4FQGA

Crystal structure of the tcerg1 ff4-6 tandem repeat domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
186
Chain Sequence
b'SHMKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation regulator 1
publication title Specific Interaction of the Transcription Elongation Regulator TCERG1 with RNA Polymerase II Requires Simultaneous Phosphorylation at Ser2, Ser5, and Ser7 within the Carboxyl-terminal Domain Repeat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 72
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA03
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA01
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA02
2L9VA 1UZCA 2LKSA 2DODA 2B7EA 2JUCA 2KFDA 2CQNA 2DOFA 2E71A 2KISA 2KZGA 4FQGA 2K85A 2DOEA 2KIQA
chains in the Genus database with same CATH superfamily
2HZDA 3H92A 5E1WA 2LP0A 3D1NI 1DPUA 2HZTA 3WE2A 3E97A 4JYKA 1STZA 3N4MA 3BY6A 3WGHA 4RLFA 1ZRCA 4V19K 1ZK8A 1Y6IA 2WAQA 3AL0C 1LVKA 2BBYA 1JI8A 3U1KA 3JRBA 4K2EA 4N0BA 4L18B 1IN4A 1YJ9I 4RB1A 1W7PB 1X4OA 4XRFA 1QA6A 2VC1A 1EKEA 3JAMK 4A2UA 4QPOA 4B48A 2XIGA 3Q0UA 2XKPA 2VQGA 2COBA 4RAGA 4KICA 4XQFA 1Z7LA 4H4KC 2DDBA 3JRFA 1DGWY 2AQEA 1S7EA 2BHYA 1MDMB 4LG0B 4M3EA 4OU0A 4PGHA 3ZQHA 4YIFA 2F2EA 5E18F 5IYBJ 3K1MA 4N9HA 2L01A 4BJ5C 2CQKA 3BG7A 2CW7A 1MZBA 1VQKI 3BCAA 1XMAA 3CUQC 1ON1A 4BHBA 2PLYA 5HS9A 3ECOA 1W4MA 2BXZA 1TTYA 1ETKA 2HDWA 4B47A 1U3EM 1SFEA 4PCQA 4KJZA 1JTXA 2XAFA 3BZCA 3HJEA 3JTHA 1I27A 4CZCA 1WJBA 4G7HF 3KZIC 1X3WB 2O5RA 3NQOA 5EEHA 5LGNA 2OTJI 1TQPA 2FX0A 4B3AA 1ENHA 4OWRB 1VQ7I 3SZGA 2HU9A 5L3CA 2PN6A 1JT0A 2ELJA 1OCOH 1MBJA 3EQLF 3F6VA 2M87A 1FSHA 3KX2A 2JVHA 3K0LA 4LJZF 4DQ2A 1RR8C 3BR2A 2XASA 1K4SA 2XKOA 3WU1B 2LNBA 5DEQA 2VUMJ 2E19A 2EINH 2A07F 1WSUA 1GDTA 2DOAA 3KLNA 3ABLH 5HOOA 2IA1A 1KU7A 2PX9A 2OTLI 2X0LA 2B7EA 4EMSA 3RQIA 2WV0A 3BP8A 2EZKA 2LF7A 2FQ3A 3PQKA 2XB0X 1X4PA 2JSPA 1K4TA 1JJ6C 3GTQJ 5CYVA 2HFHA 5DD8A 3GXOA 2O61A 4DZJA 4YG2F 2ADUA 3K9TA 3CDHA 2P7CB 4BL0B 3ZMUA 1RI7A 3SZPA 2XPWA 2R3SA 3S3OA 5ILSA 4HV5A 3COAC 1QZYA 3F23A 1TWFJ 3I53A 2IGOA 2GIZA 4KIGA 1P4XA 2BEOA 4ZC3A 1G3YA 4F93B 3BR6A 1IDZA 2STTA 3J7AY 3HUGB 4G7OF 3OSFA 2NVUB 2BXYA 1X58A 1YJWI 4A3CJ 1QHGA 3QOEA 3E6CC 2EH3A 4IO9F 1LDKB 3NAUA 5CJ9A 1SEUA 3G1MA 2QQ8A 1WPKA 3HSEA 2ICWG 1YQAA 1F36A 1HC8A 1IRGA 4XRSA 2Y2ZA 3JAMZ 3VWBA 4LD5A 3S8PA 3VODA 4N4NB 1OR7A 3HBLA 4I6ZA 3HDDA 4IRIA 2HGCA 4M3FA 2V1NA 2XAQA 1XC5A 3BG6A 3BOQA 2LRDA 4ZJZA 5E8GA 4FETA 2HDDA 2L54A 2NXNB 1E0EA 3DBLB 2K4BA 3FXKA 1SANA 4MHGA 5F1JA 2VJ5A 5D5VB 2M3AA 1ZAOA 2N8GA 4A6DA 4RA2A 5FKOA 4B3XA 4D5FA 5K5OA 4HNUA 1ZQ3P 4HDVA 1H9TA 4ZYDA 2JPCA 4AUXA 1IRFA 2V9VA 2HOTA 2B9SA 5GPAA 1P4AA 4PJMA 2L4AA 5HLTA 1XMKA 3C2GA 4AD9A 3OY9A 1YHQI 4I01A 1G3TA 4XLPF 4IHXA 1DP7P 4IEJA 1RKWA 2ME0A 4E7ZA 2F5CA 1YFHA 1FJLA 3QPHA 1U6GA 1YTYA 3FHZA 4BGDA 2IS6A 1R58A 2M9HA 5BMZA 4L0YB 2QYOA 1P92A 3ZQQA 2ZMEB 4OMZA 4NC6A 4F92B 2R7DA 2XRNA 2ECCA 5JFRA 2UUZA 4GYGA 3WU2C 4TV7A 2FD5A 3I71A 4KNYA 1DDNA 5EJCA 2E1CA 4I02A 2EPFA 4JOMA 3KPHA 1MH3A 4L9TA 2DJNA 2H1KA 3TGNA 2MGQA 2ZXIA 5EF6A 2UXXA 5FRNA 4LGWA 4UVBA 1IUFA 3FMSA 1X2NA 4BXUA 2H94A 1HXDA 5FB2A 1APLC 2F5FA 3B6CA 3HM5A 1OCTC 3R4KA 3ZQGA 3MCZA 3C3WA 3K4LA 4XLCA 1BOBA 3T0YA 3CCVI 4E7HA 2K9QA 3S1NJ 1BM9A 2RAEA 3L2VA 2RKHA 2IS2A 2GM4A 3ZMDA 3EYIA 3DCFA 2NNNA 2KL4A 5K5QA 4BH9A 4XIDA 1X1CA 3O3KA 3GFIA 2Z3YA 4P1WA 4E7KA 1S72I 5D5UB 3C2HA 3FKIJ 3TP0A 1MIJA 2XUBA 3MZYA 3EUHC 4C2UA 4A5NA 1W7PD 2R5ZA 3RJPA 1NH3A 5EZGA 5KCMA 3EUKL 4QTRA 3VFZA 3J81Z 1NG7A 1S29A 1RESA 3K4NA 1HQCA 3EDPA 2LREA 3BTLA 3AAFA 3CJTB 5IP6A 5JI6A 3CCUI 3VPRA 3BJAA 4A0YA 5LGTA 4M71A 5DM7F 1LPQA 4UY8I 5J4VA 2WWYA 5E17F 4IQJA 3L2RA 3LMMA 5FGMA 1TNTA 1R1UA 1P4WA 4XOPA 4IOCF 2RREA 3CUOA 3WTVC 1IRXA 1X2MA 1J75A 3L00A 3LAPA 3P7NA 3FK7A 1SVMA 1Z7UA 5HVQC 2ID6A 2NS8A 3WTWC 1MSEC 4I99C 5DCMB 4BY7J 4ESFA 4IQ4A 3K2AA 4JBAA 1F5TA 3RZOJ 3J80K 4WCGA 1K83J 5HS7A 1Z0XA 5F08A 2IJLA 3F8NA 2OCCH 4CDGA 1WKMA 2KIMA 1I5ZA 2KPMA 4XKBA 1M1EB 2IVMA 2FEZA 3FF5A 3ZN0A 2L9SA 2EV5A 2O03A 3BT9A 3T1BA 1TT0A 1AWCA 1R36A 3PUBA 3F8CA 2K7LA 2ZC2A 3DEEA 3DTIA 4ZDLA 5D5XB 3CMYA 4A3BJ 1K61A 2IS1A 2VQHA 2AXLA 1OLTA 5BS6A 2Y69H 1S9HA 2PEXA 3U1DA 5FKLA 4XSXF 1IXSB 5M5XJ 2EZLA 4C3IJ 3P9KA 3UR3C 2FMLA 1GV5A 3W6JB 3KP5A 1XS9A 3L7WA 4UXNA 2DCEA 3FXMA 1U9NA 3KZYA 5LBQA 5C44J 3FBNB 4CYCA 1GXPA 2LY9A 4OAZA 3PO2J 1MBKA 3QP5A 1A6QA 4NC7A 4L9NA 1HOMA 2XSDC 2R7WA 2BVMA 2KDZA 4KIBA 1N78A 4IRGA 5CVRA 2MW8A 4BXFA 3M8JA 2CFXA 2WAEA 2K9MA 4R79A 1R7JA 2R7QA 4G6TB 3ROUA 2FNPA 3BC8A 5FO5A 1FBSA 3I4PA 4UV9A 4WXCA 4XLEA 5TJJA 2TDXA 2NS0A 3D5LA 2L9VA 3QODA 4XLFA 3A4CA 5E20A 4OOIA 2P8TA 1FY7A 4YFXF 3OYHA 4BJTA 1WJ5A 3BLYA 2ZCWA 4WX9A 1ZRFA 4XLNF 2H8RA 5IYDJ 1I1SA 3H35A 1BI3A 5F6FA 2LVSA 2BY3A 2M4GA 1TWCJ 1SD5A 2YUSA 2QUFA 4MLOA 5F64A 3GVAA 3M4OJ 3W2AA 1RUNA 1J9IA 3JREA 4IHYA 3GTPJ 3ZP5A 2QZ8A 3U21A 3FBIB 2HVQA 3HOWJ 3H9GA 5E3NA 2P0WA 4FX4A 1WI9A 4C3JJ 2ZNZA 2JJ7A 1ETXA 1VQ6I 1R1TA 1GVJA 1YLFA 3DLLF 3S3MA 5IPAA 4XNFA 1T98A 4R8HA 4ASNA 2XV4S 2A5WA 2M7AA 4WF2A 1VQMI 2P4WA 1IN8A 1TNSA 2VJIA 1IF1A 5D6EA 3KLOA 4XRSG 3LSMA 4LK0F 1HBXG 3WTUC 4GDFA 3R6SA 3GTKJ 2ZXWH 4I09A 4ZYEA 3S15J 2XAHA 5FLMJ 2DA3A 3IWFA 1W5SA 4U88A 1U5TB 3M3YJ 1TP4A 2IGKA 3OYAA 4LB5A 3D0SA 3KP3A 3FISA 3HIFA 2Z1DA 2PMHA 2EWNA 4FTHA 3OYFA 1GHCA 1ETOA 3DXJF 2K5CA 1SAXA 5E3OA 1IDYA 2A6TA 1JUMA 2HNHA 3DEUA 2CQNA 5CKTA 3M1CA 1A6IA 2K4JA 4D7MA 5K1YA 5HS8A 3SDGA 2ZXHA 1A36A 5CVIA 3AFHA 5D8KB 1MKMA 1DGRM 4J00A 3QU3A 4FX0A 2HPMA 3TMOA 1L0OC 3LWFA 2ZMEC 3R60A 2DODA 2F4OB 1QZZA 4AU7A 1I1GA 4RM3A 4M6VA 4L9JA 2STWA 1JHHA 5ERIA 1D1AA 1F1ZA 2R0QC 2Y9ZA 1O7FA 2COMA 1A04A 2L0KA 3FK6A 3VYRB 4MNUA 2LBFA 1YYVA 3ZR8X 2FXAA 3F8FA 5EG0A 4QPQA 3F21A 4M3DA 2IP2A 1R4NB 2P7VB 3K4KA 1U0JA 4II3A 3WU0A 2DYRH 2QVOA 1MGTA 2KRCA 3M9AA 4PFPA 2M5WA 3KYLA 1U8RA 4MQVA 1BI0A 1B9MA 2QBYB 3FMQA 3G3ZA 3RI4A 1BIAA 4DYRA 1Y8RB 5F04A 3L2UA 3C2BA 5EYRA 1AKHB 4MO7A 5HLHA 1PP8F 4XK4A 2AQFA 2F4MB 2XGDA 4NB5A 5LLQA 4KIFA 2O8XA 3SZTA 4OMYA 3V8LA 4Y33A 1WHUA 1QHHD 4FE7A 1E3OC 4BS9A 1MMSA 1MNEA 3S1RJ 4C9YA 6PAXA 2XPUA 2PJRA 2QWWA 4A6EA 2FMYA 3DLAA 