4FQGA

Crystal structure of the tcerg1 ff4-6 tandem repeat domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
186
Chain Sequence
SHMKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific Interaction of the Transcription Elongation Regulator TCERG1 with RNA Polymerase II Requires Simultaneous Phosphorylation at Ser2, Ser5, and Ser7 within the Carboxyl-terminal Domain Repeat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcription elongation regulator 1
total genus 72
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA03
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA01
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA02
2DOEA 2DODA 2LKSA 2K85A 2CQNA 2DOFA 2KZGA 2E71A 2KFDA 4FQGA 1UZCA 2B7EA 2KIQA 2JUCA 2KISA 2L9VA
chains in the Genus database with same CATH superfamily
1Y1WJ 2NVQJ 4RB2C 1ZGWA 1HOMA 1U8BA 4E7KA 3H1CA 1I3QJ 1HA8A 3OYGA 5J1YA 2COMA 1Z7LA 1LB2A 1HDPA 3CQZJ 3VFZA 1D0XA 5HNFA 2CQXA 3K4JA 1WRJA 2L9NA 4BDZA 1Z3XA 4A3DJ 2FEZA 5K5QA 2K9MA 2DPDA 5FO5A 3OYBA 2GOXB 5KK1A 1Y0NA 3S32A 3VDXA 1OCPA 1BIBA 4PFOA 3BZKA 4XICA 5HDKA 1R5HA 3S8PA 3DXJF 3ZN0A 5E1ZB 4LJZF 3DLAA 1JXSA 2XB5A 3DTKA 4HNUA 2NOJB 2M4KA 1JTYA 5F08A 1SFXA 2MA3A 2V4JC 1D1AA 2LTPA 3L09A 1X19A 4BJTA 4HQEA 2F5DA 3F23A 4RB0A 1TT0A 2EFNA 2R5ZA 5CPRB 1R7JA 2IRFG 3KP5A 3BROA 4FX0A 2XASA 4Y3OA 1HW1A 3HUGB 3MFKA 4BBSJ 2VN2A 1YIJI 2QGUA 1X1AA 1ERDA 5GPAA 3V7CA 4A3IJ 2VBWA 2DA3A 2X6YA 4N9IA 1HDDC 1DDNA 1FTTA 3NARA 4QLCU 1W7PD 2CS3A 4BXFA 1ULYA 4M6YA 2J5PA 4EV0A 4Y4RA 5F0FA 4HV6A 3V8JA 3VODA 2AXLA 3GXOA 3HXLA 2DT6A 3WTXC 3OIQA 4MO7A 3B6AA 1YW8A 3S1RJ 2MG4A 5L3BA 2EA4A 3L2VA 2K85A 2CQQA 4YRVA 4IF4A 2MH9A 1VQ4I 3CCMI 4DYRA 4KMFA 1QZZA 1PUFA 2P0WA 3LA7A 4WXHA 1BJZA 3W2VA 2QM3A 4IRHA 1FMVA 1G8XA 3DPTA 3KLOA 3GYHX 5K7HA 5J4VA 2VQHA 3CUQB 1WPKA 2XGEA 4PJLA 3M7GA 2Y0SN 1MBGA 4XBFA 2HTJA 4OU0A 1FPQA 4I7HA 3DU6A 4BUPA 3L2RA 3ZOBA 4OAYA 2B7EA 4DJAA 5C3EJ 3GFLA 2QZ8A 2YSRA 4N9HA 4O6JA 2FQ4A 2W57A 3IH3A 1KU2A 1MMSA 3KYLA 4RA2A 4GDFA 1PJRA 3LAPA 1UZCA 1U5TB 1LE8B 4ASNA 2JVHA 2EFQA 4FE7A 3MVPA 4XRFA 1ZH5A 2L9RA 3RKYA 4L0ZB 2MC3A 5E3OA 3K7AJ 3EYYA 3DEUA 1UCRA 1MNDA 2X1CA 2BZTA 4RB1A 2M0CA 2KKOA 2P6TA 2M3AA 1O7FA 2Z3YA 1VTNC 4ZZLA 2RKHA 3I64A 4ZTJA 3LQRA 4R79A 3KX2A 2WV0A 4IZZA 2DQLA 2NXNB 5ICEA 1JKPC 1SVLA 4EGZA 4CA0A 2CGPA 2HWVA 5CQEA 5L3EA 1D8KA 5FLXZ 2L3DA 3A0HC 2QBYA 2R7SA 1B9NA 1G4DA 1VQKI 3K70D 2PEXA 2CW7A 1SD4A 5IT3A 5EF6A 5JVGF 3HTUA 1JTXA 3BR5A 2A07F 4I01A 3I55I 4S0HB 5CYVA 2EH3A 3CCJI 3TOBA 2M34A 1R4NB 3RKXA 4IKFA 2OBPA 3GTGJ 2R7RA 2H8WA 3EUHA 3JRBA 3IH2A 3ZGKA 3BG5A 2GIVA 2ZSHB 2HZTA 3CESA 1RUOA 3CMAI 2CFXA 1TWHJ 1BJAA 2DTRA 4D0PA 4HSTA 2NYXA 2HEOA 4C2TA 1AOYA 1RETA 4B4CA 2RREA 3O8HA 3TO6A 2WBMA 5E3NA 1WFXA 1TL8A 5DCFA 1FP1D 1I1GA 4II3A 1XDSA 3ZN1A 1IV8A 4A0XA 1FZPB 1IF1A 3E5QA 1S29A 3KYDB 3CCSI 4HA8A 1XS9A 4DBQA 3H92A 4U87A 4JX4A 3A1YA 4CGZA 2NVYJ 3H9QA 3VOEA 2FBKA 3TDUC 2M4GA 2LNBA 3Q9VA 1LDDA 2HS5A 2QSFX 3IUOA 3ZCOA 4YG2F 4I2OA 3K4MA 1SAUA 3FK7A 2EIKH 1W7PB 4G7HF 1W0UA 5E1WA 3ESWB 2XPWA 1HW2A 3BG9A 3F8BA 4LB6B 2BW3A 2MFZA 2VJJA 1S72I 1P4WA 1UELB 5IOZA 4J00A 2PX9A 3V8LA 4PK4A 3KYCB 3WHBA 1J5YA 1GHCA 3CLQA 2FSWA 5A2QZ 4L9VA 3PNYA 4QSHA 2V1DA 1Z3YA 2LVSA 1P92A 1S7OA 1SD5A 5C4JJ 3JRGA 1IZ1A 3CP8A 1VQ5I 2OTJI 2W82A 2P4WA 4NC8A 4LG0A 1MZBA 1V54H 3QOPA 4O3MA 1XMXA 4MHGA 3T8RA 5E3MA 2XVCA 3BTLA 3O3KA 4MQVA 3CJQB 3ZQIA 2R5YA 1BIAA 4A93J 2HNHA 4ON0A 2W85A 4CSWA 3S2DJ 3A02A 2W4SA 1MJ9A 1XG1A 4I0BA 3M4OJ 2CSOA 1D8JA 2QQ8A 3OYKA 2IGNA 2IA2A 2QF7A 3A4CA 1BC8C 3DTEA 4V19K 3JRFA 2JPBA 1MNMC 4PSXA 4GCVA 4XONA 2RDPA 3CUQA 3QYFA 5IP9J 4RLQA 3A2KA 2V26A 4PFPA 1Y56A 4D7NA 4E70A 3TMOA 3HSEA 3COAC 1O3RA 2ZO4A 4OIRF 3U9GA 3HOZJ 3EETA 4EJOA 4XNFA 1YRNA 1CF7A 2DK8A 4G8XA 1A31A 4I98B 3G6EI 2L4AA 1Y6IA 1R9TJ 3I54A 2R7DA 3HOWJ 3LSMA 3K4LA 4D5CA 4J01A 1I27A 2FMYA 2EB7A 3PUBA 2QQBA 3E0JB 2VB6A 3FMQA 3NWSA 2BE5F 3AG1H 2I5UA 1MD0A 4OWRB 4H0EA 4NHJA 2Z16A 4ANJA 1Z1DA 2O9LA 4BQQA 4O5VA 6PAXA 2E5ZA 5ICCA 4EJTA 2DXIA 3NQOA 4W1UA 3HUGA 2VOOA 3JTHA 3DKXA 2TRTA 2VT3A 3ULQB 2PBIA 2X0LA 3TOAA 2HQ5A 1HCRA 3A0BC 2LMDA 2XGXA 2Y69H 3IAM2 3W6JB 2JN6A 2HYGD 2Z9OA 2NS8A 5IY5H 2A69F 3J81K 4BS9A 1VQ7I 2E5NA 3K4NA 3AG4H 5FROA 1NG7A 2KZGA 3K1MA 3QP5A 1IRXA 1BR1A 4F52A 1AWCA 3SFIA 3DBHB 3K10A 3LOCA 4BNCA 3KZIC 5DUKA 3HPHA 4F55A 4HX4A 1BN5A 2QKLB 1V5GA 1IGNA 3W6VA 3L9FA 1VF9A 2QVOA 4HG2A 3OR2C 3QYBA 3KPHA 1IN8A 3F0CA 5DM7F 2HPMA 4XQFA 1PYVA 1ZR4A 1I1SA 1XC5A 2BY3A 4GXOA 4U7DA 3Q0VA 3NAUA 3ZQ7A 4L0YB 1BA5A 1YX5A 1QPIA 4GYIA 3BG3A 4BQOA 1IV6A 1F43A 2CO5A 1ETQA 2MABA 3G1MA 4BE2A 1OCRH 4XKVA 4YEJA 4S05A 3F8NA 3DKWA 3WTUC 3ROUA 3ELKA 1IXRC 3MAJA 1EF4A 1S3JA 2XGDA 2DAOA 1G3SA 2EV5A 1LVAA 2KISA 2GA1A 1Z9CA 1XPXA 1V55H 2HXIA 3EDPA 1RUNA 2VONA 5LHGA 2BY2A 3BJAA 4AYBN 1PVEA 1H9GA 2DBBA 1N25A 1XSVA 1NK2P 2JT1A 3I58A 2M87A 2L02A 2OZUA 2W84A 4IOAF 2O8XA 4HZFA 3F3XA 2FOKA 1A6IA 1ACIA 1YQAA 1R4MB 2ZXHA 1YJNI 2Y0MA 5JHFA 3DCFA 2CFOA 1BI2A 3TW7A 1TW2A 3IAS2 4XKBA 1FOKA 4KT6A 1OMIA 1QBJA 4XM3A 4UUTA 4XLNF 5E18F 2A5YB 3C2BA 4L5IA 2QBYB 3G1OA 4RGXA 4HOBA 2R5YB 2CRGA 5IP6A 1WJBA 4GRIA 3Q5FA 3VYRB 4P9UA 3GFIA 1G2HA 1R49A 4NQWA 3RKWA 5J8CA 4FCYA 1FJLA 3ABMH 3I59A 5DD4A 1XX5A 5EJCA 2CUZA 2MH2A 1XGMA 1IDYA 1FBSA 3ABTA 3BZ6A 1KYZA 2GA2A 3DKYA 2HYJA 3P9IA 3BTCA 1D0ZA 1RESA 4AM3A 1DGRM 2OF7A 4L9NA 3TO9A 4QTRA 1B8IA 4IHVA 3OYAA 4M6XA 3HOUJ 1DU0A 5DYMA 2A05A 3WTWC 4UUVA 2G7HA 3E5UA 4WK8F 5FKOA 3WTSC 1SFOJ 1OYIA 2Q2EA 4RLFA 2LP0A 3CC2I 5B66C 3OS2A 2FRHA 3LSKA 3K4KA 3KLNA 2RNGA 2XPVA 4OINF 3VSLA 5KNLA 1J2XA 2XC7A 1F5TA 3AL0C 2XGCA 3T1BA 4A6DA 2IA0A 4OMZA 3T8TA 4A3KJ 1C0WA 1IUYA 1JHFA 1OYWA 2IW5A 2E36A 2WB1N 1YFHA 1FC3A 3JRCA 3B6CA 4MTDA 4P55A 2E34A 1QQIA 4V2GA 4G6TB 1X4OA 4XLPF 5IT9Z 2ADUA 3MKLA 4HEA2 1JGGA 2EIMH 1H89C 2B0LA 1X2MA 2FMLA 4RAFA 4X0GA 2R7OA 3U1DA 4KDPA 1FOWA 3OYMA 5DCMA 2NVTJ 3CP2A 1FBUA 3CTAA 2R7WA 2DA5A 1R00A 2YU3A 4PUSA 1NH3A 1TC3C 4A3JJ 2F5EA 2IT0A 3CCVI 1VNDA 3RJPA 1SVOA 1K83J 1HW5A 2VASA 4BU2A 1SMTA 3ZMSA 4V2FA 3HKZN 2BXZA 2XAFA 2E35A 4JQFA 5JLXA 1ZHFA 2IGOA 4ZDLA 5B5EC 2L7FP 2OD5A 2JQ7A 3MKYB 2NS0A 