1UZCA

The structure of an ff domain from human hypa/fbp11
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
69
structure length
69
Chain Sequence
b'QPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN FLJ21157
publication title The Structure of an Ff Domain from Human Hypa/Fbp11.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 21
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2004-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 1uzcA00
2B7EA 2KISA 2DOFA 2LKSA 2E71A 2KIQA 2CQNA 2KZGA 4FQGA 2JUCA 2L9VA 2K85A 2DOEA 2DODA 1UZCA 2KFDA
chains in the Genus database with same CATH superfamily
2UUZA 1ZARA 5H6RA 1S6LA 2EK5A 4ZDPA 2A05A 2HXIA 2E60A 1FPQA 3NWTA 1MBFA 2LKSA 5HLTA 4GRIA 3L00A 1FNNA 1OR7A 1YW9A 3HKZA 2QVOA 1VQ6I 1ERDA 4BH9A 2DJIA 1J59A 2XHKA 3KZZA 3K10A 2F5CA 3PSFA 3R4KA 3HRTA 1MMGA 2ZXWH 1I3QJ 2DCEA 3AG3H 3HOWJ 1T0FC 4RGRA 2A61A 2L9NA 2BY2A 1KONA 3RTRA 1PUFA 1B72A 2VODA 2X9DA 4CHUA 3HXLA 1DP7P 4U0VA 5J40A 2ZBKA 5IT3A 4YELA 5J47A 4KN7X 3I59A 3PUFA 1ITYA 3M8FA 5J3LA 5FLVA 1W5CC 2TDXA 2EA2A 1H9GA 4IVNA 2PJRA 1V4RA 5GP9A 3PO2J 1IF1A 4Z6YA 1R6RA 3HZJA 3RSNA 4UY8I 3MKWB 3GYHX 3IRQA 5TRDA 3FMSA 2IS6A 3W2WA 2PQ8A 3TW7A 4EGZA 1WJCA 5BS6A 4NBQA 2IJLA 1O7LA 2EV5A 2OCCH 3Q3SA 3OYFA 4RGSA 2RVCA 3VODA 2BY0A 5LGTA 3J80K 1OR7C 2JSCA 2ZFWA 3OYGA 1VQ7I 3CESA 2QA4I 3BY6A 3TDZC 3BWGA 2IS2A 2NNNA 4AD9A 1ETKA 2W57A 1R1VA 2LOOA 1S7EA 3E3VA 1Y8RB 2Q0OA 3G4SI 2XB5A 2QZ8A 2R5ZB 3S1QJ 2Z2SB 2EIMH 5KAFC 3I3LA 1YQAA 1ZLKA 2EIJH 2LY1A 2KJCA 1Z9CA 2PX9A 3BQZA 4FX0A 1K61A 2E2IJ 5D4RA 3S93A 2H8WA 3OYCA 4BXXJ 1RESA 2X51A 4E7IA 2XAUA 2GBYA 1TNSA 3WGHA 2RREA 1LEAA 2JA5J 4MFDA 1IGNA 3HUGB 4BL0B 2E1CA 2OCEA 3FWEA 3LFKA 4M6VA 5BPDA 1MMSA 2KMUA 5CVJA 3QU6A 2DTRA 2XPVA 2ZXJA 1LUJB 3EETA 5LD2C 1PUEE 4PSXA 1BOAA 3FXQA 2NVTJ 1BI2A 3OIQA 3DPUA 4I0BA 3K4BA 3CCJI 4A93J 2OPTA 2M30A 3KEOA 3KYDB 4L18B 4NC8A 1D1CA 4ANJA 1J09A 4BE2A 3SZTA 1MSFC 3J81K 3VYTB 4HX7A 1XB4A 5J1RA 3GZNB 1ZRDA 2VQCA 3PUBA 1QPMA 2X0LA 2Z99A 3OYEA 3LNQA 3KETA 3F22A 4Q4ZF 1BI3A 4BJTA 4RB3C 1SD6A 4WCGA 4D5FA 1NK3P 2MSYA 2WAQN 4M9ZA 3WHBA 1IW7F 2LH9A 3HHGA 2P0WA 3VEPA 4E7HA 2E1MB 1Q1VA 3NRVA 4M3BA 2VJJA 3LA3A 1RKTA 4C30A 3V8LA 2Y30A 4KUMA 4HDVA 1ORKA 2HDCA 3EUHA 2TCTA 1BR1A 1N25A 5IYBJ 1D8JA 4M3FA 2VC1A 2Z9OA 2P7VB 2FA5A 1TLHB 3IH3A 3IKTA 4D1QA 3OS1A 4A6EA 3A2KA 4KYWA 5FKLA 3PJRA 1WJFA 5FGMA 3QYFA 4X6AJ 3KPHA 2XGXA 4JX4A 1LE8B 3DU6A 3J7ZI 2WA0A 4XSXF 4WXDA 1G2HA 2XKPA 2XASA 4PFOA 3VB2A 5LEJA 4PDKA 3F8MA 1U5TA 2MG4A 1AKHA 2BE5F 5LEKA 1OCTC 3W6VA 2FMLA 1G3TA 3MD2A 2ISZA 1X3WB 3S1NJ 4HX4A 2LBFA 2V9PA 1REPC 1VZ0A 3JREA 1WQ2A 3HSEA 3LL7A 2KQRA 5HS7A 2DO7A 2OA4A 2L0KA 4L9NA 2HR3A 2HEOA 4LLLA 2EBIA 3W6JB 4IKFA 4M9XA 4DYQA 3CDIA 1TW3A 3HGGA 1X1PA 5TGTA 2WTEA 1ON1A 2V1XA 5CVIA 2R92J 2YX4A 1R22A 1XGMA 2DU9A 2OD5A 1R58A 4A5MA 3MZYA 2P6SA 4AU7A 1CF7A 1N77A 3HC7A 2LLKA 3HSFA 2CV1A 2XAJA 4IQJA 1P4WA 1LFBA 5FRMA 1FSEA 2BVMA 2LF8A 4HAMA 3RKXA 1XD7A 1OCRH 4MQ9F 3E5QA 4XKBA 3VSLA 1HSTA 1N75A 2VOOA 1U5TC 1H8AC 4W97A 4UUVA 2NAZA 4LMYA 1ZGAA 1NH3A 4AC0A 4D7NA 2VONA 3S8PA 4M3GA 5M5WJ 2OUMA 3LSGA 2FMYA 1KQ0A 1LDJA 2JJ7A 3NARA 1LEBA 4QIWN 4AYBN 3SZPA 2HGCA 5FFZA 1AU7A 4BUPA 3S3MA 2LREA 2MYSA 3JCUC 3QPLA 2ZSIB 3CJNA 5JFRA 4O5VA 2EH3A 1IUFA 1ZG1A 1K4TA 1F4KA 5D8KB 3S1RJ 3OYDA 3N97A 2W85A 3U9GA 1I6HJ 3OSGA 2FUG2 1FMWA 1D0YA 2DLLA 1ZAOA 3UR3C 5D8LB 2A5YB 5C3EJ 1X3ZB 2BW3A 4OIPF 2ESHA 4I2OA 1U8BA 3LSJA 1D3YA 4J01A 1USTA 2HQ5A 1FOKA 2MW8A 2OAZA 3T0YA 1GVJA 2GOXB 4RLQA 4LG0B 2E19A 3F8BA 1FX7A 4GFBA 1WH7A 2UXXA 4Y4RA 4IHSA 2O61A 2CQQA 4PGHA 1X19A 4MHGA 1B8IA 4RDUA 1MIJA 1D0XA 2ZB9A 1CF7B 1Z6TA 3S14J 2ZSHB 1RZ4A 2HTSA 3BR1A 5HDNA 2COMA 2KLOA 3BOQA 5E1WA 3TKYA 4DOZA 4I0AA 4CZCA 3FIWA 3HPHA 4U0YA 1FC3A 1EKEA 2RQPA 3LFUA 2DN0A 3G3ZA 2M8EA 4KICA 1W7PA 2XSDC 4ENJA 3L2QA 2Y0SA 2P6TA 2KIQA 2KKOA 1DPRA 1TWCJ 2HZDA 1JGSA 1OMIA 4G7HF 3WGIA 5HLIA 2CRGA 1J9IA 1G3SA 4UVBA 4IX7A 1F1ZA 1VQOI 5ILUA 2K4BA 2F5DA 4CUGA 4CICA 2HFHA 4Q5SF 3W3CA 2F5VA 3H5AA 4GO1A 5F08A 3J7AY 1MW7A 1FWZA 2QENA 1GXPA 3P9KA 2E2JJ 5EF6A 3AFHA 2D1VA 2EFWA 3OS2A 2JRTA 2KFDA 2M7AA 2UXNA 2FXAA 3A0BC 4EATA 4ZJZA 4XOPA 3TEDA 3PO3J 1D1AA 2IEKA 5LRSA 3BR5A 4A6DA 2B7EA 1YS7A 1X2NA 2XF7A 4XKCA 1IAWA 2HPIA 2DPUA 1IV6A 2PBIA 2J5OA 3CCQI 2BV6A 3QODA 5M3FJ 4A3MJ 1YJ9I 2VKVA 3CCSI 2IGMA 2P4WA 4KMFA 4M3DA 2KL4A 1VQMI 1E2XA 4UUSA 4XLHA 1T8IA 1FTTA 3QP6A 3DPTA 1Z77A 2E35A 1IDYA 1RC9A 2UV1A 3KP7A 4NUBA 1KZHA 4TV7A 1K4SA 2VB6A 3TOAA 4NHJA 3HKZN 4BYYA 3TL4X 2ZJ2A 2OZ6A 4XBFA 4XN0A 1Y6IA 4BACA 3JRHA 5EDNA 1R71A 3GFIA 4PJJA 1W7PB 1GVDA 3HOYJ 1ZN2A 2X6WA 3LWFA 3FXUA 3LA7A 5LHGA 3GFMA 2E1OA 2JVHA 5K7ZA 4YFXF 1O3QA 2DFEA 2AO9A 4L9TA 4HSRA 4WF2A 1WI9A 2I10A 2VBYA 5DV5A 3AL0C 4MQVA 2IBDA 2WWYA 2ME0A 1PYVA 1WZ2A 2DQRA 1YTYA 5L3DA 1SAXA 1UG2A 2LY9A 1MBEA 1JHFA 4OU0A 2ZJRF 1SVMA 4JQFA 1JTXA 3J7YJ 2EFPA 4B47A 3S17J 2NOGA 1MNDA 1ZGJA 2H6BA 5LHIA 1ZGWA 5KAIC 1FLIA 4G12A 1HKSA 1OCZH 2IGNA 2WAQA 3GTQJ 3ZQQA 5L3GA 1GDTA 1EV7A 2Y75A 3QPHA 3KCCA 3CCMI 2JQ7A 4BY1J 2RN7A 2R3SA 2DDBA 4O6JA 2LKXA 1QNTA 1AHDP 1ONVA 3FKIJ 3FZVA 1TWAJ 1IRFA 3OOUA 3GX4X 4DGWB 2HKXA 3WE2A 4FASD 4HNUA 1HKQA 1O7FA 1JE8A 4JBAA 2K86A 2VJIA 3BROA 5F64A 5J4VA 1O3RA 3MCZA 1ETYA 2LKPA 3VFZA 4PJNA 4CCKA 4MEXF 1RKWA 2JPBA 3RPQA 1TQMA 2JZYA 2ZNZA 3C2GA 1Y0UA 3QAHA 5IP9J 5DM6F 1XDSA 1OCCH 3K1NA 3ASOH 2HYFA 4P9UA 4FISA 1TNTA 4NQWA 1E0EA 1S29A 3SDBA 3K4MA 3F9KA 1JKOC 5J6XA 3BDDA 2D2WA 1X1AA 4RM3A 5H20A 1UJ8A 1Q1HA 3ZMVA 1VQ8I 3A0HC 4DW6A 3D0SA 3LSHA 3CMYA 2FOWA 4QPQA 1R5ID 2JUCA 4FE4A 4FHTA 1F43A 4BGDA 3HEFA 2DJNA 4E7LA 1X58A 5JLXA 3X2QH 3LSMA 3JR9A 4ZYEA 3HB9A 2ZCWA 3NAUA 4F3QA 2LC2A 2CUJA 1WI3A 3KP3A 4BDYA 2L7FP 1KYZA 3CUOA 5GAEJ 3JRGA 2K9SA 2EZKA 1Z3XA 1B4AA 2NS8A 5IOZA 5M5XJ 4XIDA 3BR6A 4D9JA 5IP6A 3QQAA 4RB2C 3BR0A 2R93J 1HDDC 3IWFA 3CCVI 4JX6A 3ZQLA 5IT9K 4PJLA 1O57A 5E8IA 4A5NA 2DMQA 4G9YA 2K85A 2HYJA 1IN8A 2HDWA 1I6XA 1DUXC 2QSFX 4GDFA 2HWVA 5KNLA 4M71A 5IT9Z 2V26A 1YIJI 4AYBA 5L3FA 3H0GJ 2ID3A 1IXRC 2ZMEB 4L9JA 3QPTA 2M34A 1UMQA 3CJQB 1C0WA 1V5EA 4EJOA 4BDZA 4NQWB 3ZMTA 3SJMA 3BJAA 2JA2A 