1UZCA

The structure of an ff domain from human hypa/fbp11
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
QPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords HYPOTHETICAL PROTEIN FLJ21157
publication title The Structure of an Ff Domain from Human Hypa/Fbp11.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2004-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 1uzcA00
2JUCA 2DOEA 2KFDA 2KZGA 2DODA 2K85A 2KIQA 2LKSA 2E71A 2CQNA 2KISA 2B7EA 4FQGA 2L9VA 1UZCA 2DOFA
chains in the Genus database with same CATH superfamily
3BJOA 2ZSIB 3V7CA 1HKSA 1ETQA 1WQ2A 1VF9A 4YFNF 1VQ4I 1W5TA 2XC7A 4HAMA 4D7MA 1BN5A 1G59A 4A3JJ 4DBQA 1A04A 1OCTC 3B6CA 3IUOA 3OOUA 2D45A 2BXZA 1MDMB 2DQLA 3FK7A 2DPUA 2XPWA 2AQFA 3AL0C 1T0FA 1X4PA 2XGEA 2CQXA 1QZZA 1ZN2A 3OIOA 3F3XA 4NQWB 5EZHA 3ZP5A 1VQNI 3AL0B 1XGOA 3MZYA 4Q5SF 2Y9ZA 3E5UA 2K4BA 3LA3A 4AD9A 2VPRA 3HRUA 1LFBA 1WGXA 1VQOI 3PQJA 1MZBA 2VIXA 4WXHA 3SHFA 1IV6A 1JUSA 3DF8A 3B6AA 3LA2A 3QPSA 4EQQA 3BQZA 2E19A 3BP8A 3KYCB 3JRHA 4MGRA 2HZDA 3TO9A 1UFMA 5H20A 3WGIA 2Y2ZA 4AWXB 1OR7A 1J7KA 3DEUA 1MKMA 2QQ9A 1QA6A 1YX3A 4E6KG 3WTUC 2IJLA 3JW4A 3WTZA 1W5CC 1HDPA 4P1WA 5DUIA 1HXDA 1JKRC 2HTJA 2VQLA 2DA7A 1X1PA 5CVUA 3GFIA 2DMPA 2VI6A 3EUAA 4A0XA 3L09A 4BE0A 4XQFA 2VBYA 1H9TA 4DGWB 2EFNA 2KIUA 4XBFA 3QU6A 3TMOA 1XSDA 2LP0A 4LLGF 4RAZA 1FC3A 1TTYA 1ETWA 1BI1A 1JHHA 5H2FC 2CRGA 2LH9A 5C4XJ 1H88C 3FM3A 4HLYA 1FSHA 2UUZA 2TDXA 3EQLF 2NAZA 4IQ4A 4MTEA 3DPUA 4QLCU 4HRIA 4I0BA 3ZCOA 5GP9A 4UHTA 3BR3A 5TISC 4G6QA 4M3FA 2LNBA 3HOYJ 3R0JA 5EEAA 1N25A 3M4OJ 4Y15A 3D0SA 1ZREA 4CUGA 1D0YA 3OYGA 1BJZA 4BHBA 2R5ZB 2P5KA 4NHJA 4OINF 4L9NA 1FP1D 1MMNA 1ERDA 5L3CA 5M5YJ 4DYQA 2IW5A 4BY1J 2RQQA 3GUDA 1ONVA 2IS4A 1TNSA 1BOAA 3AAFA 3ZPLA 4UVCA 2R7QA 1R5ID 4GYGA 3HZJA 4LK1F 4M9SA 1QVUA 3A01A 9ANTA 1T56A 2XAQA 3COAC 2X4HA 2ISZA 2M34A 2HQ5A 2Y9YA 4JX6A 1O57A 3F0CA 3GZ5A 1LJ9A 4HDUA 2XF5A 3CCEI 3MN2A 2QWWA 4C2MJ 2P7CB 1ZHFA 4CGZA 2K3FA 3OYJA 2W57A 1LFUP 1B8IA 2L54A 3H9QA 5DS9A 1P4WA 2VB6A 4XKWA 2Q1ZB 2CUFA 2DYRH 2ZC2A 1TP4A 2GIVA 3PL8A 2JUGA 3GZNB 3L00A 1FBSA 1R58A 2YU9J 4JQFA 1IRFA 3RYPA 5DYMA 3H3UA 3ROUA 1R9TJ 2JN6A 3HJEA 4AUXA 3CF5F 4DQ2A 5LEJA 4EM0B 3J7AO 5E1WA 1REPC 2E36A 1S5LC 2AXTC 2CWEA 1V5EA 1EJ9A 3FMSA 2FNPA 4BJ5C 2J5PA 1O3RA 2E2IJ 4CZCA 5CVRA 4QSHA 5DD4A 4AVPA 3VPRA 1ZLJA 2ZNZA 3ZGKA 1I1GA 4XKBA 3L2UA 4IOCF 2QKMB 2ZXIA 4I2OA 5B1AH 3K4MA 2KLOA 4PSXA 4HLXA 1KYZA 1MIJA 4ZJZA 2DFFA 1SVLA 4BXUA 2NNYA 1ON1A 4XN0A 3VSKA 3TDZC 1RPWA 3DTIA 5JVTA 3BG9A 3W6KB 1GHCA 3ULQB 1HSJA 2UXXA 3MD2A 1YW7A 3MCZA 3PUFA 2TCTA 2HOAA 3TOAA 4FISA 4A0ZA 1R23A 1SVOA 2XB5A 1HSTA 3CMAI 2IGOA 1U5TA 3JRAA 3EUHC 2ELHA 1Y1WJ 2IEKA 2CU7A 1TT5B 2L4MA 2UZKA 1XG1A 1BL0A 5HLGA 2WBMA 1VFCA 2DTRA 3BROA 4P9FA 1LDJA 2FQ4A 4KIGA 5J6XA 3CD6I 4L5IA 1LE8B 3SQNA 1B72A 4GGGA 2BOLA 4JYKA 3S17J 2M1BA 4PFPA 1XDSA 3LSJA 4B1RA 3DLAA 1T95A 2GXGA 1BA5A 3PNVA 2LBFB 1CF7A 3L9FA 3HTSB 5IY5H 2Z2SB 1OCZH 5M3MJ 2ADUA 2NYXA 4UB6C 2VKHA 3SDGA 2L7MP 4G7HF 3A2KA 3REOA 2E1MC 4HX4A 2F5FA 3G4SI 3F9KA 2JK3A 2K7LA 2L7FP 4A5MA 2K27A 2HQRA 2O03A 2A69F 5LHIA 4RGUA 2F48A 5LHHA 3NAUA 3AG2H 3AFHA 1OJLA 3WU1B 3ZQCA 4OMYA 2W24A 3WG7H 2YX4A 3JCUC 2HOTA 1WVRA 4A3GJ 3HRTA 4B47A 1E3PA 3ONQA 4HF0A 3C2GA 4RBOA 1DDNA 3SFIA 1RUNA 2HVRA 3CC4I 5GTIC 5JHFA 4II2A 2HYGD 2M7AA 1YTYA 4Y52J 2BW3A 1ZRDA 4RB2C 2DFIA 2E1OA 2V7FA 1FY7A 4L5JA 4CCMA 2GOMA 1P6RA 4BL0B 2Z5UA 1QZYA 4AVZA 5GADJ 3R0AA 4ESFA 2XGDA 2XV4S 1WH7A 5KCMA 2A5WA 1LNWA 1V5GA 2FBKA 4FQGA 3QU3A 3E3VA 4XKCA 3EUKL 2Y0MA 1I5ZA 4IXAA 3N4MA 1BW5A 1BI2A 1IN6A 2NOGA 3HSRA 4X1EA 4XORA 2R7VA 2M0CA 2PMZN 3H0DA 2DA6A 4P5OA 2I5UA 3RYRA 5D4RA 2NS7A 5EGOB 2DA1A 4RM3A 3W6VA 5K5QA 2HS5A 3S3OA 2O8KA 3BPXA 3OR2C 2CJJA 5ERIA 1X1CA 3IKTA 3EYYA 1QPIA 5K7FA 3CUQB 1O7FA 4L9JA 3OWTA 2K9LA 2M3AA 3F8FA 4HQMA 2JA7J 3VYSB 4YELA 3OYDA 2GXBA 2K02A 2KDOA 2RC4A 1LUJB 3H5RA 1Y56A 2LKXA 2A5YB 4F92B 3O6BB 2R5YA 3EYIA 2GA2A 3BPVA 2DA5A 2BY0A 1SVMA 2M45A 3FXKA 3V7RA 5F27A 4M3BA 2WC2A 2A3SA 3PFIA 4ABZA 3JAMZ 4XLPF 4O6JA 3L2VA 3I4MJ 3CTAA 4RB3C 3HKZA 1DQUA 2VASA 1GT0C 3CDHA 3LNQA 3A1YA 1MW7A 3T1BA 2KRHA 3LFUA 3LAJA 1XCVA 4HBLA 1XMKA 2KRCA 2MD5A 2GBYA 3KIOA 5HVQC 3WTVC 4BU2A 1UMQA 3LFKA 2XIGA 1QZEA 4TV7A 1R49A 2NNNA 1SC7A 4EM2A 2R3SA 4G94A 3IC7A 1FMWA 2L3DA 2KFDA 4PDKA 4U0YA 3HSFA 5KNLA 2ID3A 3GVAA 5K7HA 3M1EA 3CJQB 2LY9A 2BHYA 2M4KA 2PMHA 3WG9A 3OS2A 1F9NA 2JA2A 2LKPA 3JRFA 3QRFF 1O3TA 4XRSG 2R7ZJ 4N4OB 2BHZA 2FU4A 1R71A 3RKYA 1FOWA 1WJ5A 4DBRA 4HA8A 4S04A 3KLOA 1YITI 1FYLA 3J7ZI 1F1ZA 2V6EA 1Z1DA 2IA1A 1Z3YA 2K5CA 3OIQA 5IOZA 2E5NA 4IRHA 5L3DA 5M5WJ 2R4GA 2ME6A 1PP7U 2QEXI 1X3WB 3CUOA 4B43A 4BQNA 1D8JA 4LB5A 4UY8I 3DQVC 4XLCA 1T8IA 3I56I 5F1JA 2WA0A 4EVIA 1QU3A 2ZO4A 4UUSA 4IHWA 3FWEA 3SZGA 4HYEA 2Z33A 2ZXHA 3T0YA 2V4JC 1WI9A 1ZTRA 3FZVA 3K2AA 4HDVA 1JKOC 2KL4A 1T33A 2CW8A 1VNDA 2LTPA 4XL9A 4IHXA 4XLAA 4B8XA 3O8GA 3RJPA 3OYLA 1SD5A 4CCNA 4KT5C 1AU7A 4F55A 5DCMA 1XDUA 3Q9SA 3PUBA 3DLLF 5HDGA 2XDVA 2FE3A 3JRBA 4L5EA 4DYCA 5FLXK 3IWFA 3RPUA 3I9V2 4ZYHA 1H8AC 3DTKA 3ZRGA 4LG3A 3K1PA 2FOKA 1L3LA 2Y0SN 3QPHA 1FYKA 1R5HA 2PX9A 1A5JA 5E1XA 1TC3C 3ABTA 1HKQA 4EJUA 1R5GA 2JRTA 4Y4RA 5E3NA 4MIMA 1QBJA 4A3FJ 1MMSA 2O3FA 2UV1A 4OOIA 2VPLA 1OFCX 2L9RA 3H36A 1E3OC 1YIJI 5CVVA 1UG0A 2LG4A 4EJWA 1IJWC 1IXRC 3KP7A 3Q0WA 3QQAA 3E5QA 4F3QA 4PUSA 2IPQX 1SMTA 2CW7A 3A01B 1XCBA 3S16J 3G1OA 1FP2A 4A3MJ 2PBIA 1K6YA 1BIAA 2E34A 3C7JA 1K4TA 1LPQA 3HOXJ 2QKLB 4A3KJ 3F22A 2EV0A 2A6TA 2L7KA 3CCLI 3M8FA 1S3JA 3K4KA 1Z05A 3LL7A 1E17A 2CMPA 2A68F 3PSFA 4YEJA 1TWCJ 1UAAA 1G4DA 2MYSA 1W4MA 4U7BA 2ETHA 1F36A 3SEQA 2FOWA 3S3NA 5DEQA 1Z77A 3A0HC 4KNYA 4C9YA 4U7DA 2JSCA 1XMXA 2STTA 2DOEA 5LGNA 1RESA 1WKMA 4A0YA 2VXZA 1POGA 1XTAA 2VBWA 4ZH4F 2IA2A 2R7WA 3O3KA 3PIOF 1RIOH 3FF5A 3DBRB 3OYAA 4WWCA 3BCBA 2DLLA 1K7AA 3HRSA 1Z67A 2R7TA 4C3JJ 3ZQFA 1D3YA 2HR3A 4ON0A 3QOPA 4FCYA 4R1HA 4MQVA 4BEHA 1WI3A 3EUHA 1Y39A 3MZ8A 4AIKA 2M87A 1ZGJA 2Q8KA 3SDBA 2P4WA 2VONA 2X6OA 1G6NA 4L9VA 1N78A 5HLHA 1ODDA 1SEUA 3S1NJ 1FSEA 1KZHA 4D7NA 3Q3SA 2XPUA 1IG7A 4XLFA 3SXYA 4CO8A 2CGPA 4OWRB 