1X2MA

Solution structure of the homeobox domain of mouse lag1 longevity assurance homolog 6
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
64
structure length
64
Chain Sequence
GSSGSSGTAQPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords LAG1 longevity assurance homolog 6
publication title Solution structure of the homeobox domain of mouse LAG1 longevity assurance homolog 6
rcsb
source organism Mus musculus
total genus 12
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2005-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1x2mA01
3FIWA 4C2MJ 3JR9A 1BA5A 4M6VA 2O8KA 1HDPA 1JUPA 5EDNA 1B8IA 1FTTA 2TCTA 2HYJA 1GDTA 2JA5J 4W1UA 4A3MJ 2NS7A 2DA3A 4DZJA 3GTMJ 2DA6A 1JTYA 4B3AA 2LTPA 2LY9A 5EG0A 2VUMJ 4XRSG 4BY7J 3OSFA 4IHWA 2N8GA 1LE8B 3M3YJ 5FLMJ 2YS9A 2NVTJ 2Y9ZA 3S16J 4ABZA 3BR1A 3S1QJ 1A6IA 5M5XJ 4V2GA 1MBEA 3ZQLA 1MBHA 2HDDA 3CMYA 1JJ6C 1WCMJ 2DMNA 2JN6A 3CCYA 5IP9J 1Y1WJ 4C3IJ 4A3JJ 3BQZA 3G1LA 3LOCA 4JP0A 4DYQA 4IEJA 1OCPA 1UG2A 3TP3A 1YRNA 5E3MA 3BTCA 1RKWA 2R5YB 5GP9A 2DA5A 3TW7A 1WI3A 2XPVA 2ECBA 5IP7J 1IG7A 1DU0A 2LD5A 4UUTA 2M34A 4QIWN 3BTJA 2HXIA 2ID3A 3ZQFA 1H8AC 3GTPJ 3GTJJ 4Y52J 2LVSA 1U78A 2JA8J 5EZGA 5EGOA 4A3CJ 1FEXA 3MVPA 2JK3A 1HDDC 2Y9YA 1ETXA 3JREA 3ZQGA 5F1JA 1AHDP 3BTIA 1ORKA 3S15J 1W0TA 1RR7A 1LE8A 2R7ZJ 3G1MA 1E3OC 3F0CA 1U9NA 5FKLA 2K9QA 2P81A 2ID6A 1H88C 5F0FA 1SFOJ 1NTCA 2AHQA 2DN0A 1APLC 3LSJA 1A5JA 4FISA 1MH3A 3PO3J 1Z0XA 3DEWA 1ZTRA 2XPWA 3HKZN 3MKLA 5FKOA 5C3EJ 2OF7A 1WH7A 3IH3A 5F04A 4XRMA 3BTLA 2DA7A 2W48A 4JYKA 1FJLA 2Y0SN 4AC0A 3HOWJ 2R5YA 5FKMA 1G2HA 3HGGA 1P7IA 4Y7NJ 2NVXJ 1F36A 3QPSA 1GT0C 3LSGA 5EEAA 1T33A 3ZQIA 2JJ7A 1NK2P 1GVDA 5DTDA 3S14J 3CDLA 5EF6A 2E19A 3FISA 3GTLJ 5IOZA 2DA1A 4A3GJ 2Y30A 2WV1A 4MIMA 1XC5A 3O8HA 2L7MP 2M0CA 2O9LA 2JA6J 2LFBA 3HOYJ 4M3FA 2R93J 3NAUA 1ETWA 2M2EA 1ETKA 4BY1J 4QSHA 5FJ8J 5C4JJ 4V2FA 2COBA 4CYCB 3HDDA 1K61A 2ELKA 1GV2A 1BW5A 4IHVA 3GTGJ 2DMQA 2LKXA 1Q1VA 1HOMA 4DYRA 1K83J 1D5YA 2CQXA 4D7NA 2PMZN 1MBKA 3GTOJ 2FD5A 3BG9A 1IV6A 3Q0VA 4RBOA 3B6CA 3FK7A 5F08A 1GV5A 3A01A 1S7EA 4EEFG 2EBIA 1ZKGA 4X1EA 1U9OA 1IJWC 2NVQJ 3QQAA 2JMWA 4JX6A 2EZKA 3JRFA 4QTRA 4JX5A 2HOAA 2WB1N 5C44J 4D7MA 2ME6A 2LLKA 1TWFJ 1F43A 4AYBN 3WHCA 2E2JJ 2HOSA 1POGA 2GLOA 4A3EJ 4M3GA 1BJZA 3L1PA 1GUUA 3HBLA 4XK4A 1IGNA 1OCTC 1O4XA 3S2HJ 1JKPC 2MG4A 3Q0WA 4BBSJ 1MNMC 1I3QJ 3HEFA 2ECCA 1XS9A 2MW8A 2QF7A 3RZDJ 2Y2ZA 3UKGA 1LFBA 1Y1VJ 2EH3A 2LR8A 1ENHA 2AO9A 4CYCA 1HCRA 1UHSA 3K2AA 1SANA 1IDZA 1XG1A 2CJJA 2E1OA 3ZQCA 1MBFA 1OJLA 2EQRA 4A3BJ 3BR3A 5JLWA 1ZR4A 2IAIA 1MSFC 5F0CA 2VPRA 3TW6A 5K7ZA 1AKHB 2XPUA 3E7LA 2YUSA 2OPTA 1FIAA 4B1RA 4A93J 1BW6A 1WPKA 3OIOA 2EZLA 2HXOA 5DS9A 2XB5A 2L7ZA 2KT0A 2DA2A 5FKNA 1PUFB 3JRAA 2EZHA 3IV5A 2GBYA 2DMTA 4A3KJ 3S2DJ 3FKIJ 1MBGA 4MO7A 4BXXJ 4NDLA 2XB0X 1Z77A 4MFDA 3OOUA 3S1NJ 4FE7A 2X9DA 3JRGA 2NS8A 1QRYA 5J1UA 3GTKJ 1ITYA 3WHBA 1R9TJ 1T56A 5JLXA 2LP0A 2LK2A 2K9SA 4X6AJ 4G12A 2VKEA 4DZPA 4DW6A 1I50J 3Q3SA 3HB9A 1BL0A 1HF0A 1DU6A 2L0KA 1NK3P 3IH4A 3HOXJ 1VF9A 2DTZA 2O7OA 2M9HA 1H89C 2ME0A 2HI3A 3BT9A 3Q0UA 4D5FA 4IHYA 5EG0B 1QVUA 3BG3A 9ANTA 3A02A 2MGQA 2JA7J 2IBDA 2B63J 3GTQJ 4FTHA 2X48A 1TWAJ 5IOYA 1IC8A 1JUSA 3H0GJ 4XICA 3LNQA 4JX4A 4A69C 3GBGA 5C4XJ 5J1YA 1MSEC 2ZB9A 4I6ZA 2L9RA 1PUFA 1X58A 4BBRJ 4B4CA 2R92J 2CRGA 1JTXA 4M3DA 2GM4A 4RDUA 3JRHA 2XRLA 3HOUJ 5E3LA 3RQIA 5IYCJ 2H1KA 1IDYA 3NARA 5EYRA 3ZQHA 5J1RA 5GPCA 2IEKA 3B6AA 1QVTA 1RKTA 5M3MJ 2E2HJ 5E3OA 5IYDJ 2YU9J 2FJ1A 2TRTA 2R5ZB 3FK6A 3BR5A 2H8RA 4A3DJ 4A3FJ 1P7JA 3BR0A 5K7HA 4HNVA 5EGOB 3C2BA 4C3HJ 1B72B 2D5VA 5FKKA 1FTZA 1JKRC 1ZQ3P 2M8GX 3LSPA 5J3LA 1AU7A 2XSDC 3S1MJ 3ZOBA 4XIDA 2WAQN 1ETYA 4AUXA 3SDGA 4M3EA 2CQQA 4FCYA 2HQ5A 3DCFA 4UUSB 2CU7A 5M3FJ 3G1OA 3K7AJ 2K9NA 2XGCA 3D1NI 3S1RJ 5M5WJ 3W6VA 4DYCA 5F0HA 2R0QC 1RETA 5F27A 3VPRA 3HOZJ 1OFCX 1CQTA 1ETQA 4MFEA 4A3LJ 2DMUA 3JRCA 3JRIA 3I4MJ 1QPIA 3S17J 2X6OA 4I76A 5EZHA 2XGEA 1ETVA 1ZR2A 3A03A 3IH2A 4S0HB 3CQZJ 1VNDA 3PO2J 5E3NA 4XRSA 1JT0A 2R5ZA 3OSGA 2VI6A 2Y31A 3BG5A 3JRDA 3JRBA 1B72A 1ZGWA 2QCOA 2FQ4A 2VKVA 5HODA 1JJ8C 2RAEA 2JWTA 3LSRA 1RPWA 4M3BA 2HOTA 2E2IJ 4A3IJ 1LFUP 1JGGA 1IRZA 2NVYJ 3TP0A 1W0UA 2DMPA 1FIPA 3HGYA 5IPAA 1B8IB 1IUFA 4MLOA 5IP6A 3SJMA 3BQYA 2CUFA 4C3JJ 4UUSA 4W97A 1VI0A 3SFIA 1VFCA 1JKOC 1EF4A 3QPLA 4L5EA 3H3VK 4J19A 3I4NJ 5FLVA 1ETOA 1MH4A 1JKQC 1HLVA 3BR6A 2I10A 3PM1A 3RZOJ 1X2NA 2XGDA 2EZIA 2K40A 3HM5A 3BR2A 1I6HJ 1X2MA 3A01B 1JUMA 1AKHA 5K7FA 1TWGJ 1TWCJ 4IHXA 2G0EA 4LOCA 5BNGA 2CUEA 3TEDA 2DJNA 1MBJA 3HOVJ 1U8BA 1UMQA 1WGXA 2KDZA 1TWHJ 4FE4A 3M4OJ 1TC3C 3RKQA 2NOGA 4GFBA 1WH5A 1RESA 2L7FP 1YRNB 5M5YJ 5IYBJ 2MSYA 5GPAA 4D5CA 3MN2A 1JT6A 2FX0A 1ZK8A 3O8GA 2DA4A 4BKXA
chains in the Genus database with same CATH superfamily
3UNGC 2PBIA 4KA4A 4JQFA 3IP4B 3BZKA 5DCMA 2HVRA 3FIWA 2XSJC 3JR9A 3Q9VA 1LUJB 4M6VA 4L5JA 2XDVA 3DQVC 5JI6A 1H9GA 2A6TA 3AG1H 3C7JA 3VYSB 1FTTA 2VBZA 4MNUA 4RB2C 3LSKA 4LIVA 2JA5J 1FOXA 2C6YA 1D5VA 1A31A 1I27A 4A3MJ 3K6GA 1MD0A 2A61A 2XAJA 2BYVE 4GCVA 3WTVC 2L02A 3F8NA 4II3A 3ABMH 4A0XA 1N25A 3OSFA 2ZNZA 3F9KA 1TNTA 4XR6A 4PGHA 3LA2A 3ONQA 1LE8B 4IHSA 2ACJA 5FLMJ 2YS9A 3DU6A 2LKPA 4F3QA 3GMEA 4NNJA 2F5CA 4TV7A 3BR1A 1A6IA 4V2GA 2WV0A 3ZQLA 1WJBA 1MBHA 2UXXA 1QBJA 1J0RA 3CMYA 4AIJA 2DMNA 4C30A 4E7SA 5GAGJ 1LNWA 2KQRA 3IC7A 2DI3A 4S05A 4B44A 1YYVA 2F5DA 4IEJA 2W24A 1YRNA 1G3SA 1T08B 3DKWA 5E3MA 3QODA 5B1BH 1YO5C 1XCBA 3TW7A 4U0WA 5IP7J 3EDPA 2X85A 3FHNA 3O6BB 1LVAA 5H20A 3FWEA 1BR2A 2B7EA 3ZQFA 3GTPJ 3OYKA 2Q2EA 3FM5A 2ZCWA 2LVSA 2R7SA 5EZGA 3OS2A 1Z3XA 1W36C 3AG3H 1KU7A 1S6LA 2Z33A 1HDDC 2FXAA 2EIMH 3JREA 2IS4A 3KP4A 5ICFA 3MQ0A 2XKOA 1GLNA 3T8TA 2R7TA 4KISA 2VONA 2V1DA 2G7UA 3O2PE 3BLYA 1RR7A 4CCJA 3P9CA 2KIUA 4NC8A 1W4MA 4CGZA 2OCEA 4BXFA 3I59A 3SFZA 2O0YA 2O61A 4HF0A 2KJCA 3BOQA 3KIOA 3NRVA 1UB9A 2GIVA 3H1CA 4HSRA 2KRHA 4BYYA 2CW8A 2E1MB 2QSHX 3DEWA 4BGDA 4BQNA 3BCAA 3VSLA 4QWQA 3AG4H 5K5RA 5FKOA 1OMIA 3IH3A 1WH7A 2Q8KA 5F04A 4C9YA 4XRMA 3BTLA 2DA7A 4JYKA 4II2A 3ZMZA 4OIRF 1FJLA 2Y0SN 4LLNA 4AC0A 4DBRA 5FKMA 2ZJ2A 2W57A 4LLGF 4P55A 3VODA 4BXUA 2EV6A 1F36A 4U0VA 4U0YA 1T33A 1NK2P 3S14J 5EF6A 5FFXA 2E19A 2VE9A 3R61A 3GTLJ 5B1AH 1U5TC 3RTRA 1YJWI 2WV1A 1WSUA 2F4OB 3O8HA 2JA6J 1FC3A 2EFNA 2EINH 2UUZA 1TT0A 4ZJZA 2E7WA 3JTHA 1VZ0A 3CP2A 4BS9A 3GZNB 4GXOA 1USSA 3HOTA 1K61A 4N4NB 1BW5A 2ZXJA 4G6DA 2DFEA 1W7PA 3IRQA 2KJBA 4PJ0C 2BOLA 3CJTB 1KQ0A 4G7ZF 1K83J 2MFZA 4KN7X 2CQXA 2PG4A 2K5CA 3K4LA 1YG2A 2DO7A 1MBKA 3HC7A 3P7NA 3BG9A 3L9FA 5L3BA 1Y0NA 3KX2A 3Q0VA 5E18F 4RBOA 2OJED 3C2GA 3E5XA 3FK7A 3VYTB 4BDYA 4IHTA 4IZZA 1S7OA 3A01A 1GXPA 1XPXA 2IPQX 2LOOA 5LGTA 2BHYA 1TW2A 2D1VA 1WVRA 5DCFA 2WB1N 4HAMA 4LJZF 4D7MA 5ILVA 4IKFA 4HNTA 2ZJPF 1O7FA 3OYLA 1T98A 3VWBA 5H6QA 4CUGA 1FYKA 1VQLI 4OAYA 1Q1HA 1POGA 2F5FA 1JXSA 3OR1C 5DDGA 1IGNA 5BMZA 1R23A 1T8IA 2LG4A 2DYRH 1I3AA 2V4JC 1O7LA 1OCTC 3S2HJ 1T39A 2KP6A 4NC7A 2JTVA 3SHFA 5H2FC 1ZG5A 1MNMC 1YE9A 2ECCA 1KQ9A 2JSPA 3FXRA 4BHPA 1XS9A 1C0WA 3HRMA 3RPUA 4RAYA 1QHGA 1YFHA 3HKZA 2DU9A 2NVUB 4BJ5C 3G3ZA 3ASNH 3W6KB 1QNTA 1MBFA 3I56I 1OKRA 1X3ZB 2M30A 3CUQA 3E97A 5JLWA 4HF2A 1DP3A 4YIIA 3C1DA 1MSFC 4IOAF 2LDUA 4IL6C 3DP7A 2OPTA 4B1RA 4A93J 3CCJI 3FHZA 2OTJI 3P5JA 1WRJA 2ZJRF 3PQKA 1QU3A 4M9ZA 3KE2A 4E4HA 2EV5A 2HTJA 4M9SA 5JVTA 3OYGA 5FKNA 4ESJA 2R4GA 4RLFA 2QQBA 2XKPA 2M3AA 3JRAA 2O8XA 2GBYA 1T38A 4UUVA 3CLQA 1D8KA 2XGXA 3CUOA 4AWXB 1Z6RA 2W84A 1T0FA 2Y75A 3SEZA 1NG7A 2VB6A 2A6EF 2X9DA 5HNFA 3LWFA 4OAZA 3EUHC 3ABUA 1XSXA 3W2AA 3GTKJ 1R9TJ 3IAS2 1YW7A 3ZRGA 3G73A 2HGCA 2VKEA 5GADJ 2DOEA 4L0YB 4XLCA 2L0KA 2RQPA 1V55H 3HOXJ 3K4BA 2O7OA 4MHGA 1H89C 2ME0A 2Q1ZB 5HLTA 1TL8A 1Y6IA 3AFHA 3I71A 2FRHA 3GFMA 3BT9A 2CH0A 1EH7A 4D5FA 1SAXA 3E5QA 2A5WA 3I3LA 3BG3A 2F5VA 5E1XA 1R22A 4EQQA 1FPQA 2IBDA 2DK5A 3GTQJ 1TWAJ 4PCQA 1IC8A 4XICA 3T0YA 4JX4A 4A69C 4ENMA 3HIFA 5J1YA 2LBFA 1X1BA 3RQ4A 2VT2A 1RUOA 3CO6C 2H27A 1WI9A 2ZKZA 3OIQA 1PUFA 1JGSA 4PDKA 5LBQA 4BJTA 4E6KG 1LB2A 4B4CA 2CGPA 2A3SA 3OYDA 2JSCA 2P4WA 3ZQ7A 2XRLA 2DJIA 3HOUJ 2PJRA 3RQIA 4OWRB 1IDYA 5EYRA 1BIAA 3ZQHA 5CVJA 1E2XA 1TP4A 4NB5A 2VBXA 2XVCA 3DPLC 5JFRA 1QO0D 3BPXA 4LIUA 2XF5A 4AVZA 2M1BA 2YSRA 2BHZA 2H8RA 3E3VA 1USTA 4BNCA 4LFUA 5FKKA 2EFWA 1SVLA 5EEGA 3D5SC 3F6VA 2HDWA 4QPOA 5J3LA 3V7SA 1G3WA 2DAOA 5CPRB 2BW3A 3WE2A 3S1MJ 3FXLA 2JUCA 4XIDA 1ON2A 1PP7U 3FDYA 3TMOA 5E8GA 3L2RA 1OYYA 4B3XA 2KFDA 5FFZA 2MABA 4LLLA 3CCSI 1PYVA 3KZZA 3W3CA 2ZC2A 1IXCA 1Z9CA 2W4SA 1HKQA 2WC2A 2XF6A 3S3MA 4ZZLA 4ZYDA 2CU7A 3QP6A 2NNNA 2P8TA 3K7AJ 2Y69H 1YQAA 2B0LA 2K9NA 3B73A 1IF1A 1SD7A 5GAEJ 3H3ZA 4CO8A 2KZVA 2XF7A 3OMYA 5F0HA 1BC8C 1RETA 