2A3SA

Solution structure and dynamics of dna-binding domain of myocyte nuclear factor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
101
structure length
101
Chain Sequence
ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Myocyte Nuclear Factor
publication title Solution structure and Dynamics of DNA-Binding Domain of Myocyte Nuclear Factor
rcsb
source organism Mus musculus
total genus 15
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2a3sA00
4HW0A 4G94A 1MGTA 2PEXA 3ZMTA 3GX4X 5F6FA 3F8FA 1D5VA 3T0YA 4KFCA 2Y0MA 1P4WA 4UVAA 2F2EA 4WXHA 1DDNA 4HZFA 3E97A 4R1HA 3E6BA 5E1XA 3KEOA 2VONA 1FWZA 3BP8A 3FM3A 5BQTA 1SD6A 1BM9A 4LG0A 3WG9A 1LDDA 4KN4X 3RJPA 4UNOA 2FMLA 4LK0F 1V4RA 2IJLA 4MEXF 2FF4A 2V79A 4AIKA 5L3CA 4L9TA 2V1XA 5DD4A 4LB6B 3LWFA 3HIFA 1ZLKA 1R7JA 2L02A 4EMSA 4A12A 3P7NA 4XSXF 3FF5A 3T8RA 2CYYA 2EFWA 3HOSA 1SFXA 2L4AA 5DCFA 4PCQA 4EM0B 1Z6TA 1QO0D 5DUIA 4LGWA 1I5ZA 2STWA 4LD5A 5KVRA 2XAGA 2LDUA 3TKYA 1KU3A 5LEKA 3E6DA 4RGXA 2QENA 2OAZA 4CZZA 1ON2A 2Q0OA 1G3TA 3KP6A 5K5OA 4LLNA 1EV7A 3ABTA 1HKSA 1ZG1A 1SMYF 1QGPA 4ZYGA 3CDHA 1O7FA 5CLSA 4BHPA 2MH9A 3IRQA 3RYPA 1FSEA 3E6MA 1U6GA 1S8NA 1O7LA 3I64A 4Y15A 2BEOA 2R7DA 2FQ3A 1PDNC 5AONA 2ELHA 1QQIA 2EV0A 1SAXA 5E17F 5DDGA 2V6CA 2JRTA 2GIVA 2EV6A 4S05A 1T0FA 5D4RA 3C3WA 3CLOA 2YPRA 1T2KA 3C7JA 2AS5F 3TO7A 4IRIA 4LJZF 1YQAA 2RN7A 4OMYA 3M1EA 2XAQA 4EM2A 3T5XA 4P9UA 2M5WA 1FYKA 2P7CB 2GXBA 3L09A 2JPCA 1J0RA 1Z6RA 4IVNA 5A2QK 3TO9A 5D6FA 5J8CA 1CGPA 3I54A 1Z7UA 3IKTA 3LQRA 4OIPF 1TQPA 3I59B 3IL2A 3K0LA 3ZMDA 1FC3A 4U7DA 4HYEA 4KUMA 3HHGA 4EJWA 4LLGF 2VT2A 3RPQA 3T8TA 2YX7A 4XBFA 5J6XA 4FX4A 3CUQC 3FHZA 4Q4ZF 5HS8A 3ABUA 1FP1D 3KP7A 4JQFA 3QPHA 5IT9Z 4KIFA 2RVCA 3M8FA 3DF8A 1ZG3A 3JSPA 3FXUA 4GGGA 4DQ2A 2Q2EA 2HQNA 4HF2A 2FMYA 2FNPA 4MGRA 1O3RA 3LSTA 2IT0A 3OV8A 2ESNA 1S29A 2VN2A 5AIPA 2O61A 4U88A 3N97A 2OZUA 1T38A 2G7HA 4ZH4F 5E18F 2P4WA 2Z9OA 1G3YA 3CUQB 3F8NA 4JK1X 1XCVA 3GFIA 2Z33A 3I4PA 3BJOA 3RPUA 2WTEA 2KRFA 4BHBA 2Z3YA 1TBXA 3WTZA 3WE2A 2IRFG 5L3DA 1GXPA 4GO1A 1FBSA 1LDKB 2KIFA 2JZYA 2KKOA 2P5LC 3WTYC 4JBAA 3MAJA 3JAMK 4A6EA 2K02A 3BROA 1RIOH 5LHGA 4PDKA 2CQKA 3KP2A 5LRSA 1YG2A 2KIMA 3JSOA 1XB4A 3I53A 2W25A 2O3FA 3P9KA 2XHKA 4PGGA 1KYWA 4LLLA 1WQ2A 2EFPA 3RKXA 1QPMA 3KZZA 3E3VA 1XDUA 2UXNA 1QBJA 3CUQA 4M74A 4UHTA 3HUGA 2STTA 4ON0A 3KP3A 2ZO4A 1OYIA 4UV8A 2GAUA 1LB2A 1L3LA 1G3WA 1IAWA 1GXQA 2EFQA 1BI1A 1GVJA 4ZYEA 5ILVA 5FFZA 1BI3A 1YYVA 4CICA 1SD5A 4ZZLA 2EFOA 6PAXA 3ROUA 2M1BA 3L7WA 1HW2A 1KQ0A 2M45A 2W24A 1HXDA 3GFLA 2P8TA 2MC3A 3GF2A 2K4BA 2QWWA 4I98B 5FFXA 2XKPA 3E5UA 3LFKA 2AXLA 3D0SA 3BPXA 3SQNA 3V7RA 4P96A 2F5CA 1YW8A 1R1UA 4I01A 2UXXA 1TQMA 2A6HF 2EFNA 5K1YA 3SHFA 4L0YB 3TOBA 4L5JA 1FT9A 4RB1A 4NHJA 1WRJA 1OYYA 5D8KB 3V7SA 3R0AA 2XAHA 3F3XA 4MNUA 1FLIA 3N4MA 2D45A 1TLHB 3B73A 3DEUA 3W6KB 1IN7A 4N9HA 5CJ9A 1L0OC 1AWCA 4OIOF 1C0WA 1BIBA 2OU2A 1IN5A 1BC7C 3KEQA 2XGXA 4HF0A 1SFUA 4ZZDA 1FZPB 1B9NA 4Q48A 1ZN2A 4BH9A 1P4AA 4KIGA 4IJAA 3LAJA 4H0EA 1Z1DA 5FB2A 1BC8C 2BV6A 3WE3A 3R60A 1JHHA 3DXJF 3CJNA 3TDZC 1XSVA 4I7HA 4CXFA 3GO5A 4M9SA 5E1WA 3NEUA 4LG0B 1Z91A 3JW4A 1J2XA 2A68F 5JVTA 1J59A 3CO6C 2QBYB 1YO5C 1O57A 4RAYA 3H3ZA 4I02A 1FY7A 1LVAA 4HX7A 3GXOA 2PQ8A 3SZPA 3BY6A 1XMAA 1F4KA 2XAFA 5J8FA 2Y75A 2IA0A 2PBIA 2FOKA 2ISZA 2A3SA 1T39A 5K5QA 3BPVA 1PUEE 1P92A 2DT5A 1HKQA 2GZWA 2A5YB 2QVOA 1ZRDA 1B4AA 4EJOA 1ZH5A 3J7AO 2CO5A 2WC2A 1EH8A 4CYDA 2VODA 4A0YA 2CWEA 1O3TA 1LEAA 4IF4A 1MDMB 2VOPA 4HX4A 4R8HA 5ICEA 5JFRA 2WV0A 4UVCA 4EVIA 2QBYA 1FBUA 1BBYA 3ZMSA 2X0LA 1IRGA 4AIHA 1W7PA 4A2UA 4HDUA 2FNAA 5F1RA 3R0JA 2NAZA 2IVMA 2K4JA 2JPBA 3L00A 1J75A 4M73A 5JR3A 4YIFA 2M8EA 2MLKA 2Y48A 4RB0A 1LNWA 4ESBA 1G4DA 3ZP5A 1KU9A 2GXGA 5IT9K 4P5OA 4GYGA 4AWXB 4L18B 2XUBA 3KFWX 2KIUA 5FD6A 3KP4A 5D6EA 3MQ0A 4U0WA 1XSDA 4KICA 1KU7A 2F5FA 1F1ZA 4CO8A 2EK5A 2G9WA 5FD5A 2D1HA 1F9NA 1MDMA 2VXZA 1S7OA 1MJBA 2YSRA 1YW7A 4A0XA 1TW3A 3KLOA 3O2PE 4LMYA 4QLCU 2HYFA 2IA2A 2V1DA 1BOAA 3DV8A 5CVUA 2W57A 4UXNA 1A04A 2ZNZA 4OOIA 1HBXG 4F7ZA 1KGSA 2DLLA 2K27A 2VBWA 3KCCA 3TGNA 5JI6A 1I6XA 5D8LB 1MJAA 2VBYA 4PZJA 1T98A 5FO5A 2BGCA 4KMFA 3I0TA 1R5HA 1KYZA 2HWVA 1IRFA 5D5VB 3ZMZA 3RIRA 1FBQA 3WGHA 2OZ6A 3R6SA 2DO7A 3FM5A 3EQLF 2RC4A 2DAOA 2Z5UA 2ISYA 3P9CA 3BWGA 4FHTA 3I58A 3BJ6A 5D5WB 2IPQX 3J81Z 1P2FA 5DYMA 5E8GA 1O3QA 1UHMA 1UHWA 3GVAA 4CHUA 2XV4S 2CW0F 1LJ9A 1P4XA 1IUYA 1Y0UA 2PN6A 3O3KA 3G73A 4M9XA 3HOTA 2DTRA 1YLFA 2NNYA 1YS7A 2A61A 4KMUX 4EQQA 1Z9CA 4O6JA 3COAC 4EGYA 5TJJA 4WWCA 4HF1A 2M30A 1YTYA 2OBPA 1H0MA 4G9YA 3FXQA 3HYIA 2HOEA 4BHCA 2HQRA 5BPDA 4XLPF 4ENNA 1HQCA 4KYWA 5HS9A 2XROA 2DFIA 3D5LA 2ETHA 2HFHA 3F8MA 3SFZA 3WTWC 4CGZA 1RNLA 4LFUA 2HKXA 4L0ZB 4MQ9F 4FX0A 1YW9A 3ULQB 3KETA 3C1DA 1ZG5A 1HW5A 3LA7A 4ENJA 3WGGA 4Z2YA 2FXAA 5HLGA 1MJ9A 4BNCA 3I71A 3RTRA 4WXCA 4EJVA 2L54A 2QYOA 3EYYA 4I0BA 3B02A 3SXYA 2QLZA 3WU0A 3ZMVA 3I5UA 5ILSA 2VBXA 1R58A 2CGPA 4N0BA 2V1UA 3T1BA 3QU3A 4Y13A 5LEJA 3HRTA 5LHIA 1R1VA 2UZKA 3GFMA 4NQWA 2VC1A 2HS5A 1FOKA 3GEZA 1R1TA 1BI0A 2RV8A 3BJAA 2M87A 3REOA 4MTEA 2VBZA 3HTSB 3QPTA 3U1DA 5DUKA 4U7BA 4KA4A 2UWMA 4KIBA 1T6SA 4YFNF 5EEHA 4YFXF 4P9FA 2YU3A 3W6JB 1B59A 2B0LA 2PFBA 2X4HA 3BZ6A 5AIQA 1XD7A 1IW7F 3JTGA 4N9IA 1KA8A 4ASNA 2HYGD 3RI4A 3IWFA 4HLXA 3HRMA 2V9VA 4OU0A 1S7AA 2PI0A 5BPIA 4PGHA 4BXUA 3KZYA 2DU9A 3MWMA 1IN8A 3ECHA 1TNSA 4A0ZA 3MZHA 3IKVA 5ED4A 2C6YA 3WTXC 1K78A 2FEZA 5IT3A 3LA3A 5LRRA 2ZMEB 3ZN0A 4WX9A 3J80Z 3U2RA 3K2ZA 2H27A 2D2WA 3MCZA 4HQEA 1ZRCA 1ONVA 2MLGA 1IN4A 2GA1A 4TV7A 4U0YA 2D1VA 2HTJA 1J7KA 2HGCA 2QQBA 1BN5A 1G6NA 2VT3A 2YR2A 1XGNA 4XRFA 3WTSC 3IHUA 2FBKA 2XASA 1E2XA 3GLXA 1K6OA 1XGSA 4O3MA 1XN7A 1U2WA 4I0AA 2ZFWA 4CDGA 2QUFA 1USSA 1WWXA 5FLXZ 2PMHA 1DP7P 3FMQA 2EA4A 4OINF 5LHHA 5LLQA 5HS7A 2XKOA 3ML6A 2RDPA 2F5EA 4GCVA 1UFMA 3K1PA 3ECOA 2KJCA 5JHUA 1S6LA 2MD5A 1J5YA 2ZMEA 4HAMA 2ZBKA 1YFHA 1LDJA 3GYHX 3IRRA 2Z99A 2H09A 4A5MA 3K1NA 4WF2A 5ICFA 1R5GA 5FGMA 1TW2A 5HVQC 1TNTA 2EJRA 1R00A 3DFGA 2K86A 3AAFA 4U0VA 1XSXA 4KN7X 2PG4A 1I1GA 4MQVA 4RB2C 5HDGA 2W84A 5CVVA 1JGSA 2O6GE 3QP5A 1SD7A 4P55A 1OKRA 4XSZF 4WK8F 4HLYA 5CVIA 5D4SA 4AD9A 1IZ1A 1TQIA 1XGOA 4HBLA 3FXRA 5H6RA 2GA2A 3IC7A 4KNYA 2P5KA 3TO6A 1XMKA 5CVJA 2Q8KA 5ICGA 2HZTA 2JSCA 3GUDA 4KT5C 1V3FA 3E6CC 3M7GA 4G7ZF 2HR3A 3EYIA 2BBYA 1RUNA 4O5VA 3CO7C 2DQRA 1BIAA 5E1ZB 4M71A 1FP2A 2P7VB 1W7PB 4RGUA 5L3EA 5LGTA 1VTNC 4HOBA 2EA2A 4MEYF 4I09A 2HDCA 3LA2A 1WI9A 1ZLJA 3QAHA 1Z05A 4RAZA 5TRDA 1D3YA 2L4MA 4EGZA 1JHFA 4LK1F 4G7HF 4LB5A 1QZYA 5LGUA 5DEQA 1OPCA 1XDSA 3NRVA 1WKMA 2CG4A 3J81K 1W7PD 2TDXA 3VEPA 2PLYA 4K2EA 3M8EA 5ERIA 3V7CA 1MKMA 3O6BB 2PMUA 1STZA 3V8JA 3GZ5A 2WWYA 3LQQA 2H6CA 3DPTA 3QP6A 5ICCA 3G3ZA 3SZTA 4YG2F 1JXSA 2RQPA 4ZYHA 1ZREA 4EJTA 5H6QA 2OA4A 4HDVA 4HV5A 3RDIA 1ZYRF 4G8XA 3M9AA 1KU2A 1I27A 3HSEA 4ESFA 3HHHA 2L3DA 1UB9A 1RI7A 1HSJA 1ZARA 3E5XA 3RKYA 1K79A 3K9TA 3WTVC 1CF7B 1DUXC 1JE8A 1F5TA 4HX8A 1REPC 1FYLA 2RGVA 1ON1A 2BE5F 1ULYA 2NS0A 3EDPA 3ZN1A 4EV0A 2J5OA 1SMTA 2W85A 1B9MA 5LGNA 3V8LA 3R4KA 4L5IA 4UV9A 5L3BA 4ESJA 5BS6A 4NB5A 3FMSA 4OMZA 1S3JA 1UCRA 4HV6A 2FU4A 1PP8F 3BOQA 4FT8A 2IP2A 1YS6A 2LKPA 1USTA 4EJUA 2DBBA 4IHTA 4UUVA 1D8JA 3HRUA 1ZGJA 2JTVA 2ZXJA 5D5XB 5E20A 2MBFA 1YIOA 2HKOA 1B6AA 4RGSA 2XRNA 1ZGAA 3F72A 3QU6A 1W5SA 3QOPA 3R61A 4IHSA 4Q47A 1H9GA 3CTAA 1K7AA 2G7UA 1CF7A 4G7OF 2MH2A 3JTHA 3GWZA 1MD0A 4BAYA 1P6RA 1XGMA 2ZKZA 3MZYA 3U9GA 5E8IA 2LSOA 4A5NA 2ZJ2A 2ACJA 1IXRC 1ZAOA 3DP7A 2YX4A 3HRSA 5EEGA 3WU1B 3K1MA 2EB7A 4L9JA 3PQKA 2O8XA 4HQMA 1ZRFA 2R3SA 4XLNF 1AOYA 3WTTC 2ZCWA 3V8KA 1RUOA 2VE8A 3QRFF 1HW1A 2QQ9A 4G6QA 1OYWA 3J80K 3RYRA 2DW4A 1R22A 4B8XA 5BOXA 4R79A 1TTYA 2XIGA 3EUHA 4BQAA 2FA5A 2DPUA 2R7FA 3DQVC 2K7LA 2HEOA 2NNNA 4G6DA 2O0YA 4IXAA 1XCBA 4ENMA 2J5PA 4L9VA 2GQQA 3VODA 1EH7A 1KQ9A 1G3SA 1W4MA 2DI3A 2VC0A 5BMZA 4OIQF 1R36A 5ILUA 1U5TC 3PFIA 1H9TA 2NYXA 3S2WA 4A6DA 4ZYDA 2DPDA 5CVRA 2OD5A 1IF1A 5FLXK 3HSFA 5F64A 3I59A 3GZ6A 3Q5FA 1X3UA 4M72A 5DD8A 1OR7A 1K78B 2ESHA 3ELKA 4EM1A 3HSRA 1ZHFA 1BI2A 1FPQA 2JT1A 3F8CA 4HA8A 3V4GA 2FE3A 3TDUC 4BYYA 1E17A 1I1SA 2FSWA 5L3GA 2E7WA 3ERED 4RB3C 1LEBA 2RNJA 2LNBA 3P9IA 1PP7U 1FSHA 1KQ8A 1U5TB 2LF7A 3WTUC 2E7XA 5A2QZ 4DNCA 3WODF 1IN6A 4IPAA 2L01A 3KP5A 2COMA 2DK5A 4WCGA 2LF8A 3FWEA 1QNTA 3TQNA 3F6OA 1D8KA 5LBQA 2IA1A 4M6YA 3IWZA 5HDKA 3K69A 4IRHA 2CSOA 3MFKA 2CFXA 3NQOA 1R23A 3L2CA 3ISPA 2NRAC 2PJPA 3FMRA 2A6EF 3F6VA 2EV5A 3L9FA 2FBIA 3GW2A 2O03A 4S04A 2XVCA 1FYMA 2HTSA 4Q5SF 4B09A 1SD4A 4GYIA 1ODDA 4GXOA 4M6XA 4OIRF 2BYVE 3RKWA 4KDPA 1U5TA 1HSTA 2XAJA 3LAPA 4RS8A 2E1CA 3ZMUA 1Q1HA 3KLNA 1DPRA 3F23A 3BDDA 5CYVA 4YFKF 3OOPA 3VFZA 4L9NA 2RKHA 1OMIA 3VB2A 1U3EM 1SFEA 4Y17A 1J9IA 5K5RA 2H94A 1DPUA 4I2OA 3FZVA 5HDNA 2QQAA 1B1BA 2QZ8A 4D0PA 2KJBA 1NHAA 2FBHA 1EH6A 3E5QA 1IXSB 2DQLA 3H3UA 2QM3A 2E1NA 1HKTA 4UVBA 1LQ1A 3VOEA 3FX3A 2P6TA 3DPLC 2OQGA 3JAMZ 1U8RA 2ADUA 2EWNA 4ETSA 1BJAA 1QZZA 2DK8A 4QWQA 4MTDA 3WGIA 5DCMB 3DKWA 4AVPA 3GFJA 2P5VA 4AIJA 3KE2A 3ZPLA 2MA3A 1W5TA 2A07F 4IRGA 2OQRA 2ZNYA 3EETA 4YIIA 2P6SA 3F8BA 3MEXA 1RZ4A 1MZBA 3ZQ7A 2VOOA 1IXCA 3F22A 3PQJA 5HLHA 4MHGA 4RGRA 5L3FA 1FX7A 3H92A 5KK1A 3F21A 3HTUA 5HOOA 2VE9A 3CUOA 5H20A 5HLIA 2GWRA 2IW5A 3Q9SA 4E70A 1O3SA 2H6BA 5D5UB 4ENKA 4WXDA 2FRHA 1WSUA 5DV5A 1U78A 3C18A 4M9ZA 1FNNA 2A69F 3Q9VA 5DCMA 3TOAA 2F5DA 1GHCA
chains in the Genus database with same CATH superfamily
2AO9A 2VQGA 4G94A 1MGTA 1LUJB 1D0XA 2PEXA 4HW0A 3ZMTA 3GX4X 2EZLA 5F6FA 3F8FA 3A02A 1D5VA 1JKPC 3BTIA 3T0YA 4KFCA 5GAGJ 2Y0MA 3PSIA 1P4WA 1EA3A 3OR2C 4UVAA 4A3KJ 2F2EA 4B48A 3JREA 1LE8A 2WB1A 1T0FC 1T33A 4BJ5C 5DS9A 4WXHA 4I6ZA 4ANJA 1DDNA 2NVQJ 4HZFA 3C2GA 2K9QA 2IS6A 3BC8A 5CPRB 1FJLA 2KDOA 3E97A 2IXSA 4R1HA 3E6BA 5E1XA 3JRIA 3OYNA 3KEOA 1LFBA 2VONA 1FWZA 2QKMB 3BP8A 3FM3A 5EF6A 5BQTA 2LFBA 5DM6F 1SD6A 1BM9A 4LG0A 2M9HA 3WG9A 2Z1DA 1LDDA 2R7SA 3K4NA 4KN4X 3RJPA 4JYKA 4UNOA 2FMLA 4LK0F 3HGYA 1JI8A 1R6RA 3H5NA 1BJZA 2O5RA 1V4RA 2IJLA 4MEXF 2FF4A 2V79A 4AIKA 1BA5A 2EINH 4CCKA 3TL4X 4E7JA 5L3CA 3BG9A 3OL4A 3CLQA 3G1OA 4L9TA 1KZHA 2V1XA 2HPMA 5DD4A 4LB6B 3LWFA 2X85A 3HIFA 1ZLKA 1SEUA 3RZDJ 2ZC2A 1R7JA 2L02A 4PUSA 4RM2A 4EMSA 4A12A 3P7NA 3NAUA 5J1RA 5KNLA 4XSXF 3FF5A 5EZHA 5GP9A 3TMOA 3A0BC 3T8RA 3CESA 2CYYA 1TWAJ 2EFWA 1FIPA 2VXDA 3HOSA 1SFXA 2L4AA 3HKZN 3KYLA 4IOCF 5KCMA 5DCFA 4PCQA 1NK2P 4EM0B 1Z6TA 1QO0D 4H4KC 5DUIA 4LGWA 1I5ZA 2STWA 4LD5A 1OQYA 1V5FA 3S1RJ 3D1NI 5KVRA 2XAGA 2BW3B 2LDUA 3TKYA 1KU3A 4HNTA 5LEKA 3E6DA 2Y0SA 3NARA 4RGXA 4JX4A 1YIJI 3ABKH 2QENA 2OAZA 2FX0A 4CZZA 1ON2A 4DYQA 4XOTA 1WVRA 2Q0OA 1G3TA 1TWFJ 1UG2A 1X4PA 3KP6A 5K5OA 4LLNA 1EV7A 3ABTA 5B1BH 1HKSA 1ZG1A 1SMYF 1QGPA 4ZYGA 4BBRJ 2RAEA 4MLOA 5TGTA 4E7HA 1QHGA 4AUXA 3CDHA 1O7FA 1Y6IA 2MG4A 2VL8A 5CLSA 4BHPA 2MD0A 2MH9A 1Y8QB 3IRQA 3RYPA 1FSEA 4B47A 4A3EJ 3E6MA 1U6GA 1IRXA 4GFBA 2JWTA 5IPAA 1S8NA 1O7LA 3I64A 4Y15A 1W36C 2BEOA 1YITI 2R7DA 5DTDA 3K2AA 4UUTA 2FQ3A 2ME6A 1PDNC 5AONA 3K6GA 4AYBN 1JTXA 1BR2A 2ELHA 1F36A 4DBQA 4IEJA 4B44A 5F0HA 3OYJA 4FCYA 3HOXJ 1QQIA 2EV0A 4D5CA 1SAXA 5E17F 5DDGA 3DBHB 2V6CA 2QQ8A 2JRTA 2GIVA 2Y30A 2EV6A 4S05A 1T0FA 3BR0A 1T08B 5D4RA 3C3WA 2QSFX 3CLOA 2YPRA 1T2KA 1U0JA 1MH4A 4MIMA 3C7JA 3CCEI 4ZTJA 3TO7A 1O4XA 2AS5F 4IRIA 2KPMA 2VQCA 4LJZF 3X2QH 2CS3A 5LFAA 4UUSB 1YQAA 2RN7A 1R4NB 3M1EA 4OMYA 2XAQA 2BY1A 4EM2A 3T5XA 5HLTA 1HCRA 5EZGA 2Q2EB 4P9UA 1VQLI 2KISA 2M5WA 1X19A 1FYKA 1TWGJ 3FXLA 2DFHA 1X1DA 3OYGA 2P7CB 2DODA 5M5WJ 3BTJA 3C2BA 1GT0C 2CUFA 2BVLA 2GXBA 3L09A 3I4MJ 3FKIJ 4BE2A 2VJ5A 3MD2A 2JPCA 1WI3A 3BZKA 1J0RA 1Z6RA 2O9LA 3G1MA 4IVNA 