3NEUA 3P9CA 3VYSB 1LPQA 2CQKA 2HYGD 3MKYB 3OYMA 1H88C 1TQPA 5BNGA 3FXOA 1ODDA 3RZOJ 3WTTC 3EPZA 1ZG3A 2V6CA 3B6AA 1YLFA 1VTNC 3BZKA 3B73A 4V2GA 3CUQC 4JP0A 4YRVA 2L7ZA 3JTHA 5HDGA 1R1UA 3SXYA 4M3EA 2CMPA 4XQFA 4PK4A 3L2UA 3CCEI 1VQ9I 2DOEA 1U0JA 2EFNA 4CYCB 3WHCA 4YIRX 2O3FA 1VQ5I 3BTLA 3FXLA 4EMSA 1FT9A 2YR2A 3FHZA 2W7NA 2DPDA 4CSWA 3D5RC 3IAM2 2YX7A 2Q8KA 3ZMSA 1A6QA 1FBSA 3Q9VA 4P55A 2L02A 2O5RA 3C3WA 3GXOA 4H4KC 4RB0A 5FRNA 3R6SA 2CV0A 1X1CA 4XOTA 1TW2A 1XMXA 3OIOA 1SAUA 5F0CA 3ZMUA 3QRFF 1P2FA 3IAS2 4F91B 1Z3YA 3K2AA 3E1SA 2JPCA 1RIOH 3ABTA 1MBHA 3K4LA 3WTYC 1XG1A 3FXKA 4DIQA 4EM2A 3DCFA 2RGVA 3I5UA 2L4MA 2ACJA 2BHYA 5ED4A 2COBA 1YRNB 2OV7A 4UB6C 3HTSB 1JHHA 1EJ9A 2GLOA 3CMAI 3M9AA 1XSDA 2ETHA 2L9VA 1KU3A 3WODF 2H1LA 3L2RA 2XIGA 2IS1A 2M9HA 4ENMA 1DDNA 4J00A 1NHAA 1MJAA 3M4OJ 1U78A 1FZPB 4LG3A 5KK1A 2BYVE 2M3AA 4A3DJ 1OFCX 3SHFA 3G1OA 2Y9ZA 1QHGA 3BZ6A 1VQLI 3H3ZA 2R5ZA 1D1BA 2R7WA 3SFZA 1HBXG 3FDYA 4G6TB 5D6FA 2FF4A 1Y1WJ 1A36A 2B9SA 2WC2A 3BT9A 4PUSA 2V6EA 1BJAA 3M07A 1DGWY 2GZWA 2IGKA 1R5GA 3LSTA 3DEWA 3H36A 5LGNA 4S04A 2BY3A 2X1CA 3H0DA 3I4NJ 1W0UA 3OWTA 4S05A 2FQ3A 2GAUA 3K70C 3HUGA 3V7SA 4F7ZA 1TP4A 2F4IA 1EF4A 3I9V2 2VJ4A 4IQ4A 4HV5A 4DZPA 4WX9A 2DI3A 1FBQA 2PEXA 2HOSA 4U7DA 2DXIA 1V3FA 2Y0SN 3CO6C 4ESFA 4B1RA 1JUPA 2M2EA 4QLCU 2LK2A 4G6DA 3RKWA 4YFNF 2DQLA 3ZQIA 2HVQA 4D0PA 1K78B 3IP4B 1LJ9A 3PIOF 3CLQA 3L09A 3UKGA 2W24A 1HW5A 3PFIA 5B1BH 2CJJA 2R7FA 3DKWA 1E17A 3OL3A 3P9IA 4HBLA 2DA4A 2EZLA 2PFBA 1HDPA 3HRUA 3KZIC 3H5RA 3F8NA 3PSIA 2R7DA 4HNTA 3L2CA 3D5SC 4CYDA 5KCMA 2VBWA 1XN7A 2QEXI 4KITB 1KYWA 5FKKA 4BKXA 3ELKA 5FD6A 4I01A 4IZZA 3FBIB 1LVAA 4IRGA 3PQKA 5DDGA 2Z5UA 1DGRM 1XC5A 3HSRA 1VQ4I 1IJWC 1LQ1A 4YG2F 2BEOA 5E8GA 4IHVA 4OIQF 1FYLA 2VXZA 4R8HA 4V19K 1BOBA 2G0EA 1Y56A 1RI7A 3FF5A 2PLYA 3FX3A 2CSOA 2ELJA 5K7HA 3SFIA 2QM3A 1WJEA 1MNMC 3IHUA 3SZGA 1TT5B 3G6EI 2NS0A 1LE8A 3OR2C 4PJMA 1E3OC 3PNTA 2K02A 5DTDA 1ZRCA 2G7HA 5ICEA 4V2FA 3HOSA 2A5WA 1YOVB 2BHZA 1G59A 4ZDLA 3RYPA 1OCOH 2HU9A 5HLHA 5LLQA 5LGUA 1QVUA 2BGCA 3TGNA 4FCYA 5K1YA 4A3IJ 2MABA 4BHBA 3P7NA 1W5SA 2KRFA 4II3A 4E7KA 3WE3A 4MTDA 1S3JA 2BZTA 2R7XA 3E6DA 1MH4A 2JSPA 2VN2A 1BR2A 1FP2A 2DT6A 3FBNB 3MVPA 3CLOA 4XKWA 3ZMDA 4E7SA 2E1MC 2VE9A 1OYIA 4ZTFA 4B4CA 1VI0A 1XTAA 2P7CB 1S7OA 3DXJF 4EJUA 5D5UB 3PNVA 3OYIA 4KT5C 2K9MA 4ON0A 4WXHA 3K9TA 3BG9A 3RZDJ 2GA2A 1XMKA 2V1NA 4EJVA 4BHPA 4II2A 2E5ZA 1IC8A 3MMYB 2MD0A 3F3XA 4HF0A 1S9HA 1IRXA 4I99C 2LD5A 1H89C 1HCRA 5FB2A 2X6XA 5DEQA 1Y1VJ 1SEUA 1FTZA 2R4GA 2XF6A 1YX5A 1I3AA 2XAHA 2M4KA 3K6GA 3I4MJ 1G4DA 1OYWA 5LBQA 3MKZA 1FMVA 1Z1DA 3GO5A 1MDMA 1A6IA 2WBMA 2XF5A 3ZQCA 1ZR2A 2HVRA 3ROUA 5IYDJ 1KQ8A 2ZC2A 4IHYA 3DKXA 3A4CA 2W48A 3M3YJ 1H9TA 2WADA 4Q48A 5GTHC 3CTAA 2KIFA 3ZR8X 1JI8A 4KIGA 3DTKA 2MFZA 1T6SA 2CS3A 1ZYRF 4OIRF 3I55I 4EJTA 3CF2A 4L5IA 1FOXA 5K5QA 4JX5A 4AIJA 1ZR4A 3CDLA 3S3NA 3LA2A 2W00A 2IXSA 3S3OA 3ABKH 4KDPA 4Y3OA 2XAQA 1L3LA 3K69A 3BR2A 3DKYA 5FJ8J 4E7JA 5DUIA 4B43A 3KEYA 4N9HA 3TDUC 2DYSH 4XSZF 2DOFA 1MNEA 2V1DA 3HPGA 3FMRA 1BI0A 2X1DA 4I02A 4LG0A 1JKRC 4CXFA 1BIAA 2ZKZA 3EUHC 3C1DA 3WTZA 4A69C 3AG2H 5A2QK 1WFXA 5F1RA 2NOJB 2W25A 4MO7A 4A0XA 5IP7J 3LQRA 2DA1A 5CVVA 4BJ5C 3L1PA 4L5EA 2CWEA 1OJLA 3MWMA 5A2QZ 3JW4A 3M7GA 1DU0A 2K27A 3K1PA 2Z33A 1QHHD 3ZN0A 4HDUA 1MDMB 1JJ8C 2C6YA 1WKMA 2OF7A 4L0YB 2LMDA 1OISA 2CO5A 2IVMA 4IEJA 1W4MA 2OU2A 2EFQA 2Y9YA 4IL6C 1VNDA 5IYCJ 3K4KA 3QPSA 2LNBA 5F6FA 5FROA 3E6BA 1X4OA 1MMAA 2KPMA 1EH8A 1I39A 4A3JJ 2ELKA 1KU2A 1TWHJ 2AXTC 2F2EA 2FU4A 2IRFG 3OYJA 3I53A 4Y7NJ 4AIKA 2M7BA 2EV0A 2FRHA 4M74A 1L0OC 3ABUA 3GUDA 1WRJA 2BY1A 1NTCA 5GADJ 1FP1D 4C3HJ 5CYVA 2NNYA 4BEHB 4Y17A 3EDPA 2Z1DA 2R7QA 4LOCA 1BM9A 5HNFA 3CCRI 2EPFA 2E5NA 2QKMB 2KRHA 4CCMA 3CMMA 1YW8A 5D5XB 4RB1A 3FXJA 1FEXA 1MBGA 2A68F 1IN7A 2DTZA 3ZXSA 4KNYA 1RR7A 5F0HA 2HQRA 1I1GA 1X3UA 1YHQI 5K5OA 1S72I 4LLGF 3CC4I 1G6NA 2KRCA 3ONQA 1HW1A 1KA8A 5F1JA 3BC8A 5GAHJ 3JRCA 2FD5A 3V42A 5C4JJ 3I0TA 3F8FA 4HZFA 2KJBA 2CQ7A 4ENNA 4PGGA 1S5LC 4RA2A 2IPQX 3G73A 3KP2A 2X85A 2W82A 5CQEA 4HV6A 5GAGJ 2QKLB 5JVTA 1LDKB 3F23A 3OSFA 1PP7U 1HLVA 1JT0A 3GTKJ 3K4JA 4YIIA 1WHUA 4MEYF 3F21A 4A3KJ 4MNUA 4DQ2A 4XONA 2L5QA 2RV8A 1A5JA 3GWZA 5EEHA 2UZKA 4RLFA 2IAIA 2HVSA 1DP3A 2R7ZJ 3KP6A 1VQKI 2L7MP 1TZLA 3A02A 1MD0A 2DODA 3ZQ7A 4S0HB 2FNAA 5HS8A 1X2MA 3F8CA 2P5KA 1JGGA 1BBYA 2DMUA 3GEZA 2EQRA 1RNLA 3W2AA 3JRIA 2A6TA 2Y31A 3C2BA 3MFKA 2DAOA 4LLNA 1ETVA 4L0ZB 1UAAA 4M9SA 1JT6A 1OKRA 1XSVA 3VYRB 2PG4A 1POGA 3ISPA 3IH4A 3WTVC 2Z3YA 3FXMA 4UNOA 5CLSA 1UCRA 1T38A 4U7BA 3IH2A 4MIMA 3CCUI 1F9NA 2QWWA 3FMQA 4U88A 4FX4A 6PAXA 1USSA 1XPXA 1EA3A 1UELB 4ZYGA 3P5JA 4NNJA 2EA4A 1P6RA 1SFXA 1SMYF 3C18A 3SEZA 4CCLA 5BOXA 1PJRA 3QP5A 2CG4A 4ABZA 3DBRB 4ZH4F 2K9LA 3QOPA 1T95A 3FM3A 4Y52J 1IDZA 3UNGC 1YI2I 2VKDA 3ECOA 3OYKA 3HRMA 3AAFA 4R1HA 3ZCOA 1I1SA 1LB2A 1U9NA 1F5TA 4K2EA 1D5VA 2DW4A 1J0RA 1SC7A 5B66C 3GF2A 2EILH 4XRFA 4BQOA 2OZUA 4KJZA 2PMUA 4IJAA 2VPLA 1ZK8A 4IO9F 3TMOA 2X4HA 3Q0WA 4W1UA 2BOLA 1A31A 3WTXC 4KN4X 3E7LA 3LAJA 2V79A 4IOCF 2RNGA 1YG2A 3F0CA 2VC0A 1ZKGA 4I6ZA 2ECCA 2X6YA 2QLZA 1JUSA 2EV6A 2K9QA 3WTUC 2R0QC 2OQRA 1ETQA 2F4OB 5EYRA 1HOMA 1NG7A 5E20A 4R79A 5J1YA 2XDVA 4G7ZF 4ZTJA 1R36A 4KFCA 2XV4S 1R9TJ 2JA7J 3HOUJ 1S8NA 4GGGA 1LFUP 1D8KA 2I8DA 2MH2A 5FLMJ 2K40A 1KU9A 2E36A 3G2BA 4IRIA 4BAYA 4L5JA 2I5UA 2WV0A 4BHCA 2F4MB 2DT5A 4OMYA 5E3MA 1K6OA 3BPVA 1HKTA 4JYKA 2O0YA 2GIVA 3IWZA 1SFOJ 5EZGA 3RCOA 3HHHA 4XK4A 2O8XA 2XGEA 1Y8QB 3W2VA 4RBOA 2XVCA 2A3SA 1S7AA 1RUNA 1HSJA 2H1KA 1MGTA 2O7OA 5EGOB 1ACIA 2UWMA 3KZYA 3EQLF 1GV2A 3HIFA 2FSWA 3AL0B 2CFOA 4HQEA 5DCMB 1UHWA 1XCVA 4OOIA 3GLXA 3JAMZ 2ZMEA 4XLFA 2WAFA 3ULQB 1BJZA 1SFKA 5E1XA 2ZO4A 2MC4A 3WU2C 3HOZJ 2QSGX 4KT6A 2P5LC 1Z0XA 2ESNA 3O8GA 4OAYA 2E71A 3T1BA 4N0BA 5K5RA 3A01B 1YX3A 3CMEI 1LNWA 3I4PA 2XRNA 5D5WB 4A3LJ 2XROA 2QYOA 2QUFA 3MKLA 3DBHB 2AS5F 3O2PE 4CYCA 2M45A 2IGOA 5JI6A 5C44J 1P7IA 3AG1H 4DZJA 3L7WA 2EB7A 3HM5A 2NVQJ 2DFFA 1K6YA 2G9WA 4ZYDA 4B3AA 2A6HF 4GYGA 4HG2A 3FHNA 5L3EA 2VKEA 4IXAA 2DA6A 3DF8A 1WCMJ 3ZOBA 1FSHA 1AA7A 3ZPLA 5LHHA 2ZMEC 1YS6A 