4DYQA

High resolution crystal structure of terminase small subunit gp1 of the bacterial virus sf6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
molecule keywords Gene 1 protein
total genus 37
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dyqA01
1ETQA 1TWFJ 5F04A 3LSJA 4M3EA 2EZIA 5E3OA 3WHCA 1BA5A 1ZR4A 3NARA 5FKMA 2Y31A 2Y9YA 1HDDC 2YS9A 4FE4A 4ABZA 4DZPA 9ANTA 2DA7A 4A3KJ 2EQRA 5M3MJ 1WH7A 2HI3A 5IP6A 1ITYA 3JRAA 2KDZA 2CUFA 2K9SA 2XPVA 1W0TA 3S15J 1JTXA 1MBEA 5BNGA 2R5ZA 3IH2A 3TW6A 2LD5A 3CMYA 4M6VA 2ID6A 3QPSA 4JYKA 4A69C 1ZQ3P 1U9OA 2O8KA 2XGDA 4BY1J 5J1UA 3JREA 3IV5A 1SFOJ 3PM1A 1VFCA 5C4XJ 4A3FJ 4JX6A 1AHDP 2VUMJ 5EYRA 1PUFA 1IDZA 1JUMA 4A3JJ 2CQXA 1F36A 2VKVA 2DN0A 1D5YA 2EBIA 4CYCB 1JKPC 2H8RA 2MSYA 3BR3A 4V2GA 1POGA 2JA8J 2M0CA 3TP0A 2DJNA 3A03A 2JJ7A 3BR0A 1Y1VJ 1IUFA 4AUXA 2HQ5A 1TWAJ 1BW5A 2JN6A 4DYCA 3BTLA 3GBGA 1MBKA 4A3IJ 2JK3A 2OF7A 2P81A 1JT0A 2K40A 1A5JA 1JGGA 1BW6A 1ETYA 2YUSA 2R92J 5M3FJ 2K9NA 1Z0XA 1UHSA 1B8IA 4UUSB 2ZB9A 3B6AA 3FISA 2JA6J 4S0HB 1ENHA 4BKXA 3BG9A 1MBGA 3CDLA 2GM4A 1QVUA 2R93J 3HOYJ 2XSDC 1LE8A 2PMZN 3FKIJ 2X9DA 1TWHJ 4BBRJ 5EGOB 1AU7A 1JKRC 4FTHA 4I76A 1XG1A 5IP9J 3ZQLA 1NK2P 1OFCX 3O8GA 4A3LJ 3Q0VA 5F1JA 1QRYA 3HOUJ 4XRSA 4HNVA 1R9TJ 2CJJA 3OOUA 5IYCJ 5F08A 5DS9A 1UG2A 2DMPA 1IJWC 1VI0A 1HLVA 2QF7A 3BTIA 3HM5A 2E2IJ 2CU7A 4FCYA 3ZQIA 1IG7A 2LFBA 5C3EJ 1P7JA 3GTOJ 2XRLA 3HOXJ 4DW6A 4LOCA 1IC8A 1BL0A 1JT6A 2TCTA 4XIDA 3M3YJ 4C2MJ 4M3BA 3RZOJ 2NOGA 2DA4A 4V2FA 3MN2A 2TRTA 3I4NJ 1CQTA 2JA7J 2KT0A 5F0FA 3SFIA 2CRGA 1W0UA 2R5ZB 3HOZJ 3BG3A 1IRZA 2XB5A 5EZHA 3DCFA 3Q3SA 5GPCA 3CCYA 2VPRA 3MKLA 3UKGA 5J1YA 4J19A 3E7LA 2W48A 5GPAA 1A6IA 1NK3P 1IDYA 1JKQC 1H8AC 1FIAA 5IOYA 2COBA 4QIWN 5IPAA 1G2HA 3JRHA 2IAIA 3A01A 4B3AA 3TP3A 1PUFB 2E19A 3IH3A 1IV6A 1FEXA 2L7FP 5IYBJ 1FTTA 4XRSG 1E3OC 3S1MJ 4MFEA 1APLC 5IYDJ 3LSRA 5FLVA 4JP0A 1I50J 3JRGA 2DMNA 1ZGWA 2X48A 5K7ZA 1MH3A 3ZQHA 1GUUA 2LKXA 4MO7A 1S7EA 2DMUA 2I10A 1MNMC 4A3MJ 1U8BA 2FX0A 3S2HJ 4X6AJ 1LE8B 3Q0WA 2HOTA 1GVDA 1OCPA 2AHQA 1WH5A 2NS7A 3JRCA 3GTLJ 3S17J 4UUSA 4DZJA 3BR6A 2XGCA 5C4JJ 1IGNA 5M5YJ 3BR1A 3S1RJ 3PO2J 3QPLA 4XRMA 2M34A 1NTCA 2JWTA 4C3IJ 3JRFA 2M2EA 3TW7A 4DYQA 2EH3A 1RKTA 3GTMJ 3JRDA 4A3DJ 3HGGA 3LNQA 1VF9A 1U9NA 3OIOA 3S1QJ 3ZQFA 3JRBA 2ID3A 4AYBN 1FJLA 2O9LA 3I4MJ 2X6OA 2CQQA 4B1RA 1GDTA 4A3GJ 1WGXA 1GT0C 4JX4A 1U78A 3BR2A 1RKWA 2Y2ZA 1ETWA 3LSGA 5M5XJ 3WHBA 4BXXJ 1HDPA 3BR5A 2MW8A 2E1OA 4L5EA 2WV1A 4W97A 3GTJJ 2M9HA 2L7MP 5EF6A 2DA3A 4D5FA 2H1KA 3ZQGA 3JRIA 5J3LA 2NVTJ 2VI6A 5EEAA 2NVQJ 1OJLA 1FIPA 4D7MA 3M4OJ 3GTKJ 5EDNA 3W6VA 5IOZA 2LP0A 4FISA 3GTQJ 2OPTA 3DEWA 1P7IA 4FE7A 4IEJA 4NDLA 3B6CA 1RETA 4C3JJ 3PO3J 3HB9A 4Y52J 1QVTA 3FK7A 5M5WJ 4UUTA 2ECCA 1MSEC 2NS8A 4RBOA 4A3BJ 5K7FA 1WPKA 1XC5A 2LVSA 2FQ4A 1ZTRA 2M8GX 1MBJA 1JTYA 1ZK8A 2Y9ZA 1XS9A 2L0KA 5E3LA 3QQAA 3HOWJ 3RZDJ 3NAUA 3OSFA 4JX5A 2DA1A 2L9RA 3A02A 1WI3A 4QSHA 1DU0A 1YRNB 2G0EA 2E2JJ 5GP9A 5E3MA 4IHVA 2MG4A 5FJ8J 5FLMJ 1OCTC 4IHXA 3RKQA 4MFDA 3G1MA 1HOMA 1H89C 3LSPA 2HXIA 1AKHB 2DTZA 5FKNA 4BBSJ 3GTPJ 1X2MA 1O4XA 1HF0A 1ETXA 1WCMJ 1K61A 5F27A 1ETOA 4M3GA 1I6HJ 1JJ8C 1Q1VA 2R5YA 3LOCA 2EZKA 2YU9J 3FK6A 2R7ZJ 1BJZA 3BG5A 3HBLA 5EG0A 1RESA 1LFBA 5HODA 5K7HA 1DU6A 1HCRA 2ME6A 2LK2A 2LTPA 5J1RA 3VPRA 1MH4A 2N8GA 1TWGJ 2EZHA 3G1OA 3BTJA 2IEKA 5FKKA 2Y0SN 1TWCJ 4A93J 1VNDA 1MBHA 4QTRA 2XPWA 4MIMA 4Y7NJ 1JKOC 3D1NI 5FKOA 4EEFG 2L7ZA 3HDDA 3SJMA 3HKZN 2WB1N 3FIWA 3SDGA 1ETVA 3O8HA 1MSFC 5FKLA 1ORKA 2XB0X 1JUSA 4MLOA 4XICA 1ZR2A 5EG0B 2D5VA 2AO9A 2NVYJ 3HOVJ 4M3FA 2DA5A 1RPWA 1ETKA 2DA2A 4XK4A 2HOAA 3ZOBA 4D7NA 3S2DJ 1JUPA 4BY7J 2DMTA 2R0QC 2ECBA 4A3EJ 2GBYA 2K9QA 1GV5A 3K7AJ 4AC0A 3H3VK 1TC3C 5C44J 3C2BA 4D5CA 3H0GJ 4CYCA 3F0CA 2O7OA 3L1PA 2ME0A 3BT9A 2LLKA 5JLXA 1I3QJ 2QCOA 1T33A 2Y30A 5JLWA 2VKEA 2FD5A 4IHWA 3BQYA 4C3HJ 4IHYA 3OSGA 2CUEA 1Y1WJ 3K2AA 3CQZJ 2XGEA 3JR9A 1YRNA 4RDUA 2EZLA 4G12A 3HGYA 3HEFA 1B72B 3GTGJ 1FTZA 2NVXJ 1Z77A 5E3NA 4A3CJ 2MGQA 1B8IB 1RR7A 2B63J 1F43A 5DTDA 3ZQCA 2IBDA 2WAQN 3RQIA 5IP7J 3S14J 2GLOA 1EF4A 3BQZA 4W1UA 3S16J 1T56A 5EGOA 3S1NJ 3BTCA 2LR8A 1LFUP 1X58A 4B4CA 3A01B 2JA5J 1AKHA 2RAEA 1K83J 3IH4A 1QPIA 1JJ6C 3MVPA 3TEDA 2HYJA 2XPUA 5F0CA 1GV2A 1SANA 1MBFA 1X2NA 1B72A 2JMWA 5F0HA 4X1EA 1H88C 2HOSA 4DYRA 1ZKGA 2FJ1A 2HDDA 4GFBA 1UMQA 2ELKA 5EZGA 2R5YB 2HXOA 2DA6A 2E2HJ 3Q0UA 3G1LA 2DMQA 4M3DA 4I6ZA 2LY9A
chains in the Genus database with same CATH superfamily
1TWFJ 2VBWA 5DV5A 1BBYA 3FM5A 5CVVA 1VQOI 1OCZH 3RKWA 1X3WB 2IS4A 5L3BA 1ZR4A 1WJAA 2PG4A 3ECHA 1OYWA 3ASOH 3H92A 4MHGA 3T5XA 4PUSA 2DA7A 1GXQA 3ML6A 4P9FA 4B48A 4CSWA 3BWGA 4IX7A 2IS6A 3KE2A 3OYCA 2HI3A 4LB6B 3W2WA 3E5XA 2H6BA 3JRAA 2KDZA 4DOZA 1S3JA 4ENJA 1JTXA 1IF1A 4YIIA 1QHHD 2XAUA 1TQIA 4CXFA 3TW6A 2EJRA 4CCMA 4A69C 5CKTA 3V8LA 3VYSB 3KZYA 4HEA2 2A05A 3MMYB 4LFUA 3OR2C 5DEQA 1VFCA 3EUHA 4RA2A 2F5FA 4A3FJ 4R8HA 2WB1A 2VUMJ 3BOQA 5EYRA 2CQXA 2DN0A 1D5YA 3U9GA 4OMZA 2JA2A 4CYCB 2O0YA 1TQMA 1YW7A 1KU2A 1E3HA 3WG9A 2QSHX 3M7GA 4HRIA 3BY6A 2KFDA 1NG7A 3K6GA 1EH7A 2JN6A 1WFXA 1HW5A 2FF4A 3E3VA 5H20A 4II3A 3TBIA 5LD2C 2RV8A 1VZ0A 4A3IJ 2OF7A 2LMDA 1JGGA 3JCUC 2HTJA 4Q47A 3I54A 5L3CA 2YUSA 4D1QA 2BY3A 4F93B 3ABLH 1Z0XA 4ZDPA 2K27A 2A69F 4UVBA 4BACA 2MD5A 2XRNA 3FISA 2IGKA 2E71A 2VXDA 3KEYA 1D0XA 2M7BA 4BKXA 3I71A 3LA7A 4BHPA 3I56I 1LUJB 3S2WA 1VTNC 3PL8A 4HBLA 1Z21A 1T08B 2ZO4A 2V7FA 1WJBA 3DPUA 1LE8A 3FKIJ 2CMPA 5EGOB 1TWHJ 1X19A 4BBRJ 3DP7A 4PSWA 1FOWA 4FTHA 3NWSA 4P1WA 2ZC2A 1Y6IA 5IP9J 3ZQLA 3WE3A 3LA3A 4XLPF 1MZBA 4XRSA 1R9TJ 1DGRM 5IYCJ 3BZ6A 5F08A 3DLAA 1LFPA 1IJWC 3MKWB 2LKPA 2QF7A 2Q2EA 3L2VA 3HM5A 3RPQA 1Y8RB 4UNOA 2DDAA 4AU7A 1B4AA 5C3EJ 3IWFA 2QSGX 1EJ9A 3FDYA 3HUGA 3HOXJ 2QGUA 3Q9VA 2LC2A 1XCBA 1BL0A 1FYKA 4EM1A 1LDKB 3DLLF 1AWCA 2W4SA 5CQGA 4XLHA 1SAXA 1S7OA 4C2MJ 1V5FA 2I8DA 5KNLA 5ERIA 2GXGA 3BG7A 2F4MB 3R60A 1X3UA 1G8XA 3HC7A 2JA7J 3IL2A 2CQKA 3B02A 2RREA 4PFOA 3HOZJ 3BG3A 5JI6A 1YITI 1U0JA 2OU2A 3BJ6A 1EV7A 2CSOA 5GPCA 1KQ9A 3MKLA 3O3KA 1ZRCA 4QPOA 3QYEA 2J5PA 1A35A 2VJ4A 5D4RA 2W48A 3HUGB 4L5JA 3F8FA 3MAJA 1MD0A 3L2RA 2ELJA 1WQ2A 4QIWN 1OKRA 2V6CA 4MTDA 5HS7A 1Q1HA 3JW4A 3S3OA 5ICEA 3ZGKA 2HU9A 2E19A 3IH3A 1PYVA 5E1XA 1ZG5A 4XLCA 1USTA 3W6KB 3RKYA 1APLC 5IYDJ 4E7HA 4HQEA 4BE1A 3SZTA 3LSRA 3K4MA 4BXFA 2RKHA 3FXRA 2DMNA 4HV6A 2K4BA 1ZGWA 3HYIA 2WA0A 1FOXA 2VC0A 1ACIA 1W4MA 2CV0A 1BR4A 1K6OA 1GUUA 2LKXA 4A12A 4KFCA 3PQKA 1YX3A 2E7WA 4YEJA 1YJ9I 2NS0A 2MA3A 1GVDA 2AHQA 3BP8A 2ZKZA 4FT8A 4EJUA 1CGPA 5CYVA 3A0BC 2EIJH 1ZHFA 4J01A 2EFOA 2JWTA 3JRFA 4G9YA 4DYQA 4P55A 4HV5A 1F9NA 3GXOA 2STTA 3IRRA 2OA4A 3KP5A 2JPCA 3J80K 1D0YA 2WV0A 2VJ5A 4N9HA 3L00A 4RB0A 3DQVC 4IXAA 2RDPA 2DOAA 2OCCH 3S1QJ 3H36A 3JRBA 4I0BA 2ID3A 3CUQA 4AYBN 2O9LA 2X6OA 5EEHA 2VQHA 3E6BA 1IV8A 1GDTA 3BG6A 1GT0C 4JX4A 2Q2EB 3D5RC 1U78A 1IO2A 2Y2ZA 2OCEA 1ON1A 4QWQA 3FX3A 4FETA 2FNAA 5HDNA 2MW8A 4XLAA 1V5EA 1KU3A 2E1OA 4RAZA 5FGMA 2MD0A 5GAGJ 4W97A 5HLIA 3GTJJ 5D5VB 2M9HA 3F8BA 4NUBA 3SZPA 2D1HA 4ZYEA 1OYYA 5EF6A 3E5UA 2DA3A 2W85A 3HG9A 2O61A 2H1KA 3SEZA 1I27A 3OYFA 3IWZA 2WY8Q 3CMMA 3HL2A 4IQJA 2QVOA 1DQUA 3ZQGA 4LG0A 2HVSA 2CQNA 1FIPA 5TRDA 4EV0A 4EATA 1DDNA 3BZKA 3EUHC 4MEXF 3O6BB 2QA4I 1FOYA 2R7SA 1K6YA 2LP0A 4IEJA 3C2HA 4NDLA 4AIKA 2E7XA 2XKPA 5HLTA 4Q5SF 1U6GA 4K2EA 3OMYA 5E20A 1O7LA 3K4CA 1MMNA 1D8JA 1W7PA 3ZPLA 2QQBA 1YE9A 4IVNA 2BV6A 1OYIA 1QGPA 3HSEA 3FWEA 4M74A 3KZIC 3TQNA 1JTYA 5TISC 3ZN1A 1YO5C 1PJRA 4CCNA 3K4JA 1FSEA 2DA1A 3J7YJ 2A6EF 3CC2I 2IS2A 2G0EA 3Q5FA 3K4BA 5K5QA 1ODDA 3CP2A 4OMYA 4XKVA 4IHVA 1I5ZA 3E5QA 1QPMA 1USSA 4KIFA 4YELA 1SFEA 2BVLA 3TKYA 3P5JA 1R4NB 1ZELA 4HSTA 2ZJ2A 1U5TB 2KZGA 4CZZA 1AKHB 1HC8A 3DF8A 3AFHA 4U0YA 3TMOA 2COMA 1IN7A 3CMAI 1WSUA 3CLQA 1ETXA 4U7BA 1IN4A 4JBAA 5F27A 1ETOA 2VJJA 1HKQA 1XSVA 1RC9A 3EPZA 4EJTA 1G4DA 2ZBKA 3HBLA 5EG0A 3VEPA 1LFBA 3K1MA 2OQGA 2UUZA 5HODA 1K7AA 3KP3A 4PJ0C 3BDDA 2KRCA 1HCRA 2A61A 1Z3XA 2LTPA 3QYFA 1D5VA 1XD7A 2Y75A 3F8MA 3BTJA 1U5TA 2O03A 4CZCA 3CC4I 2CG4A 3OYBA 2X51A 3M1EA 2IT0A 3QODA 5LBQA 3DPLC 3ZN0A 2L7ZA 2HQRA 3I59B 4A0ZA 3D5SC 3AG4H 3HKZN 2IA1A 2WB1N 4BS9A 3FKJA 1W5SA 1AOYA 5E1ZB 3AKZA 2MYSA 2V9PA 2FOKA 2XB0X 4XICA 1ZR2A 2F4IA 3HSRA 5EG0B 1MJ9A 3CCMI 1DP7P 2NVYJ 2XSJC 4BQQA 1Z6RA 2UXXA 3HRSA 4Q48A 2HVRA 1RPWA 1ETKA 4D7NA 4XK4A 2HOAA 3ZOBA 3CO7C 4U87A 3OYJA 4G94A 1G6NA 5DD4A 3H1CA 1BI3A 2ECBA 1SFUA 2RVCA 3GW2A 2GBYA 4S05A 2E34A 2FEZA 3H3VK 1X1CA 4D5CA 2R7UA 4P96A 3I5UA 1I3QJ 5F6FA 2PMUA 2VKEA 4IPAA 4HF2A 3BQYA 3OSGA 1VQKI 5CVUA 4EMSA 3JR9A 4G6QA 4M6XA 2VC1A 1Y56A 2IP2A 4M71A 3HGYA 3ZMUA 4F3QA 3I64A 4WXHA 5E3NA 