1OR7C

Crystal structure of escherichia coli sigmae with the cytoplasmic domain of its anti-sigma rsea
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVMAAIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RNA polymerase sigma-E factor
publication title Crystal structure of Escherichia coli sigmaE with the cytoplasmic domain of its anti-sigma RseA.
pubmed doi rcsb
source organism Escherichia coli
total genus 23
structure length 66
sequence length 66
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03872 RseA_N Anti sigma-E protein RseA, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1or7C00
1OR7C
chains in the Genus database with same CATH superfamily
1D8JA 1LEAA 3DBRB 3DU6A 3E5UA 2CFXA 4P55A 2HQRA 5EG0A 2OJED 3FXMA 1O57A 3PIPF 1IV6A 1BC7C 2VL8A 2EFQA 4WK8F 4E7JA 5LRRA 4OAYA 2WY7Q 2R93J 2LOOA 1AWCA 1FWZA 4A3IJ 2B9SA 5ILUA 3ZP5A 2IEKA 1Y6IA 1YRNB 2K7LA 3HRTA 4KMUX 1HOMA 4BXUA 1YW9A 3AL0B 1TQPA 3CMMA 2CG4A 2MH9A 3E3VA 2XUBA 3KEQA 4ZZLA 2JUCA 5IYDJ 2FQ3A 4L18B 3G6EI 4N9HA 5DD8A 4EV0A 3FXKA 3E6BA 1YS7A 1IO2A 1U5TA 4E7ZA 3GXOA 3Q0UA 3HOWJ 1MD0A 4I76A 3CP8A 1X2MA 2MD0A 2ZMEC 3ABTA 3OIOA 4AC0A 2QWWA 3HSFA 3HYIA 5KVRA 2WTEA 2XSJC 2COMA 2JZYA 4OU0A 3TQNA 1Z0XA 4HX4A 2L54A 2CJJA 3GBGA 1WVRA 3V7RA 4A3BJ 4CCJA 3WTWC 4EM1A 1X1BA 2STWA 2CH0A 2DXIA 1ZRFA 2EV6A 5HNHA 3PSFA 2HDDA 2Z99A 3CJTB 2LFBA 5HS7A 4MFEA 2XF5A 2DFFA 1HKQA 2I5UA 3BR2A 5B1BH 1MMNA 4EGYA 1HA8A 5JHFA 3ONQA 1I5ZA 4L0ZB 1U9NA 1HBXG 1B6AA 3SEQA 1P4WA 2Y0SN 4A6DA 2WADA 2WBMA 2EQRA 5J8CA 1NHAA 2EK5A 1DUXC 1ZG5A 1XPXA 1HKTA 2EH3A 1ZGAA 1MSFC 2XRLA 3C1DA 3EDPA 3FX3A 3IAS2 4X0GA 3GZNB 2KZVA 3MKLA 4CH7A 2VLAA 1TWGJ 2H94A 4BE2A 4GFBA 3MQ0A 2HDWA 2V7FA 4M3FA 1OYYA 3M1CA 3RSNA 3VEPA 2LKXA 1I6HJ 3HPGA 2Y48A 4ZYAA 5LBQA 4PGHA 1WH7A 4ZDLA 2MSYA 2ZC2A 3D5LA 1JKQC 2PMHA 4F52A 1R58A 2BOLA 1R6RA 5DUKA 3H9GA 3TOBA 2IS1A 2MG4A 4XQFA 2LC2A 2UXXA 1S8NA 3HB9A 2HS5A 3J7AO 1JKRC 2KDOA 2Y75A 4JP0A 5J4YA 1LPQA 4IVNA 3VOEA 3L7WA 4J01A 4BDZA 2OQGA 4DIQA 4A12A 2IGKA 2XKPA 2FBKA 2YX7A 4GCVA 2NOJB 4JX5A 4NUBA 3DP7A 3HOUJ 2IA1A 2NS7A 2RREA 2XGEA 1QHHD 2L7FP 4C30A 3H35A 2DPDA 3IAM2 3VPRA 3KE2A 4P96A 4O5VA 2HOSA 3CCSI 2K5CA 3K69A 3SFIA 2EZKA 4IJAA 2F5CA 2YR2A 4EM2A 1IXCA 2EV0A 4I98B 1A04A 3F3XA 5F27A 1RI7A 3LAPA 2RKHA 3EPZA 2P7VB 4EATA 3A2KA 3DPTA 4PJLA 3OSGA 3TP0A 4IRGA 3ZMTA 3FM3A 3QRFF 4AIHA 2E36A 3QODA 1ZELA 1BR2A 2DLLA 3HKZA 1D0ZA 3SFZA 2BVLA 4BACA 2DOAA 3OL4A 3Q3SA 1HW1A 2O7OA 4EVIA 3E6CC 1Z7LA 1K4SA 4KIFA 1R4NB 4IHVA 3RPQA 2Y69H 3WU1B 2X4HA 4DGWB 1IUYA 4PJJA 4XKBA 5EZHA 1R23A 1W5CC 3E6DA 2FNAA 4R1HA 2NVTJ 2MLGA 3WGHA 2DA4A 1MMDA 3CLQA 3RCOA 1XTAA 2QQBA 3K0LA 3L2VA 1G3SA 3H36A 5FLXZ 2XPVA 1X19A 1X1AA 4UVAA 1YQAA 4M71A 4B8XA 5IOYA 2OAZA 2WC2A 1XX5A 4OOIA 4XOPA 4CCKA 2DQLA 2HZDA 3GTPJ 5E79C 3CCUI 5HDNA 1W4MA 4W97A 2EV5A 2QYOA 2CUEA 2K86A 3RIRA 5DDGA 4XNFA 1WJ5A 5ICCA 1U8RA 2GAUA 2QVOA 3D5RC 1XSVA 4S05A 3T5XA 2IP2A 1J7KA 1J09A 3CP2A 3ESWB 1I27A 3K4BA 1HW2A 1LFBA 4UB6C 3HSRA 1A36A 3BCBA 1FZPB 2F5DA 4RB0A 1VQMI 4G9YA 3RYRA 4KIBA 2DT7B 5ILVA 1RR8C 3KETA 4PSWA 2HXIA 3F8NA 1FX7A 3LSJA 1MMGA 3ZQIA 3KZYA 2O5RA 4WWCA 1UFMA 3DLLF 2LBFA 5ED4A 4Y7NJ 1SD6A 3OMYA 3AG4H 4HDUA 3CC4I 5J1UA 1HKSA 4EM0B 2GA1A 2OUMA 4Q48A 3BR0A 3P9CA 5M3MJ 3DKXA 2FX0A 1HCRA 2HDCA 1D1BA 2Y30A 3BQZA 2EPFA 1I39A 2GBYA 5CQGA 2XF6A 4BDYA 2DI3A 3SDGA 1TT5B 1UHSA 3RDIA 5F1JA 1Y0UA 1DU0A 2LKPA 3F6VA 3FDYA 4A3CJ 2JA5J 2AHQA 1U8BA 2CFOA 1BI3A 4FE4A 5IY5H 1XGMA 2NNYA 4PDKA 1E0EA 3O8GA 6PAXA 1YE9A 2DA1A 2H1KA 3ZRGA 1K79A 3IP4B 1ZRDA 2HR3A 3K6GA 3VFZA 3VYRB 3GFLA 2DA3A 2ICWG 1KQ9A 2DJIA 1G59A 3MZYA 3W6JB 1RUOA 3R0AA 4FETA 4BXFA 2KP6A 1QHGA 3IRQA 4JYKA 1KU3A 2KIFA 2XPUA 4DYQA 4HYEA 5D4SA 1SVOA 3ASOH 5CPRB 2ZNZA 4UVBA 2EIMH 3LSRA 1O3SA 5BS6A 1DP7P 1O3TA 1HXDA 4IO9F 1F43A 4MHGA 4II3A 1RKWA 2V4JC 3T1BA 3E6MA 2A07F 2GLOA 1HDPA 4BUPA 2O61A 3SZPA 1ZKGA 1GUUA 3J81Z 4QIWN 4D1QA 1KU7A 3FXJA 1HSJA 2O9LA 1XDUA 3ZQCA 2IAIA 1FNNA 3LQQA 1FYKA 1MKMA 3G73A 4IOCF 5IPAA 1VQ6I 5F0HA 2UUZA 2D1HA 3K1MA 1IW7F 5F1RA 4B43A 4ZYEA 2ME0A 4M6YA 1MH4A 2R0QC 4I99C 2PLYA 4MGRA 1WHUA 3M7GA 3ZMDA 2RNGA 3HTUA 1SFKA 4AYBA 2M4GA 2R5ZB 2FD5A 5BNGA 3S1RJ 2ZNYA 3OYBA 1WJEA 2JQ7A 3PFYA 1JGGA 3CDLA 5ICEA 2DDAA 2P5VA 4MEYF 3M8EA 3GX4X 3GMEA 3E97A 3BP8A 2P6SA 1Q1HA 2Z3YA 3OYFA 2QENA 2MC4A 4A0YA 4YELA 2R7ZJ 4RLFA 2QQAA 1GV5A 2VKEA 5KAFC 1W1WE 4S04A 3EUKL 3HSEA 2ZCWA 1ETOA 1OMIA 2P7CB 3K4JA 1I6XA 5K7HA 2X9DA 1X4OA 2V1UA 4KNYA 1BN5A 1P7IA 1L3LA 1FBUA 1VQPI 1SMTA 1IAWA 2GXGA 3FIWA 5H6RA 2Q0OA 3OYLA 3G1OA 3M07A 4ZDOA 1GDTA 1OLTA 2QBYA 4ITVA 3VSLA 3BC8A 4C9YA 2ESNA 4IZZA 1FSEA 1ZRCA 3CUQB 1O7LA 2FJ1A 4LLLA 1WKMA 2LVSA 1T2KA 4UB8C 1T39A 3OYHA 1S72I 2DA6A 1JJ6C 4AVPA 1B4AA 2KRFA 2BBYA 3OS2A 2E1MB 2RDPA 4HRIA 1Z91A 4TV7A 4ENMA 4OINF 1SC7A 5FJ8J 3A03A 1ERDA 5FFXA 1UHWA 3ZQFA 5F08A 2R7TA 2LREA 1W0TA 2LF8A 1UAAA 1BOBA 2DTRA 2WB1A 3C3WA 4GYGA 3ZPLA 4Q5SF 1P4XA 5K5QA 2Z1DA 3MVPA 1T6SA 3PFIA 2M8EA 3W6VA 3BTLA 2XDVA 3OYMA 2ZJQF 1IRGA 1RETA 1YJWI 3BPXA 4XLHA 3O6BB 1SFOJ 1U5TC 2NOGA 5HLIA 1G4DA 3ML6A 4H4KC 1ZTRA 2DYSH 4JOMA 1MBKA 2VQGA 3GWZA 4MTEA 3AG2H 4BE1A 2F2EA 1TQIA 2Z2SB 1V55H 5E3LA 4CA0A 2VT2A 4UUSA 1FJLA 5DUIA 1ON1A 4KA4A 4BHBA 3P9KA 3OSFA 1U6GA 1F5TA 2P81A 2G9WA 4U0YA 1MMAA 2IPQX 1OJLA 2KL4A 2KZGA 3DFGA 2CS3A 1P9QC 1USTA 2G7HA 2HYJA 4CDGA 4HNTA 4KISA 1RPWA 4F92B 1CF7B 4M6XA 1PYVA 3OOUA 2DA5A 4RGRA 3IC7A 1U78A 4EJOA 2F4MB 4OMYA 5DCFA 2K3FA 5JLWA 4LFUA 2RQQA 3K4MA 3EQLF 1LDDA 1ODDA 1WJFA 2HPIA 4MFDA 1X1DA 3VB2A 3FHNA 3F9KA 1ON2A 1YOVB 2NYXA 3S2HJ 1F4KA 2CV0A 2DK8A 3BY6A 1FOKA 4LMYA 3OIQA 1BIAA 5FLMJ 3IH2A 4HOBA 1Z3YA 1YYVA 2K9LA 2XAJA 2LMDA 1VQOI 1EH8A 5DM7F 2DAOA 1HQCA 2VB6A 2MFZA 1RUNA 4NB5A 4NC6A 2ZSHB 3H3VK 4JX4A 3WE3A 2VODA 1ZAOA 4P9FA 3CJQB 1MJBA 2V1XA 3CQZJ 5TGTA 3K10A 3T0YA 2XASA 2NAZA 5EGOB 2DYRH 4OMZA 1DGWY 1R1VA 2E5NA 4LIUA 1R5ID 1USSA 2H8WA 5AONA 2CRGA 4DYRA 3ZQHA 1FEXA 4M72A 5AIQA 2DFIA 2GOMA 2KJBA 4CO8A 2C6YA 2OTLI 1HDDC 4BQQA 3KZZA 4DOZA 2JT1A 2PFBA 2XF7A 3TO7A 4CCLA 2HKXA 1UG0A 3L09A 2DMNA 3ZGKA 2DCEA 2KQRA 3TKYA 1U9OA 5FROA 5FKMA 4BKXA 3WG7H 3N4MA 3UKGA 4Z2YA 2OTJI 1TTYA 1S6LA 3HEFA 3Q9VA 1J59A 3F21A 5CVRA 2MA3A 4AVZA 2CQ7A 1IG7A 4XRSA 2CUZA 5C4JJ 2HQNA 3V7CA 2VOPA 3N05A 2ELKA 4Y17A 2R7DA 2Y2ZA 2Y9ZA 5K5RA 5E3NA 2ZJRF 2OZ6A 2Q1ZB 2BXZA 5ICFA 1UMQA 4EEFG 2R7SA 3KIOA 3CJRB 2M7AA 3H1CA 4U0WA 1TWAJ 4RGXA 3TMOA 1UHMA 4PK4A 4ZYGA 1JUSA 2E71A 4EJWA 4C2MJ 3OYGA 1SANA 1OCCH 1QZEA 3S16J 3JSOA 3CF2A 3VDXA 3JRIA 4P1WA 1N25A 4B3AA 4LB6B 3CMYA 4YFKF 1XDSA 2LP0A 2HKOA 3OYKA 2E1CA 3M3YJ 5FB2A 2TCTA 2JSCA 4XOTA 2CO5A 4L0YB 2VPLA 5M3FJ 5EEGA 1SMYF 3OYCA 3ECOA 4LG3A 2MW8A 5ICGA 1IC8A 3H0DA 4C3HJ 2J5PA 2WY8Q 3CLOA 5D8KB 4F7ZA 4UY8I 4NQWA 3MFKA 2DT6A 2FEZA 1O3QA 3MMYB 1R4MB 1OPCA 3A01A 4EGZA 3CDHA 4HG2A 1VQKI 1SVMA 4EMSA 3HOXJ 1S7AA 1MNEA 4FQGA 4IHWA 2VUMJ 4KN7X 1B9MA 4B3XA 4NNJA 5JVTA 1JUPA 2UV1A 2V1DA 3ABMH 4B4CA 1N75A 3FM5A 1T95A 4M73A 5D5WB 1XMXA 2DFEA 1SAXA 4N9IA 1TW3A 1V3FA 1W7PD 3CCEI 2VN2A 5DM6F 3O8HA 1EF4A 2ID3A 2A5YB 3IV5A 5E8GA 2EIKH 2JMWA 3VYUB 2LD5A 2VOOA 2M2EA 4PGGA 4YFXF 3CCJI 3K4LA 2FOWA 2WV0A 4HPQA 2HGCA 2ZKZA 4LK0F 2NXNB 1G3TA 2FF4A 1YX3A 3QU6A 1IJWC 1K78B 5DEQA 2BW3A 2A6EF 1LDJA 2FUG2 1R5HA 2JTVA 3HBLA 3SYTA 3LSMA 2VKDA 3WTYC 2YS9A 1KA8A 3H9QA 3WTVC 3HGYA 1U0JA 3LL7A 1TWCJ 4KT6A 3PNVA 5A2QK 3DF8A 2HTSA 2PJRA 3IKVA 1BJZA 1MNMC 2CV2A 3I4MJ 1I1SA 4AM3A 5HOOA 