2AXLA

Solution structure of a multifunctional dna- and protein-binding domain of human werner syndrome protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
144
structure length
144
Chain Sequence
MDDSEDTSWDFGPQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQANEELCPKKLLLPSSKTVSSGTKEHCYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a multifunctional DNA- and protein-binding motif of human Werner syndrome protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein, protein binding
molecule keywords Werner syndrome
total genus 25
structure length 144
sequence length 144
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2axlA01
2EFNA 1I1GA 2H94A 2K02A 1CF7B 3MAJA 2XAFA 1RI7A 2FBHA 4O5VA 2YX7A 4CICA 5HDKA 1Z1DA 3SQNA 1PUEE 3R6SA 4G7ZF 2VC1A 4EM2A 1R23A 3SFZA 3ISPA 2RQPA 3ZMZA 2FRHA 3FXRA 1YYVA 3K0LA 4OINF 4GO1A 4UVBA 4Y15A 3TO9A 2XGXA 4P96A 2GXBA 2DPUA 4M9ZA 3ABTA 3EYYA 4GYIA 3WTZA 5D5VB 3GLXA 3I5UA 3BWGA 3RKXA 1XB4A 5D6EA 4CO8A 4LLLA 5DYMA 4A0ZA 2KJCA 4MGRA 2OA4A 2FNPA 3KZZA 5KK1A 3WGHA 4A0XA 4OIPF 1FP1D 2BV6A 1XMKA 2R7DA 5K5QA 1X3UA 2DT5A 3RPUA 1FBSA 1P6RA 4L9NA 3KFWX 3NEUA 4RB2C 1XCVA 3JTHA 4AIHA 1Z91A 3FF5A 3V4GA 1SD6A 5CVJA 2ZNZA 3CLOA 1XCBA 5DV5A 1JXSA 4KMFA 2A69F 4YIFA 3QOPA 4FX0A 5DCMB 3LAJA 1FNNA 2V1XA 1STZA 2OAZA 5DUKA 4G94A 1MJ9A 3KEQA 1DPRA 2P5KA 4KIFA 1JHHA 4BHCA 1SFEA 2QUFA 3WODF 1LEBA 3KE2A 1R58A 3ECOA 2JZYA 4KMUX 5H6RA 4WWCA 4H0EA 4KFCA 4ESBA 4L18B 2DQRA 1FC3A 1SFXA 5TJJA 3GZ5A 3DFGA 4M9SA 2IPQX 2UXNA 2NRAC 4WF2A 2EFQA 2FA5A 3GZ6A 1ONVA 3JSPA 1KYZA 3DPLC 2BYVE 4RGSA 4EJUA 2DPDA 4XLPF 5FFXA 3LA7A 2PBIA 2HTJA 3S2WA 2DLLA 1ZARA 3MZHA 4B09A 2XHKA 3I4PA 4R8HA 3U1DA 2O03A 5E17F 2CSOA 3K69A 2IP2A 1P4XA 3D0SA 4Z2YA 4EVIA 5JVTA 1ZLJA 5IT9Z 5D4SA 3IKVA 4QWQA 4A5MA 3ERED 3JAMK 2MLGA 4IHSA 4AIKA 4U0WA 3SZTA 3ZQ7A 2V6CA 5BS6A 4MTDA 2JT1A 5E1XA 2OZ6A 3V8JA 3KETA 3T5XA 4I2OA 4L5JA 1XGOA 1DDNA 4NQWA 5TRDA 4BYYA 3F6OA 4UV8A 2V9VA 3BDDA 2A6EF 2L4MA 3GYHX 3V8KA 3TOAA 5ILVA 2OZUA 3T8TA 2CFXA 1ZH5A 6PAXA 3JTGA 3F72A 3FMRA 1U8RA 2B0LA 2Y75A 3K1NA 2CQKA 4KN4X 4OU0A 2IJLA 2A61A 2IA0A 2Z99A 3ECHA 1GXPA 2LKPA 2MBFA 3J81K 3ZN0A 3T8RA 3C18A 3F8CA 4WXDA 1MZBA 2E1CA 4R1HA 3GXOA 4EJWA 2VC0A 1KQ9A 4DQ2A 1ZRCA 1UCRA 1YS7A 4EGZA 3QAHA 3HUGA 2MA3A 1G3TA 3M7GA 1KQ0A 1SFUA 3EQLF 3K9TA 4LMYA 3WTSC 1RIOH 3C3WA 3E5XA 2P8TA 1L3LA 1AWCA 2W84A 3ZMVA 1GVJA 1DUXC 3IWZA 3L00A 3ULQB 2M87A 3BJOA 4OIQF 2M30A 3LQQA 3QRFF 5LEKA 4M74A 3KP7A 2ZMEA 2STTA 2P4WA 2D1HA 3CUQB 3IC7A 1BC7C 3VODA 5CVIA 5BMZA 4CHUA 3LA2A 5A2QK 1K79A 3MZYA 2WWYA 1FPQA 5CJ9A 3QP6A 3TO7A 2R7FA 3TO6A 5FB2A 2EK5A 3HHHA 2EV6A 2M8EA 1S7AA 5LGTA 3V7SA 4N9HA 1I5ZA 5D5XB 4LB6B 3RKWA 5CVRA 4XSXF 1GXQA 5HOOA 1HQCA 1O7FA 3HRTA 5HDNA 4ESFA 2XAQA 4ZYGA 5ICFA 2VBYA 4PCQA 3P7NA 1R36A 1W4MA 4G9YA 2O0YA 1MDMA 3I54A 4EV0A 5HLGA 2PMUA 5KVRA 1V3FA 1HXDA 2Z33A 4MEYF 3K1MA 4HZFA 4JK1X 1YLFA 5HVQC 1U78A 4AD9A 1XGSA 3K2ZA 4TV7A 4M6XA 2OQRA 3KP6A 2YR2A 2Y0MA 1LDDA 1U5TC 4G6QA 1JE8A 5IT3A 1PP8F 2KIFA 1H0MA 1BN5A 3GUDA 1G4DA 2FF4A 1KU7A 4M73A 4UUVA 3IHUA 4HBLA 2XAHA 4L9TA 4U88A 3KP2A 1FYKA 5ED4A 3T0YA 3RI4A 2HYGD 2CW0F 3CUQC 3F8MA 1O3QA 2ISZA 4A0YA 3DQVC 1NHAA 3B73A 5J8FA 5LHIA 3NQOA 1O3RA 1KA8A 5K5RA 2W24A 1HSTA 2XKOA 3L09A 1TQIA 2MC3A 5DD8A 2ZO4A 3RJPA 5FD6A 3DXJF 3JW4A 4WCGA 1EH6A 3BOQA 3M8EA 2P6SA 5CLSA 4GYGA 1IUYA 5FD5A 4KUMA 1R22A 3TOBA 1Z9CA 4XSZF 4PZJA 4P55A 4LGWA 2M45A 5E1ZB 4YFXF 1FWZA 3L7WA 4BXUA 2PLYA 4HF1A 3KP3A 2K86A 1MJBA 1DP7P 2CO5A 3QU6A 3PQKA 4S05A 3I59B 1HW2A 4PGHA 1HBXG 2XKPA 1PDNC 3L9FA 4BNCA 4A5NA 4UVCA 3VFZA 2E7XA 4PGGA 1KU2A 4BH9A 3P9CA 1HW1A 1J7KA 3C1DA 3TKYA 2V1UA 4ENMA 2E7WA 2QLZA 1IW7F 3WU1B 3FMQA 2VXZA 4MNUA 2DAOA 3RIRA 2G7UA 1P4AA 1R00A 4KIBA 4P9FA 2DI3A 4A6DA 1SD7A 3TDZC 4EQQA 1F4KA 4U0VA 2DFIA 1IXRC 1KU9A 3KP4A 3WE3A 4ESJA 2P6TA 3KCCA 5JI6A 2QYOA 1G3YA 5L3EA 4N9IA 4QLCU 1R1TA 3BJAA 4EGYA 1T2KA 2IW5A 2XAJA 3E6DA 2DO7A 4M71A 1OYWA 4A6EA 5D6FA 3U2RA 2EFWA 2Q8KA 2ZXJA 4AIJA 1S3JA 4ZYEA 2FQ3A 2L02A 1UB9A 3T1BA 4IVNA 1WKMA 4IHTA 1HKSA 2ZJ2A 1OKRA 2G9WA 1F5TA 3HHGA 4B8XA 1IXSB 4MQ9F 3COAC 5D4RA 1K78A 2L01A 1XD7A 4I98B 4GCVA 3BROA 2GA1A 3V8LA 4EM0B 4ZZDA 4DNCA 2KIUA 4M9XA 1W5SA 5DCFA 3OOPA 2JRTA 3HOTA 1WRJA 3B02A 4MTEA 2RDPA 3Q9VA 4M6YA 4HDVA 2FMYA 1B6AA 4IF4A 5FGMA 2VONA 1J75A 2XAGA 1ZG1A 2DU9A 2NYXA 4M72A 4EJOA 1S8NA 1U2WA 4RB0A 1LDJA 4LK0F 2LNBA 2PEXA 1QO0D 1T0FA 2HDCA 3J80Z 1TQMA 4KA4A 4KDPA 2A68F 3WE2A 4HF2A 3L2CA 1FZPB 5F64A 1RZ4A 1IN5A 2F5DA 2R3SA 4HDUA 1K7AA 1ODDA 2EJRA 1XGNA 3Q5FA 3MWMA 1U5TA 1FOKA 1FSEA 2VOOA 1QBJA 3N97A 5DCMA 3F21A 1ZYRF 3R4KA 2KKOA 2P5LC 3SZPA 1K6OA 3AAFA 2COMA 4XRFA 4UVAA 3DV8A 2QQ9A 3BPVA 2QQBA 3QPHA 3MFKA 5IT9K 2O6GE 1QZZA 2FBKA 4ENKA 1ON2A 1U3EM 2ZCWA 3GF2A 1OMIA 2HR3A 1I1SA 2PG4A 2A3SA 1IF1A 3CUQA 3LSTA 2MH2A 2O8XA 5HLIA 2VE8A 4RS8A 1XDUA 4BAYA 4YFNF 2L3DA 1SD5A 2K4BA 3FM3A 2NS0A 2D1VA 3HOSA 2QVOA 1BM9A 2H27A 1L0OC 1YTYA 1RNLA 5HS9A 1YW9A 3E6CC 1FY7A 1ZG5A 2HQNA 4HLXA 4OOIA 4EMSA 2RNJA 1XSXA 3KLNA 4A2UA 3EUHA 3LQRA 1U6GA 4ETSA 4G8XA 2IA2A 4FT8A 2IA1A 4Q4ZF 2DTRA 5ICCA 1LB2A 3E6BA 1REPC 4LD5A 2LSOA 2YX4A 5D5WB 4LK1F 3REOA 1BIAA 4IRHA 3VEPA 1P92A 3FXUA 4UNOA 4RGRA 1FSHA 2LF7A 4ON0A 4LB5A 4EJTA 3ABUA 5BOXA 3I53A 4RB1A 1B4AA 3E97A 3GFMA 4IXAA 1BI1A 3HRUA 1UHMA 4F7ZA 2K7LA 5JR3A 1T6SA 3I71A 4HX7A 2ZBKA 2JPCA 2W57A 3J7AO 1E17A 3JAMZ 3G3ZA 1U5TB 5ICGA 2JPBA 3WTYC 3IRQA 4HW0A 1TQPA 2G7HA 2DK8A 2VBZA 3P9IA 3WGGA 3HSEA 3M9AA 1T38A 1F9NA 3CUOA 3H92A 2CGPA 3HRSA 1OPCA 5ERIA 4OIRF 1BBYA 2BEOA 5LEJA 1FX7A 5H20A 4LLGF 5AIPA 4RAYA 2PFBA 2XIGA 1ZN2A 2MH9A 1XGMA 1HKQA 5D8LB 1D8KA 1OYIA 2A6HF 3Q9SA 3FXQA 2VODA 2HZTA 1LQ1A 3LAPA 2HQRA 4A12A 4IPAA 2GWRA 4KIGA 1C0WA 2IT0A 1ZAOA 3TQNA 4RB3C 1R7JA 1S29A 1XMAA 1W7PD 3GO5A 2XRNA 3HYIA 3GEZA 1KU3A 1R5HA 3HSFA 2GZWA 1J9IA 3PQJA 2A07F 1YS6A 4MHGA 2DQLA 2Q2EA 1XN7A 2HKOA 3WTXC 4KICA 5EEHA 4JQFA 4XBFA 2CYYA 1KGSA 2BGCA 2EA4A 5FLXK 3M1EA 2HS5A 5CVUA 2QBYA 4LLNA 1J59A 2QBYB 4N0BA 3CTAA 4CDGA 1ZG3A 4U7DA 5DUIA 4HV5A 5JHUA 3ZMTA 5HS8A 1ZHFA 5E20A 3BZ6A 5LRSA 1J5YA 3J81Z 2XROA 5D8KB 1BOAA 2ACJA 1RUNA 2HYFA 3N4MA 3DPTA 3BP8A 5CVVA 2F5FA 1Y0UA 5ILSA 3WGIA 2H6CA 1QZYA 1CGPA 2O3FA 3H3UA 2XUBA 1FT9A 4FHTA 3WG9A 2NNYA 1ZGJA 2W85A 1YFHA 1O7LA 1K78B 1EH8A 2UZKA 2FU4A 4NHJA 1W5TA 2UXXA 2KJBA 3GWZA 1Z6TA 4Q47A 2O61A 2ESHA 2D2WA 1TNTA 3W6JB 5LRRA 3E5QA 4NB5A 1ZRFA 2V79A 1MD0A 1BC8C 4ENNA 2V1DA 1A04A 2DW4A 2K4JA 2VT3A 3RKYA 3I0TA 2P7VB 4BQAA 1DPUA 4HA8A 2X0LA 4OMYA 2RGVA 2YU3A 3KP5A 4L0YB 1QGPA 5JFRA 4P9UA 2PMHA 1BIBA 1B1BA 1I6XA 4KYWA 4L9JA 1IRFA 1SMTA 1LNWA 1OR7A 5BPDA 2BBYA 3M8FA 3I64A 3I58A 2BE5F 1YW7A 2EA2A 4RGUA 1IZ1A 1B59A 1EH7A 1WSUA 3BPXA 1D5VA 2H6BA 4OMZA 5L3CA 3G73A 1HKTA 3JSOA 3BJ6A 4IRGA 4KNYA 3BY6A 2MD5A 1Z7UA 2RKHA 5F6FA 2GXGA 3R0AA 5ILUA 1EV7A 3LA3A 2XVCA 1IN7A 2JSCA 2CWEA 1YIOA 3CO7C 2Z3YA 4WX9A 1PP7U 4ZZLA 2OBPA 3GFJA 4ZYHA 2WC2A 3WTTC 1YG2A 2KIMA 2L4AA 2Y48A 3FMSA 3R61A 4WXCA 3MCZA 2VBXA 3CJNA 5A2QZ 5L3DA 3WU0A 1W7PB 1MJAA 1TW3A 5J8CA 4ASNA 2VE9A 4Q48A 3HTUA 5E8GA 1UFMA 4YG2F 2GAUA 2WTEA 2FE3A 2ZNYA 4GGGA 2NAZA 2FNAA 2CG4A 1YW8A 3GW2A 2OQGA 3TGNA 1O57A 5LHGA 5EEGA 2EFPA 3VOEA 3O3KA 3KLOA 1TTYA 4HOBA 2VN2A 3KEOA 4ENJA 3DP7A 1XSDA 1ZRDA 5L3FA 2ISYA 3J80K 2J5OA 5LBQA 4HV6A 2AXLA 2A5YB 3KZYA 1JHFA 3EDPA 4IJAA 3PFIA 2FBIA 4YFKF 1GHCA 2HWVA 2DK5A 3DF8A 3E3VA 4D0PA 5E1WA 2LF8A 4HLYA 3U9GA 4OIOF 1UHWA 4U7BA 2P5VA 1T39A 2RN7A 2HKXA 1R1UA 3FWEA 4RGXA 3WTVC 3MEXA 1ZGAA 3IL2A 1ZLKA 4G6DA 4BHPA 4YIIA 3F8NA 3DEUA 4Y13A 2FMLA 2M1BA 4G7OF 2L54A 2WV0A 1H9GA 2XASA 5CYVA 1LJ9A 1TLHB 5D5UB 3F3XA 1Z05A 3ZMUA 2ETHA 5AONA 3FZVA 1KQ8A 1P2FA 1IRGA 4CYDA 4KT5C 2VBWA 2YSRA 1XDSA 1Q1HA 3LWFA 4Y17A 1FBQA 4FX4A 3FM5A 3LFKA 2PN6A 1Z6RA 2UWMA 4I7HA 1ZREA 1MDMB 4AVPA 2EB7A 1YO5C 2STWA 2OD5A 1HSJA 1E2XA 5DD4A 1CF7A 2RC4A 5F1RA 3IRRA 4WK8F 3O2PE 1JGSA 1BJAA 2M5WA 5J6XA 3C7JA 4HAMA 2J5PA 2DBBA 1FBUA 1FYLA 2EFOA 4Q5SF 1QQIA 4LFUA 4CGZA 3HRMA 1QNTA 5FFZA 2Z9OA 4MQVA 3E5UA 5E8IA 5LHHA 3RYPA 2ELHA 4R79A 3GVAA 3F6VA 1J2XA 2F5EA 3K1PA 5LLQA 1G3WA 1LVAA 3F22A 1B9MA 4RAZA 2ADUA 3IKTA 4KN7X 4BHBA 4AWXB 4JBAA 3O6BB 2H09A 1S7OA 4LG0A 3D5LA 1ON1A 5K5OA 1BI0A 2QQAA 5L3GA 1F1ZA 2EV0A 4CZZA 2K27A 3EETA 1HW5A 4HQMA 1D3YA 5LGUA 4L9VA 3EYIA 3VB2A 4HX8A 1I27A 4HQEA 2HTSA 1WWXA 2Z5UA 1IAWA 3SHFA 3WTUC 5K1YA 3F8BA 4EJVA 3ZPLA 3I59A 4S04A 2XV4S 4L5IA 2GQQA 1R5GA 2F2EA 1FYMA 1OYYA 1R1VA 1G6NA 4EM1A 3RTRA 3V7RA 4ZYDA 3ELKA 3DKWA 2QWWA 2PJPA 1FP2A 3QPTA 3SXYA 1D8JA 4WXHA 4K2EA 2FEZA 2FSWA 3OV8A 3MQ0A 1AOYA 1WQ2A 5AIQA 1IN4A 2NNNA 2C6YA 5FLXZ 1KYWA 5L3BA 3FX3A 3HSRA 3H3ZA 5BPIA 3R0JA 4G7HF 4HX4A 4L0ZB 2IVMA 5HDGA 1QPMA 2FOKA 2VOPA 3TDUC 2KRFA 1S6LA 2OU2A 2RV8A 3GX4X 1USTA 3RYRA 3IWFA 3HIFA 1TNSA 2LDUA 1T98A 1FLIA 1MKMA 1V4RA 3ML6A 3RPQA 1IN6A 3GFIA 1RUOA 1IXCA 1ULYA 1B9NA 3WTWC 3QU3A 5ICEA 3CO6C 1O3TA 2EV5A 2QZ8A 3CDHA 4I0AA 2TDXA 1H9TA 3W6KB 5E18F 4I01A 4I02A 2ZKZA 2ESNA 4O3MA 2IRFG 2FXAA 2ZFWA 5H6QA 1SD4A 3ZMDA 5HLHA 3F8FA 4GXOA 3FHZA 3QP5A 4PDKA 4UHTA 2X4HA 2QM3A 1IN8A 4I0BA 1TW2A 4IRIA 1J0RA 2W25A 2GA2A 3P9KA 4O6JA 2PI0A 5DEQA 5HS7A 4ZH4F 4HF0A 3GFLA 3ROUA 1XSVA 4I09A 4P5OA 2PQ8A 3HTSB 2YPRA 4CXFA 5FO5A 2GIVA 2QENA 5LGNA 2HOEA 2HGCA 5DDGA 2F5CA 2AS5F 3R60A 1MGTA 2ZMEB 2Q0OA 1YQAA 4U0YA 2P7CB 4UXNA 1W7PA 2HFHA 2VT2A 1O3SA 3NRVA 4LG0B 1BI3A 4E70A 3V7CA 1VTNC 2HEOA 3RDIA 3ZN1A 4XLNF 1USSA 1SAXA 1SMYF 2JTVA 3ZP5A 4MEXF 2EWNA 1TBXA 4UV9A 3ZMSA 2MLKA 2E1NA 3E6MA 4HYEA 1LEAA 3F23A 1BI2A 1P4WA 2RVCA 1G3SA 1LDKB 2D45A 4LJZF 5BQTA 1WI9A
chains in the Genus database with same CATH superfamily
2EILH 3S14J 2EFNA 1I1GA 2H94A 2K02A 2DDAA 1CF7B 3MAJA 2XAFA 4XRSG 4HNTA 3PNTA 4BEHA 2QCOA 3CCVI 4A3JJ 1ITYA 2DOAA 1RI7A 2FBHA 4O5VA 2VQLA 2YX7A 4CICA 2LY9A 3CJRB 5HDKA 1MNMC 2XF7A 1Z1DA 1T33A 3IV5A 2F4OB 3TEDA 2AHQA 2QSGX 3SQNA 5KHDA 1PUEE 3R6SA 4G7ZF 3QODA 2HOAA 5K7ZA 5FLVA 2VC1A 4EM2A 1T95A 5C3EJ 1NH3A 1R23A 4ZTFA 2E2JJ 3DBRB 2IBDA 5FJ8J 4E7IA 3SFZA 3ISPA 2RQPA 3BR3A 3ZMZA 2FRHA 3FXRA 1YYVA 3OIOA 3BR0A 3K0LA 1JTXA 3GTPJ 4OINF 4AC0A 3MZ8A 1I3QJ 2QF7A 1IV6A 1HLVA 4GO1A 4UVBA 2LKSA 4Y15A 4YELA 2XGXA 3TO9A 2IXSA 4P96A 4PUSA 2GXBA 5CQGA 2DPUA 2ME0A 4M9ZA 3ABTA 3EYYA 4GYIA 3GMEA 3WTZA 5D5VB 3GLXA 3I5UA 5HLTA 2K9QA 2W1OA 4YRVA 2HPMA 3HOXJ 3BWGA 2VIXA 4M3EA 3RKXA 1XB4A 5D6EA 4CO8A 4LLLA 2DA4A 3FXKA 5DYMA 2FQ4A 4A0ZA 2ZJPF 4CZCA 2KJCA 4MGRA 2OA4A 2FNPA 1SVOA 3KZZA 5KK1A 3HG9A 3V42A 1FOXA 3K4MA 3WGHA 4A0XA 2ZJRF 4OIPF 3VYRB 5H2FC 1FP1D 1PVEA 2BV6A 1S9HA 2DDBA 1MBEA 1XMKA 1RR8C 1GT0C 2COBA 1BL0A 1Y8RB 3AL0C 2R7UA 4DZPA 2R7DA 3HM5A 2X6WA 4ITVA 5K5QA 1X3UA 2DT5A 3RPUA 1SFKA 3TL4X 1FBSA 1P6RA 4L9NA 5BNGA 3KFWX 3QYEA 1E3HA 2F4MB 3NEUA 4RB2C 2BW3A 1XCVA 1MBJA 2XAUA 3TW6A 1VQNI 4RAGA 3JTHA 4AIHA 1ZR4A 2HOTA 2RQQA 1Z91A 3FF5A 3M07A 3V4GA 1SD6A 5CVJA 1K61A 2ZNZA 3CLOA 1XCBA 2CRGA 1DGWY 3CDIA 5DV5A 1PYVA 2K9LA 3H36A 1JXSA 4B44A 2WY8Q 4KMFA 2A69F 4YIFA 5F04A 3QOPA 4FX0A 5B1BH 4J01A 3LMMA 5DCMB 3LAJA 1FNNA 2EIKH 2V1XA 5EZGA 1Z3YA 4XICA 1STZA 2OAZA 5DUKA 1W0UA 3CMYA 1POGA 4G94A 1MJ9A 3AG3H 4BGDA 1UZCA 3KEQA 1DPRA 2P5KA 1T56A 4KIFA 4S0HB 4C2TA 4W1UA 1A5JA 5DM7F 1JHHA 3LSKA 1Z7LA 3ZQQA 4CYCA 2FJ1A 4BHCA 1SFEA 2QUFA 2LREA 3WODF 1LEBA 3KE2A 1R58A 1Y1WJ 3ECOA 2JZYA 4KMUX 1UELB 5H6RA 4WWCA 4H0EA 4KFCA 4C3JJ 4ESBA 3BTCA 4QPQA 4L18B 2DQRA 1FC3A 3LSPA 1SFXA 2NS8A 5TJJA 5FRNA 1VF9A 3GZ5A 1G59A 3DFGA 5IOYA 4M9SA 2KZGA 1OFCX 2IPQX 2UXNA 2NRAC 4WF2A 1WPKA 2EFQA 2FA5A 3PNYA 3GZ6A 2CUZA 3GTKJ 4JX4A 2HU9A 2BY2A 1ONVA 1OCRH 3JSPA 2P0WA 3DPLC 1KYZA 2EQRA 1QVTA 2BYVE 4RGSA 4EJUA 1LE8B 1IGNA 2DPDA 1SANA 3GLLA 4XLPF 