2L9NA 2XAJA 1IZ1A 2A6HF 2HYFA 2OPTA 1I50J 3O2PE 3DF8A 1UZCA 4W1UA 3IH3A 3PM1A 1WWXA 1ZG3A 4V2GA 1XCBA 2EFOA 2M1BA 2F6CA 1T38A 1YRNA 2Q2EB 4ON0A 4O6JA 3JTGA 2CRGA 2QQAA 1DQUA 4R1HA 5B1BH 4RAZA 3I56I 2MLGA 4AYBN 2JSCA 1QQIA 2RDPA 1WJEA 2YR2A 3GBGA 1IN7A 5DYMA 1ZGWA 3I4NJ 1X1BA 2G9WA 1MBEA 2NOGA 3CUQA 3ZRGA 3CCMI 3E5UA 4NHJA 2FUG2 5DS9A 4LMYA 5J40A 1VQ4I 1Z6TA 5BPIA 3HG9A 3K7AJ 4Y13A 3OV8A 4P96A 3REOA 1C0WA 1Y56A 1YW9A 2LTPA 1HKTA 2P5VA 5E79C 1D0YA 4U7BA 4C2MJ 3OYLA 2K85A 3QAHA 3RPUA 1ZG1A 1ON2A 1ERDA 2HR3A 2KJCA 4LITA 2JA5J 3QYFA 4ENMA 5KAFC 3CCQI 1RZ4A 2P81A 1PJRA 2Z2SB 3G1LA 3O8HA 3CLOA 4IL6C 1U8BA 2YU9J 5IT9Z 3J7YJ 3TP3A 4I98B 1EA3A 1N25A 2NRAC 2HTJA 1SD4A 3K70C 2ZSHB 3OWTA 3HSFA 3E3VA 1USTA 4Q47A 2KFDA 3HEFA 5IOYA 3SYTA 2VOOA 1TWAJ 1VZ0A 2L7ZA 3M8FA 4YELA 4CH7A 2V1UA 3P9IA 4M3BA 5HLIA 2ZXJA 3AG2H 1IV8A 2HYJA 2LR8A 4ENKA 2H27A 2XF6A 4DYCA 5EGOA 2ID3A 2E35A 2O3FA 5GTIC 3QRFF 1HW2A 2VASA 2O0YA 2YU3A 1P9QC 3OYBA 1D5YA 1FOYA 3EPZA 2E7XA 2DA6A 4UNOA 1G3WA 2K86A 4BDZA 4D7NA 4KISA 2R93J 4XN0A 3Q9VA 2AHQA 3DWLE 5B1AH 1QNTA 3V7SA 1YIJI 1B72A 1D0XA 3BR5A 3GTJJ 3ML6A 1XX5A 2YX7A 3V8KA 4PUSA 4JX5A 1Z3YA 2NVYJ 4MTEA 1YITI 3ZQIA 5CVUA 2BZTA 2IEKA 4ZZLA 4BUPA 3HKZN 4PJ0C 5HDNA 4RDUA 2BOLA 2HXIA 3A01A 1KYWA 3IL2A 3FX3A 4A3FJ 1IN5A 2QGUA 1ZRDA 2DQLA 1ZYRF 3A03A 3I58A 1ZKGA 4EM1A 1ZTRA 4XOTA 2BY1A 1DU0A 2RN7A 1E3HA 4XICA 3I0TA 4PSWA 4ENJA 2DFIA 2IA0A 3SHFA 4O3MA 4HAMA 2ELHA 1MMAA 3ISPA 4II2A 3GF2A 4P55A 3SJMA 2AS5F 2DFFA 1I6HJ 1P6RA 1JXSA 1ZG5A 3H0GJ 3OR2C 4GCVA 2DA4A 2JN6A 2WB1A 2XF5A 4PZJA 3J7ZI 2CS3A 1J2XA 2NAZA 1IG7A 4M6YA 3L1PA 1P7JA 1WH7A 4HW0A 1WFXA 4OIQF 5FLXZ 2KIQA 4V2FA 1V3FA 2OA4A 3CP8A 3RPUD 4IVNA 2Z9OA 2EV0A 4M9SA 4OIOF 3S1MJ 1IO2A 4QLCU 4UUTA 2BW3A 1Z05A 4CCNA 4U87A 4Y17A 1FMVA 2HKOA 2W7NA 5H6QA 9ANTA 1R5ID 4WWCA 1JKPC 1ZLKA 2QQBA 4RB2C 3KEQA 5GPCA 3OYEA 1ZELA 1IJWC 1ETQA 4B09A 5AIPA 3LSJA 4XR6A 3E6DA 3Q3SA 2W48A 3QU6A 1YS7A 1WJCA 1FTTA 4QIWN 1UAAA 2G0EA 1U5TC 4Q5SF 3BQYA 5ED4A 2M4KA 4XL9A 5LEKA 2X9DA 2F5EA 2XRLA 2HKXA 1RNLA 3ZMZA 1LDDA 2K40A 3MKWB 4ZYHA 5LHIA 4M3GA 2E1NA 2BE5F 2ESHA 4AM3A 1BR1A 2CJJA 1U2WA 2VBXA 3DKYA 3K2ZA 4DBQA 2ACJA 3B6AA 1WGXA 1GLNA 2QF7A 1SMTA 1YX3A 3PSIA 1PYVA 2K9SA 2DK5A 2EILH 4BY1J 4GXOA 2WB1N 2X6WA 4FE4A 1OCPA 1DU6A 3HGGA 4H0EA 2VIXA 4G94A 3BWGA 5EDNA 3TQNA 1LEBA 3S14J 3GO5A 3HTUA 3R0JA 1R00A 1T2KA 2A6EF 3GLLA 3KIOA 1E17A 2QA4I 2CQXA 2R7FA 2Y31A 5KK1A 2DLLA 1YO5C 1DP3A 3GZ5A 2A61A 3JRAA 3I55I 3CD6I 2DK8A 3RKYA 2FOWA 3OYKA 3C1DA 3CF2A 1EH7A 3EUHA 3J81K 2X6OA 1WJFA 1B1BA 4ETSA 5TISC 1F43A 3RKXA 4AVPA 2ISZA 3F72A 2M34A 2VT2A 3WODF 1T0FC 2M0MA 3R61A 3L2CA 1BR4A 4EEFG 4N9IA 5H2FC 2P5KA 1ITYA 3HSRA 2L3DA 2WAFA 3QYEA 3CF5F 4B8XA 3F8BA 1ZREA 2DMUA 5FJ8J 1ZN2A 5HDKA 4RGSA 1BR2A 4BXXJ 1CF7B 1TC3C 2VPLA 1FIAA 2OV7A 1PUEE 5K7ZA 4MEYF 2OC6A 2J5OA 1FC3A 3FKJA 1W7PA 2M8GX 2DT7B 3RKWA 2A3SA 1E3PA 5LRRA 2DMQA 1YIOA 2LY1A 4Q48A 4S04A 5FD5A 3JCUC 1S7OA 1XGMA 3OYJA 2FQ4A 2HPIA 1B8IA 1KYZA 2JA2A 1G2HA 3NEUA 4RGUA 3KYDB 1UJ8A 3GTMJ 5ICCA 2BGCA 2IT0A 3F6OA 1REPC 1QBJA 2MYSA 2R4GA 2KP6A 5TGTA 2CUFA 2G7HA 1MDMA 2ZNYA 4LG0A 3HOVJ 2IW5A 3IH4A 2X1EA 2D1HA 2OCEA 3A2KA 1MMGA 1NTCA 3LSRA 2EV6A 3CC4I 1K6YA 4XM3A 3QYBA 2R7OA 4RB0A 1YW8A 3BTCA 4DOZA 1BBYA 1FYKA 1AHDP 5D4SA 4D0PA 1ZLJA 5L3BA 5FKNA 1IRZA 4HX8A 2EQRA 2EA4A 3JW4A 2H09A 5K7HA 3S2DJ 2CMPA 4NBQA 3DTKA 3T8RA 2UV1A 4AWXB 4RAYA 3I4MJ 2R7RA 4U0WA 2OAZA 2FOKA 2ZKZA 3A0HC 1J5YA 2WV1A 2JMWA 2QKMB 3AG4H 3GCMA 4KMUX 2HQRA 3I5UA 5KNLA 3QPTA 1WH5A 2KJBA 2V1XA 2HS5A 5J8CA 2CW8A 3GW2A 1FOWA 1ETWA 3IAS2 3TL4X 2GXGA 4B43A 3W2WA 4F3QA 3DV8A 1O3SA 2M8EA 3CMEI 3OOUA 4LFUA 4RS8A 4G6QA 4RMNA 4RBOA 1UHMA 1Z9CA 1Y1WJ 2D2WA 1YG2A 2BY2A 5DDGA 3RYPA 2B63J 2CW0F 1JKRC 2E1MC 4LIUA 4A5MA 1W36C 3OS2A 4DBRA 1JT6A 4UUSB 1NG6A 1OMIA 1D1CA 2Z33A 5KVRA 2ME6A 4I76A 1A35A 2D1VA 3WTXC 2LH9A 2JUCA 1YI2I 2QLZA 3PSFA 5CQGA 4BKXA 3NWTA 3OL4A 2K9LA 5LFAA 1OYIA 2PFBA 1S5LC 3LSGA 2DU9A 3WGIA 5GTHC 1T6SA 4O5VA 1I3AA 5JVTA 4BQAA 2JUGA 1DUXC 4CZZA 4IJAA 2QCOA 1K78B 1RPWA 1KQ8A 3HPHA 2DFHA 3HGYA 1MNDA 3HUGA 5HDGA 2FU4A 1LE8B 3BR3A 2ESNA 1T95A 2EIMH 4G9YA 2HWVA 3HRUA 3DFGA 2JWTA 5F0FA 3A0BC 4LK1F 5AIQA 2DQRA 3WTYC 2VXDA 2EZIA 1XG1A 1EH6A 2Q1ZB 2E34A 2HVRA 4XSZF 3ULQB 4LG3A 3MEXA 1BC8C 1LB2A 1LNWA 3HRTA 4IKFA 1YX5A 1XD7A 2NS7A 4UVAA 3ZMTA 1ZHFA 4DW6A 1FNNA 4BACA 2WY8Q 3FZVA 2FE3A 1V4RA 4P5OA 2LG4A 1IGNA 2DN0A 4ZZDA 3HHGA 2JRMA 2DA1A 1WVRA 4P9UA 2TRTA 5EEAA 4KA4A 5J1YA 3TW6A 1KQ9A 1O3QA 5DUIA 1Y0NA 1XN7A 1HSJA 3HHHA 3KETA 5D5WB 5FFZA 3V8JA 2HI3A 4PGGA 4F91B 4XKCA 2I10A 5M3MJ 1WZ2A 3I59B 2E71A 1VQPI 4HF2A 2FA5A 1OYYA 2CQQA 3CCYA 4BAYA 4KUMA 2ZMEA 1KA8A 2VN2A 3BZ6A 4QSHA 4ESBA 3FWEA 4IF4A 4E7JA 5IOZA 5CVJA 4A69C 2R5YB 1ZH5A 4NQWA 3HTSB 2V1DA 1ETVA 3DU5A 1I39A 3JRGA 5H20A 1B9NA 3GEZA 5EZHA 1XB4A 1MJ9A 4IXAA 4PK4A 3G71I 4LIVA 2VKVA 2R92J 1YJNI 4U0YA 1PP7U 2MA3A 3AG1H 2DO7A 4MFEA 3IP4B 5ILUA 3BR1A 2LD5A 2VT3A 1R23A 3FXQA 3IV5A 3VB2A 3L2QA 1SD7A 3CJNA 1XMXA 2GOMA 3PNYA 2KRFA 4DIQA 3ZCOA 3JRCA 4BBRJ 3GFLA 4EV0A 1MMDA 1BJAA 1R4MB 2ETHA 2LDUA 3CCSI 2M7BA 3RPQA 1O4XA 3QWLA 4AIDA 4EJTA 3HOYJ 4KYWA 2RNJA 1IUYA 3MFKA 1YE9A 2LLKA 3MD2A 3OSGA 5C4XJ 2OD5A 4YIIA 3DP7A 4I7HA 2Q8KA 3WTZA 3KP7A 4MFDA 4EM2A 3KYCB 1HLVA 4LB6B 2Y30A 1D8JA 4XONA 4EJOA 4E6KG 5DTDA 4YRVA 3QQAA 3HOSA 3G1OA 3S32A 2MSYA 4A0ZA 4D5CA 3GWZA 4IX7A 4CUGA 1PUFB 1YRNB 1QRYA 3RYRA 2IGMA 5LGUA 5DUKA 2ZB9A 3GTOJ 3I9V2 2X85A 3F8MA 5E3LA 2CV2A 1FP2A 1Z6RA 4QWQA 2KHMA 1HCRA 1WCMJ 2ZJRF 3PNTA 2EB7A 3X2QH 3WHCA 1SMYF 3PFIA 5GADJ 3CMMA 4HF1A 3HZJA 5DCMA 1J59A 2W24A 2E1OA 4PJJA 5CLSA 4HF0A 2X1DA 2YS9A 4CCJA 2D5VA 3I64A 2OUMA 3GYHX 2RNGA 2A69F 3SXYA 2HOAA 1F4KA 3JSOA 3SFZA 3WG7H 1FTZA 3BTIA 2VONA 1XSDA 4UB8C 4ENNA 3JRHA 3GTGJ 4RGXA 5IT9K 1LEAA 3HRMA 1WQ2A 3Q0WA 4X0GA 2O7OA 4BYYA 2MH2A 1B59A 1USSA 1HDDC 1HKSA 2NNYA 1BA5A 1VF9A 4A3IJ 1O3TA 1QO0D 4L5IA 4HPQA 1XGOA 2HQ5A 4OAYA 1BI2A 3RDIA 3CJRB 2EFPA 2F48A 1IC8A 3KEOA 4A3LJ 4AYBA 3VYSB 2CV1A 2E7WA 5DD4A 1AA7A 4XKVA 3G4SI 4A3DJ 1MJBA 1Z67A 2MG4A 1JTYA 1NHAA 2RQPA 1S7AA 3RKQA 2PI0A 4NC8A 1VQLI 4I0AA 2KIUA 4CCKA 2Y75A 2IBDA 1WJDA 2MC4A 