2A3SA

Solution structure and dynamics of dna-binding domain of myocyte nuclear factor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
101
structure length
101
Chain Sequence
ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and Dynamics of DNA-Binding Domain of Myocyte Nuclear Factor
rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords Myocyte Nuclear Factor
total genus 15
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2a3sA00
2DBBA 1G3YA 2A3SA 2JPCA 1JGSA 3KP6A 1KQ9A 4FT8A 1KGSA 2R7FA 1YTYA 2ESHA 1SFEA 2DT5A 3SXYA 1WI9A 5BQTA 1ZREA 3F8FA 2L54A 5FFZA 1RIOH 1Y0UA 3LQQA 1E17A 2FBKA 3HRMA 1R00A 4HX4A 2D2WA 5BMZA 3G73A 5CVIA 4PDKA 4UV8A 3WTTC 3DXJF 3WE3A 4H0EA 4IRHA 1U5TC 2OQRA 2XGXA 3ISPA 3B02A 1FC3A 4HDVA 2Z33A 4I0AA 3BJ6A 3FZVA 1MZBA 2A6EF 5D6FA 1SFXA 2YU3A 5LRSA 1AWCA 2FXAA 4DQ2A 2HQRA 5HDKA 4RB2C 1YW8A 5E20A 1IF1A 2GIVA 5DCFA 2P5KA 4MQ9F 2CG4A 1K7AA 2P5VA 2V1UA 1QZZA 1SAXA 4ENMA 5JVTA 3RKYA 5J6XA 3JTGA 3M7GA 4ZZLA 2ELHA 4OMYA 3FX3A 2A61A 2P6SA 3GF2A 1U8RA 3ABUA 1S7AA 5J8CA 2FSWA 2KKOA 4F7ZA 1FLIA 2IJLA 1U78A 1ZYRF 2XHKA 1O57A 1XD7A 4ZZDA 3NRVA 3TDUC 2DO7A 1I27A 1Z05A 4G9YA 4AD9A 1XMKA 2MLKA 2V1DA 4N9IA 2A07F 3DQVC 3WTZA 3VODA 3NQOA 1T38A 3S2WA 3I71A 2PEXA 2FNAA 3QU3A 4L9TA 2A5YB 3KP7A 2CSOA 3VOEA 3ZMTA 4HX8A 4OIPF 4RGXA 2VOOA 2PG4A 3H3UA 4QWQA 3P9IA 3F8MA 1ZRDA 1FSEA 3J7AO 3GFMA 5LHIA 2ADUA 1MJAA 1U6GA 5ICCA 1VTNC 1Z9CA 3IL2A 4Z2YA 4LB5A 1H9TA 3IHUA 1ULYA 3DP7A 4WXHA 3I58A 3RIRA 5L3GA 1STZA 4HF0A 1OKRA 3D5LA 4AIKA 5HVQC 3W6KB 2HR3A 3F8NA 1FBUA 2RKHA 2QQ9A 2UZKA 3FMSA 3TOBA 5A2QZ 1Z6TA 5JR3A 3JSOA 2XASA 2CQKA 2ZKZA 5AONA 1W4MA 2O6GE 3M8FA 4HDUA 1R36A 1PP7U 4G6DA 4B09A 4EQQA 2PMHA 2P8TA 4MHGA 1LDDA 1BIBA 4A2UA 1HSTA 2H09A 1H9GA 3WTXC 3L2CA 1O7LA 1IAWA 3I59A 3GFIA 5DD8A 3Q9VA 1HQCA 2XIGA 3M1EA 2QZ8A 3QOPA 4XLNF 1KU3A 3JSPA 1K79A 2HWVA 1K78A 3HHGA 5ILUA 3E5QA 3ZMDA 1FYKA 3RTRA 3GWZA 1KQ0A 5E17F 2Z9OA 1UFMA 4EJUA 2W24A 1GXQA 1LDKB 3HSFA 1R1TA 2BYVE 2UXNA 3C3WA 3MWMA 1F4KA 2GQQA 4NQWA 2UXXA 2XROA 4UNOA 1SD7A 4ETSA 4AVPA 4ENNA 1GXPA 2Y0MA 4I0BA 1LB2A 3HOTA 2HEOA 2JPBA 2L02A 4U0YA 1ODDA 5K5RA 3KEQA 5HS7A 3KLNA 5TRDA 5HS9A 4G7HF 1SD6A 4ESJA 5H20A 3WTUC 2XKPA 1GVJA 2FMLA 3IC7A 5ICGA 3E6CC 5ERIA 5LEKA 1XGMA 4LLGF 3QU6A 1CF7B 1TNTA 1XDSA 4KIFA 4KICA 2ZJ2A 3J81K 1ON2A 3GXOA 3J81Z 5DD4A 1XCBA 1YYVA 1I1GA 3HTSB 2TDXA 4ENKA 2L3DA 4G94A 2ZFWA 4G8XA 1QNTA 1HSJA 2CO5A 1J2XA 3ZMUA 3E5XA 2RV8A 4L5JA 2BBYA 3MFKA 4KNYA 4YG2F 2CFXA 2WV0A 4ESFA 5HDGA 1BI1A 3E6DA 2Y75A 3EYIA 2K4BA 2HYGD 2HTJA 4I7HA 5LGNA 3BZ6A 1RNLA 4CHUA 2FNPA 2GAUA 5ED4A 4LG0B 4CDGA 4L0YB 2XAHA 4CYDA 2IW5A 1FYLA 3FXUA 2A6HF 3I59B 4HA8A 5H6RA 1SMYF 5E18F 2FQ3A 4L18B 2VT3A 5FLXK 3CJNA 3TQNA 1Z6RA 3QP6A 2RQPA 3GFJA 3L7WA 4O6JA 2ZBKA 1KU7A 1ZG3A 2DQLA 4L9NA 2MC3A 2Q2EA 5E8GA 2VN2A 4N9HA 4KN4X 2QM3A 3N4MA 1LEBA 2VXZA 1ZLJA 1YS7A 3GYHX 2EA2A 2BGCA 2HGCA 2V1XA 1X3UA 4GYIA 2IRFG 1GHCA 3FMQA 2VE8A 3FXRA 2NNYA 4KN7X 4XSZF 1TTYA 4KMUX 3REOA 2FOKA 5E8IA 2RN7A 1BM9A 1I1SA 1HKTA 1S3JA 2DPDA 3I64A 2QYOA 1UB9A 3AAFA 2F5CA 3BP8A 2VBXA 1XN7A 1EH8A 5LLQA 2QBYB 3H3ZA 2ZXJA 3BPVA 2GA1A 2FF4A 4ASNA 2ZNZA 1IRGA 5J8FA 1BI2A 4WF2A 2K27A 3IKVA 1C0WA 4BHBA 2DPUA 4OOIA 3ML6A 3U2RA 2QBYA 4Q4ZF 2P4WA 2K4JA 4CO8A 2H27A 1IUYA 5DEQA 1F9NA 1U5TB 4HQEA 4LD5A 2DQRA 1OR7A 1ZHFA 5LGUA 1XGSA 1S6LA 3WGGA 4YIFA 3H92A 1ON1A 3QPHA 1JXSA 4EMSA 1JE8A 4A0XA 2K02A 3CTAA 1G4DA 2L4AA 1OMIA 1QBJA 2VC1A 3BY6A 1OYYA 2H6BA 4KMFA 1BN5A 5FLXZ 1T6SA 2G7HA 3WGHA 5D5UB 4M9XA 4UVAA 3LWFA 3IKTA 3C18A 5CJ9A 4RB1A 1J59A 3RKWA 2QWWA 3ROUA 2H6CA 1LNWA 1AOYA 3BOQA 3QP5A 1SD5A 3KZYA 4HBLA 4Y15A 1WQ2A 2P5LC 2A69F 2OU2A 2EFQA 2HDCA 4OIOF 2EV6A 1BIAA 2FBHA 4XSXF 3SZTA 1SD4A 2ZCWA 4BNCA 2RC4A 4S04A 3KETA 2L4MA 1QPMA 4YFKF 1R5HA 4L9VA 3DPLC 4EJOA 2Q8KA 1YW7A 3COAC 3ZN0A 3LAJA 2ACJA 4U7DA 2ZMEA 1BOAA 4OIRF 1R22A 3DKWA 1YW9A 2PJPA 2V6CA 2YX7A 4A0ZA 3ZPLA 4ON0A 2ZO4A 4I02A 2IA1A 3FM3A 1FY7A 3BWGA 1NHAA 2FEZA 1HBXG 5IT9Z 3RKXA 2VT2A 4L5IA 1U2WA 5L3EA 2G7UA 2ETHA 3T0YA 4A12A 1HXDA 3VEPA 1XDUA 3U9GA 3Q5FA 4UHTA 1R1UA 2M30A 3GVAA 1MJ9A 1EH7A 2X0LA 1U3EM 2NNNA 3U1DA 1BBYA 2JT1A 2OZ6A 2OD5A 5ILVA 2HYFA 2EA4A 4S05A 1FOKA 3F72A 5LGTA 4MQVA 1YQAA 1J5YA 4EJTA 3BPXA 1UHWA 2BEOA 5HS8A 2YPRA 4MTDA 3V4GA 2PLYA 3DV8A 2X4HA 3KFWX 3F8BA 1YLFA 2V79A 3WE2A 4HQMA 2VOPA 4HV5A 3T1BA 2VBWA 4MEYF 2FBIA 4Q5SF 5HOOA 2NYXA 5D5VB 1OYIA 2KIUA 3PQKA 2B0LA 1I6XA 1QO0D 3I54A 3GFLA 1DUXC 2VONA 3MQ0A 5L3BA 1RI7A 3TDZC 4A6DA 2STWA 4IHSA 3SHFA 1W7PB 2R3SA 3ELKA 1TQIA 1PP8F 2CGPA 2NS0A 3BROA 1ZH5A 1OYWA 4MNUA 1I5ZA 3EUHA 2HS5A 2VBZA 3B73A 1USSA 1W5SA 2JRTA 5TJJA 2CWEA 2M8EA 3MAJA 1B4AA 3L00A 1IRFA 3WTWC 1K6OA 4Q47A 5AIPA 4KIBA 4Y17A 2XRNA 3MEXA 2QVOA 4PGHA 4RB0A 2JTVA 2BE5F 2DK5A 1DPUA 1BC8C 5CVJA 3WTSC 2QQBA 4HOBA 2PBIA 3E6BA 4EGYA 1PDNC 2DK8A 3CUOA 2RVCA 4KUMA 1JHFA 5IT3A 3GUDA 2RDPA 1J7KA 3KP3A 1XGNA 5HLIA 4OU0A 4M73A 3P7NA 2O3FA 1WSUA 1TQMA 2Q0OA 4G6QA 1T39A 1DDNA 3K69A 2DAOA 3WTYC 3HRSA 2XAQA 2QENA 3HUGA 3KLOA 3ECOA 3CDHA 3FF5A 2E7WA 2K86A 1XCVA 5F64A 2XV4S 3SZPA 2RGVA 1KYWA 2ISZA 1R23A 2W57A 1TW3A 2VBYA 4I01A 5KVRA 4K2EA 5AIQA 4WX9A 4RGUA 4HV6A 5DDGA 3JTHA 4LG0A 2OQGA 3LA3A 3RPQA 2YSRA 2EFOA 4R8HA 4ESBA 4JK1X 3E3VA 2P7VB 3TO9A 5E1XA 1XSXA 3BJAA 3G3ZA 4BQAA 1REPC 4R1HA 1P6RA 1UHMA 1FZPB 3E5UA 5LHHA 1A04A 2QLZA 2MH9A 4HZFA 4A5NA 1XB4A 4HX7A 2JSCA 3K1PA 2VODA 4IPAA 1BI3A 1T2KA 3F22A 3BJOA 3GZ5A 3CO7C 1G3TA 3RYRA 4AWXB 3WTVC 5K5QA 2M1BA 1ZARA 2JZYA 2XVCA 4TV7A 4RGSA 3FM5A 1W7PD 4E70A 1T98A 1YS6A 5KK1A 5FB2A 3DF8A 2J5PA 3EDPA 4IXAA 3V7SA 4ZYDA 1MD0A 1O3SA 2DTRA 1Z1DA 5BPIA 4KDPA 2LF8A 4Y13A 2LNBA 4O5VA 2W25A 2HKXA 4M6XA 4BHPA 1D8KA 1TBXA 4PCQA 1TNSA 5JHUA 1IXSB 4M72A 2HTSA 2DW4A 3VB2A 1FNNA 4LLNA 4L9JA 1KYZA 4YIIA 3HRUA 3DPTA 1IZ1A 2DLLA 5E1WA 4I2OA 1RUOA 4HW0A 4JQFA 2OBPA 1U5TA 5CYVA 2EB7A 2MBFA 1LQ1A 3C7JA 3WU1B 2ZMEB 1T0FA 3ZMSA 3M8EA 4HLXA 1SMTA 1Q1HA 1ZG5A 3RPUA 2OZUA 4GO1A 1G6NA 3WU0A 1KA8A 1YFHA 5LBQA 4KYWA 3MCZA 3I53A 4A0YA 3QPTA 3NEUA 2D1VA 5DCMB 3WGIA 3IWZA 2WWYA 4WXCA 4I09A 3O6BB 3FMRA 2CYYA 1ZAOA 2HFHA 2KRFA 4JBAA 3F6OA 4G7ZF 1QZYA 3ZMVA 4M9SA 3LFKA 1FSHA 2XAJA 3F21A 2COMA 4KT5C 1FPQA 5HDNA 3ZN1A 4OMZA 3J80Z 4L0ZB 3GEZA 3FXQA 1FBQA 1LJ9A 1P4AA 4EJVA 3K2ZA 4ENJA 3P9CA 1L0OC 5LHGA 2EFNA 2QQAA 4U88A 1FP1D 3T5XA 4GGGA 3R4KA 4M71A 1IXCA 3FWEA 5K1YA 4MTEA 3HTUA 2W84A 3J80K 2W85A 5A2QK 5IT9K 3R60A 3CUQB 1EH6A 4GCVA 5L3CA 2Z99A 2MA3A 4XRFA 2F5EA 3LSTA 1B59A 4EM2A 3E97A 3ZQ7A 2ESNA 2M45A 4KIGA 1E2XA 4BHCA 3LA2A 2PQ8A 3WG9A 2P7CB 3IWFA 2O03A 5JI6A 3ULQB 4RAZA 1UCRA 3HIFA 2G9WA 1YIOA 2KJBA 2XKOA 2H94A 3ECHA 1ZGJA 5CVVA 3KP5A 1B9NA 2RNJA 2NRAC 4BYYA 4EJWA 3EQLF 2FMYA 5FD5A 3T8TA 3LQRA 1RZ4A 5D4RA 1IW7F 3R0AA 2PN6A 2XUBA 4M74A 2IP2A 3E6MA 3ZP5A 5H6QA 4HF1A 1G3SA 1BJAA 4FX4A 3T8RA 1SFUA 3PQJA 4B8XA 3IRQA 5JFRA 1EV7A 1B1BA 2P6TA 2MH2A 2KIFA 3I5UA 4BAYA 3EETA 1Z91A 3R0JA 3W6JB 4EV0A 2QUFA 3C1DA 3K9TA 4LB6B 2YX4A 3R6SA 4CICA 2XAFA 1WRJA 4OINF 3RYPA 2KIMA 1TW2A 2AXLA 3IRRA 4HAMA 2ZNYA 3HSEA 4IHTA 1P4WA 3RJPA 4WCGA 1HW5A 3F8CA 4AIHA 3GLXA 1DP7P 2L01A 2LSOA 3TKYA 4D0PA 1J0RA 2IVMA 2R7DA 1O3QA 1D5VA 4UUVA 1S29A 4IVNA 2DI3A 3V8LA 1V3FA 2WC2A 3D0SA 3TOAA 5F6FA 4IF4A 2K7LA 4AIJA 4U7BA 2EV0A 1MKMA 3SFZA 5E1ZB 2F5FA 3DEUA 1FYMA 4KA4A 4UVBA 1O7FA 4LGWA 1J75A 4ZYEA 2PFBA 2PI0A 2NAZA 2GXBA 3QRFF 4O3MA 4HYEA 1R1VA 4OIQF 2J5OA 4IRIA 3QAHA 5FGMA 2IT0A 2CW0F 3EYYA 1MGTA 5FFXA 5DUKA 2DU9A 1ZRFA 1WWXA 4KFCA 4M6YA 3JAMK 1QQIA 2V9VA 3MZHA 2D45A 3VFZA 3V7CA 2FRHA 2FA5A 5HLGA 1MJBA 4MEXF 1XSDA 1KU2A 1USTA 1R58A 4P55A 1MDMA 3KZZA 4LMYA 2GWRA 5FO5A 5ICEA 1HKSA 4GYGA 5CVRA 5K5OA 1S8NA 2VC0A 4U0VA 3KEOA 5F1RA 3TGNA 2BV6A 1CGPA 1P4XA 2EK5A 3K0LA 3KE2A 4A5MA 3ERED 3LA7A 1S7OA 5DUIA 4YFNF 1L3LA 3OV8A 5EEHA 2IA2A 3HHHA 2FE3A 5HLHA 3TO7A 3KP4A 1LDJA 3ZMZA 2A68F 1HKQA 5D6EA 4RB3C 2HKOA 5DYMA 2MLGA 6PAXA 1K78B 1R5GA 1V4RA 3K1NA 1WKMA 1H0MA 4EVIA 2WTEA 5FD6A 1Z7UA 2OA4A 3Q9SA 3CLOA 4GXOA 5D5WB 1W5TA 1ZGAA 4CZZA 3K1MA 3O3KA 4CXFA 4RAYA 3N97A 1YO5C 3RI4A 3GZ6A 1F1ZA 4LFUA 2GXGA 3HSRA 4YFXF 4P5OA 4N0BA 2DFIA 2AS5F 4LLLA 3KCCA 3RDIA 1ZRCA 4ZH4F 5L3FA 2XAGA 4G7OF 4P9FA 3CO6C 1OPCA 4FHTA 2O8XA 1XGOA 4I98B 3F6VA 3F23A 1LVAA 4CGZA 4RGRA 4ZYHA 1D8JA 2EFPA 4XLPF 1ONVA 2E1CA 4EM0B 2GZWA 1O3TA 5D4SA 1HW2A 2VE9A 2E1NA 3R61A 4QLCU 3HYIA 4WK8F 1KU9A 4BXUA 4WXDA 3CUQA 1MDMB 1P2FA 2F5DA 4A6EA 1JHHA 4LK0F 1O3RA 1FWZA 2LF7A 1IN5A 1FT9A 4NB5A 3F3XA 3MZYA 4P9UA 4UV9A 5ILSA 1DPRA 5DV5A 4BH9A 2LKPA 4PZJA 4LJZF 2IA0A 1ZN2A 2YR2A 5DCMA 2EFWA 3GW2A 3V8JA 3PFIA 3HRTA 2EV5A 2F2EA 4LK1F 3LAPA 4R79A 1B9MA 1FX7A 1FP2A 1IN8A 1W7PA 3V8KA 1KQ8A 5EEGA 2EJRA 1LEAA 2IPQX 4U0WA 1HW1A 5LEJA 2LDUA 2Y48A 2Z5UA 1CF7A 1XSVA 1D3YA 1RUNA 1P92A 4IRGA 4FX0A 1BI0A 2FU4A 4HLYA 4HF2A 1FBSA 4IJAA 2OAZA 1J9IA 2EWNA 1TQPA 4WWCA 4PGGA 2ISYA 2HQNA 1IN6A 2E7XA 3V7RA 1ZG1A 2HOEA 3CUQC 5D5XB 1R7JA 3KP2A 3GO5A 2D1HA 1B6AA 4P96A 3O2PE 2M87A 1PUEE 2GA2A 5D8LB 2STTA 3WODF 1IXRC 5CLSA 3FHZA 4M9ZA 3SQNA 3OOPA 1YG2A 3I4PA 4NHJA 5BS6A 1QGPA 3TO6A 3M9AA 5D8KB 1G3WA 3DFGA 5BOXA 4ZYGA 5L3DA 3ABTA 2HZTA 2O61A 4UVCA 2KJCA 5CVUA 3L09A 4UXNA 1F5TA 3P9KA 3JAMZ 3GX4X 2MD5A 3I0TA 1BC7C 1IN7A 2C6YA 1TLHB 1ZLKA 5BPDA 4XBFA 4EGZA 2UWMA 3L9FA 1XMAA 2O0YA 4RS8A 5ICFA 4EM1A 2M5WA 3HOSA 5LRRA 3JW4A 2PMUA 2Z3YA 4Q48A 1IN4A 4DNCA 3BDDA 4MGRA
chains in the Genus database with same CATH superfamily
3S14J 2DBBA 3VPRA 1DGWY 1G3YA 3TL4X 2E19A 1U8BA 2A3SA 2JPCA 2V9KA 2Y30A 1JGSA 3KP6A 1KQ9A 4FT8A 1KGSA 2R7FA 4AC0A 1I50J 3FK6A 2XB5A 4UB6C 1YTYA 4I76A 2ESHA 1LKXA 1SFEA 1VI0A 2DT5A 3SXYA 5J4VA 3HGGA 3OL4A 1WI9A 5BQTA 2Z2SB 3L2VA 3B6AA 1ZREA 3F8FA 5CQEA 5GTHC 2L54A 1XC5A 3Q0UA 2DA1A 5FFZA 4I6ZA 3C2GA 2W7NA 1RIOH 1Y0UA 3LQQA 1Y0NA 3PNVA 3HOUJ 1E17A 2R93J 1OCOH 2FBKA 2Y9YA 4XONA 3HRMA 1R00A 4HX4A 2D2WA 5BMZA 2KISA 1HOMA 3G73A 5CVIA 5FRMA 2K5CA 4BDYA 4PDKA 1RC9A 4YEJA 2TCTA 4UV8A 3WTTC 4G12A 3DXJF 4FASD 2PX9A 2NVYJ 1RPWA 3WE3A 4HSTA 4H0EA 1OCTC 3LSHA 3PNTA 4IRHA 1U5TC 3DEEA 4N4NB 4AVZA 2OQRA 2XGXA 3ISPA 3OYAA 3QWLA 4HPQA 3B02A 3L2QA 2R5ZB 1FC3A 4HDVA 5M5XJ 2Z33A 4I0AA 3BJ6A 2L9SA 5KAIC 2HQAA 3FZVA 1MZBA 2A6EF 5D6FA 4HNVA 1SFXA 1TT0A 2YU3A 5FRNA 5LRSA 2ZSHB 1AWCA 2FXAA 5GP9A 4DQ2A 2HQRA 4BU2A 3H0DA 4AM3A 5HDKA 4RB2C 1WJ5A 1YW8A 2PMZA 5E20A 1IF1A 2F48A 2GIVA 2K9MA 5DCFA 3JRHA 2P5KA 4MQ9F 4ZC3A 2CG4A 2M8GX 3QYBA 1K7AA 2FUG2 2BY0A 4X1EA 2Z16A 4XKCA 1MMNA 3DTEA 1DP3A 1G59A 2ELJA 2JA8J 2P5VA 2V1UA 1QZZA 3K10A 2LD5A 1SAXA 4ENMA 4XKVA 4XNFA 5JVTA 3NARA 3CCRI 3RKYA 5J6XA 2E1MB 3M7GA 4ZZLA 2ELHA 3JTGA 3SFIA 4OMYA 3FX3A 2A61A 4XRSG 5K7ZA 2P6SA 3GF2A 1U8RA 1BA5A 2HNHA 3ABUA 1S7AA 5J8CA 1PUFB 2FSWA 1SVLA 1IO2A 2L7KA 1MBHA 1OCPA 3PO2J 2XGDA 1APLC 4FQGA 1T0FC 1Q1VA 2KIQA 2KKOA 5BNGA 1BR1A 1YJWI 5KCMA 2EZHA 1QHHD 4F7ZA 3Q0WA 3ZQCA 1FLIA 1RESA 2IJLA 2JUGA 1U78A 1ZYRF 2ZC2A 2XHKA 3VWBA 2XDVA 1O57A 1KZHA 1XD7A 3OMYA 5KAFC 4ZZDA 3OL3A 2WAQN 2V26A 3NRVA 4D5FA 3TDUC 2W4SA 3DBHB 2DO7A 2YS9A 1I27A 1Z05A 2PJRB 3RCOA 3SEQA 4E4HA 4U87A 4G9YA 4AD9A 1XMKA 2ZXHA 3C2BA 3H1CA 2MLKA 3NWSA 2V1DA 4N9IA 2A07F 3DQVC 4L5EA 3WTZA 1ETYA 3VODA 5EG0A 3NQOA 4BL0B 2R7RA 1T38A 3S2WA 2R0QC 5M5WJ 3I71A 2PEXA 2FNAA 3QU3A 3JRGA 1MBGA 4L9TA 3QYFA 2A5YB 3KP7A 2EINH 2MC4A 2CSOA 4NC7A 4RA2A 2KZVA 4LITA 4HX8A 3VOEA 3ZMTA 4OIPF 1WI3A 4RGXA 2R7SA 2VOOA 2AQEA 2PG4A 4QPOA 3H3UA 4QWQA 3P9IA 1D5YA 3F8MA 1ZRDA 3A0BC 2ZFUA 1FSEA 1WPKA 3GFMA 4CSWA 2EH3A 3H5AA 2CQQA 5F27A 5LHIA 2ADUA 3J7AO 1MJAA 1U6GA 5ICCA 1GT0C 1VTNC 1Z9CA 2IGMA 3FXJA 3IL2A 1R71A 3IH4A 4Z2YA 3OYMA 1FEXA 5B66C 4LB5A 3CJTB 1H9TA 3KZIC 3IHUA 3Q0VA 