5FFXA 5EYRA 1OCCH 2X1DA 1RETA 1Z21A 3LA7A 2PBIA 3FIWA 2HTJA 3S2WA 5M3FJ 2CQQA 4Y33A 5FKOA 2RNGA 2DLLA 1ZARA 3MZHA 2TRTA 4B09A 2XHKA 4II2A 5F0FA 1JUSA 3I4PA 4R8HA 3U1DA 2O03A 5E17F 2CSOA 3K69A 2IP2A 2RREA 4CCOA 1UHSA 1P4XA 3OSGA 3D0SA 4Z2YA 4EVIA 3FISA 5JVTA 1ZLJA 5IT9Z 4RMNA 5D4SA 3B6CA 4DYRA 3IKVA 4QWQA 4A5MA 2FX0A 1X58A 3ERED 2X1CA 3JAMK 2MLGA 4IHSA 4AIKA 4U0WA 3SZTA 3ZQ7A 3OYMA 2V6CA 2R7TA 5BS6A 2WA0A 4MTDA 4F93B 3C2BA 2EINH 1OCTC 2XGCA 2JT1A 5E1XA 4CCJA 3J7ZI 3W2AA 2OZ6A 3V8JA 3KETA 3T5XA 2AQEA 4I2OA 1OCPA 4L5JA 1XGOA 1DU0A 2BVLA 1HDDC 3DLLF 1DDNA 2GOXB 2CUFA 3S15J 3BR5A 4NQWA 5TRDA 4GDFA 4BYYA 2JN6A 3F6OA 4UV8A 3HUGB 4XOPA 2V9VA 3BDDA 1Y8QB 3H35A 2A6EF 2L4MA 3GYHX 2IGOA 3V8KA 3TOAA 1U9NA 5ILVA 2OZUA 5TGTA 3T8TA 3RCOA 2CFXA 1ZH5A 1S5LC 6PAXA 3JTGA 2MG4A 2A5WA 3A2KA 4XR6A 4IL6C 3PNVA 1MBFA 2KISA 3F72A 3FMRA 1U8RA 2B0LA 2Y75A 3K1NA 3BCAA 1JJ6C 1OISA 5DS9A 2CQKA 4KN4X 4OU0A 1JT0A 3K4NA 1VQ5I 2IJLA 1AU7A 1ZGWA 2A61A 1XX5A 2IA0A 2Z99A 3ECHA 1SC7A 1GXPA 2MGQA 4XORA 2LKPA 4A3MJ 4X1EA 2MBFA 3J81K 3ZN0A 3T8RA 2CUJA 3C18A 1OCOH 3F8CA 4WXDA 2HQ5A 1MZBA 1U0JA 3NWTA 2E1CA 1Z67A 3GXOA 4R1HA 4EJWA 2VC0A 3HOWJ 2D5VA 1LFPA 3DCFA 4BE1A 3HC7A 2K85A 2JUCA 1KQ9A 1ENHA 3BTIA 4CCKA 2HNHA 2MD0A 4XMYA 1VQ9I 4DQ2A 1VQ4I 3WHCA 1ZRCA 4BXFA 1UCRA 1YS7A 4EGZA 1ZR2A 2W48A 3QAHA 1LUJB 4U87A 3HPGA 2E5NA 2WADA 3HUGA 1X2NA 2E36A 2I10A 2MA3A 1G3TA 4BDYA 3M7GA 1KQ0A 2M8GX 1ETKA 1SFUA 3EQLF 3UKGA 3K9TA 1YRNB 4LMYA 2ZXIA 4A3CJ 1GLNA 3LSIA 3SJMA 3WTSC 1RIOH 4BBRJ 3C3WA 3E5XA 1N75A 5GAEJ 2JQ7A 5M5XJ 4XQFA 2P8TA 4IO9F 1L3LA 2PMZA 5FLMJ 1A35A 1N25A 4PJ0C 1AWCA 2IS6A 2W84A 3ZMVA 1GVJA 1DUXC 3IWZA 3L00A 4LOCA 3DTKA 2M87A 3ULQB 3BJOA 2B9SA 4OIQF 2M30A 2V9KA 2WY7Q 3MKYB 2JSPA 3LQQA 2JRMA 2V7FA 3QRFF 5LEKA 1R6RA 1RPWA 4HSTA 1GDTA 1X1CA 4M74A 1MMSA 3OYAA 3HGYA 2IAIA 3KIOA 3KP7A 1QPIA 2ZMEA 3OYFA 2STTA 4BKXA 4Z6YA 2P4WA 2D1HA 1R9TJ 2AXTC 3CUQB 3IC7A 4XIDA 1BC7C 3K10A 1Z3XA 3VODA 2JA5J 5CVIA 5BMZA 4CHUA 5J40A 3LA2A 5A2QK 5IY5H 2OJED 2LVSA 4IOCF 4OWRB 5F08A 3BG7A 1K79A 3MZYA 3OIPA 2WWYA 1FPQA 3BR2A 5CJ9A 3TMOA 2PJRA 3QP6A 3CF5F 2JVGA 1T0FC 3TO7A 2R7FA 3BZCA 1Z0XA 2KDOA 3OIQA 3TO6A 5FB2A 2LRDA 5EF6A 2EK5A 3HHHA 1P9QC 2ECCA 4PJLA 5J47A 2EV6A 3OYLA 2V1NA 9ANTA 2M8EA 2DMQA 2HPIA 3FKIJ 1LE8A 5GPCA 3O8GA 1S7AA 2EZHA 3V7SA 4N9HA 5LGTA 3X2QH 1I5ZA 3OR2C 5D5XB 3ZQGA 4LB6B 3RKWA 1W36C 5CVRA 4XSXF 2IEKA 1A31A 4PK4A 2KIQA 1GXQA 2ZC2A 1VQOI 5HOOA 3UR3C 2IS2A 1HQCA 2E35A 2A05A 1O7FA 3HRTA 4Y4RA 4ESFA 5HDNA 4X0GA 3QOEA 3H1CA 3QQAA 4PJMA 3RKQA 2XAQA 3KZIC 4YEJA 1WCMJ 1RKWA 4ZYGA 4F91B 5ICFA 2VBYA 4XKVA 4PCQA 4UUSA 2OV7A 3K2AA 3P7NA 3JRAA 1R36A 1W4MA 1B72A 3FDYA 4G9YA 4M6VA 2LYCA 1UG0A 2O0YA 1SVLA 1MDMA 3I54A 3CP8A 1TWFJ 4EV0A 5HLGA 2PMUA 5KVRA 1V3FA 2EBIA 4E7SA 3AL0B 2IGMA 3BLYA 1B8IA 1P7JA 1HXDA 2OTLI 2Z33A 4MEYF 3HL2A 1X4OA 3K1MA 1T8IA 3M3YJ 4HZFA 4JK1X 5LD2C 1YLFA 3G71I 4XRSA 3E7LA 5HVQC 1U78A 3S1NJ 4LIUA 4AD9A 1XGSA 3K2ZA 1AKHA 4TV7A 4M6XA 2OQRA 1SFOJ 3KP6A 2KDZA 1ZK8A 2YR2A 2Y0MA 3TP3A 4XL9A 3DTIA 1LDDA 1U5TC 4G6QA 1JE8A 5IT3A 3K4KA 1X1DA 1PP8F 2KIFA 1PJRA 1H0MA 2W4SA 1BN5A 3GUDA 2M0CA 1TZLA 1GV5A 1G4DA 3O8HA 2ZJQF 4JYKA 3NAUA 2FF4A 1KU7A 4M73A 4UUVA 3IHUA 4HBLA 4XRMA 2BXZA 2XAHA 3U1KA 4JX6A 4L9TA 4U88A 3KP2A 1FYKA 1JKRC 4DYQA 2L9VA 1Y39A 4BS9A 2F6CA 5ED4A 3CZ6A 4PSWA 4BDZA 1OQYA 2R5YB 3T0YA 3A02A 3HPHA 3RI4A 3DU5A 4UB6C 2HYGD 4DYCA 1YX3A 2CW0F 3MMYB 3CUQC 3JRDA 3F8MA 4FE7A 1O3QA 2ISZA 4A0YA 1A6IA 1YHQI 3L2RA 2VL8A 4DOZA 3DQVC 1KONA 1NHAA 2DMNA 3B73A 1B72B 4BY7J 2VJJA 5J8FA 5LHIA 3NQOA 4FTHA 1O3RA 3S17J 1KA8A 5K5RA 2W24A 4PFPA 1HSTA 2XKOA 3L09A 2DA1A 1TQIA 2MC3A 5GPAA 5DD8A 4PFOA 2ZO4A 4XNFA 3RJPA 5FD6A 3CCEI 1QRYA 3I4NJ 3DXJF 3JW4A 1FIAA 2V6EA 4WCGA 3PO3J 1EH6A 3BOQA 5E3MA 3M8EA 2P6SA 3ZQLA 5CLSA 1R4NB 4B4CA 4GYGA 1IUYA 5FD5A 4KUMA 1E3OC 1R22A 3TOBA 1Z9CA 2KP6A 4XSZF 4MO7A 2BXYA 4PZJA 4P55A 2LR8A 4BXXJ 5CQEA 5EGOA 5F0CA 3CCRI 4LGWA 4X6AJ 1EF4A 2BVMA 2M45A 3FBNB 5E1ZB 2GXAA 3AFHA 4BQNA 1FWZA 3L7WA 4B3AA 4YFXF 5KAIC 4BXUA 1I39A 1I3AA 2R7WA 1CQTA 1MMGA 2BZTA 1TP4A 2PLYA 4HF1A 3KP3A 2K86A 1MJBA 3OYJA 3DLAA 1DP7P 2CO5A 3W3CA 3QU6A 3LFUA 3PQKA 4S05A 3I59B 1HW2A 4PGHA 1HBXG 4NBQA 2XKPA 1PDNC 3L9FA 3M8JA 4A69C 4BNCA 4A5NA 4UVCA 3VFZA 2E7XA 2XPWA 4PGGA 1IUFA 1KU2A 2K3FA 1QVUA 4BH9A 1NK2P 3P9CA 1HW1A 4XLCA 1J7KA 3ZRGA 3C1DA 2WB1A 3B6AA 3TKYA 2V1UA 4ENMA 1NTCA 2E7WA 2GOMA 1JT6A 2QLZA 1IW7F 5FKKA 3WU1B 1BR2A 4FE4A 4CCMA 3FMQA 2QKLB 1ZKGA 1EKEA 2VXZA 2WB1N 4MNUA 3OL3A 3ZQHA 2CV0A 1WFXA 2DAOA 4HPQA 5KAFC 3RIRA 4DW6A 2G7UA 1S7EA 3TBIA 1P4AA 3FBIB 3HJEA 1R00A 4KIBA 2O8KA 3FK6A 2DI3A 4P9FA 2QQ8A 3K4JA 4A6DA 1PUFA 1SD7A 2M7BA 3TDZC 4EQQA 1F4KA 2E71A 3OYBA 2DTZA 3K4LA 3LSRA 2K40A 4P1WA 4BU2A 4U0VA 2IS4A 3Q0VA 2DFIA 3DWLE 3DEEA 5EJCA 1IXRC 2ME6A 4V2FA 1KU9A 3KP4A 3ZR8X 3WE3A 4ESJA 2P6TA 3KCCA 5JI6A 2R5ZB 3FXOA 2JA6J 2QYOA 1G3YA 1E0EA 1QA6A 1JGGA 5L3EA 3RSNA 4N9IA 4QLCU 1R1TA 3BJAA 4EGYA 1T2KA 3A03A 5JLXA 2IW5A 2XAJA 3E6DA 2DO7A 4M71A 2R7QA 1OYWA 2DT7B 3S1MJ 5EEAA 1WJAA 4A6EA 3IP4B 5D6FA 1XTAA 3U2RA 2EFWA 2JWTA 3MN2A 2Q8KA 1NK3P 2ZXJA 4AIJA 2WAEA 3H5NA 3OYHA 1S3JA 4ZYEA 4XLFA 2FQ3A 2E60A 3S1RJ 2R7OA 2L02A 3S2DJ 2R5YA 1UB9A 3T1BA 4IVNA 3VDXA 3MKLA 1WKMA 4NNJA 4IHTA 1HKSA 2ZJ2A 5GTHC 1OKRA 2G9WA 2AQFA 1VQMI 1F5TA 2R7RA 3QPLA 4ANJA 2IGNA 3MVPA 1ETVA 5B5EC 1IDYA 3HHGA 5CPRB 4B8XA 3LSJA 4B1RA 1IXSB 2MABA 4MQ9F 2CS3A 3COAC 5D4RA 1K78A 2L01A 3HKZN 1XD7A 4I98B 4UY8I 2LK2A 4GCVA 2DT6A 3BROA 2GA1A 3V8LA 4B47A 4BUPA 2EZLA 4EM0B 4ZZDA 3VPRA 4DNCA 2N8GA 2KIUA 4M9XA 1W5SA 2X6YA 1TC3C 5DCFA 1TWGJ 3OOPA 2JRTA 1YITI 5FROA 3HOTA 1WRJA 3ESWB 1QHHD 3B02A 2CW8A 4XN3A 4MTEA 2RDPA 3Q9VA 4M6YA 2QEXI 4HDVA 3OR1C 1YJ9I 2FMYA 1J09A 1B6AA 4GFBA 4IF4A 5C4XJ 5FGMA 3G6EI 2VONA 4RM3A 2XAGA 2X51A 1ZG1A 3L2QA 2DU9A 2JA2A 1J75A 2NYXA 1LPQA 2HVQA 2DN0A 4M72A 4EJOA 1S8NA 1U2WA 3S93A 1K83J 4RB0A 1LDJA 2LNBA 4LK0F 2PEXA 2NOJB 1QO0D 3OYKA 1HC8A 1T0FA 2HDCA 3J80Z 1TQMA 1W0TA 2DODA 4KA4A 4KDPA 2A68F 2W00A 3WE2A 3IAS2 4HF2A 3L2CA 1FZPB 1JUMA 1RZ4A 3GCMA 5F64A 1IN5A 3CMEI 2JMWA 2F5DA 2R3SA 1IRXA 2K3PA 3L2VA 1TL8A 1UMQA 2EIMH 2Y9ZA 4HDUA 1OJLA 3M1CA 1K7AA 1V55H 1FTTA 2MC4A 1M1EB 4ZYAA 1ODDA 2EJRA 4UUSB 1XGNA 3Q5FA 3IH2A 2CUEA 1BA5A 5IYBJ 1FTZA 5J3LA 4AYBN 3MWMA 1U5TA 2GM4A 5GAHJ 1FOKA 2WV1A 2HXOA 1XPXA 1FSEA 2VOOA 1MMAA 1X1PA 1QBJA 5J1UA 3N97A 5DCMA 3F21A 2KL4A 1ZYRF 3R4KA 1WZ2A 2KKOA 3S3NA 4BY1J 1IDZA 2P5LC 3SZPA 1UJ8A 2JK3A 3AAFA 1K6OA 2COMA 2ZXHA 4XRFA 3LNQA 4UVAA 2VLAA 3DV8A 4B3XA 2R7VA 3HDDA 2QQ9A 2DMUA 3BPVA 2QQBA 3QPHA 1S72I 1ORKA 3MFKA 5IT9K 2O6GE 1QZZA 2FBKA 4ENKA 1ON2A 1U3EM 2ZCWA 3BQYA 3GF2A 1OMIA 2HR3A 3OWTA 1I1SA 4MFEA 2PG4A 4RDUA 2A3SA 1IF1A 3CUQA 3LSTA 4AIDA 4RA2A 2MH2A 2O8XA 5HLIA 2VE8A 2XSJC 4I99C 3I55I 4RS8A 1SEUA 2NXNB 1ZELA 3HKZA 4OAYA 1XDUA 4BAYA 3K7AJ 4YFNF 3LL7A 2L3DA 1SD5A 2K4BA 3FM3A 2NS0A 2D1VA 3HOSA 2QVOA 3JR9A 4LIVA 1BM9A 2H27A 1L0OC 2F4IA 1YTYA 1RNLA 3H9GA 2KQRA 5HS9A 3TW7A 1YW9A 3E6CC 4IHVA 1FY7A 1ZG5A 2JA7J 2HQNA 3BR6A 4HLXA 2VI6A 4IHWA 4OOIA 1BR1A 1IC8A 4EMSA 3Q0UA 2DOEA 2RNJA 1WJFA 1W1WE 1QZEA 2W82A 4RAFA 1XSXA 2LFBA 1PUFB 4BBSJ 1VNDA 3KLNA 4A2UA 3DKYA 3EUHA 3PUFA 3LQRA 1G8XA 1U6GA 3ERMA 4BJ6C 4HNVA 4ETSA 1U8BA 4G8XA 2BY1A 2IA2A 4FT8A 3CCJI 1X19A 3S8PA 2TCTA 2IA1A 4Q4ZF 3ASOH 2DTRA 1N77A 5ICCA 1LB2A 3E6BA 2V4JC 1REPC 1VFCA 4LD5A 2LSOA 2YX4A 5D5WB 4LK1F 3REOA 1HOMA 1R5ID 3ONQA 3BQZA 1BIAA 1QHGA 3NWSA 4IRHA 4DZJA 1R49A 3VEPA 2EH3A 3FXUA 1P92A 1V5EA 3KPHA 1QU3A 4UNOA 2VQHA 4RGRA 3FK7A 1FSHA 4M3FA 3CQZJ 2LF7A 4ON0A 4LB5A 2F5VA 3JRHA 3ABUA 4EJTA 1YX5A 3I53A 5BOXA 4RB1A 2X9DA 1MSFC 3OYGA 1VQ7I 3L1PA 1B4AA 3E97A 4NC6A 4XONA 2DA3A 3K70C 3H3VK 3GFMA 4IXAA 1BI1A 4A3GJ 3HRUA 1UHMA 2CFOA 1ZQ3P 1DQUA 4F7ZA 2K7LA 5JR3A 1T6SA 3I71A 4YIRX 4FISA 1EJ9A 4HX7A 4C9YA 2ZBKA 2JPCA 2W57A 5JLWA 3HBLA 5C4JJ 2W7NA 2VB6A 3J7AO 3OOUA 2XGDA 3PUBA 1E17A 4FCYA 3JAMZ 1MMNA 3G3ZA 1U5TB 5ICGA 2JPBA 3WTYC 3IRQA 5J4VA 4IHXA 2LBFB 4HW0A 2XPUA 1TQPA 2UUZA 2G7HA 2DK8A 1JKPC 2VBZA 3P9IA 4QIWN 5M3MJ 3W2VA 4D7MA 2OCCH 3WGGA 3BTJA 3HSEA 2L7MP 3GTGJ 3M9AA 2M34A 4C3HJ 4NUBA 3JRIA 1D1CA 1F9NA 3QYBA 4C30A 2NS7A 1T38A 3CUOA 3PFYA 3H92A 3HOVJ 2CGPA 3HRSA 4NDLA 5GTIC 1MNDA 1OPCA 2Y9YA 4IQJA 4NC7A 5ERIA 4PJNA 4OIRF 2CQXA 1BBYA 2BEOA 3FKJA 5LEJA 3OYNA 1FX7A 3JRGA 5H20A 4RM2A 1DU6A 3GTLJ 1VQPI 2FUG2 3KYCB 4LLGF 3HEFA 5AIPA 4RAYA 2PFBA 2V9PA 2XIGA 1ZN2A 4RBOA 2MH9A 1IJWC 1D0XA 3BZKA 4XM3A 1XGMA 5KNLA 1JKQC 3VYTB 2ID3A 3LOCA 1HKQA 5D8LB 1D8KA 3GBGA 1OYIA 3A0HC 3SEQA 2A6HF 3Q9SA 3FXQA 2VODA 2HZTA 1LQ1A 3LAPA 2HQRA 4A12A 1ETOA 5HNFA 4IPAA 2GWRA 4MLOA 4KIGA 3EUKL 1C0WA 3FXMA 3JCUC 2IT0A 1ZAOA 3TQNA 4RB3C 4D1QA 2Y30A 5B3SH 1R7JA 1S29A 1WJCA 1XMAA 1W7PD 1D5YA 2Q1ZB 3QPSA 4XOTA 3GO5A 4I6ZA 2XRNA 3S2HJ 3E1SA 5K7HA 3HYIA 3GEZA 1KU3A 1R5HA 2DJIA 2XF5A 4N4OB 3HSFA 4IOAF 2GZWA 3F0CA 2K5CA 3LSGA 5IPAA 1HF0A 1J9IA 3PQJA 2A07F 2L9RA 1YS6A 4MHGA 2DQLA 2Q2EA 4FETA 1XN7A 2HKOA 3CCUI 3WTXC 4KICA 1VQ6I 4Y3OA 5EEHA 4JQFA 2DA7A 3H0GJ 3J7AY 4XBFA 1T08B 2CYYA 1KGSA 2BGCA 2XDVA 2EA4A 1JKOC 3RZOJ 5FLXK 3M1EA 2HS5A 3SEZA 2KMUA 5CVUA 1A6QA 4KJZA 2QBYA 3S3OA 3W6VA 4LLNA 1R71A 3BC8A 2NVQJ 3IUOA 3OL4A 1J59A 4CSWA 2P81A 1KZHA 1K4SA 2QBYB 2Y69H 4N0BA 2R7XA 3SDGA 1FOYA 3CTAA 4JP0A 4CDGA 1FOWA 1ZG3A 1WJBA 5DUIA 4U7DA 5EG0B 3HXLA 4HV5A 4A93J 2L7FP 5JHUA 4DBQA 3CJQB 2BY0A 2OTJI 1H88C 3ZMTA 5IOZA 2DCEA 5HS8A 2OUMA 1ZHFA 1YE9A 5E20A 3BZ6A 5LRSA 1J5YA 3J81Z 1V54H 2KRCA 2XROA 5D8KB 1BOAA 2RAEA 4IHYA 5E79C 2ACJA 1RUNA 4V19K 2HYFA 3N4MA 3DPTA 4AYBA 3BP8A 5CVVA 2F5FA 2CU7A 1MW7A 1Y0UA 5ILSA 3WGIA 2H6CA 4RLQA 3K4BA 3OS2A 4A3IJ 1QZYA 1RKTA 1WJDA 1JUPA 1CGPA 2O3FA 4C2MJ 4HRIA 1AHDP 4IEJA 3H3UA 2XUBA 4J00A 2L7ZA 3PM1A 3HGGA 4CCLA 3HOYJ 1FT9A 1ACIA 3BT9A 2HZDA 2VKDA 2Y2ZA 3CCQI 4FHTA 4AVZA 3WG9A 3ABLH 1JTYA 4KITB 2WAQN 2ZXWH 4BQQA 2NNYA 1ZGJA 2W85A 1YFHA 1O7LA 3L2WA 3JRCA 4KISA 1K78B 1G2HA 1EH8A 2LMDA 2UZKA 2XB0X 2FU4A 3JRBA 2QKMB 3M4OJ 4NHJA 1W5TA 2UXXA 2KJBA 3HZJA 3S3MA 3GWZA 3Q0WA 1NG7A 3I4MJ 1Z6TA 2VQGA 4Q47A 4ZDLA 3S16J 2O61A 2YS9A 2ESHA 4EATA 1XMXA 2X1EA 1WHUA 2D2WA 3AG1H 1TNTA 1N78A 3W6JB 3CMAI 5LRRA 1XC5A 2XB5A 5GP9A 2MYSA 3E5QA 4NB5A 1ZRFA 2V79A 1GV2A 2NVUB 1MD0A 3ZOBA 4C3IJ 1RR7A 1BC8C 2DOFA 1MNEA 2V1DA 4ENNA 1SAUA 1A04A 2DW4A 2K4JA 3QYFA 2VT3A 4HEA2 2LG4A 3RKYA 3I0TA 1D0YA 4A3BJ 1APLC 3DEWA 3CF2A 2P7VB 1ETXA 2R0QC 1GUUA 2KLOA 3EUHC 1E3PA 3I9V2 4BQAA 2DMPA 1DPUA 1MH4A 4LITA 3BG9A 4HA8A 2X0LA 4E4HA 2RGVA 2YU3A 3G1MA 3KP5A 4OMYA 4L0YB 3RQ4A 3SZGA 2HQAA 1V5FA 1QGPA 5JFRA 4P9UA 2VXDA 3OYDA 2PMHA 2XSDC 1VQKI 1BIBA 1B1BA 2NOGA 1I6XA 4KYWA 4KT6A 1IRFA 1DGRM 2E1MB 4L9JA 1SMTA 2KPMA 1K6YA 1LNWA 4M3BA 4G6TB 2CV2A 1OR7A 3DPUA 5BPDA 2BBYA 4CH7A 2OF7A 3M8FA 2G0EA 3I64A 3CCYA 3I58A 2BE5F 1YW7A 2EA2A 1W36D 2HDWA 4RGUA 4D7NA 1IZ1A 1B59A 2UV1A 4BEHB 1EH7A 3PJRA 1WSUA 3BPXA 1D5VA 2H6BA 3A1YA 3IAM2 4OMZA 5IYDJ 5L3CA 2VJ5A 2L5QA 3G73A 1HKTA 3ZCOA 3TP0A 3JSOA 2ELKA 3BJ6A 3MD2A 2DA6A 5JVGF 1RRJA 4IRGA 4KNYA 3BY6A 1BJZA 2MD5A 3EPZA 1Z7UA 1F43A 2RKHA 5F6FA 2GXGA 2XPVA 3R0AA 5ILUA 4DIQA 1EV7A 3LA3A 4PJJA 3DBLB 3GTJJ 2XVCA 1IN7A 2JSCA 1IV8A 1FMVA 1LKXA 1YIOA 2CWEA 4NQWB 3BR1A 1BW6A 3CO7C 2Z3YA 4WX9A 1PP7U 2EZKA 5F27A 4ZZLA 2OBPA 2ID6A 3GFJA 4ZYHA 2WC2A 3A01A 3WTTC 1YG2A 2KIMA 2L4AA 2Y48A 3FMSA 3R61A 3WU2C 4E6KG 4WXCA 3PL8A 3D1NI 3MCZA 4V2GA 2VBXA 2VJ4A 3CJNA 4AU7A 5A2QZ 5L3DA 3WU0A 1W7PB 2XGEA 1MJAA 2CQNA 2R92J 1ETQA 1WH7A 1TW3A 5J8CA 4E7KA 4A3DJ 2AO9A 5DTDA 3FXJA 4ASNA 1K4TA 2VE9A 5F1JA 4D5CA 4IQ4A 3DU6A 2ZMEC 4EEFG 4Q48A 3HTUA 5E8GA 1UFMA 2ZFUA 4MFDA 3CC7I 4YG2F 2GAUA 3K70D 3ZXSA 1YI2I 2WTEA 2FE3A 2ZNYA 