1X2MA

Solution structure of the homeobox domain of mouse lag1 longevity assurance homolog 6
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
64
structure length
64
Chain Sequence
b'GSSGSSGTAQPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LAG1 longevity assurance homolog 6
publication title Solution structure of the homeobox domain of mouse LAG1 longevity assurance homolog 6
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 12
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2005-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1x2mA01
1ETKA 2ECBA 4MFDA 2DA3A 1S7EA 3S16J 4C2MJ 1OJLA 2R5ZA 1W0TA 1LFBA 5IOYA 2CRGA 4A3LJ 4CYCA 4A3BJ 3Q0WA 1F43A 4M3DA 2DMPA 2DN0A 1ZR4A 4M3GA 3IV5A 2HXOA 4BKXA 2K9SA 1XG1A 3S1QJ 1QRYA 4EEFG 1RESA 2MW8A 3DCFA 3G1LA 4B1RA 3S15J 3H0GJ 4BY1J 1HOMA 4JX6A 4MIMA 3LSRA 2L7FP 1ZQ3P 1MH3A 4IHWA 4M3EA 5F0CA 5K7FA 2LFBA 2Y31A 3Q0UA 2L0KA 3M4OJ 2DA7A 4BBRJ 1HF0A 2VI6A 1DU6A 1LE8B 1JKOC 1RETA 3SFIA 1MBEA 4ABZA 1I50J 4S0HB 3ZQFA 5EG0A 4UUTA 3GTQJ 3RZDJ 2DA2A 3GTLJ 2H1KA 1JUMA 2K9NA 3BTLA 4XRSA 1Y1WJ 3LNQA 3BTJA 3BR3A 4Y7NJ 5J1UA 4D7MA 4C3IJ 1U78A 5GPCA 2D5VA 1APLC 2KT0A 2M34A 4AYBN 1MBJA 1OCPA 2DMNA 4M3BA 1LE8A 2ID6A 2JWTA 1AHDP 2XB5A 4RDUA 4BBSJ 1QVTA 3ZQHA 3BG5A 4X1EA 4D5FA 1F36A 2L7ZA 4X6AJ 1U8BA 1ETWA 3M3YJ 5C3EJ 1ZTRA 3IH4A 1PUFB 3HOWJ 5C4XJ 2NS8A 1BW5A 2CQQA 2K40A 3S17J 2FX0A 3FKIJ 2NS7A 3NARA 1IGNA 3FK6A 4RBOA 1B72B 1TWAJ 3FK7A 3A01B 1IUFA 2FD5A 3IH2A 2HXIA 1HDPA 2EZKA 3FIWA 1WPKA 2JA7J 2IBDA 3A03A 2XGDA 1IJWC 1IG7A 4DYQA 3E7LA 3HOZJ 1TWCJ 1Q1VA 3HB9A 3CMYA 1NTCA 1B8IB 2FQ4A 4XICA 1IDZA 4I6ZA 4C3JJ 1X58A 2GM4A 3JRFA 2YU9J 3WHCA 1X2NA 4A69C 3JRHA 2Y0SN 2M8GX 2VPRA 2OPTA 2WAQN 5EGOA 1H89C 3BR2A 1K61A 1TC3C 1P7IA 1D5YA 2HYJA 1B72A 3GTPJ 1RR7A 2WV1A 3A01A 3G1MA 3ZQLA 2JN6A 5K7HA 2ID3A 1WH5A 1ZKGA 1AKHB 5M5YJ 3JRCA 4J19A 4A93J 5FKKA 2LLKA 1SANA 2E1OA 3OSFA 1Z0XA 5IYDJ 5J1YA 3JRGA 1VF9A 4A3EJ 4D5CA 5FLVA 5EEAA 1H8AC 2LK2A 5EYRA 4IHYA 3S2DJ 1TWHJ 5IPAA 2L9RA 1MBKA 1BL0A 1YRNB 1HCRA 1X2MA 2CUEA 3B6AA 2M0CA 4JYKA 3HGGA 3HKZN 3LSGA 2GBYA 5BNGA 2ME0A 4A3KJ 2CUFA 4QSHA 1ETVA 2X48A 3TP3A 3JRBA 1O4XA 3RKQA 1GUUA 2COBA 1VFCA 1SFOJ 4AC0A 1W0UA 5GPAA 2G0EA 3HEFA 1LFUP 2HOSA 2M9HA 4B4CA 2R7ZJ 3S14J 3C2BA 1FJLA 3GTKJ 1OCTC 3Q0VA 1MSEC 4A3MJ 2TCTA 3PM1A 5E3NA 1FTZA 2Y9ZA 4IHVA 4NDLA 2Y9YA 2JA6J 3DEWA 5IP6A 2EH3A 3HBLA 2XPVA 2DMTA 1ETXA 3GTGJ 3BR6A 1ETQA 1OFCX 2DA1A 5F1JA 3O8HA 3BG9A 2DA6A 3HOYJ 3RZOJ 3UKGA 2XPUA 2H8RA 3BT9A 2XRLA 9ANTA 1RPWA 4QIWN 2YS9A 3GTJJ 3D1NI 4A3IJ 5C4JJ 2AHQA 1ZR2A 1WI3A 2X6OA 3CCYA 3JRDA 2O9LA 2HI3A 1JTXA 3ZQCA 3GTOJ 2LTPA 5M3MJ 3O8GA 2R5YB 2XSDC 3BQYA 4A3JJ 1NK3P 1POGA 3CQZJ 3RQIA 1GDTA 1GVDA 3HOVJ 5E3OA 4UUSB 5IYCJ 2EZIA 3I4NJ 3JRAA 1A6IA 4AUXA 3MN2A 2XB0X 1P7JA 4L5EA 1K83J 3BTCA 3NAUA 5FJ8J 4DZPA 2XPWA 1XS9A 2ELKA 1JKPC 4V2FA 2FJ1A 1NK2P 1BW6A 4IHXA 4M3FA 2JMWA 2I10A 5F04A 1AU7A 4JP0A 2NVXJ 4GFBA 1RKTA 1H88C 1G2HA 4IEJA 3BR1A 5IP9J 3TW6A 1R9TJ 5HODA 3W6VA 5J1RA 3OIOA 3QQAA 3K7AJ 5FKLA 4LOCA 2WB1N 2N8GA 3L1PA 2GLOA 2B63J 1PUFA 2TRTA 3S1MJ 3TEDA 3S1RJ 5IYBJ 1QPIA 2DA4A 5K7ZA 1QVUA 1ENHA 3LSJA 1JT6A 4C3HJ 3ZOBA 3MKLA 2XGEA 4UUSA 2HDDA 1VNDA 2CJJA 5JLWA 1JTYA 5FKMA 2LVSA 4CYCB 4A3FJ 2OF7A 1JJ6C 4A3DJ 2DMUA 3BQZA 1ZGWA 1IRZA 3OSGA 1MBGA 2E2HJ 2QF7A 5EZHA 1WH7A 1B8IA 1EF4A 3SJMA 2EZHA 1JJ8C 4FTHA 2KDZA 3OOUA 3HGYA 2R92J 4JX5A 3JREA 2PMZN 3GTMJ 4JX4A 2MSYA 3BG3A 2X9DA 4XIDA 4G12A 3HDDA 2YUSA 3B6CA 3IH3A 2VKEA 5FKOA 3LSPA 5M5WJ 1GV5A 1UMQA 5GP9A 2MG4A 5EG0B 4QTRA 1IDYA 5F0FA 2JA8J 5IP7J 1JKQC 1AKHA 2ZB9A 1IC8A 1T56A 4MLOA 5J3LA 4B3AA 5DS9A 1VI0A 4BY7J 1RKWA 2JJ7A 4A3GJ 5DTDA 1I6HJ 1E3OC 2LR8A 1TWGJ 3PO2J 1FEXA 3TW7A 1MNMC 3BR5A 1UG2A 2DA5A 4D7NA 1JKRC 2EBIA 1YRNA 3F0CA 1TWFJ 2O7OA 1A5JA 2LD5A 1XC5A 3Q3SA 3G1OA 2EQRA 3BTIA 3K2AA 1JGGA 2JK3A 2CQXA 2W48A 1JUSA 5JLXA 3SDGA 3TP0A 3BR0A 4FE4A 2NVTJ 2E2IJ 4DYRA 1HLVA 4A3CJ 4XK4A 1IV6A 2R93J 3ZQIA 4FCYA 1JT0A 1WGXA 3JR9A 4Y52J 1U9OA 4W97A 5M3FJ 1UHSA 4XRMA 2K9QA 4M6VA 2E2JJ 2RAEA 4I76A 1MBHA 5E3MA 2O8KA 2HOTA 1ITYA 1MBFA 2QCOA 4DZJA 5C44J 1JUPA 1ETYA 3LOCA 5FLMJ 1MSFC 3GBGA 4BXXJ 2DJNA 1GV2A 1MH4A 3S1NJ 2HQ5A 2P81A 2CU7A 4DW6A 4W1UA 4MO7A 3I4MJ 2E19A 1U9NA 2DMQA 5IOZA 2ECCA 5EGOB 1Z77A 1GT0C 3QPSA 2LY9A 2NVYJ 3WHBA 4DYCA 2Y30A 3VPRA 1FIPA 1I3QJ 2IAIA 2LKXA 2EZLA 4XRSG 1CQTA 5EF6A 1FIAA 2DTZA 5E3LA 2R5YA 1HDDC 2ME6A 5F0HA 1WCMJ 2R5ZB 2L7MP 4MFEA 2IEKA 3HM5A 1T33A 2M2EA 3MVPA 3JRIA 1DU0A 3H3VK 5EZGA 4HNVA 3S2HJ 3A02A 5FKNA 5EDNA 2Y2ZA 1BA5A 2HOAA 5F27A 1Y1VJ 1FTTA 3CDLA 3QPLA 2LP0A 2NVQJ 2R0QC 1ZK8A 3HOUJ 2MGQA 4FE7A 5M5XJ 2AO9A 2VUMJ 4V2GA 5F08A 3FISA 2XGCA 1ORKA 4FISA 1ETOA 2VKVA 3PO3J 1BJZA 2NOGA 2JA5J 3ZQGA 3HOXJ
chains in the Genus database with same CATH superfamily
4OIPF 2ECBA 1KGSA 1ZG3A 1VQKI 3CCJI 2VQHA 3FMSA 2Z33A 3IAS2 2LY2A 3K4KA 2DQRA 2IS2A 2V1DA 2BXZA 3ROUA 4EJUA 1WJ5A 4GO1A 4B3XA 1D1AA 3MZ8A 4CYCA 3I56I 4YIIA 3TDUC 3LFUA 1ZR4A 4M3GA 3IV5A 1S9HA 4BKXA 5JR3A 2XASA 2K9SA 2P6SA 2VJJA 1ZG5A 3S1QJ 2DYSH 1W5TA 3FXUA 1RESA 2MW8A 3K1PA 3OR2C 3QU6A 2ZXJA 5IT3A 5BPDA 3H0GJ 4ZYAA 1TTYA 4B48A 3OYMA 2L9NA 2L7FP 1ZQ3P 3LQQA 3PNYA 4GYIA 3FHNA 2Y31A 5K1YA 3FBNB 3E6BA 1HKTA 2K4BA 3V7SA 1HF0A 2VI6A 2WTEA 1LE8B 1X4OA 3ERMA 1PVEA 2QLZA 1XDUA 1YX3A 5LGNA 3PIOF 2F5EA 1MBEA 1S6LA 1WI9A 5GTIC 2BZTA 2MFZA 4HAMA 2CG4A 2F5VA 1JE8A 3N4MA 1I50J 1Z7LA 1E0EA 4ENMA 4KIFA 1B9MA 4KMFA 2KIQA 2K86A 1JUMA 1KU7A 2HR3A 1MDMB 1YO5C 1LKXA 3OR1C 1CF7B 2L9VA 4KNYA 1GHCA 2YR2A 1HC8A 4Q5SF 2JQ7A 1XMAA 5LGUA 3DWLE 3K4LA 4KUMA 2JWTA 1FWZA 2XB5A 3SXYA 4BBSJ 2Q0OA 3HZJA 5B1AH 5FGMA 2L01A 4X1EA 4UY8I 1K4TA 4BJ6C 3CUQC 2EV0A 4X6AJ 4OOIA 2VONA 5CVUA 1R6RA 5C3EJ 1ZTRA 3OYHA 3IH4A 1UHWA 4F92B 2COMA 2NS8A 4UXNA 1NG7A 2MH9A 1YTYA 2CV1A 4YG2F 3NARA 2X1EA 2DFHA 2R3SA 4RBOA 2E71A 3FK7A 3CDIA 1ON2A 1MMAA 1Z6TA 4CZZA 2FD5A 1E3PA 2F6CA 2JT1A 4XSXF 1BR2A 2HS5A 5DUKA 1ZH5A 2GOXB 2CW8A 3A03A 1X1PA 1U5TB 3FDYA 2BOLA 3G6EI 4DYQA 2WV0A 3E7LA 4CHUA 5CQEA 4A5MA 1OISA 3N05A 4H4KC 3QYFA 3HOZJ 1TWCJ 3W2VA 2KZGA 3VWBA 3VSKA 1IDZA 3VYRB 4I6ZA 1X58A 3H9JA 2VXDA 4F3QA 3JRHA 3H3ZA 3K4MA 4XNFA 4O6JA 2Y0SN 3X2QH 1G3WA 2EIMH 2M8GX 5FFXA 4BU2A 1ZREA 2OA4A 5EGOA 3BR2A 1R71A 1SD4A 3HYIA 1P7IA 1D5YA 5KAIC 2HYJA 1B72A 2L54A 3G1MA 3ZN1A 2Z9OA 4ETSA 1QO0D 4MHGA 2IA0A 1R4MB 2CMPA 2LYCA 5DCMB 3JRCA 3ABLH 5FKKA 2LLKA 2KHMA 3TMOA 3OSFA 2OQGA 3NRVA 2WA0A 4ANJA 4XLNF 2P6TA 4MQVA 2JSCA 2RDPA 4HX7A 5EYRA 1FSHA 3VFZA 4XKCA 1XCBA 3E5UA 1BL0A 1YRNB 4ESBA 4LB6B 3OYCA 3REOA 3WTZA 3ZPLA 4M9SA 2GBYA 5BNGA 1VZ0A 2ME0A 3C2HA 4BXFA 1RR8C 3CUOA 4Y17A 4EGYA 4HDVA 1TL8A 2X48A 3PSIA 3EYIA 3RKQA 1Y0UA 2F5CA 1VFCA 1K6YA 2KRHA 3OYIA 5GPAA 2HPMA 1BOAA 2R7ZJ 4Z6YA 1F9NA 1OCTC 3Q0VA 3CJQB 1BI2A 3MEXA 5J40A 3PM1A 3SZTA 2Y9ZA 3D5LA 4IHVA 2GIZA 4ESFA 3SQNA 2BBYA 4M73A 3DEWA 1JXSA 3LSMA 1FBQA 5IP6A 4PCQA 3RKXA 2LOOA 3K4JA 1ZARA 1MJ9A 4E7JA 5FRMA 3CCEI 3U21A 4ZZLA 4WK8F 3GTGJ 3ZP5A 3WTXC 1OFCX 4KISA 3M07A 2F4MB 3TDZC 3ESWB 1D0ZA 3HOYJ 5HS7A 1A35A 3ABMH 2XPUA 3K10A 5E1ZB 3WG7H 4XLCA 3BT9A 1HXDA 2VJIA 2H8RA 4QIWN 2H94A 2JUGA 3PUFA 4A3IJ 5C4JJ 2ZJPF 1TP4A 2AHQA 2NOJB 2X6OA 3CCYA 3GXOA 2EV5A 5HDKA 4NQWB 3ML6A 1LEBA 3JSOA 4BUPA 5IT9Z 1DDNA 1FYKA 2F48A 2LTPA 3KYCB 1DGRM 5D5UB 2R5YB 2V9VA 3BQYA 2CFXA 1NK3P 3AG3H 4OINF 5LEJA 3S8PA 1GVDA 1ON1A 4G9YA 2EV6A 4UUSB 2HDWA 5L3GA 1CF7A 1G3TA 5BS6A 2EZIA 3I4NJ 2LY1A 1A6IA 4AUXA 3JRAA 3MN2A 1OYIA 3GMEA 2VODA 4DZPA 5ICEA 2ZNZA 4ZJZA 2A5YB 2FEZA 2FJ1A 1NK2P 4IHXA 3E6MA 2VOPA 5HDNA 3GFMA 2OZ6A 2XF6A 3RDIA 3WU2C 1S29A 1SD6A 4JP0A 4GFBA 1Z21A 1R1VA 5F64A 5A2QZ 1PP7U 2ZC2A 1WZ2A 2V7FA 1DP7P 5HODA 2IS1A 3OIOA 1MZBA 3K7AJ 2Y48A 4XORA 4HA8A 4U7BA 1FT9A 1O7FA 2FMLA 2M5WA 3M8JA 3PNTA 3L1PA 3S1MJ 3TEDA 2JUCA 5IYBJ 3S1RJ 1QPIA 2XIGA 1VQ5I 1RZ4A 3CC2I 3NEUA 3LSJA 4XLAA 4C3HJ 2JTVA 2HDDA 1VNDA 5JLWA 1S8NA 3HHHA 3EPZA 1VQOI 1LDDA 1JJ6C 4BACA 1FOXA 5FLXZ 2DMUA 3CP8A 2VJ5A 1U5TA 3KP3A 1IRZA 1W7PA 1R00A 2YX7A 3OSGA 1LB2A 2LREA 2E2HJ 1XB4A 2FNAA 2XUBA 5EZHA 3EQLF 4XLEA 5E8GA 2QKLB 3MD2A 3R0AA 4HOBA 2O0YA 1YFHA 2CUZA 1YQAA 3EUHA 3W3CA 1XTAA 3HGYA 2DFIA 3ASOH 4ON0A 4OIOF 4BQNA 4P9UA 4B43A 2DO7A 3JREA 4OMYA 1MGTA 4JX4A 2HDCA 4XIDA 1R5ID 1EKEA 1IV8A 3ULQB 3OS2A 3KEOA 1VQ9I 2UWMA 1IN4A 3B6CA 4I98B 4KDPA 2JVHA 3IH3A 2K3PA 3LSPA 1BBYA 1XSVA 3L9FA 1F5TA 5DEQA 1DGWY 2KLOA 2ZFWA 1I5ZA 2ZB9A 1MJBA 2HKOA 5FRNA 3FXQA 4MLOA 4FHTA 1FMVA 1PJRA 4BY7J 2KKOA 1RKWA 2JJ7A 2JVGA 3HC7A 2O5RA 3F8BA 1FYMA 2ELHA 4OAYA 2LR8A 1WJEA 3GWZA 3M8EA 1MNMC 2EB7A 2K27A 4BAYA 3BR5A 3P9KA 2E35A 2HPIA 3MKZA 2EBIA 1JKRC 3F0CA 3WGGA 1YRNA 3J7AY 5L3DA 3U1KA 4D1QA 4P55A 4DJAA 1Z3XA 1R1TA 2W48A 