4DYQA

High resolution crystal structure of terminase small subunit gp1 of the bacterial virus sf6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
molecule keywords Gene 1 protein
total genus 37
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dyqA01
5K7ZA 4A3IJ 4EEFG 2DMNA 4B3AA 3GTPJ 1MBEA 1IDYA 2HXIA 5J1RA 2IAIA 1OCTC 4B1RA 3WHBA 1ZK8A 5GPCA 2DN0A 1OJLA 4JYKA 3LSPA 4W1UA 1Z0XA 4DYCA 2H1KA 3BTLA 3Q0UA 1ETOA 1MH3A 2ID6A 3FIWA 2MGQA 5DS9A 2JMWA 1ZKGA 3S17J 2DA4A 3GBGA 1DU6A 3IV5A 4A3MJ 4FISA 3JRFA 1VF9A 1ORKA 3CMYA 3S14J 5BNGA 3B6AA 4BBRJ 5IYBJ 1XC5A 1IJWC 1EF4A 3A01A 2AO9A 2COBA 3JRCA 4D7NA 5F0FA 5E3NA 5FKKA 5C4JJ 1I50J 2JJ7A 3E7LA 2M2EA 2FX0A 2GM4A 5DTDA 4A3KJ 1FIPA 1BJZA 4MO7A 3B6CA 3A03A 3ZOBA 4AYBN 2B63J 2ELKA 2KT0A 4FE4A 2Y31A 3GTJJ 2DMUA 1GVDA 3CCYA 1OCPA 5IP9J 2Y0SN 2XRLA 2LY9A 1ZGWA 1SFOJ 4X6AJ 1H89C 1X2NA 2MG4A 2L7FP 4DW6A 5IP7J 3BG9A 4BBSJ 3SFIA 2R5YB 4BY7J 1A5JA 3O8HA 2Y30A 2WB1N 1NTCA 2YS9A 1FIAA 2LD5A 1B8IA 2HI3A 4MFEA 4MFDA 1ITYA 5FKMA 1X2MA 1LE8A 1BW6A 1JKOC 1SANA 1NK2P 1IV6A 4IHWA 3GTKJ 3OSGA 2O9LA 1Y1VJ 2N8GA 1JTXA 2TRTA 4D5CA 5FLVA 1ETYA 3PO3J 3OIOA 2NS8A 1ETVA 1IDZA 1JUPA 2HOTA 2VPRA 2QCOA 1RPWA 2OPTA 1RR7A 1ETKA 4JP0A 4XRMA 4V2FA 5IPAA 2LK2A 1UMQA 2CU7A 2GBYA 4MIMA 1LE8B 2CJJA 2CQQA 3S1NJ 2Y9YA 1MBHA 1FEXA 1I6HJ 2DMTA 2E1OA 1AHDP 5F0HA 2EZLA 4XK4A 3TW6A 1JKPC 1IUFA 1BL0A 2XGDA 3HBLA 5FKNA 2KDZA 2EZKA 1JTYA 1ZR4A 2ME0A 3BTJA 1U9OA 1X58A 2HXOA 2XPWA 1TWCJ 1RESA 4MLOA 3RZDJ 1ENHA 5M3FJ 1B72B 3K7AJ 2JA5J 5FLMJ 1VI0A 2LTPA 3MN2A 3G1LA 4JX4A 3PM1A 4JX5A 2YU9J 1RKTA 2LVSA 1O4XA 4FTHA 2EH3A 5EGOB 1S7EA 1PUFB 3Q0VA 1F36A 1MBFA 1OFCX 2L7MP 5IP6A 3JRIA 2ECBA 4L5EA 5M5YJ 3SJMA 1JJ8C 1ETWA 5M3MJ 3HB9A 4C3IJ 5J1YA 1JKQC 1H88C 2XPUA 1H8AC 2LKXA 1Y1WJ 1BA5A 1U9NA 2X9DA 3IH3A 4A3EJ 2JA6J 3ZQGA 1TWGJ 3RQIA 3HKZN 4A3GJ 4CYCB 3GTMJ 2X48A 3JRAA 2DA2A 4LOCA 1K83J 4QSHA 2VUMJ 5E3OA 4G12A 3LSRA 4HNVA 5GPAA 2JA8J 3M3YJ 3NAUA 1JGGA 5M5WJ 3H0GJ 2XGCA 3L1PA 1TWFJ 5IYCJ 2HOSA 3BR1A 2M34A 2EQRA 3VPRA 1QRYA 4Y7NJ 2M8GX 3G1OA 3LNQA 1WH7A 2VI6A 1W0UA 1T56A 3MKLA 3HOZJ 3W6VA 5HODA 2DJNA 1WCMJ 5FKLA 5EZGA 2L7ZA 2L9RA 5J1UA 3HOYJ 2JA7J 1HOMA 5E3LA 2EZHA 1DU0A 5EYRA 2R5YA 3HDDA 3HOVJ 1JT6A 2NVXJ 2R7ZJ 1YRNB 2G0EA 2E19A 1U78A 3BQYA 2E2JJ 2FD5A 1HCRA 2DTZA 3S1RJ 4I6ZA 1Z77A 1MSFC 3RZOJ 2P81A 4AC0A 1JUMA 3BG5A 4XIDA 1GV2A 2RAEA 3CDLA 3JR9A 2I10A 1HLVA 3BT9A 1JKRC 1RKWA 1QVUA 5EF6A 4XICA 1APLC 2MW8A 9ANTA 3BQZA 1CQTA 5EEAA 2E2IJ 1MBGA 4A3BJ 3O8GA 3RKQA 1RETA 1JT0A 3ZQIA 1QPIA 4D7MA 3GTOJ 2WV1A 3TP0A 2HOAA 2ZB9A 2ID3A 5C3EJ 1Q1VA 4C2MJ 1VFCA 5FKOA 3HOXJ 4BY1J 5FJ8J 4UUSB 3LSJA 5E3MA 4A3CJ 1A6IA 4A3FJ 2DMQA 1VNDA 5K7FA 2MSYA 3Q0WA 3WHCA 4DYQA 4BKXA 5EG0B 3C2BA 2GLOA 1WGXA 3OSFA 2HQ5A 3UKGA 2CQXA 2CUEA 3BR2A 3CQZJ 1JUSA 1ZTRA 2VKEA 3BR3A 1TC3C 2LLKA 1QVTA 4W97A 4D5FA 5EZHA 1ZR2A 3LOCA 2R93J 2LR8A 2IEKA 4M3GA 3FK7A 3S2HJ 4UUSA 2R92J 3ZQHA 1POGA 2NVTJ 3GTLJ 3LSGA 3Q3SA 2NS7A 1U8BA 4M6VA 1IRZA 1MBJA 2X6OA 1JJ6C 1F43A 1B72A 3G1MA 4M3BA 3S1MJ 3HGYA 1MBKA 2M0CA 1AU7A 2OF7A 3JRBA 1I3QJ 5C4XJ 4QTRA 3JRHA 5J3LA 4CYCA 4I76A 1MNMC 3M4OJ 3BG3A 1P7IA 2LP0A 4S0HB 4ABZA 2EZIA 3HGGA 3GTQJ 2K9QA 1AKHA 1WPKA 3QQAA 4X1EA 1TWAJ 1IG7A 3I4MJ 2CUFA 2WAQN 1UG2A 1E3OC 3TEDA 1IGNA 5IYDJ 3TW7A 1K61A 2DA5A 3QPSA 2PMZN 3S1QJ 2W48A 5JLXA 1LFUP 4IEJA 4XRSA 3ZQCA 1FTZA 1G2HA 1ETXA 3H3VK 3A02A 1WH5A 3K2AA 3JRDA 2M9HA 4FE7A 1BW5A 3S15J 2DA7A 2YUSA 3S16J 3BTCA 4RDUA 4UUTA 1B8IB 1W0TA 4A3LJ 1R9TJ 5C44J 3PO2J 4NDLA 2E2HJ 2IBDA 2L0KA 1MH4A 2XB0X 5F1JA 1HDDC 2QF7A 4QIWN 5IOYA 2DA6A 2ECCA 2K9NA 3FK6A 1XG1A 2R5ZB 4AUXA 4FCYA 2CRGA 2K9SA 3F0CA 3HOUJ 4Y52J 5EGOA 4J19A 1UHSA 2Y9ZA 3FISA 4A93J 1ETQA 5M5XJ 2D5VA 4DYRA 1FTTA 3HOWJ 4B4CA 1LFBA 1YRNA 2LFBA 2XGEA 4DZJA 1XS9A 1WI3A 3FKIJ 1GDTA 3GTGJ 4IHXA 2XPVA 1IC8A 1FJLA 2R0QC 1AKHB 1PUFA 4A69C 2VKVA 2JWTA 3QPLA 3D1NI 1T33A 5GP9A 3ZQLA 3BR5A 2HDDA 5F04A 4M3DA 3JREA 3MVPA 3OOUA 2Y2ZA 4IHYA 1P7JA 3BTIA 4GFBA 5IOZA 1GV5A 3DEWA 1HDPA 4XRSG 2ME6A 2FJ1A 2JK3A 3TP3A 2HYJA 1MSEC 1ZQ3P 4IHVA 5EDNA 4C3HJ 2FQ4A 2O7OA 3ZQFA 4RBOA 2NVQJ 2AHQA 5F08A 5EG0A 4V2GA 3A01B 2DMPA 2JN6A 3NARA 1GUUA 1TWHJ 3IH2A 3IH4A 2K40A 5F0CA 3HEFA 5JLWA 4A3JJ 4M3EA 2NOGA 2NVYJ 3HM5A 4BXXJ 3I4NJ 4M3FA 4C3JJ 4DZPA 1GT0C 2H8RA 3SDGA 2XSDC 2R5ZA 1HF0A 1NK3P 2DA3A 5F27A 4JX6A 2TCTA 2EBIA 3BR6A 3BR0A 3JRGA 4A3DJ 3S2DJ 5K7HA 2O8KA 1D5YA 2DA1A 2XB5A 3DCFA
chains in the Genus database with same CATH superfamily
5ICGA 2M4GA 4A3IJ 3QPTA 1L3LA 2DMNA 1MBEA 1IDYA 4NC8A 1SAXA 2HXIA 3KP6A 4D9JA 3OY9A 2DN0A 4JYKA 3PIOF 3OS1A 4XKVA 3H5NA 5HVQC 2UXXA 1KU2A 3BTLA 1ETOA 2ID6A 4XR6A 2MGQA 5DS9A 5HOOA 2VIXA 2F5EA 5DV5A 1DUXC 1LUJB 2LBFA 3M8JA 2CMPA 5J6XA 2HYGD 1B1BA 1FOWA 2K3FA 1XSDA 3MAJA 3FXJA 3OYIA 4AYBA 3CMYA 2IRFG 4IHSA 1EF4A 5AIPA 2KLOA 4UV9A 4YIFA 2M3AA 1I50J 1N78A 4LGWA 1LEBA 2ZBKA 1FIPA 4NUBA 4HNUA 3LMMA 3WTWC 3B6CA 1KQ9A 2W84A 3ZOBA 1MKMA 4AYBN 2VODA 2DFHA 3OYHA 2GXAA 5KAIC 1OISA 1W1WE 1ZLKA 4YEJA 1OKRA 5H20A 2L2OA 3RYPA 1VQPI 3BC8A 2EIKH 4R79A 1KZHA 2LY9A 1ZGWA 1SVMA 4U0WA 1H89C 2MG4A 2L7FP 1B9MA 2R7OA 2HDWA 1FYLA 4Q4ZF 1GVJA 2GOXB 2Y30A 2YS9A 4LG0A 3HKZA 2O03A 1LKXA 1S72I 1FBQA 1XN7A 3NWTA 3R61A 3RCOA 3M9AA 3GTKJ 4PDKA 4HRIA 4EQQA 2LMDA 4I99C 1IRXA 1VQ9I 4YFNF 2N8GA 5FD5A 1ZN2A 3PO3J 3PUBA 3K69A 4HDVA 4XMYA 3CUQB 4E7LA 4XRFA 2VPRA 3CMEI 2K9MA 2OPTA 1ETKA 5CQEA 4XRMA 4PCQA 3H9QA 1J5YA 1TBXA 1ODDA 4U7DA 4ON0A 2HPMA 3S1NJ 4GRIA 4ZH4F 5HLHA 1I6HJ 2KPMA 2HU9A 1VQMI 4C9YA 5KCMA 4XK4A 1W5CC 5H6QA 5D5VB 3TW6A 2STWA 3RTRA 1XCBA 5D5UB 2XROA 1XD7A 3K4JA 1A31A 1HA8A 1TLHB 1BL0A 4LG3A 3FXQA 3CCSI 1JHHA 1WJFA 3U1KA 3FDYA 3LL7A 1WJBA 2ME0A 1U9OA 3OYFA 1H9TA 3X2QH 2FBIA 4IL6C 3MZHA 1TWCJ 1XGSA 3RZDJ 3NEUA 3I64A 4L9NA 1B72B 2QM3A 2HTSA 4MGRA 3ZP5A 1FY7A 1WFXA 3MN2A 4E7IA 1W7PD 3A1YA 1RKTA 1P92A 2NNYA 3L2VA 5L3DA 1MBFA 5FROA 1SD5A 4ZYHA 3G71I 2DK5A 4IVNA 1MJAA 3CDHA 3M8FA 2BOLA 3SJMA 3HPGA 2DAOA 3HB9A 1R7JA 5J1YA 4XSZF 1H8AC 1BA5A 4B47A 2X9DA 4RGUA 4A3EJ 5DDGA 1TWGJ 5LRRA 3W2AA 1YW7A 3P5JA 1TNTA 4EJWA 2K02A 4H0EA 3GEZA 1YE9A 2HQRA 1K83J 4OU0A 4QSHA 1J75A 4EATA 2EIJH 2IS6A 4FETA 1MMAA 2EINH 2JUCA 3Q9VA 1GXPA 1ZLJA 1FBUA 2V9KA 4HF1A 3W2VA 4CDGA 4DOZA 2BBYA 2M0MA 2ZFUA 4HYEA 3TDUC 2KL4A 5IYCJ 1Z6TA 1QZYA 1S8NA 4Y7NJ 4LB6B 1QRYA 3FXOA 5EEHA 4CCLA 1W36D 2K9LA 4F52A 5GTIC 1Y56A 1EKEA 1WH7A 3TO7A 3ZGKA 2DT5A 1W4MA 1T56A 3ASNH 1IN4A 3RSNA 1N75A 2M87A 3DLAA 3W6VA 1P6RA 5J8CA 5J1UA 1P2FA 2EV6A 1R1VA 1BC7C 5CVJA 3FBIB 3NRVA 2FOWA 1ZYRF 2ZFWA 2P6SA 3W2WA 3CC4I 2V9PA 1N25A 2X6XA 1G3SA 2Q1ZB 2NVXJ 1YRNB 2G0EA 4S04A 2ZCWA 2F4OB 1E17A 3IAM2 5FRNA 1I1GA 1I27A 1HCRA 2DTZA 3S1RJ 3V7SA 1MSFC 1JUMA 2EJRA 1WJAA 4LK1F 3ZR8X 2HGCA 1AWCA 1BI1A 4XICA 5GTHC 4UV8A 1Z05A 5EEAA 1MBGA 3OOPA 3MD2A 3LFKA 3U21A 2QQ9A 2ZMEB 2E1MB 4M9XA 3EUHC 3A0BC 1JT0A 4MQVA 1STZA 5LFAA 3H9GA 2GAUA 4BAYA 2KRCA 4G8XA 3P7NA 2ZB9A 2KFDA 4U88A 4BE0A 1LEAA 3IRQA 2JSCA 4EV0A 4KIFA 4X0GA 1VNDA 3Q0WA 4G94A 3ZMVA 2BVLA 3WHCA 1OCZH 2E1CA 2X6YA 4CH7A 4KNYA 4OAYA 4UB8C 3BJ6A 1JGSA 1ZGJA 2MH9A 1XMXA 2G7HA 3KZZA 1XX5A 4XQFA 4YG2F 1E0EA 4ASNA 4D5FA 2GIZA 3HSFA 5ED4A 1O7LA 2VKDA 1QHHD 2IEKA 2L3DA 2CUZA 4M3GA 1USSA 2QKMB 2WB1A 3WTTC 4F3QA 2FEZA 2R92J 2W24A 5IT9K 1POGA 3WODF 1USTA 2FU4A 1BN5A 3SXYA 3K1MA 2CFOA 1XMAA 3FXRA 1MBJA 2X6OA 2V26A 1LFPA 2WY7Q 4F91B 3ZMTA 4JQFA 4XLPF 2ZMEA 3F22A 1MBKA 1EA3A 3QYEA 2F4MB 1GXQA 3CCRI 4PJMA 1I3QJ 3HSEA 2COMA 1FPQA 1YW8A 2FA5A 4H4KC 1EJ9A 2FUG2 3HYIA 4M72A 1JE8A 2XIGA 3HGGA 4PJLA 3GTQJ 2K9QA 4L9JA 3WU2C 5K5OA 3QQAA 4X1EA 1IG7A 2WAQN 1E3OC 2QSGX 4DNCA 5D6EA 2E35A 3OYDA 4BJ6C 4G9YA 3K1PA 3QP6A 2FOKA 5JLXA 1ON2A 4IEJA 3A0HC 2A68F 3ERMA 2KKOA 4Z2YA 5JVGF 1DP3A 3G3ZA 1WHUA 1FTZA 4B8XA 4CYDA 1QU3A 3LSHA 3A2KA 3K2AA 1UHMA 1D1AA 4IHTA 1V5GA 4CO8A 2QYOA 3S15J 2DA7A 1WVRA 3AG3H 3S32A 4A3LJ 3ZRGA 2A5WA 1R9TJ 3TQNA 2R7QA 5C44J 4AIJA 1DGWY 3ABTA 3PO2J 5ERIA 4L9VA 2IBDA 2L0KA 4G6TB 1MH4A 3HTSB 2VB6A 4PK4A 2K4JA 5F1JA 4PJNA 1HW2A 2XF6A 2K9NA 2GQQA 4FCYA 3FZVA 2CRGA 4PZJA 2K9SA 3HOUJ 4Y52J 5EGOA 4J19A 2RN7A 5FFZA 2Y9ZA 4I02A 1IRGA 4A93J 3LQQA 3DPTA 2D5VA 4DYRA 1ON1A 3HOWJ 4B4CA 3DTEA 3BZCA 2BV6A 3QYFA 2PBIA 1XSVA 2DOEA 2L01A 5F64A 5BQTA 1W36C 1S3JA 3FKIJ 4KT5C 4I01A 2XAUA 1GDTA 4IHXA 1IV8A 2XPVA 3HXLA 4XLAA 4XORA 3CCUI 3CP2A 2HQAA 4F55A 1TNSA 1AKHB 3H5RA 1SD7A 2P7CB 2P4WA 4BJTA 4A12A 1MJ9A 2MA3A 2X1EA 3QPLA 3BWGA 1J9IA 2MLGA 2HDDA 2EA4A 3U1DA 4XOTA 4BHCA 3MVPA 1P7JA 1ACIA 2PMHA 3BTIA 1ZHFA 2LSOA 2PFBA 3EUKL 3HOTA 5IOZA 1GV5A 3DTIA 2A69F 3VB2A 5D5WB 4BHBA 1HDPA 3PNVA 1QO0D 2FJ1A 2JK3A 2ME6A 2IS4A 3TP3A 2STTA 1XGNA 3PQJA 1LDJA 1XGOA 