1ULYA 3W2VA 3DP7A 1Z77A 1W36D 4WXHA 2VLAA 4X6AJ 3I58A 4UY8I 4BXXJ 3RIRA 2OF7A 5L3GA 1STZA 2QF7A 4HF0A 1OKRA 3D5LA 3MKLA 5HVQC 4AIKA 2CUZA 3S3MA 5KNLA 3W6KB 3S17J 2HR3A 3PSIA 3F8NA 4BGDA 1FBUA 1VQLI 2RKHA 2QQ9A 4RM3A 2UZKA 2ZJPF 5J47A 3FMSA 3TOBA 5A2QZ 1Z6TA 2NVXJ 3GTPJ 5JR3A 2A05A 3JSOA 3CP2A 3CF2A 2XASA 2CQKA 1X3WB 3KYDB 1VQ6I 4LOCA 4A3DJ 1ENHA 1ERDA 3IAM2 2RAEA 2ZKZA 3I56I 1ZR2A 4C3IJ 3UR3C 3BCBA 1ZQ3P 2H8WA 3RQ4A 2AHQA 5AONA 2X85A 4MFDA 1W4MA 2O6GE 2K40A 5EGOB 3M8FA 1I39A 2R7ZJ 4HDUA 1R36A 1PP7U 4G6DA 4B09A 2HPMA 4B44A 2DMNA 4EQQA 2PMHA 3H5RA 2YU9J 2P8TA 4MHGA 1LDDA 1F43A 1BIBA 4FISA 4A2UA 1ETVA 1NK2P 3BG6A 1ACIA 1HSTA 2H09A 1H9GA 3WTXC 2EIKH 4Y3OA 3L2CA 1O7LA 3HKZA 3BT9A 1IAWA 3I59A 3GFIA 5DD8A 2R7OA 3Q9VA 3RZOJ 3GBGA 2HOAA 1HQCA 2WAEA 2XIGA 3CZ6A 3M1EA 2QZ8A 3EUKL 3QOPA 4RM2A 4XLNF 1KU3A 3RKQA 4OWRB 2QKMB 3JSPA 1T95A 4CYCB 1K79A 2VJIA 5FJ8J 2HWVA 3A2KA 2BXYA 1K78A 2X6OA 1JTYA 4YIRX 1ORKA 3HHGA 3W6VA 4A3IJ 2IGNA 5ILUA 1U9NA 1ZGWA 3RPUD 3E5QA 3ZMDA 4DIQA 1FYKA 3RTRA 3GWZA 1KQ0A 1TC3C 1SANA 5DM7F 3LFUA 5E17F 2Z9OA 1OFCX 1UFMA 3FIWA 4EJUA 2W24A 4GFBA 4ITVA 1GXQA 1YIJI 2WADA 1LDKB 3HSFA 2XSDC 1ETWA 2XF6A 3M8JA 1R1TA 4LG3A 1A31A 2BYVE 3A01B 2UXNA 1PYVA 1TWGJ 3C3WA 3MWMA 1F4KA 2GQQA 4NQWA 1Z21A 3SJMA 2UXXA 2XROA 2ZXIA 3P5JA 4UNOA 1SD7A 3IH2A 4ETSA 3MKWB 2IAIA 4AVPA 4ENNA 1K4SA 1GXPA 2Y0MA 2K9SA 4I0BA 1LB2A 3HOTA 2HEOA 2JPBA 1WH5A 1WJEA 2L02A 4U0YA 1ODDA 2D5VA 5K5RA 1JI8A 3KEQA 4Y4RA 5HS7A 3KLNA 5TRDA 3OR2C 5HS9A 4G7HF 1SD6A 4ESJA 2NS8A 1YHQI 2IGKA 5H20A 3VYRB 4DZPA 2P81A 3WTUC 1N75A 3CCVI 2XKPA 1GVJA 3H9GA 4M3FA 4BJTA 4E7JA 2FMLA 3IC7A 5ICGA 1W36C 3CQZJ 3E6CC 5ERIA 1JKOC 5LEKA 3H36A 3GMEA 5E79C 1VNDA 4A3LJ 1XGMA 2H1LA 4LLGF 4C2UA 3LOCA 4A3KJ 3QU6A 2DMQA 4BE1A 1W0TA 1CF7B 1TNTA 2VL8A 3OYKA 1XDSA 4KIFA 1RR8C 4KICA 2ZJ2A 3J81K 1YJ9I 1ON2A 3GXOA 1IDYA 2CW8A 3J81Z 4E7KA 1I3QJ 3LSGA 5DD4A 1PVEA 1XCBA 1YYVA 4JX5A 4A3FJ 1I1GA 3HTSB 2ID3A 2TDXA 4BUPA 4CH7A 3OYLA 3K4LA 3CCJI 4CCOA 1WZ2A 4LIVA 4ENKA 1UG2A 1OR7C 2L3DA 4G94A 3BZCA 2ZFWA 2QCOA 5EDNA 2M34A 2BY1A 1T8IA 4G8XA 2X1CA 2XF7A 1QNTA 1HSJA 2QSFX 4PSXA 4M6VA 2CO5A 3DKXA 1J2XA 3ZMUA 2ICWG 4NQWB 1VFCA 3E5XA 1K61A 2RV8A 3OS0A 2IS2A 2AXTC 2FJ1A 4L5JA 3W2WA 2K9QA 3H9QA 2BBYA 3MFKA 1TWAJ 4KNYA 3TP0A 4BACA 4YG2F 2JVGA 2CFXA 3DBRB 3ESWB 2WV0A 4ESFA 3G1OA 5HDGA 1BI1A 3G6EI 4Y52J 3E6DA 1SFKA 4F91B 2VKEA 2EPFA 2Y75A 3EYIA 2K4BA 2HYGD 2HTJA 2NS7A 3CD6I 3I4MJ 4I7HA 5LGNA 4E7HA 3BZ6A 4XICA 1ZELA 4XORA 4E7LA 2Z1DA 1RNLA 3HPHA 4V2FA 2FNPA 4CHUA 2GAUA 5ED4A 2LFBA 4QSHA 4LG0B 1R4NB 4CDGA 2LKXA 4L0YB 3IV5A 3K4NA 3BR1A 2WBMA 2XAHA 4CYDA 4KISA 2IW5A 1FYLA 3FXUA 3OYFA 2JN6A 2A6HF 3I59B 4XMYA 4HA8A 2VJ5A 5H6RA 1SMYF 1QVUA 1A6QA 5E18F 2FQ3A 4L18B 3TBIA 2VT3A 5FLXK 3BG5A 3CJNA 3GTMJ 2WAQA 2OTJI 3TQNA 1Z6RA 2H1KA 3HUGB 4GRIA 3QP6A 1PJRA 5FKKA 3Q3SA 3BTLA 1ETQA 2RQPA 3GFJA 3L7WA 2XRLA 4O6JA 3CC7I 2ZBKA 1KU7A 1ZG3A 2DQLA 4L9NA 2MC3A 2Q2EA 5E8GA 3G2BA 4RDUA 2VN2A 4CCKA 1TL8A 1WFXA 4N9HA 4KN4X 2EBIA 3J7AY 1R5ID 2QM3A 1D1BA 3H35A 3N4MA 1Z67A 1LEBA 2VXZA 5EZHA 1X4OA 3M3YJ 2O5RA 1ZLJA 3CMYA 3CCSI 1R49A 1YS7A 3GYHX 5IYCJ 2EA2A 1T33A 2BGCA 3DTIA 3RSNA 2HGCA 2V1XA 1OLTA 4CUGA 2IXSA 1X3UA 1A5JA 4XLEA 4GYIA 2IRFG 3S93A 2XPWA 2DA4A 1GHCA 3LSIA 3FMQA 2VE8A 3FXRA 2NNYA 4KN7X 4XSZF 3W3CA 2HQ5A 1TTYA 2EIMH 4KMUX 3REOA 2FOKA 5E8IA 2RN7A 3SDGA 1BM9A 2GBYA 2HYJA 1I1SA 1HKTA 4D9JA 1S3JA 1YI2I 2M0CA 2IEKA 2DA3A 2CFOA 2DPDA 3I64A 2NOGA 1UB9A 2QYOA 1ZK8A 3AAFA 2LMDA 2F5CA 2X9DA 3FBIB 3BP8A 2I8DA 3HJEA 4BQNA 2VBXA 1Y8RB 1XN7A 3CMEI 1EH8A 5LLQA 2QBYB 3H3ZA 2Y69H 2ZXJA 3BPVA 2GA1A 2JA5J 5EEAA 4NBQA 2FF4A 2GXAA 4ASNA 2ZNZA 3OYDA 2VKVA 1IRGA 5J8FA 4MLOA 4C3JJ 3SEZA 4HRIA 4NC6A 2VUMJ 2DA7A 1BI2A 4WF2A 3HBLA 2K27A 3IKVA 1C0WA 4BHBA 2DPUA 4OOIA 3ML6A 3U2RA 2X6XA 2QBYA 1IC8A 2Q2EB 4Q4ZF 2P4WA 2EILH 2K4JA 4CO8A 2L5QA 4BDZA 4PJJA 3GZNB 5FLMJ 2H27A 3UKGA 1IUYA 5DEQA 5J1YA 1F9NA 1U9OA 1U5TB 4HQEA 2DA2A 2ZSIB 3OIQA 2DTZA 4LD5A 4AYBA 2DQRA 5J3LA 1OR7A 1SVMA 5GPAA 1ZHFA 5LGUA 1LFBA 1X1BA 1XGSA 1PUFA 1S6LA 3WGGA 4E7IA 2L2OA 4YIFA 1MIJA 2ZJRF 3NAUA 3H92A 3F9KA 2GIZA 3G1LA 2R5ZA 1ON1A 3QPHA 4CCNA 2CV0A 4EMSA 1JXSA 1RKTA 3M4OJ 3BR0A 1JE8A 1MNMC 4A0XA 2V4JC 2DDBA 2KDZA 2K02A 3CTAA 1MSFC 1G4DA 2L4AA 1E3PA 1OMIA 4F3QA 4N4OB 1QBJA 2E2JJ 2VC1A 3BY6A 1OYYA 3S16J 4DZJA 2R92J 2H6BA 2XB0X 2Y0SN 5IP9J 4KMFA 2IGOA 1BN5A 4IHXA 2VASA 4XL9A 5FLXZ 1T6SA 2G7HA 3WGHA 5D5UB 4M9XA 4UVAA 3LWFA 3IKTA 3C18A 1YE9A 2JA2A 5CJ9A 1VQKI 1I6HJ 3OYGA 1G2HA 4JOMA 4RB1A 2BHYA 3KX2A 1J59A 3RKWA 3ZGKA 1SEUA 1D1AA 3BTIA 2I10A 4UUSA 1I3AA 2E1MC 4E7ZA 2QWWA 3ROUA 2ZB9A 3S15J 2H6CA 5JLXA 1LNWA 1AOYA 3BOQA 3QP5A 1SD5A 2XAUA 3KZYA 4HBLA 1POGA 4Y15A 1WQ2A 2P5LC 3G1MA 2A69F 2OU2A 1OQYA 2EFQA 1XPXA 3CESA 4IX7A 2HDCA 2EV6A 4OIOF 3OS2A 1WVRA 2FD5A 1BIAA 2FBHA 4XSXF 3SZTA 1SD4A 1FOWA 2ZCWA 4BNCA 2RC4A 4P1WA 4S04A 3KETA 2B63J 3A02A 4F55A 2L4MA 1QPMA 5F0HA 2X6YA 4JX4A 4YFKF 1R5HA 1MW7A 4L9VA 3DPLC 2E1OA 1S9HA 4D5CA 4EJOA 5EF6A 1FTZA 2Q8KA 1YW7A 2XSJC 2W82A 4DOZA 5E3MA 1IDZA 1LE8B 5K7HA 4M3EA 3COAC 3ZN0A 3LAJA 4HEA2 2ACJA 4U7DA 4KITB 1FMWA 3OYNA 2ZMEA 4BEHB 1BOAA 3FXLA 4CCJA 4OIRF 1R22A 3DKWA 1YW9A 2PJPA 2V6CA 5IOYA 2YX7A 4A0ZA 4FE7A 1YX3A 4C2TA 3ZPLA 2CU7A 1X2NA 4ON0A 3JRBA 1VQ4I 2ZO4A 4I02A 2IA1A 2L0KA 2F4MB 3KYLA 3FM3A 1FY7A 2WY7Q 5M5YJ 3BWGA 1CQTA 1NHAA 2FEZA 1XS9A 1HBXG 5IT9Z 3RKXA 2VT2A 3EUHC 4L5IA 3CDIA 1UJ8A 3TMOA 5JLWA 3IH3A 1U2WA 4DBQA 5L3EA 2G7UA 2ETHA 3T0YA 2CUFA 4A12A 1HXDA 3G71I 1K4TA 4II2A 1BW5A 3VEPA 2W1OA 1XDUA 3U9GA 3OY9A 3Q5FA 3KYCB 4UHTA 2E71A 2LK2A 3S3NA 2M7AA 2R7QA 1MNEA 2KDOA 3VYSB 4ABZA 1R1UA 2M30A 1TT5B 2WAFA 3GVAA 1MJ9A 4DBRA 1EH7A 2X0LA 2IS6A 2KRHA 1U3EM 4PJMA 9ANTA 2NNNA 3U1DA 1BBYA 2JT1A 2OZ6A 2E60A 2HVRA 2JA6J 2DMPA 2E2HJ 1Y1WJ 3BQZA 2OD5A 1W0UA 1IV8A 1WJDA 5ILVA 4CYCA 2HYFA 2EA4A 4S05A 1FOKA 2HOTA 3F72A 5LGTA 2KFDA 3MD2A 4MQVA 3TW7A 1YQAA 1J5YA 3L2WA 3SDBA 1E3OC 2BY3A 3HGYA 4EJTA 4XLCA 3BPXA 2IBDA 1UHWA 2WA0A 2BEOA 2CMPA 5HS8A 2YPRA 4MTDA 2R7XA 3V4GA 2PLYA 4BY7J 3DV8A 2X4HA 3A4CA 3F8BA 2KZGA 1YLFA 2V79A 1ETKA 3KFWX 3WE2A 4C2MJ 2CV1A 4HQMA 4NUBA 1X4PA 3LSMA 2LY9A 2X6WA 2JSPA 3VYTB 2PMZN 1SFOJ 4XRMA 1ZTRA 2DCEA 2DOAA 2VOPA 4HV5A 3T1BA 1ETXA 2VBWA 4MEYF 3CF5F 2O9LA 2M0MA 2FBIA 5DM6F 4Q5SF 4B43A 2NYXA 5HOOA 2CJJA 2KMUA 5D5VB 1OYIA 2KIUA 3PQKA 2B0LA 2OV7A 1T56A 1I6XA 1QO0D 2ECBA 3U21A 2V6EA 3HOWJ 3I54A 2ZXWH 3GFLA 1MBEA 1DUXC 2VONA 3MQ0A 5L3BA 1F36A 1N77A 2LBFA 2KT0A 1RI7A 3TP3A 3I3LA 3TDZC 3ASOH 4A6DA 2DT7B 3S2DJ 2STWA 3HPGA 1R4MB 2KQRA 4IHSA 2K9LA 3SHFA 3GTQJ 4FTHA 1W7PB 2R3SA 3ELKA 1Y56A 4CCMA 1TQIA 1PP8F 1OJLA 2CGPA 2NS0A 3PO3J 4F52A 3BROA 3DLAA 2VQGA 1OYWA 4M3DA 4MNUA 5J1UA 1ZH5A 1I5ZA 2DFEA 3EUHA 2HS5A 3DPUA 2WB1N 3OSFA 3C2HA 2VBZA 2LBFB 3B73A 1USSA 1W5SA 2JRTA 2VJ4A 4MO7A 1GLNA 5TJJA 2CWEA 1FOXA 4C30A 3FISA 2M8EA 3MAJA 2B7EA 1B4AA 2R5YA 2LYCA 3L00A 2VPLA 4M3BA 1IRFA 3WTWC 5JHFA 1K6OA 4FE4A 2DT6A 2F4OB 4JX6A 3GTKJ 2MSYA 2NOJB 4Q47A 3O8GA 2DFFA 2LY2A 2CW7A 5AIPA 4KIBA 2E5NA 4DW6A 4Y17A 2XRNA 3K4KA 2QVOA 3MEXA 4PGHA 4RB0A 2JTVA 2BE5F 3DCFA 3AKZA 3A0HC 3OYHA 3AG2H 2F6CA 2DK5A 1LFUP 3WHBA 1R6RA 1H89C 1DPUA 5CVJA 2QQBA 3WTSC 1BC8C 4HOBA 3HDDA 3ZR8X 1EKEA 1GUUA 2PBIA 3E6BA 4BXFA 4EGYA 3CCUI 1PDNC 2N8GA 2DK8A 3CUOA 2QSGX 1X1AA 2RVCA 4KUMA 1JHFA 2LY1A 2M4KA 5IT3A 3GUDA 2Q1ZB 2RDPA 1J7KA 3ABLH 3KP3A 1XGNA 5LD2C 5HLIA 4OU0A 4M73A 4DYQA 3P7NA 2O3FA 3CP8A 1X2MA 3PJRA 1J09A 2DMTA 2R7VA 1WSUA 1TQMA 2Q0OA 4G6QA 4XM3A 4GDFA 3KEYA 1T39A 3QPSA 4A3EJ 1DDNA 4CCLA 3AL0C 3K69A 2DAOA 3OR1C 3CMMA 3WTYC 3K2AA 2CRGA 3HRSA 2XAQA 3ZXSA 3H5NA 2QENA 3HUGA 1UZCA 2LP0A 3KLOA 3ECOA 3CDHA 3FF5A 2L7MP 1QPIA 2E7WA 2R5YB 2K86A 3AG1H 2X51A 2BHZA 1XCVA 5F64A 2XV4S 3SZPA 3ZCOA 2JVHA 1JUMA 4A3JJ 2I5UA 2RGVA 1KYWA 3HL2A 2LREA 2ISZA 1R23A 1OCZH 2NVQJ 2W57A 3TEDA 1NG6A 3K70C 1TW3A 1AA7A 4ZYAA 2VBYA 4I01A 3S1NJ 5B1BH 5F0CA 5KVRA 4K2EA 4JP0A 5AIQA 4WX9A 4RGUA 4HV6A 5DDGA 4QPQA 3JTHA 4B48A 4LG0A 1IRXA 1AHDP 2OQGA 1TWFJ 3K4MA 2VIXA 3LA3A 4PUSA 1X19A 2DJNA 2H8RA 2EZKA 3ZQLA 3RPQA 2F5VA 2YSRA 3JRFA 2EFOA 2E36A 4R8HA 3B6CA 2CUEA 1WJFA 4B3AA 4ESBA 4UUSB 4JK1X 3E3VA 2P7VB 3CDLA 2HU9A 3OIOA 3TO9A 5E1XA 5KHDA 1XSXA 3BJAA 1SC7A 3G3ZA 3HXLA 3GTJJ 1NG7A 4BQAA 2ZJQF 1REPC 4KJZA 4R1HA 1P6RA 2QGUA 1A36A 1UHMA 1FZPB 3E5UA 5LHHA 2HVSA 1A04A 2QLZA 4IHYA 1GVDA 4W1UA 2WV1A 2MH9A 2X48A 1MH3A 2VJJA 4HZFA 2CQ7A 4A5NA 4RMNA 3S3OA 2QA4I 1XB4A 4HX7A 2JSCA 1YX5A 3K1PA 2VODA 4IPAA 1BI3A 1T2KA 3VYUB 1BL0A 3F22A 2COBA 3BJOA 3GZ5A 2LOOA 3CO7C 1MMGA 3HG9A 1G3TA 3RYRA 3WG7H 4AWXB 4H4KC 5J4YA 5K5QA 2M1BA 3WTVC 1TWHJ 1ZARA 2JZYA 3OYBA 2XVCA 4TV7A 2EIJH 1N78A 1EA3A 4RLFA 4RGSA 3CLQA 5C3EJ 4CA0A 3AG4H 1W1WE 3FM5A 1W7PD 4C3HJ 1DQUA 4IL6C 4E70A 1T98A 4V19K 2W00A 4HG2A 1HA8A 1YS6A 5KK1A 5FB2A 3H3VK 3DF8A 2J5PA 2O7OA 3EDPA 1WCMJ 2DN0A 4XLAA 1IGNA 4IXAA 3V7SA 3CCMI 1V5GA 3MZ8A 1WHUA 4XOTA 4ZYDA 1MD0A 2CH0A 2LH9A 1O3SA 4IEJA 3OYEA 2DTRA 1Z1DA 5BPIA 4KDPA 2LG4A 2OTLI 5M3FJ 2LF8A 2XGCA 2TRTA 4Y13A 2LNBA 4O5VA 5FLVA 2W25A 2HKXA 4M6XA 4D1QA 3K7AJ 4BHPA 2RNGA 1D8KA 1TBXA 3S1QJ 4PCQA 1TNSA 2VPRA 5JHUA 1IXSB 4M72A 2HTSA 2JQ7A 2DXIA 3ERMA 3PL8A 2DW4A 4D7NA 3RQIA 3CCYA 3VB2A 1FNNA 1JTXA 4LLNA 1Y8QB 2Y2ZA 4L9JA 1MMDA 5CQGA 1VQ9I 5FKOA 1KYZA 4YIIA 3HRUA 3DPTA 1IZ1A 4HNUA 3QYEA 2DLLA 5E1WA 4I2OA 4F92B 2DOFA 1RUOA 1JKQC 4HW0A 1GV5A 4EEFG 4JQFA 3JREA 2OBPA 2V1NA 5FKNA 1U5TA 3H9JA 5CYVA 4BJ6C 5IY5H 4PFOA 1D1CA 4XLFA 5EGOA 2DA6A 2AO9A 2EB7A 2MBFA 4C9YA 5C44J 1LQ1A 3TW6A 3C7JA 4S0HB 3WU1B 2HPIA 2ZMEB 4BEHA 1T0FA 3ZMSA 3M8EA 1X1PA 4HLXA 1SMTA 3A1YA 1RRJA 1Q1HA 1ZG5A 1D0YA 3RPUA 2K9NA 2OZUA 4GO1A 1MSEC 1G6NA 3WU0A 1KA8A 2DYRH 2CV2A 2UV1A 1YFHA 5LBQA 2BY2A 2HVQA 4KYWA 1BR2A 3MCZA 2YUSA 3I53A 2EZLA 1P7IA 4A0YA 3QPTA 3GTLJ 3NEUA 3CCEI 5FROA 2VB6A 2VQHA 2D1VA 3HC7A 1JKRC 3BR2A 5LFAA 5DCMB 2XF5A 2QEXI 2JK3A 3IWZA 3WGIA 1JJ8C 1LPQA 2DA5A 1V54H 1X58A 4E7SA 2WWYA 4FETA 1BOBA 4WXCA 4I09A 4G6TB 1P7JA 1XTAA 3O6BB 3A01A 3S2HJ 3FMRA 2CYYA 2QQ8A 2FX0A 5E3OA 1ZAOA 5TGTA 2RREA 5J1RA 1BJZA 2HFHA 2KRFA 4JBAA 1IRZA 3F6OA 4BE0A 4G7ZF 1QZYA 4IQJA 3IAS2 4AUXA 2MGQA 3ZMVA 3ASNH 3LFKA 4M9SA 2B9SA 4XK4A 1FSHA 2XAJA 5EYRA 1B72B 3F21A 2COMA 3FXKA 4KT5C 5DTDA 1FPQA 3BLYA 5HDNA 4BE2A 3FXMA 3OS1A 2OUMA 2UUZA 3AFHA 3GCMA 3JR9A 2A5WA 3MVPA 3ZN1A 1VQPI 4OMZA 1Y6IA 3J80Z 2F4IA 4L0ZB 3GEZA 3FXQA 1FBQA 3DEWA 1LJ9A 1P4AA 4EJVA 1MH4A 1VQ5I 3K2ZA 4ENJA 3P9CA 1L0OC 3PUBA 5LHGA 4NDLA 2BVLA 2EFNA 1XG1A 3HEFA 2FOWA 4ZDOA 3S32A 3DU6A 5IP6A 1QVTA 2QQAA 4U88A 5DS9A 2KP6A 3OYJA 4RLQA 4J00A 3K6GA 1FP1D 3HOXJ 2FQ4A 1IJWC 3LSPA 3T5XA 4GGGA 1FIPA 4D7MA 3R4KA 1HCRA 1WGXA 4M71A 1IXCA 3FWEA 5K1YA 1DU6A 4MTEA 4ZDPA 3HTUA 2LKSA 2W84A 2W85A 5GAGJ 3J80K 5A2QK 4FCYA 5IT9K 3R60A 2BOLA 3CUQB 3EUAA 1EH6A 4GCVA 5L3CA 3PUFA 2Z99A 3K4CA 2MA3A 5B1AH 2A6TA 4AYBN 1M1EB 4XRFA 2F5EA 3HKZN 3BR3A 3LSTA 1B59A 1B72A 4EM2A 3DKYA 3HZJA 3RZDJ 3E97A 4HSRA 4XR6A 3IUOA 4A3BJ 2L7ZA 3ZQ7A 4BKXA 1QU3A 1LVKA 2ESNA 3N05A 4PFPA 3CCLI 2M45A 2RQQA 1E2XA 1UG0A 4KIGA 4BHCA 3LA2A 2Y9ZA 2PQ8A 3WG9A 2P7CB 1E3HA 3IWFA 2O03A 5JI6A 3ULQB 4RAZA 1UCRA 2K3PA 3HIFA 2G9WA 1YIOA 2XKOA 1MBKA 2KJBA 2H94A 3ECHA 1ZGJA 5CPRB 2MYSA 4BS9A 5CVVA 3L2RA 3KP5A 1B9NA 3LSKA 2RNJA 2NRAC 4BYYA 4EJWA 3EQLF 3H0GJ 1V5EA 2FMYA 5FD5A 1RKWA 3T8TA 1DU0A 1R9TJ 2VKDA 3LQRA 1RZ4A 3PIOF 3CC4I 5D4RA 1IW7F 4OAZA 3R0AA 4XLHA 2PN6A 2MW8A 2XUBA 1OISA 3GLLA 2G0EA 4A3GJ 2E5ZA 4M74A 2IP2A 2GOXB 5GTIC 4AU7A 5EG0B 3E6MA 3ZP5A 2OCCH 5H6QA 4HF1A 1WH7A 3OWTA 1G3SA 1BJAA 4PJ0C 4FX4A 2LLKA 3T8RA 1SFUA 3LL7A 3PQJA 4F93B 4B8XA 5HNHA 5HNFA 3IRQA 5JFRA 1EV7A 1S5LC 1B1BA 