2KRFA 4RGRA 1PP8F 5BS6A 2VXZA 1ETWA 1VZ0A 1VQOI 5DV5A 5L3GA 3DBLB 3M8FA 3SFZA 2ECCA 2CW8A 5LRSA 2CUEA 4F93B 1Q1HA 5LGTA 4F7ZA 5JLWA 2X6WA 2QUFA 3R0JA 2WY7Q 4UHTA 3TP0A 2STTA 3BPXA 2QQAA 2EK5A 3E5XA 3HBLA 2LREA 1BI0A 2RAEA 3LFUA 3WTVC 1I50J 2VKDA 1MH3A 2IAIA 4HPQA 4XLHA 3U2RA 4AVZA 4UY8I 1X1CA 3AFHA 3OL4A 5LGNA 3ZR8X 3IL2A 2PJPA 2HDWA 1D1BA 3EUHC 1FTZA 3WGHA 3GF2A 1J75A 3PFYA 1XSXA 4M74A 2QA4I 2H1LA 5EG0A 1RC9A 2WAFA 3E1SA 3HIFA 4LK1F 4BY7J 4ENNA 4C2UA 1ON2A 2FUG2 1S7AA 3RZOJ 1ZGJA 2BOLA 4M3GA 1P9QC 2RGVA 5DEQA 1IG7A 2K9NA 1HSJA 1K4TA 3FF5A 2DDAA 3M1EA 5L3DA 3HOTA 4M3FA 3CDHA 4LMYA 3R60A 2EZHA 4L9TA 2EINH 5DDGA 3E6CC 2VBYA 3FBIB 1O3SA 3ISPA 1KU3A 2E60A 2EV6A 4KIGA 4IOCF 1A04A 1ONVA 1JUPA 4AYBA 2W1OA 3BDDA 3F72A 4JYKA 5CVIA 2EFWA 1DP3A 2Y30A 5J1UA 2EFPA 4OAZA 1JT6A 2L54A 2FNAA 2P6SA 3RDIA 2HU9A 5TJJA 3HL2A 2KLOA 2X6XA 4MFEA 3OOPA 3ZMDA 3DFGA 3OYLA 1YYVA 2O03A 3FMSA 1U6GA 2V1UA 3BOQA 2K4JA 4I0AA 4RM2A 5GAEJ 4HAMA 1FYKA 2NVXJ 1IRFA 4A12A 2CJJA 2Y9YA 2PFBA 2W7NA 3VB2A 2AXTC 3LQQA 3SDGA 2IEKA 2FD5A 4EJUA 5ICGA 3AKZA 2DOFA 2XPUA 1T95A 2LY2A 2Q8KA 3I59B 3J80K 2KZVA 3LSTA 1MDMA 2A68F 3JRDA 3IWZA 3VWBA 3P9CA 5JFRA 5HS9A 4BHCA 1FLIA 5FD5A 2DJIA 3WE2A 2F5CA 3WG7H 4BHBA 3CF5F 2ZMEA 4UB8C 2RQPA 1LFPA 2K3PA 3VPRA 1REPC 3Q9SA 2CYYA 1UHMA 2X48A 1KA8A 2O6GE 1JHHA 1B4AA 2HQRA 1I6XA 1K6YA 4JK1X 1U3EM 2MBFA 4HDVA 2ZFWA 2A61A 2V7FA 2AQEA 1VQ6I 3V7RA 1IRGA 2BHYA 3ECHA 3N05A 3MWMA 4E7HA 4MNUA 3JR9A 2FBIA 4U0VA 4IHYA 3H9GA 1OCOH 3GBGA 2HZDA 4E4HA 1TBXA 1BL0A 2TDXA 2DLLA 2GM4A 1LE8A 4G9YA 2XSJC 2KRHA 1RR8C 2JRTA 1LDKB 2I10A 2QCOA 3WTYC 4D9JA 2EWNA 2KIMA 4RBOA 2ZJQF 2O0YA 4KICA 1BI1A 2QEXI 2FA5A 4XR6A 2XB0X 2DO7A 3RPUD 3LSRA 2V9PA 3E7LA 5K5OA 4P5OA 1OCTC 3T5XA 3LSJA 3L7WA 4M3EA 2LG4A 2HOSA 2V1XA 1JJ6C 1FSEA 2JA2A 3KIOA 3SZTA 1U0JA 4XIDA 3BJ6A 1XMKA 1RR7A 3TBIA 2XKOA 3AAFA 2HTSA 2DOEA 3AG3H 2V6EA 1B8IB 4YIRX 4MLOA 3GLLA 1ETVA 2F48A 1D5YA 4LIUA 3RTRA 4ITVA 5EG0B 3L2UA 2ZNZA 1N77A 2DFEA 3GFMA 1OYYA 2LKPA 3CCYA 3FX3A 4W97A 4UV9A 3TO7A 3GTLJ 4LITA 3BG7A 3RCOA 4JP0A 1XTAA 4XSXF 2F5FA 4R8HA 4BKXA 3FXOA 1LVKA 1U8RA 1ORKA 3X2QH 1HKTA 2XDVA 2E1MC 1ZG1A 1MDMB 2HQNA 5EGOB 5GAHJ 5EZGA 1K4SA 3K2ZA 5GADJ 1TWFJ 3RIRA 2X51A 1N78A 3S14J 4LIVA 1UHSA 4QWQA 1OQYA 1VFCA 2R4GA 4B09A 4CXFA 1K6OA 3BC8A 3A01A 4EVIA 5F04A 1ENHA 4CYDA 4M73A 2MC4A 5M5WJ 4HF2A 5TRDA 4U88A 4M9ZA 5J47A 5CLSA 1GDTA 3L2CA 1WQ2A 3OOUA 2WA0A 4KFCA 2E19A 3GO5A 2M30A 1UJ8A 4CCJA 3GWZA 3CJNA 4HBLA 1E17A 2KRCA 1FP2A 2XHKA 3CCRI 1TQIA 2ZKZA 4ABZA 2QSGX 3GMEA 1ZK8A 2JPCA 3ECOA 3FXJA 4DQ2A 1TWGJ 1FY7A 3OYDA 4B43A 5KCMA 2RNJA 2VI6A 2DK5A 5DCMB 1MJAA 4RAYA 4YELA 5LRRA 2FX0A 5FKMA 3HOYJ 3ML6A 3FM3A 4FTHA 3OIPA 1F9NA 1RNLA 3K4BA 5AIQA 5BPIA 2MSYA 4ENKA 2IGKA 2DU9A 4AIDA 3G4SI 1OCZH 3W6KB 3LA3A 1PUFB 3DEEA 4X6AJ 3CF2A 3BT9A 3ZQQA 2OU2A 3C3WA 3TW6A 1DQUA 2KJBA 3BR1A 5CVVA 4Y15A 4HNVA 1GT0C 1Y8QB 3K69A 1HLVA 4BE0A 1HQCA 2LKXA 1YJ9I 2CH0A 3NEUA 5B3SH 2LY1A 1BC7C 3OSGA 2G0EA 4CCLA 3WE3A 3RZDJ 3P7NA 5HLGA 2QYOA 1F36A 4NB5A 4RS8A 4L18B 3RKQA 2RQQA 5D6EA 4B47A 2QWWA 1PDNC 4LG0B 2DI3A 2CQ7A 1D5VA 4PJ0C 1TW3A 4FISA 3EUKL 5KAFC 2STWA 5BMZA 5ILSA 2ME6A 2HVSA 2F4MB 1IW7F 2HOTA 2GZWA 2B63J 4P1WA 4M9SA 4DYQA 5HVQC 1K78A 2DW4A 2LR8A 4XKWA 4E7LA 2ELKA 1TP4A 1X2NA 5GTHC 3E3VA 1SAXA 3HB9A 3PUFA 3JAMZ 2JJ7A 3HSFA 4BAYA 5HDNA 3J7YJ 5FLVA 2JSPA 4C3JJ 1DGWY 4ZZDA 2DA2A 2DMPA 1GLNA 2LBFA 5FLXK 2HOEA 4XLEA 1DUXC 1X1BA 2F2EA 1MH4A 2ESNA 3KEYA 4HQMA 1B59A 2LH9A 1ZRFA 4WXDA 2GOMA 1MSEC 3ZQLA 5LHHA 3OYJA 3H35A 1W1WE 1T39A 1HC8A 1Q1VA 3DEWA 1G3WA 3CD6I 5CVRA 5IYCJ 2ZMEC 1MBEA 1Z91A 3C18A 2CW0F 4IHWA 4UVCA 4BJ5C 1RIOH 3ZMZA 4KITB 3FXUA 1POGA 1FMWA 4CO8A 1MMNA 2E1OA 2HKOA 2XKPA 4M3BA 2FU4A 4EATA 2P81A 5LLQA 2DT5A 1IXCA 3ABUA 3D0SA 2E2IJ 2VBZA 4XOTA 1AHDP 3SEZA 3OYEA 2WWYA 3RPUA 1V4RA 3Q0WA 2ELHA 1P7JA 1XB4A 2VQLA 3ZRGA 5E1XA 3CCUI 2XAQA 2AO9A 3M1CA 3BR6A 4I6ZA 4A3MJ 3FBNB 1ODDA 4PGGA 4XRMA 1JE8A 1A5JA 3CMMA 1WHUA 3H0GJ 3LSHA 1PUEE 2Y0SA 2H8RA 2UV1A 2NNYA 3BR0A 3EPZA 3R4KA 3WG9A 2A6HF 1WCMJ 3IH4A 2ID3A 3PIPF 1V5FA 4AD9A 4ESJA 2VJ5A 5CKTA 2JZYA 1O7LA 2MD0A 1GVJA 4LLLA 2WY8Q 4IL6C 1LFUP 4R1HA 4U0WA 2OPTA 2LK2A 4CICA 3CJTB 2BXYA 3DWLE 2OQGA 3Q3SA 3F8MA 3IKTA 4CH7A 3L1PA 1QPMA 3CCEI 4AIJA 1ETYA 1M1EB 4OIPF 3PO3J 3MKZA 1UG2A 1ZREA 4BY1J 5DTDA 1MIJA 2NS7A 4BE1A 2UXXA 3HOVJ 4ZJZA 2GXAA 2H6BA 2DDBA 3WTZA 2E1CA 1YRNB 2MW8A 3F21A 2WC2A 1BR2A 4D5FA 4ZYGA 3HZJA 2PJRA 2K5CA 3GTMJ 3RYRA 4NUBA 2Q1ZB 1Z7UA 1IDZA 4PCQA 2DODA 1SD7A 4EM1A 3FXRA 3IRQA 1IC8A 2OTLI 2P5KA 2DYRH 3TKYA 2A6EF 3K0LA 4BEHB 2NRAC 3O8GA 1TLHB 1G59A 4LOCA 1ZLJA 2BY0A 3F8FA 4ZC3A 3LWFA 2ID6A 3R61A 3RQ4A 1T56A 5D4RA 3FXKA 4A3FJ 1GV2A 2QKMB 2EJRA 5IPAA 1OR7C 1AU7A 1UG0A 1E3PA 1SC7A 3EQLF 3PO2J 1QNTA 1XN7A 3H36A 5E17F 1GV5A 1Y1VJ 5HS8A 4PDKA 3OL3A 4ZYHA 1FT9A 3G71I 3KP6A 1OISA 1H88C 4RMNA 4LFUA 3OS1A 3S3NA 1JJ8C 1ZGAA 2O7OA 1LKXA 1YG2A 2F4OB 1MBJA 1T6SA 3A01B 3N97A 3S17J 4C9YA 5HLTA 4LK0F 2JMWA 2GAUA 3KP2A 2PMHA 1UAAA 2W48A 2ESHA 1QU3A 3WHCA 2AQFA 4YIFA 3HRTA 3CMYA 2XIGA 3LAJA 4HDUA 3ZMTA 4G12A 3W3CA 2R92J 3S3OA 1FSHA 2H09A 1FIPA 2IPQX 1JT0A 4IO9F 2JUGA 1NTCA 2VC1A 2DQRA 2ZSIB 3H5AA 2NVUB 5EZHA 5J40A 1IRZA 2KIFA 4E7JA 4M3DA 1EV7A 4KNYA 1QVTA 2QQ9A 5K5RA 4IQJA 1R5GA 2RV8A 1RRJA 3GEZA 2H27A 2Z2SB 1WZ2A 3GZ6A 4AIKA 1NHAA 5KVRA 4NBQA 3F22A 3W2WA 5FRNA 4G94A 1LJ9A 1WGXA 3FDYA 1WI3A 4PSWA 1V5EA 4EQQA 5D5WB 3HRMA 2ACJA 3MN2A 3CMEI 2K9LA 3QU3A 3S3MA 1ZRDA 5M5YJ 1T38A 3KEOA 3O2PE 3PQKA 2VJIA 4P96A 3KCCA 3CDIA 4AWXB 1FYLA 2CV0A 2UWMA 3H5NA 2ME0A 1MBKA 3HGYA 2D5VA 2LFBA 5FKKA 2DMNA 4G6QA 4RM3A 2VKHA 2LD5A 3ABKH 1Z6TA 5IP7J 1MSFC 3L2WA 3K2AA 5B1AH 2XSDC 2VPLA 4KJZA 2GXBA 4M9XA 1CQTA 3K70C 4KN7X 4C2MJ 1KU7A 2VPRA 3I53A 2LOOA 2GLOA 2LF8A 5TISC 3CCQI 3CC7I 2VOPA 2Z99A 2K02A 2ELJA 4EM0B 4B3AA 5M5XJ 2F6CA 1LEAA 5J8FA 2BGCA 2HI3A 2P7CB 5ERIA 1R1TA 3RYPA 3WU2C 5KHDA 4N4NB 3I4NJ 4ZTFA 4DZJA 3DTIA 3MZ8A 5D6FA 2ZJPF 1YO5C 3CCLI 1Z6RA 1LUJB 4NQWB 2PI0A 4OIOF 2V1NA 2HOAA 2OA4A 5LD2C 2O61A 1HXDA 4BL0B 4A3EJ 2P8TA 1HBXG 2JA8J 1MNEA 1IUFA 4YFNF 3M3YJ 3F9KA 2X9DA 2NOGA 1CGPA 1ZRCA 1XSDA 1Z0XA 3A03A 2G9WA 1F1ZA 