4FQGA

Crystal structure of the tcerg1 ff4-6 tandem repeat domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
186
Chain Sequence
SHMKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription elongation regulator 1
publication title Specific Interaction of the Transcription Elongation Regulator TCERG1 with RNA Polymerase II Requires Simultaneous Phosphorylation at Ser2, Ser5, and Ser7 within the Carboxyl-terminal Domain Repeat.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA03
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA01
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA02
4FQGA 2KFDA 2DODA 1UZCA 2DOFA 2JUCA 2KISA 2KZGA 2E71A 2CQNA 2K85A 2B7EA 2DOEA 2LKSA 2KIQA 2L9VA
chains in the Genus database with same CATH superfamily
3BJOA 4XM3A 1GXPA 4CO8A 2VQLA 4HX4A 1MBJA 4M9XA 3ZQ7A 4ON0A 2PG4A 3JCUC 1YIJI 2V9VA 3E1SA 2D1HA 4MGRA 3ZMVA 1BIBA 2BY3A 3K4CA 3P7NA 3TEDA 1J7KA 2V6CA 2XGEA 3FXJA 5FKOA 2VPRA 4DOZA 2JA5J 1UZCA 4F93B 2O8XA 5J6XA 1TT5B 2CW0F 1YG2A 1QVUA 5CLSA 2LDUA 2V1XA 1AWCA 2VQCA 5ICEA 5LD2C 1VQKI 1LEBA 5IT9Z 4AIHA 3IWZA 2PN6A 2RNGA 3R4KA 4XOTA 3HJEA 2W82A 4RLQA 5CKTA 1SD7A 2LRDA 1MD0A 4S0HB 4IL6C 2E1OA 4XL9A 1C0WA 5GAGJ 2XF6A 4DJAA 4RAZA 3FXUA 4ZH4F 1MZBA 3K0LA 2ID3A 3S2HJ 1JTXA 3HHGA 2VQHA 3QYBA 1LFPA 4DQ2A 3BR3A 4M6YA 3T8RA 1BW5A 3ZCOA 1Y8RB 1JKPC 1J2XA 1BI1A 3H5AA 1J9IA 1JUPA 5KNLA 1EKEA 3JREA 4M3FA 2YU3A 3BQYA 3GVAA 5DS9A 3MMYB 3LSKA 2BY1A 4BAYA 4UV9A 3QU6A 3KYLA 1JJ8C 1FYKA 2HTSA 3CCRI 5FKMA 3P5JA 4KIFA 4XKBA 5D8LB 2IJLA 5GAEJ 2PJRA 1N78A 4C2TA 2VLAA 3RPUA 1NK3P 4MFEA 4LLGF 1YJWI 3O2PE 2K40A 4Z2YA 3GTKJ 4HLYA 4EMSA 2JVGA 4HNUA 3HTUA 5KK1A 2LY1A 1S7EA 3VODA 2Y0SN 4LFUA 5KAIC 2HI3A 3LA3A 2XAQA 2WA0A 3E6MA 2E7WA 1UMQA 2E2JJ 3GTMJ 3GYHX 2M34A 4WCGA 1G3YA 2OTLI 4B3AA 1ETVA 2OCEA 3FKJA 3K9TA 3VSLA 3H0DA 2UZKA 1WJEA 1WSUA 1R6RA 1E0EA 1Y0NA 2BY0A 3OYDA 4BXXJ 3K4MA 4ABZA 4E7JA 1JKRC 2X1CA 3TBIA 4L0YB 2VXDA 3IV5A 5GTHC 1ZR4A 3OYEA 3GFJA 1CF7B 2GAUA 1Z3YA 1T38A 4HSTA 1JKOC 4IRHA 2F4OB 4CCLA 2ZJRF 3IAS2 3CUOA 4MEXF 1DPUA 5A2QK 1RKTA 2VBYA 2O8KA 1IRFA 5HS7A 3WTZA 4N9IA 3RIRA 1LFBA 3I4MJ 2VOOA 2ZXHA 1Z6TA 3VPRA 1YIOA 1U6GA 1ETKA 4XRSG 5FD5A 4HBLA 5ICGA 3G3ZA 5E8IA 1BW6A 1N75A 4WXDA 2COBA 2FSWA 1OFCX 3CDHA 4Z6YA 2D45A 2KT0A 4M72A 3S2WA 4NB5A 3E6CC 1G59A 4Y4RA 2DAOA 1ZHFA 3GTJJ 2JPBA 3ASNH 3WU1B 4IXAA 5GPAA 1EH8A 2DPDA 2R93J 3SZGA 2XGDA 1NG6A 2XSJC 4E6KG 5LEJA 1X2MA 1TWAJ 2Z99A 3WE3A 2KP6A 2ELHA 1IO2A 5CQGA 4BBSJ 1W36C 1D5YA 3D5SC 3R61A 4EM1A 3ZXSA 2ECCA 2DJIA 3CDLA 1XSXA 1XD7A 2EV0A 4PCQA 3ZMDA 1RR7A 2DCEA 3CCJI 2KIFA 1MDMA 1VQ8I 3IC7A 2FMYA 4QLCU 2LC2A 1TLHB 5K7FA 2H27A 4WX9A 1H9GA 1QZEA 1FYLA 5ILSA 4G94A 2F5FA 1IC8A 5J4VA 1FZPB 3P9CA 5JFRA 4Y7NJ 4I0AA 1LUJB 1EA3A 2O9LA 1P6RA 2HKOA 2QKLB 4IJAA 2E5NA 2CJJA 3WHBA 1W7PA 1I1GA 2X48A 4AVZA 5F64A 1U8BA 4P9FA 4DZJA 2DU9A 4W1UA 5IP9J 4IHSA 2A69F 2ZNZA 3CMMA 3A0HC 4IVNA 1SAUA 5KHDA 1K83J 1XDSA 4HPQA 4MO7A 5H2FC 3GX4X 4EEFG 4HG2A 1T33A 3QOEA 4KMFA 2M5WA 5E1ZB 1F43A 4E4HA 2DBBA 3OS0A 3ABKH 3RSNA 4JK1X 2CFOA 2FOKA 1Q1HA 2P5VA 2R7VA 4KUMA 4HF1A 2UUZA 5J40A 4XRFA 1RR8C 4EATA 1B72A 3GFMA 3K1PA 2D1VA 3CO6C 3DKXA 4XLFA 2JSCA 2PX9A 3TMOA 4B48A 3MKYB 5CQEA 2CSOA 2KIMA 3DPUA 4C30A 1VQ9I 2IGKA 2QBYB 3SJMA 2L2OA 1JT0A 2JA7J 1SMYF 3HXLA 3I4PA 3AG3H 2W24A 4CCMA 2XPWA 1MNDA 3H35A 1P2FA 2FNAA 4BH9A 2R7RA 1V4RA 2ETHA 1FEXA 2L7ZA 2HZDA 2JTVA 2L9VA 3T8TA 4O6JA 3C1DA 4ZDOA 5JHFA 1I3QJ 1K4SA 1WJ5A 1QRYA 3DEUA 1HLVA 4YEJA 2Z2SB 4OIOF 1TW3A 3OR1C 4M71A 1YHQI 3KZIC 1PYVA 3TDUC 1PJRA 3R0JA 5E3LA 5IYBJ 3L2RA 3BG5A 2Y75A 1FJLA 2E35A 2E7XA 3JSOA 3CDIA 3LQQA 1A6QA 1NH3A 2DQLA 4RB0A 4JP0A 1D1AA 4NC6A 3HTSB 5F0HA 2KRCA 2YX7A 3EUKL 1USTA 4BHPA 3OSFA 1VQOI 1W0UA 2JRTA 3IKVA 4GO1A 3E3VA 4DBQA 1KQ9A 2TDXA 3B02A 3CCVI 3LAJA 2ZKZA 2QYOA 3I71A 2HYGD 3JW4A 3E5UA 2QM3A 4RGRA 4XQFA 3OYIA 3KETA 5E79C 1B1BA 3GTGJ 3CC4I 4DYQA 1QHGA 4UUSB 5BPDA 3T5XA 5EDNA 2KMUA 5CVUA 3ZGKA 4GYGA 2M0CA 3P9KA 4LGWA 2BGCA 2V1NA 3F8NA 4F55A 1IF1A 3ZQFA 2YU9J 1BA5A 2ACJA 2RQQA 1FMVA 4YRVA 3WGHA 1BI2A 3DTKA 2LP0A 1ERDA 4CYCB 2ZJQF 4BGDA 2LKXA 1NTCA 5LGUA 1R4MB 1R5ID 1Y56A 2XF5A 2F5CA 1HBXG 3Q0UA 1ZYRF 4LK1F 1OISA 2R4GA 4IOAF 1BI3A 1P92A 1U5TC 3K69A 2VPLA 3BPVA 1A36A 4II3A 2RVCA 2DW4A 3CCUI 2BBYA 2XAHA 3CF2A 3MD2A 2AO9A 2ADUA 3SZTA 1VQ5I 1YITI 2P81A 4BY1J 1D0ZA 2IA2A 5E20A 1FOKA 1DP7P 5BOXA 2P4WA 3FISA 3MZ8A 3J80K 1D3YA 5J1YA 2L7FP 1MMGA 4JX5A 3AL0C 2H6CA 4M73A 4I02A 2HOEA 3FBNB 3KP4A 4AM3A 3KYCB 2X6XA 5BNGA 2GA2A 2K9LA 1Z67A 5TGTA 2CQKA 2Q8KA 2IS1A 3IP4B 2ZC2A 4PGGA 2EA2A 1O3RA 4UUTA 4LIVA 4FCYA 3OV8A 1MIJA 1OPCA 2EQRA 2JUGA 3TW6A 1ONVA 4MQ9F 2VB6A 2A07F 2PQ8A 2FD5A 2E34A 2E1NA 5FB2A 4EGZA 2J5PA 5F27A 2XKOA 4UVAA 4MFDA 3SEQA 3ZQIA 1WJAA 3HOTA 4LG3A 1OCTC 4BKXA 5M5XJ 2FX0A 1X1AA 3FXLA 3BT9A 1W5SA 2P5KA 2HZTA 2VN2A 2JMWA 1MGTA 3BTLA 1WJBA 1WI9A 4RLFA 2O6GE 4IRGA 2CH0A 3D1NI 2HOAA 3TW7A 5EG0B 2X6YA 3W2VA 4PJ0C 3QAHA 2C6YA 4CA0A 3MKZA 1UG0A 1YJ9I 1S3JA 1KU9A 1WH7A 3RYPA 1YLFA 4UXNA 4D7MA 5ICFA 2FBKA 3GF2A 2CYYA 2W85A 1QVTA 3I59B 1OKRA 2FMLA 2KZGA 1W5CC 2NXNB 2CQNA 2MABA 1OJLA 3ZMSA 3F6VA 4NHJA 2VKVA 2BW3A 2E2IJ 3FF5A 1RRJA 2IS6A 6PAXA 3GLLA 3UR3C 4BACA 1MBEA 2DFEA 4RAFA 3OS2A 2UV1A 5JLXA 4BHCA 1XX5A 2DYRH 5C4XJ 2PEXA 2FOWA 1QGPA 4BHBA 2MSYA 4U7BA 2VOPA 2Y2ZA 4OAZA 4IO9F 4FQGA 3VB2A 4ZYHA 2EZKA 2VC1A 1IZ1A 3ZN1A 4RGUA 3GEZA 1SFXA 5FKLA 3HL2A 3HUGB 4CDGA 3EETA 3FIWA 1K79A 4C3HJ 3H36A 3LOCA 3GW2A 4C3IJ 5F04A 4PFPA 3PIPF 3DXJF 3PO3J 1ZLJA 3E0JB 4KN7X 2VT3A 4U87A 4DNCA 3CTAA 2PI0A 4IKFA 4A5MA 4L5JA 2M8EA 2HVSA 2K9SA 2XAFA 3WTUC 3HGYA 4CCKA 3BLYA 4JX4A 4V2GA 1RUOA 5FFXA 1SC7A 3L7WA 2DODA 1D8JA 3OYKA 3W6VA 2GIZA 3X2QH 4ZZLA 2H1LA 2R5ZB 4J19A 1BR4A 3GO5A 1X1CA 3RJPA 4OIPF 3K2AA 1IN7A 3ZQHA 3L2UA 2FNPA 4G12A 4PJMA 4OIRF 4KITB 4M74A 5D4RA 5BPIA 3EUHA 1W36D 4LG0B 4BJ5C 4C3JJ 1P7IA 2CW7A 3PNVA 5M3FJ 2A6EF 2A5YB 2EV6A 2Z9OA 2X1DA 4BQOA 4XSZF 2DMTA 3A1YA 5LGTA 4EJTA 2QQ8A 3E6BA 2JQ7A 3AAFA 1NK2P 1DGWY 1J59A 1D0YA 3DTEA 2VJ4A 3H3ZA 5J3LA 4BS9A 3OYMA 3ONQA 4DBRA 3DBRB 3VYRB 1ENHA 1K4TA 1WGXA 1Y39A 4JBAA 1EV7A 1B59A 4QPOA 1UHSA 4ASNA 