2BW3B 2X51A 3IWFA 1B6AA 2JRTA 3KETA 3D0SA 1WRJA 3ZQFA 3AFHA 4IF4A 2AHQA 3TGNA 3A01B 2DT7B 4M74A 1J7KA 2DMPA 3NARA 4I0AA 2K40A 3JTHA 1IXCA 5F0CA 1KYWA 2X4HA 3W6JB 5L3CA 3OYBA 3RJPA 3DU6A 2Z2SB 4I0BA 1G3TA 4HA8A 3RKXA 2KISA 4NBQA 3ZMUA 2Z99A 3KP2A 4CZCA 4II2A 2DYRH 4YIRX 2L9SA 2XSDC 1IW7F 1HF0A 2BXYA 2DA3A 2VJIA 1YHQI 1Y6IA 2K27A 4XKBA 3JRGA 3S2DJ 4XN3A 2DXIA 3KFWX 1Z3YA 3DBLB 4B3AA 3CUOA 4XONA 2XAFA 3QU6A 3WTZA 1F9NA 2L4AA 2XV4S 3E1SA 3R0AA 1VQNI 3KCCA 1SFUA 3IKVA 2H1KA 3Q0UA 1MH3A 2WAFA 3K4KA 2JMWA 2K85A 2PJRA 5DCMB 1QQIA 1FOYA 1MMDA 2JVHA 4AU7A 1ZKGA 5HNFA 3GBGA 3S17J 4U87A 1DP7P 1YQAA 3H1CA 4ZJZA 1G3WA 1U0JA 4A3MJ 3K10A 4FISA 4UVCA 5DM6F 4WX9A 1R22A 2IPQX 3B6AA 1XC5A 1XMKA 4ANJA 1XPXA 3A01A 3VODA 1OMIA 4IKFA 4Z6YA 1FMVA 4NB5A 2E34A 2Y75A 5DTDA 2A05A 2QKLB 2ZNYA 1BJZA 4EGYA 2HPIA 3FMQA 1V55H 1LB2A 3E97A 5E17F 1R1UA 2R7VA 2Y31A 3GTJJ 1GVDA 3CCYA 1BOAA 1OCPA 1TW3A 4M9ZA 5LBQA 1R5HA 3RPQA 2Y0SN 2XHKA 3I4PA 3K4MA 4YFXF 4OWRB 4PUSA 4QLCU 2DODA 5IP7J 3SFIA 3K4NA 1A5JA 2NXNB 3Q9SA 2LF8A 2L9VA 1FIAA 2LD5A 1B8IA 4XNFA 4IRHA 4MFEA 3VYUB 5FKMA 1X2MA 5B1AH 1LE8A 1SANA 1IV6A 3CJQB 1V3FA 4IOCF 4YRVA 2O9LA 5B1BH 4M71A 3DBHB 1JTXA 1DQUA 2CQ7A 2CW0F 3BJAA 3VYTB 3LAPA 3K4BA 1LDKB 3VEPA 4MEXF 1KQ0A 5JHUA 1RPWA 1TP4A 5FFXA 1RR7A 3TL4X 3J81Z 1XGMA 3TO6A 1IN8A 3F8MA 2IGMA 4D0PA 3HOSA 1VQ7I 1UMQA 3AG4H 4MIMA 1BIBA 2GXGA 1TQIA 3N97A 4BDYA 2D1HA 2Y9YA 1MBHA 3J7YJ 2DMTA 1K4TA 4HG2A 4FHTA 2EZLA 1MDMB 4N4NB 3WU1B 2ADUA 1EV7A 2A6HF 3JTGA 2O3FA 1IUFA 3GMEA 5KVRA 3ZN1A 5E1ZB 3ABMH 3KLOA 1IUYA 3HBLA 3E5XA 4BJ5C 5KHDA 2DLLA 1ZR4A 2CW7A 1TT5B 1X58A 2HNHA 2HXOA 1E2XA 1U5TB 3QODA 1VZ0A 2QEXI 1TZLA 1J0RA 1RESA 5M3FJ 2OJED 2GOMA 2JA5J 1HBXG 1MZBA 2LTPA 4JK1X 2LDUA 2V1NA 4RGRA 3V8KA 4JX5A 5ICEA 2LVSA 4MEYF 1RNLA 3FWEA 4BDZA 3RPUA 4L5IA 2VE9A 2M1BA 4HF0A 1F36A 1OFCX 1MMNA 2WWYA 3LA7A 4E4HA 5AONA 1JJ8C 1ETWA 1DPUA 2A3SA 1G59A 2VL8A 4IJAA 4KMFA 2BE5F 4L9TA 2XPUA 4U0YA 1H88C 3I5UA 1Y1WJ 3PQKA 1UELB 2WAEA 2JA6J 3HKZN 3GTMJ 2CS3A 5JVTA 2E71A 3JRAA 2FMYA 3VYRB 1YYVA 4FX4A 5CVVA 5L3BA 4A0YA 2VUMJ 2DJIA 5LEKA 1FBSA 2F5DA 4G12A 2DTRA 4HNVA 2V7FA 2IGOA 3DFGA 1IXRC 5GPAA 1RUNA 2ZJPF 1RUOA 3H5AA 2M30A 3OYNA 3M3YJ 1HXDA 1LPQA 2X1DA 3F8NA 3NAUA 3ONQA 3DU5A 4UXNA 2Z9OA 4LB5A 1JGGA 5FLXK 4P96A 3K1NA 3CCMI 2KRHA 3AG2H 2XGCA 2HOSA 2XDVA 4MTEA 1P4XA 2E1NA 2M34A 4WCGA 1V54H 2EQRA 3VPRA 4DGWB 1ZRDA 2L7KA 2Z3YA 3G1OA 3CO7C 3LNQA 4NQWA 1W0UA 3ESWB 1UHWA 2ESNA 3OMYA 4ETSA 4RB0A 3DF8A 1R1TA 5FKLA 5EZGA 1KU7A 1S5LC 2L7ZA 3F23A 3ISPA 1HOMA 1YI2I 4HW0A 3HDDA 2LY1A 3CUQC 3GXOA 3HRMA 4MTDA 1R6RA 1IAWA 4L0ZB 3HRSA 1HKTA 1DDNA 3MEXA 2E19A 2B7EA 2NVUB 2Y0SA 3BQYA 1R00A 4QWQA 3D5LA 1SFXA 1EH6A 3AKZA 4XIDA 2KIFA 2LG4A 2LYCA 3GLLA 2JVGA 3JR9A 1HLVA 4QPQA 1JKRC 1EH8A 3J7AO 2H94A 1QZZA 2ISYA 3GLXA 1QVUA 2K86A 9ANTA 3BQZA 1CQTA 4AIDA 3O8GA 2NS0A 3PNYA 2FMLA 1SC7A 1FMWA 3GCMA 3WTSC 3TP0A 4E7KA 2CO5A 2D2WA 1ONVA 2ID3A 1Y39A 5C3EJ 2ZXJA 1LVAA 2HS5A 3WGHA 5FKOA 1ZH5A 2XASA 5E3MA 2BHZA 5HLGA 1ZARA 5K7FA 1RRJA 1FLIA 2RNJA 2VLAA 2PI0A 2ZMEC 1PP8F 3DTKA 1R5ID 4XM3A 3C2BA 2YX7A 5HDGA 2AXTC 2LNBA 3LSKA 4MHGA 2HQ5A 3BZ6A 3UKGA 3C18A 2CQXA 3HTUA 1T0FA 1YJWI 3CD6I 4UVAA 1BI2A 3CQZJ 1JUSA 1ZTRA 2VKEA 2ZNZA 3KLNA 3DLLF 1T39A 1YTYA 1X1AA 1OCCH 3CCLI 2GWRA 2R93J 2LR8A 2BY1A 2P5LC 5CVRA 2MC4A 3BLYA 4CSWA 3FM5A 2ZJRF 4CHUA 4WWCA 2ZXHA 1FOKA 1YS7A 3IUOA 3Q3SA 3ABUA 4O3MA 4ESBA 1LNWA 4IZZA 3ZMDA 5D5XB 1F43A 3I0TA 1B72A 1B59A 2H6CA 3G1MA 3VWBA 2RQQA 4HEA2 4ZDPA 3JSPA 1AU7A 3EYIA 2MLKA 2R4GA 2L54A 4EGZA 4RAZA 1XCVA 5J3LA 4CYCA 5J4YA 1MNMC 3FHNA 2FSWA 2LREA 1P7IA 4S0HB 4ABZA 3GZ6A 4KISA 2W1OA 5LHGA 2Z5UA 4GGGA 2W57A 3SQNA 1T08B 1YJ9I 1N77A 3CUQA 5A2QK 4EM1A 4ITVA 1YOVB 3E6DA 1TL8A 4XL9A 3BJOA 2O0YA 4RGSA 4HDUA 2QWWA 4PSWA 5DUKA 3R60A 1R4MB 3QPSA 3FXKA 3ZCOA 2TDXA 1X3ZB 4WF2A 1LFUP 2HVRA 2HYFA 1G4DA 3O6BB 2NRAC 2MD0A 2FXAA 3I59A 1SMYF 1P4AA 4CXFA 1OPCA 4OIPF 1RZ4A 1WH5A 2VE8A 3KZYA 1FP2A 1X3UA 3JRDA 1TQPA 2M9HA 1OYYA 2LRDA 2BY3A 4FE7A 2PJPA 1I5ZA 2GA2A 4BH9A 1R4NB 1D8KA 2CWEA 2HR3A 4B3XA 2DPUA 3C3WA 5CJ9A 5HS8A 4UUTA 1B8IB 4XOPA 1IZ1A 3GO5A 3OWTA 4NDLA 2VN2A 2E2HJ 2A61A 3HRTA 4UNOA 1XTAA 5H2FC 2XB0X 1KQ8A 2RC4A 3S3NA 5GADJ 2HQNA 2QF7A 2LC2A 5IOYA 1D1CA 3FK6A 3M7GA 1XG1A 2P8TA 2R5ZB 2UV1A 4BL0B 5K5RA 3QRFF 1UHSA 3FISA 3HIFA 3K70C 2DO7A 4RGXA 5M5XJ 3IKTA 2B0LA 2P7VB 5CKTA 2OC6A 2DOAA 2IJLA 3OS0A 2XKPA 1X1BA 3RDIA 3CC2I 1YLFA 1YRNA 3PSFA 2HVQA 1UB9A 3NWSA 4E7JA 5L3EA 1F1ZA 2Z1DA 4P5OA 2DYSH 5GAHJ 3G2BA 1IC8A 2VXDA 4HQMA 4EM2A 1FJLA 3CMAI 2BW3A 4PFOA 4A69C 2H09A 5IY5H 4BQQA 4ENNA 1T33A 5GP9A 3BR5A 2ESHA 3AG1H 4HBLA 5HS9A 4FASD 1WSUA 3JSOA 2HDCA 4GDFA 2V9VA 4M3DA 4BEHA 3OOUA 2CFXA 1K6YA 1Y0UA 4G6QA 1Z6RA 2BY0A 3WTYC 1I6XA 4GFBA 4BEHB 1X19A 1JI8A 1P9QC 5ILVA 1PJRA 2DT6A 2LBFB 2IGKA 4DJAA 2FNPA 2CG4A 3RKYA 3GFIA 2H27A 1MSEC 3BG6A 3G4SI 3T0YA 3CO6C 5D4RA 2FQ4A 2CV0A 3S2WA 2L02A 3MKYB 1WJ5A 4IXAA 4XLFA 1TWHJ 3DQVC 1DGRM 4Q48A 1SD4A 4DIQA 3LA2A 1SVOA 3HEFA 1ZG1A 1UAAA 1B4AA 4A3JJ 3GWZA 4BGDA 3HM5A 3TBIA 1OR7C 1P4WA 1JHFA 2KHMA 4DZPA 3JW4A 3HC7A 3ECOA 2EILH 4Y13A 5CYVA 3HHGA 3EUAA 2TCTA 3F9KA 2R3SA 3PUFA 1O57A 2VXZA 3RI4A 1R36A 4A3DJ 2JPBA 3F6VA 3CF5F 5K7HA 3V8LA 1MW7A 3J81K 3GTPJ 2ZJQF 5J1RA 2IAIA 4B1RA 4F92B 2VBZA 4UY8I 4OMYA 1Z0XA 2X1CA 4GYIA 4HX8A 3FF5A 2KJCA 1VQLI 3C7JA 3I56I 1I39A 3G6EI 1DU6A 1IO2A 3K4CA 5LGUA 1GLNA 2DK8A 3IV5A 1OYIA 1KU9A 5DYMA 1Z7LA 2ZC2A 3TOAA 4EJVA 3JRFA 1VF9A 3MZYA 1BJAA 2E60A 3E6BA 4BBRJ 3KPHA 1D0ZA 5IYBJ 1OCRH 4HF2A 4BUPA 3DXJF 1IJWC 2BEOA 2ETHA 2COBA 3N4MA 2ICWG 1R23A 4D7NA 1MGTA 5F0FA 3KYLA 2K5CA 5FKKA 4BXUA 2JJ7A 2YR2A 1U6GA 2M2EA 5ICFA 2GM4A 4A3KJ 4M6YA 2Z33A 2B63J 1WWXA 4NC7A 2OQGA 4FE4A 4I7HA 4CA0A 4DBRA 2DMUA 5GAEJ 2E7XA 5IP9J 2R7XA 2DCEA 1KGSA 5B3SH 5K1YA 2VBXA 1VQKI 1H9GA 3V4GA 4ESFA 2XRLA 4HX7A 1X2NA 4R1HA 3GZ5A 4U7BA 4BBSJ 4G6DA 1J59A 2PEXA 2V1DA 1A36A 3DPLC 1VQ5I 2OZUA 4N0BA 3O8HA 3ZQ7A 3QWLA 1BI3A 1J09A 2OCEA 2LKPA 4MFDA 1KYZA 5BPIA 5CVUA 2KIMA 2PMUA 1JKOC 1TT0A 1NK2P 3I53A 4KT6A 2F5CA 3KEQA 4IHWA 4LG0B 4BU2A 4L18B 3BG7A 1Y1VJ 4I09A 2TRTA 4D5CA 4AIHA 1ETYA 5D8LB 3OIOA 3BCBA 4A5MA 3OIPA 1TW2A 1I1SA 2NS8A 1ETVA 1IDZA 1JUPA 4ENMA 2A5YB 2QCOA 4XKWA 5EEGA 4JP0A 4LLGF 4RB1A 3E5QA 4V2FA 5IPAA 4HOBA 4XSXF 3ZPLA 2MYSA 1ZELA 2F2EA 1RR8C 2A6TA 3IHUA 3FXLA 1LE8B 2JTVA 2VJ5A 3BROA 3S8PA 3FHZA 2R7DA 2V4JC 4RAYA 1AHDP 5F0HA 1VQOI 3GX4X 4LFUA 4FQGA 3VOEA 3GFMA 5DD8A 1MNDA 5TRDA 1OR7A 4B44A 3K70D 2XGDA 1B9NA 1OCOH 4AM3A 2OBPA 4IOAF 2W00A 3BTJA 1LQ1A 4I98B 3HJEA 2XRNA 3M1CA 2Q2EB 3H36A 4BE2A 3CCQI 1D5VA 1ENHA 1QHGA 4N4OB 2IGNA 5E8IA 2V79A 2CH0A 1VI0A 2VT2A 1FYKA 2AXLA 1YX5A 3G1LA 3KP7A 3PM1A 2YU9J 2O61A 1O4XA 2XAJA 3SFZA 4FTHA 2EH3A 2IP2A 1S7EA 1PUFB 3HPHA 2QBYA 3Q0VA 2BZTA 4PJ0C 3IWZA 3JRIA 1O3RA 3TOBA 4L5EA 2KZGA 4LLNA 3W3CA 2E1MC 2BY2A 4C3IJ 1R49A 1JKQC 3DP7A 3PJRA 4HNTA 4EJTA 5CPRB 2HVSA 2EFWA 3TDZC 3ZQGA 1SFKA 4RB3C 2EB7A 2VJJA 3ELKA 4ZYDA 2RDPA 3PL8A 3L9FA 3GFLA 4DQ2A 1WJDA 4P1WA 5L3FA 4ZDLA 2H8WA 3PSIA 4O5VA 4UB6C 2EFPA 5E3OA 2ACJA 1SD6A 2ZXWH 1X3WB 3LSRA 3R0JA 4A5NA 3SZTA 2LY2A 5D6FA 1Z3XA 1U2WA 4WXDA 4CCJA 1SEUA 2ZO4A 3ABLH 4F7ZA 2OD5A 3COAC 3J7ZI 3PFYA 5M5WJ 2ZSHB 1HKSA 1FC3A 1XDUA 4MNUA 2M7BA 1TWFJ 2VASA 3RKWA 3BR1A 3GF2A 2UWMA 1GHCA 1C0WA 1BBYA 2M8GX 1NHAA 4HPQA 1E3HA 1TQMA 1LDDA 1X4PA 3MKLA 2MD5A 1BR4A 3HOZJ 1PUEE 3BCAA 2VQLA 3CCJI 2DJNA 3TO9A 3LFUA 2OQRA 2L9RA 2O6GE 2A6EF 2L5QA 2CW8A 2M8EA 1W7PA 2RGVA 4FX0A 2RVCA 2EZHA 2M4KA 2XVCA 1DU0A 5EYRA 6PAXA 3UNGC 1JT6A 3L00A 2JA2A 2DPDA 4RM3A 3OS2A 2E2JJ 5BS6A 3FM3A 1CGPA 3ROUA 3CZ6A 2M5WA 5H6RA 4OIRF 2KP6A 1SAUA 1Z77A 2Q8KA 4I6ZA 2P81A 5ILUA 2IA1A 3VDXA 1GV2A 4NQWB 1A35A 4B43A 3AL0B 5HNHA 1YIOA 1IXSB 2AQFA 2PMZA 1RKWA 3PNTA 3RQ4A 2AQEA 4F93B 1PDNC 5LRSA 1APLC 2MW8A 4GCVA 4KUMA 2WA0A 3V8JA 1O3SA 3BP8A 5KNLA 4KN4X 3RKQA 3EETA 3HG9A 1WKMA 1QPIA 5L3GA 2A07F 3QOPA 2K7LA 3GTOJ 2DDBA 2FNAA 2CV1A 5ICCA 3OL3A 3S3OA 5HLTA 1RI7A 3HOXJ 2OA4A 2QENA 3LSJA 3K6GA 5FLXZ 1QZEA 2CYYA 4UUSB 1YFHA 3I54A 2DMQA 5LHHA 2MSYA 3WU0A 5B5EC 4C2UA 4DYQA 4BKXA 1I3AA 3OSFA 4XLCA 3OYCA 3REOA 2PLYA 1WJCA 1Z91A 2CUEA 1S29A 3F8BA 3GUDA 1TC3C 1OYWA 5HDKA 3VSKA 1MDMA 4W97A 4PGGA 4KDPA 3LOCA 3BDDA 3OYLA 2OTJI 1WZ2A 3HRUA 3S2HJ 5F1RA 4ZYAA 4ZZLA 2Y69H 4OMZA 3ZQHA 3E5UA 2XAHA 5HS7A 2I8DA 3LSGA 2ZSIB 2NVTJ 4KA4A 1JXSA 3C2GA 2XKOA 3EUHA 1U8BA 1TTYA 1T0FC 4CICA 2CQNA 4M6VA 1IRZA 5FRMA 4EVIA 5A2QZ 1MNEA 4M3BA 4XBFA 1F4KA 2M0CA 3GVAA 2OF7A 3J80Z 5C4XJ 4RLFA 4GXOA 2NOJB 2QZ8A 4QTRA 1Y0NA 3JRHA 2KJBA 4I76A 1YITI 3M4OJ 3HZJA 3E6MA 4I2OA 4EJUA 3JAMK 2UXNA 4HLYA 2EZIA 3WGGA 1AKHA 1SVLA 