3Q0UA 5E1ZB 3C2HA 4NC6A 1DPUA 1J2XA 2DA2A 4Y15A 2QQ8A 4QSHA 3JRFA 2HDDA 3S2DJ 4HEA2 2N8GA 2R5YB 1WVRA 1NK2P 2JN6A 3WU0A 4C2TA 3GTLJ 2QCOA 2P8TA 2CV2A 5D4SA 1YRNA 2LTPA 1ZLJA 4XICA 3HDDA 2VT2A 4RAGA 3LMMA 2FEZA 1GV5A 1XDUA 5B5EC 3JTGA 2NXNB 2XAGA 4OMZA 2H09A 3S1MJ 5IOYA 2D5VA 1STZA 2E34A 4MGRA 2STTA 3V4GA 1MSEC 3WTSC 4F93B 3PQJA 3K70D 5HDKA 3OS0A 2LRDA 1OPCA 1QGPA 4FQGA 3CQZJ 4UHTA 2BVLA 4C2MJ 1G3YA 3V7CA 1Y0NA 5H6QA 3BR3A 4CCOA 4A3FJ 1BI1A 3LSRA 3GZ5A 2X48A 4P1WA 1LKXA 1X1BA 2L9SA 3WG7H 3IV5A 2OQGA 1G3WA 1PVEA 5HNHA 2Y48A 5JHFA 2YS9A 1Y39A 5GPAA 2QGUA 3RPUD 2FBHA 1B9NA 4X0GA 5EG0B 3O3KA 1FIAA 1WPKA 3H9GA 1HC8A 4IPAA 2CW0F 3L2VA 2CUFA 2QF7A 2LR8A 2RNJA 3TQNA 3KE2A 4XORA 3GZ6A 3CP8A 2L3DA 3DV8A 2GQQA 2EWNA 3J7AO 4BS9A 2VQGA 3HRSA 4BBSJ 2R7UA 3H3VK 5E17F 4HNVA 5EZHA 2J5PA 1A04A 1P9QC 4XLCA 4IOAF 2JK3A 3ZQFA 4B8XA 2W4SA 5BMZA 1FY7A 3SEQA 1U2WA 4NDLA 3VDXA 2KIUA 3I71A 4AVZA 3GTJJ 2ID6A 5FFXA 4XNFA 3IUOA 4YFKF 1QPIA 1K78A 2AHQA 2Q1ZB 5H2FC 2YPRA 5E3OA 1AWCA 4XMYA 2M1BA 4XLEA 3PNYA 3HOTA 2MLGA 5EEAA 3DFGA 2E7XA 2EFOA 2FE3A 4LK0F 3LAPA 2KZGA 1ZH5A 3F6VA 2MLKA 2DA5A 1YO5C 1IN5A 4ZZLA 2XGDA 3LSKA 1QO0D 5HODA 3G1LA 3M8JA 4DYCA 2D1HA 4EJWA 4P96A 1R00A 4XLPF 3S32A 3BG5A 4G7OF 1Z7LA 3G1MA 3E0JB 4IF4A 4I09A 4RM2A 4HQMA 4LB6B 2DFIA 1SVLA 1Z67A 2CH0A 2QQ9A 2YSRA 2L54A 5L3BA 4L9VA 5BQTA 2VBXA 1YW7A 3BG3A 2VQHA 3M1CA 1J5YA 2ZJQF 3PL8A 3CZ6A 1KGSA 5J1UA 1ENHA 4AUXA 3PIPF 1MZBA 1Z21A 5FLXZ 1XSXA 3TO7A 3DBLB 4CCJA 4XRSG 5J8CA 1FBUA 4AWXB 2QBYA 2VKHA 3KYLA 3BG7A 3BZCA 3H3UA 4GYIA 3PFYA 4M73A 4PZJA 3JSOA 3MZHA 4IHWA 2KIMA 3RIRA 5CVRA 1TBXA 2MH9A 3OYAA 2KZVA 1P4XA 2V7FA 4BBRJ 2LYCA 4IRHA 3S2WA 1R4NB 3ZQHA 1HW2A 1QBJA 3GTMJ 5AIQA 2DA7A 2FOKA 1D0ZA 1XMAA 4F92B 1TL8A 1B9MA 2O9LA 1ETWA 4EQQA 3ECHA 1Z6RA 2H94A 2XPUA 4WWCA 2RC4A 3FKJA 1JKPC 3KLNA 3DP7A 4LB5A 4HPQA 4FTHA 3V8JA 3DEEA 1ETOA 4I98B 4FETA 1V5GA 3GMEA 4CDGA 1W0TA 2FX0A 4XM3A 4KMUX 3VOEA 3HOXJ 2D45A 1SFEA 2NYXA 3K7AJ 3OYBA 1I5ZA 1P92A 3OYLA 1YJWI 1UFMA 2XPWA 4C3JJ 1HF0A 2O8KA 2MBFA 3GVAA 5JVGF 5ILVA 1FJLA 3B6CA 1BW6A 2NVXJ 2OTJI 3ASNH 4RGUA 3GFLA 2PMHA 2ECBA 2PJPA 3J80Z 3KIOA 3BTIA 4GXOA 1X1DA 3BQYA 3CO7C 4BXFA 2QBYB 2WV1A 5CVUA 3VWBA 3H5NA 1W36C 3L2WA 2BXYA 1CGPA 1DU6A 4HLXA 3EYIA 1SVOA 2XSJC 3H9JA 5CKTA 3ZN1A 3DTIA 3V8KA 3GLLA 4A12A 2FBIA 3OL4A 4AIHA 5B3SH 1IZ1A 5J8FA 3RDIA 2WY7Q 2QQBA 4A3EJ 1SD4A 2JTVA 3MEXA 3G71I 4HF1A 2ZXHA 1SANA 1J7KA 3H1CA 4OINF 4G8XA 2PN6A 2M5WA 2Q2EA 4U87A 4BE1A 4CA0A 4BJ6C 4AVPA 4C9YA 1PUFB 1B72B 9ANTA 4UV9A 4ZDOA 3QU3A 5TJJA 2FJ1A 2RDPA 4HSTA 4BY7J 2ZXIA 3I59B 4MFEA 2R7RA 3BG6A 3OOPA 1Z05A 4X1EA 4KA4A 1EH6A 1SD7A 4B09A 2PJRB 2KDZA 1ZQ3P 1K7AA 1QVTA 1OLTA 1IO2A 3R0AA 1VQNI 1G8XA 4RGXA 5TISC 2PI0A 1W5TA 2LSOA 5E3LA 1U6GA 4A2UA 1E3HA 2VXDA 3HBLA 4KIFA 4ZC3A 2F5FA 4E7ZA 3J81Z 1FOYA 2IS4A 2VT3A 3NQOA 2DFHA 3DPLC 4XRSA 3RYRA 4IHTA 3E5UA 2JVGA 2ICWG 3IL2A 3COAC 2YU9J 3LSPA 2XRLA 1QA6A 2XC7A 1IV8A 2GWRA 2IW5A 3SQNA 4A3GJ 1IRZA 4IHXA 5D5VB 4HOBA 3I64A 3ERED 3BTJA 2XB0X 5F27A 4HF2A 4EV0A 4CCNA 2XAFA 4BEHA 1IN4A 4UUTA 2EIKH 3FXRA 2ISYA 4E6KG 2H6CA 3CP2A 4DBRA 3TBIA 3NWSA 1R23A 2Q2EB 4Y13A 4BQQA 5EJCA 1TC3C 2DMPA 3F72A 4LGWA 1JKQC 1FIPA 1QQIA 4HX8A 4EM0B 1R49A 1XX5A 2EJRA 2R7TA 2QSHX 5ERIA 4BQAA 1CQTA 2NS7A 2WB1N 3FISA 2DA3A 2DK5A 2MD5A 1NG6A 2MGQA 2K5CA 5FKMA 3R0JA 4EEFG 5ICFA 1ZTRA 1GT0C 1HQCA 2K9NA 1WSUA 1APLC 1ON2A 2GA1A 3BJOA 1MJ9A 2JUGA 4DNCA 3ABLH 5ICGA 1XCBA 1BC8C 3KP4A 4LFUA 3BTCA 2PMZN 3CC2I 2LP0A 1TTYA 3H35A 1W7PD 2VI6A 3VYUB 2P81A 4LJZF 5CPRB 4UB8C 2YUSA 3ZP5A 4HYEA 4OAZA 3ESWB 4I7HA 5E79C 3ML6A 2G7UA 1WJ5A 3BPXA 5DS9A 3KP5A 3KFWX 3HG9A 2BXZA 2WY8Q 2R7SA 3MQ0A 1QZZA 2O6GE 5GTIC 2BBYA 2ZJPF 1HA8A 4MLOA 3HL2A 1FYKA 3LOCA 3CCYA 4UVAA 3AKZA 3RJPA 3KX2A 4XN3A 3DQVC 3DLAA 4LITA 2GM4A 5LFAA 4ESJA 4GCVA 1O3TA 1R1TA 1UZCA 1XGSA 2ZNYA 3T8TA 1SFUA 2B63J 2STWA 2KDOA 5C4XJ 2CQNA 3BJ6A 1U5TB 1AKHB 2DYRH 2IT0A 3MN2A 2VQLA 3AG4H 2LBFB 4C2UA 4ZZDA 4RAZA 2DK8A 2VL8A 5JLWA 3CCLI 3MZ8A 2HS5A 3K1MA 1WWXA 1RETA 4HW0A 4FE7A 2KHMA 5F0FA 3OY9A 1TT0A 1PP8F 1T2KA 3I54A 1T08B 2VJ5A 1YJNI 3GTPJ 5D6EA 3DLLF 3K2ZA 5CJ9A 3OIPA 1FOWA 3GW2A 4B44A 1R4MB 3IC7A 1KU7A 3WG9A 3IKVA 4QWQA 4RAFA 2IA1A 3JSPA 3LSIA 3OMYA 3R61A 4ZYHA 1WJDA 1TQIA 3EYYA 3A03A 2OBPA 5J4YA 1P4AA 5K7FA 2K3PA 2K7LA 2VIXA 2O03A 3S15J 1UG0A 2MC3A 3T5XA 1JXSA 5GPCA 1BIBA 2E2HJ 2HI3A 2AQFA 4H0EA 2ELHA 2FBKA 1UHSA 3GCMA 1I27A 4N4NB 3TP0A 5IY5H 3HGYA 4U0WA 2DOAA 4A3BJ 2HZTA 1XGOA 3V7RA 3Q5FA 3GBGA 2X1EA 3MAJA 5E3NA 2BW3B 5HS9A 4WK8F 5EGOA 2VASA 2M0CA 2M0MA 3T8RA 5HLGA 2K4JA 1MBKA 1RUOA 1YE9A 1D5YA 4M6XA 5DCMA 1K79A 1QRYA 1ZREA 2CYYA 4CZZA 1MJBA 1T56A 5IPAA 3OR1C 1M1EB 2XUBA 4LIVA 2Y2ZA 2IP2A 2Y69H 2VLAA 4BNCA 1ZG5A 1ETXA 5KHDA 5CQGA 2W1OA 1H0MA 1B8IB 4AM3A 5BPIA 3F6OA 3ZQGA 3A01A 2V1UA 2XKOA 4XRMA 4ZYAA 2Z16A 4EM1A 2NRAC 2CQXA 2L01A 2HNHA 2M4GA 5B1AH 3S16J 4G6QA 4F55A 1J75A 3ABMH 1MMNA 3CJTB 3W6KB 2IA0A 3Q0VA 2HKOA 1O3SA 3FM5A 3K0LA 1IN6A 1BL0A 4YIFA 3KEQA 1OQYA 1FYMA 2CGPA 4KIBA 4I76A 3I56I 4LK1F 3S2HJ 3CJRB 2R7VA 2RAEA 3ERMA 3Q9SA 3L9FA 4PCQA 1JUMA 1ZHFA 1SMTA 2L4AA 4JOMA 1OYYA 1GXQA 4DJAA 1RPWA 2XGCA 3FK7A 4E70A 5DM7F 1W1WE 2CW7A 2R5YA 3HYIA 2NVYJ 1YIOA 2CU7A 2M8GX 2A07F 4BQNA 2VBZA 4CH7A 3JAMK 3SYTA 3U1KA 3FK6A 1N78A 2EZIA 4P5OA 2DMNA 3BCAA 2FNPA 2MA3A 3H9QA 3BCBA 3M8EA 1DQUA 1E3PA 4B48A 1VF9A 5DYMA 5DUKA 3O6BB 2DBBA 3HJEA 3VPRA 2K3FA 3OV8A 3ZGKA 1XS9A 4OIOF 1YYVA 5JHUA 3K4NA 2GIZA 3WU1B 2VOPA 4JK1X 5AONA 4UUSB 1QZEA 1BR4A 2DDAA 2JT1A 4NB5A 1RRJA 2GXBA 2HTJA 1GLNA 5FO5A 2LDUA 3RI4A 1HXDA 2P5VA 4F52A 1MH3A 1Z7UA 1IUYA 2TRTA 4ASNA 1IXSB 1X4PA 1LDDA 1VFCA 2HOAA 2GOMA 4ENKA 4N9IA 4RMNA 3DWLE 4HRIA 3H92A 5EG0A 3B02A 2CUEA 1GHCA 4EGYA 2IA2A 2ME6A 2WB1A 1ULYA 3PM1A 4D7MA 2JA6J 2AQEA 5ILSA 2FQ4A 2V9KA 5DCFA 3RKYA 1QU3A 5HVQC 1F36A 4Z2YA 3WTWC 2HPMA 2EZHA 3GFJA 2VE8A 1RR8C 1KQ9A 5M3MJ 1GUUA 4MTEA 1VQPI 5LRRA 2HOEA 4DYRA 3GTOJ 2PMZA 2HOTA 3HTUA 3D1NI 1EH7A 2CUZA 3R60A 2CW8A 1U8RA 2KT0A 3CUQA 4OWRB 4UV8A 1MKMA 2E7WA 2V4JC 3IRRA 2ADUA 3TOBA 2LG4A 1OCPA 2Y0MA 4EVIA 4A3CJ 2ZFUA 3JRDA 4J19A 3E6CC 3GTGJ 3RKQA 3U1DA 3E97A 