1MMSA 2FE3A 4G7ZF 1N77A 3GTGJ 2DODA 3HHGA 1F1ZA 4EJVA 3OR1C 2JA8J 3AL0C 4IHXA 4LG0B 3HOSA 2V9KA 1MJ9A 3QOPA 5GPCA 1LNWA 3Q9SA 3BG5A 2HQAA 2HI3A 2Z16A 1X3WB 4BEHA 5TJJA 1Y1VJ 1W5SA 4DW6A 2ZMEB 2O8XA 3DTKA 3CMEI 3PO3J 3HXLA 1LFUP 2XGXA 1T33A 3ROUA 4PCQA 4BY7J 4DNCA 4BGDA 2IRFG 3QYEA 3GTJJ 1R22A 3PL8A 1S3JA 3QP5A 2IA2A 4GRIA 3DWLE 1Y1WJ 1QU3A 4K2EA 2PMZA 1YW8A 4U7BA 2XSDC 3ERMA 3AFHA 3I59A 4FX4A 1JGSA 5LHIA 5M5YJ 1V5FA 4HAMA 4AD9A 4GYIA 1IF1A 2CW8A 1P7JA 5F0FA 3CO6C 2BVMA 4PJMA 3RQIA 3S3MA 3RPUD 4HLYA 3HRUA 4IRHA 3HDDA 3BG6A 2OC6A 3H3UA 5BQTA 3L9FA 1ETKA 4QTRA 3EETA 1SFUA 3H9JA 4M3BA 4NHJA 1JTXA 1FOYA 3RKWA 2EILH 3ZMUA 1YW7A 1HSTA 2DDBA 2L3DA 2ISYA 4I7HA 1WCMJ 3BR3A 5J47A 3VWBA 1PUEE 2R4GA 5J1YA 2JK3A 2RVCA 2OCEA 2K02A 2STTA 3SZGA 5FO5A 2Z5UA 1Z7UA 3HHHA 3HRMA 5KNLA 4DYCA 2EJRA 3D1NI 2BY2A 1FP2A 2ZFWA 2D5VA 5BPDA 2H6BA 1BW6A 3CD6I 5CYVA 2YSRA 1FTZA 1FOXA 5TRDA 2X6YA 2UZKA 1XSDA 3HZJA 2R3SA 1XCBA 2M3AA 3DPLC 1Y8RB 2LY2A 2BY0A 2V9VA 2BGCA 1K6OA 4CYCA 2Y0SA 3QPLA 5GTIC 2W85A 2LLKA 3HC7A 3LMMA 4XONA 1HC8A 2ZO4A 1BJAA 2BYVE 4PSXA 1VI0A 5JVGF 3SQNA 2A6HF 4GDFA 3NQOA 1N78A 2VONA 2L0KA 2BY3A 2CGPA 5L3GA 1HLVA 4A6EA 5EYRA 1Z9CA 1ZLKA 4AIJA 5DCMB 1WJAA 1IN7A 4AU7A 1OYIA 5FGMA 4U87A 5D6EA 3HUGB 3KX2A 1M1EB 4EJTA 5FRNA 1OR7A 4BU2A 4J19A 5LEKA 2V9PA 3VODA 5F04A 3KEYA 3DBHB 5E1XA 3WGGA 2RN7A 1RESA 4LLGF 3OV8A 3GTQJ 3F72A 2Q2EA 3S32A 4LD5A 1W7PB 3KYDB 4HQMA 2XRNA 2PJPA 5FFZA 2R7UA 1T0FA 1K7AA 2VJ5A 3WTSC 2HOTA 2XGDA 4NBQA 3GEZA 2N8GA 2F5FA 3L00A 1DPUA 5F0CA 5EEAA 1YLFA 2IA0A 1KYWA 2PQ8A 1JJ8C 3GFMA 3J7AY 2TRTA 2JWTA 4V19K 3CZ6A 2BE5F 4M74A 2L4MA 4QSHA 2HTJA 3H5NA 4Y52J 2W82A 1T56A 3FMQA 4WXDA 1MDMB 4RGSA 3IH3A 2FXAA 5CJ9A 1TNTA 2PMUA 2JJ7A 3S3OA 1GLNA 1O3RA 9ANTA 2HNHA 1AKHB 1DDNA 4J00A 2RAEA 3KLOA 1PP8F 1ZG3A 5IYCJ 3L2RA 3MKWB 1PUFB 4OIPF 4HW0A 2ELJA 4G7OF 2XGCA 2X6WA 2JVHA 1Y8QB 3OYIA 2R7XA 1NH3A 1GVDA 2L4AA 2VPRA 3ISPA 4LK1F 4XR6A 3N97A 2NVQJ 5KHDA 1SEUA 3JSPA 4N4OB 2KT0A 1D5VA 2HOEA 3GTOJ 3M8JA 2VI6A 4ASNA 4XIDA 3GLLA 3ERED 5LGTA 5HNFA 4HQEA 3GUDA 1WH5A 2ECBA 3KP7A 4A0ZA 2NRAC 4LLNA 2FSWA 4OWRB 1WI3A 4IF4A 4B44A 2YU3A 5L3FA 2FMLA 5EZGA 1F9NA 4RS8A 2H27A 2QGUA 2KHMA 3BZCA 3P5JA 3W2WA 4GO1A 1QVTA 1YRNA 1ZR4A 4L9TA 1GV2A 5DTDA 4RB3C 1S5LC 2VT3A 1TQMA 1D1AA 1R1UA 2QQ9A 2KRCA 4Y15A 2YPRA 2QLZA 2NS0A 1FSHA 3I5UA 3UR3C 1IRZA 1QZYA 1H88C 3TO9A 2MGQA 2O8KA 3JTHA 3S1MJ 1DP3A 2W57A 1OQYA 2M45A 2MD5A 5CVVA 4O6JA 1XCVA 2K9QA 2W25A 2FNPA 2ESHA 2W48A 2HXOA 4KT5C 2FOKA 4BJ6C 1B8IB 2ID6A 4BH9A 1TLHB 2X85A 3REOA 2V79A 2KIUA 2V1NA 1K83J 1OCRH 2WV1A 4YIIA 1LUJB 2CUJA 3ZQGA 3F22A 2ADUA 2EFNA 3EUHA 1VQ5I 3I71A 4MIMA 5IP7J 3LSKA 1KQ8A 4D5CA 3BR6A 4G6DA 3OWTA 4AYBN 1GXQA 3W2VA 4BYYA 3BG3A 4XRMA 3F0CA 3OYAA 1S7OA 2PG4A 4LJZF 1YHQI 4NC8A 1ZQ3P 3K70C 2W84A 3E0JB 3O3KA 4Y33A 1TP4A 1TL8A 3GTMJ 2F4IA 5J8FA 2HVRA 3LSGA 3G1MA 2QEXI 2ZSIB 4RMNA 3NAUA 2FQ4A 2P6TA 4ZZDA 1FBQA 2VBZA 1WQ2A 3HG9A 1J0RA 1UZCA 4XN0A 2E7XA 2DU9A 4Y13A 2DFHA 4L5IA 1MW7A 4KUMA 4M9XA 1H8AC 4IHYA 1ITYA 3BCAA 3BJAA 4YEJA 2Z33A 1SD5A 3KCCA 1R5GA 2K40A 4RAGA 1XGSA 5B5EC 2LTPA 3BLYA 3LNQA 3NEUA 5LEJA 1QZZA 1E3HA 3S15J 4KFCA 1ETWA 3KFWX 4RDUA 4ENJA 3DTIA 2R7WA 1TT0A 2JRTA 3U9GA 3FMSA 2BZTA 4HA8A 4XN3A 2W24A 3LA7A 1FMWA 3HTSB 4FHTA 3I55I 4H0EA 1X3UA 2DMPA 4IHSA 1H89C 2R5YB 3JRAA 2JPBA 3E1SA 2MC3A 2LY9A 1XC5A 3A01B 4F3QA 3CC2I 4A2UA 1SVLA 1A5JA 3BTCA 2WB1N 4KIGA 2XB0X 1DQUA 2BXYA 3DU5A 4DZPA 2OA4A 1SFEA 3KP3A 5F6FA 2KFDA 4QPQA 2MABA 3IWFA 5A2QZ 4GXOA 3CO7C 1LEBA 3MCZA 2OQRA 5FD6A 3TDZC 1MIJA 4AUXA 4IXAA 2DO7A 4XLAA 1IUFA 1ONVA 4FX0A 3R60A 4PZJA 4DBQA 4ENKA 5J40A 2DJNA 4JX6A 4CHUA 2DK5A 3V42A 1F36A 1JKPC 2IVMA 5EG0B 3EYIA 4P9UA 3W3CA 5D8LB 2IS4A 4ABZA 2BW3B 4OIOF 4ENNA 2DTZA 2FA5A 2KJCA 1QBJA 4A3FJ 2EFPA 2L9NA 3DEWA 2DA7A 2PX9A 1XN7A 3RKYA 4FTHA 1X1CA 2EFWA 4BQNA 4C3JJ 1J5YA 3OYEA 1DU6A 3ZOBA 2ZB9A 3S8PA 1OCZH 2ZXWH 4BBRJ 4M6VA 3P7NA 1JI8A 3JRFA 1IN8A 3DKYA 5EJCA 4E4HA 4PJNA 4MTDA 1U5TB 3PIOF 1SD7A 2M0CA 4B48A 4AWXB 5J6XA 2L7ZA 3BR1A 1V5GA 1XMAA 5JR3A 1G3WA 1ETXA 5CLSA 2IW5A 3TP3A 1ZGWA 2L02A 3WE2A 2R7RA 1LFPA 1O7FA 3G2BA 2WWYA 4I02A 1ULYA 3BR5A 4XRFA 3SJMA 4YRVA 3M1EA 2DBBA 2OF7A 3LFKA 3Q0WA 4A5MA 2EB7A 1FP1D 2L9VA 1K61A 1FMVA 3ASNH 3UNGC 1IN4A 1ZREA 4ETSA 2GM4A 3NWTA 3DKWA 2UWMA 1Z21A 4UUVA 3FWEA 4XLCA 2JA6J 5C4XJ 3ABLH 2A05A 2G0EA 2VIXA 1O4XA 3CMAI 5ILSA 2M34A 3QYFA 3X2QH 5IP6A 3JRCA 1VQ4I 4ESBA 3C7JA 2O0YA 2BEOA 3KYCB 4V2FA 1LE8A 3WGIA 3DV8A 2PN6A 1Y39A 2DN0A 3R6SA 3AAFA 3GO5A 2HPMA 5D4RA 2MYSA 4HZFA 1YIJI 3PSIA 1IGNA 1BOAA 4D0PA 4FCYA 1U3EM 5B3SH 5H20A 2ZFUA 5E17F 3LSHA 5FRMA 3QPTA 3MD2A 3S3NA 5JLXA 1B1BA 1CGPA 2F5VA 1D3YA 2K85A 2QQ8A 2EZHA 3H5RA 3DEUA 5L3DA 4RM2A 1MH3A 1YJ9I 2K9SA 1P4AA 1X58A 3CCLI 4CYDA 1D8KA 1TWFJ 3FKJA 1BM9A 4I0BA 2CQXA 3FBIB 2B0LA 4KYWA 4XLNF 2HU9A 2X1CA 3K1NA 5CVJA 2XAHA 1B59A 1WGXA 2R7OA 4BY1J 2O3FA 1MBGA 4A3GJ 3HOVJ 1X4PA 4PFOA 4A3KJ 3KLNA 4A3JJ 2M30A 1D0YA 3JRHA 3JRBA 4XRSG 2E35A 3P9IA 3A1YA 4IPAA 1UELB 2A6TA 4HV5A 3CCYA 2XHKA 3FF5A 1JHFA 3LOCA 4N4NB 3WG9A 2Y9YA 1A6QA 5FKKA 5L3BA 1PJRA 1AOYA 4CCMA 3ELKA 1JT6A 5HS9A 4DJAA 3G4SI 3BTIA 3BZKA 1OR7C 1A6IA 1AHDP 1NK3P 4ANJA 4I0AA 3AG1H 2OCCH 2E34A 2VE8A 2K4BA 4CZZA 1WSUA 2M0MA 1MBHA 4DBRA 3BWGA 1BW5A 3OL3A 1P6RA 5EDNA 2CWEA 2K3PA 3D5SC 4YFNF 4IHTA 2ZXJA 1KQ0A 3T8RA 1XB4A 1NTCA 3M4OJ 2HZTA 1T0FC 1FLIA 1IRFA 5GPAA 1VQ8I 3GFIA 2BHYA 2CUFA 1D5YA 3H5AA 3TW7A 3QYBA 4BJ5C 1LKXA 3ZMSA 5J3LA 4HSRA 2FBHA 2P4WA 5J1RA 1H0MA 1ZGJA 5E18F 2OD5A 2W00A 3FXRA 2R5ZA 3LWFA 3HOTA 3F23A 1E3OC 5FKNA 5B1AH 5E3MA 4A3DJ 2VQHA 4XL9A 2R7FA 2CSOA 4HV6A 2LR8A 4YIFA 2QA4I 1X1PA 3H92A 4P5OA 4W1UA 4XKCA 5D6FA 2ZXIA 1XSXA 2KIQA 3GCMA 1QO0D 1EH7A 2ME6A 2Z9OA 3LQRA 1JKOC 1OYWA 3SHFA 2MH2A 4I2OA 2DA2A 1YFHA 2VXDA 5D5VB 1WWXA 2EIJH 4JK1X 1BI2A 1KZHA 1RZ4A 3ZN1A 5B66C 1E3PA 3FZVA 4XLEA 5FD5A 2VJJA 2GIZA 2WAQA 4UVCA 1BI1A 3CDIA 2Q8KA 4G8XA 3V8LA 5DS9A 5IOZA 1YIOA 4XSXF 2GA2A 1G8XA 3SDBA 3NRVA 3CUQA 3NWSA 2AS5F 3BG9A 3I4PA 1VQ9I 2GXAA 3M8FA 1VNDA 3HOZJ 3OIPA 4S0HB 2VASA 1KONA 5KAIC 1YJNI 2IBDA 1WPKA 5CKTA 3KYLA 1LQ1A 2DOEA 2LNBA 1W36C 1QA6A 1RKTA 4G12A 3JRGA 1K6YA 3AKZA 2LBFB 4KJZA 5HLGA 1X2NA 5HDGA 3O2PE 1IDYA 1V54H 4HBLA 3LAJA 1HF0A 4RGUA 1ZH5A 2QCOA 2PMZN 3BROA 1T8IA 1T38A 4UXNA 3LSTA 1LVKA 3K9TA 3WHCA 4R8HA 4RAFA 4RA2A 5K5OA 2HWVA 3HOYJ 1Z6TA 3JREA 2VKVA 2CQKA 4N0BA 4O3MA 3BPVA 4R79A 3JTGA 3I0TA 1E17A 3EYYA 1EH6A 2DQRA 2E19A 2DT5A 2BV6A 2KKOA 3F6OA 3FMRA 2E5ZA 2ETHA 2YUSA 5F64A 1R1TA 2IXSA 5FKLA 3FXLA 2ELHA 3WHBA 1Z1DA 1EV7A 1PP7U 2XAUA 4A3MJ 3VYTB 2KPMA 4HX8A 3L2WA 3S17J 2KDZA 2VQLA 2F4OB 2NS8A 2JPCA 3EUHC 2OZUA 5LGNA 1CF7A 1SAUA 3L2CA 1S7EA 2PI0A 2EA2A 2L9SA 4BJTA 3J80K 2GZWA 5KK1A 5JI6A 1FC3A 2WAEA 2B7EA 1Z3XA 1TC3C 3PNYA 3MZHA 4Q4ZF 3QPHA 1VFCA 2F6CA 3K4NA 1FTTA 4BXXJ 4HDVA 3JRDA 2VXZA 1GHCA 3GFJA 4ZYDA 1EA3A 3WTZA 2VKHA 1TZLA 1R71A 4IQJA 4CGZA 2IS2A 1D0XA 5HS8A 3GTLJ 2VBWA 2I10A 3RTRA 3R61A 4RAZA 3JCUC 3TO6A 4BNCA 2LF7A 4XLPF 3HPHA 4U0VA 3B73A 3Q5FA 2Y0MA 2NVXJ 2FRHA 3WTUC 3V7SA 5EGOA 2EWNA 1RRJA 2EZIA 3EUAA 2VQCA 2LSOA 4LOCA 3WU0A 4FT8A 4HEA2 4CCNA 3K70D 2HVQA 1OCTC 3C2BA 2RNJA 2AXTC 4FASD 3BJ6A 2H6CA 5KCMA 1E2XA 2DMUA 1S29A 3LFUA 1YX5A 2QM3A 3CCMI 1QNTA 3GZ5A 3GZ6A 3IRRA 3HKZN 4WXCA 1G2HA 2EA4A 4ZYHA 1H9TA 2ACJA 1SD4A 2QSFX 2I8DA 2P5KA 5EF6A 4C2UA 2L2OA 4OIRF 1B72A 3MKZA 3ABUA 3S2WA 2QBYB 2IGMA 3FK6A 2E2IJ 3G71I 4QLCU 2ZBKA 4A3EJ 4RAYA 