3ERED 4JX6A 1W7PA 5LFAA 4EJVA 5LGUA 1ZR2A 2X85A 2CUFA 4B44A 3MQ0A 2XV4S 3IC7A 3BWGA 5C4XJ 3HSRA 5J1RA 1TQPA 1FOYA 1ETOA 4RAGA 4IRIA 2PG4A 2IVMA 5F1JA 1MGTA 1XMAA 1BI3A 1H8AC 3FK6A 4IXAA 4ZYAA 3OMYA 5FLMJ 1I39A 2ZXJA 5FFZA 3OYHA 2YU9J 3WGGA 4HF0A 1OCCH 1W5CC 3IWFA 4TV7A 2YUSA 1VQMI 2YX7A 2PJRB 2OZ6A 2P7VB 4S04A 4ETSA 3JRIA 2W25A 2ICWG 4BJ6C 1NG6A 3HTSB 2DYSH 4E7SA 1UB9A 5GAGJ 2H6CA 2D1VA 3ERMA 1U9NA 1EA3A 1EH7A 2PMZA 2JK3A 2DMUA 4JBAA 3GFJA 1X4PA 2HR3A 4ZH4F 5DS9A 3LL7A 2LSOA 2OAZA 1GUUA 4CYCB 1QRYA 2XF7A 2B9SA 3FIWA 1OKRA 3CUOA 1BOBA 2OV7A 4DOZA 2L5QA 1ZN2A 1B6AA 5GPCA 2CUJA 4OOIA 5K1YA 4I09A 2YPRA 3ZQHA 5F27A 5K7FA 3K6GA 4UXNA 4ZDPA 3U1KA 2ZJRF 3CC4I 1YTYA 3I4PA 1KQ0A 3ZPLA 3QQAA 1VQNI 3N4MA 2F4IA 3VSKA 1WJCA 2JSCA 4XOPA 4AC0A 1W36C 1MJBA 3SEQA 5D4SA 4LB5A 1RI7A 1O4XA 5CJ9A 4KYWA 4QPOA 4PJMA 3EYIA 4HF1A 1S8NA 4N4OB 1FBQA 1RZ4A 3ZMUA 1U5TA 4A5NA 2ZCWA 5CVJA 3IP4B 4BGDA 1W0TA 1SD6A 5E79C 1MMDA 3RI4A 1DP7P 3BQYA 5BPDA 2A5WA 5HLIA 5J3LA 5EDNA 3JREA 1K61A 3CDLA 1OPCA 4J19A 1I6HJ 3GZNB 2F5VA 4Q4ZF 2EZLA 4QPQA 4GFBA 2K4BA 2DFFA 2R7FA 3ASOH 1YI2I 2ZXWH 1W5SA 3FKJA 2WAQA 2R7TA 2VIXA 1A6QA 3D5LA 4FX4A 4IVNA 1BW6A 1P4AA 1AA7A 4B8XA 4M6VA 3VYSB 4RGUA 5C44J 5FB2A 2MLKA 3HC7A 3SHFA 1J0RA 2AS5F 1WI9A 1YW9A 4XL9A 3J7AY 4HYEA 4PJJA 2ZNYA 2PLYA 3T0YA 4Z6YA 1STZA 2EIJH 5BOXA 3P5JA 4XN0A 2BYVE 1GXQA 1MMGA 1K7AA 1WWXA 4NNJA 3KFWX 2HQAA 5HLHA 4WXCA 2VUMJ 4IX7A 4BDYA 2XRLA 2HXOA 4B1RA 4EMSA 1MW7A 4BH9A 3VYUB 5D8LB 4XLCA 1Z21A 4PZJA 1ZG3A 5IYBJ 4MIMA 1D3YA 1DPRA 2BV6A 1U5TC 1J09A 3PL8A 3JCUC 1X3WB 1YIOA 2FNPA 4Z2YA 3FXMA 1XDUA 3I4MJ 2OC6A 3H0DA 3OV8A 1O3QA 5F6FA 5DUIA 1KQ8A 3QWLA 1Y39A 2XROA 2VKVA 3RSNA 2V79A 3P9KA 3GX4X 3OSFA 1YHQI 2Z5UA 4I02A 3SYTA 5D5UB 2KL4A 3BR2A 1DU6A 4CHUA 3MD2A 3QU6A 4IPAA 2EPFA 2JRMA 4OMYA 1IN4A 4HW0A 4IJAA 1UFMA 3E6BA 4KISA 3B73A 4YFXF 4HX8A 2YR2A 2LKSA 2DFIA 2HDDA 1JI8A 2KHMA 1JUMA 3G73A 4EM2A 2IGMA 4CUGA 2R7ZJ 2ZXIA 4ZDOA 1S9HA 2ZJ2A 3BCBA 3C2HA 4EGYA 4ZYDA 1OJLA 3FXLA 4HRIA 2VJ4A 1T2KA 4A5MA 3ONQA 1KZHA 2EZKA 1X1PA 2P5VA 3PSIA 3FZVA 2CWEA 1LEBA 3F6VA 4BEHA 1NK3P 3TDZC 5LEKA 1U2WA 2PMUA 3DLLF 2N8GA 4EEFG 4A69C 4NC6A 5L3FA 2VC0A 2O3FA 2L0KA 2L7ZA 2OCEA 3OY9A 3BY6A 2KDOA 5JHUA 2L7KA 1S7EA 2DFHA 4C30A 2TCTA 4LG3A 5FGMA 1ZG5A 3GTPJ 2V9KA 5EYRA 3I56I 3EUAA 2VL8A 1ZTRA 1JUSA 1D0YA 1XGSA 2KPMA 4PJNA 3U21A 2IP2A 4RDUA 3J7AO 5E8GA 3CZ6A 1ZQ3P 4IHTA 2BY1A 4HX7A 3HPGA 1FNNA 1UMQA 3QPSA 4BYYA 5F0HA 4F91B 5EGOA 1R23A 3H5RA 1Y8RB 2EV0A 5GP9A 3Q0UA 3HEFA 1T0FA 1P4XA 2DT7B 3WGIA 1YJWI 3CUQC 2K7LA 2E2HJ 1E3OC 1X1DA 3PNTA 3DP7A 4Q48A 1Y0UA 1Z77A 3F6OA 4HLXA 1K78B 3J81Z 3IV5A 2Z33A 3CLOA 2JVGA 4BHPA 1SFUA 3JW4A 2E1NA 2R5ZB 3FM5A 2JA6J 2BBYA 3VYTB 2KMUA 3IRRA 3VEPA 2ZC2A 1YE9A 3R0AA 4ENMA 3FKIJ 1IAWA 5ILUA 1B9MA 4CZZA 4ESFA 1J59A 1Z05A 2X4HA 2PN6A 4II2A 2L01A 4X1EA 4E7IA 1P2FA 1OLTA 2FXAA 2HVRA 3WU0A 4F92B 2VQCA 1FYMA 4B3XA 1WJ5A 2XUBA 5B1BH 5IYDJ 4HNTA 2DMTA 3BLYA 1QO0D 3LA2A 2X1DA 3TEDA 2M5WA 4NDLA 2FE3A 1ITYA 1G3TA 3BCAA 2VLAA 1TNSA 2V9VA 5M3FJ 3GUDA 2LDUA 2G7UA 3BJOA 2LBFB 2JWTA 2XF6A 1R1UA 3AL0B 1XCVA 5FKNA 3V8KA 5FKLA 2QSHX 4DGWB 3D5SC 1WKMA 1W5TA 2IA1A 3G1LA 2DN0A 5CVUA 1WVRA 4LD5A 3NWTA 4Y52J 2GWRA 2MLGA 1H9TA 3K1NA 2M7BA 3FHNA 4MQ9F 1LDJA 5A2QK 3OYNA 2JTVA 2VBXA 1SFEA 5EEHA 2IBDA 5FJ8J 3GTJJ 3OYIA 4XMYA 2M45A 2ZMEB 5AIPA 3OS0A 1E0EA 3OWTA 2IS2A 1TWAJ 2AHQA 1FOXA 4Y17A 1ZELA 4BBRJ 3HJEA 2X1EA 3ZP5A 5J6XA 1VQ9I 4MTEA 2Z1DA 1R36A 2K3FA 1P6RA 1TT5B 2UUZA 2M8EA 4BXXJ 1ZYRF 1R71A 1I5ZA 3M07A 3PIOF 3C1DA 5FD6A 3KP7A 1R22A 2LLKA 5EEAA 2KQRA 2LRDA 3TP3A 1L0OC 4HLYA 3MMYB 4UUSA 3HRSA 4M71A 4CCOA 1ZAOA 1YW7A 4NC7A 2FJ1A 1SVMA 2MGQA 1BOAA 3L00A 3GCMA 1FX7A 1T08B 5HS7A 2VXDA 4E7ZA 1JGSA 3MZYA 2VT2A 3PNVA 4ESBA 3HRUA 2K9QA 1VQPI 1EH8A 1LQ1A 2DA4A 2WTEA 2HDCA 1WJEA 3SXYA 1RPWA 4AIHA 4UVBA 4AUXA 3FWEA 5ED4A 1V3FA 1JKOC 2ISYA 2GQQA 2HYFA 2M8GX 2UZKA 1USSA 2L9VA 2A3SA 1B72B 2NAZA 3OIOA 3E97A 3PM1A 2V6CA 2RC4A 4FQGA 1WJAA 2E7WA 3FMRA 4GO1A 3E6MA 4P9FA 4XN3A 3CO7C 3QOEA 4A2UA 2DPUA 4KUMA 3I5UA 1ZLKA 4RAZA 3RQIA 3OYFA 1BW5A 2W00A 3BTIA 4LLNA 1S5LC 2NNNA 3KZZA 1USTA 2Q2EB 3LSPA 4Q5SF 1MBFA 2QLZA 1DPUA 2DA6A 4U0YA 3I71A 4N0BA 2IS6A 2JUCA 2RVCA 2XF5A 1OR7A 3S93A 3QAHA 5JI6A 2DOAA 2L7MP 1VI0A 4OIQF 1QA6A 1P7IA 2Y31A 4A6EA 1QZEA 1XGNA 1ETKA 2CU7A 4DIQA 2BW3B 2D1HA 3E6DA 2OCCH 1R1VA 3WTTC 2R7XA 2M7AA 1N75A 2R7QA 3RPQA 4A3GJ 5LEJA 5DD8A 3GTOJ 1IN6A 1BBYA 3IHUA 1YS7A 3TL4X 2PMZN 1WH7A 4EJWA 3S1QJ 3KP3A 3J7ZI 1KU9A 2O5RA 3GTQJ 1MBHA 1J7KA 3GTKJ 3WU1B 2CV2A 4XLAA 3PSFA 3LNQA 4L5EA 2JA7J 3PFIA 1YITI 2ECBA 3JRAA 5H2FC 1SFKA 4XLFA 4XKCA 2R93J 1XGOA 3KETA 2J5OA 3ABLH 4MEYF 4FASD 4G7OF 1L3LA 4LGWA 1W36D 4H4KC 2VE8A 3NRVA 3ZQFA 3DQVC 3UR3C 3W2AA 3ZQCA 2Y9ZA 1B72A 2EQRA 4WWCA 1XD7A 2CQKA 1E3HA 1TWCJ 5E3LA 3SZGA 5AONA 1QZYA 4MFDA 2COBA 3V42A 2QENA 1ETXA 4Q47A 3QPTA 2HVQA 2CG4A 3QP6A 3JTGA 3BG6A 5F0CA 2CMPA 3TQNA 2R3SA 1IN5A 2PQ8A 3BQZA 3REOA 4YFKF 2M0MA 3BPVA 1WSUA 2KJCA 4MEXF 5EEGA 4BACA 3S2WA 1HSTA 4I76A 2MYSA 1U78A 2M9HA 3LMMA 4L9JA 5HNHA 1QHHD 1O3TA 3H3ZA 3M8EA 1EH6A 5J4YA 1LPQA 3DV8A 4IRGA 1IN7A 3WODF 2WB1A 1F4KA 1MKMA 4FE4A 1O57A 1VQLI 4WX9A 3HOXJ 3CJRB 2WV1A 1S6LA 3KEQA 4BXUA 4Y33A 4DBRA 1IJWC 1G3YA 4KA4A 1R58A 1WH5A 4CCNA 2WAQN 1LNWA 3J80Z 3BP8A 5IOYA 4CDGA 2BVLA 2DTZA 3DBRB 4FETA 4XK4A 5JR3A 3LSIA 4KIBA 1T98A 1FIAA 2W24A 3HGGA 4DNCA 4QIWN 3UNGC 3D1NI 3I9V2 1XCBA 3SDBA 1YLFA 4A0ZA 5L3CA 2P5LC 2EZIA 2CV1A 1GVDA 2EBIA 2VE9A 3B02A 3O6BB 4K2EA 1YOVB 2DJNA 4PGHA 3S1NJ 2Y75A 4IHSA 4G7ZF 1X3UA 3H3UA 1JKRC 3HOSA 5H6QA 3HYIA 1E2XA 1KONA 1HF0A 4CYCA 2L9SA 3IKVA 2R0QC 2EA2A 2FQ3A 1TQMA 5KAIC 2R7UA 3OR1C 1QVUA 3JAMK 2HFHA 4UV8A 1A35A 3DF8A 3KE2A 1VQ8I 2E1MB 2YX4A 9ANTA 5IT9K 4U7BA 2XAGA 4FHTA 5D8KB 4D7MA 3G2BA 4FT8A 3H3VK 3GVAA 2H1KA 2WADA 5D5VB 2K27A 4DYCA 2D2WA 2LY9A 3G3ZA 3M8JA 4WCGA 4XORA 3S15J 3MKWB 4JOMA 1SMYF 4XSZF 2O8KA 3R6SA 1FWZA 3HHHA 1YX3A 3S1MJ 3F8CA 3FISA 5BNGA 3AG2H 4G6DA 4KIFA 1ON1A 1ZARA 1EJ9A 1APLC 4I99C 4BQNA 2K40A 5H6RA 2XAUA 1K79A 4Y13A 2KP6A 2BEOA 1KGSA 3BR3A 2ZBKA 3HG9A 4C3HJ 5HODA 3LFKA 3C2GA 2X6OA 2L2OA 2LF7A 3GZ5A 4HSRA 2FBHA 3SQNA 4M72A 