2A3SA

Solution structure and dynamics of dna-binding domain of myocyte nuclear factor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
101
structure length
101
Chain Sequence
ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and Dynamics of DNA-Binding Domain of Myocyte Nuclear Factor
rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords Myocyte Nuclear Factor
total genus 15
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2a3sA00
4Y13A 3MFKA 4XLNF 1MKMA 4G9YA 5D5XB 4OU0A 2H09A 2RGVA 2VBWA 4KUMA 4I0BA 4EM0B 4MQ9F 1TQIA 2G7HA 2HTSA 2P8TA 2QUFA 3QPHA 4KIFA 1BI2A 5E8GA 4YIIA 2P7CB 4L9TA 3ULQB 3U1DA 4A6DA 4MEXF 2IA2A 6PAXA 3R60A 2QBYB 1W7PB 2HOEA 1R1UA 2XASA 1ZLJA 2E7WA 4BHBA 1OKRA 3N4MA 2NYXA 4IRGA 3GO5A 1J7KA 3T0YA 2Y0MA 1R5HA 1TLHB 4HF0A 3TDUC 1K78A 4ZYGA 3DPTA 5KK1A 1W5TA 1L3LA 1FLIA 1LDDA 5IT3A 1PP7U 4BXUA 4NQWA 3RDIA 3IKTA 1JE8A 4DQ2A 2GZWA 1T38A 5ILVA 1XCBA 3WTTC 1ZAOA 2MA3A 1O3QA 2A6EF 5K5RA 2J5PA 2K27A 3FMSA 4GO1A 2E1NA 2W85A 2L4AA 2QZ8A 4RB3C 5DDGA 2OQRA 3LQRA 3KP6A 3KP5A 2HTJA 2GAUA 3IKVA 2K4BA 1L0OC 1P2FA 3I64A 2DFIA 2ZMEB 4EM2A 4MTEA 3D0SA 2V1DA 1Q1HA 1YW7A 5DUIA 2DI3A 4RGRA 2DAOA 3EUHA 3MWMA 1JHFA 5L3GA 1H9TA 5K1YA 2COMA 1XSVA 2EFQA 3HOTA 3RPQA 4ENKA 3ZN1A 2R7DA 2PQ8A 5ED4A 5FLXZ 4RAYA 4E70A 3QU6A 2EV6A 4P9FA 4PZJA 4M72A 2PFBA 4AIKA 5L3DA 5BMZA 2STWA 1TTYA 3ZQ7A 5HVQC 4PCQA 5D4SA 3FF5A 1KA8A 1B6AA 4BHPA 2GIVA 1C0WA 3KZZA 3HUGA 5J8CA 2X0LA 1X3UA 2EJRA 1F5TA 4QWQA 5FD5A 3TGNA 2MBFA 4IXAA 2V9VA 5FFXA 3L2CA 3I59B 4KFCA 1TQMA 5DCMA 3KP7A 2XRNA 2ZBKA 3CUQC 3PQJA 3EETA 2Q2EA 3RKWA 1W7PD 3NQOA 1BC8C 3KEOA 4RB2C 3ZMVA 2YR2A 4M6XA 4ZH4F 3C3WA 3ABTA 1XN7A 3KFWX 1KQ0A 1PP8F 1ZRDA 3O6BB 1F9NA 5ILSA 5E1XA 2XAJA 3KP3A 1IZ1A 3FXUA 3KLOA 1OMIA 4WXCA 4RGUA 5DV5A 2Z9OA 4UUVA 4AD9A 2D1VA 1ZG1A 4R8HA 1USSA 2R7FA 2FXAA 2QENA 4EJWA 1BIBA 3TKYA 3WE2A 2OAZA 2ZKZA 2CGPA 2GXBA 1YS6A 3MEXA 4OMZA 1STZA 4HF1A 3O3KA 4BH9A 4Q48A 3BWGA 5FO5A 3JTHA 2CW0F 1XSDA 4WXDA 3IRRA 1H9GA 3F6VA 3SQNA 2EK5A 3WTZA 1FYKA 3V7RA 4ENJA 3DV8A 4N9IA 2MH9A 2HEOA 2ISZA 5BQTA 2XHKA 3H92A 4WCGA 4GCVA 1KU9A 1YQAA 3ZMTA 1DDNA 4FX0A 2OU2A 1YIOA 2OZUA 5E17F 1LVAA 2EFWA 2ESHA 1H0MA 2FBKA 5FB2A 3C7JA 1U2WA 2V6CA 2FE3A 1YLFA 4BHCA 3BJAA 2P4WA 1AWCA 3KE2A 4ZYEA 3E5UA 4OIOF 4R1HA 3K1MA 1KYWA 1TNSA 3KEQA 3GFLA 3C1DA 3GW2A 3WU1B 3VFZA 1PUEE 1S7AA 2DLLA 4M71A 3GUDA 2EFOA 2VE9A 1QZYA 5HDGA 1G3SA 3T8TA 1D8JA 4XLPF 1P92A 1BI1A 3NRVA 4M9XA 1MJ9A 2MD5A 4XBFA 1ZGJA 4K2EA 1Z1DA 1E17A 1BI3A 3ROUA 4WK8F 2HFHA 3G73A 3FMRA 4B09A 2EB7A 1Z91A 4A0YA 2NS0A 3WGGA 2O8XA 3BROA 2Z3YA 3D5LA 2O03A 2JPBA 5FD6A 3V7CA 3KLNA 3TDZC 3V8JA 3RI4A 3IRQA 3K0LA 3R0AA 5DYMA 2BE5F 5FGMA 3F8FA 3LAJA 2ZFWA 1MGTA 4WWCA 2AXLA 4LK0F 1E2XA 2A6HF 3SZPA 1CF7A 3BJOA 2K4JA 3TO9A 1D3YA 1P4WA 1R5GA 1TBXA 3F8NA 2LDUA 4EM1A 2FBIA 2FA5A 5BPDA 4U7DA 2GA1A 3I59A 4ENMA 3ZMDA 4UVAA 4U0WA 2KIMA 1TQPA 4BYYA 2P5LC 3DFGA 2G7UA 4IHSA 1VTNC 1ZYRF 1P6RA 4RGXA 1SFXA 5D6EA 3CJNA 4LLGF 5JHUA 4A12A 2L4MA 2MC3A 2HZTA 4IPAA 4CYDA 3T8RA 3I58A 1CF7B 3E6CC 2HQRA 4HBLA 5D5UB 4OOIA 1CGPA 3MCZA 4Z2YA 1DPUA 2Z99A 5HS9A 3JSPA 4IRHA 2YX7A 4A0ZA 3LQQA 2VBZA 3TO6A 1ZRFA 2RVCA 2O6GE 2XVCA 3J81Z 3KZYA 2LKPA 5BPIA 1D8KA 3P9CA 1B4AA 2ZMEA 2L3DA 3RTRA 4TV7A 4ESBA 3V7SA 4IHTA 5HDNA 5LRSA 2ACJA 3ML6A 4LB5A 4HYEA 1FOKA 4FHTA 4KDPA 2V1UA 4CZZA 1UCRA 1BJAA 3V8KA 2JPCA 4CO8A 3WODF 2FU4A 1QNTA 4RB1A 3W6KB 3L7WA 3OOPA 3JW4A 3I71A 5L3CA 1LJ9A 4ZYDA 3DF8A 1SD5A 2JT1A 4CDGA 1O3SA 4Q5SF 3E6DA 1IN4A 3DP7A 2UXNA 1K78B 2IA1A 2VOPA 2HKOA 1KYZA 4I98B 5CVIA 1W7PA 5ICGA 1J2XA 4HOBA 4L5IA 3LAPA 5F64A 4JQFA 3RIRA 1KU7A 3EYIA 2QBYA 3H3UA 3L09A 2UXXA 2Q0OA 5H20A 1JXSA 3P9IA 4BAYA 4FT8A 2K86A 5HDKA 5HS7A 1T2KA 2Y48A 3U9GA 5LHHA 1LQ1A 2IW5A 4KN7X 4LMYA 4LG0A 3RKYA 2DW4A 1XMAA 2ZNZA 2ZO4A 4PGGA 5DEQA 4CGZA 1P4AA 4I01A 4HZFA 5LGTA 1LEBA 3HRUA 1RIOH 2VT2A 4IF4A 2NRAC 3GYHX 3BJ6A 5CLSA 1Z6RA 4F7ZA 4LD5A 1FWZA 3BPXA 3EYYA 3ELKA 1QGPA 3F72A 1G6NA 2IVMA 2H6CA 4WXHA 3C18A 4LLLA 1J9IA 1B1BA 5EEHA 2A68F 2OA4A 2ZXJA 1R7JA 1KGSA 2YX4A 4I09A 4EJVA 3DEUA 1I1SA 5TJJA 4L0ZB 1BI0A 4KICA 2CYYA 1O57A 1D5VA 5D5VB 4HA8A 3GF2A 4A5NA 1SFUA 2DU9A 1XD7A 2RV8A 1WQ2A 2VC0A 2J5OA 3WTYC 2X4HA 2P6SA 4QLCU 4HF2A 4LG0B 2DTRA 3WGHA 2A69F 1TNTA 3SHFA 4OIQF 1FC3A 3SFZA 2BV6A 2IPQX 3TOAA 1R1VA 4MHGA 1I6XA 2F5FA 2DPDA 3E97A 3GFIA 2HKXA 3H3ZA 3QP5A 1REPC 3QPTA 1BN5A 1WRJA 5L3BA 1ZHFA 3HSEA 4HX7A 1BOAA 2M8EA 1RNLA 4KMUX 1FP2A 1BBYA 2K7LA 1ZREA 2W84A 3FX3A 1S29A 1LB2A 2XGXA 2CO5A 4ZZLA 2FBHA 3LWFA 2HS5A 4EJUA 3IC7A 1V3FA 2BGCA 4EVIA 2W57A 4EJTA 2W25A 2YPRA 4ON0A 3F23A 5ICFA 2FEZA 2NAZA 3CTAA 2V79A 1B9MA 1MZBA 3IL2A 4ESFA 5LBQA 4KIBA 2GA2A 5D8KB 4Y17A 1P4XA 2P5VA 3W6JB 2HWVA 2AS5F 2PI0A 1U5TC 3F8BA 3CO7C 4UXNA 5FFZA 2ADUA 3ABUA 5LEJA 1FBSA 4KA4A 3R61A 1I1GA 2F5CA 3F3XA 5DCMB 2DPUA 2A61A 4N0BA 3B73A 5DD8A 3R0JA 1NHAA 1J5YA 5ICCA 1IN8A 2DT5A 3SZTA 4YIFA 5HOOA 5CJ9A 1UB9A 4WF2A 1UFMA 5JFRA 3GFMA 1HQCA 1MD0A 3BP8A 2W24A 3BPVA 2PBIA 1IRGA 3FXQA 3K1PA 4RB0A 4YG2F 2XAGA 2TDXA 2CWEA 3K69A 4HV6A 4L5JA 2A5YB 3COAC 4LLNA 1Z6TA 1QQIA 3ECHA 2CSOA 2JTVA 3K2ZA 4G6DA 3Q5FA 2GQQA 3U2RA 2FNPA 2RNJA 4OIRF 5A2QK 4LJZF 2FMYA 2XIGA 1U3EM 4UVCA 3VOEA 4GXOA 1U78A 1V4RA 3HHGA 3J7AO 1SD4A 5BS6A 2Z5UA 3I54A 2P6TA 4P5OA 3V4GA 1GXQA 1HW5A 2K02A 3VB2A 4CHUA 2XAQA 2VE8A 1HKTA 3P9KA 5DUKA 2PMHA 1QO0D 5KVRA 1SD7A 1OYYA 2A3SA 5CVVA 4AVPA 2OQGA 1EH7A 1F4KA 1OR7A 4JK1X 1FPQA 3HRSA 3WTWC 4UNOA 2NNNA 2P5KA 4M6YA 1RUNA 1ZN2A 3ZP5A 4Y15A 2A07F 2V1XA 2ZJ2A 3TOBA 2MLKA 2PMUA 3HRTA 2QYOA 4EV0A 3LA2A 4HW0A 5IT9K 2FMLA 2VT3A 5CVUA 2XROA 2M45A 3ZMZA 4L9VA 4S05A 5H6RA 5TRDA 2D2WA 2IJLA 1YG2A 1I27A 4NHJA 3M1EA 3VODA 2QQ9A 5E20A 4L9JA 5F1RA 5K5QA 2HYFA 2VXZA 4IRIA 3OV8A 4MTDA 1FBQA 2ETHA 3R4KA 1HXDA 3LFKA 2IRFG 1QPMA 3WTSC 1ONVA 2PG4A 1WKMA 4HX4A 2HGCA 1KQ9A 1OPCA 2E1CA 3BDDA 3IWFA 3RKXA 1T0FA 5CYVA 4L0YB 3I5UA 2PEXA 2EFNA 3T5XA 2ESNA 4S04A 2LSOA 1ODDA 4Q4ZF 5LGNA 1YFHA 2Y75A 1T98A 4HV5A 2KRFA 4RGSA 5K5OA 3FM3A 1BIAA 4U0VA 2O0YA 2OZ6A 1W4MA 2R3SA 4R79A 2ZNYA 4L9NA 3JTGA 1TW2A 3FM5A 1IF1A 3R6SA 2F5DA 1J0RA 2XV4S 2JSCA 2NNYA 3IHUA 2EFPA 5H6QA 3F8CA 5E18F 4HQMA 3B02A 5JI6A 1AOYA 1XDSA 1EH6A 3QAHA 1K79A 4LFUA 2KIUA 4HDVA 4MQVA 5DCFA 5HLGA 4O6JA 1FT9A 4U7BA 2ZCWA 3E3VA 4MGRA 2GXGA 3F8MA 1T6SA 2FSWA 1W5SA 3EQLF 5LRRA 1QBJA 2LNBA 3HSFA 2MH2A 3JAMZ 4U0YA 2VOOA 4HLYA 4P96A 2IT0A 1IN5A 2XKPA 3FWEA 4A6EA 3J81K 2DK8A 3QOPA 3HYIA 1Y0UA 5F6FA 4KNYA 3HOSA 2XAFA 2L02A 4O5VA 3FMQA 2WTEA 1XCVA 3F22A 4A5MA 2B0LA 3WTXC 2CQKA 2F5EA 2IP2A 4I7HA 1ZARA 2FRHA 4WX9A 3GZ5A 3PFIA 4AWXB 1IXRC 1HKSA 4I0AA 3TO7A 5LHGA 1HSJA 1HSTA 1SMYF 4EJOA 1XGOA 5D4RA 3ECOA 4UV8A 2LF8A 1FBUA 3E6BA 2Z33A 4JBAA 2XKOA 1GVJA 5LLQA 1YO5C 2Q8KA 1R00A 4IVNA 2BEOA 2FQ3A 2KJBA 2XAHA 3MQ0A 1HBXG 2HYGD 1JHHA 3GLXA 1XGNA 4A2UA 1BM9A 1GHCA 5AIQA 1LDJA 5ICEA 1FP1D 2LF7A 2CFXA 1LDKB 1J75A 4M74A 5AONA 4GGGA 1DPRA 3QP6A 1MDMB 1R22A 3CUOA 1MJAA 2VONA 4CICA 1U6GA 3ZMUA 4EGZA 4HX8A 4EMSA 4M73A 3ERED 3S2WA 4ETSA 1EV7A 2QM3A 2M30A 3P7NA 1A04A 4B8XA 3RJPA 3LSTA 5AIPA 3CUQB 4ENNA 1EH8A 4M9SA 4YFXF 3RPUA 1FYLA 1G4DA 1HKQA 1KQ8A 3GEZA 1XGMA 4XSZF 4I02A 2OBPA 2EV0A 3JAMK 1YYVA 4ZYHA 1QZZA 4HLXA 1XMKA 2FF4A 1BC7C 2XUBA 4BNCA 2L01A 2CG4A 3NEUA 4G7ZF 2WV0A 3WGIA 3M7GA 2VC1A 1USTA 2UWMA 4G94A 4XRFA 1XB4A 3REOA 3DPLC 4IJAA 1O3RA 1O7FA 1U8RA 1RZ4A 3GWZA 3V8LA 4ZZDA 3FHZA 2YSRA 2UZKA 1U5TA 1IXSB 3E5XA 1WSUA 1DP7P 2EV5A 1UHWA 3CUQA 1ON1A 1K6OA 1G3WA 5CVJA 1T39A 2QLZA 4PDKA 3MZYA 4KN4X 4M9ZA 4A0XA 1ZG3A 4L18B 2L54A 1FSEA 1I5ZA 1ZRCA 1UHMA 3DQVC 1DUXC 4UV9A 1FZPB 2DK5A 1Z7UA 1WI9A 4YFNF 3JSOA 3BY6A 2O3FA 1OYIA 5E1WA 2DQRA 1ZH5A 2VN2A 2QWWA 1IXCA 4P55A 1O7LA 1PDNC 1JGSA 1HW2A 2EA4A 2HDCA 3ZPLA 1IAWA 1G3TA 4EQQA 5E8IA 4HQEA 3IWZA 1R58A 1U5TB 2EA2A 3HTUA 4OINF 3CLOA 4U88A 1S3JA 2KKOA 3WTVC 3L9FA 1YW9A 3QU3A 3O2PE 2RQPA 3FZVA 2GWRA 1KU2A 4D0PA 2BYVE 4UVBA 1IW7F 1FSHA 3M9AA 4KYWA 5IT9Z 2KIFA 3E6MA 3WTUC 3FXRA 4XSXF 3Q9SA 1ON2A 2RN7A 3K1NA 1SFEA 4CXFA 1IN6A 3WE3A 3ZMSA 5D6FA 1IUYA 1ZG5A 5FLXK 4MNUA 2ELHA 3CDHA 3HTSB 1S8NA 1J59A 3F6OA 5HS8A 1Z9CA 4UHTA 1FYMA 3G3ZA 5DD4A 2MLGA 2RKHA 2HR3A 1S7OA 5HLIA 1YS7A 1KU3A 3WG9A 2O61A 3EDPA 1ZLKA 4ESJA 4PGHA 2H27A 1ZGAA 3MAJA 2VBYA 4G8XA 5A2QZ 4OMYA 1SMTA 1R36A 1O3TA 3RYRA 1RUOA 1LNWA 4EGYA 1MDMA 3GZ6A 2KJCA 1B9NA 2P7VB 2VBXA 5L3FA 1K7AA 3N97A 2QQAA 2IA0A 2YU3A 1TW3A 1S6LA 5JR3A 4FX4A 2QVOA 1F1ZA 1ULYA 2EWNA 4LGWA 5J8FA 5JVTA 2D45A 3I0TA 3LA3A 3AAFA 5LEKA 4H0EA 1FY7A 3M8EA 3PQKA 1RI7A 1IN7A 2FOKA 1FNNA 3BOQA 4KMFA 4RAZA 3BZ6A 3GVAA 5BOXA 2QQBA 2H6BA 3E5QA 2H94A 1XSXA 4I2OA 5EEGA 3T1BA 2RDPA 4YFKF 3K9TA 4BQAA 3DXJF 3TQNA 2WWYA 3HSRA 4Q47A 1OYWA 2M1BA 5HLHA 4AIHA 5L3EA 3QRFF 2PLYA 5CVRA 3M8FA 5J6XA 4MEYF 2DO7A 2JRTA 4G7HF 3L00A 2FNAA 4N9HA 1IRFA 2PJPA 4ASNA 1WWXA 3HHHA 4KT5C 5ERIA 2C6YA 1MJBA 5D8LB 3KP2A 3KP4A 3HIFA 4AIJA 1FX7A 1HW1A 3I4PA 4KIGA 2RC4A 4LB6B 3LA7A 1XGSA 3HRMA 1G3YA 2D1HA 3SXYA 2OD5A 2M5WA 4GYIA 3J80K 3ISPA 3CO6C 2BBYA 3I53A 1SAXA 1R1TA 4HDUA 1Z05A 4DNCA 4P9UA 3RYPA 5ILUA 3MZHA 5LHIA 1XDUA 3GXOA 3GFJA 2F2EA 5E1ZB 3ZN0A 1YW8A 1YTYA 3KCCA 1B59A 2E7XA 4NB5A 1R23A 2HQNA 4HAMA 4LK1F 2DQLA 2VODA 4G7OF 4G6QA 2G9WA 2ISYA 2M87A 4OIPF 5LGUA 3GX4X 2JZYA 4GYGA 2PN6A 4O3MA 2DBBA 3WU0A 3VEPA 3J80Z 5D5WB 3Q9VA 4RS8A 3F21A 2STTA 1LEAA 3KETA 1GXPA 2WC2A 3DKWA 1SD6A
chains in the Genus database with same CATH superfamily
1RESA 4Y13A 3MFKA 3L2QA 2HXIA 2VI6A 4XLNF 1MKMA 4G9YA 5D5XB 2HQAA 4OU0A 5JHFA 2EZIA 2G0EA 2GOMA 2H09A 2RGVA 3I9V2 2VL8A 1X3ZB 3VDXA 2VBWA 3QODA 1Y1WJ 4KUMA 4I0BA 4EM0B 4MQ9F 1TQIA 3C2BA 2G7HA 3LSIA 2HTSA 1RR7A 2P8TA 2QUFA 3K70C 3QPHA 4X1EA 4KIFA 1BI2A 1K6YA 2XF6A 5E8GA 4YIIA 2P7CB 1JUSA 4L9TA 3ULQB 4A3DJ 5JLWA 3U1DA 4A6DA 4XKWA 3VYRB 4MEXF 2IA2A 4Y33A 2FQ4A 6PAXA 3QOEA 2ZSIB 3R60A 2QBYB 1W7PB 2HOEA 1R1UA 2CQXA 4CCLA 1GVDA 3C2HA 2XASA 1S9HA 1X1DA 2XB5A 1ZLJA 4XQFA 4X0GA 2E2JJ 5C44J 3MKYB 2E7WA 4BHBA 1OKRA 3N4MA 2NYXA 3ZGKA 4IRGA 3GO5A 1J7KA 3T0YA 2Y0MA 1R5HA 2LRDA 1TLHB 3B6AA 1OR7C 4HF0A 3PIPF 3TDUC 1K78A 1YJNI 2DT6A 4ZYGA 1QA6A 3DPTA 2DXIA 1G59A 1A35A 4F3QA 3OYCA 3JREA 4IHYA 2Y69H 5KK1A 1W5TA 1L3LA 1RR8C 3KYCB 3VPRA 1RC9A 2R7VA 4C2TA 3Q0VA 1FLIA 3DKYA 4A3KJ 1X4OA 1BJZA 1LDDA 3VYUB 2ZC2A 5IT3A 1PP7U 4BXUA 2IS1A 4NQWA 3RDIA 3IKTA 1MNDA 4C9YA 3HC7A 2QEXI 1UELB 1JE8A 4F92B 4DQ2A 2GZWA 4CCNA 3DLLF 1SEUA 1T38A 3QYEA 5ILVA 1XCBA 3HBLA 3WTTC 3BG3A 3BG5A 1ETKA 4PJLA 1ZAOA 2Y30A 2MA3A 1O3QA 2A6EF 4LITA 3BTLA 5K5RA 4BE2A 5E3MA 2J5PA 2K27A 3K10A 2KISA 3FMSA 2M0CA 3AG1H 2ECBA 4GO1A 5EGOB 2LBFB 1M1EB 2E1NA 2W85A 1FOYA 2L4AA 2QZ8A 1GT0C 3RSNA 4RB3C 5DDGA 2OQRA 3DTIA 3LQRA 3KP6A 3KP5A 4F55A 2HTJA 1VNDA 2A5WA 2GAUA 3K4JA 3IKVA 4NC8A 2K4BA 1T8IA 2LMDA 3SEZA 1L0OC 1P2FA 2VQGA 3I64A 2H8RA 2DFIA 2YU9J 2ZMEB 4EM2A 4MTEA 1ETXA 3CJTB 4AYBN 3D0SA 2LKXA 2V1DA 1WJCA 4XONA 1XX5A 1Q1HA 3HOVJ 1JT6A 1YW7A 1B8IA 1EJ9A 5DUIA 1YITI 2DI3A 4OAYA 4RGRA 2DAOA 5K7HA 1E3HA 1WGXA 2CS3A 3EUHA 2LY9A 3MWMA 1JHFA 5L3GA 1H9TA 5K1YA 2HPIA 2KLOA 3EUAA 1MMGA 2COMA 3G1OA 4B48A 1XSVA 3C2GA 2EFQA 1MBKA 3HOTA 3RPQA 1YX5A 4ENKA 3ZN1A 2R7DA 2DOEA 1EKEA 2PQ8A 1SVLA 5ED4A 1VQ7I 5FLXZ 4BDYA 3JRDA 3OYGA 4RAYA 2M8GX 4E70A 2X6OA 3CC7I 3QU6A 3CF5F 3G1MA 3LSGA 2VKVA 2EV6A 4P9FA 4PZJA 5K7FA 3L2RA 4M72A 2PFBA 3AG2H 3WG7H 4AIKA 5L3DA 3K4BA 5BMZA 2STWA 1TTYA 1GLNA 3ZQ7A 2CV2A 5HVQC 1A5JA 1BA5A 2F5VA 4PCQA 5D4SA 3FF5A 1KA8A 1B6AA 2EQRA 2FD5A 3FBNB 1T08B 2R5YB 1TC3C 4BHPA 2GIVA 2R7WA 3KZZA 1C0WA 3HUGA 5J8CA 4E7ZA 3PSFA 3D5RC 5EZHA 2LP0A 2X0LA 3TP3A 1X3UA 4A3GJ 2EJRA 1F5TA 4QWQA 5FD5A 2HU9A 2KMUA 2MBFA 4IXAA 3TGNA 