1UZCA

The structure of an ff domain from human hypa/fbp11
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
QPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN FLJ21157
publication title The Structure of an Ff Domain from Human Hypa/Fbp11.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 21
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2004-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 1uzcA00
2LKSA 2KFDA 2B7EA 2K85A 2KZGA 2L9VA 4FQGA 2DODA 2DOFA 2E71A 2KIQA 2KISA 1UZCA 2CQNA 2DOEA 2JUCA
chains in the Genus database with same CATH superfamily
1KQ9A 1WQ2A 4HX4A 2Q8KA 3HGYA 5HDKA 1VQKI 5AONA 4I2OA 4B47A 2Y30A 1TBXA 4XK4A 3OL3A 2JA6J 4Y3OA 5JHUA 3C2HA 1MSEC 2XF6A 4XRSG 2XB5A 4D7NA 5FKMA 3SFIA 2LP0A 4ZDLA 1XDSA 2O03A 2EK5A 2MBFA 3RYPA 5E3MA 2BVMA 1P4XA 1UMQA 1BW6A 4G8XA 2QQAA 3TOAA 1OMIA 2BHZA 3AG3H 1ZKGA 2EILH 3S3NA 5CQEA 4I99C 5KAFC 1GDTA 1OFCX 4IPAA 1ZRFA 1HKQA 3OYJA 2K3PA 1F9NA 4JP0A 2MABA 4KIBA 2JT1A 1L0OC 4IOCF 3BR5A 1TLHB 4IJAA 4OAZA 1ETYA 2MC4A 3S32A 5E18F 1I1GA 1FLIA 1LEBA 2GXAA 5DCMA 3O3KA 3GO5A 4L5IA 2QLZA 3F8FA 4XNFA 4J01A 2STTA 2QKMB 4QTRA 4MQVA 3CDLA 3EYYA 5HLIA 4OIPF 1OKRA 5JR3A 3SFZA 3TO6A 1ZREA 3ZOBA 4KN4X 5E3NA 3CMAI 3S14J 5KAIC 4M3EA 3HXLA 2QENA 4XLFA 3SJMA 4IHVA 2F2EA 3KP4A 4WK8F 3LA3A 3HM5A 3CCJI 2X6XA 5DCMB 3OYFA 4YFXF 2XAJA 1F43A 5FO5A 4II2A 3FX3A 2MFZA 1TNSA 4BQQA 5DYMA 2ZB9A 3IWZA 4P1WA 1QZZA 2LD5A 4QPQA 1B1BA 4XLHA 4ZYGA 2FBHA 4IZZA 2M0CA 2IS4A 4EJUA 2OZUA 3MKWB 1JUPA 4LLLA 3S16J 2GIVA 1E3PA 2R93J 1R00A 4DQ2A 3K7AJ 3HOYJ 3IAM2 1UHSA 2E7WA 1QO0D 3K4MA 2E35A 4XM3A 4WCGA 2HPIA 3CUOA 4L5EA 1R6RA 5IP9J 1K7AA 3SZGA 3TDUC 1MJAA 1FP2A 1LFPA 1MH3A 3U9GA 3CLQA 2Z9OA 2DAOA 2EIMH 2KDZA 1S7OA 3OYHA 1MMGA 5BPDA 2OU2A 4EJOA 4M6YA 2Z1DA 1TQPA 2TDXA 3FKIJ 4XLNF 3ZQFA 5GAEJ 4FTHA 4OMYA 2R4GA 2AHQA 3CD6I 2M4KA 1B9NA 3C3WA 4A3DJ 2F5FA 1ZQ3P 4ENKA 3FKJA 1I50J 4GYGA 2JA8J 5D5XB 4D1QA 3LSJA 1K6OA 3I5UA 1HLVA 2BE5F 2A61A 2WAQN 3KP6A 4XSZF 3WTVC 2GM4A 3G71I 1O3TA 2H1LA 2MG4A 4CSWA 5F1JA 3AG4H 1MBHA 1XMAA 3KP5A 3NAUA 4B43A 3KETA 1FOWA 1GT0C 4FETA 2DA2A 4IVNA 4UUSA 5BS6A 1XCVA 1XC5A 1D1AA 2DXIA 1MMAA 3RKYA 4F3QA 3PIPF 1DQUA 3TBIA 3K6GA 2ZNYA 1WCMJ 2EFOA 5JFRA 1S72I 2O61A 4HF0A 1P4WA 2MH9A 4LMYA 4MQ9F 5GPAA 4F52A 4F91B 4LITA 4IRIA 1OR7A 2LY1A 3PSFA 4XL9A 1YO5C 1S3JA 3H92A 1YX5A 2F4MB 2CWEA 4EMSA 3T1BA 3DWLE 4FT8A 4LIVA 1LUJB 2E2HJ 2WY7Q 1GVDA 2LY2A 3R0JA 2CUFA 4MEYF 4NNJA 3WTWC 4UUSB 2X6OA 3F6OA 1DU6A 1ITYA 2VL8A 3ABLH 2VKDA 1VNDA 1QZYA 1DPUA 3W6JB 1I3QJ 3SYTA 1HBXG 3I54A 3JSOA 3RQ4A 2CU7A 1QRYA 2IVMA 2VC1A 3PNYA 4JX4A 4GDFA 1B59A 1ONVA 5LRRA 2JN6A 2WB1A 3JSPA 2J5OA 3MZYA 4V2GA 3CJQB 2XRLA 3HOTA 1X2NA 1W36D 1S5LC 3Q0WA 4E7IA 1LE8A 4MEXF 2Y0SN 1Z67A 2XAGA 3WU1B 3HOVJ 4XN0A 1LB2A 4CCJA 2W4SA 1P7IA 1J7KA 2QGUA 4DYRA 3KZYA 1OPCA 2VPRA 4ETSA 3QP6A 3DBHB 3QP5A 2HPMA 3PSIA 1G3YA 1JHFA 3FISA 3NQOA 3FBIB 1VQ7I 4UVBA 2E1MC 2KRHA 1UG2A 3HHHA 5GADJ 3CUQA 4NB5A 2HR3A 2L3DA 2VASA 4NC6A 5HLGA 3FK7A 1ZR4A 1LE8B 1WWXA 5LEJA 3ROUA 4G94A 3N05A 2YX7A 1XGOA 2KIQA 3SEZA 3EUAA 2DMPA 5HS9A 2QBYA 4C2MJ 1D0XA 5HOOA 2FBKA 1OJLA 3LFKA 3RPQA 4AIHA 3LAPA 1QZEA 4BL0B 3HOUJ 3K1NA 4QPOA 2K40A 4HZFA 2V1UA 1Z9CA 2V9PA 2ISZA 3AFHA 2DTZA 3PFIA 1DUXC 1IZ1A 4XSXF 3M7GA 2E2JJ 3CUQB 2EB7A 2XGXA 3RJPA 3DCFA 3MKZA 2ZXJA 4ZZLA 3TL4X 2K9MA 2D45A 3EPZA 1YS6A 4JQFA 3RYRA 4BJ5C 2KIMA 2VN2A 4QLCU 4G6DA 3T8RA 5CQGA 2QBYB 1ODDA 1F36A 1BN5A 2K86A 4IOAF 1EH7A 1JTXA 2IGNA 2Y69H 4U0VA 1BA5A 3BZ6A 2LSOA 2R7ZJ 2X6WA 1R5HA 1TT5B 1I27A 2M8EA 2H27A 4NDLA 4BQAA 2OQRA 3ABKH 4I7HA 1SFEA 2E60A 3A0BC 5JVGF 4FE7A 2AXLA 1YJWI 2F4IA 4AWXB 4G7OF 1SD6A 2DA3A 3KIOA 3K70D 1AHDP 2RV8A 1ETOA 2JRTA 1PUFA 1W1WE 3BTCA 3H1CA 1ERDA 1ORKA 4HYEA 2MW8A 2P5VA 4HSTA 3CO7C 4I0AA 1YTYA 2F48A 1KZHA 4AYBN 3IHUA 1VF9A 1FTTA 1APLC 1RZ4A 1X3UA 2M7BA 3UNGC 4I02A 1BR1A 4PFPA 3A03A 4DGWB 1Y0NA 2LOOA 3VYSB 4IHWA 3IAS2 1G6NA 1D0ZA 4S0HB 2L02A 5GPCA 5J8CA 5FB2A 1YYVA 5L3GA 4A5NA 1Y1WJ 1PUFB 5LLQA 2XAFA 1W0TA 5C4XJ 2DPDA 4ENMA 3E1SA 4GYIA 3Q0VA 1GV2A 5J3LA 4MTDA 1TQIA 2VJ5A 3C7JA 4M73A 1TWFJ 2P4WA 2XSDC 2ZKZA 4OOIA 3L2UA 2VKEA 2PBIA 1HF0A 3N97A 1ETWA 1IAWA 4EM2A 1R4MB 5E79C 1I6HJ 2PX9A 4RGUA 1Y1VJ 3NWSA 3KYDB 3W2WA 1TQMA 1MBKA 2X0LA 4FCYA 1MDMA 2ZXIA 2H09A 3Q9VA 4Y33A 5FKOA 3SZPA 3GBGA 4BBRJ 3OYNA 5B66C 1FT9A 2BZTA 4PJ0C 3CCYA 2F4OB 1D0YA 2M0MA 4KITB 3V7CA 1EH8A 2LLKA 1OLTA 1DGRM 3L2VA 3FXUA 3CCMI 4A3LJ 3H5AA 5D5WB 1ENHA 3ZMDA 4WWCA 4GXOA 2LVSA 1UHMA 2VQLA 4BDYA 4C3IJ 2A6HF 1O3SA 2OC6A 3RZOJ 1ZAOA 2XC7A 4JX5A 3M8EA 2FJ1A 1MDMB 5CVUA 1TC3C 1HC8A 2BEOA 3H3UA 3LSTA 4NC7A 3F22A 2QVOA 2HDCA 4M3BA 2EIJH 1A04A 3M1EA 2LKPA 3B6CA 1PVEA 3KZZA 1X1PA 4KISA 5L3FA 1R58A 1N75A 2YSRA 3HSRA 4YIFA 1YJNI 4ZYHA 1UAAA 1JI8A 5JVTA 1IRFA 4MGRA 2DT7B 3S1MJ 4DYQA 1X4PA 1ON2A 1QU3A 4A3IJ 3PQJA 3S93A 1MJBA 4I98B 5HDGA 4RGRA 1POGA 3GTJJ 2XPUA 2Z2SB 2HVRA 3ASOH 4RAZA 2DFHA 1R4NB 5HNFA 2VBZA 2L9NA 3BG5A 3RDIA 4HAMA 4I09A 3HBLA 1SAXA 1X1DA 1NG7A 1XN7A 5F04A 4EM1A 4A3JJ 2ZO4A 3AL0B 2A3SA 2TCTA 5DM7F 3BZKA 4Q47A 2EPFA 1JT0A 3I64A 4Y52J 2PMZA 1JJ8C 3ZN0A 2R7OA 4CCNA 4R1HA 5LGNA 1S7AA 1XPXA 2XDVA 3L2QA 3HZJA 1WKMA 5C44J 4IF4A 3DPTA 2XRNA 1LDKB 4E4HA 3RSNA 3JRFA 4HNTA 5JLXA 3MKLA 3OYCA 1FPQA 5CKTA 5J47A 3L2WA 2NVUB 1X1AA 3ZRGA 2DDBA 3VEPA 4M72A 4PDKA 4V2FA 1WJ5A 3I59A 4X1EA 4RM2A 1BW5A 4XORA 2CV2A 1UB9A 4M3GA 2YR2A 4BAYA 3F6VA 1O3RA 2W82A 1FIPA 5EYRA 3CJNA 1VZ0A 2VXZA 2FXAA 2L4MA 1VQLI 1K4SA 3ABMH 4BU2A 4HQEA 2QEXI 1SEUA 2GOXB 1B9MA 4LLGF 2FOWA 2C6YA 3C18A 1Y6IA 2JSCA 1M1EB 1MGTA 2L4AA 3GW2A 5CVJA 4RB1A 4XMYA 4P55A 2P7CB 3I59B 1QBJA 3GUDA 1RUNA 4HQMA 3DKWA 3BR1A 3GFIA 2NS8A 1H89C 2LRDA 3OMYA 5L3DA 1ON1A 2BBYA 3FZVA 4MFEA 2EV5A 4HV5A 3C1DA 2XGCA 5TRDA 3HL2A 4BNCA 1WH5A 4AD9A 3OSFA 3BLYA 4PJLA 2CMPA 1H88C 1A35A 2ME6A 2DT5A 2K02A 3HKZN 1IRGA 4DJAA 5B1AH 3GVAA 3RZDJ 4EJWA 5ICEA 5HDNA 1Q1HA 3DLLF 2MH2A 4E7JA 2KT0A 4BE1A 1RR7A 1GVJA 4AVZA 1H8AC 2HQNA 1P4AA 2WAQA 2XV4S 1BBYA 3WG9A 5J1RA 2CO5A 1HKTA 5K7FA 2E5NA 1IO2A 2WWYA 9ANTA 3L2CA 4AIJA 1G4DA 2F5VA 4HSRA 4JX6A 1R1UA 5CPRB 2DMUA 2BY2A 3ML6A 4KUMA 