4DYQA

High resolution crystal structure of terminase small subunit gp1 of the bacterial virus sf6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
b'PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 1 protein
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 37
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dyqA01
1H8AC 3FK6A 3S1MJ 5FJ8J 3HOXJ 3ZQCA 5IP7J 2ECCA 5JLXA 4C3IJ 3W6VA 2YS9A 2E2JJ 2KDZA 2JA6J 1UMQA 2LLKA 2DTZA 3ZQFA 1FEXA 2IEKA 1GV5A 3TEDA 2D5VA 2EZHA 1QRYA 2FJ1A 4IEJA 3OIOA 3B6AA 3TP0A 1HF0A 3RZDJ 5BNGA 3BG3A 3JRHA 1WCMJ 1JT6A 2CJJA 3LNQA 5EG0A 2O9LA 2FD5A 3JRBA 1AKHA 4RBOA 4QTRA 4BBRJ 4A3CJ 3A03A 1TWFJ 2X6OA 5GPAA 2JA5J 2ELKA 2XPUA 2FX0A 2NOGA 3LSRA 2N8GA 3BR6A 3OSFA 2R5YA 1GVDA 2XSDC 5EZHA 3OOUA 1B72B 4C3JJ 5DTDA 1JTYA 2K9SA 2LFBA 1Z0XA 2DA4A 4D7MA 4FE4A 3JR9A 2NS7A 4DW6A 4MO7A 5FLMJ 3H0GJ 2EH3A 4UUSA 2LD5A 2HOSA 2H8RA 2GLOA 3CCYA 4M3GA 3LSJA 5M5XJ 1IGNA 3GTPJ 3GTMJ 4B1RA 2B63J 4A3BJ 4A69C 5IP9J 1MSFC 3S1RJ 1U78A 5M3MJ 4V2FA 1FTTA 2IAIA 1I50J 2H1KA 2W48A 5K7ZA 4XRSA 2Y30A 1A5JA 1MH3A 5EGOA 3JRGA 3NAUA 3G1LA 5IYDJ 1X2NA 1ETWA 5K7FA 1MBKA 2JMWA 5F0HA 5IPAA 4XRSG 1A6IA 4NDLA 1RKWA 5K7HA 2HYJA 1WPKA 2XPWA 1XS9A 2L7MP 2MW8A 3BT9A 5DS9A 3HOYJ 2DA2A 2L9RA 2NVTJ 1I3QJ 3SJMA 1P7JA 3Q3SA 3BR1A 1Y1WJ 1S7EA 5FKMA 4J19A 3SFIA 4AC0A 1P7IA 4BXXJ 1ZK8A 3RZOJ 1ETYA 3HGYA 2VUMJ 4B3AA 2ME0A 1JTXA 1MBHA 3S2HJ 3HEFA 2HXIA 4A3IJ 4JX4A 2GBYA 3IH4A 2LTPA 1JKRC 1JUPA 3BTLA 1K83J 3DCFA 4A3LJ 1T33A 3I4MJ 1FJLA 4A3JJ 3ZQGA 1QVUA 3QQAA 1FIPA 5FKNA 2E19A 2ID6A 4A3MJ 5J3LA 3MN2A 1BL0A 5EF6A 2EQRA 1JUSA 4DYCA 4A93J 4M3EA 1ETKA 1XG1A 3O8HA 2HI3A 4AYBN 3CQZJ 3CDLA 3RQIA 4CYCB 2RAEA 1ETOA 4JP0A 3K7AJ 1BW5A 1QPIA 2EZIA 3A01B 1U9OA 3HBLA 3S15J 2XB5A 3Q0WA 5E3MA 1FIAA 1SANA 1GV2A 2R7ZJ 3C2BA 5FKOA 1RETA 1LFUP 2JA7J 2WB1N 2AHQA 3HDDA 1T56A 2XPVA 5GPCA 2PMZN 3FK7A 4HNVA 1ZQ3P 4M3BA 3ZQHA 2ID3A 1IDYA 4FE7A 2M8GX 3H3VK 1ETQA 3GTKJ 3PO2J 3PO3J 1JUMA 4X1EA 2JJ7A 5J1UA 1WGXA 4IHYA 5FLVA 1VNDA 2DJNA 3Q0UA 1GT0C 1B8IB 1MBJA 1IUFA 3HOZJ 5EDNA 3S1NJ 5FKKA 1PUFA 1YRNB 2EZKA 3FKIJ 3Q0VA 5F0FA 2CUEA 3JREA 1VI0A 1ZKGA 2DA7A 5F04A 1IG7A 1LFBA 3GTOJ 1Q1VA 5C44J 4IHXA 4IHVA 1RESA 2ME6A 3L1PA 3JRIA 2XB0X 3D1NI 2MGQA 3HM5A 4A3DJ 4BY1J 3F0CA 3FIWA 3JRFA 4A3KJ 3BQYA 1LE8B 2R5ZB 1POGA 1APLC 3BR2A 1QVTA 2Y2ZA 1O4XA 4C2MJ 3BTCA 5E3LA 2YUSA 4I76A 4M6VA 5JLWA 1HDDC 2VI6A 3A01A 4W1UA 5C3EJ 1ORKA 1HLVA 4JX6A 4GFBA 2EBIA 1ENHA 1RPWA 4IHWA 1Z77A 1ETVA 5E3OA 3HB9A 1ZR2A 4A3EJ 3ZQLA 3DEWA 2M9HA 3WHCA 1MBFA 3OSGA 3K2AA 3QPLA 4MLOA 4MIMA 2R93J 5M3FJ 5F27A 3GTJJ 1JKQC 1H89C 1HDPA 1MH4A 4S0HB 2DA1A 2CQXA 1HOMA 1D5YA 1B72A 2Y0SN 2LKXA 1BJZA 2CQQA 2NVXJ 2DA3A 3BR3A 1MSEC 2NS8A 2CU7A 3BR0A 4DYQA 2O7OA 2GM4A 2E2HJ 1WH7A 2M2EA 1TWHJ 2ZB9A 3JRDA 2R5YB 2O8KA 4DYRA 1FTZA 2QCOA 4W97A 2VPRA 2E2IJ 1IDZA 2LY9A 1NTCA 2L7ZA 4JYKA 4FCYA 3HOUJ 5GP9A 3HGGA 3ZOBA 1OCPA 4JX5A 1K61A 3JRCA 1MBEA 3MKLA 2WV1A 2HOAA 4LOCA 2CRGA 3IV5A 1OCTC 3HOWJ 1GUUA 2MG4A 1MBGA 3BG5A 5M5WJ 4G12A 2DMTA 2E1OA 3O8GA 1LE8A 3S2DJ 2K9QA 1IV6A 2L0KA 1TWGJ 1RR7A 3LOCA 1JJ6C 2DA5A 2XGDA 2IBDA 2JN6A 5C4JJ 1X58A 4QSHA 3BTJA 3S16J 3B6CA 1UG2A 2XGEA 1R9TJ 2LR8A 3IH2A 5EGOB 4BKXA 2K9NA 1OJLA 5IOYA 3BR5A 4X6AJ 3HKZN 1U8BA 9ANTA 5EEAA 2X9DA 2QF7A 2COBA 2R0QC 1IC8A 3QPSA 1BA5A 1HCRA 1IRZA 1F43A 4MFEA 2I10A 2X48A 4D5CA 2DMUA 5C4XJ 5J1RA 1ZGWA 3S17J 1ETXA 1DU6A 4FISA 3WHBA 2VKVA 2YU9J 1WI3A 2ECBA 4XRMA 1SFOJ 1VF9A 3SDGA 2Y31A 1MNMC 2FQ4A 4M3FA 5M5YJ 3GTLJ 1E3OC 1EF4A 2L7FP 4M3DA 2LVSA 2M0CA 3E7LA 1I6HJ 3TW6A 2TCTA 2HOTA 2XGCA 3LSGA 3I4NJ 4XK4A 1TWAJ 2VKEA 3VPRA 2EZLA 5IYBJ 4EEFG 4AUXA 3GTQJ 4Y7NJ 1RKTA 3ZQIA 1ZR4A 3MVPA 2Y9YA 1JGGA 4RDUA 1CQTA 3GBGA 2DMNA 4CYCA 2Y9ZA 1JJ8C 4BY7J 3BG9A 4V2GA 4DZJA 3S14J 3TP3A 1ITYA 3PM1A 5IP6A 4ABZA 5F0CA 4BBSJ 1TC3C 2R92J 5J1YA 4Y52J 2NVQJ 1BW6A 3GTGJ 1Y1VJ 4QIWN 2LK2A 3CMYA 2OF7A 3BTIA 4I6ZA 1H88C 5F1JA 2CUFA 1TWCJ 4B4CA 4D5FA 1X2MA 5FKLA 1AU7A 1DU0A 2XRLA 5HODA 3S1QJ 1OFCX 1U9NA 5EZGA 2AO9A 5IYCJ 2K40A 2KT0A 2OPTA 3G1MA 5EG0B 1XC5A 1AKHB 3LSPA 1G2HA 1F36A 4XIDA 2WAQN 1UHSA 1VFCA 5F08A 2HQ5A 4FTHA 1B8IA 3NARA 3BQZA 3A02A 1WH5A 2HXOA 4UUTA 1JKOC 2DA6A 1YRNA 3RKQA 2DN0A 4D7NA 1W0TA 1NK3P 2TRTA 3G1OA 1ZTRA 1GDTA 2DMPA 3TW7A 3JRAA 2JWTA 4A3GJ 1NK2P 2M34A 3M4OJ 1AHDP 2MSYA 4C3HJ 3M3YJ 4A3FJ 2JA8J 4L5EA 2HDDA 3IH3A 2G0EA 4UUSB 1JKPC 1JT0A 3FISA 4XICA 1PUFB 1W0UA 4DZPA 2P81A 5E3NA 3UKGA 2R5ZA 5IOZA 5EYRA 2DMQA 2JK3A 1IJWC 3HOVJ 4MFDA 2LP0A 2NVYJ
chains in the Genus database with same CATH superfamily
2IXSA 3HOXJ 4XL9A 3ZQCA 2XRNA 4OAZA 5IP7J 1HKSA 1IN6A 1WRJA 2ZXHA 3KP7A 3ZQFA 1PJRA 1R5ID 3WU0A 4M71A 3TEDA 3U1KA 2EZHA 1TTYA 3I9V2 1TNTA 5E8IA 3CZ6A 3BG3A 3JRHA 2XF5A 1FMWA 3WU2C 3M8FA 1IN4A 1R6RA 2ZKZA 1Y0NA 2V9KA 4HPQA 2O9LA 1PUEE 3JRBA 3A0HC 1AKHA 3VSLA 3S2WA 3P5JA 3SEQA 4WXDA 4IO9F 4Q4ZF 2IS4A 3T1BA 5FFXA 2ZSIB 3NQOA 1U0JA 2JA5J 2JZYA 1FOKA 2MYSA 2FX0A 2ZMEA 2QBYB 3LSRA 1KU9A 3CCLI 2N8GA 4LB6B 2MC3A 1XDUA 3ULQB 4S04A 4ITVA 2VXDA 4BQQA 3OOUA 2M87A 3O6BB 5DTDA 1XCBA 5L3EA 5B5EC 4DW6A 2Z3YA 2IRFG 2RC4A 2LD5A 3FXQA 4CZZA 2H8RA 2EFQA 4QPQA 1FWZA 1BIAA 3CCYA 4M3GA 1U5TB 3GF2A 2HQAA 3E6MA 3U1DA 5DM7F 1IGNA 3GTPJ 3IRQA 2B63J 1SD7A 1U78A 4R8HA 5M3MJ 2HS5A 4V2FA 3HOTA 3GFIA 1R36A 1NH3A 3H1CA 4RB2C 3FXKA 2BXZA 2W48A 2WBMA 4XRSA 2NAZA 1A5JA 3ECHA 1I1GA 1YFHA 2RDPA 2B9SA 2GQQA 3NAUA 2LMDA 5D5XB 1X2NA 1ETWA 5TGTA 2NS0A 3OY9A 3J7ZI 1IN8A 4F92B 2DDAA 1A6IA 4YELA 3GFMA 3U21A 1WSUA 4ENMA 1XCVA 5K7HA 1XPXA 2CW0F 2XPWA 4QPOA 4YIRX 4UV9A 1XSXA 1Y6IA 2MW8A 3BT9A 4HLYA 3DKXA 1XMXA 1Y8RB 2HKXA 4IJAA 1TQMA 5J8FA 3KETA 3DTKA 1NG6A 4LD5A 3LA3A 1S72I 3SJMA 2V6EA 1SFXA 1WJAA 5BOXA 1VQLI 1K78B 1U2WA 4FT8A 4PDKA 3QRFF 4KNYA 2ZFUA 2MLKA 3SFIA 4AD9A 2HEOA 1SFEA 2CWEA 2IVMA 3IP4B 1P7IA 3LA7A 3I71A 3DV8A 5FLXZ 3KFWX 3RZOJ 3LSIA 3COAC 1S8NA 2JQ7A 1VZ0A 3OIQA 3G6EI 2VUMJ 2M7AA 2KPMA 1KZHA 1MBHA 4XM3A 4LG3A 3IH4A 2LTPA 3ZQ7A 1Z05A 4A3LJ 1XMKA 3QQAA 2R7XA 2HVQA 3DF8A 4CCKA 1R1TA 3OYNA 3KP2A 1R23A 1TT5B 2O0YA 3MN2A 2HU9A 2VKHA 5HLIA 1BL0A 1ZG5A 3HUGB 1ETKA 4AYBN 5FO5A 3CQZJ 1FSHA 1FT9A 3CDLA 1H9GA 2DFIA 2EV6A 1XMAA 3EYYA 1ETOA 2VE9A 1BW5A 3ML6A 4BQNA 3KP4A 2EFPA 4ZTJA 5IY5H 1K7AA 1Y39A 1EH8A 4XMYA 3ZN0A 5E3MA 1ZLJA 1S29A 1QNTA 1STZA 2OZ6A 2VASA 3KLOA 1S9HA 3ABLH 1LFUP 2R7UA 2WB1N 3KLNA 2IJLA 2TDXA 3IAS2 4XLFA 4EVIA 5GPCA 2O5RA 4G8XA 2LBFA 1WJFA 1YIOA 5CLSA 4UVCA 3OS0A 2BHYA 1VQNI 2M8GX 3H3VK 1ETQA 2FMYA 2L5QA 3GTKJ 3F23A 5FROA 3CCEI 2V9PA 2JJ7A 5J1UA 2DI3A 1WGXA 3M9AA 5JFRA 1X4OA 1M1EB 1AOYA 1I1SA 1GT0C 3OS1A 4HF2A 3HOZJ 5HDGA 1W5SA 2K02A 4IOAF 2H09A 3OYLA 3LFKA 2EZKA 4BEHB 2W85A 4GO1A 4EM1A 4XORA 3TO7A 2PN6A 3T8TA 1ZELA 4IHVA 5LGNA 3G4SI 3SZGA 3TOBA 4RB0A 3FF5A 1HXDA 2PQ8A 4A0XA 5D5VB 3HM5A 1B9MA 2QVOA 4BY1J 1XX5A 2DU9A 2KP6A 2LREA 2X85A 2GXGA 3WTSC 2V1UA 1LE8B 2LY2A 4HX4A 2WWYA 1APLC 1V54H 5FFZA 3V8JA 1LQ1A 1QQIA 1O4XA 2FOWA 4UY8I 1BI3A 2CFOA 1OCZH 2ZO4A 3OR2C 4I76A 2QSFX 1FOWA 3ERMA 5E3LA 5JLWA 4E7IA 3A01A 3M8EA 4W1UA 1V5GA 1HLVA 2EBIA 3GW2A 2AXLA 3TL4X 5BQTA 2WAQA 3CDIA 1Z77A 2ZC2A 4CO8A 3J80Z 1BJAA 3A0BC 3HB9A 1HSJA 1TP4A 3DKYA 4M9ZA 2MC4A 4A3EJ 1W36C 3ZPLA 3OSGA 3FXUA 3QPLA 1BI2A 4MIMA 3WE3A 1VQOI 2KJCA 2WAEA 2FBKA 5L3CA 4ON0A 3U2RA 1H89C 1UAAA 1HDPA 1MH4A 4S0HB 5D4SA 1UELB 4KT5C 1UFMA 5DEQA 4MQ9F 3FHNA 4WK8F 3BJAA 3HHGA 1D5YA 1B72A 1BJZA 1XDSA 3KP5A 5HLTA 1FOXA 3BR3A 3PJRA 1J7KA 1R71A 2NS8A 1ULYA 2R3SA 5GTHC 4CHUA 3K0LA 5E79C 2HVRA 4I09A 2P6SA 4DYQA 2GM4A 2L9NA 1YJ9I 2M2EA 2PLYA 2R5YB 2O8KA 1IDZA 3AKZA 1BM9A 3X2QH 2LY9A 3L2UA 3WG9A 1ZH5A 4QWQA 2PI0A 2MABA 4FCYA 4WX9A 1Z6RA 1LEBA 4JK1X 3JRCA 2XKOA 1EH6A 3OYIA 2QQ8A 5LD2C 3EETA 1REPC 2XAFA 4LOCA 4ZYAA 1A36A 1OCTC 3PFYA 1GUUA 5DCMB 3UNGC 4OIRF 5M5WJ 2GOMA 4CICA 3T8RA 2DXIA 3S2DJ 1IV6A 2OQRA 3D0SA 4RGXA 3V42A 2JN6A 3CJRB 1X58A 4UV8A 4QSHA 2Z99A 3BTJA 4CZCA 3MKYB 2BY1A 5GTIC 3S16J 1HC8A 3B6CA 2DOAA 3JCUC 4FHTA 3WTZA 5EGOB 3IH2A 3DXJF 2WC2A 1WHUA 5FB2A 2NOJB 2PMZA 3CP8A 1OJLA 4ZDLA 3VYTB 3DP7A 3CDHA 3K2ZA 4PFOA 1U8BA 5EEAA 2QF7A 1P6RA 2XROA 4BE0A 1HCRA 2JPBA 2W84A 2I10A 2X48A 2ZBKA 1R5GA 5A2QZ 4D5CA 3ZGKA 4EV0A 3QU3A 5C4XJ 2KLOA 1USSA 4I0AA 3S17J 4UHTA 4KITB 3GZ6A 3DBRB 2BW3A 5DUIA 2ECBA 5EEGA 3CCMI 2VE8A 3B02A 4BJTA 3ZRGA 2L4MA 1SFOJ 1HA8A 3SDGA 2Y31A 4EMSA 3CLQA 2EK5A 2D45A 1EF4A 5J47A 1GXQA 3E7LA 2F5EA 2EIKH 1ZYRF 3TW6A 5BPIA 2K4JA 4CYDA 5F1RA 2F2EA 5CVRA 3OOPA 5GAEJ 1E2XA 3LSGA 5KHDA 4KN4X 4UVAA 2EWNA 2VKEA 4EEFG 1BR2A 2R7SA 1L0OC 4H0EA 1RKTA 1QBJA 1ON1A 3RCOA 1ZR4A 3MVPA 1PP8F 4B3XA 1CQTA 2W24A 4KA4A 3GBGA 3I64A 2DMNA 1OYYA 3OYHA 3E0JB 1WVRA 1C0WA 1MGTA 1JJ8C 4DZJA 3H35A 