1T0FC 5HOOA 2R7VA 1PP7U 4GGGA 1T8IA 2ZB9A 5TGTA 3SJMA 3KZYA 2UXNA 1H0MA 4A3BJ 4IEJA 5JVTA 3UKGA 2DCEA 2KDZA 1WJFA 3QRFF 3V7SA 3LSGA 3ZMVA 2FF4A 4RB3C 4KT5C 3MZHA 1Z67A 2LC2A 3BTJA 2GIZA 2I8DA 5FRMA 4KMUX 2DA1A 2ETHA 5H20A 1HKQA 3HKZA 3K9TA 4YIIA 1KYWA 1EKEA 1U9OA 5E20A 4C3IJ 2GXGA 1QHGA 2WAEA 2OJED 3DPUA 2C6YA 3PJRA 3FHZA 1SANA 2HPIA 3D5RC 3PQJA 3M9AA 2ISZA 2Y2ZA 3OYCA 1WJDA 2A6TA 3QPLA 5F64A 2IS1A 3ZXSA 5M3MJ 1LFBA 2VQGA 1W4MA 3FXQA 2KIUA 4XRSA 2Q0OA 2VKEA 2ZFUA 1X3ZB 2XAHA 5CQGA 3JSPA 2CQNA 2GBYA 5FFXA 3QYEA 3V4GA 5ICFA 2XAJA 2DA7A 2IS4A 4AU7A 1GXPA 3DU5A 4HV5A 3CO6C 5D5XB 3L2QA 3GLXA 1IO2A 3K1PA 4DZPA 4UVAA 4IQ4A 4DW6A 5LBQA 1BM9A 3MEXA 4GYGA 4UB6C 1IXSB 2H94A 3SZPA 1B1BA 2E71A 1BR4A 2M2EA 2KT0A 3TGNA 1QGPA 4CCMA 2E2JJ 2DMQA 2KFDA 4ZYEA 5F1RA 4ENJA 1RKTA 3KP4A 4WF2A 3DPLC 2HGCA 3K4CA 2LYCA 2IXSA 4CCKA 1TNTA 3I0TA 3BZCA 1CF7B 5K7ZA 3QPHA 4E6KG 3H9JA 5E8IA 1T33A 2IJLA 3GW2A 4D1QA 1I3AA 2MD5A 1HKSA 2M1BA 1R5ID 2EFOA 4A0YA 1UHWA 1ZKGA 5BQTA 2VODA 3ZQGA 3MCZA 4UUSB 1G6NA 4A3LJ 1SEUA 4L5JA 1TTYA 1D1CA 3ASNH 1X58A 3QODA 2D45A 4A3CJ 2HKXA 4RGSA 2K9SA 2K86A 2EILH 3S2HJ 4XRSG 1AKHA 1A36A 1J9IA 4UNOA 2JA5J 4F3QA 5GTIC 4AVPA 2FOWA 2OQRA 4LLGF 1YS6A 4JX5A 4B48A 5LHIA 2Y48A 4IHXA 5ILVA 3S16J 2E7XA 3C7JA 2KIQA 1AKHB 1FEXA 2BVMA 2OUMA 2XRNA 3JRHA 4Y7NJ 1JKQC 1MMAA 2BHZA 4KN4X 4BQAA 1KQ9A 3HM5A 1RKWA 2L4MA 5DM6F 5HDGA 4MGRA 1R6RA 2RN7A 4CZCA 1OFCX 3HHGA 1TZLA 3I3LA 3JSOA 3HDDA 2YS9A
chains in the Genus database with same CATH topology
2DOEA 2DODA 2LKSA 2K85A 2CQNA 2DOFA 2KZGA 2E71A 2KFDA 4FQGA 1UZCA 2B7EA 2KIQA 2JUCA 2KISA 2L9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOE A;  2DOD A;  2LKS A;  2K85 A;  2CQN A;  2DOF A;  2KZG A;  2E71 A;  2KFD A;  4FQG A;  1UZC A;  2B7E A;  2KIQ A;  2JUC A;  2KIS A;  2L9V A; 
#chains in the Genus database with same CATH topology
 1Y1W J;  2NVQ J;  4RB2 C;  1ZGW A;  1HOM A;  1U8B A;  4E7K A;  3H1C A;  1I3Q J;  1HA8 A;  3OYG A;  5J1Y A;  2COM A;  1Z7L A;  1LB2 A;  1HDP A;  3CQZ J;  3VFZ A;  1D0X A;  5HNF A;  2CQX A;  3K4J A;  1WRJ A;  2L9N A;  4BDZ A;  1Z3X A;  4A3D J;  2FEZ A;  5K5Q A;  2K9M A;  2DPD A;  5FO5 A;  3OYB A;  2GOX B;  5KK1 A;  1Y0N A;  3S32 A;  3VDX A;  1OCP A;  1BIB A;  4PFO A;  3BZK A;  4XIC A;  5HDK A;  1R5H A;  3S8P A;  3DXJ F;  3ZN0 A;  5E1Z B;  4LJZ F;  3DLA A;  1JXS A;  2XB5 A;  3DTK A;  4HNU A;  2NOJ B;  2M4K A;  1JTY A;  5F08 A;  1SFX A;  2MA3 A;  2V4J C;  1D1A A;  2LTP A;  3L09 A;  1X19 A;  4BJT A;  4HQE A;  2F5D A;  3F23 A;  4RB0 A;  1TT0 A;  2EFN A;  2R5Z A;  5CPR B;  1R7J A;  2IRF G;  3KP5 A;  3BRO A;  4FX0 A;  2XAS A;  4Y3O A;  1HW1 A;  3HUG B;  3MFK A;  4BBS J;  2VN2 A;  1YIJ I;  2QGU A;  1X1A A;  1ERD A;  5GPA A;  3V7C A;  4A3I J;  2VBW A;  2DA3 A;  2X6Y A;  4N9I A;  1HDD C;  1DDN A;  1FTT A;  3NAR A;  4QLC U;  1W7P D;  2CS3 A;  4BXF A;  1ULY A;  4M6Y A;  2J5P A;  4EV0 A;  4Y4R A;  5F0F A;  4HV6 A;  3V8J A;  3VOD A;  2AXL A;  3GXO A;  3HXL A;  2DT6 A;  3WTX C;  3OIQ A;  4MO7 A;  3B6A A;  1YW8 A;  3S1R J;  2MG4 A;  5L3B A;  2EA4 A;  3L2V A;  2K85 A;  2CQQ A;  4YRV A;  4IF4 A;  2MH9 A;  1VQ4 I;  3CCM I;  4DYR A;  4KMF A;  1QZZ A;  1PUF A;  2P0W A;  3LA7 A;  4WXH A;  1BJZ A;  3W2V A;  2QM3 A;  4IRH A;  1FMV A;  1G8X A;  3DPT A;  3KLO A;  3GYH X;  5K7H A;  5J4V A;  2VQH A;  3CUQ B;  1WPK A;  2XGE A;  4PJL A;  3M7G A;  2Y0S N;  1MBG A;  4XBF A;  2HTJ A;  4OU0 A;  1FPQ A;  4I7H A;  3DU6 A;  4BUP A;  3L2R A;  3ZOB A;  4OAY A;  2B7E A;  4DJA A;  5C3E J;  3GFL A;  2QZ8 A;  2YSR A;  4N9H A;  4O6J A;  2FQ4 A;  2W57 A;  3IH3 A;  1KU2 A;  1MMS A;  3KYL A;  4RA2 A;  4GDF A;  1PJR A;  3LAP A;  1UZC A;  1U5T B;  1LE8 B;  4ASN A;  2JVH A;  2EFQ A;  4FE7 A;  3MVP A;  4XRF A;  1ZH5 A;  2L9R A;  3RKY A;  4L0Z B;  2MC3 A;  5E3O A;  3K7A J;  3EYY A;  3DEU A;  1UCR A;  1MND A;  2X1C A;  2BZT A;  4RB1 A;  2M0C A;  2KKO A;  2P6T A;  2M3A A;  1O7F A;  2Z3Y A;  1VTN C;  4ZZL A;  2RKH A;  3I64 A;  4ZTJ A;  3LQR A;  4R79 A;  3KX2 A;  2WV0 A;  4IZZ A;  2DQL A;  2NXN B;  5ICE A;  1JKP C;  1SVL A;  4EGZ A;  4CA0 A;  2CGP A;  2HWV A;  5CQE A;  5L3E A;  1D8K A;  5FLX Z;  2L3D A;  3A0H C;  2QBY A;  2R7S A;  1B9N A;  1G4D A;  1VQK I;  3K70 D;  2PEX A;  2CW7 A;  1SD4 A;  5IT3 A;  5EF6 A;  5JVG F;  3HTU A;  1JTX A;  3BR5 A;  2A07 F;  4I01 A;  3I55 I;  4S0H B;  5CYV A;  2EH3 A;  3CCJ I;  3TOB A;  2M34 A;  1R4N B;  3RKX A;  4IKF A;  2OBP A;  3GTG J;  2R7R A;  2H8W A;  3EUH A;  3JRB A;  3IH2 A;  3ZGK A;  3BG5 A;  2GIV A;  2ZSH B;  2HZT A;  3CES A;  1RUO A;  3CMA I;  2CFX A;  1TWH J;  1BJA A;  2DTR A;  4D0P A;  4HST A;  2NYX A;  2HEO A;  4C2T A;  1AOY A;  1RET A;  4B4C A;  2RRE A;  3O8H A;  3TO6 A;  2WBM A;  5E3N A;  1WFX A;  1TL8 A;  5DCF A;  1FP1 D;  1I1G A;  4II3 A;  1XDS A;  3ZN1 A;  1IV8 A;  4A0X A;  1FZP B;  1IF1 A;  3E5Q A;  1S29 A;  3KYD B;  3CCS I;  4HA8 A;  1XS9 A;  4DBQ A;  3H92 A;  4U87 A;  4JX4 A;  3A1Y A;  4CGZ A;  2NVY J;  3H9Q A;  3VOE A;  2FBK A;  3TDU C;  2M4G A;  2LNB A;  3Q9V A;  1LDD A;  2HS5 A;  2QSF X;  3IUO A;  3ZCO A;  4YG2 F;  4I2O A;  3K4M A;  1SAU A;  3FK7 A;  2EIK H;  1W7P B;  4G7H F;  1W0U A;  5E1W A;  3ESW B;  2XPW A;  1HW2 A;  3BG9 A;  3F8B A;  4LB6 B;  2BW3 A;  2MFZ A;  2VJJ A;  1S72 I;  1P4W A;  1UEL B;  5IOZ A;  4J00 A;  2PX9 A;  3V8L A;  4PK4 A;  3KYC B;  3WHB A;  1J5Y A;  1GHC A;  3CLQ A;  2FSW A;  5A2Q Z;  4L9V A;  3PNY A;  4QSH A;  2V1D A;  1Z3Y A;  2LVS A;  1P92 A;  1S7O A;  1SD5 A;  5C4J J;  3JRG A;  1IZ1 A;  3CP8 A;  1VQ5 I;  2OTJ I;  2W82 A;  2P4W A;  4NC8 A;  4LG0 A;  1MZB A;  1V54 H;  3QOP A;  4O3M A;  1XMX A;  4MHG A;  3T8R A;  5E3M A;  2XVC A;  3BTL A;  3O3K A;  4MQV A;  3CJQ B;  3ZQI A;  2R5Y A;  1BIA A;  4A93 J;  2HNH A;  4ON0 A;  2W85 A;  4CSW A;  3S2D J;  3A02 A;  2W4S A;  1MJ9 A;  1XG1 A;  4I0B A;  3M4O J;  2CSO A;  1D8J A;  2QQ8 A;  3OYK A;  2IGN A;  2IA2 A;  2QF7 A;  3A4C A;  1BC8 C;  3DTE A;  4V19 K;  3JRF A;  2JPB A;  1MNM C;  4PSX A;  4GCV A;  4XON A;  2RDP A;  3CUQ A;  3QYF A;  5IP9 J;  4RLQ A;  3A2K A;  2V26 A;  4PFP A;  1Y56 A;  4D7N A;  4E70 