1SVOA 4RB0A 1T08B 3RI4A 3E6MA 3P9CA 4CA0A 4CYDA 1I1SA 3SDBA 2VB6A 4C9YA 3SDGA 1OQYA 2ELKA 3BJAA 1IF1A 4PJJA 4LG0A 1ZLKA 2CV0A 3AG1H 2ESHA 2MLGA 1VQ8I 1D1CA 3H36A 4FX0A 1SD4A 1SANA 2KL4A 5GAHJ 3FWEA 3JAMK 5KHDA 2L01A 2Z99A 2W1OA 4DIQA 5BPIA 3HHGA 5HVQC 1Y8RB 1XGMA 3JRAA 4CXFA 2VXDA 3FBNB 3EQLF 2FA5A 2P0WA 2CQKA 2W85A 2ECBA 2HQRA 4B3XA 2HVQA 5DS9A 2FNPA 2O8KA 3MN2A 3RKXA 4LG0B 2RREA 2HXOA 1Z7UA 4D5CA 2COMA 2QF7A 2GWRA 1SVMA 2UV1A 1V5FA 4PJNA 1Z21A 5C4JJ 3BG3A 2K3FA 4M9SA 2Y0SA 2EZLA 4XKBA 4EGYA 3PUFA 1QVTA 2OAZA 3FXRA 2F5EA 4L9VA 1X3ZB 1X58A 4A69C 2KJBA 1O4XA 5FKNA 2DMTA 5KK1A 4RB2C 1XDUA 2RAEA 1IG7A 3UR3C 3C2GA 3F8CA 3H3VK 4BXXJ 1MJ9A 3V7RA 1R1TA 2CYYA 3DU6A 3OIPA 2O0YA 3ZMVA 4PSXA 2D1HA 4HNUA 4OMZA 4XOTA 2K5CA 1X2MA 2CFXA 1R1VA 4C3JJ 1IV8A 2DA7A 1FSHA 3WTYC 2H6CA 2E5ZA 2DBBA 2XSJC 2FE3A 3CC4I 3OIOA 4M9ZA 3ERED 1OCCH 2A6EF 2WY8Q 3LMMA 2VLAA 3E5QA 1H9GA 2NOGA 5LEKA 2YUSA 2QM3A 2Y2ZA 4GO1A 2CQQA 2JA2A 2RDPA 4OAYA 1MBEA 4PJMA 4RAFA 3TDZC 3TOBA 5F0HA 4HF1A 3M8JA 1ZARA 2GQQA 3GZ5A 3Q5FA 3LWFA 3QYEA 2CGPA 4RGSA 2X1DA 4F7ZA 2STWA 1VQMI 3VSKA 2NXNB 1CGPA 4PK4A 3IKTA 1MBGA 4A3BJ 1QNTA 3GTOJ 1U8RA 2UWMA 2IGKA 5EEGA 2VI6A 4N0BA 3F23A 3OIQA 2PJPA 1OCRH 4D7MA 1WZ2A 2F5DA 3CCSI 3U1DA 2V6EA 1QHGA 3QQAA 1QGPA 1TWGJ 5HNHA 2R3SA 3HPHA 2R7XA 2KZGA 1BR4A 1YLFA 4PCQA 1Z05A 2HZTA 2VBWA 4LB6B 5E8IA 2EFWA 4A3FJ 1JKQC 5D4SA 4B09A 3TW6A 4B4CA 3P9KA 4F92B 3BZCA 2VBYA 3E0JB 1D5VA 2LKXA 1BI3A 5BOXA 3WE3A 4K2EA 3PO3J 2HU9A 4E70A 5IT9K 5K7ZA 3PNTA 3MMYB 5E8GA 3QPLA 1P9QC 2XPVA 1F1ZA 4AC0A 2PLYA 4BKXA 3ECOA 2A5YB 4PSWA 2EZIA 1UCRA 1FOYA 4RS8A 2DYSH 4NUBA 4HLXA 4LB5A 1YIJI 4ZH4F 1SD7A 2XKPA 1D1BA 5IYDJ 2W84A 1SD5A 2O3FA 2X85A 3S2DJ 2IW5A 1X1CA 2GA2A 2M2EA 4F55A 4AYBA 3HOZJ 3K1MA 5B3SH 1OCOH 3KX2A 2HQ5A 2M87A 2H94A 2I10A 3G73A 2IEKA 4AVPA 3WE2A 1FBSA 2DQLA 2OD5A 3BQYA 2V79A 3J80K 1R23A 2L7ZA 1Z3YA 2ACJA 1Z1DA 3J7AY 3GMEA 4ENJA 5E1WA 5D4RA 3OYDA 3QAHA 4CZZA 3GWZA 4XICA 2VJJA 1J2XA 3HIFA 2L9RA 3TP3A 4MO7A 2CW8A 3MAJA 3I58A 3IKVA 2NAZA 4HDUA 4RDUA 3GX4X 2FEZA 4U7BA 2OA4A 3WGIA 1X1BA 3ZPLA 3U21A 1U78A 2HYFA 5F1RA 3B6AA 3R6SA 4HW0A 3HDDA 1RPWA 3U1KA 4DYCA 1FWZA 3I0TA 2LTPA 1W5TA 2BV6A 2FQ3A 3FK6A 1GUUA 1IN8A 3I71A 2K9NA 2K7LA 3VYRB 4ZZDA 2JZYA 2F5CA 4YIRX 1MZBA 2ZXHA 4U0WA 1K4TA 4IQ4A 4L0YB 4HX8A 3COAC 2LG4A 2DPUA 3K4NA 4YFNF 1W7PD 1VQPI 1WFXA 1A36A 3K0LA 5F64A 2QSFX 5EEHA 2O7OA 2DW4A 2OQGA 2CJJA 3L1PA 4EATA 2X4HA 1P7JA 4DNCA 4ITVA 2IGMA 3A2KA 4EQQA 5JLWA 2BY3A 3RQIA 4BE0A 4ZYAA 3V8LA 3ZMUA 1TWCJ 2Z5UA 5DM6F 1XGSA 3L2RA 4BJ6C 1J09A 2QSHX 1E2XA 1LDDA 3T8TA 3CMMA 4H4KC 5H6QA 3G3ZA 3GEZA 4RM3A 4YFKF 1H0MA 4IHXA 2ZSIB 2ID3A 2ZJRF 2IA1A 5B5EC 5J40A 5A2QZ 3JCUC 2VPLA 1W5CC 3P5JA 5LHIA 1IRZA 3S1RJ 5HLTA 3IL2A 1G8XA 2XPWA 5DUIA 1TTYA 4A6DA 2HOEA 5KNLA 3HEFA 4DBQA 4EEFG 2NNNA 3JRBA 4BH9A 1YE9A 2WBMA 3I9V2 1X3WB 4WXDA 3QODA 3X2QH 1WJCA 2HEOA 1BOAA 1KONA 4GCVA 3Q0UA 2XHKA 4J19A 2X6YA 3RCOA 3JAMZ 2R92J 1HKSA 1TL8A 2CW0F 2V9KA 1T2KA 1T98A 3DFGA 2JA5J 1RIOH 4ON0A 1C0WA 4IRGA 2CV1A 2K9QA 2IAIA 3JR9A 2LYCA 3IH2A 3CP8A 4FASD 1T56A 1HSTA 5IOZA 3S3MA 1YI2I 4L5JA 1KYZA 2DFFA 1WVRA 3GZ6A 5LGUA 3H0GJ 2DJIA 2FU4A 4KMUX 4Y4RA 5D5VB 3D1NI 4HPQA 5D8KB 4UUTA 3L09A 3HTSB 3M3YJ 3IRQA 3BDDA 4A3MJ 3LFUA 3D5SC 1MSFC 3MKYB 1T6SA 2JVGA 2UXNA 5GAGJ 3ERMA 3CF5F 4FX4A 1Y0UA 4G7ZF 3CTAA 2QSGX 3SHFA 4YEJA 3BC8A 4BY1J 5H2FC 1BI0A 3IH3A 5EZHA 2IXSA 2OV7A 1AA7A 1FMVA 2K9SA 3E97A 3OYKA 3TGNA 3HRTA 2EWNA 1FYKA 4HDVA 4OINF 2P5LC 1FOXA 4BY7J 2B63J 2OZ6A 2IA2A 3VODA 2RKHA 4IKFA 4Z2YA 3H0DA 4IQJA 3S2HJ 1MBFA 3PO2J 2W7NA 3F8BA 3I56I 3G4SI 1RR8C 5JHFA 1WPKA 2L7KA 3K4KA 4W97A 2JQ7A 2HQAA 3FMQA 3QYBA 2Q0OA 2KP6A 3GFMA 3H9JA 4UVAA 2LKSA 2NVTJ 1QA6A 2HTSA 5EJCA 4ASNA 2V6CA 4C2TA 1YG2A 3UKGA 2XB0X 3Q9SA 2JPCA 2VOOA 2ISYA 2ECCA 5EDNA 3GTKJ 2E7XA 3CJRB 3D5LA 2ZMEC 5M3MJ 2EINH 2ZBKA 3RPUD 4AU7A 1V5EA 5J8FA 2JJ7A 1ZN2A 2EBIA 2FMYA 5E3OA 4B3AA 3ZQQA 1PDNC 3ELKA 2L54A 1XSXA 4A93J 3PL8A 1IJWC 2ME0A 5DV5A 3TMOA 4R79A 1PP8F 3CLOA 1D8JA 3SEQA 4XOPA 2ESNA 2QQ9A 4LD5A 5IT9Z 1I39A 3B73A 1HQCA 4NC8A 1UFMA 3I4MJ 2VE9A 4M3FA 2H8RA 3LSKA 2DN0A 2OCCH 2PFBA 3IH4A 3FXLA 3OYEA 1U6GA 2WTEA 3TKYA 2X1EA 2R5ZA 3KEQA 4DZJA 5J4YA 1HW5A 2BVLA 2NVQJ 2BGCA 1YITI 3BY6A 3QU6A 5CLSA 2JTVA 1W7PA 3I3LA 1KGSA 1IRXA 3PM1A 2Y0MA 4HRIA 5FLVA 3VFZA 1DU0A 3ZCOA 2I8DA 3FM5A 1JKOC 2DFIA 1W36C 1OCZH 1MMDA 3FXMA 5HS8A 2FOKA 3J80Z 3AG2H 3BR2A 4C2UA 2R5ZB 4FE4A 5C3EJ 3A4CA 3JTHA 1CF7A 2WV0A 4GGGA 3KFWX 2M9HA 3J7AO 1ZGWA 3K4JA 3VB2A 2FRHA 5FD6A 2R7QA 4X0GA 1W7PB 5L3EA 1YW8A 4Q4ZF 3JRIA 2IRFG 3N4MA 1X4OA 3PQKA 3K2AA 2LH9A 2ELJA 3E6DA 3R61A 2V1XA 4XR6A 4M71A 2E1MB 2JWTA 1T33A 1ZYRF 4BHPA 1YFHA 1BIBA 1YQAA 4PZJA 1TWAJ 3L00A 1Z77A 4KYWA 2BXZA 2HKXA 5JI6A 2NYXA 2O5RA 5FKLA 4CZCA 2ZMEA 4BE2A 1CF7B 2EFNA 2LMDA 1FBUA 3LSHA 2XF5A 1DP7P 1U0JA 4OU0A 1NTCA 3CP2A 1JKRC 1JJ6C 3OS2A 2KKOA 3LSGA 1J0RA 2XVCA 5F6FA 1V4RA 1RKWA 2A07F 2VT3A 4RLQA 3O6BB 2KIFA 3Q3SA 4S04A 4ZDOA 5BMZA 1FMWA 1DDNA 2ZMEB 4KNYA 1G3TA 2IJLA 2L0KA 3WTUC 1BJAA 2V1DA 3HG9A 1MNDA 3P9IA 2M5WA 5LD2C 4U87A 5D6FA 1QVUA 4LK0F 3WGGA 4V19K 1UELB 4E7LA 3GTQJ 2DK5A 3OWTA 3MVPA 2XAUA 4QSHA 3BP8A 2KFDA 4AIDA 2DODA 1VI0A 2BY1A 5FD5A 4M9XA 4EM0B 4PGHA 2DO7A 3JRCA 2JVHA 2CS3A 4KFCA 3K70C 1IDYA 2KHMA 1TW2A 1IDZA 1E17A 2XIGA 4P9UA 3OY9A 2EH3A 1FIAA 4OWRB 3WU0A 3ZXSA 5ILVA 1BOBA 4N9HA 1LDJA 1A31A 2GOMA 5IOYA 1B72A 3CF2A 1KU7A 4IXAA 1V55H 2CFOA 2HVSA 4WF2A 1P2FA 4M74A 2UZKA 3HSFA 3ZQLA 2VT2A 2WADA 5ILUA 2VUMJ 1U5TC 4IX7A 1CQTA 2GA1A 3K4LA 4F93B 3OYLA 5FRNA 2R5YA 3EYIA 1XX5A 5LHHA 3V42A 1RRJA 4U7DA 1EJ9A 4Y13A 5ERIA 1MMSA 4CHUA 3QOPA 3SZTA 4IRHA 5DTDA 4AIKA 3RPUA 1B72B 2AS5F 4Y17A 2O8XA 1K61A 1ZRDA 3GF2A 4BHCA 4CH7A 1K78A 5ICCA 4YELA 5IP7J 1SAUA 1V3FA 2XASA 3S3OA 2OTJI 2JRMA 1B4AA 3QU3A 1ZLJA 4RMNA 1BC8C 2HGCA 2X9DA 2ZXWH 3ZR8X 5EG0A 1W0UA 2B0LA 1YX3A 4FHTA 2IT0A 5F0FA 1T0FC 2R5YB 3G1OA 3CC7I 2M7AA 4IO9F 1MNEA 3KYLA 2DCEA 1AWCA 1R36A 1WI9A 3DP7A 2AXTC 2GZWA 3VDXA 4XKVA 3HSEA 2PMUA 2LF8A 3EUHC 1VQ6I 4RAGA 1K78B 3PUBA 1IN4A 5IT3A 3HRUA 2W00A 1YS7A 4L9TA 1G3SA 1LVKA 5EG0B 2EFPA 4IHTA 1YRNA 1JGSA 