4FQGA

Crystal structure of the tcerg1 ff4-6 tandem repeat domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
186
Chain Sequence
SHMKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific Interaction of the Transcription Elongation Regulator TCERG1 with RNA Polymerase II Requires Simultaneous Phosphorylation at Ser2, Ser5, and Ser7 within the Carboxyl-terminal Domain Repeat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcription elongation regulator 1
total genus 72
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA03
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA01
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA02
2CQNA 2KZGA 2B7EA 4FQGA 2E71A 2DOFA 2KIQA 2KISA 2DOEA 2K85A 1UZCA 2DODA 2KFDA 2LKSA 2JUCA 2L9VA
chains in the Genus database with same CATH superfamily
2KDOA 1VQPI 3ZCOA 1T2KA 3ZMUA 1HKTA 2PJRB 1J2XA 1D0XA 2MG4A 2LFBA 3LOCA 2CUZA 5DCFA 4B48A 2O8XA 2KDZA 4M73A 2L0KA 4BACA 1T33A 2TDXA 2VT2A 2QSHX 2JUCA 3PO2J 1X1CA 2K3PA 3RQIA 3JRIA 5D5UB 4MEYF 3OSGA 1MIJA 3HL2A 4LB5A 3BTCA 2CV2A 4QIWN 2HGCA 1XCBA 2LYCA 1IV6A 4IRGA 2CU7A 5J4YA 1X2MA 3WTSC 3GTGJ 1HKSA 3DWLE 1X1PA 3I4NJ 4P5OA 5TGTA 3RYRA 3GYHX 5JLXA 3JRDA 1P6RA 4GYGA 2E60A 4ZDPA 1XG1A 4XKWA 2YU3A 2QQ8A 1IN7A 3HRMA 4BEHB 3COAC 2OC6A 1J0RA 2RKHA 1X1DA 2M0MA 1SVMA 1FC3A 1V5GA 4U87A 3GFMA 5HDKA 1SANA 3IC7A 1F36A 3Q9SA 1R23A 3EYYA 5DM6F 1D1CA 2JRTA 1IDZA 3VSKA 4RM3A 4ZYDA 1VF9A 4F52A 3RIRA 2PMHA 4KJZA 4RB0A 2QEXI 3ZMSA 3JR9A 3MZ8A 1HCRA 2DFIA 2HXIA 4BHCA 4A3FJ 2DMQA 3TOBA 2JA2A 4HRIA 1WI3A 5H20A 1TQPA 3J7AO 2FE3A 3ISPA 1G59A 4B44A 2ISYA 3OR1C 3QODA 4L5IA 5LEKA 3C1DA 2R5ZB 2JRMA 1W5SA 5HLGA 1WGXA 2EFWA 1P92A 1IZ1A 3CCVI 1QHHD 2M4KA 3BZKA 4FE7A 3HEFA 1IF1A 1GVDA 4MEXF 3KZYA 5GPAA 3S1RJ 2DOEA 1PJRA 1P9QC 5FJ8J 5L3BA 1Y8RB 1UG0A 3IAS2 3K69A 3K4MA 1BBYA 4DBRA 1RRJA 1HOMA 2DMNA 2CUEA 1R6RA 4BKXA 2MBFA 4D5FA 1MGTA 3DTIA 1V54H 2X1CA 3IH3A 2GOMA 4IL6C 3PNTA 4C3JJ 4BEHA 4CCMA 5IYBJ 5IOYA 1ZG3A 1YW7A 2PMZA 2ZMEC 4BQQA 4D0PA 1FEXA 3Q0WA 1HSTA 1X4OA 3FDYA 2G0EA 4C30A 2KRCA 3O2PE 3MCZA 4A3BJ 2B9SA 4PCQA 1JGGA 3O6BB 4E7ZA 2IXSA 2EB7A 4D1QA 1ZGWA 1D8KA 1H9GA 4A0ZA 2PJPA 2NOJB 4C9YA 4RGRA 4BQOA 4Z6YA 2HXOA 4LLLA 4ZJZA 4M6YA 4Y13A 3DKWA 4XN0A 1R00A 2A05A 4RAGA 2X6WA 4XOPA 1I1GA 1IDYA 2QCOA 2ZJ2A 1X3ZB 3WTVC 3WTXC 3VYSB 5CJ9A 2LNBA 5DD4A 2JN6A 4OAZA 4UUSB 1B8IA 4XICA 1MDMB 2X0LA 2QM3A 2KPMA 4HV6A 1SFXA 2M3AA 3QOEA 3IRRA 4UVBA 1GXPA 2H8RA 2EA2A 1FOWA 2IA0A 5JR3A 2AXTC 2Y0SN 2CQXA 4DGWB 1D1AA 3CCRI 3D0SA 2L9VA 4L5JA 3DQVC 1ON1A 2HDCA 1WJCA 3S3NA 2BXYA 4E7HA 3MVPA 4XORA 2ZB9A 3TP0A 4F3QA 3SHFA 5TISC 1VQ6I 4MFDA 4M74A 5HS7A 3KFWX 3TO7A 2A07F 3R60A 5FRNA 2R3SA 5C4XJ 1IN5A 2VC0A 3DPUA 2FMLA 2DOAA 2ID3A 1ETQA 3GW2A 3KZZA 4QTRA 1ETXA 2I10A 2IA2A 3QP6A 3CO7C 2PLYA 4ZYEA 4BDYA 3KZIC 4JP0A 4CA0A 3PIPF 1U5TB 1SD6A 5K7HA 3K9TA 3M8FA 1WSUA 1T38A 2DU9A 1X2NA 3PUFA 4A3JJ 2CWEA 2R7SA 5EZHA 4R8HA 1GDTA 2ZCWA 1LB2A 3UNGC 5JHFA 3CDHA 3IHUA 2XSJC 3G71I 2QBYB 1O7LA 5M5XJ 4XLPF 2Y2ZA 3FMSA 4OU0A 3A03A 2QBYA 2ZJPF 2HYFA 5FKLA 3I54A 3JW4A 1D0YA 4RMNA 1P2FA 2DW4A 3BR1A 4DBQA 2GAUA 3RKXA 4BXUA 2DDAA 1MJ9A 2VJJA 3BPXA 4UUTA 2XKPA 4BXFA 4BH9A 4A69C 3HRSA 4CXFA 2E1MB 3AG4H 3RKQA 1RZ4A 3LSTA 2FX0A 1Z21A 1XMXA 1ZREA 5M5WJ 2DFFA 5A2QK 4I7HA 3UKGA 2QVOA 3S16J 1T56A 4MTEA 3C3WA 4BGDA 3K10A 1R5ID 4HG2A 1UB9A 2V1XA 3LNQA 2R7TA 5GPCA 1K78B 2IGNA 3R6SA 3H9GA 2LKSA 4G6QA 4OIRF 4HX8A 2GOXB 4A3EJ 4BU2A 1WPKA 4BE2A 3V7RA 3LSPA 2LP0A 3CUOA 1M1EB 1N78A 5ED4A 3BTJA 2YX4A 1R58A 2ACJA 2OV7A 3I5UA 1MBJA 5HS8A 3A4CA 3FXKA 2AXLA 1MSFC 5D6EA 3G1LA 3LSGA 4XR6A 3GZ6A 1SFOJ 1TP4A 1BW6A 5M3FJ 4KA4A 1PP7U 1RESA 1YI2I 4O5VA 3VFZA 1OLTA 4CCOA 3BR2A 2VKVA 1EV7A 2VN2A 3AFHA 4RGXA 1IN6A 2XROA 2Z16A 2GXBA 1IRZA 3KX2A 1J5YA 1V5FA 2IP2A 1U8RA 5E3MA 2IT0A 4BBSJ 1XGNA 3TMOA 4ZYGA 3HBLA 2DA5A 2BHYA 3P9IA 3HYIA 2FU4A 4E70A 3LAJA 3CCJI 5FLMJ 4CZCA 2W57A 2DLLA 2DO7A 2A69F 1K6YA 2G9WA 3OWTA 3FBIB 5ILVA 2LY1A 3FK7A 4A3IJ 3HKZA 2OJED 1G3YA 2XGDA 1W36C 1LJ9A 4B47A 2K5CA 3K4KA 1YE9A 1OJLA 1ETYA 5JI6A 3KIOA 2H6BA 3JSOA 2X48A 3PNVA 3V8KA 2EZKA 2OZ6A 5IT9K 3BG5A 1JTYA 2M8GX 3HTSB 5J3LA 1XS9A 2DFHA 2DA1A 2K85A 2MW8A 2F5VA 2FJ1A 3QPSA 2FBHA 3DLAA 1ETOA 3KPHA 5DUIA 1N77A 5HNFA 1O4XA 4IHSA 1BJAA 3LSMA 3S32A 3ZQIA 2RNJA 2UV1A 5HVQC 3FXUA 2WBMA 3E5UA 1MMNA 2DA2A 2HKXA 1OCPA 5F0HA 2W00A 2MFZA 3GTLJ 5EJCA 2QENA 1JUPA 1OQYA 4DZPA 1FYLA 5LGTA 3PL8A 3KP4A 5BNGA 2HDWA 4AYBA 3HHGA 1YRNA 4BL0B 1I6HJ 4CGZA 2LD5A 2CQKA 4XLCA 4HDUA 2XASA 2H94A 5M3MJ 3QYEA 1DPRA 4P9UA 3DTEA 2DFEA 5E3NA 5E17F 1KZHA 3BTIA 4E4HA 1G4DA 2EZHA 1YYVA 1EA3A 2DDBA 2NVUB 4YFNF 2XPWA 3H3VK 2PJRA 1XSDA 2NS8A 2LF7A 3EDPA 1ZGAA 1ETVA 2HU9A 3KCCA 3G4SI 2M87A 2E1NA 1JXSA 3ZN1A 2R93J 1OR7C 4HSRA 2NVXJ 4BY1J 2F48A 2RVCA 2FQ3A 2VE8A 2P6SA 4HF1A 2B7EA 2F6CA 3OV8A 3GLLA 3S3MA 3HXLA 4ITVA 1F5TA 2N8GA 3BG3A 1JKOC 1T39A 4HPQA 2M7AA 1QPMA 3L9FA 1BC7C 2X9DA 2MC4A 2K02A 3QP5A 4ASNA 3QPHA 4FASD 2BVLA 2RREA 3DP7A 3OYDA 1V3FA 1JHHA 1I3AA 2Z5UA 2E34A 1R71A 4A5NA 4UVCA 1BA5A 4Q48A 3ZMTA 2DPDA 1TTYA 1RKWA 2DA7A 2XIGA 1W7PB 3OR2C 2VBXA 2VODA 2WADA 1UJ8A 1DU6A 1AA7A 1BIAA 4A5MA 4RA2A 1STZA 1YQAA 4F91B 4A3MJ 5FFZA 2E1MC 3OYJA 4HX4A 1SVOA 3BG7A 1H8AC 1K6OA 1NG7A 1XC5A 1TL8A 1IRFA 1W0UA 3JRHA 4ZH4F 4H0EA 5EEGA 1J59A 4XLNF 3A2KA 2EWNA 1T98A 2EJRA 5KAFC 4GFBA 5H6RA 2VOPA 1H88C 4CYCB 1GLNA 2XAGA 1J75A 1BOAA 1IN8A 3IH4A 2X6XA 4ENJA 2LSOA 3X2QH 2E5ZA 4IO9F 5FLXZ 2LOOA 2KL4A 3BR6A 3O3KA 5K7ZA 2V26A 5FGMA 4EMSA 3HB9A 5K7FA 3ECHA 1ZHFA 2IS1A 4KT6A 2LRDA 2COBA 2VJ4A 3J7YJ 1POGA 4M3GA 1BI2A 2LK2A 2L02A 3H1CA 1FP1D 2MD0A 1HQCA 2IAIA 4V2FA 3R0JA 2WY8Q 5E3LA 4AWXB 1FSEA 3S2WA 3L2CA 3E6DA 4NC7A 2L01A 2HEOA 4WX9A 4IRIA 1LNWA 1GXQA 1S8NA 2ECCA 4U7DA 2OCEA 2LF8A 1R49A 2JSPA 2QQAA 1GV2A 4IXAA 4HSTA 2F5FA 4V2GA 3Q9VA 4CDGA 1WQ2A 5F0CA 4L0YB 3EPZA 3Q0UA 4PDKA 3J81Z 2AHQA 3OL3A 1KONA 5EG0A 3JRFA 2P8TA 2XF7A 2XGXA 3ZXSA 4UUVA 5F04A 3V7CA 3GFLA 4PJMA 3MQ0A 3T0YA 2OZUA 3BR5A 4R79A 1KU3A 2E7WA 1K61A 3JRBA 1ENHA 2Q1ZB 3MWMA 4PGHA 3V4GA 1OCZH 4AU7A 2XF5A 3FXLA 1LE8B 1FSHA 1VFCA 4XK4A 4EJOA 1DGWY 2GIZA 1WKMA 3GZNB 1P7IA 4JK1X 