1NK2P 4PUSA 3I54A 2QF7A 1FIAA 5L3CA 1B9NA 4D9JA 5TISC 1VTNC 5HVQC 1PVEA 1YI2I 4XBFA 2EFOA 4E70A 1IRXA 2E2HJ 3IKTA 3LA3A 4WX9A 3IUOA 2DMTA 1ZN2A 4A69C 1FYLA 4HLXA 5E1WA 3K7AJ 2XPWA 5LD2C 1YITI 3U1DA 3ZCOA 5E8IA 3G3ZA 5HLHA 3I53A 5JHUA 3NARA 1YG2A 3OYJA 2A3SA 1ETQA 3SZTA 4A5NA 4E7KA 3B6AA 3HRSA 4E7SA 2CW7A 2KLOA 2O03A 2VJ4A 3MEXA 4M3DA 4ZC3A 3S2DJ 4ZH4F 3CC7I 4PFPA 1OISA 1I3QJ 4ESFA 2K9MA 5H6QA 3CUOA 5FKOA 4B47A 1HW5A 1GVJA 2QUFA 3PUFA 3RYPA 2R92J 4AIKA 1GXPA 4UUSB 4ESJA 1R9TJ 3HM5A 1MSEC 3K2AA 5EEHA 2K9NA 3HIFA 4CXFA 2B63J 2W4SA 1Z77A 2Y31A 2QSHX 3MZ8A 1BR1A 1W5TA 4DZJA 5LFAA 4U7DA 3A02A 2IJLA 1I1GA 2QSGX 3RJPA 1IV8A 3RQ4A 1TNSA 4EQQA 2A5WA 1R36A 3LSPA 3QU3A 2XAGA 2DOFA 2IGNA 5AIPA 3GVAA 4A3LJ 4UV8A 4YG2F 1WFXA 2E60A 4WCGA 3HL2A 4BBSJ 5ERIA 2VC0A 3B6CA 2JUGA 1TW2A 5E1ZB 1ENHA 4QWQA 2M7BA 3TGNA 3LA2A 3FK7A 4F55A 3KP4A 4RLQA 3L1PA 2L9RA 2H09A 3AG3H 4CUGA 4KDPA 2X1EA 3RZOJ 1K78A 5M5XJ 1L0OC 3BOQA 1LE8B 1FY7A 4HX7A 3ULQB 3ZQQA 2CMPA 3E7LA 1XS9A 1Z6RA 1MBJA 3OOPA 5M5WJ 1YO5C 1IXSB 1WZ2A 4RM3A 3OYNA 5C3EJ 1STZA 5GADJ 1BR4A 1JTYA 3S93A 3ZMZA 2CYYA 3PQJA 3WTXC 1DPRA 4G94A 1X3ZB 2E1OA 3ABKH 3BG7A 4IL6C 2QZ8A 2X51A 3V8KA 4MO7A 2VC1A 2ZJ2A 1OCPA 1QPMA 1ZHFA 4LG0A 2AQEA 3BJOA 4ZTFA 2EZLA 3K4CA 1I50J 1EJ9A 3HGGA 2RV8A 4FISA 1JHHA 1UB9A 4D7MA 5LRSA 1J9IA 4F91B 2ZMEA 2LY1A 1IN6A 3CESA 5GTHC 3ZMVA 3F8CA 4BHPA 2D45A 5GAHJ 2RGVA 3TDUC 4U88A 5IT9Z 3I4NJ 1T98A 2E2JJ 3QQAA 1H9GA 1ZYRF 5CVIA 4Y3OA 4BE0A 3MN2A 1R49A 2YU9J 1J2XA 4E6KG 4Q47A 5LGUA 3FHZA 3FXOA 3A0HC 5BMZA 2XVCA 1TBXA 4CZCA 3RKQA 1BL0A 4M3GA 2KRHA 4OAZA 3GYHX 4C2TA 3BDDA 4HNUA 2R7QA 5JFRA 3ZQLA 3JW4A 1D1CA 4UNOA 1TWHJ 1XMKA 4XLFA 4OIQF 3FXUA 1DGRM 3BT9A 4EJUA 1QRYA 1FT9A 1BI0A 2QKMB 4HF2A 2AQFA 4LB5A 5IP9J 3CF5F 2DMQA 2FMYA 2LK2A 2M4KA 4MQVA 5DYMA 2CQQA 1AA7A 2HEOA 2RQPA 3CTAA 3KZIC 2L7KA 3CCVI 3DBLB 4NDLA 4II2A 2R7VA 4I01A 4JBAA 4L5JA 4JQFA 4D7NA 2JA2A 2HOAA 2ZXHA 5HDKA 4X6AJ 1WJDA 5E20A 4B1RA 3E5XA 3I3LA 2FBIA 3ZQ7A 5LLQA 5D5UB 4NC7A 4IEJA 1NG7A 1UG2A 4NQWB 1C0WA 2OPTA 5FLVA 4RB2C 3DXJF 1QPIA 5H2FC 2VBXA 2M5WA 4LIVA 1RR7A 1NG6A 1ORKA 3JAMZ 1KU2A 3F8FA 3WODF 1MBEA 5K7ZA 5DD4A 1QGPA 3SXYA 1IXRC 2P5LC 4LITA 4XORA 4KMFA 2HFHA 3HJEA 2ZJPF 5BOXA 1U2WA 1JXSA 1ZARA 2D1VA 3KP6A 5L3EA 3K4KA 3ECHA 2TDXA 4C3IJ 5DCMA 1OKRA 4Z6YA 2M87A 3I58A 1IDZA 3COAC 4A93J 5IYBJ 3CUQC 3HUGA 4M9ZA 5IT3A 2EINH 3G1LA 3QAHA 4ZDPA 3PJRA 1PDNC 2H8RA 2E1MC 5HLTA 4CSWA 4KN4X 2HYFA 2X0LA 3A4CA 3PQKA 4XKWA 4LGWA 3V8JA 2V6EA 1KU9A 2UXNA 4ON0A 4L9NA 3OR2C 1ETYA 2X6XA 3WU2C 1LB2A 1OCOH 4MNUA 2OBPA 1CQTA 1J75A 1UJ8A 4BS9A 1I3AA 2J5OA 2JVGA 4MQ9F 4UUTA 1XGOA 4F93B 4ZTJA 1W7PA 2VJIA 1FYMA 3PM1A 3FXQA 2PJRB 4BHCA 4DQ2A 1FPQA 4UHTA 5LHGA 2K4JA 2RC4A 3KEOA 3PO2J 2X48A 4XK4A 1S9HA 2ISZA 2O6GE 3L2QA 3GW2A 5LHHA 5BPIA 4ZJZA 2M9HA 3J80Z 2L5QA 1ZK8A 1LDKB 2H1LA 3DQVC 3PUBA 3IL2A 2KIMA 4KITB 3GF2A 1Z05A 2PBIA 4BEHB 1KGSA 4B09A 3GTKJ 1MDMA 1ZG1A 3PNTA 4E7LA 2EBIA 2COBA 1WJCA 3OYDA 1R00A 4HF1A 1VQNI 3I9V2 3DEEA 3F8MA 3WTTC 3QPSA 2FU4A 1AKHA 1W36D 4XICA 2M8GX 1MNDA 1MZBA 1YTYA 2W7NA 1P2FA 3TEDA 2XAQA 3QWLA 1Q1VA 4M3EA 3L2UA 2P0WA 2CW0F 2DW4A 3I59B 5GAGJ 3J7YJ 3BQYA 2E7WA 2X6OA 1PUFA 2YX4A 3F8BA 2L7MP 2K27A 4RB1A 2GIVA 1RC9A 4XKVA 5DV5A 4XMYA 1YS6A 1JE8A 3FBNB 2F5EA 2GWRA 2VBYA 3QP6A 2XV4S 2D2WA 4CCOA 2BY1A 2A68F 3U2RA 2IT0A 3BTJA 4IOAF 5FLXK 1XGNA 3FKIJ 4E7HA 2DPUA 2XIGA 2E1NA 1T08B 2WAFA 1K4TA 1IN5A 2CU7A 3CCQI 1OFCX 1REPC 4YIRX 3C2HA 2PEXA 2BHZA 2CQNA 3U1KA 3VSKA 1LJ9A 2NVYJ 3VYSB 3TBIA 3U21A 1GT0C 3H0GJ 3FISA 2XC7A 3TOAA 1V4RA 4L9JA 3JR9A 4BQAA 2KISA 2A61A 4I6ZA 4D5FA 1BA5A 4UV9A 2L01A 2M1BA 4WXHA 3RPUA 1AU7A 1MGTA 4IRIA 2XB5A 4GGGA 3E5QA 4RBOA 2HYGD 1LVAA 3DTEA 3V4GA 2WA0A 3ZN0A 4BL0B 2JN6A 3Q0VA 3R4KA 4L5EA 1MJAA 2JRMA 3CJNA 4HF0A 1MBFA 1QQIA 1G3YA 1QVUA 1G6NA 1UCRA 2GOXB 3TL4X 4BQOA 5C44J 4CYCB 1W0UA 1EKEA 3M9AA 2AO9A 3W6KB 4E7IA 3RZDJ 5HODA 1B8IA 3TW6A 3MAJA 3RKXA 3K2ZA 4XSZF 1VQLI 1XG1A 1XD7A 2GQQA 2V26A 5K1YA 2NNNA 1POGA 2HQ5A 4QPOA 3ZXSA 1A35A 1BBYA 1RNLA 3T8TA 4MEXF 1B72B 3KP5A 4FE7A 3CCRI 3C2GA 2LYCA 4MLOA 1P92A 5D5XB 1ACIA 2W1OA 3QOEA 1KYZA 3OS0A 3RI4A 3S1QJ 1VF9A 2GXBA 5IT9K 5K7FA 2XKOA 3IHUA 3MWMA 3GLXA 5E3OA 2A69F 3I64A 2KMUA 4PJ0C 3SEZA 2Q2EB 1Y56A 4I09A 3OY9A 2MLKA 1BC8C 1SFXA 2MBFA 4A0XA 4M9SA 3J7ZI 4IX7A 3R0JA 2XROA 2XAFA 1ZR2A 3MKYB 1WI9A 2LDUA 3B02A 5GP9A 4L9VA 2G7UA 1V5EA 2WAQN 2OV7A 4G6QA 4AIDA 3A0BC 4IQ4A 3DLAA 3S14J 1WJBA 3LSIA 3H3ZA 1JT0A 1ZLJA 2IS6A 3I56I 2CV1A 4HSTA 3KPHA 2IGOA 2AXLA 1FOWA 1Z67A 1JUMA 2V6CA 3J81K 2VE9A 1FBSA 1A31A 3K1PA 2LH9A 1ETVA 3DCFA 2X1DA 2LRDA 2R5YA 3OS1A 4IKFA 4V2GA 5CVUA 4HNVA 1RIOH 1APLC 1VQ7I 2OU2A 3W2AA 2LKSA 4CICA 3C18A 1R7JA 3IH4A 2P8TA 5CQEA 4G7HF 2ECCA 4WF2A 4XM3A 4BAYA 1WRJA 3DPUA 2F48A 3BZ6A 1BIBA 3D0SA 2JSPA 4G6TB 4KICA 1Y0NA 4X1EA 5GAEJ 2JA7J 4Y4RA 2HVSA 3KP2A 1IZ1A 5J4VA 1VZ0A 2LG4A 3ZR8X 3S1NJ 1FIPA 2NVUB 3IWZA 2QKLB 3JAMK
chains in the Genus database with same CATH topology
3FHNA 3F9KA 2HVRA 3LSGA 2CV0A 3DU6A 2ZSIB 4RMNA 1IRXA 3OIQA 3IUOA 1Z3YA 2K9LA 5LD2C 2VL8A 3HG9A 4E7JA 4XN0A 4OAYA 3ZCOA 2WY7Q 2LOOA 2VB6A 2MFZA 1MW7A 2ZSHB 3OYJA 1Y6IA 3BCAA 4YEJA 3AL0B 3CJQB 4E7KA 3CMMA 4E7SA 2CW7A 2KLOA 3BLYA 3K10A 5TGTA 2VJ4A 4ZC3A 4PFPA 3DTIA 2R7WA 1TT0A 1DGWY 2K9MA 4E7ZA 2E5NA 4B47A 4LIUA 4XN3A 1FMWA 5HVQC 3CP8A 2MD0A 2W4SA 2GOMA 1BR1A 3E1SA 5LFAA 2XSJC 4BQQA 4DOZA 4F3QA 3GBGA 2XF7A 4CCLA 3RQ4A 1UG0A 4CCJA 1DQUA 2A5WA 3DU5A 2DCEA 2KQRA 1X1BA 3ZGKA 2CH0A 5FROA 2DXIA 4QPQA 2MABA 5HNHA 3PSFA 2IGNA 2XF5A 1WFXA 2E60A 4AVZA 4XLAA 1MMNA 1HA8A 2CUZA 3HL2A 5JHFA 3ONQA 2JUGA 4DBQA 3N05A 3SEQA 2M7BA 4F55A 4RLQA 3V42A 2WADA 4CUGA 2X1EA 2WBMA 3W3CA 2IS4A 2Q1ZB 3ZQQA 2BW3B 2CMPA 2R7SA 3CJRB 2M7AA 3IAS2 4RM3A 4X0GA 3OYNA 3TMOA 4PK4A 2KZVA 3OYGA 1BR4A 2L9NA 3S93A 4CH7A 2VLAA 3CF2A 4BE2A 3VDXA 4P1WA 2HDWA 2V7FA 3M1CA 1X1CA 3RSNA 3OYKA 3HPGA 4BQNA 3OYEA 4ZYAA 4XOTA 3BG7A 3S8PA 2VPLA 4ZDLA 1JI8A 2X51A 3DKYA 3D5LA 4E4HA 3OYCA 4PJNA 4F52A 4LG3A 2BOLA 2AQEA 3H0DA 4B48A 1R6RA 3H9GA 2IS1A 4ZTFA 4XQFA 2WY8Q 2LC2A 1V5GA 3K4CA 2DT6A 3MMYB 2KDOA 4HG2A 4F91B 3CESA 2LY1A 1MNEA 4J01A 2R7RA 1LFPA 4BDZA 4B3XA 3G2BA 4NNJA 4DIQA 2UV1A 2IGKA 1N75A 4YRVA 1T95A 2NOJB 4NUBA 4Y3OA 4BE0A 2RREA 4E6KG 1QHHD 4C30A 1FMVA 3UNGC 3H35A 3NWTA 3IAM2 4CZCA 3VYUB 2UWMA 1Z21A 2K5CA 2KRHA 4OAZA 4XLCA 4C2TA 3K4LA 2VIXA 4HNUA 2R7QA 4HPQA 3QYFA 1D1CA 4XLFA 1DGRM 1YX3A 2BW3A 2QKMB 2AQFA 2HPMA 3EPZA 2MYSA 2FUG2 2M4KA 3PSIA 3SYTA 3DPTA 4PJLA 4EATA 3A2KA 3LSMA 2VKDA 1AA7A 2L7KA 2ZFUA 3H9QA 3LL7A 1U0JA 3LSHA 4II2A 5FRMA 4KT6A 2R7VA 3MD2A 3S3NA 3PNVA 3QODA 2F5VA 1ZELA 1BR2A 3HKZA 2PJRA 1D0ZA 4JQFA 2BVLA 4BACA 2DOAA 3OL4A 3H5RA 2CV2A 2JA2A 5HOOA 2ZXHA 1Z7LA 1WJDA 4RM2A 1N77A 3I3LA 4NC7A 3OR1C 3AL0C 4DGWB 4PJJA 4XKBA 3HOSA 2V9KA 1NG7A 3FKJA 2HQAA 3FBIB 4NQWB 2HU9A 2Z16A 1MMDA 3RCOA 2X1CA 4BEHA 3L2VA 2R7OA 3DTKA 4LIVA 1X1AA 1X19A 1NG6A 1X4PA 3HXLA 4PFOA 1D0YA 4XOPA 4BGDA 4CCKA 2HZDA 3QYEA 3A1YA 3PL8A 4LITA 4XORA 1UELB 4GRIA 3DWLE 2A6TA 1QU3A 2PMZA 4U7BA 3AFHA 1V5FA 4XNFA 1WJ5A 3K4KA 4N4NB 2CW8A 3D5RC 2BVMA 4PJMA 1PJRA 3S3MA 3CP2A 1J09A 4CCMA 3RPUD 4DJAA 3K4BA 3BG6A 1OR7C 3BCBA 2OC6A 4ANJA 4ZDPA 2DT7B 3PJRA 2E1MC 3H9JA 5HLTA 4CSWA 2M0MA 3A4CA 4PSWA 4DBRA 4XKWA 2V6EA 3OL3A 1MMGA 3OR2C 2X6XA 2K3PA 3D5SC 2O5RA 4BS9A 2JVGA 3VWBA 2R4GA 2LBFA 1T0FC 3OMYA 4F93B 4ZTJA 2VJIA 3SZGA 2PJRB 2OUMA 3H5AA 4BJ5C 3DKXA 3QYBA 1LKXA 5KNLA 4HSRA 