4HRIA

Crystal structure of hetr in complex with a 21-bp palindromic dna at the upstream of the hetp promoter from anabaena
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
295
structure length
272
Chain Sequence
DIDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKIIVEEVRQALMEGKLLKTLGSQEPRYLIQFPYVWMEQYPSEEKRQIEHKLPSNLPDAQLVTSFEFLELIEFLHKRSQEDLPPEHRMELSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYERTYIMVEDTARYFRMMKDWAEKRPNAMRALEELDVPPERWDEAMQELDEIIRTWADKYHQVPMILQMVFGRKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heterocyst differentiation control protein
publication title Structural and biochemical analyses of Anabaena HetR reveal insights into its binding to DNA targets and the inhibitory hexapeptide ERGSGR
rcsb
source organism Nostoc
molecule tags Transcription/dna
total genus 64
structure length 272
sequence length 295
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hriA03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4hriA02
4J00A 3QOEA 3QODA 4HRIA 4J01A 4IZZA 4YRVA
chains in the Genus database with same CATH superfamily
2Z3YA 4YIRX 1HW1A 2ZXWH 2K5CA 3L09A 3BR2A 3F8MA 2ZJQF 1R4MB 1XD7A 1RPWA 4IRIA 3JCUC 4A2UA 2VLAA 2L7ZA 3HKZA 4G12A 2I5UA 2HS5A 3ZN1A 4EMSA 4A6EA 2ISZA 4FISA 1O57A 5KVRA 1APLC 3GO5A 5GPCA 1BN5A 2DCEA 2VXZA 4XN3A 3RTRA 1LPQA 3T0YA 2IEKA 3TMOA 2V9VA 1QO0D 3CF2A 3FXQA 1VQKI 1ZRDA 4Z6YA 3GTLJ 5GTHC 5J1UA 3FHZA 2QA4I 4OMZA 1OMIA 4ZTJA 2OQGA 2PI0A 4UUVA 1Z0XA 2VE9A 5J8CA 2XUBA 2HPMA 1NH3A 3NQOA 1R1TA 1KU3A 3CUQA 2O8XA 1YOVB 2RAEA 2NOGA 5DV5A 4N0BA 4ENJA 1ZELA 2DODA 1L0OC 3CD6I 4RGUA 5E1WA 4A3CJ 2A05A 4ZYAA 4KMFA 5TRDA 2IGNA 1IXRC 1TNSA 4A3DJ 1LUJB 5LD2C 2MC4A 3GBGA 2R7SA 1FP1D 1NTCA 1TLHB 2BYVE 2ZSIB 3JAMZ 1QPIA 2IJLA 1AKHA 1MMSA 3OYGA 1VQ8I 2QQ8A 1Z91A 2M30A 3WE2A 2K9LA 4YIFA 1SFUA 4E70A 4D1QA 2D2WA 2DYSH 1G6NA 4XKVA 2CQNA 2ID3A 1Z1DA 2OV7A 3MKLA 5JR3A 4CCOA 1UCRA 3ZQLA 1D8KA 2YX7A 3K10A 3OYCA 4S05A 2H8WA 4ZZLA 2G7HA 3CMYA 1JKQC 2K27A 1UJ8A 3SHFA 2DOAA 3BOQA 1P92A 4EM0B 3HM5A 5KHDA 2YU9J 5DUIA 4FQGA 4W1UA 4BE0A 1ZKGA 2K9MA 2EFNA 3FK7A 3O8HA 3SZGA 3VSLA 3FISA 3PUBA 3WTTC 4BDZA 1R36A 2YS9A 3G4SI 1I50J 2B0LA 3LAPA 2LY1A 1FTTA 3NARA 4MLOA 3G6EI 3VYRB 1MMGA 2DJIA 4RGRA 1F5TA 3GTMJ 1UHSA 2LKXA 1VQ4I 4HA8A 1YTYA 3OYMA 3S2HJ 1YS6A 3MD2A 1IF1A 3E6DA 1JKOC 4A3KJ 3E6BA 2IRFG 2L9NA 3ZMSA 4BE1A 2EZHA 3ONQA 3FXOA 2MLKA 2OBPA 4M6XA 5J40A 3WGGA 3BC8A 1XDSA 5M5WJ 4Y17A 1QZYA 2K02A 3M8JA 5HVQC 2X48A 5LEJA 2R5ZA 2DA5A 4RAGA 1HC8A 1A6QA 2ZXJA 1Z6TA 3BP8A 4KICA 3HTUA 1MMNA 5J1YA 1ACIA 2LF8A 1GV5A 2LVSA 1HKSA 1VQLI 4ZYEA 1K6YA 3ZR8X 3U2RA 2RC4A 1PP7U 1ZLJA 3VSKA 2NVQJ 4CGZA 5E17F 2R7VA 1D5YA 1K78A 2DJNA 2X6WA 1X1CA 2ICWG 3F0CA 5E8IA 3SXYA 3WGHA 1OQYA 4E4HA 1ODDA 1MIJA 5FD5A 4HYEA 4PJJA 1X1DA 2K85A 5JI6A 4DYQA 1RUNA 2XPUA 3SDGA 2AHQA 5L3BA 2E1CA 3L2RA 4EM2A 1IN7A 1OYWA 3I59A 3B02A 4I99C 2ZO4A 2KKOA 3NAUA 3O8GA 3F9KA 2VT2A 2KIQA 2FMYA 1HKTA 3IHUA 3GWZA 4PCQA 3MVPA 2KFDA 1SFOJ 2A6TA 3HUGA 3HYIA 3P7NA 5ICFA 1H0MA 3H9JA 4Y52J 3QOPA 5KAIC 1B8IA 2DOFA 3TKYA 1X19A 5E79C 3AG4H 4UB6C 1U6GA 5EG0B 2PJRA 2ETHA 2CO5A 4PJ0C 3WTXC 4D5CA 2JK3A 3I55I 3G1LA 1S5LC 2B63J 2ME0A 2HPIA 3ZQFA 2W85A 1RZ4A 3A02A 4I76A 1A31A 5F1RA 1JGSA 1QZZA 3OOUA 4JX4A 2CRGA 2K9NA 3S3NA 2AS5F 4HF2A 2HZDA 2MLGA 4EV0A 3E0JB 3EYIA 5DCMA 1J5YA 5JLXA 2BV6A 3VFZA 3K1NA 3F22A 2OZ6A 3CO6C 4KMUX 5EJCA 1BIBA 3TP3A 1SD5A 2XRNA 1LDDA 4L0ZB 1A6IA 3LQQA 2DFHA 4CSWA 6PAXA 2V4JC 4Q47A 2Z99A 2HR3A 2M34A 4D7MA 4HEA2 2IA2A 4M71A 2GAUA 2ESHA 1T0FC 4AYBN 1V5GA 1FYMA 3MWMA 2KLOA 4MEYF 4EM1A 3F8BA 1LE8A 3DKWA 3HOUJ 2UXNA 1O3RA 2OD5A 4RMNA 1T38A 1J2XA 2CGPA 2R7TA 1MNEA 3QP5A 5GAHJ 1K6OA 3KP3A 1G3SA 3HKZN 4II3A 2ME6A 5K7ZA 3VOEA 3IRQA 5H6QA 3V7SA 1QRYA 1T39A 2BVLA 5KCMA 4C30A 2NAZA 4XIDA 2DA3A 1W0UA 3K1MA 3ABLH 4D0PA 1Y39A 2LKPA 4AIKA 2KIFA 2WB1A 5CVJA 2H09A 5EGOB 5CQEA 3CCLI 4A0XA 5GP9A 2JA7J 4M72A 1MBKA 1WQ2A 3KP6A 1GT0C 3GZNB 4FX0A 2E2HJ 2N8GA 2L7MP 5J1RA 5B1BH 5A2QK 5IYBJ 4M3DA 3BT9A 5J8FA 1BL0A 1XGSA 1ZQ3P 3OSFA 4XONA 2FNPA 1CGPA 1TQPA 3KEYA 1L3LA 1S7EA 5TJJA 4FHTA 3WU0A 2D5VA 2Q2EA 4BBRJ 5IP7J 2B9SA 2JRTA 2X85A 2BVMA 1F1ZA 3K6GA 3ZMVA 3GTOJ 2KHMA 2ZFWA 3K2ZA 5TGTA 3BPVA 3M8EA 2X0LA 3CESA 4QPQA 5HLHA 3SQNA 3HGGA 3DP7A 2LBFA 1YJWI 3H3UA 3CC2I 2EIJH 3JRDA 1LJ9A 3G1OA 4BACA 1VQMI 4PFPA 5CKTA 1YITI 2JA8J 3DU6A 2ESNA 3GF2A 2IA1A 4G7OF 3C18A 2VPRA 1VQ7I 3OSGA 4B44A 1VQ5I 1PUFB 3HOVJ 3ZOBA 3S16J 4AM3A 3I3LA 2HEOA 1QQIA 3C1DA 3SFZA 2H8RA 4BY7J 3TO7A 3KYLA 4HSRA 1U3EM 1JGGA 1SFXA 1XDUA 2XGDA 1N25A 2DK5A 4OIPF 2O7OA 3AKZA 5BPDA 2MFZA 5A2QZ 3LSTA 1MW7A 3P9CA 2KP6A 2WY8Q 3ERED 1S9HA 4GGGA 1G4DA 5C4XJ 2P7VB 4XN0A 5CVUA 1WJCA 1AWCA 4ABZA 4B3XA 1SANA 2GM4A 2F5CA 2P7CB 2CQ7A 2XAJA 1X4OA 2YSRA 3FXLA 3FZVA 1TQIA 1I27A 2CUEA 2M45A 1VNDA 4EJTA 2LH9A 3CLQA 1JTYA 2RREA 2VQHA 2P5VA 4B43A 4ETSA 3FKIJ 2UZKA 4EJOA 3KX2A 5FRNA 2E2IJ 2HYJA 4HBLA 5AONA 4IJAA 5F0HA 3K7AJ 2M0MA 3ULQB 2NXNB 4KIFA 2DMUA 4XOPA 5FKMA 3OYBA 1YI2I 2KJCA 4RGSA 4KIBA 3B73A 2E35A 2V1DA 3OL3A 4NC8A 5DUKA 1ZRCA 4I7HA 2VB6A 1U9NA 1IXSB 1FP2A 4MIMA 2BZTA 3S2WA 2E60A 4E7LA 5CJ9A 1B72B 2VC0A 3VODA 2ELHA 4M3FA 4CZZA 4MTDA 3OMYA 1QGPA 5B66C 1YS7A 3QAHA 2H6CA 2IP2A 3U1DA 4IHTA 3QU6A 2CW0F 3KZIC 5C4JJ 2H1KA 1S29A 3CJTB 2MC3A 2NYXA 4PJNA 3EUHA 4EJVA 3JRBA 1JKRC 2FBIA 4DJAA 4A0YA 2NVYJ 1TWFJ 2PG4A 2H6BA 1JJ8C 2R7OA 5FKNA 1KU2A 2PEXA 3CTAA 4RAYA 3PQJA 3RSNA 2QSHX 1IAWA 1YE9A 2RN7A 2GXAA 3IWZA 5F08A 5ILSA 3J7AO 3G1MA 2A61A 1MD0A 4BJTA 4C2TA 3HEFA 2QQBA 1WWXA 2FOKA 1IJWC 3OIQA 1WJFA 4UHTA 2HFHA 3DCFA 2XGXA 3LAJA 1V5FA 1T98A 3H36A 3ZQCA 1ON1A 1T6SA 1OJLA 3VB2A 1E3HA 2XF6A 3DQVC 4G8XA 2JSPA 2ZXIA 3HL2A 2M8EA 2IVMA 1AOYA 2JA2A 5FFZA 2HXOA 5F27A 3I4MJ 4HW0A 2ELJA 1ZARA 3EDPA 1G8XA 1O4XA 2XV4S 1E0EA 2WC2A 3BTLA 1YJNI 4BXXJ 2FXAA 5LRSA 2V1XA 1VF9A 2JWTA 4P96A 4XK4A 1W5TA 2Y9YA 3OYEA 3QYEA 1HSTA 4ESFA 2JN6A 4HOBA 4BBSJ 1MMAA 3H35A 4ZYDA 3F3XA 5B5EC 3ABTA 4LOCA 2DTRA 3B6AA 4W97A 4HQMA 3O2PE 4HNTA 1K83J 3W3CA 3IWFA 2IW5A 2K3FA 3LA2A 3KIOA 3V8JA 3L7WA 2WB1N 5HODA 1IRGA 2DA7A 1YLFA 2OCCH 2DMQA 2UV1A 4IEJA 2O8KA 1QNTA 4II2A 1AU7A 4JK1X 1RR8C 4UV9A 2E5NA 2QENA 3U1KA 4EVIA 1W1WE 4DYRA 1HQCA 3F72A 3SFIA 4GRIA 4XRSG 3AAFA 2HNHA 2L9SA 1S3JA 1JT0A 2WY7Q 2BY1A 2DMTA 4LITA 2HTSA 2Y0SA 2BBYA 3ASOH 5CVRA 1IDYA 1JXSA 3FDYA 5IT9K 1QBJA 1VQOI 4O5VA 2KJBA 4C9YA 3GFLA 3RPQA 1JT6A 4NC7A 4EATA 3HSRA 2O6GE 3HHHA 2E7WA 2LMDA 1EA3A 1WRJA 4QIWN 2XDVA 2Q0OA 4KT6A 4RAZA 1TC3C 4B09A 4QLCU 3JRFA 1P6RA 2CYYA 1ZAOA 2DQRA 2JPBA 3BZKA 5EG0A 2ZJPF 2EBIA 4ESJA 2DT6A 2RV8A 3A4CA 1TT5B 2KISA 2M8GX 4IKFA 3BR6A 2NVTJ 2HI3A 1MGTA 1I39A 3AG1H 1BR4A 3R4KA 1R71A 5ILUA 2PN6A 3BCBA 3DKXA 4QTRA 2R92J 4K2EA 5LHHA 3QPSA 2CUZA 2ACJA 2COMA 2H1LA 4F55A 4KISA 1K61A 3I54A 1R23A 4LJZF 1FTZA 2HDWA 2VBWA 1ZGAA 4HPQA 1HOMA 1RKWA 2DYRH 3OYLA 4UVAA 2VODA 1BJAA 2OQRA 1EH6A 3UNGC 3ML6A 5BOXA 4D9JA 4DQ2A 2FE3A 2HGCA 4V2FA 4I6ZA 5EF6A 2BOLA 2CV2A 1I1SA 1Z7UA 3T8RA 1E3OC 1U5TC 5M5XJ 5KNLA 3KPHA 2DFFA 4CH7A 1RIOH 3HXLA 5DDGA 2K3PA 2BHZA 2BGCA 1VQ9I 2R7UA 4M9XA 1D0YA 3WG7H 4YFXF 2KIUA 4HZFA 2C6YA 1RKTA 5ERIA 1AHDP 2CQKA 1OISA 4IQJA 3PSFA 2E34A 3O6BB 4UVBA 3I5UA 1YW9A 5EGOA 2FF4A 1D5VA 4CYDA 3K1PA 3LA3A 2VONA 3H3ZA 2X1EA 4OMYA 4AWXB 4I01A 4YELA 1UHMA 3N97A 1I3AA 4A3IJ 3ZP5A 4KA4A 3TOBA 2AO9A 4U0WA 2LTPA 4L5JA 2EFWA 2MD5A 4HX4A 4DBQA 2FJ1A 2OTLI 3DPLC 2GA2A 1JUMA 4KT5C 5DEQA 4E7HA 1IN8A 3BR5A 3I71A 2JJ7A 1MBHA 3HTSB 2CQXA 4LD5A 1ETOA 