4ESJA 4R8HA 1BM9A 4S05A 2P81A 4JBAA 1YIOA 2ID6A 3NWTA 4HX7A 5FJ8J 3KCCA 2VQCA 5DD8A 2N8GA 3R4KA 3OL4A 1EF4A 2CQXA 2IBDA 1ZG3A 2G9WA 2KDOA 4MNUA 1S9HA 3OOPA 2QYOA 1NHAA 4LOCA 4HF2A 1ZH5A 1G2HA 4XLAA 2FX0A 4BXFA 5GTIC 3F3XA 1MH4A 3TO7A 3AKZA 4KT6A 4L9JA 3I4NJ 4CO8A 5A2QK 3FMSA 1J5YA 2HXIA 1D5YA 2Y9ZA 1YRNB 3BTIA 2NVXJ 2UXXA 2HI3A 4IHSA 2QKLB 5E20A 3E6CC 2QWWA 4BQNA 3DPUA 2GXBA 4FISA 2HZDA 2IA0A 1MMNA 3FF5A 1XSVA 3S8PA 5K5QA 3A02A 1T38A 2L7MP 4O5VA 5EZGA 2P6TA 4NHJA 5TISC 2V26A 4GRIA 4HG2A 2R7FA 2I5UA 3CESA 5L3BA 1O3QA 4JOMA 2KISA 2AO9A 2M34A 2K4BA 1HSJA 3LA2A 4M6XA 4UV9A 2PI0A 2NOJB 2KQRA 3JTGA 1HW1A 2AQEA 2IP2A 1ZG1A 1QHHD 4XIDA 4BBSJ 1K6YA 4N4OB 2JPBA 1A6QA 3KE2A 2JUGA 2ZFWA 2B9SA 2VKHA 3OS0A 3O2PE 1BJZA 1SMYF 1WH7A 3ABTA 1D3YA 5E17F 2E2IJ 4CICA 2OJED 5CJ9A 3CCQI 1VQ9I 3K1PA 2Y75A 2TRTA 3DTKA 1DP3A 2E71A 4BDZA 1G59A 4UNOA 1OYIA 2V4JC 2PQ8A 4PUSA 4ANJA 4D9JA 3LAJA 4A3CJ 2EQRA 3IRRA 2RNJA 1S6LA 5AIQA 3PJRA 1LFBA 2R7SA 2M30A 2DA5A 3LSIA 2VQGA 4XLCA 1YW9A 4I0BA 5BQTA 3HRMA 3G1MA 3BCBA 4CUGA 2XAQA 3K2ZA 1R9TJ 3O8GA 1G3WA 3EETA 3ONQA 4XLEA 3VSLA 2WAFA 3H5RA 2GXGA 1ETXA 4UHTA 2A68F 3BJ6A 3DEWA 1ACIA 1JGGA 3HPGA 3I53A 3ZGKA 1LQ1A 4AM3A 1A6IA 3QRFF 2IS2A 4XBFA 3V8KA 3FHNA 1IN6A 1FSEA 4UVCA 4E7KA 5FROA 4DOZA 1IN5A 2X48A 1IUFA 1WJFA 4UXNA 3J81Z 2G7UA 3RKQA 3H35A 1O7LA 1XG1A 1EV7A 2FD5A 1UG0A 3S1NJ 2NS7A 2FUG2 3BTJA 5LRSA 2OTLI 4L9NA 4RGXA 2LY9A 1MKMA 3MEXA 3DF8A 2VC0A 1IGNA 3HGGA 1IC8A 2HS5A 3BR3A 2CUJA 5F08A 3VPRA 3V7SA 5DUKA 4BJTA 2CRGA 1V54H 3HRSA 3KP3A 1JUSA 3PNVA 5CVVA 4Q48A 4BUPA 3GLXA 4RA2A 5D6EA 5K1YA 5FRMA 3F0CA 2J5PA 5E3LA 2EA4A 1N77A 2DOEA 4II3A 5L3CA 3TO9A 3LSRA 4A12A 2GBYA 1GXQA 2X1CA 2M8GX 2R7DA 3M07A 3WTSC 3K4CA 5D5UB 4JYKA 1WI3A 4ESBA 2DTRA 1HA8A 4UV8A 1Z6TA 1T8IA 4LJZF 2DA1A 3OSGA 2WA0A 4KN7X 2E1OA 2WV1A 2PMZN 3KEOA 1TT0A 3GFLA 5LGTA 3CCLI 1XMXA 4G9YA 4YRVA 4RBOA 3R0AA 3DPLC 3TEDA 2LR8A 3B02A 3G2BA 3L9FA 1RUOA 1IXCA 2K4JA 3T5XA 1RKTA 2XUBA 2MYSA 3ZQHA 2PN6A 2R0QC 2WAEA 3ZQIA 1OR7C 2A6TA 4W1UA 3IC7A 2RN7A 1N25A 1OYYA 3ISPA 1R49A 2QA4I 1U8BA 1H9TA 2DU9A 4BS9A 2HOTA 2IS6A 3WHCA 1Y56A 4G6TB 3GTPJ 5IYCJ 4E7SA 3K4BA 3M8FA 4XRMA 1SC7A 2GAUA 3IWFA 4XKWA 1Z3XA 3FIWA 4EV0A 1RETA 1P6RA 2Q1ZB 5DEQA 1GLNA 3ABUA 3MCZA 3V4GA 3FMRA 1U9OA 2R7RA 2V7FA 3MWMA 2OUMA 1ETQA 1PJRA 4A3EJ 2HDWA 2XF7A 5LBQA 1HDPA 5J1UA 5HS7A 2PMHA 2MLKA 3MD2A 3JW4A 3VOEA 3M1CA 4XLPF 1AU7A 3BR6A 1HDDC 2CUZA 4CGZA 5ICGA 4HA8A 2OPTA 5M3FJ 1BI2A 1ZRCA 1F5TA 1I5ZA 1V5GA 4KMFA 2Y31A 4HBLA 2OF7A 3T0YA 2BOLA 4U0YA 3CCUI 2XGDA 4B48A 4D0PA 2DYRH 3IUOA 2ZCWA 5DDGA 3JRGA 2CQ7A 4LG3A 2PEXA 2MC3A 4I6ZA 1VQ5I 3IP4B 3CUQC 1LPQA 4J00A 3BG7A 2P8TA 1A5JA 2QZ8A 1KU2A 1X19A 2E19A 3DEEA 5CVIA 3CMYA 4KICA 3WG7H 2OBPA 1WGXA 1DGWY 2QUFA 4B1RA 1XD7A 2RQPA 3BR0A 3U2RA 3G6EI 1IW7F 4A0XA 4CYCA 4G12A 5AIPA 2KPMA 3DBRB 5EF6A 5IP6A 1QPIA 1FYMA 2HFHA 1PUEE 3CO6C 1E0EA 3ZQCA 1HCRA 4UB6C 5FLMJ 1O7FA 4A3KJ 4A5MA 4PGGA 4HOBA 1TZLA 6PAXA 1HOMA 4MIMA 1XSDA 5M5WJ 2LFBA 3LNQA 4DBRA 4CCLA 2Z3YA 5K5RA 5M5YJ 2VODA 3FHZA 1NK3P 1ZR2A 1KYWA 4CYCB 3I55I 3K9TA 1KQ8A 2YPRA 2DJNA 1JKPC 2CG4A 1J75A 3PIOF 3DQVC 4BYYA 2VJIA 1Y39A 3KP7A 4XN3A 1AKHA 2DT6A 3J7YJ 2P6SA 1YW7A 2NS0A 1XB4A 1RC9A 5EEAA 3VWBA 3ZMTA 4ENNA 3KYCB 1IN7A 1SVLA 1HXDA 2PJRA 2EV6A 2UUZA 4LLNA 1LNWA 2JA7J 1ETVA 1MW7A 2ZFUA 2VIXA 4O6JA 4BXUA 2VJ4A 1D8KA 2DK8A 4OIRF 5CVRA 3H9GA 4P9FA 3HOXJ 3H9QA 4MHGA 2DQRA 3MQ0A 3E5UA 1AKHB 2BHYA 3HYIA 4E7ZA 1B6AA 1W4MA 5KVRA 2E1CA 3DXJF 3ESWB 3JREA 3GTMJ 3A01A 1J9IA 2GLOA 1NK2P 1KQ0A 1IXSB 2IS1A 1WJEA 1HW2A 2PJRB 1IXRC 2P7VB 3HKZA 1ZGAA 4LIUA 2CSOA 3CDHA 5K7HA 2CUEA 1VQ4I 3JRDA 2L9VA 3GXOA 4B44A 2XROA 2DFEA 4OIQF 3KEYA 3ZQGA 4QIWN 2M1BA 3LSMA 1XMKA 5FFXA 2F6CA 4LFUA 4ABZA 3F21A 1S8NA 1FP1D 3QPHA 4CCKA 2LREA 2XGEA 2IPQX 4L18B 2DI3A 2RQQA 2H6BA 4G6QA 2LNBA 5EGOA 3A01B 5B1BH 3DLAA 4KDPA 1LFUP 3BROA 1XCBA 2KLOA 1NG6A 5J4VA 2Z16A 2L9SA 1FNNA 1FJLA 2LBFA 1O57A 3WODF 3LSPA 1QPMA 2VE8A 2K27A 3BCAA 3E3VA 2D5VA 4RLFA 3REOA 2FNAA 1J59A 1FC3A 3HB9A 4ESFA 3RIRA 2W24A 2KRCA 4MLOA 1K79A 3S17J 5K5OA 3KPHA 2IGOA 3K69A 3LA7A 2YU9J 4FQGA 4A0YA 5EGOB 3BTLA 3OYAA 1MD0A 2RVCA 5DD4A 4ZC3A 2H1KA 3AL0C 2EJRA 3FXJA 2V9VA 1VQOI 3GCMA 1IV6A 4KT5C 1PP7U 1P92A 2FSWA 1ZK8A 2BY0A 3CCRI 1R5ID 3W3CA 2LBFB 3TW7A 2FQ4A 2EA2A 1JT6A 2RNGA 2B7EA 3CDIA 3KZIC 2FF4A 3FM3A 2K85A 2JK3A 2DMNA 1FX7A 4E7HA 2A5WA 5M5XJ 1XS9A 2DOAA 3G1LA 3ZQ7A 4D5FA 3CC2I 4LGWA 1TP4A 4A0ZA 1Y8QB 5GTHC 2R7UA 3BPXA 4CDGA 3K10A 1FTZA 2O6GE 4XRSA 4NQWA 3WTXC 1KA8A 2YX4A 4EVIA 2VQHA 2W25A 4BHBA 4KJZA 2W48A 2D1VA 1XTAA 1OYWA 2KIUA 3TQNA 3RTRA 4ZYDA 3TP0A 3EUKL 2R7VA 1DPRA 3A0HC 3W2VA 3BPVA 1LKXA 4L0ZB 5IPAA 3JRHA 1VQNI 4C30A 1ETKA 2DA6A 3VYUB 5D8LB 3OV8A 1Q1VA 4G7HF 1EH6A 4EJTA 1E3OC 4CCOA 2JUCA 1EKEA 3GFJA 3OOUA 3W6KB 1RI7A 2M4GA 4WX9A 2VKVA 5HLHA 3QPTA 2JMWA 1Z0XA 4YG2F 2EZKA 4UUVA 1WJBA 4ZTJA 1USSA 5FLXK 4NQWB 4U88A 3J81K 3HJEA 3OS1A 3GTGJ 1SFUA 2EIKH 2LC2A 3BG9A 2L2OA 3J7ZI 2HWVA 2VONA 2ZJQF 3BOQA 1MBJA 2Y48A 5GP9A 1I3AA 2QCOA 2R7WA 2K9LA 4KA4A 4IL6C 2HYGD 3GLLA 4TV7A 2HKOA 2EV0A 1PYVA 3V8JA 3OR2C 3HOSA 4DW6A 2CQNA 2ZNZA 3ECHA 4N4NB 4RAYA 1UJ8A 1FOKA 1FBQA 1R22A 1W5SA 1ULYA 3DTEA 4RB3C 3IV5A 4ZDPA 2FBIA 3KLNA 1SMTA 1K83J 3A1YA 1JHHA 1OCPA 2M3AA 2NNYA 3S2WA 3DTIA 2MD0A 1R7JA 3NARA 1GXPA 3F8NA 4IHYA 2P5KA 1USTA 2NRAC 3QPSA 5ICFA 4M3DA 3VYTB 2BXYA 4PFOA 5LFAA 5H6RA 2NVYJ 3CCVI 4IEJA 3W6VA 1LJ9A 1R5GA 3PFYA 2EFQA 3MZHA 2PG4A 3MFKA 2M45A 3FXOA 3WHBA 1R71A 1GHCA 2R7TA 2DMQA 1MIJA 3C2BA 3KP2A 3SQNA 1WRJA 2DA4A 4B8XA 2RC4A 2COBA 3E7LA 1BR2A 1ZGJA 4NBQA 1REPC 4YIIA 1Z7LA 3QOEA 2OCEA 4XRFA 4MTEA 4A3GJ 1LEAA 3ZP5A 4ZYEA 4P5OA 2QQ8A 1B8IA 3DU5A 1JTYA 3LL7A 4HNVA 5BNGA 1MNMC 1U2WA 4WXCA 5H20A 1JXSA 5J1YA 2WB1N 2V1NA 4MFDA 1SFKA 2ZJ2A 2ZC2A 1ZELA 4LK1F 3LQRA 4O3MA 1YOVB 2LK2A 2EZHA 2LF7A 2GIZA 5TGTA 3H3ZA 2E34A 3EDPA 1Z91A 3WGHA 1ZTRA 2MA3A 3SXYA 5F0CA 4EGZA 1T39A 3M9AA 1OCTC 2HTJA 2BW3A 3WTZA 3DBLB 1BIAA 2CH0A 2HYJA 1B8IB 1I6XA 1SFXA 2DLLA 2ZSHB 3RKWA 4EJVA 1EA3A 4BEHA 4Y15A 2XAHA 3BT9A 1WHUA 2KMUA 1NH3A 4AUXA 4A2UA 2MGQA 5HODA 1WJAA 4XQFA 5TJJA 2RGVA 2E36A 