5D6EA 3SDGA 2WY7Q 2CH0A 3C7JA 4FE4A 4KT6A 4NC8A 1YLFA 2V1XA 4A3CJ 2X6WA 4FCYA 4YFKF 4AIDA 2KFDA 3K1MA 1G59A 2M30A 3ZR8X 1W1WE 5DDGA 3R4KA 2K9LA 5E1XA 3L2RA 2O8KA 1R5GA 1G3YA 1BI1A 1MKMA 1S7AA 4AWXB 3HL2A 3BCBA 2QCOA 2QBYB 2NNNA 3VSLA 3N97A 5TJJA 2OTJI 2QQAA 3F8NA 2VQCA 1XCVA 2RN7A 4PJJA 2O03A 3ZCOA 1MMDA 4XKVA 3OYKA 1TBXA 4IL6C 2R7VA 3RCOA 2FBIA 3V7CA 3R60A 2K85A 1U9NA 1O3SA 1AA7A 1I39A 2ECCA 3HPGA 4PJ0C 2W25A 1Z77A 4BDZA 3QPSA 4II2A 4PDKA 2WY8Q 2FSWA 3E0JB 4GDFA 5E1WA 1RUOA 1I3QJ 3K2ZA 4NQWA 1OR7A 2EZLA 1FIAA 2L7KA 4RMNA 2R5YA 2VPLA 1MNDA 2ME6A 4BQQA 4N4NB 1WCMJ 4U87A 1IO2A 1B59A 3AAFA 4MFEA 1T33A 2F4OB 1D5VA 2YSRA 1EH7A 4MEXF 5K5RA 3A02A 3LAPA 1ZN2A 3QPHA 4K2EA 1YOVB 2RC4A 1IRFA 5DYMA 2HOAA 1LVKA 3A0HC 1LVAA 2UXXA 1FOYA 3NWTA 3DKXA 1Y1VJ 1Z67A 3FXMA 1FTTA 3CDLA 1D3YA 3QPLA 2HVSA 2NVQJ 5JVGF 3DBRB 1ZK8A 3W2AA 2MGQA 1KQ8A 3QOPA 3DLLF 1Z9CA 2BY2A 2VUMJ 2EK5A 2XAFA 3C3WA 1D8JA 1ORKA 2RV8A 2EA4A 3T1BA 2EINH 4WXDA 1QQIA 2AXTC 2MABA 4EJOA 2NOGA 3KEYA 4IKFA 3HOXJ 2Z2SB 3OS0A 1S7EA 4BYYA 3K4BA 2GIVA 4C2MJ 1X3WB 2EFNA 3F23A 1W0TA 2FBKA 5D8KB 2KDOA 1T98A 3SZPA 2UV1A 3CF5F 1F43A 2DMPA 3WGHA 4BHCA 2KIUA 3DQVC 1U5TC 2O61A 3H5RA 1I3AA 1XG1A 3HSFA 4QPQA 2Y75A 4HRIA 3OL3A 3CCSI 2RNJA 3GLXA 2IGMA 2Z16A 4AVZA 1HOMA 2XV4S 3FBIB 4JX6A 2STTA 1UHMA 1MH3A 1X1CA 2QQ9A 1K7AA 5F0CA 4MNUA 3TBIA 4CCJA 2LFBA 2VT2A 2H09A 4A2UA 2VBYA 2L0KA 3VB2A 3M4OJ 4BBRJ 4EM0B 3HG9A 1D1CA 5ICGA 5CVRA 3SFIA 3HXLA 4EJVA 4Y3OA 1I1GA 4FT8A 4PFPA 2E34A 2DTRA 2LH9A 2DW4A 3K70D 4S0HB 4I99C 3ZQFA 3PJRA 3RZDJ 4S05A 2E1MB 3GTLJ 2H1KA 3GZNB 1LJ9A 2DFFA 4LGWA 3BTLA 1KYZA 2VE8A 3BTJA 4RGUA 4F93B 2R7QA 1IRXA 3BR3A 3J81K 2KIMA 4OWRB 3OYFA 4F7ZA 1WQ2A 1U78A 2GZWA 3FXOA 3WGIA 5DV5A 2X4HA 2D5VA 2KT0A 4PJMA 1ACIA 4OMZA 1OCPA 4M3BA 2XAGA 3V4GA 1FP1D 3ZQHA 1LFPA 3H36A 3ZRGA 2AS5F 2H8WA 3RPUA 5KHDA 2HYGD 2QQ8A 3GF2A 2FE3A 4YRVA 2E5ZA 1U2WA 3PQJA 3Q9SA 3S17J 1KA8A 2X6YA 2NS7A 1IGNA 3FK6A 1B72B 1TWAJ 4HG2A 5JHFA 4FQGA 1FSEA 5EEHA 1BI0A 4LITA 4HYEA 3IH2A 2JSPA 4UV8A 4M72A 3FIWA 1HDPA 5HOOA 1WPKA 5CKTA 2JA7J 4PUSA 1AWCA 1IN8A 2VBXA 2XGDA 5LEKA 3S3MA 4ZYEA 2IGKA 3L7WA 5L3FA 3OYAA 2PQ8A 1N25A 2LSOA 3ECHA 2R7UA 2OAZA 4CCKA 2DDBA 1FP2A 4LIVA 4HPQA 5K5QA 1B8IB 1W4MA 2FQ4A 2A61A 5K5OA 4XICA 1RNLA 3L00A 5D4RA 1B9NA 3WHCA 5E8IA 1FOWA 1S5LC 2R7TA 3F72A 1DPRA 4E4HA 3S93A 2K4JA 4Y33A 3W2WA 2PX9A 1TQMA 2A6TA 2VQGA 3CD6I 1OR7C 3V8KA 3LSKA 2WV1A 4M6XA 3ZQLA 1FLIA 2P5VA 3J80K 2XF7A 4OIRF 1ZKGA 2EFWA 1BC8C 5CVIA 1AKHB 1MD0A 5D5VB 2LG4A 1I27A 2KJBA 4ZYDA 4M9ZA 1SANA 2E60A 2VC1A 5ILVA 4B44A 1S3JA 5CPRB 5TISC 4E70A 4DOZA 1V5EA 1D0XA 3JRGA 3IHUA 4D5CA 4A3EJ 2VE9A 1H8AC 5FLVA 5DUIA 1ERDA 2PBIA 2WBMA 2LK2A 3EUAA 2P5LC 1Q1HA 1USTA 2WWYA 3VYTB 1TWHJ 4UHTA 3OYBA 4RB0A 1X2MA 3SDBA 1HCRA 2X51A 4JYKA 3UR3C 4C30A 3HGGA 4EJTA 1IUYA 1H9TA 4IRHA 2DXIA 4UVAA 1VQ7I 2QSGX 4KICA 4G6DA 3TP3A 4D0PA 3JRBA 1KU3A 3KE2A 1T0FC 3H5AA 2COBA 4IJAA 3KX2A 1SFOJ 4AC0A 1WJAA 3V7RA 1W0UA 2DOAA 4CDGA 2VBZA 2RQPA 1WJCA 3S14J 3C2BA 2W57A 2ZMEA 3M1CA 3IC7A 5F6FA 2YX4A 4A3MJ 4LK0F 2JPBA 4IXAA 3Q5FA 3H9GA 3FXRA 2HQRA 3J7AO 1UJ8A 3LA2A 3MWMA 3V42A 2MLGA 4KMUX 1ETXA 3BR6A 2DA1A 1ONVA 3O8HA 2LDUA 3CZ6A 5HNHA 1LPQA 3RZOJ 2LBFA 1FMWA 4BL0B 3P9CA 3A4CA 1U3EM 2XRLA 9ANTA 1RPWA 2YS9A 2A3SA 1MJAA 2BVLA 1BC7C 2VKDA 1WRJA 1GXQA 1A31A 1JTXA 2LRDA 3CMMA 3FM5A 4PGGA 4UB8C 4WXCA 3GTOJ 4CICA 5M3MJ 1Y0NA 3ZMSA 1ZELA 3H9QA 3I54A 1PDNC 2ISZA 6PAXA 3TL4X 4E7SA 1POGA 3CQZJ 2GQQA 1WJBA 2QSFX 5D5WB 2GXBA 4BE2A 4N9HA 2HWVA 3F8FA 5E3OA 4BEHA 1R1UA 2F5DA 5IYCJ 2HFHA 4XOTA 4XR6A 4YEJA 2XB0X 3FF5A 3KYLA 2ISYA 1P7JA 1P6RA 1K83J 4YELA 3CDHA 3NAUA 4A0YA 1IXRC 2XPWA 1W7PB 3GX4X 2ETHA 2W1OA 2OTLI 2CO5A 1TLHB 2RNGA 4XN0A 2BV6A 2DI3A 5IP9J 1R9TJ 2QGUA 3E5QA 1DQUA 3I3LA 5J1RA 1R4NB 2PJPA 4HF2A 5FKLA 5LLQA 5ILUA 2BHZA 4LOCA 5ICFA 2WB1N 2B63J 5DD8A 3SYTA 4AIHA 2DPUA 5K7ZA 1QVUA 2DK8A 5E17F 1JT6A 3M8FA 3ZOBA 2EPFA 2HEOA 2FA5A 2XGEA 2V9KA 4LD5A 3K69A 2LVSA 1P2FA 3LAJA 3OYLA 1ZGWA 3S32A 2DT6A 3WG9A 5KVRA 3KEQA 1MBGA 5GADJ 5HLIA 2JA2A 2QF7A 2Z99A 3OYDA 3RIRA 2QKMB 3QWLA 3H92A 3S2WA 1ZLJA 1B8IA 4LLNA 2ZJRF 3ZMZA 4DBRA 3PNVA 1U0JA 3DBHB 3OOUA 2DCEA 2R92J 4L18B 4P5OA 4UVBA 3IAM2 1TW3A 2IW5A 2V26A 1Y8RB 4WWCA 2DJIA 3BG3A 5J8FA 2X9DA 2V1NA 4NC7A 1YS6A 4G12A 4RAYA 4IOCF 2VASA 1QBJA 5M5WJ 1GV5A 3RJPA 5EG0B 4QTRA 3DLAA 5IP7J 3R61A 1AKHA 1VQMI 3DPLC 1OCRH 1YYVA 2ZKZA 3E6CC 2OCCH 2P7CB 1IC8A 1J09A 4GCVA 3AKZA 5DS9A 1A6QA 1DP3A 3HRUA 3BOQA 1TNSA 3I4PA 2OQRA 4A3GJ 1X1DA 5DTDA 2VIXA 3ZQ7A 3PO2J 3HKZA 4XLHA 4KN7X 1WSUA 1G3SA 2IRFG 3MFKA 4RAGA 4D7NA 4E7ZA 2EIKH 1B4AA 3GCMA 4V19K 2OCEA 2R7WA 1XPXA 1A5JA 2PMHA 5L3EA 4ZH4F 2KMUA 3H3UA 1T95A 3G1OA 3Q3SA 4N4OB 1OMIA 2JK3A 1TQPA 2KJCA 4X0GA 3DKYA 3TP0A 3BR0A 4Q4ZF 2NVTJ 2ZNYA 3F9KA 2E2IJ 4DYRA 3GLLA 1WVRA 2E1CA 2R93J 3ZQIA 4LK1F 2OBPA 1UELB 4Y52J 2HVRA 4W97A 5M3FJ 5J4YA 1UHSA 1Y39A 3CCQI 3BPVA 4M6VA 2MC3A 2RAEA 1ZRDA 2E2JJ 1P92A 4BDYA 3IKTA 3ZXSA 2HOTA 4D9JA 1XGSA 4EATA 1QHHD 2D2WA 1SVOA 2F4IA 2I5UA 4HLXA 2HQAA 3RYPA 2X6XA 4AYBA 4ZTFA 5FLMJ 2DAOA 2ZCWA 4DW6A 1BR4A 2CU7A 3V8JA 4L0YB 4MO7A 4CYDA 4E7HA 1R58A 1OKRA 1ZAOA 4CSWA 2Z1DA 4BXUA 4CXFA 2DK5A 2NVYJ 3WHBA 4MTEA 3OS1A 4ENNA 1Z05A 2R4GA 3AG2H 3VPRA 5JHUA 4BE0A 1JGSA 2LKXA 4EQQA 4CH7A 4HQMA 2XAUA 4XN3A 3I64A 1R7JA 4OU0A 5E79C 3L09A 4BQOA 5EF6A 2DOFA 1HKQA 2DTZA 3BJ6A 1YIJI 4U7DA 4EGZA 2E1MC 3QRFF 1ZGJA 4N0BA 3ZQQA 3LSHA 4KT5C 4P9FA 4QPOA 3H5NA 2LNBA 3MVPA 4II3A 3JRIA 5EZGA 3S2HJ 3EETA 1VTNC 2W85A 2LMDA 4WX9A 4AU7A 2CFOA 4FETA 1BA5A 2ELJA 5L3BA 5KNLA 4DIQA 4KYWA 3G3ZA 3PIPF 2I8DA 2R0QC 1M1EB 2DOEA 3CLQA 4V2GA 2XGCA 4LFUA 4I01A 3WU0A 1ETOA 2VKVA 1OYYA 1D8KA 3RI4A 1BJZA 1MW7A 2JA5J 2PI0A 2QVOA 4E7KA 1ETKA 2DA3A 1P4XA 2PG4A 5CLSA 2R5ZA 1V55H 2LF7A 3DPTA 1KU2A 3R6SA 4F52A 1LFBA 1KQ0A 2GAUA 5IOYA 4A3LJ 4A3BJ 2HNHA 3LWFA 3Q0WA 4M3DA 3K4CA 2PJRA 1TT5B 1J7KA 4BHPA 4KN4X 4A6EA 3DCFA 3G4SI 2V9PA 3HPHA 3MMYB 2HZTA 5B1BH 3S15J 3M1EA 3WTYC 2ZFUA 1ZG1A 1W36D 3LSRA 1J0RA 4UUVA 2KP6A 3BJOA 1FBSA 5K7FA 4NUBA 1JI8A 2FXAA 4RGXA 1DU6A 3LA3A 1RETA 2VB6A 1QA6A 1YW8A 5HNFA 4BHBA 2CV0A 2XGXA 1BR1A 1PUEE 1SMYF 2PLYA 5EG0A 3GTQJ 1IN6A 4G94A 4YIRX 1X3UA 2P4WA 2DA2A 2UZKA 3MZHA 1V5GA 3TOBA 2K9NA 1Y1WJ 4ZDOA 1T2KA 3T8TA 2MA3A 1HBXG 2PMUA 5IT9K 1KQ9A 1U6GA 5J1UA 1UCRA 4D7MA 5ED4A 5GPCA 4ENKA 2M34A 4AYBN 5DM6F 2DMNA 4J00A 4KFCA 1E2XA 1YW7A 3A0BC 2ID6A 3BZKA 4RDUA 1VQ4I 3D0SA 1NHAA 5JVTA 2HKXA 5GTHC 1OCCH 3BJAA 4EMSA 2NVUB 1RUNA 3J81Z 3F21A 1OCZH 1OPCA 5ERIA 2V1UA 2XKPA 1U8BA 3BP8A 3I53A 3M3YJ 3HUGB 1P9QC 1PUFB 2HOEA 2BVMA 2FU4A 2CQQA 3SFZA 1W36C 2K40A 2FX0A 1EH8A 2WAFA 3FM3A 1KYWA 5A2QK 4GRIA 5GAGJ 1FC3A 3IWZA 1SFUA 1W7PD 4DQ2A 5L3CA 2FOWA 2EZKA 3EDPA 2GA1A 4UVCA 4ZYGA 2IBDA 3K9TA 1IJWC 4PSXA 1SD7A 1IG7A 2LC2A 1WHUA 2M87A 3GUDA 3OYNA 3E1SA 1TQIA 3HJEA 3MKWB 3U9GA 2M8EA 4FX4A 4BE1A 3CCLI 4G7HF 1EJ9A 1K4SA 3DEEA 2XC7A 3U2RA 1V5FA 1Q1VA 3HB9A 1NTCA 1R22A 5D5XB 4C3JJ 5J6XA 2GM4A 4KJZA 4P1WA 3JRFA 1W5CC 3ASNH 5HDGA 5FLXK 3B73A 3SEQA 1FNNA 4HNUA 1XMXA 2WADA 2V4JC 4RAZA 5HLTA 4IX7A 4FX0A 1LDKB 2KISA 2AXLA 3BROA 5BMZA 2HVQA 1K61A 3LFKA 1FBUA 2R7FA 2DU9A 3BY6A 3RSNA 3A01A 3DTIA 3L2QA 2KZVA 3WE3A 5K7HA 2ID3A 1WH5A 3HOTA 2G7HA 3CLOA 5M5YJ 1BIAA 4U0YA 2H6BA 2LKPA 4A93J 4KIBA 5HS9A 3FWEA 2ZMEB 3MCZA 3GZ6A 3JAMZ 3P5JA 3CJRB 3TKYA 5J1YA 2MYSA 3ZMVA 1VF9A 2X85A 4UV9A 5EEAA 3QYEA 3OV8A 4M71A 4BH9A 4IO9F 3J80Z 2Q2EA 1UFMA 3S2DJ 4ZZDA 2YU3A 4HNTA 5IPAA 2L9RA 3JTGA 2OD5A 2M4GA 2CUEA 3B6AA 1XGOA 2M0CA 2CW7A 3LSGA 3I71A 2PMZA 3JW4A 4A3KJ 3RTRA 1K78B 2CUFA 4QSHA 3EUHC 3WTTC 3CCMI 2ESNA 2IXSA 4RA2A 3PFYA 3RKWA 2LBFB 3IRRA 2A05A 5CQGA 2FUG2 2FBHA 1MMGA 2RVCA 3VYSB 2OC6A 1N75A 3KP6A 2IT0A 2EILH 4XLFA 1BN5A 2G0EA 3BC8A 2Q8KA 2E7XA 3GTKJ 3TO6A 1O3QA 2JZYA 3TOAA 4NBQA 4CUGA 3AL0B 4GXOA 5E3NA 3C2GA 1FTZA 4LLLA 1Z3YA 3MZYA 4G6TB 4R79A 2Y9YA 3WE2A 4HDUA 2X1CA 2JA6J 1NG6A 1YS7A 3HRTA 4S04A 3V8LA 4BEHB 5JI6A 3OY9A 3GEZA 2DYRH 2XPVA 3W6JB 3I58A 4AD9A 1SAXA 5AIQA 2NXNB 5F1JA 2H6CA 4JK1X 2X1DA 4IHSA 4IVNA 3IUOA 2Z5UA 1SFEA 2BYVE 4ZDLA 3DU6A 3D1NI 3GTJJ 3DKWA 2PN6A 4A0XA 3KETA 5ILSA 2D45A 1ZR2A 1WI3A 3JRDA 3FXJA 2DT7B 2O9LA 3A1YA 1Z7UA 4ZDPA 4HZFA 3A2KA 2A68F 2P8TA 3O8GA 3MKYB 3M9AA 2XSDC 5B3SH 3I5UA 4A3JJ 3RQIA 4CCLA 3HOVJ 2A5WA 4Y15A 3ZMUA 5GAEJ 3L2WA 2M0MA 4IQ4A 1XMKA 3T8RA 2QEXI 4L9JA 4HLYA 4CCNA 2L3DA 3BTCA 3LSTA 1XS9A 4BQAA 4CCOA 2ELKA 1JKPC 2A69F 3EUKL 4V2FA 2ZXIA 1T6SA 3L2VA 3M7GA 2MH2A 5F04A 2NVXJ 2HTSA 1RKTA 1G2HA 3OYJA 5LRRA 3BR1A 5TRDA 1YIOA 1R23A 5BPIA 5LD2C 1SVLA 2YPRA 4R1HA 1EH6A 1L3LA 3D5RC 3HUGA 4GGGA 3U1DA 3I55I 1PUFA 4M6YA 2UXNA 3HSRA 3SZGA 2BGCA 5D8LB 2CQ7A 4JOMA 3G71I 4RLFA 2WAEA 3MKLA 2GA2A 3FX3A 1JTYA 5J4VA 5FKMA 3RQ4A 1X3ZB 3QOEA 3BZCA 4B47A 1YE9A 4A3DJ 3BQZA 2KPMA 2V79A 5H6RA 1REPC 3QYBA 3CC7I 1ODDA 4LLGF 4EJWA 2IGNA 2MC4A 1P4AA 4PZJA 4HF1A 2AQEA 3MAJA 4UB6C 2BY0A 2NRAC 3SJMA 2EZHA 1JJ8C 2VL8A 2KDZA 4FTHA 3JCUC 3BG6A 3KLOA 3LA7A 5DCFA 3WODF 1ULYA 1VQ6I 1YHQI 2PMZN 3GTMJ 2MSYA 3K4NA 3PL8A 3IL2A 3F6OA 1WWXA 1JHHA 4IQJA 2KL4A 5FKOA 1UMQA 2J5PA 2BW3A 4RM2A 1IDYA 5F0FA 3VODA 4A5NA 2IJLA 1BOBA 4U0WA 3RYRA 2W00A 1IAWA 3GO5A 3ERED 4IRIA 1T56A 5J3LA 1AOYA 1IXCA 2ACJA 3I59B 1TNTA 5HVQC 3HRSA 4OIQF 2XHKA 3ZMTA 2ZO4A 3OWTA 1X1BA 5HS8A 1E3OC 3FMQA 1TWGJ 1V3FA 2L9SA 4G6QA 2FF4A 3CC4I 3TW7A 1OLTA 4XQFA 3KCCA 5DD4A 3RPUD 4ZYHA 2R7SA 1XSXA 1I6XA 1KONA 1TWFJ 3BDDA 3F6VA 2LD5A 1XC5A 2QUFA 1K78A 2EQRA 3FZVA 3KZIC 1JGGA 4QWQA 1IW7F 4ZC3A 2B7EA 1J5YA 4P96A 4ASNA 3CTAA 3CCRI 5LFAA 2IS6A 4XK4A 1LQ1A 1N77A 3K6GA 1JHFA 3H1CA 4L9VA 1WGXA 1IZ1A 1TZLA 3JR9A 5LHHA 1MMSA 2ICWG 2IVMA 2IGOA 3CCUI 4XRMA 3IRQA 4L5IA 1O7LA 4G8XA 4I76A 5BOXA 1HQCA 1MBHA 1PYVA 5E3MA 1C0WA 1ITYA 1S72I 3CP2A 3G2BA 5E18F 5CYVA 4I0BA 1DUXC 5FROA 3SHFA 1ETYA 2VT3A 3DP7A 5LGTA 2XRNA 2CUJA 3KZYA 1T8IA 4RLQA 2DJNA 2EFQA 1GV2A 1MH4A 2P81A 2QWWA 2X0LA 4B8XA 1R36A 1T39A 2F5FA 3T5XA 4WCGA 2XF5A 1VQ8I 5KK1A 1E3HA 4F91B 4N9IA 3ECOA 4DYCA 4WXHA 2BE5F 1GXPA 1T08B 2XVCA 2Y30A 1FIPA 4J01A 4HSTA 1ZHFA 2V6CA 1GVJA 4Y4RA 3UNGC 2FQ3A 1F1ZA 2QENA 1CQTA 2OUMA 1R49A 5E3LA 3E6DA 1HDDC 3CJTB 2DQLA 5F0HA 3E97A 5CVJA 1G8XA 2QYOA 2R5ZB 1HSTA 4BGDA 2IEKA 3HM5A 2M2EA 1QZEA 1OQYA 4HNVA 5EDNA 1J59A 4LG0A 2PJRB 4LMYA 4CZCA 2QM3A 3OOPA 1IRGA 3S3NA 3EYYA 3TGNA 4XLPF 3WU1B 4KITB 2FMYA 3HOUJ 4M74A 2RGVA 2WAQA 4AVPA 4XRFA 1EV7A 1LUJB 3FISA 1J9IA 3F8CA 4FISA 5TGTA 1SFXA 3LL7A 3ABKH 1HW5A 3KLNA 3ZQGA 1YX5A 3SEZA 1A36A 2LKSA 4MFDA 3S16J 1FYLA 2HU9A 1OJLA 1YG2A 2K3FA 3OYEA 3IWFA 4DGWB 2K9MA 3H0DA 2E36A 1SFKA 2CRGA 3J7YJ 5EJCA 5J47A 3IKVA 5H20A 2EIJH 2DN0A 4A0ZA 4NC6A 2HXOA 1QU3A 3GVAA 5AIPA 1QRYA 4EEFG 3G1LA 1T38A 4B1RA 1NH3A 2V6EA 1MMNA 4LIUA 4BY1J 2P0WA 3QP5A 4MIMA 4MEYF 1BIBA 4IHWA 4M3EA 2VKHA 3KP2A 3K0LA 3F3XA 5CJ9A 3Q0UA 3P9IA 3KZZA 2DA7A 3DTKA 3F22A 1JKOC 2CSOA 4F55A 3FKJA 1P4WA 2MLKA 3GFJA 4L5JA 2Y0MA 5FD5A 4ABZA 4BJ5C 1J2XA 2NNYA 4E7IA 2R7OA 3I0TA 4UUTA 2RREA 2O6GE 2L4AA 4A6DA 5D4SA 4XRSA 4I09A 4Q48A 1ZYRF 2CW0F 5LRSA 2ZMEC 3I59A 4ZTJA 1KZHA 3LNQA 1HW2A 4Y7NJ 3O2PE 2C6YA 3KP5A 2A6EF 4C3IJ 4UNOA 3ISPA 3O6BB 4YFNF 2IS4A 1R5HA 3FXKA 4EVIA 1APLC 2G9WA 1MBJA 4L9TA 2VLAA 3E3VA 3CF2A 3PQKA 4DBQA 3VEPA 1SVMA 1LE8A 1AHDP 4IZZA 1BM9A 1LDJA 2FNPA 3KP4A 3C1DA 1QVTA 4D5FA 3BG5A 4ITVA 2MD5A 4XBFA 1F36A 2L7ZA 3CESA 1YW9A 5FO5A 1ETWA 4Q47A 4CCMA 5C4XJ 1BW5A 3HOWJ 3FKIJ 1YI2I 4EV0A 2VJ4A 4BJTA 1XSDA 1MDMA 2JRTA 2B0LA 2QQBA 3D5SC 3A01B 3GFIA 1IUFA 4G7ZF 2HXIA 3AL0C 4IRGA 1XGNA 4HV6A 3OYGA 4GYGA 2IA1A 2CQKA 4HX8A 5IY5H 2HTJA 3L2UA 1FX7A 2Y69H 1GLNA 2FRHA 3OIPA 3CMYA 2W7NA 2LF8A 2ZJ2A 3J7ZI 2B9SA 2K7LA 2YU9J 1X2NA 3OL4A 2D1HA 5EEGA 2E7WA 4A69C 2VPRA 2OPTA 2L5QA 2WAQN 4RB3C 2ZSIB 1H89C 2W4SA 1RRJA 1QNTA 1D1BA 2E1NA 1WJFA 4Y13A 1TC3C 3HTSB 2M1BA 3DV8A 3GTPJ 1RR7A 2JN6A 3O3KA 2ZXWH 1O3RA 1HKSA 2W84A 5B5EC 1FZPB 1E17A 2GOMA 4YFXF 5FD6A 4J19A 4YIFA 5BQTA 1HA8A 3DFGA 2A07F 2E1OA 1IF1A 1Z0XA 2P5KA 5IYDJ 3CMEI 2GXGA 2M7BA 1XN7A 4MQ9F 1UG0A 2D1VA 2E5NA 1X1AA 4U88A 3HOSA 4PK4A 3HTUA 1N78A 4NHJA 3BCAA 4PJLA 4IHYA 1G6NA 1MBKA 3BLYA 4HBLA 2K5CA 2DT5A 3B02A 1EA3A 4E6KG 2JPCA 3HKZN 1IN5A 3ONQA 2HZDA 3AG1H 2IA2A 3CUQB 2JRMA 1ETVA 1QZYA 1Y8QB 2CS3A 4OAZA 4L9NA 4NNJA 3PUBA 1O4XA 3LQRA 1GUUA 2R7XA 5JFRA 3CO7C 2GXAA 2Q1ZB 2TDXA 3HEFA 5DCMA 1LFUP 1KU9A 2M9HA 4B4CA 5HLGA 2HOSA 2BXYA 2AQFA 1FJLA 3BG7A 1MIJA 1K79A 2P7VB 3G73A 1HW1A 5D6FA 1MSEC 3DEUA 2TCTA 1LEAA 4KA4A 1QHGA 4NDLA 1L0OC 2FOKA 3L2CA 3WTWC 3VOEA 2XROA 2EH3A 3HBLA 3COAC 1FPQA 4ENJA 2NS0A 2HQNA 5H6QA 2DMTA 3HRMA 4HEA2 4R8HA 2EWNA 1ETQA 4KIGA 3AG4H 3OIQA 3BG9A 2DA6A 1B1BA 1WKMA 3UKGA 2ZXHA 1SC7A 1WFXA 1YJWI 2W82A 1SAUA 2EFOA 1DPUA 4LB5A 2PEXA 2OV7A 5B66C 1H9GA 4QLCU 3LSIA 4IHTA 2HI3A 2KRCA 1RI7A 3VDXA 3ZQCA 2NYXA 2CGPA 4O5VA 5LHGA 1X4PA 3WTVC 2ZJQF 2RKHA 2F2EA 1XDSA 5J8CA 2VBWA 4Z2YA 3H35A 2VXZA 1K6OA 3VYUB 2R7RA 1GDTA 2H1LA 2MD0A 4MGRA 2BY3A 3PSFA 1J75A 2VN2A 2CWEA 3ZN0A 3AFHA 2XAQA 2PFBA 4L0ZB 4L5EA 2WC2A 5FJ8J 1S7OA 4RS8A 1BW6A 4RM3A 4TV7A 1D0YA 3W6KB 1VQNI 4M3FA 2JMWA 2DFEA 2I10A 2KQRA 4O3MA 3IP4B 1AU7A 3TO7A 2QZ8A 1ZRCA 1H88C 4IEJA 1V4RA 3TW6A 4XMYA 3W6VA 2BEOA 2IP2A 3HHGA 1G4DA 3QQAA 5KCMA 2O8XA 2XKOA 3RPQA 4CGZA 2Q2EB 2N8GA 2GLOA 2TRTA 3ELKA 2DA4A 4AIKA 2VC0A 4HSRA 1ENHA 3KPHA 1QZZA 4IPAA 2XSJC 4CA0A 3KYDB 3CJNA 1SD5A 4E7LA 4UUSA 1XD7A 2HGCA 2CJJA 2IPQX 2BW3B 1UB9A 4I2OA 3PFIA 3WTUC 2DODA 4CYCB 2G7UA 4A3FJ 2OF7A 4XONA 5AONA 4C9YA 5DM7F 1OYWA 2M4KA 3GZ5A 2CYYA 3CO6C 1RIOH 1WH7A 1O3TA 2M45A 1SEUA 1EF4A 2DLLA 3F8MA 4M9XA 3S3OA 2L2OA 2DDAA 3BWGA 3DU5A 1O57A 1T0FA 3CMAI 2A6HF 4JX5A 2W24A 2K02A 4I02A 2QA4I 2RQQA 4HW0A 3K1NA 4XKBA 2BHYA 2DBBA 3KP7A 4NB5A 4BS9A 1A04A 2GWRA 1VQLI 2STWA 1BJAA 1V54H 3HDDA 3ABTA 1STZA 2YUSA 3JTHA 1IXSB 4DNCA 2VKEA 2OZUA 4XKWA 5GP9A 2MG4A 1QGPA 1X19A 2JA8J 1JKQC 4C2UA 3KFWX 3TO9A 4B3AA 1FOKA 1U8RA 4HV5A 4FASD 3FHZA 1VI0A 1I6HJ 3DF8A 4HX4A 3FXLA 1FEXA 4XL9A 1ZGAA 5LHIA 3RKYA 5F1RA 1Z1DA 1UG2A 3BZ6A 2ZBKA 2DA5A 4XOPA 4BNCA 1USSA 2NAZA 5CVVA 3MQ0A 2O7OA 5HLHA 2VQLA 4PFOA 3GFLA 4XSZF 1CGPA 2EFPA 1TW2A 2XAJA 3CUQA 3BTIA 3K2AA 2CQXA 4U0VA 1JUSA 5JLXA 4G7OF 3ABUA 4EM1A 1H0MA 1HLVA 1IV6A 2L4MA 3E5XA 1JT0A 4H0EA 4I7HA 1U9OA 3QODA 3LMMA 3DBLB 3P7NA 1FY7A 4I0AA 3BPXA 4CO8A 4MTDA 3DTEA 2K9QA 4WF2A 2OU2A 1YITI 4HF0A 1IN7A 5KAFC 2BY1A 1MBFA 4IF4A 3QP6A 2R7DA 3HIFA 3R0JA 1UAAA 3DXJF 2L02A 4DZJA 5C44J 3JSPA 4LG3A 4XM3A 1TT0A 1JUPA 4B09A 5FB2A 3NQOA 2VOOA 5FFZA 3LOCA 3GW2A 2M7AA 4RGSA 4A12A 2ZSHB 3GBGA 1MSFC 4C2TA 2O3FA 4LG0B 4BXXJ 1SMTA 1LNWA 4PSWA 2HQ5A 5E20A 3S1NJ 4W1UA 2XDVA 2ADUA 1F4KA 2HYFA 3I4MJ 4RB2C 2E19A 2DMQA 5IOZA 1HSJA 2OJED 5EGOB 3DPUA 2EJRA 2EA2A 1GT0C 1BI3A 2LY9A 1WJDA 3C18A 2DPDA 1VQPI 4HQEA 2ESHA 1RC9A 4RAFA 3OMYA 2IAIA 4JBAA 4RB1A 3QPTA 4XRSG 3KIOA 3ZMDA 1ZLKA 4EM2A 2M3AA 3Q9VA 4PJNA 1UZCA 1XX5A 1Z6RA 2CQNA 3FMRA 2QBYA 3CCVI 2L7MP 3K70C 4AIJA 3H3VK 2CV2A 1DU0A 1Y56A 3QU3A 2Z3YA 1ZRFA 3WTSC 4LJZF 4JQFA 3GYHX 2KIFA 5FKNA 1W5SA 3HSEA 4PGHA 5GAHJ 2Y2ZA 1YJNI 5F27A 3I9V2 4ESJA 2MBFA 1OCOH 3TQNA 1PP8F 4AM3A 2Y0SA 1I1SA 1QPMA 2J5OA 1Z91A 2LP0A 3JAMK 2WB1A 4IOAF 3NWSA 4FE7A 5M5XJ 2AO9A 3ZGKA 2H27A 3QAHA 1MNEA 5F08A 1Y6IA 3T0YA 5ICCA 5LBQA 2XAHA 2UUZA 5H2FC 2KRFA 3PO3J 4RGRA 1XGMA 2QSHX 1YJ9I 1B6AA
chains in the Genus database with same CATH topology
1ETKA 2ECBA 4MFDA 2DA3A 1S7EA 3S16J 4C2MJ 1OJLA 2R5ZA 1W0TA 1LFBA 5IOYA 2CRGA 4A3LJ 4CYCA 4A3BJ 3Q0WA 1F43A 4M3DA 2DMPA 2DN0A 1ZR4A 4M3GA 3IV5A 2HXOA 4BKXA 2K9SA 1XG1A 3S1QJ 1QRYA 4EEFG 1RESA 2MW8A 3DCFA 3G1LA 4B1RA 3S15J 3H0GJ 4BY1J 1HOMA 4JX6A 4MIMA 3LSRA 2L7FP 1ZQ3P 1MH3A 4IHWA 4M3EA 5F0CA 5K7FA 2LFBA 2Y31A 3Q0UA 2L0KA 3M4OJ 2DA7A 4BBRJ 1HF0A 2VI6A 1DU6A 1LE8B 1JKOC 1RETA 3SFIA 1MBEA 4ABZA 1I50J 4S0HB 3ZQFA 5EG0A 4UUTA 3GTQJ 3RZDJ 2DA2A 3GTLJ 2H1KA 1JUMA 2K9NA 3BTLA 4XRSA 1Y1WJ 3LNQA 3BTJA 3BR3A 4Y7NJ 5J1UA 4D7MA 4C3IJ 1U78A 5GPCA 2D5VA 1APLC 2KT0A 2M34A 4AYBN 1MBJA 1OCPA 2DMNA 4M3BA 1LE8A 2ID6A 2JWTA 1AHDP 2XB5A 4RDUA 4BBSJ 1QVTA 3ZQHA 3BG5A 4X1EA 4D5FA 1F36A 2L7ZA 4X6AJ 1U8BA 1ETWA 3M3YJ 5C3EJ 1ZTRA 3IH4A 1PUFB 3HOWJ 5C4XJ 2NS8A 1BW5A 2CQQA 2K40A 3S17J 2FX0A 3FKIJ 2NS7A 3NARA 1IGNA 3FK6A 4RBOA 1B72B 1TWAJ 3FK7A 3A01B 1IUFA 2FD5A 3IH2A 2HXIA 1HDPA 2EZKA 3FIWA 1WPKA 2JA7J 2IBDA 3A03A 2XGDA 1IJWC 1IG7A 4DYQA 3E7LA 3HOZJ 1TWCJ 1Q1VA 3HB9A 3CMYA 1NTCA 1B8IB 2FQ4A 4XICA 1IDZA 4I6ZA 4C3JJ 1X58A 2GM4A 3JRFA 2YU9J 3WHCA 1X2NA 4A69C 3JRHA 2Y0SN 2M8GX 2VPRA 2OPTA 2WAQN 5EGOA 1H89C 3BR2A 1K61A 1TC3C 1P7IA 1D5YA 2HYJA 1B72A 3GTPJ 1RR7A 2WV1A 3A01A 3G1MA 3ZQLA 2JN6A 5K7HA 2ID3A 1WH5A 1ZKGA 1AKHB 5M5YJ 3JRCA 4J19A 4A93J 5FKKA 2LLKA 1SANA 2E1OA 3OSFA 1Z0XA 5IYDJ 5J1YA 3JRGA 1VF9A 4A3EJ 4D5CA 5FLVA 5EEAA 1H8AC 2LK2A 5EYRA 4IHYA 3S2DJ 1TWHJ 5IPAA 2L9RA 1MBKA 1BL0A 1YRNB 1HCRA 1X2MA 2CUEA 3B6AA 2M0CA 4JYKA 3HGGA 3HKZN 3LSGA 2GBYA 5BNGA 2ME0A 4A3KJ 2CUFA 4QSHA 1ETVA 2X48A 3TP3A 3JRBA 1O4XA 3RKQA 1GUUA 2COBA 1VFCA 1SFOJ 4AC0A 1W0UA 5GPAA 2G0EA 3HEFA 1LFUP 2HOSA 2M9HA 4B4CA 2R7ZJ 3S14J 3C2BA 1FJLA 3GTKJ 1OCTC 3Q0VA 1MSEC 4A3MJ 2TCTA 3PM1A 5E3NA 1FTZA 2Y9ZA 4IHVA 4NDLA 2Y9YA 2JA6J 3DEWA 5IP6A 2EH3A 3HBLA 2XPVA 2DMTA 1ETXA 3GTGJ 3BR6A 1ETQA 1OFCX 2DA1A 5F1JA 3O8HA 3BG9A 2DA6A 3HOYJ 3RZOJ 3UKGA 2XPUA 2H8RA 3BT9A 2XRLA 9ANTA 1RPWA 4QIWN 2YS9A 3GTJJ 3D1NI 4A3IJ 5C4JJ 2AHQA 1ZR2A 1WI3A 2X6OA 3CCYA 3JRDA 2O9LA 2HI3A 1JTXA 3ZQCA 3GTOJ 2LTPA 5M3MJ 