5F27A 2LF7A 4KIBA 3ERED 3M1EA 1KQ8A 2KKOA 4MFEA 2W7NA 3WGIA 3JRIA 3KLNA 3TQNA 1ZR2A 5LGNA 3PO2J 3RKXA 5E3NA 3GCMA 2L9NA 5HLHA 1TZLA 2VI6A 4O3MA 3JRDA 1UHWA 4RAZA 3JRBA 1B72A 4HZFA 2K4JA 3G6EI 1H9TA 2X1EA 3IKVA 1RPWA 4P9UA 4XMYA 2DFHA 5F6FA 1DPRA 5J40A 3H35A 3HSEA 2DT5A 1Z21A 3QAHA 3E5UA 2PMUA 1V5FA 4I0BA 3K1NA 2XC7A 2NVYJ 5TRDA 1W0UA 1VQ4I 4CCOA 2DXIA 1FIPA 1B8IB 1IUFA 4MLOA 5IP6A 2Y0MA 1WJAA 1B59A 3VFZA 2CUFA 2HVSA 1TBXA 1Z7UA 3RDIA 2L5QA 3QPLA 4UXNA 4XSXF 3IL2A 3E6CC 2J5PA 4XOPA 5LEJA 4J19A 1ETOA 1JKQC 3L09A 2DDAA 4ZZDA 2WADA 2X6WA 4ENKA 4UNOA 2K40A 3T8RA 1IXRC 3I64A 3HZJA 3A01B 1GVJA 3VSKA 4NQWA 1SFKA 1TWGJ 4IHXA 2MC4A 2FF4A 1SMTA 2CUEA 4E70A 3KLOA 3TEDA 2OAZA 3J81K 2VJJA 2WAQA 3K2ZA 1IN6A 4Q47A 1BOBA 1WGXA 4L5IA 2O3FA 4IQ4A 4RAFA 5L3FA 1J75A 1HW5A 4HOBA 1UJ8A 1D3YA 2GA1A 2X4HA 4G6TB 3RKQA 2JQ7A 1RESA 5TGTA 1F5TA 3BDDA 2FMLA 3CDHA 1R00A 2HQAA 5GPAA 4D5CA 3G2BA 1G59A 1RUNA 3WE3A 3TBIA 4JK1X 2JPBA 4AU7A 1IRXA 5A2QK 4BKXA 3MKZA 5FD5A 2KZGA 3N97A 3OYCA 2BXYA 3K0LA 1BA5A 1MZBA 3ZXSA 3J80Z 3AL0B 2FSWA 1X1AA 2W85A 2TCTA 1I1GA 3RI4A 3DV8A 4Y3OA 2VKDA 2CSOA 2HS5A 4W1UA 2FUG2 3GTMJ 1SAUA 4GRIA 3NEUA 5JHFA 1O3QA 1JTYA 3ABTA 5EG0A 1BI0A 4BY7J 3ZMVA 3ROUA 1FNNA 3M3YJ 4XLFA 3KETA 2EJRA 2XAHA 2KRFA 4Y15A 3H9GA 3LSHA 2E1NA 4UV9A 4IVNA 2IP2A 1MBEA 3DWLE 1F1ZA 5F64A 1JJ6C 2L4AA 3WGHA 3K4NA 4AIHA 4WX9A 2WBMA 4C3IJ 3BJOA 3G1LA 3FZVA 3HRSA 2QBYB 3JSOA 2PJPA 3W2VA 4BL0B 3A4CA 1TT5B 2Z16A 2V9PA 1IRGA 4BJ6C 1UG2A 3MWMA 2B9SA 4ZTJA 2R5YB 2DT7B 5GP9A 2DA5A 1WI3A 2RQQA 3RPQA 5HS9A 2LD5A 4UUTA 4RGSA 3LA3A 4UY8I 2M34A 2V6CA 1H8AC 3GTJJ 4R1HA 4BHCA 2JA8J 1OR7A 1XMAA 5KVRA 1R6RA 1MGTA 2M7AA 1YS6A 3SQNA 2IA0A 2LH9A 2Y9YA 1ETXA 4KJZA 5BPIA 3ZQGA 1HSTA 4E7HA 2JVGA 1VQKI 4A6EA 3RKYA 4I02A 4CCNA 5KHDA 1FOKA 3I55I 2K02A 2FMYA 3G1MA 3BG6A 3DXJF 1D1AA 1RR8C 1U9NA 4RGRA 1HSJA 2HPMA 2CG4A 2K9QA 2P81A 5E8IA 2GXAA 1I1SA 3M8FA 1IUYA 4P96A 5D8LB 1H88C 3KEOA 2AHQA 3PSFA 2KIQA 3LSJA 5J6XA 4I2OA 2R7UA 4DGWB 4KT5C 1IN5A 3SZPA 3QPTA 4FQGA 1S72I 1X3WB 1X4PA 2BY0A 2FBKA 1QGPA 4OIPF 1TLHB 2XASA 5K5QA 2KIMA 4BUPA 2D2WA 3GF2A 1QHHD 3HOWJ 1YX5A 1G2HA 2CW0F 5FRMA 2VQCA 3ML6A 2NVXJ 1HC8A 4M73A 3KZYA 3IAM2 3LSGA 3CP8A 4YIFA 2WA0A 4IX7A 3ZQIA 3KEQA 5E17F 1GVDA 5HVQC 2IGKA 3PIPF 1ULYA 3CDLA 2BW3B 2MLKA 2L7MP 2M0MA 2BY2A 3RKWA 2A6HF 4M3FA 3TGNA 4ZDOA 1ETKA 3QRFF 1DUXC 2P6SA 1YITI 1OCOH 1UG0A 1YI2I 3DTEA 1FYMA 4V2FA 3RYPA 2L01A 3KFWX 2ELKA 3G4SI 1WHUA 2EV0A 3GTGJ 2LKXA 2RGVA 2CUZA 3QU6A 2KIFA 1Q1VA 4XKBA 1XGNA 1EV7A 3L2UA 3VB2A 4HPQA 1HOMA 4BQAA 3E0JB 4XNFA 4BQQA 4U88A 4ENNA 4D7NA 2PMZN 3GTOJ 2FD5A 2A5YB 1VQPI 1LDDA 4EM0B 1XSVA 1W36D 4WK8F 3SZTA 3B6CA 5IT9K 3L00A 5D5UB 1GV5A 5D8KB 2GXBA 1S3JA 2FBHA 3QQAA 5CLSA 2HOAA 1B1BA 2DLLA 1FZPB 4EGZA 5B66C 1EA3A 3FMQA 5H6RA 3AL0C 3CCLI 3CMAI 3DBLB 1SEUA 1H0MA 1FY7A 5L3GA 2R3SA 3TO7A 3HHHA 1D0YA 2GLOA 4ZDPA 1BJZA 3HBLA 4XLAA 5HLGA 1O4XA 2MG4A 2WTEA 2Z1DA 3HEFA 4PSWA 2QF7A 1EKEA 4I09A 1BN5A 3CCEI 4HRIA 4EJOA 2LR8A 2BV6A 2VASA 2AO9A 4CYCA 3PFIA 2HTSA 1IXSB 1LKXA 2E71A 2VKHA 3FM3A 4IJAA 3K2AA 2VE8A 1XG1A 3QYBA 2OZUA 2ZSIB 4A3BJ 3BR3A 2GQQA 2IAIA 3Q5FA 1G6NA 4QPQA 2VPRA 3E7LA 2NNYA 2L9VA 3CC2I 1FOWA 4ESBA 5DS9A 2ISZA 2F48A 2DCEA 2XB5A 3F8MA 4KIGA 4R8HA 1X1CA 2KT0A 2DA2A 2HDCA 2EPFA 3UR3C 2ZBKA 4KIFA 1UCRA 3BROA 2FQ3A 1MBGA 1BM9A 3Q9SA 1Z77A 5J4YA 3GVAA 2CQNA 4MFDA 3OOUA 5HS7A 4B09A 4BHBA 4NHJA 4FE7A 2CFXA 4HSTA 1FSEA 5J1UA 5J8FA 3CTAA 5CJ9A 5JLXA 2LP0A 4EJUA 2LK2A 2STTA 1RNLA 4X6AJ 2ICWG 3GO5A 4XLPF 1I50J 2O03A 4A5NA 3HB9A 1XCVA 1BL0A 5CVRA 1DU6A 3B02A 4AIKA 1NK3P 2QENA 1AA7A 2XAGA 3F23A 1BI3A 3FXJA 3M8JA 1WFXA 3BC8A 3KYCB 3CESA 2G7HA 4G8XA 2V26A 2R7QA 5EG0B 1QVUA 4BAYA 2DTRA 2JA7J 2LNBA 3WTTC 3GEZA 4P1WA 3GUDA 3WODF 4RGUA 4IRHA 1OCZH 3HRTA 2A68F 5E20A 4AYBA 5IOYA 3JSPA 4IPAA 1JUSA 3H0GJ 2MBFA 2V9KA 1FBQA 2HOEA 4XLEA 5TJJA 1MSEC 2ZB9A 2HZDA 2DDBA 2L9RA 1R5HA 3GFJA 5DEQA 1Y39A 4Y4RA 1MMAA 3WG7H 4J01A 2CRGA 1REPC 2GM4A 1QQIA 4RDUA 2P5VA 5E3LA 2I5UA 3TKYA 5EEHA 3MZ8A 2DFIA 4BH9A 2IA2A 2QQAA 4I98B 5J1RA 5GPCA 4CCMA 2DBBA 2IEKA 5M3MJ 4E7IA 2E2HJ 3E6DA 1O3TA 4MGRA 3GX4X 2KRCA 2FJ1A 2TRTA 2V1XA 3I0TA 3BZCA 3LSTA 2R5ZB 3FK6A 3SXYA 3DPTA 2FOWA 3OYNA 4HV6A 3QWLA 3L2WA 4A3DJ 3KEYA 4IO9F 1BR1A 1MIJA 4HNVA 5E79C 2FOKA 2ZXWH 3ECHA 1JKRC 4OMZA 1ZQ3P 2EIJH 3S2WA 5DD8A 3LSPA 1I6XA 4KICA 1ZG3A 1AU7A 2E36A 1WJCA 2GAUA 5J4VA 1MMDA 3ZGKA 3KPHA 2WY7Q 1TTYA 4GDFA 1A6QA 2QSFX 4AVPA 2ZXHA 3EQLF 4AUXA 3A0HC 5FB2A 2AQFA 3LSIA 1RC9A 2P5LC 5M3FJ 4UB8C 1FMWA 5E1ZB 3ERMA 4HV5A 2XGCA 4L9NA 3F8CA 3K1MA 2DW4A 4E7KA 3CO7C 4OIQF 4XKWA 1WKMA 2FEZA 3W2WA 1XB4A 3VPRA 3ZCOA 4HX7A 1R5GA 2QZ8A 4DJAA 3SDBA 3S17J 5B5EC 2XUBA 2VIXA 3ZN0A 1J5YA 2L7KA 3GYHX 2L4MA 3LQQA 1OCCH 1DGRM 3BG5A 4UHTA 1ONVA 4N0BA 1P9QC 2JRMA 4GYIA 4PZJA 4CICA 3FXKA 2RAEA 4BE0A 2JWTA 1B9NA 1IV8A 3LSRA 2VPLA 4M3BA 1K4TA 4I99C 3L2VA 3H3UA 4YFKF 2AS5F 3R0JA 2HOTA 4ITVA 2D1HA 1LFUP 5DCMB 2EIKH 2K7LA 1JGGA 1MMNA 2F4IA 4LG0A 1IRZA 2ETHA 2QSGX 2DMPA 4HNUA 1UELB 1G3TA 2M45A 1FLIA 2Z9OA 2E5ZA 4NUBA 2QQ9A 4WF2A 1VQOI 3BQYA 4UUSA 4W97A 1VI0A 1SFUA 1WWXA 1JKOC 1MDMA 2ZMEA 3AKZA 2EA4A 4Q4ZF 1HLVA 3BWGA 1S5LC 4DOZA 4OOIA 1YTYA 2V6EA 2EZIA 1X2MA 2K4BA 2R7WA 1JUMA 2M4GA 1HKSA 5K7FA 1KU3A 1TQPA 1TWCJ 3GLLA 2JA2A 3DBHB 2XHKA 2WAEA 2W1OA 1TQMA 1MBJA 1JE8A 4ANJA 5FLXK 4M71A 2YPRA 4PK4A 1UMQA 3KP2A 5CVIA 5AIPA 5LRRA 1B6AA 2KLOA 4UVCA 5HDKA 2KDZA 4AM3A 3HXLA 4MTEA 3M4OJ 1TC3C 3GWZA 2NOGA 4EATA 4XN3A 3H5AA 3M07A 1YRNB 1N75A 4HQMA 5IYBJ 2MSYA 5LHGA 1D1CA 2R7DA 4GO1A 5B3SH 1XTAA 4IXAA 4F55A 3K4CA 1Z3YA 2HWVA 3HJEA 2IS1A 2YR2A 1MJ9A 2VL8A 1L0OC 2Q2EB 1SVMA 1J09A 1HDPA 1JUPA 2NYXA 5DV5A 2V1NA 1GDTA 4U7BA 4UB6C 3T5XA 1D1BA 5LFAA 3P9KA 1U5TA 5LHHA 3HSFA 2DA6A 1IZ1A 4B3AA 2LTPA 2LY9A 3VDXA 2VUMJ 2BY3A 1IW7F 4IHWA 3LFKA 3CZ6A 2N8GA 2VODA 1VQ8I 2PFBA 3I59B 1TNSA 1FBSA 3S1QJ 4Q5SF 1K4SA 2X1CA 2Z2SB 5L3DA 2OD5A 4N4OB 1FOYA 2F5EA 2KISA 2HDDA 1IN8A 3DEEA 5DUKA 1OR7C 2JN6A 3CCYA 5IP9J 4A3JJ 4XQFA 1YOVB 1ZGJA 2LREA 2OA4A 2TDXA 2PQ8A 2Z3YA 1GXQA 4CZZA 1OCRH 2DQRA 1K6YA 2Z99A 3I58A 1E3HA 1PJRA 2E60A 3TP3A 2VBYA 2IXSA 4GYGA 1WJEA 1RKWA 3OY9A 3ABKH 1G4DA 1Y0UA 2XPVA 3DTKA 4M74A 4QIWN 1UHMA 5LRSA 5FLXZ 2F4MB 2P5KA 3ESWB 3PNTA 2VN2A 2WAFA 1YW8A 3VYUB 1D0XA 2JK3A 1FMVA 3DLLF 1KU9A 1ZLKA 2MD5A 1J7KA 2E35A 4HQEA 3KYLA 4EJTA 4I0AA 4WXDA 4XBFA 5AIQA 1AHDP 3J7AO 1R1TA 3S8PA 3LAJA 3BTIA 3ECOA 3S93A 3CC4I 3S15J 1O3RA 2QKMB 1PP8F 3F3XA 3HSRA 4A5MA 5K1YA 3U1KA 1LE8A 2IGOA 3KCCA 3C3WA 4UV8A 1E3OC 3F0CA 1W7PB 2L3DA 4F93B 4N9IA 2ID6A 1IN7A 2DODA 2QUFA 4LB6B 1KU2A 1NTCA 3U1DA 2RC4A 3H9QA 2DN0A 4PJLA 5ICCA 1APLC 4FT8A 1A5JA 1Z0XA 3EUAA 4CCLA 2CO5A 5HOOA 1ZTRA 2XPWA 2JPCA 4IOCF 1K7AA 1FP2A 3HKZN 2M5WA 1BBYA 3TO6A 3I5UA 1SD5A 3L2QA 5GAHJ 5C3EJ 3TOBA 5HLIA 3BCBA 5L3CA 2HQRA 3LA7A 4A0ZA 5BOXA 2IW5A 4MEYF 2BEOA 2D45A 4Y7NJ 2EFPA 5K5OA 4YRVA 1S29A 1OYWA 3QPSA 1GT0C 5EEAA 5DTDA 5GTHC 2DA1A 4A3GJ 2CQKA 1ZLJA 3EUHA 2E7XA 2LMDA 3H36A 2LFBA 5J8CA 4F92B 3HOYJ 3NAUA 2M2EA 4BY1J 1A04A 2QM3A 5FGMA 6PAXA 5KAIC 5FJ8J 1R1VA 2H09A 5C4JJ 1BC7C 2KPMA 2Z5UA 4PUSA 5LGUA 3HDDA 2VT3A 3RYRA 4JOMA 3CCMI 1GV2A 1FT9A 2DMQA 1MJBA 3AAFA 2DPUA 1MMSA 3CUQB 2M8EA 2HNHA 3DPUA 1D5YA 4KNYA 2R7XA 2XRNA 2WY8Q 2UXNA 5IT3A 3DKYA 1IV6A 3RCOA 4HEA2 2PLYA 5GTIC 4IQJA 5F08A 1S7EA 4X1EA 2ESHA 1XDSA 4XLNF 1U9OA 4JX6A 2JMWA 3JRFA 3COAC 3CCQI 4KYWA 1QA6A 3SZGA 3OWTA 2CS3A 4L9TA 3V7CA 1Z67A 3BJAA 1F43A 2E2JJ 2MYSA 1ACIA 3M8EA 4A3EJ 4EMSA 3L1PA 4D0PA 5FD6A 1GUUA 3R0AA 4XK4A 3WTXC 3FKJA 3IUOA 2BVLA 4HX8A 4EV0A 4AD9A 1JKPC 3KP3A 5JVGF 2G9WA 2MW8A 2EFOA 5ED4A 3RZDJ 3EYIA 1PVEA 3E6BA 4Q48A 3UKGA 2EH3A 3KZIC 1ENHA 3J81Z 1LDJA 2K85A 4LMYA 5D5WB 1IDZA 3QU3A 2H8WA 2Y0SA 2ZNYA 2L2OA 2GA2A 2ELHA 2VXZA 2ZJQF 5F0CA 1YJ9I 5CVVA 5K7ZA 3U21A 2YUSA 1W7PD 2PX9A 1WPKA 3JAMK 5A2QZ 3OIOA 1WJ5A 1X3UA 2LBFB 2L7ZA 3GFLA 3ZN1A 4ZH4F 5DM6F 3FXQA 2LF8A 1PUFB 4PJMA 2CW7A 3IV5A 1FBUA 2CV1A 5FO5A 1RI7A 4A3KJ 3S2DJ 3FKIJ 4MO7A 3CCRI 4BXXJ 1ZRFA 4NDLA 2PJRB 2XB0X 1VQNI 1D0ZA 4XL9A 4ON0A 5HDNA 2VQHA 3S1NJ 1E17A 4R79A 3EYYA 1ERDA 3GW2A 4M6XA 1ZAOA 1S9HA 3WHBA 5CVUA 3OOPA 4Z2YA 4A0YA 4FETA 2K9SA 2W00A 1RZ4A 2O6GE 2GIZA 4G12A 1KONA 4DZPA 4DW6A 3Q3SA 2VOOA 2UWMA 3J7AY 4EJWA 4MQVA 3I9V2 4FX0A 3IH4A 4PFOA 1VF9A 2M9HA 2L9SA 4U7DA 2MLGA 4EM1A 1SVOA 4V19K 2CUJA 2HI3A 5CYVA 4WWCA 4BE1A 1LJ9A 2NXNB 3RPUD 4RB3C 1XSDA 4YIRX 1OLTA 4IHYA 2DT6A 3A02A 3HYIA 5JHUA 2WB1A 4WXHA 2B63J 1NHAA 2XROA 4FTHA 2X48A 5ICEA 4ZDLA 1G3YA 3J7ZI 1R36A 3L7WA 4IF4A 2W82A 5C4XJ 4I6ZA 4RA2A 1W1WE 5D6FA 1PUEE 1ZREA 3FBIB 2ZSHB 2CWEA 2RNJA 2V9VA 2X6XA 3FXUA 5AONA 1EH8A 1X58A 4BBRJ 1VQMI 3CC7I 5KCMA 1IO2A 5ILSA 2GOMA 1U3EM 