4C2TA 3S14J 4MQVA 1ITYA 2CSOA 2HZTA 3PM1A 3CUQB 4XLPF 3HRUA 2R92J 4UB6C 4Y52J 2VL8A 2P5LC 1BW6A 2E1NA 1BR4A 2W57A 2FEZA 3CMYA 4AWXB 1LDJA 2VC0A 2VONA 5F1JA 1J75A 3CJNA 2GAUA 3F9KA 1DU0A 3HSFA 1D1CA 2CV1A 5EG0B 5TRDA 3K6GA 3GLLA 2XIGA 2V7FA 2QKMB 2XSJC 3DU5A 5F08A 2RREA 3NARA 4UUTA 2EB7A 2K9LA 2RKHA 3D5LA 4OAYA 5LBQA 1YO5C 2NRAC 1YHQI 1YW7A 1MMGA 3AL0C 3FKJA 2HVSA 4M72A 1OLTA 2G7HA 2X51A 1HSTA 2MD5A 2JWTA 1TQIA 4A3GJ 1A35A 1Z7UA 2LF8A 2MSYA 1AHDP 2P8TA 2JA8J 3GUDA 2HDDA 1BOAA 2G0EA 2A6HF 1JT0A 1IN7A 4CCJA 4XICA 1T39A 1PUFB 4AYBA 4MGRA 2P81A 4ZDOA 2R5ZA 2H8WA 5IOZA 2HNHA 4UB8C 2VIXA 1IJWC 4AM3A 2IPQX 2QUFA 1RC9A 3NWTA 3HOVJ 4MFDA 5E1WA 2QA4I 1FBUA 4ESFA 1XGMA 1Z1DA 3S1MJ 1U8RA 2M7BA 2DK5A 1KYWA 2ECCA 5JLXA 4C3IJ 2DFEA 2L9VA 2YS9A 3OYMA 4QLCU 2KDZA 4BE2A 2E2JJ 3LWFA 4BAYA 2JA6J 4PJ0C 2LLKA 2DODA 2DTZA 2IEKA 3QYFA 1Y0UA 4IEJA 3OIOA 3WG7H 3B6AA 4A12A 3TP0A 1E3PA 1YQAA 3H9GA 1HF0A 2J5OA 2D2WA 2A5YB 5BNGA 3OYBA 3RZDJ 1WCMJ 1FSEA 3CUOA 5D6EA 2XGXA 2CJJA 4PJNA 4WCGA 2CG4A 4BBRJ 1ZAOA 2QKLB 1B9NA 1Z21A 1N75A 4NHJA 3CCSI 2EV0A 3MAJA 2XPUA 2IA0A 2XVCA 4NC7A 2Z9OA 2BV6A 1SFUA 4MHGA 1SFKA 3OYEA 2JUGA 1AA7A 3S93A 2F6CA 3OSFA 5JHUA 4HRIA 2OAZA 3FM5A 2Y75A 3I4PA 2BEOA 1JTYA 2LFBA 5AONA 4D7MA 2VJ5A 4FE4A 2D1VA 3LSHA 4GGGA 5FLMJ 1TW2A 2GWRA 2EH3A 4LJZF 4A0ZA 4UUSA 3DLLF 3GEZA 4E7LA 3JW4A 2LSOA 5B1AH 3IWFA 4YEJA 3IHUA 3LSJA 4PSXA 5M5XJ 1DP7P 2KKOA 1B6AA 2A05A 2NNYA 3GVAA 4LITA 4A3BJ 4A69C 2XC7A 2XHKA 3WTVC 5B3SH 3TO9A 3WGHA 4IVNA 4IHSA 1VQ8I 2IAIA 4NNJA 3BY6A 2Y30A 2DCEA 1WJ5A 2XUBA 4CCMA 4ZZLA 1H9TA 4OMYA 2X0LA 4B8XA 1RIOH 3DTEA 3DLAA 4XBFA 2HTJA 3E1SA 5K7FA 3DU6A 2ISYA 2P0WA 1PYVA 4EJVA 2VODA 2ICWG 4G6TB 4BHBA 4XRSG 1R4MB 3E97A 4CH7A 5IPAA 1YJWI 4HF0A 4A2UA 1PVEA 2W7NA 2FNPA 3HOSA 4KJZA 1G3SA 3W6KB 2DJIA 2KZVA 4G94A 3ASOH 5DS9A 1X1CA 1HBXG 1XB4A 2E1MB 2HPIA 2X4HA 2ZNYA 4EQQA 2XDVA 2NVTJ 1P7JA 3CESA 1TNSA 5HS9A 4BGDA 2QBYA 3CMAI 2X1DA 2F4MB 2XF6A 1Z91A 5FKMA 1XTAA 4LIUA 1BC7C 5KAIC 2XV4S 2V9VA 1X1PA 2MA3A 2VJ4A 4R1HA 2IA2A 3WU1B 4DIQA 1ZREA 1D8JA 1Q1HA 3V7RA 3ABUA 3ZQQA 2KHMA 1XN7A 2G9WA 2HXIA 2WY8Q 3LSMA 2GBYA 2K27A 4PFPA 4L9JA 4CGZA 5DM6F 3FBIB 3PIOF 1OCOH 1U5TA 3BCAA 3BTLA 3I3LA 3E5UA 2COMA 4A3JJ 2I5UA 1QVUA 1YI2I 1IO2A 2VXZA 1RNLA 2GA2A 3OS2A 3DPTA 5J3LA 5GAHJ 4D1QA 4IRHA 1P9QC 4RLFA 2F4OB 4LB5A 2VOOA 1KYZA 2WAFA 3CCJI 2DBBA 3GZ5A 1EKEA 4CXFA 4CYCB 4G7HF 3BWGA 4JQFA 3HYIA 2HQRA 1QPIA 4XRFA 1U9OA 5J4VA 3KEYA 4HOBA 4KT6A 4C30A 3WGGA 3ECOA 3CMEI 1ZHFA 5KVRA 1FIAA 1GV2A 2KMUA 3C2BA 3WTTC 3RYRA 2HKOA 2YX7A 5CPRB 1R58A 1MJAA 2WA0A 2PMZN 1DUXC 3AG2H 4M3BA 3CJQB 2CQKA 2QM3A 3I5UA 1I27A 5FD6A 5JI6A 1QA6A 2MH9A 4FE7A 4ZZDA 4HSRA 4E6KG 1K78A 5E8GA 3PO2J 1UB9A 4P1WA 4X1EA 1OR7A 1YX3A 1X3WB 4I99C 3V8KA 4BHPA 3OYAA 2YX4A 1IV8A 4IHYA 3ZN1A 4XOTA 2F5CA 3I54A 5CYVA 3S1NJ 1G3WA 2ZJPF 5FKKA 2HZDA 1YRNB 3ABTA 4BYYA 1QGPA 2FNAA 3FMQA 2X1CA 2DA7A 4AU7A 3MFKA 1IG7A 2ETHA 4PGHA 3OR1C 1IXSB 3GTOJ 2EILH 5C44J 5IT3A 4F52A 2ME6A 4D0PA 1G3TA 2CW8A 2LKSA 2ZXWH 3LAJA 4ZYDA 1DP3A 2KL4A 4L5IA 4MNUA 2K86A 1B4AA 2MGQA 4UNOA 3FBNB 4ZC3A 3EYIA 5D8LB 2KQRA 3F0CA 4D9JA 1U5TC 3JTHA 3FXRA 2EINH 4FX0A 2VJIA 3P9CA 1EH7A 4F7ZA 2FSWA 3DFGA 2CH0A 3J7AO 5LHGA 3N4MA 1QVTA 4E7JA 4PK4A 4HA8A 4A5MA 4C2MJ 2A6TA 3BTCA 1WJCA 2XAJA 2AQFA 2IGOA 2LOOA 3GMEA 1LB2A 2VI6A 2R7TA 5HS7A 1R49A 1MMSA 2KDOA 5C3EJ 2ISZA 1ORKA 2ZNZA 2CGPA 2K3FA 2K5CA 5D5UB 4GFBA 3H5NA 4XLEA 4IHWA 2BVMA 1ETVA 3SYTA 3OYGA 1WJDA 2UWMA 2PG4A 5E3OA 3ZMVA 1ZR2A 1Z3XA 3ZQLA 1CGPA 3DEWA 1IAWA 2HQNA 3K2AA 2R93J 4XONA 3E3VA 5F27A 3FXLA 1N77A 4PSWA 3DWLE 3MZ8A 3K69A 5J8CA 2CQXA 3SZTA 1HOMA 4E70A 4RA2A 3RSNA 5KK1A 2DA3A 3MMYB 2RVCA 3IUOA 5ERIA 1MSEC 5JR3A 2CU7A 3CF2A 2ZMEB 3O2PE 4NQWB 1GHCA 2VQGA 4LK0F 2YR2A 4JBAA 4ZJZA 2O7OA 1FP1D 2PMUA 2QZ8A 4BEHA 3JRDA 1Y8QB 1TWHJ 3M1EA 4AIHA 1K6OA 2UXXA 4DYRA 4W97A 2VPRA 1OR7C 1IRXA 2FE3A 2OC6A 5GP9A 5DCFA 3CCRI 1K61A 4AIJA 1MBEA 1MDMB 5JVGF 2HOAA 3W6JB 2CRGA 2PMHA 1DPUA 2DLLA 1MBGA 2Z16A 3RDIA 3LFUA 1USTA 5ICGA 2W1OA 3HIFA 2E1OA 3O8GA 1LE8A 1BC8C 2OA4A 4IRIA 3KEOA 1RR7A 3VFZA 3Q9SA 1D8KA 3L7WA 1TBXA 5C4JJ 4H4KC 2BXYA 4TV7A 2W82A 4O6JA 4FASD 3REOA 1HW2A 5CKTA 1G3YA 1R9TJ 1EJ9A 2BY0A 4N0BA 4RAGA 2K9NA 1IRGA 4Q48A 5CQGA 5IOYA 2JPCA 3BR5A 3FMSA 4UXNA 5HNHA 3QOPA 2PJRB 2QLZA 9ANTA 2X9DA 2R0QC 1V55H 1BA5A 4A6DA 2FUG2 2A5WA 2E34A 1FOYA 3HG9A 1VQ6I 2DMUA 3A4CA 2JUCA 1TLHB 1ZGWA 1JXSA 1WI9A 2VBYA 1DU6A 3WHBA 3ESWB 4E7ZA 4EGYA 4E7HA 4OINF 1LUJB 3HL2A 1LVAA 1VF9A 5DYMA 2ACJA 1MNMC 3GTLJ 2E71A 4RLQA 4M3DA 2LVSA 2M0CA 1X4PA 1S6LA 1I6HJ 4YRVA 1E0EA 1CF7A 1W7PA 5HLGA 1RUOA 2KIUA 3PIPF 1ZG1A 1FMVA 1O7LA 4RB1A 2EZLA 1W5TA 5DCMA 4AUXA 1YTYA 3L09A 4Y7NJ 3PQKA 1D1BA 1Z9CA 3RKXA 1X1BA 3P9IA 3PNYA 1JHHA 2O8XA 1JHFA 2L54A 2F48A 3ZR8X 3GZNB 3TP3A 3RYPA 2W00A 4ABZA 1K4SA 4HNTA 1L3LA 3DKWA 4IQ4A 3QYBA 2R7QA 3GTGJ 3OYCA 2QSHX 3A2KA 4G6QA 1W36D 1YW8A 4RMNA 2OCEA 4Z2YA 1PP7U 2IS1A 1ZGAA 5K5RA 3W2VA 2MLGA 4PJLA 3H0DA 2CUFA 2Z1DA 1DDNA 5FKLA 4E7SA 2XRLA 3CTAA 1U9NA 4XKBA 5LRRA 3QU6A 4RAFA 2KT0A 3CC2I 2Y0SA 4NC8A 4KYWA 2FU4A 3S3OA 5FLXK 3AFHA 1UHSA 1R00A 2LYCA 3K10A 1VFCA 2H27A 4FTHA 1B8IA 3BQZA 2HXOA 1RI7A 4I7HA 3L00A 5D5WB 1GVJA 1WJBA 4AVZA 2DA6A 4HBLA 3MKZA 3PQJA 1B1BA 2DN0A 1R5HA 4RGSA 4D7NA 2P7VB 3G3ZA 2TRTA 4KUMA 5AIPA 1ZTRA 3SFZA 1TQPA 2DMPA 3VWBA 4AVPA 1LVKA 5E17F 2H94A 2FF4A 4C3HJ 5KCMA 4E4HA 4CCNA 1LEAA 3M07A 4I01A 4XN0A 4ZTFA 3H9JA 3IAM2 3JAMK 1D0ZA 1W0UA 1A31A 2QGUA 4LLNA 2IGKA 1TT0A 2JRMA 2WY7Q 3BPVA 4ZYEA 5K5QA 4PJMA 2DMQA 2JK3A 1W7PD 4RAYA 2O6GE 1T0FC 4PCQA 2LP0A 2NVYJ 4HEA2 2ZFWA 4B47A 5LHHA 2KIFA 1QZEA 3GX4X 1F4KA 4DBQA 3GFJA 3CUQA 2JRTA 4G7ZF 3F8BA 4P5OA 2L02A 4HZFA 4KIGA 3GWZA 4C2UA 2E7WA 2Z33A 2M0MA 1ERDA 3HKZA 3HRTA 1GV5A 1DPRA 2IGNA 2M5WA 3QWLA 3HPHA 1NHAA 2M4GA 4P9UA 4XN3A 4IX7A 4G7OF 1SC7A 2DFHA 5EG0A 2FD5A 4RBOA 3CCVI 2LF7A 4N4OB 4QTRA 4ESBA 4UUVA 4A3CJ 3H5RA 5KNLA 3A03A 1TWFJ 4XLCA 2BYVE 2PEXA 2ELKA 2B0LA 3VEPA 2DPUA 2NOGA 1WFXA 4WXHA 3CCQI 3DEEA 1OISA 4XLHA 1QHGA 3TBIA 3CLOA 3ZP5A 1GVDA 2VQLA 1ODDA 1ZARA 3IC7A 1B72B 3PL8A 4C3JJ 2K9SA 3QYEA 4U7DA 2JVHA 3SZPA 3JR9A 4YIFA 2STWA 3R6SA 2NS7A 4HW0A 1T08B 3MD2A 4OIOF 3H0GJ 5DD8A 3L2CA 4EM0B 2QEXI 3SDBA 3HSEA 1HKQA 4GCVA 2WV0A 4F91B 4Z6YA 5AIQA 4B1RA 4NC6A 1D0XA 5IP9J 4MEXF 1OPCA 3S1RJ 1U3EM 1HW5A 3ZMDA 1FTTA 4U88A 1LDKB 2WTEA 1I50J 4LK1F 3PFIA 3UR3C 4DOZA 3IKTA 2K85A 1IRFA 3QPHA 4XLNF 2CQ7A 3DBLB 2AQEA 1MH3A 3HHHA 1O7FA 4OWRB 2BY2A 2OCCH 4OU0A 4EJTA 3OIPA 3F6VA 2XKPA 3BJOA 1R1VA 2ZJ2A 5F0HA 3TGNA 2V79A 3CUQC 2JTVA 4NDLA 4P9FA 1O3TA 3J7YJ 2UXNA 2M8EA 2Y48A 3RPUA 2ZJQF 2OTLI 3ROUA 4Q47A 2OZUA 1T95A 2L9RA 1EA3A 4RM2A 2RQPA 1I3QJ 2A69F 1IF1A 3C3WA 3Q3SA 2QQBA 1Y1WJ 2L4AA 3SHFA 2V26A 1S7EA 5E1ZB 1YJNI 5E1XA 3NEUA 1D1AA 2A68F 1MMNA 2EV5A 3OWTA 5DD4A 4AC0A 1P4XA 3K9TA 4ENKA 3FHZA 4BXXJ 2E7XA 1ZK8A 1GXPA 1ETYA 5ED4A 2ADUA 5ILUA 1MZBA 3HRMA 3HGYA 2VBZA 3KYDB 4BXUA 4YFNF 2ME0A 1JTXA 4CUGA 4DGWB 2GOXB 2F5FA 3QODA 3K4CA 2CV2A 1OKRA 3GFLA 1JKRC 1JUPA 3DCFA 1T33A 3I4MJ 3A1YA 1P2FA 4I02A 2HGCA 1SD5A 2Q2EB 1FIPA 5FKNA 2E19A 2ID6A 3F3XA 3E5QA 4LFUA 5HLHA 2AXTC 2XAHA 1KQ9A 3ONQA 4ETSA 4DYCA 4A93J 4M3EA 1XG1A 3G71I 2HI3A 3J81K 3I58A 3VDXA 4GYGA 2L2OA 3GXOA 3RQIA 1YG2A 1OQYA 1UHMA 4JP0A 1S3JA 5LLQA 4ZDPA 3HBLA 3AAFA 5JVTA 2XB5A 4DJAA 5HVQC 1YOVB 1X3UA 1SANA 3LSKA 1R7JA 4HQMA 3WTWC 2P6TA 1T2KA 2EIMH 1RETA 2XF7A 5D8KB 5ICEA 3HDDA 3S3NA 4LLLA 3LSTA 2OQGA 2DO7A 3P7NA 5LEKA 2BZTA 5CVVA 3ZQHA 4ANJA 1SD4A 3AG3H 1IDYA 4YG2F 4BQOA 5LRSA 3IL2A 1FP2A 3IKVA 4RS8A 3ZMZA 3BJ6A 1J2XA 3GO5A 3W2WA 3PO3J 2F5VA 4EGZA 5DUKA 1JUMA 4L18B 4LG0B 1P4WA 5L3FA 5FLVA 2RNJA 1VNDA 2DJNA 1HW1A 3Q0UA 3FM3A 1IN5A 1IUFA 1MBJA 1KQ8A 5EDNA 3HZJA 2GXBA 1U6GA 3FKIJ 2HFHA 3Q0VA 4L0YB 1QZYA 3JREA 4HAMA 1VI0A 1ZKGA 3KZYA 3BLYA 3F21A 1N78A 1Q1VA 2M4KA 3EQLF 4L9NA 4II2A 4ZH4F 4IHXA 1RESA 2NVUB 4A5NA 3JRIA 1P92A 1O3SA 3J7AY 2CUZA 2CMPA 3CCUI 2A6EF 3Q9VA 2Z2SB 3RKWA 2HPMA 4YFKF 3BPXA 2DDBA 2A3SA 4A3DJ 3FIWA 3JRFA 4LIVA 4L0ZB 4GRIA 3BQYA 3GYHX 1X19A 2R5ZB 3RKYA 1POGA 4A0YA 1KU7A 2KIMA 3CO6C 2FBHA 1G59A 2P4WA 2Y2ZA 2MH2A 1FYMA 2YUSA 5CVJA 1ZRCA 4M73A 1HDDC 1KA8A 4Y13A 2OV7A 2M1BA 3C7JA 4JX6A 3S8PA 3VSKA 2VKDA 3DEUA 3M1CA 2M30A 2VT2A 4IZZA 1BI0A 3L2WA 2E36A 2EFOA 4WF2A 1NG7A 2M9HA 1B59A 1MBFA 3FXJA 3WHCA 1HKTA 3PNTA 3TMOA 3WTUC 3KYCB 4B43A 2K9MA 2MBFA 4HDVA 4MEYF 3K70D 3KEQA 2BGCA 4GYIA 1Z3YA 2Y0SN 2E1MC 4XSXF 4FQGA 4XSZF 1QPMA 2NVXJ 1MKMA 3I53A 1ZRFA 4UVBA 5FGMA 1UHWA 2IGMA 2FRHA 2R7DA 5H6QA 3ISPA 2HDWA 1XSVA 1V4RA 3BR0A 5HNFA 4BNCA 5ICCA 2ZB9A 2WADA 1J5YA 2P7CB 3C18A 1FBQA 4LGWA 2X1EA 1NTCA 1LNWA 1J9IA 3QP6A 3HOUJ 