4FQGA

Crystal structure of the tcerg1 ff4-6 tandem repeat domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
186
Chain Sequence
SHMKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific Interaction of the Transcription Elongation Regulator TCERG1 with RNA Polymerase II Requires Simultaneous Phosphorylation at Ser2, Ser5, and Ser7 within the Carboxyl-terminal Domain Repeat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcription elongation regulator 1
total genus 72
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA03
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA01
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 4fqgA02
2DODA 2CQNA 2KFDA 2KISA 2KZGA 2DOEA 2K85A 2E71A 2KIQA 2LKSA 2B7EA 2JUCA 2L9VA 1UZCA 2DOFA 4FQGA
chains in the Genus database with same CATH superfamily
4RB3C 2R7VA 4DYCA 4MNUA 2CV2A 4O5VA 1ZKGA 1IW7F 4I02A 3O8HA 1SD5A 2QCOA 3ROUA 4ENKA 3D1NI 5FO5A 1IN7A 2JTVA 3MZYA 1A04A 4AIHA 3BR1A 2VPLA 5D8LB 1HF0A 4CDGA 4UUVA 1K4TA 4V2FA 3S1MJ 2H1LA 1I3QJ 1Z77A 3QPSA 4N4NB 5DUIA 4N0BA 1SD7A 1B72B 2MLGA 3H9GA 4LB6B 2EIMH 3A01A 4WWCA 1XGOA 2NS0A 1ZN2A 1HDPA 2L7FP 2X6YA 2YSRA 3CCQI 1WQ2A 4WK8F 3HPGA 4YFXF 3CP2A 5JVGF 2XGXA 1C0WA 2PEXA 2LMDA 5D5VB 5TISC 3RPUD 3OYFA 2HZDA 2YR2A 1FPQA 2DK8A 3KP2A 4B43A 3E6CC 2LFBA 4JX6A 2H1KA 3U21A 3I3LA 1GXPA 1ONVA 1FTTA 1L0OC 4NNJA 2CWEA 3ZQQA 1QBJA 5GPCA 2VPRA 2FJ1A 5EGOA 1TQMA 4WXCA 4RGSA 1IV8A 5E3LA 3O2PE 5FROA 1FC3A 1WJCA 1ZAOA 2Z9OA 2OZUA 4P55A 4W97A 1F4KA 2V1UA 2GXBA 3CDHA 3Q3SA 2V1XA 5BNGA 1NH3A 3JW4A 1Z3XA 2F5EA 2JPCA 4CYDA 2DW4A 1KQ0A 5CLSA 1WHUA 1LDKB 2GZWA 4CA0A 3IC7A 3BR3A 2CW7A 1YHQI 1ZTRA 3IHUA 2EFQA 5LEJA 3MMYB 2DFFA 1XMKA 5GTHC 2HXIA 2LY2A 1RKTA 5LGTA 4ZYHA 5DUKA 2L54A 4Q47A 2H09A 2IS6A 3FHNA 2VI6A 5IT3A 4P9UA 2RNJA 2MBFA 4DGWB 3FZVA 3Q0UA 2V4JC 1V5GA 2E2IJ 2WAQN 3OMYA 1T6SA 2A07F 1XDSA 2GA2A 5J6XA 2COBA 3K4CA 1QVTA 4A69C 2A5YB 3LNQA 1AKHA 1UCRA 2CUZA 2R7SA 1YW8A 3TW7A 3C2HA 2O8XA 2W24A 1IF1A 2L7ZA 2ZC2A 4FE4A 4A3EJ 1X1CA 3RDIA 3VYRB 3G1MA 1IN4A 1JUSA 5TGTA 2KIUA 3VB2A 1QNTA 4Y52J 3LA2A 3HUGA 1BR1A 2I8DA 4UHTA 1T2KA 4KMUX 3KP7A 5DD8A 3GO5A 1D3YA 2ESNA 4AIJA 1RUOA 3OIPA 2ZFUA 2BE5F 3DF8A 4BH9A 1UHWA 2WBMA 2O61A 4ZYAA 1OYWA 3HHGA 1O7FA 2GIVA 2M0CA 2A6EF 3N05A 3L2WA 1IXRC 2EQRA 2QVOA 3ZQCA 2LNBA 1U2WA 2LREA 3GFJA 4EJOA 2Y30A 3S17J 4IL6C 5CVUA 1YO5C 2B7EA 3D5SC 4KICA 1UZCA 2TRTA 2IGMA 3KCCA 2WTEA 2K9NA 2WAFA 2M30A 1OCZH 2A6TA 1FY7A 5LLQA 1MBGA 2PX9A 3G3ZA 3N4MA 3ZMVA 2P5VA 1N75A 3RI4A 5IP6A 2MC3A 2XVCA 1EH8A 1ETXA 3BJAA 3S15J 5H6QA 2BY0A 3ZQHA 3WTUC 3WG7H 1UB9A 1D8KA 4QLCU 1IDYA 3FKJA 2LYCA 4G6QA 1LVKA 1R1VA 1Y0NA 5EEHA 3JAMZ 5KAIC 3TO9A 1VFCA 2PG4A 4KDPA 4AC0A 1IRGA 1WH7A 1GV5A 1A6QA 4AM3A 4HLYA 4BE2A 3E0JB 4IZZA 5K5QA 3CJNA 3KZZA 3BG5A 3B02A 4PUSA 2VOPA 1Y6IA 4RBOA 3HRUA 1FOKA 2H27A 3UKGA 1BOBA 5B1AH 2LD5A 3K2ZA 1WKMA 3OL4A 3JTHA 4HSTA 4BEHA 1JHFA 3CC7I 2O3FA 1ZRCA 3BJ6A 2F4OB 1ZGJA 3DEWA 4CHUA 5FRNA 2IS1A 1LEAA 3EDPA 3BP8A 3BT9A 3LSJA 1MJBA 2CV1A 4A5MA 4G7HF 2HFHA 1SFOJ 5FFXA 2GXAA 1A31A 2ME0A 2XROA 3GX4X 5E79C 2K4JA 1W5TA 1FZPB 5ILVA 2QQ9A 2QLZA 1X58A 2A61A 3ECOA 3H9QA 1BI3A 4AU7A 4A3MJ 3TQNA 3PIOF 1Y0UA 2AS5F 1P6RA 3BQZA 4AIKA 2MA3A 2L4AA 2HPIA 1W36C 3F8BA 1JHHA 1UHMA 4G7ZF 1SD4A 2X0LA 1IRXA 1VQ4I 2X9DA 4ON0A 3D5RC 4XSXF 3N97A 1NK2P 1S9HA 4XLHA 2OCCH 3PFIA 4RB2C 1MMAA 2M3AA 2XC7A 3BR2A 4C2UA 1HOMA 2F5CA 4Y13A 1MBEA 1NHAA 3NEUA 3I0TA 3DTIA 5JVTA 4AVZA 3HIFA 4PJMA 1FBQA 5HLTA 2DFIA 2EBIA 1ENHA 3LSGA 3VOEA 5HOOA 1MNMC 2CH0A 2L7KA 3FBIB 3Q9SA 3LWFA 3WU1B 2MD0A 2X1DA 3ZRGA 2FQ3A 1B9MA 3K10A 2IPQX 1R22A 2TCTA 4JYKA 3X2QH 1BW5A 2CG4A 2DQLA 1NG6A 3I59A 2BW3B 4KN7X 4YEJA 1AHDP 2CU7A 5FKLA 3QOEA 3EETA 3RQIA 3ZMDA 1JUMA 3ZQLA 4PJNA 4M6XA 1FT9A 3LMMA 2V26A 3TP0A 2K40A 2STWA 2ZB9A 4OIOF 4Y17A 4A5NA 3CCJI 1XB4A 5J8FA 4RLQA 2JSCA 3GTJJ 3H5AA 4WXHA 1TW2A 1B6AA 4R79A 3SZGA 3MKZA 4H0EA 4GDFA 2OTJI 4XR6A 2RDPA 2XRNA 1EA3A 1MJ9A 3FM5A 3M1EA 4L0YB 2F4MB 3AG1H 4XMYA 3VSLA 2NRAC 4EGYA 1R5HA 3TOAA 2XSDC 2R7DA 2GA1A 3KLOA 4G8XA 5GTIC 5FJ8J 3U2RA 1JKQC 5FD6A 4E7HA 5ICEA 3HRSA 1I3AA 3HBLA 4KMFA 2XPUA 1X2NA 2UXXA 3S16J 2XF7A 1E0EA 1BI0A 1W7PB 2FE3A 2Y0SN 3Q9VA 1E3OC 3AL0B 4LG3A 3JSOA 2OF7A 1PJRA 1JGGA 2LTPA 3E7LA 3J7AO 3OS2A 1XMXA 3LA3A 3G1LA 2BY3A 3HOYJ 2OZ6A 3OYBA 4O3MA 2EFPA 2DAOA 1R4MB 3IH2A 1SC7A 2K27A 5K5RA 2JSPA 2HPMA 4OIQF 3H5NA 1S7EA 3OR1C 1UJ8A 2VXZA 1GUUA 2VKHA 4MFEA 4RMNA 2XHKA 3MVPA 4UV8A 1IXCA 3K4NA 2ZJPF 4XORA 2HDWA 3MKYB 1F5TA 1T0FC 3BZ6A 3DLAA 1ZREA 2JPBA 4XLFA 1XSVA 2K9LA 2E1MC 4ESJA 2VBXA 3LFUA 2XPWA 1IV6A 2CRGA 2BVMA 3VSKA 3T8TA 2CJJA 2HKXA 2TDXA 3CMYA 5EZGA 1USTA 4PJLA 5E8GA 4UUSB 2Y0MA 3E3VA 4M74A 2OJED 5JFRA 3BTJA 1LE8A 3D5LA 1Z6TA 4J01A 4IPAA 4AWXB 1B8IA 3FXMA 1E3PA 4UVBA 4LK1F 1R58A 2FD5A 1X1DA 1F9NA 3B6AA 1DU0A 2MLKA 4KUMA 3RSNA 2RNGA 2DMNA 3L9FA 2XF6A 3QU3A 4RB1A 3FM3A 3P5JA 1FEXA 2JRTA 1FOWA 2KPMA 1YJ9I 2VC1A 4C3JJ 4I98B 1IG7A 3DCFA 4M9SA 3CCYA 1SVOA 2RC4A 4D9JA 1SD6A 3HG9A 4PSXA 1K7AA 2V7FA 5CKTA 4ZYDA 2KHMA 1B1BA 2BVLA 2CW0F 3PO2J 4HAMA 3EUAA 1S72I 1KYZA 5FFZA 1JJ6C 1WPKA 2J5OA 3F8CA 1IGNA 2HYJA 5CJ9A 3JSPA 2XGEA 4CCJA 1JGSA 5E1XA 3JRGA 1ON2A 4CYCA 3GMEA 1P7IA 2LKSA 4L5IA 4MQVA 3LQQA 3M4OJ 2VKDA 5E8IA 1E2XA 5FKMA 4LOCA 1R9TJ 5CVVA 2VIXA 5ED4A 4X1EA 4FX4A 1Z6RA 2XB5A 5F64A 3A03A 4U0WA 1IRZA 2WAQA 1P4XA 3NRVA 3CQZJ 4UB8C 2D5VA 3ABLH 2Z16A 3PUBA 3RIRA 3MAJA 4H4KC 4ANJA 4CSWA 3FXOA 2HVSA 3HZJA 4A12A 1QU3A 4XKVA 3A0HC 4LJZF 3CUOA 2FXAA 2KIMA 1BW6A 2X4HA 1TC3C 5DCFA 1MZBA 3HTSB 3WTZA 4UY8I 2L02A 3GFLA 4MHGA 1V3FA 2PBIA 2AO9A 4BQAA 2L01A 4F91B 3H3VK 3IRRA 4YELA 1OCRH 3VWBA 2MH2A 2DMQA 5AONA 3JRAA 2VKEA 2ZXHA 3DLLF 1RESA 3CUQA 4PFPA 2W00A 2DYSH 1ETOA 2E7XA 2FF4A 1GV2A 3H0DA 4YRVA 2BOLA 3OSFA 2DN0A 5F6FA 4IRGA 4U88A 1ZGWA 2RV8A 1ETWA 1WJ5A 4NHJA 3S3OA 3J81K 2YU3A 4B8XA 3GBGA 5IYBJ 4XQFA 1Z0XA 3I71A 2ZXWH 3DU5A 4XN0A 4QIWN 1VQMI 1SMYF 1SFUA 1J2XA 5DDGA 2K9QA 3CCSI 2QSGX 4A0XA 4E7SA 1A35A 5CVIA 4DNCA 1RR7A 1VNDA 1ETYA 4YG2F 2LC2A 2WA0A 4XLEA 3M7GA 1FYMA 1SAXA 1OPCA 3DWLE 2LP0A 2G0EA 3WE3A 2M5WA 2ZNZA 2XGDA 2VJIA 2EK5A 1FLIA 3LAJA 3SJMA 3M07A 