4A3CJ 2AS5F 2JT1A 4CICA 2M0MA 4DBRA 2ICWG 2IS1A 2HZDA 2ZMEA 5LEJA 3V7RA 3KZZA 1NH3A 2GLOA 2DFEA 5BOXA 1UB9A 2H1LA 4JOMA 3S16J 5LHIA 5KAIC 1UJ8A 2E1NA 3VSLA 1Z1DA 2DBBA 2LNBA 1X58A 2FBHA 4G7OF 4ZYAA 2DFHA 3QP6A 5E8IA 5KCMA 5L3FA 1AKHA 1K83J 2XASA 2QKMB 3TEDA 4ZYGA 2LY1A 2HYJA 1K78A 2VN2A 4U0WA 1V54H 1KQ0A 3LMMA 4BNCA 2JMWA 5F0HA 4LIUA 1VQ6I 1ON2A 4E4HA 2NVUB 2HDDA 2MC3A 2QZ8A 3GX4X 3LWFA 2DA6A 4GO1A 3K4LA 3Q0UA 4IRHA 4M73A 2HZTA 1H9GA 1XSXA 2DMQA 2DPUA 1KQ8A 4M3DA 2LY9A 4A6EA 1QZEA 2UZKA 2DFIA 1C0WA 4BH9A 4IKFA 2EZIA 2BW3B 4XORA 1DPUA 4UHTA 1YJWI 4NB5A 2IGNA 2LREA 1IN6A 3TO6A 1FWZA 2K02A 2OV7A 4U0VA 4EQQA 2AQFA 5EEGA 5FKMA 5FRNA 4DNCA 1JXSA 2DTRA 4ABZA 1WJDA 4IRIA 2NRAC 5M3MJ 1FT9A 3HPHA 1ZAOA 3FMRA 3CJNA 1MDMB 1ITYA 2FQ3A 2CUFA 2WAEA 2XPVA 1W0TA 2K9LA 5DCMB 1IRFA 3ERED 1WWXA 5FFXA 4HPQA 3HOSA 3MD2A 2NNYA 1U9OA 4Y33A 2XGDA 3H35A 2WWYA 3JREA 3IV5A 1SFOJ 4P9UA 2DFFA 4JX6A 1AHDP 1QHGA 1ZLKA 1D0ZA 4BJ5C 1ZARA 1E3PA 3HJEA 2EILH 5E18F 2MH9A 1J59A 1IAWA 5CQEA 4QLCU 2VBZA 2F5CA 1WHUA 2X6XA 4GDFA 2DJNA 3BR0A 2M7AA 1Y1VJ 3BC8A 4I09A 1PP7U 1TWAJ 2VIXA 2VL8A 2K9MA 2ZXJA 1FX7A 4KN7X 2P81A 5ILVA 4M72A 3OY9A 1BW6A 4HLXA 1T95A 3CJTB 1ETYA 3DWLE 5M3FJ 4YRVA 1UHSA 1XGSA 3E0JB 1J7KA 2ZB9A 2KIFA 3CF2A 3B6AA 4UUSB 2JA6J 4S0HB 3LAJA 3BG9A 3IHUA 3CDLA 2YX7A 3HOYJ 4RS8A 3WTXC 4NC7A 2XSDC 2FRHA 3IRQA 1MGTA 1Y0UA 4MEYF 2X9DA 4BDYA 1AU7A 1R23A 2W57A 5D5UB 4IQ4A 1JKRC 4OOIA 3E6DA 3DKWA 4I76A 2F48A 3K0LA 2H6CA 1VQ4I 2EFPA 3CJQB 2XROA 4HNVA 3OOUA 2EV0A 3HTSB 3ELKA 4BXUA 5A2QK 5DS9A 1F5TA 1UG2A 3WTWC 4F52A 2YU3A 1HLVA 3RQ4A 2BXZA 3H5RA 3NQOA 3ZMZA 2CU7A 2IA2A 2A5YB 3ZQQA 1UZCA 2L5QA 1TL8A 4OAZA 2HQNA 1EKEA 3IAS2 1IXCA 2TDXA 2JUCA 3MWMA 4HX4A 1S72I 3LSKA 4II2A 1JI8A 1K79A 4I0AA 1VQ8I 3L09A 5LRRA 4HNUA 1P4WA 4HNTA 4M3BA 4FX4A 2PMZA 4E7JA 3SYTA 3RZOJ 3N05A 3L2WA 3CUOA 3QRFF 2NOGA 1YI2I 2DA4A 4MNUA 4V2FA 1XMAA 2MLKA 3OYEA 2CV2A 1KU7A 3J7AO 2KT0A 4N4NB 1W0UA 2RN7A 2HVQA 1W36D 4DGWB 2NOJB 3CP8A 3DCFA 3QOEA 3Q3SA 3FBNB 4E7IA 1UELB 5ILUA 3UKGA 3BCBA 5DCFA 5J1YA 3CCSI 2JSPA 2K4JA 4BQOA 1JKQC 2R7OA 3BJOA 4HOBA 1FIAA 5IOYA 1K4TA 2ZSHB 2HNHA 1R36A 2DLLA 3ZMDA 3I59A 4F7ZA 2KIMA 2ZJRF 1KONA 4ENKA 1RUOA 2PQ8A 3PNVA 3TP3A 3VYRB 2F2EA 3GLLA 2DYRH 3HHGA 4ON0A 5J4VA 2ZXHA 2G9WA 1IV6A 1FEXA 5E1WA 2L7FP 4KDPA 1RR8C 4HX8A 3KFWX 2R7DA 4MFEA 3S1MJ 3M8JA 3L2UA 5FLVA 4WXDA 3KYCB 2UV1A 3AL0B 1MH3A 3P9IA 4Y13A 2HDWA 3ASNH 3JSOA 4RB1A 2IXSA 1S7EA 3J80Z 2OD5A 1PDNC 4A3MJ 4HQMA 5GTHC 1NG6A 2VKDA 3DU5A 1LE8B 3Q0WA 1OLTA 2ZFUA 2KP6A 3F21A 1OCPA 1WH5A 2NS7A 4UUSA 4DZJA 2XGCA 3QAHA 5M5YJ 1J75A 4Y17A 3CDHA 4GXOA 5CVRA 2Z9OA 4A6DA 4XRMA 2M2EA 3TW7A 5LFAA 1SAUA 3KIOA 4C2TA 3S3NA 1E0EA 2OZUA 1YFHA 3I4PA 1RUNA 1IXSB 3HGGA 1VF9A 1BOAA 3I58A 3OIOA 3DBRB 3OS1A 2HFHA 1LDDA 2Z5UA 2BOLA 2Y48A 1YIOA 2V1DA 5FRMA 2LSOA 4CCLA 4A3GJ 1TW3A 1ZRFA 2GA1A 1J9IA 3BR2A 3SZGA 3LSGA 1SC7A 5M5XJ 1Z7LA 5FFZA 1V55H 2V9VA 2ISYA 2QBYB 3HSFA 4BXXJ 1FNNA 1HDPA 3TO9A 3W2VA 5HOOA 4RAFA 3FXLA 4AD9A 2WV1A 3FXQA 2L7MP 1B9NA 2IJLA 1VQ5I 1LEBA 1L0OC 3K4KA 2P8TA 5B5EC 4EM2A 2P5LC 4D5FA 3MEXA 2QQ9A 2DT5A 2CUZA 2NVTJ 5EEAA 2VJIA 1OJLA 3EDPA 2WBMA 4BHBA 4CDGA 4D7MA 5EDNA 3W2AA 4AIDA 4U88A 5IOZA 3KLOA 4BEHA 2OPTA 4FE7A 4ASNA 3OR1C 4WXCA 3B6CA 2QLZA 4DBQA 2VASA 2STWA 1X1BA 4C3JJ 4Y52J 5HNHA 1D3YA 3ZP5A 4RAGA 4G7ZF 4UUTA 1MMAA 1MSEC 4A3BJ 5K7FA 5ICGA 3FBIB 3SHFA 3A1YA 1QA6A 2VT2A 1N78A 2M8GX 4EGYA 3OL4A 1ZLJA 3QQAA 4LITA 5E3LA 3HOWJ 3D5LA 3OSFA 1FSHA 1R4MB 1WI3A 3E6CC 1LVAA 1STZA 2G7UA 2E2JJ 5GP9A 1TLHB 3V7SA 2PJRB 2R7TA 2KPMA 1RZ4A 2MG4A 3CCRI 4L0YB 4KYWA 5FJ8J 3KYLA 4ESJA 1Z3YA 2LDUA 3OS2A 4IHXA 3MCZA 4NQWB 1QO0D 1HXDA 3G1MA 1VQ7I 2LYCA 3DFGA 1HOMA 3OYMA 2F6CA 5DDGA 4B43A 1VQLI 1PVEA 4S04A 3MZYA 2CV1A 1H9TA 4IOCF 2K5CA 3HKZA 1O4XA 1WCMJ 5HLHA 4EJOA 1G3YA 1JJ8C 1HKSA 1Q1VA 5LHGA 4KIBA 2R5YA 2BBYA 1I1SA 2L7KA 3FK6A 1UFMA 1RESA 3EETA 3T0YA 1VQMI 1UAAA 4PJNA 5GAEJ 2JRTA 2QEXI 4RGSA 1P2FA 3K69A 1IRGA 2BZTA 4LLGF 3I55I 4XRFA 5BMZA 1R58A 5DM6F 1MH4A 1SD5A 4F92B 4L0ZB 2IEKA 4WK8F 2JUGA 3QOPA 1PUEE 2EIMH 4GYIA 2V26A 1QZZA 1TWCJ 2CW7A 4CYDA 1LPQA 1VNDA 4A93J 1MBHA 3F23A 2OTJI 3FM3A 4UB6C 1O3TA 3D1NI 2DQRA 4F91B 2KRHA 2QBYA 3SDGA 3GVAA 4PCQA 1ETVA 3CJRB 4IF4A 4JQFA 3O8HA 5H6RA 1CF7A 4MLOA 1JUSA 1OR7A 2L01A 3RI4A 2W7NA 2D5VA 1T38A 5FROA 2E1MC 5LGTA 1LEAA 1J09A 3CTAA 3K70D 4XSZF 1FPQA 2DA2A 4KN4X 4LK1F 4FX0A 2FU4A 1O3SA 1JUPA 1OCOH 3GUDA 2R0QC 1BC7C 3OYIA 4A3EJ 2K9QA 1GV5A 3K7AJ 3EUKL 4BQAA 1R5HA 2RGVA 2Z1DA 4PSXA 3G4SI 3H0GJ 2K3FA 3WGGA 5HLGA 2O7OA 4CYCA 3CCJI 4OIOF 2W24A 4OIRF 2ME0A 2A68F 2DODA 2YR2A 3HPGA 3HRTA 2E5NA 2FD5A 3DTEA 4IHYA 1FP1D 1Y1WJ 2B0LA 3TL4X 1LJ9A 2R7VA 5KVRA 3NWTA 1S5LC 4RDUA 4M9XA 3GTGJ 1LKXA 1EH6A 3G3ZA 4NHJA 3H9JA 2CGPA 3WE2A 2ACJA 2DAOA 3GFIA 2CO5A 4DJAA 1B8IB 2J5OA 3F6OA 3ZQCA 1P6RA 2IBDA 2WAQN 4QPQA 3RQIA 5IP7J 3RSNA 1VQNI 2FUG2 4ESFA 1I39A 3QPTA 2XVCA 4L9VA 4W1UA 1TT5B 3BTCA 1T6SA 4NQWA 1LFUP 2JA5J 1G3SA 3F8NA 3PUBA 5B1AH 1QPIA 1R00A 1JJ6C 2MFZA 1T98A 2IW5A 5EJCA 2XPUA 4E6KG 3KP7A 3U2RA 5HVQC 1XSDA 2MABA 4XSXF 3D0SA 3GZNB 2P6TA 1H88C 3C1DA 4DYRA 5EZGA 2R5YB 1GLNA 3WU0A 3S93A 2VONA 2BY2A 3J81K 2DOEA 5FB2A 3G1LA 2YX4A 3K10A 3R0AA 4TV7A 5D4SA 2Y0MA 2LF8A 4I6ZA 3FZVA 2FA5A 2M45A 2V1XA 4BUPA 1YG2A 3OIPA 2FMYA 2DJIA 1R6RA 2KRFA 4M6YA 5F04A 2K85A 4L5IA 4M3EA 3CCEI 3WHCA 5DUKA 4L18B 2DO7A 2ZFWA 3IAM2 5CJ9A 2L9VA 2XAJA 3NARA 2Y31A 3WGHA 2D45A 3ECOA 3RYRA 4X0GA 4DZPA 9ANTA 3LQQA 1ZREA 1EA3A 4LB5A 2W1OA 4WCGA 3EYIA 1I1GA 5D5XB 3WGIA 3UNGC 1KA8A 2XAQA 4A2UA 4E7SA 3OYGA 3CCVI 1BJAA 3V4GA 3S15J 3OOPA 5BNGA 2XV4S 3I3LA 2EA4A 5IT3A 4HAMA 3IH2A 2LD5A 2R4GA 3CMYA 2FSWA 3NRVA 3QPSA 2R7RA 1ZQ3P 2O8KA 4BY1J 4RLQA 3PM1A 2A6TA 5C4XJ 1N77A 4F55A 3BROA 3H9QA 3R4KA 1UHMA 5GADJ 1JUMA 5AIQA 2VKVA 4B47A 2EBIA 5FD6A 1R1VA 2OZ6A 2Q8KA 1MJBA 1P4AA 3CC7I 3MZHA 2GWRA 1JKPC 2LOOA 2H8RA 3BR3A 2E36A 1POGA 4V2GA 2JA8J 1A6QA 3TP0A 3A03A 2JJ7A 4ZDLA 1I6XA 5CVIA 1IUFA 2VKHA 2P6SA 3F6VA 4DYCA 3MFKA 2RQQA 3BTLA 2V9KA 5IY5H 1B6AA 1EH8A 1Z67A 2X6WA 3VYUB 3H9GA 5TJJA 3DEUA 1WJEA 1KZHA 1RRJA 3L9FA 4ETSA 1BR2A 5BPDA 1B8IA 1E17A 4OU0A 4Z6YA 1D1CA 1ENHA 4P5OA 1SVLA 3V8JA 1Y8QB 1MBGA 2DCEA 2HGCA 1QVUA 1J0RA 3TDZC 1R5ID 2EINH 2RNGA 3K1NA 3SXYA 2PI0A 1XB4A 4GCVA 4CUGA 2RQPA 1XG1A 5D8KB 3Q0VA 5F1JA 4YIRX 3G73A 4A3LJ 2HKXA 3LAPA 3HOUJ 2RC4A 2Y0SA 2CJJA 3GFJA 4KMUX 4YFKF 1ULYA 1JHHA 2IPQX 3H5NA 2HTSA 2PJRA 3U1KA 1VI0A 3F22A 2QQ8A 1GHCA 2E2IJ 4ZC3A 5LLQA 3QPHA 1SVOA 2LFBA 2ZSIB 4ENMA 1P7JA 3AG3H 3GTOJ 3WTTC 4OIPF 4I01A 2VB6A 3KLNA 4DW6A 1IC8A 4CCOA 4O6JA 4UXNA 1E2XA 3CESA 3ULQB 4R79A 1SFKA 3COAC 4A5NA 4XIDA 3GF2A 4XLNF 1OR7C 2H94A 2ZJQF 3M3YJ 1QU3A 1TTYA 1A04A 2XF7A 2EA2A 2QENA 1P4XA 4CCJA 2EV6A 3I53A 3FMQA 1CQTA 1B59A 4KT6A 2V79A 2CRGA 4PK4A 2R5ZB 5B1BH 4I7HA 2NNNA 1R49A 1FBSA 2K7LA 5J40A 1FZPB 4BU2A 3CCYA 1H0MA 2Q1ZB 1SD6A 2MLGA 4J19A 3E7LA 5GPAA 1NK3P 5J8CA 1IDYA 3JTGA 5KK1A 1H8AC 2XGXA 5F64A 2COBA 3VOEA 1TNTA 3W3CA 3TGNA 2WADA 3GCMA 3IKVA 5HS8A 2FBIA 2DXIA 5CPRB 3RPUD 3PFIA 5IYBJ 3OL3A 4HG2A 5H2FC 2JVGA 3OIQA 1IUYA 3EUAA 3J81Z 1R7JA 2XF6A 2ZNZA 4JP0A 4HF1A 3VWBA 4DQ2A 2XHKA 2X48A 4AYBA 5K7ZA 1HSJA 4XONA 2HEOA 3ZQHA 4YFNF 1W7PD 3W6JB 4MO7A 2DMUA 2I10A 1WZ2A 2OUMA 4WWCA 5IT9K 4GGGA 1Y39A 2P0WA 4XNFA 5ICFA 2M1BA 2PX9A 2XF5A 4XKCA 2X1CA 1IGNA 3BR6A 2BW3A 5C4JJ 1QBJA 3BR1A 3FXUA 3DTKA 4MQ9F 2LH9A 2LRDA 3LSMA 2A6HF 3ZCOA 4EVIA 3GWZA 3CDIA 1S9HA 4XM3A 5JVTA 4Z2YA 2XAHA 3I9V2 3JRDA 3LSTA 4A3DJ 1XGNA 2DU9A 1KYWA 3PSIA 1LDJA 3LNQA 5J8FA 1MDMA 4I02A 1FJLA 3KYDB 2DI3A 3LFUA 1Z9CA 2CQQA 3PNYA 4HW0A 4B1RA 2WY7Q 1WGXA 2KKOA 2MC4A 1RKWA 1V4RA 3VODA 1ETWA 4B44A 3PJRA 2KIQA 1ZG1A 4JK1X 3WU1B 4HZFA 2AQEA 3KCCA 3KEOA 3F8CA 4L5EA 3RTRA 1M1EB 1HW1A 4ZH4F 2P4WA 3CD6I 4BAYA 4M9SA 4EM0B 5LGNA 2ESHA 3PIPF 2W84A 4XOTA 4RAYA 3IC7A 1MKMA 4Y15A 1MMSA 4ZJZA 1T2KA 4HLYA 2X0LA 1OISA 3CUQC 2EPFA 2WAQA 4O3MA 4CO8A 3M4OJ 3GTKJ 4ZTJA 1FP2A 3U21A 1IZ1A 3W6VA 2E35A 4FISA 4V19K 3K2ZA 4FASD 1P7IA 1ZGJA 1U2WA 2BXYA 4HDUA 1TP4A 3PO3J 2M3AA 3FK7A 3PIOF 5M5WJ 4BQNA 4WX9A 2ECCA 2HWVA 1HW2A 4XLFA 4BE2A 2CW8A 2IGOA 2VLAA 3L2CA 3ZR8X 4KUMA 1OQYA 3G6EI 3IP4B 2L4MA 2LVSA 2X1EA 3SQNA 1OPCA 2LKSA 1ZTRA 2PLYA 2XIGA 4LLLA 1MBJA 4OINF 1ZK8A 2Y9ZA 1XS9A 2L0KA 1YYVA 3SDBA 4XN0A 4JX5A 2FOWA 3KPHA 3A02A 4QSHA 5H6QA 5HDGA 2VE8A 4HF0A 3IKTA 1FMWA 3AAFA 4AVZA 5E3MA 4PGHA 5F1RA 4MQVA 1X3ZB 3RKQA 4MFDA 3X2QH 1WJFA 4UY8I 1ZN2A 5JHUA 1U8RA 1MMDA 2XDVA 4IZZA 3F3XA 3DPTA 3LSPA 3CO6C 5D6FA 1H89C 4LK0F 2GXBA 2GZWA 4E7ZA 4A0XA 4FQGA 1ZGAA 3QP5A 1XGOA 5FKNA 4BBSJ 3GTPJ 1X2MA 1HF0A 4CCKA 1IRXA 2BE5F 2R3SA 5J6XA 5JHFA 3ZQ7A 