3HGGA 3L2QA 3OYKA 3WE2A 2JSCA 3FMRA 1TZLA 1T8IA 1O3QA 3HOWJ 1N25A 2VBWA 3BG5A 2YU3A 3U9GA 3QAHA 1D5VA 4IL6C 1FY7A 3EDPA 1TWGJ 3LOCA 2KZGA 3CJTB 4XOPA 2PJPA 5J4YA 2IBDA 1IW7F 3BZCA 1MMDA 4HG2A 1UJ8A 3KP3A 1UG2A 1F5TA 4BACA 5H2FC 3AG1H 3HXLA 2DOFA 3ERED 1JE8A 1OMIA 2CFXA 2ELHA 4FX4A 1F1ZA 2E5ZA 2Q0OA 3BC8A 5L3BA 3HKZN 5E18F 2R7WA 1VQ4I 1D3YA 3NRVA 4L9VA 2CS3A 5B66C 3RPQA 1IC8A 3L2RA 4PJJA 1MNDA 1QO0D 1F43A 4MFEA 4P55A 2BY3A 2KISA 1IZ1A 5CJ9A 5HS8A 2W25A 4OIQF 1J0RA 1ETXA 3LMMA 1W4MA 1FLIA 4FISA 2R7RA 1RR8C 2YU9J 4XRMA 3RI4A 1MNEA 4NQWA 2O61A 2A61A 2UUZA 3E6DA 3IWZA 1JI8A 4M3FA 3HSRA 4U0VA 1E3OC 3E5XA 2HDCA 6PAXA 2V6CA 4IF4A 5FRMA 3K4NA 3VYUB 3CC7I 1ZGJA 1MDMA 2GIVA 1G4DA 3I4NJ 4XK4A 3CO7C 2CO5A 1TWAJ 5IYBJ 4GDFA 3GTQJ 1W1WE 3HUGA 2OUMA 1OCRH 5IT9K 3ZQIA 3R61A 5HDKA 1GLNA 2Y9YA 3L2VA 4KICA 3I59B 4Y3OA 2VC1A 4OOIA 2Y9ZA 4HDUA 2DFFA 3BG9A 4V2GA 4BY7J 3HRSA 5IP6A 2ZXJA 3KCCA 4BBSJ 3O3KA 3HTSB 1TC3C 4EATA 4DNCA 2VJJA 1RUNA 5JHFA 1XGNA 4RAZA 4QIWN 2DW4A 3EPZA 2LK2A 1WKMA 1BBYA 2OF7A 2M3AA 3T5XA 1KU3A 1XGSA 1H88C 2PBIA 4AIDA 1ZLKA 2PJRA 3R0AA 1AU7A 3L9FA 4IXAA 2KRCA 2DYRH 2UV1A 5F6FA 5HODA 1VQMI 5EZGA 3BG7A 1SMYF 2AO9A 4N4NB 1FYLA 2OPTA 1FYKA 1SAXA 1AKHB 2PFBA 2DTRA 1F36A 3EUKL 4XIDA 1SVLA 1ZG3A 1D0YA 3FWEA 3FXOA 4DQ2A 3MKWB 2B7EA 4EM2A 3A02A 1WH5A 1W5CC 3ZMUA 3H3UA 3C2GA 4F3QA 2GA1A 4A6EA 1X1AA 3V7CA 1DGWY 1NK3P 4B48A 3G1OA 4ENJA 5D4RA 1GDTA 4XLAA 2W4SA 3JRAA 4EJWA 2KFDA 2M34A 1Z7LA 2KRHA 4M6YA 3BP8A 5FD5A 3FX3A 4L5EA 2ZMEC 3IH3A 1DGRM 4BXFA 5D6FA 1E3HA 4IKFA 1WZ2A 4DZPA 3D5RC 1SAUA 4RB3C 5E3NA 2C6YA 2DOEA 3H5AA 5B1BH 1K79A 4X0GA 1LKXA 2J5PA 4OMZA 2ZCWA 5DV5A 4EJOA 1H8AC 3JTGA 2OD5A 3FK6A 1FNNA 5FJ8J 2EPFA 2KIQA 1I6XA 3JAMZ 1RZ4A 4ASNA 4DBRA 4HQEA 3W6VA 3D5SC 3EUHA 1UMQA 5BS6A 1FEXA 3AG4H 1VQ7I 3T0YA 1YW9A 2MD0A 4IPAA 4CDGA 3ASNH 2D5VA 1QRYA 2FJ1A 2A07F 2DT5A 2BBYA 3CF5F 1BIBA 3MWMA 1JT6A 5ICFA 3W3CA 2GZWA 3ABMH 5K5OA 3LNQA 2JT1A 3OYJA 1KQ0A 2KJBA 1XGOA 4U0YA 2X6OA 1HQCA 5GPAA 5K1YA 1A6QA 2FMLA 3GLXA 3F22A 3BR6A 4AIKA 3TOAA 3OYFA 2R5YA 2XSDC 5EZHA 2VBXA 1LPQA 4KN7X 1YS7A 1Z0XA 2DA4A 1I3AA 3PUBA 1T0FA 1R4NB 4BE1A 1V5FA 2JA2A 4BQAA 2M45A 4MO7A 4J00A 3RJPA 3K4LA 2HOSA 2X6YA 4IQJA 2GLOA 3LAPA 3DTIA 2RQQA 3F72A 4CCLA 4LLGF 2LG4A 3WTYC 4Y4RA 3MEXA 2PX9A 3GTMJ 3I56I 4KMUX 1MSFC 3K1PA 2FOKA 3LA2A 4GXOA 2OJED 1KU2A 4BU2A 3R60A 2H1KA 5K7ZA 3R4KA 1I5ZA 2EJRA 2I8DA 1MJBA 5EGOA 3JRGA 4NBQA 4HLXA 1QU3A 2NXNB 2NNNA 3G1LA 5IYDJ 1YS6A 1MBKA 2JMWA 1LJ9A 4O3MA 1DQUA 2YPRA 4Y15A 2HR3A 3QOEA 3OV8A 3F8FA 4HV6A 3SQNA 3H36A 2CW7A 1VQPI 3MCZA 2DYSH 1RKWA 4BH9A 1MMAA 2HYJA 2HYFA 1WPKA 3EUHC 1XS9A 3DPUA 2L7MP 2VQCA 2V1NA 2FA5A 4MTEA 2DA2A 3HOYJ 1J09A 1KGSA 4HSTA 3MQ0A 3W2AA 4Y17A 2LBFB 3BR1A 3WGIA 1MJ9A 2DQLA 4K2EA 3MZHA 3JSPA 1BR1A 2L9SA 5KAFC 2EFNA 4J19A 4RGRA 1ZRDA 2IT0A 2QQ9A 3F8MA 4BJ5C 1RRJA 3K4MA 4G6DA 3VYSB 5F64A 1K6YA 5CVIA 5ILSA 1S5LC 2ESHA 2LY1A 3VB2A 2XAQA 2IS6A 4B3AA 3R0JA 3S2HJ 3HEFA 3S3MA 4I0BA 4JX4A 4A3IJ 4YFXF 3TKYA 3Q5FA 4HX7A 1WJEA 2O3FA 1UCRA 2YSRA 1K83J 3KZIC 3BZ6A 1FJLA 4KMFA 1CF7B 5E20A 3WODF 1W7PB 3ZQGA 1VQKI 1OYWA 1TL8A 3VODA 4A3MJ 3I0TA 1I39A 3C2HA 5EF6A 2EQRA 2BHZA 1JUSA 2DAOA 3O8HA 1BN5A 3IRRA 2IA1A 2ESNA 1YE9A 2FXAA 2BVLA 3DPLC 2RAEA 4XKCA 2ZJRF 4N9IA 3K7AJ 4HV5A 1ON2A 4IOCF 2EZIA 4R79A 3A01B 2H6BA 4XKVA 3S15J 4M9XA 5TISC 2E1CA 3Q0WA 1YYVA 2H6CA 3PSIA 2R7ZJ 2ZXIA 2RGVA 4O5VA 5FKOA 3J81Z 3FDYA 2JA7J 1AWCA 2AHQA 1T56A 2XPVA 3K4BA 3FK7A 1ZQ3P 4HNVA 3QPTA 2KRFA 4WXCA 2ID3A 3KX2A 2VPLA 1ACIA 5EJCA 5LGUA 3PNVA 2QSGX 2LC2A 3HJEA 2CQNA 2V1XA 3VYRB 3H3ZA 4V19K 3BZKA 4XQFA 1MIJA 1VQ9I 2QWWA 5LFAA 1J59A 3HPGA 4XNFA 3C1DA 1B8IB 2XAGA 2VLAA 2E60A 3TDZC 3KYLA 5BPDA 1PUFA 2Y0MA 3F6OA 4KIBA 2JVGA 3OL4A 1QHHD 2BOLA 2CUEA 2LH9A 5F0FA 3ZCOA 4F93B 4IHTA 3V4GA 2XAUA 5F04A 1T38A 1MD0A 3BDDA 2VOPA 3E6BA 1LFBA 1WQ2A 3H9QA 4CA0A 1JGSA 3PUFA 4BJ6C 2VN2A 4HNUA 1LDDA 4BS9A 2UZKA 2R7OA 3L1PA 4HF1A 2XB0X 3BG6A 2EA2A 1A04A 2Q2EA 3D1NI 3ZXSA 2RV8A 5L3GA 3V8LA 3KZZA 2HOEA 4M6XA 2L7KA 4A3KJ 1F9NA 1LFPA 3F8NA 2V1DA 3CC4I 3J80K 2MFZA 3BR2A 4I98B 2K4BA 1V5EA 4F55A 3S32A 2OU2A 5ILVA 1X3ZB 3SXYA 3OMYA 3TQNA 2JSPA 4M6VA 4BL0B 2G7UA 2EIJH 5FRNA 5CQEA 3P9KA 4U87A 4ZYHA 2AS5F 2CUJA 1TW3A 2STTA 1ENHA 1RPWA 2QENA 2ZSHB 2XASA 4EJUA 2O03A 3G73A 4HYEA 2FQ3A 2ELJA 3ELKA 3M7GA 4MLOA 4CSWA 3ZMSA 5M3FJ 3GTJJ 1JKQC 5H20A 3RTRA 2LNBA 2F5DA 2DA1A 4P96A 3AL0B 3RIRA 4CCOA 1XSDA 1IUYA 4LG0A 1T6SA 2LKXA 2CQQA 4M74A 2BW3B 4ENNA 3B73A 3MZYA 4G9YA 2K3PA 5DDGA 2HWVA 5LEJA 2E2HJ 1WH7A 4BHCA 4KISA 3FZVA 2E35A 1FTZA 2FBIA 2QCOA 2E2IJ 3HTUA 4U7BA 3CP2A 1BI1A 4KDPA 5GAGJ 1ONVA 1G8XA 2L7ZA 4HX8A 4JYKA 4Q5SF 1FC3A 1O57A 1OCPA 3BOQA 4JX5A 3ZOBA 2V4JC 3MKLA 2WV1A 1SMTA 5HOOA 4U0WA 3IV5A 5GADJ 3LL7A 2MG4A 1SEUA 1O3RA 4II3A 2DT7B 4G12A 2DMTA 1YX5A 3OYDA 1H0MA 2K9QA 2L0KA 3G2BA 2Q1ZB 1JJ6C 2GXAA 2DA5A 2XGDA 3KE2A 2IW5A 4S05A 4MTDA 1X1DA 3VOEA 2VB6A 5A2QK 1FBSA 2XGEA 1SVMA 1IXRC 2VQHA 1ZN2A 2LR8A 2IS2A 2WB1A 4BKXA 4ESJA 4IRGA 4N9HA 4X6AJ 1Z67A 1YITI 2QQAA 2X6WA 2D1HA 3KP6A 3OL3A 2COBA 3QPSA 3RPUD 2HTSA 2QYOA 5EEHA 1IRZA 3BCBA 1Z6TA 3V7SA 4XR6A 3ABKH 2Q8KA 5CVUA 3NWSA 5J1RA 1FZPB 1PDNC 4I2OA 1FPQA 2DPDA 4RGUA 2L3DA 1WWXA 4Y33A 2VKVA 5HDNA 1WI3A 4BDZA 2LKPA 3H92A 3DQVC 2FQ4A 1KONA 5M5YJ 2L7FP 2RN7A 2P5VA 3N97A 1OCCH 2GIZA 4L5JA 2R4GA 2CV0A 2TCTA 2H1LA 2NYXA 2HOTA 3M8JA 5H6RA 2XGCA 4BUPA 4BDYA 3VPRA 4XKWA 5J6XA 1G6NA 5LGTA 2EFWA 4RDUA 1JGGA 3K4JA 3GCMA 1VQ5I 4CYCA 2R7VA 3KPHA 2BE5F 4KFCA 1QZZA 1T98A 1UZCA 1Y56A 3CMMA 1UG0A 2VT3A 1R1UA 1YIJI 3K1NA 3N05A 4L9TA 5F0CA 3CD6I 1E17A 2LRDA 5J1YA 3WTXC 1S7OA 1EV7A 2NVQJ 5IT9Z 3K1MA 1Y1VJ 1R22A 3LQRA 3ZMTA 4ZYGA 3BTIA 4I6ZA 1SVOA 1SD6A 5LHIA 2P5KA 1TWCJ 1IXCA 5L3DA 4B4CA 4D5FA 4WWCA 1X2MA 3S1QJ 1OFCX 4NUBA 1OYIA 4NB5A 2CYYA 2Z5UA 5IYCJ 2K40A 3G1MA 4E7KA 1XC5A 1VTNC 1P4AA 2OBPA 3FXMA 1FX7A 3LSPA 1G2HA 4KIFA 2R7FA 2WAQN 3EUAA 3KIOA 2DK8A 2DQRA 3TO6A 4JOMA 2X6XA 2HQ5A 2Y69H 2F4IA 5J40A 2OTJI 4PUSA 1JKOC 3I55I 3RQ4A 1YRNA 1YLFA 3RKQA 4PGGA 3BROA 3SEZA 4J01A 3PSFA 3DBHB 1W0TA 3TDUC 4OIPF 3JSOA 1K4TA 3TW7A 2RNGA 3HC7A 3K70C 4M9SA 2L01A 1NK2P 4YIIA 1XD7A 3K4KA 4LMYA 2IP2A 3M4OJ 3M3YJ 3LQQA 4FETA 4A3FJ 4B44A 4C9YA 4UUSB 1JKPC 3FISA 5BMZA 1V3FA 2K7LA 3QP5A 2DT6A 1S7AA 4PZJA 2LDUA 3UKGA 2E5NA 3E6CC 4RM3A 5EYRA 5TJJA 3I59A 1BOBA 4B09A 1MW7A 2EA4A 3F8CA 2HYGD
chains in the Genus database with same CATH topology
1H8AC 3FK6A 3S1MJ 5FJ8J 3HOXJ 3ZQCA 5IP7J 2ECCA 5JLXA 4C3IJ 3W6VA 2YS9A 2E2JJ 2KDZA 2JA6J 1UMQA 2LLKA 2DTZA 3ZQFA 1FEXA 2IEKA 1GV5A 3TEDA 2D5VA 2EZHA 1QRYA 2FJ1A 4IEJA 3OIOA 3B6AA 3TP0A 1HF0A 3RZDJ 5BNGA 3BG3A 3JRHA 1WCMJ 1JT6A 2CJJA 3LNQA 5EG0A 2O9LA 2FD5A 3JRBA 1AKHA 4RBOA 4QTRA 4BBRJ 4A3CJ 3A03A 1TWFJ 2X6OA 5GPAA 2JA5J 2ELKA 2XPUA 2FX0A 2NOGA 3LSRA 2N8GA 3BR6A 3OSFA 2R5YA 1GVDA 2XSDC 5EZHA 3OOUA 1B72B 4C3JJ 5DTDA 1JTYA 2K9SA 2LFBA 1Z0XA 2DA4A 4D7MA 4FE4A 3JR9A 2NS7A 4DW6A 4MO7A 5FLMJ 3H0GJ 2EH3A 4UUSA 2LD5A 2HOSA 2H8RA 2GLOA 3CCYA 4M3GA 3LSJA 5M5XJ 1IGNA 3GTPJ 3GTMJ 4B1RA 2B63J 4A3BJ 4A69C 5IP9J 1MSFC 3S1RJ 1U78A 5M3MJ 4V2FA 1FTTA 2IAIA 1I50J 2H1KA 2W48A 5K7ZA 4XRSA 2Y30A 1A5JA 1MH3A 5EGOA 3JRGA 3NAUA 3G1LA 5IYDJ 1X2NA 1ETWA 5K7FA 1MBKA 2JMWA 5F0HA 5IPAA 4XRSG 1A6IA 4NDLA 1RKWA 5K7HA 2HYJA 1WPKA 2XPWA 1XS9A 2L7MP 2MW8A 3BT9A 5DS9A 3HOYJ 2DA2A 2L9RA 2NVTJ 1I3QJ 3SJMA 1P7JA 3Q3SA 3BR1A 1Y1WJ 1S7EA 5FKMA 4J19A 3SFIA 4AC0A 1P7IA 4BXXJ 1ZK8A 3RZOJ 1ETYA 3HGYA 2VUMJ 4B3AA 2ME0A 1JTXA 1MBHA 3S2HJ 3HEFA 2HXIA 4A3IJ 4JX4A 2GBYA 3IH4A 2LTPA 1JKRC 1JUPA 3BTLA 1K83J 3DCFA 4A3LJ 1T33A 3I4MJ 1FJLA 4A3JJ 3ZQGA 1QVUA 3QQAA 1FIPA 5FKNA 2E19A 2ID6A 4A3MJ 5J3LA 3MN2A 1BL0A 5EF6A 2EQRA 1JUSA 4DYCA 4A93J 4M3EA 1ETKA 1XG1A 3O8HA 2HI3A 4AYBN 3CQZJ 3CDLA 3RQIA 4CYCB 2RAEA 1ETOA 4JP0A 3K7AJ 1BW5A 1QPIA 2EZIA 3A01B 1U9OA 3HBLA 3S15J 2XB5A 3Q0WA 5E3MA 1FIAA 1SANA 1GV2A 2R7ZJ 3C2BA 5FKOA 1RETA 1LFUP 2JA7J 2WB1N 2AHQA 3HDDA 1T56A 2XPVA 5GPCA 2PMZN 3FK7A 4HNVA 1ZQ3P 4M3BA 3ZQHA 2ID3A 1IDYA 4FE7A 2M8GX 3H3VK 1ETQA 3GTKJ 3PO2J 3PO3J 1JUMA 4X1EA 2JJ7A 5J1UA 1WGXA 4IHYA 5FLVA 1VNDA 2DJNA 3Q0UA 1GT0C 1B8IB 1MBJA 1IUFA 3HOZJ 5EDNA 3S1NJ 5FKKA 1PUFA 1YRNB 2EZKA 3FKIJ 3Q0VA 5F0FA 2CUEA 3JREA 1VI0A 1ZKGA 2DA7A 5F04A 1IG7A 1LFBA 3GTOJ 1Q1VA 5C44J 4IHXA 4IHVA 1RESA 2ME6A 3L1PA 3JRIA 2XB0X 3D1NI 2MGQA 3HM5A 4A3DJ 4BY1J 3F0CA 3FIWA 3JRFA 4A3KJ 3BQYA 1LE8B 2R5ZB 1POGA 1APLC 3BR2A 1QVTA 2Y2ZA 1O4XA 4C2MJ 3BTCA 5E3LA 2YUSA 4I76A 4M6VA 5JLWA 1HDDC 2VI6A 3A01A 4W1UA 5C3EJ 1ORKA 1HLVA 4JX6A 4GFBA 2EBIA 1ENHA 1RPWA 4IHWA 1Z77A 1ETVA 5E3OA 3HB9A 1ZR2A 4A3EJ 3ZQLA 3DEWA 2M9HA 3WHCA 1MBFA 3OSGA 3K2AA 3QPLA 4MLOA 