2ZJPF

Thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
144
Chain Sequence
b'MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L33
publication title Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2008-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjpF02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2zjpF01
2FOWA 1YIJI 1VQ9I 3J7ZI 1FOXA 2OTJI 3CCLI 1VQ6I 2NXNB 3I56I 1YJWI 1MMSA 5GAEJ 2OTLI 4IOCF 2E36A 3CJSB 4IO9F 2JQ7A 2K3FA 1VQ7I 3CD6I 3CJTB 1VQMI 1S72I 3CCSI 3I55I 1YJNI 5GADJ 3EGVB 3CCRI 3PIOF 3PIPF 2QEXI 2E34A 1YITI 3G71I 1FOWA 1VQ5I 3G6EI 3DLLF 1HC8A 1VQOI 1VQPI 1VQ8I 1VQKI 1VQLI 1ACIA 3CJQB 3CC2I 3CC7I 2QA4I 5GAGJ 3CMAI 3G4SI 5JVGF 3CCMI 3CF5F 3CMEI 1QA6A 3CCQI 4IOAF 5DM6F 3CCJI 1VQNI 3CJRB 2H8WA 1FOYA 5DM7F 1YHQI 1Y39A 3CCVI 3CC4I 2ZJPF 2E35A 4UY8I 2ZJQF 1VQ4I 1YI2I 5GAHJ 2ZJRF 1YJ9I 3J7YJ 4V19K 3CCUI 3CCEI 1WIBA
chains in the Genus database with same CATH superfamily
3FXLA 1R5GA 2JA5J 2Y0MA 2DPDA 1D0ZA 5F08A 1OJLA 3VYSB 1E3HA 3AG1H 2FSWA 4DIQA 2CH0A 3IRQA 1Y8QB 3H3VK 3K7AJ 4LLGF 2WA0A 2KIQA 1I5ZA 3H5AA 4PUSA 3VSKA 1UZCA 2EZLA 3PSIA 1MGTA 5D8KB 2AO9A 2E5ZA 3ZOBA 2CS3A 5ILVA 3JTGA 1R4MB 4L5IA 5GAEJ 3RCOA 3OS0A 2E1MC 2P5LC 1MKMA 3I64A 1GT0C 3O8HA 2DI3A 2STTA 4A69C 3ZRGA 1TWFJ 4BU2A 1ZYRF 4IVNA 2K3FA 4RDUA 2WAEA 1OYYA 4PFPA 4QIWN 5K5QA 3C2GA 4LD5A 1XGOA 2A68F 5KK1A 4CCNA 4PJ0C 3VYUB 2WB1N 2WAQA 4A3FJ 2HFHA 4HRIA 2Z1DA 1TQMA 2KRCA 2WAFA 3H36A 5H20A 4HX7A 3K1PA 4KITB 4BDZA 3FXUA 1ZH5A 2GA1A 3C2HA 1XSDA 1XC5A 5GP9A 1DP3A 1YO5C 1VQLI 1CQTA 1K61A 4IHVA 3SQNA 3OYJA 2EJRA 3HHGA 4PK4A 1BI0A 1V5FA 4IQ4A 3OYLA 4A2UA 2JZYA 3FMQA 5D6EA 4AU7A 3UNGC 3ISPA 2RV8A 2QA4I 4HSTA 3J81Z 2HOEA 4A3KJ 1IUYA 3WTUC 3JCUC 1SMTA 3N4MA 2ETHA 2DK8A 3CMEI 5DUKA 3OIOA 3BR2A 2HNHA 4C2UA 2WC2A 2HYFA 2CUJA 3FXOA 1ETWA 3OYAA 2D1HA 2DQRA 5AIPA 2QSHX 4F91B 1Z21A 2VBWA 4HA8A 3WTYC 1ORKA 5HLGA 1V4RA 3TP0A 5EYRA 5ED4A 2XASA 3HPHA 2EBIA 1IRXA 2JRMA 3WU1B 2L7MP 4E7KA 1SD6A 3EUHC 3QODA 4RMNA 1VFCA 1HSJA 2RQQA 1KGSA 3MKLA 1HDPA 3DXJF 1YJ9I 1OPCA 4KNYA 2W24A 3OYDA 3RI4A 3DTIA 3SZGA 3M07A 3AFHA 2CWEA 5LRRA 3LSTA 1ETVA 2DFFA 1FSEA 2I8DA 4NC6A 5CVRA 3SDGA 4D1QA 1IDZA 4LIVA 3H1CA 3L2VA 4ENJA 1YW7A 4FE7A 3MQ0A 3RZDJ 1MBHA 2BOLA 5DDGA 3LOCA 4QLCU 3HRUA 1JT6A 3GTMJ 3LWFA 1FMVA 2DMQA 2F4OB 2A5YB 1TWAJ 3GMEA 4AUXA 5ICFA 3P5JA 2FX0A 5KVRA 4HQEA 1FEXA 3FXQA 4B8XA 4G94A 3IKTA 4D0PA 4LLLA 5LFAA 4M73A 1DDNA 3GYHX 3BLYA 3BZ6A 2MC3A 4R8HA 1LFPA 2DOEA 1ZGWA 2JSCA 2HOTA 2DOAA 4P55A 1D1BA 2HPIA 4OMYA 2M87A 2O8XA 1FYLA 4G6QA 5FD5A 2VT3A 5FKOA 2VBYA 4XBFA 3I53A 3QPHA 3SFZA 1YJNI 2HS5A 1ETYA 2PMUA 4UUVA 3CCRI 3SZPA 2YX7A 1QZZA 1R6RA 2K9SA 2OC6A 4U7BA 2CFOA 4DJAA 1XDUA 2K27A 3L09A 4L0YB 1UHWA 3FK7A 1FBUA 2OF7A 3QU6A 2VKHA 4PSXA 1WH7A 2BVMA 2BBYA 2DTZA 4NNJA 4Y13A 1VQKI 4MFDA 2YS9A 1XS9A 3HGGA 3IL2A 3N05A 5L3EA 2IPQX 2JK3A 4DYQA 2DMPA 4HF0A 2R7WA 4XONA 3GVAA 2MBFA 2HTJA 2EB7A 4E70A 2DAOA 5CLSA 2FRHA 3CUQB 3J80K 5H2FC 3ZMZA 5CVUA 4CYCB 1GXPA 2MG4A 4ZYHA 3L00A 3CO6C 1J75A 2DA2A 2HXIA 5EG0B 3HOTA 2E60A 4XRMA 3RPUD 2Y2ZA 1ZELA 5K7HA 1Z7LA 2N8GA 2LF8A 1HA8A 3KZZA 1HKTA 1P4WA 2FA5A 3CJNA 1JUSA 1B8IA 2CW8A 2BGCA 2DPUA 2P5VA 4MHGA 1QO0D 2QVOA 3ZMTA 1W5TA 5D8LB 4S04A 2MW8A 5BMZA 3IC7A 2CQNA 3TQNA 2GQQA 3RKQA 2AXTC 3P7NA 1WJEA 3Q9SA 3FX3A 2IP2A 3S2DJ 2IVMA 3HG9A 2XF6A 4EJOA 2L9RA 5F64A 3TOBA 2WY8Q 4UV8A 5FRNA 1KU9A 1ZRFA 2DQLA 2I5UA 3QU3A 3F8NA 4FHTA 3WHBA 4GDFA 3BPVA 1P7IA 1Z9CA 2M9HA 2BEOA 3CCLI 5C4JJ 2B7EA 4XM3A 1XB4A 2HQNA 2BW3A 4HNTA 3E7LA 2L54A 4BQAA 4A0XA 3BR0A 1Q1VA 2OQGA 2YX4A 2TDXA 3WU0A 1J0RA 2MYSA 4XNFA 1ZHFA 3HL2A 3E0JB 2XF7A 3OIPA 1UMQA 3ULQB 3ZMSA 2XAUA 5J1RA 1LDDA 1D1AA 5DEQA 3H9GA 2X1CA 3BG7A 5FRMA 3BG9A 1E3PA 1FPQA 2ID6A 3RYPA 3GZ5A 3HJEA 3OR2C 2QKLB 2VLAA 1PUFA 3BR6A 1Z7UA 2PG4A 1R23A 4N4NB 3KCCA 4EVIA 1IV6A 4IHYA 1V5GA 1P4AA 1WWXA 4FASD 3CDLA 2GXGA 2EFNA 5E1WA 2RREA 2TCTA 4ZYEA 3HOVJ 2B0LA 5B3SH 2UV1A 2P7CB 2X6YA 1GXQA 2EV0A 2A05A 3C1DA 2CUZA 2BY0A 2YSRA 3D5LA 4M6YA 1FBSA 1XCBA 2DT5A 5LBQA 1OYIA 3REOA 2BHZA 3VSLA 5CVIA 2MLKA 1FTTA 3LFUA 1IG7A 3R6SA 1OMIA 3F6VA 2COBA 2E7WA 1VZ0A 3H3UA 4ZYGA 3FM3A 3S3OA 3CMAI 2LDUA 4I2OA 2F5EA 2BY2A 3BG6A 2KHMA 1WQ2A 2BY1A 1P4XA 4Q5SF 3BJ6A 2XAFA 3H9QA 2VOOA 1RKTA 3IAM2 2L0KA 4JX4A 1RI7A 3LA2A 1VQNI 1RRJA 3CJRB 2XF5A 4WXDA 2JUGA 1BI2A 4CXFA 5FLXZ 1QGPA 3CLQA 5FJ8J 1RZ4A 4I0AA 1LDKB 5EGOA 4LLNA 4UB8C 3DQVC 3BZKA 4L0ZB 1USTA 4PGHA 4LB5A 3DKXA 2NS7A 3FXJA 4L9NA 3OOPA 3R0JA 4OU0A 1NHAA 2E35A 1X4PA 2MD0A 2X1DA 2JPBA 4WX9A 5DYMA 2L9SA 2Y9YA 5FO5A 4YIRX 1D8JA 2OA4A 4BBSJ 2DU9A 2R4GA 1WPKA 1S7AA 4I98B 3AKZA 4C2MJ 4XR6A 3FF5A 2CV1A 4UVBA 1QVUA 2D1VA 2O6GE 4CZCA 2FBIA 2DYRH 4YG2F 2Z16A 2FOWA 5J3LA 3AG3H 3M1EA 3CP2A 2NYXA 4BACA 2KQRA 1S7EA 3ZQHA 1ZG5A 2VN2A 1SFXA 3JW4A 2CSOA 4DZPA 1IJWC 3WGGA 4LMYA 1XPXA 4IQJA 3JTHA 2F5CA 3U2RA 3V7CA 3SYTA 3M9AA 4PDKA 2O8KA 1ZREA 2NOGA 3S1RJ 1S5LC 2RKHA 1IUFA 5FKLA 2DXIA 1G8XA 3A0BC 2Z5UA 3KLOA 2IXSA 2IT0A 4OOIA 4HX4A 4XQFA 4EMSA 4HF2A 3CQZJ 1BA5A 4D5FA 2HU9A 4JYKA 4IO9F 4F55A 4F3QA 2LBFB 1WCMJ 3S2HJ 2R5YA 1HW1A 3CCSI 2GWRA 2R92J 5DCMB 1TNTA 1H88C 1A36A 3ABMH 5E1XA 2NNYA 4KMFA 3BOQA 4XSZF 4E7JA 5BPIA 1WJFA 2P8TA 2DA6A 1SFEA 2M30A 3RQIA 4IZZA 4FCYA 2Q8KA 4RAFA 3ZQCA 1BR4A 1ACIA 3HSEA 3H3ZA 5F6FA 4F7ZA 3HTUA 3DU5A 2LC2A 2ELHA 1LJ9A 1K4TA 3S14J 1AU7A 3HKZN 2HGCA 4A12A 2C6YA 2CQKA 2DW4A 4PJJA 3I59B 1I39A 4BXUA 1HDDC 1UG0A 2W7NA 1RUNA 3EDPA 4P5OA 4R79A 2KT0A 5BQTA 3ZR8X 5LGUA 4QWQA 2R7RA 3MVPA 4P96A 4Y33A 4CCMA 3W6VA 5IT9Z 3AL0C 1OCPA 5IT3A 1F5TA 2VUMJ 4WXCA 3MD2A 5ICCA 2ZFUA 2M34A 4KYWA 3KX2A 3IKVA 2RDPA 3WTSC 1TW2A 1YOVB 2G9WA 3KP4A 3RQ4A 3HBLA 4D7MA 1H0MA 2A07F 3O6BB 5CQEA 1IN4A 3QRFF 2R3SA 2F5DA 2QWWA 2PBIA 4BHCA 5HNFA 2NNNA 2F5FA 5A2QZ 2PEXA 2ZJRF 3LSHA 1F4KA 3FXMA 4UB6C 2NAZA 4QPOA 1WJAA 1QHHD 3FKJA 4HV5A 3F6OA 3DFGA 2KIFA 1J59A 3NARA 2F2EA 3MAJA 3Q0UA 4CICA 4DOZA 4BGDA 2QM3A 4EJWA 4BUPA 1VQ6I 3LSKA 2IBDA 3IUOA 4G7ZF 3D0SA 1YW9A 4OAYA 3L7WA 1WSUA 2VODA 1D8KA 2CQ7A 2ZCWA 2VJIA 3T8TA 1HOMA 2DK5A 3JR9A 1DPUA 3I56I 3D5RC 3M8FA 4M9ZA 3LSGA 2A3SA 5JFRA 1LFUP 3S3NA 1VF9A 2EFQA 1U8RA 4IOCF 4MEXF 1ZG1A 3BZCA 4XRSG 2IGOA 4PGGA 1S6LA 3VOEA 4CZZA 3HC7A 2JQ7A 2A5WA 3F9KA 3R60A 3L2WA 2KDOA 3PSFA 1H9GA 1OCOH 5GADJ 3EGVB 5FLVA 2ZNZA 3H0DA 2Z3YA 5HLHA 5AIQA 4FX4A 1EH8A 4UV9A 2E34A 4UXNA 4FISA 1UHSA 3BR5A 2A61A 4M9XA 4NQWB 4DYRA 1ZARA 