5BQTA 3BPXA 3I5UA 4EVIA 3MCZA 1STZA 1B4AA 1O4XA 3V7SA 2AXTC 4A0XA 2K9MA 3COAC 4U0VA 2ZB9A 4BE1A 1V54H 2QF7A 5L3FA 5CVIA 4ZJZA 2WAQA 4FX4A 1SVOA 5HNHA 1OCCH 3W3CA 1HW5A 2DQRA 3H9QA 3M1CA 3WGGA 3I4NJ 4AIJA 4C9YA 2PMZN 2Q1ZB 1T98A 4GYIA 2XRLA 1S7OA 2YPRA 2BXZA 2WB1A 3ZQGA 2ZMEA 3S3MA 4HNTA 4A3JJ 3HIFA 5JHUA 1IN5A 4UNOA 3S93A 2V4JC 3QPTA 2GLOA 4FASD 2LTPA 3HG9A 1MH4A 1OCPA 3HPGA 2MFZA 2L02A 4JQFA 3AG4H 3TO9A 3J81K 4XLAA 1QZZA 3PO2J 4JX6A 1WHUA 2VT2A 2LR8A 5FLXK 1RESA 4XLHA 3OL3A 1PUEE 2E2HJ 2ISYA 4CHUA 4XN3A 3DF8A 1W4MA 2MC3A 3CP8A 3TKYA 4YFNF 3HOZJ 1KU3A 2HDDA 1UG2A 2ISZA 4E7LA 4BE0A 5FLVA 1XG1A 2NYXA 3G71I 3LSGA 3OYJA 3ABMH 2LREA 3OYLA 4O3MA 2R7WA 2X6OA 1GV5A 1FOXA 5EYRA 3RKWA 2ZSHB 3BZKA 3F8FA 1Z7UA 5HOOA 1ZRFA 1L0OC 1OQYA 1ETYA 1HQCA 4GRIA 3VYSB 3EPZA 2EIKH 4X1EA 1RC9A 3N97A 4B43A 4HX8A 3LFUA 1GDTA 1K6YA 3CUQA 5HS8A 4XMYA 4CYDA 4UHTA 1PVEA 1W1WE 4ZYAA 1L3LA 3QPSA 2R7ZJ 1MMAA 2CG4A 3AG2H 5CPRB 2GZWA 3O3KA 2EJRA 5DCMB 2VONA 4RGSA 5DUIA 1A6IA 1DP3A 2NOJB 3CESA 4Q4ZF 3BG3A 3M8FA 1FOWA 2KJBA 1QO0D 1FBUA 3OSGA 2GXGA 2QSGX 2HR3A 4XRSA 2IEKA 2GXAA 2IA0A 1TW2A 2QENA 4XLEA 5M3MJ 3JRCA 1U0JA 1U5TB 3KPHA 1FLIA 4HF2A 4P1WA 2HVRA 1X1DA 4LIUA 5IY5H 2WAQN 1KU2A 1KU7A 4XOPA 2ZNYA 1X1PA 4Q47A 4HSRA 2ZCWA 1B8IA 1ORKA 3S1MJ 3V7CA 3W6KB 4PJNA 3CQZJ 3D5RC 3HBLA 1U8RA 2VJ5A 1MBHA 3LQRA 3JRBA 5CVJA 1XSDA 4M3EA 1YX3A 2WB1N 3DKWA 3ERED 4LOCA 3AL0B 2L4AA 3DBLB 2DN0A 2G7HA 3BY6A 1BBYA 2JA2A 1JXSA 3FBIB 1YW8A 1ZG5A 3I9V2 1R58A 2M7AA 2GOMA 1ZR2A 1WZ2A 3I53A 5HLHA 3PNTA 4A3EJ 4PSWA 1BJZA 2EFNA 4LMYA 4BXUA 4A3KJ 2BHZA 4L5IA 1DU0A 3IAM2 1F9NA 3HM5A 3H9GA 4BQNA 5F6FA 4FTHA 3UKGA 3RTRA 2BVMA 1LE8A 2HDWA 3G4SI 2RAEA 4H0EA 4L0ZB 1XB4A 5TISC 2ZXWH 4HX7A 3TO7A 1CQTA 2AS5F 1QHHD 2NAZA 2VI6A 4IHTA 3LA2A 3KYDB 2IRFG 3GTLJ 3EYYA 2Q0OA 1TQPA 1H0MA 4ZDPA 4EM0B 4MTDA 1AA7A 1CGPA 3K7AJ 1SD6A 4D1QA 2HQAA 1FYMA 3TGNA 2OA4A 2R7SA 1WVRA 2HU9A 1G6NA 2K7LA 3JR9A 3JAMK 3DEEA 4CCOA 1HOMA 4D9JA 5FRNA 4BY7J 3HOSA 3HOUJ 2IS2A 3VSKA 1TWCJ 3QP6A 3RKYA 2HXOA 3GZNB 2V7FA 1HKTA 3HSEA 1YTYA 1S8NA 4BUPA 1YE9A 5FD6A 3HSFA 2G9WA 2M45A 3ECHA 4HV6A 2KFDA 2E36A 3IWFA 2QVOA 1JGGA 1G2HA 2R7TA 1IN8A 2EB7A 3U1KA 1OLTA 1UJ8A 4AUXA 4J01A 4E7HA 2M0MA 4KN4X 2MC4A 1WJCA 2DK5A 2FQ3A 4A0ZA 4E7IA 2CRGA 2R3SA 4I99C 3E97A 3ROUA 1VQPI 4NQWA 1MJ9A 3K6GA 4U7DA 1W0TA 4XR6A 1ZQ3P 2ESNA 4R1HA 2M7BA 1HW1A 1OYIA 3A0BC 2DO7A 4WK8F 1VQ4I 2ESHA 2MLGA 4M3BA 3SDGA 4WXHA 2KJCA 2DMPA 1VQLI 1JHFA 3BJAA 1T56A 2Y48A 3IKTA 3PL8A 1HA8A 1D8KA 3HGGA 3G2BA 1GLNA 4WXCA 3LAPA 1JTYA 1HW2A 2KLOA 2LKPA 2ELJA 3QU3A 1HSTA 2H8RA 3BZ6A 1O3QA 2MGQA 2PJRB 3SZPA 1R7JA 4J00A 3AG1H 1Q1VA 4BL0B 1QBJA 2OV7A 1ZGJA 2HOTA 1U2WA 1X4PA 5EGOA 3HOVJ 4XLPF 2AXLA 3VDXA 2VIXA 1MKMA 2R5YA 3LA7A 3SDBA 3V8LA 3J7ZI 1VZ0A 2QQBA 3AFHA 1O7FA 3V8JA 3SQNA 3F6OA 3PFYA 4F91B 5B5EC 1TC3C 1P9QC 2Y69H 2AQFA 1EH7A 2LOOA 4YFKF 1GVDA 3M4OJ 2X1EA 2CV2A 2M4KA 3ZP5A 2OQRA 2VASA 4CCJA 5ILVA 1F1ZA 2Z1DA 1XTAA 3NQOA 3EYIA 2MYSA 3OYBA 1LPQA 3WTVC 3I54A 2CFXA 2HEOA 2Q2EA 1TBXA 4A3DJ 4NNJA 2D5VA 2CUZA 2EPFA 4P55A 1K78A 5E17F 4AD9A 5EZGA 2NNYA 3PUFA 4RB1A 2Y31A 4XKVA 2KHMA 5TRDA 1M1EB 3EUAA 3G73A 4N0BA 1SD4A 2ECBA 1XGMA 4KIBA 1Z9CA 4M6XA 3LSRA 1TL8A 1WCMJ 4E7KA 2STWA 4HQMA 1MMDA 4FISA 5JVTA 2W25A 1BC8C 1BM9A 3VEPA 5HDKA 3IUOA 3OYGA 4L9TA 3DLAA 4F52A 5D5WB 1P4WA 1RKWA 1HSJA 5IT3A 3MVPA 4D0PA 2XUBA 3DFGA 2X6WA 1XC5A 3T0YA 4O5VA 3BQZA 2KRFA 1BOAA 5L3EA 2EZLA 1SFOJ 3CCLI 3RQIA 4DYCA 5DTDA 3CMYA 5IPAA 2DDBA 4HDVA 3K4NA 1MDMB 1IN6A 2OF7A 3PSIA 5D6FA 3EUHC 3L9FA 4DW6A 3BR1A 1FTZA 2I5UA 3G1OA 1H89C 2CMPA 5HLGA 4I2OA 1U3EM 4GFBA 4NUBA 1FNNA 4IPAA 2QA4I 1UELB 2R7DA 1I27A 4M3GA 1W7PB 3PIOF 3F0CA 4YIIA 1AU7A 3ML6A 5ILUA 1PDNC 1WWXA 2N8GA 1PUFA 1YJNI 2WTEA 4AYBA 2EV5A 3LSIA 2DDAA 2XHKA 1LKXA 1QU3A 3S32A 4H4KC 2CQ7A 5K5QA 3KZZA 4HF0A 1K6OA 2CV0A 2P7VB 3L00A 1VQNI 2V1UA 2CO5A 4BJ6C 1R1VA 1B72B 3RYRA 2EZHA 1X3ZB 5A2QZ 1ZRDA 1XCVA 3CJNA 4Y3OA 2BOLA 1E3PA 3CCEI 5IP7J 3QYEA 4EM2A 1N25A 5L3BA 3S1NJ 4AU7A 4I01A 4HQEA 1V5FA 4CICA 1LB2A 3KEYA 2FJ1A 4S05A 3C3WA 3KEOA 1MJBA 5ED4A 2ZMEC 1YW9A 3I3LA 1QNTA 5B3SH 4YIRX 2GA1A 3GWZA 5J1RA 5JLWA 4HRIA 4Y17A 2L5QA 2KZVA 4PJLA 2K9QA 3U21A 1XDUA 4HEA2 3GZ6A 2VBXA 3DKYA 4DYRA 2EWNA 2QWWA 1XGOA 4A2UA 1IXCA 5AIQA 4LB6B 2K4BA 5D5XB 2XB5A 4B1RA 1LDJA 4P96A 2BY2A 3FM3A 4A3GJ 4IRIA 2JZYA 3Q9SA 3TQNA 2K9NA 3WHCA 1WQ2A 3ZQLA 4ZTJA 3DCFA 2EINH 3R60A 5TJJA 1SEUA 2LK2A 2KIUA 2WADA 4LB5A 3S16J 3RDIA 3JRIA 2EIMH 2EFPA 4UUVA 2OU2A 4OMZA 3N05A 5IOYA 3KFWX 5AONA 1Y0UA 3H9JA 2WC2A 4EJVA 4BDZA 3QPHA 4RAYA 3K1MA 2ID6A 3FXMA 3RI4A 2UXXA 1TWGJ 4OAYA 3S3OA 2EBIA 1FPQA 1R1TA 3FDYA 1ODDA 1X4OA 1NG7A 2JK3A 5D8KB 2HTJA 1XPXA 5J47A 3Q3SA 3CUQC 2VC0A 4YG2F 3C7JA 3QODA 2LMDA 2XPUA 3KX2A 4AWXB 4MHGA 5HDNA 2DTZA 1SMTA 1XS9A 1R5GA 1IW7F 5LEKA 4A3FJ 3MFKA 4RGXA 4Q5SF 3OOUA 4UVCA 5LFAA 1XMAA 1P7JA 2M3AA 3VFZA 3ERMA 1ZN2A 1QQIA 3IL2A 3BG6A 4AYBN 1R00A 1IUYA 4IOCF 2HNHA 2KKOA 2DT7B 2QCOA 3DPLC 4E70A 2HXIA 4RM3A 2HFHA 1IDYA 1D1CA 1MH3A 4IHYA 1I3AA 2O03A 2MBFA 2WV1A 3OMYA 4A69C 4HDUA 4B44A 3CC2I 4RA2A 4OWRB 3CO7C 3CP2A 1A31A 1WKMA 2L9RA 5F1RA 4HOBA 4BBRJ 3QP5A 2E5ZA 2XF7A 4KISA 1T8IA 2JSPA 2KQRA 4XKWA 4OOIA 2PMZA 1Y1WJ 1EH6A 1YRNA 1OCZH 4OU0A 2DOEA 1R9TJ 3JTHA 3FXKA 3K70C 1S29A 1VNDA 4JYKA 2VBWA 1PP8F 2VKDA 1VI0A 4UB6C 2XSDC 1IRGA 2IBDA 1E2XA 2EFQA 2DMQA 3ASOH 3WTWC 2XGXA 2LY2A 5DUKA 1FY7A 2LKSA 5E3NA 2J5OA 4A5NA 4IQJA 3PQJA 2R7OA 3HKZA 1DQUA 2V9PA 3O6BB 5B1AH 1RPWA 3GBGA 4BNCA 3S1RJ 2O3FA 2UWMA 2OD5A 5H6RA 3LNQA 2ZFWA 3PUBA 4X0GA 5HLTA 2ZXJA 2IPQX 4B47A 4B4CA 2OAZA 4BEHA 1HKSA 1IAWA 3FX3A 2Z33A 4RDUA 1XSVA 3BDDA 3F9KA 2QLZA 4ETSA 2QGUA 2XVCA 4F92B 4OMYA 4YIFA 4C2UA 2FBHA 2LBFA 3H92A 4HAMA 5GTIC 2M87A 2IP2A 4D5FA 4TV7A 5LRRA 2DMUA 1AKHA 3EDPA 3PFIA 2JPCA 2L9SA 1HDPA 3KP5A 1YI2I 2L54A 3CCQI 4PSXA 4E7SA 2IXSA 1SANA 2A68F 1R23A 5D5UB 1JHHA 1UAAA 3HB9A 2A3SA 1QPMA 2BV6A 2PMHA 1S9HA 1JJ6C 3I0TA 4ANJA 3GFIA 1UHWA 2GOXB 2HVQA 1UCRA 3RCOA 1WJFA 5F1JA 5FJ8J 4W97A 3U9GA 1J0RA 2DA6A 1R36A 3J7AY 4XBFA 3S15J 1V3FA 2VJIA 1D1BA 1MSEC 2W7NA 2HKXA 4CSWA 1LVKA 2LLKA 4NC8A 4M9ZA 3CZ6A 2GQQA 3SXYA 1ETXA 