4PFOA 3BY6A 3ASOH 2EA2A 2X6XA 1WJEA 1FOYA 5CVIA 3K10A 3ZXSA 2HGCA 2KT0A 1T39A 1U5TB 1LQ1A 1TWFJ 2H6BA 2NVYJ 2VJ4A 4R79A 2RN7A 1ZQ3P 2CV1A 2BZTA 5JHUA 1ORKA 1KU3A 1U0JA 3ZQ7A 1MSFC 2HQNA 3BTIA 4ESJA 2QYOA 1ITYA 3J81Z 3HBLA 4F91B 1XD7A 4JOMA 1DU6A 3H35A 5EEHA 1PUFB 2H8RA 4IL6C 1TZLA 3QPTA 5LHGA 1X2NA 1JXSA 1OCRH 3C1DA 3ERMA 1CF7B 5D6EA 5EJCA 2EFOA 1G3TA 1MBHA 2VC0A 1SFXA 4D5CA 1IC8A 2MABA 1ULYA 3NEUA 1WJBA 4Z6YA 4Y7NJ 1HLVA 2IRFG 2W00A 3T8RA 3ABLH 2VOPA 1KQ9A 1TW3A 4M71A 1VQKI 3FXRA 1DGRM 5FKNA 3J80Z 3CF2A 3OYBA 5LGUA 3ZQIA 1L0OC 2X1CA 4X6AJ 4RA2A 2WB1A 1FZPB 3HGGA 1BBYA 2XGXA 2IP2A 4LD5A 2WADA 4M6YA 4D1QA 1F43A 1BI0A 2HOSA 2IVMA 1TL8A 4UXNA 4QPQA 3GTQJ 2ACJA 1EH6A 3F8NA 4EATA 1A31A 1WFXA 3E6BA 3BTLA 2FRHA 3VODA 2OCEA 1MH4A 4X0GA 2LVSA 1HBXG 4LFUA 3EPZA 5EG0B 1IRGA 2DJIA 4IF4A 1VQ8I 2DFHA 3R4KA 2VKDA 2HVQA 1TQPA 4HX8A 1HC8A 3RQ4A 4HOBA 4QTRA 1TW2A 1HW5A 3P5JA 1ETXA 4BHCA 1EF4A 3ZMSA 2Z16A 5J1YA 1R22A 3WU2C 3N97A 4LB6B 4U88A 4C3IJ 2EIJH 3CMMA 2G7UA 4YIFA 2K85A 3KX2A 4KT6A 4ZDPA 2HNHA 3OL4A 4N9HA 3FIWA 1P7JA 2EA4A 2XASA 3CLOA 4FETA 3WHBA 4XSZF 3D5LA 4O3MA 3IH4A 1V3FA 2O7OA 3SYTA 3KP6A 1YS6A 2DI3A 3KYDB 1KONA 5GAGJ 3K4NA 3TKYA 1LB2A 3S2HJ 3P9KA 4BBSJ 1UHSA 1AHDP 1GUUA 4UV8A 3NRVA 3RZDJ 1R00A 1NK2P 5KK1A 3HUGB 4O5VA 5FFZA 4Q47A 4C2UA 3K7AJ 4ZYDA 2KZVA 2P7VB 4MEXF 3CCUI 5HS8A 5GAHJ 2DT6A 3RKXA 5IYDJ 2GLOA 3CMEI 1USSA 4ZZLA 1QQIA 5HDNA 3H9JA 1VQ7I 2CO5A 2RQPA 3I53A 5F0FA 2EH3A 4HNTA 4CYCB 3P9IA 3KP3A 3JTHA 3OYKA 5C3EJ 1UELB 2O9LA 2LDUA 2RNJA 3CCRI 3ECOA 5DM7F 1Z3XA 3O8HA 3LSTA 1IAWA 3SZPA 2XROA 3TQNA 2EILH 2ID6A 1B4AA 2YR2A 4B4CA 2L4AA 4A6EA 1TWAJ 1YFHA 1DU0A 4KJZA 5CVJA 3ZQQA 1FWZA 1P2FA 3ZMZA 1IN7A 1IV8A 1YX5A 2OCCH 3GTKJ 1MMDA 1RZ4A 3BG3A 1KQ0A 4G8XA 2OC6A 2DT7B 1GLNA 3LA7A 1BJAA 2QCOA 2W82A 3B73A 4WF2A 5E3OA 1RRJA 1W36D 5BOXA 1W36C 3PIPF 2LKSA 3CO7C 4DW6A 4KYWA 3IRQA 2CUEA 3J7AY 3R60A 3CCQI 1F5TA 2OV7A 4ZYEA 1E2XA 4I7HA 3OSGA 4RGRA 1G2HA 2IXSA 1HCRA 4GFBA 3GFLA 3KEYA 3BG5A 1KU9A 2RVCA 2X9DA 3LQRA 3E6MA 1X3ZB 1N75A 2COBA 1MBKA 2K4JA 1YJNI 1JHFA 2NS0A 3EDPA 3BWGA 5F1RA 3VYUB 3KP2A 4EGYA 2MG4A 4WK8F 2ME0A 3A03A 1B9MA 3H0GJ 4WXCA 5CKTA 5HS7A 3IH3A 2WWYA 2FMLA 2L9VA 2JSPA 1R6RA 1XC5A 1ZELA 3K4BA 1XGMA 4ZYAA 4F52A 1AKHA 4GYIA 4CYDA 1ZG3A 4BS9A 2ZBKA 3ZOBA 3TO6A 3U1DA 1U2WA 3OYMA 5J4YA 3CDIA 1ZK8A 3L1PA 2BBYA 2KJBA 5C4JJ 3RPUD 2G0EA 2V9PA 4B48A 1RUOA 2DDAA 2VJIA 4BXFA 2CUJA 2OPTA 2F5CA 4HV6A 1TBXA 1Z6RA 4BBRJ 5JR3A 1B59A 3P9CA 5CPRB 2ZJQF 4BJ6C 3CCSI 2HI3A 5FKMA 3WHCA 2E1NA 2DK8A 4PSWA 4WX9A 3P7NA 2AS5F 4J00A 4FX4A 2J5OA 4P55A 5ILUA 3VDXA 4JBAA 3H1CA 1D1BA 5IPAA 3RQIA 3TW7A 1VI0A 3LSPA 1UHMA 1I39A 2A61A 2K9QA 2XAHA 2ZNYA 4NB5A 1S72I 3RZOJ 4WXDA 3I3LA 1S7AA 3JRDA 2JA6J 1FNNA 4A3IJ 1MJ9A 1HW1A 1XMAA 1D5YA 3ZR8X 3DBHB 3KP5A 2XF7A 4HZFA 4RGXA 1P92A 1RKTA 5M3FJ 3BR2A 2L5QA 1RKWA 3OYFA 2FQ3A 4RS8A 5FB2A 3OYNA 1HKTA 4RLQA 4G6DA 4M72A 5H6QA 3KP4A 3D5SC 2HDDA 2DCEA 3LSIA 2XRNA 2ECBA 2KPMA 3BDDA 4W97A 2V79A 4XKVA 2ZMEA 3HKZN 4ETSA 3GZ6A 4EEFG 3WTTC 1YJWI 2KRFA 4XOPA 3I71A 4BAYA 1FT9A 4B3XA 4EM1A 3S1QJ 1EKEA 3ABMH 2QBYB 2QM3A 2LYCA 1KU7A 3KE2A 2JZYA 2M9HA 3A4CA 3MZHA 2BYVE 2W84A 3MKWB 2CQKA 3IKVA 4LG0A 3L2RA 4HNVA 4CHUA 3PFYA 3NARA 3QOEA 3QYBA 3GF2A 4II3A 3WE2A 4BEHB 4D9JA 3IL2A 1EH8A 1Q1HA 1H89C 4AC0A 4P9UA 3K4LA 4MQ9F 1VQMI 2H94A 3CZ6A 5BPDA 2YPRA 3IV5A 2MBFA 3HHGA 1AOYA 4Q4ZF 5FJ8J 4EGZA 3TP0A 3K69A 3JSOA 2H27A 2PN6A 1GDTA 1R1TA 2BXYA 2E7WA 5LBQA 1Y1VJ 5L3GA 2VT3A 2JWTA 4BHPA 4A3BJ 3DBLB 1K4SA 2IBDA 2ELKA 1MBFA 4MFDA 3GLLA 1IF1A 4I6ZA 3NWSA 1WRJA 5AONA 2XPVA 5ICGA 4LMYA 4MTDA 1ZYRF 2P0WA 2Q0OA 1ZAOA 3AKZA 3CP8A 4XOTA 2NXNB 5J3LA 3I4PA 2FSWA 2VJJA 1YOVB 1X1DA 1S7EA 3TEDA 5IT9K 2VBXA 5IP6A 4XLEA 1JTXA 2VBZA 2DOFA 4GXOA 4MHGA 5IYCJ 3HSEA 1UG2A 3OMYA 4OMZA 2IT0A 1Z21A 5D4SA 1C0WA 3CC7I 3CDLA 2DMTA 1H9GA 3F8CA 4AU7A 2L01A 4D0PA 2ZCWA 3I59A 4KIFA 5ICFA 1HOMA 2QSGX 3E6DA 3FK6A 1YLFA 1IN8A 1U3EM 2F5VA 4BACA 2R7DA 3QAHA 4HNUA 3ZMVA 5HNHA 1IZ1A 4L18B 1JUMA 3DCFA 4IKFA 3CUQC 2MC3A 3IH2A 3S32A 3HHHA 3S2DJ 2JJ7A 2PMUA 4ASNA 3GX4X 2YU3A 1HQCA 2EZHA 4IEJA 4KICA 4J01A 3L2WA 1HA8A 1RR8C 5CQGA 1JE8A 1W7PA 5FKOA 3FXMA 4IHYA 2AXLA 1KQ8A 1CQTA 5B3SH 5GTHC 2BVMA 3BLYA 1J09A 4HW0A 5EF6A 2OTLI 4UUVA 3H3VK 4ZTJA 4RGSA 1MDMA 2CFXA 2WY7Q 3V7SA 4KMFA 3BR0A 2LMDA 3MMYB 2KIQA 4NQWA 4RAYA 3M7GA 3M3YJ 3IHUA 3M1CA 5FLMJ 4IHTA 2V26A 4XNFA 2Y48A 4BYYA 2VE9A 3KEOA 3M07A 2DFEA 2PFBA 3BQYA 1IXCA 3I0TA 2G9WA 4RAGA 2EFWA 2M7BA 1O3SA 2QUFA 3OY9A 2M8GX 2X1EA 2KZGA 3GXOA 1SFEA 1T0FC 1WH5A 2LOOA 2IGMA 4H0EA 2OA4A 2NOJB 2JTVA 5HDKA 3ZQLA 3WE3A 1P4AA 1VTNC 5BMZA 3ISPA 1ETVA 2DAOA 1YG2A 1DP3A 3UR3C 3DEWA 1MSEC 4EJOA 3O2PE 3I58A 4Y3OA 2DODA 3DKXA 4AIHA 3G6EI 2M0MA 1P9QC 1JTYA 1TLHB 4E4HA 1TWGJ 5F64A 1WZ2A 1S29A 3GWZA 1OYIA 3LQQA 1IUYA 1SFKA 1B9NA 2DA2A 3NWTA 5EEGA 3TGNA 5IP7J 2G7HA 1OR7C 4IVNA 5HODA 3ML6A 2X51A 2QF7A 2ISYA 4XLNF 3ESWB 3RIRA 2C6YA 3HIFA 3F8BA 1D8KA 1IN5A 2QLZA 1EV7A 2BV6A 1P7IA 4EJVA 2ESHA 4A12A 1IO2A 2DW4A 3T5XA 2H8WA 2YUSA 2RV8A 4XLHA 1FYMA 4KFCA 5E17F 2CFOA 2P8TA 2O61A 3HXLA 3KZZA 2Z1DA 3TW6A 2HXIA 2HFHA 5B66C 2IAIA 4HPQA 5FLVA 1ZG5A 1BC7C 3Q0UA 3K9TA 4IJAA 2E7XA 1UB9A 2VLAA 2B63J 4KN4X 2QQ8A 2DQRA 1NK3P 5FKLA 3HEFA 2DYSH 3HPHA 3JRIA 3QODA 4ZDLA 1OCOH 4E7SA 4CZZA 4MLOA 4CICA 1JKQC 2DMNA 2OTJI 1Q1VA 5D8KB 1G3WA 1FOXA 2P6SA 4BY7J 4AM3A 2FX0A 2ZKZA 1IUFA 3LSGA 4IHVA 4LIUA 4S0HB 3G73A 1MBJA 1YW8A 3DFGA 1ETOA 3KFWX 2WB1N 4HF2A 4I98B 3DTEA 3T8TA 3PSIA 1WSUA 4KITB 1J9IA 2QQAA 1ETYA 5LGTA 1MNDA 3I4NJ 4XSXF 1BI3A 2WV1A 1FJLA 2DOAA 4CCJA 2W48A 3GCMA 3ZMTA 1OYWA 1FBQA 3BZKA 3RPQA 5ICCA 1MJBA 4DZJA 3MWMA 3SZTA 4UNOA 2OUMA 1FLIA 1KGSA 2M5WA 1Y0NA 4R8HA 5A2QK 3JR9A 3WU0A 2OD5A 5CQEA 3KZYA 3W3CA 1B8IB 5E3MA 3ZQHA 1K61A 1APLC 3L2QA 2XSDC 1W1WE 2LC2A 5F0HA 2PEXA 3MVPA 2R7OA 5TRDA 3EETA 2DA3A 1BR4A 3H9GA 3H5AA 2PQ8A 5DDGA 3DV8A 4BDZA 3LSMA 5FLXZ 1I50J 4WCGA 1U9OA 3FXUA 3U2RA 3VFZA 1ZG1A 2STWA 5FGMA 4ZDOA 3CJNA 5HNFA 1RI7A 5M5XJ 2YSRA 3BR6A 4XONA 4A3EJ 4NC6A 3LAPA 2W1OA 4UUTA 4HSTA 3Q5FA 2JQ7A 1R4NB 1ZH5A 4A3CJ 3W6JB 1X19A 1XB4A 3HRMA 1U6GA 2LR8A 