4YRVA 4M9SA 4KJZA 2VKDA 1VTNC 3OIOA 5AIQA 2DMNA 2MH2A 5HDKA 2TDXA 1OCPA 2L3DA 5DD8A 2X1DA 3HOXJ 3DEWA 1YW7A 3LOCA 3ESWB 2J5PA 3PM1A 1A36A 2VJJA 3RYRA 5JHFA 1EH7A 1WVRA 3DTKA 3E5UA 4IF4A 4CHUA 3BROA 5LRRA 4H0EA 1BI3A 1IZ1A 4AC0A 4BH9A 4XQFA 1ZYRF 1MBGA 1PUFA 1GHCA 4HQEA 4LLGF 5D6EA 1FYKA 4Y3OA 3MZYA 3RPUD 1I1GA 3S8PA 1ZG5A 3E3VA 1XTAA 4Y33A 1FY7A 2LY9A 1PJRA 4C2MJ 1MBFA 2Z16A 1FEXA 3H9GA 2MW8A 2UUZA 4Q48A 1ORKA 2ZXHA 4YEJA 1XS9A 2F6CA 3EETA 4RAFA 5M3MJ 2V6CA 1REPC 3FBIB 2L2OA 5LLQA 4M3GA 3WODF 1S8NA 3MKZA 4AUXA 5K1YA 4B3AA 2VUMJ 1Q1VA 2EFQA 4XKWA 3CC4I 4JYKA 4U88A 2H94A 3WTYC 2WTEA 3BR3A 2ZNZA 1XN7A 2W00A 3H5NA 4GCVA 2XAGA 1I3QJ 2BXYA 2CU7A 2R7DA 2R93J 3V8KA 1LDKB 4CYCB 4A5NA 1OCCH 4DNCA 4M74A 3QODA 2NOJB 3EUKL 1DUXC 3BJAA 2RNGA 2XGCA 4L9VA 4B48A 1FOKA 3DPUA 5HOOA 4JX6A 2XPWA 3CMAI 2HQNA 3CJQB 1C0WA 2QSGX 2W48A 2HZTA 4N4OB 3ERMA 1B72A 3GTQJ 2ISYA 1JE8A 1MBJA 4DOZA 4ZDPA 5J4YA 4MQ9F 2L54A 2L7KA 5D4SA 3K4KA 2ZCWA 3S3OA 2F4MB 3WHCA 4ASNA 1OCOH 1SFEA 3WTSC 3VWBA 2F4IA 4HV5A 2EZLA 1Y56A 3FM3A 4BUPA 5L3CA 3ZCOA 4RLQA 2J5OA 4YFKF 3AFHA 5HLTA 1WZ2A 2EPFA 4KNYA 2RGVA 1G59A 4WX9A 5HDNA 3E5QA 4WK8F 2CUJA 3QPTA 1R22A 1R9TJ 2WV0A 4C3JJ 1MZBA 2VN2A 2XF7A 2KQRA 1WFXA 1XGOA 3M07A 1PDNC 4RM2A 3LQRA 1TWAJ 2FD5A 2ZBKA 1XC5A 1AA7A 1N75A 2E1NA 2G9WA 1OYYA 3OYKA 3HOTA 4HAMA 1HF0A 4FT8A 4BHPA 3FWEA 1SD7A 2FX0A 1P7JA 3GW2A 3U9GA 3CCVI 4JQFA 2WADA 2ZFUA 1O3QA 2JVGA 3G3ZA 2VKEA 2Y48A 1KQ0A 3MCZA 1YX5A 2R7WA 3OOPA 2TRTA 1FMWA 4NB5A 3M1EA 1K4SA 3DPTA 1POGA 2LOOA 2FQ3A 3K4NA 3DEEA 2DMPA 5H20A 5M5YJ 3TQNA 3LSPA 1MNDA 1FPQA 4OWRB 4G7HF 2A5WA 2PMZA 1S72I 1Z67A 1H89C 2MG4A 3M4OJ 4P9FA 1TT0A 1DGRM 1JI8A 2V26A 2VE8A 1O7FA 1R5GA 2XKOA 2Y2ZA 5KK1A 1X3WB 3H5AA 2HYFA 2ZC2A 3Q0VA 5E20A 3FMSA 3HG9A 2L01A 5K5RA 3JRGA 1T0FA 2E2JJ 3FF5A 4C2UA 1MDMB 4NBQA 1B6AA 1Y1WJ 4DYCA 4XRSA 2HWVA 3MKWB 4IHXA 2EFPA 1JUSA 1WSUA 4XLCA 5DD4A 3JRIA 4XORA 3C2BA 5FRMA 2HTJA 1R6RA 4C3IJ 2OF7A 1U5TB 1D8JA 3E6CC 4G6TB 1T95A 3SYTA 3WU2C 5CQGA 4BQOA 4ZYHA 2FSWA 2ZNYA 4N9IA 4B8XA 3FXJA 3MZHA 3QYFA 4BXFA 3FK6A 3HSEA 2O03A 2PMUA 1TL8A 3T1BA 1HDDC 2KRHA 1YIJI 2L9VA 1B1BA 3GTGJ 3RZOJ 3OYFA 3LNQA 1LFBA 1H9TA 2EH3A 3KCCA 2WV1A 3IRRA 4FTHA 3EPZA 4E6KG 2HYGD 3AG3H 3E7LA 3S2DJ 4CCMA 1QZEA 3HHGA 4S0HB 1WJDA 2OAZA 2X1CA 1IC8A 5BNGA 2YU3A 4U87A 3NRVA 1T8IA 1PP8F 2Y75A 2STTA 4LB5A 2YPRA 1ZG3A 4BL0B 2M4GA 5F0CA 3HC7A 4GO1A 5E18F 2W7NA 2E36A 3DV8A 2Y31A 4PSXA 3GFJA 2GIZA 2QKLB 3ABUA 3DBRB 4KIGA 1ON2A 2MYSA 1TW2A 5E3LA 1ETKA 2CQQA 2DXIA 4OIOF 3C7JA 3F8FA 2M9HA 1MJBA 3Q0UA 5DTDA 1K79A 5GADJ 1R5HA 2JUCA 2XKPA 2LYCA 5CYVA 5D5WB 1ETQA 2RNJA 2MABA 1UHWA 1GLNA 4IHWA 2QF7A 2A6HF 3D0SA 2FA5A 3R0JA 3W6JB 4DBRA 1EH8A 4X1EA 3MQ0A 4R8HA 2K4JA 2NVXJ 2PX9A 1LFUP 4HF1A 3LSHA 4X6AJ 1WKMA 3I0TA 2DW4A 4BJ6C 3BG5A 2OCEA 2JVHA 1P7IA 3KP7A 3M7GA 3MEXA 3GZ5A 2ECCA 2VBZA 2RKHA 3CCQI 1P9QC 2GBYA 3HPGA 2BY3A 4XLAA 3KYDB 1HA8A 3JRCA 1R5ID 3VYSB 3N4MA 3A03A 4XM3A 4IHSA 3HJEA 2PQ8A 4MEXF 2O5RA 1LVAA 1Z6RA 4IZZA 4EJWA 5L3EA 4MO7A 1G3WA 3VYTB 2R0QC 3GLLA 2GOMA 2VKHA 1JJ6C 2Z1DA 4QPOA 3BZ6A 1SC7A 3H9QA 4OAZA 1MSEC 4LMYA 4MTEA 2W84A 2DTZA 4PJLA 1MH3A 1G3YA 3CP8A 2IGKA 3TGNA 3A1YA 2DBBA 1FOWA 2MH9A 2WAEA 3ECOA 1YJ9I 4JX5A 5EZGA 1MNMC 2BW3B 3AG2H 4ZDLA 2V1NA 1HW2A 1OR7C 2DK8A 1FMVA 4CICA 2IPQX 3FXRA 1IN4A 2R5YB 3COAC 4HNVA 1TZLA 3BPXA 1ERDA 1EF4A 3KETA 2LDUA 3W2VA 1BR2A 2R7ZJ 2HVRA 3LSJA 2JRMA 2XAFA 3BY6A 2OUMA 3IP4B 5ED4A 4I09A 3RKYA 4E7JA 2K9QA 2CV1A 5EEHA 3LWFA 4WXCA 3J7ZI 4M6VA 4RGXA 5LGTA 2HVSA 2D1VA 3U21A 1B4AA 1XMXA 3V42A 2DA2A 4PDKA 4C3HJ 5FLVA 3Q5FA 3HDDA 1WH5A 1ZR2A 2ADUA 4IRHA 2I8DA 5K5QA 1MSFC 3C2HA 2RDPA 1NG6A 4BQNA 4BHBA 2HOEA 3FMQA 1T56A 3M9AA 2HOAA 3S1MJ 3SEZA 2PMZN 3KEQA 2AQEA 5AIPA 4CYCA 3DKYA 5F6FA 1OCRH 4BU2A 1T33A 1WCMJ 3IC7A 1O7LA 3GLXA 1RNLA 1V54H 5FD6A 3BR0A 3TP0A 2L9RA 2E1MC 1LNWA 1YO5C 4DZPA 1UB9A 2KZVA 4BY1J 3PIPF 4CXFA 1LDJA 1XCVA 2E19A 4LK1F 3T8TA 3UKGA 2CMPA 5B1AH 1ETXA 2GA1A 3S1NJ 4DZJA 3LSIA 3CCJI 2FUG2 4ZJZA 5L3FA 4O6JA 2XAUA 1KA8A 2Z9OA 3HIFA 1UG0A 3Q3SA 5IOYA 3MN2A 1USSA 1UELB 1XGMA 4M3EA 5JFRA 2ZMEC 9ANTA 4ZYGA 2DOEA 2KT0A 5KAFC 3F23A 3Q9SA 2VXDA 4RA2A 1ETVA 2XAQA 1FOXA 4XL9A 1Z7LA 4WXHA 2EZKA 4XR6A 4MFEA 4NNJA 3K4JA 4DGWB 4LK0F 1NK3P 1EJ9A 4N9HA 5DM6F 3PO3J 4HF0A 3JR9A 2R7RA 4RLFA 5BPIA 2XRLA 4S04A 2AXTC 1R7JA 3HRTA 1LEBA 2Q8KA 4Z2YA 2JQ7A 1PYVA 4OU0A 3WG9A 3P9IA 4LLNA 2QWWA 1I6XA 3CQZJ 3S93A 3HGYA 3ZMUA 2HQ5A 1DGWY 3OIPA 1A35A 1IUYA 3D5SC 3K9TA 3ZMTA 2V9KA 1ONVA 3DU5A 1XB4A 1F43A 1CF7B 2XB0X 5FJ8J 3GZ6A 5EEGA 3FHNA 3JRHA 5K5OA 1XSDA 1BM9A 2LD5A 4EJUA 2EILH 4P1WA 1K4TA 3BCAA 3CCRI 3IH3A 2QKMB 3BDDA 1KQ8A 4IQ4A 1IGNA 1QPMA 3RYPA 3K4BA 4LLLA 2EJRA 5IP6A 4A3GJ 1TW3A 1J7KA 3ZMZA 2WA0A 3DTEA 2EA4A 2IAIA 3Q0WA 4JP0A 1QHHD 3JSPA 4XLNF 1M1EB 2OU2A 3OYJA 1WJBA 1K7AA 3ZQGA 2EIMH 1WH7A 2OA4A 1X3UA 1FIAA 1FWZA 3CDLA 3OV8A 5HDGA 4BEHB 2HOTA 1FOYA 1IRFA 5FFXA 5LHIA 1J0RA 2XF5A 2YR2A 3PQKA 5FKLA 4XKBA 1TNTA 3T5XA 3A01B 1JHFA 4BJ5C 1W5SA 2TCTA 4ENNA 4CCLA 2LSOA 3ROUA 2VJ5A 4NQWB 2HDCA 4IOCF 1GDTA 3QRFF 1WJ5A 1IO2A 2JTVA 2RQQA 1MDMA 1KQ9A 1F9NA 4I0AA 5JHUA 4BAYA 3KP4A 2NVUB 5JLWA 4XICA 2Q1ZB 1KZHA 5IY5H 1Y6IA 2EK5A 3TDUC 1UMQA 2X6OA 1N78A 3J7YJ 3K4LA 2P5KA 3S1QJ 2NNYA 1U5TA 5DCFA 4ZH4F 2ZSHB 4TV7A 3MFKA 1GVJA 5D5XB 4UV8A 3HOYJ 1WPKA 2MSYA 3WU1B 1W7PD 2Z33A 4ESBA 1WHUA 5L3GA 2EFOA 2A69F 1D0XA 4CA0A 1ETYA 1U2WA 3HPHA 3I9V2 1MH4A 3CDHA 3E97A 3L2UA 4MFDA 1IN5A 5FLMJ 3ZMDA 2E7XA 3RKXA 2W4SA 2K40A 4GDFA 4M73A 1ZGJA 4I02A 1BC8C 4UNOA 2CW7A 3GFIA 2V79A 2IT0A 2DA4A 5IT9Z 3RIRA 2GQQA 2QSFX 1U0JA 4J00A 4XLFA 3J80K 1UZCA 2Y9ZA 1RESA 5K7FA 3L1PA 4RS8A 1X3ZB 2P6TA 4B47A 3GTKJ 1FX7A 3WHBA 1VZ0A 1STZA 2XASA 2CFOA 3BG7A 5E1XA 4NC6A 3KEOA 1R49A 4FX4A 1B9NA 1OFCX 3ABKH 4EEFG 4FE7A 2P4WA 2KDZA 3RQIA 3CC7I 3PJRA 2IXSA 1WJEA 2LREA 4XLPF 5EZHA 1TBXA 5EDNA 2GWRA 2X51A 4XBFA 4A5MA 2GXGA 3G2BA 4NUBA 2EV6A 4HLYA 2F2EA 3A2KA 1WI9A 1XPXA 1BI1A 4UUTA 1P4AA 1SVOA 3SZPA 3WTVC 4DIQA 3EUAA 3OY9A 4EGZA 2DDAA 4FE4A 4Y13A 3W6VA 3JW4A 3V7CA 1SEUA 2EINH 2Y0MA 2OPTA 3RKQA 3LA7A 3W2WA 2QLZA 3TDZC 2QBYB 1Z9CA 3W6KB 2VIXA 3OS2A 2OZUA 1SMTA 2FEZA 1BOAA 4L9TA 3PFIA 4PZJA 2QQAA 2XVCA 1YRNB 3J80Z 2XSJC 1HSJA 5D6FA 4RDUA 3KLOA 4PJMA 4ENMA 2BXZA 1DPRA 1ZN2A 1MKMA 3IV5A 4FETA 5D5UB 1VQNI 2VBYA 3CCEI 4LB6B 2HKOA 4RB0A 1KGSA 5L3DA 1P4WA 1BJZA 4EGYA 1HXDA 2LC2A 5FKOA 3RPUA 3H0DA 3D5RC 3X2QH 2QQ9A 5GAEJ 3SEQA 3I4PA 3MKYB 1Y0NA 1I6HJ 2HU9A 1V4RA 4G94A 3DLLF 4FASD 3EYYA 1YQAA 1RC9A 3C2GA 1YYVA 4OINF 4E7SA 2EA2A 1IW7F 3PNYA 4RB1A 1SVMA 3VDXA 2QGUA 1J59A 3G73A 2L7FP 4XLEA 2MA3A 3H92A 2BW3A 2Z5UA 3JRAA 4PUSA 4KN7X 5DS9A 3MZ8A 5C3EJ 1FZPB 3N05A 3IH2A 3A0BC 4G6DA 2E1MB 4U7DA 1W4MA 2JSCA 4IRGA 1X2NA 1YX3A 3A0HC 3F6OA 3LSRA 3CJNA 2R5YA 2OC6A 3DEUA 2F4OB 2EQRA 4BXUA 4RB2C 3D5LA 4YIIA 1H88C 2I10A 1N77A 4Q4ZF 4PK4A 1U8RA 2CSOA 4MGRA 3LSGA 4NDLA 3GFMA 3SJMA 1FLIA 1RI7A 1WI3A 1SFKA 2ZMEB 3DTIA 3RCOA 1LB2A 2QM3A 2VKVA 1BIAA 4E7KA 1OLTA 1ETWA 1JTXA 3BQYA 5C44J 2QEXI 4ZDOA 3OL4A 3ECHA 4AD9A 4U7BA 3R60A 1FIPA 1BR1A 4E7IA 5IP9J 4OOIA 1D1AA 4A93J 1BOBA 4ENKA 1ENHA 2AQFA 3TOAA 1G2HA 5CVVA 3GUDA 3IKTA 4B1RA 4XRMA 3HOWJ 1IV8A 3CUQC 3H1CA 2FU4A 2Y0SN 1RETA 3PIOF 3BG3A 3C3WA 2IA0A 3CCUI 4PSWA 2FNAA 4QSHA 1TP4A 2EV5A 2DT7B 3PFYA 2G0EA 4LG0B 4F52A 4I2OA 2V6EA 1LVKA 3PNTA 1BW6A 2DU9A 3OWTA 1H8AC 2LG4A 4X0GA 2K4BA 3HSFA 3PNVA 1O3SA 1SD6A 3BG6A 2CH0A 3DBLB 3VPRA 2IS2A 4NHJA 4UY8I 3WTUC 2A68F 2PFBA 3TO9A 4WXDA 4N4NB 1V55H 3LL7A 1SVLA 4GFBA 