3S14J 2RKHA 2MLKA 4P5OA 2OC6A 4CH7A 5IT9K 4C2MJ 3BC8A 3A4CA 2YUSA 2Y9YA 2X85A 4B3XA 1A04A 2ME6A 2E71A 3DU6A 2XAGA 3FHZA 2Z5UA 4EJUA 2YX4A 1SD5A 4HV5A 2QEXI 4KMUX 4LD5A 3B73A 2DOFA 4BDYA 5GAHJ 2NS0A 3A02A 5D5VB 1YFHA 3BZCA 1J5YA 4WF2A 3KZYA 1ZKGA 2MH2A 4DGWB 4ESJA 2JVHA 1YQAA 1XCBA 3OIOA 1MSFC 4ENMA 5E18F 5DV5A 1ITYA 2X0LA 3HKZN 1YO5C 4UV8A 4BQQA 3U2RA 3NEUA 4RM2A 2LYCA 5DCMA 2JRMA 3E6DA 2A6HF 1F4KA 3R0AA 4G9YA 1K7AA 1I50J 5FO5A 3DLLF 2EA4A 2DYSH 3W2AA 4N9HA 5J1UA 3GLXA 3HYIA 1VQ6I 3DEWA 4ITVA 1FP1D 2K86A 5K7ZA 3GFLA 1F5TA 4QPQA 5FLMJ 1U5TA 2VJJA 2VBZA 4ENNA 4B09A 2ZO4A 4XLNF 5JVGF 2MD0A 3FM5A 3BCBA 4UB8C 3T1BA 2QUFA 2PJPA 4ZC3A 2F4MB 2DXIA 3Q5FA 1MMSA 1LDKB 2OQGA 1I39A 1LFUP 2HDCA 1X58A 3DU5A 1ETWA 2FF4A 2K3FA 2A5WA 1T95A 1GXQA 4E7ZA 3W2WA 5AIPA 2DA5A 2EH3A 1MJAA 2K4JA 1LQ1A 3EQLF 4KJZA 3C2HA 2KPMA 2H6BA 4ZYGA 3GXOA 4IHXA 1K61A 5FRMA 1WPKA 3L2WA 2P6SA 3PQKA 4G6QA 2DA1A 2Y0MA 2HYFA 4P9UA 2IGOA 2RV8A 2ZMEB 4HYEA 5B66C 4B8XA 2JUCA 3ISPA 3CCMI 2VE8A 1ETQA 3CD6I 2QKMB 3DPTA 4MLOA 1RUNA 1X19A 4XSXF 3I55I 4I0BA 1Z21A 2V26A 2I10A 3K4JA 1ZK8A 3ZN0A 1HDDC 1FBQA 1T6SA 4BU2A 3FXOA 2O7OA 5L3DA 2OJED 2V79A 3E5XA 1QZYA 1Z6RA 2DJNA 3ZOBA 2EFWA 1FC3A 3K4LA 3KP3A 3F22A 1Z77A 3BR5A 2XROA 3TOAA 5C3EJ 2VKEA 5LGNA 2E19A 1GHCA 3MKLA 4KT5C 1HF0A 2HOSA 4A3LJ 4F3QA 5LHGA 3FHNA 2DFFA 1EJ9A 5GADJ 5DEQA 1T08B 2LSOA 3LWFA 2HS5A 2W1OA 2H8WA 1F36A 1U9NA 3M8EA 4HNVA 4XRMA 1H9TA 2KRHA 2STTA 2GWRA 2FQ4A 1G3SA 3ZMTA 5E8GA 2L7MP 3H1CA 3H3VK 2WAEA 2JJ7A 1IUFA 3FXRA 3K2ZA 2X9DA 3LSPA 1UHMA 2R92J 2CU7A 2QQAA 2HQNA 3CUQB 4A3BJ 3A01B 3M1EA 1IG7A 3BTIA 4NBQA 3FMQA 3W6JB 2LG4A 3PSFA 1B9MA 1X3UA 5IOZA 1IDZA 1MNEA 4EGYA 2DI3A 3CC7I 1ON2A 3HRUA 1DUXC 3M7GA 2TCTA 3OS1A 3BTCA 5EEAA 2B0LA 2EILH 2R7FA 1CF7A 1SFEA 1TQMA 1A5JA 3GTOJ 1U9OA 1ON1A 3L09A 1JT6A 1T0FA 1BI0A 3DP7A 2EIJH 1LNWA 2XAUA 4XKCA 2MD5A 4L18B 2PFBA 3K4KA 1ULYA 4PFOA 2Z3YA 4IX7A 1FSHA 2K27A 1V5GA 3LMMA 5L3CA 4A12A 5FROA 3TO6A 1D0XA 4II2A 2MW8A 2OCCH 3KCCA 2DA3A 1TNSA 1WJDA 1DGRM 1B8IB 1R5HA 2ZSIB 3F8MA 1YS7A 4ZDLA 2M1BA 1TZLA 3UNGC 2F48A 5D6EA 2WAFA 3J81Z 1YW7A 1UFMA 3BROA 4QWQA 2LF8A 2Y30A 2JA8J 2F5EA 2E1MC 5FLXZ 2PMUA 1USSA 2LNBA 3KE2A 3GCMA 5DCFA 1GUUA 2VODA 2AHQA 2L9NA 2XASA 1HXDA 3OIPA 3VYTB 1BC7C 3QPLA 1XGSA 1R71A 3HHHA 3MEXA 4A0YA 4EJOA 2D2WA 5HLIA 5J8CA 4L5EA 2GBYA 3H0GJ 4RBOA 3K70D 3CMEI 3OL4A 3G1LA 3HOYJ 5EJCA 2NOGA 1YYVA 1LE8B 1DDNA 1S7AA 2DA2A 2KISA 4GDFA 1G3TA 2JT1A 3I56I 3S1QJ 4JOMA 1WH5A 4GCVA 1G4DA 3V4GA 4PGHA 4EQQA 4IEJA 1ZAOA 2DK8A 3ABUA 2FU4A 2RQPA 2DFIA 4R79A 2XRNA 1T2KA 2O0YA 3H5NA 2G7UA 5IYCJ 4IF4A 2F4IA 3HDDA 1NHAA 2QZ8A 3DV8A 3SFIA 3KLOA 3QWLA 4ENJA 4D7NA 3F72A 3OYAA 3QYFA 1ZELA 1LEAA 2BVLA 3CLOA 3RPUD 1B6AA 2NNNA 2OZUA 3D0SA 2GIVA 4KICA 3U1DA 4FETA 3K1NA 2R7XA 2QBYA 3ELKA 1TWHJ 1O7LA 1FOYA 4I6ZA 1QPIA 3B6AA 5C4JJ 2VQGA 2VL8A 5CVRA 1ZRCA 2QSFX 2YS9A 3GZ5A 3MZYA 1O3TA 4NQWB 5F0CA 2ZXIA 2WY8Q 3CJQB 5DD4A 3BG9A 3FK7A 4OINF 2HQ5A 4ZYEA 2B63J 3HRTA 1KA8A 1G3WA 5M5WJ 2KIQA 3DTIA 2CV1A 2IW5A 4G8XA 4X6AJ 1IRZA 5J8FA 1JE8A 3TP3A 4BE2A 5EF6A 2A05A 4ESFA 2JWTA 2L4MA 2PLYA 2BXYA 1TTYA 4KA4A 2CUFA 3LFKA 4DIQA 1GV2A 2BE5F 1ZARA 3F8CA 5K7HA 2QSHX 3K4BA 4RMNA 2XC7A 1LDDA 1OCOH 4R8HA 1BR1A 1Y6IA 4Q48A 3NWSA 1JI8A 1W5TA 2H94A 4KT6A 4XICA 1WRJA 4CGZA 1YS6A 5EZHA 4ESBA 3G6EI 3N4MA 1KQ8A 5K5RA 3BR0A 1BJAA 3L2VA 5JR3A 3KEQA 5DM7F 5EGOB 2CQXA 3CCYA 1YOVB 2P8TA 1PP7U 3IH3A 2X4HA 5M5YJ 1WFXA 3HPHA 1Z1DA 2JA6J 3CCSI 2R5YB 5DDGA 2A61A 3RZDJ 1OR7A 3LSJA 3J7YJ 4NDLA 4UUSA 2CUJA 2COMA 3NWTA 5BMZA 3C2GA 2NVUB 4BYYA 2RGVA 2P7CB 4PUSA 2FA5A 3JAMZ 2MH9A 1FTTA 4XN0A 3WODF 2CWEA 2RN7A 2P5LC 2P6TA 3C2BA 3FXQA 3OWTA 2LF7A 2UXNA 3REOA 1OMIA 4DZPA 3DWLE 4CYCA 3ZQCA 3BG7A 1AOYA 5LHIA 1J09A 3ECOA 1P4AA 5GP9A 2R0QC 4ZTFA 3OYNA 2BZTA 3NAUA 3O8GA 3O8HA 3ZMUA 2E1CA 9ANTA 2IA1A 2Q2EB 4QSHA 1HC8A 4XLCA 5DYMA 4XONA 5DM6F 2XPVA 4A93J 3OOPA 2FXAA 2R7QA 4FHTA 3JRHA 2MG4A 1APLC 1K78B 1ZH5A 2KDZA 4LJZF 1W7PD 3IRQA 3HC7A 3SYTA 3KLNA 3JSPA 2IGMA 4HA8A 4HZFA 5D4SA 5BS6A 3PNYA 4N4OB 3Q0VA 4IQ4A 3V42A 1FIAA 1R1UA 3JRDA 3F23A 1UB9A 3WU0A 1OYYA 3MKWB 3H5RA 1Z3XA 2F6CA 4PDKA 3H3UA 3HOWJ 4GXOA 2IT0A 2V6EA 2LFBA 2DT5A 4UVBA 3V7RA 2FE3A 3WE2A 4AIKA 3VWBA 4M3DA 2F5DA 3ABLH 4MEYF 2O61A 5IYDJ 1SVMA 1BN5A 4V2FA 4G6DA 3MN2A 2EZIA 1MBFA 2M2EA 3MAJA 1POGA 2A6TA 3BJ6A 3P9IA 1B9NA 3BWGA 2Y9ZA 3WG7H 3V8KA 3M07A 4XORA 1JGSA 1LJ9A 2B9SA 3S8PA 3RKQA 2EK5A 1BIAA 3WG9A 4U0WA 4A6EA 4U0YA 3DBHB 5HNFA 2DMNA 1X2NA 5JI6A 3JRGA 1E3HA 3JRAA 3J7AO 2HQRA 5E3MA 4LITA 2OZ6A 3K10A 2DT6A 3FMRA 2L3DA 2K85A 3QRFF 2LH9A 1BR2A 4L9NA 1PUFB 4M6VA 5EG0A 2GM4A 5FGMA 4CCNA 2V1DA 1P4XA 2OBPA 1X1BA 3GTPJ 1VQMI 2OTJI 2ZJ2A 4A3MJ 1V5EA 5KAFC 1AHDP 2ZFUA 1I6XA 4RS8A 3KIOA 3I59A 3HRSA 3R6SA 1U78A 4N4NB 3ZR8X 3HOXJ 3TDZC 5F0FA 3NARA 3DQVC 3FMSA 5LBQA 3A2KA 2V9KA 5FKNA 2HGCA 2ZJPF 1BL0A 3TP0A 1GT0C 3HEFA 5HVQC 1HKQA 1Z7LA 1Z0XA 2I8DA 2ICWG 4OIQF 5LHHA 3ULQB 3AKZA 1JKQC 3HUGA 3I64A 2Z16A 3L2QA 1BOBA 5IP6A 1Y8QB 3IH2A 1XN7A 3MQ0A 3M3YJ 2IVMA 2M4GA 4RAGA 1ZGAA 1TQIA 1A35A 4UY8I 4MQVA 4LLLA 2XB0X 1R4NB 3E7LA 2BEOA 4PK4A 1S6LA 5ERIA 2EFOA 1FWZA 4CZCA 1XMKA 3OY9A 2RNJA 5EEGA 5H6QA 4G7HF 2R5ZA 2E1MB 2IAIA 1Y1VJ 1H8AC 3ABTA 3FK6A 1R49A 2L0KA 1FX7A 1V55H 2L01A 1S5LC 5CJ9A 4KFCA 3F21A 2CGPA 2DPUA 1RZ4A 1SAXA 3CJTB 2M9HA 5GPCA 1FMWA 5C44J 5KCMA 2CW8A 4L9JA 4BXFA 1KYWA 1ZGWA 4LG0A 4XK4A 2F5VA 1IXRC 3OYFA 4M9SA 2HPIA 1REPC 4LLNA 2NVQJ 1KZHA 3CF5F 2G0EA 3MZHA 1MBKA 3HRMA 5F08A 3WTYC 3S2DJ 5CYVA 5L3GA 3NRVA 2TRTA 2VUMJ 4LK0F 2WBMA 3BR6A 3SHFA 2FRHA 3GTQJ 3FWEA 4ZZDA 1JUSA 3JTGA 3QQAA 1Z91A 2K5CA 3LL7A 1VTNC 3GMEA 4I76A 4L9VA 1IN4A 1RETA 1T0FC 1E3OC 2CS3A 4FX0A 4AIDA 3S17J 1MW7A 4EV0A 3SFZA 2ME0A 3KP6A 4I98B 1J75A 3OIQA 4D5CA 5HS9A 3SEZA 2YSRA 3E5QA 4S04A 1KGSA 1MBGA 4MIMA 2WWYA 4IHWA 1MMNA 1IXSB 3ZPLA 1MNMC 3VOEA 3IRRA 1OYWA 3ZMZA 1D5VA 3VYUB 2XV4S 2ZBKA 1ETOA 3B6CA 3TL4X 4U88A 1O3SA 2QQ9A 3FKIJ 2WY7Q 4BQAA 5B1BH 1O57A 2OPTA 2W84A 2BW3B 3KP7A 1FP2A 1TWFJ 2XGCA 1FIPA 1YX5A 1YRNB 2AQEA 2X51A 4AVPA 3F3XA 2OUMA 1N77A 3F8BA 1G8XA 2K3PA 3RQ4A 5EEHA 2F2EA 2YR2A 2FEZA 1Z05A 2O5RA 1HCRA 4GGGA 5H20A 4RB3C 