6A 1T56A 3FKJA 4RGSA 1QZYA 4A3GJ 4CCOA 4RAGA 1SC7A 2VASA 2VBXA 4L9TA 2ZSIB 4II3A 1TZLA 3BWGA 1Z7LA 2EFPA 3C18A 3K4JA 2EQRA 3KEOA 5JVGF 4A3FJ 1HCRA 4HV5A 1SAUA 1G3WA 3RKYA 2JZYA 2KRCA 2O3FA 3ABUA 1D1BA 3IWZA 2M8EA 3EGVB 5FJ8J 3FISA 4WXDA 4XKBA 4FHTA 2Y0MA 1EKEA 5M5XJ 1ZAOA 3K4KA 3EUKL 3E5XA 2A68F 3TO7A 1T33A 3D1NI 5HDKA 3FK7A 5JVTA 3S3OA 2STWA 4UNOA 2E35A 5D4SA 1TNSA 1N78A 5K5OA 2ICWG 5ICEA 2QQ8A 3S3MA 1GV5A 1FBUA 1LJ9A 2HDCA 3FHZA 3F8MA 1JTYA 4ZTFA 5IY5H 2GM4A 1BJZA 3P5JA 2YX7A 3L00A 3ABMH 4LB5A 4LLNA 1XS9A 1BC7C 1KONA 3WTUC 4C3IJ 1MDMB 2IXSA 2UZKA 2A6TA 2VN2A 4BQQA 3GTJJ 3KX2A 4BHBA 3J7AY 2F5DA 1FX7A 3OS2A 4X6AJ 4D7MA 2R7XA 3I53A 3BG5A 3RPQA 4IRGA 1TT0A 1GT0C 3N97A 2KIQA 4HF0A 3ECOA 1FBSA 1B59A 2BV6A 3K1PA 5D6EA 2QGUA 2DJNA 3F6VA 4XLAA 3FMSA 4IHXA 4A3BJ 1LDJA 4XLEA 3WG7H 1LE8A 2ZO4A 3PIPF 1I1GA 2GXGA 1MJBA 3AG4H 3PSIA 3G1OA 5F27A 4BQOA 3GLLA 2Q1ZB 4YFNF 2CRGA 3H3UA 4KMUX 5F1JA 1ETWA 1KA8A 1YW7A 1OLTA 4ETSA 1IDYA 3OIPA 5J4YA 3V8KA 2VKVA 2M34A 3DBHB 2MH2A 2IRFG 2ZKZA 3OS0A 4PGHA 2HVRA 3DPTA 3RPUD 3BTCA 1Y1VJ 3GEZA 4FX0A 5HS9A 1UHSA 4S05A 3IL2A 4L5IA 4CCLA 1RUNA 2ECBA 1WGXA 2LY9A 2EB7A 3GBGA 3KEYA 3WODF 1D3YA 4AM3A 3OYIA 5F6FA 2AS5F 1U8RA 2P6SA 1UMQA 3GUDA 1Z6TA 3R0AA 1Y6IA 1V3FA 2KZGA 4IHWA 5FROA 3OYDA 4WXHA 2HU9A 1L3LA 3VYRB 2LVSA 5JR3A 2EILH 2DI3A 1MIJA 2DN0A 3ZRGA 3L2WA 2ZJQF 4GCVA 1LDKB 1H88C 2LC2A 2R4GA 3PNTA 1MBKA 4XSXF 4Y13A 1HC8A 1WJFA 3DTKA 3OYGA 3BQYA 5F64A 2UXNA 2CWEA 2R7ZJ 2X4HA 1ACIA 2L01A 3S93A 3HJEA 4ON0A 4E6KG 2PG4A 1B72A 5DD4A 5E3OA 3W6VA 4HPQA 1Z05A 3QU6A 2PQ8A 1X2NA 2WAQA 3J80Z 5EG0A 4EQQA 2W7NA 3GTMJ 2DU9A 3T1BA 1Z6RA 3Q9SA 2JMWA 3RKXA 5M5YJ 2R5YA 1STZA 3JRFA 3VYUB 3S1RJ 3DKYA 1ORKA 2YSRA 5H20A 1Y39A 2X1EA 4M9XA 3WHBA 4UB6C 1UHWA 3OYMA 5HNHA 1H0MA 1BC8C 3ZQQA 5HLHA 3OIOA 4HX7A 5EG0B 4C2TA 3LSKA 4HQMA 3PFIA 1O7FA 1RKTA 4OU0A 1AWCA 1U2WA 4A3JJ 1VQMI 4UV8A 3PIOF 3S1MJ 3DKWA 3FXOA 3B6CA 3H9QA 3OSGA 1HW2A 2DJIA 2BYVE 5E3MA 3BT9A 5JLXA 1OMIA 2QCOA 3DLAA 4C9YA 3V42A 3T5XA 4PFOA 5DD8A 1XSDA 5M5WJ 5J3LA 1VQ6I 1TT5B 4RGXA 2L9SA 2DYSH 3CC2I 1DPUA 3H5NA 1OR7C 3F6OA 3JAMZ 4NDLA 1AU7A 3TDZC 2L02A 1UG0A 4LIUA 1UAAA 1IV8A 3VPRA 2ZB9A 3FMQA 4HRIA 3W2AA 2O0YA 2HVQA 4NNJA 3H5AA 3OYAA 3RSNA 1MW7A 2P5VA 5DYMA 5DDGA 5IOZA 1B8IA 2OJED 3HKZA 2VXDA 1WHUA 2DMUA 4I7HA 3GTPJ 5C4XJ 2AXTC 2HKXA 1UZCA 1Z7UA 2DFHA 5L3DA 2Y0SA 4CDGA 4M72A 2JA6J 1J9IA 2IGKA 4A6EA 1JTXA 1CF7B 2MW8A 2V79A 3F8CA 5B1BH 5KAIC 4G9YA 1FYLA 2VJJA 3CESA 1XDSA 2WAFA 1TW2A 3U1DA 5EJCA 1YJWI 4YIRX 4FQGA 2L5QA 1QQIA 4Z6YA 3HUGB 2VJIA 2DTRA 4AIJA 4S04A 4KUMA 2Z2SB 4HAMA 3FXLA 1RC9A 3HSEA 4BE1A 3MKZA 2F6CA 5FKNA 4U7BA 1REPC 1V5GA 3ESWB 3GWZA 4GFBA 2BY1A 5A2QK 1F1ZA 3E0JB 2OBPA 2DOEA 2H6CA 5HS7A 5LGNA 2MLGA 1YI2I 1FOKA 1TWFJ 2GXBA 3N4MA 3DEWA 3L2QA 4CO8A 4CCKA 4E7HA 2ZXWH 1XGOA 1QPIA 4M9SA 1HOMA 5F0FA 3EETA 2RNGA 4CA0A 4IHYA 4KICA 1NG6A 1R58A 2F48A 2E2HJ 2LF7A 2LOOA 5FKKA 3WTTC 4HEA2 2F4MB 5KK1A 2UXXA 2VXZA 2XGEA 4Q48A 4M3GA 1FYMA 1T39A 1Q1VA 1MBFA 4YFKF 2K27A 3V7RA 1AHDP 4BJTA 2WV1A 5L3GA 2BEOA 4FT8A 2RAEA 2V9PA 3WU2C 2HKOA 4UVBA 4XORA 4MTEA 2A5YB 2QKLB 3C2GA 4UUTA 2F4OB 4XSZF 4IHVA 4A3CJ 5FRNA 2L2OA 2V9KA 1TQPA 1OCOH 2LP0A 3T8TA 1BM9A 3KE2A 2G7UA 4FISA 4I0BA 1KZHA 5EGOA 1VFCA 2DDBA 3KP7A 3Q0VA 1HSTA 4JX4A 4V19K 1YX5A 1OCTC 2CUFA 4BHPA 4EV0A 3B02A 4IJAA 4TV7A 5FD6A 5HLGA 2E71A 4LOCA 5CJ9A 3RKQA 1MBGA 4Y33A 4BXUA 4OIOF 2KQRA 1K78A 4XN3A 2R7SA 3HOSA 5L3FA 3BR3A 1R23A 5HOOA 4I0AA 3G2BA 2OTJI 4BUPA 2DCEA 5CVUA 2JQ7A 5EGOB 4PDKA 2XRNA 3I3LA 5DCMA 2F5FA 3F22A 1VQ4I 2G0EA 4HX8A 2AHQA 1G3YA 2M4GA 2EZIA 2ZFWA 2L7KA 1J0RA 2KL4A 4M3FA 5D4RA 1LUJB 1ZKGA 3CJTB 2IP2A 2R7DA 4LLGF 1YRNB 2HQNA 1GVDA 4EM1A 5ICFA 4BACA 2ELHA 2XASA 4DZJA 2GZWA 2ELJA 1K78B 3FMRA 4PCQA 3D5LA 1WJEA 2LREA 2V6CA 3NARA 3BLYA 1IUFA 3TOAA 3NWTA 3SDGA 2DMPA 4D5FA 1TWHJ 2MD0A 2YUSA 2QENA 2ESHA 2HWVA 4ESBA 1YLFA 3GTGJ 3M1EA 3QYBA 2NYXA 1R1UA 1BN5A 2P7VB 4F92B 2BBYA 3ZQHA 1YOVB 4HF2A 1WJCA 2DPDA 3I4NJ 2QBYA 4Y7NJ 1H9TA 1HQCA 3E7LA 4P5OA 3LFKA 1AKHA 2JSPA 5L3BA 4L9VA 1Z0XA 4XL9A 3BPVA 4ESFA 1OYYA 1TNTA 3HBLA 4HQEA 4HG2A 1ETOA 5GAEJ 3GLXA 2VONA 2VL8A 4ABZA 4CYCB 1DU6A 3CMAI 1ZARA 2NNNA 4XK4A 2Y2ZA 3J81K 1LFPA 2HDDA 3BZCA 4PGGA 3OYLA 4BU2A 1ON2A 2V1UA 2RNJA 2GAUA 3JRBA 5AIQA 4B47A 1AOYA 3E3VA 5HNFA 4AVPA 1LDDA 1PP8F 3JTGA 3BPXA 3HHGA 1XX5A 2KP6A 3ECHA 1VF9A 2R0QC 2ESNA 5H2FC 5BOXA 1AA7A 4P96A 2D5VA 1E17A 3DP7A 1P2FA 1USTA 2ZSHB 3R61A 1O3TA 2ETHA 4MEYF 2OTLI 1SVOA 2H27A 3MKYB 4DNCA 3J7ZI 1S6LA 3DU6A 4KNYA 3PL8A 3ZCOA 2Y75A 3GMEA 3MQ0A 1K4SA 5HLTA 1TQMA 2NVXJ 2JRTA 4D7NA 2A6HF 3CO7C 1BW6A 2AQFA 1MNDA 4RM3A 4L0ZB 3WGIA 4CH7A 3F3XA 2L54A 2M1BA 1E3OC 2HPMA 3KYCB 2IS6A 1A6IA 4XM3A 2XF7A 5CVJA 2FMLA 5DTDA 2H94A 2EFOA 1ENHA 1WH5A 1CQTA 1ULYA 1T38A 2VJ4A 4PJMA 2ZMEB 1SFUA 1SD6A 1BOAA 1S29A 1IN8A 4GRIA 2M0CA 5EZHA 2K02A 3M8FA 4AIHA 1R1TA 3FF5A 5HDGA 3KP2A 4P9UA 3A02A 4BAYA 4B3AA 4N4NB 3K70C 3HXLA 4IF4A 4BBRJ 2CQXA 1IAWA 2K9MA 5IYBJ 1XDUA 2JN6A 5CQGA 4I01A 2R7QA 3C2BA 1X4OA 3LAPA 3SFZA 4NC7A 2B0LA 2CSOA 1XTAA 1GVJA 2V6EA 4U0VA 3A4CA 2L9VA 2N8GA 3GVAA 2DA1A 4FE4A 2OAZA 4BH9A 3KYDB 4KISA 1VQPI 3RQIA 3HRUA 1SFEA 3C7JA 1RZ4A 4F3QA 5E18F 3M1CA 1X2MA 1YQAA 3QP5A 3A03A 3RTRA 4A5MA 1WI9A 2R3SA 3HDDA 3N05A 3D0SA 3V8JA 2HEOA 2I5UA 2Z16A 1I5ZA 4NHJA 3E6DA 2QWWA 4N9HA 2LTPA 3HSRA 3OOUA 5CQEA 4OAYA 1Y56A 1LPQA 2PMZA 2OQRA 4BY1J 4AIDA 1Z91A 5J6XA 2QEXI 2ME6A 2JWTA 3IH2A 2F5EA 2VKHA 3DF8A 3J7YJ 