3ABMH 3P5JA 2DYSH 4GGGA 2NAZA 3C2HA 3MKWB 2M9HA 2BHYA 2FNAA 2CG4A 3C2GA 1YW8A 3GW2A 2OQGA 2EPFA 4CYCB 4PSXA 2H1LA 1V5GA 3G1OA 4C2UA 1WVRA 3H5AA 2HVRA 1D1BA 1UG2A 3TGNA 2CW7A 1OR7C 2GIZA 3BG6A 1BR4A 2O7OA 1O57A 5LHGA 2LY2A 5EEGA 3ZQIA 2EFPA 1ETYA 1DP3A 3CP2A 3VOEA 3CCSI 2H8RA 1R4MB 3O3KA 3G2BA 2Y31A 2Q2EB 3KLOA 2MW8A 3SFIA 1TTYA 4XKBA 3PSFA 2QA4I 5IP7J 3FHNA 4FQGA 1MIJA 4HOBA 2ZSHB 2VN2A 3KEOA 4BJ5C 4ENJA 3J7YJ 2PJRB 2DMTA 3DP7A 3G4SI 1XSDA 1ZRDA 1XS9A 5L3FA 2KZVA 5FKNA 2ISYA 3J80K 2J5OA 2IGKA 4HV6A 5LBQA 2AXLA 2A5YB 3KZYA 2H1KA 1JHFA 1Z77A 3EDPA 4IJAA 1VQ8I 4CCNA 3PFIA 2FBIA 4YFKF 2B63J 2VKHA 1XG1A 1GHCA 3CESA 4BE2A 2HWVA 4D5FA 2DK5A 4N4NB 2XC7A 1TT5B 2X6OA 3DF8A 3CCLI 3QWLA 3E3VA 4D0PA 1X1AA 5E1WA 2LF8A 1I50J 2JUGA 4HLYA 3U9GA 4OIOF 1UHWA 4U7BA 2P5VA 2VUMJ 3S1QJ 3U21A 1T39A 2RN7A 3GTOJ 3OSFA 2HKXA 3WHBA 1R1UA 3FWEA 1P7IA 2OPTA 4RGXA 4F92B 5IP6A 2I8DA 3BG3A 3WTVC 1IO2A 1W5CC 3MEXA 1B8IB 4J19A 1ZGAA 3D5SC 3IL2A 2DFHA 2KT0A 1ZLKA 1YIJI 4G6DA 4BHPA 1H8AC 2LY1A 4YIIA 2E19A 3A01B 2DA2A 3VYUB 1VZ0A 3F8NA 2DYRH 3VYSB 2ECBA 3DEUA 4Y13A 2FMLA 2M1BA 4G7OF 2L54A 3LSHA 1UAAA 1FIPA 2WV0A 1H9GA 2XASA 2HYJA 2KRHA 5CYVA 1LJ9A 4QSHA 5M5YJ 4G12A 2M3AA 1TLHB 5D5UB 2CH0A 3SYTA 3VWBA 1D1AA 3F3XA 5J1RA 1Z05A 3ZMUA 4F3QA 3OS1A 2ETHA 5AONA 1TWAJ 3FZVA 1MMDA 3S32A 1KQ8A 2V26A 2LBFA 1P2FA 4HNUA 1IRGA 5FKLA 4CYDA 5JHFA 4KT5C 2VBWA 2YSRA 5LFAA 1MBGA 1LVKA 1XDSA 1Q1HA 3LWFA 3N05A 2CJJA 2NVXJ 4Y17A 1FBQA 3VSKA 4FX4A 3FM5A 1JI8A 3LFKA 5FRMA 2PN6A 3NARA 1Z6RA 2UWMA 4I7HA 1ZREA 1MDMB 4HSRA 3CCMI 4Y52J 2X6XA 4AVPA 2EB7A 1YO5C 4I76A 2EZIA 2FOWA 1Y0NA 2STWA 3PO2J 2OD5A 2R7ZJ 2X48A 1HSJA 4F52A 3K6GA 1E2XA 3OYCA 5DD4A 3OYIA 1CF7A 2RC4A 5EG0A 2KHMA 5F1RA 1D0ZA 5J1YA 2HOSA 1WH5A 1YJWI 1HA8A 3DKXA 4XN0A 3IRRA 5CKTA 4A3KJ 1ETWA 2L7KA 3K4CA 3WG7H 3O2PE 4WK8F 5HNHA 1JGSA 2VPLA 1BJAA 2M5WA 5J6XA 3C7JA 2R5ZA 3PIPF 4DJAA 5J4YA 4HAMA 2A6TA 4W97A 2ICWG 2R7SA 1BOBA 1Q1VA 2M4KA 2J5PA 2DBBA 3EUAA 1FBUA 1FYLA 2CV1A 2EFOA 4Q5SF 2LD5A 1QQIA 4LFUA 4CGZA 1WJEA 3HRMA 1QNTA 5FFZA 2Z9OA 4MQVA 3E5UA 5E8IA 5GADJ 5LHHA 3RYPA 2ELHA 2Z2SB 4R79A 3GVAA 3Q3SA 3F6VA 2HI3A 3DTEA 4BL0B 4QPOA 2VASA 4QTRA 2NVTJ 1J2XA 2F5EA 3E0JB 3K1PA 1HCRA 2KFDA 1TWHJ 4ZTJA 5LLQA 1G3WA 3BG5A 1JJ8C 1LVAA 3F22A 2IS1A 2MSYA 2Z16A 2VJIA 1B9MA 1U9OA 1WGXA 4RAZA 2ADUA 2BW3B 1TT0A 3IKTA 2LP0A 4KN7X 4BHBA 4AWXB 2WAFA 4JBAA 1MBKA 3O6BB 2H09A 3OYEA 2E34A 1S7OA 4LG0A 3CMMA 5E3NA 3D5LA 3IH3A 1ON1A 5K5OA 1BI0A 2QQAA 3PIOF 5L3GA 3PSIA 1F1ZA 1X1BA 2EV0A 2YUSA 5F0HA 4BE0A 3A0BC 4CZZA 2K27A 3EETA 4B48A 2WAQA 3I56I 2QSHX 1HW5A 4HQMA 1D3YA 5LGUA 4L9VA 3EYIA 2E1OA 4ZJZA 3VB2A 3GTQJ 2HVSA 4HX8A 1I27A 4DGWB 4HQEA 2HTSA 1WWXA 2Z5UA 1IAWA 3SHFA 3WTUC 5K1YA 3F8BA 3G1LA 4EJVA 3ZPLA 3I59A 4UUTA 4S04A 5FKMA 2XV4S 4L5IA 1NG6A 2GQQA 5IP9J 5K7FA 1R5GA 2F2EA 1AA7A 1FYMA 1OYYA 1X4PA 2M0MA 1FMWA 1R1VA 2MFZA 1G6NA 4A3FJ 4EM1A 1LFUP 3RTRA 4FASD 3BTLA 3V7RA 4ZYDA 3ELKA 4A3LJ 3DKWA 2E1MC 2QWWA 2LKXA 1O4XA 2PJPA 2PMZN 2CMPA 3I3LA 1FP2A 3CJTB 3RZDJ 4A3EJ 3CD6I 1ERDA 3QPTA 5EDNA 3SXYA 1VI0A 1D8JA 1VQLI 4WXHA 2LTPA 3KYLA 2K9NA 4E7JA 4K2EA 2FEZA 2FSWA 2F48A 3OV8A 3MQ0A 2DJNA 2OC6A 1AOYA 1WQ2A 3AG4H 5AIQA 1IN4A 1A36A 4ZDPA 2HDDA 2NNNA 2C6YA 5FLXZ 1KYWA 5L3BA 1Y56A 3FX3A 3HOUJ 3HSRA 3H3ZA 1FJLA 2XRLA 2JJ7A 2WBMA 4NC8A 3ASNH 3JREA 5BPIA 3R0JA 5IYCJ 2E2IJ 3W2WA 1GVDA 4G7HF 4HX4A 2NVYJ 2VKEA 4L0ZB 2IVMA 5HDGA 1Y6IA 2LLKA 1QPMA 2FOKA 4MIMA 2VOPA 1I6HJ 2LH9A 3TDUC 2KRFA 3CC2I 1S6LA 2BY3A 2OU2A 4L5EA 3JRFA 2DXIA 4CUGA 3FXLA 2RV8A 4DBRA 1USTA 3GX4X 4UB8C 1YOVB 1YJNI 3RYRA 4XLAA 3F9KA 4E7ZA 2E2HJ 5KCMA 1AKHB 3IWFA 4II3A 4ZC3A 3HIFA 4H4KC 1TNSA 3ZQFA 2LDUA 1SVMA 3KEYA 1T98A 3GTMJ 2H8WA 1FLIA 2L9SA 1WI3A 1MKMA 1ZTRA 1V4RA 3ML6A 3RPQA 3VSLA 2JVHA 2JA8J 1IN6A 4IZZA 4M3DA 3GFIA 1RUOA 1IXCA 1ULYA 2DFEA 5TISC 1B9NA 3WTWC 2K9SA 2HXIA 2M2EA 3QU3A 5ICEA 2M4GA 3CO6C 1O3TA 2EV5A 2QZ8A 3AG2H 3CDHA 4I0AA 2M7AA 4BACA 2TDXA 3ZGKA 1H9TA 1BW5A 2BHZA 4GRIA 3W6KB 3ZQCA 5E18F 2CQ7A 4I01A 5B66C 4I02A 3A4CA 4XLEA 5E3OA 1EA3A 2ZKZA 1MSEC 3AKZA 2ESNA 5HODA 2ZSIB 4O3MA 4IKFA 2IRFG 2FXAA 2ZFWA 5H6QA 2I5UA 5EZHA 1SD4A 3ZMDA 2X85A 5HLHA 3BCBA 4BQOA 3F8FA 4GXOA 3FHZA 3QP5A 1X2MA 1WJ5A 2QGUA 4XK4A 2XF6A 2ELJA 4PDKA 4UHTA 2X4HA 2QM3A 3H9JA 1IN8A 4I0BA 1TW2A 3OMYA 4IRIA 3HB9A 4JOMA 2K9MA 1J0RA 2W25A 5B1AH 2GA2A 3P9KA 4O6JA 2Y0SN 3UNGC 2PI0A 2VQCA 3H9QA 4XKWA 5DEQA 2FD5A 5HS7A 2GBYA 4ZH4F 2L2OA 4HF0A 1OLTA 3GFLA 2BOLA 4B43A 3ROUA 1XSVA 4F55A 2B7EA 5DM6F 4I09A 4P5OA 2PQ8A 2DA5A 3HTSB 2YPRA 4CXFA 3HOZJ 5FO5A 2O5RA 2Y0SA 2GIVA 3CLQA 4IX7A 2QENA 5LGNA 2VPRA 3GZNB 3LSMA 2HOEA 5M5WJ 1RESA 2DFFA 2HGCA 5DDGA 1HDPA 2F5CA 1TWCJ 4Y7NJ 2VKVA 3OS0A 4AM3A 2AS5F 2LC2A 3R60A 4M3GA 2E5ZA 1MGTA 2ZMEB 4E7HA 2YU9J 2Q0OA 1YQAA 5C44J 4U0YA 2P7CB 4UXNA 1W7PA 2ZB9A 2HFHA 3CC4I 1IRZA 2VT2A 1IG7A 1O3SA 4AUXA 1RC9A 3NRVA 2L0KA 1F36A 4LG0B 3RQIA 4OAZA 1OCZH 2OCEA 4CA0A 1BI3A 3RPUD 4E70A 3V7CA 3H0DA 1VTNC 4XLHA 4BJTA 2HEOA 1Y1VJ 1X3ZB 2PX9A 3OY9A 3RDIA 5E3LA 3DBHB 1FEXA 1LFBA 3ZN1A 4XLNF 4HG2A 1USSA 1SAXA 5GAGJ 2R4GA 1YRNA 2O9LA 1SMYF 2JTVA 3ZP5A 4MEXF 2EIJH 2EWNA 1TBXA 4UV9A 4D9JA 4JX5A 4E7LA 3ZMSA 2Z1DA 2MLKA 4XKCA 2E1NA 1X3WB 1H89C 4ABZA 3E6MA 4HYEA 1LEAA 3ABKH 3F23A 1BI2A 5EGOB 1P4WA 2L9NA 2RVCA 3CDLA 3KYDB 4LG3A 4ZDOA 3SDBA 1G3SA 3L2UA 1LDKB 2D45A 3KX2A 2LOOA 1MH3A 4LJZF 2GLOA 3H5RA 2R93J 2QSFX 3D5RC 1MBHA 5BQTA 3IH4A 1WI9A 4RLFA 3MKZA
chains in the Genus database with same CATH topology
2EFNA 1I1GA 2H94A 2K02A 1CF7B 3MAJA 2XAFA 1RI7A 2FBHA 4O5VA 2YX7A 4CICA 5HDKA 1Z1DA 3SQNA 1PUEE 3R6SA 4G7ZF 2VC1A 4EM2A 1R23A 3SFZA 3ISPA 2RQPA 3ZMZA 2FRHA 3FXRA 1YYVA 3K0LA 4OINF 4GO1A 4UVBA 4Y15A 3TO9A 2XGXA 4P96A 2GXBA 2DPUA 4M9ZA 3ABTA 3EYYA 4GYIA 3WTZA 5D5VB 3GLXA 3I5UA 3BWGA 3RKXA 1XB4A 5D6EA 4CO8A 4LLLA 5DYMA 4A0ZA 2KJCA 4MGRA 2OA4A 2FNPA 3KZZA 5KK1A 3WGHA 4A0XA 4OIPF 1FP1D 2BV6A 1XMKA 2R7DA 5K5QA 1X3UA 2DT5A 3RPUA 1FBSA 1P6RA 4L9NA 3KFWX 3NEUA 4RB2C 1XCVA 3JTHA 4AIHA 1Z91A 3FF5A 3V4GA 1SD6A 5CVJA 2ZNZA 3CLOA 1XCBA 5DV5A 1JXSA 4KMFA 2A69F 4YIFA 3QOPA 4FX0A 5DCMB 3LAJA 1FNNA 2V1XA 1STZA 2OAZA 5DUKA 4G94A 1MJ9A 3KEQA 1DPRA 2P5KA 4KIFA 1JHHA 4BHCA 1SFEA 2QUFA 3WODF 1LEBA 3KE2A 1R58A 3ECOA 2JZYA 4KMUX 5H6RA 4WWCA 4H0EA 4KFCA 4ESBA 4L18B 2DQRA 1FC3A 1SFXA 5TJJA 3GZ5A 3DFGA 4M9SA 2IPQX 2UXNA 2NRAC 4WF2A 2EFQA 2FA5A 3GZ6A 1ONVA 3JSPA 1KYZA 3DPLC 2BYVE 4RGSA 4EJUA 2DPDA 4XLPF 5FFXA 3LA7A 2PBIA 2HTJA 3S2WA 2DLLA 1ZARA 3MZHA 4B09A 2XHKA 3I4PA 4R8HA 3U1DA 2O03A 5E17F 2CSOA 3K69A 2IP2A 1P4XA 3D0SA 4Z2YA 4EVIA 5JVTA 1ZLJA 5IT9Z 5D4SA 3IKVA 4QWQA 4A5MA 3ERED 3JAMK 2MLGA 4IHSA 4AIKA 4U0WA 3SZTA 3ZQ7A 2V6CA 5BS6A 4MTDA 2JT1A 5E1XA 2OZ6A 3V8JA 3KETA 3T5XA 4I2OA 4L5JA 1XGOA 1DDNA 4NQWA 5TRDA 4BYYA 3F6OA 4UV8A 2V9VA 3BDDA 2A6EF 2L4MA 3GYHX 3V8KA 3TOAA 5ILVA 2OZUA 3T8TA 2CFXA 1ZH5A 6PAXA 3JTGA 3F72A 3FMRA 1U8RA 2B0LA 2Y75A 3K1NA 2CQKA 4KN4X 4OU0A 2IJLA 2A61A 2IA0A 2Z99A 3ECHA 1GXPA 2LKPA 2MBFA 3J81K 3ZN0A 3T8RA 3C18A 3F8CA 4WXDA 1MZBA 2E1CA 4R1HA 3GXOA 4EJWA 2VC0A 1KQ9A 4DQ2A 1ZRCA 1UCRA 1YS7A 4EGZA 3QAHA 3HUGA 2MA3A 1G3TA 3M7GA 1KQ0A 1SFUA 3EQLF 3K9TA 4LMYA 3WTSC 1RIOH 3C3WA 3E5XA 2P8TA 1L3LA 1AWCA 2W84A 3ZMVA 1GVJA 1DUXC 3IWZA 3L00A 3ULQB 2M87A 3BJOA 4OIQF 2M30A 3LQQA 3QRFF 5LEKA 4M74A 3KP7A 2ZMEA 2STTA 2P4WA 2D1HA 3CUQB 3IC7A 1BC7C 3VODA 5CVIA 5BMZA 4CHUA 3LA2A 5A2QK 1K79A 3MZYA 2WWYA 1FPQA 5CJ9A 3QP6A 3TO7A 2R7FA 3TO6A 5FB2A 2EK5A 3HHHA 2EV6A 2M8EA 1S7AA 5LGTA 3V7SA 4N9HA 1I5ZA 5D5XB 4LB6B 3RKWA 5CVRA 4XSXF 1GXQA 5HOOA 1HQCA 1O7FA 3HRTA 5HDNA 4ESFA 2XAQA 4ZYGA 5ICFA 2VBYA 4PCQA 3P7NA 1R36A 1W4MA 4G9YA 2O0YA 1MDMA 3I54A 4EV0A 5HLGA 2PMUA 5KVRA 1V3FA 1HXDA 2Z33A 4MEYF 3K1MA 4HZFA 4JK1X 1YLFA 5HVQC 1U78A 4AD9A 1XGSA 3K2ZA 4TV7A 4M6XA 2OQRA 3KP6A 2YR2A 2Y0MA 1LDDA 1U5TC 4G6QA 1JE8A 5IT3A 1PP8F 2KIFA 1H0MA 1BN5A 3GUDA 1G4DA 2FF4A 1KU7A 4M73A 4UUVA 3IHUA 4HBLA 2XAHA 4L9TA 4U88A 3KP2A 1FYKA 5ED4A 3T0YA 3RI4A 2HYGD 2CW0F 3CUQC 3F8MA 1O3QA 2ISZA 4A0YA 3DQVC 1NHAA 3B73A 5J8FA 5LHIA 3NQOA 1O3RA 1KA8A 5K5RA 2W24A 1HSTA 2XKOA 3L09A 1TQIA 2MC3A 5DD8A 2ZO4A 3RJPA 5FD6A 3DXJF 3JW4A 4WCGA 1EH6A 3BOQA 3M8EA 2P6SA 5CLSA 4GYGA 1IUYA 5FD5A 4KUMA 1R22A 3TOBA 1Z9CA 4XSZF 4PZJA 4P55A 4LGWA 2M45A 5E1ZB 4YFXF 1FWZA 3L7WA 4BXUA 2PLYA 4HF1A 3KP3A 2K86A 1MJBA 1DP7P 2CO5A 3QU6A 3PQKA 4S05A 3I59B 1HW2A 4PGHA 1HBXG 2XKPA 1PDNC 3L9FA 4BNCA 4A5NA 4UVCA 3VFZA 2E7XA 4PGGA 1KU2A 4BH9A 3P9CA 1HW1A 1J7KA 3C1DA 3TKYA 2V1UA 4ENMA 2E7WA 2QLZA 1IW7F 3WU1B 3FMQA 2VXZA 4MNUA 2DAOA 3RIRA 2G7UA 1P4AA 1R00A 4KIBA 4P9FA 2DI3A 4A6DA 1SD7A 3TDZC 4EQQA 1F4KA 4U0VA 2DFIA 1IXRC 1KU9A 3KP4A 3WE3A 4ESJA 2P6TA 3KCCA 5JI6A 2QYOA 1G3YA 5L3EA 4N9IA 4QLCU 1R1TA 3BJAA 4EGYA 1T2KA 2IW5A 2XAJA 3E6DA 2DO7A 4M71A 1OYWA 4A6EA 5D6FA 3U2RA 2EFWA 2Q8KA 2ZXJA 4AIJA 1S3JA 4ZYEA 2FQ3A 2L02A 1UB9A 3T1BA 4IVNA 1WKMA 4IHTA 1HKSA 2ZJ2A 1OKRA 2G9WA 1F5TA 3HHGA 4B8XA 1IXSB 4MQ9F 3COAC 5D4RA 1K78A 2L01A 1XD7A 4I98B 4GCVA 3BROA 2GA1A 3V8LA 4EM0B 4ZZDA 4DNCA 2KIUA 4M9XA 1W5SA 5DCFA 3OOPA 2JRTA 3HOTA 1WRJA 3B02A 4MTEA 2RDPA 3Q9VA 4M6YA 4HDVA 2FMYA 1B6AA 4IF4A 5FGMA 2VONA 1J75A 2XAGA 1ZG1A 2DU9A 2NYXA 4M72A 4EJOA 1S8NA 1U2WA 4RB0A 1LDJA 4LK0F 2LNBA 2PEXA 1QO0D 1T0FA 2HDCA 3J80Z 1TQMA 4KA4A 4KDPA 2A68F 3WE2A 4HF2A 3L2CA 1FZPB 5F64A 1RZ4A 1IN5A 2F5DA 2R3SA 4HDUA 1K7AA 1ODDA 2EJRA 1XGNA 3Q5FA 3MWMA 1U5TA 1FOKA 1FSEA 2VOOA 1QBJA 3N97A 5DCMA 3F21A 1ZYRF 3R4KA 2KKOA 2P5LC 3SZPA 1K6OA 3AAFA 2COMA 4XRFA 4UVAA 3DV8A 2QQ9A 3BPVA 2QQBA 3QPHA 3MFKA 5IT9K 2O6GE 1QZZA 2FBKA 4ENKA 1ON2A 1U3EM 2ZCWA 3GF2A 1OMIA 2HR3A 1I1SA 2PG4A 2A3SA 1IF1A 3CUQA 3LSTA 2MH2A 2O8XA 5HLIA 2VE8A 4RS8A 1XDUA 4BAYA 4YFNF 2L3DA 1SD5A 2K4BA 3FM3A 2NS0A 2D1VA 3HOSA 2QVOA 1BM9A 2H27A 1L0OC 1YTYA 1RNLA 5HS9A 1YW9A 3E6CC 1FY7A 1ZG5A 2HQNA 4HLXA 4OOIA 4EMSA 2RNJA 1XSXA 3KLNA 4A2UA 3EUHA 3LQRA 1U6GA 4ETSA 4G8XA 2IA2A 4FT8A 2IA1A 4Q4ZF 2DTRA 5ICCA 1LB2A 3E6BA 1REPC 4LD5A 2LSOA 2YX4A 5D5WB 4LK1F 3REOA 1BIAA 4IRHA 3VEPA 1P92A 3FXUA 4UNOA 4RGRA 1FSHA 2LF7A 4ON0A 4LB5A 4EJTA 3ABUA 5BOXA 3I53A 4RB1A 1B4AA 3E97A 3GFMA 4IXAA 1BI1A 3HRUA 1UHMA 4F7ZA 2K7LA 5JR3A 1T6SA 3I71A 4HX7A 2ZBKA 2JPCA 2W57A 3J7AO 1E17A 3JAMZ 3G3ZA 1U5TB 5ICGA 2JPBA 3WTYC 3IRQA 4HW0A 1TQPA 2G7HA 2DK8A 2VBZA 3P9IA 3WGGA 3HSEA 3M9AA 1T38A 1F9NA 3CUOA 3H92A 2CGPA 3HRSA 1OPCA 5ERIA 4OIRF 1BBYA 2BEOA 5LEJA 1FX7A 5H20A 4LLGF 5AIPA 4RAYA 2PFBA 2XIGA 1ZN2A 2MH9A 1XGMA 1HKQA 5D8LB 1D8KA 1OYIA 2A6HF 3Q9SA 3FXQA 2VODA 2HZTA 1LQ1A 3LAPA 2HQRA 4A12A 4IPAA 2GWRA 4KIGA 1C0WA 2IT0A 1ZAOA 3TQNA 4RB3C 1R7JA 1S29A 1XMAA 1W7PD 3GO5A 2XRNA 3HYIA 3GEZA 1KU3A 1R5HA 3HSFA 2GZWA 1J9IA 3PQJA 2A07F 1YS6A 4MHGA 2DQLA 2Q2EA 1XN7A 2HKOA 3WTXC 4KICA 5EEHA 4JQFA 4XBFA 2CYYA 1KGSA 2BGCA 2EA4A 5FLXK 3M1EA 2HS5A 5CVUA 2QBYA 4LLNA 1J59A 2QBYB 4N0BA 3CTAA 4CDGA 1ZG3A 4U7DA 5DUIA 4HV5A 5JHUA 3ZMTA 5HS8A 1ZHFA 5E20A 3BZ6A 5LRSA 1J5YA 3J81Z 2XROA 5D8KB 1BOAA 2ACJA 1RUNA 2HYFA 3N4MA 3DPTA 3BP8A 5CVVA 2F5FA 1Y0UA 5ILSA 3WGIA 2H6CA 1QZYA 1CGPA 2O3FA 3H3UA 2XUBA 1FT9A 4FHTA 3WG9A 2NNYA 1ZGJA 2W85A 1YFHA 1O7LA 1K78B 1EH8A 2UZKA 2FU4A 4NHJA 1W5TA 2UXXA 2KJBA 3GWZA 1Z6TA 4Q47A 2O61A 2ESHA 2D2WA 1TNTA 3W6JB 5LRRA 3E5QA 4NB5A 1ZRFA 2V79A 1MD0A 1BC8C 4ENNA 2V1DA 1A04A 2DW4A 2K4JA 2VT3A 3RKYA 3I0TA 2P7VB 4BQAA 1DPUA 4HA8A 2X0LA 4OMYA 2RGVA 2YU3A 3KP5A 4L0YB 1QGPA 5JFRA 4P9UA 2PMHA 1BIBA 1B1BA 1I6XA 4KYWA 4L9JA 1IRFA 1SMTA 1LNWA 1OR7A 5BPDA 2BBYA 3M8FA 3I64A 3I58A 2BE5F 1YW7A 2EA2A 4RGUA 1IZ1A 1B59A 1EH7A 1WSUA 3BPXA 1D5VA 2H6BA 4OMZA 5L3CA 3G73A 1HKTA 3JSOA 3BJ6A 4IRGA 4KNYA 3BY6A 2MD5A 1Z7UA 2RKHA 5F6FA 2GXGA 3R0AA 5ILUA 1EV7A 3LA3A 