1OR7C

Crystal structure of escherichia coli sigmae with the cytoplasmic domain of its anti-sigma rsea
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVMAAIEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma-E factor
publication title Crystal structure of Escherichia coli sigmaE with the cytoplasmic domain of its anti-sigma RseA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 23
structure length 66
sequence length 66
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03872 RseA_N Anti sigma-E protein RseA, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1or7C00
1OR7C
chains in the Genus database with same CATH superfamily
1QZEA 4A3CJ 4Q4ZF 3BJOA 3ZP5A 1HLVA 3K2ZA 2DODA 1ZGWA 5GP9A 4EJUA 5ICCA 4RGUA 4XR6A 2IW5A 3REOA 4X0GA 4A3LJ 5JFRA 3ELKA 1LFUP 3GXOA 2FQ4A 2E19A 2PN6A 3BR5A 4XQFA 1SMYF 2DFEA 5HLHA 4CGZA 2K4BA 2B0LA 2ZJRF 3ROUA 5JR3A 1OPCA 1IN6A 2VI6A 1TNTA 4Z2YA 5HLIA 1VFCA 4N9HA 3ASOH 1RR7A 2P5VA 1DP7P 3KZIC 3LSIA 5E17F 1SVMA 3HTSB 3SYTA 1WSUA 2VKDA 1WJFA 3ABUA 1B59A 3Q0WA 5FJ8J 2W82A 2ISYA 3G2BA 4D7NA 1Z7UA 1ULYA 4NC6A 3CQZJ 3KPHA 4KJZA 1R71A 1E0EA 3MKZA 1XD7A 1ETKA 3LAJA 4KA4A 3S8PA 5HODA 4M3GA 3ECOA 1ZAOA 3VYSB 1Z3YA 1VQKI 5ERIA 3GTGJ 4BJTA 1IDYA 3BR6A 5ILUA 3LFKA 2EQRA 2A68F 1R5ID 4OMZA 3ZCOA 5EGOA 1V55H 1YTYA 4QPQA 1GHCA 5DS9A 1QHHD 2DI3A 3WU2C 2QBYB 1MMNA 1YHQI 1PUFA 1KU2A 1R1UA 1IXCA 2LY9A 2M0MA 1FBQA 4FE7A 1YIOA 1ENHA 2CW7A 5LEKA 3S1NJ 3RQIA 2DMNA 1W1WE 2R7ZJ 2EV5A 2XAHA 2VE9A 1ETYA 1WFXA 2W24A 4MQVA 2DU9A 4E7IA 5BOXA 2PLYA 1MGTA 4HEA2 3WGGA 2OUMA 1UMQA 1FYKA 3JSOA 1BC7C 1MJBA 2MLGA 1S7AA 1UHSA 3H3VK 3IH4A 4BEHB 1W7PA 1I27A 2VC1A 3DBRB 1RPWA 4BDZA 2HZTA 2X6XA 3B6AA 2WAEA 2F2EA 1IC8A 4A3GJ 4R8HA 5CKTA 3HKZA 4KT6A 2VOPA 3BDDA 1YRNA 2E7XA 2ZXJA 2BEOA 1OCZH 3S1MJ 3KEOA 5A2QK 1XG1A 3CESA 3IRQA 4AVPA 5L3BA 1QZYA 4OIRF 5IT9K 2W25A 3V7SA 2V79A 3BZKA 2KJBA 5J8FA 2HR3A 3OS1A 3S1RJ 3IV5A 3S17J 3IAS2 1D0XA 3R4KA 1UZCA 1XC5A 4BQNA 5AIPA 4LG0A 2H09A 1MBFA 5JVGF 1XCBA 1Z77A 3W6VA 3PO3J 4BQOA 1QO0D 1NK2P 1F1ZA 5DD8A 3ZGKA 3GFIA 3J7AO 4BE0A 3N97A 2HPIA 1ODDA 2K3FA 4UY8I 2NOGA 3EYIA 1R1VA 2HQRA 4BHPA 1TT0A 3RDIA 2DFIA 2BHZA 3A03A 1R36A 4FQGA 4H4KC 3A02A 4FX4A 4IKFA 1VZ0A 1S5LC 2OU2A 2HQNA 3ZMUA 2M7BA 2O03A 2BY3A 1OLTA 3FHNA 3QYEA 2DJNA 3HTUA 1MBKA 1ON1A 3I0TA 2CW0F 2AQEA 4XIDA 1L0OC 1SEUA 2QENA 2UXXA 2XB5A 4KUMA 3GZNB 5KNLA 3J81K 1QNTA 5C4XJ 3WTSC 1Y8QB 2GXBA 4ITVA 3E6CC 2QZ8A 4JK1X 2HXIA 1YOVB 2YU9J 2R7QA 3W3CA 2KQRA 5CPRB 4XRSG 1FEXA 2EZLA 4KN4X 1TWHJ 4U87A 2LY2A 5E3LA 1PYVA 2GZWA 3E7LA 5M3MJ 4UHTA 3M9AA 3A01B 4B47A 4AYBN 1HW2A 5K7FA 3I53A 1MZBA 2LF7A 1BW5A 1KA8A 3R0JA 2NAZA 4EV0A 1J2XA 3OSFA 4ZYHA 4J19A 2LBFA 1MIJA 4ENMA 4WF2A 2K9NA 2L5QA 4OWRB 3ZMDA 1LEAA 1MNEA 1IUFA 4QPOA 3TW7A 3PNYA 1FBSA 2MABA 1K4TA 1MBHA 3N05A 3DQVC 2MGQA 3E6DA 3I9V2 4D5FA 1Y8RB 1U5TA 2IP2A 4ZYAA 4HRIA 2WA0A 1ZRFA 2AHQA 3CCUI 3SEZA 5K5QA 1PVEA 1WH7A 1XCVA 3DXJF 3DP7A 3ULQB 2OJED 4E6KG 1RESA 5EEGA 4G94A 3OYBA 2DXIA 3KZZA 1VQMI 2JA5J 3F72A 4U7DA 4CCKA 4CSWA 4OMYA 1BA5A 2VJ5A 2NVUB 3FX3A 2L9SA 4UVCA 1WH5A 1FJLA 2F6CA 5CYVA 4ZTJA 3H5AA 2ID3A 2FNAA 1XDSA 3DF8A 4C2TA 1W0TA 1LJ9A 3HXLA 5EGOB 1W5SA 1STZA 5HVQC 3BROA 3CCVI 1TBXA 3HC7A 3K4BA 5J47A 1E2XA 5LLQA 2NOJB 2HZDA 4L9JA 4P55A 4FTHA 4RB2C 1HDPA 2UWMA 4KIGA 1A36A 2K27A 3TDUC 4U88A 4G7OF 3I71A 4OIPF 4XLNF 3S3MA 1BOBA 1TNSA 2IAIA 4YG2F 1R4MB 4Y33A 3JREA 2XAFA 1IGNA 3SXYA 4IHSA 3IAM2 1ONVA 4IHVA 3OIPA 1TWFJ 4PUSA 3GMEA 1BIBA 4RLFA 2IA2A 4IJAA 3I64A 2OQRA 4TV7A 1UHMA 3CJTB 2XGXA 1TWAJ 1IRGA 2DT6A 5FFXA 1TQMA 4OIOF 3H1CA 2ELHA 2VPRA 3F8BA 1QBJA 5AIQA 5F64A 3B02A 3WGHA 5J4YA 2VQCA 2GIZA 1SD4A 3H3ZA 2VBWA 4F3QA 1IV6A 5L3FA 1YRNB 3ERMA 4X6AJ 2V9KA 1ZHFA 2WV1A 3CDIA 1VQLI 1X1CA 2AXTC 4CDGA 1G2HA 4WCGA 2DLLA 3BOQA 1D3YA 1MNDA 3BWGA 3RCOA 4I09A 2DPUA 3BZ6A 4M71A 4L9TA 3J80Z 3HYIA 2E5NA 1FYLA 1UG0A 4MFDA 2COBA 2IGOA 3GFMA 4HNUA 1F5TA 1AU7A 1BI2A 1QPMA 3J81Z 2M45A 2QCOA 3JSPA 1OYYA 2HVSA 3JRBA 1ZREA 4LOCA 4L0ZB 5D6EA 1O3SA 5K1YA 2P5LC 3R0AA 2DA6A 4GYIA 2VB6A 2DOEA 5GPAA 9ANTA 2VN2A 2CUEA 4RGXA 3NWTA 3LAPA 2KL4A 4UVAA 3TGNA 5DM7F 1FC3A 2L7KA 3L9FA 3L2VA 3DPTA 1WHUA 4BJ6C 5E3NA 4LLNA 5DTDA 2DA4A 1B9NA 5LGNA 2JSPA 2E60A 2F4IA 3D5SC 2F5CA 5HDKA 2Y0SA 3F22A 1HF0A 1IG7A 2ZXIA 1BJAA 3FHZA 2CQKA 3DEUA 1HBXG 1KQ0A 4KYWA 5KK1A 2MC3A 4F92B 1B72B 3IWFA 4NQWB 1RETA 4NHJA 1XGSA 5E18F 5LRRA 2H6CA 1R7JA 2EIMH 2IS4A 4A93J 4KFCA 3L2UA 3OV8A 2QQBA 2KHMA 3T8TA 2RNGA 5F04A 1EV7A 2WWYA 2G0EA 4ZZDA 2NXNB 4CCNA 3OR1C 1RUNA 3F0CA 2LG4A 2VQLA 4MIMA 1QVUA 1FZPB 1ZGAA 4IX7A 3S1QJ 2P6SA 1EKEA 2XRLA 1IN5A 2EINH 3O8GA 3L00A 4AUXA 2ZJQF 3EYYA 3PSFA 1O4XA 1U5TB 4IPAA 3BTIA 3BCAA 4KT5C 4E4HA 4C3JJ 5ILSA 3MEXA 3T8RA 2GWRA 3FBIB 3C2GA 4DZJA 1JUMA 4B1RA 2R7VA 3GLLA 1JXSA 1T38A 3E5QA 1K78A 2HWVA 1R9TJ 1X2MA 2D45A 1SD7A 2DMTA 2F5EA 5DV5A 3ZR8X 3D1NI 1FOKA 1RKWA 2QKMB 2WBMA 5IPAA 4HF0A 2W4SA 3W2AA 3KETA 4LIVA 3FISA 3HUGA 3OL3A 3MVPA 1JKRC 3Q9VA 2R4GA 3F6OA 3TO9A 2ESHA 3K1MA 1MH4A 1ZYRF 2DO7A 4IHYA 5CLSA 5LEJA 1Y1VJ 2LRDA 4ABZA 5IP9J 1FIPA 1JTYA 3E3VA 3CJRB 3LA3A 2ELJA 1DGWY 1S29A 2VXZA 3OYHA 1OFCX 2OD5A 2QVOA 3FF5A 2EFOA 4LB6B 1YYVA 3ML6A 4ZDPA 3PIPF 2C6YA 1PDNC 1JJ8C 3PL8A 2P0WA 2K40A 2YR2A 4LG3A 2ZSHB 2ZSIB 3LA7A 4MTDA 2Y31A 2O6GE 5DD4A 5BMZA 2O3FA 2XB0X 2XSJC 3MFKA 3IKTA 3M3YJ 3MKWB 2KZGA 4PSWA 1IXRC 3SZTA 1OISA 3OIQA 2JJ7A 1IV8A 1O7FA 4HNVA 4II2A 3N4MA 3CLQA 3V8JA 4HQEA 2HDDA 3VSLA 1MDMB 2EA4A 2EB7A 2HS5A 4HF2A 2QA4I 4BNCA 2GIVA 2Q0OA 1VNDA 3K4KA 2NS8A 2X1DA 2CG4A 2K02A 2OBPA 2OZ6A 4IRIA 1GXPA 1U8BA 4M6YA 2E2IJ 2XAUA 2RDPA 3H0GJ 3KLOA 4WX9A 2A05A 1PP7U 3A4CA 2EJRA 2XASA 3IP4B 4NBQA 4GYGA 4CCLA 1D0YA 2BE5F 1U8RA 4UUSB 3WTXC 1LDKB 1TP4A 4M6XA 1ORKA 1DPRA 2ZMEA 3FWEA 3G1LA 2ZJPF 3IUOA 4A5NA 1TW2A 1XSDA 4XRSA 1QVTA 3QYFA 1QHGA 5EG0B 4KIFA 1SFUA 1K61A 3HL2A 5HS8A 3BZCA 2R5ZA 2B63J 2MH2A 5GTIC 1U9NA 3TO7A 4XRMA 2JA6J 2GXAA 1OMIA 2O61A 1IW7F 1KU9A 2CMPA 4FHTA 3HEFA 2BV6A 1U3EM 1T95A 4DYRA 1IDZA 1GVDA 4P9UA 2KDZA 1T08B 4Y52J 1N25A 1ZKGA 3WG7H 3K4LA 1MBEA 1YIJI 5CQEA 2ESNA 2F5VA 3VPRA 5IYCJ 2N8GA 1VTNC 3DU5A 1WJDA 1RNLA 1U5TC 2GA1A 2F48A 4G7ZF 1YX5A 3KYCB 5ILVA 2NVQJ 2JA2A 2H1KA 1XSXA 3NQOA 3L2RA 1U9OA 4FETA 3EUHA 3DTIA 3JTHA 4AC0A 5GAEJ 4BQAA 3HPGA 4UB8C 1ZR2A 2EV0A 5ICFA 5BPDA 2A5YB 5E79C 3Q3SA 5KAFC 3C7JA 2W48A 4OAZA 3CMYA 2EZHA 2KLOA 2W1OA 1ZTRA 2ZFUA 1SD5A 1RI7A 2CV2A 1P9QC 4KDPA 1XSVA 1TL8A 4V2GA 3LSMA 3OS2A 2L4MA 2R7FA 4XOPA 2NRAC 4OINF 1VQ5I 1E17A 2V1UA 1A6IA 1I50J 3DPLC 2ICWG 4BE2A 3LQRA 2OQGA 3JTGA 2M9HA 1X4OA 2ISZA 5EF6A 3S2DJ 5LHGA 1YE9A 2DA7A 4A3JJ 4XSXF 4QTRA 1HW5A 2YU3A 2JWTA 4M72A 5FKLA 2HQAA 2RN7A 1T98A 4N4OB 3K0LA 1LNWA 3WGIA 5IOZA 5IP7J 4ON0A 1LE8A 5J8CA 3HUGB 4F91B 4M73A 2Z99A 2CYYA 2M3AA 4B44A 4O3MA 4LD5A 2KIFA 1ZG1A 2P5KA 4XLHA 3LSRA 2R7OA 3BG7A 3K70D 1FMVA 3LSHA 4CUGA 1AKHA 3V8LA 4AIDA 4AVZA 3WTWC 1WWXA 1XMXA 2JMWA 3IHUA 4Q48A 2WC2A 4BQQA 5F1JA 3HOVJ 1OQYA 5H20A 3AG4H 2X1CA 1A31A 1Z9CA 3FIWA 3V7CA 2DTZA 2A6EF 3E1SA 2Q2EA 4HSRA 2E34A 3SHFA 2WB1N 1FSHA 2FU4A 4KN7X 3OS0A 3CCRI 1MNMC 1ZLJA 2E36A 2JUGA 3PFIA 1ITYA 3EQLF 5E8IA 5D8KB 3HOXJ 2VONA 4GFBA 2YS9A 4EQQA 3QU6A 1X3WB 4CYCB 2JA8J 4DJAA 4EJOA 1WVRA 4C9YA 5HNHA 1W36D 4BBSJ 5B1AH 2MSYA 1Y0NA 2VBZA 3BJAA 1U78A 3AFHA 5KVRA 3ZQCA 3SJMA 1O3RA 2Y48A 5IYBJ 2X0LA 2ZFWA 3M1EA 2ZCWA 4NNJA 2IXSA 2BYVE 4G7HF 1W5CC 2H8RA 3TOBA 4XRFA 1S7OA 2CW8A 3HRTA 3Q0VA 2LVSA 3CUQA 1N75A 3Q9SA 2FSWA 4AU7A 2R5YA 4HA8A 3ZMVA 3D0SA 4I0AA 1LVAA 1X1DA 1WJAA 2ZMEB 2XROA 4JOMA 4CICA 1K83J 3GZ5A 3K9TA 3KEYA 3I4PA 1ZRCA 3FDYA 1W4MA 2K7LA 5EJCA 2LY1A 4IO9F 2RV8A 3K10A 2DA1A 1MJAA 4PGHA 4E7ZA 2BW3A 2BOLA 3OYGA 1K7AA 3DEWA 4L0YB 3A2KA 4PDKA 2WAQN 2LMDA 3QAHA 2R3SA 4C30A 2DBBA 2NS0A 2IS2A 2K3PA 4LLLA 1ZH5A 1O57A 4HPQA 1MD0A 1IRFA 3DKWA 4HX8A 5E8GA 1JI8A 1J75A 1N78A 1JUSA 4A69C 4ZDLA 4A3DJ 2CFXA 3AL0C 5GAHJ 5LRSA 3WTYC 4R1HA 1FY7A 2Z9OA 2QM3A 2H1LA 2X51A 3LL7A 4KICA 3JRAA 1FT9A 3DLAA 4PFOA 1IUYA 1FX7A 4I0BA 2KRFA 1RR8C 2JSCA 1VQ4I 1I1GA 1D1BA 5HS7A 1KYWA 3T0YA 4CCMA 2CJJA 2ZKZA 3LSPA 2RQQA 5IYDJ 2TCTA 4Y15A 2E5ZA 1XDUA 1ZRDA 1MMDA 4Y17A 3VOEA 3W6KB 1H8AC 4HF1A 2W7NA 4M3EA 4U7BA 2RVCA 2VKEA 4IXAA 5DDGA 2MYSA 3ONQA 4UVBA 4C3HJ 5B5EC 2XPUA 5F08A 5GAGJ 3UKGA 3K4JA 4JQFA 2VOOA 3RPUA 3GZ6A 3SFIA 2PJRB 4LIUA 1HKSA 2FNPA 2MW8A 4I7HA 3QU3A 1HCRA 2JVGA 2P7VB 4R79A 1JTXA 2I8DA 1H0MA 4A0XA 2ZC2A 3D5LA 5E1ZB 2BXYA 2DQLA 2NVYJ 1HKQA 4JX5A 2E1MC 1R4NB 3H9JA 1ZGJA 3PNVA 1RKTA 5JHUA 4LITA 2NYXA 4A3FJ 3J7ZI 2D5VA 1KQ8A 3JRFA 2EPFA 1WRJA 2IGNA 3BR2A 2XPVA 4CXFA 1FNNA 2P6TA 4BXFA 4V19K 3FM3A 1OCOH 2P4WA 3ZQFA 1Q1HA 2JPCA 1LE8B 3HOWJ 5CVVA 2VIXA 3KP7A 4G6DA 4HNTA 4N0BA 2D2WA 3S32A 4I99C 3DPUA 1O3QA 1AKHB 1G59A 3QPLA 3SQNA 4IZZA 2CV0A 3H5RA 4LLGF 3RKYA 2DMPA 3S2WA 1SMTA 3ABLH 5FKOA 4BE1A 3RZOJ 1J5YA 1E3HA 1BC8C 5FRMA 2Q2EB 4XLPF 1IJWC 2ZB9A 5FKKA 2KP6A 2HYJA 2V7FA 3I59A 3KLNA 1BBYA 2ZJ2A 2LKPA 2DJIA 2XVCA 2V1NA 4HV6A 3GTMJ 3OYCA 2A6HF 2ZMEC 3V4GA 2YSRA 2ZO4A 3C2BA 1A04A 3CZ6A 1F9NA 1H88C 3CCSI 5L3GA 2LKSA 4KNYA 1EH6A 2BY1A 4I6ZA 1I39A 1ON2A 2IA0A 1N77A 1Y1WJ 4NC8A 4RAZA 1K6OA 1YS7A 2EIJH 2AO9A 3S3OA 3E0JB 5FLMJ 2R0QC 5J40A 2KJCA 5K7ZA 2HOSA 2XC7A 2KIUA 2L7MP 4XKVA 3LQQA 3IKVA 2IGMA 4ASNA 5D5UB 3HB9A 1YJNI 1PUFB 4S0HB 2I10A 2AQFA 5A2QZ 4RDUA 2R5YB 2QSFX 3CCQI 1R5HA 3ECHA 1X3UA 2JUCA 3EUHC 2DTRA 3U1KA 4BY7J 3WHCA 1TTYA 1W5TA 2Z33A 2PI0A 3OYKA 3EDPA 1MMGA 3R6SA 4UUVA 5IT9Z 2HYGD 2MG4A 2WY8Q 3ZQIA 2Y9YA 2O8XA 1Y39A 4PK4A 1SVLA 2JRMA 2PFBA 2EFNA 1BN5A 5M5YJ 2MFZA 2K85A 2CQNA 3ZQ7A 1EH8A 2OTJI 3PFYA 1EJ9A 2BW3B 1P7JA 4BGDA 3MZYA 1W7PB 1E3OC 1UAAA 2FD5A 3CD6I 2WY7Q 4DYQA 2FQ3A 2R7SA 3CMMA 3KP3A 4IEJA 3W2VA 2W00A 2Q1ZB 3WTVC 4ENKA 3GTPJ 5C3EJ 2CGPA 2CQXA 1NTCA 4D0PA 3OY9A 3I56I 3S3NA 3TMOA 3PUFA 4AD9A 5J3LA 1GLNA 3G1MA 4BXXJ 1X2NA 1SAXA 2Z3YA 3RSNA 5TRDA 5F0FA 5JHFA 4M9SA 3CC7I 4A3EJ 1XX5A 2ID6A 2W84A 4EMSA 1WZ2A 2L3DA 3NAUA 2EV6A 2E7WA 2F5DA 2L9NA 2OCEA 3U2RA 5EDNA 3KCCA 1VQNI 2F5FA 3PQJA 1U2WA 1CQTA 4LG0B 1P7IA 4U0YA 2GA2A 3KFWX 4XONA 5F27A 2FA5A 1UCRA 2L7ZA 4X1EA 3JRIA 3GTLJ 4RA2A 2UZKA 3IC7A 3DWLE 1S3JA 3CDLA 3HKZN 4XLAA 1F43A 3QP5A 3GCMA 3F21A 1BI1A 2O8KA 4LMYA 5B66C 2ECCA 1VQOI 2DT5A 4UV9A 1B9MA 1G3WA 1I3QJ 3DEEA 2M0CA 3DBLB 3J7YJ 5K5OA 1JKOC 1AA7A 2HTJA 3FXQA 1GV5A 4YIFA 1T39A 4ENNA 2XHKA 3PJRA 1IAWA 4JYKA 1FLIA 2CO5A 3G3ZA 4EATA 4RAGA 3WU1B 5HLGA 2O5RA 3RPQA 1YJ9I 3R60A 4WXHA 4FASD 1ACIA 3BPXA 1GV2A 1R22A 3F23A 4AIHA 1R23A 1YW7A 3TQNA 3V7RA 1OJLA 1K79A 5KCMA 3TBIA 3K4CA 4FISA 5LHIA 3FXOA 2X6WA 4XSZF 2PMZA 5D6FA 1A6QA 3FBNB 2LNBA 2R92J 1SFOJ 2R7DA 3FMQA 3QPTA 1HSTA 2DYSH 1V5EA 1KZHA 4M9ZA 2JT1A 2E1OA 2CUZA 2X85A 2IS6A 1X1PA 2COMA 4YFKF 2J5OA 3F8CA 4S04A 3BR0A 3LA2A 3ABKH 2LBFB 2J5PA 1OYIA 2A07F 3HDDA 1VQ7I 1TZLA 4FT8A 2RQPA 2RC4A 2RREA 1T33A 3CUQC 4D1QA 5C44J 1MSFC 3I59B 5E1WA 2JPBA 2GOMA 1R00A 1TWGJ 5E3OA 1XPXA 3I5UA 2A61A 1S6LA 4MNUA 2ME6A 2XDVA 3L1PA 2JA7J 2EZIA 2FJ1A 1BIAA 3FMSA 3BG6A 4AIJA 4LK1F 4O6JA 3VWBA 3F6VA 1FTTA 3L2CA 4PJNA 3OYJA 1SD6A 2KDOA 1FYMA 2DDAA 2V1DA 3FK7A 2PEXA 1BI3A 1FBUA 2QKLB 5L3EA 1YQAA 1B6AA 1ZK8A 5F1RA 1SFEA 3H92A 3HSRA 3BPVA 2M8GX 1P4AA 2TRTA 4EJWA 2OCCH 2EILH 4I02A 1JE8A 4U0VA 2M4GA 2X9DA 1SVOA 3RQ4A 3QRFF 3G73A 2D1HA 3FXRA 2L9VA 2EFQA 3O2PE 2DCEA 4HLYA 3E97A 1FOYA 2DMQA 4IF4A 2IGKA 2A69F 3P5JA 2PMHA 3KYDB 2V9PA 4XLCA 1SFKA 4F55A 2IEKA 5BPIA 2KRHA 4M3BA 3WODF 4HDUA 1S9HA 3GTOJ 1BR4A 1ETOA 2E1CA 2BVMA 3SDGA 1I6XA 2QUFA 3WE3A 5TJJA 3CLOA 2KT0A 2Y69H 4N9IA 2HOAA 3ZQHA 2K9LA 1NHAA 2DMUA 4CYDA 3OYFA 3EPZA 3CP2A 2V9VA 1LEBA 4P5OA 3OYIA 3CMAI 1USTA 3LFUA 3BR3A 4RB1A 1DPUA 5JLWA 4PJMA 2V26A 2QQ9A 2UXNA 3K1PA 3C18A 5EZHA 2B9SA 4ZC3A 1IF1A 4J00A 2DFHA 2DN0A 3BLYA 3HZJA 4PJ0C 4A3IJ 4C2MJ 3ZMSA 2GOXB 3OOUA 1LFBA 3HOSA 5F6FA 3KP5A 4DNCA 1BL0A 2OAZA 1KU3A 1EH7A 3MWMA 2QGUA 4G6QA 3M8JA 4B4CA 3MQ0A 1UHWA 3QPHA 1D5YA 4EM2A 4ESBA 4A6DA 4BXUA 4UUTA 1XB4A 3TO6A 4IHWA 2EH3A 4XN0A 1DUXC 2HNHA 2L01A 5ICGA 4RM3A 1IO2A 3CCMI 1IRXA 1FIAA 1H9TA 4MO7A 4RBOA 1RZ4A 1D1AA 2KMUA 1L3LA 1LPQA 5LD2C 1OR7A 2JN6A 5CVUA 2JRTA 2YPRA 1Z67A 4ZTFA 2XGEA 1QA6A 2DOFA 3MKYB 4RLQA 2CWEA 1FOWA 3PO2J 1ZG3A 2FF4A 2JK3A 3FKIJ 4OU0A 2D1VA 4C3IJ 5J1YA 3WTTC 3GBGA 5HDGA 1VQ9I 1K4SA 1Y6IA 2M34A 5BNGA 4E7KA 4BHCA 2HVRA 2P7CB 3DTKA 2HVQA 2ZXWH 5F0HA 1QZZA 2VE8A 4B43A 4QLCU 1SC7A 3RKQA 5JVTA 5C4JJ 2FOWA 1JHFA 1MW7A 1Y0UA 2L9RA 5EZGA 3ZQQA 4BU2A 1MMAA 2WV0A 2XAJA 5KAIC 3K4NA 4BEHA 2M87A 1FSEA 2V1XA 3GF2A 3OYAA 2EWNA 3NEUA 2EIKH 4Y4RA 4YRVA 1DU0A 3F3XA 4RGSA 4YIRX 3TEDA 4ZYGA 4HDVA 4UNOA 3OYDA 4ENJA 1PUEE 4RGRA 1P92A 2XKOA 4BKXA 5LFAA 3HGGA 4XL9A 2ACJA 2E2HJ 2HKXA 3HG9A 4HZFA 1ERDA 3L2WA 3K1NA 1WJEA 3ABMH 3L2QA 5HNFA 1TWCJ 2CU7A 1DU6A 3I4MJ 2HEOA 2FXAA 4LGWA 4HAMA 2PJPA 1JKQC 3B73A 2X4HA 3HRSA 3F9KA 2Y0SN 4AM3A 3ERED 1T56A 2LH9A 1VI0A 3ZN1A 1FTZA 5LBQA 1OCPA 2HYFA 4I98B 1T2KA 2XV4S 1EF4A 3AL0B 4YELA 4MFEA 4BAYA 3VODA 2O0YA 3ESWB 4BJ5C 4I01A 3ZQLA 2EZKA 3ASNH 1K78B 2HXOA 4KMFA 3FMRA 1O7LA 4S05A 5LHHA 1ZLKA 4AYBA 1B8IA 4WXCA 4C2UA 2FEZA 3COAC 3TOAA 2OV7A 4IVNA 1BM9A 5CVRA 1BI0A 3BCBA 2FX0A 3BQZA 3UNGC 1D8KA 2MD5A 4IHXA 2VL8A 3M07A 1U0JA 1LDDA 2KZVA 1ETWA 2Z2SB 3VB2A 1I1SA 3H9QA 1BR1A 3IH2A 2WTEA 2QLZA 3HPHA 3C2HA 4MEYF 2KIQA 3HOTA 2X1EA 3IL2A 3K7AJ 4E7JA 4XMYA 1UJ8A 4A2UA 3OYLA 2BGCA 2E1MB 1Z21A 4CO8A 2K9SA 1LVKA 4LB5A 3EUAA 4ZDOA 1CF7A 2RNJA 2P81A 3HRMA 2LFBA 3B6CA 3HGYA 1JT0A 3FXLA 3A01A 4GCVA 3MZ8A 3RJPA 1DGRM 4XBFA 3WG9A 4Y13A 5BS6A 5FO5A 2ZBKA 3P7NA 3VSKA 1GXQA 4JX4A 2IPQX 2MC4A 2Z1DA 3S93A 1P4XA 1APLC 2F4OB 3CP8A 3P9KA 3I3LA 2X6YA 2STTA 4DIQA 2ETHA 4FE4A 4XLEA 4ZJZA 2FRHA 4WK8F 2XF5A 3GTJJ 3JAMK 4M6VA 4XKCA 3GUDA 4NDLA 4L9NA 2CFOA 3SFZA 3RYRA 3L09A 5TGTA 2M4KA 2W85A 1UG2A 2OF7A 3E5XA 4UV8A 5J1RA 2H8WA 2TDXA 2GLOA 4WXDA 2DA2A 4Z6YA 2G7UA 3VYRB 1RIOH 3GWZA 1YG2A 3LWFA 1X19A 1WCMJ 2VJ4A 4HYEA 5D4RA 3J7AY 2R7XA 4HQMA 2CV1A 4JBAA 1D5VA 3QODA 4CZZA 2L0KA 3FK6A 2V4JC 2LK2A 3BC8A 4UXNA 2QEXI 1IXSB 1KGSA 3OIOA 1F4KA 1IN8A 4XNFA 3H5NA 4MTEA 1MJ9A 2QSHX 1IZ1A 3T5XA 3S14J 5FROA 2VC0A 1HXDA 3RKXA 2DFFA 3GVAA 3K69A 3OYNA 2R5ZB 3TL4X 3IRRA 2VASA 2YUSA 3QPSA 2ADUA 1P2FA 3WTZA 3VFZA 2XF7A 3JCUC 2YX4A 5HS9A 5FRNA 5E1XA 5DCMA 1D1CA 3MZHA 2DQRA 3NRVA 2Y75A 2A3SA 1YS6A 5HLTA 3D5RC 2WADA 4XN3A 5J4VA 4D7MA 3H9GA 2KISA 2KPMA 4A3KJ 2LOOA 3BJ6A 4IOAF 1J9IA 2G7HA 4OAYA 2Y9ZA 1RRJA 1C0WA 4Q5SF 4F93B 5CVIA 1S7EA 2HPMA 2E2JJ 3FXKA 1Z6RA 5IOYA 1FWZA 2B7EA 2JTVA 3U1DA 3V8KA 3H36A 4YIIA 3VYTB 3O6BB 3AG1H 5DUKA 3BTJA 4HBLA 1OCCH 2DPDA 4ZYEA 3CC2I 5CVJA 4GGGA 3DFGA 4P1WA 4YFXF 4MQ9F 3A0HC 3SDBA 3MN2A 4A3BJ 1HOMA 4XOTA 2F4MB 4RMNA 3RIRA 2MLKA 2OC6A 1SAUA 1HA8A 4BL0B 4NC7A 1A5JA 3OR2C 3SEQA 1ZQ3P 3GTKJ 1T0FA 5K5RA 2DA3A 1LQ1A 4DOZA 5E3MA 1UB9A 3AAFA 1G3SA 2NS7A 1V3FA 3I58A 3RTRA 4DW6A 5IY5H 2XPWA 2XIGA 4JX6A 3GW2A 2Y2ZA 4RB3C 6PAXA 3BG9A 4KMUX 1VQ6I 4QSHA 4BACA 3P9IA 