2P6TA 1YRNA 1U0JA 2MH2A 3PM1A 1Y39A 2KIFA 3I5UA 3JCUC 5GPCA 2XPUA 4BAYA 1JJ6C 3M07A 3EETA 2ECCA 1Z91A 3ABMH 3R0JA 4HNTA 3W6JB 3JRCA 4EV0A 2QUFA 3C1DA 3K9TA 1VQ7I 3VSKA 1GDTA 1P9QC 2OPTA 1MMAA 4LB6B 3MKYB 2YX4A 5B5EC 4XOPA 2E35A 1N25A 3CCQI 1Z3XA 3R6SA 4CICA 2XAFA 4JYKA 4B3XA 2KL4A 1WRJA 4OINF 2DFHA 3BR6A 4W97A 3RYPA 1HLVA 2KIMA 1TW2A 2AXLA 2L9RA 3BTJA 3IRRA 4HAMA 2IS1A 2ZNYA 3HSEA 2VKHA 3HM5A 4IHTA 1P4WA 2LRDA 4MIMA 3RJPA 4WCGA 3FBNB 1A6IA 3W2AA 2LTPA 1HW5A 3F8CA 4AIHA 3L1PA 3GLXA 1DP7P 2L01A 2LSOA 1FJLA 3TKYA 4D0PA 1ITYA 4ZDLA 1J0RA 3CC2I 2IVMA 1FOYA 2K85A 2W48A 1ZKGA 1QZEA 2E34A 2R7DA 1O3QA 1D5VA 4UUVA 4LIUA 1S29A 4J19A 4IVNA 3V42A 2DI3A 3BG7A 2X1DA 3V8LA 1V3FA 1BR4A 2WC2A 3D0SA 3TOAA 3OYCA 3PIPF 5F6FA 4IF4A 4PJLA 2K7LA 2MABA 4X0GA 4AIJA 1WJAA 3ABKH 4U7BA 4BQQA 4IHWA 3BCAA 3OOUA 2EV0A 1MKMA 3SFZA 5E1ZB 2F5FA 5HODA 4XQFA 2CS3A 1JKPC 2O8KA 4RBOA 3DEUA 1FYMA 4KA4A 1VQ8I 4UVBA 1O7FA 4LGWA 1J75A 2XPVA 4ZYEA 2PFBA 2PI0A 2LC2A 5J40A 2NAZA 5CKTA 4IO9F 3PFYA 2GXBA 3QRFF 4O3MA 2DOEA 4HYEA 2MG4A 1R1VA 1XX5A 4OIQF 2J5OA 2Y31A 2JWTA 3F0CA 1JUPA 4IRIA 3E7LA 3QAHA 4BBSJ 5FGMA 2IT0A 2CW0F 3EYYA 2XGEA 2M9HA 3HB9A 1MGTA 2JJ7A 2M3AA 2BW3B 5DUKA 1V55H 2DU9A 5FFXA 2DODA 2KRCA 1ZRFA 1WWXA 4KFCA 4M6YA 3UNGC 3OYIA 3JAMK 1QQIA 2V9VA 3MZHA 2D45A 1RETA 3AG3H 3VFZA 3OSGA 3V7CA 1EF4A 2FRHA 2FA5A 3I9V2 5HLGA 3ZRGA 1MJBA 1JT6A 4MEXF 3LSRA 1XSDA 5IOZA 2L7FP 1KU2A 4YELA 4CZCA 4M3GA 2XC7A 1USTA 1R58A 1S7EA 3FHNA 4P55A 4NNJA 1MDMA 4Z6YA 3KZZA 4LMYA 1EJ9A 4IKFA 4DJAA 2GWRA 5FO5A 1QHGA 5ICEA 3KPHA 1HKSA 1KONA 4GYGA 4A69C 2R7WA 5CVRA 5K5OA 2VQLA 1MNDA 1S8NA 2VC0A 4Y33A 3ZQIA 4U0VA 2HXOA 4IZZA 3KEOA 5F1RA 3TGNA 3MKZA 1IG7A 4E6KG 5B3SH 2BV6A 1SVOA 2R7TA 5EZGA 3S8PA 4UUTA 1P4XA 2EK5A 3BC8A 1CGPA 3CJQB 3K0LA 2JA7J 2JRMA 3KE2A 4A5MA 3ERED 4A3MJ 4XN0A 3LA7A 3O8HA 1S7OA 4IQ4A 5DUIA 1B8IA 4YFNF 1UAAA 2V9PA 4XN3A 2P0WA 1L3LA 3OV8A 1QRYA 3J7ZI 5EEHA 1MMSA 1HDDC 1JGGA 2IA2A 3HHHA 2FE3A 2CQNA 2V7FA 1K6YA 5F04A 3NWTA 3QQAA 5HLHA 4IOAF 2JMWA 5GAHJ 1QA6A 3BTCA 3TO7A 3KP4A 1LDJA 2OC6A 5E3NA 3ZMZA 5GAEJ 2A68F 1HKQA 5D6EA 1AKHA 3QODA 4RB3C 2HKOA 5DYMA 2MLGA 5E3LA 3LMMA 4YRVA 6PAXA 1K78B 4BJ5C 1R5GA 2GLOA 1V4RA 3K1NA 3SZGA 2EQRA 2QSHX 2LR8A 3OIPA 3QPLA 1WKMA 3S1RJ 1H0MA 4EVIA 2WTEA 5FD6A 4DGWB 4RAGA 1Z7UA 2PJRA 2M4GA 4EATA 1TWCJ 2OA4A 3SYTA 2LVSA 3Q9SA 3CLOA 4GXOA 2DDAA 5D5WB 1O4XA 3D1NI 1W5TA 1ZGAA 4CZZA 2NVTJ 3K1MA 2ID6A 3HOZJ 1Z3YA 4UB8C 2X1EA 3O3KA 4CXFA 4RAYA 2JUCA 1D0XA 2NVUB 2R4GA 3N97A 1YO5C 4XIDA 3RI4A 3GZ6A 1F1ZA 4LFUA 2GXGA 1LUJB 5GADJ 3HSRA 4YFXF 1JUSA 5K7FA 1HF0A 4P5OA 2HOSA 4N0BA 2DFIA 4ZJZA 2AS5F 3LNQA 4LLLA 3KCCA 3RDIA 1ZRCA 4ZH4F 5L3FA 2XAGA 1UHSA 1Z0XA 3PNYA 4P9FA 1TZLA 3CO6C 4G7OF 4ZTFA 1YRNB 2M2EA 1OPCA 1WJCA 3VSLA 4FHTA 2O8XA 3EPZA 1OCCH 1XGOA 4I98B 3F6VA 3F23A 3E1SA 1LVAA 4CGZA 4I99C 4RGRA 4ZYHA 1D8JA 2EFPA 1OCRH 4XLPF 1ONVA 3BG3A 2E1CA 1UELB 3I55I 4EM0B 5IP7J 2GZWA 5M3MJ 3JRAA 1O3TA 1G8XA 1LFPA 5D4SA 4AIDA 1HW2A 1X1DA 2R7UA 3HOVJ 2VE9A 2E1NA 3R61A 3ZQHA 3DLLF 1AKHB 1Z7LA 4QLCU 3U1KA 4A93J 3FK7A 3HYIA 4WK8F 3D5RC 1KU9A 4BXUA 4WXDA 2HDWA 3CUQA 4Y7NJ 1LE8A 1MDMB 2DJIA 1P2FA 2MD0A 2F5DA 5JVGF 4A6EA 5C4XJ 1E0EA 1JHHA 3BR5A 4LK0F 1O3RA 1FWZA 3BZKA 2LF7A 5FKMA 5EJCA 4ZTJA 1IN5A 1YOVB 4BQOA 1NK3P 1VZ0A 1FT9A 3PSFA 2OJED 3F3XA 3K4JA 1BW6A 3MZYA 2L9VA 4NB5A 4P9UA 4UV9A 5ILSA 4XKBA 1B8IB 1DPRA 2IS4A 5DV5A 4BH9A 1FIAA 2LKPA 2ME6A 5F08A 4PZJA 4PK4A 4LJZF 1W5CC 1WJBA 2AQFA 2IA0A 1ZN2A 2YR2A 5DCMA 2EFWA 4KT6A 1X3ZB 3GW2A 3FKIJ 2EZIA 2ME0A 3M1CA 3V8JA 3PFIA 2CQXA 2MFZA 3HRTA 2EV5A 2ZMEC 1XMXA 2F2EA 4LK1F 3FKJA 3LAPA 1GV2A 2KPMA 4V2GA 2WB1A 3ONQA 4R79A 3ZOBA 1B9MA 1IV6A 1FX7A 1FP2A 1IN8A 1W7PA 3V8KA 3G4SI 1KQ8A 2WY8Q 2VQCA 5EEGA 1VQNI 2EJRA 1FTTA 3QOEA 1LEAA 4BY1J 2IPQX 3E0JB 2VI6A 2GM4A 4U0WA 1ETOA 4RAFA 1HW1A 5LEJA 2LDUA 1S72I 1RR7A 2Y48A 3L2UA 3DTKA 1D0ZA 2Z5UA 1CF7A 3HOYJ 1T08B 1XSVA 3LSJA 5F0FA 1D3YA 1RUNA 1P92A 3FXOA 4IRGA 2K3FA 3CJRB 4FX0A 1BI0A 1HC8A 2FU4A 4HLYA 4HF2A 3GTOJ 1FBSA 4IJAA 2OAZA 1J9IA 2EWNA 4QIWN 4XKWA 1TQPA 1AU7A 2BW3A 4PJNA 2VXDA 4WWCA 4PGGA 2ISYA 2HQNA 2L9NA 4QTRA 1IN6A 2E7XA 3V7RA 2GOMA 2Y0SA 1ZG1A 1ZR4A 2HOEA 3CUQC 5D5XB 5IYDJ 3ZQGA 2BVMA 2HZDA 1R7JA 2M7BA 1H8AC 1V5FA 1IUFA 3D5SC 4J01A 3KP2A 2KHMA 3GO5A 1A35A 2D1HA 1Y1VJ 2NXNB 3CMAI 2E2IJ 1B6AA 4P96A 3O2PE 4BBRJ 2M87A 1PUEE 4A3CJ 2GA2A 3X2QH 5D8LB 2STTA 4IOCF 3BG9A 3IP4B 3WODF 3I4NJ 1IXRC 5CLSA 3FHZA 4M9ZA 4PSWA 3SQNA 3OOPA 1YG2A 3I4PA 5HLTA 4NHJA 2OCEA 1QGPA 2HI3A 3TO6A 4B4CA 3M9AA 5BS6A 3AL0B 5D8KB 1YJNI 1K83J 3DBLB 3JRIA 1DGRM 4B1RA 4IHVA 4ANJA 1H88C 3K4BA 3MMYB 1VF9A 1G3WA 2BXZA 3BQYA 3DWLE 5C4JJ 3DFGA 5BOXA 1VQMI 3DU5A 4ZYGA 1JT0A 1NH3A 2HXIA 5IYBJ 5L3DA 5H2FC 3ZQFA 3ABTA 4DYRA 2HZTA 3VDXA 3J7YJ 4UVCA 1VQOI 5F1JA 2O61A 2KJCA 1UMQA 2DYSH 5CVUA 3L09A 3JRDA 5FKLA 3WHCA 4UXNA 1F5TA 1MBFA 1TP4A 2DMUA 2ELKA 3P9KA 3JAMZ 1X1CA 3GX4X 2MD5A 5TISC 2KLOA 3I0TA 1BC7C 1IN7A 3KIOA 1HDPA 4B47A 2C6YA 1TLHB 4OAYA 2QKLB 1ZLKA 5BPDA 4XBFA 3FDYA 4EGZA 4II3A 2HDDA 2UWMA 4NC8A 4XRSA 3MN2A 2CUJA 3L9FA 4DYCA 1YITI 3S1MJ 1XMAA 4MFEA 1FMVA 2O0YA 3K70D 4RS8A 3ZQQA 5ICFA 5IPAA 4EM1A 2M5WA 2BZTA 3A03A 5LRRA 3JW4A 3HOSA 2PMUA 2Z3YA 4Q48A 3GTGJ 1NTCA 1IN4A 4DNCA 3BDDA 3WU2C 1SAUA 1MBJA 4MGRA
chains in the Genus database with same CATH topology
2DBBA 1G3YA 2A3SA 2JPCA 1JGSA 3KP6A 1KQ9A 4FT8A 1KGSA 2R7FA 1YTYA 2ESHA 1SFEA 2DT5A 3SXYA 1WI9A 5BQTA 1ZREA 3F8FA 2L54A 5FFZA 1RIOH 1Y0UA 3LQQA 1E17A 2FBKA 3HRMA 1R00A 4HX4A 2D2WA 5BMZA 3G73A 5CVIA 4PDKA 4UV8A 3WTTC 3DXJF 3WE3A 4H0EA 4IRHA 1U5TC 2OQRA 2XGXA 3ISPA 3B02A 1FC3A 4HDVA 2Z33A 4I0AA 3BJ6A 3FZVA 1MZBA 2A6EF 5D6FA 1SFXA 2YU3A 5LRSA 1AWCA 2FXAA 4DQ2A 2HQRA 5HDKA 4RB2C 1YW8A 5E20A 1IF1A 2GIVA 5DCFA 2P5KA 4MQ9F 2CG4A 1K7AA 2P5VA 2V1UA 1QZZA 1SAXA 4ENMA 5JVTA 3RKYA 5J6XA 3JTGA 3M7GA 4ZZLA 2ELHA 4OMYA 3FX3A 2A61A 2P6SA 3GF2A 1U8RA 3ABUA 1S7AA 5J8CA 2FSWA 2KKOA 4F7ZA 1FLIA 2IJLA 1U78A 1ZYRF 2XHKA 1O57A 1XD7A 4ZZDA 3NRVA 3TDUC 2DO7A 1I27A 1Z05A 4G9YA 4AD9A 1XMKA 2MLKA 2V1DA 4N9IA 2A07F 3DQVC 3WTZA 3VODA 3NQOA 1T38A 3S2WA 3I71A 2PEXA 2FNAA 3QU3A 4L9TA 2A5YB 3KP7A 2CSOA 3VOEA 3ZMTA 4HX8A 4OIPF 4RGXA 2VOOA 2PG4A 3H3UA 4QWQA 3P9IA 3F8MA 1ZRDA 1FSEA 3J7AO 3GFMA 5LHIA 2ADUA 1MJAA 1U6GA 5ICCA 1VTNC 1Z9CA 3IL2A 4Z2YA 4LB5A 1H9TA 3IHUA 1ULYA 3DP7A 4WXHA 3I58A 3RIRA 5L3GA 1STZA 4HF0A 1OKRA 3D5LA 4AIKA 5HVQC 3W6KB 2HR3A 3F8NA 1FBUA 2RKHA 2QQ9A 2UZKA 3FMSA 3TOBA 5A2QZ 1Z6TA 5JR3A 3JSOA 2XASA 2CQKA 2ZKZA 5AONA 1W4MA 2O6GE 3M8FA 4HDUA 1R36A 1PP7U 4G6DA 4B09A 4EQQA 2PMHA 2P8TA 4MHGA 1LDDA 1BIBA 4A2UA 1HSTA 2H09A 1H9GA 3WTXC 3L2CA 1O7LA 1IAWA 3I59A 3GFIA 5DD8A 3Q9VA 1HQCA 2XIGA 3M1EA 2QZ8A 3QOPA 4XLNF 1KU3A 3JSPA 1K79A 2HWVA 1K78A 3HHGA 5ILUA 3E5QA 3ZMDA 1FYKA 3RTRA 3GWZA 1KQ0A 5E17F 2Z9OA 1UFMA 4EJUA 2W24A 1GXQA 1LDKB 3HSFA 1R1TA 2BYVE 2UXNA 3C3WA 3MWMA 1F4KA 2GQQA 4NQWA 2UXXA 2XROA 4UNOA 1SD7A 4ETSA 4AVPA 4ENNA 1GXPA 2Y0MA 4I0BA 1LB2A 3HOTA 2HEOA 2JPBA 2L02A 4U0YA 1ODDA 5K5RA 3KEQA 5HS7A 3KLNA 5TRDA 5HS9A 4G7HF 1SD6A 4ESJA 5H20A 3WTUC 2XKPA 1GVJA 2FMLA 3IC7A 5ICGA 3E6CC 5ERIA 5LEKA 1XGMA 4LLGF 3QU6A 1CF7B 1TNTA 1XDSA 4KIFA 4KICA 2ZJ2A 3J81K 1ON2A 3GXOA 3J81Z 5DD4A 1XCBA 1YYVA 1I1GA 3HTSB 2TDXA 4ENKA 2L3DA 4G94A 2ZFWA 4G8XA 1QNTA 1HSJA 2CO5A 1J2XA 3ZMUA 3E5XA 2RV8A 4L5JA 2BBYA 3MFKA 4KNYA 4YG2F 2CFXA 2WV0A 4ESFA 5HDGA 1BI1A 3E6DA 2Y75A 3EYIA 2K4BA 2HYGD 2HTJA 4I7HA 5LGNA 3BZ6A 1RNLA 4CHUA 2FNPA 2GAUA 5ED4A 4LG0B 4CDGA 4L0YB 2XAHA 4CYDA 2IW5A 1FYLA 3FXUA 2A6HF 3I59B 4HA8A 5H6RA 1SMYF 5E18F 2FQ3A 4L18B 2VT3A 5FLXK 3CJNA 3TQNA 1Z6RA 3QP6A 2RQPA 3GFJA 3L7WA 4O6JA 2ZBKA 1KU7A 1ZG3A 2DQLA 4L9NA 2MC3A 2Q2EA 5E8GA 2VN2A 4N9HA 4KN4X 2QM3A 3N4MA 1LEBA 2VXZA 1ZLJA 1YS7A 3GYHX 2EA2A 2BGCA 2HGCA 2V1XA 1X3UA 4GYIA 2IRFG 1GHCA 3FMQA 2VE8A 3FXRA 2NNYA 4KN7X 4XSZF 1TTYA 4KMUX 3REOA 2FOKA 5E8IA 2RN7A 1BM9A 1I1SA 1HKTA 1S3JA 2DPDA 3I64A 2QYOA 1UB9A 3AAFA 2F5CA 3BP8A 2VBXA 1XN7A 1EH8A 5LLQA 2QBYB 3H3ZA 2ZXJA 3BPVA 2GA1A 2FF4A 4ASNA 2ZNZA 1IRGA 5J8FA 1BI2A 4WF2A 2K27A 3IKVA 1C0WA 4BHBA 2DPUA 4OOIA 3ML6A 3U2RA 2QBYA 4Q4ZF 2P4WA 2K4JA 4CO8A 2H27A 1IUYA 5DEQA 1F9NA 1U5TB 4HQEA 4LD5A 2DQRA 1OR7A 1ZHFA 5LGUA 1XGSA 1S6LA 3WGGA 4YIFA 3H92A 1ON1A 3QPHA 1JXSA 4EMSA 1JE8A 4A0XA 2K02A 3CTAA 1G4DA 2L4AA 1OMIA 1QBJA 2VC1A 3BY6A 1OYYA 2H6BA 4KMFA 1BN5A 5FLXZ 1T6SA 2G7HA 3WGHA 5D5UB 4M9XA 4UVAA 3LWFA 3IKTA 3C18A 5CJ9A 4RB1A 1J59A 3RKWA 2QWWA 3ROUA 2H6CA 1LNWA 1AOYA 3BOQA 3QP5A 1SD5A 3KZYA 4HBLA 4Y15A 1WQ2A 2P5LC 2A69F 2OU2A 2EFQA 2HDCA 4OIOF 2EV6A 1BIAA 2FBHA 4XSXF 3SZTA 1SD4A 2ZCWA 4BNCA 2RC4A 4S04A 3KETA 2L4MA 1QPMA 4YFKF 1R5HA 4L9VA 3DPLC 4EJOA 2Q8KA 1YW7A 3COAC 3ZN0A 3LAJA 2ACJA 4U7DA 2ZMEA 1BOAA 4OIRF 1R22A 3DKWA 1YW9A 2PJPA 2V6CA 2YX7A 4A0ZA 3ZPLA 4ON0A 2ZO4A 4I02A 2IA1A 3FM3A 1FY7A 3BWGA 1NHAA 2FEZA 1HBXG 5IT9Z 3RKXA 2VT2A 4L5IA 1U2WA 5L3EA 2G7UA 2ETHA 3T0YA 4A12A 1HXDA 3VEPA 1XDUA 3U9GA 3Q5FA 4UHTA 1R1UA 2M30A 3GVAA 1MJ9A 1EH7A 2X0LA 1U3EM 2NNNA 3U1DA 1BBYA 2JT1A 2OZ6A 2OD5A 5ILVA 2HYFA 2EA4A 4S05A 1FOKA 3F72A 5LGTA 4MQVA 1YQAA 1J5YA 4EJTA 3BPXA 1UHWA 2BEOA 5HS8A 2YPRA 4MTDA 3V4GA 2PLYA 3DV8A 2X4HA 3KFWX 3F8BA 1YLFA 2V79A 3WE2A 4HQMA 2VOPA 4HV5A 3T1BA 2VBWA 4MEYF 2FBIA 4Q5SF 5HOOA 2NYXA 5D5VB 1OYIA 2KIUA 3PQKA 2B0LA 1I6XA 1QO0D 3I54A 3GFLA 1DUXC 2VONA 3MQ0A 5L3BA 1RI7A 3TDZC 4A6DA 2STWA 4IHSA 3SHFA 1W7PB 2R3SA 3ELKA 1TQIA 1PP8F 2CGPA 2NS0A 3BROA 1ZH5A 1OYWA 4MNUA 1I5ZA 3EUHA 2HS5A 2VBZA 3B73A 1USSA 1W5SA 2JRTA 5TJJA 2CWEA 2M8EA 3MAJA 1B4AA 3L00A 1IRFA 3WTWC 1K6OA 4Q47A 5AIPA 4KIBA 4Y17A 2XRNA 3MEXA 2QVOA 4PGHA 4RB0A 2JTVA 2BE5F 2DK5A 1DPUA 1BC8C 5CVJA 3WTSC 2QQBA 4HOBA 2PBIA 3E6BA 4EGYA 1PDNC 2DK8A 3CUOA 2RVCA 4KUMA 1JHFA 5IT3A 3GUDA 2RDPA 1J7KA 3KP3A 1XGNA 5HLIA 4OU0A 4M73A 3P7NA 2O3FA 1WSUA 1TQMA 2Q0OA 4G6QA 1T39A 1DDNA 3K69A 2DAOA 3WTYC 3HRSA 2XAQA 2QENA 3HUGA 3KLOA 3ECOA 3CDHA 3FF5A 2E7WA 2K86A 1XCVA 5F64A 2XV4S 3SZPA 2RGVA 1KYWA 2ISZA 1R23A 2W57A 1TW3A 2VBYA 4I01A 5KVRA 4K2EA 5AIQA 4WX9A 4RGUA 4HV6A 5DDGA 3JTHA 4LG0A 2OQGA 3LA3A 3RPQA 2YSRA 2EFOA 4R8HA 4ESBA 4JK1X 3E3VA 2P7VB 3TO9A 5E1XA 1XSXA 3BJAA 3G3ZA 4BQAA 1REPC 4R1HA 1P6RA 1UHMA 1FZPB 3E5UA 5LHHA 1A04A 2QLZA 2MH9A 4HZFA 4A5NA 1XB4A 4HX7A 2JSCA 3K1PA 2VODA 4IPAA 1BI3A 1T2KA 3F22A 3BJOA 3GZ5A 3CO7C 1G3TA 3RYRA 4AWXB 3WTVC 5K5QA 2M1BA 1ZARA 2JZYA 2XVCA 4TV7A 4RGSA 3FM5A 1W7PD 4E70A 1T98A 1YS6A 5KK1A 5FB2A 3DF8A 2J5PA 3EDPA 4IXAA 3V7SA 4ZYDA 1MD0A 1O3SA 2DTRA 1Z1DA 5BPIA 4KDPA 2LF8A 4Y13A 2LNBA 4O5VA 2W25A 2HKXA 4M6XA 4BHPA 1D8KA 1TBXA 4PCQA 1TNSA 5JHUA 1IXSB 4M72A 2HTSA 2DW4A 3VB2A 1FNNA 4LLNA 4L9JA 1KYZA 4YIIA 3HRUA 3DPTA 1IZ1A 2DLLA 5E1WA 4I2OA 1RUOA 4HW0A 4JQFA 2OBPA 1U5TA 5CYVA 2EB7A 2MBFA 1LQ1A 3C7JA 3WU1B 2ZMEB 1T0FA 3ZMSA 3M8EA 4HLXA 1SMTA 1Q1HA 1ZG5A 3RPUA 2OZUA 4GO1A 1G6NA 3WU0A 1KA8A 1YFHA 5LBQA 4KYWA 3MCZA 3I53A 4A0YA 3QPTA 3NEUA 2D1VA 5DCMB 3WGIA 3IWZA 2WWYA 4WXCA 4I09A 3O6BB 3FMRA 2CYYA 1ZAOA 2HFHA 2KRFA 4JBAA 3F6OA 4G7ZF 1QZYA 3ZMVA 4M9SA 3LFKA 1FSHA 2XAJA 3F21A 2COMA 4KT5C 1FPQA 5HDNA 3ZN1A 4OMZA 3J80Z 4L0ZB 3GEZA 3FXQA 1FBQA 1LJ9A 1P4AA 4EJVA 3K2ZA 4ENJA 3P9CA 1L0OC 5LHGA 2EFNA 2QQAA 4U88A 1FP1D 3T5XA 4GGGA 3R4KA 4M71A 1IXCA 3FWEA 5K1YA 4MTEA 3HTUA 2W84A 3J80K 2W85A 5A2QK 5IT9K 3R60A 3CUQB 1EH6A 4GCVA 5L3CA 2Z99A 2MA3A 4XRFA 2F5EA 3LSTA 1B59A 4EM2A 3E97A 3ZQ7A 2ESNA 2M45A 4KIGA 1E2XA 4BHCA 3LA2A 2PQ8A 3WG9A 2P7CB 3IWFA 2O03A 5JI6A 3ULQB 4RAZA 1UCRA 3HIFA 2G9WA 1YIOA 2KJBA 2XKOA 2H94A 3ECHA 1ZGJA 5CVVA 3KP5A 1B9NA 2RNJA 2NRAC 4BYYA 4EJWA 3EQLF 2FMYA 5FD5A 3T8TA 3LQRA 1RZ4A 5D4RA 1IW7F 3R0AA 2PN6A 2XUBA 