2LY2A 1R4NB 3JRHA 1M1EB 2ZFWA 3MZYA 2H1KA 3NARA 1OQYA 3FXMA 2KMUA 3S3OA 1EH6A 2QA4I 1AOYA 3OIPA 2QYOA 3FMRA 2IS6A 1E3PA 3B6AA 1QVTA 1RKTA 3V7RA 4M6YA 2YU9J 1Z91A 3BR5A 5K7HA 2EILH 2EA2A 3C2BA 4C3HJ 1WJDA 3K70D 3WG9A 1B72B 2D5VA 1FTZA 1V4RA 1YIOA 4F7ZA 2ESNA 2VJ4A 3MKYB 1FP1D 2IGNA 4MEXF 3ISPA 2P7VB 3CUQC 5TISC 4LG3A 2OQGA 2XSDC 1HKTA 4A2UA 2E1CA 4FASD 2WAQN 1AWCA 3MCZA 3TOAA 1N78A 1ETYA 4U87A 4L9VA 3V4GA 2V7FA 3SDGA 1LDKB 4I7HA 1R58A 4M3EA 2CQQA 2BBYA 2XAQA 3N4MA 2HQ5A 3DCFA 4BEHA 3GZ6A 3G1OA 1T0FC 5D4RA 2RVCA 2O5RA 3D1NI 2QEXI 3S1RJ 5M5WJ 3W6VA 2IRFG 3H0DA 4RMNA 2R0QC 4PSXA 3OYHA 3A1YA 1Z7LA 2EK5A 1J59A 1CQTA 2K3PA 2Q0OA 4LITA 4NQWB 4A3LJ 3JRCA 1QZEA 3I4MJ 3HUGA 3MEXA 1YS7A 4HDVA 3K70C 1Y8RB 4KT6A 5EZHA 2A05A 3IH2A 4UVBA 4S0HB 1T2KA 4H0EA 1UAAA 3OSGA 2Y31A 3FXOA 4K2EA 4CYDA 5DUIA 1IAWA 2R7VA 1MNDA 1DDNA 3OYBA 2PEXA 2EB7A 1P2FA 2FQ4A 3DLAA 2VKVA 1DP7P 2ZMEC 1JJ8C 2DFFA 1ZHFA 4ETSA 3A0BC 3T1BA 2X0LA 2HYGD 5IT9Z 3E1SA 4A3IJ 3PFYA 4XSZF 4HG2A 3PNVA 2A07F 2VJ5A 1HXDA 4O6JA 1T6SA 5IPAA 4G94A 4LK1F 4EJVA 3OS0A 4YEJA 1F4KA 3R4KA 4XKCA 3SJMA 4OINF 3SFIA 1VFCA 4WCGA 4OIOF 2OQRA 1U0JA 4HYEA 4KDPA 2KDOA 1V5EA 3MZHA 3BR6A 3CJQB 3CLOA 3JTGA 1N77A 3PIOF 2I10A 3PM1A 3ZMSA 3NWSA 4MQ9F 4ZYAA 3BR2A 4RM3A 2HU9A 5ILUA 4JBAA 2HKOA 4YG2F 1P4WA 1AKHA 2NRAC 3J7YJ 1SD6A 1UZCA 2G0EA 3ZQQA 3HG9A 2DJNA 2YX7A 5KAFC 2MC3A 1SC7A 2ZFUA 1TW3A 3CJNA 4WXCA 3D5RC 4Y33A 1BIBA 3N05A 2ZXIA 1TWHJ 2M7BA 1OPCA 2YX4A 4FE4A 2JT1A 4GFBA 1WH5A 1B4AA 5IY5H 4RB1A 1U8RA 2DOFA 3ZMUA 1JT6A 4D9JA 2PMHA 1ZK8A 3GLXA 3O8GA 2EWNA 1HQCA 4S04A 4MTDA 1QZZA 2IT0A 3OL4A 4FHTA 1I5ZA 3G71I 1VQ6I 2J5OA 4C2MJ 5BPDA 2CV2A 2O8KA 3H5RA 3GXOA 2HFHA 4LGWA 5EDNA 1B8IA 1WZ2A 4HLXA 2HEOA 2HYJA 4HA8A 1SD4A 1XD7A 1XDUA 2NS7A 2DA3A 1MJAA 2K3FA 3K9TA 4DZJA 2K9LA 4FX4A 1O3SA 4F91B 2H6CA 4XRSG 3V42A 4ZYHA 2OTLI 1ON1A 2K27A 2V1UA 2NVTJ 2KL4A 2Y9ZA 2GWRA 5KK1A 3S16J 4ABZA 3S3NA 3DEUA 3WTZA 5M5XJ 2FE3A 3CCUI 1OISA 4HX4A 1S7AA 4L9JA 5ERIA 1WCMJ 3P9IA 5EJCA 3OL3A 3K4KA 1Y1WJ 5DD4A 3BQZA 3X2QH 2OBPA 3LOCA 4YFNF 4JP0A 4DYQA 1RIOH 4C2TA 2QVOA 4I01A 3CMEI 1Z05A 3BY6A 1LVKA 1OCPA 4XORA 4BE2A 1W5TA 2JVHA 3BTCA 1K78A 1MMGA 1K79A 3GZ5A 2ECBA 3F8BA 2JUGA 1IG7A 2IGMA 1DU0A 3FMSA 2LYCA 3BTJA 2HXIA 2AXLA 2ID3A 2X6YA 5LLQA 3VOEA 4M9XA 1ZN2A 1VTNC 4Y52J 2DK8A 3V8JA 4KMUX 1U78A 5EGOA 3ABLH 4A3CJ 1FEXA 3K10A 1DGWY 3MVPA 4LD5A 2DQLA 3K4MA 3MAJA 4XN0A 5CQEA 2YU3A 2RNGA 3CF2A 1IN4A 5F1JA 3DKXA 2VQGA 4C2UA 1XMKA 4CHUA 3V8KA 1ORKA 1W0TA 4YFXF 3DU5A 2IVMA 3ULQB 3E6MA 1NH3A 2R7ZJ 2R7RA 1U6GA 1JHFA 2VOPA 2E5NA 1KGSA 3PJRA 3OYJA 1P4XA 3LSMA 3WTYC 5CKTA 5FKLA 3K69A 4A6DA 5F0FA 1SFOJ 3GFIA 2KHMA 5DM7F 1Y8QB 2R7OA 4FISA 1MH3A 2L54A 4F52A 3TO9A 3WTSC 3PO3J 1RRJA 3VYRB 1LPQA 2QBYA 3K1PA 2MH9A 1Z6TA 2ELJA 2NAZA 3MKLA 4BACA 2OF7A 4ZTFA 2X1DA 1LQ1A 3LL7A 2M87A 3RIRA 1NG6A 2W48A 3HHGA 4KITB 3MKWB 3IKTA 3DTIA 1J2XA 1DQUA 3CF5F 2VLAA 2R5YA 5D6EA 3HGGA 2RDPA 5E1WA 3IRRA 1P7IA 1VQ7I 1YX3A 2BGCA 2FA5A 5LHIA 4A12A 1X1PA 2JJ7A 1J9IA 3I53A 1CGPA 2FNAA 1XMXA 3FISA 5IOZA 3OYEA 2XAUA 2Y30A 1I39A 4MIMA 1B9MA 1XC5A 1ZELA 2M0CA 2O9LA 2E1MC 3OR2C 5L3EA 2PN6A 2WWYA 2R93J 1ETWA 4PGGA 4LB5A 4QSHA 3OYFA 2LKSA 1VQ5I 4G9YA 1YJNI 3SYTA 2XAFA 3OYAA 3PUFA 2COBA 2DYSH 4BEHB 3WGGA 5HS8A 2X51A 4CYCB 3JW4A 2ISYA 1DPUA 3QOEA 3I4PA 4L0ZB 1E0EA 2LC2A 1ZRCA 2ADUA 4IHVA 2VJIA 3A2KA 4PJJA 3REOA 1BOAA 3WU1B 5LD2C 1HA8A 2CMPA 4DYRA 3ZMTA 3F8FA 4RS8A 3VEPA 2RREA 3HOSA 2F2EA 1ZARA 3HUGB 3KP6A 1XN7A 3PNYA 5KNLA 3I54A 2RN7A 3WU2C 2VBWA 4Y17A 5D5VB 2MA3A 1WJFA 2V79A 1P4AA 4EEFG 2EBIA 1ZKGA 5FROA 4HW0A 1IJWC 3D5LA 4L18B 2NVQJ 2EZKA 4P5OA 4QTRA 1A35A 4JX5A 2NOJB 4Y13A 5LEKA 1MKMA 1BI2A 5C44J 1CF7A 2OUMA 3BZ6A 2LY1A 2ME6A 2LLKA 1TWFJ 2A69F 1YW9A 1A36A 4AYBN 3BP8A 1QPMA 3PUBA 2STWA 3WHCA 4KUMA 4O5VA 2HOSA 1HW1A 1BR4A 5HDGA 3IHUA 4M3GA 4XOTA 3U2RA 3NQOA 3ASOH 1OYIA 3QPHA 1P92A 3CD6I 3Q0WA 4B8XA 4BBSJ 2HR3A 1XGMA 2H1LA 1I3QJ 4RM2A 1LFPA 1Y56A 2Y2ZA 4NC6A 4EM2A 1LFBA 1Y1VJ 2BVMA 2LSOA 2QKLB 4QLCU 3OYMA 1YIJI 1HCRA 1UHSA 4XM3A 3CDIA 3QYFA 1SANA 1FYLA 2CJJA 3R60A 2E1OA 2FU4A 3EPZA 1OJLA 1SFEA 2EQRA 4M72A 4YELA 2HYFA 3ZMDA 3ZQCA 2AQEA 1ZR4A 1JI8A 3U9GA 3MD2A 4HBLA 1R1UA 2RV8A 2UV1A 3WTWC 5ICGA 2FNPA 3TW6A 1AKHB 4D1QA 2XPUA 1FIAA 1BW6A 1X4OA 3AG2H 3QOPA 3V8LA 4E7JA 2EZLA 2HXOA 1SFXA 2DOAA 4H4KC 3CMMA 5BS6A 4CH7A 3NWTA 2EZHA 2P6TA 2DMTA 3J80K 4ZC3A 3ZR8X 1KZHA 4HLYA 3F21A 3H5NA 4ESFA 4KMFA 1X1DA 3JRGA 2NS8A 1QRYA 3SEQA 1SMYF 1ITYA 2BXZA 2JRTA 2PI0A 1T56A 4BDZA 2IS2A 3KP5A 4Z6YA 4DIQA 4CCKA 4B48A 1MNEA 3HRUA 4LK0F 2K86A 3HPHA 2HPIA 1O57A 1HF0A 1ZH5A 5D4SA 3PSIA 2CQ7A 1QZYA 2DTZA 4ASNA 4CDGA 2PMZA 2NS0A 3BG7A 1Z1DA 4N9HA 2OCCH 4CZCA 1X19A 1TQIA 3LFUA 2DPDA 2RKHA 2VC0A 3BJ6A 3Q0UA 1ODDA 1W5SA 1KYZA 9ANTA 5DYMA 2HZTA 4CSWA 2MGQA 3CJRB 4CXFA 1W5CC 2M4KA 3EETA 3MMYB 2QGUA 2CFOA 2OU2A 4HF1A 3LNQA 3HTUA 3DF8A 4EGYA 3GBGA 1K6OA 2IA1A 5J47A 4UVAA 2ZO4A 3FF5A 3FX3A 3K4JA 4X0GA 3TDUC 5FRNA 3C18A 3RSNA 1YHQI 1FWZA 2R92J 1ZRDA 1JTXA 4M3DA 4XLHA 4DQ2A 5IYCJ 2I8DA 1K78B 2JZYA 2VC1A 1R7JA 1XX5A 1MW7A 1ZG1A 3FBNB 5E3OA 1XGOA 5IYDJ 4EVIA 4E7ZA 5HNHA 1D8JA 4IRIA 2QWWA 2MH2A 4A3FJ 1P7JA 3BR0A 5EGOB 2BE5F 3M7GA 1LEBA 3S32A 2MD0A 1KA8A 5D5XB 2M8GX 2IJLA 3KP7A 1XGSA 1HBXG 2QLZA 4KN4X 4DNCA 1EJ9A 1LEAA 3ZOBA 2XV4S 4BU2A 1G8XA 2K9MA 2HVQA 4NBQA 4LG0B 5F1RA 4B47A 1P6RA 3CCVI 4FCYA 4UUSB 3H9JA 1MDMB 3DBRB 1S8NA 4KFCA 2ZMEB 3O3KA 3IWZA 2LRDA 3TL4X 3OV8A 4RLQA 5CQGA 4DYCA 3IWFA 2XIGA 1JHHA 4P9FA 3HOZJ 1OFCX 3LMMA 3PQJA 3MFKA 1ETQA 3OYIA 2DMUA 3C2HA 2FBIA 2QQ8A 2W25A 4ZYEA 3HTSB 2Y48A 1QPIA 4RGXA 2X6OA 4I76A 1L3LA 2XGEA 1ETVA 4GGGA 3A03A 3CQZJ 1VNDA 4XRSA 1V54H 2R5ZA 1JT0A 2HKXA 2H94A 4E7LA 4RAGA 3HL2A 3H92A 1ZGWA 2QCOA 2R7FA 5JR3A 5HODA 4ENJA 2CV0A 2P0WA 2BY1A 3KYDB 1R71A 3QP5A 2CYYA 3LAPA 3F6OA 4BQOA 1U2WA 4G7HF 3JCUC 2H6BA 2E2IJ 4AIDA 4B43A 3TP0A 3WTUC 3ZPLA 3LQRA 4IRGA 3HGYA 1PDNC 3ELKA 4DBQA 1STZA 3HPGA 1EF4A 4C3JJ 1U5TB 2GXGA 2GOXB 2GZWA 1FSHA 1ZGAA 4L5EA 2OC6A 3H3VK 3I4NJ 5FLVA 1MH4A 3EUKL 3RJPA 4PJNA 2UZKA 1HW2A 3TDZC 1FX7A 4OU0A 3OS1A 3RZOJ 1X2NA 2XGDA 3HM5A 3WU0A 1I6HJ 3F22A 3M1CA 3F72A 2EFQA 4OMYA 1T95A 1R5ID 3D0SA 2E34A 4RB0A 1R49A 1IRFA 1VQ9I 3ZP5A 4XRFA 1R4MB 4LOCA 5BNGA 1CF7B 2COMA 3L2CA 3HOVJ 2P7CB 1V3FA 3R6SA 1U8BA 3W6JB 1ZYRF 2VXDA 5BQTA 3M9AA 3BPVA 4PFPA 4XONA 1BJAA 2OZ6A 2VQLA 4HDUA 4XKVA 4CA0A 1V5GA 2L7FP 5M5YJ 1BI1A 4ZYGA 2HQNA 3JAMZ 2BZTA 2OV7A 3MN2A 3QYEA 1UFMA 4J00A 1F9NA 2FX0A 2AXTC 2F6CA 1YLFA 1KYWA 2DA4A 3DFGA 4G6QA 3PL8A 1WQ2A 1GHCA 4G7OF
chains in the Genus database with same CATH topology
3FIWA 4C2MJ 3JR9A 1BA5A 4M6VA 2O8KA 1HDPA 1JUPA 5EDNA 1B8IA 1FTTA 2TCTA 2HYJA 1GDTA 2JA5J 4W1UA 4A3MJ 2NS7A 2DA3A 4DZJA 3GTMJ 2DA6A 1JTYA 4B3AA 2LTPA 2LY9A 5EG0A 2VUMJ 4XRSG 4BY7J 3OSFA 4IHWA 2N8GA 1LE8B 3M3YJ 5FLMJ 2YS9A 2NVTJ 2Y9ZA 3S16J 4ABZA 3BR1A 3S1QJ 1A6IA 5M5XJ 4V2GA 1MBEA 3ZQLA 1MBHA 2HDDA 3CMYA 1JJ6C 1WCMJ 2DMNA 2JN6A 3CCYA 5IP9J 1Y1WJ 4C3IJ 4A3JJ 3BQZA 3G1LA 3LOCA 4JP0A 4DYQA 4IEJA 1OCPA 1UG2A 3TP3A 1YRNA 5E3MA 3BTCA 1RKWA 2R5YB 5GP9A 2DA5A 3TW7A 1WI3A 2XPVA 2ECBA 5IP7J 1IG7A 1DU0A 2LD5A 4UUTA 2M34A 4QIWN 3BTJA 2HXIA 2ID3A 3ZQFA 1H8AC 3GTPJ 3GTJJ 4Y52J 2LVSA 1U78A 2JA8J 5EZGA 5EGOA 4A3CJ 1FEXA 3MVPA 2JK3A 1HDDC 2Y9YA 1ETXA 3JREA 3ZQGA 5F1JA 1AHDP 3BTIA 1ORKA 3S15J 1W0TA 1RR7A 1LE8A 2R7ZJ 3G1MA 1E3OC 3F0CA 1U9NA 5FKLA 2K9QA 2P81A 2ID6A 1H88C 5F0FA 1SFOJ 1NTCA 2AHQA 2DN0A 1APLC 3LSJA 1A5JA 4FISA 1MH3A 3PO3J 1Z0XA 3DEWA 1ZTRA 2XPWA 3HKZN 3MKLA 5FKOA 5C3EJ 2OF7A 1WH7A 3IH3A 5F04A 4XRMA 3BTLA 2DA7A 2W48A 4JYKA 1FJLA 2Y0SN 4AC0A 3HOWJ 2R5YA 5FKMA 1G2HA 3HGGA 1P7IA 4Y7NJ 2NVXJ 1F36A 3QPSA 1GT0C 3LSGA 5EEAA 1T33A 3ZQIA 2JJ7A 1NK2P 1GVDA 5DTDA 3S14J 3CDLA 5EF6A 2E19A 3FISA 3GTLJ 5IOZA 2DA1A 4A3GJ 2Y30A 2WV1A 4MIMA 1XC5A 3O8HA 2L7MP 2M0CA 2O9LA 2JA6J 2LFBA 3HOYJ 4M3FA 2R93J 3NAUA 1ETWA 2M2EA 1ETKA 4BY1J 4QSHA 5FJ8J 5C4JJ 4V2FA 2COBA 4CYCB 3HDDA 1K61A 2ELKA 1GV2A 1BW5A 4IHVA 3GTGJ 2DMQA 2LKXA 1Q1VA 1HOMA 4DYRA 1K83J 1D5YA 2CQXA 4D7NA 2PMZN 1MBKA 3GTOJ 2FD5A 3BG9A 1IV6A 3Q0VA 4RBOA 3B6CA 3FK7A 5F08A 1GV5A 3A01A 1S7EA 4EEFG 2EBIA 1ZKGA 4X1EA 1U9OA 1IJWC 2NVQJ 3QQAA 2JMWA 4JX6A 2EZKA 3JRFA 4QTRA 4JX5A 2HOAA 2WB1N 5C44J 4D7MA 2ME6A 2LLKA 1TWFJ 1F43A 4AYBN 3WHCA 2E2JJ 2HOSA 1POGA 2GLOA 4A3EJ 4M3GA 1BJZA 3L1PA 1GUUA 3HBLA 4XK4A 1IGNA 1OCTC 1O4XA 3S2HJ 1JKPC 2MG4A 3Q0WA 4BBSJ 1MNMC 1I3QJ 3HEFA 2ECCA 1XS9A 2MW8A 2QF7A 3RZDJ 2Y2ZA 3UKGA 1LFBA 1Y1VJ 2EH3A 2LR8A 1ENHA 2AO9A 4CYCA 1HCRA 1UHSA 3K2AA 1SANA 1IDZA 1XG1A 2CJJA 2E1OA 3ZQCA 1MBFA 1OJLA 2EQRA 4A3BJ 3BR3A 5JLWA 1ZR4A 2IAIA 1MSFC 5F0CA 2VPRA 3TW6A 5K7ZA 1AKHB 2XPUA 3E7LA 2YUSA 2OPTA 