1OR7C

Crystal structure of escherichia coli sigmae with the cytoplasmic domain of its anti-sigma rsea
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVMAAIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma-E factor
publication title Crystal structure of Escherichia coli sigmaE with the cytoplasmic domain of its anti-sigma RseA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 23
structure length 66
sequence length 66
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03872 RseA_N Anti sigma-E protein RseA, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1or7C00
1OR7C
chains in the Genus database with same CATH superfamily
4RA2A 3JRHA 3CCLI 1QQIA 2HPIA 1Z0XA 4DOZA 5C4XJ 2JRMA 1ETYA 4XNFA 3IWZA 2V7FA 2RNJA 2BOLA 2QQBA 1LFBA 2RC4A 1Z7LA 3DBHB 1KYWA 4A3JJ 4YEJA 4AIHA 5HS8A 1APLC 1WJAA 2OBPA 5DCMB 2Z33A 3KEOA 2RN7A 1YE9A 1EH6A 2DMQA 2FA5A 4UXNA 1X2NA 4XSZF 3GO5A 5AIQA 5FB2A 1FOXA 1TWFJ 3A01B 3WTUC 4P1WA 1WZ2A 4IX7A 1A5JA 3Q0WA 2DMPA 4E7LA 3GTQJ 4DBQA 4F7ZA 4A3EJ 4A3DJ 3TP3A 3FK6A 3CESA 1DGWY 1F36A 2AQEA 4CCMA 3CUOA 2VJJA 2DYRH 3KP6A 4E6KG 4IQJA 4O6JA 5DEQA 3VSKA 1MD0A 4QLCU 1F9NA 1RNLA 1BOAA 3K0LA 5FKNA 2NNYA 2BBYA 4CCOA 2WAQN 1WQ2A 1VQLI 1LDJA 5F64A 3MZYA 3SFIA 4XQFA 2CRGA 3U1DA 5ILVA 2LKSA 3E6BA 2ELHA 3OYNA 5K7ZA 5H2FC 3HL2A 2W82A 2VQGA 5C4JJ 2E2HJ 3BG7A 1TNTA 3WTVC 3FHZA 4ETSA 1YW7A 2QVOA 2BHYA 4ON0A 3G2BA 2ZMEC 2R7OA 3HRSA 3BG3A 2VASA 4N4NB 1O7LA 3I55I 3R6SA 1IF1A 4IJAA 1E3OC 2ZNZA 2DODA 3I4PA 3ZQHA 4RDUA 1HDDC 5J1UA 1ETVA 1DPRA 2CUJA 2F6CA 1U5TA 1R4NB 1HSJA 3ABUA 1HKTA 4Q47A 4BS9A 2DOFA 2V9VA 4EJUA 5BOXA 1WVRA 1YS7A 1GLNA 1I1GA 3ABKH 1ZRCA 2MC3A 4RS8A 1J7KA 1ZREA 1FZPB 3LWFA 4E7IA 1J75A 2ESHA 1FPQA 3HRTA 3S32A 3TW6A 2XF6A 4DGWB 3JRDA 1SMYF 1LVKA 1IN8A 1YOVB 4FISA 1K79A 1V55H 4Q5SF 1YIOA 1FYKA 1YTYA 3KPHA 2GBYA 4ZH4F 3FKIJ 3K70C 4RMNA 1WRJA 3FDYA 5KK1A 3CMYA 3WU2C 1BIBA 4IHXA 3Q0VA 2DN0A 3DTIA 3NEUA 4BDYA 1WKMA 3ZR8X 2LY2A 2YU9J 1LE8B 1LFPA 5FJ8J 3A0HC 4XM3A 3Q5FA 4HDUA 1UHWA 4O5VA 3LSRA 2BV6A 5ICCA 3LAPA 3COAC 1MIJA 4BEHB 4IQ4A 2IW5A 2GZWA 3H3VK 4F3QA 4RM2A 1B72B 5EEAA 3TGNA 1DPUA 2FBIA 4JX4A 2OF7A 4QWQA 4CCLA 2E2IJ 1MNMC 1TWHJ 4TV7A 3RKXA 4G6DA 3GTOJ 2H8WA 3TP0A 3BZKA 3M1EA 4MFEA 3PM1A 5BPIA 1ZN2A 4ENMA 4Q48A 3C18A 1U78A 3ZMZA 4BGDA 1Z7UA 2HOSA 3SEZA 4GFBA 5KCMA 1S29A 1YG2A 3S3MA 1SFOJ 1B9MA 3BG6A 1XCBA 5ILUA 2XVCA 4CUGA 2VT3A 5TGTA 1O3QA 1UG2A 2JZYA 4G9YA 3ZMUA 4B09A 4IZZA 2IS1A 4ESBA 4IRHA 3E6MA 1V5FA 1DP7P 1X1CA 4I0AA 3S2WA 3GTJJ 4DYCA 3EDPA 2V4JC 2Y48A 4LK0F 4OIQF 5D5XB 2E71A 3R0JA 2DFHA 3I4MJ 4I99C 3IH2A 1GV2A 1RR8C 5IT3A 4NUBA 1Z9CA 1EH7A 4BKXA 2P0WA 2O9LA 3LL7A 3G6EI 2LBFB 3HC7A 1MSFC 5EG0A 2DA4A 3QODA 1UJ8A 5TRDA 3V8LA 5CVUA 4U7BA 1T39A 4IPAA 1MMSA 1RKTA 1D5VA 1V4RA 1V3FA 3FMQA 3J7ZI 3ZQFA 2FX0A 2Q2EA 4L5EA 2L7MP 5B3SH 4RB3C 1SD6A 1IRGA 1P9QC 4A12A 3EETA 3FXMA 5IYDJ 3SZPA 2FNAA 4LB6B 1W36C 2HDCA 2KIFA 4LIVA 2CQQA 2R7TA 5BPDA 1OYYA 3BTJA 3DV8A 3P9CA 4QTRA 2WAEA 1NG7A 1V5EA 2IPQX 2H1KA 2QUFA 1FBQA 2XAQA 3C2HA 4DW6A 1R23A 2DT7B 2CW0F 4II3A 3CJQB 3IRRA 3F23A 1ZR4A 2DMUA 1GT0C 1GVDA 1PYVA 1Z05A 4GO1A 3JTGA 4BQAA 4IL6C 4YELA 1XMKA 4FETA 1ZGJA 4QPOA 4MEYF 4CCJA 1XGSA 4BL0B 3E3VA 3RKQA 3W6JB 1EJ9A 3OYBA 4YIRX 3VYTB 3EPZA 3EUHC 2BY1A 3OS0A 3AL0B 3RJPA 3BR3A 3SDBA 5FROA 2L4MA 2KDOA 3A0BC 1PUFB 2QKLB 4RM3A 2GWRA 3HUGB 3K1PA 1FOYA 3K2ZA 2ZXIA 4PJ0C 3RQIA 2M3AA 3X2QH 3KZIC 2ZNYA 1TWGJ 1B9NA 2X85A 3ZN1A 3H5RA 2P6SA 4YIFA 1RRJA 2E34A 3HYIA 5E8GA 4D5FA 3OYHA 4IOCF 1CF7B 2K27A 2O6GE 2R5ZB 3N05A 4G12A 2UXNA 2AHQA 3A03A 4EGYA 2XV4S 1D8JA 2V6EA 1GXPA 4A3FJ 2P7VB 1LUJB 1SFUA 1MNDA 3IV5A 3EYIA 5DD8A 2Z3YA 3I53A 3NWSA 2COMA 5FLMJ 2ZSHB 2VODA 2OQGA 2GM4A 2OV7A 2V1XA 3PNTA 1L0OC 2RQPA 2WB1A 3K4LA 1XMXA 4PFOA 2KHMA 1IN7A 1Z3YA 4IXAA 4IHSA 3E6DA 4NQWB 3BJAA 2LKPA 4ZZDA 2OA4A 3WU0A 2LVSA 3TOAA 3S14J 4M3BA 2UWMA 1FLIA 1WSUA 3I4NJ 3L2QA 1BI3A 1XDSA 2DA5A 2JA2A 4C3IJ 5KAFC 1WCMJ 3AG3H 1IUYA 3BROA 3HHGA 5CKTA 3CJNA 3TOBA 2XHKA 1HCRA 2PJRB 4MTDA 3P9KA 4HF1A 1P7JA 1UFMA 3ABMH 4UVBA 1G59A 5FKKA 1D5YA 2KRHA 4HW0A 2DA1A 4BXXJ 5E17F 5K5OA 3BP8A 2EZKA 2K9LA 1MGTA 1Z3XA 3WE2A 2IA0A 3FXOA 1WFXA 1IRXA 2XC7A 3TEDA 4UVCA 2TRTA 3HJEA 5CJ9A 3LQRA 2R5YA 1VQPI 3AAFA 1NH3A 1VF9A 4LMYA 3DPLC 2RV8A 5HLIA 3QRFF 3OOPA 3B6CA 1RPWA 1FSEA 2XROA 4KUMA 3ZQ7A 1X58A 2R3SA 2X1CA 3I64A 2V6CA 5M5WJ 2LD5A 4A2UA 1B59A 5ERIA 2KL4A 2OAZA 2P8TA 4IHWA 4RLQA 1BI0A 1ENHA 2OPTA 2JWTA 4CZZA 1A31A 3DP7A 3ZPLA 3S93A 3GYHX 1VZ0A 1HDPA 4RAFA 2LG4A 2IP2A 5L3DA 2M8EA 2DO7A 2DBBA 5E3LA 1FP2A 3D1NI 2X48A 2LF8A 3IAS2 2UUZA 3TBIA 2EH3A 4XLFA 2BGCA 4HAMA 1T6SA 1YW9A 3TO7A 4II2A 3R0AA 4D1QA 4RAGA 2CMPA 2VN2A 2IJLA 4EJWA 4A6EA 4CYCA 4FX0A 2NVUB 3F22A 4Y13A 2V26A 3FXRA 3I59B 1ZLJA 4L9NA 1VQ5I 3GFIA 2ICWG 1K7AA 3P7NA 5LRRA 3RPUA 1OR7A 4PSXA 1OFCX 3U1KA 3BQZA 2XDVA 3G71I 3HM5A 4HA8A 4J19A 3K4CA 1XTAA 3GTGJ 3I5UA 2IS4A 1HW2A 2Q8KA 1ETWA 1JKOC 2EJRA 2CH0A 3WTYC 4EJOA 3OY9A 1HA8A 4D5CA 1R1UA 1UHMA 1E3PA 3CUQC 3CDLA 1RUNA 2DJIA 3LOCA 1ETXA 2M34A 2L54A 3GTKJ 3UR3C 1HOMA 2DT6A 1T95A 5E79C 3RSNA 1B8IB 2HTSA 3TQNA 5HLHA 1BR1A 1WPKA 2X0LA 3WTZA 5F0HA 1H0MA 2YUSA 3W6VA 2JN6A 4B47A 3WHCA 1LDDA 4BYYA 3ZMVA 2VE9A 3GZ6A 3ABTA 1MH3A 4C9YA 4CXFA 4XLAA 3BZ6A 1SANA 4JP0A 3K1NA 4UV9A 3LAJA 4E7JA 2HKXA 4LLNA 4JBAA 2Z16A 2TCTA 4QSHA 4D7MA 1DU6A 2PMZA 2M87A 2I5UA 4E7ZA 5HNFA 4BDZA 2DPDA 3HIFA 1TT0A 4BAYA 4HLYA 4ABZA 2R7FA 2MH9A 2PBIA 2DQRA 2CU7A 3KEQA 4C3JJ 1QVUA 5F1JA 1Y8QB 1MNEA 2AO9A 1UELB 4MGRA 4AM3A 1BW5A 1Y0UA 4JQFA 2F2EA 5LEKA 3J7YJ 1H9GA 2ZJQF 1T0FC 2KMUA 2PG4A 1YW8A 1P4WA 2H6CA 2EA2A 1JE8A 1YRNA 1YFHA 3SZGA 2DJNA 2OQRA 1W4MA 3O8GA 4BHPA 5DDGA 3DKXA 4XRSA 4HPQA 5E18F 2ZFUA 2BY0A 3IUOA 2AXTC 4M3DA 2VXDA 1SFKA 2NVXJ 2ETHA 2EPFA 1K4SA 5BMZA 1GUUA 3ML6A 2W00A 1KU2A 4AIKA 1DDNA 3RQ4A 1ZK8A 4W97A 1K6YA 3W3CA 3DXJF 4OU0A 3IWFA 2HPMA 1JHHA 1AU7A 2HU9A 4G6TB 4AWXB 2QENA 4BBRJ 5FFXA 1ONVA 1B6AA 3DEEA 3BR6A 9ANTA 2JT1A 2HGCA 3HSRA 5JI6A 1WH7A 4GYGA 1SAUA 3BT9A 1ITYA 2M45A 4KFCA 4U0YA 3GTMJ 2QQ9A 2LLKA 4HQMA 4GRIA 3WTSC 3F9KA 5ICFA 4DYQA 4XL9A 2A5YB 3FZVA 3BC8A 3T1BA 1U0JA 1DGRM 4JX5A 2VJ4A 3KEYA 3HG9A 3HOXJ 2X1EA 2HWVA 3MKZA 3S1MJ 1KGSA 2WV0A 2VI6A 3NARA 3ONQA 2VPLA 1X1AA 4UHTA 2CV0A 5GADJ 1I5ZA 1P92A 3RTRA 3ZCOA 1FOWA 5FO5A 1MW7A 2IS6A 1XC5A 1WWXA 4EEFG 4ZYGA 2CW8A 2WAQA 3RPUD 3E97A 3GVAA 4XIDA 2Y75A 3OYIA 3MZ8A 1ZKGA 2GXGA 2OCCH 4P96A 1EV7A 2EV0A 2QBYB 2JRTA 2FOKA 2A68F 3L2WA 1O3SA 4A5MA 4H4KC 3PQKA 1ZHFA 4M73A 2KRFA 5M3MJ 2RNGA 1CGPA 3F6OA 1OKRA 5HLTA 5AONA 2OZ6A 2E7WA 4EGZA 1G3SA 5GPAA 4M72A 1RUOA 4BU2A 3PL8A 1U2WA 3OV8A 5CQGA 3M8EA 4OIRF 2M0CA 2QSFX 3L1PA 2P7CB 2LNBA 3O8HA 1QZEA 1TT5B 2DK5A 1D0YA 2VOOA 2JA6J 1KONA 5E20A 4U7DA 3IRQA 2HQ5A 2HFHA 4Z6YA 2JUCA 1GVJA 2VL8A 1YLFA 2HS5A 4K2EA 2GOMA 1NK3P 1KQ8A 5D8KB 2VKDA 4Z2YA 1K61A 2VBWA 4I76A 1QHGA 1T56A 1G2HA 4RB0A 4WXCA 2Z5UA 2VIXA 2LOOA 1FTZA 4A3KJ 3H0DA 4CSWA 3CQZJ 4CHUA 2JJ7A 1TLHB 1TNSA 1JJ6C 3K4NA 4V2FA 4WCGA 2EINH 1W7PB 2DPUA 5CVIA 3H36A 1E0EA 5TJJA 2O7OA 5EGOA 1FJLA 5IYBJ 1O3RA 3CP2A 3MKYB 2V79A 1A36A 3H9GA 4XICA 5C44J 5KVRA 4OMZA 2MD0A 2A6TA 2W1OA 1PUEE 4KIGA 2HVRA 1IC8A 1R5ID 5IP6A 3KX2A 5E1WA 3SDGA 2NS8A 4AIDA 2E36A 1BN5A 1TQPA 3N4MA 3VYSB 1O4XA 5B1AH 5GPCA 1OJLA 4HLXA 2CJJA 3PIPF 1G6NA 2P6TA 4MQ9F 4A3CJ 2VB6A 4B44A 3I0TA 2XGCA 1MMDA 1TQMA 1WJBA 3OYAA 2LMDA 3QYFA 3JRFA 2XAGA 3PUFA 3TO6A 1UMQA 3LSJA 4HV5A 4M9ZA 2LY1A 4XRFA 