4M74A 2IP2A 3E6MA 3ZP5A 5H6QA 4HF1A 1G3SA 1BJAA 4FX4A 3T8RA 1SFUA 3PQJA 4B8XA 3IRQA 5JFRA 1EV7A 1B1BA 2P6TA 2MH2A 2KIFA 3I5UA 4BAYA 3EETA 1Z91A 3R0JA 3W6JB 4EV0A 2QUFA 3C1DA 3K9TA 4LB6B 2YX4A 3R6SA 4CICA 2XAFA 1WRJA 4OINF 3RYPA 2KIMA 1TW2A 2AXLA 3IRRA 4HAMA 2ZNYA 3HSEA 4IHTA 1P4WA 3RJPA 4WCGA 1HW5A 3F8CA 4AIHA 3GLXA 1DP7P 2L01A 2LSOA 3TKYA 4D0PA 1J0RA 2IVMA 2R7DA 1O3QA 1D5VA 4UUVA 1S29A 4IVNA 2DI3A 3V8LA 1V3FA 2WC2A 3D0SA 3TOAA 5F6FA 4IF4A 2K7LA 4AIJA 4U7BA 2EV0A 1MKMA 3SFZA 5E1ZB 2F5FA 3DEUA 1FYMA 4KA4A 4UVBA 1O7FA 4LGWA 1J75A 4ZYEA 2PFBA 2PI0A 2NAZA 2GXBA 3QRFF 4O3MA 4HYEA 1R1VA 4OIQF 2J5OA 4IRIA 3QAHA 5FGMA 2IT0A 2CW0F 3EYYA 1MGTA 5FFXA 5DUKA 2DU9A 1ZRFA 1WWXA 4KFCA 4M6YA 3JAMK 1QQIA 2V9VA 3MZHA 2D45A 3VFZA 3V7CA 2FRHA 2FA5A 5HLGA 1MJBA 4MEXF 1XSDA 1KU2A 1USTA 1R58A 4P55A 1MDMA 3KZZA 4LMYA 2GWRA 5FO5A 5ICEA 1HKSA 4GYGA 5CVRA 5K5OA 1S8NA 2VC0A 4U0VA 3KEOA 5F1RA 3TGNA 2BV6A 1CGPA 1P4XA 2EK5A 3K0LA 3KE2A 4A5MA 3ERED 3LA7A 1S7OA 5DUIA 4YFNF 1L3LA 3OV8A 5EEHA 2IA2A 3HHHA 2FE3A 5HLHA 3TO7A 3KP4A 1LDJA 3ZMZA 2A68F 1HKQA 5D6EA 4RB3C 2HKOA 5DYMA 2MLGA 6PAXA 1K78B 1R5GA 1V4RA 3K1NA 1WKMA 1H0MA 4EVIA 2WTEA 5FD6A 1Z7UA 2OA4A 3Q9SA 3CLOA 4GXOA 5D5WB 1W5TA 1ZGAA 4CZZA 3K1MA 3O3KA 4CXFA 4RAYA 3N97A 1YO5C 3RI4A 3GZ6A 1F1ZA 4LFUA 2GXGA 3HSRA 4YFXF 4P5OA 4N0BA 2DFIA 2AS5F 4LLLA 3KCCA 3RDIA 1ZRCA 4ZH4F 5L3FA 2XAGA 4G7OF 4P9FA 3CO6C 1OPCA 4FHTA 2O8XA 1XGOA 4I98B 3F6VA 3F23A 1LVAA 4CGZA 4RGRA 4ZYHA 1D8JA 2EFPA 4XLPF 1ONVA 2E1CA 4EM0B 2GZWA 1O3TA 5D4SA 1HW2A 2VE9A 2E1NA 3R61A 4QLCU 3HYIA 4WK8F 1KU9A 4BXUA 4WXDA 3CUQA 1MDMB 1P2FA 2F5DA 4A6EA 1JHHA 4LK0F 1O3RA 1FWZA 2LF7A 1IN5A 1FT9A 4NB5A 3F3XA 3MZYA 4P9UA 4UV9A 5ILSA 1DPRA 5DV5A 4BH9A 2LKPA 4PZJA 4LJZF 2IA0A 1ZN2A 2YR2A 5DCMA 2EFWA 3GW2A 3V8JA 3PFIA 3HRTA 2EV5A 2F2EA 4LK1F 3LAPA 4R79A 1B9MA 1FX7A 1FP2A 1IN8A 1W7PA 3V8KA 1KQ8A 5EEGA 2EJRA 1LEAA 2IPQX 4U0WA 1HW1A 5LEJA 2LDUA 2Y48A 2Z5UA 1CF7A 1XSVA 1D3YA 1RUNA 1P92A 4IRGA 4FX0A 1BI0A 2FU4A 4HLYA 4HF2A 1FBSA 4IJAA 2OAZA 1J9IA 2EWNA 1TQPA 4WWCA 4PGGA 2ISYA 2HQNA 1IN6A 2E7XA 3V7RA 1ZG1A 2HOEA 3CUQC 5D5XB 1R7JA 3KP2A 3GO5A 2D1HA 1B6AA 4P96A 3O2PE 2M87A 1PUEE 2GA2A 5D8LB 2STTA 3WODF 1IXRC 5CLSA 3FHZA 4M9ZA 3SQNA 3OOPA 1YG2A 3I4PA 4NHJA 5BS6A 1QGPA 3TO6A 3M9AA 5D8KB 1G3WA 3DFGA 5BOXA 4ZYGA 5L3DA 3ABTA 2HZTA 2O61A 4UVCA 2KJCA 5CVUA 3L09A 4UXNA 1F5TA 3P9KA 3JAMZ 3GX4X 2MD5A 3I0TA 1BC7C 1IN7A 2C6YA 1TLHB 1ZLKA 5BPDA 4XBFA 4EGZA 2UWMA 3L9FA 1XMAA 2O0YA 4RS8A 5ICFA 4EM1A 2M5WA 3HOSA 5LRRA 3JW4A 2PMUA 2Z3YA 4Q48A 1IN4A 4DNCA 3BDDA 4MGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBB A;  1G3Y A;  2A3S A;  2JPC A;  1JGS A;  3KP6 A;  1KQ9 A;  4FT8 A;  1KGS A;  2R7F A;  1YTY A;  2ESH A;  1SFE A;  2DT5 A;  3SXY A;  1WI9 A;  5BQT A;  1ZRE A;  3F8F A;  2L54 A;  5FFZ A;  1RIO H;  1Y0U A;  3LQQ A;  1E17 A;  2FBK A;  3HRM A;  1R00 A;  4HX4 A;  2D2W A;  5BMZ A;  3G73 A;  5CVI A;  4PDK A;  4UV8 A;  3WTT C;  3DXJ F;  3WE3 A;  4H0E A;  4IRH A;  1U5T C;  2OQR A;  2XGX A;  3ISP A;  3B02 A;  1FC3 A;  4HDV A;  2Z33 A;  4I0A A;  3BJ6 A;  3FZV A;  1MZB A;  2A6E F;  5D6F A;  1SFX A;  2YU3 A;  5LRS A;  1AWC A;  2FXA A;  4DQ2 A;  2HQR A;  5HDK A;  4RB2 C;  1YW8 A;  5E20 A;  1IF1 A;  2GIV A;  5DCF A;  2P5K A;  4MQ9 F;  2CG4 A;  1K7A A;  2P5V A;  2V1U A;  1QZZ A;  1SAX A;  4ENM A;  5JVT A;  3RKY A;  5J6X A;  3JTG A;  3M7G A;  4ZZL A;  2ELH A;  4OMY A;  3FX3 A;  2A61 A;  2P6S A;  3GF2 A;  1U8R A;  3ABU A;  1S7A A;  5J8C A;  2FSW A;  2KKO A;  4F7Z A;  1FLI A;  2IJL A;  1U78 A;  1ZYR F;  2XHK A;  1O57 A;  1XD7 A;  4ZZD A;  3NRV A;  3TDU C;  2DO7 A;  1I27 A;  1Z05 A;  4G9Y A;  4AD9 A;  1XMK A;  2MLK A;  2V1D A;  4N9I A;  2A07 F;  3DQV C;  3WTZ A;  3VOD A;  3NQO A;  1T38 A;  3S2W A;  3I71 A;  2PEX A;  2FNA A;  3QU3 A;  4L9T A;  2A5Y B;  3KP7 A;  2CSO A;  3VOE A;  3ZMT A;  4HX8 A;  4OIP F;  4RGX A;  2VOO A;  2PG4 A;  3H3U A;  4QWQ A;  3P9I A;  3F8M A;  1ZRD A;  1FSE A;  3J7A O;  3GFM A;  5LHI A;  2ADU A;  1MJA A;  1U6G A;  5ICC A;  1VTN C;  1Z9C A;  3IL2 A;  4Z2Y A;  4LB5 A;  1H9T A;  3IHU A;  1ULY A;  3DP7 A;  4WXH A;  3I58 A;  3RIR A;  5L3G A;  1STZ A;  4HF0 A;  1OKR A;  3D5L A;  4AIK A;  5HVQ C;  3W6K B;  2HR3 A;  3F8N A;  1FBU A;  2RKH A;  2QQ9 A;  2UZK A;  3FMS A;  3TOB A;  5A2Q Z;  1Z6T A;  5JR3 A;  3JSO A;  2XAS A;  2CQK A;  2ZKZ A;  5AON A;  1W4M A;  2O6G E;  3M8F A;  4HDU A;  1R36 A;  1PP7 U;  4G6D A;  4B09 A;  4EQQ A;  2PMH A;  2P8T A;  4MHG A;  1LDD A;  1BIB A;  4A2U A;  1HST A;  2H09 A;  1H9G A;  3WTX C;  3L2C A;  1O7L A;  1IAW A;  3I59 A;  3GFI A;  5DD8 A;  3Q9V A;  1HQC A;  2XIG A;  3M1E A;  2QZ8 A;  3QOP A;  4XLN F;  1KU3 A;  3JSP A;  1K79 A;  2HWV A;  1K78 A;  3HHG A;  5ILU A;  3E5Q A;  3ZMD A;  1FYK A;  3RTR A;  3GWZ A;  1KQ0 A;  5E17 F;  2Z9O A;  1UFM A;  4EJU A;  2W24 A;  1GXQ A;  1LDK B;  3HSF A;  1R1T A;  2BYV E;  2UXN A;  3C3W A;  3MWM A;  1F4K A;  2GQQ A;  4NQW A;  2UXX A;  2XRO A;  4UNO A;  1SD7 A;  4ETS A;  4AVP A;  4ENN A;  1GXP A;  2Y0M A;  4I0B A;  1LB2 A;  3HOT A;  2HEO A;  2JPB A;  2L02 A;  4U0Y A;  1ODD A;  5K5R A;  3KEQ A;  5HS7 A;  3KLN A;  5TRD A;  5HS9 A;  4G7H F;  1SD6 A;  4ESJ A;  5H20 A;  3WTU C;  2XKP A;  1GVJ A;  2FML A;  3IC7 A;  5ICG A;  3E6C C;  5ERI A;  5LEK A;  1XGM A;  4LLG F;  3QU6 A;  1CF7 B;  1TNT A;  1XDS A;  4KIF A;  4KIC A;  2ZJ2 A;  3J81 K;  1ON2 A;  3GXO A;  3J81 Z;  5DD4 A;  1XCB A;  1YYV A;  1I1G A;  3HTS B;  2TDX A;  4ENK A;  2L3D A;  4G94 A;  2ZFW A;  4G8X A;  1QNT A;  1HSJ A;  2CO5 A;  1J2X A;  3ZMU A;  3E5X A;  2RV8 A;  4L5J A;  2BBY A;  3MFK A;  4KNY A;  4YG2 F;  2CFX A;  2WV0 A;  4ESF A;  5HDG A;  1BI1 A;  3E6D A;  2Y75 A;  3EYI A;  2K4B A;  2HYG D;  2HTJ A;  4I7H A;  5LGN A;  3BZ6 A;  1RNL A;  4CHU A;  2FNP A;  2GAU A;  5ED4 A;  4LG0 B;  4CDG A;  4L0Y B;  2XAH A;  4CYD A;  2IW5 A;  1FYL A;  3FXU A;  2A6H F;  3I59 B;  4HA8 A;  5H6R A;  1SMY F;  5E18 F;  2FQ3 A;  4L18 B;  2VT3 A;  5FLX K;  3CJN A;  3TQN A;  1Z6R A;  3QP6 A;  2RQP A;  3GFJ A;  3L7W A;  4O6J A;  2ZBK A;  1KU7 A;  1ZG3 A;  2DQL A;  4L9N A;  2MC3 A;  2Q2E A;  5E8G A;  2VN2 A;  4N9H A;  4KN4 X;  2QM3 A;  3N4M A;  1LEB A;  2VXZ A;  1ZLJ A;  1YS7 A;  3GYH X;  2EA2 A;  2BGC A;  2HGC A;  2V1X A;  1X3U A;  4GYI A;  2IRF G;  1GHC A;  3FMQ A;  2VE8 A;  3FXR A;  2NNY A;  4KN7 X;  4XSZ F;  1TTY A;  4KMU X;  3REO A;  2FOK A;  5E8I A;  2RN7 A;  1BM9 A;  1I1S A;  1HKT A;  1S3J A;  2DPD A;  3I64 A;  2QYO A;  1UB9 A;  3AAF A;  2F5C A;  3BP8 A;  2VBX A;  1XN7 A;  1EH8 A;  5LLQ A;  2QBY B;  3H3Z A;  2ZXJ A;  3BPV A;  2GA1 A;  2FF4 A;  4ASN A;  2ZNZ A;  1IRG A;  5J8F A;  1BI2 A;  4WF2 A;  2K27 A;  3IKV A;  1C0W A;  4BHB A;  2DPU A;  4OOI A;  3ML6 A;  3U2R A;  2QBY A;  4Q4Z F;  2P4W A;  2K4J A;  4CO8 A;  2H27 A;  1IUY A;  5DEQ A;  1F9N A;  1U5T B;  4HQE A;  4LD5 A;  2DQR A;  1OR7 A;  1ZHF A;  5LGU A;  1XGS A;  1S6L A;  3WGG A;  4YIF A;  3H92 A;  1ON1 A;  3QPH A;  1JXS A;  4EMS A;  1JE8 A;  4A0X A;  2K02 A;  3CTA A;  1G4D A;  2L4A A;  1OMI A;  1QBJ A;  2VC1 A;  3BY6 A;  1OYY A;  2H6B A;  4KMF A;  1BN5 A;  5FLX Z;  1T6S A;  2G7H A;  3WGH A;  5D5U B;  4M9X A;  4UVA A;  3LWF A;  3IKT A;  3C18 A;  5CJ9 A;  4RB1 A;  1J59 A;  3RKW A;  2QWW A;  3ROU A;  2H6C A;  1LNW A;  1AOY A;  3BOQ A;  3QP5 A;  1SD5 A;  3KZY A;  4HBL A;  4Y15 A;  1WQ2 A;  2P5L C;  2A69 F;  2OU2 A;  2EFQ A;  2HDC A;  4OIO F;  2EV6 A;  1BIA A;  2FBH A;  4XSX F;  3SZT A;  1SD4 A;  2ZCW A;  4BNC A;  2RC4 A;  4S04 A;  3KET A;  2L4M A;  1QPM A;  4YFK F;  1R5H A;  4L9V A;  3DPL C;  4EJO A;  2Q8K A;  1YW7 A;  3COA C;  3ZN0 A;  3LAJ A;  2ACJ A;  4U7D A;  2ZME A;  1BOA A;  4OIR F;  1R22 A;  3DKW A;  1YW9 A;  2PJP A;  2V6C A;  2YX7 A;  4A0Z A;  3ZPL A;  4ON0 A;  2ZO4 A;  4I02 A;  2IA1 A;  3FM3 A;  1FY7 A;  3BWG A;  1NHA A;  2FEZ A;  1HBX G;  5IT9 Z;  3RKX A;  2VT2 A;  4L5I A;  1U2W A;  5L3E A;  2G7U A;  2ETH A;  3T0Y A;  4A12 A;  1HXD A;  3VEP A;  1XDU A;  3U9G A;  3Q5F A;  4UHT A;  1R1U A;  2M30 A;  3GVA A;  1MJ9 A;  1EH7 A;  2X0L A;  1U3E M;  2NNN A;  3U1D A;  1BBY A;  2JT1 A;  2OZ6 A;  2OD5 A;  5ILV A;  2HYF A;  2EA4 A;  4S05 A;  1FOK A;  3F72 A;  5LGT A;  4MQV A;  1YQA A;  1J5Y A;  4EJT A;  3BPX A;  1UHW A;  2BEO A;  5HS8 A;  2YPR A;  4MTD A;  3V4G A;  2PLY A;  3DV8 A;  2X4H A;  3KFW X;  3F8B A;  1YLF A;  2V79 A;  3WE2 A;  4HQM A;  2VOP A;  4HV5 A;  3T1B A;  2VBW A;  4MEY F;  2FBI A;  4Q5S F;  5HOO A;  2NYX A;  5D5V B;  1OYI A;  2KIU A;  3PQK A;  2B0L A;  1I6X A;  1QO0 D;  3I54 A;  3GFL A;  1DUX C;  2VON A;  3MQ0 A;  5L3B A;  1RI7 A;  3TDZ C;  4A6D A;  2STW A;  4IHS A;  3SHF A;  1W7P B;  2R3S A;  3ELK A;  1TQI A;  1PP8 F;  2CGP A;  2NS0 A;  3BRO A;  1ZH5 A;  1OYW A;  4MNU A;  1I5Z A;  3EUH A;  2HS5 A;  2VBZ A;  3B73 A;  1USS A;  1W5S A;  2JRT A;  5TJJ A;  2CWE A;  2M8E A;  3MAJ A;  1B4A A;  3L00 A;  1IRF A;  3WTW C;  1K6O A;  4Q47 A;  5AIP A;  4KIB A;  4Y17 A;  2XRN A;  3MEX A;  2QVO A;  4PGH A;  4RB0 A;  2JTV A;  2BE5 F;  2DK5 A;  1DPU A;  1BC8 C;  5CVJ A;  3WTS C;  2QQB A;  4HOB A;  2PBI A;  3E6B A;  4EGY A;  1PDN C;  2DK8 A;  3CUO A;  2RVC A;  4KUM A;  1JHF A;  5IT3 A;  3GUD A;  2RDP A;  1J7K A;  3KP3 A;  1XGN A;  5HLI A;  4OU0 A;  4M73 A;  3P7N A;  2O3F A;  1WSU A;  1TQM A;  2Q0O A;  4G6Q A;  1T39 A;  1DDN A;  3K69 A;  2DAO A;  3WTY C;  3HRS A;  2XAQ A;  2QEN A;  3HUG A;  3KLO A;  3ECO A;  3CDH A;  3FF5 A;  2E7W A;  2K86 A;  1XCV A;  5F64 A;  2XV4 S;  3SZP A;  2RGV A;  1KYW A;  2ISZ A;  1R23 A;  2W57 A;  1TW3 A;  2VBY A;  4I01 A;  5KVR A;  4K2E A;  5AIQ A;  4WX9 A;  4RGU A;  4HV6 A;  5DDG A;  3JTH A;  4LG0 A;  2OQG A;  3LA3 A;  3RPQ A;  2YSR A;  2EFO A;  4R8H A;  4ESB A;  4JK1 X;  3E3V A;  2P7V B;  3TO9 A;  5E1X A;  1XSX A;  3BJA A;  3G3Z A;  4BQA A;  1REP C;  4R1H A;  1P6R A;  1UHM A;  1FZP B;  3E5U A;  5LHH A;  1A04 A;  2QLZ A;  2MH9 A;  4HZF A;  4A5N A;  1XB4 A;  4HX7 A;  2JSC A;  3K1P A;  2VOD A;  4IPA A;  1BI3 A;  1T2K A;  3F22 A;  3BJO A;  3GZ5 A;  3CO7 C;  1G3T A;  3RYR A;  4AWX B;  3WTV C;  5K5Q A;  2M1B A;  1ZAR A;  2JZY A;  2XVC A;  4TV7 A;  4RGS A;  3FM5 A;  1W7P D;  4E70 A;  1T98 A;  1YS6 A;  5KK1 A;  5FB2 A;  3DF8 A;  2J5P A;  3EDP A;  4IXA A;  3V7S A;  4ZYD A;  1MD0 A;  1O3S A;  2DTR A;  1Z1D A;  5BPI A;  4KDP A;  2LF8 A;  4Y13 A;  2LNB A;  4O5V A;  2W25 A;  2HKX A;  4M6X A;  4BHP A;  1D8K A;  1TBX A;  4PCQ A;  1TNS A;  5JHU A;  1IXS B;  4M72 A;  2HTS A;  2DW4 A;  3VB2 A;  1FNN A;  4LLN A;  4L9J A;  1KYZ A;  4YII A;  3HRU A;  3DPT A;  1IZ1 A;  2DLL A;  5E1W A;  4I2O A;  1RUO A;  4HW0 A;  4JQF A;  2OBP A;  1U5T A;  5CYV A;  2EB7 A;  2MBF A;  1LQ1 A;  3C7J A;  3WU1 B;  2ZME B;  1T0F A;  3ZMS A;  3M8E A;  4HLX A;  1SMT A;  1Q1H A;  1ZG5 A;  3RPU A;  2OZU A;  4GO1 A;  1G6N A;  3WU0 A;  1KA8 A;  1YFH A;  5LBQ A;  4KYW A;  3MCZ A;  3I53 A;  4A0Y A;  3QPT A;  3NEU A;  2D1V A;  5DCM B;  3WGI A;  3IWZ A;  2WWY A;  4WXC A;  4I09 A;  3O6B B;  3FMR A;  2CYY A;  1ZAO A;  2HFH A;  2KRF A;  4JBA A;  3F6O A;  4G7Z F;  1QZY A;  3ZMV A;  4M9S A;  3LFK A;  1FSH A;  2XAJ A;  3F21 A;  2COM A;  4KT5 C;  1FPQ A;  5HDN A;  3ZN1 A;  4OMZ A;  3J80 Z;  4L0Z B;  3GEZ A;  3FXQ A;  1FBQ A;  1LJ9 A;  1P4A A;  4EJV A;  3K2Z A;  4ENJ A;  3P9C A;  1L0O C;  5LHG A;  2EFN A;  2QQA A;  4U88 A;  1FP1 D;  3T5X A;  4GGG A;  3R4K A;  4M71 A;  1IXC A;  3FWE A;  5K1Y A;  4MTE A;  3HTU A;  2W84 A;  3J80 K;  2W85 A;  5A2Q K;  5IT9 K;  3R60 A;  3CUQ B;  1EH6 A;  4GCV A;  5L3C A;  2Z99 A;  2MA3 A;  