1JE8A 3QWLA 3ZMSA 2W57A 3DKXA 1L3LA 5F27A 2BW3B 3R60A 1WSUA 5CYVA 3W2AA 4BQOA 4H0EA 2HOAA 3QYFA 4WXHA 1FY7A 2ICWG 4A6EA 3E5XA 4BEHB 5E1ZB 4Z6YA 4BGDA 3O8HA 2HDDA 1BI1A 2QQBA 1SFOJ 2FMLA 2A69F 1AOYA 1U5TA 3CQZJ 1RNLA 1BL0A 1FZPB 3L7WA 2MSYA 4OIOF 3F9KA 1ZHFA 2DOFA 3HOWJ 5FGMA 3GTLJ 1U3EM 2KRFA 3M4OJ 2DDAA 3OYMA 2G0EA 2L5QA 3KLOA 1UZCA 1BC7C 5E1XA 3D5RC 3OYBA 3CJTB 3FDYA 1E3HA 4I76A 5DCFA 2ZJPF 4Q5SF 4CCMA 1TWHJ 2MD5A 3E6BA 1ZG5A 2L7FP 3NEUA 4JK1X 4KIGA 1U5TB 2LDUA 2VOPA 2AQFA 4HLYA 2BYVE 4I01A 1T0FA 3FXQA 1U9NA 5IY5H 3OYGA 1RESA 5FKKA 3BG6A 2YU3A 4E6KG 3HUGA 1Z6RA 2Q2EA 3BQZA 1LVAA 1UHWA 2CW7A 2VBXA 2Y9YA 3LQQA 5FFZA 4ZTFA 4C3HJ 3OYIA 2D2WA 3S1QJ 2ETHA 1FYLA 1F4KA 4QWQA 1QQIA 3DV8A 3MZ8A 4HEA2 4KIFA 5ED4A 3I4PA 2Z33A 3EUHA 3AAFA 4XKCA 3ULQB 1KU3A 3WU2C 4XONA 1STZA 2E1NA 3F8MA 3BJOA 1FEXA 3GYHX 2A05A 2XKOA 2WC2A 4HV6A 2HNHA 3HC7A 5ILSA 3ASNH 3BWGA 3HUGB 1TNTA 2Q2EB 3CZ6A 1YHQI 3F72A 2KJCA 3HTUA 1XGNA 4Y7NJ 1VFCA 4GFBA 2KZVA 4UY8I 4N9IA 3DEUA 4ZJZA 1OISA 3D0SA 3FXKA 2G7HA 5J6XA 3P7NA 3ZMZA 1VTNC 4UB8C 4X6AJ 5KCMA 3CCEI 5FLXZ 2H8WA 2JSPA 3H5NA 5IYBJ 1WJDA 3LOCA 4DZPA 4M6VA 1IUYA 3WTTC 4BACA 2ELHA 1YJ9I 1N78A 4P96A 3S15J 1KU9A 3GZNB 3OR1C 1S29A 5LHGA 2HOSA 1T95A 3NRVA 1GV5A 2YS9A 2ADUA 3ZN1A 2X51A 1S7EA 3DKYA 3CMEI 1JUMA 1TW3A 2O9LA
chains in the Genus database with same CATH topology
2LKSA 2KFDA 2B7EA 2K85A 2KZGA 2L9VA 4FQGA 2DODA 2DOFA 2E71A 2KIQA 2KISA 1UZCA 2CQNA 2DOEA 2JUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKS A;  2KFD A;  2B7E A;  2K85 A;  2KZG A;  2L9V A;  4FQG A;  2DOD A;  2DOF A;  2E71 A;  2KIQ A;  2KIS A;  1UZC A;  2CQN A;  2DOE A;  2JUC A; 
#chains in the Genus database with same CATH topology
 1KQ9 A;  1WQ2 A;  4HX4 A;  2Q8K A;  3HGY A;  5HDK A;  1VQK I;  5AON A;  4I2O A;  4B47 A;  2Y30 A;  1TBX A;  4XK4 A;  3OL3 A;  2JA6 J;  4Y3O A;  5JHU A;  3C2H A;  1MSE C;  2XF6 A;  4XRS G;  2XB5 A;  4D7N A;  5FKM A;  3SFI A;  2LP0 A;  4ZDL A;  1XDS A;  2O03 A;  2EK5 A;  2MBF A;  3RYP A;  5E3M A;  2BVM A;  1P4X A;  1UMQ A;  1BW6 A;  4G8X A;  2QQA A;  3TOA A;  1OMI A;  2BHZ A;  3AG3 H;  1ZKG A;  2EIL H;  3S3N A;  5CQE A;  4I99 C;  5KAF C;  1GDT A;  1OFC X;  4IPA A;  1ZRF A;  1HKQ A;  3OYJ A;  2K3P A;  1F9N A;  4JP0 A;  2MAB A;  4KIB A;  2JT1 A;  1L0O C;  4IOC F;  3BR5 A;  1TLH B;  4IJA A;  4OAZ A;  1ETY A;  2MC4 A;  3S32 A;  5E18 F;  1I1G A;  1FLI A;  1LEB A;  2GXA A;  5DCM A;  3O3K A;  3GO5 A;  4L5I A;  2QLZ A;  3F8F A;  4XNF A;  4J01 A;  2STT A;  2QKM B;  4QTR A;  4MQV A;  3CDL A;  3EYY A;  5HLI A;  4OIP F;  1OKR A;  5JR3 A;  3SFZ A;  3TO6 A;  1ZRE A;  3ZOB A;  4KN4 X;  5E3N A;  3CMA I;  3S14 J;  5KAI C;  4M3E A;  3HXL A;  2QEN A;  4XLF A;  3SJM A;  4IHV A;  2F2E A;  3KP4 A;  4WK8 F;  3LA3 A;  3HM5 A;  3CCJ I;  2X6X A;  5DCM B;  3OYF A;  4YFX F;  2XAJ A;  1F43 A;  5FO5 A;  4II2 A;  3FX3 A;  2MFZ A;  1TNS A;  4BQQ A;  5DYM A;  2ZB9 A;  3IWZ A;  4P1W A;  1QZZ A;  2LD5 A;  4QPQ A;  1B1B A;  4XLH A;  4ZYG A;  2FBH A;  4IZZ A;  2M0C A;  2IS4 A;  4EJU A;  2OZU A;  3MKW B;  1JUP A;  4LLL A;  3S16 J;  2GIV A;  1E3P A;  2R93 J;  1R00 A;  4DQ2 A;  3K7A J;  3HOY J;  3IAM 2;  1UHS A;  2E7W A;  1QO0 D;  3K4M A;  2E35 A;  4XM3 A;  4WCG A;  2HPI A;  3CUO A;  4L5E A;  1R6R A;  5IP9 J;  1K7A A;  3SZG A;  3TDU C;  1MJA A;  1FP2 A;  1LFP A;  1MH3 A;  3U9G A;  3CLQ A;  2Z9O A;  2DAO A;  2EIM H;  2KDZ A;  1S7O A;  3OYH A;  1MMG A;  5BPD A;  2OU2 A;  4EJO A;  4M6Y A;  2Z1D A;  1TQP A;  2TDX A;  3FKI J;  4XLN F;  3ZQF A;  5GAE J;  4FTH A;  4OMY A;  2R4G A;  2AHQ A;  3CD6 I;  2M4K A;  1B9N A;  3C3W A;  4A3D J;  2F5F A;  1ZQ3 P;  4ENK A;  3FKJ A;  1I50 J;  4GYG A;  2JA8 J;  5D5X B;  4D1Q A;  3LSJ A;  1K6O A;  3I5U A;  1HLV A;  2BE5 F;  2A61 A;  2WAQ N;  3KP6 A;  4XSZ F;  3WTV C;  2GM4 A;  3G71 I;  1O3T A;  2H1L A;  2MG4 A;  4CSW A;  5F1J A;  3AG4 H;  1MBH A;  1XMA A;  3KP5 A;  3NAU A;  4B43 A;  3KET A;  1FOW A;  1GT0 C;  4FET A;  2DA2 A;  4IVN A;  4UUS A;  5BS6 A;  1XCV A;  1XC5 A;  1D1A A;  2DXI A;  1MMA A;  3RKY A;  4F3Q A;  3PIP F;  1DQU A;  3TBI A;  3K6G A;  2ZNY A;  1WCM J;  2EFO A;  5JFR A;  1S72 I;  2O61 A;  4HF0 A;  1P4W A;  2MH9 A;  4LMY A;  4MQ9 F;  5GPA A;  4F52 A;  4F91 B;  4LIT A;  4IRI A;  1OR7 A;  2LY1 A;  3PSF A;  4XL9 A;  1YO5 C;  1S3J A;  3H92 A;  1YX5 A;  2F4M B;  2CWE A;  4EMS A;  3T1B A;  3DWL E;  4FT8 A;  4LIV A;  1LUJ B;  2E2H J;  2WY7 Q;  1GVD A;  2LY2 A;  3R0J A;  2CUF A;  4MEY F;  4NNJ A;  3WTW C;  4UUS B;  2X6O A;  3F6O A;  1DU6 A;  1ITY A;  2VL8 A;  3ABL H;  2VKD A;  1VND A;  1QZY A;  1DPU A;  3W6J B;  1I3Q J;  3SYT A;  1HBX G;  3I54 A;  3JSO A;  3RQ4 A;  2CU7 A;  1QRY A;  2IVM A;  2VC1 A;  3PNY A;  4JX4 A;  4GDF A;  1B59 A;  1ONV A;  5LRR A;  2JN6 A;  2WB1 A;  3JSP A;  2J5O A;  3MZY A;  4V2G A;  3CJQ B;  2XRL A;  3HOT A;  1X2N A;  1W36 D;  1S5L C;  3Q0W A;  4E7I A;  1LE8 A;  4MEX F;  2Y0S N;  1Z67 A;  2XAG A;  3WU1 B;  3HOV J;  4XN0 A;  1LB2 A;  4CCJ A;  2W4S A;  1P7I A;  1J7K A;  2QGU A;  4DYR A;  3KZY A;  1OPC A;  2VPR A;  4ETS A;  3QP6 A;  3DBH B;  3QP5 A;  2HPM A;  3PSI A;  1G3Y A;  1JHF A;  3FIS A;  3NQO A;  3FBI B;  1VQ7 I;  4UVB A;  2E1M C;  2KRH A;  1UG2 A;  3HHH A;  5GAD J;  3CUQ A;  4NB5 A;  2HR3 A;  2L3D A;  2VAS A;  4NC6 A;  5HLG A;  3FK7 A;  1ZR4 A;  1LE8 B;  1WWX A;  5LEJ A;  3ROU A;  4G94 A;  3N05 A;  2YX7 A;  1XGO A;  2KIQ A;  3SEZ A;  3EUA A;  2DMP A;  5HS9 A;  2QBY A;  4C2M J;  1D0X A;  5HOO A;  2FBK A;  1OJL A;  3LFK A;  3RPQ A;  4AIH A;  3LAP A;  1QZE A;  4BL0 B;  3HOU J;  3K1N A;  4QPO A;  2K40 A;  4HZF A;  2V1U A;  1Z9C A;  2V9P A;  2ISZ A;  3AFH A;  2DTZ A;  3PFI A;  1DUX C;  1IZ1 A;  4XSX F;  3M7G A;  2E2J J;  3CUQ B;  2EB7 A;  2XGX A;  3RJP A;  3DCF A;  3MKZ A;  2ZXJ A;  4ZZL A;  3TL4 X;  2K9M A;  2D45 A;  3EPZ A;  1YS6 A;  4JQF A;  3RYR A;  4BJ5 C;  2KIM A;  2VN2 A;  4QLC U;  4G6D A;  3T8R A;  5CQG A;  2QBY B;  1ODD A;  1F36 A;  1BN5 A;  2K86 A;  4IOA F;  1EH7 A;  1JTX A;  2IGN A;  2Y69 H;  4U0V A;  1BA5 A;  3BZ6 A;  2LSO A;  2R7Z J;  2X6W A;  