1ZREA 5HODA 2VE9A 3J80Z 4KNYA 4QTRA 5LLQA 2RC4A 1I1SA 3HZJA 1TP4A 1I6HJ 4HLXA 3PM1A 1FT9A 1I5ZA 2GXBA 5CVVA 3Q0WA 4CZZA 1GVJA 3GUDA 4ZYDA 5K5OA 2W4SA 1KONA 5E1WA 2B7EA 2PBIA 1FBSA 1DPRA 4MTEA 3LSTA 2HPMA 4HW0A 1RNLA 4I7HA 4BEHB 3BCAA 4ENKA 4MNUA 2FUG2 3CLQA 3RKXA 4XIDA 3BR2A 2NS8A 1ZLKA 1KQ0A 4V19K 2LBFB 2NVYJ 3ESWB 1IJWC 3I58A 3OYHA 2LY9A 2DTRA 3M9AA 4A3IJ 3CJRB 1XMXA 3G1MA 4A3CJ 2DOAA 1AKHB 2LVSA 1ZG1A 3LSMA 4F7ZA 1RIOH 3MWMA 2BYVE 2IGNA 3LSHA 3L1PA 5FFZA 2M30A 2NVTJ 4G7OF 2L7KA 4CUGA 2R7UA 3C18A 1ACIA 1SFUA 3PJRA 2VKHA 3WU2C 2KL4A 3FZVA 3L2CA 3ZRGA 2RREA 2IS4A 4G7ZF 3WTXC 4BJTA 3IHUA 1WI3A 2XIGA 3BOQA 3Q9VA 4FE7A 5E3OA 2MA3A 3HSRA 4G6TB 4Y52J 4AC0A 2NRAC 1DU6A 4NC7A 2JN6A 4Y33A 4QIWN 3ZQQA 2W57A 1TNTA 2NS7A 4Y15A 2LD5A 1VF9A 4IZZA 1E17A 4A6DA 2H1KA 3KP2A 1H88C 4KYWA 2HWVA 2RDPA 1VQ7I 1JUMA 1S72I 3IH4A 4YELA 3BP8A 1ZTRA 5KVRA 5HDGA 1XGNA 3M8JA 2DA7A 4I09A 3BTJA 4Y13A 2CQQA 5ICCA 3WGIA 1OCRH 2K02A 4FT8A 1QA6A 2E60A 2KDOA 5E1XA 4KDPA 3OR2C 5LRSA 2NVXJ 1EF4A 4RB2C 2Y0SA 4KIGA 4PJJA 1ZG3A 4YFXF 2XKPA 2BHYA 2FBIA 2CUEA 1KYZA 2M8GX 4FE4A 1LVAA 4PZJA 4CXFA 4XNFA 2W00A 2XDVA 2WV0A 1FSEA 3A01A 5K1YA 5DD8A 3S3NA 3TOBA 1VFCA 1T39A 1OR7C 1IV8A 3RPQA 3CMAI 2H09A 1X3WB 5FKKA 5J4YA 3OYCA 3A03A 4IHVA 2P0WA 2HYJA 1RI7A 1SVLA 1R22A 3QOPA 1IGNA 1IRXA 3D5LA 4K2EA 2XAJA 3JRFA 2DA4A 3WTTC 2W48A 3RZOJ 2ELKA 1SFKA 2VXZA 3WTSC 2DLLA 2DFHA 4EJWA 1TT0A 4WWCA 1IV6A
chains in the Genus database with same CATH topology
4FQGA 2KFDA 2DODA 1UZCA 2DOFA 2JUCA 2KISA 2KZGA 2E71A 2CQNA 2K85A 2B7EA 2DOEA 2LKSA 2KIQA 2L9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FQG A;  2KFD A;  2DOD A;  1UZC A;  2DOF A;  2JUC A;  2KIS A;  2KZG A;  2E71 A;  2CQN A;  2K85 A;  2B7E A;  2DOE A;  2LKS A;  2KIQ A;  2L9V A; 
#chains in the Genus database with same CATH topology
 3BJO A;  4XM3 A;  1GXP A;  4CO8 A;  2VQL A;  4HX4 A;  1MBJ A;  4M9X A;  3ZQ7 A;  4ON0 A;  2PG4 A;  3JCU C;  1YIJ I;  2V9V A;  3E1S A;  2D1H A;  4MGR A;  3ZMV A;  1BIB A;  2BY3 A;  3K4C A;  3P7N A;  3TED A;  1J7K A;  2V6C A;  2XGE A;  3FXJ A;  5FKO A;  2VPR A;  4DOZ A;  2JA5 J;  1UZC A;  4F93 B;  2O8X A;  5J6X A;  1TT5 B;  2CW0 F;  1YG2 A;  1QVU A;  5CLS A;  2LDU A;  2V1X A;  1AWC A;  2VQC A;  5ICE A;  5LD2 C;  1VQK I;  1LEB A;  5IT9 Z;  4AIH A;  3IWZ A;  2PN6 A;  2RNG A;  3R4K A;  4XOT A;  3HJE A;  2W82 A;  4RLQ A;  5CKT A;  1SD7 A;  2LRD A;  1MD0 A;  4S0H B;  4IL6 C;  2E1O A;  4XL9 A;  1C0W A;  5GAG J;  2XF6 A;  4DJA A;  4RAZ A;  3FXU A;  4ZH4 F;  1MZB A;  3K0L A;  2ID3 A;  3S2H J;  1JTX A;  3HHG A;  2VQH A;  3QYB A;  1LFP A;  4DQ2 A;  3BR3 A;  4M6Y A;  3T8R A;  1BW5 A;  3ZCO A;  1Y8R B;  1JKP C;  1J2X A;  1BI1 A;  3H5A A;  1J9I A;  1JUP A;  5KNL A;  1EKE A;  3JRE A;  4M3F A;  2YU3 A;  3BQY A;  3GVA A;  5DS9 A;  3MMY B;  3LSK A;  2BY1 A;  4BAY A;  4UV9 A;  3QU6 A;  3KYL A;  1JJ8 C;  1FYK A;  2HTS A;  3CCR I;  5FKM A;  3P5J A;  4KIF A;  4XKB A;  5D8L B;  2IJL A;  5GAE J;  2PJR A;  1N78 A;  4C2T A;  2VLA A;  3RPU A;  1NK3 P;  4MFE A;  4LLG F;  1YJW I;  3O2P E;  2K40 A;  4Z2Y A;  3GTK J;  4HLY A;  4EMS A;  2JVG A;  4HNU A;  3HTU A;  5KK1 A;  2LY1 A;  1S7E A;  3VOD A;  2Y0S N;  4LFU A;  5KAI C;  2HI3 A;  3LA3 A;  2XAQ A;  2WA0 A;  3E6M A;  2E7W A;  1UMQ A;  2E2J J;  3GTM J;  3GYH X;  2M34 A;  4WCG A;  1G3Y A;  2OTL I;  4B3A A;  1ETV A;  2OCE A;  3FKJ A;  3K9T A;  3VSL A;  3H0D A;  2UZK A;  1WJE A;  1WSU A;  1R6R A;  1E0E A;  1Y0N A;  2BY0 A;  3OYD A;  4BXX J;  3K4M A;  4ABZ A;  4E7J A;  1JKR C;  2X1C A;  3TBI A;  4L0Y B;  2VXD A;  3IV5 A;  5GTH C;  1ZR4 A;  3OYE A;  3GFJ A;  1CF7 B;  2GAU A;  1Z3Y A;  1T38 A;  4HST A;  1JKO C;  4IRH A;  2F4O B;  4CCL A;  2ZJR F;  3IAS 2;  3CUO A;  4MEX F;  1DPU A;  5A2Q K;  1RKT A;  2VBY A;  2O8K A;  1IRF A;  5HS7 A;  3WTZ A;  4N9I A;  3RIR A;  1LFB A;  3I4M J;  2VOO A;  2ZXH A;  1Z6T A;  3VPR A;  1YIO A;  1U6G A;  1ETK A;  4XRS G;  5FD5 A;  4HBL A;  5ICG A;  3G3Z A;  5E8I A;  1BW6 A;  1N75 A;  4WXD A;  2COB A;  2FSW A;  1OFC X;  3CDH A;  4Z6Y A;  2D45 A;  2KT0 A;  4M72 A;  3S2W A;  4NB5 A;  3E6C C;  1G59 A;  4Y4R A;  2DAO A;  1ZHF A;  3GTJ J;  2JPB A;  3ASN H;  3WU1 B;  4IXA A;  5GPA A;  1EH8 A;  2DPD A;  2R93 J;  3SZG A;  2XGD A;  1NG6 A;  2XSJ C;  4E6K G;  5LEJ A;  1X2M A;  1TWA J;  2Z99 A;  3WE3 A;  2KP6 A;  2ELH A;  1IO2 A;  5CQG A;  4BBS J;  1W36 C;  1D5Y A;  3D5S C;  3R61 A;  4EM1 A;  3ZXS A;  2ECC A;  2DJI A;  3CDL A;  1XSX A;  1XD7 A;  2EV0 A;  4PCQ A;  3ZMD A;  1RR7 A;  2DCE A;  3CCJ I;  2KIF A;  1MDM A;  1VQ8 I;  3IC7 A;  2FMY A;  4QLC U;  2LC2 A;  1TLH B;  5K7F A;  2H27 A;  4WX9 A;  1H9G A;  1QZE A;  1FYL A;  5ILS A;  4G94 A;  2F5F A;  1IC8 A;  5J4V A;  1FZP B;  3P9C A;  5JFR A;  4Y7N J;  4I0A A;  1LUJ B;  1EA3 A;  2O9L A;  1P6R A;  2HKO A;  2QKL B;  4IJA A;  2E5N A;  2CJJ A;  3WHB A;  1W7P A;  1I1G A;  2X48 A;  4AVZ A;  5F64 A;  1U8B A;  4P9F A;  4DZJ A;  2DU9 A;  4W1U A;  5IP9 J;  4IHS A;  2A69 F;  2ZNZ A;  3CMM A;  3A0H C;  4IVN A;  1SAU A;  5KHD A;  1K83 J;  1XDS A;  4HPQ A;  4MO7 A;  5H2F C;  3GX4 X;  4EEF G;  4HG2 A;  1T33 A;  3QOE A;  4KMF A;  2M5W A;  5E1Z B;  1F43 A;  4E4H A;  2DBB A;  3OS0 A;  3ABK H;  3RSN A;  4JK1 X;  2CFO A;  2FOK A;  1Q1H A;  2P5V A;  2R7V A;  4KUM A;  4HF1 A;  2UUZ A;  5J40 A;  4XRF A;  1RR8 C;  4EAT A;  1B72 A;  3GFM A;  3K1P A;  2D1V A;  3CO6 C;  3DKX A;  4XLF A;  2JSC A;  2PX9 A;  3TMO A;  4B48 A;  3MKY B;  5CQE A;  2CSO A;  2KIM A;  3DPU A;  4C30 A;  1VQ9 I;  2IGK A;  2QBY B;  3SJM A;  2L2O A;  1JT0 A;  2JA7 J;  1SMY F;  3HXL A;  3I4P A;  3AG3 H;  2W24 A;  4CCM A;  2XPW A;  1MND A;  3H35 A;  1P2F A;  2FNA A;  4BH9 A;  2R7R A;  1V4R A;  2ETH A;  1FEX A;  2L7Z A;  2HZD A;  2JTV A;  2L9V A;  3T8T A;  4O6J A;  3C1D A;  4ZDO A;  5JHF A;  1I3Q J;  1K4S A;  1WJ5 A;  1QRY A;  3DEU A;  1HLV A;  4YEJ A;  2Z2S B;  4OIO F;  1TW3 A;  3OR1 C;  4M71 A;  1YHQ I;  3KZI C;  1PYV A;  3TDU C;  1PJR A;  3R0J A;  5E3L A;  5IYB J;  3L2R A;  3BG5 A;  2Y75 A;  1FJL A;  2E35 A;  2E7X A;  3JSO A;  3CDI A;  3LQQ A;  1A6Q A;  1NH3 A;  