1FIAA 4B1RA 4A93J 1BW6A 1WPKA 3OIOA 2EZLA 2HXOA 5DS9A 2XB5A 2L7ZA 2KT0A 2DA2A 5FKNA 1PUFB 3JRAA 2EZHA 3IV5A 2GBYA 2DMTA 4A3KJ 3S2DJ 3FKIJ 1MBGA 4MO7A 4BXXJ 4NDLA 2XB0X 1Z77A 4MFDA 3OOUA 3S1NJ 4FE7A 2X9DA 3JRGA 2NS8A 1QRYA 5J1UA 3GTKJ 1ITYA 3WHBA 1R9TJ 1T56A 5JLXA 2LP0A 2LK2A 2K9SA 4X6AJ 4G12A 2VKEA 4DZPA 4DW6A 1I50J 3Q3SA 3HB9A 1BL0A 1HF0A 1DU6A 2L0KA 1NK3P 3IH4A 3HOXJ 1VF9A 2DTZA 2O7OA 2M9HA 1H89C 2ME0A 2HI3A 3BT9A 3Q0UA 4D5FA 4IHYA 5EG0B 1QVUA 3BG3A 9ANTA 3A02A 2MGQA 2JA7J 2IBDA 2B63J 3GTQJ 4FTHA 2X48A 1TWAJ 5IOYA 1IC8A 1JUSA 3H0GJ 4XICA 3LNQA 4JX4A 4A69C 3GBGA 5C4XJ 5J1YA 1MSEC 2ZB9A 4I6ZA 2L9RA 1PUFA 1X58A 4BBRJ 4B4CA 2R92J 2CRGA 1JTXA 4M3DA 2GM4A 4RDUA 3JRHA 2XRLA 3HOUJ 5E3LA 3RQIA 5IYCJ 2H1KA 1IDYA 3NARA 5EYRA 3ZQHA 5J1RA 5GPCA 2IEKA 3B6AA 1QVTA 1RKTA 5M3MJ 2E2HJ 5E3OA 5IYDJ 2YU9J 2FJ1A 2TRTA 2R5ZB 3FK6A 3BR5A 2H8RA 4A3DJ 4A3FJ 1P7JA 3BR0A 5K7HA 4HNVA 5EGOB 3C2BA 4C3HJ 1B72B 2D5VA 5FKKA 1FTZA 1JKRC 1ZQ3P 2M8GX 3LSPA 5J3LA 1AU7A 2XSDC 3S1MJ 3ZOBA 4XIDA 2WAQN 1ETYA 4AUXA 3SDGA 4M3EA 2CQQA 4FCYA 2HQ5A 3DCFA 4UUSB 2CU7A 5M3FJ 3G1OA 3K7AJ 2K9NA 2XGCA 3D1NI 3S1RJ 5M5WJ 3W6VA 4DYCA 5F0HA 2R0QC 1RETA 5F27A 3VPRA 3HOZJ 1OFCX 1CQTA 1ETQA 4MFEA 4A3LJ 2DMUA 3JRCA 3JRIA 3I4MJ 1QPIA 3S17J 2X6OA 4I76A 5EZHA 2XGEA 1ETVA 1ZR2A 3A03A 3IH2A 4S0HB 3CQZJ 1VNDA 3PO2J 5E3NA 4XRSA 1JT0A 2R5ZA 3OSGA 2VI6A 2Y31A 3BG5A 3JRDA 3JRBA 1B72A 1ZGWA 2QCOA 2FQ4A 2VKVA 5HODA 1JJ8C 2RAEA 2JWTA 3LSRA 1RPWA 4M3BA 2HOTA 2E2IJ 4A3IJ 1LFUP 1JGGA 1IRZA 2NVYJ 3TP0A 1W0UA 2DMPA 1FIPA 3HGYA 5IPAA 1B8IB 1IUFA 4MLOA 5IP6A 3SJMA 3BQYA 2CUFA 4C3JJ 4UUSA 4W97A 1VI0A 3SFIA 1VFCA 1JKOC 1EF4A 3QPLA 4L5EA 3H3VK 4J19A 3I4NJ 5FLVA 1ETOA 1MH4A 1JKQC 1HLVA 3BR6A 2I10A 3PM1A 3RZOJ 1X2NA 2XGDA 2EZIA 2K40A 3HM5A 3BR2A 1I6HJ 1X2MA 3A01B 1JUMA 1AKHA 5K7FA 1TWGJ 1TWCJ 4IHXA 2G0EA 4LOCA 5BNGA 2CUEA 3TEDA 2DJNA 1MBJA 3HOVJ 1U8BA 1UMQA 1WGXA 2KDZA 1TWHJ 4FE4A 3M4OJ 1TC3C 3RKQA 2NOGA 4GFBA 1WH5A 1RESA 2L7FP 1YRNB 5M5YJ 5IYBJ 2MSYA 5GPAA 4D5CA 3MN2A 1JT6A 2FX0A 1ZK8A 3O8GA 2DA4A 4BKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIW A;  4C2M J;  3JR9 A;  1BA5 A;  4M6V A;  2O8K A;  1HDP A;  1JUP A;  5EDN A;  1B8I A;  1FTT A;  2TCT A;  2HYJ A;  1GDT A;  2JA5 J;  4W1U A;  4A3M J;  2NS7 A;  2DA3 A;  4DZJ A;  3GTM J;  2DA6 A;  1JTY A;  4B3A A;  2LTP A;  2LY9 A;  5EG0 A;  2VUM J;  4XRS G;  4BY7 J;  3OSF A;  4IHW A;  2N8G A;  1LE8 B;  3M3Y J;  5FLM J;  2YS9 A;  2NVT J;  2Y9Z A;  3S16 J;  4ABZ A;  3BR1 A;  3S1Q J;  1A6I A;  5M5X J;  4V2G A;  1MBE A;  3ZQL A;  1MBH A;  2HDD A;  3CMY A;  1JJ6 C;  1WCM J;  2DMN A;  2JN6 A;  3CCY A;  5IP9 J;  1Y1W J;  4C3I J;  4A3J J;  3BQZ A;  3G1L A;  3LOC A;  4JP0 A;  4DYQ A;  4IEJ A;  1OCP A;  1UG2 A;  3TP3 A;  1YRN A;  5E3M A;  3BTC A;  1RKW A;  2R5Y B;  5GP9 A;  2DA5 A;  3TW7 A;  1WI3 A;  2XPV A;  2ECB A;  5IP7 J;  1IG7 A;  1DU0 A;  2LD5 A;  4UUT A;  2M34 A;  4QIW N;  3BTJ A;  2HXI A;  2ID3 A;  3ZQF A;  1H8A C;  3GTP J;  3GTJ J;  4Y52 J;  2LVS A;  1U78 A;  2JA8 J;  5EZG A;  5EGO A;  4A3C J;  1FEX A;  3MVP A;  2JK3 A;  1HDD C;  2Y9Y A;  1ETX A;  3JRE A;  3ZQG A;  5F1J A;  1AHD P;  3BTI A;  1ORK A;  3S15 J;  1W0T A;  1RR7 A;  1LE8 A;  2R7Z J;  3G1M A;  1E3O C;  3F0C A;  1U9N A;  5FKL A;  2K9Q A;  2P81 A;  2ID6 A;  1H88 C;  5F0F A;  1SFO J;  1NTC A;  2AHQ A;  2DN0 A;  1APL C;  3LSJ A;  1A5J A;  4FIS A;  1MH3 A;  3PO3 J;  1Z0X A;  3DEW A;  1ZTR A;  2XPW A;  3HKZ N;  3MKL A;  5FKO A;  5C3E J;  2OF7 A;  1WH7 A;  3IH3 A;  5F04 A;  4XRM A;  3BTL A;  2DA7 A;  2W48 A;  4JYK A;  1FJL A;  2Y0S N;  4AC0 A;  3HOW J;  2R5Y A;  5FKM A;  1G2H A;  3HGG A;  1P7I A;  4Y7N J;  2NVX J;  1F36 A;  3QPS A;  1GT0 C;  3LSG A;  5EEA A;  1T33 A;  3ZQI A;  2JJ7 A;  1NK2 P;  1GVD A;  5DTD A;  3S14 J;  3CDL A;  5EF6 A;  2E19 A;  3FIS A;  3GTL J;  5IOZ A;  2DA1 A;  4A3G J;  2Y30 A;  2WV1 A;  4MIM A;  1XC5 A;  3O8H A;  2L7M P;  2M0C A;  2O9L A;  2JA6 J;  2LFB A;  3HOY J;  4M3F A;  2R93 J;  3NAU A;  1ETW A;  2M2E A;  1ETK A;  4BY1 J;  4QSH A;  5FJ8 J;  5C4J J;  4V2F A;  2COB A;  4CYC B;  3HDD A;  1K61 A;  2ELK A;  1GV2 A;  1BW5 A;  4IHV A;  3GTG J;  2DMQ A;  2LKX A;  1Q1V A;  1HOM A;  4DYR A;  1K83 J;  1D5Y A;  2CQX A;  4D7N A;  2PMZ N;  1MBK A;  3GTO J;  2FD5 A;  3BG9 A;  1IV6 A;  3Q0V A;  4RBO A;  3B6C A;  3FK7 A;  5F08 A;  1GV5 A;  3A01 A;  1S7E A;  4EEF G;  2EBI A;  1ZKG A;  4X1E A;  1U9O A;  1IJW C;  2NVQ J;  3QQA A;  2JMW A;  4JX6 A;  2EZK A;  3JRF A;  4QTR A;  4JX5 A;  2HOA A;  2WB1 N;  5C44 J;  4D7M A;  2ME6 A;  2LLK A;  1TWF J;  1F43 A;  4AYB N;  3WHC A;  2E2J J;  2HOS A;  1POG A;  2GLO A;  4A3E J;  4M3G A;  1BJZ A;  3L1P A;  1GUU A;  3HBL A;  4XK4 A;  1IGN A;  1OCT C;  1O4X A;  3S2H J;  1JKP C;  2MG4 A;  3Q0W A;  4BBS J;  1MNM C;  1I3Q J;  3HEF A;  2ECC A;  1XS9 A;  2MW8 A;  2QF7 A;  3RZD J;  2Y2Z A;  3UKG A;  1LFB A;  1Y1V J;  2EH3 A;  2LR8 A;  1ENH A;  2AO9 A;  4CYC A;  1HCR A;  1UHS A;  3K2A A;  1SAN A;  1IDZ A;  1XG1 A;  2CJJ A;  2E1O A;  3ZQC A;  1MBF A;  1OJL A;  2EQR A;  4A3B J;  3BR3 A;  5JLW A;  1ZR4 A;  2IAI A;  1MSF C;  5F0C A;  2VPR A;  3TW6 A;  5K7Z A;  1AKH B;  2XPU A;  3E7L A;  2YUS A;  2OPT A;  1FIA A;  4B1R A;  4A93 J;  1BW6 A;  1WPK A;  3OIO A;  2EZL A;  2HXO A;  5DS9 A;  2XB5 A;  2L7Z A;  2KT0 A;  2DA2 A;  5FKN A;  1PUF B;  3JRA A;  2EZH A;  3IV5 A;  2GBY A;  2DMT A;  4A3K J;  3S2D J;  3FKI J;  1MBG A;  4MO7 A;  4BXX J;  4NDL A;  2XB0 X;  1Z77 A;  4MFD A;  3OOU A;  3S1N J;  4FE7 A;  2X9D A;  3JRG A;  2NS8 A;  1QRY A;  5J1U A;  3GTK J;  1ITY A;  3WHB A;  1R9T J;  1T56 A;  5JLX A;  2LP0 A;  2LK2 A;  2K9S A;  4X6A J;  4G12 A;  2VKE A;  4DZP A;  4DW6 A;  1I50 J;  3Q3S A;  3HB9 A;  1BL0 A;  1HF0 A;  1DU6 A;  2L0K A;  1NK3 P;  3IH4 A;  3HOX J;  1VF9 A;  2DTZ A;  2O7O A;  2M9H A;  1H89 C;  2ME0 A;  2HI3 A;  3BT9 A;  3Q0U A;  4D5F A;  4IHY A;  5EG0 B;  1QVU A;  3BG3 A;  9ANT A;  3A02 A;  2MGQ A;  2JA7 J;  2IBD A;  2B63 J;  3GTQ J;  4FTH A;  2X48 A;  1TWA J;  5IOY A;  1IC8 A;  1JUS A;  3H0G J;  4XIC A;  3LNQ A;  4JX4 A;  4A69 C;  3GBG A;  5C4X J;  5J1Y A;  1MSE C;  2ZB9 A;  4I6Z A;  2L9R A;  1PUF A;  1X58 A;  4BBR J;  4B4C A;  2R92 J;  2CRG A;  1JTX A;  4M3D A;  2GM4 A;  4RDU A;  3JRH A;  2XRL A;  3HOU J;  5E3L A;  3RQI A;  5IYC J;  2H1K A;  1IDY A;  3NAR A;  5EYR A;  3ZQH A;  5J1R A;  5GPC A;  2IEK A;  3B6A A;  1QVT A;  1RKT A;  5M3M J;  2E2H J;  5E3O A;  5IYD J;  2YU9 J;  2FJ1 A;  2TRT A;  2R5Z B;  3FK6 A;  3BR5 A;  2H8R A;  4A3D J;  4A3F J;  1P7J A;  3BR0 A;  5K7H A;  4HNV A;  5EGO B;  3C2B A;  4C3H J;  1B72 B;  2D5V A;  5FKK A;  1FTZ A;  1JKR C;  1ZQ3 P;  2M8G X;  3LSP A;  5J3L A;  1AU7 A;  2XSD C;  3S1M J;  3ZOB A;  4XID A;  2WAQ N;  1ETY A;  4AUX A;  3SDG A;  4M3E A;  2CQQ A;  4FCY A;  2HQ5 A;  3DCF A;  4UUS B;  2CU7 A;  5M3F J;  3G1O A;  3K7A J;  2K9N A;  2XGC A;  3D1N I;  3S1R J;  5M5W J;  3W6V A;  4DYC A;  5F0H A;  2R0Q C;  1RET A;  5F27 A;  3VPR A;  3HOZ J;  1OFC X;  1CQT A;  1ETQ A;  4MFE A;  4A3L J;  2DMU A;  3JRC A;  3JRI A;  3I4M J;  1QPI A;  3S17 J;  2X6O A;  4I76 A;  5EZH A;  2XGE A;  1ETV A;  1ZR2 A;  3A03 A;  3IH2 A;  4S0H B;  3CQZ J;  1VND A;  3PO2 J;  5E3N A;  4XRS A;  1JT0 A;  2R5Z A;  3OSG A;  2VI6 A;  2Y31 A;  3BG5 A;  3JRD A;  3JRB A;  1B72 A;  1ZGW A;  2QCO A;  2FQ4 A;  2VKV A;  5HOD A;  1JJ8 C;  2RAE A;  2JWT A;  3LSR A;  1RPW A;  4M3B A;  2HOT A;  2E2I J;  4A3I J;  1LFU P;  1JGG A;  1IRZ A;  2NVY J;  3TP0 A;  1W0U A;  2DMP A;  1FIP A;  3HGY A;  5IPA A;  1B8I B;  1IUF A;  4MLO A;  5IP6 A;  3SJM A;  3BQY A;  2CUF A;  4C3J J;  4UUS A;  4W97 A;  1VI0 A;  3SFI A;  1VFC A;  1JKO C;  1EF4 A;  3QPL A;  4L5E A;  3H3V K;  4J19 A;  3I4N J;  5FLV A;  1ETO A;  1MH4 A;  1JKQ C;  1HLV A;  3BR6 A;  2I10 A;  3PM1 A;  3RZO J;  1X2N A;  2XGD A;  2EZI A;  2K40 A;  3HM5 A;  3BR2 A;  1I6H J;  1X2M A;  3A01 B;  1JUM A;  1AKH A;  5K7F A;  1TWG J;  1TWC J;  4IHX A;  2G0E A;  4LOC A;  5BNG A;  2CUE A;  3TED A;  2DJN A;  1MBJ A;  3HOV J;  1U8B A;  1UMQ A;  1WGX A;  2KDZ A;  1TWH J;  4FE4 A;  3M4O J;  1TC3 C;  3RKQ A;  2NOG A;  4GFB A;  1WH5 A;  1RES A;  2L7F P;  1YRN B;  5M5Y J;  5IYB J;  2MSY A;  5GPA A;  4D5C A;  3MN2 A;  1JT6 A;  2FX0 A;  1ZK8 A;  3O8G A;  2DA4 A;  4BKX A; 
#chains in the Genus database with same CATH topology