2E1CA 3OYHA 1JT6A 1Z0XA 1R7JA 1LE8A 3S2WA 5F0CA 2VKVA 2ZJRF 5F08A 2WTEA 2XKPA 3ASNH 2H1LA 2IS1A 3LWFA 3K1MA 4IZZA 5E18F 5JFRA 2DBBA 3BZCA 3DXJF 4MEYF 3R61A 4KUMA 1MMGA 1K78A 5GPCA 4I02A 3BTJA 2LBFA 3PM1A 4JK1X 1U5TC 2KKOA 5TJJA 1M1EB 2GWRA 3GW2A 2I10A 4PJJA 2ZJPF 4B3AA 2M4GA 2EK5A 2JA5J 3BG6A 3R6SA 2ZMEB 1FOKA 2R7UA 1X1BA 2VOOA 2DT5A 3I64A 2OF7A 1GXPA 1QGPA 5GAEJ 2AQEA 2HU9A 3M8EA 2X1DA 3QPLA 1SFOJ 1NH3A 2JPBA 1UZCA 1B72B 1RETA 1X2MA 5K7ZA 2GXAA 3VWBA 2HDCA 4CCLA 2ZB9A 1BOBA 2F6CA 4OAZA 5EDNA 1OISA 3MKLA 4PGGA 3UNGC 5D6FA 2JVHA 1OLTA 4ANJA 2I8DA 4LIVA 4AIDA 3SEZA 3RKQA 2JRMA 2V1NA 1JUPA 4RB1A 5FD6A 2KIFA 1QHGA 2EPFA 2KDZA 4A2UA 3WTXC 4AYBN 1YJ9I 4OIOF 2ZXJA 3GFJA 2OAZA 4BQOA 5J8CA 3S3MA 2EV6A 3WTYC 1O4XA 2B0LA 1T98A 2KHMA 2MFZA 3WTSC 3S1RJ 3N05A 3JTGA 4CCOA 3BJ6A 1MBGA 3RSNA 1Z91A 4M6XA 1V55H 2LK2A 1ZR4A 2X85A 3TDUC 4OIQF 3I54A 1J2XA 3CESA 3K70D 1TQMA 5EGOA 2BW3B 1QPMA 3HM5A 3TO7A 2M8EA 2XVCA 3DKWA 5ILSA 1XPXA 1A36A 2Q2EA 4MFEA 2NVQJ 3HOTA 1Y8RB 1VQ9I 3GYHX 2L9NA 3HOZJ 1YRNA 1MNMC 4YRVA 2FBHA 1MBEA 2Z3YA 3F72A 2M2EA 3AG1H 4A5NA 2GA1A 2Y30A 3K4JA 4IOAF 4DIQA 3AG4H 3K1NA 2VJ5A 2FA5A 4Y13A 3I55I 4C2TA 3IWZA 2W7NA 2UWMA 2E71A 3S15J 1SAXA 2Y69H 3AG3H 1QRYA 1ZRCA 4DNCA 3U9GA 2Z9OA 3F6VA 1W7PD 1WJAA 4PJNA 5L3EA 1LEAA 1FEXA 1DUXC 1W7PB 1U8RA 1PP8F 2IGKA 1D1CA 3F23A 1QHHD 4FTHA 4S05A 4HF1A 1EH7A 2XAUA 4JX4A 2GZWA 1HDDC 1OMIA 2DJNA 1A6IA 3RKWA 4LLNA 2A05A 1WHUA 2R5YB 2OZUA 1KA8A 2PI0A 2LY2A 2VODA 4L0YB 1LFPA 3H5NA 1K83J 1OKRA 1V54H 3OIPA 2DMUA 4BNCA 1JI8A 2VUMJ 2COMA 1V4RA 2HPIA 1WCMJ 2DTZA 1LEBA 3QWLA 1ZGWA 3L2CA 4XM3A 1FTZA 2VE8A 3B02A 5FD5A 2F5DA 3G1LA 2H09A 3CMYA 1J59A 1F4KA 4KIBA 2RAEA 4RDUA 2NVUB 1BC8C 2HYJA 3FISA 1GVJA 4F7ZA 4Q48A 4HV5A 3JRCA 3D1NI 4B44A 2BY3A 3CC2I 4OIPF 2BE5F 4NNJA 4IX7A 4BE1A 4M9ZA 1JGGA 5H6RA 3FX3A 2R92J 4AYBA 1TQIA 3HOSA 3J7YJ 1Z7UA 2E2HJ 2HWVA 4V19K 1MGTA 2OJED 4RAFA 1XGSA 3JREA 1H0MA 2F4OB 1FIAA 4PZJA 3V8LA 2VT2A 2DA4A 4YG2F 5IT3A 2VN2A 3MFKA 2MLKA 2FJ1A 5GPAA 1DPUA 1JJ6C 3GTJJ 2L2OA 4FX0A 2D2WA 1N77A 4I01A 4V2GA 1Z9CA 3OSFA 2NS8A 5LRSA 2FD5A 4UUSB 1WJDA 4BE2A 1S6LA 4C30A 1S8NA 3DP7A 5LLQA 4QPOA 1CGPA 5DCFA 1ZR2A 2E60A 3IAS2 1W5SA 3CLQA 4PCQA 5KVRA 2TRTA 2NRAC 3KYLA 3QYFA 2K9NA 2ZXWH 4M3GA 5CLSA 1X1AA 1XSXA 2CW0F 2XRLA 3MQ0A 1I3QJ 4XK4A 1IN4A 5LFAA 3BG7A 3HOWJ 1JKPC 5DCMB 2JT1A 5B1BH 1J75A 3FXOA 3H3ZA 2CS3A 2Y75A 2QSHX 2HXOA 1WWXA 2QA4I 4KMUX 4W1UA 4DOZA 3MKZA 3FM5A 2IGNA 1BM9A 2P81A 5FRNA 1U78A 4YFKF 1UCRA 4ESBA 1MH3A 2R7FA 5J8FA 3E97A 3S1MJ 1NTCA 2BEOA 1R1UA 3DU6A 4A6DA 4YIRX 1R4MB 4JP0A 1RNLA 2L02A 3G2BA 3RCOA 1QNTA 2WAFA 4NC7A 2MA3A 4I09A 3CJTB 4LLLA 5JLXA 1SD4A 3TOBA 3A02A 3LOCA 2F4IA 2GAUA 2FMYA 2VKEA 4BH9A 2N8GA 2WAQN 1LKXA 1U9NA 3CJRB 5F6FA 4XICA 2DMQA 5K5OA 1PUEE 2LFBA 4ZYGA 2R7SA 2ZFUA 3CCVI 3LMMA 3VSLA 3BZ6A 5E8IA 2ICWG 4XRFA 3U1KA 1XS9A 1AWCA 1NG7A 3V8JA 2PJRA 3KLNA 4LITA 4M3DA 3WTWC 2P5LC 2AHQA 6PAXA 3BOQA 4ITVA 2RKHA 5E20A 5HLIA 5K1YA 3FKIJ 4C3HJ 3WGGA 1HW2A 1XSVA 1OCCH 4KISA 2FNAA 2PG4A 4AIJA 2E5ZA 2JMWA 4G9YA 3GTPJ 3OOPA 3W2VA 1X3UA 2CV2A 4A3LJ 3IRRA 1TT0A 2CSOA 1VQLI 1Y6IA 4UVAA 3RTRA 4U0WA 3NQOA 4J19A 2K86A 3ECHA 2VQGA 3E0JB 2E35A 2HKXA 2BY2A 2V1DA 4PJLA 4BKXA 1RR7A 4LOCA 1PUFA 4U87A 4OIRF 1JJ8C 4HQEA 2YS9A 1K78B 4FASD 3FBIB 3TL4X 1ZLKA 3BJAA 4F93B 5ED4A 2JPCA 3VOEA 3SFZA 2O5RA 2XAFA 1MNEA 3TBIA 1WJCA 5DUKA 2XGCA 2DN0A 5IOYA 4YIIA 3FMQA 4LK0F 2FF4A 1Y0UA 2W85A 2D1HA 2WY8Q 2IS6A 3FBNB 4L0ZB 3FMRA 3C2HA 1UJ8A 2E1MB 2MH9A 3VEPA 1D5VA 2EFQA 1JT0A 4KN7X 4XR6A 1IGNA 2Y31A 3X2QH 5DM6F 2LSOA 2PLYA 3GBGA 3F21A 4E70A 5E79C 1YE9A 2X6WA 1FPQA 2JA8J 2FEZA 2BVLA 4CCKA 2VC1A 4LGWA 4GDFA 1OYYA 3ZMUA 2JVGA 2LLKA 1X4OA 3JRGA 2CV0A 2DO7A 2MSYA 5EG0A 2CQNA 1VZ0A 3KCCA 5TGTA 3G3ZA 5IP9J 1T38A 4BXXJ 1D1AA 1GV2A 5J1UA 4BGDA 4CXFA 1U8BA 4FT8A 1VQPI 2IS2A 4PJ0C 3JAMK 2QZ8A 2V1UA 3BT9A 1AA7A 3VB2A 3IAM2 3Q9VA 2ZJ2A 3JSPA 1YHQI 1R36A 2OQRA 2L0KA 4FE7A 3ZMDA 5J4VA 1V5FA 4RMNA 2MH2A 4E7IA 2O0YA 3DPLC 3HG9A 5E8GA 2WAQA 2FUG2 3CCMI 2A6EF 1I6HJ 5KAFC 2GM4A 2X6YA 3S93A 3S14J 3CO6C 2DDBA 5D8LB 4FHTA 2FXAA 2EB7A 2H1KA 1ZGAA 2K9SA 2DPDA 2KP6A 1I27A 1ON2A 5BS6A 2XAJA 3CCYA 3FKJA 3FHNA 2Q2EB 1T2KA 3ABKH 2Z99A 3DKYA 3WGHA 1LVKA 2EQRA 4N9IA 1SANA 5IT9Z 1I1SA 3DPTA 1YQAA 5FO5A 2R7XA 5D5UB 3W2WA 1NG6A 1YRNB 3QP5A 2F4MB 2AO9A 2B7EA 4NBQA 4A3DJ 5JLWA 4Y17A 1DPRA 4CDGA 5E3LA 3ZQGA 2EZIA 3GO5A 5ICEA 3HUGA 4RM2A 2DU9A 1PVEA 3BTCA 3QP6A 4I99C 2LF8A 1QVTA 4XMYA 1LVAA 5EZGA 3M9AA 1Z6TA 2QSFX 5B5EC 1BR2A 3V4GA 4EV0A 2XF6A 1WJFA 1WPKA 3FHZA 1E3HA 4G7ZF 2RREA 3RDIA 2CYYA 4G6TB 2ELJA 3ELKA 1TWHJ 4N4NB 1GVDA 3F8MA 4CYCA 2ECCA 5DTDA 5J40A 2EZLA 1IDZA 4OU0A 3HPGA 1LDDA 1YW9A 2GOXB 5D5VB 4XRSA 4I76A 3TP3A 2XKOA 1D0XA 4M6VA 1J0RA 3KZIC 5BQTA 5DV5A 3L7WA 1BR1A 1TNTA 2FBIA 4ZC3A 2K40A 3GTGJ 4U0VA 2EBIA 3GLXA 2CG4A 1ZARA 2EIKH 1O7LA 4M9XA 1I3AA 2IA0A 2GQQA 3LSKA 3PO3J 2QQBA 3G71I 4H4KC 2F2EA 4A93J 1T6SA 4KA4A 4K2EA 3OYCA 2OZ6A 1X58A 3MAJA 3ERED 3RI4A 2K9MA 2CUZA 2HZTA 4A69C 4NDLA 3E6CC 5E1ZB 3GMEA 5EYRA 2R5ZA 2P5VA 2V1XA 3VYRB 5J47A 1YS7A 2HOEA 2MW8A 3DEEA 2LF7A 4PJMA 2HEOA 4EMSA 1OPCA 2XHKA 1SD7A 2EWNA 3ZN1A 4E7HA 3LSHA 1JGSA 2QGUA 2XAGA 4HX7A 4DYRA 1S9HA 2ZFWA 4E7LA 4ZZDA 2JUCA 5HS9A 1QO0D 1G8XA 3E1SA 5D5WB 3OYEA 4BDYA 3GTLJ 5KAIC 2MC4A 1KYWA 4NUBA 3FXJA 2KMUA 3F6OA 2R0QC 1G3SA 1LDKB 5F04A 4L9TA 3DU5A 3GTOJ 2V9KA 4PGHA 2LY1A 2OBPA 2W25A 5AIQA 5ILVA 4UV9A 3H92A 1Z7LA 3A0BC 5BNGA 3HB9A 1ETKA 1ZKGA 4B09A 4BJTA 1XGNA 4LJZF 3KETA 1I6XA 2PMZA 2UXNA 4M3EA 2EIMH 5FKKA 2LREA 1UHWA 3PQKA 3PO2J 2EJRA 1NHAA 5KHDA 1ACIA 1E0EA 3C18A 2LRDA 5C44J 2V6CA 3MEXA 1B6AA 3K6GA 1D0ZA 2HTSA 2P6TA 2HQAA 3KPHA 4ZTFA 2OQGA 1K6OA 1VQ6I 2NVXJ 2BY1A 1IRZA 1SMYF 1OCPA 1AKHB 5DD8A 2WV0A 2VQCA 4FE4A 3HGYA 1P4XA 3C2BA 2D5VA 4CH7A 5LD2C 3V8KA 1R1VA 5FFXA 3I5UA 2XSJC 2HYFA 5CYVA 4MNUA 2QENA 1Y8QB 3Q0VA 1BW6A 3OS1A 2EINH 4Y33A 3GTMJ 1J5YA 4RB0A 2O8XA 3OV8A 3QYEA 1W0TA 3E5XA 3GEZA 1KU2A 4IHSA 4BQQA 3MKYB 3PNTA 3HTUA 3IP4B 4E7JA 4I0AA 2RNGA 3K4CA 1IW7F 1EA3A 4ENJA 2XUBA 1G3YA 1FBUA 4GCVA 3D5RC 4G12A 1MMAA 1YYVA 4CA0A 2HKOA 1SD6A 4IPAA 4YFXF 1GXQA 