1AWCA 2R7VA 1ORKA 3CF2A 5F08A 1K78A 2M1BA 1SC7A 2XASA 2WAFA 5DTDA 1YHQI 2YS9A 4PGHA 4KDPA 3VOEA 3EQLF 3ZQGA 3A02A 4G8XA 3BG9A 1JTYA 1OPCA 3CF5F 1B4AA 1LFUP 2NVQJ 3CCUI 1ETOA 4MLOA 1ON2A 2M4KA 4L18B 3HTSB 1XMAA 2MH2A 4UNOA 1D8KA 2X6OA 2HVSA 2I10A 2XAHA 1VNDA 2FJ1A 5KHDA 4UUSB 3LQQA 1K83J 4U87A 5HDGA 2QYOA 1IDYA 1ZELA 1AHDP 4UUVA 1H89C 2VJIA 2R7QA 5K5QA 2H6BA 3BPXA 2H09A 5K7HA 4L0ZB 2ZB9A 4FHTA 2CUEA 1IN5A 5TISC 3L2UA 1ZRFA 1BM9A 4DBRA 3FX3A 2VC0A 3LA2A 3CUQB 3DF8A 1UHSA 2VONA 3F8FA 1TL8A 3DCFA 1FC3A 4XKWA 4XR6A 4BQOA 2RQQA 2H94A 2XSJC 5EF6A 2CV1A 4F93B 3S3NA 5FGMA 5CYVA 1X3ZB 2ID3A 5J40A 3ZP5A 1KQ0A 4M6VA 3HEFA 2HR3A 4B1RA 3S16J 3W6KB 1HKSA 3RZOJ 5EDNA 2EFOA 3RYPA 4LB5A 3K4BA 2UV1A 5J47A 5DD4A 2STWA 5K1YA 2YU3A 2VKVA 2E2JJ 2COBA 3VSLA 2K9SA 2F4MB 2VC1A 4IKFA 2RVCA 2VT2A 4BJ6C 4EQQA 2O0YA 4X1EA 1Z6TA 4ZTFA 3BTIA 1P4XA 3AG1H 5IOYA 1X4PA 5HOOA 4Y17A 2DYSH 3CJTB 1MDMA 1HC8A 1QZYA 2HDDA 4J00A 2CQXA 3PO2J 4XRSG 4IHVA 2CSOA 1K6OA 1DQUA 1FYLA 1MBKA 3HZJA 4I6ZA 2IGKA 2OJED 3ULQB 4ENJA 1RETA 5GAHJ 3GEZA 4N9IA 2L3DA 3NQOA 1MH4A 1X1DA 1YS6A 4C3HJ 3JW4A 2QF7A 2NYXA 2XAJA 4RGRA 1JUSA 4A3LJ 2XRNA 4X6AJ 3QPHA 3IL2A 1R1VA 3RIRA 1SVLA 5HODA 5F27A 2HYGD 2JPBA 1X3WB 1AKHB 1QHHD 2CUFA 3LSKA 3HB9A 2KIQA 3C3WA 2EK5A 4I02A 2V9KA 4RGXA 1JI8A 3TKYA 2LTPA 2XAUA 2EIKH 4ZDLA 2QGUA 3OL3A 4A0YA 2DDBA 1QGPA 1U9NA 2JVGA 5FRMA 3PUBA 2ID6A 2M2EA 2IVMA 3GWZA 3FM5A 4MO7A 1E2XA 1HF0A 4IRIA 3A2KA 4B4CA 4JX6A 2YPRA 2D5VA 2ECBA 3LSPA 1P4AA 1RKWA 2FU4A 5FFZA 2NOJB 1FYMA 4I0BA 1I6XA 3GZ5A 4WF2A 4BNCA 3FBIB 3MWMA 4DYRA 1D1CA 5B1BH 3GFJA 2M8GX 5DUKA 3CDHA 1QPIA 2EA4A 4AYBA 1T2KA 3ASNH 2DA6A 4JOMA 2CW7A 3FXKA 2WADA 2CFXA 4XSXF 2HZDA 3O3KA 3HOTA 2LFBA 3QOPA 4P9UA 1WJEA 5D6EA 1U9OA 4YG2F 1U5TC 2X51A 5FLVA 2DQLA 2PN6A 3OIQA 2QSHX 2VKHA 4LK1F 3CC7I 2FD5A 5D5UB 3ZQLA 5FD5A 3WTTC 2R7ZJ 3ROUA 2O5RA 3IH3A 2HXOA 1TC3C 3CCQI 3GXOA 4M6XA 5C3EJ 3BG5A 4M9SA 1JUPA 1WJDA 4LLLA 1S9HA 1MMNA 5CQEA 4FX4A 5J8CA 2A5WA 1MBHA 2OD5A 4PFPA 3M8JA 2GA2A 4XOPA 2KJBA 5JFRA 4LG0B 4XN3A 5IP9J 2LYCA 3CD6I 5E1ZB 2ME6A 3BOQA 3S1NJ 3WU1B 3VODA 5DCMA 4GCVA 4R8HA 2K3FA 1XDUA 2ESNA 2RAEA 3KP5A 1KYZA 2L4AA 2ELKA 2K4JA 3MCZA 3CMAI 4BJ5C 4EJVA 5IY5H 1JT0A 5D5WB 1T98A 4NC8A 1JKPC 3QPLA 3GZNB 4IF4A 2B63J 4KISA 3KETA 3A01A 4PJJA 3MN2A 1A35A 3CTAA 2EFWA 4BQNA 5HDNA 3JRGA 5ILSA 4BXUA 3GTLJ 4RAYA 3FXJA 3QQAA 1AOYA 4A6DA 4HX4A 1YJNI 1XSVA 4MNUA 1U3EM 3S8PA 2GAUA 3TW7A 2ZJRF 4MEXF 2IGOA 4I09A 2IGMA 2DU9A 2DA2A 2ZBKA 3E5XA 3OIPA 1I3AA 2FBHA 1BIAA 1SFXA 2KFDA 3CLQA 3SEQA 3ABLH 1SD7A 1FBUA 2EWNA 2PMHA 3AFHA 2IEKA 3JAMZ 2E7XA 1S8NA 1STZA 4ESFA 4BBSJ 4CDGA 3T0YA 1A6QA 3MAJA 3SXYA 4PDKA 4D9JA 3S17J 2GA1A 2CO5A 3CP8A 1QRYA 1MBFA 3V7CA 4FE4A 1XGNA 4A0XA 1OCRH 5D4SA 4XMYA 2VXZA 2KRCA 1MZBA 2CG4A 1JGGA 1USTA 3KFWX 5ED4A 4BY1J 5LGNA 3CO6C 1I6HJ 5IT9Z 2E35A 5D5VB 1H88C 3GBGA 2KKOA 4HF0A 3VDXA 4C2UA 3V7SA 1MBGA 4PZJA 3SYTA 2A69F 2BY3A 4CICA 4V19K 3DFGA 2E5NA 3LA7A 2ZXJA 3DLAA 5DCFA 1X1BA 5EJCA 4NBQA 5HNHA 4PK4A 5GP9A 4FTHA 1YO5C 3PIOF 4LG3A 3OYKA 3OYEA 2R7SA 4HNUA 2HNHA 2L7KA 3I54A 3BR5A 3ZMTA 3K9TA 1FEXA 3C1DA 2WY7Q 1R1TA 2BE5F 2XAFA 4ENKA 1ZQ3P 1KU7A 3E1SA 3L7WA 1J9IA 2M7BA 2DMTA 2O8XA 1U8RA 4WX9A 3G4SI 3D5RC 1FIPA 4MFDA 5E1XA 1N78A 1FMVA 3V8JA 1LNWA 2HZTA 4OMYA 3W2AA 2BW3B 6PAXA 5FRNA 3G73A 2W48A 1XPXA 3L2VA 2K40A 2XRLA 2ZMEB 1RZ4A 2HOEA 2QZ8A 2IXSA 1LE8A 1ETKA 3HSFA 3M7GA 1IXSB 3MVPA 4KJZA 3VYRB 3LNQA 2XB5A 3FK7A 3QU3A 2DMNA 2CFOA 3I56I 3LMMA 4P9FA 1FX7A 4BEHA 4C2TA 1XN7A 2YX4A 2KZGA 4HRIA 1B72A 3K10A 3DEUA 4Y3OA 1IUFA 2JUGA 2YR2A 3GFMA 3U21A 4XLCA 3OYFA 3J7AY 4NC7A 1R4MB 2Y2ZA 1JKRC 5DYMA 3F8CA 2FUG2 4LLGF 4S04A 4BXFA 2FQ3A 2E1NA 3GW2A 1MJAA 2ZKZA 2CWEA 5E3NA 2BY2A 1HLVA 1BI2A 1ON1A 2E1OA 3C2BA 3E5QA 4E70A 4FQGA 3F8NA 4S05A 2L9RA 3K6GA 3BQYA 2DT5A 4KIBA 2FRHA 2STTA 5IYCJ 1VQ4I 3HDDA 2KZVA 1RI7A 2KISA 2L9VA 5L3BA 3EUKL 2XGEA 2Q0OA 1WH5A 5D8LB 2LR8A 2A6EF 2LKXA 3HKZN 2R7WA 4E7SA 4L9JA 1VTNC 4F55A 1E3HA 2XGXA 1IRFA 1KA8A 2XKPA 3ECOA 3LSHA 4BE0A 2O3FA 2F5EA 2E5ZA 4L9VA 1KU3A 2K02A 1E17A 2BXZA 2WWYA 3L09A 3MQ0A 3PQJA 3JSOA 4A3MJ 1S3JA 1D3YA 4ASNA 4ITVA 1VI0A 2MABA 2N8GA 4Y33A 5H6QA 5HS7A 2JMWA 2Z9OA 3BR0A 3NAUA 3JAMK 2EQRA 4O3MA 1TWAJ 2LBFA 3OYLA 3HOYJ 2BZTA 2CV2A 1KQ9A 3JSPA 1VQ7I 1ULYA 1PP8F 1BBYA 2KP6A 3JRCA 4ZJZA 4ZDPA 1O3TA 3ASOH 2PMUA 4HX7A 3L2CA 3H35A 3N97A 1NK2P 3FXLA 1RESA 1USSA 5GTIC 5IT9K 2ZJ2A 4IHYA 2MW8A 1Y1WJ 4A93J 4YIIA 5LD2C 3OOUA 4KICA 2G7UA 2EB7A 1IXCA 4BUPA 1J2XA 1V5GA 2OTJI 3FKJA 3IKTA 3CDIA 4AIJA 5LBQA 3NRVA 3ZMSA 2OTLI 4MHGA 2LF7A 2EILH 1BA5A 2W57A 1D1BA 5J4VA 3Q3SA 2ADUA 2W25A 3G1MA 1ZARA 2R7UA 2MLGA 4XLEA 3HHHA 3PFYA 2WBMA 1BC7C 2L02A 2JVHA 3U9GA 1UZCA 1DU0A 1M1EB 2F5CA 1FT9A 1Y0NA 3FF5A 4PSWA 1BR4A 2AXLA 3BY6A 2R0QC 3VB2A 3ZRGA 5J4YA 3G3ZA 4L9TA 1U5TB 2MFZA 2K86A 2M30A 2R93J 2R7DA 3F72A 1PUFA 1MJBA 2CYYA 3W2VA 3BJ6A 4IHTA 2GQQA 2C6YA 1G4DA 3PO3J 3HUGA 1YX3A 1R36A 2P5VA 3OMYA 1J09A 4BH9A 2WY8Q 1Y39A 1CF7A 3OS1A 1FOKA 3MKWB 3K4KA 2J5OA 4N9HA 2R5ZA 3KE2A 1MSEC 1OR7C 1KZHA 2KDZA 1QPMA 1GHCA 3I9V2 4E7KA 3K1MA 3G1OA 2W24A 1MBJA 2BYVE 3MMYB 3RCOA 4B8XA 4A3GJ 3EYYA 2KLOA 4PGGA 3ZGKA 4EV0A 2BEOA 2VE8A 3RKWA 3ZXSA 1BW6A 1LQ1A 3DPTA 2KPMA 3CMMA 4M3GA 2H27A 3JR9A 3MKLA 3MEXA 4E7HA 2HQRA 2QWWA 4XORA 2RKHA 1R00A 3JTHA 2K3PA 4AVPA 4FT8A 2PJRA 3RKYA 3RZDJ 1OCOH 3TDZC 4B3XA 2WA0A 2DAOA 2ME0A 2PEXA 5K5RA 5DM6F 2OUMA 3WTXC 1YQAA 1UB9A 4QPQA 3I3LA 4U0WA 4YRVA 1HQCA 2FNPA 2K9NA 1WJCA 4HV6A 1GXQA 3FM3A 1X19A 5D4RA 1ZGWA 1K4TA 2XIGA 3ECHA 3CCEI 1VQ6I 3OS2A 4ZZLA 1SAXA 1EA3A 1OCCH 3IKVA 2L7ZA 1IXRC 4UB8C 1ZYRF 1S6LA 1T08B 3MZHA 3GX4X 3FIWA 3R4KA 4Y4RA 5EEHA 4B48A 2DTZA 2VLAA 1SMTA 1WJFA 4L5JA 4M6YA 2ECCA 2PMZN 4LJZF 2DW4A 3ZQCA 2KQRA 2LC2A 5IOZA 3CCYA 1GDTA 5J3LA 4PJNA 1MKMA 1YITI 4DNCA 2M9HA 1XD7A 4OINF 5EG0B 5IP7J 3M9AA 1ODDA 2L2OA 3LSIA 1MJ9A 4RGUA 1NHAA 4PJMA 3SZTA 3D5SC 2I8DA 3DLLF 2K7LA 2KT0A 3DQVC 4AC0A 3AL0C 1QBJA 3W2WA 2Q2EB 3P5JA 1QO0D 3KP2A 2G9WA 3VFZA 2M0MA 2GLOA 2NVYJ 3I59A 2ZCWA 2EFPA 4HQEA 2MG4A 2RGVA 3LFUA 2D2WA 3H1CA 3M1CA 2ZJPF 1OMIA 3JRAA 2EIMH 5LRSA 1DUXC 1TQIA 2RREA 2JSCA 2W4SA 4Y52J 1JT6A 1D1AA 2VQCA 3V42A 4RGSA 3K2AA 3QAHA 4YFNF 1ETQA 5DUIA 3HGGA 1QVTA 2BHZA 2JK3A 3TDUC 5JR3A 4A3BJ 2VOPA 2DXIA 3DTKA 3CJRB 3PNVA 5B66C 3H9JA 5F0CA 4N4OB 3FWEA 4BE2A 2DCEA 1BJZA 2EFQA 3CCSI 2NXNB 3ZQQA 5KAIC 2WTEA 4G94A 3P9IA 2LK2A 1N77A 1POGA 2G0EA 5BS6A 1B8IA 4CH7A 4EJTA 2E1MC 4ZYHA 1GV5A 2ELJA 2P5KA 3WGHA 2V1NA 3HRUA 1UG0A 3LSMA 3MD2A 4D7NA 3BR1A 4L0YB 1JUMA 4HOBA 3Q0UA 5F0FA 2PLYA 2XPVA 3JRIA 5LEJA 2Y0SN 3QPSA 4F92B 5F1RA 1RC9A 5K7FA 2VQLA 2PX9A 4EM2A 3WODF 5JHUA 2UZKA 2GXAA 2PQ8A 4BY7J 2LSOA 3AG2H 3HGYA 4HF2A 3QOEA 4XKVA 3KLOA 3LSTA 3CMEI 1SVOA 3KLNA 1TP4A 3REOA 3SQNA 5J6XA 3K4JA 3KCCA 2P4WA 2ISYA 3S3OA 4OWRB 2L5QA 2XUBA 3IC7A 4IVNA 5FKLA 1R6RA 2DTRA 2OCEA 1FSHA 4H0EA 2HEOA 5KNLA 2L9NA 3QU6A 1L3LA 3DWLE 3WGIA 3T8RA 1LPQA 1F43A 5JHFA 3RI4A 1FP1D 2MBFA 2F5VA 3K7AJ 3QP6A 5L3EA 2AQFA 2D1VA 3IH4A 2DOEA 3HPHA 3K4MA 1QNTA 5E3OA 1FWZA 2F4IA 1X1PA 4HYEA 4RLFA 2CQNA 1S7EA 2HOTA 3RDIA 2VJ5A 1PVEA 1Y56A 2PJPA 1BOBA 3B73A 1I1SA 4JYKA 1BJAA 2CUZA 2X4HA 2ZO4A 4BACA 2EV6A 2DA3A 5JLXA 2JSPA 4C2MJ 3OSFA 1G3YA 1PJRA 3BDDA 4LITA 2W7NA 3ISPA 4XLNF 1EKEA 4N0BA 3R60A 1BR2A 2R5YB 5M5XJ 3OWTA 4A5NA 5LGUA 3VWBA 4M71A 1IW7F 1R22A 3GTPJ 2FXAA 3U2RA 4IEJA 4BQQA 4G6QA 4G7ZF 4G7HF 2DLLA 3CO7C 3M3YJ 3LA3A 1P6RA 5F04A 1JGSA 1FNNA 