2CW0F 2KT0A 3K4CA 1FOXA 1XDUA 3IL2A 2V79A 1SVLA 2W84A 3S14J 4AIJA 2WC2A 4NC6A 1S72I 3I71A 3H5RA 1K78A 2Q2EA 3BR3A 1LVKA 5BPDA 1Z3XA 2ICWG 4N0BA 4FISA 4HAMA 4ZYAA 4E7LA 2ZBKA 2BGCA 3GTJJ 1Z91A 5IP9J 3L2UA 4ABZA 2JA6J 3TW7A 1YITI 4PK4A 2GXAA 3U2RA 2ZNYA 2F5EA 2EZLA 4QLCU 1HA8A 4C2MJ 3M1CA 4B4CA 2K27A 2KISA 2VJIA 5HLIA 4UHTA 2FXAA 1NTCA 5E8IA 2RQQA 4CZZA 2CSOA 2ZJRF 2M4GA 3KP6A 1USTA 2Q0OA 3FXRA 2H1LA 5AIQA 4JQFA 3JRAA 5JFRA 1FY7A 1XX5A 4PJLA 3LSRA 1JKPC 3TBIA 4M3DA 4A3DJ 4XMYA 2XDVA 2VBZA 3VYUB 1WH7A 1LE8A 4MLOA 2OCCH 5ICGA 1TWGJ 4PZJA 2CG4A 1QVTA 4ZTFA 1XSXA 1EJ9A 3P9KA 5FLXK 3I0TA 1MH4A 3ULQB 2K9NA 3FXQA 4NHJA 3RPUA 1P7JA 3SYTA 3K2AA 3HC7A 4K2EA 1CGPA 3MZHA 3ECOA 2JUGA 1MNEA 1UZCA 3OL4A 3CCUI 1DU0A 2STTA 2XRNA 3SJMA 2IGKA 2HVQA 2Z99A 4MFEA 4U0YA 2VQHA 2FA5A 2CQNA 2K9LA 1IUFA 3R61A 3W6JB 2KIUA 5FLVA 3EQLF 3NAUA 1W5TA 4P1WA 2DODA 4X0GA 3MD2A 2Y0MA 3H9JA 5K1YA 1UFMA 1U5TC 3R4KA 1TLHB 4FTHA 2HVSA 2P4WA 1Y0NA 3A0BC 5EYRA 3QAHA 2E2HJ 2ADUA 4KIGA 3BWGA 1IUYA 2YS9A 5IT3A 3FX3A 1MBHA 3P5JA 4PSWA 5CVJA 2P5LC 4G7ZF 1MDMA 4AIDA 4G7HF 3FZVA 2WY7Q 3WODF 3BROA 2VC1A 5BMZA 1V55H 5E1ZB 3H5NA 5KVRA 3HGYA 2HOTA 4KISA 1B1BA 2R7QA 2W24A 1FLIA 4Y17A 4YRVA 2IRFG 2LREA 2L5QA 3JCUC 1VI0A 3J7AY 5FD6A 5D4RA 5FB2A 3H0DA 5HODA 4LIUA 4DOZA 3I59A 1H89C 3SEQA 3TEDA 4I98B 2R7DA 5FO5A 2EFQA 3BQZA 1ZRCA 2O61A 4HLXA 2HOEA 4A3GJ 4LG0B 1IV8A 1SD7A 3GX4X 4M72A 3ZRGA 1BOBA 4A3KJ 4CHUA 1B9NA 2O03A 1A6IA 5L3CA 2H27A 5F1RA 4RAYA 4E7KA 2M30A 4D7MA 3ABTA 5EZGA 3TQNA 2ZNZA 2ELHA 1U9NA 1QA6A 4EGZA 2I8DA 1VQNI 5J1YA 2ME0A 1G2HA 1MW7A 6PAXA 5LD2C 3KYDB 2VPLA 3CC4I 2HQRA 2XPUA 1TT0A 3H3ZA 4UV9A 4GO1A 1ODDA 2R7XA 2TCTA 2GBYA 4DYCA 4XLHA 4D9JA 1XTAA 4UUSA 3SZPA 4RLQA 1WHUA 3JREA 3IUOA 3B73A 3CO6C 4C3HJ 2VLAA 1OCRH 2LKPA 3OIPA 4HNVA 2Y69H 3GCMA 4JYKA 3RCOA 2EIJH 1LFPA 2QQ9A 3S2HJ 4J19A 3S8PA 3FKIJ 3JRGA 1EF4A 4BY7J 4J01A 2IS4A 2JTVA 5HNHA 2JPCA 1YJ9I 5DS9A 2QSGX 3K4NA 3HGGA 3H92A 4IRHA 1MBFA 4MIMA 2NXNB 1NHAA 1IXSB 2VT3A 4G9YA 4LJZF 1VQMI 3W2WA 1KQ0A 1IG7A 2A61A 3CJRB 4LK0F 4D7NA 3ZQHA 2FSWA 1TNTA 2FBIA 3M07A 5D4SA 5EGOA 3J81K 2LH9A 3LWFA 3QOPA 3IV5A 4ENMA 1FBQA 2I5UA 1LEBA 2FUG2 5ICEA 1WJFA 4YELA 3HRTA 4Q5SF 1BR2A 2Y30A 4WK8F 5GP9A 5HS9A 4DJAA 2XF6A 3I64A 3FBNB 4G6DA 1MNMC 2GLOA 4M3BA 2IA1A 2O9LA 2A5WA 2QLZA 5F0FA 2P5KA 3S17J 2F4OB 2EV5A 2M9HA 4X6AJ 1T0FC 2KJCA 1CQTA 2QQBA 3HRUA 2PI0A 1TWAJ 3PUBA 4ZZLA 3CP2A 2WB1N 2X6YA 1LDJA 1Y39A 4IQJA 3WG9A 1ITYA 2VQLA 4FETA 5TJJA 3ZMZA 3HSEA 3F8NA 1V5EA 2JSCA 4LMYA 2DA6A 3ZQGA 2NAZA 1W7PA 3Q0VA 1X4PA 2VKEA 2R4GA 3IH2A 1C0WA 1IAWA 3PO3J 3HOWJ 4V19K 4KICA 4D5CA 1LFBA 1FWZA 4G8XA 4NQWA 4XRMA 2DXIA 5D6FA 1G3WA 3I4MJ 2X4HA 1AOYA 2NS0A 3PSIA 2FF4A 4CH7A 3CC7I 3KLNA 3L2WA 4I99C 3L00A 3BJAA 5IYCJ 2JA7J 3ML6A 2IS2A 2D45A 4CYCA 4TV7A 1HBXG 4E7IA 1T08B 4IVNA 4HYEA 3C7JA 3LQRA 3JRCA 5L3FA 1TWHJ 3BP8A 2XSDC 1RPWA 4KFCA 1UG2A 3FWEA 3QU3A 3C2BA 3HG9A 2F4IA 2K86A 4CCKA 2F5DA 4F93B 5BOXA 2ZXIA 3ONQA 2DT7B 2CS3A 1IN4A 2EZIA 3VEPA 3LQQA 4M9XA 3SDBA 1QPIA 3GMEA 3K1PA 4AVPA 1CF7B 2OA4A 4BJTA 1SEUA 1ETWA 1YRNB 4MHGA 2HDDA 3D5RC 3CUQA 2MLKA 3OYIA 1A5JA 1EH6A 4HF2A 3HIFA 1VQ4I 2LKXA 3C2HA 5EDNA 2M7BA 1XPXA 3DEEA 5JHUA 1P4WA 3F6OA 2QF7A 4HOBA 2VE9A 2R5YB 3VOEA 5FRMA 2VKHA 3QQAA 3GTPJ 3OIOA 4CSWA 5LLQA 3G73A 2GA1A 4L9JA 5E20A 2R7OA 5EG0B 1USSA 4JX4A 1QNTA 4LG0A 5GAHJ 2JVGA 1DP3A 3JTGA 4KNYA 3GZ5A 2FOKA 2ME6A 2M1BA 1LDDA 2Z2SB 4PUSA 2OQRA 4XRSA 3KLOA 1IXRC 2XVCA 5ICCA 3LL7A 2PMUA 2HPIA 4S04A 4MO7A 1U78A 2DJNA 3JTHA 1FZPB 1J09A 4IX7A 2L4MA 3CF5F 1PUFA 2EK5A 2XGCA 5CQGA 4KMFA 2KKOA 5TRDA 1LQ1A 4HZFA 2E2IJ 2IEKA 4L9NA 1YOVB 3L7WA 2Z33A 3OY9A 1LUJB 4L5EA 5IT9Z 4YIFA 1ZLKA 3HUGB 1E0EA 2Y9YA 4NBQA 3E5QA 3HUGA 1OYYA 2KMUA 2YPRA 3RQ4A 1FBUA 2FD5A 3H0GJ 4JOMA 3F21A 2IS6A 2DT6A 4FE4A 5DEQA 2CYYA 3RPUD 3MKWB 2XRLA 1I50J 4BUPA 4ENNA 2V1UA 4NUBA 1JUMA 3G2BA 1FYKA 1FMWA 3DPLC 1TW2A 4LITA 3E1SA 1BI3A 2O5RA 1HF0A 4A6EA 3F3XA 4U0VA 3PNYA 1Z6RA 2W48A 3KP7A 3RKYA 3CJTB 1OCOH 4HV5A 2J5PA 2RC4A 3BPVA 3E3VA 3NARA 4JBAA 5D8KB 2E35A 4AD9A 2B0LA 3GUDA 2BHZA 1X3WB 2H6CA 4HX7A 3TOAA 4N4NB 1MNDA 3PIOF 1A35A 1ZH5A 2EILH 3TKYA 2K9QA 2XAUA 2BZTA 2Z1DA 4EGYA 1YLFA 3GBGA 3E6CC 5CVUA 2FEZA 1HC8A 3PFYA 3GFIA 3I3LA 5ICFA 1UHSA 1MJAA 1V4RA 3TP3A 4BHBA 2Z9OA 4HQEA 3WTZA 2L7KA 3A1YA 3RKWA 2HOAA 2K9SA 2L9NA 1EKEA 4OIPF 3IWFA 5KHDA 3IAM2 1H9TA 4R1HA 2DA3A 2M45A 1K79A 1R4MB 3KEOA 4QPOA 4QWQA 1AU7A 3LA7A 1U9OA 1A6QA 2D2WA 1R5GA 1BIBA 1JUSA 5IOZA 4H4KC 4M9SA 5LRSA 1P4AA 2CGPA 3M8EA 5B66C 4OIQF 2PG4A 2PMZN 3KEYA 5H2FC 5GADJ 2CV0A 2VBWA 2J5OA 2LG4A 1X19A 2B63J 1JT0A 1XD7A 1XSVA 1BR4A 3FXOA 4IJAA 1T6SA 3ABKH 2MABA 3K0LA 5LHGA 1D3YA 1O57A 2PEXA 1O3TA 1XGMA 3C2GA 4CCNA 1NG6A 1ZRFA 2ZO4A 4P96A 1UMQA 3RI4A 1OR7A 4XLFA 2K4BA 2Y9ZA 3T5XA 3A01A 3OYNA 2HFHA 2WV0A 1K4SA 2RQPA 1FTZA 2P0WA 3TDUC 2E2JJ 3W6VA 1HW2A 2HR3A 3OYHA 2HQ5A 3S1QJ 3I55I 2LVSA 3HOSA 2M34A 4A3CJ 3IRQA 2EPFA 1HSJA 5GAGJ 2QGUA 2Q2EB 3PSFA 3RPQA 2RV8A 1WZ2A 3GEZA 2W4SA 4Y3OA 2HZTA 1HDPA 2JK3A 1XN7A 2ESNA 2BY0A 4RAFA 1UHWA 2EINH 2WB1A 1Z9CA 1X3UA 3CF2A 3CUQB 1BW5A 1TC3C 1F43A 4ESFA 1E17A 5FROA 5F6FA 4CCJA 3E6BA 4OOIA 3FM5A 2STWA 2FNPA 2CUFA 2KP6A 4XLAA 1WWXA 1D5YA 5M5YJ 1WH5A 3K7AJ 4HF0A 3REOA 4ANJA 2KLOA 3G3ZA 1FYMA 5J6XA 3MKYB 3WTYC 2ELKA 5DCMA 1DP7P 1D5VA 3FKJA 1BR1A 3AKZA 1LFUP 1OPCA 4II3A 2WAQA 2HYJA 1W1WE 1NK3P 3VPRA 3WE3A 3CCSI 1UAAA 2FBKA 4FHTA 1TNSA 2V1DA 1Y1VJ 4GDFA 1PUFB 1TT5B 1F1ZA 1ZLJA 3MKLA 1B59A 4AM3A 5IP6A 5CLSA 1HLVA 4B8XA 2W85A 5ILSA 2O0YA 3IWZA 2GZWA 3WE2A 3WGIA 4RLFA 3ROUA 4HNTA 3F8MA 2BBYA 1VQKI 3ERMA 3FHZA 4Y52J 1MMAA 4RM2A 1ZKGA 3WGGA 4OMYA 5C3EJ 2FMYA 3KYCB 1ZN2A 4BNCA 5B3SH 1RR8C 2OQGA 1P4XA 1I39A 2JWTA 3HSRA 4BBRJ 2JT1A 1Z1DA 3CLOA 5L3EA 2QYOA 2MSYA 1SFKA 3H35A 1IRXA 3OYBA 3GTOJ 3K1MA 1FX7A 2NVYJ 1G3SA 1GT0C 3GTKJ 3J7ZI 3IKTA 5BPIA 2JZYA 4BXXJ 1EH7A 2OD5A 1JI8A 1XB4A 5HLTA 3G1MA 3OIQA 3PQKA 3F9KA 3DXJF 4L9VA 4OMZA 3U21A 3KETA 2UWMA 2R0QC 4LOCA 3LFKA 2VBYA 3OOPA 4HA8A 4W97A 2GM4A 3M3YJ 2JMWA 1WCMJ 2IVMA 1ORKA 1YJNI 1RC9A 2DTRA 3ZQ7A 1DDNA 3F22A 1OFCX 4CYDA 1JTXA 3IKVA 1E3HA 2HWVA 1WVRA 2DBBA 3I53A 3GWZA 3KEQA 2HTJA 