4MIMA 2R93J 5M3FJ 5F27A 3GTJJ 1JKQC 1H89C 1HDPA 1MH4A 4S0HB 2DA1A 2CQXA 1HOMA 1D5YA 1B72A 2Y0SN 2LKXA 1BJZA 2CQQA 2NVXJ 2DA3A 3BR3A 1MSEC 2NS8A 2CU7A 3BR0A 4DYQA 2O7OA 2GM4A 2E2HJ 1WH7A 2M2EA 1TWHJ 2ZB9A 3JRDA 2R5YB 2O8KA 4DYRA 1FTZA 2QCOA 4W97A 2VPRA 2E2IJ 1IDZA 2LY9A 1NTCA 2L7ZA 4JYKA 4FCYA 3HOUJ 5GP9A 3HGGA 3ZOBA 1OCPA 4JX5A 1K61A 3JRCA 1MBEA 3MKLA 2WV1A 2HOAA 4LOCA 2CRGA 3IV5A 1OCTC 3HOWJ 1GUUA 2MG4A 1MBGA 3BG5A 5M5WJ 4G12A 2DMTA 2E1OA 3O8GA 1LE8A 3S2DJ 2K9QA 1IV6A 2L0KA 1TWGJ 1RR7A 3LOCA 1JJ6C 2DA5A 2XGDA 2IBDA 2JN6A 5C4JJ 1X58A 4QSHA 3BTJA 3S16J 3B6CA 1UG2A 2XGEA 1R9TJ 2LR8A 3IH2A 5EGOB 4BKXA 2K9NA 1OJLA 5IOYA 3BR5A 4X6AJ 3HKZN 1U8BA 9ANTA 5EEAA 2X9DA 2QF7A 2COBA 2R0QC 1IC8A 3QPSA 1BA5A 1HCRA 1IRZA 1F43A 4MFEA 2I10A 2X48A 4D5CA 2DMUA 5C4XJ 5J1RA 1ZGWA 3S17J 1ETXA 1DU6A 4FISA 3WHBA 2VKVA 2YU9J 1WI3A 2ECBA 4XRMA 1SFOJ 1VF9A 3SDGA 2Y31A 1MNMC 2FQ4A 4M3FA 5M5YJ 3GTLJ 1E3OC 1EF4A 2L7FP 4M3DA 2LVSA 2M0CA 3E7LA 1I6HJ 3TW6A 2TCTA 2HOTA 2XGCA 3LSGA 3I4NJ 4XK4A 1TWAJ 2VKEA 3VPRA 2EZLA 5IYBJ 4EEFG 4AUXA 3GTQJ 4Y7NJ 1RKTA 3ZQIA 1ZR4A 3MVPA 2Y9YA 1JGGA 4RDUA 1CQTA 3GBGA 2DMNA 4CYCA 2Y9ZA 1JJ8C 4BY7J 3BG9A 4V2GA 4DZJA 3S14J 3TP3A 1ITYA 3PM1A 5IP6A 4ABZA 5F0CA 4BBSJ 1TC3C 2R92J 5J1YA 4Y52J 2NVQJ 1BW6A 3GTGJ 1Y1VJ 4QIWN 2LK2A 3CMYA 2OF7A 3BTIA 4I6ZA 1H88C 5F1JA 2CUFA 1TWCJ 4B4CA 4D5FA 1X2MA 5FKLA 1AU7A 1DU0A 2XRLA 5HODA 3S1QJ 1OFCX 1U9NA 5EZGA 2AO9A 5IYCJ 2K40A 2KT0A 2OPTA 3G1MA 5EG0B 1XC5A 1AKHB 3LSPA 1G2HA 1F36A 4XIDA 2WAQN 1UHSA 1VFCA 5F08A 2HQ5A 4FTHA 1B8IA 3NARA 3BQZA 3A02A 1WH5A 2HXOA 4UUTA 1JKOC 2DA6A 1YRNA 3RKQA 2DN0A 4D7NA 1W0TA 1NK3P 2TRTA 3G1OA 1ZTRA 1GDTA 2DMPA 3TW7A 3JRAA 2JWTA 4A3GJ 1NK2P 2M34A 3M4OJ 1AHDP 2MSYA 4C3HJ 3M3YJ 4A3FJ 2JA8J 4L5EA 2HDDA 3IH3A 2G0EA 4UUSB 1JKPC 1JT0A 3FISA 4XICA 1PUFB 1W0UA 4DZPA 2P81A 5E3NA 3UKGA 2R5ZA 5IOZA 5EYRA 2DMQA 2JK3A 1IJWC 3HOVJ 4MFDA 2LP0A 2NVYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8A C;  3FK6 A;  3S1M J;  5FJ8 J;  3HOX J;  3ZQC A;  5IP7 J;  2ECC A;  5JLX A;  4C3I J;  3W6V A;  2YS9 A;  2E2J J;  2KDZ A;  2JA6 J;  1UMQ A;  2LLK A;  2DTZ A;  3ZQF A;  1FEX A;  2IEK A;  1GV5 A;  3TED A;  2D5V A;  2EZH A;  1QRY A;  2FJ1 A;  4IEJ A;  3OIO A;  3B6A A;  3TP0 A;  1HF0 A;  3RZD J;  5BNG A;  3BG3 A;  3JRH A;  1WCM J;  1JT6 A;  2CJJ A;  3LNQ A;  5EG0 A;  2O9L A;  2FD5 A;  3JRB A;  1AKH A;  4RBO A;  4QTR A;  4BBR J;  4A3C J;  3A03 A;  1TWF J;  2X6O A;  5GPA A;  2JA5 J;  2ELK A;  2XPU A;  2FX0 A;  2NOG A;  3LSR A;  2N8G A;  3BR6 A;  3OSF A;  2R5Y A;  1GVD A;  2XSD C;  5EZH A;  3OOU A;  1B72 B;  4C3J J;  5DTD A;  1JTY A;  2K9S A;  2LFB A;  1Z0X A;  2DA4 A;  4D7M A;  4FE4 A;  3JR9 A;  2NS7 A;  4DW6 A;  4MO7 A;  5FLM J;  3H0G J;  2EH3 A;  4UUS A;  2LD5 A;  2HOS A;  2H8R A;  2GLO A;  3CCY A;  4M3G A;  3LSJ A;  5M5X J;  1IGN A;  3GTP J;  3GTM J;  4B1R A;  2B63 J;  4A3B J;  4A69 C;  5IP9 J;  1MSF C;  3S1R J;  1U78 A;  5M3M J;  4V2F A;  1FTT A;  2IAI A;  1I50 J;  2H1K A;  2W48 A;  5K7Z A;  4XRS A;  2Y30 A;  1A5J A;  1MH3 A;  5EGO A;  3JRG A;  3NAU A;  3G1L A;  5IYD J;  1X2N A;  1ETW A;  5K7F A;  1MBK A;  2JMW A;  5F0H A;  5IPA A;  4XRS G;  1A6I A;  4NDL A;  1RKW A;  5K7H A;  2HYJ A;  1WPK A;  2XPW A;  1XS9 A;  2L7M P;  2MW8 A;  3BT9 A;  5DS9 A;  3HOY J;  2DA2 A;  2L9R A;  2NVT J;  1I3Q J;  3SJM A;  1P7J A;  3Q3S A;  3BR1 A;  1Y1W J;  1S7E A;  5FKM A;  4J19 A;  3SFI A;  4AC0 A;  1P7I A;  4BXX J;  1ZK8 A;  3RZO J;  1ETY A;  3HGY A;  2VUM J;  4B3A A;  2ME0 A;  1JTX A;  1MBH A;  3S2H J;  3HEF A;  2HXI A;  4A3I J;  4JX4 A;  2GBY A;  3IH4 A;  2LTP A;  1JKR C;  1JUP A;  3BTL A;  1K83 J;  3DCF A;  4A3L J;  1T33 A;  3I4M J;  1FJL A;  4A3J J;  3ZQG A;  1QVU A;  3QQA A;  1FIP A;  5FKN A;  2E19 A;  2ID6 A;  4A3M J;  5J3L A;  3MN2 A;  1BL0 A;  5EF6 A;  2EQR A;  1JUS A;  4DYC A;  4A93 J;  4M3E A;  1ETK A;  1XG1 A;  3O8H A;  2HI3 A;  4AYB N;  3CQZ J;  3CDL A;  3RQI A;  4CYC B;  2RAE A;  1ETO A;  4JP0 A;  3K7A J;  1BW5 A;  1QPI A;  2EZI A;  3A01 B;  1U9O A;  3HBL A;  3S15 J;  2XB5 A;  3Q0W A;  5E3M A;  1FIA A;  1SAN A;  1GV2 A;  2R7Z J;  3C2B A;  5FKO A;  1RET A;  1LFU P;  2JA7 J;  2WB1 N;  2AHQ A;  3HDD A;  1T56 A;  2XPV A;  5GPC A;  2PMZ N;  3FK7 A;  4HNV A;  1ZQ3 P;  4M3B A;  3ZQH A;  2ID3 A;  1IDY A;  4FE7 A;  2M8G X;  3H3V K;  1ETQ A;  3GTK J;  3PO2 J;  3PO3 J;  1JUM A;  4X1E A;  2JJ7 A;  5J1U A;  1WGX A;  4IHY A;  5FLV A;  1VND A;  2DJN A;  3Q0U A;  1GT0 C;  1B8I B;  1MBJ A;  1IUF A;  3HOZ J;  5EDN A;  3S1N J;  5FKK A;  1PUF A;  1YRN B;  2EZK A;  3FKI J;  3Q0V A;  5F0F A;  2CUE A;  3JRE A;  1VI0 A;  1ZKG A;  2DA7 A;  5F04 A;  1IG7 A;  1LFB A;  3GTO J;  1Q1V A;  5C44 J;  4IHX A;  4IHV A;  1RES A;  2ME6 A;  3L1P A;  3JRI A;  2XB0 X;  3D1N I;  2MGQ A;  3HM5 A;  4A3D J;  4BY1 J;  3F0C A;  3FIW A;  3JRF A;  4A3K J;  3BQY A;  1LE8 B;  2R5Z B;  1POG A;  1APL C;  3BR2 A;  1QVT A;  2Y2Z A;  1O4X A;  4C2M J;  3BTC A;  5E3L A;  2YUS A;  4I76 A;  4M6V A;  5JLW A;  1HDD C;  2VI6 A;  3A01 A;  4W1U A;  5C3E J;  1ORK A;  1HLV A;  4JX6 A;  4GFB A;  2EBI A;  1ENH A;  1RPW A;  4IHW A;  1Z77 A;  1ETV A;  5E3O A;  3HB9 A;  1ZR2 A;  4A3E J;  3ZQL A;  3DEW A;  2M9H A;  3WHC A;  1MBF A;  3OSG A;  3K2A A;  3QPL A;  4MLO A;  4MIM A;  2R93 J;  5M3F J;  5F27 A;  3GTJ J;  1JKQ C;  1H89 C;  1HDP A;  1MH4 A;  4S0H B;  2DA1 A;  2CQX A;  1HOM A;  1D5Y A;  1B72 A;  2Y0S N;  2LKX A;  1BJZ A;  2CQQ A;  2NVX J;  2DA3 A;  3BR3 A;  1MSE C;  2NS8 A;  2CU7 A;  3BR0 A;  4DYQ A;  2O7O A;  2GM4 A;  2E2H J;  1WH7 A;  2M2E A;  1TWH J;  2ZB9 A;  3JRD A;  2R5Y B;  2O8K A;  4DYR A;  1FTZ A;  2QCO A;  4W97 A;  2VPR A;  2E2I J;  1IDZ A;  2LY9 A;  1NTC A;  2L7Z A;  4JYK A;  4FCY A;  3HOU J;  5GP9 A;  3HGG A;  3ZOB A;  1OCP A;  4JX5 A;  1K61 A;  3JRC A;  1MBE A;  3MKL A;  2WV1 A;  2HOA A;  4LOC A;  2CRG A;  3IV5 A;  1OCT C;  3HOW J;  1GUU A;  2MG4 A;  1MBG A;  3BG5 A;  5M5W J;  4G12 A;  2DMT A;  2E1O A;  3O8G A;  1LE8 A;  3S2D J;  2K9Q A;  1IV6 A;  2L0K A;  1TWG J;  1RR7 A;  3LOC A;  1JJ6 C;  2DA5 A;  2XGD A;  2IBD A;  2JN6 A;  5C4J J;  1X58 A;  4QSH A;  3BTJ A;  3S16 J;  3B6C A;  1UG2 A;  2XGE A;  1R9T J;  2LR8 A;  3IH2 A;  5EGO B;  4BKX A;  2K9N A;  1OJL A;  5IOY A;  3BR5 A;  4X6A J;  3HKZ N;  1U8B A;  9ANT A;  5EEA A;  2X9D A;  2QF7 A;  2COB A;  2R0Q C;  1IC8 A;  3QPS A;  1BA5 A;  1HCR A;  1IRZ A;  1F43 A;  4MFE A;  2I10 A;  2X48 A;  4D5C A;  2DMU A;  5C4X J;  5J1R A;  1ZGW A;  3S17 J;  1ETX A;  1DU6 A;  4FIS A;  3WHB A;  2VKV A;  2YU9 J;  1WI3 A;  2ECB A;  4XRM A;  1SFO J;  1VF9 A;  3SDG A;  2Y31 A;  1MNM C;  2FQ4 A;  4M3F A;  5M5Y J;  3GTL J;  1E3O C;  1EF4 A;  2L7F P;  4M3D A;  2LVS A;  2M0C A;  3E7L A;  1I6H J;  3TW6 A;  2TCT A;  2HOT A;  2XGC A;  3LSG A;  3I4N J;  4XK4 A;  1TWA J;  2VKE A;  3VPR A;  2EZL A;  5IYB J;  4EEF G;  4AUX A;  3GTQ J;  4Y7N J;  1RKT A;  3ZQI A;  1ZR4 A;  3MVP A;  2Y9Y A;  1JGG A;  4RDU A;  1CQT A;  3GBG A;  2DMN A;  4CYC A;  2Y9Z A;  1JJ8 C;  4BY7 J;  3BG9 A;  4V2G A;  4DZJ A;  3S14 J;  3TP3 A;  1ITY A;  3PM1 A;  5IP6 A;  4ABZ A;  5F0C A;  4BBS J;  1TC3 C;  2R92 J;  5J1Y A;  4Y52 J;  2NVQ J;  1BW6 A;  3GTG J;  1Y1V J;  4QIW N;  2LK2 A;  3CMY A;  2OF7 A;  3BTI A;  4I6Z A;  1H88 C;  5F1J A;  2CUF A;  1TWC J;  4B4C A;  4D5F A;  1X2M A;  5FKL A;  1AU7 A;  1DU0 A;  2XRL A;  5HOD A;  3S1Q J;  1OFC X;  1U9N A;  5EZG A;  2AO9 A;  5IYC J;  2K40 A;  2KT0 A;  2OPT A;  3G1M A;  5EG0 B;  1XC5 A;  1AKH B;  3LSP A;  1G2H A;  1F36 A;  4XID A;  2WAQ N;  1UHS A;  1VFC A;  5F08 A;  2HQ5 A;  4FTH A;  1B8I A;  3NAR A;  3BQZ A;  3A02 A;  1WH5 A;  2HXO A;  4UUT A;  1JKO C;  2DA6 A;  1YRN A;  3RKQ A;  2DN0 A;  4D7N A;  1W0T A;  1NK3 P;  2TRT A;  3G1O A;  1ZTR A;  1GDT A;  2DMP A;  3TW7 A;  3JRA A;  2JWT A;  4A3G J;  1NK2 P;  2M34 A;  3M4O J;  1AHD P;  2MSY A;  4C3H J;  3M3Y J;  4A3F J;  2JA8 J;  4L5E A;  2HDD A;  3IH3 A;  2G0E A;  4UUS B;  1JKP C;  1JT0 A;  3FIS A;  4XIC A;  1PUF B;  1W0U A;  4DZP A;  2P81 A;  5E3N A;  3UKG A;  2R5Z A;  5IOZ A;  5EYR A;  2DMQ A;  2JK3 A;  1IJW C;  3HOV J;  4MFD A;  2LP0 A;  2NVY J; 
#chains in the Genus database with same CATH topology
