4DYQA

High resolution crystal structure of terminase small subunit gp1 of the bacterial virus sf6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 1 protein
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 37
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dyqA01
4HNVA 4XK4A 3G1OA 2M9HA 2DA4A 2ECBA 4JX4A 2XGCA 5C4JJ 1UHSA 2OF7A 3HOYJ 1WPKA 1QVTA 2XGDA 3JREA 2CJJA 1JKOC 2DA1A 2JMWA 3BR3A 1GDTA 5GPAA 3OSFA 1IGNA 2YS9A 3QQAA 2IEKA 3WHBA 4X6AJ 1ORKA 1T33A 5FLVA 1TWGJ 3HDDA 1IUFA 1HF0A 3FK6A 5F0CA 3BR0A 3GTMJ 1ZR4A 4MFDA 3JRGA 3G1MA 4JX6A 1MBEA 4D7NA 3S16J 2EZKA 5IOZA 2X9DA 5E3LA 1FTZA 3Q0VA 1OCTC 1ETXA 1FIAA 2FX0A 1Z0XA 2TRTA 4D5FA 1LE8A 2FD5A 1GV2A 4NDLA 1H8AC 4A3CJ 3DCFA 3MVPA 2AO9A 4UUTA 2LY9A 2HYJA 1YRNB 3BG3A 2L7FP 4A3GJ 4M3DA 2VKVA 3S1QJ 3ZQGA 3BT9A 2E2JJ 3A01B 3WHCA 2LD5A 5IYDJ 1U9OA 4Y52J 2R7ZJ 2QCOA 2Y0SN 2XB0X 1F43A 4JX5A 5J1RA 1JKRC 3BG5A 1RKWA 3A03A 1Q1VA 3O8HA 3JRFA 5C44J 4C3HJ 5J1YA 3C2BA 3S17J 1QRYA 1IV6A 5C3EJ 3OOUA 4FE7A 3LSPA 2L0KA 1Z77A 4BXXJ 3RZDJ 3S14J 3D1NI 2JA7J 4XRSG 2IAIA 3MKLA 4ABZA 2CRGA 2R5ZB 3HKZN 2WB1N 3BR1A 1RETA 3JR9A 2HOTA 2Y31A 3RZOJ 1NTCA 1Y1VJ 4DYRA 2LKXA 2GBYA 5IOYA 3UKGA 5F0HA 2NVQJ 1GV5A 2W48A 3K7AJ 5EZGA 3RKQA 4IHVA 2Y2ZA 3CCYA 2KDZA 2H8RA 4A3MJ 2D5VA 1MH4A 2JJ7A 4W97A 4MO7A 2CUEA 2LP0A 2O7OA 2R92J 1ETYA 2XGEA 4LOCA 1U8BA 1WH5A 2M34A 3LOCA 5JLXA 1B8IA 1RKTA 1ZR2A 1W0TA 2JWTA 3G1LA 1PUFB 1X58A 1ZKGA 2JA6J 5K7HA 1APLC 3H0GJ 3HM5A 2DMNA 1TWFJ 2ELKA 4J19A 3GTLJ 1D5YA 5JLWA 4A3LJ 1QVUA 4B1RA 2YU9J 1XC5A 1SFOJ 1JTYA 2LFBA 4M3FA 5DTDA 3MN2A 1BJZA 2LTPA 1AKHA 5M3FJ 2HOSA 1JJ6C 1B72B 2DA3A 3S15J 5E3OA 1LFUP 1ZTRA 3IH4A 1TWHJ 1AHDP 5FKNA 3M4OJ 4RBOA 3BR2A 4QSHA 3HOUJ 4A3EJ 3CDLA 1JKPC 3GTPJ 2VUMJ 4IHXA 3FIWA 2MGQA 3SDGA 3S1RJ 3K2AA 2XRLA 4DYCA 1ENHA 3JRAA 4FISA 1MH3A 1ETQA 2XPUA 1S7EA 1OCPA 3CQZJ 3RQIA 4QIWN 5IP6A 3VPRA 1QPIA 4S0HB 4IHWA 2X6OA 2M8GX 5J3LA 1LE8B 2Y30A 4M3EA 1H88C 1MBGA 1WH7A 1ETVA 1VF9A 1A6IA 2OPTA 1AU7A 1FEXA 1WCMJ 2Y9YA 1JTXA 1TWCJ 3W6VA 5J1UA 4AC0A 5DS9A 2FJ1A 3LSJA 2JK3A 3HOWJ 5EG0A 2VKEA 5EEAA 3LSRA 1MSEC 2EZHA 4FCYA 4I6ZA 5M5XJ 4EEFG 3M3YJ 3GBGA 2DMQA 4GFBA 3FK7A 2O8KA 1HCRA 1I6HJ 1ETKA 2E19A 2DN0A 4A3KJ 3BG9A 3ZQCA 2NVYJ 5F0FA 3ZQLA 2DA2A 5GPCA 1K83J 1GUUA 2ZB9A 5EGOB 2JN6A 2H1KA 5IYCJ 2EZLA 3TP3A 1EF4A 4X1EA 2WV1A 4A3JJ 1HOMA 2NVXJ 2L7MP 4AYBN 2WAQN 4D7MA 2MSYA 1HDDC 2XPWA 2M2EA 5IP7J 3B6AA 3HEFA 3JRHA 1ZK8A 1U78A 1Y1WJ 1JT6A 3S1NJ 2VPRA 2ME6A 5FKLA 4BBRJ 4BY7J 2NS8A 5M5YJ 2CQXA 2I10A 5EF6A 3E7LA 4AUXA 3QPLA 1X2NA 4UUSB 3JRIA 2B63J 5K7ZA 1JUPA 3BQYA 1HLVA 2HDDA 4M3BA 2L9RA 2LVSA 4M3GA 2DA6A 3JRBA 1MNMC 1UG2A 1IDYA 1ETOA 5EDNA 2ID3A 4DZPA 2KT0A 2EH3A 3ZQIA 1I50J 2DMTA 4D5CA 2R5ZA 1G2HA 2M0CA 1B8IB 3JRCA 2E2HJ 5M3MJ 1NK3P 4MIMA 1FIPA 4C3IJ 3FKIJ 5F1JA 3PO2J 2R5YB 3B6CA 2COBA 3PM1A 2HI3A 4B3AA 1IRZA 5IPAA 5EYRA 4G12A 3BTIA 2JA5J 3IH3A 5E3NA 2EBIA 1DU0A 2P81A 1BA5A 3BQZA 4A93J 2VI6A 2LR8A 2E2IJ 4BBSJ 4CYCA 1P7JA 1TC3C 3IH2A 1AKHB 4DW6A 5IP9J 3TW6A 1RR7A 2QF7A 4XRMA 1JJ8C 1ITYA 2EQRA 3GTOJ 1MBKA 2GLOA 1NK2P 1WGXA 2XPVA 3HOVJ 3GTGJ 2EZIA 2PMZN 4JYKA 4A3FJ 2MW8A 1POGA 1TWAJ 1P7IA 1GVDA 3LSGA 5HODA 4C2MJ 1R9TJ 2XB5A 4XICA 3SJMA 3BR6A 5FKOA 1X2MA 4A69C 2R0QC 4BKXA 5E3MA 3HOXJ 3H3VK 2K9QA 1B72A 1ETWA 2HOAA 4FE4A 2L7ZA 5EZHA 3BTCA 1U9NA 4DZJA 3QPSA 2HXIA 3HOZJ 4A3BJ 3S1MJ 3A02A 2NVTJ 1UMQA 5K7FA 3JRDA 1DU6A 5EG0B 2MG4A 3GTKJ 2AHQA 1JGGA 4IEJA 4DYQA 1CQTA 2YUSA 2DA5A 4QTRA 2K40A 3GTJJ 1VFCA 1MBFA 4A3IJ 5FJ8J 3HB9A 3OIOA 1XS9A 3I4NJ 1ZGWA 3SFIA 3ZQHA 5F27A 4L5EA 3DEWA 3FISA 3IV5A 1HDPA 3TP0A 1BW5A 4XIDA 2CQQA 4A3DJ 1JT0A 1GT0C 1RESA 1LFBA 3O8GA 3HGGA 5FLMJ 2IBDA 4V2GA 5IYBJ 1MBHA 4W1UA 3NARA 1VI0A 3ZOBA 2X48A 5C4XJ 5FKKA 3HGYA 1YRNA 1WI3A 4RDUA 3PO3J 2E1OA 4XRSA 4I76A 5FKMA 3A01A 4B4CA 3HBLA 2ECCA 3CMYA 3BTLA 4JP0A 2DA7A 3TW7A 4Y7NJ 4BY1J 2JA8J 1JUSA 1OJLA 2G0EA 2K9SA 3GTQJ 3F0CA 2HXOA 1IC8A 5EGOA 2NOGA 2NS7A 5F04A 1A5JA 1T56A 1RPWA 1K61A 4MLOA 3I4MJ 1JUMA 1MBJA 2RAEA 3BR5A 1SANA 4C3JJ 3Q0WA 3ZQFA 2CUFA 3Q3SA 9ANTA 3Q0UA 2LK2A 1IDZA 1IG7A 1IJWC 1BL0A 1OFCX 2HQ5A 4UUSA 1O4XA 1VNDA 2DMUA 4CYCB 2LLKA 3OSGA 3TEDA 2O9LA 4IHYA 1FTTA 2CU7A 4FTHA 1H89C 2DJNA 3L1PA 2GM4A 1BW6A 2R5YA 1FJLA 2XSDC 2R93J 2DTZA 2DMPA 2ME0A 1PUFA 3LNQA 2K9NA 2N8GA 5GP9A 3S2DJ 1MSFC 3NAUA 4MFEA 2ID6A 1E3OC 3S2HJ 2Y9ZA 2TCTA 5F08A 5BNGA 1I3QJ 3BTJA 1W0UA 1F36A 4M6VA 1ZQ3P 2FQ4A 1XG1A 5M5WJ 4V2FA 1JKQC
chains in the Genus database with same CATH superfamily
1WJAA 2GAUA 3V4GA 4XORA 2XKOA 1J59A 4BAYA 4LIVA 2CH0A 2ECBA 4JX4A 2XGCA 3Q5FA 4DQ2A 4RM3A 5C4JJ 2DTRA 1R36A 3WTWC 2R7SA 3ABMH 2OF7A 3OYMA 1MDMA 3HOYJ 1WPKA 2JTVA 3F3XA 2BXZA 1QVTA 2A3SA 3QWLA 3BR3A 5GPAA 1GLNA 2IEKA 2CQNA 4DJAA 4FASD 2ZXWH 3PNVA 1MGTA 1OYYA 1J2XA 1T33A 1R5HA 3ZMZA 2WAQA 5DM7F 3FXOA 1HF0A 2V1UA 3BR0A 3CCJI 2WBMA 4MFDA 4RS8A 4NQWA 5DCMA 3KP4A 2EZKA 1FTZA 2X9DA 4UVAA 5E3LA 1ZARA 3OYFA 1F4KA 4AU7A 2V6CA 3MKWB 3JTHA 3OS0A 1SAUA 4B47A 4BQOA 3GEZA 4NDLA 2LC2A 1H8AC 3I56I 3DCFA 1UHWA 2W57A 2YX4A 1IN6A 3RTRA 1SMTA 3HUGA 1D0YA 2AO9A 4UUTA 1OYIA 4XKVA 2P5LC 2NNNA 2LY9A 3BG3A 3BY6A 1R22A 2BGCA 2Z5UA 4A3GJ 2VKVA 3OYAA 1A35A 3VDXA 2XV4S 3ZQGA 1SD4A 1V4RA 3BT9A 3DLLF 5ICGA 3U21A 2E34A 1B1BA 2MC3A 3R4KA 4GYIA 1U9OA 1XX5A 4A0ZA 5ILSA 2RVCA 2R7ZJ 2RQPA 4LD5A 2FBHA 2GXGA 4BE2A 1Q1VA 3TBIA 5J1YA 2LF8A 1YX3A 4XOTA 2XROA 2VL8A 1QRYA 3CMMA 3CTAA 5LD2C 2IGKA 3EQLF 2FBIA 3OOUA 3LSPA 2V1DA 1Z77A 2JA7J 4XRSG 3MKLA 1TQPA 4ZDPA 3HKZN 1Y8QB 2HTJA 4YRVA 1P4XA 3CZ6A 2XF6A 4DNCA 4DBRA 1I1GA 2K5CA 3PQJA 2NVUB 1Y1VJ 1R23A 4UNOA 2O6GE 2GIZA 2DJIA 4EJOA 3ELKA 1O3SA 1FBSA 3FBNB 5CVVA 3LQRA 2KJCA 4L9NA 2Z99A 3HPGA 4XLAA 3SZTA 3IKVA 4RGUA 2F5DA 3PNTA 4KIGA 4OMZA 5F0HA 4BNCA 2KP6A 1EKEA 4BGDA 2M87A 3E6DA 4I0BA 4RGRA 2DDBA 3OL3A 4HYEA 3J7YJ 3Q9SA 2D5VA 3LFUA 2F5CA 4Q47A 4W97A 4LGWA 2O7OA 2PMUA 2P7VB 5ICCA 5E17F 1U8BA 4RMNA 4IO9F 2KFDA 1B8IA 1ZR2A 2JWTA 3G1LA 3EDPA 3PFYA 4FT8A 3GF2A 2IJLA 2HKXA 1MJAA 1ZKGA 2JA6J 3J7AY 5K7HA 1APLC 2J5PA 3G71I 4HA8A 4PJLA 3CLOA 1VTNC 1YE9A 1ON1A 3CCSI 4JBAA 2GXAA 4CA0A 3R61A 3WODF 4D9JA 2K27A 1IAWA 2YU9J 2YSRA 3WU2C 3HG9A 4CO8A 3CDHA 3D0SA 5DDGA 1B72B 2OBPA 2F2EA 4XLPF 2VQLA 3M07A 5H20A 1NH3A 4MQVA 1AHDP 5FKNA 3M4OJ 2JSPA 2GOMA 5D4SA 2VBXA 3RKXA 1I5ZA 4HRIA 1MMSA 1MMAA 3HOUJ 3I0TA 1YJWI 2BHZA 4A3EJ 1M1EB 2JZYA 2OUMA 3QOEA 4KA4A 1IN4A 2F6CA 5ICEA 1J5YA 2PX9A 2MBFA 1X19A 3SDGA 4AVPA 4J00A 2EFNA 2XRLA 2PN6A 1DP7P 4FISA 2CGPA 4L0YB 1QZYA 1S7EA 2E1MB 2EPFA 3S32A 4QIWN 5IP6A 1FSHA 4S0HB 3HZJA 2X6OA 3PJRA 4OIPF 4M3EA 1BR1A 1MBGA 4EV0A 1FEXA 3K4KA 4OU0A 2KQRA 2X6YA 2Y9YA 3MFKA 1R49A 2IS4A 2MD5A 2LY2A 2P4WA 5J1UA 4PJ0C 1BI0A 5J6XA 1Z91A 3LSJA 3ZXSA 3JAMK 1XMKA 3SEZA 2O3FA 2P8TA 2D1VA 3LSRA 4BHPA 1Y0UA 1EV7A 5M5XJ 2JUGA 3WG7H 3A0BC 1UB9A 3GBGA 2DMQA 1UJ8A 4G6DA 3GLXA 5D6FA 1S7OA 4U7DA 3PIOF 2A68F 1G4DA 4GYGA 4B43A 1O57A 1QU3A 2VJJA 5LHIA 1S72I 1QPMA 3ZQCA 1Y8RB 2NVYJ 4HZFA 4IRIA 4WXHA 2ZNYA 3GCMA 1P2FA 4LFUA 2JN6A 2TDXA 2MA3A 4HF0A 2UXNA 1MIJA 3I5UA 1MMGA 2HKOA 1HW1A 4AYBN 4BXFA 5E1ZB 2KL4A 2MSYA 2XPWA 3KZIC 2M2EA 2QQBA 2PEXA 2UWMA 4P9UA 5B1AH 5J8FA 1ZK8A 5AIPA 2QQ8A 3W6JB 2P5KA 3C18A 4XONA 1BC7C 1A36A 1Z3XA 1D8JA 2Q0OA 3GYHX 5FKLA 4F93B 3W3CA 2FRHA 2DO7A 3I9V2 1FNNA 2OV7A 3RPUD 3JRIA 5K7ZA 1JUPA 2JVGA 4XLEA 3ZMTA 3N05A 2B9SA 2MYSA 1MNMC 2DA6A 2W85A 1UG2A 3DU6A 4A6DA 4OIQF 2KT0A 2VE8A 3ZQIA 1R71A 4PJMA 4V19K 2QYOA 3V7SA 2M0CA 3F8CA 3IKTA 3BC8A 3JRCA 4E7SA 4EMSA 5M3MJ 1NK3P 2FSWA 1FIPA 2LYCA 2W1OA 5CYVA 5F1JA 3GMEA 2R5YB 2R4GA 4A12A 1DPRA 4M71A 3ZQQA 5IPAA 3ECHA 3OS1A 4G12A 3KYLA 5D6EA 2JA5J 4BH9A 4WX9A 2VOPA 3VEPA 2PFBA 4Y13A 3FMSA 2JPBA 5FROA 4RAYA 4AVZA 3BQZA 4A93J 2X0LA 4KMUX 3GW2A 2J5OA 2CW0F 1H9TA 4DW6A 3KYDB 3TW6A 4XSXF 1VZ0A 2QF7A 2F4MB 4XRMA 2D2WA 1BI3A 3PQKA 2K3PA 1BI1A 2QM3A 4D0PA 3H92A 1U5TC 3KLOA 2O5RA 3ZR8X 3PFIA 1F5TA 2MLGA 3H5NA 1XCBA 4YIIA 3HOVJ 2ISYA 3HC7A 2PMHA 3BCAA 4Y17A 4C2UA 1ZRCA 2OC6A 2AS5F 1QA6A 1POGA 1ZGJA 1VQ4I 1TWAJ 2VB6A 4A6EA 4B44A 4XQFA 1GVDA 3LSGA 3W2VA 3OYEA 4WK8F 1R9TJ 1XSDA 3E3VA 3BR6A 1MW7A 2HYGD 2HGCA 3MEXA 1YHQI 2R0QC 4MTDA 2M5WA 5E3MA 1IW7F 4ZYEA 4H0EA 1X1PA 3P9CA 4CYDA 2YX7A 1QZEA 2IW5A 2IS6A 4HF2A 4DZJA 2HXIA 2XGXA 3HOZJ 3EUHA 3CCRI 5K7FA 5EG0B 5CJ9A 1Z05A 3E1SA 2AHQA 1CQTA 3PNYA 3HKZA 4QTRA 3NWSA 2MH2A 1LKXA 2K40A 3U1KA 3GTJJ 4A3IJ 2IVMA 5DD8A 5FJ8J 2K9MA 3OIOA 3H5RA 2COMA 1ZGWA 3I4NJ 2UV1A 3QOPA 4C30A 3H0DA 1RI7A 1MJBA 3TP0A 1BW5A 4A5MA 4XIDA 3LA3A 3DP7A 2M1BA 1JT0A 3E6MA 2DQLA 3ZMSA 1LQ1A 3ZMDA 2P6SA 3WTVC 1LFBA 4R8HA 3IAM2 4E7IA 5FLMJ 3FBIB 2K02A 1VI0A 5C4XJ 3VFZA 4PFOA 1PUEE 3OYNA 2ADUA 4CZCA 4RB1A 