1TNSA 3WTZA 3LSIA 2NYXA 3LOCA 3OYLA 2EIKH 2MH2A 5LGUA 4B09A 3KP6A 1BJZA 2GA2A 1S7AA 3GZ6A 3P9KA 3N4MA 2ZXIA 1NHAA 4HX7A 1DU6A 2LG4A 1YOVB 5FD5A 2ME6A 1FMVA 2DYSH 2LK2A 4G8XA 5J1RA 2CWEA 3VPRA 3QWLA 2EZHA 2L9NA 1FYLA 2R7FA 2QWWA 3J7AY 1JHFA 2VPLA 3OYHA 2KDOA 1R1TA 4PGGA 3DBHB 3S3MA 4G6DA 4Y7NJ 5AONA 5FKOA 4MTEA 1HBXG 2K3PA 4UV9A 4CH7A 3SJMA 3KP2A 1S29A 3FIWA 2FE3A 4I98B 2HPMA 4KMFA 3PUFA 3ERMA 5ED4A 5FKLA 1KU9A 2JVHA 3JTHA 3FXMA 3JSPA 1A36A 3RJPA 3HOVJ 2VOPA 4M3FA 3N97A 3FMSA 4ENNA 1G3TA 1TT0A 2D2WA 1B1BA 1G3WA 4XOPA 2DMTA 2HPIA 2W25A 1UG0A 2PBIA 3JAMK 2F4OB 2PJPA 2FXAA 5B66C 3M07A 5C44J 2GOMA 3F0CA 1RIOH 4KJZA 2XAGA 3BT9A 1X1AA 3H3UA 2LLKA 5JLXA 4YG2F 1K4SA 3BCAA 4PZJA 2QCOA 2Y30A 1XMXA 2EFNA 4IHWA 4NBQA 4LLNA 2ETHA 1L3LA 4CA0A 3H3ZA 3K2AA 3CQZJ 1K78B 2XGEA 1YRNA 2OBPA 3GEZA 3E1SA 2O6GE 4HYEA 3HEFA 1B72B 2GXAA 2EWNA 3ZXSA 4J00A 1W1WE 1RR7A 1F43A 5DTDA 4LJZF 4EJVA 5B3SH 3DBLB 1Z91A 1FOKA 5CVJA 3S14J 5HNFA 3H0DA 1EF4A 3BQZA 1YS6A 3GO5A 4N9IA 5LRSA 1T39A 3A4CA 3OYDA 2QQAA 3C2GA 2LR8A 1T0FC 2P5KA 3OS0A 2DOFA 4XKBA 4BL0B 5L3GA 4B4CA 1R5GA 4BJTA 2R7XA 3L2QA 3OYNA 3MVPA 4XLEA 2H27A 1BIBA 2CS3A 3HHHA 4AIHA 1FBUA 1QQIA 2O8XA 5F0CA 1GV2A 4FHTA 3EQLF 2ZNYA 1B72A 3T8RA 4G7HF 4KITB 4NC8A 2JPBA 3FHNA 2CFOA 4PFPA 3WTSC 2FJ1A 2X4HA 2X1DA 1UMQA 3R0JA 2HXOA 4PJLA 5J47A 2ZMEC 3HIFA 4HDVA 4L9JA 2NAZA 3GFMA 4D0PA 5BQTA 1QNTA 4XQFA 4OIQF 3WU2C 1R71A 2O5RA 2GOXB 2KJBA 3ONQA 3OWTA 1ETQA 1D1BA 2EB7A 1SVMA 3LSJA 5E3OA 2M87A 3PNTA 3GMEA 2XC7A 1BA5A 1F4KA 1UHWA 1CF7B 2Y9YA 4ZYDA 1HDDC 2DT7B 2YS9A 4FE4A 3F72A 2F5DA 1A31A 4A3KJ 4OWRB 2Z3YA 2EQRA 1WH7A 3L7WA 3GLXA 1VQ9I 1P92A 5IP6A 3FXJA 2CW0F 2E1CA 2K9SA 1MBEA 6PAXA 2JRMA 5JFRA 3RPUA 2R5ZA 3ABKH 2B7EA 4M6VA 1LNWA 2ID6A 4JYKA 2JTVA 4WF2A 2LBFA 3M1CA 2BY1A 1FLIA 2KZVA 5J1UA 2XUBA 3EYYA 2FMLA 4BYYA 2P7CB 4RM3A 5E8GA 1PUFA 2G7HA 3HRUA 1IDZA 5JVGF 4O5VA 4A3JJ 1F36A 3CCUI 2KQRA 2DK8A 2P7VB 4Y4RA 1MMGA 2KIUA 2GAUA 1Z6TA 2MSYA 1SEUA 1YW8A 2M0CA 2BYVE 2X6YA 5DD8A 3KP4A 4LGWA 5L3DA 2KL4A 3T8TA 4AUXA 1R1UA 2HQ5A 1BW5A 3TO7A 4LG0B 3GBGA 1DP3A 1MBKA 2GIVA 5DCMA 3G71I 1GVJA 2JK3A 3VFZA 1A5JA 1JT0A 2K40A 2L54A 4U7DA 4LD5A 2R92J 5JR3A 2K9NA 2OC6A 2BY0A 1RNLA 3ZMVA 3LFKA 5D5WB 2W00A 4KIGA 1G59A 2PMHA 4A5MA 1S6LA 4YFXF 2R93J 2GM4A 1REPC 3LSHA 5GAHJ 4UUVA 1Z7UA 1FYMA 2PMZN 2BHZA 1HKTA 1F1ZA 1YJNI 5D6EA 4L9NA 5E79C 5DUIA 3I0TA 1NK2P 1OFCX 2L2OA 2YPRA 3O8GA 3LL7A 1DPRA 1QRYA 2GQQA 2M30A 2A07F 4E7KA 1VQPI 4KNYA 1XCVA 4N4OB 4PJMA 2VODA 1OCRH 3ROUA 3CMEI 2DMPA 3U1DA 2KHMA 4BE0A 1LB2A 4IOAF 4LMYA 1IW7F 4RGRA 1XX5A 3BTIA 2EFQA 4XMYA 2KMUA 4FCYA 2AXLA 3ZQIA 1IG7A 2QM3A 3P9CA 3CUQB 2BGCA 1AA7A 1BI2A 2XRLA 1HA8A 1GXPA 4LOCA 4IO9F 1LVKA 1TQPA 1BI0A 1JT6A 2TCTA 1BI1A 2ZXWH 4ITVA 4RGXA 1PP8F 1ZH5A 4RMNA 3WODF 2L4AA 2FNPA 1XN7A 1OCCH 3MN2A 2HQAA 2TRTA 3WTYC 3I4NJ 5K5RA 3WG7H 2ZCWA 2EK5A 3BLYA 3RKXA 4IHSA 5F0FA 3RYPA 4XL9A 3SFIA 2VBYA 2HYGD 4PJJA 1XPXA 2PN6A 4AWXB 2M4KA 2XB5A 1IRZA 4BJ6C 2Z33A 5EZHA 4I2OA 3OYKA 2VPRA 4EGZA 3SFZA 4IRGA 3J7ZI 2Y69H 4LG3A 2D1VA 1SFXA 4HA8A 4ESBA 3R6SA 1A6IA 1W36C 4CHUA 3ZMSA 4M9ZA 2M5WA 3QU6A 1ONVA 4XBFA 1BM9A 1X1PA 5IPAA 1BOBA 1R22A 3K9TA 4PDKA 1I3AA 3VDXA 1G2HA 1X4OA 4G6TB 2QKLB 3JRHA 2IAIA 2OJED 2Z16A 3DKYA 4B3AA 3A01A 1PUFB 1Z05A 2HDCA 5K1YA 2IGMA 4DIQA 4UVCA 2PEXA 1W7PB 4ZZDA 1FTTA 3MKYB 5AIPA 1YHQI 4XRSG 1E3OC 4L9TA 1I50J 3JRGA 4ZYHA 2O3FA 2R7WA 2VQGA 3DKXA 3HTUA 1V3FA 4RM2A 4C9YA 1UCRA 4LIVA 3V42A 3FXOA 1MNMC 3DV8A 5D8LB 1FC3A 2L02A 1U8BA 4ANJA 2FX0A 2P5VA 4D9JA 4UVAA 3S2HJ 4X6AJ 2HOTA 3JRCA 3S17J 3GTLJ 3K4NA 3AG2H 3REOA 3PO2J 1ZYRF 3S1RJ 2QSFX 1IN5A 3QPLA 2M34A 1NTCA 4C3IJ 2JQ7A 2YSRA 5J4YA 1MJAA 2EH3A 4BHCA 2VE9A 1RKTA 1LQ1A 3GTMJ 1X1DA 4ZDOA 1V5GA 3LA2A 1WVRA 2CYYA 3E97A 1U9NA 3CZ6A 3S32A 2L3DA 3ZQFA 1BIAA 3ESWB 2HKOA 4KICA 2V1NA 2IA0A 3RCOA 1DGWY 2Q0OA 1MIJA 2QUFA 3I4MJ 3ISPA 3KX2A 1X4PA 3AG1H 3A2KA 2LF7A 2IVMA 2V6EA 3BPVA 3ABTA 3WHBA 2VOOA 3CF5F 1BC8C 3BR5A 4Q4ZF 3OYAA 2EV5A 2I5UA 2WAFA 3BPXA 3K70C 1N25A 2CQ7A 1XMKA 5HDKA 2PFBA 4XKWA 3E6MA 2ADUA 4GRIA 1XDUA 3C3WA 3ABMH 1D8KA 4A0YA 3JRIA 3G2BA 5J3LA 2NVQJ 2VI6A 4UB8C 2GIZA 3O2PE 3BJAA 3DTIA 2DPDA 4Y3OA 3GYHX 2KLOA 2E60A 3OV8A 2OQRA 3GTQJ 3DEWA 2WTEA 2B9SA 2UXNA 1U5TC 1WJCA 2CUJA 3TDUC 1KYZA 3H5AA 4CGZA 2WC2A 1RETA 2OTLI 4ZZLA 5ICCA 3HB9A 3F9KA 1QVTA 2K86A 3CCLI 5LEKA 5BS6A 3MQ0A 4XR6A 5BPIA 2ISZA 1JE8A 4H0EA 2NS8A 4N0BA 4RBOA 1J2XA 2Z2SB 1WPKA 4BDZA 1XC5A 3FF5A 5A2QZ 2FQ4A 2E5ZA 2BVMA 2H8WA 3RIRA 4YIFA 2CH0A 3MZ8A 4BGDA 3RZDJ 3NAUA 2L9RA 5ILSA 4AVPA 3K1PA 1WI9A 1YW9A 2X85A 1DU0A 1YRNB 1OMIA 1BR1A 2OAZA 4UV8A 4IL6C 1WRJA 2XAFA 5IT9Z 4BEHB 2DW4A 5FLMJ 2HOEA 1OCTC 5KAFC 1XTAA 1XDSA 3MKZA 1MNEA 2DDBA 3HZJA 2HXIA 2JSCA 2ZMEB 1O3QA 2DTZA 4IHTA 4RGUA 1YQAA 5CLSA 5L3EA 3FXKA 3VSKA 1YX5A 3AL0C 3LQRA 1K61A 1YIJI 2ZJPF 2DT6A 4M3GA 3TOBA 3QU3A 1I6HJ 4EJWA 2R7QA 1O57A 2KISA 2EZKA 2HR3A 1P9QC 4B3XA 1HQCA 5LHHA 2YU9J 2R7ZJ 3BG5A 2F5VA 1KGSA 2DK5A 1YLFA 2MBFA 1MW7A 1SMYF 1IXRC 5K7HA 2V1UA 2FBKA 4RB3C 2BHYA 2XKOA 4E70A 2N8GA 1TWGJ 4H4KC 3HOTA 1WKMA 2ELHA 3G1OA 3GZ5A 5FKKA 2Y0SN 2EFWA 2A3SA 1SD4A 3RDIA 4QTRA 2XPWA 4MIMA 1N75A 1JKOC 1IN8A 3R61A 4HSRA 1O3RA 4EEFG 4KISA 4C2UA 3HDDA 1J5YA 3ZRGA 3V7CA 2CFXA 3CCQI 1U3EM 2VXZA 2F5EA 3WTVC 1MSFC 1ORKA 4RLFA 5DM7F 2AO9A 4E7LA 2VT3A 3HRMA 2QYOA 4OAYA 2DA5A 1BN5A 1W5TA 3P7NA 3CLOA 3S2DJ 3PQJA 2RNJA 2W82A 2M8EA 4BY7J 3VYTB 2L9SA 3IUOA 1O7FA 2ESNA 2C6YA 4AC0A 1WJ5A 4AM3A 1TC3C 3BZCA 3C2BA 2LBFB 1TBXA 3L1PA 2HS5A 1YS7A 2LY2A 3S8PA 2Z99A 1T33A 3DU6A 5JLWA 3GFLA 2DQLA 1T8IA 2VQCA 1D1AA 4C3HJ 3M8FA 2CUEA 3NEUA 1FY7A 2AXTC 5TGTA 4KT5C 2EZLA 4ZTFA 4G12A 2IRFG 2HYFA 1FTZA 3WTUC 2NVXJ 1Z77A 3TOAA 1JGSA 3JAMZ 5KHDA 2MGQA 5FO5A 2NXNB 1ERDA 1ZG3A 5HS9A 2B63J 2H09A 3UR3C 3M8EA 4B8XA 1MNDA 1W5CC 3DXJF 1T56A 1HSTA 5EGOA 5GTIC 3PSFA 3S1NJ 3T1BA 1QZYA 3Q9SA 1FBQA 2JZYA 1B9MA 3KETA 3DEEA 3SEQA 3A01B 5FLXZ 3A0HC 3C7JA 1RI7A 2RAEA 4MGRA 3IH4A 2V4JC 3QYBA 5K5OA 1T0FA 3VB2A 2A5WA 2BEOA 2KJCA 3C18A 4RB2C 4IJAA 2E1MB 2M4GA 3B73A 3V8KA 2UWMA 1SANA 1MBFA 1X2NA 4NC6A 3FHZA 1TZLA 3ABUA 3HXLA 4X1EA 2HOSA 3PFYA 1S8NA 2VQLA 1YTYA 3ZMTA 4R1HA 1ZKGA 4NNJA 1ZRDA 4GFBA 2ELKA 4KA4A 4XN3A 5E17F 1XGMA 1TW2A 3M9AA 4I99C 2E2HJ 1Y0NA 4GYGA 5DYMA 4AIJA 1SMTA 2VBXA 1SD7A 4C30A 5FLXK 3KEQA 1DUXC
chains in the Genus database with same CATH topology
1ETQA 1TWFJ 5F04A 3LSJA 4M3EA 2EZIA 5E3OA 3WHCA 1BA5A 1ZR4A 3NARA 5FKMA 2Y31A 2Y9YA 1HDDC 2YS9A 4FE4A 4ABZA 4DZPA 9ANTA 2DA7A 4A3KJ 2EQRA 5M3MJ 1WH7A 2HI3A 5IP6A 1ITYA 3JRAA 2KDZA 2CUFA 2K9SA 2XPVA 1W0TA 3S15J 1JTXA 1MBEA 5BNGA 2R5ZA 3IH2A 3TW6A 2LD5A 3CMYA 4M6VA 2ID6A 3QPSA 4JYKA 4A69C 1ZQ3P 1U9OA 2O8KA 2XGDA 4BY1J 5J1UA 3JREA 3IV5A 1SFOJ 3PM1A 1VFCA 5C4XJ 4A3FJ 4JX6A 1AHDP 2VUMJ 5EYRA 1PUFA 1IDZA 1JUMA 4A3JJ 2CQXA 1F36A 2VKVA 2DN0A 1D5YA 2EBIA 4CYCB 1JKPC 2H8RA 2MSYA 3BR3A 4V2GA 1POGA 2JA8J 2M0CA 3TP0A 2DJNA 3A03A 2JJ7A 3BR0A 1Y1VJ 1IUFA 4AUXA 2HQ5A 1TWAJ 1BW5A 2JN6A 4DYCA 3BTLA 3GBGA 1MBKA 4A3IJ 2JK3A 2OF7A 2P81A 1JT0A 2K40A 1A5JA 1JGGA 1BW6A 1ETYA 2YUSA 2R92J 5M3FJ 2K9NA 1Z0XA 1UHSA 1B8IA 4UUSB 2ZB9A 3B6AA 3FISA 2JA6J 4S0HB 1ENHA 4BKXA 3BG9A 1MBGA 3CDLA 2GM4A 1QVUA 2R93J 3HOYJ 2XSDC 1LE8A 2PMZN 3FKIJ 2X9DA 1TWHJ 4BBRJ 5EGOB 1AU7A 1JKRC 4FTHA 4I76A 1XG1A 5IP9J 3ZQLA 1NK2P 1OFCX 3O8GA 4A3LJ 3Q0VA 5F1JA 1QRYA 3HOUJ 4XRSA 4HNVA 1R9TJ 2CJJA 3OOUA 5IYCJ 5F08A 5DS9A 1UG2A 2DMPA 1IJWC 1VI0A 1HLVA 2QF7A 3BTIA 3HM5A 2E2IJ 2CU7A 4FCYA 3ZQIA 1IG7A 2LFBA 5C3EJ 1P7JA 3GTOJ 2XRLA 3HOXJ 4DW6A 4LOCA 1IC8A 1BL0A 1JT6A 2TCTA 4XIDA 3M3YJ 4C2MJ 4M3BA 3RZOJ 2NOGA 2DA4A 4V2FA 3MN2A 2TRTA 3I4NJ 1CQTA 2JA7J 2KT0A 5F0FA 3SFIA 2CRGA 1W0UA 2R5ZB 3HOZJ 3BG3A 1IRZA 2XB5A 5EZHA 3DCFA 3Q3SA 5GPCA 3CCYA 2VPRA 3MKLA 3UKGA 5J1YA 4J19A 3E7LA 2W48A 5GPAA 1A6IA 1NK3P 1IDYA 1JKQC 1H8AC 1FIAA 5IOYA 2COBA 4QIWN 5IPAA 1G2HA 3JRHA 2IAIA 3A01A 4B3AA 3TP3A 1PUFB 2E19A 3IH3A 1IV6A 1FEXA 2L7FP 5IYBJ 1FTTA 4XRSG 1E3OC 3S1MJ 4MFEA 1APLC 5IYDJ 3LSRA 5FLVA 4JP0A 1I50J 3JRGA 2DMNA 1ZGWA 2X48A 5K7ZA 1MH3A 3ZQHA 1GUUA 2LKXA 4MO7A 1S7EA 2DMUA 2I10A 1MNMC 4A3MJ 1U8BA 2FX0A 3S2HJ 4X6AJ 1LE8B 3Q0WA 2HOTA 1GVDA 1OCPA 2AHQA 1WH5A 2NS7A 3JRCA 3GTLJ 3S17J 4UUSA 4DZJA 3BR6A 2XGCA 5C4JJ 1IGNA 5M5YJ 3BR1A 3S1RJ 3PO2J 3QPLA 4XRMA 2M34A 1NTCA 2JWTA 4C3IJ 3JRFA 2M2EA 3TW7A 4DYQA 2EH3A 1RKTA 3GTMJ 3JRDA 4A3DJ 3HGGA 3LNQA 1VF9A 1U9NA 3OIOA 3S1QJ 3ZQFA 3JRBA 2ID3A 4AYBN 1FJLA 2O9LA 3I4MJ 2X6OA 2CQQA 4B1RA 1GDTA 4A3GJ 1WGXA 1GT0C 4JX4A 1U78A 3BR2A 1RKWA 2Y2ZA 1ETWA 3LSGA 5M5XJ 3WHBA 4BXXJ 1HDPA 3BR5A 2MW8A 2E1OA 4L5EA 2WV1A 4W97A 3GTJJ 2M9HA 2L7MP 5EF6A 2DA3A 4D5FA 2H1KA 3ZQGA 