4NNJA 1PP8F 4PJJA 4LB6B 1LEAA 2RDPA 3EUHC 4NB5A 5D8LB 5LHIA 4S05A 4PSXA 4ESJA 4RS8A 3V8JA 4MQVA 5J47A 3U9GA 5HDGA 1A04A 1R36A 3LSHA 3VYRB 4EJVA 3K70C 1S7OA 1N75A 2LC2A 2NS7A 2A68F 2M2EA 3LAPA 4A12A 1J7KA 4S0HB 3E6MA 3OYGA 1JGSA 4I09A 2UUZA 3CCLI 2L3DA 2ZFUA 4NQWB 2YU9J 2BY2A 1BN5A 4HBLA 3OS1A 3HKZN 3ZQQA 2EV0A 1YW8A 3SQNA 1Y1WJ 2DPUA 3SDGA 2OUMA 5EEHA 1QHGA 4IZZA 4I0AA 2DMUA 4YIIA 5IYDJ 1F9NA 2DMTA 2CO5A 4KN7X 4KITB 1BC8C 2HI3A 2ZXWH 4XIDA 3BOQA 2VKDA 4RB2C 5J8CA 2MD5A 2NYXA 1Y56A 5IP7J 4ENKA 4N9IA 1VTNC 1PYVA 1YW9A 4M3EA 3DTKA 2MH9A 1G6NA 1R5HA 2BV6A 3F8FA 3EUAA 5AONA 5D5WB 3H9QA 4MTDA 4OWRB 1XDSA 2EFPA 1T0FA 1XMAA 2L4AA 5HLHA 4OIOF 2GXGA 3L2VA 3HM5A 2IPQX 5CYVA 2X1DA 3TO9A 2XUBA 3OYEA 3K4LA 5E3OA 1Z7UA 3CCYA 3BC8A 1YX5A 4IOAF 3EUKL 3ZPLA 2O8KA 3M7GA 2VASA 2L2OA 3CZ6A 5DV5A 3MKZA 2V7FA 4IPAA 1QU3A 3GO5A 3CCMI 3TL4X 5J1UA 2E1CA 2LBFA 1W5CC 4A0XA 5EGOB 2OU2A 2Y0SA 3WU1B 4G12A 4UY8I 2L7ZA 3E0JB 5E79C 1B8IB 2IJLA 4B43A 2QSFX 3QYBA 1S9HA 1YO5C 3P9CA 5DM7F 4Q47A 2ZJQF 3CP8A 3U1KA 3AG2H 2CJJA 4HEA2 2JQ7A 2VJ5A 3I58A 3WTUC 1NK2P 1K83J 2WA0A 1QVUA 1Y8QB 2LTPA 3HOVJ 4GYIA 3NQOA 2YR2A 1KU7A 2V9VA 1LPQA 1A31A 5F27A 3L2QA 4LLGF 2XAJA 1K7AA 1MH3A 3GTQJ 2R7UA 3N97A 5CVIA 4XKBA 5FKMA 1E3PA 1R1VA 2OTJI 2QKMB 4OINF 2OBPA 4KMUX 3GTMJ 2XHKA 4M71A 3S1NJ 1U3EM 5C44J 3KYLA 3LSKA 2P81A 1Z05A 2ZFWA 3GF2A 2UZKA 3FIWA 3VB2A 3CQZJ 4ZZDA 4Y15A 4PJ0C 3HSFA 1J9IA 1OCTC 2HYGD 2LMDA 4P9FA 1GUUA 1W7PD 1I3QJ 1MMSA 5LFAA 3ZP5A 1Z6TA 2R7VA 4DYQA 2COMA 4M3FA 1WJEA 2HTSA 3FK6A 1U6GA 5LHHA 2XC7A 3M4OJ 3KP3A 3DEWA 5GAEJ 3SFIA 2Q8KA 1PVEA 2KRFA 2HNHA 3F8CA 2DYRH 3DF8A 3L09A 2MYSA 1D1BA 1YG2A 3QYFA 3DU6A 5B1BH 4XNFA 2NOGA 3EUHA 3WTWC 1U8BA 4YFKF 1F4KA 1HW1A 3MN2A 3OSFA 3H3UA 1FTTA 2R92J 4EJWA 5LGUA 4I2OA 1GHCA 1S3JA 1ACIA 1SD5A 2RNGA 2K40A 2AQFA 4IHWA 3S2DJ 4WXHA 3V7SA 4AIHA 1ZQ3P 1MBKA 4I76A 2V6EA 3QPLA 3V42A 1QZEA 2ZSIB 1RKTA 2YUSA 4ZC3A 1ZG5A 4P55A 2PFBA 4M6XA 2BXZA 2EFNA 3TGNA 1YIJI 3Q5FA 5EF6A 2M5WA 3K6GA 3OYLA 1S29A 3M1EA 2QA4I 1S7AA 1T95A 2CFXA 1B4AA 4U7BA 2CW8A 3RJPA 3O8GA 2D1VA 3PM1A 2CQ7A 3N05A 2DI3A 2RAEA 1ERDA 2A6EF 4GGGA 3FXJA 2EIMH 3PQJA 3J80K 2UXNA 1OYWA 1BI1A 1TWCJ 4EEFG 4HNUA 3MAJA 4UXNA 2LY2A 3J80Z 4FX4A 1TWFJ 2DK5A 1ZELA 4YG2F 3EETA 4EJUA 4LG3A 5BS6A 2BVMA 4IHYA 2DA4A 5H6QA 1SAUA 4Q4ZF 2X6OA 1Z67A 4U0WA 3DEUA 1UHMA 1WRJA 3CJQB 5LBQA 2HZDA 3ABMH 1U0JA 3FMRA 3K2ZA 2Y31A 2DK8A 1WI9A 3ZQLA 1SMYF 2XB0X 1VNDA 3DBRB 2P7CB 1OMIA 1QRYA 3ABLH 3A02A 2ISZA 2X1EA 3HOUJ 3RYPA 1REPC 4YEJA 3DBHB 3BTLA 3KP2A 5LEJA 2NNNA 2BYVE 4RAZA 3AL0C 2WAQN 4NC8A 3ERED 1L3LA 1IXCA 1DPUA 5IY5H 2E19A 2R5YA 5J4VA 3HJEA 1GVJA 3V8LA 1ZR4A 1FNNA 2XAQA 1YS6A 2DOFA 2LR8A 1D8JA 2DTZA 5F08A 3CCQI 2BY1A 2L9RA 1MMGA 4EM1A 4RBOA 1YTYA 4AYBN 1TW3A 2OPTA 5KCMA 3ZQFA 2VONA 4RDUA 2A6TA 1ZRDA 1YJWI 2O6GE 5K5OA 3FM3A 2KZGA 3T1BA 4ZDLA 3CUQC 1L0OC 3U1DA 2DT5A 1B6AA 2E7XA 3WU2C 2PBIA 3W3CA 3F6VA 4XSZF 1I6XA 2HPMA 4F92B 2IW5A 5JVTA 4OAYA 2K9MA 2QUFA 2WAFA 4KUMA 4XL9A 2D1HA 4B3AA 2JA8J 3NWSA 4PFOA 1QGPA 2HOSA 3VYTB 3VSLA 3P7NA 1E2XA 3B02A 1APLC 2LLKA 3IP4B 5J1RA 4KIBA 3W2VA 2NVTJ 4IHTA 2NNYA 4I02A 2C6YA 4UB8C 4YFXF 5J8FA 1MZBA 3D5LA 2EH3A 3NWTA 3JAMK 4MGRA 3N4MA 5CVRA 4L9TA 1SD4A 1KU2A 4A93J 1LVAA 1FOKA 2H09A 1QZYA 1XCVA 4GXOA 4BHPA 3KP5A 4AC0A 3F0CA 2ETHA 1IW7F 2IGMA 4UVAA 4YIRX 1ON2A 1Z0XA 4RGSA 3R0AA 2ZXJA 3WGHA 2HVRA 3CESA 2DAOA 3VDXA 1TQMA 2O7OA 4F55A 4B1RA 2ELJA 1VQLI 1UELB 1QBJA 5L3DA 1LKXA 2IBDA 1MD0A 2MGQA 4RGUA 4N9HA 3M8JA 3L2RA 2KQRA 4UNOA 4ZYHA 4M6VA 5FFXA 4KYWA 5IPAA 4KIFA 2VOOA 4XLEA 3CDIA 1SMTA 2DQLA 5CQEA 4A2UA 3ELKA 1ONVA 5GTIC 4ZTJA 3DCFA 2VIXA 3CLQA 4FT8A 4KT5C 5BQTA 2VQGA 4U88A 1JJ8C 2AO9A 2GWRA 2R5ZA 3GLXA 3OMYA 4EATA 1WJ5A 2E36A 3H36A 1JKQC 3I4PA 2XKOA 2ID6A 4JX6A 4E6KG 5CPRB 2VQCA 2EBIA 2W7NA 2VL8A 1TBXA 3FF5A 4CO8A 1R22A 2AS5F 3HOYJ 2XAHA 5FD5A 2R7ZJ 3VWBA 2H1KA 2WV1A 5E1XA 2TRTA 4CCLA 3F23A 1JT6A 3HPHA 5FKKA 2JVHA 2M8EA 1ZYRF 2HQNA 1AKHA 2W1OA 3HHHA 1D0ZA 4BQAA 4MNUA 4HQMA 2EV6A 2GIVA 1XGSA 2F4MB 4XBFA 3FISA 4QPQA 2JPBA 4I0BA 4EVIA 3BZCA 1W0TA 3OYFA 2F2EA 5K5RA 3A01B 2RGVA 3F72A 1S7EA 2P7VB 3DU5A 1HXDA 4BE0A 5DDGA 3HTUA 5GTHC 4IF4A 4XQFA 3OYAA 4L18B 2K4JA 4KN4X 3CDLA 9ANTA 2KIMA 5ERIA 4XKVA 4PFPA 2K7LA 4O3MA 1KGSA 1S5LC 1R7JA 1Q1HA 1VQ9I 4UB6C 4G7OF 1X1BA 3ZGKA 4XRSG 5HDNA 4NDLA 3SXYA 1U2WA 2FOWA 4ZDOA 3ABUA 2ZMEB 3MEXA 1NH3A 2MH2A 3OYMA 4XOTA 1Z77A 2EIKH 4DW6A 1O3QA 3TW6A 1OISA 3WHBA 4AUXA 2CH0A 4AIKA 3DPTA 3CMYA 1WJDA 3I9V2 2PQ8A 2BOLA 3LSIA 3CMEI 2EFOA 3QPTA 3ZOBA 4GCVA 4IHVA 3PFIA 4MQ9F 2KHMA 3AG3H 1JHFA 2Y48A 3NRVA 2KRHA 4LK1F 4HLYA 2MC3A 4DYRA 1A36A 2ZKZA 5D5XB 3WHCA 3WTTC 4BE1A 3K1NA 3PJRA 4RB3C 3UR3C 3CCEI 3CJNA 5J40A 1IC8A 4UV8A 5CVVA 1RI7A 4HDVA 3E5XA 3OOUA 3CC2I 1XGOA 1R4NB 2UXXA 1PUEE 2DYSH 2CRGA 4WWCA 3D1NI 1FOYA 1B72A 2XV4S 3O8HA 1IO2A 4XRFA 3DFGA 5JVGF 4KDPA 5LGNA 1LDKB 1B72B 4BS9A 1R1UA 5AIPA 4GRIA 3RDIA 4J00A 2ZMEA 2V1NA 2XPVA 3BCAA 1RUOA 2VB6A 3C18A 2QWWA 2EQRA 2FRHA 2G7UA 1FIAA 3I56I 1ZK8A 2A5YB 1MSEC 4DZJA 4O6JA 4XKCA 5F1JA 3HPGA 1ZGJA 2MLGA 5D5VB 4WCGA 1MBGA 1I27A 4PGGA 2AQEA 4B09A 4WXCA 4A6DA 3TDZC 3A0HC 5FKOA 4BQNA 1YX3A 1OCCH 2JA5J 5B5EC 2ESHA 1FMVA 1X58A 1YIOA 5JLWA 1WJAA 1HKQA 3T8RA 1BL0A 3OS2A 1FBSA 3HDDA 3W6KB 2VUMJ 1VQ8I 4I01A 4RB1A 1PDNC 3HOZJ 3K4BA 4JX5A 1ETKA 4BJ6C 4AVZA 5ILUA 3KE2A 2XGEA 3SZGA 3SZTA 2CQQA 3VODA 3SFZA 3L1PA 3DLLF 4DQ2A 1GV5A 1VQOI 1XMKA 2OF7A 3ASNH 3AG1H 2LBFB 3NEUA 4Y7NJ 3JAMZ 2HQAA 1AHDP 4F7ZA 3EYIA 1KU9A 2Y75A 5FKNA 5DTDA 3CTAA 1O3SA 2X85A 4XM3A 1UCRA 1W36D 1S6LA 3FXMA 1H0MA 3WU0A 2P6TA 4BAYA 2JJ7A 2XAFA 2Z3YA 2CFOA 3LA3A 1FJLA 1Z7LA 1YFHA 2DJIA 1G3TA 3E97A 1VQ7I 4DIQA 2R7RA 2G7HA 3BY6A 3LSJA 3HOTA 1AKHB 5E1WA 4LLNA 1DGRM 4LIVA 2O3FA 5F64A 2GA2A 4L0ZB 3I59B 1RIOH 4N4OB 3BJ6A 5DD8A 4EV0A 1KQ9A 3BLYA 2FQ4A 1U5TA 2L7MP 3ASOH 4Z2YA 3K4JA 1EH8A 1HW5A 4C3IJ 5B1AH 3GFJA 3FHNA 1X1AA 3BG9A 3MZYA 2CV1A 3DKYA 4DNCA 1OYIA 4ETSA 1SC7A 3BJOA 2P5VA 2CW7A 5L3GA 2DQRA 4C2UA 1KYZA 1I5ZA 4BJ5C 1WJBA 2E5NA 3DKXA 4E7SA 3TO6A 2ZC2A 2BW3A 3T8TA 3AL0B 2LDUA 4EQQA 1HDDC 4B3XA 5K5QA 3FMQA 2V9PA 1DQUA 1MJBA 2EA4A 3ZMVA 2YX7A 1RUNA 3LMMA 2A6HF 