3K4JA 3CO7C 3HOUJ 2ZSIB 5D8LB 3AKZA 1MBHA 2RV8A 4EVIA 3QPLA 2J5PA 1LJ9A 2CG4A 5C3EJ 2X6YA 3E0JB 4HQMA 2HOSA 1X19A 2K9NA 1YS6A 1TLHB 5GAHJ 5BPDA 1D5VA 2F5VA 2FBKA 1LVAA 4Y4RA 4ZTJA 4KDPA 2GQQA 3HYIA 3ZQLA 2EBIA 3W6KB 3ABKH 2WA0A 1OCRH 1FYMA 3HC7A 2DOFA 1FZPB 3K4MA 1JGGA 2VL8A 2VJJA 2GLOA 5IP9J 5DV5A 3SEZA 2DT6A 1SFUA 2EFNA 4UUVA 2R7XA 2Y0SA 3P9CA 2OQRA 2KRHA 3V7CA 4YFNF 1JUPA 5L3EA 1WRJA 4RM2A 4FT8A 2JA7J 2M30A 1KGSA 2JTVA 5FLXK 4HZFA 1ODDA 1TQMA 3DKWA 2CUJA 5JHUA 5KHDA 2NVXJ 3CC2I 4AIJA 1GVDA 1R5GA 4D1QA 3BCBA 3O6BB 3NWSA 1P2FA 2EIKH 4F7ZA 4KMFA 2EIJH 2DXIA 2OZ6A 4HV6A 4CCMA 5IT3A 4LLNA 1F9NA 4KITB 4M72A 1G4DA 4IHVA 3A1YA 3K70D 1D8KA 2VXZA 4HOBA 5ICEA 1PVEA 2O8KA 4FASD 3U9GA 4I2OA 3HOXJ 1Z77A 1SAUA 3MKYB 1U5TA 5M5YJ 2DFEA 2VB6A 3HKZA 1BC7C 3VEPA 5HLGA 2P5LC 1ZGJA 2IS4A 1OJLA 1OFCX 1EJ9A 1JKQC 2OZUA 2KZVA 1D3YA 4MTDA 3HXLA 1V54H 2Y0SN 3RIRA 4CHUA 4X1EA 5IP7J 2KISA 2DMNA 3CDIA 4E4HA 1V5EA 2PMZA 1BJZA 3BDDA 3MN2A 1R71A 3FXLA 2GA2A 4CCOA 4Z6YA 3DPUA 2BYVE 1UFMA 1TWGJ 2ECBA 5BOXA 5B5EC 3ABTA 2DAOA 2DA7A 1YW7A 3BROA 2AO9A 1T39A 3PNVA 2GWRA 4BDYA 2X48A 3K1NA 2W00A 2EFQA 3DEWA 2Z5UA 4HLXA 2NVQJ 3S93A 3V42A 3D5RC 1P7IA 1S8NA 4KN4X 2ISYA 2OU2A 5F27A 4IOAF 1W1WE 2V6EA 2CFOA 2YX4A 1IXRC 2ZJQF 2WBMA 2CYYA 5K5RA 4DJAA 2GXAA 1FOXA 4DZPA 4HNTA 4CXFA 5L3GA 5FD6A 4LLGF 3FM3A 1BW5A 2XSJC 1T0FA 1H89C 3OYCA 4HX7A 5J1RA 4FISA 3S2WA 2QBYA 1GV2A 1ONVA 5DM6F 1GXQA 1AKHA 2VJ4A 4HSTA 3GZ6A 1W5TA 1QGPA 4IHWA 3DQVC 3N97A 4CSWA 4B1RA 1XSVA 5ICGA 3A02A 2VBWA 2V7FA 3W2VA 3F9KA 5H6RA 4BEHA 3WTTC 1Z3XA 1ETYA 4PJNA 2PMZN 1A5JA 1EF4A 4ANJA 1UG0A 2XAGA 4KT6A 2RVCA 1FMWA 3BG3A 3VSLA 1B8IB 2LYCA 4BQNA 4W97A 3F0CA 4AIHA 1HA8A 3OL3A 2B0LA 4EJUA 2JA6J 4XRMA 2GIVA 2JZYA 3RCOA 2Q2EA 3FM5A 2DA5A 3BG5A 4G7ZF 2XAUA 4ZYAA 1GUUA 2MD0A 3DBRB 2L5QA 3H5RA 1JGSA 1Y1VJ 2QSFX 3FMRA 3TO7A 2KZGA 3PIPF 2LK2A 3OYGA 3SFIA 1G3SA 1ZGAA 1AU7A 2VKHA 2IXSA 4M6XA 2R7VA 1TBXA 1XDUA 5FROA 3MZHA 3OYDA 4MGRA 3LQRA 4A12A 3IAM2 5A2QZ 2V26A 2IA2A 2W84A 2MC3A 4HEA2 3OS0A 4KN7X 2DOEA 4P9FA 2WAQN 3IH2A 3E5QA 2WADA 3R0AA 1BW6A 2NYXA 2V9KA 3CTAA 3FXJA 1TT5B 3HL2A 3IHUA 1VFCA 3JSPA 1FPQA 1OISA 4BJ6C 5LRSA 3C18A 3TEDA 3K4CA 4M9XA 4GGGA 4Y7NJ 1RETA 1RUOA 1R49A 4EJVA 1JJ8C 1BOAA 1X1PA 2LFBA 3VOEA 1QPIA 2XVCA 1SFKA 2XPVA 3GUDA 3LSHA 2OF7A 2Q0OA 3UNGC 2X51A 1UHWA 2QKLB 3VDXA 2BHZA 1WI3A 3TOAA 4M73A 3LSKA 1JE8A 4I0BA 2XGCA 4GRIA 4Y52J 4FQGA 3Q5FA 2KIFA 4IHSA 4XKWA 1V5FA 2R5ZB 5J47A 1UCRA 2Y48A 1WJAA 3G73A 1K6OA 1BL0A 4NDLA 5GP9A 2CUEA 3CZ6A 4XMYA 2R7SA 1SC7A 2M2EA 1IV6A 4L0ZB 3K4BA 1ULYA 2G7UA 3CCLI 4EGZA 4A3EJ 1EH8A 1VQNI 5BQTA 2OQGA 3H9QA 1VQ8I 4BU2A 1TWHJ 1Z21A 2IPQX 2KDOA 1TZLA 3OS1A 5B66C 1UB9A 2YSRA 3E1SA 5ILVA 1R1VA 2VQLA 1HF0A 2VBYA 4S0HB 1G8XA 2L02A 3F3XA 2CU7A 2W82A 3LA3A 4JX6A 3OYMA 1V55H 1VNDA 3LOCA 3VYUB 3QPSA 2FJ1A 3KP6A 4L9VA 3CCEI 3RZDJ 3CCJI 3S16J 2LY2A 4CICA 3DKXA 3OIQA 3G2BA 3MZ8A 3TBIA 1FOKA 1Y8QB 3TO9A 3GX4X 2VKEA 4Y3OA 5L3FA 1LKXA 1OQYA 3MKLA 1O7LA 4N4OB 4FHTA 3ZQFA 4WK8F 2UZKA 5L3DA 3HPGA 4A3JJ 3MWMA 4A3GJ 1OKRA 3KEYA 1VQ9I 3LA7A 3TO6A 1FBQA 5F1RA 4C2TA 1SFXA 1UHSA 2DW4A 3E6MA 3Q9SA 3CESA 1U9OA 5BNGA 2HQNA 2Y0MA 4HX4A 2GA1A 1KQ0A 3H1CA 3H3ZA 5LHHA 4EATA 4HSRA 1HDPA 2EJRA 1HKQA 1XGNA 3VSKA 3LSTA 4CGZA 2VE8A 3IRQA 4RAFA 4OIPF 2L7KA 3ABUA 3GFMA 4OIRF 2XB5A 4E70A 4UHTA 4ZDPA 4CYCB 4HBLA 4ESJA 2JRTA 2V6CA 3SQNA 3HRSA 1S6LA 1ZR4A 4A3KJ 3CQZJ 3WGGA 4IPAA 1W36D 3M07A 2EZHA 2W57A 2JA8J 1MBFA 3OIOA 2M0CA 3ZMVA 2JT1A 2P6SA 5CVVA 1RRJA 4NQWB 3JR9A 1UELB 1Q1HA 1X1DA 2H6BA 3BPXA 2Z16A 4G6DA 4NNJA 4Z2YA 3WHBA 1J0RA 3ZXSA 3NARA 1O57A 5HNHA 1XCVA 2XDVA 2GBYA 2IAIA 3NRVA 2QQ9A 1FWZA 4YIRX 5F0HA 1SVOA 3RTRA 3IRRA 1XTAA 4HDUA 3E7LA 2W4SA 4B4CA 5LEJA 4Q4ZF 1W0TA 4PDKA 3CCRI 2DPUA 2L2OA 2HYGD 3MQ0A 4ABZA 2GZWA 5JVGF 2E2HJ 3E5XA 1E2XA 3CJQB 3ZGKA 1QZEA 1LFUP 4E7SA 1IAWA 2ZFWA 4YFKF 1FIPA 3DPTA 4BE1A 2V9PA 1UG2A 2QSGX 5E1ZB 2OBPA 2JPBA 2QEXI 3ZQ7A 1N75A 4WXDA 2EK5A 2FF4A 4KT5C 2ZO4A 4S05A 1I3QJ 4L5JA 3FHNA 4X6AJ 5E8IA 2R7TA 4XLAA 1H88C 1MMNA 1FEXA 2MH9A 3HOTA 5CPRB 5JLWA 1CF7A 2P6TA 3ASOH 1I6XA 2K3FA 3M8EA 1OR7C 2LKPA 2WC2A 3O8GA 3UKGA 4IRHA 2LKSA 1FLIA 2F4IA 2F5DA 3G6EI 1UMQA 3JRIA 4BQQA 4G12A 4B44A 1H8AC 1R22A 1T8IA 3ASNH 3IKVA 2DTZA 4XORA 1OCZH 2C6YA 2LOOA 5F0CA 4J19A 1IW7F 2DDAA 2YPRA 2WTEA 3KZZA 3LAJA 1J09A 3MKZA 4ZTFA 4NUBA 1N77A 2DMTA 3QOPA 1LUJB 3TW7A 2MFZA 2PBIA 4XN3A 5FKKA 4DNCA 3ERMA 2FSWA 3DU6A 3H0DA 2MLKA 3P5JA 4JX4A 4CO8A 4XLHA 5IYCJ 2UWMA 5K7FA 2Y9YA 2ZJPF 2H8WA 5GAGJ 3PFYA 1D1BA 2RQQA 3PQJA 2UXNA 3LSPA 2HEOA 3H36A 3ZOBA 2JVGA 3BR0A 2W85A 4E7IA 3B73A 3CLQA 3N05A 1O3RA 2XHKA 3KP4A 4GO1A 2TCTA 4BQOA 1IN6A 3H5NA 5J3LA 3H5AA 4CA0A 5HODA 3ONQA 4DGWB 4DYQA 3CO6C 2LBFB 3FXOA 3TKYA 2KT0A 1KU9A 2JK3A 2HQAA 3WE3A 5EG0B 3K1PA 4A93J 3VYTB 4G8XA 2KKOA 1GT0C 3CMAI 3DBHB 1MH4A 5ICFA 1EV7A 1HW5A 2H6CA 3CP2A 3ECHA 3FXUA 4HNVA 1IXCA 1JUSA 2PQ8A 2K02A 3C7JA 3K6GA 4RLQA 3L2WA 4BE0A 2D45A 3AG3H 2L7FP 3AL0B 4HA8A 4BHCA 4UVCA 2LC2A 1R5HA 3PUFA 1R9TJ 2VLAA 4MIMA 3S2HJ 3M1EA 3ESWB 4HG2A 4Y15A 4PJLA 1T08B 2CH0A 2CO5A 2KQRA 2HXOA 5FLVA 3GTLJ 1VI0A 4AIKA 1RIOH 3MAJA 3L09A 2DA2A 5D4RA 2VI6A 1NK2P 4CYDA 1D0ZA 2DMPA 5B3SH 4UUSA 2PJRB 2L4MA 3H9JA 5JR3A 4BBSJ 3JRDA 4D9JA 3PJRA 1XGSA 2AXTC 2E60A 2VBZA 1X1AA 2ZFUA 2MD5A 5CQEA 5J1UA 1FYLA 1B6AA 1R6RA 2FBIA 3TDZC 4ZDOA 4U7DA 2MBFA 3H3UA 1TW3A 4U0VA 3B02A 2R7ZJ 2VOPA 1SVLA 2GAUA 5FKMA 1Y39A 3PIOF 1K78A 2ZJ2A 1B4AA 2LKXA 1SD6A 4M9ZA 1VQOI 2L7MP 3KCCA 3SEQA 2HTSA 1LE8A 2E2JJ 1J7KA 1G59A 3CUQB 3T5XA 5J6XA 2L9RA 1TL8A 2K3PA 2I5UA 4XBFA 3PL8A 1W0UA 5DCFA 2DBBA 4C3HJ 2HOEA 2LMDA 3TOBA 3FXRA 3HB9A 1Q1VA 1CQTA 1X3UA 2VKDA 2O6GE 5C4JJ 1ZARA 2DJIA 4JP0A 4KFCA 3EETA 1QPMA 3J80Z 1AOYA 2HVSA 3ZMSA 1MD0A 3ZN1A 4HQEA 3WG9A 3LA2A 2VE9A 4JQFA 1VQ5I 2ELKA 3FIWA 4YEJA 4BNCA 1XSXA 4EGYA 2VC0A 4EQQA 1H9GA 3IKTA 1MSFC 3OIPA 4C30A 2XROA 3ABMH 1SFOJ 4OINF 2EFWA 4GFBA 1QVTA 5GAEJ 2JQ7A 3HOZJ 1FX7A 3IUOA 2BV6A 1VTNC 3ERED 3ZPLA 3K69A 4RGRA 2V79A 2WY7Q 2A5YB 3RSNA 1H0MA 5E3MA 1T56A 2XF7A 3GZNB 3CDLA 3I59A 1ZR2A 5TRDA 3BTJA 4ZH4F 2DTRA 4F52A 2ZBKA 3GLXA 1LFBA 4MEXF 2A05A 2BY0A 2QM3A 3RQ4A 3W6VA 