4BKXA 3C7JA 1VQPI 4RGXA 4W1UA 5B5EC 1E17A 1RPWA 3BQYA 1MJAA 3K1MA 4CGZA 2F4MB 4KN7X 2D45A 3B6AA 1LE8B 3BG5A 2QGUA 2OQRA 3G1MA 3G4SI 4HG2A 1J09A 5JVGF 3WG9A 1R9TJ 1RR8C 2VQLA 3HOSA 3CCMI 1MSEC 2MSYA 4EEFG 1I1GA 2XB0X 2KJBA 2KPMA 4KA4A 4M3EA 2CU7A 1FX7A 2OD5A 3H5RA 4Y4RA 4IOAF 1Z67A 3GFLA 2IA1A 2K9MA 3TO9A 5EZHA 1E2XA 3F8BA 5ICGA 1BBYA 1TT5B 3GCMA 4MFEA 2KP6A 3PUFA 2AQFA 2KZVA 5H6QA 1XGMA 1S29A 2K9LA 3BR1A 1K83J 4RGUA 3OS1A 1MJBA 1GV2A 3BCAA 5FKKA 2WTEA 2Y0SN 2Z9OA 2ZFWA 4KISA 3P9IA 5J8FA 2VASA 3SXYA 4X1EA 2KMUA 4BEHA 1BI3A 3ERMA 1PYVA 2R7SA 4LIUA 1Z6TA 2V6CA 1D5YA 4GO1A 1LQ1A 2LF7A 2DJNA 1IN7A 2ZNYA 1ONVA 4UUSA 2P0WA 4AYBN 2E71A 1VQ9I 1FP1D 2XPWA 3J7ZI 1FOXA 2LG4A 2XGDA 4JBAA 1XCVA 2R7OA 3C18A 2M0CA 3MCZA 3N97A 1TWGJ 1BL0A 1IDYA 2DMTA 2EFPA 5A2QK 3PUBA 3CLOA 1V5EA 4O3MA 3ZN0A 1X2MA 4E7LA 4N4OB 2Q0OA 2X48A 1DPRA 3FWEA 4I01A 2HOSA 2O7OA 1W7PB 2R7VA 1BIBA 1OCCH 4IJAA 5D4SA 4IHSA 2L7FP 4X0GA 2VPLA 1JUMA 3S32A 4HDUA 3HUGB 3R0AA 4WWCA 3WTXC 2NVYJ 3JRDA 1ZLJA 3DBLB 1BJAA 2MLGA 1O4XA 3X2QH 2ZO4A 2M7BA 3OYBA 4IF4A 2A6HF 4V2FA 3VODA 1WGXA 2NS8A 4M3FA 4QPQA 2ZJ2A 4OIRF 2XC7A 3I5UA 2QEXI 1UG2A 2VBXA 3M1CA 1WRJA 1WHUA 3DP7A 2LKPA 3GFIA 2XGCA 3QPSA 4HV6A 1R22A 1TT0A 4ENNA 1M1EB 1OCTC 5GTHC 2YUSA 1DGWY 1O3TA 5DS9A 1KQ8A 1T8IA 2ZMEA 2DO7A 3V4GA 5E8IA 3HXLA 2BZTA 3DEEA 2CGPA 1IO2A 2GAUA 1UJ8A 2M1BA 2CJJA 1MH4A 1TC3C 1ZTRA 4Y52J 1DGRM 2ZC2A 1O7FA 3GW2A 3HRSA 4RLFA 2JA7J 4PJMA 1JT0A 1NK2P 1OCZH 3H0GJ 2J5OA 3J80Z 2K02A 3DEUA 2ZKZA 1ZKGA 4ZYDA 3PNVA 1QU3A 1ZLKA 2H8WA 5LRSA 4A3LJ 3BJOA 3TOAA 2EZIA 2Y48A 2IRFG 3IHUA 4RLQA 1DU0A 2FQ4A 3V8KA 1XMKA 3UR3C 3JRHA 3CC4I 1R7JA 3TW7A 1DQUA 4A0ZA 4UY8I 3Q0WA 1TLHB 5LHGA 1AHDP 5J40A 4E7IA 2DCEA 2FXAA 3M7GA 4A3EJ 3S1QJ 1A5JA 1GDTA 4P1WA 2OZUA 2X85A 4XLAA 2K40A 3SFIA 2O03A 4L5JA 2F5VA 2GOMA 5F1JA 1A04A 4A6EA 1YQAA 4AVPA 1RUOA 2IGNA 4LG0B 1RETA 1SVOA 3PO3J 4AIDA 4AWXB 2VONA 1NH3A 2L3DA 2STWA 3TP3A 4PJLA 4A3DJ 5CVVA 1JJ6C 4A3MJ 2BV6A 2DDBA 4B47A 4IL6C 1U5TB 3WODF 1ZK8A 1P9QC 3E6MA 3EPZA 4XOPA 2L02A 3B73A 2KLOA 3AG2H 1BJZA 5L3FA 3SDBA 3FBIB 1TW3A 2V4JC 4RM2A 3QWLA 4I76A 3F8CA 1ETOA 5LGTA 1OFCX 2OU2A 3CD6I 2W25A 2YU9J 4L9VA 5JLWA 3WE3A 1R1TA 1YTYA 4A3BJ 4D7NA 3GZNB 3CTAA 2HOAA 4KT5C 1T2KA 1SEUA 2RQPA 5HS7A 3TO6A 3DPUA 4AC0A 1O3QA 3BQZA 1B9NA 1XGNA 1JKOC 1X3UA 2CW7A 3FISA 2FNPA 2VJ4A 1ENHA 1PP7U 2HPMA 1FC3A 1SVMA 4LITA 1VQOI 4ZC3A 3W6JB 5IP9J 2QBYA 1D1CA 1SAUA 1VTNC 4QTRA 1WI9A 1K79A 4JP0A 3F8FA 4XKBA 1AA7A 1DUXC 2XKPA 3VB2A 1YIOA 2BXYA 5FD6A 3HPGA 4BDYA 3KP3A 4KIFA 3TBIA 1BR1A 4JX5A 5EDNA 2P5KA 4RGRA 4LFUA 2DT7B 2NS0A 3ZPLA 2WAQN 5LHHA 3WG7H 5IYDJ 4ENKA 1JKRC 3O2PE 1WJCA 1BR2A 1DU6A 3EUKL 1AKHA 2A6TA 4EGYA 5M5WJ 2V1NA 3G3ZA 3OL4A 4BXFA 1A6IA 1MIJA 1W4MA 2E2HJ 2KKOA 1BN5A 2X51A 1L0OC 4A6DA 2XAGA 2EILH 1NTCA 4HOBA 1KQ0A 1MMDA 3HDDA 4D5CA 3LQRA 4DQ2A 1OQYA 2ELJA 4A5NA 1A35A 4S05A 1ZG3A 2QKMB 4NHJA 2HVQA 2DYSH 4EV0A 3GFJA 1EKEA 1KQ9A 4ABZA 1KYZA 3NEUA 3MEXA 4AM3A 4G7OF 1FIAA 3OV8A 3BC8A 5AONA 5JHUA 1K78A 4CSWA 2OTJI 3PL8A 3I4MJ 4L9JA 3ZCOA 3GLLA 2F4IA 5FROA 2LD5A 1U0JA 4NB5A 1B9MA 3Q9VA 4XIDA 1MBJA 5HODA 3IWFA 2H8RA 4W97A 4C3JJ 2XAHA 1SFKA 5CQGA 3U9GA 3K4MA 3LFKA 1N75A 3IH3A 2LREA 1XN7A 3K4CA 3OS2A 2GZWA 2DN0A 3ROUA 3GLXA 1YS7A 4ANJA 1BM9A 5DCFA 1QNTA 1TZLA 3R4KA 2JJ7A 4IRIA 3HYIA 3E5UA 2HDDA 5HVQC 4XN3A 2Y9ZA 3KP2A 3W2WA 2K86A 4GYGA 5GPAA 2H09A 4CUGA 4EM0B 2IGKA 2NVTJ 2Z99A 3W3CA 5KAFC 5HS8A 2IW5A 4P9UA 5CPRB 2ESNA 1U2WA 1J9IA 4R1HA 2EZKA 3KP7A 3GF2A 1G59A 3PFYA 3ABLH 4L18B 3VPRA 5L3GA 4DZJA 3K4BA 2CUEA 4B43A 1I6XA 1VNDA 3CC2I 3GUDA 1T0FA 1A6QA 2W57A 1MBGA 3CMMA 4A3GJ 4LOCA 3TGNA 3IV5A 1PVEA 5H6RA 1R00A 2DA1A 1FOKA 2X0LA 1U78A 1QA6A 2EZHA 2W4SA 4EJUA 3E97A 4BE1A 4BJTA 2V1XA 4NDLA 4DW6A 1LKXA 2E5NA 1LB2A 2PN6A 1BW5A 4QSHA 4U0WA 4B09A 5J4YA 2PMZA 2WY7Q 2ZMEC 3RSNA 5LHIA 1TNSA 3QAHA 1QZYA 5DM7F 3JRIA 3BWGA 4MLOA 4RB0A 3DV8A 2O61A 2Y31A 4L9TA 4MQ9F 2ZJPF 3T5XA 3E1SA 1JJ8C 1UCRA 3BG3A 4BXXJ 2M4KA 2DA3A 1Z05A 3FBNB 4M6VA 3AL0B 1YI2I 1IXCA 3G2BA 2BVLA 3ONQA 4EJTA 1PUEE 1K7AA 1LEAA 4BY1J 4IHWA 5KNLA 5K1YA 2VJ5A 1E0EA 5E3MA 1IGNA 2JPCA 3OR1C 2H94A 5E18F 1IN5A 2JWTA 1ZGAA 2O9LA 5IYCJ 1MH3A 2R7FA 4MQVA 1GV5A 1W0TA 2O0YA 1ETQA 3K70C 1Y6IA 2XV4S 1X1CA 5F0CA 2K85A 4Q48A 2HR3A 1MNDA 5KAIC 5M3FJ 4OIQF 1TQPA 3QP6A 3I58A 3GTPJ 1SAXA 1K4SA 1B8IB 4U0YA 4JX6A 1Z77A 2XKOA 2PQ8A 1R49A 4XK4A 4I09A 2DLLA 3CUQC 3ML6A 4M3BA 3OYHA 2OTLI 2Y69H 1Y56A 4HNUA 1TL8A 5FKMA 4KT6A 2E36A 2MFZA 4ETSA 4H0EA 2KDZA 4BBRJ 5B1AH 1SD5A 2IS1A 3ZQGA 5FFXA 3VYTB 4Y7NJ 5HDKA 2EQRA 1YX5A 5DUIA 3WTVC 4CH7A 4JOMA 4BY7J 1YITI 4MO7A 2BY3A 3DPLC 4Q4ZF 5K5OA 2BW3B 3G1LA 3U1DA 2HKXA 1R5HA 1HC8A 2OV7A 3ZQQA 1B72A 2H1LA 1FT9A 2NVQJ 2DJIA 2LKSA 3DKYA 2XIGA 3FDYA 4Z2YA 3ASNH 3MKWB 2K3PA 5TJJA 2PMHA 2OPTA 2L7KA 1Y0UA 1I1SA 2VI6A 2HQ5A 4BH9A 4ASNA 3LL7A 1OISA 4HDVA 3OYIA 5K7FA 4LK1F 1IN6A 4DBRA 3KP5A 1EF4A 1PUFB 2O3FA 4XLPF 3A01A 2X1EA 5JR3A 5L3CA 4XRSA 3WGIA 1JXSA 2UZKA 2ZXJA 1POGA 3K6GA 2R7DA 2XPUA 2V79A 1T33A 3K1NA 1RNLA 2XDVA 2R5ZA 3L2QA 3KZIC 1EH7A 3S2WA 4B48A 4XLCA 2FQ3A 5E3LA 4IPAA 4EQQA 1CF7A 2DA5A 4YFKF 2HWVA 2EWNA 2ELKA 2VKEA 3RJPA 3DF8A 1YFHA 1KU3A 2QQAA 4HQMA 4ZYAA 2VKDA 4XLHA 3E5QA 3CMYA 2XPVA 4DGWB 1W7PD 2Y75A 3K4NA 2JVGA 3JSOA 2IJLA 2OJED 3OMYA 1YIJI 2FMLA 3V8JA 3S8PA 1S9HA 3HGYA 4ON0A 2PJRA 2RC4A 1VI0A 4WXHA 3WU2C 1GHCA 1TTYA 2G7UA 2LFBA 2X6XA 3KPHA 1KU7A 5FKNA 2Q2EA 3HRTA 4EM2A 5EGOB 3EUAA 2W84A 2XSJC 2QUFA 1OKRA 2RNGA 1SMYF 3DLAA 1Y1WJ 3K10A 1WJDA 4PCQA 2OCEA 1ERDA 2DA7A 2DODA 5DD8A 3MFKA 2COMA 3BR3A 1T38A 4U88A 2ZB9A 1UB9A 3CF2A 2K7LA 2VXDA 2IA0A 1MMGA 2TRTA 3CJSB 2ESHA 3LA7A 1VQ7I 3B02A 2DDAA 5B1BH 2OAZA 3BDDA 1EH6A 4P9FA 4RAYA 3ZMDA 3D1NI 2XGXA 3DKWA 4A0YA 3C3WA 4V2GA 1A31A 3K69A 2M3AA 1ZAOA 4BAYA 3E3VA 3DCFA 3IAS2 2XVCA 5E1ZB 2W85A 3U1KA 2FBHA 5IY5H 2DMNA 1D3YA 3OWTA 4XLEA 2KRHA 1REPC 2KL4A 2HYJA 1ZR2A 1T98A 4UHTA 1ITYA 1IC8A 3CJQB 4C2TA 5E3OA 2CV2A 1E3OC 3NWSA 3I4PA 2OUMA 1MDMA 3J7AO 2MGQA 4IRGA 3SEZA 1BOAA 2LRDA 5D5VB 3LSPA 1FP2A 2KJCA 5GAGJ 2CUFA 3Q5FA 1XSXA 4MEYF 5JI6A 1H8AC 1YRNA 1HSTA 3KYCB 2CQXA 2GIVA 2KFDA 2VPRA 2QSFX 1X1DA 4FT8A 2E1MB 5IP6A 3QQAA 2FMYA 1ON2A 4OIPF 3WGHA 3NQOA 1BC8C 2R5YB 1ON1A 1R71A 1TQIA 3BY6A 3ZQLA 1QRYA 5E17F 1IXSB 4BNCA 3VWBA 4ESJA 3CZ6A 1T0FC 1GLNA 1OCRH 3AAFA 4II3A 3H92A 4X6AJ 3LAPA 1LFBA 2WV0A 4GXOA 4M9SA 1OR7A 3HOYJ 2NRAC 2CQQA 2DFIA 2EPFA 