1WPKA 2OU2A 5E18F 1YG2A 5JFRA 3OYGA 3B02A 4RAGA 2XSJC 1ZREA 3I4MJ 1G3YA 2CUFA 4BE1A 1QGPA 2EFNA 2CQKA 1IGNA 4KYWA 1FWZA 5HDNA 1NG6A 5IYDJ 4IPAA 1RIOH 4KMUX 1K61A 4LMYA 2DA5A 2WY8Q 4IRGA 2GXBA 4BQOA 2PMZN 2VOPA 2Q0OA 2LF7A 2W48A 4ZDOA 3ZMSA 3BPXA 4ENKA 4KFCA 1HSTA 1K79A 2LH9A 4LIVA 3ULQB 3Q5FA 2VKHA 1ETXA 3A02A 4KJZA 1FP1D 4CCMA 5BPDA 4UUVA 4DBQA 2QUFA 2P0WA 2V1UA 5E79C 5JR3A 1BW5A 3KZIC 2YUSA 2JRMA 2WTEA 3BTCA 4KIGA 4C30A 3EQLF 2VC1A 1IF1A 4R8HA 1FNNA 1ZG5A 1BC8C 3QYBA 2ECCA 2R7WA 2H1LA 2KDOA 1MJBA 3H35A 3F0CA 1AA7A 1WJEA 3C2HA 3LSIA 2WV0A 4CCKA 5JHFA 1FSEA 4KN7X 3JAMZ 1FTTA 1LFBA 3HSRA 2EFQA 2HOEA 2LFBA 2RV8A 1NH3A 2ISZA 1J2XA 4DZJA 2J5OA 2ZJ2A 3GTGJ 5EJCA 4XN0A 4E7HA 5LEJA 2QQBA 1W5TA 5FGMA 2FE3A 2PX9A 2R0QC 4OIOF 1CF7B 3MQ0A 3T5XA 2BYVE 2DBBA 3LA3A 3V42A 2XAGA 3ZQLA 3TMOA 1R58A 5GAGJ 3LWFA 2MC3A 1D0YA 2JSPA 4HV6A 2Y2ZA 4IHYA 4M6XA 3DBRB 5LLQA 3OL4A 3OYEA 2CUJA 2H6BA 2FRHA 1U8RA 2PJRB 3DEWA 4XRSG 1F5TA 2HZDA 4KIBA 4U0VA 4ZC3A 2HYJA 2P5KA 4IHVA 4RA2A 5EDNA 3KE2A 1U3EM 4OAZA 4RBOA 3LSTA 5F08A 5EG0A 4V2GA 3KP3A 3VFZA 3L2WA 1T6SA 4RAFA 2DFEA 4WK8F 3IH4A 1YW9A 4AVZA 3ASOH 2EPFA 2MH2A 2E36A 2VQCA 3BPVA 5JLWA 4ZTJA 1X1DA 2NOGA 4M3EA 2LKSA 4M3FA 2EV5A 3J7AY 2QVOA 2WAQA 2F5VA 3H9JA 1GT0C 2H8RA 3SDGA 1MMSA 2JUGA 3QPHA 4JX6A 4BACA 2MABA 2Y48A 4GO1A 3SZPA 1D5YA 1Y8RB 3T8RA 3DCFA 5K5QA 1VQ8I 5K7ZA 4EEFG 4HX4A 1XB4A 4NNJA 1OCTC 3SZGA 3F72A 3WHBA 1ZK8A 3OR2C 5GPCA 3F8FA 1OJLA 3LSPA 3S3MA 4RS8A 2VPLA 2IS2A 4W1UA 4DYCA 1Q1HA 3FIWA 2NAZA 3EDPA 4ZTFA 4EM0B 2YU3A 2OTLI 2R7TA 3KIOA 2DA4A 1XDSA 2ELHA 4ZYGA 1T95A 4HAMA 3IRRA 1K6OA 1D0XA 4HZFA 2CGPA 4HSTA 1ORKA 5LGNA 3KX2A 5TISC 3CCEI 3S14J 1YX3A 5BNGA 1FOXA 1M1EB 3WE3A 4TV7A 5B66C 2AO9A 3JRCA 5E3NA 5C4JJ 2CV2A 1BOBA 3E7LA 1WI9A 2FX0A 2VQGA 4MO7A 1IN7A 1S9HA 1Y8QB 3A03A 1SMTA 2ZXIA 3F21A 3OYMA 2ELKA 2KT0A 2HZTA 2QSFX 3R6SA 2WC2A 3SHFA 1L0OC 1ZGAA 1X4OA 1IN5A 4JOMA 1BR2A 4JBAA 4MQ9F 2D45A 3CLQA 2AS5F 3HL2A 4B09A 4ZYEA 3DKYA 2RQPA 1SFOJ 4X6AJ 4RM2A 3M07A 3I71A 4DW6A 2M45A 4CCOA 3BG9A 4WXCA 5F6FA 3WTXC 1VTNC 1YO5C 1K4SA 3WG7H 4Q47A 2R5YB 1U5TA 4IQJA 4BY7J 3F3XA 4IX7A 3WTUC 2WB1N 1NTCA 2CSOA 3K0LA 5E1WA 2FF4A 3PIPF 2HI3A 1ITYA 3HUGB 2L9NA 1BW6A 5KAFC 3OV8A 4P9FA 4O6JA 1Z9CA 3BY6A 3CJRB 2KQRA 5J8FA 3CP8A 2HWVA 3T1BA 3OSGA 2XC7A 1ULYA 3KP5A 4D1QA 5FLVA 2KIUA 1UFMA 3I3LA 4P9UA 2MFZA 3MMYB 4LD5A 1W5SA 2IA2A 3OYAA 5J47A 2O8XA 3V7RA 2HOTA 4RLQA 3FKJA 3M1EA 4RMNA 2RKHA 4G7OF 2LK2A 3H3UA 2KIQA 2F5FA 2F48A 2CU7A 2DFIA 2GBYA 3LQRA 2OCCH 4B48A 4E70A 2CJJA 2CQQA 2WADA 3PFIA 2QLZA 1PP7U 3RYRA 4NC6A 1FEXA 2Z16A 5DD4A 3ZQQA 2E1OA 1A04A 1JKPC 2EV0A 2XAQA 3FBNB 3IAS2 2XGXA 3CCVI 3BOQA 4E6KG 2EA2A 1G6NA 3K4LA 3M8EA 5IT9Z 3LSMA 5FKNA 2KDZA 3VSLA 2EZKA 4CGZA 1ZRFA 1JTYA 3LAJA 3SYTA 4BQNA 4AWXB 3DWLE 2XPWA 2QQ8A 1WQ2A 2DDAA 4XLNF 4MLOA 2GZWA 3SEZA 2FQ3A 2IW5A 2R7FA 2HTJA 3HUGA 2BGCA 3K7AJ 5FLMJ 2DFFA 3I58A 2V6CA 4EJOA 4JX4A 1O7FA 4IQ4A 4EMSA 3CC7I 3E3VA 4C2TA 5EGOB 4A6DA 2HKOA 1QNTA 3CDIA 4PGHA 1CF7A 1S6LA 4HQEA 5LGTA 3QU3A 2L7MP 5IP6A 5FB2A 5BOXA 2ECBA 3L2CA 3QAHA 5M5YJ 3IC7A 5M3MJ 4M9SA 2W4SA 1HW5A 3MCZA 2HEOA 3EYYA 2X0LA 3UR3C 2LKXA 2FBHA 1AOYA 1U9NA 3IH3A 3KYDB 1YJNI 3RQIA 4A0ZA 4A3GJ 4FT8A 3U9GA 4CYCB 2YX4A 4IRIA 1FSHA 5DCFA 4XLHA 2X48A 2DA2A 3CESA 4P55A 4LOCA 3QOEA 2C6YA 2JT1A 1UZCA 1K78A 1S7OA 3OIQA 3H92A 1UJ8A 3N05A 2QA4I 1NG7A 2VONA 2VC0A 5KK1A 2JA8J 3K2ZA 4NHJA 2F4IA 2XUBA 1T98A 4UVBA 1T8IA 2E5ZA 2QGUA 3IL2A 3H0GJ 1FT9A 2IVMA 3L1PA 2QSHX 4OIQF 3ZN0A 2EIMH 4AVPA 2MBFA 3JCUC 2VI6A 1X1CA 4YELA 5LD2C 1T2KA 2WBMA 5HODA 1WCMJ 2OV7A 3U2RA 1X1PA 3HOYJ 2JA7J 3DPUA 5E3LA 3ZXSA 3HHHA 5DM7F 2R5YA 1VQ6I 3HOVJ 1EH7A 4YIIA 5J40A 3P9IA 4ESJA 2B9SA 2R7ZJ 1U78A 4J01A 1HW1A 3B73A 3ECHA 3DV8A 1T38A 2FD5A 2G9WA 4Y15A 2X85A 2VQHA 3ABKH 2PG4A 1V5FA 1KONA 2O5RA 1QBJA 3EPZA 3RZOJ 2D1VA 4CUGA 4ENJA 4AC0A 3BG5A 4PFPA 2RAEA 3CDLA 2I10A 3BT9A 1HC8A 4A6EA 3DKXA 1K78B 4M73A 2KMUA 2QQAA 5EF6A 1OLTA 2XF5A 1W7PB 3FMSA 3CF2A 2E2IJ 3DKWA 1D8JA 4A3BJ 1BIAA 1RETA 1HKQA 3ZQIA 4A2UA 4D7MA 2WV1A 2W82A 1S7AA 2HOAA 3KYCB 3AL0C 4G7HF 1Q1VA 1E3PA 4C2MJ 2YSRA 1VFCA 5JI6A 4L5JA 4BY1J 5FJ8J 3A4CA 3WTVC 1KU3A 4WXHA 5AIQA 4BNCA 4A3CJ 1A6IA 4A3FJ 3L09A 2J5PA 2JQ7A 4RB2C 4Y33A 5EG0B 2GLOA 1WGXA 2BXZA 2F6CA 1PYVA 4L0YB 3ML6A 2EK5A 3BR2A 3ZMZA 1YS6A 1Z1DA 4BHPA 3BR3A 2W85A 2LLKA 5LHIA 3RPUD 1QVTA 4HLXA 1FX7A 2IXSA 5J4VA 2VJ4A 4LIUA 5EZHA 1ZR2A 1G8XA 2IA0A 2R7UA 2NNNA 1HSJA 1Z67A 2PQ8A 1Z21A 3FK7A 4UUSA 3O3KA 2I5UA 3L2QA 5FO5A 1XSXA 3O2PE 3QP5A 3GTLJ 2NS7A 2K4BA 3C1DA 4BQAA 3L7WA 3SEQA 2X6WA 1BM9A 2IS1A 4HV5A 1H0MA 5E1XA 1JJ6C 1IN6A 4PSXA 2JPCA 1QPMA 5ILSA 3S1MJ 3IP4B 5CQGA 3HGYA 4XKCA 2BHYA 3R4KA 5CLSA 1LJ9A 3JRBA 3KP4A 2JZYA 2DOFA 2GA1A 3WGIA 4BS9A 3BG3A 3H0DA 2LP0A 5DEQA 4LITA 2V6EA 2G7UA 1TWAJ 4LK0F 3F8CA 5CVIA 2DQLA 3S93A 4YFKF 4AIKA 4K2EA 1V4RA 2KZVA 1UG2A 1Z7UA 4Y17A 3KEOA 5IT3A 4UHTA 3TEDA 2DQRA 3G73A 3FXMA 3RIRA 3W6KB 3BZKA 3TW7A 1DPRA 4KICA 3I59B 3TKYA 3S1QJ 2R7SA 2DU9A 1IRFA 4XRSA 1VQ4I 1KA8A 3GFJA 1PVEA 2GIVA 2UUZA 3ZQCA 1FYMA 2DW4A 1OQYA 1G2HA 3GYHX 3FX3A 3OYKA 3H3VK 3DEEA 5DUIA 3MKWB 1O3QA 4Q5SF 5D8KB 2P5VA 3AAFA 2ELJA 4BYYA 2R7RA 3MWMA 3S16J 3P9KA 4RDUA 4Y3OA 1O3TA 5FD6A 1W0TA 4OINF 4CCNA 3I55I 2OZ6A 2RREA 2EFOA 2VBWA 3FXUA 5E20A 4LLLA 3MFKA 5BMZA 1LVKA 3D5RC 1HDDC 1ZRCA 4QIWN 4XLEA 2DA6A 3GW2A 3DEUA 4ZZDA 1D3YA 2NYXA 4AUXA 3MZ8A 2Y0MA 3V7CA 1SFEA 4N9HA 1ETQA 4V19K 4E7ZA 3NQOA 2XF7A 3VYSB 2W7NA 2XGEA 1U5TC 3OR1C 2ZKZA 3L2UA 2VOOA 1XS9A 1WI3A 3CTAA 3E0JB 1UCRA 1BI0A 5E8GA 3MKZA 4J00A 1PUFA 2VBYA 2QBYB 4BXFA 2VKVA 2JWTA 4G7ZF 3D1NI 3I9V2 2KRFA 3L2RA 2VT3A 1BR1A 5F04A 3T8TA 2K3PA 4N9IA 3P9CA 3D5SC 4CZZA 2M7AA 3JREA 2OUMA 2E5NA 2FBKA 1ZAOA 1R5GA 1ZG3A 4S05A 2HKXA 1QA6A 1V5EA 2E7WA 3J80K 4HSRA 3SDBA 3CMMA 3GZNB 3WE2A 1D1BA 2OAZA 4Y4RA 3E6CC 1UG0A 3CLOA 3KEYA 1ZQ3P 2EWNA 4II3A 1K7AA 4C3HJ 2O7OA 2NVQJ 5D4SA 2UZKA 1YIJI 2HFHA 2Q2EA 4A0XA 4KITB 1FZPB 2JN6A 2PN6A 1GUUA 2W25A 1R71A 3H3ZA 4E7SA 3IH2A 3CJNA 2BVMA 3OYJA 2LOOA 2V1XA 3F6OA 1MD0A 1HQCA 4GYGA 2DI3A 4OOIA 2YPRA 2NVYJ 3FMRA 3K9TA 4BXXJ 3I4NJ 4C3JJ 4AD9A 4PJJA 5DCMA 5HLIA 3CJTB 4IO9F 2P6TA 2R5ZA 1A6QA 1NK3P 5F27A 2RNGA 2IT0A 5TGTA 1RC9A 1ERDA 1MMGA 2EBIA 5TJJA 4LJZF 3BR6A 3BR0A 1MIJA 4QPOA 2L4MA 1REPC 2O8KA 2DA1A 2XB5A 3WG9A 3ERED
chains in the Genus database with same CATH topology
5K7ZA 4A3IJ 4EEFG 2DMNA 4B3AA 3GTPJ 1MBEA 1IDYA 2HXIA 5J1RA 2IAIA 1OCTC 4B1RA 3WHBA 1ZK8A 5GPCA 2DN0A 1OJLA 4JYKA 3LSPA 4W1UA 1Z0XA 4DYCA 2H1KA 3BTLA 3Q0UA 1ETOA 1MH3A 2ID6A 3FIWA 2MGQA 5DS9A 2JMWA 1ZKGA 3S17J 2DA4A 3GBGA 1DU6A 3IV5A 4A3MJ 4FISA 3JRFA 1VF9A 1ORKA 3CMYA 3S14J 5BNGA 3B6AA 4BBRJ 5IYBJ 1XC5A 1IJWC 1EF4A 3A01A 2AO9A 2COBA 3JRCA 4D7NA 5F0FA 5E3NA 5FKKA 5C4JJ 1I50J 2JJ7A 3E7LA 2M2EA 2FX0A 2GM4A 5DTDA 4A3KJ 1FIPA 1BJZA 4MO7A 3B6CA 3A03A 3ZOBA 4AYBN 2B63J 2ELKA 2KT0A 4FE4A 2Y31A 3GTJJ 2DMUA 1GVDA 3CCYA 1OCPA 5IP9J 2Y0SN 2XRLA 2LY9A 1ZGWA 1SFOJ 4X6AJ 1H89C 1X2NA 2MG4A 2L7FP 4DW6A 5IP7J 3BG9A 4BBSJ 3SFIA 2R5YB 4BY7J 1A5JA 3O8HA 2Y30A 2WB1N 1NTCA 2YS9A 1FIAA 2LD5A 1B8IA 2HI3A 4MFEA 4MFDA 1ITYA 5FKMA 1X2MA 1LE8A 1BW6A 1JKOC 1SANA 1NK2P 1IV6A 4IHWA 3GTKJ 3OSGA 2O9LA 1Y1VJ 2N8GA 1JTXA 2TRTA 4D5CA 5FLVA 1ETYA 3PO3J 3OIOA 2NS8A 1ETVA 1IDZA 1JUPA 2HOTA 2VPRA 2QCOA 1RPWA 2OPTA 1RR7A 1ETKA 4JP0A 4XRMA 4V2FA 5IPAA 2LK2A 1UMQA 2CU7A 2GBYA 4MIMA 1LE8B 2CJJA 2CQQA 3S1NJ 2Y9YA 1MBHA 1FEXA 1I6HJ 2DMTA 2E1OA 1AHDP 5F0HA 2EZLA 4XK4A 3TW6A 1JKPC 1IUFA 1BL0A 2XGDA 3HBLA 5FKNA 2KDZA 2EZKA 1JTYA 1ZR4A 2ME0A 3BTJA 1U9OA 1X58A 2HXOA 2XPWA 1TWCJ 1RESA 4MLOA 3RZDJ 1ENHA 5M3FJ 1B72B 3K7AJ 2JA5J 5FLMJ 1VI0A 2LTPA 3MN2A 3G1LA 4JX4A 3PM1A 4JX5A 2YU9J 1RKTA 2LVSA 1O4XA 4FTHA 2EH3A 5EGOB 1S7EA 1PUFB 3Q0VA 1F36A 1MBFA 1OFCX 2L7MP 5IP6A 3JRIA 2ECBA 4L5EA 5M5YJ 3SJMA 1JJ8C 1ETWA 5M3MJ 3HB9A 4C3IJ 5J1YA 1JKQC 1H88C 2XPUA 1H8AC 2LKXA 1Y1WJ 1BA5A 1U9NA 2X9DA 3IH3A 4A3EJ 2JA6J 3ZQGA 1TWGJ 3RQIA 3HKZN 4A3GJ 4CYCB 3GTMJ 2X48A 3JRAA 2DA2A 4LOCA 1K83J 4QSHA 2VUMJ 5E3OA 4G12A 3LSRA 4HNVA 5GPAA 2JA8J 3M3YJ 3NAUA 1JGGA 5M5WJ 3H0GJ 2XGCA 3L1PA 1TWFJ 5IYCJ 2HOSA 3BR1A 2M34A 2EQRA 3VPRA 1QRYA 4Y7NJ 2M8GX 3G1OA 3LNQA 1WH7A 2VI6A 1W0UA 1T56A 3MKLA 3HOZJ 3W6VA 5HODA 2DJNA 1WCMJ 5FKLA 5EZGA 2L7ZA 2L9RA 5J1UA 3HOYJ 2JA7J 1HOMA 5E3LA 2EZHA 1DU0A 5EYRA 2R5YA 3HDDA 3HOVJ 1JT6A 2NVXJ 2R7ZJ 1YRNB 2G0EA 2E19A 1U78A 3BQYA 2E2JJ 2FD5A 1HCRA 2DTZA 3S1RJ 4I6ZA 1Z77A 1MSFC 3RZOJ 2P81A 4AC0A 1JUMA 3BG5A 4XIDA 1GV2A 2RAEA 3CDLA 3JR9A 2I10A 1HLVA 3BT9A 1JKRC 1RKWA 1QVUA 5EF6A 4XICA 1APLC 2MW8A 9ANTA 3BQZA 1CQTA 5EEAA 2E2IJ 1MBGA 4A3BJ 3O8GA 3RKQA 1RETA 1JT0A 3ZQIA 1QPIA 