4OIOF 2R7OA 4XKBA 4FHTA 4L9JA 3QP5A 1WWXA 2A6EF 3A01A 1K6YA 3HBLA 3L2RA 1H0MA 1Y56A 4KN4X 4G7ZF 3N4MA 3C2GA 3W6KB 4MTEA 3TW7A 4NC6A 2HEOA 3G3ZA 3GFJA 2G0EA 1XGSA 3GTQJ 2A6HF 4HF1A 2HXOA 1FZPB 1K7AA 1IC8A 3ZPLA 3J7AO 1GXPA 2NS7A 5F04A 1FMWA 1ZREA 2VIXA 4LMYA 3CP8A 3VWBA 4Q48A 1K61A 1HW5A 3I4MJ 2XC7A 1MBJA 2H94A 1JGSA 1SANA 3HTUA 1TL8A 3MQ0A 3CO6C 1YS7A 3Q0WA 1YLFA 3MKZA 3VODA 2CUFA 1VQ5I 4NBQA 1YW7A 4JK1X 1IG7A 4IPAA 4M73A 1OFCX 5HLHA 1WZ2A 4CCLA 4CXFA 4OMYA 1ACIA 2HQ5A 2X6WA 4ZYDA 3IWZA 3WTXC 3CJRB 5J4YA 2M0MA 2Y48A 1G3WA 2W00A 4WCGA 2H27A 4IHYA 5IY5H 2DXIA 3J80K 3B73A 3F21A 2HDWA 3VYUB 5DUIA 3L1PA 3V7CA 2GM4A 2R7UA 1BW6A 3DKXA 2EFWA 2R93J 2DTZA 1PUFA 4KISA 2K9NA 2QKLB 1MSFC 3NAUA 4MFEA 3U9GA 5ERIA 2RQQA 2CQ7A 3IAS2 4P9FA 5DCFA 3RYRA 3S2HJ 4II2A 1I3QJ 2X85A 1WJBA 1ZQ3P 5M5WJ 4NB5A 1Y0NA 2GXBA 3I3LA 4QLCU 1BN5A 5TJJA 2XKPA 2BBYA 2DA4A 4EJWA 1MNDA 4RLQA 4LB5A 1XDUA 2UZKA 1ZG5A 1Z7UA 1FLIA 4I09A 1UHSA 4C9YA 3SEQA 2XGDA 2CJJA 3H1CA 1OYWA 1H9GA 5F64A 2JMWA 4B3XA 1PP8F 3F8MA 4FQGA 5J8CA 1TP4A 3WHBA 3OYIA 5JFRA 4AYBA 5FLVA 3DPUA 4LK0F 2VT3A 3HDDA 1NG6A 2O8XA 3FK6A 4IZZA 1U3EM 2MLKA 2EWNA 2E1MC 3DBLB 3DBRB 3L2VA 2A07F 3JRGA 4JX6A 3E5QA 3S16J 5IOZA 3WE3A 1STZA 1ETXA 2X1EA 1Z0XA 1IF1A 3FXLA 4BU2A 1J0RA 2HFHA 1GV2A 2DOEA 3K4BA 4EGYA 3IUOA 2WA0A 1LVKA 4HG2A 3SDBA 1EJ9A 1LFPA 3MVPA 4AD9A 2HQNA 2PJRA 4G7OF 1UHMA 2DAOA 1YRNB 2HYJA 2JSCA 5KAFC 4ZYGA 1L0OC 4G94A 2VASA 4KICA 4Y33A 3MWMA 1U0JA 4ANJA 3QRFF 2LD5A 5IYDJ 1WQ2A 4Y52J 1LDKB 4I01A 1OR7C 2XSJC 5HDKA 2XB0X 4BEHA 4JX5A 4OAZA 3K70D 1RKWA 3A03A 3CF2A 3O8HA 2W4SA 3JRFA 2VOOA 5C44J 2ICWG 2FMLA 3FX3A 4A2UA 2ZSHB 3C2BA 3L2WA 2A6TA 5C3EJ 3LAJA 1T2KA 5FRMA 2ZKZA 4FE7A 4NC7A 2L0KA 1NG7A 1ERDA 3LA7A 3D1NI 3WGHA 3H9GA 3H3ZA 2LBFB 1R5GA 2R5ZB 2LRDA 4O3MA 3DQVC 2WB1N 4WXCA 2CWEA 3JR9A 4EM2A 3K4MA 1MMDA 2Y31A 3T8RA 2ISZA 1WFXA 1RUNA 2OQGA 2GWRA 2K85A 1XDSA 5CKTA 4DYRA 1MJ9A 5IOYA 5K5OA 1HC8A 1GXQA 1XGMA 4CCKA 4XNFA 3CMEI 4IHVA 2Y2ZA 3IP4B 4A3MJ 4EJTA 4L0ZB 5KK1A 3BDDA 4AWXB 3I58A 3L2UA 2JJ7A 4G6TB 4MO7A 1PP7U 2R92J 1T95A 1G6NA 4LOCA 4RB2C 2W82A 3LOCA 3P5JA 5JLXA 5J4VA 2P7CB 3OYLA 1RKTA 2BY0A 4I2OA 2LH9A 4Y3OA 2RNGA 2LG4A 2KDOA 3PL8A 4F7ZA 3L2QA 3K4JA 3M8EA 3H0GJ 4BQAA 4A0YA 2DBBA 2DMNA 1P6RA 1W7PA 5DD4A 3GTLJ 3VYTB 3U1DA 1D5YA 2HYFA 3GX4X 4BE0A 1XC5A 1UELB 2LFBA 1KQ0A 2DYRH 2MD0A 2ZCWA 2VQHA 5GADJ 5HLIA 1QHGA 4UXNA 1LFUP 3GLLA 3IH4A 2A61A 4EM0B 3K6GA 2EB7A 4RBOA 1FY7A 2QEXI 3BR2A 4QSHA 1D1BA 1UAAA 1RNLA 5K5QA 1SAXA 3I64A 2HVQA 3GTPJ 1SD5A 4ZTFA 5BMZA 2HQAA 2LF7A 1ZHFA 4P55A 1SFKA 3JRAA 4U87A 5JVGF 4NQWB 1ETQA 5DCMB 4OWRB 1QGPA 3RQIA 1RRJA 3TDUC 1QPIA 4HQMA 4AIJA 5FRNA 2L9NA 3NEUA 2BEOA 2WTEA 2HU9A 1T39A 2L5QA 3OR2C 2OPTA 1VF9A 1A6IA 2CFXA 2CQKA 1TWCJ 2BY1A 2FXAA 3HUGB 3TL4X 4AC0A 1TBXA 1YIJI 4HLXA 3I4PA 4IOAF 3BZKA 3DTKA 5FLXK 2R3SA 3F8FA 2EIMH 2VKEA 1KQ9A 1JE8A 2Z3YA 2R7WA 5B5EC 2VQCA 2VN2A 2EZHA 1FOXA 3P9IA 3KP3A 2EV0A 4GGGA 4EEFG 1MMNA 4CSWA 4M9ZA 3GFIA 2ESNA 2ACJA 1IZ1A 3ZRGA 3FK7A 1ETKA 4A3KJ 2QBYB 2RV8A 1EH7A 1DPUA 1P4AA 3SQNA 1CF7B 1IO2A 2X1DA 5FD5A 3ZQLA 3RYPA 2F4IA 3BP8A 3K4CA 2DDAA 3LA2A 2Q8KA 2ZB9A 4IHSA 4LG0A 5EGOB 1AOYA 4L5IA 2K3FA 2EZLA 2QQ9A 1OCZH 3ERMA 1S6LA 4M6YA 3I71A 4X1EA 4ASNA 4GRIA 4A3JJ 1EF4A 4L9TA 2KPMA 4I98B 3J7ZI 1X1AA 2R7RA 4D7MA 4TV7A 1SD6A 1HDDC 3C3WA 3UR3C 3ASOH 2ESHA 1DP3A 3HEFA 5E8GA 3JRHA 3CJNA 2RREA 5L3FA 2KISA 1FMVA 2E5ZA 3BJOA 2ME6A 1HSJA 1S5LC 4BY7J 2HPMA 4XSZF 2DPDA 1D0XA 4D1QA 2NS8A 5M5YJ 2I10A 3E7LA 4AUXA 3O3KA 3QPLA 1BI2A 2FUG2 4UUSB 1V5FA 1FBUA 1HLVA 3ISPA 2L9VA 4PSWA 4M3GA 3JRBA 2Z2SB 3DPLC 2HTSA 4BYYA 4HV6A 1ETOA 5EDNA 3WTYC 1LB2A 3DTEA 4DZPA 2DMTA 2WAEA 2QVOA 1G2HA 1WSUA 1SVLA 2XVCA 1B8IB 3HSFA 2E2HJ 3V8LA 2OZ6A 2RGVA 3RQ4A 1D5VA 3FKIJ 3CESA 3DKWA 4KT6A 4NNJA 1UCRA 5D5XB 3FF5A 1IRZA 4P96A 1JHFA 2QUFA 3FXRA 4LK1F 1V54H 3AG2H 1HKSA 2E5NA 1G3YA 3NWTA 1BA5A 3HRUA 4A5NA 2LR8A 1D3YA 4CYCA 1P7JA 1Y6IA 3H3UA 1SMYF 4L9VA 1RR7A 2K4JA 2VONA 2VBZA 1JJ8C 1R7JA 2EQRA 2OTJI 4HSTA 2AXLA 3PIPF 1MBKA 3OIPA 2AXTC 2IA0A 1W5TA 3HPHA 3LSKA 2EZIA 3MZHA 4NUBA 1I27A 2BW3A 3M9AA 4MNUA 1OCOH 3PSFA 3LAPA 4M72A 2CYYA 3JSOA 3PUFA 5HODA 4C2MJ 2XAJA 4MEXF 2XB5A 4XICA 2OCCH 4HDUA 3SJMA 2LDUA 5CVUA 4CGZA 2L9SA 4A69C 4BDZA 3H5AA 1Q1HA 2LNBA 2VJIA 1B72A 2XAQA 2KMUA 1XMXA 1ZRFA 2VXZA 2EINH 1U9NA 1JXSA 2XAFA 3KE2A 5D5WB 1UMQA 5H6QA 4BHCA 5HDNA 3D5SC 4YIRX 1MKMA 4E7KA 2FNPA 2VC0A 5D8LB 2JVHA 2WB1A 4WWCA 1VFCA 4OAYA 1UG0A 3WTSC 4XN3A 2V9KA 1OMIA 1IRFA 3WE2A 4LJZF 5IT9Z 4IQ4A 2DFEA 4YELA 3IV5A 4L5JA 2XDVA 1IXCA 2CV2A 3EETA 1S8NA 5JHUA 1HKQA 4C2TA 1GT0C 3HOTA 4RGSA 5E1XA 2L3DA 3OYCA 3IHUA 2VQGA 3K0LA 2F5EA 3BZ6A 4HOBA 4W1UA 2X48A 3D5RC 5TGTA 2M8EA 4ZYAA 1WJCA 5FKKA 4BUPA 1T0FC 2OD5A 3KYCB 1VQKI 2R7XA 4RDUA 3PO3J 2VJ4A 4ZDOA 3OYJA 2E1OA 3GFLA 4II3A 3S3MA 3V8JA 2E1CA 4ESJA 1BIBA 3EYYA 4I76A 3K10A 1BJAA 4B4CA 4IVNA 3BWGA 3R60A 3DF8A 3BTLA 3HSRA 2DA7A 3M8JA 1WJEA 2HQRA 1ULYA 4EQQA 1JUSA 1TQIA 3K4LA 3HYIA 3F0CA 2XF5A 3P9KA 1XSVA 1Y39A 1FOYA 3CUQA 2DQRA 2D1HA 3M7GA 3OIQA 5E20A 4PDKA 1A5JA 1R00A 3D5LA 1GVJA 1E2XA 1R6RA 1ZELA 4ZC3A 3F6VA 1ZGAA 4IF4A 1ZLJA 3BR5A 1X4PA 1T08B 4XLFA 3AKZA 3JCUC 5A2QZ 1QHHD 2MC4A 3V8KA 1SD7A 4ZZLA 2ZJPF 3AL0B 4CICA 9ANTA 2LREA 1HKTA 4CCMA 2X51A 4UB6C 1IJWC 1BL0A 1KGSA 2GA1A 1T6SA 3LSTA 1O4XA 3DEUA 4PCQA 2DMUA 1LUJB 2LLKA 4HV5A 3TO7A 1S7AA 4RAFA 3RSNA 2K4BA 2VE9A 1IN7A 3O6BB 2VT2A 4LIUA 4E7ZA 3TEDA 3BPVA 1ZYRF 4HQEA 4RGXA 1OLTA 2CU7A 4FTHA 3ABTA 2RN7A 2R5YA 3ABUA 1K78B 1FJLA 2G7UA 3ZQ7A 3SXYA 5HNFA 2XSDC 5IT9K 1HA8A 5KCMA 2PQ8A 4AIDA 3LNQA 5GP9A 3VSKA 4BL0B 1IV8A 1P4WA 2EFQA 3AAFA 2Y9ZA 2TCTA 1Z9CA 1DDNA 5BNGA 2M45A 3L00A 3BTJA 1F36A 2FQ4A 1KU7A 1JKQC 5JHFA 4BS9A 4HNVA 3A4CA 3CO7C 2M9HA 3E0JB 1QZZA 2Q1ZB 2FNAA 5FFZA 4PK4A 3ML6A 3FXJA 3R0AA 3ERED 3JREA 2NYXA 1JKOC 4K2EA 2DA1A 2VKDA 3C1DA 1GDTA 2DI3A 1IGNA 2V4JC 2YS9A 3QQAA 1WHUA 2ZFUA 3K69A 4XKWA 2JRMA 2NS0A 2LKSA 1TLHB 5LLQA 1IUFA 3LL7A 3BCBA 4MEYF 5F0CA 3GTMJ 6PAXA 3G1MA 1MBEA 4D7NA 3TKYA 3HOSA 2F5FA 1OCTC 4N9IA 1LE8A 2FX0A 2R7DA 2TRTA 4J01A 1FC3A 1XN7A 3JW4A 5A2QK 4A3CJ 2Q2EA 2K7LA 5BPDA 3OY9A 3V42A 1Z6RA 3SHFA 2L7FP 5HS8A 3K1PA 1XTAA 2BYVE 4M3DA 3T5XA 5HLGA 5ED4A 2V9VA 3EYIA 4KDPA 1YG2A 5FGMA 3S1QJ 2E2JJ 3A01B 3WHCA 1Z3YA 1HBXG 2EIJH 5AIQA 1V5GA 2BV6A 2Y0SN 3KP7A 4E7HA 1F43A 5J1RA 3MMYB 1U2WA 3BG5A 3OV8A 3F8NA 5L3BA 2L4MA 4HAMA 3DEEA 3S17J 4PJNA 3TOAA 2OCEA 3ULQB 4CDGA 5CVIA 2PG4A 3M1CA 3LFKA 3ZGKA 4BXXJ 3S14J 1W1WE 4DIQA 4ABZA 2OU2A 1FYKA 2BOLA 2ZSIB 3BR1A 3S2WA 1QBJA 2HOTA 2JUCA 4XM3A 2IPQX 1S9HA 1NTCA 2JA2A 3BG6A 4EGZA 1BC8C 3BJAA 1KYWA 3C2HA 1YFHA 3GZ6A 3I53A 2VC1A 2LKXA 4IJAA 2CG4A 4HBLA 4KN7X 2M7BA 1ZG3A 5BOXA 2KZGA 3KP5A 3R6SA 5TRDA 1GV5A 2W48A 5EZGA 3QYFA 3K1MA 4N0BA 2ZJRF 1HXDA 3CCYA 2KDZA 3N97A 3OS2A 2E60A 2DFFA 4H4KC 2XF7A 2XAGA 4F3QA 2LP0A 1ETYA 3HHGA 2XGEA 4EATA 5E1WA 4L18B 3W2WA 2ZBKA 4IRHA 3ZN0A 1TTYA 2BVMA 4RAGA 1PUFB 3COAC 2PI0A 4LITA 5JR3A 4KIFA 2IT0A 4MQ9F 1XPXA 3QPTA 4FETA 1TWFJ 3DFGA 2ELKA 2GOXB 4J19A 2IS1A 5H6RA 2B0LA 2Z9OA 1X1DA 2HVRA 5EEGA 2QGUA 4A3LJ 3EUAA 1JTYA 1O3QA 4HLYA 5DTDA 3K70C 1XB4A 1TQMA 2LTPA 3SYTA 3OL4A 3TO9A 3LSHA 3FHZA 1JJ6C 1AKHA 1YIOA 2DA3A 4KNYA 1ZTRA 2OA4A 1YJNI 2NXNB 3P7NA 3KPHA 3GZ5A 5L3CA 2F5VA 1ONVA 3CDLA 3FWEA 1JKPC 1E3PA 4IHXA 3S1RJ 2MGQA 3K2ZA 3F6OA 1K4TA 4DYCA 1ENHA 2EFPA 1N78A 3KIOA 2XPUA 1OCPA 2BXYA 2KJBA 4GO1A 4IHWA 3DTIA 1OQYA 5J3LA 2XIGA 3G73A 2RKHA 4N4OB 1H88C 3L7WA 1ETVA 5LRRA 3G4SI 3K4NA 1ZAOA 3RPUA 2I8DA 2ZMEB 4ENJA 2DW4A 3QYBA 2BE5F 3QPHA 5GTHC 3KEYA 3W6VA 2PJRB 4HPQA 5DS9A 3FM5A 5KHDA 2RDPA 2FJ1A 2CUZA 3H9JA 1F1ZA 5J40A 4FX0A 5EEAA 4MGRA 1WKMA 2A5WA 3F8BA 3J81Z 1G59A 3S8PA 4BEHB 2O8KA 1RUOA 1HCRA 5ICFA 2E19A 2F4OB 4BXUA 3BG9A 2LKPA 1I39A 4ENNA 5GPCA 3M8FA 1R1UA 1R4NB 4EM1A 1GUUA 2E71A 2WV0A 1SFXA 2HWVA 2H1KA 5IYCJ 3CCMI 3DBHB 3TP3A 4HNUA 2KIUA 2L7MP 3HRSA 4BQQA 3S93A 1D1AA 2XRNA 2KRHA 3RCOA 3SZPA 1XSXA 5IP7J 1T0FA 5LHHA 2IA1A 2VBYA 5LEJA 1Y1WJ 1JT6A 2QZ8A 5HNHA 3S1NJ 3VSLA 3DPTA 4G7HF 2Y75A 2CQXA 3I59A 1X2NA 4HEA2 1FT9A 2VPLA 4AIHA 2FF4A 3BQYA 2HDDA 2L9RA 3IRQA 4M9SA 2FOWA 4B48A 4YEJA 2FU4A 1IDYA 2E1NA 5FD6A 1G8XA 2IXSA 2OQRA 1I50J 4D5CA 1G3TA 4WF2A 4XRFA 5LBQA 2R5ZA 4KT5C 4R1HA 4LLLA 4BJ5C 1TNTA 3A0HC 4MIMA 4C3IJ 2HOEA 3DKYA 3PO2J 2Y69H 3B6CA 3I55I 4B3AA 5EYRA 3AL0C 2KHMA 3BTIA 1W7PB 4RB3C 4CHUA 4PGHA 1DU0A 2ZXJA 3QYEA 5FFXA 1N77A 1OISA 3TDZC 4IQJA 3KP2A 3Q9VA 5IP9J 3FMRA 2BVLA 4U88A 3OWTA 2BY3A 3RKYA 3EUKL 1TNSA 3J81K 1F9NA 5CVJA 4QPQA 2DOAA 1ZN2A 5D5UB 1B4AA 3LSIA 2VLAA 1MDMB 4RLFA 3GTOJ 2JT1A 5HS9A 2GLOA 3FXMA 2X6XA 3FDYA 2NRAC 2XPVA 2L2OA 3LWFA 