3JRIA 5J3LA 2NVTJ 2VI6A 5EEAA 2NVQJ 1OJLA 1FIPA 4D7MA 3M4OJ 3GTKJ 5EDNA 3W6VA 5IOZA 2LP0A 4FISA 3GTQJ 2OPTA 3DEWA 1P7IA 4FE7A 4IEJA 4NDLA 3B6CA 1RETA 4C3JJ 3PO3J 3HB9A 4Y52J 1QVTA 3FK7A 5M5WJ 4UUTA 2ECCA 1MSEC 2NS8A 4RBOA 4A3BJ 5K7FA 1WPKA 1XC5A 2LVSA 2FQ4A 1ZTRA 2M8GX 1MBJA 1JTYA 1ZK8A 2Y9ZA 1XS9A 2L0KA 5E3LA 3QQAA 3HOWJ 3RZDJ 3NAUA 3OSFA 4JX5A 2DA1A 2L9RA 3A02A 1WI3A 4QSHA 1DU0A 1YRNB 2G0EA 2E2JJ 5GP9A 5E3MA 4IHVA 2MG4A 5FJ8J 5FLMJ 1OCTC 4IHXA 3RKQA 4MFDA 3G1MA 1HOMA 1H89C 3LSPA 2HXIA 1AKHB 2DTZA 5FKNA 4BBSJ 3GTPJ 1X2MA 1O4XA 1HF0A 1ETXA 1WCMJ 1K61A 5F27A 1ETOA 4M3GA 1I6HJ 1JJ8C 1Q1VA 2R5YA 3LOCA 2EZKA 2YU9J 3FK6A 2R7ZJ 1BJZA 3BG5A 3HBLA 5EG0A 1RESA 1LFBA 5HODA 5K7HA 1DU6A 1HCRA 2ME6A 2LK2A 2LTPA 5J1RA 3VPRA 1MH4A 2N8GA 1TWGJ 2EZHA 3G1OA 3BTJA 2IEKA 5FKKA 2Y0SN 1TWCJ 4A93J 1VNDA 1MBHA 4QTRA 2XPWA 4MIMA 4Y7NJ 1JKOC 3D1NI 5FKOA 4EEFG 2L7ZA 3HDDA 3SJMA 3HKZN 2WB1N 3FIWA 3SDGA 1ETVA 3O8HA 1MSFC 5FKLA 1ORKA 2XB0X 1JUSA 4MLOA 4XICA 1ZR2A 5EG0B 2D5VA 2AO9A 2NVYJ 3HOVJ 4M3FA 2DA5A 1RPWA 1ETKA 2DA2A 4XK4A 2HOAA 3ZOBA 4D7NA 3S2DJ 1JUPA 4BY7J 2DMTA 2R0QC 2ECBA 4A3EJ 2GBYA 2K9QA 1GV5A 3K7AJ 4AC0A 3H3VK 1TC3C 5C44J 3C2BA 4D5CA 3H0GJ 4CYCA 3F0CA 2O7OA 3L1PA 2ME0A 3BT9A 2LLKA 5JLXA 1I3QJ 2QCOA 1T33A 2Y30A 5JLWA 2VKEA 2FD5A 4IHWA 3BQYA 4C3HJ 4IHYA 3OSGA 2CUEA 1Y1WJ 3K2AA 3CQZJ 2XGEA 3JR9A 1YRNA 4RDUA 2EZLA 4G12A 3HGYA 3HEFA 1B72B 3GTGJ 1FTZA 2NVXJ 1Z77A 5E3NA 4A3CJ 2MGQA 1B8IB 1RR7A 2B63J 1F43A 5DTDA 3ZQCA 2IBDA 2WAQN 3RQIA 5IP7J 3S14J 2GLOA 1EF4A 3BQZA 4W1UA 3S16J 1T56A 5EGOA 3S1NJ 3BTCA 2LR8A 1LFUP 1X58A 4B4CA 3A01B 2JA5J 1AKHA 2RAEA 1K83J 3IH4A 1QPIA 1JJ6C 3MVPA 3TEDA 2HYJA 2XPUA 5F0CA 1GV2A 1SANA 1MBFA 1X2NA 1B72A 2JMWA 5F0HA 4X1EA 1H88C 2HOSA 4DYRA 1ZKGA 2FJ1A 2HDDA 4GFBA 1UMQA 2ELKA 5EZGA 2R5YB 2HXOA 2DA6A 2E2HJ 3Q0UA 3G1LA 2DMQA 4M3DA 4I6ZA 2LY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETQ A;  1TWF J;  5F04 A;  3LSJ A;  4M3E A;  2EZI A;  5E3O A;  3WHC A;  1BA5 A;  1ZR4 A;  3NAR A;  5FKM A;  2Y31 A;  2Y9Y A;  1HDD C;  2YS9 A;  4FE4 A;  4ABZ A;  4DZP A;  9ANT A;  2DA7 A;  4A3K J;  2EQR A;  5M3M J;  1WH7 A;  2HI3 A;  5IP6 A;  1ITY A;  3JRA A;  2KDZ A;  2CUF A;  2K9S A;  2XPV A;  1W0T A;  3S15 J;  1JTX A;  1MBE A;  5BNG A;  2R5Z A;  3IH2 A;  3TW6 A;  2LD5 A;  3CMY A;  4M6V A;  2ID6 A;  3QPS A;  4JYK A;  4A69 C;  1ZQ3 P;  1U9O A;  2O8K A;  2XGD A;  4BY1 J;  5J1U A;  3JRE A;  3IV5 A;  1SFO J;  3PM1 A;  1VFC A;  5C4X J;  4A3F J;  4JX6 A;  1AHD P;  2VUM J;  5EYR A;  1PUF A;  1IDZ A;  1JUM A;  4A3J J;  2CQX A;  1F36 A;  2VKV A;  2DN0 A;  1D5Y A;  2EBI A;  4CYC B;  1JKP C;  2H8R A;  2MSY A;  3BR3 A;  4V2G A;  1POG A;  2JA8 J;  2M0C A;  3TP0 A;  2DJN A;  3A03 A;  2JJ7 A;  3BR0 A;  1Y1V J;  1IUF A;  4AUX A;  2HQ5 A;  1TWA J;  1BW5 A;  2JN6 A;  4DYC A;  3BTL A;  3GBG A;  1MBK A;  4A3I J;  2JK3 A;  2OF7 A;  2P81 A;  1JT0 A;  2K40 A;  1A5J A;  1JGG A;  1BW6 A;  1ETY A;  2YUS A;  2R92 J;  5M3F J;  2K9N A;  1Z0X A;  1UHS A;  1B8I A;  4UUS B;  2ZB9 A;  3B6A A;  3FIS A;  2JA6 J;  4S0H B;  1ENH A;  4BKX A;  3BG9 A;  1MBG A;  3CDL A;  2GM4 A;  1QVU A;  2R93 J;  3HOY J;  2XSD C;  1LE8 A;  2PMZ N;  3FKI J;  2X9D A;  1TWH J;  4BBR J;  5EGO B;  1AU7 A;  1JKR C;  4FTH A;  4I76 A;  1XG1 A;  5IP9 J;  3ZQL A;  1NK2 P;  1OFC X;  3O8G A;  4A3L J;  3Q0V A;  5F1J A;  1QRY A;  3HOU J;  4XRS A;  4HNV A;  1R9T J;  2CJJ A;  3OOU A;  5IYC J;  5F08 A;  5DS9 A;  1UG2 A;  2DMP A;  1IJW C;  1VI0 A;  1HLV A;  2QF7 A;  3BTI A;  3HM5 A;  2E2I J;  2CU7 A;  4FCY A;  3ZQI A;  1IG7 A;  2LFB A;  5C3E J;  1P7J A;  3GTO J;  2XRL A;  3HOX J;  4DW6 A;  4LOC A;  1IC8 A;  1BL0 A;  1JT6 A;  2TCT A;  4XID A;  3M3Y J;  4C2M J;  4M3B A;  3RZO J;  2NOG A;  2DA4 A;  4V2F A;  3MN2 A;  2TRT A;  3I4N J;  1CQT A;  2JA7 J;  2KT0 A;  5F0F A;  3SFI A;  2CRG A;  1W0U A;  2R5Z B;  3HOZ J;  3BG3 A;  1IRZ A;  2XB5 A;  5EZH A;  3DCF A;  3Q3S A;  5GPC A;  3CCY A;  2VPR A;  3MKL A;  3UKG A;  5J1Y A;  4J19 A;  3E7L A;  2W48 A;  5GPA A;  1A6I A;  1NK3 P;  1IDY A;  1JKQ C;  1H8A C;  1FIA A;  5IOY A;  2COB A;  4QIW N;  5IPA A;  1G2H A;  3JRH A;  2IAI A;  3A01 A;  4B3A A;  3TP3 A;  1PUF B;  2E19 A;  3IH3 A;  1IV6 A;  1FEX A;  2L7F P;  5IYB J;  1FTT A;  4XRS G;  1E3O C;  3S1M J;  4MFE A;  1APL C;  5IYD J;  3LSR A;  5FLV A;  4JP0 A;  1I50 J;  3JRG A;  2DMN A;  1ZGW A;  2X48 A;  5K7Z A;  1MH3 A;  3ZQH A;  1GUU A;  2LKX A;  4MO7 A;  1S7E A;  2DMU A;  2I10 A;  1MNM C;  4A3M J;  1U8B A;  2FX0 A;  3S2H J;  4X6A J;  1LE8 B;  3Q0W A;  2HOT A;  1GVD A;  1OCP A;  2AHQ A;  1WH5 A;  2NS7 A;  3JRC A;  3GTL J;  3S17 J;  4UUS A;  4DZJ A;  3BR6 A;  2XGC A;  5C4J J;  1IGN A;  5M5Y J;  3BR1 A;  3S1R J;  3PO2 J;  3QPL A;  4XRM A;  2M34 A;  1NTC A;  2JWT A;  4C3I J;  3JRF A;  2M2E A;  3TW7 A;  4DYQ A;  2EH3 A;  1RKT A;  3GTM J;  3JRD A;  4A3D J;  3HGG A;  3LNQ A;  1VF9 A;  1U9N A;  3OIO A;  3S1Q J;  3ZQF A;  3JRB A;  2ID3 A;  4AYB N;  1FJL A;  2O9L A;  3I4M J;  2X6O A;  2CQQ A;  4B1R A;  1GDT A;  4A3G J;  1WGX A;  1GT0 C;  4JX4 A;  1U78 A;  3BR2 A;  1RKW A;  2Y2Z A;  1ETW A;  3LSG A;  5M5X J;  3WHB A;  4BXX J;  1HDP A;  3BR5 A;  2MW8 A;  2E1O A;  4L5E A;  2WV1 A;  4W97 A;  3GTJ J;  2M9H A;  2L7M P;  5EF6 A;  2DA3 A;  4D5F A;  2H1K A;  3ZQG A;  3JRI A;  5J3L A;  2NVT J;  2VI6 A;  5EEA A;  2NVQ J;  1OJL A;  1FIP A;  4D7M A;  3M4O J;  3GTK J;  5EDN A;  3W6V A;  5IOZ A;  2LP0 A;  4FIS A;  3GTQ J;  2OPT A;  3DEW A;  1P7I A;  4FE7 A;  4IEJ A;  4NDL A;  3B6C A;  1RET A;  4C3J J;  3PO3 J;  3HB9 A;  4Y52 J;  1QVT A;  3FK7 A;  5M5W J;  4UUT A;  2ECC A;  1MSE C;  2NS8 A;  4RBO A;  4A3B J;  5K7F A;  1WPK A;  1XC5 A;  2LVS A;  2FQ4 A;  1ZTR A;  2M8G X;  1MBJ A;  1JTY A;  1ZK8 A;  2Y9Z A;  1XS9 A;  2L0K A;  5E3L A;  3QQA A;  3HOW J;  3RZD J;  3NAU A;  3OSF A;  4JX5 A;  2DA1 A;  2L9R A;  3A02 A;  1WI3 A;  4QSH A;  1DU0 A;  1YRN B;  2G0E A;  2E2J J;  5GP9 A;  5E3M A;  4IHV A;  2MG4 A;  5FJ8 J;  5FLM J;  1OCT C;  4IHX A;  3RKQ A;  4MFD A;  3G1M A;  1HOM A;  1H89 C;  3LSP A;  2HXI A;  1AKH B;  2DTZ A;  5FKN A;  4BBS J;  3GTP J;  1X2M A;  1O4X A;  1HF0 A;  1ETX A;  1WCM J;  1K61 A;  5F27 A;  1ETO A;  4M3G A;  1I6H J;  1JJ8 C;  1Q1V A;  2R5Y A;  3LOC A;  2EZK A;  2YU9 J;  3FK6 A;  2R7Z J;  1BJZ A;  3BG5 A;  3HBL A;  5EG0 A;  1RES A;  1LFB A;  5HOD A;  5K7H A;  1DU6 A;  1HCR A;  2ME6 A;  2LK2 A;  2LTP A;  5J1R A;  3VPR A;  1MH4 A;  2N8G A;  1TWG J;  2EZH A;  3G1O A;  3BTJ A;  2IEK A;  5FKK A;  2Y0S N;  1TWC J;  4A93 J;  1VND A;  1MBH A;  4QTR A;  2XPW A;  4MIM A;  4Y7N J;  1JKO C;  3D1N I;  5FKO A;  4EEF G;  2L7Z A;  3HDD A;  3SJM A;  3HKZ N;  2WB1 N;  3FIW A;  3SDG A;  1ETV A;  3O8H A;  1MSF C;  5FKL A;  1ORK A;  2XB0 X;  1JUS A;  4MLO A;  4XIC A;  1ZR2 A;  5EG0 B;  2D5V A;  2AO9 A;  2NVY J;  3HOV J;  4M3F A;  2DA5 A;  1RPW A;  1ETK A;  2DA2 A;  4XK4 A;  2HOA A;  3ZOB A;  4D7N A;  3S2D J;  1JUP A;  4BY7 J;  2DMT A;  2R0Q C;  2ECB A;  4A3E J;  2GBY A;  2K9Q A;  1GV5 A;  3K7A J;  4AC0 A;  3H3V K;  1TC3 C;  5C44 J;  3C2B A;  4D5C A;  3H0G J;  4CYC A;  3F0C A;  2O7O A;  3L1P A;  2ME0 A;  3BT9 A;  2LLK A;  5JLX A;  1I3Q J;  2QCO A;  1T33 A;  2Y30 A;  5JLW A;  2VKE A;  2FD5 A;  4IHW A;  3BQY A;  4C3H J;  4IHY A;  3OSG A;  2CUE A;  1Y1W J;  3K2A A;  3CQZ J;  2XGE A;  3JR9 A;  1YRN A;  4RDU A;  2EZL A;  4G12 A;  3HGY A;  3HEF A;  1B72 B;  3GTG J;  1FTZ A;  2NVX J;  1Z77 A;  5E3N A;  4A3C J;  2MGQ A;  1B8I B;  1RR7 A;  2B63 J;  1F43 A;  5DTD A;  3ZQC A;  2IBD A;  2WAQ N;  3RQI A;  5IP7 J;  3S14 J;  2GLO A;  1EF4 A;  3BQZ A;  4W1U A;  3S16 J;  1T56 A;  5EGO A;  3S1N J;  3BTC A;  2LR8 A;  1LFU P;  1X58 A;  4B4C A;  3A01 B;  2JA5 J;  1AKH A;  2RAE A;  1K83 J;  3IH4 A;  1QPI A;  1JJ6 C;  3MVP A;  3TED A;  2HYJ A;  2XPU A;  5F0C A;  1GV2 A;  1SAN A;  1MBF A;  1X2N A;  1B72 A;  2JMW A;  5F0H A;  4X1E A;  1H88 C;  2HOS A;  4DYR A;  1ZKG A;  2FJ1 A;  2HDD A;  4GFB A;  1UMQ A;  2ELK A;  5EZG A;  2R5Y B;  2HXO A;  2DA6 A;  2E2H J;  3Q0U A;  3G1L A;  2DMQ A;  4M3D A;  4I6Z A;  2LY9 A; 
#chains in the Genus database with same CATH topology
