2ZJPF

Thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
144
Chain Sequence
MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S RIBOSOMAL PROTEIN L33
total genus 17
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjpF02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2zjpF01
1VQ5I 1YJ9I 2OTJI 3CJRB 1VQ7I 3J7YJ 1YIJI 2JQ7A 1VQOI 1ACIA 3I55I 3CCQI 1S72I 1MMSA 2FOWA 3I56I 3CMEI 2ZJRF 1VQKI 3CCEI 4V19K 3G6EI 5GADJ 2NXNB 3CC4I 1YJNI 1YITI 3CC2I 3CCVI 3PIPF 3CCSI 4IOAF 1VQ6I 3CCUI 5GAEJ 5DM6F 4IO9F 2ZJQF 1VQLI 2E35A 2QA4I 5GAGJ 5DM7F 1FOXA 3J7ZI 3DLLF 2QEXI 3CCLI 3PIOF 1FOWA 1YI2I 5JVGF 2H8WA 5GAHJ 1YJWI 1VQ4I 1VQPI 2OTLI 3CMAI 1VQ9I 3G4SI 3CCJI 2E36A 2K3FA 1VQNI 1YHQI 3CJTB 3G71I 1VQ8I 4UY8I 3CF5F 3CCMI 1QA6A 3CJQB 3CD6I 3CCRI 1HC8A 1WIBA 1VQMI 4IOCF 3CC7I 1Y39A 2ZJPF 3EGVB 2E34A 1FOYA 3CJSB
chains in the Genus database with same CATH superfamily
5L3CA 4Z2YA 3JCUC 3IC7A 2EV6A 2VUMJ 1VQ7I 5AONA 3PNVA 4CCMA 4A3LJ 1D0XA 4YELA 1X3ZB 2XPWA 5DCMB 3WGGA 4RAYA 4UB8C 3I55I 3RI4A 2QQBA 5C3EJ 4BY7J 5DDGA 2WWYA 4EJTA 3HZJA 2M30A 2LK2A 2IA1A 5HS7A 2ZJRF 2DI3A 3CCYA 4ESJA 1U5TB 4P5OA 3FM3A 4YIFA 1E0EA 3Q9SA 2CMPA 1JGGA 3OYAA 4IHWA 3CZ6A 2HVSA 3S3NA 2LREA 3PIPF 2DA1A 3KP5A 3OYBA 5HLTA 4B3AA 3WU0A 2QBYB 1JUSA 1I50J 4IRIA 2IA2A 2JJ7A 2JRTA 2K9MA 1K79A 4PSWA 2PEXA 1I3QJ 4L9JA 5FLMJ 3HGYA 3RCOA 2XIGA 4M3GA 3VSLA 1FOKA 4PUSA 4F93B 4IRGA 5D5VB 2YUSA 4BU2A 1ZR4A 2OZ6A 2RVCA 2NNNA 2XPUA 5J6XA 2GBYA 3DTIA 3ZMUA 5D4SA 2LMDA 2MC4A 2AS5F 3Q0VA 2PQ8A 5FJ8J 2HPMA 5AIQA 4BJ6C 2Q1ZB 4CCLA 3AG1H 1IF1A 4JX6A 2NAZA 1IAWA 1Z21A 3ASNH 2FUG2 2AXTC 3QP5A 3GTLJ 4F7ZA 4XR6A 2R7UA 2Y0SN 1X1AA 1B9MA 4LG3A 2DAOA 2NYXA 3BR1A 4EEFG 1HCRA 1Z3YA 3U21A 4MEYF 2VC1A 4E70A 4QTRA 2IS2A 2D5VA 2V9KA 3H5NA 3FK7A 2ECBA 3RPUD 4YEJA 1XMAA 4BQNA 2LKXA 2BVMA 3K4KA 3S16J 2HKOA 2IPQX 1G3SA 3Q5FA 2KT0A 3FXOA 4XKBA 3S2HJ 1POGA 3PNTA 4A3FJ 1ZGWA 1FIAA 2VQGA 1VQMI 2V4JC 3QOEA 3HBLA 1S3JA 4G9YA 3SHFA 3BR2A 3ULQB 4BS9A 3IL2A 5E20A 3SFZA 1BA5A 3B6CA 5E79C 5E3NA 2W4SA 1BR2A 2LSOA 2XKOA 3S15J 4A3JJ 1BW6A 1XCVA 1F36A 3OYEA 3CJSB 1NG7A 4PJJA 4QWQA 2K27A 3CJRB 1Y8RB 4LIVA 2Y9ZA 1APLC 2HWVA 3PFYA 1IXCA 2A61A 2P81A 1N78A 2NVYJ 4XIDA 1FYMA 2Y9YA 4KUMA 3CCQI 2EFWA 2CQKA 2FBKA 2WTEA 4CZCA 3BG7A 5F1JA 2M87A 1BOAA 3TO9A 2R92J 3FX3A 4A3DJ 1XGNA 4GFBA 3FZVA 3AG3H 2EPFA 2YX4A 1B72B 3O8GA 1JKRC 1V3FA 4E7IA 1T6SA 3AG2H 4D5CA 2W25A 4WX9A 1V54H 4XOTA 4ZYAA 1KU7A 1TWHJ 3OYCA 2MG4A 4BQAA 2NVTJ 2ZXWH 2VIXA 3DQVC 5L3GA 4NHJA 2EFPA 3CTAA 3R0JA 4IQJA 5FD5A 1VQLI 2OPTA 3F0CA 3HM5A 1LPQA 3RDIA 5M3FJ 3MVPA 1F5TA 3IRRA 3IH2A 5DM7F 1FOXA 3QYBA 2A6EF 3DLLF 2LY9A 4LG0A 5LGUA 5BPDA 3GTGJ 1IUFA 4YFNF 4A93J 4UVAA 3DKWA 5JVGF 2BY0A 1V5FA 3H3ZA 1BOBA 5TISC 2W1OA 5F1RA 5IPAA 3ERMA 2DA3A 2YPRA 2LC2A 5J8CA 4F91B 2Z99A 4U88A 3ZMVA 4PFOA 1G3TA 3KP2A 2BV6A 2CRGA 1HA8A 1Z67A 4MNUA 4BACA 1U5TC 1FSHA 2IXSA 3H9JA 5L3FA 2IJLA 2L7FP 3I59B 4ZH4F 1D1AA 2GWRA 3O6BB 1S7AA 4MLOA 1W36D 4I98B 4AYBN 3TO6A 3MKZA 2K3FA 1VQNI 2R5YB 4A3MJ 3ROUA 5F0HA 1AOYA 5HLIA 4ZZLA 4N4OB 5E17F 4HNUA 2R3SA 1DPUA 1QHHD 2QYOA 3CCMI 4A3KJ 1YOVB 5ILVA 5F27A 2K40A 4AIHA 4MFDA 3DPTA 1BR1A 3KFWX 1FP1D 4CZZA 3BCBA 4IZZA 3CUQB 2E34A 1PUFA 1ZQ3P 2W57A 5BS6A 4B1RA 5JLXA 5KAFC 4AU7A 3HPHA 2E60A 2GXGA 4XN0A 4WF2A 4XLCA 4P9UA 4BGDA 3N97A 1Y1VJ 4BQOA 1IXSB 3JR9A 3FXKA 2ACJA 1OPCA 4NC6A 3J7YJ 2UXXA 3G1OA 4RB2C 1P9QC 1OYWA 2JQ7A 4FX4A 1DUXC 1F1ZA 2Z1DA 1VQOI 1UFMA 1FC3A 4XRSA 3MAJA 3R61A 1QZZA 4KISA 1MMSA 1FWZA 2XGXA 5LBQA 3L2WA 2KDZA 3TL4X 1TW3A 4P1WA 4Q48A 1I6XA 2XDVA 2KISA 1FLIA 4RGXA 3CC4I 2CFXA 2E1MB 4ZYHA 3UR3C 5F0CA 1O4XA 2GZWA 4I01A 2DJIA 2EINH 3ASOH 3KYLA 1I1SA 4ZDLA 1KGSA 3JSOA 1R1UA 4RM3A 1XN7A 2ZJQF 3WTVC 1YE9A 2CJJA 1A5JA 2CW7A 3GTOJ 1AKHA 2KIQA 1MMNA 2VKVA 5DD8A 3BWGA 2OF7A 3OYHA 1XDSA 2PMHA 1G6NA 2K85A 2DA2A 1GXPA 4A5MA 3CCLI 3AAFA 2GM4A 5KVRA 2XRNA 3OSGA 3M8JA 1YI2I 4X0GA 3WTUC 4IVNA 4DZJA 4OAZA 1TT5B 2P5VA 2BBYA 2RQQA 3MD2A 5CJ9A 2M0MA 2EV5A 1B8IB 1SD5A 1SMYF 3BZCA 4Y13A 3S1NJ 2H8RA 4A0XA 2HEOA 4M73A 4ZZDA 3GTJJ 2ELKA 3L2CA 2HVRA 4IKFA 1Y0NA 1ETKA 1Z05A 3M1CA 1D5YA 5L3BA 4JK1X 3J7AY 2Z33A 2X0LA 2WB1N 4N9HA 2TRTA 4YIIA 3PFIA 4E4HA 3HG9A 3OYDA 3A2KA 3OYNA 1ZRFA 2JUGA 3PQKA 4ABZA 3VODA 5IT3A 1RUNA 4MFEA 4KN4X 2PN6A 1O3RA 3QPLA 3DKYA 4M74A 1YTYA 2NS7A 1WRJA 5HNHA 2R7QA 3DBLB 2A6HF 1QNTA 4M6VA 3TW6A 3V7CA 4U7BA 4XMYA 3KP6A 2O61A 2K5CA 1D8KA 3LSMA 1DU0A 2V1UA 4B43A 5TJJA 3R0AA 2WA0A 2F48A 2DW4A 3JTHA 4MHGA 3LSPA 3HTSB 2STTA 3S14J 3K6GA 4M6XA 4XONA 3GO5A 3BDDA 2QQ9A 4BYYA 3ZMTA 1FMWA 3B6AA 3S1RJ 3QWLA 2KFDA 3SEZA 3CP2A 1MKMA 2ZFUA 4D7MA 2VE9A 1MBEA 3FMSA 2BY3A 4DJAA 3FXLA 1PVEA 2ZSIB 1SFXA 1SAUA 5J47A 4OIRF 1Y56A 2XF6A 2QSGX 3WE2A 4BHCA 3JRIA 3DXJF 1PYVA 1B72A 1LEAA 1MMAA 3BR0A 5IY5H 5HODA 4XKWA 4AVZA 1NK3P 3RJPA 2LP0A 4N0BA 1P4XA 4K2EA 1S29A 2ESHA 1QA6A 3GFLA 2WAQN 4GYGA 1VZ0A 2ADUA 2LG4A 3ZQ7A 4F92B 2BYVE 3HUGB 1GV5A 1JT0A 2OZUA 1JT6A 1P6RA 3M4OJ 4Y17A 4PJLA 4OMYA 3S3MA 1AWCA 4LG0B 5GPCA 1USSA 2DYSH 4FASD 2QA4I 2CGPA 1SD4A 3J81Z 2QM3A 4XKCA 2L7MP 5CVJA 1JGSA 4FQGA 4I09A 4HA8A 2RGVA 1TQMA 4Y52J 2JSCA 4KT5C 4XRSG 2O6GE 4B48A 2K3PA 1OR7C 2W82A 3M7GA 4X6AJ 1JUMA 2HDWA 2W48A 4IHVA 3ZOBA 2DBBA 4UUSB 4IHXA 5J8FA 4JX4A 1UG2A 3I5UA 1W5SA 3LAJA 3L2RA 2M34A 2XAHA 2RKHA 4AM3A 1DQUA 1GHCA 5D8KB 2DMPA 1WVRA 2DO7A 2CWEA 1Z6TA 3AFHA 1GVDA 4IX7A 1WQ2A 3K4JA 2HTJA 3KE2A 3CJTB 4FX0A 1MH4A 3LSKA 1BIAA 1W5TA 3CQZJ 2OJED 4NC8A 4XLFA 5CVRA 3OIPA 4NQWA 4UUTA 2BZTA 2R93J 1H0MA 2IS4A 3ZQFA 3N05A 3I64A 1WIBA 3A02A 4O5VA 4A6EA 3BQYA 3FIWA 4EJVA 2DFHA 4LB5A 4EJWA 1OMIA 4XLEA 2XPVA 2AO9A 2X6XA 4ZJZA 4XRFA 3W2AA 2OTJI 3VPRA 2WY8Q 2J5OA 5ILUA 4GYIA 1XD7A 2DOFA 3NWSA 4B09A 3P5JA 2LVSA 2D2WA 3RYRA 3LSJA 3CP8A 3T8RA 3S3OA 3BOQA 5ICEA 5FD6A 5FLXZ 2L0KA 2IBDA 4IJAA 3H35A 3ZGKA 1U8BA 1R71A 2L9RA 3KLOA 4Y4RA 5EGOA 1SMTA 2RC4A 2VPLA 1YJNI 1B9NA 1D0YA 5A2QZ 2AQFA 3GUDA 1EH6A 4JBAA 3NRVA 3HOZJ 3MWMA 3S1QJ 2E19A 1N75A 1ZTRA 2E71A 3FXRA 3HKZA 5EG0A 1XGOA 3SQNA 3MKWB 1UZCA 3L7WA 1TWGJ 3S17J 4PFPA 3K4CA 4A12A 3L2QA 1KQ8A 3R4KA 5DS9A 4HDVA 4QPOA 4WXHA 4L9NA 3UKGA 3HOVJ 4E7HA 4O6JA 2DK8A 2F5CA 1EF4A 3QODA 2YX7A 1SFUA 4RGSA 1SAXA 1BI3A 1YJWI 2LH9A 5JHUA 1R4MB 2KPMA 2A69F 3K1PA 1OCPA 3HGGA 3CO6C 3CMAI 2CQNA 4RGRA 1LKXA 2OUMA 3GCMA 3JAMZ 3CMMA 2HOAA 4CGZA 3BJAA 2X6OA 4L5EA 2JVGA 2P8TA 3SXYA 5DD4A 4GXOA 3I59A 1VFCA 1I39A 