4DYQA

High resolution crystal structure of terminase small subunit gp1 of the bacterial virus sf6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
molecule keywords Gene 1 protein
total genus 37
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dyqA01
1IC8A 2DA6A 3BTLA 3HOYJ 4GFBA 1ZQ3P 5EEAA 4D5CA 1Z77A 5EYRA 1CQTA 1FJLA 1I50J 1ITYA 5F04A 1JUPA 4JP0A 3OSGA 1BW6A 2DMUA 2LTPA 3LOCA 3MN2A 1JKPC 2ID6A 4BBRJ 1U8BA 2DTZA 3L1PA 2JWTA 3MVPA 1GT0C 4DYRA 1MH3A 4G12A 5FKKA 3H0GJ 1WH5A 1OJLA 3G1MA 4MLOA 1H88C 4C3IJ 4A3MJ 1WI3A 3IH2A 5EGOA 1BL0A 2QF7A 1RKTA 2YU9J 3E7LA 5FKOA 1MBGA 2G0EA 5K7ZA 5BNGA 2FD5A 5IP7J 1AHDP 3S1NJ 1GV5A 1TWCJ 2LKXA 2LK2A 5J1RA 5IPAA 4M3FA 1DU6A 2AO9A 2R5YB 4BY1J 3DEWA 2QCOA 1ZR2A 5IOZA 2HQ5A 3HOVJ 1XG1A 2LR8A 3HKZN 1OCTC 3NAUA 1RESA 2CRGA 3S15J 4AC0A 5M3MJ 4DZJA 1I3QJ 3HGYA 4ABZA 3ZQLA 3HGGA 1E3OC 2M9HA 4QTRA 2TRTA 2E2IJ 3JRCA 5F08A 3UKGA 2NVTJ 4A3BJ 2DA3A 5FKNA 2ID3A 2O7OA 1MH4A 2VPRA 1QVTA 1WCMJ 2COBA 4A3KJ 2NVQJ 2NVXJ 2HOSA 3W6VA 2M2EA 1F36A 3IH3A 1X2MA 3HOZJ 3ZOBA 2ECCA 4IHYA 1MBEA 1GVDA 1JTXA 2HI3A 2EZIA 4BKXA 2Y9YA 2GM4A 1FEXA 4I76A 1H89C 1FIAA 3FIWA 3S1MJ 2Y2ZA 1APLC 4B3AA 3CDLA 3ZQCA 4EEFG 1HF0A 2I10A 2CJJA 4D5FA 4A3CJ 2PMZN 2JN6A 3S16J 1QPIA 4DZPA 1MSFC 1UHSA 1K83J 1MBKA 1LE8A 3LSPA 1B72B 1P7IA 5JLWA 2DMPA 1WPKA 2L0KA 2L9RA 5M5XJ 1IDYA 2CQQA 1LE8B 2EBIA 1IJWC 1B72A 4UUTA 1XS9A 4QIWN 5M5YJ 2P81A 3S1RJ 2CQXA 4J19A 1NK3P 4A3FJ 4MIMA 3S2DJ 4V2GA 1FTTA 4AYBN 3MKLA 1U78A 4A3JJ 2NS7A 2EZHA 2JK3A 3HOUJ 1IUFA 2XPVA 2JA8J 4IEJA 4XRMA 5E3LA 2JA5J 1ENHA 3BTJA 3S2HJ 3OSFA 4QSHA 1TWFJ 3M3YJ 3PO2J 1MBJA 4JX5A 5EG0A 1H8AC 3A03A 2R0QC 4FCYA 3GTMJ 4A3LJ 3HOWJ 4A3IJ 1IGNA 3G1OA 1G2HA 4JX4A 1TC3C 1RPWA 3BTCA 5FJ8J 2H8RA 2LVSA 2GBYA 1Y1VJ 2WB1N 2X9DA 4HNVA 1HLVA 2M8GX 2XPWA 4A3DJ 4IHXA 1UMQA 5IYBJ 2LFBA 3BG9A 3FKIJ 1W0TA 1AKHA 3I4NJ 3HOXJ 1YRNA 3HM5A 3GBGA 1U9NA 1VF9A 1JGGA 1F43A 5F27A 3CQZJ 4RBOA 2Y9ZA 1YRNB 4DYCA 3WHCA 2Y31A 3GTOJ 4UUSA 5JLXA 5F0FA 1ZGWA 1BA5A 4Y7NJ 4NDLA 2DA7A 3TEDA 2VKEA 1WH7A 3NARA 2FJ1A 3CMYA 3RKQA 4X6AJ 4M3EA 5EG0B 3BR1A 2DMNA 2VI6A 1JT6A 2CU7A 2WV1A 3LNQA 5F0HA 4MO7A 1FTZA 3JREA 1TWAJ 5FLMJ 2O9LA 3BR2A 1X58A 3TP3A 3H3VK 3JRFA 1A6IA 2HXIA 4DYQA 1HDDC 4C3HJ 2JA7J 1BW5A 4M3DA 2KDZA 4FE7A 1IRZA 4DW6A 5E3NA 4M3BA 5GPAA 3JRAA 1BJZA 3CCYA 5E3OA 1AKHB 2K40A 3RZDJ 4IHWA 2DA2A 2MSYA 2R5ZB 2XB5A 4JX6A 4XIDA 2HOAA 1SFOJ 1QVUA 1JKOC 4XK4A 3BR5A 5M3FJ 1RETA 2IAIA 2XB0X 2D5VA 3O8HA 1HOMA 3JRDA 4X1EA 4W97A 2R5ZA 5E3MA 3RZOJ 3PM1A 1P7JA 3K2AA 1GV2A 1ORKA 2HYJA 1JJ6C 3BR3A 2E2HJ 1U9OA 2E19A 2M34A 4AUXA 1Q1VA 1GUUA 3ZQIA 3BQZA 1ETXA 4C3JJ 3A01B 3TW6A 5IP9J 5K7HA 1JKQC 1RKWA 4V2FA 1Z0XA 2JMWA 2HOTA 1S7EA 2K9SA 1I6HJ 4XRSA 1ETVA 1MSEC 2K9NA 2W48A 2XGEA 1WGXA 5F1JA 1QRYA 2NS8A 5DS9A 3LSGA 3FISA 2LP0A 2Y30A 2NVYJ 2Y0SN 2L7FP 3BR6A 3SJMA 5M5WJ 3B6CA 4MFDA 1B8IA 3GTJJ 2DN0A 1EF4A 2HXOA 2EZKA 3FK6A 1PUFA 1R9TJ 3TW7A 3OIOA 4FE4A 2H1KA 2OPTA 1ETWA 4B4CA 3TP0A 4XRSG 5HODA 4L5EA 5FKLA 3LSRA 4M6VA 2ELKA 4MFEA 1Y1WJ 4M3GA 3BTIA 3Q3SA 3ZQGA 5C44J 2XRLA 1ZR4A 1RR7A 2CUFA 1MBFA 3O8GA 3BQYA 3LSJA 2WAQN 1T33A 2ECBA 3A01A 2LLKA 2K9QA 1LFBA 1VFCA 4I6ZA 4BXXJ 1X2NA 1NK2P 1XC5A 5IOYA 2O8KA 1MNMC 4JYKA 3QQAA 4B1RA 4XICA 5IYCJ 3JRGA 2KT0A 1SANA 3RQIA 3SFIA 2R7ZJ 3DCFA 4LOCA 1UG2A 2HDDA 2JJ7A 2EH3A 1JUMA 4RDUA 4BBSJ 5EZGA 3A02A 5FLVA 2R5YA 1PUFB 3HB9A 2FQ4A 3HDDA 1JUSA 2DA5A 1DU0A 5GP9A 1O4XA 3PO3J 1IV6A 2YUSA 4IHVA 3IV5A 2DJNA 5IYDJ 3S1QJ 2GLOA 4A93J 2XGCA 2R92J 5J1YA 5C3EJ 4A3GJ 3S17J 5IP6A 2IBDA 1ZK8A 3B6AA 3D1NI 5GPCA 4CYCB 1JT0A 2E2JJ 1POGA 5F0CA 5EGOB 4UUSB 1VNDA 3JRBA 5C4XJ 3HBLA 2JA6J 1D5YA 4CYCA 2B63J 3S14J 2X6OA 1ETOA 1HDPA 2MW8A 2M0CA 5J3LA 5J1UA 2XSDC 1OCPA 1W0UA 3WHBA 3Q0WA 3Q0VA 2AHQA 2ME6A 5EF6A 2L7MP 3FK7A 3QPLA 1NTCA 2E1OA 2IEKA 1ETQA 1FIPA 2TCTA 4FISA 9ANTA 3GTGJ 3IH4A 1IG7A 4W1UA 5EZHA 2ZB9A 2LD5A 4D7MA 2DMQA 4Y52J 3ZQHA 2DMTA 3JR9A 4FTHA 1ZKGA 2DA4A 2EZLA 4C2MJ 2ME0A 2NOGA 3Q0UA 2X48A 1JTYA 1ETYA 5FKMA 4A69C 3C2BA 1K61A 3HEFA 2R93J 1AU7A 3BG5A 2YS9A 2CUEA 2OF7A 2XPUA 2RAEA 2N8GA 2XGDA 3GTPJ 4S0HB 2EQRA 5C4JJ 2DA1A 3BG3A 2VUMJ 3M4OJ 3BT9A 4A3EJ 1ZTRA 1TWGJ 2MG4A 5K7FA 1TWHJ 4D7NA 1ETKA 3JRHA 1MBHA 3QPSA 2VKVA 3K7AJ 1JKRC 1OFCX 2FX0A 3VPRA 3I4MJ 2L7ZA 3SDGA 1GDTA 1LFUP 1JJ8C 5DTDA 2MGQA 3GTQJ 2LY9A 3BR0A 3GTKJ 3G1LA 3OOUA 1T56A 1VI0A 4BY7J 1IDZA 3JRIA 1A5JA 3ZQFA 5EDNA 1HCRA 3F0CA 1B8IB 3GTLJ
chains in the Genus database with same CATH superfamily
1IC8A 3BG6A 2B0LA 2QSHX 3A1YA 3BTLA 3KYCB 1BR1A 5EYRA 4E7LA 1Z05A 3L2UA 1CQTA 1FJLA 1T8IA 1ITYA 4P1WA 2XC7A 1JUPA 1TNSA 4XL9A 4YEJA 4HBLA 1S3JA 5DDGA 4BUPA 3TGNA 3OV8A 1MNEA 1JKPC 2COMA 5BQTA 1BN5A 3L1PA 3G73A 3I64A 1GT0C 1I3AA 4R8HA 1TQPA 4YIIA 1WH5A 4CICA 1H0MA 4UHTA 1H88C 2MH9A 1I27A 1XMXA 1WI3A 2M30A 1HSJA 3QODA 3IH2A 2QF7A 2OQGA 5DUIA 5ILUA 2PEXA 3MZ8A 1I39A 2MLKA 4GDFA 5IP7J 2CO5A 2VKHA 4IJAA 1GV5A 2LKXA 1Z1DA 2AO9A 1IXRC 1NG7A 3EPZA 1LNWA 2QCOA 3EUAA 3GUDA 3QWLA 4ASNA 1PDNC 1XG1A 3HKZN 2CRGA 3DBLB 4AC0A 4OAYA 1I3QJ 4JOMA 1Y56A 4UVAA 3HGGA 3EUHA 4ENKA 2M9HA 2GIVA 1WI9A 1QGPA 2CQKA 1AOYA 2OV7A 4O6JA 5LRRA 4PSXA 5EEHA 5F08A 5HOOA 1T0FA 4A3BJ 2DA3A 1U5TA 1T95A 2CFOA 4P9FA 2COBA 5HS8A 2PJRA 3CESA 3CUQB 1B59A 2NVXJ 2ZJPF 2EFWA 1ZHFA 3BC8A 2HNHA 2L9SA 3HOZJ 2PI0A 3H5RA 4IHYA 1MBEA 1MDMA 1O7LA 2ETHA 3DKYA 1K7AA 4QWQA 2DLLA 1JTXA 2EZIA 3M8FA 2KKOA 4EM0B 5J8CA 2GM4A 3CC7I 3OIQA 1IN5A 3K4JA 2IS4A 3U9GA 3RQ4A 5JVGF 4B3AA 1SMYF 3ZQCA 3QYFA 3HIFA 3WTXC 1HBXG 4XN3A 2CV1A 3ZMUA 2CJJA 3AFHA 4IHSA 5LGNA 4D5FA 2JN6A 2CUJA 4DZPA 3GYHX 1B72B 4HDUA 2UXNA 5E1ZB 2W24A 1OCZH 4XKWA 4PGGA 2ZNZA 1KZHA 2ACJA 4BJTA 1B72A 1UHMA 4UUTA 4HEA2 1P4XA 1OISA 2R7TA 2CQXA 4I98B 1G59A 1X3UA 2R7RA 2KRFA 4J19A 3KYDB 3ML6A 3A0HC 1YOVB 2XVCA 4MIMA 4V2GA 4NQWA 4AYBN 3PIOF 4TV7A 2EFPA 4H4KC 4L9JA 3E6BA 3H5NA 2E36A 5B5EC 3HSEA 2IW5A 1CF7A 1R5ID 2OTJI 2KJBA 1V5FA 3S2HJ 1OPCA 1V4RA 2BZTA 2K9MA 4E7HA 1TWFJ 3I0TA 3DEEA 2DT5A 5EG0A 3OYCA 1H8AC 3A03A 3GTMJ 2RQPA 4P55A 3GZ5A 3HJEA 4BHPA 2R7SA 5FB2A 2HPMA 2VPLA 1IUYA 2JRMA 3IL2A 4KUMA 3ZGKA 5FROA 2LDUA 1G8XA 2WB1N 1ZARA 2Y0MA 3FBNB 1IRXA 4DNCA 4IHXA 4WXCA 1LEAA 5GTHC 2KPMA 3AG1H 4V19K 1AKHA 3CLOA 2OUMA 5J47A 3QU3A 1U9NA 3CO7C 5B1AH 1JGGA 3CQZJ 2Y9ZA 2WAEA 4CSWA 5D8LB 2NXNB 4DBRA 4RMNA 5LBQA 4UUSA 1E0EA 4HZFA 2W4SA 3D5LA 4Y7NJ 4HV5A 4G94A 4UB8C 2L54A 1WH7A 4B44A 3VWBA 3RKYA 4ZDPA 1BIBA 4X6AJ 1TT5B 2K3PA 5HS9A 1S7AA 2QQAA 1ZLJA 5CQGA 2W85A 2BXYA 2MFZA 3FMSA 4UV9A 3VEPA 1P2FA 3K10A 5L3FA 5K5RA 5FRMA 2OTLI 3PQKA 4L18B 3ABUA 3CLQA 4CUGA 3TP3A 1E17A 1HDDC 3RIRA 1KONA 2JA7J 2KIMA 1BW5A 4LITA 4M3DA 3WTYC 3I3LA 2STTA 2P6TA 1BR2A 1IRZA 4DW6A 3GXOA 2GOMA 1V55H 