1RESA 2M8GX 5HNHA 2PJPA 4FETA 4GRIA 4PFOA 1B4AA 2QYOA 3T8RA 2H27A 4YFNF 1APLC 1Z6RA 3FMRA 3A1YA 2W48A 3CCUI 2M7AA 4NC8A 1X1AA 4C9YA 1I3AA 5K7ZA 1MBEA 2K4JA 4RB1A 2FOKA 4YIFA 1HF0A 1BOBA 3F72A 3F3XA 3QPTA 5ERIA 1HW2A 2PFBA 3L2RA 1HQCA 3WE2A 1G3YA 3QYEA 1G3SA 4RAZA 5D5XB 5GPCA 2UXXA 2WB1A 1W0UA 3VDXA 1JE8A 1PP8F 3FHZA 5EZGA 1YLFA 3KYLA 4XRFA 4A5MA 2LLKA 3PNYA 1WVRA 4HX8A 3W6KB 1H89C 2E1CA 5J1UA 3VEPA 4F92B 4BE0A 3BTIA 3KIOA 3PNTA 1MMSA 2E19A 3E5XA 1C0WA 4PZJA 3L2CA 5F0HA 4OMZA 3GTJJ 3TMOA 1SC7A 2HDCA 4E4HA 5BNGA 5IP7J 4CCJA 2FNAA 4II2A 2HXOA 5DD4A 3FZVA 2EFWA 4PJNA 1U9OA 1BIAA 2XAQA 2IAIA 2E2IJ 1LDJA 3LSRA 1FY7A 3IRRA 3F23A 4G12A 3PJRA 3G6EI 1Z3XA 4XN0A 2XUBA 1Z3YA 5JVTA 3ZP5A 1V54H 5D5WB 4WF2A 5C3EJ 1U5TA 3Q3SA 2CO5A 3GTGJ 3HOWJ 4C30A 4BJ5C 4LK0F 1UAAA 2JT1A 1KYWA 3LSJA 3MMYB 3ECHA 2XSDC 1MBKA 1W1WE 2FD5A 2LMDA 3CCQI 1PJRA 3S1NJ 3FIWA 2ICWG 1OYWA 3CCJI 1HW5A 3I4NJ 4NBQA 1W5CC 4IXAA 1XTAA 2P4WA 2ECCA 3W2AA 1D0XA 1EJ9A 3JRBA 3COAC 4HBLA 2WWYA 4B3XA 5EEGA 2OBPA 5LLQA 3GZ6A 2L9NA 3NAUA 4JQFA 3KETA 3QYBA 4J19A 2MH2A 3DBRB 4HEA2 1LVAA 3K2ZA 1JKQC 3R61A 3RKWA 3CDIA 2I10A 1JGGA 2F48A 2GXBA 4E7ZA 2M4GA 1XMAA 4XKWA 3CESA 2DA4A 4NC7A 2BYVE 5GAHJ 5DV5A 3ZMVA 2VQGA 3VYRB 1X3WB 5TRDA 2E2JJ 2Z2SB 1UHMA 4WK8F 1YX3A 4BQOA 3FXKA 3RTRA 4HNVA 1MMAA 2IEKA 1JHHA 2AS5F 2HKOA 3PO2J 5JHFA 1ETKA 1O7LA 4G9YA 2LK2A 3ELKA 3FK6A 3H9JA 5CYVA 1W5SA 2WADA 4RS8A 2HZDA 4RBOA 4XICA 2V7FA 3L1PA 4A3IJ 2JVHA 1KA8A 2EV5A 5FGMA 1O57A 1SVLA 2DT6A 3OYMA 5D5UB 1Y8RB 5GTIC 2QQ8A 3FMSA 1P6RA 5CJ9A 3HZJA 1TWHJ 4ITVA 4EM1A 4OIOF 1QHGA 3OYCA 4BEHB 3NWTA 3K0LA 3CUQA 3KYDB 1IRFA 2JTVA 2EV6A 4CYCA 3QOPA 2HEOA 4I02A 4ENMA 5HS9A 2R7QA 1RIOH 4UUSB 5EG0A 2ME6A 4I0BA 2L9VA 2LKXA 3CO7C 2QCOA 3BCBA 1R36A 3QYFA 1QQIA 2ZBKA 5HDGA 4ZDPA 2AQEA 3V8LA 4YIIA 4B4CA 3MKYB 3TL4X 3K4KA 5F04A 2DOFA 3DLLF 2KIUA 3P9KA 2W1OA 4KDPA 2NVXJ 1MMNA 2OZ6A 3TDZC 4RB2C 1CGPA 4FX0A 3KEOA 3CCYA 2O5RA 4JK1X 3KEQA 1SFUA 4XLFA 3DEWA 4HF1A 2VKVA 1P7JA 3I71A 1WJBA 3IH2A 3WTWC 3ECOA 3OYFA 2NVUB 1UFMA 1ZQ3P 2X6OA 1XDSA 1HCRA 4I99C 4J00A 2VL8A 4GCVA 1GVDA 3E6DA 5J8CA 3CF5F 2LP0A 1FMWA 4N9IA 4IX7A 2HYGD 1YS6A 2L4AA 2V6EA 4CCKA 4AD9A 1MJ9A 1R1VA 4DNCA 5J6XA 4AIKA 1FOYA 3GEZA 4H4KC 1WFXA 4WCGA 3NRVA 1LNWA 3F8MA 1FTZA 1QPIA 4Z6YA 3SEQA 3G73A 2KISA 4BQQA 5BOXA 4KFCA 3SHFA 1U8BA 3V42A 3GTLJ 4HSRA 1J5YA 4S0HB 2ZMEB 9ANTA 4FE4A 2DTRA 3ZQ7A 4C3HJ 3U21A 1YRNB 3S17J 2HQRA 1ULYA 2MC4A 2G0EA 3GWZA 1WIBA 3OOUA 1I6HJ 2P7VB 2LTPA 3KP6A 1IAWA 3WTZA 4OINF 1OR7C 4EATA 3JRFA 1HXDA 4CYDA 2P6TA 2WBMA 2CV0A 2GBYA 1LPQA 1OLTA 4M74A 3E6BA 1U3EM 2R7ZJ 4KMUX 2MA3A 5LGNA 1GVJA 1YE9A 2QF7A 2R0QC 2IS6A 3VFZA 2L7ZA 1B59A 1I27A 1MSFC 2IS2A 4E7HA 2D2WA 2VBZA 4KUMA 1B6AA 4KJZA 5C44J 3BP8A 1JGSA 2ZSHB 3TW6A 2AXLA 5HLTA 1TWCJ 3KFWX 3D5SC 5BS6A 4K2EA 1RKWA 2YPRA 3BTLA 1O3SA 1MD0A 2F6CA 1HKQA 4G6DA 4DYCA 2BE5F 4F52A 2VQCA 3ABTA 4AIHA 5LEJA 4GYIA 4B44A 5K5RA 3DTKA 2R93J 1O3RA 1G2HA 3PIOF 3IWZA 3ERED 2MABA 5FLMJ 2IGMA 3ZN1A 3DWLE 5IPAA 2VJJA 5KHDA 5M3MJ 3M8EA 3S15J 5J47A 5HLIA 3FM5A 3MN2A 2GOXB 1JTXA 3RZOJ 2UXNA 3T0YA 4XSXF 4MGRA 2JA6J 2K5CA 3J81K 4RM3A 3L9FA 1DP7P 2R7UA 3MZYA 3OY9A 1S8NA 1W36C 4ZZLA 1AOYA 2LVSA 4EJVA 3RDIA 4A3CJ 3HIFA 1D5VA 1Z91A 5J4VA 4IHXA 4UVCA 5L3DA 4ZH4F 3WTTC 3ABUA 2EIKH 1F1ZA 4ZDOA 1IW7F 3OYGA 2CFXA 1T56A 1U5TC 1S3JA 1XSVA 2ECBA 3UKGA 1WZ2A 1FLIA 3HEFA 1JUPA 5C4XJ 4HPQA 4M72A 4ESBA 2DBBA 5D4RA 4O5VA 4I7HA 1FZPB 4U87A 2RNJA 3LNQA 1NG6A 1X4OA 2JRTA 3HSRA 4HZFA 2KZGA 3CCVI 4XLNF 2EA4A 2W00A 5E79C 2QBYB 1VQ4I 2W82A 1YW8A 4O6JA 1T95A 2HQAA 2FUG2 2QENA 4BHBA 3K4JA 3RPUA 2PI0A 4C3IJ 2LBFA 1YYVA 2Y30A 1QPMA 5EEHA 4BHPA 5DCMA 3KLNA 4MTDA 2QZ8A 3OL3A 4KIBA 2GXAA 1HBXG 2CRGA 2ME0A 3KE2A 5F0FA 2CYYA 1MNMC 2FJ1A 1AKHB 5E8GA 3ZQIA 3PM1A 3I0TA 1N25A 2M45A 2NXNB 2LYCA 2LY9A 4Q47A 3JSPA 2FBKA 4L5EA 4RAGA 2ACJA 5EF6A 2L2OA 3GXOA 1ZR4A 1YG2A 3O3KA 4XOTA 3LAJA 3W2VA 2DFHA 2UUZA 3HOXJ 3AG4H 1TP4A 3I59A 1X2NA 3RKYA 3M4OJ 3GBGA 3K4LA 4YELA 3V7RA 4J01A 2HI3A 1J7KA 4CCLA 4BS9A 1I3QJ 3HKZA 3DPTA 5ILSA 1K6YA 2X4HA 3CJTB 1VQMI 1TBXA 2ID3A 3A0HC 4KN4X 4OWRB 3JRAA 1K78B 2EA2A 2CG4A 3LA3A 4MTEA 4YRVA 1FOWA 1ETXA 4XKCA 5TISC 5IOYA 3OIQA 2L5QA 1FNNA 1G4DA 1EA3A 1IRGA 3H5NA 1V3FA 2RVCA 1F43A 5D6FA 1G6NA 3G1OA 2Z33A 3ZMUA 2WV1A 2ISZA 4E6KG 2JA2A 2QQBA 1XD7A 3I9V2 2JMWA 4OAZA 2V26A 3K2AA 5CVJA 3ZGKA 1B1BA 3IH4A 2L01A 3SZTA 1PDNC 2KIMA 1ZRDA 1IF1A 2R7TA 1STZA 2BHYA 2ZXIA 1IRZA 1Y1VJ 3GTKJ 4LG3A 1S7OA 4DBQA 1U6GA 4RGSA 4NUBA 1X58A 2V9KA 3HM5A 1MW7A 3HTSB 3QPLA 1U9NA 2B63J 3BROA 4FQGA 4YFXF 1J2XA 2VC0A 5F1RA 1I50J 1WJ5A 3GFMA 4A3JJ 1ZRCA 1FBQA 2FE3A 4I6ZA 4UUTA 2GM4A 3GTOJ 3Q0VA 4XKVA 3OYEA 2VE9A 4IRHA 5IOZA 4PSWA 1X19A 1F9NA 2XGEA 3MWMA 2V9PA 5TGTA 3ASOH 4M3GA 2ZXWH 3OSFA 3TEDA 4UVAA 2JA8J 4IKFA 1L3LA 2G7HA 4BL0B 5ILUA 4GGGA 3JREA 4IEJA 3S93A 2PMZN 2LY1A 1FYKA 3GO5A 4LGWA 2L4MA 2RN7A 1IN8A 5M5YJ 5KCMA 2LR8A 4N0BA 3QOEA 2EIJH 2ZXHA 3J7AY 2IA2A 4NQWA 1LUJB 1BI1A 1K6OA 1JHFA 3JRCA 3ZXSA 3A03A 3PQKA 2AHQA 3T1BA 1KU2A 2GA2A 4HW0A 1R4NB 1QZEA 4BYYA 1F36A 1XG1A 1R58A 2V9VA 2XB5A 3O8GA 4Y3OA 1XMXA 2VXZA 3BTJA 1ODDA 1LE8A 1D0YA 2HVRA 1Z0XA 2A69F 3A4CA 3OSGA 3JAMZ 1MZBA 1LVKA 5L3BA 1SANA 4HAMA 2IS4A 1JTYA 2EH3A 4FTHA 1T6SA 2B9SA 4D9JA 2M0MA 3DU6A 2EIMH 1V55H 5JLXA 4YEJA 2K9NA 5F27A 1S72I 1HKSA 4MNUA 4ESFA 3BPXA 2XAJA 3BTCA 5EJCA 4TV7A 2JN6A 3KEYA 3PIPF 2VT2A 4G7HF 3S3MA 3JRGA 3G71I 1EV7A 4N9HA 3MZHA 4ZTFA 3RIRA 2H1KA 4G6TB 1HLVA 2FEZA 1MBFA 1G3TA 3QP5A 4CA0A 4CDGA 2VB6A 4BE2A 2LH9A 2DMUA 4G8XA 4AVZA 3FXRA 1USSA 4BJ6C 3EYYA 4ZTJA 2Y0SA 1JKPC 1Q1HA 3FHNA 3PQJA 1FJLA 2QQ9A 1AWCA 2VOPA 2XHKA 3DBHB 3EUHA 4M71A 2NOJB 2HZTA 4B3AA 2VIXA 2EINH 3HSFA 5LD2C 3F0CA 5FLXK 1P2FA 2OCCH 3OYNA 5ICEA 2V1UA 3TO7A 4ZZDA 1NK3P 4AYBA 3GTQJ 3A02A 1Y0NA 4U7DA 1XGSA 3MZ8A 4M6XA 2Q1ZB 1YHQI 1H9TA 3HOZJ 1RR7A 1T08B 4HYEA 1B72B 3LSIA 3E6CC 3B6CA 2X6WA 2BXZA 2YU3A 1JI8A 1W7PA 6PAXA 3ABKH 3FKIJ 3HUGA 2FF4A 2VC1A 3WHCA 2E1OA 4V19K 4XORA 4Y15A 2LY2A 4HLXA 2M8EA 5E20A 1LEBA 2GIZA 3EQLF 4UNOA 2H6BA 4E7SA 1R1UA 1KONA 3A01B 3BT9A 1FYMA 2CW0F 5IYBJ 3ESWB 2DFEA 3H35A 3RKXA 2R7XA 1FWZA 4A93J 5EEAA 2R5ZB 1ZGJA 4B1RA 4LJZF 2XRNA 5E3NA 1WKMA 1CF7B 5B66C 2XROA 5BPDA 1W36D 1UELB 4ZJZA 1GUUA 3S16J 4XL9A 4AIJA 5FFZA 2MD5A 2XRLA 2JUCA 2UWMA 3ZQFA 3HB9A 5HDNA 3MKZA 1YJWI 2HVSA 3TKYA 1SD7A 1R5ID 4EGZA 1Z1DA 2P6SA 1RC9A 4CHUA 2LOOA 2V1DA 2PLYA 3A2KA 1G3WA 3LSMA 1T39A 1WH5A 2VQHA 3P9CA 4M3DA 4GFBA 4HLYA 3I55I 1SD4A 2P81A 2VE8A 2QSGX 3IP4B 3F22A 3RPQA 1FSHA 2J5PA 1IZ1A 3KZYA 2E7XA 5M5XJ 2PJRB 1VQ5I 3JAMK 3S1MJ 2MH9A 3K9TA 2M5WA 4KIGA 3HOUJ 2QLZA 4Y17A 2Q2EB 4KICA 4LB6B 1VQ8I 2K9QA 2CMPA 2HDWA 3RYRA 1KZHA 1WI3A 3V7SA 1N77A 3HHHA 3F21A 3BJAA 3I54A 2GLOA 2ADUA 4CCOA 3LMMA 3CC7I 2LSOA 5HOOA 1QVTA 1FIPA 2RAEA 3SJMA 4U0VA 4ZDLA 2EFOA 4F93B 3GX4X 2YR2A 3HRMA 2X9DA 2ISYA 4BQNA 1XX5A 5LEKA 5CKTA 3PFIA 2E1NA 4LG0A 3TDUC 1IXRC 2A6EF 5IT9K 3CP8A 5DTDA 3I3LA 5FB2A 5DM6F 2ZSIB 2FU4A 1ZN2A 5J1YA 1N78A 1QBJA 3C2BA 4CO8A 3EYIA 2EK5A 2RGVA 3EETA 3M8JA 4XMYA 3M3YJ 3CDHA 1Y39A 2KRFA 1X1BA 1P92A 3CUOA 1X3ZB 3DTEA 2ZJQF 4RB3C 2H6CA 2PX9A 1MNEA 1IV8A 1BC7C 2D5VA 2K4BA 4MIMA 2LNBA 3OYKA 2HTSA 1MDMB 3J7YJ 4RA2A 1BW6A 4IHTA 1NG7A 1X1PA 3CCEI 3K70D 1SFOJ 2M2EA 2JSPA 3L2UA 3LQQA
