1X2MA

Solution structure of the homeobox domain of mouse lag1 longevity assurance homolog 6
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
64
structure length
64
Chain Sequence
GSSGSSGTAQPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LAG1 longevity assurance homolog 6
publication title Solution structure of the homeobox domain of mouse LAG1 longevity assurance homolog 6
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 12
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2005-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1x2mA01
1Q1VA 5EG0A 2CUEA 2WB1N 3ZQIA 1RKWA 2R92J 3E7LA 5HODA 3M3YJ 1ZR2A 4Y7NJ 1WI3A 4BY1J 4FE4A 3OIOA 5DS9A 2DMUA 1OCTC 1AU7A 1B72A 5IYBJ 2EZKA 3F0CA 1PUFB 1IUFA 1WH5A 1ZK8A 2COBA 2Y30A 2CQQA 5J3LA 4JX4A 2Y9YA 3HOUJ 2LD5A 1ZGWA 2E2JJ 2X48A 1U78A 4IHWA 4W1UA 2OPTA 3RZOJ 2KDZA 3FIWA 3IH4A 3W6VA 1OFCX 1VNDA 5C4XJ 1HOMA 3JRDA 5EYRA 2EQRA 1FTTA 4BKXA 3PO2J 3LNQA 1ETYA 3MN2A 3LSGA 1E3OC 1Y1VJ 2R0QC 4V2GA 1U9NA 1AKHA 4D5FA 3I4NJ 4RBOA 4DZPA 3SJMA 2D5VA 1VFCA 3Q0WA 1ITYA 2CUFA 2XPUA 1DU6A 2EZIA 4BXXJ 3JRIA 1OJLA 4M3EA 3M4OJ 3HEFA 5BNGA 1JTYA 1ORKA 2HDDA 2DMPA 3QPLA 1APLC 1JT6A 2AO9A 2R7ZJ 3TW6A 5EEAA 2YS9A 3HM5A 2N8GA 1O4XA 3BR0A 1X58A 2VUMJ 2LR8A 4MO7A 3HB9A 3JRCA 3BQZA 1QVTA 4A3LJ 3JRAA 1QRYA 3QPSA 5FKNA 3VPRA 1H89C 1RPWA 2M34A 3SDGA 4IHXA 1GVDA 5GPCA 1BJZA 2XGDA 4J19A 1LFBA 1T33A 1ZTRA 4BY7J 1JJ6C 4XRSG 2R5YA 1MBHA 4CYCB 2H1KA 2I10A 1JJ8C 4AUXA 2GLOA 1ZKGA 1LFUP 4XK4A 2XB5A 4B3AA 2HOSA 1IDYA 1Z77A 5FLVA 3HBLA 3ZQLA 2P81A 1ETKA 1MH4A 2CU7A 4G12A 3JRFA 4A3FJ 1UG2A 1IV6A 3HOZJ 1FTZA 2DJNA 1SANA 1ETXA 3G1MA 1XS9A 3RQIA 1RETA 2L0KA 3ZQCA 4A3JJ 2LY9A 2HXIA 1X2NA 4D7NA 4CYCA 3GBGA 1MSEC 3CDLA 3BG9A 2YUSA 3SFIA 4B1RA 5EG0B 1MBEA 1TWAJ 2Y31A 2ME6A 4ABZA 3GTOJ 4IEJA 1MNMC 1JUMA 4HNVA 1WGXA 4RDUA 3JR9A 1FJLA 3NARA 3QQAA 1I6HJ 1FEXA 4JP0A 2AHQA 1B72B 3L1PA 3S1NJ 3S15J 4X6AJ 3OSFA 1UHSA 2K9QA 1K83J 4DYQA 2EH3A 3B6AA 5IP9J 1JKPC 1QPIA 5F27A 3B6CA 4X1EA 2L7MP 4XRMA 3JRGA 1VI0A 3BTIA 1POGA 2K9SA 2XRLA 4W97A 3HOVJ 2VPRA 4AC0A 1ZR4A 3HDDA 3CQZJ 1ZQ3P 4MLOA 2XPWA 3CCYA 2K40A 2R93J 3FKIJ 1WCMJ 1OCPA 3ZOBA 4GFBA 3HGGA 3LSJA 2DA3A 1AKHB 4DYCA 4B4CA 3OOUA 3BTLA 3HOYJ 3GTPJ 2QF7A 4A3EJ 2DA2A 2JK3A 4XICA 2JJ7A 5K7FA 3MKLA 3HOXJ 4NDLA 1UMQA 2JWTA 4A3MJ 2IAIA 5F08A 3O8HA 5E3NA 1TC3C 4DZJA 4A3GJ 2LK2A 4D5CA 4C2MJ 2DA4A 3ZQFA 2W48A 1JGGA 3K2AA 2JA6J 3BT9A 1ETWA 2JA5J 2ECCA 1YRNA 4MIMA 1WPKA 1DU0A 1HCRA 4C3IJ 5C3EJ 2ZB9A 2E19A 1MBJA 1XC5A 4M6VA 3BG5A 4JX5A 3BR3A 2WV1A 2R5YB 1IDZA 3OSGA 1NK3P 3H0GJ 3RZDJ 2EZLA 1MBKA 2MG4A 2NVYJ 4M3BA 3LSRA 2MGQA 2EBIA 3GTLJ 3NAUA 5F0FA 1I50J 5M5YJ 3WHBA 5IOZA 3D1NI 3I4MJ 2LKXA 2JA7J 5FKLA 4XRSA 1A5JA 2DA6A 3CMYA 2RAEA 1RR7A 2DMTA 1HLVA 3RKQA 4XIDA 1FIPA 1G2HA 3BG3A 5EZHA 3A02A 4JX6A 2DMNA 2HQ5A 2DN0A 1F43A 2NVXJ 2IBDA 1F36A 4C3HJ 5EF6A 2LFBA 4MFDA 2G0EA 1TWGJ 1TWHJ 2XSDC 1RKTA 1XG1A 4FCYA 4A3KJ 3S17J 2NVTJ 2M0CA 1IGNA 4FISA 2NOGA 2L7ZA 1B8IA 1GV2A 2XGCA 5J1YA 2O8KA 3BR6A 2KT0A 1JKRC 3JRHA 5IYDJ 4V2FA 2GM4A 1H88C 4EEFG 5FKMA 5M5WJ 5EGOA 3FK6A 4DW6A 2FD5A 3S1QJ 3HOWJ 1U8BA 1EF4A 3S16J 2XGEA 3DEWA 3G1OA 3HGYA 3Q0UA 3IH3A 1SFOJ 2R5ZA 4LOCA 3S1MJ 2QCOA 4DYRA 2XB0X 1BW5A 1ETVA 2L7FP 2EZHA 3S2HJ 5GP9A 2X6OA 5IOYA 1MSFC 3BR5A 5EZGA 5M3FJ 2VKVA 1LE8A 5IPAA 5IP7J 1JUSA 3MVPA 1ETOA 1H8AC 2O9LA 5GPAA 2NVQJ 2OF7A 1BL0A 4I76A 1K61A 1MH3A 9ANTA 2JN6A 2HOAA 4MFEA 2K9NA 2LP0A 1YRNB 3BR2A 2MSYA 5DTDA 3BTJA 4QIWN 4IHVA 5E3OA 4A3CJ 1U9OA 1VF9A 3A03A 2Y2ZA 2ID6A 5C44J 2DTZA 2M8GX 1R9TJ 3A01A 2H8RA 2ELKA 3GTMJ 1GUUA 2B63J 5K7HA 2HYJA 5FKOA 3GTGJ 1GT0C 3BTCA 1Y1WJ 2E1OA 2Y9ZA 2PMZN 1RESA 3K7AJ 5F1JA 2HI3A 4M3FA 1CQTA 5C4JJ 3LSPA 5EDNA 3S1RJ 1GV5A 1HDDC 2CJJA 2YU9J 1ETQA 4A3IJ 2DMQA 4L5EA 1MBFA 2NS8A 3IV5A 3ZQGA 5M5XJ 1PUFA 1I3QJ 2VI6A 1P7IA 1FIAA 4QTRA 3GTQJ 2JA8J 3BR1A 5J1UA 2X9DA 2FQ4A 3TEDA 5FLMJ 2CQXA 3HKZN 1BA5A 3Q3SA 3JRBA 2Y0SN 1T56A 1TWCJ 3ZQHA 1JT0A 2E2IJ 4BBRJ 3IH2A 4QSHA 1IRZA 4UUSB 3WHCA 5IYCJ 2IEKA 3BQYA 1X2MA 3G1LA 1B8IB 2M9HA 2M2EA 3FK7A 2LTPA 5F04A 4A3DJ 1HF0A 4UUTA 2VKEA 2HOTA 2E2HJ 4S0HB 2HXOA 1QVUA 3UKGA 3H3VK 2JMWA 4JYKA 1NTCA 5F0CA 4Y52J 1IG7A 1Z0XA 5EGOB 4M3GA 1JTXA 2FX0A 5K7ZA 2O7OA 4UUSA 3FISA 4FE7A 4M3DA 1D5YA 1W0TA 1A6IA 1IC8A 2ECBA 5JLWA 2LVSA 2ID3A 2R5ZB 3S2DJ 3JREA 5E3LA 3LOCA 2CRGA 4BBSJ 5FJ8J 4A93J 1WH7A 3TP0A 1GDTA 4FTHA 3GTKJ 3O8GA 3PM1A 2TRTA 3GTJJ 4AYBN 2DA5A 1HDPA 1LE8B 5J1RA 2XPVA 1NK2P 2MW8A 3C2BA 4IHYA 2NS7A 4A69C 1MBGA 1BW6A 2WAQN 4D7MA 2L9RA 3DCFA 4C3JJ 2LLKA 1P7JA 2ME0A 2DA1A 1JKQC 1IJWC 1S7EA 1W0UA 2DA7A 2TCTA 1JUPA 4I6ZA 3S14J 2FJ1A 5IP6A 3A01B 2GBYA 3TP3A 1ENHA 3TW7A 5M3MJ 3PO3J 5E3MA 1TWFJ 5JLXA 1AHDP 5FKKA 3Q0VA 1JKOC 5F0HA 4A3BJ
chains in the Genus database with same CATH superfamily
1WVRA 1X1AA 4OAZA 2HKOA 1T39A 1NG6A 1SD5A 2VT2A 4L9NA 3ZR8X 1LEAA 4D9JA 4D1QA 1FWZA 1UELB 2CUZA 3KIOA 2CG4A 2XKPA 3V7RA 3WE3A 1UB9A 5KAIC 2PEXA 3CMEI 3GWZA 2EA4A 2EZKA 3F0CA 1KU7A 3V8KA 1D5VA 2H94A 1QBJA 2Y30A 3G2BA 3IWFA 4JX4A 4IVNA 2L2OA 2KDOA 4ENKA 3FXKA 4IRIA 3HOUJ 2LD5A 3IRQA 3C7JA 2OPTA 2KRFA 3RZOJ 2KDZA 3FWEA 5DUIA 1OFCX 3HTSB 4F91B 3OYGA 3JRDA 2OBPA 3BC8A 5DYMA 1G8XA 1SFEA 1XGMA 4RB1A 3F21A 1S5LC 1E3OC 1FSHA 1ZLKA 2R0QC 1AKHA 1X1PA 4ZDPA 1XSVA 2D5VA 2X51A 1VFCA 3Q0WA 1ZREA 1WJEA 3FXRA 5H6RA 4NNJA 4EJWA 4Q48A 2XAHA 2O8XA 4G6DA 1RRJA 1OJLA 1X1BA 3ZMTA 4FT8A 4JOMA 1JTYA 2C6YA 1F4KA 3W6KB 5CQGA 5K5QA 2ZBKA 2VIXA 3TW6A 5JFRA 2R7ZJ 1ZN2A 3C1DA 2VUMJ 2KIFA 4OINF 2KIMA 3JRAA 1FNNA 4EV0A 3H9QA 3L9FA 4HOBA 4G7OF 1SAXA 3SDGA 2X85A 3RPQA 5ICGA 1CF7A 2IGOA 1T33A 1JJ6C 4E70A 5K5RA 1E17A 2O03A 1JJ8C 1Z7UA 2F5CA 3BCAA 2HR3A 5D5UB 1IDYA 1MJAA 5L3DA 4ANJA 2P81A 2MLKA 1SD7A 2CU7A 2CGPA 4M72A 2G9WA 1FT9A 1BIAA 4RAGA 2DK8A 1ETXA 2F6CA 2O5RA 2HZTA 4UVCA 2L0KA 1TT0A 2CQ7A 2VQCA 4L0YB 1O57A 2CW0F 4ZJZA 2ZO4A 2LY9A 1KU9A 4N9IA 1G3WA 2FU4A 2ZXWH 2PI0A 1ACIA 5AONA 4N4NB 1WRJA 1J7KA 3KYLA 5D8LB 3DLLF 3BG9A 1O7FA 2YUSA 3K70C 2GZWA 3CCRI 2VASA 1GVJA 1HKQA 3OYIA 2ZJRF 3PNTA 1D1AA 3KX2A 3OWTA 5HLHA 4HNVA 2PJPA 3BJ6A 4HPQA 1I3AA 1WGXA 2P5VA 4RDUA 3L2RA 3NARA 3QQAA 4OAYA 2QEXI 5CVRA 3I54A 5AIQA 3CD6I 3OSFA 1BR2A 3WTXC 3EQLF 2P7CB 2DO7A 1JKPC 4UVBA 1QPIA 2V1UA 4KICA 2L7MP 3DTIA 2KHMA 3N4MA 1SMTA 1TQPA 3JRGA 3QRFF 3E3VA 2K9SA 2BVMA 3TKYA 5ICCA 3GLXA 3KEOA 2VPRA 2QSGX 4PGHA 2EIMH 3K4KA 1ZQ3P 2H1LA 2ZJQF 2K40A 4CUGA 4HA8A 1QGPA 2ZXHA 3DEEA 3ABLH 2R93J 3RKXA 2QYOA 3VDXA 4M71A 1OCPA 4GFBA 5A2QK 4HDVA 2BE5F 2DA3A 1YG2A 1AKHB 3A2KA 2DI3A 3OOUA 5GAEJ 1L3LA 4LFUA 4A3EJ 2DA2A 2DXIA 2BGCA 4BU2A 3HOXJ 4C2UA 1E2XA 5FFXA 3U9GA 3IL2A 3K2ZA 4PGGA 1TC3C 2JTVA 3Q9VA 4DZJA 3CCMI 4D5CA 1TTYA 3GFMA 2STTA 3K10A 2LYCA 3SFZA 1UHMA 1JGGA 3E6BA 4HX7A 3MKYB 4IOCF 4S04A 2HQAA 1J09A 2MLGA 2JA5J 2A3SA 5EEGA 2BVLA 1HSTA 1SVOA 2L4MA 4YFKF 1DU0A 1EH7A 4LG3A 5GADJ 3CC2I 2HKXA 1YI2I 4BDYA 4CYDA 1Z21A 1ULYA 2EFOA 1CF7B 4M6VA 1J0RA 3B02A 3BR3A 3LA3A 4PJLA 5E1XA 2AXTC 3OSGA 5E20A 3H0GJ 2EZLA 1MBKA 2W1OA 2EV5A 3EPZA 3LSRA 2RQPA 2XHKA 2MGQA 4U7DA 3VODA 4YFNF 4Y3OA 3NAUA 1I50J 2FSWA 1KQ0A 4PJMA 5IOZA 3D1NI 2V6EA 1MKMA 1LUJB 1S7AA 2X6XA 3RKWA 4YIFA 3S8PA 2ZCWA 3FBNB 3HRUA 1RZ4A 2QKLB 4ETSA 1DQUA 4XMYA 1ZAOA 2P4WA 1F43A 1F1ZA 1MMAA 3I0TA 1DGRM 4CO8A 3LAJA 1XSDA 2VB6A 1ZYRF 4HX8A 3TO9A 1BBYA 3PL8A 4EM2A 4KYWA 1TWHJ 5E17F 5DD8A 1RKTA 4FCYA 3IAS2 1T95A 1YFHA 1FYKA 3IUOA 3KP6A 2HVSA 2M0CA 1IN7A 4BS9A 1TW3A 3I3LA 2IS1A 4E7SA 2W25A 2JRTA 1B8IA 1GV2A 2LSOA 3BR6A 2PMZA 3ONQA 4R8HA 4XRFA 3JRHA 3W2VA 4HX4A 4DNCA 4II2A 1Z1DA 2GM4A 4F3QA 2J5PA 1SD4A 1IW7F 1X4PA 4EEFG 3CJTB 5M5WJ 4I09A 2PFBA 3M1CA 4E7IA 1WJBA 2OCCH 3I71A 2PN6A 2R7UA 2DT5A 3M7GA 4IPAA 1KYZA 2DPDA 2XGEA 1TZLA 2OU2A 1R36A 2M4GA 2DT7B 3HSFA 3ZP5A 1RUOA 1OISA 5LGUA 4NQWA 2CV2A 2YSRA 3CJRB 4HG2A 4A12A 2FF4A 2L7FP 3V42A 4YIRX 4OIOF 3GCMA 1J5YA 4HEA2 5IOYA 4CCKA 4UVAA 4LIUA 1SVMA 5M3FJ 4E7HA 3LSTA 3C2HA 1LE8A 2E36A 5IP7J 2MBFA 3VOEA 2F4MB 2CQNA 2UWMA 2KIUA 3MVPA 2O9LA 2NVQJ 1XGSA 2LKPA 3HOTA 1BL0A 5KAFC 2DDAA 1QA6A 2IS4A 1K61A 2WADA 2HOAA 4K2EA 4MFEA 1REPC 2LP0A 3BR2A 3HPHA 2VOPA 4A3CJ 3HC7A 1U9OA 4BJ6C 3A03A 5L3CA 3H5AA 3R0JA 5D6EA 3FKJA 3HRTA 3BJAA 1R9TJ 3A01A 2H8RA 3WTTC 2UZKA 2UV1A 2BEOA 5D5XB 3NWTA 4BHCA 3J80Z 1W5SA 2H6BA 5J8FA 2Y9ZA 1FY7A 1S8NA 1RESA 3KZZA 3QYFA 3V8LA 4XONA 3LQRA 1DGWY 2STWA 2QENA 5E8IA 5JVGF 4P9FA 5EDNA 5LBQA 3CCEI 2LY1A 5CKTA 3S1RJ 1GV5A 4ASNA 1FOYA 4UHTA 1ETQA 4E4HA 1XX5A 1Y6IA 3KYDB 2V9PA 2LC2A 2VJ4A 4CCMA 1MBFA 3LSMA 2COMA 2X6YA 1C0WA 2PX9A 2O3FA 2D1HA 4HSRA 3QODA 3PUBA 3RPUD 3F8MA 2FBIA 1P7IA 2IPQX 4HLXA 1RR8C 1ZLJA 5J1UA 2VC0A 1FLIA 3HZJA 4LMYA 4U87A 2XUBA 3HKZN 3Q3SA 1BM9A 1S3JA 3JRBA 1N78A 