4HRIA

Crystal structure of hetr in complex with a 21-bp palindromic dna at the upstream of the hetp promoter from anabaena
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
295
structure length
272
Chain Sequence
DIDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKIIVEEVRQALMEGKLLKTLGSQEPRYLIQFPYVWMEQYPSEEKRQIEHKLPSNLPDAQLVTSFEFLELIEFLHKRSQEDLPPEHRMELSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYERTYIMVEDTARYFRMMKDWAEKRPNAMRALEELDVPPERWDEAMQELDEIIRTWADKYHQVPMILQMVFGRKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Heterocyst differentiation control protein
publication title Structural and biochemical analyses of Anabaena HetR reveal insights into its binding to DNA targets and the inhibitory hexapeptide ERGSGR
rcsb
source organism Nostoc
total genus 64
structure length 272
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hriA03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hriA02
4J00A 4YRVA 3QODA 4HRIA 4IZZA 4J01A 3QOEA
chains in the Genus database with same CATH superfamily
4MQVA 4I76A 1BN5A 5EYRA 3IH2A 4CCLA 4CUGA 4NQWA 2VOPA 2L7FP 4F92B 3GCMA 5D8LB 3W6VA 1J7KA 4FT8A 4OINF 3KP2A 2M8GX 1WJEA 2F5EA 2AQFA 1FYMA 3GXOA 1SFXA 2A6EF 4M3BA 4P1WA 4BDYA 2LREA 2L9SA 4ESBA 3PUFA 3S3MA 5E8GA 2EFWA 4M74A 1FJLA 2WTEA 1VQNI 2VL8A 2IW5A 1VQ6I 1OKRA 3CLOA 3DBRB 4B3AA 4B09A 3I54A 5FKOA 4BHPA 5IT3A 1VQPI 4A6DA 4BQOA 1A6IA 2KFDA 3HOWJ 2R7QA 2BVLA 3MZHA 1QHGA 3MKLA 4D7MA 3L7WA 1V5GA 1SANA 3MMYB 1FZPB 1ZR2A 1W5TA 4GXOA 5J8FA 2Z1DA 3A02A 3P7NA 1VF9A 4P5OA 3V7SA 5IP9J 2QKMB 2L7MP 3V7RA 1WFXA 4A69C 5LFAA 2VKHA 1A04A 2RDPA 1FC3A 5E18F 2E1MB 3J80K 2EV5A 3VYUB 3E6CC 3M4OJ 1ORKA 3BJ6A 3BPVA 1YO5C 2FBKA 2XROA 4BKXA 3VODA 3ML6A 2HNHA 4XLEA 5TGTA 1FOYA 2DFEA 4PK4A 5DS9A 5IP6A 3ABTA 1W7PA 3KYDB 3DCFA 5BS6A 3GZNB 4D5FA 4Y15A 3IL2A 1J75A 2GM4A 1IUYA 1PDNC 3BLYA 1QHHD 2KIUA 1QO0D 3K69A 3F8FA 1ZHFA 3LQRA 1VNDA 4LLNA 3PO2J 2LR8A 5HDGA 1BW6A 1YI2I 3HBLA 1Y6IA 4YIFA 3ECOA 3I3LA 3W6KB 4ENKA 5H2FC 2ELKA 4HX7A 2HI3A 3FWEA 2M8EA 2XPUA 1B9MA 2P5VA 3F8MA 3U9GA 1UJ8A 5K5QA 2R7UA 3FXKA 3NARA 3KZZA 2MA3A 1KYWA 2EA4A 2X1DA 3EUHA 3P9CA 2DLLA 4PUSA 3FHZA 5HDNA 2HVSA 3OYHA 2HQRA 2EA2A 4G12A 2HZTA 3OYKA 1XMAA 4BBRJ 1R1VA 1V54H 3HTSB 1GV2A 1IXSB 1G6NA 2N8GA 3E0JB 5FFXA 1B59A 2ICWG 4PJMA 5C44J 4M9XA 2UXNA 5HS7A 3QQAA 1A36A 4S0HB 2DODA 3QPTA 3L2CA 2VODA 3FZVA 3B6AA 4UUTA 3JTGA 2E7XA 1N77A 4OMYA 3FBNB 4KMFA 1IRZA 1FTZA 3R61A 2X6WA 2A68F 4EJUA 2L2OA 3ASOH 3J7ZI 3J81K 3HIFA 4IHSA 2DYSH 3GO5A 4CZZA 2QQ9A 2DA6A 2X1CA 1KA8A 3WG9A 2Y0SN 2V6EA 2ZXHA 4DYQA 2DU9A 4XRSG 5KVRA 5D8KB 1ETYA 4CCJA 2DT6A 2LMDA 3H9JA 3SDGA 2GOXB 3BWGA 3ZQLA 1FOWA 1B6AA 2HOAA 1MJBA 4BXXJ 2P0WA 2FJ1A 2WY7Q 3F6OA 1QPIA 4WXCA 1HLVA 3RKYA 1Q1HA 1R00A 2X4HA 5L3EA 1KU2A 2K02A 2PN6A 1OR7C 1ZELA 2CMPA 3VYSB 3CD6I 4N9HA 2LFBA 2VQLA 2VJ5A 4B8XA 4RB1A 1TT0A 2CV0A 4L5JA 1PP8F 2NS7A 2HPMA 2JUCA 2A69F 3OS1A 3PNTA 4ETSA 2JRTA 2VBXA 2FRHA 2Q2EB 3OS2A 2YU3A 2CGPA 2WC2A 3VYRB 3CCVI 2O9LA 1XC5A 3O3KA 1TT5B 2PG4A 1W36C 4RAGA 1U8RA 2LP0A 4LOCA 2KPMA 2M2EA 1VQMI 2W25A 2ZFUA 3X2QH 1B72B 1X4PA 3E6MA 2MYSA 1IG7A 1ZGAA 2X51A 4HG2A 2DW4A 5GTHC 4PFOA 1X4OA 1YITI 2DT5A 5F04A 1JKRC 3D1NI 2EZLA 2DCEA 2R0QC 1EJ9A 1IC8A 2R7ZJ 5K7FA 2R7OA 2LSOA 2ESNA 3GTLJ 4RB3C 2OAZA 3HDDA 1MSFC 2VQHA 4BUPA 2R7SA 2AHQA 3L2QA 3MZYA 1RUNA 2E1CA 4IOAF 2GZWA 4BJTA 1IGNA 3GLXA 1T33A 3S8PA 1HW2A 4RBOA 2FA5A 1HDPA 4FQGA 4UVBA 2L01A 4KIBA 3DPUA 3K0LA 4QSHA 2NXNB 1BI1A 5FLXZ 3R4KA 3WHBA 1HKTA 2HOTA 3D5RC 2DYRH 4BAYA 3PFIA 1XX5A 2E2JJ 1IRXA 3CMMA 3U2RA 4E7JA 1GVDA 5E1WA 4LLGF 2GXGA 3JRHA 5FKMA 2F6CA 2LKPA 3C3WA 3S2DJ 3COAC 4X1EA 2DMNA 2QBYA 4L9VA 3W2WA 3K6GA 2Y69H 4HA8A 4QPQA 4B44A 3JRFA 3MCZA 2R7TA 1X19A 1ZG3A 2QEXI 3SYTA 1UG0A 2EH3A 2HWVA 2CQXA 4MQ9F 5LHHA 5C4JJ 1B8IB 5BMZA 3A2KA 3HOZJ 3WTXC 2G7HA 2H09A 3FF5A 3I53A 3VYTB 1T38A 3TBIA 3IH4A 4AIDA 5K7ZA 2ZNZA 3L1PA 5LGNA 4XN0A 3NEUA 4PJ0C 1EV7A 4ZYGA 5D5WB 5ILVA 2K9LA 4HQMA 4B48A 3REOA 2AO9A 1OJLA 4C3HJ 3HOYJ 5GPCA 2ECCA 2KJBA 3FXJA 1MMGA 2E1OA 2ZFWA 3SDBA 3GTGJ 2O5RA 2IPQX 3GFJA 5LEKA 2GA2A 1SVMA 2VASA 2ZJQF 1TQMA 1TWAJ 2VC1A 2W57A 3F3XA 5GAGJ 2ECBA 1XMXA 2HU9A 3QWLA 3SZPA 5D6EA 2GA1A 2VJJA 4EM2A 1MH4A 2EJRA 3HPHA 2P5KA 1N78A 5LD2C 3HKZA 2JSCA 3K1NA 3BQYA 4O3MA 3VSLA 4JK1X 3ISPA 1V5EA 4ZDPA 1YLFA 1XCVA 4HDVA 4BYYA 2XUBA 2D1HA 4M71A 1P2FA 3ZGKA 4L5EA 4EJVA 3SXYA 4EATA 4CSWA 3M9AA 3OV8A 3OYLA 4A3CJ 1OYIA 2EBIA 3CCLI 1IN6A 2HR3A 1S7OA 1JT0A 3LA3A 2IS6A 4R79A 1DU6A 1G8XA 3DFGA 3PUBA 2A07F 4MNUA 1R5HA 3OR2C 3J7AY 2FMYA 3IKVA 5F08A 1BA5A 1Y56A 3MKWB 4G8XA 2VC0A 4O6JA 3O8GA 3G1OA 3GYHX 4NBQA 1XCBA 3TDUC 4FX4A 5J3LA 1ITYA 3A4CA 1SD4A 2MD0A 4MIMA 1WHUA 1EKEA 3UKGA 3GFMA 4RGXA 5IYCJ 3F8NA 4LG0A 4A0ZA 4DQ2A 1YE9A 2NS0A 5L3CA 3F21A 1OR7A 4R1HA 4F52A 3WTSC 2UWMA 2IBDA 2GIZA 3BR5A 3FIWA 3CCEI 4LMYA 4A3IJ 1P4XA 1Z77A 2RNJA 4IO9F 3RI4A 1MNEA 3LSPA 1AKHA 3SFZA 2HDCA 2WWYA 3CJRB 2XSJC 1BJZA 3VEPA 5DCMA 1O3RA 3OSFA 4UNOA 2VUMJ 4A5NA 1L0OC 2L3DA 4OU0A 3K2AA 3GTPJ 4HF1A 3C7JA 3ZQIA 4I0BA 3CZ6A 4KJZA 1W1WE 1ZLJA 4BHBA 3AG3H 2CQQA 2DI3A 1LE8A 5LEJA 2ZXIA 1HA8A 3EQLF 4MTEA 1WJFA 1X3WB 4B4CA 3MKZA 1T6SA 3HRUA 5CLSA 2AQEA 5FD5A 2DXIA 5KHDA 3ZQCA 2ZXWH 2DO7A 4BS9A 2XDVA 2VJIA 1R58A 4ANJA 3W6JB 2DMUA 3E1SA 2Y31A 1ETOA 5CVJA 1L3LA 3CDLA 2YU9J 5A2QZ 5D4SA 2F5FA 2NOJB 3TGNA 1YJWI 1WCMJ 3G1MA 2RN7A 4WK8F 3TEDA 2OPTA 3HHHA 3BQZA 3RPUD 5E3NA 1VQ5I 1H8AC 5DCMB 2QCOA 3FXOA 5LHGA 1IO2A 4PSXA 1JJ8C 5ED4A 1XDSA 1H88C 4IHXA 1P4AA 2LNBA 2LOOA 1S29A 4XBFA 4G6TB 4ASNA 1ZGWA 2XF7A 3DPTA 2BVMA 1Z6RA 1G3SA 4BBSJ 3PQJA 4HPQA 2XV4S 4EQQA 2H27A 4RB0A 1N25A 1A5JA 3WGIA 1LE8B 1Y0NA 3VB2A 1O7LA 2LKSA 3FMQA 4Y7NJ 5B1BH 3CMEI 4KITB 3L2WA 5JHFA 4N0BA 1OCTC 5H6RA 1N75A 1X3ZB 5J1UA 3KYCB 5K7HA 2W82A 3IRRA 5F64A 3L9FA 4ZC3A 2A6HF 4D5CA 2JT1A 1M1EB 1K4SA 1ODDA 1OFCX 4DIQA 3GTKJ 3DKWA 3QP5A 4XN3A 5FLVA 3F72A 4HOBA 4Q4ZF 1RKTA 2CUFA 4OIPF 4K2EA 4GO1A 1LUJB 1FMWA 2FSWA 1ZRDA 1PUEE 2BHYA 2ZSIB 1BJAA 3ERMA 4A3LJ 3RIRA 3HM5A 5IOYA 2MG4A 3I4NJ 3TMOA 4ABZA 3H36A 1UHSA 2FD5A 3HRMA 1HW1A 4UUVA 1I3AA 2ISZA 2E5NA 2E35A 3QYBA 1NH3A 2K9NA 2VBZA 2XAJA 1W0TA 5LRSA 4AVZA 4A3BJ 3ONQA 5J4VA 4NHJA 4QIWN 1MNMC 3E7LA 1W5CC 4EV0A 2IGKA 5FKKA 4HF0A 2QQAA 4HLYA 1JGGA 3D5LA 4OOIA 2K7LA 4RDUA 2P5LC 3HOVJ 2IS1A 2NNNA 4KMUX 2JA8J 3JAMK 2K5CA 1XMKA 3KFWX 4WCGA 4JP0A 1AU7A 2BBYA 2K40A 3ZMVA 4XLNF 4Q47A 3OY9A 4D7NA 3KP5A 5E3MA 5JVGF 4G94A 1SAXA 3H5RA 2KRCA 2EIMH 4LITA 4DZJA 3LAPA 2M9HA 2XGEA 2VT2A 1TWGJ 2MH2A 4CCKA 1TWHJ 4IVNA 2FQ3A 1RZ4A 2LH9A 2R7RA 4JX5A 2V9PA 4HSRA 1H89C 4P55A 5JR3A 3MWMA 2YX7A 4CA0A 3OIQA 1MBJA 1PJRA 1YW8A 4XMYA 1APLC 5HVQC 1Z21A 3SEZA 4FASD 3BG6A 1RUOA 4BEHB 1JUPA 1YG2A 5CQEA 2CUJA 3WGGA 5E20A 2LKXA 2A3SA 2CFXA 3HJEA 4PSWA 5J47A 2NAZA 1IDYA 2DTRA 5AIQA 2CG4A 2DDAA 2EQRA 2XC7A 2QLZA 1OQYA 1SC7A 5DEQA 1S7AA 3J7AO 1RI7A 3BG7A 2VQCA 2V9KA 4EEFG 2E7WA 3ZOBA 1ZR4A 2Q1ZB 4DBRA 3DEEA 1MSEC 4IF4A 4CCNA 3S16J 2VI6A 1RC9A 4XICA 3CC7I 1JTYA 2VKDA 4C2UA 4LK0F 4NB5A 3C1DA 1TNSA 4AM3A 2VBWA 3LSGA 4A5MA 1DUXC 2WBMA 3M8JA 2HEOA 3GTQJ 1U0JA 2EV0A 2TCTA 2Y0MA 2X48A 2R4GA 2M1BA 2O61A 3K4KA 3S17J 2G7UA 1I6XA 2BEOA 2VPRA 4D1QA 5TRDA 3GVAA 4MLOA 2CQ7A 1IJWC 3CC2I 2OCEA 3M7GA 2V4JC 1U78A 1LNWA 4BQQA 2XKOA 1USSA 2GQQA 1XGNA 4BJ6C 1LJ9A 3HPGA 3H3ZA 1GLNA 3CDHA 3CCRI 1U9OA 3H35A 2HOSA 2HXOA 4DYCA 1T56A 2C6YA 4Y13A 1GV5A 1QZZA 4CCMA 3DBLB 3S32A 2A05A 1PVEA 3CF2A 2PX9A 2HVRA 3EYIA 2JMWA 2WAQA 4MEXF 3Q9SA 4PFPA 