1S9HA 1D1BA 3L2QA 5CQGA 2XF6A 4ZJZA 2W00A 4BDYA 2L5QA 1LDKB 3HOTA 3DQVC 3PUBA 2X6YA 3FDYA 4KITB 2VQHA 4XL9A 2CFOA 2M3AA 4BEHB 3DPLC 1E0EA 2LY2A 1YE9A 4P5OA 3ZRGA 3PNTA 4XKCA 4E7LA 3IP4B 2ZXIA 2Y0SA 1WJCA 3OYDA 3K6GA 3HC7A 3LMMA 4XONA 3VYRB 3I9V2 3DEEA 2DJIA 1G59A 4PSXA 1W36D 1N78A 2VXDA 1MNDA 4FETA 4BXFA 2KP6A 1QHGA 2W7NA 3L2UA 2P0WA 4XLEA 2VJJA 2WAQA 4XKVA 4XMYA 5CPRB 1WJAA 4AU7A 3FBNB 4U87A 1G8XA 3SDBA 3HUGB 3KX2A 4II3A 5FRNA 4CCOA 3NWSA 2V4JC 4BU2A 4BUPA 3OIPA 4E7HA 2VASA 3KEYA 4D1QA 1KONA 5CKTA 3KYLA 2WAFA 1W36C 1K6YA 3C2HA 2UUZA 3AKZA 3S32A 2LBFB 4KJZA 3VSKA 4B43A 3VYSB 3TBIA 3U21A 2R7UA 2XC7A 2VJ5A 1LVKA 2RNGA 1SFKA 4AYBA 2M4GA 3J7AY 3OYBA 1WJEA 3PFYA 3CZ6A 3DTEA 4R79A 2WA0A 4BL0B 3H5NA 2W82A 3OYFA 2MC4A 2GOXB 4YELA 2E5ZA 4BQOA 3TL4X 4RLFA 2IXSA 3S3OA 1GLNA 3EUKL 2HNHA 4E7IA 2XAUA 3VYTB 2KPMA 4J00A 3L2WA 2VQLA 3K4JA 3L2RA 3MKWB 1X4OA 3EUHC 2V26A 1SAUA 2ELJA 4QPOA 3OYLA 3ZXSA 2X6WA 2JVHA 2L9SA 4BJTA 3OYIA 4ZDOA 2R7XA 1OLTA 4ITVA 3VSLA 3C2GA 3BC8A 2LYCA 2WAEA 4C9YA 4XR6A 4IZZA 4MLOA 1Z3XA 5KHDA 2W1OA 4N4OB 3QOEA 3PNYA 3OYHA 3OS0A 3M8JA 3OS2A 2E1MB 4HRIA 2F6CA 3K4NA 2KMUA 5HNFA 2VXZA 3SEZA 2Q2EB 4OWRB 1ERDA 1Y56A 1EA3A 4B44A 3OY9A 2R7TA 2LREA 2VKHA 1TZLA 1UAAA 4IX7A 4IQJA 2IS2A 1D0XA 1BOBA 3MKYB 2WB1A 3RTRA 2KHMA 3W2WA 2Z1DA 1V5EA 3HPHA 2OV7A 4IQ4A 3DLAA 1WJBA 2XDVA 1D1AA 3LSIA 3OYMA 4XLHA 2KRCA 2IS6A 2CV1A 4HSTA 2IGOA 3EUAA 4H4KC 4JOMA 2VQCA 2VQGA 3K70D 4BE1A 4HEA2 4CCNA 2Z2SB 2HVQA 3UR3C 4CA0A 4FASD 2LH9A 1DP3A 2X1DA 5KCMA 2LRDA 3LFUA 1YX5A 3OS1A 4IKFA 1MMAA 2KL4A 4BJ6C 3W2AA 2CS3A 1P9QC 2X85A 2I8DA 2V1NA 4HNTA 4KISA 4C2UA 2L2OA 4F92B 2CUJA 5CQEA 1PYVA 3OOUA 4XM3A 3DPUA 3MKZA 2JSPA 3LSKA 4G6TB 2IGMA 3OWTA 3W2VA 4Y4RA 2HVSA 3OYAA 4NC8A 4PUSA 3K70C 2RQQA 3E0JB 3K4MA 1VZ0A 2LG4A 4Y33A 3ZR8X 1WJFA 4D9JA 2F4IA 2HPIA 2QKLB 1X1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR7 C; 
#chains in the Genus database with same CATH topology
 1D8J A;  1LEA A;  3DBR B;  3DU6 A;  3E5U A;  2CFX A;  4P55 A;  2HQR A;  5EG0 A;  2OJE D;  3FXM A;  1O57 A;  3PIP F;  1IV6 A;  1BC7 C;  2VL8 A;  2EFQ A;  4WK8 F;  4E7J A;  5LRR A;  4OAY A;  2WY7 Q;  2R93 J;  2LOO A;  1AWC A;  1FWZ A;  4A3I J;  2B9S A;  5ILU A;  3ZP5 A;  2IEK A;  1Y6I A;  1YRN B;  2K7L A;  3HRT A;  4KMU X;  1HOM A;  4BXU A;  1YW9 A;  3AL0 B;  1TQP A;  3CMM A;  2CG4 A;  2MH9 A;  3E3V A;  2XUB A;  3KEQ A;  4ZZL A;  2JUC A;  5IYD J;  2FQ3 A;  4L18 B;  3G6E I;  4N9H A;  5DD8 A;  4EV0 A;  3FXK A;  3E6B A;  1YS7 A;  1IO2 A;  1U5T A;  4E7Z A;  3GXO A;  3Q0U A;  3HOW J;  1MD0 A;  4I76 A;  3CP8 A;  1X2M A;  2MD0 A;  2ZME C;  3ABT A;  3OIO A;  4AC0 A;  2QWW A;  3HSF A;  3HYI A;  5KVR A;  2WTE A;  2XSJ C;  2COM A;  2JZY A;  4OU0 A;  3TQN A;  1Z0X A;  4HX4 A;  2L54 A;  2CJJ A;  3GBG A;  1WVR A;  3V7R A;  4A3B J;  4CCJ A;  3WTW C;  4EM1 A;  1X1B A;  2STW A;  2CH0 A;  2DXI A;  1ZRF A;  2EV6 A;  5HNH A;  3PSF A;  2HDD A;  2Z99 A;  3CJT B;  2LFB A;  5HS7 A;  4MFE A;  2XF5 A;  2DFF A;  1HKQ A;  2I5U A;  3BR2 A;  5B1B H;  1MMN A;  4EGY A;  1HA8 A;  5JHF A;  3ONQ A;  1I5Z A;  4L0Z B;  1U9N A;  1HBX G;  1B6A A;  3SEQ A;  1P4W A;  2Y0S N;  4A6D A;  2WAD A;  2WBM A;  2EQR A;  5J8C A;  1NHA A;  2EK5 A;  1DUX C;  1ZG5 A;  1XPX A;  1HKT A;  2EH3 A;  1ZGA A;  1MSF C;  2XRL A;  3C1D A;  3EDP A;  3FX3 A;  3IAS 2;  4X0G A;  3GZN B;  2KZV A;  3MKL A;  4CH7 A;  2VLA A;  1TWG J;  2H94 A;  4BE2 A;  4GFB A;  3MQ0 A;  2HDW A;  2V7F A;  4M3F A;  1OYY A;  3M1C A;  3RSN A;  3VEP A;  2LKX A;  1I6H J;  3HPG A;  2Y48 A;  4ZYA A;  5LBQ A;  4PGH A;  1WH7 A;  4ZDL A;  2MSY A;  2ZC2 A;  3D5L A;  1JKQ C;  2PMH A;  4F52 A;  1R58 A;  2BOL A;  1R6R A;  5DUK A;  3H9G A;  3TOB A;  2IS1 A;  2MG4 A;  4XQF A;  2LC2 A;  2UXX A;  1S8N A;  3HB9 A;  2HS5 A;  3J7A O;  1JKR C;  2KDO A;  2Y75 A;  4JP0 A;  5J4Y A;  1LPQ A;  4IVN A;  3VOE A;  3L7W A;  4J01 A;  4BDZ A;  2OQG A;  4DIQ A;  4A12 A;  2IGK A;  2XKP A;  2FBK A;  2YX7 A;  4GCV A;  2NOJ B;  4JX5 A;  4NUB A;  3DP7 A;  3HOU J;  2IA1 A;  2NS7 A;  2RRE A;  2XGE A;  1QHH D;  2L7F P;  4C30 A;  3H35 A;  2DPD A;  3IAM 2;  3VPR A;  3KE2 A;  4P96 A;  4O5V A;  2HOS A;  3CCS I;  2K5C A;  3K69 A;  3SFI A;  2EZK A;  4IJA A;  2F5C A;  2YR2 A;  4EM2 A;  1IXC A;  2EV0 A;  4I98 B;  1A04 A;  3F3X A;  5F27 A;  1RI7 A;  3LAP A;  2RKH A;  3EPZ A;  2P7V B;  4EAT A;  3A2K A;  3DPT A;  4PJL A;  3OSG A;  3TP0 A;  4IRG A;  3ZMT A;  3FM3 A;  3QRF F;  4AIH A;  2E36 A;  3QOD A;  1ZEL A;  1BR2 A;  2DLL A;  3HKZ A;  1D0Z A;  3SFZ A;  2BVL A;  4BAC A;  2DOA A;  3OL4 A;  3Q3S A;  1HW1 A;  2O7O A;  4EVI A;  3E6C C;  1Z7L A;  1K4S A;  4KIF A;  1R4N B;  4IHV A;  3RPQ A;  2Y69 H;  3WU1 B;  2X4H A;  4DGW B;  1IUY A;  4PJJ A;  4XKB A;  5EZH A;  1R23 A;  1W5C C;  3E6D A;  2FNA A;  4R1H A;  2NVT J;  2MLG A;  3WGH A;  2DA4 A;  1MMD A;  3CLQ A;  3RCO A;  1XTA A;  2QQB A;  3K0L A;  3L2V A;  1G3S A;  3H36 A;  5FLX Z;  2XPV A;  1X19 A;  1X1A A;  4UVA A;  1YQA A;  4M71 A;  4B8X A;  5IOY A;  2OAZ A;  2WC2 A;  1XX5 A;  4OOI A;  4XOP A;  4CCK A;  2DQL A;  2HZD A;  3GTP J;  5E79 C;  3CCU I;  5HDN A;  1W4M A;  4W97 A;  2EV5 A;  2QYO A;  2CUE A;  2K86 A;  3RIR A;  5DDG A;  4XNF A;  1WJ5 A;  5ICC A;  1U8R A;  2GAU A;  2QVO A;  3D5R C;  1XSV A;  4S05 A;  3T5X A;  2IP2 A;  1J7K A;  1J09 A;  3CP2 A;  3ESW B;  1I27 A;  3K4B A;  1HW2 A;  1LFB A;  4UB6 C;  3HSR A;  1A36 A;  3BCB A;  1FZP B;  2F5D A;  4RB0 A;  1VQM I;  4G9Y A;  3RYR A;  4KIB A;  2DT7 B;  5ILV A;  1RR8 C;  3KET A;  4PSW A;  2HXI A;  3F8N A;  1FX7 A;  3LSJ A;  1MMG A;  3ZQI A;  3KZY A;  2O5R A;  4WWC A;  1UFM A;  3DLL F;  2LBF A;  5ED4 A;  4Y7N J;  1SD6 A;  3OMY A;  3AG4 H;  4HDU A;  3CC4 I;  5J1U A;  1HKS A;  4EM0 B;  2GA1 A;  2OUM A;  4Q48 A;  3BR0 A;  3P9C A;  5M3M J;  3DKX A;  2FX0 A;  1HCR A;  2HDC A;  1D1B A;  2Y30 A;  3BQZ A;  2EPF A;  1I39 A;  2GBY A;  5CQG A;  2XF6 A;  4BDY A;  2DI3 A;  3SDG A;  1TT5 B;  1UHS A;  3RDI A;  5F1J A;  1Y0U A;  1DU0 A;  2LKP A;  3F6V A;  3FDY A;  4A3C J;  2JA5 J;  2AHQ A;  1U8B A;  2CFO A;  1BI3 A;  4FE4 A;  5IY5 H;  1XGM A;  2NNY A;  4PDK A;  1E0E A;  3O8G A;  6PAX A;  1YE9 A;  2DA1 A;  2H1K A;  3ZRG A;  1K79 A;  3IP4 B;  1ZRD A;  2HR3 A;  3K6G A;  3VFZ A;  3VYR B;  3GFL A;  2DA3 A;  2ICW G;  1KQ9 A;  2DJI A;  1G59 A;  3MZY A;  3W6J B;  1RUO A;  3R0A A;  4FET A;  4BXF A;  2KP6 A;  1QHG A;  3IRQ A;  4JYK A;  1KU3 A;  2KIF A;  2XPU A;  4DYQ A;  4HYE A;  5D4S A;  1SVO A;  3ASO H;  5CPR B;  2ZNZ A;  4UVB A;  2EIM H;  3LSR A;  1O3S A;  5BS6 A;  1DP7 P;  1O3T A;  1HXD A;  4IO9 F;  1F43 A;  4MHG A;  4II3 A;  1RKW A;  2V4J C;  3T1B A;  3E6M A;  2A07 F;  2GLO A;  1HDP A;  4BUP A;  2O61 A;  3SZP A;  1ZKG A;  1GUU A;  3J81 Z;  4QIW N;  4D1Q A;  1KU7 A;  3FXJ A;  1HSJ A;  2O9L A;  1XDU A;  3ZQC A;  2IAI A;  1FNN A;  3LQQ A;  1FYK A;  1MKM A;  3G73 A;  4IOC F;  5IPA A;  1VQ6 I;  5F0H A;  2UUZ A;  2D1H A;  3K1M A;  1IW7 F;  5F1R A;  4B43 A;  4ZYE A;  2ME0 A;  4M6Y A;  1MH4 A;  2R0Q C;  4I99 C;  2PLY A;  4MGR A;  1WHU A;  3M7G A;  3ZMD A;  2RNG A;  3HTU A;  1SFK A;  4AYB A;  2M4G A;  2R5Z B;  2FD5 A;  5BNG A;  3S1R J;  2ZNY A;  3OYB A;  1WJE A;  2JQ7 A;  3PFY A;  1JGG A;  3CDL A;  5ICE A;  2DDA A;  2P5V A;  4MEY F;  3M8E A;  3GX4 X;  3GME A;  3E97 A;  3BP8 A;  2P6S A;  1Q1H A;  2Z3Y A;  3OYF A;  2QEN A;  2MC4 A;  4A0Y A;  4YEL A;  