1X2MA

Solution structure of the homeobox domain of mouse lag1 longevity assurance homolog 6
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
64
structure length
64
Chain Sequence
GSSGSSGTAQPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the homeobox domain of mouse LAG1 longevity assurance homolog 6
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords LAG1 longevity assurance homolog 6
total genus 12
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2005-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1x2mA01
5FKLA 3IH3A 4QSHA 1YRNB 5IOYA 3GTKJ 4A3LJ 2HXOA 2XGEA 5M3FJ 3BR2A 3S1NJ 2XPWA 4A3JJ 4D5CA 2HDDA 5IYDJ 5F08A 1AKHB 5FKKA 3BR3A 1F43A 1RETA 4JX4A 2WB1N 1SFOJ 2DJNA 2E1OA 3NAUA 3HEFA 2O7OA 3FK6A 1TWFJ 3LSRA 2R5YB 1A6IA 2XPVA 4A3EJ 2ID6A 3GTGJ 2HOAA 3H0GJ 1QRYA 1U78A 1WH7A 3BTIA 4UUSA 2LP0A 2DA4A 1DU0A 3OSGA 2K9QA 1QVTA 1B72A 5F0HA 3S1RJ 4JX6A 5EGOA 3ZQCA 4AYBN 1VFCA 2O8KA 1ETOA 2LY9A 1IDZA 4UUTA 3HGGA 3GBGA 5F0CA 5E3LA 3NARA 2M34A 1APLC 4Y7NJ 5C4XJ 3LSJA 3FISA 3DCFA 1JT6A 3S14J 1JGGA 3ZQLA 4JP0A 2DMNA 3FIWA 1LE8B 2MG4A 3HM5A 4BBSJ 2K9SA 5E3NA 1I3QJ 3BTJA 2L7MP 3CQZJ 1WPKA 2VKVA 2R5ZA 3S16J 4IEJA 3BG9A 5FJ8J 2ELKA 2LD5A 1QVUA 3O8HA 4IHVA 1POGA 3QPLA 1AU7A 2NOGA 5EZHA 2EZHA 3BG5A 4XRSG 5FKOA 2CUFA 2R0QC 5EDNA 1JTYA 3ZQGA 4QIWN 2EZKA 2D5VA 2NVTJ 3RZDJ 3Q0VA 3BQZA 1TWCJ 5IYBJ 2CQXA 1TC3C 3PO3J 1F36A 3S2DJ 2DA5A 3MVPA 1Y1WJ 2VUMJ 1LFBA 1NTCA 4D7MA 1ETKA 4JYKA 5EZGA 2FJ1A 3M3YJ 3O8GA 3B6AA 2E2HJ 3HOXJ 3HOYJ 5C4JJ 2NVQJ 3QPSA 4MO7A 3UKGA 2X6OA 1IUFA 5M5YJ 4XRSA 1RPWA 2E2JJ 3HBLA 1MBJA 3A02A 2L7FP 1E3OC 5GPAA 2DMUA 5M5WJ 1T33A 4B1RA 2DA6A 1JTXA 4A3KJ 2DMPA 2X48A 1Q1VA 2XSDC 3RKQA 3W6VA 3IV5A 3TW6A 1XS9A 2PMZN 2LK2A 5FKNA 1NK2P 4A3CJ 1VNDA 5E3OA 4GFBA 1XG1A 2DMQA 2Y9ZA 1P7IA 5C3EJ 3OIOA 1X58A 1B8IB 3BG3A 3GTPJ 3PO2J 1RKWA 4X6AJ 2P81A 3HKZN 2HXIA 2XGCA 4LOCA 1OJLA 2XGDA 1JUSA 1HLVA 3MKLA 4HNVA 2HOSA 3E7LA 1MBGA 5EG0A 2NVXJ 2NS7A 1OCPA 2GM4A 2IEKA 3CCYA 4FISA 1U9NA 1CQTA 5IP6A 3OOUA 2M9HA 5J3LA 5EGOB 1W0UA 1UMQA 1IV6A 3Q0UA 1ORKA 1ZKGA 2L7ZA 1IC8A 3BR1A 1TWGJ 2XRLA 3M4OJ 1UG2A 5IYCJ 3Q0WA 1LFUP 2IBDA 2DA3A 3S1QJ 4AUXA 1MSEC 4DZPA 3PM1A 9ANTA 3S17J 3A01A 1GV5A 1R9TJ 2GBYA 2E2IJ 2M0CA 2LFBA 3WHCA 1I50J 1VF9A 4QTRA 1U9OA 2KDZA 3TEDA 1K83J 1AHDP 1FJLA 5C44J 4EEFG 2HQ5A 1NK3P 4DW6A 3RZOJ 1FIPA 4NDLA 2COBA 1VI0A 3A03A 4ABZA 4DYRA 1MBFA 4D7NA 1GVDA 1GV2A 1O4XA 3JRAA 2TRTA 1HCRA 3QQAA 2LTPA 4W1UA 4C3IJ 2L0KA 4DZJA 3GTOJ 1JKPC 5K7ZA 3LNQA 2M2EA 4XRMA 2N8GA 4BBRJ 2HOTA 2L9RA 3SDGA 4M3EA 2FQ4A 2ECBA 5FLMJ 4RDUA 5EEAA 3BR0A 1GDTA 4MLOA 2CQQA 3BTCA 1JT0A 3F0CA 1JJ8C 1WCMJ 4DYQA 4IHWA 2QF7A 4A3GJ 4M3BA 1BW5A 3HB9A 4C2MJ 2OF7A 1D5YA 5DTDA 2G0EA 1Y1VJ 1B72B 1XC5A 2M8GX 1H8AC 2R93J 1FIAA 3CMYA 3ZOBA 5K7HA 2GLOA 2MSYA 4XICA 2KT0A 4M3DA 2B63J 1ZR2A 3JRDA 4IHXA 3HOWJ 2R5YA 2CRGA 2RAEA 1ETVA 4BXXJ 4B3AA 3RQIA 5M3MJ 1WI3A 2ME0A 4A69C 3BTLA 4MFDA 4BKXA 2JK3A 1EF4A 5F0FA 1LE8A 1A5JA 1IRZA 3I4MJ 4FE7A 2DA1A 3BT9A 3SJMA 1AKHA 4C3HJ 2R92J 2DMTA 2DTZA 2JWTA 5JLXA 2YS9A 2R7ZJ 3I4NJ 1H89C 3G1MA 4BY7J 1MH3A 4MFEA 3S15J 1ZK8A 5F1JA 3TW7A 3D1NI 1QPIA 4BY1J 1BL0A 3JRHA 2Y31A 4A3MJ 1BJZA 5J1YA 4FTHA 1MH4A 3HOVJ 3HOZJ 2CU7A 3BR6A 1ETXA 3GTMJ 4G12A 5GP9A 2CJJA 1GT0C 1X2MA 2ME6A 4J19A 2OPTA 1T56A 1HDDC 2JA5J 5FKMA 2NVYJ 5IOZA 1X2NA 1HOMA 2FD5A 2R5ZB 3JRFA 5BNGA 4CYCA 2LVSA 3G1OA 4X1EA 5IPAA 3VPRA 2ECCA 5J1RA 1MBKA 3K7AJ 2MGQA 2E19A 1HDPA 2JN6A 5K7FA 1FTZA 5IP9J 4A3IJ 3JREA 1WH5A 1RESA 2EH3A 2ZB9A 3S2HJ 4IHYA 3HDDA 2LR8A 1IGNA 3SFIA 1RKTA 2EQRA 2Y30A 2HYJA 1ZR4A 3S1MJ 2NS8A 2W48A 2JA8J 3JRBA 3OSFA 3MN2A 4A3FJ 1B8IA 1ZTRA 1JKQC 4FCYA 1I6HJ 1S7EA 2JA6J 1ETYA 4M6VA 2DA7A 2XB5A 3LSPA 2K9NA 3IH4A 3TP3A 3FK7A 4XK4A 1ENHA 1JUMA 1OCTC 5F27A 1TWAJ 3K2AA 1MSFC 1TWHJ 2H8RA 5DS9A 4RBOA 4A3BJ 3B6CA 4AC0A 1PUFB 2AO9A 2JMWA 3FKIJ 1JKRC 5JLWA 4MIMA 1IDYA 1U8BA 2YU9J 1MNMC 1MBHA 3H3VK 2EZLA 1YRNA 2IAIA 2JJ7A 5E3MA 4M3GA 2LLKA 1FEXA 4S0HB 1HF0A 3Q3SA 3LOCA 2X9DA 4XIDA 2YUSA 3LSGA 4V2FA 5EYRA 3JR9A 3ZQIA 2VKEA 4JX5A 1JKOC 1UHSA 2DN0A 2FX0A 2Y2ZA 1ZGWA 1Z0XA 4V2GA 4I6ZA 4CYCB 3G1LA 1WGXA 1DU6A 3A01B 3GTJJ 1BA5A 4D5FA 3CDLA 3L1PA 4A93J 2MW8A 4Y52J 2H1KA 2QCOA 3GTLJ 3ZQHA 1IJWC 4UUSB 3IH2A 1ETQA 2Y9YA 3JRIA 2AHQA 3WHBA 2LKXA 2I10A 3ZQFA 2CUEA 4L5EA 3TP0A 4W97A 3BR5A 3JRCA 5FLVA 2WV1A 2O9LA 2HI3A 3BQYA 2WAQN 3HOUJ 1H88C 2XB0X 5EG0B 2JA7J 1FTTA 1MBEA 4B4CA 3DEWA 1JUPA 3C2BA 3HGYA 2DA2A 1P7JA 5EF6A 2XPUA 4M3FA 5HODA 1ZQ3P 2K40A 1ITYA 1K61A 1GUUA 1ETWA 1W0TA 4FE4A 5GPCA 1G2HA 1JJ6C 5F04A 1IG7A 5J1UA 1RR7A 3GTQJ 1SANA 2VPRA 2EBIA 2Y0SN 5M5XJ 2TCTA 1BW6A 1OFCX 1Z77A 4DYCA 4A3DJ 5IP7J 2ID3A 1PUFA 4I76A 4C3JJ 2EZIA 2VI6A 3JRGA
chains in the Genus database with same CATH superfamily
2Z3YA 3L2CA 3S93A 1BOAA 5FKLA 4QSHA 4B43A 4WXCA 4M6YA 2V1NA 3BR2A 2RDPA 5IYDJ 2E1NA 4MEYF 2FRHA 5FKKA 1RETA 1SFOJ 2WB1N 1W7PD 3WE2A 3FMRA 3GF2A 1X1CA 3HEFA 4S05A 3VSLA 3DWLE 3G71I 2O7OA 3V42A 1QZYA 2M0MA 2V26A 4HX4A 4G7ZF 2QKLB 4HLXA 2QWWA 2X85A 1TP4A 3L00A 1HBXG 4QWQA 2F5CA 3CDIA 3BLYA 3CLOA 3MKZA 3GFIA 5DEQA 3KE2A 5B1BH 1TW3A 2UZKA 3WTYC 1WH7A 3ZXSA 4J01A 2OZ6A 4FX4A 4UUSA 5LD2C 3D0SA 1QHGA 3J7AO 1O7FA 1QVTA 2A6HF 5F0HA 2XF5A 4M9ZA 3LAPA 1R49A 4JX6A 4AYBN 1VFCA 2O8KA 5FRNA 4PJMA 2VQLA 3UNGC 1RNLA 2DT7B 1STZA 2FBHA 1SVOA 2LY9A 2M5WA 2KMUA 4LK1F 3EYIA 1R1VA 5CYVA 3HGGA 2F5VA 1PJRA 1FOKA 2COMA 2E1MC 2QENA 3AG1H 5FGMA 3NARA 2M87A 1T38A 4I0BA 2HOEA 4Y7NJ 3J80K 3IWZA 2L9VA 1FP1D 2OV7A 3JSPA 2GA1A 1FSHA 3ZQQA 3J81Z 3ZQLA 2FXAA 4KISA 1AOYA 3C3WA 3FIWA 3IRRA 3OOPA 3KCCA 3V7SA 1T6SA 1ZGJA 2W1OA 4K2EA 1WWXA 3LFUA 2QKMB 4ANJA 3BZCA 3UR3C 5K5OA 4XLCA 3KETA 4BEHB 3H3UA 5E3NA 3V7CA 2LSOA 2UUZA 3LMMA 3CQZJ 4XM3A 5F1RA 1WPKA 3BG9A 2ELKA 2DDBA 4E70A 3OYBA 4X0GA 1POGA 3HL2A 2BXZA 5EZHA 3E6CC 2CGPA 4LJZF 1I27A 3FXQA 4OIQF 4OMYA 2LBFB 1DPUA 1W5CC 4P9UA 4DIQA 3A2KA 3ZQGA 1W4MA 1WKMA 4PSXA 2I5UA 4A0XA 1X3ZB 2WTEA 2CQXA 3I58A 1TC3C 1XCVA 3JTGA 3AKZA 2DA5A 1L0OC 1HQCA 2A69F 2VUMJ 1WHUA 1NTCA 4ESFA 2NNYA 2IT0A 1X1BA 4U7BA 2CFOA 2NVQJ 1BR1A 4ZDPA 2HS5A 4LG3A 4XRSA 2EIKH 3ULQB 3PJRA 3WTXC 3TO9A 3WGGA 3A02A 2OJED 5LBQA 3QYFA 3OR2C 2K7LA 1JTXA 3KZZA 2DMPA 4DQ2A 3RTRA 1UAAA 3RKQA 3LFKA 2FMYA 1Z7UA 4IJAA 4IX7A 3C18A 1EA3A 1QU3A 4RB1A 1VNDA 3DU6A 3KLOA 3OYJA 3F6OA 2DMQA 1ZLKA 5A2QK 2Z99A 2VASA 1LVKA 1FYMA 3K10A 2P81A 4X6AJ 1LDJA 2HXIA 1XSXA 3IWFA 4DNCA 3VSKA 2XGDA 4U0VA 1X3UA 2BVLA 2VPLA 2CV1A 5H6RA 2CYYA 4C30A 4HNVA 1HLVA 3O2PE 2BGCA 2XKOA 5ICEA 1G8XA 3F9KA 2FNAA 1S9HA 2K02A 2JT1A 2VE8A 1QZEA 2DI3A 1W0UA 2Y48A 2IS6A 1F1ZA 2EV5A 2KLOA 3KEQA 1W7PA 3J80Z 4JOMA 3FXUA 2K5CA 4AM3A 3TBIA 4A5NA 1OCOH 3NEUA 1P92A 3DBHB 4NQWA 4Q4ZF 1XPXA 2FE3A 3Q0WA 3K6GA 1WJAA 1LFUP 1LB2A 1OQYA 2XRNA 1VQ4I 2IBDA 4RGRA 5JHFA 4AUXA 4EJWA 2L4AA 2E7WA 3PM1A 1PVEA 9ANTA 4MHGA 4CZZA 3S17J 5DDGA 2QVOA 3WHCA 4RS8A 1I50J 1XN7A 1FJLA 4BQAA 3ZR8X 4A6DA 1ZH5A 1YS7A 1OCCH 4DW6A 4HQMA 3RZOJ 3ML6A 1N25A 3GCMA 4NDLA 4LIVA 1VI0A 3A03A 2IS2A 3C1DA 3CUQC 1MBFA 3A1YA 1S8NA 5D5WB 2K3FA 1GV2A 1ZRCA 3DQVC 2VB6A 2JUCA 2QYOA 3V4GA 4OIOF 2EIJH 3QQAA 2LTPA 1O3RA 3EUAA 3KP5A 4C2UA 2M2EA 1C0WA 2DTRA 1U5TB 1FBQA 4EJUA 5HDKA 2IA2A 3BR0A 4DGWB 4G7HF 1LEAA 3BTCA 3E5XA 4YELA 3F0CA 5ILUA 2W84A 1WCMJ 1B9MA 1YJ9I 3CP8A 1KQ0A 1IN5A 3CMAI 4M3BA 3PSFA 1BI1A 2VBWA 3ZMDA 4CHUA 3MKWB 2BY1A 2JUGA 3H5AA 5DTDA 2ZJRF 1Y1VJ 4IO9F 2R93J 1YIJI 1FIAA 4M9XA 3CMYA 2DJIA 1T0FC 5EEGA 3RIRA 1ZAOA 4CZCA 3KYDB 4RLFA 3LQRA 3X2QH 4M3DA 1ZR2A 1H0MA 4M73A 4PZJA 3FXMA 4FQGA 2NRAC 3HOWJ 2CRGA 1TQPA 2RAEA 3F72A 3JAMZ 1CF7B 2A07F 4B3AA 5ERIA 2XSJC 3QYBA 4BAYA 2GXBA 4A69C 2M4GA 5KCMA 2KRFA 4BKXA 4Q5SF 4HX7A 3E0JB 5F0FA 1LE8A 1IRZA 4U87A 1J2XA 1IXSB 3VYTB 3PUBA 1AKHA 2R7OA 4YEJA 4UB6C 4NBQA 4E7JA 3W6JB 2R7DA 1VQ7I 3S3OA 5FLXK 1QPIA 3TW7A 3D1NI 4BY1J 1BL0A 1ODDA 3OYNA 4A3MJ 1PYVA 2F48A 2XAQA 1MH4A 1UJ8A 3ZMSA 2H6BA 3BR6A 3SDBA 3GTMJ 4G12A 2JVGA 1T0FA 4ENJA 3QPHA 2F2EA 4FHTA 3ZMUA 1V5EA 5FD5A 1TW2A 2OPTA 1HDDC 4Y13A 3M1EA 3R0AA 4XORA 1FT9A 3QPTA 3OY9A 4KMFA 2BY3A 2UXNA 3JRFA 2LVSA 2CO5A 1SMTA 4IKFA 2ECCA 2Z2SB 1MBKA 3K7AJ 3U2RA 2IS4A 2NOJB 2MGQA 2D1VA 3CUQB 2P7VB 5K7FA 2OTJI 4RB3C 1CF7A 5IP9J 4A3IJ 4L5JA 2V1UA 1RESA 2EH3A 2PMZA 2BHYA 2KP6A 2KJCA 3HDDA 4AVZA 3FXOA 1YS6A 2Y30A 2ESHA 2KKOA 3OSFA 1ZG3A 4HPQA 4KYWA 3I0TA 1YLFA 4M6VA 2XB5A 3EETA 4CCLA 4LGWA 3HYIA 1YITI 2QZ8A 2BW3A 1VQLI 4DBQA 3TP3A 3ECHA 3FK7A 1S3JA 2R3SA 5F27A 1VQPI 4NHJA 2ZFUA 2WBMA 1MMAA 1J9IA 4EV0A 5DS9A 4Y33A 2LRDA 1QHHD 2CW7A 1RUNA 4CGZA 1ZLJA 4KN7X 2DFIA 1P4AA 3K69A 3KYLA 2IAIA 1WJEA 3LA2A 2XF7A 1KGSA 4BS9A 3ASOH 1XX5A 5DCMB 1VQOI 2LLKA 4CCJA 1P2FA 4S0HB 4N4OB 2DQLA 2EJRA 