1G3YA 3SHFA 5GTIC 3K70D 2K4BA 2IGNA 1NG7A 2CFOA 2EIKH 4CYCA 1K79A 1VQLI 1ZRFA 1FIAA 2HQ5A 2PMZN 4KIGA 2HFHA 2D1VA 1R22A 3CCYA 3K4JA 1WJCA 2B0LA 1LFBA 3BC8A 4YELA 5E8IA 1S5LC 3BOQA 3F8BA 2NVYJ 5F0CA 3QPSA 3S1MJ 4L9JA 3H5NA 3I58A 3FX3A 4EJWA 1S72I 1FOXA 2QSGX 1MMDA 2B63J 4IL6C 5KNLA 2V1XA 4HAMA 4RAZA 1YOVB 2H8RA 2R7XA 1R1TA 2OD5A 1SFUA 4IHVA 1Z6TA 2B7EA 5IT9K 5L3GA 2XHKA 4NQWB 5M5WJ 1F5TA 1I3QJ 4S05A 1S8NA 3DBHB 1AWCA 2GXBA 2MC3A 3DTEA 3LSIA 1FP2A 2IRFG 2PI0A 3DTIA 5H6QA 5BPIA 1FP1D 1T0FC 3OS0A 3RKXA 4PJLA 4L0ZB 4E7SA 2R93J 1MMSA 3W2AA 4ZYDA 2KIFA 1D5YA 4I0AA 1T39A 1ETXA 1H9GA 2BXZA 2DTZA 3GW2A 4CYCB 4ZDLA 2KLOA 3BCAA 1KQ8A 1D1CA 2DT7B 4XKVA 4PGGA 1H9TA 2STWA 3LSHA 5JFRA 2QA4I 1YTYA 2P6TA 3J80Z 3AKZA 3ERED 1TWFJ 4WXHA 2EZHA 5M3MJ 2DQRA 3ZR8X 1QBJA 5BPDA 4NC6A 1E2XA 2PMHA 2E60A 3F9KA 5CJ9A 5GAEJ 2Z9OA 4BHCA 1ZG1A 3AG1H 2CW7A 2Z3YA 4ENJA 2VBYA 3BR1A 4XOTA 2NVXJ 2YUSA 3ABMH 4AWXB 1ZQ3P 1F36A 1WJBA 3BG5A 1LB2A 2VXDA 1P7IA 2Y9YA 3HRSA 4UHTA 5KAFC 3BTJA 2BY0A 1IN5A 1W7PB 4M3GA 4M9ZA 3TW7A 3OOUA 4RGUA 4BH9A 1LQ1A 4IEJA 2Y30A 4U7BA 3A1YA 1FYKA 2A5WA 3G2BA 1X1CA 1UB9A 2JJ7A 3ZQHA 3L00A 3S1RJ 2MFZA 3KYLA 2O03A 3LSKA 3CQZJ 1DGRM 3RKQA 3H3VK 2FOWA 2F5VA 2LLKA 2UXXA 3HSFA 4ZJZA 2V9VA 5JLWA 3CCJI 4I99C 5EG0A 2R7VA 3TQNA 1T08B 1YS6A 3OYBA 2ZC2A 3G1LA 1UG2A 3M1EA 4YEJA 2NNYA 5HNHA 3IP4B 1BR2A 2HXIA 2OQGA 4XNFA 3H0DA 1MMNA 2K9SA 3F8CA 4AU7A 1RKWA 3I0TA 3K10A 3WHCA 4TV7A 3J81Z 2W4SA 2MABA 3T8RA 4YIRX 3DKXA 4IKFA 4XLFA 5K1YA 1Y39A 3S1QJ 2QZ8A 3LSMA 3A03A 2KISA 4HNVA 4PJNA 1WI9A 4JOMA 4RA2A 4XORA 4E6KG 2EK5A 1X2NA 2XASA 1XTAA 3R0JA 4EMSA 3PJRA 1HOMA 4R8HA 2WAFA 5EF6A 2QM3A 1Z7UA 1BC7C 4J00A 4F93B 1SMTA 1ZRCA 5M5XJ 3AL0C 4IHWA 4QWQA 2UV1A 3ABLH 4QTRA 1QVTA 1KU7A 1ERDA 3ZQGA 2R5ZA 1TWCJ 4CZCA 4Q48A 1YIJI 3QOEA 1FTTA 3KX2A 1O4XA 4BE0A 4XLCA 3VFZA 4HNUA 1KQ0A 3U1KA 1K78A 2DA1A 4G6DA 1MBEA 1WSUA 2Z99A 2ME6A 2E2IJ 3ZXSA 3AAFA 3V8JA 2KL4A 2ZSHB 5EG0B 1ZREA 2HTJA 2YS9A 3QU6A 3HEFA 5GPAA 3H3UA 1XB4A 4OMZA 4XK4A 2HYFA 2M30A 2E2HJ 2RVCA 3DV8A 1Z05A 4JX6A 2FF4A 1DGWY 4WX9A 2EZKA 3SFIA 2ZB9A 3LFUA 5BNGA 4F55A 3ZMTA 3KP7A 3KIOA 1ULYA 1TBXA 3HG9A 3P9KA 2X1EA 1R7JA 2V79A 5F0HA 4ZTFA 1R9TJ 4A12A 2DA7A 3HL2A 1XGOA 1OCZH 3E5UA 2JPBA 3I5UA 5DD8A 5L3BA 3OYGA 2LY2A 3IAM2 3CMAI 1WJDA 3HYIA 4IJAA 1ETVA 2CUEA 2PEXA 3JRIA 5JVTA 3N4MA 4AC0A 3BDDA 4AVPA 5IOZA 4I09A 1KONA 2RC4A 2QQ8A 5IPAA 4U87A 1O3TA 2KRFA 2HQAA 1WZ2A 4CO8A 2PFBA 5CPRB 5J1RA 1YX3A 4HW0A 4YFNF 3TP0A 2QQBA 2B9SA 5F1JA 1K83J 2WY8Q 3A0HC 2AXLA 2OZUA 3OR1C 1VQOI 2AS5F 4GYGA 3IWFA 3TO6A 1XSVA 5FKNA 2QSHX 3TL4X 5GP9A 4CYDA 4IOCF 2EFPA 5D5VB 1D8JA 4GDFA 4A3JJ 4B3XA 1T0FA 3CMYA 4E7IA 1MZBA 2OC6A 4L0YB 3LSJA 2ZXJA 2ZNYA 3RPQA 5FFZA 1QRYA 5BQTA 2L5QA 2ZO4A 4Y33A 1R6RA 1LKXA 2LF7A 5J8CA 4Q5SF 3GF2A 3G73A 1WGXA 1MJ9A 2F5CA 5TISC 2ETHA 3IRQA 1HF0A 3LNQA 4ENMA 3ZMZA 4I2OA 3E6BA 3G4SI 2LRDA 2F4IA 1J09A 5E1XA 1FX7A 3F22A 3DPLC 3HRTA 1DPRA 2DPDA 2LF8A 4LB5A 2JA5J 3CCQI 4DOZA 1R23A 2PLYA 3W2VA 2L4AA 3S2WA 2FOKA 3ZN1A 4P9FA 1BM9A 2GBYA 2OF7A 1JTXA 1Z7LA 2RQQA 3DQVC 1IV6A 3LOCA 3ASNH 2QENA 3LMMA 3MEXA 2X0LA 2QBYB 1UCRA 2MLGA 2CRGA 4MFEA 2JUGA 1HSTA 5L3DA 2DDBA 3HUGA 1O3QA 3PIOF 3OSGA 5ICEA 1A31A 5TJJA 1ETWA 1VI0A 1TTYA 2GXAA 3JR9A 5JLXA 2XGDA 2EWNA 2YX4A 1KZHA 4C9YA 1O3SA 4M6XA 5D6FA 2IVMA 4RLQA 3G71I 2FQ4A 2BW3A 3IH3A 1GVJA 5E1ZB 4LLLA 1T8IA 2K9QA 2H6CA 1CQTA 1WQ2A 4WXDA 2CV1A 3BPXA 1LEAA 1X1BA 3CP8A 1UFMA 3H5AA 3QODA 1KGSA 3RYRA 4FHTA 2R5YA 2OCCH 1HW5A 2QUFA 3EETA 2OBPA 2E71A 1U9NA 3ZMSA 1YJ9I 1GT0C 1WPKA 1QGPA 1I1GA 2XAGA 4PDKA 3N97A 3WTTC 3SQNA 5KAIC 2ID6A 1JKPC 1S9HA 1HQCA 3I64A 1TNTA 2HKXA 1R1UA 4N9IA 4EM1A 4KA4A 4BQAA 2DFHA 3FK7A 3BTIA 1J2XA 3GFIA 4V2GA 3LWFA 5FJ8J 2W00A 2UZKA 3K1PA 1VQ4I 1QU3A 3CUOA 3HUGB 2EFOA 2L9RA 4HV5A 4XRFA 4XQFA 4I7HA 2XF6A 1S3JA 5DV5A 1ZYRF 3HKZN 2LD5A 2QKLB 3BG9A 5J4YA 4Y3OA 2NVTJ 3KPHA 1XSXA 2Y2ZA 3T1BA 3GFLA 3HTUA 1I1SA 3ZPLA 2OJED 1P4WA 4KT6A 4BXFA 3IV5A 1MJAA 1O57A 2V7FA 3FBIB 3FXRA 2XGCA 1XDUA 4GRIA 2JPCA 4IXAA 1U5TC 1OCOH 2K85A 1D8KA 3FM5A 4HLXA 3ROUA 4IRIA 3S1NJ 4E70A 3C2BA 4NNJA 1X3UA 4LG0B 3RCOA 2XF5A 4C3IJ 4UXNA 5HS8A 1S6LA 4AYBA 2KDZA 2L7KA 1HBXG 3BR0A 4W1UA 2D5VA 5LGUA 2ADUA 4AUXA 4G7HF 2XVCA 4IQ4A 3Q0WA 3Q5FA 1AKHB 1D5VA 5AIPA 1UHMA 4YRVA 1W5SA 1J0RA 2FU4A 1QZYA 1NK2P 2I10A 1A6QA 2YR2A 4DYRA 5DUIA 2E1MC 2R92J 1SD6A 4IRGA 2RAEA 4IHYA 1IZ1A 2Y75A 1HC8A 1ZARA 1MIJA 2DJNA 4U0VA 5DDGA 2A61A 2CQNA 3E5QA 3ABKH 2HYJA 3ELKA 3ZQ7A 1I50J 4ZYHA 2F5DA 1X1AA 3I4MJ 4G7OF 2VPLA 2P6SA 1DP7P 5DCFA 1V3FA 2ZJPF 4A3EJ 1P7JA 2TRTA 4EGZA 1XSDA 3OYFA 1DQUA 4KISA 1WH5A 1D1BA 1OISA 2MH9A 3Q0UA 4Z6YA 2BV6A 1U3EM 1FSHA 4ZTJA 2KIMA 3H92A 1X1PA 3W3CA 3OYNA 2M0MA 3KEQA 3FMRA 3FMSA 4OIOF 3HGGA 3BZ6A 4XSZF 1YX5A 2HKOA 3QRFF 1IUFA 2Z5UA 3QYFA 4I98B 5CVRA 2BE5F 2LBFA 1OCCH 2UUZA 5EZHA 3NRVA 4HX8A 4RAFA 2WB1A 1ON1A 2V1UA 1J9IA 3AG4H 1XG1A 2EFQA 3CTAA 2CJJA 2Z2SB 3LSRA 1T98A 4CHUA 2COBA 1PYVA 2DA3A 2O8KA 5HOOA 3F23A 2TDXA 2XB0X 2FMLA 4LK1F 2L54A 2JWTA 4C2MJ 4AIJA 5ICGA 3ZRGA 3K4BA 1LDJA 2W7NA 2F48A 3EDPA 3OYAA 4HQEA 3S3OA 1MBHA 3LA2A 5CQGA 1YQAA 4MTDA 1XGMA 3JTHA 3HSEA 3L2RA 1JJ6C 4L9TA 4V19K 1PUFA 2W24A 3OWTA 3S93A 4BY1J 1HCRA 2DA2A 5JHUA 4KN4X 2IS4A 4RM2A 1UHWA 4XONA 1Y8QB 2KDOA 1VQ7I 4D9JA 4HDUA 2WAEA 1R4NB 5F27A 2VE8A 2LBFB 3WTYC 4LGWA 4A3DJ 1YHQI 3O2PE 4LG3A 4FETA 3HOXJ 1FY7A 2FBIA 2LVSA 1DPUA 2Y9ZA 1HKQA 2H94A 4F7ZA 2Z16A 4E7KA 2MSYA 3WU0A 4BXUA 5AONA 2Q8KA 1FWZA 4KIFA 4PGHA 1F1ZA 1VQ9I 1QPMA 1SVLA 1K6OA 6PAXA 3BR2A 2HS5A 4OAZA 2DN0A 4PZJA 3WGHA 3FHNA 1JKOC 3H9GA 2O3FA 1POGA 2EB7A 3PM1A 2HZDA 4HYEA 4O5VA 1RRJA 2IAIA 1JI8A 3RZOJ 5FRMA 4LD5A 2BY1A 2R7DA 3KCCA 4RGSA 3CCSI 4KT5C 2MD5A 1ZLKA 3JAMZ 5E3LA 1MD0A 2HOEA 1YW9A 4XRSA 1YRNA 2DBBA 5E3OA 1LFPA 3HOSA 1WWXA 1EH8A 4KYWA 5D4RA 2Y48A 3AFHA 3MKYB 1UMQA 4DNCA 5B3SH 3E97A 2JSPA 3OYJA 3PL8A 3JRGA 2OU2A 2RQPA 1VTNC 4BJ5C 3L2UA 3LQQA 4D0PA 4QPOA 2OUMA 4OAYA 3KZIC 5KCMA 2XSDC 2VKEA 3CCMI 1U5TA 2A5YB 3QP6A 2FX0A 4NC8A 1GXPA 2V1DA 1CGPA 2AXTC 1ENHA 2DQLA 5CVVA 4J01A 1P6RA 2CWEA 1K6YA 3CDIA 3RPUA 3QU3A 4XIDA 4BACA 2VQGA 2P81A 2IA1A 3IC7A 1ETKA 3CCUI 3CJNA 3DP7A 2CH0A 2DJIA 4HX4A 1U6GA 1FBQA 2CYYA 1T95A 3K70C 5FKLA 1FOKA 1D0ZA 4M6VA 5J40A 1PP7U 4J19A 3TOAA 1YRNB 4YIIA 4HEA2 1YYVA 1YFHA 2VE9A 2J5OA 2H8WA 4DZPA 2RV8A 1SD7A 3U21A 4EJTA 2CO5A 1MBFA 4FISA 2JA2A 1K61A 2MGQA 3WTZA 2K3PA 2V1NA 2V26A 3WODF 2L4MA 2EZIA 3TP3A 2ZCWA 3RDIA 1FNNA 4DW6A 2HTSA 2COMA 3DKYA 4KUMA 5ICCA 3HHGA 1YS7A 3HGYA 1U5TB 1Y8RB 3HB9A 4EGYA 2EINH 3EUKL 4A3FJ 2KIQA 2W85A 2BY3A 1XS9A 1TQIA 1LEBA 1YW7A 3LFKA 1V4RA 1Z91A 1MW7A 3FISA 3K4NA 1UZCA 3OYIA 2VOOA 2EPFA 2L7ZA 3E6DA 4KDPA 1Z3YA 4S04A 4A0YA 3H0GJ 4M3EA 2XB5A 2EFNA 3OYEA 1JUMA 1E3OC 2LDUA 2DOAA 1RIOH 3TKYA 1SVOA 3DU5A 3SZGA 4FX0A 4E7ZA 2NS8A 3F0CA 2JVHA 5DM6F 1WKMA 1D3YA 1W0UA 5EEAA 1AA7A 2W48A 2KRHA 2OV7A 2X9DA 3WE3A 4IZZA 4HV6A 2P7VB 1VQKI 5CVIA 1FMVA 2QF7A 3QPHA 1E17A 4A3KJ 1BIAA 2KP6A 1SFEA 1O7FA 3QOPA 1ON2A 2JVGA 2Y0SA 4GGGA 5HLGA 1MMAA 3BR3A 3LA7A 3GTJJ 1OMIA 4UUSA 1C0WA 2VONA 2WAQN 2NVQJ 5B1AH 3CLQA 1ETQA 3FXQA 4M9SA 3I55I 5IT9Z 2M45A 3BJAA 2RNGA 3TO9A 1BI3A 4HF2A 4G7ZF 4A6EA 2VXZA 2KZGA 3NQOA 4N4OB 3KLNA 4YFKF 2RREA 3MN2A 4F3QA 5EEHA 2VB6A 3KP6A 1NG6A 3DF8A 4JQFA 5J6XA 4BE1A 3C18A 3GTMJ 2HVQA 2M5WA 3S2HJ 3FXUA 4MO7A 5B66C 2V6CA 3OOPA 3M8FA 3M07A 2GAUA 2DAOA 2KKOA 1Q1VA 3BROA 2XGXA 5H20A 2JK3A 2CQKA 2D2WA 4XSXF 3T0YA 2NOGA 5EEGA 4YFXF 2GLOA 1WRJA 2M0CA 2M87A 3NWTA 4UUSB 4A93J 