2DPUA 4FQGA 5CPRB 5FLXK 3GZNB 2HQAA 1YITI 2FX0A 2HQ5A 3RKYA 4C2MJ 4XONA 3DTKA 1XS9A 1O3TA 2COMA 3QOPA 1YFHA 5L3GA 2VASA 3QP6A 3JAMK 4BNCA 4BBSJ 5K7FA 4LLNA 1ZR2A 4C30A 1A36A 1HCRA 3TW6A 2XKPA 2HQNA 3FDYA 4RGXA 4IEJA 2EIJH 3OYEA 9ANTA 3ZQIA 1TQIA 3JRFA 5FKOA 3MKWB 1REPC 1WRJA 3E6BA 5FRMA 1BI1A 1DUXC 1D5VA 1U6GA 2GIZA 5KAFC 1Q1HA 1D1BA 4LK0F 3LQRA 1KU9A 1YW7A 5J3LA 3I55I 2AXLA 3IRQA 2E71A 3CCRI 2XAFA 1JUPA 1BI2A 2HU9A 3L2CA 1IN5A 4S05A 3DPLC 4DZPA 2N8GA 1QZEA 2HYGD 4HLXA 4LMYA 1R4NB 3LFKA 1HQCA 2RVCA 3GTPJ 2UUZA 2HTJA 5L3CA 2V1NA 1A6IA 4M9XA 1YTYA 3IH3A 4E7IA 1LFBA 4CCOA 4GXOA 2DQRA 3T5XA 3I54A 3BZCA 4KFCA 1ZLKA 2ZCWA 2HGCA 3JTGA 4BE1A 5LRRA 1RR8C 2BXYA 5GAHJ 3OYJA 3ZCOA 4YFNF 1WVRA 2MGQA 4F93B 4MGRA 3SZTA 2XDVA 2LR8A 2KT0A 2D1HA 2H6CA 4EJTA 1J0RA 4JQFA 4ZDOA 5EF6A 5E18F 3F23A 3L09A 4ENMA 3BC8A 3K7AJ 3LSTA 1RIOH 3K69A 1GDTA 1LDJA 4DBQA 1GT0C 1YRNA 4HYEA 4BU2A 1JTYA 4BL0B 2GWRA 2E36A 5CQEA 1ZG5A 2O8KA 2V1DA 4GFBA 1H9GA 1I6XA 4C2TA 5JR3A 1ON1A 4I6ZA 4U0VA 2K86A 2M8EA 1SVLA 5ERIA 1VZ0A 4BXXJ 4U87A 2HVQA 3M8JA 4XK4A 2VQLA 1Z21A 1X3WB 1ZLJA 1RKWA 4EEFG 1HKQA 2P5LC 4BY1J 5JLWA 4BDYA 3FXRA 2P0WA 3A2KA 4A3JJ 2BHZA 2DA1A 2OC6A 2Z1DA 3KZIC 4XOTA 1F1ZA 2DJIA 2L9RA 2L9VA 1OMIA 5H6RA 4NC7A 4IHVA 4UUTA 3E1SA 1OR7C 3F6VA 1MMDA 3DKXA 4B4CA 4A93J 2KRCA 3ABKH 3B6CA 5GP9A 1ZARA 3QYBA 3SQNA 3T8RA 2Y9ZA 2H8RA 4BS9A 1TBXA 2Q1ZB 2DA2A 1XPXA 2DLLA 3OWTA 2DI3A 2ID3A 2ZJRF 1BN5A 2IS4A 5B66C 1R49A 5IPAA 2NVUB 3HGGA 3ABTA 2R5YA 3K4LA 1CF7A 3JRCA 4A3KJ 1N78A 2CUFA 1HLVA 1AWCA 2K3FA 4NB5A 3LA7A 1HDDC 1D1AA 3WHBA 5LD2C 3CCVI 1U8RA 1DPUA 2X85A 1ZR4A 2DTZA 2IA0A 4BQNA 2V9PA 3TGNA 4XLPF 3FK6A 4UVCA 3W3CA 1ZYRF 2DBBA 3V7RA 3JRHA 4BHPA 3F22A 3BPVA 2XV4S 2KQRA 2ZJQF 1LE8B 1VQ6I 1WGXA 3WU2C 1O3QA 4B09A 2VOOA 4KITB 3WODF 3HL2A 2H94A 1HW2A 1R1UA 4Z2YA 5F0HA 5DS9A 4RAGA 5K7ZA 3OYDA 5A2QK 1BOAA 4CCNA 3QU6A 2GXGA 2EA2A 2FOWA 2QENA 1OQYA 2MH9A 4KISA 2CMPA 1W7PD 4ZYGA 2P4WA 2I10A 2KDOA 2KP6A 4BUPA 1TZLA 5E3OA 1Z67A 1VQ5I 3OYNA 1O57A 3ONQA 1JKRC 3OYAA 3K2AA 4HNUA 1PP8F 3FKIJ 4P9FA 3ULQB 1B72A 4HF0A 3ZXSA 4ENJA 1B9NA 1Z91A 4M3DA 3UNGC 3WTYC 4MTDA 3AL0C 5BQTA 4IRIA 2L9SA 2HDDA 1WJBA 1XGSA 2X51A 1JXSA 2EWNA 2VLAA 1TT5B 2IGNA 4NQWB 2F6CA 3BR6A 3HKZN 4KIGA 4B3XA 1JE8A 1I1GA 3F3XA 3L2RA 1O4XA 4RA2A 2R7UA 4EGZA 4KT5C 4ZYEA 1BIBA 5IY5H 3EYYA 1VTNC 3S1NJ 5DCMA 5KHDA 1QHGA 1FBUA 2M0MA 4TV7A 3I4NJ 4M73A 1UHSA 2P7VB 3KP4A 1TT0A 1UMQA 1HKSA 4ZH4F 2O03A 3U9GA 3CC2I 2CQNA 1X2MA 1TWGJ 3QYEA 1KU3A 2HZTA 4FE7A 2M1BA 2EFWA 1Y56A 4ZZLA 4HV6A 3LL7A 4IJAA 4KIBA 2VE9A 2KDZA 4BQOA 4PGGA 1B59A 1HC8A 1ZG1A 1WJAA 5F27A 2STTA 2R7ZJ 4CXFA 1MSFC 2WV1A 4RLFA 4XIDA 3H3ZA 4CO8A 5EZHA 4GGGA 2W1OA 2A6HF 4IOAF 2DODA 1J7KA 1JT6A 1T56A 2P6SA 4RDUA 1SFKA 2QEXI 4PSWA 5ICGA 3ZGKA 3JRBA 3GZ5A 1QPMA 4BDZA 1FMWA 4D5FA 2DMPA 3PNVA 2ID6A 1GXQA 2Z2SB 4AVPA 5DV5A 1TP4A 5LGUA 1TL8A 3DQVC 3HDDA 4BYYA 2JT1A 1P9QC 4I0BA 3S14J 1IAWA 2W48A 3MD2A 2F2EA 2GQQA 4M6VA 4ENNA 4DBRA 3V7CA 1X1PA 3CDLA 4AIDA 2ZMEC 2NOJB 1Z3YA 3J7ZI 3CZ6A 2NOGA 2XAGA 3UR3C 2J5PA 2BGCA 3AKZA 2ZXIA 4LGWA 3OR2C 2YX4A 2M87A 4M3EA 2DA4A 4IX7A 3ABUA 4Z6YA 3IWFA 4IO9F 3H5RA 2ZFWA 2AQEA 4DJAA 4ZJZA 4F92B 1EF4A 2A5WA 3ERED 5D8KB 4BY7J 1H8AC 4LLLA 1RUNA 2E5ZA 2Y0SA 4BJ6C 5LGNA 4HZFA 4OOIA 1B8IB 3GTMJ 2E1CA 2JVGA 4HV5A 3QP5A 1OKRA 4LIUA 5GPAA 4BEHB 1YRNB 3MZ8A 2BYVE 2KZGA 2R93J 2W4SA 3MCZA 1XDUA 4A6EA 2ISZA 2DA5A 3CMEI 4WX9A 2BY2A 4OMZA 3GW2A 3OYGA 1SFXA 3VPRA 5LHHA 5E3MA 3FK7A 1BC8C 2Y75A 2L2OA 3IH4A 4EM1A 4EJUA 3MWMA 1XGNA 1FYLA 1PDNC 4DZJA 3KP5A 2QA4I 1FWZA 4ASNA 3CCUI 1F36A 1D5YA 5D6FA 2Y9YA 1YS7A 3K1MA 4R1HA 2VXDA 3SDGA 1WZ2A 1G3YA 1KYWA 3G2BA 2RQPA 2RN7A 3GF2A 3DBRB 3WHCA 1H88C 3CD6I 3HSEA 2XIGA 3ZPLA 1PYVA 5D4RA 2GM4A 3U1KA 2JWTA 1J9IA 1TNTA 3VYUB 3Q0VA 5DD4A 2E60A 2RAEA 2AQFA 2ADUA 4ZZDA 3KYLA 3GUDA 1WJDA 2NXNB 2UV1A 3C2GA 2IW5A 4KN4X 1D0YA 2DTRA 5CVRA 1U8BA 2Z33A 2JN6A 2A3SA 2KIQA 1PP7U 4OAYA 1LJ9A 3BJOA 4IQ4A 3HJEA 4FX0A 4QPQA 1V55H 2EIKH 2MG4A 5J1RA 2JMWA 2QM3A 4JOMA 5B5EC 2JA2A 2R7FA 4CICA 1ETVA 1YIOA 4KIFA 1LFPA 3LSPA 3LOCA 4HQMA 4B1RA 3TO7A 5F08A 1DU6A 3MZHA 2WWYA 1FIAA 4EATA 1O3SA 3SZPA 3BTIA 2BY1A 2JRMA 4IOCF 3E5QA 2JK3A 2QZ8A 2LY9A 2FNPA 4BXFA 2P7CB 4HDUA 1FSEA 2JUCA 1K78A 3COAC 3AAFA 3ISPA 3BQYA 4JBAA 1IRFA 2HXOA 3FHZA 3IP4B 4LB5A 3GVAA 3FIWA 3GCMA 5HODA 4FISA 5E3NA 3DXJF 4V2GA 4XRFA 2BW3A 1S8NA 4BJ5C 2W7NA 1S3JA 3QPTA 3MQ0A 5TRDA 5KVRA 4HA8A 3K4KA 3RKXA 2XAQA 2DOEA 4JX4A 4ETSA 5ILSA 2QQ8A 3REOA 1FOXA 1XSDA 5FLVA 2V9KA 4NC8A 4NUBA 4XL9A 3BR5A 2FRHA 1TW3A 3PNTA 5EEGA 3OYLA 1Q1VA 3HXLA 1OYYA 2KKOA 2QSHX 1WSUA 2W25A 4DQ2A 4LLGF 3ABMH 1S29A 3BCAA 3ZMTA 4YFKF 5FKNA 3ERMA 2QBYA 4OIRF 3L2UA 1QRYA 2EINH 1RRJA 2M7BA 1KGSA 2QSFX 3ZQFA 2KRHA 3NWSA 3P9KA 3RTRA 4L18B 1IUFA 2M4GA 3I53A 1R1TA 3SDBA 3H1CA 5FGMA 4G9YA 3V42A 1VQ7I 2B63J 4GCVA 1TWCJ 2ICWG 5H2FC 1APLC 1RZ4A 3R60A 4NBQA 3TP3A 3ML6A 5HLGA 5M5WJ 3DBHB 3HOWJ 4F52A 5FD5A 3BG6A 4L9TA 1SVMA 1FP2A 1LFUP 4WCGA 1R71A 3PJRA 2DA7A 4EMSA 3AFHA 2HDCA 3JCUC 2OCEA 1T33A 4L5JA 3DPUA 4A3GJ 1MW7A 3M1CA 3F21A 1X19A 2DOFA 4BKXA 4PDKA 4RGUA 2DFEA 4F55A 3IV5A 1ORKA 3M8FA 2F5DA 3IKTA 1GVJA 3M8EA 2K5CA 2F5VA 2EZLA 1U9OA 1Y1WJ 4A0YA 4EQQA 1ETQA 2ZSHB 5EGOB 1MBFA 1S7AA 4ITVA 2NNYA 1WCMJ 2IP2A 1P7JA 5ICCA 3AG3H 5DM6F 2QWWA 2YU9J 3J80Z 2K9SA 2OD5A 2DT7B 3LSKA 1EH6A 3ASNH 4NDLA 3M9AA 3OIQA 3G1OA 2BEOA 1M1EB 2X6WA 2M8GX 2PMZA 2VT2A 4HEA2 2HQRA 1MMGA 4M3BA 2GAUA 3OIOA 2Q8KA 3C3WA 3A01B 4IVNA 3WGGA 1XN7A 3FXQA 2OU2A 4L9JA 2O5RA 3Q5FA 3KIOA 2EFOA 2PJRA 3OYHA 2FUG2 2ZJ2A 1FOYA 1SANA 4D7MA 2YPRA 4DIQA 3KP6A 1V54H 2KJCA 1W0TA 2R7TA 4FTHA 1HSTA 2R92J 2Y48A 2JUGA 2NS7A 3S93A 2W84A 1ITYA 1YE9A 1QHHD 2DPDA 1SFEA 2ELHA 1S6LA 2GOMA 4MO7A 2NVXJ 3L7WA 4E7KA 1LUJB 2XF5A 2PQ8A 2Q2EB 1G3TA 4Y15A 3E6MA 3FWEA 5IP7J 1Z7LA 5L3BA 4KA4A 2XRLA 3E97A 4LFUA 2X6XA 3Q0WA 3ELKA 3PUFA 3PL8A 1ETKA 3E5XA 4M72A 4MQ9F 1T39A 5M5YJ 2IJLA 3HC7A 1KU2A 2LDUA 2FBHA 4OWRB 3AG2H 2IGOA 1FTZA 1USSA 3GXOA 3HRTA 1CGPA 1Y8RB 1TWFJ 3CESA 4JK1X 4UVAA 4U0YA 3LSRA 3L00A 2F48A 5JI6A 2CUJA 4AYBN 4RAFA 1U5TB 1R23A 4BXUA 5C4JJ 2JVHA 2EV0A 3W6KB 5F04A 2QYOA 3PNYA 3FXKA 1POGA 