1OCCH 2WAFA 2V9VA 5FFXA 4E4HA 4RM2A 3S8PA 4A3IJ 3L2CA 2XC7A 3I59B 4KFCA 1TQMA 4NBQA 5DCMA 2F4OB 3KP7A 2R5ZA 2XRNA 2ZBKA 3HB9A 3A4CA 3H0DA 3CUQC 3PQJA 1ERDA 3H9QA 1W36D 1VQ8I 1V5FA 3EETA 2Q2EA 3RKWA 2CH0A 1W7PD 3NQOA 5HNHA 3HPGA 2HPMA 1BC8C 2R7RA 5M5YJ 1Z3YA 3KEOA 2E34A 2NVUB 2W48A 4RB2C 3ZMVA 2YR2A 5FKNA 1ZR2A 5FLVA 2HI3A 3LNQA 3G6EI 3OSGA 4M6XA 4ZH4F 3C3WA 3ABTA 1XN7A 3KFWX 1KQ0A 1PP8F 1ZRDA 3IP4B 3ZR8X 4IZZA 3O6BB 1F9NA 4MLOA 5ILSA 1OCPA 4YIRX 1IG7A 2CUEA 5E1XA 3ZQLA 2XAJA 1LE8A 1R4NB 3A02A 3KP3A 4B3AA 3HOXJ 1IZ1A 3ZOBA 2MD0A 3FXUA 2COBA 3KLOA 1OMIA 4WXCA 2O9LA 2F4IA 4RGUA 5DV5A 2Z9OA 3CCRI 4UUVA 4AD9A 1Y1VJ 2D1VA 2DN0A 3HDDA 1ZG1A 1KONA 1Z3XA 4R8HA 1USSA 2KRCA 2R7FA 4JYKA 1XTAA 2IGMA 4D9JA 2FXAA 2QENA 3Q0WA 4EJWA 1BIBA 1XC5A 3TKYA 3WE2A 2OAZA 5GADJ 3BG7A 1DQUA 2WAQN 2ZKZA 4C3JJ 1YS6A 3K4LA 3MEXA 4OMZA 5BNGA 2CGPA 3CCLI 2GXBA 1STZA 4HF1A 3O3KA 4D7NA 1ETOA 5IOYA 4AUXA 4BXXJ 3OR2C 4Q48A 4BH9A 3OYDA 2F6CA 4BE1A 3A01A 3K70D 3H5AA 5IYCJ 3BWGA 5FKKA 5FO5A 4GDFA 3JTHA 2CW0F 2L7ZA 1XSDA 2W00A 2LLKA 4WXDA 3GCMA 4XLHA 4ZTFA 3HGGA 3IRRA 1H9GA 3F6VA 3SQNA 2EK5A 3WTZA 1FYKA 1UG0A 2CUJA 2CW8A 3V7RA 3S3MA 5TGTA 4ENJA 3DV8A 3W2WA 4N9IA 2MH9A 2HEOA 3DBLB 2QKMB 2ISZA 1HDDC 4BU2A 5BQTA 2XHKA 5CKTA 3H92A 4WCGA 9ANTA 2DDBA 4GCVA 4UUSB 1MBFA 1KU9A 3L1PA 1YQAA 2K3PA 3ZMTA 4FX0A 4DBRA 2OU2A 2XGDA 1YIOA 2OZUA 2VJ5A 1DDNA 5E17F 2LOOA 2IS2A 1LVAA 3MKLA 4ZDOA 2EFWA 2ESHA 1H0MA 2FBKA 5FB2A 3C7JA 3CMMA 1U2WA 2IGOA 2V6CA 2FE3A 1YLFA 3NARA 3A03A 4BHCA 1W0UA 2TRTA 3BJAA 2P4WA 2HOSA 1T95A 2ME0A 2VJ4A 4DZPA 1AWCA 3KE2A 1ORKA 4ZYEA 1IV8A 3E5UA 3OYIA 4YELA 1XMXA 1IGNA 1Z21A 4OIOF 3M8JA 5IOZA 4C3HJ 2DMQA 4R1HA 3K1MA 1KYWA 1TNSA 3KEQA 3GFLA 3C1DA 3GW2A 1EF4A 4II2A 3WU1B 3VFZA 1PUEE 1DU0A 3I4NJ 1Y8QB 1S7AA 2DLLA 5J1RA 3QYFA 4M71A 3GUDA 1QRYA 3OYMA 2EFOA 2VE9A 1QZYA 2DT7B 3SJMA 2NS7A 4XORA 5HDGA 1G3SA 2VKHA 3T8TA 1D8JA 2LFBA 4XLPF 1P92A 3MZ8A 5M3FJ 2AXTC 1BI1A 3NRVA 2DJNA 5FRMA 4M9XA 3OYNA 2XPWA 1MJ9A 2MD5A 4XBFA 1ZGJA 4K2EA 4NC6A 1Z1DA 1E17A 3VYSB 3EUHC 1BI3A 3LMMA 5KCMA 3ROUA 4WK8F 2HFHA 4PJNA 2DYRH 2OCCH 3G73A 1QZEA 3FMRA 4HNVA 3HGYA 1MBJA 4B09A 3I4MJ 3OYEA 1JKOC 4LOCA 2EB7A 1Z91A 4A0YA 3M3YJ 2NS0A 3WGGA 2O8XA 4ZTJA 3BROA 3FISA 2Z3YA 4CYCB 1X1AA 2NVYJ 3D5LA 2O03A 4C2UA 2KRHA 2VJJA 4HSTA 4XR6A 3OY9A 2JPBA 1VQOI 2EIJH 5FD6A 3V7CA 3KLNA 3TDZC 3V8JA 3RI4A 4IOCF 3OMYA 3IRQA 1JKPC 2GIZA 4D7MA 3U1KA 5KNLA 3HZJA 3K0LA 3R0AA 5DYMA 2BE5F 5FGMA 2BY2A 3F8FA 3LAJA 2QSFX 2ZFWA 1UAAA 1MGTA 1Y6IA 2VASA 1YX3A 2TCTA 3FXJA 2BVMA 4WWCA 2AXLA 4LK0F 1E2XA 4CUGA 2A6HF 3SZPA 1CF7A 3BJOA 2ZSHB 2Z1DA 2K4JA 3TO9A 1D3YA 1P4WA 2E5ZA 2KP6A 1R5GA 2HDDA 2JMWA 3S2DJ 2K85A 1TBXA 3F8NA 1IC8A 5C4XJ 4BE0A 2LDUA 2QSGX 1Y56A 4FE4A 4EM1A 1UZCA 1P7IA 2FBIA 1KZHA 2FA5A 5EJCA 4U7DA 5BPDA 4E7LA 2GA1A 3I59A 4ENMA 1N77A 1V5GA 3ZMDA 1R9TJ 4UVAA 2IXSA 4CCKA 4U0WA 4J01A 2KIMA 3TW7A 4C2MJ 1TQPA 4BYYA 2P5LC 3DFGA 4GFBA 2G7UA 4IHSA 3HEFA 5E79C 1VTNC 3PM1A 1ZYRF 2LY2A 1P6RA 4RGXA 1WHUA 1SFXA 3DCFA 5D6EA 3CJNA 4LLGF 3GBGA 5JHUA 4A12A 2V6EA 2L4MA 3CCUI 2MC3A 2HZTA 4DJAA 4IPAA 4CYDA 3T8RA 4A3LJ 1X3WB 3I58A 3JRFA 2L9VA 5EF6A 3E6CC 3BQYA 3CP8A 1CF7B 1S5LC 2VUMJ 1ZTRA 2HQRA 3PUFA 4HBLA 2ID6A 3L2UA 5D5UB 4OOIA 3DKXA 1CGPA 3CP2A 3MCZA 4Z2YA 1DPUA 5HODA 2Z99A 5HS9A 3TW6A 4BKXA 3JSPA 4IRHA 2YX7A 4A0ZA 2HYJA 5E3LA 3OYLA 1TL8A 3KEYA 4S0HB 3LQQA 2VBZA 4P1WA 3TO6A 1ZRFA 2BW3B 4I99C 1YOVB 4FQGA 2RVCA 5GP9A 4ZYAA 3J7ZI 2O6GE 1VQKI 2XVCA 3J81Z 3KZYA 2LKPA 5BPIA 4KITB 1UJ8A 2ELJA 4A69C 1D8KA 2XF5A 3P9CA 1Y39A 1B4AA 2ZMEA 2L3DA 3RTRA 1CQTA 4TV7A 1U9NA 3HOZJ 4ESBA 2MYSA 3JRCA 3V7SA 2HQ5A 4IHTA 5HDNA 5LRSA 2ACJA 3ML6A 1K4TA 4LB5A 1HDPA 4HYEA 1D0XA 3TL4X 1FOKA 1VZ0A 4FHTA 4KDPA 4A3FJ 2V1UA 4CZZA 2OPTA 1UCRA 5DM7F 1ACIA 3O8GA 1JJ6C 1BJAA 4H4KC 1JTYA 3V8KA 2JPCA 4CO8A 2WBMA 3WODF 2FU4A 1QNTA 2M0MA 4RB1A 3W6KB 3L7WA 1Q1VA 2X6XA 1D1AA 3OOPA 4A93J 3S3OA 3JW4A 5IYDJ 3I71A 5L3CA 4HEA2 5GTHC 2F48A 1LJ9A 1K4SA 4B44A 4ZYDA 3DF8A 5K7ZA 1SD5A 2JT1A 4CDGA 4Y52J 1O3SA 1LFBA 4Q5SF 3E6DA 4M3BA 2XSJC 3S17J 1IN4A 1YJ9I 3DP7A 3O8HA 2UXNA 3OL4A 3RPUD 5M5WJ 2HVSA 1V54H 4QIWN 2XGEA 1K78B 2E1MC 4AVZA 2IA1A 2FX0A 2O5RA 3H5NA 3H9JA 2VOPA 2HKOA 3H36A 5F0HA 1KYZA 4I98B 5CVIA 3IH2A 1W7PA 3CCQI 5GPAA 3G1LA 1J2XA 4IQ4A 5ICGA 2CJJA 2MW8A 4HOBA 4IL6C 4L5IA 5F0CA 3S93A 3LAPA 3QPSA 2E60A 1XS9A 1TWFJ 3FK6A 5F64A 2VIXA 3D5SC 4JQFA 3RIRA 3OL3A 2LTPA 1IDYA 1KU7A 2NVXJ 3PNTA 3EYIA 2QBYA 3H3UA 3FXKA 3PNYA 3L09A 2UXXA 2Q0OA 5H20A 1JXSA 3P9IA 4BAYA 4FT8A 1UHSA 1X2NA 2IAIA 3DU6A 4D5CA 2K86A 5HDKA 2JA5J 5HS7A 1T2KA 2Y48A 3U9GA 4ZC3A 5LHHA 2OCEA 3KX2A 2ZJPF 1LQ1A 2IW5A 4KN7X 4LMYA 1R6RA 1U8BA 3N05A 2K9MA 4LG0A 3OS2A 3RKYA 2L9NA 3EUKL 2DW4A 1XMAA 1HLVA 2ZNZA 2ZO4A 4PGGA 5DEQA 2QA4I 4CGZA 1P4AA 4I01A 1OQYA 2KL4A 5TISC 2DOAA 4HZFA 3GTGJ 4BQNA 5FJ8J 2DOFA 5LGTA 4BGDA 3HRUA 3S16J 1LEBA 1SC7A 3S15J 2XRLA 1RIOH 2VT2A 4JX6A 4L5EA 1BOBA 4IF4A 2NRAC 1I50J 2JJ7A 2R7ZJ 3IV5A 3CDLA 3GYHX 2EIMH 3BJ6A 5CLSA 2E2IJ 1Z6RA 4F7ZA 4DYQA 4LD5A 1FWZA 4A3CJ 3BPXA 3K4NA 3J7YJ 5CQEA 3EYYA 3UNGC 3ELKA 1APLC 1QGPA 3F72A 4RAFA 4UB6C 1G6NA 2IVMA 5FKLA 4V2FA 3GTJJ 2JA6J 2H6CA 2DA4A 4ZJZA 4WXHA 3C18A 4LLLA 1J9IA 1B1BA 5EEHA 2A68F 2OA4A 1WH7A 2ZXJA 1JUPA 1NG6A 1R7JA 1KGSA 2YX4A 4F91B 1F36A 4I09A 2M7BA 3RQ4A 4EJVA 1FOWA 3GTMJ 2VB6A 2WB1A 3DEUA 2JVGA 3GTQJ 1I1SA 1JTXA 5TJJA 4L0ZB 2LH9A 2B9SA 1FOXA 4Z6YA 1BI0A 2CUFA 4V19K 2X48A 1XG1A 2MSYA 2EZKA 4KICA 2CYYA 5GTIC 1O57A 5FRNA 1D5VA 5D5VB 4HA8A 3GF2A 4A5NA 1SFUA 1VQ5I 2M3AA 1H8AC 4DW6A 2JUGA 2DU9A 3ZQHA 5KAFC 1B72B 1XD7A 2VQHA 3G4SI 2RV8A 1WQ2A 2WB1N 2VC0A 3PNVA 2J5OA 1WFXA 3WTYC 1Z7LA 4FASD 3BLYA 3OOUA 1U0JA 2P6SA 2X4HA 4QLCU 4HF2A 4LG0B 2DTRA 3WGHA 1TWAJ 3GTPJ 2A69F 1TNTA 3SHFA 4OIQF 1ZR4A 2L9SA 3RZOJ 3IUOA 1FC3A 4XNFA 3ABKH 3SFZA 2BV6A 2IPQX 2KDOA 2EZHA 3LSMA 1NH3A 3TOAA 1R1VA 4AC0A 1SFOJ 1OCZH 4MHGA 1I6XA 2V9PA 2F5FA 2DPDA 3E97A 2Y31A 3GFIA 4E6KG 1OFCX 2HKXA 4UY8I 5DS9A 4F52A 2NOJB 2E5NA 3FXOA 5DM6F 1D1CA 5EDNA 3OYKA 2Q1ZB 2L9RA 1JUMA 3H3ZA 1SANA 3QP5A 2HOTA 2QQ8A 3UR3C 2QSHX 1REPC 1AKHB 3QPTA 1WZ2A 1IJWC 1BN5A 2VQCA 3P5JA 2R7UA 2GXAA 3F0CA 2K9NA 3A0BC 4XOTA 3JR9A 2IBDA 2DFHA 1WRJA 5L3BA 4IHWA 1ZHFA 3HSEA 4HX7A 1BOAA 2M8EA 1RNLA 3K2AA 3RKQA 4KMUX 2CU7A 1FP2A 3OIOA 1BBYA 1MBEA 3WU2C 3X2QH 3BQZA 2K7LA 4PK4A 1ZREA 4F93B 2W84A 3FX3A 1S29A 1VQ6I 1LB2A 3BR6A 3AG3H 2XGXA 2CO5A 4ZZLA 1TT0A 5JLXA 5EG0B 3OSFA 1IDZA 2FBHA 3LWFA 3HL2A 4U87A 3ZQCA 2HS5A 4HSRA 1A36A 1WCMJ 2MC4A 3BZKA 2L5QA 4EJUA 1V55H 3IC7A 1GV5A 1V3FA 2BGCA 4BBSJ 4EVIA 2W57A 2LD5A 2YPRA 2W25A 4D5FA 4ON0A 3F23A 1JKQC 2L0KA 4EJTA 5ICFA 3ESWB 2FEZA 3JCUC 2NAZA 3CTAA 4PSXA 2V79A 1B9MA 1MZBA 3IL2A 4ESFA 4QPOA 5LBQA 4KIBA 2GA2A 1MBGA 3TMOA 4XOPA 3AKZA 3KYDB 3BCBA 1QVUA 5D8KB 4UUTA 3WHCA 4Y17A 1P4XA 1TT5B 2P5VA 3CCSI 3DEEA 3W6JB 2HWVA 2X1EA 3AFHA 3H3VK 3Q3SA 2AS5F 2PI0A 1YRNA 2Y9ZA 1U5TC 1MSFC 2XF7A 1FIPA 3F8BA 1SFKA 3CO7C 4UXNA 5FFZA 2QKLB 2ADUA 3VSKA 3ABUA 1OLTA 4HRIA 4MFEA 1MMSA 1NG7A 5LEJA 1FBSA 4KA4A 2UV1A 1E3OC 4KT6A 3BC8A 3R61A 4XRSA 1I1GA 2F5CA 3F3XA 2H8WA 5DCMB 2DPUA 2FOWA 5F1JA 5J4YA 3L2VA 2R7XA 2A61A 4XN0A 4RBOA 3BR2A 4N0BA 3OYAA 1AA7A 2IEKA 2VPRA 3CMAI 2LREA 3B73A 5DD8A 3ZXSA 2Z16A 1JJ8C 3R0JA 1NHAA 3QWLA 2P0WA 1J5YA 5ICCA 1IN8A 2DT5A 4M6VA 3SZTA 3ZRGA 3ZQIA 4YIFA 1POGA 4JX4A 3PL8A 5HOOA 3VSLA 3ABMH 5CJ9A 2WY8Q 1UB9A 4WF2A 3S32A 2EPFA 1UFMA 5JFRA 3GFMA 2L7KA 3Q0UA 3PO2J 1HQCA 5F27A 3FHNA 3AL0C 1MD0A 3BP8A 2W24A 3BPVA 2P81A 2PBIA 3JRHA 1MW7A 1IRGA 4GRIA 4BY7J 1SVMA 1SAUA 3CMEI 3FXQA 3K1PA 4XRMA 3I3LA 4RB0A 1OCOH 3CCMI 4D1QA 4PJ0C 1DGRM 3OR1C 4YG2F 3BZCA 3QPLA 2XAGA 2DA7A 3PFYA 4OWRB 2TDXA 2K9QA 2CWEA 3S1MJ 3LL7A 3K69A 3SDBA 2R93J 4HV6A 4L5JA 2A5YB 3COAC 4M3EA 4LLNA 2YUSA 1Z6TA 1E3PA 1QQIA 3IAS2 3KIOA 3ECHA 2WV1A 2L2OA 2CSOA 4MFDA 2JTVA 3ASNH 1YRNB 3AL0B 3CCJI 1YHQI 4IHXA 2LR8A 3K2ZA 3LSJA 4G6DA 3Q5FA 1QVTA 1PUFA 1R49A 1ZK8A 4Y3OA 1E0EA 3OS1A 1EA3A 3JRIA 2DFEA 1YI2I 4IEJA 2GQQA 3U2RA 2ZXHA 2V4JC 2FNPA 2RNJA 4OIRF 5A2QK 3PO3J 4LJZF 4FTHA 2FMYA 2XIGA 4XICA 1U3EM 3S1NJ 3NWSA 4UVCA 1MMDA 1UG2A 3VOEA 5F0FA 2F4MB 4GXOA 2DA3A 1U78A 1V4RA 2XSDC 4DGWB 3HHGA 4C3IJ 3J7AO 1SD4A 2K3FA 3ZQQA 5BS6A 1MSEC 3SEQA 1NTCA 2Z5UA 2JVHA 4E7KA 5C3EJ 4EEFG 3LSRA 3EPZA 4XM3A 2WADA 3I54A 3E1SA 2P6TA 5B5EC 4PFPA 4P5OA 2X6WA 3FIWA 3V4GA 3DTKA 1X1PA 2OTLI 1GXQA 1ETVA 1HW5A 2K02A 2IGNA 3K7AJ 3VB2A 2V1NA 1A31A 4CHUA 2XAQA 2VE8A 1HKTA 3P9KA 4BQOA 5DUKA 2PMHA 1R4MB 1QO0D 5KVRA 1SD7A 5EGOA 4HNTA 2I8DA 1OYYA 2A3SA 5CVVA 5EG0A 4AVPA 2OQGA 1EH7A 2ZB9A 1F4KA 1OR7A 3E0JB 4JK1X 1FPQA 3HRSA 2E2HJ 3WTWC 4UNOA 4IO9F 2NNNA 2P5KA 4M6YA 2CUZA 2JK3A 3BTJA 1RUNA 1ZN2A 3CQZJ 4YEJA 4Y15A 3G71I 3ZP5A 4Y7NJ 2A07F 2V1XA 2WY7Q 2ZJ2A 3TOBA 2E71A 2MLKA 2PMUA 4IOAF 3HRTA 1X1CA 2QYOA 2RAEA 4EV0A 3LA2A 4HW0A 1A6QA 3WHBA 5IT9K 2FMLA 4PJMA 2VT3A 5CVUA 2XROA 2M45A 3ZMZA 4L9VA 4S05A 2RREA 2JSPA 5H6RA 2BXZA 5TRDA 3J7AY 2D2WA 2IJLA 1YG2A 1I27A 5H2FC 3RQIA 1LFPA 1TWGJ 4NHJA 3M1EA 1JGGA 1H89C 3VODA 5IY5H 2QQ9A 5E20A 1ZQ3P 4L9JA 2B63J 5F1RA 5K5QA 2HYFA 2RQQA 2DYSH 2ICWG 2A05A 2M34A 4ITVA 2VXZA 4IRIA 4N4NB 3OV8A 4MTDA 1FBQA 2H1LA 2ETHA 1GV2A 4C30A 3R4KA 2JN6A 1HXDA 3LFKA 2IRFG 3JRAA 1QPMA 3WTSC 5GAEJ 1ONVA 2PG4A 2HZDA 1V5EA 3CDIA 1WKMA 4HX4A 3CJRB 2KZGA 3RCOA 2Y2ZA 4BJ6C 2HGCA 1KQ9A 5KAIC 4AU7A 2FUG2 1LFUP 3I56I 1OPCA 2E1CA 1G8XA 3BDDA 3IWFA 3OIQA 4X6AJ 2BZTA 3RKXA 4XMYA 4BEHA 1T0FA 5CYVA 3OWTA 4A3JJ 4L0YB 3I5UA 2PEXA 1MIJA 5FKOA 2K9LA 3M4OJ 2EFNA 3T5XA 3ZQFA 4IKFA 2ESNA 4S04A 2LSOA 1ODDA 3BTCA 4DBQA 3BCAA 4Q4ZF 3ZQGA 5LGNA 4PSWA 1YFHA 2Y75A 3OS0A 1T98A 4HV5A 2KRFA 3H9GA 2NS8A 4RGSA 5K5OA 4RDUA 3FM3A 2PMZN 5LD2C 1BIAA 1I39A 5B1AH 3JRBA 3MN2A 2VPLA 4U0VA 2O0YA 2OZ6A 1W4MA 2R3SA 2DFFA 1ITYA 4R79A 1RPWA 2ZNYA 4L9NA 3BTIA 5B66C 4PFOA 1X2MA 4MIMA 5HLTA 1QHHD 3JTGA 1TW2A 3FM5A 3CC4I 2IS4A 1IF1A 3OYJA 3R6SA 2F5DA 1VQLI 3SDGA 1J0RA 2XV4S 4I76A 3IAM2 3L2WA 3H0GJ 2JSCA 4II3A 2NNYA 3IHUA 2L7FP 4I6ZA 2JA8J 2EFPA 5H6QA 4B43A 3QQAA 2BVLA 1RRJA 2R5ZB 3F8CA 1S72I 5E18F 4HQMA 3BG9A 3B02A 5JI6A 4XKVA 2AO9A 1XDSA 4N4OB 1EH6A 1AOYA 2V9KA 1ZKGA 5J47A 3GTKJ 1MMAA 3QAHA 3ABLH 1K79A 4LFUA 1WJDA 2KIUA 4HDVA 4MQVA 5DCFA 1I3QJ 1OCRH 3K4MA 2R5YA 1T33A 3S1QJ 2KPMA 5HLGA 2JWTA 4O6JA 1FT9A 4U7BA 4XN3A 5IP7J 2ZCWA 3E3VA 4MGRA 4B47A 2NXNB 5HNFA 1NK2P 4OAZA 2GXGA 3F8MA 2R7SA 5E3NA 2PJRA 1T6SA 3CLQA 2FSWA 3GTOJ 1W5SA 3EQLF 3H35A 5LRRA 2LNBA 1QBJA 3HSFA 2OTJI 2MH2A 3JAMZ 3S1RJ 1W1WE 2NVTJ 3B6CA 4U0YA 2X6YA 2WAQA 1TWCJ 2VOOA 2R7OA 4HLYA 1J09A 4P96A 2IT0A 2R4GA 1IN5A 2XKPA 3FWEA 4A6EA 1X19A 2Y0SA 3J81K 2DK8A 4BDZA 1VQPI 2QCOA 3SZGA 4IHVA 2JUCA 3IH3A 2OJED 3QOPA 3HYIA 4RAGA 3GZNB 1Y0UA 2MABA 2ZFUA 3H5RA 5F6FA 4CH7A 3DTEA 3PUBA 1MNMC 4KNYA 3I55I 3HOSA 4JP0A 3VWBA 1PYVA 2R7QA 2XAFA 1I6HJ 4W1UA 2L02A 4O5VA 3FMQA 2WTEA 5EZGA 1XCVA 3F22A 4A5MA 2B0LA 3F9KA 3WTXC 3K4CA 4JOMA 2CQKA 3TP0A 1VI0A 1D5YA 2BY1A 2ELKA 1R5ID 2F5EA 2IP2A 5DTDA 4I7HA 1ZARA 3GMEA 1VQ9I 3BR5A 2FRHA 4E7HA 1OJLA 2ZXIA 1IUFA 4WX9A 3GZ5A 5J40A 3PFIA 1IXRC 3BR1A 4QPQA 4AWXB 1HKSA 2LBFA 4I0AA 1FEXA 3TO7A 5LHGA 1HSJA 2MGQA 2JA2A 3W2VA 3BR0A 4XRSG 1HSTA 1FJLA 4A3EJ 1SMYF 2QGUA 2EH3A 2HOAA 3A0HC 4EJOA 1XGOA 4A3MJ 2LVSA 5D4RA 3ECOA 4B3XA 4UV8A 4HNUA 2LF8A 2CQQA 1FBUA 2VLAA 3E6BA 2Z33A 1BW5A 4JBAA 2XGCA 3CCYA 1Y8RB 2XKOA 2MFZA 3UKGA 4CSWA 1GVJA 5LLQA 1DU6A 1HCRA 2QF7A 1YO5C 1VQMI 2Q8KA 1R00A 4IVNA 1PUFB 1AHDP 5J1YA 3DEWA 2BEOA 2FQ3A 2KJBA 2M4GA 2XAHA 1T0FC 1X4PA 2Y9YA 3MQ0A 1HBXG 2HYGD 4XLAA 1JI8A 3OYBA 1JKRC 1JHHA 3GLXA 3BR3A 2O8KA 1AKHA 5CQGA 1XGNA 3FBIB 1IRZA 4A2UA 3GLLA 1BM9A 4FCYA 3HM5A 2DTZA 5AIQA 1LDJA 