1R5H A;  1TT5 B;  1I27 A;  2M8E A;  2H27 A;  4NDL A;  4BQA A;  2OQR A;  3ABK H;  4I7H A;  1SFE A;  2E60 A;  3A0B C;  5JVG F;  4FE7 A;  2AXL A;  1YJW I;  2F4I A;  4AWX B;  4G7O F;  1SD6 A;  2DA3 A;  3KIO A;  3K70 D;  1AHD P;  2RV8 A;  1ETO A;  2JRT A;  1PUF A;  1W1W E;  3BTC A;  3H1C A;  1ERD A;  1ORK A;  4HYE A;  2MW8 A;  2P5V A;  4HST A;  3CO7 C;  4I0A A;  1YTY A;  2F48 A;  1KZH A;  4AYB N;  3IHU A;  1VF9 A;  1FTT A;  1APL C;  1RZ4 A;  1X3U A;  2M7B A;  3UNG C;  4I02 A;  1BR1 A;  4PFP A;  3A03 A;  4DGW B;  1Y0N A;  2LOO A;  3VYS B;  4IHW A;  3IAS 2;  1G6N A;  1D0Z A;  4S0H B;  2L02 A;  5GPC A;  5J8C A;  5FB2 A;  1YYV A;  5L3G A;  4A5N A;  1Y1W J;  1PUF B;  5LLQ A;  2XAF A;  1W0T A;  5C4X J;  2DPD A;  4ENM A;  3E1S A;  4GYI A;  3Q0V A;  1GV2 A;  5J3L A;  4MTD A;  1TQI A;  2VJ5 A;  3C7J A;  4M73 A;  1TWF J;  2P4W A;  2XSD C;  2ZKZ A;  4OOI A;  3L2U A;  2VKE A;  2PBI A;  1HF0 A;  3N97 A;  1ETW A;  1IAW A;  4EM2 A;  1R4M B;  5E79 C;  1I6H J;  2PX9 A;  4RGU A;  1Y1V J;  3NWS A;  3KYD B;  3W2W A;  1TQM A;  1MBK A;  2X0L A;  4FCY A;  1MDM A;  2ZXI A;  2H09 A;  3Q9V A;  4Y33 A;  5FKO A;  3SZP A;  3GBG A;  4BBR J;  3OYN A;  5B66 C;  1FT9 A;  2BZT A;  4PJ0 C;  3CCY A;  2F4O B;  1D0Y A;  2M0M A;  4KIT B;  3V7C A;  1EH8 A;  2LLK A;  1OLT A;  1DGR M;  3L2V A;  3FXU A;  3CCM I;  4A3L J;  3H5A A;  5D5W B;  1ENH A;  3ZMD A;  4WWC A;  4GXO A;  2LVS A;  1UHM A;  2VQL A;  4BDY A;  4C3I J;  2A6H F;  1O3S A;  2OC6 A;  3RZO J;  1ZAO A;  2XC7 A;  4JX5 A;  3M8E A;  2FJ1 A;  1MDM B;  5CVU A;  1TC3 C;  1HC8 A;  2BEO A;  3H3U A;  3LST A;  4NC7 A;  3F22 A;  2QVO A;  2HDC A;  4M3B A;  2EIJ H;  1A04 A;  3M1E A;  2LKP A;  3B6C A;  1PVE A;  3KZZ A;  1X1P A;  4KIS A;  5L3F A;  1R58 A;  1N75 A;  2YSR A;  3HSR A;  4YIF A;  1YJN I;  4ZYH A;  1UAA A;  1JI8 A;  5JVT A;  1IRF A;  4MGR A;  2DT7 B;  3S1M J;  4DYQ A;  1X4P A;  1ON2 A;  1QU3 A;  4A3I J;  3PQJ A;  3S93 A;  1MJB A;  4I98 B;  5HDG A;  4RGR A;  1POG A;  3GTJ J;  2XPU A;  2Z2S B;  2HVR A;  3ASO H;  4RAZ A;  2DFH A;  1R4N B;  5HNF A;  2VBZ A;  2L9N A;  3BG5 A;  3RDI A;  4HAM A;  4I09 A;  3HBL A;  1SAX A;  1X1D A;  1NG7 A;  1XN7 A;  5F04 A;  4EM1 A;  4A3J J;  2ZO4 A;  3AL0 B;  2A3S A;  2TCT A;  5DM7 F;  3BZK A;  4Q47 A;  2EPF A;  1JT0 A;  3I64 A;  4Y52 J;  2PMZ A;  1JJ8 C;  3ZN0 A;  2R7O A;  4CCN A;  4R1H A;  5LGN A;  1S7A A;  1XPX A;  2XDV A;  3L2Q A;  3HZJ A;  1WKM A;  5C44 J;  4IF4 A;  3DPT A;  2XRN A;  1LDK B;  4E4H A;  3RSN A;  3JRF A;  4HNT A;  5JLX A;  3MKL A;  3OYC A;  1FPQ A;  5CKT A;  5J47 A;  3L2W A;  2NVU B;  1X1A A;  3ZRG A;  2DDB A;  3VEP A;  4M72 A;  4PDK A;  4V2F A;  1WJ5 A;  3I59 A;  4X1E A;  4RM2 A;  1BW5 A;  4XOR A;  2CV2 A;  1UB9 A;  4M3G A;  2YR2 A;  4BAY A;  3F6V A;  1O3R A;  2W82 A;  1FIP A;  5EYR A;  3CJN A;  1VZ0 A;  2VXZ A;  2FXA A;  2L4M A;  1VQL I;  1K4S A;  3ABM H;  4BU2 A;  4HQE A;  2QEX I;  1SEU A;  2GOX B;  1B9M A;  4LLG F;  2FOW A;  2C6Y A;  3C18 A;  1Y6I A;  2JSC A;  1M1E B;  1MGT A;  2L4A A;  3GW2 A;  5CVJ A;  4RB1 A;  4XMY A;  4P55 A;  2P7C B;  3I59 B;  1QBJ A;  3GUD A;  1RUN A;  4HQM A;  3DKW A;  3BR1 A;  3GFI A;  2NS8 A;  1H89 C;  2LRD A;  3OMY A;  5L3D A;  1ON1 A;  2BBY A;  3FZV A;  4MFE A;  2EV5 A;  4HV5 A;  3C1D A;  2XGC A;  5TRD A;  3HL2 A;  4BNC A;  1WH5 A;  4AD9 A;  3OSF A;  3BLY A;  4PJL A;  2CMP A;  1H88 C;  1A35 A;  2ME6 A;  2DT5 A;  2K02 A;  3HKZ N;  1IRG A;  4DJA A;  5B1A H;  3GVA A;  3RZD J;  4EJW A;  5ICE A;  5HDN A;  1Q1H A;  3DLL F;  2MH2 A;  4E7J A;  2KT0 A;  4BE1 A;  1RR7 A;  1GVJ A;  4AVZ A;  1H8A C;  2HQN A;  1P4A A;  2WAQ A;  2XV4 S;  1BBY A;  3WG9 A;  5J1R A;  2CO5 A;  1HKT A;  5K7F A;  2E5N A;  1IO2 A;  2WWY A;  9ANT A;  3L2C A;  4AIJ A;  1G4D A;  2F5V A;  4HSR A;  4JX6 A;  1R1U A;  5CPR B;  2DMU A;  2BY2 A;  3ML6 A;  4KUM A;  1SVO A;  4RB0 A;  1T08 B;  3RI4 A;  3E6M A;  3P9C A;  4CA0 A;  4CYD A;  1I1S A;  3SDB A;  2VB6 A;  4C9Y A;  3SDG A;  1OQY A;  2ELK A;  3BJA A;  1IF1 A;  4PJJ A;  4LG0 A;  1ZLK A;  2CV0 A;  3AG1 H;  2ESH A;  2MLG A;  1VQ8 I;  1D1C A;  3H36 A;  4FX0 A;  1SD4 A;  1SAN A;  2KL4 A;  5GAH J;  3FWE A;  3JAM K;  5KHD A;  2L01 A;  2Z99 A;  2W1O A;  4DIQ A;  5BPI A;  3HHG A;  5HVQ C;  1Y8R B;  1XGM A;  3JRA A;  4CXF A;  2VXD A;  3FBN B;  3EQL F;  2FA5 A;  2P0W A;  2CQK A;  2W85 A;  2ECB A;  2HQR A;  4B3X A;  2HVQ A;  5DS9 A;  2FNP A;  2O8K A;  3MN2 A;  3RKX A;  4LG0 B;  2RRE A;  2HXO A;  1Z7U A;  4D5C A;  2COM A;  2QF7 A;  2GWR A;  1SVM A;  2UV1 A;  1V5F A;  4PJN A;  1Z21 A;  5C4J J;  3BG3 A;  2K3F A;  4M9S A;  2Y0S A;  2EZL A;  4XKB A;  4EGY A;  3PUF A;  1QVT A;  2OAZ A;  3FXR A;  2F5E A;  4L9V A;  1X3Z B;  1X58 A;  4A69 C;  2KJB A;  1O4X A;  5FKN A;  2DMT A;  5KK1 A;  4RB2 C;  1XDU A;  2RAE A;  1IG7 A;  3UR3 C;  3C2G A;  3F8C A;  3H3V K;  4BXX J;  1MJ9 A;  3V7R A;  1R1T A;  2CYY A;  3DU6 A;  3OIP A;  2O0Y A;  3ZMV A;  4PSX A;  2D1H A;  4HNU A;  4OMZ A;  4XOT A;  2K5C A;  1X2M A;  2CFX A;  1R1V A;  4C3J J;  1IV8 A;  2DA7 A;  1FSH A;  3WTY C;  2H6C A;  2E5Z A;  2DBB A;  2XSJ C;  2FE3 A;  3CC4 I;  3OIO A;  4M9Z A;  3ERE D;  1OCC H;  2A6E F;  2WY8 Q;  3LMM A;  2VLA A;  3E5Q A;  1H9G A;  2NOG A;  5LEK A;  2YUS A;  2QM3 A;  2Y2Z A;  4GO1 A;  2CQQ A;  2JA2 A;  2RDP A;  4OAY A;  1MBE A;  4PJM A;  4RAF A;  3TDZ C;  3TOB A;  5F0H A;  4HF1 A;  3M8J A;  1ZAR A;  2GQQ A;  3GZ5 A;  3Q5F A;  3LWF A;  3QYE A;  2CGP A;  4RGS A;  2X1D A;  4F7Z A;  2STW A;  1VQM I;  3VSK A;  2NXN B;  1CGP A;  4PK4 A;  3IKT A;  1MBG A;  4A3B J;  1QNT A;  3GTO J;  1U8R A;  2UWM A;  2IGK A;  5EEG A;  2VI6 A;  4N0B A;  3F23 A;  3OIQ A;  2PJP A;  1OCR H;  4D7M A;  1WZ2 A;  2F5D A;  3CCS I;  3U1D A;  2V6E A;  1QHG A;  3QQA A;  1QGP A;  1TWG J;  5HNH A;  2R3S A;  3HPH A;  2R7X A;  2KZG A;  1BR4 A;  1YLF A;  4PCQ A;  1Z05 A;  2HZT A;  2VBW A;  4LB6 B;  5E8I A;  2EFW A;  4A3F J;  1JKQ C;  5D4S A;  4B09 A;  3TW6 A;  4B4C A;  3P9K A;  4F92 B;  3BZC A;  2VBY A;  3E0J B;  1D5V A;  2LKX A;  1BI3 A;  5BOX A;  3WE3 A;  4K2E A;  3PO3 J;  2HU9 A;  