2Y69H 4OAYA 2MABA 2ESNA 2WAEA 3DBLB 4G6DA 4V2FA 3JR9A 1OCZH 2ADUA 2VKEA 1JKOC 4HOBA 5FO5A 5BOXA 2Z33A 1EH6A 4I6ZA 4KMUX 3RYPA 3W6KB 3G1LA 3NWTA 5TRDA 4KFCA 4YIRX 3A01B 1YI2I 1K4TA 2IRFG 3OIQA 4ZYGA 3Q9SA 2G9WA 3FXLA 3CESA 4LLGF 2F6CA 3U1KA 4Y52J 1SD6A 4P5OA 3FBIB 4XOTA 2EFNA 3VEPA 4A5MA 1RR8C 4UUSB 3IH2A 3VOEA 3J7YJ 5TISC 2AHQA 1B1BA 3I54A 4WF2A 2QM3A 1R71A 4M71A 2YPRA 2DLLA 2L5QA 4W97A 3L7WA 2WV1A 4KUMA 1KU3A 3HOUJ 2XB0X 1OMIA 2Y75A 5EG0B 5TGTA 2CQNA 2PMUA 3DEWA 4C2TA 3C2BA 3IC7A 1VQ6I 3HGYA 3M8EA 3CMMA 3CO7C 2DBBA 2XPUA 3AL0B 3NRVA 5DYMA 3PUFA 1Y0UA 3OS2A 1LUJB 5GTHC 1XMXA 5CVVA 3FXJA 1GUUA 5D6EA 2ZSHB 1ZELA 4B48A 5D5UB 1G3YA 1JJ6C 5F04A 1RR7A 3GTQJ 1SANA 4DJAA 3H9JA 4R79A 2JQ7A 3RYRA 2LYCA 5H2FC 1U8RA 3HUGA 1XGMA 2ID3A 2EZIA 3CCRI 1HSJA 3T0YA 3JRGA 1FSEA 2NYXA 4RGSA 2CV2A 3SZTA 3IH3A 1YRNB 4E7IA 3GTKJ 2VJJA 5DV5A 2OA4A 5E8GA 2XPWA 3U21A 2MC3A 1IZ1A 2HDDA 3LWFA 1W7PB 1JGSA 3HOTA 3VYUB 4MEXF 1AKHB 2O5RA 5ICFA 2L9NA 1N78A 1F43A 4IZZA 3HRUA 2D45A 4KIFA 3NAUA 2E1MB 2EPFA 3P5JA 4GO1A 2KISA 1SD4A 2OZUA 1R5HA 3FM3A 3M07A 3J81K 5LGTA 1F4KA 3JTHA 1TWFJ 2CFXA 2X6YA 5L3GA 2W24A 2PMHA 2XPVA 3GTGJ 4I7HA 2BE5F 2RNJA 1U78A 3VDXA 1F9NA 3QAHA 5HLHA 1ZN2A 4OMZA 3IUOA 3OSGA 2K9QA 1B72A 2P6SA 2Q2EB 2ZCWA 5EJCA 5EGOA 2LF8A 3ZQCA 5E8IA 4O3MA 5E20A 4BHPA 2IGMA 3GO5A 1ETOA 2JPCA 4QPOA 1UFMA 2ICWG 3WU2C 1IDZA 3S2WA 3RPQA 4UUTA 2A05A 1RUOA 2OAZA 4XLEA 4XKBA 2V9VA 3E5UA 2ZXJA 3CP2A 5F0CA 3W3CA 3HPGA 3DCFA 2WWYA 2O03A 3EQLF 3IHUA 3GLXA 4AIDA 3I56I 2Q1ZB 3PIOF 1OLTA 2K9SA 1TNSA 2KJBA 2IJLA 4XRFA 2R7UA 3BTJA 4OOIA 3BCAA 2R5ZA 2VODA 1D1CA 4IEJA 5FJ8J 3K9TA 2P0WA 3B73A 2LD5A 3O8HA 3R6SA 1HKSA 4IHVA 3GUDA 4ZDOA 2ELJA 2V9KA 5GTIC 2EZHA 4HYEA 4BQNA 5D8LB 4BNCA 3BG5A 4MQVA 2MD0A 2CUFA 4IRIA 2R0QC 3K4KA 4F91B 1JTYA 4XLAA 2R7WA 2D5VA 2NVTJ 3RZDJ 3OS0A 4B3XA 3EDPA 3Q0VA 2RREA 2H8WA 3BQZA 5IYBJ 2F4IA 3CF5F 1S29A 3OIPA 3H9QA 4CXFA 4ZDLA 2MYSA 4UNOA 1BJAA 3PO3J 1YW7A 4HSRA 3MAJA 5BMZA 1Z6TA 4XOPA 3CC2I 2LMDA 3H3ZA 4ZJZA 1ETKA 3WU0A 5EZGA 5LEJA 2IA0A 3B6AA 5C4JJ 1YHQI 3LA7A 4XQFA 4MO7A 4U0WA 1HKTA 5M5YJ 1IUFA 4A12A 4IOCF 2O3FA 2R7FA 4F7ZA 4M9SA 3KPHA 5KVRA 2IP2A 1XDUA 1GXQA 2FBKA 2ZJ2A 5CVRA 2LH9A 5M5WJ 3IKTA 1B59A 2R7TA 2DA6A 1ULYA 2ZXIA 4A3KJ 2X48A 1Q1VA 2PJRA 2E36A 3IV5A 2M45A 2QA4I 2BVMA 2PMZN 2Y0MA 5FKNA 2XAJA 2VJ5A 2X51A 4G7OF 3PSIA 3L9FA 3QRFF 1BI3A 1XG1A 2W57A 2CMPA 3OIOA 4Z6YA 5CVIA 3WTVC 1B8IB 3V8JA 3GTPJ 3HPHA 3PO2J 1G3WA 3HKZN 3WTUC 3CZ6A 4HDVA 4LOCA 3ZMZA 1OJLA 4KITB 5CQEA 2E5NA 5GAHJ 2MFZA 1QNTA 1MBGA 5EG0A 2NVXJ 2UV1A 1R4NB 3OYDA 2DFEA 4FISA 2ELHA 1X4PA 4XONA 4L9JA 3HJEA 3OOUA 1D0YA 1TLHB 2DFFA 2M9HA 3SZGA 4AVPA 5B66C 5EGOB 2GIZA 1W5SA 3HKZA 4XLFA 3RQ4A 2L7ZA 1ZKGA 2LOOA 3BR1A 2X6XA 4F92B 1DUXC 3AG4H 4MNUA 4EM2A 1X19A 2XRLA 5IYCJ 3M4OJ 2VT3A 1Y6IA 4Y4RA 3KP3A 3LSTA 2B9SA 3S1QJ 1MSEC 1PP7U 4LFUA 3T8RA 3GX4X 1GV5A 1R9TJ 3P7NA 4HDUA 2L02A 5D4SA 4QTRA 3TEDA 1VF9A 4YFXF 1AHDP 2KZGA 3GWZA 2AQFA 2HQ5A 5J47A 2JSPA 2HPMA 1R5GA 2D1HA 1FBSA 2HQNA 2XKPA 5JHUA 1I3AA 2EB7A 4I98B 3J7ZI 4D7NA 2VC1A 1YQAA 2W85A 3MMYB 4PGHA 3QOPA 3MWMA 2X6WA 2L4MA 5HVQC 2FQ3A 2DT6A 1SFXA 2NAZA 1HCRA 1J75A 4I09A 5ICCA 2V1XA 2V4JC 4DZJA 4ZYEA 2VKHA 4QLCU 4ZTFA 1JKPC 4XRMA 2N8GA 4XR6A 4ZYAA 4BBRJ 3G4SI 1OYWA 2P5KA 2HOTA 5LLQA 1TQIA 2ECBA 2FQ4A 4M3EA 5FLMJ 5EEAA 4MLOA 2CQQA 4IRGA 1JT0A 2X0LA 3O6BB 3I5UA 4DYQA 2QF7A 2R4GA 3HSFA 1EH7A 1WJFA 1UZCA 3V8LA 4YIFA 1ACIA 4LK0F 3K2ZA 1U5TA 4ZYHA 3HB9A 2OF7A 1KZHA 4ETSA 1D5YA 3PNVA 5J4YA 3ERED 4P96A 1MZBA 2G0EA 3GFJA 3OYFA 1H8AC 3ASNH 2ZO4A 1YG2A 3OWTA 5K7HA 2UWMA 3DPUA 2ZJQF 2GLOA 2MSYA 3DEUA 2LKPA 2XHKA 1X1PA 2IPQX 2KT0A 2CQ7A 1VQ8I 2RV8A 1Y8QB 5FROA 4E7SA 4OIRF 2EV6A 2PLYA 3C2HA 2DCEA 1FZPB 3SZPA 2VQHA 2HVRA 3IP4B 1MJBA 5M3MJ 4BEHA 3BTLA 3ZMVA 3WGIA 1O57A 2V1DA 2NNNA 1MNEA 4FETA 1BI2A 3CCQI 2JK3A 3ONQA 4PJLA 1EF4A 1A5JA 2OD5A 2LC2A 4FE7A 2DA1A 3BT9A 4OAZA 3ZP5A 3KEOA 1GHCA 1XTAA 4I0AA 3FMQA 4RAFA 2WB1A 2DOAA 1BM9A 2F4MB 5JLXA 3COAC 4CCNA 2R7ZJ 2XV4S 1H89C 1MH3A 3IRQA 2IVMA 2MLKA 1S6LA 1Y39A 3JRHA 2Y31A 2E1CA 4XKWA 1BJZA 5J1YA 1KYWA 4BE2A 4KICA 3ECOA 3CD6I 2YR2A 3DP7A 1ETXA 3F8MA 1G3TA 4PCQA 1K7AA 5HLTA 2MH9A 2K27A 3AAFA 1I1GA 2EFOA 2F5DA 3CC7I 3DKYA 5IOZA 1E17A 1FWZA 1X2NA 3K4NA 2LREA 4Q48A 1FMVA 2FD5A 2ZBKA 2R5ZB 4CYCA 3G1OA 2XAGA 4X1EA 3F8NA 3H92A 5J1RA 2EA4A 2RKHA 1BIBA 2VE9A 2PG4A 5HDNA 4RB0A 2WC2A 3BC8A 1SD7A 1WH5A 3K0LA 3ZCOA 3JREA 1D0ZA 2ZB9A 3KLNA 1D1AA 4C9YA 3S2HJ 3LSIA 4E7HA 4LB5A 3RI4A 2VXZA 2DW4A 1MMGA 2HZTA 3SFIA 2EQRA 2ZJPF 1ZR4A 2FA5A 3GW2A 1SFEA 3AG2H 2JRTA 3BJAA 1B8IA 1ZTRA 3H1CA 4AU7A 4FCYA 1S7EA 2XC7A 2DA7A 2EWNA 1B9NA 5GAEJ 2CUZA 2GOXB 2K9NA 3IH4A 2QQAA 1TT0A 4L9TA 4I99C 4HSTA 3GFMA 5LGUA 1TWAJ 3K2AA 3ESWB 2RQPA 3DEEA 1HW2A 1B6AA 4XL9A 4A3BJ 4AC0A 2CUJA 3PQKA 2DQRA 3FKIJ 4IXAA 5JLWA 1U8BA 1IDYA 1KONA 2FBIA 2GZWA 2ZXWH 3K1NA 2YU9J 5AONA 3CCJI 3F22A 3H3VK 4CSWA 2EZLA 1YRNA 6PAXA 2O61A 2JJ7A 2LG4A 4FX0A 5E3MA 3OMYA 4GDFA 2M1BA 2L01A 2W00A 1D5VA 3Q3SA 3ABLH 1V4RA 3P9CA 3Q5FA 1VTNC 3L2WA 1O7LA 3BP8A 1XMAA 5LGNA 1UHSA 2Y2ZA 3CJQB 4CCMA 1Z0XA 2QSFX 1B4AA 4E7ZA 4HF1A 4O6JA 4UVCA 1T08B 4F3QA 3HTUA 1LJ9A 3E5QA 1YX5A 3PIPF 4L5IA 1XCBA 4HBLA 1V54H 4A93J 2H1KA 2QCOA 4IVNA 5L3FA 3GTLJ 2FU4A 3HRMA 2A61A 2QBYA 4HQEA 1LPQA 4ITVA 4RM2A 2Y9YA 3JRIA 1IO2A 3M7GA 4BJTA 3CCVI 2ETHA 4L9NA 5ILVA 2I10A 3ZQFA 1EJ9A 2QGUA 5EEHA 2CUEA 1Y56A 2E34A 2K3PA 3BR5A 2HI3A 3BQYA 4PSWA 4UVBA 3TOAA 1H88C 1A31A 2EIMH 3OL3A 1SVMA 4TV7A 2JA7J 4EM1A 3OR1C 2DT5A 4ZH4F 1JUPA 2Z5UA 2YX7A 1R58A 1GVJA 2G7HA 1QBJA 1AA7A 3QOEA 4MGRA 2KRHA 1XD7A 5ICGA 3LQQA 3EUHC 3HTSB 3VFZA 4IQJA 1M1EB 1JHFA 1WZ2A 3ABMH 1ETWA 4FE4A 5DM7F 4UV8A 5J1UA 1J59A 4RB2C 4OU0A 2VPRA 2QSGX 2EBIA 4F93B 5DD8A 4J00A 5M5XJ 1J09A 1DP7P 1OFCX 1GXPA 2G7UA 3BPVA 3RPUA 4AYBA 2LF7A 4DYCA 5IP7J 1S7OA 1IF1A 2XAUA 4B44A 3T5XA 3QODA 3B02A 4LB6B 1DGRM 2V79A 2JVHA 3GFLA 4E7LA 4WK8F 5IOYA 4BU2A 2DYSH 2XGEA 5E1XA 2A5WA 1AWCA 1YYVA 2QSHX 4RMNA 4D5CA 1USSA 2GWRA 1UHWA 3A0HC 1J7KA 2PBIA 3BR3A 1HC8A 3DXJF 4XLHA 2DOFA 3W2VA 4RLQA 3E6BA 4YRVA 1KQ9A 3JSOA 2DOEA 4G6QA 3H36A 3FK6A 1IRGA 2FF4A 5E17F 3M8FA 1FMWA 4G6TB 4A3EJ 5LRRA 1FOYA 2ID6A 2HOAA 2QLZA 3SQNA 3R0JA 5HDGA 3CO6C 4II2A 4IHTA 1QRYA 2FOKA 2GXGA 3BTIA 1MJ9A 2HEOA 4A0YA 2WA0A 1YO5C 2A3SA 5DCMA 2RC4A 1IXRC 1JI8A 4M74A 2VIXA 3G73A 3S1RJ 2WADA 2CWEA 2P6TA 5K5RA 4E6KG 1SFUA 5FD6A 4A6EA 3GBGA 2DFHA 1HKQA 5HS8A 3CLQA 2IA1A 2M34A 3DF8A 1APLC 2EA2A 2H27A 3FDYA 2K85A 1R5ID 3LSJA 2HQRA 3FISA 4RM3A 4Z2YA 1FOXA 4CO8A 1V55H 1JGGA 1DPRA 2H1LA 1R1TA 4IHSA 4JP0A 1RI7A 1LE8B 2PEXA 2MG4A 3LSKA 1KU9A 2DODA 4BBSJ 4BQQA 2QEXI 4E7KA 1TL8A 1Z67A 3CDHA 1YIOA 2IGOA 2PX9A 4A0ZA 2RN7A 1HSTA 4UVAA 1I3QJ 4R1HA 2L7MP 4GYIA 3MZYA 3GMEA 4DOZA 2PFBA 2VKVA 3GXOA 1W36C 3S16J 2VKDA 1G4DA 3IAS2 3TKYA 1QVUA 4MTEA 4HV6A 2NOGA 2Q8KA 4GXOA 2A6TA 1CGPA 3DPTA 3ABKH 5LFAA 1UCRA 5EDNA 3FM5A 3VODA 5BS6A 1I1SA 2D2WA 2JZYA 2E60A 4QIWN 5FRMA 3KYCB 1JE8A 4KNYA 5ED4A 4Y3OA 3FX3A 2VBXA 1F36A 3MVPA 1J5YA 1Z91A 1E2XA 1LFBA 1L3LA 2VOPA 4D7MA 3IKVA 3O8GA 2K9LA 2W25A 4HW0A 3HOXJ 2E2HJ 3HOYJ 1R4MB 3DTIA 2GXAA 1RPWA 2LKSA 4PGGA 4OINF 3OYHA 2W82A 1WSUA 1FPQA 4RA2A 3MCZA 4WCGA 3GZ6A 4L9VA 4S04A 5K1YA 2WY7Q 2XGXA 2L7FP 3BPXA 2DMUA 5J40A 3C7JA 2XASA 2E7XA 5LEKA 1T33A 1TQMA 1SD5A 5HLGA 2ZMEB 3E3VA 2XSDC 3CJTB 3W6VA 3FXKA 3TW6A 3NWSA 2HYGD 4UUVA 3EPZA 1FP2A 2LK2A 1NK2P 5H6QA 1PP8F 5DD4A 2VQGA 5E3OA 4GFBA 4HAMA 1OISA 1W1WE 1K6YA 1LDDA 2FUG2 5H20A 4BE1A 3GYHX 1P7IA 1X58A 5CPRB 4HRIA 1OR7A 1MMDA 3MKYB 1OYIA 1SMYF 2XGCA 1D3YA 1W36D 1JUSA 3H35A 3HHHA 2EK5A 3OL4A 1OCPA 2GM4A 4XMYA 2MH2A 3L2VA 4BL0B 1HA8A 2IEKA 3CCYA 1U9NA 4YIIA 1CQTA 2MBFA 5IP6A 3HZJA 1BOBA 1P6RA 5J3LA 5JR3A 2PN6A 4CA0A 2ZNZA 3MD2A 4RAYA 3RCOA 1UMQA 3CCLI 1IV6A 1ORKA 3S3NA 1IC8A 3CMEI 5DUIA 4YFNF 2EFWA 1A6QA 1UG2A 2BOLA 1D8JA 2KIFA 2DO7A 2LBFA 2QUFA 3SXYA 3WTSC 1XGNA 1O3TA 1R1UA 2IXSA 2BY0A 2M30A 4A2UA 3HC7A 1XB4A 3A01A 4EGYA 4Y17A 2GBYA 1BN5A 2M0CA 1N75A 5BPDA 4HLYA 3ZQ7A 3BZKA 4N0BA 1K83J 1IRFA 4PFOA 3OYEA 3F6VA 1FIPA 2YU3A 3M8JA 4ABZA 4DYRA 3OYGA 1RIOH 3VWBA 4GGGA 3WG9A 5B3SH 1GVDA 2VJ4A 2IS1A 3DV8A 2VT2A 1FX7A 2TRTA 5L3EA 3JRAA 2AQEA 2VBYA 2QQ9A 5KHDA 2EV0A 4C3IJ 3GTOJ 2PJRB 2HDCA 3LNQA 1S5LC 5F64A 1Q1HA 2JPBA 5DCFA 3EUHA 5KAIC 2HYFA 3SDGA 4ASNA 1GDTA 3EYYA 2NXNB 2ZFWA 5LHIA 2NVUB 3HG9A 1H9TA 1A36A 4FT8A 3SFZA 1JJ8C 3KX2A 4G94A 3ELKA 2DPUA 4A3GJ 4UY8I 1BW5A 3BY6A 2JA2A 2XUBA 1R7JA 5HOOA 1ZG1A 2JSCA 2M8GX 2CG4A 3ERMA 4I02A 3ZOBA 5KNLA 5J8CA 4II3A 4XICA 3LSMA 1X4OA 4RAGA 2LY2A 1TT5B 4V19K 3ISPA 1SAUA 3S8PA 3QP6A 4IHXA 4GRIA 4JK1X 2H09A 1MKMA 3CUOA 1YFHA 3M9AA 4BXXJ 3K4JA 3HIFA 1WI3A 2VC0A 