2R7Z J;  4RLF A;  2QQA A;  1GV5 A;  2VKE A;  5KAF C;  1W1W E;  4S04 A;  3EUK L;  3HSE A;  2ZCW A;  1ETO A;  1OMI A;  2P7C B;  3K4J A;  1I6X A;  5K7H A;  2X9D A;  1X4O A;  2V1U A;  4KNY A;  1BN5 A;  1P7I A;  1L3L A;  1FBU A;  1VQP I;  1SMT A;  1IAW A;  2GXG A;  3FIW A;  5H6R A;  2Q0O A;  3OYL A;  3G1O A;  3M07 A;  4ZDO A;  1GDT A;  1OLT A;  2QBY A;  4ITV A;  3VSL A;  3BC8 A;  4C9Y A;  2ESN A;  4IZZ A;  1FSE A;  1ZRC A;  3CUQ B;  1O7L A;  2FJ1 A;  4LLL A;  1WKM A;  2LVS A;  1T2K A;  4UB8 C;  1T39 A;  3OYH A;  1S72 I;  2DA6 A;  1JJ6 C;  4AVP A;  1B4A A;  2KRF A;  2BBY A;  3OS2 A;  2E1M B;  2RDP A;  4HRI A;  1Z91 A;  4TV7 A;  4ENM A;  4OIN F;  1SC7 A;  5FJ8 J;  3A03 A;  1ERD A;  5FFX A;  1UHW A;  3ZQF A;  5F08 A;  2R7T A;  2LRE A;  1W0T A;  2LF8 A;  1UAA A;  1BOB A;  2DTR A;  2WB1 A;  3C3W A;  4GYG A;  3ZPL A;  4Q5S F;  1P4X A;  5K5Q A;  2Z1D A;  3MVP A;  1T6S A;  3PFI A;  2M8E A;  3W6V A;  3BTL A;  2XDV A;  3OYM A;  2ZJQ F;  1IRG A;  1RET A;  1YJW I;  3BPX A;  4XLH A;  3O6B B;  1SFO J;  1U5T C;  2NOG A;  5HLI A;  1G4D A;  3ML6 A;  4H4K C;  1ZTR A;  2DYS H;  4JOM A;  1MBK A;  2VQG A;  3GWZ A;  4MTE A;  3AG2 H;  4BE1 A;  2F2E A;  1TQI A;  2Z2S B;  1V55 H;  5E3L A;  4CA0 A;  2VT2 A;  4UUS A;  1FJL A;  5DUI A;  1ON1 A;  4KA4 A;  4BHB A;  3P9K A;  3OSF A;  1U6G A;  1F5T A;  2P81 A;  2G9W A;  4U0Y A;  1MMA A;  2IPQ X;  1OJL A;  2KL4 A;  2KZG A;  3DFG A;  2CS3 A;  1P9Q C;  1UST A;  2G7H A;  2HYJ A;  4CDG A;  4HNT A;  4KIS A;  1RPW A;  4F92 B;  1CF7 B;  4M6X A;  1PYV A;  3OOU A;  2DA5 A;  4RGR A;  3IC7 A;  1U78 A;  4EJO A;  2F4M B;  4OMY A;  5DCF A;  2K3F A;  5JLW A;  4LFU A;  2RQQ A;  3K4M A;  3EQL F;  1LDD A;  1ODD A;  1WJF A;  2HPI A;  4MFD A;  1X1D A;  3VB2 A;  3FHN A;  3F9K A;  1ON2 A;  1YOV B;  2NYX A;  3S2H J;  1F4K A;  2CV0 A;  2DK8 A;  3BY6 A;  1FOK A;  4LMY A;  3OIQ A;  1BIA A;  5FLM J;  3IH2 A;  4HOB A;  1Z3Y A;  1YYV A;  2K9L A;  2XAJ A;  2LMD A;  1VQO I;  1EH8 A;  5DM7 F;  2DAO A;  1HQC A;  2VB6 A;  2MFZ A;  1RUN A;  4NB5 A;  4NC6 A;  2ZSH B;  3H3V K;  4JX4 A;  3WE3 A;  2VOD A;  1ZAO A;  4P9F A;  3CJQ B;  1MJB A;  2V1X A;  3CQZ J;  5TGT A;  3K10 A;  3T0Y A;  2XAS A;  2NAZ A;  5EGO B;  2DYR H;  4OMZ A;  1DGW Y;  1R1V A;  2E5N A;  4LIU A;  1R5I D;  1USS A;  2H8W A;  5AON A;  2CRG A;  4DYR A;  3ZQH A;  1FEX A;  4M72 A;  5AIQ A;  2DFI A;  2GOM A;  2KJB A;  4CO8 A;  2C6Y A;  2OTL I;  1HDD C;  4BQQ A;  3KZZ A;  4DOZ A;  2JT1 A;  2PFB A;  2XF7 A;  3TO7 A;  4CCL A;  2HKX A;  1UG0 A;  3L09 A;  2DMN A;  3ZGK A;  2DCE A;  2KQR A;  3TKY A;  1U9O A;  5FRO A;  5FKM A;  4BKX A;  3WG7 H;  3N4M A;  3UKG A;  4Z2Y A;  2OTJ I;  1TTY A;  1S6L A;  3HEF A;  3Q9V A;  1J59 A;  3F21 A;  5CVR A;  2MA3 A;  4AVZ A;  2CQ7 A;  1IG7 A;  4XRS A;  2CUZ A;  5C4J J;  2HQN A;  3V7C A;  2VOP A;  3N05 A;  2ELK A;  4Y17 A;  2R7D A;  2Y2Z A;  2Y9Z A;  5K5R A;  5E3N A;  2ZJR F;  2OZ6 A;  2Q1Z B;  2BXZ A;  5ICF A;  1UMQ A;  4EEF G;  2R7S A;  3KIO A;  3CJR B;  2M7A A;  3H1C A;  4U0W A;  1TWA J;  4RGX A;  3TMO A;  1UHM A;  4PK4 A;  4ZYG A;  1JUS A;  2E71 A;  4EJW A;  4C2M J;  3OYG A;  1SAN A;  1OCC H;  1QZE A;  3S16 J;  3JSO A;  3CF2 A;  3VDX A;  3JRI A;  4P1W A;  1N25 A;  4B3A A;  4LB6 B;  3CMY A;  4YFK F;  1XDS A;  2LP0 A;  2HKO A;  3OYK A;  2E1C A;  3M3Y J;  5FB2 A;  2TCT A;  2JSC A;  4XOT A;  2CO5 A;  4L0Y B;  2VPL A;  5M3F J;  5EEG A;  1SMY F;  3OYC A;  3ECO A;  4LG3 A;  2MW8 A;  5ICG A;  1IC8 A;  3H0D A;  4C3H J;  2J5P A;  2WY8 Q;  3CLO A;  5D8K B;  4F7Z A;  4UY8 I;  4NQW A;  3MFK A;  2DT6 A;  2FEZ A;  1O3Q A;  3MMY B;  1R4M B;  1OPC A;  3A01 A;  4EGZ A;  3CDH A;  4HG2 A;  1VQK I;  1SVM A;  4EMS A;  3HOX J;  1S7A A;  1MNE A;  4FQG A;  4IHW A;  2VUM J;  4KN7 X;  1B9M A;  4B3X A;  4NNJ A;  5JVT A;  1JUP A;  2UV1 A;  2V1D A;  3ABM H;  4B4C A;  1N75 A;  3FM5 A;  1T95 A;  4M73 A;  5D5W B;  1XMX A;  2DFE A;  1SAX A;  4N9I A;  1TW3 A;  1V3F A;  1W7P D;  3CCE I;  2VN2 A;  5DM6 F;  3O8H A;  1EF4 A;  2ID3 A;  2A5Y B;  3IV5 A;  5E8G A;  2EIK H;  2JMW A;  3VYU B;  2LD5 A;  2VOO A;  2M2E A;  4PGG A;  4YFX F;  3CCJ I;  3K4L A;  2FOW A;  2WV0 A;  4HPQ A;  2HGC A;  2ZKZ A;  4LK0 F;  2NXN B;  1G3T A;  2FF4 A;  1YX3 A;  3QU6 A;  1IJW C;  1K78 B;  5DEQ A;  2BW3 A;  2A6E F;  1LDJ A;  2FUG 2;  1R5H A;  2JTV A;  3HBL A;  3SYT A;  3LSM A;  2VKD A;  3WTY C;  2YS9 A;  1KA8 A;  3H9Q A;  3WTV C;  3HGY A;  1U0J A;  3LL7 A;  1TWC J;  4KT6 A;  3PNV A;  5A2Q K;  3DF8 A;  2HTS A;  2PJR A;  3IKV A;  1BJZ A;  1MNM C;  2CV2 A;  3I4M J;  1I1S A;  4AM3 A;  5HOO A;  1MMS A;  2FE3 A;  4G7Z F;  1N77 A;  3GTG J;  2DOD A;  3HHG A;  1F1Z A;  4EJV A;  3OR1 C;  2JA8 J;  3AL0 C;  4IHX A;  4LG0 B;  3HOS A;  2V9K A;  1MJ9 A;  3QOP A;  5GPC A;  1LNW A;  3Q9S A;  3BG5 A;  2HQA A;  2HI3 A;  2Z16 A;  1X3W B;  4BEH A;  5TJJ A;  1Y1V J;  1W5S A;  4DW6 A;  2ZME B;  2O8X A;  3DTK A;  3CME I;  3PO3 J;  3HXL A;  1LFU P;  2XGX A;  1T33 A;  3ROU A;  4PCQ A;  4BY7 J;  4DNC A;  4BGD A;  2IRF G;  3QYE A;  3GTJ J;  1R22 A;  3PL8 A;  1S3J A;  3QP5 A;  2IA2 A;  4GRI A;  3DWL E;  1Y1W J;  1QU3 A;  4K2E A;  2PMZ A;  1YW8 A;  4U7B A;  2XSD C;  3ERM A;  3AFH A;  3I59 A;  4FX4 A;  1JGS A;  5LHI A;  5M5Y J;  1V5F A;  4HAM A;  4AD9 A;  4GYI A;  1IF1 A;  2CW8 A;  1P7J A;  5F0F A;  3CO6 C;  2BVM A;  4PJM A;  3RQI A;  3S3M A;  3RPU D;  4HLY A;  3HRU A;  4IRH A;  3HDD A;  3BG6 A;  2OC6 A;  3H3U A;  5BQT A;  3L9F A;  1ETK A;  4QTR A;  3EET A;  1SFU A;  3H9J A;  4M3B A;  4NHJ A;  1JTX A;  1FOY A;  3RKW A;  2EIL H;  3ZMU A;  1YW7 A;  1HST A;  2DDB A;  2L3D A;  2ISY A;  4I7H A;  1WCM J;  3BR3 A;  5J47 A;  3VWB A;  1PUE E;  2R4G A;  5J1Y A;  2JK3 A;  2RVC A;  2OCE A;  2K02 A;  2STT A;  3SZG A;  5FO5 A;  2Z5U A;  1Z7U A;  3HHH A;  3HRM A;  5KNL A;  4DYC A;  2EJR A;  3D1N I;  2BY2 A;  1FP2 A;  2ZFW A;  2D5V A;  5BPD A;  2H6B A;  1BW6 A;  3CD6 I;  5CYV A;  2YSR A;  1FTZ A;  1FOX A;  5TRD A;  2X6Y A;  2UZK A;  1XSD A;  3HZJ A;  2R3S A;  1XCB A;  2M3A A;  3DPL C;  1Y8R B;  2LY2 A;  2BY0 A;  2V9V A;  2BGC A;  1K6O A;  4CYC A;  2Y0S A;  3QPL A;  5GTI C;  2W85 A;  2LLK A;  3HC7 A;  3LMM A;  4XON A;  1HC8 A;  2ZO4 A;  1BJA A;  2BYV E;  4PSX A;  1VI0 A;  5JVG F;  3SQN A;  2A6H F;  4GDF A;  3NQO A;  1N78 A;  2VON A;  2L0K A;  2BY3 A;  2CGP A;  5L3G A;  1HLV A;  4A6E A;  5EYR A;  1Z9C A;  1ZLK A;  4AIJ A;  5DCM B;  1WJA A;  1IN7 A;  4AU7 A;  1OYI A;  5FGM A;  4U87 A;  5D6E A;  3HUG B;  3KX2 A;  1M1E B;  4EJT A;  5FRN A;  1OR7 A;  4BU2 A;  4J19 A;  5LEK A;  2V9P A;  3VOD A;  5F04 A;  3KEY A;  3DBH B;  5E1X A;  3WGG A;  2RN7 A;  1RES A;  4LLG F;  3OV8 A;  3GTQ J;  3F72 A;  2Q2E A;  3S32 A;  4LD5 A;  1W7P B;  3KYD B;  4HQM A;  2XRN A;  2PJP A;  5FFZ A;  2R7U A;  1T0F A;  1K7A A;  2VJ5 A;  3WTS C;  2HOT A;  2XGD A;  4NBQ A;  3GEZ A;  2N8G A;  2F5F A;  3L00 A;  1DPU A;  5F0C A;  5EEA A;  1YLF A;  2IA0 A;  1KYW A;  2PQ8 A;  1JJ8 C;  3GFM A;  3J7A Y;  2TRT A;  2JWT A;  4V19 K;  3CZ6 A;  2BE5 F;  4M74 A;  2L4M A;  4QSH A;  2HTJ A;  3H5N A;  4Y52 J;  2W82 A;  1T56 A;  3FMQ A;  4WXD A;  1MDM B;  4RGS A;  3IH3 A;  2FXA A;  5CJ9 A;  1TNT A;  2PMU A;  2JJ7 A;  3S3O A;  1GLN A;  1O3R A;  9ANT A;  2HNH A;  1AKH B;  1DDN A;  4J00 A;  2RAE A;  3KLO A;  1PP8 F;  1ZG3 A;  5IYC J;  3L2R A;  3MKW B;  1PUF B;  4OIP F;  4HW0 A;  2ELJ A;  4G7O F;  2XGC