2A3SA

Solution structure and dynamics of dna-binding domain of myocyte nuclear factor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
101
structure length
101
Chain Sequence
ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and Dynamics of DNA-Binding Domain of Myocyte Nuclear Factor
rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords Myocyte Nuclear Factor
total genus 15
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2a3sA00
2QYOA 4XRFA 1BIAA 3E6CC 2ZBKA 1B59A 5F6FA 4QWQA 1BN5A 5L3BA 4IJAA 1I27A 3TGNA 1PP8F 5D8LB 1OYWA 1B9MA 2A07F 2HQNA 3F23A 2YX4A 2QQ9A 3V8KA 3E5UA 4LK0F 5E20A 5E17F 2PQ8A 3WTXC 4D0PA 4RGXA 2PBIA 3T0YA 3P7NA 2NAZA 2Y75A 1FT9A 2QWWA 1QZZA 1J59A 4RGUA 2PMUA 5ILUA 2L3DA 1PP7U 2G9WA 2R7DA 2TDXA 2IP2A 3E97A 4KUMA 3T5XA 5LHGA 1V4RA 1R22A 3QU3A 1VTNC 3IC7A 2VBWA 1XDSA 4IXAA 1W7PA 1ZLJA 3WE2A 5ICFA 1QNTA 4LFUA 2JRTA 2LDUA 2A6HF 3QP5A 2ZO4A 3FWEA 3JTHA 3AAFA 3E3VA 4MGRA 2XAGA 2VT2A 2VBXA 1I5ZA 2HTJA 4PZJA 2P6SA 2X0LA 4I7HA 2UZKA 4A0XA 2E7WA 2Q8KA 1ZN2A 2IW5A 1L0OC 2KJCA 4GO1A 3DXJF 2PLYA 5F1RA 1ODDA 4BHPA 5FFXA 1YS7A 3G3ZA 4YFXF 5LRSA 4ZYGA 3I71A 3CO7C 2A6EF 3MEXA 3K69A 5D5WB 3V8JA 2O0YA 4KIGA 3EYYA 3DQVC 3EUHA 5A2QK 3EQLF 5D4SA 3SFZA 3MZYA 5DV5A 4ESJA 3DPLC 3WE3A 4KFCA 4LGWA 1S3JA 1MZBA 1CF7A 3FXQA 2E1CA 2RV8A 5ICEA 3N97A 3DPTA 2BE5F 4LG0A 1Z91A 2M45A 2ACJA 4P96A 4BQAA 2LSOA 3HTUA 2VOOA 3ELKA 3HOSA 4BHCA 1RIOH 2D1VA 4KIBA 4EJUA 4L0ZB 4ZYDA 3IKTA 1YYVA 2Y48A 5LLQA 3T8TA 4MHGA 4S05A 2HQRA 1YW9A 3I64A 1LDJA 2JTVA 1FLIA 2QUFA 5ERIA 3VFZA 4CGZA 1ZRCA 3CJNA 4P55A 1SFXA 4L0YB 1F4KA 1ONVA 4R1HA 3GFIA 1BOAA 3QOPA 4HYEA 2IPQX 3FM3A 2M1BA 4NB5A 1FBSA 4A12A 2EB7A 4U0WA 4PCQA 1FSHA 2P4WA 2P8TA 1LVAA 5ICGA 3S2WA 3L00A 3J80K 1LEAA 1YG2A 2VE8A 2HGCA 2R7FA 3DV8A 1QO0D 1ZLKA 1J9IA 4G6QA 5E1ZB 2KRFA 3LAJA 4ZH4F 2XRNA 3KLOA 4BAYA 2FMLA 3W6KB 4Q47A 2GIVA 1EH6A 2HYGD 5AIPA 2CQKA 1U5TA 3VB2A 3BDDA 2YX7A 1H9TA 1TLHB 2JZYA 2W84A 1ZGJA 1T6SA 2ZCWA 3DF8A 2F5CA 5CVVA 3E6DA 4EJOA 1SD4A 4UHTA 1F1ZA 3JAMK 3I59B 1G4DA 3RPUA 1IXSB 2LNBA 1U6GA 3C18A 2DPUA 1B6AA 2JPBA 3J7AO 3KP5A 5BPDA 4KNYA 3F22A 1JHFA 1YO5C 2P5VA 4EM1A 3GF2A 5LHHA 1F5TA 2WC2A 2KKOA 1LDKB 4YIIA 4HLXA 1R23A 5LGNA 2DK5A 4I2OA 1D8KA 2YR2A 1W7PB 2WV0A 2FMYA 1BM9A 1K7AA 4I09A 3C7JA 1JHHA 4KMUX 2ZNYA 1O3RA 1P4AA 4HF1A 2VT3A 2GZWA 2HZTA 4GYGA 4F7ZA 1FBUA 3BJ6A 3QPHA 4MTEA 1SD5A 3TKYA 4GCVA 4HOBA 4IVNA 1I1GA 4CDGA 3Q9SA 3V8LA 1HKSA 3IWFA 2XKOA 1TW3A 3KP2A 1U5TB 2EFNA 2KIMA 3U1DA 2YPRA 5DD8A 3DFGA 1XN7A 3HHHA 5CVIA 2HFHA 2MLKA 1P4WA 1XSDA 1TBXA 2O6GE 2V9VA 3ZP5A 3FXUA 3E6MA 3ABUA 1FPQA 4BNCA 4XLPF 5HDGA 3B02A 1XD7A 1BI1A 1ZH5A 3I5UA 1HKQA 3R4KA 3MWMA 2DK8A 1O7LA 2C6YA 1REPC 4MTDA 3LA2A 4Z2YA 1KQ9A 3MCZA 3L09A 1Z9CA 2VC0A 4MEXF 3HSEA 2FNAA 4MQVA 4KICA 2QVOA 3WTSC 1O3QA 5L3GA 2DT5A 2IA2A 3D0SA 2ZFWA 4XBFA 5HLGA 5CYVA 3LA3A 2DTRA 3RIRA 2GXGA 5D6FA 1IXCA 2FRHA 1HW5A 3F8CA 2OU2A 1S7OA 2Q0OA 1O3TA 1LQ1A 3HSRA 2DBBA 1MDMB 2MLGA 3REOA 4G6DA 4LJZF 5E1XA 4IHSA 4OIQF 1OYYA 1U78A 2E1NA 2Z3YA 1KQ8A 4A0YA 4BHBA 3I54A 1Z6RA 5IT3A 1ZG3A 2EFPA 2B0LA 4HZFA 1TQIA 2DLLA 2D45A 1YIOA 2HWVA 2VBZA 1D5VA 3CTAA 5HLHA 1TW2A 2UXNA 3F6OA 4RAYA 3IWZA 3TOAA 4Y17A 1BIBA 1W5SA 3HRMA 4L9JA 2W85A 2EFOA 4U0YA 1Z1DA 2MH2A 1WWXA 4RS8A 1KU9A 2MA3A 4Q4ZF 2M30A 1B9NA 2H6CA 1KGSA 2ZJ2A 2CG4A 3ML6A 5F64A 3VODA 3M7GA 5D8KB 4U7DA 4ON0A 4LK1F 4NQWA 2HEOA 1G3YA 2RDPA 4FHTA 1F9NA 4M71A 1P4XA 3HHGA 3KLNA 2GAUA 3ZMZA 3NEUA 2J5PA 2P7CB 1Z7UA 3O2PE 5IT9Z 2A68F 5DDGA 2NYXA 1TNSA 2O3FA 2RNJA 1YW8A 1K78A 4GYIA 1XSXA 3F3XA 2WTEA 1R1UA 3WU1B 2BGCA 3ECOA 5FLXZ 4L5JA 1LEBA 3ZMDA 3WTTC 2J5OA 2ESNA 2VN2A 2KIFA 1IRGA 4JK1X 1DPUA 2XVCA 2HS5A 5DCMB 1UCRA 1Z6TA 3KZZA 4QLCU 3KETA 2FBHA 4N0BA 5LBQA 1I1SA 1ZAOA 2M5WA 5CVJA 3GVAA 2Z9OA 4OIRF 1ZYRF 5L3EA 2FF4A 3I59A 1E17A 3TOBA 2RKHA 3EYIA 1T38A 4YG2F 1YQAA 1MKMA 2EV5A 2QQBA 3RKXA 4CICA 2PI0A 4KT5C 2QENA 1U8RA 2LF7A 3V7CA 3SQNA 1IF1A 2F5EA 5L3DA 4G7ZF 2DPDA 4KN4X 4DQ2A 4R79A 3BOQA 4RGSA 4U0VA 4RB0A 3G73A 3F72A 4KN7X 3ZPLA 4M72A 2XUBA 2P6TA 3I53A 1MDMA 1XMAA 2CGPA 4E70A 4NHJA 4UVAA 1IN7A 3RYRA 3O6BB 2FEZA 5D5UB 2FU4A 4BXUA 2XAFA 1WRJA 5H6QA 2K4BA 1LJ9A 1QBJA 4I02A 3CUQA 2OA4A 1HKTA 5BMZA 2P5LC 5DYMA 3C3WA 2A69F 3M8EA 2HYFA 1KYZA 1IXRC 3GZ6A 4Q5SF 2XKPA 5JI6A 2W57A 3LSTA 2KIUA 2RC4A 4IF4A 2FBKA 4AIKA 4WX9A 3FMSA 1SMTA 5L3FA 3K1MA 4R8HA 3P9CA 4ESBA 1OMIA 2IA0A 5FGMA 3P9IA 1ZGAA 4ZYEA 5DD4A 4LG0B 4Y13A 3HRTA 3HOTA 1PDNC 1H0MA 3R60A 5AONA 3GFMA 2VONA 1T98A 4ETSA 3PQKA 5L3CA 4OINF 4L9NA 1FZPB 3R6SA 1P6RA 2VODA 2Z5UA 3JAMZ 5DCFA 2G7UA 4GXOA 2HKXA 5FFZA 3LWFA 4EJWA 1HW1A 1DDNA 4OIPF 3IHUA 1O57A 4HBLA 5HS7A 4U7BA 1O7FA 4N9HA 4M6XA 4P9FA 3LA7A 1FP1D 4CXFA 1XCVA 3WU0A 4WK8F 1FSEA 1G3SA 2P5KA 4OMZA 4UVBA 4AWXB 2WWYA 2W24A 2CO5A 1EH8A 1QQIA 3WTWC 3GLXA 4UVCA 2A61A 3F8NA 2GWRA 3F6VA 5DEQA 1TNTA 2YU3A 3GYHX 2CYYA 1YS6A 1A04A 5CVRA 3WODF 5LEKA 3FXRA 3MAJA 4LB5A 3IRQA 5HDKA 5ED4A 1OKRA 4G94A 3GWZA 1IN4A 1U2WA 3RDIA 2RQPA 1SFEA 5DUIA 5CVUA 2BBYA 4YFNF 5J8CA 2DQLA 4OIOF 2EK5A 4O3MA 1IUYA 4XSZF 3R0AA 5ICCA 1ZHFA 1IN5A 2O61A 2XHKA 4EM0B 2XASA 3RTRA 3TQNA 1UHMA 1XGSA 3KE2A 3FHZA 3KFWX 3SZPA 3KZYA 5BOXA 1V3FA 2EA4A 2KJBA 3ULQB 2DAOA 1H9GA 4HDVA 2BV6A 3BROA 2XAQA 4O6JA 3CO6C 2QM3A 4CYDA 4M9SA 3GFJA 3WTZA 4HLYA 5J8FA 5FD5A 1SAXA 1S6LA 1KYWA 2ADUA 1GXPA 1DUXC 4KMFA 4YFKF 2OQRA 1FX7A 3ZMSA 2QBYB 2OQGA 4G9YA 1XGMA 3KP6A 5DCMA 3CUOA 4I01A 1IRFA 2STWA 2YSRA 3ZMUA 2EJRA 3IRRA 3F8FA 5D6EA 3T1BA 3ABTA 3M8FA 1KU7A 5K5OA 4OU0A 2DI3A 2ZNZA 3H3UA 1OPCA 3GXOA 1BC8C 3VOEA 4A0ZA 4HAMA 4EVIA 4M74A 2XIGA 3K9TA 1MD0A 1STZA 2MBFA 4PGGA 5A2QZ 3HRSA 3EDPA 4EQQA 2EA2A 4BYYA 4G8XA 5D5VB 3DP7A 1U3EM 3V7SA 1IAWA 4IRHA 2V6CA 3LFKA 1WKMA 3COAC 5HOOA 3KEQA 3OV8A 3QPTA 1AOYA 2ELHA 3O3KA 3BPXA 4JQFA 2STTA 4HQMA 3M9AA 1GXQA 1HSJA 5HDNA 3L7WA 3MZHA 1KA8A 2DQRA 5KK1A 1R36A 4CO8A 1FOKA 3SXYA 4KDPA 4LLLA 1J5YA 5HLIA 3FMQA 4HV5A 2IJLA 3KCCA 5TJJA 2L4AA 2JPCA 1CGPA 2HR3A 2HTSA 4RGRA 3FZVA 3E5XA 3L2CA 3RI4A 3F8BA 3K1PA 4KA4A 2K4JA 3JTGA 4WF2A 3RPQA 5ILSA 5HS8A 2L02A 3BJAA 4FX0A 5JFRA 4IHTA 2QZ8A 1ZG1A 1T0FA 3NQOA 2PJPA 2FSWA 4ASNA 3HUGA 5BPIA 5K5QA 2XROA 2H09A 3BZ6A 1K79A 1BI3A 2E7XA 3V4GA 4WXHA 1IZ1A 4ENKA 1O3SA 1BC7C 2XAHA 2Y0MA 1HW2A 4M73A 3H3ZA 4HF0A 2CW0F 4M9ZA 3HRUA 3GUDA 3JW4A 4HQEA 1YFHA 4LB6B 1KQ0A 1ZARA 4GGGA 4UXNA 6PAXA 2K27A 3F21A 3FX3A 5LEJA 4AD9A 3W6JB 1K78B 4P9UA 1FP2A 3ZMTA 3ISPA 3IL2A 3WGGA 3BWGA 4ENJA 1LNWA 2F5DA 4UUVA 3LQQA 4IPAA 3CUQB 4K2EA 1FY7A 1FYKA 1ON1A 1Q1HA 2CWEA 5E1WA 3PQJA 1WI9A 4PDKA 1ULYA 4L9TA 5E8GA 5K5RA 2AXLA 4I98B 2EV0A 1FBQA 1D8JA 2LF8A 4RB1A 2ZMEA 3HSFA 1JGSA 2RVCA 2HDCA 1LDDA 3WTYC 2OBPA 5E8IA 3LQRA 3U9GA 3K0LA 4EV0A 3M1EA 3B73A 1B4AA 5AIQA 3IKVA 2BEOA 5BS6A 3GX4X 1UB9A 1DPRA 2NNNA 1G6NA 2O8XA 1FYMA 2MH9A 3H92A 2D1HA 5LRRA 1G3TA 2VBYA 1HBXG 3NRVA 4P5OA 3HIFA 3CDHA 2V1XA 3MQ0A 2EFWA 3R0JA 5LGUA 2FQ3A 2L4MA 2NRAC 1BI2A 2ETHA 3BP8A 3TDZC 2VXZA 2GA2A 2HKOA 4G7OF 2PFBA 4EGYA 1XGOA 4AVPA 1HXDA 2H94A 4N9IA 4KYWA 3WTUC 2VE9A 3E6BA 3ECHA 1OYIA 1R00A 2QQAA 1UHWA 3N4MA 3BJOA 2QBYA 3RKWA 3JSOA 1UFMA 2M87A 2P7VB 1AWCA 1QGPA 1GHCA 1P2FA 5HVQC 2ZXJA 3WTVC 3U2RA 1W4MA 1XDUA 1R5GA 4AIJA 1K6OA 2BYVE 2V1UA 4ENNA 1RNLA 4ESFA 1LB2A 4LD5A 2MC3A 2COMA 2ESHA 4TV7A 5JR3A 3J81Z 3KP3A 3J81K 1ON2A 2ZKZA 4B8XA 4UNOA 4I0AA 2V1DA 2R3SA 3C1DA 3SZTA 3PFIA 4HW0A 3P9KA 1ZREA 2RN7A 3D5LA 4KIFA 1G3WA 2ISZA 3QAHA 2OAZA 2VC1A 3JSPA 2PN6A 4L9VA 2F5FA 2UXXA 5H6RA 1XCBA 1KU3A 5JVTA 4UV8A 5D5XB 4LLNA 3TO6A 3GO5A 1NHAA 2IRFG 2FBIA 1R5HA 4A2UA 2DW4A 4FT8A 2L01A 3RJPA 3K2ZA 3TO7A 1FC3A 1J7KA 2FE3A 3WGIA 4WXCA 4MQ9F 1XMKA 2JT1A 4Q48A 2DO7A 1R1TA 4M6YA 2Z33A 3K1NA 2FA5A 1R1VA 2K02A 5E18F 4ZZLA 5IT9K 3I4PA 1T2KA 2CSOA 2A3SA 4HX4A 3MFKA 1MJBA 2G7HA 3GZ5A 3KP7A 5FO5A 3V7RA 3FM5A 2LKPA 2XGXA 2K7LA 3LAPA 5EEGA 2XAJA 3HYIA 3R61A 2IA1A 2ZMEB 4G7HF 4ZZDA 4LMYA 3ZQ7A 1Z05A 3ZMVA 2Q2EA 1D3YA 2PG4A 1MGTA 2K86A 1RUOA 2ISYA 1WQ2A 3EETA 4IRGA 3CUQC 4A5NA 2GXBA 4EJTA 1KU2A 3DEUA 3ROUA 1IW7F 1FWZA 1I6XA 4M9XA 3WGHA 4I0BA 2OZUA 2UWMA 4DNCA 1RI7A 2H6BA 1ZRFA 1YTYA 3T8RA 1ZG5A 1R7JA 2NS0A 1SD7A 1XGNA 1Y0UA 1WSUA 5FLXK 1ZRDA 2FOKA 1MJ9A 2FXAA 4ENMA 2M8EA 1J75A 1BJAA 4U88A 1W7PD 3ZN0A 1T39A 1E2XA 1JE8A 3SHFA 4BH9A 1BBYA 1S8NA 3L9FA 3HTSB 4OMYA 5HS9A 3VEPA 3GW2A 3OOPA 2IT0A 4RB2C 3BY6A 4HX7A 5CJ9A 3FMRA 2CFXA 4JBAA 3RYPA 1FNNA 1DP7P 2L54A 3QU6A 5BQTA 1R58A 1SMYF 4Y15A 4B09A 3QP6A 4UV9A 5CLSA 5FD6A 3F8MA 1OR7A 1SFUA 1J0RA 4EM2A 2GA1A 4A6EA 2NNYA 3WG9A 3QRFF 3ERED 1SD6A 1EH7A 4PGHA 1HQCA 3E5QA 1S29A 2AS5F 2DU9A 1U5TC 1YLFA 1EV7A 3GFLA 1X3UA 2XV4S 4S04A 1RUNA 1RZ4A 1USTA 2H27A 3FF5A 2VOPA 2DFIA 2MD5A 5KVRA 4A6DA 1GVJA 2RGVA 4O5VA 4HDUA 3KP4A 2PEXA 4A5MA 1FYLA 5ILVA 5LHIA 1S7AA 4WXDA 2OZ6A 2HOEA 4HA8A 1B1BA 1BI0A 4EMSA 2FNPA 2IVMA 4OOIA 2O03A 4MEYF 3TO9A 1P92A 2PMHA 2V79A 3J80Z 1TTYA 2D2WA 1HSTA 1J2XA 2GQQA 4EJVA 2W25A 4MNUA 3RKYA 3ZN1A 1TQPA 2Z99A 4HX8A 2A5YB 5D4RA 5H20A 1XSVA 4HV6A 3Q9VA 5TRDA 1CF7B 4AIHA 2EFQA 2F2EA 3I58A 1L3LA 5LGTA 4HF2A 2EV6A 5FB2A 2X4HA 4YIFA 5K1YA 1C0WA 1IN8A 3TDUC 3KEOA 3DKWA 4CZZA 1IN6A 1USSA 5EEHA 1MJAA 2JSCA 3I0TA 4RAZA 1PUEE 4CHUA 1TQMA 5JHUA 5DUKA 4LLGF 1W5TA 3GEZA 4ZYHA 2QLZA 5J6XA 4L5IA 4XSXF 2EWNA 4H0EA 4XLNF 4L18B 4FX4A 4IRIA 3BPVA 1QZYA 1XB4A 1JXSA 3CLOA 3Q5FA 4WWCA 4RB3C 1YW7A 4EGZA 1QPMA 2OD5A 4WCGA
chains in the Genus database with same CATH superfamily
2QYOA 4XRFA 1ZR4A 1BIAA 3E6CC 2ZBKA 1B59A 3A0HC 4QWQA 1BN5A 5F6FA 5L3BA 4ANJA 4F92B 1QVTA 2KRHA 2JA6J 1VI0A 4IJAA 1I27A 2XF6A 3TGNA 1H88C 2VPRA 1PP8F 2DT6A 3HG9A 1TT5B 4PSXA 4A3EJ 5D8LB 1OYWA 2R5YB 1B9MA 2A07F 4B4CA 2HQNA 1AU7A 3F23A 2YX4A 2M0MA 2QQ9A 3AL0C 4Y7NJ 4F3QA 3V8KA 3E5UA 1VQ9I 4LK0F 5E20A 5GAHJ 3LOCA 3DTIA 5E17F 1LKXA 5K7ZA 3DBLB 4Z6YA 2BY1A 2UUZA 2PQ8A 3HOUJ 1ZKGA 3WTXC 5B3SH 2L2OA 4D0PA 4RGXA 4X1EA 3JR9A 2PBIA 3T0YA 3AL0B 3P7NA 2NAZA 2Y75A 3CP8A 3GMEA 1Y8QB 1FT9A 2QWWA 1QZZA 1J59A 4RGUA 4A3IJ 2PMUA 5ILUA 2L3DA 1PP7U 2DA3A 3EUAA 2ZSHB 3I4NJ 2G9WA 2R7DA 2TDXA 2IP2A 3E97A 2CJJA 2MW8A 4KUMA 1FJLA 3T5XA 2BY2A 5LHGA 4PJ0C 1V4RA 2V7FA 1R22A 4HNVA 3QU3A 1VTNC 3IC7A 1S9HA 2EPFA 4NC8A 2VBWA 1XDSA 1SVOA 2D5VA 4IXAA 3HKZN 5B5EC 4BACA 4I6ZA 1W7PA 1ZLJA 3WE2A 5ICFA 1QNTA 1JKQC 4LFUA 2VJJA 3TEDA 4PFOA 2L5QA 2JRTA 2LDUA 4BJ5C 2A6HF 3QP5A 2Z16A 4BJTA 2ZO4A 3FWEA 3JTHA 3OIQA 3AAFA 4AU7A 2IS2A 1ETQA 3E3VA 4KT6A 2O8KA 1Y1VJ 3M8JA 4MGRA 1GV5A 2OUMA 3TBIA 4BXXJ 5GPAA 3JRAA 2XAGA 2JWTA 2VT2A 2VBXA 1I5ZA 2HTJA 1BL0A 3W2VA 3HUGB 4PZJA 4LOCA 4ZJZA 1D0ZA 2P6SA 2X0LA 1QZEA 1JKOC 2XPUA 5GP9A 4NDLA 4I7HA 2UZKA 3IH4A 4A0XA 2E7WA 2Q8KA 1ZN2A 2IW5A 1L0OC 2KJCA 4GO1A 3DXJF 2BHZA 2PLYA 1GT0C 5F1RA 2V26A 1ODDA 1WJCA 2LVSA 3RKQA 4BHPA 4YRVA 3KIOA 5FFXA 3OSFA 1YS7A 1GV2A 2DFEA 2MFZA 3G3ZA 3TP0A 4YFXF 5LRSA 4ZYGA 3I71A 2EZKA 2A6EF 3CO7C 2M3AA 4RAGA 1ZR2A 4QSHA 3MEXA 4PUSA 1KONA 3K69A 5D5WB 2ECCA 3S1MJ 3V8JA 2O0YA 4KIGA 3W2WA 3EYYA 3DQVC 3EUHA 5A2QK 2VKDA 2H1LA 2W48A 1WJAA 3EQLF 5D4SA 2E71A 2FQ4A 3SFZA 4RBOA 1A35A 4BXFA 1FMVA 3FXLA 3MZYA 1YX3A 2I10A 3HOVJ 3Q3SA 2NOGA 3HB9A 2ZC2A 5DV5A 3KPHA 4ESJA 3QWLA 3DPLC 3WE3A 4KFCA 4LGWA 1S3JA 5BNGA 2EINH 1MZBA 1MMNA 5K7HA 1CF7A 1MH3A 3FXQA 4DBQA 4DGWB 2E1CA 2RV8A 4A3CJ 5ICEA 3N97A 1WPKA 3DPTA 2ZJQF 2BE5F 4FETA 2CQQA 4LG0A 1Z91A 2M45A 3TL4X 4E4HA 2ACJA 4P96A 2Q1ZB 2X1EA 4BQAA 2LSOA 1W36D 2NVUB 2LRDA 1XC5A 3HTUA 2VOOA 2KL4A 1FIPA 4BE1A 3ELKA 1NH3A 2KPMA 2M4KA 3HOSA 4BHCA 1RIOH 2D1VA 2X1DA 1Y39A 3TW7A 4KIBA 4EJUA 1S7EA 3PSIA 2VJIA 4L0ZB 3CLQA 2LH9A 4ZYDA 2WAQN 3IKTA 1YYVA 2Y48A 5LLQA 3T8TA 5E79C 4MHGA 4S05A 2HQRA 3BTJA 1YW9A 4AUXA 3I64A 