2FEZA 5LLQA 3UKGA 1IDZA 4M3EA 2L01A 3L00A 3V4GA 2XSDC 5A2QZ 3CCJI 4XKCA 3K69A 5FKMA 2XF7A 4HBLA 2IBDA 3KYCB 4ZDOA 5HLGA 3EUHA 3BCAA 3K70D 4KITB 3DU5A 4I98B 3SFZA 2VPRA 4DIQA 2NVTJ 3GFLA 3VPRA 5FKOA 1XB4A 4YFXF 1IN4A 2QBYA 5HDKA 2B7EA 2IRFG 1R5HA 2W84A 5BQTA 2QQAA 4ESJA 2GOXB 4CA0A 2O61A 2IT0A 4CYCB 3GUDA 3G1LA 3OL4A 2DFIA 4DJAA 1P2FA 4XOTA 3KIOA 3EUAA 2YSRA 4PJLA 3GMEA 1A6IA 2FMYA 3CCRI 4NB5A 1AA7A 2EV5A 3S2DJ 3FHNA 3J7AO 2HI3A 2A3SA 3AKZA 3H9QA 2P5LC 2XPWA 5L3GA 2M4GA 2X1DA 3CC2I 4W1UA 4KA4A 2F4OB 4KT5C 4C30A 4FASD 1D0ZA 2A6HF 2CQ7A 4F52A 4RBOA 2OU2A 4WXDA 2LY9A 4LIUA 4BJTA 1LVAA 4OIPF 2HYFA 3OR2C 1WI9A 1ZTRA 3I58A 1G3TA 2IGNA 3VEPA 4ZYAA 3OYJA 2FSWA 2IAIA 2NNNA 2M7AA 2HVQA 4E4HA 4CO8A 3KP3A 4F91B 4B43A 2BXYA 1W7PA 3V8KA 1X2MA 4FCYA 4CZCA 4D0PA 1ZR2A 3H3UA 1Z1DA 1OCZH 3FBNB 4KN7X 3WG7H 2G7HA 2RDPA 3VYUB 1YIJI 4FE7A 3WTWC 3H5AA 4MIMA 4RAZA 5B5EC 3HXLA 3J81Z 4QIWN 2HQNA 2OZUA 2R7RA 4G7OF 5FLXZ 4XBFA 5GAGJ 3QPTA 2GIZA 3D0SA 5DS9A 2AS5F 1IG7A 2UXXA 2V1DA 3T5XA 3E0JB 2FBKA 4I7HA 3ZOBA 2HQAA 1IO2A 2FF4A 1JTXA 1UAAA 3R61A 2K5CA 2VBYA 1R49A 2NRAC 2HTJA 1ZH5A 2MLKA 2DK8A 2ZXHA 2LDUA 4AVZA 3JREA 3HBLA 3MFKA 4Y15A 1LJ9A 3S15J 3OYCA 1HW1A 1XX5A 2R4GA 2Z2SB 1YRNB 4HG2A 1IRZA 4J01A 3M8FA 3HOSA 1W36D 4OAZA 2H8RA 1T8IA 2JA8J 4LFUA 3RYRA 1S7OA 3S1QJ 3TO9A 1ZG5A 2PFBA 1HSTA 5F6FA 3JCUC 5AIPA 3IAM2 3CLOA 3UNGC 2Y9YA 3ZMDA 2QEXI 1F1ZA 3HKZA 1MBEA 1RR7A 3H92A 4AD9A 5JVTA 2F48A 3C2GA 5EZHA 4M74A 3M07A 4GXOA 4EMSA 2NS7A 5A2QK 3H3ZA 3OYDA 2Y69H 2MD5A 3E7LA 1ACIA 1HW5A 4PCQA 5CVVA 3ZQIA 3J80Z 3LSGA 3E6CC 2VBZA 4DZJA 1PDNC 3BTLA 5JLWA 1FY7A 4UUSA 1ZRDA 1W5TA 3F0CA 3GCMA 1T33A 1Q1HA 1J0RA 2FOWA 2P81A 2CGPA 3KZZA 1XCVA 4UB6C 2HOAA 5EEGA 3DEWA 1TZLA 1NG6A 4KMUX 2NAZA 3M4OJ 2EFNA 5ICEA 1D0XA 3OIOA 2NS0A 3CZ6A 1BL0A 4KIFA 5M5YJ 3CC4I 1X3UA 3FXQA 1J5YA 1UCRA 3A4CA 2EBIA 3HSEA 1R71A 5DM7F 2VQHA 3CUQA 3JRBA 3OYMA 1ZGAA 1SEUA 2MGQA 5JVGF 4IOAF 5EZGA 2E1MB 2GIVA 3DTEA 2DA7A 4HX8A 2X6XA 1T38A 3PSIA 1XG1A 2MYSA 3LFKA 2ZC2A 3WG9A 1TW3A 2DFEA 3HTUA 4CYDA 3DBRB 1EF4A 4BHCA 1VQNI 2L0KA 2X9DA 5FD6A 3QWLA 1S72I 1SVMA 2FE3A 2GXBA 2R92J 4M9XA 2FMLA 2ACJA 1IJWC 1HKQA 4P55A 2EIJH 5GTHC 1TW2A 4L5IA 4AYBN 2BVMA 4AU7A 5DV5A 3KZYA 3OSGA 4S0HB 3TMOA 1J59A 2XPUA 3H5NA 1FIAA 3BTCA 3IHUA 4ZTJA 2IS2A 1LB2A 1JKQC 3HOZJ 3IP4B 5LHHA 4YFKF 5CVRA 1X4OA 2X6YA 3DPUA 1W7PD 2K9QA 4RB2C 1YJWI 3AG4H 1VQ8I 3F8BA 5LFAA 1P7IA 4WWCA 4MTEA 1T0FA 3F3XA 1I50J 1BI1A 1R5GA 4CCNA 1F5TA 2ZXWH 4XN0A 1ZG1A 3J81K 3ERED 2KIMA 3SJMA 1Z91A 2Y31A 3WHBA 5FLXK 2FQ4A 4ZYEA 1VQ9I 4NNJA 2NOGA 2PI0A 2XKOA 2K4BA 1O7FA 1SD5A 1ZAOA 2KJCA 2B0LA 1FBSA 3H0GJ 1SD4A 4HNVA 4Q4ZF 3FISA 1Z6RA 1O57A 4HEA2 5H6RA 5EGOB 2D45A 1AKHA 4XRMA 3WGGA 4EM0B 2Y30A 2QSGX 5CLSA 1IV8A 3PSFA 3C7JA 3CCVI 2B9SA 4RB1A 3V7RA 1HBXG 2L9SA 2BVLA 1W1WE 5L3CA 1TTYA 1HXDA 1SFEA 4XKBA 3DKYA 2O8KA 2HDWA 4U0VA 4OAYA 5H20A 3BWGA 4BE1A 3ESWB 2IA1A 2LRDA 1W5SA 3J80K 1N25A 4NDLA 3HRMA 1H8AC 1WJ5A 2QKMB 1XS9A 1YJ9I 4A69C 4KN4X 1XGMA 2QM3A 5HVQC 3O2PE 1OYWA 1W0UA 1QA6A 2LREA 2Z99A 4B3AA 1K78B 4JK1X 2DOAA 1N75A 1Q1VA 4R1HA 3CCMI 3E5UA 2V1UA 4CGZA 3HPGA 4IO9F 1QZZA 2WC2A 4NHJA 5CPRB 3T8TA 2LP0A 2WB1N 3B02A 5M3FJ 5HS9A 1W5CC 2HYJA 4P5OA 2EZIA 1RIOH 4UY8I 2ZSIB 1MMAA 3ELKA 2XF5A 1OYIA 2O03A 4KT6A 1G3WA 2F5FA 2QCOA 1YYVA 2EZLA 3L2RA 3KYLA 3NWTA 1Y8RB 1OQYA 3DU6A 4I01A 4LG0A 4KNYA 3DBLB 5E8IA 3BJOA 1LDKB 1I27A 1JHFA 1Z21A 3FXUA 4UV8A 4ZC3A 1WI3A 4ENNA 5J1RA 1U8BA 2JQ7A 3KP4A 4GYIA 3D5LA 5J8FA 2D1HA 2JTVA 2XB0X 2ZFWA 2DDAA 1KU9A 3OYGA 3QP5A 1Y6IA 1TWCJ 3Q9VA 2VBXA 2HKOA 3GLXA 3S2HJ 5LHGA 4OOIA 1JJ8C 4GGGA 1TBXA 4XK4A 1FMWA 3GF2A 2R7XA 5BNGA 4WXHA 3L9FA 1S5LC 4EM1A 2MC4A 2Q1ZB 3FMRA 4HZFA 1IV6A 1QU3A 2ISZA 4LD5A 4ZYDA 2XGDA 1WGXA 3HOUJ 2HXIA 2VUMJ 2JA5J 1IN6A 1OCPA 3HOWJ 1XSXA 4HSTA 3S1RJ 1WHUA 1IZ1A 2F5DA 4BHBA 2LH9A 1S7AA 4HDVA 3SHFA 1G8XA 1XGOA 2K9MA 1ZLKA 3A1YA 2W85A 1I3QJ 2L7FP 2A61A 3KP7A 5EYRA 1Z67A 4DZPA 1F4KA 2JA7J 3HOVJ 5LGTA 4A0ZA 1MDMB 4U88A 1NTCA 1OLTA 2QQ8A 5CVJA 3WE3A 4NQWA 1R58A 5LHIA 3B6AA 1IAWA 1W0TA 2V9PA 4ANJA 4EVIA 3FMSA 3QYEA 4X0GA 4DQ2A 2X6WA 1ERDA 2A07F 2Y0SA 2E19A 4CCKA 3ERMA 3BLYA 3QYBA 4M3FA 3OR1C 4HSRA 1DP3A 1C0WA 2Y0MA 3BZCA 2CS3A 1YX5A 2WV1A 2Y9ZA 2QLZA 1R7JA 2QA4I 4KYWA 3I71A 1MMGA 1H9TA 1YI2I 3PJRA 2E60A 5GAEJ 2YX7A 4UUTA 1ZG3A 1Y1VJ 5L3FA 4R79A 5ICGA 1LKXA 1U6GA 2K85A 4XLHA 3O6BB 4V2GA 1R9TJ 4Y7NJ 2MA3A 1JXSA 5E3MA 3GLLA 1IGNA 1I39A 2H1LA 2TDXA 3BR2A 5D6FA 1XSDA 4UVAA 1PP7U 3F8MA 4IRGA 2BW3A 3F6VA 3PNYA 4MQVA 3ZN0A 2VKEA 2A05A 4XONA 1OISA 2ZMEA 1FTTA 3F21A 2JPCA 1EH8A 2EZHA 1REPC 2KIUA 4WK8F 4OIOF 3BPVA 2DI3A 2M5WA 1B1BA 1V54H 4GDFA 3Q9SA 4EATA 4HNTA 1A04A 4I2OA 4A3IJ 4KMFA 3DKWA 4NC6A 2J5PA 3TL4X 3PFIA 1LEAA 1CQTA 3BCBA 2IA2A 1BC8C 2Z1DA 4LOCA 5IPAA 1VQKI 3RPQA 1OCTC 4PUSA 1VFCA 2OC6A 2DFFA 1Z77A 2E1CA 2CQKA 3KYDB 1LEBA 4AUXA 2MSYA 1VQMI 1VQOI 4XLPF 5J1YA 4LGWA
chains in the Genus database with same CATH topology
4XMYA 2VXZA 2KRCA 2HPIA 4DOZA 1MNEA 1UELB 3GBGA 4XNFA 3VDXA 4C2UA 2V7FA 4JQFA 3SYTA 2BOLA 2GOXB 4CA0A 1Z7LA 2E5NA 1T0FC 2KMUA 3OL4A 3DLAA 4DJAA 4YEJA 1X1BA 4XOTA 5HNHA 4PK4A 3SZGA 1WJAA 3EUAA 3DKXA 4LG3A 4HPQA 4PJLA 3OYEA 3OYKA 2R7SA 2ZFUA 4HNUA 2HNHA 3IUOA 2L7KA 2VXDA 1AA7A 1SFKA 1YE9A 3FHNA 2WY7Q 3AKZA 3H9QA 2W00A 3K70D 3RQ4A 2M4GA 2X1DA 3E1SA 2M7BA 1K6YA 3W3CA 4P1WA 4IX7A 2HPMA 3D5RC 4C30A 4DIQA 4FASD 1FMVA 1D0ZA 1N78A 2HU9A 4G6TB 4F52A 3W2AA 2BW3B 4LIUA 4BJTA 4E7LA 5FRNA 3DEEA 4DBQA 3L2VA 3CESA 3OR2C 1DGWY 2AQEA 2IXSA 4CCMA 1SAUA 2IGNA 2VJJA 4ZYAA 3VYRB 4KJZA 3OYJA 4E6KG 2M7AA 2HVQA 4E4HA 2CFOA 4IQJA 3VSKA 4B43A 3LMMA 4F91B 4BEHA 4C2TA 4GRIA 4CCOA 4HRIA 3K10A 4Y3OA 3F9KA 2JUGA 4CZCA 4XL9A 4XQFA 3U21A 4XLCA 3OYFA 3J7AY 4NC7A 3BC8A 1U0JA 1DGRM 3FBNB 2FUG2 2VJ4A 3KEYA 3HG9A 2X1EA 4BXFA 3MKZA 3OYNA 3VYUB 3HL2A 3ONQA 2W82A 2VPLA 3H5AA 1X1AA 2VQGA 3HXLA 2CV0A 3RTRA 3BG7A 3ZCOA 2R7RA 1MW7A 2IS6A 3K6GA 2CW8A 2WAQA 3G2BA 3RPUD 3OYIA 2R7OA 3E0JB 2HQAA 2VASA 4N4NB 2KZVA 1UAAA 2K5CA 3L2WA 3EUKL 4H4KC 2ZXHA 2CUJA 2RNGA 4AVZA 2F6CA 2R7WA 5HLTA 4BS9A 4E7SA 3OYCA 1GLNA 2R4GA 2Z2SB 4F55A 4HG2A 4J01A 3HOSA 4BU2A 3PL8A 1W36D 5CQGA 4OAZA 4BE0A 3LSHA 2E5ZA 4E7IA 1D0YA 3S32A 2XF6A 3IAM2 4DGWB 1KONA 3UNGC 1LVKA 3HKZA 4ITVA 2MABA 2VL8A 4Y33A 3C2GA 3K70C 2GOMA 4RMNA 2VKDA 2LBFA 3FDYA 3OYLA 3OYDA 2CV2A 1QHGA 3DTIA 3LSGA 4BDYA 3ZR8X 2LY2A 2VIXA 2LOOA 2KP6A 1LFPA 4ZJZA 4XM3A 4ZDPA 3H0DA 3H35A 4CSWA 3K4NA 4BEHB 4IQ4A 5LD2C 1E0EA 1TZLA 1NG6A 3OOUA 4F3QA 4RM2A 1D0XA 3CP2A 3CZ6A 3MKYB 4BUPA 4CCLA 3A4CA 3H9GA 1V5GA 3FKJA 2VQHA 3OYMA 2MD0A 2A6TA 1D1BA 2W1OA 2HVRA 2E1MB 3DTEA 2X6XA 4BGDA 3PSIA 3KX2A 2R7UA 2MYSA 3SEZA 4XLEA 3PFYA 5KCMA 2WBMA 3S3MA 3BG6A 2JVHA 3VYSB 4CUGA 5TGTA 4PSWA 1BR4A 3ZRGA 2VB6A 4B44A 4IZZA 2MFZA 1MMDA 1WJBA 3OYAA 2IS1A 3QYFA 2BVMA 4AU7A 3W2VA 1V5FA 2LY1A 1X1CA 3TMOA 2R7VA 2V4JC 3CF2A 1YX3A 3H5NA 4ZTJA 2IS2A 3OMYA 1J09A 2WY8Q 2WAFA 3IP4B 1X4OA 2X6YA 3DPUA 4NUBA 3OS1A 5LFAA 3MKWB 3K4KA 2P0WA 1OR7C 3LL7A 2LBFB 3HC7A 4CCNA 4XN0A 4MLOA 2M4KA 3QODA 3I9V2 4U7BA 4E7KA 3MMYB 4NNJA 2HVSA 3RCOA 5KHDA 2KLOA 3ZGKA 4U87A 1P9QC 3ZXSA 1ZELA 2VJIA 2R7QA 4HEA2 1W36C 3DPTA 2KPMA 4LIVA 2R7TA 3CMMA 3L2UA 2WAEA 4DBRA 1NG7A 1V5EA 3PSFA 4E7HA 4XORA 2K3PA 3C2HA 4XKWA 2DT7B 4XR6A 2RQQA 2XSJC 4II3A 3CJQB 4BQOA 2CV1A 4F93B 3S3NA 4B3XA 2L9SA 1PYVA 2BVLA 2WA0A 2OUMA 4YELA 4QPQA 3I3LA 3DKYA 4XKBA 2HDWA 4FETA 4QPOA 4CCJA 4OAYA 4BL0B 4YRVA 