2M3AA 4MFDA 3N4MA 5D4RA 2VONA 2R7SA 3WTWC 2BXYA 3T1BA 4F52A 3I4MJ 2WAFA 3R60A 3FZVA 4C3HJ 3QU6A 2P4WA 3TO6A 1MMSA 2YS9A 2FOWA 1ONVA 1K4SA 2VJIA 3I4NJ 3G1MA 1U6GA 4MFEA 3S15J 1ZK8A 3DFGA 5F1JA 1R6RA 4XKCA 2W7NA 1QZZA 3FWEA 3RKWA 3V7RA 3HOVJ 3HOZJ 4BDZA 2NS0A 2FEZA 3CCUI 3MZHA 2RVCA 3KZIC 5GP9A 2CJJA 3HOSA 1P4XA 1X2MA 2ME6A 4PUSA 1Z1DA 3BG6A 2NVYJ 3PQJA 1OYYA 1HOMA 5B5EC 4G9YA 1NHAA 2GQQA 3G6EI 3FKJA 3G3ZA 4L0YB 4HEA2 3TDUC 2VL8A 2QBYB 5IPAA 3VPRA 5CQGA 4U0YA 1KQ8A 4JQFA 2E19A 1HDPA 5DM6F 1WJBA 2RGVA 1SEUA 1FTZA 1XGOA 3TMOA 1FC3A 2ZMEA 3OYMA 1UELB 2VBZA 4CUGA 3I9V2 1MMNA 1NH3A 2WV0A 5LRSA 4IQ4A 1Z9CA 2LR8A 1ON2A 3RKYA 1RKTA 4P55A 4I01A 1T2KA 3VB2A 1WVRA 3S1MJ 2W48A 5GADJ 3E6DA 3JRBA 3MN2A 1OKRA 4BE0A 3K4MA 1I6HJ 3L2RA 2JA6J 1ETYA 4DBRA 2HVSA 4AD9A 1U2WA 3TQNA 1ZGAA 4XK4A 1ENHA 4AIHA 4ZTJA 1OCTC 2X1CA 4NB5A 3HSRA 3MEXA 1MSFC 1TWHJ 4ENNA 2H8RA 4RBOA 2OUMA 2WAQA 3B6CA 4LMYA 2AO9A 2JMWA 2KPMA 2MLGA 3BCBA 3FHZA 1JKRC 1XGSA 4NC6A 3E6MA 2XF6A 3ZPLA 5LHHA 1MBHA 4E4HA 3U9GA 3D5LA 5JVGF 1Z3XA 1FEXA 1XSDA 4KT5C 5E79C 1HF0A 2BV6A 4AIJA 4FASD 5D5VB 4XIDA 2EFPA 3LSGA 5F6FA 5EYRA 5BPIA 3F23A 4PK4A 2IW5A 2R7QA 4JX5A 2DN0A 2FX0A 3CC4I 4Y15A 4WXHA 5IT9Z 2J5PA 1ZGWA 1KU2A 4V2GA 3MZ8A 2DK5A 4ON0A 1R36A 2E35A 3SHFA 2ZMEC 4XSXF 1BR4A 3CUQA 4D5FA 2EINH 3CDLA 3L1PA 3SEZA 1MDMB 3ZQHA 1Z6RA 3PL8A 2K9MA 2CH0A 3HSEA 3WODF 3AFHA 3WHBA 2K4BA 2LKXA 1SVLA 1DDNA 4L5EA 2BEOA 3TP0A 3WTTC 3JRCA 3PFIA 4QPQA 2KHMA 1T39A 1FTTA 1KU7A 2OTLI 1DP3A 5HLIA 3T8TA 4PFPA 4IOAF 3DU5A 5EF6A 4M3FA 3WTZA 3HRTA 1Z21A 2STWA 1LFPA 1HXDA 1VZ0A 1ITYA 2BHZA 2HU9A 3BJ6A 4CCKA 1PUEE 2ZC2A 1W0TA 5GPCA 3OYLA 3SEQA 1P9QC 4ESJA 4D9JA 1IG7A 4N9IA 1MD0A 5KAFC 2V7FA 2KIMA 2HVQA 1YW9A 1BW6A 2TCTA 5LHGA 3CTAA 4LIUA 3DTEA 2CSOA 2JRMA 2CW0F 3BG7A 5FFXA 2VXDA 1PUFA 4EM0B 4I76A 2FNPA 3A0BC 1TZLA 4BHCA 1LQ1A 3NQOA 2M7AA 1XMKA 2KFDA 4KA4A 4L0ZB 4A3LJ 2HXOA 4B8XA 5J8FA 5M3FJ 1D1BA 5D6FA 3S1NJ 3REOA 1IN7A 3JW4A 4A3JJ 2L9SA 2B7EA 5F08A 2V6EA 1LVAA 4JX4A 1BBYA 5GAGJ 2DJNA 1VQ5I 2E1OA 5CKTA 4LG0B 2GA2A 3IAM2 2XIGA 2A68F 4IL6C 1RRJA 3H0DA 5L3BA 2BZTA 2HQAA 2H6CA 1XDSA 4WX9A 4IF4A 1G3SA 4O5VA 4XKVA 3E1SA 4B09A 3LSRA 2R5YB 4HZFA 3I3LA 1A6IA 3BWGA 1UG0A 1YW8A 2O8XA 3L2UA 2JTVA 2VQCA 1EKEA 1MJAA 5HNHA 4EJOA 3SYTA 4BJ5C 1FYLA 3H0GJ 1X1DA 4F55A 3I59B 3N97A 1OCRH 2DU9A 4OIPF 2OC6A 5J4VA 1ERDA 2HFHA 2LP0A 2DA4A 1DU0A 5IT9K 4BACA 4UV9A 1R22A 5E18F 5CVJA 4UHTA 4LLLA 4GCVA 2CW8A 3OV8A 4PJJA 5E1ZB 2L3DA 3TL4X 2R7VA 1FY7A 5E3LA 3J7AY 4U7DA 2P5LC 3ZMTA 5C4XJ 1E0EA 2M7BA 1JT6A 3I4PA 3S14J 2I8DA 4BHBA 2GIVA 2DMNA 3D5RC 3HM5A 1R00A 2WY8Q 3QWLA 3VYRB 2GOMA 1RC9A 2AXLA 3D5SC 1FOWA 4BXUA 2HKXA 4Q47A 1I5ZA 2KIQA 3EUKL 3S3MA 1ON1A 2L2OA 1Z3YA 3PFYA 3QPLA 3KZYA 1AU7A 5D8KB 4BYYA 3WU1B 4XRSG 5FKOA 1H9GA 3ZN0A 1UB9A 4HG2A 4KIGA 2HZDA 3ZRGA 2EZKA 3W2AA 4NNJA 3I53A 3FHNA 4D1QA 1IUYA 1TWCJ 4BJ6C 2PQ8A 1IN8A 3KP4A 4UB8C 1TNTA 2AXTC 1WFXA 3KEYA 3AL0C 4BGDA 3S2DJ 2O0YA 5HS9A 1BIAA 1Y1WJ 2ACJA 2EILH 3KP2A 1ZYRF 3M3YJ 4JYKA 2FJ1A 3KP7A 1YOVB 1QPMA 3CF2A 1MW7A 3QPSA 3OYAA 3UKGA 3S32A 1IXCA 2X6OA 4ZZDA 2Z1DA 1E3PA 2E2JJ 1FLIA 3R4KA 3HBLA 2X1DA 3GZ5A 1YTYA 1MBJA 4LLNA 5CLSA 4M72A 3LL7A 1LKXA 1E3OC 5GPAA 3QYEA 3DLLF 3FF5A 5HS7A 4RGXA 4B1RA 1J0RA 5IT3A 4B47A 4HF2A 1IN4A 3O3KA 2MC4A 3ZGKA 1XS9A 3RSNA 4BDYA 4MTDA 1X1AA 4PDKA 3MQ0A 4A3CJ 3KIOA 5AIQA 3W2WA 3OYKA 2Y9ZA 2UXXA 2XDVA 5C3EJ 1QO0D 2ISZA 3BG3A 3DTKA 1RKWA 1IAWA 4RAZA 1PDNC 2P7CB 2V6CA 2ZKZA 2HOSA 3MKLA 3WE3A 3E7LA 4CCOA 2HR3A 1LEBA 1TBXA 2KZVA 2NS7A 4EMSA 3GEZA 3F8CA 2A6EF 2OQRA 2OQGA 2P8TA 3G2BA 4XNFA 4XLPF 1IN6A 1Y8RB 4GYGA 4RGUA 4XN3A 3K4LA 4AWXB 2RQQA 2ZXHA 3VYSB 1O3QA 2KIUA 5JFRA 5FLXZ 1K78B 3Q0UA 4BUPA 4I2OA 1A04A 4HV5A 2DYRH 1TWGJ 4XLNF 2Y0SA 2BBYA 4EGZA 1MDMA 2MA3A 5CVUA 3CCEI 1V3FA 2DA3A 2EFQA 5IY5H 1S72I 3RJPA 4HNTA 4IRHA 4DZPA 3LSHA 2LDUA 3BDDA 3BROA 3U1DA 1WJ5A 2E2IJ 2E71A 2LFBA 2KDZA 3RPUD 4H0EA 1U9OA 2OCCH 5C44J 4EEFG 4ENKA 2PI0A 3TDZC 1N77A 1NK3P 1VQKI 2STTA 1WI9A 1SC7A 1NG6A 3I64A 2COBA 1MNDA 2RNGA 3DLAA 2DK8A 4UXNA 5J6XA 1A35A 4XBFA 1SAXA 5A2QZ 3I55I 1HW5A 2QQBA 3IL2A 1USTA 1O4XA 2HNHA 1U0JA 1YE9A 1P4WA 3AG3H 4OWRB 4W1UA 1OPCA 2L0KA 5K7ZA 2HDWA 5FFZA 4YFKF 1KA8A 3PNTA 2L9RA 3FXRA 2BY2A 4RDUA 3HXLA 3R61A 4PJNA 2X1EA 3C2GA 2DXIA 2OU2A 3H5RA 4L18B 2Z9OA 2ZNYA 2BW3B 3F21A 2LY1A 2L54A 4IHWA 4EQQA 3BOQA 4C2MJ 3L09A 2OBPA 3CCMI 1KYZA 1B72B 1XC5A 4YG2F 1RZ4A 2VN2A 1FBUA 1IRXA 4CH7A 5B1AH 3I59A 4CDGA 4AIKA 4M6XA 3K70C 2B0LA 2CV0A 2B63J 1NG7A 1G59A 3JRDA 2R5YA 5FB2A 4H4KC 1ETVA 3RQIA 1Z7LA 2YX4A 1T95A 2ME0A 1ZG5A 2W4SA 2XAFA 4R8HA 3DBRB 2IGKA 1DQUA 4LD5A 4G8XA 3K4BA 2F5EA 2HTJA 3SJMA 1BC7C 1K78A 2KRCA 2R92J 4IPAA 2DMTA 4WXDA 2DTZA 3P9IA 1F5TA 2HGCA 2JWTA 3V8KA 4EVIA 2PJPA 1QGPA 1BI0A 1W5TA 2XAHA 4P1WA 3ABTA 4BY7J 4HNUA 2IGNA 1MGTA 2X4HA 5TJJA 2M8EA 3F3XA 4NC8A 2XROA 1OR7C 4FTHA 1DGWY 2CU7A 3GZNB 5JVTA 4WWCA 1HW1A 3M1CA 4HX8A 4CICA 1ZARA 3DKXA 4JBAA 1GT0C 2CS3A 4HF0A 1QQIA 4J19A 1T56A 3N05A 3PNYA 2JA5J 2FMLA 5FKMA 2Q2EA 4KN4X 1U3EM 1U5TC 3FBNB 3RKXA 1WQ2A 4NUBA 2HTSA 2HPIA 5BNGA 3OS1A 3H5NA 2R7RA 4N9HA 1LDKB 5AIPA 2YSRA 4NC7A 4HA8A 3TOBA 3DPLC 2JN6A 1V5FA 3K1PA 1WRJA 1SFKA 2V9PA 4N4NB 4EJTA 2DDAA 1MIJA 3I71A 1XSVA 4PJ0C 3HRSA 5L3CA 3JCUC 3OYIA 3K70D 3H9GA 3KP6A 1D8KA 1S7AA 4IHYA 2VOOA 3HHGA 5DUKA 2VLAA 1IGNA 1T98A 1Y0NA 2OCEA 3CJRB 4ESBA 1ZRDA 4NQWB 4ZZLA 1VQ9I 4P9FA 1R23A 2HYJA 2NS8A 2JA8J 1K6OA 2H94A 4A3FJ 3F8FA 1UHMA 4BQOA 1JKQC 1Z05A 2F4OB 2LNBA 5L3DA 1G6NA 3OYCA 2KL4A 3LSPA 2BYVE 1O3SA 3TO7A 4CYDA 5CJ9A 1X3WB 4ZC3A 2M4KA 1JUMA 4ENMA 2HWVA 5E1WA 5JI6A 3GVAA 3GLLA 3TGNA 3ZN1A 4ZYDA 1PUFB 3K4CA 2K4JA 2CQKA 4MIMA 1QA6A 2R7XA 2XVCA 1MNMC 3RDIA 2AS5F 4EATA 1VQMI 4M3GA 4LITA 2C6YA 3K1MA 3WGHA 3BZ6A 3LOCA 2X9DA 1FNNA 2J5OA 3F8BA 3L2QA 2YUSA 2ISYA 1JXSA 4D0PA 3DKWA 2KQRA 1I39A 3ZQIA 2HKOA 2KDOA 3E97A 1E3HA 1REPC 1EV7A 4CYCB 1WGXA 1IW7F 2FSWA 1DU6A 2GAUA 1YX3A 2A5YB 1FYKA 4KJZA 4EJVA 4KIBA 3GTJJ 1YJNI 1BA5A 5KK1A 5D5XB 2E5ZA 2MW8A 1K79A 1BR2A 4KDPA 1JHHA 1IJWC 1BC8C 3Q9VA 1WJCA 5K5QA 1ETQA 3BJOA 1EH8A 3CJNA 1LNWA 2P5VA 2L7KA 4KT6A 3LA3A 5FLVA 4U88A 2O9LA 2WAQN 2Z16A 1MBEA 2MD5A 2DAOA 4B4CA 2K86A 4LG0A 3P9KA 3CCSI 2DA2A 5HNFA 1P7JA 3JAMK 3HUGB 3LAJA 3ROUA 5HODA 1ZQ3P 1D0XA 4BH9A 2F5FA 3ABUA 3A4CA 2K40A 1WJDA 1ZRFA 3MFKA 1IV8A 4XN0A 1K61A 2TDXA 1VQNI 1G2HA 5BQTA 3QP5A 1GLNA 5ILSA 3QU3A 2Y0SN 3KFWX 1YJWI 1V5GA 1ZHFA 3FMSA 1Z77A 4MQ9F 2ZSIB 2Q0OA 1I6XA 4XSZF 1T8IA 4A3DJ 3WG7H 1ZREA 4C3JJ 4BXFA 2O6GE 2QQ8A 2DPDA 2VI6A 1TTYA
chains in the Genus database with same CATH topology
5FKLA 3IH3A 4QSHA 1YRNB 5IOYA 3GTKJ 4A3LJ 2HXOA 2XGEA 5M3FJ 3BR2A 3S1NJ 2XPWA 4A3JJ 4D5CA 2HDDA 5IYDJ 5F08A 1AKHB 5FKKA 3BR3A 1F43A 1RETA 4JX4A 2WB1N 1SFOJ 2DJNA 2E1OA 3NAUA 3HEFA 2O7OA 3FK6A 1TWFJ 3LSRA 2R5YB 1A6IA 2XPVA 4A3EJ 2ID6A 3GTGJ 2HOAA 3H0GJ 1QRYA 1U78A 1WH7A 3BTIA 4UUSA 2LP0A 2DA4A 1DU0A 3OSGA 2K9QA 1QVTA 1B72A 5F0HA 3S1RJ 4JX6A 5EGOA 3ZQCA 4AYBN 1VFCA 2O8KA 1ETOA 2LY9A 1IDZA 4UUTA 3HGGA 3GBGA 5F0CA 5E3LA 3NARA 2M34A 1APLC 4Y7NJ 5C4XJ 3LSJA 3FISA 3DCFA 1JT6A 3S14J 1JGGA 3ZQLA 4JP0A 2DMNA 3FIWA 1LE8B 2MG4A 3HM5A 4BBSJ 2K9SA 5E3NA 1I3QJ 3BTJA 2L7MP 3CQZJ 1WPKA 2VKVA 2R5ZA 3S16J 4IEJA 3BG9A 5FJ8J 2ELKA 2LD5A 1QVUA 3O8HA 4IHVA 1POGA 3QPLA 1AU7A 2NOGA 5EZHA 2EZHA 3BG5A 4XRSG 5FKOA 2CUFA 2R0QC 5EDNA 1JTYA 3ZQGA 4QIWN 2EZKA 2D5VA 2NVTJ 3RZDJ 3Q0VA 3BQZA 1TWCJ 5IYBJ 2CQXA 1TC3C 3PO3J 1F36A 3S2DJ 2DA5A 3MVPA 1Y1WJ 2VUMJ 1LFBA 1NTCA 4D7MA 1ETKA 4JYKA 5EZGA 2FJ1A 3M3YJ 3O8GA 3B6AA 2E2HJ 3HOXJ 3HOYJ 5C4JJ 2NVQJ 3QPSA 4MO7A 3UKGA 2X6OA 1IUFA 5M5YJ 4XRSA 1RPWA 2E2JJ 3HBLA 1MBJA 3A02A 2L7FP 1E3OC 5GPAA 2DMUA 5M5WJ 1T33A 4B1RA 2DA6A 1JTXA 4A3KJ 2DMPA 2X48A 1Q1VA 2XSDC 3RKQA 3W6VA 3IV5A 3TW6A 1XS9A 2PMZN 2LK2A 5FKNA 1NK2P 4A3CJ 1VNDA 5E3OA 4GFBA 1XG1A 2DMQA 2Y9ZA 1P7IA 5C3EJ 3OIOA 1X58A 1B8IB 3BG3A 3GTPJ 3PO2J 1RKWA 4X6AJ 2P81A 3HKZN 2HXIA 2XGCA 4LOCA 1OJLA 2XGDA 1JUSA 1HLVA 3MKLA 4HNVA 2HOSA 3E7LA 1MBGA 5EG0A 2NVXJ 2NS7A 1OCPA 2GM4A 2IEKA 3CCYA 4FISA 1U9NA 1CQTA 5IP6A 3OOUA 2M9HA 5J3LA 5EGOB 1W0UA 1UMQA 1IV6A 3Q0UA 1ORKA 1ZKGA 2L7ZA 1IC8A 3BR1A 1TWGJ 2XRLA 3M4OJ 1UG2A 5IYCJ 3Q0WA 1LFUP 2IBDA 2DA3A 3S1QJ 4AUXA 1MSEC 4DZPA 3PM1A 9ANTA 3S17J 3A01A 1GV5A 1R9TJ 2GBYA 2E2IJ 2M0CA 2LFBA 3WHCA 1I50J 1VF9A 4QTRA 1U9OA 2KDZA 3TEDA 1K83J 1AHDP 1FJLA 5C44J 4EEFG 2HQ5A 1NK3P 4DW6A 3RZOJ 1FIPA 4NDLA 2COBA 1VI0A 3A03A 4ABZA 4DYRA 1MBFA 4D7NA 1GVDA 1GV2A 1O4XA 3JRAA 2TRTA 1HCRA 3QQAA 2LTPA 4W1UA 4C3IJ 2L0KA 4DZJA 3GTOJ 1JKPC 5K7ZA 3LNQA 2M2EA 4XRMA 2N8GA 4BBRJ 2HOTA 2L9RA 3SDGA 4M3EA 2FQ4A 2ECBA 5FLMJ 4RDUA 5EEAA 3BR0A 1GDTA 4MLOA 2CQQA 3BTCA 1JT0A 3F0CA 1JJ8C 