5GAEJ 4OWRB 1LDJA 4D9JA 3IH2A 4A3GJ 3UNGC 2LC2A 3GBGA 3CCMI 2JTVA 4YIRX 2IS1A 1FLIA 2CH0A 2QUFA 5EYRA 4CSWA 3CCYA 5ERIA 3CDIA 3VFZA 3OSGA 2E2JJ 4CGZA 1RC9A 1LFPA 1WZ2A 5KAIC 1ZRCA 5FKOA 2VI6A 3CJNA 2ID6A 4P55A 3OS0A 1SFXA 4L0YB 2BVLA 1F4KA 1ONVA 2AQFA 4R1HA 1QU3A 2DA5A 3GFIA 1SVLA 4V19K 4C9YA 1BOAA 3QOPA 4HYEA 2IPQX 2IXSA 3FM3A 3BCBA 2M1BA 1JKPC 3KYDB 5JVGF 3H36A 4NB5A 1FBSA 4BL0B 2JSPA 4A12A 2RAEA 2EB7A 2IGOA 4U0WA 4PCQA 5E3NA 1FSHA 2DMPA 4BE0A 2P4WA 2P8TA 3DBHB 1LVAA 5ICGA 3NWSA 3L00A 3S2WA 1VQKI 4LG3A 4A3LJ 3J80K 1RRJA 1LEAA 2ELKA 3B6AA 2OTJI 3PUBA 3BG3A 1YG2A 2VE8A 2OPTA 2M9HA 2HGCA 3H0DA 2AXTC 3CC2I 3CC7I 1RETA 2R7FA 3K4BA 3DV8A 1MSEC 3JRDA 4F52A 1QO0D 1MBKA 1ZLKA 1J9IA 1A31A 2EIJH 4G6QA 5E1ZB 3K70C 2KRFA 3LAJA 4ZH4F 4CCKA 1JJ8C 2XRNA 3KLOA 2B63J 4BAYA 2FMLA 3W6KB 4Q47A 1PUFA 3DCFA 1S5LC 3QQAA 1WCMJ 3IUOA 2GIVA 1EH6A 3W6VA 2HYGD 3Q0UA 4D5CA 5AIPA 3K4NA 2CQKA 1GUUA 1U5TA 3VB2A 3BDDA 2R7SA 2YX7A 5KHDA 1H9TA 4CCJA 1TLHB 1YIJI 2E1MC 2JZYA 2W84A 3BTCA 2R93J 3KEYA 4XN0A 5DM6F 3RQIA 1ZGJA 1T6SA 2JJ7A 2ZCWA 3DF8A 2F5CA 2P0WA 5CVVA 3FHNA 3E6DA 3I9V2 3ABMH 3LSIA 4EJOA 3GTMJ 3BQYA 1SD4A 1V5GA 4JX6A 1B72A 2NVTJ 5GTHC 3MMYB 4UHTA 2E1MB 4ZDPA 2IAIA 1K61A 4UY8I 4CYCB 4XR6A 2CRGA 5KCMA 1F1ZA 3JAMK 3I59B 1OCTC 1G4DA 2F4OB 3VDXA 3RPUA 1IXSB 2B7EA 2LNBA 4G12A 5EGOA 3SYTA 1U6GA 3C18A 2DPUA 1B6AA 3OYLA 3ABLH 4X6AJ 2JPBA 4DW6A 3J7AO 3KP5A 2KISA 5BPDA 2LKXA 1UG0A 4KNYA 1E3OC 3W2AA 2NVXJ 3F22A 1JHFA 1YO5C 3EUHC 2P5VA 4EM1A 3GF2A 2ELJA 3FXMA 3CMEI 5LHHA 1F5TA 2JUGA 5F08A 2WC2A 2KKOA 3X2QH 4HRIA 3OIPA 4PJNA 2VKHA 4PK4A 3SEQA 2VIXA 1LDKB 1S72I 4YIIA 3OYGA 4AC0A 2WBMA 4HLXA 2LY2A 3OYCA 2VQCA 1R23A 5LGNA 1MBJA 2DK5A 3QYEA 1D8KA 1P7IA 4I2OA 2YR2A 1W7PB 1VQ7I 3FKJA 2WV0A 2FMYA 1BM9A 1K7AA 3A4CA 4E7IA 1G8XA 2WADA 5CQGA 4I09A 3ZOBA 9ANTA 4LIVA 4XONA 5C4JJ 3OY9A 3C7JA 3PNTA 1JHHA 5TISC 4KMUX 2ZNYA 1O3RA 1P4AA 3HGGA 1WHUA 3MKYB 2UV1A 3K4CA 5LFAA 4HF1A 3MN2A 2L7ZA 1Z77A 2VT3A 2VJ5A 2GZWA 1MIJA 2HZTA 2L7KA 3V42A 1MMAA 1MMGA 3OYNA 5KNLA 1MBGA 4GYGA 4F7ZA 1FBUA 3BJ6A 3QPHA 4MTEA 1SD5A 3EPZA 3TKYA 3OIOA 4GCVA 4HOBA 4IVNA 4ZTJA 1I1GA 4CDGA 4HNTA 1P7JA 2WY7Q 3Q9SA 4RM2A 5IP6A 5EJCA 3V8LA 1HKSA 2BHYA 2XKOA 3IWFA 1T56A 3GTJJ 1X1PA 1TW3A 2XSDC 3KP2A 2E60A 1U5TB 2YS9A 2EFNA 2KIMA 3A0BC 3U1DA 2YPRA 2A6TA 5DD8A 1N25A 3DFGA 3CF2A 3A01B 1Z67A 1XN7A 3HHHA 5CVIA 3MKZA 2MLKA 2HFHA 1P4WA 1Z0XA 1XSDA 2DYRH 1TBXA 3HOYJ 2O6GE 3FDYA 3OS1A 2B9SA 4IHYA 2DT7B 2V9VA 1M1EB 1XG1A 3QOEA 2CV1A 3CCUI 3ZP5A 4B47A 3CD6I 1TZLA 4BGDA 3FXUA 5EZHA 3H9GA 3E6MA 3ABUA 1FPQA 4BNCA 4UB6C 1DGWY 3LFUA 4DYCA 2HPMA 2GOXB 4MO7A 2KMUA 2IBDA 4XLPF 2QKMB 5HDGA 4AVZA 2EZHA 3B02A 1XD7A 3FXJA 2HDDA 2ZB9A 1BI1A 1ZH5A 3I5UA 1DU0A 4D1QA 1HKQA 3OYEA 3R4KA 3K4LA 3HJEA 3MWMA 2DK8A 3J7YJ 1O7LA 4I99C 2C6YA 4HSTA 1REPC 4MTDA 2HXOA 3LA2A 4Z2YA 1KQ9A 1NTCA 3MCZA 4QTRA 2K9NA 2KRCA 3L09A 1Z9CA 5B1BH 2I8DA 1D1CA 1YI2I 2VC0A 4DOZA 2QSFX 1X1BA 2VQLA 3PFYA 2RNGA 4MEXF 4QIWN 3WHCA 4C2UA 3HSEA 2FNAA 4MQVA 2X85A 4KICA 2QVOA 3WTSC 1O3QA 2DMNA 5L3GA 2DT5A 1UMQA 2IA2A 4DIQA 3D0SA 1MW7A 2CW7A 4G6TB 2ZFWA 1MBEA 2R7UA 4JYKA 1OLTA 1W0UA 1X1AA 4XBFA 5HLGA 2HXIA 3EUKL 5CYVA 3LA3A 2DA2A 1AA7A 4RDUA 2DTRA 3L2QA 4IL6C 3RIRA 1QPIA 4AYBA 2GXGA 2XGEA 5D6FA 1IXCA 2FRHA 1HW5A 3C2BA 2NS8A 4S0HB 1LUJB 3L2RA 3F8CA 2OU2A 4IX7A 1S7OA 2Q0OA 3U21A 2CUFA 3ZGKA 3LL7A 3H5AA 1APLC 3S3NA 2K9LA 1O3TA 3RCOA 1LQ1A 5E3LA 2E19A 3HSRA 2DBBA 2CQNA 1MDMB 2MLGA 4IQ4A 3GLLA 3REOA 1ZQ3P 1E3HA 1LE8B 1ETVA 4G6DA 2R7RA 4LJZF 5E1XA 4GFBA 4IHSA 4OIQF 4A3MJ 1OYYA 1U78A 2E1NA 2BW3A 4E7HA 4Y52J 2Z3YA 1KQ8A 5J1YA 4A0YA 4BY7J 3S15J 1KZHA 4BHBA 3UKGA 3I54A 1Z6RA 5IT3A 1ZG3A 1D5YA 3NARA 3FXKA 2EFPA 2B0LA 4HZFA 1TQIA 2DLLA 2D45A 1YIOA 1IUFA 2HWVA 1R4MB 2VBZA 2R5ZA 2IGKA 3BZKA 1D5VA 1VNDA 3CTAA 3CCEI 5F0HA 5HLHA 1TW2A 2UXNA 3F6OA 4RAYA 1ZGWA 3IWZA 3TOAA 1TWAJ 2OF7A 4Y17A 5J3LA 1BIBA 1YRNB 1W5SA 3HRMA 4L9JA 2W85A 2HU9A 3GTLJ 3ZQHA 4XKWA 3OWTA 2EFOA 4U0YA 1Z1DA 2MH2A 3F0CA 2COBA 2FOWA 1WWXA 4CH7A 4RS8A 4UB8C 1KU9A 5F04A 2MA3A 2OJED 2M30A 1B9NA 4Q4ZF 1R49A 2H6CA 1KGSA 4ZDLA 2ZJ2A 3S1QJ 1D1AA 2CG4A 4PJMA 1QHHD 1X1DA 3ML6A 2ZSIB 2DTZA 4M3DA 3J7ZI 5F64A 3CMYA 2M4GA 1EKEA 3VODA 2FX0A 3M7GA 5D8KB 4ON0A 4U7DA 4LK1F 4NQWA 1EJ9A 1TC3C 1B72B 2HEOA 2BZTA 1G3YA 2XSJC 2RDPA 2DA7A 2ZMEC 4FHTA 2KDZA 1F9NA 2HNHA 4M71A 4XKBA 1P4XA 1T33A 3HHGA 5CPRB 5B66C 3KLNA 2GAUA 3WG7H 1E0EA 1VQ8I 1LVKA 3ZMZA 1JKRC 5FLMJ 3NEUA 2WAQA 2J5PA 3O2PE 1Z7UA 2XPWA 4NC6A 5JLWA 2P7CB 5IT9Z 2A68F 2O5RA 3ZQLA 2F6CA 1JUMA 1WJDA 5J1UA 5DDGA 2NYXA 1TNSA 1PUFB 2O3FA 3K7AJ 2RNJA 1YW8A 3A01A 1K78A 2L9SA 4U87A 4GYIA 1H8AC 1XSXA 2CMPA 2WTEA 3BG5A 3F3XA 3NAUA 2W7NA 4BY1J 1R1UA 3WU1B 2BGCA 3ECOA 5FLXZ 2PMZN 4L5JA 4XRSG 1LEBA 3ZMDA 2VL8A 4XRSA 3WTTC 1WGXA 2GOMA 2VPLA 2R7VA 2J5OA 2ESNA 1YITI 2VN2A 4Y4RA 3CJTB 2KIFA 1ORKA 4A93J 1IRGA 4JK1X 1DPUA 1I3QJ 2XVCA 2KP6A 2HS5A 1H89C 5DCMB 2IS4A 1UCRA 4EATA 4IZZA 1Z6TA 3KZZA 3ONQA 4QLCU 2JA8J 3KETA 2FBHA 4N0BA 4UUTA 5LBQA 1I1SA 4C2MJ 1ZAOA 1XS9A 3K70D 2M5WA 4X0GA 1TWHJ 5CVJA 4FE4A 3GVAA 5EZGA 2Z9OA 4OIRF 5DS9A 3DLLF 1ZYRF 5L3EA 2FF4A 3I59A 1E17A 3TOBA 1QRYA 2RKHA 3EYIA 5M3FJ 1T38A 4YG2F 1IC8A 2KLOA 1YQAA 1MKMA 2EV5A 4ZTFA 2QQBA 3RKXA 4CICA 2DA6A 3IH3A 2PI0A 4KT5C 3ZQCA 2QENA 2Y9ZA 2QKLB 1U8RA 2LF7A 3V7CA 3SQNA 3CP2A 3BR0A 1IF1A 2MABA 2F5EA 5L3DA 2QSGX 2K9QA 4G7ZF 2DPDA 4KN4X 4DQ2A 2DMUA 4BQNA 4R79A 2E34A 3BOQA 4RGSA 3CJQB 4U0VA 4MLOA 4RB0A 3G73A 3F72A 3H0GJ 3DKYA 4KN7X 1SAUA 2DA1A 3VYSB 3ZPLA 4M72A 1BA5A 2M7BA 2NXNB 2XUBA 2P6TA 3I53A 2JN6A 5DTDA 2OCEA 1XMAA 3BCAA 2DFHA 1MDMA 1V5EA 2CGPA 4E70A 5EEAA 4NHJA 4UVAA 1IN7A 3RYRA 1Y56A 3CJRB 3O6BB 1AKHB 2L7FP 2FEZA 5D5UB 3S8PA 1D1BA 2FU4A 1IO2A 4BXUA 2XAFA 1WRJA 5H6QA 2AQEA 3U1KA 2K4BA 2K3PA 1FMWA 1LJ9A 2XB0X 4IOCF 2I5UA 4I02A 1QBJA 4AM3A 3S17J 3CUQA 3PUFA 2OA4A 1HKTA 3G1MA 2EILH 2ZXHA 2P5LC 5BMZA 4C3IJ 3M4OJ 5DYMA 3C3WA 2A69F 4ABZA 3M8EA 2HYFA 2X1CA 2EIMH 4EEFG 3DTEA 4JOMA 1HLVA 4C30A 3FK6A 1I50J 1KYZA 4OAZA 4KITB 1W36C 1IXRC 3GZ6A 4Q5SF 2XKPA 4FTHA 1Y8RB 4PFPA 2XDVA 5JI6A 4P1WA 2W57A 3LSTA 5HNFA 2KIUA 2F4MB 2RC4A 1HDPA 1IDYA 4IF4A 1D0XA 5M5YJ 1POGA 3BLYA 3CF5F 1OFCX 1BOBA 2FBKA 4AIKA 2EQRA 5KAFC 4XNFA 4WX9A 4A3JJ 3FMSA 1N78A 1SMTA 5L3FA 1OISA 3K1MA 1G59A 4R8HA 3P9CA 2M34A 1OMIA 2DMQA 2IA0A 4ESBA 2X48A 5FGMA 2NS7A 3P9IA 1ZGAA 2IS6A 4ZYEA 5DD4A 2HOTA 4LG0B 4FISA 2W1OA 1VQOI 4J19A 4Y13A 3HRTA 4HNUA 2R7TA 3HOTA 1PDNC 2ECBA 3VSKA 4QPOA 1H0MA 2H1KA 3R60A 5AONA 3GFMA 2VONA 4PJJA 1T98A 2VASA 4ETSA 3PQKA 2DDAA 2H8WA 4B1RA 5L3CA 4OINF 4XLEA 4HEA2 4L9NA 3QODA 4IHXA 1FZPB 3R6SA 5H2FC 1P6RA 5FKNA 2ME6A 2VODA 2Z5UA 3LSRA 3JAMZ 5DCFA 3HPHA 5M5WJ 4BBRJ 2G7UA 2LREA 4GXOA 2HKXA 5FFZA 3JRCA 4A3BJ 2DOAA 4E7ZA 3OYMA 3LWFA 3LSGA 4EJWA 1HW1A 1DDNA 4B48A 2WB1N 3FBNB 4OIPF 2DJNA 3IHUA 1O57A 2P81A 4HBLA 5HS7A 2LG4A 4U7BA 4NC7A 1O7FA 2CUJA 2WA0A 4N9HA 2IEKA 1JJ6C 1IJWC 4M6XA 4P9FA 3LA7A 1FP1D 4CXFA 1XCVA 3WU0A 4WK8F 2LP0A 2QSHX 1FSEA 2HYJA 1G3SA 2P5KA 4OMZA 2XB5A 3I3LA 4UVBA 4AWXB 2WWYA 1R9TJ 2W24A 3DWLE 1FEXA 3CQZJ 2R5YA 2JA2A 2CO5A 3OYKA 1EH8A 1QQIA 3K6GA 3WTWC 1F43A 3GLXA 2MGQA 2A61A 4UVCA 3F8NA 2GWRA 3F6VA 2R7ZJ 5DEQA 1TNTA 2YU3A 4XKCA 3GYHX 2CYYA 1YS6A 4BS9A 4E7JA 1JTXA 1X4OA 2HZDA 4XL9A 1A04A 2KFDA 2DA4A 1FTTA 5CVRA 3O8GA 1GLNA 3WODF 5LEKA 3FXRA 3MAJA 2GM4A 4LB5A 3DKXA 3IRQA 1K83J 5HDKA 3ZRGA 1OKRA 5ED4A 4G94A 3GWZA 2BY3A 1IN4A 1U2WA 3RDIA 4IHWA 3QYBA 2RQPA 1SFEA 5DUIA 5CVUA 2BBYA 2R7QA 4YFNF 4AYBN 5J8CA 2DQLA 3HPGA 4OIOF 3HXLA 2EK5A 3A1YA 2L0KA 3S93A 4N4NB 4O3MA 4M3EA 1IUYA 3BC8A 1TWGJ 1A36A 4XSZF 3R0AA 5ICCA 3K4JA 1ZHFA 1IN5A 2PJRA 2O61A 3HBLA 2XHKA 4F93B 4EM0B 1V55H 3CC4I 5EG0A 3ZQFA 2XASA 3OYJA 3RTRA 3BR6A 3S14J 2GIZA 1UHMA 3TQNA 4D7NA 1XGSA 3KE2A 3FHZA 1I3AA 2FUG2 3KFWX 3SZPA 4XICA 3KZYA 3OYFA 2KZGA 5BOXA 2K9SA 2LFBA 1V3FA 2EA4A 1X2MA 2KJBA 3S32A 1WH7A 5C3EJ 3ULQB 2DAOA 1H9GA 4HDVA 2BV6A 3TP3A 2ZJRF 3BROA 2XAQA 4O6JA 3CO6C 2QM3A 3J7AY 1CQTA 1QHGA 4CYDA 3AKZA 1FIAA 4M9SA 1OCOH 3GFJA 3L1PA 1VQ5I 4LIUA 3WTZA 4HLYA 5J8FA 1ETXA 4J01A 3FIWA 5FD5A 4XQFA 4CYCA 1SAXA 1S6LA 1BW6A 1Y6IA 1KYWA 2ADUA 1GXPA 1ETOA 5LD2C 3AG2H 1DUXC 1SC7A 4KMFA 3NWTA 4YFKF 3L2WA 1VFCA 2OQRA 3E1SA 1Z7LA 2EBIA 3MKLA 1BR1A 1FX7A 3CCRI 2XPVA 3ZMSA 1MNDA 2QBYB 2OQGA 4G9YA 1XGMA 3KP6A 3CCQI 1PVEA 2CS3A 5DCMA 1IV8A 3O8HA 1WFXA 2K5CA 3CUOA 4I01A 3Q0WA 1IRFA 1T08B 4RLFA 2STWA 2O7OA 4XN3A 2YSRA 5GTIC 3ZMUA 3ZQGA 4F91B 5FLVA 2EJRA 1VF9A 1SVMA 1WI3A 3IRRA 1VQ6I 1YE9A 3F8FA 5D6EA 3T1BA 4ZYAA 1UJ8A 4M6VA 3ABTA 3M8FA 1KU7A 4OAYA 5K5OA 1DGRM 4OU0A 4BEHB 3E0JB 1FOXA 2DDBA 3OMYA 1SFKA 2DI3A 3JRBA 2VB6A 2ZNZA 3H3UA 1OPCA 2KQRA 3GXOA 5TGTA 1BC8C 3VOEA 4A0ZA 4HAMA 5IPAA 3P5JA 5M5XJ 1LPQA 3G1LA 4EVIA 1I39A 4M74A 2XIGA 3K9TA 2VKEA 1MD0A 3CCSI 1UHSA 1STZA 1QVUA 2MBFA 4PGGA 5A2QZ 3HRSA 3EDPA 4EQQA 2EA2A 4BYYA 5JHFA 2E1OA 3BG9A 3G1OA 3GTPJ 4G8XA 5D5VB 3DP7A 1U3EM 4M3GA 1DQUA 1MMDA 3V7SA 1IAWA 4IRHA 2V6CA 2ID3A 3D1NI 3E7LA 2QA4I 1FOYA 3LFKA 4BKXA 1WKMA 4NQWB 2DODA 4UUSB 1TWFJ 3COAC 5HOOA 3KEQA 3OV8A 3QPTA 4DYRA 1AOYA 2HVQA 2ELHA 3O3KA 3WU2C 4DZJA 5EG0B 1HOMA 3BPXA 4JQFA 3CDLA 1A6QA 1ZTRA 2M8GX 2STTA 4HQMA 3M9AA 3ASOH 2OV7A 1GXQA 1HSJA 5J47A 5HDNA 3L7WA 2F4IA 3MZHA 4CUGA 1KA8A 2LBFA 1N75A 3RPUD 1JI8A 2DQRA 1NK3P 5KK1A 3CCJI 1IDZA 1R36A 1UG2A 4CO8A 4DJAA 1FOKA 3SXYA 4KDPA 2E2IJ 3DU5A 4LLLA 3DPUA 1J5YA 5HLIA 3JRGA 3FMQA 3PNYA 4HV5A 2IJLA 3KCCA 4IQJA 2LMDA 5TJJA 2L4AA 5HODA 3M3YJ 4BUPA 3BZCA 2JPCA 3LSHA 1JTYA 1CGPA 2JA5J 3Q0VA 2HR3A 3FISA 1ENHA 2HTSA 2XGCA 3I55I 2R4GA 4RGRA 4RLQA 3OR1C 3FZVA 3E5XA 3L2CA 3RI4A 3F8BA 2BXYA 2ZJPF 4NNJA 3K1PA 3PIOF 4KA4A 2K4JA 3JTGA 4WF2A 2A5WA 3RPQA 5ILSA 1MBFA 1JGGA 2L9NA 5CKTA 5HS8A 2L02A 3BJAA 1HDDC 5EDNA 3H9JA 2X6OA 5E3MA 3ABKH 4FX0A 5JFRA 5IOYA 2DMTA 3VYRB 4IHTA 2Y69H 4XLAA 3S16J 3HGYA 2QZ8A 4CCOA 1T0FA 1ZG1A 3NQOA 2WY8Q 2PJPA 1YX5A 2AO9A 2ME0A 2K9MA 2FSWA 5GADJ 2GBYA 2L7MP 4B3AA 5IYDJ 4ASNA 4E7KA 5IYCJ 3HUGA 1JT0A 5BPIA 2V9PA 2JRMA 4C2TA 5K5QA 1OCPA 1D0YA 3GCMA 2GXAA 4XLCA 1F36A 2XROA 4E6KG 3K4KA 2KT0A 2H09A 3H5RA 3BR1A 3BZ6A 1ZELA 3ZXSA 2X51A 1K79A 4II3A 1IRXA 2R0QC 4D7MA 1WJEA 2DJIA 1BI3A 1DU6A 2E7XA 1JT6A 1JUPA 2BXZA 3C2GA 3V4GA 4WXHA 2HVSA 2HVRA 2DFFA 1IZ1A 4ENKA 1LFUP 1O3SA 2DOEA 1BC7C 2XC7A 4JX4A 1MH4A 2XAHA 1K6YA 2Y0MA 3HDDA 1HW2A 4M73A 2QEXI 5C4XJ 3H3ZA 1X2NA 4HF0A 1ETWA 3DEWA 2CW0F 2YU9J 4UUSA 4M9ZA 3SFIA 3HRUA 1HC8A 1X3WB 3GUDA 3JW4A 4HQEA 2BW3B 2IGNA 2LD5A 1YFHA 4W1UA 1KQ0A 4LB6B 1ZARA 4GGGA 4UXNA 5HLTA 3GZNB 6PAXA 4XOTA 2K27A 2ZXWH 3FX3A 5LEJA 3F21A 4AD9A 2R7WA 4XKVA 1T0FC 3W6JB 1K78B 3BR2A 2KDOA 4P9UA 1FP2A 3ZMTA 3ISPA 3IL2A 3WGGA 3BWGA 4ENJA 2M7AA 1LNWA 2F5DA 4CZCA 4UUVA 4BE2A 1WJBA 5J4VA 3LQQA 4IPAA 4XM3A 3OOUA 4A3DJ 3CUQB 4K2EA 1FY7A 2CUEA 3SZGA 1MNEA 1FYKA 2AHQA 1DP3A 1ON1A 2Z2SB 1E3PA 3BQZA 1Q1HA 2W82A 2CWEA 5E1WA 2Q2EB 3PQJA 2DOFA 1WI9A 4PDKA 2E5NA 1ULYA 1X3ZB 4L9TA 5E8GA 4H4KC 1K4TA 2OTLI 5IY5H 5K5RA 1BR4A 3RSNA 2AXLA 4I98B 2EV0A 1FBQA 2ZXIA 1D8JA 2LF8A 4KJZA 2GLOA 3L2UA 2HI3A 3JCUC 4RB1A 2ZMEA 3HSFA 1JGSA 2DYSH 5J4YA 2RVCA 2HOSA 1LDDA 2HDCA 3WTYC 2OBPA 1V5FA 5FRMA 1HA8A 3OL3A 5E8IA 1XTAA 4IOAF 3LQRA 3U9GA 3K0LA 4EV0A 3M1EA 3B73A 1B4AA 2TCTA 3ZCOA 4XORA 3H35A 3HZJA 5AIQA 3IKVA 3OR2C 2BEOA 5BS6A 2BY0A 1UELB 3GX4X 3BR5A 5FJ8J 1UB9A 2QCOA 4JX5A 1DPRA 4CCMA 3OYBA 2NNNA 1G6NA 4JP0A 3S1NJ 2O8XA 1OR7C 4AIDA 4IO9F 1VQNI 1FYMA 3JRIA 3IAS2 4W97A 3PO3J 2HQAA 2MH9A 1BR2A 1RR7A 3H92A 2NVQJ 3S1RJ 2D1HA 1MMSA 5LRRA 1Y1WJ 4ZDOA 3QPSA 4M3FA 3DLAA 1ITYA 1G3TA 1RR8C 2EIKH 3C2HA 1BJZA 4J00A 4D5FA 3FXOA 2VBYA 4FCYA 1HBXG 4BDYA 3NRVA 2Y2ZA 4P5OA 