5J4YA 5EGOB 1U78A 1Z1DA 5FRMA 2W25A 2X4HA 2XGXA 2VQCA 3OYIA 4HLYA 5LD2C 5HNFA 1OYWA 2FRHA 4BE2A 2R5YA 3Q0VA 5EEGA 4L5EA 3ZQCA 1K7AA 1MJAA 3D5SC 4JK1X 3J7AO 1RKTA 4HYEA 4IHTA 3OMYA 4FCYA 3E6BA 3BJ6A 2KLOA 2QSHX 1B72B 1ACIA 1HW1A 3I54A 4A3MJ 1YOVB 1XDSA 1RC9A 4GYIA 3T8TA 2PJPA 2CSOA 3MMYB 1LQ1A 4M74A 4AVZA 2E5NA 3A01B 2FNAA 4MQ9F 5FFXA 4F55A 2VODA 3OYNA 1RR7A 2DPDA 4CCLA 3LSIA 3LNQA 2NOJB 4AC0A 1W5CC 2I8DA 3K10A 1FT9A 2X6XA 3LFKA 4LLLA 4BEHB 3EUAA 1LFPA 1DPRA 2PMUA 3GMEA 2IRFG 5J8FA 5AONA 2QENA 3KP2A 3L9FA 4ITVA 2CUZA 3GFJA 3QP6A 1BIBA 3WTSC 3KFWX 1POGA 3M7GA 5JLXA 1ORKA 1G6NA 1T33A 3V4GA 4EM0B 1BI1A 4ZYGA 2BW3B 2XGEA 3DPLC 1PUFA 1PDNC 4J01A 3S1QJ 1S3JA 3OR1C 2K27A 2V4JC 1K79A 3EYYA 2R7UA 2MABA 1OCCH 4HRIA 2H1LA 2A68F 1FBUA 5M5WJ 1QVUA 1MNMC 1LDJA 1BN5A 5A2QK 2DI3A 2DT5A 3S17J 5IY5H 3KE2A 4UV8A 5KAIC 2IGNA 1XPXA 2CQ7A 2XC7A 1CGPA 1QU3A 1V5GA 1JKOC 3BG9A 1OPCA 2E5ZA 2FBHA 4PSXA 3LL7A 4UB6C 2VPRA 3S3NA 3IC7A 3SDBA 3V7RA 2CGPA 3PO3J 1TQIA 3TDUC 2RGVA 4EJWA 2CWEA 3LQQA 3U2RA 4A0XA 1L3LA 2X1CA 3BPVA 2NVTJ 3BJOA 2KMUA 3IWZA 2HDCA 1HSTA 2BVLA 3DTEA 2CV0A 2E2IJ 1Z91A 1MBGA 1JHFA 1KU2A 4BHPA 3CC7I 5LHGA 3LFUA 1KU3A 3MVPA 5JHFA 1MW7A 4IZZA 3I3LA 2OJED 1KONA 3BZKA 1X3ZB 1FP1D 3OOPA 4RB3C 3F22A 2W1OA 4E7LA 2Z99A 2EA2A 3BQZA 1NK3P 2LF8A 4LOCA 3FDYA 1TW2A 2DYSH 2O9LA 1KZHA 3H3VK 1FSEA 1Y0UA 5D6FA 5M3FJ 2RC4A 4PFOA 4WXHA 5E1XA 2E1MB 3ELKA 3W3CA 1A31A 2PG4A 2GXBA 2LSOA 2M45A 2E36A 2GOXB
chains in the Genus database with same CATH topology
2L9VA 1UZCA 2LKSA 2DODA 2B7EA 2JUCA 2KFDA 2CQNA 2DOFA 2E71A 2KISA 2KZGA 4FQGA 2K85A 2DOEA 2KIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9V A;  1UZC A;  2LKS A;  2DOD A;  2B7E A;  2JUC A;  2KFD A;  2CQN A;  2DOF A;  2E71 A;  2KIS A;  2KZG A;  4FQG A;  2K85 A;  2DOE A;  2KIQ A; 
#chains in the Genus database with same CATH topology
 2HZD A;  3H92 A;  5E1W A;  2LP0 A;  3D1N I;  1DPU A;  2HZT A;  3WE2 A;  3E97 A;  4JYK A;  1STZ A;  3N4M A;  3BY6 A;  3WGH A;  4RLF A;  1ZRC A;  4V19 K;  1ZK8 A;  1Y6I A;  2WAQ A;  3AL0 C;  1LVK A;  2BBY A;  1JI8 A;  3U1K A;  3JRB A;  4K2E A;  4N0B A;  4L18 B;  1IN4 A;  1YJ9 I;  4RB1 A;  1W7P B;  1X4O A;  4XRF A;  1QA6 A;  2VC1 A;  1EKE A;  3JAM K;  4A2U A;  4QPO A;  4B48 A;  2XIG A;  3Q0U A;  2XKP A;  2VQG A;  2COB A;  4RAG A;  4KIC A;  4XQF A;  1Z7L A;  4H4K C;  2DDB A;  3JRF A;  1DGW Y;  2AQE A;  1S7E A;  2BHY A;  1MDM B;  4LG0 B;  4M3E A;  4OU0 A;  4PGH A;  3ZQH A;  4YIF A;  2F2E A;  5E18 F;  5IYB J;  3K1M A;  4N9H A;  2L01 A;  4BJ5 C;  2CQK A;  3BG7 A;  2CW7 A;  1MZB A;  1VQK I;  3BCA A;  1XMA A;  3CUQ C;  1ON1 A;  4BHB A;  2PLY A;  5HS9 A;  3ECO A;  1W4M A;  2BXZ A;  1TTY A;  1ETK A;  2HDW A;  4B47 A;  1U3E M;  1SFE A;  4PCQ A;  4KJZ A;  1JTX A;  2XAF A;  3BZC A;  3HJE A;  3JTH A;  1I27 A;  4CZC A;  1WJB A;  4G7H F;  3KZI C;  1X3W B;  2O5R A;  3NQO A;  5EEH A;  5LGN A;  2OTJ I;  1TQP A;  2FX0 A;  4B3A A;  1ENH A;  4OWR B;  1VQ7 I;  3SZG A;  2HU9 A;  5L3C A;  2PN6 A;  1JT0 A;  2ELJ A;  1OCO H;  1MBJ A;  3EQL F;  3F6V A;  2M87 A;  1FSH A;  3KX2 A;  2JVH A;  3K0L A;  4LJZ F;  4DQ2 A;  1RR8 C;  3BR2 A;  2XAS A;  1K4S A;  2XKO A;  3WU1 B;  2LNB A;  5DEQ A;  2VUM J;  2E19 A;  2EIN H;  2A07 F;  1WSU A;  1GDT A;  2DOA A;  3KLN A;  3ABL H;  5HOO A;  2IA1 A;  1KU7 A;  2PX9 A;  2OTL I;  2X0L A;  2B7E A;  4EMS A;  3RQI A;  2WV0 A;  3BP8 A;  2EZK A;  2LF7 A;  2FQ3 A;  3PQK A;  2XB0 X;  1X4P A;  2JSP A;  1K4T A;  1JJ6 C;  3GTQ J;  5CYV A;  2HFH A;  5DD8 A;  3GXO A;  2O61 A;  4DZJ A;  4YG2 F;  2ADU A;  3K9T A;  3CDH A;  2P7C B;  4BL0 B;  3ZMU A;  1RI7 A;  3SZP A;  2XPW A;  2R3S A;  3S3O A;  5ILS A;  4HV5 A;  3COA C;  1QZY A;  3F23 A;  1TWF J;  3I53 A;  2IGO A;  2GIZ A;  4KIG A;  1P4X A;  2BEO A;  4ZC3 A;  1G3Y A;  4F93 B;  3BR6 A;  1IDZ A;  2STT A;  3J7A Y;  3HUG B;  4G7O F;  3OSF A;  2NVU B;  2BXY A;  1X58 A;  1YJW I;  4A3C J;  1QHG A;  3QOE A;  3E6C C;  2EH3 A;  4IO9 F;  1LDK B;  3NAU A;  5CJ9 A;  1SEU A;  3G1M A;  2QQ8 A;  1WPK A;  3HSE A;  2ICW G;  1YQA A;  1F36 A;  1HC8 A;  1IRG A;  4XRS A;  2Y2Z A;  3JAM Z;  3VWB A;  4LD5 A;  3S8P A;  3VOD A;  4N4N B;  1OR7 A;  3HBL A;  4I6Z A;  3HDD A;  4IRI A;  2HGC A;  4M3F A;  2V1N A;  2XAQ A;  1XC5 A;  3BG6 A;  3BOQ A;  2LRD A;  4ZJZ A;  5E8G A;  4FET A;  2HDD A;  2L54 A;  2NXN B;  1E0E A;  3DBL B;  2K4B A;  3FXK A;  1SAN A;  4MHG A;  5F1J A;  2VJ5 A;  5D5V B;  2M3A A;  1ZAO A;  2N8G A;  4A6D A;  4RA2 A;  5FKO A;  4B3X A;  4D5F A;  5K5O A;  4HNU A;  1ZQ3 P;  4HDV A;  1H9T A;  4ZYD A;  2JPC A;  4AUX A;  1IRF A;  2V9V A;  2HOT A;  2B9S A;  5GPA A;  1P4A A;  4PJM A;  2L4A A;  5HLT A;  1XMK A;  3C2G A;  4AD9 A;  3OY9 A;  1YHQ I;  4I01 A;  1G3T A;  4XLP F;  4IHX A;  1DP7 P;  4IEJ A;  1RKW A;  2ME0 A;  4E7Z A;  2F5C A;  1YFH A;  1FJL A;  3QPH A;  1U6G A;  1YTY A;  3FHZ A;  4BGD A;  2IS6 A;  1R58 A;  2M9H A;  5BMZ A;  4L0Y B;  2QYO A;  1P92 A;  3ZQQ A;  2ZME B;  4OMZ A;  4NC6 A;  4F92 B;  2R7D A;  2XRN A;  2ECC A;  5JFR A;  2UUZ A;  4GYG A;  3WU2 C;  4TV7 A;  2FD5 A;  3I71 A;  4KNY A;  1DDN A;  5EJC A;  2E1C A;  4I02 A;  2EPF A;  4JOM A;  3KPH A;  1MH3 A;  4L9T A;  2DJN A;  2H1K A;  3TGN A;  2MGQ A;  2ZXI A;  5EF6 A;  2UXX A;  5FRN A;  4LGW A;  4UVB A;  1IUF A;  3FMS A;  1X2N A;  4BXU A;  2H94 A;  1HXD A;  5FB2 A;  1APL C;  2F5F A;  3B6C A;  3HM5 A;  1OCT C;  3R4K A;  3ZQG A;  3MCZ A;  3C3W A;  3K4L A;  4XLC A;  1BOB A;  3T0Y A;  3CCV I;  4E7H A;  2K9Q A;  3S1N J;  1BM9 A;  2RAE A;  3L2V A;  2RKH A;  2IS2 A;  2GM4 A;  3ZMD A;  3EYI A;  3DCF A;  2NNN A;  2KL4 A;  5K5Q A;  4BH9 A;  4XID A;  1X1C A;  3O3K A;  3GFI A;  2Z3Y A;  4P1W A;  4E7K A;  1S72 I;  5D5U B;  3C2H A;  3FKI J;  3TP0 A;  1MIJ A;  2XUB A;  3MZY A;  3EUH C;  4C2U A;  4A5N A;  1W7P D;  2R5Z A;  3RJP A;  1NH3 A;  5EZG A;  5KCM A;  3EUK L;  4QTR A;  3VFZ A;  3J81 Z;  1NG7 A;  1S29 A;  1RES A;  3K4N A;  1HQC A;  3EDP A;  2LRE A;  3BTL A;  3AAF A;  3CJT B;  5IP6 A;  5JI6 A;  3CCU I;  3VPR A;  3BJA A;  4A0Y A;  5LGT A;  4M71 A;  5DM7 F;  1LPQ A;  4UY8 I;  5J4V A;  2WWY A;  5E17 