A;  3TMO A;  3HSE A;  3COA C;  1O3R A;  2ZO4 A;  4OIR F;  3U9G A;  3HOZ J;  3EET A;  4EJO A;  4XNF A;  1YRN A;  1CF7 A;  2DK8 A;  4G8X A;  1A31 A;  4I98 B;  3G6E I;  2L4A A;  1Y6I A;  1R9T J;  3I54 A;  2R7D A;  3HOW J;  3LSM A;  3K4L A;  4D5C A;  4J01 A;  1I27 A;  2FMY A;  2EB7 A;  3PUB A;  2QQB A;  3E0J B;  2VB6 A;  3FMQ A;  3NWS A;  2BE5 F;  3AG1 H;  2I5U A;  1MD0 A;  4OWR B;  4H0E A;  4NHJ A;  2Z16 A;  4ANJ A;  1Z1D A;  2O9L A;  4BQQ A;  4O5V A;  6PAX A;  2E5Z A;  5ICC A;  4EJT A;  2DXI A;  3NQO A;  4W1U A;  3HUG A;  2VOO A;  3JTH A;  3DKX A;  2TRT A;  2VT3 A;  3ULQ B;  2PBI A;  2X0L A;  3TOA A;  2HQ5 A;  1HCR A;  3A0B C;  2LMD A;  2XGX A;  2Y69 H;  3IAM 2;  3W6J B;  2JN6 A;  2HYG D;  2Z9O A;  2NS8 A;  5IY5 H;  2A69 F;  3J81 K;  4BS9 A;  1VQ7 I;  2E5N A;  3K4N A;  3AG4 H;  5FRO A;  1NG7 A;  2KZG A;  3K1M A;  3QP5 A;  1IRX A;  1BR1 A;  4F52 A;  1AWC A;  3SFI A;  3DBH B;  3K10 A;  3LOC A;  4BNC A;  3KZI C;  5DUK A;  3HPH A;  4F55 A;  4HX4 A;  1BN5 A;  2QKL B;  1V5G A;  1IGN A;  3W6V A;  3L9F A;  1VF9 A;  2QVO A;  4HG2 A;  3OR2 C;  3QYB A;  3KPH A;  1IN8 A;  3F0C A;  5DM7 F;  2HPM A;  4XQF A;  1PYV A;  1ZR4 A;  1I1S A;  1XC5 A;  2BY3 A;  4GXO A;  4U7D A;  3Q0V A;  3NAU A;  3ZQ7 A;  4L0Y B;  1BA5 A;  1YX5 A;  1QPI A;  4GYI A;  3BG3 A;  4BQO A;  1IV6 A;  1F43 A;  2CO5 A;  1ETQ A;  2MAB A;  3G1M A;  4BE2 A;  1OCR H;  4XKV A;  4YEJ A;  4S05 A;  3F8N A;  3DKW A;  3WTU C;  3ROU A;  3ELK A;  1IXR C;  3MAJ A;  1EF4 A;  1S3J A;  2XGD A;  2DAO A;  1G3S A;  2EV5 A;  1LVA A;  2KIS A;  2GA1 A;  1Z9C A;  1XPX A;  1V55 H;  2HXI A;  3EDP A;  1RUN A;  2VON A;  5LHG A;  2BY2 A;  3BJA A;  4AYB N;  1PVE A;  1H9G A;  2DBB A;  1N25 A;  1XSV A;  1NK2 P;  2JT1 A;  3I58 A;  2M87 A;  2L02 A;  2OZU A;  2W84 A;  4IOA F;  2O8X A;  4HZF A;  3F3X A;  2FOK A;  1A6I A;  1ACI A;  1YQA A;  1R4M B;  2ZXH A;  1YJN I;  2Y0M A;  5JHF A;  3DCF A;  2CFO A;  1BI2 A;  3TW7 A;  1TW2 A;  3IAS 2;  4XKB A;  1FOK A;  4KT6 A;  1OMI A;  1QBJ A;  4XM3 A;  4UUT A;  4XLN F;  5E18 F;  2A5Y B;  3C2B A;  4L5I A;  2QBY B;  3G1O A;  4RGX A;  4HOB A;  2R5Y B;  2CRG A;  5IP6 A;  1WJB A;  4GRI A;  3Q5F A;  3VYR B;  4P9U A;  3GFI A;  1G2H A;  1R49 A;  4NQW A;  3RKW A;  5J8C A;  4FCY A;  1FJL A;  3ABM H;  3I59 A;  5DD4 A;  1XX5 A;  5EJC A;  2CUZ A;  2MH2 A;  1XGM A;  1IDY A;  1FBS A;  3ABT A;  3BZ6 A;  1KYZ A;  2GA2 A;  3DKY A;  2HYJ A;  3P9I A;  3BTC A;  1D0Z A;  1RES A;  4AM3 A;  1DGR M;  2OF7 A;  4L9N A;  3TO9 A;  4QTR A;  1B8I A;  4IHV A;  3OYA A;  4M6X A;  3HOU J;  1DU0 A;  5DYM A;  2A05 A;  3WTW C;  4UUV A;  2G7H A;  3E5U A;  4WK8 F;  5FKO A;  3WTS C;  1SFO J;  1OYI A;  2Q2E A;  4RLF A;  2LP0 A;  3CC2 I;  5B66 C;  3OS2 A;  2FRH A;  3LSK A;  3K4K A;  3KLN A;  2RNG A;  2XPV A;  4OIN F;  3VSL A;  5KNL A;  1J2X A;  2XC7 A;  1F5T A;  3AL0 C;  2XGC A;  3T1B A;  4A6D A;  2IA0 A;  4OMZ A;  3T8T A;  4A3K J;  1C0W A;  1IUY A;  1JHF A;  1OYW A;  2IW5 A;  2E36 A;  2WB1 N;  1YFH A;  1FC3 A;  3JRC A;  3B6C A;  4MTD A;  4P55 A;  2E34 A;  1QQI A;  4V2G A;  4G6T B;  1X4O A;  4XLP F;  5IT9 Z;  2ADU A;  3MKL A;  4HEA 2;  1JGG A;  2EIM H;  1H89 C;  2B0L A;  1X2M A;  2FML A;  4RAF A;  4X0G A;  2R7O A;  3U1D A;  4KDP A;  1FOW A;  3OYM A;  5DCM A;  2NVT J;  3CP2 A;  1FBU A;  3CTA A;  2R7W A;  2DA5 A;  1R00 A;  2YU3 A;  4PUS A;  1NH3 A;  1TC3 C;  4A3J J;  2F5E A;  2IT0 A;  3CCV I;  1VND A;  3RJP A;  1SVO A;  1K83 J;  1HW5 A;  2VAS A;  4BU2 A;  1SMT A;  3ZMS A;  4V2F A;  3HKZ N;  2BXZ A;  2XAF A;  2E35 A;  4JQF A;  5JLX A;  1ZHF A;  2IGO A;  4ZDL A;  5B5E C;  2L7F P;  2OD5 A;  2JQ7 A;  3MKY B;  2NS0 A;  2KRF A;  4RGR A;  1PP8 F;  5BS6 A;  2VXZ A;  1ETW A;  1VZ0 A;  1VQO I;  5DV5 A;  5L3G A;  3DBL B;  3M8F A;  3SFZ A;  2ECC A;  2CW8 A;  5LRS A;  2CUE A;  4F93 B;  1Q1H A;  5LGT A;  4F7Z A;  5JLW A;  2X6W A;  2QUF A;  3R0J A;  2WY7 Q;  4UHT A;  3TP0 A;  2STT A;  3BPX A;  2QQA A;  2EK5 A;  3E5X A;  3HBL A;  2LRE A;  1BI0 A;  2RAE A;  3LFU A;  3WTV C;  1I50 J;  2VKD A;  1MH3 A;  2IAI A;  4HPQ A;  4XLH A;  3U2R A;  4AVZ A;  4UY8 I;  1X1C A;  3AFH A;  3OL4 A;  5LGN A;  3ZR8 X;  3IL2 A;  2PJP A;  2HDW A;  1D1B A;  3EUH C;  1FTZ A;  3WGH A;  3GF2 A;  1J75 A;  3PFY A;  1XSX A;  4M74 A;  2QA4 I;  2H1L A;  5EG0 A;  1RC9 A;  2WAF A;  3E1S A;  3HIF A;  4LK1 F;  4BY7 J;  4ENN A;  4C2U A;  1ON2 A;  2FUG 2;  1S7A A;  3RZO J;  1ZGJ A;  2BOL A;  4M3G A;  1P9Q C;  2RGV A;  5DEQ A;  1IG7 A;  2K9N A;  1HSJ A;  1K4T A;  3FF5 A;  2DDA A;  3M1E A;  5L3D A;  3HOT A;  4M3F A;  3CDH A;  4LMY A;  3R60 A;  2EZH A;  4L9T A;  2EIN H;  5DDG A;  3E6C C;  2VBY A;  3FBI B;  1O3S A;  3ISP A;  1KU3 A;  2E60 A;  2EV6 A;  4KIG A;  4IOC F;  1A04 A;  1ONV A;  1JUP A;  4AYB A;  2W1O A;  3BDD A;  3F72 A;  4JYK A;  5CVI A;  2EFW A;  1DP3 A;  2Y30 A;  5J1U A;  2EFP A;  4OAZ A;  1JT6 A;  2L54 A;  2FNA A;  2P6S A;  3RDI A;  2HU9 A;  5TJJ A;  3HL2 A;  2KLO A;  2X6X A;  4MFE A;  3OOP A;  3ZMD A;  3DFG A;  3OYL A;  1YYV A;  2O03 A;  3FMS A;  1U6G A;  2V1U A;  3BOQ A;  2K4J A;  4I0A A;  4RM2 A;  5GAE J;  4HAM A;  1FYK A;  2NVX J;  1IRF A;  4A12 A;  2CJJ A;  2Y9Y A;  2PFB A;  2W7N A;  3VB2 A;  2AXT C;  3LQQ A;  3SDG A;  2IEK A;  2FD5 A;  4EJU A;  5ICG A;  3AKZ A;  2DOF A;  2XPU A;  1T95 A;  2LY2 A;  2Q8K A;  3I59 B;  3J80 K;  2KZV A;  3LST A;  1MDM A;  2A68 F;  3JRD A;  3IWZ A;  3VWB A;  3P9C A;  5JFR A;  5HS9 A;  4BHC A;  1FLI A;  5FD5 A;  2DJI A;  3WE2 A;  2F5C A;  3WG7 H;  4BHB A;  3CF5 F;  2ZME A;  4UB8 C;  2RQP A;  1LFP A;  2K3P A;  3VPR A;  1REP C;  3Q9S A;  2CYY A;  1UHM A;  2X48 A;  1KA8 A;  2O6G E;  1JHH A;  1B4A A;  2HQR A;  1I6X A;  1K6Y A;  4JK1 X;  1U3E M;  2MBF A;  4HDV A;  2ZFW A;  2A61 A;  2V7F A;  2AQE A;  1VQ6 I;  3V7R A;  1IRG A;  2BHY A;  3ECH A;  3N05 A;  3MWM A;  4E7H A;  4MNU A;  3JR9 A;  2FBI A;  4U0V A;  4IHY A;  3H9G A;  1OCO H;  3GBG A;  2HZD A;  4E4H A;  1TBX A;  1BL0 A;  2TDX A;  2DLL A;  2GM4 A;  1LE8 A;  4G9Y A;  2XSJ C;  2KRH A;  1RR8 C;  2JRT A;  1LDK B;  2I10 A;  2QCO A;  3WTY C;  4D9J A;  2EWN A;  2KIM A;  4RBO