3HIFA 3CDHA 2X6XA 2V1NA 1X58A 3H3VK 2V1XA 3FK7A 3HL2A 3MQ0A 2EFWA 3R0JA 4ZC3A 5K7FA 3ZR8X 2M0CA 4FASD 5LGUA 1YJ9I 2FQ3A 2L4MA 5GAGJ 2NRAC 1BI2A 1FOWA 2ETHA 3BP8A 1VQLI 1FTZA 4ITVA 1X19A 1RKTA 2KHMA 3SDGA 3TDZC 2VXZA 2GA2A 4DZPA 3RZOJ 4QPQA 2HKOA 3H5NA 2CFOA 1XX5A 4G7OF 2YUSA 2PFBA 1BW5A 1NK2P 2VQHA 5FKMA 5F0FA 4EGYA 1XGOA 1X1CA 4AVPA 1HXDA 3S3OA 2EZIA 5EF6A 1LFBA 2K3FA 2H94A 3MVPA 4N9IA 4KYWA 3WTUC 2JQ7A 2VE9A 4RAFA 3A02A 3E6BA 1TT0A 3ECHA 3BG7A 4MIMA 1OYIA 2HQ5A 1R00A 2QQAA 3HOWJ 2Y30A 3ESWB 3PNVA 3FBIB 2K85A 1UHWA 3N4MA 4PSWA 5J1RA 3BJOA 2QBYA 3RKWA 3JSOA 3H9QA 5IP9J 1UFMA 2M87A 1Z21A 2P7VB 2QF7A 2LYCA 2NOJB 4CA0A 1AWCA 1QGPA 2K40A 1G2HA 1GHCA 1OJLA 2W4SA 2VXDA 1P2FA 5HVQC 1W5CC 2ZXJA 3WTVC 2VKVA 2MD0A 3U2RA 1W4MA 1XDUA 1R5GA 3HC7A 4AIJA 2XF7A 3TW6A 1IRZA 1K6OA 2BYVE 2V1UA 4ENNA 2VJ4A 3IAM2 3K10A 1RNLA 4ESFA 1LB2A 4C3HJ 4BEHA 4LD5A 2MC3A 3QPLA 2COMA 2ESHA 4TV7A 5JR3A 3J81Z 3KP3A 3J81K 1ON2A 2ZKZA 4MFEA 4B8XA 4UNOA 4I0AA 2LR8A 3AFHA 1O4XA 2M2EA 1U9OA 2V1DA 4BJ6C 2R3SA 3C1DA 3SZTA 3PFIA 4A3FJ 4HW0A 1ETKA 3P9KA 3DBRB 1ZREA 2RN7A 1U9NA 3D5LA 4KIFA 1G3WA 2ISZA 3QAHA 2OAZA 4A69C 2VC1A 2Y0SA 3JSPA 2PN6A 3OYIA 4L9VA 2F5FA 2UXXA 5F0CA 5H6RA 1XCBA 3TMOA 1KU3A 3PO2J 3HOZJ 5JVTA 3SEZA 4V2GA 4UV8A 5D5XB 4LLNA 3TO6A 1VQMI 3G71I 3GO5A 3UR3C 5IYBJ 1NHAA 2IRFG 1ERDA 2FBIA 2ZFUA 3JREA 1R5HA 2ICWG 2V9KA 2WV1A 4A2UA 2DW4A 1T8IA 4FT8A 2L01A 3ASNH 3RJPA 3IP4B 3K2ZA 3TO7A 1FC3A 4M3BA 3VSLA 1J7KA 2FE3A 1YJWI 3DU6A 4WXCA 3WGIA 3RZDJ 4MQ9F 1XMKA 2JT1A 4Q48A 1GDTA 2DO7A 1R1TA 4M6YA 5FKLA 1PJRA 2BVMA 3PM1A 2Z33A 3K1NA 2FA5A 1R1VA 1QA6A 2K02A 3LNQA 1UAAA 3IV5A 4FE7A 5E18F 4IKFA 3OYAA 1IV6A 5JLXA 1X4PA 4YEJA 4ZZLA 5IT9K 3I4PA 4BBSJ 1T2KA 3S2HJ 2CSOA 4N4OB 2A3SA 3BTLA 2LOOA 3DEEA 4HX4A 4MFDA 2E36A 3MFKA 1MJBA 2G7HA 2JMWA 3GZ5A 3KP7A 1SFOJ 5FO5A 3V7RA 1ZK8A 3FM5A 2HDWA 1OCCH 4XLFA 3LSMA 1MNMC 5HNHA 2LKPA 1AHDP 2KIQA 2XGXA 2K7LA 3LAPA 5EEGA 1NG7A 2N8GA 2XAJA 3HYIA 3R61A 2IA1A 2ZMEB 4XLHA 4G7HF 4ZZDA 3OL4A 2FJ1A 1VQ4I 2CU7A 4LMYA 2W00A 3ZQ7A 3S3MA 1Z05A 3ZMVA 3BT9A 1OCZH 2H8RA 2Q2EA 1D3YA 2PG4A 2PMZA 3KYCB 3VYUB 1MGTA 5FKKA 2K86A 3CMMA 1OCRH 1R6RA 4XK4A 1RUOA 2HOAA 2ISYA 1WQ2A 3EETA 4IRGA 1TP4A 2QGUA 1U0JA 2X6WA 1T95A 1W1WE 3LMMA 3CUQC 4A5NA 2DN0A 5FRNA 2GXBA 4EJTA 1KU2A 4IHVA 3DEUA 3ROUA 1IW7F 1FWZA 1I6XA 5EGOB 4M9XA 3WGHA 5GPCA 4I0BA 3OS2A 1UZCA 3MD2A 3W3CA 1SANA 2OZUA 4BQOA 2UWMA 4DNCA 5DM7F 1RI7A 2H6BA 1ZRFA 4IEJA 1YTYA 2E2HJ 3G6EI 3T8RA 1ZG5A 1R7JA 1WJFA 2NS0A 2R92J 1SD7A 1XGNA 2CQ7A 3G4SI 1Y0UA 3CCVI 4BDZA 2DXIA 2Y31A 1R5ID 1WSUA 1N77A 5FLXK 1ZRDA 2FOKA 1MJ9A 2FXAA 2M8EA 4ENMA 1J75A 1VZ0A 1BJAA 2CUZA 2V4JC 4U88A 1W7PD 2LLKA 3ZN0A 1MBHA 1T39A 1E2XA 1JE8A 3SHFA 2E35A 4BH9A 1BBYA 1S8NA 4DYQA 3L9FA 1SEUA 3HTSB 3PSFA 4OMYA 5HS9A 3VEPA 3GW2A 3OOPA 1YHQI 2IT0A 3AG1H 4RB2C 3MKWB 2FD5A 3G2BA 2LKSA 3BY6A 4HX7A 2JVHA 5CJ9A 3FMRA 2CFXA 4F55A 5M3MJ 4JBAA 5F1JA 3RYPA 1FNNA 2X6YA 2CQXA 1DP7P 2L54A 1Q1VA 3QU6A 1ACIA 5BQTA 1A5JA 1R58A 2JUCA 3CCLI 3GTGJ 1P9QC 2X9DA 3D5SC 1SMYF 2F48A 4Y15A 3QP6A 4B09A 3LSJA 5FROA 5CQEA 3N05A 4UV9A 2XRLA 2F5VA 5CLSA 5FD6A 3K2AA 3F8MA 1OR7A 1HCRA 2DCEA 1J0RA 4BQQA 1SFUA 4PJLA 4YELA 4EM2A 2Z1DA 2GA1A 4A6EA 4CCLA 2OCCH 4XOPA 1PYVA 2BOLA 4II2A 4NUBA 5F27A 2NNYA 2G0EA 2JVGA 3WG9A 3ERED 3QRFF 1SD6A 2PJRB 5E3OA 2V6EA 1EH7A 4PGHA 1HQCA 1JUSA 3E5QA 3SJMA 1R71A 1S29A 2AS5F 3PL8A 4A3KJ 3HEFA 1R4NB 2DU9A 1U5TC 1YLFA 1EV7A 2LK2A 3GFLA 1B8IB 4B44A 1X3UA 1ETYA 2XV4S 2LY1A 4S04A 1NG6A 3OYHA 2QQ8A 1RUNA 1RZ4A 1USTA 2H27A 3GTKJ 4RA2A 3FF5A 1I6HJ 2VOPA 4Y3OA 3QYFA 2DFIA 2MD5A 3WHBA 5KVRA 2RQQA 1RESA 2R7OA 4E7LA 4A6DA 1IG7A 1WH5A 1U8BA 1IGNA 1GVJA 3OYDA 2RGVA 4O5VA 4HDUA 3KP4A 1MSFC 2PEXA 3SDBA 4A5MA 4B3XA 1FYLA 5ILVA 2WAFA 5LHIA 1RPWA 3RQ4A 2JA7J 1S7AA 4WXDA 2E5ZA 2HOEA 2OZ6A 4HA8A 1B1BA 3CESA 3K4MA 2TRTA 3S2DJ 1BI0A 1VQPI 3GTQJ 4HSRA 4EMSA 2FNPA 2IVMA 4OOIA 2EH3A 2O03A 4NBQA 1B8IA 4MEYF 3TO9A 4RMNA 1P92A 2VLAA 2LBFB 4XIDA 3MZ8A 1YOVB 2PMHA 3I56I 1V54H 2V79A 3J80Z 3M1CA 1TTYA 3AG3H 1EF4A 1Y0NA 4GDFA 1A6IA 2D2WA 4C3JJ 5C44J 1HSTA 1J09A 1J2XA 2GQQA 3PJRA 4EJVA 2L9VA 3ZQQA 5B1AH 3L2VA 2RREA 2W25A 4RM3A 4MNUA 3GTOJ 3RKYA 1W0TA 3H1CA 3ZN1A 1TQPA 1K4SA 2Z99A 4HX8A 3CMAI 2A5YB 5D4RA 5J40A 5H20A 1XSVA 3M07A 1HF0A 1AKHA 2A05A 2XGDA 1RKWA 4HV6A 4V2FA 3Q9VA 1TL8A 3B6CA 2WAEA 5TRDA 3VPRA 1CF7B 4AIHA 2EFQA 2MYSA 2PX9A 2L9RA 2WB1A 2F2EA 3ERMA 3I58A 2VUMJ 2IGMA 1LE8A 1L3LA 4CCNA 5LGTA 4HF2A 5IP7J 2EV6A 5FB2A 3DTKA 2X4HA 4YIFA 3LSKA 1XPXA 2MC4A 5K1YA 1C0WA 1IN8A 2CV0A 3VYTB 1EA3A 3TDUC 2MSYA 4LITA 1YJNI 3KEOA 2R7XA 3DKWA 4Y33A 3BTIA 4CZZA 3ZQIA 4E7SA 1IN6A 2EZLA 1USSA 2JK3A 5EEHA 1MJAA 2JSCA 3I0TA 2XAUA 4RAZA 1PUEE 2MG4A 3KZIC 3FKIJ 3D5RC 4CHUA 3HKZA 2CV2A 3LSPA 3BR3A 1TQMA 1Z3YA 2Y9YA 4GRIA 2HPIA 2R5ZB 3A2KA 5JHUA 3JRFA 4XMYA 5DUKA 4B43A 4LLGF 1W5TA 3GEZA 3PIPF 4ZYHA 4BU2A 3AG4H 2QLZA 2LY9A 5J6XA 4L5IA 4XSXF 3JRHA 4L5EA 2EWNA 3CZ6A 1WVRA 1YRNA 4FQGA 1WJ5A 4XLNF 4H0EA 3I4MJ 3KYLA 3F9KA 3HOXJ 4L18B 3A03A 4I76A 5IOZA 4FX4A 3KX2A 2CW8A 4IRIA 1Z3XA 3BPVA 3VWBA 3HM5A 2LTPA 1QZYA 2O9LA 3BG6A 1GVDA 4HPQA 1XB4A 4DBRA 1JXSA 2VQGA 1OQYA 2NVYJ 4HG2A 2XF5A 3CLOA 3Q5FA 4XRMA 2OC6A 4KISA 4WWCA 4RB3C 1YW7A 4EGZA 2KZVA 1QPMA 1XMXA 2OD5A 1TWCJ 2Y0SN 4WCGA
chains in the Genus database with same CATH topology
2QYOA 4XRFA 1BIAA 3E6CC 2ZBKA 1B59A 5F6FA 4QWQA 1BN5A 5L3BA 4IJAA 1I27A 3TGNA 1PP8F 5D8LB 1OYWA 1B9MA 2A07F 2HQNA 3F23A 2YX4A 2QQ9A 3V8KA 3E5UA 4LK0F 5E20A 5E17F 2PQ8A 3WTXC 4D0PA 4RGXA 2PBIA 3T0YA 3P7NA 2NAZA 2Y75A 1FT9A 2QWWA 1QZZA 1J59A 4RGUA 2PMUA 5ILUA 2L3DA 1PP7U 2G9WA 2R7DA 2TDXA 2IP2A 3E97A 4KUMA 3T5XA 5LHGA 1V4RA 1R22A 3QU3A 1VTNC 3IC7A 2VBWA 1XDSA 4IXAA 1W7PA 1ZLJA 3WE2A 5ICFA 1QNTA 4LFUA 2JRTA 2LDUA 2A6HF 3QP5A 2ZO4A 3FWEA 3JTHA 3AAFA 3E3VA 4MGRA 2XAGA 2VT2A 2VBXA 1I5ZA 2HTJA 4PZJA 2P6SA 2X0LA 4I7HA 2UZKA 4A0XA 2E7WA 2Q8KA 1ZN2A 2IW5A 1L0OC 2KJCA 4GO1A 3DXJF 2PLYA 5F1RA 1ODDA 4BHPA 5FFXA 1YS7A 3G3ZA 4YFXF 5LRSA 4ZYGA 3I71A 3CO7C 2A6EF 3MEXA 3K69A 5D5WB 3V8JA 2O0YA 4KIGA 3EYYA 3DQVC 3EUHA 5A2QK 3EQLF 5D4SA 3SFZA 3MZYA 5DV5A 4ESJA 3DPLC 3WE3A 4KFCA 4LGWA 1S3JA 1MZBA 1CF7A 3FXQA 2E1CA 2RV8A 5ICEA 3N97A 3DPTA 2BE5F 4LG0A 1Z91A 2M45A 2ACJA 4P96A 4BQAA 2LSOA 3HTUA 2VOOA 3ELKA 3HOSA 4BHCA 1RIOH 2D1VA 4KIBA 4EJUA 4L0ZB 4ZYDA 3IKTA 1YYVA 2Y48A 5LLQA 3T8TA 4MHGA 4S05A 2HQRA 1YW9A 3I64A 1LDJA 2JTVA 1FLIA 2QUFA 5ERIA 3VFZA 4CGZA 1ZRCA 3CJNA 4P55A 1SFXA 4L0YB 1F4KA 1ONVA 4R1HA 3GFIA 1BOAA 3QOPA 4HYEA 2IPQX 3FM3A 2M1BA 4NB5A 1FBSA 4A12A 2EB7A 4U0WA 4PCQA 1FSHA 2P4WA 2P8TA 1LVAA 5ICGA 3S2WA 3L00A 3J80K 1LEAA 1YG2A 2VE8A 2HGCA 2R7FA 3DV8A 1QO0D 1ZLKA 1J9IA 4G6QA 5E1ZB 2KRFA 3LAJA 4ZH4F 2XRNA 3KLOA 4BAYA 2FMLA 3W6KB 4Q47A 2GIVA 1EH6A 2HYGD 5AIPA 2CQKA 1U5TA 3VB2A 3BDDA 2YX7A 1H9TA 1TLHB 2JZYA 2W84A 1ZGJA 1T6SA 2ZCWA 3DF8A 2F5CA 5CVVA 3E6DA 4EJOA 1SD4A 4UHTA 1F1ZA 3JAMK 3I59B 1G4DA 3RPUA 1IXSB 2LNBA 1U6GA 3C18A 2DPUA 1B6AA 2JPBA 3J7AO 3KP5A 5BPDA 4KNYA 3F22A 1JHFA 1YO5C 2P5VA 4EM1A 3GF2A 5LHHA 1F5TA 2WC2A 2KKOA 1LDKB 4YIIA 4HLXA 1R23A 5LGNA 2DK5A 4I2OA 1D8KA 2YR2A 1W7PB 2WV0A 2FMYA 1BM9A 1K7AA 4I09A 3C7JA 1JHHA 4KMUX 2ZNYA 1O3RA 1P4AA 4HF1A 2VT3A 2GZWA 2HZTA 4GYGA 4F7ZA 1FBUA 3BJ6A 3QPHA 4MTEA 1SD5A 3TKYA 4GCVA 4HOBA 4IVNA 1I1GA 4CDGA 3Q9SA 3V8LA 1HKSA 3IWFA 2XKOA 1TW3A 3KP2A 1U5TB 2EFNA 2KIMA 3U1DA 2YPRA 5DD8A 3DFGA 1XN7A 3HHHA 5CVIA 2HFHA 2MLKA 1P4WA 1XSDA 1TBXA 2O6GE 2V9VA 3ZP5A 3FXUA 3E6MA 3ABUA 1FPQA 4BNCA 4XLPF 5HDGA 3B02A 1XD7A 1BI1A 1ZH5A 3I5UA 1HKQA 3R4KA 3MWMA 2DK8A 1O7LA 2C6YA 1REPC 4MTDA 3LA2A 4Z2YA 1KQ9A 3MCZA 3L09A 1Z9CA 2VC0A 4MEXF 3HSEA 2FNAA 4MQVA 4KICA 2QVOA 3WTSC 1O3QA 5L3GA 2DT5A 2IA2A 3D0SA 2ZFWA 4XBFA 5HLGA 5CYVA 3LA3A 2DTRA 3RIRA 2GXGA 5D6FA 1IXCA 2FRHA 1HW5A 3F8CA 2OU2A 1S7OA 2Q0OA 1O3TA 1LQ1A 3HSRA 2DBBA 1MDMB 2MLGA 3REOA 4G6DA 4LJZF 5E1XA 4IHSA 4OIQF 1OYYA 1U78A 2E1NA 2Z3YA 1KQ8A 4A0YA 4BHBA 3I54A 1Z6RA 5IT3A 1ZG3A 2EFPA 2B0LA 4HZFA 1TQIA 2DLLA 2D45A 1YIOA 2HWVA 2VBZA 1D5VA 3CTAA 5HLHA 1TW2A 2UXNA 3F6OA 4RAYA 3IWZA 3TOAA 4Y17A 1BIBA 1W5SA 3HRMA 4L9JA 2W85A 2EFOA 4U0YA 1Z1DA 2MH2A 1WWXA 4RS8A 1KU9A 2MA3A 4Q4ZF 2M30A 1B9NA 2H6CA 1KGSA 2ZJ2A 2CG4A 3ML6A 5F64A 3VODA 3M7GA 5D8KB 4U7DA 4ON0A 4LK1F 4NQWA 2HEOA 1G3YA 2RDPA 4FHTA 1F9NA 4M71A 1P4XA 3HHGA 3KLNA 2GAUA 3ZMZA 3NEUA 2J5PA 2P7CB 1Z7UA 3O2PE 5IT9Z 2A68F 5DDGA 2NYXA 1TNSA 2O3FA 2RNJA 1YW8A 1K78A 4GYIA 1XSXA 3F3XA 2WTEA 1R1UA 3WU1B 2BGCA 3ECOA 5FLXZ 4L5JA 1LEBA 3ZMDA 3WTTC 2J5OA 2ESNA 2VN2A 2KIFA 1IRGA 4JK1X 1DPUA 2XVCA 2HS5A 5DCMB 1UCRA 1Z6TA 3KZZA 4QLCU 3KETA 2FBHA 4N0BA 5LBQA 1I1SA 1ZAOA 2M5WA 5CVJA 3GVAA 2Z9OA 4OIRF 1ZYRF 5L3EA 2FF4A 3I59A 1E17A 3TOBA 2RKHA 3EYIA 1T38A 4YG2F 1YQAA 1MKMA 2EV5A 2QQBA 3RKXA 4CICA 2PI0A 4KT5C 2QENA 1U8RA 2LF7A 3V7CA 3SQNA 1IF1A 2F5EA 5L3DA 4G7ZF 2DPDA 4KN4X 4DQ2A 4R79A 3BOQA 4RGSA 4U0VA 4RB0A 3G73A 3F72A 4KN7X 3ZPLA 4M72A 2XUBA 2P6TA 3I53A 1MDMA 1XMAA 2CGPA 4E70A 4NHJA 4UVAA 1IN7A 3RYRA 3O6BB 2FEZA 5D5UB 2FU4A 4BXUA 2XAFA 1WRJA 5H6QA 2K4BA 1LJ9A 1QBJA 4I02A 3CUQA 2OA4A 1HKTA 5BMZA 2P5LC 5DYMA 3C3WA 2A69F 3M8EA 2HYFA 1KYZA 1IXRC 3GZ6A 4Q5SF 2XKPA 5JI6A 2W57A 3LSTA 2KIUA 2RC4A 4IF4A 2FBKA 4AIKA 4WX9A 3FMSA 1SMTA 5L3FA 3K1MA 4R8HA 3P9CA 4ESBA 1OMIA 2IA0A 5FGMA 3P9IA 1ZGAA 4ZYEA 5DD4A 4LG0B 4Y13A 3HRTA 3HOTA 1PDNC 1H0MA 3R60A 5AONA 3GFMA 2VONA 1T98A 4ETSA 3PQKA 5L3CA 4OINF 4L9NA 1FZPB 3R6SA 1P6RA 2VODA 2Z5UA 3JAMZ 5DCFA 2G7UA 4GXOA 2HKXA 5FFZA 3LWFA 4EJWA 1HW1A 1DDNA 4OIPF 3IHUA 1O57A 4HBLA 5HS7A 4U7BA 1O7FA 4N9HA 4M6XA 4P9FA 3LA7A 1FP1D 4CXFA 1XCVA 3WU0A 4WK8F 1FSEA 1G3SA 2P5KA 4OMZA 4UVBA 4AWXB 2WWYA 2W24A 2CO5A 1EH8A 1QQIA 3WTWC 3GLXA 4UVCA 2A61A 3F8NA 2GWRA 3F6VA 5DEQA 1TNTA 2YU3A 3GYHX 2CYYA 1YS6A 1A04A 5CVRA 3WODF 5LEKA 3FXRA 3MAJA 4LB5A 3IRQA 5HDKA 5ED4A 1OKRA 4G94A 3GWZA 1IN4A 1U2WA 3RDIA 2RQPA 1SFEA 5DUIA 5CVUA 2BBYA 4YFNF 5J8CA 2DQLA 4OIOF 2EK5A 4O3MA 1IUYA 4XSZF 3R0AA 5ICCA 1ZHFA 1IN5A 2O61A 2XHKA 4EM0B 2XASA 3RTRA 3TQNA 1UHMA 1XGSA 3KE2A 3FHZA 3KFWX 3SZPA 3KZYA 5BOXA 1V3FA 2EA4A 2KJBA 3ULQB 2DAOA 1H9GA 4HDVA 2BV6A 3BROA 2XAQA 4O6JA 3CO6C 2QM3A 4CYDA 4M9SA 3GFJA 3WTZA 4HLYA 5J8FA 5FD5A 1SAXA 1S6LA 1KYWA 2ADUA 1GXPA 1DUXC 4KMFA 4YFKF 2OQRA 1FX7A 3ZMSA 2QBYB 2OQGA 4G9YA 1XGMA 3KP6A 5DCMA 3CUOA 4I01A 1IRFA 2STWA 2YSRA 3ZMUA 2EJRA 3IRRA 3F8FA 5D6EA 3T1BA 3ABTA 3M8FA 1KU7A 5K5OA 4OU0A 2DI3A 2ZNZA 3H3UA 1OPCA 3GXOA 1BC8C 3VOEA 4A0ZA 4HAMA 4EVIA 4M74A 2XIGA 3K9TA 1MD0A 1STZA 2MBFA 4PGGA 5A2QZ 3HRSA 3EDPA 4EQQA 2EA2A 4BYYA 4G8XA 5D5VB 3DP7A 1U3EM 3V7SA 1IAWA 4IRHA 2V6CA 3LFKA 1WKMA 3COAC 5HOOA 3KEQA 3OV8A 3QPTA 1AOYA 2ELHA 3O3KA 3BPXA 4JQFA 2STTA 4HQMA 3M9AA 1GXQA 1HSJA 5HDNA 3L7WA 3MZHA 1KA8A 2DQRA 5KK1A 1R36A 4CO8A 1FOKA 3SXYA 4KDPA 4LLLA 1J5YA 5HLIA 3FMQA 4HV5A 2IJLA 3KCCA 5TJJA 2L4AA 2JPCA 1CGPA 2HR3A 2HTSA 4RGRA 3FZVA 3E5XA 3L2CA 3RI4A 3F8BA 3K1PA 4KA4A 2K4JA 3JTGA 4WF2A 3RPQA 5ILSA 5HS8A 2L02A 3BJAA 4FX0A 5JFRA 4IHTA 2QZ8A 1ZG1A 1T0FA 3NQOA 2PJPA 2FSWA 4ASNA 3HUGA 5BPIA 5K5QA 2XROA 2H09A 3BZ6A 1K79A 1BI3A 2E7XA 3V4GA 4WXHA 1IZ1A 4ENKA 1O3SA 1BC7C 2XAHA 2Y0MA 1HW2A 4M73A 3H3ZA 4HF0A 2CW0F 4M9ZA 3HRUA 3GUDA 3JW4A 4HQEA 1YFHA 4LB6B 1KQ0A 1ZARA 4GGGA 4UXNA 6PAXA 2K27A 3F21A 3FX3A 5LEJA 4AD9A 3W6JB 1K78B 4P9UA 1FP2A 3ZMTA 3ISPA 3IL2A 3WGGA 3BWGA 4ENJA 1LNWA 2F5DA 4UUVA 3LQQA 4IPAA 3CUQB 4K2EA 1FY7A 1FYKA 1ON1A 1Q1HA 2CWEA 5E1WA 3PQJA 1WI9A 4PDKA 1ULYA 4L9TA 5E8GA 5K5RA 2AXLA 4I98B 2EV0A 1FBQA 1D8JA 2LF8A 4RB1A 2ZMEA 3HSFA 1JGSA 2RVCA 2HDCA 1LDDA 3WTYC 2OBPA 5E8IA 3LQRA 3U9GA 3K0LA 4EV0A 3M1EA 3B73A 1B4AA 5AIQA 3IKVA 2BEOA 5BS6A 3GX4X 