2XB0X 3HOVJ 2ZSHB 1FTTA 3J81K 5D5XB 4IRGA 4E7KA 5HOOA 2QBYA 2M30A 3C3WA 2WAEA 2BGCA 4N0BA 4ENNA 4M73A 2ESNA 1B1BA 4BUPA 2V9VA 5LEKA 1DGWY 3CP2A 5A2QZ 4M74A 5L3BA 3GFMA 4GO1A 2KISA 4HG2A 2ZMEC 3VYTB 2O6GE 4OAYA 4NC8A 1O3QA 4IO9F 4CSWA 2EFPA 2H6CA 2L9SA 3OL3A 4HEA2 5IYBJ 2PJRB 4XN3A 1IRXA 1IDYA 2HDWA 3ABUA 3U21A 3K0LA 1HF0A 4XIDA 3J80K 4JX5A 2VQHA 1ENHA 1RC9A 1FIPA 3S8PA 3OS0A 3HL2A 2LD5A 3HC7A 1MD0A 4E7ZA 4KDPA 2HPMA 1PYVA 3DWLE 3KEQA 2MD0A 2L7ZA 4LG0B 2EV5A 3WODF 1GV5A 4EJTA 2KQRA 1SFUA 4Z2YA 1IXSB 4QWQA 2NVTJ 2CQ7A 4V2FA 5K5RA 1ZRFA 4P96A 1BIBA 5BPIA 2HVSA 4IRIA 2R93J 1YIOA 2F5EA 3OYIA 1PDNC 2K3PA 5L3FA 5J1RA 3BR5A 4BQAA 2DXIA 2MGQA 1VQ5I 3HDDA 1OQYA 1A35A 2B9SA 3UKGA 2GIZA 5AIPA 5HLTA 1FX7A 1K79A 2D1VA 2KIMA 4DJAA 1FMVA 4ENMA 4UB8C 3K2ZA 2CH0A 1A6QA 3FXLA 3PNYA 2R7RA 4MO7A 2A6HF 3BCAA 2OU2A 4HSRA 2CQQA 4XRMA 5CJ9A 2W4SA 5JVGF 4DZPA 2Y0SA 2E2JJ 3M8JA 3FDYA 1SAUA 2MLGA 2PJPA 3K70C 4QIWN 3G1MA 3V42A 4G7OF 1XN7A 1W0UA 3LSRA 3W2AA 2RGVA 3PJRA 2RDPA 3FXQA 4D5FA 2VXDA 2VL8A 2QVOA 3OR1C 1USTA 4RLFA 2EZKA 3CUQA 3CQZJ 1STZA 1DP7P 3HOUJ 1S7OA 3E7LA 1PJRA 2KJCA 1YI2I 2YX7A 1XX5A 5LRRA 3CCJI 3I59B 4UVBA 5FRMA 3SJMA 4IQJA 5JI6A 4GRIA 2X48A 4ENKA 4PK4A 2DK5A 3HYIA 3BC8A 3BR1A 1MJAA 3ZN0A 5FROA 2A07F 2X0LA 1T08B 1YO5C
chains in the Genus database with same CATH topology
2JUCA 2DOEA 2KFDA 2KZGA 2DODA 2K85A 2KIQA 2LKSA 2E71A 2CQNA 2KISA 2B7EA 4FQGA 2L9VA 1UZCA 2DOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JUC A;  2DOE A;  2KFD A;  2KZG A;  2DOD A;  2K85 A;  2KIQ A;  2LKS A;  2E71 A;  2CQN A;  2KIS A;  2B7E A;  4FQG A;  2L9V A;  1UZC A;  2DOF A; 
#chains in the Genus database with same CATH topology
 3BJO A;  2ZSI B;  3V7C A;  1HKS A;  1ETQ A;  1WQ2 A;  1VF9 A;  4YFN F;  1VQ4 I;  1W5T A;  2XC7 A;  4HAM A;  4D7M A;  1BN5 A;  1G59 A;  4A3J J;  4DBQ A;  1A04 A;  1OCT C;  3B6C A;  3IUO A;  3OOU A;  2D45 A;  2BXZ A;  1MDM B;  2DQL A;  3FK7 A;  2DPU A;  2XPW A;  2AQF A;  3AL0 C;  1T0F A;  1X4P A;  2XGE A;  2CQX A;  1QZZ A;  1ZN2 A;  3OIO A;  3F3X A;  4NQW B;  5EZH A;  3ZP5 A;  1VQN I;  3AL0 B;  1XGO A;  3MZY A;  4Q5S F;  2Y9Z A;  3E5U A;  2K4B A;  3LA3 A;  4AD9 A;  2VPR A;  3HRU A;  1LFB A;  1WGX A;  1VQO I;  3PQJ A;  1MZB A;  2VIX A;  4WXH A;  3SHF A;  1IV6 A;  1JUS A;  3DF8 A;  3B6A A;  3LA2 A;  3QPS A;  4EQQ A;  3BQZ A;  2E19 A;  3BP8 A;  3KYC B;  3JRH A;  4MGR A;  2HZD A;  3TO9 A;  1UFM A;  5H20 A;  3WGI A;  2Y2Z A;  4AWX B;  1OR7 A;  1J7K A;  3DEU A;  1MKM A;  2QQ9 A;  1QA6 A;  1YX3 A;  4E6K G;  3WTU C;  2IJL A;  3JW4 A;  3WTZ A;  1W5C C;  1HDP A;  4P1W A;  5DUI A;  1HXD A;  1JKR C;  2HTJ A;  2VQL A;  2DA7 A;  1X1P A;  5CVU A;  3GFI A;  2DMP A;  2VI6 A;  3EUA A;  4A0X A;  3L09 A;  4BE0 A;  4XQF A;  2VBY A;  1H9T A;  4DGW B;  2EFN A;  2KIU A;  4XBF A;  3QU6 A;  3TMO A;  1XSD A;  2LP0 A;  4LLG F;  4RAZ A;  1FC3 A;  1TTY A;  1ETW A;  1BI1 A;  1JHH A;  5H2F C;  2CRG A;  2LH9 A;  5C4X J;  1H88 C;  3FM3 A;  4HLY A;  1FSH A;  2UUZ A;  2TDX A;  3EQL F;  2NAZ A;  4IQ4 A;  4MTE A;  3DPU A;  4QLC U;  4HRI A;  4I0B A;  3ZCO A;  5GP9 A;  4UHT A;  3BR3 A;  5TIS C;  4G6Q A;  4M3F A;  2LNB A;  3HOY J;  3R0J A;  5EEA A;  1N25 A;  3M4O J;  4Y15 A;  3D0S A;  1ZRE A;  4CUG A;  1D0Y A;  3OYG A;  1BJZ A;  4BHB A;  2R5Z B;  2P5K A;  4NHJ A;  4OIN F;  4L9N A;  1FP1 D;  1MMN A;  1ERD A;  5L3C A;  5M5Y J;  4DYQ A;  2IW5 A;  4BY1 J;  2RQQ A;  3GUD A;  1ONV A;  2IS4 A;  1TNS A;  1BOA A;  3AAF A;  3ZPL A;  4UVC A;  2R7Q A;  1R5I D;  4GYG A;  3HZJ A;  4LK1 F;  4M9S A;  1QVU A;  3A01 A;  9ANT A;  1T56 A;  2XAQ A;  3COA C;  2X4H A;  2ISZ A;  2M34 A;  2HQ5 A;  2Y9Y A;  4JX6 A;  1O57 A;  3F0C A;  3GZ5 A;  1LJ9 A;  4HDU A;  2XF5 A;  3CCE I;  3MN2 A;  2QWW A;  4C2M J;  2P7C B;  1ZHF A;  4CGZ A;  2K3F A;  3OYJ A;  2W57 A;  1LFU P;  1B8I A;  2L54 A;  3H9Q A;  5DS9 A;  1P4W A;  2VB6 A;  4XKW A;  2Q1Z B;  2CUF A;  2DYR H;  2ZC2 A;  1TP4 A;  2GIV A;  3PL8 A;  2JUG A;  3GZN B;  3L00 A;  1FBS A;  1R58 A;  2YU9 J;  4JQF A;  1IRF A;  3RYP A;  5DYM A;  3H3U A;  3ROU A;  1R9T J;  2JN6 A;  3HJE A;  4AUX A;  3CF5 F;  4DQ2 A;  5LEJ A;  4EM0 B;  3J7A O;  5E1W A;  1REP C;  2E36 A;  1S5L C;  2AXT C;  2CWE A;  1V5E A;  1EJ9 A;  3FMS A;  2FNP A;  4BJ5 C;  2J5P A;  1O3R A;  2E2I J;  4CZC A;  5CVR A;  4QSH A;  5DD4 A;  4AVP A;  3VPR A;  1ZLJ A;  2ZNZ A;  3ZGK A;  1I1G A;  4XKB A;  3L2U A;  4IOC F;  2QKM B;  2ZXI A;  4I2O A;  5B1A H;  3K4M A;  2KLO A;  4PSX A;  4HLX A;  1KYZ A;  1MIJ A;  4ZJZ A;  2DFF A;  1SVL A;  4BXU A;  2NNY A;  1ON1 A;  4XN0 A;  3VSK A;  3TDZ C;  1RPW A;  3DTI A;  5JVT A;  3BG9 A;  3W6K B;  1GHC A;  3ULQ B;  1HSJ A;  2UXX A;  3MD2 A;  1YW7 A;  3MCZ A;  3PUF A;  2TCT A;  2HOA A;  3TOA A;  4FIS A;  4A0Z A;  1R23 A;  1SVO A;  2XB5 A;  1HST A;  3CMA I;  2IGO A;  1U5T A;  3JRA A;  3EUH C;  2ELH A;  1Y1W J;  2IEK A;  2CU7 A;  1TT5 B;  2L4M A;  2UZK A;  1XG1 A;  1BL0 A;  5HLG A;  2WBM A;  1VFC A;  2DTR A;  3BRO A;  4P9F A;  1LDJ A;  2FQ4 A;  4KIG A;  5J6X A;  3CD6 I;  4L5I A;  1LE8 B;  3SQN A;  1B72 A;  4GGG A;  2BOL A;  4JYK A;  3S17 J;  2M1B A;  4PFP A;  1XDS A;  3LSJ A;  4B1R A;  3DLA A;  1T95 A;  2GXG A;  1BA5 A;  3PNV A;  2LBF B;  1CF7 A;  3L9F A;  3HTS B;  5IY5 H;  2Z2S B;  1OCZ H;  5M3M J;  2ADU A;  2NYX A;  4UB6 C;  2VKH A;  3SDG A;  2L7M P;  4G7H F;  3A2K A;  3REO A;  2E1M C;  4HX4 A;  2F5F A;  3G4S I;  3F9K A;  2JK3 A;  2K7L A;  2L7F P;  4A5M A;  2K27 A;  2HQR A;  2O03 A;  2A69 F;  5LHI A;  4RGU A;  2F48 A;  5LHH A;  3NAU A;  3AG2 H;  3AFH A;  1OJL A;  3WU1 B;  3ZQC A;  4OMY A;  2W24 A;  3WG7 H;  2YX4 A;  3JCU C;  2HOT A;  1WVR A;  4A3G J;  3HRT A;  4B47 A;  1E3P A;  3ONQ A;  4HF0 A;  3C2G A;  4RBO A;  1DDN A;  3SFI A;  1RUN A;  2HVR A;  3CC4 I;  5GTI C;  5JHF A;  4II2 A;  2HYG D;  2M7A A;  1YTY A;  4Y52 J;  2BW3 A;  1ZRD A;  4RB2 C;  2DFI A;  2E1O A;  2V7F A;  1FY7 A;  4L5J A;  4CCM A;  2GOM A;  1P6R A;  4BL0 B;  2Z5U A;  1QZY A;  4AVZ A;  5GAD J;  3R0A A;  4ESF A;  2XGD A;  2XV4 S;  1WH7 A;  5KCM A;  2A5W A;  1LNW A;  