2XVCA 1IN7A 2JSCA 2CWEA 1YIOA 3CO7C 2Z3YA 4WX9A 1PP7U 4ZZLA 2OBPA 3GFJA 4ZYHA 2WC2A 3WTTC 1YG2A 2KIMA 2L4AA 2Y48A 3FMSA 3R61A 4WXCA 3MCZA 2VBXA 3CJNA 5A2QZ 5L3DA 3WU0A 1W7PB 1MJAA 1TW3A 5J8CA 4ASNA 2VE9A 4Q48A 3HTUA 5E8GA 1UFMA 4YG2F 2GAUA 2WTEA 2FE3A 2ZNYA 4GGGA 2NAZA 2FNAA 2CG4A 1YW8A 3GW2A 2OQGA 3TGNA 1O57A 5LHGA 5EEGA 2EFPA 3VOEA 3O3KA 3KLOA 1TTYA 4HOBA 2VN2A 3KEOA 4ENJA 3DP7A 1XSDA 1ZRDA 5L3FA 2ISYA 3J80K 2J5OA 5LBQA 4HV6A 2AXLA 2A5YB 3KZYA 1JHFA 3EDPA 4IJAA 3PFIA 2FBIA 4YFKF 1GHCA 2HWVA 2DK5A 3DF8A 3E3VA 4D0PA 5E1WA 2LF8A 4HLYA 3U9GA 4OIOF 1UHWA 4U7BA 2P5VA 1T39A 2RN7A 2HKXA 1R1UA 3FWEA 4RGXA 3WTVC 3MEXA 1ZGAA 3IL2A 1ZLKA 4G6DA 4BHPA 4YIIA 3F8NA 3DEUA 4Y13A 2FMLA 2M1BA 4G7OF 2L54A 2WV0A 1H9GA 2XASA 5CYVA 1LJ9A 1TLHB 5D5UB 3F3XA 1Z05A 3ZMUA 2ETHA 5AONA 3FZVA 1KQ8A 1P2FA 1IRGA 4CYDA 4KT5C 2VBWA 2YSRA 1XDSA 1Q1HA 3LWFA 4Y17A 1FBQA 4FX4A 3FM5A 3LFKA 2PN6A 1Z6RA 2UWMA 4I7HA 1ZREA 1MDMB 4AVPA 2EB7A 1YO5C 2STWA 2OD5A 1HSJA 1E2XA 5DD4A 1CF7A 2RC4A 5F1RA 3IRRA 4WK8F 3O2PE 1JGSA 1BJAA 2M5WA 5J6XA 3C7JA 4HAMA 2J5PA 2DBBA 1FBUA 1FYLA 2EFOA 4Q5SF 1QQIA 4LFUA 4CGZA 3HRMA 1QNTA 5FFZA 2Z9OA 4MQVA 3E5UA 5E8IA 5LHHA 3RYPA 2ELHA 4R79A 3GVAA 3F6VA 1J2XA 2F5EA 3K1PA 5LLQA 1G3WA 1LVAA 3F22A 1B9MA 4RAZA 2ADUA 3IKTA 4KN7X 4BHBA 4AWXB 4JBAA 3O6BB 2H09A 1S7OA 4LG0A 3D5LA 1ON1A 5K5OA 1BI0A 2QQAA 5L3GA 1F1ZA 2EV0A 4CZZA 2K27A 3EETA 1HW5A 4HQMA 1D3YA 5LGUA 4L9VA 3EYIA 3VB2A 4HX8A 1I27A 4HQEA 2HTSA 1WWXA 2Z5UA 1IAWA 3SHFA 3WTUC 5K1YA 3F8BA 4EJVA 3ZPLA 3I59A 4S04A 2XV4S 4L5IA 2GQQA 1R5GA 2F2EA 1FYMA 1OYYA 1R1VA 1G6NA 4EM1A 3RTRA 3V7RA 4ZYDA 3ELKA 3DKWA 2QWWA 2PJPA 1FP2A 3QPTA 3SXYA 1D8JA 4WXHA 4K2EA 2FEZA 2FSWA 3OV8A 3MQ0A 1AOYA 1WQ2A 5AIQA 1IN4A 2NNNA 2C6YA 5FLXZ 1KYWA 5L3BA 3FX3A 3HSRA 3H3ZA 5BPIA 3R0JA 4G7HF 4HX4A 4L0ZB 2IVMA 5HDGA 1QPMA 2FOKA 2VOPA 3TDUC 2KRFA 1S6LA 2OU2A 2RV8A 3GX4X 1USTA 3RYRA 3IWFA 3HIFA 1TNSA 2LDUA 1T98A 1FLIA 1MKMA 1V4RA 3ML6A 3RPQA 1IN6A 3GFIA 1RUOA 1IXCA 1ULYA 1B9NA 3WTWC 3QU3A 5ICEA 3CO6C 1O3TA 2EV5A 2QZ8A 3CDHA 4I0AA 2TDXA 1H9TA 3W6KB 5E18F 4I01A 4I02A 2ZKZA 2ESNA 4O3MA 2IRFG 2FXAA 2ZFWA 5H6QA 1SD4A 3ZMDA 5HLHA 3F8FA 4GXOA 3FHZA 3QP5A 4PDKA 4UHTA 2X4HA 2QM3A 1IN8A 4I0BA 1TW2A 4IRIA 1J0RA 2W25A 2GA2A 3P9KA 4O6JA 2PI0A 5DEQA 5HS7A 4ZH4F 4HF0A 3GFLA 3ROUA 1XSVA 4I09A 4P5OA 2PQ8A 3HTSB 2YPRA 4CXFA 5FO5A 2GIVA 2QENA 5LGNA 2HOEA 2HGCA 5DDGA 2F5CA 2AS5F 3R60A 1MGTA 2ZMEB 2Q0OA 1YQAA 4U0YA 2P7CB 4UXNA 1W7PA 2HFHA 2VT2A 1O3SA 3NRVA 4LG0B 1BI3A 4E70A 3V7CA 1VTNC 2HEOA 3RDIA 3ZN1A 4XLNF 1USSA 1SAXA 1SMYF 2JTVA 3ZP5A 4MEXF 2EWNA 1TBXA 4UV9A 3ZMSA 2MLKA 2E1NA 3E6MA 4HYEA 1LEAA 3F23A 1BI2A 1P4WA 2RVCA 1G3SA 1LDKB 2D45A 4LJZF 5BQTA 1WI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFN A;  1I1G A;  2H94 A;  2K02 A;  1CF7 B;  3MAJ A;  2XAF A;  1RI7 A;  2FBH A;  4O5V A;  2YX7 A;  4CIC A;  5HDK A;  1Z1D A;  3SQN A;  1PUE E;  3R6S A;  4G7Z F;  2VC1 A;  4EM2 A;  1R23 A;  3SFZ A;  3ISP A;  2RQP A;  3ZMZ A;  2FRH A;  3FXR A;  1YYV A;  3K0L A;  4OIN F;  4GO1 A;  4UVB A;  4Y15 A;  3TO9 A;  2XGX A;  4P96 A;  2GXB A;  2DPU A;  4M9Z A;  3ABT A;  3EYY A;  4GYI A;  3WTZ A;  5D5V B;  3GLX A;  3I5U A;  3BWG A;  3RKX A;  1XB4 A;  5D6E A;  4CO8 A;  4LLL A;  5DYM A;  4A0Z A;  2KJC A;  4MGR A;  2OA4 A;  2FNP A;  3KZZ A;  5KK1 A;  3WGH A;  4A0X A;  4OIP F;  1FP1 D;  2BV6 A;  1XMK A;  2R7D A;  5K5Q A;  1X3U A;  2DT5 A;  3RPU A;  1FBS A;  1P6R A;  4L9N A;  3KFW X;  3NEU A;  4RB2 C;  1XCV A;  3JTH A;  4AIH A;  1Z91 A;  3FF5 A;  3V4G A;  1SD6 A;  5CVJ A;  2ZNZ A;  3CLO A;  1XCB A;  5DV5 A;  1JXS A;  4KMF A;  2A69 F;  4YIF A;  3QOP A;  4FX0 A;  5DCM B;  3LAJ A;  1FNN A;  2V1X A;  1STZ A;  2OAZ A;  5DUK A;  4G94 A;  1MJ9 A;  3KEQ A;  1DPR A;  2P5K A;  4KIF A;  1JHH A;  4BHC A;  1SFE A;  2QUF A;  3WOD F;  1LEB A;  3KE2 A;  1R58 A;  3ECO A;  2JZY A;  4KMU X;  5H6R A;  4WWC A;  4H0E A;  4KFC A;  4ESB A;  4L18 B;  2DQR A;  1FC3 A;  1SFX A;  5TJJ A;  3GZ5 A;  3DFG A;  4M9S A;  2IPQ X;  2UXN A;  2NRA C;  4WF2 A;  2EFQ A;  2FA5 A;  3GZ6 A;  1ONV A;  3JSP A;  1KYZ A;  3DPL C;  2BYV E;  4RGS A;  4EJU A;  2DPD A;  4XLP F;  5FFX A;  3LA7 A;  2PBI A;  2HTJ A;  3S2W A;  2DLL A;  1ZAR A;  3MZH A;  4B09 A;  2XHK A;  3I4P A;  4R8H A;  3U1D A;  2O03 A;  5E17 F;  2CSO A;  3K69 A;  2IP2 A;  1P4X A;  3D0S A;  4Z2Y A;  4EVI A;  5JVT A;  1ZLJ A;  5IT9 Z;  5D4S A;  3IKV A;  4QWQ A;  4A5M A;  3ERE D;  3JAM K;  2MLG A;  4IHS A;  4AIK A;  4U0W A;  3SZT A;  3ZQ7 A;  2V6C A;  5BS6 A;  4MTD A;  2JT1 A;  5E1X A;  2OZ6 A;  3V8J A;  3KET A;  3T5X A;  4I2O A;  4L5J A;  1XGO A;  1DDN A;  4NQW A;  5TRD A;  4BYY A;  3F6O A;  4UV8 A;  2V9V A;  3BDD A;  2A6E F;  2L4M A;  3GYH X;  3V8K A;  3TOA A;  5ILV A;  2OZU A;  3T8T A;  2CFX A;  1ZH5 A;  6PAX A;  3JTG A;  3F72 A;  3FMR A;  1U8R A;  2B0L A;  2Y75 A;  3K1N A;  2CQK A;  4KN4 X;  4OU0 A;  2IJL A;  2A61 A;  2IA0 A;  2Z99 A;  3ECH A;  1GXP A;  2LKP A;  2MBF A;  3J81 K;  3ZN0 A;  3T8R A;  3C18 A;  3F8C A;  4WXD A;  1MZB A;  2E1C A;  4R1H A;  3GXO A;  4EJW A;  2VC0 A;  1KQ9 A;  4DQ2 A;  1ZRC A;  1UCR A;  1YS7 A;  4EGZ A;  3QAH A;  3HUG A;  2MA3 A;  1G3T A;  3M7G A;  1KQ0 A;  1SFU A;  3EQL F;  3K9T A;  4LMY A;  3WTS C;  1RIO H;  3C3W A;  3E5X A;  2P8T A;  1L3L A;  1AWC A;  2W84 A;  3ZMV A;  1GVJ A;  1DUX C;  3IWZ A;  3L00 A;  3ULQ B;  2M87 A;  3BJO A;  4OIQ F;  2M30 A;  3LQQ A;  3QRF F;  5LEK A;  4M74 A;  3KP7 A;  2ZME A;  2STT A;  2P4W A;  2D1H A;  3CUQ B;  3IC7 A;  1BC7 C;  3VOD A;  5CVI A;  5BMZ A;  4CHU A;  3LA2 A;  5A2Q K;  1K79 A;  3MZY A;  2WWY A;  1FPQ A;  5CJ9 A;  3QP6 A;  3TO7 A;  2R7F A;  3TO6 A;  5FB2 A;  2EK5 A;  3HHH A;  2EV6 A;  2M8E A;  1S7A A;  5LGT A;  3V7S A;  4N9H A;  1I5Z A;  5D5X B;  4LB6 B;  3RKW A;  5CVR A;  4XSX F;  1GXQ A;  5HOO A;  1HQC A;  1O7F A;  3HRT A;  5HDN A;  4ESF A;  2XAQ A;  4ZYG A;  5ICF A;  2VBY A;  4PCQ A;  3P7N A;  1R36 A;  1W4M A;  4G9Y A;  2O0Y A;  1MDM A;  3I54 A;  4EV0 A;  5HLG A;  2PMU A;  5KVR A;  1V3F A;  1HXD A;  2Z33 A;  4MEY F;  3K1M A;  4HZF A;  4JK1 X;  1YLF A;  5HVQ C;  1U78 A;  4AD9 A;  1XGS A;  3K2Z A;  4TV7 A;  4M6X A;  2OQR A;  3KP6 A;  2YR2 A;  2Y0M A;  1LDD A;  1U5T C;  4G6Q A;  1JE8 A;  5IT3 A;  1PP8 F;  2KIF A;  1H0M A;  1BN5 A;  3GUD A;  1G4D A;  2FF4 A;  1KU7 A;  4M73 A;  4UUV A;  3IHU A;  4HBL A;  2XAH A;  4L9T A;  4U88 A;  3KP2 A;  1FYK A;  5ED4 A;  3T0Y A;  3RI4 A;  2HYG D;  2CW0 F;  3CUQ C;  3F8M A;  1O3Q A;  2ISZ A;  4A0Y A;  3DQV C;  1NHA A;  3B73 A;  5J8F A;  5LHI A;  3NQO A;  1O3R A;  1KA8 A;  5K5R A;  2W24 A;  1HST A;  2XKO A;  3L09 A;  1TQI A;  2MC3 A;  5DD8 A;  2ZO4 A;  3RJP A;  5FD6 A;  3DXJ F;  3JW4 A;  4WCG A;  1EH6 A;  3BOQ A;  3M8E A;  2P6S A;  5CLS A;  4GYG A;  1IUY A;  5FD5 A;  4KUM A;  1R22 A;  3TOB A;  1Z9C A;  4XSZ F;  4PZJ A;  4P55 A;  4LGW A;  2M45 A;  5E1Z B;  4YFX F;  1FWZ A;  3L7W A;  4BXU A;  2PLY A;  4HF1 A;  3KP3 A;  2K86 A;  1MJB A;  1DP7 P;  2CO5 A;  3QU6 A;  3PQK A;  4S05 A;  3I59 B;  1HW2 A;  4PGH A;  1HBX G;  2XKP A;  1PDN C;  3L9F A;  4BNC A;  4A5N A;  4UVC A;  3VFZ A;  2E7X A;  4PGG A;  1KU2 A;  4BH9 A;  3P9C A;  1HW1 A;  1J7K A;  3C1D A;  3TKY A;  2V1U A;  4ENM A;  2E7W A;  2QLZ A;  1IW7 F;  3WU1 B;  3FMQ A;  2VXZ A;  4MNU A;  2DAO A;  3RIR A;  2G7U A;  1P4A A;  1R00 A;  4KIB A;  4P9F A;  2DI3 A;  4A6D A;  1SD7 A;  3TDZ C;  4EQQ A;  1F4K A;  4U0V A;  2DFI A;  1IXR C;  1KU9 A;  3KP4 A;  3WE3 A;  4ESJ A;  2P6T A;  3KCC A;  5JI6 A;  2QYO A;  1G3Y A;  5L3E A;  4N9I A;  4QLC U;  1R1T A;  3BJA A;  4EGY A;  1T2K A;  2IW5 A;  2XAJ A;  3E6D A;  2DO7 A;  4M71 A;  1OYW A;  4A6E A;  5D6F A;  3U2R A;  2EFW A;  2Q8K A;  2ZXJ A;  4AIJ A;  1S3J A;  4ZYE A;  2FQ3 A;  2L02 A;  1UB9 A;  3T1B A;  4IVN A;  1WKM A;  4IHT A;  1HKS A;  2ZJ2 A;  1OKR A;  2G9W A;  1F5T A;  3HHG A;  4B8X A;  1IXS B;  4MQ9 F;  3COA C;  5D4R A;  1K78 A;  2L01 A;  1XD7 A;  4I98 B;  4GCV A;  3BRO A;  2GA1 A;  3V8L A;  4EM0 B;  4ZZD A;  4DNC A;  2KIU A;  4M9X A;  1W5S A;  5DCF A;  3OOP A;  2JRT A;  3HOT A;  1WRJ A;  3B02 A;  4MTE A;  2RDP A;  3Q9V A;  4M6Y A;  4HDV A;  2FMY A;  1B6A A;  4IF4 A;  5FGM A;  2VON A;  1J75 A;  2XAG A;  1ZG1 A;  2DU9 A;  2NYX A;  4M72 A;  4EJO A;  1S8N A;  1U2W A;  4RB0 A;  1LDJ A;  4LK0 F;  2LNB A;  2PEX A;  1QO0 D;  1T0F A;  2HDC A;  3J80 Z;  1TQM A;  4KA4 A;  4KDP A;  2A68 F;  3WE2 A;  4HF2 A;  3L2C A;  1FZP B;  5F64 A;  1RZ4 A;  1IN5 A;  2F5D A;  2R3S A;  4HDU A;  1K7A A;  1ODD A;  2EJR A;  1XGN A;  3Q5F A;  3MWM A;  1U5T A;  1FOK A;  1FSE A;  2VOO A;  1QBJ A;  3N97 A;  5DCM A;  3F21 A;  1ZYR F;  3R4K A;  2KKO A;  2P5L C;  3SZP A;  1K6O A;  3AAF A;  2COM A;  4XRF A;  4UVA A;  3DV8 A;  2QQ9 A;  3BPV A;  2QQB A;  3QPH A;  3MFK A;  5IT9 K;  2O6G E;  1QZZ A;  2FBK A;  4ENK A;  1ON2 A;  1U3E M;  2ZCW A;  3GF2 A;  1OMI A;  2HR3 A;  1I1S A;  2PG4 A;  2A3S A;  1IF1 A;  3CUQ A;  3LST A;  2MH2 A;  2O8X A;  5HLI A;  2VE8 A;  4RS8 A;  1XDU A;  4BAY A;  4YFN F;  2L3D A;  1SD5 A;  2K4B A;  3FM3 A;  2NS0 A;  2D1V A;  3HOS A;  2QVO A;  1BM9 A;  2H27 A;  1L0O C;  1YTY A;  1RNL A;  5HS9 A;  1YW9 A;  3E6C C;  1FY7 A;  1ZG5 A;  2HQN A;  4HLX A;  4OOI A;  4EMS A;  2RNJ A;  1XSX A;  3KLN A;  4A2U A;  3EUH A;  3LQR A;  1U6G A;  4ETS A;  4G8X A;  2IA2 A;  4FT8 A;  2IA1 A;  4Q4Z F;  2DTR A;  5ICC A;  1LB2 A;  3E6B A;  1REP C;  4LD5 A;  2LSO A;  2YX4 A;  5D5W B;  4LK1 F;  3REO A;  1BIA A;  4IRH A;  3VEP A;  1P92 A;  3FXU A;  4UNO A;  4RGR A;  1FSH A;  2LF7 A;  4ON0 A;  4LB5 A;  4EJT A;  3ABU A;  5BOX A;  3I53 A;  4RB1 A;  1B4A A;  3E97 A;  3GFM A;  4IXA A;  1BI1 A;  3HRU A;  1UHM A;  4F7Z A;  2K7L A;  5JR3 A;  1T6S A;  3I71 A;  4HX7 A;  2ZBK A;  2JPC A;  2W57 A;  3J7A O;  1E17 A;  3JAM Z;  3G3Z A;  1U5T B;  5ICG A;  2JPB A;  3WTY C;  3IRQ A;  4HW0 A;  1TQP A;  2G7H A;  2DK8 A;  2VBZ A;  3P9I A;  3WGG A;  3HSE A;  3M9A A;  1T38 A;  1F9N A;  3CUO A;  3H92 A;  2CGP A;  3HRS A;  1OPC A;  5ERI A;  4OIR F;  1BBY A;  2BEO A;  5LEJ A;  1FX7 A;  5H20 A;  4LLG F;  5AIP A;  4RAY A;  2PFB A;  2XIG A;  1ZN2 A;  2MH9 A;  1XGM A;  1HKQ A;  5D8L B;  1D8K A;  1OYI A;  2A6H F;  3Q9S A;  3FXQ A;  2VOD A;  2HZT A;  1LQ1 A;  3LAP A;  2HQR A;  4A12 A;  4IPA A;  2GWR A;  4KIG A;  1C0W A;  2IT0 A;  1ZAO A;  3TQN A;  4RB3 C;  1R7J A;  1S29 A;  1XMA A;  1W7P D;  3GO5 A;  2XRN A;  3HYI A;  3GEZ A;  1KU3 A;  1R5H A;  3HSF A;  2GZW A;  1J9I A;  3PQJ A;  2A07 F;  1YS6 A;  4MHG A;  2DQL A;  2Q2E A;  1XN7 A;  2HKO A;  3WTX C;  4KIC A;  5EEH A;  4JQF A;  4XBF A;  2CYY A;  1KGS A;  2BGC A;  2EA4 A;  5FLX K;  3M1E A;  2HS5 A;  5CVU A;  2QBY A;  4LLN A;  1J59 A;  2QBY B;  4N0B A;  3CTA A;  4CDG A;  1ZG3 A;  4U7D A;  5DUI A;  4HV5 A;  5JHU A;  3ZMT A;  5HS8 A;  1ZHF A;  5E20 A;  3BZ6 A;  5LRS A;  1J5Y A;  3J81 Z;  2XRO A;  5D8K B;  1BOA A;  2ACJ A;  1RUN A;  2HYF A;  3N4M A;  3DPT A;  3BP8 A;  5CVV A;  2F5F A;  1Y0U A;  5ILS A;  3WGI A;  2H6C A;  1QZY A;  1CGP A;  2O3F A;  3H3U A;  2XUB A;  1FT9 A;  4FHT A;  3WG9 A;  2NNY A;  1ZGJ A;  2W85 A;  1YFH A;  1O7L A;  1K78 B;  1EH8 A;  2UZK A;  2FU4 A;  4NHJ A;  1W5T A;  2UXX A;  2KJB A;  3GWZ A;  1Z6T A;  4Q47 A;  2O61 A;  2ESH A;  2D2W A;  1TNT A;  3W6J B;  5LRR A;  3E5Q A;  4NB5 A;  1ZRF A;  2V79 A;  1MD0 A;  1BC8 C;  4ENN A;  2V1D A;  1A04 A;  2DW4 A;  2K4J A;  2VT3 A;  3RKY A;  3I0T A;  2P7V B;  4BQA A;  1DPU A;  4HA8 A;  2X0L A;  4OMY A;  2RGV A;  2YU3 A;  3KP5 A;  4L0Y B;  1QGP A;  5JFR A;  4P9U A;  2PMH A;  1BIB A;  1B1B A;  1I6X A;  4KYW A;  4L9J