1UB9A 1DPRA 2NNNA 1G6NA 2O8XA 1FYMA 2MH9A 3H92A 2D1HA 5LRRA 1G3TA 2VBYA 1HBXG 3NRVA 4P5OA 3HIFA 3CDHA 2V1XA 3MQ0A 2EFWA 3R0JA 5LGUA 2FQ3A 2L4MA 2NRAC 1BI2A 2ETHA 3BP8A 3TDZC 2VXZA 2GA2A 2HKOA 4G7OF 2PFBA 4EGYA 1XGOA 4AVPA 1HXDA 2H94A 4N9IA 4KYWA 3WTUC 2VE9A 3E6BA 3ECHA 1OYIA 1R00A 2QQAA 1UHWA 3N4MA 3BJOA 2QBYA 3RKWA 3JSOA 1UFMA 2M87A 2P7VB 1AWCA 1QGPA 1GHCA 1P2FA 5HVQC 2ZXJA 3WTVC 3U2RA 1W4MA 1XDUA 1R5GA 4AIJA 1K6OA 2BYVE 2V1UA 4ENNA 1RNLA 4ESFA 1LB2A 4LD5A 2MC3A 2COMA 2ESHA 4TV7A 5JR3A 3J81Z 3KP3A 3J81K 1ON2A 2ZKZA 4B8XA 4UNOA 4I0AA 2V1DA 2R3SA 3C1DA 3SZTA 3PFIA 4HW0A 3P9KA 1ZREA 2RN7A 3D5LA 4KIFA 1G3WA 2ISZA 3QAHA 2OAZA 2VC1A 3JSPA 2PN6A 4L9VA 2F5FA 2UXXA 5H6RA 1XCBA 1KU3A 5JVTA 4UV8A 5D5XB 4LLNA 3TO6A 3GO5A 1NHAA 2IRFG 2FBIA 1R5HA 4A2UA 2DW4A 4FT8A 2L01A 3RJPA 3K2ZA 3TO7A 1FC3A 1J7KA 2FE3A 3WGIA 4WXCA 4MQ9F 1XMKA 2JT1A 4Q48A 2DO7A 1R1TA 4M6YA 2Z33A 3K1NA 2FA5A 1R1VA 2K02A 5E18F 4ZZLA 5IT9K 3I4PA 1T2KA 2CSOA 2A3SA 4HX4A 3MFKA 1MJBA 2G7HA 3GZ5A 3KP7A 5FO5A 3V7RA 3FM5A 2LKPA 2XGXA 2K7LA 3LAPA 5EEGA 2XAJA 3HYIA 3R61A 2IA1A 2ZMEB 4G7HF 4ZZDA 4LMYA 3ZQ7A 1Z05A 3ZMVA 2Q2EA 1D3YA 2PG4A 1MGTA 2K86A 1RUOA 2ISYA 1WQ2A 3EETA 4IRGA 3CUQC 4A5NA 2GXBA 4EJTA 1KU2A 3DEUA 3ROUA 1IW7F 1FWZA 1I6XA 4M9XA 3WGHA 4I0BA 2OZUA 2UWMA 4DNCA 1RI7A 2H6BA 1ZRFA 1YTYA 3T8RA 1ZG5A 1R7JA 2NS0A 1SD7A 1XGNA 1Y0UA 1WSUA 5FLXK 1ZRDA 2FOKA 1MJ9A 2FXAA 4ENMA 2M8EA 1J75A 1BJAA 4U88A 1W7PD 3ZN0A 1T39A 1E2XA 1JE8A 3SHFA 4BH9A 1BBYA 1S8NA 3L9FA 3HTSB 4OMYA 5HS9A 3VEPA 3GW2A 3OOPA 2IT0A 4RB2C 3BY6A 4HX7A 5CJ9A 3FMRA 2CFXA 4JBAA 3RYPA 1FNNA 1DP7P 2L54A 3QU6A 5BQTA 1R58A 1SMYF 4Y15A 4B09A 3QP6A 4UV9A 5CLSA 5FD6A 3F8MA 1OR7A 1SFUA 1J0RA 4EM2A 2GA1A 4A6EA 2NNYA 3WG9A 3QRFF 3ERED 1SD6A 1EH7A 4PGHA 1HQCA 3E5QA 1S29A 2AS5F 2DU9A 1U5TC 1YLFA 1EV7A 3GFLA 1X3UA 2XV4S 4S04A 1RUNA 1RZ4A 1USTA 2H27A 3FF5A 2VOPA 2DFIA 2MD5A 5KVRA 4A6DA 1GVJA 2RGVA 4O5VA 4HDUA 3KP4A 2PEXA 4A5MA 1FYLA 5ILVA 5LHIA 1S7AA 4WXDA 2OZ6A 2HOEA 4HA8A 1B1BA 1BI0A 4EMSA 2FNPA 2IVMA 4OOIA 2O03A 4MEYF 3TO9A 1P92A 2PMHA 2V79A 3J80Z 1TTYA 2D2WA 1HSTA 1J2XA 2GQQA 4EJVA 2W25A 4MNUA 3RKYA 3ZN1A 1TQPA 2Z99A 4HX8A 2A5YB 5D4RA 5H20A 1XSVA 4HV6A 3Q9VA 5TRDA 1CF7B 4AIHA 2EFQA 2F2EA 3I58A 1L3LA 5LGTA 4HF2A 2EV6A 5FB2A 2X4HA 4YIFA 5K1YA 1C0WA 1IN8A 3TDUC 3KEOA 3DKWA 4CZZA 1IN6A 1USSA 5EEHA 1MJAA 2JSCA 3I0TA 4RAZA 1PUEE 4CHUA 1TQMA 5JHUA 5DUKA 4LLGF 1W5TA 3GEZA 4ZYHA 2QLZA 5J6XA 4L5IA 4XSXF 2EWNA 4H0EA 4XLNF 4L18B 4FX4A 4IRIA 3BPVA 1QZYA 1XB4A 1JXSA 3CLOA 3Q5FA 4WWCA 4RB3C 1YW7A 4EGZA 1QPMA 2OD5A 4WCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYO A;  4XRF A;  1BIA A;  3E6C C;  2ZBK A;  1B59 A;  5F6F A;  4QWQ A;  1BN5 A;  5L3B A;  4IJA A;  1I27 A;  3TGN A;  1PP8 F;  5D8L B;  1OYW A;  1B9M A;  2A07 F;  2HQN A;  3F23 A;  2YX4 A;  2QQ9 A;  3V8K A;  3E5U A;  4LK0 F;  5E20 A;  5E17 F;  2PQ8 A;  3WTX C;  4D0P A;  4RGX A;  2PBI A;  3T0Y A;  3P7N A;  2NAZ A;  2Y75 A;  1FT9 A;  2QWW A;  1QZZ A;  1J59 A;  4RGU A;  2PMU A;  5ILU A;  2L3D A;  1PP7 U;  2G9W A;  2R7D A;  2TDX A;  2IP2 A;  3E97 A;  4KUM A;  3T5X A;  5LHG A;  1V4R A;  1R22 A;  3QU3 A;  1VTN C;  3IC7 A;  2VBW A;  1XDS A;  4IXA A;  1W7P A;  1ZLJ A;  3WE2 A;  5ICF A;  1QNT A;  4LFU A;  2JRT A;  2LDU A;  2A6H F;  3QP5 A;  2ZO4 A;  3FWE A;  3JTH A;  3AAF A;  3E3V A;  4MGR A;  2XAG A;  2VT2 A;  2VBX A;  1I5Z A;  2HTJ A;  4PZJ A;  2P6S A;  2X0L A;  4I7H A;  2UZK A;  4A0X A;  2E7W A;  2Q8K A;  1ZN2 A;  2IW5 A;  1L0O C;  2KJC A;  4GO1 A;  3DXJ F;  2PLY A;  5F1R A;  1ODD A;  4BHP A;  5FFX A;  1YS7 A;  3G3Z A;  4YFX F;  5LRS A;  4ZYG A;  3I71 A;  3CO7 C;  2A6E F;  3MEX A;  3K69 A;  5D5W B;  3V8J A;  2O0Y A;  4KIG A;  3EYY A;  3DQV C;  3EUH A;  5A2Q K;  3EQL F;  5D4S A;  3SFZ A;  3MZY A;  5DV5 A;  4ESJ A;  3DPL C;  3WE3 A;  4KFC A;  4LGW A;  1S3J A;  1MZB A;  1CF7 A;  3FXQ A;  2E1C A;  2RV8 A;  5ICE A;  3N97 A;  3DPT A;  2BE5 F;  4LG0 A;  1Z91 A;  2M45 A;  2ACJ A;  4P96 A;  4BQA A;  2LSO A;  3HTU A;  2VOO A;  3ELK A;  3HOS A;  4BHC A;  1RIO H;  2D1V A;  4KIB A;  4EJU A;  4L0Z B;  4ZYD A;  3IKT A;  1YYV A;  2Y48 A;  5LLQ A;  3T8T A;  4MHG A;  4S05 A;  2HQR A;  1YW9 A;  3I64 A;  1LDJ A;  2JTV A;  1FLI A;  2QUF A;  5ERI A;  3VFZ A;  4CGZ A;  1ZRC A;  3CJN A;  4P55 A;  1SFX A;  4L0Y B;  1F4K A;  1ONV A;  4R1H A;  3GFI A;  1BOA A;  3QOP A;  4HYE A;  2IPQ X;  3FM3 A;  2M1B A;  4NB5 A;  1FBS A;  4A12 A;  2EB7 A;  4U0W A;  4PCQ A;  1FSH A;  2P4W A;  2P8T A;  1LVA A;  5ICG A;  3S2W A;  3L00 A;  3J80 K;  1LEA A;  1YG2 A;  2VE8 A;  2HGC A;  2R7F A;  3DV8 A;  1QO0 D;  1ZLK A;  1J9I A;  4G6Q A;  5E1Z B;  2KRF A;  3LAJ A;  4ZH4 F;  2XRN A;  3KLO A;  4BAY A;  2FML A;  3W6K B;  4Q47 A;  2GIV A;  1EH6 A;  2HYG D;  5AIP A;  2CQK A;  1U5T A;  3VB2 A;  3BDD A;  2YX7 A;  1H9T A;  1TLH B;  2JZY A;  2W84 A;  1ZGJ A;  1T6S A;  2ZCW A;  3DF8 A;  2F5C A;  5CVV A;  3E6D A;  4EJO A;  1SD4 A;  4UHT A;  1F1Z A;  3JAM K;  3I59 B;  1G4D A;  3RPU A;  1IXS B;  2LNB A;  1U6G A;  3C18 A;  2DPU A;  1B6A A;  2JPB A;  3J7A O;  3KP5 A;  5BPD A;  4KNY A;  3F22 A;  1JHF A;  1YO5 C;  2P5V A;  4EM1 A;  3GF2 A;  5LHH A;  1F5T A;  2WC2 A;  2KKO A;  1LDK B;  4YII A;  4HLX A;  1R23 A;  5LGN A;  2DK5 A;  4I2O A;  1D8K A;  2YR2 A;  1W7P B;  2WV0 A;  2FMY A;  1BM9 A;  1K7A A;  4I09 A;  3C7J A;  1JHH A;  4KMU X;  2ZNY A;  1O3R A;  1P4A A;  4HF1 A;  2VT3 A;  2GZW A;  2HZT A;  4GYG A;  4F7Z A;  1FBU A;  3BJ6 A;  3QPH A;  4MTE A;  1SD5 A;  3TKY A;  4GCV A;  4HOB A;  4IVN A;  1I1G A;  4CDG A;  3Q9S A;  3V8L A;  1HKS A;  3IWF A;  2XKO A;  1TW3 A;  3KP2 A;  1U5T B;  2EFN A;  2KIM A;  3U1D A;  2YPR A;  5DD8 A;  3DFG A;  1XN7 A;  3HHH A;  5CVI A;  2HFH A;  2MLK A;  1P4W A;  1XSD A;  1TBX A;  2O6G E;  2V9V A;  3ZP5 A;  3FXU A;  3E6M A;  3ABU A;  1FPQ A;  4BNC A;  4XLP F;  5HDG A;  3B02 A;  1XD7 A;  1BI1 A;  1ZH5 A;  3I5U A;  1HKQ A;  3R4K A;  3MWM A;  2DK8 A;  1O7L A;  2C6Y A;  1REP C;  4MTD A;  3LA2 A;  4Z2Y A;  1KQ9 A;  3MCZ A;  3L09 A;  1Z9C A;  2VC0 A;  4MEX F;  3HSE A;  2FNA A;  4MQV A;  4KIC A;  2QVO A;  3WTS C;  1O3Q A;  5L3G A;  2DT5 A;  2IA2 A;  3D0S A;  2ZFW A;  4XBF A;  5HLG A;  5CYV A;  3LA3 A;  2DTR A;  3RIR A;  2GXG A;  5D6F A;  1IXC A;  2FRH A;  1HW5 A;  3F8C A;  2OU2 A;  1S7O A;  2Q0O A;  1O3T A;  1LQ1 A;  3HSR A;  2DBB A;  1MDM B;  2MLG A;  3REO A;  4G6D A;  4LJZ F;  5E1X A;  4IHS A;  4OIQ F;  1OYY A;  1U78 A;  2E1N A;  2Z3Y A;  1KQ8 A;  4A0Y A;  4BHB A;  3I54 A;  1Z6R A;  5IT3 A;  1ZG3 A;  2EFP A;  2B0L A;  4HZF A;  1TQI A;  2DLL A;  2D45 A;  1YIO A;  2HWV A;  2VBZ A;  1D5V A;  3CTA A;  5HLH A;  1TW2 A;  2UXN A;  3F6O A;  4RAY A;  3IWZ A;  3TOA A;  4Y17 A;  1BIB A;  1W5S A;  3HRM A;  4L9J A;  2W85 A;  2EFO A;  4U0Y A;  1Z1D A;  2MH2 A;  1WWX A;  4RS8 A;  1KU9 A;  2MA3 A;  4Q4Z F;  2M30 A;  1B9N A;  2H6C A;  1KGS A;  2ZJ2 A;  2CG4 A;  3ML6 A;  5F64 A;  3VOD A;  3M7G A;  5D8K B;  4U7D A;  4ON0 A;  4LK1 F;  4NQW A;  2HEO A;  1G3Y A;  2RDP A;  4FHT A;  1F9N A;  4M71 A;  1P4X A;  3HHG A;  3KLN A;  2GAU A;  3ZMZ A;  3NEU A;  2J5P A;  2P7C B;  1Z7U A;  3O2P E;  5IT9 Z;  2A68 F;  5DDG A;  2NYX A;  1TNS A;  2O3F A;  2RNJ A;  1YW8 A;  1K78 A;  4GYI A;  1XSX A;  3F3X A;  2WTE A;  1R1U A;  3WU1 B;  2BGC A;  3ECO A;  5FLX Z;  4L5J A;  1LEB A;  3ZMD A;  3WTT C;  2J5O A;  2ESN A;  2VN2 A;  2KIF A;  1IRG A;  4JK1 X;  1DPU A;  2XVC A;  2HS5 A;  5DCM B;  1UCR A;  1Z6T A;  3KZZ A;  4QLC U;  3KET A;  2FBH A;  4N0B A;  5LBQ A;  1I1S A;  1ZAO A;  2M5W A;  5CVJ A;  3GVA A;  2Z9O A;  4OIR F;  1ZYR F;  5L3E A;  2FF4 A;  3I59 A;  1E17 A;  3TOB A;  2RKH A;  3EYI A;  1T38 A;  4YG2 F;  1YQA A;  1MKM A;  2EV5 A;  2QQB A;  3RKX A;  4CIC A;  2PI0 A;  4KT5 C;  2QEN A;  1U8R A;  2LF7 A;  3V7C A;  3SQN A;  1IF1 A;  2F5E A;  5L3D A;  4G7Z F;  2DPD A;  4KN4 X;  4DQ2 A;  4R79 A;  3BOQ A;  4RGS A;  4U0V A;  4RB0 A;  3G73 A;  3F72 A;  4KN7 X;  3ZPL A;  4M72 A;  2XUB A;  2P6T A;  3I53 A;  1MDM A;  1XMA A;  2CGP A;  4E70 A;  4NHJ A;  4UVA A;  1IN7 A;  3RYR A;  3O6B B;  2FEZ A;  5D5U B;  2FU4 A;  4BXU A;  2XAF A;  1WRJ A;  5H6Q A;  2K4B A;  1LJ9 A;  1QBJ A;  4I02 A;  3CUQ A;  2OA4 A;  1HKT A;  5BMZ A;  2P5L C;  5DYM A;  3C3W A;  2A69 F;  3M8E A;  2HYF A;  1KYZ A;  1IXR C;  3GZ6 A;  4Q5S F;  2XKP A;  5JI6 A;  2W57 A;  3LST A;  2KIU A;  2RC4 A;  4IF4 A;  2FBK A;  4AIK A;  4WX9 A;  3FMS A;  1SMT A;  5L3F A;  3K1M A;  4R8H A;  3P9C A;  4ESB A;  1OMI A;  2IA0 A;  5FGM A;  3P9I A;  1ZGA A;  4ZYE A;  5DD4 A;  4LG0 B;  4Y13 A;  3HRT A;  3HOT A;  1PDN C;  1H0M A;  3R60 A;  5AON A;  3GFM A;  2VON A;  1T98 A;  4ETS A;  3PQK A;  5L3C A;  4OIN F;  4L9N A;  1FZP B;  3R6S A;  1P6R A;  2VOD A;  2Z5U A;  3JAM Z;  5DCF A;  2G7U A;  4GXO A;  2HKX A;  5FFZ A;  3LWF A;  4EJW A;  1HW1 A;  1DDN A;  4OIP F;  3IHU A;  1O57 A;  4HBL A;  5HS7 A;  4U7B A;  1O7F A;  4N9H A;  4M6X A;  4P9F A;  3LA7 A;  1FP1 D;  4CXF A;  1XCV A;  3WU0 A;  4WK8 F;  1FSE A;  1G3S A;  2P5K A;  4OMZ A;  4UVB A;  4AWX B;  2WWY A;  2W24 A;  2CO5 A;  1EH8 A;  1QQI A;  3WTW C;  3GLX A;  4UVC A;  2A61 A;  3F8N A;  2GWR A;  3F6V A;  5DEQ A;  1TNT A;  2YU3 A;  3GYH X;  2CYY A;  1YS6 A;  1A04 A;  5CVR A;  3WOD F;  5LEK A;  3FXR A;  3MAJ A;  4LB5 A;  3IRQ A;  5HDK A;  5ED4 A;  1OKR A;  4G94 A;  3GWZ A;  1IN4 A;  1U2W A;  3RDI A;  2RQP A;  1SFE A;  5DUI A;  5CVU A;  2BBY A;  4YFN F;  5J8C A;  2DQL A;  4OIO F;  2EK5 A;  4O3M A;  1IUY A;  4XSZ F;  3R0A A;  5ICC A;  1ZHF A;  1IN5 A;  2O61 A;  2XHK A;  4EM0 B;  2XAS A;  3RTR A;  3TQN A;  1UHM A;  1XGS A;  3KE2 A;  3FHZ A;  3KFW X;  3SZP A;  3KZY A;  5BOX A;  1V3F A;  2EA4 A;  2KJB A;  3ULQ B;  2DAO A;  1H9G A;  4HDV A;  2BV6 A;  3BRO A;  2XAQ A;  4O6J A;  3CO6 C;  2QM3 A;  4CYD A;  4M9S A;  3GFJ A;  3WTZ A;  4HLY A;  5J8F A;  5FD5 A;  1SAX A;  1S6L A;  1KYW A;  2ADU A;  1GXP A;  1DUX C;  4KMF A;  4YFK F;  2OQR A;  1FX7 A;  3ZMS A;  2QBY B;  2OQG A;  4G9Y A;  1XGM A;  3KP6 A;  5DCM A;  3CUO A;  4I01 A;  1IRF A;  2STW A;  2YSR A;  3ZMU A;  2EJR A;  3IRR A;  3F8F A;  5D6E A;  3T1B A;  3ABT A;  3M8F A;  1KU7 A;  5K5O A;  4OU0 A;  2DI3 A;  2ZNZ A;  3H3U A;  1OPC A;  3GXO A;  1BC8 C;  3VOE A;  4A0Z A;  4HAM A;  4EVI A;  4M74 A;  2XIG A;  3K9T A;  1MD0 A;  1STZ A;  2MBF A;  4PGG A;  5A2Q Z;  3HRS A;  3EDP A;  4EQQ A;  2EA2 A;  4BYY A;  4G8X A;  5D5V B;  3DP7 A;  1U3E M;  3V7S A;  1IAW A;  4IRH A;  2V6C A;  3LFK A;  1WKM A;  3COA C;  5HOO A;  3KEQ A;  3OV8 A;  3QPT A;  1AOY A;  2ELH A;  3O3K A;  3BPX A;  4JQF A;  2STT A;  4HQM A;  3M9A A;  1GXQ A;  1HSJ A;  5HDN A;  3L7W A;  3MZH A;  1KA8 A;  2DQR A;  5KK1 A;  1R36 A;  4CO8 A;  1FOK A;  3SXY A;  4KDP A;  4LLL A;  1J5Y A;  5HLI A;  3FMQ A;  4HV5 A;  2IJL A;  3KCC A;  5TJJ A;  2L4A A;  2JPC A;  1CGP A;  2HR3 A;  2HTS A;  4RGR A;  3FZV A;  3E5X A;  3L2C A;  3RI4 A;  3F8B A;  3K1P A;  4KA4 A;  2K4J A;  3JTG A;  4WF2 A;  3RPQ A;  5ILS A;  5HS8 A;  2L02 A;  3BJA A;  4FX0 A;  5JFR A;  4IHT A;  2QZ8 A;  1ZG1 A;  1T0F A;  3NQO A;  2PJP A;  2FSW A;  4ASN A;  3HUG A;  5BPI A;  5K5Q A;  2XRO A;  2H09 A;  3BZ6 A;  1K79 A;  1BI3 A;  2E7X A;  3V4G A;  4WXH A;  1IZ1 A;  4ENK A;  1O3S A;  1BC7 C;  2XAH A;  2Y0M A;  1HW2 A;  4M73 A;  3H3Z A;  4HF0 A;  2CW0 F;  4M9Z A;  3HRU A;  3GUD A;  3JW4 A;  4HQE A;  1YFH A;  4LB6 B;  1KQ0 A;  1ZAR A;  4GGG A;  4UXN A;  6PAX A;  2K27 A;  3F21 A;  3FX3 A;  5LEJ A;  4AD9 A;  3W6J B;  1K78 B;  4P9U A;  1FP2 A;  3ZMT A;  3ISP A;  3IL2 A;  3WGG A;  3BWG A;  4ENJ A;  