4Q4ZF 1RIOH 2HXOA 3ZQHA 4BXFA 2P6SA 3VYUB 4UUVA 2EIJH 4DYRA 5D5XB 2UV1A 3LA2A 4XLPF 4G8XA 4HF2A 2VODA 1I6HJ 1RR8C 1ZG5A 3D5LA 4C9YA 2XF7A 1BIBA 2XAGA 1K78A 1MBFA 2EIKH 1LFPA 5BPIA 1JHHA 5JI6A 2A05A 3OMYA 4PJNA 5D4RA 3SDGA 3WU1B 4RBOA 2ETHA 1IN7A 5FFZA 1ULYA 3V8JA 4MEXF 2EQRA 2QQAA 3BY6A 3CUQA 1MDMA 1R22A 1ZN2A 2X85A 2JA2A 1FOYA 4PJMA 4RAZA 1O3QA 4II2A 3VYRB 1T56A 3W3CA 2DMNA 1TWCJ 4HSRA 2Y2ZA 2E1NA 2DPDA 4IEJA 1RR7A 2DMQA 3TGNA 1YRNB 3J81K 5LRRA 2EH3A 4ESBA 2GA1A 4CXFA 5LEJA 3GYHX 4ASNA 4ZDPA 3D5SC 4A3GJ 2DN0A 1B6AA 3F8FA 3QPHA 1ACIA 2F4OB 4MO7A 1LDJA 2DA6A 3JRAA 4DBQA 3W2VA 2R5ZA 4WXDA 3I56I 2HVQA 4HDUA 2XB5A 4BQQA 1R5HA 4V19K 1TT0A 4L5IA 5LFAA 3L2VA 2E2HJ 2L5QA 4C3HJ 2H94A 2VJ5A 1IDYA 1O57A 2R0QC 2ZC2A 4PK4A 1KONA 1OCOH 4GRIA 2HOTA 3QU3A 2CUJA 3D5RC 2CFOA 2R7WA 1I1GA 3DCFA 3A01B 4B3XA 5B66C 1B4AA 3WGIA 4HLXA 5EG0B 3E5UA 2QQ8A 1JJ6C 1HLVA 1SFKA 3VB2A 1W7PB 4MTEA 4ENMA 2JA5J 2BHZA 2G0EA 2LDUA 2L9SA 1BM9A 3F8MA 1FOWA 2HPIA 4N9IA 2PJRB 3WG9A 1WH5A 2QWWA 4P96A 1IUYA 4EGYA 1VQPI 4HQMA 1WJEA 1XMKA 3G73A 3DBRB 3QYEA 3D0SA 4L0YB 1A35A 1K83J 3KZIC 1X2NA 3MCZA 3LNQA 4FT8A 5JVTA 4E7ZA 1USTA 3GZ5A 4FISA 2LFBA 1PDNC 3TMOA 4LLLA 2V6EA 4YFKF 3C18A 1ON1A 4EQQA 1K4SA 2WAFA 5IP9J 4J01A 1PUFB 2HFHA 1KYZA 2CQXA 3FDYA 4XSXF 1Y0UA 2V1NA 2XAJA 3K9TA 2A5YB 1KA8A 4IL6C 2XGCA 2L2OA 1H88C 1OCZH 3MMYB 2LBFB 4XM3A 4XSZF 2QF7A 1GT0C 3T1BA 1IV8A 3WTYC 4D1QA 4BE1A 4FTHA 4UV9A 3A0BC 2BW3B 1BL0A 4M3FA 1ETOA 2FRHA 1U0JA 3GZ6A 2DA7A 3LQQA 2KP6A 1RESA 3OR2C 3PSIA 4IF4A 3B73A 1P7JA 4DGWB 3OS2A 5BOXA 2O8KA 1XCBA 1UHWA 1OR7A 5B3SH 2QKLB 3WG7H 1W36C 4DIQA 2DFFA 2Z5UA 3K2AA 2JA8J 4EMSA 4PZJA 4U0VA 4KT6A 3L00A 4E7LA 2K9NA 1IRXA 4E7KA 3S1MJ 1B1BA 2VB6A 4QPQA 2E1OA 3PL8A 1ORKA 4JOMA 5C4JJ 2HOSA 2LF7A 1XC5A 1OQYA 4BDYA 3CC2I 2QKMB 3FHNA 4BKXA 2ZNYA 2KHMA 3TP0A 4IPAA 4HSTA 3ZXSA 1AA7A 1UAAA 2VJJA 5LRSA 2E1MC 3KP3A 3L09A 4HEA2 1MJBA 4G7HF 3HPGA 3ZQGA 3E6BA 3I9V2 5J4YA 2DTZA 1XG1A 3ELKA 4RS8A 1WJBA 5BNGA 3OIQA 3ABLH 3Q9VA 1H8AC 2VPRA 4E6KG 1EV7A 4H0EA 1TC3C 3FKJA 4RB1A 2H6CA 3EETA 4B8XA 3DTEA 2BHYA 4HYEA 4EGZA 3ESWB 4XRMA 3SFIA 3FK6A 3M8EA 2OA4A 4BY1J 2ELHA 3KEOA 1K6OA 3SJMA 2PJRA 3GF2A 3DLAA 5E1XA 5IOZA 2VC0A 2VBZA 3PUBA 1P7IA 2FF4A 3G4SI 2DXIA 2OCEA 4JX5A 5B1BH 2WAQA 1YG2A 5TGTA 2PFBA 2DLLA 1GLNA 2MD0A 3SZPA 1ON2A 4HPQA 1LFBA 4EM2A 3DBHB 3RZDJ 1R00A 4Q5SF 3HOXJ 3H5AA 1ENHA 2MC3A 3HC7A 5TRDA 4JP0A 4KJZA 3UNGC 1K4TA 4KDPA 2FNAA 3U9GA 5KCMA 4M3DA 2MBFA 3H1CA 1E2XA 3ECOA 1WKMA 2HYJA 4HX7A 1Z7UA 3V8KA 2Q2EA 3V4GA 2O3FA 4M3BA 5M5WJ 5DUIA 4C2TA 4A2UA 1EH8A 1X58A 2CYYA 2V26A 3HB9A 3ONQA 2FA5A 1CF7A 4E7SA 4IHSA 2O8XA 1ZRDA 1U9OA 4A69C 2EA4A 3HHGA 1HDDC 3H9QA 3V7RA 1NH3A 1WJFA 4BE2A 2V1XA 3MEXA 3TP3A 2YU3A 3IRQA 3CLOA 1R23A 1Y8QB 4E7JA 2VXZA 3HL2A 3M9AA 2DOAA 3C1DA 1Z0XA 1DPRA 3PJRA 1I5ZA 3JRDA 1N77A 1D1BA 3FKIJ 5J4VA 1ZLJA 2ZMEB 3QQAA 3I4PA 4LK0F 2BY2A 1D1CA 1FT9A 2WC2A 3KPHA 3F72A 2HR3A 3REOA 2FOWA 1ZR2A 3X2QH 3I54A 2QLZA 2FU4A 3MQ0A 4HQEA 3GMEA 5IYDJ 2V7FA 3HOTA 1OKRA 1XSXA 1WHUA 2DYRH 2QGUA 1P92A 4MTDA 1ZHFA 1WPKA 3EPZA 5CVUA 3RIRA 4AWXB 1M1EB 3CCSI 2WB1A 1LB2A 1W5CC 3MN2A 4EJOA 5GAEJ 2MFZA 4KITB 4I0BA 5LHHA 2Q8KA 4L0ZB 2Y0MA 4CHUA 2HZDA 5HDGA 2RV8A 3DF8A 3EDPA 3LA7A 1RPWA 3CF2A 3WODF 3NWTA 2XC7A 1HQCA 2FOKA 3J7ZI 3L1PA 5JFRA 2Y30A 2PBIA 2G9WA 1RETA 4LK1F 2XB0X 2JUCA 2ZXJA 2O5RA 2W24A 2EB7A 1WI3A 2CQ7A 4RM2A 3H3VK 4ON0A 2ZKZA 2ZBKA 3I3LA 3ZQIA 3T0YA 5FO5A 4CH7A 1BJAA 5LLQA 4RGUA 1R1TA 1Z91A 2MABA 3FHZA 2R5YA 2O0YA 1S7OA 3Q3SA 4TV7A 1ZELA 4XK4A 1FZPB 5EZHA 2CQQA 2NS8A 2V79A 5D6FA 1K78B 4CYCB 2MA3A 1WJDA 1IJWC 5FB2A 2FQ4A 1TP4A 2L4MA 4PDKA 2LLKA 1OISA 5CQEA 1A04A 1WGXA 4ANJA 2F5EA 3RPQA 2CUEA 3L2UA 1G8XA 4J00A 1RKTA 4ITVA 4R8HA 3OYIA 3MZHA 3AL0C 2IEKA 5B5EC 2KMUA 4M6YA 1XSDA 2EK5A 3EUHC 2JK3A 3RQ4A 3NAUA 3ZN0A 1RRJA 1T33A 3GLLA 2CV0A 4BUPA 1ZH5A 4WXCA 2Y31A 4M72A 1HF0A 3RYPA 2CS3A 3J80Z 2DDAA 1R49A 1SEUA 3Q0UA 1U2WA 4KA4A 2BXZA 2EILH 1EJ9A 5DYMA 5FGMA 3C7JA 1LEBA 1KZHA 3BJOA 3HYIA 2ZMEA 2R7XA 3RKYA 3BT9A 3FBIB 3G1MA 2XF5A 5HDKA 1H89C 1ZKGA 2HU9A 4F55A 5K7HA 1E17A 1SVLA 2CW8A 4UV8A 1X4PA 2RAEA 1C0WA 2ECCA 2KJCA 3G6EI 2JA7J 2V1DA 2X1DA 4BHPA 2M45A 5EEAA 3DV8A 5DTDA 3VEPA 4AIJA 3JAMK 4O3MA 1QPMA 3H92A 4BBRJ 4C2MJ 2VQLA 4Y7NJ 4IOAF 4LGWA 3TDUC 4P9FA 1QU3A 3GTPJ 2DFEA 5HVQC 2P4WA 4PGHA 1S7EA 2DA5A 1FEXA 2CU7A 5EEGA 3OWTA 3GFIA 1QPIA 2QZ8A 2O03A 2E35A 3FXUA 2PI0A 2CUZA 1DGWY 2NNYA 2FMYA 2WAEA 3OOPA 3LSTA 1IRFA 4Z6YA 3OYKA 1KQ9A 2QEXI 2FMLA 1NTCA 1XSVA 2MLGA 2P5LC 4U0WA 3BQZA 2VL8A 1MH3A 2GOXB 5CVVA 5CVIA 3G1LA 1ZARA 1A31A 1Z9CA 5A2QK 3LL7A 3QPSA 4XICA 2X1EA 3K69A 2M7BA 5EDNA 1SANA 1MBJA 4OIQF 2VONA 2VKEA 2FE3A 3HEFA 1GXQA 2XSJC 3H36A 3WGHA 2R7DA 5FLXK 1E3OC 3BLYA 4RB0A 2R7ZJ 5IT9K 2EFQA 2HXIA 3J7AO 3EYIA 4XQFA 2DPUA 3MFKA 3DU5A 1MDMB 1WSUA 2N8GA 3E1SA 3SZTA 1N25A 2RREA 2RN7A 4KIBA 4M9SA 5J1RA 2GIVA 4UY8I 2ZMEC 3DEEA 3RZOJ 1CF7B 1JHFA 4CO8A 2FEZA 5FRMA 3FBNB 2JN6A 2OQRA 2WBMA 3CLQA 4IOCF 1WJAA 1IDZA 1FBSA 1W4MA 2R4GA 4A3IJ 4V2FA 3KP4A 4CSWA 5BQTA 1MIJA 2CV2A 1MZBA 4FCYA 2LY2A 4BNCA 1YS6A 1R1VA 4NQWB 2UZKA 1L0OC 3LMMA 1PUEE 4X1EA 4HLYA 3ZP5A 2HQNA 3DWLE 4EM1A 5L3DA 1VF9A 1HKSA 2BXYA 4QIWN 4GDFA 2L7KA 2R7TA 1DGRM 4FE4A 5FKKA 1YIJI 3A03A 3M8FA 4HG2A 2G7UA 2EA2A 2PG4A 1TNSA 3BROA 3FXQA 4HZFA 4CCJA 4U0YA 1ZG1A 2DTRA 2M7AA 3RKWA 1WH7A 4R1HA 2WY7Q 3ISPA 3QAHA 1A6IA 5ED4A 4U7DA 2L02A 4EM0B 2ID6A 1E3HA 2LKSA 4LFUA 5EF6A 2ICWG 2JPCA 2W85A 3OY9A 2B7EA 1QVTA 5LGTA 1P2FA 2VJ4A 3G3ZA 2E5ZA 4A0YA 3DPLC 1MBGA 4LITA 3CCVI 2NRAC 3LSIA 3HOYJ 3W6KB 2M3AA 5ICGA 3HUGA 2PMUA 3I53A 2VBXA 4I99C 3VOEA 3W2WA 4XLAA 1FBQA 4XLNF 1SFEA 2Z16A 5GTHC 3LA3A 2ZXHA 4XKVA 3WE3A 4YIRX 2RNGA 1XPXA 3DTKA 1RZ4A 3GW2A 1BI1A 1W1WE 2K9LA 1REPC 2P7CB 1CQTA 1YW8A 3BTJA 4KIGA 4AUXA 5E3MA 1X1PA 4XLHA 3BZ6A 1MNDA 2QVOA 3OIOA 3AKZA 1VTNC 3LFKA 4BXUA 1BI0A 2D1HA 2I8DA 4J19A 1FBUA 5FKMA 5GAHJ 4EJUA 3BP8A 2M4KA 3B02A 4UVBA 1VQ4I 1HKTA 1ETXA 1YYVA 3FISA 2G7HA 3NQOA 3O3KA 4WCGA 2STWA 5E3OA 1J9IA 4LJZF 2EIMH 1VQ9I 2EBIA 3KEQA 4AVPA 1JJ8C 1FMVA 4L5JA 1LVKA 3KP7A 2NS0A 2VE8A 5EYRA 4AYBA 3EYYA 3BCAA 2H1LA 2HKXA 2IGOA 2H27A 1ZYRF 3ABKH 5CLSA 2YU9J 3TBIA 1U3EM 3ZCOA 1V55H 2MYSA 2RDPA 2OQGA 3ABUA 2GQQA 1BJZA 2XROA 2ME6A 4RAGA 1U9NA 3BZKA 2HQAA 2NVUB 3T8TA 1H9GA 5EZGA 2R7OA 1HW2A 2B0LA 1VQ8I 3K4BA 2EZLA 2QCOA 1MBHA 4WK8F 3CF5F 2M9HA 5HLHA 3IKVA 3F23A 1XDUA 