F;  4IQJ A;  3L2R A;  3LMM A;  5FGM A;  1TNT A;  1R1U A;  1P4W A;  4XOP A;  4IOC F;  2RRE A;  3CUO A;  3WTV C;  1IRX A;  1X2M A;  1J75 A;  3L00 A;  3LAP A;  3P7N A;  3FK7 A;  1SVM A;  1Z7U A;  5HVQ C;  2ID6 A;  2NS8 A;  3WTW C;  1MSE C;  4I99 C;  5DCM B;  4BY7 J;  4ESF A;  4IQ4 A;  3K2A A;  4JBA A;  1F5T A;  3RZO J;  3J80 K;  4WCG A;  1K83 J;  5HS7 A;  1Z0X A;  5F08 A;  2IJL A;  3F8N A;  2OCC H;  4CDG A;  1WKM A;  2KIM A;  1I5Z A;  2KPM A;  4XKB A;  1M1E B;  2IVM A;  2FEZ A;  3FF5 A;  3ZN0 A;  2L9S A;  2EV5 A;  2O03 A;  3BT9 A;  3T1B A;  1TT0 A;  1AWC A;  1R36 A;  3PUB A;  3F8C A;  2K7L A;  2ZC2 A;  3DEE A;  3DTI A;  4ZDL A;  5D5X B;  3CMY A;  4A3B J;  1K61 A;  2IS1 A;  2VQH A;  2AXL A;  1OLT A;  5BS6 A;  2Y69 H;  1S9H A;  2PEX A;  3U1D A;  5FKL A;  4XSX F;  1IXS B;  5M5X J;  2EZL A;  4C3I J;  3P9K A;  3UR3 C;  2FML A;  1GV5 A;  3W6J B;  3KP5 A;  1XS9 A;  3L7W A;  4UXN A;  2DCE A;  3FXM A;  1U9N A;  3KZY A;  5LBQ A;  5C44 J;  3FBN B;  4CYC A;  1GXP A;  2LY9 A;  4OAZ A;  3PO2 J;  1MBK A;  3QP5 A;  1A6Q A;  4NC7 A;  4L9N A;  1HOM A;  2XSD C;  2R7W A;  2BVM A;  2KDZ A;  4KIB A;  1N78 A;  4IRG A;  5CVR A;  2MW8 A;  4BXF A;  3M8J A;  2CFX A;  2WAE A;  2K9M A;  4R79 A;  1R7J A;  2R7Q A;  4G6T B;  3ROU A;  2FNP A;  3BC8 A;  5FO5 A;  1FBS A;  3I4P A;  4UV9 A;  4WXC A;  4XLE A;  5TJJ A;  2TDX A;  2NS0 A;  3D5L A;  2L9V A;  3QOD A;  4XLF A;  3A4C A;  5E20 A;  4OOI A;  2P8T A;  1FY7 A;  4YFX F;  3OYH A;  4BJT A;  1WJ5 A;  3BLY A;  2ZCW A;  4WX9 A;  1ZRF A;  4XLN F;  2H8R A;  5IYD J;  1I1S A;  3H35 A;  1BI3 A;  5F6F A;  2LVS A;  2BY3 A;  2M4G A;  1TWC J;  1SD5 A;  2YUS A;  2QUF A;  4MLO A;  5F64 A;  3GVA A;  3M4O J;  3W2A A;  1RUN A;  1J9I A;  3JRE A;  4IHY A;  3GTP J;  3ZP5 A;  2QZ8 A;  3U21 A;  3FBI B;  2HVQ A;  3HOW J;  3H9G A;  5E3N A;  2P0W A;  4FX4 A;  1WI9 A;  4C3J J;  2ZNZ A;  2JJ7 A;  1ETX A;  1VQ6 I;  1R1T A;  1GVJ A;  1YLF A;  3DLL F;  3S3M A;  5IPA A;  4XNF A;  1T98 A;  4R8H A;  4ASN A;  2XV4 S;  2A5W A;  2M7A A;  4WF2 A;  1VQM I;  2P4W A;  1IN8 A;  1TNS A;  2VJI A;  1IF1 A;  5D6E A;  3KLO A;  4XRS G;  3LSM A;  4LK0 F;  1HBX G;  3WTU C;  4GDF A;  3R6S A;  3GTK J;  2ZXW H;  4I09 A;  4ZYE A;  3S15 J;  2XAH A;  5FLM J;  2DA3 A;  3IWF A;  1W5S A;  4U88 A;  1U5T B;  3M3Y J;  1TP4 A;  2IGK A;  3OYA A;  4LB5 A;  3D0S A;  3KP3 A;  3FIS A;  3HIF A;  2Z1D A;  2PMH A;  2EWN A;  4FTH A;  3OYF A;  1GHC A;  1ETO A;  3DXJ F;  2K5C A;  1SAX A;  5E3O A;  1IDY A;  2A6T A;  1JUM A;  2HNH A;  3DEU A;  2CQN A;  5CKT A;  3M1C A;  1A6I A;  2K4J A;  4D7M A;  5K1Y A;  5HS8 A;  3SDG A;  2ZXH A;  1A36 A;  5CVI A;  3AFH A;  5D8K B;  1MKM A;  1DGR M;  4J00 A;  3QU3 A;  4FX0 A;  2HPM A;  3TMO A;  1L0O C;  3LWF A;  2ZME C;  3R60 A;  2DOD A;  2F4O B;  1QZZ A;  4AU7 A;  1I1G A;  4RM3 A;  4M6V A;  4L9J A;  2STW A;  1JHH A;  5ERI A;  1D1A A;  1F1Z A;  2R0Q C;  2Y9Z A;  1O7F A;  2COM A;  1A04 A;  2L0K A;  3FK6 A;  3VYR B;  4MNU A;  2LBF A;  1YYV A;  3ZR8 X;  2FXA A;  3F8F A;  5EG0 A;  4QPQ A;  3F21 A;  4M3D A;  2IP2 A;  1R4N B;  2P7V B;  3K4K A;  1U0J A;  4II3 A;  3WU0 A;  2DYR H;  2QVO A;  1MGT A;  2KRC A;  3M9A A;  4PFP A;  2M5W A;  3KYL A;  1U8R A;  4MQV A;  1BI0 A;  1B9M A;  2QBY B;  3FMQ A;  3G3Z A;  3RI4 A;  1BIA A;  4DYR A;  1Y8R B;  5F04 A;  3L2U A;  3C2B A;  5EYR A;  1AKH B;  4MO7 A;  5HLH A;  1PP8 F;  4XK4 A;  2AQF A;  2F4M B;  2XGD A;  4NB5 A;  5LLQ A;  4KIF A;  2O8X A;  3SZT A;  4OMY A;  3V8L A;  4Y33 A;  1WHU A;  1QHH D;  4FE7 A;  1E3O C;  4BS9 A;  1MMS A;  1MNE A;  3S1R J;  4C9Y A;  6PAX A;  2XPU A;  2PJR A;  2QWW A;  4A6E A;  2FMY A;  3DLA A;  2L9N A;  2XAJ A;  1IZ1 A;  2A6H F;  2HYF A;  2OPT A;  1I50 J;  3O2P E;  3DF8 A;  1UZC A;  4W1U A;  3IH3 A;  3PM1 A;  1WWX A;  1ZG3 A;  4V2G A;  1XCB A;  2EFO A;  2M1B A;  2F6C A;  1T38 A;  1YRN A;  2Q2E B;  4ON0 A;  4O6J A;  3JTG A;  2CRG A;  2QQA A;  1DQU A;  4R1H A;  5B1B H;  4RAZ A;  3I56 I;  2MLG A;  4AYB N;  2JSC A;  1QQI A;  2RDP A;  1WJE A;  2YR2 A;  3GBG A;  1IN7 A;  5DYM A;  1ZGW A;  3I4N J;  1X1B A;  2G9W A;  1MBE A;  2NOG A;  3CUQ A;  3ZRG A;  3CCM I;  3E5U A;  4NHJ A;  2FUG 2;  5DS9 A;  4LMY A;  5J40 A;  1VQ4 I;  1Z6T A;  5BPI A;  3HG9 A;  3K7A J;  4Y13 A;  3OV8 A;  4P96 A;  3REO A;  1C0W A;  1Y56 A;  1YW9 A;  2LTP A;  1HKT A;  2P5V A;  5E79 C;  1D0Y A;  4U7B A;  4C2M J;  3OYL A;  2K85 A;  3QAH A;  3RPU A;  1ZG1 A;  1ON2 A;  1ERD A;  2HR3 A;  2KJC A;  4LIT A;  2JA5 J;  3QYF A;  4ENM A;  5KAF C;  3CCQ I;  1RZ4 A;  2P81 A;  1PJR A;  2Z2S B;  3G1L A;  3O8H A;  3CLO A;  4IL6 C;  1U8B A;  2YU9 J;  5IT9 Z;  3J7Y J;  3TP3 A;  4I98 B;  1EA3 A;  1N25 A;  2NRA C;  2HTJ A;  1SD4 A;  3K70 C;  2ZSH B;  3OWT A;  3HSF A;  3E3V A;  1UST A;  4Q47 A;  2KFD A;  3HEF A;  5IOY A;  3SYT A;  2VOO A;  1TWA J;  1VZ0 A;  2L7Z A;  3M8F A;  4YEL A;  4CH7 A;  2V1U A;  3P9I A;  4M3B A;  5HLI A;  2ZXJ A;  3AG2 H;  1IV8 A;  2HYJ A;  2LR8 A;  4ENK A;  2H27 A;  2XF6 A;  4DYC A;  5EGO A;  2ID3 A;  2E35 A;  2O3F A;  5GTI C;  3QRF F;  1HW2 A;  2VAS A;  2O0Y A;  2YU3 A;  1P9Q C;  3OYB A;  1D5Y A;  1FOY A;  3EPZ A;  2E7X A;  2DA6 A;  4UNO A;  1G3W A;  2K86 A;  4BDZ A;  4D7N A;  4KIS A;  2R93 J;  4XN0 A;  3Q9V A;  2AHQ A;  3DWL E;  5B1A H;  1QNT A;  3V7S A;  1YIJ I;  1B72 A;  1D0X A;  3BR5 A;  3GTJ J;  3ML6 A;  1XX5 A;  2YX7 A;  3V8K A;  4PUS A;  4JX5 A;  1Z3Y A;  2NVY J;  4MTE A;  1YIT I;  3ZQI A;  5CVU A;  2BZT A;  2IEK A;  4ZZL A;  4BUP A;  3HKZ N;  4PJ0 C;  5HDN A;  4RDU A;  2BOL A;  2HXI A;  3A01 A;  1KYW A;  3IL2 A;  3FX3 A;  4A3F J;  1IN5 A;  2QGU A;  1ZRD A;  2DQL A;  1ZYR F;  3A03 A;  3I58 A;  1ZKG A;  4EM1 A;  1ZTR A;  4XOT A;  2BY1 A;  1DU0 A;  2RN7 A;  1E3H A;  4XIC A;  3I0T A;  4PSW A;  4ENJ A;  2DFI A;  2IA0 A;  3SHF A;  4O3M A;  4HAM A;  2ELH A;  1MMA A;  3ISP A;  4II2 A;  3GF2 A;  4P55 A;  3SJM A;  2AS5 F;  2DFF A;  1I6H J;  1P6R A;  1JXS A;  1ZG5 A;  3H0G J;  3OR2 C;  4GCV A;  2DA4 A;  2JN6 A;  2WB1 A;  2XF5 A;  4PZJ A;  3J7Z I;  2CS3 A;  1J2X A;  2NAZ A;  1IG7 A;  4M6Y A;  3L1P A;  1P7J A;  1WH7 A;  4HW0 