3O8GA 2R5YB 2XSDC 3BQYA 4A3JJ 1NK3P 1POGA 3CQZJ 3RQIA 1GDTA 1GVDA 3HOVJ 5E3OA 4UUSB 5IYCJ 2EZIA 3I4NJ 3JRAA 1A6IA 4AUXA 3MN2A 2XB0X 1P7JA 4L5EA 1K83J 3BTCA 3NAUA 5FJ8J 4DZPA 2XPWA 1XS9A 2ELKA 1JKPC 4V2FA 2FJ1A 1NK2P 1BW6A 4IHXA 4M3FA 2JMWA 2I10A 5F04A 1AU7A 4JP0A 2NVXJ 4GFBA 1RKTA 1H88C 1G2HA 4IEJA 3BR1A 5IP9J 3TW6A 1R9TJ 5HODA 3W6VA 5J1RA 3OIOA 3QQAA 3K7AJ 5FKLA 4LOCA 2WB1N 2N8GA 3L1PA 2GLOA 2B63J 1PUFA 2TRTA 3S1MJ 3TEDA 3S1RJ 5IYBJ 1QPIA 2DA4A 5K7ZA 1QVUA 1ENHA 3LSJA 1JT6A 4C3HJ 3ZOBA 3MKLA 2XGEA 4UUSA 2HDDA 1VNDA 2CJJA 5JLWA 1JTYA 5FKMA 2LVSA 4CYCB 4A3FJ 2OF7A 1JJ6C 4A3DJ 2DMUA 3BQZA 1ZGWA 1IRZA 3OSGA 1MBGA 2E2HJ 2QF7A 5EZHA 1WH7A 1B8IA 1EF4A 3SJMA 2EZHA 1JJ8C 4FTHA 2KDZA 3OOUA 3HGYA 2R92J 4JX5A 3JREA 2PMZN 3GTMJ 4JX4A 2MSYA 3BG3A 2X9DA 4XIDA 4G12A 3HDDA 2YUSA 3B6CA 3IH3A 2VKEA 5FKOA 3LSPA 5M5WJ 1GV5A 1UMQA 5GP9A 2MG4A 5EG0B 4QTRA 1IDYA 5F0FA 2JA8J 5IP7J 1JKQC 1AKHA 2ZB9A 1IC8A 1T56A 4MLOA 5J3LA 4B3AA 5DS9A 1VI0A 4BY7J 1RKWA 2JJ7A 4A3GJ 5DTDA 1I6HJ 1E3OC 2LR8A 1TWGJ 3PO2J 1FEXA 3TW7A 1MNMC 3BR5A 1UG2A 2DA5A 4D7NA 1JKRC 2EBIA 1YRNA 3F0CA 1TWFJ 2O7OA 1A5JA 2LD5A 1XC5A 3Q3SA 3G1OA 2EQRA 3BTIA 3K2AA 1JGGA 2JK3A 2CQXA 2W48A 1JUSA 5JLXA 3SDGA 3TP0A 3BR0A 4FE4A 2NVTJ 2E2IJ 4DYRA 1HLVA 4A3CJ 4XK4A 1IV6A 2R93J 3ZQIA 4FCYA 1JT0A 1WGXA 3JR9A 4Y52J 1U9OA 4W97A 5M3FJ 1UHSA 4XRMA 2K9QA 4M6VA 2E2JJ 2RAEA 4I76A 1MBHA 5E3MA 2O8KA 2HOTA 1ITYA 1MBFA 2QCOA 4DZJA 5C44J 1JUPA 1ETYA 3LOCA 5FLMJ 1MSFC 3GBGA 4BXXJ 2DJNA 1GV2A 1MH4A 3S1NJ 2HQ5A 2P81A 2CU7A 4DW6A 4W1UA 4MO7A 3I4MJ 2E19A 1U9NA 2DMQA 5IOZA 2ECCA 5EGOB 1Z77A 1GT0C 3QPSA 2LY9A 2NVYJ 3WHBA 4DYCA 2Y30A 3VPRA 1FIPA 1I3QJ 2IAIA 2LKXA 2EZLA 4XRSG 1CQTA 5EF6A 1FIAA 2DTZA 5E3LA 2R5YA 1HDDC 2ME6A 5F0HA 1WCMJ 2R5ZB 2L7MP 4MFEA 2IEKA 3HM5A 1T33A 2M2EA 3MVPA 3JRIA 1DU0A 3H3VK 5EZGA 4HNVA 3S2HJ 3A02A 5FKNA 5EDNA 2Y2ZA 1BA5A 2HOAA 5F27A 1Y1VJ 1FTTA 3CDLA 3QPLA 2LP0A 2NVQJ 2R0QC 1ZK8A 3HOUJ 2MGQA 4FE7A 5M5XJ 2AO9A 2VUMJ 4V2GA 5F08A 3FISA 2XGCA 1ORKA 4FISA 1ETOA 2VKVA 3PO3J 1BJZA 2NOGA 2JA5J 3ZQGA 3HOXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETK A;  2ECB A;  4MFD A;  2DA3 A;  1S7E A;  3S16 J;  4C2M J;  1OJL A;  2R5Z A;  1W0T A;  1LFB A;  5IOY A;  2CRG A;  4A3L J;  4CYC A;  4A3B J;  3Q0W A;  1F43 A;  4M3D A;  2DMP A;  2DN0 A;  1ZR4 A;  4M3G A;  3IV5 A;  2HXO A;  4BKX A;  2K9S A;  1XG1 A;  3S1Q J;  1QRY A;  4EEF G;  1RES A;  2MW8 A;  3DCF A;  3G1L A;  4B1R A;  3S15 J;  3H0G J;  4BY1 J;  1HOM A;  4JX6 A;  4MIM A;  3LSR A;  2L7F P;  1ZQ3 P;  1MH3 A;  4IHW A;  4M3E A;  5F0C A;  5K7F A;  2LFB A;  2Y31 A;  3Q0U A;  2L0K A;  3M4O J;  2DA7 A;  4BBR J;  1HF0 A;  2VI6 A;  1DU6 A;  1LE8 B;  1JKO C;  1RET A;  3SFI A;  1MBE A;  4ABZ A;  1I50 J;  4S0H B;  3ZQF A;  5EG0 A;  4UUT A;  3GTQ J;  3RZD J;  2DA2 A;  3GTL J;  2H1K A;  1JUM A;  2K9N A;  3BTL A;  4XRS A;  1Y1W J;  3LNQ A;  3BTJ A;  3BR3 A;  4Y7N J;  5J1U A;  4D7M A;  4C3I J;  1U78 A;  5GPC A;  2D5V A;  1APL C;  2KT0 A;  2M34 A;  4AYB N;  1MBJ A;  1OCP A;  2DMN A;  4M3B A;  1LE8 A;  2ID6 A;  2JWT A;  1AHD P;  2XB5 A;  4RDU A;  4BBS J;  1QVT A;  3ZQH A;  3BG5 A;  4X1E A;  4D5F A;  1F36 A;  2L7Z A;  4X6A J;  1U8B A;  1ETW A;  3M3Y J;  5C3E J;  1ZTR A;  3IH4 A;  1PUF B;  3HOW J;  5C4X J;  2NS8 A;  1BW5 A;  2CQQ A;  2K40 A;  3S17 J;  2FX0 A;  3FKI J;  2NS7 A;  3NAR A;  1IGN A;  3FK6 A;  4RBO A;  1B72 B;  1TWA J;  3FK7 A;  3A01 B;  1IUF A;  2FD5 A;  3IH2 A;  2HXI A;  1HDP A;  2EZK A;  3FIW A;  1WPK A;  2JA7 J;  2IBD A;  3A03 A;  2XGD A;  1IJW C;  1IG7 A;  4DYQ A;  3E7L A;  3HOZ J;  1TWC J;  1Q1V A;  3HB9 A;  3CMY A;  1NTC A;  1B8I B;  2FQ4 A;  4XIC A;  1IDZ A;  4I6Z A;  4C3J J;  1X58 A;  2GM4 A;  3JRF A;  2YU9 J;  3WHC A;  1X2N A;  4A69 C;  3JRH A;  2Y0S N;  2M8G X;  2VPR A;  2OPT A;  2WAQ N;  5EGO A;  1H89 C;  3BR2 A;  1K61 A;  1TC3 C;  1P7I A;  1D5Y A;  2HYJ A;  1B72 A;  3GTP J;  1RR7 A;  2WV1 A;  3A01 A;  3G1M A;  3ZQL A;  2JN6 A;  5K7H A;  2ID3 A;  1WH5 A;  1ZKG A;  1AKH B;  5M5Y J;  3JRC A;  4J19 A;  4A93 J;  5FKK A;  2LLK A;  1SAN A;  2E1O A;  3OSF A;  1Z0X A;  5IYD J;  5J1Y A;  3JRG A;  1VF9 A;  4A3E J;  4D5C A;  5FLV A;  5EEA A;  1H8A C;  2LK2 A;  5EYR A;  4IHY A;  3S2D J;  1TWH J;  5IPA A;  2L9R A;  1MBK A;  1BL0 A;  1YRN B;  1HCR A;  1X2M A;  2CUE A;  3B6A A;  2M0C A;  4JYK A;  3HGG A;  3HKZ N;  3LSG A;  2GBY A;  5BNG A;  2ME0 A;  4A3K J;  2CUF A;  4QSH A;  1ETV A;  2X48 A;  3TP3 A;  3JRB A;  1O4X A;  3RKQ A;  1GUU A;  2COB A;  1VFC A;  1SFO J;  4AC0 A;  1W0U A;  5GPA A;  2G0E A;  3HEF A;  1LFU P;  2HOS A;  2M9H A;  4B4C A;  2R7Z J;  3S14 J;  3C2B A;  1FJL A;  3GTK J;  1OCT C;  3Q0V A;  1MSE C;  4A3M J;  2TCT A;  3PM1 A;  5E3N A;  1FTZ A;  2Y9Z A;  4IHV A;  4NDL A;  2Y9Y A;  2JA6 J;  3DEW A;  5IP6 A;  2EH3 A;  3HBL A;  2XPV A;  2DMT A;  1ETX A;  3GTG J;  3BR6 A;  1ETQ A;  1OFC X;  2DA1 A;  5F1J A;  3O8H A;  3BG9 A;  2DA6 A;  3HOY J;  3RZO J;  3UKG A;  2XPU A;  2H8R A;  3BT9 A;  2XRL A;  9ANT A;  1RPW A;  4QIW N;  2YS9 A;  3GTJ J;  3D1N I;  4A3I J;  5C4J J;  2AHQ A;  1ZR2 A;  1WI3 A;  2X6O A;  3CCY A;  3JRD A;  2O9L A;  2HI3 A;  1JTX A;  3ZQC A;  3GTO J;  2LTP A;  5M3M J;  3O8G A;  2R5Y B;  2XSD C;  3BQY A;  4A3J J;  1NK3 P;  1POG A;  3CQZ J;  3RQI A;  1GDT A;  1GVD A;  3HOV J;  5E3O A;  4UUS B;  5IYC J;  2EZI A;  3I4N J;  3JRA A;  1A6I A;  4AUX A;  3MN2 A;  2XB0 X;  1P7J A;  4L5E A;  1K83 J;  3BTC A;  3NAU A;  5FJ8 J;  4DZP A;  2XPW A;  1XS9 A;  2ELK A;  1JKP C;  4V2F A;  2FJ1 A;  1NK2 P;  1BW6 A;  4IHX A;  4M3F A;  2JMW A;  2I10 A;  5F04 A;  1AU7 A;  4JP0 A;  2NVX J;  4GFB A;  1RKT A;  1H88 C;  1G2H A;  4IEJ A;  3BR1 A;  5IP9 J;  3TW6 A;  1R9T J;  5HOD A;  3W6V A;  5J1R A;  3OIO A;  3QQA A;  3K7A J;  5FKL A;  4LOC A;  2WB1 N;  2N8G A;  3L1P A;  2GLO A;  2B63 J;  1PUF A;  2TRT A;  3S1M J;  3TED A;  3S1R J;  5IYB J;  1QPI A;  2DA4 A;  5K7Z A;  1QVU A;  1ENH A;  3LSJ A;  1JT6 A;  4C3H J;  3ZOB A;  3MKL A;  2XGE A;  4UUS A;  2HDD A;  1VND A;  2CJJ A;  5JLW A;  1JTY A;  5FKM A;  2LVS A;  4CYC B;  4A3F J;  2OF7 A;  1JJ6 C;  4A3D J;  2DMU A;  3BQZ A;  1ZGW A;  1IRZ A;  3OSG A;  1MBG A;  2E2H J;  2QF7 A;  5EZH A;  1WH7 A;  1B8I A;  1EF4 A;  3SJM A;  2EZH A;  1JJ8 C;  4FTH A;  2KDZ A;  3OOU A;  3HGY A;  2R92 J;  4JX5 A;  3JRE A;  2PMZ N;  3GTM J;  4JX4 A;  2MSY A;  3BG3 A;  2X9D A;  4XID A;  4G12 A;  3HDD A;  2YUS A;  3B6C A;  3IH3 A;  2VKE A;  5FKO A;  3LSP A;  5M5W J;  1GV5 A;  1UMQ A;  5GP9 A;  2MG4 A;  5EG0 B;  4QTR A;  1IDY A;  5F0F A;  2JA8 J;  5IP7 J;  1JKQ C;  1AKH A;  2ZB9 A;  1IC8 A;  1T56 A;  4MLO A;  5J3L A;  4B3A A;  5DS9 A;  1VI0 A;  4BY7 J;  1RKW A;  2JJ7 A;  4A3G J;  5DTD A;  1I6H J;  1E3O C;  2LR8 A;  1TWG J;  3PO2 J;  1FEX A;  3TW7 A;  1MNM C;  3BR5 A;  1UG2 A;  2DA5 A;  4D7N A;  1JKR C;  2EBI A;  1YRN A;  3F0C A;  1TWF J;  2O7O A;  1A5J A;  2LD5 A;  1XC5 A;  3Q3S A;  3G1O A;  2EQR A;  3BTI A;  3K2A A;  1JGG A;  2JK3 A;  2CQX A;  2W48 A;  1JUS A;  5JLX A;  3SDG A;  3TP0 A;  3BR0 A;  4FE4 A;  2NVT J;  2E2I J;  4DYR A;  1HLV A;  4A3C J;  4XK4 A;  1IV6 A;  2R93 J;  3ZQI A;  4FCY A;  1JT0 A;  1WGX A;  3JR9 A;  4Y52 J;  1U9O A;  4W97 A;  5M3F J;  1UHS A;  4XRM A;  2K9Q A;  4M6V A;  2E2J J;  2RAE A;  4I76 A;  1MBH A;  5E3M A;  2O8K A;  2HOT A;  1ITY A;  1MBF A;  2QCO A;  4DZJ A;  5C44 J;  1JUP A;  1ETY A;  3LOC A;  5FLM J;  1MSF C;  3GBG A;  4BXX J;  2DJN A;  1GV2 A;  1MH4 A;  3S1N J;  2HQ5 A;  2P81 A;  2CU7 A;  4DW6 A;  4W1U A;  4MO7 A;  3I4M J;  2E19 A;  1U9N A;  2DMQ A;  5IOZ A;  2ECC A;  5EGO B;  1Z77 A;  1GT0 C;  3QPS A;  2LY9 A;  2NVY J;  3WHB A;  4DYC A;  2Y30 A;  3VPR A;  1FIP A;  1I3Q J;  2IAI A;  2LKX A;  2EZL A;  4XRS G;  1CQT A;  5EF6 A;  1FIA A;  2DTZ A;  5E3L A;  2R5Y A;  1HDD C;  2ME6 A;  5F0H A;  1WCM J;  2R5Z B;  2L7M P;  4MFE A;  2IEK A;  3HM5 A;  1T33 A;  2M2E A;  3MVP A;  3JRI A;  1DU0 A;  3H3V K;  5EZG A;  4HNV A;  3S2H J;  3A02 A;  5FKN A;  5EDN A;  2Y2Z A;  1BA5 A;  2HOA A;  5F27 A;  1Y1V J;  1FTT A;  3CDL A;  3QPL A;  2LP0 A;  2NVQ J;  2R0Q C;  1ZK8 A;  3HOU J;  2MGQ A;  4FE7 A;  5M5X J;  2AO9 A;  2VUM J;  4V2G A;  5F08 A;  3FIS A;  2XGC A;  1ORK A;  4FIS A;  1ETO A;  2VKV A;  3PO3 J;  1BJZ A;  2NOG A;  2JA5 J;  3ZQG A;  3HOX J; 
#chains in the Genus database with same CATH topology