4GXOA 1FBUA 4EJTA 2QKMB 4BQAA 2P4WA 4XNFA 1TLHB 3S3MA 2DA2A 1VQ8I 2E1NA 1C0WA 1GHCA 3L00A 2Z33A 2AQFA 4WXHA 2HOAA 1SVLA 1SFOJ 1OR7C 1XGOA 2HKOA 1RETA 4A0XA 1ZRFA 1HOMA 1EJ9A 2VQGA 2R7XA 2A05A 4X1EA 1WJEA 4WWCA 2HYFA 4BEHB 3L09A 2HYJA 3KP6A 3CZ6A 3L2RA 4AUXA 1Q1VA 4BNCA 1JKQC 5H6RA 2VXDA 1K4SA 2X6WA 2ISYA 4BDZA 4B09A 3ZQ7A 1ETVA 1MJ9A 2XGEA 3K69A 4LLLA 4ZYEA 2ZJRF 4Y17A 3H3ZA 2LP0A 2F5FA 2Y30A 4HF0A 1XMAA 2NVYJ 2RKHA 2Y0SN 3FXQA 2VJIA 5DUKA 3HRUA 4EJWA 2GAUA 1BBYA 3BR6A 1QZZA 5LEKA 3HOSA 3M9AA 4MFDA 2VXZA 3FKJA 4C30A 3I55I 1VQKI 1EF4A 2HXOA 1PJRA 4MTDA 3BROA 4HX7A 2YX7A 2Y0SA 3LA3A 4UY8I 5E79C 2IA2A 2QVOA 4FE4A 1J75A 4EJUA 2LREA 2OPTA 4M74A 4E7ZA 3IAS2 3SZGA 4CZZA 4B4CA 4BE0A 2DK5A 2XF5A 4JQFA 5F6FA 2LRDA 4L5EA 5HODA 3LSRA 2D45A 4U7BA 3DXJF 4HYEA 3ZQGA 2VBZA 2GA2A 1RR7A 1B9MA 3H5AA 4GRIA 3BQYA 3LSJA 3LSHA 5ICEA 2HVRA 1P6RA 3K1MA 5LEJA 2LLKA 4BE1A 3FXJA 1VFCA 3HC7A 5D5XB 1MIJA 3REOA 4ENJA 3C3WA 3QQAA 1D1BA 5HDGA 4XICA 3SEQA 5E1XA 4KDPA 3NEUA 5J40A 5J4YA 1BI2A 1W7PB 1J2XA 1FT9A 4GYIA 1HW5A 1FYKA 2R7ZJ 1RI7A 4YRVA 4LIVA 4HOBA 4LOCA 5D5UB 4BXFA 4RB3C 2LMDA 3BJOA 3CCEI 1MJBA 2WTEA 1PUFB 1Z21A 5LLQA 3CC4I 1MW7A 3DP7A 1JUSA 3WTUC 5HNHA 1O4XA 2YUSA 3BJAA 3LSTA 1R4NB 2M3AA 2IP2A 5J1YA 4IQJA 4A3GJ 2JT1A 4ZTFA 3S17J 4XQFA 3B6AA 3D1NI 1B6AA 2DQRA 3PSIA 4CYCB 2ZO4A 1POGA 5EGOB 3BOQA 5C4XJ 1UAAA 4E7KA 2L9VA 4XMYA 2Q0OA 2F5DA 3GLXA 4CCNA 4YFNF 2DO7A 2MC3A 1HDPA 2VKDA 2M0CA 3J80Z 3L2VA 3CCVI 2R7UA 1OYYA 2X6XA 4S04A 3RCOA 4EJOA 1W0UA 1WKMA 3ERMA 2AHQA 4I01A 5EF6A 2L7MP 3FK7A 2E1OA 4LIUA 4HX4A 4U0YA 9ANTA 1R22A 3IH4A 1IG7A 3OR2C 2CWEA 1XB4A 5LD2C 5EZHA 2V1UA 1XTAA 1X19A 2ZB9A 2F5CA 3E1SA 1U8RA 2LD5A 2XASA 2VODA 2DMTA 3V42A 4F55A 2G7UA 3LAJA 3CCLI 3Q5FA 1D1AA 2XDVA 5CLSA 4AIHA 2VONA 1FLIA 2KFDA 4LMYA 4C9YA 4P9UA 3FXUA 3DLLF 3Q0UA 4A6EA 4NB5A 3VODA 1JTYA 1ETYA 1YJWI 3QYBA 4KICA 5JR3A 2A5YB 1XCVA 3C2BA 4RB1A 2V1DA 4LB6B 1SD7A 4C2TA 3BG5A 2HZTA 3HRMA 1VZ0A 3QP5A 2K86A 5ERIA 2N8GA 4M73A 1J09A 4PFPA 3E5UA 3A0BC 3EETA 6PAXA 2KDOA 3PNYA 5DD4A 3ZMVA 2MD0A 2MG4A 3WGIA 5E18F 4UNOA 1MMDA 5EEGA 4AM3A 1ETKA 2X4HA 4BQNA 2F6CA 1MD0A 1S7OA 3ASOH 4XONA 3BP8A 1FC3A 1JKRC 4E7IA 1OFCX 1X1AA 1FP2A 3LSMA 1W5SA 1U2WA 2EV5A 4XSXF 3I4MJ 5JI6A 5K5OA 1IV8A 2H6CA 3GTKJ 3G1LA 3OOUA 2ESNA 4BAYA 1IDZA 1YW8A 3ROUA 2PG4A 2ELJA 3OL4A 5J4VA 3DEUA 3ZQLA 3ZP5A 1YITI 2ADUA 3DU6A 5CVUA 2M0MA 4DGWB 3HOYJ 2O3FA 4FX4A 4QPQA 4D5CA 2FXAA 1PVEA 4ZZLA 3OYJA 4M9SA 2QBYA 3E6CC 1OQYA 1Z6RA 2V79A 3KP5A 5F04A 4JP0A 1FBQA 3OSGA 3MEXA 1SD4A 2MC4A 2P5KA 1R7JA 2FUG2 2LTPA 2YR2A 2HFHA 2DTZA 1IZ1A 3HUGB 3MVPA 3K4BA 1ZLKA 1G4DA 3AG3H 4G12A 4Q48A 3H0GJ 1R5HA 3R60A 4JK1X 1K6OA 2DCEA 1XPXA 1IO2A 4M71A 1OCRH 3G1MA 4RLQA 3HRTA 3KLOA 4A3MJ 2W7NA 2YX4A 4LB5A 1IW7F 5EGOA 1FNNA 4BQQA 2YU9J 3JAMK 2OD5A 2JQ7A 2R7FA 2W1OA 1BI0A 4U87A 3KEOA 2DJIA 2G0EA 2XIGA 2FD5A 3OYBA 2O03A 2BE5F 1AHDP 1KU2A 3R61A 4OIRF 2LK2A 1K78B 1B9NA 4DJAA 2FBIA 3OIPA 2LBFB 4M3FA 1T2KA 2EIKH 1DU6A 4XLNF 5HLTA 3DEWA 4XRFA 1ZR2A 1YHQI 3DQVC 2HQ5A 2ZXJA 4XSZF 1BR4A 5L3DA 1OCTC 3OYFA 5DEQA 5M3MJ 2OC6A 1IN8A 2FU4A 1OCOH 2DYRH 2X0LA 3IUOA 4EV0A 2QKLB 4OU0A 3FDYA 2E2IJ 1UCRA 4CYDA 5LGUA 1SFUA 1SVOA 2CV0A 2CSOA 2M87A 1H9GA 4HV6A 1WSUA 1LB2A 2IS6A 5FKNA 1R6RA 4UUVA 5DCMA 2IS2A 1OYWA 2ID3A 2O7OA 5IT9K 4RAYA 1SAUA 3B02A 1W36D 3X2QH 2NVQJ 3J80K 4BACA 3W6VA 2HR3A 4LD5A 5D5VB 3JTHA 2QZ8A 3IH3A 1X2MA 3L9FA 5FLXK 4ETSA 2H6BA 1VQ6I 3O3KA 4Z6YA 2Y9YA 3CCSI 3HG9A 4WK8F 2UUZA 3PQJA 2KP6A 5KNLA 1XSDA 1APLC 3QPHA 4PDKA 1QZEA 1Z91A 2KMUA 1HF0A 3L7WA 4ZTJA 3VB2A 1A35A 3S16J 2CQNA 2WC2A 1QPIA 1MBKA 1K83J 1LE8A 1DPRA 3LSPA 4Q47A 2BEOA 1P7IA 3FXRA 4IRHA 3I4PA 1BOAA 2DMPA 3G3ZA 3L2WA 1P4WA 1YFHA 1HXDA 1WPKA 2WA0A 5M5XJ 3BZ6A 3KETA 1EH6A 4PJMA 2O8XA 3J7YJ 4M72A 4HDVA 2FSWA 1BC7C 4KIFA 4KJZA 2DOEA 2J5OA 5M5YJ 1LPQA 5CVJA 4A5MA 5L3CA 1O3SA 3FXOA 4A3FJ 5FD6A 2Z5UA 3HTSB 1WFXA 1I1GA 3DWLE 3CCJI 2R7WA 2NS7A 2WY7Q 4ZZDA 2JK3A 1MDMB 1IUFA 1GXQA 4CCLA 2V6EA 4OINF 2XPVA 4OMZA 3HPHA 3QOPA 1GLNA 3BJ6A 2CFXA 3E5QA 2JA8J 2E5NA 4IEJA 2DYSH 2VQLA 5E3LA 2JA5J 3MKWB 1RC9A 1ENHA 3BTJA 3CMEI 1K6YA 2M5WA 2PMHA 3OSFA 3PIPF 3GFIA 4QSHA 4CO8A 1HA8A 3OYEA 3M3YJ 3CCRI 3BY6A 3ZXSA 2RDPA 3J7AY 4A3LJ 3CMMA 3J81Z 4A3IJ 4OIQF 2FQ3A 1XDSA 2EA4A 2M1BA 3ZR8X 1G2HA 1TC3C 3BTCA 2H8RA 2LVSA 2EWNA 2GBYA 2JTVA 1IF1A 1Y1VJ 5JFRA 2JSCA 3KFWX 3FF5A 2HZDA 2OA4A 1KQ9A 3ASNH 1YJ9I 1TW3A 1DGWY 4BU2A 1D0YA 1FOKA 2X1EA 3TMOA 3HM5A 3GBGA 2FNAA 1VF9A 1DQUA 1W7PD 5DM6F 1ONVA 5F27A 4HPQA 4G6TB 4L9TA 2FRHA 2R7QA 4RBOA 3F23A 1Y8QB 5K1YA 1YRNB 3WHCA 2BBYA 3GTOJ 5JLXA 5F0FA 1E3HA 1QA6A 3I59B 2O6GE 3CUQA 5D4RA 3W2WA 2DA7A 3FMRA 2QUFA 2L3DA 2VKEA 4IVNA 3CMYA 2FJ1A 4MTEA 4A12A 3RKQA 3HZJA 1QBJA 1S5LC 4I02A 5EG0B 3BR1A 3ZMSA 4DIQA 3JSPA 2WV1A 3V7RA 1OLTA 4MO7A 3WE3A 4D0PA 3CJTB 1TQMA 4DQ2A 1TWAJ 3GZ6A 4E7JA 4ESBA 1E2XA 1TTYA 2O0YA 5ILVA 4CA0A 4XLHA 3H3VK 2HXIA 4DYQA 2GIZA 4HSRA 3GVAA 2O5RA 1OCCH 3KP7A 3RPUD 5B66C 4X0GA 2KDZA 4FE7A 3RKWA 2IPQX 3JRAA 3MD2A 3E5XA 2LKPA 3QOEA 2JUCA 3CCYA 3TO9A 4J00A 4MEYF 2CGPA 2K40A 1BOBA 1FBSA 2ZXWH 4PK4A 2XB5A 3K4MA 4A6DA 1RNLA 2M4KA 3TOAA 4XIDA 1JKOC 1JI8A 2HU9A 2DT7B 2P0WA 3K9TA 5E3MA 3RZOJ 4XOTA 4XKBA 3OYIA 1GV2A 3NWTA 2PQ8A 1ORKA 4GYGA 2VBYA 3BR3A 4RM3A 1JJ6C 2E2HJ 1QHHD 3T1BA 2IS1A 3F9KA 4ANJA 1GUUA 1MJAA 1ETXA 1VQOI 2ESHA 3FX3A 3TW6A 3ABKH 3UR3C 5K7HA 1RKWA 4V2FA 3H9QA 2A69F 2CQ7A 4QPOA 1I6XA 2HOTA 1S7EA 2JPBA 2K9SA 1W4MA 4XLCA 2K9NA 1R00A 1XMKA 3I53A 1WGXA 2E1MC 2O61A 2NS8A 3LSGA 3OS0A 1Z7LA 2K02A 4XKCA 2K9LA 4MEXF 3EYIA 3BWGA 4O3MA 1XGNA 3GTJJ 2GA1A 2EZKA 3O2PE 4F7ZA 2IXSA 3FK6A 1PUFA 4PFOA 3OIOA 1BI1A 1LJ9A 2ZBKA 1J59A 2H1KA 1U5TC 1X3WB 3WODF 3TP0A 3ZCOA 1Z3XA 2ZJ2A 2EFOA 4M3GA 3SHFA 4ZYDA 3Q3SA 2CW8A 3CD6I 2XRLA 2QQBA 4L5IA 2XAHA 3O8GA 3RYPA 2LY1A 4NHJA 3C18A 1T33A 4CCKA 3A01A 3I56I 2K9QA 5IY5H 3F21A 2BHZA 3GFLA 1VQ5I 1R5GA 5H2FC 1NK2P 1XC5A 1OR7A 4JYKA 3CMAI 1SAXA 4ZH4F 3T5XA 5IYCJ 4HAMA 3JRGA 1MZBA 1KU3A 3HHGA 3H0DA 1RIOH 4ZC3A 3SFIA 1V54H 1DP7P 2DK8A 2DOAA 1TP4A 1UG2A 2QENA 2DDAA 2HDDA 3N97A 2HWVA 3PL8A 2JJ7A 4RAZA 1K78A 1JUMA 2QBYB 1I5ZA 4IQ4A 3V7SA 2WAFA 5EZGA 3A02A 5FLVA 2R5YA 3FBIB 2FQ4A 3HDDA 2PJPA 3CCUI 1EH8A 2KIUA 2JSPA 4KN4X 2DA5A 1DU0A 4AU7A 1AWCA 3S8PA 3CTAA 1MKMA 1D8JA 2DJNA 2VL8A 1WJFA 3HHHA 2W00A 3S1QJ 2GLOA 2XGCA 2L2OA 5C3EJ 2CV2A 3R6SA 4AWXB 2BVMA 1MNDA 4IRGA 5IP6A 2ZKZA 4OOIA 2DPDA 2DPUA 2C6YA 3W6JB 4G7HF 3I9V2 1JT0A 4H0EA 5F0CA 4PSWA 3F8FA 1WJCA 2XF7A 2XGXA 4LK0F 5DCFA 3VYTB 4BJ5C 5TRDA 1ZRDA 3LWFA 4GO1A 2BY0A 1FOYA 4RA2A 2VQHA 3GW2A 2QGUA 3SFZA 2F48A 2DBBA 4CDGA 3HXLA 3L2CA 2QQ9A 2DFFA 1FIPA 3H35A 3ECHA 4KIBA 4ESJA 3IKVA 2OCEA 4CXFA 2AXTC 4Z2YA 2M8EA 4FTHA 4NC6A 3JR9A 2VJ4A 1UB9A 2B9SA 1HKTA 2OZUA 2UWMA 2CG4A 3OS2A 3H1CA 3UNGC 2DXIA 3N05A 3SYTA 2HPIA 3FM3A 1FYLA 2NOGA 2X48A 1L0OC 4GCVA 1QQIA 2VC0A 4CHUA 5FKMA 1HW1A 1K61A 2A3SA 2BHYA 2ZFUA 1T0FC 2OCCH 2BW3A 2Y48A 2ZNYA 1USSA 2RAEA 1TT0A 3HUGA 4S0HB 2EQRA 4I2OA 3GTPJ 2VUMJ 3ZPLA 3BT9A 3TOBA 1X1PA 1ZTRA 2ZSIB 4LLNA 5HLIA 5K7FA 4D7NA 5GADJ 4PJLA 5J6XA 4MQ9F 5DM7F 4WCGA 2IJLA 3QPSA 2XSJC 2VKVA 5CVVA 3RYRA 3WGGA 1HW2A 2FX0A 4XR6A 4UVCA 3SDGA 3FM5A 2MLGA 2E71A 2BY3A 3K1NA 2MGQA 4XOPA 1XSVA 3GTQJ 4HQMA 2HEOA 1MMNA 4WXDA 3V8LA 2W84A 3JRIA 1A5JA 3BDDA 4L9VA 3RTRA 3ZQFA 5LGTA 5EDNA 1HCRA 2DA6A 1FMWA 2M7AA 2VBWA 2Y69H 3LA7A 4GFBA 3V4GA 4CCOA 1BIAA 1HSTA 1Z77A 1ZQ3P 2GXAA 1Y6IA 3R0JA 2KRCA 3W2AA 5KHDA 1I50J 1LEBA 1IN4A 5FRNA 2E5ZA 3MMYB 3FHNA 3GMEA 4HSTA 3HTUA 1D0ZA 5DYMA 3AL0B 4B47A 2V7FA 3MN2A 4U0WA 2G9WA 4BBRJ 1U8BA 1J9IA 2DFEA 2JWTA 5L3BA 3JTGA 4QLCU 5B3SH 1QHGA 4F52A 3K2ZA 4BQOA 5FKKA 3RI4A 1SVMA 3CUQC 3CJRB 3IRRA 2P5LC 4F92B 3JW4A 2M45A 4MLOA 4C3IJ 1VQLI 3U1KA 4M9XA 3IAM2 2F2EA 3I58A 1NHAA 1N77A 2YSRA 1AA7A 2A68F 2LKSA 3V8JA 1FX7A 1WZ2A 5FKOA 1MBGA 2KJCA 5EJCA 1HKSA 5GAEJ 2XROA 3BCBA 1R1TA 5E20A 2NS0A 5KAFC 4PZJA 2XKPA 1F4KA 1KA8A 2E35A 5IPAA 1DPUA 2K4JA 2NNNA 3W2VA 4OAZA 1SD5A 5TISC 5H6QA 2B7EA 3S15J 2LR8A 3NAUA 1RESA 3KPHA 3M7GA 3KE2A 2LBFA 4NUBA 4YELA 4BS9A 2A07F 1E3OC 5JHFA 1WJBA 1A31A 1MMSA 1G3SA 1GVJA 3TDUC 1XN7A 3PNVA 1YW9A 2TRTA 3GO5A 5HS7A 2P7VB 4BH9A 4LLGF 1FYMA 4KITB 1K79A 3UKGA 1PP8F 2V9VA 2NVTJ 4B8XA 4PCQA 1JGSA 2V1XA 4FQGA 3ELKA 2VPRA 3I5UA 1MH4A 1QVTA 1SD6A 1STZA 1WCMJ 2A5WA 2RNGA 1DP3A 2DQLA 5FO5A 2EV0A 3PSFA 2IVMA 4GGGA 3ZOBA 2ECCA 4DOZA 1IAWA 1YS7A 1Q1HA 1WRJA 5D8KB 1FSHA 1SFKA 2HI3A 1IRFA 4BKXA 4G7ZF 4AVPA 4N4OB 1FEXA 4I76A 2EILH 3OYKA 2EFQA 5D5WB 3DKWA 1CF7B 3LSKA 3SEZA 4XKVA 3CDLA 1KQ8A 4S05A 3EUKL 2GOXB 4Y4RA 2P7CB 1NH3A 4B43A 3PNTA 2I10A 4A3CJ 2PMZN 2BVLA 2DFIA 1MSFC 1UHSA 1M1EB 3T8RA 3P9CA 3DKXA 2HDWA 2XF6A 1U3EM 3Q9SA 3ZN1A 2L9RA 2A6EF 2QM3A 1IDYA 2CQQA 1LE8B 2EBIA 5FGMA 1IJWC 1XGSA 3RPUA 3OYAA 3G6EI 1YX5A 4OIOF 3H9JA 1YIJI 4QIWN 3K4CA 1TW2A 2H27A 4JBAA 2HS5A 4NQWB 3K70C 3K4LA 1ZN2A 1NK3P 5AIQA 1TL8A 2HQRA 1YW7A 2HTSA 4MNUA 3LAPA 2GXBA 3S2DJ 1FTTA 3GFMA 1U78A 4A3JJ 3JAMZ 3MCZA 2EZHA 3HOUJ 2F5EA 2I5UA 1YX3A 5FD5A 1YTYA 2L01A 1KGSA 5F1RA 4K2EA 4BHBA 3F8MA 2FOKA 3U2RA 3WTVC 3PO2J 1MBJA 4JX5A 2V26A 3C2GA 2R0QC 2BY2A 4I09A 1CGPA 3HOWJ 2H1LA 3FXKA 4G6DA 2JA2A 3PUFA 2QYOA 1IGNA 1YIOA 3V8KA 3BG7A 3G1OA 2CMPA 3KP3A 1TNTA 1RPWA 3VYSB 4D1QA 2Q8KA 1KQ0A 4CGZA 4LGWA 4HNVA 1HLVA 2ZXHA 1LDJA 2Q1ZB 1UMQA 5IYBJ 5IT9Z 2VE8A 4RB0A 1LDKB 4IHTA 1R36A 2FE3A 3FKIJ 4FASD 4Y15A 5LHGA 3OOPA 4P96A 5ILSA 2NVUB 3I4NJ 1FMVA 3R4KA 2KRHA 2DODA 3C2HA 1F43A 1A6QA 2XAGA 2HGCA 2KIFA 4HQEA 1WJAA 4DYCA 2XAFA 2CW7A 5K5QA 3FWEA 2Y31A 3I71A 1MMAA 4ZYAA 1NG6A 1DUXC 1BA5A 2ICWG 3WU2C 4NDLA 4EM2A 4MQVA 3RSNA 3TL4X 3NARA 5E8GA 1YO5C 3ESWB 4CCJA 2GWRA 2DMNA 2VI6A 2CU7A 2I8DA 4NC7A 2M4GA 4AIDA 4HLYA 3ZQQA 3CF2A 1WJ5A 2XRNA 5FLMJ 5F64A 3BR2A 3S3NA 1EH7A 2ZMEC 2LG4A 3CDHA 5ED4A 2DTRA 3ZMZA 5B1BH 1A6IA 3DTIA 3JRFA 1N75A 3LSIA 4C3HJ 4Y33A 3HRSA 2DT6A 5E3NA 3ERED 5TGTA 1ZH5A 4MGRA 1AKHB 5HVQC 1JE8A 1VQ7I 1IN6A 2MSYA 2R5ZB 5CYVA 5E17F 1TBXA 4AIKA 2E1CA 1QVUA 4OWRB 5M3FJ 2P8TA 2XB0X 2IAIA 1Z7UA 3B73A 3JRDA 2EK5A 4W97A 4IXAA 2WAQA 3K2AA 1BJAA 5GTIC 4PJNA 2PBIA 1U9OA 3F72A 3ABMH 2E19A 2M34A 5D6FA 3ZQIA 1UELB 4A5NA 3BQZA 5JHUA 1KU7A 4EQQA 1FPQA 3A01B 3DPUA 5KAIC 3E6DA 1R4MB 1A04A 3G4SI 3GFJA 1Z0XA 4OIPF 2MH2A 5J8FA 4F93B 4XRSA 2JPCA 1YE9A 4XBFA 4U0VA 2V1NA 2W48A 3K4KA 1MSEC 2HVSA 3ZN0A 1QRYA 2ISZA 5DS9A 4LK1F 2RGVA 2R7DA 2L7FP 3H9GA 1FY7A 4M6YA 2Q2EB 1Y8RB 1Z9CA 2VN2A 1R9TJ 1R49A 3OYMA 3VYRB 2L9NA 1WHUA 1H9TA 3E0JB 5GAHJ 4XRSG 5FKLA 4IPAA 2XKOA 2DU9A 4MFEA 3VFZA 3BTIA 3MFKA 3MKYB 5ICFA 2LH9A 1B4AA 4ZDOA 2H94A 4Y3OA 3WTZA 2WAQN 4EJVA 2ECBA 3IWZA 4WF2A 1LFBA 1N78A 4I6ZA 4BXXJ 2IGNA 2EPFA 2V9PA 5LFAA 5IOYA 1X1BA 2LNBA 2O8KA 4U88A 4B1RA 1ZELA 3F8NA 4M6XA 4NNJA 2KT0A 3P7NA 2WWYA 1T6SA 3F6OA 5FLXZ 2LF8A 2D1VA 1LKXA 2K27A 4ENNA 5FFXA 4KN7X 1HQCA 4RDUA 4ITVA 2RV8A 3HB9A 4IF4A 3QU6A 3EQLF 2ZMEA 1T98A 2VJ5A 3KCCA 4Y13A 1ZG5A 1ZGJA 1G3YA 2Z2SB 2L5QA 4HW0A 2X51A 4IZZA 1IV6A 5CJ9A 2JUGA 2ZMEB 1SFXA 5IYDJ 3HSFA 4A93J 2LF7A 2LOOA 4CCMA 4XLPF 2JVGA 2IBDA 1YI2I 1ZK8A 3VYUB 4UV8A 3CUOA 4EVIA 5GPCA 2XHKA 2VQCA 1FOXA 2AXLA 2NAZA 3RKXA 1XCBA 3F22A 4UUSB 1VNDA 1Z3YA 2BW3B 3M1CA 3TO7A 3JRBA 2Z1DA 1G3TA 2F4OB 1ZYRF 1ON2A 3S93A 2JA6J 2DI3A 1USTA 5CQEA 1ZRCA 1TZLA 4LFUA 4CYCA 3S14J 3NWSA 2A6TA 3T8TA 2X6OA 3ABLH 1O3RA 5J3LA 3LL7A 2K4BA 5J1UA 1ZG3A 3AG2H 4P5OA 5HDKA 3CO6C 3WHBA 1BC8C 1IRGA 3V7CA 2ME6A 2DFHA 2VC1A 4II3A 2V6CA 4ZYHA 4C2UA 4KYWA 3W3CA 1VQMI 1ETQA 2TCTA 3RJPA 3HOTA 1YS6A 2EINH 5CKTA 3WU1B 3VSKA 4YIRX 4G8XA 3NQOA 3WTWC 3LQQA 3H92A 2D1HA 5D6EA 1ZKGA 3IP4B 2EZLA 2VJJA 4KT5C 2BYVE 1UFMA 4C2MJ 3IKTA 5HLGA 3D0SA 3IHUA 3OR1C 1PP7U 2WADA 1G6NA 4N9HA 4DBQA 3JCUC 3G71I 4E4HA 3O6BB 1QU3A 2HQNA 3E6MA 3F3XA 1Z6TA 1WJDA 2R93J 2LSOA 5AIPA 1AU7A 2W57A 2CUEA 2OF7A 3OS1A 2Y75A 2DW4A 3VSLA 2XGDA 4IO9F 4RAFA 2BOLA 2DA1A 3BG3A 3A4CA 3M4OJ 4XORA 1V3FA 1RUNA 1U6GA 2WBMA 3AG4H 2ZJQF 1ZREA 4PJJA 1YYVA 1S6LA 3PJRA 3ONQA 2VT2A 1MBHA 2GQQA 1U0JA 3U21A 3K7AJ 2Z99A 1SC7A 1S8NA 1ULYA 3PFYA 2K85A 1V5EA 5DTDA 1X4OA 2LY9A 3BR0A 1R1UA 1E3PA 2E60A 2KHMA 1VI0A 4KNYA 1HKQA 2LC2A 3GZNB 4LG3A 5H20A 4L5JA 1SMTA 4UB6C 5EEAA 2R7VA 1ODDA 3K70D 4M9ZA 2VASA 2XV4S 3KZYA 3WE2A 3KP4A 2VT3A 1TQIA 1N25A 2OAZA 1PUEE 3AL0C 2LYCA 3JSOA 1BW6A 3M07A 1K4TA 2DMUA 3IRQA 3LFUA 3LOCA 4ZYGA 2DOFA 2ID6A 1VQ4I 4ENMA 4DYRA 1MH3A 1REPC 3CF5F 2QWWA 2WV0A 1OJLA 2FEZA 3K4NA 5A2QZ 3OMYA 2ELHA 4BXUA 1OKRA 4N9IA 1BL0A 4BJ6C 3HL2A 4OMYA 2TDXA 3D5SC 1B1BA 2A6HF 1RKTA 2VBXA 4BHCA 5CVRA 3E7LA 3LA2A 5E1WA 3CJQB 3S32A 3SXYA 2YPRA 5K7ZA 3KZIC 4XN0A 3WTSC 2XAJA 5KK1A 5BNGA 3S3OA 1Y39A 3S1NJ 1TWCJ 4YFXF 3P5JA 2FBHA 5J1RA 3CCMI 3BZCA 2R5YB 2EIMH 2L4MA 4BY1J 1RZ4A 3LQRA 1QZYA 2X1CA 3C7JA 1F1ZA 2MD5A 5IOZA 3SZPA 2IRFG 1YG2A 3CP8A 3R0AA 3HOVJ 1EA3A 1D0XA 3J81K 4DZJA 1ACIA 3HGYA 4ABZA 1O3TA 3HSRA 5ICCA 2OQRA 1ZGAA 4XLAA 4QTRA 2HDCA 1P4AA 3JRCA 2V4JC 2XAQA 1W1WE 4NC8A 3BZKA 4BE2A 2F4MB 2PLYA 2BY1A 4ZDLA 4A3KJ 3WGHA 2E7XA 5GAGJ 4CZCA 2MYSA 2HOSA 2M2EA 3A2KA 5KVRA 1F36A 2PX9A 3SZTA 3KLNA 1GVDA 2IGKA 4BYYA 2NRAC 3M1EA 3OYLA 1H89C 1FIAA 3FIWA 1ZG1A 2RN7A 3DU5A 3S1MJ 3ECOA 4II2A 1D3YA 3M8EA 2Y2ZA 4KIGA 4LG0B 2M7BA 2VIXA 1PYVA 4EEFG 2DDBA 3WTTC 3QAHA 1BM9A 4HNTA 3WU0A 1OMIA 4YG2F 2HYGD 2PFBA 3EUHC 2P5VA 3HPGA 5JLWA 1X3ZB 2QQ8A 4EGZA 4F91B 1T38A 2Q2EA 3E97A 3TBIA 4FHTA 4RGUA 2QA4I 2L0KA 3CP2A 5CPRB 2MABA 3RPQA 5L3GA 4E6KG 1XS9A 1X1DA 