1WCMJ 4DYQA 4IHWA 2QF7A 4A3GJ 4M3BA 1BW5A 3HB9A 4C2MJ 2OF7A 1D5YA 5DTDA 2G0EA 1Y1VJ 1B72B 1XC5A 2M8GX 1H8AC 2R93J 1FIAA 3CMYA 3ZOBA 5K7HA 2GLOA 2MSYA 4XICA 2KT0A 4M3DA 2B63J 1ZR2A 3JRDA 4IHXA 3HOWJ 2R5YA 2CRGA 2RAEA 1ETVA 4BXXJ 4B3AA 3RQIA 5M3MJ 1WI3A 2ME0A 4A69C 3BTLA 4MFDA 4BKXA 2JK3A 1EF4A 5F0FA 1LE8A 1A5JA 1IRZA 3I4MJ 4FE7A 2DA1A 3BT9A 3SJMA 1AKHA 4C3HJ 2R92J 2DMTA 2DTZA 2JWTA 5JLXA 2YS9A 2R7ZJ 3I4NJ 1H89C 3G1MA 4BY7J 1MH3A 4MFEA 3S15J 1ZK8A 5F1JA 3TW7A 3D1NI 1QPIA 4BY1J 1BL0A 3JRHA 2Y31A 4A3MJ 1BJZA 5J1YA 4FTHA 1MH4A 3HOVJ 3HOZJ 2CU7A 3BR6A 1ETXA 3GTMJ 4G12A 5GP9A 2CJJA 1GT0C 1X2MA 2ME6A 4J19A 2OPTA 1T56A 1HDDC 2JA5J 5FKMA 2NVYJ 5IOZA 1X2NA 1HOMA 2FD5A 2R5ZB 3JRFA 5BNGA 4CYCA 2LVSA 3G1OA 4X1EA 5IPAA 3VPRA 2ECCA 5J1RA 1MBKA 3K7AJ 2MGQA 2E19A 1HDPA 2JN6A 5K7FA 1FTZA 5IP9J 4A3IJ 3JREA 1WH5A 1RESA 2EH3A 2ZB9A 3S2HJ 4IHYA 3HDDA 2LR8A 1IGNA 3SFIA 1RKTA 2EQRA 2Y30A 2HYJA 1ZR4A 3S1MJ 2NS8A 2W48A 2JA8J 3JRBA 3OSFA 3MN2A 4A3FJ 1B8IA 1ZTRA 1JKQC 4FCYA 1I6HJ 1S7EA 2JA6J 1ETYA 4M6VA 2DA7A 2XB5A 3LSPA 2K9NA 3IH4A 3TP3A 3FK7A 4XK4A 1ENHA 1JUMA 1OCTC 5F27A 1TWAJ 3K2AA 1MSFC 1TWHJ 2H8RA 5DS9A 4RBOA 4A3BJ 3B6CA 4AC0A 1PUFB 2AO9A 2JMWA 3FKIJ 1JKRC 5JLWA 4MIMA 1IDYA 1U8BA 2YU9J 1MNMC 1MBHA 3H3VK 2EZLA 1YRNA 2IAIA 2JJ7A 5E3MA 4M3GA 2LLKA 1FEXA 4S0HB 1HF0A 3Q3SA 3LOCA 2X9DA 4XIDA 2YUSA 3LSGA 4V2FA 5EYRA 3JR9A 3ZQIA 2VKEA 4JX5A 1JKOC 1UHSA 2DN0A 2FX0A 2Y2ZA 1ZGWA 1Z0XA 4V2GA 4I6ZA 4CYCB 3G1LA 1WGXA 1DU6A 3A01B 3GTJJ 1BA5A 4D5FA 3CDLA 3L1PA 4A93J 2MW8A 4Y52J 2H1KA 2QCOA 3GTLJ 3ZQHA 1IJWC 4UUSB 3IH2A 1ETQA 2Y9YA 3JRIA 2AHQA 3WHBA 2LKXA 2I10A 3ZQFA 2CUEA 4L5EA 3TP0A 4W97A 3BR5A 3JRCA 5FLVA 2WV1A 2O9LA 2HI3A 3BQYA 2WAQN 3HOUJ 1H88C 2XB0X 5EG0B 2JA7J 1FTTA 1MBEA 4B4CA 3DEWA 1JUPA 3C2BA 3HGYA 2DA2A 1P7JA 5EF6A 2XPUA 4M3FA 5HODA 1ZQ3P 2K40A 1ITYA 1K61A 1GUUA 1ETWA 1W0TA 4FE4A 5GPCA 1G2HA 1JJ6C 5F04A 1IG7A 5J1UA 1RR7A 3GTQJ 1SANA 2VPRA 2EBIA 2Y0SN 5M5XJ 2TCTA 1BW6A 1OFCX 1Z77A 4DYCA 4A3DJ 5IP7J 2ID3A 1PUFA 4I76A 4C3JJ 2EZIA 2VI6A 3JRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKL A;  3IH3 A;  4QSH A;  1YRN B;  5IOY A;  3GTK J;  4A3L J;  2HXO A;  2XGE A;  5M3F J;  3BR2 A;  3S1N J;  2XPW A;  4A3J J;  4D5C A;  2HDD A;  5IYD J;  5F08 A;  1AKH B;  5FKK A;  3BR3 A;  1F43 A;  1RET A;  4JX4 A;  2WB1 N;  1SFO J;  2DJN A;  2E1O A;  3NAU A;  3HEF A;  2O7O A;  3FK6 A;  1TWF J;  3LSR A;  2R5Y B;  1A6I A;  2XPV A;  4A3E J;  2ID6 A;  3GTG J;  2HOA A;  3H0G J;  1QRY A;  1U78 A;  1WH7 A;  3BTI A;  4UUS A;  2LP0 A;  2DA4 A;  1DU0 A;  3OSG A;  2K9Q A;  1QVT A;  1B72 A;  5F0H A;  3S1R J;  4JX6 A;  5EGO A;  3ZQC A;  4AYB N;  1VFC A;  2O8K A;  1ETO A;  2LY9 A;  1IDZ A;  4UUT A;  3HGG A;  3GBG A;  5F0C A;  5E3L A;  3NAR A;  2M34 A;  1APL C;  4Y7N J;  5C4X J;  3LSJ A;  3FIS A;  3DCF A;  1JT6 A;  3S14 J;  1JGG A;  3ZQL A;  4JP0 A;  2DMN A;  3FIW A;  1LE8 B;  2MG4 A;  3HM5 A;  4BBS J;  2K9S A;  5E3N A;  1I3Q J;  3BTJ A;  2L7M P;  3CQZ J;  1WPK A;  2VKV A;  2R5Z A;  3S16 J;  4IEJ A;  3BG9 A;  5FJ8 J;  2ELK A;  2LD5 A;  1QVU A;  3O8H A;  4IHV A;  1POG A;  3QPL A;  1AU7 A;  2NOG A;  5EZH A;  2EZH A;  3BG5 A;  4XRS G;  5FKO A;  2CUF A;  2R0Q C;  5EDN A;  1JTY A;  3ZQG A;  4QIW N;  2EZK A;  2D5V A;  2NVT J;  3RZD J;  3Q0V A;  3BQZ A;  1TWC J;  5IYB J;  2CQX A;  1TC3 C;  3PO3 J;  1F36 A;  3S2D J;  2DA5 A;  3MVP A;  1Y1W J;  2VUM J;  1LFB A;  1NTC A;  4D7M A;  1ETK A;  4JYK A;  5EZG A;  2FJ1 A;  3M3Y J;  3O8G A;  3B6A A;  2E2H J;  3HOX J;  3HOY J;  5C4J J;  2NVQ J;  3QPS A;  4MO7 A;  3UKG A;  2X6O A;  1IUF A;  5M5Y J;  4XRS A;  1RPW A;  2E2J J;  3HBL A;  1MBJ A;  3A02 A;  2L7F P;  1E3O C;  5GPA A;  2DMU A;  5M5W J;  1T33 A;  4B1R A;  2DA6 A;  1JTX A;  4A3K J;  2DMP A;  2X48 A;  1Q1V A;  2XSD C;  3RKQ A;  3W6V A;  3IV5 A;  3TW6 A;  1XS9 A;  2PMZ N;  2LK2 A;  5FKN A;  1NK2 P;  4A3C J;  1VND A;  5E3O A;  4GFB A;  1XG1 A;  2DMQ A;  2Y9Z A;  1P7I A;  5C3E J;  3OIO A;  1X58 A;  1B8I B;  3BG3 A;  3GTP J;  3PO2 J;  1RKW A;  4X6A J;  2P81 A;  3HKZ N;  2HXI A;  2XGC A;  4LOC A;  1OJL A;  2XGD A;  1JUS A;  1HLV A;  3MKL A;  4HNV A;  2HOS A;  3E7L A;  1MBG A;  5EG0 A;  2NVX J;  2NS7 A;  1OCP A;  2GM4 A;  2IEK A;  3CCY A;  4FIS A;  1U9N A;  1CQT A;  5IP6 A;  3OOU A;  2M9H A;  5J3L A;  5EGO B;  1W0U A;  1UMQ A;  1IV6 A;  3Q0U A;  1ORK A;  1ZKG A;  2L7Z A;  1IC8 A;  3BR1 A;  1TWG J;  2XRL A;  3M4O J;  1UG2 A;  5IYC J;  3Q0W A;  1LFU P;  2IBD A;  2DA3 A;  3S1Q J;  4AUX A;  1MSE C;  4DZP A;  3PM1 A;  9ANT A;  3S17 J;  3A01 A;  1GV5 A;  1R9T J;  2GBY A;  2E2I J;  2M0C A;  2LFB A;  3WHC A;  1I50 J;  1VF9 A;  4QTR A;  1U9O A;  2KDZ A;  3TED A;  1K83 J;  1AHD P;  1FJL A;  5C44 J;  4EEF G;  2HQ5 A;  1NK3 P;  4DW6 A;  3RZO J;  1FIP A;  4NDL A;  2COB A;  1VI0 A;  3A03 A;  4ABZ A;  4DYR A;  1MBF A;  4D7N A;  1GVD A;  1GV2 A;  1O4X A;  3JRA A;  2TRT A;  1HCR A;  3QQA A;  2LTP A;  4W1U A;  4C3I J;  2L0K A;  4DZJ A;  3GTO J;  1JKP C;  5K7Z A;  3LNQ A;  2M2E A;  4XRM A;  2N8G A;  4BBR J;  2HOT A;  2L9R A;  3SDG A;  4M3E A;  2FQ4 A;  2ECB A;  5FLM J;  4RDU A;  5EEA A;  3BR0 A;  1GDT A;  4MLO A;  2CQQ A;  3BTC A;  1JT0 A;  3F0C A;  1JJ8 C;  1WCM J;  4DYQ A;  4IHW A;  2QF7 A;  4A3G J;  4M3B A;  1BW5 A;  3HB9 A;  4C2M J;  2OF7 A;  1D5Y A;  5DTD A;  2G0E A;  1Y1V J;  1B72 B;  1XC5 A;  2M8G X;  1H8A C;  2R93 J;  1FIA A;  3CMY A;  3ZOB A;  5K7H A;  2GLO A;  2MSY A;  4XIC A;  2KT0 A;  4M3D A;  2B63 J;  1ZR2 A;  3JRD A;  4IHX A;  3HOW J;  2R5Y A;  2CRG A;  2RAE A;  1ETV A;  4BXX J;  4B3A A;  3RQI A;  5M3M J;  1WI3 A;  2ME0 A;  4A69 C;  3BTL A;  4MFD A;  4BKX A;  2JK3 A;  1EF4 A;  5F0F A;  1LE8 A;  1A5J A;  1IRZ A;  3I4M J;  4FE7 A;  2DA1 A;  3BT9 A;  3SJM A;  1AKH A;  4C3H J;  2R92 J;  2DMT A;  2DTZ A;  2JWT A;  5JLX A;  2YS9 A;  2R7Z J;  3I4N J;  1H89 C;  3G1M A;  4BY7 J;  1MH3 A;  4MFE A;  3S15 J;  1ZK8 A;  5F1J A;  3TW7 A;  3D1N I;  1QPI A;  4BY1 J;  1BL0 A;  3JRH A;  2Y31 A;  4A3M J;  1BJZ A;  5J1Y A;  4FTH A;  1MH4 A;  3HOV J;  3HOZ J;  2CU7 A;  3BR6 A;  1ETX A;  3GTM J;  4G12 A;  5GP9 A;  2CJJ A;  1GT0 C;  1X2M A;  2ME6 A;  4J19 A;  2OPT A;  1T56 A;  1HDD C;  2JA5 J;  5FKM A;  2NVY J;  5IOZ A;  1X2N A;  1HOM A;  2FD5 A;  2R5Z B;  3JRF A;  5BNG A;  4CYC A;  2LVS A;  3G1O A;  4X1E A;  5IPA A;  3VPR A;  2ECC A;  5J1R A;  1MBK A;  3K7A J;  2MGQ A;  2E19 A;  1HDP A;  2JN6 A;  5K7F A;  1FTZ A;  5IP9 J;  4A3I J;  3JRE A;  1WH5 A;  1RES A;  2EH3 A;  2ZB9 A;  3S2H J;  4IHY A;  3HDD A;  2LR8 A;  1IGN A;  3SFI A;  1RKT A;  2EQR A;  2Y30 A;  2HYJ A;  1ZR4 A;  3S1M J;  2NS8 A;  2W48 A;  2JA8 J;  3JRB A;  3OSF A;  3MN2 A;  4A3F J;  1B8I A;  1ZTR A;  1JKQ C;  4FCY A;  1I6H J;  1S7E A;  2JA6 J;  1ETY A;  4M6V A;  2DA7 A;  2XB5 A;  3LSP A;  2K9N A;  3IH4 A;  3TP3 A;  3FK7 A;  4XK4 A;  1ENH A;  1JUM A;  1OCT C;  5F27 A;  1TWA J;  3K2A A;  1MSF C;  1TWH J;  2H8R A;  5DS9 A;  4RBO A;  4A3B J;  3B6C A;  4AC0 A;  1PUF B;  2AO9 A;  2JMW A;  3FKI J;  1JKR C;  5JLW A;  4MIM A;  1IDY A;  1U8B A;  2YU9 J;  1MNM C;  1MBH A;  3H3V K;  2EZL A;  1YRN A;  2IAI A;  2JJ7 A;  5E3M A;  4M3G A;  2LLK A;  1FEX A;  4S0H B;  1HF0 A;  3Q3S A;  3LOC A;  2X9D A;  4XID A;  2YUS A;  3LSG A;  4V2F A;  5EYR A;  3JR9 A;  3ZQI A;  2VKE A;  4JX5 A;  1JKO C;  1UHS A;  2DN0 A;  2FX0 A;  2Y2Z A;  1ZGW A;  1Z0X A;  4V2G A;  4I6Z A;  4CYC B;  3G1L A;  1WGX A;  1DU6 A;  3A01 B;  3GTJ J;  1BA5 A;  4D5F A;  3CDL A;  3L1P A;  4A93 J;  2MW8 A;  4Y52 J;  2H1K A;  2QCO A;  3GTL J;  3ZQH A;  1IJW C;  4UUS B;  3IH2 A;  1ETQ A;  2Y9Y A;  3JRI A;  2AHQ A;  3WHB A;  2LKX A;  2I10 A;  3ZQF A;  2CUE A;  4L5E A;  3TP0 A;  4W97 A;  3BR5 A;  3JRC A;  5FLV A;  2WV1 A;  2O9L A;  2HI3 A;  3BQY A;  2WAQ N;  3HOU J;  1H88 C;  2XB0 X;  5EG0 B;  2JA7 J;  1FTT A;  1MBE A;  4B4C A;  3DEW A;  1JUP A;  3C2B A;  3HGY A;  2DA2 A;  1P7J A;  5EF6 A;  2XPU A;  4M3F A;  5HOD A;  1ZQ3 P;  2K40 A;  1ITY A;  1K61 A;  1GUU A;  1ETW A;  1W0T A;  4FE4 A;  5GPC A;  1G2H A;  1JJ6 C;  5F04 A;  1IG7 A;  5J1U A;  1RR7 A;  3GTQ J;  1SAN A;  2VPR A;  2EBI A;  2Y0S N;  5M5X J;  2TCT A;  1BW6 A;  1OFC X;  1Z77 A;  4DYC A;  4A3D J;  5IP7 J;  2ID3 A;  1PUF A;  4I76 A;  4C3J J;  2EZI A;  2VI6 A;  3JRG A; 
#chains in the Genus database with same CATH topology