2WTEA 5EEAA 1SAXA 3G1OA 2MA3A 2F5CA 4FX0A 1IJWC 1FIPA 3GVAA 1I1SA 2ZXHA 2BY3A 3Q3SA 2L54A 1JJ6C 4FCYA 3SEZA 3CD6I 1VZ0A 2V4JC 2VPRA 1K4TA 3S3OA 1TQIA 1ZARA 3BZ6A 5CKTA 3CMMA 3ESWB 2CMPA 2A3SA 4FQGA 1BM9A 1ZG1A 1KYWA 2HKOA 1FPQA 4CICA 3B6CA 3MFKA 3CMAI 3MMYB 2WWYA 2XB5A 3OS0A 3WG7H 4IKFA 4CUGA 2W25A 4ON0A 1O7FA 3DV8A 3BR0A 3RSNA 3OYCA 1QQIA 1BJZA 2FNAA 1Q1VA 2D5VA 2V9KA 3BT9A 1O3RA 3M9AA 3OYKA 2NRAC 3K70D 3S1MJ 3AAFA 5KK1A 4LFUA 2OTLI 3RZDJ 2KIQA 2BE5F 2CUJA 2DCEA 1QZZA 1ULYA 4BYYA 1ZAOA 3E7LA 4C2TA 1B9MA 2ECBA 1JKRC 5C4JJ 1IGNA 4A3LJ 2IGOA 2R7FA 3RZOJ 2BW3B 2H8WA 2E71A 2KFDA 3RTRA 2K3FA 1ZR2A 2YSRA 5HOOA 1VQ5I 1MBEA 2M0CA 2L7FP 3F8BA 5A2QZ 4EM2A 1Y0UA 4HW0A 3LFUA 2WAEA 3LA2A 1MKMA 2BEOA 2X51A 1N25A 5LRRA 1KA8A 3QU6A 1MMDA 4Y33A 2V6CA 2DMPA 4W1UA 4IOCF 4IQ4A 2W82A 2VXZA 3B6AA 2PX9A 4WXDA 1WFXA 3BDDA 4IEJA 3ZMDA 3QRFF 1SFEA 1FT9A 1TZLA 2KZVA 1YS7A 4A0YA 2ZSHB 1JE8A 3BCBA 1IRGA 1AWCA 3BG6A 1E3OC 3ZR8X 1DUXC 1W4MA 4XONA 4XSXF 1RR7A 4EJTA 2HS5A 1BI0A 3G6EI 4IHXA 2E1OA 5KAIC 1R9TJ 2DN0A 3HOXJ 2PN6A 3S15J 3GXOA 4LD5A 2KIFA 1Z3YA 4II2A 5DUKA 4X1EA 3HZJA 1OKRA 3ZN0A 2KJBA 3H5AA 5DCMB 4M9ZA 4Y4RA 2LY9A 2NVQJ 4G94A 1YHQI 1FP2A 1ZTRA 1QO0D 1T8IA 1RNLA 4E7JA 1G8XA 4QSHA 3S93A 5E18F 4ESBA 4G6TB 4PJNA 2GQQA 2VI6A 3JSPA 3QWLA 5KNLA 4I6ZA 1RETA 1CF7A 1KQ8A 3D5SC 2R7WA 1Y6IA 4LGWA 4EM0B 2L9SA 4XN3A 2RN7A 3W2AA 2QKLB 1R1TA 2VXDA 5DYMA 3DBLB 4WF2A 3BQYA 4BDZA 3ZQCA 5E8GA 2QZ8A 2OAZA 1SFUA
chains in the Genus database with same CATH topology
2CQNA 2KZGA 2B7EA 4FQGA 2E71A 2DOFA 2KIQA 2KISA 2DOEA 2K85A 1UZCA 2DODA 2KFDA 2LKSA 2JUCA 2L9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQN A;  2KZG A;  2B7E A;  4FQG A;  2E71 A;  2DOF A;  2KIQ A;  2KIS A;  2DOE A;  2K85 A;  1UZC A;  2DOD A;  2KFD A;  2LKS A;  2JUC A;  2L9V A; 
#chains in the Genus database with same CATH topology
 2KDO A;  1VQP I;  3ZCO A;  1T2K A;  3ZMU A;  1HKT A;  2PJR B;  1J2X A;  1D0X A;  2MG4 A;  2LFB A;  3LOC A;  2CUZ A;  5DCF A;  4B48 A;  2O8X A;  2KDZ A;  4M73 A;  2L0K A;  4BAC A;  1T33 A;  2TDX A;  2VT2 A;  2QSH X;  2JUC A;  3PO2 J;  1X1C A;  2K3P A;  3RQI A;  3JRI A;  5D5U B;  4MEY F;  3OSG A;  1MIJ A;  3HL2 A;  4LB5 A;  3BTC A;  2CV2 A;  4QIW N;  2HGC A;  1XCB A;  2LYC A;  1IV6 A;  4IRG A;  2CU7 A;  5J4Y A;  1X2M A;  3WTS C;  3GTG J;  1HKS A;  3DWL E;  1X1P A;  3I4N J;  4P5O A;  5TGT A;  3RYR A;  3GYH X;  5JLX A;  3JRD A;  1P6R A;  4GYG A;  2E60 A;  4ZDP A;  1XG1 A;  4XKW A;  2YU3 A;  2QQ8 A;  1IN7 A;  3HRM A;  4BEH B;  3COA C;  2OC6 A;  1J0R A;  2RKH A;  1X1D A;  2M0M A;  1SVM A;  1FC3 A;  1V5G A;  4U87 A;  3GFM A;  5HDK A;  1SAN A;  3IC7 A;  1F36 A;  3Q9S A;  1R23 A;  3EYY A;  5DM6 F;  1D1C A;  2JRT A;  1IDZ A;  3VSK A;  4RM3 A;  4ZYD A;  1VF9 A;  4F52 A;  3RIR A;  2PMH A;  4KJZ A;  4RB0 A;  2QEX I;  3ZMS A;  3JR9 A;  3MZ8 A;  1HCR A;  2DFI A;  2HXI A;  4BHC A;  4A3F J;  2DMQ A;  3TOB A;  2JA2 A;  4HRI A;  1WI3 A;  5H20 A;  1TQP A;  3J7A O;  2FE3 A;  3ISP A;  1G59 A;  4B44 A;  2ISY A;  3OR1 C;  3QOD A;  4L5I A;  5LEK A;  3C1D A;  2R5Z B;  2JRM A;  1W5S A;  5HLG A;  1WGX A;  2EFW A;  1P92 A;  1IZ1 A;  3CCV I;  1QHH D;  2M4K A;  3BZK A;  4FE7 A;  3HEF A;  1IF1 A;  1GVD A;  4MEX F;  3KZY A;  5GPA A;  3S1R J;  2DOE A;  1PJR A;  1P9Q C;  5FJ8 J;  5L3B A;  1Y8R B;  1UG0 A;  3IAS 2;  3K69 A;  3K4M A;  1BBY A;  4DBR A;  1RRJ A;  1HOM A;  2DMN A;  2CUE A;  1R6R A;  4BKX A;  2MBF A;  4D5F A;  1MGT A;  3DTI A;  1V54 H;  2X1C A;  3IH3 A;  2GOM A;  4IL6 C;  3PNT A;  4C3J J;  4BEH A;  4CCM A;  5IYB J;  5IOY A;  1ZG3 A;  1YW7 A;  2PMZ A;  2ZME C;  4BQQ A;  4D0P A;  1FEX A;  3Q0W A;  1HST A;  1X4O A;  3FDY A;  2G0E A;  4C30 A;  2KRC A;  3O2P E;  3MCZ A;  4A3B J;  2B9S A;  4PCQ A;  1JGG A;  3O6B B;  4E7Z A;  2IXS A;  2EB7 A;  4D1Q A;  1ZGW A;  1D8K A;  1H9G A;  4A0Z A;  2PJP A;  2NOJ B;  4C9Y A;  4RGR A;  4BQO A;  4Z6Y A;  2HXO A;  4LLL A;  4ZJZ A;  4M6Y A;  4Y13 A;  3DKW A;  4XN0 A;  1R00 A;  2A05 A;  4RAG A;  2X6W A;  4XOP A;  1I1G A;  1IDY A;  2QCO A;  2ZJ2 A;  1X3Z B;  3WTV C;  3WTX C;  3VYS B;  5CJ9 A;  2LNB A;  5DD4 A;  2JN6 A;  4OAZ A;  4UUS B;  1B8I A;  4XIC A;  1MDM B;  2X0L A;  2QM3 A;  2KPM A;  4HV6 A;  1SFX A;  2M3A A;  3QOE A;  3IRR A;  4UVB A;  1GXP A;  2H8R A;  2EA2 A;  1FOW A;  2IA0 A;  5JR3 A;  2AXT C;  2Y0S N;  2CQX A;  4DGW B;  1D1A A;  3CCR I;  3D0S A;  2L9V A;  4L5J A;  3DQV C;  1ON1 A;  2HDC A;  1WJC A;  3S3N A;  2BXY A;  4E7H A;  3MVP A;  4XOR A;  2ZB9 A;  3TP0 A;  4F3Q A;  3SHF A;  5TIS C;  1VQ6 I;  4MFD A;  4M74 A;  5HS7 A;  3KFW X;  3TO7 A;  2A07 F;  3R60 A;  5FRN A;  2R3S A;  5C4X J;  1IN5 A;  2VC0 A;  3DPU A;  2FML A;  2DOA A;  2ID3 A;  1ETQ A;  3GW2 A;  3KZZ A;  4QTR A;  1ETX A;  2I10 A;  2IA2 A;  3QP6 A;  3CO7 C;  2PLY A;  4ZYE A;  4BDY A;  3KZI C;  4JP0 A;  4CA0 A;  3PIP F;  1U5T B;  1SD6 A;  5K7H A;  3K9T A;  3M8F A;  1WSU A;  1T38 A;  2DU9 A;  1X2N A;  3PUF A;  4A3J J;  2CWE A;  2R7S A;  5EZH A;  4R8H A;  1GDT A;  2ZCW A;  1LB2 A;  3UNG C;  5JHF A;  3CDH A;  3IHU A;  2XSJ C;  3G71 I;  2QBY B;  1O7L A;  5M5X J;  4XLP F;  2Y2Z A;  3FMS A;  4OU0 A;  3A03 A;  2QBY A;  2ZJP F;  2HYF A;  5FKL A;  3I54 A;  3JW4 A;  1D0Y A;  4RMN A;  1P2F A;  2DW4 A;  3BR1 A;  4DBQ A;  2GAU A;  3RKX A;  4BXU A;  2DDA A;  1MJ9 A;  2VJJ A;  3BPX A;  4UUT A;  2XKP A;  4BXF A;  4BH9 A;  4A69 C;  3HRS A;  4CXF A;  2E1M B;  3AG4 H;  3RKQ A;  1RZ4 A;  3LST A;  2FX0 A;  1Z21 A;  1XMX A;  1ZRE A;  5M5W J;  2DFF A;  5A2Q K;  4I7H A;  3UKG A;  2QVO A;  3S16 J;  1T56 A;  4MTE A;  3C3W A;  4BGD A;  3K10 A;  1R5I D;  4HG2 A;  1UB9 A;  2V1X A;  3LNQ A;  2R7T A;  5GPC A;  1K78 B;  2IGN A;  3R6S A;  3H9G A;  2LKS A;  4G6Q A;  4OIR F;  4HX8 A;  2GOX B;  4A3E J;  4BU2 A;  1WPK A;  4BE2 A;  3V7R A;  3LSP A;  2LP0 A;  3CUO A;  1M1E B;  1N78 A;  5ED4 A;  3BTJ A;  2YX4 A;  1R58 A;  2ACJ A;  2OV7 A;  3I5U A;  1MBJ A;  5HS8 A;  3A4C A;  3FXK A;  2AXL A;  1MSF C;  5D6E A;  3G1L A;  3LSG A;  4XR6 A;  3GZ6 A;  1SFO J;  1TP4 A;  1BW6 A;  5M3F J;  4KA4 A;  1PP7 U;  1RES A;  1YI2 I;  4O5V A;  3VFZ A;  1OLT A;  4CCO A;  3BR2 A;  2VKV A;  1EV7 A;  2VN2 A;  3AFH A;  4RGX A;  1IN6 A;  2XRO A;  2Z16 A;  2GXB A;  1IRZ A;  3KX2 A;  1J5Y A;  1V5F A;  2IP2 A;  1U8R A;  5E3M A;  2IT0 A;  4BBS J;  1XGN A;  3TMO A;  4ZYG A;  3HBL A;  2DA5 A;  2BHY A;  3P9I A;  3HYI A;  2FU4 A;  4E70 A;  3LAJ A;  3CCJ I;  5FLM J;  4CZC A;  2W57 A;  2DLL A;  2DO7 A;  2A69 F;  1K6Y A;  2G9W A;  3OWT A;  3FBI B;  5ILV A;  2LY1 A;  3FK7 A;  4A3I J;  3HKZ A;  2OJE D;  1G3Y A;  2XGD A;  1W36 C;  1LJ9 A;  4B47 A;  2K5C A;  3K4K A;  1YE9 A;  1OJL A;  1ETY A;  5JI6 A;  3KIO A;  2H6B A;  3JSO A;  2X48 A;  3PNV A;  3V8K A;  2EZK A;  2OZ6 A;  5IT9 K;  3BG5 A;  1JTY A;  2M8G X;  3HTS B;  5J3L A;  1XS9 A;  2DFH A;  2DA1 A;  2K85 A;  2MW8 A;  2F5V A;  2FJ1 A;  3QPS A;  2FBH A;  3DLA A;  1ETO A;  3KPH A;  5DUI A;  1N77 A;  5HNF A;  1O4X A;  4IHS A;  1BJA A;  3LSM A;  3S32 A;  3ZQI A;  2RNJ A;  2UV1 A;  5HVQ C;  3FXU A;  2WBM A;  3E5U A;  1MMN A;  2DA2 A;  2HKX A;  1OCP A;  5F0H A;  2W00 A;  2MFZ A;  3GTL J;  5EJC A;  2QEN A;  1JUP A;  1OQY A;  4DZP A;  1FYL A;  5LGT A;  3PL8 A;  3KP4 A;  5BNG A;  2HDW A;  4AYB A;  3HHG A;  1YRN A;  4BL0 B;  1I6H J;  4CGZ A;  2LD5 A;  2CQK A;  4XLC A;  4HDU A;  2XAS A;  2H94 A;  5M3M J;  3QYE A;  1DPR A;  4P9U A;  3DTE A;  2DFE A;  5E3N A;  5E17 F;  1KZH A;  3BTI A;  4E4H A;  1G4D A;  2EZH A;  1YYV A;  1EA3 A;  2DDB A;  2NVU B;  4YFN F;  2XPW A;  3H3V K;  2PJR A;  1XSD A;  2NS8 A;  2LF7 A;  3EDP A;  1ZGA A;  1ETV A;  2HU9 A;  3KCC A;  3G4S I;  2M87 A;  2E1N A;  1JXS A;  3ZN1 A;  2R93 J;  1OR7 C;  4HSR A;  2NVX J;  4BY1 J;  2F48 A;  2RVC A;  2FQ3 A;  2VE8 A;  2P6S A;  4HF1 A;  2B7E A;  2F6C A;  3OV8 A;  3GLL A;  3S3M A;  3HXL A;  4ITV A;  1F5T A;  2N8G A;  3BG3 A;  1JKO C;  1T39 A;  4HPQ A;  2M7A A;  1QPM A;  3L9F A;  1BC7 C;  2X9D A;  2MC4 A;  2K02 A;  3QP5 A;  4ASN A;  3QPH A;  4FAS D;  2BVL A;  2RRE A;  3DP7 A;  3OYD A;  1V3F A;  1JHH A;  1I3A A;  2Z5U A;  2E34 A;  1R71 A;  4A5N A;  4UVC A;  1BA5 A;  4Q48 A;  3ZMT A;  2DPD A;  1TTY A;  1RKW A;  2DA7 A;  2XIG A;  1W7P B;  3OR2 C;  2VBX A;  2VOD A;  2WAD A;  1UJ8 A;  1DU6 A;  1AA7 A;  1BIA A;  4A5M A;  4RA2 A;  1STZ A;  1YQA A;  4F91 B;  4A3M J;  5FFZ A;  2E1M C;  3OYJ A;  4HX4 A;  1SVO A;  3BG7 A;  1H8A C;  1K6O A;  1NG7 A;  1XC5 A;  1TL8 A;  1IRF A;  1W0U A;  3JRH A;  4ZH4 F;  4H0E A;  5EEG A;  1J59 A;  4XLN F;  3A2K A;  2EWN A;  1T98 A;  2EJR A;  5KAF C;  4GFB A;  5H6R A;  2VOP A;  1H88 C;  4CYC B;  1GLN A;  2XAG A;  1J75 A;  1BOA A;  1IN8 A;  3IH4 A;  2X6X A;  4ENJ A;  2LSO A;  3X2Q H;  2E5Z A;  4IO9 F;  5FLX Z;  2LOO A;  2KL4 A;  3BR6 A;  3O3K A;  5K7Z A;  2V26 A;  5FGM A;  4EMS A;  3HB9 A;  5K7F A;  3ECH A;  1ZHF A;  2IS1 A;  4KT6 A;  2LRD A;  2COB A;  2VJ4 A;  3J7Y J;  1POG A;  4M3G A;  1BI2 A;  2LK2 A;  2L02 A;  3H1C A;  1FP1 D;  2MD0 A;  1HQC A;  2IAI A;  4V2F A;  3R0J A;  2WY8 Q;  5E3L A;  4AWX B;  1FSE A;  3S2W A;  3L2C A;  3E6D A;  4NC7 A;  2L01 A;  2HEO A;  4WX9 A;  4IRI A;  1LNW A;  1GXQ A;  1S8N A;  2ECC A;  4U7D A;  2OCE A;  2LF8 A;  1R49 A;  2JSP A;  2QQA A;  1GV2 A;  4IXA A;  4HST A;  2F5F A;  4V2G A;  3Q9V A;  4CDG A;  1WQ2 A;  5F0C A;  4L0Y B;  3EPZ A;  3Q0U A;  4PDK A;  3J81 Z;  2AHQ A;  3OL3 A;  1KON A;  5EG0 A;  3JRF A;  2P8T A;  2XF7 A;  2XGX A;  3ZXS A;  4UUV A;  5F04 A;  3V7C A;  3GFL A;  4PJM A;  3MQ0 A;  3T0Y A;  2OZU A;  3BR5 A;  4R79 A;  1KU3 A;  2E7W A;  1K61 A;  3JRB A;  1ENH A;  2Q1Z B;  3MWM A;  4PGH A;  3V4G A;  1OCZ H;  4AU7 A;  2XF5 A;  3FXL A;  1LE8 B;  1FSH A;  1VFC A;  4XK4 A;  4EJO A;  1DGW Y;  2GIZ A;  1WKM A;  3GZN B;  1P7I A;  4JK1 X;  2CW0 F;  2KT0 A;  3K4C A;  1FOX A;  1XDU A;  3IL2 A;  2V79 A;  1SVL A;  2W84 A;  3S14 J;  4AIJ A;  2WC2 A;  4NC6 A;  1S72 I;  3I71 A;  3H5R A;  1K78 A;  2Q2E A;  3BR3 A;  1LVK A;  5BPD A;  1Z3X A;  2ICW G;  4N0B A;  4FIS A;  4HAM A;  4ZYA A;  4E7L A;  2ZBK A;  2BGC A;  3GTJ J;  1Z91 A;  5IP9 J;  3L2U A;  4ABZ A;  2JA6 J;  3TW7 A;  1YIT I;  4PK4 A;  2GXA A;  3U2R A;  2ZNY A;  2F5E A;  2EZL A;  4QLC U;  1HA8 A;  4C2M J;  3M1C A;  4B4C A;  2K27 A;  2KIS A;  2VJI A;  5HLI A;  4UHT A;  2FXA A;  1NTC A;  5E8I A;  2RQQ A;  4CZZ A;  2CSO A;  2ZJR F;  2M4G A;  3KP6 A;  1UST A;  2Q0O A;  3FXR A;  2H1L A;  5AIQ A;  4JQF A;  3JRA A;  5JFR A;  1FY7 A;  1XX5 A;  4PJL A;  3LSR A;  1JKP C;  3TBI A;  4M3D A;  4A3D J;  4XMY A;  2XDV A;  2VBZ A;  3VYU B;  1WH7 A;  1LE8 A;  4MLO A;  2OCC H;  5ICG A;  1TWG J;  4PZJ A;  2CG4 A;  1QVT A;  4ZTF A;  1XSX A;  1EJ9 A;  3P9K A;  5FLX K;  3I0T A;  1MH4 A;  3ULQ B;  2K9N A;  3FXQ A;  4NHJ A;  3RPU A;  1P7J A;  3SYT A;  3K2A A;  3HC7 A;  4K2E A;  1CGP A;  3MZH A;  3ECO A;  2JUG A;  1MNE A;  1UZC A;  3OL4 A;  3CCU I;  1DU0 A;  2STT A;  2XRN A;  3SJM A;  2IGK A;  2HVQ A;  2Z99 A;  4MFE A;  4U0Y A;  2VQH A;  2FA5 A;  2CQN A;  2K9L A;  1IUF A;  3R61 A;  3W6J B;  2KIU A;  5FLV A;  3EQL F;  3NAU A;  1W5T A;  4P1W A;  2DOD A;  4X0G A;  3MD2 A;  2Y0M A;  3H9J A;  5K1Y A;  1UFM A;  1U5T C;  3R4K A;  1TLH B;  4FTH A;  2HVS A;  2P4W A;  1Y0N A;  3A0B C;  5EYR A;  3QAH A;  2E2H J;  2ADU A;  4KIG A;  3BWG A;  1IUY A;  2YS9 A;  5IT3 A;  3FX3 A;  1MBH A;  3P5J A;  4PSW A;  5CVJ A;  2P5L C;  4G7Z F;  1MDM A;  4AID A;  4G7H F;  3FZV A;  2WY7 Q;  3WOD F;  3BRO A;  2VC1 A;  5BMZ A;  1V55 H;  5E1Z B;  3H5N A;  5KVR A;  3HGY A;  2HOT A;  4KIS A;  1B1B A;  2R7Q A;  2W24 A;  1FLI A;  4Y17 A;  4YRV A;  2IRF G;  2LRE A;  2L5Q A;  3JCU C;  1VI0 A;  3J7A Y;  5FD6 A;  5D4R A;  5FB2 A;  3H0D A;  5HOD A;  4LIU A;  4DOZ A;  3I59 A;  1H89 C;  3SEQ A;  3TED A;  4I98 B;  2R7D A;  5FO5 A;  2EFQ A;  3BQZ A;  1ZRC A;  2O61 A;  4HLX A;  2HOE A;  4A3G J;  4LG0 B;  1IV8 A;  1SD7 A;  3GX4 X;  4M72 A;  3ZRG A;  1BOB A;  4A3K J;  4CHU A;  1B9N A;  2O03 A;  1A6I A;  5L3C A;  2H27 A;  5F1R A;  4RAY A;  4E7K A;  2M30 A;  4D7M A;  3ABT A;  5EZG A;  3TQN A;  2ZNZ A;  2ELH A;  1U9N A;  1QA6 A;  4EGZ A;  2I8D A;  1VQN I;  5J1Y A;  2ME0 A;  1G2H A;  1MW7 A;  6PAX A;  5LD2 C;  3KYD B;  2VPL A;  3CC4 I;  2HQR A;  2XPU A;  1TT0 