4XRF A;  2F5E A;  3LST A;  1B59 A;  4EM2 A;  3E97 A;  3ZQ7 A;  2ESN A;  2M45 A;  4KIG A;  1E2X A;  4BHC A;  3LA2 A;  2PQ8 A;  3WG9 A;  2P7C B;  3IWF A;  2O03 A;  5JI6 A;  3ULQ B;  4RAZ A;  1UCR A;  3HIF A;  2G9W A;  1YIO A;  2KJB A;  2XKO A;  2H94 A;  3ECH A;  1ZGJ A;  5CVV A;  3KP5 A;  1B9N A;  2RNJ A;  2NRA C;  4BYY A;  4EJW A;  3EQL F;  2FMY A;  5FD5 A;  3T8T A;  3LQR A;  1RZ4 A;  5D4R A;  1IW7 F;  3R0A A;  2PN6 A;  2XUB A;  4M74 A;  2IP2 A;  3E6M A;  3ZP5 A;  5H6Q A;  4HF1 A;  1G3S A;  1BJA A;  4FX4 A;  3T8R A;  1SFU A;  3PQJ A;  4B8X A;  3IRQ A;  5JFR A;  1EV7 A;  1B1B A;  2P6T A;  2MH2 A;  2KIF A;  3I5U A;  4BAY A;  3EET A;  1Z91 A;  3R0J A;  3W6J B;  4EV0 A;  2QUF A;  3C1D A;  3K9T A;  4LB6 B;  2YX4 A;  3R6S A;  4CIC A;  2XAF A;  1WRJ A;  4OIN F;  3RYP A;  2KIM A;  1TW2 A;  2AXL A;  3IRR A;  4HAM A;  2ZNY A;  3HSE A;  4IHT A;  1P4W A;  3RJP A;  4WCG A;  1HW5 A;  3F8C A;  4AIH A;  3GLX A;  1DP7 P;  2L01 A;  2LSO A;  3TKY A;  4D0P A;  1J0R A;  2IVM A;  2R7D A;  1O3Q A;  1D5V A;  4UUV A;  1S29 A;  4IVN A;  2DI3 A;  3V8L A;  1V3F A;  2WC2 A;  3D0S A;  3TOA A;  5F6F A;  4IF4 A;  2K7L A;  4AIJ A;  4U7B A;  2EV0 A;  1MKM A;  3SFZ A;  5E1Z B;  2F5F A;  3DEU A;  1FYM A;  4KA4 A;  4UVB A;  1O7F A;  4LGW A;  1J75 A;  4ZYE A;  2PFB A;  2PI0 A;  2NAZ A;  2GXB A;  3QRF F;  4O3M A;  4HYE A;  1R1V A;  4OIQ F;  2J5O A;  4IRI A;  3QAH A;  5FGM A;  2IT0 A;  2CW0 F;  3EYY A;  1MGT A;  5FFX A;  5DUK A;  2DU9 A;  1ZRF A;  1WWX A;  4KFC A;  4M6Y A;  3JAM K;  1QQI A;  2V9V A;  3MZH A;  2D45 A;  3VFZ A;  3V7C A;  2FRH A;  2FA5 A;  5HLG A;  1MJB A;  4MEX F;  1XSD A;  1KU2 A;  1UST A;  1R58 A;  4P55 A;  1MDM A;  3KZZ A;  4LMY A;  2GWR A;  5FO5 A;  5ICE A;  1HKS A;  4GYG A;  5CVR A;  5K5O A;  1S8N A;  2VC0 A;  4U0V A;  3KEO A;  5F1R A;  3TGN A;  2BV6 A;  1CGP A;  1P4X A;  2EK5 A;  3K0L A;  3KE2 A;  4A5M A;  3ERE D;  3LA7 A;  1S7O A;  5DUI A;  4YFN F;  1L3L A;  3OV8 A;  5EEH A;  2IA2 A;  3HHH A;  2FE3 A;  5HLH A;  3TO7 A;  3KP4 A;  1LDJ A;  3ZMZ A;  2A68 F;  1HKQ A;  5D6E A;  4RB3 C;  2HKO A;  5DYM A;  2MLG A;  6PAX A;  1K78 B;  1R5G A;  1V4R A;  3K1N A;  1WKM A;  1H0M A;  4EVI A;  2WTE A;  5FD6 A;  1Z7U A;  2OA4 A;  3Q9S A;  3CLO A;  4GXO A;  5D5W B;  1W5T A;  1ZGA A;  4CZZ A;  3K1M A;  3O3K A;  4CXF A;  4RAY A;  3N97 A;  1YO5 C;  3RI4 A;  3GZ6 A;  1F1Z A;  4LFU A;  2GXG A;  3HSR A;  4YFX F;  4P5O A;  4N0B A;  2DFI A;  2AS5 F;  4LLL A;  3KCC A;  3RDI A;  1ZRC A;  4ZH4 F;  5L3F A;  2XAG A;  4G7O F;  4P9F A;  3CO6 C;  1OPC A;  4FHT A;  2O8X A;  1XGO A;  4I98 B;  3F6V A;  3F23 A;  1LVA A;  4CGZ A;  4RGR A;  4ZYH A;  1D8J A;  2EFP A;  4XLP F;  1ONV A;  2E1C A;  4EM0 B;  2GZW A;  1O3T A;  5D4S A;  1HW2 A;  2VE9 A;  2E1N A;  3R61 A;  4QLC U;  3HYI A;  4WK8 F;  1KU9 A;  4BXU A;  4WXD A;  3CUQ A;  1MDM B;  1P2F A;  2F5D A;  4A6E A;  1JHH A;  4LK0 F;  1O3R A;  1FWZ A;  2LF7 A;  1IN5 A;  1FT9 A;  4NB5 A;  3F3X A;  3MZY A;  4P9U A;  4UV9 A;  5ILS A;  1DPR A;  5DV5 A;  4BH9 A;  2LKP A;  4PZJ A;  4LJZ F;  2IA0 A;  1ZN2 A;  2YR2 A;  5DCM A;  2EFW A;  3GW2 A;  3V8J A;  3PFI A;  3HRT A;  2EV5 A;  2F2E A;  4LK1 F;  3LAP A;  4R79 A;  1B9M A;  1FX7 A;  1FP2 A;  1IN8 A;  1W7P A;  3V8K A;  1KQ8 A;  5EEG A;  2EJR A;  1LEA A;  2IPQ X;  4U0W A;  1HW1 A;  5LEJ A;  2LDU A;  2Y48 A;  2Z5U A;  1CF7 A;  1XSV A;  1D3Y A;  1RUN A;  1P92 A;  4IRG A;  4FX0 A;  1BI0 A;  2FU4 A;  4HLY A;  4HF2 A;  1FBS A;  4IJA A;  2OAZ A;  1J9I A;  2EWN A;  1TQP A;  4WWC A;  4PGG A;  2ISY A;  2HQN A;  1IN6 A;  2E7X A;  3V7R A;  1ZG1 A;  2HOE A;  3CUQ C;  5D5X B;  1R7J A;  3KP2 A;  3GO5 A;  2D1H A;  1B6A A;  4P96 A;  3O2P E;  2M87 A;  1PUE E;  2GA2 A;  5D8L B;  2STT A;  3WOD F;  1IXR C;  5CLS A;  3FHZ A;  4M9Z A;  3SQN A;  3OOP A;  1YG2 A;  3I4P A;  4NHJ A;  5BS6 A;  1QGP A;  3TO6 A;  3M9A A;  5D8K B;  1G3W A;  3DFG A;  5BOX A;  4ZYG A;  5L3D A;  3ABT A;  2HZT A;  2O61 A;  4UVC A;  2KJC A;  5CVU A;  3L09 A;  4UXN A;  1F5T A;  3P9K A;  3JAM Z;  3GX4 X;  2MD5 A;  3I0T A;  1BC7 C;  1IN7 A;  2C6Y A;  1TLH B;  1ZLK A;  5BPD A;  4XBF A;  4EGZ A;  2UWM A;  3L9F A;  1XMA A;  2O0Y A;  4RS8 A;  5ICF A;  4EM1 A;  2M5W A;  3HOS A;  5LRR A;  3JW4 A;  2PMU A;  2Z3Y A;  4Q48 A;  1IN4 A;  4DNC A;  3BDD A;  4MGR A; 
#chains in the Genus database with same CATH topology
 3S14 J;  2DBB A;  3VPR A;  1DGW Y;  1G3Y A;  3TL4 X;  2E19 A;  1U8B A;  2A3S A;  2JPC A;  2V9K A;  2Y30 A;  1JGS A;  3KP6 A;  1KQ9 A;  4FT8 A;  1KGS A;  2R7F A;  4AC0 A;  1I50 J;  3FK6 A;  2XB5 A;  4UB6 C;  1YTY A;  4I76 A;  2ESH A;  1LKX A;  1SFE A;  1VI0 A;  2DT5 A;  3SXY A;  5J4V A;  3HGG A;  3OL4 A;  1WI9 A;  5BQT A;  2Z2S B;  3L2V A;  3B6A A;  1ZRE A;  3F8F A;  5CQE A;  5GTH C;  2L54 A;  1XC5 A;  3Q0U A;  2DA1 A;  5FFZ A;  4I6Z A;  3C2G A;  2W7N A;  1RIO H;  1Y0U A;  3LQQ A;  1Y0N A;  3PNV A;  3HOU J;  1E17 A;  2R93 J;  1OCO H;  2FBK A;  2Y9Y A;  4XON A;  3HRM A;  1R00 A;  4HX4 A;  2D2W A;  5BMZ A;  2KIS A;  1HOM A;  3G73 A;  5CVI A;  5FRM A;  2K5C A;  4BDY A;  4PDK A;  1RC9 A;  4YEJ A;  2TCT A;  4UV8 A;  3WTT C;  4G12 A;  3DXJ F;  4FAS D;  2PX9 A;  2NVY J;  1RPW A;  3WE3 A;  4HST A;  4H0E A;  1OCT C;  3LSH A;  3PNT A;  4IRH A;  1U5T C;  3DEE A;  4N4N B;  4AVZ A;  2OQR A;  2XGX A;  3ISP A;  3OYA A;  3QWL A;  4HPQ A;  3B02 A;  3L2Q A;  2R5Z B;  1FC3 A;  4HDV A;  5M5X J;  2Z33 A;  4I0A A;  3BJ6 A;  2L9S A;  5KAI C;  2HQA A;  3FZV A;  1MZB A;  2A6E F;  5D6F A;  4HNV A;  1SFX A;  1TT0 A;  2YU3 A;  5FRN A;  5LRS A;  2ZSH B;  1AWC A;  2FXA A;  5GP9 A;  4DQ2 A;  2HQR A;  4BU2 A;  3H0D A;  4AM3 A;  5HDK A;  4RB2 C;  1WJ5 A;  1YW8 A;  2PMZ A;  5E20 A;  1IF1 A;  2F48 A;  2GIV A;  2K9M A;  5DCF A;  3JRH A;  2P5K A;  4MQ9 F;  4ZC3 A;  2CG4 A;  2M8G X;  3QYB A;  1K7A A;  2FUG 2;  2BY0 A;  4X1E A;  2Z16 A;  4XKC A;  1MMN A;  3DTE A;  1DP3 A;  1G59 A;  2ELJ A;  2JA8 J;  2P5V A;  2V1U A;  1QZZ A;  3K10 A;  2LD5 A;  1SAX A;  4ENM A;  4XKV A;  4XNF A;  5JVT A;  3NAR A;  3CCR I;  3RKY A;  5J6X A;  2E1M B;  3M7G A;  4ZZL A;  2ELH A;  3JTG A;  3SFI A;  4OMY A;  3FX3 A;  2A61 A;  4XRS G;  5K7Z A;  2P6S A;  3GF2 A;  1U8R A;  1BA5 A;  2HNH A;  3ABU A;  1S7A A;  5J8C A;  1PUF B;  2FSW A;  1SVL A;  1IO2 A;  2L7K A;  1MBH A;  1OCP A;  3PO2 J;  2XGD A;  1APL C;  4FQG A;  1T0F C;  1Q1V A;  2KIQ A;  2KKO A;  5BNG A;  1BR1 A;  1YJW I;  5KCM A;  2EZH A;  1QHH D;  4F7Z A;  3Q0W A;  3ZQC A;  1FLI A;  1RES A;  2IJL A;  2JUG A;  1U78 A;  1ZYR F;  2ZC2 A;  2XHK A;  3VWB A;  2XDV A;  1O57 A;  1KZH A;  1XD7 A;  3OMY A;  5KAF C;  4ZZD A;  3OL3 A;  2WAQ N;  2V26 A;  3NRV A;  4D5F A;  3TDU C;  2W4S A;  3DBH B;  2DO7 A;  2YS9 A;  1I27 A;  1Z05 A;  2PJR B;  3RCO A;  3SEQ A;  4E4H A;  4U87 A;  4G9Y A;  4AD9 A;  1XMK A;  2ZXH A;  3C2B A;  3H1C A;  2MLK A;  3NWS A;  2V1D A;  4N9I A;  2A07 F;  3DQV C;  4L5E A;  3WTZ A;  1ETY A;  3VOD A;  5EG0 A;  3NQO A;  4BL0 B;  2R7R A;  1T38 A;  3S2W A;  2R0Q C;  5M5W J;  3I71 A;  2PEX A;  2FNA A;  3QU3 A;  3JRG A;  1MBG A;  4L9T A;  3QYF A;  2A5Y B;  3KP7 A;  2EIN H;  2MC4 A;  2CSO A;  4NC7 A;  4RA2 A;  2KZV A;  4LIT A;  4HX8 A;  3VOE A;  3ZMT A;  4OIP F;  1WI3 A;  4RGX A;  2R7S A;  2VOO A;  2AQE A;  2PG4 A;  4QPO A;  3H3U A;  4QWQ A;  3P9I A;  1D5Y A;  3F8M A;  1ZRD A;  3A0B C;  2ZFU A;  1FSE A;  1WPK A;  3GFM A;  4CSW A;  2EH3 A;  3H5A A;  2CQQ A;  5F27 A;  5LHI A;  2ADU A;  3J7A O;  1MJA A;  1U6G A;  5ICC A;  1GT0 C;  1VTN C;  1Z9C A;  2IGM A;  3FXJ A;  3IL2 A;  1R71 A;  3IH4 A;  4Z2Y A;  3OYM A;  1FEX A;  5B66 C;  4LB5 A;  3CJT B;  1H9T A;  3KZI C;  3IHU A;  3Q0V A;  1ULY A;  3W2V A;  3DP7 A;  1Z77 A;  1W36 D;  4WXH A;  2VLA A;  4X6A J;  3I58 A;  4UY8 I;  4BXX J;  3RIR A;  2OF7 A;  5L3G A;  1STZ A;  2QF7 A;  4HF0 A;  1OKR A;  3D5L A;  3MKL A;  5HVQ C;  4AIK A;  2CUZ A;  3S3M A;  5KNL A;  3W6K B;  3S17 J;  2HR3 A;  3PSI A;  3F8N A;  4BGD A;  1FBU A;  1VQL I;  2RKH A;  2QQ9 A;  4RM3 A;  2UZK A;  2ZJP F;  5J47 A;  3FMS A;  3TOB A;  5A2Q Z;  1Z6T A;  2NVX J;  3GTP J;  5JR3 A;  2A05 A;  3JSO A;  3CP2 A;  3CF2 A;  2XAS A;  2CQK A;  1X3W B;  3KYD B;  1VQ6 I;  4LOC A;  4A3D J;  1ENH A;  1ERD A;  3IAM 2;  2RAE A;  2ZKZ A;  3I56 I;  1ZR2 A;  4C3I J;  3UR3 C;  3BCB A;  1ZQ3 P;  2H8W A;  3RQ4 A;  2AHQ A;  5AON A;  2X85 A;  4MFD A;  1W4M A;  2O6G E;  2K40 A;  5EGO B;  3M8F A;  1I39 A;  2R7Z J;  4HDU A;  1R36 A;  1PP7 U;  4G6D A;  4B09 A;  2HPM A;  4B44 A;  2DMN A;  4EQQ A;  2PMH A;  3H5R A;  2YU9 J;  2P8T A;  4MHG A;  1LDD A;  1F43 A;  1BIB A;  4FIS A;  4A2U A;  1ETV A;  1NK2 P;  3BG6 A;  1ACI A;  1HST A;  2H09 A;  1H9G A;  3WTX C;  2EIK H;  4Y3O A;  3L2C A;  1O7L A;  3HKZ A;  3BT9 A;  1IAW A;  3I59 A;  3GFI A;  5DD8 A;  2R7O A;  3Q9V A;  3RZO J;  3GBG A;  2HOA A;  1HQC A;  2WAE A;  2XIG A;  3CZ6 A;  3M1E A;  2QZ8 A;  3EUK L;  3QOP A;  4RM2 A;  4XLN F;  1KU3 A;  3RKQ A;  4OWR B;  2QKM B;  3JSP A;  1T95 A;  4CYC B;  1K79 A;  2VJI A;  5FJ8 J;  2HWV A;  3A2K A;  2BXY A;  1K78 A;  2X6O A;  1JTY A;  4YIR X;  1ORK A;  3HHG A;  3W6V A;  4A3I J;  2IGN A;  5ILU A;  1U9N A;  1ZGW A;  3RPU D;  3E5Q A;  3ZMD A;  4DIQ A;  1FYK A;  3RTR A;  3GWZ A;  1KQ0 A;  1TC3 C;  1SAN A;  5DM7 F;  3LFU A;  5E17 F;  2Z9O A;  1OFC X;  1UFM A;  3FIW A;  4EJU A;  2W24 A;  4GFB A;  4ITV A;  1GXQ A;  1YIJ I;  2WAD A;  1LDK B;  3HSF A;  2XSD C;  1ETW A;  2XF6 A;  3M8J A;  1R1T A;  4LG3 A;  1A31 A;  2BYV E;  3A01 B;  2UXN A;  1PYV A;  1TWG J;  3C3W A;  3MWM A;  1F4K A;  2GQQ A;  4NQW A;  1Z21 A;  3SJM A;  2UXX A;  2XRO A;  2ZXI A;  3P5J A;  4UNO A;  1SD7 A;  3IH2 A;  4ETS A;  3MKW B;  2IAI A;  4AVP A;  4ENN A;  1K4S A;  1GXP A;  2Y0M A;  2K9S A;  4I0B A;  1LB2 A;  3HOT A;  2HEO A;  2JPB A;  1WH5 A;  1WJE A;  2L02 A;  4U0Y A;  1ODD A;  2D5V A;  5K5R A;  1JI8 A;  3KEQ A;  4Y4R A;  5HS7 A;  3KLN A;  5TRD A;  3OR2 C;  5HS9 A;  4G7H F;  1SD6 A;  4ESJ A;  2NS8 A;  1YHQ I;  2IGK A;  5H20 A;  3VYR B;  4DZP A;  2P81 A;  3WTU C;  1N75 A;  3CCV I;  2XKP A;  1GVJ A;  3H9G A;  4M3F A;  4BJT A;  4E7J A;  2FML A;  3IC7 A;  5ICG A;  1W36 C;  3CQZ J;  3E6C C;  5ERI A;  1JKO C;  5LEK A;  3H36 A;  3GME A;  5E79 C;  1VND A;  4A3L J;  1XGM A;  2H1L A;  4LLG F;  4C2U A;  3LOC A;  4A3K J;  3QU6 A;  2DMQ A;  4BE1 A;  1W0T A;  1CF7 B;  1TNT A;  2VL8 A;  3OYK A;  1XDS A;  4KIF A;  1RR8 C;  4KIC A;  2ZJ2 A;  3J81 K;  1YJ9 I;  1ON2 A;  3GXO A;  1IDY A;  2CW8 A;  3J81 Z;  4E7K A;  1I3Q J;  3LSG A;  5DD4 A;  1PVE A;  1XCB A;  1YYV A;  4JX5 A;  4A3F J;  1I1G A;  3HTS B;  2ID3 A;  2TDX A;  4BUP A;  4CH7 A;  3OYL A;  3K4L A;  3CCJ I;  4CCO A;  1WZ2 A;  4LIV A;  4ENK A;  1UG2 A;  1OR7 C;  2L3D A;  4G94 A;  3BZC A;  2ZFW A;  2QCO A;  5EDN A;  2M34 A;  2BY1 A;  1T8I A;  4G8X A;  2X1C A;  2XF7 A;  1QNT A;  1HSJ A;  2QSF X;  4PSX A;  4M6V A;  2CO5 A;  3DKX A;  1J2X A;  3ZMU A;  2ICW G;  4NQW B;  1VFC A;  3E5X A;  1K61 A;  2RV8 A;  3OS0 A;  2IS2 A;  2AXT C;  2FJ1 A;  4L5J A;  3W2W A;  2K9Q A;  3H9Q A;  2BBY A;  3MFK A;  1TWA J;  4KNY A;  3TP0 A;  4BAC A;  4YG2 F;  2JVG A;  2CFX A;  3DBR B;  3ESW B;  2WV0 A;  4ESF A;  3G1O A;  5HDG A;  1BI1 A;  3G6E I;  4Y52 J;  3E6D A;  1SFK A;  4F91 B;  2VKE A;  2EPF A;  2Y75 A;  3EYI A;  2K4B A;  2HYG D;  2HTJ A;  2NS7 A;  3CD6 I;  3I4M J;  4I7H A;  5LGN A;  4E7H A;  3BZ6 A;  4XIC A;  1ZEL A;  4XOR A;  4E7L A;  2Z1D A;  1RNL A;  3HPH A;  4V2F A;  2FNP A;  4CHU A;  2GAU A;  5ED4 A;  2LFB A;  4QSH A;  4LG0 B;  1R4N B;  4CDG A;  2LKX A;  4L0Y B;  