4RM2A 3I59B 5HVQC 4B4CA 3BOQA 2XVCA 5JFRA 2XDVA 3CDHA 4AD9A 4AYBA 1G59A 4JBAA 2JA2A 3OS1A 1IO2A 1OYWA 4LMYA 4UY8I 2XB5A 4LITA 3Q3SA 2BE5F 2QA4I 1IRGA 3DU5A 2DDAA 4NQWA 2EV0A 3MWMA 1Z77A 1SEUA 4LG3A 1ZRCA 1XMAA 2DK5A 4IQ4A 4LJZF 2ZMEC 3CUQB 4RB3C 1T6SA 3E5UA 2JVHA 4L18B 2GLOA 1ZH5A 3WTXC 3WHCA 4UXNA 4UVCA 3ZQLA 1KGSA 4ZH4F 5ICCA 5LHHA 2DODA 3FWEA 3AFHA 2R93J 3S3NA 4ESJA 1OJLA 1FY7A 3BTLA 4W1UA 4A5NA 3DCFA 3HG9A 1DP7P 2ZC2A 1X3UA 3LNQA 2A5WA 2QYOA 3DQVC 3HHHA 1YS7A 1Z3XA 3LQRA 5FRMA 1GV2A 4EATA 1D8JA 4EGYA 1X1AA 1X3ZB 1W0UA 1NTCA 3K4MA 3KEQA 4EVIA 4WWCA 2NVUB 3KZZA 5JHUA 1BIAA 3GYHX 2WY8Q 4IO9F 2WB1N 3DFGA 4HSRA 5LLQA 1FC3A 3L2CA 1FNNA 3JCUC 3K2AA 3FXJA 2E1OA 2M2EA 1FJLA 3VDXA 4OMYA 1NG7A 1SANA 2EA4A 3A0BC 2COBA 1EH8A 3DTIA 1JKOC 4EMSA 1NHAA 3H1CA 4F52A 4IOAF 1ETVA 1MBEA 1QRYA 2OC6A 1H89C 1I27A 5CKTA 1LEBA 3FK6A 4AUXA 4E7IA 4D0PA 1W7PA 4B09A 3WU1B 3T0YA 3G6EI 4CCNA 4RB2C 2YU9J 3WE2A 3K6GA 1ZGWA 1SAXA 2DA4A 2EA2A 3DPLC 3H35A 3HTUA 1A5JA 2LMDA 4A3MJ 1BBYA 2LD5A 5E1XA 3Q5FA 1QZEA 3FXRA 3K4LA 1G4DA 4L5EA 3GCMA 2FX0A 2GOMA 5FFZA 3UKGA 2MG4A 3JRIA 4F93B 2HYGD 3RIRA 3BJOA 4I98B 2JRMA 4HDUA 2XV4S 2CYYA 2EV6A 2R5ZA 1QO0D 3KZYA 2VT2A 2HZDA 5FLVA 2DOAA 2V1DA 1XN7A 3SHFA 2VC1A 2L4AA 2E7XA 2OPTA 2X48A 3CUQC 4DYRA 3BJ6A 1QHGA 1YW9A 4ENMA 1QVUA 3GO5A 3ZOBA 4IPAA 4MGRA 2IS4A 4LD5A 2H8RA 1D0YA 1U5TA 1F9NA 1UHMA 2E60A 3OL3A 5LEKA 2XPVA 2X85A 5K7ZA 2L4MA 3CMEI 1KU2A 2X1DA 2PX9A 1JT0A 2E36A 2GWRA 1ZK8A 3O6BB 2NXNB 1X3WB 2FBHA 1VQLI 3V4GA 1RRJA 4BJ5C 1BI0A 4EJWA 4BGDA 5E20A 2BOLA 1TP4A 2BY0A 2PFBA 1XPXA 1JI8A 3J7AO 1NK2P 1W7PD 3K1MA 2V4JC 4WK8F 4RB1A 3LSTA 4DJAA 2V1XA 3TO6A 2HPIA 3L09A 2ZCWA 4GGGA 1IDZA 3CCVI 1LE8B 4XKVA 2VKDA 3UNGC 4AWXB 1FMVA 5IPAA 5BQTA 1EA3A 2EJRA 1ETQA 1MMGA 1R71A 3ABTA 5EEHA 2IA1A 2GA1A 2K3FA 2ZNZA 2FRHA 3I56I 1C0WA 4UUSA 2Z5UA 1SVMA 2LY2A 1BR4A 4ASNA 5FD5A 2R7WA 1K7AA 3GTOJ 5IP9J 1MNEA 4ZYAA 4Y3OA 3WE3A 2HFHA 4EJTA 3MZHA 3K4BA 4XBFA 3L9FA 4RA2A 2XPUA 3LSJA 4BXXJ 3GTQJ 2LH9A 3GF2A 1K6YA 4QLCU 1IGNA 2CG4A 1YX3A 3U21A 3QOPA 2K9SA 2IGNA 4MQVA 3OYJA 2GIZA 4FX4A 5IT9K 1XMKA 4ZDLA 4UUSB 1HW1A 2P8TA 3JRDA 4MO7A 1WFXA 3I54A 3AG2H 4KA4A 2EINH 2Q0OA 3LSIA 2L7FP 2CO5A 2M5WA 3A0HC 2ZXIA 1MSFC 3CJSB 4HNVA 2XKOA 3H3VK 5J8CA 2EV5A 4BNCA 1S3JA 2H09A 2VC0A 4IRIA 3SZGA 2LR8A 4HYEA 4ZDOA 1U3EM 3R60A 2MH9A 1ZG3A 4A3LJ 3FXMA 4OIRF 3QYEA 3C2HA 2J5PA 3HPHA 4G94A 1KU3A 5DV5A 3A01A 4UUVA 3IP4B 3WG9A 4F91B 1YTYA 1B72B 2JUGA 2XAUA 3IC7A 2CQQA 4XKCA 3M8JA 1Y0UA 2IGOA 4NBQA 3H9JA 3AG1H 1X1PA 1ETYA 2GXAA 4PSWA 1W1WE 1N25A 1WI3A 4ITVA 1D0ZA 1P9QC 2XF5A 1WJ5A 4BDZA 2R5YB 1Y8RB 2CUEA 2RDPA 1W4MA 3FBIB 1G8XA 2FNPA 2H6BA 5M3MJ 4MHGA 3X2QH 1UCRA 4S0HB 2DO7A 3EYIA 1T98A 5GPCA 4C30A 3K1NA 1YS6A 2K9NA 1R00A 2LG4A 3F8FA 4GYGA 4LG0A 1YITI 1R4NB 1T95A 3HOZJ 2TDXA 1JKPC 4Y15A 3Q0UA 1V54H 1F43A 4I09A 2DMNA 3HOTA 4XR6A 3ZMVA 2O5RA 3LMMA 2HTJA 2QVOA 6PAXA 2IGMA 1HLVA 2DQLA 3DWLE 4B44A 3WU0A 1W36D 9ANTA 3F72A 1XSVA 1B6AA 1XMXA 1J75A 3ZQCA 4XLHA 5DCFA 2CGPA 1IN6A 1XC5A 5C44J 2D1VA 2VE9A 3QWLA 1R6RA 2PBIA 2DFFA 1FEXA 4LB6B 1I39A 4X0GA 5J1RA 5FLXZ 2W85A 3F23A 2LSOA 1ZN2A 2MGQA 2VKEA 1Z3YA 4G7OF 1FPQA 4NC6A 5D5XB 5LD2C 1IRXA 4AC0A 3ZXSA 4L9NA 3IH3A 4II2A 4BBSJ 2P7CB 3ZN1A 2PMZN 2VODA 2VLAA 4JK1X 2Q8KA 1JJ6C 1B8IB 1BIBA 3ZMTA 3FXQA 2DBBA 1NK3P 2RV8A 5EZGA 4A2UA 1DU0A 1EH6A 2Y31A 2QLZA 5BS6A 2LY1A 3U9GA 3FXKA 4CXFA 2MD5A 1UELB 2DW4A 3ML6A 5AIPA 3HPGA 5M3FJ 1S9HA 2E2IJ 1FSEA 2ACJA 3QP6A 4RAYA 4XRSG 4B1RA 3RI4A 4UHTA 1E0EA 2LDUA 1OCCH 2KT0A 2VUMJ 1O3RA 2HZTA 4RDUA 1J7KA 4A3EJ 2HYFA 4XOPA 4ENKA 2IS2A 4E7ZA 1Y0NA 4J19A 2NAZA 2HOAA 2KFDA 4L9JA 3LWFA 1UFMA 3ERMA 2VQGA 4E7KA 3KP3A 3CCQI 3W6JB 2XAJA 1K4TA 2LBFA 1YE9A 2PEXA 1S7AA 2AXLA 1D5YA 2VB6A 3QPLA 1OQYA 2FJ1A 3HSFA 3LSGA 4HNTA 4PJ0C 1EV7A 2HTSA 1ZR2A 2L7MP 2C6YA 2HNHA 1ON1A 2XAFA 2RKHA 4G7HF 3PO2J 3CQZJ 5TGTA 4EM0B 1QHHD 4OAZA 4U0YA 4XICA 2EK5A 3CUOA 1VZ0A 1I3AA 2FQ3A 4M71A 3ZMDA 3K0LA 1ZR4A 2M4KA 2LBFB 3EQLF 5BPIA 3L1PA 1T8IA 3GFIA 2K86A 1IXRC 4DW6A 1Y1WJ 2QQAA 3O2PE 3OL4A 2G7HA 3BR6A 3BG7A 3PM1A 1CGPA 1EJ9A 4KIGA 5EEGA 5TJJA 2O03A 4NUBA 4O5VA 3QODA 2EZLA 2Y9ZA 4BEHA 2FQ4A 1XGMA 1ZELA 2RGVA 3I0TA 5D6FA 2NVTJ 1I50J 2ID3A 2RVCA 2M7BA 3PSFA 1U78A 1L0OC 3AL0B 4OIPF 2M87A 5LBQA 4XLPF 3OR2C 1N77A 2NRAC 3JRCA 4E7LA 5F1RA 2K3PA 4XONA 3PUBA 1D1CA 1LVAA 2CQNA 1BJAA 1XG1A 4LFUA 4DBQA 1ZREA 4ZDPA 1YO5C 1FP1D 5ERIA 3T8RA 3G1MA 2DA5A 2IVMA 4IXAA 3SXYA 2Z1DA 1XCBA 2XGXA 2NNYA 1Y8QB 2FU4A 2JPBA 5K5RA 4CCJA 4HNUA 2XIGA 5DCMB 3IKTA 3MN2A 2BW3A 3NAUA 1S7OA 2EWNA 2NS8A 2HI3A 3IUOA 4CUGA 5B66C 1FT9A 1XGNA 3MEXA 5F0CA 5JHFA 3G71I 1RNLA 2QSHX 3VSLA 2HOSA 3E6BA 2CH0A 4JX6A 1DPRA 1OISA 3O8HA 2RN7A 4XKWA 4XMYA 4XLNF 3I9V2 4I76A 3H36A 4KMFA 4LK1F 2MC4A 2VE8A 3FHNA 4PK4A 5F04A 4CGZA 4YRVA 3B73A 2KDOA 2VPLA 2BW3B 3TKYA 3CD6I 1I1SA 1USSA 3HGGA 2R7TA 5J1UA 4CICA 3E1SA 3I5UA 2BVMA 4CCMA 4J01A 4OOIA 1S8NA 1U9OA 4L5JA 1BI2A 4OINF 4BHCA 4ZYHA 2V26A 2O8XA 3CF2A 3JSPA 2QBYB 3F8NA 3NRVA 4HSTA 5GADJ 2JTVA 2M0MA 1YFHA 3COAC 1WWXA 4BS9A 5IT9Z 2B9SA 3CJQB 1AKHB 1R1VA 1SFXA 4JQFA 3G1LA 3V7CA 2K7LA 1A6QA 2W00A 3MAJA 2Z33A 3EPZA 3KCCA 3TEDA 1MGTA 2V7FA 2X1CA 5C3EJ 1ZRFA 5ILSA 4QPOA 4EJOA 1ZG1A 2YS9A 1SFOJ 1WZ2A 4LLLA 1T0FA 2CV1A 5GP9A 1JUPA 3W6KB 4ZYEA 3F21A 1ZGJA 1GXPA 2RQPA 3AL0C 1WPKA 3H0DA 1S72I 4BE0A 1TW3A 3TP3A 4B43A 1IN4A 3FZVA 3HTSB 3GTLJ 3ZN0A 1R5HA 1QPMA 2LNBA 3OSFA 2NVQJ 2MFZA 2QKMB 1B9NA 4C3HJ 2DT6A 3E6MA 