 1TWF J;  2VBW A;  5DV5 A;  1BBY A;  3FM5 A;  5CVV A;  1VQO I;  1OCZ H;  3RKW A;  1X3W B;  2IS4 A;  5L3B A;  1ZR4 A;  1WJA A;  2PG4 A;  3ECH A;  1OYW A;  3ASO H;  3H92 A;  4MHG A;  3T5X A;  4PUS A;  2DA7 A;  1GXQ A;  3ML6 A;  4P9F A;  4B48 A;  4CSW A;  3BWG A;  4IX7 A;  2IS6 A;  3KE2 A;  3OYC A;  2HI3 A;  4LB6 B;  3W2W A;  3E5X A;  2H6B A;  3JRA A;  2KDZ A;  4DOZ A;  1S3J A;  4ENJ A;  1JTX A;  1IF1 A;  4YII A;  1QHH D;  2XAU A;  1TQI A;  4CXF A;  3TW6 A;  2EJR A;  4CCM A;  4A69 C;  5CKT A;  3V8L A;  3VYS B;  3KZY A;  4HEA 2;  2A05 A;  3MMY B;  4LFU A;  3OR2 C;  5DEQ A;  1VFC A;  3EUH A;  4RA2 A;  2F5F A;  4A3F J;  4R8H A;  2WB1 A;  2VUM J;  3BOQ A;  5EYR A;  2CQX A;  2DN0 A;  1D5Y A;  3U9G A;  4OMZ A;  2JA2 A;  4CYC B;  2O0Y A;  1TQM A;  1YW7 A;  1KU2 A;  1E3H A;  3WG9 A;  2QSH X;  3M7G A;  4HRI A;  3BY6 A;  2KFD A;  1NG7 A;  3K6G A;  1EH7 A;  2JN6 A;  1WFX A;  1HW5 A;  2FF4 A;  3E3V A;  5H20 A;  4II3 A;  3TBI A;  5LD2 C;  2RV8 A;  1VZ0 A;  4A3I J;  2OF7 A;  2LMD A;  1JGG A;  3JCU C;  2HTJ A;  4Q47 A;  3I54 A;  5L3C A;  2YUS A;  4D1Q A;  2BY3 A;  4F93 B;  3ABL H;  1Z0X A;  4ZDP A;  2K27 A;  2A69 F;  4UVB A;  4BAC A;  2MD5 A;  2XRN A;  3FIS A;  2IGK A;  2E71 A;  2VXD A;  3KEY A;  1D0X A;  2M7B A;  4BKX A;  3I71 A;  3LA7 A;  4BHP A;  3I56 I;  1LUJ B;  3S2W A;  1VTN C;  3PL8 A;  4HBL A;  1Z21 A;  1T08 B;  2ZO4 A;  2V7F A;  1WJB A;  3DPU A;  1LE8 A;  3FKI J;  2CMP A;  5EGO B;  1TWH J;  1X19 A;  4BBR J;  3DP7 A;  4PSW A;  1FOW A;  4FTH A;  3NWS A;  4P1W A;  2ZC2 A;  1Y6I A;  5IP9 J;  3ZQL A;  3WE3 A;  3LA3 A;  4XLP F;  1MZB A;  4XRS A;  1R9T J;  1DGR M;  5IYC J;  3BZ6 A;  5F08 A;  3DLA A;  1LFP A;  1IJW C;  3MKW B;  2LKP A;  2QF7 A;  2Q2E A;  3L2V A;  3HM5 A;  3RPQ A;  1Y8R B;  4UNO A;  2DDA A;  4AU7 A;  1B4A A;  5C3E J;  3IWF A;  2QSG X;  1EJ9 A;  3FDY A;  3HUG A;  3HOX J;  2QGU A;  3Q9V A;  2LC2 A;  1XCB A;  1BL0 A;  1FYK A;  4EM1 A;  1LDK B;  3DLL F;  1AWC A;  2W4S A;  5CQG A;  4XLH A;  1SAX A;  1S7O A;  4C2M J;  1V5F A;  2I8D A;  5KNL A;  5ERI A;  2GXG A;  3BG7 A;  2F4M B;  3R60 A;  1X3U A;  1G8X A;  3HC7 A;  2JA7 J;  3IL2 A;  2CQK A;  3B02 A;  2RRE A;  4PFO A;  3HOZ J;  3BG3 A;  5JI6 A;  1YIT I;  1U0J A;  2OU2 A;  3BJ6 A;  1EV7 A;  2CSO A;  5GPC A;  1KQ9 A;  3MKL A;  3O3K A;  1ZRC A;  4QPO A;  3QYE A;  2J5P A;  1A35 A;  2VJ4 A;  5D4R A;  2W48 A;  3HUG B;  4L5J A;  3F8F A;  3MAJ A;  1MD0 A;  3L2R A;  2ELJ A;  1WQ2 A;  4QIW N;  1OKR A;  2V6C A;  4MTD A;  5HS7 A;  1Q1H A;  3JW4 A;  3S3O A;  5ICE A;  3ZGK A;  2HU9 A;  2E19 A;  3IH3 A;  1PYV A;  5E1X A;  1ZG5 A;  4XLC A;  1UST A;  3W6K B;  3RKY A;  1APL C;  5IYD J;  4E7H A;  4HQE A;  4BE1 A;  3SZT A;  3LSR A;  3K4M A;  4BXF A;  2RKH A;  3FXR A;  2DMN A;  4HV6 A;  2K4B A;  1ZGW A;  3HYI A;  2WA0 A;  1FOX A;  2VC0 A;  1ACI A;  1W4M A;  2CV0 A;  1BR4 A;  1K6O A;  1GUU A;  2LKX A;  4A12 A;  4KFC A;  3PQK A;  1YX3 A;  2E7W A;  4YEJ A;  1YJ9 I;  2NS0 A;  2MA3 A;  1GVD A;  2AHQ A;  3BP8 A;  2ZKZ A;  4FT8 A;  4EJU A;  1CGP A;  5CYV A;  3A0B C;  2EIJ H;  1ZHF A;  4J01 A;  2EFO A;  2JWT A;  3JRF A;  4G9Y A;  4DYQ A;  4P55 A;  4HV5 A;  1F9N A;  3GXO A;  2STT A;  3IRR A;  2OA4 A;  3KP5 A;  2JPC A;  3J80 K;  1D0Y A;  2WV0 A;  2VJ5 A;  4N9H A;  3L00 A;  4RB0 A;  3DQV C;  4IXA A;  2RDP A;  2DOA A;  2OCC H;  3S1Q J;  3H36 A;  3JRB A;  4I0B A;  2ID3 A;  3CUQ A;  4AYB N;  2O9L A;  2X6O A;  5EEH A;  2VQH A;  3E6B A;  1IV8 A;  1GDT A;  3BG6 A;  1GT0 C;  4JX4 A;  2Q2E B;  3D5R C;  1U78 A;  1IO2 A;  2Y2Z A;  2OCE A;  1ON1 A;  4QWQ A;  3FX3 A;  4FET A;  2FNA A;  5HDN A;  2MW8 A;  4XLA A;  1V5E A;  1KU3 A;  2E1O A;  4RAZ A;  5FGM A;  2MD0 A;  5GAG J;  4W97 A;  5HLI A;  3GTJ J;  5D5V B;  2M9H A;  3F8B A;  4NUB A;  3SZP A;  2D1H A;  4ZYE A;  1OYY A;  5EF6 A;  3E5U A;  2DA3 A;  2W85 A;  3HG9 A;  2O61 A;  2H1K A;  3SEZ A;  1I27 A;  3OYF A;  3IWZ A;  2WY8 Q;  3CMM A;  3HL2 A;  4IQJ A;  2QVO A;  1DQU A;  3ZQG A;  4LG0 A;  2HVS A;  2CQN A;  1FIP A;  5TRD A;  4EV0 A;  4EAT A;  1DDN A;  3BZK A;  3EUH C;  4MEX F;  3O6B B;  2QA4 I;  1FOY A;  2R7S A;  1K6Y A;  2LP0 A;  4IEJ A;  3C2H A;  4NDL A;  4AIK A;  2E7X A;  2XKP A;  5HLT A;  4Q5S F;  1U6G A;  4K2E A;  3OMY A;  5E20 A;  1O7L A;  3K4C A;  1MMN A;  1D8J A;  1W7P A;  3ZPL A;  2QQB A;  1YE9 A;  4IVN A;  2BV6 A;  1OYI A;  1QGP A;  3HSE A;  3FWE A;  4M74 A;  3KZI C;  3TQN A;  1JTY A;  5TIS C;  3ZN1 A;  1YO5 C;  1PJR A;  4CCN A;  3K4J A;  1FSE A;  2DA1 A;  3J7Y J;  2A6E F;  3CC2 I;  2IS2 A;  2G0E A;  3Q5F A;  3K4B A;  5K5Q A;  1ODD A;  3CP2 A;  4OMY A;  4XKV A;  4IHV A;  1I5Z A;  3E5Q A;  1QPM A;  1USS A;  4KIF A;  4YEL A;  1SFE A;  2BVL A;  3TKY A;  3P5J A;  1R4N B;  1ZEL A;  4HST A;  2ZJ2 A;  1U5T B;  2KZG A;  4CZZ A;  1AKH B;  1HC8 A;  3DF8 A;  3AFH A;  4U0Y A;  3TMO A;  2COM A;  1IN7 A;  3CMA I;  1WSU A;  3CLQ A;  1ETX A;  4U7B A;  1IN4 A;  4JBA A;  5F27 A;  1ETO A;  2VJJ A;  1HKQ A;  1XSV A;  1RC9 A;  3EPZ A;  4EJT A;  1G4D A;  2ZBK A;  3HBL A;  5EG0 A;  3VEP A;  1LFB A;  3K1M A;  2OQG A;  2UUZ A;  5HOD A;  1K7A A;  3KP3 A;  4PJ0 C;  3BDD A;  2KRC A;  1HCR A;  2A61 A;  1Z3X A;  2LTP A;  3QYF A;  1D5V A;  1XD7 A;  2Y75 A;  3F8M A;  3BTJ A;  1U5T A;  2O03 A;  4CZC A;  3CC4 I;  2CG4 A;  3OYB A;  2X51 A;  3M1E A;  2IT0 A;  3QOD A;  5LBQ A;  3DPL C;  3ZN0 A;  2L7Z A;  2HQR A;  3I59 B;  4A0Z A;  3D5S C;  3AG4 H;  3HKZ N;  2IA1 A;  2WB1 N;  4BS9 A;  3FKJ A;  1W5S A;  1AOY A;  5E1Z B;  3AKZ A;  2MYS A;  2V9P A;  2FOK A;  2XB0 X;  4XIC A;  1ZR2 A;  2F4I A;  3HSR A;  5EG0 B;  1MJ9 A;  3CCM I;  1DP7 P;  2NVY J;  2XSJ C;  4BQQ A;  1Z6R A;  2UXX A;  3HRS A;  4Q48 A;  2HVR A;  1RPW A;  1ETK A;  4D7N A;  4XK4 A;  2HOA A;  3ZOB A;  3CO7 C;  4U87 A;  3OYJ A;  4G94 A;  1G6N A;  5DD4 A;  3H1C A;  1BI3 A;  2ECB A;  1SFU A;  2RVC A;  3GW2 A;  2GBY A;  4S05 A;  2E34 A;  2FEZ A;  3H3V K;  1X1C A;  4D5C A;  2R7U A;  4P96 A;  3I5U A;  1I3Q J;  5F6F A;  2PMU A;  2VKE A;  4IPA A;  4HF2 A;  3BQY A;  3OSG A;  1VQK I;  5CVU A;  4EMS A;  3JR9 A;  4G6Q A;  4M6X A;  2VC1 A;  1Y56 A;  2IP2 A;  4M71 A;  3HGY A;  3ZMU A;  4F3Q A;  3I64 A;  4WXH A;  5E3N A;  4A3C J;  2AS5 F;  2JT1 A;  4CIC A;  2M0M A;  4DBR A;  2ICW G;  2IS1 A;  2HZD A;  2ZME A;  5LEJ A;  3V7R A;  3KZZ A;  1NH3 A;  2GLO A;  2DFE A;  5BOX A;  1UB9 A;  2H1L A;  4JOM A;  3S16 J;  5LHI A;  5KAI C;  1UJ8 A;  2E1N A;  3VSL A;  1Z1D A;  2DBB A;  2LNB A;  1X58 A;  2FBH A;  4G7O F;  4ZYA A;  2DFH A;  3QP6 A;  5E8I A;  5KCM A;  5L3F A;  1AKH A;  1K83 J;  2XAS A;  2QKM B;  3TED A;  4ZYG A;  2LY1 A;  2HYJ A;  1K78 A;  2VN2 A;  4U0W A;  1V54 H;  1KQ0 A;  3LMM A;  4BNC A;  2JMW A;  5F0H A;  4LIU A;  1VQ6 I;  1ON2 A;  4E4H A;  2NVU B;  2HDD A;  2MC3 A;  2QZ8 A;  3GX4 X;  3LWF A;  2DA6 A;  4GO1 A;  3K4L A;  3Q0U A;  4IRH A;  4M73 A;  2HZT A;  1H9G A;  1XSX A;  2DMQ A;  2DPU A;  1KQ8 A;  4M3D A;  2LY9 A;  4A6E A;  1QZE A;  2UZK A;  2DFI A;  1C0W A;  4BH9 A;  4IKF A;  2EZI A;  2BW3 B;  4XOR A;  1DPU A;  4UHT A;  1YJW I;  4NB5 A;  2IGN A;  2LRE A;  1IN6 A;  3TO6 A;  1FWZ A;  2K02 A;  2OV7 A;  4U0V A;  4EQQ A;  2AQF A;  5EEG A;  5FKM A;  5FRN A;  4DNC A;  1JXS A;  2DTR A;  4ABZ A;  1WJD A;  4IRI A;  2NRA C;  5M3M J;  1FT9 A;  3HPH A;  1ZAO A;  3FMR A;  3CJN A;  1MDM B;  1ITY A;  2FQ3 A;  2CUF A;  2WAE A;  2XPV A;  1W0T A;  2K9L A;  5DCM B;  1IRF A;  3ERE D;  1WWX A;  5FFX A;  4HPQ A;  3HOS A;  3MD2 A;  2NNY A;  1U9O A;  4Y33 A;  2XGD A;  3H35 A;  2WWY A;  3JRE A;  3IV5 A;  1SFO J;  4P9U A;  2DFF A;  4JX6 A;  1AHD P;  1QHG A;  1ZLK A;  1D0Z A;  4BJ5 C;  1ZAR A;  1E3P A;  3HJE A;  2EIL H;  5E18 F;  2MH9 A;  1J59 A;  1IAW A;  5CQE A;  4QLC U;  2VBZ A;  2F5C A;  1WHU A;  2X6X A;  4GDF A;  2DJN A;  3BR0 A;  2M7A A;  1Y1V J;  3BC8 A;  4I09 A;  1PP7 U;  1TWA J;  2VIX A;  2VL8 A;  2K9M A;  2ZXJ A;  1FX7 A;  4KN7 X;  2P81 A;  5ILV A;  4M72 A;  3OY9 A;  1BW6 A;  4HLX A;  1T95 A;  3CJT B;  1ETY A;  3DWL E;  5M3F J;  4YRV A;  1UHS A;  1XGS A;  3E0J B;  1J7K A;  2ZB9 A;  2KIF A;  3CF2 A;  3B6A A;  4UUS B;  2JA6 J;  4S0H B;  3LAJ A;  3BG9 A;  3IHU A;  3CDL A;  2YX7 A;  3HOY J;  4RS8 A;  3WTX C;  4NC7 A;  2XSD C;  2FRH A;  3IRQ A;  1MGT A;  1Y0U A;  4MEY F;  2X9D A;  4BDY A;  1AU7 A;  1R23 A;  2W57 A;  5D5U B;  4IQ4 A;  1JKR C;  4OOI A;  3E6D A;  3DKW A;  4I76 A;  2F48 A;  3K0L A;  2H6C A;  1VQ4 I;  2EFP A;  3CJQ B;  2XRO A;  4HNV A;  3OOU A;  2EV0 A;  3HTS B;  3ELK A;  4BXU A;  5A2Q K;  5DS9 A;  1F5T A;  1UG2 A;  3WTW C;  4F52 A;  2YU3 A;  1HLV A;  3RQ4 A;  2BXZ A;  3H5R A;  3NQO A;  3ZMZ A;  2CU7 A;  2IA2 A;  2A5Y B;  3ZQQ A;  1UZC A;  2L5Q A;  1TL8 A;  4OAZ A;  2HQN A;  1EKE A;  3IAS 2;  1IXC A;  2TDX A;  2JUC A;  3MWM A;  4HX4 A;  1S72 I;  3LSK A;  4II2 A;  1JI8 A;  1K79 A;  4I0A A;  1VQ8 I;  3L09 A;  5LRR A;  4HNU A;  1P4W A;  4HNT A;  4M3B A;  4FX4 A;  2PMZ A;  4E7J A;  3SYT A;  3RZO J;  3N05 A;  3L2W A;  3CUO A;  3QRF F;  2NOG A;  1YI2 I;  2DA4 