2H8WA 2M45A 5EDNA 1R36A 3GEZA 4HX4A 5J1UA 1YJNI 4HG2A 3VODA 3PSFA 2NVQJ 1BJAA 2IEKA 1MH3A 3HOXJ 3FMQA 1W0UA 1XX5A 1AU7A 1H0MA 1T38A 4OMYA 3CJRB 4ZTFA 3HHHA 3QQAA 3AG4H 4BHCA 4NQWA 3IL2A 2K3PA 1X3ZB 3BTLA 2ACJA 4IHXA 3BR0A 1V5EA 1WJEA 3O8GA 3G71I 3FBNB 5E1ZB 2W85A 2WADA 3SFZA 4UV9A 2DMTA 2AXTC 2ECBA 2EZHA 2EJRA 2VQHA 2NYXA 4HOBA 4MEYF 1FIPA 3KEYA 3T0YA 4IHSA 3W2AA 4EVIA 1E17A 3VYSB 1JT0A 4N9HA 4YIRX 4Y33A 4HQEA 3GZ6A 4ABZA 1OISA 4F7ZA 4P1WA 2HYFA 1K79A 1VQ8I 4R8HA 5J1YA 3QWLA 3D0SA 2FOKA 4X6AJ 2EPFA 1E3HA 5D5XB 1LKXA 4XLAA 3DU6A 3C1DA 4A3CJ 1TTYA 2KLOA 3DFGA 4XICA 1RNLA 3OYMA 3HOSA 1D0XA 3PSIA 3K70C 2MFZA 2VC0A 1X3UA 4GYGA 2KISA 5BMZA 1P92A 4Q5SF 3OYCA 1FYKA 4QWQA 2Y31A 2IXSA 5J47A 4YIIA 3CTAA 4RM3A 3OOPA 2HOSA 2L3DA 1T08B 3F72A 4EV0A 3V8LA 1S5LC 1PUFB 1ZRDA 3K4JA 1YX5A 3R0JA 5LHIA 4I76A 1R5ID 1KQ9A 2HTSA 3SEZA 1LEBA 1QZZA 4OAZA 2E1NA 5C3EJ 1P2FA 4II3A 3L2QA 4CZZA 2E7WA 1K6YA 4XN3A 1ZRFA 1VF9A 2R7XA 5HS9A 1BM9A 3SYTA 5JHFA 1MJAA 5KCMA 5EEAA 4HBLA 1WI3A 2KFDA 5HDKA 4MLOA 1XD7A 4CGZA 1R6RA 1Y8QB 2E5NA 2MD5A 4HSRA 1FNNA 3FF5A 3EYIA 3OS1A 2A68F 1ZGAA 2VQCA 4K2EA 3KLNA 2E1OA 2FU4A 1T98A 5KNLA 4EJVA 3CO6C 1MDMA 5EG0A 5ICFA 4L0ZB 2VBYA 1STZA 2ME6A 2HOAA 1RPWA 1JKPC 3QPLA 3R0AA 4HPQA 4Y4RA 5LRSA 1OCOH 4IKFA 4D0PA 3HB9A 2WB1N 2KJBA 2VBWA 3K9TA 3H9JA 2X1EA 2E34A 1EJ9A 1MGTA 2YS9A 1D1CA 1IO2A 3RYPA 1HW1A 3CLQA 1NTCA 1I27A 4ESBA 2K85A 2R5ZB 5J40A 3HOVJ 3IKVA 1LVAA 3DKYA 3EUKL 4XKCA 2CQKA 2LBFB 1ZK8A 1UFMA 1SEUA 1DQUA 3W2VA 2CW8A 1VQLI 3OV8A 1CQTA 5L3FA 2BHYA 3FXLA 3K0LA 3CCLI 4UNOA 5F1RA 3LSIA 2HOEA 1O3RA 3RCOA 4A3FJ 2DO7A 4II2A 1IN8A 4BJTA 1Y1VJ 1LNWA 4IF4A 4XKBA 5DYMA 1NG7A 4HF2A 5K1YA 2ELJA 5F0CA 2L7MP 1TNSA 3DEEA 2R7WA 2LBFA 5ILUA 1TWAJ 2JA6J 2XAHA 3V8KA 1B4AA 5M3FJ 1HXDA 5DCMB 2IA1A 1FJLA 1WI9A 4QSHA 2P5KA 3FX3A 2IRFG 1OCCH 5D6EA 1LB2A 1DP3A 2OV7A 3NWTA 1YQAA 2QUFA 2VB6A 4PJJA 3S32A 5HLIA 3K6GA 4QTRA 3OOUA 3E5UA 4IRHA 2R0QC 4FCYA 2AHQA 4PGHA 2OPTA 4U7BA 3MEXA 2GLOA 2UWMA 2WY8Q 4A3DJ 2I5UA 2P8TA 3W6JB 4E7ZA 3K70D 3RZDJ 1XCVA 5IT9K 3EUHC 2F4IA 2Y69H 1VQPI 2F5FA 2VT3A 2LKPA 1JKOC 4IXAA 3OYKA 3HUGB 1KU7A 2CFXA 1G4DA 1QPIA 2KIFA 3ECHA 3FMSA 2PJRB 3CJTB 4BACA 1FX7A 1JI8A 1A5JA 2NVTJ 4IHWA 2ZNYA 1XGMA 1BIAA 2XB0X 3KFWX 2WV0A 1G59A 1HA8A 3HEFA 3H36A 2XPVA 2RQQA 3JRDA 2RGVA 1AKHB 5KK1A 1MDMB 4M3GA 3WG9A 1IDZA 1D0ZA 2HR3A 1TLHB 2DT6A 4I7HA 1F43A 1Z7UA 2WY7Q 1X1BA 3F0CA 1XSXA 3KYCB 1MMSA 4X0GA 4I99C 2FNAA 4FETA 3CMAI 3KZYA 2PI0A 4G7OF 3RPQA 4DW6A 1BR2A 2R3SA 5D4SA 2R5YB 2BBYA 3BOQA 5LHGA 2LF7A 2W57A 3BWGA 3WGIA 4M3FA 2R7OA 2JA5J 3TBIA 4HX8A 3GLLA 3LAPA 2OTLI 1H89C 1PVEA 5CQGA 2PN6A 1QO0D 3S1QJ 4ESFA 2QF7A 2O9LA 1VQ9I 4M6YA 2FMLA 1TQPA 4MIMA 4XSZF 1YLFA 4O6JA 1DP7P 2R7RA 2V9VA 4UUSA 3PQKA 1RI7A 2DDAA 5E17F 1XCBA 2VJ4A 1I50J 2LVSA 3EQLF 4U7DA 2A69F 1K4SA 2PMHA 1YG2A 1IUYA 2PMZN 4FT8A 1J59A 1MBJA 2UXNA 2Z99A 5EYRA 3ZN1A 4Q4ZF 1W5SA 2QBYB 2CUEA 3I9V2 4WXDA 5BS6A 4I01A 2P81A 1ZELA 4PZJA 5HS7A 2HKOA 1V5FA 5JHUA 1IJWC 3RZOJ 4CUGA 3PIPF 1OYIA 2DK5A 2GOXB 4XLCA 1WH5A 4W1UA 1YI2I 4OIPF 1R7JA 4RAZA 5J4YA 1VQKI 2VE8A 1J09A 2D1VA 3HYIA 1DDNA 4BAYA 3I56I 2ZBKA 3I58A 3H0GJ 1XMAA 5IYCJ 3DKWA 3S1RJ 3ESWB 4GRIA 1Z05A 4CCMA 1FBSA 2OA4A 2OBPA 5GADJ 4BE0A 1IC8A 3TOBA 1W7PA 4XNFA 3QPHA 4E6KG 1W4MA 2EZIA 1HSJA 3BG3A 2E1MB 2FBKA 3IAM2 4EM2A 1QQIA 3J7YJ 3WGHA 4LITA 4G94A 2IA2A 2M34A 3TL4X 4IQJA 4CCKA 1FMVA 2CV0A 1BR4A 3ZMSA 5M5XJ 4HX7A 2OUMA 2DXIA 3V8JA 1MNEA 3PQJA 4E7LA 3CCEI 5B3SH 3G6EI 2M7AA 2WAEA 5IP9J 3T1BA 3TDUC 4KT6A 2XAUA 2WB1A 2MC4A 3CMMA 2VJ5A 3P7NA 5IYDJ 2K7LA 3HKZA 5HLHA 2Z3YA 4I0AA 3WTSC 2Q2EA 1KA8A 2KZVA 2R4GA 3SFIA 5HDGA 3EUHA 3KPHA 4RAYA 3BZKA 2CQQA 2JJ7A 1X1AA 3RPUA 2Z5UA 5FLMJ 1GHCA 1MMNA 1V4RA 1WJFA 1ULYA 4PCQA 3TMOA 3G4SI 3WE2A 4D7NA 2B9SA 3ZQGA 4GYIA 3TKYA 2CFOA 4G6DA 2FEZA 2M4KA 4KNYA 3I59B 5L3EA 5F0FA 1K6OA 4KJZA 2DA3A 1LQ1A 1G3WA 1OR7A 3DTEA 3VDXA 1ERDA 3NQOA 5FB2A 1EH7A 1P4AA 3LSHA 3DBLB 3EPZA 5K7HA 4E70A 1ZHFA 1UELB 4L9NA 4HNVA 3K1NA 2HI3A 5J8CA 3L1PA 3C2BA 2M2EA 2OQRA 2MW8A 4G12A 4EJWA 5HNFA 3H3UA 2PMUA 2DT5A 1DGRM 4Y7NJ 3CUQB 3B73A 2VQGA 3RJPA 1MD0A 1HKTA 1IN6A 4C3HJ 4BGDA 2XAJA 4XLNF 3OSGA 2YUSA 4N9IA 5CYVA 1LPQA 2UZKA 2IT0A 1HBXG 4XRSA 3NAUA 3HOZJ 3WU0A 1X4PA 3H35A 1T0FA 4ZC3A 2VN2A 3F8NA 3GTGJ 3GTOJ 1N25A 5GAEJ 2RKHA 3S3NA 2JZYA 3PM1A 3FISA 1EKEA 2G7HA 3BTCA 2QQBA 5F1JA 4A0ZA 3CC4I 3CJQB 5IT9Z 4CH7A 2BXZA 3S2HJ 1FSHA 2CGPA 1NK3P 3GTLJ 1QZYA 1N77A 3M3YJ 1IZ1A 2EH3A 2IAIA 5A2QZ 1T8IA 3L2VA 1VQOI 3ASOH 3SXYA 4CYCB 1R00A 1W5CC 3IUOA 4RB0A 5L3DA 2MABA 3ZQ7A 2ESHA 2WC2A 1S7OA 2M9HA 4BQQA 5D5UB 2L0KA 4WF2A 3W2WA 3GFIA 6PAXA 2DA6A 4M71A 4KYWA 1MBHA 1SAUA 4S04A 4BBRJ 3J80K 5BOXA 2VONA 2O0YA 3ZMZA 4PK4A 1YS6A 2X6OA 2QKLB 3FMRA 1ZH5A 2LLKA 1DGWY 3SEQA 3JRIA 1UG2A 3FXUA 3HM5A 4RS8A 2L5QA 2LF8A 3O3KA 4J00A 2BZTA 5DM7F 3GFMA 2EZKA 3CLOA 4AYBA 1G6NA 1U3EM 4BHBA 3WTVC 1QVUA 4E4HA 3HSRA 4A3BJ 1D8JA 2HVRA 3ZN0A 3OS0A 4IHYA 3IAS2 3MFKA 3KE2A 2QKMB 2NAZA 2LRDA 4P5OA 2VUMJ 1G8XA 2O6GE 3V4GA 1RETA 2LY1A 2CSOA 4LG0B 3DEUA 4CZCA 3GWZA 1K61A 3WTWC 3VEPA 1XTAA 5FKKA 3OY9A 3K4MA 3C18A 1ZG3A 1X4OA 3VYTB 1OJLA 5J4VA 3R4KA 2JA8J 2DFHA 3MKLA 3QAHA 4L9VA 1TWHJ 1VI0A 2D45A 2XGCA 1RC9A 5GAGJ 4XOPA 3R6SA 2JA7J 4PFOA 3I64A 3P9CA 1XG1A 1I5ZA 2V6EA 4DOZA 3CO7C 1K78B 3O6BB 2IBDA 1HW5A 3HSFA 2DU9A 3WTXC 4ZTJA 3KP3A 1T95A 2HEOA 2G9WA 4P96A 2L9NA 5H20A 3F9KA 2IVMA 1OCTC 2H6BA 2VJJA 3CUQC 4RGRA 4G6TB 4F3QA 4A3LJ 1J75A 4I09A 2EV5A 3R61A 3OYIA 2LKXA 2LOOA 2FMYA 4XRSG 3BLYA 3BCBA 2HWVA 2ZXJA 2K4BA 1YOVB 5B1BH 4B47A 3KX2A 5LEKA 5E1WA 3GTQJ 1G2HA 1U5TC 2LSOA 1JJ8C 1MBKA 4Y3OA 2OAZA 3NARA 3RYRA 4RM2A 3MN2A 3RKWA 4XBFA 2EA4A 4D1QA 3BG9A 3GTKJ 1KQ8A 4XKWA 4AD9A 3J7AY 1I1SA 2FQ4A 2NVYJ 1QA6A 4HDVA 2X1CA 2PJPA 3S2WA 2VL8A 4D5CA 4YIFA 3SHFA 2YX7A 3A1YA 1YX3A 1QGPA 1G3SA 1W36D 2CQXA 4HW0A 4LIVA 3S8PA 1UG0A 3TDZC 4C3IJ 3C7JA 2L4MA 2FBIA 5HNHA 1PUEE 2E19A 2EV6A 1I39A 5DTDA 2R5ZA 2NNNA 2FA5A 1U9NA 2LG4A 2Q0OA 5JLXA 1MKMA 3S3MA 5D5WB 1YW9A 3JR9A 1IXSB 4ZDLA 5LBQA 1BJZA 5HS8A 2C6YA 1JTXA 2DYRH 2EFNA 4XRMA 4LG0A 1H9TA 3BY6A 4DYQA 3CP8A 3K4BA 2HS5A 2ZSIB 2ETHA 2VBZA 4MTEA 3S2DJ 2E35A 1J5YA 