3FBNB 5AONA 4AIKA 2R7VA 4MIMA 4U0WA 2K85A 2IA0A 1R7JA 2K9LA 3GFJA 5DUIA 5DM6F 1MSEC 1BR2A 3RKWA 2WAQN 1YG2A 3PQJA 1Z1DA 4QIWN 5EEAA 3LFUA 5J47A 2VPRA 3GX4X 1VQ7I 4Z2YA 1I6XA 1D1AA 3S15J 4JOMA 1JUSA 4IVNA 1KQ9A 2M9HA 4ENNA 2QZ8A 3WGHA 3JW4A 2J5OA 3PNVA 4FTHA 1ZG5A 1RPWA 3OV8A 3BR1A 2CUJA 3OYHA 3H5RA 5HODA 1MD0A 1BA5A 4HLYA 2KJBA 4RLFA 1RR7A 5D5UB 3CJNA 1HA8A 4EM2A 4G8XA 3J80K 2GOXB 2WV0A 4E7SA 5ED4A 3M7GA 4CSWA 1ERDA 3P9CA 1BL0A 5CPRB 4ANJA 1IF1A 1JUMA 4Y4RA 3S2WA 1Z9CA 5D8LB 4OWRB 2KDZA 4DZPA 1JHHA 2M45A 5LHIA 2F5VA 2R7FA 3TOBA 2KZVA 2PLYA 3K69A 2TCTA 2JUCA 3SQNA 4WCGA 2IEKA 4IRHA 1IN7A 3CLOA 3OYFA 5GTHC 4CHUA 3IRRA 1PUEE 3PO3J 3EUAA 1MZBA 2F5CA 4BY7J 4XQFA 2O7OA 4CZZA 1OKRA 3CMMA 3EYYA 1W5CC 1P4AA 3E97A 5DUKA 3WGGA 3HKZN 5IP6A 2LRDA 2HXIA 4DQ2A 3VYTB 1P7JA 4PUSA 2JA8J 3S8PA 4G6QA 4P55A 4CZCA 5A2QZ 1KYWA 1FOWA 2Y0SN 3CCLI 1G6NA 2VQHA 3MZ8A 4A0XA 1GXQA 2FA5A 1R5GA 1F36A 2A6EF 2DK8A 3MMYB 3QRFF 4N4OB 4C2UA 4IHSA 2F4IA 2O8KA 1IZ1A 2EH3A 2Q2EA 3CC4I 3DBLB 2ZFUA 3BC8A 5JI6A 1FOYA 3EUHA 1WVRA 3RQ4A 4AVZA 1FIPA 1E3PA 3BROA 3W2WA 2A69F 1KQ8A 1MMSA 2LFBA 4JX5A 1B9MA 3DLLF 1NH3A 3HYIA 2X0LA 2OU2A 2Z3YA 4IOCF 2P81A 4JYKA 3H92A 1UB9A 1JKRC 5JLWA 4EGZA 4FETA 2ZJPF 2HOEA 1QU3A 2VOPA 3HOXJ 2R92J 2DFEA 2P5KA 3ONQA 2DQRA 1HXDA 2COMA 2P6TA 2W1OA 3OOPA 4PJLA 4XRSA 3BY6A 1JT6A 4PJNA 1JJ8C 4KN7X 4RLQA 4MLOA 3ZPLA 2XHKA 1D5VA 4XRMA 1SMTA 4BDYA 1ZLKA 2HQRA 3GXOA 3I64A 3G3ZA 3RZOJ 2MLKA 2A07F 4NQWB 4KITB 3BZ6A 2OQGA 5GAHJ 3ERED 2ZNYA 2H8WA 2EFWA 3LL7A 5KHDA 2I8DA 2LKPA 3Q9VA 3RJPA 1X1CA 3JRHA 2UWMA 2EIKH 4A12A 1DQUA 4RAFA 3FM5A 3CJRB
chains in the Genus database with same CATH topology
1VQNI 1VQKI 3CMAI 1YHQI 3G4SI 3CCEI 1VQ9I 3CF5F 3G71I 3CJSB 1VQMI 3PIOF 1YJ9I 2QEXI 3PIPF 3CCJI 3CCSI 3J7YJ 2OTLI 3CD6I 1VQ6I 3J7ZI 2E34A 3CC2I 3CCQI 5GAGJ 4V19K 4UY8I 5GADJ 3CCMI 2QA4I 3CJQB 3CMEI 1QA6A 2E36A 2OTJI 3CC7I 1VQOI 2NXNB 2JQ7A 1VQ4I 1VQLI 1YIJI 1YITI 1FOWA 3I55I 3CCLI 5DM7F 5JVGF 1FOXA 3CJTB 3CC4I 1FOYA 2ZJQF 1S72I 3CCVI 2ZJRF 3EGVB 1YJWI 1MMSA 3DLLF 4IOCF 1HC8A 1WIBA 1ACIA 2K3FA 2ZJPF 1YJNI 3I56I 4IO9F 2E35A 5DM6F 1VQ5I 3CCUI 1VQ7I 1YI2I 3CCRI 5GAHJ 4IOAF 1VQPI 2H8WA 1VQ8I 2FOWA 1Y39A 5GAEJ 3G6EI 3CJRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN I;  1VQK I;  3CMA I;  1YHQ I;  3G4S I;  3CCE I;  1VQ9 I;  3CF5 F;  3G71 I;  3CJS B;  1VQM I;  3PIO F;  1YJ9 I;  2QEX I;  3PIP F;  3CCJ I;  3CCS I;  3J7Y J;  2OTL I;  3CD6 I;  1VQ6 I;  3J7Z I;  2E34 A;  3CC2 I;  3CCQ I;  5GAG J;  4V19 K;  4UY8 I;  5GAD J;  3CCM I;  2QA4 I;  3CJQ B;  3CME I;  1QA6 A;  2E36 A;  2OTJ I;  3CC7 I;  1VQO I;  2NXN B;  2JQ7 A;  1VQ4 I;  1VQL I;  1YIJ I;  1YIT I;  1FOW A;  3I55 I;  3CCL I;  5DM7 F;  5JVG F;  1FOX A;  3CJT B;  3CC4 I;  1FOY A;  2ZJQ F;  1S72 I;  3CCV I;  2ZJR F;  3EGV B;  1YJW I;  1MMS A;  3DLL F;  4IOC F;  1HC8 A;  1WIB A;  1ACI A;  2K3F A;  2ZJP F;  1YJN I;  3I56 I;  4IO9 F;  2E35 A;  5DM6 F;  1VQ5 I;  3CCU I;  1VQ7 I;  1YI2 I;  3CCR I;  5GAH J;  4IOA F;  1VQP I;  2H8W A;  1VQ8 I;  2FOW A;  1Y39 A;  5GAE J;  3G6E I;  3CJR B; 
#chains in the Genus database with same CATH topology
 2KMU A;  1VQN I;  1FTT A;  2F2E A;  1LB2 A;  2KRH A;  2GA2 A;  3OYN A;  1O3Q A;  2HOT A;  3OYE A;  1MBJ A;  2M7A A;  1PDN C;  2ADU A;  2DPU A;  1ETX A;  5BMZ A;  4IL6 C;  4EJV A;  3D5R C;  3RYR A;  1YJ9 I;  3S2H J;  2D2W A;  5BNG A;  3JRA A;  2K4B A;  3ROU A;  1MMD A;  4DGW B;  3M9A A;  4LGW A;  3SZT A;  4MNU A;  4HF1 A;  5KAF C;  5FGM A;  5GAG J;  4O6J A;  3VEP A;  2LLK A;  5IT3 A;  1W5S A;  5FLM J;  1ZQ3 P;  2DMQ A;  1K79 A;  3IH4 A;  2KLO A;  4ZJZ A;  4RB0 A;  1Q1H A;  5CVR A;  1O7L A;  2YU3 A;  2KJC A;  3QOE A;  4G7Z F;  5FFX A;  3AG3 H;  1W7P B;  3D5S C;  3KLN A;  3KET A;  2P5L C;  2XSD C;  1MDM A;  5GTI C;  1RKW A;  2KIM A;  1TWA J;  2R7U A;  1FTZ A;  3EDP A;  2LKS A;  3IV5 A;  3RPU A;  3IWF A;  3M4O J;  1V5E A;  4C2M J;  3VYS B;  4BQN A;  2E19 A;  3QYF A;  2HGC A;  1K83 J;  2VIX A;  1PVE A;  4D9J A;  1G2H A;  3IRQ A;  1TL8 A;  1M1E B;  3KP4 A;  3FIW A;  2G9W A;  3EUH C;  4M3B A;  4MEX F;  1RI7 A;  5L3C A;  3MFK A;  3DV8 A;  5FKL A;  4GO1 A;  3E6C C;  2R5Z B;  4BQA A;  3HOW J;  3J81 Z;  1R4M B;  2ELK A;  3I4P A;  3VOD A;  1P92 A;  4QPQ A;  4G6D A;  2P0W A;  2BZT A;  3RYP A;  2Y48 A;  4IHT A;  4YEL A;  1KYZ A;  4MQ9 F;  1RET A;  4OIQ F;  2DOF A;  1OCP A;  2IA2 A;  3K4C A;  1APL C;  4M74 A;  4LK0 F;  2FBI A;  5LRR A;  1PYV A;  1D8K A;  2M8G X;  5K7H A;  1J2X A;  3L2V A;  3M8E A;  2W25 A;  3MKW B;  1FIA A;  3KZI C;  5LRS A;  3BR5 A;  1U5T B;  5K5Q A;  2Z99 A;  4I2O A;  5EDN A;  3S32 A;  2EZK A;  3DBR B;  3RDI A;  1IXS B;  2FMY A;  5LHG A;  2MAB A;  1DGW Y;  1O57 A;  1OR7 A;  3FKI J;  3LQQ A;  5TRD A;  2ZBK A;  2A05 A;  4UB8 C;  2UUZ A;  3BP8 A;  2W24 A;  2O61 A;  2OF7 A;  3G4S I;  2E1M B;  3S1N J;  2PJR A;  1SD7 A;  2VI6 A;  4MFE A;  3BJA A;  2E5Z A;  1HKT A;  2NS7 A;  4Q4Z F;  4I02 A;  2K4J A;  4A3I J;  2VQC A;  1W0T A;  1U6G A;  2Y30 A;  5B1A H;  3BR2 A;  2WA0 A;  3QQA A;  4YEJ A;  1HF0 A;  2FXA A;  4XOT A;  3M3Y J;  3WTY C;  1UG2 A;  2EZH A;  5D5V B;  2X6O A;  2H1L A;  3HC7 A;  3OR1 C;  4ZZL A;  4A3D J;  1F5T A;  2VBZ A;  4EJU A;  2L9R A;  1A35 A;  5J1Y A;  2EIM H;  1WQ2 A;  3TMO A;  2JT1 A;  3HIF A;  1U8B A;  2PJR B;  3MZY A;  3VFZ A;  4WXC A;  1FSH A;  4HA8 A;  3SFI A;  4L0Y B;  4UV9 A;  3JRG A;  1PJR A;  2RQQ A;  2ZXH