1I3QJ 3TO9A 5D6FA 5A2QK 5J8CA 3AL0C 5EGOB 4DZPA 3GTMJ 1CGPA 4NC6A 5IOYA 3I54A 4F55A 1Z7UA 3IKTA 4QTRA 3LQRA 4OIPF 1TQPA 3I59B 2CU7A 3IL2A 3I4NJ 3K0LA 1XMXA 2MABA 3ZMDA 3I55I 1FC3A 4U7DA 4PJLA 4HYEA 4KUMA 3HHGA 2DA4A 4EJWA 2JA6J 4LLGF 2VT2A 3RPQA 3T8TA 3HXLA 2YX7A 2LLKA 4XBFA 5J6XA 2ICWG 4FX4A 4X1EA 3CUQC 3FHZA 4Q4ZF 5HS8A 3ABUA 1FP1D 4IL6C 2NS8A 3KP7A 4A3DJ 4JQFA 3AFHA 3QPHA 2HDDA 5E3NA 5H2FC 2IGKA 5IT9Z 4KIFA 2RVCA 4IX7A 2BY3A 3M8FA 4V2GA 1TC3C 4BBSJ 3K4LA 3DF8A 1Z3YA 2HOSA 1RETA 4UY8I 1ZG3A 3DTKA 3JSPA 1DU0A 1IV8A 2DFFA 3FXUA 4J00A 2XGDA 3S1QJ 4GGGA 4II3A 2KIQA 4Y7NJ 4BJ6C 1ITYA 4DQ2A 2WA0A 5FRMA 3BTCA 1WH7A 2QGUA 2Q2EA 2L7MP 2HQNA 4ABZA 2R5ZB 4HF2A 2CFOA 2OJED 2FMYA 2FNPA 2V7FA 3AL0B 2I8DA 2XPVA 2X6OA 4MGRA 1O3RA 5HNFA 3KPHA 4GDFA 3AKZA 3LSTA 3ASNH 2IT0A 3OV8A 4A3MJ 5EGOA 2ESNA 1S29A 2EQRA 2VN2A 1Y8RB 5AIPA 2O61A 4U88A 3N97A 2DN0A 3CP2A 4RLFA 2OZUA 2Z2SB 3LL7A 5IP7J 1T38A 5FLMJ 2G7HA 4ZH4F 3G4SI 2IS4A 2GM4A 2RREA 1WJDA 1ZELA 5E18F 2P4WA 2Z9OA 1G3YA 3CUQB 3F8NA 4JK1X 5CQEA 2GOXB 3HUGB 2LY9A 3CP8A 1XCVA 2R7VA 3QPLA 3GFIA 2WADA 3KZIC 2Z33A 3I4PA 2EH3A 4PSWA 2LY2A 3BJOA 3RPUA 2WTEA 1CQTA 1ZR2A 3O8HA 1JT0A 2KRFA 3DKXA 2HVSA 2JQ7A 3I56I 2IAIA 2Z3YA 4BHBA 2EIMH 1EKEA 3K4KA 1TBXA 3MKYB 3WTZA 1WJ5A 3BR2A 2DA3A 2VKVA 3KX2A 5L3DA 3WE2A 2DA2A 4GO1A 4C9YA 3OYKA 1GXPA 2LD5A 2IRFG 4NC7A 2UV1A 4DYRA 3ZRGA 2B9SA 4CCOA 1FBSA 4B43A 1LDKB 2KIFA 2JZYA 4B3AA 2KKOA 2P5LC 3OYBA 3WTYC 4BL0B 4L5EA 3CD6I 4JBAA 3MAJA 3JAMK 4A6EA 1MMAA 2K02A 1S72I 3BROA 1RIOH 3MKLA 5FROA 2R5ZA 3BLYA 5LHGA 4PDKA 3SDGA 1ACIA 3H9GA 2CQKA 3KP2A 5LRSA 2MYSA 1AA7A 3TP0A 1YG2A 2KIMA 3JSOA 3FXJA 3DU5A 1MBHA 3PO3J 2V26A 4BUPA 1XB4A 3I53A 3D5SC 2W25A 2O3FA 3P9KA 2XHKA 4ITVA 1H89C 2Q1ZB 3OIPA 5B1AH 3SDBA 4PGGA 1KYWA 4LLLA 1WQ2A 2EFPA 1NH3A 3BTLA 3OY9A 4PK4A 1WCMJ 1NG6A 3RKXA 1UAAA 1QPMA 3KZZA 3OS0A 1IO2A 1XDUA 1XX5A 3E3VA 4BQNA 2UXNA 5JVGF 4A69C 1QBJA 3CUQA 4M74A 4UHTA 3HUGA 2STTA 3ABLH 4ON0A 2TCTA 3MVPA 3KP3A 2DOFA 4XONA 3G71I 2ZO4A 3DBLB 3OIOA 1OYIA 4UV8A 1YOVB 2GAUA 3CC2I 1LB2A 3CDIA 1L3LA 5FKLA 4A3CJ 4I76A 1G3WA 2K9NA 1TP4A 2DMQA 3HL2A 2LVSA 3CJQB 1MBFA 2W1OA 1IAWA 1GXQA 2EFQA 2DDAA 5F27A 3S2DJ 1BI1A 3JRGA 1PUFB 1GVJA 3MKWB 4ZYEA 3CC4I 3W6VA 5ILVA 3RQ4A 5FFZA 1BI3A 1YYVA 1D0ZA 1SD5A 4CICA 2VKEA 1MSEC 5FJ8J 3MN2A 4ZZLA 2EFOA 4C3JJ 3VYRB 6PAXA 1A36A 2JUGA 1OJLA 3ROUA 2M1BA 3L7WA 1HW2A 1KQ0A 2B63J 2M45A 2W24A 2ZXWH 1HC8A 1HXDA 4XN0A 3GTLJ 3GFLA 2P8TA 2MC3A 3GF2A 2K4BA 2QWWA 4I98B 1K61A 2OTLI 2FD5A 2XKPA 5FFXA 1YJ9I 1PYVA 1ETYA 3E5UA 2MFZA 2ZXHA 3LFKA 3CDLA 2AXLA 2KFDA 3D0SA 3PIOF 1HOMA 3LNQA 3BPXA 3SQNA 3V7RA 3BT9A 4P96A 2F5CA 1YW8A 1R1UA 2M8GX 2AQEA 4I01A 1A35A 2UXXA 1TQMA 2A6HF 1OCZH 1GV2A 1MMDA 1ETQA 4E7ZA 3L2RA 1Z0XA 3DTIA 2CMPA 3UKGA 3BG3A 2BY0A 1Y39A 1Z77A 4G12A 2EFNA 5K1YA 3LMMA 1Q1VA 2VI6A 3SHFA 1VQ6I 4L0YB 3ABMH 3TOBA 4L5JA 1FT9A 4RB1A 4NHJA 1WRJA 1MMNA 2KLOA 1HDPA 1OYYA 2KP6A 5D8KB 3V7SA 1I6HJ 3R0AA 2XAHA 3F3XA 2HI3A 4MNUA 1FLIA 3N4MA 3BR5A 2D45A 1TLHB 2F4IA 2NOJB 5HNHA 3B73A 3DEUA 3W6KB 1IN7A 4N9HA 2GBYA 1GUUA 5CJ9A 1X2MA 2ZFUA 2CV1A 1L0OC 2N8GA 1AWCA 3JRHA 3QYBA 4OIOF 1LFPA 1C0WA 2XSJC 5C44J 4DW6A 1BIBA 2JA8J 3FK7A 2OU2A 1IN5A 1BC7C 3KEQA 2P0WA 2XGXA 2M0CA 4HF0A 3S3OA 1SFUA 4FETA 4ZZDA 3H5RA 3JRDA 1FZPB 2DMTA 4BDZA 2V1NA 4B1RA 1B9NA 4Q48A 1B72A 1IDZA 1ZN2A 4BH9A 1IG7A 1P4AA 4KIGA 2X48A 4IJAA 3LAJA 1Z1DA 4D1QA 4H0EA 5FB2A 1LE8B 1BC8C 2JA7J 2BV6A 3WE3A 5K7ZA 3R60A 3ZQCA 3OYMA 4A3JJ 1JHHA 3DXJF 4YELA 5IYCJ 3PUFA 3CJNA 5F08A 3TDZC 1XSVA 1EF4A 2L7ZA 3TEDA 4I7HA 4CXFA 3GO5A 4XKVA 4M9SA 5E1WA 3NEUA 4LG0B 2DA5A 1UMQA 1Z91A 3DWLE 3JW4A 2A6TA 4BY1J 4RM3A 4C2TA 2LKSA 1J2XA 1A6QA 3K4MA 2NS7A 2A68F 3ZR8X 5JVTA 1LVKA 1J59A 3CO6C 4A3IJ 3IAS2 2QBYB 1YO5C 1O57A 2DXIA 3SZGA 4P1WA 4RAYA 1W0TA 4DGWB 1HA8A 3H3ZA 4I02A 1FY7A 3AG1H 1LVAA 4HX7A 5GPAA 3GXOA 2PQ8A 2HDWA 2P81A 4FE4A 3SZPA 3BY6A 2DJNA 4IOAF 1XMAA 1F4KA 4MFDA 1VFCA 2XAFA 5J8FA 2QKLB 2Y75A 1NK3P 3OR1C 2JUCA 3PL8A 4XKBA 2QCOA 1X1BA 4LOCA 2IA0A 2PBIA 2FOKA 2ISZA 2A3SA 1FIAA 3H0DA 1X58A 2R93J 1T39A 1TWCJ 1YJWI 1W0UA 5K5QA 2XPUA 2G0EA 3BPVA 1PUEE 4JX5A 1VQKI 2ZSIB 1P92A 2DT5A 1HKQA 2GZWA 2DMUA 3CCVI 2A5YB 2QVOA 4BY7J 5B5EC 1ZRDA 1U8BA 1HDDC 3BZCA 4IKFA 1B4AA 1G59A 2DA6A 4EJOA 3BCAA 1J09A 3GCMA 2R7XA 1ZH5A 4F93B 3J7AO 2CO5A 2WC2A 1EH8A 4CYDA 2VODA 4A0YA 5EDNA 2CWEA 2KZVA 4IQ4A 1O3TA 1OFCX 1BOBA 1SAUA 2VASA 1LEAA 4M3DA 4IF4A 4KISA 1MDMB 2VOPA 4HX4A 4R8HA 5M5XJ 5ICEA 4HNVA 5JFRA 2WV0A 4UVCA 2WV1A 4OAYA 4EVIA 5F0FA 1KONA 2QBYA 2JSPA 2E34A 1FBUA 4KT6A 2L7FP 4Y3OA 3S32A 4BGDA 3J7ZI 2LP0A 3TP3A 4PFOA 1BBYA 3B6AA 3ZMSA 3OYAA 2X0LA 1IRGA 4AIHA 1MBKA 1W7PA 4A2UA 3L2QA 4HDUA 2FNAA 5F1RA 5M3FJ 3R0JA 3A0HC 2NAZA 3SEZA 2VJ4A 2IS1A 1D1AA 2IVMA 2K4JA 2COBA 2JPBA 4BE0A 2ZB9A 3L00A 3HOVJ 1J75A 4M73A 5JR3A 4YIFA 3A1YA 2M8EA 4XIDA 2MLKA 1X4OA 3ZQGA 4EEFG 2Y48A 1TWHJ 1MIJA 4RB0A 1LNWA 4ESBA 1G4DA 3OSGA 3ZP5A 3C2HA 3W3CA 1KU9A 2GXGA 5IT9K 4P5OA 4GYGA 4AWXB 4L18B 2XUBA 1FMWA 3KFWX 2KIUA 4XRSG 2FJ1A 2K9MA 5FD6A 4PJMA 3KP4A 5D6EA 2XF5A 3VYSB 3MQ0A 1GV5A 2AXTC 4CH7A 1RR7A 2WY8Q 1MH3A 2XPWA 4U0WA 4XLFA 2H1LA 4KICA 1XSDA 4LIVA 1KU7A 2F5FA 1F1ZA 4CO8A 1I50J 3JRFA 3E1SA 1POGA 1VNDA 2EK5A 2G9WA 3DLAA 4ZTFA 1WH5A 2D1HA 5FD5A 2F48A 4F52A 2H8RA 1F9NA 1MDMA 2X6WA 2W7NA 2VXZA 1G8XA 1S7OA 1MJBA 2YSRA 1YW7A 4A0XA 1TW3A 3KLOA 1XTAA 3HPGA 2LR8A 2WAFA 4LG3A 2LBFA 3O2PE 4LMYA 4QLCU 5EEAA 1WPKA 5IYDJ 1PJRA 1ORKA 1JJ6C 3BR6A 2CUEA 2HYFA 3GTQJ 2LG4A 1ETXA 2E71A 2IA2A 3OOUA 4XKWA 2V1DA 1WZ2A 1BOAA 3DV8A 1OLTA 4J19A 5CVUA 1R4MB 2BXZA 2KT0A 2W57A 4UXNA 1A04A 2M7BA 2ZNZA 3DKYA 4OOIA 3GTGJ 3BG5A 1HBXG 4F7ZA 1AKHB 1FOXA 1KGSA 2DLLA 3CJTB 2KZGA 2K27A 2VBWA 3KCCA 3TGNA 5JI6A 1I6XA 5D8LB 1MJAA 2VBYA 4PZJA 4NDLA 1MSFC 2HVRA 4XN3A 1T98A 5EYRA 5FO5A 2BGCA 2CV0A 1NTCA 1RKTA 2LYCA 3HOYJ 4M3GA 4N4NB 4RBOA 4KMFA 2QEXI 1ZTRA 3I0TA 1R5HA 1D5YA 1KYZA 2HWVA 5TISC 4CYCB 1IRFA 5D5VB 1V5GA 2XRLA 2F5VA 3ZMZA 1TL8A 3RIRA 1FBQA 1VQ5I 3GTOJ 1A31A 4XOPA 3WGHA 1D1CA 4XKCA 2OZ6A 3R6SA 4AIDA 2LY1A 2DO7A 2XB0X 3EQLF 2RC4A 3FISA 3FM5A 2DAOA 2Z5UA 3NWSA 1G2HA 2ISYA 3P9CA 3V42A 2F4MB 3BWGA 4FHTA 3I58A 3BJ6A 2WB1N 5D5WB 3LSJA 2IPQX 2CV2A 4BJTA 3J81Z 1P2FA 2WAQA 5DYMA 2DMNA 2ID6A 3HBLA 5E8GA 1O3QA 3HM5A 4YRVA 1EJ9A 1UHMA 2XSDC 1VI0A 1UHWA 3GVAA 1MBJA 1R71A 4CHUA 2XV4S 3EUKL 2CW0F 1LJ9A 1N75A 1P4XA 1IUYA 3W2VA 1X2NA 1Y0UA 2JRMA 2JVGA 2PN6A 3O3KA 1Y1VJ 3G73A 4M9XA 3KYDB 3HOTA 4A3LJ 3H0GJ 2DTRA 5FKOA 5J1YA 1YLFA 2EZHA 2NNYA 4NNJA 1AKHA 1Z3XA 2PMZA 1YS7A 2A61A 4KMUX 4EQQA 2R7UA 3IUOA 3H3VK 2OUMA 1Z9CA 4O6JA 4NQWB 2QF7A 3COAC 1FOYA 4EGYA 2HXOA 5TJJA 3CMYA 4WWCA 5GADJ 4HF1A 2M30A 1YTYA 3K4BA 1X1PA 2OBPA 4CCNA 1H0MA 1N25A 2HYJA 2OTJI 4G9YA 3FXQA 4CYCA 4PFPA 1IC8A 5J40A 5EG0B 3GBGA 3HYIA 2HOEA 4BHCA 2HQRA 2K40A 5GAEJ 4V19K 5BPDA 1U9NA 4XLPF 4ENNA 1HQCA 4ZDPA 4KYWA 5HS9A 3WU2C 2QA4I 2VQLA 1W36D 5JHFA 2XROA 2DFIA 3D5LA 2ETHA 1K4SA 2RNGA 2E1MC 2HFHA 1FTZA 1YE9A 3F8MA 3KEYA 3SFZA 3WTWC 1PVEA 4CGZA 3P5JA 1XC5A 1RNLA 2RQQA 4LFUA 2HKXA 1Y1WJ 4XMYA 4L0ZB 4QPOA 2Y0SN 4MQ9F 3G2BA 4FX0A 3MKZA 1YW9A 3ULQB 5KAIC 3RPUD 3QYEA 3C1DA 3KETA 1ZG5A 1HW5A 3LA7A 4ENJA 1JGGA 3WGGA 4Z2YA 2FXAA 5HLGA 1MJ9A 4XRSA 3I71A 4BNCA 3RTRA 4WXCA 1R49A 3GLLA 4XRMA 4EJVA 1A6IA 2L54A 4AU7A 2QYOA 3EYYA 4I0BA 3B02A 2OPTA 3BQYA 3SXYA 2QLZA 1WJEA 2VJIA 3I5UA 3WU0A 3ZMVA 5ILSA 2VBXA 1R58A 2Y9ZA 2CGPA 3DBRB 2LKXA 4N0BA 2V1UA 4UB8C 3K70C 3T1BA 3QU3A 4BKXA 4Y13A 2KHMA 5LEJA 5F0CA 3HRTA 3E7LA 5LHIA 1R1VA 2UZKA 3GFMA 3PSFA 4NQWA 2M0MA 3PM1A 1GDTA 4JP0A 2VC1A 2TRTA 2DA1A 2HS5A 3EUAA 3CJRB 3H5AA 2ME0A 3S14J 3ZQLA 1FOKA 3GEZA 1R1TA 3JRAA 2WY7Q 1SVMA 3FXKA 1BI0A 2RV8A 3BJAA 4NUBA 4LIUA 5EG0A 1ETWA 4C2UA 2M87A 1E3OC 3HGGA 3REOA 4MTEA 2XB5A 2E1MB 4IZZA 3AG2H 2VBZA 3HTSB 2CW7A 3LSMA 3QPTA 3ZQIA 2XGEA 2L9NA 3K10A 3SYTA 5E3MA 3U1DA 4B4CA 3OS2A 5DUKA 4C3HJ 2L9SA 4U7BA 2ZMEC 4KA4A 2UWMA 4BXFA 4KIBA 2KDZA 2LK2A 1W1WE 1S9HA 1T6SA 4YFNF 2FQ4A 3PJRA 5EEHA 4YFXF 4P9FA 2YU3A 3W6JB 2X1EA 3ERMA 2IGOA 1H8AC 2ELKA 1B59A 2K9SA 5J1UA 2B0LA 1SVOA 2PFBA 2X4HA 2M2EA 4RMNA 5BNGA 4PJ0C 1Z67A 3Q0VA 3BZ6A 5AIQA 1TT0A 1XD7A 1IW7F 1X3ZB 3JTGA 4N9IA 1KA8A 2MC4A 4ASNA 4F91B 1LPQA 4V2FA 2HYGD 5EJCA 3RI4A 3IWFA 4HLXA 3HRMA 2V9VA 2DDBA 4OU0A 1S7AA 2PI0A 2V9PA 5BPIA 4C3IJ 4PGHA 4BXUA 3KZYA 2DU9A 1QZEA 3MWMA 1IN8A 2VKDA 1TNSA 3ECHA 3ZGKA 4CSWA 4A0ZA 2LRDA 3MZHA 3IKVA 3F9KA 4DBRA 1IRZA 3FBNB 2XC7A 5ED4A 3PNTA 3FXOA 2C6YA 3WTXC 1K78A 1GVDA 3LSIA 4D9JA 1OCPA 2CQ7A 4ZDOA 4XLCA 2Y2ZA 4W97A 2FEZA 5IT3A 3M8JA 3M1CA 5E3LA 3LA3A 5LRRA 2ZMEB 1DGRM 2BZTA 2M4KA 3ZN0A 4Z6YA 4WX9A 3J80Z 2GOMA 1WHUA 4ZDLA 3MZ8A 4HPQA 3U2RA 3CZ6A 3WHCA 1HF0A 3K2ZA 1Y56A 2H27A 2MGQA 2D2WA 3ZQHA 3MCZA 4DJAA 5M3MJ 4HQEA 1ZRCA 1ONVA 3DLLF 5IP6A 2MLGA 1IN4A 2R4GA 2GA1A 2YU9J 4TV7A 4U0YA 2D1VA 2HTJA 5GAHJ 1J7KA 2HGCA 2QQBA 1BN5A 1G6NA 2VT3A 2YR2A 4RDUA 1JT6A 1XGNA 4XRFA 1VQ9I 2I5UA 1K4TA 3S1MJ 3LSKA 5B3SH 2EBIA 3WTSC 3LSHA 3IHUA 3PFYA 2JA5J 3PNYA 2FBKA 2XASA 1D0YA 1B72B 1ZKGA 1UJ8A 1E2XA 3GLXA 1K6OA 1WJFA 1XGSA 2CRGA 2EZIA 2LOOA 4O3MA 1XN7A 4RAGA 1MNMC 3S93A 1RESA 1U2WA 4I0AA 1F43A 2EILH 2XF7A 2ZFWA 2ZSHB 4CDGA 4YEJA 2ZJQF 2QUFA 1LFUP 1USSA 1WWXA 5FLXZ 2PMHA 1OCTC 1DP7P 3FMQA 1YX5A 3OYFA 2EA4A 4OINF 4MO7A 5LHHA 5LLQA 5HS7A 2BXYA 4QIWN 2XKOA 3ML6A 2X51A 2RDPA 1ENHA 2F5EA 4GCVA 2JN6A 3SJMA 1VQMI 1UFMA 3JRBA 3HG9A 4QSHA 3K1PA 1N78A 3ECOA 2KJCA 5IY5H 1MBEA 2KMUA 2BVMA 5JHUA 1S6LA 2MD5A 2ZJPF 1J5YA 2ZMEA 3BCBA 4HAMA 2ZBKA 4XQFA 3IH4A 1YFHA 3L2VA 1LDJA 4F3QA 5FKKA 1E3HA 4XICA 5FLVA 4QPQA 2HZDA 3GYHX 3IRRA 2Z99A 2H09A 3H36A 4A5MA 3K1NA 4WF2A 2DJIA 1TT5B 5ICFA 1R5GA 3EPZA 2HU9A 2A05A 2F4OB 4XLEA 2HQAA 2ID3A 3CQZJ 4G6TB 3K7AJ 1YHQI 4I99C 5FGMA 2L5QA 1TW2A 1N77A 2OF7A 5HVQC 1TNTA 2EJRA 1R00A 4J01A 1ZR4A 1JTYA 3DFGA 2NVUB 2K86A 3AAFA 2OV7A 4U0VA 2H8WA 1XSXA 4FQGA 4KN7X 4XL9A 4AC0A 3CCUI 2PG4A 1APLC 1K83J 3LOCA 2DOAA 1IJWC 2ZXIA 3HB9A 1I1GA 3DTEA 3HKZA 2B7EA 1RRJA 2HQ5A 2ELJA 4FTHA 4MQVA 2IS2A 4RB2C 5HDGA 2W84A 1T95A 4DOZA 5CVVA 1JGSA 3BR3A 2O6GE 2OCEA 3QP5A 1SD7A 4P55A 2PX9A 4CZCA 1RR8C 3NWTA 1OKRA 4XLAA 4XSZF 4WK8F 4HLYA 5CVIA 5D4SA 1YRNB 1QVUA 4AD9A 1IZ1A 1TQIA 1RC9A 1XGOA 4HBLA 2I10A 3OSFA 3SFIA 3FXRA 1JKRC 5H6RA 2X1DA 2GA2A 3IC7A 4KNYA 2P5KA 3TO6A 1SFKA 4IHWA 1XMKA 2MSYA 5CVJA 5FKMA 2Q8KA 5ICGA 2HZTA 2L7KA 4BXXJ 2JSCA 1Z7LA 2WBMA 3GUDA 4KT5C 1V3FA 4BQOA 3M7GA 3E6CC 2PJRB 4HNUA 1UHSA 4G7ZF 4E7LA 2HR3A 4A3FJ 1OISA 4BDYA 4FE7A 2BOLA 2ECBA 2R0QC 1X1AA 3EYIA 2E19A 2BBYA 3IV5A 1RUNA 3Q0UA 1XS9A 4O5VA 3CCYA 3CO7C 2DQRA 3CCSI 1BIAA 5E1ZB 3S16J 3QOEA 4M71A 1FP2A 2P7VB 1W7PB 3ZOBA 4RGUA 5B66C 1YJNI 5L3EA 4C2MJ 5LGTA 2E35A 3L2WA 3MMYB 1VTNC 1BR4A 4AYBA 3BQZA 3VSKA 4HOBA 3K4CA 2EA2A 4MEYF 4I09A 2HDCA 3LA2A 3QYFA 2NVYJ 3ESWB 3FIWA 4E4HA 4ZYAA 4BU2A 1WI9A 1ZLJA 1M1EB 3QAHA 2FUG2 5C4JJ 1Z05A 2R7ZJ 5GTIC 3S17J 4RAZA 5TRDA 2YS9A 3RQIA 4CA0A 1D3YA 2Y69H 2L4MA 1MNDA 2LC2A 2W4SA 2NOGA 1JKOC 1WJAA 4EGZA 1JHFA 1YRNA 3FBIB 1ETOA 4LK1F 4G7HF 4LB5A 1QZYA 2Y31A 3JCUC 5LGUA 5DEQA 4HSRA 2XGCA 3B6CA 1OPCA 2VPRA 1XDSA 3NRVA 3GTPJ 1GLNA 3E0JB 1WKMA 2CG4A 2ECCA 3J81K 1W7PD 2TDXA 3I3LA 3VEPA 4M3BA 2PLYA 2E1OA 1ERDA 4K2EA 3M8EA 5E3OA 2PJRA 5ERIA 5CQGA 2LREA 3V7CA 2EPFA 1MKMA 2LBFB 3Q0WA 3O6BB 4RLQA 2PMUA 1BW6A 2IGNA 1STZA 4PJNA 5IOZA 2DT6A 3V8JA 5F1JA 3GZ5A 2WWYA 4XR6A 4IHVA 3LQQA 1MBGA 3RCOA 2KRCA 2X6XA 2H6CA 3VPRA 1WJBA 3DPTA 3FK6A 2VIXA 1WGXA 3QP6A 5ICCA 1VZ0A 2K9LA 3G3ZA 3SZTA 4YG2F 2HOTA 2E60A 1JXSA 4A93J 2RQPA 4ZYHA 1ZREA 3VWBA 4EJTA 5H6QA 2OA4A 4RA2A 5GTHC 1AU7A 4HDVA 5K7HA 2KL4A 4HV5A 1E0EA 3RDIA 1ZYRF 4M6VA 1BW5A 3GZNB 3HDDA 