2DQL A;  4RB0 A;  4JP0 A;  1D1A A;  4NC6 A;  3HTS B;  5F0H A;  2KRC A;  2YX7 A;  3EUK L;  1UST A;  4BHP A;  3OSF A;  1VQO I;  1W0U A;  2JRT A;  3IKV A;  4GO1 A;  3E3V A;  4DBQ A;  1KQ9 A;  2TDX A;  3B02 A;  3CCV I;  3LAJ A;  2ZKZ A;  2QYO A;  3I71 A;  2HYG D;  3JW4 A;  3E5U A;  2QM3 A;  4RGR A;  4XQF A;  3OYI A;  3KET A;  5E79 C;  1B1B A;  3GTG J;  3CC4 I;  4DYQ A;  1QHG A;  4UUS B;  5BPD A;  3T5X A;  5EDN A;  2KMU A;  5CVU A;  3ZGK A;  4GYG A;  2M0C A;  3P9K A;  4LGW A;  2BGC A;  2V1N A;  3F8N A;  4F55 A;  1IF1 A;  3ZQF A;  2YU9 J;  1BA5 A;  2ACJ A;  2RQQ A;  1FMV A;  4YRV A;  3WGH A;  1BI2 A;  3DTK A;  2LP0 A;  1ERD A;  4CYC B;  2ZJQ F;  4BGD A;  2LKX A;  1NTC A;  5LGU A;  1R4M B;  1R5I D;  1Y56 A;  2XF5 A;  2F5C A;  1HBX G;  3Q0U A;  1ZYR F;  4LK1 F;  1OIS A;  2R4G A;  4IOA F;  1BI3 A;  1P92 A;  1U5T C;  3K69 A;  2VPL A;  3BPV A;  1A36 A;  4II3 A;  2RVC A;  2DW4 A;  3CCU I;  2BBY A;  2XAH A;  3CF2 A;  3MD2 A;  2AO9 A;  2ADU A;  3SZT A;  1VQ5 I;  1YIT I;  2P81 A;  4BY1 J;  1D0Z A;  2IA2 A;  5E20 A;  1FOK A;  1DP7 P;  5BOX A;  2P4W A;  3FIS A;  3MZ8 A;  3J80 K;  1D3Y A;  5J1Y A;  2L7F P;  1MMG A;  4JX5 A;  3AL0 C;  2H6C A;  4M73 A;  4I02 A;  2HOE A;  3FBN B;  3KP4 A;  4AM3 A;  3KYC B;  2X6X A;  5BNG A;  2GA2 A;  2K9L A;  1Z67 A;  5TGT A;  2CQK A;  2Q8K A;  2IS1 A;  3IP4 B;  2ZC2 A;  4PGG A;  2EA2 A;  1O3R A;  4UUT A;  4LIV A;  4FCY A;  3OV8 A;  1MIJ A;  1OPC A;  2EQR A;  2JUG A;  3TW6 A;  1ONV A;  4MQ9 F;  2VB6 A;  2A07 F;  2PQ8 A;  2FD5 A;  2E34 A;  2E1N A;  5FB2 A;  4EGZ A;  2J5P A;  5F27 A;  2XKO A;  4UVA A;  4MFD A;  3SEQ A;  3ZQI A;  1WJA A;  3HOT A;  4LG3 A;  1OCT C;  4BKX A;  5M5X J;  2FX0 A;  1X1A A;  3FXL A;  3BT9 A;  1W5S A;  2P5K A;  2HZT A;  2VN2 A;  2JMW A;  1MGT A;  3BTL A;  1WJB A;  1WI9 A;  4RLF A;  2O6G E;  4IRG A;  2CH0 A;  3D1N I;  2HOA A;  3TW7 A;  5EG0 B;  2X6Y A;  3W2V A;  4PJ0 C;  3QAH A;  2C6Y A;  4CA0 A;  3MKZ A;  1UG0 A;  1YJ9 I;  1S3J A;  1KU9 A;  1WH7 A;  3RYP A;  1YLF A;  4UXN A;  4D7M A;  5ICF A;  2FBK A;  3GF2 A;  2CYY A;  2W85 A;  1QVT A;  3I59 B;  1OKR A;  2FML A;  2KZG A;  1W5C C;  2NXN B;  2CQN A;  2MAB A;  1OJL A;  3ZMS A;  3F6V A;  4NHJ A;  2VKV A;  2BW3 A;  2E2I J;  3FF5 A;  1RRJ A;  2IS6 A;  6PAX A;  3GLL A;  3UR3 C;  4BAC A;  1MBE A;  2DFE A;  4RAF A;  3OS2 A;  2UV1 A;  5JLX A;  4BHC A;  1XX5 A;  2DYR H;  5C4X J;  2PEX A;  2FOW A;  1QGP A;  4BHB A;  2MSY A;  4U7B A;  2VOP A;  2Y2Z A;  4OAZ A;  4IO9 F;  4FQG A;  3VB2 A;  4ZYH A;  2EZK A;  2VC1 A;  1IZ1 A;  3ZN1 A;  4RGU A;  3GEZ A;  1SFX A;  5FKL A;  3HL2 A;  3HUG B;  4CDG A;  3EET A;  3FIW A;  1K79 A;  4C3H J;  3H36 A;  3LOC A;  3GW2 A;  4C3I J;  5F04 A;  4PFP A;  3PIP F;  3DXJ F;  3PO3 J;  1ZLJ A;  3E0J B;  4KN7 X;  2VT3 A;  4U87 A;  4DNC A;  3CTA A;  2PI0 A;  4IKF A;  4A5M A;  4L5J A;  2M8E A;  2HVS A;  2K9S A;  2XAF A;  3WTU C;  3HGY A;  4CCK A;  3BLY A;  4JX4 A;  4V2G A;  1RUO A;  5FFX A;  1SC7 A;  3L7W A;  2DOD A;  1D8J A;  3OYK A;  3W6V A;  2GIZ A;  3X2Q H;  4ZZL A;  2H1L A;  2R5Z B;  4J19 A;  1BR4 A;  3GO5 A;  1X1C A;  3RJP A;  4OIP F;  3K2A A;  1IN7 A;  3ZQH A;  3L2U A;  2FNP A;  4G12 A;  4PJM A;  4OIR F;  4KIT B;  4M74 A;  5D4R A;  5BPI A;  3EUH A;  1W36 D;  4LG0 B;  4BJ5 C;  4C3J J;  1P7I A;  2CW7 A;  3PNV A;  5M3F J;  2A6E F;  2A5Y B;  2EV6 A;  2Z9O A;  2X1D A;  4BQO A;  4XSZ F;  2DMT A;  3A1Y A;  5LGT A;  4EJT A;  2QQ8 A;  3E6B A;  2JQ7 A;  3AAF A;  1NK2 P;  1DGW Y;  1J59 A;  1D0Y A;  3DTE A;  2VJ4 A;  3H3Z A;  5J3L A;  4BS9 A;  3OYM A;  3ONQ A;  4DBR A;  3DBR B;  3VYR B;  1ENH A;  1K4T A;  1WGX A;  1Y39 A;  4JBA A;  1EV7 A;  1B59 A;  4QPO A;  1UHS A;  4ASN A;  5BQT A;  3BPX A;  3I5U A;  4EVI A;  3MCZ A;  1STZ A;  1B4A A;  1O4X A;  3V7S A;  2AXT C;  4A0X A;  2K9M A;  3COA C;  4U0V A;  2ZB9 A;  4BE1 A;  1V54 H;  2QF7 A;  5L3F A;  5CVI A;  4ZJZ A;  2WAQ A;  4FX4 A;  1SVO A;  5HNH A;  1OCC H;  3W3C A;  1HW5 A;  2DQR A;  3H9Q A;  3M1C A;  3WGG A;  3I4N J;  4AIJ A;  4C9Y A;  2PMZ N;  2Q1Z B;  1T98 A;  4GYI A;  2XRL A;  1S7O A;  2YPR A;  2BXZ A;  2WB1 A;  3ZQG A;  2ZME A;  3S3M A;  4HNT A;  4A3J J;  3HIF A;  5JHU A;  1IN5 A;  4UNO A;  3S93 A;  2V4J C;  3QPT A;  2GLO A;  4FAS D;  2LTP A;  3HG9 A;  1MH4 A;  1OCP A;  3HPG A;  2MFZ A;  2L02 A;  4JQF A;  3AG4 H;  3TO9 A;  3J81 K;  4XLA A;  1QZZ A;  3PO2 J;  4JX6 A;  1WHU A;  2VT2 A;  2LR8 A;  5FLX K;  1RES A;  4XLH A;  3OL3 A;  1PUE E;  2E2H J;  2ISY A;  4CHU A;  4XN3 A;  3DF8 A;  1W4M A;  2MC3 A;  3CP8 A;  3TKY A;  4YFN F;  3HOZ J;  1KU3 A;  2HDD A;  1UG2 A;  2ISZ A;  4E7L A;  4BE0 A;  5FLV A;  1XG1 A;  2NYX A;  3G71 I;  3LSG A;  3OYJ A;  3ABM H;  2LRE A;  3OYL A;  4O3M A;  2R7W A;  2X6O A;  1GV5 A;  1FOX A;  5EYR A;  3RKW A;  2ZSH B;  3BZK A;  3F8F A;  1Z7U A;  5HOO A;  1ZRF A;  1L0O C;  1OQY A;  1ETY A;  1HQC A;  4GRI A;  3VYS B;  3EPZ A;  2EIK H;  4X1E A;  1RC9 A;  3N97 A;  4B43 A;  4HX8 A;  3LFU A;  1GDT A;  1K6Y A;  3CUQ A;  5HS8 A;  4XMY A;  4CYD A;  4UHT A;  1PVE A;  1W1W E;  4ZYA A;  1L3L A;  3QPS A;  2R7Z J;  1MMA A;  2CG4 A;  3AG2 H;  5CPR B;  2GZW A;  3O3K A;  2EJR A;  5DCM B;  2VON A;  4RGS A;  5DUI A;  1A6I A;  1DP3 A;  2NOJ B;  3CES A;  4Q4Z F;  3BG3 A;  3M8F A;  1FOW A;  2KJB A;  1QO0 D;  1FBU A;  3OSG A;  2GXG A;  2QSG X;  2HR3 A;  4XRS A;  2IEK A;  2GXA A;  2IA0 A;  1TW2 A;  2QEN A;  4XLE A;  5M3M J;  3JRC A;  1U0J A;  1U5T B;  3KPH A;  1FLI A;  4HF2 A;  4P1W A;  2HVR A;  1X1D A;  4LIU A;  5IY5 H;  2WAQ N;  1KU2 A;  1KU7 A;  4XOP A;  2ZNY A;  1X1P A;  4Q47 A;  4HSR A;  2ZCW A;  1B8I A;  1ORK A;  3S1M J;  3V7C A;  3W6K B;  4PJN A;  3CQZ J;  3D5R C;  3HBL A;  1U8R A;  2VJ5 A;  1MBH A;  3LQR A;  3JRB A;  5CVJ A;  1XSD A;  4M3E A;  1YX3 A;  2WB1 N;  3DKW A;  3ERE D;  4LOC A;  3AL0 B;  2L4A A;  3DBL B;  2DN0 A;  2G7H A;  3BY6 A;  1BBY A;  2JA2 A;  1JXS A;  3FBI B;  1YW8 A;  1ZG5 A;  3I9V 2;  1R58 A;  2M7A A;  2GOM A;  1ZR2 A;  1WZ2 A;  3I53 A;  5HLH A;  3PNT A;  4A3E J;  4PSW A;  1BJZ A;  2EFN A;  4LMY A;  4BXU A;  4A3K J;  2BHZ A;  4L5I A;  1DU0 A;  3IAM 