 4OIP F;  2ECB A;  1KGS A;  1ZG3 A;  1VQK I;  3CCJ I;  2VQH A;  3FMS A;  2Z33 A;  3IAS 2;  2LY2 A;  3K4K A;  2DQR A;  2IS2 A;  2V1D A;  2BXZ A;  3ROU A;  4EJU A;  1WJ5 A;  4GO1 A;  4B3X A;  1D1A A;  3MZ8 A;  4CYC A;  3I56 I;  4YII A;  3TDU C;  3LFU A;  1ZR4 A;  4M3G A;  3IV5 A;  1S9H A;  4BKX A;  5JR3 A;  2XAS A;  2K9S A;  2P6S A;  2VJJ A;  1ZG5 A;  3S1Q J;  2DYS H;  1W5T A;  3FXU A;  1RES A;  2MW8 A;  3K1P A;  3OR2 C;  3QU6 A;  2ZXJ A;  5IT3 A;  5BPD A;  3H0G J;  4ZYA A;  1TTY A;  4B48 A;  3OYM A;  2L9N A;  2L7F P;  1ZQ3 P;  3LQQ A;  3PNY A;  4GYI A;  3FHN A;  2Y31 A;  5K1Y A;  3FBN B;  3E6B A;  1HKT A;  2K4B A;  3V7S A;  1HF0 A;  2VI6 A;  2WTE A;  1LE8 B;  1X4O A;  3ERM A;  1PVE A;  2QLZ A;  1XDU A;  1YX3 A;  5LGN A;  3PIO F;  2F5E A;  1MBE A;  1S6L A;  1WI9 A;  5GTI C;  2BZT A;  2MFZ A;  4HAM A;  2CG4 A;  2F5V A;  1JE8 A;  3N4M A;  1I50 J;  1Z7L A;  1E0E A;  4ENM A;  4KIF A;  1B9M A;  4KMF A;  2KIQ A;  2K86 A;  1JUM A;  1KU7 A;  2HR3 A;  1MDM B;  1YO5 C;  1LKX A;  3OR1 C;  1CF7 B;  2L9V A;  4KNY A;  1GHC A;  2YR2 A;  1HC8 A;  4Q5S F;  2JQ7 A;  1XMA A;  5LGU A;  3DWL E;  3K4L A;  4KUM A;  2JWT A;  1FWZ A;  2XB5 A;  3SXY A;  4BBS J;  2Q0O A;  3HZJ A;  5B1A H;  5FGM A;  2L01 A;  4X1E A;  4UY8 I;  1K4T A;  4BJ6 C;  3CUQ C;  2EV0 A;  4X6A J;  4OOI A;  2VON A;  5CVU A;  1R6R A;  5C3E J;  1ZTR A;  3OYH A;  3IH4 A;  1UHW A;  4F92 B;  2COM A;  2NS8 A;  4UXN A;  1NG7 A;  2MH9 A;  1YTY A;  2CV1 A;  4YG2 F;  3NAR A;  2X1E A;  2DFH A;  2R3S A;  4RBO A;  2E71 A;  3FK7 A;  3CDI A;  1ON2 A;  1MMA A;  1Z6T A;  4CZZ A;  2FD5 A;  1E3P A;  2F6C A;  2JT1 A;  4XSX F;  1BR2 A;  2HS5 A;  5DUK A;  1ZH5 A;  2GOX B;  2CW8 A;  3A03 A;  1X1P A;  1U5T B;  3FDY A;  2BOL A;  3G6E I;  4DYQ A;  2WV0 A;  3E7L A;  4CHU A;  5CQE A;  4A5M A;  1OIS A;  3N05 A;  4H4K C;  3QYF A;  3HOZ J;  1TWC J;  3W2V A;  2KZG A;  3VWB A;  3VSK A;  1IDZ A;  3VYR B;  4I6Z A;  1X58 A;  3H9J A;  2VXD A;  4F3Q A;  3JRH A;  3H3Z A;  3K4M A;  4XNF A;  4O6J A;  2Y0S N;  3X2Q H;  1G3W A;  2EIM H;  2M8G X;  5FFX A;  4BU2 A;  1ZRE A;  2OA4 A;  5EGO A;  3BR2 A;  1R71 A;  1SD4 A;  3HYI A;  1P7I A;  1D5Y A;  5KAI C;  2HYJ A;  1B72 A;  2L54 A;  3G1M A;  3ZN1 A;  2Z9O A;  4ETS A;  1QO0 D;  4MHG A;  2IA0 A;  1R4M B;  2CMP A;  2LYC A;  5DCM B;  3JRC A;  3ABL H;  5FKK A;  2LLK A;  2KHM A;  3TMO A;  3OSF A;  2OQG A;  3NRV A;  2WA0 A;  4ANJ A;  4XLN F;  2P6T A;  4MQV A;  2JSC A;  2RDP A;  4HX7 A;  5EYR A;  1FSH A;  3VFZ A;  4XKC A;  1XCB A;  3E5U A;  1BL0 A;  1YRN B;  4ESB A;  4LB6 B;  3OYC A;  3REO A;  3WTZ A;  3ZPL A;  4M9S A;  2GBY A;  5BNG A;  1VZ0 A;  2ME0 A;  3C2H A;  4BXF A;  1RR8 C;  3CUO A;  4Y17 A;  4EGY A;  4HDV A;  1TL8 A;  2X48 A;  3PSI A;  3EYI A;  3RKQ A;  1Y0U A;  2F5C A;  1VFC A;  1K6Y A;  2KRH A;  3OYI A;  5GPA A;  2HPM A;  1BOA A;  2R7Z J;  4Z6Y A;  1F9N A;  1OCT C;  3Q0V A;  3CJQ B;  1BI2 A;  3MEX A;  5J40 A;  3PM1 A;  3SZT A;  2Y9Z A;  3D5L A;  4IHV A;  2GIZ A;  4ESF A;  3SQN A;  2BBY A;  4M73 A;  3DEW A;  1JXS A;  3LSM A;  1FBQ A;  5IP6 A;  4PCQ A;  3RKX A;  2LOO A;  3K4J A;  1ZAR A;  1MJ9 A;  4E7J A;  5FRM A;  3CCE I;  3U21 A;  4ZZL A;  4WK8 F;  3GTG J;  3ZP5 A;  3WTX C;  1OFC X;  4KIS A;  3M07 A;  2F4M B;  3TDZ C;  3ESW B;  1D0Z A;  3HOY J;  5HS7 A;  1A35 A;  3ABM H;  2XPU A;  3K10 A;  5E1Z B;  3WG7 H;  4XLC A;  3BT9 A;  1HXD A;  2VJI A;  2H8R A;  4QIW N;  2H94 A;  2JUG A;  3PUF A;  4A3I J;  5C4J J;  2ZJP F;  1TP4 A;  2AHQ A;  2NOJ B;  2X6O A;  3CCY A;  3GXO A;  2EV5 A;  5HDK A;  4NQW B;  3ML6 A;  1LEB A;  3JSO A;  4BUP A;  5IT9 Z;  1DDN A;  1FYK A;  2F48 A;  2LTP A;  3KYC B;  1DGR M;  5D5U B;  2R5Y B;  2V9V A;  3BQY A;  2CFX A;  1NK3 P;  3AG3 H;  4OIN F;  5LEJ A;  3S8P A;  1GVD A;  1ON1 A;  4G9Y A;  2EV6 A;  4UUS B;  2HDW A;  5L3G A;  1CF7 A;  1G3T A;  5BS6 A;  2EZI A;  3I4N J;  2LY1 A;  1A6I A;  4AUX A;  3JRA A;  3MN2 A;  1OYI A;  3GME A;  2VOD A;  4DZP A;  5ICE A;  2ZNZ A;  4ZJZ A;  2A5Y B;  2FEZ A;  2FJ1 A;  1NK2 P;  4IHX A;  3E6M A;  2VOP A;  5HDN A;  3GFM A;  2OZ6 A;  2XF6 A;  3RDI A;  3WU2 C;  1S29 A;  1SD6 A;  4JP0 A;  4GFB A;  1Z21 A;  1R1V A;  5F64 A;  5A2Q Z;  1PP7 U;  2ZC2 A;  1WZ2 A;  2V7F A;  1DP7 P;  5HOD A;  2IS1 A;  3OIO A;  1MZB A;  3K7A J;  2Y48 A;  4XOR A;  4HA8 A;  4U7B A;  1FT9 A;  1O7F A;  2FML A;  2M5W A;  3M8J A;  3PNT A;  3L1P A;  3S1M J;  3TED A;  2JUC A;  5IYB J;  3S1R J;  1QPI A;  2XIG A;  1VQ5 I;  1RZ4 A;  3CC2 I;  3NEU A;  3LSJ A;  4XLA A;  4C3H J;  2JTV A;  2HDD A;  1VND A;  5JLW A;  1S8N A;  3HHH A;  3EPZ A;  1VQO I;  1LDD A;  1JJ6 C;  4BAC A;  1FOX A;  5FLX Z;  2DMU A;  3CP8 A;  2VJ5 A;  1U5T A;  3KP3 A;  1IRZ A;  1W7P A;  1R00 A;  2YX7 A;  3OSG A;  1LB2 A;  2LRE A;  2E2H J;  1XB4 A;  2FNA A;  2XUB A;  5EZH A;  3EQL F;  4XLE A;  5E8G A;  2QKL B;  3MD2 A;  3R0A A;  4HOB A;  2O0Y A;  1YFH A;  2CUZ A;  1YQA A;  3EUH A;  3W3C A;  1XTA A;  3HGY A;  2DFI A;  3ASO H;  4ON0 A;  4OIO F;  4BQN A;  4P9U A;  4B43 A;  2DO7 A;  3JRE A;  4OMY A;  1MGT A;  4JX4 A;  2HDC A;  4XID A;  1R5I D;  1EKE A;  1IV8 A;  3ULQ B;  3OS2 A;  3KEO A;  1VQ9 I;  2UWM A;  1IN4 A;  3B6C A;  4I98 B;  4KDP A;  2JVH A;  3IH3 A;  2K3P A;  3LSP A;  1BBY A;  1XSV A;  3L9F A;  1F5T A;  5DEQ A;  1DGW Y;  2KLO A;  2ZFW A;  1I5Z A;  2ZB9 A;  1MJB A;  2HKO A;  5FRN A;  3FXQ A;  4MLO A;  4FHT A;  1FMV A;  1PJR A;  4BY7 J;  2KKO A;  1RKW A;  2JJ7 A;  2JVG A;  3HC7 A;  2O5R A;  3F8B A;  1FYM A;  2ELH A;  4OAY A;  2LR8 A;  1WJE A;  3GWZ A;  3M8E A;  1MNM C;  2EB7 A;  2K27 A;  4BAY A;  3BR5 A;  3P9K A;  2E35 A;  2HPI A;  3MKZ A;  2EBI A;  1JKR C;  3F0C A;  3WGG A;  1YRN A;  3J7A Y;  5L3D A;  3U1K A;  4D1Q A;  4P55 A;  4DJA A;  1Z3X A;  1R1T A;  2W48 A;  5D6E A;  3SDG A;  2WY7 Q;  2CH0 A;  3C7J A;  4FE4 A;  4KT6 A;  4NC8 A;  1YLF A;  2V1X A;  4A3C J;  2X6W A;  4FCY A;  4YFK F;  4AID A;  2KFD A;  3K1M A;  1G59 A;  2M30 A;  3ZR8 X;  1W1W E;  5DDG A;  3R4K A;  2K9L A;  5E1X A;  3L2R A;  2O8K A;  1R5G A;  1G3Y A;  1BI1 A;  1MKM A;  1S7A A;  4AWX B;  3HL2 A;  3BCB A;  2QCO A;  2QBY B;  2NNN A;  3VSL A;  3N97 A;  5TJJ A;  2OTJ I;  2QQA A;  3F8N A;  2VQC A;  1XCV A;  2RN7 A;  4PJJ A;  2O03 A;  3ZCO A;  1MMD A;  4XKV A;  3OYK A;  1TBX A;  4IL6 C;  2R7V A;  3RCO A;  2FBI A;  3V7C A;  3R60 A;  2K85 A;  1U9N A;  1O3S A;  1AA7 A;  1I39 A;  2ECC A;  3HPG A;  4PJ0 C;  2W25 A;  1Z77 A;  4BDZ A;  3QPS A;  4II2 A;  4PDK A;  2WY8 Q;  2FSW A;  3E0J B;  4GDF A;  5E1W A;  1RUO A;  1I3Q J;  3K2Z A;  4NQW A;  1OR7 A;  2EZL A;  1FIA A;  2L7K A;  4RMN A;  2R5Y A;  2VPL A;  1MND A;  2ME6 A;  4BQQ A;  4N4N B;  1WCM J;  4U87 A;  1IO2 A;  1B59 A;  3AAF A;  4MFE A;  1T33 A;  2F4O B;  1D5V A;  2YSR A;  1EH7 A;  4MEX F;  5K5R A;  3A02 A;  3LAP A;  1ZN2 A;  3QPH A;  4K2E A;  1YOV B;  2RC4 A;  1IRF A;  5DYM A;  2HOA A;  1LVK A;  3A0H C;  1LVA A;  2UXX A;  1FOY A;  3NWT A;  3DKX A;  1Y1V J;  1Z67 A;  3FXM A;  1FTT A;  3CDL A;  1D3Y A;  3QPL A;  2HVS A;  2NVQ J;  5JVG F;  3DBR B;  1ZK8 A;  3W2A A;  2MGQ A;  1KQ8 A;  3QOP A;  3DLL F;  1Z9C A;  2BY2 A;  2VUM J;  2EK5 A;  2XAF A;  3C3W A;  1D8J A;  1ORK A;  2RV8 A;  2EA4 A;  3T1B A;  2EIN H;  4WXD A;  1QQI A;  2AXT C;  2MAB A;  4EJO A;  2NOG A;  3KEY A;  4IKF A;  3HOX J;  2Z2S B;  3OS0 A;  1S7E A;  4BYY A;  3K4B A;  2GIV A;  4C2M J;  1X3W B;  2EFN A;  3F23 A;  1W0T A;  2FBK A;  5D8K B;  2KDO A;  1T98 A;  3SZP A;  2UV1 A;  3CF5 F;  1F43 A;  2DMP A;  3WGH A;  4BHC A;  2KIU A;  3DQV C;  1U5T C;  2O61 A;  3H5R A;  1I3A A;  1XG1 A;  3HSF A;  4QPQ A;  2Y75 A;  4HRI A;  3OL3 A;  3CCS I;  2RNJ A;  3GLX A;  2IGM A;  2Z16 A;  4AVZ A;  1HOM A;  2XV4 S;  3FBI B;  4JX6 A;  2STT A;  1UHM A;  1MH3 A;  1X1C A;  2QQ9 A;  1K7A A;  5F0C A;  4MNU A;  3TBI A;  4CCJ A;  2LFB A;  2VT2 A;  2H09 A;  4A2U A;  2VBY A;  2L0K A;  3VB2 A;  3M4O J;  4BBR J;  4EM0 B;  3HG9 A;  1D1C A;  5ICG A;  5CVR A;  3SFI A;  3HXL A;  4EJV A;  4Y3O A;  1I1G A;  4FT8 A;  4PFP A;  2E34 A;  2DTR A;  2LH9 A;  2DW4 A;  3K70 D;  4S0H B;  4I99 C;  3ZQF A;  3PJR A;  3RZD J;  4S05 A;  2E1M B;  3GTL J;  2H1K A;  3GZN B;  1LJ9 A;  2DFF A;  4LGW A;  3BTL A;  1KYZ A;  2VE8 A;  3BTJ A;  4RGU A;  4F93 B;  2R7Q A;  1IRX A;  3BR3 A;  3J81 K;  2KIM A;  4OWR B;  3OYF A;  4F7Z A;  1WQ2 A;  1U78 A;  2GZW A;  3FXO A;  3WGI A;  5DV5 A;  2X4H A;  2D5V A;  2KT0 A;  4PJM A;  1ACI A;  4OMZ A;  1OCP A;  4M3B A;  2XAG A;  3V4G A;  1FP1 D;  3ZQH A;  1LFP A;  3H36 A;  3ZRG A;  2AS5 F;  2H8W A;  3RPU A;  5KHD A;  2HYG D;  2QQ8 A;  3GF2 A;  2FE3 A;  4YRV A;  2E5Z A;  1U2W A;  3PQJ A;  3Q9S A;  3S17 J;  1KA8 A;  2X6Y A;  2NS7 A;  1IGN A;  3FK6 A;  1B72 B;  1TWA J;  4HG2 A;  5JHF A;  4FQG A;  1FSE A;  5EEH A;  1BI0 A;  4LIT A;  4HYE A;  3IH2 A;  2JSP A;  4UV8 A;  4M72 A;  3FIW A;  1HDP A;  5HOO A;  1WPK A;  5CKT A;  2JA7 J;  4PUS A;  