1V5G A;  2FBK A;  4FQG A;  3QU3 A;  3E3V A;  4XKC A;  3EUK L;  2Y0M A;  1I5Z A;  4IXA A;  3N4M A;  1BW5 A;  1BI2 A;  1IN6 A;  2NOG A;  3HSR A;  4X1E A;  4XOR A;  2R7V A;  2M0C A;  2PMZ N;  3H0D A;  2DA6 A;  4P5O A;  2I5U A;  3RYR A;  5D4R A;  2NS7 A;  5EGO B;  2DA1 A;  4RM3 A;  3W6V A;  5K5Q A;  2HS5 A;  3S3O A;  2O8K A;  3BPX A;  3OR2 C;  2CJJ A;  5ERI A;  1X1C A;  3IKT A;  3EYY A;  1QPI A;  5K7F A;  3CUQ B;  1O7F A;  4L9J A;  3OWT A;  2K9L A;  2M3A A;  3F8F A;  4HQM A;  2JA7 J;  3VYS B;  4YEL A;  3OYD A;  2GXB A;  2K02 A;  2KDO A;  2RC4 A;  1LUJ B;  3H5R A;  1Y56 A;  2LKX A;  2A5Y B;  4F92 B;  3O6B B;  2R5Y A;  3EYI A;  2GA2 A;  3BPV A;  2DA5 A;  2BY0 A;  1SVM A;  2M45 A;  3FXK A;  3V7R A;  5F27 A;  4M3B A;  2WC2 A;  2A3S A;  3PFI A;  4ABZ A;  3JAM Z;  4XLP F;  4O6J A;  3L2V A;  3I4M J;  3CTA A;  4RB3 C;  3HKZ A;  1DQU A;  2VAS A;  1GT0 C;  3CDH A;  3LNQ A;  3A1Y A;  1MW7 A;  3T1B A;  2KRH A;  3LFU A;  3LAJ A;  1XCV A;  4HBL A;  1XMK A;  2KRC A;  2MD5 A;  2GBY A;  3KIO A;  5HVQ C;  3WTV C;  4BU2 A;  1UMQ A;  3LFK A;  2XIG A;  1QZE A;  4TV7 A;  1R49 A;  2NNN A;  1SC7 A;  4EM2 A;  2R3S A;  4G94 A;  3IC7 A;  1FMW A;  2L3D A;  2KFD A;  4PDK A;  4U0Y A;  3HSF A;  5KNL A;  2ID3 A;  3GVA A;  5K7H A;  3M1E A;  3CJQ B;  2LY9 A;  2BHY A;  2M4K A;  2PMH A;  3WG9 A;  3OS2 A;  1F9N A;  2JA2 A;  2LKP A;  3JRF A;  3QRF F;  1O3T A;  4XRS G;  2R7Z J;  4N4O B;  2BHZ A;  2FU4 A;  1R71 A;  3RKY A;  1FOW A;  1WJ5 A;  4DBR A;  4HA8 A;  4S04 A;  3KLO A;  1YIT I;  1FYL A;  3J7Z I;  1F1Z A;  2V6E A;  1Z1D A;  2IA1 A;  1Z3Y A;  2K5C A;  3OIQ A;  5IOZ A;  2E5N A;  4IRH A;  5L3D A;  5M5W J;  2R4G A;  2ME6 A;  1PP7 U;  2QEX I;  1X3W B;  3CUO A;  4B43 A;  4BQN A;  1D8J A;  4LB5 A;  4UY8 I;  3DQV C;  4XLC A;  1T8I A;  3I56 I;  5F1J A;  2WA0 A;  4EVI A;  1QU3 A;  2ZO4 A;  4UUS A;  4IHW A;  3FWE A;  3SZG A;  4HYE A;  2Z33 A;  2ZXH A;  3T0Y A;  2V4J C;  1WI9 A;  1ZTR A;  3FZV A;  3K2A A;  4HDV A;  1JKO C;  2KL4 A;  1T33 A;  2CW8 A;  1VND A;  2LTP A;  4XL9 A;  4IHX A;  4XLA A;  4B8X A;  3O8G A;  3RJP A;  3OYL A;  1SD5 A;  4CCN A;  4KT5 C;  1AU7 A;  4F55 A;  5DCM A;  1XDU A;  3Q9S A;  3PUB A;  3DLL F;  5HDG A;  2XDV A;  2FE3 A;  3JRB A;  4L5E A;  4DYC A;  5FLX K;  3IWF A;  3RPU A;  3I9V 2;  4ZYH A;  1H8A C;  3DTK A;  3ZRG A;  4LG3 A;  3K1P A;  2FOK A;  1L3L A;  2Y0S N;  3QPH A;  1FYK A;  1R5H A;  2PX9 A;  1A5J A;  5E1X A;  1TC3 C;  3ABT A;  1HKQ A;  4EJU A;  1R5G A;  2JRT A;  4Y4R A;  5E3N A;  4MIM A;  1QBJ A;  4A3F J;  1MMS A;  2O3F A;  2UV1 A;  4OOI A;  2VPL A;  1OFC X;  2L9R A;  3H36 A;  1E3O C;  1YIJ I;  5CVV A;  1UG0 A;  2LG4 A;  4EJW A;  1IJW C;  1IXR C;  3KP7 A;  3Q0W A;  3QQA A;  3E5Q A;  4F3Q A;  4PUS A;  2IPQ X;  1SMT A;  2CW7 A;  3A01 B;  1XCB A;  3S16 J;  3G1O A;  1FP2 A;  4A3M J;  2PBI A;  1K6Y A;  1BIA A;  2E34 A;  3C7J A;  1K4T A;  1LPQ A;  3HOX J;  2QKL B;  4A3K J;  3F22 A;  2EV0 A;  2A6T A;  2L7K A;  3CCL I;  3M8F A;  1S3J A;  3K4K A;  1Z05 A;  3LL7 A;  1E17 A;  2CMP A;  2A68 F;  3PSF A;  4YEJ A;  1TWC J;  1UAA A;  1G4D A;  2MYS A;  1W4M A;  4U7B A;  2ETH A;  1F36 A;  3SEQ A;  2FOW A;  3S3N A;  5DEQ A;  1Z77 A;  3A0H C;  4KNY A;  4C9Y A;  4U7D A;  2JSC A;  1XMX A;  2STT A;  2DOE A;  5LGN A;  1RES A;  1WKM A;  4A0Y A;  2VXZ A;  1POG A;  1XTA A;  2VBW A;  4ZH4 F;  2IA2 A;  2R7W A;  3O3K A;  3PIO F;  1RIO H;  3FF5 A;  3DBR B;  3OYA A;  4WWC A;  3BCB A;  2DLL A;  1K7A A;  3HRS A;  1Z67 A;  2R7T A;  4C3J J;  3ZQF A;  1D3Y A;  2HR3 A;  4ON0 A;  3QOP A;  4FCY A;  4R1H A;  4MQV A;  4BEH A;  1WI3 A;  3EUH A;  1Y39 A;  3MZ8 A;  4AIK A;  2M87 A;  1ZGJ A;  2Q8K A;  3SDB A;  2P4W A;  2VON A;  2X6O A;  1G6N A;  4L9V A;  1N78 A;  5HLH A;  1ODD A;  1SEU A;  3S1N J;  1FSE A;  1KZH A;  4D7N A;  3Q3S A;  2XPU A;  1IG7 A;  4XLF A;  3SXY A;  4CO8 A;  2CGP A;  4OWR B;  4PFO A;  3BY6 A;  3ASO H;  2EA2 A;  2X6X A;  1WJE A;  1FOY A;  5CVI A;  3K10 A;  3ZXS A;  2HGC A;  2KT0 A;  1T39 A;  1U5T B;  1LQ1 A;  1TWF J;  2H6B A;  2NVY J;  2VJ4 A;  4R79 A;  2RN7 A;  1ZQ3 P;  2CV1 A;  2BZT A;  5JHU A;  1ORK A;  1KU3 A;  1U0J A;  3ZQ7 A;  1MSF C;  2HQN A;  3BTI A;  4ESJ A;  2QYO A;  1ITY A;  3J81 Z;  3HBL A;  4F91 B;  1XD7 A;  4JOM A;  1DU6 A;  3H35 A;  5EEH A;  1PUF B;  2H8R A;  4IL6 C;  1TZL A;  3QPT A;  5LHG A;  1X2N A;  1JXS A;  1OCR H;  3C1D A;  3ERM A;  1CF7 B;  5D6E A;  5EJC A;  2EFO A;  1G3T A;  1MBH A;  2VC0 A;  1SFX A;  4D5C A;  1IC8 A;  2MAB A;  1ULY A;  3NEU A;  1WJB A;  4Z6Y A;  4Y7N J;  1HLV A;  2IRF G;  2W00 A;  3T8R A;  3ABL H;  2VOP A;  1KQ9 A;  1TW3 A;  4M71 A;  1VQK I;  3FXR A;  1DGR M;  5FKN A;  3J80 Z;  3CF2 A;  3OYB A;  5LGU A;  3ZQI A;  1L0O C;  2X1C A;  4X6A J;  4RA2 A;  2WB1 A;  1FZP B;  3HGG A;  1BBY A;  2XGX A;  2IP2 A;  4LD5 A;  2WAD A;  4M6Y A;  4D1Q A;  1F43 A;  1BI0 A;  2HOS A;  2IVM A;  1TL8 A;  4UXN A;  4QPQ A;  3GTQ J;  2ACJ A;  1EH6 A;  3F8N A;  4EAT A;  1A31 A;  1WFX A;  3E6B A;  3BTL A;  2FRH A;  3VOD A;  2OCE A;  1MH4 A;  4X0G A;  2LVS A;  1HBX G;  4LFU A;  3EPZ A;  5EG0 B;  1IRG A;  2DJI A;  4IF4 A;  1VQ8 I;  2DFH A;  3R4K A;  2VKD A;  2HVQ A;  1TQP A;  4HX8 A;  1HC8 A;  3RQ4 A;  4HOB A;  4QTR A;  1TW2 A;  1HW5 A;  3P5J A;  1ETX A;  4BHC A;  1EF4 A;  3ZMS A;  2Z16 A;  5J1Y A;  1R22 A;  3WU2 C;  3N97 A;  4LB6 B;  4U88 A;  4C3I J;  2EIJ H;  3CMM A;  2G7U A;  4YIF A;  2K85 A;  3KX2 A;  4KT6 A;  4ZDP A;  2HNH A;  3OL4 A;  4N9H A;  3FIW A;  1P7J A;  2EA4 A;  2XAS A;  3CLO A;  4FET A;  3WHB A;  4XSZ F;  3D5L A;  4O3M A;  3IH4 A;  1V3F A;  2O7O A;  3SYT A;  3KP6 A;  1YS6 A;  2DI3 A;  3KYD B;  1KON A;  5GAG J;  3K4N A;  3TKY A;  1LB2 A;  3S2H J;  3P9K A;  4BBS J;  1UHS A;  1AHD P;  1GUU A;  4UV8 A;  3NRV A;  3RZD J;  1R00 A;  1NK2 P;  5KK1 A;  3HUG B;  4O5V A;  5FFZ A;  4Q47 A;  4C2U A;  3K7A J;  4ZYD A;  2KZV A;  2P7V B;  4MEX F;  3CCU I;  5HS8 A;  5GAH J;  2DT6 A;  3RKX A;  5IYD J;  2GLO A;  3CME I;  1USS A;  4ZZL A;  1QQI A;  5HDN A;  3H9J A;  1VQ7 I;  2CO5 A;  2RQP A;  3I53 A;  5F0F A;  2EH3 A;  4HNT