1U5TA 2UXXA 1V55H 4CCOA 2PMZN 1C0WA 2YU3A 3IWFA 3CJQB 3VB2A 1ZG1A 4XMYA 1B6AA 2E7XA 2MW8A 1LPQA 1BOAA 1P7IA 1EH8A 2W7NA 1LJ9A 2MFZA 2XAHA 5FKOA 2FE3A 1SVMA 2Y0SA 4BKXA 5F1RA 2K9LA 3HOXJ 3KEQA 3H3VK 2ZXIA 2FQ3A 1ETWA 3HSEA 1AA7A 2HZDA 2K86A 3HIFA 2V1NA 4FE4A 4GCVA 1KYZA 1N75A 5EZHA 3TOBA 3EUHC 5LRSA 4M9XA 1O3TA 3S1MJ 4KUMA 4YG2F 2NVTJ 4XLCA 3O2PE 2QSGX 3JRDA 1DU6A 2MG4A 3CC7I 1LEAA 4R79A 4P1WA 3OYDA 3IL2A 1AWCA 4AM3A 4IEJA 2YUSA 2KLOA 4B8XA 2DCEA 3IRRA 3ABKH 5F6FA 3WU0A 4ZJZA 4IKFA 1MBFA 4X0GA 2CFOA 4PFPA 3BOQA 3IC7A 4CCJA 4HX4A 4I02A 2O03A 4UV8A 2CS3A 3RJPA 1QQIA 1DUXC 4F52A 5J47A 5F27A 4L5EA 3FISA 5TISC 1HDPA 2X4HA 5IT3A 2ZFWA 3CD6I 4CUGA 4LG0B 2CQQA 5L3EA 2LY1A 3BZCA 1K79A 2DPUA 1USTA 1I1SA 2WADA 4BHBA 1IXSB 3HGGA 5B3SH 5IYBJ 3KZZA 4UHTA 3ZOBA 5KVRA 4HNTA 3CCLI 5L3GA 3HGYA 2H6CA 1YITI 1J75A 3GO5A 4HX7A 3ZMUA 2P0WA 1XCVA 3AG1H 2O0YA 5CPRB 5LGUA 4GDFA 2M30A 1DGWY 4XRSA 1BBYA 4P5OA 5FKMA 1CGPA 2EA2A 4ENMA 1YI2I 1KA8A 3CMYA 1WJFA 3DLAA 1ON2A 3X2QH 5LGTA 1FP2A 4Q4ZF 1HW2A 5HLTA 2QBYA 2JA8J 1YOVB 1YS6A 1CF7A 1OJLA 2K9SA 4PZJA 3CCVI 2VJ5A 5EGOA 3OOPA 5DEQA 4BJ6C 2NOGA 1W4MA 1XGNA 2XUBA 1T56A 1SC7A 4KITB 2EJRA 4QWQA 5E8IA 1RPWA 2OJED 4U0VA 3ZN1A 3DXJF 3CF5F 4MLOA 4WXDA 1JUMA 4E4HA 4M6XA 1X3WB 3E6CC 1IRXA 3JAMZ 2L01A 4BE1A 1IDZA 2Z33A 3LMMA 4RM2A 1V3FA 4RA2A 5FB2A 3HL2A 1D8KA 3CJTB 3KETA 1WJDA 5LEKA 4UUSA 1VNDA 1FPQA 2FBKA 3JTGA 3VOEA 2D45A 4CYCB 1FP1D 1Z7LA 2V7FA 3QP6A 3E5XA 2YR2A 2OAZA 1YW8A 2X1CA 1TW3A 2ZJQF 1X1CA 2VODA 1R1TA 4G6QA 1MZBA 4OOIA 5EEHA 1H89C 2QSHX 2DOFA 3GVAA 2QA4I 1ZH5A 2CMPA 2BY2A 2A5YB 2ME0A 2BW3B 4CZZA 1VQ9I 4ESFA 3A2KA 3S2DJ 3FHNA 1T98A 1TT0A 2ID6A 2E7WA 1W0UA 3TO6A 4M6VA 1R58A 2FMYA 2DU9A 4PJJA 4ON0A 4XK4A 2M3AA 1W5CC 2KIFA 3G1OA 5B66C 4Y4RA 3VYRB 4EVIA 1G3SA 1K6OA 2WC2A 4XKCA 1B59A 5DM6F 3VYSB 2NNYA 1SFUA 3QODA 3PSIA 3TQNA 4I7HA 4YIFA 4ZDLA 2QKMB 4PGGA 5FO5A 3T0YA 1FYMA 1IRGA 3OSFA 4JOMA 3MD2A 4PUSA 1S29A 4X6AJ 1ORKA 4LLGF 4ESBA 1TWGJ 4RAZA 3RKWA 4BJTA 3WTZA 1ZR4A 5GAGJ 3WGGA 4F92B 3BLYA 2R7FA 4KIBA 3Q0VA 3S3NA 2XHKA 2ELHA 2GQQA 1DGRM 2OZUA 1FIAA 3REOA 4D5FA 4YFKF 3OMYA 1R1VA 1BM9A 1W5SA 1VQMI 4UY8I 2FD5A 2GIVA 2ZMEC 3ECOA 5BQTA 5HOOA 2V9PA 3MCZA 2ETHA 5HDGA 3HRMA 4GXOA 4Y15A 4I99C 1FX7A 4F55A 1OCCH 3RPQA 3HTSB 1TW2A 4IX7A 1SEUA 3WU1B 1EH6A 2B7EA 3LSMA 3ZCOA 1Z67A 5K1YA 3KCCA 2LSOA 4HSRA 2QCOA 1RIOH 1JKRC 2XAUA 1QNTA 1OR7A 5DUKA 4C3HJ 2ELJA 4XN0A 3TMOA 3CUQB 5L3DA 1IV6A 4UVCA 1R4MB 2IP2A 1X4OA 5CLSA 3F23A 3RZDJ 2IAIA 2DYSH 2I5UA 3MZ8A 5E79C 2CRGA 3MKYB 3GUDA 1X3ZB 1BOBA 4Z6YA 2H6BA 5K5RA 1RETA 1PYVA 4I0AA 3RZOJ 3NRVA 1IUYA 5KAIC 5CVRA 1KU9A 1FOWA 3ONQA 4BACA 1VQPI 2STWA 2GBYA 2PMZA 3UKGA 1J09A 2RNJA 3K7AJ 2BHYA 1VQ6I 2NVQJ 2V79A 3RKQA 2DLLA 1GHCA 1LNWA 2LOOA 2L54A 3F9KA 4XL9A 1IN5A 2H8RA 1LDJA 5DV5A 3DWLE 1BIAA 2IRFG 1MH4A 1T8IA 2CUEA 2YPRA 5HS7A 4JQFA 3RIRA 1WH5A 2M34A 3BPXA 4XLNF 1W0TA 5DYMA 5H2FC 1X58A 2L4AA 2HPIA 2P6TA 3OYHA 2V6EA 1REPC 2CO5A 3CCQI 1O7LA 2PJPA 2VBWA 3H35A 2XASA 3HM5A 4G9YA 2DK8A 4S05A 5JLWA 1OKRA 1RC9A 2KRFA 3CLQA 4HDVA 1QVUA 2W25A 4B1RA 2HR3A 1SFOJ 3FXKA 4M3FA 2M4KA 1NHAA 2DK5A 2V1XA 1P92A 1U8RA 2Y0MA 1ZRDA 2V26A 3MN2A 1IXRC 4QPOA 1BJZA 1DQUA 2CW8A 3ZP5A 5M3FJ 2HOSA 3TGNA 3S15J 4IRGA 5E3OA 1R5ID 1HSTA 1TWHJ 4NC8A 5CQEA 5D5VB 4HX8A 1K78A 1FOKA 1PVEA 4M74A 2WWYA 2FEZA 5GAEJ 3OYBA 2HNHA 1A04A 3OYKA 2VUMJ 2H09A 1D1CA 3FIWA 3WTTC 3K2AA 1MH3A 1LEBA 2IS2A 3OYGA 1YX5A 4UUVA 3CQZJ 4KFCA 4BDYA 4OIRF 3VPRA 1MD0A 2KZVA 3BJ6A 1P9QC 2JQ7A 2M8GX 1LE8B 1LVAA 4KMFA 2Y30A 1YJ9I 4UB8C 1WH7A 1AU7A 4IHTA 5GAHJ 1WCMJ 1D0ZA 2EV5A 3HXLA 1JTXA 2MH9A 1W36C 2Q2EB 2M4GA 4CH7A 3U2RA 1U6GA 1N25A 4CCNA 4F91B 1Z6TA 2JK3A 3HOWJ 2LMDA 2KIMA 3J80Z 5EG0A 1L3LA 1W7PD 4DOZA 4HW0A 1MSEC 1FWZA 2QSFX 4FCYA 4I6ZA 3M3YJ 3KEOA 2P5VA 2EFOA 1B9NA 3E5UA 4GFBA 3R0JA 4YFXF 2Z16A 3CC2I 1I6HJ 2DN0A 5EJCA 1S3JA 2VXDA 4LG3A 3CC4I 1PJRA 5F0FA 3GXOA 2IGNA 2DA2A 3BROA 2L7KA 4MHGA 1K83J 2MABA 5KNLA 3ASNH 4BQNA 2E35A 2WY7Q 3C7JA 2WV1A 1HOMA 3KFWX 2NVXJ 2WAQN 3DV8A 4N9HA 5LGNA 5JVTA 1KU3A 1WJ5A 4ITVA 3B6AA 2C6YA 4ZZDA 2FA5A 1VQ7I 2EK5A 1MNEA 2GZWA 1U78A 2OTLI 1SFEA 4DGWB 2VPRA 3FXQA 2G9WA 4BBRJ 4E7JA 2QQAA 3H9QA 2EIKH 5EF6A 2ZXHA 2B63J 3B02A 4IXAA 4PSXA 3A1YA 4M3BA 2L02A 2LVSA 4EJVA 2R7QA 5BS6A 1JI8A 1W36D 2Z1DA 2ID3A 4U0YA 4KJZA 3CP2A 2EH3A 2A69F 2WAFA 4XOPA 5CQGA 4YFNF 1OPCA 1ODDA 3NQOA 2COBA 1BR4A 3PM1A 1O7FA 2HI3A 2HZTA 2RC4A 2PBIA 4ETSA 4ZTJA 2DFIA 3OR1C 4AIKA 3SFZA 1Z1DA 3CCUI 4XR6A 1KONA 3IH3A 5E3NA 2EBIA 4UVBA 1E3HA 4A0XA 5D8KB 1TZLA 2P81A 4S04A 3ABLH 3WGIA 1FBQA 1YO5C 1T38A 2VI6A 2HS5A 3ESWB 2E2IJ 4U0WA 4E70A 4NHJA 4BBSJ 4O5VA 3FM3A 1TC3C 3IH2A 1AKHB 2HDCA 2F48A 2QWWA 4XLHA 3PUBA 1O3RA 2FOKA 2DFHA 3FXUA 1ITYA 2M7AA 4G8XA 1NK2P 2H8WA 1A6QA 3L9FA 1WGXA 3F72A 3V7RA 2AQEA 2QENA 4O6JA 4E7LA 1E17A 3GTGJ 3KZYA 4JYKA 3FMQA 5GTIC 5ILUA 3CMAI 4A3FJ 1YTYA 2KKOA 2IGMA 3HJEA 4XBFA 2IA2A 3JSPA 1XMAA 2W24A 1QO0D 1VQNI 1JHHA 2GA2A 2KRCA 1K4SA 1X2MA 1XGOA 4N4NB 2K9QA 3RDIA 2H1LA 5JI6A 1WI9A 2HOAA 2EV6A 2L7ZA 1LDDA 3QU6A 1SVOA 3BTCA 3EPZA 3QPSA 5ILVA 1UFMA 2AQFA 4A3BJ 3A02A 3G2BA 3L09A 4RB0A 3T1BA 1FYLA 3GTKJ 1JGGA 4DYQA 2DT5A 2DA5A 2NAZA 3G6EI 4EJUA 3CDIA 2EA4A 3M1EA 2DT7B 2JPCA 2WY8Q 3HB9A 3KP6A 2UUZA 4IL6C 1J9IA 1XS9A 3SFIA 3WTUC 3DU5A 1YW9A 3ZQHA 4B09A 4OINF 1WVRA 2CSOA 2CV0A 2STTA 1XD7A 3DEWA 4LB6B 1ZLKA 1RZ4A 2ZMEA 4A3DJ 3CCEI 1EA3A 3KX2A 2G7HA 1RESA 1FSEA 3O8GA 2IBDA 4V2GA 1BR2A 1MBHA 3NARA 1X1BA 3UNGC 2O61A 4Z2YA 1YRNA 1WI3A 2HVSA 3BG7A 1RR8C 3W2AA 3FZVA 2JRTA 1VQ8I 2E36A 1HQCA 3I59B 3MZYA 4Q5SF 2ECCA 3S3OA 3AFHA 3AG3H 3HHHA 4JP0A 1B9MA 4Y7NJ 4BY1J 3HRTA 3WG9A 3CUQC 3FKJA 4FX4A 1UZCA 2DT6A 2PLYA 3T8TA 5LHGA 1E0EA 3E97A 5LFAA 1OCRH 2KIQA 2R7VA 3K9TA 3LQQA 4DBQA 3MAJA 3H36A 3E6BA 1IN8A 2LBFA 2ZJ2A 3SZGA 2ZC2A 3CUOA 1PDNC 2BZTA 5AONA 2RAEA 2CV1A 3ROUA 4C3JJ 3GFMA 1A31A 3ZQFA 3RI4A 3Q3SA 1KZHA 2CUJA 2LK2A 3Q0UA 5FLXZ 3AG4H 4U7BA 1YYVA 3QU3A 4KYWA 1USSA 1Z21A 2VKHA 5E18F 2QLZA 1WRJA 3OSGA 1I6XA 1J7KA 1TT5B 5BPIA 2A05A 3F22A 2W84A 3K1NA 3L2CA 2O9LA 4ZH4F 1FTTA 2ZO4A 3I54A 2NOJB 5D4RA 1X3UA 4UV9A 3QAHA 4ZYHA 2DJNA 3ZMVA 4IOCF 1VQOI 1V5EA 1VQLI 2ZNZA 1U5TB 4ENKA 1I3AA 2DMPA 3KLNA 2N8GA 2R7TA 1E3OC 1KQ8A 4LLNA 5F08A 5HVQC 5B1BH 2DODA 1YQAA 1KU2A 4E6KG 2CW7A 1XG1A 2EILH 3GWZA 2IGOA 3GZNB 4V2FA
chains in the Genus database with same CATH topology
4HNVA 4XK4A 3G1OA 2M9HA 2DA4A 2ECBA 4JX4A 2XGCA 5C4JJ 1UHSA 2OF7A 3HOYJ 1WPKA 1QVTA 2XGDA 3JREA 2CJJA 1JKOC 2DA1A 2JMWA 3BR3A 1GDTA 5GPAA 3OSFA 1IGNA 2YS9A 3QQAA 2IEKA 3WHBA 4X6AJ 1ORKA 1T33A 5FLVA 1TWGJ 3HDDA 1IUFA 1HF0A 3FK6A 5F0CA 3BR0A 3GTMJ 1ZR4A 4MFDA 3JRGA 3G1MA 4JX6A 1MBEA 4D7NA 3S16J 2EZKA 5IOZA 2X9DA 5E3LA 1FTZA 3Q0VA 1OCTC 1ETXA 1FIAA 2FX0A 1Z0XA 2TRTA 4D5FA 1LE8A 2FD5A 1GV2A 4NDLA 1H8AC 4A3CJ 3DCFA 3MVPA 2AO9A 4UUTA 2LY9A 2HYJA 1YRNB 3BG3A 2L7FP 4A3GJ 4M3DA 2VKVA 3S1QJ 3ZQGA 3BT9A 2E2JJ 3A01B 3WHCA 2LD5A 5IYDJ 1U9OA 4Y52J 2R7ZJ 2QCOA 2Y0SN 2XB0X 1F43A 4JX5A 5J1RA 1JKRC 3BG5A 1RKWA 3A03A 1Q1VA 3O8HA 3JRFA 5C44J 4C3HJ 5J1YA 3C2BA 3S17J 1QRYA 1IV6A 5C3EJ 3OOUA 4FE7A 3LSPA 2L0KA 1Z77A 4BXXJ 3RZDJ 3S14J 3D1NI 2JA7J 4XRSG 2IAIA 3MKLA 4ABZA 2CRGA 2R5ZB 3HKZN 2WB1N 3BR1A 1RETA 3JR9A 2HOTA 2Y31A 3RZOJ 1NTCA 1Y1VJ 4DYRA 2LKXA 2GBYA 5IOYA 3UKGA 5F0HA 2NVQJ 1GV5A 2W48A 3K7AJ 5EZGA 3RKQA 4IHVA 2Y2ZA 3CCYA 2KDZA 2H8RA 4A3MJ 2D5VA 1MH4A 2JJ7A 4W97A 4MO7A 2CUEA 2LP0A 2O7OA 2R92J 1ETYA 2XGEA 4LOCA 1U8BA 1WH5A 2M34A 3LOCA 5JLXA 1B8IA 1RKTA 1ZR2A 1W0TA 2JWTA 3G1LA 1PUFB 1X58A 1ZKGA 2JA6J 5K7HA 1APLC 3H0GJ 3HM5A 2DMNA 1TWFJ 2ELKA 4J19A 3GTLJ 1D5YA 5JLWA 4A3LJ 1QVUA 4B1RA 2YU9J 1XC5A 1SFOJ 1JTYA 2LFBA 4M3FA 5DTDA 3MN2A 1BJZA 2LTPA 1AKHA 5M3FJ 2HOSA 1JJ6C 1B72B 2DA3A 3S15J 5E3OA 1LFUP 1ZTRA 3IH4A 1TWHJ 1AHDP 5FKNA 3M4OJ 4RBOA 3BR2A 4QSHA 3HOUJ 4A3EJ 3CDLA 1JKPC 3GTPJ 2VUMJ 4IHXA 3FIWA 2MGQA 3SDGA 3S1RJ 3K2AA 2XRLA 4DYCA 1ENHA 3JRAA 4FISA 1MH3A 1ETQA 2XPUA 1S7EA 1OCPA 3CQZJ 3RQIA 4QIWN 5IP6A 3VPRA 1QPIA 4S0HB 4IHWA 2X6OA 2M8GX 5J3LA 1LE8B 2Y30A 4M3EA 1H88C 1MBGA 1WH7A 1ETVA 1VF9A 1A6IA 2OPTA 1AU7A 1FEXA 1WCMJ 2Y9YA 1JTXA 1TWCJ 3W6VA 5J1UA 4AC0A 5DS9A 2FJ1A 3LSJA 2JK3A 3HOWJ 5EG0A 2VKEA 5EEAA 3LSRA 1MSEC 2EZHA 4FCYA 4I6ZA 5M5XJ 4EEFG 3M3YJ 3GBGA 2DMQA 4GFBA 3FK7A 2O8KA 1HCRA 1I6HJ 1ETKA 2E19A 2DN0A 4A3KJ 3BG9A 3ZQCA 2NVYJ 5F0FA 3ZQLA 2DA2A 5GPCA 1K83J 1GUUA 2ZB9A 5EGOB 2JN6A 2H1KA 5IYCJ 2EZLA 3TP3A 1EF4A 4X1EA 2WV1A 4A3JJ 1HOMA 2NVXJ 2L7MP 4AYBN 2WAQN 4D7MA 2MSYA 1HDDC 2XPWA 2M2EA 5IP7J 3B6AA 3HEFA 3JRHA 1ZK8A 1U78A 1Y1WJ 1JT6A 3S1NJ 2VPRA 2ME6A 5FKLA 4BBRJ 4BY7J 2NS8A 5M5YJ 2CQXA 2I10A 5EF6A 3E7LA 4AUXA 3QPLA 