1T56A 2JRMA 4C2TA 2L5QA 2L9VA 2MYSA 1RIOH 1YITI 1XGOA 4PSXA 2WAFA 1S72I 2IEKA 3OS0A 3G1LA 1X2MA 4CHUA 4DGWB 1B8IB 3CJQB 4WCGA 2M9HA 3FK7A 4PCQA 4B48A 2LG4A 3MKWB 4Z6YA 1S29A 1YLFA 2Z5UA 2WB1A 1H9TA 1MMDA 4WF2A 2M1BA 4BEHA 4DBQA 3UKGA 2JMWA 1NTCA 3K1PA 3L2VA 3MZHA 2WY7Q 3H0DA 1IG7A 1Z0XA 2A6TA 4LK1F 1R49A 4B44A 2CSOA 4FE7A 2OZUA 4M3DA 3WGIA 3K9TA 3OYDA 4BJ5C 1W0TA 2ECBA 2EFQA 2A68F 4IXAA 3S32A 3C18A 3S2DJ 4NQWB 2FNPA 5FJ8J 3CMMA 3K1MA 3J7ZI 1K78A 4A93J 1B9MA 3RCOA 2GXAA 4UUVA 2A5YB 3GTKJ 3O8GA 2WA0A 3PM1A 3OS2A 1LFPA 4RAYA 1Y0UA 2DA5A 1XB4A 1LE8B 2VQGA 4BH9A 5J1RA 2NS0A 2ISZA 5CVIA 4XSXF 2MW8A 3ZQ7A 4XN0A 4A69C 1Z6TA 2HNHA 4GO1A 3ROUA 2G7HA 2W7NA 4XQFA 4C3JJ 2LKSA 4C30A 4O3MA 4BHPA 1VZ0A 5HDGA 2VLAA 5E1ZB 1JXSA 2H8WA 1MMSA 1N75A 2KZGA 2TCTA 1JUPA 4I6ZA 3ESWB 1B4AA 3S14J 4BXFA 5IP6A 3A01B 2GBYA 3H1CA 3TP3A 2KQRA 3OL3A 3PO3J 5E3MA 2OJED 3P9IA 2WAEA 3I5UA 3PSIA 4ENNA 5F0HA 2FE3A 5LRRA 2L01A 1Q1VA 2W00A 4EQQA 3AAFA 4GDFA 2X1DA 5KHDA 5HODA 2ZMEA 2EB7A 5HS8A 5CPRB 2VBXA 3M8FA 1WI3A 3VYUB 3IWZA 4RA2A 4FE4A 4II3A 3OIOA 2HYGD 2DMUA 4EMSA 4BY1J 3J7AY 2R7TA 1YYVA 3GFIA 1O3TA 4PUSA 3KYCB 2P5LC 1O3RA 1B72A 1UG0A 5IYBJ 2JVHA 5D4SA 3OV8A 3CJNA 4O5VA 1DDNA 1WH5A 2COBA 5J3LA 3WU2C 4HRIA 3D5SC 2Y9YA 2MH9A 2Y69H 1ZGWA 4KIBA 4AYBA 4IHWA 4W1UA 1QHGA 2CFOA 2YX7A 1VQ7I 2E1CA 3FIWA 3IH4A 1DP3A 3VYSB 2RC4A 3QOEA 5EYRA 3TGNA 1FYLA 2MD0A 2CH0A 3PO2J 2LREA 1LNWA 3GF2A 3LNQA 1LKXA 1Z91A 4G94A 3F3XA 4CCNA 4OMYA 1W7PA 4BEHB 1AOYA 4V2GA 2ZMEC 5HLGA 3H3UA 4RBOA 4DZPA 1FZPB 3V4GA 1PP8F 4AU7A 5CQEA 1XTAA 3ZGKA 2XPUA 5D5VB 5HS9A 4YRVA 2KLOA 1DU6A 3TO7A 1V5FA 4IKFA 3PSFA 1ORKA 3CCQI 3RYPA 2LF8A 3QPLA 1APLC 4UY8I 2P8TA 3T8TA 4Z2YA 2AO9A 3TO6A 4AIKA 3QU6A 5CJ9A 3BR0A 2LR8A 4MO7A 3PIOF 1K78B 1R7JA 1QVTA 1YX5A 3ZN0A 3QPSA 2D45A 1LJ9A 4ENMA 3EUAA 5ICEA 1K6OA 1ZG5A 2XC7A 1GVDA 3ZMSA 1TNTA 2PBIA 2XGDA 2LY2A 3ZMVA 3U21A 3DU5A 3I64A 3S3OA 4MEYF 2H1KA 2XF6A 2BHYA 4AUXA 1LFUP 4XK4A 3L7WA 2HOSA 3O2PE 1LQ1A 4RMNA 3ZQLA 2K27A 3VSLA 1USTA 1IV6A 1UG2A 2BXYA 3FBIB 2K7LA 3A0BC 1E3HA 3MCZA 2VE9A 1SANA 2F5VA 2VJJA 3G1MA 3HSRA 1XS9A 4A3JJ 1J2XA 1QZEA 3KP3A 1G4DA 4RGXA 4D7NA 3BCBA 2OD5A 1MSEC 2HU9A 4GGGA 4LJZF 5CVVA 2GWRA 4E7JA 1YW7A 3CDLA 5FD5A 4G6QA 1LDJA 5HLTA 4L5IA 2A6HF 2ZMEB 1MBEA 4KN4X 1B1BA 2F5DA 3GTOJ 3GXOA 4I02A 4IEJA 4WXDA 3MEXA 1JUMA 1ZRFA 4F7ZA 3K4JA 2ZSHB 3M07A 5LRSA 2EJRA 1B72B 2PMHA 4M9XA 3S1NJ 4MTDA 1UHSA 4BGDA 1SC7A 4Y33A 3TQNA 2EH3A 2ZXIA 3B6AA 2V26A 5IP9J 5LGNA 2B9SA 2M5WA 3HUGA 5F27A 3IP4B 1BI0A 1QZZA 2V9KA 3NEUA 3AKZA 1VI0A 3BTIA 1KU2A 3W2AA 1I1SA 3DQVC 2K5CA 1QZYA 3HOVJ 1MD0A 1MMNA 1ZR4A 4OIQF 5GTIC 5KVRA 2CS3A 2DPUA 4LK0F 2XPWA 3GFJA 3CCYA 3SEQA 1WFXA 1EJ9A 3WE2A 2BBYA 4D0PA 3OR1C 2L3DA 1WCMJ 3MQ0A 2ZNYA 4XLEA 4LB6B 1FSEA 1UJ8A 3ZOBA 4NB5A 1W7PB 2TDXA 4HDUA 4PFPA 1E0EA 4HAMA 3WTVC 3DLAA 2VJIA 2JK3A 2E35A 4AVPA 1V5EA 4BE1A 4XICA 1W36C 1D1BA 2JJ7A 5K7FA 5ED4A 2QSFX 3BPXA 3DBHB 1YO5C 4A3MJ 2IAIA 5F08A 2WWYA 1GXPA 1VQ5I 5B5EC 4ZYEA 2LK2A 3ERMA 4HSTA 5BMZA 1FOWA 2DA4A 4BJTA 3CCLI 2CYYA 2Y75A 4I2OA 5FLXZ 4X0GA 4J01A 4LLLA 4A0XA 2ACJA 2HS5A 3H5NA 4IHTA 3H9GA 3WTZA 1D3YA 1R4NB 3MFKA 2XAQA 2W4SA 3OYAA 2Z3YA 3QPTA 1XC5A 4G7ZF 1MMGA 2EV0A 3BG5A 4JX5A 5D6FA 4KA4A 4BXUA 5HOOA 2BY1A 2MG4A 3KZYA 2XGXA 4RAFA 2I8DA 1IV8A 1VQ4I 2EBIA 2OTJI 2BHZA 3DP7A 3EUHC 1X1DA 4U0WA 3SZGA 1EKEA 4HNTA 2R7FA 2LKXA 4F52A 1TLHB 3CMYA 1RR7A 2DMTA 2RAEA 3RKQA 4BQOA 1FIPA 1BI2A 5J8CA 1HW2A 1G2HA 4R79A 2W57A 5ILSA 2DN0A 2IBDA 3DKWA 2X0LA 4JQFA 2DW4A 4HV5A 1F36A 1YW8A 1G3YA 4C3HJ 5EF6A 1DUXC 4BE0A 3A0HC 2VXZA 3DBRB 2UUZA 2LFBA 4MFDA 4CZCA 1TWGJ 1A35A 4L0ZB 2XSDC 4UB8C 1R5HA 1XG1A 1HC8A 3V7SA 4A3KJ 3KP2A 4ZTFA 2L7ZA 2XGCA 3COAC 4DJAA 4A6DA 2H6CA 2KT0A 1JKRC 5EJCA 1KYWA 3QP6A 1YOVB 2O6GE 2RN7A 3HUGB 1SVLA 3I9V2 4V2FA 3OOPA 2V79A 2MABA 2L02A 2V1DA 2CQKA 5FKMA 4L9TA 4CA0A 3JSPA 4DW6A 2FD5A 5E1WA 3BOQA 1F5TA 3OR2C 4KT5C 4AIDA 2AQEA 1EF4A 4FX4A 4YIIA 5J6XA 3GO5A 3JTHA 1QNTA 1R6RA 4MTEA 3G1OA 3Q0UA 2G7UA 4IX7A 3JTGA 5GAGJ 1SFOJ 1TQIA 3GW2A 3FM5A 1EA3A 5IT9Z 1USSA 3BZCA 2CWEA 2W84A 3E97A 4A5NA 4B43A 2R5ZA 2ZFWA 3J81Z 2WBMA 2Y0SA 4DIQA 5F1RA 4XKBA 2EZHA 2VBYA 3KP4A 3CCUI 1MSFC 2OQGA 1K4TA 5GTHC 5L3EA 3J80K 3MD2A 5DCMA 5IPAA 1W5CC 3RQ4A 2YU3A 2QLZA 3E6DA 2FRHA 1ON2A 1JUSA 1H8AC 1P4XA 4I76A 3E5QA 2Q0OA 2X6WA 4IRHA 2K9NA 2KZVA 5DTDA 2DYSH 3CO7C 4IHVA 1YE9A 1VF9A 5J4VA 4A0ZA 2Y2ZA 1D0YA 2KKOA 4RB0A 1GUUA 3HG9A 1Y56A 5FKOA 4HLYA 3GTGJ 1OYIA 3G3ZA 2F4IA 2KFDA 2HPMA 2M0MA 4BAYA 2R3SA 3FZVA 1Y1WJ 2E1OA 5F1JA 3FMSA 4JBAA 1V55H 3LSPA 2DU9A 1YW9A 3I4PA 2ESHA 2XVCA 3CLOA 2YU9J 2VODA 5E18F 4A3IJ 2FMYA 2K02A 2NXNB 2NS8A 3IV5A 2BOLA 5M5XJ 4WK8F 4IO9F 1I3QJ 5KCMA 3FF5A 1OCRH 3QYBA 4U0YA 1QQIA 4HW0A 3OYMA 5FLMJ 2CQXA 2E60A 2IGKA 1S7OA 1S6LA 1OCCH 1D1CA 2EWNA 2IW5A 4C9YA 3RDIA 1TWCJ 2LDUA 2V1NA 3PQKA 3R6SA 4CXFA 1R71A 3IH2A 4QSHA 4UUSB 2M4KA 3WHCA 3QU3A 1K79A 3M1EA 3BQYA 3MKZA 2AXLA 2R7VA 3SYTA 1G6NA 2LTPA 5F04A 2OC6A 1FBUA 4PFOA 3E6CC 1JE8A 3R60A 2GIZA 4S0HB 3I58A 2AQFA 3ABKH 1ONVA 4PDKA 3WTSC 2KP6A 4M3GA 1YIOA 5K7ZA 1B9NA 1I27A 3OYLA 1UFMA 1D5YA 4QPOA 2ADUA 5LHGA 2QM3A 1S9HA 4H4KC 3AG4H 1TL8A 2KIQA 4B47A 2VPLA 2X1EA 4HBLA 4ON0A 2R5ZB 5E3LA 2CRGA 2WV0A 1BIBA 3RJPA 5IY5H 1R00A 2MD5A 1GDTA 4IHSA 2QQBA 4M6XA 2IA2A 3RI4A 3PIPF 3GTJJ 2QUFA 3FX3A 4G8XA 4AYBN 1KONA 3DV8A 4Y15A 5DCMB 3C2GA 2IA0A 1ZG1A 2FOKA 1ZG3A 1WJDA 2IA1A 2DK5A 2BZTA 2NS7A 4I98B 4IOAF 5DV5A 1MBGA 2WAQN 1BR4A 2EIJH 5J40A 4MQVA 1FP2A 3DCFA 5CVJA 4DOZA 4XLHA 2HTSA 1FC3A 3VYRB 3CF2A 1X3ZB 2EFPA 1IXSB 3HYIA 3BDDA 2CW8A 4XSZF 4ESJA 5BPIA 2FJ1A 1UAAA 4LD5A 3IKVA 4P96A 3OYEA 1Y39A 1QPMA 4QPQA 5CVUA 2FA5A 3KFWX 3J7AO 1BI3A 3PFYA 3ZQIA 1O3SA 2R92J 3E7LA 5JVTA 1ZR2A 4Y7NJ 2HOEA 2ZFUA 3GZ5A 3HPGA 2HQNA 5J4YA 2XV4S 1ERDA 1X3WB 4MHGA 4L9JA 2CW7A 5E8GA 1WI9A 1OCTC 1PVEA 5BOXA 2HWVA 5H2FC 3GX4X 1HSJA 2ZJ2A 1LDKB 2Z1DA 1LVAA 3LMMA 2X4HA 3DTKA 2NAZA 1IUFA 1ZK8A 2CQQA 2KMUA 4KFCA 2ZNZA 2R7DA 3H35A 1BN5A 1BI1A 2R7SA 2E2JJ 1ZHFA 1XGNA 2KJCA 2QQ9A 3E0JB 4XLPF 4FASD 5FROA 1V4RA 1W5TA 2PJRA 2EPFA 1YJWI 3WTWC 1L0OC 5B1BH 1VQ6I 3TOBA 4B3XA 5C4XJ 3N05A 1HOMA 2IS6A 1FBSA 3K4LA 5GAHJ 2VJ5A 1QHHD 1R58A 2MH2A 1MJBA 1NH3A 3CUQA 1ETYA 3MN2A 4E7LA 2IS2A 3KP5A 3K4CA 5JHFA 4DQ2A 4KITB 4HNUA 4FHTA 1Z3XA 2K4JA 3QWLA 2HPIA 3BP8A 1OYYA 3CP8A 5DCFA 3U2RA 1WJ5A 2EZIA 5KK1A 4BXXJ 3JRIA 2F5FA 4U7BA 2CV0A 5FO5A 3FM3A 3HEFA 1Z67A 3WGGA 1HQCA 3M4OJ 3DBLB 4KJZA 4YELA 1WZ2A 5EEAA 1K7AA 3GEZA 4V19K 1R23A 2N8GA 2W24A 4NC7A 3GMEA 3T8RA 1FOXA 4BNCA 3HB9A 3BQZA 2XAFA 3GFLA 1FYMA 2R7RA 3ZMZA 1PYVA 2CV1A 1D8JA 4OU0A 2D1VA 3F72A 3VPRA 2LMDA 1H89C 2IP2A 4IHXA 5GPCA 3BLYA 1BJZA 2DCEA 1LFBA 1WWXA 2FMLA 2F4OB 3RSNA 1ZTRA 4BY7J 2YPRA 4XR6A 4XRSG 4CYCB 4XKCA 3CUQC 1V54H 2I10A 2RGVA 4BQNA 2GLOA 2XB5A 3RKYA 3F23A 4BL0B 4UXNA 1FMVA 5DDGA 1IRGA 2KPMA 1JI8A 1Z77A 3CF5F 3HBLA 1ETKA 3GVAA 4A3FJ 3JRFA 4LLGF 3NRVA 4EGYA 1Z9CA 1F9NA 2NNNA 2HVQA 3RQIA 1STZA 1RETA 3BROA 3ZQCA 4RM3A 4IZZA 2HXIA 3L09A 3OYBA 1X2NA 2V7FA 5HNHA 4O6JA 2E5NA 2ISYA 3ASOH 3GBGA 1VTNC 1KQ9A 4KISA 3CTAA 1G3TA 1ZGAA 1I5ZA 2PMUA 1Z7LA 2NOJB 3LSKA 2NYXA 3K69A 4P5OA 1ZH5A 1OQYA 1YHQI 3OIQA 5CYVA 2IXSA 3F6OA 3GYHX 3O6BB 3JR9A 1FJLA 4IQJA 2Y48A 4ZYHA 1YJ9I 1I6HJ 2QGUA 5HVQC 4CH7A 2H27A 3S15J 1ZELA 2IVMA 2BW3B 3GUDA 4EVIA 1K83J 4OWRB 3S93A 4KIGA 4QWQA 3SDBA 4A6EA 3B6CA 4XRMA 2BYVE 2RDPA 5LD2C 3T0YA 4EM1A 2UXNA 3FXJA 1H9GA 3ZN1A 2JA2A 2XRLA 2DQLA 4GYIA 2EA2A 4W97A 2PJRB 3J7YJ 4AC0A 1R1TA 3CCSI 3HDDA 2VT3A 2IJLA 3CQZJ 3HHGA 2A07F 4MLOA 1ZRDA 1GHCA 5EEHA 2QQ8A 4NC8A 3CUQB 2EK5A 1A6QA 1XSXA 2XDVA 4DYCA 4B4CA 3BTLA 4P1WA 1MGTA 1D0ZA 2X1CA 3RYRA 3MKLA 3ULQB 1P6RA 2OV7A 4TV7A 4RB2C 2MC4A 1UMQA 3MMYB 1UCRA 2JWTA 2F2EA 3QAHA 2V9VA 4LB5A 1SFXA 2GXGA 2VC1A 3HXLA 3O8HA 5E3NA 2HQRA 3DPUA 4XKVA 1DP7P 3CC4I 4Y13A 4C2MJ 4AD9A 1XPXA 3ZQFA 5BQTA 2E7XA 2OA4A 2P5KA 3DU6A 2W48A 3K2AA 2J5OA 3ZCOA 1ETWA 3K1NA 2ECCA 1YRNA 2FBKA 1J59A 1WPKA 1HCRA 4C3IJ 3DXJF 1HW5A 3LQQA 1MIJA 5C3EJ 3OYFA 2OUMA 4A2UA 5DUKA 4XLAA 1KZHA 3HRMA 3U1DA 2DAOA 3WTUC 2WV1A 1FOKA 1IDZA 4HQMA 5ERIA 1LPQA 2RVCA 1W4MA 2BY3A 3NWSA 2NVYJ 1YTYA 4RGSA 1RC9A 3GTLJ 5F0FA 1OPCA 1Z3YA 1J9IA 2E7WA 1A5JA 4XRSA 3S3MA 2DA6A 2JPCA 4XKWA 3DWLE 4J00A 1BJAA 4PK4A 2O0YA 2Q2EA 5EZHA 3VFZA 4EJUA 2DFEA 2IRFG 2DMNA 2HQ5A 3BJOA 3HJEA 3FDYA 4XNFA 3IHUA 1YQAA 2DBBA 2G0EA 3WU0A 3QOPA 4Q5SF 1HW1A 2DFFA 5JHUA 1HA8A 3SZPA 5IT9K 4A0YA 1V5GA 1RUNA 2NVTJ 3S17J 3G6EI 4FISA 3EETA 3JCUC 3J81K 3ZQQA 2BY0A 1Z6RA 3IRRA 4HQEA 4I01A 1NG7A 3PNYA 4Y4RA 3JAMZ 3S2WA 5IYDJ 2R4GA 2W82A 4FX0A 2K3FA 4AIJA 2LRDA 3ASNH 1U2WA 3WG9A 4MGRA 3E5XA 3FK6A 4IL6C 1PJRA 3HOWJ 1U8BA 5H20A 1Y8RB 1IO2A 