1YJWI 4I2OA 2P6TA 4A3IJ 2XASA 2ZKZA 2HNHA 5FLXZ 3HGYA 2CYYA 4LD5A 4Q48A 5BPDA 3PFYA 2ELKA 4JP0A 1WFXA 3A0BC 3KYDB 3BROA 5C44J 3GLXA 5IOYA 3W6VA 4MEXF 3TO6A 5EJCA 1YYVA 4M9ZA 3HOUJ 4QPOA 3RQ4A 2CS3A 4OINF 3ZMUA 1L3LA 2DOAA 4V19K 3DV8A 1MNDA 3GYHX 2B0LA 3HPHA 3U1DA 1PUFA 3J81Z 1Z9CA 2O7OA 5CVJA 4B44A 2EILH 4AUXA 3QRFF 1BL0A 2MSYA 2BV6A 4CCLA 1DPRA 2NS8A 2E2HJ 4DYRA 3G73A 2XUBA 2XSJC 4MFDA 3BPXA 3BDDA 2W82A 3PO3J 2GBYA 5IOZA 1K83J 3I4MJ 3F8FA 2EB7A 1ZQ3P 2KRFA 4HRIA 1SMTA 2KL4A 2VODA 2ECCA 1BA5A 1I6HJ 2X48A 1Z1DA 3F8MA 2FSWA 2PLYA 4UB6C 3A02A 3K1PA 2K9MA 1O7LA 3IWZA 4IHTA 2ZO4A 4A6DA 2DDBA 1GLNA 2IGKA 2LK2A 1OCPA 5LFAA 5E20A 3HRMA 1W1WE 4A2UA 1EV7A 3CDIA 3I4PA 2QGUA 3F6OA 2RREA 4PJ0C 2MYSA 1P4WA 3HTUA 1UAAA 3LSMA 2KMUA 3JREA 3RKQA 4E7JA 2A05A 4C9YA 2Y2ZA 5K5OA 2DCEA 5TJJA 3DP7A 3BG7A 1U78A 2DMUA 3H92A 1MIJA 2ISYA 5HVQC 4HF1A 1BC7C 2OQGA 3ZR8X 4JX5A 3CF5F 1LDDA 4B3AA 2ZMEA 2QQAA 1WWXA 1XC5A 1U0JA 2R7QA 2PFBA 3CF2A 2V79A 3HOTA 2V6CA 1OLTA 2LH9A 1YIJI 1U5TA 2XKOA 2CQ7A 1MSEC 2HOTA 2G7UA 3VFZA 1KONA 5DEQA 2DJNA 4GO1A 5EG0B 3QYFA 1MH4A 5AIPA 3V7SA 3ZOBA 4FASD 3QODA 5M3MJ 3DPTA 4S0HB 2JQ7A 5BPIA 2D2WA 4FHTA 1VQNI 5C4XJ 3I5UA 1AA7A 1Y39A 1ACIA 4HNTA 4UXNA 1AOYA 3A4CA 3E6DA 3CCMI 2E2JJ 4ZDPA 4B48A 3ZP5A 3OL3A 1GVDA 5AIQA 1BBYA 2K02A 3KEOA 4XM3A 3TEDA 1CF7B 3KEQA 1R5GA 4NC6A 4OU0A 3WTTC 2IS2A 4N4OB 4L5EA 3FXJA 3KETA 5HDNA 3P9IA 4EM0B 1ODDA 1FP1D 2CO5A 1OFCX 2VKVA 1KZHA 2ZMEB 4J19A
chains in the Genus database with same CATH topology
2DODA 2CQNA 2KFDA 2KISA 2KZGA 2DOEA 2K85A 2E71A 2KIQA 2LKSA 2B7EA 2JUCA 2L9VA 1UZCA 2DOFA 4FQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOD A;  2CQN A;  2KFD A;  2KIS A;  2KZG A;  2DOE A;  2K85 A;  2E71 A;  2KIQ A;  2LKS A;  2B7E A;  2JUC A;  2L9V A;  1UZC A;  2DOF A;  4FQG A; 
#chains in the Genus database with same CATH topology
 4RB3 C;  2R7V A;  4DYC A;  4MNU A;  2CV2 A;  4O5V A;  1ZKG A;  1IW7 F;  4I02 A;  3O8H A;  1SD5 A;  2QCO A;  3ROU A;  4ENK A;  3D1N I;  5FO5 A;  1IN7 A;  2JTV A;  3MZY A;  1A04 A;  4AIH A;  3BR1 A;  2VPL A;  5D8L B;  1HF0 A;  4CDG A;  4UUV A;  1K4T A;  4V2F A;  3S1M J;  2H1L A;  1I3Q J;  1Z77 A;  3QPS A;  4N4N B;  5DUI A;  4N0B A;  1SD7 A;  1B72 B;  2MLG A;  3H9G A;  4LB6 B;  2EIM H;  3A01 A;  4WWC A;  1XGO A;  2NS0 A;  1ZN2 A;  1HDP A;  2L7F P;  2X6Y A;  2YSR A;  3CCQ I;  1WQ2 A;  4WK8 F;  3HPG A;  4YFX F;  3CP2 A;  5JVG F;  2XGX A;  1C0W A;  2PEX A;  2LMD A;  5D5V B;  5TIS C;  3RPU D;  3OYF A;  2HZD A;  2YR2 A;  1FPQ A;  2DK8 A;  3KP2 A;  4B43 A;  3E6C C;  2LFB A;  4JX6 A;  2H1K A;  3U21 A;  3I3L A;  1GXP A;  1ONV A;  1FTT A;  1L0O C;  4NNJ A;  2CWE A;  3ZQQ A;  1QBJ A;  5GPC A;  2VPR A;  2FJ1 A;  5EGO A;  1TQM A;  4WXC A;  4RGS A;  1IV8 A;  5E3L A;  3O2P E;  5FRO A;  1FC3 A;  1WJC A;  1ZAO A;  2Z9O A;  2OZU A;  4P55 A;  4W97 A;  1F4K A;  2V1U A;  2GXB A;  3CDH A;  3Q3S A;  2V1X A;  5BNG A;  1NH3 A;  3JW4 A;  1Z3X A;  2F5E A;  2JPC A;  4CYD A;  2DW4 A;  1KQ0 A;  5CLS A;  1WHU A;  1LDK B;  2GZW A;  4CA0 A;  3IC7 A;  3BR3 A;  2CW7 A;  1YHQ I;  1ZTR A;  3IHU A;  2EFQ A;  5LEJ A;  3MMY B;  2DFF A;  1XMK A;  5GTH C;  2HXI A;  2LY2 A;  1RKT A;  5LGT A;  4ZYH A;  5DUK A;  2L54 A;  4Q47 A;  2H09 A;  2IS6 A;  3FHN A;  2VI6 A;  5IT3 A;  4P9U A;  2RNJ A;  2MBF A;  4DGW B;  3FZV A;  3Q0U A;  2V4J C;  1V5G A;  2E2I J;  2WAQ N;  3OMY A;  1T6S A;  2A07 F;  1XDS A;  2GA2 A;  5J6X A;  2COB A;  3K4C A;  1QVT A;  4A69 C;  2A5Y B;  3LNQ A;  1AKH A;  1UCR A;  2CUZ A;  2R7S A;  1YW8 A;  3TW7 A;  3C2H A;  2O8X A;  2W24 A;  1IF1 A;  2L7Z A;  2ZC2 A;  4FE4 A;  4A3E J;  1X1C A;  3RDI A;  3VYR B;  3G1M A;  1IN4 A;  1JUS A;  5TGT A;  2KIU A;  3VB2 A;  1QNT A;  4Y52 J;  3LA2 A;  3HUG A;  1BR1 A;  2I8D A;  4UHT A;  1T2K A;  4KMU X;  3KP7 A;  5DD8 A;  3GO5 A;  1D3Y A;  2ESN A;  4AIJ A;  1RUO A;  3OIP A;  2ZFU A;  2BE5 F;  3DF8 A;  4BH9 A;  1UHW A;  2WBM A;  2O61 A;  4ZYA A;  1OYW A;  3HHG A;  1O7F A;  2GIV A;  2M0C A;  2A6E F;  3N05 A;  3L2W A;  1IXR C;  2EQR A;  2QVO A;  3ZQC A;  2LNB A;  1U2W A;  2LRE A;  3GFJ A;  4EJO A;  2Y30 A;  3S17 J;  4IL6 C;  5CVU A;  1YO5 C;  2B7E A;  3D5S C;  4KIC A;  1UZC A;  2TRT A;  2IGM A;  3KCC A;  2WTE A;  2K9N A;  2WAF A;  2M30 A;  1OCZ H;  2A6T A;  1FY7 A;  5LLQ A;  1MBG A;  2PX9 A;  3G3Z A;  3N4M A;  3ZMV A;  2P5V A;  1N75 A;  3RI4 A;  5IP6 A;  2MC3 A;  2XVC A;  1EH8 A;  1ETX A;  3BJA A;  3S15 J;  5H6Q A;  2BY0 A;  3ZQH A;  3WTU C;  3WG7 H;  1UB9 A;  1D8K A;  4QLC U;  1IDY A;  3FKJ A;  2LYC A;  4G6Q A;  1LVK A;  1R1V A;  1Y0N A;  5EEH A;  3JAM Z;  5KAI C;  3TO9 A;  1VFC A;  2PG4 A;  4KDP A;  4AC0 A;  1IRG A;  1WH7 A;  1GV5 A;  1A6Q A;  4AM3 A;  4HLY A;  4BE2 A;  3E0J B;  4IZZ A;  5K5Q A;  3CJN A;  3KZZ A;  3BG5 A;  3B02 A;  4PUS A;  2VOP A;  1Y6I A;  4RBO A;  3HRU A;  1FOK A;  2H27 A;  3UKG A;  1BOB A;  5B1A H;  2LD5 A;  3K2Z A;  1WKM A;  3OL4 A;  3JTH A;  4HST A;  4BEH A;  1JHF A;  3CC7 I;  2O3F A;  1ZRC A;  3BJ6 A;  2F4O B;  1ZGJ A;  3DEW A;  4CHU A;  5FRN A;  2IS1 A;  1LEA A;  3EDP A;  3BP8 A;  3BT9 A;  3LSJ A;  1MJB A;  2CV1 A;  4A5M A;  4G7H F;  2HFH A;  1SFO J;  5FFX A;  2GXA A;  1A31 A;  2ME0 A;  2XRO A;  3GX4 X;  5E79 C;  2K4J A;  1W5T A;  1FZP B;  5ILV A;  2QQ9 A;  2QLZ A;  1X58 A;  2A61 A;  3ECO A;  3H9Q A;  1BI3 A;  4AU7 A;  4A3M J;  3TQN A;  3PIO F;  1Y0U A;  2AS5 F;  1P6R A;  3BQZ A;  4AIK A;  2MA3 A;  2L4A A;  2HPI A;  1W36 C;  3F8B A;  1JHH A;  1UHM A;  4G7Z F;  1SD4 A;  2X0L A;  1IRX A;  1VQ4 I;  2X9D A;  4ON0 A;  3D5R C;  4XSX F;  3N97 A;  1NK2 P;  1S9H A;  4XLH A;  2OCC H;  3PFI A;  4RB2 C;  1MMA A;  2M3A A;  2XC7 A;  3BR2 A;  4C2U A;  1HOM A;  2F5C A;  4Y13 A;  1MBE A;  1NHA A;  3NEU A;  3I0T A;  3DTI A;  5JVT A;  4AVZ A;  3HIF A;  4PJM A;  1FBQ A;  5HLT A;  2DFI A;  2EBI A;  1ENH A;  3LSG A;  3VOE A;  5HOO A;  1MNM C;  2CH0 A;  2L7K A;  3FBI B;  3Q9S A;  3LWF A;  3WU1 B;  2MD0 A;  2X1D A;  3ZRG A;  2FQ3 A;  1B9M A;  3K10 A;  2IPQ X;  1R22 A;  2TCT A;  4JYK A;  3X2Q H;  1BW5 A;  2CG4 A;  2DQL A;  1NG6 A;  3I59 A;  2BW3 B;  4KN7 X;  