chains in the Genus database with same CATH topology
2FOWA 1YIJI 1VQ9I 3J7ZI 1FOXA 2OTJI 3CCLI 1VQ6I 2NXNB 3I56I 1YJWI 1MMSA 5GAEJ 2OTLI 4IOCF 2E36A 3CJSB 4IO9F 2JQ7A 2K3FA 1VQ7I 3CD6I 3CJTB 1VQMI 1S72I 3CCSI 3I55I 1YJNI 5GADJ 3EGVB 3CCRI 3PIOF 3PIPF 2QEXI 2E34A 1YITI 3G71I 1FOWA 1VQ5I 3G6EI 3DLLF 1HC8A 1VQOI 1VQPI 1VQ8I 1VQKI 1VQLI 1ACIA 3CJQB 3CC2I 3CC7I 2QA4I 5GAGJ 3CMAI 3G4SI 5JVGF 3CCMI 3CF5F 3CMEI 1QA6A 3CCQI 4IOAF 5DM6F 3CCJI 1VQNI 3CJRB 2H8WA 1FOYA 5DM7F 1YHQI 1Y39A 3CCVI 3CC4I 2ZJPF 2E35A 4UY8I 2ZJQF 1VQ4I 1YI2I 5GAHJ 2ZJRF 1YJ9I 3J7YJ 4V19K 3CCUI 3CCEI 1WIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOW A;  1YIJ I;  1VQ9 I;  3J7Z I;  1FOX A;  2OTJ I;  3CCL I;  1VQ6 I;  2NXN B;  3I56 I;  1YJW I;  1MMS A;  5GAE J;  2OTL I;  4IOC F;  2E36 A;  3CJS B;  4IO9 F;  2JQ7 A;  2K3F A;  1VQ7 I;  3CD6 I;  3CJT B;  1VQM I;  1S72 I;  3CCS I;  3I55 I;  1YJN I;  5GAD J;  3EGV B;  3CCR I;  3PIO F;  3PIP F;  2QEX I;  2E34 A;  1YIT I;  3G71 I;  1FOW A;  1VQ5 I;  3G6E I;  3DLL F;  1HC8 A;  1VQO I;  1VQP I;  1VQ8 I;  1VQK I;  1VQL I;  1ACI A;  3CJQ B;  3CC2 I;  3CC7 I;  2QA4 I;  5GAG J;  3CMA I;  3G4S I;  5JVG F;  3CCM I;  3CF5 F;  3CME I;  1QA6 A;  3CCQ I;  4IOA F;  5DM6 F;  3CCJ I;  1VQN I;  3CJR B;  2H8W A;  1FOY A;  5DM7 F;  1YHQ I;  1Y39 A;  3CCV I;  3CC4 I;  2ZJP F;  2E35 A;  4UY8 I;  2ZJQ F;  1VQ4 I;  1YI2 I;  5GAH J;  2ZJR F;  1YJ9 I;  3J7Y J;  4V19 K;  3CCU I;  3CCE I;  1WIB A; 
#chains in the Genus database with same CATH topology
 3FXL A;  1R5G A;  2JA5 J;  2Y0M A;  2DPD A;  1D0Z A;  5F08 A;  1OJL A;  3VYS B;  1E3H A;  3AG1 H;  2FSW A;  4DIQ A;  2CH0 A;  3IRQ A;  1Y8Q B;  3H3V K;  3K7A J;  4LLG F;  2WA0 A;  2KIQ A;  1I5Z A;  3H5A A;  4PUS A;  3VSK A;  1UZC A;  2EZL A;  3PSI A;  1MGT A;  5D8K B;  2AO9 A;  2E5Z A;  3ZOB A;  2CS3 A;  5ILV A;  3JTG A;  1R4M B;  4L5I A;  5GAE J;  3RCO A;  3OS0 A;  2E1M C;  2P5L C;  1MKM A;  3I64 A;  1GT0 C;  3O8H A;  2DI3 A;  2STT A;  4A69 C;  3ZRG A;  1TWF J;  4BU2 A;  1ZYR F;  4IVN A;  2K3F A;  4RDU A;  2WAE A;  1OYY A;  4PFP A;  4QIW N;  5K5Q A;  3C2G A;  4LD5 A;  1XGO A;  2A68 F;  5KK1 A;  4CCN A;  4PJ0 C;  3VYU B;  2WB1 N;  2WAQ A;  4A3F J;  2HFH A;  4HRI A;  2Z1D A;  1TQM A;  2KRC A;  2WAF A;  3H36 A;  5H20 A;  4HX7 A;  3K1P A;  4KIT B;  4BDZ A;  3FXU A;  1ZH5 A;  2GA1 A;  3C2H A;  1XSD A;  1XC5 A;  5GP9 A;  1DP3 A;  1YO5 C;  1VQL I;  1CQT A;  1K61 A;  4IHV A;  3SQN A;  3OYJ A;  2EJR A;  3HHG A;  4PK4 A;  1BI0 A;  1V5F A;  4IQ4 A;  3OYL A;  4A2U A;  2JZY A;  3FMQ A;  5D6E A;  4AU7 A;  3UNG C;  3ISP A;  2RV8 A;  2QA4 I;  4HST A;  3J81 Z;  2HOE A;  4A3K J;  1IUY A;  3WTU C;  3JCU C;  1SMT A;  3N4M A;  2ETH A;  2DK8 A;  3CME I;  5DUK A;  3OIO A;  3BR2 A;  2HNH A;  4C2U A;  2WC2 A;  2HYF A;  2CUJ A;  3FXO A;  1ETW A;  3OYA A;  2D1H A;  2DQR A;  5AIP A;  2QSH X;  4F91 B;  1Z21 A;  2VBW A;  4HA8 A;  3WTY C;  1ORK A;  5HLG A;  1V4R A;  3TP0 A;  5EYR A;  5ED4 A;  2XAS A;  3HPH A;  2EBI A;  1IRX A;  2JRM A;  3WU1 B;  2L7M P;  4E7K A;  1SD6 A;  3EUH C;  3QOD A;  4RMN A;  1VFC A;  1HSJ A;  2RQQ A;  1KGS A;  3MKL A;  1HDP A;  3DXJ F;  1YJ9 I;  1OPC A;  4KNY A;  2W24 A;  3OYD A;  3RI4 A;  3DTI A;  3SZG A;  3M07 A;  3AFH A;  2CWE A;  5LRR A;  3LST A;  1ETV A;  2DFF A;  1FSE A;  2I8D A;  4NC6 A;  5CVR A;  3SDG A;  4D1Q A;  1IDZ A;  4LIV A;  3H1C A;  3L2V A;  4ENJ A;  1YW7 A;  4FE7 A;  3MQ0 A;  3RZD J;  1MBH A;  2BOL A;  5DDG A;  3LOC A;  4QLC U;  3HRU A;  1JT6 A;  3GTM J;  3LWF A;  1FMV A;  2DMQ A;  2F4O B;  2A5Y B;  1TWA J;  3GME A;  4AUX A;  5ICF A;  3P5J A;  2FX0 A;  5KVR A;  4HQE A;  1FEX A;  3FXQ A;  4B8X A;  4G94 A;  3IKT A;  4D0P A;  4LLL A;  5LFA A;  4M73 A;  1DDN A;  3GYH X;  3BLY A;  3BZ6 A;  2MC3 A;  4R8H A;  1LFP A;  2DOE A;  1ZGW A;  2JSC A;  2HOT A;  2DOA A;  4P55 A;  1D1B A;  2HPI A;  4OMY A;  2M87 A;  2O8X A;  1FYL A;  4G6Q A;  5FD5 A;  2VT3 A;  5FKO A;  2VBY A;  4XBF A;  3I53 A;  3QPH A;  3SFZ A;  1YJN I;  2HS5 A;  1ETY A;  2PMU A;  4UUV A;  3CCR I;  3SZP A;  2YX7 A;  1QZZ A;  1R6R A;  2K9S A;  2OC6 A;  4U7B A;  2CFO A;  4DJA A;  1XDU A;  2K27 A;  3L09 A;  4L0Y B;  1UHW A;  3FK7 A;  1FBU A;  2OF7 A;  3QU6 A;  2VKH A;  4PSX A;  1WH7 A;  2BVM A;  2BBY A;  2DTZ A;  4NNJ A;  4Y13 A;  1VQK I;  4MFD A;  2YS9 A;  1XS9 A;  3HGG A;  3IL2 A;  3N05 A;  5L3E A;  2IPQ X;  2JK3 A;  4DYQ A;  2DMP A;  4HF0 A;  2R7W A;  4XON A;  3GVA A;  2MBF A;  2HTJ A;  2EB7 A;  4E70 A;  2DAO A;  5CLS A;  2FRH A;  3CUQ B;  3J80 K;  5H2F C;  3ZMZ A;  5CVU A;  4CYC B;  1GXP A;  2MG4 A;  4ZYH A;  3L00 A;  3CO6 C;  1J75 A;  2DA2 A;  2HXI A;  5EG0 B;  3HOT A;  2E60 A;  4XRM A;  3RPU D;  2Y2Z A;  1ZEL A;  5K7H A;  1Z7L A;  2N8G A;  2LF8 A;  1HA8 A;  3KZZ A;  1HKT A;  1P4W A;  2FA5 A;  3CJN A;  1JUS A;  1B8I A;  2CW8 A;  2BGC A;  2DPU A;  2P5V A;  4MHG A;  1QO0 D;  2QVO A;  3ZMT A;  1W5T A;  5D8L B;  4S04 A;  2MW8 A;  5BMZ A;  3IC7 A;  2CQN A;  3TQN A;  2GQQ A;  3RKQ A;  2AXT C;  3P7N A;  1WJE A;  3Q9S A;  3FX3 A;  2IP2 A;  3S2D J;  2IVM A;  3HG9 A;  2XF6 A;  4EJO A;  2L9R A;  5F64 A;  3TOB A;  2WY8 Q;  4UV8 A;  5FRN A;  1KU9 A;  1ZRF A;  2DQL A;  2I5U A;  3QU3 A;  3F8N A;  4FHT A;  3WHB A;  4GDF A;  3BPV A;  1P7I A;  1Z9C A;  2M9H A;  2BEO A;  3CCL I;  5C4J J;  2B7E A;  4XM3 A;  1XB4 A;  2HQN A;  2BW3 A;  4HNT A;  3E7L A;  2L54 A;  4BQA A;  4A0X A;  3BR0 A;  1Q1V A;  2OQG A;  2YX4 A;  2TDX A;  3WU0 A;  1J0R A;  2MYS A;  4XNF A;  1ZHF