1LNW A;  2F5D A;  4UUV A;  3LQQ A;  4IPA A;  3CUQ B;  4K2E A;  1FY7 A;  1FYK A;  1ON1 A;  1Q1H A;  2CWE A;  5E1W A;  3PQJ A;  1WI9 A;  4PDK A;  1ULY A;  4L9T A;  5E8G A;  5K5R A;  2AXL A;  4I98 B;  2EV0 A;  1FBQ A;  1D8J A;  2LF8 A;  4RB1 A;  2ZME A;  3HSF A;  1JGS A;  2RVC A;  2HDC A;  1LDD A;  3WTY C;  2OBP A;  5E8I A;  3LQR A;  3U9G A;  3K0L A;  4EV0 A;  3M1E A;  3B73 A;  1B4A A;  5AIQ A;  3IKV A;  2BEO A;  5BS6 A;  3GX4 X;  1UB9 A;  1DPR A;  2NNN A;  1G6N A;  2O8X A;  1FYM A;  2MH9 A;  3H92 A;  2D1H A;  5LRR A;  1G3T A;  2VBY A;  1HBX G;  3NRV A;  4P5O A;  3HIF A;  3CDH A;  2V1X A;  3MQ0 A;  2EFW A;  3R0J A;  5LGU A;  2FQ3 A;  2L4M A;  2NRA C;  1BI2 A;  2ETH A;  3BP8 A;  3TDZ C;  2VXZ A;  2GA2 A;  2HKO A;  4G7O F;  2PFB A;  4EGY A;  1XGO A;  4AVP A;  1HXD A;  2H94 A;  4N9I A;  4KYW A;  3WTU C;  2VE9 A;  3E6B A;  3ECH A;  1OYI A;  1R00 A;  2QQA A;  1UHW A;  3N4M A;  3BJO A;  2QBY A;  3RKW A;  3JSO A;  1UFM A;  2M87 A;  2P7V B;  1AWC A;  1QGP A;  1GHC A;  1P2F A;  5HVQ C;  2ZXJ A;  3WTV C;  3U2R A;  1W4M A;  1XDU A;  1R5G A;  4AIJ A;  1K6O A;  2BYV E;  2V1U A;  4ENN A;  1RNL A;  4ESF A;  1LB2 A;  4LD5 A;  2MC3 A;  2COM A;  2ESH A;  4TV7 A;  5JR3 A;  3J81 Z;  3KP3 A;  3J81 K;  1ON2 A;  2ZKZ A;  4B8X A;  4UNO A;  4I0A A;  2V1D A;  2R3S A;  3C1D A;  3SZT A;  3PFI A;  4HW0 A;  3P9K A;  1ZRE A;  2RN7 A;  3D5L A;  4KIF A;  1G3W A;  2ISZ A;  3QAH A;  2OAZ A;  2VC1 A;  3JSP A;  2PN6 A;  4L9V A;  2F5F A;  2UXX A;  5H6R A;  1XCB A;  1KU3 A;  5JVT A;  4UV8 A;  5D5X B;  4LLN A;  3TO6 A;  3GO5 A;  1NHA A;  2IRF G;  2FBI A;  1R5H A;  4A2U A;  2DW4 A;  4FT8 A;  2L01 A;  3RJP A;  3K2Z A;  3TO7 A;  1FC3 A;  1J7K A;  2FE3 A;  3WGI A;  4WXC A;  4MQ9 F;  1XMK A;  2JT1 A;  4Q48 A;  2DO7 A;  1R1T A;  4M6Y A;  2Z33 A;  3K1N A;  2FA5 A;  1R1V A;  2K02 A;  5E18 F;  4ZZL A;  5IT9 K;  3I4P A;  1T2K A;  2CSO A;  2A3S A;  4HX4 A;  3MFK A;  1MJB A;  2G7H A;  3GZ5 A;  3KP7 A;  5FO5 A;  3V7R A;  3FM5 A;  2LKP A;  2XGX A;  2K7L A;  3LAP A;  5EEG A;  2XAJ A;  3HYI A;  3R61 A;  2IA1 A;  2ZME B;  4G7H F;  4ZZD A;  4LMY A;  3ZQ7 A;  1Z05 A;  3ZMV A;  2Q2E A;  1D3Y A;  2PG4 A;  1MGT A;  2K86 A;  1RUO A;  2ISY A;  1WQ2 A;  3EET A;  4IRG A;  3CUQ C;  4A5N A;  2GXB A;  4EJT A;  1KU2 A;  3DEU A;  3ROU A;  1IW7 F;  1FWZ A;  1I6X A;  4M9X A;  3WGH A;  4I0B A;  2OZU A;  2UWM A;  4DNC A;  1RI7 A;  2H6B A;  1ZRF A;  1YTY A;  3T8R A;  1ZG5 A;  1R7J A;  2NS0 A;  1SD7 A;  1XGN A;  1Y0U A;  1WSU A;  5FLX K;  1ZRD A;  2FOK A;  1MJ9 A;  2FXA A;  4ENM A;  2M8E A;  1J75 A;  1BJA A;  4U88 A;  1W7P D;  3ZN0 A;  1T39 A;  1E2X A;  1JE8 A;  3SHF A;  4BH9 A;  1BBY A;  1S8N A;  3L9F A;  3HTS B;  4OMY A;  5HS9 A;  3VEP A;  3GW2 A;  3OOP A;  2IT0 A;  4RB2 C;  3BY6 A;  4HX7 A;  5CJ9 A;  3FMR A;  2CFX A;  4JBA A;  3RYP A;  1FNN A;  1DP7 P;  2L54 A;  3QU6 A;  5BQT A;  1R58 A;  1SMY F;  4Y15 A;  4B09 A;  3QP6 A;  4UV9 A;  5CLS A;  5FD6 A;  3F8M A;  1OR7 A;  1SFU A;  1J0R A;  4EM2 A;  2GA1 A;  4A6E A;  2NNY A;  3WG9 A;  3QRF F;  3ERE D;  1SD6 A;  1EH7 A;  4PGH A;  1HQC A;  3E5Q A;  1S29 A;  2AS5 F;  2DU9 A;  1U5T C;  1YLF A;  1EV7 A;  3GFL A;  1X3U A;  2XV4 S;  4S04 A;  1RUN A;  1RZ4 A;  1UST A;  2H27 A;  3FF5 A;  2VOP A;  2DFI A;  2MD5 A;  5KVR A;  4A6D A;  1GVJ A;  2RGV A;  4O5V A;  4HDU A;  3KP4 A;  2PEX A;  4A5M A;  1FYL A;  5ILV A;  5LHI A;  1S7A A;  4WXD A;  2OZ6 A;  2HOE A;  4HA8 A;  1B1B A;  1BI0 A;  4EMS A;  2FNP A;  2IVM A;  4OOI A;  2O03 A;  4MEY F;  3TO9 A;  1P92 A;  2PMH A;  2V79 A;  3J80 Z;  1TTY A;  2D2W A;  1HST A;  1J2X A;  2GQQ A;  4EJV A;  2W25 A;  4MNU A;  3RKY A;  3ZN1 A;  1TQP A;  2Z99 A;  4HX8 A;  2A5Y B;  5D4R A;  5H20 A;  1XSV A;  4HV6 A;  3Q9V A;  5TRD A;  1CF7 B;  4AIH A;  2EFQ A;  2F2E A;  3I58 A;  1L3L A;  5LGT A;  4HF2 A;  2EV6 A;  5FB2 A;  2X4H A;  4YIF A;  5K1Y A;  1C0W A;  1IN8 A;  3TDU C;  3KEO A;  3DKW A;  4CZZ A;  1IN6 A;  1USS A;  5EEH A;  1MJA A;  2JSC A;  3I0T A;  4RAZ A;  1PUE E;  4CHU A;  1TQM A;  5JHU A;  5DUK A;  4LLG F;  1W5T A;  3GEZ A;  4ZYH A;  2QLZ A;  5J6X A;  4L5I A;  4XSX F;  2EWN A;  4H0E A;  4XLN F;  4L18 B;  4FX4 A;  4IRI A;  3BPV A;  1QZY A;  1XB4 A;  1JXS A;  3CLO A;  3Q5F A;  4WWC A;  4RB3 C;  1YW7 A;  4EGZ A;  1QPM A;  2OD5 A;  4WCG A; 
#chains in the Genus database with same CATH topology
 2QYO A;  4XRF A;  1ZR4 A;  1BIA A;  3E6C C;  2ZBK A;  1B59 A;  3A0H C;  4QWQ A;  1BN5 A;  5F6F A;  5L3B A;  4ANJ A;  4F92 B;  1QVT A;  2KRH A;  2JA6 J;  1VI0 A;  4IJA A;  1I27 A;  2XF6 A;  3TGN A;  1H88 C;  2VPR A;  1PP8 F;  2DT6 A;  3HG9 A;  1TT5 B;  4PSX A;  4A3E J;  5D8L B;  1OYW A;  2R5Y B;  1B9M A;  2A07 F;  4B4C A;  2HQN A;  1AU7 A;  3F23 A;  2YX4 A;  2M0M A;  2QQ9 A;  3AL0 C;  4Y7N J;  4F3Q A;  3V8K A;  3E5U A;  1VQ9 I;  4LK0 F;  5E20 A;  5GAH J;  3LOC A;  3DTI A;  5E17 F;  1LKX A;  5K7Z A;  3DBL B;  4Z6Y A;  2BY1 A;  2UUZ A;  2PQ8 A;  3HOU J;  1ZKG A;  3WTX C;  5B3S H;  2L2O A;  4D0P A;  4RGX A;  4X1E A;  3JR9 A;  2PBI A;  3T0Y A;  3AL0 B;  3P7N A;  2NAZ A;  2Y75 A;  3CP8 A;  3GME A;  1Y8Q B;  1FT9 A;  2QWW A;  1QZZ A;  1J59 A;  4RGU A;  4A3I J;  2PMU A;  5ILU A;  2L3D A;  1PP7 U;  2DA3 A;  3EUA A;  2ZSH B;  3I4N J;  2G9W A;  2R7D A;  2TDX A;  2IP2 A;  3E97 A;  2CJJ A;  2MW8 A;  4KUM A;  1FJL A;  3T5X A;  2BY2 A;  5LHG A;  4PJ0 C;  1V4R A;  2V7F A;  1R22 A;  4HNV A;  3QU3 A;  1VTN C;  3IC7 A;  1S9H A;  2EPF A;  4NC8 A;  2VBW A;  1XDS A;  1SVO A;  2D5V A;  4IXA A;  3HKZ N;  5B5E C;  4BAC A;  4I6Z A;  1W7P A;  1ZLJ A;  3WE2 A;  5ICF A;  1QNT A;  1JKQ C;  4LFU A;  2VJJ A;  3TED A;  4PFO A;  2L5Q A;  2JRT A;  2LDU A;  4BJ5 C;  2A6H F;  3QP5 A;  2Z16 A;  4BJT A;  2ZO4 A;  3FWE A;  3JTH A;  3OIQ A;  3AAF A;  4AU7 A;  2IS2 A;  1ETQ A;  3E3V A;  4KT6 A;  2O8K A;  1Y1V J;  3M8J A;  4MGR A;  1GV5 A;  2OUM A;  3TBI A;  4BXX J;  5GPA A;  3JRA A;  2XAG A;  2JWT A;  2VT2 A;  2VBX A;  1I5Z A;  2HTJ A;  1BL0 A;  3W2V A;  3HUG B;  4PZJ A;  4LOC A;  4ZJZ A;  1D0Z A;  2P6S A;  2X0L A;  1QZE A;  1JKO C;  2XPU A;  5GP9 A;  4NDL A;  4I7H A;  2UZK A;  3IH4 A;  4A0X A;  2E7W A;  2Q8K A;  1ZN2 A;  2IW5 A;  1L0O C;  2KJC A;  4GO1 A;  3DXJ F;  2BHZ A;  2PLY A;  1GT0 C;  5F1R A;  2V26 A;  1ODD A;  1WJC A;  2LVS A;  3RKQ A;  4BHP A;  4YRV A;  3KIO A;  5FFX A;  3OSF A;  1YS7 A;  1GV2 A;  2DFE A;  2MFZ A;  3G3Z A;  3TP0 A;  4YFX F;  5LRS A;  4ZYG A;  3I71 A;  2EZK A;  2A6E F;  3CO7 C;  2M3A A;  4RAG A;  1ZR2 A;  4QSH A;  3MEX A;  4PUS A;  1KON A;  3K69 A;  5D5W B;  2ECC A;  3S1M J;  3V8J A;  2O0Y A;  4KIG A;  3W2W A;  3EYY A;  3DQV C;  3EUH A;  5A2Q K;  2VKD A;  2H1L A;  2W48 A;  1WJA A;  3EQL F;  5D4S A;  2E71 A;  2FQ4 A;  3SFZ A;  4RBO A;  1A35 A;  4BXF A;  1FMV A;  3FXL A;  3MZY A;  1YX3 A;  2I10 A;  3HOV J;  3Q3S A;  2NOG A;  3HB9 A;  2ZC2 A;  5DV5 A;  3KPH A;  4ESJ A;  3QWL A;  3DPL C;  3WE3 A;  4KFC A;  4LGW A;  1S3J A;  5BNG A;  2EIN H;  1MZB A;  1MMN A;  5K7H A;  1CF7 A;  1MH3 A;  3FXQ A;  4DBQ A;  4DGW B;  2E1C A;  2RV8 A;  4A3C J;  5ICE A;  3N97 A;  1WPK A;  3DPT A;  2ZJQ F;  2BE5 F;  4FET A;  2CQQ A;  4LG0 A;  1Z91 A;  2M45 A;  3TL4 X;  4E4H A;  2ACJ A;  4P96 A;  2Q1Z B;  2X1E A;  4BQA A;  2LSO A;  1W36 D;  2NVU B;  2LRD A;  1XC5 A;  3HTU A;  2VOO A;  2KL4 A;  1FIP A;  4BE1 A;  3ELK A;  1NH3 A;  2KPM A;  2M4K A;  3HOS A;  4BHC A;  1RIO H;  2D1V A;  2X1D A;  1Y39 A;  3TW7 A;  4KIB A;  4EJU A;  1S7E A;  3PSI A;  2VJI A;  4L0Z B;  3CLQ A;  2LH9 A;  4ZYD A;  2WAQ N;  3IKT A;  1YYV A;  2Y48 A;  5LLQ A;  3T8T A;  5E79 C;  4MHG A;  4S05 A;  2HQR A;  3BTJ A;  1YW9 A;  4AUX A;  3I64 A;  5GAE J;  4OWR B;  1LDJ A;  4D9J A;  3IH2 A;  4A3G J;  3UNG C;  2LC2 A;  3GBG A;  3CCM I;  2JTV A;  4YIR X;  2IS1 A;  1FLI A;  2CH0 A;  2QUF A;  5EYR A;  4CSW A;  3CCY A;  5ERI A;  3CDI A;  3VFZ A;  3OSG A;  2E2J J;  4CGZ A;  1RC9 A;  1LFP A;  1WZ2 A;  5KAI C;  1ZRC A;  5FKO A;  2VI6 A;  3CJN A;  2ID6 A;  4P55 A;  3OS0 A;  1SFX A;  4L0Y B;  2BVL A;  1F4K A;  1ONV A;  2AQF A;  4R1H A;  1QU3 A;  2DA5 A;  3GFI A;  1SVL A;  4V19 K;  4C9Y A;  1BOA A;  3QOP A;  4HYE A;  2IPQ X;  2IXS A;  3FM3 A;  3BCB A;  2M1B A;  1JKP C;  3KYD B;  5JVG F;  3H36 A;  4NB5 A;  1FBS A;  4BL0 B;  2JSP A;  4A12 A;  2RAE A;  2EB7 A;  2IGO A;  4U0W A;  4PCQ A;  5E3N A;  1FSH A;  2DMP A;  4BE0 A;  2P4W A;  2P8T A;  3DBH B;  1LVA A;  5ICG A;  3NWS A;  3L00 A;  3S2W A;  1VQK I;  4LG3 A;  4A3L J;  3J80 K;  1RRJ A;  1LEA A;  2ELK A;  3B6A A;  2OTJ I;  3PUB A;  3BG3 A;  1YG2 A;  2VE8 A;  2OPT A;  2M9H A;  2HGC A;  3H0D A;  2AXT C;  3CC2 I;  3CC7 I;  1RET A;  2R7F A;  3K4B A;  3DV8 A;  1MSE C;  3JRD A;  4F52 A;  1QO0 D;  1MBK A;  1ZLK A;  1J9I A;  1A31 A;  2EIJ H;  4G6Q A;  5E1Z B;  3K70 C;  2KRF A;  3LAJ A;  4ZH4 F;  4CCK A;  1JJ8 C;  2XRN A;  3KLO A;  2B63 J;  4BAY A;  2FML A;  3W6K B;  4Q47 A;  1PUF A;  3DCF A;  1S5L C;  3QQA A;  1WCM J;  3IUO A;  2GIV A;  1EH6 A;  3W6V A;  2HYG D;  3Q0U A;  4D5C A;  5AIP A;  3K4N A;  2CQK A;  1GUU A;  1U5T A;  3VB2 A;  3BDD A;  2R7S A;  2YX7 A;  5KHD A;  1H9T A;  4CCJ A;  1TLH B;  1YIJ I;  2E1M C;  2JZY A;  2W84 A;  3BTC A;  2R93 J;  3KEY A;  4XN0 A;  5DM6 F;  3RQI A;  1ZGJ A;  1T6S A;  2JJ7 A;  2ZCW A;  3DF8 A;  2F5C A;  2P0W A;  5CVV A;  3FHN A;  3E6D A;  3I9V 2;  3ABM H;  3LSI A;  4EJO A;  3GTM J;  3BQY A;  1SD4 A;  1V5G A;  4JX6 A;  1B72 A;  2NVT J;  5GTH C;  3MMY B;  4UHT A;  2E1M B;  4ZDP A;  2IAI A;  1K61 A;  4UY8 I;  4CYC B;  4XR6 A;  2CRG A;  5KCM A;  1F1Z A;  3JAM K;  3I59 B;  1OCT C;  1G4D A;  2F4O B;  3VDX A;  3RPU A;  1IXS B;  2B7E A;  2LNB A;  4G12 A;  5EGO A;  3SYT A;  1U6G A;  3C18 A;  2DPU A;  1B6A A;  3OYL A;  3ABL H;  4X6A J;  2JPB A;  4DW6 A;  3J7A O;  3KP5 A;  2KIS A;  5BPD A;  2LKX A;  1UG0 A;  4KNY A;  1E3O C;  3W2A A;  2NVX J;  3F22 A;  1JHF A;  1YO5 C;  3EUH C;  2P5V A;  4EM1 A;  3GF2 A;  2ELJ A;  3FXM A;  3CME I;  5LHH A;  1F5T A;  2JUG A;  5F08 A;  2WC2 A;  2KKO A;  3X2Q H;  4HRI A;  3OIP A;  4PJN A;  2VKH A;  4PK4 A;  3SEQ A;  2VIX A;  1LDK B;  1S72 I;  4YII A;  3OYG A;  4AC0 A;  2WBM A;  4HLX A;  2LY2 A;  3OYC A;  2VQC A;  1R23 A;  5LGN A;  1MBJ A;  2DK5 A;  3QYE A;  1D8K A;  1P7I A;  4I2O A;  2YR2 A;  1W7P B;  1VQ7 I;  3FKJ A;  2WV0 A;  2FMY A;  1BM9 A;  1K7A A;  3A4C A;  4E7I A;  1G8X A;  2WAD A;  5CQG A;  4I09 A;  3ZOB A;  9ANT A;  4LIV A;  4XON A;  5C4J J;  3OY9 A;  3C7J A;  3PNT A;  1JHH A;  5TIS C;  4KMU X;  2ZNY A;  1O3R A;  1P4A A;  3HGG A;  1WHU A;  3MKY B;  2UV1 A;  3K4C A;  5LFA A;  4HF1 A;  3MN2 A;  2L7Z A;  1Z77 A;  2VT3 A;  2VJ5 A;  2GZW A;  1MIJ A;  2HZT A;  2L7K A;  3V42 A;  1MMA A;  1MMG A;  3OYN A;  5KNL A;  1MBG A;  4GYG A;  4F7Z A;  1FBU A;  3BJ6 A;  3QPH A;  4MTE A;  1SD5 A;  3EPZ A;  3TKY A;  3OIO A;  4GCV A;  4HOB A;  4IVN A;  4ZTJ A;  1I1G A;  4CDG A;  4HNT A;  1P7J A;  2WY7 Q;  3Q9S A;  4RM2 A;  5IP6 A;  5EJC A;  3V8L A;  1HKS A;  2BHY A;  2XKO A;  3IWF A;  1T56 A;  3GTJ J;  1X1P A;  1TW3 A;  2XSD C;  3KP2 A;  2E60 A;  1U5T B;  2YS9 A;  2EFN A;  2KIM A;  3A0B C;  3U1D A;  2YPR A;  2A6T A;  5DD8 A;  1N25 A;  3DFG A;  3CF2 A;  3A01 B;  1Z67 A;  1XN7 A;  3HHH A;  5CVI A;  3MKZ A;  2MLK A;  2HFH A;  1P4W A;  1Z0X A;  1XSD A;  2DYR H;  1TBX A;  3HOY J;  2O6G E;  3FDY A;  3OS1 A;  2B9S A;  4IHY A;  2DT7 B;  2V9V A;  1M1E B;  1XG1 A;  3QOE A;  2CV1 A;  3CCU I;  3ZP5 A;  4B47 A;  3CD6 I;  1TZL A;  4BGD A;  3FXU A;  5EZH A;  3H9G A;  3E6M A;  3ABU A;  1FPQ A;  4BNC A;  4UB6 C;  1DGW Y;  