4DGWB 1V55H 3B6CA 3SEQA 5M3FJ 1Z3XA 3VWBA 1WJAA 3CO6C 4ZDOA 3GBGA 2IGOA 2Q2EA 1SEUA 2ELJA 1E3HA 3K2ZA 2MC4A 2JA6J 2E5ZA 3EUAA 3RSNA 2ZJRF 4B47A 1LDDA 4ZH4F 3ZCOA 1JKQC 1UAAA 4XLAA 1FT9A 3JRBA 4PCQA 2STTA 3K1MA 1B72A 1BIBA 4JYKA 1FPQA 3BTLA 4DJAA 5IYBJ 1JE8A 2M4KA 1Y0UA 3V42A 3OL3A 3A01A 1NK3P 2R3SA 4FTHA 3NAUA 3FKIJ 3GMEA 4HNTA 4HZFA 1SFKA 2CSOA 1QA6A 2PJPA 3VDXA 2A6TA 4GYIA 1QZEA 3G6EI 3GTOJ 2CU7A 4LB6B 2QSFX 3HOTA 3ABUA 3R0AA 1RPWA 2F2EA 4XR6A 2FE3A 2O8XA 4LIVA 3JREA 3FXMA 9ANTA 3P5JA 2W1OA 2XRLA 2KHMA 2XPWA 3QAHA 3KE2A 4U0WA 2LG4A 2ZMEC 1BW5A 3FXLA 4IQJA 2F4MB 3SJMA 3K7AJ 3RJPA 1XD7A 4XKBA 4AIKA 1WH7A 2BOLA 5HDKA 1BOAA 2DOEA 4KN7X 3E5XA 5DYMA 4CCOA 5DUKA 3JRDA 3ZMUA 3D0SA 4H4KC 1MKMA 1WI3A 1TW3A 1HKSA 4L5IA 3RQIA 1AHDP 5E17F 1GHCA 2GWRA 3WTUC 4KFCA 5FLXK 1SMYF 1S7EA 1EH6A 4II2A 3B02A 2CW0F 4ZYAA 3KP4A 3A01B 5M5YJ 2EV6A 4V2FA 2IEKA 2O6GE 1W36D 1BR4A 1BC8C 1USTA 2D45A 4UV8A 3DWLE 3BZKA 1LVKA 1B8IA 1BL0A 3A0BC 4UVCA 4EVIA 2R5ZB 1FEXA 3RYPA 3WTWC 3IHUA 4ZZDA 4ITVA 1MBGA 2ESHA 2BGCA 3LSTA 4NUBA 3HXLA 3JSPA 2GIVA 5FD6A 2OTJI 1K78B 1R4MB 1JXSA 4WF2A 2IGMA 1Z1DA 3C2GA 4RB2C 4KICA 2H1KA 3O8HA 3KLOA 1GUUA 1Z67A 3V4GA 4UVAA 1TLHB 2LK2A 2X6YA 5C4XJ 1IF1A 1ONVA 4G9YA 2E36A 2LTPA 2JQ7A 3RKWA 4C2TA 2DA4A 1R71A 4W97A 3GZ6A 2DK8A 2ACJA 3U1DA 1HXDA 1QNTA 3FDYA 1MNDA 5D5UB 5FLMJ 4JBAA 3O6BB 4XM3A 2L0KA 4XKCA 4XL9A 2K27A 5C3EJ 2RKHA 1K4TA 2JTVA 3GX4X 1MGTA 2WA0A 2MW8A 1KU3A 1YJNI 1LFUP 3TW6A 4YG2F 4A3MJ 3PNVA 4IRHA 2BY2A 2VKVA 1DDNA 3WTVC 3V7CA 5BOXA 3L09A 1IRFA 4Y4RA 2IA0A 5JI6A 3BT9A 5IYDJ 2O0YA 4H0EA 1I5ZA 1STZA 3ZMDA 3CC4I 5EGOA 3RTRA 4BGDA 2QVOA 4Y17A 2X85A 2IP2A 3I4PA 3HSRA 4U7DA 2K4JA 3JCUC 4B1RA 5K5OA 1ZG5A 3K9TA 3QPLA 2CV2A 2ELHA 2IXSA 1UELB 5D5XB 2KZVA 3G3ZA 2R7WA 1B9NA 2VN2A 2JZYA 3B73A 4FE7A 4C30A 4XLPF 1R5GA 3CP2A 4QLCU 2QGUA 2IT0A 5J1YA 1IRGA 3OYMA 2FUG2 3GWZA 4FE4A 1TP4A 3V8KA 3DU6A 2HQNA 4OIRF 5HODA 2BZTA 5EJCA 2JN6A 3JRAA 2K9MA 2PMUA 2E34A 2WADA 3JRCA 4OWRB 3N05A 2KJCA 4LJZF 2L02A 4RGRA 1BR1A 3I59A 2HPIA 4II3A 3GZ5A 4RM3A 3PIPF 2CS3A 1VQ8I 1IN4A 2M7AA 1EA3A 2QWWA 3R60A 3V8LA 1EH7A 5ICFA 2YSRA 3Q3SA 3NWSA 4P96A 3TDZC 4HRIA 4X0GA 2JRMA 5EGOB 1KU9A 4MHGA 3TOBA 3MZ8A 1GDTA 2W84A 2ID3A 3CUQC 2NYXA 2BXYA 4AD9A 1TZLA 2WV1A 4UY8I 3ZP5A 1T2KA 4XKWA 5L3FA 1E3PA 5GAHJ 3D5SC 4ZYEA 4B43A 3OMYA 1RR7A 2L9VA 1CF7A 1OCRH 3CJTB 4DBQA 1J5YA 2ISYA 5ERIA 3MD2A 3DEUA 4RLFA 5FO5A 1G3WA 5GADJ 2BW3B 2H1LA 1HDDC 4CGZA 1ZH5A 5LGTA 1IXCA 2E1NA 2M7BA 3BY6A 1TC3C 3I59B 2LY9A 2Z33A 2LY1A 2CUZA 2H6BA 2I5UA 5DD4A 1IV8A 3H9QA 2HDDA 2ZMEA 2R5YB 1FLIA 1OYYA 1Y1VJ 1ZK8A 2LC2A 3BR6A 1IN7A 2FNPA 2GOMA 1JHFA 1X2MA 3UR3C 1RR8C 3MAJA 2FXAA 3QYEA 3R6SA 2JA7J 5A2QK 2BYVE 5LLQA 3BP8A 4BE2A 4G6QA 3SZTA 1JHHA 1OCPA 4HBLA 4LFUA 2MBFA 3GEZA 3RZDJ 1ACIA 2PBIA 1GXQA 1G2HA 2OTLI 3TO7A 2F4OB 1HSJA 4RS8A 2XAHA 2CW8A 5HLIA 1RESA 1JGSA 5F1RA 1D0XA 1TW2A 1CF7B 2M3AA 3K4LA 4UB8C 3I9V2 4BNCA 1MBKA 4MFDA 2LYCA 4CDGA 3AL0B 1ZAOA 2KMUA 4UV9A 3WG7H 3P9IA 3BTCA 4U88A 4BU2A 1JT6A 1TQPA 1Y1WJ 4N4NB 4Z2YA 2M4GA 3MFKA 1OLTA 5DM7F 5FGMA 1J59A 3VPRA 3J7YJ 3OL4A 5FB2A 4L18B 3PSFA 1WVRA 2ZMEB 2KT0A 2OA4A 3ZQQA 1IDZA 1R49A 4HSTA 1XGSA 4I01A 2VIXA 4XLHA 2P8TA 5CYVA 1WJ5A 4MEYF 3ECHA 2XAQA 1A35A 3FM3A 1JUSA 2XRNA 5B5EC 2RGVA 3LL7A 3EYYA 4M3DA 1D1AA 1U2WA 3ZN0A 3ULQB 4U0YA 4BDZA 2XPVA 5EDNA 4A3GJ 3DTKA 1FIPA 4CH7A 1OYWA 2DFIA 4M3FA 3JSOA 3L2VA 4EM0B 5F6FA 5KK1A 3M8EA 2DMQA 4P9UA 1SD5A 5LHIA 4XRMA 2ME0A 4ENNA 4NC7A 2EILH 1IW7F 4A2UA 1P92A 2DK5A 1IXRC 2P4WA 2MLKA 1FSEA 3E3VA 3S3NA 3DLLF 3PFYA 3CF5F 2PQ8A 1TL8A 4JX4A 3BCBA 4AIHA 1VFCA 1W4MA 2OZ6A 1LVAA 5LRRA 1FBSA 1YIOA 4RMNA 4AYBN 4E7HA 1G59A 1IAWA 3HC7A 3HOUJ 1ZKGA 3WU1B 3C2HA 4IX7A 2OQRA 4LIUA 4IHTA 2O7OA 3DXJF 4FCYA 2DOFA 2XKPA 2IA2A 1V5FA 4E7LA 2J5PA 4EJOA 4M6YA 4IPAA 3KEYA 3WU2C 5FROA 3BZCA 2VLAA 3S15J 5LBQA 4WWCA 1I27A 3CO7C 3FK6A 3HZJA 3CJQB 1DP3A 3ESWB 2FBHA 1NTCA 3IKTA 1Z0XA 2X6OA 3OIPA 3UNGC 4OIQF 3I56I 1X1DA 3EPZA 3I71A 1MDMA 1MH3A 5ILSA 4KNYA 1NHAA 2R7FA 2DPUA 4A0XA 1BI0A 5HNFA 1AOYA 3PQKA 4M73A 1F4KA 3DEWA 4ESFA 3Q0VA 1R36A 1W7PD 2QYOA 2VJ4A 2K3FA 5ILUA 4CICA 3OIOA 3K4CA 3M3YJ 2IS2A 3AG2H 1P9QC 4BL0B 1ZGJA 1SAUA 4BEHA 2L9NA 2WV0A 3KZYA 3Q9VA 4I02A 2HDWA 4C3JJ 5FRNA 1BBYA 1FBUA 4RAYA 3EUHC 3BG3A 3M1CA 3LAJA 3PSIA 5E79C 3KETA 2HGCA 3CESA 2FNAA 3OYDA 2ZBKA 4XOPA 1I6HJ 3CUQA 3VSKA 2XAUA 3T8TA 4ZZLA 2HYGD 3GLLA 1K7AA 1RNLA 4E4HA 1VZ0A 3F6VA 1LPQA 1D0YA 1QQIA 5HLHA 2WB1N 1BOBA 2XIGA 2FEZA 3KEOA 3K4MA 5HS9A 1F43A 3H1CA 3OYCA 1MDMB 2X6XA 5CKTA 4BY7J 3MVPA 2BHZA 1PUFB 1R5ID 1B1BA 2IJLA 4GCVA 4F91B 3IWZA 1DU0A 2PJRA 1XPXA 1B4AA 1BI2A 4I6ZA 5F0FA 3GUDA 4BQNA 1ZTRA 2YPRA 2ZJ2A 2P7CB 1QVUA 1G3TA 3FKJA 4X6AJ 2E19A 1X58A 3IUOA 2PMZA 3MQ0A 3VOEA 1I39A 4ESJA 1KYZA 2Q0OA 5EZGA 2M34A 1SFOJ 3ZQFA 5CVUA 1U8BA 4M72A 3RQ4A 2NRAC 3IAS2 2K86A 5HLTA 4UB6C 1LDKB 2KQRA 2I8DA 4ON0A 3T5XA 1OPCA 3CUQB 5IP7J 1RETA 2DA5A 1Z9CA 1E0EA 4PJJA 2DMTA 1XN7A 3JW4A 2VT3A 3BJOA 4MGRA 3PNYA 5K5RA 3KP3A 4NDLA 1G4DA 2DMPA 3WE2A 1ZN2A 1EF4A 1KQ9A 5DTDA 5IY5H 1IN8A 4Y52J 1F9NA 2G0EA 4L9NA 1FYLA 4CXFA 2ZKZA 3PO3J 2EIJH 3S14J 2G9WA 1REPC 4GFBA 2DFFA 2NVUB 2XAFA 2PJRB 1H0MA 3DLAA
chains in the Genus database with same CATH topology
4ZC3A 4CCLA 4CUGA 4C9YA 4HNTA 1SFKA 4RLQA 3VDXA 4F92B 4DIQA 2A6TA 2BW3A 4XN3A 3HOTA 1WJEA 4XR6A 2CV1A 1X1BA 3CP8A 3H5AA 1FMWA 2AQFA 3QODA 4P1WA 4LIVA 4BDYA 2LREA 2L9SA 2W1OA 2ZSIB 3S3MA 2KHMA 2LG4A 2VL8A 4IQJA 3TMOA 4XKBA 2BOLA 4BQOA 1S9HA 2R7QA 2BVLA 4CCOA 1QHGA 1V5GA 2E5NA 3MMYB 4H4KC 2Z1DA 4P5OA 3QYBA 2QKMB 2W00A 4AVZA 1WFXA 1QU3A 5LFAA 2VKHA 3ONQA 4II2A 2E1MB 3HUGB 3VYUB 4ZYAA 4XQFA 2XF6A 2IGKA 1W36D 2QKLB 1BR4A 3D5LA 4Y3OA 2HNHA 4XLEA 5TGTA 3DWLE 1LVKA 2IS1A 4PK4A 2K5CA 4ITVA 3OY9A 4KT6A 4NUBA 4BXFA 3HXLA 2V7FA 3FBIB 3BLYA 1QHHD 3H5RA 2KRCA 4GRIA 4LITA 2IGMA 3C2GA 1Y6IA 4CCKA 3I3LA 2LH9A 2R7RA 4NNJA 2X6YA 4HSRA 3RCOA 4CA0A 2XF5A 3OIQA 1PJRA 4C2TA 2R7UA 4XMYA 5HVQC 1Z21A 3SEZA 4AYBA 2L7KA 4PUSA 2X1DA 4FASD 3BG6A 2HVSA 3FDYA 4BEHB 1MNDA 3OYHA 5CQEA 3OYKA 4IQ4A 2CUJA 4XM3A 3E0JB 4XKCA 4YRVA 4PJMA 4XL9A 4PSWA 2XC7A 2WA0A 1N77A 3FBNB 3BG7A 2X6WA 2VQCA 2V9KA 3PNVA 2E1MC 2L2OA 4Y4RA 2Q1ZB 4DBRA 3DEEA 4CCNA 2VKDA 3RTRA 4BGDA 4C2UA 2X85A 3LSGA 2WBMA 2X1CA 3M8JA 1U0JA 2CV2A 1X1AA 2R4GA 2V6EA 2IXSA 2ZXHA 3K4KA 1UELB 2VPLA 4D1QA 2KZVA 2R7WA 4C30A 3CP2A 4MLOA 4CCJA 2DT6A 3H9JA 3OYFA 2GOXB 1DQUA 4KISA 3OYMA 2FUG2 2V4JC 1D1BA 2P0WA 3DU6A 2WY7Q 4ZTJA 3W3CA 3OYNA 2M0MA 4BQQA 4BJ6C 2K9MA 3HPGA 1GLNA 2WADA 1YX5A 3H35A 4OWRB 3N05A 1BR1A 3QYFA 2HPIA 4II3A 4RM3A 2CS3A 4CCMA 3S32A 1OR7C 2LBFA 3CF2A 2HVRA 2M7AA 1EA3A 1ZELA 2CMPA 2UUZA 3VYSB 2WAQA 2VQLA 4PFPA 3K70D 2VJ5A 2CV0A 1TT0A 2IGNA 1NG7A 2CFOA 2HPMA 3NWSA 2WB1A 3OS1A 3PNTA 4HRIA 4X0GA 3K4JA 2Q2EB 1WJCA 3OS2A 3BC8A 4YELA 2Z2SB 3VYRB 1PYVA 1W36C 1TZLA 5HOOA 3H5NA 2KPMA 4XKWA 3ZRGA 3D5SC 2ZFUA 4B43A 1MMDA 3K4BA 1X4PA 3OMYA 2W7NA 2MYSA 5KNLA 2X51A 4HG2A 3OYAA 4DBQA 3S3OA 4PFOA 1X4OA 3MD2A 2R7XA 5CQGA 4RLFA 3L2RA 2DCEA 4NQWB 3OWTA 3S93A 2R7OA 2BW3B 2IS4A 4RM2A 3DTEA 3LSIA 2VQHA 4XONA 4BUPA 2M7BA 3DTIA 2R7SA 2KDOA 3L2QA 1T0FC 4D9JA 2LY1A 2CUZA 2WAEA 2LBFB 4PJLA 3OS0A 3H9QA 4E7SA 4BJTA 4LG3A 4FETA 3S8PA 2LC2A 3W2AA 2GOMA 2Z16A 4E7KA 3UR3C 3QYEA 3DPUA 4ZDLA 2KLOA 3BCAA 1D1CA 2DT7B 4XKVA 3LSHA 4BE2A 4OAZA 3FHNA 3AKZA 3D5RC 3H9GA 2HZDA 1IRXA 3CMMA 3ZR8X 2CW8A 4E7JA 1JI8A 1D0XA 2F6CA 2E60A 3F9KA 5FRMA 2M3AA 3K4LA 3I9V2 3W2WA 3K6GA 2CW7A 2LYCA 4QPQA 4B44A 2R7TA 