 3UNG C;  2PBI A;  4KA4 A;  4JQF A;  3IP4 B;  3BZK A;  5DCM A;  2HVR A;  3FIW A;  2XSJ C;  3JR9 A;  3Q9V A;  1LUJ B;  4M6V A;  4L5J A;  2XDV A;  3DQV C;  5JI6 A;  1H9G A;  2A6T A;  3AG1 H;  3C7J A;  3VYS B;  1FTT A;  2VBZ A;  4MNU A;  4RB2 C;  3LSK A;  4LIV A;  2JA5 J;  1FOX A;  2C6Y A;  1D5V A;  1A31 A;  1I27 A;  4A3M J;  3K6G A;  1MD0 A;  2A61 A;  2XAJ A;  2BYV E;  4GCV A;  3WTV C;  2L02 A;  3F8N A;  4II3 A;  3ABM H;  4A0X A;  1N25 A;  3OSF A;  2ZNZ A;  3F9K A;  1TNT A;  4XR6 A;  4PGH A;  3LA2 A;  3ONQ A;  1LE8 B;  4IHS A;  2ACJ A;  5FLM J;  2YS9 A;  3DU6 A;  2LKP A;  4F3Q A;  3GME A;  4NNJ A;  2F5C A;  4TV7 A;  3BR1 A;  1A6I A;  4V2G A;  2WV0 A;  3ZQL A;  1WJB A;  1MBH A;  2UXX A;  1QBJ A;  1J0R A;  3CMY A;  4AIJ A;  2DMN A;  4C30 A;  4E7S A;  5GAG J;  1LNW A;  2KQR A;  3IC7 A;  2DI3 A;  4S05 A;  4B44 A;  1YYV A;  2F5D A;  4IEJ A;  2W24 A;  1YRN A;  1G3S A;  1T08 B;  3DKW A;  5E3M A;  3QOD A;  5B1B H;  1YO5 C;  1XCB A;  3TW7 A;  4U0W A;  5IP7 J;  3EDP A;  2X85 A;  3FHN A;  3O6B B;  1LVA A;  5H20 A;  3FWE A;  1BR2 A;  2B7E A;  3ZQF A;  3GTP J;  3OYK A;  2Q2E A;  3FM5 A;  2ZCW A;  2LVS A;  2R7S A;  5EZG A;  3OS2 A;  1Z3X A;  1W36 C;  3AG3 H;  1KU7 A;  1S6L A;  2Z33 A;  1HDD C;  2FXA A;  2EIM H;  3JRE A;  2IS4 A;  3KP4 A;  5ICF A;  3MQ0 A;  2XKO A;  1GLN A;  3T8T A;  2R7T A;  4KIS A;  2VON A;  2V1D A;  2G7U A;  3O2P E;  3BLY A;  1RR7 A;  4CCJ A;  3P9C A;  2KIU A;  4NC8 A;  1W4M A;  4CGZ A;  2OCE A;  4BXF A;  3I59 A;  3SFZ A;  2O0Y A;  2O61 A;  4HF0 A;  2KJC A;  3BOQ A;  3KIO A;  3NRV A;  1UB9 A;  2GIV A;  3H1C A;  4HSR A;  2KRH A;  4BYY A;  2CW8 A;  2E1M B;  2QSH X;  3DEW A;  4BGD A;  4BQN A;  3BCA A;  3VSL A;  4QWQ A;  3AG4 H;  5K5R A;  5FKO A;  1OMI A;  3IH3 A;  1WH7 A;  2Q8K A;  5F04 A;  4C9Y A;  4XRM A;  3BTL A;  2DA7 A;  4JYK A;  4II2 A;  3ZMZ A;  4OIR F;  1FJL A;  2Y0S N;  4LLN A;  4AC0 A;  4DBR A;  5FKM A;  2ZJ2 A;  2W57 A;  4LLG F;  4P55 A;  3VOD A;  4BXU A;  2EV6 A;  1F36 A;  4U0V A;  4U0Y A;  1T33 A;  1NK2 P;  3S14 J;  5EF6 A;  5FFX A;  2E19 A;  2VE9 A;  3R61 A;  3GTL J;  5B1A H;  1U5T C;  3RTR A;  1YJW I;  2WV1 A;  1WSU A;  2F4O B;  3O8H A;  2JA6 J;  1FC3 A;  2EFN A;  2EIN H;  2UUZ A;  1TT0 A;  4ZJZ A;  2E7W A;  3JTH A;  1VZ0 A;  3CP2 A;  4BS9 A;  3GZN B;  4GXO A;  1USS A;  3HOT A;  1K61 A;  4N4N B;  1BW5 A;  2ZXJ A;  4G6D A;  2DFE A;  1W7P A;  3IRQ A;  2KJB A;  4PJ0 C;  2BOL A;  3CJT B;  1KQ0 A;  4G7Z F;  1K83 J;  2MFZ A;  4KN7 X;  2CQX A;  2PG4 A;  2K5C A;  3K4L A;  1YG2 A;  2DO7 A;  1MBK A;  3HC7 A;  3P7N A;  3BG9 A;  3L9F A;  5L3B A;  1Y0N A;  3KX2 A;  3Q0V A;  5E18 F;  4RBO A;  2OJE D;  3C2G A;  3E5X A;  3FK7 A;  3VYT B;  4BDY A;  4IHT A;  4IZZ A;  1S7O A;  3A01 A;  1GXP A;  1XPX A;  2IPQ X;  2LOO A;  5LGT A;  2BHY A;  1TW2 A;  2D1V A;  1WVR A;  5DCF A;  2WB1 N;  4HAM A;  4LJZ F;  4D7M A;  5ILV A;  4IKF A;  4HNT A;  2ZJP F;  1O7F A;  3OYL A;  1T98 A;  3VWB A;  5H6Q A;  4CUG A;  1FYK A;  1VQL I;  4OAY A;  1Q1H A;  1POG A;  2F5F A;  1JXS A;  3OR1 C;  5DDG A;  1IGN A;  5BMZ A;  1R23 A;  1T8I A;  2LG4 A;  2DYR H;  1I3A A;  2V4J C;  1O7L A;  1OCT C;  3S2H J;  1T39 A;  2KP6 A;  4NC7 A;  2JTV A;  3SHF A;  5H2F C;  1ZG5 A;  1MNM C;  1YE9 A;  2ECC A;  1KQ9 A;  2JSP A;  3FXR A;  4BHP A;  1XS9 A;  1C0W A;  3HRM A;  3RPU A;  4RAY A;  1QHG A;  1YFH A;  3HKZ A;  2DU9 A;  2NVU B;  4BJ5 C;  3G3Z A;  3ASN H;  3W6K B;  1QNT A;  1MBF A;  3I56 I;  1OKR A;  1X3Z B;  2M30 A;  3CUQ A;  3E97 A;  5JLW A;  4HF2 A;  1DP3 A;  4YII A;  3C1D A;  1MSF C;  4IOA F;  2LDU A;  4IL6 C;  3DP7 A;  2OPT A;  4B1R A;  4A93 J;  3CCJ I;  3FHZ A;  2OTJ I;  3P5J A;  1WRJ A;  2ZJR F;  3PQK A;  1QU3 A;  4M9Z A;  3KE2 A;  4E4H A;  2EV5 A;  2HTJ A;  4M9S A;  5JVT A;  3OYG A;  5FKN A;  4ESJ A;  2R4G A;  4RLF A;  2QQB A;  2XKP A;  2M3A A;  3JRA A;  2O8X A;  2GBY A;  1T38 A;  4UUV A;  3CLQ A;  1D8K A;  2XGX A;  3CUO A;  4AWX B;  1Z6R A;  2W84 A;  1T0F A;  2Y75 A;  3SEZ A;  1NG7 A;  2VB6 A;  2A6E F;  2X9D A;  5HNF A;  3LWF A;  4OAZ A;  3EUH C;  3ABU A;  1XSX A;  3W2A A;  3GTK J;  1R9T J;  3IAS 2;  1YW7 A;  3ZRG A;  3G73 A;  2HGC A;  2VKE A;  5GAD J;  2DOE A;  4L0Y B;  4XLC A;  2L0K A;  2RQP A;  1V55 H;  3HOX J;  3K4B A;  2O7O A;  4MHG A;  1H89 C;  2ME0 A;  2Q1Z B;  5HLT A;  1TL8 A;  1Y6I A;  3AFH A;  3I71 A;  2FRH A;  3GFM A;  3BT9 A;  2CH0 A;  1EH7 A;  4D5F A;  1SAX A;  3E5Q A;  2A5W A;  3I3L A;  3BG3 A;  2F5V A;  5E1X A;  1R22 A;  4EQQ A;  1FPQ A;  2IBD A;  2DK5 A;  3GTQ J;  1TWA J;  4PCQ A;  1IC8 A;  4XIC A;  3T0Y A;  4JX4 A;  4A69 C;  4ENM A;  3HIF A;  5J1Y A;  2LBF A;  1X1B A;  3RQ4 A;  2VT2 A;  1RUO A;  3CO6 C;  2H27 A;  1WI9 A;  2ZKZ A;  3OIQ A;  1PUF A;  1JGS A;  4PDK A;  5LBQ A;  4BJT A;  4E6K G;  1LB2 A;  4B4C A;  2CGP A;  2A3S A;  3OYD A;  2JSC A;  2P4W A;  3ZQ7 A;  2XRL A;  2DJI A;  3HOU J;  2PJR A;  3RQI A;  4OWR B;  1IDY A;  5EYR A;  1BIA A;  3ZQH A;  5CVJ A;  1E2X A;  1TP4 A;  4NB5 A;  2VBX A;  2XVC A;  3DPL C;  5JFR A;  1QO0 D;  3BPX A;  4LIU A;  2XF5 A;  4AVZ A;  2M1B A;  2YSR A;  2BHZ A;  2H8R A;  3E3V A;  1UST A;  4BNC A;  4LFU A;  5FKK A;  2EFW A;  1SVL A;  5EEG A;  3D5S C;  3F6V A;  2HDW A;  4QPO A;  5J3L A;  3V7S A;  1G3W A;  2DAO A;  5CPR B;  2BW3 A;  3WE2 A;  3S1M J;  3FXL A;  2JUC A;  4XID A;  1ON2 A;  1PP7 U;  3FDY A;  3TMO A;  5E8G A;  3L2R A;  1OYY A;  4B3X A;  2KFD A;  5FFZ A;  2MAB A;  4LLL A;  3CCS I;  1PYV A;  3KZZ A;  3W3C A;  2ZC2 A;  1IXC A;  1Z9C A;  2W4S A;  1HKQ A;  2WC2 A;  2XF6 A;  3S3M A;  4ZZL A;  4ZYD A;  2CU7 A;  3QP6 A;  2NNN A;  2P8T A;  3K7A J;  2Y69 H;  1YQA A;  2B0L A;  2K9N A;  3B73 A;  1IF1 A;  1SD7 A;  5GAE J;  3H3Z A;  4CO8 A;  2KZV A;  2XF7 A;  3OMY A;  5F0H A;  1BC8 C;  1RET A;  5F27 A;  2LF7 A;  4KIB A;  3ERE D;  3M1E A;  1KQ8 A;  2KKO A;  4MFE A;  2W7N A;  3WGI A;  3JRI A;  3KLN A;  3TQN A;  1ZR2 A;  5LGN A;  3PO2 J;  3RKX A;  5E3N A;  3GCM A;  2L9N A;  5HLH A;  1TZL A;  2VI6 A;  4O3M A;  3JRD A;  1UHW A;  4RAZ A;  3JRB A;  1B72 A;  4HZF A;  2K4J A;  3G6E I;  1H9T A;  2X1E A;  3IKV A;  1RPW A;  4P9U A;  4XMY A;  2DFH A;  5F6F A;  1DPR A;  5J40 A;  3H35 A;  3HSE A;  2DT5 A;  1Z21 A;  3QAH A;  3E5U A;  2PMU A;  1V5F A;  4I0B A;  3K1N A;  2XC7 A;  2NVY J;  5TRD A;  1W0U A;  1VQ4 I;  4CCO A;  2DXI A;  1FIP A;  1B8I B;  1IUF A;  4MLO A;  5IP6 A;  2Y0M A;  1WJA A;  1B59 A;  3VFZ A;  2CUF A;  2HVS A;  1TBX A;  1Z7U A;  3RDI A;  2L5Q A;  3QPL A;  4UXN A;  4XSX F;  3IL2 A;  3E6C C;  2J5P A;  4XOP A;  5LEJ A;  4J19 A;  1ETO A;  1JKQ C;  3L09 A;  2DDA A;  4ZZD A;  2WAD A;  2X6W A;  4ENK A;  4UNO A;  2K40 A;  3T8R A;  1IXR C;  3I64 A;  3HZJ A;  3A01 B;  1GVJ A;  3VSK A;  4NQW A;  1SFK A;  1TWG J;  4IHX A;  2MC4 A;  2FF4 A;  1SMT A;  2CUE A;  4E70 A;  3KLO A;  3TED A;  2OAZ A;  3J81 K;  2VJJ A;  2WAQ A;  3K2Z A;  1IN6 A;  4Q47 A;  1BOB A;  1WGX A;  4L5I A;  2O3F A;  4IQ4 A;  4RAF A;  5L3F A;  1J75 A;  1HW5 A;  4HOB A;  1UJ8 A;  1D3Y A;  2GA1 A;  2X4H A;  4G6T B;  3RKQ A;  2JQ7 A;  1RES A;  5TGT A;  1F5T A;  3BDD A;  2FML A;  3CDH A;  1R00 A;  2HQA A;  5GPA A;  4D5C A;  3G2B A;  1G59 A;  1RUN A;  3WE3 A;  3TBI A;  4JK1 X;  2JPB A;  4AU7 A;  1IRX A;  5A2Q K;  4BKX A;  3MKZ A;  5FD5 A;  2KZG A;  3N97 A;  3OYC A;  2BXY A;  3K0L A;  1BA5 A;  1MZB A;  3ZXS A;  3J80 Z;  3AL0 B;  2FSW A;  1X1A A;  2W85 A;  2TCT A;  1I1G A;  3RI4 A;  3DV8 A;  4Y3O A;  2VKD A;  2CSO A;  2HS5 A;  4W1U A;  2FUG 2;  3GTM J;  1SAU A;  4GRI A;  3NEU A;  5JHF A;  1O3Q A;  1JTY A;  3ABT A;  5EG0 A;  1BI0 A;  4BY7 J;  3ZMV A;  3ROU A;  1FNN A;  3M3Y J;  4XLF A;  3KET A;  2EJR A;  2XAH A;  2KRF A;  4Y15 A;  3H9G A;  3LSH A;  2E1N A;  4UV9 A;  4IVN A;  2IP2 A;  1MBE A;  3DWL E;  1F1Z A;  5F64 A;  1JJ6 C;  2L4A A;  3WGH A;  3K4N A;  4AIH A;  4WX9 A;  2WBM A;  4C3I J;  3BJO A;  3G1L A;  3FZV A;  3HRS A;  2QBY B;  3JSO A;  2PJP A;  3W2V A;  4BL0 B;  3A4C A;  1TT5 B;  2Z16 A;  2V9P A;  1IRG A;  4BJ6 C;  1UG2 A;  3MWM A;  2B9S A;  4ZTJ A;  2R5Y B;  2DT7 B;  5GP9 A;  2DA5 A;  1WI3 A;  2RQQ A;  3RPQ A;  5HS9 A;  2LD5 A;  4UUT A;  4RGS A;  3LA3 A;  4UY8 I;  2M34 A;  2V6C A;  1H8A C;  3GTJ J;  4R1H A;  4BHC A;  2JA8 J;  1OR7 A;  1XMA A;  5KVR A;  1R6R A;  1MGT A;  2M7A A;  1YS6 A;  3SQN A;  2IA0 A;  2LH9 A;  2Y9Y A;  1ETX A;  4KJZ A;  5BPI A;  3ZQG A;  1HST A;  4E7H A;  2JVG A;  1VQK I;  4A6E A;  3RKY A;  4I02 A;  4CCN A;  5KHD A;  1FOK A;  3I55 I;  2K02 A;  2FMY A;  3G1M A;  3BG6 A;  3DXJ F;  1D1A A;  1RR8 C;  1U9N A;  4RGR A;  1HSJ A;  2HPM A;  2CG4 A;  2K9Q A;  2P81 A;  5E8I A;  2GXA A;  1I1S A;  3M8F A;  1IUY A;  4P96 A;  5D8L B;  1H88 C;  3KEO A;  2AHQ A;  3PSF A;  2KIQ A;  3LSJ A;  5J6X A;  4I2O A;  2R7U A;  4DGW B;  4KT5 C;  1IN5 A;  3SZP A;  3QPT A;  4FQG A;  1S72 I;  1X3W B;  1X4P A;  2BY0 A;  2FBK A;  1QGP A;  4OIP F;  1TLH B;  