2V9PA 4C3JJ 1HC8A 1ZRCA 4I02A 2IVMA 3WTTC 1BN5A 2DFIA 2D45A 4HW0A 1V5EA 2A68F 2X48A 1A6QA 1VNDA 5LD2C 1MNMC 3S93A 2KZVA 4PGGA 4G6DA 3KZYA 3ERED 2VT2A 3KCCA 3O2PE 1F4KA 3PSFA 4N4NB 2IW5A 4MQ9F 2VN2A 3RQIA 1O7FA 3HSFA 3K2ZA 1NK2P 4F3QA 3GEZA 2FSWA 2UXNA 1KU2A 3H5RA 4LIUA 2BGCA 3OR1C 2ZJ2A 2B9SA 3I4NJ 1MNEA 4AD9A 3CMEI 3FF5A 3GTKJ 1S5LC 1O7LA 4S04A 1YRNA 3I71A 2L9NA 1BC7C 3HSEA 2VKHA 2XKPA 5GADJ 5ICCA 2D1VA 2IAIA 2NXNB 3TO7A 2BVLA 3I0TA 2FNPA 4CICA 4OINF 3F8CA 2DA4A 5C44J 1TWFJ 1R9TJ 1ERDA 5E1ZB 2ZCWA 3HRTA 3IKTA 4ENKA 5FRNA 1S8NA 3OYFA 4IO9F 1TQIA 3BR3A 4LOCA 2EZKA 2K02A 5D5UB 3WTXC 2QBYA 1G2HA 1OCCH 1T08B 1U8RA 4CA0A 3L9FA 4I0AA 4CCNA 1R6RA 2HDDA 1ETWA 1J59A 1X4OA 5GAGJ 1ZREA 4L9TA 1MMGA 4A3CJ 2ME0A 3PNYA 3ZMSA 1XTAA 4IHYA 2F4IA 4D0PA 1P4WA 3FXJA 3HRSA 2PX9A 1B59A 5K7FA 4NB5A 3DU6A 1W7PA 5IYBJ 5K5RA 2IGKA 1UB9A 5E3LA 4RB3C 3H0GJ 2KJBA 2CSOA 3QYFA 1OCTC 3E6CC 4IQ4A 3OYGA 3CMYA 3OSFA 5DEQA 4M3EA 3QOPA 1JKPC 4XOPA 2VQHA 3K7AJ 1PJRA 2Q2EB 2JSPA 2OC6A 2FJ1A 3PUFA 4OOIA 1WI9A 4W1UA 3WTZA 2KLOA 3GZNB 2YS9A 2Y0SA 2MD5A 1YHQI 1LUJB 3HRUA 1ITYA 1D5VA 4G6QA 1EH7A 2X51A 2ISYA 3FMQA 3G71I 2PLYA 2Z2SB 3CCRI 4QSHA 4KICA 2HI3A 5D6EA 4B47A 1OLTA 4YRVA 2MH9A 4I76A 1BR4A 1UJ8A 2V9VA 3DPUA 5K1YA 4OIOF 2XAQA 4HNVA 4HAMA 3RKXA 2QSHX 1X3UA 4BDZA 3PO3J 6PAXA 1T38A 1FYLA 3E0JB 3WTWC 2EZIA 3F21A 1TTYA 3ZR8X 2VOPA 5J3LA 3K4MA 1SVMA 1IN4A 1JKQC 1VI0A 2XHKA 1JI8A 2LBFA 3K10A 2VLAA 2R5ZB 5EGOB 2J5PA 2DJNA 2KL4A 4W97A 5CYVA 4LMYA 1I3AA 4CUGA 3M1EA 2KIUA 2LF8A 4KFCA 3IWZA 3DEUA 3GLXA 2ZB9A 1R7JA 3ML6A 4HOBA 5IYCJ 2XSDC 2DMUA 1OYIA 2HTSA 3P9KA 3Q0WA 2ISZA 2VBWA 1QVUA 4G7OF 1TWAJ 4GO1A 1T98A 4OU0A 5GTIC 3KX2A 2YR2A 1FPQA 2QUFA 3GTMJ 4A3EJ 3V42A 3ABMH 1MSEC 3A01A 2R7VA 4NNJA 1F9NA 2KQRA 2LRDA 5D8LB 1AU7A 3CCUI 3CJNA 1YFHA 5KK1A 3VYTB 3HXLA 5M3MJ 1V4RA 1WWXA 3H3UA 4KMUX 1JXSA 2B63J 3MZYA 3QU6A 1LE8B 3OYJA 2M0CA 5BMZA 5LHGA 2F5FA 2JPBA 2HYGD 1D3YA 5K5OA 1IN5A 1X19A 2XGEA 3CUOA 4UUSA 3JRGA 4C30A 2JZYA 2HS5A 4A3BJ 1OFCX 5EEHA 1SVOA 1ZAOA 2IGNA 3HIFA 3U2RA 4OIPF 3BG6A 1T2KA 3ZPLA 1FTZA 1AKHB 2EZHA 3LWFA 4CYDA 2LKPA 1QGPA 2YSRA 2LYCA 2VASA 5H6RA 3GX4X 4BL0B 1IRGA 4DZPA 2DQRA 2DT7B 2W00A 3PM1A 4NDLA 4BJTA 3HKZN 4D5FA 3WHBA 4C3IJ 2WADA 2OBPA 4RMNA 2NOJB 2E36A 4UB6C 3R6SA 1XMXA 2OU2A 3K1NA 1W0TA 5GP9A 4ZTFA 1T39A 3HJEA 1RC9A 2K86A 2NVQJ 1IZ1A 1JTYA 1MW7A 4ENNA 1LQ1A 4JQFA 5LHIA 4A0ZA 4KIFA 2LD5A 1TBXA 1PP7U 5K7ZA 1IG7A 4NBQA 3VFZA 1FX7A 3E6DA 1HSTA 4RAFA 3U1KA 4DW6A 1J2XA 1BBYA 2AHQA 3G2BA 3H0DA 3LSGA 1JE8A 3HTUA 3CJQB 5E8GA 1FIPA 1YX5A 2MGQA 4II3A 2ZO4A 2EFOA 2X6YA 4OWRB 4AC0A 1Y39A 1QO0D 3IV5A 1ETQA 1BI2A 3IP4B 4F52A 5C4XJ 5HNFA 4HV6A 1Z7LA 3VSKA 3F8NA 1R4NB 3NARA 2FXAA 2F5DA 1JKOC 3VDXA 4V2GA 2K4BA 5J40A 4BE0A 4HF1A 2P6TA 2VOOA 2IT0A 1YIOA 3LSRA 3CESA 5KAIC 2L4AA 4I7HA 3WHCA 2A07F 2JWTA 3S32A 3OL3A 4XBFA 1YW9A 3I4MJ 3DFGA 2P0WA 3OS1A 3E5XA 4BJ5C 2PJPA 1ONVA 3JRFA 5EJCA 5FFXA 1MBKA 4RLFA 4AIKA 1K7AA 3GFJA 1IN6A 1XX5A 4EATA 5IOYA 1T0FA 5IP7J 1FY7A 5LEKA 3F6OA 1RI7A 1IV6A 2Y48A 2BY1A 4UVCA 3FWEA 5DM6F 1X1CA 5FROA 3BR5A 1GV2A 4BH9A 4I6ZA 3KETA 5M5YJ 5IP6A 3RSNA 1XB4A 1SD6A 5E18F 2H6BA 3GVAA 2ID3A 2BE5F 2JRMA 3MZ8A 3LQRA 5H20A 2P7VB 3BG9A 3BTIA 4WWCA 1Z1DA 1SFOJ 2XAUA 1Z3XA 2X9DA 1V5GA 2L3DA 2XAFA 3SEQA 2KIFA 3U1DA 2E7XA 4G12A 4ZYEA 3OS0A 3PO2J 3JTGA 4HX4A 5F0FA 1LJ9A 1YLFA 3ZMZA 1DP3A 1BW5A 1SD7A 2MW8A 2RQPA 1UCRA 3TQNA 2ZFWA 4G94A 1K61A 3C2BA 2TCTA 1UHMA 1X1BA 2HGCA 5AIPA 2GIZA 1WZ2A 4HV5A 4RLQA 2IA0A 2BOLA 3K4LA 2RNJA 5L3EA 1R5ID 3DKXA 2COMA 3HHHA 2XVCA 1KU3A 2PMZN 2ELJA 4DBRA 3QP6A 4HX8A 4KYWA 1F43A 3BG5A 3BR6A 1OYYA 3CD6I 2BW3A 2WV1A 3RKQA 3IHUA 3J80K 4KMFA 1YW7A 3KYDB 2FBHA 3FMRA 2I10A 2IP2A 5ILSA 4MQVA 3CC7I 3BPVA 1HW5A 3EGVB 2GAUA 1XGSA 4L9VA 3BG3A 4I2OA 2GXBA 4G6TB 5J1UA 3VWBA 3S2WA 2WV0A 1IN8A 1ODDA 2VKDA 3MKLA 3C2HA 2A6TA 1P4AA 1CGPA 3GTQJ 3AG4H 5CQGA 2GA2A 1MSFC 2JA6J 1MJ9A 5FLVA 2LNBA 4BEHA 4C2UA 5ICFA 1S72I 2I5UA 1PP8F 1XS9A 1G3WA 1UMQA 2LR8A 1TNTA 4B44A 3F9KA 1FJLA 3CO7C 2FQ3A 1HDPA 4KNYA 4M9XA 5E1WA 5CPRB 2E1CA 3JREA 1BC8C 3K1MA 1G59A 4EV0A 1S6LA 4OMZA 1S9HA 3M3YJ 2DT6A 2K4JA 5HLGA 4JYKA 1TW2A 5E8IA 4PJ0C 4R79A 1I27A 2CUFA 2EJRA 2ZSHB 3F22A 1GVJA 5ERIA 1EKEA 2MH2A 1WJCA 2M5WA 3FXMA 2XRLA 3E3VA 5B1AH 1QRYA 3SYTA 1DP7P 1G3YA 4FETA 5DUKA 1UHSA 2DODA 3P7NA 3S2DJ 5HDNA 5HOOA 5FKLA 2K9SA 1RKWA 2HOEA 3C3WA 2L01A 2C6YA 2IS1A 3T5XA 2GLOA 3TEDA 4Y33A 1YX3A 3O8HA 3SDBA 2JMWA 1L3LA 1FTTA 1STZA 3GBGA 2AXLA 3ZMDA 1YQAA 2DMTA 3ZRGA 3IAM2 3K70C 1U6GA 3LOCA 2HNHA 5H2FC 3CCJI 2VQCA 2GOMA 1OJLA 4ESFA 1ETYA 3PQJA 1MMDA 4IXAA 2VT3A 4XORA 1D8JA 3S8PA 3F3XA 1EA3A 4S05A 1W0UA 1ZGAA 4EVIA 2W7NA 4NC7A 5JR3A 1HW1A 4HRIA 1Q1HA 2LY1A 2VXDA 3IUOA 1AHDP 2CH0A 4GGGA 9ANTA 5JLWA 3HRMA 2XV4S 4DYQA 2UWMA 2KZGA 4LLNA 1J09A 3ZQQA 4XN3A 4AIDA 5FKOA 4CCKA 4CCOA 3BJ6A 3W6VA 2Z9OA 2V6CA 1QBJA 2KRCA 1VQ5I 1YJ9I 3KIOA 2DU9A 3CUQC 3P9CA 4HF0A 1QZYA 1HOMA 5GPAA 2F6CA 2K7LA 3JW4A 4Y3OA 2HQRA 3MKYB 3TOAA 2GXAA 1KQ0A 2P5KA 2NOGA 4PSXA 3KZZA 1LDDA 2CV1A 1RNLA 5M5XJ 1T0FC 2BEOA 2QSFX 2KRHA 5F64A 2LOOA 3C2GA 3HSRA 1MGTA 3E6MA 2W84A 3K4NA 4B4CA 2DDBA 4IHTA 2ZNZA 3IWFA 4LD5A 4DYCA 2H1KA 2FBIA 3TDZC 1Z6RA 3GFMA 2DOEA 2CG4A 3AL0B 3OYLA 3KEYA 1XGMA 1K6YA 2L9VA 2OCCH 2E2JJ 3CDLA 5JHFA 3IAS2 3HOWJ 2R7SA 3EQLF 5DCFA 1IRZA 1TLHB 2Q0OA 1JTXA 4XL9A 5CKTA 2R7FA 4Y15A 1WFXA 3P9IA 3DP7A 1QHGA 3BC8A 1MD0A 1QZEA 5F6FA 3HDDA 2MLKA 1KU9A 1YO5C 1UG0A 4UXNA 1X1DA 2OD5A 2X6WA 4D9JA 2E2IJ 1J5YA 4XNFA 4HNTA 1QQIA 2OV7A 3PIOF 1R5GA 2XUBA 4P55A 2H8WA 1TZLA 1H9TA 5FKNA 2H09A 4A6DA 3F8BA 3LFUA 3E5QA 3K0LA 5DV5A 4UNOA 2XGDA 2PMZA 4Q47A 2M4GA 1NHAA 5F08A 1ZLKA 1ZK8A 1GDTA 4OAYA 4CYCA 2EV0A 3EUKL 4MIMA 4KN7X 4ZTJA 3ZQLA 1OCRH 3OV8A 3E7LA 1FNNA 1B8IA 2OAZA 1D0ZA 2DCEA 4DOZA 1IGNA 1ZG3A 2JVHA 1IC8A 1T8IA 3E97A 3RTRA 3CDIA 2R7RA 1X2MA 1E3PA 3ABTA 4BXXJ 3HOSA 4DQ2A 4FHTA 4ZYDA 3WTSC 4ZC3A 3OYMA 2NVXJ 5KNLA 1LNWA 3A0HC 1TL8A 3H9GA 3BTLA 3WU2C 4DNCA 1O3SA 2F5VA 2VJIA 3N4MA 4BHBA 2LTPA 4QLCU 3DEWA 4M9ZA 2KRFA 2A5WA 2L7ZA 3M07A 3ECHA 2XASA 4ZDOA 1IO2A 2KKOA 4G7ZF 1G4DA 2F4MB 1R36A 5DCMA 2DQLA 4BEHB 3D1NI 1J75A 2EFNA 2M2EA 2Z3YA 4FE7A 2EWNA 2HZTA 1SC7A 1WJ5A 3SZGA 1U5TA 3ZQCA 3TW7A 3LAPA 5J1YA 4RA2A 2M1BA 3F6VA 2JTVA 1Y6IA 1VQKI 5LGNA 3CCEI 4L18B 4M71A 2HYFA 4GCVA 1NG6A 2AQEA 2UUZA 1YITI 1LE8A 2M8GX 1IXRC 1W7PD 2HQ5A 2KDOA 2MSYA 1HKQA 3GWZA 4LB6B 1MJAA 1VQ6I 1Q1VA 5HS8A 1RUOA 3W6JB 4NUBA 5K5QA 2HDCA 1ZGJA 2O7OA 5KHDA 1LVAA 1TQPA 1YS7A 1R58A 1O3TA 1FYKA 2FX0A 1UELB 3I58A 4ETSA 3IH4A 2DT5A 3JSPA 3OOUA 3EUAA 4U87A 1HXDA 2O9LA 2E5NA 4S0HB 2JT1A 1J0RA 3TOBA 3V7SA 3COAC 2Y69H 1X3WB 1A36A 2CW0F 2TDXA 3FM5A 1Y1WJ 1Z77A 2COBA 3JRHA 3HOUJ 3OL4A 1LDKB 2OTLI 5H6QA 4YG2F 4CDGA 4A5NA 2F2EA 4HBLA 3NEUA 3KYCB 2DK5A 1JUPA 3LSHA 3EUHA 2IS6A 3KLNA 4ENJA 3RPUA 3GXOA 2L54A 3CDHA 3R60A 2FD5A 4IRHA 1J7KA 4H4KC 3QRFF 3TKYA 2KIMA 2Y75A 3ZN1A 2A3SA 3A1YA 3JRCA 1KYWA 2VI6A 4PCQA 1HSJA 5HS9A 1FP2A 4YFXF 2IRFG 5IT9Z 1FSEA 2CO5A 3JRBA 2ZXIA 1LFUP 4UHTA 3VYSB 3BTCA 4BBSJ 5D5WB 3IH3A 2VBYA 1DDNA 3QPTA 3K70D 4ZYGA 3A4CA 4LLGF 4D7NA 2ZJPF 5F04A 3V8LA 2X4HA 1T95A 2E7WA 2K9QA 2M8EA 1DU6A 1GUUA 2ESNA 2QENA 2X1CA 1ETVA 1IW7F 2IGMA 3BPXA 4BAYA 4MGRA 1U78A 4RDUA 1HBXG 1WCMJ