3DEWA 4IJAA 3EYYA 2HDWA 2FXAA 3AL0C 2ICWG 3GZ6A 2XF5A 2FQ3A 1AWCA 4B09A 4DYRA 2XB0X 2QA4I 4GYGA 2B0LA 3TBIA 3AFHA 3S2HJ 2ZKZA 2X6OA 3SZTA 1ON1A 1WKMA 5HDKA 5EZGA 2NVUB 1TBXA 3P9KA 3HHHA 4EJOA 1U6GA 2HYFA 1KGSA 2VXDA 3LSHA 1WJAA 3K70D 1VQMI 1ETOA 4PZJA 5GPAA 1OR7A 2OF7A 2RNJA 3AG3H 2M3AA 2RNGA 1QU3A 4M73A 4WXHA 3S3NA 1XD7A 2EILH 1YRNB 2MSYA 4CZZA 3BTJA 2ELJA 1WJCA 3EUHA 4Q47A 2CUJA 3PJRA 2MC3A 1ZGJA 3R61A 1SFKA 4XORA 2ID6A 2DTZA 2FUG2 3G71I 3JW4A 1WQ2A 5LEJA 3FHZA 1ZRCA 4F93B 3OYNA 1GT0C 3E5UA 5HDNA 1WHUA 2HGCA 4L18B 2P6TA 2PMZN 4IRGA 4L5JA 3LAPA 3K7AJ 1HKTA 2EIKH 3ELKA 5F64A 2HI3A 4M3FA 4CICA 4YFXF 5C4JJ 3H5RA 3KEQA 3CDIA 2E34A 2CJJA 2DMQA 3HTUA 4L5EA 4AWXB 4CCLA 1ZARA 2Q2EB 1OR7C 3ZQGA 5ILVA 3V7CA 1X1CA 4U0VA 1HBXG 1PUFA 3AL0B 3DTEA 2VI6A 4QTRA 3P9CA 3GTQJ 5LLQA 2PG4A 5B1AH 3FMQA 4UV9A 4RLQA 5LGTA 2X9DA 3TEDA 3L2QA 4KUMA 2QBYA 1BA5A 1R1VA 3B73A 2PLYA 1I1GA 3TL4X 2KISA 2E71A 5FB2A 2K9MA 1OYWA 2DOEA 2ELHA 3BY6A 3CESA 4F55A 1JT0A 2E2IJ 1IRZA 1SD6A 5IYCJ 5F6FA 1X4OA 4RB3C 2M2EA 2LBFA 3LFUA 4L9VA 1HF0A 3MZ8A 3UNGC 1BC8C 1O3QA 2VKEA 2E2HJ 2R7WA 5IT3A 1QVUA 5DEQA 5HNFA 2QSHX 3H3VK 4JYKA 2HDCA 1IUYA 5F0CA 4CGZA 1U5TA 2KL4A 4Y52J 2JZYA 1MDMB 3I56I 5KNLA 3QP5A 1T2KA 2FX0A 3VSKA 1A31A 2O7OA 2VL8A 2M45A 4HF1A 4UUSA 4NBQA 3HRSA 1A6IA 3IKTA 5JLWA 3CO6C 2LVSA 4ZYDA 1N25A 2ID3A 3JREA 1GXQA 3LOCA 5FRMA 4AM3A 1WH7A 3TP0A 1R4MB 3FHNA 5D4RA 2QWWA 4Q4ZF 3TDUC 2R7QA 1P4AA 2NRAC 2OQRA 1CGPA 3MWMA 2ZXJA 2DOAA 2QQAA 4N9HA 2Z99A 1FP1D 2XPVA 1NK2P 3ECOA 1BOBA 1KQ8A 3C2BA 4E6KG 3DKYA 2GIVA 2Z33A 6PAXA 2IT0A 1B59A 4Y17A 1BW6A 2EFNA 2L9RA 5CLSA 2LF7A 2LLKA 4BHBA 1WSUA 1U5TC 1HKSA 2ME0A 2DA1A 4EJTA 2F48A 3A1YA 3L00A 1GLNA 1YS7A 1S7EA 1IJWC 2EFWA 1AA7A 2V6CA 2A69F 2PQ8A 3ABTA 3VYTB 3FMRA 4BYYA 5LHHA 5D5WB 3IC7A 2DFHA 4WWCA 1R22A 1IRXA 2DQRA 5JLXA 4I0BA 3DPLC 1AHDP 2K86A 1BOAA 1JKOC 1YX3A 2K4BA 4RAZA 5TGTA 4MEXF 4OIPF 2Z16A 5EG0A 2CUEA 2WB1N 2YR2A 1RKWA 4KT6A 4A5MA 2ETHA 3U1KA 3M3YJ 1JHHA 4FETA 5DS9A 5BPDA 2JPBA 3CLQA 5L3FA 3M8JA 4LG0A 1AU7A 1P2FA 2H09A 4HF0A 3F8BA 3L2CA 2GOXB 1PUFB 1Y0NA 4ZDLA 1G3SA 4NC6A 1VQ8I 2QBYB 1XN7A 1EH6A 2X48A 1U78A 1PP7U 4F92B 3KZIC 3FXUA 3LL7A 4OMZA 3W6VA 4PJJA 4XL9A 5K5OA 4I0AA 1VNDA 5FRNA 2MA3A 2EQRA 1FTTA 4BKXA 2WY8Q 3AG2H 2LBFB 2E1NA 3KEYA 5LHIA 2M87A 1X3UA 3LSGA 1Y1VJ 1U9NA 3X2QH 4D5FA 3I4NJ 3SJMA 1U5TB 4GXOA 2Z9OA 1YS6A 1VQPI 1ITYA 4EM0B 2CUFA 3FXQA 1I6XA 2L9SA 4M3EA 1FPQA 3HL2A 3R0AA 5BNGA 2HDDA 2DMPA 2XRNA 4YG2F 4P9UA 1TQMA 2Q1ZB 1JT6A 2CFXA 5B3SH 1VQ9I 5LEKA 2YS9A 3HM5A 1O4XA 1X58A 1XMXA 2GXBA 4BUPA 3JRCA 4MNUA 4A3LJ 2I5UA 1QRYA 2DOFA 4N0BA 4KNYA 5ILUA 3L2UA 1SMYF 1T6SA 4NHJA 5FKNA 2K3PA 4XN3A 4S05A 3F8NA 1RPWA 2M34A 1D8KA 2VBWA 4J19A 1EH8A 1X19A 5HLIA 2R5YA 1MBHA 2HVRA 1RI7A 1P4WA 3I59A 1U0JA 3O3KA 2M30A 3G4SI 1ZKGA 2VKHA 3CUOA 1DPRA 1MNDA 1V3FA 2B7EA 1R5GA 3MZYA 4B3AA 1U3EM 5FLVA 1MH4A 1LVKA 3BPVA 1P9QC 3BZ6A 4G12A 3HOZJ 1FTZA 2DJNA 2OAZA 4CDGA 2P7VB 2Y0MA 4XOPA 1D0XA 4CYCA 3KP7A 1N77A 5JI6A 3SFIA 4B1RA 5EG0B 1E3PA 3FXMA 2JVGA 2A5WA 2XSJC 2FNAA 4MQ9F 4AVZA 1TWAJ 2Y31A 2ESNA 2ME6A 4ABZA 1HXDA 2KJBA 2XAUA 1MNMC 4LITA 3DKXA 3K4NA 2F5EA 4ZH4F 4LG0B 1FEXA 4JP0A 2AHQA 4IQ4A 3L1PA 3ABMH 3CP2A 1PUEE 4YEJA 2GOMA 3G73A 4X6AJ 2HFHA 2K9QA 3UR3C 4DYQA 2JSCA 2DTRA 3TDZC 1IN4A 1XMAA 3H3ZA 4X1EA 3ECHA 5ICFA 3ERED 4G6TB 1POGA 1MW7A 4GCVA 2YX4A 4B8XA 2JSPA 1KA8A 3KLOA 4XLNF 4E7KA 2FEZA 3OYCA 2BW3A 3CCJI 2L9NA 2Z2SB 3FKIJ 4ZZDA 3HGGA 3LSJA 3HOYJ 3GTPJ 2QF7A 1IAWA 2GA2A 3RIRA 4ZC3A 4R1HA 5JR3A 3DEUA 1UZCA 1M1EB 2L7KA 4NDLA 1XDUA 2DFIA 2FOWA 4KMUX 3PQJA 2XAJA 1A36A 4A3GJ 3BG7A 5L3GA 2BXZA 1T08B 2RQQA 2O61A 2D2WA 2FBHA 3F22A 4XM3A 1SFUA 2JA6J 3BT9A 2BY2A 2XASA 3BG6A 2P6SA 4MIMA 3HSEA 3DPTA 5A2QZ 2ZB9A 3E6MA 2E19A 2W85A 1B6AA 1MBJA 1IRFA 2A6EF 4ENJA 3Q9SA 5TISC 2JUGA 5K1YA 3REOA 2R5YB 1NK3P 1MNEA 3W6JB 3L2WA 3I59B 3RZDJ 1ODDA 4M3BA 3VWBA 3I55I 3E1SA 4BE2A 2VOOA 4KN7X 2DODA 5M5YJ 1FX7A 4RS8A 3WHBA 1XCVA 1IXCA 1QO0D 3OYKA 3I4MJ 2KRCA 2JA7J 5FKLA 3EDPA 3JAMK 1HLVA 3NQOA 4XIDA 3ABUA 1UHWA 3OY9A 3BG3A 1IN8A 1T0FA 3A02A 4JX6A 2XAGA 5FFZA 3W3CA 3T5XA 4ESBA 5H6QA 2NVXJ 2HEOA 2KRHA 4BDZA 1IXRC 1WJFA 4RGRA 2K85A 4XLCA 4CCOA 4CSWA 1JGSA 2DDBA 5FD6A 3F8CA 4HF2A 1YIJI 5D8KB 4HV6A 3A4CA 3GZNB 4M9ZA 1MZBA 3WU1B 2QVOA 4N4OB 2K9LA 4PJNA 2OZ6A 1IN6A 1IGNA 2NOGA 2IGNA 4ESFA 1OKRA 2QKMB 5J1YA 1PDNC 2O8KA 3LA2A 1G59A 4EGZA 2DLLA 4U88A 5L3BA 3K4MA 2EINH 3CC7I 4XOTA 4ZTJA 1T98A 4RM2A 1H88C 1OMIA 2DYRH 1IZ1A 3N97A 3M9AA 3RPUA 3DF8A 5EGOA 2CO5A 4ITVA 2RKHA 4G7HF 2R7OA 3S1QJ 1H0MA 1W7PD 3WGHA 2NNYA 1T0FC 3V8JA 3HIFA 2RV8A 3HGYA 4BACA 3EYIA 3S16J 3IH3A 2UXXA 3SEZA 1IF1A 4XLFA 3OS1A 2VQLA 4LOCA 3ZRGA 3S1MJ 2M8EA 2XROA 2QCOA 2VQHA 1BW5A 1ETVA 4PSWA 4ZYAA 5GP9A 2VN2A 5E79C 2M7AA 3OYHA 3BR5A 3AG1H 1OLTA 4P55A 2E5ZA 2V4JC 3FXLA 2VKVA 3LA7A 3D0SA 2M7BA 3K6GA 5FLXK 2DJIA 1A04A 3QPHA 3WTYC 3H92A 4KIFA 3K4BA 1MH3A 3IAM2 1VQNI 2L4AA 2OCEA 9ANTA 2JN6A 3R4KA 3BWGA 4DBRA 3HOSA 4QIWN 3F8FA 1XDSA 5E3OA 1EV7A 2VBZA 3RTRA 5B66C 3ZMUA 2WC2A 4ZDOA 2QZ8A 5C44J 5LFAA 2M8GX 3VB2A 1P92A 3CDHA 2ELKA 4GRIA 3GTMJ 2A05A 4EATA 2B63J 5K7HA 3OL4A 3D5LA 2HYJA 4OOIA 4E7ZA 2A61A 3LFKA 2OTLI 5BS6A 2DT6A 1K4SA 1VQOI 2AS5F 3MAJA 1YJNI 3BTCA 1IN5A 5DD4A 2XF7A 4RGUA 4LLNA 3ML6A 3K0LA 3WG7H 3TOAA 1CQTA 1XCBA 1OCOH 2CMPA 2WTEA 2GQQA 3LWFA 3BZKA 2E1MC 1HDDC 3Q5FA 3KE2A 1Q1HA 2L54A 4KMFA 4ZYGA 4LIVA 4UV8A 2HTJA 2WAQA 5DM6F 3SXYA 1LDDA 1TP4A 1KU3A 2ZJPF 1XMKA 3CMAI 3DFGA 3I53A 1FIAA 4M9SA 3F6VA 3CZ6A 2JA8J 3BR1A 4I99C 3ZMDA 1W36D 2FQ4A 1DPUA 2V1XA 4OIRF 3C3WA 3PUFA 2BV6A 4M6YA 2Y0SN 3FXOA 5HS7A 3ZQHA 1I39A 4BBRJ 3SQNA 2JUCA 1VQLI 4UB6C 4HYEA 2P0WA 1Y8QB 1LB2A 2Q8KA 3PFIA 4A3DJ 4LGWA 4UUTA 4I7HA 3EUKL 1T8IA 4XBFA 3LSIA 2HOTA 2HXOA 2VONA 4JK1X 3GLLA 3OIPA 4M74A 3H36A 3OMYA 2IGMA 3ZPLA 2GA1A 5AIPA 3CCVI 2R7XA 4NUBA 3VEPA 3H9JA 5EGOB 3P7NA 2JQ7A 4UNOA 4AIHA 1JTXA 1SAUA 1OCZH 2XIGA 1BC7C 4HZFA 3FISA 5TRDA 1MJ9A 3KETA 3ISPA 1IC8A 4G9YA 3KCCA 4KDPA 1Z05A 1SEUA 2VE8A 1FBQA 4BBSJ 1TW2A 2XKOA 3WODF 3PNVA 1VQKI 4FTHA 2GAUA 3SHFA 2ZC2A 3W2WA 1MDMA 2TRTA 2MFZA 4PJ0C 1LEBA 4RLFA 1HDPA 3OYJA 1W1WE 3KPHA 3D5RC 2E1MB 1TT5B 1J75A 3ZXSA 4QLCU 1O7LA 4FQGA 4IHYA 2JT1A 1BR1A 3T1BA 3KLNA 1FMWA 1R5ID 2EV6A 5DM7F 4CCJA 1NHAA 3HKZA 4D7MA 3P5JA 1P7JA 2RREA 1T38A 5TJJA 1JKQC 4WXCA 4BQAA 3F9KA 2HZDA 4EJVA 4ZZLA 1W0UA 5FGMA 2DA7A 2LNBA 1JHFA 3TMOA 4IF4A 5J47A 4WX9A 1K6YA 1R1UA 2VKDA 2LH9A 2LOOA 1ENHA 2ZSIB 3TW7A 5M3MJ 1TWFJ 1U8RA 3M8EA 5FKKA 3Q0VA 4BQQA 3JSOA 1TNSA 3QYEA 4H0EA 1RNLA 4A3BJ
chains in the Genus database with same CATH topology
1Q1VA 5EG0A 2CUEA 2WB1N 3ZQIA 1RKWA 2R92J 3E7LA 5HODA 3M3YJ 1ZR2A 4Y7NJ 1WI3A 4BY1J 4FE4A 3OIOA 5DS9A 2DMUA 1OCTC 1AU7A 1B72A 5IYBJ 2EZKA 3F0CA 1PUFB 1IUFA 1WH5A 1ZK8A 2COBA 2Y30A 2CQQA 5J3LA 4JX4A 2Y9YA 3HOUJ 2LD5A 1ZGWA 2E2JJ 2X48A 1U78A 4IHWA 4W1UA 2OPTA 3RZOJ 2KDZA 3FIWA 3IH4A 3W6VA 1OFCX 1VNDA 5C4XJ 1HOMA 3JRDA 5EYRA 2EQRA 1FTTA 4BKXA 3PO2J 3LNQA 1ETYA 3MN2A 3LSGA 1E3OC 1Y1VJ 2R0QC 4V2GA 1U9NA 1AKHA 4D5FA 3I4NJ 4RBOA 4DZPA 3SJMA 2D5VA 1VFCA 3Q0WA 1ITYA 2CUFA 2XPUA 1DU6A 2EZIA 4BXXJ 3JRIA 1OJLA 4M3EA 3M4OJ 3HEFA 5BNGA 1JTYA 1ORKA 2HDDA 2DMPA 3QPLA 1APLC 1JT6A 2AO9A 2R7ZJ 3TW6A 5EEAA 2YS9A 3HM5A 2N8GA 1O4XA 3BR0A 1X58A 2VUMJ 2LR8A 4MO7A 3HB9A 3JRCA 3BQZA 1QVTA 4A3LJ 3JRAA 1QRYA 3QPSA 5FKNA 3VPRA 1H89C 1RPWA 2M34A 3SDGA 4IHXA 1GVDA 5GPCA 1BJZA 2XGDA 4J19A 1LFBA 1T33A 1ZTRA 4BY7J 1JJ6C 4XRSG 2R5YA 1MBHA 4CYCB 2H1KA 2I10A 1JJ8C 4AUXA 2GLOA 1ZKGA 1LFUP 4XK4A 2XB5A 4B3AA 2HOSA 1IDYA 1Z77A 5FLVA 3HBLA 3ZQLA 2P81A 1ETKA 1MH4A 2CU7A 4G12A 3JRFA 4A3FJ 1UG2A 1IV6A 3HOZJ 1FTZA 2DJNA 1SANA 1ETXA 3G1MA 1XS9A 3RQIA 1RETA 2L0KA 3ZQCA 4A3JJ 2LY9A 2HXIA 1X2NA 4D7NA 4CYCA 3GBGA 1MSEC 3CDLA 3BG9A 2YUSA 3SFIA 4B1RA 5EG0B 1MBEA 1TWAJ 2Y31A 2ME6A 4ABZA 3GTOJ 4IEJA 1MNMC 1JUMA 4HNVA 1WGXA 4RDUA 3JR9A 1FJLA 3NARA 3QQAA 1I6HJ 1FEXA 4JP0A 2AHQA 1B72B 3L1PA 3S1NJ 3S15J 4X6AJ 3OSFA 1UHSA 2K9QA 1K83J 4DYQA 2EH3A 3B6AA 5IP9J 1JKPC 1QPIA 5F27A 3B6CA 4X1EA 2L7MP 4XRMA 3JRGA 1VI0A 3BTIA 1POGA 2K9SA 2XRLA 4W97A 3HOVJ 2VPRA 4AC0A 1ZR4A 3HDDA 3CQZJ 1ZQ3P 4MLOA 2XPWA 3CCYA 2K40A 2R93J 3FKIJ 1WCMJ 1OCPA 3ZOBA 4GFBA 3HGGA 3LSJA 2DA3A 1AKHB 4DYCA 4B4CA 3OOUA 3BTLA 3HOYJ 3GTPJ 2QF7A 4A3EJ 2DA2A 2JK3A 4XICA 2JJ7A 5K7FA 3MKLA 3HOXJ 4NDLA 1UMQA 2JWTA 4A3MJ 2IAIA 5F08A 3O8HA 5E3NA 1TC3C 4DZJA 4A3GJ 2LK2A 4D5CA 4C2MJ 2DA4A 3ZQFA 2W48A 1JGGA 3K2AA 2JA6J 3BT9A 1ETWA 2JA5J 2ECCA 1YRNA 4MIMA 1WPKA 1DU0A 1HCRA 4C3IJ 5C3EJ 2ZB9A 2E19A 1MBJA 1XC5A 4M6VA 3BG5A 4JX5A 3BR3A 2WV1A 2R5YB 1IDZA 3OSGA 1NK3P 3H0GJ 3RZDJ 2EZLA 1MBKA 2MG4A 2NVYJ 4M3BA 3LSRA 2MGQA 2EBIA 3GTLJ 3NAUA 5F0FA 