A;  2K5C A;  1I6H J;  5K1Y A;  1X4P A;  4NC8 A;  4ZYD A;  4Y17 A;  4F55 A;  3CMY A;  3BTJ A;  1IJW C;  4GYI A;  3ABL H;  2MYS A;  5FKM A;  1MKM A;  3IKV A;  3PFY A;  5F08 A;  4E70 A;  3CDL A;  4HW0 A;  1HW5 A;  3TW7 A;  2D1H A;  2EFN A;  4HLX A;  2VQL A;  4FAS D;  2BVL A;  1V5F A;  5CLS A;  2BHZ A;  1OPC A;  4N0B A;  1H9G A;  3I4M J;  3GFL A;  2ISZ A;  4B48 A;  1G3S A;  3LAJ A;  3CP8 A;  3HL2 A;  2W48 A;  1IXC A;  4Y52 J;  3CDI A;  4D1Q A;  3MCZ A;  2IT0 A;  2CS3 A;  1GUU A;  2M3A A;  3ZQG A;  1SD4 A;  2MSY A;  4BJ6 C;  1R36 A;  2P4W A;  4QWQ A;  3A1Y A;  1J09 A;  3R4K A;  2B7E A;  4QTR A;  1DP3 A;  4Q5S F;  2JVG A;  5J4V A;  4BL0 B;  4O3M A;  1IC8 A;  2BGC A;  2CUZ A;  1FBQ A;  2W4S A;  4ZTJ A;  3A01 B;  5BPD A;  3GZN B;  2BY2 A;  2Y9Y A;  1U5T C;  1X1D A;  4E7J A;  1JXS A;  3O8G A;  4M3E A;  4R1H A;  5HDN A;  2PI0 A;  4HBL A;  1WSU A;  1TWG J;  2OA4 A;  2WY7 Q;  3WTZ A;  4DIQ A;  2VBW A;  1K61 A;  3C1D A;  1RR8 C;  3VOE A;  3SEQ A;  2E1M C;  2KIS A;  3ZQ7 A;  3GFM A;  2CV0 A;  3LSH A;  1Z67 A;  1WRJ A;  1FP2 A;  3ASO H;  3B6A A;  4P9F A;  4YII A;  1PUF A;  1YIO A;  1VQ8 I;  3KPH A;  2WC2 A;  3S1Q J;  4B3X A;  4J00 A;  3ELK A;  3DPU A;  4PZJ A;  1FYK A;  4LG0 B;  3S16 J;  3VSK A;  3KP5 A;  2V9V A;  1YHQ I;  2E1C A;  2FD5 A;  2XB0 X;  3W3C A;  1FMW A;  2JPC A;  1MMN A;  4RGU A;  1N75 A;  2LYC A;  1MMA A;  3TQN A;  1CF7 A;  2XGD A;  1ZLJ A;  2CMP A;  1P4X A;  3L7W A;  5E1W A;  1HKQ A;  2V1N A;  3HRT A;  3LA7 A;  5F0H A;  3S2D J;  1PUF B;  2JK3 A;  3DTE A;  4W97 A;  2OD5 A;  3V8L A;  1BW5 A;  1WCM J;  2KIU A;  2FSW A;  4BE2 A;  3BG6 A;  3HUG A;  3M07 A;  3KLO A;  2CJJ A;  4V2G A;  2H1K A;  3L2U A;  2K40 A;  4XNF A;  1O3S A;  2JA5 J;  1LFB A;  1G3T A;  4AYB N;  2KPM A;  3LSM A;  4U7D A;  3S17 J;  2NS0 A;  2MBF A;  1W36 C;  4P1W A;  2W57 A;  3MKL A;  4M6X A;  3IAS 2;  2OUM A;  4BKX A;  4FE7 A;  2IW5 A;  3ULQ B;  2XC7 A;  1HBX G;  1OFC X;  1ZYR F;  2GBY A;  2XGC A;  4DBR A;  3BQZ A;  2DLL A;  3H9G A;  1T08 B;  3QPT A;  3P7N A;  3SEZ A;  2PJP A;  2HQ5 A;  4M6Y A;  1XD7 A;  4GXO A;  3CC7 I;  1ZTR A;  2MC3 A;  1U0J A;  1W5T A;  3GW2 A;  2CQK A;  4H0E A;  2HS5 A;  2DT5 A;  2XKP A;  3OMY A;  5E1Z B;  4WX9 A;  3LA3 A;  4M3D A;  4YG2 F;  5DM7 F;  2FOK A;  4OMZ A;  3ZP5 A;  5B3S H;  3BCB A;  5B5E C;  1BI1 A;  3K2Z A;  4IX7 A;  1Z21 A;  1I3Q J;  4V2F A;  3JR9 A;  1P4W A;  2KKO A;  4M9Z A;  3MVP A;  2RC4 A;  3Q0W A;  2XPW A;  5E17 F;  5FB2 A;  1TC3 C;  2M30 A;  2IBD A;  2OCC H;  4N9I A;  1IRZ A;  3RZD J;  1VI0 A;  2XUB A;  4YIF A;  1B1B A;  2NOJ B;  2Y69 H;  3KP6 A;  4BYY A;  4KFC A;  2EPF A;  3PNY A;  3OYB A;  2WB1 A;  1JKQ C;  3PJR A;  1O4X A;  1JGS A;  2JA7 J;  2HXO A;  4KJZ A;  1KQ0 A;  5D8K B;  5ICG A;  3HOV J;  1LFU P;  5LGT A;  2XRL A;  4XID A;  1LNW A;  1HDP A;  2O6G E;  2X9D A;  2QSG X;  5KNL A;  1RUO A;  3A2K A;  4U87 A;  1V55 H;  3CP2 A;  1A31 A;  2FOW A;  2Z9O A;  2A3S A;  1VND A;  1LVK A;  2QQ9 A;  3BTI A;  4K2E A;  4IQJ A;  1J59 A;  2LF8 A;  2GQQ A;  4D5C A;  1VQK I;  3BG9 A;  1QBJ A;  1V4R A;  1SVL A;  5CYV A;  3JTH A;  3ZGK A;  3OYK A;  4RBO A;  4HX4 A;  3CLQ A;  1YRN A;  1QGP A;  2KHM A;  3V7S A;  3JRE A;  5J8F A;  3KYL A;  1IUY A;  2ME0 A;  2VJ5 A;  1BR1 A;  2WTE A;  1DDN A;  1IRF A;  5DEQ A;  5L3E A;  1FLI A;  4BEH B;  5HLI A;  3NWS A;  4ZYG A;  3AAF A;  2HYJ A;  2FBK A;  3WTS C;  1KU9 A;  3BDD A;  1JHF A;  1XGS A;  1RES A;  2FE3 A;  1E3H A;  3SZP A;  1A36 A;  5FO5 A;  1X19 A;  2FEZ A;  1SFK A;  4R8H A;  4KYW A;  1FWZ A;  2PMH A;  3IAM 2;  2XF6 A;  3I71 A;  3P9I A;  4A0Y A;  1POG A;  3BR0 A;  2BXZ A;  2PN6 A;  3SJM A;  1A04 A;  1IV6 A;  3F0C A;  3CCM I;  4IEJ A;  2DA7 A;  2JSC A;  1SD5 A;  3ZQF A;  2L0K A;  2KRF A;  4RMN A;  3S14 J;  2DTZ A;  1RIO H;  2QUF A;  3QU3 A;  3ABK H;  3HRM A;  4KT6 A;  4KT5 C;  4C3J J;  1YIJ I;  4CYC A;  1JGG A;  2DAO A;  3I55 I;  2QSF X;  2XSJ C;  4AU7 A;  2DYR H;  3HZJ A;  1J5Y A;  4M6V A;  5TIS C;  4GDF A;  1U9N A;  3CCY A;  3GZ6 A;  1FOX A;  2D45 A;  1GLN A;  3SYT A;  3H0G J;  3LA2 A;  5K7F A;  2VBY A;  4XLC A;  1TWC J;  2VT3 A;  4MFD A;  1WH7 A;  1R49 A;  1X58 A;  3HGY A;  1K6O A;  4KIB A;  3DEU A;  3QPS A;  3FXU A;  3MD2 A;  3SDB A;  1MBH A;  5FKO A;  2CFX A;  3KFW X;  3IHU A;  1EF4 A;  2A61 A;  4XN0 A;  1BOB A;  3PUF A;  1F4K A;  2IJL A;  3I58 A;  1PP7 U;  1XB4 A;  3LSR A;  2I10 A;  3K4N A;  1R22 A;  4DOZ A;  2E2J J;  3REO A;  1R9T J;  3CCU I;  4CYD A;  2ISY A;  3DKX A;  1P7I A;  2E5N A;  5LFA A;  3OIQ A;  3ZQI A;  1MJA A;  3HEF A;  3TGN A;  4BXF A;  1SMY F;  4KDP A;  1MH4 A;  2CU7 A;  3HM5 A;  3NQO A;  2EBI A;  4I6Z A;  2IS1 A;  4QSH A;  4I99 C;  2HDW A;  2BXY A;  2CW7 A;  1KU7 A;  3K9T A;  4E4H A;  1ZRD A;  4DYC A;  4YFX F;  3HOY J;  2QQB A;  4Q47 A;  4WF2 A;  3TW6 A;  3H3Z A;  2MA3 A;  3K70 D;  2STT A;  1MH3 A;  2AQE A;  4A93 J;  5H6R A;  5CVV A;  1VQ9 I;  1TTY A;  5LEJ A;  4NB5 A;  2YX4 A;  1LEA A;  2X6X A;  2ZME A;  2DA6 A;  3R0J A;  4RS8 A;  5IP7 J;  3WTW C;  1IG7 A;  2R7R A;  4F7Z A;  4HDV A;  2ID6 A;  2HVS A;  2GIV A;  1ITY A;  5IYD J;  4FCY A;  2QF7 A;  5GPA A;  1LQ1 A;  4A3K J;  2E7W A;  3FM3 A;  2EFQ A;  3KIO A;  3UR3 C;  5DS9 A;  1MJ9 A;  2NOG A;  1HKS A;  2DT7 B;  4ZC3 A;  3R6S A;  3F9K A;  3BCA A;  1WJD A;  1S5L C;  2BHY A;  3QPH A;  2AO9 A;  3ZMU A;  3OY9 A;  1UJ8 A;  2YR2 A;  1ODD A;  4KN4 X;  3G73 A;  3HB9 A;  1YYV