chains in the Genus database with same CATH topology
1VQ5I 1YJ9I 2OTJI 3CJRB 1VQ7I 3J7YJ 1YIJI 2JQ7A 1VQOI 1ACIA 3I55I 3CCQI 1S72I 1MMSA 2FOWA 3I56I 3CMEI 2ZJRF 1VQKI 3CCEI 4V19K 3G6EI 5GADJ 2NXNB 3CC4I 1YJNI 1YITI 3CC2I 3CCVI 3PIPF 3CCSI 4IOAF 1VQ6I 3CCUI 5GAEJ 5DM6F 4IO9F 2ZJQF 1VQLI 2E35A 2QA4I 5GAGJ 5DM7F 1FOXA 3J7ZI 3DLLF 2QEXI 3CCLI 3PIOF 1FOWA 1YI2I 5JVGF 2H8WA 5GAHJ 1YJWI 1VQ4I 1VQPI 2OTLI 3CMAI 1VQ9I 3G4SI 3CCJI 2E36A 2K3FA 1VQNI 1YHQI 3CJTB 3G71I 1VQ8I 4UY8I 3CF5F 3CCMI 1QA6A 3CJQB 3CD6I 3CCRI 1HC8A 1WIBA 1VQMI 4IOCF 3CC7I 1Y39A 2ZJPF 3EGVB 2E34A 1FOYA 3CJSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 I;  1YJ9 I;  2OTJ I;  3CJR B;  1VQ7 I;  3J7Y J;  1YIJ I;  2JQ7 A;  1VQO I;  1ACI A;  3I55 I;  3CCQ I;  1S72 I;  1MMS A;  2FOW A;  3I56 I;  3CME I;  2ZJR F;  1VQK I;  3CCE I;  4V19 K;  3G6E I;  5GAD J;  2NXN B;  3CC4 I;  1YJN I;  1YIT I;  3CC2 I;  3CCV I;  3PIP F;  3CCS I;  4IOA F;  1VQ6 I;  3CCU I;  5GAE J;  5DM6 F;  4IO9 F;  2ZJQ F;  1VQL I;  2E35 A;  2QA4 I;  5GAG J;  5DM7 F;  1FOX A;  3J7Z I;  3DLL F;  2QEX I;  3CCL I;  3PIO F;  1FOW A;  1YI2 I;  5JVG F;  2H8W A;  5GAH J;  1YJW I;  1VQ4 I;  1VQP I;  2OTL I;  3CMA I;  1VQ9 I;  3G4S I;  3CCJ I;  2E36 A;  2K3F A;  1VQN I;  1YHQ I;  3CJT B;  3G71 I;  1VQ8 I;  4UY8 I;  3CF5 F;  3CCM I;  1QA6 A;  3CJQ B;  3CD6 I;  3CCR I;  1HC8 A;  1WIB A;  1VQM I;  4IOC F;  3CC7 I;  1Y39 A;  2ZJP F;  3EGV B;  2E34 A;  1FOY A;  3CJS B; 
#chains in the Genus database with same CATH topology
 5L3C A;  4Z2Y A;  3JCU C;  3IC7 A;  2EV6 A;  2VUM J;  1VQ7 I;  5AON A;  3PNV A;  4CCM A;  4A3L J;  1D0X A;  4YEL A;  1X3Z B;  2XPW A;  5DCM B;  3WGG A;  4RAY A;  4UB8 C;  3I55 I;  3RI4 A;  2QQB A;  5C3E J;  4BY7 J;  5DDG A;  2WWY A;  4EJT A;  3HZJ A;  2M30 A;  2LK2 A;  2IA1 A;  5HS7 A;  2ZJR F;  2DI3 A;  3CCY A;  4ESJ A;  1U5T B;  4P5O A;  3FM3 A;  4YIF A;  1E0E A;  3Q9S A;  2CMP A;  1JGG A;  3OYA A;  4IHW A;  3CZ6 A;  2HVS A;  3S3N A;  2LRE A;  3PIP F;  2DA1 A;  3KP5 A;  3OYB A;  5HLT A;  4B3A A;  3WU0 A;  2QBY B;  1JUS A;  1I50 J;  4IRI A;  2IA2 A;  2JJ7 A;  2JRT A;  2K9M A;  1K79 A;  4PSW A;  2PEX A;  1I3Q J;  4L9J A;  5FLM J;  3HGY A;  3RCO A;  2XIG A;  4M3G A;  3VSL A;  1FOK A;  4PUS A;  4F93 B;  4IRG A;  5D5V B;  2YUS A;  4BU2 A;  1ZR4 A;  2OZ6 A;  2RVC A;  2NNN A;  2XPU A;  5J6X A;  2GBY A;  3DTI A;  3ZMU A;  5D4S A;  2LMD A;  2MC4 A;  2AS5 F;  3Q0V A;  2PQ8 A;  5FJ8 J;  2HPM A;  5AIQ A;  4BJ6 C;  2Q1Z B;  4CCL A;  3AG1 H;  1IF1 A;  4JX6 A;  2NAZ A;  1IAW A;  1Z21 A;  3ASN H;  2FUG 2;  2AXT C;  3QP5 A;  3GTL J;  4F7Z A;  4XR6 A;  2R7U A;  2Y0S N;  1X1A A;  1B9M A;  4LG3 A;  2DAO A;  2NYX A;  3BR1 A;  4EEF G;  1HCR A;  1Z3Y A;  3U21 A;  4MEY F;  2VC1 A;  4E70 A;  4QTR A;  2IS2 A;  2D5V A;  2V9K A;  3H5N A;  3FK7 A;  2ECB A;  3RPU D;  4YEJ A;  1XMA A;  4BQN A;  2LKX A;  2BVM A;  3K4K A;  3S16 J;  2HKO A;  2IPQ X;  1G3S A;  3Q5F A;  2KT0 A;  3FXO A;  4XKB A;  3S2H J;  1POG A;  3PNT A;  4A3F J;  1ZGW A;  1FIA A;  2VQG A;  1VQM I;  2V4J C;  3QOE A;  3HBL A;  1S3J A;  4G9Y A;  3SHF A;  3BR2 A;  3ULQ B;  4BS9 A;  3IL2 A;  5E20 A;  3SFZ A;  1BA5 A;  3B6C A;  5E79 C;  5E3N A;  2W4S A;  1BR2 A;  2LSO A;  2XKO A;  3S15 J;  4A3J J;  1BW6 A;  1XCV A;  1F36 A;  3OYE A;  3CJS B;  1NG7 A;  4PJJ A;  4QWQ A;  2K27 A;  3CJR B;  1Y8R B;  4LIV A;  2Y9Z A;  1APL C;  2HWV A;  3PFY A;  1IXC A;  2A61 A;  2P81 A;  1N78 A;  2NVY J;  4XID A;  1FYM A;  2Y9Y A;  4KUM A;  3CCQ I;  2EFW A;  2CQK A;  2FBK A;  2WTE A;  4CZC A;  3BG7 A;  5F1J A;  2M87 A;  1BOA A;  3TO9 A;  2R92 J;  3FX3 A;  4A3D J;  1XGN A;  4GFB A;  3FZV A;  3AG3 H;  2EPF A;  2YX4 A;  1B72 B;  3O8G A;  1JKR C;  1V3F A;  4E7I A;  1T6S A;  3AG2 H;  4D5C A;  2W25 A;  4WX9 A;  1V54 H;  4XOT A;  4ZYA A;  1KU7 A;  1TWH J;  3OYC A;  2MG4 A;  4BQA A;  2NVT J;  2ZXW H;  2VIX A;  3DQV C;  5L3G A;  4NHJ A;  2EFP A;  3CTA A;  3R0J A;  4IQJ A;  5FD5 A;  1VQL I;  2OPT A;  3F0C A;  3HM5 A;  1LPQ A;  3RDI A;  5M3F J;  3MVP A;  1F5T A;  3IRR A;  3IH2 A;  5DM7 F;  1FOX A;  3QYB A;  2A6E F;  3DLL F;  2LY9 A;  4LG0 A;  5LGU A;  5BPD A;  3GTG J;  1IUF A;  4YFN F;  4A93 J;  4UVA A;  3DKW A;  5JVG F;  2BY0 A;  1V5F A;  3H3Z A;  1BOB A;  5TIS C;  2W1O A;  5F1R A;  5IPA A;  3ERM A;  2DA3 A;  2YPR A;  2LC2 A;  5J8C A;  4F91 B;  2Z99 A;  4U88 A;  3ZMV A;  4PFO A;  1G3T A;  3KP2 A;  2BV6 A;  2CRG A;  1HA8 A;  1Z67 A;  4MNU A;  4BAC A;  1U5T C;  1FSH A;  2IXS A;  3H9J A;  5L3F A;  2IJL A;  2L7F P;  3I59 B;  4ZH4 F;  1D1A A;  2GWR A;  3O6B B;  1S7A A;  4MLO A;  1W36 D;  4I98 B;  4AYB N;  3TO6 A;  3MKZ A;  2K3F A;  1VQN I;  2R5Y B;  4A3M J;  3ROU A;  5F0H A;  1AOY A;  5HLI A;  4ZZL A;  4N4O B;  5E17 F;  4HNU A;  2R3S A;  1DPU A;  1QHH D;  2QYO A;  3CCM I;  4A3K J;  1YOV B;  5ILV A;  5F27 A;  2K40 A;  4AIH A;  4MFD A;  3DPT A;  1BR1 A;  3KFW X;  1FP1 D;  4CZZ A;  3BCB A;  4IZZ A;  3CUQ B;  2E34 A;  1PUF A;  1ZQ3 P;  2W57 A;  5BS6 A;  4B1R A;  5JLX A;  5KAF C;  4AU7 A;  3HPH A;  2E60 A;  2GXG A;  4XN0 A;  4WF2 A;  4XLC A;  4P9U A;  4BGD A;  3N97 A;  1Y1V J;  4BQO A;  1IXS B;  3JR9 A;  3FXK A;  2ACJ A;  1OPC A;  4NC6 A;  3J7Y J;  2UXX A;  3G1O A;  4RB2 C;  1P9Q C;  1OYW A;  2JQ7 A;  4FX4 A;  1DUX C;  1F1Z A;  2Z1D A;  1VQO I;  1UFM A;  1FC3 A;  4XRS A;  3MAJ A;  3R61 A;  1QZZ A;  4KIS A;  1MMS A;  1FWZ A;  2XGX A;  5LBQ A;  3L2W A;  2KDZ A;  3TL4 X;  1TW3 A;  4P1W A;  4Q48 A;  1I6X A;  2XDV A;  2KIS A;  1FLI A;  4RGX A;  