A;  2X6W A;  2JVH A;  1Y8Q B;  3OYI A;  2R7X A;  1NH3 A;  1GVD A;  2L4A A;  2VPR A;  3ISP A;  4LK1 F;  4XR6 A;  3N97 A;  2NVQ J;  5KHD A;  1SEU A;  3JSP A;  4N4O B;  2KT0 A;  1D5V A;  2HOE A;  3GTO J;  3M8J A;  2VI6 A;  4ASN A;  4XID A;  3GLL A;  3ERE D;  5LGT A;  5HNF A;  4HQE A;  3GUD A;  1WH5 A;  2ECB A;  3KP7 A;  4A0Z A;  2NRA C;  4LLN A;  2FSW A;  4OWR B;  1WI3 A;  4IF4 A;  4B44 A;  2YU3 A;  5L3F A;  2FML A;  5EZG A;  1F9N A;  4RS8 A;  2H27 A;  2QGU A;  2KHM A;  3BZC A;  3P5J A;  3W2W A;  4GO1 A;  1QVT A;  1YRN A;  1ZR4 A;  4L9T A;  1GV2 A;  5DTD A;  4RB3 C;  1S5L C;  2VT3 A;  1TQM A;  1D1A A;  1R1U A;  2QQ9 A;  2KRC A;  4Y15 A;  2YPR A;  2QLZ A;  2NS0 A;  1FSH A;  3I5U A;  3UR3 C;  1IRZ A;  1QZY A;  1H88 C;  3TO9 A;  2MGQ A;  2O8K A;  3JTH A;  3S1M J;  1DP3 A;  2W57 A;  1OQY A;  2M45 A;  2MD5 A;  5CVV A;  4O6J A;  1XCV A;  2K9Q A;  2W25 A;  2FNP A;  2ESH A;  2W48 A;  2HXO A;  4KT5 C;  2FOK A;  4BJ6 C;  1B8I B;  2ID6 A;  4BH9 A;  1TLH B;  2X85 A;  3REO A;  2V79 A;  2KIU A;  2V1N A;  1K83 J;  1OCR H;  2WV1 A;  4YII A;  1LUJ B;  2CUJ A;  3ZQG A;  3F22 A;  2ADU A;  2EFN A;  3EUH A;  1VQ5 I;  3I71 A;  4MIM A;  5IP7 J;  3LSK A;  1KQ8 A;  4D5C A;  3BR6 A;  4G6D A;  3OWT A;  4AYB N;  1GXQ A;  3W2V A;  4BYY A;  3BG3 A;  4XRM A;  3F0C A;  3OYA A;  1S7O A;  2PG4 A;  4LJZ F;  1YHQ I;  4NC8 A;  1ZQ3 P;  3K70 C;  2W84 A;  3E0J B;  3O3K A;  4Y33 A;  1TP4 A;  1TL8 A;  3GTM J;  2F4I A;  5J8F A;  2HVR A;  3LSG A;  3G1M A;  2QEX I;  2ZSI B;  4RMN A;  3NAU A;  2FQ4 A;  2P6T A;  4ZZD A;  1FBQ A;  2VBZ A;  1WQ2 A;  3HG9 A;  1J0R A;  1UZC A;  4XN0 A;  2E7X A;  2DU9 A;  4Y13 A;  2DFH A;  4L5I A;  1MW7 A;  4KUM A;  4M9X A;  1H8A C;  4IHY A;  1ITY A;  3BCA A;  3BJA A;  4YEJ A;  2Z33 A;  1SD5 A;  3KCC A;  1R5G A;  2K40 A;  4RAG A;  1XGS A;  5B5E C;  2LTP A;  3BLY A;  3LNQ A;  3NEU A;  5LEJ A;  1QZZ A;  1E3H A;  3S15 J;  4KFC A;  1ETW A;  3KFW X;  4RDU A;  4ENJ A;  3DTI A;  2R7W A;  1TT0 A;  2JRT A;  3U9G A;  3FMS A;  2BZT A;  4HA8 A;  4XN3 A;  2W24 A;  3LA7 A;  1FMW A;  3HTS B;  4FHT A;  3I55 I;  4H0E A;  1X3U A;  2DMP A;  4IHS A;  1H89 C;  2R5Y B;  3JRA A;  2JPB A;  3E1S A;  2MC3 A;  2LY9 A;  1XC5 A;  3A01 B;  4F3Q A;  3CC2 I;  4A2U A;  1SVL A;  1A5J A;  3BTC A;  2WB1 N;  4KIG A;  2XB0 X;  1DQU A;  2BXY A;  3DU5 A;  4DZP A;  2OA4 A;  1SFE A;  3KP3 A;  5F6F A;  2KFD A;  4QPQ A;  2MAB A;  3IWF A;  5A2Q Z;  4GXO A;  3CO7 C;  1LEB A;  3MCZ A;  2OQR A;  5FD6 A;  3TDZ C;  1MIJ A;  4AUX A;  4IXA A;  2DO7 A;  4XLA A;  1IUF A;  1ONV A;  4FX0 A;  3R60 A;  4PZJ A;  4DBQ A;  4ENK A;  5J40 A;  2DJN A;  4JX6 A;  4CHU A;  2DK5 A;  3V42 A;  1F36 A;  1JKP C;  2IVM A;  5EG0 B;  3EYI A;  4P9U A;  3W3C A;  5D8L B;  2IS4 A;  4ABZ A;  2BW3 B;  4OIO F;  4ENN A;  2DTZ A;  2FA5 A;  2KJC A;  1QBJ A;  4A3F J;  2EFP A;  2L9N A;  3DEW A;  2DA7 A;  2PX9 A;  1XN7 A;  3RKY A;  4FTH A;  1X1C A;  2EFW A;  4BQN A;  4C3J J;  1J5Y A;  3OYE A;  1DU6 A;  3ZOB A;  2ZB9 A;  3S8P A;  1OCZ H;  2ZXW H;  4BBR J;  4M6V A;  3P7N A;  1JI8 A;  3JRF A;  1IN8 A;  3DKY A;  5EJC A;  4E4H A;  4PJN A;  4MTD A;  1U5T B;  3PIO F;  1SD7 A;  2M0C A;  4B48 A;  4AWX B;  5J6X A;  2L7Z A;  3BR1 A;  1V5G A;  1XMA A;  5JR3 A;  1G3W A;  1ETX A;  5CLS A;  2IW5 A;  3TP3 A;  1ZGW A;  2L02 A;  3WE2 A;  2R7R A;  1LFP A;  1O7F A;  3G2B A;  2WWY A;  4I02 A;  1ULY A;  3BR5 A;  4XRF A;  3SJM A;  4YRV A;  3M1E A;  2DBB A;  2OF7 A;  3LFK A;  3Q0W A;  4A5M A;  2EB7 A;  1FP1 D;  2L9V A;  1K61 A;  1FMV A;  3ASN H;  3UNG C;  1IN4 A;  1ZRE A;  4ETS A;  2GM4 A;  3NWT A;  3DKW A;  2UWM A;  1Z21 A;  4UUV A;  3FWE A;  4XLC A;  2JA6 J;  5C4X J;  3ABL H;  2A05 A;  2G0E A;  2VIX A;  1O4X A;  3CMA I;  5ILS A;  2M34 A;  3QYF A;  3X2Q H;  5IP6 A;  3JRC A;  1VQ4 I;  4ESB A;  3C7J A;  2O0Y A;  2BEO A;  3KYC B;  4V2F A;  1LE8 A;  3WGI A;  3DV8 A;  2PN6 A;  1Y39 A;  2DN0 A;  3R6S A;  3AAF A;  3GO5 A;  2HPM A;  5D4R A;  2MYS A;  4HZF A;  1YIJ I;  3PSI A;  1IGN A;  1BOA A;  4D0P A;  4FCY A;  1U3E M;  5B3S H;  5H20 A;  2ZFU A;  5E17 F;  3LSH A;  5FRM A;  3QPT A;  3MD2 A;  3S3N A;  5JLX A;  1B1B A;  1CGP A;  2F5V A;  1D3Y A;  2K85 A;  2QQ8 A;  2EZH A;  3H5R A;  3DEU A;  5L3D A;  4RM2 A;  1MH3 A;  1YJ9 I;  2K9S A;  1P4A A;  1X58 A;  3CCL I;  4CYD A;  1D8K A;  1TWF J;  3FKJ A;  1BM9 A;  4I0B A;  2CQX A;  3FBI B;  2B0L A;  4KYW A;  4XLN F;  2HU9 A;  2X1C A;  3K1N A;  5CVJ A;  2XAH A;  1B59 A;  1WGX A;  2R7O A;  4BY1 J;  2O3F A;  1MBG A;  4A3G J;  3HOV J;  1X4P A;  4PFO A;  4A3K J;  3KLN A;  4A3J J;  2M30 A;  1D0Y A;  3JRH A;  3JRB A;  4XRS G;  2E35 A;  3P9I A;  3A1Y A;  4IPA A;  1UEL B;  2A6T A;  4HV5 A;  3CCY A;  2XHK A;  3FF5 A;  1JHF A;  3LOC A;  4N4N B;  3WG9 A;  2Y9Y A;  1A6Q A;  5FKK A;  5L3B A;  1PJR A;  1AOY A;  4CCM A;  3ELK A;  1JT6 A;  5HS9 A;  4DJA A;  3G4S I;  3BTI A;  3BZK A;  1OR7 C;  1A6I A;  1AHD P;  1NK3 P;  4ANJ A;  4I0A A;  3AG1 H;  2OCC H;  2E34 A;  2VE8 A;  2K4B A;  4CZZ A;  1WSU A;  2M0M A;  1MBH A;  4DBR A;  3BWG A;  1BW5 A;  3OL3 A;  1P6R A;  5EDN A;  2CWE A;  2K3P A;  3D5S C;  4YFN F;  4IHT A;  2ZXJ A;  1KQ0 A;  3T8R A;  1XB4 A;  1NTC A;  3M4O J;  2HZT A;  1T0F C;  1FLI A;  1IRF A;  5GPA A;  1VQ8 I;  3GFI A;  2BHY A;  2CUF A;  1D5Y A;  3H5A A;  3TW7 A;  3QYB A;  4BJ5 C;  1LKX A;  3ZMS A;  5J3L A;  4HSR A;  2FBH A;  2P4W A;  5J1R A;  1H0M A;  1ZGJ A;  5E18 F;  2OD5 A;  2W00 A;  3FXR A;  2R5Z A;  3LWF A;  3HOT A;  3F23 A;  1E3O C;  5FKN A;  5B1A H;  5E3M A;  4A3D J;  2VQH A;  4XL9 A;  2R7F A;  2CSO A;  4HV6 A;  2LR8 A;  4YIF A;  2QA4 I;  1X1P A;  3H92 A;  4P5O A;  4W1U A;  4XKC A;  5D6F A;  2ZXI A;  1XSX A;  2KIQ A;  3GCM A;  1QO0 D;  1EH7 A;  2ME6 A;  2Z9O A;  3LQR A;  1JKO C;  1OYW A;  3SHF A;  2MH2 A;  4I2O A;  2DA2 A;  1YFH A;  2VXD A;  5D5V B;  1WWX A;  2EIJ H;  4JK1 X;  1BI2 A;  1KZH A;  1RZ4 A;  3ZN1 A;  5B66 C;  1E3P A;  3FZV A;  4XLE A;  5FD5 A;  2VJJ A;  2GIZ A;  2WAQ A;  4UVC A;  1BI1 A;  3CDI A;  2Q8K A;  4G8X A;  3V8L A;  5DS9 A;  5IOZ A;  1YIO A;  4XSX F;  2GA2 A;  1G8X A;  3SDB A;  3NRV A;  3CUQ A;  3NWS A;  2AS5 F;  3BG9 A;  3I4P A;  1VQ9 I;  2GXA A;  3M8F A;  1VND A;  3HOZ J;  3OIP A;  4S0H B;  2VAS A;  1KON A;  5KAI C;  1YJN I;  2IBD A;  1WPK A;  5CKT A;  3KYL A;  1LQ1 A;  2DOE A;  2LNB A;  1W36 C;  1QA6 A;  1RKT A;  4G12 A;  3JRG A;  1K6Y A;  3AKZ A;  2LBF B;  4KJZ A;  5HLG A;  1X2N A;  5HDG A;  3O2P E;  1IDY A;  1V54 H;  4HBL A;  3LAJ A;  1HF0 A;  4RGU A;  1ZH5 A;  2QCO A;  2PMZ N;  3BRO A;  1T8I A;  1T38 A;  4UXN A;  3LST A;  1LVK A;  3K9T A;  3WHC A;  4R8H A;  4RAF A;  4RA2 A;  5K5O A;  2HWV A;  3HOY J;  1Z6T A;  3JRE A;  2VKV A;  2CQK A;  4N0B A;  4O3M A;  3BPV A;  4R79 A;  3JTG A;  3I0T A;  1E17 A;  3EYY A;  1EH6 A;  2DQR A;  2E19 A;  2DT5 A;  2BV6 A;  2KKO A;  3F6O A;  3FMR A;  2E5Z A;  2ETH A;  2YUS A;  5F64 A;  1R1T A;  2IXS A;  5FKL A;  3FXL A;  2ELH A;  3WHB A;  1Z1D A;  1EV7 A;  1PP7 U;  2XAU A;  4A3M J;  3VYT B;  2KPM A;  4HX8 A;  3L2W A;  3S17 J;  2KDZ A;  2VQL A;  2F4O B;  2NS8 A;  2JPC A;  3EUH C;  2OZU A;  5LGN A;  1CF7 A;  1SAU A;  3L2C A;  1S7E A;  2PI0 A;  2EA2 A;  2L9S A;  4BJT A;  3J80 K;  2GZW A;  5KK1 A;  5JI6 A;  1FC3 A;  2WAE A;  2B7E A;  1Z3X A;  1TC3 C;  3PNY A;  3MZH A;  4Q4Z F;  3QPH A;  1VFC A;  2F6C A;  3K4N A;  1FTT A;  4BXX J;  4HDV A;  3JRD A;  