 2IXS A;  3HOX J;  4XL9 A;  3ZQC A;  2XRN A;  4OAZ A;  5IP7 J;  1HKS A;  1IN6 A;  1WRJ A;  2ZXH A;  3KP7 A;  3ZQF A;  1PJR A;  1R5I D;  3WU0 A;  4M71 A;  3TED A;  3U1K A;  2EZH A;  1TTY A;  3I9V 2;  1TNT A;  5E8I A;  3CZ6 A;  3BG3 A;  3JRH A;  2XF5 A;  1FMW A;  3WU2 C;  3M8F A;  1IN4 A;  1R6R A;  2ZKZ A;  1Y0N A;  2V9K A;  4HPQ A;  2O9L A;  1PUE E;  3JRB A;  3A0H C;  1AKH A;  3VSL A;  3S2W A;  3P5J A;  3SEQ A;  4WXD A;  4IO9 F;  4Q4Z F;  2IS4 A;  3T1B A;  5FFX A;  2ZSI B;  3NQO A;  1U0J A;  2JA5 J;  2JZY A;  1FOK A;  2MYS A;  2FX0 A;  2ZME A;  2QBY B;  3LSR A;  1KU9 A;  3CCL I;  2N8G A;  4LB6 B;  2MC3 A;  1XDU A;  3ULQ B;  4S04 A;  4ITV A;  2VXD A;  4BQQ A;  3OOU A;  2M87 A;  3O6B B;  5DTD A;  1XCB A;  5L3E A;  5B5E C;  4DW6 A;  2Z3Y A;  2IRF G;  2RC4 A;  2LD5 A;  3FXQ A;  4CZZ A;  2H8R A;  2EFQ A;  4QPQ A;  1FWZ A;  1BIA A;  3CCY A;  4M3G A;  1U5T B;  3GF2 A;  2HQA A;  3E6M A;  3U1D A;  5DM7 F;  1IGN A;  3GTP J;  3IRQ A;  2B63 J;  1SD7 A;  1U78 A;  4R8H A;  5M3M J;  2HS5 A;  4V2F A;  3HOT A;  3GFI A;  1R36 A;  1NH3 A;  3H1C A;  4RB2 C;  3FXK A;  2BXZ A;  2W48 A;  2WBM A;  4XRS A;  2NAZ A;  1A5J A;  3ECH A;  1I1G A;  1YFH A;  2RDP A;  2B9S A;  2GQQ A;  3NAU A;  2LMD A;  5D5X B;  1X2N A;  1ETW A;  5TGT A;  2NS0 A;  3OY9 A;  3J7Z I;  1IN8 A;  4F92 B;  2DDA A;  1A6I A;  4YEL A;  3GFM A;  3U21 A;  1WSU A;  4ENM A;  1XCV A;  5K7H A;  1XPX A;  2CW0 F;  2XPW A;  4QPO A;  4YIR X;  4UV9 A;  1XSX A;  1Y6I A;  2MW8 A;  3BT9 A;  4HLY A;  3DKX A;  1XMX A;  1Y8R B;  2HKX A;  4IJA A;  1TQM A;  5J8F A;  3KET A;  3DTK A;  1NG6 A;  4LD5 A;  3LA3 A;  1S72 I;  3SJM A;  2V6E A;  1SFX A;  1WJA A;  5BOX A;  1VQL I;  1K78 B;  1U2W A;  4FT8 A;  4PDK A;  3QRF F;  4KNY A;  2ZFU A;  2MLK A;  3SFI A;  4AD9 A;  2HEO A;  1SFE A;  2CWE A;  2IVM A;  3IP4 B;  1P7I A;  3LA7 A;  3I71 A;  3DV8 A;  5FLX Z;  3KFW X;  3RZO J;  3LSI A;  3COA C;  1S8N A;  2JQ7 A;  1VZ0 A;  3OIQ A;  3G6E I;  2VUM J;  2M7A A;  2KPM A;  1KZH A;  1MBH A;  4XM3 A;  4LG3 A;  3IH4 A;  2LTP A;  3ZQ7 A;  1Z05 A;  4A3L J;  1XMK A;  3QQA A;  2R7X A;  2HVQ A;  3DF8 A;  4CCK A;  1R1T A;  3OYN A;  3KP2 A;  1R23 A;  1TT5 B;  2O0Y A;  3MN2 A;  2HU9 A;  2VKH A;  5HLI A;  1BL0 A;  1ZG5 A;  3HUG B;  1ETK A;  4AYB N;  5FO5 A;  3CQZ J;  1FSH A;  1FT9 A;  3CDL A;  1H9G A;  2DFI A;  2EV6 A;  1XMA A;  3EYY A;  1ETO A;  2VE9 A;  1BW5 A;  3ML6 A;  4BQN A;  3KP4 A;  2EFP A;  4ZTJ A;  5IY5 H;  1K7A A;  1Y39 A;  1EH8 A;  4XMY A;  3ZN0 A;  5E3M A;  1ZLJ A;  1S29 A;  1QNT A;  1STZ A;  2OZ6 A;  2VAS A;  3KLO A;  1S9H A;  3ABL H;  1LFU P;  2R7U A;  2WB1 N;  3KLN A;  2IJL A;  2TDX A;  3IAS 2;  4XLF A;  4EVI A;  5GPC A;  2O5R A;  4G8X A;  2LBF A;  1WJF A;  1YIO A;  5CLS A;  4UVC A;  3OS0 A;  2BHY A;  1VQN I;  2M8G X;  3H3V K;  1ETQ A;  2FMY A;  2L5Q A;  3GTK J;  3F23 A;  5FRO A;  3CCE I;  2V9P A;  2JJ7 A;  5J1U A;  2DI3 A;  1WGX A;  3M9A A;  5JFR A;  1X4O A;  1M1E B;  1AOY A;  1I1S A;  1GT0 C;  3OS1 A;  4HF2 A;  3HOZ J;  5HDG A;  1W5S A;  2K02 A;  4IOA F;  2H09 A;  3OYL A;  3LFK A;  2EZK A;  4BEH B;  2W85 A;  4GO1 A;  4EM1 A;  4XOR A;  3TO7 A;  2PN6 A;  3T8T A;  1ZEL A;  4IHV A;  5LGN A;  3G4S I;  3SZG A;  3TOB A;  4RB0 A;  3FF5 A;  1HXD A;  2PQ8 A;  4A0X A;  5D5V B;  3HM5 A;  1B9M A;  2QVO A;  4BY1 J;  1XX5 A;  2DU9 A;  2KP6 A;  2LRE A;  2X85 A;  2GXG A;  3WTS C;  2V1U A;  1LE8 B;  2LY2 A;  4HX4 A;  2WWY A;  1APL C;  1V54 H;  5FFZ A;  3V8J A;  1LQ1 A;  1QQI A;  1O4X A;  2FOW A;  4UY8 I;  1BI3 A;  2CFO A;  1OCZ H;  2ZO4 A;  3OR2 C;  4I76 A;  2QSF X;  1FOW A;  3ERM A;  5E3L A;  5JLW A;  4E7I A;  3A01 A;  3M8E A;  4W1U A;  1V5G A;  1HLV A;  2EBI A;  3GW2 A;  2AXL A;  3TL4 X;  5BQT A;  2WAQ A;  3CDI A;  1Z77 A;  2ZC2 A;  4CO8 A;  3J80 Z;  1BJA A;  3A0B C;  3HB9 A;  1HSJ A;  1TP4 A;  3DKY A;  4M9Z A;  2MC4 A;  4A3E J;  1W36 C;  3ZPL A;  3OSG A;  3FXU A;  3QPL A;  1BI2 A;  4MIM A;  3WE3 A;  1VQO I;  2KJC A;  2WAE A;  2FBK A;  5L3C A;  4ON0 A;  3U2R A;  1H89 C;  1UAA A;  1HDP A;  1MH4 A;  4S0H B;  5D4S A;  1UEL B;  4KT5 C;  1UFM A;  5DEQ A;  4MQ9 F;  3FHN A;  4WK8 F;  3BJA A;  3HHG A;  1D5Y A;  1B72 A;  1BJZ A;  1XDS A;  3KP5 A;  5HLT A;  1FOX A;  3BR3 A;  3PJR A;  1J7K A;  1R71 A;  2NS8 A;  1ULY A;  2R3S A;  5GTH C;  4CHU A;  3K0L A;  5E79 C;  2HVR A;  4I09 A;  2P6S A;  4DYQ A;  2GM4 A;  2L9N A;  1YJ9 I;  2M2E A;  2PLY A;  2R5Y B;  2O8K A;  1IDZ A;  3AKZ A;  1BM9 A;  3X2Q H;  2LY9 A;  3L2U A;  3WG9 A;  1ZH5 A;  4QWQ A;  2PI0 A;  2MAB A;  4FCY A;  4WX9 A;  1Z6R A;  1LEB A;  4JK1 X;  3JRC A;  2XKO A;  1EH6 A;  3OYI A;  2QQ8 A;  5LD2 C;  3EET A;  1REP C;  2XAF A;  4LOC A;  4ZYA A;  1A36 A;  1OCT C;  3PFY A;  1GUU A;  5DCM B;  3UNG C;  4OIR F;  5M5W J;  2GOM A;  4CIC A;  3T8R A;  2DXI A;  3S2D J;  1IV6 A;  2OQR A;  3D0S A;  4RGX A;  3V42 A;  2JN6 A;  3CJR B;  1X58 A;  4UV8 A;  4QSH A;  2Z99 A;  3BTJ A;  4CZC A;  3MKY B;  2BY1 A;  5GTI C;  3S16 J;  1HC8 A;  3B6C A;  2DOA A;  3JCU C;  4FHT A;  3WTZ A;  5EGO B;  3IH2 A;  3DXJ F;  2WC2 A;  1WHU A;  5FB2 A;  2NOJ B;  2PMZ A;  3CP8 A;  1OJL A;  4ZDL A;  3VYT B;  3DP7 A;  3CDH A;  3K2Z A;  4PFO A;  1U8B A;  5EEA A;  2QF7 A;  1P6R A;  2XRO A;  4BE0 A;  1HCR A;  2JPB A;  2W84 A;  2I10 A;  2X48 A;  2ZBK A;  1R5G A;  5A2Q Z;  4D5C A;  3ZGK A;  4EV0 A;  3QU3 A;  5C4X J;  2KLO A;  1USS A;  4I0A A;  3S17 J;  4UHT A;  4KIT B;  3GZ6 A;  3DBR B;  2BW3 A;  5DUI A;  2ECB A;  5EEG A;  3CCM I;  2VE8 A;  3B02 A;  4BJT A;  3ZRG A;  2L4M A;  1SFO J;  1HA8 A;  3SDG A;  2Y31 A;  4EMS A;  3CLQ A;  2EK5 A;  2D45 A;  1EF4 A;  5J47 A;  1GXQ A;  3E7L A;  2F5E A;  2EIK H;  1ZYR F;  3TW6 A;  5BPI A;  2K4J A;  4CYD A;  5F1R A;  2F2E A;  5CVR A;  3OOP A;  5GAE J;  1E2X A;  3LSG A;  5KHD A;  4KN4 X;  4UVA A;  2EWN A;  2VKE A;  4EEF G;  1BR2 A;  2R7S A;  1L0O C;  4H0E A;  1RKT A;  1QBJ A;  1ON1 A;  3RCO A;  1ZR4 A;  3MVP A;  1PP8 F;  4B3X A;  1CQT A;  2W24 A;  4KA4 A;  3GBG A;  3I64 A;  2DMN A;  1OYY A;  3OYH A;  3E0J B;  1WVR A;  1C0W A;  1MGT A;  1JJ8 C;  4DZJ A;  3H35 A;  4C2T A;  3S14 J;  4MQV A;  1ITY A;  2CSO A;  2HZT A;  3PM1 A;  3CUQ B;  4XLP F;  3HRU A;  2R92 J;  4UB6 C;  4Y52 J;  2VL8 A;  2P5L C;  1BW6 A;  2E1N A;  1BR4 A;  2W57 A;  2FEZ A;  3CMY A;  4AWX B;  1LDJ A;  2VC0 A;  2VON A;  5F1J A;  1J75 A;  3CJN A;  2GAU A;  3F9K A;  1DU0 A;  3HSF A;  1D1C A;  2CV1 A;  5EG0 B;  5TRD A;  3K6G A;  3GLL A;  2XIG A;  2V7F A;  2QKM B;  2XSJ C;  3DU5 A;  5F08 A;  2RRE A;  3NAR A;  4UUT A;  2EB7 A;  2K9L A;  2RKH A;  3D5L A;  4OAY A;  5LBQ A;  1YO5 C;  2NRA C;  1YHQ I;  1YW7 A;  1MMG A;  3AL0 C;  3FKJ A;  2HVS A;  4M72 A;  1OLT A;  2G7H A;  2X51 A;  1HST A;  2MD5 A;  2JWT A;  1TQI A;  4A3G J;  1A35 A;  1Z7U A;  2LF8 A;  2MSY A;  1AHD P;  2P8T A;  2JA8 J;  3GUD A;  2HDD A;  1BOA A;  2G0E A;  2A6H F;  1JT0 A;  1IN7 A;  4CCJ A;  4XIC A;  1T39 A;  1PUF B;  4AYB A;  4MGR A;  2P81 A;  4ZDO A;  2R5Z A;  2H8W A;  5IOZ A;  2HNH A;  4UB8 C;  2VIX A;  1IJW C;  4AM3 A;  2IPQ X;  2QUF A;  1RC9 A;  3NWT A;  3HOV J;  4MFD A;  5E1W A;  2QA4 I;  1FBU A;  4ESF A;  1XGM A;  1Z1D A;  3S1M J;  1U8R A;  2M7B A;  2DK5 A;  1KYW A;  2ECC A;  5JLX A;  4C3I J;  2DFE A;  2L9V A;  2YS9 A;  3OYM A;  4QLC U;  2KDZ A;  4BE2 A;  2E2J J;  3LWF A;  4BAY A;  2JA6 J;  4PJ0 C;  2LLK A;  2DOD A;  2DTZ A;  2IEK A;  3QYF A;  1Y0U A;  4IEJ A;  3OIO A;  3WG7 H;  3B6A A;  4A12 A;  3TP0 A;  1E3P A;  1YQA A;  3H9G A;  1HF0 A;  2J5O A;  2D2W A;  2A5Y B;  5BNG A;  3OYB A;  3RZD J;  1WCM J;  1FSE A;  3CUO A;  5D6E A;  2XGX A;  2CJJ A;  4PJN A;  4WCG A;  2CG4 A;  4BBR J;  1ZAO A;  2QKL B;  1B9N A;  1Z21 A;  1N75 A;  4NHJ A;  3CCS I;  2EV0 A;  3MAJ A;  2XPU A;  2IA0 A;  2XVC A;  4NC7 A;  2Z9O A;  2BV6 A;  1SFU A;  4MHG A;  1SFK A;  3OYE A;  2JUG A;  1AA7 A;  3S93 A;  2F6C A;  3OSF A;  5JHU A;  4HRI A;  2OAZ A;  3FM5 A;  2Y75 A;  3I4P A;  2BEO A;  1JTY A;  2LFB A;  5AON A;  4D7M A;  2VJ5 A;  4FE4 A;  2D1V A;  3LSH A;  4GGG A;  5FLM J;  1TW2 A;  2GWR A;  2EH3 A;  4LJZ F;  4A0Z A;  4UUS A;  3DLL F;  3GEZ A;  4E7L A;  3JW4 A;  2LSO A;  5B1A H;  3IWF A;  4YEJ A;  3IHU A;  3LSJ A;  4PSX A;  5M5X J;  1DP7 P;  2KKO A;  1B6A A;  2A05 A;  2NNY A;  3GVA A;  4LIT A;  4A3B J;  4A69 C;  2XC7 A;  2XHK A;  3WTV C;  5B3S H;  3TO9 A;  3WGH A;  4IVN A;  4IHS A;  1VQ8 I;  2IAI A;  4NNJ A;  3BY6 A;  2Y30 A;  2DCE A;  1WJ5 A;  2XUB A;  4CCM A;  4ZZL A;  1H9T A;  4OMY A;  2X0L A;  4B8X A;  1RIO H;  3DTE A;  3DLA A;  4XBF A;  2HTJ A;  3E1S A;  5K7F A;  3DU6 A;  2ISY A;  2P0W A;  1PYV A;  4EJV A;  2VOD A;  2ICW G;  4G6T B;  4BHB A;  4XRS G;  1R4M B;  3E97 A;  4CH7 A;  5IPA A;  1YJW I;  4HF0 A;  4A2U A;  1PVE A;  2W7N A;  2FNP A;  3HOS A;  4KJZ A;  1G3S A;  3W6K B;  2DJI A;  2KZV A;  4G94 A;  3ASO H;  5DS9 A;  1X1C A;  1HBX G;  1XB4 A;  2E1M B;  2HPI A;  2X4H A;  2ZNY A;  4EQQ A;  2XDV A;  2NVT J;  1P7J A;  3CES A;  1TNS A;  5HS9 A;  4BGD A;  2QBY