2;  1F9N A;  3HM5 A;  3H9G A;  4BQN A;  5F6F A;  4FTH A;  3UKG A;  3RTR A;  2BVM A;  1LE8 A;  2HDW A;  3G4S I;  2RAE A;  4H0E A;  4L0Z B;  1XB4 A;  5TIS C;  2ZXW H;  4HX7 A;  3TO7 A;  1CQT A;  2AS5 F;  1QHH D;  2NAZ A;  2VI6 A;  4IHT A;  3LA2 A;  3KYD B;  2IRF G;  3GTL J;  3EYY A;  2Q0O A;  1TQP A;  1H0M A;  4ZDP A;  4EM0 B;  4MTD A;  1AA7 A;  1CGP A;  3K7A J;  1SD6 A;  4D1Q A;  2HQA A;  1FYM A;  3TGN A;  2OA4 A;  2R7S A;  1WVR A;  2HU9 A;  1G6N A;  2K7L A;  3JR9 A;  3JAM K;  3DEE A;  4CCO A;  1HOM A;  4D9J A;  5FRN A;  4BY7 J;  3HOS A;  3HOU J;  2IS2 A;  3VSK A;  1TWC J;  3QP6 A;  3RKY A;  2HXO A;  3GZN B;  2V7F A;  1HKT A;  3HSE A;  1YTY A;  1S8N A;  4BUP A;  1YE9 A;  5FD6 A;  3HSF A;  2G9W A;  2M45 A;  3ECH A;  4HV6 A;  2KFD A;  2E36 A;  3IWF A;  2QVO A;  1JGG A;  1G2H A;  2R7T A;  1IN8 A;  2EB7 A;  3U1K A;  1OLT A;  1UJ8 A;  4AUX A;  4J01 A;  4E7H A;  2M0M A;  4KN4 X;  2MC4 A;  1WJC A;  2DK5 A;  2FQ3 A;  4A0Z A;  4E7I A;  2CRG A;  2R3S A;  4I99 C;  3E97 A;  3ROU A;  1VQP I;  4NQW A;  1MJ9 A;  3K6G A;  4U7D A;  1W0T A;  4XR6 A;  1ZQ3 P;  2ESN A;  4R1H A;  2M7B A;  1HW1 A;  1OYI A;  3A0B C;  2DO7 A;  4WK8 F;  1VQ4 I;  2ESH A;  2MLG A;  4M3B A;  3SDG A;  4WXH A;  2KJC A;  2DMP A;  1VQL I;  1JHF A;  3BJA A;  1T56 A;  2Y48 A;  3IKT A;  3PL8 A;  1HA8 A;  1D8K A;  3HGG A;  3G2B A;  1GLN A;  4WXC A;  3LAP A;  1JTY A;  1HW2 A;  2KLO A;  2LKP A;  2ELJ A;  3QU3 A;  1HST A;  2H8R A;  3BZ6 A;  1O3Q A;  2MGQ A;  2PJR B;  3SZP A;  1R7J A;  4J00 A;  3AG1 H;  1Q1V A;  4BL0 B;  1QBJ A;  2OV7 A;  1ZGJ A;  2HOT A;  1U2W A;  1X4P A;  5EGO A;  3HOV J;  4XLP F;  2AXL A;  3VDX A;  2VIX A;  1MKM A;  2R5Y A;  3LA7 A;  3SDB A;  3V8L A;  3J7Z I;  1VZ0 A;  2QQB A;  3AFH A;  1O7F A;  3V8J A;  3SQN A;  3F6O A;  3PFY A;  4F91 B;  5B5E C;  1TC3 C;  1P9Q C;  2Y69 H;  2AQF A;  1EH7 A;  2LOO A;  4YFK F;  1GVD A;  3M4O J;  2X1E A;  2CV2 A;  2M4K A;  3ZP5 A;  2OQR A;  2VAS A;  4CCJ A;  5ILV A;  1F1Z A;  2Z1D A;  1XTA A;  3NQO A;  3EYI A;  2MYS A;  3OYB A;  1LPQ A;  3WTV C;  3I54 A;  2CFX A;  2HEO A;  2Q2E A;  1TBX A;  4A3D J;  4NNJ A;  2D5V A;  2CUZ A;  2EPF A;  4P55 A;  1K78 A;  5E17 F;  4AD9 A;  5EZG A;  2NNY A;  3PUF A;  4RB1 A;  2Y31 A;  4XKV A;  2KHM A;  5TRD A;  1M1E B;  3EUA A;  3G73 A;  4N0B A;  1SD4 A;  2ECB A;  1XGM A;  4KIB A;  1Z9C A;  4M6X A;  3LSR A;  1TL8 A;  1WCM J;  4E7K A;  2STW A;  4HQM A;  1MMD A;  4FIS A;  5JVT A;  2W25 A;  1BC8 C;  1BM9 A;  3VEP A;  5HDK A;  3IUO A;  3OYG A;  4L9T A;  3DLA A;  4F52 A;  5D5W B;  1P4W A;  1RKW A;  1HSJ A;  5IT3 A;  3MVP A;  4D0P A;  2XUB A;  3DFG A;  2X6W A;  1XC5 A;  3T0Y A;  4O5V A;  3BQZ A;  2KRF A;  1BOA A;  5L3E A;  2EZL A;  1SFO J;  3CCL I;  3RQI A;  4DYC A;  5DTD A;  3CMY A;  5IPA A;  2DDB A;  4HDV A;  3K4N A;  1MDM B;  1IN6 A;  2OF7 A;  3PSI A;  5D6F A;  3EUH C;  3L9F A;  4DW6 A;  3BR1 A;  1FTZ A;  2I5U A;  3G1O A;  1H89 C;  2CMP A;  5HLG A;  4I2O A;  1U3E M;  4GFB A;  4NUB A;  1FNN A;  4IPA A;  2QA4 I;  1UEL B;  2R7D A;  1I27 A;  4M3G A;  1W7P B;  3PIO F;  3F0C A;  4YII A;  1AU7 A;  3ML6 A;  5ILU A;  1PDN C;  1WWX A;  2N8G A;  1PUF A;  1YJN I;  2WTE A;  4AYB A;  2EV5 A;  3LSI A;  2DDA A;  2XHK A;  1LKX A;  1QU3 A;  3S32 A;  4H4K C;  2CQ7 A;  5K5Q A;  3KZZ A;  4HF0 A;  1K6O A;  2CV0 A;  2P7V B;  3L00 A;  1VQN I;  2V1U A;  2CO5 A;  4BJ6 C;  1R1V A;  1B72 B;  3RYR A;  2EZH A;  1X3Z B;  5A2Q Z;  1ZRD A;  1XCV A;  3CJN A;  4Y3O A;  2BOL A;  1E3P A;  3CCE I;  5IP7 J;  3QYE A;  4EM2 A;  1N25 A;  5L3B A;  3S1N J;  4AU7 A;  4I01 A;  4HQE A;  1V5F A;  4CIC A;  1LB2 A;  3KEY A;  2FJ1 A;  4S05 A;  3C3W A;  3KEO A;  1MJB A;  5ED4 A;  2ZME C;  1YW9 A;  3I3L A;  1QNT A;  5B3S H;  4YIR X;  2GA1 A;  3GWZ A;  5J1R A;  5JLW A;  4HRI A;  4Y17 A;  2L5Q A;  2KZV A;  4PJL A;  2K9Q A;  3U21 A;  1XDU A;  4HEA 2;  3GZ6 A;  2VBX A;  3DKY A;  4DYR A;  2EWN A;  2QWW A;  1XGO A;  4A2U A;  1IXC A;  5AIQ A;  4LB6 B;  2K4B A;  5D5X B;  2XB5 A;  4B1R A;  1LDJ A;  4P96 A;  2BY2 A;  3FM3 A;  4A3G J;  4IRI A;  2JZY A;  3Q9S A;  3TQN A;  2K9N A;  3WHC A;  1WQ2 A;  3ZQL A;  4ZTJ A;  3DCF A;  2EIN H;  3R60 A;  5TJJ A;  1SEU A;  2LK2 A;  2KIU A;  2WAD A;  4LB5 A;  3S16 J;  3RDI A;  3JRI A;  2EIM H;  2EFP A;  4UUV A;  2OU2 A;  4OMZ A;  3N05 A;  5IOY A;  3KFW X;  5AON A;  1Y0U A;  3H9J A;  2WC2 A;  4EJV A;  4BDZ A;  3QPH A;  4RAY A;  3K1M A;  2ID6 A;  3FXM A;  3RI4 A;  2UXX A;  1TWG J;  4OAY A;  3S3O A;  2EBI A;  1FPQ A;  1R1T A;  3FDY A;  1ODD A;  1X4O A;  1NG7 A;  2JK3 A;  5D8K B;  2HTJ A;  1XPX A;  5J47 A;  3Q3S A;  3CUQ C;  2VC0 A;  4YG2 F;  3C7J A;  3QOD A;  2LMD A;  2XPU A;  3KX2 A;  4AWX B;  4MHG A;  5HDN A;  2DTZ A;  1SMT A;  1XS9 A;  1R5G A;  1IW7 F;  5LEK A;  4A3F J;  3MFK A;  4RGX A;  4Q5S F;  3OOU A;  4UVC A;  5LFA A;  1XMA A;  1P7J A;  2M3A A;  3VFZ A;  3ERM A;  1ZN2 A;  1QQI A;  3IL2 A;  3BG6 A;  4AYB N;  1R00 A;  1IUY A;  4IOC F;  2HNH A;  2KKO A;  2DT7 B;  2QCO A;  3DPL C;  4E70 A;  2HXI A;  4RM3 A;  2HFH A;  1IDY A;  1D1C A;  1MH3 A;  4IHY A;  1I3A A;  2O03 A;  2MBF A;  2WV1 A;  3OMY A;  4A69 C;  4HDU A;  4B44 A;  3CC2 I;  4RA2 A;  4OWR B;  3CO7 C;  3CP2 A;  1A31 A;  1WKM A;  2L9R A;  5F1R A;  4HOB A;  4BBR J;  3QP5 A;  2E5Z A;  2XF7 A;  4KIS A;  1T8I A;  2JSP A;  2KQR A;  4XKW A;  4OOI A;  2PMZ A;  1Y1W J;  1EH6 A;  1YRN A;  1OCZ H;  4OU0 A;  2DOE A;  1R9T J;  3JTH A;  3FXK A;  3K70 C;  1S29 A;  1VND A;  4JYK A;  2VBW A;  1PP8 F;  2VKD A;  1VI0 A;  4UB6 C;  2XSD C;  1IRG A;  2IBD A;  1E2X A;  2EFQ A;  2DMQ A;  3ASO H;  3WTW C;  2XGX A;  2LY2 A;  5DUK A;  1FY7 A;  2LKS A;  5E3N A;  2J5O A;  4A5N A;  4IQJ A;  3PQJ A;  2R7O A;  3HKZ A;  1DQU A;  2V9P A;  3O6B B;  5B1A H;  1RPW A;  3GBG A;  4BNC A;  3S1R J;  2O3F A;  2UWM A;  2OD5 A;  5H6R A;  3LNQ A;  2ZFW A;  3PUB A;  4X0G A;  5HLT A;  2ZXJ A;  2IPQ X;  4B47 A;  4B4C A;  2OAZ A;  4BEH A;  1HKS A;  1IAW A;  3FX3 A;  2Z33 A;  4RDU A;  1XSV A;  3BDD A;  3F9K A;  2QLZ A;  4ETS A;  2QGU A;  2XVC A;  4F92 B;  4OMY A;  4YIF A;  4C2U A;  2FBH A;  2LBF A;  3H92 A;  