1I50J 5M5YJ 3WHBA 5IOZA 3D1NI 3I4MJ 2LKXA 2JA7J 5FKLA 4XRSA 1A5JA 2DA6A 3CMYA 2RAEA 1RR7A 2DMTA 1HLVA 3RKQA 4XIDA 1FIPA 1G2HA 3BG3A 5EZHA 3A02A 4JX6A 2DMNA 2HQ5A 2DN0A 1F43A 2NVXJ 2IBDA 1F36A 4C3HJ 5EF6A 2LFBA 4MFDA 2G0EA 1TWGJ 1TWHJ 2XSDC 1RKTA 1XG1A 4FCYA 4A3KJ 3S17J 2NVTJ 2M0CA 1IGNA 4FISA 2NOGA 2L7ZA 1B8IA 1GV2A 2XGCA 5J1YA 2O8KA 3BR6A 2KT0A 1JKRC 3JRHA 5IYDJ 4V2FA 2GM4A 1H88C 4EEFG 5FKMA 5M5WJ 5EGOA 3FK6A 4DW6A 2FD5A 3S1QJ 3HOWJ 1U8BA 1EF4A 3S16J 2XGEA 3DEWA 3G1OA 3HGYA 3Q0UA 3IH3A 1SFOJ 2R5ZA 4LOCA 3S1MJ 2QCOA 4DYRA 2XB0X 1BW5A 1ETVA 2L7FP 2EZHA 3S2HJ 5GP9A 2X6OA 5IOYA 1MSFC 3BR5A 5EZGA 5M3FJ 2VKVA 1LE8A 5IPAA 5IP7J 1JUSA 3MVPA 1ETOA 1H8AC 2O9LA 5GPAA 2NVQJ 2OF7A 1BL0A 4I76A 1K61A 1MH3A 9ANTA 2JN6A 2HOAA 4MFEA 2K9NA 2LP0A 1YRNB 3BR2A 2MSYA 5DTDA 3BTJA 4QIWN 4IHVA 5E3OA 4A3CJ 1U9OA 1VF9A 3A03A 2Y2ZA 2ID6A 5C44J 2DTZA 2M8GX 1R9TJ 3A01A 2H8RA 2ELKA 3GTMJ 1GUUA 2B63J 5K7HA 2HYJA 5FKOA 3GTGJ 1GT0C 3BTCA 1Y1WJ 2E1OA 2Y9ZA 2PMZN 1RESA 3K7AJ 5F1JA 2HI3A 4M3FA 1CQTA 5C4JJ 3LSPA 5EDNA 3S1RJ 1GV5A 1HDDC 2CJJA 2YU9J 1ETQA 4A3IJ 2DMQA 4L5EA 1MBFA 2NS8A 3IV5A 3ZQGA 5M5XJ 1PUFA 1I3QJ 2VI6A 1P7IA 1FIAA 4QTRA 3GTQJ 2JA8J 3BR1A 5J1UA 2X9DA 2FQ4A 3TEDA 5FLMJ 2CQXA 3HKZN 1BA5A 3Q3SA 3JRBA 2Y0SN 1T56A 1TWCJ 3ZQHA 1JT0A 2E2IJ 4BBRJ 3IH2A 4QSHA 1IRZA 4UUSB 3WHCA 5IYCJ 2IEKA 3BQYA 1X2MA 3G1LA 1B8IB 2M9HA 2M2EA 3FK7A 2LTPA 5F04A 4A3DJ 1HF0A 4UUTA 2VKEA 2HOTA 2E2HJ 4S0HB 2HXOA 1QVUA 3UKGA 3H3VK 2JMWA 4JYKA 1NTCA 5F0CA 4Y52J 1IG7A 1Z0XA 5EGOB 4M3GA 1JTXA 2FX0A 5K7ZA 2O7OA 4UUSA 3FISA 4FE7A 4M3DA 1D5YA 1W0TA 1A6IA 1IC8A 2ECBA 5JLWA 2LVSA 2ID3A 2R5ZB 3S2DJ 3JREA 5E3LA 3LOCA 2CRGA 4BBSJ 5FJ8J 4A93J 1WH7A 3TP0A 1GDTA 4FTHA 3GTKJ 3O8GA 3PM1A 2TRTA 3GTJJ 4AYBN 2DA5A 1HDPA 1LE8B 5J1RA 2XPVA 1NK2P 2MW8A 3C2BA 4IHYA 2NS7A 4A69C 1MBGA 1BW6A 2WAQN 4D7MA 2L9RA 3DCFA 4C3JJ 2LLKA 1P7JA 2ME0A 2DA1A 1JKQC 1IJWC 1S7EA 1W0UA 2DA7A 2TCTA 1JUPA 4I6ZA 3S14J 2FJ1A 5IP6A 3A01B 2GBYA 3TP3A 1ENHA 3TW7A 5M3MJ 3PO3J 5E3MA 1TWFJ 5JLXA 1AHDP 5FKKA 3Q0VA 1JKOC 5F0HA 4A3BJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1V A;  5EG0 A;  2CUE A;  2WB1 N;  3ZQI A;  1RKW A;  2R92 J;  3E7L A;  5HOD A;  3M3Y J;  1ZR2 A;  4Y7N J;  1WI3 A;  4BY1 J;  4FE4 A;  3OIO A;  5DS9 A;  2DMU A;  1OCT C;  1AU7 A;  1B72 A;  5IYB J;  2EZK A;  3F0C A;  1PUF B;  1IUF A;  1WH5 A;  1ZK8 A;  2COB A;  2Y30 A;  2CQQ A;  5J3L A;  4JX4 A;  2Y9Y A;  3HOU J;  2LD5 A;  1ZGW A;  2E2J J;  2X48 A;  1U78 A;  4IHW A;  4W1U A;  2OPT A;  3RZO J;  2KDZ A;  3FIW A;  3IH4 A;  3W6V A;  1OFC X;  1VND A;  5C4X J;  1HOM A;  3JRD A;  5EYR A;  2EQR A;  1FTT A;  4BKX A;  3PO2 J;  3LNQ A;  1ETY A;  3MN2 A;  3LSG A;  1E3O C;  1Y1V J;  2R0Q C;  4V2G A;  1U9N A;  1AKH A;  4D5F A;  3I4N J;  4RBO A;  4DZP A;  3SJM A;  2D5V A;  1VFC A;  3Q0W A;  1ITY A;  2CUF A;  2XPU A;  1DU6 A;  2EZI A;  4BXX J;  3JRI A;  1OJL A;  4M3E A;  3M4O J;  3HEF A;  5BNG A;  1JTY A;  1ORK A;  2HDD A;  2DMP A;  3QPL A;  1APL C;  1JT6 A;  2AO9 A;  2R7Z J;  3TW6 A;  5EEA A;  2YS9 A;  3HM5 A;  2N8G A;  1O4X A;  3BR0 A;  1X58 A;  2VUM J;  2LR8 A;  4MO7 A;  3HB9 A;  3JRC A;  3BQZ A;  1QVT A;  4A3L J;  3JRA A;  1QRY A;  3QPS A;  5FKN A;  3VPR A;  1H89 C;  1RPW A;  2M34 A;  3SDG A;  4IHX A;  1GVD A;  5GPC A;  1BJZ A;  2XGD A;  4J19 A;  1LFB A;  1T33 A;  1ZTR A;  4BY7 J;  1JJ6 C;  4XRS G;  2R5Y A;  1MBH A;  4CYC B;  2H1K A;  2I10 A;  1JJ8 C;  4AUX A;  2GLO A;  1ZKG A;  1LFU P;  4XK4 A;  2XB5 A;  4B3A A;  2HOS A;  1IDY A;  1Z77 A;  5FLV A;  3HBL A;  3ZQL A;  2P81 A;  1ETK A;  1MH4 A;  2CU7 A;  4G12 A;  3JRF A;  4A3F J;  1UG2 A;  1IV6 A;  3HOZ J;  1FTZ A;  2DJN A;  1SAN A;  1ETX A;  3G1M A;  1XS9 A;  3RQI A;  1RET A;  2L0K A;  3ZQC A;  4A3J J;  2LY9 A;  2HXI A;  1X2N A;  4D7N A;  4CYC A;  3GBG A;  1MSE C;  3CDL A;  3BG9 A;  2YUS A;  3SFI A;  4B1R A;  5EG0 B;  1MBE A;  1TWA J;  2Y31 A;  2ME6 A;  4ABZ A;  3GTO J;  4IEJ A;  1MNM C;  1JUM A;  4HNV A;  1WGX A;  4RDU A;  3JR9 A;  1FJL A;  3NAR A;  3QQA A;  1I6H J;  1FEX A;  4JP0 A;  2AHQ A;  1B72 B;  3L1P A;  3S1N J;  3S15 J;  4X6A J;  3OSF A;  1UHS A;  2K9Q A;  1K83 J;  4DYQ A;  2EH3 A;  3B6A A;  5IP9 J;  1JKP C;  1QPI A;  5F27 A;  3B6C A;  4X1E A;  2L7M P;  4XRM A;  3JRG A;  1VI0 A;  3BTI A;  1POG A;  2K9S A;  2XRL A;  4W97 A;  3HOV J;  2VPR A;  4AC0 A;  1ZR4 A;  3HDD A;  3CQZ J;  1ZQ3 P;  4MLO A;  2XPW A;  3CCY A;  2K40 A;  2R93 J;  3FKI J;  1WCM J;  1OCP A;  3ZOB A;  4GFB A;  3HGG A;  3LSJ A;  2DA3 A;  1AKH B;  4DYC A;  4B4C A;  3OOU A;  3BTL A;  3HOY J;  3GTP J;  2QF7 A;  4A3E J;  2DA2 A;  2JK3 A;  4XIC A;  2JJ7 A;  5K7F A;  3MKL A;  3HOX J;  4NDL A;  1UMQ A;  2JWT A;  4A3M J;  2IAI A;  5F08 A;  3O8H A;  5E3N A;  1TC3 C;  4DZJ A;  4A3G J;  2LK2 A;  4D5C A;  4C2M J;  2DA4 A;  3ZQF A;  2W48 A;  1JGG A;  3K2A A;  2JA6 J;  3BT9 A;  1ETW A;  2JA5 J;  2ECC A;  1YRN A;  4MIM A;  1WPK A;  1DU0 A;  1HCR A;  4C3I J;  5C3E J;  2ZB9 A;  2E19 A;  1MBJ A;  1XC5 A;  4M6V A;  3BG5 A;  4JX5 A;  3BR3 A;  2WV1 A;  2R5Y B;  1IDZ A;  3OSG A;  1NK3 P;  3H0G J;  3RZD J;  2EZL A;  1MBK A;  2MG4 A;  2NVY J;  4M3B A;  3LSR A;  2MGQ A;  2EBI A;  3GTL J;  3NAU A;  5F0F A;  1I50 J;  5M5Y J;  3WHB A;  5IOZ A;  3D1N I;  3I4M J;  2LKX A;  2JA7 J;  5FKL A;  4XRS A;  1A5J A;  2DA6 A;  3CMY A;  2RAE A;  1RR7 A;  2DMT A;  1HLV A;  3RKQ A;  4XID A;  1FIP A;  1G2H A;  3BG3 A;  5EZH A;  3A02 A;  4JX6 A;  2DMN A;  2HQ5 A;  2DN0 A;  1F43 A;  2NVX J;  2IBD A;  1F36 A;  4C3H J;  5EF6 A;  2LFB A;  4MFD A;  2G0E A;  1TWG J;  1TWH J;  2XSD C;  1RKT A;  1XG1 A;  4FCY A;  4A3K J;  3S17 J;  2NVT J;  2M0C A;  1IGN A;  4FIS A;  2NOG A;  2L7Z A;  1B8I A;  1GV2 A;  2XGC A;  5J1Y A;  2O8K A;  3BR6 A;  2KT0 A;  1JKR C;  3JRH A;  5IYD J;  4V2F A;  2GM4 A;  1H88 C;  4EEF G;  5FKM A;  5M5W J;  5EGO A;  3FK6 A;  4DW6 A;  2FD5 A;  3S1Q J;  3HOW J;  1U8B A;  1EF4 A;  3S16 J;  2XGE A;  3DEW A;  3G1O A;  3HGY A;  3Q0U A;  3IH3 A;  1SFO J;  2R5Z A;  4LOC A;  3S1M J;  2QCO A;  4DYR A;  2XB0 X;  1BW5 A;  1ETV A;  2L7F P;  2EZH A;  3S2H J;  5GP9 A;  2X6O A;  5IOY A;  1MSF C;  3BR5 A;  5EZG A;  5M3F J;  2VKV A;  1LE8 A;  5IPA A;  5IP7 J;  1JUS A;  3MVP A;  1ETO A;  1H8A C;  2O9L A;  5GPA A;  2NVQ J;  2OF7 A;  1BL0 A;  4I76 A;  1K61 A;  1MH3 A;  9ANT A;  2JN6 A;  2HOA A;  4MFE A;  2K9N A;  2LP0 A;  1YRN B;  3BR2 A;  2MSY A;  5DTD A;  3BTJ A;  4QIW N;  4IHV A;  5E3O A;  4A3C J;  1U9O A;  1VF9 A;  3A03 A;  2Y2Z A;  2ID6 A;  5C44 J;  2DTZ A;  2M8G X;  1R9T J;  3A01 A;  2H8R A;  2ELK A;  3GTM J;  1GUU A;  2B63 J;  5K7H A;  2HYJ A;  5FKO A;  3GTG J;  1GT0 C;  3BTC A;  1Y1W J;  2E1O A;  2Y9Z A;  2PMZ N;  1RES A;  3K7A J;  5F1J A;  2HI3 A;  4M3F A;  1CQT A;  5C4J J;  3LSP A;  5EDN A;  3S1R J;  1GV5 A;  1HDD C;  2CJJ A;  2YU9 J;  1ETQ A;  4A3I J;  2DMQ A;  4L5E A;  1MBF A;  2NS8 A;  3IV5 A;  3ZQG A;  5M5X J;  1PUF A;  1I3Q J;  2VI6 A;  1P7I A;  1FIA A;  4QTR A;  3GTQ J;  2JA8 J;  3BR1 A;  5J1U A;  2X9D A;  2FQ4 A;  3TED A;  5FLM J;  2CQX A;  3HKZ N;  1BA5 A;  3Q3S A;  3JRB A;  2Y0S N;  1T56 A;  1TWC J;  3ZQH A;  1JT0 A;  2E2I J;  4BBR J;  3IH2 A;  4QSH A;  1IRZ A;  4UUS B;  3WHC A;  5IYC J;  2IEK A;  3BQY A;  1X2M A;  3G1L A;  1B8I B;  2M9H A;  2M2E A;  3FK7 A;  2LTP A;  5F04 A;  4A3D J;  1HF0 A;  4UUT A;  2VKE A;  2HOT A;  2E2H J;  4S0H B;  2HXO A;  1QVU A;  3UKG A;  3H3V K;  2JMW A;  4JYK A;  1NTC A;  5F0C A;  4Y52 J;  1IG7 A;  1Z0X A;  5EGO B;  4M3G A;  1JTX A;  2FX0 A;  5K7Z A;  2O7O A;  4UUS A;  3FIS A;  4FE7 A;  4M3D A;  1D5Y A;  1W0T A;  1A6I A;  1IC8 A;  2ECB A;  5JLW A;  2LVS A;  2ID3 A;  2R5Z B;  3S2D J;  3JRE A;  5E3L A;  3LOC A;  2CRG A;  4BBS J;  5FJ8 J;  4A93 J;  1WH7 A;  3TP0 A;  1GDT A;  4FTH A;  3GTK J;  3O8G A;  3PM1 A;  2TRT A;  3GTJ J;  4AYB N;  2DA5 A;  1HDP A;  1LE8 B;  5J1R A;  2XPV A;  1NK2 P;  2MW8 A;  3C2B A;  4IHY A;  2NS7 A;  4A69 C;  1MBG A;  1BW6 A;  2WAQ N;  4D7M A;  2L9R A;  3DCF A;  4C3J J;  2LLK A;  1P7J A;  2ME0 A;  2DA1 A;  1JKQ C;  1IJW C;  1S7E A;  1W0U A;  2DA7 A;  2TCT A;  1JUP A;  4I6Z A;  3S14 J;  2FJ1 A;  5IP6 A;  3A01 B;  2GBY A;  3TP3 A;  1ENH A;  3TW7 A;  5M3M J;  3PO3 J;  5E3M A;  1TWF J;  5JLX A;  1AHD P;  5FKK A;  3Q0V A;  1JKO C;  5F0H A;  4A3B J; 
#chains in the Genus database with same CATH topology