2XAS A;  5K5Q A;  2KIM A;  4BUP A;  2D2W A;  3GF2 A;  1QHH D;  3HOW J;  1YX5 A;  1G2H A;  2CW0 F;  5FRM A;  2VQC A;  3ML6 A;  2NVX J;  1HC8 A;  4M73 A;  3KZY A;  3IAM 2;  3LSG A;  3CP8 A;  4YIF A;  2WA0 A;  4IX7 A;  3ZQI A;  3KEQ A;  5E17 F;  1GVD A;  5HVQ C;  2IGK A;  3PIP F;  1ULY A;  3CDL A;  2BW3 B;  2MLK A;  2L7M P;  2M0M A;  2BY2 A;  3RKW A;  2A6H F;  4M3F A;  3TGN A;  4ZDO A;  1ETK A;  3QRF F;  1DUX C;  2P6S A;  1YIT I;  1OCO H;  1UG0 A;  1YI2 I;  3DTE A;  1FYM A;  4V2F A;  3RYP A;  2L01 A;  3KFW X;  2ELK A;  3G4S I;  1WHU A;  2EV0 A;  3GTG J;  2LKX A;  2RGV A;  2CUZ A;  3QU6 A;  2KIF A;  1Q1V A;  4XKB A;  1XGN A;  1EV7 A;  3L2U A;  3VB2 A;  4HPQ A;  1HOM A;  4BQA A;  3E0J B;  4XNF A;  4BQQ A;  4U88 A;  4ENN A;  4D7N A;  2PMZ N;  3GTO J;  2FD5 A;  2A5Y B;  1VQP I;  1LDD A;  4EM0 B;  1XSV A;  1W36 D;  4WK8 F;  3SZT A;  3B6C A;  5IT9 K;  3L00 A;  5D5U B;  1GV5 A;  5D8K B;  2GXB A;  1S3J A;  2FBH A;  3QQA A;  5CLS A;  2HOA A;  1B1B A;  2DLL A;  1FZP B;  4EGZ A;  5B66 C;  1EA3 A;  3FMQ A;  5H6R A;  3AL0 C;  3CCL I;  3CMA I;  3DBL B;  1SEU A;  1H0M A;  1FY7 A;  5L3G A;  2R3S A;  3TO7 A;  3HHH A;  1D0Y A;  2GLO A;  4ZDP A;  1BJZ A;  3HBL A;  4XLA A;  5HLG A;  1O4X A;  2MG4 A;  2WTE A;  2Z1D A;  3HEF A;  4PSW A;  2QF7 A;  1EKE A;  4I09 A;  1BN5 A;  3CCE I;  4HRI A;  4EJO A;  2LR8 A;  2BV6 A;  2VAS A;  2AO9 A;  4CYC A;  3PFI A;  2HTS A;  1IXS B;  1LKX A;  2E71 A;  2VKH A;  3FM3 A;  4IJA A;  3K2A A;  2VE8 A;  1XG1 A;  3QYB A;  2OZU A;  2ZSI B;  4A3B J;  3BR3 A;  2GQQ A;  2IAI A;  3Q5F A;  1G6N A;  4QPQ A;  2VPR A;  3E7L A;  2NNY A;  2L9V A;  3CC2 I;  1FOW A;  4ESB A;  5DS9 A;  2ISZ A;  2F48 A;  2DCE A;  2XB5 A;  3F8M A;  4KIG A;  4R8H A;  1X1C A;  2KT0 A;  2DA2 A;  2HDC A;  2EPF A;  3UR3 C;  2ZBK A;  4KIF A;  1UCR A;  3BRO A;  2FQ3 A;  1MBG A;  1BM9 A;  3Q9S A;  1Z77 A;  5J4Y A;  3GVA A;  2CQN A;  4MFD A;  3OOU A;  5HS7 A;  4B09 A;  4BHB A;  4NHJ A;  4FE7 A;  2CFX A;  4HST A;  1FSE A;  5J1U A;  5J8F A;  3CTA A;  5CJ9 A;  5JLX A;  2LP0 A;  4EJU A;  2LK2 A;  2STT A;  1RNL A;  4X6A J;  2ICW G;  3GO5 A;  4XLP F;  1I50 J;  2O03 A;  4A5N A;  3HB9 A;  1XCV A;  1BL0 A;  5CVR A;  1DU6 A;  3B02 A;  4AIK A;  1NK3 P;  2QEN A;  1AA7 A;  2XAG A;  3F23 A;  1BI3 A;  3FXJ A;  3M8J A;  1WFX A;  3BC8 A;  3KYC B;  3CES A;  2G7H A;  4G8X A;  2V26 A;  2R7Q A;  5EG0 B;  1QVU A;  4BAY A;  2DTR A;  2JA7 J;  2LNB A;  3WTT C;  3GEZ A;  4P1W A;  3GUD A;  3WOD F;  4RGU A;  4IRH A;  1OCZ H;  3HRT A;  2A68 F;  5E20 A;  4AYB A;  5IOY A;  3JSP A;  4IPA A;  1JUS A;  3H0G J;  2MBF A;  2V9K A;  1FBQ A;  2HOE A;  4XLE A;  5TJJ A;  1MSE C;  2ZB9 A;  2HZD A;  2DDB A;  2L9R A;  1R5H A;  3GFJ A;  5DEQ A;  1Y39 A;  4Y4R A;  1MMA A;  3WG7 H;  4J01 A;  2CRG A;  1REP C;  2GM4 A;  1QQI A;  4RDU A;  2P5V A;  5E3L A;  2I5U A;  3TKY A;  5EEH A;  3MZ8 A;  2DFI A;  4BH9 A;  2IA2 A;  2QQA A;  4I98 B;  5J1R A;  5GPC A;  4CCM A;  2DBB A;  2IEK A;  5M3M J;  4E7I A;  2E2H J;  3E6D A;  1O3T A;  4MGR A;  3GX4 X;  2KRC A;  2FJ1 A;  2TRT A;  2V1X A;  3I0T A;  3BZC A;  3LST A;  2R5Z B;  3FK6 A;  3SXY A;  3DPT A;  2FOW A;  3OYN A;  4HV6 A;  3QWL A;  3L2W A;  4A3D J;  3KEY A;  4IO9 F;  1BR1 A;  1MIJ A;  4HNV A;  5E79 C;  2FOK A;  2ZXW H;  3ECH A;  1JKR C;  4OMZ A;  1ZQ3 P;  2EIJ H;  3S2W A;  5DD8 A;  3LSP A;  1I6X A;  4KIC A;  1ZG3 A;  1AU7 A;  2E36 A;  1WJC A;  2GAU A;  5J4V A;  1MMD A;  3ZGK A;  3KPH A;  2WY7 Q;  1TTY A;  4GDF A;  1A6Q A;  2QSF X;  4AVP A;  2ZXH A;  3EQL F;  4AUX A;  3A0H C;  5FB2 A;  2AQF A;  3LSI A;  1RC9 A;  2P5L C;  5M3F J;  4UB8 C;  1FMW A;  5E1Z B;  3ERM A;  4HV5 A;  2XGC A;  4L9N A;  3F8C A;  3K1M A;  2DW4 A;  4E7K A;  3CO7 C;  4OIQ F;  4XKW A;  1WKM A;  2FEZ A;  3W2W A;  1XB4 A;  3VPR A;  3ZCO A;  4HX7 A;  1R5G A;  2QZ8 A;  4DJA A;  3SDB A;  3S17 J;  5B5E C;  2XUB A;  2VIX A;  3ZN0 A;  1J5Y A;  2L7K A;  3GYH X;  2L4M A;  3LQQ A;  1OCC H;  1DGR M;  3BG5 A;  4UHT A;  1ONV A;  4N0B A;  1P9Q C;  2JRM A;  4GYI A;  4PZJ A;  4CIC A;  3FXK A;  2RAE A;  4BE0 A;  2JWT A;  1B9N A;  1IV8 A;  3LSR A;  2VPL A;  4M3B A;  1K4T A;  4I99 C;  3L2V A;  3H3U A;  4YFK F;  2AS5 F;  3R0J A;  2HOT A;  4ITV A;  2D1H A;  1LFU P;  5DCM B;  2EIK H;  2K7L A;  1JGG A;  1MMN A;  2F4I A;  4LG0 A;  1IRZ A;  2ETH A;  2QSG X;  2DMP A;  4HNU A;  1UEL B;  1G3T A;  2M45 A;  1FLI A;  2Z9O A;  2E5Z A;  4NUB A;  2QQ9 A;  4WF2 A;  1VQO I;  3BQY A;  4UUS A;  4W97 A;  1VI0 A;  1SFU A;  1WWX A;  1JKO C;  1MDM A;  2ZME A;  3AKZ A;  2EA4 A;  4Q4Z F;  1HLV A;  3BWG A;  1S5L C;  4DOZ A;  4OOI A;  1YTY A;  2V6E A;  2EZI A;  1X2M A;  2K4B A;  2R7W A;  1JUM A;  2M4G A;  1HKS A;  5K7F A;  1KU3 A;  1TQP A;  1TWC J;  3GLL A;  2JA2 A;  3DBH B;  2XHK A;  2WAE A;  2W1O A;  1TQM A;  1MBJ A;  1JE8 A;  4ANJ A;  5FLX K;  4M71 A;  2YPR A;  4PK4 A;  1UMQ A;  3KP2 A;  5CVI A;  5AIP A;  5LRR A;  1B6A A;  2KLO A;  4UVC A;  5HDK A;  2KDZ A;  4AM3 A;  3HXL A;  4MTE A;  3M4O J;  1TC3 C;  3GWZ A;  2NOG A;  4EAT A;  4XN3 A;  3H5A A;  3M07 A;  1YRN B;  1N75 A;  4HQM A;  5IYB J;  2MSY A;  5LHG A;  1D1C A;  2R7D A;  4GO1 A;  5B3S H;  1XTA A;  4IXA A;  4F55 A;  3K4C A;  1Z3Y A;  2HWV A;  3HJE A;  2IS1 A;  2YR2 A;  1MJ9 A;  2VL8 A;  1L0O C;  2Q2E B;  1SVM A;  1J09 A;  1HDP A;  1JUP A;  2NYX A;  5DV5 A;  2V1N A;  1GDT A;  4U7B A;  4UB6 C;  3T5X A;  1D1B A;  5LFA A;  3P9K A;  1U5T A;  5LHH A;  3HSF A;  2DA6 A;  1IZ1 A;  4B3A A;  2LTP A;  2LY9 A;  3VDX A;  2VUM J;  2BY3 A;  1IW7 F;  4IHW A;  3LFK A;  3CZ6 A;  2N8G A;  2VOD A;  1VQ8 I;  2PFB A;  3I59 B;  1TNS A;  1FBS A;  3S1Q J;  4Q5S F;  1K4S A;  2X1C A;  2Z2S B;  5L3D A;  2OD5 A;  4N4O B;  1FOY A;  2F5E A;  2KIS A;  2HDD A;  1IN8 A;  3DEE A;  5DUK A;  1OR7 C;  2JN6 A;  3CCY A;  5IP9 J;  4A3J J;  4XQF A;  1YOV B;  1ZGJ A;  2LRE A;  2OA4 A;  2TDX A;  2PQ8 A;  2Z3Y A;  1GXQ A;  4CZZ A;  1OCR H;  2DQR A;  1K6Y A;  2Z99 A;  3I58 A;  1E3H A;  1PJR A;  2E60 A;  3TP3 A;  2VBY A;  2IXS A;  4GYG A;  1WJE A;  1RKW A;  3OY9 A;  3ABK H;  1G4D A;  1Y0U A;  2XPV A;  3DTK A;  4M74 A;  4QIW N;  1UHM A;  5LRS A;  5FLX Z;  2F4M B;  2P5K A;  3ESW B;  3PNT A;  2VN2 A;  2WAF A;  1YW8 A;  3VYU B;  1D0X A;  2JK3 A;  1FMV A;  3DLL F;  1KU9 A;  1ZLK A;  2MD5 A;  1J7K A;  2E35 A;  4HQE A;  3KYL A;  4EJT A;  4I0A A;  4WXD A;  4XBF A;  5AIQ A;  1AHD P;  3J7A O;  1R1T A;  3S8P A;  3LAJ A;  3BTI A;  3ECO A;  3S93 A;  3CC4 I;  3S15 J;  1O3R A;  2QKM B;  1PP8 F;  3F3X A;  3HSR A;  4A5M A;  5K1Y A;  3U1K A;  1LE8 A;  2IGO A;  3KCC A;  3C3W A;  4UV8 A;  1E3O C;  3F0C A;  1W7P B;  2L3D A;  4F93 B;  4N9I A;  2ID6 A;  1IN7 A;  2DOD A;  2QUF A;  4LB6 B;  1KU2 A;  1NTC A;  3U1D A;  2RC4 A;  3H9Q A;  2DN0 A;  4PJL A;  5ICC A;  1APL C;  4FT8 A;  1A5J A;  1Z0X A;  3EUA A;  4CCL A;  2CO5 A;  5HOO A;  1ZTR A;  2XPW A;  2JPC A;  4IOC F;  1K7A A;  1FP2 A;  3HKZ N;  2M5W A;  1BBY A;  3TO6 A;  3I5U A;  1SD5 A;  3L2Q A;  5GAH J;  5C3E J;  3TOB A;  5HLI A;  3BCB A;  5L3C A;  2HQR A;  3LA7 A;  4A0Z A;  5BOX A;  2IW5 A;  4MEY F;  2BEO A;  2D45 A;  4Y7N J;  2EFP A;  5K5O A;  4YRV A;  1S29 A;  1OYW A;  3QPS A;  1GT0 C;  5EEA A;  5DTD A;  5GTH C;  2DA1 A;  4A3G J;  2CQK A;  1ZLJ A;  3EUH A;  2E7X A;  2LMD A;  3H36 A;  2LFB A;  5J8C A;  4F92 B;  3HOY J;  3NAU A;  2M2E A;  4BY1 J;  1A04 A;  2QM3 A;  5FGM A;  6PAX A;  5KAI C;  5FJ8 J;  1R1V A;  2H09 A;  5C4J J;  1BC7 C;  2KPM A;  2Z5U A;  4PUS A;  5LGU A;  3HDD A;  2VT3 A;  3RYR A;  4JOM A;  3CCM I;  1GV2 A;  1FT9 A;  2DMQ A;  1MJB A;  3AAF A;  2DPU A;  1MMS A;  3CUQ B;  2M8E A;  2HNH A;  3DPU A;  1D5Y A;  4KNY A;  2R7X A;  2XRN A;  2WY8 Q;  2UXN A;  5IT3 A;  3DKY A;  1IV6 A;  3RCO A;  4HEA 2;  2PLY A;  5GTI C;  4IQJ A;  5F08 A;  1S7E A;  4X1E A;  2ESH A;  1XDS A;  4XLN F;  1U9O A;  4JX6 A;  2JMW A;  3JRF A;  3COA C;  3CCQ I;  4KYW A;  1QA6 A;  3SZG A;  3OWT A;  2CS3 A;  4L9T A;  3V7C A;  1Z67 A;  3BJA A;  1F43 A;  2E2J J;  2MYS A;  1ACI A;  3M8E A;  4A3E J;  4EMS A;  3L1P A;  4D0P A;  5FD6 A;  1GUU A;  3R0A A;  4XK4 A;  3WTX C;  3FKJ A;  3IUO A;  2BVL A;  4HX8 A;  4EV0 A;  4AD9 A;  1JKP C;  3KP3 A;  5JVG F;  2G9W A;  2MW8 A;  2EFO A;  5ED4 A;  3RZD J;  3EYI A;  1PVE A;  3E6B A;  4Q48 A;  3UKG A;  2EH3 A;  3KZI C;  1ENH A;  3J81 Z;  1LDJ A;  2K85 A;  4LMY A;  5D5W B;  1IDZ A;  3QU3 A;  2H8W A;  2Y0S A;  2ZNY A;  2L2O A;  2GA2 A;  2ELH A;  2VXZ A;  2ZJQ F;  5F0C A;  1YJ9 I;  5CVV A;  5K7Z A;  3U21 A;  2YUS A;  1W7P D;  2PX9 A;  1WPK A;  3JAM K;  5A2Q Z;  3OIO A;  1WJ5 A;  1X3U A;  2LBF B;  2L7Z A;  3GFL A;  3ZN1 A;  4ZH4 