2P81A 3OYDA 2IA1A 3FXLA 4HX8A 3S1RJ 2X6YA 1XD7A 3P9KA 4KT6A 4FETA 2NYXA 4L0YB 1FP1D 1RR8C 4RLFA 1XDUA 3ZMDA 1JXSA 3MKLA 3QP6A 4HA8A 1SFEA 2IGMA 2FNPA 3ULQB 1XX5A 4PJ0C 1BI3A 1YLFA 2XAUA 1LFPA 2K3FA 3DF8A 3LMMA 3P9IA 1S9HA 1Z67A 4XRMA 2PMZA 1FOWA 3VOEA 1VQNI 4ON0A 2Z3YA 5A2QK 4IRIA 2OU2A 3QYEA 2UXXA 2ZC2A 2ZXIA 1G3WA 3MWMA 2CW0F 5KCMA 4FCYA 3BPXA 4RS8A 5HDNA 4HF1A 4UXNA 1W7PA 4IKFA 2GXGA 2QEXI 4JX4A 1Y0UA 2IA0A 4J01A 5FJ8J 2JZYA 2KLOA 4BDYA 1P92A 2X9DA 3J7AO 2EV6A 2M8GX 2XPWA 4A3DJ 2VOPA 1MMGA 4KMFA 1ON1A 1KU9A 5LHIA 3DBHB 3AAFA 5BPDA 2AQEA 2LFBA 3BG9A 2VOOA 2FMYA 1VQPI 3KP2A 1W0TA 2RVCA 1FSEA 3HOXJ 1YRNA 2EA2A 2MBFA 2OJED 3GEZA 3TQNA 2P6SA 4IOAF 1YJNI 4I7HA 3OWTA 2OBPA 2KIQA 1MGTA 1OYIA 2PMUA 3H3UA 1P9QC 4PUSA 1KYWA 2G7HA 5HNFA 4KISA 2CYYA 4HLXA 1ZGWA 4L9NA 5BOXA 1J7KA 4FT8A 3COAC 1W36C 2CS3A 3MQ0A 3TEDA 2E1MB 4FX0A 4PGHA 3OYNA 2HKXA 1X1CA 2K7LA 4M3EA 3KIOA 1JT6A 3DPTA 5BPIA 3FXMA 4N4NB 3LNQA 1S72I 1S29A 5F0HA 2YU3A 5L3EA 2D2WA 1FTZA 1I1SA 3ZRGA 1GXPA 1J0RA 3JREA 1V5GA 3F8BA 3TO6A 2RREA 4EM1A 4LG0A 3MKZA 2O9LA 4D9JA 1X58A 4AIJA 1VQ9I 5JVTA 3FMQA 4XLEA 3FHZA 2L02A 2E34A 1D5VA 3VDXA 2UV1A 2RQQA 2ZCWA 3DV8A 4M3BA 5GPAA 2IGOA 3J7ZI 1BJZA 5E3OA 2FF4A 4WX9A 3RZDJ 2IT0A 3GLLA 4IHWA 1U5TB 2KQRA 4ZJZA 1JHFA 3F6VA 3MZHA 1EV7A 4JX6A 4RM2A 4AVZA 4EMSA 4XK4A 3BR5A 2HOEA 2LY2A 3O8HA 3OL3A 2D5VA 3DPLC 3H36A 1A36A 4YFKF 2R5ZA 5D4SA 3PM1A 1P7JA 1WVRA 1WWXA 4I0AA 3SDBA 4AD9A 2WY8Q 5TJJA 2F5VA 3DTEA 2BGCA 3NRVA 4BL0B 1F9NA 4C3JJ 3QPTA 5IP9J 5DD8A 1LVAA 2E7WA 2VE9A 2JMWA 2VLAA 4F3QA 4HF2A 2CUZA 3E3VA 1I6HJ 1IN7A 2L7KA 5F1JA 4G7OF 4G6QA 5AONA 2BXZA 3L2QA 3FISA 4B48A 3SQNA 4BGDA 1QO0D 4KMUX 3IC7A 4IX7A 3SJMA 2AS5F 5M5WJ 3WG7H 3HKZA 3B6CA 1LUJB 2V9KA 1B8IA 2DN0A 1QPMA 4LJZF 3F8CA 2UZKA 5E8IA 3TW7A 3MZYA 4IOCF 4IL6C 1R23A 1ETWA 2R7OA 1R58A 4A0YA 4M6VA 2ELKA 1Y1WJ 2PN6A 2X85A 1UJ8A 2XUBA 3D5RC 3HYIA 4NBQA 3W6KB 4CH7A 5C44J 1O7FA 3CCQI 4KA4A 2F4IA 1T08B 4RGXA 3MAJA 1ZR4A 1KYZA 4Q5SF 2CUFA 1MBFA 2ZFWA 3LFKA 3GF2A 2WB1A 2Z9OA 2ZSHB 3DBRB 1JHHA 1R1VA 5FFZA 3RDIA 3TKYA 3OYHA 1RUOA 1LQ1A 2JRTA 2VB6A 1X2NA 1ERDA 3BLYA 3G2BA 3K1PA 1MNMC 5HLHA 3I59A 4AYBA 5LRSA 3K0LA 2KZGA 1SANA 2A61A 4UVBA 4R79A 3RQIA 1D8KA 1LDDA 1UZCA 3DCFA 4ESFA 3KEYA 3T0YA 5BS6A 2EH3A 3KX2A 1W5TA 3U1DA 3K6GA 1ZAOA 4O5VA 4BBSJ 1LVKA 1FWZA 2FOWA 2RNJA 4RAGA 4XLFA 5BMZA 2NOJB 2STWA 4HNUA 3KZZA 1O3QA 2EJRA 5GP9A 2Z16A 3CJNA 3PO3J 3C1DA 3ISPA 2KL4A 2FBKA 3BPVA 4IHVA 3IV5A 3PUBA 3CC2I 2BV6A 2R92J 5IT3A 1QNTA 3ABTA 2EB7A 2H8WA 2L4AA 2GZWA 2QLZA 3DFGA 4Q4ZF 4L0ZB 2E2JJ 3EDPA 1IXSB 1J5YA 4RGRA 3Q9VA 1W5CC 3HBLA 2W25A 4G9YA 1D5YA 2FA5A 2W82A 4EGYA 1EKEA 2R4GA 2B63J 3IWFA 3ZMTA 2RC4A 1ETOA 5DV5A 2MW8A 2QSGX 2EFNA 2KISA 2XSDC 3QRFF 1UG0A 1OCPA 4BEHA 4HRIA 1L3LA 3BCAA 1HC8A 3Q0WA 3Q0VA 1VTNC 4RGSA 4A2UA 3OY9A 3QPLA 1NTCA 4MHGA 4N0BA 2IEKA 4E70A 2FMLA 3I54A 1RRJA 1F5TA 2JVHA 4FISA 4R1HA 3GTGJ 3GX4X 4W1UA 1D1CA 3KYLA 2DAOA 2H09A 3EYYA 1YQAA 1IXCA 2DMQA 4D7MA 4Y52J 2K5CA 2QSFX 3ZQHA 1XGMA 2X1DA 2DA4A 2J5PA 3DLAA 4B3XA 4KFCA 4I99C 1T39A 2ME0A 1XSXA 5DCMB 1WQ2A 4A0ZA 1O57A 2NNYA 3AKZA 3PFIA 2PJRB 2MA3A 4A69C 4YIFA 3DTKA 1UHWA 3HEFA 4RB2C 1X4PA 2YS9A 2OZ6A 2XPUA 4HG2A 2KZVA 1SEUA 5C4JJ 3CDIA 4I0BA 3OYGA 4U7DA 4A3EJ 1TWGJ 2HTJA 5LHHA 3FZVA 4E7SA 1TWHJ 3JRHA 4XM3A 1DDNA 3N4MA 1R71A 2R3SA 3WG9A 1FZPB 3GWZA 5CVIA 3VPRA 2HQAA 2L7ZA 1GDTA 3M8JA 1LFUP 1JJ8C 2EIJH 2HVQA 1DGRM 3GCMA 3TDZC 3KEQA 5ICGA 1T56A 4BY7J 2CH0A 4EATA 1Y0NA 3S2WA 3F0CA 1B8IB 3GTLJ
chains in the Genus database with same CATH topology
1IC8A 2DA6A 3BTLA 3HOYJ 4GFBA 1ZQ3P 5EEAA 4D5CA 1Z77A 5EYRA 1CQTA 1FJLA 1I50J 1ITYA 5F04A 1JUPA 4JP0A 3OSGA 1BW6A 2DMUA 2LTPA 3LOCA 3MN2A 1JKPC 2ID6A 4BBRJ 1U8BA 2DTZA 3L1PA 2JWTA 3MVPA 1GT0C 4DYRA 1MH3A 4G12A 5FKKA 3H0GJ 1WH5A 1OJLA 3G1MA 4MLOA 1H88C 4C3IJ 4A3MJ 1WI3A 3IH2A 5EGOA 1BL0A 2QF7A 1RKTA 2YU9J 3E7LA 5FKOA 1MBGA 2G0EA 5K7ZA 5BNGA 2FD5A 5IP7J 1AHDP 3S1NJ 1GV5A 1TWCJ 2LKXA 2LK2A 5J1RA 5IPAA 4M3FA 1DU6A 2AO9A 2R5YB 4BY1J 3DEWA 2QCOA 1ZR2A 5IOZA 2HQ5A 3HOVJ 1XG1A 2LR8A 3HKZN 1OCTC 3NAUA 1RESA 2CRGA 3S15J 4AC0A 5M3MJ 4DZJA 1I3QJ 3HGYA 4ABZA 3ZQLA 3HGGA 1E3OC 2M9HA 4QTRA 2TRTA 2E2IJ 3JRCA 5F08A 3UKGA 2NVTJ 4A3BJ 2DA3A 5FKNA 2ID3A 2O7OA 1MH4A 2VPRA 1QVTA 1WCMJ 2COBA 4A3KJ 2NVQJ 2NVXJ 2HOSA 3W6VA 2M2EA 1F36A 3IH3A 1X2MA 3HOZJ 3ZOBA 2ECCA 4IHYA 1MBEA 1GVDA 1JTXA 2HI3A 2EZIA 4BKXA 2Y9YA 2GM4A 1FEXA 4I76A 1H89C 1FIAA 3FIWA 3S1MJ 2Y2ZA 1APLC 4B3AA 3CDLA 3ZQCA 4EEFG 1HF0A 2I10A 2CJJA 4D5FA 4A3CJ 2PMZN 2JN6A 3S16J 1QPIA 4DZPA 1MSFC 1UHSA 1K83J 1MBKA 1LE8A 3LSPA 1B72B 1P7IA 5JLWA 2DMPA 1WPKA 2L0KA 2L9RA 5M5XJ 1IDYA 2CQQA 1LE8B 2EBIA 1IJWC 1B72A 4UUTA 1XS9A 4QIWN 5M5YJ 2P81A 3S1RJ 2CQXA 4J19A 1NK3P 4A3FJ 4MIMA 3S2DJ 4V2GA 1FTTA 4AYBN 3MKLA 1U78A 4A3JJ 2NS7A 2EZHA 2JK3A 3HOUJ 1IUFA 2XPVA 2JA8J 4IEJA 4XRMA 5E3LA 2JA5J 1ENHA 3BTJA 3S2HJ 3OSFA 4QSHA 1TWFJ 3M3YJ 3PO2J 1MBJA 4JX5A 5EG0A 1H8AC 3A03A 2R0QC 4FCYA 3GTMJ 4A3LJ 3HOWJ 4A3IJ 1IGNA 3G1OA 1G2HA 4JX4A 1TC3C 1RPWA 3BTCA 5FJ8J 2H8RA 2LVSA 2GBYA 1Y1VJ 2WB1N 2X9DA 4HNVA 1HLVA 2M8GX 2XPWA 4A3DJ 4IHXA 1UMQA 5IYBJ 2LFBA 3BG9A 3FKIJ 1W0TA 1AKHA 3I4NJ 3HOXJ 1YRNA 3HM5A 3GBGA 1U9NA 1VF9A 1JGGA 1F43A 5F27A 3CQZJ 4RBOA 2Y9ZA 1YRNB 4DYCA 3WHCA 2Y31A 3GTOJ 4UUSA 5JLXA 5F0FA 1ZGWA 1BA5A 4Y7NJ 4NDLA 2DA7A 3TEDA 2VKEA 1WH7A 3NARA 2FJ1A 3CMYA 3RKQA 4X6AJ 4M3EA 5EG0B 3BR1A 2DMNA 2VI6A 1JT6A 2CU7A 2WV1A 3LNQA 5F0HA 4MO7A 1FTZA 3JREA 1TWAJ 5FLMJ 2O9LA 3BR2A 1X58A 3TP3A 3H3VK 3JRFA 1A6IA 2HXIA 4DYQA 1HDDC 4C3HJ 2JA7J 1BW5A 4M3DA 2KDZA 4FE7A 1IRZA 4DW6A 5E3NA 4M3BA 5GPAA 3JRAA 1BJZA 3CCYA 5E3OA 1AKHB 2K40A 3RZDJ 4IHWA 2DA2A 2MSYA 2R5ZB 2XB5A 4JX6A 4XIDA 2HOAA 1SFOJ 1QVUA 1JKOC 4XK4A 3BR5A 5M3FJ 1RETA 2IAIA 2XB0X 2D5VA 3O8HA 1HOMA 3JRDA 4X1EA 4W97A 2R5ZA 5E3MA 3RZOJ 3PM1A 1P7JA 3K2AA 1GV2A 1ORKA 2HYJA 1JJ6C 3BR3A 2E2HJ 1U9OA 2E19A 2M34A 4AUXA 1Q1VA 1GUUA 3ZQIA 3BQZA 1ETXA 4C3JJ 3A01B 3TW6A 5IP9J 5K7HA 1JKQC 1RKWA 4V2FA 1Z0XA 2JMWA 2HOTA 1S7EA 2K9SA 1I6HJ 4XRSA 1ETVA 1MSEC 2K9NA 2W48A 2XGEA 1WGXA 5F1JA 1QRYA 2NS8A 5DS9A 3LSGA 3FISA 2LP0A 2Y30A 2NVYJ 2Y0SN 2L7FP 3BR6A 3SJMA 5M5WJ 3B6CA 4MFDA 1B8IA 3GTJJ 2DN0A 1EF4A 2HXOA 2EZKA 3FK6A 1PUFA 1R9TJ 3TW7A 3OIOA 4FE4A 2H1KA 2OPTA 1ETWA 4B4CA 3TP0A 4XRSG 5HODA 4L5EA 5FKLA 3LSRA 4M6VA 2ELKA 4MFEA 1Y1WJ 4M3GA 3BTIA 3Q3SA 3ZQGA 5C44J 2XRLA 1ZR4A 1RR7A 2CUFA 1MBFA 3O8GA 3BQYA 3LSJA 2WAQN 1T33A 2ECBA 3A01A 2LLKA 2K9QA 1LFBA 1VFCA 4I6ZA 4BXXJ 1X2NA 1NK2P 1XC5A 5IOYA 2O8KA 1MNMC 4JYKA 3QQAA 4B1RA 4XICA 5IYCJ 3JRGA 2KT0A 1SANA 3RQIA 3SFIA 2R7ZJ 3DCFA 4LOCA 1UG2A 2HDDA 2JJ7A 2EH3A 1JUMA 4RDUA 4BBSJ 5EZGA 3A02A 5FLVA 2R5YA 1PUFB 3HB9A 