A;  4CYC B;  3P9I A;  3KP3 A;  3JTH A;  3OYK A;  5C3E J;  1UEL B;  2O9L A;  2LDU A;  2RNJ A;  3CCR I;  3ECO A;  5DM7 F;  1Z3X A;  3O8H A;  3LST A;  1IAW A;  3SZP A;  2XRO A;  3TQN A;  2EIL H;  2ID6 A;  1B4A A;  2YR2 A;  4B4C A;  2L4A A;  4A6E A;  1TWA J;  1YFH A;  1DU0 A;  4KJZ A;  5CVJ A;  3ZQQ A;  1FWZ A;  1P2F A;  3ZMZ A;  1IN7 A;  1IV8 A;  1YX5 A;  2OCC H;  3GTK J;  1MMD A;  1RZ4 A;  3BG3 A;  1KQ0 A;  4G8X A;  2OC6 A;  2DT7 B;  1GLN A;  3LA7 A;  1BJA A;  2QCO A;  2W82 A;  3B73 A;  4WF2 A;  5E3O A;  1RRJ A;  1W36 D;  5BOX A;  1W36 C;  3PIP F;  2LKS A;  3CO7 C;  4DW6 A;  4KYW A;  3IRQ A;  2CUE A;  3J7A Y;  3R60 A;  3CCQ I;  1F5T A;  2OV7 A;  4ZYE A;  1E2X A;  4I7H A;  3OSG A;  4RGR A;  1G2H A;  2IXS A;  1HCR A;  4GFB A;  3GFL A;  3KEY A;  3BG5 A;  1KU9 A;  2RVC A;  2X9D A;  3LQR A;  3E6M A;  1X3Z B;  1N75 A;  2COB A;  1MBK A;  2K4J A;  1YJN I;  1JHF A;  2NS0 A;  3EDP A;  3BWG A;  5F1R A;  3VYU B;  3KP2 A;  4EGY A;  2MG4 A;  4WK8 F;  2ME0 A;  3A03 A;  1B9M A;  3H0G J;  4WXC A;  5CKT A;  5HS7 A;  3IH3 A;  2WWY A;  2FML A;  2L9V A;  2JSP A;  1R6R A;  1XC5 A;  1ZEL A;  3K4B A;  1XGM A;  4ZYA A;  4F52 A;  1AKH A;  4GYI A;  4CYD A;  1ZG3 A;  4BS9 A;  2ZBK A;  3ZOB A;  3TO6 A;  3U1D A;  1U2W A;  3OYM A;  5J4Y A;  3CDI A;  1ZK8 A;  3L1P A;  2BBY A;  2KJB A;  5C4J J;  3RPU D;  2G0E A;  2V9P A;  4B48 A;  1RUO A;  2DDA A;  2VJI A;  4BXF A;  2CUJ A;  2OPT A;  2F5C A;  4HV6 A;  1TBX A;  1Z6R A;  4BBR J;  5JR3 A;  1B59 A;  3P9C A;  5CPR B;  2ZJQ F;  4BJ6 C;  3CCS I;  2HI3 A;  5FKM A;  3WHC A;  2E1N A;  2DK8 A;  4PSW A;  4WX9 A;  3P7N A;  2AS5 F;  4J00 A;  4FX4 A;  2J5O A;  4P55 A;  5ILU A;  3VDX A;  4JBA A;  3H1C A;  1D1B A;  5IPA A;  3RQI A;  3TW7 A;  1VI0 A;  3LSP A;  1UHM A;  1I39 A;  2A61 A;  2K9Q A;  2XAH A;  2ZNY A;  4NB5 A;  1S72 I;  3RZO J;  4WXD A;  3I3L A;  1S7A A;  3JRD A;  2JA6 J;  1FNN A;  4A3I J;  1MJ9 A;  1HW1 A;  1XMA A;  1D5Y A;  3ZR8 X;  3DBH B;  3KP5 A;  2XF7 A;  4HZF A;  4RGX A;  1P92 A;  1RKT A;  5M3F J;  3BR2 A;  2L5Q A;  1RKW A;  3OYF A;  2FQ3 A;  4RS8 A;  5FB2 A;  3OYN A;  1HKT A;  4RLQ A;  4G6D A;  4M72 A;  5H6Q A;  3KP4 A;  3D5S C;  2HDD A;  2DCE A;  3LSI A;  2XRN A;  2ECB A;  2KPM A;  3BDD A;  4W97 A;  2V79 A;  4XKV A;  2ZME A;  3HKZ N;  4ETS A;  3GZ6 A;  4EEF G;  3WTT C;  1YJW I;  2KRF A;  4XOP A;  3I71 A;  4BAY A;  1FT9 A;  4B3X A;  4EM1 A;  3S1Q J;  1EKE A;  3ABM H;  2QBY B;  2QM3 A;  2LYC A;  1KU7 A;  3KE2 A;  2JZY A;  2M9H A;  3A4C A;  3MZH A;  2BYV E;  2W84 A;  3MKW B;  2CQK A;  3IKV A;  4LG0 A;  3L2R A;  4HNV A;  4CHU A;  3PFY A;  3NAR A;  3QOE A;  3QYB A;  3GF2 A;  4II3 A;  3WE2 A;  4BEH B;  4D9J A;  3IL2 A;  1EH8 A;  1Q1H A;  1H89 C;  4AC0 A;  4P9U A;  3K4L A;  4MQ9 F;  1VQM I;  2H94 A;  3CZ6 A;  5BPD A;  2YPR A;  3IV5 A;  2MBF A;  3HHG A;  1AOY A;  4Q4Z F;  5FJ8 J;  4EGZ A;  3TP0 A;  3K69 A;  3JSO A;  2H27 A;  2PN6 A;  1GDT A;  1R1T A;  2BXY A;  2E7W A;  5LBQ A;  1Y1V J;  5L3G A;  2VT3 A;  2JWT A;  4BHP A;  4A3B J;  3DBL B;  1K4S A;  2IBD A;  2ELK A;  1MBF A;  4MFD A;  3GLL A;  1IF1 A;  4I6Z A;  3NWS A;  1WRJ A;  5AON A;  2XPV A;  5ICG A;  4LMY A;  4MTD A;  1ZYR F;  2P0W A;  2Q0O A;  1ZAO A;  3AKZ A;  3CP8 A;  4XOT A;  2NXN B;  5J3L A;  3I4P A;  2FSW A;  2VJJ A;  1YOV B;  1X1D A;  1S7E A;  3TED A;  5IT9 K;  2VBX A;  5IP6 A;  4XLE A;  1JTX A;  2VBZ A;  2DOF A;  4GXO A;  4MHG A;  5IYC J;  3HSE A;  1UG2 A;  3OMY A;  4OMZ A;  2IT0 A;  1Z21 A;  5D4S A;  1C0W A;  3CC7 I;  3CDL A;  2DMT A;  1H9G A;  3F8C A;  4AU7 A;  2L01 A;  4D0P A;  2ZCW A;  3I59 A;  4KIF A;  5ICF A;  1HOM A;  2QSG X;  3E6D A;  3FK6 A;  1YLF A;  1IN8 A;  1U3E M;  2F5V A;  4BAC A;  2R7D A;  3QAH A;  4HNU A;  3ZMV A;  5HNH A;  1IZ1 A;  4L18 B;  1JUM A;  3DCF A;  4IKF A;  3CUQ C;  2MC3 A;  3IH2 A;  3S32 A;  3HHH A;  3S2D J;  2JJ7 A;  2PMU A;  4ASN A;  3GX4 X;  2YU3 A;  1HQC A;  2EZH A;  4IEJ A;  4KIC A;  4J01 A;  3L2W A;  1HA8 A;  1RR8 C;  5CQG A;  1JE8 A;  1W7P A;  5FKO A;  3FXM A;  4IHY A;  2AXL A;  1KQ8 A;  1CQT A;  5B3S H;  5GTH C;  2BVM A;  3BLY A;  1J09 A;  4HW0 A;  5EF6 A;  2OTL I;  4UUV A;  3H3V K;  4ZTJ A;  4RGS A;  1MDM A;  2CFX A;  2WY7 Q;  3V7S A;  4KMF A;  3BR0 A;  2LMD A;  3MMY B;  2KIQ A;  4NQW A;  4RAY A;  3M7G A;  3M3Y J;  3IHU A;  3M1C A;  5FLM J;  4IHT A;  2V26 A;  4XNF A;  2Y48 A;  4BYY A;  2VE9 A;  3KEO A;  3M07 A;  2DFE A;  2PFB A;  3BQY A;  1IXC A;  3I0T A;  2G9W A;  4RAG A;  2EFW A;  2M7B A;  1O3S A;  2QUF A;  3OY9 A;  2M8G X;  2X1E A;  2KZG A;  3GXO A;  1SFE A;  1T0F C;  1WH5 A;  2LOO A;  2IGM A;  4H0E A;  2OA4 A;  2NOJ B;  2JTV A;  5HDK A;  3ZQL A;  3WE3 A;  1P4A A;  1VTN C;  5BMZ A;  3ISP A;  1ETV A;  2DAO A;  1YG2 A;  1DP3 A;  3UR3 C;  3DEW A;  1MSE C;  4EJO A;  3O2P E;  3I58 A;  4Y3O A;  2DOD A;  3DKX A;  4AIH A;  3G6E I;  2M0M A;  1P9Q C;  1JTY A;  1TLH B;  4E4H A;  1TWG J;  5F64 A;  1WZ2 A;  1S29 A;  3GWZ A;  1OYI A;  3LQQ A;  1IUY A;  1SFK A;  1B9N A;  2DA2 A;  3NWT A;  5EEG A;  3TGN A;  5IP7 J;  2G7H A;  1OR7 C;  4IVN A;  5HOD A;  3ML6 A;  2X51 A;  2QF7 A;  2ISY A;  4XLN F;  3ESW B;  3RIR A;  2C6Y A;  3HIF A;  3F8B A;  1D8K A;  1IN5 A;  2QLZ A;  1EV7 A;  2BV6 A;  1P7I A;  4EJV A;  2ESH A;  4A12 A;  1IO2 A;  2DW4 A;  3T5X A;  2H8W A;  2YUS A;  2RV8 A;  4XLH A;  1FYM A;  4KFC A;  5E17 F;  2CFO A;  2P8T A;  2O61 A;  3HXL A;  3KZZ A;  2Z1D A;  3TW6 A;  2HXI A;  2HFH A;  5B66 C;  2IAI A;  4HPQ A;  5FLV A;  1ZG5 A;  1BC7 C;  3Q0U A;  3K9T A;  4IJA A;  2E7X A;  1UB9 A;  2VLA A;  2B63 J;  4KN4 X;  2QQ8 A;  2DQR A;  1NK3 P;  5FKL A;  3HEF A;  2DYS H;  3HPH A;  3JRI A;  3QOD A;  4ZDL A;  1OCO H;  4E7S A;  4CZZ A;  4MLO A;  4CIC A;  1JKQ C;  2DMN A;  2OTJ I;  1Q1V A;  5D8K B;  1G3W A;  1FOX A;  2P6S A;  4BY7 J;  4AM3 A;  2FX0 A;  2ZKZ A;  1IUF A;  3LSG A;  4IHV A;  4LIU A;  4S0H B;  3G73 A;  1MBJ A;  1YW8 A;  3DFG A;  1ETO A;  3KFW X;  2WB1 N;  4HF2 A;  4I98 B;  3DTE A;  3T8T A;  3PSI A;  1WSU A;  4KIT B;  1J9I A;  2QQA A;  1ETY A;  5LGT A;  1MND A;  3I4N J;  4XSX F;  1BI3 A;  