 1WVR A;  1X1A A;  4OAZ A;  2HKO A;  1T39 A;  1NG6 A;  1SD5 A;  2VT2 A;  4L9N A;  3ZR8 X;  1LEA A;  4D9J A;  4D1Q A;  1FWZ A;  1UEL B;  2CUZ A;  3KIO A;  2CG4 A;  2XKP A;  3V7R A;  3WE3 A;  1UB9 A;  5KAI C;  2PEX A;  3CME I;  3GWZ A;  2EA4 A;  2EZK A;  3F0C A;  1KU7 A;  3V8K A;  1D5V A;  2H94 A;  1QBJ A;  2Y30 A;  3G2B A;  3IWF A;  4JX4 A;  4IVN A;  2L2O A;  2KDO A;  4ENK A;  3FXK A;  4IRI A;  3HOU J;  2LD5 A;  3IRQ A;  3C7J A;  2OPT A;  2KRF A;  3RZO J;  2KDZ A;  3FWE A;  5DUI A;  1OFC X;  3HTS B;  4F91 B;  3OYG A;  3JRD A;  2OBP A;  3BC8 A;  5DYM A;  1G8X A;  1SFE A;  1XGM A;  4RB1 A;  3F21 A;  1S5L C;  1E3O C;  1FSH A;  1ZLK A;  2R0Q C;  1AKH A;  1X1P A;  4ZDP A;  1XSV A;  2D5V A;  2X51 A;  1VFC A;  3Q0W A;  1ZRE A;  1WJE A;  3FXR A;  5H6R A;  4NNJ A;  4EJW A;  4Q48 A;  2XAH A;  2O8X A;  4G6D A;  1RRJ A;  1OJL A;  1X1B A;  3ZMT A;  4FT8 A;  4JOM A;  1JTY A;  2C6Y A;  1F4K A;  3W6K B;  5CQG A;  5K5Q A;  2ZBK A;  2VIX A;  3TW6 A;  5JFR A;  2R7Z J;  1ZN2 A;  3C1D A;  2VUM J;  2KIF A;  4OIN F;  2KIM A;  3JRA A;  1FNN A;  4EV0 A;  3H9Q A;  3L9F A;  4HOB A;  4G7O F;  1SAX A;  3SDG A;  2X85 A;  3RPQ A;  5ICG A;  1CF7 A;  2IGO A;  1T33 A;  1JJ6 C;  4E70 A;  5K5R A;  1E17 A;  2O03 A;  1JJ8 C;  1Z7U A;  2F5C A;  3BCA A;  2HR3 A;  5D5U B;  1IDY A;  1MJA A;  5L3D A;  4ANJ A;  2P81 A;  2MLK A;  1SD7 A;  2CU7 A;  2CGP A;  4M72 A;  2G9W A;  1FT9 A;  1BIA A;  4RAG A;  2DK8 A;  1ETX A;  2F6C A;  2O5R A;  2HZT A;  4UVC A;  2L0K A;  1TT0 A;  2CQ7 A;  2VQC A;  4L0Y B;  1O57 A;  2CW0 F;  4ZJZ A;  2ZO4 A;  2LY9 A;  1KU9 A;  4N9I A;  1G3W A;  2FU4 A;  2ZXW H;  2PI0 A;  1ACI A;  5AON A;  4N4N B;  1WRJ A;  1J7K A;  3KYL A;  5D8L B;  3DLL F;  3BG9 A;  1O7F A;  2YUS A;  3K70 C;  2GZW A;  3CCR I;  2VAS A;  1GVJ A;  1HKQ A;  3OYI A;  2ZJR F;  3PNT A;  1D1A A;  3KX2 A;  3OWT A;  5HLH A;  4HNV A;  2PJP A;  3BJ6 A;  4HPQ A;  1I3A A;  1WGX A;  2P5V A;  4RDU A;  3L2R A;  3NAR A;  3QQA A;  4OAY A;  2QEX I;  5CVR A;  3I54 A;  5AIQ A;  3CD6 I;  3OSF A;  1BR2 A;  3WTX C;  3EQL F;  2P7C B;  2DO7 A;  1JKP C;  4UVB A;  1QPI A;  2V1U A;  4KIC A;  2L7M P;  3DTI A;  2KHM A;  3N4M A;  1SMT A;  1TQP A;  3JRG A;  3QRF F;  3E3V A;  2K9S A;  2BVM A;  3TKY A;  5ICC A;  3GLX A;  3KEO A;  2VPR A;  2QSG X;  4PGH A;  2EIM H;  3K4K A;  1ZQ3 P;  2H1L A;  2ZJQ F;  2K40 A;  4CUG A;  4HA8 A;  1QGP A;  2ZXH A;  3DEE A;  3ABL H;  2R93 J;  3RKX A;  2QYO A;  3VDX A;  4M71 A;  1OCP A;  4GFB A;  5A2Q K;  4HDV A;  2BE5 F;  2DA3 A;  1YG2 A;  1AKH B;  3A2K A;  2DI3 A;  3OOU A;  5GAE J;  1L3L A;  4LFU A;  4A3E J;  2DA2 A;  2DXI A;  2BGC A;  4BU2 A;  3HOX J;  4C2U A;  1E2X A;  5FFX A;  3U9G A;  3IL2 A;  3K2Z A;  4PGG A;  1TC3 C;  2JTV A;  3Q9V A;  4DZJ A;  3CCM I;  4D5C A;  1TTY A;  3GFM A;  2STT A;  3K10 A;  2LYC A;  3SFZ A;  1UHM A;  1JGG A;  3E6B A;  4HX7 A;  3MKY B;  4IOC F;  4S04 A;  2HQA A;  1J09 A;  2MLG A;  2JA5 J;  2A3S A;  5EEG A;  2BVL A;  1HST A;  1SVO A;  2L4M A;  4YFK F;  1DU0 A;  1EH7 A;  4LG3 A;  5GAD J;  3CC2 I;  2HKX A;  1YI2 I;  4BDY A;  4CYD A;  1Z21 A;  1ULY A;  2EFO A;  1CF7 B;  4M6V A;  1J0R A;  3B02 A;  3BR3 A;  3LA3 A;  4PJL A;  5E1X A;  2AXT C;  3OSG A;  5E20 A;  3H0G J;  2EZL A;  1MBK A;  2W1O A;  2EV5 A;  3EPZ A;  3LSR A;  2RQP A;  2XHK A;  2MGQ A;  4U7D A;  3VOD A;  4YFN F;  4Y3O A;  3NAU A;  1I50 J;  2FSW A;  1KQ0 A;  4PJM A;  5IOZ A;  3D1N I;  2V6E A;  1MKM A;  1LUJ B;  1S7A A;  2X6X A;  3RKW A;  4YIF A;  3S8P A;  2ZCW A;  3FBN B;  3HRU A;  1RZ4 A;  2QKL B;  4ETS A;  1DQU A;  4XMY A;  1ZAO A;  2P4W A;  1F43 A;  1F1Z A;  1MMA A;  3I0T A;  1DGR M;  4CO8 A;  3LAJ A;  1XSD A;  2VB6 A;  1ZYR F;  4HX8 A;  3TO9 A;  1BBY A;  3PL8 A;  4EM2 A;  4KYW A;  1TWH J;  5E17 F;  5DD8 A;  1RKT A;  4FCY A;  3IAS 2;  1T95 A;  1YFH A;  1FYK A;  3IUO A;  3KP6 A;  2HVS A;  2M0C A;  1IN7 A;  4BS9 A;  1TW3 A;  3I3L A;  2IS1 A;  4E7S A;  2W25 A;  2JRT A;  1B8I A;  1GV2 A;  2LSO A;  3BR6 A;  2PMZ A;  3ONQ A;  4R8H A;  4XRF A;  3JRH A;  3W2V A;  4HX4 A;  4DNC A;  4II2 A;  1Z1D A;  2GM4 A;  4F3Q A;  2J5P A;  1SD4 A;  1IW7 F;  1X4P A;  4EEF G;  3CJT B;  5M5W J;  4I09 A;  2PFB A;  3M1C A;  4E7I A;  1WJB A;  2OCC H;  3I71 A;  2PN6 A;  2R7U A;  2DT5 A;  3M7G A;  4IPA A;  1KYZ A;  2DPD A;  2XGE A;  1TZL A;  2OU2 A;  1R36 A;  2M4G A;  2DT7 B;  3HSF A;  3ZP5 A;  1RUO A;  1OIS A;  5LGU A;  4NQW A;  2CV2 A;  2YSR A;  3CJR B;  4HG2 A;  4A12 A;  2FF4 A;  2L7F P;  3V42 A;  4YIR X;  4OIO F;  3GCM A;  1J5Y A;  4HEA 2;  5IOY A;  4CCK A;  4UVA A;  4LIU A;  1SVM A;  5M3F J;  4E7H A;  3LST A;  3C2H A;  1LE8 A;  2E36 A;  5IP7 J;  2MBF A;  3VOE A;  2F4M B;  2CQN A;  2UWM A;  2KIU A;  3MVP A;  2O9L A;  2NVQ J;  1XGS A;  2LKP A;  3HOT A;  1BL0 A;  5KAF C;  2DDA A;  1QA6 A;  2IS4 A;  1K61 A;  2WAD A;  2HOA A;  4K2E A;  4MFE A;  1REP C;  2LP0 A;  3BR2 A;  3HPH A;  2VOP A;  4A3C J;  3HC7 A;  1U9O A;  4BJ6 C;  3A03 A;  5L3C A;  3H5A A;  3R0J A;  5D6E A;  3FKJ A;  3HRT A;  3BJA A;  1R9T J;  3A01 A;  2H8R A;  3WTT C;  2UZK A;  2UV1 A;  2BEO A;  5D5X B;  3NWT A;  4BHC A;  3J80 Z;  1W5S A;  2H6B A;  5J8F A;  2Y9Z A;  1FY7 A;  1S8N A;  1RES A;  3KZZ A;  3QYF A;  3V8L A;  4XON A;  3LQR A;  1DGW Y;  2STW A;  2QEN A;  5E8I A;  5JVG F;  4P9F A;  5EDN A;  5LBQ A;  3CCE I;  2LY1 A;  5CKT A;  3S1R J;  1GV5 A;  4ASN A;  1FOY A;  4UHT A;  1ETQ A;  4E4H A;  1XX5 A;  1Y6I A;  3KYD B;  2V9P A;  2LC2 A;  2VJ4 A;  4CCM A;  1MBF A;  3LSM A;  2COM A;  2X6Y A;  1C0W A;  2PX9 A;  2O3F A;  2D1H A;  4HSR A;  3QOD A;  3PUB A;  3RPU D;  3F8M A;  2FBI A;  1P7I A;  2IPQ X;  4HLX A;  1RR8 C;  1ZLJ A;  5J1U A;  2VC0 A;  1FLI A;  3HZJ A;  4LMY A;  4U87 A;  2XUB A;  3HKZ N;  3Q3S A;  1BM9 A;  1S3J A;  3JRB A;  1N78 A;  1T56 A;  2JRM A;  4C2T A;  2L5Q A;  2L9V A;  2MYS A;  1RIO H;  1YIT I;  1XGO A;  4PSX A;  2WAF A;  1S72 I;  2IEK A;  3OS0 A;  3G1L A;  1X2M A;  4CHU A;  4DGW B;  1B8I B;  3CJQ B;  4WCG A;  2M9H A;  3FK7 A;  4PCQ A;  4B48 A;  2LG4 A;  3MKW B;  4Z6Y A;  1S29 A;  1YLF A;  2Z5U A;  2WB1 A;  1H9T A;  1MMD A;  4WF2 A;  2M1B A;  4BEH A;  4DBQ A;  3UKG A;  2JMW A;  1NTC A;  3K1P A;  3L2V A;  3MZH A;  2WY7 Q;  3H0D A;  1IG7 A;  1Z0X A;  2A6T A;  4LK1 F;  1R49 A;  4B44 A;  2CSO A;  4FE7 A;  2OZU A;  4M3D A;  3WGI A;  3K9T A;  3OYD A;  4BJ5 C;  1W0T A;  2ECB A;  2EFQ A;  2A68 F;  4IXA A;  3S32 A;  3C18 A;  3S2D J;  4NQW B;  2FNP A;  5FJ8 J;  3CMM A;  3K1M A;  3J7Z I;  1K78 A;  4A93 J;  1B9M A;  3RCO A;  2GXA A;  4UUV A;  2A5Y B;  3GTK J;  3O8G A;  2WA0 A;  3PM1 A;  3OS2 A;  1LFP A;  4RAY A;  1Y0U A;  2DA5 A;  1XB4 A;  1LE8 B;  2VQG A;  4BH9 A;  5J1R A;  2NS0 A;  2ISZ A;  5CVI A;  4XSX F;  2MW8 A;  3ZQ7 A;  4XN0 A;  4A69 C;  1Z6T A;  2HNH A;  4GO1 A;  3ROU A;  2G7H A;  2W7N A;  4XQF A;  4C3J J;  2LKS A;  4C30 A;  4O3M A;  4BHP A;  1VZ0 A;  5HDG A;  2VLA A;  5E1Z B;  1JXS A;  2H8W A;  1MMS A;  1N75 A;  2KZG A;  2TCT A;  1JUP A;  4I6Z A;  3ESW B;  1B4A A;  3S14 J;  4BXF A;  5IP6 A;  3A01 B;  2GBY A;  3H1C A;  3TP3 A;  2KQR A;  3OL3 A;  3PO3 J;  5E3M A;  2OJE D;  3P9I A;  2WAE A;  3I5U A;  3PSI A;  4ENN A;  5F0H A;  2FE3 A;  5LRR A;  2L01 A;  1Q1V A;  2W00 A;  4EQQ A;  3AAF A;  4GDF A;  2X1D A;  5KHD A;  5HOD A;  2ZME A;  2EB7 A;  5HS8 A;  5CPR B;  2VBX A;  3M8F A;  1WI3 A;  3VYU B;  3IWZ A;  4RA2 A;  4FE4 A;  4II3 A;  3OIO A;  2HYG D;  2DMU A;  4EMS A;  4BY1 J;  3J7A Y;  2R7T A;  1YYV A;  3GFI A;  1O3T A;  4PUS A;  3KYC B;  2P5L C;  1O3R A;  1B72 A;  1UG0 A;  5IYB J;  2JVH A;  5D4S A;  3OV8 A;  3CJN A;  4O5V A;  1DDN A;  1WH5 A;  2COB A;  5J3L A;  3WU2 C;  4HRI A;  3D5S C;  2Y9Y A;  2MH9 A;  2Y69 H;  1ZGW A;  4KIB A;  4AYB A;  4IHW A;  4W1U A;  1QHG A;  2CFO A;  2YX7 A;  1VQ7 I;  2E1C A;  3FIW A;  3IH4 A;  1DP3 A;  3VYS B;  2RC4 A;  3QOE A;  5EYR A;  3TGN A;  1FYL A;  2MD0 A;  2CH0 A;  3PO2 J;  2LRE A;  1LNW A;  3GF2 A;  3LNQ A;  1LKX A;  1Z91 A;  4G94 A;  3F3X A;  4CCN A;  4OMY A;  1W7P A;  4BEH B;  1AOY A;  4V2G A;  2ZME C;  5HLG A;  3H3U A;  4RBO A;  4DZP A;  1FZP B;  3V4G A;  1PP8 F;  4AU7 A;  5CQE A;  1XTA A;  3ZGK A;  2XPU A;  5D5V B;  5HS9 A;  4YRV A;  2KLO A;  1DU6 A;  3TO7 A;  1V5F A;  4IKF A;  3PSF A;  1ORK A;  3CCQ I;  3RYP A;  2LF8 A;  3QPL A;  1APL C;  4UY8 I;  2P8T A;  3T8T A;  4Z2Y A;  2AO9 A;  3TO6 A;  4AIK A;  3QU6 A;  5CJ9 A;  3BR0 A;  2LR8 A;  4MO7 A;  3PIO F;  1K78 B;  1R7J A;  1QVT A;  1YX5 A;  3ZN0 A;  3QPS A;  2D45 A;  1LJ9 A;  4ENM A;  3EUA A;  5ICE A;  1K6O A;  1ZG5 A;  2XC7 A;  1GVD A;  3ZMS A;  1TNT A;  2PBI A;  2XGD A;  2LY2 A;  3ZMV A;  3U21 A;  3DU5 A;  3I64 A;  3S3O A;  4MEY F;  2H1K A;  2XF6 A;  2BHY A;  4AUX A;  1LFU P;  4XK4 A;  3L7W A;  2HOS A;  3O2P E;  1LQ1 A;  4RMN A;  3ZQL A;  2K27 A;  3VSL A;  1UST A;  1IV6 A;  1UG2 A;  2BXY A;  3FBI B;  2K7L A;  3A0B C;  1E3H A;  3MCZ A;  2VE9 A;  