4YFNF 2DN0A 5FGMA 3JSOA 5LEKA 1J09A 3F6VA 1B9MA 4P55A 4R79A 1EV7A 2L4AA 4BGDA 2P6SA 4HDUA 2R7XA 2W25A 2CG4A 4RB3C 3IAM2 4QWQA 3ZRGA 2VQGA 4GXOA 2JZYA 2WWYA 3RQ4A 3QQAA 3FXKA 2BHYA 4U0VA 5FKKA 2DPDA 1RUOA 4XOTA 2OTJI 2FQ4A 3KP2A 2M1BA 3OR1C 2HKXA 5B3SH 2LR8A 2VQCA 2VT3A 4WCGA 2RQPA 3JTGA 4UUSB 1GUUA 2FOWA 4H4KC 1FT9A 2QZ8A 1R1VA 4HV6A 4IPAA 2M4KA 4HLXA 4IHVA 1T2KA 2DPUA 2COBA 4XKCA 1FBQA 3FM5A 3E6MA 3BR1A 1B59A 1USTA 4DW6A 1CF7A 1X4PA 3BLYA 1HW5A 2NS0A 4KN4X 1Z05A 3HB9A 2YUSA 2EV0A 1IXCA 4WWCA 2BY2A 5K7HA 4M3BA 1TTYA 1UFMA 3VEPA 3FMRA 2X6XA 3R6SA 4BHCA 3CCMI 2PJPA 3NWTA 2EWNA 2WAQA 4ZZDA 3QP6A 2K9SA 1BBYA 1XG1A 4OAYA 4M9ZA 1ZR4A 4WF2A 1V5EA 3GEZA 5F1JA 3DF8A 4BEHA 4A3FJ 2AXLA 3OYIA 1W7PB 3ZN0A 1IV6A 3K0LA 3M3YJ 1FC3A 3ZXSA 3A01A 2KMUA 2CUFA 4KYWA 3MMYB 4CCKA 3P9KA 4A69C 3QPLA 1X1PA 2M87A 3DBHB 1A5JA 4NQWA 2V1UA 1Y1VJ 1Z3XA 1ZGWA 1J75A 1E2XA 4A3BJ 4L5EA 2FBKA 4HDVA 1U8BA 4UB8C 3RJPA 2R3SA 4ITVA 4BS9A 2STWA 1MMDA 5HNFA 4L5IA 2F5FA 2P8TA 3PL8A 3H5RA 4Y7NJ 4A3JJ 3ZQQA 3OS0A 3HRSA 5D8KB 4JOMA 2W57A 3GTJJ 2GIVA 3CUOA 3I53A 5LBQA 1VQ6I 1XCBA 3S14J 3I58A 4ZTFA 5IYDJ 2HQRA 2BE5F 2XPVA 2KPMA 2DFIA 5BQTA 2DQLA 2NRAC 2NS7A 2PMHA 1X1BA 1XGNA 1SMYF 3CP2A 3FKJA 5D8LB 4L18B 1OKRA 5ICGA 3S17J 4BNCA 5TISC 2DI3A 4CZCA 2A6EF 2ID6A 2EB7A 4AIJA 2CJJA 2RVCA 3RKWA 3BZCA 1HDPA 3CMEI 4M6YA 3UR3C 1KU7A 2D1HA 3D1NI 2D45A 2K86A 2VJ4A 3TO6A 2P5LC 5F0FA 1WJAA 3ZGKA 2FMLA 2DO7A 4UXNA 4I0BA 3BWGA 2E5ZA 4A3EJ 2VOOA 3HZJA 3KYCB 4P9UA 3CJRB 4MHGA 2IGMA 4LGWA 1H9GA 3E5XA 1DDNA 2F5DA 5BMZA 1TQMA 3L00A 4F92B 5FB2A 1HKQA 3BQZA 1LFPA 2A5YB 2KRFA 4JBAA 1XSVA 2F5VA 2HXIA 3F8CA 4L9JA 3JREA 2LRDA 1DU0A 1U9OA 2H27A 4L9NA 4EQQA 1OR7A 1WGXA 3R0AA 1RR7A 3L2QA 4IHYA 2L02A 1YHQI 4E7ZA 3GYHX 3LFUA 2VI6A 1O3TA 2Y69H 4AU7A 1FNNA 5EYRA 4XSZF 3OYAA 3ABMH 2HDDA 2QBYA 1QVUA 3BJ6A 3GVAA 4PGHA 3L2CA 1VFCA 3KZYA 3L9FA 3CF5F 2LKSA 3G71I 3GCMA 4Q5SF 1YW8A 2R4GA 2XROA 3BG9A 1YRNA 3HOSA 1X2MA 3KZZA 5J4VA 4KFCA 1CQTA 5CPRB 4BE2A 3CLOA 3EQLF 1NK2P 3IUOA 5IPAA 4A0ZA 2XB5A 2ZJRF 3BTCA 4Y15A 1D1CA 1Z21A 1QHGA 3AL0C 4I98B 3HRMA 4G9YA 1SAUA 3QWLA 2JPCA 1QA6A 1YFHA 2VQLA 3ISPA 1ULYA 3CUQB 3RI4A 1ZRFA 3L2VA 5J6XA 1KONA 5F04A 3S15J 2V7FA 2M7BA 2ZB9A 2JMWA 1ITYA 1DU6A 4XMYA 2CW8A 3GXOA 1HCRA 1R1UA 1J9IA 4V2GA 5FLXK 5J47A 3FIWA 3QOEA 5GTIC 1D0ZA 1I5ZA 2GOXB 3MAJA 3RDIA 4IO9F 5JVGF 2DLLA 2ELKA 5E1ZB 4Y4RA 2XHKA 1W36D 1IRXA 1AKHB 3F8NA 2JUGA 2GXBA 2M5WA 3QPHA 3I4NJ 3J7AY 2BEOA 5H2FC 2OJED 2IS6A 1UAAA 1UG2A 3IH4A 2F5EA 1IDZA 1IUFA 2LF7A 3PO2J 2V9PA 2M2EA 2M0CA 2MGQA 3ELKA 3BJOA 4IXAA 3SZTA 1TWHJ 2XSDC 1FJLA 3ZPLA 2IBDA 4A3LJ 5IOZA 5IYCJ 3V8LA 4XSXF 5E3MA 1D1BA 1E17A 3O3KA 2KIMA 2X6YA 2E71A 4G6QA 2EZIA 3FXUA 1MJAA 3DLAA 2ZMEA 3TL4X 1DPUA 2DT5A 5LGNA 3K4CA 4LFUA 4MQVA 2ZKZA 5HLIA 2MD0A 1W36C 1IN6A 1MJ9A 4KITB 1PUEE 4U0YA 1V3FA 1Y0UA 4OIRF 4LIVA 3BTJA 3ZQ7A 3GX4X 3ZQHA 3REOA 1ZK8A 2WAQN 2X9DA 1DP3A 1LEAA 1HLVA 1F36A 1R00A 4RM3A 2VASA 5ICCA 3L2WA 4A12A 1Z3YA 3LFKA 2O9LA 1OYIA 4HRIA 5FLXZ 3ASNH 3CCYA 3IAS2 4LG0A 3OYNA 5E3NA 2VPLA 4AIHA 1IRZA 4PFOA 3OYHA 3I64A 1XMAA 3V7RA 5ILVA 1GVDA 3S1RJ 4A6DA 1XX5A 1YG2A 3OR2C 4KUMA 3EUHC 2UXXA 2R5ZB 3TEDA 5JVTA 4CCJA 5E8GA 1FSHA 2QVOA 4CDGA 3TW6A 4YG2F 2IS4A 4F93B 4J19A 1X58A 3PUFA 5EEAA 5FO5A 5J3LA 3WTZA 3K69A 2X4HA 1R58A 5GPAA 1RRJA 4BDYA 4CUGA 5DM7F 1QVTA 2VL8A 1K78B 2G7UA 2P0WA 3QU3A 4IOAF 3LSMA 2LNBA 2KDOA 2JA5J 2XC7A 1VI0A 1FSEA 4IVNA 2ECBA 2VOPA 1Z77A 2WBMA 2XAHA 2LK2A 1Q1HA 3RZDJ 1JKPC 2CV0A 3GMEA 1G3TA 3K2AA 4HNUA 2Y30A 4XNFA 4UVCA 3I59B 1S6LA 3BTIA 3S3MA 1BI0A 5CLSA 4HG2A 3S32A 4HX8A 3HUGB 4UUSA 1OCZH 3P5JA 1OPCA 4ANJA 3HOZJ 4PGGA 1FYLA 3HRUA 4CCNA 1X1AA 1KYWA 1Y8RB 1S7AA 2MBFA 1B8IB 2O61A 3LSKA 3DFGA 4OIQF 2R7QA 5FROA 1JUPA 2PJRB 1BA5A 2M7AA 4P5OA 4ON0A 1ZTRA 3LMMA 4AIDA 2VBXA 2L5QA 4GYIA 2KL4A 3KLNA 3NWSA 1QU3A 1YIOA 3K70D 2LLKA 1DP7P 1TWGJ 3FX3A 2YX4A 3GTPJ 5DCMB 4LG3A 3H3VK 5D5VB 2EIKH 2Z2SB 2VC1A 3WTWC 3F21A 4A3MJ 3K4MA 5CVIA 3VYUB 1W5CC 2QUFA 3QYBA 2NS8A 2W82A 1LQ1A 4BQAA 3HBLA 3ZQIA 2NNNA 1ZG1A 1MBEA 4D5FA 4GYGA 5BS6A 2A3SA 3J81K 4HSTA 1W7PA 2FBHA 2XIGA 1OCTC 3PSIA 2FRHA 3K70C 4B4CA 1LE8B 2CWEA 2O0YA 1ZREA 3WGIA 4CO8A 1LKXA 1ZHFA 2GLOA 4J01A 2P81A 2W24A 1NG7A 2ZJ2A 3IL2A 2JA6J 3SDBA 3WE3A 1T08B 2GZWA 3B6CA 3CZ6A 2L0KA 4AVZA 2F48A 1VQPI 3CDIA 2DA6A 3R61A 1TWCJ 3M1CA 2DAOA 2W1OA 4KDPA 4O3MA 4XLHA 5M3FJ 2E1OA 3KFWX 1JHHA 1XMKA 1NHAA 1KYZA 1PVEA 2PBIA 2BY0A 5GAGJ 4FCYA 2CFXA 1DQUA 2VJIA 1Y8QB 5LHGA 2B7EA 3TW7A 2XGEA 2HOSA 1E3PA 2IS1A 2HVQA 3NEUA 4BKXA 1U78A 5ICEA 1SD4A 5IT3A 5LFAA 4BYYA 2LP0A 3TBIA 3M8FA 3OYDA 1S7OA 2M3AA 4G7ZF 1FBUA 3JTHA 5H6RA 4AVPA 2Q2EB 2QYOA 1D3YA 2CS3A 2DDBA 5DYMA 1FBSA 4LIUA 5F64A 1BC7C 2HQAA 3Q9VA 4IL6C 2DA1A 1KU9A 3CCSI 1XSXA 1GXQA 3OS1A 3J81Z 3IKVA 2DFEA 3DWLE 1P4XA 2O3FA 4MNUA 3CO7C 4L0YB 1ZH5A 4HX7A 3V4GA 2KZGA 4F91B 1W0TA 2LBFB 4D7NA 3AL0B 5HS9A 4R1HA 3W2AA 3CMMA 4F7ZA 2R7FA 3KE2A 3FBNB 3KP5A 1GXPA 2LFBA 1ZLKA 2UWMA 1EKEA 2WAFA 4XRFA 3H0GJ 1BW5A 2PLYA 5HS8A 2JT1A 1IG7A 1GV2A 2A07F 4IX7A 1A04A 5D4RA 5E3OA 3I56I 4RBOA 4F3QA 5HNHA 3DXJF 2KRCA 4V19K 1P2FA 1F4KA 2IGOA 3FXMA 4AYBA 2K7LA 1HBXG 4ZC3A 1BI2A 5HLGA 5LGUA 3JAMK 3E1SA 2L4MA 2QCOA 5HS7A 1SAXA 1R4NB 4BQQA 2LY2A
chains in the Genus database with same CATH topology
3BLYA 2UV1A 2IGKA 4II2A 3A1YA 2K5CA 2WAEA 2E5NA 2VLAA 3HKZA 2BW3B 4GRIA 4ZDLA 2HNHA 2V1NA 2L9SA 1OR7C 2X6XA 2WY7Q 3RTRA 2DCEA 2VXZA 4XN3A 1FMVA 4LITA 3NWTA 2Y0SA 3TMOA 3CF2A 2WAQA 3FDYA 1TZLA 4C9YA 1ERDA 4OAYA 4NC7A 4EATA 4ZTJA 1V5EA 1EA3A 3W2VA 1BR2A 2XDVA 4KT6A 2HVRA 4BEHA 2HPMA 3OYIA 3IP4B 2OUMA 2CV1A 4E7JA 3ZXSA 2DT6A 3A4CA 2KMUA 4IKFA 3MMYB 4CCKA 1ZELA 2HVSA 3U21A 3V42A 1Z3XA 1BR4A 3BCBA 3DKXA 4ZYAA 2IGNA 2CUZA 4F55A 2I8DA 2MC4A 3GBGA 5LD2C 3C2HA 4KISA 1NG6A 4BQNA 2R7SA 4ITVA 4BS9A 2ZSIB 1MMDA 5HNFA 2HDWA 3OYGA 3PL8A 4HPQA 3H5RA 2K9LA 3ZQQA 3SEZA 3OS0A 4D1QA 4JOMA 4XKVA 2AQEA 3OYLA 4ZTFA 2OV7A 3DKYA 4CCOA 3UNGC 4BU2A 4D9JA 2KPMA 3K10A 3OYCA 1X1BA 2BOLA 2DOAA 2E1MC 2CV2A 3CP2A 5KHDA 2KZVA 3FKJA 4BE0A 2CMPA 5KNLA 2K9MA 3VSLA 3SZGA 4CH7A 3HXLA 3PUBA 4CZCA 2K3PA 3LSIA 2FUG2 4ZJZA 2XAUA 4BDZA 2R7UA 1D0YA 1UG0A 2LY1A 1UELB 3UR3C 3PSFA 4IQJA 4MLOA 3VYRB 1MMGA 2DJIA 2VJ4A 1WJAA 2X1EA 3ZGKA 2VXDA 4YELA 4XL9A 1Z7LA 3OYMA 4XR6A 3MD2A 2E5ZA 3K4JA 4NNJA 4DGWB 2L9NA 3CJRB 4BE1A 2IGMA 3ONQA 4DBQA 2R7RA 4RLFA 3BC8A 3DPLC 4F92B 5HVQC 3M8JA 4E7HA 1LFPA 2F5VA 2LRDA 1PYVA 4YRVA 4KJZA 2VKDA 1MMNA 3L2QA 3S93A 4E7ZA 1K6YA 3ZR8X 1DGWY 3OIPA 3LFUA 2X1DA 3D5SC 3VSKA 2V9KA 3DU5A 4AU7A 2R7VA 3OYAA 2X6WA 1X1CA 3FHNA 4E4HA 4PJJA 1X1DA 4P1WA 2VJJA 3BCAA 5JHFA 2R4GA 3DTKA 3HOSA 3L2RA 2QKMB 4IQ4A 5CPRB 4XQFA 3K4BA 4BE2A 3F9KA 3IUOA 2WA0A 3DTEA 4Y3OA 1QHHD 3RPUD 1D1CA 1Z21A 2A6TA 3S8PA 1QHGA 3OYJA 1WJBA 3AL0C 3H9JA 4Y33A 4BEHB 1PJRA 1SAUA 1X19A 2VQLA 2XF5A 2Z16A 4XKBA 3H9GA 2PJRA 2UUZA 3L2VA 1KONA 2ZXHA 4YEJA 4BJ5C 2F6CA 2V7FA 2M7BA 4CCLA 3FBIB 2HPIA 4XMYA 2VJ5A 2CW8A 4NQWB 2L2OA 1WJ5A 3OOUA 3S3NA 3MKZA 2RQQA 3QOEA 2HZDA 1D0ZA 2GOXB 2Q1ZB 3E0JB 1Y6IA 4Y4RA 4XKWA 1W36D 1IRXA 1N78A 2JUGA 3K4LA 4CSWA 3J7AY 3H5NA 2V4JC 2W00A 2IS6A 1UAAA 2ZSHB 4HEA2 1LDKB 1T0FC 1V5GA 3QODA 2NOJB 3EUKL 1D0XA 1D1BA 4CA0A 2KLOA 2X6YA 2RNGA 3HPHA 3I9V2 3L2UA 3DLAA 3TL4X 4B48A 4RMNA 2W4SA 3K4CA 2R7TA 3DPUA 1MNEA 2MD0A 5HOOA 1W36C 2CW7A 3CJQB 4KITB 4II3A 4N4OB 2LY2A 1U0JA 4ZDPA 4DOZA 4XLFA 2BVLA 4LIVA 5KCMA 4C30A 4J00A 2L7KA 3K4KA 3S3OA 1DP3A 4B47A 3VWBA 2WB1A 2F4IA 1VZ0A 1Y56A 4BUPA 4RM3A 5CQEA 2VASA 3L2WA 2CFOA 