1WJCA 4BE1A 1X19A 3OYBA 2LRDA 3K4BA 2UV1A 3VYTB 3EPZA 3EUHC 3OS0A 3AL0B 3SDBA 5FROA 3OS2A 1EA3A 1WJ5A 2KDOA 2QKMB 2QKLB 4RM3A 5HVQC 3HUGB 3VSLA 2ZXIA 2LREA 4IKFA 4BJ6C 4Y4RA 4B48A 2M3AA 2DOAA 1N75A 2VLAA 1WJFA 4ZTFA 2X85A 3H5RA 1X4PA 3HPGA 5HOOA 5CPRB 2KQRA 2LC2A 3OYHA 4J00A 4P5OA 4PJNA 3N05A 1DQUA 2ZSIB 1MMAA 2V6EA 2IGKA 2XF5A 1MNDA 2L2OA 4KT6A 3LSIA 1X1DA 4PJMA 3D5SC 3NWSA 2I8DA 3L2RA 3KYLA 3NWTA 2ZSHB 3DQVC 3DU6A 3AL0C 3W2WA 2Q2EB 2OV7A 1LDKB 3PNTA 1Z21A 2M0MA 2WB1A 3K4LA 4PFOA 2KHMA 4ZC3A 1Z3YA 4NQWB 3LFUA 3D5LA 3M1CA 1QHHD 3LSKA 3OYGA 2RREA 2UWMA 2W4SA 2V9KA 1Y6IA 2VQCA 1D1AA 3V42A 1JI8A 2XAUA 3L2QA 4ZDLA 2JA2A 3OL3A 5FRMA 5CKTA 2JVGA 3PUBA 2PJRB 1G59A 2DXIA 3DTKA 3CJRB 2KRHA 3PNVA 3H9JA 4N4OB 2K9LA 4BE2A 1FMWA 3A2KA 2DCEA 1Z3XA 2PJRA 2R7XA 3ZQQA 1WFXA 1IRXA 2XC7A 1N77A 2NOJB 2MC4A 2Q1ZB 4CH7A 2E1MC 2ELJA 3FBIB 1QU3A 1D1CA 3DPLC 2V1NA 1UG0A 4AYBA 3LSMA 4HSTA 3MD2A 2X1CA 4JOMA 2CW7A 2LH9A 2WADA 2HZDA 3HOTA 2KL4A 4RLQA 1G8XA 1WJEA 2K9MA 4F92B 3A1YA 2VQLA 2X51A 3S93A 1VZ0A 3OIQA 2LG4A 2VKHA 1OLTA 3QOEA 4XKVA 2O5RA 3IAS2 3K4JA 2UUZA 3TBIA 4ANJA 1WJDA 3S3OA 1S9HA 1MMNA 3QYEA 4OWRB 2L5QA 2X6WA 4XLFA 2A5WA 5CQEA 4X0GA 1ERDA 2Y0SA 4PFPA 3M8JA 4CCKA 3BLYA 3QYBA 3OR1C 1R6RA 4HSRA 4II2A 4XOPA 4D1QA 1DP3A 2CMPA 4XN3A 2LYCA 5KNLA 2L9NA 2CS3A 1YX5A 3DWLE 2V26A 5JHFA 2F5VA 1MMGA 2AQFA 3PJRA 2E60A 4PSXA 3HPHA 3K4MA 2F4IA 2XDVA 4BJ5C 4NC8A 4RLFA 4R79A 1LKXA 3K4CA 4XLHA 2VJ5A 2IS4A 1Y56A 1BOBA 4KISA 4PJJA 2CUZA 2CH0A 4BQNA 3OY9A 4BACA 1HA8A 2BW3A 2JSPA 3PNYA 1PJRA 4XONA 2DJIA 4LITA 3UR3C 2W7NA 3S8PA 2DT6A 1T95A 3RSNA 1BR2A 1BR1A 3OWTA 4B47A 4EATA 2IGOA 2IGMA 3VWBA 4HNTA 4C9YA 4XLAA 3OIPA 4BQQA 4E7JA 3TL4X 3SEQA 2Z16A 3BCBA 3AFHA 2Z1DA 2PMZA 4PUSA 4E7ZA 4XKCA 5HNFA 2OC6A 4BDZA 2XF7A 1TT0A 4D9JA 4ZDOA 3BCAA 3CP8A 4KITB 3DU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR7 C; 
#chains in the Genus database with same CATH topology
 4RA2 A;  3JRH A;  3CCL I;  1QQI A;  2HPI A;  1Z0X A;  4DOZ A;  5C4X J;  2JRM A;  1ETY A;  4XNF A;  3IWZ A;  2V7F A;  2RNJ A;  2BOL A;  2QQB A;  1LFB A;  2RC4 A;  1Z7L A;  3DBH B;  1KYW A;  4A3J J;  4YEJ A;  4AIH A;  5HS8 A;  1APL C;  1WJA A;  2OBP A;  5DCM B;  2Z33 A;  3KEO A;  2RN7 A;  1YE9 A;  1EH6 A;  2DMQ A;  2FA5 A;  4UXN A;  1X2N A;  4XSZ F;  3GO5 A;  5AIQ A;  5FB2 A;  1FOX A;  1TWF J;  3A01 B;  3WTU C;  4P1W A;  1WZ2 A;  4IX7 A;  1A5J A;  3Q0W A;  2DMP A;  4E7L A;  3GTQ J;  4DBQ A;  4F7Z A;  4A3E J;  4A3D J;  3TP3 A;  3FK6 A;  3CES A;  1DGW Y;  1F36 A;  2AQE A;  4CCM A;  3CUO A;  2VJJ A;  2DYR H;  3KP6 A;  4E6K G;  4IQJ A;  4O6J A;  5DEQ A;  3VSK A;  1MD0 A;  4QLC U;  1F9N A;  1RNL A;  1BOA A;  3K0L A;  5FKN A;  2NNY A;  2BBY A;  4CCO A;  2WAQ N;  1WQ2 A;  1VQL I;  1LDJ A;  5F64 A;  3MZY A;  3SFI A;  4XQF A;  2CRG A;  3U1D A;  5ILV A;  2LKS A;  3E6B A;  2ELH A;  3OYN A;  5K7Z A;  5H2F C;  3HL2 A;  2W82 A;  2VQG A;  5C4J J;  2E2H J;  3BG7 A;  1TNT A;  3WTV C;  3FHZ A;  4ETS A;  1YW7 A;  2QVO A;  2BHY A;  4ON0 A;  3G2B A;  2ZME C;  2R7O A;  3HRS A;  3BG3 A;  2VAS A;  4N4N B;  1O7L A;  3I55 I;  3R6S A;  1IF1 A;  4IJA A;  1E3O C;  2ZNZ A;  2DOD A;  3I4P A;  3ZQH A;  4RDU A;  1HDD C;  5J1U A;  1ETV A;  1DPR A;  2CUJ A;  2F6C A;  1U5T A;  1R4N B;  1HSJ A;  3ABU A;  1HKT A;  4Q47 A;  4BS9 A;  2DOF A;  2V9V A;  4EJU A;  5BOX A;  1WVR A;  1YS7 A;  1GLN A;  1I1G A;  3ABK H;  1ZRC A;  2MC3 A;  4RS8 A;  1J7K A;  1ZRE A;  1FZP B;  3LWF A;  4E7I A;  1J75 A;  2ESH A;  1FPQ A;  3HRT A;  3S32 A;  3TW6 A;  2XF6 A;  4DGW B;  3JRD A;  1SMY F;  1LVK A;  1IN8 A;  1YOV B;  4FIS A;  1K79 A;  1V55 H;  4Q5S F;  1YIO A;  1FYK A;  1YTY A;  3KPH A;  2GBY A;  4ZH4 F;  3FKI J;  3K70 C;  4RMN A;  1WRJ A;  3FDY A;  5KK1 A;  3CMY A;  3WU2 C;  1BIB A;  4IHX A;  3Q0V A;  2DN0 A;  3DTI A;  3NEU A;  4BDY A;  1WKM A;  3ZR8 X;  2LY2 A;  2YU9 J;  1LE8 B;  1LFP A;  5FJ8 J;  3A0H C;  4XM3 A;  3Q5F A;  4HDU A;  1UHW A;  4O5V A;  3LSR A;  2BV6 A;  5ICC A;  3LAP A;  3COA C;  1MIJ A;  4BEH B;  4IQ4 A;  2IW5 A;  2GZW A;  3H3V K;  4F3Q A;  4RM2 A;  1B72 B;  5EEA A;  3TGN A;  1DPU A;  2FBI A;  4JX4 A;  2OF7 A;  4QWQ A;  4CCL A;  2E2I J;  1MNM C;  1TWH J;  4TV7 A;  3RKX A;  4G6D A;  3GTO J;  2H8W A;  3TP0 A;  3BZK A;  3M1E A;  4MFE A;  3PM1 A;  5BPI A;  1ZN2 A;  4ENM A;  4Q48 A;  3C18 A;  1U78 A;  3ZMZ A;  4BGD A;  1Z7U A;  2HOS A;  3SEZ A;  4GFB A;  5KCM A;  1S29 A;  1YG2 A;  3S3M A;  1SFO J;  1B9M A;  3BG6 A;  1XCB A;  5ILU A;  2XVC A;  4CUG A;  2VT3 A;  5TGT A;  1O3Q A;  1UG2 A;  2JZY A;  4G9Y A;  3ZMU A;  4B09 A;  4IZZ A;  2IS1 A;  4ESB A;  4IRH A;  3E6M A;  1V5F A;  1DP7 P;  1X1C A;  4I0A A;  3S2W A;  3GTJ J;  4DYC A;  3EDP A;  2V4J C;  2Y48 A;  4LK0 F;  4OIQ F;  5D5X B;  2E71 A;  3R0J A;  2DFH A;  3I4M J;  4I99 C;  3IH2 A;  1GV2 A;  1RR8 C;  5IT3 A;  4NUB A;  1Z9C A;  1EH7 A;  4BKX A;  2P0W A;  2O9L A;  3LL7 A;  3G6E I;  2LBF B;  3HC7 A;  1MSF C;  5EG0 A;  2DA4 A;  3QOD A;  1UJ8 A;  5TRD A;  3V8L A;  5CVU A;  4U7B A;  1T39 A;  4IPA A;  1MMS A;  1RKT A;  1D5V A;  1V4R A;  1V3F A;  3FMQ A;  3J7Z I;  3ZQF A;  2FX0 A;  2Q2E A;  4L5E A;  2L7M P;  5B3S H;  4RB3 C;  1SD6 A;  1IRG A;  1P9Q C;  4A12 A;  3EET A;  3FXM A;  5IYD J;  3SZP A;  2FNA A;  4LB6 B;  1W36 C;  2HDC A;  2KIF A;  4LIV A;  2CQQ A;  2R7T A;  5BPD A;  1OYY A;  3BTJ A;  3DV8 A;  3P9C A;  4QTR A;  2WAE A;  1NG7 A;  1V5E A;  2IPQ X;  2H1K A;  2QUF A;  1FBQ A;  2XAQ A;  3C2H A;  4DW6 A;  1R23 A;  2DT7 B;  2CW0 F;  4II3 A;  3CJQ B;  3IRR A;  3F23 A;  1ZR4 A;  2DMU A;  1GT0 C;  1GVD A;  1PYV A;  1Z05 A;  4GO1 A;  3JTG A;  4BQA A;  4IL6 C;  4YEL A;  1XMK A;  4FET A;  1ZGJ A;  4QPO A;  4MEY F;  4CCJ A;  1XGS A;  4BL0 B;  3E3V A;  3RKQ A;  3W6J B;  1EJ9 A;  3OYB A;  4YIR X;  3VYT B;  3EPZ A;  3EUH C;  2BY1 A;  3OS0 A;  3AL0 B;  3RJP A;  3BR3 A;  3SDB A;  5FRO A;  2L4M A;  2KDO A;  3A0B C;  1PUF B;  2QKL B;  4RM3 A;  2GWR A;  3HUG B;  3K1P A;  1FOY A;  3K2Z A;  2ZXI A;  4PJ0 C;  3RQI A;  2M3A A;  3X2Q H;  3KZI C;  2ZNY A;  1TWG J;  1B9N A;  2X85 A;  3ZN1 A;  3H5R A;  2P6S A;  4YIF A;  1RRJ A;  2E34 A;  3HYI A;  5E8G A;  4D5F A;  3OYH A;  4IOC F;  1CF7 B;  2K27 A;  2O6G E;  2R5Z B;  3N05 A;  4G12 A;  2UXN A;  2AHQ A;  3A03 A;  4EGY A;  2XV4 S;  1D8J A;  2V6E A;  1GXP A;  4A3F J;  2P7V B;  1LUJ B;  1SFU A;  1MND A;  3IV5 A;  3EYI A;  5DD8 A;  2Z3Y A;  3I53 A;  3NWS A;  2COM A;  5FLM J;  2ZSH B;  2VOD A;  2OQG A;  2GM4 A;  2OV7 A;  2V1X A;  3PNT A;  1L0O C;  2RQP A;  2WB1 A;  3K4L A;  1XMX A;  4PFO A;  2KHM A;  1IN7 A;  1Z3Y A;  4IXA A;  4IHS A;  3E6D A;  4NQW B;  3BJA A;  2LKP A;  4ZZD A;  2OA4 A;  3WU0 A;  2LVS A;  3TOA A;  3S14 J;  4M3B A;  2UWM A;  1FLI A;  1WSU A;  3I4N J;  3L2Q A;  1BI3 A;  1XDS A;  2DA5 A;  2JA2 A;  4C3I J;  5KAF C;  1WCM J;  3AG3 H;  1IUY A;  3BRO A;  3HHG A;  5CKT A;  3CJN A;  3TOB A;  2XHK A;  1HCR A;  2PJR B;  4MTD A;  3P9K A;  4HF1 A;  1P7J A;  1UFM A;  3ABM H;  4UVB A;  1G59 A;  5FKK A;  1D5Y A;  2KRH A;  4HW0 A;  2DA1 A;  4BXX J;  5E17 F;  5K5O A;  3BP8 A;  2EZK A;  2K9L A;  1MGT A;  1Z3X A;  3WE2 A;  2IA0 A;  3FXO A;  1WFX A;  1IRX A;  2XC7 A;  3TED A;  4UVC A;  2TRT A;  3HJE A;  5CJ9 A;  3LQR A;  2R5Y A;  1VQP I;  3AAF A;  1NH3 A;  1VF9 A;  4LMY A;  3DPL C;  2RV8 A;  5HLI A;  3QRF F;  3OOP A;  3B6C A;  1RPW A;  1FSE A;  2XRO A;  4KUM A;  3ZQ7 