2E36A 1A5JA 4KITB 3VYTB 4G8XA 3FHNA 3M9AA 4DZJA 4KJZA 1KU2A 2F6CA 2DCEA 2L2OA 1I27A 3HSEA 4ESFA 1ZGWA 5FRNA 2K3PA 3HHHA 2Y9YA 2L3DA 1XPXA 1UB9A 1JJ8C 1RI7A 1OCOH 1HSJA 1ZARA 4XK4A 5K7FA 1JUSA 3E5XA 4IHXA 1JUPA 3I9V2 5F04A 3RKYA 3EUHC 2W82A 1K79A 3K9TA 2E5ZA 3WTVC 2KQRA 1CF7B 2DYRH 5J47A 1DUXC 3CCLI 1JE8A 4PJJA 1F5TA 4HX8A 1REPC 4C30A 2GXAA 1FYLA 4BACA 2RGVA 1ON1A 2BE5F 1ULYA 2CUZA 2LTPA 2NS0A 3EDPA 4PSXA 3ZN1A 4EV0A 1VQ7I 2J5OA 3A2KA 5JLXA 1SMTA 2W85A 3LSRA 3A4CA 1T8IA 3HC7A 1B9MA 1IDYA 3OS1A 3S3NA 5LGNA 3V8LA 3LSPA 3QWLA 3R4KA 4L5IA 3CCMI 4UV9A 2FOWA 3M07A 2L9VA 5L3BA 4Y52J 4OWRB 4W1UA 3CC7I 5BS6A 4ESJA 4NB5A 1V55H 3FMSA 4OMZA 4E7SA 1S3JA 1UCRA 4D7MA 1T56A 4HV6A 2FU4A 2K5CA 1PP8F 3BOQA 4FT8A 2IP2A 4BE1A 1YS6A 2LKPA 1USTA 1UELB 1OR7C 4EJUA 1BR1A 2DBBA 4IHTA 4UUVA 5DM7F 1D8JA 1XG1A 3HRUA 2IGMA 1ZGJA 1OCCH 2JTVA 2ZXJA 2DFEA 2CJJA 5D5XB 4OAZA 1LKXA 5E20A 2MBFA 1YIOA 1R9TJ 3FXMA 2HKOA 4AVZA 4E6KG 1B6AA 4RGSA 2XRNA 1ZGAA 1I39A 3F72A 3QU6A 2JJ7A 1W5SA 3QOPA 2W00A 3R61A 3OYLA 2BW3A 4IHSA 2W48A 4Q47A 3WHBA 1H9GA 4E7IA 3CTAA 1K7AA 1NG7A 2G7UA 1CF7A 4G7OF 2MH2A 3JTHA 2O7OA 3GWZA 4XNFA 3SEQA 1MD0A 3H35A 3UNGC 4BAYA 1P6RA 3TW6A 1XGMA 3A01B 1S5LC 3IH2A 2ZKZA 3DCFA 3MZYA 3U9GA 4N4OB 3TW7A 5E8IA 2LSOA 4A5NA 2VPLA 2ZJ2A 2ACJA 1U9OA 1IXRC 3OYDA 4LITA 4FASD 1ZAOA 3DP7A 3DEWA 4RAFA 4BQQA 4HRIA 2YX4A 3HRSA 2NVTJ 2V4JC 5EEGA 4F92B 3D5RC 1IUFA 3WU1B 3K1MA 3CF2A 2EB7A 4L9JA 3PQKA 2O8XA 4HQMA 1ZRFA 2R3SA 4XLNF 2R7RA 2EZKA 4JX6A 1AOYA 3QQAA 3WTTC 1P7JA 2ZCWA 3N05A 3V8KA 2DMPA 1RUOA 3HOWJ 2VE8A 2VJJA 1P9QC 3QPSA 3QRFF 1HW1A 2E5NA 3CF5F 2R7QA 3W2WA 2QQ9A 4G6QA 1OYWA 1FMVA 3J80K 3RYRA 2NXNB 2DW4A 1K6YA 2AHQA 2WAEA 1R22A 4B8XA 3H9QA 5BOXA 4R79A 2LH9A 1TTYA 2XIGA 3EUHA 4ZC3A 4BQAA 2HPIA 4D5FA 1S7EA 2FA5A 5GPCA 2R7FA 3DQVC 1H88C 2DPUA 1SVLA 2K7LA 3KIOA 4M3EA 2HEOA 1JKQC 2NNNA 4UUSA 3BG6A 4G6DA 1RPWA 2X1CA 2O0YA 9ANTA 2HVQA 4CCLA 4IXAA 1ZQ3P 1XCBA 3HEFA 4ENMA 3GTKJ 2J5PA 5J4VA 4L9VA 2GIZA 4XLHA 2GQQA 2D5VA 3VODA 4E7KA 1EH7A 1KQ9A 1FTTA 1OCRH 1Z21A 3CCRI 1G3SA 4FISA 4BEHB 4CUGA 1W4MA 2DI3A 2VC0A 2HNHA 5BMZA 4OIQF 3O8GA 3CMAI 2HOAA 3A01A 1R36A 3OL3A 3UR3C 5ILUA 1U5TC 3PFIA 1H9TA 3PO2J 2NYXA 3S2WA 1QU3A 4A6DA 2OC6A 4ZYDA 2DPDA 5CVRA 1VQ8I 3J7AY 2OD5A 2K3FA 3ONQA 2X6YA 4XM3A 4YIRX 4CCJA 1IF1A 5FLXK 1MMGA 2K85A 3HSFA 4Y4RA 5F64A 3VSLA 3HOUJ 3I59A 3GZ6A 3Q5FA 1DU6A 2VQHA 5C3EJ 1SANA 1X3UA 2OCCH 4M72A 2M34A 3S15J 5DD8A 1OR7A 1K78B 1VQOI 1WFXA 2ESHA 3ELKA 4X0GA 4EM1A 3HSRA 1ZHFA 2BY2A 1BI2A 4A3BJ 1QA6A 5E79C 5IYBJ 4IO9F 2CQNA 1FPQA 2DTZA 3AG4H 3A03A 2JT1A 3F8CA 1VF9A 4HA8A 3V4GA 2FE3A 3TDUC 4BYYA 1E17A 3IP4B 2E2JJ 1I1SA 3BR1A 4HG2A 2FSWA 1DGWY 3U1KA 5L3GA 3M4OJ 2E7WA 3ERED 4RB3C 4ZJZA 2VUMJ 1UG0A 2EIJH 1LEBA 2RNJA 3CMMA 4NBQA 2LNBA 3P9IA 1PP7U 1X3WB 1FSHA 1QRYA 1YI2I 1KQ8A 1U5TB 3W2AA 2V6EA 2LF7A 3WTUC 2AQFA 2JK3A 4BEHA 2E7XA 3CCQI 4Y33A 4DNCA 2WAQN 3WODF 5A2QZ 1IN6A 1B8IB 4IPAA 1SC7A 2L01A 3S2HJ 3KP5A 5HODA 2COMA 2DK5A 3OYIA 1JUMA 4WCGA 2LF8A 3FWEA 4UB6C 3DEEA 1QNTA 3TQNA 2MW8A 3F6OA 1D8KA 1ETKA 2O8KA 2CW8A 3H1CA 3OYHA 1QVTA 1YX3A 3LFUA 2M4GA 3HPHA 1IV6A 5LBQA 2IA1A 4M6YA 3ASOH 3IWZA 4U87A 5HDKA 4A3GJ 3Q3SA 2XF6A 2PMZN 1V5EA 3ZQQA 3K69A 2QSGX 2IBDA 3VDXA 5J4YA 4IRHA 2CSOA 2DA7A 3MFKA 2CFXA 3RKQA 3NQOA 4X6AJ 1R23A 5KAFC 3L2CA 1SFOJ 3CCJI 1MW7A 3JRCA 3ISPA 2NRAC 2VLAA 2PJPA 3FMRA 2A6EF 3HZJA 3F6VA 2EV5A 3L9FA 3RZOJ 2FBIA 3GW2A 2O03A 4S04A 2R5YB 2EIKH 1R5ID 2LMDA 2XVCA 1FYMA 2A5WA 4S0HB 4IQJA 2HTSA 4GRIA 4HEA2 4Q5SF 4B09A 1SD4A 4GYIA 3K70D 1ODDA 3BG7A 2DOEA 4GXOA 1QHHD 4M6XA 4OIRF 2BYVE 3M3YJ 3RKWA 3FDYA 4KDPA 2CQQA 2R92J 1U5TA 1TZLA 3J7YJ 1AHDP 1MMSA 1HSTA 3IH3A 2XAJA 1I3AA 4MFEA 3LAPA 4RS8A 5IP9J 1B8IA 2E1CA 3OYEA 4B3XA 3ZMUA 3OMYA 2CUJA 1ZK8A 2KRHA 4M3FA 3FKJA 2BHZA 1Q1HA 3KLNA 2VB6A 1DPRA 4HSTA 3F23A 3BDDA 2CH0A 3F0CA 2Z16A 4NC8A 5CYVA 4IHYA 2JA2A 3KYCB 4YFKF 3OOPA 1X1CA 3VFZA 4L9NA 2RKHA 2VKHA 1OMIA 3VB2A 1VQPI 1U3EM 1SFEA 4Y17A 4CCMA 1J9IA 2YUSA 5K5RA 2NVXJ 5KHDA 3LSGA 2H94A 3H9JA 3HJEA 1DPUA 3S3MA 4I2OA 3FZVA 3PIPF 5HDNA 2QQAA 2HXIA 3DPUA 3GMEA 1B1BA 3OYCA 2R7OA 2QZ8A 2M7AA 4D0PA 3IAM2 2R7WA 3HOZJ 2KJBA 1NHAA 2FBHA 1EH6A 3OIQA 3E5QA 1IXSB 1HLVA 2XDVA 4II2A 1D1BA 2DQLA 3H3UA 5J3LA 1PUFA 5M5YJ 2R5YA 4EATA 2QM3A 1RKWA 5CKTA 2E1NA 1HKTA 2GLOA 4UVBA 1LQ1A 3AG3H 3FX3A 2P6TA 3VOEA 3DPLC 2OQGA 2UUZA 3JAMZ 1U8RA 2L0KA 2QSHX 2ADUA 2BHYA 5FKNA 1FOWA 1BL0A 2EWNA 4ETSA 1BJAA 1QZZA 4JOMA 3TBIA 2DK8A 3GTJJ 4QWQA 4D7NA 3ZCOA 4MTDA 3WGIA 3OWTA 3DKWA 5DCMB 4AVPA 2JVHA 3GFJA 3DU6A 4AM3A 2P5VA 4AIJA 3KE2A 3ZPLA 1UZCA 2MA3A 2L9RA 1W5TA 4DIQA 2A07F 3S8PA 4IRGA 2OQRA 2ZNYA 3EETA 4YIIA 3U21A 2P6SA 3F8BA 3CMEI 3MEXA 1VQNI 1RZ4A 3L1PA 1MZBA 3ZQ7A 1MNEA 3PUBA 3RSNA 2VOOA 1IXCA 3F22A 2CQXA 2XAUA 3VYUB 3PQJA 2ZJRF 5HLHA 3QODA 3G1LA 4MHGA 4BS9A 4RGRA 5L3FA 2DYSH 1FX7A 3H92A 5KK1A 1VQ4I 3F21A 3HTUA 1W5CC 1WJCA 3WG7H 5HOOA 2VE9A 3CUOA 5H20A 4XORA 5HLIA 1V54H 3K4JA 1DQUA 2GWRA 2IW5A 3Q9SA 3ZQFA 4E70A 5LD2C 5C4XJ 1O3SA 2V9KA 1Y0NA 2H6BA 3JR9A 4DYCA 1IGNA 5D5UB 4ENKA 3G6EI 2E2HJ 4WXDA 1E3PA 2FRHA 1P7IA 2JMWA 1WSUA 5DV5A 1U78A 1ETVA 2H1KA 3C18A 1DP3A 4M9ZA 1FNNA 3S1NJ 2A69F 2M3AA 3PNVA 1QPIA 2E2IJ 3Q9VA 1FEXA 2R7TA 5DCMA 2IEKA 3TOAA 2F5DA 2X9DA 3ZXSA 3L2UA 5JLWA 2DT7B 1GHCA
chains in the Genus database with same CATH topology
4HW0A 4G94A 1MGTA 2PEXA 3ZMTA 3GX4X 5F6FA 3F8FA 1D5VA 3T0YA 4KFCA 2Y0MA 1P4WA 4UVAA 2F2EA 4WXHA 1DDNA 4HZFA 3E97A 4R1HA 3E6BA 5E1XA 3KEOA 2VONA 1FWZA 3BP8A 3FM3A 5BQTA 1SD6A 1BM9A 4LG0A 3WG9A 1LDDA 4KN4X 3RJPA 4UNOA 2FMLA 4LK0F 1V4RA 2IJLA 4MEXF 2FF4A 2V79A 4AIKA 5L3CA 4L9TA 2V1XA 5DD4A 4LB6B 3LWFA 3HIFA 1ZLKA 1R7JA 2L02A 4EMSA 4A12A 3P7NA 4XSXF 3FF5A 3T8RA 2CYYA 2EFWA 3HOSA 1SFXA 2L4AA 5DCFA 4PCQA 4EM0B 1Z6TA 1QO0D 5DUIA 4LGWA 1I5ZA 2STWA 4LD5A 5KVRA 2XAGA 2LDUA 3TKYA 1KU3A 5LEKA 3E6DA 4RGXA 2QENA 2OAZA 4CZZA 1ON2A 2Q0OA 1G3TA 3KP6A 5K5OA 4LLNA 1EV7A 3ABTA 1HKSA 1ZG1A 1SMYF 1QGPA 4ZYGA 3CDHA 1O7FA 5CLSA 4BHPA 2MH9A 3IRQA 3RYPA 1FSEA 3E6MA 1U6GA 1S8NA 1O7LA 3I64A 4Y15A 2BEOA 2R7DA 2FQ3A 1PDNC 5AONA 2ELHA 1QQIA 2EV0A 1SAXA 5E17F 5DDGA 2V6CA 2JRTA 2GIVA 2EV6A 4S05A 1T0FA 5D4RA 3C3WA 3CLOA 2YPRA 1T2KA 3C7JA 2AS5F 3TO7A 4IRIA 4LJZF 1YQAA 2RN7A 4OMYA 3M1EA 2XAQA 4EM2A 3T5XA 4P9UA 2M5WA 1FYKA 2P7CB 2GXBA 3L09A 2JPCA 1J0RA 1Z6RA 4IVNA 5A2QK 3TO9A 5D6FA 5J8CA 1CGPA 3I54A 1Z7UA 3IKTA 3LQRA 4OIPF 1TQPA 3I59B 3IL2A 3K0LA 3ZMDA 1FC3A 4U7DA 4HYEA 4KUMA 3HHGA 4EJWA 4LLGF 2VT2A 3RPQA 3T8TA 2YX7A 4XBFA 5J6XA 4FX4A 3CUQC 3FHZA 4Q4ZF 5HS8A 3ABUA 1FP1D 3KP7A 4JQFA 3QPHA 5IT9Z 4KIFA 2RVCA 3M8FA 3DF8A 1ZG3A 3JSPA 3FXUA 4GGGA 4DQ2A 2Q2EA 2HQNA 4HF2A 2FMYA 2FNPA 4MGRA 1O3RA 3LSTA 2IT0A 3OV8A 2ESNA 1S29A 2VN2A 5AIPA 2O61A 4U88A 3N97A 2OZUA 1T38A 2G7HA 4ZH4F 5E18F 2P4WA 2Z9OA 1G3YA 3CUQB 3F8NA 4JK1X 1XCVA 3GFIA 2Z33A 3I4PA 3BJOA 3RPUA 2WTEA 2KRFA 4BHBA 2Z3YA 1TBXA 3WTZA 3WE2A 2IRFG 5L3DA 1GXPA 4GO1A 1FBSA 1LDKB 2KIFA 2JZYA 2KKOA 2P5LC 3WTYC 4JBAA 3MAJA 3JAMK 4A6EA 2K02A 3BROA 1RIOH 5LHGA 4PDKA 2CQKA 3KP2A 5LRSA 1YG2A 2KIMA 3JSOA 1XB4A 3I53A 2W25A 2O3FA 3P9KA 2XHKA 4PGGA 1KYWA 4LLLA 1WQ2A 2EFPA 3RKXA 1QPMA 3KZZA 3E3VA 1XDUA 2UXNA 1QBJA 3CUQA 4M74A 4UHTA 3HUGA 2STTA 4ON0A 3KP3A 2ZO4A 1OYIA 4UV8A 2GAUA 1LB2A 1L3LA 1G3WA 1IAWA 1GXQA 2EFQA 1BI1A 1GVJA 4ZYEA 5ILVA 5FFZA 1BI3A 1YYVA 4CICA 1SD5A 4ZZLA 2EFOA 6PAXA 3ROUA 2M1BA 3L7WA 1HW2A 1KQ0A 2M45A 2W24A 1HXDA 3GFLA 2P8TA 2MC3A 3GF2A 2K4BA 2QWWA 4I98B 5FFXA 2XKPA 3E5UA 3LFKA 2AXLA 3D0SA 3BPXA 3SQNA 3V7RA 4P96A 2F5CA 1YW8A 1R1UA 4I01A 2UXXA 1TQMA 2A6HF 2EFNA 5K1YA 3SHFA 4L0YB 3TOBA 4L5JA 1FT9A 4RB1A 4NHJA 1WRJA 1OYYA 5D8KB 3V7SA 3R0AA 2XAHA 3F3XA 4MNUA 1FLIA 3N4MA 2D45A 1TLHB 3B73A 3DEUA 3W6KB 1IN7A 4N9HA 5CJ9A 1L0OC 1AWCA 4OIOF 1C0WA 1BIBA 2OU2A 1IN5A 1BC7C 3KEQA 2XGXA 4HF0A 1SFUA 4ZZDA 1FZPB 1B9NA 4Q48A 1ZN2A 4BH9A 1P4AA 4KIGA 4IJAA 3LAJA 4H0EA 1Z1DA 5FB2A 1BC8C 2BV6A 3WE3A 3R60A 1JHHA 3DXJF 3CJNA 3TDZC 1XSVA 4I7HA 4CXFA 3GO5A 4M9SA 5E1WA 3NEUA 4LG0B 1Z91A 3JW4A 1J2XA 2A68F 5JVTA 1J59A 3CO6C 2QBYB 1YO5C 1O57A 4RAYA 3H3ZA 4I02A 1FY7A 1LVAA 4HX7A 3GXOA 2PQ8A 3SZPA 3BY6A 1XMAA 1F4KA 2XAFA 5J8FA 2Y75A 2IA0A 2PBIA 2FOKA 2ISZA 2A3SA 1T39A 5K5QA 3BPVA 1PUEE 1P92A 2DT5A 1HKQA 2GZWA 2A5YB 2QVOA 1ZRDA 1B4AA 4EJOA 1ZH5A 3J7AO 2CO5A 2WC2A 1EH8A 4CYDA 2VODA 4A0YA 2CWEA 1O3TA 1LEAA 4IF4A 1MDMB 2VOPA 4HX4A 4R8HA 5ICEA 5JFRA 2WV0A 4UVCA 4EVIA 2QBYA 1FBUA 1BBYA 3ZMSA 2X0LA 1IRGA 4AIHA 1W7PA 4A2UA 4HDUA 2FNAA 5F1RA 3R0JA 2NAZA 2IVMA 2K4JA 2JPBA 3L00A 1J75A 4M73A 5JR3A 4YIFA 2M8EA 2MLKA 2Y48A 4RB0A 1LNWA 4ESBA 1G4DA 3ZP5A 1KU9A 2GXGA 5IT9K 4P5OA 4GYGA 4AWXB 4L18B 2XUBA 3KFWX 2KIUA 5FD6A 3KP4A 5D6EA 3MQ0A 4U0WA 1XSDA 4KICA 1KU7A 2F5FA 1F1ZA 4CO8A 2EK5A 2G9WA 5FD5A 2D1HA 1F9NA 1MDMA 2VXZA 1S7OA 1MJBA 2YSRA 1YW7A 4A0XA 1TW3A 3KLOA 3O2PE 4LMYA 4QLCU 2HYFA 2IA2A 2V1DA 1BOAA 3DV8A 5CVUA 2W57A 4UXNA 1A04A 2ZNZA 4OOIA 1HBXG 4F7ZA 1KGSA 2DLLA 2K27A 2VBWA 3KCCA 3TGNA 5JI6A 1I6XA 5D8LB 1MJAA 2VBYA 4PZJA 1T98A 5FO5A 2BGCA 4KMFA 3I0TA 1R5HA 1KYZA 2HWVA 1IRFA 5D5VB 3ZMZA 3RIRA 1FBQA 3WGHA 2OZ6A 3R6SA 2DO7A 3FM5A 3EQLF 2RC4A 2DAOA 2Z5UA 2ISYA 3P9CA 3BWGA 4FHTA 3I58A 3BJ6A 5D5WB 2IPQX 3J81Z 1P2FA 5DYMA 5E8GA 1O3QA 1UHMA 1UHWA 3GVAA 4CHUA 2XV4S 2CW0F 1LJ9A 1P4XA 1IUYA 1Y0UA 2PN6A 3O3KA 3G73A 4M9XA 3HOTA 2DTRA 1YLFA 2NNYA 1YS7A 2A61A 4KMUX 4EQQA 1Z9CA 4O6JA 3COAC 4EGYA 5TJJA 4WWCA 4HF1A 2M30A 1YTYA 2OBPA 1H0MA 4G9YA 3FXQA 3HYIA 2HOEA 4BHCA 2HQRA 5BPDA 4XLPF 4ENNA 1HQCA 4KYWA 5HS9A 2XROA 2DFIA 3D5LA 2ETHA 2HFHA 3F8MA 3SFZA 3WTWC 4CGZA 1RNLA 4LFUA 2HKXA 4L0ZB 4MQ9F 4FX0A 1YW9A 3ULQB 3KETA 3C1DA 1ZG5A 1HW5A 3LA7A 4ENJA 3WGGA 4Z2YA 2FXAA 5HLGA 1MJ9A 4BNCA 3I71A 3RTRA 4WXCA 4EJVA 2L54A 2QYOA 3EYYA 4I0BA 3B02A 3SXYA 2QLZA 3WU0A 3ZMVA 3I5UA 5ILSA 2VBXA 1R58A 2CGPA 4N0BA 2V1UA 3T1BA 3QU3A 4Y13A 5LEJA 3HRTA 5LHIA 1R1VA 2UZKA 3GFMA 4NQWA 2VC1A 2HS5A 1FOKA 3GEZA 1R1TA 1BI0A 2RV8A 3BJAA 2M87A 3REOA 4MTEA 2VBZA 3HTSB 3QPTA 3U1DA 5DUKA 4U7BA 4KA4A 2UWMA 4KIBA 1T6SA 4YFNF 5EEHA 4YFXF 4P9FA 2YU3A 3W6JB 1B59A 2B0LA 2PFBA 2X4HA 3BZ6A 5AIQA 1XD7A 1IW7F 3JTGA 4N9IA 1KA8A 4ASNA 2HYGD 3RI4A 3IWFA 4HLXA 3HRMA 2V9VA 4OU0A 1S7AA 2PI0A 5BPIA 4PGHA 4BXUA 3KZYA 2DU9A 3MWMA 1IN8A 3ECHA 1TNSA 4A0ZA 3MZHA 3IKVA 5ED4A 2C6YA 3WTXC 1K78A 2FEZA 5IT3A 3LA3A 5LRRA 2ZMEB 3ZN0A 4WX9A 3J80Z 3U2RA 3K2ZA 2H27A 2D2WA 3MCZA 4HQEA 1ZRCA 1ONVA 2MLGA 1IN4A 2GA1A 4TV7A 4U0YA 2D1VA 2HTJA 1J7KA 2HGCA 2QQBA 1BN5A 1G6NA 2VT3A 2YR2A 1XGNA 4XRFA 3WTSC 3IHUA 2FBKA 2XASA 1E2XA 3GLXA 1K6OA 1XGSA 4O3MA 1XN7A 1U2WA 4I0AA 2ZFWA 4CDGA 2QUFA 1USSA 1WWXA 5FLXZ 2PMHA 1DP7P 3FMQA 2EA4A 4OINF 5LHHA 5LLQA 5HS7A 2XKOA 3ML6A 2RDPA 2F5EA 4GCVA 1UFMA 3K1PA 3ECOA 2KJCA 5JHUA 1S6LA 2MD5A 1J5YA 2ZMEA 4HAMA 2ZBKA 1YFHA 1LDJA 3GYHX 3IRRA 2Z99A 2H09A 4A5MA 3K1NA 4WF2A 5ICFA 1R5GA 5FGMA 1TW2A 5HVQC 1TNTA 2EJRA 1R00A 3DFGA 2K86A 3AAFA 4U0VA 1XSXA 4KN7X 2PG4A 1I1GA 4MQVA 4RB2C 5HDGA 2W84A 5CVVA 1JGSA 2O6GE 3QP5A 1SD7A 4P55A 1OKRA 4XSZF 4WK8F 4HLYA 5CVIA 5D4SA 4AD9A 1IZ1A 1TQIA 1XGOA 4HBLA 3FXRA 5H6RA 2GA2A 3IC7A 4KNYA 2P5KA 3TO6A 1XMKA 5CVJA 2Q8KA 5ICGA 2HZTA 2JSCA 3GUDA 4KT5C 1V3FA 3E6CC 3M7GA 4G7ZF 2HR3A 3EYIA 2BBYA 1RUNA 4O5VA 3CO7C 2DQRA 1BIAA 5E1ZB 4M71A 1FP2A 2P7VB 1W7PB 4RGUA 5L3EA 5LGTA 1VTNC 4HOBA 2EA2A 4MEYF 4I09A 2HDCA 3LA2A 1WI9A 1ZLJA 3QAHA 1Z05A 4RAZA 5TRDA 1D3YA 2L4MA 4EGZA 1JHFA 4LK1F 4G7HF 4LB5A 1QZYA 5LGUA 5DEQA 1OPCA 1XDSA 3NRVA 1WKMA 2CG4A 3J81K 1W7PD 2TDXA 3VEPA 2PLYA 4K2EA 3M8EA 5ERIA 3V7CA 1MKMA 3O6BB 2PMUA 1STZA 3V8JA 3GZ5A 2WWYA 3LQQA 2H6CA 3DPTA 3QP6A 5ICCA 3G3ZA 3SZTA 4YG2F 1JXSA 2RQPA 4ZYHA 