3IV5 A;  3K4N A;  3BR1 A;  2WBM A;  2XAH A;  4CYD A;  4KIS A;  2IW5 A;  1FYL A;  3FXU A;  3OYF A;  2JN6 A;  2A6H F;  3I59 B;  4XMY A;  4HA8 A;  2VJ5 A;  5H6R A;  1SMY F;  1QVU A;  1A6Q A;  5E18 F;  2FQ3 A;  4L18 B;  3TBI A;  2VT3 A;  5FLX K;  3BG5 A;  3CJN A;  3GTM J;  2WAQ A;  2OTJ I;  3TQN A;  1Z6R A;  2H1K A;  3HUG B;  4GRI A;  3QP6 A;  1PJR A;  5FKK A;  3Q3S A;  3BTL A;  1ETQ A;  2RQP A;  3GFJ A;  3L7W A;  2XRL A;  4O6J A;  3CC7 I;  2ZBK A;  1KU7 A;  1ZG3 A;  2DQL A;  4L9N A;  2MC3 A;  2Q2E A;  5E8G A;  3G2B A;  4RDU A;  2VN2 A;  4CCK A;  1TL8 A;  1WFX A;  4N9H A;  4KN4 X;  2EBI A;  3J7A Y;  1R5I D;  2QM3 A;  1D1B A;  3H35 A;  3N4M A;  1Z67 A;  1LEB A;  2VXZ A;  5EZH A;  1X4O A;  3M3Y J;  2O5R A;  1ZLJ A;  3CMY A;  3CCS I;  1R49 A;  1YS7 A;  3GYH X;  5IYC J;  2EA2 A;  1T33 A;  2BGC A;  3DTI A;  3RSN A;  2HGC A;  2V1X A;  1OLT A;  4CUG A;  2IXS A;  1X3U A;  1A5J A;  4XLE A;  4GYI A;  2IRF G;  3S93 A;  2XPW A;  2DA4 A;  1GHC A;  3LSI A;  3FMQ A;  2VE8 A;  3FXR A;  2NNY A;  4KN7 X;  4XSZ F;  3W3C A;  2HQ5 A;  1TTY A;  2EIM H;  4KMU X;  3REO A;  2FOK A;  5E8I A;  2RN7 A;  3SDG A;  1BM9 A;  2GBY A;  2HYJ A;  1I1S A;  1HKT A;  4D9J A;  1S3J A;  1YI2 I;  2M0C A;  2IEK A;  2DA3 A;  2CFO A;  2DPD A;  3I64 A;  2NOG A;  1UB9 A;  2QYO A;  1ZK8 A;  3AAF A;  2LMD A;  2F5C A;  2X9D A;  3FBI B;  3BP8 A;  2I8D A;  3HJE A;  4BQN A;  2VBX A;  1Y8R B;  1XN7 A;  3CME I;  1EH8 A;  5LLQ A;  2QBY B;  3H3Z A;  2Y69 H;  2ZXJ A;  3BPV A;  2GA1 A;  2JA5 J;  5EEA A;  4NBQ A;  2FF4 A;  2GXA A;  4ASN A;  2ZNZ A;  3OYD A;  2VKV A;  1IRG A;  5J8F A;  4MLO A;  4C3J J;  3SEZ A;  4HRI A;  4NC6 A;  2VUM J;  2DA7 A;  1BI2 A;  4WF2 A;  3HBL A;  2K27 A;  3IKV A;  1C0W A;  4BHB A;  2DPU A;  4OOI A;  3ML6 A;  3U2R A;  2X6X A;  2QBY A;  1IC8 A;  2Q2E B;  4Q4Z F;  2P4W A;  2EIL H;  2K4J A;  4CO8 A;  2L5Q A;  4BDZ A;  4PJJ A;  3GZN B;  5FLM J;  2H27 A;  3UKG A;  1IUY A;  5DEQ A;  5J1Y A;  1F9N A;  1U9O A;  1U5T B;  4HQE A;  2DA2 A;  2ZSI B;  3OIQ A;  2DTZ A;  4LD5 A;  4AYB A;  2DQR A;  5J3L A;  1OR7 A;  1SVM A;  5GPA A;  1ZHF A;  5LGU A;  1LFB A;  1X1B A;  1XGS A;  1PUF A;  1S6L A;  3WGG A;  4E7I A;  2L2O A;  4YIF A;  1MIJ A;  2ZJR F;  3NAU A;  3H92 A;  3F9K A;  2GIZ A;  3G1L A;  2R5Z A;  1ON1 A;  3QPH A;  4CCN A;  2CV0 A;  4EMS A;  1JXS A;  1RKT A;  3M4O J;  3BR0 A;  1JE8 A;  1MNM C;  4A0X A;  2V4J C;  2DDB A;  2KDZ A;  2K02 A;  3CTA A;  1MSF C;  1G4D A;  2L4A A;  1E3P A;  1OMI A;  4F3Q A;  4N4O B;  1QBJ A;  2E2J J;  2VC1 A;  3BY6 A;  1OYY A;  3S16 J;  4DZJ A;  2R92 J;  2H6B A;  2XB0 X;  2Y0S N;  5IP9 J;  4KMF A;  2IGO A;  1BN5 A;  4IHX A;  2VAS A;  4XL9 A;  5FLX Z;  1T6S A;  2G7H A;  3WGH A;  5D5U B;  4M9X A;  4UVA A;  3LWF A;  3IKT A;  3C18 A;  1YE9 A;  2JA2 A;  5CJ9 A;  1VQK I;  1I6H J;  3OYG A;  1G2H A;  4JOM A;  4RB1 A;  2BHY A;  3KX2 A;  1J59 A;  3RKW A;  3ZGK A;  1SEU A;  1D1A A;  3BTI A;  2I10 A;  4UUS A;  1I3A A;  2E1M C;  4E7Z A;  2QWW A;  3ROU A;  2ZB9 A;  3S15 J;  2H6C A;  5JLX A;  1LNW A;  1AOY A;  3BOQ A;  3QP5 A;  1SD5 A;  2XAU A;  3KZY A;  4HBL A;  1POG A;  4Y15 A;  1WQ2 A;  2P5L C;  3G1M A;  2A69 F;  2OU2 A;  1OQY A;  2EFQ A;  1XPX A;  3CES A;  4IX7 A;  2HDC A;  2EV6 A;  4OIO F;  3OS2 A;  1WVR A;  2FD5 A;  1BIA A;  2FBH A;  4XSX F;  3SZT A;  1SD4 A;  1FOW A;  2ZCW A;  4BNC A;  2RC4 A;  4P1W A;  4S04 A;  3KET A;  2B63 J;  3A02 A;  4F55 A;  2L4M A;  1QPM A;  5F0H A;  2X6Y A;  4JX4 A;  4YFK F;  1R5H A;  1MW7 A;  4L9V A;  3DPL C;  2E1O A;  1S9H A;  4D5C A;  4EJO A;  5EF6 A;  1FTZ A;  2Q8K A;  1YW7 A;  2XSJ C;  2W82 A;  4DOZ A;  5E3M A;  1IDZ A;  1LE8 B;  5K7H A;  4M3E A;  3COA C;  3ZN0 A;  3LAJ A;  4HEA 2;  2ACJ A;  4U7D A;  4KIT B;  1FMW A;  3OYN A;  2ZME A;  4BEH B;  1BOA A;  3FXL A;  4CCJ A;  4OIR F;  1R22 A;  3DKW A;  1YW9 A;  2PJP A;  2V6C A;  5IOY A;  2YX7 A;  4A0Z A;  4FE7 A;  1YX3 A;  4C2T A;  3ZPL A;  2CU7 A;  1X2N A;  4ON0 A;  3JRB A;  1VQ4 I;  2ZO4 A;  4I02 A;  2IA1 A;  2L0K A;  2F4M B;  3KYL A;  3FM3 A;  1FY7 A;  2WY7 Q;  5M5Y J;  3BWG A;  1CQT A;  1NHA A;  2FEZ A;  1XS9 A;  1HBX G;  5IT9 Z;  3RKX A;  2VT2 A;  3EUH C;  4L5I A;  3CDI A;  1UJ8 A;  3TMO A;  5JLW A;  3IH3 A;  1U2W A;  4DBQ A;  5L3E A;  2G7U A;  2ETH A;  3T0Y A;  2CUF A;  4A12 A;  1HXD A;  3G71 I;  1K4T A;  4II2 A;  1BW5 A;  3VEP A;  2W1O A;  1XDU A;  3U9G A;  3OY9 A;  3Q5F A;  3KYC B;  4UHT A;  2E71 A;  2LK2 A;  3S3N A;  2M7A A;  2R7Q A;  1MNE A;  2KDO A;  3VYS B;  4ABZ A;  1R1U A;  2M30 A;  1TT5 B;  2WAF A;  3GVA A;  1MJ9 A;  4DBR A;  1EH7 A;  2X0L A;  2IS6 A;  2KRH A;  1U3E M;  4PJM A;  9ANT A;  2NNN A;  3U1D A;  1BBY A;  2JT1 A;  2OZ6 A;  2E60 A;  2HVR A;  2JA6 J;  2DMP A;  2E2H J;  1Y1W J;  3BQZ A;  2OD5 A;  1W0U A;  1IV8 A;  1WJD A;  5ILV A;  4CYC A;  2HYF A;  2EA4 A;  4S05 A;  1FOK A;  2HOT A;  3F72 A;  5LGT A;  2KFD A;  3MD2 A;  4MQV A;  3TW7 A;  1YQA A;  1J5Y A;  3L2W A;  3SDB A;  1E3O C;  2BY3 A;  3HGY A;  4EJT A;  4XLC A;  3BPX A;  2IBD A;  1UHW A;  2WA0 A;  2BEO A;  2CMP A;  5HS8 A;  2YPR A;  4MTD A;  2R7X A;  3V4G A;  2PLY A;  4BY7 J;  3DV8 A;  2X4H A;  3A4C A;  3F8B A;  2KZG A;  1YLF A;  2V79 A;  1ETK A;  3KFW X;  3WE2 A;  4C2M J;  2CV1 A;  4HQM A;  4NUB A;  1X4P A;  3LSM A;  2LY9 A;  2X6W A;  2JSP A;  3VYT B;  2PMZ N;  1SFO J;  4XRM A;  1ZTR A;  2DCE A;  2DOA A;  2VOP A;  4HV5 A;  3T1B A;  1ETX A;  2VBW A;  4MEY F;  3CF5 F;  2O9L A;  2M0M A;  2FBI A;  5DM6 F;  4Q5S F;  4B43 A;  2NYX A;  5HOO A;  2CJJ A;  2KMU A;  5D5V B;  1OYI A;  2KIU A;  3PQK A;  2B0L A;  2OV7 A;  1T56 A;  1I6X A;  1QO0 D;  2ECB A;  3U21 A;  2V6E A;  3HOW J;  3I54 A;  2ZXW H;  3GFL A;  1MBE A;  1DUX C;  2VON A;  3MQ0 A;  5L3B A;  1F36 A;  1N77 A;  2LBF A;  2KT0 A;  1RI7 A;  3TP3 A;  3I3L A;  3TDZ C;  3ASO H;  4A6D A;  2DT7 B;  3S2D J;  2STW A;  3HPG A;  1R4M B;  2KQR A;  4IHS A;  2K9L A;  3SHF A;  3GTQ J;  4FTH A;  1W7P B;  2R3S A;  3ELK A;  1Y56 A;  4CCM A;  1TQI A;  1PP8 F;  1OJL A;  2CGP A;  2NS0 A;  3PO3 J;  4F52 A;  3BRO A;  3DLA A;  2VQG A;  1OYW A;  4M3D A;  4MNU A;  5J1U A;  1ZH5 A;  1I5Z A;  2DFE A;  3EUH A;  2HS5 A;  3DPU A;  2WB1 N;  3OSF A;  3C2H A;  2VBZ A;  2LBF B;  3B73 A;  1USS A;  1W5S A;  2JRT A;  2VJ4 A;  4MO7 A;  1GLN A;  5TJJ A;  2CWE A;  1FOX A;  4C30 A;  3FIS A;  2M8E A;  3MAJ A;  2B7E A;  1B4A A;  2R5Y A;  2LYC A;  3L00 A;  2VPL A;  4M3B A;  1IRF A;  3WTW C;  5JHF A;  1K6O A;  4FE4 A;  2DT6 A;  2F4O B;  4JX6 A;  3GTK J;  2MSY A;  2NOJ B;  4Q47 A;  3O8G A;  2DFF A;  2LY2 A;  2CW7 A;  5AIP A;  4KIB A;  2E5N A;  4DW6 A;  4Y17 A;  2XRN A;  3K4K A;  2QVO A;  3MEX A;  4PGH A;  4RB0 A;  2JTV A;  2BE5 F;  3DCF A;  3AKZ A;  3A0H C;  3OYH A;  3AG2 H;  2F6C A;  2DK5 A;  1LFU P;  3WHB A;  1R6R A;  1H89 C;  1DPU A;  5CVJ A;  2QQB A;  3WTS C;  1BC8 C;  4HOB A;  3HDD A;  3ZR8 X;  1EKE A;  1GUU A;  2PBI A;  3E6B A;  4BXF A;  4EGY A;  3CCU I;  1PDN C;  2N8G A;  2DK8 A;  3CUO A;  2QSG X;  1X1A A;  2RVC A;  4KUM A;  1JHF A;  2LY1 A;  2M4K A;  5IT3 A;  3GUD A;  2Q1Z B;  2RDP A;  1J7K A;  3ABL H;  3KP3 A;  1XGN A;  5LD2 C;  5HLI A;  4OU0 A;  4M73 A;  4DYQ A;  3P7N A;  2O3F A;  3CP8 A;  1X2M A;  3PJR A;  1J09 A;  2DMT A;  2R7V A;  1WSU A;  1TQM A;  2Q0O A;  4G6Q A;  4XM3 A;  4GDF A;  3KEY A;  1T39 A;  3QPS A;  4A3E J;  1DDN A;  4CCL A;  3AL0 C;  3K69 A;  2DAO A;  3OR1 C;  3CMM A;  3WTY C;  3K2A A;  2CRG A;  3HRS A;  2XAQ A;  3ZXS A;  3H5N A;  2QEN A;  3HUG A;  1UZC A;  2LP0 A;  3KLO A;  3ECO A;  3CDH A;  3FF5 A;  2L7M P;  1QPI A;  2E7W A;  2R5Y B;  2K86 A;  3AG1 H;  2X51 A;  2BHZ A;  1XCV A;  5F64 A;  2XV4 S;  3SZP A;  3ZCO A;  2JVH A;  1JUM A;  4A3J J;  2I5U A;  2RGV A;  1KYW A;  3HL2 A;  2LRE A;  2ISZ A;  1R23 A;  1OCZ H;  2NVQ J;  2W57 A;  3TED A;  1NG6 A;  3K70 C;  1TW3 A;  1AA7 A;  4ZYA A;  2VBY A;  4I01 A;  3S1N J;  5B1B H;  5F0C A;  5KVR A;  4K2E A;  4JP0 A;  5AIQ A;  4WX9 A;  4RGU A;  4HV6 A;  5DDG A;  4QPQ A;  3JTH A;  4B48 A;  4LG0 A;  1IRX A;  1AHD P;  2OQG A;  1TWF J;  3K4M A;  2VIX A;  3LA3 A;  4PUS A;  1X19 A;  2DJN A;  2H8R A;  2EZK A;  3ZQL A;  3RPQ A;  2F5V A;  2YSR A;  3JRF A;  2EFO A;  2E36 A;  4R8H A;  3B6C A;  2CUE A;  1WJF A;  4B3A A;  4ESB A;  4UUS B;  4JK1 X;  3E3V A;  2P7V B;  3CDL A;  2HU9 A;  3OIO A;  3TO9 A;  5E1X A;  5KHD A;  1XSX A;  3BJA A;  1SC7 A;  3G3Z A;  3HXL A;  3GTJ J;  1NG7 A;  4BQA A;  2ZJQ F;  1REP C;  4KJZ A;  4R1H A;  1P6R A;  2QGU A;  1A36 A;  1UHM A;  1FZP B;  3E5U A;  5LHH A;  2HVS A;  1A04 A;  2QLZ A;  4IHY A;  1GVD A;  4W1U A;  2WV1 A;  2MH9 A;  2X48 A;  1MH3 A;  2VJJ A;  4HZF A;  2CQ7 A;  4A5N A;  4RMN A;  3S3O A;  2QA4 I;  1XB4 A;  4HX7 A;  2JSC A;  1YX5 A;  3K1P A;  2VOD A;  4IPA A;  1BI3 A;  1T2K A;  3VYU B;  1BL0 A;  3F22 A;  2COB A;  3BJO A;  3GZ5 A;  2LOO A;  3CO7 C;  1MMG A;  3HG9 A;  1G3T A;  3RYR A;  3WG7 H;  4AWX B;  4H4K C;  5J4Y A;  5K5Q A;  2M1B A;  3WTV C;  1TWH J;  1ZAR A;  2JZY A;  3OYB A;  2XVC A;  4TV7 A;  2EIJ H;  1N78 A;  1EA3 A;  4RLF A;  4RGS A;  3CLQ A;  5C3E J;  4CA0 A;  3AG4 H;  1W1W E;  3FM5 A;  1W7P D;  4C3H J;  1DQU A;  4IL6 C;  4E70 A;  1T98 A;  4V19 K;  2W00 A;  4HG2 A;  1HA8 A;  1YS6 A;  5KK1 A;  5FB2 A;  3H3V K;  3DF8 A;  2J5P A;  2O7O A;  3EDP A;  1WCM J;  2DN0 A;  4XLA A;  1IGN A;  4IXA A;  3V7S A;  3CCM I;  1V5G A;  3MZ8 A;  1WHU A;  4XOT A;  4ZYD A;  1MD0 A;  2CH0 A;  2LH9 A;  1O3S A;  4IEJ A;  3OYE A;  2DTR A;  1Z1D A;  5BPI A;  4KDP A;  2LG4 A;  2OTL I;  5M3F J;  2LF8 A;  2XGC A;  2TRT A;  4Y13 A;  2LNB A;  4O5V A;  5FLV A;  2W25 A;  2HKX A;  4M6X A;  4D1Q A;  3K7A J;  4BHP A;  2RNG A;  1D8K A;  1TBX A;  3S1Q J;  4PCQ A;  1TNS A;  2VPR A;  5JHU A;  1IXS B;  4M72 A;  2HTS A;  2JQ7 A;  2DXI A;  3ERM A;  3PL8 A;  2DW4 A;  4D7N A;  3RQI A;  3CCY A;  3VB2 A;  1FNN A;  1JTX A;  4LLN A;  1Y8Q B;  2Y2Z A;  4L9J A;  1MMD A;  5CQG A;  1VQ9 I;  5FKO A;  1KYZ A;  4YII A;  3HRU A;  3DPT A;  1IZ1 A;  4HNU A;  3QYE A;  2DLL A;  5E1W A;  4I2O A;  4F92 B;  2DOF A;  1RUO A;  1JKQ C;  4HW0 A;  1GV5 A;  4EEF G;  4JQF A;  3JRE A;  2OBP A;  2V1N A;  5FKN A;  1U5T A;  3H9J A;  5CYV A;  4BJ6 C;  5IY5 H;  4PFO A;  1D1C A;  4XLF A;  5EGO A;  2DA6 A;  2AO9 A;  2EB7 A;  2MBF A;  4C9Y A;  5C44 J;  1LQ1 A;  3TW6 A;  3C7J A;  4S0H B;  3WU1 B;  2HPI A;  2ZME B;  4BEH A;  1T0F A;  3ZMS A;  3M8E A;  1X1P A;  4HLX A;  1SMT A;  3A1Y A;  1RRJ A;  1Q1H A;  1ZG5 A;  1D0Y A;  3RPU A;  2K9N A;  2OZU A;  4GO1 A;  1MSE C;  1G6N A;  3WU0 A;  1KA8 A;  2DYR H;  2CV2 A;  2UV1 A;  1YFH A;  5LBQ A;  2BY2 A;  2HVQ A;  4KYW A;  1BR2 A;  3MCZ A;  2YUS A;  3I53 A;  2EZL A;  1P7I A;  4A0Y A;  3QPT A;  3GTL J;  3NEU A;  3CCE I;  5FRO A;  2VB6 A;  2VQH A;  2D1V A;  3HC7 A;  1JKR C;  3BR2 A;  5LFA A;  5DCM B;  2XF5 A;  2QEX I;  2JK3 A;  3IWZ A;  3WGI A;  1JJ8 C;  1LPQ A;  2DA5 A;  1V54 H;  1X58 A;  4E7S A;  2WWY A;  4FET A;  1BOB A;  4WXC A;  4I09 A;  4G6T B;  1P7J A;  1XTA A;  3O6B B;  3A01 A;  3S2H J;  3FMR A;  2CYY A;  2QQ8 A;  2FX0 A;  5E3O A;  1ZAO A;  5TGT A;  2RRE A;  5J1R A;  1BJZ A;  2HFH A;  2KRF A;  4JBA A;  1IRZ A;  3F6O A;  4BE0 A;  4G7Z F;  1QZY A;  4IQJ A;  3IAS 2;  4AUX A;  2MGQ A;  3ZMV A;  3ASN H;  3LFK A;  4M9S A;  2B9S A;  4XK4 A;  1FSH A;  2XAJ A;  5EYR A;  1B72 B;  3F21 A;  2COM A;  3FXK A;  4KT5 C;  5DTD A;  1FPQ A;  3BLY A;  5HDN A;  4BE2 A;  3FXM A;  3OS1 A;  2OUM A;  2UUZ A;  3AFH A;  3GCM A;  3JR9 A;  2A5W A;  3MVP A;  3ZN1 A;  1VQP I;  4OMZ A;  1Y6I A;  3J80 Z;  2F4I A;  4L0Z B;  3GEZ A;  3FXQ A;  1FBQ A;  3DEW A;  1LJ9 A;  1P4A A;  4EJV A;  1MH4 A;  1VQ5 I;  3K2Z A;  4ENJ A;  3P9C A;  1L0O C;  3PUB A;  5LHG A;  4NDL A;  2BVL A;  2EFN A;  1XG1 A;  3HEF A;  2FOW A;  4ZDO A;  3S32 A;  3DU6 A;  5IP6 A;  1QVT A;  2QQA A;  4U88 A;  5DS9 A;  2KP6 A;  3OYJ A;  4RLQ A;  4J00 A;  3K6G A;  1FP1 D;  3HOX J;  2FQ4 A;  1IJW C;  3LSP A;  3T5X A;  4GGG A;  1FIP A;  4D7M A;  3R4K A;  1HCR A;  1WGX A;  4M71 A;  1IXC A;  3FWE A;  5K1Y A;  1DU6 A;  4MTE A;  4ZDP A;  3HTU A;  2LKS A;  2W84 A;  2W85 A;  5GAG J;  3J80 K;  5A2Q K;  4FCY A;  5IT9 K;  3R60 A;  2BOL A;  3CUQ B;  3EUA A;  1EH6 A;  4GCV A;  5L3C A;  3PUF A;  2Z99 A;  3K4C A;  2MA3 A;  5B1A H;  2A6T A;  4AYB N;  1M1E B;  4XRF A;  2F5E A;  3HKZ N;  3BR3 A;  3LST A;  1B59 A;  1B72 A;  4EM2 A;  3DKY A;  3HZJ A;  3RZD J;  3E97 A;  4HSR A;  4XR6 A;  3IUO A;  4A3B J;  2L7Z A;  3ZQ7 A;  4BKX A;  1QU3 A;  1LVK A;  2ESN A;  3N05 A;  4PFP A;  3CCL I;  2M45 A;  2RQQ A;  1E2X A;  1UG0 A;  4KIG A;  4BHC A;  3LA2 A;  2Y9Z A;  2PQ8 A;  3WG9 A;  2P7C B;  1E3H A;  3IWF A;  2O03 A;  5JI6 A;  3ULQ B;  4RAZ A;  1UCR A;  2K3P A;  3HIF A;  2G9W A;  1YIO A;  2XKO A;  1MBK A;  2KJB A;  2H94 A;  3ECH A;  1ZGJ A;  5CPR B;  2MYS A;  4BS9 A;  5CVV A;  3L2R A;  3KP5 A;  1B9N A;  3LSK A;  2RNJ A;  2NRA C;  4BYY A;  4EJW A;  3EQL F;  3H0G J;  1V5E A;  2FMY A;  5FD5 A;  1RKW A;  3T8T A;  1DU0 A;  1R9T J;  2VKD A;  3LQR A;  1RZ4 A;  3PIO F;  3CC4 I;  5D4R A;  1IW7 F;  4OAZ A;  3R0A A;  4XLH A;  2PN6 A;  2MW8 A;  2XUB A;  1OIS A;  3GLL A;  2G0E A;  4A3G J;  2E5Z A;  4M74 A;  2IP2 A;  2GOX B;  5GTI C;  4AU7 A;  5EG0 B;  3E6M A;  3ZP5 A;  2OCC H;  5H6Q A;  4HF1 A;  1WH7 A;  3OWT A;  1G3S A;  1BJA A;  4PJ0 C;  4FX4 A;  2LLK A;  3T8R A;  1SFU A;  3LL7 A;  3PQJ A;  4F93 B;  4B8X A;  5HNH A;  5HNF A;  3IRQ A;  5JFR A;  1EV7 A;  1S5L C;  1B1B A;  2P6T A;  1YRN A;  1U0J A;  2MH2 A;  3PM1 A;  1Y39 A;  2KIF A;  3I5U A;  3JCU C;  5GPC A;  2XPU A;  4BAY A;  1JJ6 C;  3M07 A;  3EET A;  2ECC A;  1Z91 A;  3ABM H;  3R0J A;  4HNT A;  3W6J B;  3JRC A;  4EV0 A;  2QUF A;  3C1D A;  3K9T A;  1VQ7 I;  3VSK A;  1GDT A;  1P9Q C;  2OPT A;  1MMA A;  4LB6 B;  3MKY B;  2YX4 A;  5B5E C;  4XOP A;  2E35 A;  1N25 A;  3CCQ I;  1Z3X A;  3R6S A;  4CIC A;  2XAF A;  4JYK A;  4B3X A;  2KL4 A;  1WRJ A;  4OIN F;  2DFH A;  3BR6 A;  4W97 A;  3RYP A;  1HLV A;  2KIM A;  1TW2 A;  2AXL A;  2L9R A;  3BTJ A;  3IRR A;  4HAM A;  2IS1 A;  2ZNY A;  3HSE A;  2VKH A;  3HM5 A;  4IHT A;  1P4W A;  2LRD A;  4MIM A;  3RJP A;  4WCG A;  3FBN B;  1A6I A;  3W2A A;  2LTP A;  1HW5 A;  3F8C A;  4AIH A;  3L1P A;  3GLX A;  1DP7 P;  2L01 A;  2LSO A;  1FJL A;  3TKY A;  4D0P A;  1ITY A;  4ZDL A;  1J0R A;  3CC2 I;  2IVM A;  1FOY A;  2K85 A;  2W48 A;  1ZKG A;  1QZE A;  2E34 A;  2R7D A;  1O3Q A;  1D5V A;  4UUV A;  4LIU A;  1S29 A;  4J19 A;  4IVN A;  3V42 A;  2DI3 A;  3BG7 A;  2X1D A;  3V8L A;  1V3F A;  1BR4 A;  2WC2 A;  3D0S A;  3TOA A;  3OYC A;  3PIP F;  5F6F A;  4IF4 A;  4PJL A;  2K7L A;  2MAB A;  4X0G A;  4AIJ A;  1WJA A;  3ABK H;  4U7B A;  4BQQ A;  4IHW A;  3BCA A;  3OOU A;  2EV0 A;  1MKM A;  3SFZ A;  5E1Z B;  2F5F A;  5HOD A;  4XQF A;  2CS3 A;  1JKP C;  2O8K A;  4RBO A;  3DEU A;  1FYM A;  4KA4 A;  1VQ8 I;  4UVB A;  1O7F A;  4LGW A;  1J75 A;  2XPV A;  4ZYE A;  2PFB A;  2PI0 A;  2LC2 A;  5J40 A;  2NAZ A;  5CKT A;  4IO9 F;  3PFY A;  2GXB A;  3QRF F;  4O3M A;  2DOE A;  4HYE A;  2MG4 A;  1R1V A;  1XX5 A;  4OIQ F;  2J5O A;  2Y31 A;  2JWT A;  3F0C A;  1JUP A;  4IRI A;  3E7L A;  3QAH A;  4BBS J;  5FGM A;  2IT0 A;  2CW0 F;  3EYY A;  2XGE A;  2M9H A;  3HB9 A;  1MGT A;  2JJ7 A;  2M3A A;  2BW3 B;  5DUK A;  1V55 H;  2DU9 A;  5FFX A;  2DOD A;  2KRC A;  1ZRF A;  1WWX A;  4KFC A;  4M6Y A;  3UNG C;  3OYI A;  3JAM K;  1QQI A;  2V9V A;  3MZH A;  2D45 A;  1RET A;  3AG3 H;  3VFZ A;  3OSG A;  3V7C A;  1EF4 A;  2FRH A;  2FA5 A;  3I9V 2;  5HLG A;  3ZRG A;  1MJB A;  1JT6 A;  4MEX F;  3LSR A;  1XSD A;  5IOZ A;  2L7F P;  1KU2 A;  4YEL A;  4CZC A;  4M3G A;  2XC7 A;  1UST A;  1R58 A;  1S7E A;  3FHN A;  4P55 A;  4NNJ A;  1MDM A;  4Z6Y A;  3KZZ A;  4LMY A;  1EJ9 A;  4IKF A;  4DJA A;  2GWR A;  5FO5 A;  1QHG A;  5ICE A;  3KPH A;  1HKS A;  1KON A;  4GYG A;  4A69 C;  2R7W A;  5CVR A;  5K5O A;  2VQL A;  1MND A;  1S8N A;  2VC0 A;  4Y33 A;  3ZQI A;  4U0V A;  2HXO A;  4IZZ A;  3KEO A;  5F1R A;  3TGN A;  3MKZ A;  1IG7 A;  4E6K G;  5B3S H;  2BV6 A;  1SVO A;  2R7T A;  5EZG A;  3S8P A;  4UUT A;  1P4X A;  2EK5 A;  3BC8 A;  1CGP A;  3CJQ B;  3K0L A;  2JA7 J;  2JRM A;  3KE2 A;  4A5M A;  3ERE D;  4A3M J;  4XN0 A;  3LA7 A;  3O8H A;  1S7O A;  4IQ4 A;  5DUI A;  1B8I A;  4YFN F;  1UAA A;  2V9P A;  4XN3 A;  2P0W A;  1L3L A;  3OV8 A;  1QRY A;  3J7Z I;  5EEH A;  1MMS A;  1HDD C;  1JGG A;  2IA2 A;  3HHH A;  2FE3 A;  2CQN A;  2V7F A;  1K6Y A;  5F04 A;  3NWT A;  3QQA A;  5HLH A;  4IOA F;  2JMW A;  5GAH J;  1QA6 A;  3BTC A;  3TO7 A;  3KP4 A;  1LDJ A;  2OC6 A;  5E3N A;  3ZMZ A;  5GAE J;  2A68 F;  1HKQ A;  5D6E A;  1AKH A;  3QOD A;  4RB3 C;  2HKO A;  5DYM A;  2MLG A;  5E3L A;  3LMM A;  4YRV A;  6PAX A;  1K78 B;  4BJ5 C;  1R5G A;  2GLO A;  1V4R A;  3K1N A;  3SZG A;  2EQR A;  2QSH X;  2LR8 A;  3OIP A;  3QPL A;  1WKM A;  3S1R J;  1H0M A;  4EVI A;  2WTE A;  5FD6 A;  4DGW B;  4RAG A;  1Z7U A;  2PJR A;  2M4G A;  4EAT A;  1TWC J;  2OA4 A;  3SYT A;  2LVS A;  3Q9S A;  3CLO A;  4GXO A;  2DDA A;  5D5W B;  1O4X A;  3D1N I;  1W5T A;  1ZGA A;  4CZZ A;  2NVT J;  3K1M A;  2ID6 A;  3HOZ J;  1Z3Y A;  4UB8 C;  2X1E A;  3O3K A;  4CXF A;  4RAY A;  2JUC A;  1D0X A;  2NVU B;  2R4G A;  3N97 A;  1YO5 C;  4XID A;  3RI4 A;  3GZ6 A;  1F1Z A;  4LFU A;  2GXG A;  1LUJ B;  5GAD J;  3HSR A;  4YFX F;  1JUS A;  5K7F A;  1HF0 A;  4P5O A;  2HOS A;  4N0B A;  2DFI A;  4ZJZ A;  2AS5 F;  3LNQ A;  4LLL A;  3KCC A;  3RDI A;  1ZRC A;  4ZH4 F;  5L3F A;  2XAG A;  1UHS A;  1Z0X A;  3PNY A;  4P9F A;  1TZL A;  3CO6 C;  4G7O F;  4ZTF A;  1YRN B;  2M2E A;  1OPC A;  1WJC A;  3VSL A;  4FHT A;  2O8X A;  3EPZ A;  1OCC H;  1XGO A;  4I98 B;  3F6V A;  3F23 A;  3E1S A;  1LVA A;  4CGZ A;  4I99 C;  4RGR A;  4ZYH A;  1D8J A;  2EFP A;  1OCR H;  4XLP F;  1ONV A;  3BG3 A;  2E1C A;  1UEL B;  3I55 I;  4EM0 B;  5IP7 J;  2GZW A;  5M3M J;  3JRA A;  1O3T A;  1G8X A;  1LFP A;  5D4S A;  4AID A;  1HW2 A;  1X1D A;  2R7U A;  3HOV J;  2VE9 A;  2E1N A;  3R61 A;  3ZQH A;  3DLL F;  1AKH B;  1Z7L A;  4QLC U;  3U1K A;  4A93 J;  3FK7 A;  3HYI A;  4WK8 F;  3D5R C;  1KU9 A;  4BXU A;  4WXD A;  2HDW A;  3CUQ A;  4Y7N J;  1LE8 A;  1MDM B;  2DJI A;  1P2F A;  2MD0 A;  2F5D A;  5JVG F;  4A6E A;  5C4X J;  1E0E A;  1JHH A;  3BR5 A;  4LK0 F;  1O3R A;  1FWZ A;  3BZK A;  2LF7 A;  5FKM A;  5EJC A;  4ZTJ A;  1IN5 A;  1YOV B;  4BQO A;  1NK3 P;  1VZ0 A;  1FT9 A;  3PSF A;  2OJE D;  3F3X A;  3K4J A;  1BW6 A;  3MZY A;  2L9V A;  4NB5 A;  4P9U A;  4UV9 A;  5ILS A;  4XKB A;  1B8I B;  1DPR A;  2IS4 A;  5DV5 A;  4BH9 A;  1FIA A;  2LKP A;  2ME6 A;  5F08 A;  4PZJ A;  4PK4 A;  4LJZ F;  1W5C C;  1WJB A;  2AQF A;  2IA0 A;  1ZN2 A;  2YR2 A;  5DCM A;  2EFW A;  4KT6 A;  1X3Z B;  3GW2 A;  3FKI J;  2EZI A;  2ME0 A;  3M1C A;  3V8J A;  3PFI A;  2CQX A;  2MFZ A;  3HRT A;  2EV5 A;  2ZME C;  1XMX A;  2F2E A;  4LK1 F;  3FKJ A;  3LAP A;  1GV2 A;  2KPM A;  4V2G A;  2WB1 A;  3ONQ A;  4R79 A;  3ZOB A;  1B9M A;  1IV6 A;  1FX7 A;  1FP2 A;  1IN8 A;  1W7P A;  3V8K A;  3G4S I;  1KQ8 A;  2WY8 Q;  2VQC A;  5EEG A;  1VQN I;  2EJR A;  1FTT A;  3QOE A;  1LEA A;  4BY1 J;  2IPQ X;  3E0J B;  2VI6 A;  2GM4 A;  4U0W A;  1ETO A;  4RAF A;  1HW1 A;  5LEJ A;  2LDU A;  1S72 I;  1RR7 A;  2Y48 A;  3L2U A;  3DTK A;  1D0Z A;  2Z5U A;  1CF7 A;  3HOY J;  1T08 B;  1XSV A;  3LSJ A;  5F0F A;  1D3Y A;  1RUN A;  1P92 A;  3FXO A;  4IRG A;  2K3F A;  3CJR B;  4FX0 A;  1BI0 A;  1HC8 A;  2FU4 A;  4HLY A;  4HF2 A;  3GTO J;  1FBS A;  4IJA A;  2OAZ A;  1J9I A;  2EWN A;  4QIW N;  4XKW A;  1TQP A;  1AU7 A;  2BW3 A;  4PJN A;  2VXD A;  4WWC A;  4PGG A;  2ISY A;  2HQN A;  2L9N A;  4QTR A;  1IN6 A;  2E7X A;  3V7R A;  2GOM A;  2Y0S A;  1ZG1 A;  1ZR4 A;  2HOE A;  3CUQ C;  5D5X B;  5IYD J;  3ZQG A;  2BVM A;  2HZD A;  1R7J A;  2M7B A;  1H8A C;  1V5F A;  1IUF A;  3D5S C;  4J01 A;  3KP2 A;  2KHM A;  3GO5 A;  1A35 A;  2D1H A;  1Y1V J;  2NXN B;  3CMA I;  2E2I J;  1B6A A;  4P96 A;  3O2P E;  4BBR J;  2M87 A;  1PUE E;  4A3C J;  2GA2 A;  3X2Q H;  5D8L B;  2STT A;  4IOC F;  3BG9 A;  3IP4 B;  3WOD F;  3I4N J;  1IXR C;  5CLS A;  3FHZ A;  4M9Z A;  4PSW A;  3SQN A;  3OOP A;  1YG2 A;  3I4P A;  5HLT A;  4NHJ A;  2OCE A;  1QGP A;  2HI3 A;  3TO6 A;  4B4C A;  3M9A A;  5BS6 A;  3AL0 B;  5D8K B;  1YJN I;  1K83 J;  3DBL B;  3JRI A;  1DGR M;  4B1R A;  4IHV A;  4ANJ A;  1H88 C;  3K4B A;  3MMY B;  1VF9 A;  1G3W A;  2BXZ A;  3BQY A;  3DWL E;  5C4J J;  3DFG A;  5BOX A;  1VQM I;  3DU5 A;  4ZYG A;  1JT0 A;  1NH3 A;  2HXI A;  5IYB J;  5L3D A;  5H2F C;  3ZQF A;  3ABT A;  4DYR A;  2HZT A;  3VDX A;  3J7Y J;  4UVC A;  1VQO I;  5F1J A;  2O61 A;  2KJC A;  1UMQ A;  2DYS H;  5CVU A;  3L09 A;  3JRD A;  5FKL A;  3WHC A;  4UXN A;  1F5T A;  1MBF A;  1TP4 A;  2DMU A;  2ELK A;  3P9K A;  3JAM Z;  1X1C A;  3GX4 X;  2MD5 A;  5TIS C;  2KLO A;  3I0T A;  1BC7 C;  1IN7 A;  3KIO A;  1HDP A;  4B47 A;  2C6Y A;  1TLH B;  4OAY A;  2QKL B;  1ZLK A;  5BPD A;  4XBF A;  3FDY A;  4EGZ A;  4II3 A;  2HDD A;  2UWM A;  4NC8 A;  4XRS A;  3MN2 A;  2CUJ A;  3L9F A;  4DYC A;  1YIT I;  3S1M J;  1XMA A;  4MFE A;  1FMV A;  2O0Y A;  3K70 D;  4RS8 A;  3ZQQ A;  5ICF A;  5IPA A;  4EM1 A;  2M5W A;  2BZT A;  3A03 A;  5LRR A;  3JW4 A;  3HOS A;  2PMU A;  2Z3Y A;  4Q48 A;  3GTG J;  1NTC A;  1IN4 A;  4DNC A;  3BDD A;  3WU2 C;  1SAU A;  1MBJ A;  4MGR A; 
#chains in the Genus database with same CATH homology
 2DBB A;  1G3Y A;  2A3S A;  2JPC A;  1JGS A;  3KP6 A;  1KQ9 A;  4FT8 A;  1KGS A;  2R7F A;  1YTY A;  2ESH A;  1SFE A;  2DT5 A;  3SXY A;  1WI9 A;  5BQT A;  1ZRE A;  3F8F A;  2L54 A;  5FFZ A;  1RIO H;  1Y0U A;  3LQQ A;  1E17 A;  2FBK A;  3HRM A;  1R00 A;  4HX4 A;  2D2W A;  5BMZ A;  3G73 A;  5CVI A;  4PDK A;  4UV8 A;  3WTT C;  3DXJ F;  3WE3 A;  4H0E A;  4IRH A;  1U5T C;  2OQR A;  2XGX A;  3ISP A;  3B02 A;  1FC3 A;  4HDV A;  2Z33 A;  4I0A A;  3BJ6 A;  3FZV A;  1MZB A;  2A6E F;  5D6F A;  1SFX A;  2YU3 A;  5LRS A;  1AWC A;  2FXA A;  4DQ2 A;  2HQR A;  5HDK A;  4RB2 C;  1YW8 A;  5E20 A;  1IF1 A;  2GIV A;  5DCF A;  2P5K A;  4MQ9 F;  2CG4 A;  1K7A A;  2P5V A;  2V1U A;  1QZZ A;  1SAX A;  4ENM A;  5JVT A;  3RKY A;  5J6X A;  3JTG A;  3M7G A;  4ZZL A;  2ELH A;  4OMY A;  3FX3 A;  2A61 A;  2P6S A;  3GF2 A;  1U8R A;  3ABU A;  1S7A A;  5J8C A;  2FSW A;  2KKO A;  4F7Z A;  1FLI A;  2IJL A;  1U78 A;  1ZYR F;  2XHK A;  1O57 A;  1XD7 A;  4ZZD A;  3NRV A;  3TDU C;  2DO7 A;  1I27 A;  1Z05 A;  4G9Y A;  4AD9 A;  1XMK A;  2MLK A;  2V1D A;  4N9I A;  2A07 F;  3DQV C;  3WTZ A;  3VOD A;  3NQO A;  1T38 A;  3S2W A;  3I71 A;  2PEX A;  2FNA A;  3QU3 A;  4L9T A;  2A5Y B;  3KP7 A;  2CSO A;  3VOE A;  3ZMT A;  4HX8 A;  4OIP F;  4RGX A;  2VOO A;  2PG4 A;  3H3U A;  4QWQ A;  3P9I A;  3F8M A;  1ZRD A;  1FSE A;  3J7A O;  3GFM A;  5LHI A;  2ADU A;  1MJA A;  1U6G A;  5ICC A;  1VTN C;  1Z9C A;  3IL2 A;  4Z2Y A;  4LB5 A;  1H9T A;  3IHU A;  1ULY A;  3DP7 A;  4WXH A;  3I58 A;  3RIR A;  5L3G A;  1STZ A;  4HF0 A;  1OKR A;  3D5L A;  4AIK A;  5HVQ C;  3W6K B;  2HR3 A;  3F8N A;  1FBU A;  2RKH A;  2QQ9 A;  2UZK A;  3FMS A;  3TOB A;  5A2Q Z;  1Z6T A;  5JR3 A;  3JSO A;  2XAS A;  2CQK A;  