A;  3CMA I;  2X1D A;  2F4M B;  2XF6 A;  1Z91 A;  5FKM A;  1XTA A;  4LIU A;  1BC7 C;  5KAI C;  2XV4 S;  2V9V A;  1X1P A;  2MA3 A;  2VJ4 A;  4R1H A;  2IA2 A;  3WU1 B;  4DIQ A;  1ZRE A;  1D8J A;  1Q1H A;  3V7R A;  3ABU A;  3ZQQ A;  2KHM A;  1XN7 A;  2G9W A;  2HXI A;  2WY8 Q;  3LSM A;  2GBY A;  2K27 A;  4PFP A;  4L9J A;  4CGZ A;  5DM6 F;  3FBI B;  3PIO F;  1OCO H;  1U5T A;  3BCA A;  3BTL A;  3I3L A;  3E5U A;  2COM A;  4A3J J;  2I5U A;  1QVU A;  1YI2 I;  1IO2 A;  2VXZ A;  1RNL A;  2GA2 A;  3OS2 A;  3DPT A;  5J3L A;  5GAH J;  4D1Q A;  4IRH A;  1P9Q C;  4RLF A;  2F4O B;  4LB5 A;  2VOO A;  1KYZ A;  2WAF A;  3CCJ I;  2DBB A;  3GZ5 A;  1EKE A;  4CXF A;  4CYC B;  4G7H F;  3BWG A;  4JQF A;  3HYI A;  2HQR A;  1QPI A;  4XRF A;  1U9O A;  5J4V A;  3KEY A;  4HOB A;  4KT6 A;  4C30 A;  3WGG A;  3ECO A;  3CME I;  1ZHF A;  5KVR A;  1FIA A;  1GV2 A;  2KMU A;  3C2B A;  3WTT C;  3RYR A;  2HKO A;  2YX7 A;  5CPR B;  1R58 A;  1MJA A;  2WA0 A;  2PMZ N;  1DUX C;  3AG2 H;  4M3B A;  3CJQ B;  2CQK A;  2QM3 A;  3I5U A;  1I27 A;  5FD6 A;  5JI6 A;  1QA6 A;  2MH9 A;  4FE7 A;  4ZZD A;  4HSR A;  4E6K G;  1K78 A;  5E8G A;  3PO2 J;  1UB9 A;  4P1W A;  4X1E A;  1OR7 A;  1YX3 A;  1X3W B;  4I99 C;  3V8K A;  4BHP A;  3OYA A;  2YX4 A;  1IV8 A;  4IHY A;  3ZN1 A;  4XOT A;  2F5C A;  3I54 A;  5CYV A;  3S1N J;  1G3W A;  2ZJP F;  5FKK A;  2HZD A;  1YRN B;  3ABT A;  4BYY A;  1QGP A;  2FNA A;  3FMQ A;  2X1C A;  2DA7 A;  4AU7 A;  3MFK A;  1IG7 A;  2ETH A;  4PGH A;  3OR1 C;  1IXS B;  3GTO J;  2EIL H;  5C44 J;  5IT3 A;  4F52 A;  2ME6 A;  4D0P A;  1G3T A;  2CW8 A;  2LKS A;  2ZXW H;  3LAJ A;  4ZYD A;  1DP3 A;  2KL4 A;  4L5I A;  4MNU A;  2K86 A;  1B4A A;  2MGQ A;  4UNO A;  3FBN B;  4ZC3 A;  3EYI A;  5D8L B;  2KQR A;  3F0C A;  4D9J A;  1U5T C;  3JTH A;  3FXR A;  2EIN H;  4FX0 A;  2VJI A;  3P9C A;  1EH7 A;  4F7Z A;  2FSW A;  3DFG A;  2CH0 A;  3J7A O;  5LHG A;  3N4M A;  1QVT A;  4E7J A;  4PK4 A;  4HA8 A;  4A5M A;  4C2M J;  2A6T A;  3BTC A;  1WJC A;  2XAJ A;  2AQF A;  2IGO A;  2LOO A;  3GME A;  1LB2 A;  2VI6 A;  2R7T A;  5HS7 A;  1R49 A;  1MMS A;  2KDO A;  5C3E J;  2ISZ A;  1ORK A;  2ZNZ A;  2CGP A;  2K3F A;  2K5C A;  5D5U B;  4GFB A;  3H5N A;  4XLE A;  4IHW A;  2BVM A;  1ETV A;  3SYT A;  3OYG A;  1WJD A;  2UWM A;  2PG4 A;  5E3O A;  3ZMV A;  1ZR2 A;  1Z3X A;  3ZQL A;  1CGP A;  3DEW A;  1IAW A;  2HQN A;  3K2A A;  2R93 J;  4XON A;  3E3V A;  5F27 A;  3FXL A;  1N77 A;  4PSW A;  3DWL E;  3MZ8 A;  3K69 A;  5J8C A;  2CQX A;  3SZT A;  1HOM A;  4E70 A;  4RA2 A;  3RSN A;  5KK1 A;  2DA3 A;  3MMY B;  2RVC A;  3IUO A;  5ERI A;  1MSE C;  5JR3 A;  2CU7 A;  3CF2 A;  2ZME B;  3O2P E;  4NQW B;  1GHC A;  2VQG A;  4LK0 F;  2YR2 A;  4JBA A;  4ZJZ A;  2O7O A;  1FP1 D;  2PMU A;  2QZ8 A;  4BEH A;  3JRD A;  1Y8Q B;  1TWH J;  3M1E A;  4AIH A;  1K6O A;  2UXX A;  4DYR A;  4W97 A;  2VPR A;  1OR7 C;  1IRX A;  2FE3 A;  2OC6 A;  5GP9 A;  5DCF A;  3CCR I;  1K61 A;  4AIJ A;  1MBE A;  1MDM B;  5JVG F;  2HOA A;  3W6J B;  2CRG A;  2PMH A;  1DPU A;  2DLL A;  1MBG A;  2Z16 A;  3RDI A;  3LFU A;  1UST A;  5ICG A;  2W1O A;  3HIF A;  2E1O A;  3O8G A;  1LE8 A;  1BC8 C;  2OA4 A;  4IRI A;  3KEO A;  1RR7 A;  3VFZ A;  3Q9S A;  1D8K A;  3L7W A;  1TBX A;  5C4J J;  4H4K C;  2BXY A;  4TV7 A;  2W82 A;  4O6J A;  4FAS D;  3REO A;  1HW2 A;  5CKT A;  1G3Y A;  1R9T J;  1EJ9 A;  2BY0 A;  4N0B A;  4RAG A;  2K9N A;  1IRG A;  4Q48 A;  5CQG A;  5IOY A;  2JPC A;  3BR5 A;  3FMS A;  4UXN A;  5HNH A;  3QOP A;  2PJR B;  2QLZ A;  9ANT A;  2X9D A;  2R0Q C;  1V55 H;  1BA5 A;  4A6D A;  2FUG 2;  2A5W A;  2E34 A;  1FOY A;  3HG9 A;  1VQ6 I;  2DMU A;  3A4C A;  2JUC A;  1TLH B;  1ZGW A;  1JXS A;  1WI9 A;  2VBY A;  1DU6 A;  3WHB A;  3ESW B;  4E7Z A;  4EGY A;  4E7H A;  4OIN F;  1LUJ B;  3HL2 A;  1LVA A;  1VF9 A;  5DYM A;  2ACJ A;  1MNM C;  3GTL J;  2E71 A;  4RLQ A;  4M3D A;  2LVS A;  2M0C A;  1X4P A;  1S6L A;  1I6H J;  4YRV A;  1E0E A;  1CF7 A;  1W7P A;  5HLG A;  1RUO A;  2KIU A;  3PIP F;  1ZG1 A;  1FMV A;  1O7L A;  4RB1 A;  2EZL A;  1W5T A;  5DCM A;  4AUX A;  1YTY A;  3L09 A;  4Y7N J;  3PQK A;  1D1B A;  1Z9C A;  3RKX A;  1X1B A;  3P9I A;  3PNY A;  1JHH A;  2O8X A;  1JHF A;  2L54 A;  2F48 A;  3ZR8 X;  3GZN B;  3TP3 A;  3RYP A;  2W00 A;  4ABZ A;  1K4S A;  4HNT A;  1L3L A;  3DKW A;  4IQ4 A;  3QYB A;  2R7Q A;  3GTG J;  3OYC A;  2QSH X;  3A2K A;  4G6Q A;  1W36 D;  1YW8 A;  4RMN A;  2OCE A;  4Z2Y A;  1PP7 U;  2IS1 A;  1ZGA A;  5K5R A;  3W2V A;  2MLG A;  4PJL A;  3H0D A;  2CUF A;  2Z1D A;  1DDN A;  5FKL A;  4E7S A;  2XRL A;  3CTA A;  1U9N A;  4XKB A;  5LRR A;  3QU6 A;  4RAF A;  2KT0 A;  3CC2 I;  2Y0S A;  4NC8 A;  4KYW A;  2FU4 A;  3S3O A;  5FLX K;  3AFH A;  1UHS A;  1R00 A;  2LYC A;  3K10 A;  1VFC A;  2H27 A;  4FTH A;  1B8I A;  3BQZ A;  2HXO A;  1RI7 A;  4I7H A;  3L00 A;  5D5W B;  1GVJ A;  1WJB A;  4AVZ A;  2DA6 A;  4HBL A;  3MKZ A;  3PQJ A;  1B1B A;  2DN0 A;  1R5H A;  4RGS A;  4D7N A;  2P7V B;  3G3Z A;  2TRT A;  4KUM A;  5AIP A;  1ZTR A;  3SFZ A;  1TQP A;  2DMP A;  3VWB A;  4AVP A;  1LVK A;  5E17 F;  2H94 A;  2FF4 A;  4C3H J;  5KCM A;  4E4H A;  4CCN A;  1LEA A;  3M07 A;  4I01 A;  4XN0 A;  4ZTF A;  3H9J A;  3IAM 2;  3JAM K;  1D0Z A;  1W0U A;  1A31 A;  2QGU A;  4LLN A;  2IGK A;  1TT0 A;  2JRM A;  2WY7 Q;  3BPV A;  4ZYE A;  5K5Q A;  4PJM A;  2DMQ A;  2JK3 A;  1W7P D;  4RAY A;  2O6G E;  1T0F C;  4PCQ A;  2LP0 A;  2NVY J;  4HEA 2;  2ZFW A;  4B47 A;  5LHH A;  2KIF A;  1QZE A;  3GX4 X;  1F4K A;  4DBQ A;  3GFJ A;  3CUQ A;  2JRT A;  4G7Z F;  3F8B A;  4P5O A;  2L02 A;  4HZF A;  4KIG A;  3GWZ A;  4C2U A;  2E7W A;  2Z33 A;  2M0M A;  1ERD A;  3HKZ A;  3HRT A;  1GV5 A;  1DPR A;  2IGN A;  2M5W A;  3QWL A;  3HPH A;  1NHA A;  2M4G A;  4P9U A;  4XN3 A;  4IX7 A;  4G7O F;  1SC7 A;  2DFH A;  5EG0 A;  2FD5 A;  4RBO A;  3CCV I;  2LF7 A;  4N4O B;  4QTR A;  4ESB A;  4UUV A;  4A3C J;  3H5R A;  5KNL A;  3A03 A;  1TWF J;  4XLC A;  2BYV E;  2PEX A;  2ELK A;  2B0L A;  3VEP A;  2DPU A;  2NOG A;  1WFX A;  4WXH A;  3CCQ I;  3DEE A;  1OIS A;  4XLH A;  1QHG A;  3TBI A;  3CLO A;  3ZP5 A;  1GVD A;  2VQL A;  1ODD A;  1ZAR A;  3IC7 A;  1B72 B;  3PL8 A;  4C3J J;  2K9S A;  3QYE A;  4U7D A;  2JVH A;  3SZP A;  3JR9 A;  4YIF A;  2STW A;  3R6S A;  2NS7 A;  4HW0 A;  1T08 B;  3MD2 A;  4OIO F;  3H0G J;  5DD8 A;  3L2C A;  4EM0 B;  2QEX I;  3SDB A;  3HSE A;  1HKQ A;  4GCV A;  2WV0 A;  4F91 B;  4Z6Y A;  5AIQ A;  4B1R A;  4NC6 A;  1D0X A;  5IP9 J;  4MEX F;  1OPC A;  3S1R J;  1U3E M;  1HW5 A;  3ZMD A;  1FTT A;  4U88 A;  1LDK B;  2WTE A;  1I50 J;  4LK1 F;  3PFI A;  3UR3 C;  4DOZ A;  3IKT A;  2K85 A;  1IRF A;  3QPH A;  4XLN F;  2CQ7 A;  3DBL B;  2AQE A;  1MH3 A;  3HHH A;  1O7F A;  4OWR B;  2BY2 A;  2OCC H;  4OU0 A;  4EJT A;  3OIP A;  3F6V A;  2XKP A;  3BJO A;  1R1V A;  2ZJ2 A;  5F0H A;  3TGN A;  2V79 A;  3CUQ C;  2JTV A;  4NDL A;  4P9F A;  1O3T A;  3J7Y J;  2UXN A;  2M8E A;  2Y48 A;  3RPU A;  2ZJQ F;  2OTL I;  3ROU A;  4Q47 A;  2OZU A;  1T95 A;  2L9R A;  1EA3 A;  4RM2 A;  2RQP A;  1I3Q J;  2A69 F;  1IF1 A;  3C3W A;  3Q3S A;  2QQB A;  1Y1W J;  2L4A A;  3SHF A;  2V26 A;  1S7E A;  5E1Z B;  1YJN I;  5E1X A;  3NEU A;  1D1A A;  2A68 F;  1MMN A;  2EV5 A;  3OWT A;  5DD4 A;  4AC0 A;  1P4X A;  3K9T A;  4ENK A;  3FHZ A;  4BXX J;  2E7X A;  1ZK8 A;  1GXP A;  1ETY A;  5ED4 A;  2ADU A;  5ILU A;  1MZB A;  3HRM A;  3HGY A;  2VBZ A;  3KYD B;  4BXU A;  4YFN F;  2ME0 A;  1JTX A;  4CUG A;  4DGW B;  2GOX B;  2F5F A;  3QOD A;  3K4C A;  2CV2 A;  1OKR A;  3GFL A;  1JKR C;  1JUP A;  3DCF A;  1T33 A;  3I4M J;  3A1Y A;  1P2F A;  4I02 A;  2HGC A;  1SD5 A;  2Q2E B;  1FIP A;  5FKN A;  2E19 A;  2ID6 A;  3F3X A;  3E5Q A;  4LFU A;  5HLH A;  2AXT C;  2XAH A;  1KQ9 A;  3ONQ A;  4ETS A;  4DYC A;  4A93 J;  4M3E A;  1XG1 A;  3G71 I;  2HI3 A;  3J81 K;  3I58 A;  3VDX A;  4GYG A;  2L2O A;  3GXO A;  3RQI A;  1YG2 A;  1OQY A;  1UHM A;  4JP0 A;  1S3J A;  5LLQ A;  4ZDP A;  3HBL A;  3AAF A;  5JVT A;  2XB5 A;  4DJA A;  5HVQ C;  1YOV B;  1X3U A;  1SAN A;  3LSK A;  1R7J A;  4HQM A;  3WTW C;  2P6T A;  1T2K A;  2EIM H;  1RET A;  2XF7 A;  5D8K B;  5ICE A;  3HDD A;  3S3N A;  4LLL A;  3LST A;  2OQG A;  2DO7 A;  3P7N A;  5LEK A;  2BZT A;  5CVV A;  3ZQH A;  4ANJ A;  1SD4 A;  3AG3 H;  1IDY A;  4YG2 F;  4BQO A;  5LRS A;  3IL2 A;  1FP2 A;  3IKV A;  4RS8 A;  3ZMZ A;  3BJ6 A;  1J2X A;  3GO5 A;  3W2W A;  3PO3 J;  2F5V A;  4EGZ A;  5DUK A;  1JUM A;  4L18 B;  4LG0 B;  1P4W A;  5L3F A;  5FLV A;  2RNJ A;  1VND A;  2DJN A;  1HW1 A;  3Q0U A;  3FM3 A;  1IN5 A;  1IUF A;  1MBJ A;  1KQ8 