3CC4 I;  2CFX A;  2E1M B;  4ZYH A;  3UR3 C;  5F0C A;  1O4X A;  2GZW A;  4I01 A;  2DJI A;  2EIN H;  3ASO H;  3KYL A;  1I1S A;  4ZDL A;  1KGS A;  3JSO A;  1R1U A;  4RM3 A;  1XN7 A;  2ZJQ F;  3WTV C;  1YE9 A;  2CJJ A;  1A5J A;  2CW7 A;  3GTO J;  1AKH A;  2KIQ A;  1MMN A;  2VKV A;  5DD8 A;  3BWG A;  2OF7 A;  3OYH A;  1XDS A;  2PMH A;  1G6N A;  2K85 A;  2DA2 A;  1GXP A;  4A5M A;  3CCL I;  3AAF A;  2GM4 A;  5KVR A;  2XRN A;  3OSG A;  3M8J A;  1YI2 I;  4X0G A;  3WTU C;  4IVN A;  4DZJ A;  4OAZ A;  1TT5 B;  2P5V A;  2BBY A;  2RQQ A;  3MD2 A;  5CJ9 A;  2M0M A;  2EV5 A;  1B8I B;  1SD5 A;  1SMY F;  3BZC A;  4Y13 A;  3S1N J;  2H8R A;  4A0X A;  2HEO A;  4M73 A;  4ZZD A;  3GTJ J;  2ELK A;  3L2C A;  2HVR A;  4IKF A;  1Y0N A;  1ETK A;  1Z05 A;  3M1C A;  1D5Y A;  5L3B A;  4JK1 X;  3J7A Y;  2Z33 A;  2X0L A;  2WB1 N;  4N9H A;  2TRT A;  4YII A;  3PFI A;  4E4H A;  3HG9 A;  3OYD A;  3A2K A;  3OYN A;  1ZRF A;  2JUG A;  3PQK A;  4ABZ A;  3VOD A;  5IT3 A;  1RUN A;  4MFE A;  4KN4 X;  2PN6 A;  1O3R A;  3QPL A;  3DKY A;  4M74 A;  1YTY A;  2NS7 A;  1WRJ A;  5HNH A;  2R7Q A;  3DBL B;  2A6H F;  1QNT A;  4M6V A;  3TW6 A;  3V7C A;  4U7B A;  4XMY A;  3KP6 A;  2O61 A;  2K5C A;  1D8K A;  3LSM A;  1DU0 A;  2V1U A;  4B43 A;  5TJJ A;  3R0A A;  2WA0 A;  2F48 A;  2DW4 A;  3JTH A;  4MHG A;  3LSP A;  3HTS B;  2STT A;  3S14 J;  3K6G A;  4M6X A;  4XON A;  3GO5 A;  3BDD A;  2QQ9 A;  4BYY A;  3ZMT A;  1FMW A;  3B6A A;  3S1R J;  3QWL A;  2KFD A;  3SEZ A;  3CP2 A;  1MKM A;  2ZFU A;  4D7M A;  2VE9 A;  1MBE A;  3FMS A;  2BY3 A;  4DJA A;  3FXL A;  1PVE A;  2ZSI B;  1SFX A;  1SAU A;  5J47 A;  4OIR F;  1Y56 A;  2XF6 A;  2QSG X;  3WE2 A;  4BHC A;  3JRI A;  3DXJ F;  1PYV A;  1B72 A;  1LEA A;  1MMA A;  3BR0 A;  5IY5 H;  5HOD A;  4XKW A;  4AVZ A;  1NK3 P;  3RJP A;  2LP0 A;  4N0B A;  1P4X A;  4K2E A;  1S29 A;  2ESH A;  1QA6 A;  3GFL A;  2WAQ N;  4GYG A;  1VZ0 A;  2ADU A;  2LG4 A;  3ZQ7 A;  4F92 B;  2BYV E;  3HUG B;  1GV5 A;  1JT0 A;  2OZU A;  1JT6 A;  1P6R A;  3M4O J;  4Y17 A;  4PJL A;  4OMY A;  3S3M A;  1AWC A;  4LG0 B;  5GPC A;  1USS A;  2DYS H;  4FAS D;  2QA4 I;  2CGP A;  1SD4 A;  3J81 Z;  2QM3 A;  4XKC A;  2L7M P;  5CVJ A;  1JGS A;  4FQG A;  4I09 A;  4HA8 A;  2RGV A;  1TQM A;  4Y52 J;  2JSC A;  4KT5 C;  4XRS G;  2O6G E;  4B48 A;  2K3P A;  1OR7 C;  2W82 A;  3M7G A;  4X6A J;  1JUM A;  2HDW A;  2W48 A;  4IHV A;  3ZOB A;  2DBB A;  4UUS B;  4IHX A;  5J8F A;  4JX4 A;  1UG2 A;  3I5U A;  1W5S A;  3LAJ A;  3L2R A;  2M34 A;  2XAH A;  2RKH A;  4AM3 A;  1DQU A;  1GHC A;  5D8K B;  2DMP A;  1WVR A;  2DO7 A;  2CWE A;  1Z6T A;  3AFH A;  1GVD A;  4IX7 A;  1WQ2 A;  3K4J A;  2HTJ A;  3KE2 A;  3CJT B;  4FX0 A;  1MH4 A;  3LSK A;  1BIA A;  1W5T A;  3CQZ J;  2OJE D;  4NC8 A;  4XLF A;  5CVR A;  3OIP A;  4NQW A;  4UUT A;  2BZT A;  2R93 J;  1H0M A;  2IS4 A;  3ZQF A;  3N05 A;  3I64 A;  1WIB A;  3A02 A;  4O5V A;  4A6E A;  3BQY A;  3FIW A;  4EJV A;  2DFH A;  4LB5 A;  4EJW A;  1OMI A;  4XLE A;  2XPV A;  2AO9 A;  2X6X A;  4ZJZ A;  4XRF A;  3W2A A;  2OTJ I;  3VPR A;  2WY8 Q;  2J5O A;  5ILU A;  4GYI A;  1XD7 A;  2DOF A;  3NWS A;  4B09 A;  3P5J A;  2LVS A;  2D2W A;  3RYR A;  3LSJ A;  3CP8 A;  3T8R A;  3S3O A;  3BOQ A;  5ICE A;  5FD6 A;  5FLX Z;  2L0K A;  2IBD A;  4IJA A;  3H35 A;  3ZGK A;  1U8B A;  1R71 A;  2L9R A;  3KLO A;  4Y4R A;  5EGO A;  1SMT A;  2RC4 A;  2VPL A;  1YJN I;  1B9N A;  1D0Y A;  5A2Q Z;  2AQF A;  3GUD A;  1EH6 A;  4JBA A;  3NRV A;  3HOZ J;  3MWM A;  3S1Q J;  2E19 A;  1N75 A;  1ZTR A;  2E71 A;  3FXR A;  3HKZ A;  5EG0 A;  1XGO A;  3SQN A;  3MKW B;  1UZC A;  3L7W A;  1TWG J;  3S17 J;  4PFP A;  3K4C A;  4A12 A;  3L2Q A;  1KQ8 A;  3R4K A;  5DS9 A;  4HDV A;  4QPO A;  4WXH A;  4L9N A;  3UKG A;  3HOV J;  4E7H A;  4O6J A;  2DK8 A;  2F5C A;  1EF4 A;  3QOD A;  2YX7 A;  1SFU A;  4RGS A;  1SAX A;  1BI3 A;  1YJW I;  2LH9 A;  5JHU A;  1R4M B;  2KPM A;  2A69 F;  3K1P A;  1OCP A;  3HGG A;  3CO6 C;  3CMA I;  2CQN A;  4RGR A;  1LKX A;  2OUM A;  3GCM A;  3JAM Z;  3CMM A;  2HOA A;  4CGZ A;  3BJA A;  2X6O A;  4L5E A;  2JVG A;  2P8T A;  3SXY A;  5DD4 A;  4GXO A;  3I59 A;  1VFC A;  1I39 A;  4Q4Z F;  1RIO H;  2HXO A;  3ZQH A;  4BXF A;  2P6S A;  3VYU B;  4UUV A;  2EIJ H;  4DYR A;  5D5X B;  2UV1 A;  3LA2 A;  4XLP F;  4G8X A;  4HF2 A;  2VOD A;  1I6H J;  1RR8 C;  1ZG5 A;  3D5L A;  4C9Y A;  2XF7 A;  1BIB A;  2XAG A;  1K78 A;  1MBF A;  2EIK H;  1LFP A;  5BPI A;  1JHH A;  5JI6 A;  2A05 A;  3OMY A;  4PJN A;  5D4R A;  3SDG A;  3WU1 B;  4RBO A;  2ETH A;  1IN7 A;  5FFZ A;  1ULY A;  3V8J A;  4MEX F;  2EQR A;  2QQA A;  3BY6 A;  3CUQ A;  1MDM A;  1R22 A;  1ZN2 A;  2X85 A;  2JA2 A;  1FOY A;  4PJM A;  4RAZ A;  1O3Q A;  4II2 A;  3VYR B;  1T56 A;  3W3C A;  2DMN A;  1TWC J;  4HSR A;  2Y2Z A;  2E1N A;  2DPD A;  4IEJ A;  1RR7 A;  2DMQ A;  3TGN A;  1YRN B;  3J81 K;  5LRR A;  2EH3 A;  4ESB A;  2GA1 A;  4CXF A;  5LEJ A;  3GYH X;  4ASN A;  4ZDP A;  3D5S C;  4A3G J;  2DN0 A;  1B6A A;  3F8F A;  3QPH A;  1ACI A;  2F4O B;  4MO7 A;  1LDJ A;  2DA6 A;  3JRA A;  4DBQ A;  3W2V A;  2R5Z A;  4WXD A;  3I56 I;  2HVQ A;  4HDU A;  2XB5 A;  4BQQ A;  1R5H A;  4V19 K;  1TT0 A;  4L5I A;  5LFA A;  3L2V A;  2E2H J;  2L5Q A;  4C3H J;  2H94 A;  2VJ5 A;  1IDY A;  1O57 A;  2R0Q C;  2ZC2 A;  4PK4 A;  1KON A;  1OCO H;  4GRI A;  2HOT A;  3QU3 A;  2CUJ A;  3D5R C;  2CFO A;  2R7W A;  1I1G A;  3DCF A;  3A01 B;  4B3X A;  5B66 C;  1B4A A;  3WGI A;  4HLX A;  5EG0 B;  3E5U A;  2QQ8 A;  1JJ6 C;  1HLV A;  1SFK A;  3VB2 A;  1W7P B;  4MTE A;  4ENM A;  2JA5 J;  2BHZ A;  2G0E A;  2LDU A;  2L9S A;  1BM9 A;  3F8M A;  1FOW A;  2HPI A;  4N9I A;  2PJR B;  3WG9 A;  1WH5 A;  2QWW A;  4P96 A;  1IUY A;  4EGY A;  1VQP I;  4HQM A;  1WJE A;  1XMK A;  3G73 A;  3DBR B;  3QYE A;  3D0S A;  4L0Y B;  1A35 A;  1K83 J;  3KZI C;  1X2N A;  3MCZ A;  3LNQ A;  4FT8 A;  5JVT A;  4E7Z A;  1UST A;  3GZ5 A;  4FIS A;  2LFB A;  1PDN C;  3TMO A;  4LLL A;  2V6E A;  4YFK F;  3C18 A;  1ON1 A;  4EQQ A;  1K4S A;  2WAF A;  5IP9 J;  4J01 A;  1PUF B;  2HFH A;  1KYZ A;  2CQX A;  3FDY A;  4XSX F;  1Y0U A;  2V1N A;  2XAJ A;  3K9T A;  2A5Y B;  1KA8 A;  4IL6 C;  2XGC A;  2L2O A;  1H88 C;  1OCZ H;  3MMY B;  2LBF B;  4XM3 A;  4XSZ F;  2QF7 A;  1GT0 C;  3T1B A;  1IV8 A;  3WTY C;  4D1Q A;  4BE1 A;  4FTH A;  4UV9 A;  3A0B C;  2BW3 B;  1BL0 A;  