2FQ4A 3HDDA 1JUSA 2DA5A 1DU0A 5GP9A 1O4XA 3PO3J 1IV6A 2YUSA 4IHVA 3IV5A 2DJNA 5IYDJ 3S1QJ 2GLOA 4A93J 2XGCA 2R92J 5J1YA 5C3EJ 4A3GJ 3S17J 5IP6A 2IBDA 1ZK8A 3B6AA 3D1NI 5GPCA 4CYCB 1JT0A 2E2JJ 1POGA 5F0CA 5EGOB 4UUSB 1VNDA 3JRBA 5C4XJ 3HBLA 2JA6J 1D5YA 4CYCA 2B63J 3S14J 2X6OA 1ETOA 1HDPA 2MW8A 2M0CA 5J3LA 5J1UA 2XSDC 1OCPA 1W0UA 3WHBA 3Q0WA 3Q0VA 2AHQA 2ME6A 5EF6A 2L7MP 3FK7A 3QPLA 1NTCA 2E1OA 2IEKA 1ETQA 1FIPA 2TCTA 4FISA 9ANTA 3GTGJ 3IH4A 1IG7A 4W1UA 5EZHA 2ZB9A 2LD5A 4D7MA 2DMQA 4Y52J 3ZQHA 2DMTA 3JR9A 4FTHA 1ZKGA 2DA4A 2EZLA 4C2MJ 2ME0A 2NOGA 3Q0UA 2X48A 1JTYA 1ETYA 5FKMA 4A69C 3C2BA 1K61A 3HEFA 2R93J 1AU7A 3BG5A 2YS9A 2CUEA 2OF7A 2XPUA 2RAEA 2N8GA 2XGDA 3GTPJ 4S0HB 2EQRA 5C4JJ 2DA1A 3BG3A 2VUMJ 3M4OJ 3BT9A 4A3EJ 1ZTRA 1TWGJ 2MG4A 5K7FA 1TWHJ 4D7NA 1ETKA 3JRHA 1MBHA 3QPSA 2VKVA 3K7AJ 1JKRC 1OFCX 2FX0A 3VPRA 3I4MJ 2L7ZA 3SDGA 1GDTA 1LFUP 1JJ8C 5DTDA 2MGQA 3GTQJ 2LY9A 3BR0A 3GTKJ 3G1LA 3OOUA 1T56A 1VI0A 4BY7J 1IDZA 3JRIA 1A5JA 3ZQFA 5EDNA 1HCRA 3F0CA 1B8IB 3GTLJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IC8 A;  2DA6 A;  3BTL A;  3HOY J;  4GFB A;  1ZQ3 P;  5EEA A;  4D5C A;  1Z77 A;  5EYR A;  1CQT A;  1FJL A;  1I50 J;  1ITY A;  5F04 A;  1JUP A;  4JP0 A;  3OSG A;  1BW6 A;  2DMU A;  2LTP A;  3LOC A;  3MN2 A;  1JKP C;  2ID6 A;  4BBR J;  1U8B A;  2DTZ A;  3L1P A;  2JWT A;  3MVP A;  1GT0 C;  4DYR A;  1MH3 A;  4G12 A;  5FKK A;  3H0G J;  1WH5 A;  1OJL A;  3G1M A;  4MLO A;  1H88 C;  4C3I J;  4A3M J;  1WI3 A;  3IH2 A;  5EGO A;  1BL0 A;  2QF7 A;  1RKT A;  2YU9 J;  3E7L A;  5FKO A;  1MBG A;  2G0E A;  5K7Z A;  5BNG A;  2FD5 A;  5IP7 J;  1AHD P;  3S1N J;  1GV5 A;  1TWC J;  2LKX A;  2LK2 A;  5J1R A;  5IPA A;  4M3F A;  1DU6 A;  2AO9 A;  2R5Y B;  4BY1 J;  3DEW A;  2QCO A;  1ZR2 A;  5IOZ A;  2HQ5 A;  3HOV J;  1XG1 A;  2LR8 A;  3HKZ N;  1OCT C;  3NAU A;  1RES A;  2CRG A;  3S15 J;  4AC0 A;  5M3M J;  4DZJ A;  1I3Q J;  3HGY A;  4ABZ A;  3ZQL A;  3HGG A;  1E3O C;  2M9H A;  4QTR A;  2TRT A;  2E2I J;  3JRC A;  5F08 A;  3UKG A;  2NVT J;  4A3B J;  2DA3 A;  5FKN A;  2ID3 A;  2O7O A;  1MH4 A;  2VPR A;  1QVT A;  1WCM J;  2COB A;  4A3K J;  2NVQ J;  2NVX J;  2HOS A;  3W6V A;  2M2E A;  1F36 A;  3IH3 A;  1X2M A;  3HOZ J;  3ZOB A;  2ECC A;  4IHY A;  1MBE A;  1GVD A;  1JTX A;  2HI3 A;  2EZI A;  4BKX A;  2Y9Y A;  2GM4 A;  1FEX A;  4I76 A;  1H89 C;  1FIA A;  3FIW A;  3S1M J;  2Y2Z A;  1APL C;  4B3A A;  3CDL A;  3ZQC A;  4EEF G;  1HF0 A;  2I10 A;  2CJJ A;  4D5F A;  4A3C J;  2PMZ N;  2JN6 A;  3S16 J;  1QPI A;  4DZP A;  1MSF C;  1UHS A;  1K83 J;  1MBK A;  1LE8 A;  3LSP A;  1B72 B;  1P7I A;  5JLW A;  2DMP A;  1WPK A;  2L0K A;  2L9R A;  5M5X J;  1IDY A;  2CQQ A;  1LE8 B;  2EBI A;  1IJW C;  1B72 A;  4UUT A;  1XS9 A;  4QIW N;  5M5Y J;  2P81 A;  3S1R J;  2CQX A;  4J19 A;  1NK3 P;  4A3F J;  4MIM A;  3S2D J;  4V2G A;  1FTT A;  4AYB N;  3MKL A;  1U78 A;  4A3J J;  2NS7 A;  2EZH A;  2JK3 A;  3HOU J;  1IUF A;  2XPV A;  2JA8 J;  4IEJ A;  4XRM A;  5E3L A;  2JA5 J;  1ENH A;  3BTJ A;  3S2H J;  3OSF A;  4QSH A;  1TWF J;  3M3Y J;  3PO2 J;  1MBJ A;  4JX5 A;  5EG0 A;  1H8A C;  3A03 A;  2R0Q C;  4FCY A;  3GTM J;  4A3L J;  3HOW J;  4A3I J;  1IGN A;  3G1O A;  1G2H A;  4JX4 A;  1TC3 C;  1RPW A;  3BTC A;  5FJ8 J;  2H8R A;  2LVS A;  2GBY A;  1Y1V J;  2WB1 N;  2X9D A;  4HNV A;  1HLV A;  2M8G X;  2XPW A;  4A3D J;  4IHX A;  1UMQ A;  5IYB J;  2LFB A;  3BG9 A;  3FKI J;  1W0T A;  1AKH A;  3I4N J;  3HOX J;  1YRN A;  3HM5 A;  3GBG A;  1U9N A;  1VF9 A;  1JGG A;  1F43 A;  5F27 A;  3CQZ J;  4RBO A;  2Y9Z A;  1YRN B;  4DYC A;  3WHC A;  2Y31 A;  3GTO J;  4UUS A;  5JLX A;  5F0F A;  1ZGW A;  1BA5 A;  4Y7N J;  4NDL A;  2DA7 A;  3TED A;  2VKE A;  1WH7 A;  3NAR A;  2FJ1 A;  3CMY A;  3RKQ A;  4X6A J;  4M3E A;  5EG0 B;  3BR1 A;  2DMN A;  2VI6 A;  1JT6 A;  2CU7 A;  2WV1 A;  3LNQ A;  5F0H A;  4MO7 A;  1FTZ A;  3JRE A;  1TWA J;  5FLM J;  2O9L A;  3BR2 A;  1X58 A;  3TP3 A;  3H3V K;  3JRF A;  1A6I A;  2HXI A;  4DYQ A;  1HDD C;  4C3H J;  2JA7 J;  1BW5 A;  4M3D A;  2KDZ A;  4FE7 A;  1IRZ A;  4DW6 A;  5E3N A;  4M3B A;  5GPA A;  3JRA A;  1BJZ A;  3CCY A;  5E3O A;  1AKH B;  2K40 A;  3RZD J;  4IHW A;  2DA2 A;  2MSY A;  2R5Z B;  2XB5 A;  4JX6 A;  4XID A;  2HOA A;  1SFO J;  1QVU A;  1JKO C;  4XK4 A;  3BR5 A;  5M3F J;  1RET A;  2IAI A;  2XB0 X;  2D5V A;  3O8H A;  1HOM A;  3JRD A;  4X1E A;  4W97 A;  2R5Z A;  5E3M A;  3RZO J;  3PM1 A;  1P7J A;  3K2A A;  1GV2 A;  1ORK A;  2HYJ A;  1JJ6 C;  3BR3 A;  2E2H J;  1U9O A;  2E19 A;  2M34 A;  4AUX A;  1Q1V A;  1GUU A;  3ZQI A;  3BQZ A;  1ETX A;  4C3J J;  3A01 B;  3TW6 A;  5IP9 J;  5K7H A;  1JKQ C;  1RKW A;  4V2F A;  1Z0X A;  2JMW A;  2HOT A;  1S7E A;  2K9S A;  1I6H J;  4XRS A;  1ETV A;  1MSE C;  2K9N A;  2W48 A;  2XGE A;  1WGX A;  5F1J A;  1QRY A;  2NS8 A;  5DS9 A;  3LSG A;  3FIS A;  2LP0 A;  2Y30 A;  2NVY J;  2Y0S N;  2L7F P;  3BR6 A;  3SJM A;  5M5W J;  3B6C A;  4MFD A;  1B8I A;  3GTJ J;  2DN0 A;  1EF4 A;  2HXO A;  2EZK A;  3FK6 A;  1PUF A;  1R9T J;  3TW7 A;  3OIO A;  4FE4 A;  2H1K A;  2OPT A;  1ETW A;  4B4C A;  3TP0 A;  4XRS G;  5HOD A;  4L5E A;  5FKL A;  3LSR A;  4M6V A;  2ELK A;  4MFE A;  1Y1W J;  4M3G A;  3BTI A;  3Q3S A;  3ZQG A;  5C44 J;  2XRL A;  1ZR4 A;  1RR7 A;  2CUF A;  1MBF A;  3O8G A;  3BQY A;  3LSJ A;  2WAQ N;  1T33 A;  2ECB A;  3A01 A;  2LLK A;  2K9Q A;  1LFB A;  1VFC A;  4I6Z A;  4BXX J;  1X2N A;  1NK2 P;  1XC5 A;  5IOY A;  2O8K A;  1MNM C;  4JYK A;  3QQA A;  4B1R A;  4XIC A;  5IYC J;  3JRG A;  2KT0 A;  1SAN A;  3RQI A;  3SFI A;  2R7Z J;  3DCF A;  4LOC A;  1UG2 A;  2HDD A;  2JJ7 A;  2EH3 A;  1JUM A;  4RDU A;  4BBS J;  5EZG A;  3A02 A;  5FLV A;  2R5Y A;  1PUF B;  3HB9 A;  2FQ4 A;  3HDD A;  1JUS A;  2DA5 A;  1DU0 A;  5GP9 A;  1O4X A;  3PO3 J;  1IV6 A;  2YUS A;  4IHV A;  3IV5 A;  2DJN A;  5IYD J;  3S1Q J;  2GLO A;  4A93 J;  2XGC A;  2R92 J;  5J1Y A;  5C3E J;  4A3G J;  3S17 J;  5IP6 A;  2IBD A;  1ZK8 A;  3B6A A;  3D1N I;  5GPC A;  4CYC B;  1JT0 A;  2E2J J;  1POG A;  5F0C A;  5EGO B;  4UUS B;  1VND A;  3JRB A;  5C4X J;  3HBL A;  2JA6 J;  1D5Y A;  4CYC A;  2B63 J;  3S14 J;  2X6O A;  1ETO A;  1HDP A;  2MW8 A;  2M0C A;  5J3L A;  5J1U A;  2XSD C;  1OCP A;  1W0U A;  3WHB A;  3Q0W A;  3Q0V A;  2AHQ A;  2ME6 A;  5EF6 A;  2L7M P;  3FK7 A;  3QPL A;  1NTC A;  2E1O A;  2IEK A;  1ETQ A;  1FIP A;  2TCT A;  4FIS A;  9ANT A;  3GTG J;  3IH4 A;  1IG7 A;  4W1U A;  5EZH A;  2ZB9 A;  2LD5 A;  4D7M A;  2DMQ A;  4Y52 J;  3ZQH A;  2DMT A;  3JR9 A;  4FTH A;  1ZKG A;  2DA4 A;  2EZL A;  4C2M J;  2ME0 A;  2NOG A;  3Q0U A;  2X48 A;  1JTY A;  1ETY A;  5FKM A;  4A69 C;  3C2B A;  1K61 A;  3HEF A;  2R93 J;  1AU7 A;  3BG5 A;  2YS9 A;  2CUE A;  2OF7 A;  2XPU A;  2RAE A;  2N8G A;  2XGD A;  3GTP J;  4S0H B;  2EQR A;  5C4J J;  2DA1 A;  3BG3 A;  2VUM J;  3M4O J;  3BT9 A;  4A3E J;  1ZTR A;  1TWG J;  2MG4 A;  5K7F A;  1TWH J;  4D7N A;  1ETK A;  3JRH A;  1MBH A;  3QPS A;  2VKV A;  3K7A J;  1JKR C;  1OFC X;  2FX0 A;  3VPR A;  3I4M J;  2L7Z A;  3SDG A;  1GDT A;  1LFU P;  1JJ8 C;  5DTD A;  2MGQ A;  3GTQ J;  2LY9 A;  3BR0 A;  3GTK J;  3G1L A;  3OOU A;  1T56 A;  1VI0 A;  4BY7 J;  1IDZ A;  3JRI A;  1A5J A;  3ZQF A;  5EDN A;  1HCR A;  3F0C A;  1B8I B;  3GTL J; 