A;  1S7E A;  3VB2 A;  3DXJ F;  3CO6 C;  4A0Z A;  4PJJ A;  2ZXJ A;  1GDT A;  2WAE A;  2KIF A;  5IYC J;  3QAH A;  1FZP B;  5E79 C;  1HSJ A;  2XAG A;  1QVT A;  4M73 A;  1QZZ A;  3OWT A;  2R7O A;  4UVA A;  1JE8 A;  4KIF A;  5E3N A;  2W82 A;  3RCO A;  4A69 C;  2YPR A;  5E3L A;  1VQO I;  4JP0 A;  5E8I A;  1XCV A;  2FUG 2;  1ONV A;  2LKX A;  1DUX C;  3W2V A;  2DA2 A;  5LGU A;  5D5W B;  3HRS A;  2O9L A;  1B4A A;  4LIV A;  1MNM C;  2K9Q A;  2XAQ A;  3ASN H;  1H8A C;  2CW8 A;  5J40 A;  1TBX A;  1XSX A;  2ZJR F;  2OZU A;  1HDD C;  1LKX A;  2CQ7 A;  1TLH B;  2IPQ X;  3BZK A;  1WIB A;  5CVI A;  2DXI A;  2LK2 A;  3AKZ A;  3LSP A;  1VTN C;  3I59 A;  3K10 A;  1YJN I;  2WAD A;  3K7A J;  4RGR A;  2FF4 A;  2OV7 A;  2UV1 A;  5EYR A;  4R79 A;  5KCM A;  3ZMZ A;  3DEE A;  5KVR A;  3U2R A;  4G6T B;  4XLF A;  1VQ5 I;  3TL4 X;  1WJB A;  1ZGA A;  3FDY A;  5EF6 A;  2WWY A;  2L3D A;  4HV6 A;  1TQI A;  3VWB A;  4H4K C;  5IOY A;  3NEU A;  1D0X A;  3JAM K;  3CCR I;  1T0F C;  2DFI A;  2JJ7 A;  3L2R A;  3ZMS A;  3ZR8 X;  4A6D A;  4ZZD A;  3WTV C;  2RRE A;  5HS8 A;  3CUQ A;  1X1B A;  2HR3 A;  2BY3 A;  1IN5 A;  1OCR H;  3FX3 A;  2NVY J;  1EH7 A;  3CZ6 A;  4MTD A;  4PSX A;  3E5Q A;  3TP0 A;  2E1N A;  1E2X A;  3HOU J;  3JSO A;  2IAI A;  4X1E A;  2WBM A;  1QNT A;  5E8G A;  3C3W A;  3CCE I;  2ZJ2 A;  5FLX K;  3CF5 F;  1IW7 F;  2Q2E B;  3PQK A;  4U88 A;  4HOB A;  3GZ5 A;  3CTA A;  4B8X A;  2XRO A;  4EEF G;  1WJA A;  2EIJ H;  2X51 A;  1YW8 A;  3F8B A;  3CCJ I;  4PFP A;  1GHC A;  3CCS I;  2X6Y A;  2DA3 A;  1OYI A;  2L7Z A;  4RAZ A;  2VOO A;  1R5I D;  1ZHF A;  2OCE A;  2X6W A;  2QM3 A;  3P9K A;  4DYQ A;  4IZZ A;  2E34 A;  4G12 A;  1ETK A;  2CV2 A;  2TRT A;  3BG3 A;  2PMU A;  3GTK J;  3LOC A;  5H6Q A;  1DGR M;  3TO9 A;  4IKF A;  2W84 A;  2L9N A;  2FNA A;  3U1K A;  3TDU C;  1P6R A;  2ECC A;  4ENJ A;  2CFO A;  1BI3 A;  4XRF A;  2XAH A;  2HQA A;  2OZ6 A;  3ISP A;  4HZF A;  5C4J J;  1WKM A;  3O3K A;  3OYC A;  2B63 J;  2CW0 F;  1OCZ H;  1T2K A;  3TBI A;  2DMT A;  5ILU A;  5ILV A;  1QA6 A;  1T56 A;  3FKJ A;  4RGS A;  1QZY A;  4A3G J;  4CCO A;  4RAG A;  1SC7 A;  2VAS A;  2VBX A;  4L9T A;  2ZSI B;  4II3 A;  1TZL A;  3BWG A;  1Z7L A;  2EFP A;  3C18 A;  3K4J A;  2EQR A;  3KEO A;  5JVG F;  4A3F J;  1HCR A;  4HV5 A;  1SAU A;  1G3W A;  3RKY A;  2JZY A;  2KRC A;  2O3F A;  3ABU A;  1D1B A;  3IWZ A;  2M8E A;  3EGV B;  5FJ8 J;  3FIS A;  4WXD A;  4XKB A;  4FHT A;  2Y0M A;  1EKE A;  5M5X J;  1ZAO A;  3K4K A;  3EUK L;  3E5X A;  2A68 F;  3TO7 A;  1T33 A;  3D1N I;  5HDK A;  3FK7 A;  5JVT A;  3S3O A;  2STW A;  4UNO A;  2E35 A;  5D4S A;  1TNS A;  1N78 A;  5K5O A;  2ICW G;  5ICE A;  2QQ8 A;  3S3M A;  1GV5 A;  1FBU A;  1LJ9 A;  2HDC A;  3FHZ A;  3F8M A;  1JTY A;  4ZTF A;  5IY5 H;  2GM4 A;  1BJZ A;  3P5J A;  2YX7 A;  3L00 A;  3ABM H;  4LB5 A;  4LLN A;  1XS9 A;  1BC7 C;  1KON A;  3WTU C;  4C3I J;  1MDM B;  2IXS A;  2UZK A;  2A6T A;  2VN2 A;  4BQQ A;  3GTJ J;  3KX2 A;  4BHB A;  3J7A Y;  2F5D A;  1FX7 A;  3OS2 A;  4X6A J;  4D7M A;  2R7X A;  3I53 A;  3BG5 A;  3RPQ A;  4IRG A;  1TT0 A;  1GT0 C;  3N97 A;  2KIQ A;  4HF0 A;  3ECO A;  1FBS A;  1B59 A;  2BV6 A;  3K1P A;  5D6E A;  2QGU A;  2DJN A;  3F6V A;  4XLA A;  3FMS A;  4IHX A;  4A3B J;  1LDJ A;  4XLE A;  3WG7 H;  1LE8 A;  2ZO4 A;  3PIP F;  1I1G A;  2GXG A;  1MJB A;  3AG4 H;  3PSI A;  3G1O A;  5F27 A;  4BQO A;  3GLL A;  2Q1Z B;  4YFN F;  2CRG A;  3H3U A;  4KMU X;  5F1J A;  1ETW A;  1KA8 A;  1YW7 A;  1OLT A;  4ETS A;  1IDY A;  3OIP A;  5J4Y A;  3V8K A;  2VKV A;  2M34 A;  3DBH B;  2MH2 A;  2IRF G;  2ZKZ A;  3OS0 A;  4PGH A;  2HVR A;  3DPT A;  3RPU D;  3BTC A;  1Y1V J;  3GEZ A;  4FX0 A;  5HS9 A;  1UHS A;  4S05 A;  3IL2 A;  4L5I A;  4CCL A;  1RUN A;  2ECB A;  1WGX A;  2LY9 A;  2EB7 A;  3GBG A;  3KEY A;  3WOD F;  1D3Y A;  4AM3 A;  3OYI A;  5F6F A;  2AS5 F;  1U8R A;  2P6S A;  1UMQ A;  3GUD A;  1Z6T A;  3R0A A;  1Y6I A;  1V3F A;  2KZG A;  4IHW A;  5FRO A;  3OYD A;  4WXH A;  2HU9 A;  1L3L A;  3VYR B;  2LVS A;  5JR3 A;  2EIL H;  2DI3 A;  1MIJ A;  2DN0 A;  3ZRG A;  3L2W A;  2ZJQ F;  4GCV A;  1LDK B;  1H88 C;  2LC2 A;  2R4G A;  3PNT A;  1MBK A;  4XSX F;  4Y13 A;  1HC8 A;  1WJF A;  3DTK A;  3OYG A;  3BQY A;  5F64 A;  2UXN A;  2CWE A;  2R7Z J;  2X4H A;  1ACI A;  2L01 A;  3S93 A;  3HJE A;  4ON0 A;  4E6K G;  2PG4 A;  1B72 A;  5DD4 A;  5E3O A;  3W6V A;  4HPQ A;  1Z05 A;  3QU6 A;  2PQ8 A;  1X2N A;  2WAQ A;  3J80 Z;  5EG0 A;  4EQQ A;  2W7N A;  3GTM J;  2DU9 A;  3T1B A;  1Z6R A;  3Q9S A;  2JMW A;  3RKX A;  5M5Y J;  2R5Y A;  1STZ A;  3JRF A;  3VYU B;  3S1R J;  3DKY A;  1ORK A;  2YSR A;  5H20 A;  1Y39 A;  2X1E A;  4M9X A;  3WHB A;  4UB6 C;  1UHW A;  3OYM A;  5HNH A;  1H0M A;  1BC8 C;  3ZQQ A;  5HLH A;  3OIO A;  4HX7 A;  5EG0 B;  4C2T A;  3LSK A;  4HQM A;  3PFI A;  1O7F A;  1RKT A;  4OU0 A;  1AWC A;  1U2W A;  4A3J J;  1VQM I;  4UV8 A;  3PIO F;  3S1M J;  3DKW A;  3FXO A;  3B6C A;  3H9Q A;  3OSG A;  1HW2 A;  2DJI A;  2BYV E;  5E3M A;  3BT9 A;  5JLX A;  1OMI A;  2QCO A;  3DLA A;  4C9Y A;  3V42 A;  3T5X A;  4PFO A;  5DD8 A;  1XSD A;  5M5W J;  5J3L A;  1VQ6 I;  1TT5 B;  4RGX A;  2L9S A;  2DYS H;  3CC2 I;  1DPU A;  3H5N A;  1OR7 C;  3F6O A;  3JAM Z;  4NDL A;  1AU7 A;  3TDZ C;  2L02 A;  1UG0 A;  4LIU A;  1UAA A;  1IV8 A;  3VPR A;  2ZB9 A;  3FMQ A;  4HRI A;  3W2A A;  2O0Y A;  2HVQ A;  4NNJ A;  3H5A A;  3OYA A;  3RSN A;  1MW7 