4M3F A;  1ETO A;  2FRH A;  1U0J A;  3GZ6 A;  2DA7 A;  3LQQ A;  2KP6 A;  1RES A;  3OR2 C;  3PSI A;  4IF4 A;  3B73 A;  1P7J A;  4DGW B;  3OS2 A;  5BOX A;  2O8K A;  1XCB A;  1UHW A;  1OR7 A;  5B3S H;  2QKL B;  3WG7 H;  1W36 C;  4DIQ A;  2DFF A;  2Z5U A;  3K2A A;  2JA8 J;  4EMS A;  4PZJ A;  4U0V A;  4KT6 A;  3L00 A;  4E7L A;  2K9N A;  1IRX A;  4E7K A;  3S1M J;  1B1B A;  2VB6 A;  4QPQ A;  2E1O A;  3PL8 A;  1ORK A;  4JOM A;  5C4J J;  2HOS A;  2LF7 A;  1XC5 A;  1OQY A;  4BDY A;  3CC2 I;  2QKM B;  3FHN A;  4BKX A;  2ZNY A;  2KHM A;  3TP0 A;  4IPA A;  4HST A;  3ZXS A;  1AA7 A;  1UAA A;  2VJJ A;  5LRS A;  2E1M C;  3KP3 A;  3L09 A;  4HEA 2;  1MJB A;  4G7H F;  3HPG A;  3ZQG A;  3E6B A;  3I9V 2;  5J4Y A;  2DTZ A;  1XG1 A;  3ELK A;  4RS8 A;  1WJB A;  5BNG A;  3OIQ A;  3ABL H;  3Q9V A;  1H8A C;  2VPR A;  4E6K G;  1EV7 A;  4H0E A;  1TC3 C;  3FKJ A;  4RB1 A;  2H6C A;  3EET A;  4B8X A;  3DTE A;  2BHY A;  4HYE A;  4EGZ A;  3ESW B;  4XRM A;  3SFI A;  3FK6 A;  3M8E A;  2OA4 A;  4BY1 J;  2ELH A;  3KEO A;  1K6O A;  3SJM A;  2PJR A;  3GF2 A;  3DLA A;  5E1X A;  5IOZ A;  2VC0 A;  2VBZ A;  3PUB A;  1P7I A;  2FF4 A;  3G4S I;  2DXI A;  2OCE A;  4JX5 A;  5B1B H;  2WAQ A;  1YG2 A;  5TGT A;  2PFB A;  2DLL A;  1GLN A;  2MD0 A;  3SZP A;  1ON2 A;  4HPQ A;  1LFB A;  4EM2 A;  3DBH B;  3RZD J;  1R00 A;  4Q5S F;  3HOX J;  3H5A A;  1ENH A;  2MC3 A;  3HC7 A;  5TRD A;  4JP0 A;  4KJZ A;  3UNG C;  1K4T A;  4KDP A;  2FNA A;  3U9G A;  5KCM A;  4M3D A;  2MBF A;  3H1C A;  1E2X A;  3ECO A;  1WKM A;  2HYJ A;  4HX7 A;  1Z7U A;  3V8K A;  2Q2E A;  3V4G A;  2O3F A;  4M3B A;  5M5W J;  5DUI A;  4C2T A;  4A2U A;  1EH8 A;  1X58 A;  2CYY A;  2V26 A;  3HB9 A;  3ONQ A;  2FA5 A;  1CF7 A;  4E7S A;  4IHS A;  2O8X A;  1ZRD A;  1U9O A;  4A69 C;  2EA4 A;  3HHG A;  1HDD C;  3H9Q A;  3V7R A;  1NH3 A;  1WJF A;  4BE2 A;  2V1X A;  3MEX A;  3TP3 A;  2YU3 A;  3IRQ A;  3CLO A;  1R23 A;  1Y8Q B;  4E7J A;  2VXZ A;  3HL2 A;  3M9A A;  2DOA A;  3C1D A;  1Z0X A;  1DPR A;  3PJR A;  1I5Z A;  3JRD A;  1N77 A;  1D1B A;  3FKI J;  5J4V A;  1ZLJ A;  2ZME B;  3QQA A;  3I4P A;  4LK0 F;  2BY2 A;  1D1C A;  1FT9 A;  2WC2 A;  3KPH A;  3F72 A;  2HR3 A;  3REO A;  2FOW A;  1ZR2 A;  3X2Q H;  3I54 A;  2QLZ A;  2FU4 A;  3MQ0 A;  4HQE A;  3GME A;  5IYD J;  2V7F A;  3HOT A;  1OKR A;  1XSX A;  1WHU A;  2DYR H;  2QGU A;  1P92 A;  4MTD A;  1ZHF A;  1WPK A;  3EPZ A;  5CVU A;  3RIR A;  4AWX B;  1M1E B;  3CCS I;  2WB1 A;  1LB2 A;  1W5C C;  3MN2 A;  4EJO A;  5GAE J;  2MFZ A;  4KIT B;  4I0B A;  5LHH A;  2Q8K A;  4L0Z B;  2Y0M A;  4CHU A;  2HZD A;  5HDG A;  2RV8 A;  3DF8 A;  3EDP A;  3LA7 A;  1RPW A;  3CF2 A;  3WOD F;  3NWT A;  2XC7 A;  1HQC A;  2FOK A;  3J7Z I;  3L1P A;  5JFR A;  2Y30 A;  2PBI A;  2G9W A;  1RET A;  4LK1 F;  2XB0 X;  2JUC A;  2ZXJ A;  2O5R A;  2W24 A;  2EB7 A;  1WI3 A;  2CQ7 A;  4RM2 A;  3H3V K;  4ON0 A;  2ZKZ A;  2ZBK A;  3I3L A;  3ZQI A;  3T0Y A;  5FO5 A;  4CH7 A;  1BJA A;  5LLQ A;  4RGU A;  1R1T A;  1Z91 A;  2MAB A;  3FHZ A;  2R5Y A;  2O0Y A;  1S7O A;  3Q3S A;  4TV7 A;  1ZEL A;  4XK4 A;  1FZP B;  5EZH A;  2CQQ A;  2NS8 A;  2V79 A;  5D6F A;  1K78 B;  4CYC B;  2MA3 A;  1WJD A;  1IJW C;  5FB2 A;  2FQ4 A;  1TP4 A;  2L4M A;  4PDK A;  2LLK A;  1OIS A;  5CQE A;  1A04 A;  1WGX A;  4ANJ A;  2F5E A;  3RPQ A;  2CUE A;  3L2U A;  1G8X A;  4J00 A;  1RKT A;  4ITV A;  4R8H A;  3OYI A;  3MZH A;  3AL0 C;  2IEK A;  5B5E C;  2KMU A;  4M6Y A;  1XSD A;  2EK5 A;  3EUH C;  2JK3 A;  3RQ4 A;  3NAU A;  3ZN0 A;  1RRJ A;  1T33 A;  3GLL A;  2CV0 A;  4BUP A;  1ZH5 A;  4WXC A;  2Y31 A;  4M72 A;  1HF0 A;  3RYP A;  2CS3 A;  3J80 Z;  2DDA A;  1R49 A;  1SEU A;  3Q0U A;  1U2W A;  4KA4 A;  2BXZ A;  2EIL H;  1EJ9 A;  5DYM A;  5FGM A;  3C7J A;  1LEB A;  1KZH A;  3BJO A;  3HYI A;  2ZME A;  2R7X A;  3RKY A;  3BT9 A;  3FBI B;  3G1M A;  2XF5 A;  5HDK A;  1H89 C;  1ZKG A;  2HU9 A;  4F55 A;  5K7H A;  1E17 A;  1SVL A;  2CW8 A;  4UV8 A;  1X4P A;  2RAE A;  1C0W A;  2ECC A;  2KJC A;  3G6E I;  2JA7 J;  2V1D A;  2X1D A;  4BHP A;  2M45 A;  5EEA A;  3DV8 A;  5DTD A;  3VEP A;  4AIJ A;  3JAM K;  4O3M A;  1QPM A;  3H92 A;  4BBR J;  4C2M J;  2VQL A;  4Y7N J;  4IOA F;  4LGW A;  3TDU C;  4P9F A;  1QU3 A;  3GTP J;  2DFE A;  5HVQ C;  2P4W A;  4PGH A;  1S7E A;  2DA5 A;  1FEX A;  2CU7 A;  5EEG A;  3OWT A;  3GFI A;  1QPI A;  2QZ8 A;  2O03 A;  2E35 A;  3FXU A;  2PI0 A;  2CUZ A;  1DGW Y;  2NNY A;  2FMY A;  2WAE A;  3OOP A;  3LST A;  1IRF A;  4Z6Y A;  3OYK A;  1KQ9 A;  2QEX I;  2FML A;  1NTC A;  1XSV A;  2MLG A;  2P5L C;  4U0W A;  3BQZ A;  2VL8 A;  1MH3 A;  2GOX B;  5CVV A;  5CVI A;  3G1L A;  1ZAR A;  1A31 A;  1Z9C A;  5A2Q K;  3LL7 A;  3QPS A;  4XIC A;  2X1E A;  3K69 A;  2M7B A;  5EDN A;  1SAN A;  1MBJ A;  4OIQ F;  2VON A;  2VKE A;  2FE3 A;  3HEF A;  1GXQ A;  2XSJ C;  3H36 A;  3WGH A;  2R7D A;  5FLX K;  1E3O C;  3BLY A;  4RB0 A;  2R7Z J;  5IT9 K;  2EFQ A;  2HXI A;  3J7A O;  3EYI A;  4XQF A;  2DPU A;  3MFK A;  3DU5 A;  1MDM B;  1WSU A;  2N8G A;  3E1S A;  3SZT A;  1N25 A;  2RRE A;  2RN7 A;  4KIB A;  4M9S A;  5J1R A;  2GIV A;  4UY8 I;  2ZME C;  3DEE A;  3RZO J;  1CF7 B;  1JHF A;  4CO8 A;  2FEZ A;  5FRM A;  3FBN B;  2JN6 A;  2OQR A;  2WBM A;  3CLQ A;  4IOC F;  1WJA A;  1IDZ A;  1FBS A;  1W4M A;  2R4G A;  4A3I J;  4V2F A;  3KP4 A;  4CSW A;  5BQT A;  1MIJ A;  2CV2 A;  1MZB A;  4FCY A;  2LY2 A;  4BNC A;  1YS6 A;  1R1V A;  4NQW B;  2UZK A;  1L0O C;  3LMM A;  1PUE E;  4X1E A;  4HLY A;  3ZP5 A;  2HQN A;  3DWL E;  4EM1 A;  5L3D A;  1VF9 A;  1HKS A;  2BXY A;  4QIW N;  4GDF A;  2L7K A;  2R7T A;  1DGR M;  4FE4 A;  5FKK A;  1YIJ I;  3A03 A;  3M8F A;  4HG2 A;  2G7U A;  2EA2 A;  2PG4 A;  1TNS A;  3BRO A;  3FXQ A;  4HZF A;  4CCJ A;  4U0Y A;  1ZG1 A;  2DTR A;  2M7A A;  3RKW A;  1WH7 A;  4R1H A;  2WY7 Q;  3ISP A;  3QAH A;  1A6I A;  5ED4 A;  4U7D A;  2L02 A;  4EM0 B;  2ID6 A;  1E3H A;  2LKS A;  4LFU A;  5EF6 A;  2ICW G;  2JPC A;  2W85 A;  3OY9 A;  2B7E A;  1QVT A;  5LGT A;  1P2F A;  2VJ4 A;  3G3Z A;  2E5Z A;  4A0Y A;  3DPL C;  1MBG A;  4LIT A;  3CCV I;  2NRA C;  3LSI A;  3HOY J;  3W6K B;  2M3A A;  5ICG A;  3HUG A;  2PMU A;  3I53 A;  2VBX A;  4I99 C;  3VOE A;  3W2W A;  4XLA A;  1FBQ A;  4XLN F;  1SFE A;  2Z16 A;  5GTH C;  3LA3 A;  2ZXH A;  4XKV A;  3WE3 A;  4YIR X;  2RNG A;  1XPX A;  3DTK A;  1RZ4 A;  3GW2 A;  1BI1 