1ZREA 4EJTA 5H6QA 2OA4A 4HDVA 4HV5A 3RDIA 1ZYRF 4G8XA 3M9AA 1KU2A 1I27A 3HSEA 4ESFA 3HHHA 2L3DA 1UB9A 1RI7A 1HSJA 1ZARA 3E5XA 3RKYA 1K79A 3K9TA 3WTVC 1CF7B 1DUXC 1JE8A 1F5TA 4HX8A 1REPC 1FYLA 2RGVA 1ON1A 2BE5F 1ULYA 2NS0A 3EDPA 3ZN1A 4EV0A 2J5OA 1SMTA 2W85A 1B9MA 5LGNA 3V8LA 3R4KA 4L5IA 4UV9A 5L3BA 4ESJA 5BS6A 4NB5A 3FMSA 4OMZA 1S3JA 1UCRA 4HV6A 2FU4A 1PP8F 3BOQA 4FT8A 2IP2A 1YS6A 2LKPA 1USTA 4EJUA 2DBBA 4IHTA 4UUVA 1D8JA 3HRUA 1ZGJA 2JTVA 2ZXJA 5D5XB 5E20A 2MBFA 1YIOA 2HKOA 1B6AA 4RGSA 2XRNA 1ZGAA 3F72A 3QU6A 1W5SA 3QOPA 3R61A 4IHSA 4Q47A 1H9GA 3CTAA 1K7AA 2G7UA 1CF7A 4G7OF 2MH2A 3JTHA 3GWZA 1MD0A 4BAYA 1P6RA 1XGMA 2ZKZA 3MZYA 3U9GA 5E8IA 2LSOA 4A5NA 2ZJ2A 2ACJA 1IXRC 1ZAOA 3DP7A 2YX4A 3HRSA 5EEGA 3WU1B 3K1MA 2EB7A 4L9JA 3PQKA 2O8XA 4HQMA 1ZRFA 2R3SA 4XLNF 1AOYA 3WTTC 2ZCWA 3V8KA 1RUOA 2VE8A 3QRFF 1HW1A 2QQ9A 4G6QA 1OYWA 3J80K 3RYRA 2DW4A 1R22A 4B8XA 5BOXA 4R79A 1TTYA 2XIGA 3EUHA 4BQAA 2FA5A 2DPUA 2R7FA 3DQVC 2K7LA 2HEOA 2NNNA 4G6DA 2O0YA 4IXAA 1XCBA 4ENMA 2J5PA 4L9VA 2GQQA 3VODA 1EH7A 1KQ9A 1G3SA 1W4MA 2DI3A 2VC0A 5BMZA 4OIQF 1R36A 5ILUA 1U5TC 3PFIA 1H9TA 2NYXA 3S2WA 4A6DA 4ZYDA 2DPDA 5CVRA 2OD5A 1IF1A 5FLXK 3HSFA 5F64A 3I59A 3GZ6A 3Q5FA 1X3UA 4M72A 5DD8A 1OR7A 1K78B 2ESHA 3ELKA 4EM1A 3HSRA 1ZHFA 1BI2A 1FPQA 2JT1A 3F8CA 4HA8A 3V4GA 2FE3A 3TDUC 4BYYA 1E17A 1I1SA 2FSWA 5L3GA 2E7WA 3ERED 4RB3C 1LEBA 2RNJA 2LNBA 3P9IA 1PP7U 1FSHA 1KQ8A 1U5TB 2LF7A 3WTUC 2E7XA 5A2QZ 4DNCA 3WODF 1IN6A 4IPAA 2L01A 3KP5A 2COMA 2DK5A 4WCGA 2LF8A 3FWEA 1QNTA 3TQNA 3F6OA 1D8KA 5LBQA 2IA1A 4M6YA 3IWZA 5HDKA 3K69A 4IRHA 2CSOA 3MFKA 2CFXA 3NQOA 1R23A 3L2CA 3ISPA 2NRAC 2PJPA 3FMRA 2A6EF 3F6VA 2EV5A 3L9FA 2FBIA 3GW2A 2O03A 4S04A 2XVCA 1FYMA 2HTSA 4Q5SF 4B09A 1SD4A 4GYIA 1ODDA 4GXOA 4M6XA 4OIRF 2BYVE 3RKWA 4KDPA 1U5TA 1HSTA 2XAJA 3LAPA 4RS8A 2E1CA 3ZMUA 1Q1HA 3KLNA 1DPRA 3F23A 3BDDA 5CYVA 4YFKF 3OOPA 3VFZA 4L9NA 2RKHA 1OMIA 3VB2A 1U3EM 1SFEA 4Y17A 1J9IA 5K5RA 2H94A 1DPUA 4I2OA 3FZVA 5HDNA 2QQAA 1B1BA 2QZ8A 4D0PA 2KJBA 1NHAA 2FBHA 1EH6A 3E5QA 1IXSB 2DQLA 3H3UA 2QM3A 2E1NA 1HKTA 4UVBA 1LQ1A 3VOEA 3FX3A 2P6TA 3DPLC 2OQGA 3JAMZ 1U8RA 2ADUA 2EWNA 4ETSA 1BJAA 1QZZA 2DK8A 4QWQA 4MTDA 3WGIA 5DCMB 3DKWA 4AVPA 3GFJA 2P5VA 4AIJA 3KE2A 3ZPLA 2MA3A 1W5TA 2A07F 4IRGA 2OQRA 2ZNYA 3EETA 4YIIA 2P6SA 3F8BA 3MEXA 1RZ4A 1MZBA 3ZQ7A 2VOOA 1IXCA 3F22A 3PQJA 5HLHA 4MHGA 4RGRA 5L3FA 1FX7A 3H92A 5KK1A 3F21A 3HTUA 5HOOA 2VE9A 3CUOA 5H20A 5HLIA 2GWRA 2IW5A 3Q9SA 4E70A 1O3SA 2H6BA 5D5UB 4ENKA 4WXDA 2FRHA 1WSUA 5DV5A 1U78A 3C18A 4M9ZA 1FNNA 2A69F 3Q9VA 5DCMA 3TOAA 2F5DA 1GHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HW0 A;  4G94 A;  1MGT A;  2PEX A;  3ZMT A;  3GX4 X;  5F6F A;  3F8F A;  1D5V A;  3T0Y A;  4KFC A;  2Y0M A;  1P4W A;  4UVA A;  2F2E A;  4WXH A;  1DDN A;  4HZF A;  3E97 A;  4R1H A;  3E6B A;  5E1X A;  3KEO A;  2VON A;  1FWZ A;  3BP8 A;  3FM3 A;  5BQT A;  1SD6 A;  1BM9 A;  4LG0 A;  3WG9 A;  1LDD A;  4KN4 X;  3RJP A;  4UNO A;  2FML A;  4LK0 F;  1V4R A;  2IJL A;  4MEX F;  2FF4 A;  2V79 A;  4AIK A;  5L3C A;  4L9T A;  2V1X A;  5DD4 A;  4LB6 B;  3LWF A;  3HIF A;  1ZLK A;  1R7J A;  2L02 A;  4EMS A;  4A12 A;  3P7N A;  4XSX F;  3FF5 A;  3T8R A;  2CYY A;  2EFW A;  3HOS A;  1SFX A;  2L4A A;  5DCF A;  4PCQ A;  4EM0 B;  1Z6T A;  1QO0 D;  5DUI A;  4LGW A;  1I5Z A;  2STW A;  4LD5 A;  5KVR A;  2XAG A;  2LDU A;  3TKY A;  1KU3 A;  5LEK A;  3E6D A;  4RGX A;  2QEN A;  2OAZ A;  4CZZ A;  1ON2 A;  2Q0O A;  1G3T A;  3KP6 A;  5K5O A;  4LLN A;  1EV7 A;  3ABT A;  1HKS A;  1ZG1 A;  1SMY F;  1QGP A;  4ZYG A;  3CDH A;  1O7F A;  5CLS A;  4BHP A;  2MH9 A;  3IRQ A;  3RYP A;  1FSE A;  3E6M A;  1U6G A;  1S8N A;  1O7L A;  3I64 A;  4Y15 A;  2BEO A;  2R7D A;  2FQ3 A;  1PDN C;  5AON A;  2ELH A;  1QQI A;  2EV0 A;  1SAX A;  5E17 F;  5DDG A;  2V6C A;  2JRT A;  2GIV A;  2EV6 A;  4S05 A;  1T0F A;  5D4R A;  3C3W A;  3CLO A;  2YPR A;  1T2K A;  3C7J A;  2AS5 F;  3TO7 A;  4IRI A;  4LJZ F;  1YQA A;  2RN7 A;  4OMY A;  3M1E A;  2XAQ A;  4EM2 A;  3T5X A;  4P9U A;  2M5W A;  1FYK A;  2P7C B;  2GXB A;  3L09 A;  2JPC A;  1J0R A;  1Z6R A;  4IVN A;  5A2Q K;  3TO9 A;  5D6F A;  5J8C A;  1CGP A;  3I54 A;  1Z7U A;  3IKT A;  3LQR A;  4OIP F;  1TQP A;  3I59 B;  3IL2 A;  3K0L A;  3ZMD A;  1FC3 A;  4U7D A;  4HYE A;  4KUM A;  3HHG A;  4EJW A;  4LLG F;  2VT2 A;  3RPQ A;  3T8T A;  2YX7 A;  4XBF A;  5J6X A;  4FX4 A;  3CUQ C;  3FHZ A;  4Q4Z F;  5HS8 A;  3ABU A;  1FP1 D;  3KP7 A;  4JQF A;  3QPH A;  5IT9 Z;  4KIF A;  2RVC A;  3M8F A;  3DF8 A;  1ZG3 A;  3JSP A;  3FXU A;  4GGG A;  4DQ2 A;  2Q2E A;  2HQN A;  4HF2 A;  2FMY A;  2FNP A;  4MGR A;  1O3R A;  3LST A;  2IT0 A;  3OV8 A;  2ESN A;  1S29 A;  2VN2 A;  5AIP A;  2O61 A;  4U88 A;  3N97 A;  2OZU A;  1T38 A;  2G7H A;  4ZH4 F;  5E18 F;  2P4W A;  2Z9O A;  1G3Y A;  3CUQ B;  3F8N A;  4JK1 X;  1XCV A;  3GFI A;  2Z33 A;  3I4P A;  3BJO A;  3RPU A;  2WTE A;  2KRF A;  4BHB A;  2Z3Y A;  1TBX A;  3WTZ A;  3WE2 A;  2IRF G;  5L3D A;  1GXP A;  4GO1 A;  1FBS A;  1LDK B;  2KIF A;  2JZY A;  2KKO A;  2P5L C;  3WTY C;  4JBA A;  3MAJ A;  3JAM K;  4A6E A;  2K02 A;  3BRO A;  1RIO H;  5LHG A;  4PDK A;  2CQK A;  3KP2 A;  5LRS A;  1YG2 A;  2KIM A;  3JSO A;  1XB4 A;  3I53 A;  2W25 A;  2O3F A;  3P9K A;  2XHK A;  4PGG A;  1KYW A;  4LLL A;  1WQ2 A;  2EFP A;  3RKX A;  1QPM A;  3KZZ A;  3E3V A;  1XDU A;  2UXN A;  1QBJ A;  3CUQ A;  4M74 A;  4UHT A;  3HUG A;  2STT A;  4ON0 A;  3KP3 A;  2ZO4 A;  1OYI A;  4UV8 A;  2GAU A;  1LB2 A;  1L3L A;  1G3W A;  1IAW A;  1GXQ A;  2EFQ A;  1BI1 A;  1GVJ A;  4ZYE A;  5ILV A;  5FFZ A;  1BI3 A;  1YYV A;  4CIC A;  1SD5 A;  4ZZL A;  2EFO A;  6PAX A;  3ROU A;  2M1B A;  3L7W A;  1HW2 A;  1KQ0 A;  2M45 A;  2W24 A;  1HXD A;  3GFL A;  2P8T A;  2MC3 A;  3GF2 A;  2K4B A;  2QWW A;  4I98 B;  5FFX A;  2XKP A;  3E5U A;  3LFK A;  2AXL A;  3D0S A;  3BPX A;  3SQN A;  3V7R A;  4P96 A;  2F5C A;  1YW8 A;  1R1U A;  4I01 A;  2UXX A;  1TQM A;  2A6H F;  2EFN A;  5K1Y A;  3SHF A;  4L0Y B;  3TOB A;  4L5J A;  1FT9 A;  4RB1 A;  4NHJ A;  1WRJ A;  1OYY A;  5D8K B;  3V7S A;  3R0A A;  2XAH A;  3F3X A;  4MNU A;  1FLI A;  3N4M A;  2D45 A;  1TLH B;  3B73 A;  3DEU A;  3W6K B;  1IN7 A;  4N9H A;  5CJ9 A;  1L0O C;  1AWC A;  4OIO F;  1C0W A;  1BIB A;  2OU2 A;  1IN5 A;  1BC7 C;  3KEQ A;  2XGX A;  4HF0 A;  1SFU A;  4ZZD A;  1FZP B;  1B9N A;  4Q48 A;  1ZN2 A;  4BH9 A;  1P4A A;  4KIG A;  4IJA A;  3LAJ A;  4H0E A;  1Z1D A;  5FB2 A;  1BC8 C;  2BV6 A;  3WE3 A;  3R60 A;  1JHH A;  3DXJ F;  3CJN A;  3TDZ C;  1XSV A;  4I7H A;  4CXF A;  3GO5 A;  4M9S A;  5E1W A;  3NEU A;  4LG0 B;  1Z91 A;  3JW4 A;  1J2X A;  2A68 F;  5JVT A;  1J59 A;  3CO6 C;  2QBY B;  1YO5 C;  1O57 A;  4RAY A;  3H3Z A;  4I02 A;  1FY7 A;  1LVA A;  4HX7 A;  3GXO A;  2PQ8 A;  3SZP A;  3BY6 A;  1XMA A;  1F4K A;  2XAF A;  5J8F A;  2Y75 A;  2IA0 A;  2PBI A;  2FOK A;  2ISZ A;  2A3S A;  1T39 A;  5K5Q A;  3BPV A;  1PUE E;  1P92 A;  2DT5 A;  1HKQ A;  2GZW A;  2A5Y B;  2QVO A;  1ZRD A;  1B4A A;  4EJO A;  1ZH5 A;  3J7A O;  2CO5 A;  2WC2 A;  1EH8 A;  4CYD A;  2VOD A;  4A0Y A;  2CWE A;  1O3T A;  1LEA A;  4IF4 A;  1MDM B;  2VOP A;  4HX4 A;  4R8H A;  5ICE A;  5JFR A;  2WV0 A;  4UVC A;  4EVI A;  2QBY A;  1FBU A;  1BBY A;  3ZMS A;  2X0L A;  1IRG A;  4AIH A;  1W7P A;  4A2U A;  4HDU A;  2FNA A;  5F1R A;  3R0J A;  2NAZ A;  2IVM A;  2K4J A;  2JPB A;  3L00 A;  1J75 A;  4M73 A;  5JR3 A;  4YIF A;  2M8E A;  2MLK A;  2Y48 A;  4RB0 A;  1LNW A;  4ESB A;  1G4D A;  3ZP5 A;  1KU9 A;  2GXG A;  5IT9 K;  4P5O A;  4GYG A;  4AWX B;  4L18 B;  2XUB A;  3KFW X;  2KIU A;  5FD6 A;  3KP4 A;  5D6E A;  3MQ0 A;  4U0W A;  1XSD A;  4KIC A;  1KU7 A;  2F5F A;  1F1Z A;  4CO8 A;  2EK5 A;  2G9W A;  5FD5 A;  2D1H A;  1F9N A;  1MDM A;  2VXZ A;  1S7O A;  1MJB A;  2YSR A;  1YW7 A;  4A0X A;  1TW3 A;  3KLO A;  3O2P E;  4LMY A;  4QLC U;  2HYF A;  2IA2 A;  2V1D A;  1BOA A;  3DV8 A;  5CVU A;  2W57 A;  4UXN A;  1A04 A;  2ZNZ A;  4OOI A;  1HBX G;  4F7Z A;  1KGS A;  2DLL A;  2K27 A;  2VBW A;  3KCC A;  3TGN A;  5JI6 A;  1I6X A;  5D8L B;  1MJA A;  2VBY A;  4PZJ A;  1T98 A;  5FO5 A;  2BGC A;  4KMF A;  3I0T A;  1R5H A;  1KYZ A;  2HWV A;  1IRF A;  5D5V B;  3ZMZ A;  3RIR A;  1FBQ A;  3WGH A;  2OZ6 A;  3R6S A;  2DO7 A;  3FM5 A;  3EQL F;  2RC4 A;  2DAO A;  2Z5U A;  2ISY A;  3P9C A;  3BWG A;  4FHT A;  3I58 A;  3BJ6 A;  5D5W B;  2IPQ X;  3J81 Z;  1P2F A;  5DYM A;  5E8G A;  1O3Q A;  1UHM A;  1UHW A;  3GVA A;  4CHU A;  2XV4 S;  2CW0 F;  1LJ9 A;  1P4X A;  1IUY A;  1Y0U A;  2PN6 A;  3O3K A;  3G73 A;  4M9X A;  3HOT A;  2DTR A;  1YLF A;  2NNY A;  1YS7 A;  2A61 A;  4KMU X;  4EQQ A;  1Z9C A;  4O6J A;  3COA C;  4EGY A;  5TJJ A;  4WWC A;  4HF1 A;  2M30 A;  1YTY A;  2OBP A;  1H0M A;  4G9Y A;  3FXQ A;  3HYI A;  2HOE A;  4BHC A;  2HQR A;  5BPD A;  4XLP F;  4ENN A;  1HQC A;  4KYW A;  5HS9 A;  2XRO A;  2DFI A;  3D5L A;  2ETH A;  2HFH A;  3F8M A;  3SFZ A;  3WTW C;  4CGZ A;  1RNL A;  4LFU A;  2HKX A;  4L0Z B;  4MQ9 F;  4FX0 A;  1YW9 A;  3ULQ B;  3KET A;  3C1D A;  1ZG5 A;  1HW5 A;  3LA7 A;  4ENJ A;  3WGG A;  4Z2Y A;  2FXA A;  5HLG A;  1MJ9 A;  4BNC A;  3I71 A;  3RTR A;  4WXC A;  4EJV A;  2L54 A;  2QYO A;  3EYY A;  4I0B A;  3B02 A;  3SXY A;  2QLZ A;  3WU0 A;  3ZMV A;  3I5U A;  5ILS A;  2VBX A;  1R58 A;  2CGP A;  4N0B A;  2V1U A;  3T1B A;  3QU3 A;  4Y13 A;  5LEJ A;  3HRT A;  5LHI A;  1R1V A;  2UZK A;  3GFM A;  4NQW A;  2VC1 A;  2HS5 A;  1FOK A;  3GEZ A;  1R1T A;  1BI0 A;  2RV8 A;  3BJA A;  2M87 A;  3REO A;  4MTE A;  2VBZ A;  3HTS B;  3QPT A;  3U1D A;  5DUK A;  4U7B A;  4KA4 A;  2UWM A;  4KIB A;  1T6S A;  4YFN F;  5EEH A;  4YFX F;  4P9F A;  2YU3 A;  3W6J B;  1B59 A;  2B0L A;  2PFB A;  2X4H A;  3BZ6 A;  5AIQ A;  1XD7 A;  1IW7 F;  3JTG A;  4N9I A;  1KA8 A;  4ASN A;  2HYG D;  3RI4 A;  3IWF A;  4HLX A;  3HRM A;  2V9V A;  4OU0 A;  1S7A A;  2PI0 A;  5BPI A;  4PGH A;  4BXU A;  3KZY A;  2DU9 A;  3MWM A;  1IN8 A;  3ECH A;  1TNS A;  4A0Z A;  3MZH A;  3IKV A;  5ED4 A;  2C6Y A;  3WTX C;  1K78 A;  2FEZ A;  5IT3 A;  3LA3 A;  5LRR A;  2ZME B;  3ZN0 A;  4WX9 A;  3J80 Z;  3U2R A;  3K2Z A;  2H27 A;  2D2W A;  3MCZ A;  4HQE A;  1ZRC A;  1ONV A;  2MLG A;  1IN4 A;  2GA1 A;  4TV7 A;  4U0Y A;  2D1V A;  2HTJ A;  1J7K A;  2HGC A;  2QQB A;  1BN5 A;  1G6N A;  2VT3 A;  2YR2 A;  1XGN A;  4XRF A;  3WTS C;  3IHU A;  2FBK A;  2XAS A;  1E2X A;  3GLX A;  1K6O A;  1XGS A;  4O3M A;  1XN7 A;  1U2W A;  4I0A A;  2ZFW A;  4CDG A;  2QUF A;  1USS A;  1WWX A;  5FLX Z;  2PMH A;  1DP7 P;  3FMQ A;  2EA4 A;  4OIN F;  5LHH A;  5LLQ A;  5HS7 A;  2XKO A;  3ML6 A;  2RDP A;  2F5E A;  4GCV A;  1UFM A;  3K1P A;  3ECO A;  2KJC A;  5JHU A;  1S6L A;  2MD5 A;  1J5Y A;  2ZME A;  4HAM A;  2ZBK A;  1YFH A;  1LDJ A;  3GYH X;  3IRR A;  2Z99 A;  2H09 A;  4A5M A;  3K1N A;  4WF2 A;  5ICF A;  1R5G A;  5FGM A;  1TW2 A;  5HVQ C;  1TNT A;  2EJR A;  1R00 A;  3DFG A;  2K86 A;  3AAF A;  4U0V A;  1XSX A;  4KN7 X;  2PG4 A;  1I1G A;  4MQV A;  4RB2 C;  5HDG A;  2W84 A;  5CVV A;  1JGS A;  2O6G E;  3QP5 A;  1SD7 A;  4P55 A;  1OKR A;  4XSZ F;  4WK8 F;  4HLY A;  5CVI A;  5D4S A;  4AD9 A;  1IZ1 A;  1TQI A;  1XGO A;  4HBL A;  3FXR A;  5H6R A;  2GA2 A;  3IC7 A;  4KNY A;  2P5K A;  3TO6 A;  1XMK A;  5CVJ A;  2Q8K A;  5ICG A;  2HZT A;  2JSC A;  3GUD A;  4KT5 C;  1V3F A;  3E6C C;  3M7G A;  4G7Z F;  2HR3 A;  3EYI A;  2BBY A;  1RUN A;  4O5V A;  3CO7 C;  2DQR A;  1BIA A;  5E1Z B;  4M71 A;  1FP2 A;  2P7V B;  1W7P B;  4RGU A;  5L3E A;  5LGT A;  1VTN C;  4HOB A;  2EA2 A;  4MEY F;  4I09 A;  2HDC A;  3LA2 A;  1WI9 A;  