A;  1IRF A;  1SMT A;  1LNW A;  1OR7 A;  5BPD A;  2BBY A;  3M8F A;  3I64 A;  3I58 A;  2BE5 F;  1YW7 A;  2EA2 A;  4RGU A;  1IZ1 A;  1B59 A;  1EH7 A;  1WSU A;  3BPX A;  1D5V A;  2H6B A;  4OMZ A;  5L3C A;  3G73 A;  1HKT A;  3JSO A;  3BJ6 A;  4IRG A;  4KNY A;  3BY6 A;  2MD5 A;  1Z7U A;  2RKH A;  5F6F A;  2GXG A;  3R0A A;  5ILU A;  1EV7 A;  3LA3 A;  2XVC A;  1IN7 A;  2JSC A;  2CWE A;  1YIO A;  3CO7 C;  2Z3Y A;  4WX9 A;  1PP7 U;  4ZZL A;  2OBP A;  3GFJ A;  4ZYH A;  2WC2 A;  3WTT C;  1YG2 A;  2KIM A;  2L4A A;  2Y48 A;  3FMS A;  3R61 A;  4WXC A;  3MCZ A;  2VBX A;  3CJN A;  5A2Q Z;  5L3D A;  3WU0 A;  1W7P B;  1MJA A;  1TW3 A;  5J8C A;  4ASN A;  2VE9 A;  4Q48 A;  3HTU A;  5E8G A;  1UFM A;  4YG2 F;  2GAU A;  2WTE A;  2FE3 A;  2ZNY A;  4GGG A;  2NAZ A;  2FNA A;  2CG4 A;  1YW8 A;  3GW2 A;  2OQG A;  3TGN A;  1O57 A;  5LHG A;  5EEG A;  2EFP A;  3VOE A;  3O3K A;  3KLO A;  1TTY A;  4HOB A;  2VN2 A;  3KEO A;  4ENJ A;  3DP7 A;  1XSD A;  1ZRD A;  5L3F A;  2ISY A;  3J80 K;  2J5O A;  5LBQ A;  4HV6 A;  2AXL A;  2A5Y B;  3KZY A;  1JHF A;  3EDP A;  4IJA A;  3PFI A;  2FBI A;  4YFK F;  1GHC A;  2HWV A;  2DK5 A;  3DF8 A;  3E3V A;  4D0P A;  5E1W A;  2LF8 A;  4HLY A;  3U9G A;  4OIO F;  1UHW A;  4U7B A;  2P5V A;  1T39 A;  2RN7 A;  2HKX A;  1R1U A;  3FWE A;  4RGX A;  3WTV C;  3MEX A;  1ZGA A;  3IL2 A;  1ZLK A;  4G6D A;  4BHP A;  4YII A;  3F8N A;  3DEU A;  4Y13 A;  2FML A;  2M1B A;  4G7O F;  2L54 A;  2WV0 A;  1H9G A;  2XAS A;  5CYV A;  1LJ9 A;  1TLH B;  5D5U B;  3F3X A;  1Z05 A;  3ZMU A;  2ETH A;  5AON A;  3FZV A;  1KQ8 A;  1P2F A;  1IRG A;  4CYD A;  4KT5 C;  2VBW A;  2YSR A;  1XDS A;  1Q1H A;  3LWF A;  4Y17 A;  1FBQ A;  4FX4 A;  3FM5 A;  3LFK A;  2PN6 A;  1Z6R A;  2UWM A;  4I7H A;  1ZRE A;  1MDM B;  4AVP A;  2EB7 A;  1YO5 C;  2STW A;  2OD5 A;  1HSJ A;  1E2X A;  5DD4 A;  1CF7 A;  2RC4 A;  5F1R A;  3IRR A;  4WK8 F;  3O2P E;  1JGS A;  1BJA A;  2M5W A;  5J6X A;  3C7J A;  4HAM A;  2J5P A;  2DBB A;  1FBU A;  1FYL A;  2EFO A;  4Q5S F;  1QQI A;  4LFU A;  4CGZ A;  3HRM A;  1QNT A;  5FFZ A;  2Z9O A;  4MQV A;  3E5U A;  5E8I A;  5LHH A;  3RYP A;  2ELH A;  4R79 A;  3GVA A;  3F6V A;  1J2X A;  2F5E A;  3K1P A;  5LLQ A;  1G3W A;  1LVA A;  3F22 A;  1B9M A;  4RAZ A;  2ADU A;  3IKT A;  4KN7 X;  4BHB A;  4AWX B;  4JBA A;  3O6B B;  2H09 A;  1S7O A;  4LG0 A;  3D5L A;  1ON1 A;  5K5O A;  1BI0 A;  2QQA A;  5L3G A;  1F1Z A;  2EV0 A;  4CZZ A;  2K27 A;  3EET A;  1HW5 A;  4HQM A;  1D3Y A;  5LGU A;  4L9V A;  3EYI A;  3VB2 A;  4HX8 A;  1I27 A;  4HQE A;  2HTS A;  1WWX A;  2Z5U A;  1IAW A;  3SHF A;  3WTU C;  5K1Y A;  3F8B A;  4EJV A;  3ZPL A;  3I59 A;  4S04 A;  2XV4 S;  4L5I A;  2GQQ A;  1R5G A;  2F2E A;  1FYM A;  1OYY A;  1R1V A;  1G6N A;  4EM1 A;  3RTR A;  3V7R A;  4ZYD A;  3ELK A;  3DKW A;  2QWW A;  2PJP A;  1FP2 A;  3QPT A;  3SXY A;  1D8J A;  4WXH A;  4K2E A;  2FEZ A;  2FSW A;  3OV8 A;  3MQ0 A;  1AOY A;  1WQ2 A;  5AIQ A;  1IN4 A;  2NNN A;  2C6Y A;  5FLX Z;  1KYW A;  5L3B A;  3FX3 A;  3HSR A;  3H3Z A;  5BPI A;  3R0J A;  4G7H F;  4HX4 A;  4L0Z B;  2IVM A;  5HDG A;  1QPM A;  2FOK A;  2VOP A;  3TDU C;  2KRF A;  1S6L A;  2OU2 A;  2RV8 A;  3GX4 X;  1UST A;  3RYR A;  3IWF A;  3HIF A;  1TNS A;  2LDU A;  1T98 A;  1FLI A;  1MKM A;  1V4R A;  3ML6 A;  3RPQ A;  1IN6 A;  3GFI A;  1RUO A;  1IXC A;  1ULY A;  1B9N A;  3WTW C;  3QU3 A;  5ICE A;  3CO6 C;  1O3T A;  2EV5 A;  2QZ8 A;  3CDH A;  4I0A A;  2TDX A;  1H9T A;  3W6K B;  5E18 F;  4I01 A;  4I02 A;  2ZKZ A;  2ESN A;  4O3M A;  2IRF G;  2FXA A;  2ZFW A;  5H6Q A;  1SD4 A;  3ZMD A;  5HLH A;  3F8F A;  4GXO A;  3FHZ A;  3QP5 A;  4PDK A;  4UHT A;  2X4H A;  2QM3 A;  1IN8 A;  4I0B A;  1TW2 A;  4IRI A;  1J0R A;  2W25 A;  2GA2 A;  3P9K A;  4O6J A;  2PI0 A;  5DEQ A;  5HS7 A;  4ZH4 F;  4HF0 A;  3GFL A;  3ROU A;  1XSV A;  4I09 A;  4P5O A;  2PQ8 A;  3HTS B;  2YPR A;  4CXF A;  5FO5 A;  2GIV A;  2QEN A;  5LGN A;  2HOE A;  2HGC A;  5DDG A;  2F5C A;  2AS5 F;  3R60 A;  1MGT A;  2ZME B;  2Q0O A;  1YQA A;  4U0Y A;  2P7C B;  4UXN A;  1W7P A;  2HFH A;  2VT2 A;  1O3S A;  3NRV A;  4LG0 B;  1BI3 A;  4E70 A;  3V7C A;  1VTN C;  2HEO A;  3RDI A;  3ZN1 A;  4XLN F;  1USS A;  1SAX A;  1SMY F;  2JTV A;  3ZP5 A;  4MEX F;  2EWN A;  1TBX A;  4UV9 A;  3ZMS A;  2MLK A;  2E1N A;  3E6M A;  4HYE A;  1LEA A;  3F23 A;  1BI2 A;  1P4W A;  2RVC A;  1G3S A;  1LDK B;  2D45 A;  4LJZ F;  5BQT A;  1WI9 A; 
#chains in the Genus database with same CATH topology
 2EIL H;  3S14 J;  2EFN A;  1I1G A;  2H94 A;  2K02 A;  2DDA A;  1CF7 B;  3MAJ A;  2XAF A;  4XRS G;  4HNT A;  3PNT A;  4BEH A;  2QCO A;  3CCV I;  4A3J J;  1ITY A;  2DOA A;  1RI7 A;  2FBH A;  4O5V A;  2VQL A;  2YX7 A;  4CIC A;  2LY9 A;  3CJR B;  5HDK A;  1MNM C;  2XF7 A;  1Z1D A;  1T33 A;  3IV5 A;  2F4O B;  3TED A;  2AHQ A;  2QSG X;  3SQN A;  5KHD A;  1PUE E;  3R6S A;  4G7Z F;  3QOD A;  2HOA A;  5K7Z A;  5FLV A;  2VC1 A;  4EM2 A;  1T95 A;  5C3E J;  1NH3 A;  1R23 A;  4ZTF A;  2E2J J;  3DBR B;  2IBD A;  5FJ8 J;  4E7I A;  3SFZ A;  3ISP A;  2RQP A;  3BR3 A;  3ZMZ A;  2FRH A;  3FXR A;  1YYV A;  3OIO A;  3BR0 A;  3K0L A;  1JTX A;  3GTP J;  4OIN F;  4AC0 A;  3MZ8 A;  1I3Q J;  2QF7 A;  1IV6 A;  1HLV A;  4GO1 A;  4UVB A;  2LKS A;  4Y15 A;  4YEL A;  2XGX A;  3TO9 A;  2IXS A;  4P96 A;  4PUS A;  2GXB A;  5CQG A;  2DPU A;  2ME0 A;  4M9Z A;  3ABT A;  3EYY A;  4GYI A;  3GME A;  3WTZ A;  5D5V B;  3GLX A;  3I5U A;  5HLT A;  2K9Q A;  2W1O A;  4YRV A;  2HPM A;  3HOX J;  3BWG A;  2VIX A;  4M3E A;  3RKX A;  1XB4 A;  5D6E A;  4CO8 A;  4LLL A;  2DA4 A;  3FXK A;  5DYM A;  2FQ4 A;  4A0Z A;  2ZJP F;  4CZC A;  2KJC A;  4MGR A;  2OA4 A;  2FNP A;  1SVO A;  3KZZ A;  5KK1 A;  3HG9 A;  3V42 A;  1FOX A;  3K4M A;  3WGH A;  4A0X A;  2ZJR F;  4OIP F;  3VYR B;  5H2F C;  1FP1 D;  1PVE A;  2BV6 A;  1S9H A;  2DDB A;  1MBE A;  1XMK A;  1RR8 C;  1GT0 C;  2COB A;  1BL0 A;  1Y8R B;  3AL0 C;  2R7U A;  4DZP A;  2R7D A;  3HM5 A;  2X6W A;  4ITV A;  5K5Q A;  1X3U A;  2DT5 A;  3RPU A;  1SFK A;  3TL4 X;  1FBS A;  1P6R A;  4L9N A;  5BNG A;  3KFW X;  3QYE A;  1E3H A;  2F4M B;  3NEU A;  4RB2 C;  2BW3 A;  1XCV A;  1MBJ A;  2XAU A;  3TW6 A;  1VQN I;  4RAG A;  3JTH A;  4AIH A;  1ZR4 A;  2HOT A;  2RQQ A;  1Z91 A;  3FF5 A;  3M07 A;  3V4G A;  1SD6 A;  5CVJ A;  1K61 A;  2ZNZ A;  3CLO A;  1XCB A;  2CRG A;  1DGW Y;  3CDI A;  5DV5 A;  1PYV A;  2K9L A;  3H36 A;  1JXS A;  4B44 A;  2WY8 Q;  4KMF A;  2A69 F;  4YIF A;  5F04 A;  3QOP A;  4FX0 A;  5B1B H;  4J01 A;  3LMM A;  5DCM B;  3LAJ A;  1FNN A;  2EIK H;  2V1X A;  5EZG A;  1Z3Y A;  4XIC A;  1STZ A;  2OAZ A;  5DUK A;  1W0U A;  3CMY A;  1POG A;  4G94 A;  1MJ9 A;  3AG3 H;  4BGD A;  1UZC A;  3KEQ A;  1DPR A;  2P5K A;  1T56 A;  4KIF A;  4S0H B;  4C2T A;  4W1U A;  1A5J A;  5DM7 F;  1JHH A;  3LSK A;  1Z7L A;  3ZQQ A;  4CYC A;  2FJ1 A;  4BHC A;  1SFE A;  2QUF A;  2LRE A;  3WOD F;  1LEB A;  3KE2 A;  1R58 A;  1Y1W J;  3ECO A;  2JZY A;  4KMU X;  1UEL B;  5H6R A;  4WWC A;  4H0E A;  4KFC A;  4C3J J;  4ESB A;  3BTC A;  4QPQ A;  4L18 B;  2DQR A;  1FC3 A;  3LSP A;  1SFX A;  2NS8 A;  5TJJ A;  5FRN A;  1VF9 A;  3GZ5 A;  1G59 A;  3DFG A;  5IOY A;  4M9S A;  2KZG A;  1OFC X;  2IPQ X;  2UXN A;  2NRA C;  4WF2 A;  1WPK A;  2EFQ A;  2FA5 A;  3PNY A;  3GZ6 A;  2CUZ A;  3GTK J;  4JX4 A;  2HU9 A;  2BY2 A;  1ONV A;  1OCR H;  3JSP A;  2P0W A;  3DPL C;  1KYZ A;  2EQR A;  1QVT A;  2BYV E;  4RGS A;  4EJU A;  1LE8 B;  1IGN A;  2DPD A;  1SAN A;  3GLL A;  4XLP F;  5FFX A;  5EYR A;  1OCC H;  2X1D A;  1RET A;  1Z21 A;  3LA7 A;  2PBI A;  3FIW A;  2HTJ A;  3S2W A;  5M3F J;  2CQQ A;  4Y33 A;  5FKO A;  2RNG A;  2DLL A;  1ZAR A;  3MZH A;  2TRT A;  4B09 A;  2XHK A;  4II2 A;  5F0F A;  1JUS A;  3I4P A;  4R8H A;  3U1D A;  2O03 A;  5E17 F;  2CSO A;  3K69 A;  2IP2 A;  2RRE A;  4CCO A;  1UHS A;  1P4X A;  3OSG A;  3D0S A;  4Z2Y A;  4EVI A;  3FIS A;  5JVT A;  1ZLJ A;  5IT9 Z;  4RMN A;  5D4S A;  3B6C A;  4DYR A;  3IKV A;  4QWQ A;  4A5M A;  2FX0 A;  1X58 A;  3ERE D;  2X1C A;  3JAM K;  2MLG A;  4IHS A;  4AIK A;  4U0W A;  3SZT A;  3ZQ7 A;  3OYM A;  2V6C A;  2R7T A;  5BS6 A;  2WA0 A;  4MTD A;  4F93 B;  3C2B A;  2EIN H;  1OCT C;  2XGC A;  2JT1 A;  5E1X A;  4CCJ A;  3J7Z I;  3W2A A;  2OZ6 A;  3V8J A;  3KET A;  3T5X A;  2AQE A;  4I2O A;  1OCP A;  4L5J A;  1XGO A;  1DU0 A;  2BVL A;  1HDD C;  3DLL F;  1DDN A;  2GOX B;  2CUF A;  3S15 J;  3BR5 A;  4NQW A;  5TRD A;  4GDF A;  4BYY A;  2JN6 A;  3F6O A;  4UV8 A;  3HUG B;  4XOP A;  2V9V A;  3BDD A;  1Y8Q B;  3H35 A;  2A6E F;  2L4M A;  3GYH X;  2IGO A;  3V8K A;  3TOA A;  1U9N A;  5ILV A;  2OZU A;  5TGT A;  3T8T A;  3RCO A;  2CFX A;  1ZH5 A;  1S5L C;  6PAX A;  3JTG A;  2MG4 A;  2A5W A;  3A2K A;  4XR6 A;  4IL6 C;  3PNV A;  1MBF A;  2KIS A;  3F72 A;  3FMR A;  1U8R A;  2B0L A;  2Y75 A;  3K1N A;  3BCA A;  1JJ6 C;  1OIS A;  5DS9 A;  2CQK A;  4KN4 X;  4OU0 A;  1JT0 A;  3K4N A;  1VQ5 I;  2IJL A;  1AU7 A;  1ZGW A;  2A61 A;  1XX5 A;  2IA0 A;  2Z99 A;  3ECH A;  1SC7 A;  1GXP A;  2MGQ A;  4XOR A;  2LKP A;  4A3M J;  4X1E A;  2MBF A;  3J81 K;  3ZN0 A;  3T8R A;  2CUJ A;  3C18 A;  1OCO H;  3F8C A;  4WXD A;  2HQ5 A;  1MZB A;  1U0J A;  3NWT A;  2E1C A;  1Z67 A;  3GXO A;  4R1H A;  4EJW A;  2VC0 A;  3HOW J;  2D5V A;  1LFP A;  3DCF A;  4BE1 A;  3HC7 A;  2K85 A;  2JUC A;  1KQ9 A;  1ENH A;  3BTI A;  4CCK A;  2HNH A;  2MD0 A;  4XMY A;  1VQ9 I;  4DQ2 A;  1VQ4 I;  3WHC A;  1ZRC A;  4BXF A;  1UCR A;  1YS7 A;  4EGZ A;  1ZR2 A;  2W48 A;  3QAH A;  1LUJ B;  4U87 A;  3HPG A;  2E5N A;  2WAD A;  3HUG A;  1X2N A;  2E36 A;  2I10 A;  2MA3 A;  1G3T A;  4BDY A;  3M7G A;  1KQ0 A;  2M8G X;  1ETK A;  1SFU A;  3EQL F;  3UKG A;  3K9T A;  1YRN B;  4LMY A;  2ZXI A;  4A3C J;  1GLN A;  3LSI A;  3SJM A;  3WTS C;  1RIO H;  4BBR J;  3C3W A;  3E5X A;  1N75 A;  5GAE J;  2JQ7 A;  5M5X J;  4XQF A;  2P8T A;  4IO9 F;  1L3L A;  2PMZ A;  5FLM J;  1A35 A;  1N25 A;  4PJ0 C;  1AWC A;  2IS6 A;  2W84 A;  3ZMV A;  1GVJ A;  1DUX C;  3IWZ A;  3L00 A;  4LOC A;  3DTK A;  2M87 A;  3ULQ B;  3BJO A;  2B9S A;  4OIQ F;  2M30 A;  2V9K A;  2WY7 Q;  3MKY B;  2JSP A;  3LQQ A;  2JRM A;  2V7F A;  3QRF F;  5LEK A;  1R6R A;  1RPW A;  4HST A;  1GDT A;  1X1C A;  4M74 A;  1MMS A;  3OYA A;  3HGY A;  2IAI A;  3KIO A;  3KP7 A;  1QPI A;  2ZME A;  3OYF A;  2STT A;  4BKX A;  4Z6Y A;  2P4W A;  2D1H A;  1R9T J;  2AXT C;  3CUQ B;  3IC7 A;  4XID A;  1BC7 C;  3K10 A;  1Z3X A;  3VOD A;  2JA5 J;  5CVI A;  5BMZ A;  4CHU A;  5J40 A;  3LA2 A;  5A2Q K;  5IY5 H;  2OJE D;  2LVS A;  4IOC F;  4OWR B;  5F08 A;  3BG7 A;  1K79 A;  3MZY A;  3OIP A;  2WWY A;  1FPQ A;  3BR2 A;  5CJ9 A;  3TMO A;  2PJR A;  3QP6 A;  3CF5 F;  2JVG A;  1T0F C;  3TO7 A;  2R7F A;  3BZC A;  1Z0X A;  2KDO A;  3OIQ A;  3TO6 A;  5FB2 A;  2LRD A;  5EF6 A;  2EK5 A;  3HHH A;  1P9Q C;  2ECC A;  4PJL A;  5J47 A;  2EV6 A;  3OYL A;  2V1N A;  9ANT A;  2M8E A;  2DMQ A;  2HPI A;  3FKI J;  1LE8 A;  5GPC A;  3O8G A;  1S7A A;  2EZH A;  3V7S A;  4N9H A;  5LGT A;  3X2Q H;  1I5Z A;  3OR2 C;  5D5X B;  3ZQG A;  4LB6 B;  3RKW A;  1W36 C;  5CVR A;  4XSX F;  2IEK A;  1A31 A;  4PK4 A;  2KIQ A;  1GXQ A;  2ZC2 A;  1VQO I;  5HOO A;  3UR3 C;  2IS2 A;  1HQC A;  2E35 A;  2A05 A;  1O7F A;  3HRT A;  4Y4R A;  4ESF A;  5HDN A;  4X0G A;  3QOE A;  3H1C A;  3QQA A;  4PJM A;  3RKQ A;  2XAQ A;  3KZI C;  4YEJ A;  1WCM J;  1RKW A;  4ZYG A;  4F91 B;  5ICF A;  2VBY A;  4XKV A;  4PCQ A;  4UUS A;  2OV7 A;  3K2A A;  3P7N A;  3JRA A;  1R36 A;  1W4M A;  1B72 A;  3FDY A;  4G9Y A;  4M6V A;  2LYC A;  1UG0 A;  2O0Y A;  1SVL A;  1MDM A;  3I54 A;  