4YEJ A;  1AHD P;  2CU7 A;  5FKL A;  3QOE A;  3EET A;  3RQI A;  3ZMD A;  1JUM A;  3ZQL A;  4PJN A;  4M6X A;  1FT9 A;  3LMM A;  2V26 A;  3TP0 A;  2K40 A;  2STW A;  2ZB9 A;  4OIO F;  4Y17 A;  4A5N A;  3CCJ I;  1XB4 A;  5J8F A;  4RLQ A;  2JSC A;  3GTJ J;  3H5A A;  4WXH A;  1TW2 A;  1B6A A;  4R79 A;  3SZG A;  3MKZ A;  4H0E A;  4GDF A;  2OTJ I;  4XR6 A;  2RDP A;  2XRN A;  1EA3 A;  1MJ9 A;  3FM5 A;  3M1E A;  4L0Y B;  2F4M B;  3AG1 H;  4XMY A;  3VSL A;  2NRA C;  4EGY A;  1R5H A;  3TOA A;  2XSD C;  2R7D A;  2GA1 A;  3KLO A;  4G8X A;  5GTI C;  5FJ8 J;  3U2R A;  1JKQ C;  5FD6 A;  4E7H A;  5ICE A;  3HRS A;  1I3A A;  3HBL A;  4KMF A;  2XPU A;  1X2N A;  2UXX A;  3S16 J;  2XF7 A;  1E0E A;  1BI0 A;  1W7P B;  2FE3 A;  2Y0S N;  3Q9V A;  1E3O C;  3AL0 B;  4LG3 A;  3JSO A;  2OF7 A;  1PJR A;  1JGG A;  2LTP A;  3E7L A;  3J7A O;  3OS2 A;  1XMX A;  3LA3 A;  3G1L A;  2BY3 A;  3HOY J;  2OZ6 A;  3OYB A;  4O3M A;  2EFP A;  2DAO A;  1R4M B;  3IH2 A;  1SC7 A;  2K27 A;  5K5R A;  2JSP A;  2HPM A;  4OIQ F;  3H5N A;  1S7E A;  3OR1 C;  1UJ8 A;  2VXZ A;  1GUU A;  2VKH A;  4MFE A;  4RMN A;  2XHK A;  3MVP A;  4UV8 A;  1IXC A;  3K4N A;  2ZJP F;  4XOR A;  2HDW A;  3MKY B;  1F5T A;  1T0F C;  3BZ6 A;  3DLA A;  1ZRE A;  2JPB A;  4XLF A;  1XSV A;  2K9L A;  2E1M C;  4ESJ A;  2VBX A;  3LFU A;  2XPW A;  1IV6 A;  2CRG A;  2BVM A;  3VSK A;  3T8T A;  2CJJ A;  2HKX A;  2TDX A;  3CMY A;  5EZG A;  1UST A;  4PJL A;  5E8G A;  4UUS B;  2Y0M A;  3E3V A;  4M74 A;  2OJE D;  5JFR A;  3BTJ A;  1LE8 A;  3D5L A;  1Z6T A;  4J01 A;  4IPA A;  4AWX B;  1B8I A;  3FXM A;  1E3P A;  4UVB A;  4LK1 F;  1R58 A;  2FD5 A;  1X1D A;  1F9N A;  3B6A A;  1DU0 A;  2MLK A;  4KUM A;  3RSN A;  2RNG A;  2DMN A;  3L9F A;  2XF6 A;  3QU3 A;  4RB1 A;  3FM3 A;  3P5J A;  1FEX A;  2JRT A;  1FOW A;  2KPM A;  1YJ9 I;  2VC1 A;  4C3J J;  4I98 B;  1IG7 A;  3DCF A;  4M9S A;  3CCY A;  1SVO A;  2RC4 A;  4D9J A;  1SD6 A;  3HG9 A;  4PSX A;  1K7A A;  2V7F A;  5CKT A;  4ZYD A;  2KHM A;  1B1B A;  2BVL A;  2CW0 F;  3PO2 J;  4HAM A;  3EUA A;  1S72 I;  1KYZ A;  5FFZ A;  1JJ6 C;  1WPK A;  2J5O A;  3F8C A;  1IGN A;  2HYJ A;  5CJ9 A;  3JSP A;  2XGE A;  4CCJ A;  1JGS A;  5E1X A;  3JRG A;  1ON2 A;  4CYC A;  3GME A;  1P7I A;  2LKS A;  4L5I A;  4MQV A;  3LQQ A;  3M4O J;  2VKD A;  5E8I A;  1E2X A;  5FKM A;  4LOC A;  1R9T J;  5CVV A;  2VIX A;  5ED4 A;  4X1E A;  4FX4 A;  1Z6R A;  2XB5 A;  5F64 A;  3A03 A;  4U0W A;  1IRZ A;  2WAQ A;  1P4X A;  3NRV A;  3CQZ J;  4UB8 C;  2D5V A;  3ABL H;  2Z16 A;  3PUB A;  3RIR A;  3MAJ A;  4H4K C;  4ANJ A;  4CSW A;  3FXO A;  2HVS A;  3HZJ A;  4A12 A;  1QU3 A;  4XKV A;  3A0H C;  4LJZ F;  3CUO A;  2FXA A;  2KIM A;  1BW6 A;  2X4H A;  1TC3 C;  5DCF A;  1MZB A;  3HTS B;  3WTZ A;  4UY8 I;  2L02 A;  3GFL A;  4MHG A;  1V3F A;  2PBI A;  2AO9 A;  4BQA A;  2L01 A;  4F91 B;  3H3V K;  3IRR A;  4YEL A;  1OCR H;  3VWB A;  2MH2 A;  2DMQ A;  5AON A;  3JRA A;  2VKE A;  2ZXH A;  3DLL F;  1RES A;  3CUQ A;  4PFP A;  2W00 A;  2DYS H;  1ETO A;  2E7X A;  2FF4 A;  1GV2 A;  3H0D A;  4YRV A;  2BOL A;  3OSF A;  2DN0 A;  5F6F A;  4IRG A;  4U88 A;  1ZGW A;  2RV8 A;  1ETW A;  1WJ5 A;  4NHJ A;  3S3O A;  3J81 K;  2YU3 A;  4B8X A;  3GBG A;  5IYB J;  4XQF A;  1Z0X A;  3I71 A;  2ZXW H;  3DU5 A;  4XN0 A;  4QIW N;  1VQM I;  1SMY F;  1SFU A;  1J2X A;  5DDG A;  2K9Q A;  3CCS I;  2QSG X;  4A0X A;  4E7S A;  1A35 A;  5CVI A;  4DNC A;  1RR7 A;  1VND A;  1ETY A;  4YG2 F;  2LC2 A;  2WA0 A;  4XLE A;  3M7G A;  1FYM A;  1SAX A;  1OPC A;  3DWL E;  2LP0 A;  2G0E A;  3WE3 A;  2M5W A;  2ZNZ A;  2XGD A;  2VJI A;  2EK5 A;  1FLI A;  3LAJ A;  3SJM A;  3M07 A;  2DPU A;  4FQG A;  5CPR B;  5FLX K;  3GZN B;  2HQA A;  1YIT I;  2FX0 A;  2HQ5 A;  3RKY A;  4C2M J;  4XON A;  3DTK A;  1XS9 A;  1O3T A;  2COM A;  3QOP A;  1YFH A;  5L3G A;  2VAS A;  3QP6 A;  3JAM K;  4BNC A;  4BBS J;  5K7F A;  4LLN A;  1ZR2 A;  4C30 A;  1A36 A;  1HCR A;  3TW6 A;  2XKP A;  2HQN A;  3FDY A;  4RGX A;  4IEJ A;  2EIJ H;  3OYE A;  9ANT A;  3ZQI A;  1TQI A;  3JRF A;  5FKO A;  3MKW B;  1REP C;  1WRJ A;  3E6B A;  5FRM A;  1BI1 A;  1DUX C;  1D5V A;  1U6G A;  2GIZ A;  5KAF C;  1Q1H A;  1D1B A;  4LK0 F;  3LQR A;  1KU9 A;  1YW7 A;  5J3L A;  3I55 I;  2AXL A;  3IRQ A;  2E71 A;  3CCR I;  2XAF A;  1JUP A;  1BI2 A;  2HU9 A;  3L2C A;  1IN5 A;  4S05 A;  3DPL C;  4DZP A;  2N8G A;  1QZE A;  2HYG D;  4HLX A;  4LMY A;  1R4N B;  3LFK A;  1HQC A;  2RVC A;  3GTP J;  2UUZ A;  2HTJ A;  5L3C A;  2V1N A;  1A6I A;  4M9X A;  1YTY A;  3IH3 A;  4E7I A;  1LFB A;  4CCO A;  4GXO A;  2DQR A;  3T5X A;  3I54 A;  3BZC A;  4KFC A;  1ZLK A;  2ZCW A;  2HGC A;  3JTG A;  4BE1 A;  5LRR A;  1RR8 C;  2BXY A;  5GAH J;  3OYJ A;  3ZCO A;  4YFN F;  1WVR A;  2MGQ A;  4F93 B;  4MGR A;  3SZT A;  2XDV A;  2LR8 A;  2KT0 A;  2D1H A;  2H6C A;  4EJT A;  1J0R A;  4JQF A;  4ZDO A;  5EF6 A;  5E18 F;  3F23 A;  3L09 A;  4ENM A;  3BC8 A;  3K7A J;  3LST A;  1RIO H;  3K69 A;  1GDT A;  1LDJ A;  4DBQ A;  1GT0 C;  1YRN A;  4HYE A;  4BU2 A;  1JTY A;  4BL0 B;  2GWR A;  2E36 A;  5CQE A;  1ZG5 A;  2O8K A;  2V1D A;  4GFB A;  1H9G A;  1I6X A;  4C2T A;  5JR3 A;  1ON1 A;  4I6Z A;  4U0V A;  2K86 A;  2M8E A;  1SVL A;  5ERI A;  1VZ0 A;  4BXX J;  4U87 A;  2HVQ A;  3M8J A;  4XK4 A;  2VQL A;  1Z21 A;  1X3W B;  1ZLJ A;  1RKW A;  4EEF G;  1HKQ A;  2P5L C;  4BY1 J;  5JLW A;  4BDY A;  3FXR A;  2P0W A;  3A2K A;  4A3J J;  2BHZ A;  2DA1 A;  2OC6 A;  2Z1D A;  3KZI C;  4XOT A;  1F1Z A;  2DJI A;  2L9R A;  2L9V A;  1OMI A;  5H6R A;  4NC7 A;  4IHV A;  4UUT A;  3E1S A;  1OR7 C;  3F6V A;  1MMD A;  3DKX A;  4B4C A;  4A93 J;  2KRC A;  3ABK H;  3B6C A;  5GP9 A;  1ZAR A;  3QYB A;  3SQN A;  3T8R A;  2Y9Z A;  2H8R A;  4BS9 A;  1TBX A;  2Q1Z B;  2DA2 A;  1XPX A;  2DLL A;  3OWT A;  2DI3 A;  2ID3 A;  2ZJR F;  1BN5 A;  2IS4 A;  5B66 C;  1R49 A;  5IPA A;  2NVU B;  3HGG A;  3ABT A;  2R5Y A;  3K4L A;  1CF7 A;  3JRC A;  4A3K J;  1N78 A;  2CUF A;  1HLV A;  1AWC A;  2K3F A;  4NB5 A;  3LA7 A;  1HDD C;  1D1A A;  3WHB A;  5LD2 C;  3CCV I;  1U8R A;  1DPU A;  2X85 A;  1ZR4 A;  2DTZ A;  2IA0 A;  4BQN A;  2V9P