3LFU A;  4DYC A;  2HPM A;  2GOX B;  4MO7 A;  2KMU A;  2IBD A;  4XLP F;  2QKM B;  5HDG A;  4AVZ A;  2EZH A;  3B02 A;  1XD7 A;  3FXJ A;  2HDD A;  2ZB9 A;  1BI1 A;  1ZH5 A;  3I5U A;  1DU0 A;  4D1Q A;  1HKQ A;  3OYE A;  3R4K A;  3K4L A;  3HJE A;  3MWM A;  2DK8 A;  3J7Y J;  1O7L A;  4I99 C;  2C6Y A;  4HST A;  1REP C;  4MTD A;  2HXO A;  3LA2 A;  4Z2Y A;  1KQ9 A;  1NTC A;  3MCZ A;  4QTR A;  2K9N A;  2KRC A;  3L09 A;  1Z9C A;  5B1B H;  2I8D A;  1D1C A;  1YI2 I;  2VC0 A;  4DOZ A;  2QSF X;  1X1B A;  2VQL A;  3PFY A;  2RNG A;  4MEX F;  4QIW N;  3WHC A;  4C2U A;  3HSE A;  2FNA A;  4MQV A;  2X85 A;  4KIC A;  2QVO A;  3WTS C;  1O3Q A;  2DMN A;  5L3G A;  2DT5 A;  1UMQ A;  2IA2 A;  4DIQ A;  3D0S A;  1MW7 A;  2CW7 A;  4G6T B;  2ZFW A;  1MBE A;  2R7U A;  4JYK A;  1OLT A;  1W0U A;  1X1A A;  4XBF A;  5HLG A;  2HXI A;  3EUK L;  5CYV A;  3LA3 A;  2DA2 A;  1AA7 A;  4RDU A;  2DTR A;  3L2Q A;  4IL6 C;  3RIR A;  1QPI A;  4AYB A;  2GXG A;  2XGE A;  5D6F A;  1IXC A;  2FRH A;  1HW5 A;  3C2B A;  2NS8 A;  4S0H B;  1LUJ B;  3L2R A;  3F8C A;  2OU2 A;  4IX7 A;  1S7O A;  2Q0O A;  3U21 A;  2CUF A;  3ZGK A;  3LL7 A;  3H5A A;  1APL C;  3S3N A;  2K9L A;  1O3T A;  3RCO A;  1LQ1 A;  5E3L A;  2E19 A;  3HSR A;  2DBB A;  2CQN A;  1MDM B;  2MLG A;  4IQ4 A;  3GLL A;  3REO A;  1ZQ3 P;  1E3H A;  1LE8 B;  1ETV A;  4G6D A;  2R7R A;  4LJZ F;  5E1X A;  4GFB A;  4IHS A;  4OIQ F;  4A3M J;  1OYY A;  1U78 A;  2E1N A;  2BW3 A;  4E7H A;  4Y52 J;  2Z3Y A;  1KQ8 A;  5J1Y A;  4A0Y A;  4BY7 J;  3S15 J;  1KZH A;  4BHB A;  3UKG A;  3I54 A;  1Z6R A;  5IT3 A;  1ZG3 A;  1D5Y A;  3NAR A;  3FXK A;  2EFP A;  2B0L A;  4HZF A;  1TQI A;  2DLL A;  2D45 A;  1YIO A;  1IUF A;  2HWV A;  1R4M B;  2VBZ A;  2R5Z A;  2IGK A;  3BZK A;  1D5V A;  1VND A;  3CTA A;  3CCE I;  5F0H A;  5HLH A;  1TW2 A;  2UXN A;  3F6O A;  4RAY A;  1ZGW A;  3IWZ A;  3TOA A;  1TWA J;  2OF7 A;  4Y17 A;  5J3L A;  1BIB A;  1YRN B;  1W5S A;  3HRM A;  4L9J A;  2W85 A;  2HU9 A;  3GTL J;  3ZQH A;  4XKW A;  3OWT A;  2EFO A;  4U0Y A;  1Z1D A;  2MH2 A;  3F0C A;  2COB A;  2FOW A;  1WWX A;  4CH7 A;  4RS8 A;  4UB8 C;  1KU9 A;  5F04 A;  2MA3 A;  2OJE D;  2M30 A;  1B9N A;  4Q4Z F;  1R49 A;  2H6C A;  1KGS A;  4ZDL A;  2ZJ2 A;  3S1Q J;  1D1A A;  2CG4 A;  4PJM A;  1QHH D;  1X1D A;  3ML6 A;  2ZSI B;  2DTZ A;  4M3D A;  3J7Z I;  5F64 A;  3CMY A;  2M4G A;  1EKE A;  3VOD A;  2FX0 A;  3M7G A;  5D8K B;  4ON0 A;  4U7D A;  4LK1 F;  4NQW A;  1EJ9 A;  1TC3 C;  1B72 B;  2HEO A;  2BZT A;  1G3Y A;  2XSJ C;  2RDP A;  2DA7 A;  2ZME C;  4FHT A;  2KDZ A;  1F9N A;  2HNH A;  4M71 A;  4XKB A;  1P4X A;  1T33 A;  3HHG A;  5CPR B;  5B66 C;  3KLN A;  2GAU A;  3WG7 H;  1E0E A;  1VQ8 I;  1LVK A;  3ZMZ A;  1JKR C;  5FLM J;  3NEU A;  2WAQ A;  2J5P A;  3O2P E;  1Z7U A;  2XPW A;  4NC6 A;  5JLW A;  2P7C B;  5IT9 Z;  2A68 F;  2O5R A;  3ZQL A;  2F6C A;  1JUM A;  1WJD A;  5J1U A;  5DDG A;  2NYX A;  1TNS A;  1PUF B;  2O3F A;  3K7A J;  2RNJ A;  1YW8 A;  3A01 A;  1K78 A;  2L9S A;  4U87 A;  4GYI A;  1H8A C;  1XSX A;  2CMP A;  2WTE A;  3BG5 A;  3F3X A;  3NAU A;  2W7N A;  4BY1 J;  1R1U A;  3WU1 B;  2BGC A;  3ECO A;  5FLX Z;  2PMZ N;  4L5J A;  4XRS G;  1LEB A;  3ZMD A;  2VL8 A;  4XRS A;  3WTT C;  1WGX A;  2GOM A;  2VPL A;  2R7V A;  2J5O A;  2ESN A;  1YIT I;  2VN2 A;  4Y4R A;  3CJT B;  2KIF A;  1ORK A;  4A93 J;  1IRG A;  4JK1 X;  1DPU A;  1I3Q J;  2XVC A;  2KP6 A;  2HS5 A;  1H89 C;  5DCM B;  2IS4 A;  1UCR A;  4EAT A;  4IZZ A;  1Z6T A;  3KZZ A;  3ONQ A;  4QLC U;  2JA8 J;  3KET A;  2FBH A;  4N0B A;  4UUT A;  5LBQ A;  1I1S A;  4C2M J;  1ZAO A;  1XS9 A;  3K70 D;  2M5W A;  4X0G A;  1TWH J;  5CVJ A;  4FE4 A;  3GVA A;  5EZG A;  2Z9O A;  4OIR F;  5DS9 A;  3DLL F;  1ZYR F;  5L3E A;  2FF4 A;  3I59 A;  1E17 A;  3TOB A;  1QRY A;  2RKH A;  3EYI A;  5M3F J;  1T38 A;  4YG2 F;  1IC8 A;  2KLO A;  1YQA A;  1MKM A;  2EV5 A;  4ZTF A;  2QQB A;  3RKX A;  4CIC A;  2DA6 A;  3IH3 A;  2PI0 A;  4KT5 C;  3ZQC A;  2QEN A;  2Y9Z A;  2QKL B;  1U8R A;  2LF7 A;  3V7C A;  3SQN A;  3CP2 A;  3BR0 A;  1IF1 A;  2MAB A;  2F5E A;  5L3D A;  2QSG X;  2K9Q A;  4G7Z F;  2DPD A;  4KN4 X;  4DQ2 A;  2DMU A;  4BQN A;  4R79 A;  2E34 A;  3BOQ A;  4RGS A;  3CJQ B;  4U0V A;  4MLO A;  4RB0 A;  3G73 A;  3F72 A;  3H0G J;  3DKY A;  4KN7 X;  1SAU A;  2DA1 A;  3VYS B;  3ZPL A;  4M72 A;  1BA5 A;  2M7B A;  2NXN B;  2XUB A;  2P6T A;  3I53 A;  2JN6 A;  5DTD A;  2OCE A;  1XMA A;  3BCA A;  2DFH A;  1MDM A;  1V5E A;  2CGP A;  4E70 A;  5EEA A;  4NHJ A;  4UVA A;  1IN7 A;  3RYR A;  1Y56 A;  3CJR B;  3O6B B;  1AKH B;  2L7F P;  2FEZ A;  5D5U B;  3S8P A;  1D1B A;  2FU4 A;  1IO2 A;  4BXU A;  2XAF A;  1WRJ A;  5H6Q A;  2AQE A;  3U1K A;  2K4B A;  2K3P A;  1FMW A;  1LJ9 A;  2XB0 X;  4IOC F;  2I5U A;  4I02 A;  1QBJ A;  4AM3 A;  3S17 J;  3CUQ A;  3PUF A;  2OA4 A;  1HKT A;  3G1M A;  2EIL H;  2ZXH A;  2P5L C;  5BMZ A;  4C3I J;  3M4O J;  5DYM A;  3C3W A;  2A69 F;  4ABZ A;  3M8E A;  2HYF A;  2X1C A;  2EIM H;  4EEF G;  3DTE A;  4JOM A;  1HLV A;  4C30 A;  3FK6 A;  1I50 J;  1KYZ A;  4OAZ A;  4KIT B;  1W36 C;  1IXR C;  3GZ6 A;  4Q5S F;  2XKP A;  4FTH A;  1Y8R B;  4PFP A;  2XDV A;  5JI6 A;  4P1W A;  2W57 A;  3LST A;  5HNF A;  2KIU A;  2F4M B;  2RC4 A;  1HDP A;  1IDY A;  4IF4 A;  1D0X A;  5M5Y J;  1POG A;  3BLY A;  3CF5 F;  1OFC X;  1BOB A;  2FBK A;  4AIK A;  2EQR A;  5KAF C;  4XNF A;  4WX9 A;  4A3J J;  3FMS A;  1N78 A;  1SMT A;  5L3F A;  1OIS A;  3K1M A;  1G59 A;  4R8H A;  3P9C A;  2M34 A;  1OMI A;  2DMQ A;  2IA0 A;  4ESB A;  2X48 A;  5FGM A;  2NS7 A;  3P9I A;  1ZGA A;  2IS6 A;  4ZYE A;  5DD4 A;  2HOT A;  4LG0 B;  4FIS A;  2W1O A;  1VQO I;  4J19 A;  4Y13 A;  3HRT A;  4HNU A;  2R7T A;  3HOT A;  1PDN C;  2ECB A;  3VSK A;  4QPO A;  1H0M A;  2H1K A;  3R60 A;  5AON A;  3GFM A;  2VON A;  4PJJ A;  1T98 A;  2VAS A;  4ETS A;  3PQK A;  2DDA A;  2H8W A;  4B1R A;  5L3C A;  4OIN F;  4XLE A;  4HEA 2;  4L9N A;  3QOD A;  4IHX A;  1FZP B;  3R6S A;  5H2F C;  1P6R A;  5FKN A;  2ME6 A;  2VOD A;  2Z5U A;  3LSR A;  3JAM Z;  5DCF A;  3HPH A;  5M5W J;  4BBR J;  2G7U A;  2LRE A;  4GXO A;  2HKX A;  5FFZ A;  3JRC A;  4A3B J;  2DOA A;  4E7Z A;  3OYM A;  3LWF A;  3LSG A;  4EJW A;  1HW1 A;  1DDN A;  4B48 A;  2WB1 N;  3FBN B;  4OIP F;  2DJN A;  3IHU A;  1O57 A;  2P81 A;  4HBL A;  5HS7 A;  2LG4 A;  4U7B A;  4NC7 A;  1O7F A;  2CUJ A;  2WA0 A;  4N9H A;  2IEK A;  1JJ6 C;  1IJW C;  4M6X A;  4P9F A;  3LA7 A;  1FP1 D;  4CXF A;  1XCV A;  3WU0 A;  4WK8 F;  2LP0 A;  2QSH X;  1FSE A;  2HYJ A;  1G3S A;  2P5K A;  4OMZ A;  2XB5 A;  3I3L A;  4UVB A;  4AWX B;  2WWY A;  1R9T J;  2W24 A;  3DWL E;  1FEX A;  3CQZ J;  2R5Y A;  2JA2 A;  2CO5 A;  3OYK A;  1EH8 A;  1QQI A;  3K6G A;  3WTW C;  1F43 A;  3GLX A;  2MGQ A;  2A61 A;  4UVC A;  3F8N A;  2GWR A;  3F6V A;  2R7Z J;  5DEQ A;  1TNT A;  2YU3 A;  4XKC A;  3GYH X;  2CYY A;  1YS6 A;  4BS9 A;  4E7J A;  1JTX A;  1X4O A;  2HZD A;  4XL9 A;  1A04 A;  2KFD A;  2DA4 A;  1FTT A;  5CVR A;  3O8G A;  1GLN A;  3WOD F;  5LEK A;  3FXR A;  3MAJ A;  2GM4 A;  4LB5 A;  3DKX A;  3IRQ A;  1K83 J;  5HDK A;  3ZRG A;  1OKR A;  5ED4 A;  4G94 A;  3GWZ A;  2BY3 A;  1IN4 A;  1U2W A;  3RDI A;  4IHW A;  3QYB A;  2RQP A;  1SFE A;  5DUI A;  5CVU A;  2BBY A;  2R7Q A;  4YFN F;  4AYB N;  5J8C A;  2DQL A;  3HPG A;  4OIO F;  3HXL A;  2EK5 A;  3A1Y A;  2L0K A;  3S93 A;  4N4N B;  4O3M A;  4M3E A;  1IUY A;  3BC8 A;  1TWG J;  1A36 A;  4XSZ F;  3R0A A;  5ICC A;  3K4J A;  1ZHF A;  1IN5 A;  2PJR A;  2O61 A;  3HBL A;  2XHK A;  4F93 B;  4EM0 B;  1V55 H;  3CC4 I;  5EG0 A;  3ZQF A;  2XAS A;  3OYJ A;  3RTR A;  3BR6 A;  3S14 J;  2GIZ A;  1UHM A;  3TQN A;  4D7N A;  1XGS A;  3KE2 A;  3FHZ A;  1I3A A;  2FUG 2;  3KFW X;  3SZP A;  4XIC A;  3KZY A;  3OYF A;  2KZG A;  5BOX A;  2K9S A;  2LFB A;  1V3F A;  2EA4 A;  1X2M A;  2KJB A;  3S32 A;  1WH7 A;  5C3E J;  3ULQ B;  2DAO A;  1H9G A;  4HDV A;  2BV6 A;  3TP3 A;  2ZJR F;  3BRO A;  2XAQ A;  4O6J A;  3CO6 C;  2QM3 A;  3J7A Y;  1CQT A;  1QHG A;  4CYD A;  3AKZ A;  1FIA A;  4M9S A;  1OCO H;  3GFJ A;  3L1P A;  1VQ5 I;  4LIU A;  3WTZ A;  4HLY A;  5J8F A;  1ETX A;  4J01 A;  3FIW A;  5FD5 A;  4XQF A;  4CYC A;  1SAX A;  1S6L A;  1BW6 A;  1Y6I A;  1KYW A;  2ADU A;  1GXP A;  1ETO A;  5LD2 C;  3AG2 H;  1DUX C;  1SC7 A;  4KMF A;  3NWT A;  4YFK F;  3L2W A;  1VFC A;  2OQR A;  3E1S A;  1Z7L A;  2EBI A;  3MKL A;  1BR1 A;  1FX7 A;  3CCR I;  2XPV A;  3ZMS A;  1MND A;  2QBY B;  2OQG A;  4G9Y A;  1XGM A;  3KP6 A;  3CCQ I;  1PVE A;  2CS3 A;  5DCM A;  1IV8 A;  3O8H A;  1WFX A;  2K5C A;  3CUO A;  4I01 A;  3Q0W A;  1IRF A;  1T08 B;  4RLF A;  2STW A;  2O7O A;  4XN3 A;  2YSR A;  5GTI C;  3ZMU A;  3ZQG A;  4F91 B;  5FLV A;  2EJR A;  1VF9 A;  1SVM A;  1WI3 A;  3IRR A;  1VQ6 I;  1YE9 A;  3F8F A;  5D6E A;  3T1B A;  4ZYA A;  1UJ8 A;  4M6V A;  3ABT A;  3M8F A;  1KU7 A;  4OAY A;  5K5O A;  1DGR M;  4OU0 A;  4BEH B;  3E0J B;  1FOX A;  2DDB A;  3OMY A;  1SFK A;  2DI3 A;  3JRB A;  2VB6 A;  2ZNZ A;  3H3U A;  1OPC A;  2KQR A;  3GXO A;  5TGT A;  1BC8 C;  3VOE A;  4A0Z A;  4HAM A;  5IPA A;  3P5J A;  5M5X J;  1LPQ A;  3G1L A;  4EVI A;  1I39 A;  4M74 A;  2XIG A;  3K9T A;  2VKE A;  1MD0 A;  3CCS I;  1UHS A;  1STZ A;  1QVU A;  2MBF A;  4PGG A;  5A2Q Z;  3HRS A;  3EDP A;  4EQQ A;  2EA2 A;  4BYY A;  5JHF A;  2E1O A;  3BG9 A;  3G1O A;  3GTP J;  4G8X A;  5D5V B;  3DP7 A;  1U3E M;  4M3G A;  1DQU A;  1MMD A;  3V7S A;  1IAW A;  4IRH A;  2V6C A;  2ID3 A;  3D1N I;  3E7L A;  2QA4 I;  1FOY A;  3LFK A;  4BKX A;  1WKM A;  4NQW B;  2DOD A;  4UUS B;  1TWF J;  3COA C;  5HOO A;  3KEQ A;  3OV8 A;  3QPT A;  4DYR A;  1AOY A;  2HVQ A;  2ELH A;  3O3K A;  3WU2 C;  4DZJ A;  5EG0 B;  1HOM A;  3BPX A;  4JQF A;  3CDL A;  1A6Q A;  1ZTR A;  2M8G X;  2STT A;  4HQM A;  3M9A A;  3ASO H;  2OV7 A;  1GXQ A;  1HSJ A;  5J47 A;  5HDN A;  3L7W A;  2F4I A;  3MZH A;  4CUG A;  1KA8 A;  2LBF A;  1N75 A;  3RPU D;  1JI8 A;  2DQR A;  1NK3 P;  5KK1 A;  3CCJ I;  1IDZ A;  1R36 A;  1UG2 A;  4CO8 A;  4DJA A;  1FOK A;  3SXY A;  4KDP A;  2E2I J;  3DU5 A;  4LLL A;  3DPU A;  1J5Y A;  5HLI A;  3JRG A;  3FMQ A;  3PNY A;  4HV5 A;  2IJL A;  3KCC A;  4IQJ A;  2LMD A;  5TJJ A;  2L4A A;  5HOD A;  3M3Y J;  4BUP A;  3BZC A;  2JPC A;  3LSH A;  1JTY A;  1CGP A;  2JA5 J;  3Q0V A;  2HR3 A;  3FIS A;  1ENH A;  2HTS A;  2XGC A;  3I55 I;  2R4G A;  4RGR A;  4RLQ A;  3OR1 C;  3FZV A;  3E5X A;  3L2C A;  3RI4 A;  3F8B A;  2BXY A;  2ZJP F;  4NNJ A;  3K1P A;  3PIO F;  4KA4 A;  2K4J A;  3JTG A;  4WF2 A;  2A5W A;  3RPQ A;  5ILS A;  1MBF A;  1JGG A;  2L9N A;  5CKT A;  5HS8 A;  2L02 A;  3BJA A;  1HDD C;  5EDN A;  3H9J A;  2X6O A;  5E3M A;  3ABK H;  4FX0 A;  5JFR A;  5IOY A;  2DMT A;  3VYR B;  4IHT A;  2Y69 H;  4XLA A;  3S16 J;  3HGY A;  2QZ8 A;  4CCO A;  1T0F A;  1ZG1 A;  3NQO A;  2WY8 Q;  2PJP A;  1YX5 A;  2AO9 A;  2ME0 A;  2K9M A;  2FSW A;  5GAD J;  2GBY A;  2L7M P;  4B3A A;  5IYD J;  4ASN A;  4E7K A;  5IYC J;  3HUG A;  1JT0 A;  5BPI A;  2V9P A;  2JRM A;  4C2T A;  5K5Q A;  1OCP A;  1D0Y A;  3GCM A;  2GXA A;  4XLC A;  1F36 A;  2XRO A;  4E6K G;  3K4K A;  2KT0 A;  2H09 A;  3H5R A;  3BR1 A;  3BZ6 A;  1ZEL A;  3ZXS A;  2X51 A;  1K79 A;  4II3 A;  1IRX A;  2R0Q C;  4D7M A;  1WJE A;  2DJI A;  1BI3 A;  1DU6 A;  2E7X A;  1JT6 A;  1JUP A;  2BXZ A;  3C2G A;  3V4G A;  4WXH A;  2HVS A;  2HVR A;  2DFF A;  1IZ1 A;  4ENK A;  1LFU P;  1O3S A;  2DOE A;  1BC7 C;  2XC7 A;  4JX4 A;  1MH4 A;  2XAH A;  1K6Y A;  2Y0M A;  3HDD A;  1HW2 A;  4M73 A;  2QEX I;  5C4X J;  3H3Z A;  1X2N A;  4HF0 