1SAN A;  2F5V A;  2VJJ A;  3G1M A;  3HSR A;  1XS9 A;  4A3J J;  1J2X A;  1QZE A;  3KP3 A;  1G4D A;  4RGX A;  4D7N A;  3BCB A;  2OD5 A;  1MSE C;  2HU9 A;  4GGG A;  4LJZ F;  5CVV A;  2GWR A;  4E7J A;  1YW7 A;  3CDL A;  5FD5 A;  4G6Q A;  1LDJ A;  5HLT A;  4L5I A;  2A6H F;  2ZME B;  1MBE A;  4KN4 X;  1B1B A;  2F5D A;  3GTO J;  3GXO A;  4I02 A;  4IEJ A;  4WXD A;  3MEX A;  1JUM A;  1ZRF A;  4F7Z A;  3K4J A;  2ZSH B;  3M07 A;  5LRS A;  2EJR A;  1B72 B;  2PMH A;  4M9X A;  3S1N J;  4MTD A;  1UHS A;  4BGD A;  1SC7 A;  4Y33 A;  3TQN A;  2EH3 A;  2ZXI A;  3B6A A;  2V26 A;  5IP9 J;  5LGN A;  2B9S A;  2M5W A;  3HUG A;  5F27 A;  3IP4 B;  1BI0 A;  1QZZ A;  2V9K A;  3NEU A;  3AKZ A;  1VI0 A;  3BTI A;  1KU2 A;  3W2A A;  1I1S A;  3DQV C;  2K5C A;  1QZY A;  3HOV J;  1MD0 A;  1MMN A;  1ZR4 A;  4OIQ F;  5GTI C;  5KVR A;  2CS3 A;  2DPU A;  4LK0 F;  2XPW A;  3GFJ A;  3CCY A;  3SEQ A;  1WFX A;  1EJ9 A;  3WE2 A;  2BBY A;  4D0P A;  3OR1 C;  2L3D A;  1WCM J;  3MQ0 A;  2ZNY A;  4XLE A;  4LB6 B;  1FSE A;  1UJ8 A;  3ZOB A;  4NB5 A;  1W7P B;  2TDX A;  4HDU A;  4PFP A;  1E0E A;  4HAM A;  3WTV C;  3DLA A;  2VJI A;  2JK3 A;  2E35 A;  4AVP A;  1V5E A;  4BE1 A;  4XIC A;  1W36 C;  1D1B A;  2JJ7 A;  5K7F A;  5ED4 A;  2QSF X;  3BPX A;  3DBH B;  1YO5 C;  4A3M J;  2IAI A;  5F08 A;  2WWY A;  1GXP A;  1VQ5 I;  5B5E C;  4ZYE A;  2LK2 A;  3ERM A;  4HST A;  5BMZ A;  1FOW A;  2DA4 A;  4BJT A;  3CCL I;  2CYY A;  2Y75 A;  4I2O A;  5FLX Z;  4X0G A;  4J01 A;  4LLL A;  4A0X A;  2ACJ A;  2HS5 A;  3H5N A;  4IHT A;  3H9G A;  3WTZ A;  1D3Y A;  1R4N B;  3MFK A;  2XAQ A;  2W4S A;  3OYA A;  2Z3Y A;  3QPT A;  1XC5 A;  4G7Z F;  1MMG A;  2EV0 A;  3BG5 A;  4JX5 A;  5D6F A;  4KA4 A;  4BXU A;  5HOO A;  2BY1 A;  2MG4 A;  3KZY A;  2XGX A;  4RAF A;  2I8D A;  1IV8 A;  1VQ4 I;  2EBI A;  2OTJ I;  2BHZ A;  3DP7 A;  3EUH C;  1X1D A;  4U0W A;  3SZG A;  1EKE A;  4HNT A;  2R7F A;  2LKX A;  4F52 A;  1TLH B;  3CMY A;  1RR7 A;  2DMT A;  2RAE A;  3RKQ A;  4BQO A;  1FIP A;  1BI2 A;  5J8C A;  1HW2 A;  1G2H A;  4R79 A;  2W57 A;  5ILS A;  2DN0 A;  2IBD A;  3DKW A;  2X0L A;  4JQF A;  2DW4 A;  4HV5 A;  1F36 A;  1YW8 A;  1G3Y A;  4C3H J;  5EF6 A;  1DUX C;  4BE0 A;  3A0H C;  2VXZ A;  3DBR B;  2UUZ A;  2LFB A;  4MFD A;  4CZC A;  1TWG J;  1A35 A;  4L0Z B;  2XSD C;  4UB8 C;  1R5H A;  1XG1 A;  1HC8 A;  3V7S A;  4A3K J;  3KP2 A;  4ZTF A;  2L7Z A;  2XGC A;  3COA C;  4DJA A;  4A6D A;  2H6C A;  2KT0 A;  1JKR C;  5EJC A;  1KYW A;  3QP6 A;  1YOV B;  2O6G E;  2RN7 A;  3HUG B;  1SVL A;  3I9V 2;  4V2F A;  3OOP A;  2V79 A;  2MAB A;  2L02 A;  2V1D A;  2CQK A;  5FKM A;  4L9T A;  4CA0 A;  3JSP A;  4DW6 A;  2FD5 A;  5E1W A;  3BOQ A;  1F5T A;  3OR2 C;  4KT5 C;  4AID A;  2AQE A;  1EF4 A;  4FX4 A;  4YII A;  5J6X A;  3GO5 A;  3JTH A;  1QNT A;  1R6R A;  4MTE A;  3G1O A;  3Q0U A;  2G7U A;  4IX7 A;  3JTG A;  5GAG J;  1SFO J;  1TQI A;  3GW2 A;  3FM5 A;  1EA3 A;  5IT9 Z;  1USS A;  3BZC A;  2CWE A;  2W84 A;  3E97 A;  4A5N A;  4B43 A;  2R5Z A;  2ZFW A;  3J81 Z;  2WBM A;  2Y0S A;  4DIQ A;  5F1R A;  4XKB A;  2EZH A;  2VBY A;  3KP4 A;  3CCU I;  1MSF C;  2OQG A;  1K4T A;  5GTH C;  5L3E A;  3J80 K;  3MD2 A;  5DCM A;  5IPA A;  1W5C C;  3RQ4 A;  2YU3 A;  2QLZ A;  3E6D A;  2FRH A;  1ON2 A;  1JUS A;  1H8A C;  1P4X A;  4I76 A;  3E5Q A;  2Q0O A;  2X6W A;  4IRH A;  2K9N A;  2KZV A;  5DTD A;  2DYS H;  3CO7 C;  4IHV A;  1YE9 A;  1VF9 A;  5J4V A;  4A0Z A;  2Y2Z A;  1D0Y A;  2KKO A;  4RB0 A;  1GUU A;  3HG9 A;  1Y56 A;  5FKO A;  4HLY A;  3GTG J;  1OYI A;  3G3Z A;  2F4I A;  2KFD A;  2HPM A;  2M0M A;  4BAY A;  2R3S A;  3FZV A;  1Y1W J;  2E1O A;  5F1J A;  3FMS A;  4JBA A;  1V55 H;  3LSP A;  2DU9 A;  1YW9 A;  3I4P A;  2ESH A;  2XVC A;  3CLO A;  2YU9 J;  2VOD A;  5E18 F;  4A3I J;  2FMY A;  2K02 A;  2NXN B;  2NS8 A;  3IV5 A;  2BOL A;  5M5X J;  4WK8 F;  4IO9 F;  1I3Q J;  5KCM A;  3FF5 A;  1OCR H;  3QYB A;  4U0Y A;  1QQI A;  4HW0 A;  3OYM A;  5FLM J;  2CQX A;  2E60 A;  2IGK A;  1S7O A;  1S6L A;  1OCC H;  1D1C A;  2EWN A;  2IW5 A;  4C9Y A;  3RDI A;  1TWC J;  2LDU A;  2V1N A;  3PQK A;  3R6S A;  4CXF A;  1R71 A;  3IH2 A;  4QSH A;  4UUS B;  2M4K A;  3WHC A;  3QU3 A;  1K79 A;  3M1E A;  3BQY A;  3MKZ A;  2AXL A;  2R7V A;  3SYT A;  1G6N A;  2LTP A;  5F04 A;  2OC6 A;  1FBU A;  4PFO A;  3E6C C;  1JE8 A;  3R60 A;  2GIZ A;  4S0H B;  3I58 A;  2AQF A;  3ABK H;  1ONV A;  4PDK A;  3WTS C;  2KP6 A;  4M3G A;  1YIO A;  5K7Z A;  1B9N A;  1I27 A;  3OYL A;  1UFM A;  1D5Y A;  4QPO A;  2ADU A;  5LHG A;  2QM3 A;  1S9H A;  4H4K C;  3AG4 H;  1TL8 A;  2KIQ A;  4B47 A;  2VPL A;  2X1E A;  4HBL A;  4ON0 A;  2R5Z B;  5E3L A;  2CRG A;  2WV0 A;  1BIB A;  3RJP A;  5IY5 H;  1R00 A;  2MD5 A;  1GDT A;  4IHS A;  2QQB A;  4M6X A;  2IA2 A;  3RI4 A;  3PIP F;  3GTJ J;  2QUF A;  3FX3 A;  4G8X A;  4AYB N;  1KON A;  3DV8 A;  4Y15 A;  5DCM B;  3C2G A;  2IA0 A;  1ZG1 A;  2FOK A;  1ZG3 A;  1WJD A;  2IA1 A;  2DK5 A;  2BZT A;  2NS7 A;  4I98 B;  4IOA F;  5DV5 A;  1MBG A;  2WAQ N;  1BR4 A;  2EIJ H;  5J40 A;  4MQV A;  1FP2 A;  3DCF A;  5CVJ A;  4DOZ A;  4XLH A;  2HTS A;  1FC3 A;  3VYR B;  3CF2 A;  1X3Z B;  2EFP A;  1IXS B;  3HYI A;  3BDD A;  2CW8 A;  4XSZ F;  4ESJ A;  5BPI A;  2FJ1 A;  1UAA A;  4LD5 A;  3IKV A;  4P96 A;  3OYE A;  1Y39 A;  1QPM A;  4QPQ A;  5CVU A;  2FA5 A;  3KFW X;  3J7A O;  1BI3 A;  3PFY A;  3ZQI A;  1O3S A;  2R92 J;  3E7L A;  5JVT A;  1ZR2 A;  4Y7N J;  2HOE A;  2ZFU A;  3GZ5 A;  3HPG A;  2HQN A;  5J4Y A;  2XV4 S;  1ERD A;  1X3W B;  4MHG A;  4L9J A;  2CW7 A;  5E8G A;  1WI9 A;  1OCT C;  1PVE A;  5BOX A;  2HWV A;  5H2F C;  3GX4 X;  1HSJ A;  2ZJ2 A;  1LDK B;  2Z1D A;  1LVA A;  3LMM A;  2X4H A;  3DTK A;  2NAZ A;  1IUF A;  1ZK8 A;  2CQQ A;  2KMU A;  4KFC A;  2ZNZ A;  2R7D A;  3H35 A;  1BN5 A;  1BI1 A;  2R7S A;  2E2J J;  1ZHF A;  1XGN A;  2KJC A;  2QQ9 A;  3E0J B;  4XLP F;  4FAS D;  5FRO A;  1V4R A;  1W5T A;  2PJR A;  2EPF A;  1YJW I;  3WTW C;  1L0O C;  5B1B H;  1VQ6 I;  3TOB A;  4B3X A;  5C4X J;  3N05 A;  1HOM A;  2IS6 A;  1FBS A;  3K4L A;  5GAH J;  2VJ5 A;  1QHH D;  1R58 A;  2MH2 A;  1MJB A;  1NH3 A;  3CUQ A;  1ETY A;  3MN2 A;  4E7L A;  2IS2 A;  3KP5 A;  3K4C A;  5JHF A;  4DQ2 A;  4KIT B;  4HNU A;  4FHT A;  1Z3X A;  2K4J A;  3QWL A;  2HPI A;  3BP8 A;  1OYY A;  3CP8 A;  5DCF A;  3U2R A;  1WJ5 A;  2EZI A;  5KK1 A;  4BXX J;  3JRI A;  2F5F A;  4U7B A;  2CV0 A;  5FO5 A;  3FM3 A;  3HEF A;  1Z67 A;  3WGG A;  1HQC A;  3M4O J;  3DBL B;  4KJZ A;  4YEL A;  1WZ2 A;  5EEA A;  1K7A A;  3GEZ A;  4V19 K;  1R23 A;  2N8G A;  2W24 A;  4NC7 A;  3GME A;  3T8R A;  1FOX A;  4BNC A;  3HB9 A;  3BQZ A;  2XAF A;  3GFL A;  1FYM A;  2R7R A;  3ZMZ A;  1PYV A;  2CV1 A;  1D8J A;  4OU0 A;  2D1V A;  3F72 A;  3VPR A;  2LMD A;  1H89 C;  2IP2 A;  4IHX A;  5GPC A;  3BLY A;  1BJZ A;  2DCE A;  1LFB A;  1WWX A;  2FML A;  2F4O B;  3RSN A;  1ZTR A;  4BY7 J;  2YPR A;  4XR6 A;  4XRS G;  4CYC B;  4XKC A;  3CUQ C;  1V54 H;  2I10 A;  2RGV A;  4BQN A;  2GLO A;  2XB5 A;  3RKY A;  3F23 A;  4BL0 B;  4UXN A;  1FMV A;  5DDG A;  1IRG A;  2KPM A;  1JI8 A;  1Z77 A;  3CF5 F;  3HBL A;  1ETK A;  3GVA A;  4A3F J;  3JRF A;  4LLG F;  3NRV A;  4EGY A;  1Z9C A;  1F9N A;  2NNN A;  2HVQ A;  3RQI A;  1STZ A;  1RET A;  3BRO A;  3ZQC A;  4RM3 A;  4IZZ A;  2HXI A;  3L09 A;  3OYB A;  1X2N A;  2V7F A;  5HNH A;  4O6J A;  2E5N A;  2ISY A;  3ASO H;  3GBG A;  1VTN C;  1KQ9 A;  4KIS A;  3CTA A;  1G3T A;  1ZGA A;  1I5Z A;  2PMU A;  1Z7L A;  2NOJ B;  3LSK A;  2NYX A;  3K69 A;  4P5O A;  1ZH5 A;  1OQY A;  1YHQ I;  3OIQ A;  5CYV A;  2IXS A;  3F6O A;  3GYH X;  3O6B B;  3JR9 A;  1FJL A;  4IQJ A;  2Y48 A;  4ZYH A;  1YJ9 I;  1I6H J;  2QGU A;  5HVQ C;  4CH7 A;  2H27 A;  3S15 J;  1ZEL A;  2IVM A;  2BW3 B;  3GUD A;  4EVI A;  1K83 J;  4OWR B;  3S93 A;  4KIG A;  4QWQ A;  3SDB A;  4A6E A;  3B6C A;  4XRM A;  2BYV E;  2RDP A;  5LD2 C;  3T0Y A;  4EM1 A;  2UXN A;  3FXJ A;  1H9G A;  3ZN1 A;  2JA2 A;  2XRL A;  2DQL A;  4GYI A;  2EA2 A;  4W97 A;  2PJR B;  3J7Y J;  4AC0 A;  1R1T A;  3CCS I;  3HDD A;  2VT3 A;  2IJL A;  3CQZ J;  3HHG A;  2A07 F;  4MLO A;  1ZRD A;  1GHC A;  5EEH A;  2QQ8 A;  4NC8 A;  3CUQ B;  2EK5 A;  1A6Q A;  1XSX A;  2XDV A;  4DYC A;  4B4C A;  3BTL A;  4P1W A;  1MGT A;  1D0Z A;  2X1C A;  3RYR A;  3MKL A;  3ULQ B;  1P6R A;  2OV7 A;  4TV7 A;  4RB2 C;  2MC4 A;  1UMQ A;  3MMY B;  1UCR A;  2JWT A;  2F2E A;  3QAH A;  2V9V A;  4LB5 A;  1SFX A;  2GXG A;  2VC1 A;  3HXL A;  3O8H A;  5E3N A;  2HQR A;  3DPU A;  4XKV A;  1DP7 P;  3CC4 I;  4Y13 A;  4C2M J;  4AD9 A;  1XPX A;  3ZQF A;  5BQT A;  2E7X A;  2OA4 A;  2P5K A;  3DU6 