3AL0B 1LFPA 2KMUA 4XOTA 1X19A 3HOSA 3SYTA 1WJBA 1UG0A 4BU2A 4N4NB 3AFHA 3MKYB 2VXDA 2M4GA 3A2KA 1OLTA 2JSPA 3OYJA 3PL8A 3OL4A 3VYTB 3TBIA 4BJ5C 3L2UA 3OOUA 4QPOA 3PSFA 2OUMA 4OAYA 4XN0A 5KCMA 3ZQQA 4U7BA 3A1YA 2A5WA 2K9LA 1X1CA 3G2BA 4HSTA 4NC8A 4B48A 2VIXA 4XLHA 1WJ5A 4J01A 1MMGA 2MFZA 3SDBA 1K6YA 3KYLA 2O5RA 3LSKA 2VASA 1DGRM 3LL7A 2F5VA 1D1AA 4BACA 2VQGA 4ZJZA 2HU9A 4BDZA 3DTKA 2R7VA 2VJJA 4CH7A 2CH0A 3L2VA 2DJIA 3OYBA 1T95A 4YEJA 3HPHA 3K70C 1N78A 5LD2C 5HNHA 3HKZA 3IP4B 1BR2A 4XNFA 4NC7A 1D0ZA 3H0DA 1MMNA 3VSLA 4AU7A 1V5EA 4ZDPA 3K10A 3S3NA 4HEA2 3PFYA 2W4SA 2MABA 4IKFA 3DKXA 4XLFA 3BCBA 3LSMA 3U21A 4PJNA 4JOMA 4RMNA 2JA2A 4XORA 4E7HA 4E6KG 3HC7A 1G59A 3ZGKA 2K3PA 3PJRA 2V1NA 2V26A 3C2HA 4IX7A 4EATA 2WAFA 4CSWA 4J00A 4F93B 4LIUA 3DKYA 3OYLA 3AL0C 2UV1A 1ERDA 4CZCA 1V5FA 3EUKL 4E7LA 3QOEA 2IS6A 4R79A 1G8XA 3KEYA 3PUBA 3KX2A 3OR2C 5FROA 3J7AY 2VLAA 4BE0A 1MW7A 4XLCA 3K4NA 1Y56A 4HNUA 3MKWB 3OYIA 3CJQB 3ZXSA 1DP3A 2KL4A 3A4CA 1Z3YA 2MD0A 3OIPA 2ZSHB 3UNGC 1X1DA 3EPZA 3OYEA 5HNFA 2DOAA 1YE9A 3DU5A 3SZGA 2VJ4A 4F52A 4E7ZA 1DGWY 2UWMA 3K4CA 2JVHA 3LFUA 2IS2A 4F55A 1P9QC 4BL0B 1SAUA 4BEHA 2L9NA 1AA7A 2HDWA 3HG9A 5FRNA 2X1EA 4ZTFA 1MNEA 2KRHA 2OV7A 3EUHC 4IZZA 3HL2A 3M1CA 3CJRB 3PSIA 2XSJC 3OYGA 1FMVA 2LY2A 3IAM2 1WJDA 2KP6A 3CESA 3OYDA 2JVGA 4XOPA 2Y0SA 1MMAA 3VSKA 2XAUA 1KONA 3CZ6A 4KJZA 4U87A 2HQAA 4E4HA 5CPRB 1VZ0A 1YX3A 1D0YA 2RNGA 2ZXIA 1HA8A 1BOBA 3K4MA 1WJFA 2WY8Q 3MKZA 3OYCA 2VXZA 2X6XA 5CKTA 3OR1C 2AQEA 4N4OB 2DXIA 3TL4X 2RREA 5KHDA 4F91B 4F3QA 2PJRA 2VB6A 4B3XA 4BS9A 2XDVA 2VJIA 1NG6A 4E7IA 4ANJA 4BQNA 4JQFA 4BE1A 2OC6A 2HVQA 3E1SA 3FKJA 2L5QA 2NOJB 4Y33A 3IUOA 1R6RA 1LKXA 2PMZA 3RPUD 3RQ4A 3IAS2 4PSXA 5HLTA 1LDKB 2KQRA 2I8DA 2F4IA 1J09A 2LRDA 2LOOA 3DPLC 1E0EA 3NWTA 4G6TB 2XF7A 4PJJA 3DPTA 4DGWB 2BVMA 3SEQA 1Z3XA 3VWBA 1WJAA 4DOZA 3PNYA 4HPQA 4ZDOA 3GBGA 2IGOA 3W2VA 2ELJA 2MC4A 2E5ZA 3EUAA 3RSNA 4B47A 3DQVC 1Z7LA 2RQQA 3ZCOA 1UAAA 4XLAA 3LMMA 4KITB 3L2WA 5JHFA 2JUGA 4DJAA 2PJRB 1N75A 2M4KA 3V42A 3OL3A 2W82A 3DLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J00 A;  4YRV A;  3QOD A;  4HRI A;  4IZZ A;  4J01 A;  3QOE A; 
#chains in the Genus database with same CATH topology
 4MQV A;  4I76 A;  1BN5 A;  5EYR A;  3IH2 A;  4CCL A;  4CUG A;  4NQW A;  2VOP A;  2L7F P;  4F92 B;  3GCM A;  5D8L B;  3W6V A;  1J7K A;  4FT8 A;  4OIN F;  3KP2 A;  2M8G X;  1WJE A;  2F5E A;  2AQF A;  1FYM A;  3GXO A;  1SFX A;  2A6E F;  4M3B A;  4P1W A;  4BDY A;  2LRE A;  2L9S A;  4ESB A;  3PUF A;  3S3M A;  5E8G A;  2EFW A;  4M74 A;  1FJL A;  2WTE A;  1VQN I;  2VL8 A;  2IW5 A;  1VQ6 I;  1OKR A;  3CLO A;  3DBR B;  4B3A A;  4B09 A;  3I54 A;  5FKO A;  4BHP A;  5IT3 A;  1VQP I;  4A6D A;  4BQO A;  1A6I A;  2KFD A;  3HOW J;  2R7Q A;  2BVL A;  3MZH A;  1QHG A;  3MKL A;  4D7M A;  3L7W A;  1V5G A;  1SAN A;  3MMY B;  1FZP B;  1ZR2 A;  1W5T A;  4GXO A;  5J8F A;  2Z1D A;  3A02 A;  3P7N A;  1VF9 A;  4P5O A;  3V7S A;  5IP9 J;  2QKM B;  2L7M P;  3V7R A;  1WFX A;  4A69 C;  5LFA A;  2VKH A;  1A04 A;  2RDP A;  1FC3 A;  5E18 F;  2E1M B;  3J80 K;  2EV5 A;  3VYU B;  3E6C C;  3M4O J;  1ORK A;  3BJ6 A;  3BPV A;  1YO5 C;  2FBK A;  2XRO A;  4BKX A;  3VOD A;  3ML6 A;  2HNH A;  4XLE A;  5TGT A;  1FOY A;  2DFE A;  4PK4 A;  5DS9 A;  5IP6 A;  3ABT A;  1W7P A;  3KYD B;  3DCF A;  5BS6 A;  3GZN B;  4D5F A;  4Y15 A;  3IL2 A;  1J75 A;  2GM4 A;  1IUY A;  1PDN C;  3BLY A;  1QHH D;  2KIU A;  1QO0 D;  3K69 A;  3F8F A;  1ZHF A;  3LQR A;  1VND A;  4LLN A;  3PO2 J;  2LR8 A;  5HDG A;  1BW6 A;  1YI2 I;  3HBL A;  1Y6I A;  4YIF A;  3ECO A;  3I3L A;  3W6K B;  4ENK A;  5H2F C;  2ELK A;  4HX7 A;  2HI3 A;  3FWE A;  2M8E A;  2XPU A;  1B9M A;  2P5V A;  3F8M A;  3U9G A;  1UJ8 A;  5K5Q A;  2R7U A;  3FXK A;  3NAR A;  3KZZ A;  2MA3 A;  1KYW A;  2EA4 A;  2X1D A;  3EUH A;  3P9C A;  2DLL A;  4PUS A;  3FHZ A;  5HDN A;  2HVS A;  3OYH A;  2HQR A;  2EA2 A;  4G12 A;  2HZT A;  3OYK A;  1XMA A;  4BBR J;  1R1V A;  1V54 H;  3HTS B;  1GV2 A;  1IXS B;  1G6N A;  2N8G A;  3E0J B;  5FFX A;  1B59 A;  2ICW G;  4PJM A;  5C44 J;  4M9X A;  2UXN A;  5HS7 A;  3QQA A;  1A36 A;  4S0H B;  2DOD A;  3QPT A;  3L2C A;  2VOD A;  3FZV A;  3B6A A;  4UUT A;  3JTG A;  2E7X A;  1N77 A;  4OMY A;  3FBN B;  4KMF A;  1IRZ A;  1FTZ A;  3R61 A;  2X6W A;  2A68 F;  4EJU A;  2L2O A;  3ASO H;  3J7Z I;  3J81 K;  3HIF A;  4IHS A;  2DYS H;  3GO5 A;  4CZZ A;  2QQ9 A;  2DA6 A;  2X1C A;  1KA8 A;  3WG9 A;  2Y0S N;  2V6E A;  2ZXH A;  4DYQ A;  2DU9 A;  4XRS G;  5KVR A;  5D8K B;  1ETY A;  4CCJ A;  2DT6 A;  2LMD A;  3H9J A;  3SDG A;  2GOX B;  3BWG A;  3ZQL A;  1FOW A;  1B6A A;  2HOA A;  1MJB A;  4BXX J;  2P0W A;  2FJ1 A;  2WY7 Q;  3F6O A;  1QPI A;  4WXC A;  1HLV A;  3RKY A;  1Q1H A;  1R00 A;  2X4H A;  5L3E A;  1KU2 A;  2K02 A;  2PN6 A;  1OR7 C;  1ZEL A;  2CMP A;  3VYS B;  3CD6 I;  4N9H A;  2LFB A;  2VQL A;  2VJ5 A;  4B8X A;  4RB1 A;  1TT0 A;  2CV0 A;  4L5J A;  1PP8 F;  2NS7 A;  2HPM A;  2JUC A;  2A69 F;  3OS1 A;  3PNT A;  4ETS A;  2JRT A;  2VBX A;  2FRH A;  2Q2E B;  3OS2 A;  2YU3 A;  2CGP A;  2WC2 A;  3VYR B;  3CCV I;  2O9L A;  1XC5 A;  3O3K A;  1TT5 B;  2PG4 A;  1W36 C;  4RAG A;  1U8R A;  2LP0 A;  4LOC A;  2KPM A;  2M2E A;  1VQM I;  2W25 A;  2ZFU A;  3X2Q H;  1B72 B;  1X4P A;  3E6M A;  2MYS A;  1IG7 A;  1ZGA A;  2X51 A;  4HG2 A;  2DW4 A;  5GTH C;  4PFO A;  1X4O A;  1YIT I;  2DT5 A;  5F04 A;  1JKR C;  3D1N I;  2EZL A;  2DCE A;  2R0Q C;  1EJ9 A;  1IC8 A;  2R7Z J;  5K7F A;  2R7O A;  2LSO A;  2ESN A;  3GTL J;  4RB3 C;  2OAZ A;  3HDD A;  1MSF C;  2VQH A;  4BUP A;  2R7S A;  2AHQ A;  3L2Q A;  3MZY A;  1RUN A;  2E1C A;  4IOA F;  2GZW A;  4BJT A;  1IGN A;  3GLX A;  1T33 A;  3S8P A;  1HW2 A;  4RBO A;  2FA5 A;  1HDP A;  4FQG A;  4UVB A;  2L01 A;  4KIB A;  3DPU A;  3K0L A;  4QSH A;  2NXN B;  1BI1 A;  5FLX Z;  3R4K A;  3WHB A;  1HKT A;  2HOT A;  3D5R C;  2DYR H;  4BAY A;  3PFI A;  1XX5 A;  2E2J J;  1IRX A;  3CMM A;  3U2R A;  4E7J A;  1GVD A;  5E1W A;  4LLG F;  2GXG A;  3JRH A;  5FKM A;  2F6C A;  2LKP A;  3C3W A;  3S2D J;  3COA C;  4X1E A;  2DMN A;  2QBY A;  4L9V A;  3W2W A;  3K6G A;  2Y69 H;  4HA8 A;  4QPQ A;  4B44 A;  3JRF A;  3MCZ A;  2R7T A;  1X19 A;  1ZG3 A;  2QEX I;  3SYT A;  1UG0 A;  2EH3 A;  2HWV A;  2CQX A;  4MQ9 F;  5LHH A;  5C4J J;  1B8I B;  5BMZ A;  3A2K A;  3HOZ J;  3WTX C;  2G7H A;  2H09 A;  3FF5 A;  3I53 A;  3VYT B;  1T38 A;  3TBI A;  3IH4 A;  4AID A;  5K7Z A;  2ZNZ A;  3L1P A;  5LGN A;  4XN0 A;  3NEU A;  4PJ0 C;  1EV7 A;  4ZYG A;  5D5W B;  5ILV A;  2K9L A;  4HQM A;  4B48 A;  3REO A;  2AO9 A;  1OJL A;  4C3H J;  3HOY J;  5GPC A;  2ECC A;  2KJB A;  3FXJ A;  1MMG A;  2E1O A;  2ZFW A;  3SDB A;  3GTG J;  2O5R A;  2IPQ X;  3GFJ A;  5LEK A;  2GA2 A;  1SVM A;  2VAS A;  2ZJQ F;  1TQM A;  1TWA J;  2VC1 A;  2W57 A;  3F3X A;  5GAG J;  2ECB A;  1XMX A;  2HU9 A;  3QWL A;  3SZP A;  5D6E A;  2GA1 A;  2VJJ A;  4EM2 A;  1MH4 A;  2EJR A;  3HPH A;  2P5K A;  1N78 A;  5LD2 C;  3HKZ A;  2JSC A;  3K1N A;  3BQY A;  4O3M A;  3VSL A;  4JK1 X;  3ISP A;  1V5E A;  4ZDP A;  1YLF A;  1XCV A;  4HDV A;  4BYY A;  2XUB A;  2D1H A;  4M71 A;  1P2F A;  3ZGK A;  4L5E A;  4EJV A;  3SXY A;  4EAT A;  4CSW A;  3M9A A;  3OV8 A;  3OYL A;  4A3C J;  1OYI A;  2EBI A;  3CCL I;  1IN6 A;  2HR3 A;  1S7O A;  1JT0 A;  3LA3 A;  2IS6 A;  4R79 A;  1DU6 A;  1G8X A;  3DFG A;  3PUB A;  2A07 F;  4MNU A;  1R5H A;  3OR2 C;  3J7A Y;  2FMY A;  3IKV