1ZLJ A;  3QAH A;  1Z05 A;  4RAZ A;  5TRD A;  1D3Y A;  2L4M A;  4EGZ A;  1JHF A;  4LK1 F;  4G7H F;  4LB5 A;  1QZY A;  5LGU A;  5DEQ A;  1OPC A;  1XDS A;  3NRV A;  1WKM A;  2CG4 A;  3J81 K;  1W7P D;  2TDX A;  3VEP A;  2PLY A;  4K2E A;  3M8E A;  5ERI A;  3V7C A;  1MKM A;  3O6B B;  2PMU A;  1STZ A;  3V8J A;  3GZ5 A;  2WWY A;  3LQQ A;  2H6C A;  3DPT A;  3QP6 A;  5ICC A;  3G3Z A;  3SZT A;  4YG2 F;  1JXS A;  2RQP A;  4ZYH A;  1ZRE A;  4EJT A;  5H6Q A;  2OA4 A;  4HDV A;  4HV5 A;  3RDI A;  1ZYR F;  4G8X A;  3M9A A;  1KU2 A;  1I27 A;  3HSE A;  4ESF A;  3HHH A;  2L3D A;  1UB9 A;  1RI7 A;  1HSJ A;  1ZAR A;  3E5X A;  3RKY A;  1K79 A;  3K9T A;  3WTV C;  1CF7 B;  1DUX C;  1JE8 A;  1F5T A;  4HX8 A;  1REP C;  1FYL A;  2RGV A;  1ON1 A;  2BE5 F;  1ULY A;  2NS0 A;  3EDP A;  3ZN1 A;  4EV0 A;  2J5O A;  1SMT A;  2W85 A;  1B9M A;  5LGN A;  3V8L A;  3R4K A;  4L5I A;  4UV9 A;  5L3B A;  4ESJ A;  5BS6 A;  4NB5 A;  3FMS A;  4OMZ A;  1S3J A;  1UCR A;  4HV6 A;  2FU4 A;  1PP8 F;  3BOQ A;  4FT8 A;  2IP2 A;  1YS6 A;  2LKP A;  1UST A;  4EJU A;  2DBB A;  4IHT A;  4UUV A;  1D8J A;  3HRU A;  1ZGJ A;  2JTV A;  2ZXJ A;  5D5X B;  5E20 A;  2MBF A;  1YIO A;  2HKO A;  1B6A A;  4RGS A;  2XRN A;  1ZGA A;  3F72 A;  3QU6 A;  1W5S A;  3QOP A;  3R61 A;  4IHS A;  4Q47 A;  1H9G A;  3CTA A;  1K7A A;  2G7U A;  1CF7 A;  4G7O F;  2MH2 A;  3JTH A;  3GWZ A;  1MD0 A;  4BAY A;  1P6R A;  1XGM A;  2ZKZ A;  3MZY A;  3U9G A;  5E8I A;  2LSO A;  4A5N A;  2ZJ2 A;  2ACJ A;  1IXR C;  1ZAO A;  3DP7 A;  2YX4 A;  3HRS A;  5EEG A;  3WU1 B;  3K1M A;  2EB7 A;  4L9J A;  3PQK A;  2O8X A;  4HQM A;  1ZRF A;  2R3S A;  4XLN F;  1AOY A;  3WTT C;  2ZCW A;  3V8K A;  1RUO A;  2VE8 A;  3QRF F;  1HW1 A;  2QQ9 A;  4G6Q A;  1OYW A;  3J80 K;  3RYR A;  2DW4 A;  1R22 A;  4B8X A;  5BOX A;  4R79 A;  1TTY A;  2XIG A;  3EUH A;  4BQA A;  2FA5 A;  2DPU A;  2R7F A;  3DQV C;  2K7L A;  2HEO A;  2NNN A;  4G6D A;  2O0Y A;  4IXA A;  1XCB A;  4ENM A;  2J5P A;  4L9V A;  2GQQ A;  3VOD A;  1EH7 A;  1KQ9 A;  1G3S A;  1W4M A;  2DI3 A;  2VC0 A;  5BMZ A;  4OIQ F;  1R36 A;  5ILU A;  1U5T C;  3PFI A;  1H9T A;  2NYX A;  3S2W A;  4A6D A;  4ZYD A;  2DPD A;  5CVR A;  2OD5 A;  1IF1 A;  5FLX K;  3HSF A;  5F64 A;  3I59 A;  3GZ6 A;  3Q5F A;  1X3U A;  4M72 A;  5DD8 A;  1OR7 A;  1K78 B;  2ESH A;  3ELK A;  4EM1 A;  3HSR A;  1ZHF A;  1BI2 A;  1FPQ A;  2JT1 A;  3F8C A;  4HA8 A;  3V4G A;  2FE3 A;  3TDU C;  4BYY A;  1E17 A;  1I1S A;  2FSW A;  5L3G A;  2E7W A;  3ERE D;  4RB3 C;  1LEB A;  2RNJ A;  2LNB A;  3P9I A;  1PP7 U;  1FSH A;  1KQ8 A;  1U5T B;  2LF7 A;  3WTU C;  2E7X A;  5A2Q Z;  4DNC A;  3WOD F;  1IN6 A;  4IPA A;  2L01 A;  3KP5 A;  2COM A;  2DK5 A;  4WCG A;  2LF8 A;  3FWE A;  1QNT A;  3TQN A;  3F6O A;  1D8K A;  5LBQ A;  2IA1 A;  4M6Y A;  3IWZ A;  5HDK A;  3K69 A;  4IRH A;  2CSO A;  3MFK A;  2CFX A;  3NQO A;  1R23 A;  3L2C A;  3ISP A;  2NRA C;  2PJP A;  3FMR A;  2A6E F;  3F6V A;  2EV5 A;  3L9F A;  2FBI A;  3GW2 A;  2O03 A;  4S04 A;  2XVC A;  1FYM A;  2HTS A;  4Q5S F;  4B09 A;  1SD4 A;  4GYI A;  1ODD A;  4GXO A;  4M6X A;  4OIR F;  2BYV E;  3RKW A;  4KDP A;  1U5T A;  1HST A;  2XAJ A;  3LAP A;  4RS8 A;  2E1C A;  3ZMU A;  1Q1H A;  3KLN A;  1DPR A;  3F23 A;  3BDD A;  5CYV A;  4YFK F;  3OOP A;  3VFZ A;  4L9N A;  2RKH A;  1OMI A;  3VB2 A;  1U3E M;  1SFE A;  4Y17 A;  1J9I A;  5K5R A;  2H94 A;  1DPU A;  4I2O A;  3FZV A;  5HDN A;  2QQA A;  1B1B A;  2QZ8 A;  4D0P A;  2KJB A;  1NHA A;  2FBH A;  1EH6 A;  3E5Q A;  1IXS B;  2DQL A;  3H3U A;  2QM3 A;  2E1N A;  1HKT A;  4UVB A;  1LQ1 A;  3VOE A;  3FX3 A;  2P6T A;  3DPL C;  2OQG A;  3JAM Z;  1U8R A;  2ADU A;  2EWN A;  4ETS A;  1BJA A;  1QZZ A;  2DK8 A;  4QWQ A;  4MTD A;  3WGI A;  5DCM B;  3DKW A;  4AVP A;  3GFJ A;  2P5V A;  4AIJ A;  3KE2 A;  3ZPL A;  2MA3 A;  1W5T A;  2A07 F;  4IRG A;  2OQR A;  2ZNY A;  3EET A;  4YII A;  2P6S A;  3F8B A;  3MEX A;  1RZ4 A;  1MZB A;  3ZQ7 A;  2VOO A;  1IXC A;  3F22 A;  3PQJ A;  5HLH A;  4MHG A;  4RGR A;  5L3F A;  1FX7 A;  3H92 A;  5KK1 A;  3F21 A;  3HTU A;  5HOO A;  2VE9 A;  3CUO A;  5H20 A;  5HLI A;  2GWR A;  2IW5 A;  3Q9S A;  4E70 A;  1O3S A;  2H6B A;  5D5U B;  4ENK A;  4WXD A;  2FRH A;  1WSU A;  5DV5 A;  1U78 A;  3C18 A;  4M9Z A;  1FNN A;  2A69 F;  3Q9V A;  5DCM A;  3TOA A;  2F5D A;  1GHC A; 
#chains in the Genus database with same CATH topology
 2AO9 A;  2VQG A;  4G94 A;  1MGT A;  1LUJ B;  1D0X A;  2PEX A;  4HW0 A;  3ZMT A;  3GX4 X;  2EZL A;  5F6F A;  3F8F A;  3A02 A;  1D5V A;  1JKP C;  3BTI A;  3T0Y A;  4KFC A;  5GAG J;  2Y0M A;  3PSI A;  1P4W A;  1EA3 A;  3OR2 C;  4UVA A;  4A3K J;  2F2E A;  4B48 A;  3JRE A;  1LE8 A;  2WB1 A;  1T0F C;  1T33 A;  4BJ5 C;  5DS9 A;  4WXH A;  4I6Z A;  4ANJ A;  1DDN A;  2NVQ J;  4HZF A;  3C2G A;  2K9Q A;  2IS6 A;  3BC8 A;  5CPR B;  1FJL A;  2KDO A;  3E97 A;  2IXS A;  4R1H A;  3E6B A;  5E1X A;  3JRI A;  3OYN A;  3KEO A;  1LFB A;  2VON A;  1FWZ A;  2QKM B;  3BP8 A;  3FM3 A;  5EF6 A;  5BQT A;  2LFB A;  5DM6 F;  1SD6 A;  1BM9 A;  4LG0 A;  2M9H A;  3WG9 A;  2Z1D A;  1LDD A;  2R7S A;  3K4N A;  4KN4 X;  3RJP A;  4JYK A;  4UNO A;  2FML A;  4LK0 F;  3HGY A;  1JI8 A;  1R6R A;  3H5N A;  1BJZ A;  2O5R A;  1V4R A;  2IJL A;  4MEX F;  2FF4 A;  2V79 A;  4AIK A;  1BA5 A;  2EIN H;  4CCK A;  3TL4 X;  4E7J A;  5L3C A;  3BG9 A;  3OL4 A;  3CLQ A;  3G1O A;  4L9T A;  1KZH A;  2V1X A;  2HPM A;  5DD4 A;  4LB6 B;  3LWF A;  2X85 A;  3HIF A;  1ZLK A;  1SEU A;  3RZD J;  2ZC2 A;  1R7J A;  2L02 A;  4PUS A;  4RM2 A;  4EMS A;  4A12 A;  3P7N A;  3NAU A;  5J1R A;  5KNL A;  4XSX F;  3FF5 A;  5EZH A;  5GP9 A;  3TMO A;  3A0B C;  3T8R A;  3CES A;  2CYY A;  1TWA J;  2EFW A;  1FIP A;  2VXD A;  3HOS A;  1SFX A;  2L4A A;  3HKZ N;  3KYL A;  4IOC F;  5KCM A;  5DCF A;  4PCQ A;  1NK2 P;  4EM0 B;  1Z6T A;  1QO0 D;  4H4K C;  5DUI A;  4LGW A;  1I5Z A;  2STW A;  4LD5 A;  1OQY A;  1V5F A;  3S1R J;  3D1N I;  5KVR A;  2XAG A;  2BW3 B;  2LDU A;  3TKY A;  1KU3 A;  4HNT A;  5LEK A;  3E6D A;  2Y0S A;  3NAR A;  4RGX A;  4JX4 A;  1YIJ I;  3ABK H;  2QEN A;  2OAZ A;  2FX0 A;  4CZZ A;  1ON2 A;  4DYQ A;  4XOT A;  1WVR A;  2Q0O A;  1G3T A;  1TWF J;  1UG2 A;  1X4P A;  3KP6 A;  5K5O A;  4LLN A;  1EV7 A;  3ABT A;  5B1B H;  1HKS A;  1ZG1 A;  1SMY F;  1QGP A;  4ZYG A;  4BBR J;  2RAE A;  4MLO A;  5TGT A;  4E7H A;  1QHG A;  4AUX A;  3CDH A;  1O7F A;  1Y6I A;  2MG4 A;  2VL8 A;  5CLS A;  4BHP A;  2MD0 A;  2MH9 A;  1Y8Q B;  3IRQ A;  3RYP A;  1FSE A;  4B47 A;  4A3E J;  3E6M A;  1U6G A;  1IRX A;  4GFB A;  2JWT A;  5IPA A;  1S8N A;  1O7L A;  3I64 A;  4Y15 A;  1W36 C;  2BEO A;  1YIT I;  2R7D A;  5DTD A;  3K2A A;  4UUT A;  2FQ3 A;  2ME6 A;  1PDN C;  5AON A;  3K6G A;  4AYB N;  1JTX A;  1BR2 A;  2ELH A;  1F36 A;  4DBQ A;  4IEJ A;  4B44 A;  5F0H A;  3OYJ A;  4FCY A;  3HOX J;  1QQI A;  2EV0 A;  4D5C A;  1SAX A;  5E17 F;  5DDG A;  3DBH B;  2V6C A;  2QQ8 A;  2JRT A;  2GIV A;  2Y30 A;  2EV6 A;  4S05 A;  1T0F A;  3BR0 A;  1T08 B;  5D4R A;  3C3W A;  2QSF X;  3CLO A;  2YPR A;  1T2K A;  1U0J A;  1MH4 A;  4MIM A;  3C7J A;  3CCE I;  4ZTJ A;  3TO7 A;  1O4X A;  2AS5 F;  4IRI A;  2KPM A;  2VQC A;  4LJZ F;  3X2Q H;  2CS3 A;  5LFA A;  4UUS B;  1YQA A;  2RN7 A;  1R4N B;  3M1E A;  4OMY A;  2XAQ A;  2BY1 A;  4EM2 A;  3T5X A;  5HLT A;  1HCR A;  5EZG A;  2Q2E B;  4P9U A;  1VQL I;  2KIS A;  2M5W A;  1X19 A;  1FYK A;  1TWG J;  3FXL A;  2DFH A;  1X1D A;  3OYG A;  2P7C B;  2DOD A;  5M5W J;  3BTJ A;  3C2B A;  1GT0 C;  2CUF A;  2BVL A;  2GXB A;  3L09 A;  3I4M J;  3FKI J;  4BE2 A;  2VJ5 A;  3MD2 A;  2JPC A;  1WI3 A;  3BZK A;  1J0R A;  1Z6R A;  2O9L A;  3G1M A;  4IVN A;  1I3Q J;  3TO9 A;  5D6F A;  5A2Q K;  5J8C A;  3AL0 C;  5EGO B;  4DZP A;  3GTM J;  1CGP A;  4NC6 A;  5IOY A;  3I54 A;  4F55 A;  1Z7U A;  3IKT A;  4QTR A;  3LQR A;  4OIP F;  1TQP A;  3I59 B;  2CU7 A;  3IL2 A;  3I4N J;  3K0L A;  1XMX A;  2MAB A;  3ZMD A;  3I55 I;  1FC3 A;  4U7D A;  4PJL A;  4HYE A;  4KUM A;  3HHG A;  2DA4 A;  4EJW A;  2JA6 J;  4LLG F;  2VT2 A;  3RPQ A;  3T8T A;  3HXL A;  2YX7 A;  2LLK A;  4XBF A;  5J6X A;  2ICW G;  4FX4 A;  4X1E A;  3CUQ C;  3FHZ A;  4Q4Z F;  5HS8 A;  3ABU A;  1FP1 D;  4IL6 C;  2NS8 A;  3KP7 A;  4A3D J;  4JQF A;  3AFH A;  3QPH A;  2HDD A;  5E3N A;  5H2F C;  2IGK A;  5IT9 Z;  4KIF A;  2RVC A;  4IX7 A;  2BY3 A;  3M8F A;  4V2G A;  1TC3 C;  4BBS J;  3K4L A;  3DF8 A;  1Z3Y A;  2HOS A;  1RET A;  4UY8 I;  1ZG3 A;  3DTK A;  3JSP A;  1DU0 A;  1IV8 A;  2DFF A;  3FXU A;  4J00 A;  2XGD A;  3S1Q J;  4GGG A;  4II3 A;  2KIQ A;  4Y7N J;  4BJ6 C;  1ITY A;  4DQ2 A;  2WA0 A;  5FRM A;  3BTC A;  1WH7 A;  2QGU A;  2Q2E A;  2L7M P;  2HQN A;  4ABZ A;  2R5Z B;  4HF2 A;  2CFO A;  2OJE D;  2FMY A;  2FNP A;  2V7F A;  3AL0 B;  2I8D A;  2XPV A;  2X6O A;  4MGR A;  1O3R A;  5HNF A;  3KPH A;  4GDF A;  3AKZ A;  3LST A;  3ASN H;  2IT0 A;  3OV8 A;  4A3M J;  5EGO A;  2ESN A;  1S29 A;  2EQR A;  2VN2 A;  1Y8R B;  5AIP A;  2O61 A;  4U88 A;  3N97 A;  2DN0 A;  3CP2 A;  4RLF A;  2OZU A;  2Z2S B;  3LL7 A;  5IP7 J;  1T38 A;  5FLM J;  2G7H A;  4ZH4 F;  3G4S I;  2IS4 A;  2GM4 A;  2RRE A;  1WJD A;  1ZEL A;  5E18 F;  2P4W A;  2Z9O A;  1G3Y A;  3CUQ B;  3F8N A;  4JK1 X;  5CQE A;  2GOX B;  3HUG B;  2LY9 A;  3CP8 A;  1XCV A;  2R7V A;  3QPL A;  3GFI A;  2WAD A;  3KZI C;  2Z33 A;  3I4P A;  2EH3 A;  4PSW A;  2LY2 A;  3BJO A;  3RPU A;  2WTE A;  1CQT A;  1ZR2 A;  3O8H A;  1JT0 A;  2KRF A;  3DKX A;  2HVS A;  2JQ7 A;  3I56 I;  2IAI A;  2Z3Y A;  4BHB A;  2EIM H;  1EKE A;  3K4K A;  1TBX A;  3MKY B;  3WTZ A;  1WJ5 A;  3BR2 A;  2DA3 A;  2VKV A;  3KX2 A;  5L3D A;  3WE2 A;  2DA2 A;  4GO1 A;  4C9Y A;  3OYK A;  1GXP A;  2LD5 A;  2IRF G;  4NC7 A;  2UV1 A;  4DYR A;  3ZRG A;  2B9S A;  4CCO A;  1FBS A;  4B43 A;  1LDK B;  2KIF A;  2JZY A;  4B3A A;  2KKO A;  2P5L C;  3OYB A;  3WTY C;  4BL0 B;  4L5E A;  3CD6 I;  4JBA A;  3MAJ A;  3JAM K;  4A6E A;  1MMA A;  2K02 A;  1S72 I;  3BRO A;  1RIO H;  3MKL A;  5FRO A;  2R5Z A;  3BLY A;  5LHG A;  4PDK A;  3SDG A;  1ACI A;  3H9G A;  2CQK A;  3KP2 A;  5LRS A;  2MYS A;  1AA7 A;  3TP0 A;  1YG2 A;  2KIM A;  3JSO A;  3FXJ A;  3DU5 A;  1MBH A;  3PO3 J;  2V26 A;  4BUP A;  1XB4 A;  3I53 A;  3D5S C;  2W25 A;  2O3F A;  3P9K A;  2XHK A;  4ITV A;  1H89 C;  2Q1Z B;  3OIP A;  5B1A H;  3SDB A;  4PGG A;  1KYW A;  4LLL A;  1WQ2 A;  2EFP A;  1NH3 A;  3BTL A;  3OY9 A;  4PK4 A;  1WCM J;  1NG6 A;  3RKX A;  1UAA A;  1QPM A;  3KZZ A;  3OS0 A;  1IO2 A;  1XDU A;  1XX5 A;  3E3V A;  4BQN A;  2UXN A;  5JVG F;  4A69 C;  1QBJ A;  3CUQ A;  4M74 A;  4UHT A;  3HUG A;  2STT A;  3ABL H;  4ON0 A;  2TCT A;  3MVP A;  3KP3 A;  2DOF A;  4XON A;  3G71 I;  2ZO4 A;  3DBL B;  3OIO A;  1OYI A;  4UV8 A;  1YOV B;  2GAU A;  3CC2 I;  1LB2 A;  3CDI A;  1L3L A;  5FKL A;  4A3C J;  4I76 A;  1G3W A;  2K9N A;  1TP4 A;  2DMQ A;  3HL2 A;  2LVS A;  3CJQ B;  1MBF A;  2W1O A;  1IAW A;  1GXQ A;  2EFQ A;  2DDA A;  5F27 A;  3S2D J;  1BI1 A;  3JRG A;  1PUF B;  1GVJ A;  3MKW B;  4ZYE A;  3CC4 I;  3W6V A;  5ILV A;  3RQ4 A;  5FFZ A;  1BI3 A;  1YYV A;  1D0Z A;  1SD5 A;  4CIC A;  2VKE A;  1MSE C;  5FJ8 J;  3MN2 A;  4ZZL A;  2EFO A;  4C3J J;  3VYR B;  6PAX A;  1A36 A;  2JUG A;  1OJL A;  3ROU A;  2M1B A;  3L7W A;  1HW2 A;  1KQ0 A;  2B63 J;  2M45 A;  2W24 A;  2ZXW H;  1HC8 A;  1HXD A;  4XN0 A;  3GTL J;  3GFL A;  2P8T A;  2MC3 A;  3GF2 A;  2K4B A;  2QWW A;  4I98 B;  1K61 A;  2OTL I;  2FD5 A;  2XKP A;  5FFX A;  1YJ9 I;  1PYV A;  1ETY A;  3E5U A;  2MFZ A;  2ZXH A;  3LFK A;  3CDL A;  2AXL A;  2KFD A;  3D0S A;  3PIO F;  1HOM