3TDZC 3RI4A 2A6TA 3MMYB 4KITB 1JJ6C 1DDNA 4CH7A 3CJQB 1GUUA 3FZVA 4RAYA 1MKMA 1X58A 5JI6A 1TQPA 1G3YA 4PGGA 4BYYA 1B8IB 5D5VB 2K4JA 4Y7NJ 3BQYA 3HBLA 3AKZA 3DKXA 3KIOA 3CJNA 2AXLA 3V42A 3H35A 4PZJA 1J09A 2OA4A 2LYCA 3A0BC 3HM5A 2NVTJ 4G9YA 4P96A 5GADJ 3J80K 2STWA 3CTAA 1S8NA 2JVHA 3JAMZ 3F8FA 3KP6A 4A5MA 1E3PA 3CF5F 2KIMA 2NNNA 2QSGX 1B4AA 3OWTA 5D5WB 4CCOA 1Z3XA 1B72A 1H9GA 2VQHA 3A1YA 5L3CA 1AOYA 4NQWA 1LB2A 1V5FA 1DQUA 4E7HA 3T1BA 4HLXA 4ZYDA 3JRCA 2VT2A 1I5ZA 2DA5A 1CF7B 1JHHA 2PQ8A 3NARA 1KONA 3LSKA 3QP6A 2KFDA 2VPLA 1J7KA 4IHTA 3W6JB 4IQ4A 4DQ2A 1ZELA 2YX7A 3SZPA 2XAQA 3PIOF 5B1BH 2GAUA 1HQCA 4EM1A 2VODA 1WI3A 2VJJA 1ZARA 2Y0MA 3GTQJ 2CS3A 1Y56A 4HW0A 2EK5A 3FKJA 3U9GA 1BOAA 1OR7C 3BTLA 1WJBA 3OOPA 3PNTA 2UV1A 1DP3A 4W1UA 4XKBA 2ELKA 1ETQA 1WKMA 4L9VA 4LJZF 4HG2A 2JQ7A 2HKOA 3F8NA 2E1NA 1S72I 2VXDA 1X4PA 2M1BA 3DLLF 3KP2A 4LK0F 3FM5A 3S15J 4CHUA 3HOYJ 3ZPLA 2VQGA 3EETA 5E20A 1TLHB 2RAEA 1LDJA 2GBYA 2XKPA 3GEZA 4K2EA 3CUQB 3E5UA 3CO7C 2Y30A 3MKLA 2DT7B 3K2AA 3W2WA 2CRGA 1VF9A 3S2HJ 1Q1VA 3G4SI 5ED4A 4HX4A 3H3UA 2R7TA 2HOEA 1OCTC 2K5CA 2M8EA 2LF8A 2DYRH 3M8EA 1R6RA 3GFJA 2R7WA 2OTLI 3CC4I 2FBKA 3PUBA 1JUPA 2KKOA 1Z0XA 4HX7A 1GT0C 5DCMB 3QWLA 1GDTA 2MA3A 2O7OA 3CUOA 2MBFA 3DCFA 4ESFA 3UR3C 2HFHA 5EYRA 3JRHA 4EEFG 4LFUA 3PQKA 1XS9A 1K6YA 3HSFA 5H6QA 5J6XA 3HRUA 1HC8A 4B8XA 4HSTA 4I76A 1QU3A 4XORA 4KISA 4A6EA 4E7SA 4PSXA 1H89C 2IJLA 1U6GA 1WPKA 2DOAA 4OOIA 3WU0A 4IRGA 4M3DA 3I4NJ 2FE3A 1EA3A 3KX2A 4P9FA 4BH9A 3KP4A 2X6OA 1JKPC 1P6RA 1YW8A 3HHGA 2BXZA 4B09A 2HQ5A 1WQ2A 2EA2A 3IH3A 1MDMA 2VT3A 3WHBA 1V54H 4M9XA 5F0CA 5M3FJ 1R49A 4MLOA 1D8JA 3BG3A 3ZMZA 5IP6A 2HDCA 3FXMA 4HV5A 3GO5A 4F7ZA 1FMWA 1JGSA 4W97A 4CZCA 1BW6A 5HOOA 2XGCA 4PCQA 2DAOA 1NH3A 3C1DA 3G71I 3CMEI 1TQIA 1YLFA 3LNQA 2XUBA 3TW6A 4ZH4F 4UUSA 1YITI 4J01A 4N4NB 1QGPA 3F8MA 2R7UA 3JW4A 4I2OA 2CH0A 3WE2A 2QQAA 3OSGA 1VQ8I 4RB0A 3R61A 2R93J 5GTHC 4EJVA 5FLXK 5D4SA 4QWQA 4MGRA 5EG0A 4QIWN 5EEAA 4BUPA 1M1EB 2HI3A 3C3WA 3MAJA 1NK3P 2DK8A 5CJ9A 1ETXA 4BHBA 5FGMA 2OZUA 5DEQA 3ZQGA 2CUFA 3LMMA 2LR8A 1FP2A 2PG4A 3VDXA 2IA1A 3BTCA 4BBRJ 1YX3A 4ETSA 4ANJA 4G12A 2BY2A 3X2QH 1NG7A 4JP0A 4NB5A 1Z91A 4NUBA 5ICEA 2CQ7A 2GM4A 3HIFA 2BY0A 3M4OJ 3RKWA 1YW9A 3GFLA 4MHGA 3M1CA 1RC9A 4D9JA 1QQIA 3P9CA 1P4WA 3LSGA 1A35A 2LDUA 5H6RA 2R7RA 1X1AA 3JRGA 2KRCA 4D5CA 1G3TA 1LKXA 3OMYA 3GYHX 3ISPA 4CA0A 2EFWA 1MMSA 4B3AA 4E70A 5M5WJ 1X3ZB 4HOBA 4IL6C 5BQTA 1T6SA 2CQQA 3OL4A 1PP8F 2Z16A 5DUIA 5FD5A 2PX9A 2HGCA 4DYCA 3CCEI 3MCZA 2DK5A 2H27A 3AG3H 1UELB 2WAFA 3G6EI 1AWCA 4YEJA 3DKYA 2H94A 3ZN0A 1Z6TA 1D0ZA 3LSJA 5FLVA 3ZRGA 3IWZA 3O3KA 5AONA 1TT5B 4F52A 2QYOA 2I5UA 1G6NA 2PBIA 4O5VA 4BS9A 5JLXA 2HDWA 5FD6A 2VBYA 4E7LA 1HDDC 1V5GA 1FPQA 2WB1A 2QWWA 2VBXA 1I6HJ 2M2EA 3GLXA 2ME0A 3HJEA 2AS5F 3QOPA 5FFZA 3BP8A 2XF6A 3LOCA 1MBGA 5EEHA 4L18B 4DBQA 2OPTA 4XICA 1WJ5A 3HOUJ 2CSOA 2FBIA 5D8LB 3RZDJ 4U0WA 3H0DA 4IOCF 1XGMA 1ZR4A 2V6EA 1R1TA 1XMAA 4G8XA 4B3XA 5LGUA 3HOZJ 2L7FP 2EFPA 4GXOA 3EUKL 4RM2A 4XLFA 4L5IA 4MEXF 2EBIA 1J59A 4IQJA 3FXJA 3Q5FA 1CGPA 2DDBA 2FUG2 4GDFA 2E35A 1T0FC 2LTPA 1KQ9A 3BG5A 1LUJB 5LGTA 2QQ8A 2XSDC 2UUZA 5B3SH 1AHDP 3SZGA 2X48A 2MH9A 5IT3A 4WWCA 1HSJA 1RUOA 2VLAA 2LSOA 4EGZA 2K9MA 3QOEA 2ZNYA 1OCRH 5D5XB 1J0RA 3CCYA 4RS8A 3O8HA 2L4AA 4AWXB 1WGXA 4DBRA 3L7WA 1POGA 4CYCA 4KIBA 4OIQF 3HSEA 5KHDA 1W7PD 4M3FA 5FLXZ 3KEQA 3G1OA 1SFXA 1OKRA 4G6TB 1XTAA 2RKHA 2NNYA 3OYEA 2IRFG 2LKXA 3U21A 4DGWB 2BHYA 2WAQA 3Q0UA 2Q8KA 1ZG5A 1FP1D 2E71A 3MD2A 2ZXHA 3BT9A 3KE2A 4EGYA 2DW4A 1G8XA 1HW1A 4ZZLA 3TKYA 4CCJA 3ABTA 3CCLI 2FMLA 1R5GA 3KYLA 2QBYA 5FKMA 3I55I 4PJLA 2W57A 4FCYA 1KU7A 3I54A 2XAGA 1KYZA 3WTUC 1JT6A 2P8TA 1NG6A 4A0YA 1MSEC 3GX4X 2G9WA 3ZOBA 4L5EA 2GQQA 3PSIA 2IS1A 3RPUD 1WI9A 1JGGA 4V2FA 4IRHA 3PM1A 2L54A 2QF7A 2FOKA 2FBHA 4EVIA 4M74A 5H2FC 3DTEA 2VKHA 2HOTA 3NWSA 4BDYA 3QYBA 1TW3A 2VUMJ 3E6BA 2LD5A 2V6CA 1WJCA 3E6MA 1O3TA 3LSTA 2JZYA 4Q47A 1PJRA 3M8FA 3ZXSA 2FMYA 4H0EA 5DCFA 1OYWA 1V4RA 3VYUB 3RYPA 1MBJA 3AG2H 2BZTA 4GO1A 1QPIA 2O9LA 2GXGA 3BY6A 3DU6A 5L3DA 5HDNA 4A3MJ 4PFPA 1W0UA 2LC2A 1LFPA 2Z5UA 5DM6F 3CO6C 1IRZA 3K70C 5DYMA 1VQPI 2IVMA 2A5WA 2H6BA 2LP0A 2XRNA 2K9QA 3DV8A 1R58A 5GPCA 4EJTA 4EM0B 4FX0A 3JRDA 3HHHA 5J1UA 2LLKA 4XKWA 1XN7A 3VEPA 1XGOA 1I3AA 4YFNF 1GVJA 4UB6C 3K4MA 4PJJA 1X1BA 3CCJI 1T8IA 3K6GA 1Z7LA 2NVXJ 2HTSA 1MH3A 1BR2A 2RGVA 1ETVA 3FXUA 2XGDA 3BR1A 2ZNZA 5FB2A 4RAFA 1SANA 2M7AA 2M30A 3S16J 1QRYA 1YJWI 3CF2A 5M5XJ 2IT0A 3DBHB 2VJIA 2PJRA 2PMZN 4BY1J 3M7GA 3ZMTA 4Y3OA 2IBDA 1BJZA 1HKTA 3TP3A 4XK4A 2VKVA 2M5WA 1REPC 3TP0A 5K7HA 4L5JA 4AIKA 2BBYA 2LREA 4ESJA 2L2OA 1YI2I 5CQGA 1B1BA 1G4DA 1TC3C 1F36A 2CUJA 2ECBA 3CDHA 5FKNA 1YFHA 1W36C 1IN4A 1IN7A 2MD0A 1XMKA 4DZPA 1USSA 4A0ZA 1XGNA 2HU9A 1YO5C 3QQAA 2L02A 3JR9A 4A12A 2PMUA 3KZYA 2K86A 3OYMA 5TISC 1FOXA 4II3A 4GRIA 2BVLA 4B48A 4XM3A 1UFMA 1Z05A 1ZN2A 1Z1DA
chains in the Genus database with same CATH topology
3CJQB 2XSJC 3MKWB 4PSWA 4XONA 3OIQA 4XR6A 4II2A 4X0GA 3AKZA 3DKXA 3V42A 3H35A 1J09A 3VSLA 3DWLE 2LYCA 4XLAA 4XQFA 3K4KA 2JVHA 2X1DA 3DEEA 2XAUA 1AA7A 3OWTA 4CCOA 3A4CA 3LSIA 1Z3XA 2VQHA 3A1YA 3IP4B 3SYTA 3PJRA 2VKDA 4B48A 1WJFA 4CCLA 1D0YA 1V5FA 1DQUA 4EATA 4E7HA 2W82A 3G2BA 2O5RA 1LDKB 4FASD 4KJZA 1E0EA 3MKZA 1KONA 3IUOA 3LSKA 5KCMA 2VPLA 3QYFA 3TBIA 3K4CA 1QHGA 3S8PA 3HL2A 4IQ4A 1ZELA 2X6WA 3VYSB 1Z3YA 2PMZA 2CMPA 3FBNB 4BJTA 2VJJA 1T95A 1Y56A 2CS3A 3FKJA 1OR7C 1WJBA 3PNTA 1V5EA 2UV1A 3ZCOA 1DP3A 2CUZA 4QPQA 4XKBA 2X85A 2IS6A 3K4LA 4HG2A 1QHHD 2VXDA 1X4PA 5CQEA 2LBFB 2F5VA 1MMNA 3DU5A 1WJDA 2VQGA 2M0MA 1TZLA 1YX5A 2RREA 2CW7A 2JA2A 4D1QA 3L2RA 2GOMA 4FETA 1WFXA 3DTIA 2XDVA 4E7IA 3HPGA 4HEA2 2OUMA 3BG6A 3VWBA 2DT7B 3W2WA 4OAZA 2KLOA 4BEHB 2R7TA 2W1OA 4PJNA 3OYJA 2ZFUA 2K5CA 2CV2A 2KDOA 1P9QC 2X6XA 4BDZA 1R6RA 2WAEA 3OS2A 3LSMA 2R7WA 2QKLB 3PUBA 3HKZA 4XOPA 5CKTA 4KT6A 3DPLC 4BE2A 3UR3C 2M4GA 3CESA 3RQ4A 1X4OA 1YE9A 2DCEA 1K6YA 3OS1A 4HSTA 2IGKA 2HQAA 1QU3A 4N4OB 3IAS2 4XLCA 1D0XA 4XORA 1SFKA 4F55A 4BQNA 4KISA 4E7SA 4PSXA 2DOAA 2KRHA 1S9HA 1BR4A 4BQOA 2BVMA 1EA3A 3KX2A 3HUGB 3ZGKA 4F91B 2K9LA 2M3AA 2HPIA 4B44A 4BE0A 3OYFA 3EPZA 3CP2A 4XLHA 4P5OA 2R7OA 3BG7A 4MLOA 3OYIA 1FMVA 3K70D 3LFUA 3LSHA 1TT0A 4CUGA 1FMWA 4PJMA 2V26A 4AVZA 4CZCA 5HOOA 4H4KC 4IKFA 1VZ0A 4ZC3A 4BQQA 4J00A 3BLYA 2X1CA 2M7BA 1OLTA 2GOXB 3FHNA 3OOUA 3QYEA 4J01A 3E1SA 4N4NB 2AQEA 2R7UA 3HOSA 2CH0A 4HSRA 3OS0A 5KNLA 4ITVA 3M8JA 2JUGA 4BUPA 2R7QA 3W3CA 2KQRA 5CPRB 4U87A 2LY2A 1PYVA 4XN0A 2HNHA 4RM3A 4DJAA 3LMMA 4B47A 1IRXA 3VDXA 4C9YA 1D1AA 2KMUA 5HNHA 1W36D 5LD2C 1YX3A 4ANJA 4ZTFA 1NG7A 3MKYB 2LBFA 4RLQA 4NUBA 3AFHA 2L5QA 4OWRB 1MNEA 4QPOA 3PNYA 2MABA 3GBGA 4NNJA 2IXSA 1Y6IA 3DQVC 3N05A 4E7KA 3I9V2 2HVRA 3DTKA 3M1CA 4ZYAA 4D9JA 2HVQA 4HRIA 3LSGA 4B43A 2CW8A 2WA0A 2R7RA 1X1AA 1N75A 2KRCA 4AU7A 3SEZA 1MW7A 1LKXA 3OMYA 4CA0A 1X1DA 3ZQQA 1WJAA 4BU2A 1MMAA 4E6KG 3K4NA 3OYBA 4BEHA 2DXIA 4JOMA 3OYAA 3KEYA 3OL4A 2Z16A 4Y4RA 4YRVA 4CCKA 4CSWA 2VJ5A 3OYDA 3FDYA 2L9SA 5LFAA 2LY1A 4XL9A 1UELB 2WAFA 2F6CA 3K10A 4ZTJA 3H5AA 3HG9A 4YEJA 4E7ZA 2BW3A 2BOLA 3OYGA 4C2TA 3A2KA 3DKYA 1ERDA 3L2WA 3HXLA 1D0ZA 1WJEA 4C30A 3L2QA 5HVQC 5HNFA 3ZRGA 2IS2A 2K3PA 3HC7A 3K4BA 4F52A 4HPQA 2NOJB 2HZDA 2UWMA 4BS9A 1JI8A 1N78A 2HDWA 3F9KA 4ZDLA 4E7LA 3AL0C 1V5GA 2WB1A 2LH9A 3S3MA 1BOBA 3LL7A 2X51A 4Y33A 3DLAA 4PFOA 3AL0B 3IAM2 4YELA 3OIPA 2XF6A 4PUSA 1D1BA 4RLFA 4DBQA 