1X2NA 4UUSB 3JRIA 2B63J 5K7ZA 1JUPA 3BQYA 1HLVA 2HDDA 4M3BA 2L9RA 2LVSA 4M3GA 2DA6A 3JRBA 1MNMC 1UG2A 1IDYA 1ETOA 5EDNA 2ID3A 4DZPA 2KT0A 2EH3A 3ZQIA 1I50J 2DMTA 4D5CA 2R5ZA 1G2HA 2M0CA 1B8IB 3JRCA 2E2HJ 5M3MJ 1NK3P 4MIMA 1FIPA 4C3IJ 3FKIJ 5F1JA 3PO2J 2R5YB 3B6CA 2COBA 3PM1A 2HI3A 4B3AA 1IRZA 5IPAA 5EYRA 4G12A 3BTIA 2JA5J 3IH3A 5E3NA 2EBIA 1DU0A 2P81A 1BA5A 3BQZA 4A93J 2VI6A 2LR8A 2E2IJ 4BBSJ 4CYCA 1P7JA 1TC3C 3IH2A 1AKHB 4DW6A 5IP9J 3TW6A 1RR7A 2QF7A 4XRMA 1JJ8C 1ITYA 2EQRA 3GTOJ 1MBKA 2GLOA 1NK2P 1WGXA 2XPVA 3HOVJ 3GTGJ 2EZIA 2PMZN 4JYKA 4A3FJ 2MW8A 1POGA 1TWAJ 1P7IA 1GVDA 3LSGA 5HODA 4C2MJ 1R9TJ 2XB5A 4XICA 3SJMA 3BR6A 5FKOA 1X2MA 4A69C 2R0QC 4BKXA 5E3MA 3HOXJ 3H3VK 2K9QA 1B72A 1ETWA 2HOAA 4FE4A 2L7ZA 5EZHA 3BTCA 1U9NA 4DZJA 3QPSA 2HXIA 3HOZJ 4A3BJ 3S1MJ 3A02A 2NVTJ 1UMQA 5K7FA 3JRDA 1DU6A 5EG0B 2MG4A 3GTKJ 2AHQA 1JGGA 4IEJA 4DYQA 1CQTA 2YUSA 2DA5A 4QTRA 2K40A 3GTJJ 1VFCA 1MBFA 4A3IJ 5FJ8J 3HB9A 3OIOA 1XS9A 3I4NJ 1ZGWA 3SFIA 3ZQHA 5F27A 4L5EA 3DEWA 3FISA 3IV5A 1HDPA 3TP0A 1BW5A 4XIDA 2CQQA 4A3DJ 1JT0A 1GT0C 1RESA 1LFBA 3O8GA 3HGGA 5FLMJ 2IBDA 4V2GA 5IYBJ 1MBHA 4W1UA 3NARA 1VI0A 3ZOBA 2X48A 5C4XJ 5FKKA 3HGYA 1YRNA 1WI3A 4RDUA 3PO3J 2E1OA 4XRSA 4I76A 5FKMA 3A01A 4B4CA 3HBLA 2ECCA 3CMYA 3BTLA 4JP0A 2DA7A 3TW7A 4Y7NJ 4BY1J 2JA8J 1JUSA 1OJLA 2G0EA 2K9SA 3GTQJ 3F0CA 2HXOA 1IC8A 5EGOA 2NOGA 2NS7A 5F04A 1A5JA 1T56A 1RPWA 1K61A 4MLOA 3I4MJ 1JUMA 1MBJA 2RAEA 3BR5A 1SANA 4C3JJ 3Q0WA 3ZQFA 2CUFA 3Q3SA 9ANTA 3Q0UA 2LK2A 1IDZA 1IG7A 1IJWC 1BL0A 1OFCX 2HQ5A 4UUSA 1O4XA 1VNDA 2DMUA 4CYCB 2LLKA 3OSGA 3TEDA 2O9LA 4IHYA 1FTTA 2CU7A 4FTHA 1H89C 2DJNA 3L1PA 2GM4A 1BW6A 2R5YA 1FJLA 2XSDC 2R93J 2DTZA 2DMPA 2ME0A 1PUFA 3LNQA 2K9NA 2N8GA 5GP9A 3S2DJ 1MSFC 3NAUA 4MFEA 2ID6A 1E3OC 3S2HJ 2Y9ZA 2TCTA 5F08A 5BNGA 1I3QJ 3BTJA 1W0UA 1F36A 4M6VA 1ZQ3P 2FQ4A 1XG1A 5M5WJ 4V2FA 1JKQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNV A;  4XK4 A;  3G1O A;  2M9H A;  2DA4 A;  2ECB A;  4JX4 A;  2XGC A;  5C4J J;  1UHS A;  2OF7 A;  3HOY J;  1WPK A;  1QVT A;  2XGD A;  3JRE A;  2CJJ A;  1JKO C;  2DA1 A;  2JMW A;  3BR3 A;  1GDT A;  5GPA A;  3OSF A;  1IGN A;  2YS9 A;  3QQA A;  2IEK A;  3WHB A;  4X6A J;  1ORK A;  1T33 A;  5FLV A;  1TWG J;  3HDD A;  1IUF A;  1HF0 A;  3FK6 A;  5F0C A;  3BR0 A;  3GTM J;  1ZR4 A;  4MFD A;  3JRG A;  3G1M A;  4JX6 A;  1MBE A;  4D7N A;  3S16 J;  2EZK A;  5IOZ A;  2X9D A;  5E3L A;  1FTZ A;  3Q0V A;  1OCT C;  1ETX A;  1FIA A;  2FX0 A;  1Z0X A;  2TRT A;  4D5F A;  1LE8 A;  2FD5 A;  1GV2 A;  4NDL A;  1H8A C;  4A3C J;  3DCF A;  3MVP A;  2AO9 A;  4UUT A;  2LY9 A;  2HYJ A;  1YRN B;  3BG3 A;  2L7F P;  4A3G J;  4M3D A;  2VKV A;  3S1Q J;  3ZQG A;  3BT9 A;  2E2J J;  3A01 B;  3WHC A;  2LD5 A;  5IYD J;  1U9O A;  4Y52 J;  2R7Z J;  2QCO A;  2Y0S N;  2XB0 X;  1F43 A;  4JX5 A;  5J1R A;  1JKR C;  3BG5 A;  1RKW A;  3A03 A;  1Q1V A;  3O8H A;  3JRF A;  5C44 J;  4C3H J;  5J1Y A;  3C2B A;  3S17 J;  1QRY A;  1IV6 A;  5C3E J;  3OOU A;  4FE7 A;  3LSP A;  2L0K A;  1Z77 A;  4BXX J;  3RZD J;  3S14 J;  3D1N I;  2JA7 J;  4XRS G;  2IAI A;  3MKL A;  4ABZ A;  2CRG A;  2R5Z B;  3HKZ N;  2WB1 N;  3BR1 A;  1RET A;  3JR9 A;  2HOT A;  2Y31 A;  3RZO J;  1NTC A;  1Y1V J;  4DYR A;  2LKX A;  2GBY A;  5IOY A;  3UKG A;  5F0H A;  2NVQ J;  1GV5 A;  2W48 A;  3K7A J;  5EZG A;  3RKQ A;  4IHV A;  2Y2Z A;  3CCY A;  2KDZ A;  2H8R A;  4A3M J;  2D5V A;  1MH4 A;  2JJ7 A;  4W97 A;  4MO7 A;  2CUE A;  2LP0 A;  2O7O A;  2R92 J;  1ETY A;  2XGE A;  4LOC A;  1U8B A;  1WH5 A;  2M34 A;  3LOC A;  5JLX A;  1B8I A;  1RKT A;  1ZR2 A;  1W0T A;  2JWT A;  3G1L A;  1PUF B;  1X58 A;  1ZKG A;  2JA6 J;  5K7H A;  1APL C;  3H0G J;  3HM5 A;  2DMN A;  1TWF J;  2ELK A;  4J19 A;  3GTL J;  1D5Y A;  5JLW A;  4A3L J;  1QVU A;  4B1R A;  2YU9 J;  1XC5 A;  1SFO J;  1JTY A;  2LFB A;  4M3F A;  5DTD A;  3MN2 A;  1BJZ A;  2LTP A;  1AKH A;  5M3F J;  2HOS A;  1JJ6 C;  1B72 B;  2DA3 A;  3S15 J;  5E3O A;  1LFU P;  1ZTR A;  3IH4 A;  1TWH J;  1AHD P;  5FKN A;  3M4O J;  4RBO A;  3BR2 A;  4QSH A;  3HOU J;  4A3E J;  3CDL A;  1JKP C;  3GTP J;  2VUM J;  4IHX A;  3FIW A;  2MGQ A;  3SDG A;  3S1R J;  3K2A A;  2XRL A;  4DYC A;  1ENH A;  3JRA A;  4FIS A;  1MH3 A;  1ETQ A;  2XPU A;  1S7E A;  1OCP A;  3CQZ J;  3RQI A;  4QIW N;  5IP6 A;  3VPR A;  1QPI A;  4S0H B;  4IHW A;  2X6O A;  2M8G X;  5J3L A;  1LE8 B;  2Y30 A;  4M3E A;  1H88 C;  1MBG A;  1WH7 A;  1ETV A;  1VF9 A;  1A6I A;  2OPT A;  1AU7 A;  1FEX A;  1WCM J;  2Y9Y A;  1JTX A;  1TWC J;  3W6V A;  5J1U A;  4AC0 A;  5DS9 A;  2FJ1 A;  3LSJ A;  2JK3 A;  3HOW J;  5EG0 A;  2VKE A;  5EEA A;  3LSR A;  1MSE C;  2EZH A;  4FCY A;  4I6Z A;  5M5X J;  4EEF G;  3M3Y J;  3GBG A;  2DMQ A;  4GFB A;  3FK7 A;  2O8K A;  1HCR A;  1I6H J;  1ETK A;  2E19 A;  2DN0 A;  4A3K J;  3BG9 A;  3ZQC A;  2NVY J;  5F0F A;  3ZQL A;  2DA2 A;  5GPC A;  1K83 J;  1GUU A;  2ZB9 A;  5EGO B;  2JN6 A;  2H1K A;  5IYC J;  2EZL A;  3TP3 A;  1EF4 A;  4X1E A;  2WV1 A;  4A3J J;  1HOM A;  2NVX J;  2L7M P;  4AYB N;  2WAQ N;  4D7M A;  2MSY A;  1HDD C;  2XPW A;  2M2E A;  5IP7 J;  3B6A A;  3HEF A;  3JRH A;  1ZK8 A;  1U78 A;  1Y1W J;  1JT6 A;  3S1N J;  2VPR A;  2ME6 A;  5FKL A;  4BBR J;  4BY7 J;  2NS8 A;  5M5Y J;  2CQX A;  2I10 A;  5EF6 A;  3E7L A;  4AUX A;  3QPL A;  1X2N A;  4UUS B;  3JRI A;  2B63 J;  5K7Z A;  1JUP A;  3BQY A;  1HLV A;  2HDD A;  4M3B A;  2L9R A;  2LVS A;  4M3G A;  2DA6 A;  3JRB A;  1MNM C;  1UG2 A;  1IDY A;  1ETO A;  5EDN A;  2ID3 A;  4DZP A;  2KT0 A;  2EH3 A;  3ZQI A;  1I50 J;  2DMT A;  4D5C A;  2R5Z A;  1G2H A;  2M0C A;  1B8I B;  3JRC A;  2E2H J;  5M3M J;  1NK3 P;  4MIM A;  1FIP A;  4C3I J;  3FKI J;  5F1J A;  3PO2 J;  2R5Y B;  3B6C A;  2COB A;  3PM1 A;  2HI3 A;  4B3A A;  1IRZ A;  5IPA A;  5EYR A;  4G12 A;  3BTI A;  2JA5 J;  3IH3 A;  5E3N A;  2EBI A;  1DU0 A;  2P81 A;  1BA5 A;  3BQZ A;  4A93 J;  2VI6 A;  2LR8 A;  2E2I J;  4BBS J;  4CYC A;  1P7J A;  1TC3 C;  3IH2 A;  1AKH B;  4DW6 A;  5IP9 J;  3TW6 A;  1RR7 A;  2QF7 A;  4XRM A;  1JJ8 C;  1ITY A;  2EQR A;  3GTO J;  1MBK A;  2GLO A;  1NK2 P;  1WGX A;  2XPV A;  3HOV J;  3GTG J;  2EZI A;  2PMZ N;  4JYK A;  4A3F J;  2MW8 A;  1POG A;  1TWA J;  1P7I A;  1GVD A;  3LSG A;  5HOD A;  4C2M J;  1R9T J;  2XB5 A;  4XIC A;  3SJM A;  3BR6 A;  5FKO A;  1X2M A;  4A69 C;  2R0Q C;  4BKX A;  5E3M A;  3HOX J;  3H3V K;  2K9Q A;  1B72 A;  1ETW A;  2HOA A;  4FE4 A;  2L7Z A;  5EZH A;  3BTC A;  1U9N A;  4DZJ A;  3QPS A;  2HXI A;  3HOZ J;  4A3B J;  3S1M J;  3A02 A;  2NVT J;  1UMQ A;  5K7F A;  3JRD A;  1DU6 A;  5EG0 B;  2MG4 A;  3GTK J;  2AHQ A;  1JGG A;  4IEJ A;  4DYQ A;  1CQT A;  2YUS A;  2DA5 A;  4QTR A;  2K40 A;  3GTJ J;  1VFC A;  1MBF A;  4A3I J;  5FJ8 J;  3HB9 A;  3OIO A;  1XS9 A;  3I4N J;  1ZGW A;  3SFI A;  3ZQH A;  5F27 A;  4L5E A;  3DEW A;  3FIS A;  3IV5 A;  1HDP A;  3TP0 A;  1BW5 A;  4XID A;  2CQQ A;  4A3D J;  1JT0 A;  1GT0 C;  1RES A;  1LFB A;  3O8G A;  3HGG A;  5FLM J;  2IBD A;  4V2G A;  5IYB J;  1MBH A;  4W1U A;  3NAR A;  1VI0 A;  3ZOB A;  2X48 A;  5C4X J;  5FKK A;  3HGY A;  1YRN A;  1WI3 A;  4RDU A;  3PO3 J;  2E1O A;  4XRS A;  4I76 A;  5FKM A;  3A01 A;  4B4C A;  3HBL A;  2ECC A;  3CMY A;  3BTL A;  4JP0 A;  2DA7 A;  3TW7 A;  4Y7N J;  4BY1 J;  2JA8 J;  1JUS A;  1OJL A;  2G0E A;  2K9S A;  3GTQ J;  3F0C A;  2HXO A;  1IC8 A;  5EGO A;  2NOG A;  2NS7 A;  5F04 A;  1A5J A;  1T56 A;  1RPW A;  1K61 A;  4MLO A;  3I4M J;  1JUM A;  1MBJ A;  2RAE A;  3BR5 A;  1SAN A;  4C3J J;  3Q0W A;  3ZQF A;  2CUF A;  3Q3S A;  9ANT A;  3Q0U A;  2LK2 A;  1IDZ A;  1IG7 A;  1IJW C;  1BL0 A;  1OFC X;  2HQ5 A;  4UUS A;  1O4X A;  1VND A;  2DMU A;  4CYC B;  2LLK A;  3OSG A;  3TED A;  2O9L A;  4IHY A;  1FTT A;  2CU7 A;  4FTH A;  1H89 C;  2DJN A;  3L1P A;  2GM4 A;  1BW6 A;  2R5Y A;  1FJL A;  2XSD C;  2R93 J;  2DTZ A;  2DMP A;  2ME0 A;  1PUF A;  3LNQ A;  2K9N A;  2N8G A;  5GP9 A;  3S2D J;  1MSF C;  3NAU A;  4MFE A;  2ID6 A;  1E3O C;  3S2H J;  2Y9Z A;  2TCT A;  5F08 A;  5BNG A;  1I3Q J;  3BTJ A;  1W0U A;  1F36 A;  4M6V A;  1ZQ3 P;  2FQ4 A;  1XG1 A;  5M5W J;  4V2F A;  1JKQ C; 
#chains in the Genus database with same CATH topology