A;  3HL2 A;  3E0J B;  2XF7 A;  3OIP A;  1UMQ A;  3ULQ B;  3ZMS A;  2XAU A;  5J1R A;  1LDD A;  1D1A A;  5DEQ A;  3H9G A;  2X1C A;  3BG7 A;  5FRM A;  3BG9 A;  1E3P A;  1FPQ A;  2ID6 A;  3RYP A;  3GZ5 A;  3HJE A;  3OR2 C;  2QKL B;  2VLA A;  1PUF A;  3BR6 A;  1Z7U A;  2PG4 A;  1R23 A;  4N4N B;  3KCC A;  4EVI A;  1IV6 A;  4IHY A;  1V5G A;  1P4A A;  1WWX A;  4FAS D;  3CDL A;  2GXG A;  2EFN A;  5E1W A;  2RRE A;  2TCT A;  4ZYE A;  3HOV J;  2B0L A;  5B3S H;  2UV1 A;  2P7C B;  2X6Y A;  1GXQ A;  2EV0 A;  2A05 A;  3C1D A;  2CUZ A;  2BY0 A;  2YSR A;  3D5L A;  4M6Y A;  1FBS A;  1XCB A;  2DT5 A;  5LBQ A;  1OYI A;  3REO A;  2BHZ A;  3VSL A;  5CVI A;  2MLK A;  1FTT A;  3LFU A;  1IG7 A;  3R6S A;  1OMI A;  3F6V A;  2COB A;  2E7W A;  1VZ0 A;  3H3U A;  4ZYG A;  3FM3 A;  3S3O A;  3CMA I;  2LDU A;  4I2O A;  2F5E A;  2BY2 A;  3BG6 A;  2KHM A;  1WQ2 A;  2BY1 A;  1P4X A;  4Q5S F;  3BJ6 A;  2XAF A;  3H9Q A;  2VOO A;  1RKT A;  3IAM 2;  2L0K A;  4JX4 A;  1RI7 A;  3LA2 A;  1VQN I;  1RRJ A;  3CJR B;  2XF5 A;  4WXD A;  2JUG A;  1BI2 A;  4CXF A;  5FLX Z;  1QGP A;  3CLQ A;  5FJ8 J;  1RZ4 A;  4I0A A;  1LDK B;  5EGO A;  4LLN A;  4UB8 C;  3DQV C;  3BZK A;  4L0Z B;  1UST A;  4PGH A;  4LB5 A;  3DKX A;  2NS7 A;  3FXJ A;  4L9N A;  3OOP A;  3R0J A;  4OU0 A;  1NHA A;  2E35 A;  1X4P A;  2MD0 A;  2X1D A;  2JPB A;  4WX9 A;  5DYM A;  2L9S A;  2Y9Y A;  5FO5 A;  4YIR X;  1D8J A;  2OA4 A;  4BBS J;  2DU9 A;  2R4G A;  1WPK A;  1S7A A;  4I98 B;  3AKZ A;  4C2M J;  4XR6 A;  3FF5 A;  2CV1 A;  4UVB A;  1QVU A;  2D1V A;  2O6G E;  4CZC A;  2FBI A;  2DYR H;  4YG2 F;  2Z16 A;  2FOW A;  5J3L A;  3AG3 H;  3M1E A;  3CP2 A;  2NYX A;  4BAC A;  2KQR A;  1S7E A;  3ZQH A;  1ZG5 A;  2VN2 A;  1SFX A;  3JW4 A;  2CSO A;  4DZP A;  1IJW C;  3WGG A;  4LMY A;  1XPX A;  4IQJ A;  3JTH A;  2F5C A;  3U2R A;  3V7C A;  3SYT A;  3M9A A;  4PDK A;  2O8K A;  1ZRE A;  2NOG A;  3S1R J;  1S5L C;  2RKH A;  1IUF A;  5FKL A;  2DXI A;  1G8X A;  3A0B C;  2Z5U A;  3KLO A;  2IXS A;  2IT0 A;  4OOI A;  4HX4 A;  4XQF A;  4EMS A;  4HF2 A;  3CQZ J;  1BA5 A;  4D5F A;  2HU9 A;  4JYK A;  4IO9 F;  4F55 A;  4F3Q A;  2LBF B;  1WCM J;  3S2H J;  2R5Y A;  1HW1 A;  3CCS I;  2GWR A;  2R92 J;  5DCM B;  1TNT A;  1H88 C;  1A36 A;  3ABM H;  5E1X A;  2NNY A;  4KMF A;  3BOQ A;  4XSZ F;  4E7J A;  5BPI A;  1WJF A;  2P8T A;  2DA6 A;  1SFE A;  2M30 A;  3RQI A;  4IZZ A;  4FCY A;  2Q8K A;  4RAF A;  3ZQC A;  1BR4 A;  1ACI A;  3HSE A;  3H3Z A;  5F6F A;  4F7Z A;  3HTU A;  3DU5 A;  2LC2 A;  2ELH A;  1LJ9 A;  1K4T A;  3S14 J;  1AU7 A;  3HKZ N;  2HGC A;  4A12 A;  2C6Y A;  2CQK A;  2DW4 A;  4PJJ A;  3I59 B;  1I39 A;  4BXU A;  1HDD C;  1UG0 A;  2W7N A;  1RUN A;  3EDP A;  4P5O A;  4R79 A;  2KT0 A;  5BQT A;  3ZR8 X;  5LGU A;  4QWQ A;  2R7R A;  3MVP A;  4P96 A;  4Y33 A;  4CCM A;  3W6V A;  5IT9 Z;  3AL0 C;  1OCP A;  5IT3 A;  1F5T A;  2VUM J;  4WXC A;  3MD2 A;  5ICC A;  2ZFU A;  2M34 A;  4KYW A;  3KX2 A;  3IKV A;  2RDP A;  3WTS C;  1TW2 A;  1YOV B;  2G9W A;  3KP4 A;  3RQ4 A;  3HBL A;  4D7M A;  1H0M A;  2A07 F;  3O6B B;  5CQE A;  1IN4 A;  3QRF F;  2R3S A;  2F5D A;  2QWW A;  2PBI A;  4BHC A;  5HNF A;  2NNN A;  2F5F A;  5A2Q Z;  2PEX A;  2ZJR F;  3LSH A;  1F4K A;  3FXM A;  4UB6 C;  2NAZ A;  4QPO A;  1WJA A;  1QHH D;  3FKJ A;  4HV5 A;  3F6O A;  3DFG A;  2KIF A;  1J59 A;  3NAR A;  2F2E A;  3MAJ A;  3Q0U A;  4CIC A;  4DOZ A;  4BGD A;  2QM3 A;  4EJW A;  4BUP A;  1VQ6 I;  3LSK A;  2IBD A;  3IUO A;  4G7Z F;  3D0S A;  1YW9 A;  4OAY A;  3L7W A;  1WSU A;  2VOD A;  1D8K A;  2CQ7 A;  2ZCW A;  2VJI A;  3T8T A;  1HOM A;  2DK5 A;  3JR9 A;  1DPU A;  3I56 I;  3D5R C;  3M8F A;  4M9Z A;  3LSG A;  2A3S A;  5JFR A;  1LFU P;  3S3N A;  1VF9 A;  2EFQ A;  1U8R A;  4IOC F;  4MEX F;  1ZG1 A;  3BZC A;  4XRS G;  2IGO A;  4PGG A;  1S6L A;  3VOE A;  4CZZ A;  3HC7 A;  2JQ7 A;  2A5W A;  3F9K A;  3R60 A;  3L2W A;  2KDO A;  3PSF A;  1H9G A;  1OCO H;  5GAD J;  3EGV B;  5FLV A;  2ZNZ A;  3H0D A;  2Z3Y A;  5HLH A;  5AIQ A;  4FX4 A;  1EH8 A;  4UV9 A;  2E34 A;  4UXN A;  4FIS A;  1UHS A;  3BR5 A;  2A61 A;  4M9X A;  4NQW B;  4DYR A;  1ZAR A;  4BKX A;  3C7J A;  1VQP I;  4RGX A;  4W1U A;  5B5E C;  1E17 A;  1RPW A;  3BQY A;  1MJA A;  3K1M A;  4CGZ A;  2F4M B;  4KN7 X;  2D45 A;  3B6A A;  1LE8 B;  3BG5 A;  2QGU A;  2OQR A;  3G1M A;  3G4S I;  4HG2 A;  1J09 A;  5JVG F;  3WG9 A;  1R9T J;  1RR8 C;  2VQL A;  3HOS A;  3CCM I;  1MSE C;  2MSY A;  4EEF G;  1I1G A;  2XB0 X;  2KJB A;  2KPM A;  4KA4 A;  4M3E A;  2CU7 A;  1FX7 A;  2OD5 A;  3H5R A;  4Y4R A;  4IOA F;  1Z67 A;  3GFL A;  2IA1 A;  2K9M A;  3TO9 A;  5EZH A;  1E2X A;  3F8B A;  5ICG A;  1BBY A;  1TT5 B;  3GCM A;  4MFE A;  2KP6 A;  3PUF A;  2AQF A;  2KZV A;  5H6Q A;  1XGM A;  1S29 A;  2K9L A;  3BR1 A;  1K83 J;  4RGU A;  3OS1 A;  1MJB A;  1GV2 A;  3BCA A;  5FKK A;  2WTE A;  2Y0S N;  2Z9O A;  2ZFW A;  4KIS A;  3P9I A;  5J8F A;  2VAS A;  3SXY A;  4X1E A;  2KMU A;  4BEH A;  1BI3 A;  3ERM A;  1PYV A;  2R7S A;  4LIU A;  1Z6T A;  2V6C A;  1D5Y A;  4GO1 A;  1LQ1 A;  2LF7 A;  2DJN A;  1IN7 A;  2ZNY A;  1ONV A;  4UUS A;  2P0W A;  4AYB N;  2E71 A;  1VQ9 I;  1FP1 D;  2XPW A;  3J7Z I;  1FOX A;  2LG4 A;  2XGD A;  4JBA A;  1XCV A;  2R7O A;  3C18 A;  2M0C A;  3MCZ A;  3N97 A;  1TWG J;  1BL0 A;  1IDY A;  2DMT A;  2EFP A;  5A2Q K;  3PUB A;  3CLO A;  1V5E A;  4O3M A;  3ZN0 A;  1X2M A;  4E7L A;  4N4O B;  2Q0O A;  2X48 A;  1DPR A;  3FWE A;  4I01 A;  2HOS A;  2O7O A;  1W7P B;  2R7V A;  1BIB A;  1OCC H;  4IJA A;  5D4S A;  4IHS A;  2L7F P;  4X0G A;  2VPL A;  1JUM A;  3S32 A;  4HDU A;  3HUG B;  3R0A A;  4WWC A;  3WTX C;  2NVY J;  3JRD A;  1ZLJ A;  3DBL B;  1BJA A;  2MLG A;  1O4X A;  3X2Q H;  2ZO4 A;  2M7B A;  3OYB A;  4IF4 A;  2A6H F;  4V2F A;  3VOD A;  1WGX A;  2NS8 A;  4M3F A;  4QPQ A;  2ZJ2 A;  4OIR F;  2XC7 A;  3I5U A;  2QEX I;  1UG2 A;  2VBX A;  3M1C A;  1WRJ A;  1WHU A;  3DP7 A;  2LKP A;  3GFI A;  2XGC A;  3QPS A;  4HV6 A;  1R22 A;  1TT0 A;  4ENN A;  1M1E B;  1OCT C;  5GTH C;  2YUS A;  1DGW Y;  1O3T A;  5DS9 A;  1KQ8 A;  1T8I A;  2ZME A;  2DO7 A;  3V4G A;  5E8I A;  3HXL A;  2BZT A;  3DEE A;  2CGP A;  1IO2 A;  2GAU A;  1UJ8 A;  2M1B A;  2CJJ A;  1MH4 A;  1TC3 C;  1ZTR A;  4Y52 J;  1DGR M;  2ZC2 A;  1O7F A;  3GW2 A;  3HRS A;  4RLF A;  2JA7 J;  4PJM A;  1JT0 A;  1NK2 P;  1OCZ H;  3H0G J;  2J5O A;  