A;  1X58 A;  2R3S A;  2X1C A;  3I64 A;  2V6C A;  5M5W J;  2LD5 A;  4A2U A;  1B59 A;  5ERI A;  2KL4 A;  2OAZ A;  2P8T A;  4IHW A;  4RLQ A;  1BI0 A;  1ENH A;  2OPT A;  2JWT A;  4CZZ A;  1A31 A;  3DP7 A;  3ZPL A;  3S93 A;  3GYH X;  1VZ0 A;  1HDP A;  4RAF A;  2LG4 A;  2IP2 A;  5L3D A;  2M8E A;  2DO7 A;  2DBB A;  5E3L A;  1FP2 A;  3D1N I;  2X48 A;  2LF8 A;  3IAS 2;  2UUZ A;  3TBI A;  2EH3 A;  4XLF A;  2BGC A;  4HAM A;  1T6S A;  1YW9 A;  3TO7 A;  4II2 A;  3R0A A;  4D1Q A;  4RAG A;  2CMP A;  2VN2 A;  2IJL A;  4EJW A;  4A6E A;  4CYC A;  4FX0 A;  2NVU B;  3F22 A;  4Y13 A;  2V26 A;  3FXR A;  3I59 B;  1ZLJ A;  4L9N A;  1VQ5 I;  3GFI A;  2ICW G;  1K7A A;  3P7N A;  5LRR A;  3RPU A;  1OR7 A;  4PSX A;  1OFC X;  3U1K A;  3BQZ A;  2XDV A;  3G71 I;  3HM5 A;  4HA8 A;  4J19 A;  3K4C A;  1XTA A;  3GTG J;  3I5U A;  2IS4 A;  1HW2 A;  2Q8K A;  1ETW A;  1JKO C;  2EJR A;  2CH0 A;  3WTY C;  4EJO A;  3OY9 A;  1HA8 A;  4D5C A;  1R1U A;  1UHM A;  1E3P A;  3CUQ C;  3CDL A;  1RUN A;  2DJI A;  3LOC A;  1ETX A;  2M34 A;  2L54 A;  3GTK J;  3UR3 C;  1HOM A;  2DT6 A;  1T95 A;  5E79 C;  3RSN A;  1B8I B;  2HTS A;  3TQN A;  5HLH A;  1BR1 A;  1WPK A;  2X0L A;  3WTZ A;  5F0H A;  1H0M A;  2YUS A;  3W6V A;  2JN6 A;  4B47 A;  3WHC A;  1LDD A;  4BYY A;  3ZMV A;  2VE9 A;  3GZ6 A;  3ABT A;  1MH3 A;  4C9Y A;  4CXF A;  4XLA A;  3BZ6 A;  1SAN A;  4JP0 A;  3K1N A;  4UV9 A;  3LAJ A;  4E7J A;  2HKX A;  4LLN A;  4JBA A;  2Z16 A;  2TCT A;  4QSH A;  4D7M A;  1DU6 A;  2PMZ A;  2M87 A;  2I5U A;  4E7Z A;  5HNF A;  4BDZ A;  2DPD A;  3HIF A;  1TT0 A;  4BAY A;  4HLY A;  4ABZ A;  2R7F A;  2MH9 A;  2PBI A;  2DQR A;  2CU7 A;  3KEQ A;  4C3J J;  1QVU A;  5F1J A;  1Y8Q B;  1MNE A;  2AO9 A;  1UEL B;  4MGR A;  4AM3 A;  1BW5 A;  1Y0U A;  4JQF A;  2F2E A;  5LEK A;  3J7Y J;  1H9G A;  2ZJQ F;  1T0F C;  2KMU A;  2PG4 A;  1YW8 A;  1P4W A;  2H6C A;  2EA2 A;  1JE8 A;  1YRN A;  1YFH A;  3SZG A;  2DJN A;  2OQR A;  1W4M A;  3O8G A;  4BHP A;  5DDG A;  3DKX A;  4XRS A;  4HPQ A;  5E18 F;  2ZFU A;  2BY0 A;  3IUO A;  2AXT C;  4M3D A;  2VXD A;  1SFK A;  2NVX J;  2ETH A;  2EPF A;  1K4S A;  5BMZ A;  1GUU A;  3ML6 A;  2W00 A;  1KU2 A;  4AIK A;  1DDN A;  3RQ4 A;  1ZK8 A;  4W97 A;  1K6Y A;  3W3C A;  3DXJ F;  4OU0 A;  3IWF A;  2HPM A;  1JHH A;  1AU7 A;  2HU9 A;  4G6T B;  4AWX B;  2QEN A;  4BBR J;  5FFX A;  1ONV A;  1B6A A;  3DEE A;  3BR6 A;  9ANT A;  2JT1 A;  2HGC A;  3HSR A;  5JI6 A;  1WH7 A;  4GYG A;  1SAU A;  3BT9 A;  1ITY A;  2M45 A;  4KFC A;  4U0Y A;  3GTM J;  2QQ9 A;  2LLK A;  4HQM A;  4GRI A;  3WTS C;  3F9K A;  5ICF A;  4DYQ A;  4XL9 A;  2A5Y B;  3FZV A;  3BC8 A;  3T1B A;  1U0J A;  1DGR M;  4JX5 A;  2VJ4 A;  3KEY A;  3HG9 A;  3HOX J;  2X1E A;  2HWV A;  3MKZ A;  3S1M J;  1KGS A;  2WV0 A;  2VI6 A;  3NAR A;  3ONQ A;  2VPL A;  1X1A A;  4UHT A;  2CV0 A;  5GAD J;  1I5Z A;  1P92 A;  3RTR A;  3ZCO A;  1FOW A;  5FO5 A;  1MW7 A;  2IS6 A;  1XC5 A;  1WWX A;  4EEF G;  4ZYG A;  2CW8 A;  2WAQ A;  3RPU D;  3E97 A;  3GVA A;  4XID A;  2Y75 A;  3OYI A;  3MZ8 A;  1ZKG A;  2GXG A;  2OCC H;  4P96 A;  1EV7 A;  2EV0 A;  2QBY B;  2JRT A;  2FOK A;  2A68 F;  3L2W A;  1O3S A;  4A5M A;  4H4K C;  3PQK A;  1ZHF A;  4M73 A;  2KRF A;  5M3M J;  2RNG A;  1CGP A;  3F6O A;  1OKR A;  5HLT A;  5AON A;  2OZ6 A;  2E7W A;  4EGZ A;  1G3S A;  5GPA A;  4M72 A;  1RUO A;  4BU2 A;  3PL8 A;  1U2W A;  3OV8 A;  5CQG A;  3M8E A;  4OIR F;  2M0C A;  2QSF X;  3L1P A;  2P7C B;  2LNB A;  3O8H A;  1QZE A;  1TT5 B;  2DK5 A;  1D0Y A;  2VOO A;  2JA6 J;  1KON A;  5E20 A;  4U7D A;  3IRQ A;  2HQ5 A;  2HFH A;  4Z6Y A;  2JUC A;  1GVJ A;  2VL8 A;  1YLF A;  2HS5 A;  4K2E A;  2GOM A;  1NK3 P;  1KQ8 A;  5D8K B;  2VKD A;  4Z2Y A;  1K61 A;  2VBW A;  4I76 A;  1QHG A;  1T56 A;  1G2H A;  4RB0 A;  4WXC A;  2Z5U A;  2VIX A;  2LOO A;  1FTZ A;  4A3K J;  3H0D A;  4CSW A;  3CQZ J;  4CHU A;  2JJ7 A;  1TLH B;  1TNS A;  1JJ6 C;  3K4N A;  4V2F A;  4WCG A;  2EIN H;  1W7P B;  2DPU A;  5CVI A;  3H36 A;  1E0E A;  5TJJ A;  2O7O A;  5EGO A;  1FJL A;  5IYB J;  1O3R A;  3CP2 A;  3MKY B;  2V79 A;  1A36 A;  3H9G A;  4XIC A;  5C44 J;  5KVR A;  4OMZ A;  2MD0 A;  2A6T A;  2W1O A;  1PUE E;  4KIG A;  2HVR A;  1IC8 A;  1R5I D;  5IP6 A;  3KX2 A;  5E1W A;  3SDG A;  2NS8 A;  4AID A;  2E36 A;  1BN5 A;  1TQP A;  3N4M A;  3VYS B;  1O4X A;  5B1A H;  5GPC A;  1OJL A;  4HLX A;  2CJJ A;  3PIP F;  1G6N A;  2P6T A;  4MQ9 F;  4A3C J;  2VB6 A;  4B44 A;  3I0T A;  2XGC A;  1MMD A;  1TQM A;  1WJB A;  3OYA A;  2LMD A;  3QYF A;  3JRF A;  2XAG A;  3PUF A;  3TO6 A;  1UMQ A;  3LSJ A;  4HV5 A;  4M9Z A;  2LY1 A;  4XRF A;  1AWC A;  2R7V A;  1ORK A;  3CF2 A;  5F08 A;  1K78 A;  2M1B A;  1SC7 A;  2XAS A;  2WAF A;  5DTD A;  1YHQ I;  2YS9 A;  4PGH A;  4KDP A;  3VOE A;  3EQL F;  3ZQG A;  3A02 A;  4G8X A;  3BG9 A;  1JTY A;  1OPC A;  3CF5 F;  1B4A A;  1LFU P;  2NVQ J;  3CCU I;  1ETO A;  4MLO A;  1ON2 A;  2M4K A;  4L18 B;  3HTS B;  1XMA A;  2MH2 A;  4UNO A;  1D8K A;  2X6O A;  2HVS A;  2I10 A;  2XAH A;  1VND A;  2FJ1 A;  5KHD A;  4UUS B;  3LQQ A;  1K83 J;  4U87 A;  5HDG A;  2QYO A;  1IDY A;  1ZEL A;  1AHD P;  4UUV A;  1H89 C;  2VJI A;  2R7Q A;  5K5Q A;  2H6B A;  3BPX A;  2H09 A;  5K7H A;  4L0Z B;  2ZB9 A;  4FHT A;  2CUE A;  1IN5 A;  5TIS C;  3L2U A;  1ZRF A;  1BM9 A;  4DBR A;  3FX3 A;  2VC0 A;  3LA2 A;  3CUQ B;  3DF8 A;  1UHS A;  2VON A;  3F8F A;  1TL8 A;  3DCF A;  1FC3 A;  4XKW A;  4XR6 A;  4BQO A;  2RQQ A;  2H94 A;  2XSJ C;  5EF6 A;  2CV1 A;  4F93 B;  3S3N A;  5FGM A;  5CYV A;  1X3Z B;  2ID3 A;  5J40 A;  3ZP5 A;  1KQ0 A;  4M6V A;  3HEF A;  2HR3 A;  4B1R A;  3S16 J;  3W6K B;  1HKS A;  3RZO J;  5EDN A;  2EFO A;  3RYP A;  4LB5 A;  3K4B A;  2UV1 A;  5J47 A;  5DD4 A;  2STW A;  5K1Y A;  2YU3 A;  2VKV A;  2E2J J;  2COB A;  3VSL A;  2K9S A;  2F4M B;  2VC1 A;  4IKF A;  2RVC A;  2VT2 A;  4BJ6 C;  4EQQ A;  2O0Y A;  4X1E A;  1Z6T A;  4ZTF A;  3BTI A;  1P4X A;  3AG1 H;  5IOY A;  1X4P A;  5HOO A;  4Y17 A;  2DYS H;  3CJT B;  1MDM A;  1HC8 A;  1QZY A;  2HDD A;  4J00 A;  2CQX A;  3PO2 J;  4XRS G;  4IHV A;  2CSO A;  1K6O A;  1DQU A;  1FYL A;  1MBK A;  3HZJ A;  4I6Z A;  2IGK A;  2OJE D;  3ULQ B;  4ENJ A;  1RET A;  5GAH J;  3GEZ A;  4N9I A;  2L3D A;  3NQO A;  1MH4 A;  1X1D A;  1YS6 A;  4C3H J;  3JW4 A;  2QF7 A;  2NYX A;  2XAJ A;  4RGR A;  1JUS A;  4A3L J;  2XRN A;  4X6A J;  3QPH A;  3IL2 A;  1R1V A;  3RIR A;  1SVL A;  5HOD A;  5F27 A;  2HYG D;  2JPB A;  1X3W B;  1AKH B;  1QHH D;  2CUF A;  3LSK A;  3HB9 A;  2KIQ A;  3C3W A;  2EK5 A;  4I02 A;  2V9K A;  4RGX A;  1JI8 A;  3TKY A;  2LTP A;  2XAU A;  2EIK H;  4ZDL A;  2QGU A;  3OL3 A;  4A0Y A;  2DDB A;  1QGP A;  1U9N A;  2JVG A;  5FRM A;  3PUB A;  2ID6 A;  2M2E A;  2IVM A;  3GWZ A;  3FM5 A;  4MO7 A;  1E2X A;  1HF0 A;  4IRI A;  3A2K A;  4B4C A;  4JX6 A;  2YPR A;  2D5V A;  2ECB A;  3LSP A;  1P4A A;  1RKW A;  2FU4 A;  5FFZ A;  2NOJ B;  1FYM A;  4I0B A;  1I6X A;  3GZ5 A;  4WF2 A;  4BNC A;  3FBI B;  3MWM A;  4DYR A;  1D1C A;  5B1B H;  3GFJ A;  2M8G X;  5DUK A;  3CDH A;  1QPI A;  2EA4 A;  4AYB A;  1T2K A;  3ASN H;  2DA6 A;  4JOM A;  2CW7 A;  3FXK A;  2WAD A;  2CFX A;  4XSX F;  2HZD A;  3O3K A;  3HOT A;  2LFB A;  3QOP A;  4P9U A;  1WJE A;  5D6E A;  1U9O A;  4YG2 F;  1U5T C;  2X51 A;  5FLV A;  2DQL A;  2PN6 A;  3OIQ A;  2QSH X;  2VKH A;  4LK1 F;  3CC7 I;  2FD5 A;  5D5U B;  3ZQL A;  5FD5 A;  3WTT