3CP8 A;  1TWF J;  4EV0 A;  5HLG A;  2PMU A;  5KVR A;  1V3F A;  2EBI A;  4E7S A;  3AL0 B;  2IGM A;  3BLY A;  1B8I A;  1P7J A;  1HXD A;  2OTL I;  2Z33 A;  4MEY F;  3HL2 A;  1X4O A;  3K1M A;  1T8I A;  3M3Y J;  4HZF A;  4JK1 X;  5LD2 C;  1YLF A;  3G71 I;  4XRS A;  3E7L A;  5HVQ C;  1U78 A;  3S1N J;  4LIU A;  4AD9 A;  1XGS A;  3K2Z A;  1AKH A;  4TV7 A;  4M6X A;  2OQR A;  1SFO J;  3KP6 A;  2KDZ A;  1ZK8 A;  2YR2 A;  2Y0M A;  3TP3 A;  4XL9 A;  3DTI A;  1LDD A;  1U5T C;  4G6Q A;  1JE8 A;  5IT3 A;  3K4K A;  1X1D A;  1PP8 F;  2KIF A;  1PJR A;  1H0M A;  2W4S A;  1BN5 A;  3GUD A;  2M0C A;  1TZL A;  1GV5 A;  1G4D A;  3O8H A;  2ZJQ F;  4JYK A;  3NAU A;  2FF4 A;  1KU7 A;  4M73 A;  4UUV A;  3IHU A;  4HBL A;  4XRM A;  2BXZ A;  2XAH A;  3U1K A;  4JX6 A;  4L9T A;  4U88 A;  3KP2 A;  1FYK A;  1JKR C;  4DYQ A;  2L9V A;  1Y39 A;  4BS9 A;  2F6C A;  5ED4 A;  3CZ6 A;  4PSW A;  4BDZ A;  1OQY A;  2R5Y B;  3T0Y A;  3A02 A;  3HPH A;  3RI4 A;  3DU5 A;  4UB6 C;  2HYG D;  4DYC A;  1YX3 A;  2CW0 F;  3MMY B;  3CUQ C;  3JRD A;  3F8M A;  4FE7 A;  1O3Q A;  2ISZ A;  4A0Y A;  1A6I A;  1YHQ I;  3L2R A;  2VL8 A;  4DOZ A;  3DQV C;  1KON A;  1NHA A;  2DMN A;  3B73 A;  1B72 B;  4BY7 J;  2VJJ A;  5J8F A;  5LHI A;  3NQO A;  4FTH A;  1O3R A;  3S17 J;  1KA8 A;  5K5R A;  2W24 A;  4PFP A;  1HST A;  2XKO A;  3L09 A;  2DA1 A;  1TQI A;  2MC3 A;  5GPA A;  5DD8 A;  4PFO A;  2ZO4 A;  4XNF A;  3RJP A;  5FD6 A;  3CCE I;  1QRY A;  3I4N J;  3DXJ F;  3JW4 A;  1FIA A;  2V6E A;  4WCG A;  3PO3 J;  1EH6 A;  3BOQ A;  5E3M A;  3M8E A;  2P6S A;  3ZQL A;  5CLS A;  1R4N B;  4B4C A;  4GYG A;  1IUY A;  5FD5 A;  4KUM A;  1E3O C;  1R22 A;  3TOB A;  1Z9C A;  2KP6 A;  4XSZ F;  4MO7 A;  2BXY A;  4PZJ A;  4P55 A;  2LR8 A;  4BXX J;  5CQE A;  5EGO A;  5F0C A;  3CCR I;  4LGW A;  4X6A J;  1EF4 A;  2BVM A;  2M45 A;  3FBN B;  5E1Z B;  2GXA A;  3AFH A;  4BQN A;  1FWZ A;  3L7W A;  4B3A A;  4YFX F;  5KAI C;  4BXU A;  1I39 A;  1I3A A;  2R7W A;  1CQT A;  1MMG A;  2BZT A;  1TP4 A;  2PLY A;  4HF1 A;  3KP3 A;  2K86 A;  1MJB A;  3OYJ A;  3DLA A;  1DP7 P;  2CO5 A;  3W3C A;  3QU6 A;  3LFU A;  3PQK A;  4S05 A;  3I59 B;  1HW2 A;  4PGH A;  1HBX G;  4NBQ A;  2XKP A;  1PDN C;  3L9F A;  3M8J A;  4A69 C;  4BNC A;  4A5N A;  4UVC A;  3VFZ A;  2E7X A;  2XPW A;  4PGG A;  1IUF A;  1KU2 A;  2K3F A;  1QVU A;  4BH9 A;  1NK2 P;  3P9C A;  1HW1 A;  4XLC A;  1J7K A;  3ZRG A;  3C1D A;  2WB1 A;  3B6A A;  3TKY A;  2V1U A;  4ENM A;  1NTC A;  2E7W A;  2GOM A;  1JT6 A;  2QLZ A;  1IW7 F;  5FKK A;  3WU1 B;  1BR2 A;  4FE4 A;  4CCM A;  3FMQ A;  2QKL B;  1ZKG A;  1EKE A;  2VXZ A;  2WB1 N;  4MNU A;  3OL3 A;  3ZQH A;  2CV0 A;  1WFX A;  2DAO A;  4HPQ A;  5KAF C;  3RIR A;  4DW6 A;  2G7U A;  1S7E A;  3TBI A;  1P4A A;  3FBI B;  3HJE A;  1R00 A;  4KIB A;  2O8K A;  3FK6 A;  2DI3 A;  4P9F A;  2QQ8 A;  3K4J A;  4A6D A;  1PUF A;  1SD7 A;  2M7B A;  3TDZ C;  4EQQ A;  1F4K A;  2E71 A;  3OYB A;  2DTZ A;  3K4L A;  3LSR A;  2K40 A;  4P1W A;  4BU2 A;  4U0V A;  2IS4 A;  3Q0V A;  2DFI A;  3DWL E;  3DEE A;  5EJC A;  1IXR C;  2ME6 A;  4V2F A;  1KU9 A;  3KP4 A;  3ZR8 X;  3WE3 A;  4ESJ A;  2P6T A;  3KCC A;  5JI6 A;  2R5Z B;  3FXO A;  2JA6 J;  2QYO A;  1G3Y A;  1E0E A;  1QA6 A;  1JGG A;  5L3E A;  3RSN A;  4N9I A;  4QLC U;  1R1T A;  3BJA A;  4EGY A;  1T2K A;  3A03 A;  5JLX A;  2IW5 A;  2XAJ A;  3E6D A;  2DO7 A;  4M71 A;  2R7Q A;  1OYW A;  2DT7 B;  3S1M J;  5EEA A;  1WJA A;  4A6E A;  3IP4 B;  5D6F A;  1XTA A;  3U2R A;  2EFW A;  2JWT A;  3MN2 A;  2Q8K A;  1NK3 P;  2ZXJ A;  4AIJ A;  2WAE A;  3H5N A;  3OYH A;  1S3J A;  4ZYE A;  4XLF A;  2FQ3 A;  2E60 A;  3S1R J;  2R7O A;  2L02 A;  3S2D J;  2R5Y A;  1UB9 A;  3T1B A;  4IVN A;  3VDX A;  3MKL A;  1WKM A;  4NNJ A;  4IHT A;  1HKS A;  2ZJ2 A;  5GTH C;  1OKR A;  2G9W A;  2AQF A;  1VQM I;  1F5T A;  2R7R A;  3QPL A;  4ANJ A;  2IGN A;  3MVP A;  1ETV A;  5B5E C;  1IDY A;  3HHG A;  5CPR B;  4B8X A;  3LSJ A;  4B1R A;  1IXS B;  2MAB A;  4MQ9 F;  2CS3 A;  3COA C;  5D4R A;  1K78 A;  2L01 A;  3HKZ N;  1XD7 A;  4I98 B;  4UY8 I;  2LK2 A;  4GCV A;  2DT6 A;  3BRO A;  2GA1 A;  3V8L A;  4B47 A;  4BUP A;  2EZL A;  4EM0 B;  4ZZD A;  3VPR A;  4DNC A;  2N8G A;  2KIU A;  4M9X A;  1W5S A;  2X6Y A;  1TC3 C;  5DCF A;  1TWG J;  3OOP A;  2JRT A;  1YIT I;  5FRO A;  3HOT A;  1WRJ A;  3ESW B;  1QHH D;  3B02 A;  2CW8 A;  4XN3 A;  4MTE A;  2RDP A;  3Q9V A;  4M6Y A;  2QEX I;  4HDV A;  3OR1 C;  1YJ9 I;  2FMY A;  1J09 A;  1B6A A;  4GFB A;  4IF4 A;  5C4X J;  5FGM A;  3G6E I;  2VON A;  4RM3 A;  2XAG A;  2X51 A;  1ZG1 A;  3L2Q A;  2DU9 A;  2JA2 A;  1J75 A;  2NYX A;  1LPQ A;  2HVQ A;  2DN0 A;  4M72 A;  4EJO A;  1S8N A;  1U2W A;  3S93 A;  1K83 J;  4RB0 A;  1LDJ A;  2LNB A;  4LK0 F;  2PEX A;  2NOJ B;  1QO0 D;  3OYK A;  1HC8 A;  1T0F A;  2HDC A;  3J80 Z;  1TQM A;  1W0T A;  2DOD A;  4KA4 A;  4KDP A;  2A68 F;  2W00 A;  3WE2 A;  3IAS 2;  4HF2 A;  3L2C A;  1FZP B;  1JUM A;  1RZ4 A;  3GCM A;  5F64 A;  1IN5 A;  3CME I;  2JMW A;  2F5D A;  2R3S A;  1IRX A;  2K3P A;  3L2V A;  1TL8 A;  1UMQ A;  2EIM H;  2Y9Z A;  4HDU A;  1OJL A;  3M1C A;  1K7A A;  1V55 H;  1FTT A;  2MC4 A;  1M1E B;  4ZYA A;  1ODD A;  2EJR A;  4UUS B;  1XGN A;  3Q5F A;  3IH2 A;  2CUE A;  1BA5 A;  5IYB J;  1FTZ A;  5J3L A;  4AYB N;  3MWM A;  1U5T A;  2GM4 A;  5GAH J;  1FOK A;  2WV1 A;  2HXO A;  1XPX A;  1FSE A;  2VOO A;  1MMA A;  1X1P A;  1QBJ A;  5J1U A;  3N97 A;  5DCM A;  3F21 A;  2KL4 A;  1ZYR F;  3R4K A;  1WZ2 A;  2KKO A;  3S3N A;  4BY1 J;  1IDZ A;  2P5L C;  3SZP A;  1UJ8 A;  2JK3 A;  3AAF A;  1K6O A;  2COM A;  2ZXH A;  4XRF A;  3LNQ A;  4UVA A;  2VLA A;  3DV8 A;  4B3X A;  2R7V A;  3HDD A;  2QQ9 A;  2DMU A;  3BPV A;  2QQB A;  3QPH A;  1S72 I;  1ORK A;  3MFK A;  5IT9 K;  2O6G E;  1QZZ A;  2FBK A;  4ENK A;  1ON2 A;  1U3E M;  2ZCW A;  3BQY A;  3GF2 A;  1OMI A;  2HR3 A;  3OWT A;  1I1S A;  4MFE A;  2PG4 A;  4RDU A;  2A3S A;  1IF1 A;  3CUQ A;  3LST A;  4AID A;  4RA2 A;  2MH2 A;  2O8X A;  5HLI A;  2VE8 A;  2XSJ C;  4I99 C;  3I55 I;  4RS8 A;  1SEU A;  2NXN B;  1ZEL A;  3HKZ A;  4OAY A;  1XDU A;  4BAY A;  3K7A J;  4YFN F;  3LL7 A;  2L3D A;  1SD5 A;  2K4B A;  3FM3 A;  2NS0 A;  2D1V A;  3HOS A;  2QVO A;  3JR9 A;  4LIV A;  1BM9 A;  2H27 A;  1L0O C;  2F4I A;  1YTY A;  1RNL A;  3H9G A;  2KQR A;  5HS9 A;  3TW7 A;  1YW9 A;  3E6C C;  4IHV A;  1FY7 A;  1ZG5 A;  2JA7 J;  2HQN A;  3BR6 A;  4HLX A;  2VI6 A;  4IHW A;  4OOI A;  1BR1 A;  1IC8 A;  4EMS A;  3Q0U A;  2DOE A;  2RNJ A;  1WJF A;  1W1W E;  1QZE A;  2W82 A;  4RAF A;  1XSX A;  2LFB A;  1PUF B;  4BBS J;  1VND A;  3KLN A;  4A2U A;  3DKY A;  3EUH A;  3PUF A;  3LQR A;  1G8X A;  1U6G A;  3ERM A;  4BJ6 C;  4HNV A;  4ETS A;  1U8B A;  4G8X A;  2BY1 A;  2IA2 A;  4FT8 A;  3CCJ I;  1X19 A;  3S8P A;  2TCT A;  2IA1 A;  4Q4Z F;  3ASO H;  2DTR A;  1N77 A;  5ICC A;  1LB2 A;  3E6B A;  2V4J C;  1REP C;  1VFC A;  4LD5 A;  2LSO A;  2YX4 A;  5D5W B;  4LK1 F;  3REO A;  1HOM A;  1R5I D;  3ONQ A;  3BQZ A;  1BIA A;  1QHG A;  3NWS A;  4IRH A;  4DZJ A;  1R49 A;  3VEP A;  2EH3 A;  3FXU A;  1P92 A;  1V5E A;  3KPH A;  1QU3 A;  4UNO A;  2VQH A;  4RGR A;  3FK7 A;  1FSH A;  4M3F A;  3CQZ J;  2LF7 A;  4ON0 A;  4LB5 A;  2F5V A;  3JRH A;  3ABU A;  4EJT A;  1YX5 A;  3I53 A;  5BOX A;  4RB1 A;  2X9D A;  1MSF C;  3OYG A;  1VQ7 I;  3L1P A;  1B4A A;  3E97 A;  4NC6 A;  4XON A;  2DA3 A;  3K70 C;  3H3V K;  3GFM A;  4IXA A;  1BI1 A;  4A3G J;  3HRU A;  1UHM A;  2CFO A;  1ZQ3 P;  1DQU A;  4F7Z A;  2K7L A;  5JR3 A;  1T6S A;  3I71 A;  4YIR X;  4FIS A;  1EJ9 A;  4HX7 A;  4C9Y A;  2ZBK A;  2JPC A;  2W57 A;  5JLW A;  3HBL A;  5C4J J;  2W7N A;  2VB6 A;  3J7A O;  3OOU A;  2XGD A;  3PUB A;  1E17 A;  4FCY A;  3JAM Z;  1MMN A;  3G3Z A;  1U5T B;  5ICG A;  2JPB A;  3WTY C;  3IRQ A;  5J4V A;  4IHX A;  2LBF B;  4HW0 A;  2XPU A;  1TQP A;  2UUZ A;  2G7H A;  2DK8 A;  1JKP C;  2VBZ A;  3P9I A;  4QIW N;  5M3M J;  3W2V A;  4D7M A;  2OCC H;  3WGG A;  3BTJ A;  3HSE A;  2L7M P;  3GTG J;  3M9A A;  2M34 A;  4C3H J;  4NUB A;  3JRI A;  1D1C A;  1F9N A;  3QYB A;  4C30 A;  2NS7 A;  1T38 A;  3CUO A;  3PFY A;  3H92 A;  3HOV J;  2CGP A;  3HRS A;  4NDL A;  5GTI C;  1MND A;  1OPC A;  2Y9Y A;  4IQJ A;  4NC7 A;  5ERI A;  4PJN A;  4OIR F;  2CQX A;  1BBY A;  2BEO A;  3FKJ A;  5LEJ A;  3OYN A;  1FX7 A;  3JRG A;  5H20 A;  4RM2 A;  1DU6 A;  3GTL J;  1VQP I;  2FUG 2;  3KYC B;  4LLG F;  3HEF A;  5AIP A;  4RAY A;  2PFB A;  2V9P A;  2XIG A;  1ZN2 A;  4RBO A;  2MH9 A;  1IJW C;  1D0X A;  3BZK A;  4XM3 A;  1XGM A;  5KNL A;  1JKQ C;  3VYT B;  2ID3 A;  3LOC A;  1HKQ A;  5D8L B;  1D8K A;  3GBG A;  1OYI A;  3A0H C;  3SEQ A;  2A6H F;  3Q9S A;  3FXQ A;  2VOD A;  2HZT A;  1LQ1 A;  3LAP A;  2HQR A;  4A12 A;  1ETO A;  5HNF A;  4IPA A;  2GWR A;  4MLO A;  4KIG A;  3EUK L;  1C0W A;  3FXM A;  3JCU C;  2IT0 A;  1ZAO A;  3TQN A;  4RB3 C;  4D1Q A;  2Y30 A;  5B3S H;  1R7J A;  1S29 A;  1WJC A;  1XMA A;  1W7P D;  1D5Y A;  2Q1Z B;  3QPS A;  4XOT A;  3GO5 A;  4I6Z A;  2XRN A;  3S2H J;  3E1S A;  5K7H A;  3HYI A;  3GEZ A;  1KU3 A;  1R5H A;  2DJI A;  2XF5 A;  4N4O B;  3HSF A;  4IOA F;  2GZW A;  3F0C A;  2K5C A;  3LSG A;  5IPA A;  1HF0 A;  1J9I A;  3PQJ A;  2A07 F;  2L9R A;  1YS6 A;  4MHG A;  2DQL A;  2Q2E A;  4FET A;  1XN7 A;  2HKO A;  3CCU I;  3WTX C;  4KIC A;  1VQ6 I;  4Y3O A;  5EEH A;  4JQF A;  2DA7 A;  3H0G J;  3J7A Y;  4XBF A;  1T08 B;  2CYY A;  1KGS A;  2BGC A;  2XDV A;  2EA4 A;  1JKO C;  3RZO J;  5FLX K;  3M1E A;  2HS5 A;  3SEZ A;  2KMU A;  5CVU A;  1A6Q A;  4KJZ A;  2QBY A;  3S3O A;  3W6V A;  4LLN A;  1R71 A;  3BC8 A;  2NVQ J;  3IUO A;  3OL4 A;  1J59 A;  4CSW A;  2P81 A;  1KZH A;  1K4S A;  2QBY B;  2Y69 H;  4N0B A;  2R7X A;  3SDG A;  1FOY A;  3CTA A;  4JP0 A;  4CDG A;  1FOW A;  1ZG3 A;  1WJB A;  5DUI A;  4U7D A;  5EG0 B;  3HXL A;  4HV5 A;  4A93 J;  2L7F P;  5JHU A;  4DBQ A;  3CJQ B;  2BY0 A;  2OTJ I;  1H88 C;  3ZMT A;  5IOZ A;  2DCE A;  5HS8 A;  2OUM A;  1ZHF A;  1YE9 A;  5E20 A;  3BZ6 A;  5LRS A;  1J5Y A;  3J81 Z;  1V54 H;  2KRC A;  2XRO A;  5D8K B;  1BOA A;  2RAE A;  4IHY A;  5E79 C;  2ACJ A;  1RUN A;  4V19 K;  2HYF A;  3N4M A;  3DPT A;  4AYB A;  3BP8 A;  5CVV A;  2F5F A;  2CU7 A;  1MW7 A;  1Y0U A;  5ILS A;  3WGI A;  2H6C A;  4RLQ A;  3K4B A;  3OS2 A;  4A3I J;  1QZY A;  1RKT A;  1WJD A;  1JUP A;  1CGP A;  2O3F A;  4C2M J;  4HRI A;  1AHD P;  4IEJ A;  3H3U A;  2XUB A;  4J00 A;  2L7Z A;  3PM1 A;  3HGG A;  4CCL A;  3HOY J;  1FT9 A;  1ACI A;  3BT9 A;  2HZD A;  2VKD A;  2Y2Z A;  3CCQ I;  4FHT A;  4AVZ A;  3WG9 A;  3ABL H;  1JTY A;  4KIT B;  2WAQ N;  2ZXW H;  4BQQ A;  2NNY A;  1ZGJ A;  2W85 A;  1YFH A;  1O7L A;  3L2W A;  3JRC A;  4KIS A;  1K78 B;  1G2H A;  1EH8 A;  2LMD A;  2UZK A;  2XB0 X;  2FU4 A;  3JRB A;  2QKM B;  3M4O J;  4NHJ A;  1W5T A;  2UXX A;  2KJB A;  3HZJ A;  3S3M A;  3GWZ A;  3Q0W A;  1NG7 A;  3I4M J;  1Z6T A;  2VQG A;  4Q47 A;  4ZDL A;  3S16 J;  2O61 A;  2YS9 A;  2ESH A;  4EAT A;  1XMX A;  2X1E A;  1WHU A;  2D2W A;  3AG1 H;  1TNT A;  1N78 A;  3W6J B;  3CMA I;  5LRR A;  1XC5 A;  2XB5 A;  5GP9 A;  2MYS A;  3E5Q A;  4NB5 A;  1ZRF A;  2V79 A;  1GV2 A;  2NVU B;  1MD0 A;  3ZOB A;  4C3I J;  1RR7 A;  1BC8 C;  2DOF A;  1MNE A;  2V1D A;  4ENN A;  1SAU A;  1A04 A;  2DW4 A;  2K4J A;  3QYF A;  2VT3 A;  4HEA 2;  2LG4 A;  3RKY A;  3I0T A;  1D0Y A;  4A3B J;  1APL C;  3DEW A;  3CF2 A;  2P7V B;  1ETX A;  2R0Q C;  1GUU A;  2KLO A;  3EUH C;  1E3P A;  3I9V 2;  4BQA A;  2DMP A;  1DPU A;  1MH4 A;  4LIT A;  3BG9 A;  4HA8 A;  2X0L A;  4E4H A;  2RGV A;  2YU3 A;  3G1M A;  3KP5 A;  