A;  3LNQ A;  3BPX A;  3SQN A;  3V7R A;  3BT9 A;  4P96 A;  2F5C A;  1YW8 A;  1R1U A;  2M8G X;  2AQE A;  4I01 A;  1A35 A;  2UXX A;  1TQM A;  2A6H F;  1OCZ H;  1GV2 A;  1MMD A;  1ETQ A;  4E7Z A;  3L2R A;  1Z0X A;  3DTI A;  2CMP A;  3UKG A;  3BG3 A;  2BY0 A;  1Y39 A;  1Z77 A;  4G12 A;  2EFN A;  5K1Y A;  3LMM A;  1Q1V A;  2VI6 A;  3SHF A;  1VQ6 I;  4L0Y B;  3ABM H;  3TOB A;  4L5J A;  1FT9 A;  4RB1 A;  4NHJ A;  1WRJ A;  1MMN A;  2KLO A;  1HDP A;  1OYY A;  2KP6 A;  5D8K B;  3V7S A;  1I6H J;  3R0A A;  2XAH A;  3F3X A;  2HI3 A;  4MNU A;  1FLI A;  3N4M A;  3BR5 A;  2D45 A;  1TLH B;  2F4I A;  2NOJ B;  5HNH A;  3B73 A;  3DEU A;  3W6K B;  1IN7 A;  4N9H A;  2GBY A;  1GUU A;  5CJ9 A;  1X2M A;  2ZFU A;  2CV1 A;  1L0O C;  2N8G A;  1AWC A;  3JRH A;  3QYB A;  4OIO F;  1LFP A;  1C0W A;  2XSJ C;  5C44 J;  4DW6 A;  1BIB A;  2JA8 J;  3FK7 A;  2OU2 A;  1IN5 A;  1BC7 C;  3KEQ A;  2P0W A;  2XGX A;  2M0C A;  4HF0 A;  3S3O A;  1SFU A;  4FET A;  4ZZD A;  3H5R A;  3JRD A;  1FZP B;  2DMT A;  4BDZ A;  2V1N A;  4B1R A;  1B9N A;  4Q48 A;  1B72 A;  1IDZ A;  1ZN2 A;  4BH9 A;  1IG7 A;  1P4A A;  4KIG A;  2X48 A;  4IJA A;  3LAJ A;  1Z1D A;  4D1Q A;  4H0E A;  5FB2 A;  1LE8 B;  1BC8 C;  2JA7 J;  2BV6 A;  3WE3 A;  5K7Z A;  3R60 A;  3ZQC A;  3OYM A;  4A3J J;  1JHH A;  3DXJ F;  4YEL A;  5IYC J;  3PUF A;  3CJN A;  5F08 A;  3TDZ C;  1XSV A;  1EF4 A;  2L7Z A;  3TED A;  4I7H A;  4CXF A;  3GO5 A;  4XKV A;  4M9S A;  5E1W A;  3NEU A;  4LG0 B;  2DA5 A;  1UMQ A;  1Z91 A;  3DWL E;  3JW4 A;  2A6T A;  4BY1 J;  4RM3 A;  4C2T A;  2LKS A;  1J2X A;  1A6Q A;  3K4M A;  2NS7 A;  2A68 F;  3ZR8 X;  5JVT A;  1LVK A;  1J59 A;  3CO6 C;  4A3I J;  3IAS 2;  2QBY B;  1YO5 C;  1O57 A;  2DXI A;  3SZG A;  4P1W A;  4RAY A;  1W0T A;  4DGW B;  1HA8 A;  3H3Z A;  4I02 A;  1FY7 A;  3AG1 H;  1LVA A;  4HX7 A;  5GPA A;  3GXO A;  2PQ8 A;  2HDW A;  2P81 A;  4FE4 A;  3SZP A;  3BY6 A;  2DJN A;  4IOA F;  1XMA A;  1F4K A;  4MFD A;  1VFC A;  2XAF A;  5J8F A;  2QKL B;  2Y75 A;  1NK3 P;  3OR1 C;  2JUC A;  3PL8 A;  4XKB A;  2QCO A;  1X1B A;  4LOC A;  2IA0 A;  2PBI A;  2FOK A;  2ISZ A;  2A3S A;  1FIA A;  3H0D A;  1X58 A;  2R93 J;  1T39 A;  1TWC J;  1YJW I;  1W0U A;  5K5Q A;  2XPU A;  2G0E A;  3BPV A;  1PUE E;  4JX5 A;  1VQK I;  2ZSI B;  1P92 A;  2DT5 A;  1HKQ A;  2GZW A;  2DMU A;  3CCV I;  2A5Y B;  2QVO A;  4BY7 J;  5B5E C;  1ZRD A;  1U8B A;  1HDD C;  3BZC A;  4IKF A;  1B4A A;  1G59 A;  2DA6 A;  4EJO A;  3BCA A;  1J09 A;  3GCM A;  2R7X A;  1ZH5 A;  4F93 B;  3J7A O;  2CO5 A;  2WC2 A;  1EH8 A;  4CYD A;  2VOD A;  4A0Y A;  5EDN A;  2CWE A;  2KZV A;  4IQ4 A;  1O3T A;  1OFC X;  1BOB A;  1SAU A;  2VAS A;  1LEA A;  4M3D A;  4IF4 A;  4KIS A;  1MDM B;  2VOP A;  4HX4 A;  4R8H A;  5M5X J;  5ICE A;  4HNV A;  5JFR A;  2WV0 A;  4UVC A;  2WV1 A;  4OAY A;  4EVI A;  5F0F A;  1KON A;  2QBY A;  2JSP A;  2E34 A;  1FBU A;  4KT6 A;  2L7F P;  4Y3O A;  3S32 A;  4BGD A;  3J7Z I;  2LP0 A;  3TP3 A;  4PFO A;  1BBY A;  3B6A A;  3ZMS A;  3OYA A;  2X0L A;  1IRG A;  4AIH A;  1MBK A;  1W7P A;  4A2U A;  3L2Q A;  4HDU A;  2FNA A;  5F1R A;  5M3F J;  3R0J A;  3A0H C;  2NAZ A;  3SEZ A;  2VJ4 A;  2IS1 A;  1D1A A;  2IVM A;  2K4J A;  2COB A;  2JPB A;  4BE0 A;  2ZB9 A;  3L00 A;  3HOV J;  1J75 A;  4M73 A;  5JR3 A;  4YIF A;  3A1Y A;  2M8E A;  4XID A;  2MLK A;  1X4O A;  3ZQG A;  4EEF G;  2Y48 A;  1TWH J;  1MIJ A;  4RB0 A;  1LNW A;  4ESB A;  1G4D A;  3OSG A;  3ZP5 A;  3C2H A;  3W3C A;  1KU9 A;  2GXG A;  5IT9 K;  4P5O A;  4GYG A;  4AWX B;  4L18 B;  2XUB A;  1FMW A;  3KFW X;  2KIU A;  4XRS G;  2FJ1 A;  2K9M A;  5FD6 A;  4PJM A;  3KP4 A;  5D6E A;  2XF5 A;  3VYS B;  3MQ0 A;  1GV5 A;  2AXT C;  4CH7 A;  1RR7 A;  2WY8 Q;  1MH3 A;  2XPW A;  4U0W A;  4XLF A;  2H1L A;  4KIC A;  1XSD A;  4LIV A;  1KU7 A;  2F5F A;  1F1Z A;  4CO8 A;  1I50 J;  3JRF A;  3E1S A;  1POG A;  1VND A;  2EK5 A;  2G9W A;  3DLA A;  4ZTF A;  1WH5 A;  2D1H A;  5FD5 A;  2F48 A;  4F52 A;  2H8R A;  1F9N A;  1MDM A;  2X6W A;  2W7N A;  2VXZ A;  1G8X A;  1S7O A;  1MJB A;  2YSR A;  1YW7 A;  4A0X A;  1TW3 A;  3KLO A;  1XTA A;  3HPG A;  2LR8 A;  2WAF A;  4LG3 A;  2LBF A;  3O2P E;  4LMY A;  4QLC U;  5EEA A;  1WPK A;  5IYD J;  1PJR A;  1ORK A;  1JJ6 C;  3BR6 A;  2CUE A;  2HYF A;  3GTQ J;  2LG4 A;  1ETX A;  2E71 A;  2IA2 A;  3OOU A;  4XKW A;  2V1D A;  1WZ2 A;  1BOA A;  3DV8 A;  1OLT A;  4J19 A;  5CVU A;  1R4M B;  2BXZ A;  2KT0 A;  2W57 A;  4UXN A;  1A04 A;  2M7B A;  2ZNZ A;  3DKY A;  4OOI A;  3GTG J;  3BG5 A;  1HBX G;  4F7Z A;  1AKH B;  1FOX A;  1KGS A;  2DLL A;  3CJT B;  2KZG A;  2K27 A;  2VBW A;  3KCC A;  3TGN A;  5JI6 A;  1I6X A;  5D8L B;  1MJA A;  2VBY A;  4PZJ A;  4NDL A;  1MSF C;  2HVR A;  4XN3 A;  1T98 A;  5EYR A;  5FO5 A;  2BGC A;  2CV0 A;  1NTC A;  1RKT A;  2LYC A;  3HOY J;  4M3G A;  4N4N B;  4RBO A;  4KMF A;  2QEX I;  1ZTR A;  3I0T A;  1R5H A;  1D5Y A;  1KYZ A;  2HWV A;  5TIS C;  4CYC B;  1IRF A;  5D5V B;  1V5G A;  2XRL A;  2F5V A;  3ZMZ A;  1TL8 A;  3RIR A;  1FBQ A;  1VQ5 I;  3GTO J;  1A31 A;  4XOP A;  3WGH A;  1D1C A;  4XKC A;  2OZ6 A;  3R6S A;  4AID A;  2LY1 A;  2DO7 A;  2XB0 X;  3EQL F;  2RC4 A;  3FIS A;  3FM5 A;  2DAO A;  2Z5U A;  3NWS A;  1G2H A;  2ISY A;  3P9C A;  3V42 A;  2F4M B;  3BWG A;  4FHT A;  3I58 A;  3BJ6 A;  2WB1 N;  5D5W B;  3LSJ A;  2IPQ X;  2CV2 A;  4BJT A;  3J81 Z;  1P2F A;  2WAQ A;  5DYM A;  2DMN A;  2ID6 A;  3HBL A;  5E8G A;  1O3Q A;  3HM5 A;  4YRV A;  1EJ9 A;  1UHM A;  2XSD C;  1VI0 A;  1UHW A;  3GVA A;  1MBJ A;  1R71 A;  4CHU A;  2XV4 S;  3EUK L;  2CW0 F;  1LJ9 A;  1N75 A;  1P4X A;  1IUY A;  3W2V A;  1X2N A;  1Y0U A;  2JRM A;  2JVG A;  2PN6 A;  3O3K A;  1Y1V J;  3G73 A;  4M9X A;  3KYD B;  3HOT A;  4A3L J;  3H0G J;  2DTR A;  5FKO A;  5J1Y A;  1YLF A;  2EZH A;  2NNY A;  4NNJ A;  1AKH A;  1Z3X A;  2PMZ A;  1YS7 A;  2A61 A;  4KMU X;  4EQQ A;  2R7U A;  3IUO A;  3H3V K;  2OUM A;  1Z9C A;  4O6J A;  4NQW B;  2QF7 A;  3COA C;  1FOY A;  4EGY A;  2HXO A;  5TJJ A;  3CMY A;  4WWC A;  5GAD J;  4HF1 A;  2M30 A;  1YTY A;  3K4B A;  1X1P A;  2OBP A;  4CCN A;  1H0M A;  1N25 A;  2HYJ A;  2OTJ I;  4G9Y A;  3FXQ A;  4CYC A;  4PFP A;  1IC8 A;  5J40 A;  5EG0 B;  3GBG A;  3HYI A;  2HOE A;  4BHC A;  2HQR A;  2K40 A;  5GAE J;  4V19 K;  5BPD A;  1U9N A;  4XLP F;  4ENN A;  1HQC A;  4ZDP A;  4KYW A;  5HS9 A;  3WU2 C;  2QA4 I;  2VQL A;  1W36 D;  5JHF A;  2XRO A;  2DFI A;  3D5L A;  2ETH A;  1K4S A;  2RNG A;  2E1M C;  2HFH A;  1FTZ A;  1YE9 A;  3F8M A;  3KEY A;  3SFZ A;  3WTW C;  1PVE A;  4CGZ A;  3P5J A;  1XC5 A;  1RNL A;  2RQQ A;  4LFU A;  2HKX A;  1Y1W J;  4XMY A;  4L0Z B;  4QPO A;  2Y0S N;  4MQ9 F;  3G2B A;  4FX0 A;  3MKZ A;  1YW9 A;  3ULQ B;  5KAI C;  3RPU D;  3QYE A;  3C1D A;  3KET A;  1ZG5 A;  1HW5 A;  3LA7 A;  4ENJ A;  1JGG A;  3WGG A;  4Z2Y A;  2FXA A;  5HLG A;  1MJ9 A;  4XRS A;  3I71 A;  4BNC A;  3RTR A;  4WXC A;  1R49 A;  3GLL A;  4XRM A;  4EJV A;  1A6I A;  2L54 A;  4AU7 A;  2QYO A;  3EYY A;  4I0B A;  3B02 A;  2OPT A;  3BQY A;  3SXY A;  2QLZ A;  1WJE A;  2VJI A;  3I5U A;  3WU0 A;  3ZMV A;  5ILS A;  2VBX A;  1R58 A;  2Y9Z A;  2CGP A;  3DBR B;  2LKX A;  4N0B A;  2V1U A;  4UB8 C;  3K70 C;  3T1B A;  3QU3 A;  4BKX A;  4Y13 A;  2KHM A;  5LEJ A;  5F0C A;  3HRT A;  3E7L A;  5LHI A;  1R1V A;  2UZK A;  3GFM A;  3PSF A;  4NQW A;  2M0M A;  3PM1 A;  1GDT A;  4JP0 A;  2VC1 A;  2TRT A;  2DA1 A;  2HS5 A;  3EUA A;  3CJR B;  3H5A A;  2ME0 A;  3S14 J;  3ZQL A;  1FOK A;  3GEZ A;  1R1T A;  3JRA A;  2WY7 Q;  1SVM A;  3FXK A;  1BI0 A;  2RV8 A;  3BJA A;  4NUB A;  4LIU A;  5EG0 A;  1ETW A;  4C2U A;  2M87 A;  1E3O C;  3HGG A;  3REO A;  4MTE A;  2XB5 A;  2E1M B;  4IZZ A;  3AG2 H;  2VBZ A;  3HTS B;  2CW7 A;  3LSM A;  3QPT A;  3ZQI A;  2XGE A;  2L9N A;  3K10 A;  3SYT A;  5E3M A;  3U1D A;  4B4C A;  3OS2 A;  5DUK A;  4C3H J;  2L9S A;  4U7B A;  2ZME C;  4KA4 A;  2UWM A;  4BXF A;  4KIB A;  2KDZ A;  2LK2 A;  1W1W E;  1S9H A;  1T6S A;  4YFN F;  2FQ4 A;  3PJR A;  5EEH A;  4YFX F;  4P9F A;  2YU3 A;  3W6J B;  2X1E A;  3ERM A;  2IGO A;  1H8A C;  2ELK A;  1B59 A;  2K9S A;  5J1U A;  2B0L A;  1SVO A;  2PFB A;  2X4H A;  2M2E A;  4RMN A;  5BNG A;  4PJ0 C;  1Z67 A;  3Q0V A;  3BZ6 A;  5AIQ A;  1TT0 A;  1XD7 A;  1IW7 F;  1X3Z B;  3JTG A;  4N9I A;  1KA8 A;  2MC4 A;  4ASN A;  4F91 B;  1LPQ A;  4V2F A;  2HYG D;  5EJC A;  3RI4 A;  3IWF A;  4HLX A;  3HRM A;  2V9V A;  2DDB A;  4OU0 A;  1S7A A;  2PI0 A;  2V9P A;  5BPI A;  4C3I J;  4PGH A;  4BXU A;  3KZY A;  2DU9 A;  1QZE A;  3MWM A;  1IN8 A;  2VKD A;  1TNS A;  3ECH A;  3ZGK A;  4CSW A;  4A0Z A;  2LRD A;  3MZH A;  3IKV A;  3F9K A;  4DBR A;  1IRZ A;  3FBN B;  2XC7 A;  5ED4 A;  3PNT A;  3FXO A;  2C6Y A;  3WTX C;  1K78 A;  1GVD A;  3LSI A;  4D9J A;  1OCP A;  2CQ7 A;  4ZDO A;  4XLC A;  2Y2Z A;  4W97 A;  2FEZ A;  5IT3 A;  3M8J A;  3M1C A;  5E3L A;  3LA3 A;  5LRR A;  2ZME B;  1DGR M;  2BZT A;  2M4K A;  3ZN0 A;  4Z6Y A;  4WX9 A;  3J80 Z;  2GOM A;  1WHU A;  4ZDL A;  3MZ8 A;  4HPQ A;  3U2R A;  3CZ6 A;  3WHC A;  1HF0 A;  3K2Z A;  1Y56 A;  2H27 A;  2MGQ A;  2D2W A;  3ZQH A;  3MCZ A;  4DJA A;  5M3M J;  4HQE A;  1ZRC A;  1ONV A;  3DLL F;  5IP6 A;  2MLG A;  1IN4 A;  2R4G A;  2GA1 A;  2YU9 J;  4TV7 A;  4U0Y A;  2D1V A;  2HTJ A;  5GAH J;  1J7K A;  2HGC A;  2QQB A;  1BN5 A;  1G6N A;  2VT3 A;  2YR2 A;  4RDU A;  1JT6 A;  1XGN A;  4XRF A;  1VQ9 I;  2I5U A;  1K4T A;  3S1M J;  3LSK A;  5B3S H;  2EBI A;  3WTS C;  3LSH A;  3IHU A;  3PFY A;  2JA5 J;  3PNY A;  2FBK A;  2XAS A;  1D0Y A;  1B72 B;  1ZKG A;  1UJ8 A;  1E2X A;  3GLX A;  1K6O A;  1WJF A;  1XGS A;  2CRG A;  2EZI A;  2LOO A;  4O3M A;  1XN7 A;  4RAG A;  1MNM C;  3S93 A;  1RES A;  1U2W A;  4I0A A;  1F43 A;  2EIL H;  2XF7 A;  2ZFW A;  2ZSH B;  4CDG A;  4YEJ A;  2ZJQ F;  2QUF A;  1LFU P;  1USS A;  1WWX A;  5FLX Z;  2PMH A;  1OCT C;  1DP7 P;  3FMQ A;  1YX5 A;  3OYF A;  2EA4 A;  4OIN F;  4MO7 A;  5LHH A;  5LLQ A;  5HS7 A;  2BXY A;  4QIW N;  2XKO A;  3ML6 A;  2X51 A;  2RDP A;  1ENH A;  2F5E A;  4GCV A;  2JN6 A;  3SJM A;  1VQM I;  1UFM A;  3JRB A;  3HG9 A;  4QSH A;  3K1P A;  1N78 A;  3ECO A;  2KJC A;  5IY5 H;  1MBE A;  2KMU A;  2BVM A;  5JHU A;  1S6L A;  2MD5 A;  2ZJP F;  1J5Y A;  2ZME A;  3BCB A;  4HAM A;  2ZBK A;  4XQF A;  3IH4 A;  1YFH A;  3L2V A;  1LDJ A;  4F3Q A;  5FKK A;  1E3H A;  4XIC A;  5FLV A;  4QPQ A;  2HZD A;  3GYH X;  3IRR A;  2Z99 A;  2H09 A;  3H36 A;  4A5M A;  3K1N A;  4WF2 A;  2DJI A;  1TT5 B;  5ICF A;  1R5G A;  3EPZ A;  2HU9 A;  2A05 A;  2F4O B;  4XLE A;  2HQA A;  2ID3 A;  3CQZ J;  4G6T B;  3K7A J;  1YHQ I;  4I99 C;  5FGM A;  2L5Q A;  1TW2 A;  1N77 A;  2OF7 A;  5HVQ C;  1TNT A;  2EJR A;  1R00 A;  4J01 A;  1ZR4 A;  1JTY A;  3DFG A;  2NVU B;  2K86 A;  3AAF A;  2OV7 A;  4U0V A;  2H8W A;  1XSX A;  4FQG A;  4KN7 X;  4XL9 A;  4AC0 A;  3CCU I;  2PG4 A;  1APL C;  1K83 J;  3LOC A;  2DOA A;  1IJW C;  2ZXI A;  3HB9 A;  1I1G A;  3DTE A;  3HKZ A;  2B7E A;  1RRJ A;  2HQ5 A;  2ELJ A;  4FTH A;  4MQV A;  2IS2 A;  4RB2 C;  5HDG A;  2W84 A;  1T95 A;  4DOZ A;  5CVV A;  1JGS A;  3BR3 A;  2O6G E;  2OCE A;  3QP5 A;  1SD7 A;  4P55 A;  2PX9 A;  4CZC A;  1RR8 C;  3NWT A;  1OKR A;  4XLA A;  4XSZ F;  4WK8 F;  4HLY A;  5CVI A;  5D4S A;  1YRN B;  1QVU A;  4AD9 A;  1IZ1 A;  1TQI A;  1RC9 A;  1XGO A;  4HBL A;  2I10 A;  3OSF A;  3SFI A;  3FXR A;  1JKR C;  5H6R A;  2X1D A;  2GA2 A;  3IC7 A;  4KNY A;  2P5K A;  3TO6 A;  1SFK A;  4IHW A;  1XMK A;  2MSY A;  5CVJ A;  5FKM A;  2Q8K A;  5ICG A;  2HZT A;  2L7K A;  4BXX J;  2JSC A;  1Z7L A;  2WBM A;  3GUD A;  4KT5 