A;  1WFX A;  4OIQ F;  5FLX Z;  2KIQ A;  4V2F A;  1V3F A;  2OA4 A;  3CP8 A;  3RPU D;  4IVN A;  2Z9O A;  2EV0 A;  4M9S A;  4OIO F;  3S1M J;  1IO2 A;  4QLC U;  4UUT A;  2BW3 A;  1Z05 A;  4CCN A;  4U87 A;  4Y17 A;  1FMV A;  2HKO A;  2W7N A;  5H6Q A;  9ANT A;  1R5I D;  4WWC A;  1JKP C;  1ZLK A;  2QQB A;  4RB2 C;  3KEQ A;  5GPC A;  3OYE A;  1ZEL A;  1IJW C;  1ETQ A;  4B09 A;  5AIP A;  3LSJ A;  4XR6 A;  3E6D A;  3Q3S A;  2W48 A;  3QU6 A;  1YS7 A;  1WJC A;  1FTT A;  4QIW N;  1UAA A;  2G0E A;  1U5T C;  4Q5S F;  3BQY A;  5ED4 A;  2M4K A;  4XL9 A;  5LEK A;  2X9D A;  2F5E A;  2XRL A;  2HKX A;  1RNL A;  3ZMZ A;  1LDD A;  2K40 A;  3MKW B;  4ZYH A;  5LHI A;  4M3G A;  2E1N A;  2BE5 F;  2ESH A;  4AM3 A;  1BR1 A;  2CJJ A;  1U2W A;  2VBX A;  3DKY A;  3K2Z A;  4DBQ A;  2ACJ A;  3B6A A;  1WGX A;  1GLN A;  2QF7 A;  1SMT A;  1YX3 A;  3PSI A;  1PYV A;  2K9S A;  2DK5 A;  2EIL H;  4BY1 J;  4GXO A;  2WB1 N;  2X6W A;  4FE4 A;  1OCP A;  1DU6 A;  3HGG A;  4H0E A;  2VIX A;  4G94 A;  3BWG A;  5EDN A;  3TQN A;  1LEB A;  3S14 J;  3GO5 A;  3HTU A;  3R0J A;  1R00 A;  1T2K A;  2A6E F;  3GLL A;  3KIO A;  1E17 A;  2QA4 I;  2CQX A;  2R7F A;  2Y31 A;  5KK1 A;  2DLL A;  1YO5 C;  1DP3 A;  3GZ5 A;  2A61 A;  3JRA A;  3I55 I;  3CD6 I;  2DK8 A;  3RKY A;  2FOW A;  3OYK A;  3C1D A;  3CF2 A;  1EH7 A;  3EUH A;  3J81 K;  2X6O A;  1WJF A;  1B1B A;  4ETS A;  5TIS C;  1F43 A;  3RKX A;  4AVP A;  2ISZ A;  3F72 A;  2M34 A;  2VT2 A;  3WOD F;  1T0F C;  2M0M A;  3R61 A;  3L2C A;  1BR4 A;  4EEF G;  4N9I A;  5H2F C;  2P5K A;  1ITY A;  3HSR A;  2L3D A;  2WAF A;  3QYE A;  3CF5 F;  4B8X A;  3F8B A;  1ZRE A;  2DMU A;  5FJ8 J;  1ZN2 A;  5HDK A;  4RGS A;  1BR2 A;  4BXX J;  1CF7 B;  1TC3 C;  2VPL A;  1FIA A;  2OV7 A;  1PUE E;  5K7Z A;  4MEY F;  2OC6 A;  2J5O A;  1FC3 A;  3FKJ A;  1W7P A;  2M8G X;  2DT7 B;  3RKW A;  2A3S A;  1E3P A;  5LRR A;  2DMQ A;  1YIO A;  2LY1 A;  4Q48 A;  4S04 A;  5FD5 A;  3JCU C;  1S7O A;  1XGM A;  3OYJ A;  2FQ4 A;  2HPI A;  1B8I A;  1KYZ A;  2JA2 A;  1G2H A;  3NEU A;  4RGU A;  3KYD B;  1UJ8 A;  3GTM J;  5ICC A;  2BGC A;  2IT0 A;  3F6O A;  1REP C;  1QBJ A;  2MYS A;  2R4G A;  2KP6 A;  5TGT A;  2CUF A;  2G7H A;  1MDM A;  2ZNY A;  4LG0 A;  3HOV J;  2IW5 A;  3IH4 A;  2X1E A;  2D1H A;  2OCE A;  3A2K A;  1MMG A;  1NTC A;  3LSR A;  2EV6 A;  3CC4 I;  1K6Y A;  4XM3 A;  3QYB A;  2R7O A;  4RB0 A;  1YW8 A;  3BTC A;  4DOZ A;  1BBY A;  1FYK A;  1AHD P;  5D4S A;  4D0P A;  1ZLJ A;  5L3B A;  5FKN A;  1IRZ A;  4HX8 A;  2EQR A;  2EA4 A;  3JW4 A;  2H09 A;  5K7H A;  3S2D J;  2CMP A;  4NBQ A;  3DTK A;  3T8R A;  2UV1 A;  4AWX B;  4RAY A;  3I4M J;  2R7R A;  4U0W A;  2OAZ A;  2FOK A;  2ZKZ A;  3A0H C;  1J5Y A;  2WV1 A;  2JMW A;  2QKM B;  3AG4 H;  3GCM A;  4KMU X;  2HQR A;  3I5U A;  5KNL A;  3QPT A;  1WH5 A;  2KJB A;  2V1X A;  2HS5 A;  5J8C A;  2CW8 A;  3GW2 A;  1FOW A;  1ETW A;  3IAS 2;  3TL4 X;  2GXG A;  4B43 A;  3W2W A;  4F3Q A;  3DV8 A;  1O3S A;  2M8E A;  3CME I;  3OOU A;  4LFU A;  4RS8 A;  4G6Q A;  4RMN A;  4RBO A;  1UHM A;  1Z9C A;  1Y1W J;  2D2W A;  1YG2 A;  2BY2 A;  5DDG A;  3RYP A;  2B63 J;  2CW0 F;  1JKR C;  2E1M C;  4LIU A;  4A5M A;  1W36 C;  3OS2 A;  4DBR A;  1JT6 A;  4UUS B;  1NG6 A;  1OMI A;  1D1C A;  2Z33 A;  5KVR A;  2ME6 A;  4I76 A;  1A35 A;  2D1V A;  3WTX C;  2LH9 A;  2JUC A;  1YI2 I;  2QLZ A;  3PSF A;  5CQG A;  4BKX A;  3NWT A;  3OL4 A;  2K9L A;  5LFA A;  1OYI A;  2PFB A;  1S5L C;  3LSG A;  2DU9 A;  3WGI A;  5GTH C;  1T6S A;  4O5V A;  1I3A A;  5JVT A;  4BQA A;  2JUG A;  1DUX C;  4CZZ A;  4IJA A;  2QCO A;  1K78 B;  1RPW A;  1KQ8 A;  3HPH A;  2DFH A;  3HGY A;  1MND A;  3HUG A;  5HDG A;  2FU4 A;  1LE8 B;  3BR3 A;  2ESN A;  1T95 A;  2EIM H;  4G9Y A;  2HWV A;  3HRU A;  3DFG A;  2JWT A;  5F0F A;  3A0B C;  4LK1 F;  5AIQ A;  2DQR A;  3WTY C;  2VXD A;  2EZI A;  1XG1 A;  1EH6 A;  2Q1Z B;  2E34 A;  2HVR A;  4XSZ F;  3ULQ B;  4LG3 A;  3MEX A;  1BC8 C;  1LB2 A;  1LNW A;  3HRT A;  4IKF A;  1YX5 A;  1XD7 A;  2NS7 A;  4UVA A;  3ZMT A;  1ZHF A;  4DW6 A;  1FNN A;  4BAC A;  2WY8 Q;  3FZV A;  2FE3 A;  1V4R A;  4P5O A;  2LG4 A;  1IGN A;  2DN0 A;  4ZZD A;  3HHG A;  2JRM A;  2DA1 A;  1WVR A;  4P9U A;  2TRT A;  5EEA A;  4KA4 A;  5J1Y A;  3TW6 A;  1KQ9 A;  1O3Q A;  5DUI A;  1Y0N A;  1XN7 A;  1HSJ A;  3HHH A;  3KET A;  5D5W B;  5FFZ A;  3V8J A;  2HI3 A;  4PGG A;  4F91 B;  4XKC A;  2I10 A;  5M3M J;  1WZ2 A;  3I59 B;  2E71 A;  1VQP I;  4HF2 A;  2FA5 A;  1OYY A;  2CQQ A;  3CCY A;  4BAY A;  4KUM A;  2ZME A;  1KA8 A;  2VN2 A;  3BZ6 A;  4QSH A;  4ESB A;  3FWE A;  4IF4 A;  4E7J A;  5IOZ A;  5CVJ A;  4A69 C;  2R5Y B;  1ZH5 A;  4NQW A;  3HTS B;  2V1D A;  1ETV A;  3DU5 A;  1I39 A;  3JRG A;  5H20 A;  1B9N A;  3GEZ A;  5EZH A;  1XB4 A;  1MJ9 A;  4IXA A;  4PK4 A;  3G71 I;  4LIV A;  2VKV A;  2R92 J;  1YJN I;  4U0Y A;  1PP7 U;  2MA3 A;  3AG1 H;  2DO7 A;  4MFE A;  3IP4 B;  5ILU A;  3BR1 A;  2LD5 A;  2VT3 A;  1R23 A;  3FXQ A;  3IV5 A;  3VB2 A;  3L2Q A;  1SD7 A;  3CJN A;  1XMX A;  2GOM A;  3PNY A;  2KRF A;  4DIQ A;  3ZCO A;  3JRC A;  4BBR J;  3GFL A;  4EV0 A;  1MMD A;  1BJA A;  1R4M B;  2ETH A;  2LDU A;  3CCS I;  2M7B A;  3RPQ A;  1O4X A;  3QWL A;  4AID A;  4EJT A;  3HOY J;  4KYW A;  2RNJ A;  1IUY A;  3MFK A;  1YE9 A;  2LLK A;  3MD2 A;  3OSG A;  5C4X J;  2OD5 A;  4YII A;  3DP7 A;  4I7H A;  2Q8K A;  3WTZ A;  3KP7 A;  4MFD A;  4EM2 A;  3KYC B;  1HLV A;  4LB6 B;  2Y30 A;  1D8J A;  4XON A;  4EJO A;  4E6K G;  5DTD A;  4YRV A;  3QQA A;  3HOS A;  3G1O A;  3S32 A;  2MSY A;  4A0Z A;  4D5C A;  3GWZ A;  4IX7 A;  4CUG A;  1PUF B;  1YRN B;  1QRY A;  3RYR A;  2IGM A;  5LGU A;  5DUK A;  2ZB9 A;  3GTO J;  3I9V 2;  2X85 A;  3F8M A;  5E3L A;  2CV2 A;  1FP2 A;  1Z6R A;  4QWQ A;  2KHM A;  1HCR A;  1WCM J;  2ZJR F;  3PNT A;  2EB7 A;  3X2Q H;  3WHC A;  1SMY F;  3PFI A;  5GAD J;  3CMM A;  4HF1 A;  3HZJ A;  5DCM A;  1J59 A;  2W24 A;  2E1O A;  4PJJ A;  5CLS A;  4HF0 A;  2X1D A;  2YS9 A;  4CCJ A;  2D5V A;  3I64 A;  2OUM A;  3GYH X;  2RNG A;  2A69 F;  3SXY A;  2HOA A;  1F4K A;  3JSO A;  3SFZ A;  3WG7 H;  1FTZ A;  3BTI A;  2VON A;  1XSD