1AWC A;  1IN8 A;  2VBX A;  2XGD A;  5LEK A;  3S3M A;  4ZYE A;  2IGK A;  3L7W A;  5L3F A;  3OYA A;  2PQ8 A;  1N25 A;  2LSO A;  3ECH A;  2R7U A;  2OAZ A;  4CCK A;  2DDB A;  1FP2 A;  4LIV A;  4HPQ A;  5K5Q A;  1B8I B;  1W4M A;  2FQ4 A;  2A61 A;  5K5O A;  4XIC A;  1RNL A;  3L00 A;  5D4R A;  1B9N A;  3WHC A;  5E8I A;  1FOW A;  1S5L C;  2R7T A;  3F72 A;  1DPR A;  4E4H A;  3S93 A;  2K4J A;  4Y33 A;  3W2W A;  2PX9 A;  1TQM A;  2A6T A;  2VQG A;  3CD6 I;  1OR7 C;  3V8K A;  3LSK A;  2WV1 A;  4M6X A;  3ZQL A;  1FLI A;  2P5V A;  3J80 K;  2XF7 A;  4OIR F;  1ZKG A;  2EFW A;  1BC8 C;  5CVI A;  1AKH B;  1MD0 A;  5D5V B;  2LG4 A;  1I27 A;  2KJB A;  4ZYD A;  4M9Z A;  1SAN A;  2E60 A;  2VC1 A;  5ILV A;  4B44 A;  1S3J A;  5CPR B;  5TIS C;  4E70 A;  4DOZ A;  1V5E A;  1D0X A;  3JRG A;  3IHU A;  4D5C A;  4A3E J;  2VE9 A;  1H8A C;  5FLV A;  5DUI A;  1ERD A;  2PBI A;  2WBM A;  2LK2 A;  3EUA A;  2P5L C;  1Q1H A;  1UST A;  2WWY A;  3VYT B;  1TWH J;  4UHT A;  3OYB A;  4RB0 A;  1X2M A;  3SDB A;  1HCR A;  2X51 A;  4JYK A;  3UR3 C;  4C30 A;  3HGG A;  4EJT A;  1IUY A;  1H9T A;  4IRH A;  2DXI A;  4UVA A;  1VQ7 I;  2QSG X;  4KIC A;  4G6D A;  3TP3 A;  4D0P A;  3JRB A;  1KU3 A;  3KE2 A;  1T0F C;  3H5A A;  2COB A;  4IJA A;  3KX2 A;  1SFO J;  4AC0 A;  1WJA A;  3V7R A;  1W0U A;  2DOA A;  4CDG A;  2VBZ A;  2RQP A;  1WJC A;  3S14 J;  3C2B A;  2W57 A;  2ZME A;  3M1C A;  3IC7 A;  5F6F A;  2YX4 A;  4A3M J;  4LK0 F;  2JPB A;  4IXA A;  3Q5F A;  3H9G A;  3FXR A;  2HQR A;  3J7A O;  1UJ8 A;  3LA2 A;  3MWM A;  3V42 A;  2MLG A;  4KMU X;  1ETX A;  3BR6 A;  2DA1 A;  1ONV A;  3O8H A;  2LDU A;  3CZ6 A;  5HNH A;  1LPQ A;  3RZO J;  2LBF A;  1FMW A;  4BL0 B;  3P9C A;  3A4C A;  1U3E M;  2XRL A;  9ANT A;  1RPW A;  2YS9 A;  2A3S A;  1MJA A;  2BVL A;  1BC7 C;  2VKD A;  1WRJ A;  1GXQ A;  1A31 A;  1JTX A;  2LRD A;  3CMM A;  3FM5 A;  4PGG A;  4UB8 C;  4WXC A;  3GTO J;  4CIC A;  5M3M J;  1Y0N A;  3ZMS A;  1ZEL A;  3H9Q A;  3I54 A;  1PDN C;  2ISZ A;  6PAX A;  3TL4 X;  4E7S A;  1POG A;  3CQZ J;  2GQQ A;  1WJB A;  2QSF X;  5D5W B;  2GXB A;  4BE2 A;  4N9H A;  2HWV A;  3F8F A;  5E3O A;  4BEH A;  1R1U A;  2F5D A;  5IYC J;  2HFH A;  4XOT A;  4XR6 A;  4YEJ A;  2XB0 X;  3FF5 A;  3KYL A;  2ISY A;  1P7J A;  1P6R A;  1K83 J;  4YEL A;  3CDH A;  3NAU A;  4A0Y A;  1IXR C;  2XPW A;  1W7P B;  3GX4 X;  2ETH A;  2W1O A;  2OTL I;  2CO5 A;  1TLH B;  2RNG A;  4XN0 A;  2BV6 A;  2DI3 A;  5IP9 J;  1R9T J;  2QGU A;  3E5Q A;  1DQU A;  3I3L A;  5J1R A;  1R4N B;  2PJP A;  4HF2 A;  5FKL A;  5LLQ A;  5ILU A;  2BHZ A;  4LOC A;  5ICF A;  2WB1 N;  2B63 J;  5DD8 A;  3SYT A;  4AIH A;  2DPU A;  5K7Z A;  1QVU A;  2DK8 A;  5E17 F;  1JT6 A;  3M8F A;  3ZOB A;  2EPF A;  2HEO A;  2FA5 A;  2XGE A;  2V9K A;  4LD5 A;  3K69 A;  2LVS A;  1P2F A;  3LAJ A;  3OYL A;  1ZGW A;  3S32 A;  2DT6 A;  3WG9 A;  5KVR A;  3KEQ A;  1MBG A;  5GAD J;  5HLI A;  2JA2 A;  2QF7 A;  2Z99 A;  3OYD A;  3RIR A;  2QKM B;  3QWL A;  3H92 A;  3S2W A;  1ZLJ A;  1B8I A;  4LLN A;  2ZJR F;  3ZMZ A;  4DBR A;  3PNV A;  1U0J A;  3DBH B;  3OOU A;  2DCE A;  2R92 J;  4L18 B;  4P5O A;  4UVB A;  3IAM 2;  1TW3 A;  2IW5 A;  2V26 A;  1Y8R B;  4WWC A;  2DJI A;  3BG3 A;  5J8F A;  2X9D A;  2V1N A;  4NC7 A;  1YS6 A;  4G12 A;  4RAY A;  4IOC F;  2VAS A;  1QBJ A;  5M5W J;  1GV5 A;  3RJP A;  5EG0 B;  4QTR A;  3DLA A;  5IP7 J;  3R61 A;  1AKH A;  1VQM I;  3DPL C;  1OCR H;  1YYV A;  2ZKZ A;  3E6C C;  2OCC H;  2P7C B;  1IC8 A;  1J09 A;  4GCV A;  3AKZ A;  5DS9 A;  1A6Q A;  1DP3 A;  3HRU A;  3BOQ A;  1TNS A;  3I4P A;  2OQR A;  4A3G J;  1X1D A;  5DTD A;  2VIX A;  3ZQ7 A;  3PO2 J;  3HKZ A;  4XLH A;  4KN7 X;  1WSU A;  1G3S A;  2IRF G;  3MFK A;  4RAG A;  4D7N A;  4E7Z A;  2EIK H;  1B4A A;  3GCM A;  4V19 K;  2OCE A;  2R7W A;  1XPX A;  1A5J A;  2PMH A;  5L3E A;  4ZH4 F;  2KMU A;  3H3U A;  1T95 A;  3G1O A;  3Q3S A;  4N4O B;  1OMI A;  2JK3 A;  1TQP A;  2KJC A;  4X0G A;  3DKY A;  3TP0 A;  3BR0 A;  4Q4Z F;  2NVT J;  2ZNY A;  3F9K A;  2E2I J;  4DYR A;  3GLL A;  1WVR A;  2E1C A;  2R93 J;  3ZQI A;  4LK1 F;  2OBP A;  1UEL B;  4Y52 J;  2HVR A;  4W97 A;  5M3F J;  5J4Y A;  1UHS A;  1Y39 A;  3CCQ I;  3BPV A;  4M6V A;  2MC3 A;  2RAE A;  1ZRD A;  2E2J J;  1P92 A;  4BDY A;  3IKT A;  3ZXS A;  2HOT A;  4D9J A;  1XGS A;  4EAT A;  1QHH D;  2D2W A;  1SVO A;  2F4I A;  2I5U A;  4HLX A;  2HQA A;  3RYP A;  2X6X A;  4AYB A;  4ZTF A;  5FLM J;  2DAO A;  2ZCW A;  4DW6 A;  1BR4 A;  2CU7 A;  3V8J A;  4L0Y B;  4MO7 A;  4CYD A;  4E7H A;  1R58 A;  1OKR A;  1ZAO A;  4CSW A;  2Z1D A;  4BXU A;  4CXF A;  2DK5 A;  2NVY J;  3WHB A;  4MTE A;  3OS1 A;  4ENN A;  1Z05 A;  2R4G A;  3AG2 H;  3VPR A;  5JHU A;  4BE0 A;  1JGS A;  2LKX A;  4EQQ A;  4CH7 A;  4HQM A;  2XAU A;  4XN3 A;  3I64 A;  1R7J A;  4OU0 A;  5E79 C;  3L09 A;  4BQO A;  5EF6 A;  2DOF A;  1HKQ A;  2DTZ A;  3BJ6 A;  1YIJ I;  4U7D A;  4EGZ A;  2E1M C;  3QRF F;  1ZGJ A;  4N0B A;  3ZQQ A;  3LSH A;  4KT5 C;  4P9F A;  4QPO A;  3H5N A;  2LNB A;  3MVP A;  4II3 A;  3JRI A;  5EZG A;  3S2H J;  3EET A;  1VTN C;  2W85 A;  2LMD A;  4WX9 A;  4AU7 A;  2CFO A;  4FET A;  1BA5 A;  2ELJ A;  5L3B A;  5KNL A;  4DIQ A;  4KYW A;  3G3Z A;  3PIP F;  2I8D A;  2R0Q C;  1M1E B;  2DOE A;  3CLQ A;  4V2G A;  2XGC A;  4LFU A;  4I01 A;  3WU0 A;  1ETO A;  2VKV A;  1OYY A;  1D8K A;  3RI4 A;  1BJZ A;  1MW7 A;  2JA5 J;  2PI0 A;  2QVO A;  4E7K A;  1ETK A;  2DA3 A;  1P4X A;  2PG4 A;  5CLS A;  2R5Z A;  1V55 H;  2LF7 A;  3DPT A;  1KU2 A;  3R6S A;  4F52 A;  1LFB A;  1KQ0 A;  2GAU A;  5IOY A;  4A3L J;  4A3B J;  2HNH A;  3LWF A;  3Q0W A;  4M3D A;  3K4C A;  2PJR A;  1TT5 B;  1J7K A;  4BHP A;  4KN4 X;  4A6E A;  3DCF A;  3G4S I;  2V9P A;  3HPH A;  3MMY B;  2HZT A;  5B1B H;  3S15 J;  3M1E A;  3WTY C;  2ZFU A;  1ZG1 A;  1W36 D;  3LSR A;  1J0R A;  4UUV A;  2KP6 A;  3BJO A;  1FBS A;  5K7F A;  4NUB A;  1JI8 A;  2FXA A;  4RGX A;  1DU6 A;  3LA3 A;  1RET A;  2VB6 A;  1QA6 A;  1YW8 A;  5HNF A;  4BHB A;  2CV0 A;  2XGX A;  1BR1 A;  1PUE E;  1SMY F;  2PLY A;  5EG0 A;  3GTQ J;  1IN6 A;  4G94 A;  4YIR X;  1X3U A;  2P4W A;  2DA2 A;  2UZK A;  3MZH A;  1V5G A;  3TOB A;  2K9N A;  1Y1W J;  4ZDO A;  1T2K A;  3T8T A;  2MA3 A;  1HBX G;  2PMU A;  5IT9 K;  1KQ9 A;  1U6G A;  5J1U A;  1UCR A;  4D7M A;  5ED4 A;  5GPC A;  4ENK A;  2M34 A;  4AYB N;  5DM6 F;  2DMN A;  4J00 A;  4KFC A;  1E2X A;  1YW7 A;  3A0B C;  2ID6 A;  3BZK A;  4RDU A;  1VQ4 I;  3D0S A;  1NHA A;  5JVT A;  2HKX A;  5GTH C;  1OCC H;  3BJA A;  4EMS A;  2NVU B;  1RUN A;  3J81 Z;  3F21 A;  1OCZ H;  1OPC A;  5ERI A;  2V1U A;  2XKP A;  1U8B A;  3BP8 A;  3I53 A;  3M3Y J;  3HUG B;  1P9Q C;  1PUF B;  2HOE A;  2BVM A;  2FU4 A;  2CQQ A;  3SFZ A;  1W36 C;  2K40 A;  2FX0 A;  1EH8 A;  2WAF A;  3FM3 A;  1KYW A;  5A2Q K;  4GRI A;  5GAG J;  1FC3 A;  3IWZ A;  1SFU A;  1W7P D;  4DQ2 A;  5L3C A;  2FOW A;  2EZK A;  3EDP A;  2GA1 A;  4UVC A;  4ZYG A;  2IBD A;  3K9T A;  1IJW C;  4PSX A;  1SD7 A;  1IG7 A;  2LC2 A;  1WHU A;  2M87 A;  3GUD A;  3OYN A;  3E1S A;  1TQI A;  3HJE A;  3MKW B;  3U9G A;  2M8E A;  4FX4 A;  4BE1 A;  3CCL I;  4G7H F;  1EJ9 A;  1K4S A;  3DEE A;  2XC7 A;  3U2R A;  1V5F A;  1Q1V A;  3HB9 A;  1NTC A;  1R22 A;  5D5X B;  4C3J J;  5J6X A;  2GM4 A;  4KJZ A;  4P1W A;  3JRF A;  1W5C C;  3ASN H;  5HDG A;  5FLX K;  3B73 A;  3SEQ A;  1FNN A;  4HNU A;  1XMX A;  2WAD A;  2V4J C;  4RAZ A;  5HLT A;  4IX7 A;  4FX0 A;  1LDK B;  2KIS A;  2AXL A;  3BRO A;  5BMZ A;  2HVQ A;  1K61 A;  3LFK A;  1FBU A;  2R7F A;  2DU9 A;  3BY6 A;  3RSN A;  3A01 A;  3DTI A;  3L2Q A;  2KZV A;  3WE3 A;  5K7H A;  2ID3 A;  1WH5 A;  3HOT A;  2G7H A;  3CLO A;  5M5Y J;  1BIA A;  4U0Y A;  2H6B A;  2LKP A;  4A93 J;  4KIB A;  5HS9 A;  3FWE A;  2ZME B;  3MCZ A;  3GZ6 A;  3JAM Z;  3P5J A;  3CJR B;  3TKY A;  5J1Y A;  2MYS A;  3ZMV A;  1VF9 A;  2X85 A;  4UV9 A;  5EEA A;  3QYE A;  3OV8 A;  4M71 A;  4BH9 A;  4IO9 F;  3J80 Z;  2Q2E A;  1UFM A;  3S2D J;  4ZZD A;  2YU3 A;  4HNT A;  5IPA A;  2L9R A;  3JTG A;  2OD5 A;  2M4G A;  2CUE A;  3B6A A;  1XGO A;  2M0C A;  2CW7 A;  3LSG A;  3I71 A;  2PMZ A;  3JW4 A;  4A3K J;  3RTR A;  1K78 B;  2CUF A;  4QSH A;  3EUH C;  3WTT C;  3CCM I;  2ESN A;  2IXS A;  4RA2 A;  3PFY A;  3RKW A;  2LBF B;  3IRR A;  2A05 A;  5CQG A;  2FUG 2;  2FBH A;  1MMG A;  2RVC A;  3VYS B;  2OC6 A;  1N75 A;  3KP6 A;  2IT0 A;  2EIL H;  4XLF A;  1BN5 A;  2G0E A;  3BC8 A;  2Q8K A;  2E7X A;  3GTK J;  3TO6 A;  1O3Q A;  2JZY A;  3TOA A;  4NBQ A;  4CUG A;  3AL0 B;  4GXO A;  5E3N A;  3C2G A;  1FTZ A;  4LLL A;  1Z3Y A;  3MZY A;  4G6T B;  4R79 A;  2Y9Y A;  3WE2 A;  4HDU A;  