A;  2ZJQ F;  2O0Y A;  4KIC A;  1BI1 A;  2QEX I;  2FA5 A;  4XR6 A;  2XB0 X;  2DO7 A;  3RPU D;  3LSR A;  2V9P A;  3E7L A;  5K5O A;  4P5O A;  1OCT C;  3T5X A;  3LSJ A;  3L7W A;  4M3E A;  2LG4 A;  2HOS A;  2V1X A;  1JJ6 C;  1FSE A;  2JA2 A;  3KIO A;  3SZT A;  1U0J A;  4XID A;  3BJ6 A;  1XMK A;  1RR7 A;  3TBI A;  2XKO A;  3AAF A;  2HTS A;  2DOE A;  3AG3 H;  2V6E A;  1B8I B;  4YIR X;  4MLO A;  3GLL A;  1ETV A;  2F48 A;  1D5Y A;  4LIU A;  3RTR A;  4ITV A;  5EG0 B;  3L2U A;  2ZNZ A;  1N77 A;  2DFE A;  3GFM A;  1OYY A;  2LKP A;  3CCY A;  3FX3 A;  4W97 A;  4UV9 A;  3TO7 A;  3GTL J;  4LIT A;  3BG7 A;  3RCO A;  4JP0 A;  1XTA A;  4XSX F;  2F5F A;  4R8H A;  4BKX A;  3FXO A;  1LVK A;  1U8R A;  1ORK A;  3X2Q H;  1HKT A;  2XDV A;  2E1M C;  1ZG1 A;  1MDM B;  2HQN A;  5EGO B;  5GAH J;  5EZG A;  1K4S A;  3K2Z A;  5GAD J;  1TWF J;  3RIR A;  2X51 A;  1N78 A;  3S14 J;  4LIV A;  1UHS A;  4QWQ A;  1OQY A;  1VFC A;  2R4G A;  4B09 A;  4CXF A;  1K6O A;  3BC8 A;  3A01 A;  4EVI A;  5F04 A;  1ENH A;  4CYD A;  4M73 A;  2MC4 A;  5M5W J;  4HF2 A;  5TRD A;  4U88 A;  4M9Z A;  5J47 A;  5CLS A;  1GDT A;  3L2C A;  1WQ2 A;  3OOU A;  2WA0 A;  4KFC A;  2E19 A;  3GO5 A;  2M30 A;  1UJ8 A;  4CCJ A;  3GWZ A;  3CJN A;  4HBL A;  1E17 A;  2KRC A;  1FP2 A;  2XHK A;  3CCR I;  1TQI A;  2ZKZ A;  4ABZ A;  2QSG X;  3GME A;  1ZK8 A;  2JPC A;  3ECO A;  3FXJ A;  4DQ2 A;  1TWG J;  1FY7 A;  3OYD A;  4B43 A;  5KCM A;  2RNJ A;  2VI6 A;  2DK5 A;  5DCM B;  1MJA A;  4RAY A;  4YEL A;  5LRR A;  2FX0 A;  5FKM A;  3HOY J;  3ML6 A;  3FM3 A;  4FTH A;  3OIP A;  1F9N A;  1RNL A;  3K4B A;  5AIQ A;  5BPI A;  2MSY A;  4ENK A;  2IGK A;  2DU9 A;  4AID A;  3G4S I;  1OCZ H;  3W6K B;  3LA3 A;  1PUF B;  3DEE A;  4X6A J;  3CF2 A;  3BT9 A;  3ZQQ A;  2OU2 A;  3C3W A;  3TW6 A;  1DQU A;  2KJB A;  3BR1 A;  5CVV A;  4Y15 A;  4HNV A;  1GT0 C;  1Y8Q B;  3K69 A;  1HLV A;  4BE0 A;  1HQC A;  2LKX A;  1YJ9 I;  2CH0 A;  3NEU A;  5B3S H;  2LY1 A;  1BC7 C;  3OSG A;  2G0E A;  4CCL A;  3WE3 A;  3RZD J;  3P7N A;  5HLG A;  2QYO A;  1F36 A;  4NB5 A;  4RS8 A;  4L18 B;  3RKQ A;  2RQQ A;  5D6E A;  4B47 A;  2QWW A;  1PDN C;  4LG0 B;  2DI3 A;  2CQ7 A;  1D5V A;  4PJ0 C;  1TW3 A;  4FIS A;  3EUK L;  5KAF C;  2STW A;  5BMZ A;  5ILS A;  2ME6 A;  2HVS A;  2F4M B;  1IW7 F;  2HOT A;  2GZW A;  2B63 J;  4P1W A;  4M9S A;  4DYQ A;  5HVQ C;  1K78 A;  2DW4 A;  2LR8 A;  4XKW A;  4E7L A;  2ELK A;  1TP4 A;  1X2N A;  5GTH C;  3E3V A;  1SAX A;  3HB9 A;  3PUF A;  3JAM Z;  2JJ7 A;  3HSF A;  4BAY A;  5HDN A;  3J7Y J;  5FLV A;  2JSP A;  4C3J J;  1DGW Y;  4ZZD A;  2DA2 A;  2DMP A;  1GLN A;  2LBF A;  5FLX K;  2HOE A;  4XLE A;  1DUX C;  1X1B A;  2F2E A;  1MH4 A;  2ESN A;  3KEY A;  4HQM A;  1B59 A;  2LH9 A;  1ZRF A;  4WXD A;  2GOM A;  1MSE C;  3ZQL A;  5LHH A;  3OYJ A;  3H35 A;  1W1W E;  1T39 A;  1HC8 A;  1Q1V A;  3DEW A;  1G3W A;  3CD6 I;  5CVR A;  5IYC J;  2ZME C;  1MBE A;  1Z91 A;  3C18 A;  2CW0 F;  4IHW A;  4UVC A;  4BJ5 C;  1RIO H;  3ZMZ A;  4KIT B;  3FXU A;  1POG A;  1FMW A;  4CO8 A;  1MMN A;  2E1O A;  2HKO A;  2XKP A;  4M3B A;  2FU4 A;  4EAT A;  2P81 A;  5LLQ A;  2DT5 A;  1IXC A;  3ABU A;  3D0S A;  2E2I J;  2VBZ A;  4XOT A;  1AHD P;  3SEZ A;  3OYE A;  2WWY A;  3RPU A;  1V4R A;  3Q0W A;  2ELH A;  1P7J A;  1XB4 A;  2VQL A;  3ZRG A;  5E1X A;  3CCU I;  2XAQ A;  2AO9 A;  3M1C A;  3BR6 A;  4I6Z A;  4A3M J;  3FBN B;  1ODD A;  4PGG A;  4XRM A;  1JE8 A;  1A5J A;  3CMM A;  1WHU A;  3H0G J;  3LSH A;  1PUE E;  2Y0S A;  2H8R A;  2UV1 A;  2NNY A;  3BR0 A;  3EPZ A;  3R4K A;  3WG9 A;  2A6H F;  1WCM J;  3IH4 A;  2ID3 A;  3PIP F;  1V5F A;  4AD9 A;  4ESJ A;  2VJ5 A;  5CKT A;  2JZY A;  1O7L A;  2MD0 A;  1GVJ A;  4LLL A;  2WY8 Q;  4IL6 C;  1LFU P;  4R1H A;  4U0W A;  2OPT A;  2LK2 A;  4CIC A;  3CJT B;  2BXY A;  3DWL E;  2OQG A;  3Q3S A;  3F8M A;  3IKT A;  4CH7 A;  3L1P A;  1QPM A;  3CCE I;  4AIJ A;  1ETY A;  1M1E B;  4OIP F;  3PO3 J;  3MKZ A;  1UG2 A;  1ZRE A;  4BY1 J;  5DTD A;  1MIJ A;  2NS7 A;  4BE1 A;  2UXX A;  3HOV J;  4ZJZ A;  2GXA A;  2H6B A;  2DDB A;  3WTZ A;  2E1C A;  1YRN B;  2MW8 A;  3F21 A;  2WC2 A;  1BR2 A;  4D5F A;  4ZYG A;  3HZJ A;  2PJR A;  2K5C A;  3GTM J;  3RYR A;  4NUB A;  2Q1Z B;  1Z7U A;  1IDZ A;  4PCQ A;  2DOD A;  1SD7 A;  4EM1 A;  3FXR A;  3IRQ A;  1IC8 A;  2OTL I;  2P5K A;  2DYR H;  3TKY A;  2A6E F;  3K0L A;  4BEH B;  2NRA C;  3O8G A;  1TLH B;  1G59 A;  4LOC A;  1ZLJ A;  2BY0 A;  3F8F A;  4ZC3 A;  3LWF A;  2ID6 A;  3R61 A;  3RQ4 A;  1T56 A;  5D4R A;  3FXK A;  4A3F J;  1GV2 A;  2QKM B;  2EJR A;  5IPA A;  1OR7 C;  1AU7 A;  1UG0 A;  1E3P A;  1SC7 A;  3EQL F;  3PO2 J;  1QNT A;  1XN7 A;  3H36 A;  5E17 F;  1GV5 A;  1Y1V J;  5HS8 A;  4PDK A;  3OL3 A;  4ZYH A;  1FT9 A;  3G71 I;  3KP6 A;  1OIS A;  1H88 C;  4RMN A;  4LFU A;  3OS1 A;  3S3N A;  1JJ8 C;  1ZGA A;  2O7O A;  1LKX A;  1YG2 A;  2F4O B;  1MBJ A;  1T6S A;  3A01 B;  3N97 A;  3S17 J;  4C9Y A;  5HLT A;  4LK0 F;  2JMW A;  2GAU A;  3KP2 A;  2PMH A;  1UAA A;  2W48 A;  2ESH A;  1QU3 A;  3WHC A;  2AQF A;  4YIF A;  3HRT A;  3CMY A;  2XIG A;  3LAJ A;  4HDU A;  3ZMT A;  4G12 A;  3W3C A;  2R92 J;  3S3O A;  1FSH A;  2H09 A;  1FIP A;  2IPQ X;  1JT0 A;  4IO9 F;  2JUG A;  1NTC A;  2VC1 A;  2DQR A;  2ZSI B;  3H5A A;  2NVU B;  5EZH A;  5J40 A;  1IRZ A;  2KIF A;  4E7J A;  4M3D A;  1EV7 A;  4KNY A;  1QVT A;  2QQ9 A;  5K5R A;  4IQJ A;  1R5G A;  2RV8 A;  1RRJ A;  3GEZ A;  2H27 A;  2Z2S B;  1WZ2 A;  3GZ6 A;  4AIK A;  1NHA A;  5KVR A;  4NBQ A;  3F22 A;  3W2W A;  5FRN A;  4G94 A;  1LJ9 A;  1WGX A;  3FDY A;  1WI3 A;  4PSW A;  1V5E A;  4EQQ A;  5D5W B;  3HRM A;  2ACJ A;  3MN2 A;  3CME I;  2K9L A;  3QU3 A;  3S3M A;  1ZRD A;  5M5Y J;  1T38 A;  3KEO A;  3O2P E;  3PQK A;  2VJI A;  4P96 A;  3KCC A;  3CDI A;  4AWX B;  1FYL A;  2CV0 A;  2UWM A;  3H5N A;  2ME0 A;  1MBK A;  3HGY A;  2D5V A;  2LFB A;  5FKK A;  2DMN A;  4G6Q A;  4RM3 A;  2VKH A;  2LD5 A;  3ABK H;  1Z6T A;  5IP7 J;  1MSF C;  3L2W A;  3K2A A;  5B1A H;  2XSD C;  2VPL A;  4KJZ A;  2GXB A;  4M9X A;  1CQT A;  3K70 C;  4KN7 X;  4C2M J;  1KU7 A;  2VPR A;  3I53 A;  2LOO