2WV1 A;  1FJL A;  2DOA A;  4CCJ A;  2W48 A;  3GCM A;  3ZMT A;  1OYW A;  1FBQ A;  3BZK A;  3RPQ A;  5ICC A;  1MJB A;  4DZJ A;  3MWM A;  3SZT A;  4UNO A;  2OUM A;  1FLI A;  1KGS A;  2M5W A;  1Y0N A;  4R8H A;  5A2Q K;  3JR9 A;  3WU0 A;  2OD5 A;  5CQE A;  3KZY A;  3W3C A;  1B8I B;  5E3M A;  3ZQH A;  1K61 A;  1APL C;  3L2Q A;  2XSD C;  1W1W E;  2LC2 A;  5F0H A;  2PEX A;  3MVP A;  2R7O A;  5TRD A;  3EET A;  2DA3 A;  1BR4 A;  3H9G A;  3H5A A;  2PQ8 A;  5DDG A;  3DV8 A;  4BDZ A;  3LSM A;  5FLX Z;  1I50 J;  4WCG A;  1U9O A;  3FXU A;  3U2R A;  3VFZ A;  1ZG1 A;  2STW A;  5FGM A;  4ZDO A;  3CJN A;  5HNF A;  1RI7 A;  5M5X J;  2YSR A;  3BR6 A;  4XON A;  4A3E J;  4NC6 A;  3LAP A;  2W1O A;  4UUT A;  4HST A;  3Q5F A;  2JQ7 A;  1R4N B;  1ZH5 A;  4A3C J;  3W6J B;  1X19 A;  1XB4 A;  3HRM A;  1U6G A;  2LR8 A;  2E1C A;  3OYH A;  1JT6 A;  1Z0X A;  1R7J A;  1LE8 A;  3S2W A;  5F0C A;  2VKV A;  2ZJR F;  5F08 A;  2WTE A;  2XKP A;  3ASN H;  2H1L A;  2IS1 A;  3LWF A;  3K1M A;  4IZZ A;  5E18 F;  5JFR A;  2DBB A;  3BZC A;  3DXJ F;  4MEY F;  3R61 A;  4KUM A;  1MMG A;  1K78 A;  5GPC A;  4I02 A;  3BTJ A;  2LBF A;  3PM1 A;  4JK1 X;  1U5T C;  2KKO A;  5TJJ A;  1M1E B;  2GWR A;  3GW2 A;  2I10 A;  4PJJ A;  2ZJP F;  4B3A A;  2M4G A;  2EK5 A;  2JA5 J;  3BG6 A;  3R6S A;  2ZME B;  1FOK A;  2R7U A;  1X1B A;  2VOO A;  2DT5 A;  3I64 A;  2OF7 A;  1GXP A;  1QGP A;  5GAE J;  2AQE A;  2HU9 A;  3M8E A;  2X1D A;  3QPL A;  1SFO J;  1NH3 A;  2JPB A;  1UZC A;  1B72 B;  1RET A;  1X2M A;  5K7Z A;  2GXA A;  3VWB A;  2HDC A;  4CCL A;  2ZB9 A;  1BOB A;  2F6C A;  4OAZ A;  5EDN A;  1OIS A;  3MKL A;  4PGG A;  3UNG C;  5D6F A;  2JVH A;  1OLT A;  4ANJ A;  2I8D A;  4LIV A;  4AID A;  3SEZ A;  3RKQ A;  2JRM A;  2V1N A;  1JUP A;  4RB1 A;  5FD6 A;  2KIF A;  1QHG A;  2EPF A;  2KDZ A;  4A2U A;  3WTX C;  4AYB N;  1YJ9 I;  4OIO F;  2ZXJ A;  3GFJ A;  2OAZ A;  4BQO A;  5J8C A;  3S3M A;  2EV6 A;  3WTY C;  1O4X A;  2B0L A;  1T98 A;  2KHM A;  2MFZ A;  3WTS C;  3S1R J;  3N05 A;  3JTG A;  4CCO A;  3BJ6 A;  1MBG A;  3RSN A;  1Z91 A;  4M6X A;  1V55 H;  2LK2 A;  1ZR4 A;  2X85 A;  3TDU C;  4OIQ F;  3I54 A;  1J2X A;  3CES A;  3K70 D;  1TQM A;  5EGO A;  2BW3 B;  1QPM A;  3HM5 A;  3TO7 A;  2M8E A;  2XVC A;  3DKW A;  5ILS A;  1XPX A;  1A36 A;  2Q2E A;  4MFE A;  2NVQ J;  3HOT A;  1Y8R B;  1VQ9 I;  3GYH X;  2L9N A;  3HOZ J;  1YRN A;  1MNM C;  4YRV A;  2FBH A;  1MBE A;  2Z3Y A;  3F72 A;  2M2E A;  3AG1 H;  4A5N A;  2GA1 A;  2Y30 A;  3K4J A;  4IOA F;  4DIQ A;  3AG4 H;  3K1N A;  2VJ5 A;  2FA5 A;  4Y13 A;  3I55 I;  4C2T A;  3IWZ A;  2W7N A;  2UWM A;  2E71 A;  3S15 J;  1SAX A;  2Y69 H;  3AG3 H;  1QRY A;  1ZRC A;  4DNC A;  3U9G A;  2Z9O A;  3F6V A;  1W7P D;  1WJA A;  4PJN A;  5L3E A;  1LEA A;  1FEX A;  1DUX C;  1W7P B;  1U8R A;  1PP8 F;  2IGK A;  1D1C A;  3F23 A;  1QHH D;  4FTH A;  4S05 A;  4HF1 A;  1EH7 A;  2XAU A;  4JX4 A;  2GZW A;  1HDD C;  1OMI A;  2DJN A;  1A6I A;  3RKW A;  4LLN A;  2A05 A;  1WHU A;  2R5Y B;  2OZU A;  1KA8 A;  2PI0 A;  2LY2 A;  2VOD A;  4L0Y B;  1LFP A;  3H5N A;  1K83 J;  1OKR A;  1V54 H;  3OIP A;  2DMU A;  4BNC A;  1JI8 A;  2VUM J;  2COM A;  1V4R A;  2HPI A;  1WCM J;  2DTZ A;  1LEB A;  3QWL A;  1ZGW A;  3L2C A;  4XM3 A;  1FTZ A;  2VE8 A;  3B02 A;  5FD5 A;  2F5D A;  3G1L A;  2H09 A;  3CMY A;  1J59 A;  1F4K A;  4KIB A;  2RAE A;  4RDU A;  2NVU B;  1BC8 C;  2HYJ A;  3FIS A;  1GVJ A;  4F7Z A;  4Q48 A;  4HV5 A;  3JRC A;  3D1N I;  4B44 A;  2BY3 A;  3CC2 I;  4OIP F;  2BE5 F;  4NNJ A;  4IX7 A;  4BE1 A;  4M9Z A;  1JGG A;  5H6R A;  3FX3 A;  2R92 J;  4AYB A;  1TQI A;  3HOS A;  3J7Y J;  1Z7U A;  2E2H J;  2HWV A;  4V19 K;  1MGT A;  2OJE D;  4RAF A;  1XGS A;  3JRE A;  1H0M A;  2F4O B;  1FIA A;  4PZJ A;  3V8L A;  2VT2 A;  2DA4 A;  4YG2 F;  5IT3 A;  2VN2 A;  3MFK A;  2MLK A;  2FJ1 A;  5GPA A;  1DPU A;  1JJ6 C;  3GTJ J;  2L2O A;  4FX0 A;  2D2W A;  1N77 A;  4I01 A;  4V2G A;  1Z9C A;  3OSF A;  2NS8 A;  5LRS A;  2FD5 A;  4UUS B;  1WJD A;  4BE2 A;  1S6L A;  4C30 A;  1S8N A;  3DP7 A;  5LLQ A;  4QPO A;  1CGP A;  5DCF A;  1ZR2 A;  2E60 A;  3IAS 2;  1W5S A;  3CLQ A;  4PCQ A;  5KVR A;  2TRT A;  2NRA C;  3KYL A;  3QYF A;  2K9N A;  2ZXW H;  4M3G A;  5CLS A;  1X1A A;  1XSX A;  2CW0 F;  2XRL A;  3MQ0 A;  1I3Q J;  4XK4 A;  1IN4 A;  5LFA A;  3BG7 A;  3HOW J;  1JKP C;  5DCM B;  2JT1 A;  5B1B H;  1J75 A;  3FXO A;  3H3Z A;  2CS3 A;  2Y75 A;  2QSH X;  2HXO A;  1WWX A;  2QA4 I;  4KMU X;  4W1U A;  4DOZ A;  3MKZ A;  3FM5 A;  2IGN A;  1BM9 A;  2P81 A;  5FRN A;  1U78 A;  4YFK F;  1UCR A;  4ESB A;  1MH3 A;  2R7F A;  5J8F A;  3E97 A;  3S1M J;  1NTC A;  2BEO A;  1R1U A;  3DU6 A;  4A6D A;  4YIR X;  1R4M B;  4JP0 A;  1RNL A;  2L02 A;  3G2B A;  3RCO A;  1QNT A;  2WAF A;  4NC7 A;  2MA3 A;  4I09 A;  3CJT B;  4LLL A;  5JLX A;  1SD4 A;  3TOB A;  3A02 A;  3LOC A;  2F4I A;  2GAU A;  2FMY A;  2VKE A;  4BH9 A;  2N8G A;  2WAQ N;  1LKX A;  1U9N A;  3CJR B;  5F6F A;  4XIC A;  2DMQ A;  5K5O A;  1PUE E;  2LFB A;  4ZYG A;  2R7S A;  2ZFU A;  3CCV I;  3LMM A;  3VSL A;  3BZ6 A;  5E8I A;  2ICW G;  4XRF A;  3U1K A;  1XS9 A;  1AWC A;  1NG7 A;  3V8J A;  2PJR A;  3KLN A;  4LIT A;  4M3D A;  3WTW C;  2P5L C;  2AHQ A;  6PAX A;  3BOQ A;  4ITV A;  2RKH A;  5E20 A;  5HLI A;  5K1Y A;  3FKI J;  4C3H J;  3WGG A;  1HW2 A;  1XSV A;  1OCC H;  4KIS A;  2FNA A;  2PG4 A;  4AIJ A;  2E5Z A;  2JMW A;  4G9Y A;  3GTP J;  3OOP A;  3W2V A;  1X3U A;  2CV2 A;  4A3L J;  3IRR A;  1TT0 A;  2CSO A;  1VQL I;  1Y6I A;  4UVA A;  3RTR A;  4U0W A;  3NQO A;  4J19 A;  2K86 A;  3ECH A;  2VQG A;  3E0J B;  2E35 A;  2HKX A;  2BY2 A;  2V1D A;  4PJL A;  4BKX A;  1RR7 A;  4LOC A;  1PUF A;  4U87 A;  4OIR F;  1JJ8 C;  4HQE A;  2YS9 A;  1K78 B;  4FAS D;  3FBI B;  3TL4 X;  1ZLK A;  3BJA A;  4F93 B;  5ED4 A;  2JPC A;  3VOE A;  3SFZ A;  2O5R A;  2XAF A;  1MNE A;  3TBI A;  1WJC A;  5DUK A;  2XGC A;  2DN0 A;  5IOY A;  4YII A;  3FMQ A;  4LK0 F;  2FF4 A;  1Y0U A;  2W85 A;  2D1H A;  2WY8 Q;  2IS6 A;  3FBN B;  4L0Z B;  3FMR A;  3C2H A;  1UJ8 A;  2E1M B;  2MH9 A;  3VEP A;  