A;  5F08 A;  1BA5 A;  1Y56 A;  3MKW B;  4G8X A;  2VC0 A;  4O6J A;  3O8G A;  3G1O A;  3GYH X;  4NBQ A;  1XCB A;  3TDU C;  4FX4 A;  5J3L A;  1ITY A;  3A4C A;  1SD4 A;  2MD0 A;  4MIM A;  1WHU A;  1EKE A;  3UKG A;  3GFM A;  4RGX A;  5IYC J;  3F8N A;  4LG0 A;  4A0Z A;  4DQ2 A;  1YE9 A;  2NS0 A;  5L3C A;  3F21 A;  1OR7 A;  4R1H A;  4F52 A;  3WTS C;  2UWM A;  2IBD A;  2GIZ A;  3BR5 A;  3FIW A;  3CCE I;  4LMY A;  4A3I J;  1P4X A;  1Z77 A;  2RNJ A;  4IO9 F;  3RI4 A;  1MNE A;  3LSP A;  1AKH A;  3SFZ A;  2HDC A;  2WWY A;  3CJR B;  2XSJ C;  1BJZ A;  3VEP A;  5DCM A;  1O3R A;  3OSF A;  4UNO A;  2VUM J;  4A5N A;  1L0O C;  2L3D A;  4OU0 A;  3K2A A;  3GTP J;  4HF1 A;  3C7J A;  3ZQI A;  4I0B A;  3CZ6 A;  4KJZ A;  1W1W E;  1ZLJ A;  4BHB A;  3AG3 H;  2CQQ A;  2DI3 A;  1LE8 A;  5LEJ A;  2ZXI A;  1HA8 A;  3EQL F;  4MTE A;  1WJF A;  1X3W B;  4B4C A;  3MKZ A;  1T6S A;  3HRU A;  5CLS A;  2AQE A;  5FD5 A;  2DXI A;  5KHD A;  3ZQC A;  2ZXW H;  2DO7 A;  4BS9 A;  2XDV A;  2VJI A;  1R58 A;  4ANJ A;  3W6J B;  2DMU A;  3E1S A;  2Y31 A;  1ETO A;  5CVJ A;  1L3L A;  3CDL A;  2YU9 J;  5A2Q Z;  5D4S A;  2F5F A;  2NOJ B;  3TGN A;  1YJW I;  1WCM J;  3G1M A;  2RN7 A;  4WK8 F;  3TED A;  2OPT A;  3HHH A;  3BQZ A;  3RPU D;  5E3N A;  1VQ5 I;  1H8A C;  5DCM B;  2QCO A;  3FXO A;  5LHG A;  1IO2 A;  4PSX A;  1JJ8 C;  5ED4 A;  1XDS A;  1H88 C;  4IHX A;  1P4A A;  2LNB A;  2LOO A;  1S29 A;  4XBF A;  4G6T B;  4ASN A;  1ZGW A;  2XF7 A;  3DPT A;  2BVM A;  1Z6R A;  1G3S A;  4BBS J;  3PQJ A;  4HPQ A;  2XV4 S;  4EQQ A;  2H27 A;  4RB0 A;  1N25 A;  1A5J A;  3WGI A;  1LE8 B;  1Y0N A;  3VB2 A;  1O7L A;  2LKS A;  3FMQ A;  4Y7N J;  5B1B H;  3CME I;  4KIT B;  3L2W A;  5JHF A;  4N0B A;  1OCT C;  5H6R A;  1N75 A;  1X3Z B;  5J1U A;  3KYC B;  5K7H A;  2W82 A;  3IRR A;  5F64 A;  3L9F A;  4ZC3 A;  2A6H F;  4D5C A;  2JT1 A;  1M1E B;  1K4S A;  1ODD A;  1OFC X;  4DIQ A;  3GTK J;  3DKW A;  3QP5 A;  4XN3 A;  5FLV A;  3F72 A;  4HOB A;  4Q4Z F;  1RKT A;  2CUF A;  4OIP F;  4K2E A;  4GO1 A;  1LUJ B;  1FMW A;  2FSW A;  1ZRD A;  1PUE E;  2BHY A;  2ZSI B;  1BJA A;  3ERM A;  4A3L J;  3RIR A;  3HM5 A;  5IOY A;  2MG4 A;  3I4N J;  3TMO A;  4ABZ A;  3H36 A;  1UHS A;  2FD5 A;  3HRM A;  1HW1 A;  4UUV A;  1I3A A;  2ISZ A;  2E5N A;  2E35 A;  3QYB A;  1NH3 A;  2K9N A;  2VBZ A;  2XAJ A;  1W0T A;  5LRS A;  4AVZ A;  4A3B J;  3ONQ A;  5J4V A;  4NHJ A;  4QIW N;  1MNM C;  3E7L A;  1W5C C;  4EV0 A;  2IGK A;  5FKK A;  4HF0 A;  2QQA A;  4HLY A;  1JGG A;  3D5L A;  4OOI A;  2K7L A;  4RDU A;  2P5L C;  3HOV J;  2IS1 A;  2NNN A;  4KMU X;  2JA8 J;  3JAM K;  2K5C A;  1XMK A;  3KFW X;  4WCG A;  4JP0 A;  1AU7 A;  2BBY A;  2K40 A;  3ZMV A;  4XLN F;  4Q47 A;  3OY9 A;  4D7N A;  3KP5 A;  5E3M A;  5JVG F;  4G94 A;  1SAX A;  3H5R A;  2KRC A;  2EIM H;  4LIT A;  4DZJ A;  3LAP A;  2M9H A;  2XGE A;  2VT2 A;  1TWG J;  2MH2 A;  4CCK A;  1TWH J;  4IVN A;  2FQ3 A;  1RZ4 A;  2LH9 A;  2R7R A;  4JX5 A;  2V9P A;  4HSR A;  1H89 C;  4P55 A;  5JR3 A;  3MWM A;  2YX7 A;  4CA0 A;  3OIQ A;  1MBJ A;  1PJR A;  1YW8 A;  4XMY A;  1APL C;  5HVQ C;  1Z21 A;  3SEZ A;  4FAS D;  3BG6 A;  1RUO A;  4BEH B;  1JUP A;  1YG2 A;  5CQE A;  2CUJ A;  3WGG A;  5E20 A;  2LKX A;  2A3S A;  2CFX A;  3HJE A;  4PSW A;  5J47 A;  2NAZ A;  1IDY A;  2DTR A;  5AIQ A;  2CG4 A;  2DDA A;  2EQR A;  2XC7 A;  2QLZ A;  1OQY A;  1SC7 A;  5DEQ A;  1S7A A;  3J7A O;  1RI7 A;  3BG7 A;  2VQC A;  2V9K A;  4EEF G;  2E7W A;  3ZOB A;  1ZR4 A;  2Q1Z B;  4DBR A;  3DEE A;  1MSE C;  4IF4 A;  4CCN A;  3S16 J;  2VI6 A;  1RC9 A;  4XIC A;  3CC7 I;  1JTY A;  2VKD A;  4C2U A;  4LK0 F;  4NB5 A;  3C1D A;  1TNS A;  4AM3 A;  2VBW A;  3LSG A;  4A5M A;  1DUX C;  2WBM A;  3M8J A;  2HEO A;  3GTQ J;  1U0J A;  2EV0 A;  2TCT A;  2Y0M A;  2X48 A;  2R4G A;  2M1B A;  2O61 A;  3K4K A;  3S17 J;  2G7U A;  1I6X A;  2BEO A;  2VPR A;  4D1Q A;  5TRD A;  3GVA A;  4MLO A;  2CQ7 A;  1IJW C;  3CC2 I;  2OCE A;  3M7G A;  2V4J C;  1U78 A;  1LNW A;  4BQQ A;  2XKO A;  1USS A;  2GQQ A;  1XGN A;  4BJ6 C;  1LJ9 A;  3HPG A;  3H3Z A;  1GLN A;  3CDH A;  3CCR I;  1U9O A;  3H35 A;  2HOS A;  2HXO A;  4DYC A;  1T56 A;  2C6Y A;  4Y13 A;  1GV5 A;  1QZZ A;  4CCM A;  3DBL B;  3S32 A;  2A05 A;  1PVE A;  3CF2 A;  2PX9 A;  2HVR A;  3EYI A;  2JMW A;  2WAQ A;  4MEX F;  3Q9S A;  4PFP A;  1G3Y A;  3SHF A;  5GTI C;  3K70 D;  2K4B A;  2IGN A;  1NG7 A;  2CFO A;  2EIK H;  4CYC A;  1K79 A;  1VQL I;  1ZRF A;  1FIA A;  2HQ5 A;  2PMZ N;  4KIG A;  2HFH A;  2D1V A;  1R22 A;  3CCY A;  3K4J A;  1WJC A;  2B0L A;  1LFB A;  3BC8 A;  4YEL A;  5E8I A;  1S5L C;  3BOQ A;  3F8B A;  2NVY J;  5F0C A;  3QPS A;  3S1M J;  4L9J A;  3H5N A;  3I58 A;  3FX3 A;  4EJW A;  1S72 I;  1FOX A;  2QSG X;  1MMD A;  2B63 J;  4IL6 C;  5KNL A;  2V1X A;  4HAM A;  4RAZ A;  1YOV B;  2H8R A;  2R7X A;  1R1T A;  2OD5 A;  1SFU A;  4IHV A;  1Z6T A;  2B7E A;  5IT9 K;  5L3G A;  2XHK A;  4NQW B;  5M5W J;  1F5T A;  1I3Q J;  4S05 A;  1S8N A;  3DBH B;  1AWC A;  2GXB A;  2MC3 A;  3DTE A;  3LSI A;  1FP2 A;  2IRF G;  2PI0 A;  3DTI A;  5H6Q A;  5BPI A;  1FP1 D;  1T0F C;  3OS0 A;  3RKX A;  4PJL A;  4L0Z B;  4E7S A;  2R93 J;  1MMS A;  3W2A A;  4ZYD A;  2KIF A;  1D5Y A;  4I0A A;  1T39 A;  1ETX A;  1H9G A;  2BXZ A;  2DTZ A;  3GW2 A;  4CYC B;  4ZDL A;  2KLO A;  3BCA A;  1KQ8 A;  1D1C A;  2DT7 B;  4XKV A;  4PGG A;  1H9T A;  2STW A;  3LSH A;  5JFR A;  2QA4 I;  1YTY A;  2P6T A;  3J80 Z;  3AKZ A;  3ERE D;  1TWF J;  4WXH A;  2EZH A;  5M3M J;  2DQR A;  3ZR8 X;  1QBJ A;  5BPD A;  4NC6 A;  1E2X A;  2PMH A;  2E60 A;  3F9K A;  5CJ9 A;  5GAE J;  2Z9O A;  4BHC A;  1ZG1 A;  3AG1 H;  2CW7 A;  2Z3Y A;  4ENJ A;  2VBY A;  3BR1 A;  4XOT A;  2NVX J;  2YUS A;  3ABM H;  4AWX B;  1ZQ3 P;  1F36 A;  1WJB A;  3BG5 A;  1LB2 A;  2VXD A;  1P7I A;  2Y9Y A;  3HRS A;  4UHT A;  5KAF C;  3BTJ A;  2BY0 A;  1IN5 A;  1W7P B;  4M3G A;  4M9Z A;  3TW7 A;  3OOU A;  4RGU A;  4BH9 A;  1LQ1 A;  4IEJ A;  2Y30 A;  4U7B A;  3A1Y A;  1FYK A;  2A5W A;  3G2B A;  1X1C A;  1UB9 A;  2JJ7 A;  3ZQH A;  3L00 A;  3S1R J;  2MFZ A;  3KYL A;  2O03 A;  3LSK A;  3CQZ J;  1DGR M;  3RKQ A;  3H3V K;  2FOW A;  2F5V A;  2LLK A;  2UXX A;  3HSF A;  4ZJZ A;  2V9V A;  5JLW A;  3CCJ I;  4I99 C;  5EG0 A;  2R7V A;  3TQN A;  1T08 B;  1YS6 A;  3OYB A;  2ZC2 A;  3G1L A;  1UG2 A;  3M1E A;  4YEJ A;  2NNY A;  5HNH A;  3IP4 B;  1BR2 A;  2HXI A;  2OQG A;  4XNF A;  3H0D A;  1MMN A;  2K9S A;  3F8C A;  4AU7 A;  1RKW A;  3I0T A;  3K10 A;  3WHC A;  4TV7 A;  3J81 Z;  2W4S A;  2MAB A;  3T8R A;  4YIR X;  3DKX A;  4IKF A;  4XLF A;  5K1Y A;  1Y39 A;  3S1Q J;  2QZ8 A;  3LSM A;  3A03 A;  2KIS A;  4HNV A;  4PJN A;  1WI9 A;  4JOM A;  4RA2 A;  4XOR A;  4E6K G;  2EK5 A;  1X2N A;  2XAS A;  1XTA A;  3R0J A;  4EMS A;  3PJR A;  1HOM A;  4R8H A;  2WAF A;  5EF6 A;  2QM3 A;  1Z7U A;  1BC7 C;  4J00 A;  4F93 B;  1SMT A;  1ZRC A;  5M5X J;  3AL0 C;  4IHW A;  4QWQ A;  2UV1 A;  3ABL H;  4QTR A;  1QVT A;  1KU7 A;  1ERD A;  3ZQG A;  2R5Z A;  1TWC J;  4CZC A;  4Q48 A;  1YIJ I;  3QOE A;  1FTT A;  3KX2 A;  1O4X A;  4BE0 A;  4XLC A;  3VFZ A;  4HNU A;  1KQ0 A;  3U1K A;  1K78 A;  2DA1 A;  4G6D A;  1MBE A;  1WSU A;  2Z99 A;  2ME6 A;  2E2I J;  3ZXS A;  3AAF A;  3V8J A;  2KL4 A;  2ZSH B;  5EG0 B;  1ZRE A;  2HTJ A;  2YS9 A;  3QU6 A;  3HEF A;  5GPA A;  3H3U A;  1XB4 A;  4OMZ A;  4XK4 A;  2HYF A;  2M30 A;  2E2H J;  2RVC A;  3DV8 A;  1Z05 A;  4JX6 A;  2FF4 A;  1DGW Y;  4WX9 A;  