3J80 Z;  2K02 A;  3DEU A;  2ZKZ A;  1ZKG A;  4ZYD A;  3PNV A;  1QU3 A;  1ZLK A;  2H8W A;  5LRS A;  4A3L J;  3BJO A;  3TOA A;  2EZI A;  2Y48 A;  2IRF G;  3IHU A;  4RLQ A;  1DU0 A;  2FQ4 A;  3V8K A;  1XMK A;  3UR3 C;  3JRH A;  3CC4 I;  1R7J A;  3TW7 A;  1DQU A;  4A0Z A;  4UY8 I;  3Q0W A;  1TLH B;  5LHG A;  1AHD P;  5J40 A;  4E7I A;  2DCE A;  2FXA A;  3M7G A;  4A3E J;  3S1Q J;  1A5J A;  1GDT A;  4P1W A;  2OZU A;  2X85 A;  4XLA A;  2K40 A;  3SFI A;  2O03 A;  4L5J A;  2F5V A;  2GOM A;  5F1J A;  1A04 A;  4A6E A;  1YQA A;  4AVP A;  1RUO A;  2IGN A;  4LG0 B;  1RET A;  1SVO A;  3PO3 J;  4AID A;  4AWX B;  2VON A;  1NH3 A;  2L3D A;  2STW A;  3TP3 A;  4PJL A;  4A3D J;  5CVV A;  1JJ6 C;  4A3M J;  2BV6 A;  2DDB A;  4B47 A;  4IL6 C;  1U5T B;  3WOD F;  1ZK8 A;  1P9Q C;  3E6M A;  3EPZ A;  4XOP A;  2L02 A;  3B73 A;  2KLO A;  3AG2 H;  1BJZ A;  5L3F A;  3SDB A;  3FBI B;  1TW3 A;  2V4J C;  4RM2 A;  3QWL A;  4I76 A;  3F8C A;  1ETO A;  5LGT A;  1OFC X;  2OU2 A;  3CD6 I;  2W25 A;  2YU9 J;  4L9V A;  5JLW A;  3WE3 A;  1R1T A;  1YTY A;  4A3B J;  4D7N A;  3GZN B;  3CTA A;  2HOA A;  4KT5 C;  1T2K A;  1SEU A;  2RQP A;  5HS7 A;  3TO6 A;  3DPU A;  4AC0 A;  1O3Q A;  3BQZ A;  1B9N A;  1XGN A;  1JKO C;  1X3U A;  2CW7 A;  3FIS A;  2FNP A;  2VJ4 A;  1ENH A;  1PP7 U;  2HPM A;  1FC3 A;  1SVM A;  4LIT A;  1VQO I;  4ZC3 A;  3W6J B;  5IP9 J;  2QBY A;  1D1C A;  1SAU A;  1VTN C;  4QTR A;  1WI9 A;  1K79 A;  4JP0 A;  3F8F A;  4XKB A;  1AA7 A;  1DUX C;  2XKP A;  3VB2 A;  1YIO A;  2BXY A;  5FD6 A;  3HPG A;  4BDY A;  3KP3 A;  4KIF A;  3TBI A;  1BR1 A;  4JX5 A;  5EDN A;  2P5K A;  4RGR A;  4LFU A;  2DT7 B;  2NS0 A;  3ZPL A;  2WAQ N;  5LHH A;  3WG7 H;  5IYD J;  4ENK A;  1JKR C;  3O2P E;  1WJC A;  1BR2 A;  1DU6 A;  3EUK L;  1AKH A;  2A6T A;  4EGY A;  5M5W J;  2V1N A;  3G3Z A;  3OL4 A;  4BXF A;  1A6I A;  1MIJ A;  1W4M A;  2E2H J;  2KKO A;  1BN5 A;  2X51 A;  1L0O C;  4A6D A;  2XAG A;  2EIL H;  1NTC A;  4HOB A;  1KQ0 A;  1MMD A;  3HDD A;  4D5C A;  3LQR A;  4DQ2 A;  1OQY A;  2ELJ A;  4A5N A;  1A35 A;  4S05 A;  1ZG3 A;  2QKM B;  4NHJ A;  2HVQ A;  2DYS H;  4EV0 A;  3GFJ A;  1EKE A;  1KQ9 A;  4ABZ A;  1KYZ A;  3NEU A;  3MEX A;  4AM3 A;  4G7O F;  1FIA A;  3OV8 A;  3BC8 A;  5AON A;  5JHU A;  1K78 A;  4CSW A;  2OTJ I;  3PL8 A;  3I4M J;  4L9J A;  3ZCO A;  3GLL A;  2F4I A;  5FRO A;  2LD5 A;  1U0J A;  4NB5 A;  1B9M A;  3Q9V A;  4XID A;  1MBJ A;  5HOD A;  3IWF A;  2H8R A;  4W97 A;  4C3J J;  2XAH A;  1SFK A;  5CQG A;  3U9G A;  3K4M A;  3LFK A;  1N75 A;  3IH3 A;  2LRE A;  1XN7 A;  3K4C A;  3OS2 A;  2GZW A;  2DN0 A;  3ROU A;  3GLX A;  1YS7 A;  4ANJ A;  1BM9 A;  5DCF A;  1QNT A;  1TZL A;  3R4K A;  2JJ7 A;  4IRI A;  3HYI A;  3E5U A;  2HDD A;  5HVQ C;  4XN3 A;  2Y9Z A;  3KP2 A;  3W2W A;  2K86 A;  4GYG A;  5GPA A;  2H09 A;  4CUG A;  4EM0 B;  2IGK A;  2NVT J;  2Z99 A;  3W3C A;  5KAF C;  5HS8 A;  2IW5 A;  4P9U A;  5CPR B;  2ESN A;  1U2W A;  1J9I A;  4R1H A;  2EZK A;  3KP7 A;  3GF2 A;  1G59 A;  3PFY A;  3ABL H;  4L18 B;  3VPR A;  5L3G A;  4DZJ A;  3K4B A;  2CUE A;  4B43 A;  1I6X A;  1VND A;  3CC2 I;  3GUD A;  1T0F A;  1A6Q A;  2W57 A;  1MBG A;  3CMM A;  4A3G J;  4LOC A;  3TGN A;  3IV5 A;  1PVE A;  5H6R A;  1R00 A;  2DA1 A;  1FOK A;  2X0L A;  1U78 A;  1QA6 A;  2EZH A;  2W4S A;  4EJU A;  3E97 A;  4BE1 A;  4BJT A;  2V1X A;  4NDL A;  4DW6 A;  1LKX A;  2E5N A;  1LB2 A;  2PN6 A;  1BW5 A;  4QSH A;  4U0W A;  4B09 A;  5J4Y A;  2PMZ A;  2WY7 Q;  2ZME C;  3RSN A;  5LHI A;  1TNS A;  3QAH A;  1QZY A;  5DM7 F;  3JRI A;  3BWG A;  4MLO A;  4RB0 A;  3DV8 A;  2O61 A;  2Y31 A;  4L9T A;  4MQ9 F;  2ZJP F;  3T5X A;  3E1S A;  1JJ8 C;  1UCR A;  3BG3 A;  4BXX J;  2M4K A;  2DA3 A;  1Z05 A;  3FBN B;  4M6V A;  3AL0 B;  1YI2 I;  1IXC A;  3G2B A;  2BVL A;  3ONQ A;  4EJT A;  1PUE E;  1K7A A;  1LEA A;  4BY1 J;  4IHW A;  5KNL A;  5K1Y A;  2VJ5 A;  1E0E A;  5E3M A;  1IGN A;  2JPC A;  3OR1 C;  2H94 A;  5E18 F;  1IN5 A;  2JWT A;  1ZGA A;  2O9L A;  5IYC J;  1MH3 A;  2R7F A;  4MQV A;  1GV5 A;  1W0T A;  2O0Y A;  1ETQ A;  3K70 C;  1Y6I A;  2XV4 S;  1X1C A;  5F0C A;  2K85 A;  4Q48 A;  2HR3 A;  1MND A;  5KAI C;  5M3F J;  4OIQ F;  1TQP A;  3QP6 A;  3I58 A;  3GTP J;  1SAX A;  1K4S A;  1B8I B;  4U0Y A;  4JX6 A;  1Z77 A;  2XKO A;  2PQ8 A;  1R49 A;  4XK4 A;  4I09 A;  2DLL A;  3CUQ C;  3ML6 A;  4M3B A;  3OYH A;  2OTL I;  2Y69 H;  1Y56 A;  4HNU A;  1TL8 A;  5FKM A;  4KT6 A;  2E36 A;  2MFZ A;  4ETS A;  4H0E A;  2KDZ A;  4BBR J;  5B1A H;  1SD5 A;  2IS1 A;  3ZQG A;  5FFX A;  3VYT B;  4Y7N J;  5HDK A;  2EQR A;  1YX5 A;  5DUI A;  3WTV C;  4CH7 A;  4JOM A;  4BY7 J;  1YIT I;  4MO7 A;  2BY3 A;  3DPL C;  4Q4Z F;  5K5O A;  2BW3 B;  3G1L A;  3U1D A;  2HKX A;  1R5H A;  1HC8 A;  2OV7 A;  3ZQQ A;  1B72 A;  2H1L A;  1FT9 A;  2NVQ J;  2DJI A;  2LKS A;  3DKY A;  2XIG A;  3FDY A;  4Z2Y A;  3ASN H;  3MKW B;  2K3P A;  5TJJ A;  2PMH A;  2OPT A;  2L7K A;  1Y0U A;  1I1S A;  2VI6 A;  2HQ5 A;  4BH9 A;  4ASN A;  3LL7 A;  1OIS A;  4HDV A;  3OYI A;  5K7F A;  4LK1 F;  1IN6 A;  4DBR A;  3KP5 A;  1EF4 A;  1PUF B;  2O3F A;  4XLP F;  3A01 A;  2X1E A;  5JR3 A;  5L3C A;  4XRS A;  3WGI A;  1JXS A;  2UZK A;  2ZXJ A;  1POG A;  3K6G A;  2R7D A;  2XPU A;  2V79 A;  1T33 A;  3K1N A;  1RNL A;  2XDV A;  2R5Z A;  3L2Q A;  3KZI C;  1EH7 A;  3S2W A;  4B48 A;  4XLC A;  2FQ3 A;  5E3L A;  4IPA A;  4EQQ A;  1CF7 A;  2DA5 A;  4YFK F;  2HWV A;  2EWN A;  2ELK A;  2VKE A;  3RJP A;  3DF8 A;  1YFH A;  1KU3 A;  2QQA A;  4HQM A;  4ZYA A;  2VKD A;  4XLH A;  3E5Q A;  3CMY A;  2XPV A;  4DGW B;  1W7P D;  2Y75 A;  3K4N A;  2JVG A;  3JSO A;  2IJL A;  2OJE D;  3OMY A;  1YIJ I;  2FML A;  3V8J A;  3S8P A;  1S9H A;  3HGY A;  4ON0 A;  2PJR A;  2RC4 A;  1VI0 A;  4WXH A;  3WU2 C;  1GHC A;  1TTY A;  2G7U A;  2LFB A;  2X6X A;  3KPH A;  1KU7 A;  5FKN A;  2Q2E A;  3HRT A;  4EM2 A;  5EGO B;  3EUA A;  2W84 A;  2XSJ C;  2QUF A;  1OKR A;  2RNG A;  1SMY F;  3DLA A;  1Y1W J;  3K10 A;  1WJD A;  4PCQ A;  2OCE A;  1ERD A;  2DA7 A;  2DOD A;  5DD8 A;  3MFK A;  2COM A;  3BR3 A;  1T38 A;  4U88 A;  2ZB9 A;  1UB9 A;  3CF2 A;  2K7L A;  2VXD A;  2IA0 A;  1MMG A;  2TRT A;  3CJS B;  2ESH A;  3LA7 A;  1VQ7 I;  3B02 A;  2DDA A;  5B1B H;  2OAZ A;  3BDD A;  1EH6 A;  4P9F A;  4RAY A;  3ZMD A;  3D1N I;  2XGX A;  3DKW A;  4A0Y A;  3C3W A;  4V2G A;  1A31 A;  3K69 A;  