1GHCA 5ICEA 1VFCA 2PJRB 1FP1D 2LF7A 1QU3A 3OYHA 2CFXA 1FIAA 1LDKB 5IP9J 1J75A 4M74A 2WAEA 2YS9A 2XPUA 3DU5A 5AONA 4GGGA 1DPRA 3QP6A 5IPAA 3MKWB 1MDMB 1TZLA 1R22A 2DDAA 3CUOA 3HKZN 4XKCA 1MJAA 2VONA 1FMVA 3ERMA 2CQ7A 2PX9A 4XLFA 2LY1A 5F08A 1U6GA 3ZMUA 4CICA 1RETA 1S7EA 2VJIA 4G6TB 4EGZA 4HX8A 5LFAA 5EYRA 5M3MJ 4EMSA 4M73A 3ERED 2D5VA 3S2WA 3OIPA 4ETSA 1R71A 1EV7A 2QM3A 2KQRA 2VKDA 2M30A 2E35A 1N75A 3LSPA 3P7NA 1A04A 3DPUA 4BL0B 1BL0A 4B8XA 3RJPA 3LSTA 3IH4A 3VYTB 5AIPA 1GUUA 2XB0X 4BUPA 3CUQB 4ENNA 1EH8A 4M9SA 4YFXF 1B72A 4NC7A 3RPUA 1RKTA 1FYLA 1G4DA 1HKQA 3PIOF 1KQ8A 3GEZA 1XGMA 4XSZF 2K9SA 4I02A 2OBPA 2EV0A 3MD2A 3JAMK 1YYVA 4ZYHA 1QZZA 4HLXA 2GLOA 1XMKA 1YE9A 2FF4A 2BOLA 2PMZA 3MMYB 4J00A 1BC7C 2XUBA 4BNCA 1FTTA 2L01A 4DOZA 2AQEA 1B8IB 2CG4A 3NEUA 2V7FA 3MVPA 3K4KA 4RA2A 4CYCA 4G7ZF 2WV0A 2X9DA 3WGIA 2ZMEC 3M7GA 2VC1A 1ZGWA 1USTA 3CMYA 2UWMA 4G94A 4XRFA 1UMQA 4LIUA 1XB4A 2HVRA 3REOA 1O4XA 2RNGA 3DPLC 4IJAA 1NK3P 1O3RA 5FROA 1O7FA 4XLEA 3U21A 5B3SH 3GTLJ 3HOWJ 1U8RA 2E36A 1RZ4A 2VKEA 3GWZA 3V8LA 4ZZDA 3FHZA 4HG2A 3CF2A 5KHDA 1HC8A 1ETWA 2YSRA 3HXLA 1GDTA 3AG4H 3S3NA 2UZKA 1U5TA 1IXSB 1ETYA 2AHQA 1LUJB 2DMUA 2CW7A 3E5XA 2M9HA 5J4VA 1WSUA 1DP7P 2EV5A 1ETQA 1UHWA 2E1OA 3CUQA 2M7AA 1ON1A 1K6OA 4M3GA 4AM3A 2DA6A 2K40A 3NWTA 1G3WA 4Y4RA 4LIVA 1LPQA 1I3AA 5CVJA 1T39A 2ZXWH 2QLZA 2AQFA 3K6GA 2DA2A 4PDKA 3MZYA 3W3CA 4BBRJ 4KN4X 2X51A 3CD6I 2VQLA 4M9ZA 3CESA 4A0XA 1ZG3A 4L18B 2L54A 3LSHA 4W97A 1YJWI 4CZCA 2E19A 2Z2SB 1VF9A 4NUBA 1FSEA 1I5ZA 3TEDA 4QTRA 4IX7A 1ZRCA 1UHMA 3DQVC 3DLAA 1DUXC 2DCEA 2DA1A 2UUZA 2JRMA 4UV9A 4UB8C 1FZPB 5FLMJ 1WJ5A 2DK5A 4PUSA 1Z7UA 3SFIA 1WI9A 5B1BH 4YFNF 2XDVA 4HPQA 3JSOA 3BY6A 2O3FA 1OYIA 3KYLA 5E1WA 3DBHB 1HOMA 1N78A 2NOGA 3ZCOA 2VXDA 2EIKH 2DQRA 1ZH5A 2EINH 4ZDPA 4UUSA 2VN2A 2QWWA 3V42A 1IXCA 4P55A 1O7LA 1PDNC 1JGSA 2V26A 1HW2A 2EA4A 2HDCA 2HDWA 1TP4A 3ZPLA 1IAWA 2M4KA 2EZLA 1G3TA 2KT0A 5IP6A 1MMNA 1WI3A 4EQQA 5E8IA 4HQEA 3MKZA 3IWZA 1R58A 1U5TB 2DMPA 2EA2A 3HTUA 2W7NA 1MBHA 3A01B 1ZELA 4OINF 5C4JJ 3CLOA 3FKIJ 2R7TA 4U88A 1S3JA 2KKOA 2NVQJ 5J3LA 4EATA 4NDLA 1WJFA 3PJRA 3WTVC 4AYBA 2DJIA 3L9FA 2GM4A 1YW9A 3S2HJ 2A6TA 3QU3A 1TWHJ 3O2PE 4FISA 2RQPA 1W0TA 3FXMA 3FZVA 5GPCA 2GWRA 4FE7A 1KU2A 4YRVA 3HKZA 4BXFA 4D0PA 1Z0XA 2BYVE 4UVBA 1IW7F 2XPVA 1FSHA 2L7MP 2CV0A 3G2BA 3M9AA 2W4SA 1F43A 2BXYA 2ZJRF 2DODA 4KYWA 4NNJA 2KIFA 5IT9Z 3E6MA 5GAGJ 3S14J 1OCTC 4RMNA 3WTUC 1JT0A 3FXRA 4XSXF 1LE8B 3Q9SA 2IS6A 1XPXA 2OF7A 2W82A 1ON2A 2DMTA 2KZVA 2RN7A 2HVQA 3K1NA 1SFEA 2LK2A 4AIDA 4CXFA 1K83J 4CA0A 1IN6A 1BR1A 3WE3A 3ZMSA 4KISA 5D6FA 1IUYA 1ZG5A 5FLXK 1PVEA 2B7EA 1HA8A 2BW3A 4MNUA 2ELHA 4E7JA 3CDHA 2H1KA 2MG4A 5IYBJ 1ENHA 1S8NA 2BHZA 1J59A 3HTSB 3F6OA 2ME6A 3PSIA 4B4CA 1QHGA 2Y0SN 5HS8A 4XIDA 2Q2EB 2HXOA 3A1YA 4UHTA 1Z9CA 1FYMA 3FDYA 1AU7A 3G3ZA 5DD4A 2MLGA 2RKHA 2OC6A 1FMWA 2HR3A 1IV6A 3BG6A 5FKMA 1S7OA 5HLIA 3HUGB 1YS7A 3HG9A 4FETA 1KU3A 1MNEA 4V2GA 2KHMA 3WG9A 2O61A 3EDPA 1ZLKA 5E3OA 4ESJA 4G12A 4PGHA 1HF0A 2H27A 1ZGAA 4BS9A 3MAJA 3CCVI 2VBYA 1D0YA 4G8XA 5A2QZ 4OMYA 4M3DA 1SMTA 1R36A 2CQNA 4RLQA 4XLCA 1O3TA 3RYRA 1N25A 2IGKA 1RUOA 1LNWA 1QPIA 4EGYA 1MDMA 4ABZA 4CCMA 3BT9A 1DGWY 3GZ6A 2KJCA 1B9NA 3M07A 1P9QC 5GAHJ 2P7VB 2VBXA 5L3FA 2OV7A 2JQ7A 1K7AA 3N97A 4JX5A 2QQAA 4XKBA 2IA0A 2YU3A 2BY3A 1TW3A 1S6LA 1WPKA 1WJAA 5JR3A 2ECCA 4FX4A 2QVOA 1F1ZA 2OUMA 1ULYA 2EWNA 4LGWA 2GBYA 5J8FA 5JVTA 2KDZA 2D45A 1VQ4I 3I0TA 1RKWA 3M1CA 3LA3A 3AAFA 5LEKA 4H0EA 4BY1J 1FY7A 3OYFA 3M8EA 2ID3A 3PQKA 1RI7A 3HPHA 1IN7A 2FOKA 4ANJA 1FNNA 2CFOA 1H88C 3BOQA 5EEAA 1LKXA 4KMFA 1Z77A 2R0QC 4RAZA 1WH5A 2CRGA 3BZ6A 3GVAA 5BOXA 5CPRB 4RLFA 2QQBA 5JVGF 2H6BA 3E5QA 4B1RA 2H94A 2W1OA 1XSXA 4I2OA 2FJ1A 3HJEA 2RDPA 5EEGA 3T1BA 4YFKF 1IO2A 3K9TA 4BQAA 3NAUA 3DXJF 4BQQA 4DZJA 3TQNA 3LSKA 2WWYA 3HSRA 4Q47A 2R92J 1X58A 1OYWA 2M1BA 5HLHA 3DBRB 4AIHA 3FK7A 5L3EA 2ZJQF 3QRFF 2E1MB 3HOUJ 1Z67A 4E7SA 2PLYA 5CVRA 3M8FA 5M5XJ 3JRGA 5J6XA 4MEYF 3FXLA 2DO7A 2JRTA 4G7HF 3L00A 2FNAA 2LG4A 4N9HA 1IRFA 2PJPA 4MO7A 4ASNA 1WWXA 3HHHA 4NQWB 4BJ5C 1W5CC 4KT5C 5ERIA 3SYTA 1FTZA 2C6YA 4CCJA 1MJBA 1VQNI 5D8LB 2X1DA 2X1CA 3KP2A 2GOXB 3KP4A 3HIFA 4AIJA 1FX7A 1HW1A 1DP3A 3HOYJ 4RM3A 2JA7J 3I4PA 4J19A 1A6IA 1MH4A 4KIGA 4PJJA 3LOCA 1WJEA 1YIJI 4XK4A 2RC4A 1PJRA 4LB6B 2CV1A 3LA7A 1XGSA 2DMNA 1MH3A 5F04A 4BJTA 1D0ZA 4QSHA 3H1CA 1WVRA 4M3FA 3HRMA 1G3YA 2D1HA 2LKSA 3SXYA 2OD5A 1G2HA 2M5WA 4XL9A 3W6VA 4GYIA 3J80K 4LG3A 3ISPA 3CO6C 2BBYA 3I53A 3D1NI 1SAXA 3KPHA 1R1TA 4DYCA 1U9OA 2M2EA 4HDUA 1Z05A 4DNCA 4P9UA 4A3BJ 3RYPA 5ILUA 3MZHA 1BR2A 2EBIA 4BACA 2EILH 5LHIA 2K5CA 1XDUA 1Y0NA 2LYCA 3GXOA 1LVKA 3LFUA 3CCEI 3GFJA 2F2EA 5E1ZB 2O7OA 1BW6A 3ZN0A 1P7JA 1YW8A 1YTYA 4IQJA 3CZ6A 2I10A 2I5UA 2N8GA 3CC2I 3KCCA 1B59A 2E7XA 4NB5A 3E7LA 4CCOA 1K61A 1R23A 2HQNA 4HAMA 4LK1F 3TBIA 2DQLA 2VODA 4G7OF 4G6QA 1SVOA 3ASOH 1IRXA 2KIQA 2G9WA 2ISYA 2HNHA 1T56A 2M87A 3QYBA 4OIPF 5LGUA 3GX4X 1X1BA 2JZYA 4GYGA 4ZDLA 2PN6A 3DWLE 4O3MA 2DBBA 2LC2A 4DIQA 1BR4A 2DA5A 1WJBA 3WU0A 2BHYA 3ONQA 1D1BA 3VEPA 2BY0A 3J80Z 2KFDA 4DYRA 2CMPA 3CJQB 5D5WB 3Q9VA 3KZIC 4RS8A 4E7IA 3W2AA 3F21A 3A2KA 3RZDJ 2WA0A 4KJZA 2STTA 1LEAA 4BEHB 3KETA 2XAUA 3FKJA 1GXPA 2WC2A 3DKWA 5J1UA 1OISA 1SD6A 2X85A 1W36C
chains in the Genus database with same CATH topology
4Y13A 3MFKA 4XLNF 1MKMA 4G9YA 5D5XB 4OU0A 2H09A 2RGVA 2VBWA 4KUMA 4I0BA 4EM0B 4MQ9F 1TQIA 2G7HA 2HTSA 2P8TA 2QUFA 3QPHA 4KIFA 1BI2A 5E8GA 4YIIA 2P7CB 4L9TA 3ULQB 3U1DA 4A6DA 4MEXF 2IA2A 6PAXA 3R60A 2QBYB 1W7PB 2HOEA 1R1UA 2XASA 1ZLJA 2E7WA 4BHBA 1OKRA 3N4MA 2NYXA 4IRGA 3GO5A 1J7KA 3T0YA 2Y0MA 1R5HA 1TLHB 4HF0A 3TDUC 1K78A 4ZYGA 3DPTA 5KK1A 1W5TA 1L3LA 1FLIA 1LDDA 5IT3A 1PP7U 4BXUA 4NQWA 3RDIA 3IKTA 1JE8A 4DQ2A 2GZWA 1T38A 5ILVA 1XCBA 3WTTC 1ZAOA 2MA3A 1O3QA 2A6EF 5K5RA 2J5PA 2K27A 3FMSA 4GO1A 2E1NA 2W85A 2L4AA 2QZ8A 4RB3C 5DDGA 2OQRA 3LQRA 3KP6A 3KP5A 2HTJA 2GAUA 3IKVA 2K4BA 1L0OC 1P2FA 3I64A 2DFIA 2ZMEB 4EM2A 4MTEA 3D0SA 2V1DA 1Q1HA 1YW7A 5DUIA 2DI3A 4RGRA 2DAOA 3EUHA 3MWMA 1JHFA 5L3GA 1H9TA 5K1YA 2COMA 1XSVA 2EFQA 3HOTA 3RPQA 4ENKA 3ZN1A 2R7DA 2PQ8A 5ED4A 5FLXZ 4RAYA 4E70A 3QU6A 2EV6A 4P9FA 4PZJA 4M72A 2PFBA 4AIKA 5L3DA 5BMZA 2STWA 1TTYA 3ZQ7A 5HVQC 4PCQA 5D4SA 3FF5A 1KA8A 1B6AA 4BHPA 2GIVA 1C0WA 3KZZA 3HUGA 5J8CA 2X0LA 1X3UA 2EJRA 1F5TA 4QWQA 5FD5A 3TGNA 2MBFA 4IXAA 2V9VA 5FFXA 3L2CA 3I59B 4KFCA 1TQMA 5DCMA 3KP7A 2XRNA 2ZBKA 3CUQC 3PQJA 3EETA 2Q2EA 3RKWA 1W7PD 3NQOA 1BC8C 3KEOA 4RB2C 3ZMVA 2YR2A 4M6XA 4ZH4F 3C3WA 3ABTA 1XN7A 3KFWX 1KQ0A 1PP8F 1ZRDA 3O6BB 1F9NA 5ILSA 5E1XA 2XAJA 3KP3A 1IZ1A 3FXUA 3KLOA 1OMIA 4WXCA 4RGUA 5DV5A 2Z9OA 4UUVA 4AD9A 2D1VA 1ZG1A 4R8HA 1USSA 2R7FA 2FXAA 2QENA 4EJWA 1BIBA 3TKYA 3WE2A 2OAZA 2ZKZA 2CGPA 2GXBA 1YS6A 3MEXA 4OMZA 1STZA 4HF1A 3O3KA 4BH9A 4Q48A 3BWGA 5FO5A 3JTHA 2CW0F 1XSDA 4WXDA 3IRRA 1H9GA 3F6VA 3SQNA 2EK5A 3WTZA 1FYKA 3V7RA 4ENJA 3DV8A 4N9IA 2MH9A 2HEOA 2ISZA 5BQTA 2XHKA 3H92A 4WCGA 4GCVA 1KU9A 1YQAA 3ZMTA 1DDNA 4FX0A 2OU2A 1YIOA 2OZUA 5E17F 1LVAA 2EFWA 2ESHA 1H0MA 2FBKA 5FB2A 3C7JA 1U2WA 2V6CA 2FE3A 1YLFA 4BHCA 3BJAA 2P4WA 1AWCA 3KE2A 4ZYEA 3E5UA 4OIOF 4R1HA 3K1MA 1KYWA 1TNSA 3KEQA 3GFLA 3C1DA 3GW2A 3WU1B 3VFZA 1PUEE 1S7AA 2DLLA 4M71A 3GUDA 2EFOA 2VE9A 1QZYA 5HDGA 1G3SA 3T8TA 1D8JA 4XLPF 1P92A 1BI1A 3NRVA 4M9XA 1MJ9A 2MD5A 4XBFA 1ZGJA 4K2EA 1Z1DA 1E17A 1BI3A 3ROUA 4WK8F 2HFHA 3G73A 3FMRA 4B09A 2EB7A 1Z91A 4A0YA 2NS0A 3WGGA 2O8XA 3BROA 2Z3YA 3D5LA 2O03A 2JPBA 5FD6A 3V7CA 3KLNA 3TDZC 3V8JA 3RI4A 3IRQA 3K0LA 3R0AA 5DYMA 2BE5F 5FGMA 3F8FA 3LAJA 2ZFWA 1MGTA 4WWCA 2AXLA 4LK0F 1E2XA 2A6HF 3SZPA 1CF7A 3BJOA 2K4JA 3TO9A 1D3YA 1P4WA 1R5GA 1TBXA 3F8NA 2LDUA 4EM1A 2FBIA 2FA5A 5BPDA 4U7DA 2GA1A 3I59A 4ENMA 3ZMDA 4UVAA 4U0WA 2KIMA 1TQPA 4BYYA 2P5LC 3DFGA 2G7UA 4IHSA 1VTNC 1ZYRF 1P6RA 4RGXA 1SFXA 5D6EA 3CJNA 4LLGF 5JHUA 4A12A 2L4MA 2MC3A 2HZTA 4IPAA 4CYDA 3T8RA 3I58A 1CF7B 3E6CC 2HQRA 4HBLA 5D5UB 4OOIA 1CGPA 3MCZA 4Z2YA 1DPUA 2Z99A 5HS9A 3JSPA 4IRHA 2YX7A 4A0ZA 3LQQA 2VBZA 3TO6A 1ZRFA 2RVCA 2O6GE 2XVCA 3J81Z 3KZYA 2LKPA 5BPIA 1D8KA 3P9CA 1B4AA 2ZMEA 2L3DA 3RTRA 4TV7A 4ESBA 3V7SA 4IHTA 5HDNA 5LRSA 2ACJA 3ML6A 4LB5A 4HYEA 1FOKA 4FHTA 4KDPA 2V1UA 4CZZA 1UCRA 1BJAA 3V8KA 2JPCA 4CO8A 3WODF 2FU4A 1QNTA 4RB1A 3W6KB 3L7WA 3OOPA 3JW4A 3I71A 5L3CA 1LJ9A 4ZYDA 3DF8A 1SD5A 2JT1A 4CDGA 1O3SA 4Q5SF 3E6DA 1IN4A 3DP7A 2UXNA 1K78B 2IA1A 2VOPA 2HKOA 1KYZA 4I98B 5CVIA 1W7PA 5ICGA 1J2XA 4HOBA 4L5IA 3LAPA 5F64A 4JQFA 3RIRA 1KU7A 3EYIA 2QBYA 3H3UA 3L09A 2UXXA 2Q0OA 5H20A 1JXSA 3P9IA 4BAYA 4FT8A 2K86A 5HDKA 5HS7A 1T2KA 2Y48A 3U9GA 5LHHA 1LQ1A 2IW5A 4KN7X 4LMYA 4LG0A 3RKYA 2DW4A 1XMAA 2ZNZA 2ZO4A 4PGGA 5DEQA 4CGZA 1P4AA 4I01A 4HZFA 5LGTA 1LEBA 3HRUA 1RIOH 2VT2A 4IF4A 2NRAC 3GYHX 3BJ6A 5CLSA 1Z6RA 4F7ZA 4LD5A 1FWZA 3BPXA 3EYYA 3ELKA 1QGPA 3F72A 1G6NA 2IVMA 2H6CA 4WXHA 3C18A 4LLLA 1J9IA 1B1BA 5EEHA 2A68F 2OA4A 2ZXJA 1R7JA 1KGSA 2YX4A 4I09A 4EJVA 3DEUA 1I1SA 5TJJA 4L0ZB 1BI0A 4KICA 2CYYA 1O57A 1D5VA 5D5VB 4HA8A 3GF2A 4A5NA 1SFUA 2DU9A 1XD7A 2RV8A 1WQ2A 2VC0A 2J5OA 3WTYC 2X4HA 2P6SA 4QLCU 4HF2A 4LG0B 2DTRA 3WGHA 2A69F 1TNTA 3SHFA 4OIQF 1FC3A 3SFZA 2BV6A 2IPQX 3TOAA 1R1VA 4MHGA 1I6XA 2F5FA 2DPDA 3E97A 3GFIA 2HKXA 3H3ZA 3QP5A 1REPC 3QPTA 1BN5A 1WRJA 5L3BA 1ZHFA 3HSEA 4HX7A 1BOAA 2M8EA 1RNLA 4KMUX 1FP2A 1BBYA 2K7LA 1ZREA 2W84A 3FX3A 1S29A 1LB2A 2XGXA 2CO5A 4ZZLA 2FBHA 3LWFA 2HS5A 4EJUA 3IC7A 1V3FA 2BGCA 4EVIA 2W57A 4EJTA 2W25A 2YPRA 4ON0A 3F23A 5ICFA 2FEZA 2NAZA 3CTAA 2V79A 1B9MA 1MZBA 3IL2A 4ESFA 5LBQA 4KIBA 2GA2A 5D8KB 4Y17A 1P4XA 2P5VA 3W6JB 2HWVA 2AS5F 2PI0A 1U5TC 3F8BA 3CO7C 4UXNA 5FFZA 2ADUA 3ABUA 5LEJA 1FBSA 4KA4A 3R61A 1I1GA 2F5CA 3F3XA 5DCMB 2DPUA 2A61A 4N0BA 3B73A 5DD8A 3R0JA 1NHAA 1J5YA 5ICCA 1IN8A 2DT5A 3SZTA 4YIFA 5HOOA 5CJ9A 1UB9A 4WF2A 1UFMA 5JFRA 3GFMA 1HQCA 1MD0A 3BP8A 2W24A 3BPVA 2PBIA 1IRGA 3FXQA 3K1PA 4RB0A 4YG2F 2XAGA 2TDXA 2CWEA 3K69A 4HV6A 4L5JA 2A5YB 3COAC 4LLNA 1Z6TA 1QQIA 3ECHA 2CSOA 2JTVA 3K2ZA 4G6DA 3Q5FA 2GQQA 3U2RA 2FNPA 2RNJA 4OIRF 5A2QK 4LJZF 2FMYA 2XIGA 1U3EM 4UVCA 3VOEA 4GXOA 1U78A 1V4RA 3HHGA 3J7AO 1SD4A 5BS6A 2Z5UA 3I54A 2P6TA 4P5OA 3V4GA 1GXQA 1HW5A 2K02A 3VB2A 4CHUA 2XAQA 2VE8A 1HKTA 3P9KA 5DUKA 2PMHA 1QO0D 5KVRA 1SD7A 1OYYA 2A3SA 5CVVA 4AVPA 2OQGA 1EH7A 1F4KA 1OR7A 4JK1X 1FPQA 3HRSA 3WTWC 4UNOA 2NNNA 2P5KA 4M6YA 1RUNA 1ZN2A 3ZP5A 4Y15A 2A07F 2V1XA 2ZJ2A 3TOBA 2MLKA 2PMUA 3HRTA 2QYOA 4EV0A 3LA2A 4HW0A 5IT9K 2FMLA 2VT3A 5CVUA 2XROA 2M45A 3ZMZA 4L9VA 4S05A 5H6RA 5TRDA 2D2WA 2IJLA 1YG2A 1I27A 4NHJA 3M1EA 3VODA 2QQ9A 5E20A 4L9JA 5F1RA 5K5QA 2HYFA 2VXZA 4IRIA 3OV8A 4MTDA 1FBQA 2ETHA 3R4KA 1HXDA 3LFKA 2IRFG 1QPMA 3WTSC 1ONVA 2PG4A 1WKMA 4HX4A 2HGCA 1KQ9A 1OPCA 2E1CA 3BDDA 3IWFA 3RKXA 1T0FA 5CYVA 4L0YB 3I5UA 2PEXA 2EFNA 3T5XA 2ESNA 4S04A 2LSOA 1ODDA 4Q4ZF 5LGNA 1YFHA 2Y75A 1T98A 4HV5A 2KRFA 4RGSA 5K5OA 3FM3A 1BIAA 4U0VA 2O0YA 2OZ6A 1W4MA 2R3SA 4R79A 2ZNYA 4L9NA 3JTGA 1TW2A 3FM5A 1IF1A 3R6SA 2F5DA 1J0RA 2XV4S 2JSCA 2NNYA 3IHUA 2EFPA 5H6QA 3F8CA 5E18F 4HQMA 3B02A 5JI6A 1AOYA 1XDSA 1EH6A 3QAHA 1K79A 4LFUA 2KIUA 4HDVA 4MQVA 5DCFA 5HLGA 4O6JA 1FT9A 4U7BA 2ZCWA 3E3VA 4MGRA 2GXGA 3F8MA 1T6SA 2FSWA 1W5SA 3EQLF 5LRRA 1QBJA 2LNBA 3HSFA 2MH2A 3JAMZ 4U0YA 2VOOA 4HLYA 4P96A 2IT0A 1IN5A 2XKPA 3FWEA 4A6EA 3J81K 2DK8A 3QOPA 3HYIA 1Y0UA 5F6FA 4KNYA 3HOSA 2XAFA 2L02A 4O5VA 3FMQA 2WTEA 1XCVA 3F22A 4A5MA 2B0LA 3WTXC 2CQKA 2F5EA 2IP2A 4I7HA 1ZARA 2FRHA 4WX9A 3GZ5A 3PFIA 4AWXB 1IXRC 1HKSA 4I0AA 3TO7A 5LHGA 1HSJA 1HSTA 1SMYF 4EJOA 1XGOA 5D4RA 3ECOA 4UV8A 2LF8A 1FBUA 3E6BA 2Z33A 4JBAA 2XKOA 1GVJA 5LLQA 1YO5C 2Q8KA 1R00A 4IVNA 2BEOA 