 1WJA A;  2GAU A;  3V4G A;  4XOR A;  2XKO A;  1J59 A;  4BAY A;  4LIV A;  2CH0 A;  2ECB A;  4JX4 A;  2XGC A;  3Q5F A;  4DQ2 A;  4RM3 A;  5C4J J;  2DTR A;  1R36 A;  3WTW C;  2R7S A;  3ABM H;  2OF7 A;  3OYM A;  1MDM A;  3HOY J;  1WPK A;  2JTV A;  3F3X A;  2BXZ A;  1QVT A;  2A3S A;  3QWL A;  3BR3 A;  5GPA A;  1GLN A;  2IEK A;  2CQN A;  4DJA A;  4FAS D;  2ZXW H;  3PNV A;  1MGT A;  1OYY A;  1J2X A;  1T33 A;  1R5H A;  3ZMZ A;  2WAQ A;  5DM7 F;  3FXO A;  1HF0 A;  2V1U A;  3BR0 A;  3CCJ I;  2WBM A;  4MFD A;  4RS8 A;  4NQW A;  5DCM A;  3KP4 A;  2EZK A;  1FTZ A;  2X9D A;  4UVA A;  5E3L A;  1ZAR A;  3OYF A;  1F4K A;  4AU7 A;  2V6C A;  3MKW B;  3JTH A;  3OS0 A;  1SAU A;  4B47 A;  4BQO A;  3GEZ A;  4NDL A;  2LC2 A;  1H8A C;  3I56 I;  3DCF A;  1UHW A;  2W57 A;  2YX4 A;  1IN6 A;  3RTR A;  1SMT A;  3HUG A;  1D0Y A;  2AO9 A;  4UUT A;  1OYI A;  4XKV A;  2P5L C;  2NNN A;  2LY9 A;  3BG3 A;  3BY6 A;  1R22 A;  2BGC A;  2Z5U A;  4A3G J;  2VKV A;  3OYA A;  1A35 A;  3VDX A;  2XV4 S;  3ZQG A;  1SD4 A;  1V4R A;  3BT9 A;  3DLL F;  5ICG A;  3U21 A;  2E34 A;  1B1B A;  2MC3 A;  3R4K A;  4GYI A;  1U9O A;  1XX5 A;  4A0Z A;  5ILS A;  2RVC A;  2R7Z J;  2RQP A;  4LD5 A;  2FBH A;  2GXG A;  4BE2 A;  1Q1V A;  3TBI A;  5J1Y A;  2LF8 A;  1YX3 A;  4XOT A;  2XRO A;  2VL8 A;  1QRY A;  3CMM A;  3CTA A;  5LD2 C;  2IGK A;  3EQL F;  2FBI A;  3OOU A;  3LSP A;  2V1D A;  1Z77 A;  2JA7 J;  4XRS G;  3MKL A;  1TQP A;  4ZDP A;  3HKZ N;  1Y8Q B;  2HTJ A;  4YRV A;  1P4X A;  3CZ6 A;  2XF6 A;  4DNC A;  4DBR A;  1I1G A;  2K5C A;  3PQJ A;  2NVU B;  1Y1V J;  1R23 A;  4UNO A;  2O6G E;  2GIZ A;  2DJI A;  4EJO A;  3ELK A;  1O3S A;  1FBS A;  3FBN B;  5CVV A;  3LQR A;  2KJC A;  4L9N A;  2Z99 A;  3HPG A;  4XLA A;  3SZT A;  3IKV A;  4RGU A;  2F5D A;  3PNT A;  4KIG A;  4OMZ A;  5F0H A;  4BNC A;  2KP6 A;  1EKE A;  4BGD A;  2M87 A;  3E6D A;  4I0B A;  4RGR A;  2DDB A;  3OL3 A;  4HYE A;  3J7Y J;  3Q9S A;  2D5V A;  3LFU A;  2F5C A;  4Q47 A;  4W97 A;  4LGW A;  2O7O A;  2PMU A;  2P7V B;  5ICC A;  5E17 F;  1U8B A;  4RMN A;  4IO9 F;  2KFD A;  1B8I A;  1ZR2 A;  2JWT A;  3G1L A;  3EDP A;  3PFY A;  4FT8 A;  3GF2 A;  2IJL A;  2HKX A;  1MJA A;  1ZKG A;  2JA6 J;  3J7A Y;  5K7H A;  1APL C;  2J5P A;  3G71 I;  4HA8 A;  4PJL A;  3CLO A;  1VTN C;  1YE9 A;  1ON1 A;  3CCS I;  4JBA A;  2GXA A;  4CA0 A;  3R61 A;  3WOD F;  4D9J A;  2K27 A;  1IAW A;  2YU9 J;  2YSR A;  3WU2 C;  3HG9 A;  4CO8 A;  3CDH A;  3D0S A;  5DDG A;  1B72 B;  2OBP A;  2F2E A;  4XLP F;  2VQL A;  3M07 A;  5H20 A;  1NH3 A;  4MQV A;  1AHD P;  5FKN A;  3M4O J;  2JSP A;  2GOM A;  5D4S A;  2VBX A;  3RKX A;  1I5Z A;  4HRI A;  1MMS A;  1MMA A;  3HOU J;  3I0T A;  1YJW I;  2BHZ A;  4A3E J;  1M1E B;  2JZY A;  2OUM A;  3QOE A;  4KA4 A;  1IN4 A;  2F6C A;  5ICE A;  1J5Y A;  2PX9 A;  2MBF A;  1X19 A;  3SDG A;  4AVP A;  4J00 A;  2EFN A;  2XRL A;  2PN6 A;  1DP7 P;  4FIS A;  2CGP A;  4L0Y B;  1QZY A;  1S7E A;  2E1M B;  2EPF A;  3S32 A;  4QIW N;  5IP6 A;  1FSH A;  4S0H B;  3HZJ A;  2X6O A;  3PJR A;  4OIP F;  4M3E A;  1BR1 A;  1MBG A;  4EV0 A;  1FEX A;  3K4K A;  4OU0 A;  2KQR A;  2X6Y A;  2Y9Y A;  3MFK A;  1R49 A;  2IS4 A;  2MD5 A;  2LY2 A;  2P4W A;  5J1U A;  4PJ0 C;  1BI0 A;  5J6X A;  1Z91 A;  3LSJ A;  3ZXS A;  3JAM K;  1XMK A;  3SEZ A;  2O3F A;  2P8T A;  2D1V A;  3LSR A;  4BHP A;  1Y0U A;  1EV7 A;  5M5X J;  2JUG A;  3WG7 H;  3A0B C;  1UB9 A;  3GBG A;  2DMQ A;  1UJ8 A;  4G6D A;  3GLX A;  5D6F A;  1S7O A;  4U7D A;  3PIO F;  2A68 F;  1G4D A;  4GYG A;  4B43 A;  1O57 A;  1QU3 A;  2VJJ A;  5LHI A;  1S72 I;  1QPM A;  3ZQC A;  1Y8R B;  2NVY J;  4HZF A;  4IRI A;  4WXH A;  2ZNY A;  3GCM A;  1P2F A;  4LFU A;  2JN6 A;  2TDX A;  2MA3 A;  4HF0 A;  2UXN A;  1MIJ A;  3I5U A;  1MMG A;  2HKO A;  1HW1 A;  4AYB N;  4BXF A;  5E1Z B;  2KL4 A;  2MSY A;  2XPW A;  3KZI C;  2M2E A;  2QQB A;  2PEX A;  2UWM A;  4P9U A;  5B1A H;  5J8F A;  1ZK8 A;  5AIP A;  2QQ8 A;  3W6J B;  2P5K A;  3C18 A;  4XON A;  1BC7 C;  1A36 A;  1Z3X A;  1D8J A;  2Q0O A;  3GYH X;  5FKL A;  4F93 B;  3W3C A;  2FRH A;  2DO7 A;  3I9V 2;  1FNN A;  2OV7 A;  3RPU D;  3JRI A;  5K7Z A;  1JUP A;  2JVG A;  4XLE A;  3ZMT A;  3N05 A;  2B9S A;  2MYS A;  1MNM C;  2DA6 A;  2W85 A;  1UG2 A;  3DU6 A;  4A6D A;  4OIQ F;  2KT0 A;  2VE8 A;  3ZQI A;  1R71 A;  4PJM A;  4V19 K;  2QYO A;  3V7S A;  2M0C A;  3F8C A;  3IKT A;  3BC8 A;  3JRC A;  4E7S A;  4EMS A;  5M3M J;  1NK3 P;  2FSW A;  1FIP A;  2LYC A;  2W1O A;  5CYV A;  5F1J A;  3GME A;  2R5Y B;  2R4G A;  4A12 A;  1DPR A;  4M71 A;  3ZQQ A;  5IPA A;  3ECH A;  3OS1 A;  4G12 A;  3KYL A;  5D6E A;  2JA5 J;  4BH9 A;  4WX9 A;  2VOP A;  3VEP A;  2PFB A;  4Y13 A;  3FMS A;  2JPB A;  5FRO A;  4RAY A;  4AVZ A;  3BQZ A;  4A93 J;  2X0L A;  4KMU X;  3GW2 A;  2J5O A;  2CW0 F;  1H9T A;  4DW6 A;  3KYD B;  3TW6 A;  4XSX F;  1VZ0 A;  2QF7 A;  2F4M B;  4XRM A;  2D2W A;  1BI3 A;  3PQK A;  2K3P A;  1BI1 A;  2QM3 A;  4D0P A;  3H92 A;  1U5T C;  3KLO A;  2O5R A;  3ZR8 X;  3PFI A;  1F5T A;  2MLG A;  3H5N A;  1XCB A;  4YII A;  3HOV J;  2ISY A;  3HC7 A;  2PMH A;  3BCA A;  4Y17 A;  4C2U A;  1ZRC A;  2OC6 A;  2AS5 F;  1QA6 A;  1POG A;  1ZGJ A;  1VQ4 I;  1TWA J;  2VB6 A;  4A6E A;  4B44 A;  4XQF A;  1GVD A;  3LSG A;  3W2V A;  3OYE A;  4WK8 F;  1R9T J;  1XSD A;  3E3V A;  3BR6 A;  1MW7 A;  2HYG D;  2HGC A;  3MEX A;  1YHQ I;  2R0Q C;  4MTD A;  2M5W A;  5E3M A;  1IW7 F;  4ZYE A;  4H0E A;  1X1P A;  3P9C A;  4CYD A;  2YX7 A;  1QZE A;  2IW5 A;  2IS6 A;  4HF2 A;  4DZJ A;  2HXI A;  2XGX A;  3HOZ J;  3EUH A;  3CCR I;  5K7F A;  5EG0 B;  5CJ9 A;  1Z05 A;  3E1S A;  2AHQ A;  1CQT A;  3PNY A;  3HKZ A;  4QTR A;  3NWS A;  2MH2 A;  1LKX A;  2K40 A;  3U1K A;  3GTJ J;  4A3I J;  2IVM A;  5DD8 A;  5FJ8 J;  2K9M A;  3OIO A;  3H5R A;  2COM A;  1ZGW A;  3I4N J;  2UV1 A;  3QOP A;  4C30 A;  3H0D A;  1RI7 A;  1MJB A;  3TP0 A;  1BW5 A;  4A5M A;  4XID A;  3LA3 A;  3DP7 A;  2M1B A;  1JT0 A;  3E6M A;  2DQL A;  3ZMS A;  1LQ1 A;  3ZMD A;  2P6S A;  3WTV C;  1LFB A;  4R8H A;  3IAM 2;  4E7I A;  5FLM J;  3FBI B;  2K02 A;  1VI0 A;  5C4X J;  3VFZ A;  4PFO A;  1PUE E;  3OYN A;  2ADU A;  4CZC A;  4RB1 A;  4OIO F;  2R7O A;  4XKB A;  4FHT A;  4L9J A;  3QP5 A;  1WWX A;  2A6E F;  3A01 A;  1K6Y A;  3HBL A;  3L2R A;  1H0M A;  1Y56 A;  4KN4 X;  4G7Z F;  3N4M A;  3C2G A;  3W6K B;  4MTE A;  3TW7 A;  4NC6 A;  2HEO A;  3G3Z A;  3GFJ A;  2G0E A;  1XGS A;  3GTQ J;  2A6H F;  4HF1 A;  2HXO A;  1FZP B;  1K7A A;  1IC8 A;  3ZPL A;  3J7A O;  1GXP A;  2NS7 A;  5F04 A;  1FMW A;  1ZRE A;  2VIX A;  4LMY A;  3CP8 A;  3VWB A;  4Q48 A;  1K61 A;  1HW5 A;  3I4M J;  2XC7 A;  1MBJ A;  2H94 A;  1JGS A;  1SAN A;  3HTU A;  1TL8 A;  3MQ0 A;  3CO6 C;  1YS7 A;  3Q0W A;  1YLF A;  3MKZ A;  3VOD A;  2CUF A;  1VQ5 I;  4NBQ A;  1YW7 A;  4JK1 X;  1IG7 A;  4IPA A;  4M73 A;  1OFC X;  5HLH A;  1WZ2 A;  4CCL A;  4CXF A;  4OMY A;  1ACI A;  2HQ5 A;  2X6W A;  4ZYD A;  3IWZ A;  3WTX C;  3CJR B;  5J4Y A;  2M0M A;  2Y48 A;  1G3W A;  2W00 A;  4WCG A;  2H27 A;  4IHY A;  5IY5 H;  2DXI A;  3J80 K;  3B73 A;  3F21 A;  2HDW A;  3VYU B;  5DUI A;  3L1P A;  3V7C A;  2GM4 A;  2R7U A;  1BW6 A;  3DKX A;  2EFW A;  2R93 J;  2DTZ A;  1PUF A;  4KIS A;  2K9N A;  2QKL B;  1MSF C;  3NAU A;  4MFE A;  3U9G A;  5ERI A;  2RQQ A;  2CQ7 A;  3IAS 2;  4P9F A;  5DCF A;  3RYR A;  3S2H J;  4II2 A;  1I3Q J;  2X85 A;  1WJB A;  1ZQ3 P;  5M5W J;  4NB5 A;  1Y0N A;  2GXB A;  3I3L A;  4QLC U;  1BN5 A;  5TJJ A;  2XKP A;  2BBY A;  2DA4 A;  4EJW A;  1MND A;  4RLQ A;  4LB5 A;  1XDU A;  2UZK A;  1ZG5 A;  1Z7U A;  1FLI A;  4I09 A;  1UHS A;  4C9Y A;  3SEQ A;  2XGD A;  2CJJ A;  3H1C A;  1OYW A;  1H9G A;  5F64 A;  2JMW A;  4B3X A;  1PP8 F;  3F8M A;  4FQG A;  5J8C A;  1TP4 A;  3WHB A;  3OYI A;  5JFR A;  4AYB A;  5FLV A;  3DPU A;  4LK0 F;  2VT3 A;  3HDD A;  1NG6 A;  2O8X A;  3FK6 A;  4IZZ A;  1U3E M;  2MLK A;  2EWN A;  2E1M C;  3DBL B;  3DBR B;  3L2V A;  2A07 F;  3JRG A;  4JX6 A;  3E5Q A;  3S16 J;  5IOZ A;  3WE3 A;  1STZ A;  1ETX A;  2X1E A;  1Z0X A;  1IF1 A;  3FXL A;  4BU2 A;  1J0R A;  2HFH A;  1GV2 A;  2DOE A;  3K4B A;  4EGY A;  3IUO A;  2WA0 A;  1LVK A;  4HG2 A;  3SDB A;  1EJ9 A;  1LFP A;  3MVP A;  4AD9 A;  2HQN A;  2PJR A;  4G7O F;  1UHM A;  2DAO A;  1YRN B;  2HYJ A;  2JSC A;  5KAF C;  4ZYG A;  1L0O C;  4G94 A;  2VAS A;  4KIC A;  4Y33 A;  3MWM A;  1U0J A;  4ANJ A;  3QRF F;  2LD5 A;  5IYD J;  1WQ2 A;  4Y52 J;  1LDK B;  4I01 A;  1OR7 C;  2XSJ C;  5HDK A;  2XB0 X;  4BEH A;  4JX5 A;  4OAZ A;  3K70 D;  1RKW A;  3A03 A;  3CF2 A;  3O8H A;  2W4S A;  3JRF A;  2VOO A;  5C44 J;  2ICW G;  2FML A;  3FX3 A;  4A2U A;  2ZSH B;  3C2B A;  3L2W A;  2A6T A;  5C3E J;  3LAJ A;  1T2K A;  5FRM A;  2ZKZ A;  4FE7 A;  4NC7 A;  2L0K A;  1NG7 A;  1ERD A;  3LA7 A;  3D1N I;  3WGH A;  3H9G A;  3H3Z A;  2LBF B;  1R5G A;  2R5Z B;  2LRD A;  4O3M A;  3DQV C;  2WB1 N;  4WXC A;  2CWE A;  3JR9 A;  4EM2 A;  3K4M A;  1MMD A;  2Y31 A;  3T8R A;  2ISZ A;  1WFX A;  1RUN A;  2OQG A;  2GWR A;  