4D7MA 3GTOJ 2WV1A 3TP0A 2HOAA 2ZB9A 2ID3A 5C3EJ 1Q1VA 4C2MJ 1VFCA 5FKOA 3HOXJ 4BY1J 5FJ8J 4UUSB 3LSJA 5E3MA 4A3CJ 1A6IA 4A3FJ 2DMQA 1VNDA 5K7FA 2MSYA 3Q0WA 3WHCA 4DYQA 4BKXA 5EG0B 3C2BA 2GLOA 1WGXA 3OSFA 2HQ5A 3UKGA 2CQXA 2CUEA 3BR2A 3CQZJ 1JUSA 1ZTRA 2VKEA 3BR3A 1TC3C 2LLKA 1QVTA 4W97A 4D5FA 5EZHA 1ZR2A 3LOCA 2R93J 2LR8A 2IEKA 4M3GA 3FK7A 3S2HJ 4UUSA 2R92J 3ZQHA 1POGA 2NVTJ 3GTLJ 3LSGA 3Q3SA 2NS7A 1U8BA 4M6VA 1IRZA 1MBJA 2X6OA 1JJ6C 1F43A 1B72A 3G1MA 4M3BA 3S1MJ 3HGYA 1MBKA 2M0CA 1AU7A 2OF7A 3JRBA 1I3QJ 5C4XJ 4QTRA 3JRHA 5J3LA 4CYCA 4I76A 1MNMC 3M4OJ 3BG3A 1P7IA 2LP0A 4S0HB 4ABZA 2EZIA 3HGGA 3GTQJ 2K9QA 1AKHA 1WPKA 3QQAA 4X1EA 1TWAJ 1IG7A 3I4MJ 2CUFA 2WAQN 1UG2A 1E3OC 3TEDA 1IGNA 5IYDJ 3TW7A 1K61A 2DA5A 3QPSA 2PMZN 3S1QJ 2W48A 5JLXA 1LFUP 4IEJA 4XRSA 3ZQCA 1FTZA 1G2HA 1ETXA 3H3VK 3A02A 1WH5A 3K2AA 3JRDA 2M9HA 4FE7A 1BW5A 3S15J 2DA7A 2YUSA 3S16J 3BTCA 4RDUA 4UUTA 1B8IB 1W0TA 4A3LJ 1R9TJ 5C44J 3PO2J 4NDLA 2E2HJ 2IBDA 2L0KA 1MH4A 2XB0X 5F1JA 1HDDC 2QF7A 4QIWN 5IOYA 2DA6A 2ECCA 2K9NA 3FK6A 1XG1A 2R5ZB 4AUXA 4FCYA 2CRGA 2K9SA 3F0CA 3HOUJ 4Y52J 5EGOA 4J19A 1UHSA 2Y9ZA 3FISA 4A93J 1ETQA 5M5XJ 2D5VA 4DYRA 1FTTA 3HOWJ 4B4CA 1LFBA 1YRNA 2LFBA 2XGEA 4DZJA 1XS9A 1WI3A 3FKIJ 1GDTA 3GTGJ 4IHXA 2XPVA 1IC8A 1FJLA 2R0QC 1AKHB 1PUFA 4A69C 2VKVA 2JWTA 3QPLA 3D1NI 1T33A 5GP9A 3ZQLA 3BR5A 2HDDA 5F04A 4M3DA 3JREA 3MVPA 3OOUA 2Y2ZA 4IHYA 1P7JA 3BTIA 4GFBA 5IOZA 1GV5A 3DEWA 1HDPA 4XRSG 2ME6A 2FJ1A 2JK3A 3TP3A 2HYJA 1MSEC 1ZQ3P 4IHVA 5EDNA 4C3HJ 2FQ4A 2O7OA 3ZQFA 4RBOA 2NVQJ 2AHQA 5F08A 5EG0A 4V2GA 3A01B 2DMPA 2JN6A 3NARA 1GUUA 1TWHJ 3IH2A 3IH4A 2K40A 5F0CA 3HEFA 5JLWA 4A3JJ 4M3EA 2NOGA 2NVYJ 3HM5A 4BXXJ 3I4NJ 4M3FA 4C3JJ 4DZPA 1GT0C 2H8RA 3SDGA 2XSDC 2R5ZA 1HF0A 1NK3P 2DA3A 5F27A 4JX6A 2TCTA 2EBIA 3BR6A 3BR0A 3JRGA 4A3DJ 3S2DJ 5K7HA 2O8KA 1D5YA 2DA1A 2XB5A 3DCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K7Z A;  4A3I J;  4EEF G;  2DMN A;  4B3A A;  3GTP J;  1MBE A;  1IDY A;  2HXI A;  5J1R A;  2IAI A;  1OCT C;  4B1R A;  3WHB A;  1ZK8 A;  5GPC A;  2DN0 A;  1OJL A;  4JYK A;  3LSP A;  4W1U A;  1Z0X A;  4DYC A;  2H1K A;  3BTL A;  3Q0U A;  1ETO A;  1MH3 A;  2ID6 A;  3FIW A;  2MGQ A;  5DS9 A;  2JMW A;  1ZKG A;  3S17 J;  2DA4 A;  3GBG A;  1DU6 A;  3IV5 A;  4A3M J;  4FIS A;  3JRF A;  1VF9 A;  1ORK A;  3CMY A;  3S14 J;  5BNG A;  3B6A A;  4BBR J;  5IYB J;  1XC5 A;  1IJW C;  1EF4 A;  3A01 A;  2AO9 A;  2COB A;  3JRC A;  4D7N A;  5F0F A;  5E3N A;  5FKK A;  5C4J J;  1I50 J;  2JJ7 A;  3E7L A;  2M2E A;  2FX0 A;  2GM4 A;  5DTD A;  4A3K J;  1FIP A;  1BJZ A;  4MO7 A;  3B6C A;  3A03 A;  3ZOB A;  4AYB N;  2B63 J;  2ELK A;  2KT0 A;  4FE4 A;  2Y31 A;  3GTJ J;  2DMU A;  1GVD A;  3CCY A;  1OCP A;  5IP9 J;  2Y0S N;  2XRL A;  2LY9 A;  1ZGW A;  1SFO J;  4X6A J;  1H89 C;  1X2N A;  2MG4 A;  2L7F P;  4DW6 A;  5IP7 J;  3BG9 A;  4BBS J;  3SFI A;  2R5Y B;  4BY7 J;  1A5J A;  3O8H A;  2Y30 A;  2WB1 N;  1NTC A;  2YS9 A;  1FIA A;  2LD5 A;  1B8I A;  2HI3 A;  4MFE A;  4MFD A;  1ITY A;  5FKM A;  1X2M A;  1LE8 A;  1BW6 A;  1JKO C;  1SAN A;  1NK2 P;  1IV6 A;  4IHW A;  3GTK J;  3OSG A;  2O9L A;  1Y1V J;  2N8G A;  1JTX A;  2TRT A;  4D5C A;  5FLV A;  1ETY A;  3PO3 J;  3OIO A;  2NS8 A;  1ETV A;  1IDZ A;  1JUP A;  2HOT A;  2VPR A;  2QCO A;  1RPW A;  2OPT A;  1RR7 A;  1ETK A;  4JP0 A;  4XRM A;  4V2F A;  5IPA A;  2LK2 A;  1UMQ A;  2CU7 A;  2GBY A;  4MIM A;  1LE8 B;  2CJJ A;  2CQQ A;  3S1N J;  2Y9Y A;  1MBH A;  1FEX A;  1I6H J;  2DMT A;  2E1O A;  1AHD P;  5F0H A;  2EZL A;  4XK4 A;  3TW6 A;  1JKP C;  1IUF A;  1BL0 A;  2XGD A;  3HBL A;  5FKN A;  2KDZ A;  2EZK A;  1JTY A;  1ZR4 A;  2ME0 A;  3BTJ A;  1U9O A;  1X58 A;  2HXO A;  2XPW A;  1TWC J;  1RES A;  4MLO A;  3RZD J;  1ENH A;  5M3F J;  1B72 B;  3K7A J;  2JA5 J;  5FLM J;  1VI0 A;  2LTP A;  3MN2 A;  3G1L A;  4JX4 A;  3PM1 A;  4JX5 A;  2YU9 J;  1RKT A;  2LVS A;  1O4X A;  4FTH A;  2EH3 A;  5EGO B;  1S7E A;  1PUF B;  3Q0V A;  1F36 A;  1MBF A;  1OFC X;  2L7M P;  5IP6 A;  3JRI A;  2ECB A;  4L5E A;  5M5Y J;  3SJM A;  1JJ8 C;  1ETW A;  5M3M J;  3HB9 A;  4C3I J;  5J1Y A;  1JKQ C;  1H88 C;  2XPU A;  1H8A C;  2LKX A;  1Y1W J;  1BA5 A;  1U9N A;  2X9D A;  3IH3 A;  4A3E J;  2JA6 J;  3ZQG A;  1TWG J;  3RQI A;  3HKZ N;  4A3G J;  4CYC B;  3GTM J;  2X48 A;  3JRA A;  2DA2 A;  4LOC A;  1K83 J;  4QSH A;  2VUM J;  5E3O A;  4G12 A;  3LSR A;  4HNV A;  5GPA A;  2JA8 J;  3M3Y J;  3NAU A;  1JGG A;  5M5W J;  3H0G J;  2XGC A;  3L1P A;  1TWF J;  5IYC J;  2HOS A;  3BR1 A;  2M34 A;  2EQR A;  3VPR A;  1QRY A;  4Y7N J;  2M8G X;  3G1O A;  3LNQ A;  1WH7 A;  2VI6 A;  1W0U A;  1T56 A;  3MKL A;  3HOZ J;  3W6V A;  5HOD A;  2DJN A;  1WCM J;  5FKL A;  5EZG A;  2L7Z A;  2L9R A;  5J1U A;  3HOY J;  2JA7 J;  1HOM A;  5E3L A;  2EZH A;  1DU0 A;  5EYR A;  2R5Y A;  3HDD A;  3HOV J;  1JT6 A;  2NVX J;  2R7Z J;  1YRN B;  2G0E A;  2E19 A;  1U78 A;  3BQY A;  2E2J J;  2FD5 A;  1HCR A;  2DTZ A;  3S1R J;  4I6Z A;  1Z77 A;  1MSF C;  3RZO J;  2P81 A;  4AC0 A;  1JUM A;  3BG5 A;  4XID A;  1GV2 A;  2RAE A;  3CDL A;  3JR9 A;  2I10 A;  1HLV A;  3BT9 A;  1JKR C;  1RKW A;  1QVU A;  5EF6 A;  4XIC A;  1APL C;  2MW8 A;  9ANT A;  3BQZ A;  1CQT A;  5EEA A;  2E2I J;  1MBG A;  4A3B J;  3O8G A;  3RKQ A;  1RET A;  1JT0 A;  3ZQI A;  1QPI A;  4D7M A;  3GTO J;  2WV1 A;  3TP0 A;  2HOA A;  2ZB9 A;  2ID3 A;  5C3E J;  1Q1V A;  4C2M J;  1VFC A;  5FKO A;  3HOX J;  4BY1 J;  5FJ8 J;  4UUS B;  3LSJ A;  5E3M A;  4A3C J;  1A6I A;  4A3F J;  2DMQ A;  1VND A;  5K7F A;  2MSY A;  3Q0W A;  3WHC A;  4DYQ A;  4BKX A;  5EG0 B;  3C2B A;  2GLO A;  1WGX A;  3OSF A;  2HQ5 A;  3UKG A;  2CQX A;  2CUE A;  3BR2 A;  3CQZ J;  1JUS A;  1ZTR A;  2VKE A;  3BR3 A;  1TC3 C;  2LLK A;  1QVT A;  4W97 A;  4D5F A;  5EZH A;  1ZR2 A;  3LOC A;  2R93 J;  2LR8 A;  2IEK A;  4M3G A;  3FK7 A;  3S2H J;  4UUS A;  2R92 J;  3ZQH A;  1POG A;  2NVT J;  3GTL J;  3LSG A;  3Q3S A;  2NS7 A;  1U8B A;  4M6V A;  1IRZ A;  1MBJ A;  2X6O A;  1JJ6 C;  1F43 A;  1B72 A;  3G1M A;  4M3B A;  3S1M J;  3HGY A;  1MBK A;  2M0C A;  1AU7 A;  2OF7 A;  3JRB A;  1I3Q J;  5C4X J;  4QTR A;  3JRH A;  5J3L A;  4CYC A;  4I76 A;  1MNM C;  3M4O J;  3BG3 A;  1P7I A;  2LP0 A;  4S0H B;  4ABZ A;  2EZI A;  3HGG A;  3GTQ J;  2K9Q A;  1AKH A;  1WPK A;  3QQA A;  4X1E A;  1TWA J;  1IG7 A;  3I4M J;  2CUF A;  2WAQ N;  1UG2 A;  1E3O C;  3TED A;  1IGN A;  5IYD J;  3TW7 A;  1K61 A;  2DA5 A;  3QPS A;  2PMZ N;  3S1Q J;  2W48 A;  5JLX A;  1LFU P;  4IEJ A;  4XRS A;  3ZQC A;  1FTZ A;  1G2H A;  1ETX A;  3H3V K;  3A02 A;  1WH5 A;  3K2A A;  3JRD A;  2M9H A;  4FE7 A;  1BW5 A;  3S15 J;  2DA7 A;  2YUS A;  3S16 J;  3BTC A;  4RDU A;  4UUT A;  1B8I B;  1W0T A;  4A3L J;  1R9T J;  5C44 J;  3PO2 J;  4NDL A;  2E2H J;  2IBD A;  2L0K A;  1MH4 A;  2XB0 X;  5F1J A;  1HDD C;  2QF7 A;  4QIW N;  5IOY A;  2DA6 A;  2ECC A;  2K9N A;  3FK6 A;  1XG1 A;  2R5Z B;  4AUX A;  4FCY A;  2CRG A;  2K9S A;  3F0C A;  3HOU J;  4Y52 J;  5EGO A;  4J19 A;  1UHS A;  2Y9Z A;  3FIS A;  4A93 J;  1ETQ A;  5M5X J;  2D5V A;  4DYR A;  1FTT A;  3HOW J;  4B4C A;  1LFB A;  1YRN A;  2LFB A;  2XGE A;  4DZJ A;  1XS9 A;  1WI3 A;  3FKI J;  1GDT A;  3GTG J;  4IHX A;  2XPV A;  1IC8 A;  1FJL A;  2R0Q C;  1AKH B;  1PUF A;  4A69 C;  2VKV A;  2JWT A;  3QPL A;  3D1N I;  1T33 A;  5GP9 A;  3ZQL A;  3BR5 A;  2HDD A;  5F04 A;  4M3D A;  3JRE A;  3MVP A;  3OOU A;  2Y2Z A;  4IHY A;  1P7J A;  3BTI A;  4GFB A;  5IOZ A;  1GV5 A;  3DEW A;  1HDP A;  4XRS G;  2ME6 A;  2FJ1 A;  2JK3 A;  3TP3 A;  2HYJ A;  1MSE C;  1ZQ3 P;  4IHV A;  5EDN A;  4C3H J;  2FQ4 A;  2O7O A;  3ZQF A;  4RBO A;  2NVQ J;  2AHQ A;  5F08 A;  5EG0 A;  4V2G A;  3A01 B;  2DMP A;  2JN6 A;  3NAR A;  1GUU A;  1TWH J;  3IH2 A;  3IH4 A;  2K40 A;  5F0C A;  3HEF A;  5JLW A;  4A3J J;  4M3E A;  2NOG A;  2NVY J;  3HM5 A;  4BXX J;  3I4N J;  4M3F A;  4C3J J;  4DZP A;  1GT0 C;  2H8R A;  3SDG A;  2XSD C;  2R5Z A;  1HF0 A;  1NK3 P;  2DA3 A;  5F27 A;  4JX6 A;  2TCT A;  2EBI A;  3BR6 A;  3BR0 A;  3JRG A;  4A3D J;  3S2D J;  5K7H A;  2O8K A;  1D5Y A;  2DA1 A;  2XB5 A;  3DCF A; 
#chains in the Genus database with same CATH topology