2ZKZ A;  5AON A;  1W4M A;  2O6G E;  3M8F A;  4HDU A;  1R36 A;  1PP7 U;  4G6D A;  4B09 A;  4EQQ A;  2PMH A;  2P8T A;  4MHG A;  1LDD A;  1BIB A;  4A2U A;  1HST A;  2H09 A;  1H9G A;  3WTX C;  3L2C A;  1O7L A;  1IAW A;  3I59 A;  3GFI A;  5DD8 A;  3Q9V A;  1HQC A;  2XIG A;  3M1E A;  2QZ8 A;  3QOP A;  4XLN F;  1KU3 A;  3JSP A;  1K79 A;  2HWV A;  1K78 A;  3HHG A;  5ILU A;  3E5Q A;  3ZMD A;  1FYK A;  3RTR A;  3GWZ A;  1KQ0 A;  5E17 F;  2Z9O A;  1UFM A;  4EJU A;  2W24 A;  1GXQ A;  1LDK B;  3HSF A;  1R1T A;  2BYV E;  2UXN A;  3C3W A;  3MWM A;  1F4K A;  2GQQ A;  4NQW A;  2UXX A;  2XRO A;  4UNO A;  1SD7 A;  4ETS A;  4AVP A;  4ENN A;  1GXP A;  2Y0M A;  4I0B A;  1LB2 A;  3HOT A;  2HEO A;  2JPB A;  2L02 A;  4U0Y A;  1ODD A;  5K5R A;  3KEQ A;  5HS7 A;  3KLN A;  5TRD A;  5HS9 A;  4G7H F;  1SD6 A;  4ESJ A;  5H20 A;  3WTU C;  2XKP A;  1GVJ A;  2FML A;  3IC7 A;  5ICG A;  3E6C C;  5ERI A;  5LEK A;  1XGM A;  4LLG F;  3QU6 A;  1CF7 B;  1TNT A;  1XDS A;  4KIF A;  4KIC A;  2ZJ2 A;  3J81 K;  1ON2 A;  3GXO A;  3J81 Z;  5DD4 A;  1XCB A;  1YYV A;  1I1G A;  3HTS B;  2TDX A;  4ENK A;  2L3D A;  4G94 A;  2ZFW A;  4G8X A;  1QNT A;  1HSJ A;  2CO5 A;  1J2X A;  3ZMU A;  3E5X A;  2RV8 A;  4L5J A;  2BBY A;  3MFK A;  4KNY A;  4YG2 F;  2CFX A;  2WV0 A;  4ESF A;  5HDG A;  1BI1 A;  3E6D A;  2Y75 A;  3EYI A;  2K4B A;  2HYG D;  2HTJ A;  4I7H A;  5LGN A;  3BZ6 A;  1RNL A;  4CHU A;  2FNP A;  2GAU A;  5ED4 A;  4LG0 B;  4CDG A;  4L0Y B;  2XAH A;  4CYD A;  2IW5 A;  1FYL A;  3FXU A;  2A6H F;  3I59 B;  4HA8 A;  5H6R A;  1SMY F;  5E18 F;  2FQ3 A;  4L18 B;  2VT3 A;  5FLX K;  3CJN A;  3TQN A;  1Z6R A;  3QP6 A;  2RQP A;  3GFJ A;  3L7W A;  4O6J A;  2ZBK A;  1KU7 A;  1ZG3 A;  2DQL A;  4L9N A;  2MC3 A;  2Q2E A;  5E8G A;  2VN2 A;  4N9H A;  4KN4 X;  2QM3 A;  3N4M A;  1LEB A;  2VXZ A;  1ZLJ A;  1YS7 A;  3GYH X;  2EA2 A;  2BGC A;  2HGC A;  2V1X A;  1X3U A;  4GYI A;  2IRF G;  1GHC A;  3FMQ A;  2VE8 A;  3FXR A;  2NNY A;  4KN7 X;  4XSZ F;  1TTY A;  4KMU X;  3REO A;  2FOK A;  5E8I A;  2RN7 A;  1BM9 A;  1I1S A;  1HKT A;  1S3J A;  2DPD A;  3I64 A;  2QYO A;  1UB9 A;  3AAF A;  2F5C A;  3BP8 A;  2VBX A;  1XN7 A;  1EH8 A;  5LLQ A;  2QBY B;  3H3Z A;  2ZXJ A;  3BPV A;  2GA1 A;  2FF4 A;  4ASN A;  2ZNZ A;  1IRG A;  5J8F A;  1BI2 A;  4WF2 A;  2K27 A;  3IKV A;  1C0W A;  4BHB A;  2DPU A;  4OOI A;  3ML6 A;  3U2R A;  2QBY A;  4Q4Z F;  2P4W A;  2K4J A;  4CO8 A;  2H27 A;  1IUY A;  5DEQ A;  1F9N A;  1U5T B;  4HQE A;  4LD5 A;  2DQR A;  1OR7 A;  1ZHF A;  5LGU A;  1XGS A;  1S6L A;  3WGG A;  4YIF A;  3H92 A;  1ON1 A;  3QPH A;  1JXS A;  4EMS A;  1JE8 A;  4A0X A;  2K02 A;  3CTA A;  1G4D A;  2L4A A;  1OMI A;  1QBJ A;  2VC1 A;  3BY6 A;  1OYY A;  2H6B A;  4KMF A;  1BN5 A;  5FLX Z;  1T6S A;  2G7H A;  3WGH A;  5D5U B;  4M9X A;  4UVA A;  3LWF A;  3IKT A;  3C18 A;  5CJ9 A;  4RB1 A;  1J59 A;  3RKW A;  2QWW A;  3ROU A;  2H6C A;  1LNW A;  1AOY A;  3BOQ A;  3QP5 A;  1SD5 A;  3KZY A;  4HBL A;  4Y15 A;  1WQ2 A;  2P5L C;  2A69 F;  2OU2 A;  2EFQ A;  2HDC A;  4OIO F;  2EV6 A;  1BIA A;  2FBH A;  4XSX F;  3SZT A;  1SD4 A;  2ZCW A;  4BNC A;  2RC4 A;  4S04 A;  3KET A;  2L4M A;  1QPM A;  4YFK F;  1R5H A;  4L9V A;  3DPL C;  4EJO A;  2Q8K A;  1YW7 A;  3COA C;  3ZN0 A;  3LAJ A;  2ACJ A;  4U7D A;  2ZME A;  1BOA A;  4OIR F;  1R22 A;  3DKW A;  1YW9 A;  2PJP A;  2V6C A;  2YX7 A;  4A0Z A;  3ZPL A;  4ON0 A;  2ZO4 A;  4I02 A;  2IA1 A;  3FM3 A;  1FY7 A;  3BWG A;  1NHA A;  2FEZ A;  1HBX G;  5IT9 Z;  3RKX A;  2VT2 A;  4L5I A;  1U2W A;  5L3E A;  2G7U A;  2ETH A;  3T0Y A;  4A12 A;  1HXD A;  3VEP A;  1XDU A;  3U9G A;  3Q5F A;  4UHT A;  1R1U A;  2M30 A;  3GVA A;  1MJ9 A;  1EH7 A;  2X0L A;  1U3E M;  2NNN A;  3U1D A;  1BBY A;  2JT1 A;  2OZ6 A;  2OD5 A;  5ILV A;  2HYF A;  2EA4 A;  4S05 A;  1FOK A;  3F72 A;  5LGT A;  4MQV A;  1YQA A;  1J5Y A;  4EJT A;  3BPX A;  1UHW A;  2BEO A;  5HS8 A;  2YPR A;  4MTD A;  3V4G A;  2PLY A;  3DV8 A;  2X4H A;  3KFW X;  3F8B A;  1YLF A;  2V79 A;  3WE2 A;  4HQM A;  2VOP A;  4HV5 A;  3T1B A;  2VBW A;  4MEY F;  2FBI A;  4Q5S F;  5HOO A;  2NYX A;  5D5V B;  1OYI A;  2KIU A;  3PQK A;  2B0L A;  1I6X A;  1QO0 D;  3I54 A;  3GFL A;  1DUX C;  2VON A;  3MQ0 A;  5L3B A;  1RI7 A;  3TDZ C;  4A6D A;  2STW A;  4IHS A;  3SHF A;  1W7P B;  2R3S A;  3ELK A;  1TQI A;  1PP8 F;  2CGP A;  2NS0 A;  3BRO A;  1ZH5 A;  1OYW A;  4MNU A;  1I5Z A;  3EUH A;  2HS5 A;  2VBZ A;  3B73 A;  1USS A;  1W5S A;  2JRT A;  5TJJ A;  2CWE A;  2M8E A;  3MAJ A;  1B4A A;  3L00 A;  1IRF A;  3WTW C;  1K6O A;  4Q47 A;  5AIP A;  4KIB A;  4Y17 A;  2XRN A;  3MEX A;  2QVO A;  4PGH A;  4RB0 A;  2JTV A;  2BE5 F;  2DK5 A;  1DPU A;  1BC8 C;  5CVJ A;  3WTS C;  2QQB A;  4HOB A;  2PBI A;  3E6B A;  4EGY A;  1PDN C;  2DK8 A;  3CUO A;  2RVC A;  4KUM A;  1JHF A;  5IT3 A;  3GUD A;  2RDP A;  1J7K A;  3KP3 A;  1XGN A;  5HLI A;  4OU0 A;  4M73 A;  3P7N A;  2O3F A;  1WSU A;  1TQM A;  2Q0O A;  4G6Q A;  1T39 A;  1DDN A;  3K69 A;  2DAO A;  3WTY C;  3HRS A;  2XAQ A;  2QEN A;  3HUG A;  3KLO A;  3ECO A;  3CDH A;  3FF5 A;  2E7W A;  2K86 A;  1XCV A;  5F64 A;  2XV4 S;  3SZP A;  2RGV A;  1KYW A;  2ISZ A;  1R23 A;  2W57 A;  1TW3 A;  2VBY A;  4I01 A;  5KVR A;  4K2E A;  5AIQ A;  4WX9 A;  4RGU A;  4HV6 A;  5DDG A;  3JTH A;  4LG0 A;  2OQG A;  3LA3 A;  3RPQ A;  2YSR A;  2EFO A;  4R8H A;  4ESB A;  4JK1 X;  3E3V A;  2P7V B;  3TO9 A;  5E1X A;  1XSX A;  3BJA A;  3G3Z A;  4BQA A;  1REP C;  4R1H A;  1P6R A;  1UHM A;  1FZP B;  3E5U A;  5LHH A;  1A04 A;  2QLZ A;  2MH9 A;  4HZF A;  4A5N A;  1XB4 A;  4HX7 A;  2JSC A;  3K1P A;  2VOD A;  4IPA A;  1BI3 A;  1T2K A;  3F22 A;  3BJO A;  3GZ5 A;  3CO7 C;  1G3T A;  3RYR A;  4AWX B;  3WTV C;  5K5Q A;  2M1B A;  1ZAR A;  2JZY A;  2XVC A;  4TV7 A;  4RGS A;  3FM5 A;  1W7P D;  4E70 A;  1T98 A;  1YS6 A;  5KK1 A;  5FB2 A;  3DF8 A;  2J5P A;  3EDP A;  4IXA A;  3V7S A;  4ZYD A;  1MD0 A;  1O3S A;  2DTR A;  1Z1D A;  5BPI A;  4KDP A;  2LF8 A;  4Y13 A;  2LNB A;  4O5V A;  2W25 A;  2HKX A;  4M6X A;  4BHP A;  1D8K A;  1TBX A;  4PCQ A;  1TNS A;  5JHU A;  1IXS B;  4M72 A;  2HTS A;  2DW4 A;  3VB2 A;  1FNN A;  4LLN A;  4L9J A;  1KYZ A;  4YII A;  3HRU A;  3DPT A;  1IZ1 A;  2DLL A;  5E1W A;  4I2O A;  1RUO A;  4HW0 A;  4JQF A;  2OBP A;  1U5T A;  5CYV A;  2EB7 A;  2MBF A;  1LQ1 A;  3C7J A;  3WU1 B;  2ZME B;  1T0F A;  3ZMS A;  3M8E A;  4HLX A;  1SMT A;  1Q1H A;  1ZG5 A;  3RPU A;  2OZU A;  4GO1 A;  1G6N A;  3WU0 A;  1KA8 A;  1YFH A;  5LBQ A;  4KYW A;  3MCZ A;  3I53 A;  4A0Y A;  3QPT A;  3NEU A;  2D1V A;  5DCM B;  3WGI A;  3IWZ A;  2WWY A;  4WXC A;  4I09 A;  3O6B B;  3FMR A;  2CYY A;  1ZAO A;  2HFH A;  2KRF A;  4JBA A;  3F6O A;  4G7Z F;  1QZY A;  3ZMV A;  4M9S A;  3LFK A;  1FSH A;  2XAJ A;  3F21 A;  2COM A;  4KT5 C;  1FPQ A;  5HDN A;  3ZN1 A;  4OMZ A;  3J80 Z;  4L0Z B;  3GEZ A;  3FXQ A;  1FBQ A;  1LJ9 A;  1P4A A;  4EJV A;  3K2Z A;  4ENJ A;  3P9C A;  1L0O C;  5LHG A;  2EFN A;  2QQA A;  4U88 A;  1FP1 D;  3T5X A;  4GGG A;  3R4K A;  4M71 A;  1IXC A;  3FWE A;  5K1Y A;  4MTE A;  3HTU A;  2W84 A;  3J80 K;  2W85 A;  5A2Q K;  5IT9 K;  3R60 A;  3CUQ B;  1EH6 A;  4GCV A;  5L3C A;  2Z99 A;  2MA3 A;  4XRF A;  2F5E A;  3LST A;  1B59 A;  4EM2 A;  3E97 A;  3ZQ7 A;  2ESN A;  2M45 A;  4KIG A;  1E2X A;  4BHC A;  3LA2 A;  2PQ8 A;  3WG9 A;  2P7C B;  3IWF A;  2O03 A;  5JI6 A;  3ULQ B;  4RAZ A;  1UCR A;  3HIF A;  2G9W A;  1YIO A;  2KJB A;  2XKO A;  2H94 A;  3ECH A;  1ZGJ A;  5CVV A;  3KP5 A;  1B9N A;  2RNJ A;  2NRA C;  4BYY A;  4EJW A;  3EQL F;  2FMY A;  5FD5 A;  3T8T A;  3LQR A;  1RZ4 A;  5D4R A;  1IW7 F;  3R0A A;  2PN6 A;  2XUB A;  4M74 A;  2IP2 A;  3E6M A;  3ZP5 A;  5H6Q A;  4HF1 A;  1G3S A;  1BJA A;  4FX4 A;  3T8R A;  1SFU A;  3PQJ A;  4B8X A;  3IRQ A;  5JFR A;  1EV7 A;  1B1B A;  2P6T A;  2MH2 A;  2KIF A;  3I5U A;  4BAY A;  3EET A;  1Z91 A;  3R0J A;  3W6J B;  4EV0 A;  2QUF A;  3C1D A;  3K9T A;  4LB6 B;  2YX4 A;  3R6S A;  4CIC A;  2XAF A;  1WRJ A;  4OIN F;  3RYP A;  2KIM A;  1TW2 A;  2AXL A;  3IRR A;  4HAM A;  2ZNY A;  3HSE A;  4IHT A;  1P4W A;  3RJP A;  4WCG A;  1HW5 A;  3F8C A;  4AIH A;  3GLX A;  1DP7 P;  2L01 A;  2LSO A;  3TKY A;  4D0P A;  1J0R A;  2IVM A;  2R7D A;  1O3Q A;  1D5V A;  4UUV A;  1S29 A;  4IVN A;  2DI3 A;  3V8L A;  1V3F A;  2WC2 A;  3D0S A;  3TOA A;  5F6F A;  4IF4 A;  2K7L A;  4AIJ A;  4U7B A;  2EV0 A;  1MKM A;  3SFZ A;  5E1Z B;  2F5F A;  3DEU A;  1FYM A;  4KA4 A;  4UVB A;  1O7F A;  4LGW A;  1J75 A;  4ZYE A;  2PFB A;  2PI0 A;  2NAZ A;  2GXB A;  3QRF F;  4O3M A;  4HYE A;  1R1V A;  4OIQ F;  2J5O A;  4IRI A;  3QAH A;  5FGM A;  2IT0 A;  2CW0 F;  3EYY A;  1MGT A;  5FFX A;  5DUK A;  2DU9 A;  1ZRF A;  1WWX A;  4KFC A;  4M6Y A;  3JAM K;  1QQI A;  2V9V A;  3MZH A;  2D45 A;  3VFZ A;  3V7C A;  2FRH A;  2FA5 A;  5HLG A;  1MJB A;  4MEX F;  1XSD A;  1KU2 A;  1UST A;  1R58 A;  4P55 A;  1MDM A;  3KZZ A;  4LMY A;  2GWR A;  5FO5 A;  5ICE A;  1HKS A;  4GYG A;  5CVR A;  5K5O A;  1S8N A;  2VC0 A;  4U0V A;  3KEO A;  5F1R A;  3TGN A;  2BV6 A;  1CGP A;  1P4X A;  2EK5 A;  3K0L A;  3KE2 A;  4A5M A;  3ERE D;  3LA7 A;  1S7O A;  5DUI A;  4YFN F;  1L3L A;  3OV8 A;  5EEH A;  2IA2 A;  3HHH A;  2FE3 A;  5HLH A;  3TO7 A;  3KP4 A;  1LDJ A;  3ZMZ A;  2A68 F;  1HKQ A;  5D6E A;  4RB3 C;  2HKO A;  5DYM A;  2MLG A;  6PAX A;  1K78 B;  1R5G A;  1V4R A;  3K1N A;  1WKM A;  1H0M A;  4EVI A;  2WTE A;  5FD6 A;  1Z7U A;  2OA4 A;  3Q9S A;  3CLO A;  4GXO A;  5D5W B;  1W5T A;  1ZGA A;  4CZZ A;  3K1M A;  3O3K A;  4CXF A;  4RAY A;  3N97 A;  1YO5 C;  3RI4 A;  3GZ6 A;  1F1Z A;  4LFU A;  2GXG A;  3HSR A;  4YFX F;  4P5O A;  4N0B A;  2DFI A;  2AS5 F;  4LLL A;  3KCC A;  3RDI A;  1ZRC A;  4ZH4 F;  5L3F A;  2XAG A;  4G7O F;  4P9F A;  3CO6 C;  1OPC A;  4FHT A;  2O8X A;  1XGO A;  4I98 B;  3F6V A;  3F23 A;  1LVA A;  4CGZ A;  4RGR A;  4ZYH A;  1D8J A;  2EFP A;  4XLP F;  1ONV A;  2E1C A;  4EM0 B;  2GZW A;  1O3T A;  5D4S A;  1HW2 A;  2VE9 A;  2E1N A;  3R61 A;  4QLC U;  3HYI A;  4WK8 F;  1KU9 A;  4BXU A;  4WXD A;  3CUQ A;  1MDM B;  1P2F A;  2F5D A;  4A6E A;  1JHH A;  4LK0 F;  1O3R A;  1FWZ A;  2LF7 A;  1IN5 A;  1FT9 A;  4NB5 A;  3F3X A;  3MZY A;  4P9U A;  4UV9 A;  5ILS A;  1DPR A;  5DV5 A;  4BH9 A;  2LKP A;  4PZJ A;  4LJZ F;  2IA0 A;  1ZN2 A;  2YR2 A;  5DCM A;  2EFW A;  3GW2 A;  3V8J A;  3PFI A;  3HRT A;  2EV5 A;  2F2E A;  4LK1 F;  3LAP A;  4R79 A;  1B9M A;  1FX7 A;  1FP2 A;  1IN8 A;  1W7P A;  3V8K A;  1KQ8 A;  5EEG A;  2EJR A;  1LEA A;  2IPQ X;  4U0W A;  1HW1 A;  5LEJ A;  2LDU A;  2Y48 A;  2Z5U A;  1CF7 A;  1XSV A;  1D3Y A;  1RUN A;  1P92 A;  4IRG A;  4FX0 A;  1BI0 A;  2FU4 A;  4HLY A;  4HF2 A;  1FBS A;  4IJA A;  2OAZ A;  1J9I A;  2EWN A;  1TQP A;  4WWC A;  4PGG A;  2ISY A;  2HQN A;  1IN6 A;  2E7X A;  3V7R A;  1ZG1 A;  2HOE A;  3CUQ C;  5D5X B;  1R7J A;  3KP2 A;  3GO5 A;  2D1H A;  1B6A A;  4P96 A;  3O2P E;  2M87 A;  1PUE E;  2GA2 A;  5D8L B;  2STT A;  3WOD F;  1IXR C;  5CLS A;  3FHZ A;  4M9Z A;  3SQN A;  3OOP A;  1YG2 A;  3I4P A;  4NHJ A;  5BS6 A;  1QGP A;  3TO6 A;  3M9A A;  5D8K B;  1G3W A;  3DFG A;  5BOX A;  4ZYG A;  5L3D A;  3ABT A;  2HZT A;  2O61 A;  4UVC A;  2KJC A;  5CVU A;  3L09 A;  4UXN A;  1F5T A;  3P9K A;  3JAM Z;  3GX4 X;  2MD5 A;  3I0T A;  1BC7 C;  1IN7 A;  2C6Y A;  1TLH B;  1ZLK A;  5BPD A;  4XBF A;  4EGZ A;  2UWM A;  3L9F A;  1XMA A;  2O0Y A;  4RS8 A;  5ICF A;  4EM1 A;  2M5W A;  3HOS A;  5LRR A;  3JW4 A;  2PMU A;  2Z3Y A;  4Q48 A;  1IN4 A;  4DNC A;  3BDD A;  4MGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...