2K85 A;  1XDS A;  5CKT A;  4DYR A;  1MJ9 A;  5IOY A;  5K5O A;  1HC8 A;  1GXQ A;  1XGM A;  4CCK A;  4XNF A;  3CME I;  4IHV A;  2Y2Z A;  3IP4 B;  4A3M J;  4EJT A;  4L0Z B;  5KK1 A;  3BDD A;  4AWX B;  3I58 A;  3L2U A;  2JJ7 A;  4G6T B;  4MO7 A;  1PP7 U;  2R92 J;  1T95 A;  1G6N A;  4LOC A;  4RB2 C;  2W82 A;  3LOC A;  3P5J A;  5JLX A;  5J4V A;  2P7C B;  3OYL A;  1RKT A;  2BY0 A;  4I2O A;  2LH9 A;  4Y3O A;  2RNG A;  2LG4 A;  2KDO A;  3PL8 A;  4F7Z A;  3L2Q A;  3K4J A;  3M8E A;  3H0G J;  4BQA A;  4A0Y A;  2DBB A;  2DMN A;  1P6R A;  1W7P A;  5DD4 A;  3GTL J;  3VYT B;  3U1D A;  1D5Y A;  2HYF A;  3GX4 X;  4BE0 A;  1XC5 A;  1UEL B;  2LFB A;  1KQ0 A;  2DYR H;  2MD0 A;  2ZCW A;  2VQH A;  5GAD J;  5HLI A;  1QHG A;  4UXN A;  1LFU P;  3GLL A;  3IH4 A;  2A61 A;  4EM0 B;  3K6G A;  2EB7 A;  4RBO A;  1FY7 A;  2QEX I;  3BR2 A;  4QSH A;  1D1B A;  1UAA A;  1RNL A;  5K5Q A;  1SAX A;  3I64 A;  2HVQ A;  3GTP J;  1SD5 A;  4ZTF A;  5BMZ A;  2HQA A;  2LF7 A;  1ZHF A;  4P55 A;  1SFK A;  3JRA A;  4U87 A;  5JVG F;  4NQW B;  1ETQ A;  5DCM B;  4OWR B;  1QGP A;  3RQI A;  1RRJ A;  3TDU C;  1QPI A;  4HQM A;  4AIJ A;  5FRN A;  2L9N A;  3NEU A;  2BEO A;  2WTE A;  2HU9 A;  1T39 A;  2L5Q A;  3OR2 C;  2OPT A;  1VF9 A;  1A6I A;  2CFX A;  2CQK A;  1TWC J;  2BY1 A;  2FXA A;  3HUG B;  3TL4 X;  4AC0 A;  1TBX A;  1YIJ I;  4HLX A;  3I4P A;  4IOA F;  3BZK A;  3DTK A;  5FLX K;  2R3S A;  3F8F A;  2EIM H;  2VKE A;  1KQ9 A;  1JE8 A;  2Z3Y A;  2R7W A;  5B5E C;  2VQC A;  2VN2 A;  2EZH A;  1FOX A;  3P9I A;  3KP3 A;  2EV0 A;  4GGG A;  4EEF G;  1MMN A;  4CSW A;  4M9Z A;  3GFI A;  2ESN A;  2ACJ A;  1IZ1 A;  3ZRG A;  3FK7 A;  1ETK A;  4A3K J;  2QBY B;  2RV8 A;  1EH7 A;  1DPU A;  1P4A A;  3SQN A;  1CF7 B;  1IO2 A;  2X1D A;  5FD5 A;  3ZQL A;  3RYP A;  2F4I A;  3BP8 A;  3K4C A;  2DDA A;  3LA2 A;  2Q8K A;  2ZB9 A;  4IHS A;  4LG0 A;  5EGO B;  1AOY A;  4L5I A;  2K3F A;  2EZL A;  2QQ9 A;  1OCZ H;  3ERM A;  1S6L A;  4M6Y A;  3I71 A;  4X1E A;  4ASN A;  4GRI A;  4A3J J;  1EF4 A;  4L9T A;  2KPM A;  4I98 B;  3J7Z I;  1X1A A;  2R7R A;  4D7M A;  4TV7 A;  1SD6 A;  1HDD C;  3C3W A;  3UR3 C;  3ASO H;  2ESH A;  1DP3 A;  3HEF A;  5E8G A;  3JRH A;  3CJN A;  2RRE A;  5L3F A;  2KIS A;  1FMV A;  2E5Z A;  3BJO A;  2ME6 A;  1HSJ A;  1S5L C;  4BY7 J;  2HPM A;  4XSZ F;  2DPD A;  1D0X A;  4D1Q A;  2NS8 A;  5M5Y J;  2I10 A;  3E7L A;  4AUX A;  3O3K A;  3QPL A;  1BI2 A;  2FUG 2;  4UUS B;  1V5F A;  1FBU A;  1HLV A;  3ISP A;  2L9V A;  4PSW A;  4M3G A;  3JRB A;  2Z2S B;  3DPL C;  2HTS A;  4BYY A;  4HV6 A;  1ETO A;  5EDN A;  3WTY C;  1LB2 A;  3DTE A;  4DZP A;  2DMT A;  2WAE A;  2QVO A;  1G2H A;  1WSU A;  1SVL A;  2XVC A;  1B8I B;  3HSF A;  2E2H J;  3V8L A;  2OZ6 A;  2RGV A;  3RQ4 A;  1D5V A;  3FKI J;  3CES A;  3DKW A;  4KT6 A;  4NNJ A;  1UCR A;  5D5X B;  3FF5 A;  1IRZ A;  4P96 A;  1JHF A;  2QUF A;  3FXR A;  4LK1 F;  1V54 H;  3AG2 H;  1HKS A;  2E5N A;  1G3Y A;  3NWT A;  1BA5 A;  3HRU A;  4A5N A;  2LR8 A;  1D3Y A;  4CYC A;  1P7J A;  1Y6I A;  3H3U A;  1SMY F;  4L9V A;  1RR7 A;  2K4J A;  2VON A;  2VBZ A;  1JJ8 C;  1R7J A;  2EQR A;  2OTJ I;  4HST A;  2AXL A;  3PIP F;  1MBK A;  3OIP A;  2AXT C;  2IA0 A;  1W5T A;  3HPH A;  3LSK A;  2EZI A;  3MZH A;  4NUB A;  1I27 A;  2BW3 A;  3M9A A;  4MNU A;  1OCO H;  3PSF A;  3LAP A;  4M72 A;  2CYY A;  3JSO A;  3PUF A;  5HOD A;  4C2M J;  2XAJ A;  4MEX F;  2XB5 A;  4XIC A;  2OCC H;  4HDU A;  3SJM A;  2LDU A;  5CVU A;  4CGZ A;  2L9S A;  4A69 C;  4BDZ A;  3H5A A;  1Q1H A;  2LNB A;  2VJI A;  1B72 A;  2XAQ A;  2KMU A;  1XMX A;  1ZRF A;  2VXZ A;  2EIN H;  1U9N A;  1JXS A;  2XAF A;  3KE2 A;  5D5W B;  1UMQ A;  5H6Q A;  4BHC A;  5HDN A;  3D5S C;  4YIR X;  1MKM A;  4E7K A;  2FNP A;  2VC0 A;  5D8L B;  2JVH A;  2WB1 A;  4WWC A;  1VFC A;  4OAY A;  1UG0 A;  3WTS C;  4XN3 A;  2V9K A;  1OMI A;  1IRF A;  3WE2 A;  4LJZ F;  5IT9 Z;  4IQ4 A;  2DFE A;  4YEL A;  3IV5 A;  4L5J A;  2XDV A;  1IXC A;  2CV2 A;  3EET A;  1S8N A;  5JHU A;  1HKQ A;  4C2T A;  1GT0 C;  3HOT A;  4RGS A;  5E1X A;  2L3D A;  3OYC A;  3IHU A;  2VQG A;  3K0L A;  2F5E A;  3BZ6 A;  4HOB A;  4W1U A;  2X48 A;  3D5R C;  5TGT A;  2M8E A;  4ZYA A;  1WJC A;  5FKK A;  4BUP A;  1T0F C;  2OD5 A;  3KYC B;  1VQK I;  2R7X A;  4RDU A;  3PO3 J;  2VJ4 A;  4ZDO A;  3OYJ A;  2E1O A;  3GFL A;  4II3 A;  3S3M A;  3V8J A;  2E1C A;  4ESJ A;  1BIB A;  3EYY A;  4I76 A;  3K10 A;  1BJA A;  4B4C A;  4IVN A;  3BWG A;  3R60 A;  3DF8 A;  3BTL A;  3HSR A;  2DA7 A;  3M8J A;  1WJE A;  2HQR A;  1ULY A;  4EQQ A;  1JUS A;  1TQI A;  3K4L A;  3HYI A;  3F0C A;  2XF5 A;  3P9K A;  1XSV A;  1Y39 A;  1FOY A;  3CUQ A;  2DQR A;  2D1H A;  3M7G A;  3OIQ A;  5E20 A;  4PDK A;  1A5J A;  1R00 A;  3D5L A;  1GVJ A;  1E2X A;  1R6R A;  1ZEL A;  4ZC3 A;  3F6V A;  1ZGA A;  4IF4 A;  1ZLJ A;  3BR5 A;  1X4P A;  1T08 B;  4XLF A;  3AKZ A;  3JCU C;  5A2Q Z;  1QHH D;  2MC4 A;  3V8K A;  1SD7 A;  4ZZL A;  2ZJP F;  3AL0 B;  4CIC A;  9ANT A;  2LRE A;  1HKT A;  4CCM A;  2X51 A;  4UB6 C;  1IJW C;  1BL0 A;  1KGS A;  2GA1 A;  1T6S A;  3LST A;  1O4X A;  3DEU A;  4PCQ A;  2DMU A;  1LUJ B;  2LLK A;  4HV5 A;  3TO7 A;  1S7A A;  4RAF A;  3RSN A;  2K4B A;  2VE9 A;  1IN7 A;  3O6B B;  2VT2 A;  4LIU A;  4E7Z A;  3TED A;  3BPV A;  1ZYR F;  4HQE A;  4RGX A;  1OLT A;  2CU7 A;  4FTH A;  3ABT A;  2RN7 A;  2R5Y A;  3ABU A;  1K78 B;  1FJL A;  2G7U A;  3ZQ7 A;  3SXY A;  5HNF A;  2XSD C;  5IT9 K;  1HA8 A;  5KCM A;  2PQ8 A;  4AID A;  3LNQ A;  5GP9 A;  3VSK A;  4BL0 B;  1IV8 A;  1P4W A;  2EFQ A;  3AAF A;  2Y9Z A;  2TCT A;  1Z9C A;  1DDN A;  5BNG A;  2M45 A;  3L00 A;  3BTJ A;  1F36 A;  2FQ4 A;  1KU7 A;  1JKQ C;  5JHF A;  4BS9 A;  4HNV A;  3A4C A;  3CO7 C;  2M9H A;  3E0J B;  1QZZ A;  2Q1Z B;  2FNA A;  5FFZ A;  4PK4 A;  3ML6 A;  3FXJ A;  3R0A A;  3ERE D;  3JRE A;  2NYX A;  1JKO C;  4K2E A;  2DA1 A;  2VKD A;  3C1D A;  1GDT A;  2DI3 A;  1IGN A;  2V4J C;  2YS9 A;  3QQA A;  1WHU A;  2ZFU A;  3K69 A;  4XKW A;  2JRM A;  2NS0 A;  2LKS A;  1TLH B;  5LLQ A;  1IUF A;  3LL7 A;  3BCB A;  4MEY F;  5F0C A;  3GTM J;  6PAX A;  3G1M A;  1MBE A;  4D7N A;  3TKY A;  3HOS A;  2F5F A;  1OCT C;  4N9I A;  1LE8 A;  2FX0 A;  2R7D A;  2TRT A;  4J01 A;  1FC3 A;  1XN7 A;  3JW4 A;  5A2Q K;  4A3C J;  2Q2E A;  2K7L A;  5BPD A;  3OY9 A;  3V42 A;  1Z6R A;  3SHF A;  2L7F P;  5HS8 A;  3K1P A;  1XTA A;  2BYV E;  4M3D A;  3T5X A;  5HLG A;  5ED4 A;  2V9V A;  3EYI A;  4KDP A;  1YG2 A;  5FGM A;  3S1Q J;  2E2J J;  3A01 B;  3WHC A;  1Z3Y A;  1HBX G;  2EIJ H;  5AIQ A;  1V5G A;  2BV6 A;  2Y0S N;  3KP7 A;  4E7H A;  1F43 A;  5J1R A;  3MMY B;  1U2W A;  3BG5 A;  3OV8 A;  3F8N A;  5L3B A;  2L4M A;  4HAM A;  3DEE A;  3S17 J;  4PJN A;  3TOA A;  2OCE A;  3ULQ B;  4CDG A;  5CVI A;  2PG4 A;  3M1C A;  3LFK A;  3ZGK A;  4BXX J;  3S14 J;  1W1W E;  4DIQ A;  4ABZ A;  2OU2 A;  1FYK A;  2BOL A;  2ZSI B;  3BR1 A;  3S2W A;  1QBJ A;  2HOT A;  2JUC A;  4XM3 A;  2IPQ X;  1S9H A;  1NTC A;  2JA2 A;  3BG6 A;  4EGZ A;  1BC8 C;  3BJA A;  1KYW A;  3C2H A;  1YFH A;  3GZ6 A;  3I53 A;  2VC1 A;  2LKX A;  4IJA A;  2CG4 A;  4HBL A;  4KN7 X;  2M7B A;  1ZG3 A;  5BOX A;  2KZG A;  3KP5 A;  3R6S A;  5TRD A;  1GV5 A;  2W48 A;  5EZG A;  3QYF A;  3K1M A;  4N0B A;  2ZJR F;  1HXD A;  3CCY A;  2KDZ A;  3N97 A;  3OS2 A;  2E60 A;  2DFF A;  4H4K C;  2XF7 A;  2XAG A;  4F3Q A;  2LP0 A;  1ETY A;  3HHG A;  2XGE A;  4EAT A;  5E1W A;  4L18 B;  3W2W A;  2ZBK A;  4IRH A;  3ZN0 A;  1TTY A;  2BVM A;  4RAG A;  1PUF B;  3COA C;  2PI0 A;  4LIT A;  5JR3 A;  4KIF A;  2IT0 A;  4MQ9 F;  1XPX A;  3QPT A;  4FET A;  1TWF J;  3DFG A;  2ELK A;  2GOX B;  4J19 A;  2IS1 A;  5H6R A;  2B0L A;  2Z9O A;  1X1D A;  2HVR A;  5EEG A;  2QGU A;  4A3L J;  3EUA A;  1JTY A;  1O3Q A;  4HLY A;  5DTD A;  3K70 C;  1XB4 A;  1TQM A;  2LTP A;  3SYT A;  3OL4 A;  3TO9 A;  3LSH A;  3FHZ A;  1JJ6 C;  1AKH A;  1YIO A;  2DA3 A;  4KNY A;  1ZTR A;  2OA4 A;  1YJN I;  2NXN B;  3P7N A;  3KPH A;  3GZ5 A;  5L3C A;  2F5V A;  1ONV A;  3CDL A;  3FWE A;  1JKP C;  1E3P A;  4IHX A;  3S1R J;  2MGQ A;  3K2Z A;  3F6O A;  1K4T A;  4DYC A;  1ENH A;  2EFP A;  1N78 A;  3KIO A;  2XPU A;  1OCP A;  2BXY A;  2KJB A;  4GO1 A;  4IHW A;  3DTI A;  1OQY A;  5J3L A;  2XIG A;  3G73 A;  2RKH A;  4N4O B;  1H88 C;  3L7W A;  1ETV A;  5LRR A;  3G4S I;  3K4N A;  1ZAO A;  3RPU A;  2I8D A;  2ZME B;  4ENJ A;  2DW4 A;  3QYB A;  2BE5 F;  3QPH A;  5GTH C;  3KEY A;  3W6V A;  2PJR B;  4HPQ A;  5DS9 A;  3FM5 A;  5KHD A;  2RDP A;  2FJ1 A;  2CUZ A;  3H9J A;  1F1Z A;  5J40 A;  4FX0 A;  5EEA A;  4MGR A;  1WKM A;  