 5ICG A;  2M4G A;  4A3I J;  3QPT A;  1L3L A;  2DMN A;  1MBE A;  1IDY A;  4NC8 A;  1SAX A;  2HXI A;  3KP6 A;  4D9J A;  3OY9 A;  2DN0 A;  4JYK A;  3PIO F;  3OS1 A;  4XKV A;  3H5N A;  5HVQ C;  2UXX A;  1KU2 A;  3BTL A;  1ETO A;  2ID6 A;  4XR6 A;  2MGQ A;  5DS9 A;  5HOO A;  2VIX A;  2F5E A;  5DV5 A;  1DUX C;  1LUJ B;  2LBF A;  3M8J A;  2CMP A;  5J6X A;  2HYG D;  1B1B A;  1FOW A;  2K3F A;  1XSD A;  3MAJ A;  3FXJ A;  3OYI A;  4AYB A;  3CMY A;  2IRF G;  4IHS A;  1EF4 A;  5AIP A;  2KLO A;  4UV9 A;  4YIF A;  2M3A A;  1I50 J;  1N78 A;  4LGW A;  1LEB A;  2ZBK A;  1FIP A;  4NUB A;  4HNU A;  3LMM A;  3WTW C;  3B6C A;  1KQ9 A;  2W84 A;  3ZOB A;  1MKM A;  4AYB N;  2VOD A;  2DFH A;  3OYH A;  2GXA A;  5KAI C;  1OIS A;  1W1W E;  1ZLK A;  4YEJ A;  1OKR A;  5H20 A;  2L2O A;  3RYP A;  1VQP I;  3BC8 A;  2EIK H;  4R79 A;  1KZH A;  2LY9 A;  1ZGW A;  1SVM A;  4U0W A;  1H89 C;  2MG4 A;  2L7F P;  1B9M A;  2R7O A;  2HDW A;  1FYL A;  4Q4Z F;  1GVJ A;  2GOX B;  2Y30 A;  2YS9 A;  4LG0 A;  3HKZ A;  2O03 A;  1LKX A;  1S72 I;  1FBQ A;  1XN7 A;  3NWT A;  3R61 A;  3RCO A;  3M9A A;  3GTK J;  4PDK A;  4HRI A;  4EQQ A;  2LMD A;  4I99 C;  1IRX A;  1VQ9 I;  4YFN F;  2N8G A;  5FD5 A;  1ZN2 A;  3PO3 J;  3PUB A;  3K69 A;  4HDV A;  4XMY A;  3CUQ B;  4E7L A;  4XRF A;  2VPR A;  3CME I;  2K9M A;  2OPT A;  1ETK A;  5CQE A;  4XRM A;  4PCQ A;  3H9Q A;  1J5Y A;  1TBX A;  1ODD A;  4U7D A;  4ON0 A;  2HPM A;  3S1N J;  4GRI A;  4ZH4 F;  5HLH A;  1I6H J;  2KPM A;  2HU9 A;  1VQM I;  4C9Y A;  5KCM A;  4XK4 A;  1W5C C;  5H6Q A;  5D5V B;  3TW6 A;  2STW A;  3RTR A;  1XCB A;  5D5U B;  2XRO A;  1XD7 A;  3K4J A;  1A31 A;  1HA8 A;  1TLH B;  1BL0 A;  4LG3 A;  3FXQ A;  3CCS I;  1JHH A;  1WJF A;  3U1K A;  3FDY A;  3LL7 A;  1WJB A;  2ME0 A;  1U9O A;  3OYF A;  1H9T A;  3X2Q H;  2FBI A;  4IL6 C;  3MZH A;  1TWC J;  1XGS A;  3RZD J;  3NEU A;  3I64 A;  4L9N A;  1B72 B;  2QM3 A;  2HTS A;  4MGR A;  3ZP5 A;  1FY7 A;  1WFX A;  3MN2 A;  4E7I A;  1W7P D;  3A1Y A;  1RKT A;  1P92 A;  2NNY A;  3L2V A;  5L3D A;  1MBF A;  5FRO A;  1SD5 A;  4ZYH A;  3G71 I;  2DK5 A;  4IVN A;  1MJA A;  3CDH A;  3M8F A;  2BOL A;  3SJM A;  3HPG A;  2DAO A;  3HB9 A;  1R7J A;  5J1Y A;  4XSZ F;  1H8A C;  1BA5 A;  4B47 A;  2X9D A;  4RGU A;  4A3E J;  5DDG A;  1TWG J;  5LRR A;  3W2A A;  1YW7 A;  3P5J A;  1TNT A;  4EJW A;  2K02 A;  4H0E A;  3GEZ A;  1YE9 A;  2HQR A;  1K83 J;  4OU0 A;  4QSH A;  1J75 A;  4EAT A;  2EIJ H;  2IS6 A;  4FET A;  1MMA A;  2EIN H;  2JUC A;  3Q9V A;  1GXP A;  1ZLJ A;  1FBU A;  2V9K A;  4HF1 A;  3W2V A;  4CDG A;  4DOZ A;  2BBY A;  2M0M A;  2ZFU A;  4HYE A;  3TDU C;  2KL4 A;  5IYC J;  1Z6T A;  1QZY A;  1S8N A;  4Y7N J;  4LB6 B;  1QRY A;  3FXO A;  5EEH A;  4CCL A;  1W36 D;  2K9L A;  4F52 A;  5GTI C;  1Y56 A;  1EKE A;  1WH7 A;  3TO7 A;  3ZGK A;  2DT5 A;  1W4M A;  1T56 A;  3ASN H;  1IN4 A;  3RSN A;  1N75 A;  2M87 A;  3DLA A;  3W6V A;  1P6R A;  5J8C A;  5J1U A;  1P2F A;  2EV6 A;  1R1V A;  1BC7 C;  5CVJ A;  3FBI B;  3NRV A;  2FOW A;  1ZYR F;  2ZFW A;  2P6S A;  3W2W A;  3CC4 I;  2V9P A;  1N25 A;  2X6X A;  1G3S A;  2Q1Z B;  2NVX J;  1YRN B;  2G0E A;  4S04 A;  2ZCW A;  2F4O B;  1E17 A;  3IAM 2;  5FRN A;  1I1G A;  1I27 A;  1HCR A;  2DTZ A;  3S1R J;  3V7S A;  1MSF C;  1JUM A;  2EJR A;  1WJA A;  4LK1 F;  3ZR8 X;  2HGC A;  1AWC A;  1BI1 A;  4XIC A;  5GTH C;  4UV8 A;  1Z05 A;  5EEA A;  1MBG A;  3OOP A;  3MD2 A;  3LFK A;  3U21 A;  2QQ9 A;  2ZME B;  2E1M B;  4M9X A;  3EUH C;  3A0B C;  1JT0 A;  4MQV A;  1STZ A;  5LFA A;  3H9G A;  2GAU A;  4BAY A;  2KRC A;  4G8X A;  3P7N A;  2ZB9 A;  2KFD A;  4U88 A;  4BE0 A;  1LEA A;  3IRQ A;  2JSC A;  4EV0 A;  4KIF A;  4X0G A;  1VND A;  3Q0W A;  4G94 A;  3ZMV A;  2BVL A;  3WHC A;  1OCZ H;  2E1C A;  2X6Y A;  4CH7 A;  4KNY A;  4OAY A;  4UB8 C;  3BJ6 A;  1JGS A;  1ZGJ A;  2MH9 A;  1XMX A;  2G7H A;  3KZZ A;  1XX5 A;  4XQF A;  4YG2 F;  1E0E A;  4ASN A;  4D5F A;  2GIZ A;  3HSF A;  5ED4 A;  1O7L A;  2VKD A;  1QHH D;  2IEK A;  2L3D A;  2CUZ A;  4M3G A;  1USS A;  2QKM B;  2WB1 A;  3WTT C;  4F3Q A;  2FEZ A;  2R92 J;  2W24 A;  5IT9 K;  1POG A;  3WOD F;  1UST A;  2FU4 A;  1BN5 A;  3SXY A;  3K1M A;  2CFO A;  1XMA A;  3FXR A;  1MBJ A;  2X6O A;  2V26 A;  1LFP A;  2WY7 Q;  4F91 B;  3ZMT A;  4JQF A;  4XLP F;  2ZME A;  3F22 A;  1MBK A;  1EA3 A;  3QYE A;  2F4M B;  1GXQ A;  3CCR I;  4PJM A;  1I3Q J;  3HSE A;  2COM A;  1FPQ A;  1YW8 A;  2FA5 A;  4H4K C;  1EJ9 A;  2FUG 2;  3HYI A;  4M72 A;  1JE8 A;  2XIG A;  3HGG A;  4PJL A;  3GTQ J;  2K9Q A;  4L9J A;  3WU2 C;  5K5O A;  3QQA A;  4X1E A;  1IG7 A;  2WAQ N;  1E3O C;  2QSG X;  4DNC A;  5D6E A;  2E35 A;  3OYD A;  4BJ6 C;  4G9Y A;  3K1P A;  3QP6 A;  2FOK A;  5JLX A;  1ON2 A;  4IEJ A;  3A0H C;  2A68 F;  3ERM A;  2KKO A;  4Z2Y A;  5JVG F;  1DP3 A;  3G3Z A;  1WHU A;  1FTZ A;  4B8X A;  4CYD A;  1QU3 A;  3LSH A;  3A2K A;  3K2A A;  1UHM A;  1D1A A;  4IHT A;  1V5G A;  4CO8 A;  2QYO A;  3S15 J;  2DA7 A;  1WVR A;  3AG3 H;  3S32 A;  4A3L J;  3ZRG A;  2A5W A;  1R9T J;  3TQN A;  2R7Q A;  5C44 J;  4AIJ A;  1DGW Y;  3ABT A;  3PO2 J;  5ERI A;  4L9V A;  2IBD A;  2L0K A;  4G6T B;  1MH4 A;  3HTS B;  2VB6 A;  4PK4 A;  2K4J A;  5F1J A;  4PJN A;  1HW2 A;  2XF6 A;  2K9N A;  2GQQ A;  4FCY A;  3FZV A;  2CRG A;  4PZJ A;  2K9S A;  3HOU J;  4Y52 J;  5EGO A;  4J19 A;  2RN7 A;  5FFZ A;  2Y9Z A;  4I02 A;  1IRG A;  4A93 J;  3LQQ A;  3DPT A;  2D5V A;  4DYR A;  1ON1 A;  3HOW J;  4B4C A;  3DTE A;  3BZC A;  2BV6 A;  3QYF A;  2PBI A;  1XSV A;  2DOE A;  2L01 A;  5F64 A;  5BQT A;  1W36 C;  1S3J A;  3FKI J;  4KT5 C;  4I01 A;  2XAU A;  1GDT A;  4IHX A;  1IV8 A;  2XPV A;  3HXL A;  4XLA A;  4XOR A;  3CCU I;  3CP2 A;  2HQA A;  4F55 A;  1TNS A;  1AKH B;  3H5R A;  1SD7 A;  2P7C B;  2P4W A;  4BJT A;  4A12 A;  1MJ9 A;  2MA3 A;  2X1E A;  3QPL A;  3BWG A;  1J9I A;  2MLG A;  2HDD A;  2EA4 A;  3U1D A;  4XOT A;  4BHC A;  3MVP A;  1P7J A;  1ACI A;  2PMH A;  3BTI A;  1ZHF A;  2LSO A;  2PFB A;  3EUK L;  3HOT A;  5IOZ A;  1GV5 A;  3DTI A;  2A69 F;  3VB2 A;  5D5W B;  4BHB A;  1HDP A;  3PNV A;  1QO0 D;  2FJ1 A;  2JK3 A;  2ME6 A;  2IS4 A;  3TP3 A;  2STT A;  1XGN A;  3PQJ A;  1LDJ A;  1XGO A;  2BW3 B;  2X51 A;  3IWF A;  1B6A A;  2JRT A;  3KET A;  3D0S A;  1WRJ A;  3ZQF A;  3AFH A;  4IF4 A;  2AHQ A;  3TGN A;  3A01 B;  2DT7 B;  4M74 A;  1J7K A;  2DMP A;  3NAR A;  4I0A A;  2K40 A;  3JTH A;  1IXC A;  5F0C A;  1KYW A;  2X4H A;  3W6J B;  5L3C A;  3OYB A;  3RJP A;  3DU6 A;  2Z2S B;  4I0B A;  1G3T A;  4HA8 A;  3RKX A;  2KIS A;  4NBQ A;  3ZMU A;  2Z99 A;  3KP2 A;  4CZC A;  4II2 A;  2DYR H;  4YIR X;  2L9S A;  2XSD C;  1IW7 F;  1HF0 A;  2BXY A;  2DA3 A;  2VJI A;  1YHQ I;  1Y6I A;  2K27 A;  4XKB A;  3JRG A;  3S2D J;  4XN3 A;  2DXI A;  3KFW X;  1Z3Y A;  3DBL B;  4B3A A;  3CUO A;  4XON A;  2XAF A;  3QU6 A;  3WTZ A;  1F9N A;  2L4A A;  2XV4 S;  3E1S A;  3R0A A;  1VQN I;  3KCC A;  1SFU A;  3IKV A;  2H1K A;  3Q0U A;  1MH3 A;  2WAF A;  3K4K A;  2JMW A;  2K85 A;  2PJR A;  5DCM B;  1QQI A;  1FOY A;  1MMD A;  2JVH A;  4AU7 A;  1ZKG A;  5HNF A;  3GBG A;  3S17 J;  4U87 A;  1DP7 P;  1YQA A;  3H1C A;  4ZJZ A;  1G3W A;  1U0J A;  4A3M J;  3K10 A;  4FIS A;  4UVC A;  5DM6 F;  4WX9 A;  1R22 A;  2IPQ X;  3B6A A;  1XC5 A;  1XMK A;  4ANJ A;  1XPX A;  3A01 A;  3VOD A;  1OMI A;  4IKF A;  4Z6Y A;  1FMV A;  4NB5 A;  2E34 A;  2Y75 A;  5DTD A;  2A05 A;  2QKL B;  2ZNY A;  1BJZ A;  4EGY A;  2HPI A;  3FMQ A;  1V55 H;  1LB2 A;  3E97 A;  5E17 F;  1R1U A;  2R7V A;  2Y31 A;  3GTJ J;  1GVD A;  3CCY A;  1BOA A;  1OCP A;  1TW3 A;  4M9Z A;  5LBQ A;  1R5H A;  3RPQ A;  2Y0S N;  2XHK A;  3I4P A;  3K4M A;  4YFX F;  4OWR B;  4PUS A;  4QLC U;  2DOD A;  5IP7 J;  3SFI A;  3K4N A;  1A5J A;  2NXN B;  3Q9S A;  2LF8 A;  2L9V A;  1FIA A;  2LD5 A;  1B8I A;  4XNF A;  4IRH A;  4MFE A;  3VYU B;  5FKM A;  1X2M A;  5B1A H;  1LE8 A;  1SAN A;  1IV6 A;  3CJQ B;  1V3F A;  4IOC F;  4YRV A;  2O9L A;  5B1B H;  4M71 A;  3DBH B;  1JTX A;  1DQU A;  2CQ7 A;  2CW0 F;  3BJA A;  3VYT B;  3LAP A;  3K4B A;  1LDK B;  3VEP A;  4MEX F;  1KQ0 A;  5JHU A;  1RPW A;  1TP4 A;  5FFX A;  1RR7 A;  3TL4 X;  3J81 Z;  1XGM A;  3TO6 A;  1IN8 A;  3F8M A;  2IGM A;  4D0P A;  3HOS A;  1VQ7 I;  1UMQ A;  3AG4 H;  4MIM A;  1BIB A;  2GXG A;  1TQI A;  3N97 A;  4BDY A;  2D1H A;  2Y9Y A;  1MBH A;  3J7Y J;  2DMT A;  1K4T A;  4HG2 A;  4FHT A;  2EZL A;  1MDM B;  4N4N B;  3WU1 B;  2ADU A;  1EV7 A;  2A6H F;  3JTG A;  2O3F A;  1IUF A;  3GME A;  5KVR A;  3ZN1 A;  5E1Z B;  3ABM H;  3KLO A;  1IUY A;  3HBL A;  3E5X A;  4BJ5 C;  5KHD A;  2DLL A;  1ZR4 A;  2CW7 A;  1TT5 B;  1X58 A;  2HNH A;  2HXO A;  1E2X A;  1U5T B;  3QOD A;  1VZ0 A;  2QEX I;  1TZL A;  1J0R A;  1RES A;  5M3F J;  2OJE D;  2GOM A;  2JA5 J;  1HBX G;  1MZB A;  2LTP A;  4JK1 X;  2LDU A;  2V1N A;  4RGR A;  3V8K A;  4JX5 A;  5ICE A;  2LVS A;  4MEY F;  1RNL A;  3FWE A;  4BDZ A;  3RPU A;  4L5I A;  2VE9 A;  2M1B A;  4HF0 A;  1F36 A;  1OFC X;  1MMN A;  2WWY A;  3LA7 A;  4E4H A;  5AON