A;  2W48 A;  3K2A A;  2J5O A;  3ZCO A;  1ETW A;  3K1N A;  2ECC A;  1YRN A;  2FBK A;  1J59 A;  1WPK A;  1HCR A;  4C3I J;  3DXJ F;  1HW5 A;  3LQQ A;  1MIJ A;  5C3E J;  3OYF A;  2OUM A;  4A2U A;  5DUK A;  4XLA A;  1KZH A;  3HRM A;  3U1D A;  2DAO A;  3WTU C;  2WV1 A;  1FOK A;  1IDZ A;  4HQM A;  5ERI A;  1LPQ A;  2RVC A;  1W4M A;  2BY3 A;  3NWS A;  2NVY J;  1YTY A;  4RGS A;  1RC9 A;  3GTL J;  5F0F A;  1OPC A;  1Z3Y A;  1J9I A;  2E7W A;  1A5J A;  4XRS A;  3S3M A;  2DA6 A;  2JPC A;  4XKW A;  3DWL E;  4J00 A;  1BJA A;  4PK4 A;  2O0Y A;  2Q2E A;  5EZH A;  3VFZ A;  4EJU A;  2DFE A;  2IRF G;  2DMN A;  2HQ5 A;  3BJO A;  3HJE A;  3FDY A;  4XNF A;  3IHU A;  1YQA A;  2DBB A;  2G0E A;  3WU0 A;  3QOP A;  4Q5S F;  1HW1 A;  2DFF A;  5JHU A;  1HA8 A;  3SZP A;  5IT9 K;  4A0Y A;  1V5G A;  1RUN A;  2NVT J;  3S17 J;  3G6E I;  4FIS A;  3EET A;  3JCU C;  3J81 K;  3ZQQ A;  2BY0 A;  1Z6R A;  3IRR A;  4HQE A;  4I01 A;  1NG7 A;  3PNY A;  4Y4R A;  3JAM Z;  3S2W A;  5IYD J;  2R4G A;  2W82 A;  4FX0 A;  2K3F A;  4AIJ A;  2LRD A;  3ASN H;  1U2W A;  3WG9 A;  4MGR A;  3E5X A;  3FK6 A;  4IL6 C;  1PJR A;  3HOW J;  1U8B A;  5H20 A;  1Y8R B;  1IO2 A;  3DEW A;  4IJA A;  3EYY A;  2HDW A;  2FXA A;  3AL0 C;  2ICW G;  3GZ6 A;  2XF5 A;  2FQ3 A;  1AWC A;  4B09 A;  4DYR A;  2XB0 X;  2QA4 I;  4GYG A;  2B0L A;  3TBI A;  3AFH A;  3S2H J;  2ZKZ A;  2X6O A;  3SZT A;  1ON1 A;  1WKM A;  5HDK A;  5EZG A;  2NVU B;  1TBX A;  3P9K A;  3HHH A;  4EJO A;  1U6G A;  2HYF A;  1KGS A;  2VXD A;  3LSH A;  1WJA A;  3K70 D;  1VQM I;  1ETO A;  4PZJ A;  5GPA A;  1OR7 A;  2OF7 A;  2RNJ A;  3AG3 H;  2M3A A;  2RNG A;  1QU3 A;  4M73 A;  4WXH A;  3S3N A;  1XD7 A;  2EIL H;  1YRN B;  2MSY A;  4CZZ A;  3BTJ A;  2ELJ A;  1WJC A;  3EUH A;  4Q47 A;  2CUJ A;  3PJR A;  2MC3 A;  1ZGJ A;  3R61 A;  1SFK A;  4XOR A;  2ID6 A;  2DTZ A;  2FUG 2;  3G71 I;  3JW4 A;  1WQ2 A;  5LEJ A;  3FHZ A;  1ZRC A;  4F93 B;  3OYN A;  1GT0 C;  3E5U A;  5HDN A;  1WHU A;  2HGC A;  4L18 B;  2P6T A;  2PMZ N;  4IRG A;  4L5J A;  3LAP A;  3K7A J;  1HKT A;  2EIK H;  3ELK A;  5F64 A;  2HI3 A;  4M3F A;  4CIC A;  4YFX F;  5C4J J;  3H5R A;  3KEQ A;  3CDI A;  2E34 A;  2CJJ A;  2DMQ A;  3HTU A;  4L5E A;  4AWX B;  4CCL A;  1ZAR A;  2Q2E B;  1OR7 C;  3ZQG A;  5ILV A;  3V7C A;  1X1C A;  4U0V A;  1HBX G;  1PUF A;  3AL0 B;  3DTE A;  2VI6 A;  4QTR A;  3P9C A;  3GTQ J;  5LLQ A;  2PG4 A;  5B1A H;  3FMQ A;  4UV9 A;  4RLQ A;  5LGT A;  2X9D A;  3TED A;  3L2Q A;  4KUM A;  2QBY A;  1BA5 A;  1R1V A;  3B73 A;  2PLY A;  1I1G A;  3TL4 X;  2KIS A;  2E71 A;  5FB2 A;  2K9M A;  1OYW A;  2DOE A;  2ELH A;  3BY6 A;  3CES A;  4F55 A;  1JT0 A;  2E2I J;  1IRZ A;  1SD6 A;  5IYC J;  5F6F A;  1X4O A;  4RB3 C;  2M2E A;  2LBF A;  3LFU A;  4L9V A;  1HF0 A;  3MZ8 A;  3UNG C;  1BC8 C;  1O3Q A;  2VKE A;  2E2H J;  2R7W A;  5IT3 A;  1QVU A;  5DEQ A;  5HNF A;  2QSH X;  3H3V K;  4JYK A;  2HDC A;  1IUY A;  5F0C A;  4CGZ A;  1U5T A;  2KL4 A;  4Y52 J;  2JZY A;  1MDM B;  3I56 I;  5KNL A;  3QP5 A;  1T2K A;  2FX0 A;  3VSK A;  1A31 A;  2O7O A;  2VL8 A;  2M45 A;  4HF1 A;  4UUS A;  4NBQ A;  3HRS A;  1A6I A;  3IKT A;  5JLW A;  3CO6 C;  2LVS A;  4ZYD A;  1N25 A;  2ID3 A;  3JRE A;  1GXQ A;  3LOC A;  5FRM A;  4AM3 A;  1WH7 A;  3TP0 A;  1R4M B;  3FHN A;  5D4R A;  2QWW A;  4Q4Z F;  3TDU C;  2R7Q A;  1P4A A;  2NRA C;  2OQR A;  1CGP A;  3MWM A;  2ZXJ A;  2DOA A;  2QQA A;  4N9H A;  2Z99 A;  1FP1 D;  2XPV A;  1NK2 P;  3ECO A;  1BOB A;  1KQ8 A;  3C2B A;  4E6K G;  3DKY A;  2GIV A;  2Z33 A;  6PAX A;  2IT0 A;  1B59 A;  4Y17 A;  1BW6 A;  2EFN A;  2L9R A;  5CLS A;  2LF7 A;  2LLK A;  4BHB A;  1WSU A;  1U5T C;  1HKS A;  2ME0 A;  2DA1 A;  4EJT A;  2F48 A;  3A1Y A;  3L00 A;  1GLN A;  1YS7 A;  1S7E A;  1IJW C;  2EFW A;  1AA7 A;  2V6C A;  2A69 F;  2PQ8 A;  3ABT A;  3VYT B;  3FMR A;  4BYY A;  5LHH A;  5D5W B;  3IC7 A;  2DFH A;  4WWC A;  1R22 A;  1IRX A;  2DQR A;  5JLX A;  4I0B A;  3DPL C;  1AHD P;  2K86 A;  1BOA A;  1JKO C;  1YX3 A;  2K4B A;  4RAZ A;  5TGT A;  4MEX F;  4OIP F;  2Z16 A;  5EG0 A;  2CUE A;  2WB1 N;  2YR2 A;  1RKW A;  4KT6 A;  4A5M A;  2ETH A;  3U1K A;  3M3Y J;  1JHH A;  4FET A;  5DS9 A;  5BPD A;  2JPB A;  3CLQ A;  5L3F A;  3M8J A;  4LG0 A;  1AU7 A;  1P2F A;  2H09 A;  4HF0 A;  3F8B A;  3L2C A;  2GOX B;  1PUF B;  1Y0N A;  4ZDL A;  1G3S A;  4NC6 A;  1VQ8 I;  2QBY B;  1XN7 A;  1EH6 A;  2X48 A;  1U78 A;  1PP7 U;  4F92 B;  3KZI C;  3FXU A;  3LL7 A;  4OMZ A;  3W6V A;  4PJJ A;  4XL9 A;  5K5O A;  4I0A A;  1VND A;  5FRN A;  2MA3 A;  2EQR A;  1FTT A;  4BKX A;  2WY8 Q;  3AG2 H;  2LBF B;  2E1N A;  3KEY A;  5LHI A;  2M87 A;  1X3U A;  3LSG A;  1Y1V J;  1U9N A;  3X2Q H;  4D5F A;  3I4N J;  3SJM A;  1U5T B;  4GXO A;  2Z9O A;  1YS6 A;  1VQP I;  1ITY A;  4EM0 B;  2CUF A;  3FXQ A;  1I6X A;  2L9S A;  4M3E A;  1FPQ A;  3HL2 A;  3R0A A;  5BNG A;  2HDD A;  2DMP A;  2XRN A;  4YG2 F;  4P9U A;  1TQM A;  2Q1Z B;  1JT6 A;  2CFX A;  5B3S H;  1VQ9 I;  5LEK A;  2YS9 A;  3HM5 A;  1O4X A;  1X58 A;  1XMX A;  2GXB A;  4BUP A;  3JRC A;  4MNU A;  4A3L J;  2I5U A;  1QRY A;  2DOF A;  4N0B A;  4KNY A;  5ILU A;  3L2U A;  1SMY F;  1T6S A;  4NHJ A;  5FKN A;  2K3P A;  4XN3 A;  4S05 A;  3F8N A;  1RPW A;  2M34 A;  1D8K A;  2VBW A;  4J19 A;  1EH8 A;  1X19 A;  5HLI A;  2R5Y A;  1MBH A;  2HVR A;  1RI7 A;  1P4W A;  3I59 A;  1U0J A;  3O3K A;  2M30 A;  3G4S I;  1ZKG A;  2VKH A;  3CUO A;  1DPR A;  1MND A;  1V3F A;  2B7E A;  1R5G A;  3MZY A;  4B3A A;  1U3E M;  5FLV A;  1MH4 A;  1LVK A;  3BPV A;  1P9Q C;  3BZ6 A;  4G12 A;  3HOZ J;  1FTZ A;  2DJN A;  2OAZ A;  4CDG A;  2P7V B;  2Y0M A;  4XOP A;  1D0X A;  4CYC A;  3KP7 A;  1N77 A;  5JI6 A;  3SFI A;  4B1R A;  5EG0 B;  1E3P A;  3FXM A;  2JVG A;  2A5W A;  2XSJ C;  2FNA A;  4MQ9 F;  4AVZ A;  1TWA J;  2Y31 A;  2ESN A;  2ME6 A;  4ABZ A;  1HXD A;  2KJB A;  2XAU A;  1MNM C;  4LIT A;  3DKX A;  3K4N A;  2F5E A;  4ZH4 F;  4LG0 B;  1FEX A;  4JP0 A;  2AHQ A;  4IQ4 A;  3L1P A;  3ABM H;  3CP2 A;  1PUE E;  4YEJ A;  2GOM A;  3G73 A;  4X6A J;  2HFH A;  2K9Q A;  3UR3 C;  4DYQ A;  2JSC A;  2DTR A;  3TDZ C;  1IN4 A;  1XMA A;  3H3Z A;  4X1E A;  3ECH A;  5ICF A;  3ERE D;  4G6T B;  1POG A;  1MW7 A;  4GCV A;  2YX4 A;  4B8X A;  2JSP A;  1KA8 A;  3KLO A;  4XLN F;  4E7K A;  2FEZ A;  3OYC A;  2BW3 A;  3CCJ I;  2L9N A;  2Z2S B;  3FKI J;  4ZZD A;  3HGG A;  3LSJ A;  3HOY J;  3GTP J;  2QF7 A;  1IAW A;  2GA2 A;  3RIR A;  4ZC3 A;  4R1H A;  5JR3 A;  3DEU A;  1UZC A;  1M1E B;  2L7K A;  4NDL A;  1XDU A;  2DFI A;  2FOW A;  4KMU X;  3PQJ A;  2XAJ A;  1A36 A;  4A3G J;  3BG7 A;  5L3G A;  2BXZ A;  1T08 B;  2RQQ A;  2O61 A;  2D2W A;  2FBH A;  3F22 A;  4XM3 A;  1SFU A;  2JA6 J;  3BT9 A;  2BY2 A;  2XAS A;  3BG6 A;  2P6S A;  4MIM A;  3HSE A;  3DPT A;  5A2Q Z;  2ZB9 A;  3E6M A;  2E19 A;  2W85 A;  1B6A A;  1MBJ A;  1IRF A;  2A6E F;  4ENJ A;  3Q9S A;  5TIS C;  2JUG A;  5K1Y A;  3REO A;  2R5Y B;  1NK3 P;  1MNE A;  3W6J B;  3L2W A;  3I59 B;  3RZD J;  1ODD A;  4M3B A;  3VWB A;  3I55 I;  3E1S A;  4BE2 A;  2VOO A;  4KN7 X;  2DOD A;  5M5Y J;  1FX7 A;  4RS8 A;  3WHB A;  1XCV A;  1IXC A;  1QO0 D;  3OYK A;  3I4M J;  2KRC A;  2JA7 J;  5FKL A;  3EDP A;  3JAM K;  1HLV A;  3NQO A;  4XID A;  3ABU A;  1UHW A;  3OY9 A;  3BG3 A;  1IN8 A;  1T0F A;  3A02 A;  4JX6 A;  2XAG A;  5FFZ A;  3W3C A;  3T5X A;  4ESB A;  5H6Q A;  2NVX J;  2HEO A;  2KRH A;  4BDZ A;  1IXR C;  1WJF A;  4RGR A;  2K85 A;  4XLC A;  4CCO A;  4CSW A;  1JGS A;  2DDB A;  5FD6 A;  3F8C A;  4HF2 A;  1YIJ I;  5D8K B;  4HV6 A;  3A4C A;  3GZN B;  4M9Z A;  1MZB A;  3WU1 B;  2QVO A;  4N4O B;  2K9L A;  4PJN A;  2OZ6 A;  1IN6 A;  1IGN A;  2NOG A;  2IGN A;  4ESF A;  1OKR A;  2QKM B;  5J1Y A;  1PDN C;  2O8K A;  3LA2 A;  1G59 A;  4EGZ A;  2DLL A;  4U88 A;  5L3B A;  3K4M A;  2EIN H;  3CC7 I;  4XOT A;  4ZTJ A;  1T98 A;  4RM2 A;  1H88 C;  1OMI A;  2DYR H;  1IZ1 A;  3N97 A;  3M9A A;  3RPU A;  3DF8 A;  5EGO A;  2CO5 A;  4ITV A;  2RKH A;  4G7H F;  2R7O A;  3S1Q J;  1H0M A;  1W7P D;  3WGH A;  2NNY A;  1T0F C;  3V8J A;  3HIF A;  2RV8 A;  3HGY A;  4BAC A;  3EYI A;  3S16 J;  3IH3 A;  2UXX A;  3SEZ A;  1IF1 A;  4XLF A;  3OS1 A;  2VQL A;  4LOC A;  3ZRG A;  3S1M J;  2M8E A;  2XRO A;  2QCO A;  2VQH A;  1BW5 A;  1ETV A;  4PSW A;  4ZYA A;  5GP9 A;  2VN2 A;  5E79 C;  2M7A A;  3OYH A;  3BR5 A;  3AG1 H;  1OLT A;  4P55 A;  2E5Z A;  2V4J C;  3FXL A;  2VKV A;  3LA7 A;  3D0S A;  2M7B A;  3K6G A;  5FLX K;  2DJI A;  1A04 A;  3QPH A;  3WTY C;  3H92 A;  4KIF A;  3K4B A;  1MH3 A;  3IAM 2;  1VQN I;  2L4A A;  2OCE A;  9ANT A;  2JN6 A;  3R4K A;  3BWG A;  4DBR A;  3HOS A;  4QIW