2M3A A;  1ZAO A;  4BAY A;  3E3V A;  3DCF A;  3IAS 2;  2XVC A;  5E1Z B;  2W85 A;  3U1K A;  2FBH A;  5IY5 H;  2DMN A;  1D3Y A;  3OWT A;  4XLE A;  2KRH A;  1REP C;  2KL4 A;  2HYJ A;  1ZR2 A;  1T98 A;  4UHT A;  1ITY A;  1IC8 A;  3CJQ B;  4C2T A;  5E3O A;  2CV2 A;  1E3O C;  3NWS A;  3I4P A;  2OUM A;  1MDM A;  3J7A O;  2MGQ A;  4IRG A;  3SEZ A;  1BOA A;  2LRD A;  5D5V B;  3LSP A;  1FP2 A;  2KJC A;  5GAG J;  2CUF A;  3Q5F A;  1XSX A;  4MEY F;  5JI6 A;  1H8A C;  1YRN A;  1HST A;  3KYC B;  2CQX A;  2GIV A;  2KFD A;  2VPR A;  2QSF X;  1X1D A;  4FT8 A;  2E1M B;  5IP6 A;  3QQA A;  2FMY A;  1ON2 A;  4OIP F;  3WGH A;  3NQO A;  1BC8 C;  2R5Y B;  1ON1 A;  1R71 A;  1TQI A;  3BY6 A;  3ZQL A;  1QRY A;  5E17 F;  1IXS B;  4BNC A;  3VWB A;  4ESJ A;  3CZ6 A;  1T0F C;  1GLN A;  1OCR H;  3AAF A;  4II3 A;  3H92 A;  4X6A J;  3LAP A;  1LFB A;  2WV0 A;  4GXO A;  4M9S A;  1OR7 A;  3HOY J;  2NRA C;  2CQQ A;  2DFI A;  2EPF A;  1RES A;  2M8G X;  5HNH A;  2PJP A;  4FET A;  4GRI A;  4PFO A;  1B4A A;  2QYO A;  3T8R A;  2H27 A;  4YFN F;  1APL C;  1Z6R A;  3FMR A;  3A1Y A;  2W48 A;  3CCU I;  2M7A A;  4NC8 A;  1X1A A;  4C9Y A;  1I3A A;  5K7Z A;  1MBE A;  2K4J A;  4RB1 A;  2FOK A;  4YIF A;  1HF0 A;  1BOB A;  3F72 A;  3F3X A;  3QPT A;  5ERI A;  1HW2 A;  2PFB A;  3L2R A;  1HQC A;  3WE2 A;  1G3Y A;  3QYE A;  1G3S A;  4RAZ A;  5D5X B;  5GPC A;  2UXX A;  2WB1 A;  1W0U A;  3VDX A;  1JE8 A;  1PP8 F;  3FHZ A;  5EZG A;  1YLF A;  3KYL A;  4XRF A;  4A5M A;  2LLK A;  3PNY A;  1WVR A;  4HX8 A;  3W6K B;  1H89 C;  2E1C A;  5J1U A;  3VEP A;  4F92 B;  4BE0 A;  3BTI A;  3KIO A;  3PNT A;  1MMS A;  2E19 A;  3E5X A;  1C0W A;  4PZJ A;  3L2C A;  5F0H A;  4OMZ A;  3GTJ J;  3TMO A;  1SC7 A;  2HDC A;  4E4H A;  5BNG A;  5IP7 J;  4CCJ A;  2FNA A;  4II2 A;  2HXO A;  5DD4 A;  3FZV A;  2EFW A;  4PJN A;  1U9O A;  1BIA A;  2XAQ A;  2IAI A;  2E2I J;  1LDJ A;  3LSR A;  1FY7 A;  3IRR A;  3F23 A;  4G12 A;  3PJR A;  3G6E I;  1Z3X A;  4XN0 A;  2XUB A;  1Z3Y A;  5JVT A;  3ZP5 A;  1V54 H;  5D5W B;  4WF2 A;  5C3E J;  1U5T A;  3Q3S A;  2CO5 A;  3GTG J;  3HOW J;  4C30 A;  4BJ5 C;  4LK0 F;  1UAA A;  2JT1 A;  1KYW A;  3LSJ A;  3MMY B;  3ECH A;  2XSD C;  1MBK A;  1W1W E;  2FD5 A;  2LMD A;  3CCQ I;  1PJR A;  3S1N J;  3FIW A;  2ICW G;  1OYW A;  3CCJ I;  1HW5 A;  3I4N J;  4NBQ A;  1W5C C;  4IXA A;  1XTA A;  2P4W A;  2ECC A;  3W2A A;  1D0X A;  1EJ9 A;  3JRB A;  3COA C;  4HBL A;  2WWY A;  4B3X A;  5EEG A;  2OBP A;  5LLQ A;  3GZ6 A;  2L9N A;  3NAU A;  4JQF A;  3KET A;  3QYB A;  4J19 A;  2MH2 A;  3DBR B;  4HEA 2;  1LVA A;  3K2Z A;  1JKQ C;  3R61 A;  3RKW A;  3CDI A;  2I10 A;  1JGG A;  2F48 A;  2GXB A;  4E7Z A;  2M4G A;  1XMA A;  4XKW A;  3CES A;  2DA4 A;  4NC7 A;  2BYV E;  5GAH J;  5DV5 A;  3ZMV A;  2VQG A;  3VYR B;  1X3W B;  5TRD A;  2E2J J;  2Z2S B;  1UHM A;  4WK8 F;  1YX3 A;  4BQO A;  3FXK A;  3RTR A;  4HNV A;  1MMA A;  2IEK A;  1JHH A;  2AS5 F;  2HKO A;  3PO2 J;  5JHF A;  1ETK A;  1O7L A;  4G9Y A;  2LK2 A;  3ELK A;  3FK6 A;  3H9J A;  5CYV A;  1W5S A;  2WAD A;  4RS8 A;  2HZD A;  4RBO A;  4XIC A;  2V7F A;  3L1P A;  4A3I J;  2JVH A;  1KA8 A;  2EV5 A;  5FGM A;  1O57 A;  1SVL A;  2DT6 A;  3OYM A;  5D5U B;  1Y8R B;  5GTI C;  2QQ8 A;  3FMS A;  1P6R A;  5CJ9 A;  3HZJ A;  1TWH J;  4ITV A;  4EM1 A;  4OIO F;  1QHG A;  3OYC A;  4BEH B;  3NWT A;  3K0L A;  3CUQ A;  3KYD B;  1IRF A;  2JTV A;  2EV6 A;  4CYC A;  3QOP A;  2HEO A;  4I02 A;  4ENM A;  5HS9 A;  2R7Q A;  1RIO H;  4UUS B;  5EG0 A;  2ME6 A;  4I0B A;  2L9V A;  2LKX A;  3CO7 C;  2QCO A;  3BCB A;  1R36 A;  3QYF A;  1QQI A;  2ZBK A;  5HDG A;  4ZDP A;  2AQE A;  3V8L A;  4YII A;  4B4C A;  3MKY B;  3TL4 X;  3K4K A;  5F04 A;  2DOF A;  3DLL F;  2KIU A;  3P9K A;  2W1O A;  4KDP A;  2NVX J;  1MMN A;  2OZ6 A;  3TDZ C;  4RB2 C;  1CGP A;  4FX0 A;  3KEO A;  3CCY A;  2O5R A;  4JK1 X;  3KEQ A;  1SFU A;  4XLF A;  3DEW A;  4HF1 A;  2VKV A;  1P7J A;  3I71 A;  1WJB A;  3IH2 A;  3WTW C;  3ECO A;  3OYF A;  2NVU B;  1UFM A;  1ZQ3 P;  2X6O A;  1XDS A;  1HCR A;  4I99 C;  4J00 A;  2VL8 A;  4GCV A;  1GVD A;  3E6D A;  5J8C A;  3CF5 F;  2LP0 A;  1FMW A;  4N9I A;  4IX7 A;  2HYG D;  1YS6 A;  2L4A A;  2V6E A;  4CCK A;  4AD9 A;  1MJ9 A;  1R1V A;  4DNC A;  5J6X A;  4AIK A;  1FOY A;  3GEZ A;  4H4K C;  1WFX A;  4WCG A;  3NRV A;  1LNW A;  3F8M A;  1FTZ A;  1QPI A;  4Z6Y A;  3SEQ A;  3G73 A;  2KIS A;  4BQQ A;  5BOX A;  4KFC A;  3SHF A;  1U8B A;  3V42 A;  3GTL J;  4HSR A;  1J5Y A;  4S0H B;  2ZME B;  9ANT A;  4FE4 A;  2DTR A;  3ZQ7 A;  4C3H J;  3U21 A;  1YRN B;  3S17 J;  2HQR A;  1ULY A;  2MC4 A;  2G0E A;  3GWZ A;  1WIB A;  3OOU A;  1I6H J;  2P7V B;  2LTP A;  3KP6 A;  1IAW A;  3WTZ A;  4OIN F;  1OR7 C;  4EAT A;  3JRF A;  1HXD A;  4CYD A;  2P6T A;  2WBM A;  2CV0 A;  2GBY A;  1LPQ A;  1OLT A;  4M74 A;  3E6B A;  1U3E M;  2R7Z J;  4KMU X;  2MA3 A;  5LGN A;  1GVJ A;  1YE9 A;  2QF7 A;  2R0Q C;  2IS6 A;  3VFZ A;  2L7Z A;  1B59 A;  1I27 A;  1MSF C;  2IS2 A;  4E7H A;  2D2W A;  2VBZ A;  4KUM A;  1B6A A;  4KJZ A;  5C44 J;  3BP8 A;  1JGS A;  2ZSH B;  3TW6 A;  2AXL A;  5HLT A;  1TWC J;  3KFW X;  3D5S C;  5BS6 A;  4K2E A;  1RKW A;  2YPR A;  3BTL A;  1O3S A;  1MD0 A;  2F6C A;  1HKQ A;  4G6D A;  4DYC A;  2BE5 F;  4F52 A;  2VQC A;  3ABT A;  4AIH A;  5LEJ A;  4GYI A;  4B44 A;  5K5R A;  3DTK A;  2R93 J;  1O3R A;  1G2H A;  3PIO F;  3IWZ A;  3ERE D;  2MAB A;  5FLM J;  2IGM A;  3ZN1 A;  3DWL E;  5IPA A;  2VJJ A;  5KHD A;  5M3M J;  3M8E A;  3S15 J;  5J47 A;  5HLI A;  3FM5 A;  3MN2 A;  2GOX B;  1JTX A;  3RZO J;  2UXN A;  3T0Y A;  4XSX F;  4MGR A;  2JA6 J;  2K5C A;  3J81 K;  4RM3 A;  3L9F A;  1DP7 P;  2R7U A;  3MZY A;  3OY9 A;  1S8N A;  1W36 C;  4ZZL A;  1AOY A;  2LVS A;  4EJV A;  3RDI A;  4A3C J;  3HIF A;  1D5V A;  1Z91 A;  5J4V A;  4IHX A;  4UVC A;  5L3D A;  4ZH4 F;  3WTT C;  3ABU A;  2EIK H;  1F1Z A;  4ZDO A;  1IW7 F;  3OYG A;  2CFX A;  1T56 A;  1U5T C;  1S3J A;  1XSV A;  2ECB A;  3UKG A;  1WZ2 A;  1FLI A;  3HEF A;  1JUP A;  5C4X J;  4HPQ A;  4M72 A;  4ESB A;  2DBB A;  5D4R A;  4O5V A;  4I7H A;  1FZP B;  4U87 A;  2RNJ A;  3LNQ A;  1NG6 A;  1X4O A;  2JRT A;  3HSR A;  4HZF A;  2KZG A;  3CCV I;  4XLN F;  2EA4 A;  2W00 A;  5E79 C;  2QBY B;  1VQ4 I;  2W82 A;  1YW8 A;  4O6J A;  1T95 A;  2HQA A;  2FUG 2;  2QEN A;  4BHB A;  3K4J A;  3RPU A;  2PI0 A;  4C3I J;  