A;  1ETW A;  3DEW A;  2CW0 F;  2YU9 J;  4UUS A;  4M9Z A;  3SFI A;  3HRU A;  1HC8 A;  1X3W B;  3GUD A;  3JW4 A;  4HQE A;  2BW3 B;  2IGN A;  2LD5 A;  1YFH A;  4W1U A;  1KQ0 A;  4LB6 B;  1ZAR A;  4GGG A;  4UXN A;  5HLT A;  3GZN B;  6PAX A;  4XOT A;  2K27 A;  2ZXW H;  3FX3 A;  5LEJ A;  3F21 A;  4AD9 A;  2R7W A;  4XKV A;  1T0F C;  3W6J B;  1K78 B;  3BR2 A;  2KDO A;  4P9U A;  1FP2 A;  3ZMT A;  3ISP A;  3IL2 A;  3WGG A;  3BWG A;  4ENJ A;  2M7A A;  1LNW A;  2F5D A;  4CZC A;  4UUV A;  4BE2 A;  1WJB A;  5J4V A;  3LQQ A;  4IPA A;  4XM3 A;  3OOU A;  4A3D J;  3CUQ B;  4K2E A;  1FY7 A;  2CUE A;  3SZG A;  1MNE A;  1FYK A;  2AHQ A;  1DP3 A;  1ON1 A;  2Z2S B;  1E3P A;  3BQZ A;  1Q1H A;  2W82 A;  2CWE A;  5E1W A;  2Q2E B;  3PQJ A;  2DOF A;  1WI9 A;  4PDK A;  2E5N A;  1ULY A;  1X3Z B;  4L9T A;  5E8G A;  4H4K C;  1K4T A;  2OTL I;  5IY5 H;  5K5R A;  1BR4 A;  3RSN A;  2AXL A;  4I98 B;  2EV0 A;  1FBQ A;  2ZXI A;  1D8J A;  2LF8 A;  4KJZ A;  2GLO A;  3L2U A;  2HI3 A;  3JCU C;  4RB1 A;  2ZME A;  3HSF A;  1JGS A;  2DYS H;  5J4Y A;  2RVC A;  2HOS A;  1LDD A;  2HDC A;  3WTY C;  2OBP A;  1V5F A;  5FRM A;  1HA8 A;  3OL3 A;  5E8I A;  1XTA A;  4IOA F;  3LQR A;  3U9G A;  3K0L A;  4EV0 A;  3M1E A;  3B73 A;  1B4A A;  2TCT A;  3ZCO A;  4XOR A;  3H35 A;  3HZJ A;  5AIQ A;  3IKV A;  3OR2 C;  2BEO A;  5BS6 A;  2BY0 A;  1UEL B;  3GX4 X;  3BR5 A;  5FJ8 J;  1UB9 A;  2QCO A;  4JX5 A;  1DPR A;  4CCM A;  3OYB A;  2NNN A;  1G6N A;  4JP0 A;  3S1N J;  2O8X A;  1OR7 C;  4AID A;  4IO9 F;  1VQN I;  1FYM A;  3JRI A;  3IAS 2;  4W97 A;  3PO3 J;  2HQA A;  2MH9 A;  1BR2 A;  1RR7 A;  3H92 A;  2NVQ J;  3S1R J;  2D1H A;  1MMS A;  5LRR A;  1Y1W J;  4ZDO A;  3QPS A;  4M3F A;  3DLA A;  1ITY A;  1G3T A;  1RR8 C;  2EIK H;  3C2H A;  1BJZ A;  4J00 A;  4D5F A;  3FXO A;  2VBY A;  4FCY A;  1HBX G;  4BDY A;  3NRV A;  2Y2Z A;  4P5O A;  3HIF A;  3CDH A;  2X6X A;  2V1N A;  1X58 A;  3H3V K;  2V1X A;  3FK7 A;  3HL2 A;  3MQ0 A;  2EFW A;  3R0J A;  4ZC3 A;  5K7F A;  3ZR8 X;  2M0C A;  4FAS D;  5LGU A;  1YJ9 I;  2FQ3 A;  2L4M A;  5GAG J;  2NRA C;  1BI2 A;  1FOW A;  2ETH A;  3BP8 A;  1VQL I;  1FTZ A;  4ITV A;  1X19 A;  1RKT A;  2KHM A;  3SDG A;  3TDZ C;  2VXZ A;  2GA2 A;  4DZP A;  3RZO J;  4QPQ A;  2HKO A;  3H5N A;  2CFO A;  1XX5 A;  4G7O F;  2YUS A;  2PFB A;  1BW5 A;  1NK2 P;  2VQH A;  5FKM A;  5F0F A;  4EGY A;  1XGO A;  1X1C A;  4AVP A;  1HXD A;  3S3O A;  2EZI A;  5EF6 A;  1LFB A;  2K3F A;  2H94 A;  3MVP A;  4N9I A;  4KYW A;  3WTU C;  2JQ7 A;  2VE9 A;  4RAF A;  3A02 A;  3E6B A;  1TT0 A;  3ECH A;  3BG7 A;  4MIM A;  1OYI A;  2HQ5 A;  1R00 A;  2QQA A;  3HOW J;  2Y30 A;  3ESW B;  3PNV A;  3FBI B;  2K85 A;  1UHW A;  3N4M A;  4PSW A;  5J1R A;  3BJO A;  2QBY A;  3RKW A;  3JSO A;  3H9Q A;  5IP9 J;  1UFM A;  2M87 A;  1Z21 A;  2P7V B;  2QF7 A;  2LYC A;  2NOJ B;  4CA0 A;  1AWC A;  1QGP A;  2K40 A;  1G2H A;  1GHC A;  1OJL A;  2W4S A;  2VXD A;  1P2F A;  5HVQ C;  1W5C C;  2ZXJ A;  3WTV C;  2VKV A;  2MD0 A;  3U2R A;  1W4M A;  1XDU A;  1R5G A;  3HC7 A;  4AIJ A;  2XF7 A;  3TW6 A;  1IRZ A;  1K6O A;  2BYV E;  2V1U A;  4ENN A;  2VJ4 A;  3IAM 2;  3K10 A;  1RNL A;  4ESF A;  1LB2 A;  4C3H J;  4BEH A;  4LD5 A;  2MC3 A;  3QPL A;  2COM A;  2ESH A;  4TV7 A;  5JR3 A;  3J81 Z;  3KP3 A;  3J81 K;  1ON2 A;  2ZKZ A;  4MFE A;  4B8X A;  4UNO A;  4I0A A;  2LR8 A;  3AFH A;  1O4X A;  2M2E A;  1U9O A;  2V1D A;  4BJ6 C;  2R3S A;  3C1D A;  3SZT A;  3PFI A;  4A3F J;  4HW0 A;  1ETK A;  3P9K A;  3DBR B;  1ZRE A;  2RN7 A;  1U9N A;  3D5L A;  4KIF A;  1G3W A;  2ISZ A;  3QAH A;  2OAZ A;  4A69 C;  2VC1 A;  2Y0S A;  3JSP A;  2PN6 A;  3OYI A;  4L9V A;  2F5F A;  2UXX A;  5F0C A;  5H6R A;  1XCB A;  3TMO A;  1KU3 A;  3PO2 J;  3HOZ J;  5JVT A;  3SEZ A;  4V2G A;  4UV8 A;  5D5X B;  4LLN A;  3TO6 A;  1VQM I;  3G71 I;  3GO5 A;  3UR3 C;  5IYB J;  1NHA A;  2IRF G;  1ERD A;  2FBI A;  2ZFU A;  3JRE A;  1R5H A;  2ICW G;  2V9K A;  2WV1 A;  4A2U A;  2DW4 A;  1T8I A;  4FT8 A;  2L01 A;  3ASN H;  3RJP A;  3IP4 B;  3K2Z A;  3TO7 A;  1FC3 A;  4M3B A;  3VSL A;  1J7K A;  2FE3 A;  1YJW I;  3DU6 A;  4WXC A;  3WGI A;  3RZD J;  4MQ9 F;  1XMK A;  2JT1 A;  4Q48 A;  1GDT A;  2DO7 A;  1R1T A;  4M6Y A;  5FKL A;  1PJR A;  2BVM A;  3PM1 A;  2Z33 A;  3K1N A;  2FA5 A;  1R1V A;  1QA6 A;  2K02 A;  3LNQ A;  1UAA A;  3IV5 A;  4FE7 A;  5E18 F;  4IKF A;  3OYA A;  1IV6 A;  5JLX A;  1X4P A;  4YEJ A;  4ZZL A;  5IT9 K;  3I4P A;  4BBS J;  1T2K A;  3S2H J;  2CSO A;  4N4O B;  2A3S A;  3BTL A;  2LOO A;  3DEE A;  4HX4 A;  4MFD A;  2E36 A;  3MFK A;  1MJB A;  2G7H A;  2JMW A;  3GZ5 A;  3KP7 A;  1SFO J;  5FO5 A;  3V7R A;  1ZK8 A;  3FM5 A;  2HDW A;  1OCC H;  4XLF A;  3LSM A;  1MNM C;  5HNH A;  2LKP A;  1AHD P;  2KIQ A;  2XGX A;  2K7L A;  3LAP A;  5EEG A;  1NG7 A;  2N8G A;  2XAJ A;  3HYI A;  3R61 A;  2IA1 A;  2ZME B;  4XLH A;  4G7H F;  4ZZD A;  3OL4 A;  2FJ1 A;  1VQ4 I;  2CU7 A;  4LMY A;  2W00 A;  3ZQ7 A;  3S3M A;  1Z05 A;  3ZMV A;  3BT9 A;  1OCZ H;  2H8R A;  2Q2E A;  1D3Y A;  2PG4 A;  2PMZ A;  3KYC B;  3VYU B;  1MGT A;  5FKK A;  2K86 A;  3CMM A;  1OCR H;  1R6R A;  4XK4 A;  1RUO A;  2HOA A;  2ISY A;  1WQ2 A;  3EET A;  4IRG A;  1TP4 A;  2QGU A;  1U0J A;  2X6W A;  1T95 A;  1W1W E;  3LMM A;  3CUQ C;  4A5N A;  2DN0 A;  5FRN A;  2GXB A;  4EJT A;  1KU2 A;  4IHV A;  3DEU A;  3ROU A;  1IW7 F;  1FWZ A;  1I6X A;  5EGO B;  4M9X A;  3WGH A;  5GPC A;  4I0B A;  3OS2 A;  1UZC A;  3MD2 A;  3W3C A;  1SAN A;  2OZU A;  4BQO A;  2UWM A;  4DNC A;  5DM7 F;  1RI7 A;  2H6B A;  1ZRF A;  4IEJ A;  1YTY A;  2E2H J;  3G6E I;  3T8R A;  1ZG5 A;  1R7J A;  1WJF A;  2NS0 A;  2R92 J;  1SD7 A;  1XGN A;  2CQ7 A;  3G4S I;  1Y0U A;  3CCV I;  4BDZ A;  2DXI A;  2Y31 A;  1R5I D;  1WSU A;  1N77 A;  5FLX K;  1ZRD A;  2FOK A;  1MJ9 A;  2FXA A;  2M8E A;  4ENM A;  1J75 A;  1VZ0 A;  1BJA A;  2CUZ A;  2V4J C;  4U88 A;  1W7P D;  2LLK A;  3ZN0 A;  1MBH A;  1T39 A;  1E2X A;  1JE8 A;  3SHF A;  2E35 A;  4BH9 A;  1BBY A;  1S8N A;  4DYQ A;  3L9F A;  1SEU A;  3HTS B;  3PSF A;  4OMY A;  5HS9 A;  3VEP A;  3GW2 A;  3OOP A;  1YHQ I;  2IT0 A;  3AG1 H;  4RB2 C;  3MKW B;  2FD5 A;  3G2B A;  2LKS A;  3BY6 A;  4HX7 A;  2JVH A;  5CJ9 A;  3FMR A;  2CFX A;  4F55 A;  5M3M J;  4JBA A;  5F1J A;  3RYP A;  1FNN A;  2X6Y A;  2CQX A;  1DP7 P;  2L54 A;  1Q1V A;  3QU6 A;  1ACI A;  5BQT A;  1A5J A;  1R58 A;  2JUC A;  3CCL I;  3GTG J;  1P9Q C;  2X9D A;  3D5S C;  1SMY F;  2F48 A;  4Y15 A;  3QP6 A;  4B09 A;  3LSJ A;  5FRO A;  5CQE A;  3N05 A;  4UV9 A;  2XRL A;  2F5V A;  5CLS A;  5FD6 A;  3K2A A;  3F8M A;  1OR7 A;  1HCR A;  2DCE A;  1J0R A;  4BQQ A;  1SFU A;  4PJL A;  4YEL A;  4EM2 A;  2Z1D A;  2GA1 A;  4A6E A;  4CCL A;  2OCC H;  4XOP A;  1PYV A;  2BOL A;  4II2 A;  4NUB A;  5F27 A;  2NNY A;  2G0E A;  2JVG A;  3WG9 A;  3ERE D;  3QRF F;  1SD6 A;  2PJR B;  5E3O A;  2V6E A;  1EH7 A;  4PGH A;  1HQC A;  1JUS A;  3E5Q A;  3SJM A;  1R71 A;  1S29 A;  2AS5 F;  3PL8 A;  4A3K J;  3HEF A;  1R4N B;  2DU9 A;  1U5T C;  1YLF A;  1EV7 A;  2LK2 A;  3GFL A;  1B8I B;  4B44 A;  1X3U A;  1ETY A;  2XV4 S;  2LY1 A;  4S04 A;  1NG6 A;  3OYH A;  2QQ8 A;  1RUN A;  1RZ4 A;  1UST A;  2H27 A;  3GTK J;  4RA2 A;  3FF5 A;  1I6H J;  2VOP A;  4Y3O A;  3QYF A;  2DFI A;  2MD5 A;  3WHB A;  5KVR A;  2RQQ A;  1RES A;  2R7O A;  4E7L A;  4A6D A;  1IG7 A;  1WH5 A;  1U8B A;  1IGN A;  1GVJ A;  3OYD A;  2RGV A;  4O5V A;  4HDU A;  3KP4 A;  1MSF C;  2PEX A;  3SDB A;  4A5M A;  4B3X A;  1FYL A;  5ILV A;  2WAF A;  5LHI A;  1RPW A;  3RQ4 A;  2JA7 J;  1S7A A;  4WXD A;  2E5Z A;  2HOE A;  2OZ6 A;  4HA8 A;  1B1B A;  3CES A;  3K4M A;  2TRT A;  3S2D J;  1BI0 A;  1VQP I;  3GTQ J;  4HSR A;  4EMS A;  2FNP A;  2IVM A;  4OOI A;  2EH3 A;  2O03 A;  4NBQ A;  1B8I A;  4MEY F;  3TO9 A;  4RMN A;  1P92 A;  2VLA A;  2LBF B;  4XID A;  3MZ8 A;  1YOV B;  2PMH A;  3I56 I;  1V54 H;  2V79 A;  3J80 Z;  3M1C A;  1TTY A;  3AG3 H;  1EF4 A;  1Y0N A;  4GDF A;  1A6I A;  2D2W A;  4C3J J;  5C44 J;  1HST A;  1J09 A;  1J2X A;  2GQQ A;  3PJR A;  4EJV A;  2L9V A;  3ZQQ A;  5B1A H;  3L2V A;  2RRE A;  2W25 A;  4RM3 A;  4MNU A;  3GTO J;  3RKY A;  1W0T A;  3H1C A;  3ZN1 A;  1TQP A;  1K4S A;  2Z99 A;  4HX8 A;  3CMA I;  2A5Y B;  5D4R A;  5J40 A;  5H20 A;  1XSV A;  3M07 A;  1HF0 A;  1AKH A;  2A05 A;  2XGD A;  1RKW A;  4HV6 A;  4V2F A;  3Q9V A;  1TL8 A;  3B6C A;  2WAE A;  5TRD A;  3VPR A;  1CF7 B;  4AIH A;  2EFQ A;  2MYS A;  2PX9 A;  2L9R A;  2WB1 A;  2F2E A;  3ERM A;  3I58 A;  2VUM J;  2IGM A;  1LE8 A;  1L3L A;  4CCN A;  5LGT A;  4HF2 A;  5IP7 J;  2EV6 A;  5FB2 A;  3DTK A;  2X4H A;  4YIF A;  3LSK A;  1XPX A;  2MC4 A;  5K1Y A;  1C0W A;  1IN8 A;  2CV0 A;  3VYT B;  1EA3 A;  3TDU C;  2MSY A;  4LIT A;  1YJN I;  3KEO A;  2R7X A;  3DKW A;  4Y33 A;  3BTI A;  4CZZ A;  3ZQI A;  4E7S A;  1IN6 A;  2EZL A;  1USS A;  2JK3 A;  5EEH A;  1MJA A;  2JSC A;  3I0T A;  2XAU A;  4RAZ A;  1PUE E;  2MG4 A;  3KZI C;  3FKI J;  3D5R C;  4CHU A;  3HKZ A;  2CV2 A;  3LSP A;  3BR3 A;  1TQM A;  1Z3Y A;  2Y9Y A;  4GRI A;  2HPI A;  2R5Z B;  3A2K A;  5JHU A;  3JRF A;  4XMY A;  5DUK A;  4B43 A;  4LLG F;  1W5T A;  3GEZ A;  3PIP F;  4ZYH A;  4BU2 A;  3AG4 H;  2QLZ A;  2LY9 A;  5J6X A;  4L5I A;  4XSX F;  3JRH A;  4L5E A;  2EWN A;  3CZ6 A;  1WVR A;  1YRN A;  4FQG A;  1WJ5 A;  4XLN F;  4H0E A;  3I4M J;  3KYL A;  3F9K A;  3HOX J;  4L18 B;  3A03 A;  4I76 A;  5IOZ A;  4FX4 A;  3KX2 A;  2CW8 A;  4IRI A;  1Z3X A;  3BPV A;  3VWB A;  3HM5 A;  2LTP A;  1QZY A;  2O9L A;  3BG6 A;  1GVD A;  4HPQ A;  1XB4 A;  4DBR A;  1JXS A;  2VQG A;  1OQY A;  2NVY J;  4HG2 A;  2XF5 A;  3CLO A;  3Q5F A;  4XRM A;  2OC6 A;  4KIS A;  4WWC A;  4RB3 C;  1YW7 A;  4EGZ A;  2KZV A;  1QPM A;  1XMX A;  2OD5 A;  1TWC J;  2Y0S N;  4WCG A; 
#chains in the Genus database with same CATH homology
 2QYO A;  4XRF A;  1BIA A;  3E6C C;  2ZBK A;  1B59 A;  5F6F A;  4QWQ A;  1BN5 A;  5L3B A;  4IJA A;  1I27 A;  3TGN A;  1PP8 F;  5D8L B;  1OYW A;  1B9M A;  2A07 F;  2HQN A;  3F23 A;  2YX4 A;  2QQ9 A;  3V8K A;  3E5U A;  4LK0 F;  5E20 A;  5E17 F;  2PQ8 A;  3WTX C;  4D0P A;  4RGX A;  2PBI A;  3T0Y A;  3P7N A;  2NAZ A;  2Y75 A;  1FT9 A;  2QWW A;  1QZZ A;  1J59 A;  4RGU A;  2PMU A;  5ILU A;  2L3D A;  1PP7 U;  2G9W A;  2R7D A;  2TDX A;  2IP2 A;  3E97 A;  4KUM A;  3T5X A;  5LHG A;  1V4R A;  1R22 A;  3QU3 A;  1VTN C;  3IC7 A;  2VBW A;  1XDS A;  4IXA A;  1W7P A;  1ZLJ A;  3WE2 A;  5ICF A;  1QNT A;  4LFU A;  2JRT A;  2LDU A;  2A6H F;  3QP5 A;  2ZO4 A;  3FWE A;  3JTH A;  3AAF A;  3E3V A;  4MGR A;  2XAG A;  2VT2 A;  2VBX A;  1I5Z A;  2HTJ A;  4PZJ A;  2P6S A;  2X0L A;  4I7H A;  2UZK A;  4A0X A;  2E7W A;  2Q8K A;  1ZN2 A;  2IW5 A;  1L0O C;  2KJC A;  4GO1 A;  3DXJ F;  2PLY A;  5F1R A;  1ODD A;  4BHP A;  5FFX A;  1YS7 A;  3G3Z A;  4YFX F;  5LRS A;  4ZYG A;  3I71 A;  3CO7 C;  2A6E F;  3MEX A;  3K69 A;  5D5W B;  3V8J A;  2O0Y A;  4KIG A;  3EYY A;  3DQV C;  3EUH A;  5A2Q K;  3EQL F;  5D4S A;  3SFZ A;  3MZY A;  5DV5 A;  4ESJ A;  3DPL C;  3WE3 A;  4KFC A;  4LGW A;  1S3J A;  1MZB A;  1CF7 A;  3FXQ A;  2E1C A;  2RV8 A;  5ICE A;  3N97 A;  3DPT A;  2BE5 F;  4LG0 A;  1Z91 A;  2M45 A;  2ACJ A;  4P96 A;  4BQA A;  2LSO A;  3HTU A;  2VOO A;  3ELK A;  3HOS A;  4BHC A;  1RIO H;  2D1V A;  4KIB A;  4EJU A;  4L0Z B;  4ZYD A;  3IKT A;  1YYV A;  2Y48 A;  5LLQ A;  3T8T A;  4MHG A;  4S05 A;  2HQR A;  1YW9 A;  3I64 A;  1LDJ A;  2JTV A;  1FLI A;  2QUF A;  5ERI A;  3VFZ A;  4CGZ A;  1ZRC A;  3CJN A;  4P55 A;  1SFX A;  4L0Y B;  1F4K A;  1ONV A;  4R1H A;  3GFI A;  1BOA A;  