 2Z3Y A;  3L2C A;  3S93 A;  1BOA A;  5FKL A;  4QSH A;  4B43 A;  4WXC A;  4M6Y A;  2V1N A;  3BR2 A;  2RDP A;  5IYD J;  2E1N A;  4MEY F;  2FRH A;  5FKK A;  1RET A;  1SFO J;  2WB1 N;  1W7P D;  3WE2 A;  3FMR A;  3GF2 A;  1X1C A;  3HEF A;  4S05 A;  3VSL A;  3DWL E;  3G71 I;  2O7O A;  3V42 A;  1QZY A;  2M0M A;  2V26 A;  4HX4 A;  4G7Z F;  2QKL B;  4HLX A;  2QWW A;  2X85 A;  1TP4 A;  3L00 A;  1HBX G;  4QWQ A;  2F5C A;  3CDI A;  3BLY A;  3CLO A;  3MKZ A;  3GFI A;  5DEQ A;  3KE2 A;  5B1B H;  1TW3 A;  2UZK A;  3WTY C;  1WH7 A;  3ZXS A;  4J01 A;  2OZ6 A;  4FX4 A;  4UUS A;  5LD2 C;  3D0S A;  1QHG A;  3J7A O;  1O7F A;  1QVT A;  2A6H F;  5F0H A;  2XF5 A;  4M9Z A;  3LAP A;  1R49 A;  4JX6 A;  4AYB N;  1VFC A;  2O8K A;  5FRN A;  4PJM A;  2VQL A;  3UNG C;  1RNL A;  2DT7 B;  1STZ A;  2FBH A;  1SVO A;  2LY9 A;  2M5W A;  2KMU A;  4LK1 F;  3EYI A;  1R1V A;  5CYV A;  3HGG A;  2F5V A;  1PJR A;  1FOK A;  2COM A;  2E1M C;  2QEN A;  3AG1 H;  5FGM A;  3NAR A;  2M87 A;  1T38 A;  4I0B A;  2HOE A;  4Y7N J;  3J80 K;  3IWZ A;  2L9V A;  1FP1 D;  2OV7 A;  3JSP A;  2GA1 A;  1FSH A;  3ZQQ A;  3J81 Z;  3ZQL A;  2FXA A;  4KIS A;  1AOY A;  3C3W A;  3FIW A;  3IRR A;  3OOP A;  3KCC A;  3V7S A;  1T6S A;  1ZGJ A;  2W1O A;  4K2E A;  1WWX A;  3LFU A;  2QKM B;  4ANJ A;  3BZC A;  3UR3 C;  5K5O A;  4XLC A;  3KET A;  4BEH B;  3H3U A;  5E3N A;  3V7C A;  2LSO A;  2UUZ A;  3LMM A;  3CQZ J;  4XM3 A;  5F1R A;  1WPK A;  3BG9 A;  2ELK A;  2DDB A;  4E70 A;  3OYB A;  4X0G A;  1POG A;  3HL2 A;  2BXZ A;  5EZH A;  3E6C C;  2CGP A;  4LJZ F;  1I27 A;  3FXQ A;  4OIQ F;  4OMY A;  2LBF B;  1DPU A;  1W5C C;  4P9U A;  4DIQ A;  3A2K A;  3ZQG A;  1W4M A;  1WKM A;  4PSX A;  2I5U A;  4A0X A;  1X3Z B;  2WTE A;  2CQX A;  3I58 A;  1TC3 C;  1XCV A;  3JTG A;  3AKZ A;  2DA5 A;  1L0O C;  1HQC A;  2A69 F;  2VUM J;  1WHU A;  1NTC A;  4ESF A;  2NNY A;  2IT0 A;  1X1B A;  4U7B A;  2CFO A;  2NVQ J;  1BR1 A;  4ZDP A;  2HS5 A;  4LG3 A;  4XRS A;  2EIK H;  3ULQ B;  3PJR A;  3WTX C;  3TO9 A;  3WGG A;  3A02 A;  2OJE D;  5LBQ A;  3QYF A;  3OR2 C;  2K7L A;  1JTX A;  3KZZ A;  2DMP A;  4DQ2 A;  3RTR A;  1UAA A;  3RKQ A;  3LFK A;  2FMY A;  1Z7U A;  4IJA A;  4IX7 A;  3C18 A;  1EA3 A;  1QU3 A;  4RB1 A;  1VND A;  3DU6 A;  3KLO A;  3OYJ A;  3F6O A;  2DMQ A;  1ZLK A;  5A2Q K;  2Z99 A;  2VAS A;  1LVK A;  1FYM A;  3K10 A;  2P81 A;  4X6A J;  1LDJ A;  2HXI A;  1XSX A;  3IWF A;  4DNC A;  3VSK A;  2XGD A;  4U0V A;  1X3U A;  2BVL A;  2VPL A;  2CV1 A;  5H6R A;  2CYY A;  4C30 A;  4HNV A;  1HLV A;  3O2P E;  2BGC A;  2XKO A;  5ICE A;  1G8X A;  3F9K A;  2FNA A;  1S9H A;  2K02 A;  2JT1 A;  2VE8 A;  1QZE A;  2DI3 A;  1W0U A;  2Y48 A;  2IS6 A;  1F1Z A;  2EV5 A;  2KLO A;  3KEQ A;  1W7P A;  3J80 Z;  4JOM A;  3FXU A;  2K5C A;  4AM3 A;  3TBI A;  4A5N A;  1OCO H;  3NEU A;  1P92 A;  3DBH B;  4NQW A;  4Q4Z F;  1XPX A;  2FE3 A;  3Q0W A;  3K6G A;  1WJA A;  1LFU P;  1LB2 A;  1OQY A;  2XRN A;  1VQ4 I;  2IBD A;  4RGR A;  5JHF A;  4AUX A;  4EJW A;  2L4A A;  2E7W A;  3PM1 A;  1PVE A;  9ANT A;  4MHG A;  4CZZ A;  3S17 J;  5DDG A;  2QVO A;  3WHC A;  4RS8 A;  1I50 J;  1XN7 A;  1FJL A;  4BQA A;  3ZR8 X;  4A6D A;  1ZH5 A;  1YS7 A;  1OCC H;  4DW6 A;  4HQM A;  3RZO J;  3ML6 A;  1N25 A;  3GCM A;  4NDL A;  4LIV A;  1VI0 A;  3A03 A;  2IS2 A;  3C1D A;  3CUQ C;  1MBF A;  3A1Y A;  1S8N A;  5D5W B;  2K3F A;  1GV2 A;  1ZRC A;  3DQV C;  2VB6 A;  2JUC A;  2QYO A;  3V4G A;  4OIO F;  2EIJ H;  3QQA A;  2LTP A;  1O3R A;  3EUA A;  3KP5 A;  4C2U A;  2M2E A;  1C0W A;  2DTR A;  1U5T B;  1FBQ A;  4EJU A;  5HDK A;  2IA2 A;  3BR0 A;  4DGW B;  4G7H F;  1LEA A;  3BTC A;  3E5X A;  4YEL A;  3F0C A;  5ILU A;  2W84 A;  1WCM J;  1B9M A;  1YJ9 I;  3CP8 A;  1KQ0 A;  1IN5 A;  3CMA I;  4M3B A;  3PSF A;  1BI1 A;  2VBW A;  3ZMD A;  4CHU A;  3MKW B;  2BY1 A;  2JUG A;  3H5A A;  5DTD A;  2ZJR F;  1Y1V J;  4IO9 F;  2R93 J;  1YIJ I;  1FIA A;  4M9X A;  3CMY A;  2DJI A;  1T0F C;  5EEG A;  3RIR A;  1ZAO A;  4CZC A;  3KYD B;  4RLF A;  3LQR A;  3X2Q H;  4M3D A;  1ZR2 A;  1H0M A;  4M73 A;  4PZJ A;  3FXM A;  4FQG A;  2NRA C;  3HOW J;  2CRG A;  1TQP A;  2RAE A;  3F72 A;  3JAM Z;  1CF7 B;  2A07 F;  4B3A A;  5ERI A;  2XSJ C;  3QYB A;  4BAY A;  2GXB A;  4A69 C;  2M4G A;  5KCM A;  2KRF A;  4BKX A;  4Q5S F;  4HX7 A;  3E0J B;  5F0F A;  1LE8 A;  1IRZ A;  4U87 A;  1J2X A;  1IXS B;  3VYT B;  3PUB A;  1AKH A;  2R7O A;  4YEJ A;  4UB6 C;  4NBQ A;  4E7J A;  3W6J B;  2R7D A;  1VQ7 I;  3S3O A;  5FLX K;  1QPI A;  3TW7 A;  3D1N I;  4BY1 J;  1BL0 A;  1ODD A;  3OYN A;  4A3M J;  1PYV A;  2F48 A;  2XAQ A;  1MH4 A;  1UJ8 A;  3ZMS A;  2H6B A;  3BR6 A;  3SDB A;  3GTM J;  4G12 A;  2JVG A;  1T0F A;  4ENJ A;  3QPH A;  2F2E A;  4FHT A;  3ZMU A;  1V5E A;  5FD5 A;  1TW2 A;  2OPT A;  1HDD C;  4Y13 A;  3M1E A;  3R0A A;  4XOR A;  1FT9 A;  3QPT A;  3OY9 A;  4KMF A;  2BY3 A;  2UXN A;  3JRF A;  2LVS A;  2CO5 A;  1SMT A;  4IKF A;  2ECC A;  2Z2S B;  1MBK A;  3K7A J;  3U2R A;  2IS4 A;  2NOJ B;  2MGQ A;  2D1V A;  3CUQ B;  2P7V B;  5K7F A;  2OTJ I;  4RB3 C;  1CF7 A;  5IP9 J;  4A3I J;  4L5J A;  2V1U A;  1RES A;  2EH3 A;  2PMZ A;  2BHY A;  2KP6 A;  2KJC A;  3HDD A;  4AVZ A;  3FXO A;  1YS6 A;  2Y30 A;  2ESH A;  2KKO A;  3OSF A;  1ZG3 A;  4HPQ A;  4KYW A;  3I0T A;  1YLF A;  4M6V A;  2XB5 A;  3EET A;  4CCL A;  4LGW A;  3HYI A;  1YIT I;  2QZ8 A;  2BW3 A;  1VQL I;  4DBQ A;  3TP3 A;  3ECH A;  3FK7 A;  1S3J A;  2R3S A;  5F27 A;  1VQP I;  4NHJ A;  2ZFU A;  2WBM A;  1MMA A;  1J9I A;  4EV0 A;  5DS9 A;  4Y33 A;  2LRD A;  1QHH D;  2CW7 A;  1RUN A;  4CGZ A;  1ZLJ A;  4KN7 X;  2DFI A;  1P4A A;  3K69 A;  3KYL A;  2IAI A;  1WJE A;  3LA2 A;  2XF7 A;  1KGS A;  4BS9 A;  3ASO H;  1XX5 A;  5DCM B;  1VQO I;  2LLK A;  4CCJ A;  1P2F A;  4S0H B;  4N4O B;  2DQL A;  2EJR A;  2Y69 H;  4OAY A;  2MAB A;  2ESN A;  2WAE A;  3DBL B;  4G6D A;  4V2F A;  3JR9 A;  1OCZ H;  2ADU A;  2VKE A;  1JKO C;  4HOB A;  5FO5 A;  5BOX A;  2Z33 A;  1EH6 A;  4I6Z A;  4KMU X;  3RYP A;  3W6K B;  3G1L A;  3NWT A;  5TRD A;  4KFC A;  4YIR X;  3A01 B;  1YI2 I;  1K4T A;  2IRF G;  3OIQ A;  4ZYG A;  3Q9S A;  2G9W A;  3FXL A;  3CES A;  4LLG F;  2F6C A;  3U1K A;  4Y52 J;  1SD6 A;  4P5O A;  3FBI B;  4XOT A;  2EFN A;  3VEP A;  4A5M A;  1RR8 C;  4UUS B;  3IH2 A;  3VOE A;  3J7Y J;  5TIS C;  2AHQ A;  1B1B A;  3I54 A;  4WF2 A;  2QM3 A;  1R71 A;  4M71 A;  2YPR A;  2DLL A;  2L5Q A;  4W97 A;  3L7W A;  2WV1 A;  4KUM A;  1KU3 A;  3HOU J;  2XB0 X;  1OMI A;  2Y75 A;  5EG0 B;  5TGT A;  2CQN A;  2PMU A;  3DEW A;  4C2T A;  3C2B A;  3IC7 A;  1VQ6 I;  3HGY A;  3M8E A;  3CMM A;  3CO7 C;  2DBB A;  2XPU A;  3AL0 B;  3NRV A;  5DYM A;  3PUF A;  1Y0U A;  3OS2 A;  1LUJ B;  5GTH C;  1XMX A;  5CVV A;  3FXJ A;  1GUU A;  5D6E A;  2ZSH B;  1ZEL A;  4B48 A;  5D5U B;  1G3Y A;  1JJ6 C;  5F04 A;  1RR7 A;  3GTQ J;  1SAN A;  4DJA A;  3H9J A;  4R79 A;  2JQ7 A;  3RYR A;  2LYC A;  5H2F C;  1U8R A;  3HUG A;  1XGM A;  2ID3 A;  2EZI A;  3CCR I;  1HSJ A;  3T0Y A;  3JRG A;  1FSE A;  2NYX A;  4RGS A;  2CV2 A;  3SZT A;  3IH3 A;  1YRN B;  4E7I A;  3GTK J;  2VJJ A;  5DV5 A;  2OA4 A;  5E8G A;  2XPW A;  3U21 A;  2MC3 A;  1IZ1 A;  2HDD A;  3LWF A;  1W7P B;  1JGS A;  3HOT A;  3VYU B;  4MEX F;  1AKH B;  2O5R A;  5ICF A;  2L9N A;  1N78 A;  1F43 A;  4IZZ A;  3HRU A;  2D45 A;  4KIF A;  3NAU A;  2E1M B;  2EPF A;  3P5J A;  4GO1 A;  2KIS A;  1SD4 A;  2OZU A;  1R5H A;  3FM3 A;  3M07 A;  3J81 K;  5LGT A;  1F4K A;  3JTH A;  1TWF J;  2CFX A;  2X6Y A;  5L3G A;  2W24 A;  2PMH A;  2XPV A;  3GTG J;  4I7H A;  2BE5 F;  2RNJ A;  1U78 A;  3VDX A;  1F9N A;  3QAH A;  5HLH A;  1ZN2 A;  4OMZ A;  3IUO A;  3OSG A;  2K9Q A;  1B72 A;  2P6S A;  2Q2E B;  2ZCW A;  5EJC A;  5EGO A;  2LF8 A;  3ZQC A;  5E8I A;  4O3M A;  5E20 A;  4BHP A;  2IGM A;  3GO5 A;  1ETO A;  2JPC A;  4QPO A;  1UFM A;  2ICW G;  3WU2 C;  1IDZ A;  3S2W A;  3RPQ A;  4UUT A;  2A05 A;  1RUO A;  2OAZ A;  4XLE A;  4XKB A;  2V9V A;  3E5U A;  2ZXJ A;  3CP2 A;  5F0C A;  3W3C A;  3HPG A;  3DCF A;  2WWY A;  2O03 A;  3EQL F;  3IHU A;  3GLX A;  4AID A;  3I56 I;  2Q1Z B;  3PIO F;  1OLT A;  2K9S A;  1TNS A;  2KJB A;  2IJL A;  4XRF A;  2R7U A;  3BTJ A;  4OOI A;  3BCA A;  2R5Z A;  2VOD A;  1D1C A;  4IEJ A;  5FJ8 J;  3K9T A;  2P0W A;  3B73 A;  2LD5 A;  3O8H A;  3R6S A;  1HKS A;  4IHV A;  3GUD A;  4ZDO A;  2ELJ A;  2V9K A;  5GTI C;  2EZH A;  4HYE A;  4BQN A;  5D8L B;  4BNC A;  3BG5 A;  4MQV A;  2MD0 A;  2CUF A;  4IRI A;  2R0Q C;  3K4K A;  4F91 B;  1JTY A;  4XLA A;  2R7W A;  2D5V A;  2NVT J;  3RZD J;  3OS0 A;  4B3X A;  3EDP A;  3Q0V A;  2RRE A;  2H8W A;  3BQZ A;  5IYB J;  2F4I A;  3CF5 F;  1S29 A;  3OIP A;  3H9Q A;  4CXF A;  4ZDL A;  2MYS A;  4UNO A;  1BJA A;  3PO3 J;  1YW7 A;  4HSR A;  3MAJ A;  5BMZ A;  1Z6T A;  4XOP A;  3CC2 I;  2LMD A;  3H3Z A;  4ZJZ A;  1ETK A;  3WU0 A;  5EZG A;  5LEJ A;  2IA0 A;  3B6A A;  5C4J J;  1YHQ I;  