1R5HA 1Z91A 4PFPA 4XKVA 4NC7A 1V5FA 1I50J 1MMDA 3CC7I 3TO6A 2GXGA 2RQQA 1P7JA 4RAYA 2L7KA 5KVRA 4ETSA 1WH5A 3REOA 3VSKA 1U9OA 3CF5F 1WGXA 3E5XA 1PDNC 2V9VA 3M1EA 1V55H 3TW6A 1O4XA 3KYCB 3EUKL 1B59A 1B6AA 1U3EM 4E4HA 1A35A 2KP6A 1TWFJ 4LD5A 1T33A 5ICCA 1IG7A 5AIPA 4ITVA 1LVKA 2E1NA 2F5EA 2JWTA 3TO9A 5EEGA 4HLYA 4Y33A 1YFHA 2DMTA 1XGNA 2HXOA 3DEUA 3OYNA 1YITI 2JRMA 4D5CA 5JR3A 2JA8J 2AXLA 2GXAA 5HOOA 2L9RA 1IRGA 4P9FA 4AIDA 3LQQA 4XR6A 2A69F 2HQNA 4UXNA 3QWLA 2H8RA 1UB9A 3E6MA 1BN5A 2CFXA 5FKNA 2OJED 3SDGA 4BE0A 2W84A 1ZELA 2JMWA 2OC6A 4FT8A 2RKHA 4RS8A 1TWGJ 4XLNF 3CUQB 4BU2A 2LVSA 3N4MA 1SD5A 5E18F 3N05A 4M6YA 3RQ4A 4M72A 5DD4A 3BP8A 4A0YA 2L2OA 4QPOA 3ZMZA 2F48A 3CDHA 4KISA 1BC7C 5L3CA 2X6OA 2EINH 1ZRFA 4CO8A 4DBQA 3I58A 2F6CA 5F04A 3TP3A 2VPRA 4A0ZA 1BW5A 2LY2A 1MBJA 2LFBA 2A6EF 3QOEA 3HOVJ 1R7JA 4BXUA 3OYHA 4ESBA 3U2RA 3D5LA 2KISA 3U21A 3JRAA 1W36D 3ZRGA 1LFPA 3DU5A 1JJ6C 2LF7A 4PSWA 4HA8A 3K4CA 2WAEA 1T0FA 1V54H 2B0LA 3O8HA 3QYBA 5FD5A 4Q47A 5FKOA 3A1YA 1AOYA 4YEJA 1WJBA 4O3MA 2HQAA 4C3IJ 3JRBA 1IXCA 3KLOA 3QYEA 5DD8A 4CGZA 5M5YJ 2DT7B 2VUMJ 1T39A 3C7JA 3WGGA 1WJAA 3BLYA 4N4OB 1QZYA 4WXCA 5FLXK 4G94A 4XL9A 3RPUA 4LIUA 2OTLI 2QQAA 1B1BA 1T98A 2M87A 2YU3A 3RQIA 4UVCA 1BA5A 3EUAA 1JTYA 1UHMA 2NVUB 4B3XA 2H27A 3CD6I 1K83J 4QTRA 2R7OA 4PJ0C 4XLAA 3DTEA
chains in the Genus database with same CATH topology
2B7EA 2KISA 2DOFA 2LKSA 2E71A 2KIQA 2CQNA 2KZGA 4FQGA 2JUCA 2L9VA 2K85A 2DOEA 2DODA 1UZCA 2KFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7E A;  2KIS A;  2DOF A;  2LKS A;  2E71 A;  2KIQ A;  2CQN A;  2KZG A;  4FQG A;  2JUC A;  2L9V A;  2K85 A;  2DOE A;  2DOD A;  1UZC A;  2KFD A; 
#chains in the Genus database with same CATH topology
 2UUZ A;  1ZAR A;  5H6R A;  1S6L A;  2EK5 A;  4ZDP A;  2A05 A;  2HXI A;  2E60 A;  1FPQ A;  3NWT A;  1MBF A;  2LKS A;  5HLT A;  4GRI A;  3L00 A;  1FNN A;  1OR7 A;  1YW9 A;  3HKZ A;  2QVO A;  1VQ6 I;  1ERD A;  4BH9 A;  2DJI A;  1J59 A;  2XHK A;  3KZZ A;  3K10 A;  2F5C A;  3PSF A;  3R4K A;  3HRT A;  1MMG A;  2ZXW H;  1I3Q J;  2DCE A;  3AG3 H;  3HOW J;  1T0F C;  4RGR A;  2A61 A;  2L9N A;  2BY2 A;  1KON A;  3RTR A;  1PUF A;  1B72 A;  2VOD A;  2X9D A;  4CHU A;  3HXL A;  1DP7 P;  4U0V A;  5J40 A;  2ZBK A;  5IT3 A;  4YEL A;  5J47 A;  4KN7 X;  3I59 A;  3PUF A;  1ITY A;  3M8F A;  5J3L A;  5FLV A;  1W5C C;  2TDX A;  2EA2 A;  1H9G A;  4IVN A;  2PJR A;  1V4R A;  5GP9 A;  3PO2 J;  1IF1 A;  4Z6Y A;  1R6R A;  3HZJ A;  3RSN A;  4UY8 I;  3MKW B;  3GYH X;  3IRQ A;  5TRD A;  3FMS A;  2IS6 A;  3W2W A;  2PQ8 A;  3TW7 A;  4EGZ A;  1WJC A;  5BS6 A;  4NBQ A;  2IJL A;  1O7L A;  2EV5 A;  2OCC H;  3Q3S A;  3OYF A;  4RGS A;  2RVC A;  3VOD A;  2BY0 A;  5LGT A;  3J80 K;  1OR7 C;  2JSC A;  2ZFW A;  3OYG A;  1VQ7 I;  3CES A;  2QA4 I;  3BY6 A;  3TDZ C;  3BWG A;  2IS2 A;  2NNN A;  4AD9 A;  1ETK A;  2W57 A;  1R1V A;  2LOO A;  1S7E A;  3E3V A;  1Y8R B;  2Q0O A;  3G4S I;  2XB5 A;  2QZ8 A;  2R5Z B;  3S1Q J;  2Z2S B;  2EIM H;  5KAF C;  3I3L A;  1YQA A;  1ZLK A;  2EIJ H;  2LY1 A;  2KJC A;  1Z9C A;  2PX9 A;  3BQZ A;  4FX0 A;  1K61 A;  2E2I J;  5D4R A;  3S93 A;  2H8W A;  3OYC A;  4BXX J;  1RES A;  2X51 A;  4E7I A;  2XAU A;  2GBY A;  1TNS A;  3WGH A;  2RRE A;  1LEA A;  2JA5 J;  4MFD A;  1IGN A;  3HUG B;  4BL0 B;  2E1C A;  2OCE A;  3FWE A;  3LFK A;  4M6V A;  5BPD A;  1MMS A;  2KMU A;  5CVJ A;  3QU6 A;  2DTR A;  2XPV A;  2ZXJ A;  1LUJ B;  3EET A;  5LD2 C;  1PUE E;  4PSX A;  1BOA A;  3FXQ A;  2NVT J;  1BI2 A;  3OIQ A;  3DPU A;  4I0B A;  3K4B A;  3CCJ I;  4A93 J;  2OPT A;  2M30 A;  3KEO A;  3KYD B;  4L18 B;  4NC8 A;  1D1C A;  4ANJ A;  1J09 A;  4BE2 A;  3SZT A;  1MSF C;  3J81 K;  3VYT B;  4HX7 A;  1XB4 A;  5J1R A;  3GZN B;  1ZRD A;  2VQC A;  3PUB A;  1QPM A;  2X0L A;  2Z99 A;  3OYE A;  3LNQ A;  3KET A;  3F22 A;  4Q4Z F;  1BI3 A;  4BJT A;  4RB3 C;  1SD6 A;  4WCG A;  4D5F A;  1NK3 P;  2MSY A;  2WAQ N;  4M9Z A;  3WHB A;  1IW7 F;  2LH9 A;  3HHG A;  2P0W A;  3VEP A;  4E7H A;  2E1M B;  1Q1V A;  3NRV A;  4M3B A;  2VJJ A;  3LA3 A;  1RKT A;  4C30 A;  3V8L A;  2Y30 A;  4KUM A;  4HDV A;  1ORK A;  2HDC A;  3EUH A;  2TCT A;  1BR1 A;  1N25 A;  5IYB J;  1D8J A;  4M3F A;  2VC1 A;  2Z9O A;  2P7V B;  2FA5 A;  1TLH B;  3IH3 A;  3IKT A;  4D1Q A;  3OS1 A;  4A6E A;  3A2K A;  4KYW A;  5FKL A;  3PJR A;  1WJF A;  5FGM A;  3QYF A;  4X6A J;  3KPH A;  2XGX A;  4JX4 A;  1LE8 B;  3DU6 A;  3J7Z I;  2WA0 A;  4XSX F;  4WXD A;  1G2H A;  2XKP A;  2XAS A;  4PFO A;  3VB2 A;  5LEJ A;  4PDK A;  3F8M A;  1U5T A;  2MG4 A;  1AKH A;  2BE5 F;  5LEK A;  1OCT C;  3W6V A;  2FML A;  1G3T A;  3MD2 A;  2ISZ A;  1X3W B;  3S1N J;  4HX4 A;  2LBF A;  2V9P A;  1REP C;  1VZ0 A;  3JRE A;  1WQ2 A;  3HSE A;  3LL7 A;  2KQR A;  5HS7 A;  2DO7 A;  2OA4 A;  2L0K A;  4L9N A;  2HR3 A;  2HEO A;  4LLL A;  2EBI A;  3W6J B;  4IKF A;  4M9X A;  4DYQ A;  3CDI A;  1TW3 A;  3HGG A;  1X1P A;  5TGT A;  2WTE A;  1ON1 A;  2V1X A;  5CVI A;  2R92 J;  2YX4 A;  1R22 A;  1XGM A;  2DU9 A;  2OD5 A;  1R58 A;  4A5M A;  3MZY A;  2P6S A;  4AU7 A;  1CF7 A;  1N77 A;  3HC7 A;  2LLK A;  3HSF A;  2CV1 A;  2XAJ A;  4IQJ A;  1P4W A;  1LFB A;  5FRM A;  1FSE A;  2BVM A;  2LF8 A;  4HAM A;  3RKX A;  1XD7 A;  1OCR H;  4MQ9 F;  3E5Q A;  4XKB A;  3VSL A;  1HST A;  1N75 A;  2VOO A;  1U5T C;  1H8A C;  4W97 A;  4UUV A;  2NAZ A;  4LMY A;  1ZGA A;  1NH3 A;  4AC0 A;  4D7N A;  2VON A;  3S8P A;  4M3G A;  5M5W J;  2OUM A;  3LSG A;  2FMY A;  1KQ0 A;  1LDJ A;  2JJ7 A;  3NAR A;  1LEB A;  4QIW N;  4AYB N;  3SZP A;  2HGC A;  5FFZ A;  1AU7 A;  4BUP A;  3S3M A;  2LRE A;  2MYS A;  3JCU C;  3QPL A;  2ZSI B;  3CJN A;  5JFR A;  4O5V A;  2EH3 A;  1IUF A;  1ZG1 A;  1K4T A;  1F4K A;  5D8K B;  3S1R J;  3OYD A;  3N97 A;  2W85 A;  3U9G A;  1I6H J;  3OSG A;  2FUG 2;  1FMW A;  1D0Y A;  2DLL A;  1ZAO A;  3UR3 C;  5D8L B;  2A5Y B;  5C3E J;  1X3Z B;  2BW3 A;  4OIP F;  2ESH A;  4I2O A;  1U8B A;  3LSJ A;  1D3Y A;  4J01 A;  1UST A;  2HQ5 A;  1FOK A;  2MW8 A;  2OAZ A;  3T0Y A;  1GVJ A;  2GOX B;  4RLQ A;  4LG0 B;  2E19 A;  3F8B A;  1FX7 A;  