2VXZ A;  1GHC A;  3GFJ A;  4ZYD A;  1EA3 A;  3WTZ A;  2VKH A;  1TZL A;  1R71 A;  4IQJ A;  4CGZ A;  2IS2 A;  1D0X A;  5HS8 A;  3GTL J;  2VBW A;  2I10 A;  3RTR A;  3R61 A;  4RAZ A;  3JCU C;  3TO6 A;  4BNC A;  2LF7 A;  4XLP F;  3HPH A;  4U0V A;  3B73 A;  3Q5F A;  2Y0M A;  2NVX J;  2FRH A;  3WTU C;  3V7S A;  5EGO A;  2EWN A;  1RRJ A;  2EZI A;  3EUA A;  2VQC A;  2LSO A;  4LOC A;  3WU0 A;  4FT8 A;  4HEA 2;  4CCN A;  3K70 D;  2HVQ A;  1OCT C;  3C2B A;  2RNJ A;  2AXT C;  4FAS D;  3BJ6 A;  2H6C A;  5KCM A;  1E2X A;  2DMU A;  1S29 A;  3LFU A;  1YX5 A;  2QM3 A;  3CCM I;  1QNT A;  3GZ5 A;  3GZ6 A;  3IRR A;  3HKZ N;  4WXC A;  1G2H A;  2EA4 A;  4ZYH A;  1H9T A;  2ACJ A;  1SD4 A;  2QSF X;  2I8D A;  2P5K A;  5EF6 A;  4C2U A;  2L2O A;  4OIR F;  1B72 A;  3MKZ A;  3ABU A;  3S2W A;  2QBY B;  2IGM A;  3FK6 A;  2E2I J;  3G71 I;  4QLC U;  2ZBK A;  4A3E J;  4RAY A;  1NK2 P;  4PUS A;  3I54 A;  2QF7 A;  1FIA A;  5L3C A;  1B9N A;  4D9J A;  5TIS C;  1VTN C;  5HVQ C;  1PVE A;  1YI2 I;  4XBF A;  2EFO A;  4E70 A;  1IRX A;  2E2H J;  3IKT A;  3LA3 A;  4WX9 A;  3IUO A;  2DMT A;  1ZN2 A;  4A69 C;  1FYL A;  4HLX A;  5E1W A;  3K7A J;  2XPW A;  5LD2 C;  1YIT I;  3U1D A;  3ZCO A;  5E8I A;  3G3Z A;  5HLH A;  3I53 A;  5JHU A;  3NAR A;  1YG2 A;  3OYJ A;  2A3S A;  1ETQ A;  3SZT A;  4A5N A;  4E7K A;  3B6A A;  3HRS A;  4E7S A;  2CW7 A;  2KLO A;  2O03 A;  2VJ4 A;  3MEX A;  4M3D A;  4ZC3 A;  3S2D J;  4ZH4 F;  3CC7 I;  4PFP A;  1OIS A;  1I3Q J;  4ESF A;  2K9M A;  5H6Q A;  3CUO A;  5FKO A;  4B47 A;  1HW5 A;  1GVJ A;  2QUF A;  3PUF A;  3RYP A;  2R92 J;  4AIK A;  1GXP A;  4UUS B;  4ESJ A;  1R9T J;  3HM5 A;  1MSE C;  3K2A A;  5EEH A;  2K9N A;  3HIF A;  4CXF A;  2B63 J;  2W4S A;  1Z77 A;  2Y31 A;  2QSH X;  3MZ8 A;  1BR1 A;  1W5T A;  4DZJ A;  5LFA A;  4U7D A;  3A02 A;  2IJL A;  1I1G A;  2QSG X;  3RJP A;  1IV8 A;  3RQ4 A;  1TNS A;  4EQQ A;  2A5W A;  1R36 A;  3LSP A;  3QU3 A;  2XAG A;  2DOF A;  2IGN A;  5AIP A;  3GVA A;  4A3L J;  4UV8 A;  4YG2 F;  1WFX A;  2E60 A;  4WCG A;  3HL2 A;  4BBS J;  5ERI A;  2VC0 A;  3B6C A;  2JUG A;  1TW2 A;  5E1Z B;  1ENH A;  4QWQ A;  2M7B A;  3TGN A;  3LA2 A;  3FK7 A;  4F55 A;  3KP4 A;  4RLQ A;  3L1P A;  2L9R A;  2H09 A;  3AG3 H;  4CUG A;  4KDP A;  2X1E A;  3RZO J;  1K78 A;  5M5X J;  1L0O C;  3BOQ A;  1LE8 B;  1FY7 A;  4HX7 A;  3ULQ B;  3ZQQ A;  2CMP A;  3E7L A;  1XS9 A;  1Z6R A;  1MBJ A;  3OOP A;  5M5W J;  1YO5 C;  1IXS B;  1WZ2 A;  4RM3 A;  3OYN A;  5C3E J;  1STZ A;  5GAD J;  1BR4 A;  1JTY A;  3S93 A;  3ZMZ A;  2CYY A;  3PQJ A;  3WTX C;  1DPR A;  4G94 A;  1X3Z B;  2E1O A;  3ABK H;  3BG7 A;  4IL6 C;  2QZ8 A;  2X51 A;  3V8K A;  4MO7 A;  2VC1 A;  2ZJ2 A;  1OCP A;  1QPM A;  1ZHF A;  4LG0 A;  2AQE A;  3BJO A;  4ZTF A;  2EZL A;  3K4C A;  1I50 J;  1EJ9 A;  3HGG A;  2RV8 A;  4FIS A;  1JHH A;  1UB9 A;  4D7M A;  5LRS A;  1J9I A;  4F91 B;  2ZME A;  2LY1 A;  1IN6 A;  3CES A;  5GTH C;  3ZMV A;  3F8C A;  4BHP A;  2D45 A;  5GAH J;  2RGV A;  3TDU C;  4U88 A;  5IT9 Z;  3I4N J;  1T98 A;  2E2J J;  3QQA A;  1H9G A;  1ZYR F;  5CVI A;  4Y3O A;  4BE0 A;  3MN2 A;  1R49 A;  2YU9 J;  1J2X A;  4E6K G;  4Q47 A;  5LGU A;  3FHZ A;  3FXO A;  3A0H C;  5BMZ A;  2XVC A;  1TBX A;  4CZC A;  3RKQ A;  1BL0 A;  4M3G A;  2KRH A;  4OAZ A;  3GYH X;  4C2T A;  3BDD A;  4HNU A;  2R7Q A;  5JFR A;  3ZQL A;  3JW4 A;  1D1C A;  4UNO A;  1TWH J;  1XMK A;  4XLF A;  4OIQ F;  3FXU A;  1DGR M;  3BT9 A;  4EJU A;  1QRY A;  1FT9 A;  1BI0 A;  2QKM B;  4HF2 A;  2AQF A;  4LB5 A;  5IP9 J;  3CF5 F;  2DMQ A;  2FMY A;  2LK2 A;  2M4K A;  4MQV A;  5DYM A;  2CQQ A;  1AA7 A;  2HEO A;  2RQP A;  3CTA A;  3KZI C;  2L7K A;  3CCV I;  3DBL B;  4NDL A;  4II2 A;  2R7V A;  4I01 A;  4JBA A;  4L5J A;  4JQF A;  4D7N A;  2JA2 A;  2HOA A;  2ZXH A;  5HDK A;  4X6A J;  1WJD A;  5E20 A;  4B1R A;  3E5X A;  3I3L A;  2FBI A;  3ZQ7 A;  5LLQ A;  5D5U B;  4NC7 A;  4IEJ A;  1NG7 A;  1UG2 A;  4NQW B;  1C0W A;  2OPT A;  5FLV A;  4RB2 C;  3DXJ F;  1QPI A;  5H2F C;  2VBX A;  2M5W A;  4LIV A;  1RR7 A;  1NG6 A;  1ORK A;  3JAM Z;  1KU2 A;  3F8F A;  3WOD F;  1MBE A;  5K7Z A;  5DD4 A;  1QGP A;  3SXY A;  1IXR C;  2P5L C;  4LIT A;  4XOR A;  4KMF A;  2HFH A;  3HJE A;  2ZJP F;  5BOX A;  1U2W A;  1JXS A;  1ZAR A;  2D1V A;  3KP6 A;  5L3E A;  3K4K A;  3ECH A;  2TDX A;  4C3I J;  5DCM A;  1OKR A;  4Z6Y A;  2M87 A;  3I58 A;  1IDZ A;  3COA C;  4A93 J;  5IYB J;  3CUQ C;  3HUG A;  4M9Z A;  5IT3 A;  2EIN H;  3G1L A;  3QAH A;  4ZDP A;  3PJR A;  1PDN C;  2H8R A;  2E1M C;  5HLT A;  4CSW A;  4KN4 X;  2HYF A;  2X0L A;  3A4C A;  3PQK A;  4XKW A;  4LGW A;  3V8J A;  2V6E A;  1KU9 A;  2UXN A;  4ON0 A;  4L9N A;  3OR2 C;  1ETY A;  2X6X A;  3WU2 C;  1LB2 A;  1OCO H;  4MNU A;  2OBP A;  1CQT A;  1J75 A;  1UJ8 A;  4BS9 A;  1I3A A;  2J5O A;  2JVG A;  4MQ9 F;  4UUT A;  1XGO A;  4F93 B;  4ZTJ A;  1W7P A;  2VJI A;  1FYM A;  3PM1 A;  3FXQ A;  2PJR B;  4BHC A;  4DQ2 A;  1FPQ A;  4UHT A;  5LHG A;  2K4J A;  2RC4 A;  3KEO A;  3PO2 J;  2X48 A;  4XK4 A;  1S9H A;  2ISZ A;  2O6G E;  3L2Q A;  3GW2 A;  5LHH A;  5BPI A;  4ZJZ A;  2M9H A;  3J80 Z;  2L5Q A;  1ZK8 A;  1LDK B;  2H1L A;  3DQV C;  3PUB A;  3IL2 A;  2KIM A;  4KIT B;  3GF2 A;  1Z05 A;  2PBI A;  4BEH B;  1KGS A;  4B09 A;  3GTK J;  1MDM A;  1ZG1 A;  3PNT A;  4E7L A;  2EBI A;  2COB A;  1WJC A;  3OYD A;  1R00 A;  4HF1 A;  1VQN I;  3I9V 2;  3DEE A;  3F8M A;  3WTT C;  3QPS A;  2FU4 A;  1AKH A;  1W36 D;  4XIC A;  2M8G X;  1MND A;  1MZB A;  1YTY A;  2W7N A;  1P2F A;  3TED A;  2XAQ A;  3QWL A;  1Q1V A;  4M3E A;  3L2U A;  2P0W A;  2CW0 F;  2DW4 A;  3I59 B;  5GAG J;  3J7Y J;  3BQY A;  2E7W A;  2X6O A;  1PUF A;  2YX4 A;  3F8B A;  2L7M P;  2K27 A;  4RB1 A;  2GIV A;  1RC9 A;  4XKV A;  5DV5 A;  4XMY A;  1YS6 A;  1JE8 A;  3FBN B;  2F5E A;  2GWR A;  2VBY A;  3QP6 A;  2XV4 S;  2D2W A;  4CCO A;  2BY1 A;  2A68 F;  3U2R A;  2IT0 A;  3BTJ A;  4IOA F;  5FLX K;  1XGN A;  3FKI J;  4E7H A;  2DPU A;  2XIG A;  2E1N A;  1T08 B;  2WAF A;  1K4T A;  1IN5 A;  2CU7 A;  3CCQ I;  1OFC X;  1REP C;  4YIR X;  3C2H A;  2PEX A;  2BHZ A;  2CQN A;  3U1K A;  3VSK A;  1LJ9 A;  2NVY J;  3VYS B;  3TBI A;  3U21 A;  1GT0 C;  3H0G J;  3FIS A;  2XC7 A;  3TOA A;  1V4R A;  4L9J A;  3JR9 A;  4BQA A;  2KIS A;  2A61 A;  4I6Z A;  4D5F A;  1BA5 A;  4UV9 A;  2L01 A;  2M1B A;  4WXH A;  3RPU A;  1AU7 A;  1MGT A;  4IRI A;  2XB5 A;  4GGG A;  3E5Q A;  4RBO A;  2HYG D;  1LVA A;  3DTE A;  3V4G A;  2WA0 A;  3ZN0 A;  4BL0 B;  2JN6 A;  3Q0V A;  3R4K A;  4L5E A;  1MJA A;  2JRM A;  3CJN A;  4HF0 A;  1MBF A;  1QQI A;  1G3Y A;  1QVU A;  1G6N A;  1UCR A;  2GOX B;  3TL4 X;  4BQO A;  5C44 J;  4CYC B;  1W0U A;  1EKE A;  3M9A A;  2AO9 A;  3W6K B;  4E7I A;  3RZD J;  5HOD A;  1B8I A;  3TW6 A;  3MAJ A;  3RKX A;  3K2Z A;  4XSZ F;  1VQL I;  1XG1 A;  1XD7 A;  2GQQ A;  2V26 A;  5K1Y A;  2NNN A;  1POG A;  2HQ5 A;  4QPO A;  3ZXS A;  1A35 A;  1BBY A;  1RNL A;  3T8T A;  4MEX F;  1B72 B;  3KP5 A;  4FE7 A;  3CCR I;  3C2G A;  2LYC A;  4MLO A;  1P92 A;  5D5X B;  1ACI A;  2W1O A;  3QOE A;  1KYZ A;  3OS0 A;  3RI4 A;  3S1Q J;  1VF9 A;  2GXB A;  5IT9 K;  5K7F A;  2XKO A;  3IHU A;  3MWM A;  3GLX A;  5E3O A;  2A69 F;  3I64 A;  2KMU A;  4PJ0 C;  3SEZ A;  2Q2E B;  1Y56 A;  4I09 A;  3OY9 A;  2MLK A;  1BC8 C;  1SFX A;  2MBF A;  4A0X A;  4M9S A;  3J7Z I;  4IX7 A;  3R0J A;  2XRO A;  2XAF A;  1ZR2 A;  3MKY B;  1WI9 A;  2LDU A;  3B02 A;  5GP9 A;  4L9V A;  2G7U A;  1V5E A;  2WAQ N;  2OV7 A;  4G6Q A;  4AID A;  3A0B C;  4IQ4 A;  3DLA A;  3S14 J;  1WJB A;  3LSI A;  3H3Z A;  1JT0 A;  1ZLJ A;  2IS6 A;  3I56 I;  2CV1 A;  4HST A;  3KPH A;  2IGO A;  2AXL A;  1FOW A;  1Z67 A;  1JUM A;  2V6C A;  3J81 K;  2VE9 A;  1FBS A;  1A31 A;  3K1P A;  2LH9 A;  1ETV A;  3DCF A;  2X1D A;  2LRD A;  2R5Y A;  3OS1 A;  4IKF A;  4V2G A;  5CVU A;  4HNV A;  1RIO H;  1APL C;  1VQ7 I;  2OU2 A;  3W2A A;  2LKS A;  4CIC A;  3C18 A;  1R7J A;  3IH4 A;  2P8T A;  5CQE A;  4G7H F;  2ECC A;  4WF2 A;  4XM3 A;  4BAY A;  1WRJ A;  3DPU A;  2F48 A;  3BZ6 A;  1BIB A;  3D0S A;  2JSP A;  4G6T B;  4KIC A;  1Y0N A;  4X1E A;  5GAE J;  2JA7 J;  4Y4R A;  2HVS A;  3KP2 A;  1IZ1 A;  5J4V A;  1VZ0 A;  2LG4 A;  3ZR8 X;  3S1N J;  1FIP A;  2NVU B;  3IWZ A;  2QKL B;  3JAM K; 