A;  2P5V A;  5DYM A;  5DDG A;  5IOZ A;  1B8I A;  2OJE D;  3HKZ A;  2VXD A;  1WHU A;  2DMU A;  4I7H A;  3GTP J;  5C4X J;  2AXT C;  2HKX A;  1UZC A;  1Z7U A;  2DFH A;  5L3D A;  2Y0S A;  4CDG A;  4M72 A;  2JA6 J;  1J9I A;  2IGK A;  4A6E A;  1JTX A;  1CF7 B;  2MW8 A;  2V79 A;  3F8C A;  5B1B H;  5KAI C;  4G9Y A;  1FYL A;  2VJJ A;  3CES A;  1XDS A;  2WAF A;  1TW2 A;  3U1D A;  5EJC A;  1YJW I;  4YIR X;  4FQG A;  2L5Q A;  1QQI A;  4Z6Y A;  3HUG B;  2VJI A;  2DTR A;  4AIJ A;  4S04 A;  4KUM A;  2Z2S B;  4HAM A;  3FXL A;  1RC9 A;  3HSE A;  4BE1 A;  3MKZ A;  2F6C A;  5FKN A;  4U7B A;  1REP C;  1V5G A;  3ESW B;  3GWZ A;  4GFB A;  2BY1 A;  5A2Q K;  1F1Z A;  3E0J B;  2OBP A;  2DOE A;  2H6C A;  5HS7 A;  5LGN A;  2MLG A;  1YI2 I;  1FOK A;  1TWF J;  2GXB A;  3N4M A;  3DEW A;  3L2Q A;  4CO8 A;  4CCK A;  4E7H A;  2ZXW H;  1XGO A;  1QPI A;  4M9S A;  1HOM A;  5F0F A;  3EET A;  2RNG A;  4CA0 A;  4IHY A;  4KIC A;  1NG6 A;  1R58 A;  2F48 A;  2E2H J;  2LF7 A;  2LOO A;  5FKK A;  3WTT C;  4HEA 2;  2F4M B;  5KK1 A;  2UXX A;  2VXZ A;  2XGE A;  4Q48 A;  4M3G A;  1FYM A;  1T39 A;  1Q1V A;  1MBF A;  4YFK F;  2K27 A;  3V7R A;  1AHD P;  4BJT A;  2WV1 A;  5L3G A;  2BEO A;  4FT8 A;  2RAE A;  2V9P A;  3WU2 C;  2HKO A;  4UVB A;  4XOR A;  4MTE A;  2A5Y B;  2QKL B;  3C2G A;  4UUT A;  2F4O B;  4XSZ F;  4IHV A;  4A3C J;  5FRN A;  2L2O A;  2V9K A;  1TQP A;  1OCO H;  2LP0 A;  3T8T A;  1BM9 A;  3KE2 A;  2G7U A;  4FIS A;  4I0B A;  1KZH A;  5EGO A;  1VFC A;  2DDB A;  3KP7 A;  3Q0V A;  1HST A;  4JX4 A;  4V19 K;  1YX5 A;  1OCT C;  2CUF A;  4BHP A;  4EV0 A;  3B02 A;  4IJA A;  4TV7 A;  5FD6 A;  5HLG A;  2E71 A;  4LOC A;  5CJ9 A;  3RKQ A;  1MBG A;  4Y33 A;  4BXU A;  4OIO F;  2KQR A;  1K78 A;  4XN3 A;  2R7S A;  3HOS A;  5L3F A;  3BR3 A;  1R23 A;  5HOO A;  4I0A A;  3G2B A;  2OTJ I;  4BUP A;  2DCE A;  5CVU A;  2JQ7 A;  5EGO B;  4PDK A;  2XRN A;  3I3L A;  5DCM A;  2F5F A;  3F22 A;  1VQ4 I;  2G0E A;  4HX8 A;  2AHQ A;  1G3Y A;  2M4G A;  2EZI A;  2ZFW A;  2L7K A;  1J0R A;  2KL4 A;  4M3F A;  5D4R A;  1LUJ B;  1ZKG A;  3CJT B;  2IP2 A;  2R7D A;  4LLG F;  1YRN B;  2HQN A;  1GVD A;  4EM1 A;  5ICF A;  4BAC A;  2ELH A;  2XAS A;  4DZJ A;  2GZW A;  2ELJ A;  1K78 B;  3FMR A;  4PCQ A;  3D5L A;  1WJE A;  2LRE A;  2V6C A;  3NAR A;  3BLY A;  1IUF A;  3TOA A;  3NWT A;  3SDG A;  2DMP A;  4D5F A;  1TWH J;  2MD0 A;  2YUS A;  2QEN A;  2ESH A;  2HWV A;  4ESB A;  1YLF A;  3GTG J;  3M1E A;  3QYB A;  2NYX A;  1R1U A;  1BN5 A;  2P7V B;  4F92 B;  2BBY A;  3ZQH A;  1YOV B;  4HF2 A;  1WJC A;  2DPD A;  3I4N J;  2QBY A;  4Y7N J;  1H9T A;  1HQC A;  3E7L A;  4P5O A;  3LFK A;  1AKH A;  2JSP A;  5L3B A;  4L9V A;  1Z0X A;  4XL9 A;  3BPV A;  4ESF A;  1OYY A;  1TNT A;  3HBL A;  4HQE A;  4HG2 A;  1ETO A;  5GAE J;  3GLX A;  2VON A;  2VL8 A;  4ABZ A;  4CYC B;  1DU6 A;  3CMA I;  1ZAR A;  2NNN A;  4XK4 A;  2Y2Z A;  3J81 K;  1LFP A;  2HDD A;  3BZC A;  4PGG A;  3OYL A;  4BU2 A;  1ON2 A;  2V1U A;  2RNJ A;  2GAU A;  3JRB A;  5AIQ A;  4B47 A;  1AOY A;  3E3V A;  5HNF A;  4AVP A;  1LDD A;  1PP8 F;  3JTG A;  3BPX A;  3HHG A;  1XX5 A;  2KP6 A;  3ECH A;  1VF9 A;  2R0Q C;  2ESN A;  5H2F C;  5BOX A;  1AA7 A;  4P96 A;  2D5V A;  1E17 A;  3DP7 A;  1P2F A;  1UST A;  2ZSH B;  3R61 A;  1O3T A;  2ETH A;  4MEY F;  2OTL I;  1SVO A;  2H27 A;  3MKY B;  4DNC A;  3J7Z I;  1S6L A;  3DU6 A;  4KNY A;  3PL8 A;  3ZCO A;  2Y75 A;  3GME A;  3MQ0 A;  1K4S A;  5HLT A;  1TQM A;  2NVX J;  2JRT A;  4D7N A;  2A6H F;  3CO7 C;  1BW6 A;  2AQF A;  1MND A;  4RM3 A;  4L0Z B;  3WGI A;  4CH7 A;  3F3X A;  2L54 A;  2M1B A;  1E3O C;  2HPM A;  3KYC B;  2IS6 A;  1A6I A;  4XM3 A;  2XF7 A;  5CVJ A;  2FML A;  5DTD A;  2H94 A;  2EFO A;  1ENH A;  1WH5 A;  1CQT A;  1ULY A;  1T38 A;  2VJ4 A;  4PJM A;  2ZME B;  1SFU A;  1SD6 A;  1BOA A;  1S29 A;  1IN8 A;  4GRI A;  2M0C A;  5EZH A;  2K02 A;  3M8F A;  4AIH A;  1R1T A;  3FF5 A;  5HDG A;  3KP2 A;  4P9U A;  3A02 A;  4BAY A;  4B3A A;  4N4N B;  3K70 C;  3HXL A;  4IF4 A;  4BBR J;  2CQX A;  1IAW A;  2K9M A;  5IYB J;  1XDU A;  2JN6 A;  5CQG A;  4I01 A;  2R7Q A;  3C2B A;  1X4O A;  3LAP A;  3SFZ A;  4NC7 A;  2B0L A;  2CSO A;  1XTA A;  1GVJ A;  2V6E A;  4U0V A;  3A4C A;  2L9V A;  2N8G A;  3GVA A;  2DA1 A;  4FE4 A;  2OAZ A;  4BH9 A;  3KYD B;  4KIS A;  1VQP I;  3RQI A;  3HRU A;  1SFE A;  3C7J A;  1RZ4 A;  4F3Q A;  5E18 F;  3M1C A;  1X2M A;  1YQA A;  3QP5 A;  3A03 A;  3RTR A;  4A5M A;  1WI9 A;  2R3S A;  3HDD A;  3N05 A;  3D0S A;  3V8J A;  2HEO A;  2I5U A;  2Z16 A;  1I5Z A;  4NHJ A;  3E6D A;  2QWW A;  4N9H A;  2LTP A;  3HSR A;  3OOU A;  5CQE A;  4OAY A;  1Y56 A;  1LPQ A;  2PMZ A;  2OQR A;  4BY1 J;  4AID A;  1Z91 A;  5J6X A;  2QEX I;  2ME6 A;  2JWT A;  3IH2 A;  2F5E A;  2VKH A;  3DF8 A;  3J7Y J;  4RM2 A;  3I59 B;  5HVQ C;  4B4C A;  3BOQ A;  2XVC A;  5JFR A;  2XDV A;  3CDH A;  4AD9 A;  4AYB A;  1G59 A;  4JBA A;  2JA2 A;  3OS1 A;  1IO2 A;  1OYW A;  4LMY A;  4UY8 I;  2XB5 A;  4LIT A;  3Q3S A;  2BE5 F;  2QA4 I;  1IRG A;  3DU5 A;  2DDA A;  4NQW A;  2EV0 A;  3MWM A;  1Z77 A;  1SEU A;  4LG3 A;  1ZRC A;  1XMA A;  2DK5 A;  4IQ4 A;  4LJZ F;  2ZME C;  3CUQ B;  4RB3 C;  1T6S A;  3E5U A;  2JVH A;  4L18 B;  2GLO A;  1ZH5 A;  3WTX C;  3WHC A;  4UXN A;  4UVC A;  3ZQL A;  1KGS A;  4ZH4 F;  5ICC A;  5LHH A;  2DOD A;  3FWE A;  3AFH A;  2R93 J;  3S3N A;  4ESJ A;  1OJL A;  1FY7 A;  3BTL A;  4W1U A;  4A5N A;  3DCF