4GFB A;  1WH7 A;  2UXX A;  4Y4R A;  4IHS A;  2O61 A;  2CQQ A;  4PGH A;  1X19 A;  4MHG A;  1B8I A;  4RDU A;  1MIJ A;  1D0X A;  2ZB9 A;  1CF7 B;  1Z6T A;  3S14 J;  2ZSH B;  1RZ4 A;  2HTS A;  3BR1 A;  5HDN A;  2COM A;  2KLO A;  3BOQ A;  5E1W A;  3TKY A;  4DOZ A;  4I0A A;  4CZC A;  3FIW A;  3HPH A;  4U0Y A;  1FC3 A;  1EKE A;  2RQP A;  3LFU A;  2DN0 A;  3G3Z A;  2M8E A;  4KIC A;  1W7P A;  2XSD C;  4ENJ A;  3L2Q A;  2Y0S A;  2P6T A;  2KIQ A;  2KKO A;  1DPR A;  1TWC J;  2HZD A;  1JGS A;  1OMI A;  4G7H F;  3WGI A;  5HLI A;  2CRG A;  1J9I A;  1G3S A;  4UVB A;  4IX7 A;  1F1Z A;  1VQO I;  5ILU A;  2K4B A;  2F5D A;  4CUG A;  4CIC A;  2HFH A;  4Q5S F;  3W3C A;  2F5V A;  3H5A A;  4GO1 A;  5F08 A;  3J7A Y;  1MW7 A;  1FWZ A;  2QEN A;  1GXP A;  3P9K A;  2E2J J;  5EF6 A;  3AFH A;  2D1V A;  2EFW A;  3OS2 A;  2JRT A;  2KFD A;  2M7A A;  2UXN A;  2FXA A;  3A0B C;  4EAT A;  4ZJZ A;  4XOP A;  3TED A;  3PO3 J;  1D1A A;  2IEK A;  5LRS A;  3BR5 A;  4A6D A;  2B7E A;  1YS7 A;  1X2N A;  2XF7 A;  4XKC A;  1IAW A;  2HPI A;  2DPU A;  1IV6 A;  2PBI A;  2J5O A;  3CCQ I;  2BV6 A;  3QOD A;  5M3F J;  4A3M J;  1YJ9 I;  2VKV A;  3CCS I;  2IGM A;  2P4W A;  4KMF A;  4M3D A;  2KL4 A;  1VQM I;  1E2X A;  4UUS A;  4XLH A;  1T8I A;  1FTT A;  3QP6 A;  3DPT A;  1Z77 A;  2E35 A;  1IDY A;  1RC9 A;  2UV1 A;  3KP7 A;  4NUB A;  1KZH A;  4TV7 A;  1K4S A;  2VB6 A;  3TOA A;  4NHJ A;  3HKZ N;  4BYY A;  3TL4 X;  2ZJ2 A;  2OZ6 A;  4XBF A;  4XN0 A;  1Y6I A;  4BAC A;  3JRH A;  5EDN A;  1R71 A;  3GFI A;  4PJJ A;  1W7P B;  1GVD A;  3HOY J;  1ZN2 A;  2X6W A;  3LWF A;  3FXU A;  3LA7 A;  5LHG A;  3GFM A;  2E1O A;  2JVH A;  5K7Z A;  4YFX F;  1O3Q A;  2DFE A;  2AO9 A;  4L9T A;  4HSR A;  4WF2 A;  1WI9 A;  2I10 A;  2VBY A;  5DV5 A;  3AL0 C;  4MQV A;  2IBD A;  2WWY A;  2ME0 A;  1PYV A;  1WZ2 A;  2DQR A;  1YTY A;  5L3D A;  1SAX A;  1UG2 A;  2LY9 A;  1MBE A;  1JHF A;  4OU0 A;  2ZJR F;  1SVM A;  4JQF A;  1JTX A;  3J7Y J;  2EFP A;  4B47 A;  3S17 J;  2NOG A;  1MND A;  1ZGJ A;  2H6B A;  5LHI A;  1ZGW A;  5KAI C;  1FLI A;  4G12 A;  1HKS A;  1OCZ H;  2IGN A;  2WAQ A;  3GTQ J;  3ZQQ A;  5L3G A;  1GDT A;  1EV7 A;  2Y75 A;  3QPH A;  3KCC A;  3CCM I;  2JQ7 A;  4BY1 J;  2RN7 A;  2R3S A;  2DDB A;  4O6J A;  2LKX A;  1QNT A;  1AHD P;  1ONV A;  3FKI J;  3FZV A;  1TWA J;  1IRF A;  3OOU A;  3GX4 X;  4DGW B;  2HKX A;  3WE2 A;  4FAS D;  4HNU A;  1HKQ A;  1O7F A;  1JE8 A;  4JBA A;  2K86 A;  2VJI A;  3BRO A;  5F64 A;  5J4V A;  1O3R A;  3MCZ A;  1ETY A;  2LKP A;  3VFZ A;  4PJN A;  4CCK A;  4MEX F;  1RKW A;  2JPB A;  3RPQ A;  1TQM A;  2JZY A;  2ZNZ A;  3C2G A;  1Y0U A;  3QAH A;  5IP9 J;  5DM6 F;  1XDS A;  1OCC H;  3K1N A;  3ASO H;  2HYF A;  4P9U A;  4FIS A;  1TNT A;  4NQW A;  1E0E A;  1S29 A;  3SDB A;  3K4M A;  3F9K A;  1JKO C;  5J6X A;  3BDD A;  2D2W A;  1X1A A;  4RM3 A;  5H20 A;  1UJ8 A;  1Q1H A;  3ZMV A;  1VQ8 I;  3A0H C;  4DW6 A;  3D0S A;  3LSH A;  3CMY A;  2FOW A;  4QPQ A;  1R5I D;  2JUC A;  4FE4 A;  4FHT A;  1F43 A;  4BGD A;  3HEF A;  2DJN A;  4E7L A;  1X58 A;  5JLX A;  3X2Q H;  3LSM A;  3JR9 A;  4ZYE A;  3HB9 A;  2ZCW A;  3NAU A;  4F3Q A;  2LC2 A;  2CUJ A;  1WI3 A;  3KP3 A;  4BDY A;  2L7F P;  1KYZ A;  3CUO A;  5GAE J;  3JRG A;  2K9S A;  2EZK A;  1Z3X A;  1B4A A;  2NS8 A;  5IOZ A;  5M5X J;  4XID A;  3BR6 A;  4D9J A;  5IP6 A;  3QQA A;  4RB2 C;  3BR0 A;  2R93 J;  1HDD C;  3IWF A;  3CCV I;  4JX6 A;  3ZQL A;  5IT9 K;  4PJL A;  1O57 A;  5E8I A;  4A5N A;  2DMQ A;  4G9Y A;  2K85 A;  2HYJ A;  1IN8 A;  2HDW A;  1I6X A;  1DUX C;  2QSF X;  4GDF A;  2HWV A;  5KNL A;  4M71 A;  5IT9 Z;  2V26 A;  1YIJ I;  4AYB A;  5L3F A;  3H0G J;  2ID3 A;  1IXR C;  2ZME B;  4L9J A;  3QPT A;  2M34 A;  1UMQ A;  3CJQ B;  1C0W A;  1V5E A;  4EJO A;  4BDZ A;  4NQW B;  3ZMT A;  3SJM A;  3BJA A;  2JA2 A;  3NEU A;  3P9C A;  3VYS B;  1LPQ A;  2CQK A;  2HYG D;  3MKY B;  3OYM A;  1H88 C;  1TQP A;  5BNG A;  3FXO A;  1ODD A;  3RZO J;  3WTT C;  3EPZ A;  1ZG3 A;  2V6C A;  3B6A A;  1YLF A;  1VTN C;  3BZK A;  3B73 A;  4V2G A;  3CUQ C;  4JP0 A;  4YRV A;  2L7Z A;  3JTH A;  5HDG A;  1R1U A;  3SXY A;  4M3E A;  2CMP A;  4XQF A;  4PK4 A;  3L2U A;  3CCE I;  1VQ9 I;  2DOE A;  1U0J A;  2EFN A;  4CYC B;  3WHC A;  4YIR X;  2O3F A;  1VQ5 I;  3BTL A;  3FXL A;  4EMS A;  1FT9 A;  2YR2 A;  3FHZ A;  2W7N A;  2DPD A;  4CSW A;  3D5R C;  3IAM 2;  2YX7 A;  2Q8K A;  3ZMS A;  1A6Q A;  1FBS A;  3Q9V A;  4P55 A;  2L02 A;  2O5R A;  3C3W A;  3GXO A;  4H4K C;  4RB0 A;  5FRN A;  3R6S A;  2CV0 A;  1X1C A;  4XOT A;  1TW2 A;  1XMX A;  3OIO A;  1SAU A;  5F0C A;  3ZMU A;  3QRF F;  1P2F A;  3IAS 2;  4F91 B;  1Z3Y A;  3K2A A;  3E1S A;  2JPC A;  1RIO H;  3ABT A;  1MBH A;  3K4L A;  3WTY C;  1XG1 A;  3FXK A;  4DIQ A;  4EM2 A;  3DCF A;  2RGV A;  3I5U A;  2L4M A;  2ACJ A;  2BHY A;  5ED4 A;  2COB A;  1YRN B;  2OV7 A;  4UB6 C;  3HTS B;  1JHH A;  1EJ9 A;  2GLO A;  3CMA I;  3M9A A;  1XSD A;  2ETH A;  2L9V A;  1KU3 A;  3WOD F;  2H1L A;  3L2R A;  2XIG A;  2IS1 A;  2M9H A;  4ENM A;  1DDN A;  4J00 A;  1NHA A;  1MJA A;  3M4O J;  1U78 A;  1FZP B;  4LG3 A;  5KK1 A;  2BYV E;  2M3A A;  4A3D J;  1OFC X;  3SHF A;  3G1O A;  2Y9Z A;  1QHG A;  3BZ6 A;  1VQL I;  3H3Z A;  2R5Z A;  1D1B A;  2R7W A;  3SFZ A;  1HBX G;  3FDY A;  4G6T B;  5D6F A;  2FF4 A;  1Y1W J;  1A36 A;  2B9S A;  2WC2 A;  3BT9 A;  4PUS A;  2V6E A;  1BJA A;  3M07 A;  1DGW Y;  2GZW A;  2IGK A;  1R5G A;  3LST A;  3DEW A;  3H36 A;  5LGN A;  4S04 A;  2BY3 A;  2X1C A;  3H0D A;  3I4N J;  1W0U A;  3OWT A;  4S05 A;  2FQ3 A;  2GAU A;  3K70 C;  3HUG A;  3V7S A;  4F7Z A;  1TP4 A;  2F4I A;  1EF4 A;  3I9V 2;  2VJ4 A;  4IQ4 A;  4HV5 A;  4DZP A;  4WX9 A;  2DI3 A;  1FBQ A;  2PEX A;  2HOS A;  4U7D A;  2DXI A;  1V3F A;  2Y0S N;  3CO6 C;  4ESF A;  4B1R A;  1JUP A;  2M2E A;  4QLC U;  2LK2 A;  4G6D A;  3RKW A;  4YFN F;  2DQL A;  3ZQI A;  2HVQ A;  4D0P A;  1K78 B;  3IP4 B;  1LJ9 A;  3PIO F;  3CLQ A;  3L09 A;  3UKG A;  2W24 A;  1HW5 A;  3PFI A;  5B1B H;  2CJJ A;  2R7F A;  3DKW A;  1E17 A;  3OL3 A;  3P9I A;  4HBL A;  2DA4 A;  2EZL A;  2PFB A;  1HDP