C;  2R7Z J;  3ROU A;  2O5R A;  3IH3 A;  2HXO A;  1TC3 C;  3CCQ I;  3GXO A;  4M6X A;  5C3E J;  3BG5 A;  4M9S A;  1JUP A;  1WJD A;  4LLL A;  1S9H A;  1MMN A;  5CQE A;  4FX4 A;  5J8C A;  2A5W A;  1MBH A;  2OD5 A;  4PFP A;  3M8J A;  2GA2 A;  4XOP A;  2KJB A;  5JFR A;  4LG0 B;  4XN3 A;  5IP9 J;  2LYC A;  3CD6 I;  5E1Z B;  2ME6 A;  3BOQ A;  3S1N J;  3WU1 B;  3VOD A;  5DCM A;  4GCV A;  4R8H A;  2K3F A;  1XDU A;  2ESN A;  2RAE A;  3KP5 A;  1KYZ A;  2L4A A;  2ELK A;  2K4J A;  3MCZ A;  3CMA I;  4BJ5 C;  4EJV A;  5IY5 H;  1JT0 A;  5D5W B;  1T98 A;  4NC8 A;  1JKP C;  3QPL A;  3GZN B;  4IF4 A;  2B63 J;  4KIS A;  3KET A;  3A01 A;  4PJJ A;  3MN2 A;  1A35 A;  3CTA A;  2EFW A;  4BQN A;  5HDN A;  3JRG A;  5ILS A;  4BXU A;  3GTL J;  4RAY A;  3FXJ A;  3QQA A;  1AOY A;  4A6D A;  4HX4 A;  1YJN I;  1XSV A;  4MNU A;  1U3E M;  3S8P A;  2GAU A;  3TW7 A;  2ZJR F;  4MEX F;  2IGO A;  4I09 A;  2IGM A;  2DU9 A;  2DA2 A;  2ZBK A;  3E5X A;  3OIP A;  1I3A A;  2FBH A;  1BIA A;  1SFX A;  2KFD A;  3CLQ A;  3SEQ A;  3ABL H;  1SD7 A;  1FBU A;  2EWN A;  2PMH A;  3AFH A;  2IEK A;  3JAM Z;  2E7X A;  1S8N A;  1STZ A;  4ESF A;  4BBS J;  4CDG A;  3T0Y A;  1A6Q A;  3MAJ A;  3SXY A;  4PDK A;  4D9J A;  3S17 J;  2GA1 A;  2CO5 A;  3CP8 A;  1QRY A;  1MBF A;  3V7C A;  4FE4 A;  1XGN A;  4A0X A;  1OCR H;  5D4S A;  4XMY A;  2VXZ A;  2KRC A;  1MZB A;  2CG4 A;  1JGG A;  1UST A;  3KFW X;  5ED4 A;  4BY1 J;  5LGN A;  3CO6 C;  1I6H J;  5IT9 Z;  2E35 A;  5D5V B;  1H88 C;  3GBG A;  2KKO A;  4HF0 A;  3VDX A;  4C2U A;  3V7S A;  1MBG A;  4PZJ A;  3SYT A;  2A69 F;  2BY3 A;  4CIC A;  4V19 K;  3DFG A;  2E5N A;  3LA7 A;  2ZXJ A;  3DLA A;  5DCF A;  1X1B A;  5EJC A;  4NBQ A;  5HNH A;  4PK4 A;  5GP9 A;  4FTH A;  1YO5 C;  3PIO F;  4LG3 A;  3OYK A;  3OYE A;  2R7S A;  4HNU A;  2HNH A;  2L7K A;  3I54 A;  3BR5 A;  3ZMT A;  3K9T A;  1FEX A;  3C1D A;  2WY7 Q;  1R1T A;  2BE5 F;  2XAF A;  4ENK A;  1ZQ3 P;  1KU7 A;  3E1S A;  3L7W A;  1J9I A;  2M7B A;  2DMT A;  2O8X A;  1U8R A;  4WX9 A;  3G4S I;  3D5R C;  1FIP A;  4MFD A;  5E1X A;  1N78 A;  1FMV A;  3V8J A;  1LNW A;  2HZT A;  4OMY A;  3W2A A;  2BW3 B;  6PAX A;  5FRN A;  3G73 A;  2W48 A;  1XPX A;  3L2V A;  2K40 A;  2XRL A;  2ZME B;  1RZ4 A;  2HOE A;  2QZ8 A;  2IXS A;  1LE8 A;  1ETK A;  3HSF A;  3M7G A;  1IXS B;  3MVP A;  4KJZ A;  3VYR B;  3LNQ A;  2XB5 A;  3FK7 A;  3QU3 A;  2DMN A;  2CFO A;  3I56 I;  3LMM A;  4P9F A;  1FX7 A;  4BEH A;  4C2T A;  1XN7 A;  2YX4 A;  2KZG A;  4HRI A;  1B72 A;  3K10 A;  3DEU A;  4Y3O A;  1IUF A;  2JUG A;  2YR2 A;  3GFM A;  3U21 A;  4XLC A;  3OYF A;  3J7A Y;  4NC7 A;  1R4M B;  2Y2Z A;  1JKR C;  5DYM A;  3F8C A;  2FUG 2;  4LLG F;  4S04 A;  4BXF A;  2FQ3 A;  2E1N A;  3GW2 A;  1MJA A;  2ZKZ A;  2CWE A;  5E3N A;  2BY2 A;  1HLV A;  1BI2 A;  1ON1 A;  2E1O A;  3C2B A;  3E5Q A;  4E70 A;  4FQG A;  3F8N A;  4S05 A;  2L9R A;  3K6G A;  3BQY A;  2DT5 A;  4KIB A;  2FRH A;  2STT A;  5IYC J;  1VQ4 I;  3HDD A;  2KZV A;  1RI7 A;  2KIS A;  2L9V A;  5L3B A;  3EUK L;  2XGE A;  2Q0O A;  1WH5 A;  5D8L B;  2LR8 A;  2A6E F;  2LKX A;  3HKZ N;  2R7W A;  4E7S A;  4L9J A;  1VTN C;  4F55 A;  1E3H A;  2XGX A;  1IRF A;  1KA8 A;  2XKP A;  3ECO A;  3LSH A;  4BE0 A;  2O3F A;  2F5E A;  2E5Z A;  4L9V A;  1KU3 A;  2K02 A;  1E17 A;  2BXZ A;  2WWY A;  3L09 A;  3MQ0 A;  3PQJ A;  3JSO A;  4A3M J;  1S3J A;  1D3Y A;  4ASN A;  4ITV A;  1VI0 A;  2MAB A;  2N8G A;  4Y33 A;  5H6Q A;  5HS7 A;  2JMW A;  2Z9O A;  3BR0 A;  3NAU A;  3JAM K;  2EQR A;  4O3M A;  1TWA J;  2LBF A;  3OYL A;  3HOY J;  2BZT A;  2CV2 A;  1KQ9 A;  3JSP A;  1VQ7 I;  1ULY A;  1PP8 F;  1BBY A;  2KP6 A;  3JRC A;  4ZJZ A;  4ZDP A;  1O3T A;  3ASO H;  2PMU A;  4HX7 A;  3L2C A;  3H35 A;  3N97 A;  1NK2 P;  3FXL A;  1RES A;  1USS A;  5GTI C;  5IT9 K;  2ZJ2 A;  4IHY A;  2MW8 A;  1Y1W J;  4A93 J;  4YII A;  5LD2 C;  3OOU A;  4KIC A;  2G7U A;  2EB7 A;  1IXC A;  4BUP A;  1J2X A;  1V5G A;  2OTJ I;  3FKJ A;  3IKT A;  3CDI A;  4AIJ A;  5LBQ A;  3NRV A;  3ZMS A;  2OTL I;  4MHG A;  2LF7 A;  2EIL H;  1BA5 A;  2W57 A;  1D1B A;  5J4V A;  3Q3S A;  2ADU A;  2W25 A;  3G1M A;  1ZAR A;  2R7U A;  2MLG A;  4XLE A;  3HHH A;  3PFY A;  2WBM A;  1BC7 C;  2L02 A;  2JVH A;  3U9G A;  1UZC A;  1DU0 A;  1M1E B;  2F5C A;  1FT9 A;  1Y0N A;  3FF5 A;  4PSW A;  1BR4 A;  2AXL A;  3BY6 A;  2R0Q C;  3VB2 A;  3ZRG A;  5J4Y A;  3G3Z A;  4L9T A;  1U5T B;  2MFZ A;  2K86 A;  2M30 A;  2R93 J;  2R7D A;  3F72 A;  1PUF A;  1MJB A;  2CYY A;  3W2V A;  3BJ6 A;  4IHT A;  2GQQ A;  2C6Y A;  1G4D A;  3PO3 J;  3HUG A;  1YX3 A;  1R36 A;  2P5V A;  3OMY A;  1J09 A;  4BH9 A;  2WY8 Q;  1Y39 A;  1CF7 A;  3OS1 A;  1FOK A;  3MKW B;  3K4K A;  2J5O A;  4N9H A;  2R5Z A;  3KE2 A;  1MSE C;  1OR7 C;  1KZH A;  2KDZ A;  1QPM A;  1GHC A;  3I9V 2;  4E7K A;  3K1M A;  3G1O A;  2W24 A;  1MBJ A;  2BYV E;  3MMY B;  3RCO A;  4B8X A;  4A3G J;  3EYY A;  2KLO A;  4PGG A;  3ZGK A;  4EV0 A;  2BEO A;  2VE8 A;  3RKW A;  3ZXS A;  1BW6 A;  1LQ1 A;  3DPT A;  2KPM A;  3CMM A;  4M3G A;  2H27 A;  3JR9 A;  3MKL A;  3MEX A;  4E7H A;  2HQR A;  2QWW A;  4XOR A;  2RKH A;  1R00 A;  3JTH A;  2K3P A;  4AVP A;  4FT8 A;  2PJR A;  3RKY A;  3RZD J;  1OCO H;  3TDZ C;  4B3X A;  2WA0 A;  2DAO A;  2ME0 A;  2PEX A;  5K5R A;  5DM6 F;  2OUM A;  3WTX C;  1YQA A;  1UB9 A;  4QPQ A;  3I3L A;  4U0W A;  4YRV A;  1HQC A;  2FNP A;  2K9N A;  1WJC A;  4HV6 A;  1GXQ A;  3FM3 A;  1X19 A;  5D4R A;  1ZGW A;  1K4T A;  2XIG A;  3ECH A;  3CCE I;  1VQ6 I;  3OS2 A;  4ZZL A;  1SAX A;  1EA3 A;  1OCC H;  3IKV A;  2L7Z A;  1IXR C;  4UB8 C;  1ZYR F;  1S6L A;  1T08 B;  3MZH A;  3GX4 X;  3FIW A;  3R4K A;  4Y4R A;  5EEH A;  4B48 A;  2DTZ A;  2VLA A;  1SMT A;  1WJF A;  4L5J A;  4M6Y A;  2ECC A;  2PMZ N;  4LJZ F;  2DW4 A;  3ZQC A;  2KQR A;  2LC2 A;  5IOZ A;  3CCY A;  1GDT A;  5J3L A;  4PJN A;  1MKM A;  1YIT I;  4DNC A;  2M9H A;  1XD7 A;  4OIN F;  5EG0 B;  5IP7 J;  3M9A A;  1ODD A;  2L2O A;  3LSI A;  1MJ9 A;  4RGU A;  1NHA A;  4PJM A;  3SZT A;  3D5S C;  2I8D A;  3DLL F;  2K7L A;  2KT0 A;  3DQV C;  4AC0 A;  3AL0 C;  1QBJ A;  3W2W A;  2Q2E B;  3P5J A;  1QO0 D;  3KP2 A;  2G9W A;  3VFZ A;  2M0M A;  2GLO A;  2NVY J;  3I59 A;  2ZCW A;  2EFP A;  4HQE A;  2MG4 A;  2RGV A;  3LFU A;  2D2W A;  3H1C A;  3M1C A;  2ZJP F;  1OMI A;  3JRA A;  2EIM H;  5LRS A;  1DUX C;  1TQI A;  2RRE A;  2JSC A;  2W4S A;  4Y52 J;  1JT6 A;  1D1A A;  2VQC A;  3V42 A;  4RGS A;  3K2A A;  3QAH A;  4YFN F;  1ETQ A;  5DUI A;  3HGG A;  1QVT A;  2BHZ A;  2JK3 A;  3TDU C;  5JR3 A;  4A3B J;  2VOP A;  2DXI A;  3DTK A;  3CJR B;  3PNV A;  5B66 C;  3H9J A;  5F0C A;  4N4O B;  3FWE A;  4BE2 A;  2DCE A;  1BJZ A;  2EFQ A;  3CCS I;  2NXN B;  3ZQQ A;  5KAI C;  2WTE A;  4G94 A;  3P9I A;  2LK2 A;  1N77 A;  1POG A;  2G0E A;  5BS6 A;  1B8I A;  4CH7 A;  4EJT A;  2E1M C;  4ZYH A;  1GV5 A;  2ELJ A;  2P5K A;  3WGH A;  2V1N A;  3HRU A;  1UG0 A;  3LSM A;  3MD2 A;  4D7N A;  3BR1 A;  4L0Y B;  1JUM A;  4HOB A;  3Q0U A;  5F0F A;  2PLY A;  2XPV A;  3JRI A;  5LEJ A;  2Y0S N;  3QPS A;  4F92 B;  5F1R A;  1RC9 A;  5K7F A;  2VQL A;  2PX9 A;  4EM2 A;  3WOD F;  5JHU A;  2UZK A;  2GXA A;  2PQ8 A;  4BY7 J;  2LSO A;  3AG2 H;  3HGY A;  4HF2 A;  3QOE A;  4XKV A;  3KLO A;  3LST A;  3CME I;  1SVO A;  3KLN A;  1TP4 A;  3REO A;  3SQN A;  5J6X A;  3K4J A;  3KCC A;  2P4W A;  2ISY A;  3S3O A;  4OWR B;  2L5Q A;  2XUB A;  