2EZK A;  3SFI A;  2ZB9 A;  3LFU A;  5BNG A;  4F55 A;  3ZMT A;  3KP7 A;  3KIO A;  1ULY A;  1TBX A;  3HG9 A;  3P9K A;  2X1E A;  1R7J A;  2V79 A;  5F0H A;  4ZTF A;  1R9T J;  4A12 A;  2DA7 A;  3HL2 A;  1XGO A;  1OCZ H;  3E5U A;  2JPB A;  3I5U A;  5DD8 A;  5L3B A;  3OYG A;  2LY2 A;  3IAM 2;  3CMA I;  1WJD A;  3HYI A;  4IJA A;  1ETV A;  2CUE A;  2PEX A;  3JRI A;  5JVT A;  3N4M A;  4AC0 A;  3BDD A;  4AVP A;  5IOZ A;  4I09 A;  1KON A;  2RC4 A;  2QQ8 A;  5IPA A;  4U87 A;  1O3T A;  2KRF A;  2HQA A;  1WZ2 A;  4CO8 A;  2PFB A;  5CPR B;  5J1R A;  1YX3 A;  4HW0 A;  4YFN F;  3TP0 A;  2QQB A;  2B9S A;  5F1J A;  1K83 J;  2WY8 Q;  3A0H C;  2AXL A;  2OZU A;  3OR1 C;  1VQO I;  2AS5 F;  4GYG A;  3IWF A;  3TO6 A;  1XSV A;  5FKN A;  2QSH X;  3TL4 X;  5GP9 A;  4CYD A;  4IOC F;  2EFP A;  5D5V B;  1D8J A;  4GDF A;  4A3J J;  4B3X A;  1T0F A;  3CMY A;  4E7I A;  1MZB A;  2OC6 A;  4L0Y B;  3LSJ A;  2ZXJ A;  2ZNY A;  3RPQ A;  5FFZ A;  1QRY A;  5BQT A;  2L5Q A;  2ZO4 A;  4Y33 A;  1R6R A;  1LKX A;  2LF7 A;  5J8C A;  4Q5S F;  3GF2 A;  3G73 A;  1WGX A;  1MJ9 A;  2F5C A;  5TIS C;  2ETH A;  3IRQ A;  1HF0 A;  3LNQ A;  4ENM A;  3ZMZ A;  4I2O A;  3E6B A;  3G4S I;  2LRD A;  2F4I A;  1J09 A;  5E1X A;  1FX7 A;  3F22 A;  3DPL C;  3HRT A;  1DPR A;  2DPD A;  2LF8 A;  4LB5 A;  2JA5 J;  3CCQ I;  4DOZ A;  1R23 A;  2PLY A;  3W2V A;  2L4A A;  3S2W A;  2FOK A;  3ZN1 A;  4P9F A;  1BM9 A;  2GBY A;  2OF7 A;  1JTX A;  1Z7L A;  2RQQ A;  3DQV C;  1IV6 A;  3LOC A;  3ASN H;  2QEN A;  3LMM A;  3MEX A;  2X0L A;  2QBY B;  1UCR A;  2MLG A;  2CRG A;  4MFE A;  2JUG A;  1HST A;  5L3D A;  2DDB A;  3HUG A;  1O3Q A;  3PIO F;  3OSG A;  5ICE A;  1A31 A;  5TJJ A;  1ETW A;  1VI0 A;  1TTY A;  2GXA A;  3JR9 A;  5JLX A;  2XGD A;  2EWN A;  2YX4 A;  1KZH A;  4C9Y A;  1O3S A;  4M6X A;  5D6F A;  2IVM A;  4RLQ A;  3G71 I;  2FQ4 A;  2BW3 A;  3IH3 A;  1GVJ A;  5E1Z B;  4LLL A;  1T8I A;  2K9Q A;  2H6C A;  1CQT A;  1WQ2 A;  4WXD A;  2CV1 A;  3BPX A;  1LEA A;  1X1B A;  3CP8 A;  1UFM A;  3H5A A;  3QOD A;  1KGS A;  3RYR A;  4FHT A;  2R5Y A;  2OCC H;  1HW5 A;  2QUF A;  3EET A;  2OBP A;  2E71 A;  1U9N A;  3ZMS A;  1YJ9 I;  1GT0 C;  1WPK A;  1QGP A;  1I1G A;  2XAG A;  4PDK A;  3N97 A;  3WTT C;  3SQN A;  5KAI C;  2ID6 A;  1JKP C;  1S9H A;  1HQC A;  3I64 A;  1TNT A;  2HKX A;  1R1U A;  4N9I A;  4EM1 A;  4KA4 A;  4BQA A;  2DFH A;  3FK7 A;  3BTI A;  1J2X A;  3GFI A;  4V2G A;  3LWF A;  5FJ8 J;  2W00 A;  2UZK A;  3K1P A;  1VQ4 I;  1QU3 A;  3CUO A;  3HUG B;  2EFO A;  2L9R A;  4HV5 A;  4XRF A;  4XQF A;  4I7H A;  2XF6 A;  1S3J A;  5DV5 A;  1ZYR F;  3HKZ N;  2LD5 A;  2QKL B;  3BG9 A;  5J4Y A;  4Y3O A;  2NVT J;  3KPH A;  1XSX A;  2Y2Z A;  3T1B A;  3GFL A;  3HTU A;  1I1S A;  3ZPL A;  2OJE D;  1P4W A;  4KT6 A;  4BXF A;  3IV5 A;  1MJA A;  1O57 A;  2V7F A;  3FBI B;  3FXR A;  2XGC A;  1XDU A;  4GRI A;  2JPC A;  4IXA A;  1U5T C;  1OCO H;  2K85 A;  1D8K A;  3FM5 A;  4HLX A;  3ROU A;  4IRI A;  3S1N J;  4E70 A;  3C2B A;  4NNJ A;  1X3U A;  4LG0 B;  3RCO A;  2XF5 A;  4C3I J;  4UXN A;  5HS8 A;  1S6L A;  4AYB A;  2KDZ A;  2L7K A;  1HBX G;  3BR0 A;  4W1U A;  2D5V A;  5LGU A;  2ADU A;  4AUX A;  4G7H F;  2XVC A;  4IQ4 A;  3Q0W A;  3Q5F A;  1AKH B;  1D5V A;  5AIP A;  1UHM A;  4YRV A;  1W5S A;  1J0R A;  2FU4 A;  1QZY A;  1NK2 P;  2I10 A;  1A6Q A;  2YR2 A;  4DYR A;  5DUI A;  2E1M C;  2R92 J;  1SD6 A;  4IRG A;  2RAE A;  4IHY A;  1IZ1 A;  2Y75 A;  1HC8 A;  1ZAR A;  1MIJ A;  2DJN A;  4U0V A;  5DDG A;  2A61 A;  2CQN A;  3E5Q A;  3ABK H;  2HYJ A;  3ELK A;  3ZQ7 A;  1I50 J;  4ZYH A;  2F5D A;  1X1A A;  3I4M J;  4G7O F;  2VPL A;  2P6S A;  1DP7 P;  5DCF A;  1V3F A;  2ZJP F;  4A3E J;  1P7J A;  2TRT A;  4EGZ A;  1XSD A;  3OYF A;  1DQU A;  4KIS A;  1WH5 A;  1D1B A;  1OIS A;  2MH9 A;  3Q0U A;  4Z6Y A;  2BV6 A;  1U3E M;  1FSH A;  4ZTJ A;  2KIM A;  3H92 A;  1X1P A;  3W3C A;  3OYN A;  2M0M A;  3KEQ A;  3FMR A;  3FMS A;  4OIO F;  3HGG A;  3BZ6 A;  4XSZ F;  1YX5 A;  2HKO A;  3QRF F;  1IUF A;  2Z5U A;  3QYF A;  4I98 B;  5CVR A;  2BE5 F;  2LBF A;  1OCC H;  2UUZ A;  5EZH A;  3NRV A;  4HX8 A;  4RAF A;  2WB1 A;  1ON1 A;  2V1U A;  1J9I A;  3AG4 H;  1XG1 A;  2EFQ A;  3CTA A;  2CJJ A;  2Z2S B;  3LSR A;  1T98 A;  4CHU A;  2COB A;  1PYV A;  2DA3 A;  2O8K A;  5HOO A;  3F23 A;  2TDX A;  2XB0 X;  2FML A;  4LK1 F;  2L54 A;  2JWT A;  4C2M J;  4AIJ A;  5ICG A;  3ZRG A;  3K4B A;  1LDJ A;  2W7N A;  2F48 A;  3EDP A;  3OYA A;  4HQE A;  3S3O A;  1MBH A;  3LA2 A;  5CQG A;  1YQA A;  4MTD A;  1XGM A;  3JTH A;  3HSE A;  3L2R A;  1JJ6 C;  4L9T A;  4V19 K;  1PUF A;  2W24 A;  3OWT A;  3S93 A;  4BY1 J;  1HCR A;  2DA2 A;  5JHU A;  4KN4 X;  2IS4 A;  4RM2 A;  1UHW A;  4XON A;  1Y8Q B;  2KDO A;  1VQ7 I;  4D9J A;  4HDU A;  2WAE A;  1R4N B;  5F27 A;  2VE8 A;  2LBF B;  3WTY C;  4LGW A;  4A3D J;  1YHQ I;  3O2P E;  4LG3 A;  4FET A;  3HOX J;  1FY7 A;  2FBI A;  2LVS A;  1DPU A;  2Y9Z A;  1HKQ A;  2H94 A;  4F7Z A;  2Z16 A;  4E7K A;  2MSY A;  3WU0 A;  4BXU A;  5AON A;  2Q8K A;  1FWZ A;  4KIF A;  4PGH A;  1F1Z A;  1VQ9 I;  1QPM A;  1SVL A;  1K6O A;  6PAX A;  3BR2 A;  2HS5 A;  4OAZ A;  2DN0 A;  4PZJ A;  3WGH A;  3FHN A;  1JKO C;  3H9G A;  2O3F A;  1POG A;  2EB7 A;  3PM1 A;  2HZD A;  4HYE A;  4O5V A;  1RRJ A;  2IAI A;  1JI8 A;  3RZO J;  5FRM A;  4LD5 A;  2BY1 A;  2R7D A;  3KCC A;  4RGS A;  3CCS I;  4KT5 C;  2MD5 A;  1ZLK A;  3JAM Z;  5E3L A;  1MD0 A;  2HOE A;  1YW9 A;  4XRS A;  1YRN A;  2DBB A;  5E3O A;  1LFP A;  3HOS A;  1WWX A;  1EH8 A;  4KYW A;  5D4R A;  2Y48 A;  3AFH A;  3MKY B;  1UMQ A;  4DNC A;  5B3S H;  3E97 A;  2JSP A;  3OYJ A;  3PL8 A;  3JRG A;  2OU2 A;  2RQP A;  1VTN C;  4BJ5 C;  3L2U A;  3LQQ A;  4D0P A;  4QPO A;  2OUM A;  4OAY A;  3KZI C;  5KCM A;  2XSD C;  2VKE A;  3CCM I;  1U5T A;  2A5Y B;  3QP6 A;  2FX0 A;  4NC8 A;  1GXP A;  2V1D A;  1CGP A;  2AXT C;  1ENH A;  2DQL A;  5CVV A;  4J01 A;  1P6R A;  2CWE A;  1K6Y A;  3CDI A;  3RPU A;  3QU3 A;  4XID A;  4BAC A;  2VQG A;  2P81 A;  2IA1 A;  3IC7 A;  1ETK A;  3CCU I;  3CJN A;  3DP7 A;  2CH0 A;  2DJI A;  4HX4 A;  1U6G A;  1FBQ A;  2CYY A;  1T95 A;  3K70 C;  5FKL A;  1FOK A;  1D0Z A;  4M6V A;  5J40 A;  1PP7 U;  4J19 A;  3TOA A;  1YRN B;  4YII A;  4HEA 2;  1YYV A;  1YFH A;  2VE9 A;  2J5O A;  2H8W A;  4DZP A;  2RV8 A;  1SD7 A;  3U21 A;  4EJT A;  2CO5 A;  1MBF A;  4FIS A;  2JA2 A;  1K61 A;  2MGQ A;  3WTZ A;  2K3P A;  2V1N A;  2V26 A;  3WOD F;  2L4M A;  2EZI A;  3TP3 A;  2ZCW A;  3RDI A;  1FNN A;  4DW6 A;  2HTS A;  2COM A;  3DKY A;  4KUM A;  5ICC A;  3HHG A;  1YS7 A;  3HGY A;  1U5T B;  1Y8R B;  3HB9 A;  4EGY A;  2EIN H;  3EUK L;  4A3F J;  2KIQ A;  2W85 A;  2BY3 A;  1XS9 A;  1TQI A;  1LEB A;  1YW7 A;  3LFK A;  1V4R A;  1Z91 A;  1MW7 A;  3FIS A;  3K4N A;  1UZC A;  3OYI A;  2VOO A;  2EPF A;  2L7Z A;  3E6D A;  4KDP A;  1Z3Y A;  4S04 A;  4A0Y A;  3H0G J;  4M3E A;  2XB5 A;  2EFN A;  3OYE A;  1JUM A;  1E3O C;  2LDU A;  2DOA A;  1RIO H;  3TKY A;  1SVO A;  3DU5 A;  3SZG A;  4FX0 A;  4E7Z A;  2NS8 A;  3F0C A;  2JVH A;  5DM6 F;  1WKM A;  1D3Y A;  1W0U A;  5EEA A;  1AA7 A;  2W48 A;  2KRH A;  2OV7 A;  2X9D A;  3WE3 A;  4IZZ A;  4HV6 A;  2P7V B;  1VQK I;  5CVI A;  1FMV A;  2QF7 A;  3QPH A;  1E17 A;  4A3K J;  1BIA A;  2KP6 A;  1SFE A;  1O7F A;  3QOP A;  1ON2 A;  2JVG A;  2Y0S A;  4GGG A;  5HLG A;  1MMA A;  3BR3 A;  3LA7 A;  3GTJ J;  1OMI A;  4UUS A;  1C0W A;  2VON A;  2WAQ N;  2NVQ J;  5B1A H;  