F;  5DM6 F;  3FXQ A;  2LF8 A;  1PUF B;  4PJM A;  2CW7 A;  3IV5 A;  1FBU A;  2CV1 A;  5FO5 A;  1RI7 A;  4A3K J;  3S2D J;  3FKI J;  4MO7 A;  3CCR I;  4BXX J;  1ZRF A;  4NDL A;  2PJR B;  2XB0 X;  1VQN I;  1D0Z A;  4XL9 A;  4ON0 A;  5HDN A;  2VQH A;  3S1N J;  1E17 A;  4R79 A;  3EYY A;  1ERD A;  3GW2 A;  4M6X A;  1ZAO A;  1S9H A;  3WHB A;  5CVU A;  3OOP A;  4Z2Y A;  4A0Y A;  4FET A;  2K9S A;  2W00 A;  1RZ4 A;  2O6G E;  2GIZ A;  4G12 A;  1KON A;  4DZP A;  4DW6 A;  3Q3S A;  2VOO A;  2UWM A;  3J7A Y;  4EJW A;  4MQV A;  3I9V 2;  4FX0 A;  3IH4 A;  4PFO A;  1VF9 A;  2M9H A;  2L9S A;  4U7D A;  2MLG A;  4EM1 A;  1SVO A;  4V19 K;  2CUJ A;  2HI3 A;  5CYV A;  4WWC A;  4BE1 A;  1LJ9 A;  2NXN B;  3RPU D;  4RB3 C;  1XSD A;  4YIR X;  1OLT A;  4IHY A;  2DT6 A;  3A02 A;  3HYI A;  5JHU A;  2WB1 A;  4WXH A;  2B63 J;  1NHA A;  2XRO A;  4FTH A;  2X48 A;  5ICE A;  4ZDL A;  1G3Y A;  3J7Z I;  1R36 A;  3L7W A;  4IF4 A;  2W82 A;  5C4X J;  4I6Z A;  4RA2 A;  1W1W E;  5D6F A;  1PUE E;  1ZRE A;  3FBI B;  2ZSH B;  2CWE A;  2RNJ A;  2V9V A;  2X6X A;  3FXU A;  5AON A;  1EH8 A;  1X58 A;  4BBR J;  1VQM I;  3CC7 I;  5KCM A;  1IO2 A;  5ILS A;  2GOM A;  1U3E M;  2LY2 A;  1R4N B;  3JRH A;  1M1E B;  2ZFW A;  3MZY A;  2H1K A;  3NAR A;  1OQY A;  3FXM A;  2KMU A;  3S3O A;  1EH6 A;  2QA4 I;  1AOY A;  3OIP A;  2QYO A;  3FMR A;  2IS6 A;  1E3P A;  3B6A A;  1QVT A;  1RKT A;  3V7R A;  4M6Y A;  2YU9 J;  1Z91 A;  3BR5 A;  5K7H A;  2EIL H;  2EA2 A;  3C2B A;  4C3H J;  1WJD A;  3K70 D;  3WG9 A;  1B72 B;  2D5V A;  1FTZ A;  1V4R A;  1YIO A;  4F7Z A;  2ESN A;  2VJ4 A;  3MKY B;  1FP1 D;  2IGN A;  4MEX F;  3ISP A;  2P7V B;  3CUQ C;  5TIS C;  4LG3 A;  2OQG A;  2XSD C;  1HKT A;  4A2U A;  2E1C A;  4FAS D;  2WAQ N;  1AWC A;  3MCZ A;  3TOA A;  1N78 A;  1ETY A;  4U87 A;  4L9V A;  3V4G A;  2V7F A;  3SDG A;  1LDK B;  4I7H A;  1R58 A;  4M3E A;  2CQQ A;  2BBY A;  2XAQ A;  3N4M A;  2HQ5 A;  3DCF A;  4BEH A;  3GZ6 A;  3G1O A;  1T0F C;  5D4R A;  2RVC A;  2O5R A;  3D1N I;  2QEX I;  3S1R J;  5M5W J;  3W6V A;  2IRF G;  3H0D A;  4RMN A;  2R0Q C;  4PSX A;  3OYH A;  3A1Y A;  1Z7L A;  2EK5 A;  1J59 A;  1CQT A;  2K3P A;  2Q0O A;  4LIT A;  4NQW B;  4A3L J;  3JRC A;  1QZE A;  3I4M J;  3HUG A;  3MEX A;  1YS7 A;  4HDV A;  3K70 C;  1Y8R B;  4KT6 A;  5EZH A;  2A05 A;  3IH2 A;  4UVB A;  4S0H B;  1T2K A;  4H0E A;  1UAA A;  3OSG A;  2Y31 A;  3FXO A;  4K2E A;  4CYD A;  5DUI A;  1IAW A;  2R7V A;  1MND A;  1DDN A;  3OYB A;  2PEX A;  2EB7 A;  1P2F A;  2FQ4 A;  3DLA A;  2VKV A;  1DP7 P;  2ZME C;  1JJ8 C;  2DFF A;  1ZHF A;  4ETS A;  3A0B C;  3T1B A;  2X0L A;  2HYG D;  5IT9 Z;  3E1S A;  4A3I J;  3PFY A;  4XSZ F;  4HG2 A;  3PNV A;  2A07 F;  2VJ5 A;  1HXD A;  4O6J A;  1T6S A;  5IPA A;  4G94 A;  4LK1 F;  4EJV A;  3OS0 A;  4YEJ A;  1F4K A;  3R4K A;  4XKC A;  3SJM A;  4OIN F;  3SFI A;  1VFC A;  4WCG A;  4OIO F;  2OQR A;  1U0J A;  4HYE A;  4KDP A;  2KDO A;  1V5E A;  3MZH A;  3BR6 A;  3CJQ B;  3CLO A;  3JTG A;  1N77 A;  3PIO F;  2I10 A;  3PM1 A;  3ZMS A;  3NWS A;  4MQ9 F;  4ZYA A;  3BR2 A;  4RM3 A;  2HU9 A;  5ILU A;  4JBA A;  2HKO A;  4YG2 F;  1P4W A;  1AKH A;  2NRA C;  3J7Y J;  1SD6 A;  1UZC A;  2G0E A;  3ZQQ A;  3HG9 A;  2DJN A;  2YX7 A;  5KAF C;  2MC3 A;  1SC7 A;  2ZFU A;  1TW3 A;  3CJN A;  4WXC A;  3D5R C;  4Y33 A;  1BIB A;  3N05 A;  2ZXI A;  1TWH J;  2M7B A;  1OPC A;  2YX4 A;  4FE4 A;  2JT1 A;  4GFB A;  1WH5 A;  1B4A A;  5IY5 H;  4RB1 A;  1U8R A;  2DOF A;  3ZMU A;  1JT6 A;  4D9J A;  2PMH A;  1ZK8 A;  3GLX A;  3O8G A;  2EWN A;  1HQC A;  4S04 A;  4MTD A;  1QZZ A;  2IT0 A;  3OL4 A;  4FHT A;  1I5Z A;  3G71 I;  1VQ6 I;  2J5O A;  4C2M J;  5BPD A;  2CV2 A;  2O8K A;  3H5R A;  3GXO A;  2HFH A;  4LGW A;  5EDN A;  1B8I A;  1WZ2 A;  4HLX A;  2HEO A;  2HYJ A;  4HA8 A;  1SD4 A;  1XD7 A;  1XDU A;  2NS7 A;  2DA3 A;  1MJA A;  2K3F A;  3K9T A;  4DZJ A;  2K9L A;  4FX4 A;  1O3S A;  4F91 B;  2H6C A;  4XRS G;  3V42 A;  4ZYH A;  2OTL I;  1ON1 A;  2K27 A;  2V1U A;  2NVT J;  2KL4 A;  2Y9Z A;  2GWR A;  5KK1 A;  3S16 J;  4ABZ A;  3S3N A;  3DEU A;  3WTZ A;  5M5X J;  2FE3 A;  3CCU I;  1OIS A;  4HX4 A;  1S7A A;  4L9J A;  5ERI A;  1WCM J;  3P9I A;  5EJC A;  3OL3 A;  3K4K A;  1Y1W J;  5DD4 A;  3BQZ A;  3X2Q H;  2OBP A;  3LOC A;  4YFN F;  4JP0 A;  4DYQ A;  1RIO H;  4C2T A;  2QVO A;  4I01 A;  3CME I;  1Z05 A;  3BY6 A;  1LVK A;  1OCP A;  4XOR A;  4BE2 A;  1W5T A;  2JVH A;  3BTC A;  1K78 A;  1MMG A;  1K79 A;  3GZ5 A;  2ECB A;  3F8B A;  2JUG A;  1IG7 A;  2IGM A;  1DU0 A;  3FMS A;  2LYC A;  3BTJ A;  2HXI A;  2AXL A;  2ID3 A;  2X6Y A;  5LLQ A;  3VOE A;  4M9X A;  1ZN2 A;  1VTN C;  4Y52 J;  2DK8 A;  3V8J A;  4KMU X;  1U78 A;  5EGO A;  3ABL H;  4A3C J;  1FEX A;  3K10 A;  1DGW Y;  3MVP A;  4LD5 A;  2DQL A;  3K4M A;  3MAJ A;  4XN0 A;  5CQE A;  2YU3 A;  2RNG A;  3CF2 A;  1IN4 A;  5F1J A;  3DKX A;  2VQG A;  4C2U A;  1XMK A;  4CHU A;  3V8K A;  1ORK A;  1W0T A;  4YFX F;  3DU5 A;  2IVM A;  3ULQ B;  3E6M A;  1NH3 A;  2R7Z J;  2R7R A;  1U6G A;  1JHF A;  2VOP A;  2E5N A;  1KGS A;  3PJR A;  3OYJ A;  1P4X A;  3LSM A;  3WTY C;  5CKT A;  5FKL A;  3K69 A;  4A6D A;  5F0F A;  1SFO J;  3GFI A;  2KHM A;  5DM7 F;  1Y8Q B;  2R7O A;  4FIS A;  1MH3 A;  2L54 A;  4F52 A;  3TO9 A;  3WTS C;  3PO3 J;  1RRJ A;  3VYR B;  1LPQ A;  2QBY A;  3K1P A;  2MH9 A;  1Z6T A;  2ELJ A;  2NAZ A;  3MKL A;  4BAC A;  2OF7 A;  4ZTF A;  2X1D A;  1LQ1 A;  3LL7 A;  2M87 A;  3RIR A;  1NG6 A;  2W48 A;  3HHG A;  4KIT B;  3MKW B;  3IKT A;  3DTI A;  1J2X A;  1DQU A;  3CF5 F;  2VLA A;  2R5Y A;  5D6E A;  3HGG A;  2RDP A;  5E1W A;  3IRR A;  1P7I A;  1VQ7 I;  1YX3 A;  2BGC A;  2FA5 A;  5LHI A;  4A12 A;  1X1P A;  2JJ7 A;  1J9I A;  3I53 A;  1CGP A;  2FNA A;  1XMX A;  3FIS A;  5IOZ A;  3OYE A;  2XAU A;  2Y30 A;  1I39 A;  4MIM A;  1B9M A;  1XC5 A;  1ZEL A;  2M0C A;  2O9L A;  2E1M C;  3OR2 C;  5L3E A;  2PN6 A;  2WWY A;  2R93 J;  1ETW A;  4PGG A;  4LB5 A;  4QSH A;  3OYF A;  2LKS A;  1VQ5 I;  4G9Y A;  1YJN I;  3SYT A;  2XAF A;  3OYA A;  3PUF A;  2COB A;  2DYS H;  4BEH B;  3WGG A;  5HS8 A;  2X51 A;  4CYC B;  3JW4 A;  2ISY A;  1DPU A;  3QOE A;  3I4P A;  4L0Z B;  1E0E A;  2LC2 A;  1ZRC A;  2ADU A;  4IHV A;  2VJI A;  3A2K A;  4PJJ A;  3REO A;  1BOA A;  3WU1 B;  5LD2 C;  1HA8 A;  2CMP A;  4DYR A;  3ZMT A;  3F8F A;  4RS8 A;  3VEP A;  2RRE A;  3HOS A;  2F2E A;  1ZAR A;  3HUG B;  3KP6 A;  1XN7 A;  3PNY A;  5KNL A;  3I54 A;  2RN7 A;  3WU2 C;  2VBW A;  4Y17 A;  5D5V B;  2MA3 A;  1WJF A;  2V79 A;  1P4A A;  4EEF G;  2EBI A;  1ZKG A;  5FRO A;  4HW0 A;  1IJW C;  3D5L A;  4L18 B;  2NVQ J;  2EZK A;  4P5O A;  4QTR A;  1A35 A;  4JX5 A;  2NOJ B;  4Y13 A;  5LEK A;  1MKM A;  1BI2 A;  5C44 J;  1CF7 A;  2OUM A;  3BZ6 A;  2LY1 A;  2ME6 A;  2LLK A;  1TWF J;  2A69 F;  1YW9 A;  1A36 A;  4AYB N;  3BP8 A;  1QPM A;  3PUB A;  2STW A;  3WHC A;  4KUM A;  4O5V A;  2HOS A;  1HW1 A;  1BR4 A;  5HDG A;  3IHU A;  4M3G A;  4XOT A;  3U2R A;  3NQO A;  3ASO H;  1OYI A;  3QPH A;  1P92 A;  3CD6 I;  3Q0W A;  4B8X A;  4BBS J;  2HR3 A;  1XGM A;  2H1L A;  1I3Q J;  4RM2 A;  1LFP A;  1Y56 A;  2Y2Z A;  4NC6 A;  4EM2 A;  1LFB A;  1Y1V J;  2BVM A;  2LSO A;  2QKL B;  4QLC U;  3OYM A;  1YIJ I;  1HCR A;  1UHS A;  4XM3 A;  3CDI A;  3QYF A;  1SAN A;  1FYL A;  2CJJ A;  3R60 A;  2E1O A;  2FU4 A;  3EPZ A;  1OJL A;  1SFE A;  2EQR A;  4M72 A;  4YEL A;  2HYF A;  3ZMD A;  3ZQC A;  2AQE A;  1ZR4 A;  1JI8 A;  3U9G A;  3MD2 A;  4HBL A;  1R1U A;  2RV8 A;  2UV1 A;  3WTW C;  5ICG A;  2FNP A;  3TW6 A;  1AKH B;  4D1Q A;  2XPU A;  1FIA A;  1BW6 A;  1X4O A;  3AG2 H;  3QOP A;  3V8L A;  4E7J A;  2EZL A;  2HXO A;  1SFX A;  2DOA A;  4H4K C;  3CMM A;  5BS6 A;  4CH7 A;  3NWT A;  2EZH A;  2P6T A;  2DMT A;  3J80 K;  4ZC3 A;  3ZR8 X;  1KZH A;  4HLY A;  3F21 A;  3H5N A;  4ESF A;  4KMF A;  1X1D A;  3JRG A;  2NS8 A;  1QRY A;  3SEQ A;  1SMY F;  1ITY A;  2BXZ A;  2JRT A;  2PI0 A;  1T56 A;  4BDZ A;  2IS2 A;  3KP5 A;  4Z6Y A;  4DIQ A;  4CCK A;  4B48 A;  1MNE A;  3HRU A;  4LK0 F;  2K86 A;  3HPH A;  2HPI A;  1O57 A;  1HF0 A;  1ZH5 A;  5D4S A;  3PSI A;  2CQ7 A;  1QZY A;  2DTZ A;  4ASN A;  4CDG A;  2PMZ A;  2NS0 A;  3BG7 A;  1Z1D A;  4N9H A;  2OCC H;  4CZC A;  1X19 A;  1TQI A;  3LFU A;  2DPD A;  2RKH A;  2VC0 A;  3BJ6 A;  3Q0U A;  1ODD A;  1W5S A;  1KYZ A;  9ANT A;  5DYM A;  2HZT A;  4CSW A;  2MGQ A;  3CJR B;  4CXF A;  1W5C C;  2M4K A;  3EET A;  3MMY B;  2QGU A;  2CFO A;  2OU2 A;  4HF1 A;  3LNQ A;  3HTU A;  3DF8 A;  4EGY A;  3GBG A;  1K6O A;  2IA1 A;  5J47 A;  4UVA A;  2ZO4 A;  3FF5 A;  3FX3 A;  3K4J A;  4X0G A;  3TDU C;  5FRN A;  3C18 A;  3RSN