A;  2GLO A;  2LF8 A;  5TIS C;  3CCQ I;  3CC7 I;  2VOP A;  2Z99 A;  2K02 A;  2ELJ A;  4EM0 B;  4B3A A;  5M5X J;  2F6C A;  1LEA A;  5J8F A;  2BGC A;  2HI3 A;  2P7C B;  5ERI A;  1R1T A;  3RYP A;  3WU2 C;  5KHD A;  4N4N B;  3I4N J;  4ZTF A;  4DZJ A;  3DTI A;  3MZ8 A;  5D6F A;  2ZJP F;  1YO5 C;  3CCL I;  1Z6R A;  1LUJ B;  4NQW B;  2PI0 A;  4OIO F;  2V1N A;  2HOA A;  2OA4 A;  5LD2 C;  2O61 A;  1HXD A;  4BL0 B;  4A3E J;  2P8T A;  1HBX G;  2JA8 J;  1MNE A;  1IUF A;  4YFN F;  3M3Y J;  3F9K A;  2X9D A;  2NOG A;  1CGP A;  1ZRC A;  1XSD A;  1Z0X A;  3A03 A;  2G9W A;  1F1Z A;  3ERE D;  4JX6 A;  1W7P A;  5LFA A;  4EJV A;  5LGU A;  1ZR2 A;  2X85 A;  2CUF A;  4B44 A;  3MQ0 A;  2XV4 S;  3IC7 A;  3BWG A;  5C4X J;  3HSR A;  5J1R A;  1TQP A;  1FOY A;  1ETO A;  4RAG A;  4IRI A;  2PG4 A;  2IVM A;  5F1J A;  1MGT A;  1XMA A;  1BI3 A;  1H8A C;  3FK6 A;  4IXA A;  4ZYA A;  3OMY A;  5FLM J;  1I39 A;  2ZXJ A;  5FFZ A;  3OYH A;  2YU9 J;  3WGG A;  4HF0 A;  1OCC H;  1W5C C;  3IWF A;  4TV7 A;  2YUS A;  1VQM I;  2YX7 A;  2PJR B;  2OZ6 A;  2P7V B;  4S04 A;  4ETS A;  3JRI A;  2W25 A;  2ICW G;  4BJ6 C;  1NG6 A;  3HTS B;  2DYS H;  4E7S A;  1UB9 A;  5GAG J;  2H6C A;  2D1V A;  3ERM A;  1U9N A;  1EA3 A;  1EH7 A;  2PMZ A;  2JK3 A;  2DMU A;  4JBA A;  3GFJ A;  1X4P A;  2HR3 A;  4ZH4 F;  5DS9 A;  3LL7 A;  2LSO A;  2OAZ A;  1GUU A;  4CYC B;  1QRY A;  2XF7 A;  2B9S A;  3FIW A;  1OKR A;  3CUO A;  1BOB A;  2OV7 A;  4DOZ A;  2L5Q A;  1ZN2 A;  1B6A A;  5GPC A;  2CUJ A;  4OOI A;  5K1Y A;  4I09 A;  2YPR A;  3ZQH A;  5F27 A;  5K7F A;  3K6G A;  4UXN A;  4ZDP A;  3U1K A;  2ZJR F;  3CC4 I;  1YTY A;  3I4P A;  1KQ0 A;  3ZPL A;  3QQA A;  1VQN I;  3N4M A;  2F4I A;  3VSK A;  1WJC A;  2JSC A;  4XOP A;  4AC0 A;  1W36 C;  1MJB A;  3SEQ A;  5D4S A;  4LB5 A;  1RI7 A;  1O4X A;  5CJ9 A;  4KYW A;  4QPO A;  4PJM A;  3EYI A;  4HF1 A;  1S8N A;  4N4O B;  1FBQ A;  1RZ4 A;  3ZMU A;  1U5T A;  4A5N A;  2ZCW A;  5CVJ A;  3IP4 B;  4BGD A;  1W0T A;  1SD6 A;  5E79 C;  1MMD A;  3RI4 A;  1DP7 P;  3BQY A;  5BPD A;  2A5W A;  5HLI A;  5J3L A;  5EDN A;  3JRE A;  1K61 A;  3CDL A;  1OPC A;  4J19 A;  1I6H J;  3GZN B;  2F5V A;  4Q4Z F;  2EZL A;  4QPQ A;  4GFB A;  2K4B A;  2DFF A;  2R7F A;  3ASO H;  1YI2 I;  2ZXW H;  1W5S A;  3FKJ A;  2WAQ A;  2R7T A;  2VIX A;  1A6Q A;  3D5L A;  4FX4 A;  4IVN A;  1BW6 A;  1P4A A;  1AA7 A;  4B8X A;  4M6V A;  3VYS B;  4RGU A;  5C44 J;  5FB2 A;  2MLK A;  3HC7 A;  3SHF A;  1J0R A;  2AS5 F;  1WI9 A;  1YW9 A;  4XL9 A;  3J7A Y;  4HYE A;  4PJJ A;  2ZNY A;  2PLY A;  3T0Y A;  4Z6Y A;  1STZ A;  2EIJ H;  5BOX A;  3P5J A;  4XN0 A;  2BYV E;  1GXQ A;  1MMG A;  1K7A A;  1WWX A;  4NNJ A;  3KFW X;  2HQA A;  5HLH A;  4WXC A;  2VUM J;  4IX7 A;  4BDY A;  2XRL A;  2HXO A;  4B1R A;  4EMS A;  1MW7 A;  4BH9 A;  3VYU B;  5D8L B;  4XLC A;  1Z21 A;  4PZJ A;  1ZG3 A;  5IYB J;  4MIM A;  1D3Y A;  1DPR A;  2BV6 A;  1U5T C;  1J09 A;  3PL8 A;  3JCU C;  1X3W B;  1YIO A;  2FNP A;  4Z2Y A;  3FXM A;  1XDU A;  3I4M J;  2OC6 A;  3H0D A;  3OV8 A;  1O3Q A;  5F6F A;  5DUI A;  1KQ8 A;  3QWL A;  1Y39 A;  2XRO A;  2VKV A;  3RSN A;  2V79 A;  3P9K A;  3GX4 X;  3OSF A;  1YHQ I;  2Z5U A;  4I02 A;  3SYT A;  5D5U B;  2KL4 A;  3BR2 A;  1DU6 A;  4CHU A;  3MD2 A;  3QU6 A;  4IPA A;  2EPF A;  2JRM A;  4OMY A;  1IN4 A;  4HW0 A;  4IJA A;  1UFM A;  3E6B A;  4KIS A;  3B73 A;  4YFX F;  4HX8 A;  2YR2 A;  2LKS A;  2DFI A;  2HDD A;  1JI8 A;  2KHM A;  1JUM A;  3G73 A;  4EM2 A;  2IGM A;  4CUG A;  2R7Z J;  2ZXI A;  4ZDO A;  1S9H A;  2ZJ2 A;  3BCB A;  3C2H A;  4EGY A;  4ZYD A;  1OJL A;  3FXL A;  4HRI A;  2VJ4 A;  1T2K A;  4A5M A;  3ONQ A;  1KZH A;  2EZK A;  1X1P A;  2P5V A;  3PSI A;  3FZV A;  2CWE A;  1LEB A;  3F6V A;  4BEH A;  1NK3 P;  3TDZ C;  5LEK A;  1U2W A;  2PMU A;  3DLL F;  2N8G A;  4EEF G;  4A69 C;  4NC6 A;  5L3F A;  2VC0 A;  2O3F A;  2L0K A;  2L7Z A;  2OCE A;  3OY9 A;  3BY6 A;  2KDO A;  5JHU A;  2L7K A;  1S7E A;  2DFH A;  4C30 A;  2TCT A;  4LG3 A;  5FGM A;  1ZG5 A;  3GTP J;  2V9K A;  5EYR A;  3I56 I;  3EUA A;  2VL8 A;  1ZTR A;  1JUS A;  1D0Y A;  1XGS A;  2KPM A;  4PJN A;  3U21 A;  2IP2 A;  4RDU A;  3J7A O;  5E8G A;  3CZ6 A;  1ZQ3 P;  4IHT A;  2BY1 A;  4HX7 A;  3HPG A;  1FNN A;  1UMQ A;  3QPS A;  4BYY A;  5F0H A;  4F91 B;  5EGO A;  1R23 A;  3H5R A;  1Y8R B;  2EV0 A;  5GP9 A;  3Q0U A;  3HEF A;  1T0F A;  1P4X A;  2DT7 B;  3WGI A;  1YJW I;  3CUQ C;  2K7L A;  2E2H J;  1E3O C;  1X1D A;  3PNT A;  3DP7 A;  4Q48 A;  1Y0U A;  1Z77 A;  3F6O A;  4HLX A;  1K78 B;  3J81 Z;  3IV5 A;  2Z33 A;  3CLO A;  2JVG A;  4BHP A;  1SFU A;  3JW4 A;  2E1N A;  2R5Z B;  3FM5 A;  2JA6 J;  2BBY A;  3VYT B;  2KMU A;  3IRR A;  3VEP A;  2ZC2 A;  1YE9 A;  3R0A A;  4ENM A;  3FKI J;  1IAW A;  5ILU A;  1B9M A;  4CZZ A;  4ESF A;  1J59 A;  1Z05 A;  2X4H A;  2PN6 A;  4II2 A;  2L01 A;  4X1E A;  4E7I A;  1P2F A;  1OLT A;  2FXA A;  2HVR A;  3WU0 A;  4F92 B;  2VQC A;  1FYM A;  4B3X A;  1WJ5 A;  2XUB A;  5B1B H;  5IYD J;  4HNT A;  2DMT A;  3BLY A;  1QO0 D;  3LA2 A;  2X1D A;  3TED A;  2M5W A;  4NDL A;  2FE3 A;  1ITY A;  1G3T A;  3BCA A;  2VLA A;  1TNS A;  2V9V A;  5M3F J;  3GUD A;  2LDU A;  2G7U A;  3BJO A;  2LBF B;  2JWT A;  2XF6 A;  1R1U A;  3AL0 B;  1XCV A;  5FKN A;  3V8K A;  5FKL A;  2QSH X;  4DGW B;  3D5S C;  1WKM A;  1W5T A;  2IA1 A;  3G1L A;  2DN0 A;  5CVU A;  1WVR A;  4LD5 A;  3NWT A;  4Y52 J;  2GWR A;  2MLG A;  1H9T A;  3K1N A;  2M7B A;  3FHN A;  4MQ9 F;  1LDJ A;  5A2Q K;  3OYN A;  2JTV A;  2VBX A;  1SFE A;  5EEH A;  2IBD A;  5FJ8 J;  3GTJ J;  3OYI A;  4XMY A;  2M45 A;  2ZME B;  5AIP A;  3OS0 A;  1E0E A;  3OWT A;  2IS2 A;  1TWA J;  2AHQ A;  1FOX A;  4Y17 A;  1ZEL A;  4BBR J;  3HJE A;  2X1E A;  3ZP5 A;  5J6X A;  1VQ9 I;  4MTE A;  2Z1D A;  1R36 A;  2K3F A;  1P6R A;  1TT5 B;  2UUZ A;  2M8E A;  4BXX J;  1ZYR F;  1R71 A;  1I5Z A;  3M07 A;  3PIO F;  3C1D A;  5FD6 A;  3KP7 A;  1R22 A;  2LLK A;  5EEA A;  2KQR A;  2LRD A;  3TP3 A;  1L0O C;  4HLY A;  3MMY B;  4UUS A;  3HRS A;  4M71 A;  4CCO A;  1ZAO A;  1YW7 A;  4NC7 A;  2FJ1 A;  1SVM A;  2MGQ A;  1BOA A;  3L00 A;  3GCM A;  1FX7 