3CLQ A;  1ETQ A;  3FXQ A;  4M9S A;  3I55 I;  5IT9 Z;  2M45 A;  3BJA A;  2RNG A;  3TO9 A;  1BI3 A;  4HF2 A;  4G7Z F;  4A6E A;  2VXZ A;  2KZG A;  3NQO A;  4N4O B;  3KLN A;  4YFK F;  2RRE A;  3MN2 A;  4F3Q A;  5EEH A;  2VB6 A;  3KP6 A;  1NG6 A;  3DF8 A;  4JQF A;  5J6X A;  4BE1 A;  3C18 A;  3GTM J;  2HVQ A;  2M5W A;  3S2H J;  3FXU A;  4MO7 A;  5B66 C;  2V6C A;  3OOP A;  3M8F A;  3M07 A;  2GAU A;  2DAO A;  2KKO A;  1Q1V A;  3BRO A;  2XGX A;  5H20 A;  2JK3 A;  2CQK A;  2D2W A;  4XSX F;  3T0Y A;  2NOG A;  5EEG A;  4YFX F;  2GLO A;  1WRJ A;  2M0C A;  2M87 A;  3NWT A;  4UUS B;  4A93 J;  4DGW B;  1V55 H;  3B6C A;  3SEQ A;  5M3F J;  1Z3X A;  3VWB A;  1WJA A;  3CO6 C;  4ZDO A;  3GBG A;  2IGO A;  2Q2E A;  1SEU A;  2ELJ A;  1E3H A;  3K2Z A;  2MC4 A;  2JA6 J;  2E5Z A;  3EUA A;  3RSN A;  2ZJR F;  4B47 A;  1LDD A;  4ZH4 F;  3ZCO A;  1JKQ C;  1UAA A;  4XLA A;  1FT9 A;  3JRB A;  4PCQ A;  2STT A;  3K1M A;  1B72 A;  1BIB A;  4JYK A;  1FPQ A;  3BTL A;  4DJA A;  5IYB J;  1JE8 A;  2M4K A;  1Y0U A;  3V42 A;  3OL3 A;  3A01 A;  1NK3 P;  2R3S A;  4FTH A;  3NAU A;  3FKI J;  3GME A;  4HNT A;  4HZF A;  1SFK A;  2CSO A;  1QA6 A;  2PJP A;  3VDX A;  2A6T A;  4GYI A;  1QZE A;  3G6E I;  3GTO J;  2CU7 A;  4LB6 B;  2QSF X;  3HOT A;  3ABU A;  3R0A A;  1RPW A;  2F2E A;  4XR6 A;  2FE3 A;  2O8X A;  4LIV A;  3JRE A;  3FXM A;  9ANT A;  3P5J A;  2W1O A;  2XRL A;  2KHM A;  2XPW A;  3QAH A;  3KE2 A;  4U0W A;  2LG4 A;  2ZME C;  1BW5 A;  3FXL A;  4IQJ A;  2F4M B;  3SJM A;  3K7A J;  3RJP A;  1XD7 A;  4XKB A;  4AIK A;  1WH7 A;  2BOL A;  5HDK A;  1BOA A;  2DOE A;  4KN7 X;  3E5X A;  5DYM A;  4CCO A;  5DUK A;  3JRD A;  3ZMU A;  3D0S A;  4H4K C;  1MKM A;  1WI3 A;  1TW3 A;  1HKS A;  4L5I A;  3RQI A;  1AHD P;  5E17 F;  1GHC A;  2GWR A;  3WTU C;  4KFC A;  5FLX K;  1SMY F;  1S7E A;  1EH6 A;  4II2 A;  3B02 A;  2CW0 F;  4ZYA A;  3KP4 A;  3A01 B;  5M5Y J;  2EV6 A;  4V2F A;  2IEK A;  2O6G E;  1W36 D;  1BR4 A;  1BC8 C;  1UST A;  2D45 A;  4UV8 A;  3DWL E;  3BZK A;  1LVK A;  1B8I A;  1BL0 A;  3A0B C;  4UVC A;  4EVI A;  2R5Z B;  1FEX A;  3RYP A;  3WTW C;  3IHU A;  4ZZD A;  4ITV A;  1MBG A;  2ESH A;  2BGC A;  3LST A;  4NUB A;  3HXL A;  3JSP A;  2GIV A;  5FD6 A;  2OTJ I;  1K78 B;  1R4M B;  1JXS A;  4WF2 A;  2IGM A;  1Z1D A;  3C2G A;  4RB2 C;  4KIC A;  2H1K A;  3O8H A;  3KLO A;  1GUU A;  1Z67 A;  3V4G A;  4UVA A;  1TLH B;  2LK2 A;  2X6Y A;  5C4X J;  1IF1 A;  1ONV A;  4G9Y A;  2E36 A;  2LTP A;  2JQ7 A;  3RKW A;  4C2T A;  2DA4 A;  1R71 A;  4W97 A;  3GZ6 A;  2DK8 A;  2ACJ A;  3U1D A;  1HXD A;  1QNT A;  3FDY A;  1MND A;  5D5U B;  5FLM J;  4JBA A;  3O6B B;  4XM3 A;  2L0K A;  4XKC A;  4XL9 A;  2K27 A;  5C3E J;  2RKH A;  1K4T A;  2JTV A;  3GX4 X;  1MGT A;  2WA0 A;  2MW8 A;  1KU3 A;  1YJN I;  1LFU P;  3TW6 A;  4YG2 F;  4A3M J;  3PNV A;  4IRH A;  2BY2 A;  2VKV A;  1DDN A;  3WTV C;  3V7C A;  5BOX A;  3L09 A;  1IRF A;  4Y4R A;  2IA0 A;  5JI6 A;  3BT9 A;  5IYD J;  2O0Y A;  4H0E A;  1I5Z A;  1STZ A;  3ZMD A;  3CC4 I;  5EGO A;  3RTR A;  4BGD A;  2QVO A;  4Y17 A;  2X85 A;  2IP2 A;  3I4P A;  3HSR A;  4U7D A;  2K4J A;  3JCU C;  4B1R A;  5K5O A;  1ZG5 A;  3K9T A;  3QPL A;  2CV2 A;  2ELH A;  2IXS A;  1UEL B;  5D5X B;  2KZV A;  3G3Z A;  2R7W A;  1B9N A;  2VN2 A;  2JZY A;  3B73 A;  4FE7 A;  4C30 A;  4XLP F;  1R5G A;  3CP2 A;  4QLC U;  2QGU A;  2IT0 A;  5J1Y A;  1IRG A;  3OYM A;  2FUG 2;  3GWZ A;  4FE4 A;  1TP4 A;  3V8K A;  3DU6 A;  2HQN A;  4OIR F;  5HOD A;  2BZT A;  5EJC A;  2JN6 A;  3JRA A;  2K9M A;  2PMU A;  2E34 A;  2WAD A;  3JRC A;  4OWR B;  3N05 A;  2KJC A;  4LJZ F;  2L02 A;  4RGR A;  1BR1 A;  3I59 A;  2HPI A;  4II3 A;  3GZ5 A;  4RM3 A;  3PIP F;  2CS3 A;  1VQ8 I;  1IN4 A;  2M7A A;  1EA3 A;  2QWW A;  3R60 A;  3V8L A;  1EH7 A;  5ICF A;  2YSR A;  3Q3S A;  3NWS A;  4P96 A;  3TDZ C;  4HRI A;  4X0G A;  2JRM A;  5EGO B;  1KU9 A;  4MHG A;  3TOB A;  3MZ8 A;  1GDT A;  2W84 A;  2ID3 A;  3CUQ C;  2NYX A;  2BXY A;  4AD9 A;  1TZL A;  2WV1 A;  4UY8 I;  3ZP5 A;  1T2K A;  4XKW A;  5L3F A;  1E3P A;  5GAH J;  3D5S C;  4ZYE A;  4B43 A;  3OMY A;  1RR7 A;  2L9V A;  1CF7 A;  1OCR H;  3CJT B;  4DBQ A;  1J5Y A;  2ISY A;  5ERI A;  3MD2 A;  3DEU A;  4RLF A;  5FO5 A;  1G3W A;  5GAD J;  2BW3 B;  2H1L A;  1HDD C;  4CGZ A;  1ZH5 A;  5LGT A;  1IXC A;  2E1N A;  2M7B A;  3BY6 A;  1TC3 C;  3I59 B;  2LY9 A;  2Z33 A;  2LY1 A;  2CUZ A;  2H6B A;  2I5U A;  5DD4 A;  1IV8 A;  3H9Q A;  2HDD A;  2ZME A;  2R5Y B;  1FLI A;  1OYY A;  1Y1V J;  1ZK8 A;  2LC2 A;  3BR6 A;  1IN7 A;  2FNP A;  2GOM A;  1JHF A;  1X2M A;  3UR3 C;  1RR8 C;  3MAJ A;  2FXA A;  3QYE A;  3R6S A;  2JA7 J;  5A2Q K;  2BYV E;  5LLQ A;  3BP8 A;  4BE2 A;  4G6Q A;  3SZT A;  1JHH A;  1OCP A;  4HBL A;  4LFU A;  2MBF A;  3GEZ A;  3RZD J;  1ACI A;  2PBI A;  1GXQ A;  1G2H A;  2OTL I;  3TO7 A;  2F4O B;  1HSJ A;  4RS8 A;  2XAH A;  2CW8 A;  5HLI A;  1RES A;  1JGS A;  5F1R A;  1D0X A;  1TW2 A;  1CF7 B;  2M3A A;  3K4L A;  4UB8 C;  3I9V 2;  4BNC A;  1MBK A;  4MFD A;  2LYC A;  4CDG A;  3AL0 B;  1ZAO A;  2KMU A;  4UV9 A;  3WG7 H;  3P9I A;  3BTC A;  4U88 A;  4BU2 A;  1JT6 A;  1TQP A;  1Y1W J;  4N4N B;  4Z2Y A;  2M4G A;  3MFK A;  1OLT A;  5DM7 F;  5FGM A;  1J59 A;  3VPR A;  3J7Y J;  3OL4 A;  5FB2 A;  4L18 B;  3PSF A;  1WVR A;  2ZME B;  2KT0 A;  2OA4 A;  3ZQQ A;  1IDZ A;  1R49 A;  4HST A;  1XGS A;  4I01 A;  2VIX A;  4XLH A;  2P8T A;  5CYV A;  1WJ5 A;  4MEY F;  3ECH A;  2XAQ A;  1A35 A;  3FM3 A;  1JUS A;  2XRN A;  5B5E C;  2RGV A;  3LL7 A;  3EYY A;  4M3D A;  1D1A A;  1U2W A;  3ZN0 A;  3ULQ B;  4U0Y A;  4BDZ A;  2XPV A;  5EDN A;  4A3G J;  3DTK A;  1FIP A;  4CH7 A;  1OYW A;  2DFI A;  4M3F A;  3JSO A;  3L2V A;  4EM0 B;  5F6F A;  5KK1 A;  3M8E A;  2DMQ A;  4P9U A;  1SD5 A;  5LHI A;  4XRM A;  2ME0 A;  4ENN A;  4NC7 A;  2EIL H;  1IW7 F;  4A2U A;  1P92 A;  2DK5 A;  1IXR C;  2P4W A;  2MLK A;  1FSE A;  3E3V A;  3S3N A;  3DLL F;  3PFY A;  3CF5 F;  2PQ8 A;  1TL8 A;  4JX4 A;  3BCB A;  4AIH A;  1VFC A;  1W4M A;  2OZ6 A;  1LVA A;  5LRR A;  1FBS A;  1YIO A;  4RMN A;  4AYB N;  4E7H A;  1G59 A;  1IAW A;  3HC7 A;  3HOU J;  1ZKG A;  3WU1 B;  3C2H A;  4IX7 A;  2OQR A;  4LIU A;  4IHT A;  2O7O A;  3DXJ F;  4FCY A;  2DOF A;  2XKP A;  2IA2 A;  1V5F A;  4E7L A;  2J5P A;  4EJO A;  4M6Y A;  4IPA A;  3KEY A;  3WU2 C;  5FRO A;  3BZC A;  2VLA A;  3S15 J;  5LBQ A;  4WWC A;  1I27 A;  3CO7 C;  3FK6 A;  3HZJ A;  3CJQ B;  1DP3 A;  3ESW B;  2FBH A;  1NTC A;  3IKT A;  1Z0X A;  2X6O A;  3OIP A;  3UNG C;  4OIQ F;  3I56 I;  1X1D A;  3EPZ A;  3I71 A;  1MDM A;  1MH3 A;  5ILS A;  4KNY A;  1NHA A;  2R7F A;  2DPU A;  4A0X A;  1BI0 A;  5HNF A;  1AOY A;  3PQK A;  4M73 A;  1F4K A;  3DEW A;  4ESF A;  3Q0V A;  1R36 A;  1W7P D;  2QYO A;  2VJ4 A;  2K3F A;  5ILU A;  4CIC A;  3OIO A;  3K4C A;  3M3Y J;  2IS2 A;  3AG2 H;  1P9Q C;  4BL0 B;  1ZGJ A;  1SAU A;  4BEH A;  2L9N A;  2WV0 A;  3KZY A;  3Q9V A;  4I02 A;  2HDW A;  4C3J J;  5FRN A;  1BBY A;  1FBU A;  4RAY A;  3EUH C;  3BG3 A;  3M1C A;  3LAJ A;  3PSI A;  5E79 C;  3KET A;  2HGC A;  3CES A;  2FNA A;  3OYD A;  2ZBK A;  4XOP A;  1I6H J;  3CUQ A;  3VSK A;  2XAU A;  3T8T A;  4ZZL A;  2HYG D;  3GLL A;  1K7A A;  1RNL A;  4E4H A;  1VZ0 A;  3F6V A;  1LPQ A;  1D0Y A;  1QQI A;  5HLH A;  2WB1 N;  1BOB A;  2XIG A;  2FEZ A;  3KEO A;  3K4M A;  5HS9 A;  1F43 A;  3H1C A;  3OYC A;  1MDM B;  2X6X A;  5CKT A;  4BY7 J;  3MVP A;  2BHZ A;  1PUF B;  1R5I D;  1B1B A;  2IJL A;  4GCV A;  4F91 B;  3IWZ A;  1DU0 A;  2PJR A;  1XPX A;  1B4A A;  1BI2 A;  4I6Z A;  5F0F A;  3GUD A;  4BQN A;  1ZTR A;  2YPR A;  2ZJ2 A;  2P7C B;  1QVU A;  1G3T A;  3FKJ A;  4X6A J;  2E19 A;  1X58 A;  3IUO A;  2PMZ A;  3MQ0 A;  3VOE A;  1I39 A;  4ESJ A;  1KYZ A;  2Q0O A;  5EZG A;  2M34 A;  1SFO J;  3ZQF A;  5CVU A;  1U8B A;  4M72 A;  3RQ4 A;  2NRA C;  3IAS 2;  2K86 A;  5HLT A;  4UB6 C;  1LDK B;  2KQR A;  2I8D A;  4ON0 A;  3T5X A;  1OPC A;  3CUQ B;  5IP7 J;  1RET A;  2DA5 A;  1Z9C A;  1E0E A;  4PJJ A;  2DMT A;  1XN7 A;  3JW4 A;  2VT3 A;  3BJO A;  4MGR A;  3PNY A;  5K5R A;  3KP3 A;  4NDL A;  1G4D A;  2DMP A;  3WE2 A;  1ZN2 A;  1EF4 A;  1KQ9 A;  5DTD A;  5IY5 H;  1IN8 A;  4Y52 J;  1F9N A;  2G0E A;  4L9N A;  1FYL A;  4CXF A;  2ZKZ A;  3PO3 J;  2EIJ H;  3S14 J;  2G9W A;  1REP C;  4GFB A;  2DFF A;  2NVU B;  2XAF A;  2PJR B;  1H0M A;  3DLA A; 