2LBF A;  1YYV A;  2Y30 A;  1QPM A;  5EEH A;  4BHP A;  5DCM A;  3KLN A;  4MTD A;  2QZ8 A;  3OL3 A;  4KIB A;  2GXA A;  1HBX G;  2CRG A;  2ME0 A;  3KE2 A;  5F0F A;  2CYY A;  1MNM C;  2FJ1 A;  1AKH B;  5E8G A;  3ZQI A;  3PM1 A;  3I0T A;  1N25 A;  2M45 A;  2NXN B;  2LYC A;  2LY9 A;  4Q47 A;  3JSP A;  2FBK A;  4L5E A;  4RAG A;  2ACJ A;  5EF6 A;  2L2O A;  3GXO A;  1ZR4 A;  1YG2 A;  3O3K A;  4XOT A;  3LAJ A;  3W2V A;  2DFH A;  2UUZ A;  3HOX J;  3AG4 H;  1TP4 A;  3I59 A;  1X2N A;  3RKY A;  3M4O J;  3GBG A;  3K4L A;  4YEL A;  3V7R A;  4J01 A;  2HI3 A;  1J7K A;  4CCL A;  4BS9 A;  1I3Q J;  3HKZ A;  3DPT A;  5ILS A;  1K6Y A;  2X4H A;  3CJT B;  1VQM I;  1TBX A;  2ID3 A;  3A0H C;  4KN4 X;  4OWR B;  3JRA A;  1K78 B;  2EA2 A;  2CG4 A;  3LA3 A;  4MTE A;  4YRV A;  1FOW A;  1ETX A;  4XKC A;  5TIS C;  5IOY A;  3OIQ A;  2L5Q A;  1FNN A;  1G4D A;  1EA3 A;  1IRG A;  3H5N A;  1V3F A;  2RVC A;  1F43 A;  5D6F A;  1G6N A;  3G1O A;  2Z33 A;  3ZMU A;  2WV1 A;  2ISZ A;  4E6K G;  2JA2 A;  2QQB A;  1XD7 A;  3I9V 2;  2JMW A;  4OAZ A;  2V26 A;  3K2A A;  5CVJ A;  3ZGK A;  1B1B A;  3IH4 A;  2L01 A;  3SZT A;  1PDN C;  2KIM A;  1ZRD A;  1IF1 A;  2R7T A;  1STZ A;  2BHY A;  2ZXI A;  1IRZ A;  1Y1V J;  3GTK J;  4LG3 A;  1S7O A;  4DBQ A;  1U6G A;  4RGS A;  4NUB A;  1X58 A;  2V9K A;  3HM5 A;  1MW7 A;  3HTS B;  3QPL A;  1U9N A;  2B63 J;  3BRO A;  4FQG A;  4YFX F;  1J2X A;  2VC0 A;  5F1R A;  1I50 J;  1WJ5 A;  3GFM A;  4A3J J;  1ZRC A;  1FBQ A;  2FE3 A;  4I6Z A;  4UUT A;  2GM4 A;  3GTO J;  3Q0V A;  4XKV A;  3OYE A;  2VE9 A;  4IRH A;  5IOZ A;  4PSW A;  1X19 A;  1F9N A;  2XGE A;  3MWM A;  2V9P A;  5TGT A;  3ASO H;  4M3G A;  2ZXW H;  3OSF A;  3TED A;  4UVA A;  2JA8 J;  4IKF A;  1L3L A;  2G7H A;  4BL0 B;  5ILU A;  4GGG A;  3JRE A;  4IEJ A;  3S93 A;  2PMZ N;  2LY1 A;  1FYK A;  3GO5 A;  4LGW A;  2L4M A;  2RN7 A;  1IN8 A;  5M5Y J;  5KCM A;  2LR8 A;  4N0B A;  3QOE A;  2EIJ H;  2ZXH A;  3J7A Y;  2IA2 A;  4NQW A;  1LUJ B;  1BI1 A;  1K6O A;  1JHF A;  3JRC A;  3ZXS A;  3A03 A;  3PQK A;  2AHQ A;  3T1B A;  1KU2 A;  2GA2 A;  4HW0 A;  1R4N B;  1QZE A;  4BYY A;  1F36 A;  1XG1 A;  1R58 A;  2V9V A;  2XB5 A;  3O8G A;  4Y3O A;  1XMX A;  2VXZ A;  3BTJ A;  1ODD A;  1LE8 A;  1D0Y A;  2HVR A;  1Z0X A;  2A69 F;  3A4C A;  3OSG A;  3JAM Z;  1MZB A;  1LVK A;  5L3B A;  1SAN A;  4HAM A;  2IS4 A;  1JTY A;  2EH3 A;  4FTH A;  1T6S A;  2B9S A;  4D9J A;  2M0M A;  3DU6 A;  2EIM H;  1V55 H;  5JLX A;  4YEJ A;  2K9N A;  5F27 A;  1S72 I;  1HKS A;  4MNU A;  4ESF A;  3BPX A;  2XAJ A;  3BTC A;  5EJC A;  4TV7 A;  2JN6 A;  3KEY A;  3PIP F;  2VT2 A;  4G7H F;  3S3M A;  3JRG A;  3G71 I;  1EV7 A;  4N9H A;  3MZH A;  4ZTF A;  3RIR A;  2H1K A;  4G6T B;  1HLV A;  2FEZ A;  1MBF A;  1G3T A;  3QP5 A;  4CA0 A;  4CDG A;  2VB6 A;  4BE2 A;  2LH9 A;  2DMU A;  4G8X A;  4AVZ A;  3FXR A;  1USS A;  4BJ6 C;  3EYY A;  4ZTJ A;  2Y0S A;  1JKP C;  1Q1H A;  3FHN A;  3PQJ A;  1FJL A;  2QQ9 A;  1AWC A;  2VOP A;  2XHK A;  3DBH B;  3EUH A;  4M71 A;  2NOJ B;  2HZT A;  4B3A A;  2VIX A;  2EIN H;  3HSF A;  5LD2 C;  3F0C A;  5FLX K;  1P2F A;  2OCC H;  3OYN A;  5ICE A;  2V1U A;  3TO7 A;  4ZZD A;  1NK3 P;  4AYB A;  3GTQ J;  3A02 A;  1Y0N A;  4U7D A;  1XGS A;  3MZ8 A;  4M6X A;  2Q1Z B;  1YHQ I;  1H9T A;  3HOZ J;  1RR7 A;  1T08 B;  4HYE A;  1B72 B;  3LSI A;  3E6C C;  3B6C A;  2X6W A;  2BXZ A;  2YU3 A;  1JI8 A;  1W7P A;  6PAX A;  3ABK H;  3FKI J;  3HUG A;  2FF4 A;  2VC1 A;  3WHC A;  2E1O A;  4V19 K;  4XOR A;  4Y15 A;  2LY2 A;  4HLX A;  2M8E A;  5E20 A;  1LEB A;  2GIZ A;  3EQL F;  4UNO A;  2H6B A;  4E7S A;  1R1U A;  1KON A;  3A01 B;  3BT9 A;  1FYM A;  2CW0 F;  5IYB J;  3ESW B;  2DFE A;  3H35 A;  3RKX A;  2R7X A;  1FWZ A;  4A93 J;  5EEA A;  2R5Z B;  1ZGJ A;  4B1R A;  4LJZ F;  2XRN A;  5E3N A;  1WKM A;  1CF7 B;  5B66 C;  2XRO A;  5BPD A;  1W36 D;  1UEL B;  4ZJZ A;  1GUU A;  3S16 J;  4XL9 A;  4AIJ A;  5FFZ A;  2MD5 A;  2XRL A;  2JUC A;  2UWM A;  3ZQF A;  3HB9 A;  5HDN A;  3MKZ A;  1YJW I;  2HVS A;  3TKY A;  1SD7 A;  1R5I D;  4EGZ A;  1Z1D A;  2P6S A;  1RC9 A;  4CHU A;  2LOO A;  2V1D A;  2PLY A;  3A2K A;  1G3W A;  3LSM A;  1T39 A;  1WH5 A;  2VQH A;  3P9C A;  4M3D A;  4GFB A;  4HLY A;  3I55 I;  1SD4 A;  2P81 A;  2VE8 A;  2QSG X;  3IP4 B;  3F22 A;  3RPQ A;  1FSH A;  2J5P A;  1IZ1 A;  3KZY A;  2E7X A;  5M5X J;  2PJR B;  1VQ5 I;  3JAM K;  3S1M J;  2MH9 A;  3K9T A;  2M5W A;  4KIG A;  3HOU J;  2QLZ A;  4Y17 A;  2Q2E B;  4KIC A;  4LB6 B;  1VQ8 I;  2K9Q A;  2CMP A;  2HDW A;  3RYR A;  1KZH A;  1WI3 A;  3V7S A;  1N77 A;  3HHH A;  3F21 A;  3BJA A;  3I54 A;  2GLO A;  2ADU A;  4CCO A;  3LMM A;  3CC7 I;  2LSO A;  5HOO A;  1QVT A;  1FIP A;  2RAE A;  3SJM A;  4U0V A;  4ZDL A;  2EFO A;  4F93 B;  3GX4 X;  2YR2 A;  3HRM A;  2X9D A;  2ISY A;  4BQN A;  1XX5 A;  5LEK A;  5CKT A;  3PFI A;  2E1N A;  4LG0 A;  3TDU C;  1IXR C;  2A6E F;  5IT9 K;  3CP8 A;  5DTD A;  3I3L A;  5FB2 A;  5DM6 F;  2ZSI B;  2FU4 A;  1ZN2 A;  5J1Y A;  1N78 A;  1QBJ A;  3C2B A;  4CO8 A;  3EYI A;  2EK5 A;  2RGV A;  3EET A;  3M8J A;  4XMY A;  3M3Y J;  3CDH A;  1Y39 A;  2KRF A;  1X1B A;  1P92 A;  3CUO A;  1X3Z B;  3DTE A;  2ZJQ F;  4RB3 C;  2H6C A;  2PX9 A;  1MNE A;  1IV8 A;  1BC7 C;  2D5V A;  2K4B A;  4MIM A;  2LNB A;  3OYK A;  2HTS A;  1MDM B;  3J7Y J;  4RA2 A;  1BW6 A;  4IHT A;  1NG7 A;  1X1P A;  3CCE I;  3K70 D;  1SFO J;  2M2E A;  2JSP A;  3L2U A;  3LQQ A; 
#chains in the Genus database with same CATH homology
 2FOW A;  1YIJ I;  1VQ9 I;  3J7Z I;  1FOX A;  2OTJ I;  3CCL I;  1VQ6 I;  2NXN B;  3I56 I;  1YJW I;  1MMS A;  5GAE J;  2OTL I;  4IOC F;  2E36 A;  3CJS B;  4IO9 F;  2JQ7 A;  2K3F A;  1VQ7 I;  3CD6 I;  3CJT B;  1VQM I;  1S72 I;  3CCS I;  3I55 I;  1YJN I;  5GAD J;  3EGV B;  3CCR I;  3PIO F;  3PIP F;  2QEX I;  2E34 A;  1YIT I;  3G71 I;  1FOW A;  1VQ5 I;  3G6E I;  3DLL F;  1HC8 A;  1VQO I;  1VQP I;  1VQ8 I;  1VQK I;  1VQL I;  1ACI A;  3CJQ B;  3CC2 I;  3CC7 I;  2QA4 I;  5GAG J;  3CMA I;  3G4S I;  5JVG F;  3CCM I;  3CF5 F;  3CME I;  1QA6 A;  3CCQ I;  4IOA F;  5DM6 F;  3CCJ I;  1VQN I;  3CJR B;  2H8W A;  1FOY A;  5DM7 F;  1YHQ I;  1Y39 A;  3CCV I;  3CC4 I;  2ZJP F;  2E35 A;  4UY8 I;  2ZJQ F;  1VQ4 I;  1YI2 I;  5GAH J;  2ZJR F;  1YJ9 I;  3J7Y J;  4V19 K;  3CCU I;  3CCE I;  1WIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...