4E70 A;  5IT9 K;  5K7Z A;  3PNT A;  3MMY B;  5E8G A;  3QPL A;  1P9Q C;  2XPV A;  1F1Z A;  4AC0 A;  2PLY A;  4BKX A;  3ECO A;  2A5Y B;  4PSW A;  2EZI A;  1UCR A;  1FOY A;  4RS8 A;  2DYS H;  4NUB A;  4HLX A;  4LB5 A;  1YIJ I;  4ZH4 F;  1SD7 A;  2XKP A;  1D1B A;  5IYD J;  2W84 A;  1SD5 A;  2O3F A;  2X85 A;  3S2D J;  2IW5 A;  1X1C A;  2GA2 A;  2M2E A;  4F55 A;  4AYB A;  3HOZ J;  3K1M A;  5B3S H;  1OCO H;  3KX2 A;  2HQ5 A;  2M87 A;  2H94 A;  2I10 A;  3G73 A;  2IEK A;  4AVP A;  3WE2 A;  1FBS A;  2DQL A;  2OD5 A;  3BQY A;  2V79 A;  3J80 K;  1R23 A;  2L7Z A;  1Z3Y A;  2ACJ A;  1Z1D A;  3J7A Y;  3GME A;  4ENJ A;  5E1W A;  5D4R A;  3OYD A;  3QAH A;  4CZZ A;  3GWZ A;  4XIC A;  2VJJ A;  1J2X A;  3HIF A;  2L9R A;  3TP3 A;  4MO7 A;  2CW8 A;  3MAJ A;  3I58 A;  3IKV A;  2NAZ A;  4HDU A;  4RDU A;  3GX4 X;  2FEZ A;  4U7B A;  2OA4 A;  3WGI A;  1X1B A;  3ZPL A;  3U21 A;  1U78 A;  2HYF A;  5F1R A;  3B6A A;  3R6S A;  4HW0 A;  3HDD A;  1RPW A;  3U1K A;  4DYC A;  1FWZ A;  3I0T A;  2LTP A;  1W5T A;  2BV6 A;  2FQ3 A;  3FK6 A;  1GUU A;  1IN8 A;  3I71 A;  2K9N A;  2K7L A;  3VYR B;  4ZZD A;  2JZY A;  2F5C A;  4YIR X;  1MZB A;  2ZXH A;  4U0W A;  1K4T A;  4IQ4 A;  4L0Y B;  4HX8 A;  3COA C;  2LG4 A;  2DPU A;  3K4N A;  4YFN F;  1W7P D;  1VQP I;  1WFX A;  1A36 A;  3K0L A;  5F64 A;  2QSF X;  5EEH A;  2O7O A;  2DW4 A;  2OQG A;  2CJJ A;  3L1P A;  4EAT A;  2X4H A;  1P7J A;  4DNC A;  4ITV A;  2IGM A;  3A2K A;  4EQQ A;  5JLW A;  2BY3 A;  3RQI A;  4BE0 A;  4ZYA A;  3V8L A;  3ZMU A;  1TWC J;  2Z5U A;  5DM6 F;  1XGS A;  3L2R A;  4BJ6 C;  1J09 A;  2QSH X;  1E2X A;  1LDD A;  3T8T A;  3CMM A;  4H4K C;  5H6Q A;  3G3Z A;  3GEZ A;  4RM3 A;  4YFK F;  1H0M A;  4IHX A;  2ZSI B;  2ID3 A;  2ZJR F;  2IA1 A;  5B5E C;  5J40 A;  5A2Q Z;  3JCU C;  2VPL A;  1W5C C;  3P5J A;  5LHI A;  1IRZ A;  3S1R J;  5HLT A;  3IL2 A;  1G8X A;  2XPW A;  5DUI A;  1TTY A;  4A6D A;  2HOE A;  5KNL A;  3HEF A;  4DBQ A;  4EEF G;  2NNN A;  3JRB A;  4BH9 A;  1YE9 A;  2WBM A;  3I9V 2;  1X3W B;  4WXD A;  3QOD A;  3X2Q H;  1WJC A;  2HEO A;  1BOA A;  1KON A;  4GCV A;  3Q0U A;  2XHK A;  4J19 A;  2X6Y A;  3RCO A;  3JAM Z;  2R92 J;  1HKS A;  1TL8 A;  2CW0 F;  2V9K A;  1T2K A;  1T98 A;  3DFG A;  2JA5 J;  1RIO H;  4ON0 A;  1C0W A;  4IRG A;  2CV1 A;  2K9Q A;  2IAI A;  3JR9 A;  2LYC A;  3IH2 A;  3CP8 A;  4FAS D;  1T56 A;  1HST A;  5IOZ A;  3S3M A;  1YI2 I;  4L5J A;  1KYZ A;  2DFF A;  1WVR A;  3GZ6 A;  5LGU A;  3H0G J;  2DJI A;  2FU4 A;  4KMU X;  4Y4R A;  5D5V B;  3D1N I;  4HPQ A;  5D8K B;  4UUT A;  3L09 A;  3HTS B;  3M3Y J;  3IRQ A;  3BDD A;  4A3M J;  3LFU A;  3D5S C;  1MSF C;  3MKY B;  1T6S A;  2JVG A;  2UXN A;  5GAG J;  3ERM A;  3CF5 F;  4FX4 A;  1Y0U A;  4G7Z F;  3CTA A;  2QSG X;  3SHF A;  4YEJ A;  3BC8 A;  4BY1 J;  5H2F C;  1BI0 A;  3IH3 A;  5EZH A;  2IXS A;  2OV7 A;  1AA7 A;  1FMV A;  2K9S A;  3E97 A;  3OYK A;  3TGN A;  3HRT A;  2EWN A;  1FYK A;  4HDV A;  4OIN F;  2P5L C;  1FOX A;  4BY7 J;  2B63 J;  2OZ6 A;  2IA2 A;  3VOD A;  2RKH A;  4IKF A;  4Z2Y A;  3H0D A;  4IQJ A;  3S2H J;  1MBF A;  3PO2 J;  2W7N A;  3F8B A;  3I56 I;  3G4S I;  1RR8 C;  5JHF A;  1WPK A;  2L7K A;  3K4K A;  4W97 A;  2JQ7 A;  2HQA A;  3FMQ A;  3QYB A;  2Q0O A;  2KP6 A;  3GFM A;  3H9J A;  4UVA A;  2LKS A;  2NVT J;  1QA6 A;  2HTS A;  5EJC A;  4ASN A;  2V6C A;  4C2T A;  1YG2 A;  3UKG A;  2XB0 X;  3Q9S A;  2JPC A;  2VOO A;  2ISY A;  2ECC A;  5EDN A;  3GTK J;  2E7X A;  3CJR B;  3D5L A;  2ZME C;  5M3M J;  2EIN H;  2ZBK A;  3RPU D;  4AU7 A;  1V5E A;  5J8F A;  2JJ7 A;  1ZN2 A;  2EBI A;  2FMY A;  5E3O A;  4B3A A;  3ZQQ A;  1PDN C;  3ELK A;  2L54 A;  1XSX A;  4A93 J;  3PL8 A;  1IJW C;  2ME0 A;  5DV5 A;  3TMO A;  4R79 A;  1PP8 F;  3CLO A;  1D8J A;  3SEQ A;  4XOP A;  2ESN A;  2QQ9 A;  4LD5 A;  5IT9 Z;  1I39 A;  3B73 A;  1HQC A;  4NC8 A;  1UFM A;  3I4M J;  2VE9 A;  4M3F A;  2H8R A;  3LSK A;  2DN0 A;  2OCC H;  2PFB A;  3IH4 A;  3FXL A;  3OYE A;  1U6G A;  2WTE A;  3TKY A;  2X1E A;  2R5Z A;  3KEQ A;  4DZJ A;  5J4Y A;  1HW5 A;  2BVL A;  2NVQ J;  2BGC A;  1YIT I;  3BY6 A;  3QU6 A;  5CLS A;  2JTV A;  1W7P A;  3I3L A;  1KGS A;  1IRX A;  3PM1 A;  2Y0M A;  4HRI A;  5FLV A;  3VFZ A;  1DU0 A;  3ZCO A;  2I8D A;  3FM5 A;  1JKO C;  2DFI A;  1W36 C;  1OCZ H;  1MMD A;  3FXM A;  5HS8 A;  2FOK A;  3J80 Z;  3AG2 H;  3BR2 A;  4C2U A;  2R5Z B;  4FE4 A;  5C3E J;  3A4C A;  3JTH A;  1CF7 A;  2WV0 A;  4GGG A;  3KFW X;  2M9H A;  3J7A O;  1ZGW A;  3K4J A;  3VB2 A;  2FRH A;  5FD6 A;  2R7Q A;  4X0G A;  1W7P B;  5L3E A;  1YW8 A;  4Q4Z F;  3JRI A;  2IRF G;  3N4M A;  1X4O A;  3PQK A;  3K2A A;  2LH9 A;  2ELJ A;  3E6D A;  3R61 A;  2V1X A;  4XR6 A;  4M71 A;  2E1M B;  2JWT A;  1T33 A;  1ZYR F;  4BHP A;  1YFH A;  1BIB A;  1YQA A;  4PZJ A;  1TWA J;  3L00 A;  1Z77 A;  4KYW A;  2BXZ A;  2HKX A;  5JI6 A;  2NYX A;  2O5R A;  5FKL A;  4CZC A;  2ZME A;  4BE2 A;  1CF7 B;  2EFN A;  2LMD A;  1FBU A;  3LSH A;  2XF5 A;  1DP7 P;  1U0J A;  4OU0 A;  1NTC A;  3CP2 A;  1JKR C;  1JJ6 C;  3OS2 A;  2KKO A;  3LSG A;  1J0R A;  2XVC A;  5F6F A;  1V4R A;  1RKW A;  2A07 F;  2VT3 A;  4RLQ A;  3O6B B;  2KIF A;  3Q3S A;  4S04 A;  4ZDO A;  5BMZ A;  1FMW A;  1DDN A;  2ZME B;  4KNY A;  1G3T A;  2IJL A;  2L0K A;  3WTU C;  1BJA A;  2V1D A;  3HG9 A;  1MND A;  3P9I A;  2M5W A;  5LD2 C;  4U87 A;  5D6F A;  1QVU A;  4LK0 F;  3WGG A;  4V19 K;  1UEL B;  4E7L A;  3GTQ J;  2DK5 A;  3OWT A;  3MVP A;  2XAU A;  4QSH A;  3BP8 A;  2KFD A;  4AID A;  2DOD A;  1VI0 A;  2BY1 A;  5FD5 A;  4M9X A;  4EM0 B;  4PGH A;  2DO7 A;  3JRC A;  2JVH A;  2CS3 A;  4KFC A;  3K70 C;  1IDY A;  2KHM A;  1TW2 A;  1IDZ A;  1E17 A;  2XIG A;  4P9U A;  3OY9 A;  2EH3 A;  1FIA A;  4OWR B;  3WU0 A;  3ZXS A;  5ILV A;  1BOB A;  4N9H A;  1LDJ A;  1A31 A;  2GOM A;  5IOY A;  1B72 A;  3CF2 A;  1KU7 A;  4IXA A;  1V55 H;  2CFO A;  2HVS A;  4WF2 A;  1P2F A;  4M74 A;  2UZK A;  3HSF A;  3ZQL A;  2VT2 A;  2WAD A;  5ILU A;  2VUM J;  1U5T C;  4IX7 A;  1CQT A;  2GA1 A;  3K4L A;  4F93 B;  3OYL A;  5FRN A;  2R5Y A;  3EYI A;  1XX5 A;  5LHH A;  3V42 A;  