#chains in the Genus database with same CATH homology
 4ZC3 A;  4CCL A;  4CUG A;  4C9Y A;  4HNT A;  1SFK A;  4RLQ A;  3VDX A;  4F92 B;  4DIQ A;  2A6T A;  2BW3 A;  4XN3 A;  3HOT A;  1WJE A;  4XR6 A;  2CV1 A;  1X1B A;  3CP8 A;  3H5A A;  1FMW A;  2AQF A;  3QOD A;  4P1W A;  4LIV A;  4BDY A;  2LRE A;  2L9S A;  2W1O A;  2ZSI B;  3S3M A;  2KHM A;  2LG4 A;  2VL8 A;  4IQJ A;  3TMO A;  4XKB A;  2BOL A;  4BQO A;  1S9H A;  2R7Q A;  2BVL A;  4CCO A;  1QHG A;  1V5G A;  2E5N A;  3MMY B;  4H4K C;  2Z1D A;  4P5O A;  3QYB A;  2QKM B;  2W00 A;  4AVZ A;  1WFX A;  1QU3 A;  5LFA A;  2VKH A;  3ONQ A;  4II2 A;  2E1M B;  3HUG B;  3VYU B;  4ZYA A;  4XQF A;  2XF6 A;  2IGK A;  1W36 D;  2QKL B;  1BR4 A;  3D5L A;  4Y3O A;  2HNH A;  4XLE A;  5TGT A;  3DWL E;  1LVK A;  2IS1 A;  4PK4 A;  2K5C A;  4ITV A;  3OY9 A;  4KT6 A;  4NUB A;  4BXF A;  3HXL A;  2V7F A;  3FBI B;  3BLY A;  1QHH D;  3H5R A;  2KRC A;  4GRI A;  4LIT A;  2IGM A;  3C2G A;  1Y6I A;  4CCK A;  3I3L A;  2LH9 A;  2R7R A;  4NNJ A;  2X6Y A;  4HSR A;  3RCO A;  4CA0 A;  2XF5 A;  3OIQ A;  1PJR A;  4C2T A;  2R7U A;  4XMY A;  5HVQ C;  1Z21 A;  3SEZ A;  4AYB A;  2L7K A;  4PUS A;  2X1D A;  4FAS D;  3BG6 A;  2HVS A;  3FDY A;  4BEH B;  1MND A;  3OYH A;  5CQE A;  3OYK A;  4IQ4 A;  2CUJ A;  4XM3 A;  3E0J B;  4XKC A;  4YRV A;  4PJM A;  4XL9 A;  4PSW A;  2XC7 A;  2WA0 A;  1N77 A;  3FBN B;  3BG7 A;  2X6W A;  2VQC A;  2V9K A;  3PNV A;  2E1M C;  2L2O A;  4Y4R A;  2Q1Z B;  4DBR A;  3DEE A;  4CCN A;  2VKD A;  3RTR A;  4BGD A;  4C2U A;  2X85 A;  3LSG A;  2WBM A;  2X1C A;  3M8J A;  1U0J A;  2CV2 A;  1X1A A;  2R4G A;  2V6E A;  2IXS A;  2ZXH A;  3K4K A;  1UEL B;  2VPL A;  4D1Q A;  2KZV A;  2R7W A;  4C30 A;  3CP2 A;  4MLO A;  4CCJ A;  2DT6 A;  3H9J A;  3OYF A;  2GOX B;  1DQU A;  4KIS A;  3OYM A;  2FUG 2;  2V4J C;  1D1B A;  2P0W A;  3DU6 A;  2WY7 Q;  4ZTJ A;  3W3C A;  3OYN A;  2M0M A;  4BQQ A;  4BJ6 C;  2K9M A;  3HPG A;  1GLN A;  2WAD A;  1YX5 A;  3H35 A;  4OWR B;  3N05 A;  1BR1 A;  3QYF A;  2HPI A;  4II3 A;  4RM3 A;  2CS3 A;  4CCM A;  3S32 A;  1OR7 C;  2LBF A;  3CF2 A;  2HVR A;  2M7A A;  1EA3 A;  1ZEL A;  2CMP A;  2UUZ A;  3VYS B;  2WAQ A;  2VQL A;  4PFP A;  3K70 D;  2VJ5 A;  2CV0 A;  1TT0 A;  2IGN A;  1NG7 A;  2CFO A;  2HPM A;  3NWS A;  2WB1 A;  3OS1 A;  3PNT A;  4HRI A;  4X0G A;  3K4J A;  2Q2E B;  1WJC A;  3OS2 A;  3BC8 A;  4YEL A;  2Z2S B;  3VYR B;  1PYV A;  1W36 C;  1TZL A;  5HOO A;  3H5N A;  2KPM A;  4XKW A;  3ZRG A;  3D5S C;  2ZFU A;  4B43 A;  1MMD A;  3K4B A;  1X4P A;  3OMY A;  2W7N A;  2MYS A;  5KNL A;  2X51 A;  4HG2 A;  3OYA A;  4DBQ A;  3S3O A;  4PFO A;  1X4O A;  3MD2 A;  2R7X A;  5CQG A;  4RLF A;  3L2R A;  2DCE A;  4NQW B;  3OWT A;  3S93 A;  2R7O A;  2BW3 B;  2IS4 A;  4RM2 A;  3DTE A;  3LSI A;  2VQH A;  4XON A;  4BUP A;  2M7B A;  3DTI A;  2R7S A;  2KDO A;  3L2Q A;  1T0F C;  4D9J A;  2LY1 A;  2CUZ A;  2WAE A;  2LBF B;  4PJL A;  3OS0 A;  3H9Q A;  4E7S A;  4BJT A;  4LG3 A;  4FET A;  3S8P A;  2LC2 A;  3W2A A;  2GOM A;  2Z16 A;  4E7K A;  3UR3 C;  3QYE A;  3DPU A;  4ZDL A;  2KLO A;  3BCA A;  1D1C A;  2DT7 B;  4XKV A;  3LSH A;  4BE2 A;  4OAZ A;  3FHN A;  3AKZ A;  3D5R C;  3H9G A;  2HZD A;  1IRX A;  3CMM A;  3ZR8 X;  2CW8 A;  4E7J A;  1JI8 A;  1D0X A;  2F6C A;  2E60 A;  3F9K A;  5FRM A;  2M3A A;  3K4L A;  3I9V 2;  3W2W A;  3K6G A;  2CW7 A;  2LYC A;  4QPQ A;  4B44 A;  2R7T A;  3AL0 B;  1LFP A;  2KMU A;  4XOT A;  1X19 A;  3HOS A;  3SYT A;  1WJB A;  1UG0 A;  4BU2 A;  4N4N B;  3AFH A;  3MKY B;  2VXD A;  2M4G A;  3A2K A;  1OLT A;  2JSP A;  3OYJ A;  3PL8 A;  3OL4 A;  3VYT B;  3TBI A;  4BJ5 C;  3L2U A;  3OOU A;  4QPO A;  3PSF A;  2OUM A;  4OAY A;  4XN0 A;  5KCM A;  3ZQQ A;  4U7B A;  3A1Y A;  2A5W A;  2K9L A;  1X1C A;  3G2B A;  4HST A;  4NC8 A;  4B48 A;  2VIX A;  4XLH A;  1WJ5 A;  4J01 A;  1MMG A;  2MFZ A;  3SDB A;  1K6Y A;  3KYL A;  2O5R A;  3LSK A;  2VAS A;  1DGR M;  3LL7 A;  2F5V A;  1D1A A;  4BAC A;  2VQG A;  4ZJZ A;  2HU9 A;  4BDZ A;  3DTK A;  2R7V A;  2VJJ A;  4CH7 A;  2CH0 A;  3L2V A;  2DJI A;  3OYB A;  1T95 A;  4YEJ A;  3HPH A;  3K70 C;  1N78 A;  5LD2 C;  5HNH A;  3HKZ A;  3IP4 B;  1BR2 A;  4XNF A;  4NC7 A;  1D0Z A;  3H0D A;  1MMN A;  3VSL A;  4AU7 A;  1V5E A;  4ZDP A;  3K10 A;  3S3N A;  4HEA 2;  3PFY A;  2W4S A;  2MAB A;  4IKF A;  3DKX A;  4XLF A;  3BCB A;  3LSM A;  3U21 A;  4PJN A;  4JOM A;  4RMN A;  2JA2 A;  4XOR A;  4E7H A;  4E6K G;  3HC7 A;  1G59 A;  3ZGK A;  2K3P A;  3PJR A;  2V1N A;  2V26 A;  3C2H A;  4IX7 A;  4EAT A;  2WAF A;  4CSW A;  4J00 A;  4F93 B;  4LIU A;  3DKY A;  3OYL A;  3AL0 C;  2UV1 A;  1ERD A;  4CZC A;  1V5F A;  3EUK L;  4E7L A;  3QOE A;  2IS6 A;  4R79 A;  1G8X A;  3KEY A;  3PUB A;  3KX2 A;  3OR2 C;  5FRO A;  3J7A Y;  2VLA A;  4BE0 A;  1MW7 A;  4XLC A;  3K4N A;  1Y56 A;  4HNU A;  3MKW B;  3OYI A;  3CJQ B;  3ZXS A;  1DP3 A;  2KL4 A;  3A4C A;  1Z3Y A;  2MD0 A;  3OIP A;  2ZSH B;  3UNG C;  1X1D A;  3EPZ A;  3OYE A;  5HNF A;  2DOA A;  1YE9 A;  3DU5 A;  3SZG A;  2VJ4 A;  4F52 A;  4E7Z A;  1DGW Y;  2UWM A;  3K4C A;  2JVH A;  3LFU A;  2IS2 A;  4F55 A;  1P9Q C;  4BL0 B;  1SAU A;  4BEH A;  2L9N A;  1AA7 A;  2HDW A;  3HG9 A;  5FRN A;  2X1E A;  4ZTF A;  1MNE A;  2KRH A;  2OV7 A;  3EUH C;  4IZZ A;  3HL2 A;  3M1C A;  3CJR B;  3PSI A;  2XSJ C;  3OYG A;  1FMV A;  2LY2 A;  3IAM 2;  1WJD A;  2KP6 A;  3CES A;  3OYD A;  2JVG A;  4XOP A;  2Y0S A;  1MMA A;  3VSK A;  2XAU A;  1KON A;  3CZ6 A;  4KJZ A;  4U87 A;  2HQA A;  4E4H A;  5CPR B;  1VZ0 A;  1YX3 A;  1D0Y A;  2RNG A;  2ZXI A;  1HA8 A;  1BOB A;  3K4M A;  1WJF A;  2WY8 Q;  3MKZ A;  3OYC A;  2VXZ A;  2X6X A;  5CKT A;  3OR1 C;  2AQE A;  4N4O B;  2DXI A;  3TL4 X;  2RRE A;  5KHD A;  4F91 B;  4F3Q A;  2PJR A;  2VB6 A;  4B3X A;  4BS9 A;  2XDV A;  2VJI A;  1NG6 A;  4E7I A;  4ANJ A;  4BQN A;  4JQF A;  4BE1 A;  2OC6 A;  2HVQ A;  3E1S A;  3FKJ A;  2L5Q A;  2NOJ B;  4Y33 A;  3IUO A;  1R6R A;  1LKX A;  2PMZ A;  3RPU D;  3RQ4 A;  3IAS 2;  4PSX A;  5HLT A;  1LDK B;  2KQR A;  2I8D A;  2F4I A;  1J09 A;  2LRD A;  2LOO A;  3DPL C;  1E0E A;  3NWT A;  4G6T B;  2XF7 A;  4PJJ A;  3DPT A;  4DGW B;  2BVM A;  3SEQ A;  1Z3X A;  3VWB A;  1WJA A;  4DOZ A;  3PNY A;  4HPQ A;  4ZDO A;  3GBG A;  2IGO A;  3W2V A;  2ELJ A;  2MC4 A;  2E5Z A;  3EUA A;  3RSN A;  4B47 A;  3DQV C;  1Z7L A;  2RQQ A;  3ZCO A;  1UAA A;  4XLA A;  3LMM A;  4KIT B;  3L2W A;  5JHF A;  2JUG A;  4DJA A;  2PJR B;  1N75 A;  2M4K A;  3V42 A;  3OL3 A;  2W82 A;  3DLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...