A;  3HRU A;  3KZI C;  3H5R A;  3F8N A;  3PSI A;  2R7D A;  4HNT A;  3L2C A;  3D5S C;  4CYD A;  5KCM A;  2VBW A;  1XN7 A;  2QEX I;  4KIT B;  1KYW A;  5FKK A;  4BKX A;  3ELK A;  5FD6 A;  4I01 A;  4IZZ A;  3FBI B;  1LVA A;  4IRG A;  3PQK A;  5DDG A;  2Z5U A;  1DGR M;  1XC5 A;  3HSR A;  1VQ4 I;  1IJW C;  1LQ1 A;  4YG2 F;  2BEO A;  5E8G A;  4IHV A;  4OIQ F;  1FYL A;  2VXZ A;  4R8H A;  4V19 K;  1BOB A;  2G0E A;  1Y56 A;  1RI7 A;  3FF5 A;  2PLY A;  3FX3 A;  2CSO A;  2ELJ A;  5K7H A;  3SFI A;  2QM3 A;  1WJE A;  1MNM C;  3IHU A;  3SZG A;  1TT5 B;  3G6E I;  2NS0 A;  1LE8 A;  3OR2 C;  4PJM A;  1E3O C;  3PNT A;  2K02 A;  5DTD A;  1ZRC A;  2G7H A;  5ICE A;  4V2F A;  3HOS A;  2A5W A;  1YOV B;  2BHZ A;  1G59 A;  4ZDL A;  3RYP A;  1OCO H;  2HU9 A;  5HLH A;  5LLQ A;  5LGU A;  1QVU A;  2BGC A;  3TGN A;  4FCY A;  5K1Y A;  4A3I J;  2MAB A;  4BHB A;  3P7N A;  1W5S A;  2KRF A;  4II3 A;  4E7K A;  3WE3 A;  4MTD A;  1S3J A;  2BZT A;  2R7X A;  3E6D A;  1MH4 A;  2JSP A;  2VN2 A;  1BR2 A;  1FP2 A;  2DT6 A;  3FBN B;  3MVP A;  3CLO A;  4XKW A;  3ZMD A;  4E7S A;  2E1M C;  2VE9 A;  1OYI A;  4ZTF A;  4B4C A;  1VI0 A;  1XTA A;  2P7C B;  1S7O A;  3DXJ F;  4EJU A;  5D5U B;  3PNV A;  3OYI A;  4KT5 C;  2K9M A;  4ON0 A;  4WXH A;  3K9T A;  3BG9 A;  3RZD J;  2GA2 A;  1XMK A;  2V1N A;  4EJV A;  4BHP A;  4II2 A;  2E5Z A;  1IC8 A;  3MMY B;  2MD0 A;  3F3X A;  4HF0 A;  1S9H A;  1IRX A;  4I99 C;  2LD5 A;  1H89 C;  1HCR A;  5FB2 A;  2X6X A;  5DEQ A;  1Y1V J;  1SEU A;  1FTZ A;  2R4G A;  2XF6 A;  1YX5 A;  1I3A A;  2XAH A;  2M4K A;  3K6G A;  3I4M J;  1G4D A;  1OYW A;  5LBQ A;  3MKZ A;  1FMV A;  1Z1D A;  3GO5 A;  1MDM A;  1A6I A;  2WBM A;  2XF5 A;  3ZQC A;  1ZR2 A;  2HVR A;  3ROU A;  5IYD J;  1KQ8 A;  2ZC2 A;  4IHY A;  3DKX A;  3A4C A;  2W48 A;  3M3Y J;  1H9T A;  2WAD A;  4Q48 A;  5GTH C;  3CTA A;  2KIF A;  3ZR8 X;  1JI8 A;  4KIG A;  3DTK A;  2MFZ A;  1T6S A;  2CS3 A;  1ZYR F;  4OIR F;  3I55 I;  4EJT A;  3CF2 A;  4L5I A;  1FOX A;  5K5Q A;  4JX5 A;  4AIJ A;  1ZR4 A;  3CDL A;  3S3N A;  3LA2 A;  2W00 A;  2IXS A;  3S3O A;  3ABK H;  4KDP A;  4Y3O A;  2XAQ A;  1L3L A;  3K69 A;  3BR2 A;  3DKY A;  5FJ8 J;  4E7J A;  5DUI A;  4B43 A;  3KEY A;  4N9H A;  3TDU C;  2DYS H;  4XSZ F;  2DOF A;  1MNE A;  2V1D A;  3HPG A;  3FMR A;  1BI0 A;  2X1D A;  4I02 A;  4LG0 A;  1JKR C;  4CXF A;  1BIA A;  2ZKZ A;  3EUH C;  3C1D A;  3WTZ A;  4A69 C;  3AG2 H;  5A2Q K;  1WFX A;  5F1R A;  2NOJ B;  2W25 A;  4MO7 A;  4A0X A;  5IP7 J;  3LQR A;  2DA1 A;  5CVV A;  4BJ5 C;  3L1P A;  4L5E A;  2CWE A;  1OJL A;  3MWM A;  5A2Q Z;  3JW4 A;  3M7G A;  1DU0 A;  2K27 A;  3K1P A;  2Z33 A;  1QHH D;  3ZN0 A;  4HDU A;  1MDM B;  1JJ8 C;  2C6Y A;  1WKM A;  2OF7 A;  4L0Y B;  2LMD A;  1OIS A;  2CO5 A;  2IVM A;  4IEJ A;  1W4M A;  2OU2 A;  2EFQ A;  2Y9Y A;  4IL6 C;  1VND A;  5IYC J;  3K4K A;  3QPS A;  2LNB A;  5F6F A;  5FRO A;  3E6B A;  1X4O A;  1MMA A;  2KPM A;  1EH8 A;  1I39 A;  4A3J J;  2ELK A;  1KU2 A;  1TWH J;  2AXT C;  2F2E A;  2FU4 A;  2IRF G;  3OYJ A;  3I53 A;  4Y7N J;  4AIK A;  2M7B A;  2EV0 A;  2FRH A;  4M74 A;  1L0O C;  3ABU A;  3GUD A;  1WRJ A;  2BY1 A;  1NTC A;  5GAD J;  1FP1 D;  4C3H J;  5CYV A;  2NNY A;  4BEH B;  4Y17 A;  3EDP A;  2Z1D A;  2R7Q A;  4LOC A;  1BM9 A;  5HNF A;  3CCR I;  2EPF A;  2E5N A;  2QKM B;  2KRH A;  4CCM A;  3CMM A;  1YW8 A;  5D5X B;  4RB1 A;  3FXJ A;  1FEX A;  1MBG A;  2A68 F;  1IN7 A;  2DTZ A;  3ZXS A;  4KNY A;  1RR7 A;  5F0H A;  2HQR A;  1I1G A;  1X3U A;  1YHQ I;  5K5O A;  1S72 I;  4LLG F;  3CC4 I;  1G6N A;  2KRC A;  3ONQ A;  1HW1 A;  1KA8 A;  5F1J A;  3BC8 A;  5GAH J;  3JRC A;  2FD5 A;  3V42 A;  5C4J J;  3I0T A;  3F8F A;  4HZF A;  2KJB A;  2CQ7 A;  4ENN A;  4PGG A;  1S5L C;  4RA2 A;  2IPQ X;  3G73 A;  3KP2 A;  2X85 A;  2W82 A;  5CQE A;  4HV6 A;  5GAG J;  2QKL B;  5JVT A;  1LDK B;  3F23 A;  3OSF A;  1PP7 U;  1HLV A;  1JT0 A;  3GTK J;  3K4J A;  4YII A;  1WHU A;  4MEY F;  3F21 A;  4A3K J;  4MNU A;  4DQ2 A;  4XON A;  2L5Q A;  2RV8 A;  1A5J A;  3GWZ A;  5EEH A;  2UZK A;  4RLF A;  2IAI A;  2HVS A;  1DP3 A;  2R7Z J;  3KP6 A;  1VQK I;  2L7M P;  1TZL A;  3A02 A;  1MD0 A;  2DOD A;  3ZQ7 A;  4S0H B;  2FNA A;  5HS8 A;  1X2M A;  3F8C A;  2P5K A;  1JGG A;  1BBY A;  2DMU A;  3GEZ A;  2EQR A;  1RNL A;  3W2A A;  3JRI A;  2A6T A;  2Y31 A;  3C2B A;  3MFK A;  2DAO A;  4LLN A;  1ETV A;  4L0Z B;  1UAA A;  4M9S A;  1JT6 A;  1OKR A;  1XSV A;  3VYR B;  2PG4 A;  1POG A;  3ISP A;  3IH4 A;  3WTV C;  2Z3Y A;  3FXM A;  4UNO A;  5CLS A;  1UCR A;  1T38 A;  4U7B A;  3IH2 A;  4MIM A;  3CCU I;  1F9N A;  2QWW A;  3FMQ A;  4U88 A;  4FX4 A;  6PAX A;  1USS A;  1XPX A;  1EA3 A;  1UEL B;  4ZYG A;  3P5J A;  4NNJ A;  2EA4 A;  1P6R A;  1SFX A;  1SMY F;  3C18 A;  3SEZ A;  4CCL A;  5BOX A;  1PJR A;  3QP5 A;  2CG4 A;  4ABZ A;  3DBR B;  4ZH4 F;  2K9L A;  3QOP A;  1T95 A;  3FM3 A;  4Y52 J;  1IDZ A;  3UNG C;  1YI2 I;  2VKD A;  3ECO A;  3OYK A;  3HRM A;  3AAF A;  4R1H A;  3ZCO A;  1I1S A;  1LB2 A;  1U9N A;  1F5T A;  4K2E A;  1D5V A;  2DW4 A;  1J0R A;  1SC7 A;  5B66 C;  3GF2 A;  2EIL H;  4XRF A;  4BQO A;  2OZU A;  4KJZ A;  2PMU A;  4IJA A;  2VPL A;  1ZK8 A;  4IO9 F;  3TMO A;  2X4H A;  3Q0W A;  4W1U A;  2BOL A;  1A31 A;  3WTX C;  4KN4 X;  3E7L A;  3LAJ A;  2V79 A;  4IOC F;  2RNG A;  1YG2 A;  3F0C A;  2VC0 A;  1ZKG A;  4I6Z A;  2ECC A;  2X6Y A;  2QLZ A;  1JUS A;  2EV6 A;  2K9Q A;  3WTU C;  2R0Q C;  2OQR A;  1ETQ A;  2F4O B;  5EYR A;  1HOM A;  1NG7 A;  5E20 A;  4R79 A;  5J1Y A;  2XDV A;  4G7Z F;  4ZTJ A;  1R36 A;  4KFC A;  2XV4 S;  1R9T J;  2JA7 J;  3HOU J;  1S8N A;  4GGG A;  1LFU P;  1D8K A;  2I8D A;  2MH2 A;  5FLM J;  2K40 A;  1KU9 A;  2E36 A;  3G2B A;  4IRI A;  4BAY A;  4L5J A;  2I5U A;  2WV0 A;  4BHC A;  2F4M B;  2DT5 A;  4OMY A;  5E3M A;  1K6O A;  3BPV A;  1HKT A;  4JYK A;  2O0Y A;  2GIV A;  3IWZ A;  1SFO J;  5EZG A;  3RCO A;  3HHH A;  4XK4 A;  2O8X A;  2XGE A;  1Y8Q B;  3W2V A;  4RBO A;  2XVC A;  2A3S A;  1S7A A;  1RUN A;  1HSJ A;  2H1K A;  1MGT A;  2O7O A;  5EGO B;  1ACI A;  2UWM A;  3KZY A;  3EQL F;  1GV2 A;  