2FQ3A 2KJBA 2XAHA 3MQ0A 1HBXG 2HYGD 1JHHA 3GLXA 1XGNA 4A2UA 1BM9A 1GHCA 5AIQA 1LDJA 5ICEA 1FP1D 2LF7A 2CFXA 1LDKB 1J75A 4M74A 5AONA 4GGGA 1DPRA 3QP6A 1MDMB 1R22A 3CUOA 1MJAA 2VONA 4CICA 1U6GA 3ZMUA 4EGZA 4HX8A 4EMSA 4M73A 3ERED 3S2WA 4ETSA 1EV7A 2QM3A 2M30A 3P7NA 1A04A 4B8XA 3RJPA 3LSTA 5AIPA 3CUQB 4ENNA 1EH8A 4M9SA 4YFXF 3RPUA 1FYLA 1G4DA 1HKQA 1KQ8A 3GEZA 1XGMA 4XSZF 4I02A 2OBPA 2EV0A 3JAMK 1YYVA 4ZYHA 1QZZA 4HLXA 1XMKA 2FF4A 1BC7C 2XUBA 4BNCA 2L01A 2CG4A 3NEUA 4G7ZF 2WV0A 3WGIA 3M7GA 2VC1A 1USTA 2UWMA 4G94A 4XRFA 1XB4A 3REOA 3DPLC 4IJAA 1O3RA 1O7FA 1U8RA 1RZ4A 3GWZA 3V8LA 4ZZDA 3FHZA 2YSRA 2UZKA 1U5TA 1IXSB 3E5XA 1WSUA 1DP7P 2EV5A 1UHWA 3CUQA 1ON1A 1K6OA 1G3WA 5CVJA 1T39A 2QLZA 4PDKA 3MZYA 4KN4X 4M9ZA 4A0XA 1ZG3A 4L18B 2L54A 1FSEA 1I5ZA 1ZRCA 1UHMA 3DQVC 1DUXC 4UV9A 1FZPB 2DK5A 1Z7UA 1WI9A 4YFNF 3JSOA 3BY6A 2O3FA 1OYIA 5E1WA 2DQRA 1ZH5A 2VN2A 2QWWA 1IXCA 4P55A 1O7LA 1PDNC 1JGSA 1HW2A 2EA4A 2HDCA 3ZPLA 1IAWA 1G3TA 4EQQA 5E8IA 4HQEA 3IWZA 1R58A 1U5TB 2EA2A 3HTUA 4OINF 3CLOA 4U88A 1S3JA 2KKOA 3WTVC 3L9FA 1YW9A 3QU3A 3O2PE 2RQPA 3FZVA 2GWRA 1KU2A 4D0PA 2BYVE 4UVBA 1IW7F 1FSHA 3M9AA 4KYWA 5IT9Z 2KIFA 3E6MA 3WTUC 3FXRA 4XSXF 3Q9SA 1ON2A 2RN7A 3K1NA 1SFEA 4CXFA 1IN6A 3WE3A 3ZMSA 5D6FA 1IUYA 1ZG5A 5FLXK 4MNUA 2ELHA 3CDHA 3HTSB 1S8NA 1J59A 3F6OA 5HS8A 1Z9CA 4UHTA 1FYMA 3G3ZA 5DD4A 2MLGA 2RKHA 2HR3A 1S7OA 5HLIA 1YS7A 1KU3A 3WG9A 2O61A 3EDPA 1ZLKA 4ESJA 4PGHA 2H27A 1ZGAA 3MAJA 2VBYA 4G8XA 5A2QZ 4OMYA 1SMTA 1R36A 1O3TA 3RYRA 1RUOA 1LNWA 4EGYA 1MDMA 3GZ6A 2KJCA 1B9NA 2P7VB 2VBXA 5L3FA 1K7AA 3N97A 2QQAA 2IA0A 2YU3A 1TW3A 1S6LA 5JR3A 4FX4A 2QVOA 1F1ZA 1ULYA 2EWNA 4LGWA 5J8FA 5JVTA 2D45A 3I0TA 3LA3A 3AAFA 5LEKA 4H0EA 1FY7A 3M8EA 3PQKA 1RI7A 1IN7A 2FOKA 1FNNA 3BOQA 4KMFA 4RAZA 3BZ6A 3GVAA 5BOXA 2QQBA 2H6BA 3E5QA 2H94A 1XSXA 4I2OA 5EEGA 3T1BA 2RDPA 4YFKF 3K9TA 4BQAA 3DXJF 3TQNA 2WWYA 3HSRA 4Q47A 1OYWA 2M1BA 5HLHA 4AIHA 5L3EA 3QRFF 2PLYA 5CVRA 3M8FA 5J6XA 4MEYF 2DO7A 2JRTA 4G7HF 3L00A 2FNAA 4N9HA 1IRFA 2PJPA 4ASNA 1WWXA 3HHHA 4KT5C 5ERIA 2C6YA 1MJBA 5D8LB 3KP2A 3KP4A 3HIFA 4AIJA 1FX7A 1HW1A 3I4PA 4KIGA 2RC4A 4LB6B 3LA7A 1XGSA 3HRMA 1G3YA 2D1HA 3SXYA 2OD5A 2M5WA 4GYIA 3J80K 3ISPA 3CO6C 2BBYA 3I53A 1SAXA 1R1TA 4HDUA 1Z05A 4DNCA 4P9UA 3RYPA 5ILUA 3MZHA 5LHIA 1XDUA 3GXOA 3GFJA 2F2EA 5E1ZB 3ZN0A 1YW8A 1YTYA 3KCCA 1B59A 2E7XA 4NB5A 1R23A 2HQNA 4HAMA 4LK1F 2DQLA 2VODA 4G7OF 4G6QA 2G9WA 2ISYA 2M87A 4OIPF 5LGUA 3GX4X 2JZYA 4GYGA 2PN6A 4O3MA 2DBBA 3WU0A 3VEPA 3J80Z 5D5WB 3Q9VA 4RS8A 3F21A 2STTA 1LEAA 3KETA 1GXPA 2WC2A 3DKWA 1SD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y13 A;  3MFK A;  4XLN F;  1MKM A;  4G9Y A;  5D5X B;  4OU0 A;  2H09 A;  2RGV A;  2VBW A;  4KUM A;  4I0B A;  4EM0 B;  4MQ9 F;  1TQI A;  2G7H A;  2HTS A;  2P8T A;  2QUF A;  3QPH A;  4KIF A;  1BI2 A;  5E8G A;  4YII A;  2P7C B;  4L9T A;  3ULQ B;  3U1D A;  4A6D A;  4MEX F;  2IA2 A;  6PAX A;  3R60 A;  2QBY B;  1W7P B;  2HOE A;  1R1U A;  2XAS A;  1ZLJ A;  2E7W A;  4BHB A;  1OKR A;  3N4M A;  2NYX A;  4IRG A;  3GO5 A;  1J7K A;  3T0Y A;  2Y0M A;  1R5H A;  1TLH B;  4HF0 A;  3TDU C;  1K78 A;  4ZYG A;  3DPT A;  5KK1 A;  1W5T A;  1L3L A;  1FLI A;  1LDD A;  5IT3 A;  1PP7 U;  4BXU A;  4NQW A;  3RDI A;  3IKT A;  1JE8 A;  4DQ2 A;  2GZW A;  1T38 A;  5ILV A;  1XCB A;  3WTT C;  1ZAO A;  2MA3 A;  1O3Q A;  2A6E F;  5K5R A;  2J5P A;  2K27 A;  3FMS A;  4GO1 A;  2E1N A;  2W85 A;  2L4A A;  2QZ8 A;  4RB3 C;  5DDG A;  2OQR A;  3LQR A;  3KP6 A;  3KP5 A;  2HTJ A;  2GAU A;  3IKV A;  2K4B A;  1L0O C;  1P2F A;  3I64 A;  2DFI A;  2ZME B;  4EM2 A;  4MTE A;  3D0S A;  2V1D A;  1Q1H A;  1YW7 A;  5DUI A;  2DI3 A;  4RGR A;  2DAO A;  3EUH A;  3MWM A;  1JHF A;  5L3G A;  1H9T A;  5K1Y A;  2COM A;  1XSV A;  2EFQ A;  3HOT A;  3RPQ A;  4ENK A;  3ZN1 A;  2R7D A;  2PQ8 A;  5ED4 A;  5FLX Z;  4RAY A;  4E70 A;  3QU6 A;  2EV6 A;  4P9F A;  4PZJ A;  4M72 A;  2PFB A;  4AIK A;  5L3D A;  5BMZ A;  2STW A;  1TTY A;  3ZQ7 A;  5HVQ C;  4PCQ A;  5D4S A;  3FF5 A;  1KA8 A;  1B6A A;  4BHP A;  2GIV A;  1C0W A;  3KZZ A;  3HUG A;  5J8C A;  2X0L A;  1X3U A;  2EJR A;  1F5T A;  4QWQ A;  5FD5 A;  3TGN A;  2MBF A;  4IXA A;  2V9V A;  5FFX A;  3L2C A;  3I59 B;  4KFC A;  1TQM A;  5DCM A;  3KP7 A;  2XRN A;  2ZBK A;  3CUQ C;  3PQJ A;  3EET A;  2Q2E A;  3RKW A;  1W7P D;  3NQO A;  1BC8 C;  3KEO A;  4RB2 C;  3ZMV A;  2YR2 A;  4M6X A;  4ZH4 F;  3C3W A;  3ABT A;  1XN7 A;  3KFW X;  1KQ0 A;  1PP8 F;  1ZRD A;  3O6B B;  1F9N A;  5ILS A;  5E1X A;  2XAJ A;  3KP3 A;  1IZ1 A;  3FXU A;  3KLO A;  1OMI A;  4WXC A;  4RGU A;  5DV5 A;  2Z9O A;  4UUV A;  4AD9 A;  2D1V A;  1ZG1 A;  4R8H A;  1USS A;  2R7F A;  2FXA A;  2QEN A;  4EJW A;  1BIB A;  3TKY A;  3WE2 A;  2OAZ A;  2ZKZ A;  2CGP A;  2GXB A;  1YS6 A;  3MEX A;  4OMZ A;  1STZ A;  4HF1 A;  3O3K A;  4BH9 A;  4Q48 A;  3BWG A;  5FO5 A;  3JTH A;  2CW0 F;  1XSD A;  4WXD A;  3IRR A;  1H9G A;  3F6V A;  3SQN A;  2EK5 A;  3WTZ A;  1FYK A;  3V7R A;  4ENJ A;  3DV8 A;  4N9I A;  2MH9 A;  2HEO A;  2ISZ A;  5BQT A;  2XHK A;  3H92 A;  4WCG A;  4GCV A;  1KU9 A;  1YQA A;  3ZMT A;  1DDN A;  4FX0 A;  2OU2 A;  1YIO A;  2OZU A;  5E17 F;  1LVA A;  2EFW A;  2ESH A;  1H0M A;  2FBK A;  5FB2 A;  3C7J A;  1U2W A;  2V6C A;  2FE3 A;  1YLF A;  4BHC A;  3BJA A;  2P4W A;  1AWC A;  3KE2 A;  4ZYE A;  3E5U A;  4OIO F;  4R1H A;  3K1M A;  1KYW A;  1TNS A;  3KEQ A;  3GFL A;  3C1D A;  3GW2 A;  3WU1 B;  3VFZ A;  1PUE E;  1S7A A;  2DLL A;  4M71 A;  3GUD A;  2EFO A;  2VE9 A;  1QZY A;  5HDG A;  1G3S A;  3T8T A;  1D8J A;  4XLP F;  1P92 A;  1BI1 A;  3NRV A;  4M9X A;  1MJ9 A;  2MD5 A;  4XBF A;  1ZGJ A;  4K2E A;  1Z1D A;  1E17 A;  1BI3 A;  3ROU A;  4WK8 F;  2HFH A;  3G73 A;  3FMR A;  4B09 A;  2EB7 A;  1Z91 A;  4A0Y A;  2NS0 A;  3WGG A;  2O8X A;  3BRO A;  2Z3Y A;  3D5L A;  2O03 A;  2JPB A;  5FD6 A;  3V7C A;  3KLN A;  3TDZ C;  3V8J A;  3RI4 A;  3IRQ A;  3K0L A;  3R0A A;  5DYM A;  2BE5 F;  5FGM A;  3F8F A;  3LAJ A;  2ZFW A;  1MGT A;  4WWC A;  2AXL A;  4LK0 F;  1E2X A;  2A6H F;  3SZP A;  1CF7 A;  3BJO A;  2K4J A;  3TO9 A;  1D3Y A;  1P4W A;  1R5G A;  1TBX A;  3F8N A;  2LDU A;  4EM1 A;  2FBI A;  2FA5 A;  5BPD A;  4U7D A;  2GA1 A;  3I59 A;  4ENM A;  3ZMD A;  4UVA A;  4U0W A;  2KIM A;  1TQP A;  4BYY A;  2P5L C;  3DFG A;  2G7U A;  4IHS A;  1VTN C;  1ZYR F;  1P6R A;  4RGX A;  1SFX A;  5D6E A;  3CJN A;  4LLG F;  5JHU A;  4A12 A;  2L4M A;  2MC3 A;  2HZT A;  4IPA A;  4CYD A;  3T8R A;  3I58 A;  1CF7 B;  3E6C C;  2HQR A;  4HBL A;  5D5U B;  4OOI A;  1CGP A;  3MCZ A;  4Z2Y A;  1DPU A;  2Z99 A;  5HS9 A;  3JSP A;  4IRH A;  2YX7 A;  4A0Z A;  3LQQ A;  2VBZ A;  3TO6 A;  1ZRF A;  2RVC A;  2O6G E;  2XVC A;  3J81 Z;  3KZY A;  2LKP A;  5BPI A;  1D8K A;  3P9C A;  1B4A A;  2ZME A;  2L3D A;  3RTR A;  4TV7 A;  4ESB A;  3V7S A;  4IHT A;  5HDN A;  5LRS A;  2ACJ A;  3ML6 A;  4LB5 A;  4HYE A;  1FOK A;  4FHT A;  4KDP A;  2V1U A;  4CZZ A;  1UCR A;  1BJA A;  3V8K A;  2JPC A;  4CO8 A;  3WOD F;  2FU4 A;  1QNT A;  4RB1 A;  3W6K B;  3L7W A;  3OOP A;  3JW4 A;  3I71 A;  5L3C A;  1LJ9 A;  4ZYD A;  3DF8 A;  1SD5 A;  2JT1 A;  4CDG A;  1O3S A;  4Q5S F;  3E6D A;  1IN4 A;  3DP7 A;  2UXN A;  1K78 B;  2IA1 A;  2VOP A;  2HKO A;  1KYZ A;  4I98 B;  5CVI A;  1W7P A;  5ICG A;  1J2X A;  4HOB A;  4L5I A;  3LAP A;  5F64 A;  4JQF A;  3RIR A;  1KU7 A;  3EYI A;  2QBY A;  3H3U A;  3L09 A;  2UXX A;  2Q0O A;  5H20 A;  1JXS A;  3P9I A;  4BAY A;  4FT8 A;  2K86 A;  5HDK A;  5HS7 A;  1T2K A;  2Y48 A;  3U9G A;  5LHH A;  1LQ1 A;  2IW5 A;  4KN7 X;  4LMY A;  4LG0 A;  3RKY A;  2DW4 A;  1XMA A;  2ZNZ A;  2ZO4 A;  4PGG A;  5DEQ A;  4CGZ A;  1P4A A;  4I01 A;  4HZF A;  5LGT A;  1LEB A;  3HRU A;  1RIO H;  2VT2 A;  4IF4 A;  2NRA C;  3GYH X;  3BJ6 A;  5CLS A;  1Z6R A;  4F7Z A;  4LD5 A;  1FWZ A;  3BPX A;  3EYY A;  3ELK A;  1QGP A;  3F72 A;  1G6N A;  2IVM A;  2H6C A;  4WXH A;  3C18 A;  4LLL A;  1J9I A;  1B1B A;  5EEH A;  2A68 F;  2OA4 A;  2ZXJ A;  1R7J A;  1KGS A;  2YX4 A;  4I09 A;  4EJV A;  3DEU A;  1I1S A;  5TJJ A;  4L0Z B;  1BI0 A;  4KIC A;  2CYY A;  1O57 A;  1D5V A;  5D5V B;  4HA8 A;  3GF2 A;  4A5N A;  1SFU A;  2DU9 A;  1XD7 A;  2RV8 A;  1WQ2 A;  2VC0 A;  2J5O A;  3WTY C;  2X4H A;  2P6S A;  4QLC U;  4HF2 A;  4LG0 B;  2DTR A;  3WGH A;  2A69 F;  1TNT A;  3SHF A;  4OIQ F;  1FC3 A;  3SFZ A;  2BV6 A;  2IPQ X;  3TOA A;  1R1V A;  4MHG A;  1I6X A;  2F5F A;  2DPD A;  3E97 A;  3GFI A;  2HKX A;  3H3Z A;  3QP5 A;  1REP C;  3QPT A;  1BN5 A;  1WRJ A;  5L3B A;  1ZHF A;  3HSE A;  4HX7 A;  1BOA A;  2M8E A;  1RNL A;  4KMU X;  1FP2 A;  1BBY A;  2K7L A;  1ZRE A;  2W84 A;  3FX3 A;  1S29 A;  1LB2 A;  2XGX A;  2CO5 A;  4ZZL A;  2FBH A;  3LWF A;  2HS5 A;  4EJU A;  3IC7 A;  1V3F A;  2BGC A;  4EVI A;  2W57 A;  4EJT A;  2W25 A;  2YPR A;  4ON0 A;  3F23 A;  5ICF A;  2FEZ A;  2NAZ A;  3CTA A;  2V79 A;  1B9M A;  1MZB A;  3IL2 A;  4ESF A;  5LBQ A;  4KIB A;  2GA2 A;  5D8K B;  4Y17 A;  1P4X A;  2P5V A;  3W6J B;  2HWV A;  2AS5 F;  2PI0 A;  1U5T C;  3F8B A;  3CO7 C;  4UXN A;  5FFZ A;  2ADU A;  3ABU A;  5LEJ A;  1FBS A;  4KA4 A;  3R61 A;  1I1G A;  2F5C A;  3F3X A;  5DCM B;  2DPU A;  2A61 A;  4N0B A;  3B73 A;  5DD8 A;  3R0J A;  1NHA A;  1J5Y A;  5ICC A;  1IN8 A;  2DT5 A;  3SZT A;  4YIF A;  5HOO A;  5CJ9 A;  1UB9 A;  4WF2 A;  1UFM A;  5JFR A;  3GFM A;  1HQC A;  1MD0 A;  3BP8 A;  2W24 A;  3BPV A;  2PBI A;  1IRG A;  3FXQ A;  3K1P A;  4RB0 A;  4YG2 F;  2XAG A;  2TDX A;  2CWE A;  3K69 A;  4HV6 A;  4L5J A;  2A5Y B;  3COA C;  4LLN A;  1Z6T A;  1QQI A;  3ECH A;  2CSO A;  2JTV A;  3K2Z A;  4G6D A;  3Q5F A;  2GQQ A;  3U2R A;  2FNP A;  2RNJ A;  4OIR F;  5A2Q K;  4LJZ F;  2FMY A;  2XIG A;  1U3E M;  4UVC A;  3VOE A;  4GXO A;  1U78 A;  1V4R A;  3HHG A;  3J7A O;  1SD4 A;  5BS6 A;  2Z5U A;  3I54 A;  2P6T A;  4P5O A;  3V4G A;  1GXQ A;  1HW5 A;  2K02 A;  3VB2 A;  4CHU A;  2XAQ A;  2VE8 A;  1HKT A;  3P9K A;  5DUK A;  2PMH A;  1QO0 D;  5KVR A;  1SD7 A;  1OYY A;  2A3S A;  5CVV A;  4AVP A;  2OQG A;  1EH7 A;  1F4K A;  1OR7 A;  4JK1 X;  1FPQ A;  3HRS A;  3WTW C;  4UNO A;  2NNN A;  2P5K A;  4M6Y A;  1RUN A;  1ZN2 A;  3ZP5 A;  4Y15 A;  2A07 F;  2V1X A;  2ZJ2 A;  3TOB A;  2MLK A;  2PMU A;  3HRT A;  2QYO A;  4EV0 A;  3LA2 A;  4HW0 A;  5IT9 K;  2FML A;  2VT3 A;  5CVU A;  2XRO A;  2M45 A;  3ZMZ A;  4L9V A;  4S05 A;  5H6R A;  5TRD A;  2D2W A;  2IJL A;  1YG2 A;  1I27 A;  4NHJ A;  3M1E A;  3VOD A;  2QQ9 A;  5E20 A;  4L9J A;  5F1R A;  5K5Q A;  2HYF A;  2VXZ A;  4IRI A;  3OV8 A;  4MTD A;  1FBQ A;  2ETH A;  3R4K A;  1HXD A;  3LFK A;  2IRF G;  1QPM A;  3WTS C;  1ONV A;  2PG4 A;  1WKM A;  4HX4 A;  2HGC A;  1KQ9 A;  1OPC A;  2E1C A;  3BDD A;  3IWF A;  3RKX A;  1T0F A;  5CYV A;  4L0Y B;  3I5U A;  2PEX A;  2EFN A;  3T5X A;  2ESN A;  4S04 A;  2LSO A;  1ODD A;  4Q4Z F;  5LGN A;  1YFH A;  2Y75 A;  1T98 A;  4HV5 A;  2KRF A;  4RGS A;  5K5O A;  3FM3 A;  1BIA A;  4U0V A;  2O0Y A;  2OZ6 A;  1W4M A;  2R3S A;  4R79 A;  2ZNY A;  4L9N A;  3JTG A;  1TW2 A;  3FM5 A;  1IF1 A;  3R6S A;  2F5D A;  1J0R A;  2XV4 S;  2JSC A;  2NNY A;  3IHU A;  2EFP A;  5H6Q A;  3F8C A;  5E18 F;  4HQM A;  3B02 A;  5JI6 A;  1AOY A;  1XDS A;  1EH6 A;  3QAH A;  1K79 A;  4LFU A;  2KIU A;  4HDV A;  4MQV A;  5DCF A;  5HLG A;  4O6J A;  1FT9 A;  4U7B A;  2ZCW A;  3E3V A;  4MGR A;  2GXG A;  3F8M A;  1T6S A;  2FSW A;  1W5S A;  3EQL F;  5LRR A;  1QBJ A;  2LNB A;  3HSF A;  2MH2 A;  3JAM Z;  4U0Y A;  2VOO A;  4HLY A;  4P96 A;  2IT0 A;  1IN5 A;  2XKP A;  3FWE A;  4A6E A;  3J81 K;  2DK8 A;  3QOP A;  3HYI A;  1Y0U A;  5F6F A;  