2A5W A;  3F8B A;  3J81 Z;  1G59 A;  3S8P A;  4BEH B;  2O8K A;  1RUO A;  1HCR A;  5ICF A;  2E19 A;  2F4O B;  4BXU A;  3BG9 A;  2LKP A;  1I39 A;  4ENN A;  5GPC A;  3M8F A;  1R1U A;  1R4N B;  4EM1 A;  1GUU A;  2E71 A;  2WV0 A;  1SFX A;  2HWV A;  2H1K A;  5IYC J;  3CCM I;  3DBH B;  3TP3 A;  4HNU A;  2KIU A;  2L7M P;  3HRS A;  4BQQ A;  3S93 A;  1D1A A;  2XRN A;  2KRH A;  3RCO A;  3SZP A;  1XSX A;  5IP7 J;  1T0F A;  5LHH A;  2IA1 A;  2VBY A;  5LEJ A;  1Y1W J;  1JT6 A;  2QZ8 A;  5HNH A;  3S1N J;  3VSL A;  3DPT A;  4G7H F;  2Y75 A;  2CQX A;  3I59 A;  1X2N A;  4HEA 2;  1FT9 A;  2VPL A;  4AIH A;  2FF4 A;  3BQY A;  2HDD A;  2L9R A;  3IRQ A;  4M9S A;  2FOW A;  4B48 A;  4YEJ A;  2FU4 A;  1IDY A;  2E1N A;  5FD6 A;  1G8X A;  2IXS A;  2OQR A;  1I50 J;  4D5C A;  1G3T A;  4WF2 A;  4XRF A;  5LBQ A;  2R5Z A;  4KT5 C;  4R1H A;  4LLL A;  4BJ5 C;  1TNT A;  3A0H C;  4MIM A;  4C3I J;  2HOE A;  3DKY A;  3PO2 J;  2Y69 H;  3B6C A;  3I55 I;  4B3A A;  5EYR A;  3AL0 C;  2KHM A;  3BTI A;  1W7P B;  4RB3 C;  4CHU A;  4PGH A;  1DU0 A;  2ZXJ A;  3QYE A;  5FFX A;  1N77 A;  1OIS A;  3TDZ C;  4IQJ A;  3KP2 A;  3Q9V A;  5IP9 J;  3FMR A;  2BVL A;  4U88 A;  3OWT A;  2BY3 A;  3RKY A;  3EUK L;  1TNS A;  3J81 K;  1F9N A;  5CVJ A;  4QPQ A;  2DOA A;  1ZN2 A;  5D5U B;  1B4A A;  3LSI A;  2VLA A;  1MDM B;  4RLF A;  3GTO J;  2JT1 A;  5HS9 A;  2GLO A;  3FXM A;  2X6X A;  3FDY A;  2NRA C;  2XPV A;  2L2O A;  3LWF A;  1U5T A;  2UXX A;  1V55 H;  4CCO A;  2PMZ N;  1C0W A;  2YU3 A;  3IWF A;  3CJQ B;  3VB2 A;  1ZG1 A;  4XMY A;  1B6A A;  2E7X A;  2MW8 A;  1LPQ A;  1BOA A;  1P7I A;  1EH8 A;  2W7N A;  1LJ9 A;  2MFZ A;  2XAH A;  5FKO A;  2FE3 A;  1SVM A;  2Y0S A;  4BKX A;  5F1R A;  2K9L A;  3HOX J;  3KEQ A;  3H3V K;  2ZXI A;  2FQ3 A;  1ETW A;  3HSE A;  1AA7 A;  2HZD A;  2K86 A;  3HIF A;  2V1N A;  4FE4 A;  4GCV A;  1KYZ A;  1N75 A;  5EZH A;  3TOB A;  3EUH C;  5LRS A;  4M9X A;  1O3T A;  3S1M J;  4KUM A;  4YG2 F;  2NVT J;  4XLC A;  3O2P E;  2QSG X;  3JRD A;  1DU6 A;  2MG4 A;  3CC7 I;  1LEA A;  4R79 A;  4P1W A;  3OYD A;  3IL2 A;  1AWC A;  4AM3 A;  4IEJ A;  2YUS A;  2KLO A;  4B8X A;  2DCE A;  3IRR A;  3ABK H;  5F6F A;  3WU0 A;  4ZJZ A;  4IKF A;  1MBF A;  4X0G A;  2CFO A;  4PFP A;  3BOQ A;  3IC7 A;  4CCJ A;  4HX4 A;  4I02 A;  2O03 A;  4UV8 A;  2CS3 A;  3RJP A;  1QQI A;  1DUX C;  4F52 A;  5J47 A;  5F27 A;  4L5E A;  3FIS A;  5TIS C;  1HDP A;  2X4H A;  5IT3 A;  2ZFW A;  3CD6 I;  4CUG A;  4LG0 B;  2CQQ A;  5L3E A;  2LY1 A;  3BZC A;  1K79 A;  2DPU A;  1UST A;  1I1S A;  2WAD A;  4BHB A;  1IXS B;  3HGG A;  5B3S H;  5IYB J;  3KZZ A;  4UHT A;  3ZOB A;  5KVR A;  4HNT A;  3CCL I;  5L3G A;  3HGY A;  2H6C A;  1YIT I;  1J75 A;  3GO5 A;  4HX7 A;  3ZMU A;  2P0W A;  1XCV A;  3AG1 H;  2O0Y A;  5CPR B;  5LGU A;  4GDF A;  2M30 A;  1DGW Y;  4XRS A;  1BBY A;  4P5O A;  5FKM A;  1CGP A;  2EA2 A;  4ENM A;  1YI2 I;  1KA8 A;  3CMY A;  1WJF A;  3DLA A;  1ON2 A;  3X2Q H;  5LGT A;  1FP2 A;  4Q4Z F;  1HW2 A;  5HLT A;  2QBY A;  2JA8 J;  1YOV B;  1YS6 A;  1CF7 A;  1OJL A;  2K9S A;  4PZJ A;  3CCV I;  2VJ5 A;  5EGO A;  3OOP A;  5DEQ A;  4BJ6 C;  2NOG A;  1W4M A;  1XGN A;  2XUB A;  1T56 A;  1SC7 A;  4KIT B;  2EJR A;  4QWQ A;  5E8I A;  1RPW A;  2OJE D;  4U0V A;  3ZN1 A;  3DXJ F;  3CF5 F;  4MLO A;  4WXD A;  1JUM A;  4E4H A;  4M6X A;  1X3W B;  3E6C C;  1IRX A;  3JAM Z;  2L01 A;  4BE1 A;  1IDZ A;  2Z33 A;  3LMM A;  4RM2 A;  1V3F A;  4RA2 A;  5FB2 A;  3HL2 A;  1D8K A;  3CJT B;  3KET A;  1WJD A;  5LEK A;  4UUS A;  1VND A;  1FPQ A;  2FBK A;  3JTG A;  3VOE A;  2D45 A;  4CYC B;  1FP1 D;  1Z7L A;  2V7F A;  3QP6 A;  3E5X A;  2YR2 A;  2OAZ A;  1YW8 A;  2X1C A;  1TW3 A;  2ZJQ F;  1X1C A;  2VOD A;  1R1T A;  4G6Q A;  1MZB A;  4OOI A;  5EEH A;  1H89 C;  2QSH X;  2DOF A;  3GVA A;  2QA4 I;  1ZH5 A;  2CMP A;  2BY2 A;  2A5Y B;  2ME0 A;  2BW3 B;  4CZZ A;  1VQ9 I;  4ESF A;  3A2K A;  3S2D J;  3FHN A;  1T98 A;  1TT0 A;  2ID6 A;  2E7W A;  1W0U A;  3TO6 A;  4M6V A;  1R58 A;  2FMY A;  2DU9 A;  4PJJ A;  4ON0 A;  4XK4 A;  2M3A A;  1W5C C;  2KIF A;  3G1O A;  5B66 C;  4Y4R A;  3VYR B;  4EVI A;  1G3S A;  1K6O A;  2WC2 A;  4XKC A;  1B59 A;  5DM6 F;  3VYS B;  2NNY A;  1SFU A;  3QOD A;  3PSI A;  3TQN A;  4I7H A;  4YIF A;  4ZDL A;  2QKM B;  4PGG A;  5FO5 A;  3T0Y A;  1FYM A;  1IRG A;  3OSF A;  4JOM A;  3MD2 A;  4PUS A;  1S29 A;  4X6A J;  1ORK A;  4LLG F;  4ESB A;  1TWG J;  4RAZ A;  3RKW A;  4BJT A;  3WTZ A;  1ZR4 A;  5GAG J;  3WGG A;  4F92 B;  3BLY A;  2R7F A;  4KIB A;  3Q0V A;  3S3N A;  2XHK A;  2ELH A;  2GQQ A;  1DGR M;  2OZU A;  1FIA A;  3REO A;  4D5F A;  4YFK F;  3OMY A;  1R1V A;  1BM9 A;  1W5S A;  1VQM I;  4UY8 I;  2FD5 A;  2GIV A;  2ZME C;  3ECO A;  5BQT A;  5HOO A;  2V9P A;  3MCZ A;  2ETH A;  5HDG A;  3HRM A;  4GXO A;  4Y15 A;  4I99 C;  1FX7 A;  4F55 A;  1OCC H;  3RPQ A;  3HTS B;  1TW2 A;  4IX7 A;  1SEU A;  3WU1 B;  1EH6 A;  2B7E A;  3LSM A;  3ZCO A;  1Z67 A;  5K1Y A;  3KCC A;  2LSO A;  4HSR A;  2QCO A;  1RIO H;  1JKR C;  2XAU A;  1QNT A;  1OR7 A;  5DUK A;  4C3H J;  2ELJ A;  4XN0 A;  3TMO A;  3CUQ B;  5L3D A;  1IV6 A;  4UVC A;  1R4M B;  2IP2 A;  1X4O A;  5CLS A;  3F23 A;  3RZD J;  2IAI A;  2DYS H;  2I5U A;  3MZ8 A;  5E79 C;  2CRG A;  3MKY B;  3GUD A;  1X3Z B;  1BOB A;  4Z6Y A;  2H6B A;  5K5R A;  1RET A;  1PYV A;  4I0A A;  3RZO J;  3NRV A;  1IUY A;  5KAI C;  5CVR A;  1KU9 A;  1FOW A;  3ONQ A;  4BAC A;  1VQP I;  2STW A;  2GBY A;  2PMZ A;  3UKG A;  1J09 A;  2RNJ A;  3K7A J;  2BHY A;  1VQ6 I;  2NVQ J;  2V79 A;  3RKQ A;  2DLL A;  1GHC A;  1LNW A;  2LOO A;  2L54 A;  3F9K A;  4XL9 A;  1IN5 A;  2H8R A;  1LDJ A;  5DV5 A;  3DWL E;  1BIA A;  2IRF G;  1MH4 A;  1T8I A;  2CUE A;  2YPR A;  5HS7 A;  4JQF A;  3RIR A;  1WH5 A;  2M34 A;  3BPX A;  4XLN F;  1W0T A;  5DYM A;  5H2F C;  1X58 A;  2L4A A;  2HPI A;  2P6T A;  3OYH A;  2V6E A;  1REP C;  2CO5 A;  3CCQ I;  1O7L A;  2PJP A;  2VBW A;  3H35 A;  2XAS A;  3HM5 A;  4G9Y A;  2DK8 A;  4S05 A;  5JLW A;  1OKR A;  1RC9 A;  2KRF A;  3CLQ A;  4HDV A;  1QVU A;  2W25 A;  4B1R A;  2HR3 A;  1SFO J;  3FXK A;  4M3F A;  2M4K A;  1NHA A;  2DK5 A;  2V1X A;  1P92 A;  1U8R A;  2Y0M A;  1ZRD A;  2V26 A;  3MN2 A;  1IXR C;  4QPO A;  1BJZ A;  1DQU A;  2CW8 A;  3ZP5 A;  5M3F J;  2HOS A;  3TGN A;  3S15 J;  4IRG A;  5E3O A;  1R5I D;  1HST A;  1TWH J;  4NC8 A;  5CQE A;  5D5V B;  4HX8 A;  1K78 A;  1FOK A;  1PVE A;  4M74 A;  2WWY A;  2FEZ A;  5GAE J;  3OYB A;  2HNH A;  1A04 A;  3OYK A;  2VUM J;  2H09 A;  1D1C A;  3FIW A;  3WTT C;  3K2A A;  1MH3 A;  1LEB A;  2IS2 A;  3OYG A;  1YX5 A;  4UUV A;  3CQZ J;  4KFC A;  4BDY A;  4OIR F;  3VPR A;  1MD0 A;  2KZV A;  3BJ6 A;  1P9Q C;  2JQ7 A;  2M8G X;  1LE8 B;  1LVA A;  4KMF A;  2Y30 A;  1YJ9 I;  4UB8 C;  1WH7 A;  1AU7 A;  4IHT A;  5GAH J;  1WCM J;  1D0Z A;  2EV5 A;  3HXL A;  1JTX A;  2MH9 A;  1W36 C;  2Q2E B;  2M4G A;  4CH7 A;  3U2R A;  1U6G A;  1N25 A;  4CCN A;  4F91 B;  1Z6T A;  2JK3 A;  3HOW J;  2LMD A;  2KIM A;  3J80 Z;  5EG0 A;  1L3L A;  1W7P D;  4DOZ A;  4HW0 A;  1MSE C;  1FWZ A;  2QSF X;  4FCY A;  4I6Z A;  3M3Y J;  3KEO A;  2P5V A;  2EFO A;  1B9N A;  3E5U A;  4GFB A;  3R0J A;  4YFX F;  2Z16 A;  3CC2 I;  1I6H J;  2DN0 A;  5EJC A;  1S3J A;  2VXD A;  4LG3 A;  3CC4 I;  1PJR A;  5F0F A;  3GXO A;  2IGN A;  2DA2 A;  3BRO A;  2L7K A;  4MHG A;  1K83 J;  2MAB A;  5KNL A;  3ASN H;  4BQN A;  2E35 A;  2WY7 Q;  3C7J A;  2WV1 A;  1HOM A;  3KFW X;  2NVX J;  2WAQ N;  3DV8 A;  4N9H A;  5LGN A;  5JVT A;  1KU3 A;  1WJ5 A;  4ITV A;  3B6A A;  2C6Y A;  4ZZD A;  2FA5 A;  1VQ7 I;  2EK5 A;  1MNE A;  2GZW A;  1U78 A;  2OTL I;  1SFE A;  4DGW B;  2VPR A;  3FXQ A;  2G9W A;  4BBR J;  4E7J A;  2QQA A;  3H9Q A;  2EIK H;  5EF6 A;  2ZXH A;  2B63 J;  3B02 A;  4IXA A;  4PSX A;  3A1Y A;  4M3B A;  2L02 A;  2LVS A;  4EJV A;  2R7Q A;  5BS6 A;  1JI8 A;  1W36 D;  2Z1D A;  2ID3 A;  4U0Y A;  4KJZ A;  3CP2 A;  2EH3 A;  2A69 F;  2WAF A;  4XOP A;  5CQG A;  4YFN F;  1OPC A;  1ODD A;  3NQO A;  2COB A;  1BR4 A;  3PM1 A;  1O7F A;  2HI3 A;  2HZT A;  2RC4 A;  2PBI A;  4ETS A;  4ZTJ A;  2DFI A;  3OR1 C;  4AIK A;  3SFZ A;  1Z1D A;  3CCU I;  4XR6 A;  1KON A;  3IH3 A;  5E3N A;  2EBI A;  4UVB A;  1E3H A;  4A0X A;  5D8K B;  1TZL A;  2P81 A;  4S04 A;  3ABL H;  3WGI A;  1FBQ A;  1YO5 C;  1T38 A;  2VI6 A;  2HS5 A;  3ESW B;  2E2I J;  4U0W A;  4E70 A;  4NHJ A;  4BBS J;  4O5V A;  3FM3 A;  1TC3 C;  3IH2 A;  1AKH B;  2HDC A;  2F48 A;  2QWW A;  4XLH A;  3PUB A;  1O3R A;  2FOK A;  2DFH A;  3FXU A;  1ITY A;  2M7A A;  4G8X A;  1NK2 P;  2H8W A;  1A6Q A;  3L9F A;  1WGX