A;  1YHQ I;  1FWZ A;  2R92 J;  1ZRD A;  1JTX A;  4M3D A;  4XLH A;  4DQ2 A;  5IYC J;  2I8D A;  1K78 B;  2JZY A;  2VC1 A;  1R7J A;  1XX5 A;  1MW7 A;  1ZG1 A;  3FBN B;  5E3O A;  1XGO A;  5IYD J;  4EVI A;  4E7Z A;  5HNH A;  1D8J A;  4IRI A;  2QWW A;  2MH2 A;  4A3F J;  1P7J A;  3BR0 A;  5EGO B;  2BE5 F;  3M7G A;  1LEB A;  3S32 A;  2MD0 A;  1KA8 A;  5D5X B;  2M8G X;  2IJL A;  3KP7 A;  1XGS A;  1HBX G;  2QLZ A;  4KN4 X;  4DNC A;  1EJ9 A;  1LEA A;  3ZOB A;  2XV4 S;  4BU2 A;  1G8X A;  2K9M A;  2HVQ A;  4NBQ A;  4LG0 B;  5F1R A;  4B47 A;  1P6R A;  3CCV I;  4FCY A;  4UUS B;  3H9J A;  1MDM B;  3DBR B;  1S8N A;  4KFC A;  2ZME B;  3O3K A;  3IWZ A;  2LRD A;  3TL4 X;  3OV8 A;  4RLQ A;  5CQG A;  4DYC A;  3IWF A;  2XIG A;  1JHH A;  4P9F A;  3HOZ J;  1OFC X;  3LMM A;  3PQJ A;  3MFK A;  1ETQ A;  3OYI A;  2DMU A;  3C2H A;  2FBI A;  2QQ8 A;  2W25 A;  4ZYE A;  3HTS B;  2Y48 A;  1QPI A;  4RGX A;  2X6O A;  4I76 A;  1L3L A;  2XGE A;  1ETV A;  4GGG A;  3A03 A;  3CQZ J;  1VND A;  4XRS A;  1V54 H;  2R5Z A;  1JT0 A;  2HKX A;  2H94 A;  4E7L A;  4RAG A;  3HL2 A;  3H92 A;  1ZGW A;  2QCO A;  2R7F A;  5JR3 A;  5HOD A;  4ENJ A;  2CV0 A;  2P0W A;  2BY1 A;  3KYD B;  1R71 A;  3QP5 A;  2CYY A;  3LAP A;  3F6O A;  4BQO A;  1U2W A;  4G7H F;  3JCU C;  2H6B A;  2E2I J;  4AID A;  4B43 A;  3TP0 A;  3WTU C;  3ZPL A;  3LQR A;  4IRG A;  3HGY A;  1PDN C;  3ELK A;  4DBQ A;  1STZ A;  3HPG A;  1EF4 A;  4C3J J;  1U5T B;  2GXG A;  2GOX B;  2GZW A;  1FSH A;  1ZGA A;  4L5E A;  2OC6 A;  3H3V K;  3I4N J;  5FLV A;  1MH4 A;  3EUK L;  3RJP A;  4PJN A;  2UZK A;  1HW2 A;  3TDZ C;  1FX7 A;  4OU0 A;  3OS1 A;  3RZO J;  1X2N A;  2XGD A;  3HM5 A;  3WU0 A;  1I6H J;  3F22 A;  3M1C A;  3F72 A;  2EFQ A;  4OMY A;  1T95 A;  1R5I D;  3D0S A;  2E34 A;  4RB0 A;  1R49 A;  1IRF A;  1VQ9 I;  3ZP5 A;  4XRF A;  1R4M B;  4LOC A;  5BNG A;  1CF7 B;  2COM A;  3L2C A;  3HOV J;  2P7C B;  1V3F A;  3R6S A;  1U8B A;  3W6J B;  1ZYR F;  2VXD A;  5BQT A;  3M9A A;  3BPV A;  4PFP A;  4XON A;  1BJA A;  2OZ6 A;  2VQL A;  4HDU A;  4XKV A;  4CA0 A;  1V5G A;  2L7F P;  5M5Y J;  1BI1 A;  4ZYG A;  2HQN A;  3JAM Z;  2BZT A;  2OV7 A;  3MN2 A;  3QYE A;  1UFM A;  4J00 A;  1F9N A;  2FX0 A;  2AXT C;  2F6C A;  1YLF A;  1KYW A;  2DA4 A;  3DFG A;  4G6Q A;  3PL8 A;  1WQ2 A;  1GHC A;  4G7O F; 
#chains in the Genus database with same CATH homology
 3FIW A;  4C2M J;  3JR9 A;  1BA5 A;  4M6V A;  2O8K A;  1HDP A;  1JUP A;  5EDN A;  1B8I A;  1FTT A;  2TCT A;  2HYJ A;  1GDT A;  2JA5 J;  4W1U A;  4A3M J;  2NS7 A;  2DA3 A;  4DZJ A;  3GTM J;  2DA6 A;  1JTY A;  4B3A A;  2LTP A;  2LY9 A;  5EG0 A;  2VUM J;  4XRS G;  4BY7 J;  3OSF A;  4IHW A;  2N8G A;  1LE8 B;  3M3Y J;  5FLM J;  2YS9 A;  2NVT J;  2Y9Z A;  3S16 J;  4ABZ A;  3BR1 A;  3S1Q J;  1A6I A;  5M5X J;  4V2G A;  1MBE A;  3ZQL A;  1MBH A;  2HDD A;  3CMY A;  1JJ6 C;  1WCM J;  2DMN A;  2JN6 A;  3CCY A;  5IP9 J;  1Y1W J;  4C3I J;  4A3J J;  3BQZ A;  3G1L A;  3LOC A;  4JP0 A;  4DYQ A;  4IEJ A;  1OCP A;  1UG2 A;  3TP3 A;  1YRN A;  5E3M A;  3BTC A;  1RKW A;  2R5Y B;  5GP9 A;  2DA5 A;  3TW7 A;  1WI3 A;  2XPV A;  2ECB A;  5IP7 J;  1IG7 A;  1DU0 A;  2LD5 A;  4UUT A;  2M34 A;  4QIW N;  3BTJ A;  2HXI A;  2ID3 A;  3ZQF A;  1H8A C;  3GTP J;  3GTJ J;  4Y52 J;  2LVS A;  1U78 A;  2JA8 J;  5EZG A;  5EGO A;  4A3C J;  1FEX A;  3MVP A;  2JK3 A;  1HDD C;  2Y9Y A;  1ETX A;  3JRE A;  3ZQG A;  5F1J A;  1AHD P;  3BTI A;  1ORK A;  3S15 J;  1W0T A;  1RR7 A;  1LE8 A;  2R7Z J;  3G1M A;  1E3O C;  3F0C A;  1U9N A;  5FKL A;  2K9Q A;  2P81 A;  2ID6 A;  1H88 C;  5F0F A;  1SFO J;  1NTC A;  2AHQ A;  2DN0 A;  1APL C;  3LSJ A;  1A5J A;  4FIS A;  1MH3 A;  3PO3 J;  1Z0X A;  3DEW A;  1ZTR A;  2XPW A;  3HKZ N;  3MKL A;  5FKO A;  5C3E J;  2OF7 A;  1WH7 A;  3IH3 A;  5F04 A;  4XRM A;  3BTL A;  2DA7 A;  2W48 A;  4JYK A;  1FJL A;  2Y0S N;  4AC0 A;  3HOW J;  2R5Y A;  5FKM A;  1G2H A;  3HGG A;  1P7I A;  4Y7N J;  2NVX J;  1F36 A;  3QPS A;  1GT0 C;  3LSG A;  5EEA A;  1T33 A;  3ZQI A;  2JJ7 A;  1NK2 P;  1GVD A;  5DTD A;  3S14 J;  3CDL A;  5EF6 A;  2E19 A;  3FIS A;  3GTL J;  5IOZ A;  2DA1 A;  4A3G J;  2Y30 A;  2WV1 A;  4MIM A;  1XC5 A;  3O8H A;  2L7M P;  2M0C A;  2O9L A;  2JA6 J;  2LFB A;  3HOY J;  4M3F A;  2R93 J;  3NAU A;  1ETW A;  2M2E A;  1ETK A;  4BY1 J;  4QSH A;  5FJ8 J;  5C4J J;  4V2F A;  2COB A;  4CYC B;  3HDD A;  1K61 A;  2ELK A;  1GV2 A;  1BW5 A;  4IHV A;  3GTG J;  2DMQ A;  2LKX A;  1Q1V A;  1HOM A;  4DYR A;  1K83 J;  1D5Y A;  2CQX A;  4D7N A;  2PMZ N;  1MBK A;  3GTO J;  2FD5 A;  3BG9 A;  1IV6 A;  3Q0V A;  4RBO A;  3B6C A;  3FK7 A;  5F08 A;  1GV5 A;  3A01 A;  1S7E A;  4EEF G;  2EBI A;  1ZKG A;  4X1E A;  1U9O A;  1IJW C;  2NVQ J;  3QQA A;  2JMW A;  4JX6 A;  2EZK A;  3JRF A;  4QTR A;  4JX5 A;  2HOA A;  2WB1 N;  5C44 J;  4D7M A;  2ME6 A;  2LLK A;  1TWF J;  1F43 A;  4AYB N;  3WHC A;  2E2J J;  2HOS A;  1POG A;  2GLO A;  4A3E J;  4M3G A;  1BJZ A;  3L1P A;  1GUU A;  3HBL A;  4XK4 A;  1IGN A;  1OCT C;  1O4X A;  3S2H J;  1JKP C;  2MG4 A;  3Q0W A;  4BBS J;  1MNM C;  1I3Q J;  3HEF A;  2ECC A;  1XS9 A;  2MW8 A;  2QF7 A;  3RZD J;  2Y2Z A;  3UKG A;  1LFB A;  1Y1V J;  2EH3 A;  2LR8 A;  1ENH A;  2AO9 A;  4CYC A;  1HCR A;  1UHS A;  3K2A A;  1SAN A;  1IDZ A;  1XG1 A;  2CJJ A;  2E1O A;  3ZQC A;  1MBF A;  1OJL A;  2EQR A;  4A3B J;  3BR3 A;  5JLW A;  1ZR4 A;  2IAI A;  1MSF C;  5F0C A;  2VPR A;  3TW6 A;  5K7Z A;  1AKH B;  2XPU A;  3E7L A;  2YUS A;  2OPT A;  1FIA A;  4B1R A;  4A93 J;  1BW6 A;  1WPK A;  3OIO A;  2EZL A;  2HXO A;  5DS9 A;  2XB5 A;  2L7Z A;  2KT0 A;  2DA2 A;  5FKN A;  1PUF B;  3JRA A;  2EZH A;  3IV5 A;  2GBY A;  2DMT A;  4A3K J;  3S2D J;  3FKI J;  1MBG A;  4MO7 A;  4BXX J;  4NDL A;  2XB0 X;  1Z77 A;  4MFD A;  3OOU A;  3S1N J;  4FE7 A;  2X9D A;  3JRG A;  2NS8 A;  1QRY A;  5J1U A;  3GTK J;  1ITY A;  3WHB A;  1R9T J;  1T56 A;  5JLX A;  2LP0 A;  2LK2 A;  2K9S A;  4X6A J;  4G12 A;  2VKE A;  4DZP A;  4DW6 A;  1I50 J;  3Q3S A;  3HB9 A;  1BL0 A;  1HF0 A;  1DU6 A;  2L0K A;  1NK3 P;  3IH4 A;  3HOX J;  1VF9 A;  2DTZ A;  2O7O A;  2M9H A;  1H89 C;  2ME0 A;  2HI3 A;  3BT9 A;  3Q0U A;  4D5F A;  4IHY A;  5EG0 B;  1QVU A;  3BG3 A;  9ANT A;  3A02 A;  2MGQ A;  2JA7 J;  2IBD A;  2B63 J;  3GTQ J;  4FTH A;  2X48 A;  1TWA J;  5IOY A;  1IC8 A;  1JUS A;  3H0G J;  4XIC A;  3LNQ A;  4JX4 A;  4A69 C;  3GBG A;  5C4X J;  5J1Y A;  1MSE C;  2ZB9 A;  4I6Z A;  2L9R A;  1PUF A;  1X58 A;  4BBR J;  4B4C A;  2R92 J;  2CRG A;  1JTX A;  4M3D A;  2GM4 A;  4RDU A;  3JRH A;  2XRL A;  3HOU J;  5E3L A;  3RQI A;  5IYC J;  2H1K A;  1IDY A;  3NAR A;  5EYR A;  3ZQH A;  5J1R A;  5GPC A;  2IEK A;  3B6A A;  1QVT A;  1RKT A;  5M3M J;  2E2H J;  5E3O A;  5IYD J;  2YU9 J;  2FJ1 A;  2TRT A;  2R5Z B;  3FK6 A;  3BR5 A;  2H8R A;  4A3D J;  4A3F J;  1P7J A;  3BR0 A;  5K7H A;  4HNV A;  5EGO B;  3C2B A;  4C3H J;  1B72 B;  2D5V A;  5FKK A;  1FTZ A;  1JKR C;  1ZQ3 P;  2M8G X;  3LSP A;  5J3L A;  1AU7 A;  2XSD C;  3S1M J;  3ZOB A;  4XID A;  2WAQ N;  1ETY A;  4AUX A;  3SDG A;  4M3E A;  2CQQ A;  4FCY A;  2HQ5 A;  3DCF A;  4UUS B;  2CU7 A;  5M3F J;  3G1O A;  3K7A J;  2K9N A;  2XGC A;  3D1N I;  3S1R J;  5M5W J;  3W6V A;  4DYC A;  5F0H A;  2R0Q C;  1RET A;  5F27 A;  3VPR A;  3HOZ J;  1OFC X;  1CQT A;  1ETQ A;  4MFE A;  4A3L J;  2DMU A;  3JRC A;  3JRI A;  3I4M J;  1QPI A;  3S17 J;  2X6O A;  4I76 A;  5EZH A;  2XGE A;  1ETV A;  1ZR2 A;  3A03 A;  3IH2 A;  4S0H B;  3CQZ J;  1VND A;  3PO2 J;  5E3N A;  4XRS A;  1JT0 A;  2R5Z A;  3OSG A;  2VI6 A;  2Y31 A;  3BG5 A;  3JRD A;  3JRB A;  1B72 A;  1ZGW A;  2QCO A;  2FQ4 A;  2VKV A;  5HOD A;  1JJ8 C;  2RAE A;  2JWT A;  3LSR A;  1RPW A;  4M3B A;  2HOT A;  2E2I J;  4A3I J;  1LFU P;  1JGG A;  1IRZ A;  2NVY J;  3TP0 A;  1W0U A;  2DMP A;  1FIP A;  3HGY A;  5IPA A;  1B8I B;  1IUF A;  4MLO A;  5IP6 A;  3SJM A;  3BQY A;  2CUF A;  4C3J J;  4UUS A;  4W97 A;  1VI0 A;  3SFI A;  1VFC A;  1JKO C;  1EF4 A;  3QPL A;  4L5E A;  3H3V K;  4J19 A;  3I4N J;  5FLV A;  1ETO A;  1MH4 A;  1JKQ C;  1HLV A;  3BR6 A;  2I10 A;  3PM1 A;  3RZO J;  1X2N A;  2XGD A;  2EZI A;  2K40 A;  3HM5 A;  3BR2 A;  1I6H J;  1X2M A;  3A01 B;  1JUM A;  1AKH A;  5K7F A;  1TWG J;  1TWC J;  4IHX A;  2G0E A;  4LOC A;  5BNG A;  2CUE A;  3TED A;  2DJN A;  1MBJ A;  3HOV J;  1U8B A;  1UMQ A;  1WGX A;  2KDZ A;  1TWH J;  4FE4 A;  3M4O J;  1TC3 C;  3RKQ A;  2NOG A;  4GFB A;  1WH5 A;  1RES A;  2L7F P;  1YRN B;  5M5Y J;  5IYB J;  2MSY A;  5GPA A;  4D5C A;  3MN2 A;  1JT6 A;  2FX0 A;  1ZK8 A;  3O8G A;  2DA4 A;  4BKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...