A;  5EDN A;  3HZJ A;  2GXB A;  1U6G A;  3FKI J;  2HFH A;  3Q0V A;  4L0Y B;  1QZY A;  3JRE A;  4HAM A;  1VI0 A;  1ZKG A;  3KZY A;  3BLY A;  3F21 A;  1N78 A;  1Q1V A;  2M4K A;  3EQL F;  4L9N A;  4II2 A;  4ZH4 F;  4IHX A;  1RES A;  2NVU B;  4A5N A;  3JRI A;  1P92 A;  1O3S A;  3J7A Y;  2CUZ A;  2CMP A;  3CCU I;  2A6E F;  3Q9V A;  2Z2S B;  3RKW A;  2HPM A;  4YFK F;  3BPX A;  2DDB A;  2A3S A;  4A3D J;  3FIW A;  3JRF A;  4LIV A;  4L0Z B;  4GRI A;  3BQY A;  3GYH X;  1X19 A;  2R5Z B;  3RKY A;  1POG A;  4A0Y A;  1KU7 A;  2KIM A;  3CO6 C;  2FBH A;  1G59 A;  2P4W A;  2Y2Z A;  2MH2 A;  1FYM A;  2YUS A;  5CVJ A;  1ZRC A;  4M73 A;  1HDD C;  1KA8 A;  4Y13 A;  2OV7 A;  2M1B A;  3C7J A;  4JX6 A;  3S8P A;  3VSK A;  2VKD A;  3DEU A;  3M1C A;  2M30 A;  2VT2 A;  4IZZ A;  1BI0 A;  3L2W A;  2E36 A;  2EFO A;  4WF2 A;  1NG7 A;  2M9H A;  1B59 A;  1MBF A;  3FXJ A;  3WHC A;  1HKT A;  3PNT A;  3TMO A;  3WTU C;  3KYC B;  4B43 A;  2K9M A;  2MBF A;  4HDV A;  4MEY F;  3K70 D;  3KEQ A;  2BGC A;  4GYI A;  1Z3Y A;  2Y0S N;  2E1M C;  4XSX F;  4FQG A;  4XSZ F;  1QPM A;  2NVX J;  1MKM A;  3I53 A;  1ZRF A;  4UVB A;  5FGM A;  1UHW A;  2IGM A;  2FRH A;  2R7D A;  5H6Q A;  3ISP A;  2HDW A;  1XSV A;  1V4R A;  3BR0 A;  5HNF A;  4BNC A;  5ICC A;  2ZB9 A;  2WAD A;  1J5Y A;  2P7C B;  3C18 A;  1FBQ A;  4LGW A;  2X1E A;  1NTC A;  1LNW A;  1J9I A;  3QP6 A;  3HOU J;  3HGG A;  3L2Q A;  3OYK A;  3WE2 A;  2JSC A;  3FMR A;  1TZL A;  1T8I A;  1O3Q A;  3HOW J;  1N25 A;  2VBW A;  3BG5 A;  2YU3 A;  3U9G A;  3QAH A;  1D5V A;  4IL6 C;  1FY7 A;  3EDP A;  1TWG J;  3LOC A;  2KZG A;  3CJT B;  4XOP A;  2PJP A;  5J4Y A;  2IBD A;  1IW7 F;  3BZC A;  1MMD A;  4HG2 A;  1UJ8 A;  3KP3 A;  1UG2 A;  1F5T A;  4BAC A;  5H2F C;  3AG1 H;  3HXL A;  2DOF A;  3ERE D;  1JE8 A;  1OMI A;  2CFX A;  2ELH A;  4FX4 A;  1F1Z A;  2E5Z A;  2Q0O A;  3BC8 A;  5L3B A;  3HKZ N;  5E18 F;  2R7W A;  1VQ4 I;  1D3Y A;  3NRV A;  4L9V A;  2CS3 A;  5B66 C;  3RPQ A;  1IC8 A;  3L2R A;  4PJJ A;  1MND A;  1QO0 D;  1F43 A;  4MFE A;  4P55 A;  2BY3 A;  2KIS A;  1IZ1 A;  5CJ9 A;  5HS8 A;  2W25 A;  4OIQ F;  1J0R A;  1ETX A;  3LMM A;  1W4M A;  1FLI A;  4FIS A;  2R7R A;  1RR8 C;  2YU9 J;  4XRM A;  3RI4 A;  1MNE A;  4NQW A;  2O61 A;  2A61 A;  2UUZ A;  3E6D A;  3IWZ A;  1JI8 A;  4M3F A;  3HSR A;  4U0V A;  1E3O C;  3E5X A;  2HDC A;  6PAX A;  2V6C A;  4IF4 A;  5FRM A;  3K4N A;  3VYU B;  3CC7 I;  1ZGJ A;  1MDM A;  2GIV A;  1G4D A;  3I4N J;  4XK4 A;  3CO7 C;  2CO5 A;  1TWA J;  5IYB J;  4GDF A;  3GTQ J;  1W1W E;  3HUG A;  2OUM A;  1OCR H;  5IT9 K;  3ZQI A;  3R61 A;  5HDK A;  1GLN A;  2Y9Y A;  3L2V A;  4KIC A;  3I59 B;  4Y3O A;  2VC1 A;  4OOI A;  2Y9Z A;  4HDU A;  2DFF A;  3BG9 A;  4V2G A;  4BY7 J;  3HRS A;  5IP6 A;  2ZXJ A;  3KCC A;  4BBS J;  3O3K A;  3HTS B;  1TC3 C;  4EAT A;  4DNC A;  2VJJ A;  1RUN A;  5JHF A;  1XGN A;  4RAZ A;  4QIW N;  2DW4 A;  3EPZ A;  2LK2 A;  1WKM A;  1BBY A;  2OF7 A;  2M3A A;  3T5X A;  1KU3 A;  1XGS A;  1H88 C;  2PBI A;  4AID A;  1ZLK A;  2PJR A;  3R0A A;  1AU7 A;  3L9F A;  4IXA A;  2KRC A;  2DYR H;  2UV1 A;  5F6F A;  5HOD A;  1VQM I;  5EZG A;  3BG7 A;  1SMY F;  2AO9 A;  4N4N B;  1FYL A;  2OPT A;  1FYK A;  1SAX A;  1AKH B;  2PFB A;  2DTR A;  1F36 A;  3EUK L;  4XID A;  1SVL A;  1ZG3 A;  1D0Y A;  3FWE A;  3FXO A;  4DQ2 A;  3MKW B;  2B7E A;  4EM2 A;  3A02 A;  1WH5 A;  1W5C C;  3ZMU A;  3H3U A;  3C2G A;  4F3Q A;  2GA1 A;  4A6E A;  1X1A A;  3V7C A;  1DGW Y;  1NK3 P;  4B48 A;  3G1O A;  4ENJ A;  5D4R A;  1GDT A;  4XLA A;  2W4S A;  3JRA A;  4EJW A;  2KFD A;  2M34 A;  1Z7L A;  2KRH A;  4M6Y A;  3BP8 A;  5FD5 A;  3FX3 A;  4L5E A;  2ZME C;  3IH3 A;  1DGR M;  4BXF A;  5D6F A;  1E3H A;  4IKF A;  1WZ2 A;  4DZP A;  3D5R C;  1SAU A;  4RB3 C;  5E3N A;  2C6Y A;  2DOE A;  3H5A A;  5B1B H;  1K79 A;  4X0G A;  1LKX A;  2J5P A;  4OMZ A;  2ZCW A;  5DV5 A;  4EJO A;  1H8A C;  3JTG A;  2OD5 A;  3FK6 A;  1FNN A;  5FJ8 J;  2EPF A;  2KIQ A;  1I6X A;  3JAM Z;  1RZ4 A;  4ASN A;  4DBR A;  4HQE A;  3W6V A;  3D5S C;  3EUH A;  1UMQ A;  5BS6 A;  1FEX A;  3AG4 H;  1VQ7 I;  3T0Y A;  1YW9 A;  2MD0 A;  4IPA A;  4CDG A;  3ASN H;  2D5V A;  1QRY A;  2FJ1 A;  2A07 F;  2DT5 A;  2BBY A;  3CF5 F;  1BIB A;  3MWM A;  1JT6 A;  5ICF A;  3W3C A;  2GZW A;  3ABM H;  5K5O A;  3LNQ A;  2JT1 A;  3OYJ A;  1KQ0 A;  2KJB A;  1XGO A;  4U0Y A;  2X6O A;  1HQC A;  5GPA A;  5K1Y A;  1A6Q A;  2FML A;  3GLX A;  3F22 A;  3BR6 A;  4AIK A;  3TOA A;  3OYF A;  2R5Y A;  2XSD C;  5EZH A;  2VBX A;  1LPQ A;  4KN7 X;  1YS7 A;  1Z0X A;  2DA4 A;  1I3A A;  3PUB A;  1T0F A;  1R4N B;  4BE1 A;  1V5F A;  2JA2 A;  4BQA A;  2M45 A;  4MO7 A;  4J00 A;  3RJP A;  3K4L A;  2HOS A;  2X6Y A;  4IQJ A;  2GLO A;  3LAP A;  3DTI A;  2RQQ A;  3F72 A;  4CCL A;  4LLG F;  2LG4 A;  3WTY C;  4Y4R A;  3MEX A;  2PX9 A;  3GTM J;  3I56 I;  4KMU X;  1MSF C;  3K1P A;  2FOK A;  3LA2 A;  4GXO A;  2OJE D;  1KU2 A;  4BU2 A;  3R60 A;  2H1K A;  5K7Z A;  3R4K A;  1I5Z A;  2EJR A;  2I8D A;  1MJB A;  5EGO A;  3JRG A;  4NBQ A;  4HLX A;  1QU3 A;  2NXN B;  2NNN A;  3G1L A;  5IYD J;  1YS6 A;  1MBK A;  2JMW A;  1LJ9 A;  4O3M A;  1DQU A;  2YPR A;  4Y15 A;  2HR3 A;  3QOE A;  3OV8 A;  3F8F A;  4HV6 A;  3SQN A;  3H36 A;  2CW7 A;  1VQP I;  3MCZ A;  2DYS H;  1RKW A;  4BH9 A;  1MMA A;  2HYJ A;  2HYF A;  1WPK A;  3EUH C;  1XS9 A;  3DPU A;  2L7M P;  2VQC A;  2V1N A;  2FA5 A;  4MTE A;  2DA2 A;  3HOY J;  1J09 A;  1KGS A;  4HST A;  3MQ0 A;  3W2A A;  4Y17 A;  2LBF B;  3BR1 A;  3WGI A;  1MJ9 A;  2DQL A;  4K2E A;  3MZH A;  3JSP A;  1BR1 A;  2L9S A;  5KAF C;  2EFN A;  4J19 A;  4RGR A;  1ZRD A;  2IT0 A;  2QQ9 A;  3F8M A;  4BJ5 C;  1RRJ A;  3K4M A;  4G6D A;  3VYS B;  5F64 A;  1K6Y A;  5CVI A;  5ILS A;  1S5L C;  2ESH A;  2LY1 A;  3VB2 A;  2XAQ A;  2IS6 A;  4B3A A;  3R0J A;  3S2H J;  3HEF A;  3S3M A;  4I0B A;  4JX4 A;  4A3I J;  4YFX F;  3TKY A;  3Q5F A;  4HX7 A;  1WJE A;  2O3F A;  1UCR A;  2YSR A;  1K83 J;  3KZI C;  3BZ6 A;  1FJL A;  4KMF A;  1CF7 B;  5E20 A;  3WOD F;  1W7P B;  3ZQG A;  1VQK I;  1OYW A;  1TL8 A;  3VOD A;  4A3M J;  3I0T A;  1I39 A;  3C2H A;  5EF6 A;  2EQR A;  2BHZ A;  1JUS A;  2DAO A;  3O8H A;  1BN5 A;  3IRR A;  2IA1 A;  2ESN A;  1YE9 A;  2FXA A;  2BVL A;  3DPL C;  2RAE A;  4XKC A;  2ZJR F;  4N9I A;  3K7A J;  4HV5 A;  1ON2 A;  4IOC F;  2EZI A;  4R79 A;  3A01 B;  2H6B A;  4XKV A;  3S15 J;  4M9X A;  5TIS C;  2E1C A;  3Q0W A;  1YYV A;  2H6C A;  3PSI A;  2R7Z J;  2ZXI A;  2RGV A;  4O5V A;  5FKO A;  3J81 Z;  3FDY A;  2JA7 J;  1AWC A;  2AHQ A;  1T56 A;  2XPV A;  3K4B A;  3FK7 A;  1ZQ3 P;  4HNV A;  3QPT A;  2KRF A;  4WXC A;  2ID3 A;  3KX2 A;  2VPL A;  1ACI A;  5EJC A;  5LGU A;  3PNV A;  2QSG X;  2LC2 A;  3HJE A;  2CQN A;  2V1X A;  3VYR B;  3H3Z A;  4V19 K;  3BZK A;  4XQF A;  1MIJ A;  1VQ9 I;  2QWW A;  5LFA A;  1J59 A;  3HPG A;  4XNF A;  3C1D A;  1B8I B;  2XAG A;  2VLA A;  2E60 A;  3TDZ C;  3KYL A;  5BPD A;  1PUF A;  2Y0M A;  3F6O A;  4KIB A;  2JVG A;  3OL4 A;  1QHH D;  2BOL A;  2CUE A;  2LH9 A;  5F0F A;  3ZCO A;  4F93 B;  4IHT A;  3V4G A;  2XAU A;  5F04 A;  1T38 A;  1MD0 A;  3BDD A;  2VOP A;  3E6B A;  1LFB A;  1WQ2 A;  3H9Q A;  4CA0 A;  1JGS A;  3PUF A;  4BJ6 C;  2VN2 A;  4HNU A;  1LDD A;  4BS9 A;  2UZK A;  2R7O A;  3L1P A;  4HF1 A;  2XB0 X;  3BG6 A;  2EA2 A;  1A04 A;  2Q2E A;  3D1N I;  3ZXS A;  2RV8 A;  5L3G A;  3V8L A;  3KZZ A;  2HOE A;  4M6X A;  2L7K A;  4A3K J;  1F9N A;  1LFP A;  3F8N A;  2V1D A;  3CC4 I;  3J80 K;  2MFZ A;  3BR2 A;  4I98 B;  2K4B A;  1V5E A;  4F55 A;  3S32 A;  2OU2 A;  5ILV A;  1X3Z B;  3SXY A;  3OMY A;  3TQN A;  2JSP A;  4M6V A;  4BL0 B;  2G7U A;  2EIJ H;  5FRN A;  5CQE A;  3P9K A;  4U87 A;  4ZYH A;  2AS5 F;  2CUJ A;  1TW3 A;  2STT A;  1ENH A;  1RPW A;  2QEN A;  2ZSH B;  2XAS A;  4EJU A;  2O03 A;  3G73 A;  4HYE A;  2FQ3 A;  2ELJ A;  3ELK A;  3M7G A;  4MLO A;  4CSW A;  3ZMS A;  5M3F J;  3GTJ J;  1JKQ C;  5H20 A;  3RTR A;  2LNB A;  2F5D A;  2DA1 A;  4P96 A;  3AL0 B;  3RIR A;  4CCO A;  1XSD A;  1IUY A;  4LG0 A;  1T6S A;  2LKX A;  2CQQ A;  4M74 A;  2BW3 B;  4ENN A;  3B73 A;  3MZY A;  4G9Y A;  2K3P A;  5DDG A;  2HWV A;  5LEJ A;  2E2H J;  1WH7 A;  4BHC A;  4KIS A;  3FZV A;  2E35 A;  1FTZ A;  2FBI A;  2QCO A;  2E2I J;  3HTU A;  4U7B A;  3CP2 A;  1BI1 A;  4KDP A;  5GAG J;  1ONV A;  1G8X A;  2L7Z A;  4HX8 A;  4JYK A;  4Q5S F;  1FC3 A;  1O57 A;  1OCP A;  3BOQ A;  4JX5 A;  3ZOB A;  2V4J C;  3MKL A;  2WV1 A;  1SMT A;  5HOO A;  4U0W A;  3IV5 A;  5GAD J;  3LL7 A;  2MG4 A;  1SEU A;  1O3R A;  4II3 A;  2DT7 B;  4G12 A;  2DMT A;  1YX5 A;  3OYD