1D5V A;  2EFQ A;  1JT0 A;  4KN7 X;  4XR6 A;  1IGN A;  2Y31 A;  3X2Q H;  5DM6 F;  2LSO A;  2PLY A;  3GBG A;  3F21 A;  4E70 A;  5E79 C;  1YE9 A;  2X6W A;  1FPQ A;  2JA8 J;  2FEZ A;  2BVL A;  4CCK A;  2VC1 A;  4LGW A;  4GDF A;  1OYY A;  3ZMU A;  2JVG A;  2LLK A;  1X4O A;  3JRG A;  2CV0 A;  2DO7 A;  2MSY A;  5EG0 A;  2CQN A;  1VZ0 A;  3KCC A;  5TGT A;  3G3Z A;  5IP9 J;  1T38 A;  4BXX J;  1D1A A;  1GV2 A;  5J1U A;  4BGD A;  4CXF A;  1U8B A;  4FT8 A;  1VQP I;  2IS2 A;  4PJ0 C;  3JAM K;  2QZ8 A;  2V1U A;  3BT9 A;  1AA7 A;  3VB2 A;  3IAM 2;  3Q9V A;  2ZJ2 A;  3JSP A;  1YHQ I;  1R36 A;  2OQR A;  2L0K A;  4FE7 A;  3ZMD A;  5J4V A;  1V5F A;  4RMN A;  2MH2 A;  4E7I A;  2O0Y A;  3DPL C;  3HG9 A;  5E8G A;  2WAQ A;  2FUG 2;  3CCM I;  2A6E F;  1I6H J;  5KAF C;  2GM4 A;  2X6Y A;  3S93 A;  3S14 J;  3CO6 C;  2DDB A;  5D8L B;  4FHT A;  2FXA A;  2EB7 A;  2H1K A;  1ZGA A;  2K9S A;  2DPD A;  2KP6 A;  1I27 A;  1ON2 A;  5BS6 A;  2XAJ A;  3CCY A;  3FKJ A;  3FHN A;  2Q2E B;  1T2K A;  3ABK H;  2Z99 A;  3DKY A;  3WGH A;  1LVK A;  2EQR A;  4N9I A;  1SAN A;  5IT9 Z;  1I1S A;  3DPT A;  1YQA A;  5FO5 A;  2R7X A;  5D5U B;  3W2W A;  1NG6 A;  1YRN B;  3QP5 A;  2F4M B;  2AO9 A;  2B7E A;  4NBQ A;  4A3D J;  5JLW A;  4Y17 A;  1DPR A;  4CDG A;  5E3L A;  3ZQG A;  2EZI A;  3GO5 A;  5ICE A;  3HUG A;  4RM2 A;  2DU9 A;  1PVE A;  3BTC A;  3QP6 A;  4I99 C;  2LF8 A;  1QVT A;  4XMY A;  1LVA A;  5EZG A;  3M9A A;  1Z6T A;  2QSF X;  5B5E C;  1BR2 A;  3V4G A;  4EV0 A;  2XF6 A;  1WJF A;  1WPK A;  3FHZ A;  1E3H A;  4G7Z F;  2RRE A;  3RDI A;  2CYY A;  4G6T B;  2ELJ A;  3ELK A;  1TWH J;  4N4N B;  1GVD A;  3F8M A;  4CYC A;  2ECC A;  5DTD A;  5J40 A;  2EZL A;  1IDZ A;  4OU0 A;  3HPG A;  1LDD A;  1YW9 A;  2GOX B;  5D5V B;  4XRS A;  4I76 A;  3TP3 A;  2XKO A;  1D0X A;  4M6V A;  1J0R A;  3KZI C;  5BQT A;  5DV5 A;  3L7W A;  1BR1 A;  1TNT A;  2FBI A;  4ZC3 A;  2K40 A;  3GTG J;  4U0V A;  2EBI A;  3GLX A;  2CG4 A;  1ZAR A;  2EIK H;  1O7L A;  4M9X A;  1I3A A;  2IA0 A;  2GQQ A;  3LSK A;  3PO3 J;  2QQB A;  3G71 I;  4H4K C;  2F2E A;  4A93 J;  1T6S A;  4KA4 A;  4K2E A;  3OYC A;  2OZ6 A;  1X58 A;  3MAJ A;  3ERE D;  3RI4 A;  2K9M A;  2CUZ A;  2HZT A;  4A69 C;  4NDL A;  3E6C C;  5E1Z B;  3GME A;  5EYR A;  2R5Z A;  2P5V A;  2V1X A;  3VYR B;  5J47 A;  1YS7 A;  2HOE A;  2MW8 A;  3DEE A;  2LF7 A;  4PJM A;  2HEO A;  4EMS A;  1OPC A;  2XHK A;  1SD7 A;  2EWN A;  3ZN1 A;  4E7H A;  3LSH A;  1JGS A;  2QGU A;  2XAG A;  4HX7 A;  4DYR A;  1S9H A;  2ZFW A;  4E7L A;  4ZZD A;  2JUC A;  5HS9 A;  1QO0 D;  1G8X A;  3E1S A;  5D5W B;  3OYE A;  4BDY A;  3GTL J;  5KAI C;  2MC4 A;  1KYW A;  4NUB A;  3FXJ A;  2KMU A;  3F6O A;  2R0Q C;  1G3S A;  1LDK B;  5F04 A;  4L9T A;  3DU5 A;  3GTO J;  2V9K A;  4PGH A;  2LY1 A;  2OBP A;  2W25 A;  5AIQ A;  5ILV A;  4UV9 A;  3H92 A;  1Z7L A;  3A0B C;  5BNG A;  3HB9 A;  1ETK A;  1ZKG A;  4B09 A;  4BJT A;  1XGN A;  4LJZ F;  3KET A;  1I6X A;  2PMZ A;  2UXN A;  4M3E A;  2EIM H;  5FKK A;  2LRE A;  1UHW A;  3PQK A;  3PO2 J;  2EJR A;  1NHA A;  5KHD A;  1ACI A;  1E0E A;  3C18 A;  2LRD A;  5C44 J;  2V6C A;  3MEX A;  1B6A A;  3K6G A;  1D0Z A;  2HTS A;  2P6T A;  2HQA A;  3KPH A;  4ZTF A;  2OQG A;  1K6O A;  1VQ6 I;  2NVX J;  2BY1 A;  1IRZ A;  1SMY F;  1OCP A;  1AKH B;  5DD8 A;  2WV0 A;  2VQC A;  4FE4 A;  3HGY A;  1P4X A;  3C2B A;  2D5V A;  4CH7 A;  5LD2 C;  3V8K A;  1R1V A;  5FFX A;  3I5U A;  2XSJ C;  2HYF A;  5CYV A;  4MNU A;  2QEN A;  1Y8Q B;  3Q0V A;  1BW6 A;  3OS1 A;  2EIN H;  4Y33 A;  3GTM J;  1J5Y A;  4RB0 A;  2O8X A;  3OV8 A;  3QYE A;  1W0T A;  3E5X A;  3GEZ A;  1KU2 A;  4IHS A;  4BQQ A;  3MKY B;  3PNT A;  3HTU A;  3IP4 B;  4E7J A;  4I0A A;  2RNG A;  3K4C A;  1IW7 F;  1EA3 A;  4ENJ A;  2XUB A;  1G3Y A;  1FBU A;  4GCV A;  3D5R C;  4G12 A;  1MMA A;  1YYV A;  4CA0 A;  2HKO A;  1SD6 A;  4IPA A;  4YFX F;  1GXQ A;  2XB0 X;  3HOV J;  2ZSH B;  1FTT A;  3J81 K;  5D5X B;  4IRG A;  4E7K A;  5HOO A;  2QBY A;  2M30 A;  3C3W A;  2WAE A;  2BGC A;  4N0B A;  4ENN A;  4M73 A;  2ESN A;  1B1B A;  4BUP A;  2V9V A;  5LEK A;  1DGW Y;  3CP2 A;  5A2Q Z;  4M74 A;  5L3B A;  3GFM A;  4GO1 A;  2KIS A;  4HG2 A;  2ZME C;  3VYT B;  2O6G E;  4OAY A;  4NC8 A;  1O3Q A;  4IO9 F;  4CSW A;  2EFP A;  2H6C A;  2L9S A;  3OL3 A;  4HEA 2;  5IYB J;  2PJR B;  4XN3 A;  1IRX A;  1IDY A;  2HDW A;  3ABU A;  3U21 A;  3K0L A;  1HF0 A;  4XID A;  3J80 K;  4JX5 A;  2VQH A;  1ENH A;  1RC9 A;  1FIP A;  3S8P A;  3OS0 A;  3HL2 A;  2LD5 A;  3HC7 A;  1MD0 A;  4E7Z A;  4KDP A;  2HPM A;  1PYV A;  3DWL E;  3KEQ A;  2MD0 A;  2L7Z A;  4LG0 B;  2EV5 A;  3WOD F;  1GV5 A;  4EJT A;  2KQR A;  1SFU A;  4Z2Y A;  1IXS B;  4QWQ A;  2NVT J;  2CQ7 A;  4V2F A;  5K5R A;  1ZRF A;  4P96 A;  1BIB A;  5BPI A;  2HVS A;  4IRI A;  2R93 J;  1YIO A;  2F5E A;  3OYI A;  1PDN C;  2K3P A;  5L3F A;  5J1R A;  3BR5 A;  4BQA A;  2DXI A;  2MGQ A;  1VQ5 I;  3HDD A;  1OQY A;  1A35 A;  2B9S A;  3UKG A;  2GIZ A;  5AIP A;  5HLT A;  1FX7 A;  1K79 A;  2D1V A;  2KIM A;  4DJA A;  1FMV A;  4ENM A;  4UB8 C;  3K2Z A;  2CH0 A;  1A6Q A;  3FXL A;  3PNY A;  2R7R A;  4MO7 A;  2A6H F;  3BCA A;  2OU2 A;  4HSR A;  2CQQ A;  4XRM A;  5CJ9 A;  2W4S A;  5JVG F;  4DZP A;  2Y0S A;  2E2J J;  3M8J A;  3FDY A;  1SAU A;  2MLG A;  2PJP A;  3K70 C;  4QIW N;  3G1M A;  3V42 A;  4G7O F;  1XN7 A;  1W0U A;  3LSR A;  3W2A A;  2RGV A;  3PJR A;  2RDP A;  3FXQ A;  4D5F A;  2VXD A;  2VL8 A;  2QVO A;  3OR1 C;  1UST A;  4RLF A;  2EZK A;  3CUQ A;  3CQZ J;  1STZ A;  1DP7 P;  3HOU J;  1S7O A;  3E7L A;  1PJR A;  2KJC A;  1YI2 I;  2YX7 A;  1XX5 A;  5LRR A;  3CCJ I;  3I59 B;  4UVB A;  5FRM A;  3SJM A;  4IQJ A;  5JI6 A;  4GRI A;  2X48 A;  4ENK A;  4PK4 A;  2DK5 A;  3HYI A;  3BC8 A;  3BR1 A;  1MJA A;  3ZN0 A;  5FRO A;  2A07 F;  2X0L A;  1T08 B;  1YO5 C; 
#chains in the Genus database with same CATH homology
 2JUC A;  2DOE A;  2KFD A;  2KZG A;  2DOD A;  2K85 A;  2KIQ A;  2LKS A;  2E71 A;  2CQN A;  2KIS A;  2B7E A;  4FQG A;  2L9V A;  1UZC A;  2DOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...