4HAM A;  5GTI C;  2M87 A;  2IP2 A;  4D5F A;  4TV7 A;  5LRR A;  2DMU A;  1AKH A;  3EDP A;  3PFI A;  2JPC A;  2L9S A;  1HDP A;  3KP5 A;  1YI2 I;  2L54 A;  3CCQ I;  4PSX A;  4E7S A;  2IXS A;  1SAN A;  2A68 F;  1R23 A;  5D5U B;  1JHH A;  1UAA A;  3HB9 A;  2A3S A;  1QPM A;  2BV6 A;  2PMH A;  1S9H A;  1JJ6 C;  3I0T A;  4ANJ A;  3GFI A;  1UHW A;  2GOX B;  2HVQ A;  1UCR A;  3RCO A;  1WJF A;  5F1J A;  5FJ8 J;  4W97 A;  3U9G A;  1J0R A;  2DA6 A;  1R36 A;  3J7A Y;  4XBF A;  3S15 J;  1V3F A;  2VJI A;  1D1B A;  1MSE C;  2W7N A;  2HKX A;  4CSW A;  1LVK A;  2LLK A;  4NC8 A;  4M9Z A;  3CZ6 A;  2GQQ A;  3SXY A;  1ETX A;  3S14 J;  2RKH A;  2MLK A;  4P5O A;  2OC6 A;  4CH7 A;  5IT9 K;  4C2M J;  3BC8 A;  3A4C A;  2YUS A;  2Y9Y A;  2X85 A;  4B3X A;  1A04 A;  2ME6 A;  2E71 A;  3DU6 A;  2XAG A;  3FHZ A;  2Z5U A;  4EJU A;  2YX4 A;  1SD5 A;  4HV5 A;  2QEX I;  4KMU X;  4LD5 A;  3B73 A;  2DOF A;  4BDY A;  5GAH J;  2NS0 A;  3A02 A;  5D5V B;  1YFH A;  3BZC A;  1J5Y A;  4WF2 A;  3KZY A;  1ZKG A;  2MH2 A;  4DGW B;  4ESJ A;  2JVH A;  1YQA A;  1XCB A;  3OIO A;  1MSF C;  4ENM A;  5E18 F;  5DV5 A;  1ITY A;  2X0L A;  3HKZ N;  1YO5 C;  4UV8 A;  4BQQ A;  3U2R A;  3NEU A;  4RM2 A;  2LYC A;  5DCM A;  2JRM A;  3E6D A;  2A6H F;  1F4K A;  3R0A A;  4G9Y A;  1K7A A;  1I50 J;  5FO5 A;  3DLL F;  2EA4 A;  2DYS H;  3W2A A;  4N9H A;  5J1U A;  3GLX A;  3HYI A;  1VQ6 I;  3DEW A;  4ITV A;  1FP1 D;  2K86 A;  5K7Z A;  3GFL A;  1F5T A;  4QPQ A;  5FLM J;  1U5T A;  2VJJ A;  2VBZ A;  4ENN A;  4B09 A;  2ZO4 A;  4XLN F;  5JVG F;  2MD0 A;  3FM5 A;  3BCB A;  4UB8 C;  3T1B A;  2QUF A;  2PJP A;  4ZC3 A;  2F4M B;  2DXI A;  3Q5F A;  1MMS A;  1LDK B;  2OQG A;  1I39 A;  1LFU P;  2HDC A;  1X58 A;  3DU5 A;  1ETW A;  2FF4 A;  2K3F A;  2A5W A;  1T95 A;  1GXQ A;  4E7Z A;  3W2W A;  5AIP A;  2DA5 A;  2EH3 A;  1MJA A;  2K4J A;  1LQ1 A;  3EQL F;  4KJZ A;  3C2H A;  2KPM A;  2H6B A;  4ZYG A;  3GXO A;  4IHX A;  1K61 A;  5FRM A;  1WPK A;  3L2W A;  2P6S A;  3PQK A;  4G6Q A;  2DA1 A;  2Y0M A;  2HYF A;  4P9U A;  2IGO A;  2RV8 A;  2ZME B;  4HYE A;  5B66 C;  4B8X A;  2JUC A;  3ISP A;  3CCM I;  2VE8 A;  1ETQ A;  3CD6 I;  2QKM B;  3DPT A;  4MLO A;  1RUN A;  1X19 A;  4XSX F;  3I55 I;  4I0B A;  1Z21 A;  2V26 A;  2I10 A;  3K4J A;  1ZK8 A;  3ZN0 A;  1HDD C;  1FBQ A;  1T6S A;  4BU2 A;  3FXO A;  2O7O A;  5L3D A;  2OJE D;  2V79 A;  3E5X A;  1QZY A;  1Z6R A;  2DJN A;  3ZOB A;  2EFW A;  1FC3 A;  3K4L A;  3KP3 A;  3F22 A;  1Z77 A;  3BR5 A;  2XRO A;  3TOA A;  5C3E J;  2VKE A;  5LGN A;  2E19 A;  1GHC A;  3MKL A;  4KT5 C;  1HF0 A;  2HOS A;  4A3L J;  4F3Q A;  5LHG A;  3FHN A;  2DFF A;  1EJ9 A;  5GAD J;  5DEQ A;  1T08 B;  2LSO A;  3LWF A;  2HS5 A;  2W1O A;  2H8W A;  1F36 A;  1U9N A;  3M8E A;  4HNV A;  4XRM A;  1H9T A;  2KRH A;  2STT A;  2GWR A;  2FQ4 A;  1G3S A;  3ZMT A;  5E8G A;  2L7M P;  3H1C A;  3H3V K;  2WAE A;  2JJ7 A;  1IUF A;  3FXR A;  3K2Z A;  2X9D A;  3LSP A;  1UHM A;  2R92 J;  2CU7 A;  2QQA A;  2HQN A;  3CUQ B;  4A3B J;  3A01 B;  3M1E A;  1IG7 A;  3BTI A;  4NBQ A;  3FMQ A;  3W6J B;  2LG4 A;  3PSF A;  1B9M A;  1X3U A;  5IOZ A;  1IDZ A;  1MNE A;  4EGY A;  2DI3 A;  3CC7 I;  1ON2 A;  3HRU A;  1DUX C;  3M7G A;  2TCT A;  3OS1 A;  3BTC A;  5EEA A;  2B0L A;  2EIL H;  2R7F A;  1CF7 A;  1SFE A;  1TQM A;  1A5J A;  3GTO J;  1U9O A;  1ON1 A;  3L09 A;  1JT6 A;  1T0F A;  1BI0 A;  3DP7 A;  2EIJ H;  1LNW A;  2XAU A;  4XKC A;  2MD5 A;  4L18 B;  2PFB A;  3K4K A;  1ULY A;  4PFO A;  2Z3Y A;  4IX7 A;  1FSH A;  2K27 A;  1V5G A;  3LMM A;  5L3C A;  4A12 A;  5FRO A;  3TO6 A;  1D0X A;  4II2 A;  2MW8 A;  2OCC H;  3KCC A;  2DA3 A;  1TNS A;  1WJD A;  1DGR M;  1B8I B;  1R5H A;  2ZSI B;  3F8M A;  1YS7 A;  4ZDL A;  2M1B A;  1TZL A;  3UNG C;  2F48 A;  5D6E A;  2WAF A;  3J81 Z;  1YW7 A;  1UFM A;  3BRO A;  4QWQ A;  2LF8 A;  2Y30 A;  2JA8 J;  2F5E A;  2E1M C;  5FLX Z;  2PMU A;  1USS A;  2LNB A;  3KE2 A;  3GCM A;  5DCF A;  1GUU A;  2VOD A;  2AHQ A;  2L9N A;  2XAS A;  1HXD A;  3OIP A;  3VYT B;  1BC7 C;  3QPL A;  1XGS A;  1R71 A;  3HHH A;  3MEX A;  4A0Y A;  4EJO A;  2D2W A;  5HLI A;  5J8C A;  4L5E A;  2GBY A;  3H0G J;  4RBO A;  3K70 D;  3CME I;  3OL4 A;  3G1L A;  3HOY J;  5EJC A;  2NOG A;  1YYV A;  1LE8 B;  1DDN A;  1S7A A;  2DA2 A;  2KIS A;  4GDF A;  1G3T A;  2JT1 A;  3I56 I;  3S1Q J;  4JOM A;  1WH5 A;  4GCV A;  1G4D A;  3V4G A;  4PGH A;  4EQQ A;  4IEJ A;  1ZAO A;  2DK8 A;  3ABU A;  2FU4 A;  2RQP A;  2DFI A;  4R79 A;  2XRN A;  1T2K A;  2O0Y A;  3H5N A;  2G7U A;  5IYC J;  4IF4 A;  2F4I A;  3HDD A;  1NHA A;  2QZ8 A;  3DV8 A;  3SFI A;  3KLO A;  3QWL A;  4ENJ A;  4D7N A;  3F72 A;  3OYA A;  3QYF A;  1ZEL A;  1LEA A;  2BVL A;  3CLO A;  3RPU D;  1B6A A;  2NNN A;  2OZU A;  3D0S A;  2GIV A;  4KIC A;  3U1D A;  4FET A;  3K1N A;  2R7X A;  2QBY A;  3ELK A;  1TWH J;  1O7L A;  1FOY A;  4I6Z A;  1QPI A;  3B6A A;  5C4J J;  2VQG A;  2VL8 A;  5CVR A;  1ZRC A;  2QSF X;  2YS9 A;  3GZ5 A;  3MZY A;  1O3T A;  4NQW B;  5F0C A;  2ZXI A;  2WY8 Q;  3CJQ B;  5DD4 A;  3BG9 A;  3FK7 A;  4OIN F;  2HQ5 A;  4ZYE A;  2B63 J;  3HRT A;  1KA8 A;  1G3W A;  5M5W J;  2KIQ A;  3DTI A;  2CV1 A;  2IW5 A;  4G8X A;  4X6A J;  1IRZ A;  5J8F A;  1JE8 A;  3TP3 A;  4BE2 A;  5EF6 A;  2A05 A;  4ESF A;  2JWT A;  2L4M A;  2PLY A;  2BXY A;  1TTY A;  4KA4 A;  2CUF A;  3LFK A;  4DIQ A;  1GV2 A;  2BE5 F;  1ZAR A;  3F8C A;  5K7H A;  2QSH X;  3K4B A;  4RMN A;  2XC7 A;  1LDD A;  1OCO H;  4R8H A;  1BR1 A;  1Y6I A;  4Q48 A;  3NWS A;  1JI8 A;  1W5T A;  2H94 A;  4KT6 A;  4XIC A;  1WRJ A;  4CGZ A;  1YS6 A;  5EZH A;  4ESB A;  3G6E I;  3N4M A;  1KQ8 A;  5K5R A;  3BR0 A;  1BJA A;  3L2V A;  5JR3 A;  3KEQ A;  5DM7 F;  5EGO B;  2CQX A;  3CCY A;  1YOV B;  2P8T A;  1PP7 U;  3IH3 A;  2X4H A;  5M5Y J;  1WFX A;  3HPH A;  1Z1D A;  2JA6 J;  3CCS I;  2R5Y B;  5DDG A;  2A61 A;  3RZD J;  1OR7 A;  3LSJ A;  3J7Y J;  4NDL A;  4UUS A;  2CUJ A;  2COM A;  3NWT A;  5BMZ A;  3C2G A;  2NVU B;  4BYY A;  2RGV A;  2P7C B;  4PUS A;  2FA5 A;  3JAM Z;  2MH9 A;  1FTT A;  4XN0 A;  3WOD F;  2CWE A;  2RN7 A;  2P5L C;  2P6T A;  3C2B A;  