A;  4MNU A;  4V2F A;  1XMA A;  2MLK A;  3OYE A;  2CV2 A;  1KU7 A;  3J7A O;  2KT0 A;  4N4N B;  1W0U A;  2RN7 A;  2HVQ A;  1W36 D;  4DGW B;  2NOJ B;  3CP8 A;  3DCF A;  3QOE A;  3Q3S A;  3FBN B;  4E7I A;  1UEL B;  5ILU A;  3UKG A;  3BCB A;  5DCF A;  5J1Y A;  3CCS I;  2JSP A;  2K4J A;  4BQO A;  1JKQ C;  2R7O A;  3BJO A;  4HOB A;  1FIA A;  5IOY A;  1K4T A;  2ZSH B;  2HNH A;  1R36 A;  2DLL A;  3ZMD A;  3I59 A;  4F7Z A;  2KIM A;  2ZJR F;  1KON A;  4ENK A;  1RUO A;  2PQ8 A;  3PNV A;  3TP3 A;  3VYR B;  2F2E A;  3GLL A;  2DYR H;  3HHG A;  4ON0 A;  5J4V A;  2ZXH A;  2G9W A;  1IV6 A;  1FEX A;  5E1W A;  2L7F P;  4KDP A;  1RR8 C;  4HX8 A;  3KFW X;  2R7D A;  4MFE A;  3S1M J;  3M8J A;  3L2U A;  5FLV A;  4WXD A;  3KYC B;  2UV1 A;  3AL0 B;  1MH3 A;  3P9I A;  4Y13 A;  2HDW A;  3ASN H;  3JSO A;  4RB1 A;  2IXS A;  1S7E A;  3J80 Z;  2OD5 A;  1PDN C;  4A3M J;  4HQM A;  5GTH C;  1NG6 A;  2VKD A;  3DU5 A;  1LE8 B;  3Q0W A;  1OLT A;  2ZFU A;  2KP6 A;  3F21 A;  1OCP A;  1WH5 A;  2NS7 A;  4UUS A;  4DZJ A;  2XGC A;  3QAH A;  5M5Y J;  1J75 A;  4Y17 A;  3CDH A;  4GXO A;  5CVR A;  2Z9O A;  4A6D A;  4XRM A;  2M2E A;  3TW7 A;  5LFA A;  1SAU A;  3KIO A;  4C2T A;  3S3N A;  1E0E A;  2OZU A;  1YFH A;  3I4P A;  1RUN A;  1IXS B;  3HGG A;  1VF9 A;  1BOA A;  3I58 A;  3OIO A;  3DBR B;  3OS1 A;  2HFH A;  1LDD A;  2Z5U A;  2BOL A;  2Y48 A;  1YIO A;  2V1D A;  5FRM A;  2LSO A;  4CCL A;  4A3G J;  1TW3 A;  1ZRF A;  2GA1 A;  1J9I A;  3BR2 A;  3SZG A;  3LSG A;  1SC7 A;  5M5X J;  1Z7L A;  5FFZ A;  1V55 H;  2V9V A;  2ISY A;  2QBY B;  3HSF A;  4BXX J;  1FNN A;  1HDP A;  3TO9 A;  3W2V A;  5HOO A;  4RAF A;  3FXL A;  4AD9 A;  2WV1 A;  3FXQ A;  2L7M P;  1B9N A;  2IJL A;  1VQ5 I;  1LEB A;  1L0O C;  3K4K A;  2P8T A;  5B5E C;  4EM2 A;  2P5L C;  4D5F A;  3MEX A;  2QQ9 A;  2DT5 A;  2CUZ A;  2NVT J;  5EEA A;  2VJI A;  1OJL A;  3EDP A;  2WBM A;  4BHB A;  4CDG A;  4D7M A;  5EDN A;  3W2A A;  4AID A;  4U88 A;  5IOZ A;  3KLO A;  4BEH A;  2OPT A;  4FE7 A;  4ASN A;  3OR1 C;  4WXC A;  3B6C A;  2QLZ A;  4DBQ A;  2VAS A;  2STW A;  1X1B A;  4C3J J;  4Y52 J;  5HNH A;  1D3Y A;  3ZP5 A;  4RAG A;  4G7Z F;  4UUT A;  1MMA A;  1MSE C;  4A3B J;  5K7F A;  5ICG A;  3FBI B;  3SHF A;  3A1Y A;  1QA6 A;  2VT2 A;  1N78 A;  2M8G X;  4EGY A;  3OL4 A;  1ZLJ A;  3QQA A;  4LIT A;  5E3L A;  3HOW J;  3D5L A;  3OSF A;  1FSH A;  1R4M B;  1WI3 A;  3E6C C;  1LVA A;  1STZ A;  2G7U A;  2E2J J;  5GP9 A;  1TLH B;  3V7S A;  2PJR B;  2R7T A;  2KPM A;  1RZ4 A;  2MG4 A;  3CCR I;  4L0Y B;  4KYW A;  5FJ8 J;  3KYL A;  4ESJ A;  1Z3Y A;  2LDU A;  3OS2 A;  4IHX A;  3MCZ A;  4NQW B;  1QO0 D;  1HXD A;  3G1M A;  1VQ7 I;  2LYC A;  3DFG A;  1HOM A;  3OYM A;  2F6C A;  5DDG A;  4B43 A;  1VQL I;  1PVE A;  4S04 A;  3MZY A;  2CV1 A;  1H9T A;  4IOC F;  2K5C A;  3HKZ A;  1O4X A;  1WCM J;  5HLH A;  4EJO A;  1G3Y A;  1JJ8 C;  1HKS A;  1Q1V A;  5LHG A;  4KIB A;  2R5Y A;  2BBY A;  1I1S A;  2L7K A;  3FK6 A;  1UFM A;  1RES A;  3EET A;  3T0Y A;  1VQM I;  1UAA A;  4PJN A;  5GAE J;  2JRT A;  2QEX I;  4RGS A;  1P2F A;  3K69 A;  1IRG A;  2BZT A;  4LLG F;  3I55 I;  4XRF A;  5BMZ A;  1R58 A;  5DM6 F;  1MH4 A;  1SD5 A;  4F92 B;  4L0Z B;  2IEK A;  4WK8 F;  2JUG A;  3QOP A;  1PUE E;  2EIM H;  4GYI A;  2V26 A;  1QZZ A;  1TWC J;  2CW7 A;  4CYD A;  1LPQ A;  1VND A;  4A93 J;  1MBH A;  3F23 A;  2OTJ I;  3FM3 A;  4UB6 C;  1O3T A;  3D1N I;  2DQR A;  4F91 B;  2KRH A;  2QBY A;  3SDG A;  3GVA A;  4PCQ A;  1ETV A;  3CJR B;  4IF4 A;  4JQF A;  3O8H A;  5H6R A;  1CF7 A;  4MLO A;  1JUS A;  1OR7 A;  2L01 A;  3RI4 A;  2W7N A;  2D5V A;  1T38 A;  5FRO A;  2E1M C;  5LGT A;  1LEA A;  1J09 A;  3CTA A;  3K70 D;  4XSZ F;  1FPQ A;  2DA2 A;  4KN4 X;  4LK1 F;  4FX0 A;  2FU4 A;  1O3S A;  1JUP A;  1OCO H;  3GUD A;  2R0Q C;  1BC7 C;  3OYI A;  4A3E J;  2K9Q A;  1GV5 A;  3K7A J;  3EUK L;  4BQA A;  1R5H A;  2RGV A;  2Z1D A;  4PSX A;  3G4S I;  3H0G J;  2K3F A;  3WGG A;  5HLG A;  2O7O A;  4CYC A;  3CCJ I;  4OIO F;  2W24 A;  4OIR F;  2ME0 A;  2A68 F;  2DOD A;  2YR2 A;  3HPG A;  3HRT A;  2E5N A;  2FD5 A;  3DTE A;  4IHY A;  1FP1 D;  1Y1W J;  2B0L A;  3TL4 X;  1LJ9 A;  2R7V A;  5KVR A;  3NWT A;  1S5L C;  4RDU A;  4M9X A;  3GTG J;  1LKX A;  1EH6 A;  3G3Z A;  4NHJ A;  3H9J A;  2CGP A;  3WE2 A;  2ACJ A;  2DAO A;  3GFI A;  2CO5 A;  4DJA A;  1B8I B;  2J5O A;  3F6O A;  3ZQC A;  1P6R A;  2IBD A;  2WAQ N;  4QPQ A;  3RQI A;  5IP7 J;  3RSN A;  1VQN I;  2FUG 2;  4ESF A;  1I39 A;  3QPT A;  2XVC A;  4L9V A;  4W1U A;  1TT5 B;  3BTC A;  1T6S A;  4NQW A;  1LFU P;  2JA5 J;  1G3S A;  3F8N A;  3PUB A;  5B1A H;  1QPI A;  1R00 A;  1JJ6 C;  2MFZ A;  1T98 A;  2IW5 A;  5EJC A;  2XPU A;  4E6K G;  3KP7 A;  3U2R A;  5HVQ C;  1XSD A;  2MAB A;  4XSX F;  3D0S A;  3GZN B;  2P6T A;  1H88 C;  3C1D A;  4DYR A;  5EZG A;  2R5Y B;  1GLN A;  3WU0 A;  3S93 A;  2VON A;  2BY2 A;  3J81 K;  2DOE A;  5FB2 A;  3G1L A;  2YX4 A;  3K10 A;  3R0A A;  4TV7 A;  5D4S A;  2Y0M A;  2LF8 A;  4I6Z A;  3FZV A;  2FA5 A;  2M45 A;  2V1X A;  4BUP A;  1YG2 A;  3OIP A;  2FMY A;  2DJI A;  1R6R A;  2KRF A;  4M6Y A;  5F04 A;  2K85 A;  4L5I A;  4M3E A;  3CCE I;  3WHC A;  5DUK A;  4L18 B;  2DO7 A;  2ZFW A;  3IAM 2;  5CJ9 A;  2L9V A;  2XAJ A;  3NAR A;  2Y31 A;  3WGH A;  2D45 A;  3ECO A;  3RYR A;  4X0G A;  4DZP A;  9ANT A;  3LQQ A;  1ZRE A;  1EA3 A;  4LB5 A;  2W1O A;  4WCG A;  3EYI A;  1I1G A;  5D5X B;  3WGI A;  3UNG C;  1KA8 A;  2XAQ A;  4A2U A;  4E7S A;  3OYG A;  3CCV I;  1BJA A;  3V4G A;  3S15 J;  3OOP A;  5BNG A;  2XV4 S;  3I3L A;  2EA4 A;  5IT3 A;  4HAM A;  3IH2 A;  2LD5 A;  2R4G A;  3CMY A;  2FSW A;  3NRV A;  3QPS A;  2R7R A;  1ZQ3 P;  2O8K A;  4BY1 J;  4RLQ A;  3PM1 A;  2A6T A;  5C4X J;  1N77 A;  4F55 A;  3BRO A;  3H9Q A;  3R4K A;  1UHM A;  5GAD J;  1JUM A;  5AIQ A;  2VKV A;  4B47 A;  2EBI A;  5FD6 A;  1R1V A;  2OZ6 A;  2Q8K A;  1MJB A;  1P4A A;  3CC7 I;  3MZH A;  2GWR A;  1JKP C;  2LOO A;  2H8R A;  3BR3 A;  2E36 A;  1POG A;  4V2G A;  2JA8 J;  1A6Q A;  3TP0 A;  3A03 A;  2JJ7 A;  4ZDL A;  1I6X A;  5CVI A;  1IUF A;  2VKH A;  2P6S A;  3F6V A;  4DYC A;  3MFK A;  2RQQ A;  3BTL A;  2V9K A;  5IY5 H;  1B6A A;  1EH8 A;  1Z67 A;  2X6W A;  3VYU B;  3H9G A;  5TJJ A;  3DEU A;  1WJE A;  1KZH A;  1RRJ A;  3L9F A;  4ETS A;  1BR2 A;  5BPD A;  1B8I A;  1E17 A;  4OU0 A;  4Z6Y A;  1D1C A;  1ENH A;  4P5O A;  1SVL A;  3V8J A;  1Y8Q B;  1MBG A;  2DCE A;  2HGC A;  1QVU A;  1J0R A;  3TDZ C;  1R5I D;  2EIN H;  2RNG A;  3K1N A;  3SXY A;  2PI0 A;  1XB4 A;  4GCV A;  4CUG A;  2RQP A;  1XG1 A;  5D8K B;  3Q0V A;  5F1J A;  4YIR X;  3G73 A;  4A3L J;  2HKX A;  3LAP A;  3HOU J;  2RC4 A;  2Y0S A;  2CJJ A;  3GFJ A;  4KMU X;  4YFK F;  1ULY A;  1JHH A;  2IPQ X;  3H5N A;  2HTS A;  2PJR A;  3U1K A;  1VI0 A;  3F22 A;  2QQ8 A;  1GHC A;  2E2I J;  4ZC3 A;  5LLQ A;  3QPH A;  1SVO A;  2LFB A;  2ZSI B;  4ENM A;  1P7J A;  3AG3 H;  3GTO J;  3WTT C;  4OIP F;  4I01 A;  2VB6 A;  3KLN A;  4DW6 A;  1IC8 A;  4CCO A;  4O6J A;  4UXN A;  1E2X A;  3CES A;  3ULQ B;  4R79 A;  1SFK A;  3COA C;  4A5N A;  4XID A;  3GF2 A;  4XLN F;  1OR7 C;  2H94 A;  2ZJQ F;  3M3Y J;  1QU3 A;  1TTY A;  1A04 A;  2XF7 A;  2EA2 A;  2QEN A;  1P4X A;  4CCJ A;  2EV6 A;  3I53 A;  3FMQ A;  1CQT A;  1B59 A;  4KT6 A;  2V79 A;  2CRG A;  4PK4 A;  2R5Z B;  5B1B H;  4I7H A;  2NNN A;  1R49 A;  1FBS A;  2K7L A;  5J40 A;  1FZP B;  4BU2 A;  3CCY A;  1H0M A;  2Q1Z B;  1SD6 A;  2MLG A;  4J19 A;  3E7L A;  5GPA A;  1NK3 P;  5J8C A;  1IDY A;  3JTG A;  5KK1 A;  1H8A C;  2XGX A;  5F64 A;  2COB A;  3VOE A;  1TNT A;  3W3C A;  3TGN A;  2WAD A;  3GCM A;  3IKV A;  5HS8 A;  2FBI A;  2DXI A;  5CPR B;  3RPU D;  3PFI A;  5IYB J;  3OL3 A;  4HG2 A;  5H2F C;  2JVG A;  3OIQ A;  1IUY A;  3EUA A;  3J81 Z;  1R7J A;  2XF6 A;  2ZNZ A;  4JP0 A;  4HF1 A;  3VWB A;  4DQ2 A;  2XHK A;  2X48 A;  4AYB A;  5K7Z A;  1HSJ A;  4XON A;  2HEO A;  3ZQH A;  4YFN F;  1W7P D;  3W6J B;  4MO7 A;  2DMU A;  2I10 A;  1WZ2 A;  2OUM A;  4WWC A;  5IT9 K;  4GGG A;  1Y39 A;  2P0W A;  4XNF A;  5ICF A;  2M1B A;  2PX9 A;  2XF5 A;  4XKC A;  2X1C A;  1IGN A;  3BR6 A;  2BW3 A;  5C4J J;  1QBJ A;  3BR1 A;  3FXU A;  3DTK A;  4MQ9 F;  2LH9 A;  2LRD A;  3LSM A;  2A6H F;  3ZCO A;  4EVI A;  3GWZ A;  3CDI A;  1S9H A;  4XM3 A;  5JVT A;  4Z2Y A;  2XAH A;  3I9V 2;  3JRD A;  3LST A;  4A3D J;  1XGN A;  2DU9 A;  1KYW A;  3PSI A;  1LDJ A;  3LNQ A;  5J8F A;  1MDM A;  4I02 A;  1FJL A;  3KYD B;  2DI3 A;  3LFU A;  1Z9C A;  2CQQ A;  3PNY A;  4HW0 A;  4B1R A;  2WY7 Q;  1WGX A;  2KKO A;  2MC4 A;  1RKW A;  1V4R A;  3VOD A;  1ETW