A;  1W1W E;  2K9L A;  1REP C;  2P7C B;  1CQT A;  1YW8 A;  3BTJ A;  4KIG A;  4AUX A;  5E3M A;  1X1P A;  4XLH A;  3BZ6 A;  1MND A;  2QVO A;  3OIO A;  3AKZ A;  1VTN C;  3LFK A;  4BXU A;  1BI0 A;  2D1H A;  2I8D A;  4J19 A;  1FBU A;  5FKM A;  5GAH J;  4EJU A;  3BP8 A;  2M4K A;  3B02 A;  4UVB A;  1VQ4 I;  1HKT A;  1ETX A;  1YYV A;  3FIS A;  2G7H A;  3NQO A;  3O3K A;  4WCG A;  2STW A;  5E3O A;  1J9I A;  4LJZ F;  2EIM H;  1VQ9 I;  2EBI A;  3KEQ A;  4AVP A;  1JJ8 C;  1FMV A;  4L5J A;  1LVK A;  3KP7 A;  2NS0 A;  2VE8 A;  5EYR A;  4AYB A;  3EYY A;  3BCA A;  2H1L A;  2HKX A;  2IGO A;  2H27 A;  1ZYR F;  3ABK H;  5CLS A;  2YU9 J;  3TBI A;  1U3E M;  3ZCO A;  1V55 H;  2MYS A;  2RDP A;  2OQG A;  3ABU A;  2GQQ A;  1BJZ A;  2XRO A;  2ME6 A;  4RAG A;  1U9N A;  3BZK A;  2HQA A;  2NVU B;  3T8T A;  1H9G A;  5EZG A;  2R7O A;  1HW2 A;  2B0L A;  1VQ8 I;  3K4B A;  2EZL A;  2QCO A;  1MBH A;  4WK8 F;  3CF5 F;  2M9H A;  5HLH A;  3IKV A;  3F23 A;  1XDU A;  2V9P A;  4C3J J;  1HC8 A;  1ZRC A;  4I02 A;  2IVM A;  3WTT C;  1BN5 A;  2DFI A;  2D45 A;  4HW0 A;  1V5E A;  2A68 F;  2X48 A;  1A6Q A;  1VND A;  5LD2 C;  1MNM C;  3S93 A;  2KZV A;  4PGG A;  4G6D A;  3KZY A;  3ERE D;  2VT2 A;  3KCC A;  3O2P E;  1F4K A;  3PSF A;  4N4N B;  2IW5 A;  4MQ9 F;  2VN2 A;  3RQI A;  1O7F A;  3HSF A;  3K2Z A;  1NK2 P;  4F3Q A;  3GEZ A;  2FSW A;  2UXN A;  1KU2 A;  3H5R A;  4LIU A;  2BGC A;  3OR1 C;  2ZJ2 A;  2B9S A;  3I4N J;  1MNE A;  4AD9 A;  3CME I;  3FF5 A;  3GTK J;  1S5L C;  1O7L A;  4S04 A;  1YRN A;  3I71 A;  2L9N A;  1BC7 C;  3HSE A;  2VKH A;  2XKP A;  5GAD J;  5ICC A;  2D1V A;  2IAI A;  2NXN B;  3TO7 A;  2BVL A;  3I0T A;  2FNP A;  4CIC A;  4OIN F;  3F8C A;  2DA4 A;  5C44 J;  1TWF J;  1R9T J;  1ERD A;  5E1Z B;  2ZCW A;  3HRT A;  3IKT A;  4ENK A;  5FRN A;  1S8N A;  3OYF A;  4IO9 F;  1TQI A;  3BR3 A;  4LOC A;  2EZK A;  2K02 A;  5D5U B;  3WTX C;  2QBY A;  1G2H A;  1OCC H;  1T08 B;  1U8R A;  4CA0 A;  3L9F A;  4I0A A;  4CCN A;  1R6R A;  2HDD A;  1ETW A;  1J59 A;  1X4O A;  5GAG J;  1ZRE A;  4L9T A;  1MMG A;  4A3C J;  2ME0 A;  3PNY A;  3ZMS A;  1XTA A;  4IHY A;  2F4I A;  4D0P A;  1P4W A;  3FXJ A;  3HRS A;  2PX9 A;  1B59 A;  5K7F A;  4NB5 A;  3DU6 A;  1W7P A;  5IYB J;  5K5R A;  2IGK A;  1UB9 A;  5E3L A;  4RB3 C;  3H0G J;  2KJB A;  2CSO A;  3QYF A;  1OCT C;  3E6C C;  4IQ4 A;  3OYG A;  3CMY A;  3OSF A;  5DEQ A;  4M3E A;  3QOP A;  1JKP C;  4XOP A;  2VQH A;  3K7A J;  1PJR A;  2Q2E B;  2JSP A;  2OC6 A;  2FJ1 A;  3PUF A;  4OOI A;  1WI9 A;  4W1U A;  3WTZ A;  2KLO A;  3GZN B;  2YS9 A;  2Y0S A;  2MD5 A;  1YHQ I;  1LUJ B;  3HRU A;  1ITY A;  1D5V A;  4G6Q A;  1EH7 A;  2X51 A;  2ISY A;  3FMQ A;  3G71 I;  2PLY A;  2Z2S B;  3CCR I;  4QSH A;  4KIC A;  2HI3 A;  5D6E A;  4B47 A;  1OLT A;  4YRV A;  2MH9 A;  4I76 A;  1BR4 A;  1UJ8 A;  2V9V A;  3DPU A;  5K1Y A;  4OIO F;  2XAQ A;  4HNV A;  4HAM A;  3RKX A;  2QSH X;  1X3U A;  4BDZ A;  3PO3 J;  6PAX A;  1T38 A;  1FYL A;  3E0J B;  3WTW C;  2EZI A;  3F21 A;  1TTY A;  3ZR8 X;  2VOP A;  5J3L A;  3K4M A;  1SVM A;  1IN4 A;  1JKQ C;  1VI0 A;  2XHK A;  1JI8 A;  2LBF A;  3K10 A;  2VLA A;  2R5Z B;  5EGO B;  2J5P A;  2DJN A;  2KL4 A;  4W97 A;  5CYV A;  4LMY A;  1I3A A;  4CUG A;  3M1E A;  2KIU A;  2LF8 A;  4KFC A;  3IWZ A;  3DEU A;  3GLX A;  2ZB9 A;  1R7J A;  3ML6 A;  4HOB A;  5IYC J;  2XSD C;  2DMU A;  1OYI A;  2HTS A;  3P9K A;  3Q0W A;  2ISZ A;  2VBW A;  1QVU A;  4G7O F;  1TWA J;  4GO1 A;  1T98 A;  4OU0 A;  5GTI C;  3KX2 A;  2YR2 A;  1FPQ A;  2QUF A;  3GTM J;  4A3E J;  3V42 A;  3ABM H;  1MSE C;  3A01 A;  2R7V A;  4NNJ A;  1F9N A;  2KQR A;  2LRD A;  5D8L B;  1AU7 A;  3CCU I;  3CJN A;  1YFH A;  5KK1 A;  3VYT B;  3HXL A;  5M3M J;  1V4R A;  1WWX A;  3H3U A;  4KMU X;  1JXS A;  2B63 J;  3MZY A;  3QU6 A;  1LE8 B;  3OYJ A;  2M0C A;  5BMZ A;  5LHG A;  2F5F A;  2JPB A;  2HYG D;  1D3Y A;  5K5O A;  1IN5 A;  1X19 A;  2XGE A;  3CUO A;  4UUS A;  3JRG A;  4C30 A;  2JZY A;  2HS5 A;  4A3B J;  1OFC X;  5EEH A;  1SVO A;  1ZAO A;  2IGN A;  3HIF A;  3U2R A;  4OIP F;  3BG6 A;  1T2K A;  3ZPL A;  1FTZ A;  1AKH B;  2EZH A;  3LWF A;  4CYD A;  2LKP A;  1QGP A;  2YSR A;  2LYC A;  2VAS A;  5H6R A;  3GX4 X;  4BL0 B;  1IRG A;  4DZP A;  2DQR A;  2DT7 B;  2W00 A;  3PM1 A;  4NDL A;  4BJT A;  3HKZ N;  4D5F A;  3WHB A;  4C3I J;  2WAD A;  2OBP A;  4RMN A;  2NOJ B;  2E36 A;  4UB6 C;  3R6S A;  1XMX A;  2OU2 A;  3K1N A;  1W0T A;  5GP9 A;  4ZTF A;  1T39 A;  3HJE A;  1RC9 A;  2K86 A;  2NVQ J;  1IZ1 A;  1JTY A;  1MW7 A;  4ENN A;  1LQ1 A;  4JQF A;  5LHI A;  4A0Z A;  4KIF A;  2LD5 A;  1TBX A;  1PP7 U;  5K7Z A;  1IG7 A;  4NBQ A;  3VFZ A;  1FX7 A;  3E6D A;  1HST A;  4RAF A;  3U1K A;  4DW6 A;  1J2X A;  1BBY A;  2AHQ A;  3G2B A;  3H0D A;  3LSG A;  1JE8 A;  3HTU A;  3CJQ B;  5E8G A;  1FIP A;  1YX5 A;  2MGQ A;  4II3 A;  2ZO4 A;  2EFO A;  2X6Y A;  4OWR B;  4AC0 A;  1Y39 A;  1QO0 D;  3IV5 A;  1ETQ A;  1BI2 A;  3IP4 B;  4F52 A;  5C4X J;  5HNF A;  4HV6 A;  1Z7L A;  3VSK A;  3F8N A;  1R4N B;  3NAR A;  2FXA A;  2F5D A;  1JKO C;  3VDX A;  4V2G A;  2K4B A;  5J40 A;  4BE0 A;  4HF1 A;  2P6T A;  2VOO A;  2IT0 A;  1YIO A;  3LSR A;  3CES A;  5KAI C;  2L4A A;  4I7H A;  3WHC A;  2A07 F;  2JWT A;  3S32 A;  3OL3 A;  4XBF A;  1YW9 A;  3I4M J;  3DFG A;  2P0W A;  3OS1 A;  3E5X A;  4BJ5 C;  2PJP A;  1ONV A;  3JRF A;  5EJC A;  5FFX A;  1MBK A;  4RLF A;  4AIK A;  1K7A A;  3GFJ A;  1IN6 A;  1XX5 A;  4EAT A;  5IOY A;  1T0F A;  5IP7 J;  1FY7 A;  5LEK A;  3F6O A;  1RI7 A;  1IV6 A;  2Y48 A;  2BY1 A;  4UVC A;  3FWE A;  5DM6 F;  1X1C A;  5FRO A;  3BR5 A;  1GV2 A;  4BH9 A;  4I6Z A;  3KET A;  5M5Y J;  5IP6 A;  3RSN A;  1XB4 A;  1SD6 A;  5E18 F;  2H6B A;  3GVA A;  2ID3 A;  2BE5 F;  2JRM A;  3MZ8 A;  3LQR A;  5H20 A;  2P7V B;  3BG9 A;  3BTI A;  4WWC A;  1Z1D A;  1SFO J;  2XAU A;  1Z3X A;  2X9D A;  1V5G A;  2L3D A;  2XAF A;  3SEQ A;  2KIF A;  3U1D A;  2E7X A;  4G12 A;  4ZYE A;  3OS0 A;  3PO2 J;  3JTG A;  4HX4 A;  5F0F A;  1LJ9 A;  1YLF A;  3ZMZ A;  1DP3 A;  1BW5 A;  1SD7 A;  2MW8 A;  2RQP A;  1UCR A;  3TQN A;  2ZFW A;  4G94 A;  1K61 A;  3C2B A;  2TCT A;  1UHM A;  1X1B A;  2HGC A;  5AIP A;  2GIZ A;  1WZ2 A;  4HV5 A;  4RLQ A;  2IA0 A;  2BOL A;  3K4L A;  2RNJ A;  5L3E A;  1R5I D;  3DKX A;  2COM A;  3HHH A;  2XVC A;  1KU3 A;  2PMZ N;  2ELJ A;  4DBR A;  3QP6 A;  4HX8 