A;  3HG9 A;  1DP7 P;  2ZC2 A;  1X3U A;  3LNQ A;  2A5W A;  2QYO A;  3DQV C;  3HHH A;  1YS7 A;  1Z3X A;  3LQR A;  5FRM A;  1GV2 A;  4EAT A;  1D8J A;  4EGY A;  1X1A A;  1X3Z B;  1W0U A;  1NTC A;  3K4M A;  3KEQ A;  4EVI A;  4WWC A;  2NVU B;  3KZZ A;  5JHU A;  1BIA A;  3GYH X;  2WY8 Q;  4IO9 F;  2WB1 N;  3DFG A;  4HSR A;  5LLQ A;  1FC3 A;  3L2C A;  1FNN A;  3JCU C;  3K2A A;  3FXJ A;  2E1O A;  2M2E A;  1FJL A;  3VDX A;  4OMY A;  1NG7 A;  1SAN A;  2EA4 A;  3A0B C;  2COB A;  1EH8 A;  3DTI A;  1JKO C;  4EMS A;  1NHA A;  3H1C A;  4F52 A;  4IOA F;  1ETV A;  1MBE A;  1QRY A;  2OC6 A;  1H89 C;  1I27 A;  5CKT A;  1LEB A;  3FK6 A;  4AUX A;  4E7I A;  4D0P A;  1W7P A;  4B09 A;  3WU1 B;  3T0Y A;  3G6E I;  4CCN A;  4RB2 C;  2YU9 J;  3WE2 A;  3K6G A;  1ZGW A;  1SAX A;  2DA4 A;  2EA2 A;  3DPL C;  3H35 A;  3HTU A;  1A5J A;  2LMD A;  4A3M J;  1BBY A;  2LD5 A;  5E1X A;  3Q5F A;  1QZE A;  3FXR A;  3K4L A;  1G4D A;  4L5E A;  3GCM A;  2FX0 A;  2GOM A;  5FFZ A;  3UKG A;  2MG4 A;  3JRI A;  4F93 B;  2HYG D;  3RIR A;  3BJO A;  4I98 B;  2JRM A;  4HDU A;  2XV4 S;  2CYY A;  2EV6 A;  2R5Z A;  1QO0 D;  3KZY A;  2VT2 A;  2HZD A;  5FLV A;  2DOA A;  2V1D A;  1XN7 A;  3SHF A;  2VC1 A;  2L4A A;  2E7X A;  2OPT A;  2X48 A;  3CUQ C;  4DYR A;  3BJ6 A;  1QHG A;  1YW9 A;  4ENM A;  1QVU A;  3GO5 A;  3ZOB A;  4IPA A;  4MGR A;  2IS4 A;  4LD5 A;  2H8R A;  1D0Y A;  1U5T A;  1F9N A;  1UHM A;  2E60 A;  3OL3 A;  5LEK A;  2XPV A;  2X85 A;  5K7Z A;  2L4M A;  3CME I;  1KU2 A;  2X1D A;  2PX9 A;  1JT0 A;  2E36 A;  2GWR A;  1ZK8 A;  3O6B B;  2NXN B;  1X3W B;  2FBH A;  1VQL I;  3V4G A;  1RRJ A;  4BJ5 C;  1BI0 A;  4EJW A;  4BGD A;  5E20 A;  2BOL A;  1TP4 A;  2BY0 A;  2PFB A;  1XPX A;  1JI8 A;  3J7A O;  1NK2 P;  1W7P D;  3K1M A;  2V4J C;  4WK8 F;  4RB1 A;  3LST A;  4DJA A;  2V1X A;  3TO6 A;  2HPI A;  3L09 A;  2ZCW A;  4GGG A;  1IDZ A;  3CCV I;  1LE8 B;  4XKV A;  2VKD A;  3UNG C;  4AWX B;  1FMV A;  5IPA A;  5BQT A;  1EA3 A;  2EJR A;  1ETQ A;  1MMG A;  1R71 A;  3ABT A;  5EEH A;  2IA1 A;  2GA1 A;  2K3F A;  2ZNZ A;  2FRH A;  3I56 I;  1C0W A;  4UUS A;  2Z5U A;  1SVM A;  2LY2 A;  1BR4 A;  4ASN A;  5FD5 A;  2R7W A;  1K7A A;  3GTO J;  5IP9 J;  1MNE A;  4ZYA A;  4Y3O A;  3WE3 A;  2HFH A;  4EJT A;  3MZH A;  3K4B A;  4XBF A;  3L9F A;  4RA2 A;  2XPU A;  3LSJ A;  4BXX J;  3GTQ J;  2LH9 A;  3GF2 A;  1K6Y A;  4QLC U;  1IGN A;  2CG4 A;  1YX3 A;  3U21 A;  3QOP A;  2K9S A;  2IGN A;  4MQV A;  3OYJ A;  2GIZ A;  4FX4 A;  5IT9 K;  1XMK A;  4ZDL A;  4UUS B;  1HW1 A;  2P8T A;  3JRD A;  4MO7 A;  1WFX A;  3I54 A;  3AG2 H;  4KA4 A;  2EIN H;  2Q0O A;  3LSI A;  2L7F P;  2CO5 A;  2M5W A;  3A0H C;  2ZXI A;  1MSF C;  3CJS B;  4HNV A;  2XKO A;  3H3V K;  5J8C A;  2EV5 A;  4BNC A;  1S3J A;  2H09 A;  2VC0 A;  4IRI A;  3SZG A;  2LR8 A;  4HYE A;  4ZDO A;  1U3E M;  3R60 A;  2MH9 A;  1ZG3 A;  4A3L J;  3FXM A;  4OIR F;  3QYE A;  3C2H A;  2J5P A;  3HPH A;  4G94 A;  1KU3 A;  5DV5 A;  3A01 A;  4UUV A;  3IP4 B;  3WG9 A;  4F91 B;  1YTY A;  1B72 B;  2JUG A;  2XAU A;  3IC7 A;  2CQQ A;  4XKC A;  3M8J A;  1Y0U A;  2IGO A;  4NBQ A;  3H9J A;  3AG1 H;  1X1P A;  1ETY A;  2GXA A;  4PSW A;  1W1W E;  1N25 A;  1WI3 A;  4ITV A;  1D0Z A;  1P9Q C;  2XF5 A;  1WJ5 A;  4BDZ A;  2R5Y B;  1Y8R B;  2CUE A;  2RDP A;  1W4M A;  3FBI B;  1G8X A;  2FNP A;  2H6B A;  5M3M J;  4MHG A;  3X2Q H;  1UCR A;  4S0H B;  2DO7 A;  3EYI A;  1T98 A;  5GPC A;  4C30 A;  3K1N A;  1YS6 A;  2K9N A;  1R00 A;  2LG4 A;  3F8F A;  4GYG A;  4LG0 A;  1YIT I;  1R4N B;  1T95 A;  3HOZ J;  2TDX A;  1JKP C;  4Y15 A;  3Q0U A;  1V54 H;  1F43 A;  4I09 A;  2DMN A;  3HOT A;  4XR6 A;  3ZMV A;  2O5R A;  3LMM A;  2HTJ A;  2QVO A;  6PAX A;  2IGM A;  1HLV A;  2DQL A;  3DWL E;  4B44 A;  3WU0 A;  1W36 D;  9ANT A;  3F72 A;  1XSV A;  1B6A A;  1XMX A;  1J75 A;  3ZQC A;  4XLH A;  5DCF A;  2CGP A;  1IN6 A;  1XC5 A;  5C44 J;  2D1V A;  2VE9 A;  3QWL A;  1R6R A;  2PBI A;  2DFF A;  1FEX A;  4LB6 B;  1I39 A;  4X0G A;  5J1R A;  5FLX Z;  2W85 A;  3F23 A;  2LSO A;  1ZN2 A;  2MGQ A;  2VKE A;  1Z3Y A;  4G7O F;  1FPQ A;  4NC6 A;  5D5X B;  5LD2 C;  1IRX A;  4AC0 A;  3ZXS A;  4L9N A;  3IH3 A;  4II2 A;  4BBS J;  2P7C B;  3ZN1 A;  2PMZ N;  2VOD A;  2VLA A;  4JK1 X;  2Q8K A;  1JJ6 C;  1B8I B;  1BIB A;  3ZMT A;  3FXQ A;  2DBB A;  1NK3 P;  2RV8 A;  5EZG A;  4A2U A;  1DU0 A;  1EH6 A;  2Y31 A;  2QLZ A;  5BS6 A;  2LY1 A;  3U9G A;  3FXK A;  4CXF A;  2MD5 A;  1UEL B;  2DW4 A;  3ML6 A;  5AIP A;  3HPG A;  5M3F J;  1S9H A;  2E2I J;  1FSE A;  2ACJ A;  3QP6 A;  4RAY A;  4XRS G;  4B1R A;  3RI4 A;  4UHT A;  1E0E A;  2LDU A;  1OCC H;  2KT0 A;  2VUM J;  1O3R A;  2HZT A;  4RDU A;  1J7K A;  4A3E J;  2HYF A;  4XOP A;  4ENK A;  2IS2 A;  4E7Z A;  1Y0N A;  4J19 A;  2NAZ A;  2HOA A;  2KFD A;  4L9J A;  3LWF A;  1UFM A;  3ERM A;  2VQG A;  4E7K A;  3KP3 A;  3CCQ I;  3W6J B;  2XAJ A;  1K4T A;  2LBF A;  1YE9 A;  2PEX A;  1S7A A;  2AXL A;  1D5Y A;  2VB6 A;  3QPL A;  1OQY A;  2FJ1 A;  3HSF A;  3LSG A;  4HNT A;  4PJ0 C;  1EV7 A;  2HTS A;  1ZR2 A;  2L7M P;  2C6Y A;  2HNH A;  1ON1 A;  2XAF A;  2RKH A;  4G7H F;  3PO2 J;  3CQZ J;  5TGT A;  4EM0 B;  1QHH D;  4OAZ A;  4U0Y A;  4XIC A;  2EK5 A;  3CUO A;  1VZ0 A;  1I3A A;  2FQ3 A;  4M71 A;  3ZMD A;  3K0L A;  1ZR4 A;  2M4K A;  2LBF B;  3EQL F;  5BPI A;  3L1P A;  1T8I A;  3GFI A;  2K86 A;  1IXR C;  4DW6 A;  1Y1W J;  2QQA A;  3O2P E;  3OL4 A;  2G7H A;  3BR6 