A;  3H3Z A;  4UV9 A;  4GO1 A;  1ODD A;  2R7X A;  2TCT A;  2GBY A;  4DYC A;  4XLH A;  4D9J A;  1XTA A;  4UUS A;  3SZP A;  4RLQ A;  1WHU A;  3JRE A;  3IUO A;  3B73 A;  3CO6 C;  4C3H J;  2VLA A;  1OCR H;  2LKP A;  3OIP A;  4HNV A;  2Y69 H;  3GCM A;  4JYK A;  3RCO A;  2EIJ H;  1LFP A;  2QQ9 A;  3S2H J;  4J19 A;  3S8P A;  3FKI J;  3JRG A;  1EF4 A;  4BY7 J;  4J01 A;  2IS4 A;  2JTV A;  5HNH A;  2JPC A;  1YJ9 I;  5DS9 A;  2QSG X;  3K4N A;  3HGG A;  3H92 A;  4IRH A;  1MBF A;  4MIM A;  2NXN B;  1NHA A;  1IXS B;  2VT3 A;  4G9Y A;  4LJZ F;  1VQM I;  3W2W A;  1KQ0 A;  1IG7 A;  2A61 A;  3CJR B;  4LK0 F;  4D7N A;  3ZQH A;  2FSW A;  1TNT A;  2FBI A;  3M07 A;  5D4S A;  5EGO A;  3J81 K;  2LH9 A;  3LWF A;  3QOP A;  3IV5 A;  4ENM A;  1FBQ A;  2I5U A;  1LEB A;  2FUG 2;  5ICE A;  1WJF A;  4YEL A;  3HRT A;  4Q5S F;  1BR2 A;  2Y30 A;  4WK8 F;  5GP9 A;  5HS9 A;  4DJA A;  2XF6 A;  3I64 A;  3FBN B;  4G6D A;  1MNM C;  2GLO A;  4M3B A;  2IA1 A;  2O9L A;  2A5W A;  2QLZ A;  5F0F A;  2P5K A;  3S17 J;  2F4O B;  2EV5 A;  2M9H A;  4X6A J;  1T0F C;  2KJC A;  1CQT A;  2QQB A;  3HRU A;  2PI0 A;  1TWA J;  3PUB A;  4ZZL A;  3CP2 A;  2WB1 N;  2X6Y A;  1LDJ A;  1Y39 A;  4IQJ A;  3WG9 A;  1ITY A;  2VQL A;  4FET A;  5TJJ A;  3ZMZ A;  3HSE A;  3F8N A;  1V5E A;  2JSC A;  4LMY A;  2DA6 A;  3ZQG A;  2NAZ A;  1W7P A;  3Q0V A;  1X4P A;  2VKE A;  2R4G A;  3IH2 A;  1C0W A;  1IAW A;  3PO3 J;  3HOW J;  4V19 K;  4KIC A;  4D5C A;  1LFB A;  1FWZ A;  4G8X A;  4NQW A;  4XRM A;  2DXI A;  5D6F A;  1G3W A;  3I4M J;  2X4H A;  1AOY A;  2NS0 A;  3PSI A;  2FF4 A;  4CH7 A;  3CC7 I;  3KLN A;  3L2W A;  4I99 C;  3L00 A;  3BJA A;  5IYC J;  2JA7 J;  3ML6 A;  2IS2 A;  2D45 A;  4CYC A;  4TV7 A;  1HBX G;  4E7I A;  1T08 B;  4IVN A;  4HYE A;  3C7J A;  3LQR A;  3JRC A;  5L3F A;  1TWH J;  3BP8 A;  2XSD C;  1RPW A;  4KFC A;  1UG2 A;  3FWE A;  3QU3 A;  3C2B A;  3HG9 A;  2F4I A;  2K86 A;  4CCK A;  2F5D A;  4F93 B;  5BOX A;  2ZXI A;  3ONQ A;  2DT7 B;  2CS3 A;  1IN4 A;  2EZI A;  3VEP A;  3LQQ A;  4M9X A;  3SDB A;  1QPI A;  3GME A;  3K1P A;  4AVP A;  1CF7 B;  2OA4 A;  4BJT A;  1SEU A;  1ETW A;  1YRN B;  4MHG A;  2HDD A;  3D5R C;  3CUQ A;  2MLK A;  3OYI A;  1A5J A;  1EH6 A;  4HF2 A;  3HIF A;  1VQ4 I;  2LKX A;  3C2H A;  5EDN A;  2M7B A;  1XPX A;  3DEE A;  5JHU A;  1P4W A;  3F6O A;  2QF7 A;  4HOB A;  2VE9 A;  2R5Y B;  3VOE A;  5FRM A;  2VKH A;  3QQA A;  3GTP J;  3OIO A;  4CSW A;  5LLQ A;  3G73 A;  2GA1 A;  4L9J A;  5E20 A;  2R7O A;  5EG0 B;  1USS A;  4JX4 A;  1QNT A;  4LG0 A;  5GAH J;  2JVG A;  1DP3 A;  3JTG A;  4KNY A;  3GZ5 A;  2FOK A;  2ME6 A;  2M1B A;  1LDD A;  2Z2S B;  4PUS A;  2OQR A;  4XRS A;  3KLO A;  1IXR C;  2XVC A;  5ICC A;  3LL7 A;  2PMU A;  2HPI A;  4S04 A;  4MO7 A;  1U78 A;  2DJN A;  3JTH A;  1FZP B;  1J09 A;  4IX7 A;  2L4M A;  3CF5 F;  1PUF A;  2EK5 A;  2XGC A;  5CQG A;  4KMF A;  2KKO A;  5TRD A;  1LQ1 A;  4HZF A;  2E2I J;  2IEK A;  4L9N A;  1YOV B;  3L7W A;  2Z33 A;  3OY9 A;  1LUJ B;  4L5E A;  5IT9 Z;  4YIF A;  1ZLK A;  3HUG B;  1E0E A;  2Y9Y A;  4NBQ A;  3E5Q A;  3HUG A;  1OYY A;  2KMU A;  2YPR A;  3RQ4 A;  1FBU A;  2FD5 A;  3H0G J;  4JOM A;  3F21 A;  2IS6 A;  2DT6 A;  4FE4 A;  5DEQ A;  2CYY A;  3RPU D;  3MKW B;  2XRL A;  1I50 J;  4BUP A;  4ENN A;  2V1U A;  4NUB A;  1JUM A;  3G2B A;  1FYK A;  1FMW A;  3DPL C;  1TW2 A;  4LIT A;  3E1S A;  1BI3 A;  2O5R A;  1HF0 A;  4A6E A;  3F3X A;  4U0V A;  3PNY A;  1Z6R A;  2W48 A;  3KP7 A;  3RKY A;  3CJT B;  1OCO H;  4HV5 A;  2J5P A;  2RC4 A;  3BPV A;  3E3V A;  3NAR A;  4JBA A;  5D8K B;  2E35 A;  4AD9 A;  2B0L A;  3GUD A;  2BHZ A;  1X3W B;  2H6C A;  4HX7 A;  3TOA A;  4N4N B;  1MND A;  3PIO F;  1A35 A;  1ZH5 A;  2EIL H;  3TKY A;  2K9Q A;  2XAU A;  2BZT A;  2Z1D A;  4EGY A;  1YLF A;  3GBG A;  3E6C C;  5CVU A;  2FEZ A;  1HC8 A;  3PFY A;  3GFI A;  3I3L A;  5ICF A;  1UHS A;  1MJA A;  1V4R A;  3TP3 A;  4BHB A;  2Z9O A;  4HQE A;  3WTZ A;  2L7K A;  3A1Y A;  3RKW A;  2HOA A;  2K9S A;  2L9N A;  1EKE A;  4OIP F;  3IWF A;  5KHD A;  3IAM 2;  1H9T A;  4R1H A;  2DA3 A;  2M45 A;  1K79 A;  1R4M B;  3KEO A;  4QPO A;  4QWQ A;  1AU7 A;  3LA7 A;  1U9O A;  1A6Q A;  2D2W A;  1R5G A;  1BIB A;  1JUS A;  5IOZ A;  4H4K C;  4M9S A;  5LRS A;  1P4A A;  2CGP A;  3M8E A;  5B66 C;  4OIQ F;  2PG4 A;  2PMZ N;  3KEY A;  5H2F C;  5GAD J;  2CV0 A;  2VBW A;  2J5O A;  2LG4 A;  1X19 A;  2B63 J;  1JT0 A;  1XD7 A;  1XSV A;  1BR4 A;  3FXO A;  4IJA A;  1T6S A;  3ABK H;  2MAB A;  3K0L A;  5LHG A;  1D3Y A;  1O57 A;  2PEX A;  1O3T A;  1XGM A;  3C2G A;  4CCN A;  1NG6 A;  1ZRF A;  2ZO4 A;  4P96 A;  1UMQ A;  3RI4 A;  1OR7 A;  4XLF A;  2K4B A;  2Y9Z A;  3T5X A;  3A01 A;  3OYN A;  2HFH A;  2WV0 A;  1K4S A;  2RQP A;  1FTZ A;  2P0W A;  3TDU C;  2E2J J;  3W6V A;  1HW2 A;  2HR3 A;  3OYH A;  2HQ5 A;  3S1Q J;  3I55 I;  2LVS A;  3HOS A;  2M34 A;  4A3C J;  3IRQ A;  2EPF A;  1HSJ A;  5GAG J;  2QGU A;  2Q2E B;  3PSF A;  3RPQ A;  2RV8 A;  1WZ2 A;  3GEZ A;  2W4S A;  4Y3O A;  2HZT A;  1HDP A;  2JK3 A;  1XN7 A;  2ESN A;  2BY0 A;  4RAF A;  1UHW A;  2EIN H;  2WB1 A;  1Z9C A;  1X3U A;  3CF2 A;  3CUQ B;  1BW5 A;  1TC3 C;  1F43 A;  4ESF A;  1E17 A;  5FRO A;  5F6F A;  4CCJ A;  3E6B A;  4OOI A;  3FM5 A;  2STW A;  2FNP A;  2CUF A;  2KP6 A;  4XLA A;  1WWX A;  1D5Y A;  5M5Y J;  1WH5 A;  3K7A J;  4HF0 A;  3REO A;  4ANJ A;  2KLO A;  3G3Z A;  1FYM A;  5J6X A;  3MKY B;  3WTY C;  2ELK A;  5DCM A;  1DP7 P;  1D5V A;  3FKJ A;  1BR1 A;  3AKZ A;  1LFU P;  1OPC A;  4II3 A;  2WAQ A;  2HYJ A;  1W1W E;  1NK3 P;  3VPR A;  3WE3 A;  3CCS I;  1UAA A;  2FBK A;  4FHT A;  1TNS A;  2V1D A;  1Y1V J;  4GDF A;  1PUF B;  1TT5 B;  1F1Z A;  1ZLJ A;  3MKL A;  1B59 A;  4AM3 A;  5IP6 A;  5CLS A;  1HLV A;  4B8X A;  2W85 A;  5ILS A;  2O0Y A;  3IWZ A;  2GZW A;  3WE2 A;  3WGI A;  4RLF A;  3ROU A;  4HNT A;  3F8M A;  2BBY A;  1VQK I;  3ERM A;  3FHZ A;  4Y52 J;  1MMA A;  4RM2 A;  1ZKG A;  3WGG A;  4OMY A;  5C3E J;  2FMY A;  3KYC B;  1ZN2 A;  4BNC A;  5B3S H;  1RR8 C;  2OQG A;  1P4X A;  1I39 A;  2JWT A;  3HSR A;  4BBR J;  2JT1 A;  1Z1D A;  3CLO A;  5L3E A;  2QYO