A;  4B44 A;  3PJR A;  2KIQ A;  1ZG1 A;  4JK1 X;  3WU1 B;  4HZF A;  2AQE A;  3KCC A;  3KEO A;  3F8C A;  4L5E A;  3RTR A;  1M1E B;  1HW1 A;  4ZH4 F;  2P4W A;  3CD6 I;  4BAY A;  4M9S A;  4EM0 B;  5LGN A;  2ESH A;  3PIP F;  2W84 A;  4XOT A;  4RAY A;  3IC7 A;  1MKM A;  4Y15 A;  1MMS A;  4ZJZ A;  1T2K A;  4HLY A;  2X0L A;  1OIS A;  3CUQ C;  2EPF A;  2WAQ A;  4O3M A;  4CO8 A;  3M4O J;  3GTK J;  4ZTJ A;  1FP2 A;  3U21 A;  1IZ1 A;  3W6V A;  2E35 A;  4FIS A;  4V19 K;  3K2Z A;  4FAS D;  1P7I A;  1ZGJ A;  1U2W A;  2BXY A;  4HDU A;  1TP4 A;  3PO3 J;  2M3A A;  3FK7 A;  3PIO F;  5M5W J;  4BQN A;  4WX9 A;  2ECC A;  2HWV A;  1HW2 A;  4XLF A;  4BE2 A;  2CW8 A;  2IGO A;  2VLA A;  3L2C A;  3ZR8 X;  4KUM A;  1OQY A;  3G6E I;  3IP4 B;  2L4M A;  2LVS A;  2X1E A;  3SQN A;  1OPC A;  2LKS A;  1ZTR A;  2PLY A;  2XIG A;  4LLL A;  1MBJ A;  4OIN F;  1ZK8 A;  2Y9Z A;  1XS9 A;  2L0K A;  1YYV A;  3SDB A;  4XN0 A;  4JX5 A;  2FOW A;  3KPH A;  3A02 A;  4QSH A;  5H6Q A;  5HDG A;  2VE8 A;  4HF0 A;  3IKT A;  1FMW A;  3AAF A;  4AVZ A;  5E3M A;  4PGH A;  5F1R A;  4MQV A;  1X3Z B;  3RKQ A;  4MFD A;  3X2Q H;  1WJF A;  4UY8 I;  1ZN2 A;  5JHU A;  1U8R A;  1MMD A;  2XDV A;  4IZZ A;  3F3X A;  3DPT A;  3LSP A;  3CO6 C;  5D6F A;  1H89 C;  4LK0 F;  2GXB A;  2GZW A;  4E7Z A;  4A0X A;  4FQG A;  1ZGA A;  3QP5 A;  1XGO A;  5FKN A;  4BBS J;  3GTP J;  1X2M A;  1HF0 A;  4CCK A;  1IRX A;  2BE5 F;  2R3S A;  5J6X A;  5JHF A;  3ZQ7 A;  1TNS A;  3WTZ A;  3LSI A;  2NYX A;  3LOC A;  3OYL A;  2EIK H;  2MH2 A;  5LGU A;  4B09 A;  3KP6 A;  1BJZ A;  2GA2 A;  1S7A A;  3GZ6 A;  3P9K A;  3N4M A;  2ZXI A;  1NHA A;  4HX7 A;  1DU6 A;  2LG4 A;  1YOV B;  5FD5 A;  2ME6 A;  1FMV A;  2DYS H;  2LK2 A;  4G8X A;  5J1R A;  2CWE A;  3VPR A;  3QWL A;  2EZH A;  2L9N A;  1FYL A;  2R7F A;  2QWW A;  3J7A Y;  1JHF A;  2VPL A;  3OYH A;  2KDO A;  1R1T A;  4PGG A;  3DBH B;  3S3M A;  4G6D A;  4Y7N J;  5AON A;  5FKO A;  4MTE A;  1HBX G;  2K3P A;  4UV9 A;  4CH7 A;  3SJM A;  3KP2 A;  1S29 A;  3FIW A;  2FE3 A;  4I98 B;  2HPM A;  4KMF A;  3PUF A;  3ERM A;  5ED4 A;  5FKL A;  1KU9 A;  2JVH A;  3JTH A;  3FXM A;  3JSP A;  1A36 A;  3RJP A;  3HOV J;  2VOP A;  4M3F A;  3N97 A;  3FMS A;  4ENN A;  1G3T A;  1TT0 A;  2D2W A;  1B1B A;  1G3W A;  4XOP A;  2DMT A;  2HPI A;  2W25 A;  1UG0 A;  2PBI A;  3JAM K;  2F4O B;  2PJP A;  2FXA A;  5B66 C;  3M07 A;  5C44 J;  2GOM A;  3F0C A;  1RIO H;  4KJZ A;  2XAG A;  3BT9 A;  1X1A A;  3H3U A;  2LLK A;  5JLX A;  4YG2 F;  1K4S A;  3BCA A;  4PZJ A;  2QCO A;  2Y30 A;  1XMX A;  2EFN A;  4IHW A;  4NBQ A;  4LLN A;  2ETH A;  1L3L A;  4CA0 A;  3H3Z A;  3K2A A;  3CQZ J;  1K78 B;  2XGE A;  1YRN A;  2OBP A;  3GEZ A;  3E1S A;  2O6G E;  4HYE A;  3HEF A;  1B72 B;  2GXA A;  2EWN A;  3ZXS A;  4J00 A;  1W1W E;  1RR7 A;  1F43 A;  5DTD A;  4LJZ F;  4EJV A;  5B3S H;  3DBL B;  1Z91 A;  1FOK A;  5CVJ A;  3S14 J;  5HNF A;  3H0D A;  1EF4 A;  3BQZ A;  1YS6 A;  3GO5 A;  4N9I A;  5LRS A;  1T39 A;  3A4C A;  3OYD A;  2QQA A;  3C2G A;  2LR8 A;  1T0F C;  2P5K A;  3OS0 A;  2DOF A;  4XKB A;  4BL0 B;  5L3G A;  4B4C A;  1R5G A;  4BJT A;  2R7X A;  3L2Q A;  3OYN A;  3MVP A;  4XLE A;  2H27 A;  1BIB A;  2CS3 A;  3HHH A;  4AIH A;  1FBU A;  1QQI A;  2O8X A;  5F0C A;  1GV2 A;  4FHT A;  3EQL F;  2ZNY A;  1B72 A;  3T8R A;  4G7H F;  4KIT B;  4NC8 A;  2JPB A;  3FHN A;  2CFO A;  4PFP A;  3WTS C;  2FJ1 A;  2X4H A;  2X1D A;  1UMQ A;  3R0J A;  2HXO A;  4PJL A;  5J47 A;  2ZME C;  3HIF A;  4HDV A;  4L9J A;  2NAZ A;  3GFM A;  4D0P A;  5BQT A;  1QNT A;  4XQF A;  4OIQ F;  3WU2 C;  1R71 A;  2O5R A;  2GOX B;  2KJB A;  3ONQ A;  3OWT A;  1ETQ A;  1D1B A;  2EB7 A;  1SVM A;  3LSJ A;  5E3O A;  2M87 A;  3PNT A;  3GME A;  2XC7 A;  1BA5 A;  1F4K A;  1UHW A;  1CF7 B;  2Y9Y A;  4ZYD A;  1HDD C;  2DT7 B;  2YS9 A;  4FE4 A;  3F72 A;  2F5D A;  1A31 A;  4A3K J;  4OWR B;  2Z3Y A;  2EQR A;  1WH7 A;  3L7W A;  3GLX A;  1VQ9 I;  1P92 A;  5IP6 A;  3FXJ A;  2CW0 F;  2E1C A;  2K9S A;  1MBE A;  6PAX A;  2JRM A;  5JFR A;  3RPU A;  2R5Z A;  3ABK H;  2B7E A;  4M6V A;  1LNW A;  2ID6 A;  4JYK A;  2JTV A;  4WF2 A;  2LBF A;  3M1C A;  2BY1 A;  1FLI A;  2KZV A;  5J1U A;  2XUB A;  3EYY A;  2FML A;  4BYY A;  2P7C B;  4RM3 A;  5E8G A;  1PUF A;  2G7H A;  3HRU A;  1IDZ A;  5JVG F;  4O5V A;  4A3J J;  1F36 A;  3CCU I;  2KQR A;  2DK8 A;  2P7V B;  4Y4R A;  1MMG A;  2KIU A;  2GAU A;  1Z6T A;  2MSY A;  1SEU A;  1YW8 A;  2M0C A;  2BYV E;  2X6Y A;  5DD8 A;  3KP4 A;  4LGW A;  5L3D A;  2KL4 A;  3T8T A;  4AUX A;  1R1U A;  2HQ5 A;  1BW5 A;  3TO7 A;  4LG0 B;  3GBG A;  1DP3 A;  1MBK A;  2GIV A;  5DCM A;  3G71 I;  1GVJ A;  2JK3 A;  3VFZ A;  1A5J A;  1JT0 A;  2K40 A;  2L54 A;  4U7D A;  4LD5 A;  2R92 J;  5JR3 A;  2K9N A;  2OC6 A;  2BY0 A;  1RNL A;  3ZMV A;  3LFK A;  5D5W B;  2W00 A;  4KIG A;  1G59 A;  2PMH A;  4A5M A;  1S6L A;  4YFX F;  2R93 J;  2GM4 A;  1REP C;  3LSH A;  5GAH J;  4UUV A;  1Z7U A;  1FYM A;  2PMZ N;  2BHZ A;  1HKT A;  1F1Z A;  1YJN I;  5D6E A;  4L9N A;  5E79 C;  5DUI A;  3I0T A;  1NK2 P;  1OFC X;  2L2O A;  2YPR A;  3O8G A;  3LL7 A;  1DPR A;  1QRY A;  2GQQ A;  2M30 A;  2A07 F;  4E7K A;  1VQP I;  4KNY A;  1XCV A;  4N4O B;  4PJM A;  2VOD A;  1OCR H;  3ROU A;  3CME I;  2DMP A;  3U1D A;  2KHM A;  4BE0 A;  1LB2 A;  4IOA F;  4LMY A;  1IW7 F;  4RGR A;  1XX5 A;  3BTI A;  2EFQ A;  4XMY A;  2KMU A;  4FCY A;  2AXL A;  3ZQI A;  1IG7 A;  2QM3 A;  3P9C A;  3CUQ B;  2BGC A;  1AA7 A;  1BI2 A;  2XRL A;  1HA8 A;  1GXP A;  4LOC A;  4IO9 F;  1LVK A;  1TQP A;  1BI0 A;  1JT6 A;  2TCT A;  1BI1 A;  2ZXW H;  4ITV A;  4RGX A;  1PP8 F;  1ZH5 A;  4RMN A;  3WOD F;  2L4A A;  2FNP A;  1XN7 A;  1OCC H;  3MN2 A;  2HQA A;  2TRT A;  3WTY C;  3I4N J;  5K5R A;  3WG7 H;  2ZCW A;  2EK5 A;  3BLY A;  3RKX A;  4IHS A;  5F0F A;  3RYP A;  4XL9 A;  3SFI A;  2VBY A;  2HYG D;  4PJJ A;  1XPX A;  2PN6 A;  4AWX B;  2M4K A;  2XB5 A;  1IRZ A;  4BJ6 C;  2Z33 A;  5EZH A;  4I2O A;  3OYK A;  2VPR A;  4EGZ A;  3SFZ A;  4IRG A;  3J7Z I;  2Y69 H;  4LG3 A;  2D1V A;  1SFX A;  4HA8 A;  4ESB A;  3R6S A;  1A6I A;  1W36 C;  4CHU A;  3ZMS A;  4M9Z A;  2M5W A;  3QU6 A;  1ONV A;  4XBF A;  1BM9 A;  1X1P A;  5IPA A;  1BOB A;  1R22 A;  3K9T A;  4PDK A;  1I3A A;  3VDX A;  1G2H A;  1X4O A;  4G6T B;  2QKL B;  3JRH A;  2IAI A;  2OJE D;  2Z16 A;  3DKY A;  4B3A A;  3A01 A;  1PUF B;  1Z05 A;  2HDC A;  5K1Y A;  2IGM A;  4DIQ A;  4UVC A;  2PEX A;  1W7P B;  4ZZD A;  1FTT A;  3MKY B;  5AIP A;  1YHQ I;  4XRS G;  1E3O C;  4L9T A;  1I50 J;  3JRG A;  4ZYH A;  2O3F A;  2R7W A;  2VQG A;  3DKX A;  3HTU A;  1V3F A;  4RM2 A;  4C9Y A;  1UCR A;  4LIV A;  3V42 A;  3FXO A;  1MNM C;  3DV8 A;  5D8L B;  1FC3 A;  2L02 A;  1U8B A;  4ANJ A;  2FX0 A;  2P5V A;  4D9J A;  4UVA A;  3S2H J;  4X6A J;  2HOT A;  3JRC A;  3S17 J;  3GTL J;  3K4N A;  3AG2 H;  3REO A;  3PO2 J;  1ZYR F;  3S1R J;  2QSF X;  1IN5 A;  3QPL A;  2M34 A;  1NTC A;  4C3I J;  2JQ7 A;  2YSR A;  5J4Y A;  1MJA A;  2EH3 A;  4BHC A;  2VE9 A;  1RKT A;  1LQ1 A;  3GTM J;  1X1D A;  4ZDO A;  1V5G A;  3LA2 A;  1WVR A;  2CYY A;  3E97 A;  1U9N A;  3CZ6 A;  3S32 A;  2L3D A;  3ZQF A;  1BIA A;  3ESW B;  2HKO A;  4KIC A;  2V1N A;  2IA0 A;  3RCO A;  1DGW Y;  2Q0O A;  1MIJ A;  2QUF A;  3I4M J;  3ISP A;  3KX2 A;  1X4P A;  3AG1 H;  3A2K A;  2LF7 A;  2IVM A;  2V6E A;  3BPV A;  3ABT A;  3WHB A;  2VOO A;  3CF5 F;  1BC8 C;  3BR5 A;  4Q4Z F;  3OYA A;  2EV5 A;  2I5U A;  2WAF A;  3BPX A;  3K70 C;  1N25 A;  2CQ7 A;  1XMK A;  5HDK A;  2PFB A;  4XKW A;  3E6M A;  2ADU A;  4GRI A;  1XDU A;  3C3W A;  3ABM H;  1D8K A;  4A0Y A;  3JRI A;  3G2B A;  5J3L A;  2NVQ J;  2VI6 A;  4UB8 C;  2GIZ A;  3O2P E;  3BJA A;  3DTI A;  2DPD A;  4Y3O A;  3GYH X;  2KLO A;  2E60 A;  3OV8 A;  2OQR A;  3GTQ J;  3DEW A;  2WTE A;  2B9S A;  2UXN A;  1U5T C;  1WJC A;  2CUJ A;  3TDU C;  1KYZ A;  3H5A A;  4CGZ A;  2WC2 A;  1RET A;  2OTL I;  4ZZL A;  5ICC A;  3HB9 A;  3F9K A;  1QVT A;  2K86 A;  3CCL I;  5LEK A;  5BS6 A;  3MQ0 A;  4XR6 A;  5BPI A;  2ISZ A;  1JE8 A;  4H0E A;  2NS8 A;  4N0B A;  4RBO A;  1J2X A;  2Z2S B;  1WPK A;  4BDZ A;  1XC5 A;  3FF5 A;  5A2Q Z;  2FQ4 A;  2E5Z A;  2BVM A;  2H8W A;  3RIR A;  4YIF A;  2CH0 A;  3MZ8 A;  4BGD A;  3RZD J;  3NAU A;  2L9R A;  5ILS A;  4AVP A;  3K1P A;  1WI9 A;  1YW9 A;  2X85 A;  1DU0 A;  1YRN B;  1OMI A;  1BR1 A;  2OAZ A;  4UV8 A;  4IL6 C;  1WRJ A;  2XAF A;  5IT9 Z;  4BEH B;  2DW4 A;  5FLM J;  2HOE A;  1OCT C;  5KAF C;  1XTA A;  1XDS A;  3MKZ A;  1MNE A;  2DDB A;  3HZJ A;  2HXI A;  2JSC A;  2ZME B;  1O3Q A;  2DTZ A;  4IHT A;  4RGU A;  1YQA