#chains in the Genus database with same CATH topology
 1IC8 A;  3BG6 A;  2B0L A;  2QSH X;  3A1Y A;  3BTL A;  3KYC B;  1BR1 A;  5EYR A;  4E7L A;  1Z05 A;  3L2U A;  1CQT A;  1FJL A;  1T8I A;  1ITY A;  4P1W A;  2XC7 A;  1JUP A;  1TNS A;  4XL9 A;  4YEJ A;  4HBL A;  1S3J A;  5DDG A;  4BUP A;  3TGN A;  3OV8 A;  1MNE A;  1JKP C;  2COM A;  5BQT A;  1BN5 A;  3L1P A;  3G73 A;  3I64 A;  1GT0 C;  1I3A A;  4R8H A;  1TQP A;  4YII A;  1WH5 A;  4CIC A;  1H0M A;  4UHT A;  1H88 C;  2MH9 A;  1I27 A;  1XMX A;  1WI3 A;  2M30 A;  1HSJ A;  3QOD A;  3IH2 A;  2QF7 A;  2OQG A;  5DUI A;  5ILU A;  2PEX A;  3MZ8 A;  1I39 A;  2MLK A;  4GDF A;  5IP7 J;  2CO5 A;  2VKH A;  4IJA A;  1GV5 A;  2LKX A;  1Z1D A;  2AO9 A;  1IXR C;  1NG7 A;  3EPZ A;  1LNW A;  2QCO A;  3EUA A;  3GUD A;  3QWL A;  4ASN A;  1PDN C;  1XG1 A;  3HKZ N;  2CRG A;  3DBL B;  4AC0 A;  4OAY A;  1I3Q J;  4JOM A;  1Y56 A;  4UVA A;  3HGG A;  3EUH A;  4ENK A;  2M9H A;  2GIV A;  1WI9 A;  1QGP A;  2CQK A;  1AOY A;  2OV7 A;  4O6J A;  5LRR A;  4PSX A;  5EEH A;  5F08 A;  5HOO A;  1T0F A;  4A3B J;  2DA3 A;  1U5T A;  1T95 A;  2CFO A;  4P9F A;  2COB A;  5HS8 A;  2PJR A;  3CES A;  3CUQ B;  1B59 A;  2NVX J;  2ZJP F;  2EFW A;  1ZHF A;  3BC8 A;  2HNH A;  2L9S A;  3HOZ J;  2PI0 A;  3H5R A;  4IHY A;  1MBE A;  1MDM A;  1O7L A;  2ETH A;  3DKY A;  1K7A A;  4QWQ A;  2DLL A;  1JTX A;  2EZI A;  3M8F A;  2KKO A;  4EM0 B;  5J8C A;  2GM4 A;  3CC7 I;  3OIQ A;  1IN5 A;  3K4J A;  2IS4 A;  3U9G A;  3RQ4 A;  5JVG F;  4B3A A;  1SMY F;  3ZQC A;  3QYF A;  3HIF A;  3WTX C;  1HBX G;  4XN3 A;  2CV1 A;  3ZMU A;  2CJJ A;  3AFH A;  4IHS A;  5LGN A;  4D5F A;  2JN6 A;  2CUJ A;  4DZP A;  3GYH X;  1B72 B;  4HDU A;  2UXN A;  5E1Z B;  2W24 A;  1OCZ H;  4XKW A;  4PGG A;  2ZNZ A;  1KZH A;  2ACJ A;  4BJT A;  1B72 A;  1UHM A;  4UUT A;  4HEA 2;  1P4X A;  1OIS A;  2R7T A;  2CQX A;  4I98 B;  1G59 A;  1X3U A;  2R7R A;  2KRF A;  4J19 A;  3KYD B;  3ML6 A;  3A0H C;  1YOV B;  2XVC A;  4MIM A;  4V2G A;  4NQW A;  4AYB N;  3PIO F;  4TV7 A;  2EFP A;  4H4K C;  4L9J A;  3E6B A;  3H5N A;  2E36 A;  5B5E C;  3HSE A;  2IW5 A;  1CF7 A;  1R5I D;  2OTJ I;  2KJB A;  1V5F A;  3S2H J;  1OPC A;  1V4R A;  2BZT A;  2K9M A;  4E7H A;  1TWF J;  3I0T A;  3DEE A;  2DT5 A;  5EG0 A;  3OYC A;  1H8A C;  3A03 A;  3GTM J;  2RQP A;  4P55 A;  3GZ5 A;  3HJE A;  4BHP A;  2R7S A;  5FB2 A;  2HPM A;  2VPL A;  1IUY A;  2JRM A;  3IL2 A;  4KUM A;  3ZGK A;  5FRO A;  2LDU A;  1G8X A;  2WB1 N;  1ZAR A;  2Y0M A;  3FBN B;  1IRX A;  4DNC A;  4IHX A;  4WXC A;  1LEA A;  5GTH C;  2KPM A;  3AG1 H;  4V19 K;  1AKH A;  3CLO A;  2OUM A;  5J47 A;  3QU3 A;  1U9N A;  3CO7 C;  5B1A H;  1JGG A;  3CQZ J;  2Y9Z A;  2WAE A;  4CSW A;  5D8L B;  2NXN B;  4DBR A;  4RMN A;  5LBQ A;  4UUS A;  1E0E A;  4HZF A;  2W4S A;  3D5L A;  4Y7N J;  4HV5 A;  4G94 A;  4UB8 C;  2L54 A;  1WH7 A;  4B44 A;  3VWB A;  3RKY A;  4ZDP A;  1BIB A;  4X6A J;  1TT5 B;  2K3P A;  5HS9 A;  1S7A A;  2QQA A;  1ZLJ A;  5CQG A;  2W85 A;  2BXY A;  2MFZ A;  3FMS A;  4UV9 A;  3VEP A;  1P2F A;  3K10 A;  5L3F A;  5K5R A;  5FRM A;  2OTL I;  3PQK A;  4L18 B;  3ABU A;  3CLQ A;  4CUG A;  3TP3 A;  1E17 A;  1HDD C;  3RIR A;  1KON A;  2JA7 J;  2KIM A;  1BW5 A;  4LIT A;  4M3D A;  3WTY C;  3I3L A;  2STT A;  2P6T A;  1BR2 A;  1IRZ A;  4DW6 A;  3GXO A;  2GOM A;  1V55 H;  4GXO A;  1FBU A;  4EJT A;  2QKM B;  4BQA A;  2P4W A;  4XNF A;  1TLH B;  3S3M A;  2DA2 A;  1VQ8 I;  2E1N A;  1C0W A;  1GHC A;  3L00 A;  2Z33 A;  2AQF A;  4WXH A;  2HOA A;  1SVL A;  1SFO J;  1OR7 C;  1XGO A;  2HKO A;  1RET A;  4A0X A;  1ZRF A;  1HOM A;  1EJ9 A;  2VQG A;  2R7X A;  2A05 A;  4X1E A;  1WJE A;  4WWC A;  2HYF A;  4BEH B;  3L09 A;  2HYJ A;  3KP6 A;  3CZ6 A;  3L2R A;  4AUX A;  1Q1V A;  4BNC A;  1JKQ C;  5H6R A;  2VXD A;  1K4S A;  2X6W A;  2ISY A;  4BDZ A;  4B09 A;  3ZQ7 A;  1ETV A;  1MJ9 A;  2XGE A;  3K69 A;  4LLL A;  4ZYE A;  2ZJR F;  4Y17 A;  3H3Z A;  2LP0 A;  2F5F A;  2Y30 A;  4HF0 A;  1XMA A;  2NVY J;  2RKH A;  2Y0S N;  3FXQ A;  2VJI A;  5DUK A;  3HRU A;  4EJW A;  2GAU A;  1BBY A;  3BR6 A;  1QZZ A;  5LEK A;  3HOS A;  3M9A A;  4MFD A;  2VXZ A;  3FKJ A;  4C30 A;  3I55 I;  1VQK I;  1EF4 A;  2HXO A;  1PJR A;  4MTD A;  3BRO A;  4HX7 A;  2YX7 A;  2Y0S A;  3LA3 A;  4UY8 I;  5E79 C;  2IA2 A;  2QVO A;  4FE4 A;  1J75 A;  4EJU A;  2LRE A;  2OPT A;  4M74 A;  4E7Z A;  3IAS 2;  3SZG A;  4CZZ A;  4B4C A;  4BE0 A;  2DK5 A;  2XF5 A;  4JQF A;  5F6F A;  2LRD A;  4L5E A;  5HOD A;  3LSR A;  2D45 A;  4U7B A;  3DXJ F;  4HYE A;  3ZQG A;  2VBZ A;  2GA2 A;  1RR7 A;  1B9M A;  3H5A A;  4GRI A;  3BQY A;  3LSJ A;  3LSH A;  5ICE A;  2HVR A;  1P6R A;  3K1M A;  5LEJ A;  2LLK A;  4BE1 A;  3FXJ A;  1VFC A;  3HC7 A;  5D5X B;  1MIJ A;  3REO A;  4ENJ A;  3C3W A;  3QQA A;  1D1B A;  5HDG A;  4XIC A;  3SEQ A;  5E1X A;  4KDP A;  3NEU A;  5J40 A;  5J4Y A;  1BI2 A;  1W7P B;  1J2X A;  1FT9 A;  4GYI A;  1HW5 A;  1FYK A;  2R7Z J;  1RI7 A;  4YRV A;  4LIV A;  4HOB A;  4LOC A;  5D5U B;  4BXF A;  4RB3 C;  2LMD A;  3BJO A;  3CCE I;  1MJB A;  2WTE A;  1PUF B;  1Z21 A;  5LLQ A;  3CC4 I;  1MW7 A;  3DP7 A;  1JUS A;  3WTU C;  5HNH A;  1O4X A;  2YUS A;  3BJA A;  3LST A;  1R4N B;  2M3A A;  2IP2 A;  5J1Y A;  4IQJ A;  4A3G J;  2JT1 A;  4ZTF A;  3S17 J;  4XQF A;  3B6A A;  3D1N I;  1B6A A;  2DQR A;  3PSI A;  4CYC B;  2ZO4 A;  1POG A;  5EGO B;  3BOQ A;  5C4X J;  1UAA A;  4E7K A;  2L9V A;  4XMY A;  2Q0O A;  2F5D A;  3GLX A;  4CCN A;  4YFN F;  2DO7 A;  2MC3 A;  1HDP A;  2VKD A;  2M0C A;  3J80 Z;  3L2V A;  3CCV I;  2R7U A;  1OYY A;  2X6X A;  4S04 A;  3RCO A;  4EJO A;  1W0U A;  1WKM A;  3ERM A;  2AHQ A;  4I01 A;  5EF6 A;  2L7M P;  3FK7 A;  2E1O A;  4LIU A;  4HX4 A;  4U0Y A;  9ANT A;  1R22 A;  3IH4 A;  1IG7 A;  3OR2 C;  2CWE A;  1XB4 A;  5LD2 C;  5EZH A;  2V1U A;  1XTA A;  1X19 A;  2ZB9 A;  2F5C A;  3E1S A;  1U8R A;  2LD5 A;  2XAS A;  2VOD A;  2DMT A;  3V42 A;  4F55 A;  2G7U A;  3LAJ A;  3CCL I;  3Q5F A;  1D1A A;  2XDV A;  5CLS A;  4AIH A;  2VON A;  1FLI A;  