1RRJ A;  4U7D A;  1EJ9 A;  4Y13 A;  5ERI A;  1MMS A;  4CHU A;  3QOP A;  3SZT A;  4IRH A;  5DTD A;  4AIK A;  3RPU A;  1B72 B;  2AS5 F;  4Y17 A;  2O8X A;  1K61 A;  1ZRD A;  3GF2 A;  4BHC A;  4CH7 A;  1K78 A;  5ICC A;  4YEL A;  5IP7 J;  1SAU A;  1V3F A;  2XAS A;  3S3O A;  2OTJ I;  2JRM A;  1B4A A;  3QU3 A;  1ZLJ A;  4RMN A;  1BC8 C;  2HGC A;  2X9D A;  2ZXW H;  3ZR8 X;  5EG0 A;  1W0U A;  2B0L A;  1YX3 A;  4FHT A;  2IT0 A;  5F0F A;  1T0F C;  2R5Y B;  3G1O A;  3CC7 I;  2M7A A;  4IO9 F;  1MNE A;  3KYL A;  2DCE A;  1AWC A;  1R36 A;  1WI9 A;  3DP7 A;  2AXT C;  2GZW A;  3VDX A;  4XKV A;  3HSE A;  2PMU A;  2LF8 A;  3EUH C;  1VQ6 I;  4RAG A;  1K78 B;  3PUB A;  1IN4 A;  5IT3 A;  3HRU A;  2W00 A;  1YS7 A;  4L9T A;  1G3S A;  1LVK A;  5EG0 B;  2EFP A;  4IHT A;  1YRN A;  1JGS A;  4ESJ A;  4R8H A;  1BM9 A;  4S05 A;  2P81 A;  4JBA A;  1YIO A;  2ID6 A;  3NWT A;  4HX7 A;  5FJ8 J;  3KCC A;  2VQC A;  5DD8 A;  2N8G A;  3R4K A;  3OL4 A;  1EF4 A;  2CQX A;  2IBD A;  1ZG3 A;  2G9W A;  2KDO A;  4MNU A;  1S9H A;  3OOP A;  2QYO A;  1NHA A;  4LOC A;  4HF2 A;  1ZH5 A;  1G2H A;  4XLA A;  2FX0 A;  4BXF A;  5GTI C;  3F3X A;  1MH4 A;  3TO7 A;  3AKZ A;  4KT6 A;  4L9J A;  3I4N J;  4CO8 A;  5A2Q K;  3FMS A;  1J5Y A;  2HXI A;  1D5Y A;  2Y9Z A;  1YRN B;  3BTI A;  2NVX J;  2UXX A;  2HI3 A;  4IHS A;  2QKL B;  5E20 A;  3E6C C;  2QWW A;  4BQN A;  3DPU A;  2GXB A;  4FIS A;  2HZD A;  2IA0 A;  1MMN A;  3FF5 A;  1XSV A;  3S8P A;  5K5Q A;  3A02 A;  1T38 A;  2L7M P;  4O5V A;  5EZG A;  2P6T A;  4NHJ A;  5TIS C;  2V26 A;  4GRI A;  4HG2 A;  2R7F A;  2I5U A;  3CES A;  5L3B A;  1O3Q A;  4JOM A;  2KIS A;  2AO9 A;  2M34 A;  2K4B A;  1HSJ A;  3LA2 A;  4M6X A;  4UV9 A;  2PI0 A;  2NOJ B;  2KQR A;  3JTG A;  1HW1 A;  2AQE A;  2IP2 A;  1ZG1 A;  1QHH D;  4XID A;  4BBS J;  1K6Y A;  4N4O B;  2JPB A;  1A6Q A;  3KE2 A;  2JUG A;  2ZFW A;  2B9S A;  2VKH A;  3OS0 A;  3O2P E;  1BJZ A;  1SMY F;  1WH7 A;  3ABT A;  1D3Y A;  5E17 F;  2E2I J;  4CIC A;  2OJE D;  5CJ9 A;  3CCQ I;  1VQ9 I;  3K1P A;  2Y75 A;  2TRT A;  3DTK A;  1DP3 A;  2E71 A;  4BDZ A;  1G59 A;  4UNO A;  1OYI A;  2V4J C;  2PQ8 A;  4PUS A;  4ANJ A;  4D9J A;  3LAJ A;  4A3C J;  2EQR A;  3IRR A;  2RNJ A;  1S6L A;  5AIQ A;  3PJR A;  1LFB A;  2R7S A;  2M30 A;  2DA5 A;  3LSI A;  2VQG A;  4XLC A;  1YW9 A;  4I0B A;  5BQT A;  3HRM A;  3G1M A;  3BCB A;  4CUG A;  2XAQ A;  3K2Z A;  1R9T J;  3O8G A;  1G3W A;  3EET A;  3ONQ A;  4XLE A;  3VSL A;  2WAF A;  3H5R A;  2GXG A;  1ETX A;  4UHT A;  2A68 F;  3BJ6 A;  3DEW A;  1ACI A;  1JGG A;  3HPG A;  3I53 A;  3ZGK A;  1LQ1 A;  4AM3 A;  1A6I A;  3QRF F;  2IS2 A;  4XBF A;  3V8K A;  3FHN A;  1IN6 A;  1FSE A;  4UVC A;  4E7K A;  5FRO A;  4DOZ A;  1IN5 A;  2X48 A;  1IUF A;  1WJF A;  4UXN A;  3J81 Z;  2G7U A;  3RKQ A;  3H35 A;  1O7L A;  1XG1 A;  1EV7 A;  2FD5 A;  1UG0 A;  3S1N J;  2NS7 A;  2FUG 2;  3BTJ A;  5LRS A;  2OTL I;  4L9N A;  4RGX A;  2LY9 A;  1MKM A;  3MEX A;  3DF8 A;  2VC0 A;  1IGN A;  3HGG A;  1IC8 A;  2HS5 A;  3BR3 A;  2CUJ A;  5F08 A;  3VPR A;  3V7S A;  5DUK A;  4BJT A;  2CRG A;  1V54 H;  3HRS A;  3KP3 A;  1JUS A;  3PNV A;  5CVV A;  4Q48 A;  4BUP A;  3GLX A;  4RA2 A;  5D6E A;  5K1Y A;  5FRM A;  3F0C A;  2J5P A;  5E3L A;  2EA4 A;  1N77 A;  2DOE A;  4II3 A;  5L3C A;  3TO9 A;  3LSR A;  4A12 A;  2GBY A;  1GXQ A;  2X1C A;  2M8G X;  2R7D A;  3M07 A;  3WTS C;  3K4C A;  5D5U B;  4JYK A;  1WI3 A;  4ESB A;  2DTR A;  1HA8 A;  4UV8 A;  1Z6T A;  1T8I A;  4LJZ F;  2DA1 A;  3OSG A;  2WA0 A;  4KN7 X;  2E1O A;  2WV1 A;  2PMZ N;  3KEO A;  1TT0 A;  3GFL A;  5LGT A;  3CCL I;  1XMX A;  4G9Y A;  4YRV A;  4RBO A;  3R0A A;  3DPL C;  3TED A;  2LR8 A;  3B02 A;  3G2B A;  3L9F A;  1RUO A;  1IXC A;  2K4J A;  3T5X A;  1RKT A;  2XUB A;  2MYS A;  3ZQH A;  2PN6 A;  2R0Q C;  2WAE A;  3ZQI A;  1OR7 C;  2A6T A;  4W1U A;  3IC7 A;  2RN7 A;  1N25 A;  1OYY A;  3ISP A;  1R49 A;  2QA4 I;  1U8B A;  1H9T A;  2DU9 A;  4BS9 A;  2HOT A;  2IS6 A;  3WHC A;  1Y56 A;  4G6T B;  3GTP J;  5IYC J;  4E7S A;  3K4B A;  3M8F A;  4XRM A;  1SC7 A;  2GAU A;  3IWF A;  4XKW A;  1Z3X A;  3FIW A;  4EV0 A;  1RET A;  1P6R A;  2Q1Z B;  5DEQ A;  1GLN A;  3ABU A;  3MCZ A;  3V4G A;  3FMR A;  1U9O A;  2R7R A;  2V7F A;  3MWM A;  2OUM A;  1ETQ A;  1PJR A;  4A3E J;  2HDW A;  2XF7 A;  5LBQ A;  1HDP A;  5J1U A;  5HS7 A;  2PMH A;  2MLK A;  3MD2 A;  3JW4 A;  3VOE A;  3M1C A;  4XLP F;  1AU7 A;  3BR6 A;  1HDD C;  2CUZ A;  4CGZ A;  5ICG A;  4HA8 A;  2OPT A;  5M3F J;  1BI2 A;  1ZRC A;  1F5T A;  1I5Z A;  1V5G A;  4KMF A;  2Y31 A;  4HBL A;  2OF7 A;  3T0Y A;  2BOL A;  4U0Y A;  3CCU I;  2XGD A;  4B48 A;  4D0P A;  2DYR H;  3IUO A;  2ZCW A;  5DDG A;  3JRG A;  2CQ7 A;  4LG3 A;  2PEX A;  2MC3 A;  4I6Z A;  1VQ5 I;  3IP4 B;  3CUQ C;  1LPQ A;  4J00 A;  3BG7 A;  2P8T A;  1A5J A;  2QZ8 A;  1KU2 A;  1X19 A;  2E19 A;  3DEE A;  5CVI A;  3CMY A;  4KIC A;  3WG7 H;  2OBP A;  1WGX A;  1DGW Y;  2QUF A;  4B1R A;  1XD7 A;  2RQP A;  3BR0 A;  3U2R A;  3G6E I;  1IW7 F;  4A0X A;  4CYC A;  4G12 A;  5AIP A;  2KPM A;  3DBR B;  5EF6 A;  5IP6 A;  1QPI A;  1FYM A;  2HFH A;  1PUE E;  3CO6 C;  1E0E A;  3ZQC A;  1HCR A;  4UB6 C;  5FLM J;  1O7F A;  4A3K J;  4A5M A;  4PGG A;  4HOB A;  1TZL A;  6PAX A;  1HOM A;  4MIM A;  1XSD A;  5M5W J;  2LFB A;  3LNQ A;  4DBR A;  4CCL A;  2Z3Y A;  5K5R A;  5M5Y J;  2VOD A;  3FHZ A;  1NK3 P;  1ZR2 A;  1KYW A;  4CYC B;  3I55 I;  3K9T A;  1KQ8 A;  2YPR A;  2DJN A;  1JKP C;  2CG4 A;  1J75 A;  3PIO F;  3DQV C;  4BYY A;  2VJI A;  1Y39 A;  3KP7 A;  4XN3 A;  1AKH A;  2DT6 A;  3J7Y J;  2P6S A;  1YW7 A;  2NS0 A;  1XB4 A;  1RC9 A;  5EEA A;  3VWB A;  3ZMT A;  4ENN A;  3KYC B;  1IN7 A;  1SVL A;  1HXD A;  2PJR A;  2EV6 A;  2UUZ A;  4LLN A;  1LNW A;  2JA7 J;  1ETV A;  1MW7 A;  2ZFU A;  2VIX A;  4O6J A;  4BXU A;  2VJ4 A;  1D8K A;  2DK8 A;  4OIR F;  5CVR A;  3H9G A;  4P9F A;  3HOX J;  3H9Q A;  4MHG A;  2DQR A;  3MQ0 A;  3E5U A;  1AKH B;  2BHY A;  3HYI A;  4E7Z A;  1B6A A;  1W4M A;  5KVR A;  2E1C A;  3DXJ F;  3ESW B;  3JRE A;  3GTM J;  3A01 A;  1J9I A;  2GLO A;  1NK2 P;  