4BJ5C 4CCMA 1WJ5A 2RQQA 2E5ZA 1MMDA 3H0DA 2DT6A 2V6EA 4B3XA 4AYBA 2W7NA 4U7BA 4C2UA 2MYSA 2OV7A 3EUKL 3ONQA 4RM2A 4XLFA 2VQCA 3BCBA 3K4JA 4JQFA 4F3QA 2PJRB 3UNGC 4LIUA 4IQJA 2VL8A 2FUG2 1U0JA 2Z2SB 2KZVA 1T0FC 2JVGA 1BR1A 2V9KA 3H9QA 4R79A 3HPHA 3C2HA 2I8DA 3D5LA 1X1CA 3HOTA 2UUZA 2X1EA 2E1MC 3RCOA 1MNDA 3H9JA 3SZGA 3PNVA 4E7JA 2VLAA 4XMYA 4LITA 2E5NA 2K9MA 3QOEA 3OYLA 2E1MB 1UG0A 2IGNA 1Z21A 2IGOA 4HNUA 1LVKA 3EUAA 4BXFA 4DBRA 4ZDOA 5KHDA 1DGRM 2HVSA 4G6TB 3VSKA 2VIXA 3OYEA 2MC4A 2Z1DA 3S93A 4HNTA 3U21A 2VB6A 4DGWB 3CP8A 3S32A 3NWTA 3I3LA 2X6YA 3DPUA 2KL4A 4DIQA 2WAQA 4XLEA 4ZJZA 2XF5A 1G59A 3MD2A 2ZXHA 2L7KA 4IZZA 2CV0A 3L2VA 4XKCA 3H5RA 3DPTA 4BJ6C 2CFOA 1G8XA 2M4KA 5TGTA 4BE1A 2JSPA 4CCJA 2E60A 2F4IA 3D5SC 3KYLA 2Y0SA 4PJLA 5FRMA 2Q2EB 2ZXIA 3VYRB 2KP6A 2V7FA 3J7AY 1X19A 2VJ4A 1NG6A 2R7XA 2CV1A 4F92B 3QODA 2DJIA 2V4JC 2V1NA 3BC8A 4NQWB 3OYCA 3CZ6A 3PSIA 2IS1A 3RPUD 2IS4A 4XNFA 3L2UA 3H5NA 2KHMA 2RNGA 3DTEA 2VKHA 5FROA 3NWSA 4BDYA 3QYBA 1N77A 3OYNA 1WJCA 4CCNA 3OR1C 1PJRA 3TL4X 2VASA 3ZXSA 4NC8A 2XF7A 2LG4A 2VQLA 3VYUB 5FRNA 4IX7A 1D1CA 3S3OA 3E0JB 5HLTA 2XC7A 3D5RC 3DU6A 4XKVA 2WADA 4PFPA 4XN3A 2LC2A 1LFPA 3PSFA 3K70C 2IGMA 2A5WA 2KPMA 3H9GA 3BCAA 4E4HA 2LOOA 3FBIB 4OAYA 3C2GA 4XKWA 2AQFA 4F93B 2HPMA 3K4MA 3EUHC 1X1BA 4PJJA 2R7VA 3K6GA 1Z7LA 1BR2A 3OYKA 1MMGA 3VYTB 3ZR8X 2WY8Q 2QKMB 2WBMA 2M7AA 2W4SA 4PK4A 3W2AA 4P1WA 3CF2A 4LIVA 3OL3A 3SDBA 2VJIA 2PJRA 2MFZA 2R4GA 4XOTA 4Y3OA 4RMNA 3PFYA 2BW3B 2OC6A 1SAUA 4BGDA 1HA8A 4BL0B 1UAAA 4NC7A 2WY7Q 2LRDA 3OR2C 3SEQA 4DOZA 2R7SA 3CMMA 2LREA 3W2VA 2W00A 2Q1ZB 2L2OA 3CJRB 5CQGA 2ELJA 2CUJA 3OY9A 1W36C 1DGWY 3RTRA 3S3NA 3TMOA 2MD0A 1GLNA 2VXZA 3OYHA 4ZDPA 2HU9A 3RSNA 5JHFA 3PL8A 4BACA 2P0WA 3OYMA 4II3A 2ZSIB 2BVLA 2ZSHB 4GRIA 2A6TA 2L9NA 4LG3A 3MMYB 4XM3A 4KITB 4CH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR7 C; 
#chains in the Genus database with same CATH topology
 1QZE A;  4A3C J;  4Q4Z F;  3BJO A;  3ZP5 A;  1HLV A;  3K2Z A;  2DOD A;  1ZGW A;  5GP9 A;  4EJU A;  5ICC A;  4RGU A;  4XR6 A;  2IW5 A;  3REO A;  4X0G A;  4A3L J;  5JFR A;  3ELK A;  1LFU P;  3GXO A;  2FQ4 A;  2E19 A;  2PN6 A;  3BR5 A;  4XQF A;  1SMY F;  2DFE A;  5HLH A;  4CGZ A;  2K4B A;  2B0L A;  2ZJR F;  3ROU A;  5JR3 A;  1OPC A;  1IN6 A;  2VI6 A;  1TNT A;  4Z2Y A;  5HLI A;  1VFC A;  4N9H A;  3ASO H;  1RR7 A;  2P5V A;  1DP7 P;  3KZI C;  3LSI A;  5E17 F;  1SVM A;  3HTS B;  3SYT A;  1WSU A;  2VKD A;  1WJF A;  3ABU A;  1B59 A;  3Q0W A;  5FJ8 J;  2W82 A;  2ISY A;  3G2B A;  4D7N A;  1Z7U A;  1ULY A;  4NC6 A;  3CQZ J;  3KPH A;  4KJZ A;  1R71 A;  1E0E A;  3MKZ A;  1XD7 A;  1ETK A;  3LAJ A;  4KA4 A;  3S8P A;  5HOD A;  4M3G A;  3ECO A;  1ZAO A;  3VYS B;  1Z3Y A;  1VQK I;  5ERI A;  3GTG J;  4BJT A;  1IDY A;  3BR6 A;  5ILU A;  3LFK A;  2EQR A;  2A68 F;  1R5I D;  4OMZ A;  3ZCO A;  5EGO A;  1V55 H;  1YTY A;  4QPQ A;  1GHC A;  5DS9 A;  1QHH D;  2DI3 A;  3WU2 C;  2QBY B;  1MMN A;  1YHQ I;  1PUF A;  1KU2 A;  1R1U A;  1IXC A;  2LY9 A;  2M0M A;  1FBQ A;  4FE7 A;  1YIO A;  1ENH A;  2CW7 A;  5LEK A;  3S1N J;  3RQI A;  2DMN A;  1W1W E;  2R7Z J;  2EV5 A;  2XAH A;  2VE9 A;  1ETY A;  1WFX A;  2W24 A;  4MQV A;  2DU9 A;  4E7I A;  5BOX A;  2PLY A;  1MGT A;  4HEA 2;  3WGG A;  2OUM A;  1UMQ A;  1FYK A;  3JSO A;  1BC7 C;  1MJB A;  2MLG A;  1S7A A;  1UHS A;  3H3V K;  3IH4 A;  4BEH B;  1W7P A;  1I27 A;  2VC1 A;  3DBR B;  1RPW A;  4BDZ A;  2HZT A;  2X6X A;  3B6A A;  2WAE A;  2F2E A;  1IC8 A;  4A3G J;  4R8H A;  5CKT A;  3HKZ A;  4KT6 A;  2VOP A;  3BDD A;  1YRN A;  2E7X A;  2ZXJ A;  2BEO A;  1OCZ H;  3S1M J;  3KEO A;  5A2Q K;  1XG1 A;  3CES A;  3IRQ A;  4AVP A;  5L3B A;  1QZY A;  4OIR F;  5IT9 K;  2W25 A;  3V7S A;  2V79 A;  3BZK A;  2KJB A;  5J8F A;  2HR3 A;  3OS1 A;  3S1R J;  3IV5 A;  3S17 J;  3IAS 2;  1D0X A;  3R4K A;  1UZC A;  1XC5 A;  4BQN A;  5AIP A;  4LG0 A;  2H09 A;  1MBF A;  5JVG F;  1XCB A;  1Z77 A;  3W6V A;  3PO3 J;  4BQO A;  1QO0 D;  1NK2 P;  1F1Z A;  5DD8 A;  3ZGK A;  3GFI A;  3J7A O;  4BE0 A;  3N97 A;  2HPI A;  1ODD A;  2K3F A;  4UY8 I;  2NOG A;  3EYI A;  1R1V A;  2HQR A;  4BHP A;  1TT0 A;  3RDI A;  2DFI A;  2BHZ A;  3A03 A;  1R36 A;  4FQG A;  4H4K C;  3A02 A;  4FX4 A;  4IKF A;  1VZ0 A;  1S5L C;  2OU2 A;  2HQN A;  3ZMU A;  2M7B A;  2O03 A;  2BY3 A;  1OLT A;  3FHN A;  3QYE A;  2DJN A;  3HTU A;  1MBK A;  1ON1 A;  3I0T A;  2CW0 F;  2AQE A;  4XID A;  1L0O C;  1SEU A;  2QEN A;  2UXX A;  2XB5 A;  4KUM A;  3GZN B;  5KNL A;  3J81 K;  1QNT A;  5C4X J;  3WTS C;  1Y8Q B;  2GXB A;  4ITV A;  3E6C C;  2QZ8 A;  4JK1 X;  2HXI A;  1YOV B;  2YU9 J;  2R7Q A;  3W3C A;  2KQR A;  5CPR B;  4XRS G;  1FEX A;  2EZL A;  4KN4 X;  1TWH J;  4U87 A;  2LY2 A;  5E3L A;  1PYV A;  2GZW A;  3E7L A;  5M3M J;  4UHT A;  3M9A A;  3A01 B;  4B47 A;  4AYB N;  1HW2 A;  5K7F A;  3I53 A;  1MZB A;  2LF7 A;  1BW5 A;  1KA8 A;  3R0J A;  2NAZ A;  4EV0 A;  1J2X A;  3OSF A;  4ZYH A;  4J19 A;  2LBF A;  1MIJ A;  4ENM A;  4WF2 A;  2K9N A;  2L5Q A;  4OWR B;  3ZMD A;  1LEA A;  1MNE A;  1IUF A;  4QPO A;  3TW7 A;  3PNY A;  1FBS A;  2MAB A;  1K4T A;  1MBH A;  3N05 A;  3DQV C;  2MGQ A;  3E6D A;  3I9V 2;  4D5F A;  1Y8R B;  1U5T A;  2IP2 A;  4ZYA A;  4HRI A;  2WA0 A;  1ZRF A;  2AHQ A;  3CCU I;  3SEZ A;  5K5Q A;  1PVE A;  1WH7 A;  1XCV A;  3DXJ F;  3DP7 A;  3ULQ B;  2OJE D;  4E6K G;  1RES A;  5EEG A;  4G94 A;  3OYB A;  2DXI A;  3KZZ A;  1VQM I;  2JA5 J;  3F72 A;  4U7D A;  4CCK A;  4CSW A;  4OMY A;  1BA5 A;  2VJ5 A;  2NVU B;  3FX3 A;  2L9S A;  4UVC A;  1WH5 A;  1FJL A;  2F6C A;  5CYV A;  4ZTJ A;  3H5A A;  2ID3 A;  2FNA A;  1XDS A;  3DF8 A;  4C2T A;  1W0T A;  1LJ9 A;  3HXL A;  5EGO B;  1W5S A;  1STZ A;  5HVQ C;  3BRO A;  3CCV I;  1TBX A;  3HC7 A;  3K4B A;  5J47 A;  1E2X A;  5LLQ A;  2NOJ B;  2HZD A;  4L9J A;  4P55 A;  4FTH A;  4RB2 C;  1HDP A;  2UWM A;  4KIG A;  1A36 A;  2K27 A;  3TDU C;  4U88 A;  4G7O F;  3I71 A;  4OIP F;  4XLN F;  3S3M A;  1BOB A;  1TNS A;  2IAI A;  4YG2 F;  1R4M B;  4Y33 A;  3JRE A;  2XAF A;  1IGN A;  3SXY A;  4IHS A;  3IAM 2;  1ONV A;  4IHV A;  3OIP A;  1TWF J;  4PUS A;  3GME A;  1BIB A;  4RLF A;  2IA2 A;  4IJA A;  3I64 A;  2OQR A;  4TV7 A;  1UHM A;  3CJT B;  2XGX A;  1TWA J;  1IRG A;  2DT6 A;  5FFX A;  1TQM A;  4OIO F;  3H1C A;  2ELH A;  2VPR A;  3F8B A;  1QBJ A;  5AIQ A;  5F64 A;  3B02 A;  3WGH A;  5J4Y A;  2VQC A;  2GIZ A;  1SD4 A;  3H3Z A;  2VBW A;  4F3Q A;  1IV6 A;  5L3F A;  1YRN B;  3ERM A;  4X6A J;  2V9K A;  1ZHF A;  2WV1 A;  3CDI A;  1VQL I;  1X1C A;  2AXT C;  4CDG A;  1G2H A;  4WCG A;  2DLL A;  3BOQ A;  1D3Y A;  1MND A;  3BWG A;  3RCO A;  4I09 A;  2DPU A;  3BZ6 A;  4M71 A;  4L9T A;  3J80 Z;  3HYI A;  2E5N A;  1FYL A;  1UG0 A;  4MFD A;  2COB A;  2IGO A;  3GFM A;  4HNU A;  1F5T A;  1AU7 A;  1BI2 A;  1QPM A;  3J81 Z;  2M45 A;  2QCO A;  3JSP A;  1OYY A;  2HVS A;  3JRB A;  1ZRE A;  4LOC A;  4L0Z B;  5D6E A;  1O3S A;  5K1Y A;  2P5L C;  3R0A A;  2DA6 A;  4GYI A;  2VB6 A;  2DOE A;  5GPA A;  9ANT A;  2VN2 A;  2CUE A;  4RGX A;  3NWT A;  3LAP A;  2KL4 A;  4UVA A;  3TGN A;  5DM7 F;  1FC3 A;  2L7K A;  3L9F A;  3L2V A;  3DPT A;  1WHU A;  4BJ6 C;  5E3N A;  4LLN A;  5DTD A;  2DA4 A;  1B9N A;  5LGN A;  2JSP A;  2E60 A;  2F4I A;  3D5S C;  2F5C A;  5HDK A;  2Y0S A;  3F22 A;  1HF0 A;  1IG7 A;  2ZXI A;  1BJA A;  3FHZ A;  2CQK A;  3DEU A;  1HBX G;  1KQ0 A;  4KYW