2KFD A;  4LMY A;  4C9Y A;  4P9U A;  3FXU A;  3DLL F;  3Q0U A;  4A6E A;  4NB5 A;  3VOD A;  1JTY A;  1ETY A;  1YJW I;  3QYB A;  4KIC A;  5JR3 A;  2A5Y B;  1XCV A;  3C2B A;  4RB1 A;  2V1D A;  4LB6 B;  1SD7 A;  4C2T A;  3BG5 A;  2HZT A;  3HRM A;  1VZ0 A;  3QP5 A;  2K86 A;  5ERI A;  2N8G A;  4M73 A;  1J09 A;  4PFP A;  3E5U A;  3A0B C;  3EET A;  6PAX A;  2KDO A;  3PNY A;  5DD4 A;  3ZMV A;  2MD0 A;  2MG4 A;  3WGI A;  5E18 F;  4UNO A;  1MMD A;  5EEG A;  4AM3 A;  1ETK A;  2X4H A;  4BQN A;  2F6C A;  1MD0 A;  1S7O A;  3ASO H;  4XON A;  3BP8 A;  1FC3 A;  1JKR C;  4E7I A;  1OFC X;  1X1A A;  1FP2 A;  3LSM A;  1W5S A;  1U2W A;  2EV5 A;  4XSX F;  3I4M J;  5JI6 A;  5K5O A;  1IV8 A;  2H6C A;  3GTK J;  3G1L A;  3OOU A;  2ESN A;  4BAY A;  1IDZ A;  1YW8 A;  3ROU A;  2PG4 A;  2ELJ A;  3OL4 A;  5J4V A;  3DEU A;  3ZQL A;  3ZP5 A;  1YIT I;  2ADU A;  3DU6 A;  5CVU A;  2M0M A;  4DGW B;  3HOY J;  2O3F A;  4FX4 A;  4QPQ A;  4D5C A;  2FXA A;  1PVE A;  4ZZL A;  3OYJ A;  4M9S A;  2QBY A;  3E6C C;  1OQY A;  1Z6R A;  2V79 A;  3KP5 A;  5F04 A;  4JP0 A;  1FBQ A;  3OSG A;  3MEX A;  1SD4 A;  2MC4 A;  2P5K A;  1R7J A;  2FUG 2;  2LTP A;  2YR2 A;  2HFH A;  2DTZ A;  1IZ1 A;  3HUG B;  3MVP A;  3K4B A;  1ZLK A;  1G4D A;  3AG3 H;  4G12 A;  4Q48 A;  3H0G J;  1R5H A;  3R60 A;  4JK1 X;  1K6O A;  2DCE A;  1XPX A;  1IO2 A;  4M71 A;  1OCR H;  3G1M A;  4RLQ A;  3HRT A;  3KLO A;  4A3M J;  2W7N A;  2YX4 A;  4LB5 A;  1IW7 F;  5EGO A;  1FNN A;  4BQQ A;  2YU9 J;  3JAM K;  2OD5 A;  2JQ7 A;  2R7F A;  2W1O A;  1BI0 A;  4U87 A;  3KEO A;  2DJI A;  2G0E A;  2XIG A;  2FD5 A;  3OYB A;  2O03 A;  2BE5 F;  1AHD P;  1KU2 A;  3R61 A;  4OIR F;  2LK2 A;  1K78 B;  1B9N A;  4DJA A;  2FBI A;  3OIP A;  2LBF B;  4M3F A;  1T2K A;  2EIK H;  1DU6 A;  4XLN F;  5HLT A;  3DEW A;  4XRF A;  1ZR2 A;  1YHQ I;  3DQV C;  2HQ5 A;  2ZXJ A;  4XSZ F;  1BR4 A;  5L3D A;  1OCT C;  3OYF A;  5DEQ A;  5M3M J;  2OC6 A;  1IN8 A;  2FU4 A;  1OCO H;  2DYR H;  2X0L A;  3IUO A;  4EV0 A;  2QKL B;  4OU0 A;  3FDY A;  2E2I J;  1UCR A;  4CYD A;  5LGU A;  1SFU A;  1SVO A;  2CV0 A;  2CSO A;  2M87 A;  1H9G A;  4HV6 A;  1WSU A;  1LB2 A;  2IS6 A;  5FKN A;  1R6R A;  4UUV A;  5DCM A;  2IS2 A;  1OYW A;  2ID3 A;  2O7O A;  5IT9 K;  4RAY A;  1SAU A;  3B02 A;  1W36 D;  3X2Q H;  2NVQ J;  3J80 K;  4BAC A;  3W6V A;  2HR3 A;  4LD5 A;  5D5V B;  3JTH A;  2QZ8 A;  3IH3 A;  1X2M A;  3L9F A;  5FLX K;  4ETS A;  2H6B A;  1VQ6 I;  3O3K A;  4Z6Y A;  2Y9Y A;  3CCS I;  3HG9 A;  4WK8 F;  2UUZ A;  3PQJ A;  2KP6 A;  5KNL A;  1XSD A;  1APL C;  3QPH A;  4PDK A;  1QZE A;  1Z91 A;  2KMU A;  1HF0 A;  3L7W A;  4ZTJ A;  3VB2 A;  1A35 A;  3S16 J;  2CQN A;  2WC2 A;  1QPI A;  1MBK A;  1K83 J;  1LE8 A;  1DPR A;  3LSP A;  4Q47 A;  2BEO A;  1P7I A;  3FXR A;  4IRH A;  3I4P A;  1BOA A;  2DMP A;  3G3Z A;  3L2W A;  1P4W A;  1YFH A;  1HXD A;  1WPK A;  2WA0 A;  5M5X J;  3BZ6 A;  3KET A;  1EH6 A;  4PJM A;  2O8X A;  3J7Y J;  4M72 A;  4HDV A;  2FSW A;  1BC7 C;  4KIF A;  4KJZ A;  2DOE A;  2J5O A;  5M5Y J;  1LPQ A;  5CVJ A;  4A5M A;  5L3C A;  1O3S A;  3FXO A;  4A3F J;  5FD6 A;  2Z5U A;  3HTS B;  1WFX A;  1I1G A;  3DWL E;  3CCJ I;  2R7W A;  2NS7 A;  2WY7 Q;  4ZZD A;  2JK3 A;  1MDM B;  1IUF A;  1GXQ A;  4CCL A;  2V6E A;  4OIN F;  2XPV A;  4OMZ A;  3HPH A;  3QOP A;  1GLN A;  3BJ6 A;  2CFX A;  3E5Q A;  2JA8 J;  2E5N A;  4IEJ A;  2DYS H;  2VQL A;  5E3L A;  2JA5 J;  3MKW B;  1RC9 A;  1ENH A;  3BTJ A;  3CME I;  1K6Y A;  2M5W A;  2PMH A;  3OSF A;  3PIP F;  3GFI A;  4QSH A;  4CO8 A;  1HA8 A;  3OYE A;  3M3Y J;  3CCR I;  3BY6 A;  3ZXS A;  2RDP A;  3J7A Y;  4A3L J;  3CMM A;  3J81 Z;  4A3I J;  4OIQ F;  2FQ3 A;  1XDS A;  2EA4 A;  2M1B A;  3ZR8 X;  1G2H A;  1TC3 C;  3BTC A;  2H8R A;  2LVS A;  2EWN A;  2GBY A;  2JTV A;  1IF1 A;  1Y1V J;  5JFR A;  2JSC A;  3KFW X;  3FF5 A;  2HZD A;  2OA4 A;  1KQ9 A;  3ASN H;  1YJ9 I;  1TW3 A;  1DGW Y;  4BU2 A;  1D0Y A;  1FOK A;  2X1E A;  3TMO A;  3HM5 A;  3GBG A;  2FNA A;  1VF9 A;  1DQU A;  1W7P D;  5DM6 F;  1ONV A;  5F27 A;  4HPQ A;  4G6T B;  4L9T A;  2FRH A;  2R7Q A;  4RBO A;  3F23 A;  1Y8Q B;  5K1Y A;  1YRN B;  3WHC A;  2BBY A;  3GTO J;  5JLX A;  5F0F A;  1E3H A;  1QA6 A;  3I59 B;  2O6G E;  3CUQ A;  5D4R A;  3W2W A;  2DA7 A;  3FMR A;  2QUF A;  2L3D A;  2VKE A;  4IVN A;  3CMY A;  2FJ1 A;  4MTE A;  4A12 A;  3RKQ A;  3HZJ A;  1QBJ A;  1S5L C;  4I02 A;  5EG0 B;  3BR1 A;  3ZMS A;  4DIQ A;  3JSP A;  2WV1 A;  3V7R A;  1OLT A;  4MO7 A;  3WE3 A;  4D0P A;  3CJT B;  1TQM A;  4DQ2 A;  1TWA J;  3GZ6 A;  4E7J A;  4ESB A;  1E2X A;  1TTY A;  2O0Y A;  5ILV A;  4CA0 A;  4XLH A;  3H3V K;  2HXI A;  4DYQ A;  2GIZ A;  4HSR A;  3GVA A;  2O5R A;  1OCC H;  3KP7 A;  3RPU D;  5B66 C;  4X0G A;  2KDZ A;  4FE7 A;  3RKW A;  2IPQ X;  3JRA A;  3MD2 A;  3E5X A;  2LKP A;  3QOE A;  2JUC A;  3CCY A;  3TO9 A;  4J00 A;  4MEY F;  2CGP A;  2K40 A;  1BOB A;  1FBS A;  2ZXW H;  4PK4 A;  2XB5 A;  3K4M A;  4A6D A;  1RNL A;  2M4K A;  3TOA A;  4XID A;  1JKO C;  1JI8 A;  2HU9 A;  2DT7 B;  2P0W A;  3K9T A;  5E3M A;  3RZO J;  4XOT A;  4XKB A;  3OYI A;  1GV2 A;  3NWT A;  2PQ8 A;  1ORK A;  4GYG A;  2VBY A;  3BR3 A;  4RM3 A;  1JJ6 C;  2E2H J;  1QHH D;  3T1B A;  2IS1 A;  3F9K A;  4ANJ A;  1GUU A;  1MJA A;  1ETX A;  1VQO I;  2ESH A;  3FX3 A;  3TW6 A;  3ABK H;  3UR3 C;  5K7H A;  1RKW A;  4V2F A;  3H9Q A;  2A69 F;  2CQ7 A;  4QPO A;  1I6X A;  2HOT A;  1S7E A;  2JPB A;  2K9S A;  1W4M A;  4XLC A;  2K9N A;  1R00 A;  1XMK A;  3I53 A;  1WGX A;  2E1M C;  2O61 A;  2NS8 A;  3LSG A;  3OS0 A;  1Z7L A;  2K02 A;  4XKC A;  2K9L A;  4MEX F;  3EYI A;  3BWG A;  4O3M A;  1XGN A;  3GTJ J;  2GA1 A;  2EZK A;  3O2P E;  4F7Z A;  2IXS A;  3FK6 A;  1PUF A;  4PFO A;  3OIO A;  1BI1 A;  1LJ9 A;  2ZBK A;  1J59 A;  2H1K A;  1U5T C;  1X3W B;  3WOD F;  3TP0 A;  3ZCO A;  1Z3X A;  2ZJ2 A;  2EFO A;  4M3G A;  3SHF A;  4ZYD A;  3Q3S A;  2CW8 A;  3CD6 I;  2XRL A;  2QQB A;  4L5I A;  2XAH A;  3O8G A;  3RYP A;  2LY1 A;  4NHJ A;  3C18 A;  1T33 A;  4CCK A;  3A01 A;  3I56 I;  2K9Q A;  5IY5 H;  3F21 A;  2BHZ A;  3GFL A;  1VQ5 I;  1R5G A;  5H2F C;  1NK2 P;  1XC5 A;  1OR7 A;  4JYK A;  3CMA I;  1SAX A;  4ZH4 F;  3T5X A;  5IYC J;  4HAM A;  3JRG A;  1MZB A;  1KU3 A;  3HHG A;  3H0D A;  1RIO H;  4ZC3 A;  3SFI A;  1V54 H;  1DP7 P;  2DK8 A;  2DOA A;  1TP4 A;  1UG2 A;  2QEN A;  2DDA A;  2HDD A;  3N97 A;  2HWV A;  3PL8 A;  2JJ7 A;  4RAZ A;  1K78 A;  1JUM A;  2QBY B;  1I5Z A;  4IQ4 A;  3V7S A;  2WAF A;  5EZG A;  3A02 A;  5FLV A;  2R5Y A;  3FBI B;  2FQ4 A;  3HDD A;  2PJP A;  3CCU I;  1EH8 A;  2KIU A;  2JSP A;  4KN4 X;  2DA5 A;  1DU0 A;  4AU7 A;  1AWC A;  3S8P