3HIF A;  2FSW A;  3AL0 B;  2CFO A;  4HQE A;  5DCM B;  1UHW A;  1XCV A;  4OOI A;  3GLX A;  3JAM Z;  2ZME A;  4XLF A;  2WAF A;  3ULQ B;  1BJZ A;  1SFK A;  5E1X A;  2ZO4 A;  2MC4 A;  3WU2 C;  3HOZ J;  2QSG X;  4KT6 A;  2P5L C;  1Z0X A;  2ESN A;  3O8G A;  4OAY A;  2E71 A;  3T1B A;  4N0B A;  5K5R A;  3A01 B;  1YX3 A;  3CME I;  1LNW A;  3I4P A;  2XRN A;  5D5W B;  4A3L J;  2XRO A;  2QYO A;  2QUF A;  3MKL A;  3DBH B;  2AS5 F;  3O2P E;  4CYC A;  2M45 A;  2IGO A;  5JI6 A;  5C44 J;  1P7I A;  3AG1 H;  4DZJ A;  3L7W A;  2EB7 A;  3HM5 A;  2NVQ J;  2DFF A;  1K6Y A;  2G9W A;  4ZYD A;  4B3A A;  2A6H F;  4GYG A;  4HG2 A;  3FHN A;  5L3E A;  2VKE A;  4IXA A;  2DA6 A;  3DF8 A;  1WCM J;  3ZOB A;  1FSH A;  1AA7 A;  3ZPL A;  5LHH A;  2ZME C;  1YS6 A;  3Q0U A;  5E1Z B;  3C2H A;  4NC6 A;  1DPU A;  1J2X A;  2DA2 A;  4Y15 A;  2QQ8 A;  4QSH A;  3JRF A;  2HDD A;  3S2D J;  4HEA 2;  2N8G A;  2R5Y B;  1WVR A;  1NK2 P;  2JN6 A;  3WU0 A;  4C2T A;  3GTL J;  2QCO A;  2P8T A;  2CV2 A;  5D4S A;  1YRN A;  2LTP A;  1ZLJ A;  4XIC A;  3HDD A;  2VT2 A;  4RAG A;  3LMM A;  2FEZ A;  1GV5 A;  1XDU A;  5B5E C;  3JTG A;  2NXN B;  2XAG A;  4OMZ A;  2H09 A;  3S1M J;  5IOY A;  2D5V A;  1STZ A;  2E34 A;  4MGR A;  2STT A;  3V4G A;  1MSE C;  3WTS C;  4F93 B;  3PQJ A;  3K70 D;  5HDK A;  3OS0 A;  2LRD A;  1OPC A;  1QGP A;  4FQG A;  3CQZ J;  4UHT A;  2BVL A;  4C2M J;  1G3Y A;  3V7C A;  1Y0N A;  5H6Q A;  3BR3 A;  4CCO A;  4A3F J;  1BI1 A;  3LSR A;  3GZ5 A;  2X48 A;  4P1W A;  1LKX A;  1X1B A;  2L9S A;  3WG7 H;  3IV5 A;  2OQG A;  1G3W A;  1PVE A;  5HNH A;  2Y48 A;  5JHF A;  2YS9 A;  1Y39 A;  5GPA A;  2QGU A;  3RPU D;  2FBH A;  1B9N A;  4X0G A;  5EG0 B;  3O3K A;  1FIA A;  1WPK A;  3H9G A;  1HC8 A;  4IPA A;  2CW0 F;  3L2V A;  2CUF A;  2QF7 A;  2LR8 A;  2RNJ A;  3TQN A;  3KE2 A;  4XOR A;  3GZ6 A;  3CP8 A;  2L3D A;  3DV8 A;  2GQQ A;  2EWN A;  3J7A O;  4BS9 A;  2VQG A;  3HRS A;  4BBS J;  2R7U A;  3H3V K;  5E17 F;  4HNV A;  5EZH A;  2J5P A;  1A04 A;  1P9Q C;  4XLC A;  4IOA F;  2JK3 A;  3ZQF A;  4B8X A;  2W4S A;  5BMZ A;  1FY7 A;  3SEQ A;  1U2W A;  4NDL A;  3VDX A;  2KIU A;  3I71 A;  4AVZ A;  3GTJ J;  2ID6 A;  5FFX A;  4XNF A;  3IUO A;  4YFK F;  1QPI A;  1K78 A;  2AHQ A;  2Q1Z B;  5H2F C;  2YPR A;  5E3O A;  1AWC A;  4XMY A;  2M1B A;  4XLE A;  3PNY A;  3HOT A;  2MLG A;  5EEA A;  3DFG A;  2E7X A;  2EFO A;  2FE3 A;  4LK0 F;  3LAP A;  2KZG A;  1ZH5 A;  3F6V A;  2MLK A;  2DA5 A;  1YO5 C;  1IN5 A;  4ZZL A;  2XGD A;  3LSK A;  1QO0 D;  5HOD A;  3G1L A;  3M8J A;  4DYC A;  2D1H A;  4EJW A;  4P96 A;  1R00 A;  4XLP F;  3S32 A;  3BG5 A;  4G7O F;  1Z7L A;  3G1M A;  3E0J B;  4IF4 A;  4I09 A;  4RM2 A;  4HQM A;  4LB6 B;  2DFI A;  1SVL A;  1Z67 A;  2CH0 A;  2QQ9 A;  2YSR A;  2L54 A;  5L3B A;  4L9V A;  5BQT A;  2VBX A;  1YW7 A;  3BG3 A;  2VQH A;  3M1C A;  1J5Y A;  2ZJQ F;  3PL8 A;  3CZ6 A;  1KGS A;  5J1U A;  1ENH A;  4AUX A;  3PIP F;  1MZB A;  1Z21 A;  5FLX Z;  1XSX A;  3TO7 A;  3DBL B;  4CCJ A;  4XRS G;  5J8C A;  1FBU A;  4AWX B;  2QBY A;  2VKH A;  3KYL A;  3BG7 A;  3BZC A;  3H3U A;  4GYI A;  3PFY A;  4M73 A;  4PZJ A;  3JSO A;  3MZH A;  4IHW A;  2KIM A;  3RIR A;  5CVR A;  1TBX A;  2MH9 A;  3OYA A;  2KZV A;  1P4X A;  2V7F A;  4BBR J;  2LYC A;  4IRH A;  3S2W A;  1R4N B;  3ZQH A;  1HW2 A;  1QBJ A;  3GTM J;  5AIQ A;  2DA7 A;  2FOK A;  1D0Z A;  1XMA A;  4F92 B;  1TL8 A;  1B9M A;  2O9L A;  1ETW A;  4EQQ A;  3ECH A;  1Z6R A;  2H94 A;  2XPU A;  4WWC A;  2RC4 A;  3FKJ A;  1JKP C;  3KLN A;  3DP7 A;  4LB5 A;  4HPQ A;  4FTH A;  3V8J A;  3DEE A;  1ETO A;  4I98 B;  4FET A;  1V5G A;  3GME A;  4CDG A;  1W0T A;  2FX0 A;  4XM3 A;  4KMU X;  3VOE A;  3HOX J;  2D45 A;  1SFE A;  2NYX A;  3K7A J;  3OYB A;  1I5Z A;  1P92 A;  3OYL A;  1YJW I;  1UFM A;  2XPW A;  4C3J J;  1HF0 A;  2O8K A;  2MBF A;  3GVA A;  5JVG F;  5ILV A;  1FJL A;  3B6C A;  1BW6 A;  2NVX J;  2OTJ I;  3ASN H;  4RGU A;  3GFL A;  2PMH A;  2ECB A;  2PJP A;  3J80 Z;  3KIO A;  3BTI A;  4GXO A;  1X1D A;  3BQY A;  3CO7 C;  4BXF A;  2QBY B;  2WV1 A;  5CVU A;  3VWB A;  3H5N A;  1W36 C;  3L2W A;  2BXY A;  1CGP A;  1DU6 A;  4HLX A;  3EYI A;  1SVO A;  2XSJ C;  3H9J A;  5CKT A;  3ZN1 A;  3DTI A;  3V8K A;  3GLL A;  4A12 A;  2FBI A;  3OL4 A;  4AIH A;  5B3S H;  1IZ1 A;  5J8F A;  3RDI A;  2WY7 Q;  2QQB A;  4A3E J;  1SD4 A;  2JTV A;  3MEX A;  3G71 I;  4HF1 A;  2ZXH A;  1SAN A;  1J7K A;  3H1C A;  4OIN F;  4G8X A;  2PN6 A;  2M5W A;  2Q2E A;  4U87 A;  4BE1 A;  4CA0 A;  4BJ6 C;  4AVP A;  4C9Y A;  1PUF B;  1B72 B;  9ANT A;  4UV9 A;  4ZDO A;  3QU3 A;  5TJJ A;  2FJ1 A;  2RDP A;  4HST A;  4BY7 J;  2ZXI A;  3I59 B;  4MFE A;  2R7R A;  3BG6 A;  3OOP A;  1Z05 A;  4X1E A;  4KA4 A;  1EH6 A;  1SD7 A;  4B09 A;  2PJR B;  2KDZ A;  1ZQ3 P;  1K7A A;  1QVT A;  1OLT A;  1IO2 A;  3R0A A;  1VQN I;  1G8X A;  4RGX A;  5TIS C;  2PI0 A;  1W5T A;  2LSO A;  5E3L A;  1U6G A;  4A2U A;  1E3H A;  2VXD A;  3HBL A;  4KIF A;  4ZC3 A;  2F5F A;  4E7Z A;  3J81 Z;  1FOY A;  2IS4 A;  2VT3 A;  3NQO A;  2DFH A;  3DPL C;  4XRS A;  3RYR A;  4IHT A;  3E5U A;  2JVG A;  2ICW G;  3IL2 A;  3COA C;  2YU9 J;  3LSP A;  2XRL A;  1QA6 A;  2XC7 A;  1IV8 A;  2GWR A;  2IW5 A;  3SQN A;  4A3G J;  1IRZ A;  4IHX A;  5D5V B;  4HOB A;  3I64 A;  3ERE D;  3BTJ A;  2XB0 X;  5F27 A;  4HF2 A;  4EV0 A;  4CCN A;  2XAF A;  4BEH A;  1IN4 A;  4UUT A;  2EIK H;  3FXR A;  2ISY A;  4E6K G;  2H6C A;  3CP2 A;  4DBR A;  3TBI A;  3NWS A;  1R23 A;  2Q2E B;  4Y13 A;  4BQQ A;  5EJC A;  1TC3 C;  2DMP A;  3F72 A;  4LGW A;  1JKQ C;  1FIP A;  1QQI A;  4HX8 A;  4EM0 B;  1R49 A;  1XX5 A;  2EJR A;  2R7T A;  2QSH X;  5ERI A;  4BQA A;  1CQT A;  2NS7 A;  2WB1 N;  3FIS A;  2DA3 A;  2DK5 A;  2MD5 A;  1NG6 A;  2MGQ A;  2K5C A;  5FKM A;  3R0J A;  4EEF G;  5ICF A;  1ZTR A;  1GT0 C;  1HQC A;  2K9N A;  1WSU A;  1APL C;  1ON2 A;  2GA1 A;  3BJO A;  1MJ9 A;  2JUG A;  4DNC A;  3ABL H;  5ICG A;  1XCB A;  1BC8 C;  3KP4 A;  4LFU A;  3BTC A;  2PMZ N;  3CC2 I;  2LP0 A;  1TTY A;  3H35 A;  1W7P D;  2VI6 A;  3VYU B;  2P81 A;  4LJZ F;  5CPR B;  4UB8 C;  2YUS A;  