A;  1JJ8 C;  1ETW A;  1DPU A;  2A3S A;  1G59 A;  2VL8 A;  4IJA A;  4KMF A;  2BE5 F;  4L9T A;  2XPU A;  4U0Y A;  1H88 C;  3I5U A;  1Y1W J;  3PQK A;  1UEL B;  2WAE A;  2JA6 J;  3HKZ N;  3GTM J;  2CS3 A;  5JVT A;  2E71 A;  3JRA A;  2FMY A;  3VYR B;  1YYV A;  4FX4 A;  5CVV A;  5L3B A;  4A0Y A;  2VUM J;  2DJI A;  5LEK A;  1FBS A;  2F5D A;  4G12 A;  2DTR A;  4HNV A;  2V7F A;  2IGO A;  3DFG A;  1IXR C;  5GPA A;  1RUN A;  2ZJP F;  1RUO A;  3H5A A;  2M30 A;  3OYN A;  3M3Y J;  1HXD A;  1LPQ A;  2X1D A;  3F8N A;  3NAU A;  3ONQ A;  3DU5 A;  4UXN A;  2Z9O A;  4LB5 A;  1JGG A;  5FLX K;  4P96 A;  3K1N A;  3CCM I;  2KRH A;  3AG2 H;  2XGC A;  2HOS A;  2XDV A;  4MTE A;  1P4X A;  2E1N A;  2M34 A;  4WCG A;  1V54 H;  2EQR A;  3VPR A;  4DGW B;  1ZRD A;  2L7K A;  2Z3Y A;  3G1O A;  3CO7 C;  3LNQ A;  4NQW A;  1W0U A;  3ESW B;  1UHW A;  2ESN A;  3OMY A;  4ETS A;  4RB0 A;  3DF8 A;  1R1T A;  5FKL A;  5EZG A;  1KU7 A;  1S5L C;  2L7Z A;  3F23 A;  3ISP A;  1HOM A;  1YI2 I;  4HW0 A;  3HDD A;  2LY1 A;  3CUQ C;  3GXO A;  3HRM A;  4MTD A;  1R6R A;  1IAW A;  4L0Z B;  3HRS A;  1HKT A;  1DDN A;  3MEX A;  2E19 A;  2B7E A;  2NVU B;  2Y0S A;  3BQY A;  1R00 A;  4QWQ A;  3D5L A;  1SFX A;  1EH6 A;  3AKZ A;  4XID A;  2KIF A;  2LG4 A;  2LYC A;  3GLL A;  2JVG A;  3JR9 A;  1HLV A;  4QPQ A;  1JKR C;  1EH8 A;  3J7A O;  2H94 A;  1QZZ A;  2ISY A;  3GLX A;  1QVU A;  2K86 A;  9ANT A;  3BQZ A;  1CQT A;  4AID A;  3O8G A;  2NS0 A;  3PNY A;  2FML A;  1SC7 A;  1FMW A;  3GCM A;  3WTS C;  3TP0 A;  4E7K A;  2CO5 A;  2D2W A;  1ONV A;  2ID3 A;  1Y39 A;  5C3E J;  2ZXJ A;  1LVA A;  2HS5 A;  3WGH A;  5FKO A;  1ZH5 A;  2XAS A;  5E3M A;  2BHZ A;  5HLG A;  1ZAR A;  5K7F A;  1RRJ A;  1FLI A;  2RNJ A;  2VLA A;  2PI0 A;  2ZME C;  1PP8 F;  3DTK A;  1R5I D;  4XM3 A;  3C2B A;  2YX7 A;  5HDG A;  2AXT C;  2LNB A;  3LSK A;  4MHG A;  2HQ5 A;  3BZ6 A;  3UKG A;  3C18 A;  2CQX A;  3HTU A;  1T0F A;  1YJW I;  3CD6 I;  4UVA A;  1BI2 A;  3CQZ J;  1JUS A;  1ZTR A;  2VKE A;  2ZNZ A;  3KLN A;  3DLL F;  1T39 A;  1YTY A;  1X1A A;  1OCC H;  3CCL I;  2GWR A;  2R93 J;  2LR8 A;  2BY1 A;  2P5L C;  5CVR A;  2MC4 A;  3BLY A;  4CSW A;  3FM5 A;  2ZJR F;  4CHU A;  4WWC A;  2ZXH A;  1FOK A;  1YS7 A;  3IUO A;  3Q3S A;  3ABU A;  4O3M A;  4ESB A;  1LNW A;  4IZZ A;  3ZMD A;  5D5X B;  1F43 A;  3I0T A;  1B72 A;  1B59 A;  2H6C A;  3G1M A;  3VWB A;  2RQQ A;  4HEA 2;  4ZDP A;  3JSP A;  1AU7 A;  3EYI A;  2MLK A;  2R4G A;  2L54 A;  4EGZ A;  4RAZ A;  1XCV A;  5J3L A;  4CYC A;  5J4Y A;  1MNM C;  3FHN A;  2FSW A;  2LRE A;  1P7I A;  4S0H B;  4ABZ A;  3GZ6 A;  4KIS A;  2W1O A;  5LHG A;  2Z5U A;  4GGG A;  2W57 A;  3SQN A;  1T08 B;  1YJ9 I;  1N77 A;  3CUQ A;  5A2Q K;  4EM1 A;  4ITV A;  1YOV B;  3E6D A;  1TL8 A;  4XL9 A;  3BJO A;  2O0Y A;  4RGS A;  4HDU A;  2QWW A;  4PSW A;  5DUK A;  3R60 A;  1R4M B;  3QPS A;  3FXK A;  3ZCO A;  2TDX A;  1X3Z B;  4WF2 A;  1LFU P;  2HVR A;  2HYF A;  1G4D A;  3O6B B;  2NRA C;  2MD0 A;  2FXA A;  3I59 A;  1SMY F;  1P4A A;  4CXF A;  1OPC A;  4OIP F;  1RZ4 A;  1WH5 A;  2VE8 A;  3KZY A;  1FP2 A;  1X3U A;  3JRD A;  1TQP A;  2M9H A;  1OYY A;  2LRD A;  2BY3 A;  4FE7 A;  2PJP A;  1I5Z A;  2GA2 A;  4BH9 A;  1R4N B;  1D8K A;  2CWE A;  2HR3 A;  4B3X A;  2DPU A;  3C3W A;  5CJ9 A;  5HS8 A;  4UUT A;  1B8I B;  4XOP A;  1IZ1 A;  3GO5 A;  3OWT A;  4NDL A;  2VN2 A;  2E2H J;  2A61 A;  3HRT A;  4UNO A;  1XTA A;  5H2F C;  2XB0 X;  1KQ8 A;  2RC4 A;  3S3N A;  5GAD J;  2HQN A;  2QF7 A;  2LC2 A;  5IOY A;  1D1C A;  3FK6 A;  3M7G A;  1XG1 A;  2P8T A;  2R5Z B;  2UV1 A;  4BL0 B;  5K5R A;  3QRF F;  1UHS A;  3FIS A;  3HIF A;  3K70 C;  2DO7 A;  4RGX A;  5M5X J;  3IKT A;  2B0L A;  2P7V B;  5CKT A;  2OC6 A;  2DOA A;  2IJL A;  3OS0 A;  2XKP A;  1X1B A;  3RDI A;  3CC2 I;  1YLF A;  1YRN A;  3PSF A;  2HVQ A;  1UB9 A;  3NWS A;  4E7J A;  5L3E A;  1F1Z A;  2Z1D A;  4P5O A;  2DYS H;  5GAH J;  3G2B A;  1IC8 A;  2VXD A;  4HQM A;  4EM2 A;  1FJL A;  3CMA I;  2BW3 A;  4PFO A;  4A69 C;  2H09 A;  5IY5 H;  4BQQ A;  4ENN A;  1T33 A;  5GP9 A;  3BR5 A;  2ESH A;  3AG1 H;  4HBL A;  5HS9 A;  4FAS D;  1WSU A;  3JSO A;  2HDC A;  4GDF A;  2V9V A;  4M3D A;  4BEH A;  3OOU A;  2CFX A;  1K6Y A;  1Y0U A;  4G6Q A;  1Z6R A;  2BY0 A;  3WTY C;  1I6X A;  4GFB A;  4BEH B;  1X19 A;  1JI8 A;  1P9Q C;  5ILV A;  1PJR A;  2DT6 A;  2LBF B;  2IGK A;  4DJA A;  2FNP A;  2CG4 A;  3RKY A;  3GFI A;  2H27 A;  1MSE C;  3BG6 A;  3G4S I;  3T0Y A;  3CO6 C;  5D4R A;  2FQ4 A;  2CV0 A;  3S2W A;  2L02 A;  3MKY B;  1WJ5 A;  4IXA A;  4XLF A;  1TWH J;  3DQV C;  1DGR M;  4Q48 A;  1SD4 A;  4DIQ A;  3LA2 A;  1SVO A;  3HEF A;  1ZG1 A;  1UAA A;  1B4A A;  4A3J J;  3GWZ A;  4BGD A;  3HM5 A;  3TBI A;  1OR7 C;  1P4W A;  1JHF A;  2KHM A;  4DZP A;  3JW4 A;  3HC7 A;  3ECO A;  2EIL H;  4Y13 A;  5CYV A;  3HHG A;  3EUA A;  2TCT A;  3F9K A;  2R3S A;  3PUF A;  1O57 A;  2VXZ A;  3RI4 A;  1R36 A;  4A3D J;  2JPB A;  3F6V A;  3CF5 F;  5K7H A;  3V8L A;  1MW7 A;  3J81 K;  3GTP J;  2ZJQ F;  5J1R A;  2IAI A;  4B1R A;  4F92 B;  2VBZ A;  4UY8 I;  4OMY A;  1Z0X A;  2X1C A;  4GYI A;  4HX8 A;  3FF5 A;  2KJC A;  1VQL I;  3C7J A;  3I56 I;  1I39 A;  3G6E I;  1DU6 A;  1IO2 A;  3K4C A;  5LGU A;  1GLN A;  2DK8 A;  3IV5 A;  1OYI A;  1KU9 A;  5DYM A;  1Z7L A;  2ZC2 A;  3TOA A;  4EJV A;  3JRF A;  1VF9 A;  3MZY A;  1BJA A;  2E60 A;  3E6B A;  4BBR J;  3KPH A;  1D0Z A;  5IYB J;  1OCR H;  4HF2 A;  4BUP A;  3DXJ F;  1IJW C;  2BEO A;  2ETH A;  2COB A;  3N4M A;  2ICW G;  1R23 A;  4D7N A;  1MGT A;  5F0F A;  3KYL A;  2K5C A;  5FKK A;  4BXU A;  2JJ7 A;  2YR2 A;  1U6G A;  2M2E A;  5ICF A;  2GM4 A;  4A3K J;  4M6Y A;  2Z33 A;  2B63 J;  1WWX A;  4NC7 A;  2OQG A;  4FE4 A;  4I7H A;  4CA0 A;  4DBR A;  2DMU A;  5GAE J;  2E7X A;  5IP9 J;  2R7X A;  2DCE A;  1KGS A;  5B3S H;  5K1Y A;  2VBX A;  1VQK I;  1H9G A;  3V4G A;  4ESF A;  2XRL A;  4HX7 A;  1X2N A;  4R1H A;  3GZ5 A;  4U7B A;  4BBS J;  4G6D A;  1J59 A;  2PEX A;  2V1D A;  1A36 A;  3DPL C;  1VQ5 I;  2OZU A;  4N0B A;  3O8H A;  3ZQ7 A;  3QWL A;  1BI3 A;  1J09 A;  2OCE A;  2LKP A;  4MFD A;  1KYZ A;  5BPI A;  5CVU A;  2KIM A;  2PMU A;  1JKO C;  1TT0 A;  1NK2 P;  3I53 A;  4KT6 A;  2F5C A;  3KEQ A;  4IHW A;  4LG0 B;  4BU2 A;  4L18 B;  3BG7 A;  1Y1V J;  4I09 A;  2TRT A;  4D5C A;  4AIH A;  1ETY A;  5D8L B;  3OIO A;  3BCB A;  4A5M A;  3OIP A;  1TW2 A;  1I1S A;  2NS8 A;  1ETV A;  1IDZ A;  1JUP A;  4ENM A;  2A5Y B;  2QCO A;  4XKW A;  5EEG A;  4JP0 A;  4LLG F;  4RB1 A;  3E5Q A;  4V2F A;  5IPA A;  4HOB A;  4XSX F;  3ZPL A;  2MYS A;  1ZEL A;  2F2E A;  1RR8 C;  2A6T A;  3IHU A;  3FXL A;  1LE8 B;  2JTV A;  2VJ5 A;  3BRO A;  3S8P A;  3FHZ A;  2R7D A;  2V4J C;  4RAY A;  1AHD P;  5F0H A;  1VQO I;  3GX4 X;  4LFU A;  4FQG A;  3VOE A;  3GFM A;  5DD8 A;  1MND A;  5TRD A;  1OR7 A;  4B44 A;  3K70 D;  2XGD A;  1B9N A;  1OCO H;  4AM3 A;  2OBP A;  4IOA F;  2W00 A;  3BTJ A;  1LQ1 A;  4I98 B;  3HJE A;  2XRN A;  3M1C A;  2Q2E B;  3H36 A;  4BE2 A;  3CCQ I;  1D5V A;  1ENH A;  1QHG A;  4N4O B;  2IGN A;  5E8I A;  2V79 A;  2CH0 A;  1VI0 A;  2VT2 A;  1FYK A;  2AXL A;  1YX5 A;  3G1L A;  3KP7 A;  3PM1 A;  2YU9 J;  2O61 A;  1O4X A;  2XAJ A;  3SFZ A;  4FTH A;  2EH3 A;  2IP2 A;  1S7E A;  1PUF B;  3HPH A;  2QBY A;  3Q0V A;  2BZT A;  4PJ0 C;  3IWZ A;  3JRI A;  1O3R A;  3TOB A;  4L5E A;  2KZG A;  4LLN A;  3W3C A;  2E1M C;  2BY2 A;  4C3I J;  1R49 A;  1JKQ C;  3DP7 A;  3PJR A;  4HNT A;  4EJT A;  5CPR B;  2HVS A;  2EFW A;  3TDZ C;  3ZQG A;  1SFK A;  4RB3 C;  2EB7 A;  2VJJ A;  3ELK A;  4ZYD A;  2RDP A;  3PL8 A;  3L9F A;  3GFL A;  4DQ2 A;  1WJD A;  4P1W A;  5L3F A;  4ZDL A;  2H8W A;  3PSI A;  4O5V A;  4UB6 C;  2EFP A;  5E3O A;  2ACJ A;  1SD6 A;  2ZXW H;  1X3W B;  3LSR A;  3R0J A;  4A5N A;  3SZT A;  2LY2 A;  5D6F A;  1Z3X A;  1U2W A;  4WXD A;  4CCJ A;  1SEU A;  2ZO4 A;  3ABL H;  4F7Z A;  2OD5 A;  3COA C;  3J7Z I;  3PFY A;  5M5W J;  2ZSH B;  1HKS A;  1FC3 A;  1XDU A;  4MNU A;  2M7B A;  1TWF J;  2VAS A;  3RKW A;  3BR1 A;  3GF2 A;  2UWM A;  1GHC A;  1C0W A;  1BBY A;  2M8G X;  1NHA A;  4HPQ A;  1E3H A;  1TQM A;  1LDD A;  1X4P A;  3MKL A;  2MD5 A;  1BR4 A;  3HOZ J;  1PUE E;  3BCA A;  2VQL A;  3CCJ I;  2DJN A;  3TO9 A;  3LFU A;  2OQR A;  2L9R A;  2O6G E;  2A6E F;  2L5Q A;  2CW8 A;  2M8E A;  1W7P A;  2RGV A;  4FX0 A;  2RVC A;  2EZH A;  2M4K A;  2XVC A;  1DU0 A;  5EYR A;  6PAX A;  3UNG C;  1JT6 A;  3L00 A;  2JA2 A;  2DPD A;  4RM3 A;  3OS2 A;  2E2J J;  5BS6 A;  3FM3 A;  1CGP A;  3ROU A;  3CZ6 A;  2M5W A;  5H6R A;  4OIR F;  2KP6 A;  1SAU A;  1Z77 A;  2Q8K