A;  5KK1 A;  2MC3 A;  4F92 B;  1B72 B;  3IWF A;  4NQW B;  1RET A;  4NHJ A;  1XGS A;  5E18 F;  5LRR A;  2H6C A;  1R7J A;  2EIM H;  2IS4 A;  4A93 J;  4KFC A;  3L2U A;  3OV8 A;  2QQB A;  2KHM A;  3T8T A;  2RNG A;  5F04 A;  1EV7 A;  2WWY A;  2G0E A;  4ZZD A;  2NXN B;  4CCN A;  3OR1 C;  1RUN A;  3F0C A;  2LG4 A;  2VQL A;  4MIM A;  1QVU A;  1FZP B;  1ZGA A;  4IX7 A;  3S1Q J;  2P6S A;  1EKE A;  2XRL A;  1IN5 A;  2EIN H;  3O8G A;  3L00 A;  4AUX A;  2ZJQ F;  3EYY A;  3PSF A;  1O4X A;  1U5T B;  4IPA A;  3BTI A;  3BCA A;  4KT5 C;  4E4H A;  4C3J J;  5ILS A;  3MEX A;  3T8R A;  2GWR A;  3FBI B;  3C2G A;  4DZJ A;  1JUM A;  4B1R A;  2R7V A;  3GLL A;  1JXS A;  1T38 A;  3E5Q A;  1K78 A;  2HWV A;  1R9T J;  1X2M A;  2D45 A;  1SD7 A;  2DMT A;  2F5E A;  5DV5 A;  3ZR8 X;  3D1N I;  1FOK A;  1RKW A;  2QKM B;  2WBM A;  5IPA A;  4HF0 A;  2W4S A;  3W2A A;  3KET A;  4LIV A;  3FIS A;  3HUG A;  3OL3 A;  3MVP A;  1JKR C;  3Q9V A;  2R4G A;  3F6O A;  3TO9 A;  2ESH A;  3K1M A;  1MH4 A;  1ZYR F;  2DO7 A;  4IHY A;  5CLS A;  5LEJ A;  1Y1V J;  2LRD A;  4ABZ A;  5IP9 J;  1FIP A;  1JTY A;  3E3V A;  3CJR B;  3LA3 A;  2ELJ A;  1DGW Y;  1S29 A;  2VXZ A;  3OYH A;  1OFC X;  2OD5 A;  2QVO A;  3FF5 A;  2EFO A;  4LB6 B;  1YYV A;  3ML6 A;  4ZDP A;  3PIP F;  2C6Y A;  1PDN C;  1JJ8 C;  3PL8 A;  2P0W A;  2K40 A;  2YR2 A;  4LG3 A;  2ZSH B;  2ZSI B;  3LA7 A;  4MTD A;  2Y31 A;  2O6G E;  5DD4 A;  5BMZ A;  2O3F A;  2XB0 X;  2XSJ C;  3MFK A;  3IKT A;  3M3Y J;  3MKW B;  2KZG A;  4PSW A;  1IXR C;  3SZT A;  1OIS A;  3OIQ A;  2JJ7 A;  1IV8 A;  1O7F A;  4HNV A;  4II2 A;  3N4M A;  3CLQ A;  3V8J A;  4HQE A;  2HDD A;  3VSL A;  1MDM B;  2EA4 A;  2EB7 A;  2HS5 A;  4HF2 A;  2QA4 I;  4BNC A;  2GIV A;  2Q0O A;  1VND A;  3K4K A;  2NS8 A;  2X1D A;  2CG4 A;  2K02 A;  2OBP A;  2OZ6 A;  4IRI A;  1GXP A;  1U8B A;  4M6Y A;  2E2I J;  2XAU A;  2RDP A;  3H0G J;  3KLO A;  4WX9 A;  2A05 A;  1PP7 U;  3A4C A;  2EJR A;  2XAS A;  3IP4 B;  4NBQ A;  4GYG A;  4CCL A;  1D0Y A;  2BE5 F;  1U8R A;  4UUS B;  3WTX C;  1LDK B;  1TP4 A;  4M6X A;  1ORK A;  1DPR A;  2ZME A;  3FWE A;  3G1L A;  2ZJP F;  3IUO A;  4A5N A;  1TW2 A;  1XSD A;  4XRS A;  1QVT A;  3QYF A;  1QHG A;  5EG0 B;  4KIF A;  1SFU A;  1K61 A;  3HL2 A;  5HS8 A;  3BZC A;  2R5Z A;  2B63 J;  2MH2 A;  5GTI C;  1U9N A;  3TO7 A;  4XRM A;  2JA6 J;  2GXA A;  1OMI A;  2O61 A;  1IW7 F;  1KU9 A;  2CMP A;  4FHT A;  3HEF A;  2BV6 A;  1U3E M;  1T95 A;  4DYR A;  1IDZ A;  1GVD A;  4P9U A;  2KDZ A;  1T08 B;  4Y52 J;  1N25 A;  1ZKG A;  3WG7 H;  3K4L A;  1MBE A;  1YIJ I;  5CQE A;  2ESN A;  2F5V A;  3VPR A;  5IYC J;  2N8G A;  1VTN C;  3DU5 A;  1WJD A;  1RNL A;  1U5T C;  2GA1 A;  2F48 A;  4G7Z F;  1YX5 A;  3KYC B;  5ILV A;  2NVQ J;  2JA2 A;  2H1K A;  1XSX A;  3NQO A;  3L2R A;  1U9O A;  4FET A;  3EUH A;  3DTI A;  3JTH A;  4AC0 A;  5GAE J;  4BQA A;  3HPG A;  4UB8 C;  1ZR2 A;  2EV0 A;  5ICF A;  5BPD A;  2A5Y B;  5E79 C;  3Q3S A;  5KAF C;  3C7J A;  2W48 A;  4OAZ A;  3CMY A;  2EZH A;  2KLO A;  2W1O A;  1ZTR A;  2ZFU A;  1SD5 A;  1RI7 A;  2CV2 A;  1P9Q C;  4KDP A;  1XSV A;  1TL8 A;  4V2G A;  3LSM A;  3OS2 A;  2L4M A;  2R7F A;  4XOP A;  2NRA C;  4OIN F;  1VQ5 I;  1E17 A;  2V1U A;  1A6I A;  1I50 J;  3DPL C;  2ICW G;  4BE2 A;  3LQR A;  2OQG A;  3JTG A;  2M9H A;  1X4O A;  2ISZ A;  5EF6 A;  3S2D J;  5LHG A;  1YE9 A;  2DA7 A;  4A3J J;  4XSX F;  4QTR A;  1HW5 A;  2YU3 A;  2JWT A;  4M72 A;  5FKL A;  2HQA A;  2RN7 A;  1T98 A;  4N4O B;  3K0L A;  1LNW A;  3WGI A;  5IOZ A;  5IP7 J;  4ON0 A;  1LE8 A;  5J8C A;  3HUG B;  4F91 B;  4M73 A;  2Z99 A;  2CYY A;  2M3A A;  4B44 A;  4O3M A;  4LD5 A;  2KIF A;  1ZG1 A;  2P5K A;  4XLH A;  3LSR A;  2R7O A;  3BG7 A;  3K70 D;  1FMV A;  3LSH A;  4CUG A;  1AKH A;  3V8L A;  4AID A;  4AVZ A;  3WTW C;  1WWX A;  1XMX A;  2JMW A;  3IHU A;  4Q48 A;  2WC2 A;  4BQQ A;  5F1J A;  3HOV J;  1OQY A;  5H20 A;  3AG4 H;  2X1C A;  1A31 A;  1Z9C A;  3FIW A;  3V7C A;  2DTZ A;  2A6E F;  3E1S A;  2Q2E A;  4HSR A;  2E34 A;  3SHF A;  2WB1 N;  1FSH A;  2FU4 A;  4KN7 X;  3OS0 A;  3CCR I;  1MNM C;  1ZLJ A;  2E36 A;  2JUG A;  3PFI A;  1ITY A;  3EQL F;  5E8I A;  5D8K B;  3HOX J;  2VON A;  4GFB A;  2YS9 A;  4EQQ A;  3QU6 A;  1X3W B;  4CYC B;  2JA8 J;  4DJA A;  4EJO A;  1WVR A;  4C9Y A;  5HNH A;  1W36 D;  4BBS J;  5B1A H;  2MSY A;  1Y0N A;  2VBZ A;  3BJA A;  1U78 A;  3AFH A;  5KVR A;  3ZQC A;  3SJM A;  1O3R A;  2Y48 A;  5IYB J;  2X0L A;  2ZFW A;  3M1E A;  2ZCW A;  4NNJ A;  2IXS A;  2BYV E;  4G7H F;  1W5C C;  2H8R A;  3TOB A;  4XRF A;  1S7O A;  2CW8 A;  3HRT A;  3Q0V A;  2LVS A;  3CUQ A;  1N75 A;  3Q9S A;  2FSW A;  4AU7 A;  2R5Y A;  4HA8 A;  3ZMV A;  3D0S A;  4I0A A;  1LVA A;  1X1D A;  1WJA A;  2ZME B;  2XRO A;  4JOM A;  4CIC A;  1K83 J;  3GZ5 A;  3K9T A;  3KEY A;  3I4P A;  1ZRC A;  3FDY A;  1W4M A;  2K7L A;  5EJC A;  2LY1 A;  4IO9 F;  2RV8 A;  3K10 A;  2DA1 A;  1MJA A;  4PGH A;  4E7Z A;  2BW3 A;  2BOL A;  3OYG A;  1K7A A;  3DEW A;  4L0Y B;  3A2K A;  4PDK A;  2WAQ N;  2LMD A;  3QAH A;  2R3S A;  4C30 A;  2DBB A;  2NS0 A;  2IS2 A;  2K3P A;  4LLL A;  1ZH5 A;  1O57 A;  4HPQ A;  1MD0 A;  1IRF A;  3DKW A;  4HX8 A;  5E8G A;  1JI8 A;  1J75 A;  1N78 A;  1JUS A;  4A69 C;  4ZDL A;  4A3D J;  2CFX A;  3AL0 C;  5GAH J;  5LRS A;  3WTY C;  4R1H A;  1FY7 A;  2Z9O A;  2QM3 A;  2H1L A;  2X51 A;  3LL7 A;  4KIC A;  3JRA A;  1FT9 A;  3DLA A;  4PFO A;  1IUY A;  1FX7 A;  4I0B A;  2KRF A;  1RR8 C;  2JSC A;  1VQ4 I;  1I1G A;  1D1B A;  5HS7 A;  1KYW A;  3T0Y A;  4CCM A;  2CJJ A;  2ZKZ A;  3LSP A;  2RQQ A;  5IYD J;  2TCT A;  4Y15 A;  2E5Z A;  1XDU A;  1ZRD A;  1MMD A;  4Y17 A;  3VOE A;  3W6K B;  1H8A C;  4HF1 A;  2W7N A;  4M3E A;  4U7B A;  2RVC A;  2VKE A;  4IXA A;  5DDG A;  2MYS A;  3ONQ A;  4UVB A;  4C3H J;  5B5E C;  2XPU A;  5F08 A;  5GAG J;  3UKG A;  3K4J A;  4JQF A;  2VOO A;  3RPU A;  3GZ6 A;  3SFI A;  2PJR B;  4LIU A;  1HKS A;  2FNP A;  2MW8 A;  4I7H A;  3QU3 A;  1HCR A;  2JVG A;  2P7V B;  4R79 A;  1JTX A;  2I8D A;  1H0M A;  4A0X A;  2ZC2 A;  3D5L A;  5E1Z B;  2BXY A;  2DQL A;  2NVY J;  1HKQ A;  4JX5 A;  2E1M C;  1R4N B;  3H9J A;  1ZGJ A;  3PNV A;  1RKT A;  5JHU A;  4LIT A;  2NYX A;  4A3F J;  3J7Z I;  2D5V A;  1KQ8 A;  3JRF A;  2EPF A;  1WRJ A;  2IGN A;  3BR2 A;  2XPV A;  4CXF A;  1FNN A;  2P6T A;  4BXF A;  4V19 K;  3FM3 A;  1OCO H;  2P4W A;  3ZQF A;  1Q1H A;  2JPC A;  1LE8 B;  3HOW J;  5CVV A;  2VIX A;  3KP7 A;  4G6D A;  4HNT A;  4N0B A;  2D2W A;  3S32 A;  4I99 C;  3DPU A;  1O3Q A;  1AKH B;  1G59 A;  3QPL A;  3SQN A;  4IZZ A;  2CV0 A;  3H5R A;  4LLG F;  3RKY A;  2DMP A;  3S2W A;  1SMT A;  3ABL H;  5FKO A;  4BE1 A;  3RZO J;  1J5Y A;  1E3H A;  1BC8 C;  5FRM A;  2Q2E B;  4XLP F;  1IJW C;  2ZB9 A;  5FKK A;  2KP6 A;  2HYJ A;  2V7F A;  3I59 A;  3KLN A;  1BBY A;  2ZJ2 A;  2LKP A;  2DJI A;  2XVC A;  2V1N A;  4HV6 A;  3GTM J;  3OYC A;  2A6H F;  2ZME C;  3V4G A;  2YSR A;  2ZO4 A;  3C2B A;  1A04 A;  3CZ6 A;  1F9N A;  1H88 C;  3CCS I;  5L3G A;  2LKS A;  4KNY A;  1EH6 A;  2BY1 A;  4I6Z A;  1I39 A;  1ON2 A;  2IA0 A;  1N77 A;  1Y1W J;  4NC8 A;  4RAZ A;  1K6O A;  1YS7 A;  2EIJ H;  2AO9 A;  3S3O A;  3E0J B;  5FLM J;  2R0Q C;  5J40 A;  2KJC A;  5K7Z A;  2HOS A;  2XC7 A;  2KIU A;  2L7M P;  4XKV A;  3LQQ A;  3IKV A;  2IGM A;  4ASN A;  5D5U B;  3HB9 A;  1YJN I;  1PUF B;  4S0H B;  2I10 A;  2AQF A;  5A2Q Z;  4RDU A;  2R5Y B;  2QSF X;  3CCQ I;  1R5H A;  3ECH A;  1X3U A;  2JUC A;  3EUH C;  2DTR A;  3U1K A;  4BY7 J;  3WHC A;  1TTY A;  1W5T A;  2Z33 A;  2PI0 A;  3OYK A;  3EDP A;  1MMG A;  3R6S A;  4UUV A;  5IT9 Z;  2HYG D;  2MG4 A;  2WY8 Q;  3ZQI A;  2Y9Y A;  2O8X A;  1Y39 A;  4PK4 A;  1SVL A;  2JRM A;  2PFB A;  2EFN A;  1BN5 A;  5M5Y J;  2MFZ A;  2K85 A;  2CQN A;  3ZQ7 A;  1EH8 A;  2OTJ I;  3PFY A;  1EJ9 A;  2BW3 B;  1P7J A;  4BGD A;  3MZY A;  1W7P B;  1E3O C;  1UAA A;  2FD5 A;  3CD6 I;  2WY7 Q;  4DYQ A;  2FQ3 A;  2R7S A;  3CMM A;  3KP3 A;  4IEJ A;  3W2V A;  2W00 A;  2Q1Z B;  3WTV C;  4ENK A;  3GTP J;  5C3E J;  2CGP A;  2CQX A;  1NTC A;  4D0P A;  3OY9 A;  3I56 I;  3S3N A;  3TMO A;  3PUF A;  4AD9 A;  5J3L A;  1GLN A;  3G1M A;  4BXX J;  1X2N A;  1SAX A;  2Z3Y A;  3RSN A;  5TRD A;  5F0F A;  5JHF A;  4M9S A;  3CC7 I;  4A3E J;  1XX5 A;  2ID6 A;  2W84 A;  4EMS A;  1WZ2 A;  2L3D A;  3NAU A;  2EV6 A;  2E7W A;  2F5D A;  2L9N A;  2OCE A;  3U2R A;  5EDN A;  3KCC A;  1VQN I;  2F5F A;  3PQJ A;  1U2W A;  1CQT A;  4LG0 B;  1P7I A;  4U0Y A;  2GA2 A;  3KFW X;  4XON A;  5F27 A;  2FA5 A;  1UCR A;  2L7Z A;  4X1E A;  3JRI A;  3GTL J;  4RA2 A;  2UZK A;  3IC7 A;  3DWL E;  1S3J A;  3CDL A;  3HKZ N;  4XLA A;  1F43 A;  3QP5 A;  3GCM A;  3F21 A;  1BI1 A;  2O8K A;  4LMY A;  5B66 C;  2ECC A;  1VQO I;  2DT5 A;  4UV9 A;  1B9M A;  1G3W A;  1I3Q J;  3DEE A;  2M0C A;  3DBL B;  3J7Y J;  5K5O A;  1JKO C;  1AA7 A;  2HTJ A;  3FXQ A;  1GV5 A;  4YIF A;  1T39 A;  4ENN A;  2XHK A;  3PJR A;  1IAW A;  4JYK A;  1FLI A;  2CO5 A;  3G3Z A;  4EAT A;  4RAG A;  3WU1 B;  5HLG A;  2O5R A;  3RPQ A;  1YJ9 I;  3R60 A;  4WXH A;  4FAS D;  1ACI A;  3BPX A;  1GV2 A;  1R22 A;  3F23 A;  4AIH A;  1R23 A;  1YW7 A;  3TQN A;  3V7R A;  1OJL A;  1K79 A;  5KCM A;  3TBI A;  3K4C A;  4FIS A;  5LHI A;  3FXO A;  2X6W A;  4XSZ F;  2PMZ A;  5D6F A;  1A6Q A;  3FBN B;  2LNB A;  2R92 J;  1SFO J;  2R7D A;  3FMQ A;  3QPT A;  1HST A;  2DYS H;  1V5E A;  1KZH A;  4M9Z A;  2JT1 A;  2E1O A;  2CUZ A;  2X85 A;  2IS6 A;  1X1P A;  2COM A;  4YFK F;  2J5O A;  3F8C A;  4S04 A;  3BR0 A;  3LA2 A;  3ABK H;  2LBF B;  2J5P A;  1OYI A;  2A07 F;  3HDD A;  1VQ7 I;  1TZL A;  4FT8 A;  2RQP A;  2RC4 A;  2RRE A;  1T33 A;  3CUQ C;  4D1Q A;  5C44 J;  1MSF C;  3I59 B;  5E1W A;  2JPB A;  2GOM A;  1R00 A;  1TWG J;  5E3O A;  1XPX A;  3I5U A;  2A61 A;  1S6L A;  4MNU A;  2ME6 A;  2XDV A;  3L1P A;  2JA7 J;  2EZI A;  2FJ1 A;  1BIA A;  3FMS A;  3BG6 A;  4AIJ A;  4LK1 F;  4O6J A;  3VWB A;  3F6V A;  1FTT A;  3L2C A;  4PJN A;  3OYJ A;  1SD6 A;  2KDO A;  1FYM A;  2DDA A;  2V1D A;  3FK7 A;  2PEX A;  1BI3 A;  1FBU A;  2QKL B;  5L3E A;  1YQA A;  1B6A A;  1ZK8 A;  5F1R A;  1SFE A;  3H92 A;  3HSR A;  3BPV A;  2M8G X;  1P4A A;  2TRT A;  4EJW A;  2OCC H;  2EIL H;  4I02 A;  1JE8 A;  4U0V A;  2M4G A;  2X9D A;  1SVO A;  3RQ4 A;  3QRF F;  3G73 A;  2D1H A;  3FXR A;  2L9V A;  2EFQ A;  3O2P E;  2DCE A;  4HLY A;  3E97 A;  1FOY A;  2DMQ A;  4IF4 A;  2IGK A;  2A69 F;  3P5J A;  2PMH A;  3KYD B;  2V9P A;  4XLC A;  1SFK A;  4F55 A;  2IEK A;  5BPI A;  2KRH A;  4M3B A;  3WOD F;  4HDU A;  1S9H A;  3GTO J;  1BR4 A;  1ETO A;  2E1C A;  2BVM A;  3SDG A;  1I6X A;  2QUF A;  3WE3 A;  5TJJ A;  3CLO A;  2KT0 A;  2Y69 H;  4N9I A;  2HOA A;  3ZQH A;  2K9L A;  1NHA A;  2DMU A;  4CYD A;  3OYF A;  3EPZ A;  3CP2 A;  2V9V A;  1LEB A;  4P5O A;  3OYI A;  3CMA I;  1UST A;  3LFU A;  3BR3 A;  4RB1 A;  1DPU A;  5JLW A;  4PJM A;  2V26 A;  2QQ9 A;  2UXN A;  3K1P A;  3C18 A;  5EZH A;  2B9S A;  4ZC3 A;  1IF1 A;  4J00 A;  2DFH A;  2DN0 A;  3BLY A;  3HZJ A;  4PJ0 C;  4A3I J;  4C2M J;  3ZMS A;  2GOX B;  3OOU A;  1LFB A;  3HOS A;  5F6F A;  3KP5 A;  4DNC A;  1BL0 A;  2OAZ A;  1KU3 A;  1EH7 A;  3MWM A;  2QGU A;  4G6Q A;  3M8J A;  4B4C A;  3MQ0 A;  1UHW A;  3QPH A;  1D5Y A;  4EM2 A;  4ESB A;  4A6D A;  4BXU A;  4UUT A;  1XB4 A;  3TO6 A;  4IHW A;  2EH3 A;  4XN0 A;  1DUX C;  2HNH A;  2L01 A;  5ICG A;  4RM3 A;  1IO2 A;  3CCM I;  1IRX A;  1FIA A;  1H9T A;  4MO7 A;  4RBO A;  1RZ4 A;  1D1A A;  2KMU A;  1L3L A;  1LPQ A;  5LD2 C;  1OR7 A;  2JN6 A;  5CVU A;  2JRT A;  2YPR A;  1Z67 A;  4ZTF A;  2XGE A;  1QA6 A;  2DOF A;  3MKY B;  4RLQ A;  2CWE A;  1FOW A;  3PO2 J;  1ZG3 A;  2FF4 A;  2JK3 A;  3FKI J;  4OU0 A;  2D1V A;  4C3I J;  5J1Y A;  3WTT C;  3GBG A;  5HDG A;  1VQ9 I;  1K4S A;  1Y6I A;  2M34 A;  5BNG A;  4E7K A;  4BHC A;  2HVR A;  2P7C B;  3DTK A;  2HVQ A;  2ZXW H;  5F0H A;  1QZZ A;  2VE8 A;  4B43 A;  4QLC U;  1SC7 A;  3RKQ A;  5JVT A;  5C4J J;  2FOW A;  1JHF A;  1MW7 A;  1Y0U A;  2L9R A;  5EZG A;  3ZQQ A;  4BU2 A;  1MMA A;  2WV0 A;  2XAJ A;  5KAI C;  3K4N A;  4BEH A;  2M87 A;  1FSE A;  2V1X A;  3GF2 A;  3OYA A;  2EWN A;  3NEU A;  2EIK H;  4Y4R A;  4YRV A;  1DU0 A;  3F3X A;  4RGS A;  4YIR X;  3TED A;  4ZYG A;  4HDV A;  4UNO A;  3OYD A;  4ENJ A;  1PUE E;  4RGR A;  1P92 A;  2XKO A;  4BKX A;  5LFA A;  3HGG A;  4XL9 A;  2ACJ A;  2E2H J;  2HKX A;  3HG9 A;  4HZF A;  1ERD A;  3L2W A;  3K1N A;  1WJE A;  3ABM H;  3L2Q A;  5HNF A;  1TWC J;  2CU7 A;  1DU6 A;  3I4M J;  2HEO A;  2FXA A;  4LGW A;  4HAM A;  2PJP A;  1JKQ C;  3B73 A;  2X4H A;  3HRS A;  3F9K A;  2Y0S N;  4AM3 A;  3ERE D;  1T56 A;  2LH9 A;  1VI0 A;  3ZN1 A;  1FTZ A;  5LBQ A;  1OCP A;  2HYF A;  4I98 B;  1T2K A;  2XV4 S;  1EF4 A;  3AL0 B;  4YEL A;  4MFE A;  4BAY A;  3VOD A;  2O0Y A;  3ESW B;  4BJ5 C;  4I01 A;  3ZQL A;  2EZK A;  3ASN H;  1K78 B;  2HXO A;  4KMF A;  3FMR A;  1O7L A;  4S05 A;  5LHH A;  1ZLK A;  4AYB A;  1B8I A;  4WXC A;  4C2U A;  2FEZ A;  3COA C;  3TOA A;  2OV7 A;  4IVN A;  1BM9 A;  5CVR A;  1BI0 A;  3BCB A;  2FX0 A;  3BQZ A;  3UNG C;  1D8K A;  2MD5 A;  4IHX A;  2VL8 A;  3M07 A;  1U0J A;  1LDD A;  2KZV A;  1ETW A;  2Z2S B;  3VB2 A;  1I1S A;  3H9Q A;  1BR1 A;  3IH2 A;  2WTE A;  2QLZ A;  3HPH A;  3C2H A;  4MEY F;  2KIQ A;  3HOT A;  2X1E A;  3IL2 A;  3K7A J;  4E7J A;  4XMY A;  1UJ8 A;  4A2U A;  3OYL A;  2BGC A;  2E1M B;  1Z21 A;  4CO8 A;  2K9S A;  1LVK A;  4LB5 A;  3EUA A;  4ZDO A;  1CF7 A;  2RNJ A;  2P81 A;  3HRM A;  2LFB A;  3B6C A;  3HGY A;  1JT0 A;  3FXL A;  3A01 A;  4GCV A;  3MZ8 A;  3RJP A;  1DGR M;  4XBF A;  3WG9 A;  4Y13 A;  5BS6 A;  5FO5 A;  2ZBK A;  3P7N A;  3VSK A;  1GXQ A;  4JX4 A;  2IPQ X;  2MC4 A;  2Z1D A;  3S93 A;  1P4X A;  1APL C;  2F4O B;  3CP8 A;  3P9K A;  3I3L A;  2X6Y A;  2STT A;  4DIQ A;  2ETH A;  4FE4 A;  4XLE A;  4ZJZ A;  2FRH A;  4WK8 F;  2XF5 A;  3GTJ J;  3JAM K;  4M6V A;  4XKC A;  3GUD A;  4NDL A;  4L9N A;  2CFO A;  3SFZ A;  3RYR A;  3L09 A;  5TGT A;  2M4K A;  2W85 A;  1UG2 A;  2OF7 A;  3E5X A;  4UV8 A;  5J1R A;  2H8W A;  2TDX A;  2GLO A;  4WXD A;  2DA2 A;  4Z6Y A;  2G7U A;  3VYR B;  1RIO H;  3GWZ A;  1YG2 A;  3LWF A;  1X19 A;  1WCM J;  2VJ4 A;  4HYE A;  5D4R A;  3J7A Y;  2R7X A;  4HQM A;  2CV1 A;  4JBA A;  1D5V A;  3QOD A;  4CZZ A;  2L0K A;  3FK6 A;  2V4J C;  2LK2 A;  3BC8 A;  4UXN A;  2QEX I;  1IXS B;  1KGS A;  3OIO A;  1F4K A;  1IN8 A;  4XNF A;  3H5N A;  4MTE A;  1MJ9 A;  2QSH X;  1IZ1 A;  3T5X A;  3S14 J;  5FRO A;  2VC0 A;  1HXD A;  3RKX A;  2DFF A;  3GVA A;  3K69 A;  3OYN A;  2R5Z B;  3TL4 X;  3IRR A;  2VAS A;  2YUS A;  3QPS A;  2ADU A;  1P2F A;  3WTZ A;  3VFZ A;  2XF7 A;  3JCU C;  2YX4 A;  5HS9 A;  5FRN A;  5E1X A;  5DCM A;  1D1C A;  3MZH A;  2DQR A;  3NRV A;  2Y75 A;  2A3S A;  1YS6 A;  5HLT A;  3D5R C;  