A;  3TGN A;  4XLP F;  3FK6 A;  4UVC A;  3W3C A;  1ZYR F;  2DBB A;  3V7R A;  3JRH A;  4BHP A;  3F22 A;  3BPV A;  2XV4 S;  2KQR A;  2ZJQ F;  1LE8 B;  1VQ6 I;  1WGX A;  3WU2 C;  1O3Q A;  4B09 A;  2VOO A;  4KIT B;  3WOD F;  3HL2 A;  2H94 A;  1HW2 A;  1R1U A;  4Z2Y A;  5F0H A;  5DS9 A;  4RAG A;  5K7Z A;  3OYD A;  5A2Q K;  1BOA A;  4CCN A;  3QU6 A;  2GXG A;  2EA2 A;  2FOW A;  2QEN A;  1OQY A;  2MH9 A;  4KIS A;  2CMP A;  1W7P D;  4ZYG A;  2P4W A;  2I10 A;  2KDO A;  2KP6 A;  4BUP A;  1TZL A;  5E3O A;  1Z67 A;  1VQ5 I;  3OYN A;  1O57 A;  3ONQ A;  1JKR C;  3OYA A;  3K2A A;  4HNU A;  1PP8 F;  3FKI J;  4P9F A;  3ULQ B;  1B72 A;  4HF0 A;  3ZXS A;  4ENJ A;  1B9N A;  1Z91 A;  4M3D A;  3UNG C;  3WTY C;  4MTD A;  3AL0 C;  5BQT A;  4IRI A;  2L9S A;  2HDD A;  1WJB A;  1XGS A;  2X51 A;  1JXS A;  2EWN A;  2VLA A;  1TT5 B;  2IGN A;  4NQW B;  2F6C A;  3BR6 A;  3HKZ N;  4KIG A;  4B3X A;  1JE8 A;  1I1G A;  3F3X A;  3L2R A;  1O4X A;  4RA2 A;  2R7U A;  4EGZ A;  4KT5 C;  4ZYE A;  1BIB A;  5IY5 H;  3EYY A;  1VTN C;  3S1N J;  5DCM A;  5KHD A;  1QHG A;  1FBU A;  2M0M A;  4TV7 A;  3I4N J;  4M73 A;  1UHS A;  2P7V B;  3KP4 A;  1TT0 A;  1UMQ A;  1HKS A;  4ZH4 F;  2O03 A;  3U9G A;  3CC2 I;  2CQN A;  1X2M A;  1TWG J;  3QYE A;  1KU3 A;  2HZT A;  4FE7 A;  2M1B A;  2EFW A;  1Y56 A;  4ZZL A;  4HV6 A;  3LL7 A;  4IJA A;  4KIB A;  2VE9 A;  2KDZ A;  4BQO A;  4PGG A;  1B59 A;  1HC8 A;  1ZG1 A;  1WJA A;  5F27 A;  2STT A;  2R7Z J;  4CXF A;  1MSF C;  2WV1 A;  4RLF A;  4XID A;  3H3Z A;  4CO8 A;  5EZH A;  4GGG A;  2W1O A;  2A6H F;  4IOA F;  2DOD A;  1J7K A;  1JT6 A;  1T56 A;  2P6S A;  4RDU A;  1SFK A;  2QEX I;  4PSW A;  5ICG A;  3ZGK A;  3JRB A;  3GZ5 A;  1QPM A;  4BDZ A;  1FMW A;  4D5F A;  2DMP A;  3PNV A;  2ID6 A;  1GXQ A;  2Z2S B;  4AVP A;  5DV5 A;  1TP4 A;  5LGU A;  1TL8 A;  3DQV C;  3HDD A;  4BYY A;  2JT1 A;  1P9Q C;  4I0B A;  3S14 J;  1IAW A;  2W48 A;  3MD2 A;  2F2E A;  2GQQ A;  4M6V A;  4ENN A;  4DBR A;  3V7C A;  1X1P A;  3CDL A;  4AID A;  2ZME C;  2NOJ B;  1Z3Y A;  3J7Z I;  3CZ6 A;  2NOG A;  2XAG A;  3UR3 C;  2J5P A;  2BGC A;  3AKZ A;  2ZXI A;  4LGW A;  3OR2 C;  2YX4 A;  2M87 A;  4M3E A;  2DA4 A;  4IX7 A;  3ABU A;  4Z6Y A;  3IWF A;  4IO9 F;  3H5R A;  2ZFW A;  2AQE A;  4DJA A;  4ZJZ A;  4F92 B;  1EF4 A;  2A5W A;  3ERE D;  5D8K B;  4BY7 J;  1H8A C;  4LLL A;  1RUN A;  2E5Z A;  2Y0S A;  4BJ6 C;  5LGN A;  4HZF A;  4OOI A;  1B8I B;  3GTM J;  2E1C A;  2JVG A;  4HV5 A;  3QP5 A;  1OKR A;  4LIU A;  5GPA A;  4BEH B;  1YRN B;  3MZ8 A;  2BYV E;  2KZG A;  2R93 J;  2W4S A;  3MCZ A;  1XDU A;  4A6E A;  2ISZ A;  2DA5 A;  3CME I;  4WX9 A;  2BY2 A;  4OMZ A;  3GW2 A;  3OYG A;  1SFX A;  3VPR A;  5LHH A;  5E3M A;  3FK7 A;  1BC8 C;  2Y75 A;  2L2O A;  3IH4 A;  4EM1 A;  4EJU A;  3MWM A;  1XGN A;  1FYL A;  1PDN C;  4DZJ A;  3KP5 A;  2QA4 I;  1FWZ A;  4ASN A;  3CCU I;  1F36 A;  1D5Y A;  5D6F A;  2Y9Y A;  1YS7 A;  3K1M A;  4R1H A;  2VXD A;  3SDG A;  1WZ2 A;  1G3Y A;  1KYW A;  3G2B A;  2RQP A;  2RN7 A;  3GF2 A;  3DBR B;  3WHC A;  1H88 C;  3CD6 I;  3HSE A;  2XIG A;  3ZPL A;  1PYV A;  5D4R A;  2GM4 A;  3U1K A;  2JWT A;  1J9I A;  1TNT A;  3VYU B;  3Q0V A;  5DD4 A;  2E60 A;  2RAE A;  2AQF A;  2ADU A;  4ZZD A;  3KYL A;  3GUD A;  1WJD A;  2NXN B;  2UV1 A;  3C2G A;  2IW5 A;  4KN4 X;  1D0Y A;  2DTR A;  5CVR A;  1U8B A;  2Z33 A;  2JN6 A;  2A3S A;  2KIQ A;  1PP7 U;  4OAY A;  1LJ9 A;  3BJO A;  4IQ4 A;  3HJE A;  4FX0 A;  4QPQ A;  1V55 H;  2EIK H;  2MG4 A;  5J1R A;  2JMW A;  2QM3 A;  4JOM A;  5B5E C;  2JA2 A;  2R7F A;  4CIC A;  1ETV A;  1YIO A;  4KIF A;  1LFP A;  3LSP A;  3LOC A;  4HQM A;  4B1R A;  3TO7 A;  5F08 A;  1DU6 A;  3MZH A;  2WWY A;  1FIA A;  4EAT A;  1O3S A;  3SZP A;  3BTI A;  2BY1 A;  2JRM A;  4IOC F;  3E5Q A;  2JK3 A;  2QZ8 A;  2LY9 A;  2FNP A;  4BXF A;  2P7C B;  4HDU A;  1FSE A;  2JUC A;  1K78 A;  3COA C;  3AAF A;  3ISP A;  3BQY A;  4JBA A;  1IRF A;  2HXO A;  3FHZ A;  3IP4 B;  4LB5 A;  3GVA A;  3FIW A;  3GCM A;  5HOD A;  4FIS A;  5E3N A;  3DXJ F;  4V2G A;  4XRF A;  2BW3 A;  1S8N A;  4BJ5 C;  2W7N A;  1S3J A;  3QPT A;  3MQ0 A;  5TRD A;  5KVR A;  4HA8 A;  3K4K A;  3RKX A;  2XAQ A;  2DOE A;  4JX4 A;  4ETS A;  5ILS A;  2QQ8 A;  3REO A;  1FOX A;  1XSD A;  5FLV A;  2V9K A;  4NC8 A;  4NUB A;  4XL9 A;  3BR5 A;  2FRH A;  1TW3 A;  3PNT A;  5EEG A;  3OYL A;  1Q1V A;  3HXL A;  1OYY A;  2KKO A;  2QSH X;  1WSU A;  2W25 A;  4DQ2 A;  4LLG F;  3ABM H;  1S29 A;  3BCA A;  3ZMT A;  4YFK F;  5FKN A;  3ERM A;  2QBY A;  4OIR F;  3L2U A;  1QRY A;  2EIN H;  1RRJ A;  2M7B A;  1KGS A;  2QSF X;  3ZQF A;  2KRH A;  3NWS A;  3P9K A;  3RTR A;  4L18 B;  1IUF A;  2M4G A;  3I53 A;  1R1T A;  3SDB A;  3H1C A;  5FGM A;  4G9Y A;  3V42 A;  1VQ7 I;  2B63 J;  4GCV A;  1TWC J;  2ICW G;  5H2F C;  1APL C;  1RZ4 A;  3R60 A;  4NBQ A;  3TP3 A;  3ML6 A;  5HLG A;  5M5W J;  3DBH B;  3HOW J;  4F52 A;  5FD5 A;  3BG6 A;  4L9T A;  1SVM A;  1FP2 A;  1LFU P;  4WCG A;  1R71 A;  3PJR A;  2DA7 A;  4EMS A;  3AFH A;  2HDC A;  3JCU C;  2OCE A;  1T33 A;  4L5J A;  3DPU A;  4A3G J;  1MW7 A;  3M1C A;  3F21 A;  1X19 A;  2DOF A;  4BKX A;  4PDK A;  4RGU A;  2DFE A;  4F55 A;  3IV5 A;  1ORK A;  3M8F A;  2F5D A;  3IKT A;  1GVJ A;  3M8E A;  2K5C A;  2F5V A;  2EZL A;  1U9O A;  1Y1W J;  4A0Y A;  4EQQ A;  1ETQ A;  2ZSH B;  5EGO B;  1MBF A;  1S7A A;  4ITV A;  2NNY A;  1WCM J;  2IP2 A;  1P7J A;  5ICC A;  3AG3 H;  5DM6 F;  2QWW A;  2YU9 J;  3J80 Z;  2K9S A;  2OD5 A;  2DT7 B;  3LSK A;  1EH6 A;  3ASN H;  4NDL A;  3M9A A;  3OIQ A;  3G1O A;  2BEO A;  1M1E B;  2X6W A;  2M8G X;  2PMZ A;  2VT2 A;  4HEA 2;  2HQR A;  1MMG A;  4M3B A;  2GAU A;  3OIO A;  2Q8K A;  3C3W A;  3A01 B;  4IVN A;  3WGG A;  1XN7 A;  3FXQ A;  2OU2 A;  4L9J A;  2O5R A;  3Q5F A;  3KIO A;  2EFO A;  2PJR A;  3OYH A;  2FUG 2;  2ZJ2 A;  1FOY A;  1SAN A;  4D7M A;  2YPR A;  4DIQ A;  3KP6 A;  1V54 H;  2KJC A;  1W0T A;  2R7T A;  4FTH A;  1HST A;  2R92 J;  2Y48 A;  2JUG A;  2NS7 A;  3S93 A;  2W84 A;  1ITY A;  1YE9 A;  1QHH D;  2DPD A;  1SFE A;  2ELH A;  1S6L A;  2GOM A;  4MO7 A;  2NVX J;  3L7W A;  4E7K A;  1LUJ B;  2XF5 A;  2PQ8 A;  2Q2E B;  1G3T A;  4Y15 A;  3E6M A;  3FWE A;  5IP7 J;  1Z7L A;  5L3B A;  4KA4 A;  2XRL A;  3E97 A;  4LFU A;  2X6X A;  3Q0W A;  3ELK A;  3PUF A;  3PL8 A;  1ETK A;  3E5X A;  4M72 A;  4MQ9 F;  1T39 A;  5M5Y J;  2IJL A;  3HC7 A;  1KU2 A;  2LDU A;  2FBH A;  4OWR B;  3AG2 H;  2IGO A;  1FTZ A;  1USS A;  3GXO A;  3HRT A;  1CGP A;  1Y8R B;  1TWF J;  3CES A;  4JK1 X;  4UVA A;  4U0Y A;  3LSR A;  3L00 A;  2F48 A;  5JI6 A;  2CUJ A;  4AYB N;  4RAF A;  1U5T B;  1R23 A;  4BXU A;  5C4J J;  2JVH A;  2EV0 A;  3W6K B;  5F04 A;  2QYO A;  3PNY A;  3FXK A;  1POG A;  2H8W A;  2M45 A;  5EDN A;  1R36 A;  3GEZ A;  4HX4 A;  5J1U A;  1YJN I;  4HG2 A;  3VOD A;  3PSF A;  2NVQ J;  1BJA A;  2IEK A;  1MH3 A;  3HOX J;  3FMQ A;  1W0U A;  1XX5 A;  1AU7 A;  1H0M A;  1T38 A;  4OMY A;  3CJR B;  4ZTF A;  3HHH A;  3QQA A;  3AG4 H;  4BHC A;  4NQW A;  3IL2 A;  2K3P A;  1X3Z B;  3BTL A;  2ACJ A;  4IHX A;  3BR0 A;  1V5E A;  1WJE A;  3O8G A;  3G71 I;  3FBN B;  5E1Z B;  2W85 A;  2WAD A;  3SFZ A;  4UV9 A;  2DMT A;  2AXT C;  2ECB A;  2EZH A;  2EJR A;  2VQH A;  2NYX A;  4HOB A;  4MEY F;  1FIP A;  3KEY A;  3T0Y A;  4IHS A;  3W2A A;  4EVI A;  1E17 A;  3VYS B;  1JT0 A;  4N9H A;  4YIR X;  4Y33 A;  4HQE A;  3GZ6 A;  4ABZ A;  1OIS A;  4F7Z A;  4P1W A;  2HYF A;  1K79 A;  1VQ8 I;  4R8H A;  5J1Y A;  3QWL A;  3D0S A;  2FOK A;  4X6A J;  2EPF A;  1E3H A;  5D5X B;  1LKX A;  4XLA A;  3DU6 A;  3C1D A;  4A3C J;  1TTY A;  2KLO A;  3DFG A;  4XIC A;  1RNL A;  3OYM A;  3HOS A;  1D0X A;  3PSI A;  3K70 C;  2MFZ A;  2VC0 A;  1X3U A;  4GYG A;  2KIS A;  5BMZ A;  1P92 A;  4Q5S F;  3OYC A;  1FYK A;  4QWQ A;  2Y31 A;  2IXS A;  5J47 A;  4YII A;  3CTA A;  4RM3 A;  3OOP A;  2HOS A;  2L3D A;  1T08 B;  3F72 A;  4EV0 A;  3V8L A;  1S5L C;  1PUF B;  1ZRD A;  3K4J A;  1YX5 A;  3R0J A;  5LHI A;  4I76 A;  1R5I D;  1KQ9 A;  2HTS A;  3SEZ A;  1LEB A;  1QZZ A;  4OAZ A;  2E1N A;  5C3E J;  1P2F A;  4II3 A;  3L2Q A;  4CZZ A;  2E7W A;  1K6Y A;  4XN3 A;  1ZRF A;  1VF9 A;  2R7X A;  5HS9 A;  1BM9 A;  3SYT A;  5JHF A;  1MJA A;  5KCM A;  5EEA A;  4HBL A;  1WI3 A;  2KFD A;  5HDK A;  4MLO A;  1XD7 A;  4CGZ A;  1R6R A;  1Y8Q B;  2E5N A;  2MD5 A;  4HSR A;  1FNN A;  3FF5 A;  3EYI A;  3OS1 A;  2A68 F;  1ZGA A;  2VQC A;  4K2E A;  3KLN A;  2E1O A;  2FU4 A;  1T98 A;  5KNL A;  4EJV A;  3CO6 C;  1MDM A;  5EG0 A;  5ICF A;  4L0Z B;  2VBY A;  1STZ A;  2ME6 A;  2HOA A;  1RPW A;  1JKP C;  3QPL A;  3R0A A;  4HPQ A;  4Y4R A;  5LRS A;  1OCO H;  4IKF A;  4D0P A;  3HB9 A;  2WB1 N;  2KJB A;  2VBW A;  3K9T A;  3H9J A;  2X1E A;  2E34 A;  1EJ9 A;  1MGT A;  2YS9 A;  1D1C A;  1IO2 A;  3RYP A;  1HW1 A;  3CLQ A;  1NTC A;  1I27 A;  4ESB A;  2K85 A;  2R5Z B;  5J40 A;  3HOV J;  3IKV A;  1LVA A;  3DKY A;  3EUK L;  4XKC A;  2CQK A;  2LBF B;  1ZK8 A;  1UFM A;  1SEU A;  1DQU A;  3W2V A;  2CW8 A;  1VQL I;  3OV8 A;  1CQT A;  5L3F A;  2BHY A;  3FXL A;  3K0L A;  3CCL I;  4UNO A;  5F1R A;  3LSI A;  2HOE A;  1O3R A;  3RCO A;  4A3F J;  2DO7 A;  4II2 A;  1IN8 A;  4BJT A;  1Y1V J;  1LNW A;  4IF4 A;  4XKB A;  5DYM A;  1NG7 A;  4HF2 A;  5K1Y A;  2ELJ A;  5F0C A;  2L7M P;  1TNS A;  3DEE A;  2R7W A;  2LBF A;  5ILU A;  1TWA J;  2JA6 J;  2XAH A;  3V8K A;  1B4A A;  5M3F J;  1HXD A;  5DCM B;  2IA1 A;  1FJL A;  1WI9 A;  4QSH A;  2P5K A;  3FX3 A;  2IRF G;  1OCC H;  5D6E A;  1LB2 A;  1DP3 A;  2OV7 A;  3NWT A;  1YQA A;  2QUF A;  2VB6 A;  4PJJ A;  3S32 A;  5HLI A;  3K6G A;  4QTR A;  3OOU A;  3E5U A;  4IRH A;  2R0Q C;  4FCY A;  2AHQ A;  4PGH A;  2OPT A;  4U7B A;  3MEX A;  2GLO A;  2UWM A;  2WY8 Q;  4A3D J;  2I5U A;  2P8T A;  3W6J B;  4E7Z A;  3K70 D;  3RZD J;  1XCV A;  5IT9 K;  3EUH C;  2F4I A;  2Y69 H;  1VQP I;  2F5F A;  2VT3 A;  2LKP A;  1JKO C;  4IXA A;  3OYK A;  3HUG B;  1KU7 A;  2CFX A;  1G4D A;  1QPI A;  2KIF A;  3ECH A;  3FMS A;  2PJR B;  3CJT B;  4BAC A;  1FX7 A;  1JI8 A;  1A5J A;  2NVT J;  4IHW A;  2ZNY A;  1XGM A;  1BIA A;  2XB0 X;  3KFW X;  2WV0 A;  1G59 A;  1HA8 A;  3HEF A;  3H36 A;  2XPV A;  2RQQ A;  3JRD A;  2RGV A;  1AKH B;  5KK1 A;  1MDM B;  4M3G A;  3WG9 A;  1IDZ A;  1D0Z A;  2HR3 A;  1TLH B;  2DT6 A;  4I7H A;  1F43 A;  1Z7U A;  2WY7 Q;  1X1B A;  3F0C A;  1XSX A;  3KYC B;  1MMS A;  4X0G A;  4I99 C;  2FNA A;  4FET A;  3CMA I;  3KZY A;  2PI0 A;  4G7O F;  3RPQ A;  4DW6 A;  1BR2 A;  2R3S A;  5D4S A;  2R5Y B;  2BBY A;  3BOQ A;  5LHG A;  2LF7 A;  2W57 A;  3BWG A;  3WGI A;  4M3F A;  2R7O A;  2JA5 J;  3TBI A;  4HX8 A;  3GLL A;  3LAP A;  2OTL I;  1H89 C;  1PVE A;  5CQG A;  2PN6 A;  1QO0 D;  3S1Q J;  4ESF A;  2QF7 A;  2O9L A;  1VQ9 I;  4M6Y A;  2FML A;  1TQP A;  4MIM A;  4XSZ F;  1YLF A;  4O6J A;  1DP7 P;  2R7R A;  2V9V A;  4UUS A;  3PQK A;  1RI7 A;  2DDA A;  5E17 F;  1XCB A;  2VJ4 A;  1I50 J;  2LVS A;  3EQL F;  4U7D A;  2A69 F;  1K4S A;  2PMH A;  1YG2 A;  1IUY A;  2PMZ N;  4FT8 A;  1J59 A;  1MBJ A;  2UXN A;  2Z99 A;  5EYR A;  3ZN1 A;  4Q4Z F;  1W5S A;  2QBY B;  2CUE A;  3I9V 2;  4WXD A;  5BS6 A;  4I01 A;  2P81 A;  1ZEL A;  4PZJ A;  5HS7 A;  2HKO A;  1V5F A;  5JHU A;  1IJW C;  3RZO J;  4CUG A;  3PIP F;  1OYI A;  2DK5 A;  2GOX B;  4XLC A;  1WH5 A;  4W1U A;  1YI2 I;  4OIP F;  1R7J A;  4RAZ A;  5J4Y A;  1VQK I;  2VE8 A;  1J09 A;  2D1V A;  3HYI A;  1DDN A;  4BAY A;  3I56 I;  2ZBK A;  3I58 A;  3H0G J;  1XMA A;  5IYC J;  3DKW A;  3S1R J;  3ESW B;  4GRI A;  1Z05 A;  4CCM A;  1FBS A;  2OA4 A;  2OBP A;  5GAD J;  4BE0 A;  1IC8 A;  3TOB A;  1W7P A;  4XNF A;  3QPH A;  4E6K G;  1W4M A;  2EZI A;  1HSJ A;  3BG3 A;  2E1M B;  2FBK A;  3IAM 2;  4EM2 A;  1QQI A;  3J7Y J;  3WGH A;  4LIT A;  4G94 A;  2IA2 A;  2M34 A;  3TL4 X;  4IQJ A;  4CCK A;  1FMV A;  2CV0 A;  1BR4 A;  3ZMS A;  5M5X J;  4HX7 A;  2OUM A;  2DXI A;  3V8J A;  1MNE A;  3PQJ A;  4E7L A;  3CCE I;  5B3S H;  3G6E I;  2M7A A;  2WAE A;  5IP9 J;  3T1B A;  3TDU C;  4KT6 A;  2XAU A;  2WB1 A;  2MC4 A;  3CMM A;  2VJ5 A;  3P7N A;  5IYD J;  2K7L A;  3HKZ A;  5HLH A;  2Z3Y A;  4I0A A;  3WTS C;  2Q2E A;  1KA8 A;  2KZV A;  2R4G A;  3SFI A;  5HDG A;  3EUH A;  3KPH A;  4RAY A;  3BZK A;  2CQQ A;  2JJ7 A;  1X1A A;  3RPU