1Z3YA 3ZCOA 3BG7A 4RLQA 4HRIA 3IAS2 3OYNA 2VPLA 3AFHA 4PFOA 5HLTA 3OYHA 3PJRA 2IXSA 1WJEA 2LREA 4XONA 1G59A 2X51A 3OR2C 2CUJA 3EUHC 3G2BA 3KEYA 4NUBA 3A2KA 4CCJA 2XF7A 4DIQA 2KQRA 3EUAA 2IS4A 1WFXA 4F93B 2X85A 3OY9A 4RM2A 2BVMA 3K6GA 2KHMA 1AA7A 1N75A 4CUGA 3OYKA 5TGTA 3HOTA 4BDYA 3W2WA 2VL8A 3CESA 4QPQA 2P0WA 3LSMA 2VIXA 3OS2A 2KDOA 2LBFA 4JQFA 2XC7A 4BACA 2WADA 4PFPA 5CKTA 2ZFUA 2WBMA 3DU6A 2JVGA 1YX5A 2R7WA 2CV0A 4HNUA 2XSJC 4XNFA 1FMWA 3DPTA 4PJMA 3S3MA 2LOOA 4B44A 3K4NA 3DEEA 4FETA 4HG2A 3I3LA 3S32A 1MNDA 4OWRB 2A5WA 2PMZA 3HUGB 4ANJA 3KYLA 4HSRA 4CCNA 2LC2A 1X1AA 3H0DA 3D5RC 3MKYB 1TT0A 3SEQA 1DGRM 3LSKA 3AKZA 2MFZA 1JI8A 2V26A 1MW7A 2R7QA 5FROA 2PJRB 2HU9A 2KP6A 2M7AA 2WY8Q 4P5OA 1S9HA 3H5AA 3LMMA 4XN0A 4FASD 1WJCA 4B3XA 2L5QA 2KL4A 3C2GA 4E7SA 3HG9A 1X4OA 3NWSA 1QU3A 3PNYA 3VDXA 3K70D 4C2UA 4XLEA 1X4PA 2BW3A 3MKWB 4PUSA 4LG3A 2LH9A 3N05A 2VQHA 2RREA 4XLCA 4B43A 2E1MB 2Z2SB 4XORA 5FRMA 3KX2A 5FRNA 1R6RA 3K4MA 1YX3A 4G6TB 3VYUB 1T95A 2OC6A 3SYTA 3QYBA 5CQGA 4BQOA 2W82A 2M0MA 3D5LA 4XOPA 3OYBA 3QYFA 4BXFA 4HSTA 1N77A 4PK4A 3PSIA 2KRHA 3K70C 3LSGA 3OL3A 4NC8A 3RCOA 1SFKA 3DTIA 3OYFA 2VB6A 4E7KA 1OLTA 1LKXA 2E60A 3EPZA 4J01A 4E6KG 3OL4A 4ZDOA 1NG7A 4U7BA 4E7LA 4CCMA 3SDBA 1BR1A 4AVZA 3CZ6A 4E7IA 3OMYA 1D1AA 1WJDA 1BOBA 2X1CA 3M1CA 2W1OA 2AQFA 4XLHA 4U87A 4PJNA 4BL0B 4DJAA 2M4GA 1DQUA 2VJIA 2R7OA 3HC7A 2W7NA 4PSWA 3PFYA 2DT7B 4PSXA 3RSNA 4F52A 2QKLB 2V6EA 1YE9A 1LVKA 3PNTA 2HVQA 2IS1A 2MYSA 3OWTA 4BJTA 4C2TA 2LG4A 2DXIA 4X0GA 5LFAA 3PNVA 3TBIA 3OYDA 3BG6A 3OIQA 2M3AA 1WJFA 2CH0A 2IS2A 2Q2EB 2CS3A 4LIUA 2HQAA 2LYCA 4N4NB 2MABA 1GLNA 1V5FA 4DBRA 3OS1A 3LL7A 3DWLE 2XF6A 3DQVC 2JSPA 2ZXIA 3LSHA 3HL2A 1J09A 4F91B 3AL0B 4BJ6C 2LBFB 4R79A 2JA2A 4BGDA 2R7XA 3W2AA 2JVHA 3CMMA 2ELJA 3FBNB 3IAM2 3ZRGA 1G8XA 2VQGA 2UWMA 1P9QC 3RQ4A 3HPGA 1E0EA 2WAFA 4XLAA 1HA8A 3VYSB 4XM3A 4XOTA 3OYEA 3QYEA 3OR1C 2O5RA 4IX7A 2VQCA 4IZZA 1MMAA 3H35A 4F3QA 5HNHA 3VYTB 2KRCA 4H4KC 2GOMA 2IGOA 2VKHA 4HNTA 4AYBA 2Z1DA 4QPOA 2M4KA 3H9QA 4OAZA 3W3CA 4ZC3A 4XKCA 3E1SA 4BQQA 4PJLA 3CP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J00 A;  3QOE A;  3QOD A;  4HRI A;  4J01 A;  4IZZ A;  4YRV A; 
#chains in the Genus database with same CATH topology
 2Z3Y A;  4YIR X;  1HW1 A;  2ZXW H;  2K5C A;  3L09 A;  3BR2 A;  3F8M A;  2ZJQ F;  1R4M B;  1XD7 A;  1RPW A;  4IRI A;  3JCU C;  4A2U A;  2VLA A;  2L7Z A;  3HKZ A;  4G12 A;  2I5U A;  2HS5 A;  3ZN1 A;  4EMS A;  4A6E A;  2ISZ A;  4FIS A;  1O57 A;  5KVR A;  1APL C;  3GO5 A;  5GPC A;  1BN5 A;  2DCE A;  2VXZ A;  4XN3 A;  3RTR A;  1LPQ A;  3T0Y A;  2IEK A;  3TMO A;  2V9V A;  1QO0 D;  3CF2 A;  3FXQ A;  1VQK I;  1ZRD A;  4Z6Y A;  3GTL J;  5GTH C;  5J1U A;  3FHZ A;  2QA4 I;  4OMZ A;  1OMI A;  4ZTJ A;  2OQG A;  2PI0 A;  4UUV A;  1Z0X A;  2VE9 A;  5J8C A;  2XUB A;  2HPM A;  1NH3 A;  3NQO A;  1R1T A;  1KU3 A;  3CUQ A;  2O8X A;  1YOV B;  2RAE A;  2NOG A;  5DV5 A;  4N0B A;  4ENJ A;  1ZEL A;  2DOD A;  1L0O C;  3CD6 I;  4RGU A;  5E1W A;  4A3C J;  2A05 A;  4ZYA A;  4KMF A;  5TRD A;  2IGN A;  1IXR C;  1TNS A;  4A3D J;  1LUJ B;  5LD2 C;  2MC4 A;  3GBG A;  2R7S A;  1FP1 D;  1NTC A;  1TLH B;  2BYV E;  2ZSI B;  3JAM Z;  1QPI A;  2IJL A;  1AKH A;  1MMS A;  3OYG A;  1VQ8 I;  2QQ8 A;  1Z91 A;  2M30 A;  3WE2 A;  2K9L A;  4YIF A;  1SFU A;  4E70 A;  4D1Q A;  2D2W A;  2DYS H;  1G6N A;  4XKV A;  2CQN A;  2ID3 A;  1Z1D A;  2OV7 A;  3MKL A;  5JR3 A;  4CCO A;  1UCR A;  3ZQL A;  1D8K A;  2YX7 A;  3K10 A;  3OYC A;  4S05 A;  2H8W A;  4ZZL A;  2G7H A;  3CMY A;  1JKQ C;  2K27 A;  1UJ8 A;  3SHF A;  2DOA A;  3BOQ A;  1P92 A;  4EM0 B;  3HM5 A;  5KHD A;  2YU9 J;  5DUI A;  4FQG A;  4W1U A;  4BE0 A;  1ZKG A;  2K9M A;  2EFN A;  3FK7 A;  3O8H A;  3SZG A;  3VSL A;  3FIS A;  3PUB A;  3WTT C;  4BDZ A;  1R36 A;  2YS9 A;  3G4S I;  1I50 J;  2B0L A;  3LAP A;  2LY1 A;  1FTT A;  3NAR A;  4MLO A;  3G6E I;  3VYR B;  1MMG A;  2DJI A;  4RGR A;  1F5T A;  3GTM J;  1UHS A;  2LKX A;  1VQ4 I;  4HA8 A;  1YTY A;  3OYM A;  3S2H J;  1YS6 A;  3MD2 A;  1IF1 A;  3E6D A;  1JKO C;  4A3K J;  3E6B A;  2IRF G;  2L9N A;  3ZMS A;  4BE1 A;  2EZH A;  3ONQ A;  3FXO A;  2MLK A;  2OBP A;  4M6X A;  5J40 A;  3WGG A;  3BC8 A;  1XDS A;  5M5W J;  4Y17 A;  1QZY A;  2K02 A;  3M8J A;  5HVQ C;  2X48 A;  5LEJ A;  2R5Z A;  2DA5 A;  4RAG A;  1HC8 A;  1A6Q A;  2ZXJ A;  1Z6T A;  3BP8 A;  4KIC A;  3HTU A;  1MMN A;  5J1Y A;  1ACI A;  2LF8 A;  1GV5 A;  2LVS A;  1HKS A;  1VQL I;  4ZYE A;  1K6Y A;  3ZR8 X;  3U2R A;  2RC4 A;  1PP7 U;  1ZLJ A;  3VSK A;  2NVQ J;  4CGZ A;  5E17 F;  2R7V A;  1D5Y A;  1K78 A;  2DJN A;  2X6W A;  1X1C A;  2ICW G;  3F0C A;  5E8I A;  3SXY A;  3WGH A;  1OQY A;  4E4H A;  1ODD A;  1MIJ A;  5FD5 A;  4HYE A;  4PJJ A;  1X1D A;  2K85 A;  5JI6 A;  4DYQ A;  1RUN A;  2XPU A;  3SDG A;  2AHQ A;  5L3B A;  2E1C A;  3L2R A;  4EM2 A;  1IN7 A;  1OYW A;  3I59 A;  3B02 A;  4I99 C;  2ZO4 A;  2KKO A;  3NAU A;  3O8G A;  3F9K A;  2VT2 A;  2KIQ A;  2FMY A;  1HKT A;  3IHU A;  3GWZ A;  4PCQ A;  3MVP A;  2KFD A;  1SFO J;  2A6T A;  3HUG A;  3HYI A;  3P7N A;  5ICF A;  1H0M A;  3H9J A;  4Y52 J;  3QOP A;  5KAI C;  1B8I A;  2DOF A;  3TKY A;  1X19 A;  5E79 C;  3AG4 H;  4UB6 C;  1U6G A;  5EG0 B;  2PJR A;  2ETH A;  2CO5 A;  4PJ0 C;  3WTX C;  4D5C A;  2JK3 A;  3I55 I;  3G1L A;  1S5L C;  2B63 J;  2ME0 A;  2HPI A;  3ZQF A;  2W85 A;  1RZ4 A;  3A02 A;  4I76 A;  1A31 A;  5F1R A;  1JGS A;  1QZZ A;  3OOU A;  4JX4 A;  2CRG A;  2K9N A;  3S3N A;  2AS5 F;  4HF2 A;  2HZD A;  2MLG A;  4EV0 A;  3E0J B;  3EYI A;  5DCM A;  1J5Y A;  5JLX A;  2BV6 A;  3VFZ A;  3K1N A;  3F22 A;  2OZ6 A;  3CO6 C;  4KMU X;  5EJC A;  1BIB A;  3TP3 A;  1SD5 A;  2XRN A;  1LDD A;  4L0Z B;  1A6I A;  3LQQ A;  2DFH A;  4CSW A;  6PAX A;  2V4J C;  4Q47 A;  2Z99 A;  2HR3 A;  2M34 A;  4D7M A;  4HEA 2;  2IA2 A;  4M71 A;  2GAU A;  2ESH A;  1T0F C;  4AYB N;  1V5G A;  1FYM A;  3MWM A;  2KLO A;  4MEY F;  4EM1 A;  3F8B A;  1LE8 A;  3DKW A;  3HOU J;  2UXN A;  1O3R A;  2OD5 A;  4RMN A;  1T38 A;  1J2X A;  2CGP A;  2R7T A;  1MNE A;  3QP5 A;  5GAH J;  1K6O A;  3KP3 A;  1G3S A;  3HKZ N;  4II3 A;  2ME6 A;  5K7Z A;  3VOE A;  3IRQ A;  5H6Q A;  3V7S A;  1QRY A;  1T39 A;  2BVL A;  5KCM A;  4C30 A;  2NAZ A;  4XID A;  2DA3 A;  1W0U A;  3K1M A;  3ABL H;  4D0P A;  1Y39 A;  2LKP A;  4AIK A;  2KIF A;  2WB1 A;  5CVJ A;  2H09 A;  5EGO B;  5CQE A;  3CCL I;  4A0X A;  5GP9 A;  2JA7 J;  4M72 A;  1MBK A;  1WQ2 A;  3KP6 A;  1GT0 C;  3GZN B;  4FX0 A;  2E2H J;  2N8G A;  2L7M P;  5J1R A;  5B1B H;  5A2Q K;  5IYB J;  4M3D A;  3BT9 A;  5J8F A;  1BL0 A;  1XGS A;  1ZQ3 P;  3OSF A;  4XON A;  2FNP A;  1CGP A;  1TQP A;  3KEY A;  1L3L A;  1S7E A;  5TJJ A;  4FHT A;  3WU0 A;  2D5V A;  2Q2E A;  4BBR J;  5IP7 J;  2B9S A;  2JRT A;  2X85 A;  2BVM A;  1F1Z A;  3K6G A;  3ZMV A;  3GTO J;  2KHM A;  2ZFW A;  3K2Z A;  5TGT A;  3BPV A;  3M8E A;  2X0L A;  3CES A;  4QPQ A;  5HLH A;  3SQN A;  3HGG A;  3DP7 A;  2LBF A;  1YJW I;  3H3U A;  3CC2 I;  2EIJ H;  3JRD A;  1LJ9 A;  3G1O A;  4BAC A;  1VQM I;  4PFP A;  5CKT A;  1YIT I;  2JA8 J;  3DU6 A;  2ESN A;  3GF2 A;  2IA1 A;  4G7O F;  3C18 A;  2VPR A;  1VQ7 I;  3OSG A;  4B44 A;  1VQ5 I;  1PUF B;  3HOV J;  3ZOB A;  3S16 J;  4AM3 A;  3I3L A;  2HEO A;  1QQI A;  3C1D A;  3SFZ A;  2H8R A;  4BY7 J;  3TO7 A;  3KYL A;  4HSR A;  1U3E M;  1JGG A;  1SFX A;  1XDU A;  2XGD A;  1N25 A;  2DK5 A;  4OIP F;  2O7O A;  3AKZ A;  5BPD A;  2MFZ A;  5A2Q Z;  3LST A;  1MW7 A;  3P9C A;  2KP6 A;  2WY8 Q;  3ERE D;  1S9H A;  4GGG A;  1G4D A;  5C4X J;  2P7V B;  4XN0 A;  5CVU A;  1WJC A;  1AWC A;  4ABZ A;  4B3X A;  1SAN A;  2GM4 A;  2F5C A;  2P7C B;  2CQ7 A;  2XAJ A;  1X4O A;  2YSR A;  3FXL A;  3FZV A;  1TQI A;  1I27 A;  2CUE A;  2M45 A;  1VND A;  4EJT A;  2LH9 A;  3CLQ A;  1JTY A;  2RRE A;  2VQH A;  2P5V A;  4B43 A;  4ETS A;  3FKI J;  2UZK A;  4EJO A;  3KX2 A;  5FRN A;  2E2I J;  2HYJ A;  4HBL A;  5AON A;  4IJA A;  5F0H A;  3K7A J;  2M0M A;  3ULQ B;  2NXN B;  4KIF A;  2DMU A;  4XOP A;  5FKM A;  3OYB A;  1YI2 I;  2KJC A;  4RGS A;  4KIB A;  3B73 A;  2E35 A;  2V1D A;  3OL3 A;  4NC8 A;  5DUK A;  1ZRC A;  4I7H A;  2VB6 A;  1U9N A;  1IXS B;  1FP2 A;  4MIM A;  2BZT A;  3S2W A;  2E60 A;  4E7L A;  5CJ9 A;  1B72 B;  2VC0 A;  3VOD A;  2ELH A;  4M3F A;  4CZZ A;  4MTD A;  3OMY A;  1QGP A;  5B66 C;  1YS7 A;  3QAH A;  2H6C A;  2IP2 A;  3U1D A;  4IHT A;  3QU6 A;  2CW0 F;  3KZI C;  5C4J J;  2H1K A;  1S29 A;  3CJT B;  2MC3 A;  2NYX A;  4PJN A;  3EUH A;  4EJV A;  3JRB A;  1JKR C;  2FBI A;  4DJA A;  4A0Y A;  2NVY J;  1TWF J;  2PG4 A;  2H6B A;  1JJ8 C;  2R7O A;  5FKN A;  1KU2 A;  2PEX A;  3CTA A;  4RAY A;  3PQJ A;  3RSN A;  2QSH X;  1IAW A;  1YE9 A;  2RN7 A;  2GXA A;  3IWZ A;  5F08 A;  5ILS A;  3J7A O;  3G1M A;  2A61 A;  1MD0 A;  4BJT A;  4C2T A;  3HEF A;  2QQB A;  1WWX A;  2FOK A;  1IJW C;  3OIQ A;  1WJF A;  4UHT A;  2HFH A;  3DCF A;  2XGX A;  3LAJ A;  1V5F A;  1T98 A;  3H36 A;  3ZQC A;  1ON1 A;  1T6S A;  1OJL A;  3VB2 A;  1E3H A;  2XF6 A;  3DQV C;  4G8X A;  2JSP A;  2ZXI A;  3HL2 A;  2M8E A;  2IVM A;  1AOY A;  2JA2 A;  5FFZ A;  2HXO A;  5F27 A;  3I4M J;  4HW0 A;  2ELJ A;  1ZAR A;  3EDP A;  1G8X A;  1O4X A;  2XV4 S;  1E0E A;  2WC2 A;  3BTL A;  1YJN I;  4BXX J;  2FXA A;  5LRS A;  2V1X A;  1VF9 A;  2JWT A;  4P96 A;  4XK4 A;  1W5T A;  2Y9Y A;  3OYE A;  3QYE A;  1HST A;  4ESF A;  2JN6 A;  4HOB A;  4BBS J;  1MMA A;  3H35 A;  4ZYD A;  3F3X A;  5B5E C;  3ABT A;  4LOC A;  2DTR A;  3B6A A;  4W97 A;  4HQM A;  3O2P E;  4HNT A;  1K83 J;  3W3C A;  3IWF A;  2IW5 A;  2K3F A;  3LA2 A;  3KIO A;  3V8J A;  3L7W A;  2WB1 N;  5HOD A;  1IRG A;  2DA7 A;  1YLF A;  2OCC H;  2DMQ A;  2UV1 A;  4IEJ A;  2O8K A;  1QNT A;  4II2 A;  1AU7 A;  4JK1 X;  1RR8 C;  4UV9 A;  2E5N A;  2QEN A;  3U1K A;  4EVI A;  1W1W E;  4DYR A;  1HQC A;  3F72 A;  3SFI A;  4GRI A;  4XRS G;  3AAF A;  2HNH A;  2L9S A;  1S3J A;  1JT0 A;  2WY7 Q;  2BY1 A;  2DMT A;  4LIT A;  2HTS A;  2Y0S A;  2BBY A;  3ASO H;  5CVR A;  1IDY A;  1JXS A;  3FDY A;  5IT9 K;  1QBJ A;  1VQO I;  4O5V A;  2KJB A;  4C9Y A;  3GFL A;  3RPQ A;  1JT6 A;  4NC7 A;  4EAT A;  3HSR A;  2O6G E;  3HHH A;  2E7W A;  2LMD A;  1EA3 A;  1WRJ A;  4QIW N;  2XDV A;  2Q0O A;  4KT6 A;  4RAZ A;  1TC3 C;  4B09 A;  4QLC U;  3JRF A;  1P6R A;  2CYY A;  1ZAO A;  2DQR A;  2JPB A;  3BZK A;  5EG0 A;  2ZJP F;  2EBI A;  4ESJ A;  2DT6 A;  2RV8 A;  3A4C A;  1TT5 B;  2KIS A;  2M8G X;  4IKF A;  3BR6 A;  2NVT J;  2HI3 A;  1MGT A;  1I39 A;  3AG1 H;  1BR4 A;  3R4K A;  1R71 A;  5ILU A;  2PN6 A;  3BCB A;  3DKX A;  4QTR A;  2R92 J;  4K2E A;  5LHH A;  3QPS A;  2CUZ A;  2ACJ A;  2COM A;  2H1L A;  4F55 A;  4KIS A;  1K61 A;  3I54 A;  1R23 A;  4LJZ F;  1FTZ A;  2HDW A;  2VBW A;  1ZGA A;  4HPQ A;  1HOM A;  1RKW A;  2DYR H;  3OYL A;  4UVA A;  2VOD A;  1BJA A;  2OQR A;  1EH6 A;  3UNG C;  3ML6 A;  5BOX A;  4D9J A;  4DQ2 A;  2FE3 A;  2HGC A;  4V2F A;  4I6Z A;  5EF6 A;  2BOL A;  2CV2 A;  1I1S A;  1Z7U A;  3T8R A;  1E3O C;  1U5T C;  5M5X J;  5KNL A;  3KPH A;  2DFF A;  4CH7 A;  1RIO H;  3HXL A;  5DDG A;  2K3P A;  2BHZ A;  2BGC A;  1VQ9 I;  2R7U A;  4M9X A;  1D0Y A;  3WG7 H;  4YFX F;  2KIU A;  4HZF A;  2C6Y A;  1RKT A;  5ERI A;  1AHD P;  2CQK A;  1OIS A;  4IQJ A;  3PSF A;  2E34 A;  3O6B B;  4UVB A;  3I5U A;  1YW9 A;  5EGO A;  2FF4 A;  1D5V A;  4CYD A;  3K1P A;  3LA3 A;  2VON A;  3H3Z A;  2X1E A;  4OMY A;  4AWX B;  4I01 A;  4YEL A;  1UHM A;  3N97 A;  1I3A A;  4A3I J;  3ZP5 A;  4KA4 A;  3TOB A;  2AO9 A;  4U0W A;  2LTP A;  4L5J A;  2EFW A;  2MD5 A;  4HX4 A;  4DBQ A;  2FJ1 A;  2OTL I;  3DPL C;  2GA2 A;  1JUM A;  4KT5 C;  5DEQ A;  4E7H A;  1IN8 A;  3BR5 A;  3I71 A;  2JJ7 A;  1MBH A;  3HTS B;  2CQX A;  4LD5 A;  1ETO A;  4YRV A;  4M9S A;  4KJZ A;  2VKD A;  1VTN C;  3OIO A;  5AIQ A;  2DMN A;  2MH2 A;  5HDK A;  2TDX A;  1OCP A;  2L3D A;  5DD8 A;  2X1D A;  3HOX J;  3DEW A;  1YW7 A;  3LOC A;  3ESW B;  2J5P A;  3PM1 A;  1A36 A;  2VJJ A;  3RYR A;  5JHF A;  1EH7 A;  1WVR A;  3DTK A;  3E5U A;  4IF4 A;  4CHU A;  3BRO A;  5LRR A;  4H0E A;  1BI3 A;  1IZ1 A;  4AC0 A;  4BH9 A;  4XQF A;  1ZYR F;  1MBG A;  1PUF A;  1GHC A;  4HQE A;  4LLG F;  5D6E A;  1FYK A;  4Y3O A;  3MZY A;  3RPU D;  1I1G A;  3S8P A;  1ZG5 A;  3E3V A;  1XTA A;  4Y33 A;  1FY7 A;  2LY9 A;  1PJR A;  4C2M J;  1MBF A;  2Z16 A;  1FEX A;  3H9G A;  2MW8 A;  2UUZ A;  4Q48 A;  1ORK A;  2ZXH A;  4YEJ A;  1XS9 A;  2F6C A;  3EET A;  4RAF A;  5M3M J;  2V6C A;  1REP C;  3FBI B;  2L2O A;  5LLQ A;  4M3G A;  3WOD F;  1S8N A;  3MKZ A;  4AUX A;  5K1Y A;  4B3A A;  2VUM J;  1Q1V A;  2EFQ A;  4XKW A;  3CC4 I;  4JYK A;  4U88 A;  2H94 A;  3WTY C;  2WTE A;  3BR3 A;  2ZNZ A;  1XN7 A;  2W00 A;  3H5N A;  4GCV A;  2XAG A;  1I3Q J;  2BXY A;  2CU7 A;  2R7D A;  2R93 J;  3V8K A;  1LDK B;  4CYC B;  4A5N A;  1OCC H;  4DNC A;  4M74 A;  3QOD A;  2NOJ B;  3EUK L;  1DUX C;  3BJA A;  2RNG A;  2XGC A;  4L9V A;  4B48 A;  1FOK A;  3DPU A;  5HOO A;  4JX6 A;  2XPW A;  3CMA I;  2HQN A;  3CJQ B;  1C0W A;  2QSG X;  2W48 A;  2HZT A;  4N4O B;  3ERM A;  1B72 A;  3GTQ J;  2ISY A;  1JE8 A;  1MBJ A;  4DOZ A;  4ZDP A;  5J4Y A;  4MQ9 F;  2L54 A;  2L7K A;  5D4S A;  3K4K A;  2ZCW A;  3S3O A;  2F4M B;  3WHC A;  4ASN A;  1OCO H;  1SFE A;  3WTS C;  3VWB A;  2F4I A;  4HV5 A;  2EZL A;  1Y56 A;  3FM3 A;  4BUP A;  5L3C A;  3ZCO A;  4RLQ A;  2J5O A;  4YFK F;  3AFH A;  5HLT A;  1WZ2 A;  2EPF A;  4KNY A;  2RGV A;  1G59 A;  4WX9 A;  5HDN A;  3E5Q A;  4WK8 F;  2CUJ A;  3QPT A;  1R22 A;  1R9T J;  2WV0 A;  4C3J J;  1MZB A;  2VN2 A;  2XF7 A;  2KQR A;  1WFX A;  1XGO A;  3M07 A;  1PDN C;  4RM2 A;  3LQR A;  1TWA J;  2FD5 A;  2ZBK A;  1XC5 A;  1AA7 A;  1N75 A;  2E1N A;  2G9W A;  1OYY A;  3OYK A;  3HOT A;  4HAM A;  1HF0 A;  4FT8 A;  4BHP A;  3FWE A;  1SD7 A;  2FX0 A;  1P7J A;  3GW2 A;  3U9G A;  3CCV I;  4JQF A;  2WAD A;  2ZFU A;  1O3Q A;  2JVG A;  3G3Z A;  2VKE A;  2Y48 A;  1KQ0 A;  3MCZ A;  1YX5 A;  2R7W A;  3OOP A;  2TRT A;  1FMW A;  4NB5 A;  3M1E A;  1K4S A;  3DPT A;  1POG A;  2LOO A;  2FQ3 A;  3K4N A;  3DEE A;  2DMP A;  5H20 A;  5M5Y J;  3TQN A;  3LSP A;  1MND A;  1FPQ A;  4OWR B;  4G7H F;  2A5W A;  2PMZ A;  1S72 I;  1Z67 A;  1H89 C;  2MG4 A;  3M4O J;  4P9F A;  1TT0 A;  1DGR M;  1JI8 A;  2V26 A;  2VE8 A;  1O7F A;  1R5G A;  2XKO A;  2Y2Z A;  5KK1 A;  1X3W B;  3H5A A;  2HYF A;  2ZC2 A;  3Q0V A;  5E20 A;  3FMS A;  3HG9 A;  2L01 A;  5K5R A;  3JRG A;  1T0F A;  2E2J J;  3FF5 A;  4C2U A;  1MDM B;  4NBQ A;  1B6A A;  1Y1W J;  4DYC A;  4XRS A;  2HWV A;  3MKW B;  4IHX A;  2EFP A;  1JUS A;  1WSU A;  4XLC A;  5DD4 A;  3JRI A;  4XOR A;  3C2B A;  5FRM A;  2HTJ A;  1R6R A;  4C3I J;  2OF7 A;  1U5T B;  1D8J A;  3E6C C;  4G6T B;  1T95 A;  3SYT A;  3WU2 C;  5CQG A;  4BQO A;  4ZYH A;  2FSW A;  2ZNY A;  4N9I A;  4B8X A;  3FXJ A;  3MZH A;  3QYF A;  4BXF A;  3FK6 A;  3HSE A;  2O03 A;  2PMU A;  1TL8 A;  3T1B A;  1HDD