A;  4I6Z A;  2P81 A;  5ILU A;  2IA1 A;  3VDX A;  1GV2 A;  4NQW B;  1A35 A;  4B43 A;  3AL0 B;  5HNH A;  1YIO A;  1IXS B;  2AQF A;  2PMZ A;  1RKW A;  3PNT A;  3RQ4 A;  2AQE A;  4F93 B;  1PDN C;  5LRS A;  1APL C;  2MW8 A;  4GCV A;  4KUM A;  2WA0 A;  3V8J A;  1O3S A;  3BP8 A;  5KNL A;  4KN4 X;  3RKQ A;  3EET A;  3HG9 A;  1WKM A;  1QPI A;  5L3G A;  2A07 F;  3QOP A;  2K7L A;  3GTO J;  2DDB A;  2FNA A;  2CV1 A;  5ICC A;  3OL3 A;  3S3O A;  5HLT A;  1RI7 A;  3HOX J;  2OA4 A;  2QEN A;  3LSJ A;  3K6G A;  5FLX Z;  1QZE A;  2CYY A;  4UUS B;  1YFH A;  3I54 A;  2DMQ A;  5LHH A;  2MSY A;  3WU0 A;  5B5E C;  4C2U A;  4DYQ A;  4BKX A;  1I3A A;  3OSF A;  4XLC A;  3OYC A;  3REO A;  2PLY A;  1WJC A;  1Z91 A;  2CUE A;  1S29 A;  3F8B A;  3GUD A;  1TC3 C;  1OYW A;  5HDK A;  3VSK A;  1MDM A;  4W97 A;  4PGG A;  4KDP A;  3LOC A;  3BDD A;  3OYL A;  2OTJ I;  1WZ2 A;  3HRU A;  3S2H J;  5F1R A;  4ZYA A;  4ZZL A;  2Y69 H;  4OMZ A;  3ZQH A;  3E5U A;  2XAH A;  5HS7 A;  2I8D A;  3LSG A;  2ZSI B;  2NVT J;  4KA4 A;  1JXS A;  3C2G A;  2XKO A;  3EUH A;  1U8B A;  1TTY A;  1T0F C;  4CIC A;  2CQN A;  4M6V A;  1IRZ A;  5FRM A;  4EVI A;  5A2Q Z;  1MNE A;  4M3B A;  4XBF A;  1F4K A;  2M0C A;  3GVA A;  2OF7 A;  3J80 Z;  5C4X J;  4RLF A;  4GXO A;  2NOJ B;  2QZ8 A;  4QTR A;  1Y0N A;  3JRH A;  2KJB A;  4I76 A;  1YIT I;  3M4O J;  3HZJ A;  3E6M A;  4I2O A;  4EJU A;  3JAM K;  2UXN A;  4HLY A;  2EZI A;  3WGG A;  1AKH A;  1SVL A;  1WPK A;  2OU2 A;  5E18 F;  1YG2 A;  5JFR A;  3OYG A;  3B02 A;  4RAG A;  2XSJ C;  1ZRE A;  3I4M J;  1G3Y A;  2CUF A;  4BE1 A;  1QGP A;  2EFN A;  2CQK A;  1IGN A;  4KYW A;  1FWZ A;  5HDN A;  1NG6 A;  5IYD J;  4IPA A;  1RIO H;  4KMU X;  1K61 A;  4LMY A;  2DA5 A;  2WY8 Q;  4IRG A;  2GXB A;  4BQO A;  2PMZ N;  2VOP A;  2Q0O A;  2LF7 A;  2W48 A;  4ZDO A;  3ZMS A;  3BPX A;  4ENK A;  4KFC A;  1HST A;  1K79 A;  2LH9 A;  4LIV A;  3ULQ B;  3Q5F A;  2VKH A;  1ETX A;  3A02 A;  4KJZ A;  1FP1 D;  4CCM A;  5BPD A;  4UUV A;  4DBQ A;  2QUF A;  2P0W A;  2V1U A;  5E79 C;  5JR3 A;  1BW5 A;  3KZI C;  2YUS A;  2JRM A;  2WTE A;  3BTC A;  4KIG A;  4C30 A;  3EQL F;  2VC1 A;  1IF1 A;  4R8H A;  1FNN A;  1ZG5 A;  1BC8 C;  3QYB A;  2ECC A;  2R7W A;  2H1L A;  2KDO A;  1MJB A;  3H35 A;  3F0C A;  1AA7 A;  1WJE A;  3C2H A;  3LSI A;  2WV0 A;  4CCK A;  5JHF A;  1FSE A;  4KN7 X;  3JAM Z;  1FTT A;  1LFB A;  3HSR A;  2EFQ A;  2HOE A;  2LFB A;  2RV8 A;  1NH3 A;  2ISZ A;  1J2X A;  4DZJ A;  2J5O A;  2ZJ2 A;  3GTG J;  5EJC A;  4XN0 A;  4E7H A;  5LEJ A;  2QQB A;  1W5T A;  5FGM A;  2FE3 A;  2PX9 A;  2R0Q C;  4OIO F;  1CF7 B;  3MQ0 A;  3T5X A;  2BYV E;  2DBB A;  3LA3 A;  3V42 A;  2XAG A;  3ZQL A;  3TMO A;  1R58 A;  5GAG J;  3LWF A;  2MC3 A;  1D0Y A;  2JSP A;  4HV6 A;  2Y2Z A;  4IHY A;  4M6X A;  3DBR B;  5LLQ A;  3OL4 A;  3OYE A;  2CUJ A;  2H6B A;  2FRH A;  1U8R A;  2PJR B;  3DEW A;  4XRS G;  1F5T A;  2HZD A;  4KIB A;  4U0V A;  4ZC3 A;  2HYJ A;  2P5K A;  4IHV A;  4RA2 A;  5EDN A;  3KE2 A;  1U3E M;  4OAZ A;  4RBO A;  3LST A;  5F08 A;  5EG0 A;  4V2G A;  3KP3 A;  3VFZ A;  3L2W A;  1T6S A;  4RAF A;  2DFE A;  4WK8 F;  3IH4 A;  1YW9 A;  4AVZ A;  3ASO H;  2EPF A;  2MH2 A;  2E36 A;  2VQC A;  3BPV A;  5JLW A;  4ZTJ A;  1X1D A;  2NOG A;  4M3E A;  2LKS A;  4M3F A;  2EV5 A;  3J7A Y;  2QVO A;  2WAQ A;  2F5V A;  3H9J A;  1GT0 C;  2H8R A;  3SDG A;  1MMS A;  2JUG A;  3QPH A;  4JX6 A;  4BAC A;  2MAB A;  2Y48 A;  4GO1 A;  3SZP A;  1D5Y A;  1Y8R B;  3T8R A;  3DCF A;  5K5Q A;  1VQ8 I;  5K7Z A;  4EEF G;  4HX4 A;  1XB4 A;  4NNJ A;  1OCT C;  3SZG A;  3F72 A;  3WHB A;  1ZK8 A;  3OR2 C;  5GPC A;  3F8F A;  1OJL A;  3LSP A;  3S3M A;  4RS8 A;  2VPL A;  2IS2 A;  4W1U A;  4DYC A;  1Q1H A;  3FIW A;  2NAZ A;  3EDP A;  4ZTF A;  4EM0 B;  2YU3 A;  2OTL I;  2R7T A;  3KIO A;  2DA4 A;  1XDS A;  2ELH A;  4ZYG A;  1T95 A;  4HAM A;  3IRR A;  1K6O A;  1D0X A;  4HZF A;  2CGP A;  4HST A;  1ORK A;  5LGN A;  3KX2 A;  5TIS C;  3CCE I;  3S14 J;  1YX3 A;  5BNG A;  1FOX A;  1M1E B;  3WE3 A;  4TV7 A;  5B66 C;  2AO9 A;  3JRC A;  5E3N A;  5C4J J;  2CV2 A;  1BOB A;  3E7L A;  1WI9 A;  2FX0 A;  2VQG A;  4MO7 A;  1IN7 A;  1S9H A;  1Y8Q B;  3A03 A;  1SMT A;  2ZXI A;  3F21 A;  3OYM A;  2ELK A;  2KT0 A;  2HZT A;  2QSF X;  3R6S A;  2WC2 A;  3SHF A;  1L0O C;  1ZGA A;  1X4O A;  1IN5 A;  4JOM A;  1BR2 A;  4JBA A;  4MQ9 F;  2D45 A;  3CLQ A;  2AS5 F;  3HL2 A;  4B09 A;  4ZYE A;  3DKY A;  2RQP A;  1SFO J;  4X6A J;  4RM2 A;  3M07 A;  3I71 A;  4DW6 A;  2M45 A;  4CCO A;  3BG9 A;  4WXC A;  5F6F A;  3WTX C;  1VTN C;  1YO5 C;  1K4S A;  3WG7 H;  4Q47 A;  2R5Y B;  1U5T A;  4IQJ A;  4BY7 J;  3F3X A;  4IX7 A;  3WTU C;  2WB1 N;  1NTC A;  2CSO A;  3K0L A;  5E1W A;  2FF4 A;  3PIP F;  2HI3 A;  1ITY A;  3HUG B;  2L9N A;  1BW6 A;  5KAF C;  3OV8 A;  4P9F A;  4O6J A;  1Z9C A;  3BY6 A;  3CJR B;  2KQR A;  5J8F A;  3CP8 A;  2HWV A;  3T1B A;  3OSG A;  2XC7 A;  1ULY A;  3KP5 A;  4D1Q A;  5FLV A;  2KIU A;  1UFM A;  3I3L A;  4P9U A;  2MFZ A;  3MMY B;  4LD5 A;  1W5S A;  2IA2 A;  3OYA A;  5J47 A;  2O8X A;  3V7R A;  2HOT A;  4RLQ A;  3FKJ A;  3M1E A;  4RMN A;  2RKH A;  4G7O F;  2LK2 A;  3H3U A;  2KIQ A;  2F5F A;  2F48 A;  2CU7 A;  2DFI A;  2GBY A;  3LQR A;  2OCC H;  4B48 A;  4E70 A;  2CJJ A;  2CQQ A;  2WAD A;  3PFI A;  2QLZ A;  1PP7 U;  3RYR A;  4NC6 A;  1FEX A;  2Z16 A;  5DD4 A;  3ZQQ A;  2E1O A;  1A04 A;  1JKP C;  2EV0 A;  2XAQ A;  3FBN B;  3IAS 2;  2XGX A;  3CCV I;  3BOQ A;  4E6K G;  2EA2 A;  1G6N A;  3K4L A;  3M8E A;  5IT9 Z;  3LSM A;  5FKN A;  2KDZ A;  3VSL A;  2EZK A;  4CGZ A;  1ZRF A;  1JTY A;  3LAJ A;  3SYT A;  4BQN A;  4AWX B;  3DWL E;  2XPW A;  2QQ8 A;  1WQ2 A;  2DDA A;  4XLN F;  4MLO A;  2GZW A;  3SEZ A;  2FQ3 A;  2IW5 A;  2R7F A;  2HTJ A;  3HUG A;  2BGC A;  3K7A J;  5FLM J;  2DFF A;  3I58 A;  2V6C A;  4EJO A;  4JX4 A;  1O7F A;  4IQ4 A;  4EMS A;  3CC7 I;  3E3V A;  4C2T A;  5EGO B;  4A6D A;  2HKO A;  1QNT A;  3CDI A;  4PGH A;  1CF7 A;  1S6L A;  4HQE A;  5LGT A;  3QU3 A;  2L7M P;  5IP6 A;  5FB2 A;  5BOX A;  2ECB A;  3L2C A;  3QAH A;  5M5Y J;  3IC7 A;  5M3M J;  4M9S A;  2W4S A;  1HW5 A;  3MCZ A;  2HEO A;  3EYY A;  2X0L A;  3UR3 C;  2LKX A;  2FBH A;  1AOY A;  1U9N A;  3IH3 A;  3KYD B;  1YJN I;  3RQI A;  4A0Z A;  4A3G J;  4FT8 A;  3U9G A;  4CYC B;  2YX4 A;  4IRI A;  1FSH A;  5DCF A;  4XLH A;  2X48 A;  2DA2 A;  3CES A;  4P55 A;  4LOC A;  3QOE A;  2C6Y A;  2JT1 A;  1UZC A;  1K78 A;  1S7O A;  3OIQ A;  3H92 A;  1UJ8 A;  3N05 A;  2QA4 I;  1NG7 A;  2VON A;  2VC0 A;  5KK1 A;  2JA8 J;  3K2Z A;  4NHJ A;  2F4I A;  2XUB A;  1T98 A;  4UVB A;  1T8I A;  2E5Z A;  2QGU A;  3IL2 A;  3H0G J;  1FT9 A;  2IVM A;  3L1P A;  2QSH X;  4OIQ F;  3ZN0 A;  2EIM H;  4AVP A;  2MBF A;  3JCU C;  2VI6 A;  1X1C A;  4YEL A;  5LD2 C;  1T2K A;  2WBM A;  5HOD A;  1WCM J;  2OV7 A;  3U2R A;  1X1P A;  3HOY J;  2JA7 J;  3DPU A;  5E3L A;  3ZXS A;  3HHH A;  5DM7 F;  2R5Y A;  1VQ6 I;  3HOV J;  1EH7 A;  4YII A;  5J40 A;  3P9I A;  4ESJ A;  2B9S A;  2R7Z J;  1U78 A;  4J01 A;  1HW1 A;  3B73 A;  3ECH A;  3DV8 A;  1T38 A;  2FD5 A;  2G9W A;  4Y15 A;  2X85 A;  2VQH A;  3ABK H;  2PG4 A;  1V5F A;  1KON A;  2O5R A;  1QBJ A;  3EPZ A;  3RZO J;  2D1V A;  4CUG A;  4ENJ A;  4AC0 A;  3BG5 A;  4PFP A;  2RAE A;  3CDL A;  2I10 A;  3BT9 A;  1HC8 A;  4A6E A;  3DKX A;  1K78 B;  4M73 A;  2KMU A;  2QQA A;  5EF6 A;  1OLT A;  2XF5 A;  1W7P B;  3FMS A;  3CF2 A;  2E2I J;  3DKW A;  1D8J A;  4A3B J;  1BIA A;  1RET A;  1HKQ A;  3ZQI A;  4A2U A;  4D7M A;  2WV1 A;  2W82 A;  1S7A A;  2HOA A;  3KYC B;  3AL0 C;  4G7H F;  1Q1V A;  1E3P A;  4C2M J;  2YSR A;  1VFC A;  5JI6 A;  4L5J A;  4BY1 J;  5FJ8 J;  3A4C A;  3WTV C;  1KU3 A;  4WXH A;  5AIQ A;  4BNC A;  4A3C J;  1A6I A;  4A3F J;  3L09 A;  2J5P A;  2JQ7 A;  4RB2 C;  4Y33 A;  5EG0 B;  2GLO A;  1WGX A;  2BXZ A;  2F6C A;  1PYV A;  4L0Y B;  3ML6 A;  2EK5 A;  3BR2 A;  3ZMZ A;  1YS6 A;  1Z1D A;  4BHP A;  3BR3 A;  2W85 A;  2LLK A;  5LHI A;  3RPU D;  1QVT A;  4HLX A;  1FX7 A;  2IXS A;  5J4V A;  2VJ4 A;  4LIU A;  5EZH A;  1ZR2 A;  1G8X A;  2IA0 A;  2R7U A;  2NNN A;  1HSJ A;  1Z67 A;  2PQ8 A;  1Z21 A;  3FK7 A;  4UUS A;  3O3K A;  2I5U A;  3L2Q A;  5FO5 A;  1XSX A;  3O2P E;  3QP5 A;  3GTL J;  2NS7 A;  2K4B A;  3C1D A;  4BQA A;  3L7W A;  3SEQ A;  2X6W A;  1BM9 A;  2IS1 A;  4HV5 A;  1H0M A;  5E1X A;  1JJ6 C;  1IN6 A;  4PSX A;  2JPC A;  1QPM A;  5ILS A;  3S1M J;  3IP4 B;  5CQG A;  3HGY A;  4XKC A;  2BHY A;  3R4K A;  5CLS A;  1LJ9 A;  3JRB A;  3KP4 A;  2JZY A;  2DOF A;  2GA1 A;  3WGI A;  4BS9 A;  3BG3 A;  3H0D A;  2LP0 