3QOP A;  4HYE A;  2IPQ X;  3FM3 A;  2M1B A;  4NB5 A;  1FBS A;  4A12 A;  2EB7 A;  4U0W A;  4PCQ A;  1FSH A;  2P4W A;  2P8T A;  1LVA A;  5ICG A;  3S2W A;  3L00 A;  3J80 K;  1LEA A;  1YG2 A;  2VE8 A;  2HGC A;  2R7F A;  3DV8 A;  1QO0 D;  1ZLK A;  1J9I A;  4G6Q A;  5E1Z B;  2KRF A;  3LAJ A;  4ZH4 F;  2XRN A;  3KLO A;  4BAY A;  2FML A;  3W6K B;  4Q47 A;  2GIV A;  1EH6 A;  2HYG D;  5AIP A;  2CQK A;  1U5T A;  3VB2 A;  3BDD A;  2YX7 A;  1H9T A;  1TLH B;  2JZY A;  2W84 A;  1ZGJ A;  1T6S A;  2ZCW A;  3DF8 A;  2F5C A;  5CVV A;  3E6D A;  4EJO A;  1SD4 A;  4UHT A;  1F1Z A;  3JAM K;  3I59 B;  1G4D A;  3RPU A;  1IXS B;  2LNB A;  1U6G A;  3C18 A;  2DPU A;  1B6A A;  2JPB A;  3J7A O;  3KP5 A;  5BPD A;  4KNY A;  3F22 A;  1JHF A;  1YO5 C;  2P5V A;  4EM1 A;  3GF2 A;  5LHH A;  1F5T A;  2WC2 A;  2KKO A;  1LDK B;  4YII A;  4HLX A;  1R23 A;  5LGN A;  2DK5 A;  4I2O A;  1D8K A;  2YR2 A;  1W7P B;  2WV0 A;  2FMY A;  1BM9 A;  1K7A A;  4I09 A;  3C7J A;  1JHH A;  4KMU X;  2ZNY A;  1O3R A;  1P4A A;  4HF1 A;  2VT3 A;  2GZW A;  2HZT A;  4GYG A;  4F7Z A;  1FBU A;  3BJ6 A;  3QPH A;  4MTE A;  1SD5 A;  3TKY A;  4GCV A;  4HOB A;  4IVN A;  1I1G A;  4CDG A;  3Q9S A;  3V8L A;  1HKS A;  3IWF A;  2XKO A;  1TW3 A;  3KP2 A;  1U5T B;  2EFN A;  2KIM A;  3U1D A;  2YPR A;  5DD8 A;  3DFG A;  1XN7 A;  3HHH A;  5CVI A;  2HFH A;  2MLK A;  1P4W A;  1XSD A;  1TBX A;  2O6G E;  2V9V A;  3ZP5 A;  3FXU A;  3E6M A;  3ABU A;  1FPQ A;  4BNC A;  4XLP F;  5HDG A;  3B02 A;  1XD7 A;  1BI1 A;  1ZH5 A;  3I5U A;  1HKQ A;  3R4K A;  3MWM A;  2DK8 A;  1O7L A;  2C6Y A;  1REP C;  4MTD A;  3LA2 A;  4Z2Y A;  1KQ9 A;  3MCZ A;  3L09 A;  1Z9C A;  2VC0 A;  4MEX F;  3HSE A;  2FNA A;  4MQV A;  4KIC A;  2QVO A;  3WTS C;  1O3Q A;  5L3G A;  2DT5 A;  2IA2 A;  3D0S A;  2ZFW A;  4XBF A;  5HLG A;  5CYV A;  3LA3 A;  2DTR A;  3RIR A;  2GXG A;  5D6F A;  1IXC A;  2FRH A;  1HW5 A;  3F8C A;  2OU2 A;  1S7O A;  2Q0O A;  1O3T A;  1LQ1 A;  3HSR A;  2DBB A;  1MDM B;  2MLG A;  3REO A;  4G6D A;  4LJZ F;  5E1X A;  4IHS A;  4OIQ F;  1OYY A;  1U78 A;  2E1N A;  2Z3Y A;  1KQ8 A;  4A0Y A;  4BHB A;  3I54 A;  1Z6R A;  5IT3 A;  1ZG3 A;  2EFP A;  2B0L A;  4HZF A;  1TQI A;  2DLL A;  2D45 A;  1YIO A;  2HWV A;  2VBZ A;  1D5V A;  3CTA A;  5HLH A;  1TW2 A;  2UXN A;  3F6O A;  4RAY A;  3IWZ A;  3TOA A;  4Y17 A;  1BIB A;  1W5S A;  3HRM A;  4L9J A;  2W85 A;  2EFO A;  4U0Y A;  1Z1D A;  2MH2 A;  1WWX A;  4RS8 A;  1KU9 A;  2MA3 A;  4Q4Z F;  2M30 A;  1B9N A;  2H6C A;  1KGS A;  2ZJ2 A;  2CG4 A;  3ML6 A;  5F64 A;  3VOD A;  3M7G A;  5D8K B;  4U7D A;  4ON0 A;  4LK1 F;  4NQW A;  2HEO A;  1G3Y A;  2RDP A;  4FHT A;  1F9N A;  4M71 A;  1P4X A;  3HHG A;  3KLN A;  2GAU A;  3ZMZ A;  3NEU A;  2J5P A;  2P7C B;  1Z7U A;  3O2P E;  5IT9 Z;  2A68 F;  5DDG A;  2NYX A;  1TNS A;  2O3F A;  2RNJ A;  1YW8 A;  1K78 A;  4GYI A;  1XSX A;  3F3X A;  2WTE A;  1R1U A;  3WU1 B;  2BGC A;  3ECO A;  5FLX Z;  4L5J A;  1LEB A;  3ZMD A;  3WTT C;  2J5O A;  2ESN A;  2VN2 A;  2KIF A;  1IRG A;  4JK1 X;  1DPU A;  2XVC A;  2HS5 A;  5DCM B;  1UCR A;  1Z6T A;  3KZZ A;  4QLC U;  3KET A;  2FBH A;  4N0B A;  5LBQ A;  1I1S A;  1ZAO A;  2M5W A;  5CVJ A;  3GVA A;  2Z9O A;  4OIR F;  1ZYR F;  5L3E A;  2FF4 A;  3I59 A;  1E17 A;  3TOB A;  2RKH A;  3EYI A;  1T38 A;  4YG2 F;  1YQA A;  1MKM A;  2EV5 A;  2QQB A;  3RKX A;  4CIC A;  2PI0 A;  4KT5 C;  2QEN A;  1U8R A;  2LF7 A;  3V7C A;  3SQN A;  1IF1 A;  2F5E A;  5L3D A;  4G7Z F;  2DPD A;  4KN4 X;  4DQ2 A;  4R79 A;  3BOQ A;  4RGS A;  4U0V A;  4RB0 A;  3G73 A;  3F72 A;  4KN7 X;  3ZPL A;  4M72 A;  2XUB A;  2P6T A;  3I53 A;  1MDM A;  1XMA A;  2CGP A;  4E70 A;  4NHJ A;  4UVA A;  1IN7 A;  3RYR A;  3O6B B;  2FEZ A;  5D5U B;  2FU4 A;  4BXU A;  2XAF A;  1WRJ A;  5H6Q A;  2K4B A;  1LJ9 A;  1QBJ A;  4I02 A;  3CUQ A;  2OA4 A;  1HKT A;  5BMZ A;  2P5L C;  5DYM A;  3C3W A;  2A69 F;  3M8E A;  2HYF A;  1KYZ A;  1IXR C;  3GZ6 A;  4Q5S F;  2XKP A;  5JI6 A;  2W57 A;  3LST A;  2KIU A;  2RC4 A;  4IF4 A;  2FBK A;  4AIK A;  4WX9 A;  3FMS A;  1SMT A;  5L3F A;  3K1M A;  4R8H A;  3P9C A;  4ESB A;  1OMI A;  2IA0 A;  5FGM A;  3P9I A;  1ZGA A;  4ZYE A;  5DD4 A;  4LG0 B;  4Y13 A;  3HRT A;  3HOT A;  1PDN C;  1H0M A;  3R60 A;  5AON A;  3GFM A;  2VON A;  1T98 A;  4ETS A;  3PQK A;  5L3C A;  4OIN F;  4L9N A;  1FZP B;  3R6S A;  1P6R A;  2VOD A;  2Z5U A;  3JAM Z;  5DCF A;  2G7U A;  4GXO A;  2HKX A;  5FFZ A;  3LWF A;  4EJW A;  1HW1 A;  1DDN A;  4OIP F;  3IHU A;  1O57 A;  4HBL A;  5HS7 A;  4U7B A;  1O7F A;  4N9H A;  4M6X A;  4P9F A;  3LA7 A;  1FP1 D;  4CXF A;  1XCV A;  3WU0 A;  4WK8 F;  1FSE A;  1G3S A;  2P5K A;  4OMZ A;  4UVB A;  4AWX B;  2WWY A;  2W24 A;  2CO5 A;  1EH8 A;  1QQI A;  3WTW C;  3GLX A;  4UVC A;  2A61 A;  3F8N A;  2GWR A;  3F6V A;  5DEQ A;  1TNT A;  2YU3 A;  3GYH X;  2CYY A;  1YS6 A;  1A04 A;  5CVR A;  3WOD F;  5LEK A;  3FXR A;  3MAJ A;  4LB5 A;  3IRQ A;  5HDK A;  5ED4 A;  1OKR A;  4G94 A;  3GWZ A;  1IN4 A;  1U2W A;  3RDI A;  2RQP A;  1SFE A;  5DUI A;  5CVU A;  2BBY A;  4YFN F;  5J8C A;  2DQL A;  4OIO F;  2EK5 A;  4O3M A;  1IUY A;  4XSZ F;  3R0A A;  5ICC A;  1ZHF A;  1IN5 A;  2O61 A;  2XHK A;  4EM0 B;  2XAS A;  3RTR A;  3TQN A;  1UHM A;  1XGS A;  3KE2 A;  3FHZ A;  3KFW X;  3SZP A;  3KZY A;  5BOX A;  1V3F A;  2EA4 A;  2KJB A;  3ULQ B;  2DAO A;  1H9G A;  4HDV A;  2BV6 A;  3BRO A;  2XAQ A;  4O6J A;  3CO6 C;  2QM3 A;  4CYD A;  4M9S A;  3GFJ A;  3WTZ A;  4HLY A;  5J8F A;  5FD5 A;  1SAX A;  1S6L A;  1KYW A;  2ADU A;  1GXP A;  1DUX C;  4KMF A;  4YFK F;  2OQR A;  1FX7 A;  3ZMS A;  2QBY B;  2OQG A;  4G9Y A;  1XGM A;  3KP6 A;  5DCM A;  3CUO A;  4I01 A;  1IRF A;  2STW A;  2YSR A;  3ZMU A;  2EJR A;  3IRR A;  3F8F A;  5D6E A;  3T1B A;  3ABT A;  3M8F A;  1KU7 A;  5K5O A;  4OU0 A;  2DI3 A;  2ZNZ A;  3H3U A;  1OPC A;  3GXO A;  1BC8 C;  3VOE A;  4A0Z A;  4HAM A;  4EVI A;  4M74 A;  2XIG A;  3K9T A;  1MD0 A;  1STZ A;  2MBF A;  4PGG A;  5A2Q Z;  3HRS A;  3EDP A;  4EQQ A;  2EA2 A;  4BYY A;  4G8X A;  5D5V B;  3DP7 A;  1U3E M;  3V7S A;  1IAW A;  4IRH A;  2V6C A;  3LFK A;  1WKM A;  3COA C;  5HOO A;  3KEQ A;  3OV8 A;  3QPT A;  1AOY A;  2ELH A;  3O3K A;  3BPX A;  4JQF A;  2STT A;  4HQM A;  3M9A A;  1GXQ A;  1HSJ A;  5HDN A;  3L7W A;  3MZH A;  1KA8 A;  2DQR A;  5KK1 A;  1R36 A;  4CO8 A;  1FOK A;  3SXY A;  4KDP A;  4LLL A;  1J5Y A;  5HLI A;  3FMQ A;  4HV5 A;  2IJL A;  3KCC A;  5TJJ A;  2L4A A;  2JPC A;  1CGP A;  2HR3 A;  2HTS A;  4RGR A;  3FZV A;  3E5X A;  3L2C A;  3RI4 A;  3F8B A;  3K1P A;  4KA4 A;  2K4J A;  3JTG A;  4WF2 A;  3RPQ A;  5ILS A;  5HS8 A;  2L02 A;  3BJA A;  4FX0 A;  5JFR A;  4IHT A;  2QZ8 A;  1ZG1 A;  1T0F A;  3NQO A;  2PJP A;  2FSW A;  4ASN A;  3HUG A;  5BPI A;  5K5Q A;  2XRO A;  2H09 A;  3BZ6 A;  1K79 A;  1BI3 A;  2E7X A;  3V4G A;  4WXH A;  1IZ1 A;  4ENK A;  1O3S A;  1BC7 C;  2XAH A;  2Y0M A;  1HW2 A;  4M73 A;  3H3Z A;  4HF0 A;  2CW0 F;  4M9Z A;  3HRU A;  3GUD A;  3JW4 A;  4HQE A;  1YFH A;  4LB6 B;  1KQ0 A;  1ZAR A;  4GGG A;  4UXN A;  6PAX A;  2K27 A;  3F21 A;  3FX3 A;  5LEJ A;  4AD9 A;  3W6J B;  1K78 B;  4P9U A;  1FP2 A;  3ZMT A;  3ISP A;  3IL2 A;  3WGG A;  3BWG A;  4ENJ A;  1LNW A;  2F5D A;  4UUV A;  3LQQ A;  4IPA A;  3CUQ B;  4K2E A;  1FY7 A;  1FYK A;  1ON1 A;  1Q1H A;  2CWE A;  5E1W A;  3PQJ A;  1WI9 A;  4PDK A;  1ULY A;  4L9T A;  5E8G A;  5K5R A;  2AXL A;  4I98 B;  2EV0 A;  1FBQ A;  1D8J A;  2LF8 A;  4RB1 A;  2ZME A;  3HSF A;  1JGS A;  2RVC A;  2HDC A;  1LDD A;  3WTY C;  2OBP A;  5E8I A;  3LQR A;  3U9G A;  3K0L A;  4EV0 A;  3M1E A;  3B73 A;  1B4A A;  5AIQ A;  3IKV A;  2BEO A;  5BS6 A;  3GX4 X;  1UB9 A;  1DPR A;  2NNN A;  1G6N A;  2O8X A;  1FYM A;  2MH9 A;  3H92 A;  2D1H A;  5LRR A;  1G3T A;  2VBY A;  1HBX G;  3NRV A;  4P5O A;  3HIF A;  3CDH A;  2V1X A;  3MQ0 A;  2EFW A;  3R0J A;  5LGU A;  2FQ3 A;  2L4M A;  2NRA C;  1BI2 A;  2ETH A;  3BP8 A;  3TDZ C;  2VXZ A;  2GA2 A;  2HKO A;  4G7O F;  2PFB A;  4EGY A;  1XGO A;  4AVP A;  1HXD A;  2H94 A;  4N9I A;  4KYW A;  3WTU C;  2VE9 A;  3E6B A;  3ECH A;  1OYI A;  1R00 A;  2QQA A;  1UHW A;  3N4M A;  3BJO A;  2QBY A;  3RKW A;  3JSO A;  1UFM A;  2M87 A;  2P7V B;  1AWC A;  1QGP A;  1GHC A;  1P2F A;  5HVQ C;  2ZXJ A;  3WTV C;  3U2R A;  1W4M A;  1XDU A;  1R5G A;  4AIJ A;  1K6O A;  2BYV E;  2V1U A;  4ENN A;  1RNL A;  4ESF A;  1LB2 A;  4LD5 A;  2MC3 A;  2COM A;  2ESH A;  4TV7 A;  5JR3 A;  3J81 Z;  3KP3 A;  3J81 K;  1ON2 A;  2ZKZ A;  4B8X A;  4UNO A;  4I0A A;  2V1D A;  2R3S A;  3C1D A;  3SZT A;  3PFI A;  4HW0 A;  3P9K A;  1ZRE A;  2RN7 A;  3D5L A;  4KIF A;  1G3W A;  2ISZ A;  3QAH A;  2OAZ A;  2VC1 A;  3JSP A;  2PN6 A;  4L9V A;  2F5F A;  2UXX A;  5H6R A;  1XCB A;  1KU3 A;  5JVT A;  4UV8 A;  5D5X B;  4LLN A;  3TO6 A;  3GO5 A;  1NHA A;  2IRF G;  2FBI A;  1R5H A;  4A2U A;  2DW4 A;  4FT8 A;  2L01 A;  3RJP A;  3K2Z A;  3TO7 A;  1FC3 A;  1J7K A;  2FE3 A;  3WGI A;  4WXC A;  4MQ9 F;  1XMK A;  2JT1 A;  4Q48 A;  2DO7 A;  1R1T A;  4M6Y A;  2Z33 A;  3K1N A;  2FA5 A;  1R1V A;  2K02 A;  5E18 F;  4ZZL A;  5IT9 K;  3I4P A;  1T2K A;  2CSO A;  2A3S A;  4HX4 A;  3MFK A;  1MJB A;  2G7H A;  3GZ5 A;  3KP7 A;  5FO5 A;  3V7R A;  3FM5 A;  2LKP A;  2XGX A;  2K7L A;  3LAP A;  5EEG A;  2XAJ A;  3HYI A;  3R61 A;  2IA1 A;  2ZME B;  4G7H F;  4ZZD A;  4LMY A;  3ZQ7 A;  1Z05 A;  3ZMV A;  2Q2E A;  1D3Y A;  2PG4 A;  1MGT A;  2K86 A;  1RUO A;  2ISY A;  1WQ2 A;  3EET A;  4IRG A;  3CUQ C;  4A5N A;  2GXB A;  4EJT A;  1KU2 A;  3DEU A;  3ROU A;  1IW7 F;  1FWZ A;  1I6X A;  4M9X A;  3WGH A;  4I0B A;  2OZU A;  2UWM A;  4DNC A;  1RI7 A;  2H6B A;  1ZRF A;  1YTY A;  3T8R A;  1ZG5 A;  1R7J A;  2NS0 A;  1SD7 A;  1XGN A;  1Y0U A;  1WSU A;  5FLX K;  1ZRD A;  2FOK A;  1MJ9 A;  2FXA A;  4ENM A;  2M8E A;  1J75 A;  1BJA A;  4U88 A;  1W7P D;  3ZN0 A;  1T39 A;  1E2X A;  1JE8 A;  3SHF A;  4BH9 A;  1BBY A;  1S8N A;  3L9F A;  3HTS B;  4OMY A;  5HS9 A;  3VEP A;  3GW2 A;  3OOP A;  2IT0 A;  4RB2 C;  3BY6 A;  4HX7 A;  5CJ9 A;  3FMR A;  2CFX A;  4JBA A;  3RYP A;  1FNN A;  1DP7 P;  2L54 A;  3QU6 A;  5BQT A;  1R58 A;  1SMY F;  4Y15 A;  4B09 A;  3QP6 A;  4UV9 A;  5CLS A;  5FD6 A;  3F8M A;  1OR7 A;  1SFU A;  1J0R A;  4EM2 A;  2GA1 A;  4A6E A;  2NNY A;  3WG9 A;  3QRF F;  3ERE D;  1SD6 A;  1EH7 A;  4PGH A;  1HQC A;  3E5Q A;  1S29 A;  2AS5 F;  2DU9 A;  1U5T C;  1YLF A;  1EV7 A;  3GFL A;  1X3U A;  2XV4 S;  4S04 A;  1RUN A;  1RZ4 A;  1UST A;  2H27 A;  3FF5 A;  2VOP A;  2DFI A;  2MD5 A;  5KVR A;  4A6D A;  1GVJ A;  2RGV A;  4O5V A;  4HDU A;  3KP4 A;  2PEX A;  4A5M A;  1FYL A;  5ILV A;  5LHI A;  1S7A A;  4WXD A;  2OZ6 A;  2HOE A;  4HA8 A;  1B1B A;  1BI0 A;  4EMS A;  2FNP A;  2IVM A;  4OOI A;  2O03 A;  4MEY F;  3TO9 A;  1P92 A;  2PMH A;  2V79 A;  3J80 Z;  1TTY A;  2D2W A;  1HST A;  1J2X A;  2GQQ A;  4EJV A;  2W25 A;  4MNU A;  3RKY A;  3ZN1 A;  1TQP A;  2Z99 A;  4HX8 A;  2A5Y B;  5D4R A;  5H20 A;  1XSV A;  4HV6 A;  3Q9V A;  5TRD A;  1CF7 B;  4AIH A;  2EFQ A;  2F2E A;  3I58 A;  1L3L A;  5LGT A;  4HF2 A;  2EV6 A;  5FB2 A;  2X4H A;  4YIF A;  5K1Y A;  1C0W A;  1IN8 A;  3TDU C;  3KEO A;  3DKW A;  4CZZ A;  1IN6 A;  1USS A;  5EEH A;  1MJA A;  2JSC A;  3I0T A;  4RAZ A;  1PUE E;  4CHU A;  1TQM A;  5JHU A;  5DUK A;  4LLG F;  1W5T A;  3GEZ A;  4ZYH A;  2QLZ A;  5J6X A;  4L5I A;  4XSX F;  2EWN A;  4H0E A;  4XLN F;  4L18 B;  4FX4 A;  4IRI A;  3BPV A;  1QZY A;  1XB4 A;  1JXS A;  3CLO A;  3Q5F A;  4WWC A;  4RB3 C;  1YW7 A;  4EGZ A;  1QPM A;  2OD5 A;  4WCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...