4KNY A;  3HOS A;  2XAF A;  2L02 A;  4O5V A;  3FMQ A;  2WTE A;  1XCV A;  3F22 A;  4A5M A;  2B0L A;  3WTX C;  2CQK A;  2F5E A;  2IP2 A;  4I7H A;  1ZAR A;  2FRH A;  4WX9 A;  3GZ5 A;  3PFI A;  4AWX B;  1IXR C;  1HKS A;  4I0A A;  3TO7 A;  5LHG A;  1HSJ A;  1HST A;  1SMY F;  4EJO A;  1XGO A;  5D4R A;  3ECO A;  4UV8 A;  2LF8 A;  1FBU A;  3E6B A;  2Z33 A;  4JBA A;  2XKO A;  1GVJ A;  5LLQ A;  1YO5 C;  2Q8K A;  1R00 A;  4IVN A;  2BEO A;  2FQ3 A;  2KJB A;  2XAH A;  3MQ0 A;  1HBX G;  2HYG D;  1JHH A;  3GLX A;  1XGN A;  4A2U A;  1BM9 A;  1GHC A;  5AIQ A;  1LDJ A;  5ICE A;  1FP1 D;  2LF7 A;  2CFX A;  1LDK B;  1J75 A;  4M74 A;  5AON A;  4GGG A;  1DPR A;  3QP6 A;  1MDM B;  1R22 A;  3CUO A;  1MJA A;  2VON A;  4CIC A;  1U6G A;  3ZMU A;  4EGZ A;  4HX8 A;  4EMS A;  4M73 A;  3ERE D;  3S2W A;  4ETS A;  1EV7 A;  2QM3 A;  2M30 A;  3P7N A;  1A04 A;  4B8X A;  3RJP A;  3LST A;  5AIP A;  3CUQ B;  4ENN A;  1EH8 A;  4M9S A;  4YFX F;  3RPU A;  1FYL A;  1G4D A;  1HKQ A;  1KQ8 A;  3GEZ A;  1XGM A;  4XSZ F;  4I02 A;  2OBP A;  2EV0 A;  3JAM K;  1YYV A;  4ZYH A;  1QZZ A;  4HLX A;  1XMK A;  2FF4 A;  1BC7 C;  2XUB A;  4BNC A;  2L01 A;  2CG4 A;  3NEU A;  4G7Z F;  2WV0 A;  3WGI A;  3M7G A;  2VC1 A;  1UST A;  2UWM A;  4G94 A;  4XRF A;  1XB4 A;  3REO A;  3DPL C;  4IJA A;  1O3R A;  1O7F A;  1U8R A;  1RZ4 A;  3GWZ A;  3V8L A;  4ZZD A;  3FHZ A;  2YSR A;  2UZK A;  1U5T A;  1IXS B;  3E5X A;  1WSU A;  1DP7 P;  2EV5 A;  1UHW A;  3CUQ A;  1ON1 A;  1K6O A;  1G3W A;  5CVJ A;  1T39 A;  2QLZ A;  4PDK A;  3MZY A;  4KN4 X;  4M9Z A;  4A0X A;  1ZG3 A;  4L18 B;  2L54 A;  1FSE A;  1I5Z A;  1ZRC A;  1UHM A;  3DQV C;  1DUX C;  4UV9 A;  1FZP B;  2DK5 A;  1Z7U A;  1WI9 A;  4YFN F;  3JSO A;  3BY6 A;  2O3F A;  1OYI A;  5E1W A;  2DQR A;  1ZH5 A;  2VN2 A;  2QWW A;  1IXC A;  4P55 A;  1O7L A;  1PDN C;  1JGS A;  1HW2 A;  2EA4 A;  2HDC A;  3ZPL A;  1IAW A;  1G3T A;  4EQQ A;  5E8I A;  4HQE A;  3IWZ A;  1R58 A;  1U5T B;  2EA2 A;  3HTU A;  4OIN F;  3CLO A;  4U88 A;  1S3J A;  2KKO A;  3WTV C;  3L9F A;  1YW9 A;  3QU3 A;  3O2P E;  2RQP A;  3FZV A;  2GWR A;  1KU2 A;  4D0P A;  2BYV E;  4UVB A;  1IW7 F;  1FSH A;  3M9A A;  4KYW A;  5IT9 Z;  2KIF A;  3E6M A;  3WTU C;  3FXR A;  4XSX F;  3Q9S A;  1ON2 A;  2RN7 A;  3K1N A;  1SFE A;  4CXF A;  1IN6 A;  3WE3 A;  3ZMS A;  5D6F A;  1IUY A;  1ZG5 A;  5FLX K;  4MNU A;  2ELH A;  3CDH A;  3HTS B;  1S8N A;  1J59 A;  3F6O A;  5HS8 A;  1Z9C A;  4UHT A;  1FYM A;  3G3Z A;  5DD4 A;  2MLG A;  2RKH A;  2HR3 A;  1S7O A;  5HLI A;  1YS7 A;  1KU3 A;  3WG9 A;  2O61 A;  3EDP A;  1ZLK A;  4ESJ A;  4PGH A;  2H27 A;  1ZGA A;  3MAJ A;  2VBY A;  4G8X A;  5A2Q Z;  4OMY A;  1SMT A;  1R36 A;  1O3T A;  3RYR A;  1RUO A;  1LNW A;  4EGY A;  1MDM A;  3GZ6 A;  2KJC A;  1B9N A;  2P7V B;  2VBX A;  5L3F A;  1K7A A;  3N97 A;  2QQA A;  2IA0 A;  2YU3 A;  1TW3 A;  1S6L A;  5JR3 A;  4FX4 A;  2QVO A;  1F1Z A;  1ULY A;  2EWN A;  4LGW A;  5J8F A;  5JVT A;  2D45 A;  3I0T A;  3LA3 A;  3AAF A;  5LEK A;  4H0E A;  1FY7 A;  3M8E A;  3PQK A;  1RI7 A;  1IN7 A;  2FOK A;  1FNN A;  3BOQ A;  4KMF A;  4RAZ A;  3BZ6 A;  3GVA A;  5BOX A;  2QQB A;  2H6B A;  3E5Q A;  2H94 A;  1XSX A;  4I2O A;  5EEG A;  3T1B A;  2RDP A;  4YFK F;  3K9T A;  4BQA A;  3DXJ F;  3TQN A;  2WWY A;  3HSR A;  4Q47 A;  1OYW A;  2M1B A;  5HLH A;  4AIH A;  5L3E A;  3QRF F;  2PLY A;  5CVR A;  3M8F A;  5J6X A;  4MEY F;  2DO7 A;  2JRT A;  4G7H F;  3L00 A;  2FNA A;  4N9H A;  1IRF A;  2PJP A;  4ASN A;  1WWX A;  3HHH A;  4KT5 C;  5ERI A;  2C6Y A;  1MJB A;  5D8L B;  3KP2 A;  3KP4 A;  3HIF A;  4AIJ A;  1FX7 A;  1HW1 A;  3I4P A;  4KIG A;  2RC4 A;  4LB6 B;  3LA7 A;  1XGS A;  3HRM A;  1G3Y A;  2D1H A;  3SXY A;  2OD5 A;  2M5W A;  4GYI A;  3J80 K;  3ISP A;  3CO6 C;  2BBY A;  3I53 A;  1SAX A;  1R1T A;  4HDU A;  1Z05 A;  4DNC A;  4P9U A;  3RYP A;  5ILU A;  3MZH A;  5LHI A;  1XDU A;  3GXO A;  3GFJ A;  2F2E A;  5E1Z B;  3ZN0 A;  1YW8 A;  1YTY A;  3KCC A;  1B59 A;  2E7X A;  4NB5 A;  1R23 A;  2HQN A;  4HAM A;  4LK1 F;  2DQL A;  2VOD A;  4G7O F;  4G6Q A;  2G9W A;  2ISY A;  2M87 A;  4OIP F;  5LGU A;  3GX4 X;  2JZY A;  4GYG A;  2PN6 A;  4O3M A;  2DBB A;  3WU0 A;  3VEP A;  3J80 Z;  5D5W B;  3Q9V A;  4RS8 A;  3F21 A;  2STT A;  1LEA A;  3KET A;  1GXP A;  2WC2 A;  3DKW A;  1SD6 A; 
#chains in the Genus database with same CATH topology
 1RES A;  4Y13 A;  3MFK A;  3L2Q A;  2HXI A;  2VI6 A;  4XLN F;  1MKM A;  4G9Y A;  5D5X B;  2HQA A;  4OU0 A;  5JHF A;  2EZI A;  2G0E A;  2GOM A;  2H09 A;  2RGV A;  3I9V 2;  2VL8 A;  1X3Z B;  3VDX A;  2VBW A;  3QOD A;  1Y1W J;  4KUM A;  4I0B A;  4EM0 B;  4MQ9 F;  1TQI A;  3C2B A;  2G7H A;  3LSI A;  2HTS A;  1RR7 A;  2P8T A;  2QUF A;  3K70 C;  3QPH A;  4X1E A;  4KIF A;  1BI2 A;  1K6Y A;  2XF6 A;  5E8G A;  4YII A;  2P7C B;  1JUS A;  4L9T A;  3ULQ B;  4A3D J;  5JLW A;  3U1D A;  4A6D A;  4XKW A;  3VYR B;  4MEX F;  2IA2 A;  4Y33 A;  2FQ4 A;  6PAX A;  3QOE A;  2ZSI B;  3R60 A;  2QBY B;  1W7P B;  2HOE A;  1R1U A;  2CQX A;  4CCL A;  1GVD A;  3C2H A;  2XAS A;  1S9H A;  1X1D A;  2XB5 A;  1ZLJ A;  4XQF A;  4X0G A;  2E2J J;  5C44 J;  3MKY B;  2E7W A;  4BHB A;  1OKR A;  3N4M A;  2NYX A;  3ZGK A;  4IRG A;  3GO5 A;  1J7K A;  3T0Y A;  2Y0M A;  1R5H A;  2LRD A;  1TLH B;  3B6A A;  1OR7 C;  4HF0 A;  3PIP F;  3TDU C;  1K78 A;  1YJN I;  2DT6 A;  4ZYG A;  1QA6 A;  3DPT A;  2DXI A;  1G59 A;  1A35 A;  4F3Q A;  3OYC A;  3JRE A;  4IHY A;  2Y69 H;  5KK1 A;  1W5T A;  1L3L A;  1RR8 C;  3KYC B;  3VPR A;  1RC9 A;  2R7V A;  4C2T A;  3Q0V A;  1FLI A;  3DKY A;  4A3K J;  1X4O A;  1BJZ A;  1LDD A;  3VYU B;  2ZC2 A;  5IT3 A;  1PP7 U;  4BXU A;  2IS1 A;  4NQW A;  3RDI A;  3IKT A;  1MND A;  4C9Y A;  3HC7 A;  2QEX I;  1UEL B;  1JE8 A;  4F92 B;  4DQ2 A;  2GZW A;  4CCN A;  3DLL F;  1SEU A;  1T38 A;  3QYE A;  5ILV A;  1XCB A;  3HBL A;  3WTT C;  3BG3 A;  3BG5 A;  1ETK A;  4PJL A;  1ZAO A;  2Y30 A;  2MA3 A;  1O3Q A;  2A6E F;  4LIT A;  3BTL A;  5K5R A;  4BE2 A;  5E3M A;  2J5P A;  2K27 A;  3K10 A;  2KIS A;  3FMS A;  2M0C A;  3AG1 H;  2ECB A;  4GO1 A;  5EGO B;  2LBF B;  1M1E B;  2E1N A;  2W85 A;  1FOY A;  2L4A A;  2QZ8 A;  1GT0 C;  3RSN A;  4RB3 C;  5DDG A;  2OQR A;  3DTI A;  3LQR A;  3KP6 A;  3KP5 A;  4F55 A;  2HTJ A;  1VND A;  2A5W A;  2GAU A;  3K4J A;  3IKV A;  4NC8 A;  2K4B A;  1T8I A;  2LMD A;  3SEZ A;  1L0O C;  1P2F A;  2VQG A;  3I64 A;  2H8R A;  2DFI A;  2YU9 J;  2ZME B;  4EM2 A;  4MTE A;  1ETX A;  3CJT B;  4AYB N;  3D0S A;  2LKX A;  2V1D A;  1WJC A;  4XON A;  1XX5 A;  1Q1H A;  3HOV J;  1JT6 A;  1YW7 A;  1B8I A;  1EJ9 A;  5DUI A;  1YIT I;  2DI3 A;  4OAY A;  4RGR A;  2DAO A;  5K7H A;  1E3H A;  1WGX A;  2CS3 A;  3EUH A;  2LY9 A;  3MWM A;  1JHF A;  5L3G A;  1H9T A;  5K1Y A;  2HPI A;  2KLO A;  3EUA A;  1MMG A;  2COM A;  3G1O A;  4B48 A;  1XSV A;  3C2G A;  2EFQ A;  1MBK A;  3HOT A;  3RPQ A;  1YX5 A;  4ENK A;  3ZN1 A;  2R7D A;  2DOE A;  1EKE A;  2PQ8 A;  1SVL A;  5ED4 A;  1VQ7 I;  5FLX Z;  4BDY A;  3JRD A;  3OYG A;  4RAY A;  2M8G X;  4E70 A;  2X6O A;  3CC7 I;  3QU6 A;  3CF5 F;  3G1M A;  3LSG A;  2VKV A;  2EV6 A;  4P9F A;  4PZJ A;  5K7F A;  3L2R A;  4M72 A;  2PFB A;  3AG2 H;  3WG7 H;  4AIK A;  5L3D A;  3K4B A;  5BMZ A;  2STW A;  1TTY A;  1GLN A;  3ZQ7 A;  2CV2 A;  5HVQ C;  1A5J A;  1BA5 A;  2F5V A;  4PCQ A;  5D4S A;  3FF5 A;  1KA8 A;  1B6A A;  2EQR A;  2FD5 A;  3FBN B;  1T08 B;  2R5Y B;  1TC3 C;  4BHP A;  2GIV A;  2R7W A;  3KZZ A;  1C0W A;  3HUG A;  5J8C A;  4E7Z A;  3PSF A;  3D5R C;  5EZH A;  2LP0 A;  2X0L A;  3TP3 A;  1X3U A;  4A3G J;  2EJR A;  1F5T A;  4QWQ A;  5FD5 A;  2HU9 A;  2KMU A;  2MBF A;  4IXA A;  3TGN A;  1OCC H;  2WAF A;  2V9V A;  5FFX A;  4E4H A;  4RM2 A;  3S8P A;  4A3I J;  3L2C A;  2XC7 A;  3I59 B;  4KFC A;  1TQM A;  4NBQ A;  5DCM A;  2F4O B;  3KP7 A;  2R5Z A;  2XRN A;  2ZBK A;  3HB9 A;  3A4C A;  3H0D A;  3CUQ C;  3PQJ A;  1ERD A;  3H9Q A;  1W36 D;  1VQ8 I;  1V5F A;  3EET A;  2Q2E A;  3RKW A;  2CH0 A;  1W7P D;  3NQO A;  5HNH A;  3HPG A;  2HPM A;  1BC8 C;  2R7R A;  5M5Y J;  1Z3Y A;  3KEO A;  2E34 A;  2NVU B;  2W48 A;  4RB2 C;  3ZMV A;  2YR2 A;  5FKN A;  1ZR2 A;  5FLV A;  2HI3 A;  3LNQ A;  3G6E I;  3OSG A;  4M6X A;  4ZH4 F;  3C3W A;  3ABT A;  1XN7 A;  3KFW X;  1KQ0 A;  1PP8 F;  1ZRD A;  3IP4 B;  3ZR8 X;  4IZZ A;  3O6B B;  1F9N A;  4MLO A;  5ILS A;  1OCP A;  4YIR X;  1IG7 A;  2CUE A;  5E1X A;  3ZQL A;  2XAJ A;  1LE8 A;  1R4N B;  3A02 A;  3KP3 A;  4B3A A;  3HOX J;  1IZ1 A;  3ZOB A;  2MD0 A;  3FXU A;  2COB A;  3KLO A;  1OMI A;  4WXC A;  2O9L A;  2F4I A;  4RGU A;  5DV5 A;  2Z9O A;  3CCR I;  4UUV A;  4AD9 A;  1Y1V J;  2D1V A;  2DN0 A;  3HDD A;  1ZG1 A;  1KON A;  1Z3X A;  4R8H A;  1USS A;  2KRC A;  2R7F A;  4JYK A;  1XTA A;  2IGM A;  4D9J A;  2FXA A;  2QEN A;  3Q0W A;  4EJW A;  1BIB A;  1XC5 A;  3TKY A;  3WE2 A;  2OAZ A;  5GAD J;  3BG7 A;  1DQU A;  2WAQ N;  2ZKZ A;  4C3J J;  1YS6 A;  3K4L A;  3MEX A;  4OMZ A;  5BNG A;  2CGP A;  3CCL I;  2GXB A;  1STZ A;  4HF1 A;  3O3K A;  4D7N A;  1ETO A;  5IOY A;  4AUX A;  4BXX J;  3OR2 C;  4Q48 A;  4BH9 A;  3OYD A;  2F6C A;  4BE1 A;  3A01 A;  3K70 D;  3H5A A;  5IYC J;  3BWG A;  5FKK A;  5FO5 A;  4GDF A;  3JTH A;  2CW0 F;  2L7Z A;  1XSD A;  2W00 A;  2LLK A;  4WXD A;  3GCM A;  4XLH A;  4ZTF A;  3HGG A;  3IRR A;  1H9G A;  3F6V A;  3SQN A;  2EK5 A;  3WTZ A;  1FYK A;  1UG0 A;  2CUJ A;  2CW8 A;  3V7R A;  3S3M A;  5TGT A;  4ENJ A;  3DV8 A;  3W2W A;  4N9I A;  2MH9 A;  2HEO A;  3DBL B;  2QKM B;  2ISZ A;  1HDD C;  4BU2 A;  5BQT A;  2XHK A;  5CKT A;  3H92 A;  4WCG A;  9ANT A;  2DDB A;  4GCV A;  4UUS B;  1MBF A;  1KU9 A;  3L1P A;  1YQA A;  2K3P A;  3ZMT A;  4FX0 A;  4DBR A;  2OU2 A;  2XGD A;  1YIO A;  2OZU A;  2VJ5 A;  1DDN A;  5E17 F;  2LOO A;  2IS2 A;  1LVA A;  3MKL A;  4ZDO A;  2EFW A;  2ESH A;  1H0M A;  2FBK A;  5FB2 A;  3C7J A;  3CMM A;  1U2W A;  2IGO A;  2V6C A;  2FE3 A;  1YLF A;  3NAR A;  3A03 A;  4BHC A;  1W0U A;  2TRT A;  3BJA A;  2P4W A;  2HOS A;  1T95 A;  2ME0 A;  2VJ4 A;  4DZP A;  1AWC A;  3KE2 A;  1ORK A;  4ZYE A;  1IV8 A;  3E5U A;  3OYI A;  4YEL A;  1XMX A;  1IGN A;  1Z21 A;  4OIO F;  3M8J A;  5IOZ A;  4C3H J;  2DMQ A;  4R1H A;  3K1M A;  1KYW A;  1TNS A;  3KEQ A;  3GFL A;  3C1D A;  3GW2 A;  1EF4 A;  4II2 A;  3WU1 B;  3VFZ A;  1PUE E;  1DU0 A;  3I4N J;  1Y8Q B;  1S7A A;  2DLL A;  5J1R A;  3QYF A;  4M71 A;  3GUD A;  1QRY A;  3OYM A;  2EFO A;  2VE9 A;  1QZY A;  2DT7 B;  3SJM A;  2NS7 A;  4XOR A;  5HDG A;  1G3S A;  2VKH A;  3T8T A;  1D8J A;  2LFB A;  4XLP F;  1P92 A;  3MZ8 A;  5M3F J;  2AXT C;  1BI1 A;  3NRV A;  2DJN A;  5FRM A;  4M9X A;  3OYN A;  2XPW A;  1MJ9 A;  2MD5 A;  4XBF A;  1ZGJ A;  4K2E A;  4NC6 A;  1Z1D A;  1E17 A;  3VYS B;  3EUH C;  1BI3 A;  3LMM A;  5KCM A;  3ROU A;  4WK8 F;  2HFH A;  4PJN A;  2DYR H;  2OCC H;  3G73 A;  1QZE A;  3FMR A;  4HNV A;  3HGY A;  1MBJ A;  4B09 A;  3I4M J;  3OYE A;  1JKO C;  4LOC A;  2EB7 A;  1Z91 A;  4A0Y A;  3M3Y J;  2NS0 A;  3WGG A;  2O8X A;  4ZTJ A;  3BRO A;  3FIS A;  2Z3Y A;  4CYC B;  1X1A A;  2NVY J;  3D5L A;  2O03 A;  4C2U A;  2KRH A;  2VJJ A;  4HST A;  4XR6 A;  3OY9 A;  2JPB A;  1VQO I;  2EIJ H;  5FD6 A;  3V7C A;  3KLN A;  3TDZ C;  3V8J A;  3RI4 A;  4IOC F;  3OMY A;  3IRQ A;  1JKP C;  2GIZ A;  4D7M A;  3U1K A;  5KNL A;  3HZJ A;  3K0L A;  3R0A A;  5DYM A;  2BE5 F;  5FGM A;  2BY2 A;  3F8F A;  3LAJ A;  2QSF X;  2ZFW A;  1UAA A;  1MGT A;  1Y6I A;  2VAS A;  1YX3 A;  2TCT A;  3FXJ A;  2BVM A;  4WWC A;  2AXL A;  4LK0 F;  1E2X A;  4CUG A;  2A6H F;  3SZP A;  1CF7 A;  