N;  3F8F A;  1XDS A;  5E3O A;  1EV7 A;  2VBZ A;  3RTR A;  5B66 C;  3ZMU A;  2WC2 A;  4ZDO A;  2QZ8 A;  5C44 J;  5LFA A;  2M8G X;  3VB2 A;  1P92 A;  3CDH A;  2ELK A;  4GRI A;  3GTM J;  2A05 A;  4EAT A;  2B63 J;  5K7H A;  3OL4 A;  3D5L A;  2HYJ A;  4OOI A;  4E7Z A;  2A61 A;  3LFK A;  2OTL I;  5BS6 A;  2DT6 A;  1K4S A;  1VQO I;  2AS5 F;  3MAJ A;  1YJN I;  3BTC A;  1IN5 A;  5DD4 A;  2XF7 A;  4RGU A;  4LLN A;  3ML6 A;  3K0L A;  3WG7 H;  3TOA A;  1CQT A;  1XCB A;  1OCO H;  2CMP A;  2WTE A;  2GQQ A;  3LWF A;  3BZK A;  2E1M C;  1HDD C;  3Q5F A;  3KE2 A;  1Q1H A;  2L54 A;  4KMF A;  4ZYG A;  4LIV A;  4UV8 A;  2HTJ A;  2WAQ A;  5DM6 F;  3SXY A;  1LDD A;  1TP4 A;  1KU3 A;  2ZJP F;  1XMK A;  3CMA I;  3DFG A;  3I53 A;  1FIA A;  4M9S A;  3F6V A;  3CZ6 A;  2JA8 J;  3BR1 A;  4I99 C;  3ZMD A;  1W36 D;  2FQ4 A;  1DPU A;  2V1X A;  4OIR F;  3C3W A;  3PUF A;  2BV6 A;  4M6Y A;  2Y0S N;  3FXO A;  5HS7 A;  3ZQH A;  1I39 A;  4BBR J;  3SQN A;  2JUC A;  1VQL I;  4UB6 C;  4HYE A;  2P0W A;  1Y8Q B;  1LB2 A;  2Q8K A;  3PFI A;  4A3D J;  4LGW A;  4UUT A;  4I7H A;  3EUK L;  1T8I A;  4XBF A;  3LSI A;  2HOT A;  2HXO A;  2VON A;  4JK1 X;  3GLL A;  3OIP A;  4M74 A;  3H36 A;  3OMY A;  2IGM A;  3ZPL A;  2GA1 A;  5AIP A;  3CCV I;  2R7X A;  4NUB A;  3VEP A;  3H9J A;  5EGO B;  3P7N A;  2JQ7 A;  4UNO A;  4AIH A;  1JTX A;  1SAU A;  1OCZ H;  2XIG A;  1BC7 C;  4HZF A;  3FIS A;  5TRD A;  1MJ9 A;  3KET A;  3ISP A;  1IC8 A;  4G9Y A;  3KCC A;  4KDP A;  1Z05 A;  1SEU A;  2VE8 A;  1FBQ A;  4BBS J;  1TW2 A;  2XKO A;  3WOD F;  3PNV A;  1VQK I;  4FTH A;  2GAU A;  3SHF A;  2ZC2 A;  3W2W A;  1MDM A;  2TRT A;  2MFZ A;  4PJ0 C;  1LEB A;  4RLF A;  1HDP A;  3OYJ A;  1W1W E;  3KPH A;  3D5R C;  2E1M B;  1TT5 B;  1J75 A;  3ZXS A;  4QLC U;  1O7L A;  4FQG A;  4IHY A;  2JT1 A;  1BR1 A;  3T1B A;  3KLN A;  1FMW A;  1R5I D;  2EV6 A;  5DM7 F;  4CCJ A;  1NHA A;  3HKZ A;  4D7M A;  3P5J A;  1P7J A;  2RRE A;  1T38 A;  5TJJ A;  1JKQ C;  4WXC A;  4BQA A;  3F9K A;  2HZD A;  4EJV A;  4ZZL A;  1W0U A;  5FGM A;  2DA7 A;  2LNB A;  1JHF A;  3TMO A;  4IF4 A;  5J47 A;  4WX9 A;  1K6Y A;  1R1U A;  2VKD A;  2LH9 A;  2LOO A;  1ENH A;  2ZSI B;  3TW7 A;  5M3M J;  1TWF J;  1U8R A;  3M8E A;  5FKK A;  3Q0V A;  4BQQ A;  3JSO A;  1TNS A;  3QYE A;  4H0E A;  1RNL A;  4A3B J; 
#chains in the Genus database with same CATH homology
 1Q1V A;  5EG0 A;  2CUE A;  2WB1 N;  3ZQI A;  1RKW A;  2R92 J;  3E7L A;  5HOD A;  3M3Y J;  1ZR2 A;  4Y7N J;  1WI3 A;  4BY1 J;  4FE4 A;  3OIO A;  5DS9 A;  2DMU A;  1OCT C;  1AU7 A;  1B72 A;  5IYB J;  2EZK A;  3F0C A;  1PUF B;  1IUF A;  1WH5 A;  1ZK8 A;  2COB A;  2Y30 A;  2CQQ A;  5J3L A;  4JX4 A;  2Y9Y A;  3HOU J;  2LD5 A;  1ZGW A;  2E2J J;  2X48 A;  1U78 A;  4IHW A;  4W1U A;  2OPT A;  3RZO J;  2KDZ A;  3FIW A;  3IH4 A;  3W6V A;  1OFC X;  1VND A;  5C4X J;  1HOM A;  3JRD A;  5EYR A;  2EQR A;  1FTT A;  4BKX A;  3PO2 J;  3LNQ A;  1ETY A;  3MN2 A;  3LSG A;  1E3O C;  1Y1V J;  2R0Q C;  4V2G A;  1U9N A;  1AKH A;  4D5F A;  3I4N J;  4RBO A;  4DZP A;  3SJM A;  2D5V A;  1VFC A;  3Q0W A;  1ITY A;  2CUF A;  2XPU A;  1DU6 A;  2EZI A;  4BXX J;  3JRI A;  1OJL A;  4M3E A;  3M4O J;  3HEF A;  5BNG A;  1JTY A;  1ORK A;  2HDD A;  2DMP A;  3QPL A;  1APL C;  1JT6 A;  2AO9 A;  2R7Z J;  3TW6 A;  5EEA A;  2YS9 A;  3HM5 A;  2N8G A;  1O4X A;  3BR0 A;  1X58 A;  2VUM J;  2LR8 A;  4MO7 A;  3HB9 A;  3JRC A;  3BQZ A;  1QVT A;  4A3L J;  3JRA A;  1QRY A;  3QPS A;  5FKN A;  3VPR A;  1H89 C;  1RPW A;  2M34 A;  3SDG A;  4IHX A;  1GVD A;  5GPC A;  1BJZ A;  2XGD A;  4J19 A;  1LFB A;  1T33 A;  1ZTR A;  4BY7 J;  1JJ6 C;  4XRS G;  2R5Y A;  1MBH A;  4CYC B;  2H1K A;  2I10 A;  1JJ8 C;  4AUX A;  2GLO A;  1ZKG A;  1LFU P;  4XK4 A;  2XB5 A;  4B3A A;  2HOS A;  1IDY A;  1Z77 A;  5FLV A;  3HBL A;  3ZQL A;  2P81 A;  1ETK A;  1MH4 A;  2CU7 A;  4G12 A;  3JRF A;  4A3F J;  1UG2 A;  1IV6 A;  3HOZ J;  1FTZ A;  2DJN A;  1SAN A;  1ETX A;  3G1M A;  1XS9 A;  3RQI A;  1RET A;  2L0K A;  3ZQC A;  4A3J J;  2LY9 A;  2HXI A;  1X2N A;  4D7N A;  4CYC A;  3GBG A;  1MSE C;  3CDL A;  3BG9 A;  2YUS A;  3SFI A;  4B1R A;  5EG0 B;  1MBE A;  1TWA J;  2Y31 A;  2ME6 A;  4ABZ A;  3GTO J;  4IEJ A;  1MNM C;  1JUM A;  4HNV A;  1WGX A;  4RDU A;  3JR9 A;  1FJL A;  3NAR A;  3QQA A;  1I6H J;  1FEX A;  4JP0 A;  2AHQ A;  1B72 B;  3L1P A;  3S1N J;  3S15 J;  4X6A J;  3OSF A;  1UHS A;  2K9Q A;  1K83 J;  4DYQ A;  2EH3 A;  3B6A A;  5IP9 J;  1JKP C;  1QPI A;  5F27 A;  3B6C A;  4X1E A;  2L7M P;  4XRM A;  3JRG A;  1VI0 A;  3BTI A;  1POG A;  2K9S A;  2XRL A;  4W97 A;  3HOV J;  2VPR A;  4AC0 A;  1ZR4 A;  3HDD A;  3CQZ J;  1ZQ3 P;  4MLO A;  2XPW A;  3CCY A;  2K40 A;  2R93 J;  3FKI J;  1WCM J;  1OCP A;  3ZOB A;  4GFB A;  3HGG A;  3LSJ A;  2DA3 A;  1AKH B;  4DYC A;  4B4C A;  3OOU A;  3BTL A;  3HOY J;  3GTP J;  2QF7 A;  4A3E J;  2DA2 A;  2JK3 A;  4XIC A;  2JJ7 A;  5K7F A;  3MKL A;  3HOX J;  4NDL A;  1UMQ A;  2JWT A;  4A3M J;  2IAI A;  5F08 A;  3O8H A;  5E3N A;  1TC3 C;  4DZJ A;  4A3G J;  2LK2 A;  4D5C A;  4C2M J;  2DA4 A;  3ZQF A;  2W48 A;  1JGG A;  3K2A A;  2JA6 J;  3BT9 A;  1ETW A;  2JA5 J;  2ECC A;  1YRN A;  4MIM A;  1WPK A;  1DU0 A;  1HCR A;  4C3I J;  5C3E J;  2ZB9 A;  2E19 A;  1MBJ A;  1XC5 A;  4M6V A;  3BG5 A;  4JX5 A;  3BR3 A;  2WV1 A;  2R5Y B;  1IDZ A;  3OSG A;  1NK3 P;  3H0G J;  3RZD J;  2EZL A;  1MBK A;  2MG4 A;  2NVY J;  4M3B A;  3LSR A;  2MGQ A;  2EBI A;  3GTL J;  3NAU A;  5F0F A;  1I50 J;  5M5Y J;  3WHB A;  5IOZ A;  3D1N I;  3I4M J;  2LKX A;  2JA7 J;  5FKL A;  4XRS A;  1A5J A;  2DA6 A;  3CMY A;  2RAE A;  1RR7 A;  2DMT A;  1HLV A;  3RKQ A;  4XID A;  1FIP A;  1G2H A;  3BG3 A;  5EZH A;  3A02 A;  4JX6 A;  2DMN A;  2HQ5 A;  2DN0 A;  1F43 A;  2NVX J;  2IBD A;  1F36 A;  4C3H J;  5EF6 A;  2LFB A;  4MFD A;  2G0E A;  1TWG J;  1TWH J;  2XSD C;  1RKT A;  1XG1 A;  4FCY A;  4A3K J;  3S17 J;  2NVT J;  2M0C A;  1IGN A;  4FIS A;  2NOG A;  2L7Z A;  1B8I A;  1GV2 A;  2XGC A;  5J1Y A;  2O8K A;  3BR6 A;  2KT0 A;  1JKR C;  3JRH A;  5IYD J;  4V2F A;  2GM4 A;  1H88 C;  4EEF G;  5FKM A;  5M5W J;  5EGO A;  3FK6 A;  4DW6 A;  2FD5 A;  3S1Q J;  3HOW J;  1U8B A;  1EF4 A;  3S16 J;  2XGE A;  3DEW A;  3G1O A;  3HGY A;  3Q0U A;  3IH3 A;  1SFO J;  2R5Z A;  4LOC A;  3S1M J;  2QCO A;  4DYR A;  2XB0 X;  1BW5 A;  1ETV A;  2L7F P;  2EZH A;  3S2H J;  5GP9 A;  2X6O A;  5IOY A;  1MSF C;  3BR5 A;  5EZG A;  5M3F J;  2VKV A;  1LE8 A;  5IPA A;  5IP7 J;  1JUS A;  3MVP A;  1ETO A;  1H8A C;  2O9L A;  5GPA A;  2NVQ J;  2OF7 A;  1BL0 A;  4I76 A;  1K61 A;  1MH3 A;  9ANT A;  2JN6 A;  2HOA A;  4MFE A;  2K9N A;  2LP0 A;  1YRN B;  3BR2 A;  2MSY A;  5DTD A;  3BTJ A;  4QIW N;  4IHV A;  5E3O A;  4A3C J;  1U9O A;  1VF9 A;  3A03 A;  2Y2Z A;  2ID6 A;  5C44 J;  2DTZ A;  2M8G X;  1R9T J;  3A01 A;  2H8R A;  2ELK A;  3GTM J;  1GUU A;  2B63 J;  5K7H A;  2HYJ A;  5FKO A;  3GTG J;  1GT0 C;  3BTC A;  1Y1W J;  2E1O A;  2Y9Z A;  2PMZ N;  1RES A;  3K7A J;  5F1J A;  2HI3 A;  4M3F A;  1CQT A;  5C4J J;  3LSP A;  5EDN A;  3S1R J;  1GV5 A;  1HDD C;  2CJJ A;  2YU9 J;  1ETQ A;  4A3I J;  2DMQ A;  4L5E A;  1MBF A;  2NS8 A;  3IV5 A;  3ZQG A;  5M5X J;  1PUF A;  1I3Q J;  2VI6 A;  1P7I A;  1FIA A;  4QTR A;  3GTQ J;  2JA8 J;  3BR1 A;  5J1U A;  2X9D A;  2FQ4 A;  3TED A;  5FLM J;  2CQX A;  3HKZ N;  1BA5 A;  3Q3S A;  3JRB A;  2Y0S N;  1T56 A;  1TWC J;  3ZQH A;  1JT0 A;  2E2I J;  4BBR J;  3IH2 A;  4QSH A;  1IRZ A;  4UUS B;  3WHC A;  5IYC J;  2IEK A;  3BQY A;  1X2M A;  3G1L A;  1B8I B;  2M9H A;  2M2E A;  3FK7 A;  2LTP A;  5F04 A;  4A3D J;  1HF0 A;  4UUT A;  2VKE A;  2HOT A;  2E2H J;  4S0H B;  2HXO A;  1QVU A;  3UKG A;  3H3V K;  2JMW A;  4JYK A;  1NTC A;  5F0C A;  4Y52 J;  1IG7 A;  1Z0X A;  5EGO B;  4M3G A;  1JTX A;  2FX0 A;  5K7Z A;  2O7O A;  4UUS A;  3FIS A;  4FE7 A;  4M3D A;  1D5Y A;  1W0T A;  1A6I A;  1IC8 A;  2ECB A;  5JLW A;  2LVS A;  2ID3 A;  2R5Z B;  3S2D J;  3JRE A;  5E3L A;  3LOC A;  2CRG A;  4BBS J;  5FJ8 J;  4A93 J;  1WH7 A;  3TP0 A;  1GDT A;  4FTH A;  3GTK J;  3O8G A;  3PM1 A;  2TRT A;  3GTJ J;  4AYB N;  2DA5 A;  1HDP A;  1LE8 B;  5J1R A;  2XPV A;  1NK2 P;  2MW8 A;  3C2B A;  4IHY A;  2NS7 A;  4A69 C;  1MBG A;  1BW6 A;  2WAQ N;  4D7M A;  2L9R A;  3DCF A;  4C3J J;  2LLK A;  1P7J A;  2ME0 A;  2DA1 A;  1JKQ C;  1IJW C;  1S7E A;  1W0U A;  2DA7 A;  2TCT A;  1JUP A;  4I6Z A;  3S14 J;  2FJ1 A;  5IP6 A;  3A01 B;  2GBY A;  3TP3 A;  1ENH A;  3TW7 A;  5M3M J;  3PO3 J;  5E3M A;  1TWF J;  5JLX A;  1AHD P;  5FKK A;  3Q0V A;  1JKO C;  5F0H A;  4A3B J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...