2X1C A;  2JA6 J;  1NG6 A;  1YS7 A;  3HRT A;  4S04 A;  3V8L A;  4BEH B;  5JI6 A;  3OY9 A;  3GEZ A;  2DYR H;  2XPV A;  3W6J B;  3I58 A;  4AD9 A;  1SAX A;  5AIQ A;  2NXN B;  5F1J A;  2H6C A;  4JK1 X;  2X1D A;  4IHS A;  4IVN A;  3IUO A;  2Z5U A;  1SFE A;  2BYV E;  4ZDL A;  3DU6 A;  3D1N I;  3GTJ J;  3DKW A;  2PN6 A;  4A0X A;  3KET A;  5ILS A;  2D45 A;  1ZR2 A;  1WI3 A;  3JRD A;  3FXJ A;  2DT7 B;  2O9L A;  3A1Y A;  1Z7U A;  4ZDP A;  4HZF A;  3A2K A;  2A68 F;  2P8T A;  3O8G A;  3MKY B;  3M9A A;  2XSD C;  5B3S H;  3I5U A;  4A3J J;  3RQI A;  4CCL A;  3HOV J;  2A5W A;  4Y15 A;  3ZMU A;  5GAE J;  3L2W A;  2M0M A;  4IQ4 A;  1XMK A;  3T8R A;  2QEX I;  4L9J A;  4HLY A;  4CCN A;  2L3D A;  3BTC A;  3LST A;  1XS9 A;  4BQA A;  4CCO A;  2ELK A;  1JKP C;  2A69 F;  3EUK L;  4V2F A;  2ZXI A;  1T6S A;  3L2V A;  3M7G A;  2MH2 A;  5F04 A;  2NVX J;  2HTS A;  1RKT A;  1G2H A;  3OYJ A;  5LRR A;  3BR1 A;  5TRD A;  1YIO A;  1R23 A;  5BPI A;  5LD2 C;  1SVL A;  2YPR A;  4R1H A;  1EH6 A;  1L3L A;  3D5R C;  3HUG A;  4GGG A;  3U1D A;  3I55 I;  1PUF A;  4M6Y A;  2UXN A;  3HSR A;  3SZG A;  2BGC A;  5D8L B;  2CQ7 A;  4JOM A;  3G71 I;  4RLF A;  2WAE A;  3MKL A;  2GA2 A;  3FX3 A;  1JTY A;  5J4V A;  5FKM A;  3RQ4 A;  1X3Z B;  3QOE A;  3BZC A;  4B47 A;  1YE9 A;  4A3D J;  3BQZ A;  2KPM A;  2V79 A;  5H6R A;  1REP C;  3QYB A;  3CC7 I;  1ODD A;  4LLG F;  4EJW A;  2IGN A;  2MC4 A;  1P4A A;  4PZJ A;  4HF1 A;  2AQE A;  3MAJ A;  4UB6 C;  2BY0 A;  2NRA C;  3SJM A;  2EZH A;  1JJ8 C;  2VL8 A;  2KDZ A;  4FTH A;  3JCU C;  3BG6 A;  3KLO A;  3LA7 A;  5DCF A;  3WOD F;  1ULY A;  1VQ6 I;  1YHQ I;  2PMZ N;  3GTM J;  2MSY A;  3K4N A;  3PL8 A;  3IL2 A;  3F6O A;  1WWX A;  1JHH A;  4IQJ A;  2KL4 A;  5FKO A;  1UMQ A;  2J5P A;  2BW3 A;  4RM2 A;  1IDY A;  5F0F A;  3VOD A;  4A5N A;  2IJL A;  1BOB A;  4U0W A;  3RYR A;  2W00 A;  1IAW A;  3GO5 A;  3ERE D;  4IRI A;  1T56 A;  5J3L A;  1AOY A;  1IXC A;  2ACJ A;  3I59 B;  1TNT A;  5HVQ C;  3HRS A;  4OIQ F;  2XHK A;  3ZMT A;  2ZO4 A;  3OWT A;  1X1B A;  5HS8 A;  1E3O C;  3FMQ A;  1TWG J;  1V3F A;  2L9S A;  4G6Q A;  2FF4 A;  3CC4 I;  3TW7 A;  1OLT A;  4XQF A;  3KCC A;  5DD4 A;  3RPU D;  4ZYH A;  2R7S A;  1XSX A;  1I6X A;  1KON A;  1TWF J;  3BDD A;  3F6V A;  2LD5 A;  1XC5 A;  2QUF A;  1K78 A;  2EQR A;  3FZV A;  3KZI C;  1JGG A;  4QWQ A;  1IW7 F;  4ZC3 A;  2B7E A;  1J5Y A;  4P96 A;  4ASN A;  3CTA A;  3CCR I;  5LFA A;  2IS6 A;  4XK4 A;  1LQ1 A;  1N77 A;  3K6G A;  1JHF A;  3H1C A;  4L9V A;  1WGX A;  1IZ1 A;  1TZL A;  3JR9 A;  5LHH A;  1MMS A;  2ICW G;  2IVM A;  2IGO A;  3CCU I;  4XRM A;  3IRQ A;  4L5I A;  1O7L A;  4G8X A;  4I76 A;  5BOX A;  1HQC A;  1MBH A;  1PYV A;  5E3M A;  1C0W A;  1ITY A;  1S72 I;  3CP2 A;  3G2B A;  5E18 F;  5CYV A;  4I0B A;  1DUX C;  5FRO A;  3SHF A;  1ETY A;  2VT3 A;  3DP7 A;  5LGT A;  2XRN A;  2CUJ A;  3KZY A;  1T8I A;  4RLQ A;  2DJN A;  2EFQ A;  1GV2 A;  1MH4 A;  2P81 A;  2QWW A;  2X0L A;  4B8X A;  1R36 A;  1T39 A;  2F5F A;  3T5X A;  4WCG A;  2XF5 A;  1VQ8 I;  5KK1 A;  1E3H A;  4F91 B;  4N9I A;  3ECO A;  4DYC A;  4WXH A;  2BE5 F;  1GXP A;  1T08 B;  2XVC A;  2Y30 A;  1FIP A;  4J01 A;  4HST A;  1ZHF A;  2V6C A;  1GVJ A;  4Y4R A;  3UNG C;  2FQ3 A;  1F1Z A;  2QEN A;  1CQT A;  2OUM A;  1R49 A;  5E3L A;  3E6D A;  1HDD C;  3CJT B;  2DQL A;  5F0H A;  3E97 A;  5CVJ A;  1G8X A;  2QYO A;  2R5Z B;  1HST A;  4BGD A;  2IEK A;  3HM5 A;  2M2E A;  1QZE A;  1OQY A;  4HNV A;  5EDN A;  1J59 A;  4LG0 A;  2PJR B;  4LMY A;  4CZC A;  2QM3 A;  3OOP A;  1IRG A;  3S3N A;  3EYY A;  3TGN A;  4XLP F;  3WU1 B;  4KIT B;  2FMY A;  3HOU J;  4M74 A;  2RGV A;  2WAQ A;  4AVP A;  4XRF A;  1EV7 A;  1LUJ B;  3FIS A;  1J9I A;  3F8C A;  4FIS A;  5TGT A;  1SFX A;  3LL7 A;  3ABK H;  1HW5 A;  3KLN A;  3ZQG A;  1YX5 A;  3SEZ A;  1A36 A;  2LKS A;  4MFD A;  3S16 J;  1FYL A;  2HU9 A;  1OJL A;  1YG2 A;  2K3F A;  3OYE A;  3IWF A;  4DGW B;  2K9M A;  3H0D A;  2E36 A;  1SFK A;  2CRG A;  3J7Y J;  5EJC A;  5J47 A;  3IKV A;  5H20 A;  2EIJ H;  2DN0 A;  4A0Z A;  4NC6 A;  2HXO A;  1QU3 A;  3GVA A;  5AIP A;  1QRY A;  4EEF G;  3G1L A;  1T38 A;  4B1R A;  1NH3 A;  2V6E A;  1MMN A;  4LIU A;  4BY1 J;  2P0W A;  3QP5 A;  4MIM A;  4MEY F;  1BIB A;  4IHW A;  4M3E A;  2VKH A;  3KP2 A;  3K0L A;  3F3X A;  5CJ9 A;  3Q0U A;  3P9I A;  3KZZ A;  2DA7 A;  3DTK A;  3F22 A;  1JKO C;  2CSO A;  4F55 A;  3FKJ A;  1P4W A;  2MLK A;  3GFJ A;  4L5J A;  2Y0M A;  5FD5 A;  4ABZ A;  4BJ5 C;  1J2X A;  2NNY A;  4E7I A;  2R7O A;  3I0T A;  4UUT A;  2RRE A;  2O6G E;  2L4A A;  4A6D A;  5D4S A;  4XRS A;  4I09 A;  4Q48 A;  1ZYR F;  2CW0 F;  5LRS A;  2ZME C;  3I59 A;  4ZTJ A;  1KZH A;  3LNQ A;  1HW2 A;  4Y7N J;  3O2P E;  2C6Y A;  3KP5 A;  2A6E F;  4C3I J;  4UNO A;  3ISP A;  3O6B B;  4YFN F;  2IS4 A;  1R5H A;  3FXK A;  4EVI A;  1APL C;  2G9W A;  1MBJ A;  4L9T A;  2VLA A;  3E3V A;  3CF2 A;  3PQK A;  4DBQ A;  3VEP A;  1SVM A;  1LE8 A;  1AHD P;  4IZZ A;  1BM9 A;  1LDJ A;  2FNP A;  3KP4 A;  3C1D A;  1QVT A;  4D5F A;  3BG5 A;  4ITV A;  2MD5 A;  4XBF A;  1F36 A;  2L7Z A;  3CES A;  1YW9 A;  5FO5 A;  1ETW A;  4Q47 A;  4CCM A;  5C4X J;  1BW5 A;  3HOW J;  3FKI J;  1YI2 I;  4EV0 A;  2VJ4 A;  4BJT A;  1XSD A;  1MDM A;  2JRT A;  2B0L A;  2QQB A;  3D5S C;  3A01 B;  3GFI A;  1IUF A;  4G7Z F;  2HXI A;  3AL0 C;  4IRG A;  1XGN A;  4HV6 A;  3OYG A;  4GYG A;  2IA1 A;  2CQK A;  4HX8 A;  5IY5 H;  2HTJ A;  3L2U A;  1FX7 A;  2Y69 H;  1GLN A;  2FRH A;  3OIP A;  3CMY A;  2W7N A;  2LF8 A;  2ZJ2 A;  3J7Z I;  2B9S A;  2K7L A;  2YU9 J;  1X2N A;  3OL4 A;  2D1H A;  5EEG A;  2E7W A;  4A69 C;  2VPR A;  2OPT A;  2L5Q A;  2WAQ N;  4RB3 C;  2ZSI B;  1H89 C;  2W4S A;  1RRJ A;  1QNT A;  1D1B A;  2E1N A;  1WJF A;  4Y13 A;  1TC3 C;  3HTS B;  2M1B A;  3DV8 A;  3GTP J;  1RR7 A;  2JN6 A;  3O3K A;  2ZXW H;  1O3R A;  1HKS A;  2W84 A;  5B5E C;  1FZP B;  1E17 A;  2GOM A;  4YFX F;  5FD6 A;  4J19 A;  4YIF A;  5BQT A;  1HA8 A;  3DFG A;  2A07 F;  2E1O A;  1IF1 A;  1Z0X A;  2P5K A;  5IYD J;  3CME I;  2GXG A;  2M7B A;  1XN7 A;  4MQ9 F;  1UG0 A;  2D1V A;  2E5N A;  1X1A A;  4U88 A;  3HOS A;  4PK4 A;  3HTU A;  1N78 A;  4NHJ A;  3BCA A;  4PJL A;  4IHY A;  1G6N A;  1MBK A;  3BLY A;  4HBL A;  2K5C A;  2DT5 A;  3B02 A;  1EA3 A;  4E6K G;  2JPC A;  3HKZ N;  1IN5 A;  3ONQ A;  2HZD A;  3AG1 H;  2IA2 A;  3CUQ B;  2JRM A;  1ETV A;  1QZY A;  1Y8Q B;  2CS3 A;  4OAZ A;  4L9N A;  4NNJ A;  3PUB A;  1O4X A;  3LQR A;  1GUU A;  2R7X A;  5JFR A;  3CO7 C;  2GXA A;  2Q1Z B;  2TDX A;  3HEF A;  5DCM A;  1LFU P;  1KU9 A;  2M9H A;  4B4C A;  5HLG A;  2HOS A;  2BXY A;  2AQF A;  1FJL A;  3BG7 A;  1MIJ A;  1K79 A;  2P7V B;  3G73 A;  1HW1 A;  5D6F A;  1MSE C;  3DEU A;  2TCT A;  1LEA A;  4KA4 A;  1QHG A;  4NDL A;  1L0O C;  2FOK A;  3L2C A;  3WTW C;  3VOE A;  2XRO A;  2EH3 A;  3HBL A;  3COA C;  1FPQ A;  4ENJ A;  2NS0 A;  2HQN A;  5H6Q A;  2DMT A;  3HRM A;  4HEA 2;  4R8H A;  2EWN A;  1ETQ A;  4KIG A;  3AG4 H;  3OIQ A;  3BG9 A;  2DA6 A;  1B1B A;  1WKM A;  3UKG A;  2ZXH A;  1SC7 A;  1WFX A;  1YJW I;  2W82 A;  1SAU A;  2EFO A;  1DPU A;  4LB5 A;  2PEX A;  2OV7 A;  5B66 C;  1H9G A;  4QLC U;  3LSI A;  4IHT A;  2HI3 A;  2KRC A;  1RI7 A;  3VDX A;  3ZQC A;  2NYX A;  2CGP A;  4O5V A;  5LHG A;  1X4P A;  3WTV C;  2ZJQ F;  2RKH A;  2F2E A;  1XDS A;  5J8C A;  2VBW A;  4Z2Y A;  3H35 A;  2VXZ A;  1K6O A;  3VYU B;  2R7R A;  1GDT A;  2H1L A;  2MD0 A;  4MGR A;  2BY3 A;  3PSF A;  1J75 A;  2VN2 A;  2CWE A;  3ZN0 A;  3AFH A;  2XAQ A;  2PFB A;  4L0Z B;  4L5E A;  2WC2 A;  5FJ8 J;  1S7O A;  4RS8 A;  1BW6 A;  4RM3 A;  4TV7 A;  1D0Y A;  3W6K B;  1VQN I;  4M3F A;  2JMW A;  2DFE A;  2I10 A;  2KQR A;  4O3M A;  3IP4 B;  1AU7 A;  3TO7 A;  2QZ8 A;  1ZRC A;  1H88 C;  4IEJ A;  1V4R A;  3TW6 A;  4XMY A;  3W6V A;  2BEO A;  2IP2 A;  3HHG A;  1G4D A;  3QQA A;  5KCM A;  2O8X A;  2XKO A;  3RPQ A;  4CGZ A;  2Q2E B;  2N8G A;  2GLO A;  2TRT A;  3ELK A;  2DA4 A;  4AIK A;  2VC0 A;  4HSR A;  1ENH A;  3KPH A;  1QZZ A;  4IPA A;  2XSJ C;  4CA0 A;  3KYD B;  3CJN A;  1SD5 A;  4E7L A;  4UUS A;  1XD7 A;  2HGC A;  2CJJ A;  2IPQ X;  2BW3 B;  1UB9 A;  4I2O A;  3PFI A;  3WTU C;  2DOD A;  4CYC B;  2G7U A;  4A3F J;  2OF7 A;  4XON A;  5AON A;  4C9Y A;  5DM7 F;  1OYW A;  2M4K A;  3GZ5 A;  2CYY A;  3CO6 C;  1RIO H;  1WH7 A;  1O3T A;  2M45 A;  1SEU A;  1EF4 A;  2DLL A;  3F8M A;  4M9X A;  3S3O A;  2L2O A;  2DDA A;  3BWG A;  3DU5 A;  1O57 A;  1T0F A;  3CMA I;  2A6H F;  4JX5 A;  2W24 A;  2K02 A;  4I02 A;  2QA4 I;  2RQQ A;  4HW0 A;  3K1N A;  4XKB A;  2BHY A;  2DBB A;  3KP7 A;  4NB5 A;  4BS9 A;  1A04 A;  2GWR