A;  1T08 B;  5HS7 A;  2VXD A;  4E7Z A;  1JGS A;  3MZY A;  2VT2 A;  3PNV A;  4ESB A;  3HRU A;  2K9Q A;  1VQP I;  1EH8 A;  1LQ1 A;  2DA4 A;  2WTE A;  2HDC A;  1WJE A;  3SXY A;  1RPW A;  4AIH A;  4UVB A;  4AUX A;  3FWE A;  5ED4 A;  1V3F A;  1JKO C;  2ISY A;  2GQQ A;  2HYF A;  2M8G X;  2UZK A;  1USS A;  2L9V A;  2A3S A;  1B72 B;  2NAZ A;  3OIO A;  3E97 A;  3PM1 A;  2V6C A;  2RC4 A;  4FQG A;  1WJA A;  2E7W A;  3FMR A;  4GO1 A;  3E6M A;  4P9F A;  4XN3 A;  3CO7 C;  3QOE A;  4A2U A;  2DPU A;  4KUM A;  3I5U A;  1ZLK A;  4RAZ A;  3RQI A;  3OYF A;  1BW5 A;  2W00 A;  3BTI A;  4LLN A;  1S5L C;  2NNN A;  3KZZ A;  1UST A;  2Q2E B;  3LSP A;  4Q5S F;  1MBF A;  2QLZ A;  1DPU A;  2DA6 A;  4U0Y A;  3I71 A;  4N0B A;  2IS6 A;  2JUC A;  2RVC A;  2XF5 A;  1OR7 A;  3S93 A;  3QAH A;  5JI6 A;  2DOA A;  2L7M P;  1VI0 A;  4OIQ F;  1QA6 A;  1P7I A;  2Y31 A;  4A6E A;  1QZE A;  1XGN A;  1ETK A;  2CU7 A;  4DIQ A;  2BW3 B;  2D1H A;  3E6D A;  2OCC H;  1R1V A;  3WTT C;  2R7X A;  2M7A A;  1N75 A;  2R7Q A;  3RPQ A;  4A3G J;  5LEJ A;  5DD8 A;  3GTO J;  1IN6 A;  1BBY A;  3IHU A;  1YS7 A;  3TL4 X;  2PMZ N;  1WH7 A;  4EJW A;  3S1Q J;  3KP3 A;  3J7Z I;  1KU9 A;  2O5R A;  3GTQ J;  1MBH A;  1J7K A;  3GTK J;  3WU1 B;  2CV2 A;  4XLA A;  3PSF A;  3LNQ A;  4L5E A;  2JA7 J;  3PFI A;  1YIT I;  2ECB A;  3JRA A;  5H2F C;  1SFK A;  4XLF A;  4XKC A;  2R93 J;  1XGO A;  3KET A;  2J5O A;  3ABL H;  4MEY F;  4FAS D;  4G7O F;  1L3L A;  4LGW A;  1W36 D;  4H4K C;  2VE8 A;  3NRV A;  3ZQF A;  3DQV C;  3UR3 C;  3W2A A;  3ZQC A;  2Y9Z A;  1B72 A;  2EQR A;  4WWC A;  1XD7 A;  2CQK A;  1E3H A;  1TWC J;  5E3L A;  3SZG A;  5AON A;  1QZY A;  4MFD A;  2COB A;  3V42 A;  2QEN A;  1ETX A;  4Q47 A;  3QPT A;  2HVQ A;  2CG4 A;  3QP6 A;  3JTG A;  3BG6 A;  5F0C A;  2CMP A;  3TQN A;  2R3S A;  1IN5 A;  2PQ8 A;  3BQZ A;  3REO A;  4YFK F;  2M0M A;  3BPV A;  1WSU A;  2KJC A;  4MEX F;  5EEG A;  4BAC A;  3S2W A;  1HST A;  4I76 A;  2MYS A;  1U78 A;  2M9H A;  3LMM A;  4L9J A;  5HNH A;  1QHH D;  1O3T A;  3H3Z A;  3M8E A;  1EH6 A;  5J4Y A;  1LPQ A;  3DV8 A;  4IRG A;  1IN7 A;  3WOD F;  2WB1 A;  1F4K A;  1MKM A;  4FE4 A;  1O57 A;  1VQL I;  4WX9 A;  3HOX J;  3CJR B;  2WV1 A;  1S6L A;  3KEQ A;  4BXU A;  4Y33 A;  4DBR A;  1IJW C;  1G3Y A;  4KA4 A;  1R58 A;  1WH5 A;  4CCN A;  2WAQ N;  1LNW A;  3J80 Z;  3BP8 A;  5IOY A;  4CDG A;  2BVL A;  2DTZ A;  3DBR B;  4FET A;  4XK4 A;  5JR3 A;  3LSI A;  4KIB A;  1T98 A;  1FIA A;  2W24 A;  3HGG A;  4DNC A;  4QIW N;  3UNG C;  3D1N I;  3I9V 2;  1XCB A;  3SDB A;  1YLF A;  4A0Z A;  5L3C A;  2P5L C;  2EZI A;  2CV1 A;  1GVD A;  2EBI A;  2VE9 A;  3B02 A;  3O6B B;  4K2E A;  1YOV B;  2DJN A;  4PGH A;  3S1N J;  2Y75 A;  4IHS A;  4G7Z F;  1X3U A;  3H3U A;  1JKR C;  3HOS A;  5H6Q A;  3HYI A;  1E2X A;  1KON A;  1HF0 A;  4CYC A;  2L9S A;  3IKV A;  2R0Q C;  2EA2 A;  2FQ3 A;  1TQM A;  5KAI C;  2R7U A;  3OR1 C;  1QVU A;  3JAM K;  2HFH A;  4UV8 A;  1A35 A;  3DF8 A;  3KE2 A;  1VQ8 I;  2E1M B;  2YX4 A;  9ANT A;  5IT9 K;  4U7B A;  2XAG A;  4FHT A;  5D8K B;  4D7M A;  3G2B A;  4FT8 A;  3H3V K;  3GVA A;  2H1K A;  2WAD A;  5D5V B;  2K27 A;  4DYC A;  2D2W A;  2LY9 A;  3G3Z A;  3M8J A;  4WCG A;  4XOR A;  3S15 J;  3MKW B;  4JOM A;  1SMY F;  4XSZ F;  2O8K A;  3R6S A;  1FWZ A;  3HHH A;  1YX3 A;  3S1M J;  3F8C A;  3FIS A;  5BNG A;  3AG2 H;  4G6D A;  4KIF A;  1ON1 A;  1ZAR A;  1EJ9 A;  1APL C;  4I99 C;  4BQN A;  2K40 A;  5H6R A;  2XAU A;  1K79 A;  4Y13 A;  2KP6 A;  2BEO A;  1KGS A;  3BR3 A;  2ZBK A;  3HG9 A;  4C3H J;  5HOD A;  3LFK A;  3C2G A;  2X6O A;  2L2O A;  2LF7 A;  3GZ5 A;  4HSR A;  2FBH A;  3SQN A;  4M72 A;  1T0F C;  5HOO A;  2R7V A;  1PP7 U;  4GGG A;  1T8I A;  2ZB9 A;  5TGT A;  3SJM A;  3KZY A;  2UXN A;  1H0M A;  4A3B J;  4IEJ A;  5JVT A;  3UKG A;  2DCE A;  2KDZ A;  1WJF A;  3QRF F;  3V7S A;  3LSG A;  3ZMV A;  2FF4 A;  4RB3 C;  4KT5 C;  3MZH A;  1Z67 A;  2LC2 A;  3BTJ A;  2GIZ A;  2I8D A;  5FRM A;  4KMU X;  2DA1 A;  2ETH A;  5H20 A;  1HKQ A;  3HKZ A;  3K9T A;  4YII A;  1KYW A;  1EKE A;  1U9O A;  5E20 A;  4C3I J;  2GXG A;  1QHG A;  2WAE A;  2OJE D;  3DPU A;  2C6Y A;  3PJR A;  3FHZ A;  1SAN A;  2HPI A;  3D5R C;  3PQJ A;  3M9A A;  2ISZ A;  2Y2Z A;  3OYC A;  1WJD A;  2A6T A;  3QPL A;  5F64 A;  2IS1 A;  3ZXS A;  5M3M J;  1LFB A;  2VQG A;  1W4M A;  3FXQ A;  2KIU A;  4XRS A;  2Q0O A;  2VKE A;  2ZFU A;  1X3Z B;  2XAH A;  5CQG A;  3JSP A;  2CQN A;  2GBY A;  5FFX A;  3QYE A;  3V4G A;  5ICF A;  2XAJ A;  2DA7 A;  2IS4 A;  4AU7 A;  1GXP A;  3DU5 A;  4HV5 A;  3CO6 C;  5D5X B;  3L2Q A;  3GLX A;  1IO2 A;  3K1P A;  4DZP A;  4UVA A;  4IQ4 A;  4DW6 A;  5LBQ A;  1BM9 A;  3MEX A;  4GYG A;  4UB6 C;  1IXS B;  2H94 A;  3SZP A;  1B1B A;  2E71 A;  1BR4 A;  2M2E A;  2KT0 A;  3TGN A;  1QGP A;  4CCM A;  2E2J J;  2DMQ A;  2KFD A;  4ZYE A;  5F1R A;  4ENJ A;  1RKT A;  3KP4 A;  4WF2 A;  3DPL C;  2HGC A;  3K4C A;  2LYC A;  2IXS A;  4CCK A;  1TNT A;  3I0T A;  3BZC A;  1CF7 B;  5K7Z A;  3QPH A;  4E6K G;  3H9J A;  5E8I A;  1T33 A;  2IJL A;  3GW2 A;  4D1Q A;  1I3A A;  2MD5 A;  1HKS A;  2M1B A;  1R5I D;  2EFO A;  4A0Y A;  1UHW A;  1ZKG A;  5BQT A;  2VOD A;  3ZQG A;  3MCZ A;  4UUS B;  1G6N A;  4A3L J;  1SEU A;  4L5J A;  1TTY A;  1D1C A;  3ASN H;  1X58 A;  3QOD A;  2D45 A;  4A3C J;  2HKX A;  4RGS A;  2K9S A;  2K86 A;  2EIL H;  3S2H J;  4XRS G;  1AKH A;  1A36 A;  1J9I A;  4UNO A;  2JA5 J;  4F3Q A;  5GTI C;  4AVP A;  2FOW A;  2OQR A;  4LLG F;  1YS6 A;  4JX5 A;  4B48 A;  5LHI A;  2Y48 A;  4IHX A;  5ILV A;  3S16 J;  2E7X A;  3C7J A;  2KIQ A;  1AKH B;  1FEX A;  2BVM A;  2OUM A;  2XRN A;  3JRH A;  4Y7N J;  1JKQ C;  1MMA A;  2BHZ A;  4KN4 X;  4BQA A;  1KQ9 A;  3HM5 A;  1RKW A;  2L4M A;  5DM6 F;  5HDG A;  4MGR A;  1R6R A;  2RN7 A;  4CZC A;  1OFC X;  3HHG A;  1TZL A;  3I3L A;  3JSO A;  3HDD A;  2YS9 A; 
#chains in the Genus database with same CATH homology
 2DOE A;  2DOD A;  2LKS A;  2K85 A;  2CQN A;  2DOF A;  2KZG A;  2E71 A;  2KFD A;  4FQG A;  1UZC A;  2B7E A;  2KIQ A;  2JUC A;  2KIS A;  2L9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...