4OMY A;  4L0Y B;  3RQ4 A;  3SZG A;  2HQA A;  1V5F A;  1QGP A;  5JFR A;  4P9U A;  2VXD A;  3OYD A;  2PMH A;  2XSD C;  1VQK I;  1BIB A;  1B1B A;  2NOG A;  1I6X A;  4KYW A;  4KT6 A;  1IRF A;  1DGR M;  2E1M B;  4L9J A;  1SMT A;  2KPM A;  1K6Y A;  1LNW A;  4M3B A;  4G6T B;  2CV2 A;  1OR7 A;  3DPU A;  5BPD A;  2BBY A;  4CH7 A;  2OF7 A;  3M8F A;  2G0E A;  3I64 A;  3CCY A;  3I58 A;  2BE5 F;  1YW7 A;  2EA2 A;  1W36 D;  2HDW A;  4RGU A;  4D7N A;  1IZ1 A;  1B59 A;  2UV1 A;  4BEH B;  1EH7 A;  3PJR A;  1WSU A;  3BPX A;  1D5V A;  2H6B A;  3A1Y A;  3IAM 2;  4OMZ A;  5IYD J;  5L3C A;  2VJ5 A;  2L5Q A;  3G73 A;  1HKT A;  3ZCO A;  3TP0 A;  3JSO A;  2ELK A;  3BJ6 A;  3MD2 A;  2DA6 A;  5JVG F;  1RRJ A;  4IRG A;  4KNY A;  3BY6 A;  1BJZ A;  2MD5 A;  3EPZ A;  1Z7U A;  1F43 A;  2RKH A;  5F6F A;  2GXG A;  2XPV A;  3R0A A;  5ILU A;  4DIQ A;  1EV7 A;  3LA3 A;  4PJJ A;  3DBL B;  3GTJ J;  2XVC A;  1IN7 A;  2JSC A;  1IV8 A;  1FMV A;  1LKX A;  1YIO A;  2CWE A;  4NQW B;  3BR1 A;  1BW6 A;  3CO7 C;  2Z3Y A;  4WX9 A;  1PP7 U;  2EZK A;  5F27 A;  4ZZL A;  2OBP A;  2ID6 A;  3GFJ A;  4ZYH A;  2WC2 A;  3A01 A;  3WTT C;  1YG2 A;  2KIM A;  2L4A A;  2Y48 A;  3FMS A;  3R61 A;  3WU2 C;  4E6K G;  4WXC A;  3PL8 A;  3D1N I;  3MCZ A;  4V2G A;  2VBX A;  2VJ4 A;  3CJN A;  4AU7 A;  5A2Q Z;  5L3D A;  3WU0 A;  1W7P B;  2XGE A;  1MJA A;  2CQN A;  2R92 J;  1ETQ A;  1WH7 A;  1TW3 A;  5J8C A;  4E7K A;  4A3D J;  2AO9 A;  5DTD A;  3FXJ A;  4ASN A;  1K4T A;  2VE9 A;  5F1J A;  4D5C A;  4IQ4 A;  3DU6 A;  2ZME C;  4EEF G;  4Q48 A;  3HTU A;  5E8G A;  1UFM A;  2ZFU A;  4MFD A;  3CC7 I;  4YG2 F;  2GAU A;  3K70 D;  3ZXS A;  1YI2 I;  2WTE A;  2FE3 A;  2ZNY A;  3ABM H;  3P5J A;  2DYS H;  4GGG A;  2NAZ A;  3C2H A;  3MKW B;  2M9H A;  2BHY A;  2FNA A;  2CG4 A;  3C2G A;  1YW8 A;  3GW2 A;  2OQG A;  2EPF A;  4CYC B;  4PSX A;  2H1L A;  1V5G A;  3G1O A;  4C2U A;  1WVR A;  3H5A A;  2HVR A;  1D1B A;  1UG2 A;  3TGN A;  2CW7 A;  1OR7 C;  2GIZ A;  3BG6 A;  1BR4 A;  2O7O A;  1O57 A;  5LHG A;  2LY2 A;  5EEG A;  3ZQI A;  2EFP A;  1ETY A;  1DP3 A;  3CP2 A;  3VOE A;  3CCS I;  2H8R A;  1R4M B;  3O3K A;  3G2B A;  2Y31 A;  2Q2E B;  3KLO A;  2MW8 A;  3SFI A;  1TTY A;  4XKB A;  3PSF A;  2QA4 I;  5IP7 J;  3FHN A;  4FQG A;  1MIJ A;  4HOB A;  2ZSH B;  2VN2 A;  3KEO A;  4BJ5 C;  4ENJ A;  3J7Y J;  2PJR B;  2DMT A;  3DP7 A;  3G4S I;  1XSD A;  1ZRD A;  1XS9 A;  5L3F A;  2KZV A;  5FKN A;  2ISY A;  3J80 K;  2J5O A;  2IGK A;  4HV6 A;  5LBQ A;  2AXL A;  2A5Y B;  3KZY A;  2H1K A;  1JHF A;  1Z77 A;  3EDP A;  4IJA A;  1VQ8 I;  4CCN A;  3PFI A;  2FBI A;  4YFK F;  2B63 J;  2VKH A;  1XG1 A;  1GHC A;  3CES A;  4BE2 A;  2HWV A;  4D5F A;  2DK5 A;  4N4N B;  2XC7 A;  1TT5 B;  2X6O A;  3DF8 A;  3CCL I;  3QWL A;  3E3V A;  4D0P A;  1X1A A;  5E1W A;  2LF8 A;  1I50 J;  2JUG A;  4HLY A;  3U9G A;  4OIO F;  1UHW A;  4U7B A;  2P5V A;  2VUM J;  3S1Q J;  3U21 A;  1T39 A;  2RN7 A;  3GTO J;  3OSF A;  2HKX A;  3WHB A;  1R1U A;  3FWE A;  1P7I A;  2OPT A;  4RGX A;  4F92 B;  5IP6 A;  2I8D A;  3BG3 A;  3WTV C;  1IO2 A;  1W5C C;  3MEX A;  1B8I B;  4J19 A;  1ZGA A;  3D5S C;  3IL2 A;  2DFH A;  2KT0 A;  1ZLK A;  1YIJ I;  4G6D A;  4BHP A;  1H8A C;  2LY1 A;  4YII A;  2E19 A;  3A01 B;  2DA2 A;  3VYU B;  1VZ0 A;  3F8N A;  2DYR H;  3VYS B;  2ECB A;  3DEU A;  4Y13 A;  2FML A;  2M1B A;  4G7O F;  2L54 A;  3LSH A;  1UAA A;  1FIP A;  2WV0 A;  1H9G A;  2XAS A;  2HYJ A;  2KRH A;  5CYV A;  1LJ9 A;  4QSH A;  5M5Y J;  4G12 A;  2M3A A;  1TLH B;  5D5U B;  2CH0 A;  3SYT A;  3VWB A;  1D1A A;  3F3X A;  5J1R A;  1Z05 A;  3ZMU A;  4F3Q A;  3OS1 A;  2ETH A;  5AON A;  1TWA J;  3FZV A;  1MMD A;  3S32 A;  1KQ8 A;  2V26 A;  2LBF A;  1P2F A;  4HNU A;  1IRG A;  5FKL A;  4CYD A;  5JHF A;  4KT5 C;  2VBW A;  2YSR A;  5LFA A;  1MBG A;  1LVK A;  1XDS A;  1Q1H A;  3LWF A;  3N05 A;  2CJJ A;  2NVX J;  4Y17 A;  1FBQ A;  3VSK A;  4FX4 A;  3FM5 A;  1JI8 A;  3LFK A;  5FRM A;  2PN6 A;  3NAR A;  1Z6R A;  2UWM A;  4I7H A;  1ZRE A;  1MDM B;  4HSR A;  3CCM I;  4Y52 J;  2X6X A;  4AVP A;  2EB7 A;  1YO5 C;  4I76 A;  2EZI A;  2FOW A;  1Y0N A;  2STW A;  3PO2 J;  2OD5 A;  2R7Z J;  2X48 A;  1HSJ A;  4F52 A;  3K6G A;  1E2X A;  3OYC A;  5DD4 A;  3OYI A;  1CF7 A;  2RC4 A;  5EG0 A;  2KHM A;  5F1R A;  1D0Z A;  5J1Y A;  2HOS A;  1WH5 A;  1YJW I;  1HA8 A;  3DKX A;  4XN0 A;  3IRR A;  5CKT A;  4A3K J;  1ETW A;  2L7K A;  3K4C A;  3WG7 H;  3O2P E;  4WK8 F;  5HNH A;  1JGS A;  2VPL A;  1BJA A;  2M5W A;  5J6X A;  3C7J A;  2R5Z A;  3PIP F;  4DJA A;  5J4Y A;  4HAM A;  2A6T A;  4W97 A;  2ICW G;  2R7S A;  1BOB A;  1Q1V A;  2M4K A;  2J5P A;  2DBB A;  3EUA A;  1FBU A;  1FYL A;  2CV1 A;  2EFO A;  4Q5S F;  2LD5 A;  1QQI A;  4LFU A;  4CGZ A;  1WJE A;  3HRM A;  1QNT A;  5FFZ A;  2Z9O A;  4MQV A;  3E5U A;  5E8I A;  5GAD J;  5LHH A;  3RYP A;  2ELH A;  2Z2S B;  4R79 A;  3GVA A;  3Q3S A;  3F6V A;  2HI3 A;  3DTE A;  4BL0 B;  4QPO A;  2VAS A;  4QTR A;  2NVT J;  1J2X A;  2F5E A;  3E0J B;  3K1P A;  1HCR A;  2KFD A;  1TWH J;  4ZTJ A;  5LLQ A;  1G3W A;  3BG5 A;  1JJ8 C;  1LVA A;  3F22 A;  2IS1 A;  2MSY A;  2Z16 A;  2VJI A;  1B9M A;  1U9O A;  1WGX A;  4RAZ A;  2ADU A;  2BW3 B;  1TT0 A;  3IKT A;  2LP0 A;  4KN7 X;  4BHB A;  4AWX B;  2WAF A;  4JBA A;  1MBK A;  3O6B B;  2H09 A;  3OYE A;  2E34 A;  1S7O A;  4LG0 A;  3CMM A;  5E3N A;  3D5L A;  3IH3 A;  1ON1 A;  5K5O A;  1BI0 A;  2QQA A;  3PIO F;  5L3G A;  3PSI A;  1F1Z A;  1X1B A;  2EV0 A;  2YUS A;  5F0H A;  4BE0 A;  3A0B C;  4CZZ A;  2K27 A;  3EET A;  4B48 A;  2WAQ A;  3I56 I;  2QSH X;  1HW5 A;  4HQM A;  1D3Y A;  5LGU A;  4L9V A;  3EYI A;  2E1O A;  4ZJZ A;  3VB2 A;  3GTQ J;  2HVS A;  4HX8 A;  1I27 A;  4DGW B;  4HQE A;  2HTS A;  1WWX A;  2Z5U A;  1IAW A;  3SHF A;  3WTU C;  5K1Y A;  3F8B A;  3G1L A;  4EJV A;  3ZPL A;  3I59 A;  4UUT A;  4S04 A;  5FKM A;  2XV4 S;  4L5I A;  1NG6 A;  2GQQ A;  5IP9 J;  5K7F A;  1R5G A;  2F2E A;  1AA7 A;  1FYM A;  1OYY A;  1X4P A;  2M0M A;  1FMW A;  1R1V A;  2MFZ A;  1G6N A;  4A3F J;  4EM1 A;  1LFU P;  3RTR A;  4FAS D;  3BTL A;  3V7R A;  4ZYD A;  3ELK A;  4A3L J;  3DKW A;  2E1M C;  2QWW A;  2LKX A;  1O4X A;  2PJP A;  2PMZ N;  2CMP A;  3I3L A;  1FP2 A;  3CJT B;  3RZD J;  4A3E J;  3CD6 I;  1ERD A;  3QPT A;  5EDN A;  3SXY A;  1VI0 A;  1D8J A;  1VQL I;  4WXH A;  2LTP A;  3KYL A;  2K9N A;  4E7J A;  4K2E A;  2FEZ A;  2FSW A;  2F48 A;  3OV8 A;  3MQ0 A;  2DJN A;  2OC6 A;  1AOY A;  1WQ2 A;  3AG4 H;  5AIQ A;  1IN4 A;  1A36 A;  4ZDP A;  2HDD A;  2NNN A;  2C6Y A;  5FLX Z;  1KYW A;  5L3B A;  1Y56 A;  3FX3 A;  3HOU J;  3HSR A;  3H3Z A;  1FJL A;  2XRL A;  2JJ7 A;  2WBM A;  4NC8 A;  3ASN H;  3JRE A;  5BPI A;  3R0J A;  5IYC J;  2E2I J;  3W2W A;  1GVD A;  4G7H F;  4HX4 A;  2NVY J;  2VKE A;  4L0Z B;  2IVM A;  5HDG A;  1Y6I A;  2LLK A;  1QPM A;  2FOK A;  4MIM A;  2VOP A;  1I6H J;  2LH9 A;  3TDU C;  2KRF A;  3CC2 I;  1S6L A;  2BY3 A;  2OU2 A;  4L5E A;  3JRF A;  2DXI A;  4CUG A;  3FXL A;  2RV8 A;  4DBR A;  1UST A;  3GX4 X;  4UB8 C;  1YOV B;  1YJN I;  3RYR A;  4XLA A;  3F9K A;  4E7Z A;  2E2H J;  5KCM A;  1AKH B;  3IWF A;  4II3 A;  4ZC3 A;  3HIF A;  4H4K C;  1TNS A;  3ZQF A;  2LDU A;  1SVM A;  3KEY A;  1T98 A;  3GTM J;  2H8W A;  1FLI A;  2L9S A;  1WI3 A;  1MKM A;  1ZTR A;  1V4R A;  3ML6 A;  3RPQ A;  3VSL A;  2JVH A;  2JA8 J;  1IN6 A;  4IZZ A;  4M3D A;  3GFI A;  1RUO A;  1IXC A;  1ULY A;  2DFE A;  5TIS C;  1B9N A;  3WTW C;  2K9S A;  2HXI A;  2M2E A;  3QU3 A;  5ICE A;  2M4G A;  3CO6 C;  1O3T A;  2EV5 A;  2QZ8 A;  3AG2 H;  3CDH A;  4I0A A;  2M7A A;  4BAC A;  2TDX A;  3ZGK A;  1H9T A;  1BW5 A;  2BHZ A;  4GRI A;  3W6K B;  3ZQC A;  5E18 F;  2CQ7 A;  4I01 A;  5B66 C;  4I02 A;  3A4C A;  4XLE A;  5E3O A;  1EA3 A;  2ZKZ A;  1MSE C;  3AKZ A;  2ESN A;  5HOD A;  2ZSI B;  4O3M A;  4IKF A;  2IRF G;  2FXA A;  2ZFW A;  5H6Q A;  2I5U A;  5EZH A;  1SD4 A;  3ZMD A;  2X85 A;  5HLH A;  3BCB A;  4BQO A;  3F8F A;  4GXO A;  3FHZ A;  3QP5 A;  1X2M A;  1WJ5 A;  2QGU A;  4XK4 A;  2XF6 A;  2ELJ A;  4PDK A;  4UHT A;  2X4H A;  2QM3 A;  3H9J A;  1IN8 A;  4I0B A;  1TW2 A;  3OMY A;  4IRI A;  3HB9 A;  4JOM A;  2K9M A;  1J0R A;  2W25 A;  5B1A H;  2GA2 A;  3P9K A;  4O6J A;  2Y0S N;  3UNG C;  2PI0 A;  2VQC A;  3H9Q A;  4XKW A;  5DEQ A;  2FD5 A;  5HS7 A;  2GBY A;  4ZH4 F;  2L2O A;  4HF0 A;  1OLT A;  3GFL A;  2BOL A;  4B43 A;  3ROU A;  1XSV A;  4F55 A;  2B7E A;  5DM6 F;  4I09 A;  4P5O A;  2PQ8 A;  2DA5 A;  3HTS B;  2YPR A;  4CXF A;  3HOZ J;  5FO5 A;  2O5R A;  2Y0S A;  2GIV A;  3CLQ A;  4IX7 A;  2QEN A;  5LGN A;  2VPR A;  3GZN B;  3LSM A;  2HOE A;  5M5W J;  1RES A;  2DFF A;  2HGC A;  5DDG A;  1HDP A;  2F5C A;  1TWC J;  4Y7N J;  2VKV A;  3OS0 A;  4AM3 A;  2AS5 F;  2LC2 A;  3R60 A;  4M3G A;  2E5Z A;  1MGT A;  2ZME B;  4E7H A;  2YU9 J;  2Q0O A;  1YQA A;  5C44 J;  4U0Y A;  2P7C B;  4UXN A;  1W7P A;  2ZB9 A;  2HFH A;  3CC4 I;  1IRZ A;  2VT2 A;  1IG7 A;  1O3S A;  4AUX A;  1RC9 A;  3NRV A;  2L0K A;  1F36 A;  4LG0 B;  3RQI A;  4OAZ A;  1OCZ H;  2OCE A;  4CA0 A;  1BI3 A;  3RPU D;  4E70 A;  3V7C A;  3H0D A;  1VTN C;  4XLH A;  4BJT A;  2HEO A;  1Y1V J;  1X3Z B;  2PX9 A;  3OY9 A;  3RDI A;  5E3L A;  3DBH B;  1FEX A;  1LFB A;  3ZN1 A;  4XLN F;  4HG2 A;  1USS A;  1SAX A;  5GAG J;  2R4G A;  1YRN A;  2O9L A;  1SMY F;  2JTV A;  3ZP5 A;  4MEX F;  2EIJ H;  2EWN A;  1TBX A;  4UV9 A;  4D9J A;  4JX5 A;  4E7L A;  3ZMS A;  2Z1D A;  2MLK A;  4XKC A;  2E1N A;  1X3W B;  1H89 C;  4ABZ A;  3E6M A;  4HYE A;  1LEA A;  3ABK H;  3F23 A;  1BI2 A;  5EGO B;  1P4W A;  2L9N A;  2RVC A;  3CDL A;  3KYD B;  4LG3 A;  4ZDO A;  3SDB A;  1G3S A;  3L2U A;  1LDK B;  2D45 A;  3KX2 A;  2LOO A;  1MH3 A;  4LJZ F;  2GLO A;  3H5R A;  2R93 J;  2QSF X;  3D5R C;  1MBH A;  5BQT A;  3IH4 A;  1WI9 A;  4RLF A;  3MKZ A; 
#chains in the Genus database with same CATH homology