A;  2MSY A;  1SFK A;  3H35 A;  1IRX A;  3OYB A;  3GTO J;  3K1M A;  1FX7 A;  2NVY J;  1G3S A;  1GT0 C;  3GTK J;  3J7Z I;  3IKT A;  5BPI A;  2JZY A;  4BXX J;  1EH7 A;  2OD5 A;  1JI8 A;  1XB4 A;  5HLT A;  3G1M A;  3OIQ A;  3PQK A;  3F9K A;  3DXJ F;  4L9V A;  4OMZ A;  3U21 A;  3KET A;  2UWM A;  2R0Q C;  4LOC A;  3LFK A;  2VBY A;  3OOP A;  4HA8 A;  4W97 A;  2GM4 A;  3M3Y J;  2JMW A;  1WCM J;  2IVM A;  1ORK A;  1YJN I;  1RC9 A;  2DTR A;  3ZQ7 A;  1DDN A;  3F22 A;  1OFC X;  4CYD A;  1JTX A;  3IKV A;  1E3H A;  2HWV A;  1WVR A;  2DBB A;  3I53 A;  3GWZ A;  3KEQ A;  2HTJ A;  4NNJ A;  1PP8 F;  4PJJ A;  4LB6 B;  1LEA A;  2RDP A;  3EUH C;  4NB5 A;  5D8L B;  5LHI A;  4S05 A;  4PSX A;  4ESJ A;  4RS8 A;  3V8J A;  4MQV A;  5J47 A;  3U9G A;  5HDG A;  1A04 A;  1R36 A;  3LSH A;  3VYR B;  4EJV A;  3K70 C;  1S7O A;  1N75 A;  2LC2 A;  2NS7 A;  2A68 F;  2M2E A;  3LAP A;  4A12 A;  1J7K A;  4S0H B;  3E6M A;  3OYG A;  1JGS A;  4I09 A;  2UUZ A;  3CCL I;  2L3D A;  2ZFU A;  4NQW B;  2YU9 J;  2BY2 A;  1BN5 A;  4HBL A;  3OS1 A;  3HKZ N;  3ZQQ A;  2EV0 A;  1YW8 A;  3SQN A;  1Y1W J;  2DPU A;  3SDG A;  2OUM A;  5EEH A;  1QHG A;  4IZZ A;  4I0A A;  2DMU A;  4YII A;  5IYD J;  1F9N A;  2DMT A;  2CO5 A;  4KN7 X;  4KIT B;  1BC8 C;  2HI3 A;  2ZXW H;  4XID A;  3BOQ A;  2VKD A;  4RB2 C;  5J8C A;  2MD5 A;  2NYX A;  1Y56 A;  5IP7 J;  4ENK A;  4N9I A;  1VTN C;  1PYV A;  1YW9 A;  4M3E A;  3DTK A;  2MH9 A;  1G6N A;  1R5H A;  2BV6 A;  3F8F A;  3EUA A;  5AON A;  5D5W B;  3H9Q A;  4MTD A;  4OWR B;  1XDS A;  2EFP A;  1T0F A;  1XMA A;  2L4A A;  5HLH A;  4OIO F;  2GXG A;  3L2V A;  3HM5 A;  2IPQ X;  5CYV A;  2X1D A;  3TO9 A;  2XUB A;  3OYE A;  3K4L A;  5E3O A;  1Z7U A;  3CCY A;  3BC8 A;  1YX5 A;  4IOA F;  3EUK L;  3ZPL A;  2O8K A;  3M7G A;  2VAS A;  2L2O A;  3CZ6 A;  5DV5 A;  3MKZ A;  2V7F A;  4IPA A;  1QU3 A;  3GO5 A;  3CCM I;  3TL4 X;  5J1U A;  2E1C A;  2LBF A;  1W5C C;  4A0X A;  5EGO B;  2OU2 A;  2Y0S A;  3WU1 B;  4G12 A;  4UY8 I;  2L7Z A;  3E0J B;  5E79 C;  1B8I B;  2IJL A;  4B43 A;  2QSF X;  3QYB A;  1S9H A;  1YO5 C;  3P9C A;  5DM7 F;  4Q47 A;  2ZJQ F;  3CP8 A;  3U1K A;  3AG2 H;  2CJJ A;  4HEA 2;  2JQ7 A;  2VJ5 A;  3I58 A;  3WTU C;  1NK2 P;  1K83 J;  2WA0 A;  1QVU A;  1Y8Q B;  2LTP A;  3HOV J;  4GYI A;  3NQO A;  2YR2 A;  1KU7 A;  2V9V A;  1LPQ A;  1A31 A;  5F27 A;  3L2Q A;  4LLG F;  2XAJ A;  1K7A A;  1MH3 A;  3GTQ J;  2R7U A;  3N97 A;  5CVI A;  4XKB A;  5FKM A;  1E3P A;  1R1V A;  2OTJ I;  2QKM B;  4OIN F;  2OBP A;  4KMU X;  3GTM J;  2XHK A;  4M71 A;  3S1N J;  1U3E M;  5C44 J;  3KYL A;  3LSK A;  2P81 A;  1Z05 A;  2ZFW A;  3GF2 A;  2UZK A;  3FIW A;  3VB2 A;  3CQZ J;  4ZZD A;  4Y15 A;  4PJ0 C;  3HSF A;  1J9I A;  1OCT C;  2HYG D;  2LMD A;  4P9F A;  1GUU A;  1W7P D;  1I3Q J;  1MMS A;  5LFA A;  3ZP5 A;  1Z6T A;  2R7V A;  4DYQ A;  2COM A;  4M3F A;  1WJE A;  2HTS A;  3FK6 A;  1U6G A;  5LHH A;  2XC7 A;  3M4O J;  3KP3 A;  3DEW A;  5GAE J;  3SFI A;  2Q8K A;  1PVE A;  2KRF A;  2HNH A;  3F8C A;  2DYR H;  3DF8 A;  3L09 A;  2MYS A;  1D1B A;  1YG2 A;  3QYF A;  3DU6 A;  5B1B H;  4XNF A;  2NOG A;  3EUH A;  3WTW C;  1U8B A;  4YFK F;  1F4K A;  1HW1 A;  3MN2 A;  3OSF A;  3H3U A;  1FTT A;  2R92 J;  4EJW A;  5LGU A;  4I2O A;  1GHC A;  1S3J A;  1ACI A;  1SD5 A;  2RNG A;  2K40 A;  2AQF A;  4IHW A;  3S2D J;  4WXH A;  3V7S A;  4AIH A;  1ZQ3 P;  1MBK A;  4I76 A;  2V6E A;  3QPL A;  3V42 A;  1QZE A;  2ZSI B;  1RKT A;  2YUS A;  4ZC3 A;  1ZG5 A;  4P55 A;  2PFB A;  4M6X A;  2BXZ A;  2EFN A;  3TGN A;  1YIJ I;  3Q5F A;  5EF6 A;  2M5W A;  3K6G A;  3OYL A;  1S29 A;  3M1E A;  2QA4 I;  1S7A A;  1T95 A;  2CFX A;  1B4A A;  4U7B A;  2CW8 A;  3RJP A;  3O8G A;  2D1V A;  3PM1 A;  2CQ7 A;  3N05 A;  2DI3 A;  2RAE A;  1ERD A;  2A6E F;  4GGG A;  3FXJ A;  2EIM H;  3PQJ A;  3J80 K;  2UXN A;  1OYW A;  1BI1 A;  1TWC J;  4EEF G;  4HNU A;  3MAJ A;  4UXN A;  2LY2 A;  3J80 Z;  4FX4 A;  1TWF J;  2DK5 A;  1ZEL A;  4YG2 F;  3EET A;  4EJU A;  4LG3 A;  5BS6 A;  2BVM A;  4IHY A;  2DA4 A;  5H6Q A;  1SAU A;  4Q4Z F;  2X6O A;  1Z67 A;  4U0W A;  3DEU A;  1UHM A;  1WRJ A;  3CJQ B;  5LBQ A;  2HZD A;  3ABM H;  1U0J A;  3FMR A;  3K2Z A;  2Y31 A;  2DK8 A;  1WI9 A;  3ZQL A;  1SMY F;  2XB0 X;  1VND A;  3DBR B;  2P7C B;  1OMI A;  1QRY A;  3ABL H;  3A02 A;  2ISZ A;  2X1E A;  3HOU J;  3RYP A;  1REP C;  4YEJ A;  3DBH B;  3BTL A;  3KP2 A;  5LEJ A;  2NNN A;  2BYV E;  4RAZ A;  3AL0 C;  2WAQ N;  4NC8 A;  3ERE D;  1L3L A;  1IXC A;  1DPU A;  5IY5 H;  2E19 A;  2R5Y A;  5J4V A;  3HJE A;  1GVJ A;  3V8L A;  1ZR4 A;  1FNN A;  2XAQ A;  1YS6 A;  2DOF A;  2LR8 A;  1D8J A;  2DTZ A;  5F08 A;  3CCQ I;  2BY1 A;  2L9R A;  1MMG A;  4EM1 A;  4RBO A;  1YTY A;  4AYB N;  1TW3 A;  2OPT A;  5KCM A;  3ZQF A;  2VON A;  4RDU A;  2A6T A;  1ZRD A;  1YJW I;  2O6G E;  5K5O A;  3FM3 A;  2KZG A;  3T1B A;  4ZDL A;  3CUQ C;  1L0O C;  3U1D A;  2DT5 A;  1B6A A;  2E7X A;  3WU2 C;  2PBI A;  3W3C A;  3F6V A;  4XSZ F;  1I6X A;  2HPM A;  4F92 B;  2IW5 A;  5JVT A;  4OAY A;  2K9M A;  2QUF A;  2WAF A;  4KUM A;  4XL9 A;  2D1H A;  4B3A A;  2JA8 J;  3NWS A;  4PFO A;  1QGP A;  2HOS A;  3VYT B;  3VSL A;  3P7N A;  1E2X A;  3B02 A;  1APL C;  2LLK A;  3IP4 B;  5J1R A;  4KIB A;  3W2V A;  2NVT J;  4IHT A;  2NNY A;  4I02 A;  2C6Y A;  4UB8 C;  4YFX F;  5J8F A;  1MZB A;  3D5L A;  2EH3 A;  3NWT A;  3JAM K;  4MGR A;  3N4M A;  5CVR A;  4L9T A;  1SD4 A;  1KU2 A;  4A93 J;  1LVA A;  1FOK A;  2H09 A;  1QZY A;  1XCV A;  4GXO A;  4BHP A;  3KP5 A;  4AC0 A;  3F0C A;  2ETH A;  1IW7 F;  2IGM A;  4UVA A;  4YIR X;  1ON2 A;  1Z0X A;  4RGS A;  3R0A A;  2ZXJ A;  3WGH A;  2HVR A;  3CES A;  2DAO A;  3VDX A;  1TQM A;  2O7O A;  4F55 A;  4B1R A;  2ELJ A;  1VQL I;  1UEL B;  1QBJ A;  5L3D A;  1LKX A;  2IBD A;  1MD0 A;  2MGQ A;  4RGU A;  4N9H A;  3M8J A;  3L2R A;  2KQR A;  4UNO A;  4ZYH A;  4M6V A;  5FFX A;  4KYW A;  5IPA A;  4KIF A;  2VOO A;  4XLE A;  3CDI A;  1SMT A;  2DQL A;  5CQE A;  4A2U A;  3ELK A;  1ONV A;  5GTI C;  4ZTJ A;  3DCF A;  2VIX A;  3CLQ A;  4FT8 A;  4KT5 C;  5BQT A;  2VQG A;  4U88 A;  1JJ8 C;  2AO9 A;  2GWR