A;  5CLS A;  5L3E A;  3FXK A;  3VSK A;  1YX5 A;  3AL0 C;  3LQR A;  1K61 A;  1YIJ I;  2ZJP F;  2DT6 A;  4M3G A;  3TOB A;  3QU3 A;  1I6H J;  4EJW A;  2R7Q A;  1O57 A;  2KIS A;  2EZK A;  2HR3 A;  1P9Q C;  4B3X A;  1HQC A;  5LHH A;  2YU9 J;  2R7Z J;  3BG5 A;  2F5V A;  1KGS A;  2DK5 A;  1YLF A;  2MBF A;  1MW7 A;  1SMY F;  1IXR C;  5K7H A;  2V1U A;  2FBK A;  4RB3 C;  2BHY A;  2XKO A;  4E70 A;  2N8G A;  1TWG J;  4H4K C;  3HOT A;  1WKM A;  2ELH A;  3G1O A;  3GZ5 A;  5FKK A;  2Y0S N;  2EFW A;  2A3S A;  1SD4 A;  3RDI A;  4QTR A;  2XPW A;  4MIM A;  1N75 A;  1JKO C;  1IN8 A;  3R61 A;  4HSR A;  1O3R A;  4EEF G;  4KIS A;  4C2U A;  3HDD A;  1J5Y A;  3ZRG A;  3V7C A;  2CFX A;  3CCQ I;  1U3E M;  2VXZ A;  2F5E A;  3WTV C;  1MSF C;  1ORK A;  4RLF A;  5DM7 F;  2AO9 A;  4E7L A;  2VT3 A;  3HRM A;  2QYO A;  4OAY A;  2DA5 A;  1BN5 A;  1W5T A;  3P7N A;  3CLO A;  3S2D J;  3PQJ A;  2RNJ A;  2W82 A;  2M8E A;  4BY7 J;  3VYT B;  2L9S A;  3IUO A;  1O7F A;  2ESN A;  2C6Y A;  4AC0 A;  1WJ5 A;  4AM3 A;  1TC3 C;  3BZC A;  3C2B A;  2LBF B;  1TBX A;  3L1P A;  2HS5 A;  1YS7 A;  2LY2 A;  3S8P A;  2Z99 A;  1T33 A;  3DU6 A;  5JLW A;  3GFL A;  2DQL A;  1T8I A;  2VQC A;  1D1A A;  4C3H J;  3M8F A;  2CUE A;  3NEU A;  1FY7 A;  2AXT C;  5TGT A;  4KT5 C;  2EZL A;  4ZTF A;  4G12 A;  2IRF G;  2HYF A;  1FTZ A;  3WTU C;  2NVX J;  1Z77 A;  3TOA A;  1JGS A;  3JAM Z;  5KHD A;  2MGQ A;  5FO5 A;  2NXN B;  1ERD A;  1ZG3 A;  5HS9 A;  2B63 J;  2H09 A;  3UR3 C;  3M8E A;  4B8X A;  1MND A;  1W5C C;  3DXJ F;  1T56 A;  1HST A;  5EGO A;  5GTI C;  3PSF A;  3S1N J;  3T1B A;  1QZY A;  3Q9S A;  1FBQ A;  2JZY A;  1B9M A;  3KET A;  3DEE A;  3SEQ A;  3A01 B;  5FLX Z;  3A0H C;  3C7J A;  1RI7 A;  2RAE A;  4MGR A;  3IH4 A;  2V4J C;  3QYB A;  5K5O A;  1T0F A;  3VB2 A;  2A5W A;  2BEO A;  2KJC A;  3C18 A;  4RB2 C;  4IJA A;  2E1M B;  2M4G A;  3B73 A;  3V8K A;  2UWM A;  1SAN A;  1MBF A;  1X2N A;  4NC6 A;  3FHZ A;  1TZL A;  3ABU A;  3HXL A;  4X1E A;  2HOS A;  3PFY A;  1S8N A;  2VQL A;  1YTY A;  3ZMT A;  4R1H A;  1ZKG A;  4NNJ A;  1ZRD A;  4GFB A;  2ELK A;  4KA4 A;  4XN3 A;  5E17 F;  1XGM A;  1TW2 A;  3M9A A;  4I99 C;  2E2H J;  1Y0N A;  4GYG A;  5DYM A;  4AIJ A;  1SMT A;  2VBX A;  1SD7 A;  4C30 A;  5FLX K;  3KEQ A;  1DUX C; 
#chains in the Genus database with same CATH homology
 1ETQ A;  1TWF J;  5F04 A;  3LSJ A;  4M3E A;  2EZI A;  5E3O A;  3WHC A;  1BA5 A;  1ZR4 A;  3NAR A;  5FKM A;  2Y31 A;  2Y9Y A;  1HDD C;  2YS9 A;  4FE4 A;  4ABZ A;  4DZP A;  9ANT A;  2DA7 A;  4A3K J;  2EQR A;  5M3M J;  1WH7 A;  2HI3 A;  5IP6 A;  1ITY A;  3JRA A;  2KDZ A;  2CUF A;  2K9S A;  2XPV A;  1W0T A;  3S15 J;  1JTX A;  1MBE A;  5BNG A;  2R5Z A;  3IH2 A;  3TW6 A;  2LD5 A;  3CMY A;  4M6V A;  2ID6 A;  3QPS A;  4JYK A;  4A69 C;  1ZQ3 P;  1U9O A;  2O8K A;  2XGD A;  4BY1 J;  5J1U A;  3JRE A;  3IV5 A;  1SFO J;  3PM1 A;  1VFC A;  5C4X J;  4A3F J;  4JX6 A;  1AHD P;  2VUM J;  5EYR A;  1PUF A;  1IDZ A;  1JUM A;  4A3J J;  2CQX A;  1F36 A;  2VKV A;  2DN0 A;  1D5Y A;  2EBI A;  4CYC B;  1JKP C;  2H8R A;  2MSY A;  3BR3 A;  4V2G A;  1POG A;  2JA8 J;  2M0C A;  3TP0 A;  2DJN A;  3A03 A;  2JJ7 A;  3BR0 A;  1Y1V J;  1IUF A;  4AUX A;  2HQ5 A;  1TWA J;  1BW5 A;  2JN6 A;  4DYC A;  3BTL A;  3GBG A;  1MBK A;  4A3I J;  2JK3 A;  2OF7 A;  2P81 A;  1JT0 A;  2K40 A;  1A5J A;  1JGG A;  1BW6 A;  1ETY A;  2YUS A;  2R92 J;  5M3F J;  2K9N A;  1Z0X A;  1UHS A;  1B8I A;  4UUS B;  2ZB9 A;  3B6A A;  3FIS A;  2JA6 J;  4S0H B;  1ENH A;  4BKX A;  3BG9 A;  1MBG A;  3CDL A;  2GM4 A;  1QVU A;  2R93 J;  3HOY J;  2XSD C;  1LE8 A;  2PMZ N;  3FKI J;  2X9D A;  1TWH J;  4BBR J;  5EGO B;  1AU7 A;  1JKR C;  4FTH A;  4I76 A;  1XG1 A;  5IP9 J;  3ZQL A;  1NK2 P;  1OFC X;  3O8G A;  4A3L J;  3Q0V A;  5F1J A;  1QRY A;  3HOU J;  4XRS A;  4HNV A;  1R9T J;  2CJJ A;  3OOU A;  5IYC J;  5F08 A;  5DS9 A;  1UG2 A;  2DMP A;  1IJW C;  1VI0 A;  1HLV A;  2QF7 A;  3BTI A;  3HM5 A;  2E2I J;  2CU7 A;  4FCY A;  3ZQI A;  1IG7 A;  2LFB A;  5C3E J;  1P7J A;  3GTO J;  2XRL A;  3HOX J;  4DW6 A;  4LOC A;  1IC8 A;  1BL0 A;  1JT6 A;  2TCT A;  4XID A;  3M3Y J;  4C2M J;  4M3B A;  3RZO J;  2NOG A;  2DA4 A;  4V2F A;  3MN2 A;  2TRT A;  3I4N J;  1CQT A;  2JA7 J;  2KT0 A;  5F0F A;  3SFI A;  2CRG A;  1W0U A;  2R5Z B;  3HOZ J;  3BG3 A;  1IRZ A;  2XB5 A;  5EZH A;  3DCF A;  3Q3S A;  5GPC A;  3CCY A;  2VPR A;  3MKL A;  3UKG A;  5J1Y A;  4J19 A;  3E7L A;  2W48 A;  5GPA A;  1A6I A;  1NK3 P;  1IDY A;  1JKQ C;  1H8A C;  1FIA A;  5IOY A;  2COB A;  4QIW N;  5IPA A;  1G2H A;  3JRH A;  2IAI A;  3A01 A;  4B3A A;  3TP3 A;  1PUF B;  2E19 A;  3IH3 A;  1IV6 A;  1FEX A;  2L7F P;  5IYB J;  1FTT A;  4XRS G;  1E3O C;  3S1M J;  4MFE A;  1APL C;  5IYD J;  3LSR A;  5FLV A;  4JP0 A;  1I50 J;  3JRG A;  2DMN A;  1ZGW A;  2X48 A;  5K7Z A;  1MH3 A;  3ZQH A;  1GUU A;  2LKX A;  4MO7 A;  1S7E A;  2DMU A;  2I10 A;  1MNM C;  4A3M J;  1U8B A;  2FX0 A;  3S2H J;  4X6A J;  1LE8 B;  3Q0W A;  2HOT A;  1GVD A;  1OCP A;  2AHQ A;  1WH5 A;  2NS7 A;  3JRC A;  3GTL J;  3S17 J;  4UUS A;  4DZJ A;  3BR6 A;  2XGC A;  5C4J J;  1IGN A;  5M5Y J;  3BR1 A;  3S1R J;  3PO2 J;  3QPL A;  4XRM A;  2M34 A;  1NTC A;  2JWT A;  4C3I J;  3JRF A;  2M2E A;  3TW7 A;  4DYQ A;  2EH3 A;  1RKT A;  3GTM J;  3JRD A;  4A3D J;  3HGG A;  3LNQ A;  1VF9 A;  1U9N A;  3OIO A;  3S1Q J;  3ZQF A;  3JRB A;  2ID3 A;  4AYB N;  1FJL A;  2O9L A;  3I4M J;  2X6O A;  2CQQ A;  4B1R A;  1GDT A;  4A3G J;  1WGX A;  1GT0 C;  4JX4 A;  1U78 A;  3BR2 A;  1RKW A;  2Y2Z A;  1ETW A;  3LSG A;  5M5X J;  3WHB A;  4BXX J;  1HDP A;  3BR5 A;  2MW8 A;  2E1O A;  4L5E A;  2WV1 A;  4W97 A;  3GTJ J;  2M9H A;  2L7M P;  5EF6 A;  2DA3 A;  4D5F A;  2H1K A;  3ZQG A;  3JRI A;  5J3L A;  2NVT J;  2VI6 A;  5EEA A;  2NVQ J;  1OJL A;  1FIP A;  4D7M A;  3M4O J;  3GTK J;  5EDN A;  3W6V A;  5IOZ A;  2LP0 A;  4FIS A;  3GTQ J;  2OPT A;  3DEW A;  1P7I A;  4FE7 A;  4IEJ A;  4NDL A;  3B6C A;  1RET A;  4C3J J;  3PO3 J;  3HB9 A;  4Y52 J;  1QVT A;  3FK7 A;  5M5W J;  4UUT A;  2ECC A;  1MSE C;  2NS8 A;  4RBO A;  4A3B J;  5K7F A;  1WPK A;  1XC5 A;  2LVS A;  2FQ4 A;  1ZTR A;  2M8G X;  1MBJ A;  1JTY A;  1ZK8 A;  2Y9Z A;  1XS9 A;  2L0K A;  5E3L A;  3QQA A;  3HOW J;  3RZD J;  3NAU A;  3OSF A;  4JX5 A;  2DA1 A;  2L9R A;  3A02 A;  1WI3 A;  4QSH A;  1DU0 A;  1YRN B;  2G0E A;  2E2J J;  5GP9 A;  5E3M A;  4IHV A;  2MG4 A;  5FJ8 J;  5FLM J;  1OCT C;  4IHX A;  3RKQ A;  4MFD A;  3G1M A;  1HOM A;  1H89 C;  3LSP A;  2HXI A;  1AKH B;  2DTZ A;  5FKN A;  4BBS J;  3GTP J;  1X2M A;  1O4X A;  1HF0 A;  1ETX A;  1WCM J;  1K61 A;  5F27 A;  1ETO A;  4M3G A;  1I6H J;  1JJ8 C;  1Q1V A;  2R5Y A;  3LOC A;  2EZK A;  2YU9 J;  3FK6 A;  2R7Z J;  1BJZ A;  3BG5 A;  3HBL A;  5EG0 A;  1RES A;  1LFB A;  5HOD A;  5K7H A;  1DU6 A;  1HCR A;  2ME6 A;  2LK2 A;  2LTP A;  5J1R A;  3VPR A;  1MH4 A;  2N8G A;  1TWG J;  2EZH A;  3G1O A;  3BTJ A;  2IEK A;  5FKK A;  2Y0S N;  1TWC J;  4A93 J;  1VND A;  1MBH A;  4QTR A;  2XPW A;  4MIM A;  4Y7N J;  1JKO C;  3D1N I;  5FKO A;  4EEF G;  2L7Z A;  3HDD A;  3SJM A;  3HKZ N;  2WB1 N;  3FIW A;  3SDG A;  1ETV A;  3O8H A;  1MSF C;  5FKL A;  1ORK A;  2XB0 X;  1JUS A;  4MLO A;  4XIC A;  1ZR2 A;  5EG0 B;  2D5V A;  2AO9 A;  2NVY J;  3HOV J;  4M3F A;  2DA5 A;  1RPW A;  1ETK A;  2DA2 A;  4XK4 A;  2HOA A;  3ZOB A;  4D7N A;  3S2D J;  1JUP A;  4BY7 J;  2DMT A;  2R0Q C;  2ECB A;  4A3E J;  2GBY A;  2K9Q A;  1GV5 A;  3K7A J;  4AC0 A;  3H3V K;  1TC3 C;  5C44 J;  3C2B A;  4D5C A;  3H0G J;  4CYC A;  3F0C A;  2O7O A;  3L1P A;  2ME0 A;  3BT9 A;  2LLK A;  5JLX A;  1I3Q J;  2QCO A;  1T33 A;  2Y30 A;  5JLW A;  2VKE A;  2FD5 A;  4IHW A;  3BQY A;  4C3H J;  4IHY A;  3OSG A;  2CUE A;  1Y1W J;  3K2A A;  3CQZ J;  2XGE A;  3JR9 A;  1YRN A;  4RDU A;  2EZL A;  4G12 A;  3HGY A;  3HEF A;  1B72 B;  3GTG J;  1FTZ A;  2NVX J;  1Z77 A;  5E3N A;  4A3C J;  2MGQ A;  1B8I B;  1RR7 A;  2B63 J;  1F43 A;  5DTD A;  3ZQC A;  2IBD A;  2WAQ N;  3RQI A;  5IP7 J;  3S14 J;  2GLO A;  1EF4 A;  3BQZ A;  4W1U A;  3S16 J;  1T56 A;  5EGO A;  3S1N J;  3BTC A;  2LR8 A;  1LFU P;  1X58 A;  4B4C A;  3A01 B;  2JA5 J;  1AKH A;  2RAE A;  1K83 J;  3IH4 A;  1QPI A;  1JJ6 C;  3MVP A;  3TED A;  2HYJ A;  2XPU A;  5F0C A;  1GV2 A;  1SAN A;  1MBF A;  1X2N A;  1B72 A;  2JMW A;  5F0H A;  4X1E A;  1H88 C;  2HOS A;  4DYR A;  1ZKG A;  2FJ1 A;  2HDD A;  4GFB A;  1UMQ A;  2ELK A;  5EZG A;  2R5Y B;  2HXO A;  2DA6 A;  2E2H J;  3Q0U A;  3G1L A;  2DMQ A;  4M3D A;  4I6Z A;  2LY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...