3LA7 A;  4XQF A;  4MO7 A;  4U0W A;  1HKT A;  5M5Y J;  1IUF A;  4A12 A;  4IOC F;  2O3F A;  2R7F A;  4F7Z A;  4M9S A;  3KPH A;  5KVR A;  2IP2 A;  1XDU A;  1GXQ A;  2FBK A;  2ZJ2 A;  5CVR A;  2LH9 A;  5M5W J;  3IKT A;  1B59 A;  2R7T A;  2DA6 A;  1ULY A;  2ZXI A;  4A3K J;  2X48 A;  1Q1V A;  2PJR A;  2E36 A;  3IV5 A;  2M45 A;  2QA4 I;  2BVM A;  2PMZ N;  2Y0M A;  5FKN A;  2XAJ A;  2VJ5 A;  2X51 A;  4G7O F;  3PSI A;  3L9F A;  3QRF F;  1BI3 A;  1XG1 A;  2W57 A;  2CMP A;  3OIO A;  4Z6Y A;  5CVI A;  3WTV C;  1B8I B;  3V8J A;  3GTP J;  3HPH A;  3PO2 J;  1G3W A;  3HKZ N;  3WTU C;  3CZ6 A;  4HDV A;  4LOC A;  3ZMZ A;  1OJL A;  4KIT B;  5CQE A;  2E5N A;  5GAH J;  2MFZ A;  1QNT A;  1MBG A;  5EG0 A;  2NVX J;  2UV1 A;  1R4N B;  3OYD A;  2DFE A;  4FIS A;  2ELH A;  1X4P A;  4XON A;  4L9J A;  3HJE A;  3OOU A;  1D0Y A;  1TLH B;  2DFF A;  2M9H A;  3SZG A;  4AVP A;  5B66 C;  5EGO B;  2GIZ A;  1W5S A;  3HKZ A;  4XLF A;  3RQ4 A;  2L7Z A;  1ZKG A;  2LOO A;  3BR1 A;  2X6X A;  4F92 B;  1DUX C;  3AG4 H;  4MNU A;  4EM2 A;  1X19 A;  2XRL A;  5IYC J;  3M4O J;  2VT3 A;  1Y6I A;  4Y4R A;  3KP3 A;  3LST A;  2B9S A;  3S1Q J;  1MSE C;  1PP7 U;  4LFU A;  3T8R A;  3GX4 X;  1GV5 A;  1R9T J;  3P7N A;  4HDU A;  2L02 A;  5D4S A;  4QTR A;  3TED A;  1VF9 A;  4YFX F;  1AHD P;  2KZG A;  3GWZ A;  2AQF A;  2HQ5 A;  5J47 A;  2JSP A;  2HPM A;  1R5G A;  2D1H A;  1FBS A;  2HQN A;  2XKP A;  5JHU A;  1I3A A;  2EB7 A;  4I98 B;  3J7Z I;  4D7N A;  2VC1 A;  1YQA A;  2W85 A;  3MMY B;  4PGH A;  3QOP A;  3MWM A;  2X6W A;  2L4M A;  5HVQ C;  2FQ3 A;  2DT6 A;  1SFX A;  2NAZ A;  1HCR A;  1J75 A;  4I09 A;  5ICC A;  2V1X A;  2V4J C;  4DZJ A;  4ZYE A;  2VKH A;  4QLC U;  4ZTF A;  1JKP C;  4XRM A;  2N8G A;  4XR6 A;  4ZYA A;  4BBR J;  3G4S I;  1OYW A;  2P5K A;  2HOT A;  5LLQ A;  1TQI A;  2ECB A;  2FQ4 A;  4M3E A;  5FLM J;  5EEA A;  4MLO A;  2CQQ A;  4IRG A;  1JT0 A;  2X0L A;  3O6B B;  3I5U A;  4DYQ A;  2QF7 A;  2R4G A;  3HSF A;  1EH7 A;  1WJF A;  1UZC A;  3V8L A;  4YIF A;  1ACI A;  4LK0 F;  3K2Z A;  1U5T A;  4ZYH A;  3HB9 A;  2OF7 A;  1KZH A;  4ETS A;  1D5Y A;  3PNV A;  5J4Y A;  3ERE D;  4P96 A;  1MZB A;  2G0E A;  3GFJ A;  3OYF A;  1H8A C;  3ASN H;  2ZO4 A;  1YG2 A;  3OWT A;  5K7H A;  2UWM A;  3DPU A;  2ZJQ F;  2GLO A;  2MSY A;  3DEU A;  2LKP A;  2XHK A;  1X1P A;  2IPQ X;  2KT0 A;  2CQ7 A;  1VQ8 I;  2RV8 A;  1Y8Q B;  5FRO A;  4E7S A;  4OIR F;  2EV6 A;  2PLY A;  3C2H A;  2DCE A;  1FZP B;  3SZP A;  2VQH A;  2HVR A;  3IP4 B;  1MJB A;  5M3M J;  4BEH A;  3BTL A;  3ZMV A;  3WGI A;  1O57 A;  2V1D A;  2NNN A;  1MNE A;  4FET A;  1BI2 A;  3CCQ I;  2JK3 A;  3ONQ A;  4PJL A;  1EF4 A;  1A5J A;  2OD5 A;  2LC2 A;  4FE7 A;  2DA1 A;  3BT9 A;  4OAZ A;  3ZP5 A;  3KEO A;  1GHC A;  1XTA A;  4I0A A;  3FMQ A;  4RAF A;  2WB1 A;  2DOA A;  1BM9 A;  2F4M B;  5JLX A;  3COA C;  4CCN A;  2R7Z J;  2XV4 S;  1H89 C;  1MH3 A;  3IRQ A;  2IVM A;  2MLK A;  1S6L A;  1Y39 A;  3JRH A;  2Y31 A;  2E1C A;  4XKW A;  1BJZ A;  5J1Y A;  1KYW A;  4BE2 A;  4KIC A;  3ECO A;  3CD6 I;  2YR2 A;  3DP7 A;  1ETX A;  3F8M A;  1G3T A;  4PCQ A;  1K7A A;  5HLT A;  2MH9 A;  2K27 A;  3AAF A;  1I1G A;  2EFO A;  2F5D A;  3CC7 I;  3DKY A;  5IOZ A;  1E17 A;  1FWZ A;  1X2N A;  3K4N A;  2LRE A;  4Q48 A;  1FMV A;  2FD5 A;  2ZBK A;  2R5Z B;  4CYC A;  3G1O A;  2XAG A;  4X1E A;  3F8N A;  3H92 A;  5J1R A;  2EA4 A;  2RKH A;  1BIB A;  2VE9 A;  2PG4 A;  5HDN A;  4RB0 A;  2WC2 A;  3BC8 A;  1SD7 A;  1WH5 A;  3K0L A;  3ZCO A;  3JRE A;  1D0Z A;  2ZB9 A;  3KLN A;  1D1A A;  4C9Y A;  3S2H J;  3LSI A;  4E7H A;  4LB5 A;  3RI4 A;  2VXZ A;  2DW4 A;  1MMG A;  2HZT A;  3SFI A;  2EQR A;  2ZJP F;  1ZR4 A;  2FA5 A;  3GW2 A;  1SFE A;  3AG2 H;  2JRT A;  3BJA A;  1B8I A;  1ZTR A;  3H1C A;  4AU7 A;  4FCY A;  1S7E A;  2XC7 A;  2DA7 A;  2EWN A;  1B9N A;  5GAE J;  2CUZ A;  2GOX B;  2K9N A;  3IH4 A;  2QQA A;  1TT0 A;  4L9T A;  4I99 C;  4HST A;  3GFM A;  5LGU A;  1TWA J;  3K2A A;  3ESW B;  2RQP A;  3DEE A;  1HW2 A;  1B6A A;  4XL9 A;  4A3B J;  4AC0 A;  2CUJ A;  3PQK A;  2DQR A;  3FKI J;  4IXA A;  5JLW A;  1U8B A;  1IDY A;  1KON A;  2FBI A;  2GZW A;  2ZXW H;  3K1N A;  2YU9 J;  5AON A;  3CCJ I;  3F22 A;  3H3V K;  4CSW A;  2EZL A;  1YRN A;  6PAX A;  2O61 A;  2JJ7 A;  2LG4 A;  4FX0 A;  5E3M A;  3OMY A;  4GDF A;  2M1B A;  2L01 A;  2W00 A;  1D5V A;  3Q3S A;  3ABL H;  1V4R A;  3P9C A;  3Q5F A;  1VTN C;  3L2W A;  1O7L A;  3BP8 A;  1XMA A;  5LGN A;  1UHS A;  2Y2Z A;  3CJQ B;  4CCM A;  1Z0X A;  2QSF X;  1B4A A;  4E7Z A;  4HF1 A;  4O6J A;  4UVC A;  1T08 B;  4F3Q A;  3HTU A;  1LJ9 A;  3E5Q A;  1YX5 A;  3PIP F;  4L5I A;  1XCB A;  4HBL A;  1V54 H;  4A93 J;  2H1K A;  2QCO A;  4IVN A;  5L3F A;  3GTL J;  2FU4 A;  3HRM A;  2A61 A;  2QBY A;  4HQE A;  1LPQ A;  4ITV A;  4RM2 A;  2Y9Y A;  3JRI A;  1IO2 A;  3M7G A;  4BJT A;  3CCV I;  2ETH A;  4L9N A;  5ILV A;  2I10 A;  3ZQF A;  1EJ9 A;  2QGU A;  5EEH A;  2CUE A;  1Y56 A;  2E34 A;  2K3P A;  3BR5 A;  2HI3 A;  3BQY A;  4PSW A;  4UVB A;  3TOA A;  1H88 C;  1A31 A;  2EIM H;  3OL3 A;  1SVM A;  4TV7 A;  2JA7 J;  4EM1 A;  3OR1 C;  2DT5 A;  4ZH4 F;  1JUP A;  2Z5U A;  2YX7 A;  1R58 A;  1GVJ A;  2G7H A;  1QBJ A;  1AA7 A;  3QOE A;  4MGR A;  2KRH A;  1XD7 A;  5ICG A;  3LQQ A;  3EUH C;  3HTS B;  3VFZ A;  4IQJ A;  1M1E B;  1JHF A;  1WZ2 A;  3ABM H;  1ETW A;  4FE4 A;  5DM7 F;  4UV8 A;  5J1U A;  1J59 A;  4RB2 C;  4OU0 A;  2VPR A;  2QSG X;  2EBI A;  4F93 B;  5DD8 A;  4J00 A;  5M5X J;  1J09 A;  1DP7 P;  1OFC X;  1GXP A;  2G7U A;  3BPV A;  3RPU A;  4AYB A;  2LF7 A;  4DYC A;  5IP7 J;  1S7O A;  1IF1 A;  2XAU A;  4B44 A;  3T5X A;  3QOD A;  3B02 A;  4LB6 B;  1DGR M;  2V79 A;  2JVH A;  3GFL A;  4E7L A;  4WK8 F;  5IOY A;  4BU2 A;  2DYS H;  2XGE A;  5E1X A;  2A5W A;  1AWC A;  1YYV A;  2QSH X;  4RMN A;  4D5C A;  1USS A;  2GWR A;  1UHW A;  3A0H C;  1J7K A;  2PBI A;  3BR3 A;  1HC8 A;  3DXJ F;  4XLH A;  2DOF A;  3W2V A;  4RLQ A;  3E6B A;  4YRV A;  1KQ9 A;  3JSO A;  2DOE A;  4G6Q A;  3H36 A;  3FK6 A;  1IRG A;  2FF4 A;  5E17 F;  3M8F A;  1FMW A;  4G6T B;  4A3E J;  5LRR A;  1FOY A;  2ID6 A;  2HOA A;  2QLZ A;  3SQN A;  3R0J A;  5HDG A;  3CO6 C;  4II2 A;  4IHT A;  1QRY A;  2FOK A;  2GXG A;  3BTI A;  1MJ9 A;  2HEO A;  4A0Y A;  2WA0 A;  1YO5 C;  2A3S A;  5DCM A;  2RC4 A;  1IXR C;  1JI8 A;  4M74 A;  2VIX A;  3G73 A;  3S1R J;  2WAD A;  2CWE A;  2P6T A;  5K5R A;  4E6K G;  1SFU A;  5FD6 A;  4A6E A;  3GBG A;  2DFH A;  1HKQ A;  5HS8 A;  3CLQ A;  2IA1 A;  2M34 A;  3DF8 A;  1APL C;  2EA2 A;  2H27 A;  3FDY A;  2K85 A;  1R5I D;  3LSJ A;  2HQR A;  3FIS A;  4RM3 A;  4Z2Y A;  1FOX A;  4CO8 A;  1V55 H;  1JGG A;  1DPR A;  2H1L A;  1R1T A;  4IHS A;  4JP0 A;  1RI7 A;  1LE8 B;  2PEX A;  2MG4 A;  3LSK A;  1KU9 A;  2DOD A;  4BBS J;  4BQQ A;  2QEX I;  4E7K A;  1TL8 A;  1Z67 A;  3CDH A;  1YIO A;  2IGO A;  2PX9 A;  4A0Z A;  2RN7 A;  1HST A;  4UVA A;  1I3Q J;  4R1H A;  2L7M P;  4GYI A;  3MZY A;  3GME A;  4DOZ A;  2PFB A;  2VKV A;  3GXO A;  1W36 C;  3S16 J;  2VKD A;  1G4D A;  3IAS 2;  3TKY A;  1QVU A;  4MTE A;  4HV6 A;  2NOG A;  2Q8K A;  4GXO A;  2A6T A;  1CGP A;  3DPT A;  3ABK H;  5LFA A;  1UCR A;  5EDN A;  3FM5 A;  3VOD A;  5BS6 A;  1I1S A;  2D2W A;  2JZY A;  2E60 A;  4QIW N;  5FRM A;  3KYC B;  1JE8 A;  4KNY A;  5ED4 A;  4Y3O A;  3FX3 A;  2VBX A;  1F36 A;  3MVP A;  1J5Y A;  1Z91 A;  1E2X A;  1LFB A;  1L3L A;  2VOP A;  4D7M A;  3IKV A;  3O8G A;  2K9L A;  2W25 A;  4HW0 A;  3HOX J;  2E2H J;  3HOY J;  1R4M B;  3DTI A;  2GXA A;  1RPW A;  2LKS A;  4PGG A;  4OIN F;  3OYH A;  2W82 A;  1WSU A;  1FPQ A;  4RA2 A;  3MCZ A;  4WCG A;  3GZ6 A;  4L9V A;  4S04 A;  5K1Y A;  2WY7 Q;  2XGX A;  2L7F P;  3BPX A;  2DMU A;  5J40 A;  3C7J A;  2XAS A;  2E7X A;  5LEK A;  1T33 A;  1TQM A;  1SD5 A;  5HLG A;  2ZME B;  3E3V A;  2XSD C;  3CJT B;  3W6V A;  3FXK A;  3TW6 A;  3NWS A;  2HYG D;  4UUV A;  3EPZ A;  1FP2 A;  2LK2 A;  1NK2 P;  5H6Q A;  1PP8 F;  5DD4 A;  2VQG A;  5E3O A;  4GFB A;  4HAM A;  1OIS A;  1W1W E;  1K6Y A;  1LDD A;  2FUG 2;  5H20 A;  4BE1 A;  3GYH X;  1P7I A;  1X58 A;  5CPR B;  4HRI A;  1OR7 A;  1MMD A;  3MKY B;  1OYI A;  1SMY F;  2XGC A;  1D3Y A;  1W36 D;  1JUS A;  3H35 A;  3HHH A;  2EK5 A;  3OL4 A;  1OCP A;  2GM4 A;  4XMY A;  2MH2 A;  3L2V A;  4BL0 B;  1HA8 A;  2IEK A;  3CCY A;  1U9N A;  4YII A;  1CQT A;  2MBF A;  5IP6 A;  3HZJ A;  1BOB A;  1P6R A;  5J3L A;  5JR3 A;  2PN6 A;  4CA0 A;  2ZNZ A;  3MD2 A;  4RAY A;  3RCO A;  1UMQ A;  3CCL I;  1IV6 A;  1ORK A;  3S3N A;  1IC8 A;  3CME I;  5DUI A;  4YFN F;  2EFW A;  1A6Q A;  1UG2 A;  2BOL A;  1D8J A;  2KIF A;  2DO7 A;  