C;  2KRH A;  1YIJ I;  2L9V A;  1B1B A;  3GTG J;  3RZO J;  3OYF A;  3LNQ A;  1LFB A;  1H9T A;  2EH3 A;  3KCC A;  2WV1 A;  3IRR A;  4FTH A;  3EPZ A;  4E6K G;  2HYG D;  3AG3 H;  3E7L A;  3S2D J;  4CCM A;  1QZE A;  3HHG A;  4S0H B;  1WJD A;  2OAZ A;  2X1C A;  1IC8 A;  5BNG A;  2YU3 A;  4U87 A;  3NRV A;  1T8I A;  1PP8 F;  2Y75 A;  2STT A;  4LB5 A;  2YPR A;  1ZG3 A;  4BL0 B;  2M4G A;  5F0C A;  3HC7 A;  4GO1 A;  5E18 F;  2W7N A;  2E36 A;  3DV8 A;  2Y31 A;  4PSX A;  3GFJ A;  2GIZ A;  2QKL B;  3ABU A;  3DBR B;  4KIG A;  1ON2 A;  2MYS A;  1TW2 A;  5E3L A;  1ETK A;  2CQQ A;  2DXI A;  4OIO F;  3C7J A;  3F8F A;  2M9H A;  1MJB A;  3Q0U A;  5DTD A;  1K79 A;  5GAD J;  1R5H A;  2JUC A;  2XKP A;  2LYC A;  5CYV A;  5D5W B;  1ETQ A;  2RNJ A;  2MAB A;  1UHW A;  1GLN A;  4IHW A;  2QF7 A;  2A6H F;  3D0S A;  2FA5 A;  3R0J A;  3W6J B;  4DBR A;  1EH8 A;  4X1E A;  3MQ0 A;  4R8H A;  2K4J A;  2NVX J;  2PX9 A;  1LFU P;  4HF1 A;  3LSH A;  4X6A J;  1WKM A;  3I0T A;  2DW4 A;  4BJ6 C;  3BG5 A;  2OCE A;  2JVH A;  1P7I A;  3KP7 A;  3M7G A;  3MEX A;  3GZ5 A;  2ECC A;  2VBZ A;  2RKH A;  3CCQ I;  1P9Q C;  2GBY A;  3HPG A;  2BY3 A;  4XLA A;  3KYD B;  1HA8 A;  3JRC A;  1R5I D;  3VYS B;  3N4M A;  3A03 A;  4XM3 A;  4IHS A;  3HJE A;  2PQ8 A;  4MEX F;  2O5R A;  1LVA A;  1Z6R A;  4IZZ A;  4EJW A;  5L3E A;  4MO7 A;  1G3W A;  3VYT B;  2R0Q C;  3GLL A;  2GOM A;  2VKH A;  1JJ6 C;  2Z1D A;  4QPO A;  3BZ6 A;  1SC7 A;  3H9Q A;  4OAZ A;  1MSE C;  4LMY A;  4MTE A;  2W84 A;  2DTZ A;  4PJL A;  1MH3 A;  1G3Y A;  3CP8 A;  2IGK A;  3TGN A;  3A1Y A;  2DBB A;  1FOW A;  2MH9 A;  2WAE A;  3ECO A;  1YJ9 I;  4JX5 A;  5EZG A;  1MNM C;  2BW3 B;  3AG2 H;  4ZDL A;  2V1N A;  1HW2 A;  1OR7 C;  2DK8 A;  1FMV A;  4CIC A;  2IPQ X;  3FXR A;  1IN4 A;  2R5Y B;  3COA C;  4HNV A;  1TZL A;  3BPX A;  1ERD A;  1EF4 A;  3KET A;  2LDU A;  3W2V A;  1BR2 A;  2R7Z J;  2HVR A;  3LSJ A;  2JRM A;  2XAF A;  3BY6 A;  2OUM A;  3IP4 B;  5ED4 A;  4I09 A;  3RKY A;  4E7J A;  2K9Q A;  2CV1 A;  5EEH A;  3LWF A;  4WXC A;  3J7Z I;  4M6V A;  4RGX A;  5LGT A;  2HVS A;  2D1V A;  3U21 A;  1B4A A;  1XMX A;  3V42 A;  2DA2 A;  4PDK A;  4C3H J;  5FLV A;  3Q5F A;  3HDD A;  1WH5 A;  1ZR2 A;  2ADU A;  4IRH A;  2I8D A;  5K5Q A;  1MSF C;  3C2H A;  2RDP A;  1NG6 A;  4BQN A;  4BHB A;  2HOE A;  3FMQ A;  1T56 A;  3M9A A;  2HOA A;  3S1M J;  3SEZ A;  2PMZ N;  3KEQ A;  2AQE A;  5AIP A;  4CYC A;  3DKY A;  5F6F A;  1OCR H;  4BU2 A;  1T33 A;  1WCM J;  3IC7 A;  1O7L A;  3GLX A;  1RNL A;  1V54 H;  5FD6 A;  3BR0 A;  3TP0 A;  2L9R A;  2E1M C;  1LNW A;  1YO5 C;  4DZP A;  1UB9 A;  2KZV A;  4BY1 J;  3PIP F;  4CXF A;  1LDJ A;  1XCV A;  2E19 A;  4LK1 F;  3T8T A;  3UKG A;  2CMP A;  5B1A H;  1ETX A;  2GA1 A;  3S1N J;  4DZJ A;  3LSI A;  3CCJ I;  2FUG 2;  4ZJZ A;  5L3F A;  4O6J A;  2XAU A;  1KA8 A;  2Z9O A;  3HIF A;  1UG0 A;  3Q3S A;  5IOY A;  3MN2 A;  1USS A;  1UEL B;  1XGM A;  4M3E A;  5JFR A;  2ZME C;  9ANT A;  4ZYG A;  2DOE A;  2KT0 A;  5KAF C;  3F23 A;  3Q9S A;  2VXD A;  4RA2 A;  1ETV A;  2XAQ A;  1FOX A;  4XL9 A;  1Z7L A;  4WXH A;  2EZK A;  4XR6 A;  4MFE A;  4NNJ A;  3K4J A;  4DGW B;  4LK0 F;  1NK3 P;  1EJ9 A;  4N9H A;  5DM6 F;  3PO3 J;  4HF0 A;  3JR9 A;  2R7R A;  4RLF A;  5BPI A;  2XRL A;  4S04 A;  2AXT C;  1R7J A;  3HRT A;  1LEB A;  2Q8K A;  4Z2Y A;  2JQ7 A;  1PYV A;  4OU0 A;  3WG9 A;  3P9I A;  4LLN A;  2QWW A;  1I6X A;  3CQZ J;  3S93 A;  3HGY A;  3ZMU A;  2HQ5 A;  1DGW Y;  3OIP A;  1A35 A;  1IUY A;  3D5S C;  3K9T A;  3ZMT A;  2V9K A;  1ONV A;  3DU5 A;  1XB4 A;  1F43 A;  1CF7 B;  2XB0 X;  5FJ8 J;  3GZ6 A;  5EEG A;  3FHN A;  3JRH A;  5K5O A;  1XSD A;  1BM9 A;  2LD5 A;  4EJU A;  2EIL H;  4P1W A;  1K4T A;  3BCA A;  3CCR I;  3IH3 A;  2QKM B;  3BDD A;  1KQ8 A;  4IQ4 A;  1IGN A;  1QPM A;  3RYP A;  3K4B A;  4LLL A;  2EJR A;  5IP6 A;  4A3G J;  1TW3 A;  1J7K A;  3ZMZ A;  2WA0 A;  3DTE A;  2EA4 A;  2IAI A;  3Q0W A;  4JP0 A;  1QHH D;  3JSP A;  4XLN F;  1M1E B;  2OU2 A;  3OYJ A;  1WJB A;  1K7A A;  3ZQG A;  2EIM H;  1WH7 A;  2OA4 A;  1X3U A;  1FIA A;  1FWZ A;  3CDL A;  3OV8 A;  5HDG A;  4BEH B;  2HOT A;  1FOY A;  1IRF A;  5FFX A;  5LHI A;  1J0R A;  2XF5 A;  2YR2 A;  3PQK A;  5FKL A;  4XKB A;  1TNT A;  3T5X A;  3A01 B;  1JHF A;  4BJ5 C;  1W5S A;  2TCT A;  4ENN A;  4CCL A;  2LSO A;  3ROU A;  2VJ5 A;  4NQW B;  2HDC A;  4IOC F;  1GDT A;  3QRF F;  1WJ5 A;  1IO2 A;  2JTV A;  2RQQ A;  1MDM A;  1KQ9 A;  1F9N A;  4I0A A;  5JHU A;  4BAY A;  3KP4 A;  2NVU B;  5JLW A;  4XIC A;  2Q1Z B;  1KZH A;  5IY5 H;  1Y6I A;  2EK5 A;  3TDU C;  1UMQ A;  2X6O A;  1N78 A;  3J7Y J;  3K4L A;  2P5K A;  3S1Q J;  2NNY A;  1U5T A;  5DCF A;  4ZH4 F;  2ZSH B;  4TV7 A;  3MFK A;  1GVJ A;  5D5X B;  4UV8 A;  3HOY J;  1WPK A;  2MSY A;  3WU1 B;  1W7P D;  2Z33 A;  4ESB A;  1WHU A;  5L3G A;  2EFO A;  2A69 F;  1D0X A;  4CA0 A;  1ETY A;  1U2W A;  3HPH A;  3I9V 2;  1MH4 A;  3CDH A;  3E97 A;  3L2U A;  4MFD A;  1IN5 A;  5FLM J;  3ZMD A;  2E7X A;  3RKX A;  2W4S A;  2K40 A;  4GDF A;  4M73 A;  1ZGJ A;  4I02 A;  1BC8 C;  4UNO A;  2CW7 A;  3GFI A;  2V79 A;  2IT0 A;  2DA4 A;  5IT9 Z;  3RIR A;  2GQQ A;  2QSF X;  1U0J A;  4J00 A;  4XLF A;  3J80 K;  1UZC A;  2Y9Z A;  1RES A;  5K7F A;  3L1P A;  4RS8 A;  1X3Z B;  2P6T A;  4B47 A;  3GTK J;  1FX7 A;  3WHB A;  1VZ0 A;  1STZ A;  2XAS A;  2CFO A;  3BG7 A;  5E1X A;  4NC6 A;  3KEO A;  1R49 A;  4FX4 A;  1B9N A;  1OFC X;  3ABK H;  4EEF G;  4FE7 A;  2P4W A;  2KDZ A;  3RQI A;  3CC7 I;  3PJR A;  2IXS A;  1WJE A;  2LRE A;  4XLP F;  5EZH A;  1TBX A;  5EDN A;  2GWR A;  2X51 A;  4XBF A;  4A5M A;  2GXG A;  3G2B A;  4NUB A;  2EV6 A;  4HLY A;  2F2E A;  3A2K A;  1WI9 A;  1XPX A;  1BI1 A;  4UUT A;  1P4A A;  1SVO A;  3SZP A;  3WTV C;  4DIQ A;  3EUA A;  3OY9 A;  4EGZ A;  2DDA A;  4FE4 A;  4Y13 A;  3W6V A;  3JW4 A;  3V7C A;  1SEU A;  2EIN H;  2Y0M A;  2OPT A;  3RKQ A;  3LA7 A;  3W2W A;  2QLZ A;  3TDZ C;  2QBY B;  1Z9C A;  3W6K B;  2VIX A;  3OS2 A;  2OZU A;  1SMT A;  2FEZ A;  1BOA A;  4L9T A;  3PFI A;  4PZJ A;  2QQA A;  2XVC A;  1YRN B;  3J80 Z;  2XSJ C;  1HSJ A;  5D6F A;  4RDU A;  3KLO A;  4PJM A;  4ENM A;  2BXZ A;  1DPR A;  1ZN2 A;  1MKM A;  3IV5 A;  4FET A;  5D5U B;  1VQN I;  2VBY A;  3CCE I;  4LB6 B;  2HKO A;  4RB0 A;  1KGS A;  5L3D A;  1P4W A;  1BJZ A;  4EGY A;  1HXD A;  2LC2 A;  5FKO A;  3RPU A;  3H0D A;  3D5R C;  3X2Q H;  2QQ9 A;  5GAE J;  3SEQ A;  3I4P A;  3MKY B;  1Y0N A;  1I6H J;  2HU9 A;  1V4R A;  4G94 A;  3DLL F;  4FAS D;  3EYY A;  1YQA A;  1RC9 A;  3C2G A;  1YYV A;  4OIN F;  4E7S A;  2EA2 A;  1IW7 F;  3PNY A;  4RB1 A;  1SVM A;  3VDX A;  2QGU A;  1J59 A;  3G73 A;  2L7F P;  4XLE A;  2MA3 A;  3H92 A;  2BW3 A;  2Z5U A;  3JRA A;  4PUS A;  4KN7 X;  5DS9 A;  3MZ8 A;  5C3E J;  1FZP B;  3N05 A;  3IH2 A;  3A0B C;  4G6D A;  2E1M B;  4U7D A;  1W4M A;  2JSC A;  4IRG A;  1X2N A;  1YX3 A;  3A0H C;  3F6O A;  3LSR A;  3CJN A;  2R5Y A;  2OC6 A;  3DEU A;  2F4O B;  2EQR A;  4BXU A;  4RB2 C;  3D5L A;  4YII A;  1H88 C;  2I10 A;  1N77 A;  4Q4Z F;  4PK4 A;  1U8R A;  2CSO A;  4MGR A;  3LSG A;  4NDL A;  3GFM A;  3SJM A;  1FLI A;  1RI7 A;  1WI3 A;  1SFK A;  2ZME B;  3DTI A;  3RCO A;  1LB2 A;  2QM3 A;  2VKV A;  1BIA A;  4E7K A;  1OLT A;  1ETW A;  1JTX A;  3BQY A;  5C44 J;  2QEX I;  4ZDO A;  3OL4 A;  3ECH A;  4AD9 A;  4U7B A;  3R60 A;  1FIP A;  1BR1 A;  4E7I A;  5IP9 J;  4OOI A;  1D1A A;  4A93 J;  1BOB A;  4ENK A;  1ENH A;  2AQF A;  3TOA A;  1G2H