3FXQ A;  3OWT A;  2LF7 A;  2UXN A;  3REO A;  1OMI A;  4DZP A;  3DWL E;  4CYC A;  3ZQC A;  3BG7 A;  1AOY A;  5LHI A;  1J09 A;  3ECO A;  1P4A A;  5GP9 A;  2R0Q C;  4ZTF A;  3OYN A;  2BZT A;  3NAU A;  3O8G A;  3O8H A;  3ZMU A;  2E1C A;  9ANT A;  2IA1 A;  2Q2E B;  4QSH A;  1HC8 A;  4XLC A;  5DYM A;  4XON A;  5DM6 F;  2XPV A;  4A93 J;  3OOP A;  2FXA A;  2R7Q A;  4FHT A;  3JRH A;  2MG4 A;  1APL C;  1K78 B;  1ZH5 A;  2KDZ A;  4LJZ F;  1W7P D;  3IRQ A;  3HC7 A;  3SYT A;  3KLN A;  3JSP A;  2IGM A;  4HA8 A;  4HZF A;  5D4S A;  5BS6 A;  3PNY A;  4N4O B;  3Q0V A;  4IQ4 A;  3V42 A;  1FIA A;  1R1U A;  3JRD A;  3F23 A;  1UB9 A;  3WU0 A;  1OYY A;  3MKW B;  3H5R A;  1Z3X A;  2F6C A;  4PDK A;  3H3U A;  3HOW J;  4GXO A;  2IT0 A;  2V6E A;  2LFB A;  2DT5 A;  4UVB A;  3V7R A;  2FE3 A;  3WE2 A;  4AIK A;  3VWB A;  4M3D A;  2F5D A;  3ABL H;  4MEY F;  2O61 A;  5IYD J;  1SVM A;  1BN5 A;  4V2F A;  4G6D A;  3MN2 A;  2EZI A;  1MBF A;  2M2E A;  3MAJ A;  1POG A;  2A6T A;  3BJ6 A;  3P9I A;  1B9N A;  3BWG A;  2Y9Z A;  3WG7 H;  3V8K A;  3M07 A;  4XOR A;  1JGS A;  1LJ9 A;  2B9S A;  3S8P A;  3RKQ A;  2EK5 A;  1BIA A;  3WG9 A;  4U0W A;  4A6E A;  4U0Y A;  3DBH B;  5HNF A;  2DMN A;  1X2N A;  5JI6 A;  3JRG A;  1E3H A;  3JRA A;  3J7A O;  2HQR A;  5E3M A;  4LIT A;  2OZ6 A;  3K10 A;  2DT6 A;  3FMR A;  2L3D A;  2K85 A;  3QRF F;  2LH9 A;  1BR2 A;  4L9N A;  1PUF B;  4M6V A;  5EG0 A;  2GM4 A;  5FGM A;  4CCN A;  2V1D A;  1P4X A;  2OBP A;  1X1B A;  3GTP J;  1VQM I;  2OTJ I;  2ZJ2 A;  4A3M J;  1V5E A;  5KAF C;  1AHD P;  2ZFU A;  1I6X A;  4RS8 A;  3KIO A;  3I59 A;  3HRS A;  3R6S A;  1U78 A;  4N4N B;  3ZR8 X;  3HOX J;  3TDZ C;  5F0F A;  3NAR A;  3DQV C;  3FMS A;  5LBQ A;  3A2K A;  2V9K A;  5FKN A;  2HGC A;  2ZJP F;  1BL0 A;  3TP0 A;  1GT0 C;  3HEF A;  5HVQ C;  1HKQ A;  1Z7L A;  1Z0X A;  2I8D A;  2ICW G;  4OIQ F;  5LHH A;  3ULQ B;  3AKZ A;  1JKQ C;  3HUG A;  3I64 A;  2Z16 A;  3L2Q A;  1BOB A;  5IP6 A;  1Y8Q B;  3IH2 A;  1XN7 A;  3MQ0 A;  3M3Y J;  2IVM A;  2M4G A;  4RAG A;  1ZGA A;  1TQI A;  1A35 A;  4UY8 I;  4MQV A;  4LLL A;  2XB0 X;  1R4N B;  3E7L A;  2BEO A;  4PK4 A;  1S6L A;  5ERI A;  2EFO A;  1FWZ A;  4CZC A;  1XMK A;  3OY9 A;  2RNJ A;  5EEG A;  5H6Q A;  4G7H F;  2R5Z A;  2E1M B;  2IAI A;  1Y1V J;  1H8A C;  3ABT A;  3FK6 A;  1R49 A;  2L0K A;  1FX7 A;  1V55 H;  2L01 A;  1S5L C;  5CJ9 A;  4KFC A;  3F21 A;  2CGP A;  2DPU A;  1RZ4 A;  1SAX A;  3CJT B;  2M9H A;  5GPC A;  1FMW A;  5C44 J;  5KCM A;  2CW8 A;  4L9J A;  4BXF A;  1KYW A;  1ZGW A;  4LG0 A;  4XK4 A;  2F5V A;  1IXR C;  3OYF A;  4M9S A;  2HPI A;  1REP C;  4LLN A;  2NVQ J;  1KZH A;  3CF5 F;  2G0E A;  3MZH A;  1MBK A;  3HRM A;  5F08 A;  3WTY C;  3S2D J;  5CYV A;  5L3G A;  3NRV A;  2TRT A;  2VUM J;  4LK0 F;  2WBM A;  3BR6 A;  3SHF A;  2FRH A;  3GTQ J;  3FWE A;  4ZZD A;  1JUS A;  3JTG A;  3QQA A;  1Z91 A;  2K5C A;  3LL7 A;  1VTN C;  3GME A;  4I76 A;  4L9V A;  1IN4 A;  1RET A;  1T0F C;  1E3O C;  2CS3 A;  4FX0 A;  4AID A;  3S17 J;  1MW7 A;  4EV0 A;  3SFZ A;  2ME0 A;  3KP6 A;  4I98 B;  1J75 A;  3OIQ A;  4D5C A;  5HS9 A;  3SEZ A;  2YSR A;  3E5Q A;  4S04 A;  1KGS A;  1MBG A;  4MIM A;  2WWY A;  4IHW A;  1MMN A;  1IXS B;  3ZPL A;  1MNM C;  3VOE A;  3IRR A;  1OYW A;  3ZMZ A;  1D5V A;  3VYU B;  2XV4 S;  2ZBK A;  1ETO A;  3B6C A;  3TL4 X;  4U88 A;  1O3S A;  2QQ9 A;  3FKI J;  2WY7 Q;  4BQA A;  5B1B H;  1O57 A;  2OPT A;  2W84 A;  2BW3 B;  3KP7 A;  1FP2 A;  1TWF J;  2XGC A;  1FIP A;  1YX5 A;  1YRN B;  2AQE A;  2X51 A;  4AVP A;  3F3X A;  2OUM A;  1N77 A;  3F8B A;  1G8X A;  2K3P A;  3RQ4 A;  5EEH A;  2F2E A;  2YR2 A;  2FEZ A;  1Z05 A;  2O5R A;  1HCR A;  4GGG A;  5H20 A;  4RB3 C;  1ZRE A;  5HOD A;  2VE9 A;  3J80 Z;  4KNY A;  4QTR A;  5LLQ A;  2RC4 A;  1I1S A;  3HZJ A;  1TP4 A;  1I6H J;  4HLX A;  3PM1 A;  1FT9 A;  1I5Z A;  2GXB A;  5CVV A;  3Q0W A;  4CZZ A;  1GVJ A;  3GUD A;  4ZYD A;  5K5O A;  2W4S A;  1KON A;  5E1W A;  2B7E A;  2PBI A;  1FBS A;  1DPR A;  4MTE A;  3LST A;  2HPM A;  4HW0 A;  1RNL A;  4I7H A;  4BEH B;  3BCA A;  4ENK A;  4MNU A;  2FUG 2;  3CLQ A;  3RKX A;  4XID A;  3BR2 A;  2NS8 A;  1ZLK A;  1KQ0 A;  4V19 K;  2LBF B;  2NVY J;  3ESW B;  1IJW C;  3I58 A;  3OYH A;  2LY9 A;  2DTR A;  3M9A A;  4A3I J;  3CJR B;  1XMX A;  3G1M A;  4A3C J;  2DOA A;  1AKH B;  2LVS A;  1ZG1 A;  3LSM A;  4F7Z A;  1RIO H;  3MWM A;  2BYV E;  2IGN A;  3LSH A;  3L1P A;  5FFZ A;  2M30 A;  2NVT J;  4G7O F;  2L7K A;  4CUG A;  2R7U A;  3C18 A;  1ACI A;  1SFU A;  3PJR A;  2VKH A;  3WU2 C;  2KL4 A;  3FZV A;  3L2C A;  3ZRG A;  2RRE A;  2IS4 A;  4G7Z F;  3WTX C;  4BJT A;  3IHU A;  1WI3 A;  2XIG A;  3BOQ A;  3Q9V A;  4FE7 A;  5E3O A;  2MA3 A;  3HSR A;  4G6T B;  4Y52 J;  4AC0 A;  2NRA C;  1DU6 A;  4NC7 A;  2JN6 A;  4Y33 A;  4QIW N;  3ZQQ A;  2W57 A;  1TNT A;  2NS7 A;  4Y15 A;  2LD5 A;  1VF9 A;  4IZZ A;  1E17 A;  4A6D A;  2H1K A;  3KP2 A;  1H88 C;  4KYW A;  2HWV A;  2RDP A;  1VQ7 I;  1JUM A;  1S72 I;  3IH4 A;  4YEL A;  3BP8 A;  1ZTR A;  5KVR A;  5HDG A;  1XGN A;  3M8J A;  2DA7 A;  4I09 A;  3BTJ A;  4Y13 A;  2CQQ A;  5ICC A;  3WGI A;  1OCR H;  2K02 A;  4FT8 A;  1QA6 A;  2E60 A;  2KDO A;  5E1X A;  4KDP A;  3OR2 C;  5LRS A;  2NVX J;  1EF4 A;  4RB2 C;  2Y0S A;  4KIG A;  4PJJ A;  1ZG3 A;  4YFX F;  2XKP A;  2BHY A;  2FBI A;  2CUE A;  1KYZ A;  2M8G X;  4FE4 A;  1LVA A;  4PZJ A;  4CXF A;  4XNF A;  2W00 A;  2XDV A;  2WV0 A;  1FSE A;  3A01 A;  5K1Y A;  5DD8 A;  3S3N A;  3TOB A;  1VFC A;  1T39 A;  1OR7 C;  1IV8 A;  3RPQ A;  3CMA I;  2H09 A;  1X3W B;  5FKK A;  5J4Y A;  3OYC A;  3A03 A;  4IHV A;  2P0W A;  2HYJ A;  1RI7 A;  1SVL A;  1R22 A;  3QOP A;  1IGN A;  1IRX A;  3D5L A;  4K2E A;  2XAJ A;  3JRF A;  2DA4 A;  3WTT C;  2W48 A;  3RZO J;  2ELK A;  1SFK A;  2VXZ A;  3WTS C;  2DLL A;  2DFH A;  4EJW A;  1TT0 A;  4WWC A;  1IV6 A; 
#chains in the Genus database with same CATH homology
 4FQG A;  2KFD A;  2DOD A;  1UZC A;  2DOF A;  2JUC A;  2KIS A;  2KZG A;  2E71 A;  2CQN A;  2K85 A;  2B7E A;  2DOE A;  2LKS A;  2KIQ A;  2L9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...