C;  1V3F A;  4BQO A;  3M7G A;  3E6C C;  2PJR B;  4HNU A;  1UHS A;  4G7Z F;  4E7L A;  2HR3 A;  4A3F J;  1OIS A;  4BDY A;  4FE7 A;  2BOL A;  2ECB A;  2R0Q C;  1X1A A;  3EYI A;  2E19 A;  2BBY A;  3IV5 A;  1RUN A;  3Q0U A;  1XS9 A;  4O5V A;  3CCY A;  3CO7 C;  2DQR A;  3CCS I;  1BIA A;  5E1Z B;  3S16 J;  3QOE A;  4M71 A;  1FP2 A;  2P7V B;  1W7P B;  3ZOB A;  4RGU A;  5B66 C;  1YJN I;  5L3E A;  4C2M J;  5LGT A;  2E35 A;  3L2W A;  3MMY B;  1VTN C;  1BR4 A;  4AYB A;  3BQZ A;  3VSK A;  4HOB A;  3K4C A;  2EA2 A;  4MEY F;  4I09 A;  2HDC A;  3LA2 A;  3QYF A;  2NVY J;  3ESW B;  3FIW A;  4E4H A;  4ZYA A;  4BU2 A;  1WI9 A;  1ZLJ A;  1M1E B;  3QAH A;  2FUG 2;  5C4J J;  1Z05 A;  2R7Z J;  5GTI C;  3S17 J;  4RAZ A;  5TRD A;  2YS9 A;  3RQI A;  4CA0 A;  1D3Y A;  2Y69 H;  2L4M A;  1MND A;  2LC2 A;  2W4S A;  2NOG A;  1JKO C;  1WJA A;  4EGZ A;  1JHF A;  1YRN A;  3FBI B;  1ETO A;  4LK1 F;  4G7H F;  4LB5 A;  1QZY A;  2Y31 A;  3JCU C;  5LGU A;  5DEQ A;  4HSR A;  2XGC A;  3B6C A;  1OPC A;  2VPR A;  1XDS A;  3NRV A;  3GTP J;  1GLN A;  3E0J B;  1WKM A;  2CG4 A;  2ECC A;  3J81 K;  1W7P D;  2TDX A;  3I3L A;  3VEP A;  4M3B A;  2PLY A;  2E1O A;  1ERD A;  4K2E A;  3M8E A;  5E3O A;  2PJR A;  5ERI A;  5CQG A;  2LRE A;  3V7C A;  2EPF A;  1MKM A;  2LBF B;  3Q0W A;  3O6B B;  4RLQ A;  2PMU A;  1BW6 A;  2IGN A;  1STZ A;  4PJN A;  5IOZ A;  2DT6 A;  3V8J A;  5F1J A;  3GZ5 A;  2WWY A;  4XR6 A;  4IHV A;  3LQQ A;  1MBG A;  3RCO A;  2KRC A;  2X6X A;  2H6C A;  3VPR A;  1WJB A;  3DPT A;  3FK6 A;  2VIX A;  1WGX A;  3QP6 A;  5ICC A;  1VZ0 A;  2K9L A;  3G3Z A;  3SZT A;  4YG2 F;  2HOT A;  2E60 A;  1JXS A;  4A93 J;  2RQP A;  4ZYH A;  1ZRE A;  3VWB A;  4EJT A;  5H6Q A;  2OA4 A;  4RA2 A;  5GTH C;  1AU7 A;  4HDV A;  5K7H A;  2KL4 A;  4HV5 A;  1E0E A;  3RDI A;  1ZYR F;  4M6V A;  1BW5 A;  3GZN B;  3HDD A;  2E36 A;  1A5J A;  4KIT B;  3VYT B;  4G8X A;  3FHN A;  3M9A A;  4DZJ A;  4KJZ A;  1KU2 A;  2F6C A;  2DCE A;  2L2O A;  1I27 A;  3HSE A;  4ESF A;  1ZGW A;  5FRN A;  2K3P A;  3HHH A;  2Y9Y A;  2L3D A;  1XPX A;  1UB9 A;  1JJ8 C;  1RI7 A;  1OCO H;  1HSJ A;  1ZAR A;  4XK4 A;  5K7F A;  1JUS A;  3E5X A;  4IHX A;  1JUP A;  3I9V 2;  5F04 A;  3RKY A;  3EUH C;  2W82 A;  1K79 A;  3K9T A;  2E5Z A;  3WTV C;  2KQR A;  1CF7 B;  2DYR H;  5J47 A;  1DUX C;  3CCL I;  1JE8 A;  4PJJ A;  1F5T A;  4HX8 A;  1REP C;  4C30 A;  2GXA A;  1FYL A;  4BAC A;  2RGV A;  1ON1 A;  2BE5 F;  1ULY A;  2CUZ A;  2LTP A;  2NS0 A;  3EDP A;  4PSX A;  3ZN1 A;  4EV0 A;  1VQ7 I;  2J5O A;  3A2K A;  5JLX A;  1SMT A;  2W85 A;  3LSR A;  3A4C A;  1T8I A;  3HC7 A;  1B9M A;  1IDY A;  3OS1 A;  3S3N A;  5LGN A;  3V8L A;  3LSP A;  3QWL A;  3R4K A;  4L5I A;  3CCM I;  4UV9 A;  2FOW A;  3M07 A;  2L9V A;  5L3B A;  4Y52 J;  4OWR B;  4W1U A;  3CC7 I;  5BS6 A;  4ESJ A;  4NB5 A;  1V55 H;  3FMS A;  4OMZ A;  4E7S A;  1S3J A;  1UCR A;  4D7M A;  1T56 A;  4HV6 A;  2FU4 A;  2K5C A;  1PP8 F;  3BOQ A;  4FT8 A;  2IP2 A;  4BE1 A;  1YS6 A;  2LKP A;  1UST A;  1UEL B;  1OR7 C;  4EJU A;  1BR1 A;  2DBB A;  4IHT A;  4UUV A;  5DM7 F;  1D8J A;  1XG1 A;  3HRU A;  2IGM A;  1ZGJ A;  1OCC H;  2JTV A;  2ZXJ A;  2DFE A;  2CJJ A;  5D5X B;  4OAZ A;  1LKX A;  5E20 A;  2MBF A;  1YIO A;  1R9T J;  3FXM A;  2HKO A;  4AVZ A;  4E6K G;  1B6A A;  4RGS A;  2XRN A;  1ZGA A;  1I39 A;  3F72 A;  3QU6 A;  2JJ7 A;  1W5S A;  3QOP A;  2W00 A;  3R61 A;  3OYL A;  2BW3 A;  4IHS A;  2W48 A;  4Q47 A;  3WHB A;  1H9G A;  4E7I A;  3CTA A;  1K7A A;  1NG7 A;  2G7U A;  1CF7 A;  4G7O F;  2MH2 A;  3JTH A;  2O7O A;  3GWZ A;  4XNF A;  3SEQ A;  1MD0 A;  3H35 A;  3UNG C;  4BAY A;  1P6R A;  3TW6 A;  1XGM A;  3A01 B;  1S5L C;  3IH2 A;  2ZKZ A;  3DCF A;  3MZY A;  3U9G A;  4N4O B;  3TW7 A;  5E8I A;  2LSO A;  4A5N A;  2VPL A;  2ZJ2 A;  2ACJ A;  1U9O A;  1IXR C;  3OYD A;  4LIT A;  4FAS D;  1ZAO A;  3DP7 A;  3DEW A;  4RAF A;  4BQQ A;  4HRI A;  2YX4 A;  3HRS A;  2NVT J;  2V4J C;  5EEG A;  4F92 B;  3D5R C;  1IUF A;  3WU1 B;  3K1M A;  3CF2 A;  2EB7 A;  4L9J A;  3PQK A;  2O8X A;  4HQM A;  1ZRF A;  2R3S A;  4XLN F;  2R7R A;  2EZK A;  4JX6 A;  1AOY A;  3QQA A;  3WTT C;  1P7J A;  2ZCW A;  3N05 A;  3V8K A;  2DMP A;  1RUO A;  3HOW J;  2VE8 A;  2VJJ A;  1P9Q C;  3QPS A;  3QRF F;  1HW1 A;  2E5N A;  3CF5 F;  2R7Q A;  3W2W A;  2QQ9 A;  4G6Q A;  1OYW A;  1FMV A;  3J80 K;  3RYR A;  2NXN B;  2DW4 A;  1K6Y A;  2AHQ A;  2WAE A;  1R22 A;  4B8X A;  3H9Q A;  5BOX A;  4R79 A;  2LH9 A;  1TTY A;  2XIG A;  3EUH A;  4ZC3 A;  4BQA A;  2HPI A;  4D5F A;  1S7E A;  2FA5 A;  5GPC A;  2R7F A;  3DQV C;  1H88 C;  2DPU A;  1SVL A;  2K7L A;  3KIO A;  4M3E A;  2HEO A;  1JKQ C;  2NNN A;  4UUS A;  3BG6 A;  4G6D A;  1RPW A;  2X1C A;  2O0Y A;  9ANT A;  2HVQ A;  4CCL A;  4IXA A;  1ZQ3 P;  1XCB A;  3HEF A;  4ENM A;  3GTK J;  2J5P A;  5J4V A;  4L9V A;  2GIZ A;  4XLH A;  2GQQ A;  2D5V A;  3VOD A;  4E7K A;  1EH7 A;  1KQ9 A;  1FTT A;  1OCR H;  1Z21 A;  3CCR I;  1G3S A;  4FIS A;  4BEH B;  4CUG A;  1W4M A;  2DI3 A;  2VC0 A;  2HNH A;  5BMZ A;  4OIQ F;  3O8G A;  3CMA I;  2HOA A;  3A01 A;  1R36 A;  3OL3 A;  3UR3 C;  5ILU A;  1U5T C;  3PFI A;  1H9T A;  3PO2 J;  2NYX A;  3S2W A;  1QU3 A;  4A6D A;  2OC6 A;  4ZYD A;  2DPD A;  5CVR A;  1VQ8 I;  3J7A Y;  2OD5 A;  2K3F A;  3ONQ A;  2X6Y A;  4XM3 A;  4YIR X;  4CCJ A;  1IF1 A;  5FLX K;  1MMG A;  2K85 A;  3HSF A;  4Y4R A;  5F64 A;  3VSL A;  3HOU J;  3I59 A;  3GZ6 A;  3Q5F A;  1DU6 A;  2VQH A;  5C3E J;  1SAN A;  1X3U A;  2OCC H;  4M72 A;  2M34 A;  3S15 J;  5DD8 A;  1OR7 A;  1K78 B;  1VQO I;  1WFX A;  2ESH A;  3ELK A;  4X0G A;  4EM1 A;  3HSR A;  1ZHF A;  2BY2 A;  1BI2 A;  4A3B J;  1QA6 A;  5E79 C;  5IYB J;  4IO9 F;  2CQN A;  1FPQ A;  2DTZ A;  3AG4 H;  3A03 A;  2JT1 A;  3F8C A;  1VF9 A;  4HA8 A;  3V4G A;  2FE3 A;  3TDU C;  4BYY A;  1E17 A;  3IP4 B;  2E2J J;  1I1S A;  3BR1 A;  4HG2 A;  2FSW A;  1DGW Y;  3U1K A;  5L3G A;  3M4O J;  2E7W A;  3ERE D;  4RB3 C;  4ZJZ A;  2VUM J;  1UG0 A;  2EIJ H;  1LEB A;  2RNJ A;  3CMM A;  4NBQ A;  2LNB A;  3P9I A;  1PP7 U;  1X3W B;  1FSH A;  1QRY A;  1YI2 I;  1KQ8 A;  1U5T B;  3W2A A;  2V6E A;  2LF7 A;  3WTU C;  2AQF A;  2JK3 A;  4BEH A;  2E7X A;  3CCQ I;  4Y33 A;  4DNC A;  2WAQ N;  3WOD F;  5A2Q Z;  1IN6 A;  1B8I B;  4IPA A;  1SC7 A;  2L01 A;  3S2H J;  3KP5 A;  5HOD A;  2COM A;  2DK5 A;  3OYI A;  1JUM A;  4WCG A;  2LF8 A;  3FWE A;  4UB6 C;  3DEE A;  1QNT A;  3TQN A;  2MW8 A;  3F6O A;  1D8K A;  1ETK A;  2O8K A;  2CW8 A;  3H1C A;  3OYH A;  1QVT A;  1YX3 A;  3LFU A;  2M4G A;  3HPH A;  1IV6 A;  5LBQ A;  2IA1 A;  4M6Y A;  3ASO H;  3IWZ A;  4U87 A;  5HDK A;  4A3G J;  3Q3S A;  2XF6 A;  2PMZ N;  1V5E A;  3ZQQ A;  3K69 A;  2QSG X;  2IBD A;  3VDX A;  5J4Y A;  4IRH A;  2CSO A;  2DA7 A;  3MFK A;  2CFX A;  3RKQ A;  3NQO A;  4X6A J;  1R23 A;  5KAF C;  3L2C A;  1SFO J;  3CCJ I;  1MW7 A;  3JRC A;  3ISP A;  2NRA C;  2VLA A;  2PJP A;  3FMR A;  2A6E F;  3HZJ A;  3F6V A;  2EV5 A;  3L9F A;  3RZO J;  2FBI A;  3GW2 A;  2O03 A;  4S04 A;  2R5Y B;  2EIK H;  1R5I D;  2LMD A;  2XVC A;  1FYM A;  2A5W A;  4S0H B;  4IQJ A;  2HTS A;  4GRI A;  4HEA 2;  4Q5S F;  4B09 A;  1SD4 A;  4GYI A;  3K70 D;  1ODD A;  3BG7 A;  2DOE A;  4GXO A;  1QHH D;  4M6X A;  4OIR F;  2BYV E;  3M3Y J;  3RKW A;  3FDY A;  4KDP A;  2CQQ A;  2R92 J;  1U5T A;  1TZL A;  3J7Y J;  1AHD P;  1MMS A;  1HST A;  3IH3 A;  2XAJ A;  1I3A A;  4MFE A;  3LAP A;  4RS8 A;  5IP9 J;  1B8I A;  2E1C A;  3OYE A;  4B3X A;  3ZMU A;  3OMY A;  2CUJ A;  1ZK8 A;  2KRH A;  4M3F A;  3FKJ A;  2BHZ A;  1Q1H A;  3KLN A;  2VB6 A;  1DPR A;  4HST A;  3F23 A;  3BDD A;  2CH0 A;  3F0C A;  2Z16 A;  4NC8 A;  5CYV A;  4IHY A;  2JA2 A;  3KYC B;  4YFK F;  3OOP A;  1X1C A;  3VFZ A;  4L9N A;  2RKH A;  2VKH A;  1OMI A;  3VB2 A;  1VQP I;  1U3E M;  1SFE A;  4Y17 A;  4CCM A;  1J9I A;  2YUS A;  5K5R A;  2NVX J;  5KHD A;  3LSG A;  2H94 A;  3H9J A;  3HJE A;  1DPU A;  3S3M A;  4I2O A;  3FZV A;  3PIP F;  5HDN A;  2QQA A;  2HXI A;  3DPU A;  3GME A;  1B1B A;  3OYC A;  2R7O A;  2QZ8 A;  2M7A A;  4D0P A;  3IAM 2;  2R7W A;  3HOZ J;  2KJB A;  1NHA A;  2FBH A;  1EH6 A;  3OIQ A;  3E5Q A;  1IXS B;  1HLV A;  2XDV A;  4II2 A;  1D1B A;  2DQL A;  3H3U A;  5J3L A;  1PUF A;  5M5Y J;  2R5Y A;  4EAT A;  2QM3 A;  1RKW A;  5CKT A;  2E1N A;  1HKT A;  2GLO A;  4UVB A;  1LQ1 A;  3AG3 H;  3FX3 A;  2P6T A;  3VOE A;  3DPL C;  2OQG A;  2UUZ A;  3JAM Z;  1U8R A;  2L0K A;  2QSH X;  2ADU A;  2BHY A;  5FKN A;  1FOW A;  1BL0 A;  2EWN A;  4ETS A;  1BJA A;  1QZZ A;  4JOM A;  3TBI A;  2DK8 A;  3GTJ J;  4QWQ A;  4D7N A;  3ZCO A;  4MTD A;  3WGI A;  3OWT A;  3DKW A;  5DCM B;  4AVP A;  2JVH A;  3GFJ A;  3DU6 A;  4AM3 A;  2P5V A;  4AIJ A;  3KE2 A;  3ZPL A;  1UZC A;  2MA3 A;  2L9R A;  1W5T A;  4DIQ A;  2A07 F;  3S8P A;  4IRG A;  2OQR A;  2ZNY A;  3EET A;  4YII A;  3U21 A;  2P6S A;  3F8B A;  3CME I;  3MEX A;  1VQN I;  1RZ4 A;  3L1P A;  1MZB A;  3ZQ7 A;  1MNE A;  3PUB A;  3RSN A;  2VOO A;  1IXC A;  3F22 A;  2CQX A;  2XAU A;  3VYU B;  3PQJ A;  2ZJR F;  5HLH A;  3QOD A;  3G1L A;  4MHG A;  4BS9 A;  4RGR A;  5L3F A;  2DYS H;  1FX7 A;  3H92 A;  5KK1 A;  1VQ4 I;  3F21 A;  3HTU A;  1W5C C;  1WJC A;  3WG7 H;  5HOO A;  2VE9 A;  3CUO A;  5H20 A;  4XOR A;  5HLI A;  1V54 H;  3K4J A;  1DQU A;  2GWR A;  2IW5 A;  3Q9S A;  3ZQF A;  4E70 A;  5LD2 C;  5C4X J;  1O3S A;  2V9K A;  1Y0N A;  2H6B A;  3JR9 A;  4DYC A;  1IGN A;  5D5U B;  4ENK A;  3G6E I;  2E2H J;  4WXD A;  1E3P A;  2FRH A;  1P7I A;  2JMW A;  1WSU A;  5DV5 A;  1U78 A;  1ETV A;  2H1K A;  3C18 A;  1DP3 A;  4M9Z A;  1FNN A;  3S1N J;  2A69 F;  2M3A A;  3PNV A;  1QPI A;  2E2I J;  3Q9V A;  1FEX A;  2R7T A;  5DCM A;  2IEK A;  3TOA A;  2F5D A;  2X9D A;  3ZXS A;  3L2U A;  5JLW A;  2DT7 B;  1GHC A; 
#chains in the Genus database with same CATH homology
 4HW0 A;  4G94 A;  1MGT A;  2PEX A;  3ZMT A;  3GX4 X;  5F6F A;  3F8F A;  1D5V A;  3T0Y A;  4KFC A;  2Y0M A;  1P4W A;  4UVA A;  2F2E A;  4WXH A;  1DDN A;  4HZF A;  3E97 A;  4R1H A;  3E6B A;  5E1X A;  3KEO A;  2VON A;  1FWZ A;  3BP8 A;  3FM3 A;  5BQT A;  1SD6 A;  1BM9 A;  4LG0 A;  3WG9 A;  1LDD A;  4KN4 X;  3RJP A;  4UNO A;  2FML A;  4LK0 F;  1V4R A;  2IJL A;  4MEX F;  2FF4 A;  2V79 A;  4AIK A;  5L3C A;  4L9T A;  2V1X A;  5DD4 A;  4LB6 B;  3LWF A;  3HIF A;  1ZLK A;  1R7J A;  2L02 A;  4EMS A;  4A12 A;  3P7N A;  4XSX F;  3FF5 A;  3T8R A;  2CYY A;  2EFW A;  3HOS A;  1SFX A;  2L4A A;  5DCF A;  4PCQ A;  4EM0 B;  1Z6T A;  1QO0 D;  5DUI A;  4LGW A;  1I5Z A;  2STW A;  4LD5 A;  5KVR A;  2XAG A;  2LDU A;  3TKY A;  1KU3 A;  5LEK A;  3E6D A;  4RGX A;  2QEN A;  2OAZ A;  4CZZ A;  1ON2 A;  2Q0O A;  1G3T A;  3KP6 A;  5K5O A;  4LLN A;  1EV7 A;  3ABT A;  1HKS A;  1ZG1 A;  1SMY F;  1QGP A;  4ZYG A;  3CDH A;  1O7F A;  5CLS A;  4BHP A;  2MH9 A;  3IRQ A;  3RYP A;  1FSE A;  3E6M A;  1U6G A;  1S8N A;  1O7L A;  3I64 A;  4Y15 A;  2BEO A;  2R7D A;  2FQ3 A;  1PDN C;  5AON A;  2ELH A;  1QQI A;  2EV0 A;  1SAX A;  5E17 F;  5DDG A;  2V6C A;  2JRT A;  2GIV A;  2EV6 A;  4S05 A;  1T0F A;  5D4R A;  3C3W A;  3CLO A;  2YPR A;  1T2K A;  3C7J A;  2AS5 F;  3TO7 A;  4IRI A;  4LJZ F;  1YQA A;  2RN7 A;  4OMY A;  3M1E A;  2XAQ A;  4EM2 A;  3T5X A;  4P9U A;  2M5W A;  1FYK A;  2P7C B;  2GXB A;  3L09 A;  2JPC A;  1J0R A;  1Z6R A;  4IVN A;  5A2Q K;  3TO9 A;  5D6F A;  5J8C A;  1CGP A;  3I54 A;  1Z7U A;  3IKT A;  3LQR A;  4OIP F;  1TQP A;  3I59 B;  3IL2 A;  3K0L A;  3ZMD A;  1FC3 A;  4U7D A;  4HYE A;  4KUM A;  3HHG A;  4EJW A;  4LLG F;  2VT2 A;  3RPQ A;  3T8T A;  2YX7 A;  4XBF A;  