3IC7 A;  4IVN A;  5FKL A;  1R6R A;  2DTR A;  2OCE A;  1FSH A;  4H0E A;  2HEO A;  5KNL A;  2L9N A;  3QU6 A;  1L3L A;  3DWL E;  3WGI A;  3T8R A;  1LPQ A;  1F43 A;  5JHF A;  3RI4 A;  1FP1 D;  2MBF A;  2F5V A;  3K7A J;  3QP6 A;  5L3E A;  2AQF A;  2D1V A;  3IH4 A;  2DOE A;  3HPH A;  3K4M A;  1QNT A;  5E3O A;  1FWZ A;  2F4I A;  1X1P A;  4HYE A;  4RLF A;  2CQN A;  1S7E A;  2HOT A;  3RDI A;  2VJ5 A;  1PVE A;  1Y56 A;  2PJP A;  1BOB A;  3B73 A;  1I1S A;  4JYK A;  1BJA A;  2CUZ A;  2X4H A;  2ZO4 A;  4BAC A;  2EV6 A;  2DA3 A;  5JLX A;  2JSP A;  4C2M J;  3OSF A;  1G3Y A;  1PJR A;  3BDD A;  4LIT A;  2W7N A;  3ISP A;  4XLN F;  1EKE A;  4N0B A;  3R60 A;  1BR2 A;  2R5Y B;  5M5X J;  3OWT A;  4A5N A;  5LGU A;  3VWB A;  4M71 A;  1IW7 F;  1R22 A;  3GTP J;  2FXA A;  3U2R A;  4IEJ A;  4BQQ A;  4G6Q A;  4G7Z F;  4G7H F;  2DLL A;  3CO7 C;  3M3Y J;  3LA3 A;  1P6R A;  5F04 A;  1JGS A;  1FNN A;  2FEZ A;  5LLQ A;  3UKG A;  1IDZ A;  4M3E A;  2L01 A;  3L00 A;  3V4G A;  2XSD C;  5A2Q Z;  3CCJ I;  4XKC A;  3K69 A;  5FKM A;  2XF7 A;  4HBL A;  2IBD A;  3KYC B;  4ZDO A;  5HLG A;  3EUH A;  3BCA A;  3K70 D;  4KIT B;  3DU5 A;  4I98 B;  3SFZ A;  2VPR A;  4DIQ A;  2NVT J;  3GFL A;  3VPR A;  5FKO A;  1XB4 A;  4YFX F;  1IN4 A;  2QBY A;  5HDK A;  2B7E A;  2IRF G;  1R5H A;  2W84 A;  5BQT A;  2QQA A;  4ESJ A;  2GOX B;  4CA0 A;  2O61 A;  2IT0 A;  4CYC B;  3GUD A;  3G1L A;  3OL4 A;  2DFI A;  4DJA A;  1P2F A;  4XOT A;  3KIO A;  3EUA A;  2YSR A;  4PJL A;  3GME A;  1A6I A;  2FMY A;  3CCR I;  4NB5 A;  1AA7 A;  2EV5 A;  3S2D J;  3FHN A;  3J7A O;  2HI3 A;  2A3S A;  3AKZ A;  3H9Q A;  2P5L C;  2XPW A;  5L3G A;  2M4G A;  2X1D A;  3CC2 I;  4W1U A;  4KA4 A;  2F4O B;  4KT5 C;  4C30 A;  4FAS D;  1D0Z A;  2A6H F;  2CQ7 A;  4F52 A;  4RBO A;  2OU2 A;  4WXD A;  2LY9 A;  4LIU A;  4BJT A;  1LVA A;  4OIP F;  2HYF A;  3OR2 C;  1WI9 A;  1ZTR A;  3I58 A;  1G3T A;  2IGN A;  3VEP A;  4ZYA A;  3OYJ A;  2FSW A;  2IAI A;  2NNN A;  2M7A A;  2HVQ A;  4E4H A;  4CO8 A;  3KP3 A;  4F91 B;  4B43 A;  2BXY A;  1W7P A;  3V8K A;  1X2M A;  4FCY A;  4CZC A;  4D0P A;  1ZR2 A;  3H3U A;  1Z1D A;  1OCZ H;  3FBN B;  4KN7 X;  3WG7 H;  2G7H A;  2RDP A;  3VYU B;  1YIJ I;  4FE7 A;  3WTW C;  3H5A A;  4MIM A;  4RAZ A;  5B5E C;  3HXL A;  3J81 Z;  4QIW N;  2HQN A;  2OZU A;  2R7R A;  4G7O F;  5FLX Z;  4XBF A;  5GAG J;  3QPT A;  2GIZ A;  3D0S A;  5DS9 A;  2AS5 F;  1IG7 A;  2UXX A;  2V1D A;  3T5X A;  3E0J B;  2FBK A;  4I7H A;  3ZOB A;  2HQA A;  1IO2 A;  2FF4 A;  1JTX A;  1UAA A;  3R61 A;  2K5C A;  2VBY A;  1R49 A;  2NRA C;  2HTJ A;  1ZH5 A;  2MLK A;  2DK8 A;  2ZXH A;  2LDU A;  4AVZ A;  3JRE A;  3HBL A;  3MFK A;  4Y15 A;  1LJ9 A;  3S15 J;  3OYC A;  1HW1 A;  1XX5 A;  2R4G A;  2Z2S B;  1YRN B;  4HG2 A;  1IRZ A;  4J01 A;  3M8F A;  3HOS A;  1W36 D;  4OAZ A;  2H8R A;  1T8I A;  2JA8 J;  4LFU A;  3RYR A;  1S7O A;  3S1Q J;  3TO9 A;  1ZG5 A;  2PFB A;  1HST A;  5F6F A;  3JCU C;  5AIP A;  3IAM 2;  3CLO A;  3UNG C;  2Y9Y A;  3ZMD A;  2QEX I;  1F1Z A;  3HKZ A;  1MBE A;  1RR7 A;  3H92 A;  4AD9 A;  5JVT A;  2F48 A;  3C2G A;  5EZH A;  4M74 A;  3M07 A;  4GXO A;  4EMS A;  2NS7 A;  5A2Q K;  3H3Z A;  3OYD A;  2Y69 H;  2MD5 A;  3E7L A;  1ACI A;  1HW5 A;  4PCQ A;  5CVV A;  3ZQI A;  3J80 Z;  3LSG A;  3E6C C;  2VBZ A;  4DZJ A;  1PDN C;  3BTL A;  5JLW A;  1FY7 A;  4UUS A;  1ZRD A;  1W5T A;  3F0C A;  3GCM A;  1T33 A;  1Q1H A;  1J0R A;  2FOW A;  2P81 A;  2CGP A;  3KZZ A;  1XCV A;  4UB6 C;  2HOA A;  5EEG A;  3DEW A;  1TZL A;  1NG6 A;  4KMU X;  2NAZ A;  3M4O J;  2EFN A;  5ICE A;  1D0X A;  3OIO A;  2NS0 A;  3CZ6 A;  1BL0 A;  4KIF A;  5M5Y J;  3CC4 I;  1X3U A;  3FXQ A;  1J5Y A;  1UCR A;  3A4C A;  2EBI A;  3HSE A;  1R71 A;  5DM7 F;  2VQH A;  3CUQ A;  3JRB A;  3OYM A;  1ZGA A;  1SEU A;  2MGQ A;  5JVG F;  4IOA F;  5EZG A;  2E1M B;  2GIV A;  3DTE A;  2DA7 A;  4HX8 A;  2X6X A;  1T38 A;  3PSI A;  1XG1 A;  2MYS A;  3LFK A;  2ZC2 A;  3WG9 A;  1TW3 A;  2DFE A;  3HTU A;  4CYD A;  3DBR B;  1EF4 A;  4BHC A;  1VQN I;  2L0K A;  2X9D A;  5FD6 A;  3QWL A;  1S72 I;  1SVM A;  2FE3 A;  2GXB A;  2R92 J;  4M9X A;  2FML A;  2ACJ A;  1IJW C;  1HKQ A;  4P55 A;  2EIJ H;  5GTH C;  1TW2 A;  4L5I A;  4AYB N;  2BVM A;  4AU7 A;  5DV5 A;  3KZY A;  3OSG A;  4S0H B;  3TMO A;  1J59 A;  2XPU A;  3H5N A;  1FIA A;  3BTC A;  3IHU A;  4ZTJ A;  2IS2 A;  1LB2 A;  1JKQ C;  3HOZ J;  3IP4 B;  5LHH A;  4YFK F;  5CVR A;  1X4O A;  2X6Y A;  3DPU A;  1W7P D;  2K9Q A;  4RB2 C;  1YJW I;  3AG4 H;  1VQ8 I;  3F8B A;  5LFA A;  1P7I A;  4WWC A;  4MTE A;  1T0F A;  3F3X A;  1I50 J;  1BI1 A;  1R5G A;  4CCN A;  1F5T A;  2ZXW H;  4XN0 A;  1ZG1 A;  3J81 K;  3ERE D;  2KIM A;  3SJM A;  1Z91 A;  2Y31 A;  3WHB A;  5FLX K;  2FQ4 A;  4ZYE A;  1VQ9 I;  4NNJ A;  2NOG A;  2PI0 A;  2XKO A;  2K4B A;  1O7F A;  1SD5 A;  1ZAO A;  2KJC A;  2B0L A;  1FBS A;  3H0G J;  1SD4 A;  4HNV A;  4Q4Z F;  3FIS A;  1Z6R A;  1O57 A;  4HEA 2;  5H6R A;  5EGO B;  2D45 A;  1AKH A;  4XRM A;  3WGG A;  4EM0 B;  2Y30 A;  2QSG X;  5CLS A;  1IV8 A;  3PSF A;  3C7J A;  3CCV I;  2B9S A;  4RB1 A;  3V7R A;  1HBX G;  2L9S A;  2BVL A;  1W1W E;  5L3C A;  1TTY A;  1HXD A;  1SFE A;  4XKB A;  3DKY A;  2O8K A;  2HDW A;  4U0V A;  4OAY A;  5H20 A;  3BWG A;  4BE1 A;  3ESW B;  2IA1 A;  2LRD A;  1W5S A;  3J80 K;  1N25 A;  4NDL A;  3HRM A;  1H8A C;  1WJ5 A;  2QKM B;  1XS9 A;  1YJ9 I;  4A69 C;  4KN4 X;  1XGM A;  2QM3 A;  5HVQ C;  3O2P E;  1OYW A;  1W0U A;  1QA6 A;  2LRE A;  2Z99 A;  4B3A A;  1K78 B;  4JK1 X;  2DOA A;  1N75 A;  1Q1V A;  4R1H A;  3CCM I;  3E5U A;  2V1U A;  4CGZ A;  3HPG A;  4IO9 F;  1QZZ A;  2WC2 A;  4NHJ A;  5CPR B;  3T8T A;  2LP0 A;  2WB1 N;  3B02 A;  5M3F J;  5HS9 A;  1W5C C;  2HYJ A;  4P5O A;  2EZI A;  1RIO H;  4UY8 I;  2ZSI B;  1MMA A;  3ELK A;  2XF5 A;  1OYI A;  2O03 A;  4KT6 A;  1G3W A;  2F5F A;  2QCO A;  1YYV A;  2EZL A;  3L2R A;  3KYL A;  3NWT A;  1Y8R B;  1OQY A;  3DU6 A;  4I01 A;  4LG0 A;  4KNY A;  3DBL B;  5E8I A;  3BJO A;  1LDK B;  1I27 A;  1JHF A;  1Z21 A;  3FXU A;  4UV8 A;  4ZC3 A;  1WI3 A;  4ENN A;  5J1R A;  1U8B A;  2JQ7 A;  3KP4 A;  4GYI A;  3D5L A;  5J8F A;  2D1H A;  2JTV A;  2XB0 X;  2ZFW A;  2DDA A;  1KU9 A;  3OYG A;  3QP5 A;  1Y6I A;  1TWC J;  3Q9V A;  2VBX A;  2HKO A;  3GLX A;  3S2H J;  5LHG A;  4OOI A;  1JJ8 C;  4GGG A;  1TBX A;  4XK4 A;  1FMW A;  3GF2 A;  2R7X A;  5BNG A;  4WXH A;  3L9F A;  1S5L C;  4EM1 A;  2MC4 A;  2Q1Z B;  3FMR A;  4HZF A;  1IV6 A;  1QU3 A;  2ISZ A;  4LD5 A;  4ZYD A;  2XGD A;  1WGX A;  3HOU J;  2HXI A;  2VUM J;  2JA5 J;  1IN6 A;  1OCP A;  3HOW J;  1XSX A;  4HST A;  3S1R J;  1WHU A;  1IZ1 A;  2F5D A;  4BHB A;  2LH9 A;  1S7A A;  4HDV A;  3SHF A;  1G8X A;  1XGO A;  2K9M A;  1ZLK A;  3A1Y A;  2W85 A;  1I3Q J;  2L7F P;  2A61 A;  3KP7 A;  5EYR A;  1Z67 A;  4DZP A;  1F4K A;  2JA7 J;  3HOV J;  5LGT A;  4A0Z A;  1MDM B;  4U88 A;  1NTC A;  1OLT A;  2QQ8 A;  5CVJ A;  3WE3 A;  4NQW A;  1R58 A;  5LHI A;  3B6A A;  1IAW A;  1W0T A;  2V9P A;  4ANJ A;  4EVI A;  3FMS A;  3QYE A;  4X0G A;  4DQ2 A;  2X6W A;  1ERD A;  2A07 F;  2Y0S A;  2E19 A;  4CCK A;  3ERM A;  3BLY A;  3QYB A;  4M3F A;  3OR1 C;  4HSR A;  1DP3 A;  1C0W A;  2Y0M A;  3BZC A;  2CS3 A;  1YX5 A;  2WV1 A;  2Y9Z A;  2QLZ A;  1R7J A;  2QA4 I;  4KYW A;  3I71 A;  1MMG A;  1H9T A;  1YI2 I;  3PJR A;  2E60 A;  5GAE J;  2YX7 A;  4UUT A;  1ZG3 A;  1Y1V J;  5L3F A;  4R79 A;  5ICG A;  1LKX A;  1U6G A;  2K85 A;  4XLH A;  3O6B B;  4V2G A;  1R9T J;  4Y7N J;  2MA3 A;  1JXS A;  5E3M A;  3GLL A;  1IGN A;  1I39 A;  2H1L A;  2TDX A;  3BR2 A;  5D6F A;  1XSD A;  4UVA A;  1PP7 U;  3F8M A;  4IRG A;  2BW3 A;  3F6V A;  3PNY A;  4MQV A;  3ZN0 A;  2VKE A;  2A05 A;  4XON A;  1OIS A;  2ZME A;  1FTT A;  3F21 A;  2JPC A;  1EH8 A;  2EZH A;  1REP C;  2KIU A;  4WK8 F;  4OIO F;  3BPV A;  2DI3 A;  2M5W A;  1B1B A;  1V54 H;  4GDF A;  3Q9S A;  4EAT A;  4HNT A;  1A04 A;  4I2O A;  4A3I J;  4KMF A;  3DKW A;  4NC6 A;  2J5P A;  3TL4 X;  3PFI A;  1LEA A;  1CQT A;  3BCB A;  2IA2 A;  1BC8 C;  2Z1D A;  4LOC A;  5IPA A;  1VQK I;  3RPQ A;  1OCT C;  4PUS A;  1VFC A;  2OC6 A;  2DFF A;  1Z77 A;  2E1C A;  2CQK A;  3KYD B;  1LEB A;  4AUX A;  2MSY A;  1VQM I;  1VQO I;  4XLP F;  5J1Y A;  4LGW A; 