#chains in the Genus database with same CATH homology
 3FHN A;  3F9K A;  2HVR A;  3LSG A;  2CV0 A;  3DU6 A;  2ZSI B;  4RMN A;  1IRX A;  3OIQ A;  3IUO A;  1Z3Y A;  2K9L A;  5LD2 C;  2VL8 A;  3HG9 A;  4E7J A;  4XN0 A;  4OAY A;  3ZCO A;  2WY7 Q;  2LOO A;  2VB6 A;  2MFZ A;  1MW7 A;  2ZSH B;  3OYJ A;  1Y6I A;  3BCA A;  4YEJ A;  3AL0 B;  3CJQ B;  4E7K A;  3CMM A;  4E7S A;  2CW7 A;  2KLO A;  3BLY A;  3K10 A;  5TGT A;  2VJ4 A;  4ZC3 A;  4PFP A;  3DTI A;  2R7W A;  1TT0 A;  1DGW Y;  2K9M A;  4E7Z A;  2E5N A;  4B47 A;  4LIU A;  4XN3 A;  1FMW A;  5HVQ C;  3CP8 A;  2MD0 A;  2W4S A;  2GOM A;  1BR1 A;  3E1S A;  5LFA A;  2XSJ C;  4BQQ A;  4DOZ A;  4F3Q A;  3GBG A;  2XF7 A;  4CCL A;  3RQ4 A;  1UG0 A;  4CCJ A;  1DQU A;  2A5W A;  3DU5 A;  2DCE A;  2KQR A;  1X1B A;  3ZGK A;  2CH0 A;  5FRO A;  2DXI A;  4QPQ A;  2MAB A;  5HNH A;  3PSF A;  2IGN A;  2XF5 A;  1WFX A;  2E60 A;  4AVZ A;  4XLA A;  1MMN A;  1HA8 A;  2CUZ A;  3HL2 A;  5JHF A;  3ONQ A;  2JUG A;  4DBQ A;  3N05 A;  3SEQ A;  2M7B A;  4F55 A;  4RLQ A;  3V42 A;  2WAD A;  4CUG A;  2X1E A;  2WBM A;  3W3C A;  2IS4 A;  2Q1Z B;  3ZQQ A;  2BW3 B;  2CMP A;  2R7S A;  3CJR B;  2M7A A;  3IAS 2;  4RM3 A;  4X0G A;  3OYN A;  3TMO A;  4PK4 A;  2KZV A;  3OYG A;  1BR4 A;  2L9N A;  3S93 A;  4CH7 A;  2VLA A;  3CF2 A;  4BE2 A;  3VDX A;  4P1W A;  2HDW A;  2V7F A;  3M1C A;  1X1C A;  3RSN A;  3OYK A;  3HPG A;  4BQN A;  3OYE A;  4ZYA A;  4XOT A;  3BG7 A;  3S8P A;  2VPL A;  4ZDL A;  1JI8 A;  2X51 A;  3DKY A;  3D5L A;  4E4H A;  3OYC A;  4PJN A;  4F52 A;  4LG3 A;  2BOL A;  2AQE A;  3H0D A;  4B48 A;  1R6R A;  3H9G A;  2IS1 A;  4ZTF A;  4XQF A;  2WY8 Q;  2LC2 A;  1V5G A;  3K4C A;  2DT6 A;  3MMY B;  2KDO A;  4HG2 A;  4F91 B;  3CES A;  2LY1 A;  1MNE A;  4J01 A;  2R7R A;  1LFP A;  4BDZ A;  4B3X A;  3G2B A;  4NNJ A;  4DIQ A;  2UV1 A;  2IGK A;  1N75 A;  4YRV A;  1T95 A;  2NOJ B;  4NUB A;  4Y3O A;  4BE0 A;  2RRE A;  4E6K G;  1QHH D;  4C30 A;  1FMV A;  3UNG C;  3H35 A;  3NWT A;  3IAM 2;  4CZC A;  3VYU B;  2UWM A;  1Z21 A;  2K5C A;  2KRH A;  4OAZ A;  4XLC A;  4C2T A;  3K4L A;  2VIX A;  4HNU A;  2R7Q A;  4HPQ A;  3QYF A;  1D1C A;  4XLF A;  1DGR M;  1YX3 A;  2BW3 A;  2QKM B;  2AQF A;  2HPM A;  3EPZ A;  2MYS A;  2FUG 2;  2M4K A;  3PSI A;  3SYT A;  3DPT A;  4PJL A;  4EAT A;  3A2K A;  3LSM A;  2VKD A;  1AA7 A;  2L7K A;  2ZFU A;  3H9Q A;  3LL7 A;  1U0J A;  3LSH A;  4II2 A;  5FRM A;  4KT6 A;  2R7V A;  3MD2 A;  3S3N A;  3PNV A;  3QOD A;  2F5V A;  1ZEL A;  1BR2 A;  3HKZ A;  2PJR A;  1D0Z A;  4JQF A;  2BVL A;  4BAC A;  2DOA A;  3OL4 A;  3H5R A;  2CV2 A;  2JA2 A;  5HOO A;  2ZXH A;  1Z7L A;  1WJD A;  4RM2 A;  1N77 A;  3I3L A;  4NC7 A;  3OR1 C;  3AL0 C;  4DGW B;  4PJJ A;  4XKB A;  3HOS A;  2V9K A;  1NG7 A;  3FKJ A;  2HQA A;  3FBI B;  4NQW B;  2HU9 A;  2Z16 A;  1MMD A;  3RCO A;  2X1C A;  4BEH A;  3L2V A;  2R7O A;  3DTK A;  4LIV A;  1X1A A;  1X19 A;  1NG6 A;  1X4P A;  3HXL A;  4PFO A;  1D0Y A;  4XOP A;  4BGD A;  4CCK A;  2HZD A;  3QYE A;  3A1Y A;  3PL8 A;  4LIT A;  4XOR A;  1UEL B;  4GRI A;  3DWL E;  2A6T A;  1QU3 A;  2PMZ A;  4U7B A;  3AFH A;  1V5F A;  4XNF A;  1WJ5 A;  3K4K A;  4N4N B;  2CW8 A;  3D5R C;  2BVM A;  4PJM A;  1PJR A;  3S3M A;  3CP2 A;  1J09 A;  4CCM A;  3RPU D;  4DJA A;  3K4B A;  3BG6 A;  1OR7 C;  3BCB A;  2OC6 A;  4ANJ A;  4ZDP A;  2DT7 B;  3PJR A;  2E1M C;  3H9J A;  5HLT A;  4CSW A;  2M0M A;  3A4C A;  4PSW A;  4DBR A;  4XKW A;  2V6E A;  3OL3 A;  1MMG A;  3OR2 C;  2X6X A;  2K3P A;  3D5S C;  2O5R A;  4BS9 A;  2JVG A;  3VWB A;  2R4G A;  2LBF A;  1T0F C;  3OMY A;  4F93 B;  4ZTJ A;  2VJI A;  3SZG A;  2PJR B;  2OUM A;  3H5A A;  4BJ5 C;  3DKX A;  3QYB A;  1LKX A;  5KNL A;  4HSR A;  1S9H A;  1D1B A;  3L2Q A;  5CQG A;  2XF6 A;  4ZJZ A;  2W00 A;  4BDY A;  2L5Q A;  1LDK B;  3HOT A;  3DQV C;  3PUB A;  2X6Y A;  3FDY A;  4KIT B;  2VQH A;  4XL9 A;  2CFO A;  2M3A A;  4BEH B;  3DPL C;  1E0E A;  2LY2 A;  1YE9 A;  4P5O A;  3ZRG A;  3PNT A;  4XKC A;  4E7L A;  3IP4 B;  2ZXI A;  2Y0S A;  1WJC A;  3OYD A;  3K6G A;  3HC7 A;  3LMM A;  4XON A;  3VYR B;  3I9V 2;  3DEE A;  2DJI A;  1G59 A;  4PSX A;  1W36 D;  1N78 A;  2VXD A;  1MND A;  4FET A;  4BXF A;  2KP6 A;  1QHG A;  2W7N A;  3L2U A;  2P0W A;  4XLE A;  2VJJ A;  2WAQ A;  4XKV A;  4XMY A;  5CPR B;  1WJA A;  4AU7 A;  3FBN B;  4U87 A;  1G8X A;  3SDB A;  3HUG B;  3KX2 A;  4II3 A;  5FRN A;  4CCO A;  3NWS A;  2V4J C;  4BU2 A;  4BUP A;  3OIP A;  4E7H A;  2VAS A;  3KEY A;  4D1Q A;  1KON A;  5CKT A;  3KYL A;  2WAF A;  1W36 C;  1K6Y A;  3C2H A;  2UUZ A;  3AKZ A;  3S32 A;  2LBF B;  4KJZ A;  3VSK A;  4B43 A;  3VYS B;  3TBI A;  3U21 A;  2R7U A;  2XC7 A;  2VJ5 A;  1LVK A;  2RNG A;  1SFK A;  4AYB A;  2M4G A;  3J7A Y;  3OYB A;  1WJE A;  3PFY A;  3CZ6 A;  3DTE A;  4R79 A;  2WA0 A;  4BL0 B;  3H5N A;  2W82 A;  3OYF A;  2MC4 A;  2GOX B;  4YEL A;  2E5Z A;  4BQO A;  3TL4 X;  4RLF A;  2IXS A;  3S3O A;  1GLN A;  3EUK L;  2HNH A;  4E7I A;  2XAU A;  3VYT B;  2KPM A;  4J00 A;  3L2W A;  2VQL A;  3K4J A;  3L2R A;  3MKW B;  1X4O A;  3EUH C;  2V26 A;  1SAU A;  2ELJ A;  4QPO A;  3OYL A;  3ZXS A;  2X6W A;  2JVH A;  2L9S A;  4BJT A;  3OYI A;  4ZDO A;  2R7X A;  1OLT A;  4ITV A;  3VSL A;  3C2G A;  3BC8 A;  2LYC A;  2WAE A;  4C9Y A;  4XR6 A;  4IZZ A;  4MLO A;  1Z3X A;  5KHD A;  2W1O A;  4N4O B;  3QOE A;  3PNY A;  3OYH A;  3OS0 A;  3M8J A;  3OS2 A;  2E1M B;  4HRI A;  2F6C A;  3K4N A;  2KMU A;  5HNF A;  2VXZ A;  3SEZ A;  2Q2E B;  4OWR B;  1ERD A;  1Y56 A;  1EA3 A;  4B44 A;  3OY9 A;  2R7T A;  2LRE A;  2VKH A;  1TZL A;  1UAA A;  4IX7 A;  4IQJ A;  2IS2 A;  1D0X A;  1BOB A;  3MKY B;  2WB1 A;  3RTR A;  2KHM A;  3W2W A;  2Z1D A;  1V5E A;  3HPH A;  2OV7 A;  4IQ4 A;  3DLA A;  1WJB A;  2XDV A;  1D1A A;  3LSI A;  3OYM A;  4XLH A;  2KRC A;  2IS6 A;  2CV1 A;  4HST A;  2IGO A;  3EUA A;  4H4K C;  4JOM A;  2VQC A;  2VQG A;  3K70 D;  4BE1 A;  4HEA 2;  4CCN A;  2Z2S B;  2HVQ A;  3UR3 C;  4CA0 A;  4FAS D;  2LH9 A;  1DP3 A;  2X1D A;  5KCM A;  2LRD A;  3LFU A;  1YX5 A;  3OS1 A;  4IKF A;  1MMA A;  2KL4 A;  4BJ6 C;  3W2A A;  2CS3 A;  1P9Q C;  2X85 A;  2I8D A;  2V1N A;  4HNT A;  4KIS A;  4C2U A;  2L2O A;  4F92 B;  2CUJ A;  5CQE A;  1PYV A;  3OOU A;  4XM3 A;  3DPU A;  3MKZ A;  2JSP A;  3LSK A;  4G6T B;  2IGM A;  3OWT A;  3W2V A;  4Y4R A;  2HVS A;  3OYA A;  4NC8 A;  4PUS A;  3K70 C;  2RQQ A;  3E0J B;  3K4M A;  1VZ0 A;  2LG4 A;  4Y33 A;  3ZR8 X;  1WJF A;  4D9J A;  2F4I A;  2HPI A;  2QKL B;  1X1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...