5J6X A;  4FX4 A;  3CUQ C;  3FHZ A;  4Q4Z F;  5HS8 A;  3ABU A;  1FP1 D;  3KP7 A;  4JQF A;  3QPH A;  5IT9 Z;  4KIF A;  2RVC A;  3M8F A;  3DF8 A;  1ZG3 A;  3JSP A;  3FXU A;  4GGG A;  4DQ2 A;  2Q2E A;  2HQN A;  4HF2 A;  2FMY A;  2FNP A;  4MGR A;  1O3R A;  3LST A;  2IT0 A;  3OV8 A;  2ESN A;  1S29 A;  2VN2 A;  5AIP A;  2O61 A;  4U88 A;  3N97 A;  2OZU A;  1T38 A;  2G7H A;  4ZH4 F;  5E18 F;  2P4W A;  2Z9O A;  1G3Y A;  3CUQ B;  3F8N A;  4JK1 X;  1XCV A;  3GFI A;  2Z33 A;  3I4P A;  3BJO A;  3RPU A;  2WTE A;  2KRF A;  4BHB A;  2Z3Y A;  1TBX A;  3WTZ A;  3WE2 A;  2IRF G;  5L3D A;  1GXP A;  4GO1 A;  1FBS A;  1LDK B;  2KIF A;  2JZY A;  2KKO A;  2P5L C;  3WTY C;  4JBA A;  3MAJ A;  3JAM K;  4A6E A;  2K02 A;  3BRO A;  1RIO H;  5LHG A;  4PDK A;  2CQK A;  3KP2 A;  5LRS A;  1YG2 A;  2KIM A;  3JSO A;  1XB4 A;  3I53 A;  2W25 A;  2O3F A;  3P9K A;  2XHK A;  4PGG A;  1KYW A;  4LLL A;  1WQ2 A;  2EFP A;  3RKX A;  1QPM A;  3KZZ A;  3E3V A;  1XDU A;  2UXN A;  1QBJ A;  3CUQ A;  4M74 A;  4UHT A;  3HUG A;  2STT A;  4ON0 A;  3KP3 A;  2ZO4 A;  1OYI A;  4UV8 A;  2GAU A;  1LB2 A;  1L3L A;  1G3W A;  1IAW A;  1GXQ A;  2EFQ A;  1BI1 A;  1GVJ A;  4ZYE A;  5ILV A;  5FFZ A;  1BI3 A;  1YYV A;  4CIC A;  1SD5 A;  4ZZL A;  2EFO A;  6PAX A;  3ROU A;  2M1B A;  3L7W A;  1HW2 A;  1KQ0 A;  2M45 A;  2W24 A;  1HXD A;  3GFL A;  2P8T A;  2MC3 A;  3GF2 A;  2K4B A;  2QWW A;  4I98 B;  5FFX A;  2XKP A;  3E5U A;  3LFK A;  2AXL A;  3D0S A;  3BPX A;  3SQN A;  3V7R A;  4P96 A;  2F5C A;  1YW8 A;  1R1U A;  4I01 A;  2UXX A;  1TQM A;  2A6H F;  2EFN A;  5K1Y A;  3SHF A;  4L0Y B;  3TOB A;  4L5J A;  1FT9 A;  4RB1 A;  4NHJ A;  1WRJ A;  1OYY A;  5D8K B;  3V7S A;  3R0A A;  2XAH A;  3F3X A;  4MNU A;  1FLI A;  3N4M A;  2D45 A;  1TLH B;  3B73 A;  3DEU A;  3W6K B;  1IN7 A;  4N9H A;  5CJ9 A;  1L0O C;  1AWC A;  4OIO F;  1C0W A;  1BIB A;  2OU2 A;  1IN5 A;  1BC7 C;  3KEQ A;  2XGX A;  4HF0 A;  1SFU A;  4ZZD A;  1FZP B;  1B9N A;  4Q48 A;  1ZN2 A;  4BH9 A;  1P4A A;  4KIG A;  4IJA A;  3LAJ A;  4H0E A;  1Z1D A;  5FB2 A;  1BC8 C;  2BV6 A;  3WE3 A;  3R60 A;  1JHH A;  3DXJ F;  3CJN A;  3TDZ C;  1XSV A;  4I7H A;  4CXF A;  3GO5 A;  4M9S A;  5E1W A;  3NEU A;  4LG0 B;  1Z91 A;  3JW4 A;  1J2X A;  2A68 F;  5JVT A;  1J59 A;  3CO6 C;  2QBY B;  1YO5 C;  1O57 A;  4RAY A;  3H3Z A;  4I02 A;  1FY7 A;  1LVA A;  4HX7 A;  3GXO A;  2PQ8 A;  3SZP A;  3BY6 A;  1XMA A;  1F4K A;  2XAF A;  5J8F A;  2Y75 A;  2IA0 A;  2PBI A;  2FOK A;  2ISZ A;  2A3S A;  1T39 A;  5K5Q A;  3BPV A;  1PUE E;  1P92 A;  2DT5 A;  1HKQ A;  2GZW A;  2A5Y B;  2QVO A;  1ZRD A;  1B4A A;  4EJO A;  1ZH5 A;  3J7A O;  2CO5 A;  2WC2 A;  1EH8 A;  4CYD A;  2VOD A;  4A0Y A;  2CWE A;  1O3T A;  1LEA A;  4IF4 A;  1MDM B;  2VOP A;  4HX4 A;  4R8H A;  5ICE A;  5JFR A;  2WV0 A;  4UVC A;  4EVI A;  2QBY A;  1FBU A;  1BBY A;  3ZMS A;  2X0L A;  1IRG A;  4AIH A;  1W7P A;  4A2U A;  4HDU A;  2FNA A;  5F1R A;  3R0J A;  2NAZ A;  2IVM A;  2K4J A;  2JPB A;  3L00 A;  1J75 A;  4M73 A;  5JR3 A;  4YIF A;  2M8E A;  2MLK A;  2Y48 A;  4RB0 A;  1LNW A;  4ESB A;  1G4D A;  3ZP5 A;  1KU9 A;  2GXG A;  5IT9 K;  4P5O A;  4GYG A;  4AWX B;  4L18 B;  2XUB A;  3KFW X;  2KIU A;  5FD6 A;  3KP4 A;  5D6E A;  3MQ0 A;  4U0W A;  1XSD A;  4KIC A;  1KU7 A;  2F5F A;  1F1Z A;  4CO8 A;  2EK5 A;  2G9W A;  5FD5 A;  2D1H A;  1F9N A;  1MDM A;  2VXZ A;  1S7O A;  1MJB A;  2YSR A;  1YW7 A;  4A0X A;  1TW3 A;  3KLO A;  3O2P E;  4LMY A;  4QLC U;  2HYF A;  2IA2 A;  2V1D A;  1BOA A;  3DV8 A;  5CVU A;  2W57 A;  4UXN A;  1A04 A;  2ZNZ A;  4OOI A;  1HBX G;  4F7Z A;  1KGS A;  2DLL A;  2K27 A;  2VBW A;  3KCC A;  3TGN A;  5JI6 A;  1I6X A;  5D8L B;  1MJA A;  2VBY A;  4PZJ A;  1T98 A;  5FO5 A;  2BGC A;  4KMF A;  3I0T A;  1R5H A;  1KYZ A;  2HWV A;  1IRF A;  5D5V B;  3ZMZ A;  3RIR A;  1FBQ A;  3WGH A;  2OZ6 A;  3R6S A;  2DO7 A;  3FM5 A;  3EQL F;  2RC4 A;  2DAO A;  2Z5U A;  2ISY A;  3P9C A;  3BWG A;  4FHT A;  3I58 A;  3BJ6 A;  5D5W B;  2IPQ X;  3J81 Z;  1P2F A;  5DYM A;  5E8G A;  1O3Q A;  1UHM A;  1UHW A;  3GVA A;  4CHU A;  2XV4 S;  2CW0 F;  1LJ9 A;  1P4X A;  1IUY A;  1Y0U A;  2PN6 A;  3O3K A;  3G73 A;  4M9X A;  3HOT A;  2DTR A;  1YLF A;  2NNY A;  1YS7 A;  2A61 A;  4KMU X;  4EQQ A;  1Z9C A;  4O6J A;  3COA C;  4EGY A;  5TJJ A;  4WWC A;  4HF1 A;  2M30 A;  1YTY A;  2OBP A;  1H0M A;  4G9Y A;  3FXQ A;  3HYI A;  2HOE A;  4BHC A;  2HQR A;  5BPD A;  4XLP F;  4ENN A;  1HQC A;  4KYW A;  5HS9 A;  2XRO A;  2DFI A;  3D5L A;  2ETH A;  2HFH A;  3F8M A;  3SFZ A;  3WTW C;  4CGZ A;  1RNL A;  4LFU A;  2HKX A;  4L0Z B;  4MQ9 F;  4FX0 A;  1YW9 A;  3ULQ B;  3KET A;  3C1D A;  1ZG5 A;  1HW5 A;  3LA7 A;  4ENJ A;  3WGG A;  4Z2Y A;  2FXA A;  5HLG A;  1MJ9 A;  4BNC A;  3I71 A;  3RTR A;  4WXC A;  4EJV A;  2L54 A;  2QYO A;  3EYY A;  4I0B A;  3B02 A;  3SXY A;  2QLZ A;  3WU0 A;  3ZMV A;  3I5U A;  5ILS A;  2VBX A;  1R58 A;  2CGP A;  4N0B A;  2V1U A;  3T1B A;  3QU3 A;  4Y13 A;  5LEJ A;  3HRT A;  5LHI A;  1R1V A;  2UZK A;  3GFM A;  4NQW A;  2VC1 A;  2HS5 A;  1FOK A;  3GEZ A;  1R1T A;  1BI0 A;  2RV8 A;  3BJA A;  2M87 A;  3REO A;  4MTE A;  2VBZ A;  3HTS B;  3QPT A;  3U1D A;  5DUK A;  4U7B A;  4KA4 A;  2UWM A;  4KIB A;  1T6S A;  4YFN F;  5EEH A;  4YFX F;  4P9F A;  2YU3 A;  3W6J B;  1B59 A;  2B0L A;  2PFB A;  2X4H A;  3BZ6 A;  5AIQ A;  1XD7 A;  1IW7 F;  3JTG A;  4N9I A;  1KA8 A;  4ASN A;  2HYG D;  3RI4 A;  3IWF A;  4HLX A;  3HRM A;  2V9V A;  4OU0 A;  1S7A A;  2PI0 A;  5BPI A;  4PGH A;  4BXU A;  3KZY A;  2DU9 A;  3MWM A;  1IN8 A;  3ECH A;  1TNS A;  4A0Z A;  3MZH A;  3IKV A;  5ED4 A;  2C6Y A;  3WTX C;  1K78 A;  2FEZ A;  5IT3 A;  3LA3 A;  5LRR A;  2ZME B;  3ZN0 A;  4WX9 A;  3J80 Z;  3U2R A;  3K2Z A;  2H27 A;  2D2W A;  3MCZ A;  4HQE A;  1ZRC A;  1ONV A;  2MLG A;  1IN4 A;  2GA1 A;  4TV7 A;  4U0Y A;  2D1V A;  2HTJ A;  1J7K A;  2HGC A;  2QQB A;  1BN5 A;  1G6N A;  2VT3 A;  2YR2 A;  1XGN A;  4XRF A;  3WTS C;  3IHU A;  2FBK A;  2XAS A;  1E2X A;  3GLX A;  1K6O A;  1XGS A;  4O3M A;  1XN7 A;  1U2W A;  4I0A A;  2ZFW A;  4CDG A;  2QUF A;  1USS A;  1WWX A;  5FLX Z;  2PMH A;  1DP7 P;  3FMQ A;  2EA4 A;  4OIN F;  5LHH A;  5LLQ A;  5HS7 A;  2XKO A;  3ML6 A;  2RDP A;  2F5E A;  4GCV A;  1UFM A;  3K1P A;  3ECO A;  2KJC A;  5JHU A;  1S6L A;  2MD5 A;  1J5Y A;  2ZME A;  4HAM A;  2ZBK A;  1YFH A;  1LDJ A;  3GYH X;  3IRR A;  2Z99 A;  2H09 A;  4A5M A;  3K1N A;  4WF2 A;  5ICF A;  1R5G A;  5FGM A;  1TW2 A;  5HVQ C;  1TNT A;  2EJR A;  1R00 A;  3DFG A;  2K86 A;  3AAF A;  4U0V A;  1XSX A;  4KN7 X;  2PG4 A;  1I1G A;  4MQV A;  4RB2 C;  5HDG A;  2W84 A;  5CVV A;  1JGS A;  2O6G E;  3QP5 A;  1SD7 A;  4P55 A;  1OKR A;  4XSZ F;  4WK8 F;  4HLY A;  5CVI A;  5D4S A;  4AD9 A;  1IZ1 A;  1TQI A;  1XGO A;  4HBL A;  3FXR A;  5H6R A;  2GA2 A;  3IC7 A;  4KNY A;  2P5K A;  3TO6 A;  1XMK A;  5CVJ A;  2Q8K A;  5ICG A;  2HZT A;  2JSC A;  3GUD A;  4KT5 C;  1V3F A;  3E6C C;  3M7G A;  4G7Z F;  2HR3 A;  3EYI A;  2BBY A;  1RUN A;  4O5V A;  3CO7 C;  2DQR A;  1BIA A;  5E1Z B;  4M71 A;  1FP2 A;  2P7V B;  1W7P B;  4RGU A;  5L3E A;  5LGT A;  1VTN C;  4HOB A;  2EA2 A;  4MEY F;  4I09 A;  2HDC A;  3LA2 A;  1WI9 A;  1ZLJ A;  3QAH A;  1Z05 A;  4RAZ A;  5TRD A;  1D3Y A;  2L4M A;  4EGZ A;  1JHF A;  4LK1 F;  4G7H F;  4LB5 A;  1QZY A;  5LGU A;  5DEQ A;  1OPC A;  1XDS A;  3NRV A;  1WKM A;  2CG4 A;  3J81 K;  1W7P D;  2TDX A;  3VEP A;  2PLY A;  4K2E A;  3M8E A;  5ERI A;  3V7C A;  1MKM A;  3O6B B;  2PMU A;  1STZ A;  3V8J A;  3GZ5 A;  2WWY A;  3LQQ A;  2H6C A;  3DPT A;  3QP6 A;  5ICC A;  3G3Z A;  3SZT A;  4YG2 F;  1JXS A;  2RQP A;  4ZYH A;  1ZRE A;  4EJT A;  5H6Q A;  2OA4 A;  4HDV A;  4HV5 A;  3RDI A;  1ZYR F;  4G8X A;  3M9A A;  1KU2 A;  1I27 A;  3HSE A;  4ESF A;  3HHH A;  2L3D A;  1UB9 A;  1RI7 A;  1HSJ A;  1ZAR A;  3E5X A;  3RKY A;  1K79 A;  3K9T A;  3WTV C;  1CF7 B;  1DUX C;  1JE8 A;  1F5T A;  4HX8 A;  1REP C;  1FYL A;  2RGV A;  1ON1 A;  2BE5 F;  1ULY A;  2NS0 A;  3EDP A;  3ZN1 A;  4EV0 A;  2J5O A;  1SMT A;  2W85 A;  1B9M A;  5LGN A;  3V8L A;  3R4K A;  4L5I A;  4UV9 A;  5L3B A;  4ESJ A;  5BS6 A;  4NB5 A;  3FMS A;  4OMZ A;  1S3J A;  1UCR A;  4HV6 A;  2FU4 A;  1PP8 F;  3BOQ A;  4FT8 A;  2IP2 A;  1YS6 A;  2LKP A;  1UST A;  4EJU A;  2DBB A;  4IHT A;  4UUV A;  1D8J A;  3HRU A;  1ZGJ A;  2JTV A;  2ZXJ A;  5D5X B;  5E20 A;  2MBF A;  1YIO A;  2HKO A;  1B6A A;  4RGS A;  2XRN A;  1ZGA A;  3F72 A;  3QU6 A;  1W5S A;  3QOP A;  3R61 A;  4IHS A;  4Q47 A;  1H9G A;  3CTA A;  1K7A A;  2G7U A;  1CF7 A;  4G7O F;  2MH2 A;  3JTH A;  3GWZ A;  1MD0 A;  4BAY A;  1P6R A;  1XGM A;  2ZKZ A;  3MZY A;  3U9G A;  5E8I A;  2LSO A;  4A5N A;  2ZJ2 A;  2ACJ A;  1IXR C;  1ZAO A;  3DP7 A;  2YX4 A;  3HRS A;  5EEG A;  3WU1 B;  3K1M A;  2EB7 A;  4L9J A;  3PQK A;  2O8X A;  4HQM A;  1ZRF A;  2R3S A;  4XLN F;  1AOY A;  3WTT C;  2ZCW A;  3V8K A;  1RUO A;  2VE8 A;  3QRF F;  1HW1 A;  2QQ9 A;  4G6Q A;  1OYW A;  3J80 K;  3RYR A;  2DW4 A;  1R22 A;  4B8X A;  5BOX A;  4R79 A;  1TTY A;  2XIG A;  3EUH A;  4BQA A;  2FA5 A;  2DPU A;  2R7F A;  3DQV C;  2K7L A;  2HEO A;  2NNN A;  4G6D A;  2O0Y A;  4IXA A;  1XCB A;  4ENM A;  2J5P A;  4L9V A;  2GQQ A;  3VOD A;  1EH7 A;  1KQ9 A;  1G3S A;  1W4M A;  2DI3 A;  2VC0 A;  5BMZ A;  4OIQ F;  1R36 A;  5ILU A;  1U5T C;  3PFI A;  1H9T A;  2NYX A;  3S2W A;  4A6D A;  4ZYD A;  2DPD A;  5CVR A;  2OD5 A;  1IF1 A;  5FLX K;  3HSF A;  5F64 A;  3I59 A;  3GZ6 A;  3Q5F A;  1X3U A;  4M72 A;  5DD8 A;  1OR7 A;  1K78 B;  2ESH A;  3ELK A;  4EM1 A;  3HSR A;  1ZHF A;  1BI2 A;  1FPQ A;  2JT1 A;  3F8C A;  4HA8 A;  3V4G A;  2FE3 A;  3TDU C;  4BYY A;  1E17 A;  1I1S A;  2FSW A;  5L3G A;  2E7W A;  3ERE D;  4RB3 C;  1LEB A;  2RNJ A;  2LNB A;  3P9I A;  1PP7 U;  1FSH A;  1KQ8 A;  1U5T B;  2LF7 A;  3WTU C;  2E7X A;  5A2Q Z;  4DNC A;  3WOD F;  1IN6 A;  4IPA A;  2L01 A;  3KP5 A;  2COM A;  2DK5 A;  4WCG A;  2LF8 A;  3FWE A;  1QNT A;  3TQN A;  3F6O A;  1D8K A;  5LBQ A;  2IA1 A;  4M6Y A;  3IWZ A;  5HDK A;  3K69 A;  4IRH A;  2CSO A;  3MFK A;  2CFX A;  3NQO A;  1R23 A;  3L2C A;  3ISP A;  2NRA C;  2PJP A;  3FMR A;  2A6E F;  3F6V A;  2EV5 A;  3L9F A;  2FBI A;  3GW2 A;  2O03 A;  4S04 A;  2XVC A;  1FYM A;  2HTS A;  4Q5S F;  4B09 A;  1SD4 A;  4GYI A;  1ODD A;  4GXO A;  4M6X A;  4OIR F;  2BYV E;  3RKW A;  4KDP A;  1U5T A;  1HST A;  2XAJ A;  3LAP A;  4RS8 A;  2E1C A;  3ZMU A;  1Q1H A;  3KLN A;  1DPR A;  3F23 A;  3BDD A;  5CYV A;  4YFK F;  3OOP A;  3VFZ A;  4L9N A;  2RKH A;  1OMI A;  3VB2 A;  1U3E M;  1SFE A;  4Y17 A;  1J9I A;  5K5R A;  2H94 A;  1DPU A;  4I2O A;  3FZV A;  5HDN A;  2QQA A;  1B1B A;  2QZ8 A;  4D0P A;  2KJB A;  1NHA A;  2FBH A;  1EH6 A;  3E5Q A;  1IXS B;  2DQL A;  3H3U A;  2QM3 A;  2E1N A;  1HKT A;  4UVB A;  1LQ1 A;  3VOE A;  3FX3 A;  2P6T A;  3DPL C;  2OQG A;  3JAM Z;  1U8R A;  2ADU A;  2EWN A;  4ETS A;  1BJA A;  1QZZ A;  2DK8 A;  4QWQ A;  4MTD A;  3WGI A;  5DCM B;  3DKW A;  4AVP A;  3GFJ A;  2P5V A;  4AIJ A;  3KE2 A;  3ZPL A;  2MA3 A;  1W5T A;  2A07 F;  4IRG A;  2OQR A;  2ZNY A;  3EET A;  4YII A;  2P6S A;  3F8B A;  3MEX A;  1RZ4 A;  1MZB A;  3ZQ7 A;  2VOO A;  1IXC A;  3F22 A;  3PQJ A;  5HLH A;  4MHG A;  4RGR A;  5L3F A;  1FX7 A;  3H92 A;  5KK1 A;  3F21 A;  3HTU A;  5HOO A;  2VE9 A;  3CUO A;  5H20 A;  5HLI A;  2GWR A;  2IW5 A;  3Q9S A;  4E70 A;  1O3S A;  2H6B A;  5D5U B;  4ENK A;  4WXD A;  2FRH A;  1WSU A;  5DV5 A;  1U78 A;  3C18 A;  4M9Z A;  1FNN A;  2A69 F;  3Q9V A;  5DCM A;  3TOA A;  2F5D A;  1GHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...