A;  5CVV A;  3GUD A;  3IKT A;  4B1R A;  4XRM A;  3HOW J;  1IV8 A;  3CUQ C;  3H1C A;  2FU4 A;  2Y0S N;  1RET A;  3PIO F;  3BG3 A;  3C3W A;  2IA0 A;  3CCU I;  4PSW A;  2FNA A;  4QSH A;  1TP4 A;  2EV5 A;  2DT7 B;  3PFY A;  2G0E A;  4LG0 B;  4F52 A;  4I2O A;  2V6E A;  1LVK A;  3PNT A;  1BW6 A;  2DU9 A;  3OWT A;  1H8A C;  2LG4 A;  4X0G A;  2K4B A;  3HSF A;  3PNV A;  1O3S A;  1SD6 A;  3BG6 A;  2CH0 A;  3DBL B;  3VPR A;  2IS2 A;  4NHJ A;  4UY8 I;  3WTU C;  2A68 F;  2PFB A;  3TO9 A;  4WXD A;  4N4N B;  1V55 H;  3LL7 A;  1SVL A;  4GFB A;  4YFN F;  2DN0 A;  5FGM A;  3JSO A;  5LEK A;  1J09 A;  3F6V A;  1B9M A;  4P55 A;  4R79 A;  1EV7 A;  2L4A A;  4BGD A;  2P6S A;  4HDU A;  2R7X A;  2W25 A;  2CG4 A;  4RB3 C;  3IAM 2;  4QWQ A;  3ZRG A;  2VQG A;  4GXO A;  2JZY A;  2WWY A;  3RQ4 A;  3QQA A;  3FXK A;  2BHY A;  4U0V A;  5FKK A;  2DPD A;  1RUO A;  4XOT A;  2OTJ I;  2FQ4 A;  3KP2 A;  2M1B A;  3OR1 C;  2HKX A;  5B3S H;  2LR8 A;  2VQC A;  2VT3 A;  4WCG A;  2RQP A;  3JTG A;  4UUS B;  1GUU A;  2FOW A;  4H4K C;  1FT9 A;  2QZ8 A;  1R1V A;  4HV6 A;  4IPA A;  2M4K A;  4HLX A;  4IHV A;  1T2K A;  2DPU A;  2COB A;  4XKC A;  1FBQ A;  3FM5 A;  3E6M A;  3BR1 A;  1B59 A;  1UST A;  4DW6 A;  1CF7 A;  1X4P A;  3BLY A;  1HW5 A;  2NS0 A;  4KN4 X;  1Z05 A;  3HB9 A;  2YUS A;  2EV0 A;  1IXC A;  4WWC A;  2BY2 A;  5K7H A;  4M3B A;  1TTY A;  1UFM A;  3VEP A;  3FMR A;  2X6X A;  3R6S A;  4BHC A;  3CCM I;  2PJP A;  3NWT A;  2EWN A;  2WAQ A;  4ZZD A;  3QP6 A;  2K9S A;  1BBY A;  1XG1 A;  4OAY A;  4M9Z A;  1ZR4 A;  4WF2 A;  1V5E A;  3GEZ A;  5F1J A;  3DF8 A;  4BEH A;  4A3F J;  2AXL A;  3OYI A;  1W7P B;  3ZN0 A;  1IV6 A;  3K0L A;  3M3Y J;  1FC3 A;  3ZXS A;  3A01 A;  2KMU A;  2CUF A;  4KYW A;  3MMY B;  4CCK A;  3P9K A;  4A69 C;  3QPL A;  1X1P A;  2M87 A;  3DBH B;  1A5J A;  4NQW A;  2V1U A;  1Y1V J;  1Z3X A;  1ZGW A;  1J75 A;  1E2X A;  4A3B J;  4L5E A;  2FBK A;  4HDV A;  1U8B A;  4UB8 C;  3RJP A;  2R3S A;  4ITV A;  4BS9 A;  2STW A;  1MMD A;  5HNF A;  4L5I A;  2F5F A;  2P8T A;  3PL8 A;  3H5R A;  4Y7N J;  4A3J J;  3ZQQ A;  3OS0 A;  3HRS A;  5D8K B;  4JOM A;  2W57 A;  3GTJ J;  2GIV A;  3CUO A;  3I53 A;  5LBQ A;  1VQ6 I;  1XCB A;  3S14 J;  3I58 A;  4ZTF A;  5IYD J;  2HQR A;  2BE5 F;  2XPV A;  2KPM A;  2DFI A;  5BQT A;  2DQL A;  2NRA C;  2NS7 A;  2PMH A;  1X1B A;  1XGN A;  1SMY F;  3CP2 A;  3FKJ A;  5D8L B;  4L18 B;  1OKR A;  5ICG A;  3S17 J;  4BNC A;  5TIS C;  2DI3 A;  4CZC A;  2A6E F;  2ID6 A;  2EB7 A;  4AIJ A;  2CJJ A;  2RVC A;  3RKW A;  3BZC A;  1HDP A;  3CME I;  4M6Y A;  3UR3 C;  1KU7 A;  2D1H A;  3D1N I;  2D45 A;  2K86 A;  2VJ4 A;  3TO6 A;  2P5L C;  5F0F A;  1WJA A;  3ZGK A;  2FML A;  2DO7 A;  4UXN A;  4I0B A;  3BWG A;  2E5Z A;  4A3E J;  2VOO A;  3HZJ A;  3KYC B;  4P9U A;  3CJR B;  4MHG A;  2IGM A;  4LGW A;  1H9G A;  3E5X A;  1DDN A;  2F5D A;  5BMZ A;  1TQM A;  3L00 A;  4F92 B;  5FB2 A;  1HKQ A;  3BQZ A;  1LFP A;  2A5Y B;  2KRF A;  4JBA A;  1XSV A;  2F5V A;  2HXI A;  3F8C A;  4L9J A;  3JRE A;  2LRD A;  1DU0 A;  1U9O A;  2H27 A;  4L9N A;  4EQQ A;  1OR7 A;  1WGX A;  3R0A A;  1RR7 A;  3L2Q A;  4IHY A;  2L02 A;  1YHQ I;  4E7Z A;  3GYH X;  3LFU A;  2VI6 A;  1O3T A;  2Y69 H;  4AU7 A;  1FNN A;  5EYR A;  4XSZ F;  3OYA A;  3ABM H;  2HDD A;  2QBY A;  1QVU A;  3BJ6 A;  3GVA A;  4PGH A;  3L2C A;  1VFC A;  3KZY A;  3L9F A;  3CF5 F;  2LKS A;  3G71 I;  3GCM A;  4Q5S F;  1YW8 A;  2R4G A;  2XRO A;  3BG9 A;  1YRN A;  3HOS A;  1X2M A;  3KZZ A;  5J4V A;  4KFC A;  1CQT A;  5CPR B;  4BE2 A;  3CLO A;  3EQL F;  1NK2 P;  3IUO A;  5IPA A;  4A0Z A;  2XB5 A;  2ZJR F;  3BTC A;  4Y15 A;  1D1C A;  1Z21 A;  1QHG A;  3AL0 C;  4I98 B;  3HRM A;  4G9Y A;  1SAU A;  3QWL A;  2JPC A;  1QA6 A;  1YFH A;  2VQL A;  3ISP A;  1ULY A;  3CUQ B;  3RI4 A;  1ZRF A;  3L2V A;  5J6X A;  1KON A;  5F04 A;  3S15 J;  2V7F A;  2M7B A;  2ZB9 A;  2JMW A;  1ITY A;  1DU6 A;  4XMY A;  2CW8 A;  3GXO A;  1HCR A;  1R1U A;  1J9I A;  4V2G A;  5FLX K;  5J47 A;  3FIW A;  3QOE A;  5GTI C;  1D0Z A;  1I5Z A;  2GOX B;  3MAJ A;  3RDI A;  4IO9 F;  5JVG F;  2DLL A;  2ELK A;  5E1Z B;  4Y4R A;  2XHK A;  1W36 D;  1IRX A;  1AKH B;  3F8N A;  2JUG A;  2GXB A;  2M5W A;  3QPH A;  3I4N J;  3J7A Y;  2BEO A;  5H2F C;  2OJE D;  2IS6 A;  1UAA A;  1UG2 A;  3IH4 A;  2F5E A;  1IDZ A;  1IUF A;  2LF7 A;  3PO2 J;  2V9P A;  2M2E A;  2M0C A;  2MGQ A;  3ELK A;  3BJO A;  4IXA A;  3SZT A;  1TWH J;  2XSD C;  1FJL A;  3ZPL A;  2IBD A;  4A3L J;  5IOZ A;  5IYC J;  3V8L A;  4XSX F;  5E3M A;  1D1B A;  1E17 A;  3O3K A;  2KIM A;  2X6Y A;  2E71 A;  4G6Q A;  2EZI A;  3FXU A;  1MJA A;  3DLA A;  2ZME A;  3TL4 X;  1DPU A;  2DT5 A;  5LGN A;  3K4C A;  4LFU A;  4MQV A;  2ZKZ A;  5HLI A;  2MD0 A;  1W36 C;  1IN6 A;  1MJ9 A;  4KIT B;  1PUE E;  4U0Y A;  1V3F A;  1Y0U A;  4OIR F;  4LIV A;  3BTJ A;  3ZQ7 A;  3GX4 X;  3ZQH A;  3REO A;  1ZK8 A;  2WAQ N;  2X9D A;  1DP3 A;  1LEA A;  1HLV A;  1F36 A;  1R00 A;  4RM3 A;  2VAS A;  5ICC A;  3L2W A;  4A12 A;  1Z3Y A;  3LFK A;  2O9L A;  1OYI A;  4HRI A;  5FLX Z;  3ASN H;  3CCY A;  3IAS 2;  4LG0 A;  3OYN A;  5E3N A;  2VPL A;  4AIH A;  1IRZ A;  4PFO A;  3OYH A;  3I64 A;  1XMA A;  3V7R A;  5ILV A;  1GVD A;  3S1R J;  4A6D A;  1XX5 A;  1YG2 A;  3OR2 C;  4KUM A;  3EUH C;  2UXX A;  2R5Z B;  3TED A;  5JVT A;  4CCJ A;  5E8G A;  1FSH A;  2QVO A;  4CDG A;  3TW6 A;  4YG2 F;  2IS4 A;  4F93 B;  4J19 A;  1X58 A;  3PUF A;  5EEA A;  5FO5 A;  5J3L A;  3WTZ A;  3K69 A;  2X4H A;  1R58 A;  5GPA A;  1RRJ A;  4BDY A;  4CUG A;  5DM7 F;  1QVT A;  2VL8 A;  1K78 B;  2G7U A;  2P0W A;  3QU3 A;  4IOA F;  3LSM A;  2LNB A;  2KDO A;  2JA5 J;  2XC7 A;  1VI0 A;  1FSE A;  4IVN A;  2ECB A;  2VOP A;  1Z77 A;  2WBM A;  2XAH A;  2LK2 A;  1Q1H A;  3RZD J;  1JKP C;  2CV0 A;  3GME A;  1G3T A;  3K2A A;  4HNU A;  2Y30 A;  4XNF A;  4UVC A;  3I59 B;  1S6L A;  3BTI A;  3S3M A;  1BI0 A;  5CLS A;  4HG2 A;  3S32 A;  4HX8 A;  3HUG B;  4UUS A;  1OCZ H;  3P5J A;  1OPC A;  4ANJ A;  3HOZ J;  4PGG A;  1FYL A;  3HRU A;  4CCN A;  1X1A A;  1KYW A;  1Y8R B;  1S7A A;  2MBF A;  1B8I B;  2O61 A;  3LSK A;  3DFG A;  4OIQ F;  2R7Q A;  5FRO A;  1JUP A;  2PJR B;  1BA5 A;  2M7A A;  4P5O A;  4ON0 A;  1ZTR A;  3LMM A;  4AID A;  2VBX A;  2L5Q A;  4GYI A;  2KL4 A;  3KLN A;  3NWS A;  1QU3 A;  1YIO A;  3K70 D;  2LLK A;  1DP7 P;  1TWG J;  3FX3 A;  2YX4 A;  3GTP J;  5DCM B;  4LG3 A;  3H3V K;  5D5V B;  2EIK H;  2Z2S B;  2VC1 A;  3WTW C;  3F21 A;  4A3M J;  3K4M A;  5CVI A;  3VYU B;  1W5C C;  2QUF A;  3QYB A;  2NS8 A;  2W82 A;  1LQ1 A;  4BQA A;  3HBL A;  3ZQI A;  2NNN A;  1ZG1 A;  1MBE A;  4D5F A;  4GYG A;  5BS6 A;  2A3S A;  3J81 K;  4HST A;  1W7P A;  2FBH A;  2XIG A;  1OCT C;  3PSI A;  2FRH A;  3K70 C;  4B4C A;  1LE8 B;  2CWE A;  2O0Y A;  1ZRE A;  3WGI A;  4CO8 A;  1LKX A;  1ZHF A;  2GLO A;  4J01 A;  2P81 A;  2W24 A;  1NG7 A;  2ZJ2 A;  3IL2 A;  2JA6 J;  3SDB A;  3WE3 A;  1T08 B;  2GZW A;  3B6C A;  3CZ6 A;  2L0K A;  4AVZ A;  2F48 A;  1VQP I;  3CDI A;  2DA6 A;  3R61 A;  1TWC J;  3M1C A;  2DAO A;  2W1O A;  4KDP A;  4O3M A;  4XLH A;  5M3F J;  2E1O A;  3KFW X;  1JHH A;  1XMK A;  1NHA A;  1KYZ A;  1PVE A;  2PBI A;  2BY0 A;  5GAG J;  4FCY A;  2CFX A;  1DQU A;  2VJI A;  1Y8Q B;  5LHG A;  2B7E A;  3TW7 A;  2XGE A;  2HOS A;  1E3P A;  2IS1 A;  2HVQ A;  3NEU A;  4BKX A;  1U78 A;  5ICE A;  1SD4 A;  5IT3 A;  5LFA A;  4BYY A;  2LP0 A;  3TBI A;  3M8F A;  3OYD A;  1S7O A;  2M3A A;  4G7Z F;  1FBU A;  3JTH A;  5H6R A;  4AVP A;  2Q2E B;  2QYO A;  1D3Y A;  2CS3 A;  2DDB A;  5DYM A;  1FBS A;  4LIU A;  5F64 A;  1BC7 C;  2HQA A;  3Q9V A;  4IL6 C;  2DA1 A;  1KU9 A;  3CCS I;  1XSX A;  1GXQ A;  3OS1 A;  3J81 Z;  3IKV A;  2DFE A;  3DWL E;  1P4X A;  2O3F A;  4MNU A;  3CO7 C;  4L0Y B;  1ZH5 A;  4HX7 A;  3V4G A;  2KZG A;  4F91 B;  1W0T A;  2LBF B;  4D7N A;  3AL0 B;  5HS9 A;  4R1H A;  3W2A A;  3CMM A;  4F7Z A;  2R7F A;  3KE2 A;  3FBN B;  3KP5 A;  1GXP A;  2LFB A;  1ZLK A;  2UWM A;  1EKE A;  2WAF A;  4XRF A;  3H0G J;  1BW5 A;  2PLY A;  5HS8 A;  2JT1 A;  1IG7 A;  1GV2 A;  2A07 F;  4IX7 A;  1A04 A;  5D4R A;  5E3O A;  3I56 I;  4RBO A;  4F3Q A;  5HNH A;  3DXJ F;  2KRC A;  4V19 K;  1P2F A;  1F4K A;  2IGO A;  3FXM A;  4AYB A;  2K7L A;  1HBX G;  4ZC3 A;  1BI2 A;  5HLG A;  5LGU A;  3JAM K;  3E1S A;  2L4M A;  2QCO A;  5HS7 A;  1SAX A;  1R4N B;  4BQQ A;  2LY2 A; 