3BJO A;  2ZSH B;  2Z1D A;  2K4J A;  3TO9 A;  1D3Y A;  1P4W A;  2E5Z A;  2KP6 A;  1R5G A;  2HDD A;  2JMW A;  3S2D J;  2K85 A;  1TBX A;  3F8N A;  1IC8 A;  5C4X J;  4BE0 A;  2LDU A;  2QSG X;  1Y56 A;  4FE4 A;  4EM1 A;  1UZC A;  1P7I A;  2FBI A;  1KZH A;  2FA5 A;  5EJC A;  4U7D A;  5BPD A;  4E7L A;  2GA1 A;  3I59 A;  4ENM A;  1N77 A;  1V5G A;  3ZMD A;  1R9T J;  4UVA A;  2IXS A;  4CCK A;  4U0W A;  4J01 A;  2KIM A;  3TW7 A;  4C2M J;  1TQP A;  4BYY A;  2P5L C;  3DFG A;  4GFB A;  2G7U A;  4IHS A;  3HEF A;  5E79 C;  1VTN C;  3PM1 A;  1ZYR F;  2LY2 A;  1P6R A;  4RGX A;  1WHU A;  1SFX A;  3DCF A;  5D6E A;  3CJN A;  4LLG F;  3GBG A;  5JHU A;  4A12 A;  2V6E A;  2L4M A;  3CCU I;  2MC3 A;  2HZT A;  4DJA A;  4IPA A;  4CYD A;  3T8R A;  4A3L J;  1X3W B;  3I58 A;  3JRF A;  2L9V A;  5EF6 A;  3E6C C;  3BQY A;  3CP8 A;  1CF7 B;  1S5L C;  2VUM J;  1ZTR A;  2HQR A;  3PUF A;  4HBL A;  2ID6 A;  3L2U A;  5D5U B;  4OOI A;  3DKX A;  1CGP A;  3CP2 A;  3MCZ A;  4Z2Y A;  1DPU A;  5HOD A;  2Z99 A;  5HS9 A;  3TW6 A;  4BKX A;  3JSP A;  4IRH A;  2YX7 A;  4A0Z A;  2HYJ A;  5E3L A;  3OYL A;  1TL8 A;  3KEY A;  4S0H B;  3LQQ A;  2VBZ A;  4P1W A;  3TO6 A;  1ZRF A;  2BW3 B;  4I99 C;  1YOV B;  4FQG A;  2RVC A;  5GP9 A;  4ZYA A;  3J7Z I;  2O6G E;  1VQK I;  2XVC A;  3J81 Z;  3KZY A;  2LKP A;  5BPI A;  4KIT B;  1UJ8 A;  2ELJ A;  4A69 C;  1D8K A;  2XF5 A;  3P9C A;  1Y39 A;  1B4A A;  2ZME A;  2L3D A;  3RTR A;  1CQT A;  4TV7 A;  1U9N A;  3HOZ J;  4ESB A;  2MYS A;  3JRC A;  3V7S A;  2HQ5 A;  4IHT A;  5HDN A;  5LRS A;  2ACJ A;  3ML6 A;  1K4T A;  4LB5 A;  1HDP A;  4HYE A;  1D0X A;  3TL4 X;  1FOK A;  1VZ0 A;  4FHT A;  4KDP A;  4A3F J;  2V1U A;  4CZZ A;  2OPT A;  1UCR A;  5DM7 F;  1ACI A;  3O8G A;  1JJ6 C;  1BJA A;  4H4K C;  1JTY A;  3V8K A;  2JPC A;  4CO8 A;  2WBM A;  3WOD F;  2FU4 A;  1QNT A;  2M0M A;  4RB1 A;  3W6K B;  3L7W A;  1Q1V A;  2X6X A;  1D1A A;  3OOP A;  4A93 J;  3S3O A;  3JW4 A;  5IYD J;  3I71 A;  5L3C A;  4HEA 2;  5GTH C;  2F48 A;  1LJ9 A;  1K4S A;  4B44 A;  4ZYD A;  3DF8 A;  5K7Z A;  1SD5 A;  2JT1 A;  4CDG A;  4Y52 J;  1O3S A;  1LFB A;  4Q5S F;  3E6D A;  4M3B A;  2XSJ C;  3S17 J;  1IN4 A;  1YJ9 I;  3DP7 A;  3O8H A;  2UXN A;  3OL4 A;  3RPU D;  5M5W J;  2HVS A;  1V54 H;  4QIW N;  2XGE A;  1K78 B;  2E1M C;  4AVZ A;  2IA1 A;  2FX0 A;  2O5R A;  3H5N A;  3H9J A;  2VOP A;  2HKO A;  3H36 A;  5F0H A;  1KYZ A;  4I98 B;  5CVI A;  3IH2 A;  1W7P A;  3CCQ I;  5GPA A;  3G1L A;  1J2X A;  4IQ4 A;  5ICG A;  2CJJ A;  2MW8 A;  4HOB A;  4IL6 C;  4L5I A;  5F0C A;  3S93 A;  3LAP A;  3QPS A;  2E60 A;  1XS9 A;  1TWF J;  3FK6 A;  5F64 A;  2VIX A;  3D5S C;  4JQF A;  3RIR A;  3OL3 A;  2LTP A;  1IDY A;  1KU7 A;  2NVX J;  3PNT A;  3EYI A;  2QBY A;  3H3U A;  3FXK A;  3PNY A;  3L09 A;  2UXX A;  2Q0O A;  5H20 A;  1JXS A;  3P9I A;  4BAY A;  4FT8 A;  1UHS A;  1X2N A;  2IAI A;  3DU6 A;  4D5C A;  2K86 A;  5HDK A;  2JA5 J;  5HS7 A;  1T2K A;  2Y48 A;  3U9G A;  4ZC3 A;  5LHH A;  2OCE A;  3KX2 A;  2ZJP F;  1LQ1 A;  2IW5 A;  4KN7 X;  4LMY A;  1R6R A;  1U8B A;  3N05 A;  2K9M A;  4LG0 A;  3OS2 A;  3RKY A;  2L9N A;  3EUK L;  2DW4 A;  1XMA A;  1HLV A;  2ZNZ A;  2ZO4 A;  4PGG A;  5DEQ A;  2QA4 I;  4CGZ A;  1P4A A;  4I01 A;  1OQY A;  2KL4 A;  5TIS C;  2DOA A;  4HZF A;  3GTG J;  4BQN A;  5FJ8 J;  2DOF A;  5LGT A;  4BGD A;  3HRU A;  3S16 J;  1LEB A;  1SC7 A;  3S15 J;  2XRL A;  1RIO H;  2VT2 A;  4JX6 A;  4L5E A;  1BOB A;  4IF4 A;  2NRA C;  1I50 J;  2JJ7 A;  2R7Z J;  3IV5 A;  3CDL A;  3GYH X;  2EIM H;  3BJ6 A;  5CLS A;  2E2I J;  1Z6R A;  4F7Z A;  4DYQ A;  4LD5 A;  1FWZ A;  4A3C J;  3BPX A;  3K4N A;  3J7Y J;  5CQE A;  3EYY A;  3UNG C;  3ELK A;  1APL C;  1QGP A;  3F72 A;  4RAF A;  4UB6 C;  1G6N A;  2IVM A;  5FKL A;  4V2F A;  3GTJ J;  2JA6 J;  2H6C A;  2DA4 A;  4ZJZ A;  4WXH A;  3C18 A;  4LLL A;  1J9I A;  1B1B A;  5EEH A;  2A68 F;  2OA4 A;  1WH7 A;  2ZXJ A;  1JUP A;  1NG6 A;  1R7J A;  1KGS A;  2YX4 A;  4F91 B;  1F36 A;  4I09 A;  2M7B A;  3RQ4 A;  4EJV A;  1FOW A;  3GTM J;  2VB6 A;  2WB1 A;  3DEU A;  2JVG A;  3GTQ J;  1I1S A;  1JTX A;  5TJJ A;  4L0Z B;  2LH9 A;  2B9S A;  1FOX A;  4Z6Y A;  1BI0 A;  2CUF A;  4V19 K;  2X48 A;  1XG1 A;  2MSY A;  2EZK A;  4KIC A;  2CYY A;  5GTI C;  1O57 A;  5FRN A;  1D5V A;  5D5V B;  4HA8 A;  3GF2 A;  4A5N A;  1SFU A;  1VQ5 I;  2M3A A;  1H8A C;  4DW6 A;  2JUG A;  2DU9 A;  3ZQH A;  5KAF C;  1B72 B;  1XD7 A;  2VQH A;  3G4S I;  2RV8 A;  1WQ2 A;  2WB1 N;  2VC0 A;  3PNV A;  2J5O A;  1WFX A;  3WTY C;  1Z7L A;  4FAS D;  3BLY A;  3OOU A;  1U0J A;  2P6S A;  2X4H A;  4QLC U;  4HF2 A;  4LG0 B;  2DTR A;  3WGH A;  1TWA J;  3GTP J;  2A69 F;  1TNT A;  3SHF A;  4OIQ F;  1ZR4 A;  2L9S A;  3RZO J;  3IUO A;  1FC3 A;  4XNF A;  3ABK H;  3SFZ A;  2BV6 A;  2IPQ X;  2KDO A;  2EZH A;  3LSM A;  1NH3 A;  3TOA A;  1R1V A;  4AC0 A;  1SFO J;  1OCZ H;  4MHG A;  1I6X A;  2V9P A;  2F5F A;  2DPD A;  3E97 A;  2Y31 A;  3GFI A;  4E6K G;  1OFC X;  2HKX A;  4UY8 I;  5DS9 A;  4F52 A;  2NOJ B;  2E5N A;  3FXO A;  5DM6 F;  1D1C A;  5EDN A;  3OYK A;  2Q1Z B;  2L9R A;  1JUM A;  3H3Z A;  1SAN A;  3QP5 A;  2HOT A;  2QQ8 A;  3UR3 C;  2QSH X;  1REP C;  1AKH B;  3QPT A;  1WZ2 A;  1IJW C;  1BN5 A;  2VQC A;  3P5J A;  2R7U A;  2GXA A;  3F0C A;  2K9N A;  3A0B C;  4XOT A;  3JR9 A;  2IBD A;  2DFH A;  1WRJ A;  5L3B A;  4IHW A;  1ZHF A;  3HSE A;  4HX7 A;  1BOA A;  2M8E A;  1RNL A;  3K2A A;  3RKQ A;  4KMU X;  2CU7 A;  1FP2 A;  3OIO A;  1BBY A;  1MBE A;  3WU2 C;  3X2Q H;  3BQZ A;  2K7L A;  4PK4 A;  1ZRE A;  4F93 B;  2W84 A;  3FX3 A;  1S29 A;  1VQ6 I;  1LB2 A;  3BR6 A;  3AG3 H;  2XGX A;  2CO5 A;  4ZZL A;  1TT0 A;  5JLX A;  5EG0 B;  3OSF A;  1IDZ A;  2FBH A;  3LWF A;  3HL2 A;  4U87 A;  3ZQC A;  2HS5 A;  4HSR A;  1A36 A;  1WCM J;  2MC4 A;  3BZK A;  2L5Q A;  4EJU A;  1V55 H;  3IC7 A;  1GV5 A;  1V3F A;  2BGC A;  4BBS J;  4EVI A;  2W57 A;  2LD5 A;  2YPR A;  2W25 A;  4D5F A;  4ON0 A;  3F23 A;  1JKQ C;  2L0K A;  4EJT A;  5ICF A;  3ESW B;  2FEZ A;  3JCU C;  2NAZ A;  3CTA A;  4PSX A;  2V79 A;  1B9M A;  1MZB A;  3IL2 A;  4ESF A;  4QPO A;  5LBQ A;  4KIB A;  2GA2 A;  1MBG A;  3TMO A;  4XOP A;  3AKZ A;  3KYD B;  3BCB A;  1QVU A;  5D8K B;  4UUT A;  3WHC A;  4Y17 A;  1P4X A;  1TT5 B;  2P5V A;  3CCS I;  3DEE A;  3W6J B;  2HWV A;  2X1E A;  3AFH A;  3H3V K;  3Q3S A;  2AS5 F;  2PI0 A;  1YRN A;  2Y9Z A;  1U5T C;  1MSF C;  2XF7 A;  1FIP A;  3F8B A;  1SFK A;  3CO7 C;  4UXN A;  5FFZ A;  2QKL B;  2ADU A;  3VSK A;  3ABU A;  1OLT A;  4HRI A;  4MFE A;  1MMS A;  1NG7 A;  5LEJ A;  1FBS A;  4KA4 A;  2UV1 A;  1E3O C;  4KT6 A;  3BC8 A;  3R61 A;  4XRS A;  1I1G A;  2F5C A;  3F3X A;  2H8W A;  5DCM B;  2DPU A;  2FOW A;  5F1J A;  5J4Y A;  3L2V A;  2R7X A;  2A61 A;  4XN0 A;  4RBO A;  3BR2 A;  4N0B A;  3OYA A;  1AA7 A;  2IEK A;  2VPR A;  3CMA I;  2LRE A;  3B73 A;  5DD8 A;  3ZXS A;  2Z16 A;  1JJ8 C;  3R0J A;  1NHA A;  3QWL A;  2P0W A;  1J5Y A;  5ICC A;  1IN8 A;  2DT5 A;  4M6V A;  3SZT A;  3ZRG A;  3ZQI A;  4YIF A;  1POG A;  4JX4 A;  3PL8 A;  5HOO A;  3VSL A;  3ABM H;  5CJ9 A;  2WY8 Q;  1UB9 A;  4WF2 A;  3S32 A;  2EPF A;  1UFM A;  5JFR A;  3GFM A;  2L7K A;  3Q0U A;  3PO2 J;  1HQC A;  5F27 A;  3FHN A;  3AL0 C;  1MD0 A;  3BP8 A;  2W24 A;  3BPV A;  2P81 A;  2PBI A;  3JRH A;  1MW7 A;  1IRG A;  4GRI A;  4BY7 J;  1SVM A;  1SAU A;  3CME I;  3FXQ A;  3K1P A;  4XRM A;  3I3L A;  4RB0 A;  1OCO H;  3CCM I;  4D1Q A;  4PJ0 C;  1DGR M;  3OR1 C;  4YG2 F;  3BZC A;  3QPL A;  2XAG A;  2DA7 A;  3PFY A;  4OWR B;  2TDX A;  2K9Q A;  2CWE A;  3S1M J;  3LL7 A;  3K69 A;  3SDB A;  2R93 J;  4HV6 A;  4L5J A;  2A5Y B;  3COA C;  4M3E A;  4LLN A;  2YUS A;  1Z6T A;  1E3P A;  1QQI A;  3IAS 2;  3KIO A;  3ECH A;  2WV1 A;  2L2O A;  2CSO A;  4MFD A;  2JTV A;  3ASN H;  1YRN B;  3AL0 B;  3CCJ I;  1YHQ I;  4IHX A;  2LR8 A;  3K2Z A;  3LSJ A;  4G6D A;  3Q5F A;  1QVT A;  1PUF A;  1R49 A;  1ZK8 A;  4Y3O A;  1E0E A;  3OS1 A;  1EA3 A;  3JRI A;  2DFE A;  1YI2 I;  4IEJ A;  2GQQ A;  3U2R A;  2ZXH A;  2V4J C;  2FNP A;  2RNJ A;  4OIR F;  5A2Q K;  3PO3 J;  4LJZ F;  4FTH A;  2FMY A;  2XIG A;  4XIC A;  1U3E M;  3S1N J;  3NWS A;  4UVC A;  1MMD A;  1UG2 A;  3VOE A;  5F0F A;  2F4M B;  4GXO A;  2DA3 A;  1U78 A;  1V4R A;  2XSD C;  4DGW B;  3HHG A;  4C3I J;  3J7A O;  1SD4 A;  2K3F A;  3ZQQ A;  5BS6 A;  1MSE C;  3SEQ A;  1NTC A;  2Z5U A;  2JVH A;  4E7K A;  5C3E J;  4EEF G;  3LSR A;  3EPZ A;  4XM3 A;  2WAD A;  3I54 A;  3E1S A;  2P6T A;  5B5E C;  4PFP A;  4P5O A;  2X6W A;  3FIW A;  3V4G A;  3DTK A;  1X1P A;  2OTL I;  1GXQ A;  1ETV A;  1HW5 A;  2K02 A;  2IGN A;  3K7A J;  3VB2 A;  2V1N A;  1A31 A;  4CHU A;  2XAQ A;  2VE8 A;  1HKT A;  3P9K A;  4BQO A;  5DUK A;  2PMH A;  1R4M B;  1QO0 D;  5KVR A;  1SD7 A;  5EGO A;  4HNT A;  2I8D A;  1OYY A;  2A3S A;  5CVV A;  5EG0 A;  4AVP A;  2OQG A;  1EH7 A;  2ZB9 A;  1F4K A;  1OR7 A;  3E0J B;  4JK1 X;  1FPQ A;  3HRS A;  2E2H J;  3WTW C;  4UNO A;  4IO9 F;  2NNN A;  2P5K A;  4M6Y A;  2CUZ A;  2JK3 A;  3BTJ A;  1RUN A;  1ZN2 A;  3CQZ J;  4YEJ A;  4Y15 A;  3G71 I;  3ZP5 A;  4Y7N J;  2A07 F;  2V1X A;  2WY7 Q;  2ZJ2 A;  3TOB A;  2E71 A;  2MLK A;  2PMU A;  4IOA F;  3HRT A;  1X1C A;  2QYO A;  2RAE A;  4EV0 A;  3LA2 A;  4HW0 A;  1A6Q A;  3WHB A;  5IT9 K;  2FML A;  4PJM A;  2VT3 A;  5CVU A;  2XRO A;  2M45 A;  3ZMZ A;  4L9V A;  4S05 A;  2RRE A;  2JSP A;  5H6R A;  2BXZ A;  5TRD A;  3J7A Y;  2D2W A;  2IJL A;  1YG2 A;  1I27 A;  5H2F C;  3RQI A;  1LFP A;  1TWG J;  4NHJ A;  3M1E A;  1JGG A;  1H89 C;  3VOD A;  5IY5 H;  2QQ9 A;  5E20 A;  1ZQ3 P;  4L9J A;  2B63 J;  5F1R A;  5K5Q A;  2HYF A;  2RQQ A;  2DYS H;  2ICW G;  2A05 A;  2M34 A;  4ITV A;  2VXZ A;  4IRI A;  4N4N B;  3OV8 A;  4MTD A;  1FBQ A;  2H1L A;  2ETH A;  1GV2 A;  4C30 A;  3R4K A;  2JN6 A;  1HXD A;  3LFK A;  2IRF G;  3JRA A;  1QPM A;  3WTS C;  5GAE J;  1ONV A;  2PG4 A;  2HZD A;  1V5E A;  3CDI A;  1WKM A;  4HX4 A;  3CJR B;  2KZG A;  3RCO A;  2Y2Z A;  4BJ6 C;  2HGC A;  1KQ9 A;  5KAI C;  4AU7 A;  2FUG 2;  1LFU P;  3I56 I;  1OPC A;  2E1C A;  1G8X A;  3BDD A;  3IWF A;  3OIQ A;  4X6A J;  2BZT A;  3RKX A;  4XMY A;  4BEH A;  1T0F A;  5CYV A;  3OWT A;  4A3J J;  4L0Y B;  3I5U A;  2PEX A;  1MIJ A;  5FKO A;  2K9L A;  3M4O J;  2EFN A;  3T5X A;  3ZQF A;  4IKF A;  2ESN A;  4S04 A;  2LSO A;  1ODD A;  3BTC A;  4DBQ A;  3BCA A;  4Q4Z F;  3ZQG A;  5LGN A;  4PSW A;  1YFH A;  2Y75 A;  3OS0 A;  1T98 A;  4HV5 A;  2KRF A;  3H9G A;  2NS8 A;  4RGS A;  5K5O A;  4RDU A;  3FM3 A;  2PMZ N;  5LD2 C;  1BIA A;  1I39 A;  5B1A H;  3JRB A;  3MN2 A;  2VPL A;  4U0V A;  2O0Y A;  2OZ6 A;  1W4M A;  2R3S A;  2DFF A;  1ITY A;  4R79 A;  1RPW A;  2ZNY A;  4L9N A;  3BTI A;  5B66 C;  4PFO A;  1X2M A;  4MIM A;  5HLT A;  1QHH D;  3JTG A;  1TW2 A;  3FM5 A;  3CC4 I;  2IS4 A;  1IF1 A;  3OYJ A;  3R6S A;  2F5D A;  1VQL I;  3SDG A;  1J0R A;  2XV4 S;  4I76 A;  3IAM 2;  3L2W A;  3H0G J;  2JSC A;  4II3 A;  2NNY A;  3IHU A;  2L7F P;  4I6Z A;  2JA8 J;  2EFP A;  5H6Q A;  4B43 A;  3QQA A;  2BVL A;  1RRJ A;  2R5Z B;  3F8C A;  1S72 I;  5E18 F;  4HQM A;  3BG9 A;  3B02 A;  5JI6 A;  4XKV A;  2AO9 A;  1XDS A;  4N4O B;  1EH6 A;  1AOY A;  2V9K A;  1ZKG A;  5J47 A;  3GTK J;  1MMA A;  3QAH A;  3ABL H;  1K79 A;  4LFU A;  1WJD A;  2KIU A;  4HDV A;  4MQV A;  5DCF A;  1I3Q J;  1OCR H;  3K4M A;  2R5Y A;  1T33 A;  3S1Q J;  2KPM A;  5HLG A;  2JWT A;  4O6J A;  1FT9 A;  4U7B A;  4XN3 A;  5IP7 J;  2ZCW A;  3E3V A;  4MGR A;  4B47 A;  2NXN B;  5HNF A;  1NK2 P;  4OAZ A;  2GXG A;  3F8M A;  2R7S A;  5E3N A;  2PJR