A;  1H0M A;  2K9Q A;  2L0K A;  3G2B A;  2Q1Z B;  1JJ6 C;  2GXA A;  2DA5 A;  2XGD A;  3KE2 A;  2IW5 A;  4S05 A;  4MTD A;  1X1D A;  3VOE A;  2VB6 A;  5A2Q K;  1FBS A;  2XGE A;  1SVM A;  1IXR C;  2VQH A;  1ZN2 A;  2LR8 A;  2IS2 A;  2WB1 A;  4BKX A;  4ESJ A;  4IRG A;  4N9H A;  4X6A J;  1Z67 A;  1YIT I;  2QQA A;  2X6W A;  2D1H A;  3KP6 A;  3OL3 A;  2COB A;  3QPS A;  3RPU D;  2HTS A;  2QYO A;  5EEH A;  1IRZ A;  3BCB A;  1Z6T A;  3V7S A;  4XR6 A;  3ABK H;  2Q8K A;  5CVU A;  3NWS A;  5J1R A;  1FZP B;  1PDN C;  4I2O A;  1FPQ A;  2DPD A;  4RGU A;  2L3D A;  1WWX A;  4Y33 A;  2VKV A;  5HDN A;  1WI3 A;  4BDZ A;  2LKP A;  3H92 A;  3DQV C;  2FQ4 A;  1KON A;  5M5Y J;  2L7F P;  2RN7 A;  2P5V A;  3N97 A;  1OCC H;  2GIZ A;  4L5J A;  2R4G A;  2CV0 A;  2TCT A;  2H1L A;  2NYX A;  2HOT A;  3M8J A;  5H6R A;  2XGC A;  4BUP A;  4BDY A;  3VPR A;  4XKW A;  5J6X A;  1G6N A;  5LGT A;  2EFW A;  4RDU A;  1JGG A;  3K4J A;  3GCM A;  1VQ5 I;  4CYC A;  2R7V A;  3KPH A;  2BE5 F;  4KFC A;  1QZZ A;  1T98 A;  1UZC A;  1Y56 A;  3CMM A;  1UG0 A;  2VT3 A;  1R1U A;  1YIJ I;  3K1N A;  3N05 A;  4L9T A;  5F0C A;  3CD6 I;  1E17 A;  2LRD A;  5J1Y A;  3WTX C;  1S7O A;  1EV7 A;  2NVQ J;  5IT9 Z;  3K1M A;  1Y1V J;  1R22 A;  3LQR A;  3ZMT A;  4ZYG A;  3BTI A;  4I6Z A;  1SVO A;  1SD6 A;  5LHI A;  2P5K A;  1TWC J;  1IXC A;  5L3D A;  4B4C A;  4D5F A;  4WWC A;  1X2M A;  3S1Q J;  1OFC X;  4NUB A;  1OYI A;  4NB5 A;  2CYY A;  2Z5U A;  5IYC J;  2K40 A;  3G1M A;  4E7K A;  1XC5 A;  1VTN C;  1P4A A;  2OBP A;  3FXM A;  1FX7 A;  3LSP A;  1G2H A;  4KIF A;  2R7F A;  2WAQ N;  3EUA A;  3KIO A;  2DK8 A;  2DQR A;  3TO6 A;  4JOM A;  2X6X A;  2HQ5 A;  2Y69 H;  2F4I A;  5J40 A;  2OTJ I;  4PUS A;  1JKO C;  3I55 I;  3RQ4 A;  1YRN A;  1YLF A;  3RKQ A;  4PGG A;  3BRO A;  3SEZ A;  4J01 A;  3PSF A;  3DBH B;  1W0T A;  3TDU C;  4OIP F;  3JSO A;  1K4T A;  3TW7 A;  2RNG A;  3HC7 A;  3K70 C;  4M9S A;  2L01 A;  1NK2 P;  4YII A;  1XD7 A;  3K4K A;  4LMY A;  2IP2 A;  3M4O J;  3M3Y J;  3LQQ A;  4FET A;  4A3F J;  4B44 A;  4C9Y A;  4UUS B;  1JKP C;  3FIS A;  5BMZ A;  1V3F A;  2K7L A;  3QP5 A;  2DT6 A;  1S7A A;  4PZJ A;  2LDU A;  3UKG A;  2E5N A;  3E6C C;  4RM3 A;  5EYR A;  5TJJ A;  3I59 A;  1BOB A;  4B09 A;  1MW7 A;  2EA4 A;  3F8C A;  2HYG D; 
#chains in the Genus database with same CATH homology
 1H8A C;  3FK6 A;  3S1M J;  5FJ8 J;  3HOX J;  3ZQC A;  5IP7 J;  2ECC A;  5JLX A;  4C3I J;  3W6V A;  2YS9 A;  2E2J J;  2KDZ A;  2JA6 J;  1UMQ A;  2LLK A;  2DTZ A;  3ZQF A;  1FEX A;  2IEK A;  1GV5 A;  3TED A;  2D5V A;  2EZH A;  1QRY A;  2FJ1 A;  4IEJ A;  3OIO A;  3B6A A;  3TP0 A;  1HF0 A;  3RZD J;  5BNG A;  3BG3 A;  3JRH A;  1WCM J;  1JT6 A;  2CJJ A;  3LNQ A;  5EG0 A;  2O9L A;  2FD5 A;  3JRB A;  1AKH A;  4RBO A;  4QTR A;  4BBR J;  4A3C J;  3A03 A;  1TWF J;  2X6O A;  5GPA A;  2JA5 J;  2ELK A;  2XPU A;  2FX0 A;  2NOG A;  3LSR A;  2N8G A;  3BR6 A;  3OSF A;  2R5Y A;  1GVD A;  2XSD C;  5EZH A;  3OOU A;  1B72 B;  4C3J J;  5DTD A;  1JTY A;  2K9S A;  2LFB A;  1Z0X A;  2DA4 A;  4D7M A;  4FE4 A;  3JR9 A;  2NS7 A;  4DW6 A;  4MO7 A;  5FLM J;  3H0G J;  2EH3 A;  4UUS A;  2LD5 A;  2HOS A;  2H8R A;  2GLO A;  3CCY A;  4M3G A;  3LSJ A;  5M5X J;  1IGN A;  3GTP J;  3GTM J;  4B1R A;  2B63 J;  4A3B J;  4A69 C;  5IP9 J;  1MSF C;  3S1R J;  1U78 A;  5M3M J;  4V2F A;  1FTT A;  2IAI A;  1I50 J;  2H1K A;  2W48 A;  5K7Z A;  4XRS A;  2Y30 A;  1A5J A;  1MH3 A;  5EGO A;  3JRG A;  3NAU A;  3G1L A;  5IYD J;  1X2N A;  1ETW A;  5K7F A;  1MBK A;  2JMW A;  5F0H A;  5IPA A;  4XRS G;  1A6I A;  4NDL A;  1RKW A;  5K7H A;  2HYJ A;  1WPK A;  2XPW A;  1XS9 A;  2L7M P;  2MW8 A;  3BT9 A;  5DS9 A;  3HOY J;  2DA2 A;  2L9R A;  2NVT J;  1I3Q J;  3SJM A;  1P7J A;  3Q3S A;  3BR1 A;  1Y1W J;  1S7E A;  5FKM A;  4J19 A;  3SFI A;  4AC0 A;  1P7I A;  4BXX J;  1ZK8 A;  3RZO J;  1ETY A;  3HGY A;  2VUM J;  4B3A A;  2ME0 A;  1JTX A;  1MBH A;  3S2H J;  3HEF A;  2HXI A;  4A3I J;  4JX4 A;  2GBY A;  3IH4 A;  2LTP A;  1JKR C;  1JUP A;  3BTL A;  1K83 J;  3DCF A;  4A3L J;  1T33 A;  3I4M J;  1FJL A;  4A3J J;  3ZQG A;  1QVU A;  3QQA A;  1FIP A;  5FKN A;  2E19 A;  2ID6 A;  4A3M J;  5J3L A;  3MN2 A;  1BL0 A;  5EF6 A;  2EQR A;  1JUS A;  4DYC A;  4A93 J;  4M3E A;  1ETK A;  1XG1 A;  3O8H A;  2HI3 A;  4AYB N;  3CQZ J;  3CDL A;  3RQI A;  4CYC B;  2RAE A;  1ETO A;  4JP0 A;  3K7A J;  1BW5 A;  1QPI A;  2EZI A;  3A01 B;  1U9O A;  3HBL A;  3S15 J;  2XB5 A;  3Q0W A;  5E3M A;  1FIA A;  1SAN A;  1GV2 A;  2R7Z J;  3C2B A;  5FKO A;  1RET A;  1LFU P;  2JA7 J;  2WB1 N;  2AHQ A;  3HDD A;  1T56 A;  2XPV A;  5GPC A;  2PMZ N;  3FK7 A;  4HNV A;  1ZQ3 P;  4M3B A;  3ZQH A;  2ID3 A;  1IDY A;  4FE7 A;  2M8G X;  3H3V K;  1ETQ A;  3GTK J;  3PO2 J;  3PO3 J;  1JUM A;  4X1E A;  2JJ7 A;  5J1U A;  1WGX A;  4IHY A;  5FLV A;  1VND A;  2DJN A;  3Q0U A;  1GT0 C;  1B8I B;  1MBJ A;  1IUF A;  3HOZ J;  5EDN A;  3S1N J;  5FKK A;  1PUF A;  1YRN B;  2EZK A;  3FKI J;  3Q0V A;  5F0F A;  2CUE A;  3JRE A;  1VI0 A;  1ZKG A;  2DA7 A;  5F04 A;  1IG7 A;  1LFB A;  3GTO J;  1Q1V A;  5C44 J;  4IHX A;  4IHV A;  1RES A;  2ME6 A;  3L1P A;  3JRI A;  2XB0 X;  3D1N I;  2MGQ A;  3HM5 A;  4A3D J;  4BY1 J;  3F0C A;  3FIW A;  3JRF A;  4A3K J;  3BQY A;  1LE8 B;  2R5Z B;  1POG A;  1APL C;  3BR2 A;  1QVT A;  2Y2Z A;  1O4X A;  4C2M J;  3BTC A;  5E3L A;  2YUS A;  4I76 A;  4M6V A;  5JLW A;  1HDD C;  2VI6 A;  3A01 A;  4W1U A;  5C3E J;  1ORK A;  1HLV A;  4JX6 A;  4GFB A;  2EBI A;  1ENH A;  1RPW A;  4IHW A;  1Z77 A;  1ETV A;  5E3O A;  3HB9 A;  1ZR2 A;  4A3E J;  3ZQL A;  3DEW A;  2M9H A;  3WHC A;  1MBF A;  3OSG A;  3K2A A;  3QPL A;  4MLO A;  4MIM A;  2R93 J;  5M3F J;  5F27 A;  3GTJ J;  1JKQ C;  1H89 C;  1HDP A;  1MH4 A;  4S0H B;  2DA1 A;  2CQX A;  1HOM A;  1D5Y A;  1B72 A;  2Y0S N;  2LKX A;  1BJZ A;  2CQQ A;  2NVX J;  2DA3 A;  3BR3 A;  1MSE C;  2NS8 A;  2CU7 A;  3BR0 A;  4DYQ A;  2O7O A;  2GM4 A;  2E2H J;  1WH7 A;  2M2E A;  1TWH J;  2ZB9 A;  3JRD A;  2R5Y B;  2O8K A;  4DYR A;  1FTZ A;  2QCO A;  4W97 A;  2VPR A;  2E2I J;  1IDZ A;  2LY9 A;  1NTC A;  2L7Z A;  4JYK A;  4FCY A;  3HOU J;  5GP9 A;  3HGG A;  3ZOB A;  1OCP A;  4JX5 A;  1K61 A;  3JRC A;  1MBE A;  3MKL A;  2WV1 A;  2HOA A;  4LOC A;  2CRG A;  3IV5 A;  1OCT C;  3HOW J;  1GUU A;  2MG4 A;  1MBG A;  3BG5 A;  5M5W J;  4G12 A;  2DMT A;  2E1O A;  3O8G A;  1LE8 A;  3S2D J;  2K9Q A;  1IV6 A;  2L0K A;  1TWG J;  1RR7 A;  3LOC A;  1JJ6 C;  2DA5 A;  2XGD A;  2IBD A;  2JN6 A;  5C4J J;  1X58 A;  4QSH A;  3BTJ A;  3S16 J;  3B6C A;  1UG2 A;  2XGE A;  1R9T J;  2LR8 A;  3IH2 A;  5EGO B;  4BKX A;  2K9N A;  1OJL A;  5IOY A;  3BR5 A;  4X6A J;  3HKZ N;  1U8B A;  9ANT A;  5EEA A;  2X9D A;  2QF7 A;  2COB A;  2R0Q C;  1IC8 A;  3QPS A;  1BA5 A;  1HCR A;  1IRZ A;  1F43 A;  4MFE A;  2I10 A;  2X48 A;  4D5C A;  2DMU A;  5C4X J;  5J1R A;  1ZGW A;  3S17 J;  1ETX A;  1DU6 A;  4FIS A;  3WHB A;  2VKV A;  2YU9 J;  1WI3 A;  2ECB A;  4XRM A;  1SFO J;  1VF9 A;  3SDG A;  2Y31 A;  1MNM C;  2FQ4 A;  4M3F A;  5M5Y J;  3GTL J;  1E3O C;  1EF4 A;  2L7F P;  4M3D A;  2LVS A;  2M0C A;  3E7L A;  1I6H J;  3TW6 A;  2TCT A;  2HOT A;  2XGC A;  3LSG A;  3I4N J;  4XK4 A;  1TWA J;  2VKE A;  3VPR A;  2EZL A;  5IYB J;  4EEF G;  4AUX A;  3GTQ J;  4Y7N J;  1RKT A;  3ZQI A;  1ZR4 A;  3MVP A;  2Y9Y A;  1JGG A;  4RDU A;  1CQT A;  3GBG A;  2DMN A;  4CYC A;  2Y9Z A;  1JJ8 C;  4BY7 J;  3BG9 A;  4V2G A;  4DZJ A;  3S14 J;  3TP3 A;  1ITY A;  3PM1 A;  5IP6 A;  4ABZ A;  5F0C A;  4BBS J;  1TC3 C;  2R92 J;  5J1Y A;  4Y52 J;  2NVQ J;  1BW6 A;  3GTG J;  1Y1V J;  4QIW N;  2LK2 A;  3CMY A;  2OF7 A;  3BTI A;  4I6Z A;  1H88 C;  5F1J A;  2CUF A;  1TWC J;  4B4C A;  4D5F A;  1X2M A;  5FKL A;  1AU7 A;  1DU0 A;  2XRL A;  5HOD A;  3S1Q J;  1OFC X;  1U9N A;  5EZG A;  2AO9 A;  5IYC J;  2K40 A;  2KT0 A;  2OPT A;  3G1M A;  5EG0 B;  1XC5 A;  1AKH B;  3LSP A;  1G2H A;  1F36 A;  4XID A;  2WAQ N;  1UHS A;  1VFC A;  5F08 A;  2HQ5 A;  4FTH A;  1B8I A;  3NAR A;  3BQZ A;  3A02 A;  1WH5 A;  2HXO A;  4UUT A;  1JKO C;  2DA6 A;  1YRN A;  3RKQ A;  2DN0 A;  4D7N A;  1W0T A;  1NK3 P;  2TRT A;  3G1O A;  1ZTR A;  1GDT A;  2DMP A;  3TW7 A;  3JRA A;  2JWT A;  4A3G J;  1NK2 P;  2M34 A;  3M4O J;  1AHD P;  2MSY A;  4C3H J;  3M3Y J;  4A3F J;  2JA8 J;  4L5E A;  2HDD A;  3IH3 A;  2G0E A;  4UUS B;  1JKP C;  1JT0 A;  3FIS A;  4XIC A;  1PUF B;  1W0U A;  4DZP A;  2P81 A;  5E3N A;  3UKG A;  2R5Z A;  5IOZ A;  5EYR A;  2DMQ A;  2JK3 A;  1IJW C;  3HOV J;  4MFD A;  2LP0 A;  2NVY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...