A;  4UB8 C;  4ENN A;  3JRH A;  3GTG J;  4RGX A;  5IT9 K;  1LEA A;  3HRM A;  1WQ2 A;  3Q0W A;  4X0G A;  2O7O A;  4BYY A;  2MH2 A;  1B59 A;  1USS A;  1HDD C;  1HKS A;  2NNY A;  1BA5 A;  1VF9 A;  4A3I J;  1O3T A;  1QO0 D;  4L5I A;  4HPQ A;  1XGO A;  2HQ5 A;  4OAY A;  1BI2 A;  3RDI A;  3CJR B;  2EFP A;  2F48 A;  1IC8 A;  3KEO A;  4A3L J;  4AYB A;  3VYS B;  2CV1 A;  2E7W A;  5DD4 A;  1AA7 A;  4XKV A;  3G4S I;  4A3D J;  1MJB A;  1Z67 A;  2MG4 A;  1JTY A;  1NHA A;  2RQP A;  1S7A A;  3RKQ A;  2PI0 A;  4NC8 A;  1VQL I;  4I0A A;  2KIU A;  4CCK A;  2Y75 A;  2IBD A;  1WJD A;  2MC4 A;  3K4J A;  3CO7 C;  3HOU J;  2ZSI B;  5D8L B;  3AKZ A;  1MBH A;  2RV8 A;  4EVI A;  3QPL A;  2J5P A;  1LJ9 A;  2CG4 A;  5C3E J;  2X6Y A;  3E0J B;  4HQM A;  2HOS A;  1X19 A;  2K9N A;  1YS6 A;  1TLH B;  5GAH J;  5BPD A;  1D5V A;  2F5V A;  2FBK A;  1LVA A;  4Y4R A;  4ZTJ A;  4KDP A;  2GQQ A;  3HYI A;  3ZQL A;  2EBI A;  3W6K B;  3ABK H;  2WA0 A;  1OCR H;  1FYM A;  3HC7 A;  2DOF A;  1FZP B;  3K4M A;  1JGG A;  2VL8 A;  2VJJ A;  2GLO A;  5IP9 J;  5DV5 A;  3SEZ A;  2DT6 A;  1SFU A;  2EFN A;  4UUV A;  2R7X A;  2Y0S A;  3P9C A;  2OQR A;  2KRH A;  3V7C A;  4YFN F;  1JUP A;  5L3E A;  1WRJ A;  4RM2 A;  4FT8 A;  2JA7 J;  2M30 A;  1KGS A;  2JTV A;  5FLX K;  4HZF A;  1ODD A;  1TQM A;  3DKW A;  2CUJ A;  5JHU A;  5KHD A;  2NVX J;  3CC2 I;  4AIJ A;  1GVD A;  1R5G A;  4D1Q A;  3BCB A;  3O6B B;  3NWS A;  1P2F A;  2EIK H;  4F7Z A;  4KMF A;  2EIJ H;  2DXI A;  2OZ6 A;  4HV6 A;  4CCM A;  5IT3 A;  4LLN A;  1F9N A;  4KIT B;  4M72 A;  1G4D A;  4IHV A;  3A1Y A;  3K70 D;  1D8K A;  2VXZ A;  4HOB A;  5ICE A;  1PVE A;  2O8K A;  4FAS D;  3U9G A;  4I2O A;  3HOX J;  1Z77 A;  1SAU A;  3MKY B;  1U5T A;  5M5Y J;  2DFE A;  2VB6 A;  3HKZ A;  1BC7 C;  3VEP A;  5HLG A;  2P5L C;  1ZGJ A;  2IS4 A;  1OJL A;  1OFC X;  1EJ9 A;  1JKQ C;  2OZU A;  2KZV A;  1D3Y A;  4MTD A;  3HXL A;  1V54 H;  2Y0S N;  3RIR A;  4CHU A;  4X1E A;  5IP7 J;  2KIS A;  2DMN A;  3CDI A;  4E4H A;  1V5E A;  2PMZ A;  1BJZ A;  3BDD A;  3MN2 A;  1R71 A;  3FXL A;  2GA2 A;  4CCO A;  4Z6Y A;  3DPU A;  2BYV E;  1UFM A;  1TWG J;  2ECB A;  5BOX A;  5B5E C;  3ABT A;  2DAO A;  2DA7 A;  1YW7 A;  3BRO A;  2AO9 A;  1T39 A;  3PNV A;  2GWR A;  4BDY A;  2X48 A;  3K1N A;  2W00 A;  2EFQ A;  3DEW A;  2Z5U A;  4HLX A;  2NVQ J;  3S93 A;  3V42 A;  3D5R C;  1P7I A;  1S8N A;  4KN4 X;  2ISY A;  2OU2 A;  5F27 A;  4IOA F;  1W1W E;  2V6E A;  2CFO A;  2YX4 A;  1IXR C;  2ZJQ F;  2WBM A;  2CYY A;  5K5R A;  4DJA A;  2GXA A;  1FOX A;  4DZP A;  4HNT A;  4CXF A;  5L3G A;  5FD6 A;  4LLG F;  3FM3 A;  1BW5 A;  2XSJ C;  1T0F A;  1H89 C;  3OYC A;  4HX7 A;  5J1R A;  4FIS A;  3S2W A;  2QBY A;  1GV2 A;  1ONV A;  5DM6 F;  1GXQ A;  1AKH A;  2VJ4 A;  4HST A;  3GZ6 A;  1W5T A;  1QGP A;  4IHW A;  3DQV C;  3N97 A;  4CSW A;  4B1R A;  1XSV A;  5ICG A;  3A02 A;  2VBW A;  2V7F A;  3W2V A;  3F9K A;  5H6R A;  4BEH A;  3WTT C;  1Z3X A;  1ETY A;  4PJN A;  2PMZ N;  1A5J A;  1EF4 A;  4ANJ A;  1UG0 A;  2XAG A;  4KT6 A;  2RVC A;  1FMW A;  3BG3 A;  3VSL A;  1B8I B;  2LYC A;  4BQN A;  4W97 A;  3F0C A;  4AIH A;  1HA8 A;  3OL3 A;  2B0L A;  4EJU A;  2JA6 J;  4XRM A;  2GIV A;  2JZY A;  3RCO A;  2Q2E A;  3FM5 A;  2DA5 A;  3BG5 A;  4G7Z F;  2XAU A;  4ZYA A;  1GUU A;  2MD0 A;  3DBR B;  2L5Q A;  3H5R A;  1JGS A;  1Y1V J;  2QSF X;  3FMR A;  3TO7 A;  2KZG A;  3PIP F;  2LK2 A;  3OYG A;  3SFI A;  1G3S A;  1ZGA A;  1AU7 A;  2VKH A;  2IXS A;  4M6X A;  2R7V A;  1TBX A;  1XDU A;  5FRO A;  3MZH A;  3OYD A;  4MGR A;  3LQR A;  4A12 A;  3IAM 2;  5A2Q Z;  2V26 A;  2IA2 A;  2W84 A;  2MC3 A;  4HEA 2;  3OS0 A;  4KN7 X;  2DOE A;  4P9F A;  2WAQ N;  3IH2 A;  3E5Q A;  2WAD A;  3R0A A;  1BW6 A;  2NYX A;  2V9K A;  3CTA A;  3FXJ A;  1TT5 B;  3HL2 A;  3IHU A;  1VFC A;  3JSP A;  1FPQ A;  1OIS A;  4BJ6 C;  5LRS A;  3C18 A;  3TED A;  3K4C A;  4M9X A;  4GGG A;  4Y7N J;  1RET A;  1RUO A;  1R49 A;  4EJV A;  1JJ8 C;  1BOA A;  1X1P A;  2LFB A;  3VOE A;  1QPI A;  2XVC A;  1SFK A;  2XPV A;  3GUD A;  3LSH A;  2OF7 A;  2Q0O A;  3UNG C;  2X51 A;  1UHW A;  2QKL B;  3VDX A;  2BHZ A;  1WI3 A;  3TOA A;  4M73 A;  3LSK A;  1JE8 A;  4I0B A;  2XGC A;  4GRI A;  4Y52 J;  4FQG A;  3Q5F A;  2KIF A;  4IHS A;  4XKW A;  1V5F A;  2R5Z B;  5J47 A;  1UCR A;  2Y48 A;  1WJA A;  3G73 A;  1K6O A;  1BL0 A;  4NDL A;  5GP9 A;  2CUE A;  3CZ6 A;  4XMY A;  2R7S A;  1SC7 A;  2M2E A;  1IV6 A;  4L0Z B;  3K4B A;  1ULY A;  2G7U A;  3CCL I;  4EGZ A;  4A3E J;  1EH8 A;  1VQN I;  5BQT A;  2OQG A;  3H9Q A;  1VQ8 I;  4BU2 A;  1TWH J;  1Z21 A;  2IPQ X;  2KDO A;  1TZL A;  3OS1 A;  5B66 C;  1UB9 A;  2YSR A;  3E1S A;  5ILV A;  1R1V A;  2VQL A;  1HF0 A;  2VBY A;  4S0H B;  1G8X A;  2L02 A;  3F3X A;  2CU7 A;  2W82 A;  3LA3 A;  4JX6 A;  3OYM A;  1V55 H;  1VND A;  3LOC A;  3VYU B;  3QPS A;  2FJ1 A;  3KP6 A;  4L9V A;  3CCE I;  3RZD J;  3CCJ I;  3S16 J;  2LY2 A;  4CIC A;  3DKX A;  3OIQ A;  3G2B A;  3MZ8 A;  3TBI A;  1FOK A;  1Y8Q B;  3TO9 A;  3GX4 X;  2VKE A;  4Y3O A;  5L3F A;  1LKX A;  1OQY A;  3MKL A;  1O7L A;  4N4O B;  4FHT A;  3ZQF A;  4WK8 F;  2UZK A;  5L3D A;  3HPG A;  4A3J J;  3MWM A;  4A3G J;  1OKR A;  3KEY A;  1VQ9 I;  3LA7 A;  3TO6 A;  1FBQ A;  5F1R A;  4C2T A;  1SFX A;  1UHS A;  2DW4 A;  3E6M A;  3Q9S A;  3CES A;  1U9O A;  5BNG A;  2HQN A;  2Y0M A;  4HX4 A;  2GA1 A;  1KQ0 A;  3H1C A;  3H3Z A;  5LHH A;  4EAT A;  4HSR A;  1HDP A;  2EJR A;  1HKQ A;  1XGN A;  3VSK A;  3LST A;  4CGZ A;  2VE8 A;  3IRQ A;  4RAF A;  4OIP F;  2L7K A;  3ABU A;  3GFM A;  4OIR F;  2XB5 A;  4E70 A;  4UHT A;  4ZDP A;  4CYC B;  4HBL A;  4ESJ A;  2JRT A;  2V6C A;  3SQN A;  3HRS A;  1S6L A;  1ZR4 A;  4A3K J;  3CQZ J;  3WGG A;  4IPA A;  1W36 D;  3M07 A;  2EZH A;  2W57 A;  2JA8 J;  1MBF A;  3OIO A;  2M0C A;  3ZMV A;  2JT1 A;  2P6S A;  5CVV A;  1RRJ A;  4NQW B;  3JR9 A;  1UEL B;  1Q1H A;  1X1D A;  2H6B A;  3BPX A;  2Z16 A;  4G6D A;  4NNJ A;  4Z2Y A;  3WHB A;  1J0R A;  3ZXS A;  3NAR A;  1O57 A;  5HNH A;  1XCV A;  2XDV A;  2GBY A;  2IAI A;  3NRV A;  2QQ9 A;  1FWZ A;  4YIR X;  5F0H A;  1SVO A;  3RTR A;  3IRR