A;  1T6S A;  3CLQ A;  2FSW A;  3GTO J;  1W5S A;  3EQL F;  3H35 A;  5LRR A;  2LNB A;  1QBJ A;  3HSF A;  2OTJ I;  2MH2 A;  3JAM Z;  3S1R J;  1W1W E;  2NVT J;  3B6C A;  4U0Y A;  2X6Y A;  2WAQ A;  1TWC J;  2VOO A;  2R7O A;  4HLY A;  1J09 A;  4P96 A;  2IT0 A;  2R4G A;  1IN5 A;  2XKP A;  3FWE A;  4A6E A;  1X19 A;  2Y0S A;  3J81 K;  2DK8 A;  4BDZ A;  1VQP I;  2QCO A;  3SZG A;  4IHV A;  2JUC A;  3IH3 A;  2OJE D;  3QOP A;  3HYI A;  4RAG A;  3GZN B;  1Y0U A;  2MAB A;  2ZFU A;  3H5R A;  5F6F A;  4CH7 A;  3DTE A;  3PUB A;  1MNM C;  4KNY A;  3I55 I;  3HOS A;  4JP0 A;  3VWB A;  1PYV A;  2R7Q A;  2XAF A;  1I6H J;  4W1U A;  2L02 A;  4O5V A;  3FMQ A;  2WTE A;  5EZG A;  1XCV A;  3F22 A;  4A5M A;  2B0L A;  3F9K A;  3WTX C;  3K4C A;  4JOM A;  2CQK A;  3TP0 A;  1VI0 A;  1D5Y A;  2BY1 A;  2ELK A;  1R5I D;  2F5E A;  2IP2 A;  5DTD A;  4I7H A;  1ZAR A;  3GME A;  1VQ9 I;  3BR5 A;  2FRH A;  4E7H A;  1OJL A;  2ZXI A;  1IUF A;  4WX9 A;  3GZ5 A;  5J40 A;  3PFI A;  1IXR C;  3BR1 A;  4QPQ A;  4AWX B;  1HKS A;  2LBF A;  4I0A A;  1FEX A;  3TO7 A;  5LHG A;  1HSJ A;  2MGQ A;  2JA2 A;  3W2V A;  3BR0 A;  4XRS G;  1HST A;  1FJL A;  4A3E J;  1SMY F;  2QGU A;  2EH3 A;  2HOA A;  3A0H C;  4EJO A;  1XGO A;  4A3M J;  2LVS A;  5D4R A;  3ECO A;  4B3X A;  4UV8 A;  4HNU A;  2LF8 A;  2CQQ A;  1FBU A;  2VLA A;  3E6B A;  2Z33 A;  1BW5 A;  4JBA A;  2XGC A;  3CCY A;  1Y8R B;  2XKO A;  2MFZ A;  3UKG A;  4CSW A;  1GVJ A;  5LLQ A;  1DU6 A;  1HCR A;  2QF7 A;  1YO5 C;  1VQM I;  2Q8K A;  1R00 A;  4IVN A;  1PUF B;  1AHD P;  5J1Y A;  3DEW A;  2BEO A;  2FQ3 A;  2KJB A;  2M4G A;  2XAH A;  1T0F C;  1X4P A;  2Y9Y A;  3MQ0 A;  1HBX G;  2HYG D;  4XLA A;  1JI8 A;  3OYB A;  1JKR C;  1JHH A;  3GLX A;  3BR3 A;  2O8K A;  1AKH A;  5CQG A;  1XGN A;  3FBI B;  1IRZ A;  4A2U A;  3GLL A;  1BM9 A;  4FCY A;  3HM5 A;  2DTZ A;  5AIQ A;  1LDJ A;  1GHC A;  5ICE A;  1VFC A;  2PJR B;  1FP1 D;  2LF7 A;  1QU3 A;  3OYH A;  2CFX A;  1FIA A;  1LDK B;  5IP9 J;  1J75 A;  4M74 A;  2WAE A;  2YS9 A;  2XPU A;  3DU5 A;  5AON A;  4GGG A;  1DPR A;  3QP6 A;  5IPA A;  3MKW B;  1MDM B;  1TZL A;  1R22 A;  2DDA A;  3CUO A;  3HKZ N;  4XKC A;  1MJA A;  2VON A;  1FMV A;  3ERM A;  2CQ7 A;  2PX9 A;  4XLF A;  2LY1 A;  5F08 A;  1U6G A;  3ZMU A;  4CIC A;  1RET A;  1S7E A;  2VJI A;  4G6T B;  4EGZ A;  4HX8 A;  5LFA A;  5EYR A;  5M3M J;  4EMS A;  4M73 A;  3ERE D;  2D5V A;  3S2W A;  3OIP A;  4ETS A;  1R71 A;  1EV7 A;  2QM3 A;  2KQR A;  2VKD A;  2M30 A;  2E35 A;  1N75 A;  3LSP A;  3P7N A;  1A04 A;  3DPU A;  4BL0 B;  1BL0 A;  4B8X A;  3RJP A;  3LST A;  3IH4 A;  3VYT B;  5AIP A;  1GUU A;  2XB0 X;  4BUP A;  3CUQ B;  4ENN A;  1EH8 A;  4M9S A;  4YFX F;  1B72 A;  4NC7 A;  3RPU A;  1RKT A;  1FYL A;  1G4D A;  1HKQ A;  3PIO F;  1KQ8 A;  3GEZ A;  1XGM A;  4XSZ F;  2K9S A;  4I02 A;  2OBP A;  2EV0 A;  3MD2 A;  3JAM K;  1YYV A;  4ZYH A;  1QZZ A;  4HLX A;  2GLO A;  1XMK A;  1YE9 A;  2FF4 A;  2BOL A;  2PMZ A;  3MMY B;  4J00 A;  1BC7 C;  2XUB A;  4BNC A;  1FTT A;  2L01 A;  4DOZ A;  2AQE A;  1B8I B;  2CG4 A;  3NEU A;  2V7F A;  3MVP A;  3K4K A;  4RA2 A;  4CYC A;  4G7Z F;  2WV0 A;  2X9D A;  3WGI A;  2ZME C;  3M7G A;  2VC1 A;  1ZGW A;  1UST A;  3CMY A;  2UWM A;  4G94 A;  4XRF A;  1UMQ A;  4LIU A;  1XB4 A;  2HVR A;  3REO A;  1O4X A;  2RNG A;  3DPL C;  4IJA A;  1NK3 P;  1O3R A;  5FRO A;  1O7F A;  4XLE A;  3U21 A;  5B3S H;  3GTL J;  3HOW J;  1U8R A;  2E36 A;  1RZ4 A;  2VKE A;  3GWZ A;  3V8L A;  4ZZD A;  3FHZ A;  4HG2 A;  3CF2 A;  5KHD A;  1HC8 A;  1ETW A;  2YSR A;  3HXL A;  1GDT A;  3AG4 H;  3S3N A;  2UZK A;  1U5T A;  1IXS B;  1ETY A;  2AHQ A;  1LUJ B;  2DMU A;  2CW7 A;  3E5X A;  2M9H A;  5J4V A;  1WSU A;  1DP7 P;  2EV5 A;  1ETQ A;  1UHW A;  2E1O A;  3CUQ A;  2M7A A;  1ON1 A;  1K6O A;  4M3G A;  4AM3 A;  2DA6 A;  2K40 A;  3NWT A;  1G3W A;  4Y4R A;  4LIV A;  1LPQ A;  1I3A A;  5CVJ A;  1T39 A;  2ZXW H;  2QLZ A;  2AQF A;  3K6G A;  2DA2 A;  4PDK A;  3MZY A;  3W3C A;  4BBR J;  4KN4 X;  2X51 A;  3CD6 I;  2VQL A;  4M9Z A;  3CES A;  4A0X A;  1ZG3 A;  4L18 B;  2L54 A;  3LSH A;  4W97 A;  1YJW I;  4CZC A;  2E19 A;  2Z2S B;  1VF9 A;  4NUB A;  1FSE A;  1I5Z A;  3TED A;  4QTR A;  4IX7 A;  1ZRC A;  1UHM A;  3DQV C;  3DLA A;  1DUX C;  2DCE A;  2DA1 A;  2UUZ A;  2JRM A;  4UV9 A;  4UB8 C;  1FZP B;  5FLM J;  1WJ5 A;  2DK5 A;  4PUS A;  1Z7U A;  3SFI A;  1WI9 A;  5B1B H;  4YFN F;  2XDV A;  4HPQ A;  3JSO A;  3BY6 A;  2O3F A;  1OYI A;  3KYL A;  5E1W A;  3DBH B;  1HOM A;  1N78 A;  2NOG A;  3ZCO A;  2VXD A;  2EIK H;  2DQR A;  1ZH5 A;  2EIN H;  4ZDP A;  4UUS A;  2VN2 A;  2QWW A;  3V42 A;  1IXC A;  4P55 A;  1O7L A;  1PDN C;  1JGS A;  2V26 A;  1HW2 A;  2EA4 A;  2HDC A;  2HDW A;  1TP4 A;  3ZPL A;  1IAW A;  2M4K A;  2EZL A;  1G3T A;  2KT0 A;  5IP6 A;  1MMN A;  1WI3 A;  4EQQ A;  5E8I A;  4HQE A;  3MKZ A;  3IWZ A;  1R58 A;  1U5T B;  2DMP A;  2EA2 A;  3HTU A;  2W7N A;  1MBH A;  3A01 B;  1ZEL A;  4OIN F;  5C4J J;  3CLO A;  3FKI J;  2R7T A;  4U88 A;  1S3J A;  2KKO A;  2NVQ J;  5J3L A;  4EAT A;  4NDL A;  1WJF A;  3PJR A;  3WTV C;  4AYB A;  2DJI A;  3L9F A;  2GM4 A;  1YW9 A;  3S2H J;  2A6T A;  3QU3 A;  1TWH J;  3O2P E;  4FIS A;  2RQP A;  1W0T A;  3FXM A;  3FZV A;  5GPC A;  2GWR A;  4FE7 A;  1KU2 A;  4YRV A;  3HKZ A;  4BXF A;  4D0P A;  1Z0X A;  2BYV E;  4UVB A;  1IW7 F;  2XPV A;  1FSH A;  2L7M P;  2CV0 A;  3G2B A;  3M9A A;  2W4S A;  1F43 A;  2BXY A;  2ZJR F;  2DOD A;  4KYW A;  4NNJ A;  2KIF A;  5IT9 Z;  3E6M A;  5GAG J;  3S14 J;  1OCT C;  4RMN A;  3WTU C;  1JT0 A;  3FXR A;  4XSX F;  1LE8 B;  3Q9S A;  2IS6 A;  1XPX A;  2OF7 A;  2W82 A;  1ON2 A;  2DMT A;  2KZV A;  2RN7 A;  2HVQ A;  3K1N A;  1SFE A;  2LK2 A;  4AID A;  4CXF A;  1K83 J;  4CA0 A;  1IN6 A;  1BR1 A;  3WE3 A;  3ZMS A;  4KIS A;  5D6F A;  1IUY A;  1ZG5 A;  5FLX K;  1PVE A;  2B7E A;  1HA8 A;  2BW3 A;  4MNU A;  2ELH A;  4E7J A;  3CDH A;  2H1K A;  2MG4 A;  5IYB J;  1ENH A;  1S8N A;  2BHZ A;  1J59 A;  3HTS B;  3F6O A;  2ME6 A;  3PSI A;  4B4C A;  1QHG A;  2Y0S N;  5HS8 A;  4XID A;  2Q2E B;  2HXO A;  3A1Y A;  4UHT A;  1Z9C A;  1FYM A;  3FDY A;  1AU7 A;  3G3Z A;  5DD4 A;  2MLG A;  2RKH A;  2OC6 A;  1FMW A;  2HR3 A;  1IV6 A;  3BG6 A;  5FKM A;  1S7O A;  5HLI A;  3HUG B;  1YS7 A;  3HG9 A;  4FET A;  1KU3 A;  1MNE A;  4V2G A;  2KHM A;  3WG9 A;  2O61 A;  3EDP A;  1ZLK A;  5E3O A;  4ESJ A;  4G12 A;  4PGH A;  1HF0 A;  2H27 A;  1ZGA A;  4BS9 A;  3MAJ A;  3CCV I;  2VBY A;  1D0Y A;  4G8X A;  5A2Q Z;  4OMY A;  4M3D A;  1SMT A;  1R36 A;  2CQN A;  4RLQ A;  4XLC A;  1O3T A;  3RYR A;  1N25 A;  2IGK A;  1RUO A;  1LNW A;  1QPI A;  4EGY A;  1MDM A;  4ABZ A;  4CCM A;  3BT9 A;  1DGW Y;  3GZ6 A;  2KJC A;  1B9N A;  3M07 A;  1P9Q C;  5GAH J;  2P7V B;  2VBX A;  5L3F A;  2OV7 A;  2JQ7 A;  1K7A A;  3N97 A;  4JX5 A;  2QQA A;  4XKB A;  2IA0 A;  2YU3 A;  2BY3 A;  1TW3 A;  1S6L A;  1WPK A;  1WJA A;  5JR3 A;  2ECC A;  4FX4 A;  2QVO A;  1F1Z A;  2OUM A;  1ULY A;  2EWN A;  4LGW A;  2GBY A;  5J8F A;  5JVT A;  2KDZ A;  2D45 A;  1VQ4 I;  3I0T A;  1RKW A;  3M1C A;  3LA3 A;  3AAF A;  5LEK A;  4H0E A;  4BY1 J;  1FY7 A;  3OYF A;  3M8E A;  2ID3 A;  3PQK A;  1RI7 A;  3HPH A;  1IN7 A;  2FOK A;  4ANJ A;  1FNN A;  2CFO A;  1H88 C;  3BOQ A;  5EEA A;  1LKX A;  4KMF A;  1Z77 A;  2R0Q C;  4RAZ A;  1WH5 A;  2CRG A;  3BZ6 A;  3GVA A;  5BOX A;  5CPR B;  4RLF A;  2QQB A;  5JVG F;  2H6B A;  3E5Q A;  4B1R A;  2H94 A;  2W1O A;  1XSX A;  4I2O A;  2FJ1 A;  3HJE A;  2RDP A;  5EEG A;  3T1B A;  4YFK F;  1IO2 A;  3K9T A;  4BQA A;  3NAU A;  3DXJ F;  4BQQ A;  4DZJ A;  3TQN A;  3LSK A;  2WWY A;  3HSR A;  4Q47 A;  2R92 J;  1X58 A;  1OYW A;  2M1B A;  5HLH A;  3DBR B;  4AIH A;  3FK7 A;  5L3E A;  2ZJQ F;  3QRF F;  2E1M B;  3HOU J;  1Z67 A;  4E7S A;  2PLY A;  5CVR A;  3M8F A;  5M5X J;  3JRG A;  5J6X A;  4MEY F;  3FXL A;  2DO7 A;  2JRT A;  4G7H F;  3L00 A;  2FNA A;  2LG4 A;  4N9H A;  1IRF A;  2PJP A;  4MO7 A;  4ASN A;  1WWX A;  3HHH A;  4NQW B;  4BJ5 C;  1W5C C;  4KT5 C;  5ERI A;  3SYT A;  1FTZ A;  2C6Y A;  4CCJ A;  1MJB A;  1VQN I;  5D8L B;  2X1D A;  2X1C A;  3KP2 A;  2GOX B;  3KP4 A;  3HIF A;  4AIJ A;  1FX7 A;  1HW1 A;  1DP3 A;  3HOY J;  4RM3 A;  2JA7 J;  3I4P A;  4J19 A;  1A6I A;  1MH4 A;  4KIG A;  4PJJ A;  3LOC A;  1WJE A;  1YIJ I;  4XK4 A;  2RC4 A;  1PJR A;  4LB6 B;  2CV1 A;  3LA7 A;  1XGS A;  2DMN A;  1MH3 A;  5F04 A;  4BJT A;  1D0Z A;  4QSH A;  3H1C A;  1WVR A;  4M3F A;  3HRM A;  1G3Y A;  2D1H A;  2LKS A;  3SXY A;  2OD5 A;  1G2H A;  2M5W A;  4XL9 A;  3W6V A;  4GYI A;  3J80 K;  4LG3 A;  3ISP A;  3CO6 C;  2BBY A;  3I53 A;  3D1N I;  1SAX A;  3KPH A;  1R1T A;  4DYC A;  1U9O A;  2M2E A;  4HDU A;  1Z05 A;  4DNC A;  4P9U A;  4A3B J;  3RYP A;  5ILU A;  3MZH A;  1BR2 A;  2EBI A;  4BAC A;  2EIL H;  5LHI A;  2K5C A;  1XDU A;  1Y0N A;  2LYC A;  3GXO A;  1LVK A;  3LFU A;  3CCE I;  3GFJ A;  2F2E A;  5E1Z B;  2O7O A;  1BW6 A;  3ZN0 A;  1P7J A;  1YW8 A;  1YTY A;  4IQJ A;  3CZ6 A;  2I10 A;  2I5U A;  2N8G A;  3CC2 I;  3KCC A;  1B59 A;  2E7X A;  4NB5 A;  3E7L A;  4CCO A;  1K61 A;  1R23 A;  2HQN A;  4HAM A;  4LK1 F;  3TBI A;  2DQL A;  2VOD A;  4G7O F;  4G6Q A;  1SVO A;  3ASO H;  1IRX A;  2KIQ A;  2G9W A;  2ISY A;  2HNH A;  1T56 A;  2M87 A;  3QYB A;  4OIP F;  5LGU A;  3GX4 X;  1X1B A;  2JZY A;  4GYG A;  4ZDL A;  2PN6 A;  3DWL E;  4O3M A;  2DBB A;  2LC2 A;  4DIQ A;  1BR4 A;  2DA5 A;  1WJB A;  3WU0 A;  2BHY A;  3ONQ A;  1D1B A;  3VEP A;  2BY0 A;  3J80 Z;  2KFD A;  4DYR A;  2CMP A;  3CJQ B;  5D5W B;  3Q9V A;  3KZI C;  4RS8 A;  4E7I A;  3W2A A;  3F21 A;  3A2K A;  3RZD J;  2WA0 A;  4KJZ A;  2STT A;  1LEA A;  4BEH B;  3KET A;  2XAU A;  3FKJ A;  1GXP A;  2WC2 A;  3DKW A;  5J1U A;  1OIS A;  1SD6 A;  2X85 A;  1W36 C; 
#chains in the Genus database with same CATH homology
 4Y13 A;  3MFK A;  4XLN F;  1MKM A;  4G9Y A;  5D5X B;  4OU0 A;  2H09 A;  2RGV A;  2VBW A;  4KUM A;  4I0B A;  4EM0 B;  4MQ9 F;  1TQI A;  2G7H A;  2HTS A;  2P8T A;  2QUF A;  3QPH A;  4KIF A;  1BI2 A;  5E8G A;  4YII A;  2P7C B;  4L9T A;  3ULQ B;  3U1D A;  4A6D A;  4MEX F;  2IA2 A;  6PAX A;  3R60 A;  2QBY B;  1W7P B;  2HOE A;  1R1U A;  2XAS A;  1ZLJ A;  2E7W A;  4BHB A;  1OKR A;  3N4M A;  2NYX A;  4IRG A;  3GO5 A;  1J7K A;  3T0Y A;  2Y0M A;  1R5H A;  1TLH B;  4HF0 A;  3TDU C;  1K78 A;  4ZYG A;  3DPT A;  5KK1 A;  1W5T A;  1L3L A;  1FLI A;  1LDD A;  5IT3 A;  1PP7 U;  4BXU A;  4NQW A;  3RDI A;  3IKT A;  1JE8 A;  4DQ2 A;  2GZW A;  1T38 A;  5ILV A;  1XCB A;  3WTT C;  1ZAO A;  2MA3 A;  1O3Q A;  2A6E F;  5K5R A;  2J5P A;  2K27 A;  3FMS A;  4GO1 A;  2E1N A;  2W85 A;  2L4A A;  2QZ8 A;  4RB3 C;  5DDG A;  2OQR A;  3LQR A;  3KP6 A;  3KP5 A;  2HTJ A;  2GAU A;  3IKV A;  2K4B A;  1L0O C;  1P2F A;  3I64 A;  2DFI A;  2ZME B;  4EM2 A;  4MTE A;  3D0S A;  2V1D A;  1Q1H A;  1YW7 A;  5DUI A;  2DI3 A;  4RGR A;  2DAO A;  3EUH A;  3MWM A;  1JHF A;  5L3G A;  1H9T A;  5K1Y A;  2COM A;  1XSV A;  2EFQ A;  3HOT A;  3RPQ A;  4ENK A;  3ZN1 A;  2R7D A;  2PQ8 A;  5ED4 A;  5FLX Z;  4RAY A;  4E70 A;  3QU6 A;  2EV6 A;  4P9F A;  4PZJ A;  4M72 A;  2PFB A;  4AIK A;  5L3D A;  5BMZ A;  2STW A;  1TTY A;  3ZQ7 A;  5HVQ C;  4PCQ A;  5D4S A;  3FF5 A;  1KA8 A;  1B6A A;  4BHP A;  2GIV A;  1C0W A;  3KZZ A;  3HUG A;  5J8C A;  2X0L A;  1X3U A;  2EJR A;  1F5T A;  4QWQ A;  5FD5 A;  3TGN A;  2MBF A;  4IXA A;  2V9V A;  5FFX A;  3L2C A;  3I59 B;  4KFC A;  1TQM A;  5DCM A;  3KP7 A;  2XRN A;  2ZBK A;  3CUQ C;  3PQJ A;  3EET A;  2Q2E A;  3RKW A;  1W7P D;  3NQO A;  1BC8 C;  3KEO A;  4RB2 C;  