A;  3F72 A;  3V7R A;  2AQE A;  2QEN A;  4O6J A;  4E7L A;  1E17 A;  3GTG J;  3KZY A;  4JYK A;  3FMQ A;  5GTI C;  5ILU A;  3CMA I;  4A3F J;  1YTY A;  2KKO A;  2IGM A;  3HJE A;  4XBF A;  2IA2 A;  3JSP A;  1XMA A;  2W24 A;  1QO0 D;  1VQN I;  1JHH A;  2GA2 A;  2KRC A;  1K4S A;  1X2M A;  1XGO A;  4N4N B;  2K9Q A;  3RDI A;  2H1L A;  5JI6 A;  1WI9 A;  2HOA A;  2EV6 A;  2L7Z A;  1LDD A;  3QU6 A;  1SVO A;  3BTC A;  3EPZ A;  3QPS A;  5ILV A;  1UFM A;  2AQF A;  4A3B J;  3A02 A;  3G2B A;  3L09 A;  4RB0 A;  3T1B A;  1FYL A;  3GTK J;  1JGG A;  4DYQ A;  2DT5 A;  2DA5 A;  2NAZ A;  3G6E I;  4EJU A;  3CDI A;  2EA4 A;  3M1E A;  2DT7 B;  2JPC A;  2WY8 Q;  3HB9 A;  3KP6 A;  2UUZ A;  4IL6 C;  1J9I A;  1XS9 A;  3SFI A;  3WTU C;  3DU5 A;  1YW9 A;  3ZQH A;  4B09 A;  4OIN F;  1WVR A;  2CSO A;  2CV0 A;  2STT A;  1XD7 A;  3DEW A;  4LB6 B;  1ZLK A;  1RZ4 A;  2ZME A;  4A3D J;  3CCE I;  1EA3 A;  3KX2 A;  2G7H A;  1RES A;  1FSE A;  3O8G A;  2IBD A;  4V2G A;  1BR2 A;  1MBH A;  3NAR A;  1X1B A;  3UNG C;  2O61 A;  4Z2Y A;  1YRN A;  1WI3 A;  2HVS A;  3BG7 A;  1RR8 C;  3W2A A;  3FZV A;  2JRT A;  1VQ8 I;  2E36 A;  1HQC A;  3I59 B;  3MZY A;  4Q5S F;  2ECC A;  3S3O A;  3AFH A;  3AG3 H;  3HHH A;  4JP0 A;  1B9M A;  4Y7N J;  4BY1 J;  3HRT A;  3WG9 A;  3CUQ C;  3FKJ A;  4FX4 A;  1UZC A;  2DT6 A;  2PLY A;  3T8T A;  5LHG A;  1E0E A;  3E97 A;  5LFA A;  1OCR H;  2KIQ A;  2R7V A;  3K9T A;  3LQQ A;  4DBQ A;  3MAJ A;  3H36 A;  3E6B A;  1IN8 A;  2LBF A;  2ZJ2 A;  3SZG A;  2ZC2 A;  3CUO A;  1PDN C;  2BZT A;  5AON A;  2RAE A;  2CV1 A;  3ROU A;  4C3J J;  3GFM A;  1A31 A;  3ZQF A;  3RI4 A;  3Q3S A;  1KZH A;  2CUJ A;  2LK2 A;  3Q0U A;  5FLX Z;  3AG4 H;  4U7B A;  1YYV A;  3QU3 A;  4KYW A;  1USS A;  1Z21 A;  2VKH A;  5E18 F;  2QLZ A;  1WRJ A;  3OSG A;  1I6X A;  1J7K A;  1TT5 B;  5BPI A;  2A05 A;  3F22 A;  2W84 A;  3K1N A;  3L2C A;  2O9L A;  4ZH4 F;  1FTT A;  2ZO4 A;  3I54 A;  2NOJ B;  5D4R A;  1X3U A;  4UV9 A;  3QAH A;  4ZYH A;  2DJN A;  3ZMV A;  4IOC F;  1VQO I;  1V5E A;  1VQL I;  2ZNZ A;  1U5T B;  4ENK A;  1I3A A;  2DMP A;  3KLN A;  2N8G A;  2R7T A;  1E3O C;  1KQ8 A;  4LLN A;  5F08 A;  5HVQ C;  5B1B H;  2DOD A;  1YQA A;  1KU2 A;  4E6K G;  2CW7 A;  1XG1 A;  2EIL H;  3GWZ A;  2IGO A;  3GZN B;  4V2F A; 
#chains in the Genus database with same CATH homology
 4HNV A;  4XK4 A;  3G1O A;  2M9H A;  2DA4 A;  2ECB A;  4JX4 A;  2XGC A;  5C4J J;  1UHS A;  2OF7 A;  3HOY J;  1WPK A;  1QVT A;  2XGD A;  3JRE A;  2CJJ A;  1JKO C;  2DA1 A;  2JMW A;  3BR3 A;  1GDT A;  5GPA A;  3OSF A;  1IGN A;  2YS9 A;  3QQA A;  2IEK A;  3WHB A;  4X6A J;  1ORK A;  1T33 A;  5FLV A;  1TWG J;  3HDD A;  1IUF A;  1HF0 A;  3FK6 A;  5F0C A;  3BR0 A;  3GTM J;  1ZR4 A;  4MFD A;  3JRG A;  3G1M A;  4JX6 A;  1MBE A;  4D7N A;  3S16 J;  2EZK A;  5IOZ A;  2X9D A;  5E3L A;  1FTZ A;  3Q0V A;  1OCT C;  1ETX A;  1FIA A;  2FX0 A;  1Z0X A;  2TRT A;  4D5F A;  1LE8 A;  2FD5 A;  1GV2 A;  4NDL A;  1H8A C;  4A3C J;  3DCF A;  3MVP A;  2AO9 A;  4UUT A;  2LY9 A;  2HYJ A;  1YRN B;  3BG3 A;  2L7F P;  4A3G J;  4M3D A;  2VKV A;  3S1Q J;  3ZQG A;  3BT9 A;  2E2J J;  3A01 B;  3WHC A;  2LD5 A;  5IYD J;  1U9O A;  4Y52 J;  2R7Z J;  2QCO A;  2Y0S N;  2XB0 X;  1F43 A;  4JX5 A;  5J1R A;  1JKR C;  3BG5 A;  1RKW A;  3A03 A;  1Q1V A;  3O8H A;  3JRF A;  5C44 J;  4C3H J;  5J1Y A;  3C2B A;  3S17 J;  1QRY A;  1IV6 A;  5C3E J;  3OOU A;  4FE7 A;  3LSP A;  2L0K A;  1Z77 A;  4BXX J;  3RZD J;  3S14 J;  3D1N I;  2JA7 J;  4XRS G;  2IAI A;  3MKL A;  4ABZ A;  2CRG A;  2R5Z B;  3HKZ N;  2WB1 N;  3BR1 A;  1RET A;  3JR9 A;  2HOT A;  2Y31 A;  3RZO J;  1NTC A;  1Y1V J;  4DYR A;  2LKX A;  2GBY A;  5IOY A;  3UKG A;  5F0H A;  2NVQ J;  1GV5 A;  2W48 A;  3K7A J;  5EZG A;  3RKQ A;  4IHV A;  2Y2Z A;  3CCY A;  2KDZ A;  2H8R A;  4A3M J;  2D5V A;  1MH4 A;  2JJ7 A;  4W97 A;  4MO7 A;  2CUE A;  2LP0 A;  2O7O A;  2R92 J;  1ETY A;  2XGE A;  4LOC A;  1U8B A;  1WH5 A;  2M34 A;  3LOC A;  5JLX A;  1B8I A;  1RKT A;  1ZR2 A;  1W0T A;  2JWT A;  3G1L A;  1PUF B;  1X58 A;  1ZKG A;  2JA6 J;  5K7H A;  1APL C;  3H0G J;  3HM5 A;  2DMN A;  1TWF J;  2ELK A;  4J19 A;  3GTL J;  1D5Y A;  5JLW A;  4A3L J;  1QVU A;  4B1R A;  2YU9 J;  1XC5 A;  1SFO J;  1JTY A;  2LFB A;  4M3F A;  5DTD A;  3MN2 A;  1BJZ A;  2LTP A;  1AKH A;  5M3F J;  2HOS A;  1JJ6 C;  1B72 B;  2DA3 A;  3S15 J;  5E3O A;  1LFU P;  1ZTR A;  3IH4 A;  1TWH J;  1AHD P;  5FKN A;  3M4O J;  4RBO A;  3BR2 A;  4QSH A;  3HOU J;  4A3E J;  3CDL A;  1JKP C;  3GTP J;  2VUM J;  4IHX A;  3FIW A;  2MGQ A;  3SDG A;  3S1R J;  3K2A A;  2XRL A;  4DYC A;  1ENH A;  3JRA A;  4FIS A;  1MH3 A;  1ETQ A;  2XPU A;  1S7E A;  1OCP A;  3CQZ J;  3RQI A;  4QIW N;  5IP6 A;  3VPR A;  1QPI A;  4S0H B;  4IHW A;  2X6O A;  2M8G X;  5J3L A;  1LE8 B;  2Y30 A;  4M3E A;  1H88 C;  1MBG A;  1WH7 A;  1ETV A;  1VF9 A;  1A6I A;  2OPT A;  1AU7 A;  1FEX A;  1WCM J;  2Y9Y A;  1JTX A;  1TWC J;  3W6V A;  5J1U A;  4AC0 A;  5DS9 A;  2FJ1 A;  3LSJ A;  2JK3 A;  3HOW J;  5EG0 A;  2VKE A;  5EEA A;  3LSR A;  1MSE C;  2EZH A;  4FCY A;  4I6Z A;  5M5X J;  4EEF G;  3M3Y J;  3GBG A;  2DMQ A;  4GFB A;  3FK7 A;  2O8K A;  1HCR A;  1I6H J;  1ETK A;  2E19 A;  2DN0 A;  4A3K J;  3BG9 A;  3ZQC A;  2NVY J;  5F0F A;  3ZQL A;  2DA2 A;  5GPC A;  1K83 J;  1GUU A;  2ZB9 A;  5EGO B;  2JN6 A;  2H1K A;  5IYC J;  2EZL A;  3TP3 A;  1EF4 A;  4X1E A;  2WV1 A;  4A3J J;  1HOM A;  2NVX J;  2L7M P;  4AYB N;  2WAQ N;  4D7M A;  2MSY A;  1HDD C;  2XPW A;  2M2E A;  5IP7 J;  3B6A A;  3HEF A;  3JRH A;  1ZK8 A;  1U78 A;  1Y1W J;  1JT6 A;  3S1N J;  2VPR A;  2ME6 A;  5FKL A;  4BBR J;  4BY7 J;  2NS8 A;  5M5Y J;  2CQX A;  2I10 A;  5EF6 A;  3E7L A;  4AUX A;  3QPL A;  1X2N A;  4UUS B;  3JRI A;  2B63 J;  5K7Z A;  1JUP A;  3BQY A;  1HLV A;  2HDD A;  4M3B A;  2L9R A;  2LVS A;  4M3G A;  2DA6 A;  3JRB A;  1MNM C;  1UG2 A;  1IDY A;  1ETO A;  5EDN A;  2ID3 A;  4DZP A;  2KT0 A;  2EH3 A;  3ZQI A;  1I50 J;  2DMT A;  4D5C A;  2R5Z A;  1G2H A;  2M0C A;  1B8I B;  3JRC A;  2E2H J;  5M3M J;  1NK3 P;  4MIM A;  1FIP A;  4C3I J;  3FKI J;  5F1J A;  3PO2 J;  2R5Y B;  3B6C A;  2COB A;  3PM1 A;  2HI3 A;  4B3A A;  1IRZ A;  5IPA A;  5EYR A;  4G12 A;  3BTI A;  2JA5 J;  3IH3 A;  5E3N A;  2EBI A;  1DU0 A;  2P81 A;  1BA5 A;  3BQZ A;  4A93 J;  2VI6 A;  2LR8 A;  2E2I J;  4BBS J;  4CYC A;  1P7J A;  1TC3 C;  3IH2 A;  1AKH B;  4DW6 A;  5IP9 J;  3TW6 A;  1RR7 A;  2QF7 A;  4XRM A;  1JJ8 C;  1ITY A;  2EQR A;  3GTO J;  1MBK A;  2GLO A;  1NK2 P;  1WGX A;  2XPV A;  3HOV J;  3GTG J;  2EZI A;  2PMZ N;  4JYK A;  4A3F J;  2MW8 A;  1POG A;  1TWA J;  1P7I A;  1GVD A;  3LSG A;  5HOD A;  4C2M J;  1R9T J;  2XB5 A;  4XIC A;  3SJM A;  3BR6 A;  5FKO A;  1X2M A;  4A69 C;  2R0Q C;  4BKX A;  5E3M A;  3HOX J;  3H3V K;  2K9Q A;  1B72 A;  1ETW A;  2HOA A;  4FE4 A;  2L7Z A;  5EZH A;  3BTC A;  1U9N A;  4DZJ A;  3QPS A;  2HXI A;  3HOZ J;  4A3B J;  3S1M J;  3A02 A;  2NVT J;  1UMQ A;  5K7F A;  3JRD A;  1DU6 A;  5EG0 B;  2MG4 A;  3GTK J;  2AHQ A;  1JGG A;  4IEJ A;  4DYQ A;  1CQT A;  2YUS A;  2DA5 A;  4QTR A;  2K40 A;  3GTJ J;  1VFC A;  1MBF A;  4A3I J;  5FJ8 J;  3HB9 A;  3OIO A;  1XS9 A;  3I4N J;  1ZGW A;  3SFI A;  3ZQH A;  5F27 A;  4L5E A;  3DEW A;  3FIS A;  3IV5 A;  1HDP A;  3TP0 A;  1BW5 A;  4XID A;  2CQQ A;  4A3D J;  1JT0 A;  1GT0 C;  1RES A;  1LFB A;  3O8G A;  3HGG A;  5FLM J;  2IBD A;  4V2G A;  5IYB J;  1MBH A;  4W1U A;  3NAR A;  1VI0 A;  3ZOB A;  2X48 A;  5C4X J;  5FKK A;  3HGY A;  1YRN A;  1WI3 A;  4RDU A;  3PO3 J;  2E1O A;  4XRS A;  4I76 A;  5FKM A;  3A01 A;  4B4C A;  3HBL A;  2ECC A;  3CMY A;  3BTL A;  4JP0 A;  2DA7 A;  3TW7 A;  4Y7N J;  4BY1 J;  2JA8 J;  1JUS A;  1OJL A;  2G0E A;  2K9S A;  3GTQ J;  3F0C A;  2HXO A;  1IC8 A;  5EGO A;  2NOG A;  2NS7 A;  5F04 A;  1A5J A;  1T56 A;  1RPW A;  1K61 A;  4MLO A;  3I4M J;  1JUM A;  1MBJ A;  2RAE A;  3BR5 A;  1SAN A;  4C3J J;  3Q0W A;  3ZQF A;  2CUF A;  3Q3S A;  9ANT A;  3Q0U A;  2LK2 A;  1IDZ A;  1IG7 A;  1IJW C;  1BL0 A;  1OFC X;  2HQ5 A;  4UUS A;  1O4X A;  1VND A;  2DMU A;  4CYC B;  2LLK A;  3OSG A;  3TED A;  2O9L A;  4IHY A;  1FTT A;  2CU7 A;  4FTH A;  1H89 C;  2DJN A;  3L1P A;  2GM4 A;  1BW6 A;  2R5Y A;  1FJL A;  2XSD C;  2R93 J;  2DTZ A;  2DMP A;  2ME0 A;  1PUF A;  3LNQ A;  2K9N A;  2N8G A;  5GP9 A;  3S2D J;  1MSF C;  3NAU A;  4MFE A;  2ID6 A;  1E3O C;  3S2H J;  2Y9Z A;  2TCT A;  5F08 A;  5BNG A;  1I3Q J;  3BTJ A;  1W0U A;  1F36 A;  4M6V A;  1ZQ3 P;  2FQ4 A;  1XG1 A;  5M5W J;  4V2F A;  1JKQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...