A;  1XTA A;  4HDU A;  3E7L A;  2W4S A;  4B4C A;  5LEJ A;  4Q4Z F;  1W0T A;  4PDK A;  3CCR I;  2DPU A;  2L2O A;  2HYG D;  3MQ0 A;  4ABZ A;  2GZW A;  5JVG F;  2E2H J;  3E5X A;  1E2X A;  3CJQ B;  3ZGK A;  1QZE A;  1LFU P;  4E7S A;  1IAW A;  2ZFW A;  4YFK F;  1FIP A;  3DPT A;  4BE1 A;  2V9P A;  1UG2 A;  2QSG X;  5E1Z B;  2OBP A;  2JPB A;  2QEX I;  3ZQ7 A;  1N75 A;  4WXD A;  2EK5 A;  2FF4 A;  4KT5 C;  2ZO4 A;  4S05 A;  1I3Q J;  4L5J A;  3FHN A;  4X6A J;  5E8I A;  2R7T A;  4XLA A;  1H88 C;  1MMN A;  1FEX A;  2MH9 A;  3HOT A;  5CPR B;  5JLW A;  1CF7 A;  2P6T A;  3ASO H;  1I6X A;  2K3F A;  3M8E A;  1OR7 C;  2LKP A;  2WC2 A;  3O8G A;  3UKG A;  4IRH A;  2LKS A;  1FLI A;  2F4I A;  2F5D A;  3G6E I;  1UMQ A;  3JRI A;  4BQQ A;  4G12 A;  4B44 A;  1H8A C;  1R22 A;  1T8I A;  3ASN H;  3IKV A;  2DTZ A;  4XOR A;  1OCZ H;  2C6Y A;  2LOO A;  5F0C A;  4J19 A;  1IW7 F;  2DDA A;  2YPR A;  2WTE A;  3KZZ A;  3LAJ A;  1J09 A;  3MKZ A;  4ZTF A;  4NUB A;  1N77 A;  2DMT A;  3QOP A;  1LUJ B;  3TW7 A;  2MFZ A;  2PBI A;  4XN3 A;  5FKK A;  4DNC A;  3ERM A;  2FSW A;  3DU6 A;  3H0D A;  2MLK A;  3P5J A;  4JX4 A;  4CO8 A;  4XLH A;  5IYC J;  2UWM A;  5K7F A;  2Y9Y A;  2ZJP F;  2H8W A;  5GAG J;  3PFY A;  1D1B A;  2RQQ A;  3PQJ A;  2UXN A;  3LSP A;  2HEO A;  3H36 A;  3ZOB A;  2JVG A;  3BR0 A;  2W85 A;  4E7I A;  3B73 A;  3CLQ A;  3N05 A;  1O3R A;  2XHK A;  3KP4 A;  4GO1 A;  2TCT A;  4BQO A;  1IN6 A;  3H5N A;  5J3L A;  3H5A A;  4CA0 A;  5HOD A;  3ONQ A;  4DGW B;  4DYQ A;  3CO6 C;  2LBF B;  3FXO A;  3TKY A;  2KT0 A;  1KU9 A;  2JK3 A;  2HQA A;  3WE3 A;  5EG0 B;  3K1P A;  4A93 J;  3VYT B;  4G8X A;  2KKO A;  1GT0 C;  3CMA I;  3DBH B;  1MH4 A;  5ICF A;  1EV7 A;  1HW5 A;  2H6C A;  3CP2 A;  3ECH A;  3FXU A;  4HNV A;  1IXC A;  1JUS A;  2PQ8 A;  2K02 A;  3C7J A;  3K6G A;  4RLQ A;  3L2W A;  4BE0 A;  2D45 A;  3AG3 H;  2L7F P;  3AL0 B;  4HA8 A;  4BHC A;  4UVC A;  2LC2 A;  1R5H A;  3PUF A;  1R9T J;  2VLA A;  4MIM A;  3S2H J;  3M1E A;  3ESW B;  4HG2 A;  4Y15 A;  4PJL A;  1T08 B;  2CH0 A;  2CO5 A;  2KQR A;  2HXO A;  5FLV A;  3GTL J;  1VI0 A;  4AIK A;  1RIO H;  3MAJ A;  3L09 A;  2DA2 A;  5D4R A;  2VI6 A;  1NK2 P;  4CYD A;  1D0Z A;  2DMP A;  5B3S H;  4UUS A;  2PJR B;  2L4M A;  3H9J A;  5JR3 A;  4BBS J;  3JRD A;  4D9J A;  3PJR A;  1XGS A;  2AXT C;  2E60 A;  2VBZ A;  1X1A A;  2ZFU A;  2MD5 A;  5CQE A;  5J1U A;  1FYL A;  1B6A A;  1R6R A;  2FBI A;  3TDZ C;  4ZDO A;  4U7D A;  2MBF A;  3H3U A;  1TW3 A;  4U0V A;  3B02 A;  2R7Z J;  2VOP A;  1SVL A;  2GAU A;  5FKM A;  1Y39 A;  3PIO F;  1K78 A;  2ZJ2 A;  1B4A A;  2LKX A;  1SD6 A;  4M9Z A;  1VQO I;  2L7M P;  3KCC A;  3SEQ A;  2HTS A;  1LE8 A;  2E2J J;  1J7K A;  1G59 A;  3CUQ B;  3T5X A;  5J6X A;  2L9R A;  1TL8 A;  2K3P A;  2I5U A;  4XBF A;  3PL8 A;  1W0U A;  5DCF A;  2DBB A;  4C3H J;  2HOE A;  2LMD A;  3TOB A;  3FXR A;  3HB9 A;  1Q1V A;  1CQT A;  1X3U A;  2VKD A;  2O6G E;  5C4J J;  1ZAR A;  2DJI A;  4JP0 A;  4KFC A;  3EET A;  1QPM A;  3J80 Z;  1AOY A;  2HVS A;  3ZMS A;  1MD0 A;  3ZN1 A;  4HQE A;  3WG9 A;  3LA2 A;  2VE9 A;  4JQF A;  1VQ5 I;  2ELK A;  3FIW A;  4YEJ A;  4BNC A;  1XSX A;  4EGY A;  2VC0 A;  4EQQ A;  1H9G A;  3IKT A;  1MSF C;  3OIP A;  4C30 A;  2XRO A;  3ABM H;  1SFO J;  4OIN F;  2EFW A;  4GFB A;  1QVT A;  5GAE J;  2JQ7 A;  3HOZ J;  1FX7 A;  3IUO A;  2BV6 A;  1VTN C;  3ERE D;  3ZPL A;  3K69 A;  4RGR A;  2V79 A;  2WY7 Q;  2A5Y B;  3RSN A;  1H0M A;  5E3M A;  1T56 A;  2XF7 A;  3GZN B;  3CDL A;  3I59 A;  1ZR2 A;  5TRD A;  3BTJ A;  4ZH4 F;  2DTR A;  4F52 A;  2ZBK A;  3GLX A;  1LFB A;  4MEX F;  2A05 A;  2BY0 A;  2QM3 A;  3RQ4 A;  3W6V A;  5J4Y A;  5EGO B;  1U78 A;  1Z1D A;  5FRM A;  2W25 A;  2X4H A;  2XGX A;  2VQC A;  3OYI A;  4HLY A;  5LD2 C;  5HNF A;  1OYW A;  2FRH A;  4BE2 A;  2R5Y A;  3Q0V A;  5EEG A;  4L5E A;  3ZQC A;  1K7A A;  1MJA A;  3D5S C;  4JK1 X;  3J7A O;  1RKT A;  4HYE A;  4IHT A;  3OMY A;  4FCY A;  3E6B A;  3BJ6 A;  2KLO A;  2QSH X;  1B72 B;  1ACI A;  1HW1 A;  3I54 A;  4A3M J;  1YOV B;  1XDS A;  1RC9 A;  4GYI A;  3T8T A;  2PJP A;  2CSO A;  3MMY B;  1LQ1 A;  4M74 A;  4AVZ A;  2E5N A;  3A01 B;  2FNA A;  4MQ9 F;  5FFX A;  4F55 A;  2VOD A;  3OYN A;  1RR7 A;  2DPD A;  4CCL A;  3LSI A;  3LNQ A;  2NOJ B;  4AC0 A;  1W5C C;  2I8D A;  3K10 A;  1FT9 A;  2X6X A;  3LFK A;  4LLL A;  4BEH B;  3EUA A;  1LFP A;  1DPR A;  2PMU A;  3GME A;  2IRF G;  5J8F A;  5AON A;  2QEN A;  3KP2 A;  3L9F A;  4ITV A;  2CUZ A;  3GFJ A;  3QP6 A;  1BIB A;  3WTS C;  3KFW X;  1POG A;  3M7G A;  5JLX A;  1ORK A;  1G6N A;  1T33 A;  3V4G A;  4EM0 B;  1BI1 A;  4ZYG A;  2BW3 B;  2XGE A;  3DPL C;  1PUF A;  1PDN C;  4J01 A;  3S1Q J;  1S3J A;  3OR1 C;  2K27 A;  2V4J C;  1K79 A;  3EYY A;  2R7U A;  2MAB A;  1OCC H;  4HRI A;  2H1L A;  2A68 F;  1FBU A;  5M5W J;  1QVU A;  1MNM C;  1LDJ A;  1BN5 A;  5A2Q K;  2DI3 A;  2DT5 A;  3S17 J;  5IY5 H;  3KE2 A;  4UV8 A;  5KAI C;  2IGN A;  1XPX A;  2CQ7 A;  2XC7 A;  1CGP A;  1QU3 A;  1V5G A;  1JKO C;  3BG9 A;  1OPC A;  2E5Z A;  2FBH A;  4PSX A;  3LL7 A;  4UB6 C;  2VPR A;  3S3N A;  3IC7 A;  3SDB A;  3V7R A;  2CGP A;  3PO3 J;  1TQI A;  3TDU C;  2RGV A;  4EJW A;  2CWE A;  3LQQ A;  3U2R A;  4A0X A;  1L3L A;  2X1C A;  3BPV A;  2NVT J;  3BJO A;  2KMU A;  3IWZ A;  2HDC A;  1HST A;  2BVL A;  3DTE A;  2CV0 A;  2E2I J;  1Z91 A;  1MBG A;  1JHF A;  1KU2 A;  4BHP A;  3CC7 I;  5LHG A;  3LFU A;  1KU3 A;  3MVP A;  5JHF A;  1MW7 A;  4IZZ A;  3I3L A;  2OJE D;  1KON A;  3BZK A;  1X3Z B;  1FP1 D;  3OOP A;  4RB3 C;  3F22 A;  2W1O A;  4E7L A;  2Z99 A;  2EA2 A;  3BQZ A;  1NK3 P;  2LF8 A;  4LOC A;  3FDY A;  1TW2 A;  2DYS H;  2O9L A;  1KZH A;  3H3V K;  1FSE A;  1Y0U A;  5D6F A;  5M3F J;  2RC4 A;  4PFO A;  4WXH A;  5E1X A;  2E1M B;  3ELK A;  3W3C A;  1A31 A;  2PG4 A;  2GXB A;  2LSO A;  2M45 A;  2E36 A;  2GOX B; 
#chains in the Genus database with same CATH homology
 2L9V A;  1UZC A;  2LKS A;  2DOD A;  2B7E A;  2JUC A;  2KFD A;  2CQN A;  2DOF A;  2E71 A;  2KIS A;  2KZG A;  4FQG A;  2K85 A;  2DOE A;  2KIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...