2LBF A;  2QUF A;  3SXY A;  3WTS C;  1XGN A;  1O3T A;  1R1U A;  2IXS A;  2BY0 A;  2M30 A;  4A2U A;  3HC7 A;  1XB4 A;  3A01 A;  4EGY A;  4Y17 A;  2GBY A;  1BN5 A;  2M0C A;  1N75 A;  5BPD A;  4HLY A;  3ZQ7 A;  3BZK A;  4N0B A;  1K83 J;  1IRF A;  4PFO A;  3OYE A;  3F6V A;  1FIP A;  2YU3 A;  3M8J A;  4ABZ A;  4DYR A;  3OYG A;  1RIO H;  3VWB A;  4GGG A;  3WG9 A;  5B3S H;  1GVD A;  2VJ4 A;  2IS1 A;  3DV8 A;  2VT2 A;  1FX7 A;  2TRT A;  5L3E A;  3JRA A;  2AQE A;  2VBY A;  2QQ9 A;  5KHD A;  2EV0 A;  4C3I J;  3GTO J;  2PJR B;  2HDC A;  3LNQ A;  1S5L C;  5F64 A;  1Q1H A;  2JPB A;  5DCF A;  3EUH A;  5KAI C;  2HYF A;  3SDG A;  4ASN A;  1GDT A;  3EYY A;  2NXN B;  2ZFW A;  5LHI A;  2NVU B;  3HG9 A;  1H9T A;  1A36 A;  4FT8 A;  3SFZ A;  1JJ8 C;  3KX2 A;  4G94 A;  3ELK A;  2DPU A;  4A3G J;  4UY8 I;  1BW5 A;  3BY6 A;  2JA2 A;  2XUB A;  1R7J A;  5HOO A;  1ZG1 A;  2JSC A;  2M8G X;  2CG4 A;  3ERM A;  4I02 A;  3ZOB A;  5KNL A;  5J8C A;  4II3 A;  4XIC A;  3LSM A;  1X4O A;  4RAG A;  2LY2 A;  1TT5 B;  4V19 K;  3ISP A;  1SAU A;  3S8P A;  3QP6 A;  4IHX A;  4GRI A;  4JK1 X;  2H09 A;  1MKM A;  3CUO A;  1YFH A;  3M9A A;  4BXX J;  3K4J A;  3HIF A;  1WI3 A;  2VC0 A;  2M3A A;  4MFD A;  3N4M A;  5D4R A;  2VON A;  2R7S A;  3WTW C;  2BXY A;  3T1B A;  4F52 A;  3I4M J;  2WAF A;  3R60 A;  3FZV A;  4C3H J;  3QU6 A;  2P4W A;  3TO6 A;  1MMS A;  2YS9 A;  2FOW A;  1ONV A;  1K4S A;  2VJI A;  3I4N J;  3G1M A;  1U6G A;  4MFE A;  3S15 J;  1ZK8 A;  3DFG A;  5F1J A;  1R6R A;  4XKC A;  2W7N A;  1QZZ A;  3FWE A;  3RKW A;  3V7R A;  3HOV J;  3HOZ J;  4BDZ A;  2NS0 A;  2FEZ A;  3CCU I;  3MZH A;  2RVC A;  3KZI C;  5GP9 A;  2CJJ A;  3HOS A;  1P4X A;  1X2M A;  2ME6 A;  4PUS A;  1Z1D A;  3BG6 A;  2NVY J;  3PQJ A;  1OYY A;  1HOM A;  5B5E C;  4G9Y A;  1NHA A;  2GQQ A;  3G6E I;  3FKJ A;  3G3Z A;  4L0Y B;  4HEA 2;  3TDU C;  2VL8 A;  2QBY B;  5IPA A;  3VPR A;  5CQG A;  4U0Y A;  1KQ8 A;  4JQF A;  2E19 A;  1HDP A;  5DM6 F;  1WJB A;  2RGV A;  1SEU A;  1FTZ A;  1XGO A;  3TMO A;  1FC3 A;  2ZME A;  3OYM A;  1UEL B;  2VBZ A;  4CUG A;  3I9V 2;  1MMN A;  1NH3 A;  2WV0 A;  5LRS A;  4IQ4 A;  1Z9C A;  2LR8 A;  1ON2 A;  3RKY A;  1RKT A;  4P55 A;  4I01 A;  1T2K A;  3VB2 A;  1WVR A;  3S1M J;  2W48 A;  5GAD J;  3E6D A;  3JRB A;  3MN2 A;  1OKR A;  4BE0 A;  3K4M A;  1I6H J;  3L2R A;  2JA6 J;  1ETY A;  4DBR A;  2HVS A;  4AD9 A;  1U2W A;  3TQN A;  1ZGA A;  4XK4 A;  1ENH A;  4AIH A;  4ZTJ A;  1OCT C;  2X1C A;  4NB5 A;  3HSR A;  3MEX A;  1MSF C;  1TWH J;  4ENN A;  2H8R A;  4RBO A;  2OUM A;  2WAQ A;  3B6C A;  4LMY A;  2AO9 A;  2JMW A;  2KPM A;  2MLG A;  3BCB A;  3FHZ A;  1JKR C;  1XGS A;  4NC6 A;  3E6M A;  2XF6 A;  3ZPL A;  5LHH A;  1MBH A;  4E4H A;  3U9G A;  3D5L A;  5JVG F;  1Z3X A;  1FEX A;  1XSD A;  4KT5 C;  5E79 C;  1HF0 A;  2BV6 A;  4AIJ A;  4FAS D;  5D5V B;  4XID A;  2EFP A;  3LSG A;  5F6F A;  5EYR A;  5BPI A;  3F23 A;  4PK4 A;  2IW5 A;  2R7Q A;  4JX5 A;  2DN0 A;  2FX0 A;  3CC4 I;  4Y15 A;  4WXH A;  5IT9 Z;  2J5P A;  1ZGW A;  1KU2 A;  4V2G A;  3MZ8 A;  2DK5 A;  4ON0 A;  1R36 A;  2E35 A;  3SHF A;  2ZME C;  4XSX F;  1BR4 A;  3CUQ A;  4D5F A;  2EIN H;  3CDL A;  3L1P A;  3SEZ A;  1MDM B;  3ZQH A;  1Z6R A;  3PL8 A;  2K9M A;  2CH0 A;  3HSE A;  3WOD F;  3AFH A;  3WHB A;  2K4B A;  2LKX A;  1SVL A;  1DDN A;  4L5E A;  2BEO A;  3TP0 A;  3WTT C;  3JRC A;  3PFI A;  4QPQ A;  2KHM A;  1T39 A;  1FTT A;  1KU7 A;  2OTL I;  1DP3 A;  5HLI A;  3T8T A;  4PFP A;  4IOA F;  3DU5 A;  5EF6 A;  4M3F A;  3WTZ A;  3HRT A;  1Z21 A;  2STW A;  1LFP A;  1HXD A;  1VZ0 A;  1ITY A;  2BHZ A;  2HU9 A;  3BJ6 A;  4CCK A;  1PUE E;  2ZC2 A;  1W0T A;  5GPC A;  3OYL A;  3SEQ A;  1P9Q C;  4ESJ A;  4D9J A;  1IG7 A;  4N9I A;  1MD0 A;  5KAF C;  2V7F A;  2KIM A;  2HVQ A;  1YW9 A;  1BW6 A;  2TCT A;  5LHG A;  3CTA A;  4LIU A;  3DTE A;  2CSO A;  2JRM A;  2CW0 F;  3BG7 A;  5FFX A;  2VXD A;  1PUF A;  4EM0 B;  4I76 A;  2FNP A;  3A0B C;  1TZL A;  4BHC A;  1LQ1 A;  3NQO A;  2M7A A;  1XMK A;  2KFD A;  4KA4 A;  4L0Z B;  4A3L J;  2HXO A;  4B8X A;  5J8F A;  5M3F J;  1D1B A;  5D6F A;  3S1N J;  3REO A;  1IN7 A;  3JW4 A;  4A3J J;  2L9S A;  2B7E A;  5F08 A;  2V6E A;  1LVA A;  4JX4 A;  1BBY A;  5GAG J;  2DJN A;  1VQ5 I;  2E1O A;  5CKT A;  4LG0 B;  2GA2 A;  3IAM 2;  2XIG A;  2A68 F;  4IL6 C;  1RRJ A;  3H0D A;  5L3B A;  2BZT A;  2HQA A;  2H6C A;  1XDS A;  4WX9 A;  4IF4 A;  1G3S A;  4O5V A;  4XKV A;  3E1S A;  4B09 A;  3LSR A;  2R5Y B;  4HZF A;  3I3L A;  1A6I A;  3BWG A;  1UG0 A;  1YW8 A;  2O8X A;  3L2U A;  2JTV A;  2VQC A;  1EKE A;  1MJA A;  5HNH A;  4EJO A;  3SYT A;  4BJ5 C;  1FYL A;  3H0G J;  1X1D A;  4F55 A;  3I59 B;  3N97 A;  1OCR H;  2DU9 A;  4OIP F;  2OC6 A;  5J4V A;  1ERD A;  2HFH A;  2LP0 A;  2DA4 A;  1DU0 A;  5IT9 K;  4BAC A;  4UV9 A;  1R22 A;  5E18 F;  5CVJ A;  4UHT A;  4LLL A;  4GCV A;  2CW8 A;  3OV8 A;  4PJJ A;  5E1Z B;  2L3D A;  3TL4 X;  2R7V A;  1FY7 A;  5E3L A;  3J7A Y;  4U7D A;  2P5L C;  3ZMT A;  5C4X J;  1E0E A;  2M7B A;  1JT6 A;  3I4P A;  3S14 J;  2I8D A;  4BHB A;  2GIV A;  2DMN A;  3D5R C;  3HM5 A;  1R00 A;  2WY8 Q;  3QWL A;  3VYR B;  2GOM A;  1RC9 A;  2AXL A;  3D5S C;  1FOW A;  4BXU A;  2HKX A;  4Q47 A;  1I5Z A;  2KIQ A;  3EUK L;  3S3M A;  1ON1 A;  2L2O A;  1Z3Y A;  3PFY A;  3QPL A;  3KZY A;  1AU7 A;  5D8K B;  4BYY A;  3WU1 B;  4XRS G;  5FKO A;  1H9G A;  3ZN0 A;  1UB9 A;  4HG2 A;  4KIG A;  2HZD A;  3ZRG A;  2EZK A;  3W2A A;  4NNJ A;  3I53 A;  3FHN A;  4D1Q A;  1IUY A;  1TWC J;  4BJ6 C;  2PQ8 A;  1IN8 A;  3KP4 A;  4UB8 C;  1TNT A;  2AXT C;  1WFX A;  3KEY A;  3AL0 C;  4BGD A;  3S2D J;  2O0Y A;  5HS9 A;  1BIA A;  1Y1W J;  2ACJ A;  2EIL H;  3KP2 A;  1ZYR F;  3M3Y J;  4JYK A;  2FJ1 A;  3KP7 A;  1YOV B;  1QPM A;  3CF2 A;  1MW7 A;  3QPS A;  3OYA A;  3UKG A;  3S32 A;  1IXC A;  2X6O A;  4ZZD A;  2Z1D A;  1E3P A;  2E2J J;  1FLI A;  3R4K A;  3HBL A;  2X1D A;  3GZ5 A;  1YTY A;  1MBJ A;  4LLN A;  5CLS A;  4M72 A;  3LL7 A;  1LKX A;  1E3O C;  5GPA A;  3QYE A;  3DLL F;  3FF5 A;  5HS7 A;  4RGX A;  4B1R A;  1J0R A;  5IT3 A;  4B47 A;  4HF2 A;  1IN4 A;  3O3K A;  2MC4 A;  3ZGK A;  1XS9 A;  3RSN A;  4BDY A;  4MTD A;  1X1A A;  4PDK A;  3MQ0 A;  4A3C J;  3KIO A;  5AIQ A;  3W2W A;  3OYK A;  2Y9Z A;  2UXX A;  2XDV A;  5C3E J;  1QO0 D;  2ISZ A;  3BG3 A;  3DTK A;  1RKW A;  1IAW A;  4RAZ A;  1PDN C;  2P7C B;  2V6C A;  2ZKZ A;  2HOS A;  3MKL A;  3WE3 A;  3E7L A;  4CCO A;  2HR3 A;  1LEB A;  1TBX A;  2KZV A;  2NS7 A;  4EMS A;  3GEZ A;  3F8C A;  2A6E F;  2OQR A;  2OQG A;  2P8T A;  3G2B A;  4XNF A;  4XLP F;  1IN6 A;  1Y8R B;  4GYG A;  4RGU A;  4XN3 A;  3K4L A;  4AWX B;  2RQQ A;  2ZXH A;  3VYS B;  1O3Q A;  2KIU A;  5JFR A;  5FLX Z;  1K78 B;  3Q0U A;  4BUP A;  4I2O A;  1A04 A;  4HV5 A;  2DYR H;  1TWG J;  4XLN F;  2Y0S A;  2BBY A;  4EGZ A;  1MDM A;  2MA3 A;  5CVU A;  3CCE I;  1V3F A;  2DA3 A;  2EFQ A;  5IY5 H;  1S72 I;  3RJP A;  4HNT A;  4IRH A;  4DZP A;  3LSH A;  2LDU A;  3BDD A;  3BRO A;  3U1D A;  1WJ5 A;  2E2I J;  2E71 A;  2LFB A;  2KDZ A;  3RPU D;  4H0E A;  1U9O A;  2OCC H;  5C44 J;  4EEF G;  4ENK A;  2PI0 A;  3TDZ C;  1N77 A;  1NK3 P;  1VQK I;  2STT A;  1WI9 A;  1SC7 A;  1NG6 A;  3I64 A;  2COB A;  1MND A;  2RNG A;  3DLA A;  2DK8 A;  4UXN A;  5J6X A;  1A35 A;  4XBF A;  1SAX A;  5A2Q Z;  3I55 I;  1HW5 A;  2QQB A;  3IL2 A;  1UST A;  1O4X A;  2HNH A;  1U0J A;  1YE9 A;  1P4W A;  3AG3 H;  4OWR B;  4W1U A;  1OPC A;  2L0K A;  5K7Z A;  2HDW A;  5FFZ A;  4YFK F;  1KA8 A;  3PNT A;  2L9R A;  3FXR A;  2BY2 A;  4RDU A;  3HXL A;  3R61 A;  4PJN A;  2X1E A;  3C2G A;  2DXI A;  2OU2 A;  3H5R A;  4L18 B;  2Z9O A;  2ZNY A;  2BW3 B;  3F21 A;  2LY1 A;  2L54 A;  4IHW A;  4EQQ A;  3BOQ A;  4C2M J;  3L09 A;  2OBP A;  3CCM I;  1KYZ A;  1B72 B;  1XC5 A;  4YG2 F;  1RZ4 A;  2VN2 A;  1FBU A;  1IRX A;  4CH7 A;  5B1A H;  3I59 A;  4CDG A;  4AIK A;  4M6X A;  3K70 C;  2B0L A;  2CV0 A;  2B63 J;  1NG7 A;  1G59 A;  3JRD A;  2R5Y A;  5FB2 A;  4H4K C;  1ETV A;  3RQI A;  1Z7L A;  2YX4 A;  1T95 A;  2ME0 A;  1ZG5 A;  2W4S A;  2XAF A;  4R8H A;  3DBR B;  2IGK A;  1DQU A;  4LD5 A;  4G8X A;  3K4B A;  2F5E A;  2HTJ A;  3SJM A;  1BC7 C;  1K78 A;  2KRC A;  2R92 J;  4IPA A;  2DMT A;  4WXD A;  2DTZ A;  3P9I A;  1F5T A;  2HGC A;  2JWT A;  3V8K A;  4EVI A;  2PJP A;  1QGP A;  1BI0 A;  1W5T A;  2XAH A;  4P1W A;  3ABT A;  4BY7 J;  4HNU A;  2IGN A;  1MGT A;  2X4H A;  5TJJ A;  2M8E A;  3F3X A;  4NC8 A;  2XRO A;  1OR7 C;  4FTH A;  1DGW Y;  2CU7 A;  3GZN B;  5JVT A;  4WWC A;  1HW1 A;  3M1C A;  4HX8 A;  4CIC A;  1ZAR A;  3DKX A;  4JBA A;  1GT0 C;  2CS3 A;  4HF0 A;  