A;  5DEQ A;  4LIT A;  2V6E A;  2G7U A;  1TWA J;  4LK0 F;  3F8C A;  5CVI A;  2DQL A;  3S93 A;  4YFK F;  4AIK A;  4K2E A;  1V4R A;  2KZV A;  1UG2 A;  1Z7U A;  4Y17 A;  3KEO A;  5IT3 A;  4UHT A;  3TED A;  2DQR A;  3G73 A;  3FXM A;  3RIR A;  3W6K B;  3BZK A;  3TW7 A;  1DPR A;  4KIC A;  3I59 B;  3TKY A;  3S1Q J;  2R7S A;  2DU9 A;  1IRF A;  4XRS A;  1VQ4 I;  1KA8 A;  3GFJ A;  1PVE A;  2GIV A;  2UUZ A;  3ZQC A;  1FYM A;  2DW4 A;  1OQY A;  1G2H A;  3GYH X;  3FX3 A;  3OYK A;  3H3V K;  3DEE A;  5DUI A;  3MKW B;  1O3Q A;  4Q5S F;  5D8K B;  2P5V A;  3AAF A;  2ELJ A;  4BYY A;  2R7R A;  3MWM A;  3S16 J;  3P9K A;  4RDU A;  4Y3O A;  1O3T A;  5FD6 A;  1W0T A;  4OIN F;  4CCN A;  3I55 I;  2OZ6 A;  2RRE A;  2EFO A;  2VBW A;  3FXU A;  5E20 A;  4LLL A;  3MFK A;  5BMZ A;  1LVK A;  3D5R C;  1HDD C;  1ZRC A;  4QIW N;  4XLE A;  2DA6 A;  3GW2 A;  3DEU A;  4ZZD A;  1D3Y A;  2NYX A;  4AUX A;  3MZ8 A;  2Y0M A;  3V7C A;  1SFE A;  4N9H A;  1ETQ A;  4V19 K;  4E7Z A;  3NQO A;  2XF7 A;  3VYS B;  2W7N A;  2XGE A;  1U5T C;  3OR1 C;  2ZKZ A;  3L2U A;  2VOO A;  1XS9 A;  1WI3 A;  3CTA A;  3E0J B;  1UCR A;  1BI0 A;  5E8G A;  3MKZ A;  4J00 A;  1PUF A;  2VBY A;  2QBY B;  4BXF A;  2VKV A;  2JWT A;  4G7Z F;  3D1N I;  3I9V 2;  2KRF A;  3L2R A;  2VT3 A;  1BR1 A;  5F04 A;  3T8T A;  2K3P A;  4N9I A;  3P9C A;  3D5S C;  4CZZ A;  2M7A A;  3JRE A;  2OUM A;  2E5N A;  2FBK A;  1ZAO A;  1R5G A;  1ZG3 A;  4S05 A;  2HKX A;  1QA6 A;  1V5E A;  2E7W A;  3J80 K;  4HSR A;  3SDB A;  3CMM A;  3GZN B;  3WE2 A;  1D1B A;  2OAZ A;  4Y4R A;  3E6C C;  1UG0 A;  3CLO A;  3KEY A;  1ZQ3 P;  2EWN A;  4II3 A;  1K7A A;  4C3H J;  2O7O A;  2NVQ J;  5D4S A;  2UZK A;  1YIJ I;  2HFH A;  2Q2E A;  4A0X A;  4KIT B;  1FZP B;  2JN6 A;  2PN6 A;  1GUU A;  2W25 A;  1R71 A;  3H3Z A;  4E7S A;  3IH2 A;  3CJN A;  2BVM A;  3OYJ A;  2LOO A;  2V1X A;  3F6O A;  1MD0 A;  1HQC A;  4GYG A;  2DI3 A;  4OOI A;  2YPR A;  2NVY J;  3FMR A;  3K9T A;  4BXX J;  3I4N J;  4C3J J;  4AD9 A;  4PJJ A;  5DCM A;  5HLI A;  3CJT B;  4IO9 F;  2P6T A;  2R5Z A;  1A6Q A;  1NK3 P;  5F27 A;  2RNG A;  2IT0 A;  5TGT A;  1RC9 A;  1ERD A;  1MMG A;  2EBI A;  5TJJ A;  4LJZ F;  3BR6 A;  3BR0 A;  1MIJ A;  4QPO A;  2L4M A;  1REP C;  2O8K A;  2DA1 A;  2XB5 A;  3WG9 A;  3ERE D; 
#chains in the Genus database with same CATH homology
 5K7Z A;  4A3I J;  4EEF G;  2DMN A;  4B3A A;  3GTP J;  1MBE A;  1IDY A;  2HXI A;  5J1R A;  2IAI A;  1OCT C;  4B1R A;  3WHB A;  1ZK8 A;  5GPC A;  2DN0 A;  1OJL A;  4JYK A;  3LSP A;  4W1U A;  1Z0X A;  4DYC A;  2H1K A;  3BTL A;  3Q0U A;  1ETO A;  1MH3 A;  2ID6 A;  3FIW A;  2MGQ A;  5DS9 A;  2JMW A;  1ZKG A;  3S17 J;  2DA4 A;  3GBG A;  1DU6 A;  3IV5 A;  4A3M J;  4FIS A;  3JRF A;  1VF9 A;  1ORK A;  3CMY A;  3S14 J;  5BNG A;  3B6A A;  4BBR J;  5IYB J;  1XC5 A;  1IJW C;  1EF4 A;  3A01 A;  2AO9 A;  2COB A;  3JRC A;  4D7N A;  5F0F A;  5E3N A;  5FKK A;  5C4J J;  1I50 J;  2JJ7 A;  3E7L A;  2M2E A;  2FX0 A;  2GM4 A;  5DTD A;  4A3K J;  1FIP A;  1BJZ A;  4MO7 A;  3B6C A;  3A03 A;  3ZOB A;  4AYB N;  2B63 J;  2ELK A;  2KT0 A;  4FE4 A;  2Y31 A;  3GTJ J;  2DMU A;  1GVD A;  3CCY A;  1OCP A;  5IP9 J;  2Y0S N;  2XRL A;  2LY9 A;  1ZGW A;  1SFO J;  4X6A J;  1H89 C;  1X2N A;  2MG4 A;  2L7F P;  4DW6 A;  5IP7 J;  3BG9 A;  4BBS J;  3SFI A;  2R5Y B;  4BY7 J;  1A5J A;  3O8H A;  2Y30 A;  2WB1 N;  1NTC A;  2YS9 A;  1FIA A;  2LD5 A;  1B8I A;  2HI3 A;  4MFE A;  4MFD A;  1ITY A;  5FKM A;  1X2M A;  1LE8 A;  1BW6 A;  1JKO C;  1SAN A;  1NK2 P;  1IV6 A;  4IHW A;  3GTK J;  3OSG A;  2O9L A;  1Y1V J;  2N8G A;  1JTX A;  2TRT A;  4D5C A;  5FLV A;  1ETY A;  3PO3 J;  3OIO A;  2NS8 A;  1ETV A;  1IDZ A;  1JUP A;  2HOT A;  2VPR A;  2QCO A;  1RPW A;  2OPT A;  1RR7 A;  1ETK A;  4JP0 A;  4XRM A;  4V2F A;  5IPA A;  2LK2 A;  1UMQ A;  2CU7 A;  2GBY A;  4MIM A;  1LE8 B;  2CJJ A;  2CQQ A;  3S1N J;  2Y9Y A;  1MBH A;  1FEX A;  1I6H J;  2DMT A;  2E1O A;  1AHD P;  5F0H A;  2EZL A;  4XK4 A;  3TW6 A;  1JKP C;  1IUF A;  1BL0 A;  2XGD A;  3HBL A;  5FKN A;  2KDZ A;  2EZK A;  1JTY A;  1ZR4 A;  2ME0 A;  3BTJ A;  1U9O A;  1X58 A;  2HXO A;  2XPW A;  1TWC J;  1RES A;  4MLO A;  3RZD J;  1ENH A;  5M3F J;  1B72 B;  3K7A J;  2JA5 J;  5FLM J;  1VI0 A;  2LTP A;  3MN2 A;  3G1L A;  4JX4 A;  3PM1 A;  4JX5 A;  2YU9 J;  1RKT A;  2LVS A;  1O4X A;  4FTH A;  2EH3 A;  5EGO B;  1S7E A;  1PUF B;  3Q0V A;  1F36 A;  1MBF A;  1OFC X;  2L7M P;  5IP6 A;  3JRI A;  2ECB A;  4L5E A;  5M5Y J;  3SJM A;  1JJ8 C;  1ETW A;  5M3M J;  3HB9 A;  4C3I J;  5J1Y A;  1JKQ C;  1H88 C;  2XPU A;  1H8A C;  2LKX A;  1Y1W J;  1BA5 A;  1U9N A;  2X9D A;  3IH3 A;  4A3E J;  2JA6 J;  3ZQG A;  1TWG J;  3RQI A;  3HKZ N;  4A3G J;  4CYC B;  3GTM J;  2X48 A;  3JRA A;  2DA2 A;  4LOC A;  1K83 J;  4QSH A;  2VUM J;  5E3O A;  4G12 A;  3LSR A;  4HNV A;  5GPA A;  2JA8 J;  3M3Y J;  3NAU A;  1JGG A;  5M5W J;  3H0G J;  2XGC A;  3L1P A;  1TWF J;  5IYC J;  2HOS A;  3BR1 A;  2M34 A;  2EQR A;  3VPR A;  1QRY A;  4Y7N J;  2M8G X;  3G1O A;  3LNQ A;  1WH7 A;  2VI6 A;  1W0U A;  1T56 A;  3MKL A;  3HOZ J;  3W6V A;  5HOD A;  2DJN A;  1WCM J;  5FKL A;  5EZG A;  2L7Z A;  2L9R A;  5J1U A;  3HOY J;  2JA7 J;  1HOM A;  5E3L A;  2EZH A;  1DU0 A;  5EYR A;  2R5Y A;  3HDD A;  3HOV J;  1JT6 A;  2NVX J;  2R7Z J;  1YRN B;  2G0E A;  2E19 A;  1U78 A;  3BQY A;  2E2J J;  2FD5 A;  1HCR A;  2DTZ A;  3S1R J;  4I6Z A;  1Z77 A;  1MSF C;  3RZO J;  2P81 A;  4AC0 A;  1JUM A;  3BG5 A;  4XID A;  1GV2 A;  2RAE A;  3CDL A;  3JR9 A;  2I10 A;  1HLV A;  3BT9 A;  1JKR C;  1RKW A;  1QVU A;  5EF6 A;  4XIC A;  1APL C;  2MW8 A;  9ANT A;  3BQZ A;  1CQT A;  5EEA A;  2E2I J;  1MBG A;  4A3B J;  3O8G A;  3RKQ A;  1RET A;  1JT0 A;  3ZQI A;  1QPI A;  4D7M A;  3GTO J;  2WV1 A;  3TP0 A;  2HOA A;  2ZB9 A;  2ID3 A;  5C3E J;  1Q1V A;  4C2M J;  1VFC A;  5FKO A;  3HOX J;  4BY1 J;  5FJ8 J;  4UUS B;  3LSJ A;  5E3M A;  4A3C J;  1A6I A;  4A3F J;  2DMQ A;  1VND A;  5K7F A;  2MSY A;  3Q0W A;  3WHC A;  4DYQ A;  4BKX A;  5EG0 B;  3C2B A;  2GLO A;  1WGX A;  3OSF A;  2HQ5 A;  3UKG A;  2CQX A;  2CUE A;  3BR2 A;  3CQZ J;  1JUS A;  1ZTR A;  2VKE A;  3BR3 A;  1TC3 C;  2LLK A;  1QVT A;  4W97 A;  4D5F A;  5EZH A;  1ZR2 A;  3LOC A;  2R93 J;  2LR8 A;  2IEK A;  4M3G A;  3FK7 A;  3S2H J;  4UUS A;  2R92 J;  3ZQH A;  1POG A;  2NVT J;  3GTL J;  3LSG A;  3Q3S A;  2NS7 A;  1U8B A;  4M6V A;  1IRZ A;  1MBJ A;  2X6O A;  1JJ6 C;  1F43 A;  1B72 A;  3G1M A;  4M3B A;  3S1M J;  3HGY A;  1MBK A;  2M0C A;  1AU7 A;  2OF7 A;  3JRB A;  1I3Q J;  5C4X J;  4QTR A;  3JRH A;  5J3L A;  4CYC A;  4I76 A;  1MNM C;  3M4O J;  3BG3 A;  1P7I A;  2LP0 A;  4S0H B;  4ABZ A;  2EZI A;  3HGG A;  3GTQ J;  2K9Q A;  1AKH A;  1WPK A;  3QQA A;  4X1E A;  1TWA J;  1IG7 A;  3I4M J;  2CUF A;  2WAQ N;  1UG2 A;  1E3O C;  3TED A;  1IGN A;  5IYD J;  3TW7 A;  1K61 A;  2DA5 A;  3QPS A;  2PMZ N;  3S1Q J;  2W48 A;  5JLX A;  1LFU P;  4IEJ A;  4XRS A;  3ZQC A;  1FTZ A;  1G2H A;  1ETX A;  3H3V K;  3A02 A;  1WH5 A;  3K2A A;  3JRD A;  2M9H A;  4FE7 A;  1BW5 A;  3S15 J;  2DA7 A;  2YUS A;  3S16 J;  3BTC A;  4RDU A;  4UUT A;  1B8I B;  1W0T A;  4A3L J;  1R9T J;  5C44 J;  3PO2 J;  4NDL A;  2E2H J;  2IBD A;  2L0K A;  1MH4 A;  2XB0 X;  5F1J A;  1HDD C;  2QF7 A;  4QIW N;  5IOY A;  2DA6 A;  2ECC A;  2K9N A;  3FK6 A;  1XG1 A;  2R5Z B;  4AUX A;  4FCY A;  2CRG A;  2K9S A;  3F0C A;  3HOU J;  4Y52 J;  5EGO A;  4J19 A;  1UHS A;  2Y9Z A;  3FIS A;  4A93 J;  1ETQ A;  5M5X J;  2D5V A;  4DYR A;  1FTT A;  3HOW J;  4B4C A;  1LFB A;  1YRN A;  2LFB A;  2XGE A;  4DZJ A;  1XS9 A;  1WI3 A;  3FKI J;  1GDT A;  3GTG J;  4IHX A;  2XPV A;  1IC8 A;  1FJL A;  2R0Q C;  1AKH B;  1PUF A;  4A69 C;  2VKV A;  2JWT A;  3QPL A;  3D1N I;  1T33 A;  5GP9 A;  3ZQL A;  3BR5 A;  2HDD A;  5F04 A;  4M3D A;  3JRE A;  3MVP A;  3OOU A;  2Y2Z A;  4IHY A;  1P7J A;  3BTI A;  4GFB A;  5IOZ A;  1GV5 A;  3DEW A;  1HDP A;  4XRS G;  2ME6 A;  2FJ1 A;  2JK3 A;  3TP3 A;  2HYJ A;  1MSE C;  1ZQ3 P;  4IHV A;  5EDN A;  4C3H J;  2FQ4 A;  2O7O A;  3ZQF A;  4RBO A;  2NVQ J;  2AHQ A;  5F08 A;  5EG0 A;  4V2G A;  3A01 B;  2DMP A;  2JN6 A;  3NAR A;  1GUU A;  1TWH J;  3IH2 A;  3IH4 A;  2K40 A;  5F0C A;  3HEF A;  5JLW A;  4A3J J;  4M3E A;  2NOG A;  2NVY J;  3HM5 A;  4BXX J;  3I4N J;  4M3F A;  4C3J J;  4DZP A;  1GT0 C;  2H8R A;  3SDG A;  2XSD C;  2R5Z A;  1HF0 A;  1NK3 P;  2DA3 A;  5F27 A;  4JX6 A;  2TCT A;  2EBI A;  3BR6 A;  3BR0 A;  3JRG A;  4A3D J;  3S2D J;  5K7H A;  2O8K A;  1D5Y A;  2DA1 A;  2XB5 A;  3DCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...