 2EFN A;  1I1G A;  2H94 A;  2K02 A;  1CF7 B;  3MAJ A;  2XAF A;  1RI7 A;  2FBH A;  4O5V A;  2YX7 A;  4CIC A;  5HDK A;  1Z1D A;  3SQN A;  1PUE E;  3R6S A;  4G7Z F;  2VC1 A;  4EM2 A;  1R23 A;  3SFZ A;  3ISP A;  2RQP A;  3ZMZ A;  2FRH A;  3FXR A;  1YYV A;  3K0L A;  4OIN F;  4GO1 A;  4UVB A;  4Y15 A;  3TO9 A;  2XGX A;  4P96 A;  2GXB A;  2DPU A;  4M9Z A;  3ABT A;  3EYY A;  4GYI A;  3WTZ A;  5D5V B;  3GLX A;  3I5U A;  3BWG A;  3RKX A;  1XB4 A;  5D6E A;  4CO8 A;  4LLL A;  5DYM A;  4A0Z A;  2KJC A;  4MGR A;  2OA4 A;  2FNP A;  3KZZ A;  5KK1 A;  3WGH A;  4A0X A;  4OIP F;  1FP1 D;  2BV6 A;  1XMK A;  2R7D A;  5K5Q A;  1X3U A;  2DT5 A;  3RPU A;  1FBS A;  1P6R A;  4L9N A;  3KFW X;  3NEU A;  4RB2 C;  1XCV A;  3JTH A;  4AIH A;  1Z91 A;  3FF5 A;  3V4G A;  1SD6 A;  5CVJ A;  2ZNZ A;  3CLO A;  1XCB A;  5DV5 A;  1JXS A;  4KMF A;  2A69 F;  4YIF A;  3QOP A;  4FX0 A;  5DCM B;  3LAJ A;  1FNN A;  2V1X A;  1STZ A;  2OAZ A;  5DUK A;  4G94 A;  1MJ9 A;  3KEQ A;  1DPR A;  2P5K A;  4KIF A;  1JHH A;  4BHC A;  1SFE A;  2QUF A;  3WOD F;  1LEB A;  3KE2 A;  1R58 A;  3ECO A;  2JZY A;  4KMU X;  5H6R A;  4WWC A;  4H0E A;  4KFC A;  4ESB A;  4L18 B;  2DQR A;  1FC3 A;  1SFX A;  5TJJ A;  3GZ5 A;  3DFG A;  4M9S A;  2IPQ X;  2UXN A;  2NRA C;  4WF2 A;  2EFQ A;  2FA5 A;  3GZ6 A;  1ONV A;  3JSP A;  1KYZ A;  3DPL C;  2BYV E;  4RGS A;  4EJU A;  2DPD A;  4XLP F;  5FFX A;  3LA7 A;  2PBI A;  2HTJ A;  3S2W A;  2DLL A;  1ZAR A;  3MZH A;  4B09 A;  2XHK A;  3I4P A;  4R8H A;  3U1D A;  2O03 A;  5E17 F;  2CSO A;  3K69 A;  2IP2 A;  1P4X A;  3D0S A;  4Z2Y A;  4EVI A;  5JVT A;  1ZLJ A;  5IT9 Z;  5D4S A;  3IKV A;  4QWQ A;  4A5M A;  3ERE D;  3JAM K;  2MLG A;  4IHS A;  4AIK A;  4U0W A;  3SZT A;  3ZQ7 A;  2V6C A;  5BS6 A;  4MTD A;  2JT1 A;  5E1X A;  2OZ6 A;  3V8J A;  3KET A;  3T5X A;  4I2O A;  4L5J A;  1XGO A;  1DDN A;  4NQW A;  5TRD A;  4BYY A;  3F6O A;  4UV8 A;  2V9V A;  3BDD A;  2A6E F;  2L4M A;  3GYH X;  3V8K A;  3TOA A;  5ILV A;  2OZU A;  3T8T A;  2CFX A;  1ZH5 A;  6PAX A;  3JTG A;  3F72 A;  3FMR A;  1U8R A;  2B0L A;  2Y75 A;  3K1N A;  2CQK A;  4KN4 X;  4OU0 A;  2IJL A;  2A61 A;  2IA0 A;  2Z99 A;  3ECH A;  1GXP A;  2LKP A;  2MBF A;  3J81 K;  3ZN0 A;  3T8R A;  3C18 A;  3F8C A;  4WXD A;  1MZB A;  2E1C A;  4R1H A;  3GXO A;  4EJW A;  2VC0 A;  1KQ9 A;  4DQ2 A;  1ZRC A;  1UCR A;  1YS7 A;  4EGZ A;  3QAH A;  3HUG A;  2MA3 A;  1G3T A;  3M7G A;  1KQ0 A;  1SFU A;  3EQL F;  3K9T A;  4LMY A;  3WTS C;  1RIO H;  3C3W A;  3E5X A;  2P8T A;  1L3L A;  1AWC A;  2W84 A;  3ZMV A;  1GVJ A;  1DUX C;  3IWZ A;  3L00 A;  3ULQ B;  2M87 A;  3BJO A;  4OIQ F;  2M30 A;  3LQQ A;  3QRF F;  5LEK A;  4M74 A;  3KP7 A;  2ZME A;  2STT A;  2P4W A;  2D1H A;  3CUQ B;  3IC7 A;  1BC7 C;  3VOD A;  5CVI A;  5BMZ A;  4CHU A;  3LA2 A;  5A2Q K;  1K79 A;  3MZY A;  2WWY A;  1FPQ A;  5CJ9 A;  3QP6 A;  3TO7 A;  2R7F A;  3TO6 A;  5FB2 A;  2EK5 A;  3HHH A;  2EV6 A;  2M8E A;  1S7A A;  5LGT A;  3V7S A;  4N9H A;  1I5Z A;  5D5X B;  4LB6 B;  3RKW A;  5CVR A;  4XSX F;  1GXQ A;  5HOO A;  1HQC A;  1O7F A;  3HRT A;  5HDN A;  4ESF A;  2XAQ A;  4ZYG A;  5ICF A;  2VBY A;  4PCQ A;  3P7N A;  1R36 A;  1W4M A;  4G9Y A;  2O0Y A;  1MDM A;  3I54 A;  4EV0 A;  5HLG A;  2PMU A;  5KVR A;  1V3F A;  1HXD A;  2Z33 A;  4MEY F;  3K1M A;  4HZF A;  4JK1 X;  1YLF A;  5HVQ C;  1U78 A;  4AD9 A;  1XGS A;  3K2Z A;  4TV7 A;  4M6X A;  2OQR A;  3KP6 A;  2YR2 A;  2Y0M A;  1LDD A;  1U5T C;  4G6Q A;  1JE8 A;  5IT3 A;  1PP8 F;  2KIF A;  1H0M A;  1BN5 A;  3GUD A;  1G4D A;  2FF4 A;  1KU7 A;  4M73 A;  4UUV A;  3IHU A;  4HBL A;  2XAH A;  4L9T A;  4U88 A;  3KP2 A;  1FYK A;  5ED4 A;  3T0Y A;  3RI4 A;  2HYG D;  2CW0 F;  3CUQ C;  3F8M A;  1O3Q A;  2ISZ A;  4A0Y A;  3DQV C;  1NHA A;  3B73 A;  5J8F A;  5LHI A;  3NQO A;  1O3R A;  1KA8 A;  5K5R A;  2W24 A;  1HST A;  2XKO A;  3L09 A;  1TQI A;  2MC3 A;  5DD8 A;  2ZO4 A;  3RJP A;  5FD6 A;  3DXJ F;  3JW4 A;  4WCG A;  1EH6 A;  3BOQ A;  3M8E A;  2P6S A;  5CLS A;  4GYG A;  1IUY A;  5FD5 A;  4KUM A;  1R22 A;  3TOB A;  1Z9C A;  4XSZ F;  4PZJ A;  4P55 A;  4LGW A;  2M45 A;  5E1Z B;  4YFX F;  1FWZ A;  3L7W A;  4BXU A;  2PLY A;  4HF1 A;  3KP3 A;  2K86 A;  1MJB A;  1DP7 P;  2CO5 A;  3QU6 A;  3PQK A;  4S05 A;  3I59 B;  1HW2 A;  4PGH A;  1HBX G;  2XKP A;  1PDN C;  3L9F A;  4BNC A;  4A5N A;  4UVC A;  3VFZ A;  2E7X A;  4PGG A;  1KU2 A;  4BH9 A;  3P9C A;  1HW1 A;  1J7K A;  3C1D A;  3TKY A;  2V1U A;  4ENM A;  2E7W A;  2QLZ A;  1IW7 F;  3WU1 B;  3FMQ A;  2VXZ A;  4MNU A;  2DAO A;  3RIR A;  2G7U A;  1P4A A;  1R00 A;  4KIB A;  4P9F A;  2DI3 A;  4A6D A;  1SD7 A;  3TDZ C;  4EQQ A;  1F4K A;  4U0V A;  2DFI A;  1IXR C;  1KU9 A;  3KP4 A;  3WE3 A;  4ESJ A;  2P6T A;  3KCC A;  5JI6 A;  2QYO A;  1G3Y A;  5L3E A;  4N9I A;  4QLC U;  1R1T A;  3BJA A;  4EGY A;  1T2K A;  2IW5 A;  2XAJ A;  3E6D A;  2DO7 A;  4M71 A;  1OYW A;  4A6E A;  5D6F A;  3U2R A;  2EFW A;  2Q8K A;  2ZXJ A;  4AIJ A;  1S3J A;  4ZYE A;  2FQ3 A;  2L02 A;  1UB9 A;  3T1B A;  4IVN A;  1WKM A;  4IHT A;  1HKS A;  2ZJ2 A;  1OKR A;  2G9W A;  1F5T A;  3HHG A;  4B8X A;  1IXS B;  4MQ9 F;  3COA C;  5D4R A;  1K78 A;  2L01 A;  1XD7 A;  4I98 B;  4GCV A;  3BRO A;  2GA1 A;  3V8L A;  4EM0 B;  4ZZD A;  4DNC A;  2KIU A;  4M9X A;  1W5S A;  5DCF A;  3OOP A;  2JRT A;  3HOT A;  1WRJ A;  3B02 A;  4MTE A;  2RDP A;  3Q9V A;  4M6Y A;  4HDV A;  2FMY A;  1B6A A;  4IF4 A;  5FGM A;  2VON A;  1J75 A;  2XAG A;  1ZG1 A;  2DU9 A;  2NYX A;  4M72 A;  4EJO A;  1S8N A;  1U2W A;  4RB0 A;  1LDJ A;  4LK0 F;  2LNB A;  2PEX A;  1QO0 D;  1T0F A;  2HDC A;  3J80 Z;  1TQM A;  4KA4 A;  4KDP A;  2A68 F;  3WE2 A;  4HF2 A;  3L2C A;  1FZP B;  5F64 A;  1RZ4 A;  1IN5 A;  2F5D A;  2R3S A;  4HDU A;  1K7A A;  1ODD A;  2EJR A;  1XGN A;  3Q5F A;  3MWM A;  1U5T A;  1FOK A;  1FSE A;  2VOO A;  1QBJ A;  3N97 A;  5DCM A;  3F21 A;  1ZYR F;  3R4K A;  2KKO A;  2P5L C;  3SZP A;  1K6O A;  3AAF A;  2COM A;  4XRF A;  4UVA A;  3DV8 A;  2QQ9 A;  3BPV A;  2QQB A;  3QPH A;  3MFK A;  5IT9 K;  2O6G E;  1QZZ A;  2FBK A;  4ENK A;  1ON2 A;  1U3E M;  2ZCW A;  3GF2 A;  1OMI A;  2HR3 A;  1I1S A;  2PG4 A;  2A3S A;  1IF1 A;  3CUQ A;  3LST A;  2MH2 A;  2O8X A;  5HLI A;  2VE8 A;  4RS8 A;  1XDU A;  4BAY A;  4YFN F;  2L3D A;  1SD5 A;  2K4B A;  3FM3 A;  2NS0 A;  2D1V A;  3HOS A;  2QVO A;  1BM9 A;  2H27 A;  1L0O C;  1YTY A;  1RNL A;  5HS9 A;  1YW9 A;  3E6C C;  1FY7 A;  1ZG5 A;  2HQN A;  4HLX A;  4OOI A;  4EMS A;  2RNJ A;  1XSX A;  3KLN A;  4A2U A;  3EUH A;  3LQR A;  1U6G A;  4ETS A;  4G8X A;  2IA2 A;  4FT8 A;  2IA1 A;  4Q4Z F;  2DTR A;  5ICC A;  1LB2 A;  3E6B A;  1REP C;  4LD5 A;  2LSO A;  2YX4 A;  5D5W B;  4LK1 F;  3REO A;  1BIA A;  4IRH A;  3VEP A;  1P92 A;  3FXU A;  4UNO A;  4RGR A;  1FSH A;  2LF7 A;  4ON0 A;  4LB5 A;  4EJT A;  3ABU A;  5BOX A;  3I53 A;  4RB1 A;  1B4A A;  3E97 A;  3GFM A;  4IXA A;  1BI1 A;  3HRU A;  1UHM A;  4F7Z A;  2K7L A;  5JR3 A;  1T6S A;  3I71 A;  4HX7 A;  2ZBK A;  2JPC A;  2W57 A;  3J7A O;  1E17 A;  3JAM Z;  3G3Z A;  1U5T B;  5ICG A;  2JPB A;  3WTY C;  3IRQ A;  4HW0 A;  1TQP A;  2G7H A;  2DK8 A;  2VBZ A;  3P9I A;  3WGG A;  3HSE A;  3M9A A;  1T38 A;  1F9N A;  3CUO A;  3H92 A;  2CGP A;  3HRS A;  1OPC A;  5ERI A;  4OIR F;  1BBY A;  2BEO A;  5LEJ A;  1FX7 A;  5H20 A;  4LLG F;  5AIP A;  4RAY A;  2PFB A;  2XIG A;  1ZN2 A;  2MH9 A;  1XGM A;  1HKQ A;  5D8L B;  1D8K A;  1OYI A;  2A6H F;  3Q9S A;  3FXQ A;  2VOD A;  2HZT A;  1LQ1 A;  3LAP A;  2HQR A;  4A12 A;  4IPA A;  2GWR A;  4KIG A;  1C0W A;  2IT0 A;  1ZAO A;  3TQN A;  4RB3 C;  1R7J A;  1S29 A;  1XMA A;  1W7P D;  3GO5 A;  2XRN A;  3HYI A;  3GEZ A;  1KU3 A;  1R5H A;  3HSF A;  2GZW A;  1J9I A;  3PQJ A;  2A07 F;  1YS6 A;  4MHG A;  2DQL A;  2Q2E A;  1XN7 A;  2HKO A;  3WTX C;  4KIC A;  5EEH A;  4JQF A;  4XBF A;  2CYY A;  1KGS A;  2BGC A;  2EA4 A;  5FLX K;  3M1E A;  2HS5 A;  5CVU A;  2QBY A;  4LLN A;  1J59 A;  2QBY B;  4N0B A;  3CTA A;  4CDG A;  1ZG3 A;  4U7D A;  5DUI A;  4HV5 A;  5JHU A;  3ZMT A;  5HS8 A;  1ZHF A;  5E20 A;  3BZ6 A;  5LRS A;  1J5Y A;  3J81 Z;  2XRO A;  5D8K B;  1BOA A;  2ACJ A;  1RUN A;  2HYF A;  3N4M A;  3DPT A;  3BP8 A;  5CVV A;  2F5F A;  1Y0U A;  5ILS A;  3WGI A;  2H6C A;  1QZY A;  1CGP A;  2O3F A;  3H3U A;  2XUB A;  1FT9 A;  4FHT A;  3WG9 A;  2NNY A;  1ZGJ A;  2W85 A;  1YFH A;  1O7L A;  1K78 B;  1EH8 A;  2UZK A;  2FU4 A;  4NHJ A;  1W5T A;  2UXX A;  2KJB A;  3GWZ A;  1Z6T A;  4Q47 A;  2O61 A;  2ESH A;  2D2W A;  1TNT A;  3W6J B;  5LRR A;  3E5Q A;  4NB5 A;  1ZRF A;  2V79 A;  1MD0 A;  1BC8 C;  4ENN A;  2V1D A;  1A04 A;  2DW4 A;  2K4J A;  2VT3 A;  3RKY A;  3I0T A;  2P7V B;  4BQA A;  1DPU A;  4HA8 A;  2X0L A;  4OMY A;  2RGV A;  2YU3 A;  3KP5 A;  4L0Y B;  1QGP A;  5JFR A;  4P9U A;  2PMH A;  1BIB A;  1B1B A;  1I6X A;  4KYW A;  4L9J A;  1IRF A;  1SMT A;  1LNW A;  1OR7 A;  5BPD A;  2BBY A;  3M8F A;  3I64 A;  3I58 A;  2BE5 F;  1YW7 A;  2EA2 A;  4RGU A;  1IZ1 A;  1B59 A;  1EH7 A;  1WSU A;  3BPX A;  1D5V A;  2H6B A;  4OMZ A;  5L3C A;  3G73 A;  1HKT A;  3JSO A;  3BJ6 A;  4IRG A;  4KNY A;  3BY6 A;  2MD5 A;  1Z7U A;  2RKH A;  5F6F A;  2GXG A;  3R0A A;  5ILU A;  1EV7 A;  3LA3 A;  2XVC A;  1IN7 A;  2JSC A;  2CWE A;  1YIO A;  3CO7 C;  2Z3Y A;  4WX9 A;  1PP7 U;  4ZZL A;  2OBP A;  3GFJ A;  4ZYH A;  2WC2 A;  3WTT C;  1YG2 A;  2KIM A;  2L4A A;  2Y48 A;  3FMS A;  3R61 A;  4WXC A;  3MCZ A;  2VBX A;  3CJN A;  5A2Q Z;  5L3D A;  3WU0 A;  1W7P B;  1MJA A;  1TW3 A;  5J8C A;  4ASN A;  2VE9 A;  4Q48 A;  3HTU A;  5E8G A;  1UFM A;  4YG2 F;  2GAU A;  2WTE A;  2FE3 A;  2ZNY A;  4GGG A;  2NAZ A;  2FNA A;  2CG4 A;  1YW8 A;  3GW2 A;  2OQG A;  3TGN A;  1O57 A;  5LHG A;  5EEG A;  2EFP A;  3VOE A;  3O3K A;  3KLO A;  1TTY A;  4HOB A;  2VN2 A;  3KEO A;  4ENJ A;  3DP7 A;  1XSD A;  1ZRD A;  5L3F A;  2ISY A;  3J80 K;  2J5O A;  5LBQ A;  4HV6 A;  2AXL A;  2A5Y B;  3KZY A;  1JHF A;  3EDP A;  4IJA A;  3PFI A;  2FBI A;  4YFK F;  1GHC A;  2HWV A;  2DK5 A;  3DF8 A;  3E3V A;  4D0P A;  5E1W A;  2LF8 A;  4HLY A;  3U9G A;  4OIO F;  1UHW A;  4U7B A;  2P5V A;  1T39 A;  2RN7 A;  2HKX A;  1R1U A;  3FWE A;  4RGX A;  3WTV C;  3MEX A;  1ZGA A;  3IL2 A;  1ZLK A;  4G6D A;  4BHP A;  4YII A;  3F8N A;  3DEU A;  4Y13 A;  2FML A;  2M1B A;  4G7O F;  2L54 A;  2WV0 A;  1H9G A;  2XAS A;  5CYV A;  1LJ9 A;  1TLH B;  5D5U B;  3F3X A;  1Z05 A;  3ZMU A;  2ETH A;  5AON A;  3FZV A;  1KQ8 A;  1P2F A;  1IRG A;  4CYD A;  4KT5 C;  2VBW A;  2YSR A;  1XDS A;  1Q1H A;  3LWF A;  4Y17 A;  1FBQ A;  4FX4 A;  3FM5 A;  3LFK A;  2PN6 A;  1Z6R A;  2UWM A;  4I7H A;  1ZRE A;  1MDM B;  4AVP A;  2EB7 A;  1YO5 C;  2STW A;  2OD5 A;  1HSJ A;  1E2X A;  5DD4 A;  1CF7 A;  2RC4 A;  5F1R A;  3IRR A;  4WK8 F;  3O2P E;  1JGS A;  1BJA A;  2M5W A;  5J6X A;  3C7J A;  4HAM A;  2J5P A;  2DBB A;  1FBU A;  1FYL A;  2EFO A;  4Q5S F;  1QQI A;  4LFU A;  4CGZ A;  3HRM A;  1QNT A;  5FFZ A;  2Z9O A;  4MQV A;  3E5U A;  5E8I A;  5LHH A;  3RYP A;  2ELH A;  4R79 A;  3GVA A;  3F6V A;  1J2X A;  2F5E A;  3K1P A;  5LLQ A;  1G3W A;  1LVA A;  3F22 A;  1B9M A;  4RAZ A;  2ADU A;  3IKT A;  4KN7 X;  4BHB A;  4AWX B;  4JBA A;  3O6B B;  2H09 A;  1S7O A;  4LG0 A;  3D5L A;  1ON1 A;  5K5O A;  1BI0 A;  2QQA A;  5L3G A;  1F1Z A;  2EV0 A;  4CZZ A;  2K27 A;  3EET A;  1HW5 A;  4HQM A;  1D3Y A;  5LGU A;  4L9V A;  3EYI A;  3VB2 A;  4HX8 A;  1I27 A;  4HQE A;  2HTS A;  1WWX A;  2Z5U A;  1IAW A;  3SHF A;  3WTU C;  5K1Y A;  3F8B A;  4EJV A;  3ZPL A;  3I59 A;  4S04 A;  2XV4 S;  4L5I A;  2GQQ A;  1R5G A;  2F2E A;  1FYM A;  1OYY A;  1R1V A;  1G6N A;  4EM1 A;  3RTR A;  3V7R A;  4ZYD A;  3ELK A;  3DKW A;  2QWW A;  2PJP A;  1FP2 A;  3QPT A;  3SXY A;  1D8J A;  4WXH A;  4K2E A;  2FEZ A;  2FSW A;  3OV8 A;  3MQ0 A;  1AOY A;  1WQ2 A;  5AIQ A;  1IN4 A;  2NNN A;  2C6Y A;  5FLX Z;  1KYW A;  5L3B A;  3FX3 A;  3HSR A;  3H3Z A;  5BPI A;  3R0J A;  4G7H F;  4HX4 A;  4L0Z B;  2IVM A;  5HDG A;  1QPM A;  2FOK A;  2VOP A;  3TDU C;  2KRF A;  1S6L A;  2OU2 A;  2RV8 A;  3GX4 X;  1UST A;  3RYR A;  3IWF A;  3HIF A;  1TNS A;  2LDU A;  1T98 A;  1FLI A;  1MKM A;  1V4R A;  3ML6 A;  3RPQ A;  1IN6 A;  3GFI A;  1RUO A;  1IXC A;  1ULY A;  1B9N A;  3WTW C;  3QU3 A;  5ICE A;  3CO6 C;  1O3T A;  2EV5 A;  2QZ8 A;  3CDH A;  4I0A A;  2TDX A;  1H9T A;  3W6K B;  5E18 F;  4I01 A;  4I02 A;  2ZKZ A;  2ESN A;  4O3M A;  2IRF G;  2FXA A;  2ZFW A;  5H6Q A;  1SD4 A;  3ZMD A;  5HLH A;  3F8F A;  4GXO A;  3FHZ A;  3QP5 A;  4PDK A;  4UHT A;  2X4H A;  2QM3 A;  1IN8 A;  4I0B A;  1TW2 A;  4IRI A;  1J0R A;  2W25 A;  2GA2 A;  3P9K A;  4O6J A;  2PI0 A;  5DEQ A;  5HS7 A;  4ZH4 F;  4HF0 A;  3GFL A;  3ROU A;  1XSV A;  4I09 A;  4P5O A;  2PQ8 A;  3HTS B;  2YPR A;  4CXF A;  5FO5 A;  2GIV A;  2QEN A;  5LGN A;  2HOE A;  2HGC A;  5DDG A;  2F5C A;  2AS5 F;  3R60 A;  1MGT A;  2ZME B;  2Q0O A;  1YQA A;  4U0Y A;  2P7C B;  4UXN A;  1W7P A;  2HFH A;  2VT2 A;  1O3S A;  3NRV A;  4LG0 B;  1BI3 A;  4E70 A;  3V7C A;  1VTN C;  2HEO A;  3RDI A;  3ZN1 A;  4XLN F;  1USS A;  1SAX A;  1SMY F;  2JTV A;  3ZP5 A;  4MEX F;  2EWN A;  1TBX A;  4UV9 A;  3ZMS A;  2MLK A;  2E1N A;  3E6M A;  4HYE A;  1LEA A;  3F23 A;  1BI2 A;  1P4W A;  2RVC A;  1G3S A;  1LDK B;  2D45 A;  4LJZ F;  5BQT A;  1WI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...