#chains in the Genus database with same CATH homology
 3BLY A;  2UV1 A;  2IGK A;  4II2 A;  3A1Y A;  2K5C A;  2WAE A;  2E5N A;  2VLA A;  3HKZ A;  2BW3 B;  4GRI A;  4ZDL A;  2HNH A;  2V1N A;  2L9S A;  1OR7 C;  2X6X A;  2WY7 Q;  3RTR A;  2DCE A;  2VXZ A;  4XN3 A;  1FMV A;  4LIT A;  3NWT A;  2Y0S A;  3TMO A;  3CF2 A;  2WAQ A;  3FDY A;  1TZL A;  4C9Y A;  1ERD A;  4OAY A;  4NC7 A;  4EAT A;  4ZTJ A;  1V5E A;  1EA3 A;  3W2V A;  1BR2 A;  2XDV A;  4KT6 A;  2HVR A;  4BEH A;  2HPM A;  3OYI A;  3IP4 B;  2OUM A;  2CV1 A;  4E7J A;  3ZXS A;  2DT6 A;  3A4C A;  2KMU A;  4IKF A;  3MMY B;  4CCK A;  1ZEL A;  2HVS A;  3U21 A;  3V42 A;  1Z3X A;  1BR4 A;  3BCB A;  3DKX A;  4ZYA A;  2IGN A;  2CUZ A;  4F55 A;  2I8D A;  2MC4 A;  3GBG A;  5LD2 C;  3C2H A;  4KIS A;  1NG6 A;  4BQN A;  2R7S A;  4ITV A;  4BS9 A;  2ZSI B;  1MMD A;  5HNF A;  2HDW A;  3OYG A;  3PL8 A;  4HPQ A;  3H5R A;  2K9L A;  3ZQQ A;  3SEZ A;  3OS0 A;  4D1Q A;  4JOM A;  4XKV A;  2AQE A;  3OYL A;  4ZTF A;  2OV7 A;  3DKY A;  4CCO A;  3UNG C;  4BU2 A;  4D9J A;  2KPM A;  3K10 A;  3OYC A;  1X1B A;  2BOL A;  2DOA A;  2E1M C;  2CV2 A;  3CP2 A;  5KHD A;  2KZV A;  3FKJ A;  4BE0 A;  2CMP A;  5KNL A;  2K9M A;  3VSL A;  3SZG A;  4CH7 A;  3HXL A;  3PUB A;  4CZC A;  2K3P A;  3LSI A;  2FUG 2;  4ZJZ A;  2XAU A;  4BDZ A;  2R7U A;  1D0Y A;  1UG0 A;  2LY1 A;  1UEL B;  3UR3 C;  3PSF A;  4IQJ A;  4MLO A;  3VYR B;  1MMG A;  2DJI A;  2VJ4 A;  1WJA A;  2X1E A;  3ZGK A;  2VXD A;  4YEL A;  4XL9 A;  1Z7L A;  3OYM A;  4XR6 A;  3MD2 A;  2E5Z A;  3K4J A;  4NNJ A;  4DGW B;  2L9N A;  3CJR B;  4BE1 A;  2IGM A;  3ONQ A;  4DBQ A;  2R7R A;  4RLF A;  3BC8 A;  3DPL C;  4F92 B;  5HVQ C;  3M8J A;  4E7H A;  1LFP A;  2F5V A;  2LRD A;  1PYV A;  4YRV A;  4KJZ A;  2VKD A;  1MMN A;  3L2Q A;  3S93 A;  4E7Z A;  1K6Y A;  3ZR8 X;  1DGW Y;  3OIP A;  3LFU A;  2X1D A;  3D5S C;  3VSK A;  2V9K A;  3DU5 A;  4AU7 A;  2R7V A;  3OYA A;  2X6W A;  1X1C A;  3FHN A;  4E4H A;  4PJJ A;  1X1D A;  4P1W A;  2VJJ A;  3BCA A;  5JHF A;  2R4G A;  3DTK A;  3HOS A;  3L2R A;  2QKM B;  4IQ4 A;  5CPR B;  4XQF A;  3K4B A;  4BE2 A;  3F9K A;  3IUO A;  2WA0 A;  3DTE A;  4Y3O A;  1QHH D;  3RPU D;  1D1C A;  1Z21 A;  2A6T A;  3S8P A;  1QHG A;  3OYJ A;  1WJB A;  3AL0 C;  3H9J A;  4Y33 A;  4BEH B;  1PJR A;  1SAU A;  1X19 A;  2VQL A;  2XF5 A;  2Z16 A;  4XKB A;  3H9G A;  2PJR A;  2UUZ A;  3L2V A;  1KON A;  2ZXH A;  4YEJ A;  4BJ5 C;  2F6C A;  2V7F A;  2M7B A;  4CCL A;  3FBI B;  2HPI A;  4XMY A;  2VJ5 A;  2CW8 A;  4NQW B;  2L2O A;  1WJ5 A;  3OOU A;  3S3N A;  3MKZ A;  2RQQ A;  3QOE A;  2HZD A;  1D0Z A;  2GOX B;  2Q1Z B;  3E0J B;  1Y6I A;  4Y4R A;  4XKW A;  1W36 D;  1IRX A;  1N78 A;  2JUG A;  3K4L A;  4CSW A;  3J7A Y;  3H5N A;  2V4J C;  2W00 A;  2IS6 A;  1UAA A;  2ZSH B;  4HEA 2;  1LDK B;  1T0F C;  1V5G A;  3QOD A;  2NOJ B;  3EUK L;  1D0X A;  1D1B A;  4CA0 A;  2KLO A;  2X6Y A;  2RNG A;  3HPH A;  3I9V 2;  3L2U A;  3DLA A;  3TL4 X;  4B48 A;  4RMN A;  2W4S A;  3K4C A;  2R7T A;  3DPU A;  1MNE A;  2MD0 A;  5HOO A;  1W36 C;  2CW7 A;  3CJQ B;  4KIT B;  4II3 A;  4N4O B;  2LY2 A;  1U0J A;  4ZDP A;  4DOZ A;  4XLF A;  2BVL A;  4LIV A;  5KCM A;  4C30 A;  4J00 A;  2L7K A;  3K4K A;  3S3O A;  1DP3 A;  4B47 A;  3VWB A;  2WB1 A;  2F4I A;  1VZ0 A;  1Y56 A;  4BUP A;  4RM3 A;  5CQE A;  2VAS A;  3L2W A;  2CFO A;  1Z3Y A;  3ZCO A;  3BG7 A;  4RLQ A;  4HRI A;  3IAS 2;  3OYN A;  2VPL A;  3AFH A;  4PFO A;  5HLT A;  3OYH A;  3PJR A;  2IXS A;  1WJE A;  2LRE A;  4XON A;  1G59 A;  2X51 A;  3OR2 C;  2CUJ A;  3EUH C;  3G2B A;  3KEY A;  4NUB A;  3A2K A;  4CCJ A;  2XF7 A;  4DIQ A;  2KQR A;  3EUA A;  2IS4 A;  1WFX A;  4F93 B;  2X85 A;  3OY9 A;  4RM2 A;  2BVM A;  3K6G A;  2KHM A;  1AA7 A;  1N75 A;  4CUG A;  3OYK A;  5TGT A;  3HOT A;  4BDY A;  3W2W A;  2VL8 A;  3CES A;  4QPQ A;  2P0W A;  3LSM A;  2VIX A;  3OS2 A;  2KDO A;  2LBF A;  4JQF A;  2XC7 A;  4BAC A;  2WAD A;  4PFP A;  5CKT A;  2ZFU A;  2WBM A;  3DU6 A;  2JVG A;  1YX5 A;  2R7W A;  2CV0 A;  4HNU A;  2XSJ C;  4XNF A;  1FMW A;  3DPT A;  4PJM A;  3S3M A;  2LOO A;  4B44 A;  3K4N A;  3DEE A;  4FET A;  4HG2 A;  3I3L A;  3S32 A;  1MND A;  4OWR B;  2A5W A;  2PMZ A;  3HUG B;  4ANJ A;  3KYL A;  4HSR A;  4CCN A;  2LC2 A;  1X1A A;  3H0D A;  3D5R C;  3MKY B;  1TT0 A;  3SEQ A;  1DGR M;  3LSK A;  3AKZ A;  2MFZ A;  1JI8 A;  2V26 A;  1MW7 A;  2R7Q A;  5FRO A;  2PJR B;  2HU9 A;  2KP6 A;  2M7A A;  2WY8 Q;  4P5O A;  1S9H A;  3H5A A;  3LMM A;  4XN0 A;  4FAS D;  1WJC A;  4B3X A;  2L5Q A;  2KL4 A;  3C2G A;  4E7S A;  3HG9 A;  1X4O A;  3NWS A;  1QU3 A;  3PNY A;  3VDX A;  3K70 D;  4C2U A;  4XLE A;  1X4P A;  2BW3 A;  3MKW B;  4PUS A;  4LG3 A;  2LH9 A;  3N05 A;  2VQH A;  2RRE A;  4XLC A;  4B43 A;  2E1M B;  2Z2S B;  4XOR A;  5FRM A;  3KX2 A;  5FRN A;  1R6R A;  3K4M A;  1YX3 A;  4G6T B;  3VYU B;  1T95 A;  2OC6 A;  3SYT A;  3QYB A;  5CQG A;  4BQO A;  2W82 A;  2M0M A;  3D5L A;  4XOP A;  3OYB A;  3QYF A;  4BXF A;  4HST A;  1N77 A;  4PK4 A;  3PSI A;  2KRH A;  3K70 C;  3LSG A;  3OL3 A;  4NC8 A;  3RCO A;  1SFK A;  3DTI A;  3OYF A;  2VB6 A;  4E7K A;  1OLT A;  1LKX A;  2E60 A;  3EPZ A;  4J01 A;  4E6K G;  3OL4 A;  4ZDO A;  1NG7 A;  4U7B A;  4E7L A;  4CCM A;  3SDB A;  1BR1 A;  4AVZ A;  3CZ6 A;  4E7I A;  3OMY A;  1D1A A;  1WJD A;  1BOB A;  2X1C A;  3M1C A;  2W1O A;  2AQF A;  4XLH A;  4U87 A;  4PJN A;  4BL0 B;  4DJA A;  2M4G A;  1DQU A;  2VJI A;  2R7O A;  3HC7 A;  2W7N A;  4PSW A;  3PFY A;  2DT7 B;  4PSX A;  3RSN A;  4F52 A;  2QKL B;  2V6E A;  1YE9 A;  1LVK A;  3PNT A;  2HVQ A;  2IS1 A;  2MYS A;  3OWT A;  4BJT A;  4C2T A;  2LG4 A;  2DXI A;  4X0G A;  5LFA A;  3PNV A;  3TBI A;  3OYD A;  3BG6 A;  3OIQ A;  2M3A A;  1WJF A;  2CH0 A;  2IS2 A;  2Q2E B;  2CS3 A;  4LIU A;  2HQA A;  2LYC A;  4N4N B;  2MAB A;  1GLN A;  1V5F A;  4DBR A;  3OS1 A;  3LL7 A;  3DWL E;  2XF6 A;  3DQV C;  2JSP A;  2ZXI A;  3LSH A;  3HL2 A;  1J09 A;  4F91 B;  3AL0 B;  4BJ6 C;  2LBF B;  4R79 A;  2JA2 A;  4BGD A;  2R7X A;  3W2A A;  2JVH A;  3CMM A;  2ELJ A;  3FBN B;  3IAM 2;  3ZRG A;  1G8X A;  2VQG A;  2UWM A;  1P9Q C;  3RQ4 A;  3HPG A;  1E0E A;  2WAF A;  4XLA A;  1HA8 A;  3VYS B;  4XM3 A;  4XOT A;  3OYE A;  3QYE A;  3OR1 C;  2O5R A;  4IX7 A;  2VQC A;  4IZZ A;  1MMA A;  3H35 A;  4F3Q A;  5HNH A;  3VYT B;  2KRC A;  4H4K C;  2GOM A;  2IGO A;  2VKH A;  4HNT A;  4AYB A;  2Z1D A;  4QPO A;  2M4K A;  3H9Q A;  4OAZ A;  3W3C A;  4ZC3 A;  4XKC A;  3E1S A;  4BQQ A;  4PJL A;  3CP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...