2WAD A;  4XN3 A;  5J4V A;  4D7M A;  3H9G A;  2KIS A;  2KPM A;  4A3K J;  2LOO A;  3BJ6 A;  4IOA F;  1J9I A;  2G7H A;  4OAY A;  2Y9Z A;  1RRJ A;  1C0W A;  4Q5S F;  4F93 B;  5CVI A;  1S7E A;  2HPM A;  2E2J J;  3FXK A;  1Z6R A;  5IOY A;  1FWZ A;  2B7E A;  2JTV A;  3U1D A;  3V8K A;  3H36 A;  4YII A;  3VYT B;  3O6B B;  3AG1 H;  5DUK A;  3BTJ A;  4HBL A;  1OCC H;  2DPD A;  4ZYE A;  3CC2 I;  5CVJ A;  4GGG A;  3DFG A;  4P1W A;  4YFX F;  4MQ9 F;  3A0H C;  3SDB A;  3MN2 A;  4A3B J;  1HOM A;  4XOT A;  2F4M B;  4RMN A;  3RIR A;  2MLK A;  2OC6 A;  1SAU A;  1HA8 A;  4BL0 B;  4NC7 A;  1A5J A;  3OR2 C;  3SEQ A;  1ZQ3 P;  3GTK J;  1T0F A;  5K5R A;  2DA3 A;  1LQ1 A;  4DOZ A;  5E3M A;  1UB9 A;  3AAF A;  1G3S A;  2NS7 A;  1V3F A;  3I58 A;  3RTR A;  4DW6 A;  5IY5 H;  2XPW A;  2XIG A;  4JX6 A;  3GW2 A;  2Y2Z A;  4RB3 C;  6PAX A;  3BG9 A;  4KMU X;  1VQ6 I;  4QSH A;  4BAC A;  3P9I A;  3TDZ C;  3RI4 A;  2A6T A;  3MMY B;  4KIT B;  1JJ6 C;  1DDN A;  4CH7 A;  3CJQ B;  1GUU A;  3FZV A;  4RAY A;  1MKM A;  1X58 A;  5JI6 A;  1TQP A;  1G3Y A;  4PGG A;  4BYY A;  1B8I B;  5D5V B;  2K4J A;  4Y7N J;  3BQY A;  3HBL A;  3AKZ A;  3DKX A;  3KIO A;  3CJN A;  2AXL A;  3V42 A;  3H35 A;  4PZJ A;  1J09 A;  2OA4 A;  2LYC A;  3A0B C;  3HM5 A;  2NVT J;  4G9Y A;  4P96 A;  5GAD J;  3J80 K;  2STW A;  3CTA A;  1S8N A;  2JVH A;  3JAM Z;  3F8F A;  3KP6 A;  4A5M A;  1E3P A;  3CF5 F;  2KIM A;  2NNN A;  2QSG X;  1B4A A;  3OWT A;  5D5W B;  4CCO A;  1Z3X A;  1B72 A;  1H9G A;  2VQH A;  3A1Y A;  5L3C A;  1AOY A;  4NQW A;  1LB2 A;  1V5F A;  1DQU A;  4E7H A;  3T1B A;  4HLX A;  4ZYD A;  3JRC A;  2VT2 A;  1I5Z A;  2DA5 A;  1CF7 B;  1JHH A;  2PQ8 A;  3NAR A;  1KON A;  3LSK A;  3QP6 A;  2KFD A;  2VPL A;  1J7K A;  4IHT A;  3W6J B;  4IQ4 A;  4DQ2 A;  1ZEL A;  2YX7 A;  3SZP A;  2XAQ A;  3PIO F;  5B1B H;  2GAU A;  1HQC A;  4EM1 A;  2VOD A;  1WI3 A;  2VJJ A;  1ZAR A;  2Y0M A;  3GTQ J;  2CS3 A;  1Y56 A;  4HW0 A;  2EK5 A;  3FKJ A;  3U9G A;  1BOA A;  1OR7 C;  3BTL A;  1WJB A;  3OOP A;  3PNT A;  2UV1 A;  1DP3 A;  4W1U A;  4XKB A;  2ELK A;  1ETQ A;  1WKM A;  4L9V A;  4LJZ F;  4HG2 A;  2JQ7 A;  2HKO A;  3F8N A;  2E1N A;  1S72 I;  2VXD A;  1X4P A;  2M1B A;  3DLL F;  3KP2 A;  4LK0 F;  3FM5 A;  3S15 J;  4CHU A;  3HOY J;  3ZPL A;  2VQG A;  3EET A;  5E20 A;  1TLH B;  2RAE A;  1LDJ A;  2GBY A;  2XKP A;  3GEZ A;  4K2E A;  3CUQ B;  3E5U A;  3CO7 C;  2Y30 A;  3MKL A;  2DT7 B;  3K2A A;  3W2W A;  2CRG A;  1VF9 A;  3S2H J;  1Q1V A;  3G4S I;  5ED4 A;  4HX4 A;  3H3U A;  2R7T A;  2HOE A;  1OCT C;  2K5C A;  2M8E A;  2LF8 A;  2DYR H;  3M8E A;  1R6R A;  3GFJ A;  2R7W A;  2OTL I;  3CC4 I;  2FBK A;  3PUB A;  1JUP A;  2KKO A;  1Z0X A;  4HX7 A;  1GT0 C;  5DCM B;  3QWL A;  1GDT A;  2MA3 A;  2O7O A;  3CUO A;  2MBF A;  3DCF A;  4ESF A;  3UR3 C;  2HFH A;  5EYR A;  3JRH A;  4EEF G;  4LFU A;  3PQK A;  1XS9 A;  1K6Y A;  3HSF A;  5H6Q A;  5J6X A;  3HRU A;  1HC8 A;  4B8X A;  4HST A;  4I76 A;  1QU3 A;  4XOR A;  4KIS A;  4A6E A;  4E7S A;  4PSX A;  1H89 C;  2IJL A;  1U6G A;  1WPK A;  2DOA A;  4OOI A;  3WU0 A;  4IRG A;  4M3D A;  3I4N J;  2FE3 A;  1EA3 A;  3KX2 A;  4P9F A;  4BH9 A;  3KP4 A;  2X6O A;  1JKP C;  1P6R A;  1YW8 A;  3HHG A;  2BXZ A;  4B09 A;  2HQ5 A;  1WQ2 A;  2EA2 A;  3IH3 A;  1MDM A;  2VT3 A;  3WHB A;  1V54 H;  4M9X A;  5F0C A;  5M3F J;  1R49 A;  4MLO A;  1D8J A;  3BG3 A;  3ZMZ A;  5IP6 A;  2HDC A;  3FXM A;  4HV5 A;  3GO5 A;  4F7Z A;  1FMW A;  1JGS A;  4W97 A;  4CZC A;  1BW6 A;  5HOO A;  2XGC A;  4PCQ A;  2DAO A;  1NH3 A;  3C1D A;  3G71 I;  3CME I;  1TQI A;  1YLF A;  3LNQ A;  2XUB A;  3TW6 A;  4ZH4 F;  4UUS A;  1YIT I;  4J01 A;  4N4N B;  1QGP A;  3F8M A;  2R7U A;  3JW4 A;  4I2O A;  2CH0 A;  3WE2 A;  2QQA A;  3OSG A;  1VQ8 I;  4RB0 A;  3R61 A;  2R93 J;  5GTH C;  4EJV A;  5FLX K;  5D4S A;  4QWQ A;  4MGR A;  5EG0 A;  4QIW N;  5EEA A;  4BUP A;  1M1E B;  2HI3 A;  3C3W A;  3MAJ A;  1NK3 P;  2DK8 A;  5CJ9 A;  1ETX A;  4BHB A;  5FGM A;  2OZU A;  5DEQ A;  3ZQG A;  2CUF A;  3LMM A;  2LR8 A;  1FP2 A;  2PG4 A;  3VDX A;  2IA1 A;  3BTC A;  4BBR J;  1YX3 A;  4ETS A;  4ANJ A;  4G12 A;  2BY2 A;  3X2Q H;  1NG7 A;  4JP0 A;  4NB5 A;  1Z91 A;  4NUB A;  5ICE A;  2CQ7 A;  2GM4 A;  3HIF A;  2BY0 A;  3M4O J;  3RKW A;  1YW9 A;  3GFL A;  4MHG A;  3M1C A;  1RC9 A;  4D9J A;  1QQI A;  3P9C A;  1P4W A;  3LSG A;  1A35 A;  2LDU A;  5H6R A;  2R7R A;  1X1A A;  3JRG A;  2KRC A;  4D5C A;  1G3T A;  1LKX A;  3OMY A;  3GYH X;  3ISP A;  4CA0 A;  2EFW A;  1MMS A;  4B3A A;  4E70 A;  5M5W J;  1X3Z B;  4HOB A;  4IL6 C;  5BQT A;  1T6S A;  2CQQ A;  3OL4 A;  1PP8 F;  2Z16 A;  5DUI A;  5FD5 A;  2PX9 A;  2HGC A;  4DYC A;  3CCE I;  3MCZ A;  2DK5 A;  2H27 A;  3AG3 H;  1UEL B;  2WAF A;  3G6E I;  1AWC A;  4YEJ A;  3DKY A;  2H94 A;  3ZN0 A;  1Z6T A;  1D0Z A;  3LSJ A;  5FLV A;  3ZRG A;  3IWZ A;  3O3K A;  5AON A;  1TT5 B;  4F52 A;  2QYO A;  2I5U A;  1G6N A;  2PBI A;  4O5V A;  4BS9 A;  5JLX A;  2HDW A;  5FD6 A;  2VBY A;  4E7L A;  1HDD C;  1V5G A;  1FPQ A;  2WB1 A;  2QWW A;  2VBX A;  1I6H J;  2M2E A;  3GLX A;  2ME0 A;  3HJE A;  2AS5 F;  3QOP A;  5FFZ A;  3BP8 A;  2XF6 A;  3LOC A;  1MBG A;  5EEH A;  4L18 B;  4DBQ A;  2OPT A;  4XIC A;  1WJ5 A;  3HOU J;  2CSO A;  2FBI A;  5D8L B;  3RZD J;  4U0W A;  3H0D A;  4IOC F;  1XGM A;  1ZR4 A;  2V6E A;  1R1T A;  1XMA A;  4G8X A;  4B3X A;  5LGU A;  3HOZ J;  2L7F P;  2EFP A;  4GXO A;  3EUK L;  4RM2 A;  4XLF A;  4L5I A;  4MEX F;  2EBI A;  1J59 A;  4IQJ A;  3FXJ A;  3Q5F A;  1CGP A;  2DDB A;  2FUG 2;  4GDF A;  2E35 A;  1T0F C;  2LTP A;  1KQ9 A;  3BG5 A;  1LUJ B;  5LGT A;  2QQ8 A;  2XSD C;  2UUZ A;  5B3S H;  1AHD P;  3SZG A;  2X48 A;  2MH9 A;  5IT3 A;  4WWC A;  1HSJ A;  1RUO A;  2VLA A;  2LSO A;  4EGZ A;  2K9M A;  3QOE A;  2ZNY A;  1OCR H;  5D5X B;  1J0R A;  3CCY A;  4RS8 A;  3O8H A;  2L4A A;  4AWX B;  1WGX A;  4DBR A;  3L7W A;  1POG A;  4CYC A;  4KIB A;  4OIQ F;  3HSE A;  5KHD A;  1W7P D;  4M3F A;  5FLX Z;  3KEQ A;  3G1O A;  1SFX A;  1OKR A;  4G6T B;  1XTA A;  2RKH A;  2NNY A;  3OYE A;  2IRF G;  2LKX A;  3U21 A;  4DGW B;  2BHY A;  2WAQ A;  3Q0U A;  2Q8K A;  1ZG5 A;  1FP1 D;  2E71 A;  3MD2 A;  2ZXH A;  3BT9 A;  3KE2 A;  4EGY A;  2DW4 A;  1G8X A;  1HW1 A;  4ZZL A;  3TKY A;  4CCJ A;  3ABT A;  3CCL I;  2FML A;  1R5G A;  3KYL A;  2QBY A;  5FKM A;  3I55 I;  4PJL A;  2W57 A;  4FCY A;  1KU7 A;  3I54 A;  2XAG A;  1KYZ A;  3WTU C;  1JT6 A;  2P8T A;  1NG6 A;  4A0Y A;  1MSE C;  3GX4 X;  2G9W A;  3ZOB A;  4L5E A;  2GQQ A;  3PSI A;  2IS1 A;  3RPU D;  1WI9 A;  1JGG A;  4V2F A;  4IRH A;  3PM1 A;  2L54 A;  2QF7 A;  2FOK A;  2FBH A;  4EVI A;  4M74 A;  5H2F C;  3DTE A;  2VKH A;  2HOT A;  3NWS A;  4BDY A;  3QYB A;  1TW3 A;  2VUM J;  3E6B A;  2LD5 A;  2V6C A;  1WJC A;  3E6M A;  1O3T A;  3LST A;  2JZY A;  4Q47 A;  1PJR A;  3M8F A;  3ZXS A;  2FMY A;  4H0E A;  5DCF A;  1OYW A;  1V4R A;  3VYU B;  3RYP A;  1MBJ A;  3AG2 H;  2BZT A;  4GO1 A;  1QPI A;  2O9L A;  2GXG A;  3BY6 A;  3DU6 A;  5L3D A;  5HDN A;  4A3M J;  4PFP A;  1W0U A;  2LC2 A;  1LFP A;  2Z5U A;  5DM6 F;  3CO6 C;  1IRZ A;  3K70 C;  5DYM A;  1VQP I;  2IVM A;  2A5W A;  2H6B A;  2LP0 A;  2XRN A;  2K9Q A;  3DV8 A;  1R58 A;  5GPC A;  4EJT A;  4EM0 B;  4FX0 A;  3JRD A;  3HHH A;  5J1U A;  2LLK A;  4XKW A;  1XN7 A;  3VEP A;  1XGO A;  1I3A A;  4YFN F;  1GVJ A;  4UB6 C;  3K4M A;  4PJJ A;  1X1B A;  3CCJ I;  1T8I A;  3K6G A;  1Z7L A;  2NVX J;  2HTS A;  1MH3 A;  1BR2 A;  2RGV A;  1ETV A;  3FXU A;  2XGD A;  3BR1 A;  2ZNZ A;  5FB2 A;  4RAF A;  1SAN A;  2M7A A;  2M30 A;  3S16 J;  1QRY A;  1YJW I;  3CF2 A;  5M5X J;  2IT0 A;  3DBH B;  2VJI A;  2PJR A;  2PMZ N;  4BY1 J;  3M7G A;  3ZMT A;  4Y3O A;  2IBD A;  1BJZ A;  1HKT A;  3TP3 A;  4XK4 A;  2VKV A;  2M5W A;  1REP C;  3TP0 A;  5K7H A;  4L5J A;  4AIK A;  2BBY A;  2LRE A;  4ESJ A;  2L2O A;  1YI2 I;  5CQG A;  1B1B A;  1G4D A;  1TC3 C;  1F36 A;  2CUJ A;  2ECB A;  3CDH A;  5FKN A;  1YFH A;  1W36 C;  1IN4 A;  1IN7 A;  2MD0 A;  1XMK A;  4DZP A;  1USS A;  4A0Z A;  1XGN A;  2HU9 A;  1YO5 C;  3QQA A;  2L02 A;  3JR9 A;  4A12 A;  2PMU A;  3KZY A;  2K86 A;  3OYM A;  5TIS C;  1FOX A;  4II3 A;  4GRI A;  2BVL A;  4B48 A;  4XM3 A;  1UFM A;  1Z05 A;  1ZN2 A;  1Z1D A; 