A;  4KYW A;  1F43 A;  3BG5 A;  3BR6 A;  1OYY A;  3CD6 I;  2BW3 A;  2WV1 A;  3RKQ A;  3IHU A;  3J80 K;  4KMF A;  1YW7 A;  3KYD B;  2FBH A;  3FMR A;  2I10 A;  2IP2 A;  5ILS A;  4MQV A;  3CC7 I;  3BPV A;  1HW5 A;  3EGV B;  2GAU A;  1XGS A;  4L9V A;  3BG3 A;  4I2O A;  2GXB A;  4G6T B;  5J1U A;  3VWB A;  3S2W A;  2WV0 A;  1IN8 A;  1ODD A;  2VKD A;  3MKL A;  3C2H A;  2A6T A;  1P4A A;  1CGP A;  3GTQ J;  3AG4 H;  5CQG A;  2GA2 A;  1MSF C;  2JA6 J;  1MJ9 A;  5FLV A;  2LNB A;  4BEH A;  4C2U A;  5ICF A;  1S72 I;  2I5U A;  1PP8 F;  1XS9 A;  1G3W A;  1UMQ A;  2LR8 A;  1TNT A;  4B44 A;  3F9K A;  1FJL A;  3CO7 C;  2FQ3 A;  1HDP A;  4KNY A;  4M9X A;  5E1W A;  5CPR B;  2E1C A;  3JRE A;  1BC8 C;  3K1M A;  1G59 A;  4EV0 A;  1S6L A;  4OMZ A;  1S9H A;  3M3Y J;  2DT6 A;  2K4J A;  5HLG A;  4JYK A;  1TW2 A;  5E8I A;  4PJ0 C;  4R79 A;  1I27 A;  2CUF A;  2EJR A;  2ZSH B;  3F22 A;  1GVJ A;  5ERI A;  1EKE A;  2MH2 A;  1WJC A;  2M5W A;  3FXM A;  2XRL A;  3E3V A;  5B1A H;  1QRY A;  3SYT A;  1DP7 P;  1G3Y A;  4FET A;  5DUK A;  1UHS A;  2DOD A;  3P7N A;  3S2D J;  5HDN A;  5HOO A;  5FKL A;  2K9S A;  1RKW A;  2HOE A;  3C3W A;  2L01 A;  2C6Y A;  2IS1 A;  3T5X A;  2GLO A;  3TED A;  4Y33 A;  1YX3 A;  3O8H A;  3SDB A;  2JMW A;  1L3L A;  1FTT A;  1STZ A;  3GBG A;  2AXL A;  3ZMD A;  1YQA A;  2DMT A;  3ZRG A;  3IAM 2;  3K70 C;  1U6G A;  3LOC A;  2HNH A;  5H2F C;  3CCJ I;  2VQC A;  2GOM A;  1OJL A;  4ESF A;  1ETY A;  3PQJ A;  1MMD A;  4IXA A;  2VT3 A;  4XOR A;  1D8J A;  3S8P A;  3F3X A;  1EA3 A;  4S05 A;  1W0U A;  1ZGA A;  4EVI A;  2W7N A;  4NC7 A;  5JR3 A;  1HW1 A;  4HRI A;  1Q1H A;  2LY1 A;  2VXD A;  3IUO A;  1AHD P;  2CH0 A;  4GGG A;  9ANT A;  5JLW A;  3HRM A;  2XV4 S;  4DYQ A;  2UWM A;  2KZG A;  4LLN A;  1J09 A;  3ZQQ A;  4XN3 A;  4AID A;  5FKO A;  4CCK A;  4CCO A;  3BJ6 A;  3W6V A;  2Z9O A;  2V6C A;  1QBJ A;  2KRC A;  1VQ5 I;  1YJ9 I;  3KIO A;  2DU9 A;  3CUQ C;  3P9C A;  4HF0 A;  1QZY A;  1HOM A;  5GPA A;  2F6C A;  2K7L A;  3JW4 A;  4Y3O A;  2HQR A;  3MKY B;  3TOA A;  2GXA A;  1KQ0 A;  2P5K A;  2NOG A;  4PSX A;  3KZZ A;  1LDD A;  2CV1 A;  1RNL A;  5M5X J;  1T0F C;  2BEO A;  2QSF X;  2KRH A;  5F64 A;  2LOO A;  3C2G A;  3HSR A;  1MGT A;  3E6M A;  2W84 A;  3K4N A;  4B4C A;  2DDB A;  4IHT A;  2ZNZ A;  3IWF A;  4LD5 A;  4DYC A;  2H1K A;  2FBI A;  3TDZ C;  1Z6R A;  3GFM A;  2DOE A;  2CG4 A;  3AL0 B;  3OYL A;  3KEY A;  1XGM A;  1K6Y A;  2L9V A;  2OCC H;  2E2J J;  3CDL A;  5JHF A;  3IAS 2;  3HOW J;  2R7S A;  3EQL F;  5DCF A;  1IRZ A;  1TLH B;  2Q0O A;  1JTX A;  4XL9 A;  5CKT A;  2R7F A;  4Y15 A;  1WFX A;  3P9I A;  3DP7 A;  1QHG A;  3BC8 A;  1MD0 A;  1QZE A;  5F6F A;  3HDD A;  2MLK A;  1KU9 A;  1YO5 C;  1UG0 A;  4UXN A;  1X1D A;  2OD5 A;  2X6W A;  4D9J A;  2E2I J;  1J5Y A;  4XNF A;  4HNT A;  1QQI A;  2OV7 A;  3PIO F;  1R5G A;  2XUB A;  4P55 A;  2H8W A;  1TZL A;  1H9T A;  5FKN A;  2H09 A;  4A6D A;  3F8B A;  3LFU A;  3E5Q A;  3K0L A;  5DV5 A;  4UNO A;  2XGD A;  2PMZ A;  4Q47 A;  2M4G A;  1NHA A;  5F08 A;  1ZLK A;  1ZK8 A;  1GDT A;  4OAY A;  4CYC A;  2EV0 A;  3EUK L;  4MIM A;  4KN7 X;  4ZTJ A;  3ZQL A;  1OCR H;  3OV8 A;  3E7L A;  1FNN A;  1B8I A;  2OAZ A;  1D0Z A;  2DCE A;  4DOZ A;  1IGN A;  1ZG3 A;  2JVH A;  1IC8 A;  1T8I A;  3E97 A;  3RTR A;  3CDI A;  2R7R A;  1X2M A;  1E3P A;  3ABT A;  4BXX J;  3HOS A;  4DQ2 A;  4FHT A;  4ZYD A;  3WTS C;  4ZC3 A;  3OYM A;  2NVX J;  5KNL A;  1LNW A;  3A0H C;  1TL8 A;  3H9G A;  3BTL A;  3WU2 C;  4DNC A;  1O3S A;  2F5V A;  2VJI A;  3N4M A;  4BHB A;  2LTP A;  4QLC U;  3DEW A;  4M9Z A;  2KRF A;  2A5W A;  2L7Z A;  3M07 A;  3ECH A;  2XAS A;  4ZDO A;  1IO2 A;  2KKO A;  4G7Z F;  1G4D A;  2F4M B;  1R36 A;  5DCM A;  2DQL A;  4BEH B;  3D1N I;  1J75 A;  2EFN A;  2M2E A;  2Z3Y A;  4FE7 A;  2EWN A;  2HZT A;  1SC7 A;  1WJ5 A;  3SZG A;  1U5T A;  3ZQC A;  3TW7 A;  3LAP A;  5J1Y A;  4RA2 A;  2M1B A;  3F6V A;  2JTV A;  1Y6I A;  1VQK I;  5LGN A;  3CCE I;  4L18 B;  4M71 A;  2HYF A;  4GCV A;  1NG6 A;  2AQE A;  2UUZ A;  1YIT I;  1LE8 A;  2M8G X;  1IXR C;  1W7P D;  2HQ5 A;  2KDO A;  2MSY A;  1HKQ A;  3GWZ A;  4LB6 B;  1MJA A;  1VQ6 I;  1Q1V A;  5HS8 A;  1RUO A;  3W6J B;  4NUB A;  5K5Q A;  2HDC A;  1ZGJ A;  2O7O A;  5KHD A;  1LVA A;  1TQP A;  1YS7 A;  1R58 A;  1O3T A;  1FYK A;  2FX0 A;  1UEL B;  3I58 A;  4ETS A;  3IH4 A;  2DT5 A;  3JSP A;  3OOU A;  3EUA A;  4U87 A;  1HXD A;  2O9L A;  2E5N A;  4S0H B;  2JT1 A;  1J0R A;  3TOB A;  3V7S A;  3COA C;  2Y69 H;  1X3W B;  1A36 A;  2CW0 F;  2TDX A;  3FM5 A;  1Y1W J;  1Z77 A;  2COB A;  3JRH A;  3HOU J;  3OL4 A;  1LDK B;  2OTL I;  5H6Q A;  4YG2 F;  4CDG A;  4A5N A;  2F2E A;  4HBL A;  3NEU A;  3KYC B;  2DK5 A;  1JUP A;  3LSH A;  3EUH A;  2IS6 A;  3KLN A;  4ENJ A;  3RPU A;  3GXO A;  2L54 A;  3CDH A;  3R60 A;  2FD5 A;  4IRH A;  1J7K A;  4H4K C;  3QRF F;  3TKY A;  2KIM A;  2Y75 A;  3ZN1 A;  2A3S A;  3A1Y A;  3JRC A;  1KYW A;  2VI6 A;  4PCQ A;  1HSJ A;  5HS9 A;  1FP2 A;  4YFX F;  2IRF G;  5IT9 Z;  1FSE A;  2CO5 A;  3JRB A;  2ZXI A;  1LFU P;  4UHT A;  3VYS B;  3BTC A;  4BBS J;  5D5W B;  3IH3 A;  2VBY A;  1DDN A;  3QPT A;  3K70 D;  4ZYG A;  3A4C A;  4LLG F;  4D7N A;  2ZJP F;  5F04 A;  3V8L A;  2X4H A;  1T95 A;  2E7W A;  2K9Q A;  2M8E A;  1DU6 A;  1GUU A;  2ESN A;  2QEN A;  2X1C A;  1ETV A;  1IW7 F;  2IGM A;  3BPX A;  4BAY A;  4MGR A;  1U78 A;  4RDU A;  1HBX G;  1WCM J; 
#chains in the Genus database with same CATH homology
 1VQ5 I;  1YJ9 I;  2OTJ I;  3CJR B;  1VQ7 I;  3J7Y J;  1YIJ I;  2JQ7 A;  1VQO I;  1ACI A;  3I55 I;  3CCQ I;  1S72 I;  1MMS A;  2FOW A;  3I56 I;  3CME I;  2ZJR F;  1VQK I;  3CCE I;  4V19 K;  3G6E I;  5GAD J;  2NXN B;  3CC4 I;  1YJN I;  1YIT I;  3CC2 I;  3CCV I;  3PIP F;  3CCS I;  4IOA F;  1VQ6 I;  3CCU I;  5GAE J;  5DM6 F;  4IO9 F;  2ZJQ F;  1VQL I;  2E35 A;  2QA4 I;  5GAG J;  5DM7 F;  1FOX A;  3J7Z I;  3DLL F;  2QEX I;  3CCL I;  3PIO F;  1FOW A;  1YI2 I;  5JVG F;  2H8W A;  5GAH J;  1YJW I;  1VQ4 I;  1VQP I;  2OTL I;  3CMA I;  1VQ9 I;  3G4S I;  3CCJ I;  2E36 A;  2K3F A;  1VQN I;  1YHQ I;  3CJT B;  3G71 I;  1VQ8 I;  4UY8 I;  3CF5 F;  3CCM I;  1QA6 A;  3CJQ B;  3CD6 I;  3CCR I;  1HC8 A;  1WIB A;  1VQM I;  4IOC F;  3CC7 I;  1Y39 A;  2ZJP F;  3EGV B;  2E34 A;  1FOY A;  3CJS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...