3ZMV A;  2YR2 A;  4M6X A;  4ZH4 F;  3C3W A;  3ABT A;  1XN7 A;  3KFW X;  1KQ0 A;  1PP8 F;  1ZRD A;  3O6B B;  1F9N A;  5ILS A;  5E1X A;  2XAJ A;  3KP3 A;  1IZ1 A;  3FXU A;  3KLO A;  1OMI A;  4WXC A;  4RGU A;  5DV5 A;  2Z9O A;  4UUV A;  4AD9 A;  2D1V A;  1ZG1 A;  4R8H A;  1USS A;  2R7F A;  2FXA A;  2QEN A;  4EJW A;  1BIB A;  3TKY A;  3WE2 A;  2OAZ A;  2ZKZ A;  2CGP A;  2GXB A;  1YS6 A;  3MEX A;  4OMZ A;  1STZ A;  4HF1 A;  3O3K A;  4BH9 A;  4Q48 A;  3BWG A;  5FO5 A;  3JTH A;  2CW0 F;  1XSD A;  4WXD A;  3IRR A;  1H9G A;  3F6V A;  3SQN A;  2EK5 A;  3WTZ A;  1FYK A;  3V7R A;  4ENJ A;  3DV8 A;  4N9I A;  2MH9 A;  2HEO A;  2ISZ A;  5BQT A;  2XHK A;  3H92 A;  4WCG A;  4GCV A;  1KU9 A;  1YQA A;  3ZMT A;  1DDN A;  4FX0 A;  2OU2 A;  1YIO A;  2OZU A;  5E17 F;  1LVA A;  2EFW A;  2ESH A;  1H0M A;  2FBK A;  5FB2 A;  3C7J A;  1U2W A;  2V6C A;  2FE3 A;  1YLF A;  4BHC A;  3BJA A;  2P4W A;  1AWC A;  3KE2 A;  4ZYE A;  3E5U A;  4OIO F;  4R1H A;  3K1M A;  1KYW A;  1TNS A;  3KEQ A;  3GFL A;  3C1D A;  3GW2 A;  3WU1 B;  3VFZ A;  1PUE E;  1S7A A;  2DLL A;  4M71 A;  3GUD A;  2EFO A;  2VE9 A;  1QZY A;  5HDG A;  1G3S A;  3T8T A;  1D8J A;  4XLP F;  1P92 A;  1BI1 A;  3NRV A;  4M9X A;  1MJ9 A;  2MD5 A;  4XBF A;  1ZGJ A;  4K2E A;  1Z1D A;  1E17 A;  1BI3 A;  3ROU A;  4WK8 F;  2HFH A;  3G73 A;  3FMR A;  4B09 A;  2EB7 A;  1Z91 A;  4A0Y A;  2NS0 A;  3WGG A;  2O8X A;  3BRO A;  2Z3Y A;  3D5L A;  2O03 A;  2JPB A;  5FD6 A;  3V7C A;  3KLN A;  3TDZ C;  3V8J A;  3RI4 A;  3IRQ A;  3K0L A;  3R0A A;  5DYM A;  2BE5 F;  5FGM A;  3F8F A;  3LAJ A;  2ZFW A;  1MGT A;  4WWC A;  2AXL A;  4LK0 F;  1E2X A;  2A6H F;  3SZP A;  1CF7 A;  3BJO A;  2K4J A;  3TO9 A;  1D3Y A;  1P4W A;  1R5G A;  1TBX A;  3F8N A;  2LDU A;  4EM1 A;  2FBI A;  2FA5 A;  5BPD A;  4U7D A;  2GA1 A;  3I59 A;  4ENM A;  3ZMD A;  4UVA A;  4U0W A;  2KIM A;  1TQP A;  4BYY A;  2P5L C;  3DFG A;  2G7U A;  4IHS A;  1VTN C;  1ZYR F;  1P6R A;  4RGX A;  1SFX A;  5D6E A;  3CJN A;  4LLG F;  5JHU A;  4A12 A;  2L4M A;  2MC3 A;  2HZT A;  4IPA A;  4CYD A;  3T8R A;  3I58 A;  1CF7 B;  3E6C C;  2HQR A;  4HBL A;  5D5U B;  4OOI A;  1CGP A;  3MCZ A;  4Z2Y A;  1DPU A;  2Z99 A;  5HS9 A;  3JSP A;  4IRH A;  2YX7 A;  4A0Z A;  3LQQ A;  2VBZ A;  3TO6 A;  1ZRF A;  2RVC A;  2O6G E;  2XVC A;  3J81 Z;  3KZY A;  2LKP A;  5BPI A;  1D8K A;  3P9C A;  1B4A A;  2ZME A;  2L3D A;  3RTR A;  4TV7 A;  4ESB A;  3V7S A;  4IHT A;  5HDN A;  5LRS A;  2ACJ A;  3ML6 A;  4LB5 A;  4HYE A;  1FOK A;  4FHT A;  4KDP A;  2V1U A;  4CZZ A;  1UCR A;  1BJA A;  3V8K A;  2JPC A;  4CO8 A;  3WOD F;  2FU4 A;  1QNT A;  4RB1 A;  3W6K B;  3L7W A;  3OOP A;  3JW4 A;  3I71 A;  5L3C A;  1LJ9 A;  4ZYD A;  3DF8 A;  1SD5 A;  2JT1 A;  4CDG A;  1O3S A;  4Q5S F;  3E6D A;  1IN4 A;  3DP7 A;  2UXN A;  1K78 B;  2IA1 A;  2VOP A;  2HKO A;  1KYZ A;  4I98 B;  5CVI A;  1W7P A;  5ICG A;  1J2X A;  4HOB A;  4L5I A;  3LAP A;  5F64 A;  4JQF A;  3RIR A;  1KU7 A;  3EYI A;  2QBY A;  3H3U A;  3L09 A;  2UXX A;  2Q0O A;  5H20 A;  1JXS A;  3P9I A;  4BAY A;  4FT8 A;  2K86 A;  5HDK A;  5HS7 A;  1T2K A;  2Y48 A;  3U9G A;  5LHH A;  1LQ1 A;  2IW5 A;  4KN7 X;  4LMY A;  4LG0 A;  3RKY A;  2DW4 A;  1XMA A;  2ZNZ A;  2ZO4 A;  4PGG A;  5DEQ A;  4CGZ A;  1P4A A;  4I01 A;  4HZF A;  5LGT A;  1LEB A;  3HRU A;  1RIO H;  2VT2 A;  4IF4 A;  2NRA C;  3GYH X;  3BJ6 A;  5CLS A;  1Z6R A;  4F7Z A;  4LD5 A;  1FWZ A;  3BPX A;  3EYY A;  3ELK A;  1QGP A;  3F72 A;  1G6N A;  2IVM A;  2H6C A;  4WXH A;  3C18 A;  4LLL A;  1J9I A;  1B1B A;  5EEH A;  2A68 F;  2OA4 A;  2ZXJ A;  1R7J A;  1KGS A;  2YX4 A;  4I09 A;  4EJV A;  3DEU A;  1I1S A;  5TJJ A;  4L0Z B;  1BI0 A;  4KIC A;  2CYY A;  1O57 A;  1D5V A;  5D5V B;  4HA8 A;  3GF2 A;  4A5N A;  1SFU A;  2DU9 A;  1XD7 A;  2RV8 A;  1WQ2 A;  2VC0 A;  2J5O A;  3WTY C;  2X4H A;  2P6S A;  4QLC U;  4HF2 A;  4LG0 B;  2DTR A;  3WGH A;  2A69 F;  1TNT A;  3SHF A;  4OIQ F;  1FC3 A;  3SFZ A;  2BV6 A;  2IPQ X;  3TOA A;  1R1V A;  4MHG A;  1I6X A;  2F5F A;  2DPD A;  3E97 A;  3GFI A;  2HKX A;  3H3Z A;  3QP5 A;  1REP C;  3QPT A;  1BN5 A;  1WRJ A;  5L3B A;  1ZHF A;  3HSE A;  4HX7 A;  1BOA A;  2M8E A;  1RNL A;  4KMU X;  1FP2 A;  1BBY A;  2K7L A;  1ZRE A;  2W84 A;  3FX3 A;  1S29 A;  1LB2 A;  2XGX A;  2CO5 A;  4ZZL A;  2FBH A;  3LWF A;  2HS5 A;  4EJU A;  3IC7 A;  1V3F A;  2BGC A;  4EVI A;  2W57 A;  4EJT A;  2W25 A;  2YPR A;  4ON0 A;  3F23 A;  5ICF A;  2FEZ A;  2NAZ A;  3CTA A;  2V79 A;  1B9M A;  1MZB A;  3IL2 A;  4ESF A;  5LBQ A;  4KIB A;  2GA2 A;  5D8K B;  4Y17 A;  1P4X A;  2P5V A;  3W6J B;  2HWV A;  2AS5 F;  2PI0 A;  1U5T C;  3F8B A;  3CO7 C;  4UXN A;  5FFZ A;  2ADU A;  3ABU A;  5LEJ A;  1FBS A;  4KA4 A;  3R61 A;  1I1G A;  2F5C A;  3F3X A;  5DCM B;  2DPU A;  2A61 A;  4N0B A;  3B73 A;  5DD8 A;  3R0J A;  1NHA A;  1J5Y A;  5ICC A;  1IN8 A;  2DT5 A;  3SZT A;  4YIF A;  5HOO A;  5CJ9 A;  1UB9 A;  4WF2 A;  1UFM A;  5JFR A;  3GFM A;  1HQC A;  1MD0 A;  3BP8 A;  2W24 A;  3BPV A;  2PBI A;  1IRG A;  3FXQ A;  3K1P A;  4RB0 A;  4YG2 F;  2XAG A;  2TDX A;  2CWE A;  3K69 A;  4HV6 A;  4L5J A;  2A5Y B;  3COA C;  4LLN A;  1Z6T A;  1QQI A;  3ECH A;  2CSO A;  2JTV A;  3K2Z A;  4G6D A;  3Q5F A;  2GQQ A;  3U2R A;  2FNP A;  2RNJ A;  4OIR F;  5A2Q K;  4LJZ F;  2FMY A;  2XIG A;  1U3E M;  4UVC A;  3VOE A;  4GXO A;  1U78 A;  1V4R A;  3HHG A;  3J7A O;  1SD4 A;  5BS6 A;  2Z5U A;  3I54 A;  2P6T A;  4P5O A;  3V4G A;  1GXQ A;  1HW5 A;  2K02 A;  3VB2 A;  4CHU A;  2XAQ A;  2VE8 A;  1HKT A;  3P9K A;  5DUK A;  2PMH A;  1QO0 D;  5KVR A;  1SD7 A;  1OYY A;  2A3S A;  5CVV A;  4AVP A;  2OQG A;  1EH7 A;  1F4K A;  1OR7 A;  4JK1 X;  1FPQ A;  3HRS A;  3WTW C;  4UNO A;  2NNN A;  2P5K A;  4M6Y A;  1RUN A;  1ZN2 A;  3ZP5 A;  4Y15 A;  2A07 F;  2V1X A;  2ZJ2 A;  3TOB A;  2MLK A;  2PMU A;  3HRT A;  2QYO A;  4EV0 A;  3LA2 A;  4HW0 A;  5IT9 K;  2FML A;  2VT3 A;  5CVU A;  2XRO A;  2M45 A;  3ZMZ A;  4L9V A;  4S05 A;  5H6R A;  5TRD A;  2D2W A;  2IJL A;  1YG2 A;  1I27 A;  4NHJ A;  3M1E A;  3VOD A;  2QQ9 A;  5E20 A;  4L9J A;  5F1R A;  5K5Q A;  2HYF A;  2VXZ A;  4IRI A;  3OV8 A;  4MTD A;  1FBQ A;  2ETH A;  3R4K A;  1HXD A;  3LFK A;  2IRF G;  1QPM A;  3WTS C;  1ONV A;  2PG4 A;  1WKM A;  4HX4 A;  2HGC A;  1KQ9 A;  1OPC A;  2E1C A;  3BDD A;  3IWF A;  3RKX A;  1T0F A;  5CYV A;  4L0Y B;  3I5U A;  2PEX A;  2EFN A;  3T5X A;  2ESN A;  4S04 A;  2LSO A;  1ODD A;  4Q4Z F;  5LGN A;  1YFH A;  2Y75 A;  1T98 A;  4HV5 A;  2KRF A;  4RGS A;  5K5O A;  3FM3 A;  1BIA A;  4U0V A;  2O0Y A;  2OZ6 A;  1W4M A;  2R3S A;  4R79 A;  2ZNY A;  4L9N A;  3JTG A;  1TW2 A;  3FM5 A;  1IF1 A;  3R6S A;  2F5D A;  1J0R A;  2XV4 S;  2JSC A;  2NNY A;  3IHU A;  2EFP A;  5H6Q A;  3F8C A;  5E18 F;  4HQM A;  3B02 A;  5JI6 A;  1AOY A;  1XDS A;  1EH6 A;  3QAH A;  1K79 A;  4LFU A;  2KIU A;  4HDV A;  4MQV A;  5DCF A;  5HLG A;  4O6J A;  1FT9 A;  4U7B A;  2ZCW A;  3E3V A;  4MGR A;  2GXG A;  3F8M A;  1T6S A;  2FSW A;  1W5S A;  3EQL F;  5LRR A;  1QBJ A;  2LNB A;  3HSF A;  2MH2 A;  3JAM Z;  4U0Y A;  2VOO A;  4HLY A;  4P96 A;  2IT0 A;  1IN5 A;  2XKP A;  3FWE A;  4A6E A;  3J81 K;  2DK8 A;  3QOP A;  3HYI A;  1Y0U A;  5F6F A;  4KNY A;  3HOS A;  2XAF A;  2L02 A;  4O5V A;  3FMQ A;  2WTE A;  1XCV A;  3F22 A;  4A5M A;  2B0L A;  3WTX C;  2CQK A;  2F5E A;  2IP2 A;  4I7H A;  1ZAR A;  2FRH A;  4WX9 A;  3GZ5 A;  3PFI A;  4AWX B;  1IXR C;  1HKS A;  4I0A A;  3TO7 A;  5LHG A;  1HSJ A;  1HST A;  1SMY F;  4EJO A;  1XGO A;  5D4R A;  3ECO A;  4UV8 A;  2LF8 A;  1FBU A;  3E6B A;  2Z33 A;  4JBA A;  2XKO A;  1GVJ A;  5LLQ A;  1YO5 C;  2Q8K A;  1R00 A;  4IVN A;  2BEO A;  2FQ3 A;  2KJB A;  2XAH A;  3MQ0 A;  1HBX G;  2HYG D;  1JHH A;  3GLX A;  1XGN A;  4A2U A;  1BM9 A;  1GHC A;  5AIQ A;  1LDJ A;  5ICE A;  1FP1 D;  2LF7 A;  2CFX A;  1LDK B;  1J75 A;  4M74 A;  5AON A;  4GGG A;  1DPR A;  3QP6 A;  1MDM B;  1R22 A;  3CUO A;  1MJA A;  2VON A;  4CIC A;  1U6G A;  3ZMU A;  4EGZ A;  4HX8 A;  4EMS A;  4M73 A;  3ERE D;  3S2W A;  4ETS A;  1EV7 A;  2QM3 A;  2M30 A;  3P7N A;  1A04 A;  4B8X A;  3RJP A;  3LST A;  5AIP A;  3CUQ B;  4ENN A;  1EH8 A;  4M9S A;  4YFX F;  3RPU A;  1FYL A;  1G4D A;  1HKQ A;  1KQ8 A;  3GEZ A;  1XGM A;  4XSZ F;  4I02 A;  2OBP A;  2EV0 A;  3JAM K;  1YYV A;  4ZYH A;  1QZZ A;  4HLX A;  1XMK A;  2FF4 A;  1BC7 C;  2XUB A;  4BNC A;  2L01 A;  2CG4 A;  3NEU A;  4G7Z F;  2WV0 A;  3WGI A;  3M7G A;  2VC1 A;  1UST A;  2UWM A;  4G94 A;  4XRF A;  1XB4 A;  3REO A;  3DPL C;  4IJA A;  1O3R A;  1O7F A;  1U8R A;  1RZ4 A;  3GWZ A;  3V8L A;  4ZZD A;  3FHZ A;  2YSR A;  2UZK A;  1U5T A;  1IXS B;  3E5X A;  1WSU A;  1DP7 P;  2EV5 A;  1UHW A;  3CUQ A;  1ON1 A;  1K6O A;  1G3W A;  5CVJ A;  1T39 A;  2QLZ A;  4PDK A;  3MZY A;  4KN4 X;  4M9Z A;  4A0X A;  1ZG3 A;  4L18 B;  2L54 A;  1FSE A;  1I5Z A;  1ZRC A;  1UHM A;  3DQV C;  1DUX C;  4UV9 A;  1FZP B;  2DK5 A;  1Z7U A;  1WI9 A;  4YFN F;  3JSO A;  3BY6 A;  2O3F A;  1OYI A;  5E1W A;  2DQR A;  1ZH5 A;  2VN2 A;  2QWW A;  1IXC A;  4P55 A;  1O7L A;  1PDN C;  1JGS A;  1HW2 A;  2EA4 A;  2HDC A;  3ZPL A;  1IAW A;  1G3T A;  4EQQ A;  5E8I A;  4HQE A;  3IWZ A;  1R58 A;  1U5T B;  2EA2 A;  3HTU A;  4OIN F;  3CLO A;  4U88 A;  1S3J A;  2KKO A;  3WTV C;  3L9F A;  1YW9 A;  3QU3 A;  3O2P E;  2RQP A;  3FZV A;  2GWR A;  1KU2 A;  4D0P A;  2BYV E;  4UVB A;  1IW7 F;  1FSH A;  3M9A A;  4KYW A;  5IT9 Z;  2KIF A;  3E6M A;  3WTU C;  3FXR A;  4XSX F;  3Q9S A;  1ON2 A;  2RN7 A;  3K1N A;  1SFE A;  4CXF A;  1IN6 A;  3WE3 A;  3ZMS A;  5D6F A;  1IUY A;  1ZG5 A;  5FLX K;  4MNU A;  2ELH A;  3CDH A;  3HTS B;  1S8N A;  1J59 A;  3F6O A;  5HS8 A;  1Z9C A;  4UHT A;  1FYM A;  3G3Z A;  5DD4 A;  2MLG A;  2RKH A;  2HR3 A;  1S7O A;  5HLI A;  1YS7 A;  1KU3 A;  3WG9 A;  2O61 A;  3EDP A;  1ZLK A;  4ESJ A;  4PGH A;  2H27 A;  1ZGA A;  3MAJ A;  2VBY A;  4G8X A;  5A2Q Z;  4OMY A;  1SMT A;  1R36 A;  1O3T A;  3RYR A;  1RUO A;  1LNW A;  4EGY A;  1MDM A;  3GZ6 A;  2KJC A;  1B9N A;  2P7V B;  2VBX A;  5L3F A;  1K7A A;  3N97 A;  2QQA A;  2IA0 A;  2YU3 A;  1TW3 A;  1S6L A;  5JR3 A;  4FX4 A;  2QVO A;  1F1Z A;  1ULY A;  2EWN A;  4LGW A;  5J8F A;  5JVT A;  2D45 A;  3I0T A;  3LA3 A;  3AAF A;  5LEK A;  4H0E A;  1FY7 A;  3M8E A;  3PQK A;  1RI7 A;  1IN7 A;  2FOK A;  1FNN A;  3BOQ A;  4KMF A;  4RAZ A;  3BZ6 A;  3GVA A;  5BOX A;  2QQB A;  2H6B A;  3E5Q A;  2H94 A;  1XSX A;  4I2O A;  5EEG A;  3T1B A;  2RDP A;  4YFK F;  3K9T A;  4BQA A;  3DXJ F;  3TQN A;  2WWY A;  3HSR A;  4Q47 A;  1OYW A;  2M1B A;  5HLH A;  4AIH A;  5L3E A;  3QRF F;  2PLY A;  5CVR A;  3M8F A;  5J6X A;  4MEY F;  2DO7 A;  2JRT A;  4G7H F;  3L00 A;  2FNA A;  4N9H A;  1IRF A;  2PJP A;  4ASN A;  1WWX A;  3HHH A;  4KT5 C;  5ERI A;  2C6Y A;  1MJB A;  5D8L B;  3KP2 A;  3KP4 A;  3HIF A;  4AIJ A;  1FX7 A;  1HW1 A;  3I4P A;  4KIG A;  2RC4 A;  4LB6 B;  3LA7 A;  1XGS A;  3HRM A;  1G3Y A;  2D1H A;  3SXY A;  2OD5 A;  2M5W A;  4GYI A;  3J80 K;  3ISP A;  3CO6 C;  2BBY A;  3I53 A;  1SAX A;  1R1T A;  4HDU A;  1Z05 A;  4DNC A;  4P9U A;  3RYP A;  5ILU A;  3MZH A;  5LHI A;  1XDU A;  3GXO A;  3GFJ A;  2F2E A;  5E1Z B;  3ZN0 A;  1YW8 A;  1YTY A;  3KCC A;  1B59 A;  2E7X A;  4NB5 A;  1R23 A;  2HQN A;  4HAM A;  4LK1 F;  2DQL A;  2VOD A;  4G7O F;  4G6Q A;  2G9W A;  2ISY A;  2M87 A;  4OIP F;  5LGU A;  3GX4 X;  2JZY A;  4GYG A;  2PN6 A;  4O3M A;  2DBB A;  3WU0 A;  3VEP A;  3J80 Z;  5D5W B;  3Q9V A;  4RS8 A;  3F21 A;  2STT A;  1LEA A;  3KET A;  1GXP A;  2WC2 A;  3DKW A;  1SD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...