#chains in the Genus database with same CATH homology
 3CJQ B;  2XSJ C;  3MKW B;  4PSW A;  4XON A;  3OIQ A;  4XR6 A;  4II2 A;  4X0G A;  3AKZ A;  3DKX A;  3V42 A;  3H35 A;  1J09 A;  3VSL A;  3DWL E;  2LYC A;  4XLA A;  4XQF A;  3K4K A;  2JVH A;  2X1D A;  3DEE A;  2XAU A;  1AA7 A;  3OWT A;  4CCO A;  3A4C A;  3LSI A;  1Z3X A;  2VQH A;  3A1Y A;  3IP4 B;  3SYT A;  3PJR A;  2VKD A;  4B48 A;  1WJF A;  4CCL A;  1D0Y A;  1V5F A;  1DQU A;  4EAT A;  4E7H A;  2W82 A;  3G2B A;  2O5R A;  1LDK B;  4FAS D;  4KJZ A;  1E0E A;  3MKZ A;  1KON A;  3IUO A;  3LSK A;  5KCM A;  2VPL A;  3QYF A;  3TBI A;  3K4C A;  1QHG A;  3S8P A;  3HL2 A;  4IQ4 A;  1ZEL A;  2X6W A;  3VYS B;  1Z3Y A;  2PMZ A;  2CMP A;  3FBN B;  4BJT A;  2VJJ A;  1T95 A;  1Y56 A;  2CS3 A;  3FKJ A;  1OR7 C;  1WJB A;  3PNT A;  1V5E A;  2UV1 A;  3ZCO A;  1DP3 A;  2CUZ A;  4QPQ A;  4XKB A;  2X85 A;  2IS6 A;  3K4L A;  4HG2 A;  1QHH D;  2VXD A;  1X4P A;  5CQE A;  2LBF B;  2F5V A;  1MMN A;  3DU5 A;  1WJD A;  2VQG A;  2M0M A;  1TZL A;  1YX5 A;  2RRE A;  2CW7 A;  2JA2 A;  4D1Q A;  3L2R A;  2GOM A;  4FET A;  1WFX A;  3DTI A;  2XDV A;  4E7I A;  3HPG A;  4HEA 2;  2OUM A;  3BG6 A;  3VWB A;  2DT7 B;  3W2W A;  4OAZ A;  2KLO A;  4BEH B;  2R7T A;  2W1O A;  4PJN A;  3OYJ A;  2ZFU A;  2K5C A;  2CV2 A;  2KDO A;  1P9Q C;  2X6X A;  4BDZ A;  1R6R A;  2WAE A;  3OS2 A;  3LSM A;  2R7W A;  2QKL B;  3PUB A;  3HKZ A;  4XOP A;  5CKT A;  4KT6 A;  3DPL C;  4BE2 A;  3UR3 C;  2M4G A;  3CES A;  3RQ4 A;  1X4O A;  1YE9 A;  2DCE A;  1K6Y A;  3OS1 A;  4HST A;  2IGK A;  2HQA A;  1QU3 A;  4N4O B;  3IAS 2;  4XLC A;  1D0X A;  4XOR A;  1SFK A;  4F55 A;  4BQN A;  4KIS A;  4E7S A;  4PSX A;  2DOA A;  2KRH A;  1S9H A;  1BR4 A;  4BQO A;  2BVM A;  1EA3 A;  3KX2 A;  3HUG B;  3ZGK A;  4F91 B;  2K9L A;  2M3A A;  2HPI A;  4B44 A;  4BE0 A;  3OYF A;  3EPZ A;  3CP2 A;  4XLH A;  4P5O A;  2R7O A;  3BG7 A;  4MLO A;  3OYI A;  1FMV A;  3K70 D;  3LFU A;  3LSH A;  1TT0 A;  4CUG A;  1FMW A;  4PJM A;  2V26 A;  4AVZ A;  4CZC A;  5HOO A;  4H4K C;  4IKF A;  1VZ0 A;  4ZC3 A;  4BQQ A;  4J00 A;  3BLY A;  2X1C A;  2M7B A;  1OLT A;  2GOX B;  3FHN A;  3OOU A;  3QYE A;  4J01 A;  3E1S A;  4N4N B;  2AQE A;  2R7U A;  3HOS A;  2CH0 A;  4HSR A;  3OS0 A;  5KNL A;  4ITV A;  3M8J A;  2JUG A;  4BUP A;  2R7Q A;  3W3C A;  2KQR A;  5CPR B;  4U87 A;  2LY2 A;  1PYV A;  4XN0 A;  2HNH A;  4RM3 A;  4DJA A;  3LMM A;  4B47 A;  1IRX A;  3VDX A;  4C9Y A;  1D1A A;  2KMU A;  5HNH A;  1W36 D;  5LD2 C;  1YX3 A;  4ANJ A;  4ZTF A;  1NG7 A;  3MKY B;  2LBF A;  4RLQ A;  4NUB A;  3AFH A;  2L5Q A;  4OWR B;  1MNE A;  4QPO A;  3PNY A;  2MAB A;  3GBG A;  4NNJ A;  2IXS A;  1Y6I A;  3DQV C;  3N05 A;  4E7K A;  3I9V 2;  2HVR A;  3DTK A;  3M1C A;  4ZYA A;  4D9J A;  2HVQ A;  4HRI A;  3LSG A;  4B43 A;  2CW8 A;  2WA0 A;  2R7R A;  1X1A A;  1N75 A;  2KRC A;  4AU7 A;  3SEZ A;  1MW7 A;  1LKX A;  3OMY A;  4CA0 A;  1X1D A;  3ZQQ A;  1WJA A;  4BU2 A;  1MMA A;  4E6K G;  3K4N A;  3OYB A;  4BEH A;  2DXI A;  4JOM A;  3OYA A;  3KEY A;  3OL4 A;  2Z16 A;  4Y4R A;  4YRV A;  4CCK A;  4CSW A;  2VJ5 A;  3OYD A;  3FDY A;  2L9S A;  5LFA A;  2LY1 A;  4XL9 A;  1UEL B;  2WAF A;  2F6C A;  3K10 A;  4ZTJ A;  3H5A A;  3HG9 A;  4YEJ A;  4E7Z A;  2BW3 A;  2BOL A;  3OYG A;  4C2T A;  3A2K A;  3DKY A;  1ERD A;  3L2W A;  3HXL A;  1D0Z A;  1WJE A;  4C30 A;  3L2Q A;  5HVQ C;  5HNF A;  3ZRG A;  2IS2 A;  2K3P A;  3HC7 A;  3K4B A;  4F52 A;  4HPQ A;  2NOJ B;  2HZD A;  2UWM A;  4BS9 A;  1JI8 A;  1N78 A;  2HDW A;  3F9K A;  4ZDL A;  4E7L A;  3AL0 C;  1V5G A;  2WB1 A;  2LH9 A;  3S3M A;  1BOB A;  3LL7 A;  2X51 A;  4Y33 A;  3DLA A;  4PFO A;  3AL0 B;  3IAM 2;  4YEL A;  3OIP A;  2XF6 A;  4PUS A;  1D1B A;  4RLF A;  4DBQ A;  4BJ5 C;  4CCM A;  1WJ5 A;  2RQQ A;  2E5Z A;  1MMD A;  3H0D A;  2DT6 A;  2V6E A;  4B3X A;  4AYB A;  2W7N A;  4U7B A;  4C2U A;  2MYS A;  2OV7 A;  3EUK L;  3ONQ A;  4RM2 A;  4XLF A;  2VQC A;  3BCB A;  3K4J A;  4JQF A;  4F3Q A;  2PJR B;  3UNG C;  4LIU A;  4IQJ A;  2VL8 A;  2FUG 2;  1U0J A;  2Z2S B;  2KZV A;  1T0F C;  2JVG A;  1BR1 A;  2V9K A;  3H9Q A;  4R79 A;  3HPH A;  3C2H A;  2I8D A;  3D5L A;  1X1C A;  3HOT A;  2UUZ A;  2X1E A;  2E1M C;  3RCO A;  1MND A;  3H9J A;  3SZG A;  3PNV A;  4E7J A;  2VLA A;  4XMY A;  4LIT A;  2E5N A;  2K9M A;  3QOE A;  3OYL A;  2E1M B;  1UG0 A;  2IGN A;  1Z21 A;  2IGO A;  4HNU A;  1LVK A;  3EUA A;  4BXF A;  4DBR A;  4ZDO A;  5KHD A;  1DGR M;  2HVS A;  4G6T B;  3VSK A;  2VIX A;  3OYE A;  2MC4 A;  2Z1D A;  3S93 A;  4HNT A;  3U21 A;  2VB6 A;  4DGW B;  3CP8 A;  3S32 A;  3NWT A;  3I3L A;  2X6Y A;  3DPU A;  2KL4 A;  4DIQ A;  2WAQ A;  4XLE A;  4ZJZ A;  2XF5 A;  1G59 A;  3MD2 A;  2ZXH A;  2L7K A;  4IZZ A;  2CV0 A;  3L2V A;  4XKC A;  3H5R A;  3DPT A;  4BJ6 C;  2CFO A;  1G8X A;  2M4K A;  5TGT A;  4BE1 A;  2JSP A;  4CCJ A;  2E60 A;  2F4I A;  3D5S C;  3KYL A;  2Y0S A;  4PJL A;  5FRM A;  2Q2E B;  2ZXI A;  3VYR B;  2KP6 A;  2V7F A;  3J7A Y;  1X19 A;  2VJ4 A;  1NG6 A;  2R7X A;  2CV1 A;  4F92 B;  3QOD A;  2DJI A;  2V4J C;  2V1N A;  3BC8 A;  4NQW B;  3OYC A;  3CZ6 A;  3PSI A;  2IS1 A;  3RPU D;  2IS4 A;  4XNF A;  3L2U A;  3H5N A;  2KHM A;  2RNG A;  3DTE A;  2VKH A;  5FRO A;  3NWS A;  4BDY A;  3QYB A;  1N77 A;  3OYN A;  1WJC A;  4CCN A;  3OR1 C;  1PJR A;  3TL4 X;  2VAS A;  3ZXS A;  4NC8 A;  2XF7 A;  2LG4 A;  2VQL A;  3VYU B;  5FRN A;  4IX7 A;  1D1C A;  3S3O A;  3E0J B;  5HLT A;  2XC7 A;  3D5R C;  3DU6 A;  4XKV A;  2WAD A;  4PFP A;  4XN3 A;  2LC2 A;  1LFP A;  3PSF A;  3K70 C;  2IGM A;  2A5W A;  2KPM A;  3H9G A;  3BCA A;  4E4H A;  2LOO A;  3FBI B;  4OAY A;  3C2G A;  4XKW A;  2AQF A;  4F93 B;  2HPM A;  3K4M A;  3EUH C;  1X1B A;  4PJJ A;  2R7V A;  3K6G A;  1Z7L A;  1BR2 A;  3OYK A;  1MMG A;  3VYT B;  3ZR8 X;  2WY8 Q;  2QKM B;  2WBM A;  2M7A A;  2W4S A;  4PK4 A;  3W2A A;  4P1W A;  3CF2 A;  4LIV A;  3OL3 A;  3SDB A;  2VJI A;  2PJR A;  2MFZ A;  2R4G A;  4XOT A;  4Y3O A;  4RMN A;  3PFY A;  2BW3 B;  2OC6 A;  1SAU A;  4BGD A;  1HA8 A;  4BL0 B;  1UAA A;  4NC7 A;  2WY7 Q;  2LRD A;  3OR2 C;  3SEQ A;  4DOZ A;  2R7S A;  3CMM A;  2LRE A;  3W2V A;  2W00 A;  2Q1Z B;  2L2O A;  3CJR B;  5CQG A;  2ELJ A;  2CUJ A;  3OY9 A;  1W36 C;  1DGW Y;  3RTR A;  3S3N A;  3TMO A;  2MD0 A;  1GLN A;  2VXZ A;  3OYH A;  4ZDP A;  2HU9 A;  3RSN A;  5JHF A;  3PL8 A;  4BAC A;  2P0W A;  3OYM A;  4II3 A;  2ZSI B;  2BVL A;  2ZSH B;  4GRI A;  2A6T A;  2L9N A;  4LG3 A;  3MMY B;  4XM3 A;  4KIT B;  4CH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...