#chains in the Genus database with same CATH homology
 4XMY A;  2VXZ A;  2KRC A;  2HPI A;  4DOZ A;  1MNE A;  1UEL B;  3GBG A;  4XNF A;  3VDX A;  4C2U A;  2V7F A;  4JQF A;  3SYT A;  2BOL A;  2GOX B;  4CA0 A;  1Z7L A;  2E5N A;  1T0F C;  2KMU A;  3OL4 A;  3DLA A;  4DJA A;  4YEJ A;  1X1B A;  4XOT A;  5HNH A;  4PK4 A;  3SZG A;  1WJA A;  3EUA A;  3DKX A;  4LG3 A;  4HPQ A;  4PJL A;  3OYE A;  3OYK A;  2R7S A;  2ZFU A;  4HNU A;  2HNH A;  3IUO A;  2L7K A;  2VXD A;  1AA7 A;  1SFK A;  1YE9 A;  3FHN A;  2WY7 Q;  3AKZ A;  3H9Q A;  2W00 A;  3K70 D;  3RQ4 A;  2M4G A;  2X1D A;  3E1S A;  2M7B A;  1K6Y A;  3W3C A;  4P1W A;  4IX7 A;  2HPM A;  3D5R C;  4C30 A;  4DIQ A;  4FAS D;  1FMV A;  1D0Z A;  1N78 A;  2HU9 A;  4G6T B;  4F52 A;  3W2A A;  2BW3 B;  4LIU A;  4BJT A;  4E7L A;  5FRN A;  3DEE A;  4DBQ A;  3L2V A;  3CES A;  3OR2 C;  1DGW Y;  2AQE A;  2IXS A;  4CCM A;  1SAU A;  2IGN A;  2VJJ A;  4ZYA A;  3VYR B;  4KJZ A;  3OYJ A;  4E6K G;  2M7A A;  2HVQ A;  4E4H A;  2CFO A;  4IQJ A;  3VSK A;  4B43 A;  3LMM A;  4F91 B;  4BEH A;  4C2T A;  4GRI A;  4CCO A;  4HRI A;  3K10 A;  4Y3O A;  3F9K A;  2JUG A;  4CZC A;  4XL9 A;  4XQF A;  3U21 A;  4XLC A;  3OYF A;  3J7A Y;  4NC7 A;  3BC8 A;  1U0J A;  1DGR M;  3FBN B;  2FUG 2;  2VJ4 A;  3KEY A;  3HG9 A;  2X1E A;  4BXF A;  3MKZ A;  3OYN A;  3VYU B;  3HL2 A;  3ONQ A;  2W82 A;  2VPL A;  3H5A A;  1X1A A;  2VQG A;  3HXL A;  2CV0 A;  3RTR A;  3BG7 A;  3ZCO A;  2R7R A;  1MW7 A;  2IS6 A;  3K6G A;  2CW8 A;  2WAQ A;  3G2B A;  3RPU D;  3OYI A;  2R7O A;  3E0J B;  2HQA A;  2VAS A;  4N4N B;  2KZV A;  1UAA A;  2K5C A;  3L2W A;  3EUK L;  4H4K C;  2ZXH A;  2CUJ A;  2RNG A;  4AVZ A;  2F6C A;  2R7W A;  5HLT A;  4BS9 A;  4E7S A;  3OYC A;  1GLN A;  2R4G A;  2Z2S B;  4F55 A;  4HG2 A;  4J01 A;  3HOS A;  4BU2 A;  3PL8 A;  1W36 D;  5CQG A;  4OAZ A;  4BE0 A;  3LSH A;  2E5Z A;  4E7I A;  1D0Y A;  3S32 A;  2XF6 A;  3IAM 2;  4DGW B;  1KON A;  3UNG C;  1LVK A;  3HKZ A;  4ITV A;  2MAB A;  2VL8 A;  4Y33 A;  3C2G A;  3K70 C;  2GOM A;  4RMN A;  2VKD A;  2LBF A;  3FDY A;  3OYL A;  3OYD A;  2CV2 A;  1QHG A;  3DTI A;  3LSG A;  4BDY A;  3ZR8 X;  2LY2 A;  2VIX A;  2LOO A;  2KP6 A;  1LFP A;  4ZJZ A;  4XM3 A;  4ZDP A;  3H0D A;  3H35 A;  4CSW A;  3K4N A;  4BEH B;  4IQ4 A;  5LD2 C;  1E0E A;  1TZL A;  1NG6 A;  3OOU A;  4F3Q A;  4RM2 A;  1D0X A;  3CP2 A;  3CZ6 A;  3MKY B;  4BUP A;  4CCL A;  3A4C A;  3H9G A;  1V5G A;  3FKJ A;  2VQH A;  3OYM A;  2MD0 A;  2A6T A;  1D1B A;  2W1O A;  2HVR A;  2E1M B;  3DTE A;  2X6X A;  4BGD A;  3PSI A;  3KX2 A;  2R7U A;  2MYS A;  3SEZ A;  4XLE A;  3PFY A;  5KCM A;  2WBM A;  3S3M A;  3BG6 A;  2JVH A;  3VYS B;  4CUG A;  5TGT A;  4PSW A;  1BR4 A;  3ZRG A;  2VB6 A;  4B44 A;  4IZZ A;  2MFZ A;  1MMD A;  1WJB A;  3OYA A;  2IS1 A;  3QYF A;  2BVM A;  4AU7 A;  3W2V A;  1V5F A;  2LY1 A;  1X1C A;  3TMO A;  2R7V A;  2V4J C;  3CF2 A;  1YX3 A;  3H5N A;  4ZTJ A;  2IS2 A;  3OMY A;  1J09 A;  2WY8 Q;  2WAF A;  3IP4 B;  1X4O A;  2X6Y A;  3DPU A;  4NUB A;  3OS1 A;  5LFA A;  3MKW B;  3K4K A;  2P0W A;  1OR7 C;  3LL7 A;  2LBF B;  3HC7 A;  4CCN A;  4XN0 A;  4MLO A;  2M4K A;  3QOD A;  3I9V 2;  4U7B A;  4E7K A;  3MMY B;  4NNJ A;  2HVS A;  3RCO A;  5KHD A;  2KLO A;  3ZGK A;  4U87 A;  1P9Q C;  3ZXS A;  1ZEL A;  2VJI A;  2R7Q A;  4HEA 2;  1W36 C;  3DPT A;  2KPM A;  4LIV A;  2R7T A;  3CMM A;  3L2U A;  2WAE A;  4DBR A;  1NG7 A;  1V5E A;  3PSF A;  4E7H A;  4XOR A;  2K3P A;  3C2H A;  4XKW A;  2DT7 B;  4XR6 A;  2RQQ A;  2XSJ C;  4II3 A;  3CJQ B;  4BQO A;  2CV1 A;  4F93 B;  3S3N A;  4B3X A;  2L9S A;  1PYV A;  2BVL A;  2WA0 A;  2OUM A;  4YEL A;  4QPQ A;  3I3L A;  3DKY A;  4XKB A;  2HDW A;  4FET A;  4QPO A;  4CCJ A;  4OAY A;  4BL0 B;  4YRV A;  1WJC A;  4BE1 A;  1X19 A;  3OYB A;  2LRD A;  3K4B A;  2UV1 A;  3VYT B;  3EPZ A;  3EUH C;  3OS0 A;  3AL0 B;  3SDB A;  5FRO A;  3OS2 A;  1EA3 A;  1WJ5 A;  2KDO A;  2QKM B;  2QKL B;  4RM3 A;  5HVQ C;  3HUG B;  3VSL A;  2ZXI A;  2LRE A;  4IKF A;  4BJ6 C;  4Y4R A;  4B48 A;  2M3A A;  2DOA A;  1N75 A;  2VLA A;  1WJF A;  4ZTF A;  2X85 A;  3H5R A;  1X4P A;  3HPG A;  5HOO A;  5CPR B;  2KQR A;  2LC2 A;  3OYH A;  4J00 A;  4P5O A;  4PJN A;  3N05 A;  1DQU A;  2ZSI B;  1MMA A;  2V6E A;  2IGK A;  2XF5 A;  1MND A;  2L2O A;  4KT6 A;  3LSI A;  1X1D A;  4PJM A;  3D5S C;  3NWS A;  2I8D A;  3L2R A;  3KYL A;  3NWT A;  2ZSH B;  3DQV C;  3DU6 A;  3AL0 C;  3W2W A;  2Q2E B;  2OV7 A;  1LDK B;  3PNT A;  1Z21 A;  2M0M A;  2WB1 A;  3K4L A;  4PFO A;  2KHM A;  4ZC3 A;  1Z3Y A;  4NQW B;  3LFU A;  3D5L A;  3M1C A;  1QHH D;  3LSK A;  3OYG A;  2RRE A;  2UWM A;  2W4S A;  2V9K A;  1Y6I A;  2VQC A;  1D1A A;  3V42 A;  1JI8 A;  2XAU A;  3L2Q A;  4ZDL A;  2JA2 A;  3OL3 A;  5FRM A;  5CKT A;  2JVG A;  3PUB A;  2PJR B;  1G59 A;  2DXI A;  3DTK A;  3CJR B;  2KRH A;  3PNV A;  3H9J A;  4N4O B;  2K9L A;  4BE2 A;  1FMW A;  3A2K A;  2DCE A;  1Z3X A;  2PJR A;  2R7X A;  3ZQQ A;  1WFX A;  1IRX A;  2XC7 A;  1N77 A;  2NOJ B;  2MC4 A;  2Q1Z B;  4CH7 A;  2E1M C;  2ELJ A;  3FBI B;  1QU3 A;  1D1C A;  3DPL C;  2V1N A;  1UG0 A;  4AYB A;  3LSM A;  4HST A;  3MD2 A;  2X1C A;  4JOM A;  2CW7 A;  2LH9 A;  2WAD A;  2HZD A;  3HOT A;  2KL4 A;  4RLQ A;  1G8X A;  1WJE A;  2K9M A;  4F92 B;  3A1Y A;  2VQL A;  2X51 A;  3S93 A;  1VZ0 A;  3OIQ A;  2LG4 A;  2VKH A;  1OLT A;  3QOE A;  4XKV A;  2O5R A;  3IAS 2;  3K4J A;  2UUZ A;  3TBI A;  4ANJ A;  1WJD A;  3S3O A;  1S9H A;  1MMN A;  3QYE A;  4OWR B;  2L5Q A;  2X6W A;  4XLF A;  2A5W A;  5CQE A;  4X0G A;  1ERD A;  2Y0S A;  4PFP A;  3M8J A;  4CCK A;  3BLY A;  3QYB A;  3OR1 C;  1R6R A;  4HSR A;  4II2 A;  4XOP A;  4D1Q A;  1DP3 A;  2CMP A;  4XN3 A;  2LYC A;  5KNL A;  2L9N A;  2CS3 A;  1YX5 A;  3DWL E;  2V26 A;  5JHF A;  2F5V A;  1MMG A;  2AQF A;  3PJR A;  2E60 A;  4PSX A;  3HPH A;  3K4M A;  2F4I A;  2XDV A;  4BJ5 C;  4NC8 A;  4RLF A;  4R79 A;  1LKX A;  3K4C A;  4XLH A;  2VJ5 A;  2IS4 A;  1Y56 A;  1BOB A;  4KIS A;  4PJJ A;  2CUZ A;  2CH0 A;  4BQN A;  3OY9 A;  4BAC A;  1HA8 A;  2BW3 A;  2JSP A;  3PNY A;  1PJR A;  4XON A;  2DJI A;  4LIT A;  3UR3 C;  2W7N A;  3S8P A;  2DT6 A;  1T95 A;  3RSN A;  1BR2 A;  1BR1 A;  3OWT A;  4B47 A;  4EAT A;  2IGO A;  2IGM A;  3VWB A;  4HNT A;  4C9Y A;  4XLA A;  3OIP A;  4BQQ A;  4E7J A;  3TL4 X;  3SEQ A;  2Z16 A;  3BCB A;  3AFH A;  2Z1D A;  2PMZ A;  4PUS A;  4E7Z A;  4XKC A;  5HNF A;  2OC6 A;  4BDZ A;  2XF7 A;  1TT0 A;  4D9J A;  4ZDO A;  3BCA A;  3CP8 A;  4KIT B;  3DU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...