1KQ0 A;  1IXS B;  2IS1 A;  1WJE A;  1HW2 A;  2PJR B;  1IXR C;  2P7V B;  3HKZ A;  1ZGA A;  4LIU A;  2CSO A;  3CDH A;  5K7H A;  2CUE A;  1VQ4 I;  3JRD A;  2L9V A;  3GXO A;  4B44 A;  2XRO A;  2DFE A;  4OIQ F;  3KEY A;  3ZQG A;  4QIW N;  2M1B A;  3LSM A;  1XMK A;  5FFX A;  2F6C A;  4LFU A;  4ABZ A;  3F21 A;  1S8N A;  1FP1 D;  3QPH A;  4CCK A;  2LRE A;  2XGE A;  2IPQ X;  4L18 B;  2DI3 A;  2RQQ A;  2H6B A;  4G6Q A;  2LNB A;  5EGO A;  3A01 B;  5B1B H;  3DLA A;  4KDP A;  1LFU P;  3BRO A;  1XCB A;  2KLO A;  1NG6 A;  5J4V A;  2Z16 A;  2L9S A;  1FNN A;  1FJL A;  2LBF A;  1O57 A;  3WOD F;  3LSP A;  1QPM A;  2VE8 A;  2K27 A;  3BCA A;  3E3V A;  2D5V A;  4RLF A;  3REO A;  2FNA A;  1J59 A;  1FC3 A;  3HB9 A;  4ESF A;  3RIR A;  2W24 A;  2KRC A;  4MLO A;  1K79 A;  3S17 J;  5K5O A;  3KPH A;  2IGO A;  3K69 A;  3LA7 A;  2YU9 J;  4FQG A;  4A0Y A;  5EGO B;  3BTL A;  3OYA A;  1MD0 A;  2RVC A;  5DD4 A;  4ZC3 A;  2H1K A;  3AL0 C;  2EJR A;  3FXJ A;  2V9V A;  1VQO I;  3GCM A;  1IV6 A;  4KT5 C;  1PP7 U;  1P92 A;  2FSW A;  1ZK8 A;  2BY0 A;  3CCR I;  1R5I D;  3W3C A;  2LBF B;  3TW7 A;  2FQ4 A;  2EA2 A;  1JT6 A;  2RNG A;  2B7E A;  3CDI A;  3KZI C;  2FF4 A;  3FM3 A;  2K85 A;  2JK3 A;  2DMN A;  1FX7 A;  4E7H A;  2A5W A;  5M5X J;  1XS9 A;  2DOA A;  3G1L A;  3ZQ7 A;  4D5F A;  3CC2 I;  4LGW A;  1TP4 A;  4A0Z A;  1Y8Q B;  5GTH C;  2R7U A;  3BPX A;  4CDG A;  3K10 A;  1FTZ A;  2O6G E;  4XRS A;  4NQW A;  3WTX C;  1KA8 A;  2YX4 A;  4EVI A;  2VQH A;  2W25 A;  4BHB A;  4KJZ A;  2W48 A;  2D1V A;  1XTA A;  1OYW A;  2KIU A;  3TQN A;  3RTR A;  4ZYD A;  3TP0 A;  3EUK L;  2R7V A;  1DPR A;  3A0H C;  3W2V A;  3BPV A;  1LKX A;  4L0Z B;  5IPA A;  3JRH A;  1VQN I;  4C30 A;  1ETK A;  2DA6 A;  3VYU B;  5D8L B;  3OV8 A;  1Q1V A;  4G7H F;  1EH6 A;  4EJT A;  1E3O C;  4CCO A;  2JUC A;  1EKE A;  3GFJ A;  3OOU A;  3W6K B;  1RI7 A;  2M4G A;  4WX9 A;  2VKV A;  5HLH A;  3QPT A;  2JMW A;  1Z0X A;  4YG2 F;  2EZK A;  4UUV A;  1WJB A;  4ZTJ A;  1USS A;  5FLX K;  4NQW B;  4U88 A;  3J81 K;  3HJE A;  3OS1 A;  3GTG J;  1SFU A;  2EIK H;  2LC2 A;  3BG9 A;  2L2O A;  3J7Z I;  2HWV A;  2VON A;  2ZJQ F;  3BOQ A;  1MBJ A;  2Y48 A;  5GP9 A;  1I3A A;  2QCO A;  2R7W A;  2K9L A;  4KA4 A;  4IL6 C;  2HYG D;  3GLL A;  4TV7 A;  2HKO A;  2EV0 A;  1PYV A;  3V8J A;  3OR2 C;  3HOS A;  4DW6 A;  2CQN A;  2ZNZ A;  3ECH A;  4N4N B;  4RAY A;  1UJ8 A;  1FOK A;  1FBQ A;  1R22 A;  1W5S A;  1ULY A;  3DTE A;  4RB3 C;  3IV5 A;  4ZDP A;  2FBI A;  3KLN A;  1SMT A;  1K83 J;  3A1Y A;  1JHH A;  1OCP A;  2M3A A;  2NNY A;  3S2W A;  3DTI A;  2MD0 A;  1R7J A;  3NAR A;  1GXP A;  3F8N A;  4IHY A;  2P5K A;  1UST A;  2NRA C;  3QPS A;  5ICF A;  4M3D A;  3VYT B;  2BXY A;  4PFO A;  5LFA A;  5H6R A;  2NVY J;  3CCV I;  4IEJ A;  3W6V A;  1LJ9 A;  1R5G A;  3PFY A;  2EFQ A;  3MZH A;  2PG4 A;  3MFK A;  2M45 A;  3FXO A;  3WHB A;  1R71 A;  1GHC A;  2R7T A;  2DMQ A;  1MIJ A;  3C2B A;  3KP2 A;  3SQN A;  1WRJ A;  2DA4 A;  4B8X A;  2RC4 A;  2COB A;  3E7L A;  1BR2 A;  1ZGJ A;  4NBQ A;  1REP C;  4YII A;  1Z7L A;  3QOE A;  2OCE A;  4XRF A;  4MTE A;  4A3G J;  1LEA A;  3ZP5 A;  4ZYE A;  4P5O A;  2QQ8 A;  1B8I A;  3DU5 A;  1JTY A;  3LL7 A;  4HNV A;  5BNG A;  1MNM C;  1U2W A;  4WXC A;  5H20 A;  1JXS A;  5J1Y A;  2WB1 N;  2V1N A;  4MFD A;  1SFK A;  2ZJ2 A;  2ZC2 A;  1ZEL A;  4LK1 F;  3LQR A;  4O3M A;  1YOV B;  2LK2 A;  2EZH A;  2LF7 A;  2GIZ A;  5TGT A;  3H3Z A;  2E34 A;  3EDP A;  1Z91 A;  3WGH A;  1ZTR A;  2MA3 A;  3SXY A;  5F0C A;  4EGZ A;  1T39 A;  3M9A A;  1OCT C;  2HTJ A;  2BW3 A;  3WTZ A;  3DBL B;  1BIA A;  2CH0 A;  2HYJ A;  1B8I B;  1I6X A;  1SFX A;  2DLL A;  2ZSH B;  3RKW A;  4EJV A;  1EA3 A;  4BEH A;  4Y15 A;  2XAH A;  3BT9 A;  1WHU A;  2KMU A;  1NH3 A;  4AUX A;  4A2U A;  2MGQ A;  5HOD A;  1WJA A;  4XQF A;  5TJJ A;  2RGV A;  2E36 A;  1JE8 A;  3QWL A;  3ZMS A;  2W57 A;  3DKX A;  1L3L A;  5F27 A;  2BW3 B;  3R60 A;  1WSU A;  5CYV A;  3W2A A;  4BQO A;  4H0E A;  2HOA A;  3QYF A;  4WXH A;  1FY7 A;  2ICW G;  4A6E A;  3E5X A;  4BEH B;  5E1Z B;  4Z6Y A;  4BGD A;  3O8H A;  2HDD A;  1BI1 A;  2QQB A;  1SFO J;  2FML A;  2A69 F;  1AOY A;  1U5T A;  3CQZ J;  1RNL A;  1BL0 A;  1FZP B;  3L7W A;  2MSY A;  4OIO F;  3F9K A;  1ZHF A;  2DOF A;  3HOW J;  5FGM A;  3GTL J;  1U3E M;  2KRF A;  3M4O J;  2DDA A;  3OYM A;  2G0E A;  2L5Q A;  3KLO A;  1UZC A;  1BC7 C;  5E1X A;  3D5R C;  3OYB A;  3CJT B;  3FDY A;  1E3H A;  4I76 A;  5DCF A;  2ZJP F;  4Q5S F;  4CCM A;  1TWH J;  2MD5 A;  3E6B A;  1ZG5 A;  2L7F P;  3NEU A;  4JK1 X;  4KIG A;  1U5T B;  2LDU A;  2VOP A;  2AQF A;  4HLY A;  2BYV E;  4I01 A;  1T0F A;  3FXQ A;  1U9N A;  5IY5 H;  3OYG A;  1RES A;  5FKK A;  3BG6 A;  2YU3 A;  4E6K G;  3HUG A;  1Z6R A;  2Q2E A;  3BQZ A;  1LVA A;  1UHW A;  2CW7 A;  2VBX A;  2Y9Y A;  3LQQ A;  5FFZ A;  4ZTF A;  4C3H J;  3OYI A;  2D2W A;  3S1Q J;  2ETH A;  1FYL A;  1F4K A;  4QWQ A;  1QQI A;  3DV8 A;  3MZ8 A;  4HEA 2;  4KIF A;  5ED4 A;  3I4P A;  2Z33 A;  3EUH A;  3AAF A;  4XKC A;  3ULQ B;  1KU3 A;  3WU2 C;  4XON A;  1STZ A;  2E1N A;  3F8M A;  3BJO A;  1FEX A;  3GYH X;  2A05 A;  2XKO A;  2WC2 A;  4HV6 A;  2HNH A;  3HC7 A;  5ILS A;  3ASN H;  3BWG A;  3HUG B;  1TNT A;  2Q2E B;  3CZ6 A;  1YHQ I;  3F72 A;  2KJC A;  3HTU A;  1XGN A;  4Y7N J;  1VFC A;  4GFB A;  2KZV A;  4UY8 I;  4N9I A;  3DEU A;  4ZJZ A;  1OIS A;  3D0S A;  3FXK A;  2G7H A;  5J6X A;  3P7N A;  3ZMZ A;  1VTN C;  4UB8 C;  4X6A J;  5KCM A;  3CCE I;  5FLX Z;  2H8W A;  2JSP A;  3H5N A;  5IYB J;  1WJD A;  3LOC A;  4DZP A;  4M6V A;  1IUY A;  3WTT C;  4BAC A;  2ELH A;  1YJ9 I;  1N78 A;  4P96 A;  3S15 J;  1KU9 A;  3GZN B;  3OR1 C;  1S29 A;  5LHG A;  2HOS A;  1T95 A;  3NRV A;  1GV5 A;  2YS9 A;  2ADU A;  3ZN1 A;  2X51 A;  1S7E A;  3DKY A;  3CME I;  1JUM A;  1TW3 A;  2O9L A; 
#chains in the Genus database with same CATH homology
 2LKS A;  2KFD A;  2B7E A;  2K85 A;  2KZG A;  2L9V A;  4FQG A;  2DOD A;  2DOF A;  2E71 A;  2KIQ A;  2KIS A;  1UZC A;  2CQN A;  2DOE A;  2JUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...