A;  3BG7 A;  3PM1 A;  1CGP A;  1EJ9 A;  4KIG A;  5EEG A;  5TJJ A;  2O03 A;  4NUB A;  4O5V A;  3QOD A;  2EZL A;  2Y9Z A;  4BEH A;  2FQ4 A;  1XGM A;  1ZEL A;  2RGV A;  3I0T A;  5D6F A;  2NVT J;  1I50 J;  2ID3 A;  2RVC A;  2M7B A;  3PSF A;  1U78 A;  1L0O C;  3AL0 B;  4OIP F;  2M87 A;  5LBQ A;  4XLP F;  3OR2 C;  1N77 A;  2NRA C;  3JRC A;  4E7L A;  5F1R A;  2K3P A;  4XON A;  3PUB A;  1D1C A;  1LVA A;  2CQN A;  1BJA A;  1XG1 A;  4LFU A;  4DBQ A;  1ZRE A;  4ZDP A;  1YO5 C;  1FP1 D;  5ERI A;  3T8R A;  3G1M A;  2DA5 A;  2IVM A;  4IXA A;  3SXY A;  2Z1D A;  1XCB A;  2XGX A;  2NNY A;  1Y8Q B;  2FU4 A;  2JPB A;  5K5R A;  4CCJ A;  4HNU A;  2XIG A;  5DCM B;  3IKT A;  3MN2 A;  2BW3 A;  3NAU A;  1S7O A;  2EWN A;  2NS8 A;  2HI3 A;  3IUO A;  4CUG A;  5B66 C;  1FT9 A;  1XGN A;  3MEX A;  5F0C A;  5JHF A;  3G71 I;  1RNL A;  2QSH X;  3VSL A;  2HOS A;  3E6B A;  2CH0 A;  4JX6 A;  1DPR A;  1OIS A;  3O8H A;  2RN7 A;  4XKW A;  4XMY A;  4XLN F;  3I9V 2;  4I76 A;  3H36 A;  4KMF A;  4LK1 F;  2MC4 A;  2VE8 A;  3FHN A;  4PK4 A;  5F04 A;  4CGZ A;  4YRV A;  3B73 A;  2KDO A;  2VPL A;  2BW3 B;  3TKY A;  3CD6 I;  1I1S A;  1USS A;  3HGG A;  2R7T A;  5J1U A;  4CIC A;  3E1S A;  3I5U A;  2BVM A;  4CCM A;  4J01 A;  4OOI A;  1S8N A;  1U9O A;  4L5J A;  1BI2 A;  4OIN F;  4BHC A;  4ZYH A;  2V26 A;  2O8X A;  3CF2 A;  3JSP A;  2QBY B;  3F8N A;  3NRV A;  4HST A;  5GAD J;  2JTV A;  2M0M A;  1YFH A;  3COA C;  1WWX A;  4BS9 A;  5IT9 Z;  2B9S A;  3CJQ B;  1AKH B;  1R1V A;  1SFX A;  4JQF A;  3G1L A;  3V7C A;  2K7L A;  1A6Q A;  2W00 A;  3MAJ A;  2Z33 A;  3EPZ A;  3KCC A;  3TED A;  1MGT A;  2V7F A;  2X1C A;  5C3E J;  1ZRF A;  5ILS A;  4QPO A;  4EJO A;  1ZG1 A;  2YS9 A;  1SFO J;  1WZ2 A;  4LLL A;  1T0F A;  2CV1 A;  5GP9 A;  1JUP A;  3W6K B;  4ZYE A;  3F21 A;  1ZGJ A;  1GXP A;  2RQP A;  3AL0 C;  1WPK A;  3H0D A;  1S72 I;  4BE0 A;  1TW3 A;  3TP3 A;  4B43 A;  1IN4 A;  3FZV A;  3HTS B;  3GTL J;  3ZN0 A;  1R5H A;  1QPM A;  2LNB A;  3OSF A;  2NVQ J;  2MFZ A;  2QKM B;  1B9N A;  4C3H J;  2DT6 A;  3E6M A;  3FBN B;  5AON A;  4AIK A;  2R7V A;  4MIM A;  4U0W A;  2K85 A;  2IA0 A;  1R7J A;  2K9L A;  3GFJ A;  5DUI A;  5DM6 F;  1MSE C;  1BR2 A;  3RKW A;  2WAQ N;  1YG2 A;  3PQJ A;  1Z1D A;  4QIW N;  5EEA A;  3LFU A;  5J47 A;  2VPR A;  3GX4 X;  1VQ7 I;  4Z2Y A;  1I6X A;  1D1A A;  3S15 J;  4JOM A;  1JUS A;  4IVN A;  1KQ9 A;  2M9H A;  4ENN A;  2QZ8 A;  3WGH A;  3JW4 A;  2J5O A;  3PNV A;  4FTH A;  1ZG5 A;  1RPW A;  3OV8 A;  3BR1 A;  2CUJ A;  3OYH A;  3H5R A;  5HOD A;  1MD0 A;  1BA5 A;  4HLY A;  2KJB A;  4RLF A;  1RR7 A;  5D5U B;  3CJN A;  1HA8 A;  4EM2 A;  4G8X A;  3J80 K;  2GOX B;  2WV0 A;  4E7S A;  5ED4 A;  3M7G A;  4CSW A;  1ERD A;  3P9C A;  1BL0 A;  5CPR B;  4ANJ A;  1IF1 A;  1JUM A;  4Y4R A;  3S2W A;  1Z9C A;  5D8L B;  4OWR B;  2KDZ A;  4DZP A;  1JHH A;  2M45 A;  5LHI A;  2F5V A;  2R7F A;  3TOB A;  2KZV A;  2PLY A;  3K69 A;  2TCT A;  2JUC A;  3SQN A;  4WCG A;  2IEK A;  4IRH A;  1IN7 A;  3CLO A;  3OYF A;  5GTH C;  4CHU A;  3IRR A;  1PUE E;  3PO3 J;  3EUA A;  1MZB A;  2F5C A;  4BY7 J;  4XQF A;  2O7O A;  4CZZ A;  1OKR A;  3CMM A;  3EYY A;  1W5C C;  1P4A A;  3E97 A;  5DUK A;  3WGG A;  3HKZ N;  5IP6 A;  2LRD A;  2HXI A;  4DQ2 A;  3VYT B;  1P7J A;  4PUS A;  2JA8 J;  3S8P A;  4G6Q A;  4P55 A;  4CZC A;  5A2Q Z;  1KYW A;  1FOW A;  2Y0S N;  3CCL I;  1G6N A;  2VQH A;  3MZ8 A;  4A0X A;  1GXQ A;  2FA5 A;  1R5G A;  1F36 A;  2A6E F;  2DK8 A;  3MMY B;  3QRF F;  4N4O B;  4C2U A;  4IHS A;  2F4I A;  2O8K A;  1IZ1 A;  2EH3 A;  2Q2E A;  3CC4 I;  3DBL B;  2ZFU A;  3BC8 A;  5JI6 A;  1FOY A;  3EUH A;  1WVR A;  3RQ4 A;  4AVZ A;  1FIP A;  1E3P A;  3BRO A;  3W2W A;  2A69 F;  1KQ8 A;  1MMS A;  2LFB A;  4JX5 A;  1B9M A;  3DLL F;  1NH3 A;  3HYI A;  2X0L A;  2OU2 A;  2Z3Y A;  4IOC F;  2P81 A;  4JYK A;  3H92 A;  1UB9 A;  1JKR C;  5JLW A;  4EGZ A;  4FET A;  2ZJP F;  2HOE A;  1QU3 A;  2VOP A;  3HOX J;  2R92 J;  2DFE A;  2P5K A;  3ONQ A;  2DQR A;  1HXD A;  2COM A;  2P6T A;  2W1O A;  3OOP A;  4PJL A;  4XRS A;  3BY6 A;  1JT6 A;  4PJN A;  1JJ8 C;  4KN7 X;  4RLQ A;  4MLO A;  3ZPL A;  2XHK A;  1D5V A;  4XRM A;  1SMT A;  4BDY A;  1ZLK A;  2HQR A;  3GXO A;  3I64 A;  3G3Z A;  3RZO J;  2MLK A;  2A07 F;  4NQW B;  4KIT B;  3BZ6 A;  2OQG A;  5GAH J;  3ERE D;  2ZNY A;  2H8W A;  2EFW A;  3LL7 A;  5KHD A;  2I8D A;  2LKP A;  3Q9V A;  3RJP A;  1X1C A;  3JRH A;  2UWM A;  2EIK H;  4A12 A;  1DQU A;  4RAF A;  3FM5 A;  3CJR B; 
#chains in the Genus database with same CATH homology
 1VQN I;  1VQK I;  3CMA I;  1YHQ I;  3G4S I;  3CCE I;  1VQ9 I;  3CF5 F;  3G71 I;  3CJS B;  1VQM I;  3PIO F;  1YJ9 I;  2QEX I;  3PIP F;  3CCJ I;  3CCS I;  3J7Y J;  2OTL I;  3CD6 I;  1VQ6 I;  3J7Z I;  2E34 A;  3CC2 I;  3CCQ I;  5GAG J;  4V19 K;  4UY8 I;  5GAD J;  3CCM I;  2QA4 I;  3CJQ B;  3CME I;  1QA6 A;  2E36 A;  2OTJ I;  3CC7 I;  1VQO I;  2NXN B;  2JQ7 A;  1VQ4 I;  1VQL I;  1YIJ I;  1YIT I;  1FOW A;  3I55 I;  3CCL I;  5DM7 F;  5JVG F;  1FOX A;  3CJT B;  3CC4 I;  1FOY A;  2ZJQ F;  1S72 I;  3CCV I;  2ZJR F;  3EGV B;  1YJW I;  1MMS A;  3DLL F;  4IOC F;  1HC8 A;  1WIB A;  1ACI A;  2K3F A;  2ZJP F;  1YJN I;  3I56 I;  4IO9 F;  2E35 A;  5DM6 F;  1VQ5 I;  3CCU I;  1VQ7 I;  1YI2 I;  3CCR I;  5GAH J;  4IOA F;  1VQP I;  2H8W A;  1VQ8 I;  2FOW A;  1Y39 A;  5GAE J;  3G6E I;  3CJR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...