3ZP5 A;  4HYE A;  4OAZ A;  3ESW B;  4I7H A;  5E79 C;  3ML6 A;  2G7U A;  1WJ5 A;  3BPX A;  5DS9 A;  3KP5 A;  3KFW X;  3HG9 A;  2BXZ A;  2WY8 Q;  2R7S A;  3MQ0 A;  1QZZ A;  2O6G E;  5GTI C;  2BBY A;  2ZJP F;  1HA8 A;  4MLO A;  3HL2 A;  1FYK A;  3LOC A;  3CCY A;  4UVA A;  3AKZ A;  3RJP A;  3KX2 A;  4XN3 A;  3DQV C;  3DLA A;  4LIT A;  2GM4 A;  5LFA A;  4ESJ A;  4GCV A;  1O3T A;  1R1T A;  1UZC A;  1XGS A;  2ZNY A;  3T8T A;  1SFU A;  2B63 J;  2STW A;  2KDO A;  5C4X J;  2CQN A;  3BJ6 A;  1U5T B;  1AKH B;  2DYR H;  2IT0 A;  3MN2 A;  2VQL A;  3AG4 H;  2LBF B;  4C2U A;  4ZZD A;  4RAZ A;  2DK8 A;  2VL8 A;  5JLW A;  3CCL I;  3MZ8 A;  2HS5 A;  3K1M A;  1WWX A;  1RET A;  4HW0 A;  4FE7 A;  2KHM A;  5F0F A;  3OY9 A;  1TT0 A;  1PP8 F;  1T2K A;  3I54 A;  1T08 B;  2VJ5 A;  1YJN I;  3GTP J;  5D6E A;  3DLL F;  3K2Z A;  5CJ9 A;  3OIP A;  1FOW A;  3GW2 A;  4B44 A;  1R4M B;  3IC7 A;  1KU7 A;  3WG9 A;  3IKV A;  4QWQ A;  4RAF A;  2IA1 A;  3JSP A;  3LSI A;  3OMY A;  3R61 A;  4ZYH A;  1WJD A;  1TQI A;  3EYY A;  3A03 A;  2OBP A;  5J4Y A;  1P4A A;  5K7F A;  2K3P A;  2K7L A;  2VIX A;  2O03 A;  3S15 J;  1UG0 A;  2MC3 A;  3T5X A;  1JXS A;  5GPC A;  1BIB A;  2E2H J;  2HI3 A;  2AQF A;  4H0E A;  2ELH A;  2FBK A;  1UHS A;  3GCM A;  1I27 A;  4N4N B;  3TP0 A;  5IY5 H;  3HGY A;  4U0W A;  2DOA A;  4A3B J;  2HZT A;  1XGO A;  3V7R A;  3Q5F A;  3GBG A;  2X1E A;  3MAJ A;  5E3N A;  2BW3 B;  5HS9 A;  4WK8 F;  5EGO A;  2VAS A;  2M0C A;  2M0M A;  3T8R A;  5HLG A;  2K4J A;  1MBK A;  1RUO A;  1YE9 A;  1D5Y A;  4M6X A;  5DCM A;  1K79 A;  1QRY A;  1ZRE A;  2CYY A;  4CZZ A;  1MJB A;  1T56 A;  5IPA A;  3OR1 C;  1M1E B;  2XUB A;  4LIV A;  2Y2Z A;  2IP2 A;  2Y69 H;  2VLA A;  4BNC A;  1ZG5 A;  1ETX A;  5KHD A;  5CQG A;  2W1O A;  1H0M A;  1B8I B;  4AM3 A;  5BPI A;  3F6O A;  3ZQG A;  3A01 A;  2V1U A;  2XKO A;  4XRM A;  4ZYA A;  2Z16 A;  4EM1 A;  2NRA C;  2CQX A;  2L01 A;  2HNH A;  2M4G A;  5B1A H;  3S16 J;  4G6Q A;  4F55 A;  1J75 A;  3ABM H;  1MMN A;  3CJT B;  3W6K B;  2IA0 A;  3Q0V A;  2HKO A;  1O3S A;  3FM5 A;  3K0L A;  1IN6 A;  1BL0 A;  4YIF A;  3KEQ A;  1OQY A;  1FYM A;  2CGP A;  4KIB A;  4I76 A;  3I56 I;  4LK1 F;  3S2H J;  3CJR B;  2R7V A;  2RAE A;  3ERM A;  3Q9S A;  3L9F A;  4PCQ A;  1JUM A;  1ZHF A;  1SMT A;  2L4A A;  4JOM A;  1OYY A;  1GXQ A;  4DJA A;  1RPW A;  2XGC A;  3FK7 A;  4E70 A;  5DM7 F;  1W1W E;  2CW7 A;  2R5Y A;  3HYI A;  2NVY J;  1YIO A;  2CU7 A;  2M8G X;  2A07 F;  4BQN A;  2VBZ A;  4CH7 A;  3JAM K;  3SYT A;  3U1K A;  3FK6 A;  1N78 A;  2EZI A;  4P5O A;  2DMN A;  3BCA A;  2FNP A;  2MA3 A;  3H9Q A;  3BCB A;  3M8E A;  1DQU A;  1E3P A;  4B48 A;  1VF9 A;  5DYM A;  5DUK A;  3O6B B;  2DBB A;  3HJE A;  3VPR A;  2K3F A;  3OV8 A;  3ZGK A;  1XS9 A;  4OIO F;  1YYV A;  5JHU A;  3K4N A;  2GIZ A;  3WU1 B;  2VOP A;  4JK1 X;  5AON A;  4UUS B;  1QZE A;  1BR4 A;  2DDA A;  2JT1 A;  4NB5 A;  1RRJ A;  2GXB A;  2HTJ A;  1GLN A;  5FO5 A;  2LDU A;  3RI4 A;  1HXD A;  2P5V A;  4F52 A;  1MH3 A;  1Z7U A;  1IUY A;  2TRT A;  4ASN A;  1IXS B;  1X4P A;  1LDD A;  1VFC A;  2HOA A;  2GOM A;  4ENK A;  4N9I A;  4RMN A;  3DWL E;  4HRI A;  3H92 A;  5EG0 A;  3B02 A;  2CUE A;  1GHC A;  4EGY A;  2IA2 A;  2ME6 A;  2WB1 A;  1ULY A;  3PM1 A;  4D7M A;  2JA6 J;  2AQE A;  5ILS A;  2FQ4 A;  2V9K A;  5DCF A;  3RKY A;  1QU3 A;  5HVQ C;  1F36 A;  4Z2Y A;  3WTW C;  2HPM A;  2EZH A;  3GFJ A;  2VE8 A;  1RR8 C;  1KQ9 A;  5M3M J;  1GUU A;  4MTE A;  1VQP I;  5LRR A;  2HOE A;  4DYR A;  3GTO J;  2PMZ A;  2HOT A;  3HTU A;  3D1N I;  1EH7 A;  2CUZ A;  3R60 A;  2CW8 A;  1U8R A;  2KT0 A;  3CUQ A;  4OWR B;  4UV8 A;  1MKM A;  2E7W A;  2V4J C;  3IRR A;  2ADU A;  3TOB A;  2LG4 A;  1OCP A;  2Y0M A;  4EVI A;  4A3C J;  2ZFU A;  3JRD A;  4J19 A;  3E6C C;  3GTG J;  3RKQ A;  3U1D A;  3E97 A;  1R5H A;  1Z91 A;  4PFP A;  4XKV A;  4NC7 A;  1V5F A;  1I50 J;  1MMD A;  3CC7 I;  3TO6 A;  2GXG A;  2RQQ A;  1P7J A;  4RAY A;  2L7K A;  5KVR A;  4ETS A;  1WH5 A;  3REO A;  3VSK A;  1U9O A;  3CF5 F;  1WGX A;  3E5X A;  1PDN C;  2V9V A;  3M1E A;  1V55 H;  3TW6 A;  1O4X A;  3KYC B;  3EUK L;  1B59 A;  1B6A A;  1U3E M;  4E4H A;  1A35 A;  2KP6 A;  1TWF J;  4LD5 A;  1T33 A;  5ICC A;  1IG7 A;  5AIP A;  4ITV A;  1LVK A;  2E1N A;  2F5E A;  2JWT A;  3TO9 A;  5EEG A;  4HLY A;  4Y33 A;  1YFH A;  2DMT A;  1XGN A;  2HXO A;  3DEU A;  3OYN A;  1YIT I;  2JRM A;  4D5C A;  5JR3 A;  2JA8 J;  2AXL A;  2GXA A;  5HOO A;  2L9R A;  1IRG A;  4P9F A;  4AID A;  3LQQ A;  4XR6 A;  2A69 F;  2HQN A;  4UXN A;  3QWL A;  2H8R A;  1UB9 A;  3E6M A;  1BN5 A;  2CFX A;  5FKN A;  2OJE D;  3SDG A;  4BE0 A;  2W84 A;  1ZEL A;  2JMW A;  2OC6 A;  4FT8 A;  2RKH A;  4RS8 A;  1TWG J;  4XLN F;  3CUQ B;  4BU2 A;  2LVS A;  3N4M A;  1SD5 A;  5E18 F;  3N05 A;  4M6Y A;  3RQ4 A;  4M72 A;  5DD4 A;  3BP8 A;  4A0Y A;  2L2O A;  4QPO A;  3ZMZ A;  2F48 A;  3CDH A;  4KIS A;  1BC7 C;  5L3C A;  2X6O A;  2EIN H;  1ZRF A;  4CO8 A;  4DBQ A;  3I58 A;  2F6C A;  5F04 A;  3TP3 A;  2VPR A;  4A0Z A;  1BW5 A;  2LY2 A;  1MBJ A;  2LFB A;  2A6E F;  3QOE A;  3HOV J;  1R7J A;  4BXU A;  3OYH A;  4ESB A;  3U2R A;  3D5L A;  2KIS A;  3U21 A;  3JRA A;  1W36 D;  3ZRG A;  1LFP A;  3DU5 A;  1JJ6 C;  2LF7 A;  4PSW A;  4HA8 A;  3K4C A;  2WAE A;  1T0F A;  1V54 H;  2B0L A;  3O8H A;  3QYB A;  5FD5 A;  4Q47 A;  5FKO A;  3A1Y A;  1AOY A;  4YEJ A;  1WJB A;  4O3M A;  2HQA A;  4C3I J;  3JRB A;  1IXC A;  3KLO A;  3QYE A;  5DD8 A;  4CGZ A;  5M5Y J;  2DT7 B;  2VUM J;  1T39 A;  3C7J A;  3WGG A;  1WJA A;  3BLY A;  4N4O B;  1QZY A;  4WXC A;  5FLX K;  4G94 A;  4XL9 A;  3RPU A;  4LIU A;  2OTL I;  2QQA A;  1B1B A;  1T98 A;  2M87 A;  2YU3 A;  3RQI A;  4UVC A;  1BA5 A;  3EUA A;  1JTY A;  1UHM A;  2NVU B;  4B3X A;  2H27 A;  3CD6 I;  1K83 J;  4QTR A;  2R7O A;  4PJ0 C;  4XLA A;  3DTE A; 
#chains in the Genus database with same CATH homology
 2B7E A;  2KIS A;  2DOF A;  2LKS A;  2E71 A;  2KIQ A;  2CQN A;  2KZG A;  4FQG A;  2JUC A;  2L9V A;  2K85 A;  2DOE A;  2DOD A;  1UZC A;  2KFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...