1QQI A;  4J19 A;  1T56 A;  3N05 A;  3PNY A;  2JA5 J;  2FML A;  5FKM A;  2Q2E A;  4KN4 X;  1U3E M;  1U5T C;  3FBN B;  3RKX A;  1WQ2 A;  4NUB A;  2HTS A;  2HPI A;  5BNG A;  3OS1 A;  3H5N A;  2R7R A;  4N9H A;  1LDK B;  5AIP A;  2YSR A;  4NC7 A;  4HA8 A;  3TOB A;  3DPL C;  2JN6 A;  1V5F A;  3K1P A;  1WRJ A;  1SFK A;  2V9P A;  4N4N B;  4EJT A;  2DDA A;  1MIJ A;  3I71 A;  1XSV A;  4PJ0 C;  3HRS A;  5L3C A;  3JCU C;  3OYI A;  3K70 D;  3H9G A;  3KP6 A;  1D8K A;  1S7A A;  4IHY A;  2VOO A;  3HHG A;  5DUK A;  2VLA A;  1IGN A;  1T98 A;  1Y0N A;  2OCE A;  3CJR B;  4ESB A;  1ZRD A;  4NQW B;  4ZZL A;  1VQ9 I;  4P9F A;  1R23 A;  2HYJ A;  2NS8 A;  2JA8 J;  1K6O A;  2H94 A;  4A3F J;  3F8F A;  1UHM A;  4BQO A;  1JKQ C;  1Z05 A;  2F4O B;  2LNB A;  5L3D A;  1G6N A;  3OYC A;  2KL4 A;  3LSP A;  2BYV E;  1O3S A;  3TO7 A;  4CYD A;  5CJ9 A;  1X3W B;  4ZC3 A;  2M4K A;  1JUM A;  4ENM A;  2HWV A;  5E1W A;  5JI6 A;  3GVA A;  3GLL A;  3TGN A;  3ZN1 A;  4ZYD A;  1PUF B;  3K4C A;  2K4J A;  2CQK A;  4MIM A;  1QA6 A;  2R7X A;  2XVC A;  1MNM C;  3RDI A;  2AS5 F;  4EAT A;  1VQM I;  4M3G A;  4LIT A;  2C6Y A;  3K1M A;  3WGH A;  3BZ6 A;  3LOC A;  2X9D A;  1FNN A;  2J5O A;  3F8B A;  3L2Q A;  2YUS A;  2ISY A;  1JXS A;  4D0P A;  3DKW A;  2KQR A;  1I39 A;  3ZQI A;  2HKO A;  2KDO A;  3E97 A;  1E3H A;  1REP C;  1EV7 A;  4CYC B;  1WGX A;  1IW7 F;  2FSW A;  1DU6 A;  2GAU A;  1YX3 A;  2A5Y B;  1FYK A;  4KJZ A;  4EJV A;  4KIB A;  3GTJ J;  1YJN I;  1BA5 A;  5KK1 A;  5D5X B;  2E5Z A;  2MW8 A;  1K79 A;  1BR2 A;  4KDP A;  1JHH A;  1IJW C;  1BC8 C;  3Q9V A;  1WJC A;  5K5Q A;  1ETQ A;  3BJO A;  1EH8 A;  3CJN A;  1LNW A;  2P5V A;  2L7K A;  4KT6 A;  3LA3 A;  5FLV A;  4U88 A;  2O9L A;  2WAQ N;  2Z16 A;  1MBE A;  2MD5 A;  2DAO A;  4B4C A;  2K86 A;  4LG0 A;  3P9K A;  3CCS I;  2DA2 A;  5HNF A;  1P7J A;  3JAM K;  3HUG B;  3LAJ A;  3ROU A;  5HOD A;  1ZQ3 P;  1D0X A;  4BH9 A;  2F5F A;  3ABU A;  3A4C A;  2K40 A;  1WJD A;  1ZRF A;  3MFK A;  1IV8 A;  4XN0 A;  1K61 A;  2TDX A;  1VQN I;  1G2H A;  5BQT A;  3QP5 A;  1GLN A;  5ILS A;  3QU3 A;  2Y0S N;  3KFW X;  1YJW I;  1V5G A;  1ZHF A;  3FMS A;  1Z77 A;  4MQ9 F;  2ZSI B;  2Q0O A;  1I6X A;  4XSZ F;  1T8I A;  4A3D J;  3WG7 H;  1ZRE A;  4C3J J;  4BXF A;  2O6G E;  2QQ8 A;  2DPD A;  2VI6 A;  1TTY A; 
#chains in the Genus database with same CATH homology
 5FKL A;  3IH3 A;  4QSH A;  1YRN B;  5IOY A;  3GTK J;  4A3L J;  2HXO A;  2XGE A;  5M3F J;  3BR2 A;  3S1N J;  2XPW A;  4A3J J;  4D5C A;  2HDD A;  5IYD J;  5F08 A;  1AKH B;  5FKK A;  3BR3 A;  1F43 A;  1RET A;  4JX4 A;  2WB1 N;  1SFO J;  2DJN A;  2E1O A;  3NAU A;  3HEF A;  2O7O A;  3FK6 A;  1TWF J;  3LSR A;  2R5Y B;  1A6I A;  2XPV A;  4A3E J;  2ID6 A;  3GTG J;  2HOA A;  3H0G J;  1QRY A;  1U78 A;  1WH7 A;  3BTI A;  4UUS A;  2LP0 A;  2DA4 A;  1DU0 A;  3OSG A;  2K9Q A;  1QVT A;  1B72 A;  5F0H A;  3S1R J;  4JX6 A;  5EGO A;  3ZQC A;  4AYB N;  1VFC A;  2O8K A;  1ETO A;  2LY9 A;  1IDZ A;  4UUT A;  3HGG A;  3GBG A;  5F0C A;  5E3L A;  3NAR A;  2M34 A;  1APL C;  4Y7N J;  5C4X J;  3LSJ A;  3FIS A;  3DCF A;  1JT6 A;  3S14 J;  1JGG A;  3ZQL A;  4JP0 A;  2DMN A;  3FIW A;  1LE8 B;  2MG4 A;  3HM5 A;  4BBS J;  2K9S A;  5E3N A;  1I3Q J;  3BTJ A;  2L7M P;  3CQZ J;  1WPK A;  2VKV A;  2R5Z A;  3S16 J;  4IEJ A;  3BG9 A;  5FJ8 J;  2ELK A;  2LD5 A;  1QVU A;  3O8H A;  4IHV A;  1POG A;  3QPL A;  1AU7 A;  2NOG A;  5EZH A;  2EZH A;  3BG5 A;  4XRS G;  5FKO A;  2CUF A;  2R0Q C;  5EDN A;  1JTY A;  3ZQG A;  4QIW N;  2EZK A;  2D5V A;  2NVT J;  3RZD J;  3Q0V A;  3BQZ A;  1TWC J;  5IYB J;  2CQX A;  1TC3 C;  3PO3 J;  1F36 A;  3S2D J;  2DA5 A;  3MVP A;  1Y1W J;  2VUM J;  1LFB A;  1NTC A;  4D7M A;  1ETK A;  4JYK A;  5EZG A;  2FJ1 A;  3M3Y J;  3O8G A;  3B6A A;  2E2H J;  3HOX J;  3HOY J;  5C4J J;  2NVQ J;  3QPS A;  4MO7 A;  3UKG A;  2X6O A;  1IUF A;  5M5Y J;  4XRS A;  1RPW A;  2E2J J;  3HBL A;  1MBJ A;  3A02 A;  2L7F P;  1E3O C;  5GPA A;  2DMU A;  5M5W J;  1T33 A;  4B1R A;  2DA6 A;  1JTX A;  4A3K J;  2DMP A;  2X48 A;  1Q1V A;  2XSD C;  3RKQ A;  3W6V A;  3IV5 A;  3TW6 A;  1XS9 A;  2PMZ N;  2LK2 A;  5FKN A;  1NK2 P;  4A3C J;  1VND A;  5E3O A;  4GFB A;  1XG1 A;  2DMQ A;  2Y9Z A;  1P7I A;  5C3E J;  3OIO A;  1X58 A;  1B8I B;  3BG3 A;  3GTP J;  3PO2 J;  1RKW A;  4X6A J;  2P81 A;  3HKZ N;  2HXI A;  2XGC A;  4LOC A;  1OJL A;  2XGD A;  1JUS A;  1HLV A;  3MKL A;  4HNV A;  2HOS A;  3E7L A;  1MBG A;  5EG0 A;  2NVX J;  2NS7 A;  1OCP A;  2GM4 A;  2IEK A;  3CCY A;  4FIS A;  1U9N A;  1CQT A;  5IP6 A;  3OOU A;  2M9H A;  5J3L A;  5EGO B;  1W0U A;  1UMQ A;  1IV6 A;  3Q0U A;  1ORK A;  1ZKG A;  2L7Z A;  1IC8 A;  3BR1 A;  1TWG J;  2XRL A;  3M4O J;  1UG2 A;  5IYC J;  3Q0W A;  1LFU P;  2IBD A;  2DA3 A;  3S1Q J;  4AUX A;  1MSE C;  4DZP A;  3PM1 A;  9ANT A;  3S17 J;  3A01 A;  1GV5 A;  1R9T J;  2GBY A;  2E2I J;  2M0C A;  2LFB A;  3WHC A;  1I50 J;  1VF9 A;  4QTR A;  1U9O A;  2KDZ A;  3TED A;  1K83 J;  1AHD P;  1FJL A;  5C44 J;  4EEF G;  2HQ5 A;  1NK3 P;  4DW6 A;  3RZO J;  1FIP A;  4NDL A;  2COB A;  1VI0 A;  3A03 A;  4ABZ A;  4DYR A;  1MBF A;  4D7N A;  1GVD A;  1GV2 A;  1O4X A;  3JRA A;  2TRT A;  1HCR A;  3QQA A;  2LTP A;  4W1U A;  4C3I J;  2L0K A;  4DZJ A;  3GTO J;  1JKP C;  5K7Z A;  3LNQ A;  2M2E A;  4XRM A;  2N8G A;  4BBR J;  2HOT A;  2L9R A;  3SDG A;  4M3E A;  2FQ4 A;  2ECB A;  5FLM J;  4RDU A;  5EEA A;  3BR0 A;  1GDT A;  4MLO A;  2CQQ A;  3BTC A;  1JT0 A;  3F0C A;  1JJ8 C;  1WCM J;  4DYQ A;  4IHW A;  2QF7 A;  4A3G J;  4M3B A;  1BW5 A;  3HB9 A;  4C2M J;  2OF7 A;  1D5Y A;  5DTD A;  2G0E A;  1Y1V J;  1B72 B;  1XC5 A;  2M8G X;  1H8A C;  2R93 J;  1FIA A;  3CMY A;  3ZOB A;  5K7H A;  2GLO A;  2MSY A;  4XIC A;  2KT0 A;  4M3D A;  2B63 J;  1ZR2 A;  3JRD A;  4IHX A;  3HOW J;  2R5Y A;  2CRG A;  2RAE A;  1ETV A;  4BXX J;  4B3A A;  3RQI A;  5M3M J;  1WI3 A;  2ME0 A;  4A69 C;  3BTL A;  4MFD A;  4BKX A;  2JK3 A;  1EF4 A;  5F0F A;  1LE8 A;  1A5J A;  1IRZ A;  3I4M J;  4FE7 A;  2DA1 A;  3BT9 A;  3SJM A;  1AKH A;  4C3H J;  2R92 J;  2DMT A;  2DTZ A;  2JWT A;  5JLX A;  2YS9 A;  2R7Z J;  3I4N J;  1H89 C;  3G1M A;  4BY7 J;  1MH3 A;  4MFE A;  3S15 J;  1ZK8 A;  5F1J A;  3TW7 A;  3D1N I;  1QPI A;  4BY1 J;  1BL0 A;  3JRH A;  2Y31 A;  4A3M J;  1BJZ A;  5J1Y A;  4FTH A;  1MH4 A;  3HOV J;  3HOZ J;  2CU7 A;  3BR6 A;  1ETX A;  3GTM J;  4G12 A;  5GP9 A;  2CJJ A;  1GT0 C;  1X2M A;  2ME6 A;  4J19 A;  2OPT A;  1T56 A;  1HDD C;  2JA5 J;  5FKM A;  2NVY J;  5IOZ A;  1X2N A;  1HOM A;  2FD5 A;  2R5Z B;  3JRF A;  5BNG A;  4CYC A;  2LVS A;  3G1O A;  4X1E A;  5IPA A;  3VPR A;  2ECC A;  5J1R A;  1MBK A;  3K7A J;  2MGQ A;  2E19 A;  1HDP A;  2JN6 A;  5K7F A;  1FTZ A;  5IP9 J;  4A3I J;  3JRE A;  1WH5 A;  1RES A;  2EH3 A;  2ZB9 A;  3S2H J;  4IHY A;  3HDD A;  2LR8 A;  1IGN A;  3SFI A;  1RKT A;  2EQR A;  2Y30 A;  2HYJ A;  1ZR4 A;  3S1M J;  2NS8 A;  2W48 A;  2JA8 J;  3JRB A;  3OSF A;  3MN2 A;  4A3F J;  1B8I A;  1ZTR A;  1JKQ C;  4FCY A;  1I6H J;  1S7E A;  2JA6 J;  1ETY A;  4M6V A;  2DA7 A;  2XB5 A;  3LSP A;  2K9N A;  3IH4 A;  3TP3 A;  3FK7 A;  4XK4 A;  1ENH A;  1JUM A;  1OCT C;  5F27 A;  1TWA J;  3K2A A;  1MSF C;  1TWH J;  2H8R A;  5DS9 A;  4RBO A;  4A3B J;  3B6C A;  4AC0 A;  1PUF B;  2AO9 A;  2JMW A;  3FKI J;  1JKR C;  5JLW A;  4MIM A;  1IDY A;  1U8B A;  2YU9 J;  1MNM C;  1MBH A;  3H3V K;  2EZL A;  1YRN A;  2IAI A;  2JJ7 A;  5E3M A;  4M3G A;  2LLK A;  1FEX A;  4S0H B;  1HF0 A;  3Q3S A;  3LOC A;  2X9D A;  4XID A;  2YUS A;  3LSG A;  4V2F A;  5EYR A;  3JR9 A;  3ZQI A;  2VKE A;  4JX5 A;  1JKO C;  1UHS A;  2DN0 A;  2FX0 A;  2Y2Z A;  1ZGW A;  1Z0X A;  4V2G A;  4I6Z A;  4CYC B;  3G1L A;  1WGX A;  1DU6 A;  3A01 B;  3GTJ J;  1BA5 A;  4D5F A;  3CDL A;  3L1P A;  4A93 J;  2MW8 A;  4Y52 J;  2H1K A;  2QCO A;  3GTL J;  3ZQH A;  1IJW C;  4UUS B;  3IH2 A;  1ETQ A;  2Y9Y A;  3JRI A;  2AHQ A;  3WHB A;  2LKX A;  2I10 A;  3ZQF A;  2CUE A;  4L5E A;  3TP0 A;  4W97 A;  3BR5 A;  3JRC A;  5FLV A;  2WV1 A;  2O9L A;  2HI3 A;  3BQY A;  2WAQ N;  3HOU J;  1H88 C;  2XB0 X;  5EG0 B;  2JA7 J;  1FTT A;  1MBE A;  4B4C A;  3DEW A;  1JUP A;  3C2B A;  3HGY A;  2DA2 A;  1P7J A;  5EF6 A;  2XPU A;  4M3F A;  5HOD A;  1ZQ3 P;  2K40 A;  1ITY A;  1K61 A;  1GUU A;  1ETW A;  1W0T A;  4FE4 A;  5GPC A;  1G2H A;  1JJ6 C;  5F04 A;  1IG7 A;  5J1U A;  1RR7 A;  3GTQ J;  1SAN A;  2VPR A;  2EBI A;  2Y0S N;  5M5X J;  2TCT A;  1BW6 A;  1OFC X;  1Z77 A;  4DYC A;  4A3D J;  5IP7 J;  2ID3 A;  1PUF A;  4I76 A;  4C3J J;  2EZI A;  2VI6 A;  3JRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...