A;  1VQL I;  2STW A;  1BJA A;  1V54 H;  3HDD A;  3ABT A;  1STZ A;  2YUS A;  3JTH A;  1IXS B;  4DNC A;  2VKE A;  2OZU A;  4XKW A;  5GP9 A;  2MG4 A;  1QGP A;  1X19 A;  2JA8 J;  1JKQ C;  4C2U A;  3KFW X;  3TO9 A;  4B3A A;  1FOK A;  1U8R A;  4HV5 A;  4FAS D;  3FHZ A;  1VI0 A;  1I6H J;  3DF8 A;  4HX4 A;  3FXL A;  1FEX A;  4XL9 A;  1ZGA A;  5LHI A;  3RKY A;  5F1R A;  1Z1D A;  1UG2 A;  3BZ6 A;  2ZBK A;  2DA5 A;  4XOP A;  4BNC A;  1USS A;  2NAZ A;  5CVV A;  3MQ0 A;  2O7O A;  5HLH A;  2VQL A;  4PFO A;  3GFL A;  4XSZ F;  1CGP A;  2EFP A;  1TW2 A;  2XAJ A;  3CUQ A;  3BTI A;  3K2A A;  2CQX A;  4U0V A;  1JUS A;  5JLX A;  4G7O F;  3ABU A;  4EM1 A;  1H0M A;  1HLV A;  1IV6 A;  2L4M A;  3E5X A;  1JT0 A;  4H0E A;  4I7H A;  1U9O A;  3QOD A;  3LMM A;  3DBL B;  3P7N A;  1FY7 A;  4I0A A;  3BPX A;  4CO8 A;  4MTD A;  3DTE A;  2K9Q A;  4WF2 A;  2OU2 A;  1YIT I;  4HF0 A;  1IN7 A;  5KAF C;  2BY1 A;  1MBF A;  4IF4 A;  3QP6 A;  2R7D A;  3HIF A;  3R0J A;  1UAA A;  3DXJ F;  2L02 A;  4DZJ A;  5C44 J;  3JSP A;  4LG3 A;  4XM3 A;  1TT0 A;  1JUP A;  4B09 A;  5FB2 A;  3NQO A;  2VOO A;  5FFZ A;  3LOC A;  3GW2 A;  2M7A A;  4RGS A;  4A12 A;  2ZSH B;  3GBG A;  1MSF C;  4C2T A;  2O3F A;  4LG0 B;  4BXX J;  1SMT A;  1LNW A;  4PSW A;  2HQ5 A;  5E20 A;  3S1N J;  4W1U A;  2XDV A;  2ADU A;  1F4K A;  2HYF A;  3I4M J;  4RB2 C;  2E19 A;  2DMQ A;  5IOZ A;  1HSJ A;  2OJE D;  5EGO B;  3DPU A;  2EJR A;  2EA2 A;  1GT0 C;  1BI3 A;  2LY9 A;  1WJD A;  3C18 A;  2DPD A;  1VQP I;  4HQE A;  2ESH A;  1RC9 A;  4RAF A;  3OMY A;  2IAI A;  4JBA A;  4RB1 A;  3QPT A;  4XRS G;  3KIO A;  3ZMD A;  1ZLK A;  4EM2 A;  2M3A A;  3Q9V A;  4PJN A;  1UZC A;  1XX5 A;  1Z6R A;  2CQN A;  3FMR A;  2QBY A;  3CCV I;  2L7M P;  3K70 C;  4AIJ A;  3H3V K;  2CV2 A;  1DU0 A;  1Y56 A;  3QU3 A;  2Z3Y A;  1ZRF A;  3WTS C;  4LJZ F;  4JQF A;  3GYH X;  2KIF A;  5FKN A;  1W5S A;  3HSE A;  4PGH A;  5GAH J;  2Y2Z A;  1YJN I;  5F27 A;  3I9V 2;  4ESJ A;  2MBF A;  1OCO H;  3TQN A;  1PP8 F;  4AM3 A;  2Y0S A;  1I1S A;  1QPM A;  2J5O A;  1Z91 A;  2LP0 A;  3JAM K;  2WB1 A;  4IOA F;  3NWS A;  4FE7 A;  5M5X J;  2AO9 A;  3ZGK A;  2H27 A;  3QAH A;  1MNE A;  5F08 A;  1Y6I A;  3T0Y A;  5ICC A;  5LBQ A;  2XAH A;  2UUZ A;  5H2F C;  2KRF A;  3PO3 J;  4RGR A;  1XGM A;  2QSH X;  1YJ9 I;  1B6A A; 
#chains in the Genus database with same CATH homology
 1ETK A;  2ECB A;  4MFD A;  2DA3 A;  1S7E A;  3S16 J;  4C2M J;  1OJL A;  2R5Z A;  1W0T A;  1LFB A;  5IOY A;  2CRG A;  4A3L J;  4CYC A;  4A3B J;  3Q0W A;  1F43 A;  4M3D A;  2DMP A;  2DN0 A;  1ZR4 A;  4M3G A;  3IV5 A;  2HXO A;  4BKX A;  2K9S A;  1XG1 A;  3S1Q J;  1QRY A;  4EEF G;  1RES A;  2MW8 A;  3DCF A;  3G1L A;  4B1R A;  3S15 J;  3H0G J;  4BY1 J;  1HOM A;  4JX6 A;  4MIM A;  3LSR A;  2L7F P;  1ZQ3 P;  1MH3 A;  4IHW A;  4M3E A;  5F0C A;  5K7F A;  2LFB A;  2Y31 A;  3Q0U A;  2L0K A;  3M4O J;  2DA7 A;  4BBR J;  1HF0 A;  2VI6 A;  1DU6 A;  1LE8 B;  1JKO C;  1RET A;  3SFI A;  1MBE A;  4ABZ A;  1I50 J;  4S0H B;  3ZQF A;  5EG0 A;  4UUT A;  3GTQ J;  3RZD J;  2DA2 A;  3GTL J;  2H1K A;  1JUM A;  2K9N A;  3BTL A;  4XRS A;  1Y1W J;  3LNQ A;  3BTJ A;  3BR3 A;  4Y7N J;  5J1U A;  4D7M A;  4C3I J;  1U78 A;  5GPC A;  2D5V A;  1APL C;  2KT0 A;  2M34 A;  4AYB N;  1MBJ A;  1OCP A;  2DMN A;  4M3B A;  1LE8 A;  2ID6 A;  2JWT A;  1AHD P;  2XB5 A;  4RDU A;  4BBS J;  1QVT A;  3ZQH A;  3BG5 A;  4X1E A;  4D5F A;  1F36 A;  2L7Z A;  4X6A J;  1U8B A;  1ETW A;  3M3Y J;  5C3E J;  1ZTR A;  3IH4 A;  1PUF B;  3HOW J;  5C4X J;  2NS8 A;  1BW5 A;  2CQQ A;  2K40 A;  3S17 J;  2FX0 A;  3FKI J;  2NS7 A;  3NAR A;  1IGN A;  3FK6 A;  4RBO A;  1B72 B;  1TWA J;  3FK7 A;  3A01 B;  1IUF A;  2FD5 A;  3IH2 A;  2HXI A;  1HDP A;  2EZK A;  3FIW A;  1WPK A;  2JA7 J;  2IBD A;  3A03 A;  2XGD A;  1IJW C;  1IG7 A;  4DYQ A;  3E7L A;  3HOZ J;  1TWC J;  1Q1V A;  3HB9 A;  3CMY A;  1NTC A;  1B8I B;  2FQ4 A;  4XIC A;  1IDZ A;  4I6Z A;  4C3J J;  1X58 A;  2GM4 A;  3JRF A;  2YU9 J;  3WHC A;  1X2N A;  4A69 C;  3JRH A;  2Y0S N;  2M8G X;  2VPR A;  2OPT A;  2WAQ N;  5EGO A;  1H89 C;  3BR2 A;  1K61 A;  1TC3 C;  1P7I A;  1D5Y A;  2HYJ A;  1B72 A;  3GTP J;  1RR7 A;  2WV1 A;  3A01 A;  3G1M A;  3ZQL A;  2JN6 A;  5K7H A;  2ID3 A;  1WH5 A;  1ZKG A;  1AKH B;  5M5Y J;  3JRC A;  4J19 A;  4A93 J;  5FKK A;  2LLK A;  1SAN A;  2E1O A;  3OSF A;  1Z0X A;  5IYD J;  5J1Y A;  3JRG A;  1VF9 A;  4A3E J;  4D5C A;  5FLV A;  5EEA A;  1H8A C;  2LK2 A;  5EYR A;  4IHY A;  3S2D J;  1TWH J;  5IPA A;  2L9R A;  1MBK A;  1BL0 A;  1YRN B;  1HCR A;  1X2M A;  2CUE A;  3B6A A;  2M0C A;  4JYK A;  3HGG A;  3HKZ N;  3LSG A;  2GBY A;  5BNG A;  2ME0 A;  4A3K J;  2CUF A;  4QSH A;  1ETV A;  2X48 A;  3TP3 A;  3JRB A;  1O4X A;  3RKQ A;  1GUU A;  2COB A;  1VFC A;  1SFO J;  4AC0 A;  1W0U A;  5GPA A;  2G0E A;  3HEF A;  1LFU P;  2HOS A;  2M9H A;  4B4C A;  2R7Z J;  3S14 J;  3C2B A;  1FJL A;  3GTK J;  1OCT C;  3Q0V A;  1MSE C;  4A3M J;  2TCT A;  3PM1 A;  5E3N A;  1FTZ A;  2Y9Z A;  4IHV A;  4NDL A;  2Y9Y A;  2JA6 J;  3DEW A;  5IP6 A;  2EH3 A;  3HBL A;  2XPV A;  2DMT A;  1ETX A;  3GTG J;  3BR6 A;  1ETQ A;  1OFC X;  2DA1 A;  5F1J A;  3O8H A;  3BG9 A;  2DA6 A;  3HOY J;  3RZO J;  3UKG A;  2XPU A;  2H8R A;  3BT9 A;  2XRL A;  9ANT A;  1RPW A;  4QIW N;  2YS9 A;  3GTJ J;  3D1N I;  4A3I J;  5C4J J;  2AHQ A;  1ZR2 A;  1WI3 A;  2X6O A;  3CCY A;  3JRD A;  2O9L A;  2HI3 A;  1JTX A;  3ZQC A;  3GTO J;  2LTP A;  5M3M J;  3O8G A;  2R5Y B;  2XSD C;  3BQY A;  4A3J J;  1NK3 P;  1POG A;  3CQZ J;  3RQI A;  1GDT A;  1GVD A;  3HOV J;  5E3O A;  4UUS B;  5IYC J;  2EZI A;  3I4N J;  3JRA A;  1A6I A;  4AUX A;  3MN2 A;  2XB0 X;  1P7J A;  4L5E A;  1K83 J;  3BTC A;  3NAU A;  5FJ8 J;  4DZP A;  2XPW A;  1XS9 A;  2ELK A;  1JKP C;  4V2F A;  2FJ1 A;  1NK2 P;  1BW6 A;  4IHX A;  4M3F A;  2JMW A;  2I10 A;  5F04 A;  1AU7 A;  4JP0 A;  2NVX J;  4GFB A;  1RKT A;  1H88 C;  1G2H A;  4IEJ A;  3BR1 A;  5IP9 J;  3TW6 A;  1R9T J;  5HOD A;  3W6V A;  5J1R A;  3OIO A;  3QQA A;  3K7A J;  5FKL A;  4LOC A;  2WB1 N;  2N8G A;  3L1P A;  2GLO A;  2B63 J;  1PUF A;  2TRT A;  3S1M J;  3TED A;  3S1R J;  5IYB J;  1QPI A;  2DA4 A;  5K7Z A;  1QVU A;  1ENH A;  3LSJ A;  1JT6 A;  4C3H J;  3ZOB A;  3MKL A;  2XGE A;  4UUS A;  2HDD A;  1VND A;  2CJJ A;  5JLW A;  1JTY A;  5FKM A;  2LVS A;  4CYC B;  4A3F J;  2OF7 A;  1JJ6 C;  4A3D J;  2DMU A;  3BQZ A;  1ZGW A;  1IRZ A;  3OSG A;  1MBG A;  2E2H J;  2QF7 A;  5EZH A;  1WH7 A;  1B8I A;  1EF4 A;  3SJM A;  2EZH A;  1JJ8 C;  4FTH A;  2KDZ A;  3OOU A;  3HGY A;  2R92 J;  4JX5 A;  3JRE A;  2PMZ N;  3GTM J;  4JX4 A;  2MSY A;  3BG3 A;  2X9D A;  4XID A;  4G12 A;  3HDD A;  2YUS A;  3B6C A;  3IH3 A;  2VKE A;  5FKO A;  3LSP A;  5M5W J;  1GV5 A;  1UMQ A;  5GP9 A;  2MG4 A;  5EG0 B;  4QTR A;  1IDY A;  5F0F A;  2JA8 J;  5IP7 J;  1JKQ C;  1AKH A;  2ZB9 A;  1IC8 A;  1T56 A;  4MLO A;  5J3L A;  4B3A A;  5DS9 A;  1VI0 A;  4BY7 J;  1RKW A;  2JJ7 A;  4A3G J;  5DTD A;  1I6H J;  1E3O C;  2LR8 A;  1TWG J;  3PO2 J;  1FEX A;  3TW7 A;  1MNM C;  3BR5 A;  1UG2 A;  2DA5 A;  4D7N A;  1JKR C;  2EBI A;  1YRN A;  3F0C A;  1TWF J;  2O7O A;  1A5J A;  2LD5 A;  1XC5 A;  3Q3S A;  3G1O A;  2EQR A;  3BTI A;  3K2A A;  1JGG A;  2JK3 A;  2CQX A;  2W48 A;  1JUS A;  5JLX A;  3SDG A;  3TP0 A;  3BR0 A;  4FE4 A;  2NVT J;  2E2I J;  4DYR A;  1HLV A;  4A3C J;  4XK4 A;  1IV6 A;  2R93 J;  3ZQI A;  4FCY A;  1JT0 A;  1WGX A;  3JR9 A;  4Y52 J;  1U9O A;  4W97 A;  5M3F J;  1UHS A;  4XRM A;  2K9Q A;  4M6V A;  2E2J J;  2RAE A;  4I76 A;  1MBH A;  5E3M A;  2O8K A;  2HOT A;  1ITY A;  1MBF A;  2QCO A;  4DZJ A;  5C44 J;  1JUP A;  1ETY A;  3LOC A;  5FLM J;  1MSF C;  3GBG A;  4BXX J;  2DJN A;  1GV2 A;  1MH4 A;  3S1N J;  2HQ5 A;  2P81 A;  2CU7 A;  4DW6 A;  4W1U A;  4MO7 A;  3I4M J;  2E19 A;  1U9N A;  2DMQ A;  5IOZ A;  2ECC A;  5EGO B;  1Z77 A;  1GT0 C;  3QPS A;  2LY9 A;  2NVY J;  3WHB A;  4DYC A;  2Y30 A;  3VPR A;  1FIP A;  1I3Q J;  2IAI A;  2LKX A;  2EZL A;  4XRS G;  1CQT A;  5EF6 A;  1FIA A;  2DTZ A;  5E3L A;  2R5Y A;  1HDD C;  2ME6 A;  5F0H A;  1WCM J;  2R5Z B;  2L7M P;  4MFE A;  2IEK A;  3HM5 A;  1T33 A;  2M2E A;  3MVP A;  3JRI A;  1DU0 A;  3H3V K;  5EZG A;  4HNV A;  3S2H J;  3A02 A;  5FKN A;  5EDN A;  2Y2Z A;  1BA5 A;  2HOA A;  5F27 A;  1Y1V J;  1FTT A;  3CDL A;  3QPL A;  2LP0 A;  2NVQ J;  2R0Q C;  1ZK8 A;  3HOU J;  2MGQ A;  4FE7 A;  5M5X J;  2AO9 A;  2VUM J;  4V2G A;  5F08 A;  3FIS A;  2XGC A;  1ORK A;  4FIS A;  1ETO A;  2VKV A;  3PO3 J;  1BJZ A;  2NOG A;  2JA5 J;  3ZQG A;  3HOX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...