A;  2Z5U A;  5FLM J;  1GHC A;  1MMN A;  1V4R A;  1WJF A;  1ULY A;  4PCQ A;  3TMO A;  3G4S I;  3WE2 A;  4D7N A;  2B9S A;  3ZQG A;  4GYI A;  3TKY A;  2CFO A;  4G6D A;  2FEZ A;  2M4K A;  4KNY A;  3I59 B;  5L3E A;  5F0F A;  1K6O A;  4KJZ A;  2DA3 A;  1LQ1 A;  1G3W A;  1OR7 A;  3DTE A;  3VDX A;  1ERD A;  3NQO A;  5FB2 A;  1EH7 A;  1P4A A;  3LSH A;  3DBL B;  3EPZ A;  5K7H A;  4E70 A;  1ZHF A;  1UEL B;  4L9N A;  4HNV A;  3K1N A;  2HI3 A;  5J8C A;  3L1P A;  3C2B A;  2M2E A;  2OQR A;  2MW8 A;  4G12 A;  4EJW A;  5HNF A;  3H3U A;  2PMU A;  2DT5 A;  1DGR M;  4Y7N J;  3CUQ B;  3B73 A;  2VQG A;  3RJP A;  1MD0 A;  1HKT A;  1IN6 A;  4C3H J;  4BGD A;  2XAJ A;  4XLN F;  3OSG A;  2YUS A;  4N9I A;  5CYV A;  1LPQ A;  2UZK A;  2IT0 A;  1HBX G;  4XRS A;  3NAU A;  3HOZ J;  3WU0 A;  1X4P A;  3H35 A;  1T0F A;  4ZC3 A;  2VN2 A;  3F8N A;  3GTG J;  3GTO J;  1N25 A;  5GAE J;  2RKH A;  3S3N A;  2JZY A;  3PM1 A;  3FIS A;  1EKE A;  2G7H A;  3BTC A;  2QQB A;  5F1J A;  4A0Z A;  3CC4 I;  3CJQ B;  5IT9 Z;  4CH7 A;  2BXZ A;  3S2H J;  1FSH A;  2CGP A;  1NK3 P;  3GTL J;  1QZY A;  1N77 A;  3M3Y J;  1IZ1 A;  2EH3 A;  2IAI A;  5A2Q Z;  1T8I A;  3L2V A;  1VQO I;  3ASO H;  3SXY A;  4CYC B;  1R00 A;  1W5C C;  3IUO A;  4RB0 A;  5L3D A;  2MAB A;  3ZQ7 A;  2ESH A;  2WC2 A;  1S7O A;  2M9H A;  4BQQ A;  5D5U B;  2L0K A;  4WF2 A;  3W2W A;  3GFI A;  6PAX A;  2DA6 A;  4M71 A;  4KYW A;  1MBH A;  1SAU A;  4S04 A;  4BBR J;  3J80 K;  5BOX A;  2VON A;  2O0Y A;  3ZMZ A;  4PK4 A;  1YS6 A;  2X6O A;  2QKL B;  3FMR A;  1ZH5 A;  2LLK A;  1DGW Y;  3SEQ A;  3JRI A;  1UG2 A;  3FXU A;  3HM5 A;  4RS8 A;  2L5Q A;  2LF8 A;  3O3K A;  4J00 A;  2BZT A;  5DM7 F;  3GFM A;  2EZK A;  3CLO A;  4AYB A;  1G6N A;  1U3E M;  4BHB A;  3WTV C;  1QVU A;  4E4H A;  3HSR A;  4A3B J;  1D8J A;  2HVR A;  3ZN0 A;  3OS0 A;  4IHY A;  3IAS 2;  3MFK A;  3KE2 A;  2QKM B;  2NAZ A;  2LRD A;  4P5O A;  2VUM J;  1G8X A;  2O6G E;  3V4G A;  1RET A;  2LY1 A;  2CSO A;  4LG0 B;  3DEU A;  4CZC A;  3GWZ A;  1K61 A;  3WTW C;  3VEP A;  1XTA A;  5FKK A;  3OY9 A;  3K4M A;  3C18 A;  1ZG3 A;  1X4O A;  3VYT B;  1OJL A;  5J4V A;  3R4K A;  2JA8 J;  2DFH A;  3MKL A;  3QAH A;  4L9V A;  1TWH J;  1VI0 A;  2D45 A;  2XGC A;  1RC9 A;  5GAG J;  4XOP A;  3R6S A;  2JA7 J;  4PFO A;  3I64 A;  3P9C A;  1XG1 A;  1I5Z A;  2V6E A;  4DOZ A;  3CO7 C;  1K78 B;  3O6B B;  2IBD A;  1HW5 A;  3HSF A;  2DU9 A;  3WTX C;  4ZTJ A;  3KP3 A;  1T95 A;  2HEO A;  2G9W A;  4P96 A;  2L9N A;  5H20 A;  3F9K A;  2IVM A;  1OCT C;  2H6B A;  2VJJ A;  3CUQ C;  4RGR A;  4G6T B;  4F3Q A;  4A3L J;  1J75 A;  4I09 A;  2EV5 A;  3R61 A;  3OYI A;  2LKX A;  2LOO A;  2FMY A;  4XRS G;  3BLY A;  3BCB A;  2HWV A;  2ZXJ A;  2K4B A;  1YOV B;  5B1B H;  4B47 A;  3KX2 A;  5LEK A;  5E1W A;  3GTQ J;  1G2H A;  1U5T C;  2LSO A;  1JJ8 C;  1MBK A;  4Y3O A;  2OAZ A;  3NAR A;  3RYR A;  4RM2 A;  3MN2 A;  3RKW A;  4XBF A;  2EA4 A;  4D1Q A;  3BG9 A;  3GTK J;  1KQ8 A;  4XKW A;  4AD9 A;  3J7A Y;  1I1S A;  2FQ4 A;  2NVY J;  1QA6 A;  4HDV A;  2X1C A;  2PJP A;  3S2W A;  2VL8 A;  4D5C A;  4YIF A;  3SHF A;  2YX7 A;  3A1Y A;  1YX3 A;  1QGP A;  1G3S A;  1W36 D;  2CQX A;  4HW0 A;  4LIV A;  3S8P A;  1UG0 A;  3TDZ C;  4C3I J;  3C7J A;  2L4M A;  2FBI A;  5HNH A;  1PUE E;  2E19 A;  2EV6 A;  1I39 A;  5DTD A;  2R5Z A;  2NNN A;  2FA5 A;  1U9N A;  2LG4 A;  2Q0O A;  5JLX A;  1MKM A;  3S3M A;  5D5W B;  1YW9 A;  3JR9 A;  1IXS B;  4ZDL A;  5LBQ A;  1BJZ A;  5HS8 A;  2C6Y A;  1JTX A;  2DYR H;  2EFN A;  4XRM A;  4LG0 A;  1H9T A;  3BY6 A;  4DYQ A;  3CP8 A;  3K4B A;  2HS5 A;  2ZSI B;  2ETH A;  2VBZ A;  4MTE A;  3S2D J;  2E35 A;  1J5Y A;  1YJW I;  4I2O A;  2P6T A;  4A3I J;  2XAS A;  2ZKZ A;  2HNH A;  5FLX Z;  3HGY A;  2CYY A;  4LD5 A;  4Q48 A;  5BPD A;  3PFY A;  2ELK A;  4JP0 A;  1WFX A;  3A0B C;  3KYD B;  3BRO A;  5C44 J;  3GLX A;  5IOY A;  3W6V A;  4MEX F;  3TO6 A;  5EJC A;  1YYV A;  4M9Z A;  3HOU J;  4QPO A;  3RQ4 A;  2CS3 A;  4OIN F;  3ZMU A;  1L3L A;  2DOA A;  4V19 K;  3DV8 A;  1MND A;  3GYH X;  2B0L A;  3HPH A;  3U1D A;  1PUF A;  3J81 Z;  1Z9C A;  2O7O A;  5CVJ A;  4B44 A;  2EIL H;  4AUX A;  3QRF F;  1BL0 A;  2MSY A;  2BV6 A;  4CCL A;  1DPR A;  2NS8 A;  2E2H J;  4DYR A;  3G73 A;  2XUB A;  2XSJ C;  4MFD A;  3BPX A;  3BDD A;  2W82 A;  3PO3 J;  2GBY A;  5IOZ A;  1K83 J;  3I4M J;  3F8F A;  2EB7 A;  1ZQ3 P;  2KRF A;  4HRI A;  1SMT A;  2KL4 A;  2VOD A;  2ECC A;  1BA5 A;  1I6H J;  2X48 A;  1Z1D A;  3F8M A;  2FSW A;  2PLY A;  4UB6 C;  3A02 A;  3K1P A;  2K9M A;  1O7L A;  3IWZ A;  4IHT A;  2ZO4 A;  4A6D A;  2DDB A;  1GLN A;  2IGK A;  2LK2 A;  1OCP A;  5LFA A;  5E20 A;  3HRM A;  1W1W E;  4A2U A;  1EV7 A;  3CDI A;  3I4P A;  2QGU A;  3F6O A;  2RRE A;  4PJ0 C;  2MYS A;  1P4W A;  3HTU A;  1UAA A;  3LSM A;  2KMU A;  3JRE A;  3RKQ A;  4E7J A;  2A05 A;  4C9Y A;  2Y2Z A;  5K5O A;  2DCE A;  5TJJ A;  3DP7 A;  3BG7 A;  1U78 A;  2DMU A;  3H92 A;  1MIJ A;  2ISY A;  5HVQ C;  4HF1 A;  1BC7 C;  2OQG A;  3ZR8 X;  4JX5 A;  3CF5 F;  1LDD A;  4B3A A;  2ZME A;  2QQA A;  1WWX A;  1XC5 A;  1U0J A;  2R7Q A;  2PFB A;  3CF2 A;  2V79 A;  3HOT A;  2V6C A;  1OLT A;  2LH9 A;  1YIJ I;  1U5T A;  2XKO A;  2CQ7 A;  1MSE C;  2HOT A;  2G7U A;  3VFZ A;  1KON A;  5DEQ A;  2DJN A;  4GO1 A;  5EG0 B;  3QYF A;  1MH4 A;  5AIP A;  3V7S A;  3ZOB A;  4FAS D;  3QOD A;  5M3M J;  3DPT A;  4S0H B;  2JQ7 A;  5BPI A;  2D2W A;  4FHT A;  1VQN I;  5C4X J;  3I5U A;  1AA7 A;  1Y39 A;  1ACI A;  4HNT A;  4UXN A;  1AOY A;  3A4C A;  3E6D A;  3CCM I;  2E2J J;  4ZDP A;  4B48 A;  3ZP5 A;  3OL3 A;  1GVD A;  5AIQ A;  1BBY A;  2K02 A;  3KEO A;  4XM3 A;  3TED A;  1CF7 B;  3KEQ A;  1R5G A;  4NC6 A;  4OU0 A;  3WTT C;  2IS2 A;  4N4O B;  4L5E A;  3FXJ A;  3KET A;  5HDN A;  3P9I A;  4EM0 B;  1ODD A;  1FP1 D;  2CO5 A;  1OFC X;  2VKV A;  1KZH A;  2ZME B;  4J19 A; 
#chains in the Genus database with same CATH homology
 2DOD A;  2CQN A;  2KFD A;  2KIS A;  2KZG A;  2DOE A;  2K85 A;  2E71 A;  2KIQ A;  2LKS A;  2B7E A;  2JUC A;  2L9V A;  1UZC A;  2DOF A;  4FQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...