A;  2R5Z A;  3GLX A;  3OMY A;  4EAT A;  1WJ5 A;  2E36 A;  3H36 A;  1JKQ C;  3I4P A;  2XKO A;  2ID6 A;  4JX6 A;  4E6K G;  5CPR B;  2VQC A;  2EBI A;  2W7N A;  2VL8 A;  1TBX A;  3FF5 A;  4CO8 A;  1R22 A;  2AS5 F;  3HOY J;  2XAH A;  5FD5 A;  2R7Z J;  3VWB A;  2H1K A;  2WV1 A;  5E1X A;  2TRT A;  4CCL A;  3F23 A;  1JT6 A;  3HPH A;  5FKK A;  2JVH A;  2M8E A;  1ZYR F;  2HQN A;  1AKH A;  2W1O A;  3HHH A;  1D0Z A;  4BQA A;  4MNU A;  4HQM A;  2EV6 A;  2GIV A;  1XGS A;  2F4M B;  4XBF A;  3FIS A;  4QPQ A;  2JPB A;  4I0B A;  4EVI A;  3BZC A;  1W0T A;  3OYF A;  2F2E A;  5K5R A;  3A01 B;  2RGV A;  3F72 A;  1S7E A;  2P7V B;  3DU5 A;  1HXD A;  4BE0 A;  5DDG A;  3HTU A;  5GTH C;  4IF4 A;  4XQF A;  3OYA A;  4L18 B;  2K4J A;  4KN4 X;  3CDL A;  9ANT A;  2KIM A;  5ERI A;  4XKV A;  4PFP A;  2K7L A;  4O3M A;  1KGS A;  1S5L C;  1R7J A;  1Q1H A;  1VQ9 I;  4UB6 C;  4G7O F;  1X1B A;  3ZGK A;  4XRS G;  5HDN A;  4NDL A;  3SXY A;  1U2W A;  2FOW A;  4ZDO A;  3ABU A;  2ZME B;  3MEX A;  1NH3 A;  2MH2 A;  3OYM A;  4XOT A;  1Z77 A;  2EIK H;  4DW6 A;  1O3Q A;  3TW6 A;  1OIS A;  3WHB A;  4AUX A;  2CH0 A;  4AIK A;  3DPT A;  3CMY A;  1WJD A;  3I9V 2;  2PQ8 A;  2BOL A;  3LSI A;  3CME I;  2EFO A;  3QPT A;  3ZOB A;  4GCV A;  4IHV A;  3PFI A;  4MQ9 F;  2KHM A;  3AG3 H;  1JHF A;  2Y48 A;  3NRV A;  2KRH A;  4LK1 F;  4HLY A;  2MC3 A;  4DYR A;  1A36 A;  2ZKZ A;  5D5X B;  3WHC A;  3WTT C;  4BE1 A;  3K1N A;  3PJR A;  4RB3 C;  3UR3 C;  3CCE I;  3CJN A;  5J40 A;  1IC8 A;  4UV8 A;  5CVV A;  1RI7 A;  4HDV A;  3E5X A;  3OOU A;  3CC2 I;  1XGO A;  1R4N B;  2UXX A;  1PUE E;  2DYS H;  2CRG A;  4WWC A;  3D1N I;  1FOY A;  1B72 A;  2XV4 S;  3O8H A;  1IO2 A;  4XRF A;  3DFG A;  5JVG F;  4KDP A;  5LGN A;  1LDK B;  1B72 B;  4BS9 A;  1R1U A;  5AIP A;  4GRI A;  3RDI A;  4J00 A;  2ZME A;  2V1N A;  2XPV A;  3BCA A;  1RUO A;  2VB6 A;  3C18 A;  2QWW A;  2EQR A;  2FRH A;  2G7U A;  1FIA A;  3I56 I;  1ZK8 A;  2A5Y B;  1MSE C;  4DZJ A;  4O6J A;  4XKC A;  5F1J A;  3HPG A;  1ZGJ A;  2MLG A;  5D5V B;  4WCG A;  1MBG A;  1I27 A;  4PGG A;  2AQE A;  4B09 A;  4WXC A;  4A6D A;  3TDZ C;  3A0H C;  5FKO A;  4BQN A;  1YX3 A;  1OCC H;  2JA5 J;  5B5E C;  2ESH A;  1FMV A;  1X58 A;  1YIO A;  5JLW A;  1WJA A;  1HKQ A;  3T8R A;  1BL0 A;  3OS2 A;  1FBS A;  3HDD A;  3W6K B;  2VUM J;  1VQ8 I;  4I01 A;  4RB1 A;  1PDN C;  3HOZ J;  3K4B A;  4JX5 A;  1ETK A;  4BJ6 C;  4AVZ A;  5ILU A;  3KE2 A;  2XGE A;  3SZG A;  3SZT A;  2CQQ A;  3VOD A;  3SFZ A;  3L1P A;  3DLL F;  4DQ2 A;  1GV5 A;  1VQO I;  1XMK A;  2OF7 A;  3ASN H;  3AG1 H;  2LBF B;  3NEU A;  4Y7N J;  3JAM Z;  2HQA A;  1AHD P;  4F7Z A;  3EYI A;  1KU9 A;  2Y75 A;  5FKN A;  5DTD A;  3CTA A;  1O3S A;  2X85 A;  4XM3 A;  1UCR A;  1W36 D;  1S6L A;  3FXM A;  1H0M A;  3WU0 A;  2P6T A;  4BAY A;  2JJ7 A;  2XAF A;  2Z3Y A;  2CFO A;  3LA3 A;  1FJL A;  1Z7L A;  1YFH A;  2DJI A;  1G3T A;  3E97 A;  1VQ7 I;  4DIQ A;  2R7R A;  2G7H A;  3BY6 A;  3LSJ A;  3HOT A;  1AKH B;  5E1W A;  4LLN A;  1DGR M;  4LIV A;  2O3F A;  5F64 A;  2GA2 A;  4L0Z B;  3I59 B;  1RIO H;  4N4O B;  3BJ6 A;  5DD8 A;  4EV0 A;  1KQ9 A;  3BLY A;  2FQ4 A;  1U5T A;  2L7M P;  3ASO H;  4Z2Y A;  3K4J A;  1EH8 A;  1HW5 A;  4C3I J;  5B1A H;  3GFJ A;  3FHN A;  1X1A A;  3BG9 A;  3MZY A;  2CV1 A;  3DKY A;  4DNC A;  1OYI A;  4ETS A;  1SC7 A;  3BJO A;  2P5V A;  2CW7 A;  5L3G A;  2DQR A;  4C2U A;  1KYZ A;  1I5Z A;  4BJ5 C;  1WJB A;  2E5N A;  3DKX A;  4E7S A;  3TO6 A;  2ZC2 A;  2BW3 A;  3T8T A;  3AL0 B;  2LDU A;  4EQQ A;  1HDD C;  4B3X A;  5K5Q A;  3FMQ A;  2V9P A;  1DQU A;  1MJB A;  2EA4 A;  3ZMV A;  2YX7 A;  1RUN A;  3LMM A;  2A6H F;  2WTE A;  5EEA A;  1SAX A;  3G1O A;  2MA3 A;  2F5C A;  4FX0 A;  1IJW C;  1FIP A;  3GVA A;  1I1S A;  2ZXH A;  2BY3 A;  3Q3S A;  2L54 A;  1JJ6 C;  4FCY A;  3SEZ A;  3CD6 I;  1VZ0 A;  2V4J C;  2VPR A;  1K4T A;  3S3O A;  1TQI A;  1ZAR A;  3BZ6 A;  5CKT A;  3CMM A;  3ESW B;  2CMP A;  2A3S A;  4FQG A;  1BM9 A;  1ZG1 A;  1KYW A;  2HKO A;  1FPQ A;  4CIC A;  3B6C A;  3MFK A;  3CMA I;  3MMY B;  2WWY A;  2XB5 A;  3OS0 A;  3WG7 H;  4IKF A;  4CUG A;  2W25 A;  4ON0 A;  1O7F A;  3DV8 A;  3BR0 A;  3RSN A;  3OYC A;  1QQI A;  1BJZ A;  2FNA A;  1Q1V A;  2D5V A;  2V9K A;  3BT9 A;  1O3R A;  3M9A A;  3OYK A;  2NRA C;  3K70 D;  3S1M J;  3AAF A;  5KK1 A;  4LFU A;  2OTL I;  3RZD J;  2KIQ A;  2BE5 F;  2CUJ A;  2DCE A;  1QZZ A;  1ULY A;  4BYY A;  1ZAO A;  3E7L A;  4C2T A;  1B9M A;  2ECB A;  1JKR C;  5C4J J;  1IGN A;  4A3L J;  2IGO A;  2R7F A;  3RZO J;  2BW3 B;  2H8W A;  2E71 A;  2KFD A;  3RTR A;  2K3F A;  1ZR2 A;  2YSR A;  5HOO A;  1VQ5 I;  1MBE A;  2M0C A;  2L7F P;  3F8B A;  5A2Q Z;  4EM2 A;  1Y0U A;  4HW0 A;  3LFU A;  2WAE A;  3LA2 A;  1MKM A;  2BEO A;  2X51 A;  1N25 A;  5LRR A;  1KA8 A;  3QU6 A;  1MMD A;  4Y33 A;  2V6C A;  2DMP A;  4W1U A;  4IOC F;  4IQ4 A;  2W82 A;  2VXZ A;  3B6A A;  2PX9 A;  4WXD A;  1WFX A;  3BDD A;  4IEJ A;  3ZMD A;  3QRF F;  1SFE A;  1FT9 A;  1TZL A;  2KZV A;  1YS7 A;  4A0Y A;  2ZSH B;  1JE8 A;  3BCB A;  1IRG A;  1AWC A;  3BG6 A;  1E3O C;  3ZR8 X;  1DUX C;  1W4M A;  4XON A;  4XSX F;  1RR7 A;  4EJT A;  2HS5 A;  1BI0 A;  3G6E I;  4IHX A;  2E1O A;  5KAI C;  1R9T J;  2DN0 A;  3HOX J;  2PN6 A;  3S15 J;  3GXO A;  4LD5 A;  2KIF A;  1Z3Y A;  4II2 A;  5DUK A;  4X1E A;  3HZJ A;  1OKR A;  3ZN0 A;  2KJB A;  3H5A A;  5DCM B;  4M9Z A;  4Y4R A;  2LY9 A;  2NVQ J;  4G94 A;  1YHQ I;  1FP2 A;  1ZTR A;  1QO0 D;  1T8I A;  1RNL A;  4E7J A;  1G8X A;  4QSH A;  3S93 A;  5E18 F;  4ESB A;  4G6T B;  4PJN A;  2GQQ A;  2VI6 A;  3JSP A;  3QWL A;  5KNL A;  4I6Z A;  1RET A;  1CF7 A;  1KQ8 A;  3D5S C;  2R7W A;  1Y6I A;  4LGW A;  4EM0 B;  2L9S A;  4XN3 A;  2RN7 A;  3W2A A;  2QKL B;  1R1T A;  2VXD A;  5DYM A;  3DBL B;  4WF2 A;  3BQY A;  4BDZ A;  3ZQC A;  5E8G A;  2QZ8 A;  2OAZ A;  1SFU A; 
#chains in the Genus database with same CATH homology
 2CQN A;  2KZG A;  2B7E A;  4FQG A;  2E71 A;  2DOF A;  2KIQ A;  2KIS A;  2DOE A;  2K85 A;  1UZC A;  2DOD A;  2KFD A;  2LKS A;  2JUC A;  2L9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...