A;  3CTA A;  1MKM A;  1D8J A;  2DJN A;  2VL8 A;  1WJF A;  3HHH A;  2W00 A;  3S1Q J;  2GLO A;  2XGC A;  2L2O A;  5C3E J;  2CV2 A;  3R6S A;  4AWX B;  2BVM A;  1MND A;  4IRG A;  5IP6 A;  2ZKZ A;  4OOI A;  2DPD A;  2DPU A;  2C6Y A;  3W6J B;  4G7H F;  3I9V 2;  1JT0 A;  4H0E A;  5F0C A;  4PSW A;  3F8F A;  1WJC A;  2XF7 A;  2XGX A;  4LK0 F;  5DCF A;  3VYT B;  4BJ5 C;  5TRD A;  1ZRD A;  3LWF A;  4GO1 A;  2BY0 A;  1FOY A;  4RA2 A;  2VQH A;  3GW2 A;  2QGU A;  3SFZ A;  2F48 A;  2DBB A;  4CDG A;  3HXL A;  3L2C A;  2QQ9 A;  2DFF A;  1FIP A;  3H35 A;  3ECH A;  4KIB A;  4ESJ A;  3IKV A;  2OCE A;  4CXF A;  2AXT C;  4Z2Y A;  2M8E A;  4FTH A;  4NC6 A;  3JR9 A;  2VJ4 A;  1UB9 A;  2B9S A;  1HKT A;  2OZU A;  2UWM A;  2CG4 A;  3OS2 A;  3H1C A;  3UNG C;  2DXI A;  3N05 A;  3SYT A;  2HPI A;  3FM3 A;  1FYL A;  2NOG A;  2X48 A;  1L0O C;  4GCV A;  1QQI A;  2VC0 A;  4CHU A;  5FKM A;  1HW1 A;  1K61 A;  2A3S A;  2BHY A;  2ZFU A;  1T0F C;  2OCC H;  2BW3 A;  2Y48 A;  2ZNY A;  1USS A;  2RAE A;  1TT0 A;  3HUG A;  4S0H B;  2EQR A;  4I2O A;  3GTP J;  2VUM J;  3ZPL A;  3BT9 A;  3TOB A;  1X1P A;  1ZTR A;  2ZSI B;  4LLN A;  5HLI A;  5K7F A;  4D7N A;  5GAD J;  4PJL A;  5J6X A;  4MQ9 F;  5DM7 F;  4WCG A;  2IJL A;  3QPS A;  2XSJ C;  2VKV A;  5CVV A;  3RYR A;  3WGG A;  1HW2 A;  2FX0 A;  4XR6 A;  4UVC A;  3SDG A;  3FM5 A;  2MLG A;  2E71 A;  2BY3 A;  3K1N A;  2MGQ A;  4XOP A;  1XSV A;  3GTQ J;  4HQM A;  2HEO A;  1MMN A;  4WXD A;  3V8L A;  2W84 A;  3JRI A;  1A5J A;  3BDD A;  4L9V A;  3RTR A;  3ZQF A;  5LGT A;  5EDN A;  1HCR A;  2DA6 A;  1FMW A;  2M7A A;  2VBW A;  2Y69 H;  3LA7 A;  4GFB A;  3V4G A;  4CCO A;  1BIA A;  1HST A;  1Z77 A;  1ZQ3 P;  2GXA A;  1Y6I A;  3R0J A;  2KRC A;  3W2A A;  5KHD A;  1I50 J;  1LEB A;  1IN4 A;  5FRN A;  2E5Z A;  3MMY B;  3FHN A;  3GME A;  4HST A;  3HTU A;  1D0Z A;  5DYM A;  3AL0 B;  4B47 A;  2V7F A;  3MN2 A;  4U0W A;  2G9W A;  4BBR J;  1U8B A;  1J9I A;  2DFE A;  2JWT A;  5L3B A;  3JTG A;  4QLC U;  5B3S H;  1QHG A;  4F52 A;  3K2Z A;  4BQO A;  5FKK A;  3RI4 A;  1SVM A;  3CUQ C;  3CJR B;  3IRR A;  2P5L C;  4F92 B;  3JW4 A;  2M45 A;  4MLO A;  4C3I J;  1VQL I;  3U1K A;  4M9X A;  3IAM 2;  2F2E A;  3I58 A;  1NHA A;  1N77 A;  2YSR A;  1AA7 A;  2A68 F;  2LKS A;  3V8J A;  1FX7 A;  1WZ2 A;  5FKO A;  1MBG A;  2KJC A;  5EJC A;  1HKS A;  5GAE J;  2XRO A;  3BCB A;  1R1T A;  5E20 A;  2NS0 A;  5KAF C;  4PZJ A;  2XKP A;  1F4K A;  1KA8 A;  2E35 A;  5IPA A;  1DPU A;  2K4J A;  2NNN A;  3W2V A;  4OAZ A;  1SD5 A;  5TIS C;  5H6Q A;  2B7E A;  3S15 J;  2LR8 A;  3NAU A;  1RES A;  3KPH A;  3M7G A;  3KE2 A;  2LBF A;  4NUB A;  4YEL A;  4BS9 A;  2A07 F;  1E3O C;  5JHF A;  1WJB A;  1A31 A;  1MMS A;  1G3S A;  1GVJ A;  3TDU C;  1XN7 A;  3PNV A;  1YW9 A;  2TRT A;  3GO5 A;  5HS7 A;  2P7V B;  4BH9 A;  4LLG F;  1FYM A;  4KIT B;  1K79 A;  3UKG A;  1PP8 F;  2V9V A;  2NVT J;  4B8X A;  4PCQ A;  1JGS A;  2V1X A;  4FQG A;  3ELK A;  2VPR A;  3I5U A;  1MH4 A;  1QVT A;  1SD6 A;  1STZ A;  1WCM J;  2A5W A;  2RNG A;  1DP3 A;  2DQL A;  5FO5 A;  2EV0 A;  3PSF A;  2IVM A;  4GGG A;  3ZOB A;  2ECC A;  4DOZ A;  1IAW A;  1YS7 A;  1Q1H A;  1WRJ A;  5D8K B;  1FSH A;  1SFK A;  2HI3 A;  1IRF A;  4BKX A;  4G7Z F;  4AVP A;  4N4O B;  1FEX A;  4I76 A;  2EIL H;  3OYK A;  2EFQ A;  5D5W B;  3DKW A;  1CF7 B;  3LSK A;  3SEZ A;  4XKV A;  3CDL A;  1KQ8 A;  4S05 A;  3EUK L;  2GOX B;  4Y4R A;  2P7C B;  1NH3 A;  4B43 A;  3PNT A;  2I10 A;  4A3C J;  2PMZ N;  2BVL A;  2DFI A;  1MSF C;  1UHS A;  1M1E B;  3T8R A;  3P9C A;  3DKX A;  2HDW A;  2XF6 A;  1U3E M;  3Q9S A;  3ZN1 A;  2L9R A;  2A6E F;  2QM3 A;  1IDY A;  2CQQ A;  1LE8 B;  2EBI A;  5FGM A;  1IJW C;  1XGS A;  3RPU A;  3OYA A;  3G6E I;  1YX5 A;  4OIO F;  3H9J A;  1YIJ I;  4QIW N;  3K4C A;  1TW2 A;  2H27 A;  4JBA A;  2HS5 A;  4NQW B;  3K70 C;  3K4L A;  1ZN2 A;  1NK3 P;  5AIQ A;  1TL8 A;  2HQR A;  1YW7 A;  2HTS A;  4MNU A;  3LAP A;  2GXB A;  3S2D J;  1FTT A;  3GFM A;  1U78 A;  4A3J J;  3JAM Z;  3MCZ A;  2EZH A;  3HOU J;  2F5E A;  2I5U A;  1YX3 A;  5FD5 A;  1YTY A;  2L01 A;  1KGS A;  5F1R A;  4K2E A;  4BHB A;  3F8M A;  2FOK A;  3U2R A;  3WTV C;  3PO2 J;  1MBJ A;  4JX5 A;  2V26 A;  3C2G A;  2R0Q C;  2BY2 A;  4I09 A;  1CGP A;  3HOW J;  2H1L A;  3FXK A;  4G6D A;  2JA2 A;  3PUF A;  2QYO A;  1IGN A;  1YIO A;  3V8K A;  3BG7 A;  3G1O A;  2CMP A;  3KP3 A;  1TNT A;  1RPW A;  3VYS B;  4D1Q A;  2Q8K A;  1KQ0 A;  4CGZ A;  4LGW A;  4HNV A;  1HLV A;  2ZXH A;  1LDJ A;  2Q1Z B;  1UMQ A;  5IYB J;  5IT9 Z;  2VE8 A;  4RB0 A;  1LDK B;  4IHT A;  1R36 A;  2FE3 A;  3FKI J;  4FAS D;  4Y15 A;  5LHG A;  3OOP A;  4P96 A;  5ILS A;  2NVU B;  3I4N J;  1FMV A;  3R4K A;  2KRH A;  2DOD A;  3C2H A;  1F43 A;  1A6Q A;  2XAG A;  2HGC A;  2KIF A;  4HQE A;  1WJA A;  4DYC A;  2XAF A;  2CW7 A;  5K5Q A;  3FWE A;  2Y31 A;  3I71 A;  1MMA A;  4ZYA A;  1NG6 A;  1DUX C;  1BA5 A;  2ICW G;  3WU2 C;  4NDL A;  4EM2 A;  4MQV A;  3RSN A;  3TL4 X;  3NAR A;  5E8G A;  1YO5 C;  3ESW B;  4CCJ A;  2GWR A;  2DMN A;  2VI6 A;  2CU7 A;  2I8D A;  4NC7 A;  2M4G A;  4AID A;  4HLY A;  3ZQQ A;  3CF2 A;  1WJ5 A;  2XRN A;  5FLM J;  5F64 A;  3BR2 A;  3S3N A;  1EH7 A;  2ZME C;  2LG4 A;  3CDH A;  5ED4 A;  2DTR A;  3ZMZ A;  5B1B H;  1A6I A;  3DTI A;  3JRF A;  1N75 A;  3LSI A;  4C3H J;  4Y33 A;  3HRS A;  2DT6 A;  5E3N A;  3ERE D;  5TGT A;  1ZH5 A;  4MGR A;  1AKH B;  5HVQ C;  1JE8 A;  1VQ7 I;  1IN6 A;  2MSY A;  2R5Z B;  5CYV A;  5E17 F;  1TBX A;  4AIK A;  2E1C A;  1QVU A;  4OWR B;  5M3F J;  2P8T A;  2XB0 X;  2IAI A;  1Z7U A;  3B73 A;  3JRD A;  2EK5 A;  4W97 A;  4IXA A;  2WAQ A;  3K2A A;  1BJA A;  5GTI C;  4PJN A;  2PBI A;  1U9O A;  3F72 A;  3ABM H;  2E19 A;  2M34 A;  5D6F A;  3ZQI A;  1UEL B;  4A5N A;  3BQZ A;  5JHU A;  1KU7 A;  4EQQ A;  1FPQ A;  3A01 B;  3DPU A;  5KAI C;  3E6D A;  1R4M B;  1A04 A;  3G4S I;  3GFJ A;  1Z0X A;  4OIP F;  2MH2 A;  5J8F A;  4F93 B;  4XRS A;  2JPC A;  1YE9 A;  4XBF A;  4U0V A;  2V1N A;  2W48 A;  3K4K A;  1MSE C;  2HVS A;  3ZN0 A;  1QRY A;  2ISZ A;  5DS9 A;  4LK1 F;  2RGV A;  2R7D A;  2L7F P;  3H9G A;  1FY7 A;  4M6Y A;  2Q2E B;  1Y8R B;  1Z9C A;  2VN2 A;  1R9T J;  1R49 A;  3OYM A;  3VYR B;  2L9N A;  1WHU A;  1H9T A;  3E0J B;  5GAH J;  4XRS G;  5FKL A;  4IPA A;  2XKO A;  2DU9 A;  4MFE A;  3VFZ A;  3BTI A;  3MFK A;  3MKY B;  5ICF A;  2LH9 A;  1B4A A;  4ZDO A;  2H94 A;  4Y3O A;  3WTZ A;  2WAQ N;  4EJV A;  2ECB A;  3IWZ A;  4WF2 A;  1LFB A;  1N78 A;  4I6Z A;  4BXX J;  2IGN A;  2EPF A;  2V9P A;  5LFA A;  5IOY A;  1X1B A;  2LNB A;  2O8K A;  4U88 A;  4B1R A;  1ZEL A;  3F8N A;  4M6X A;  4NNJ A;  2KT0 A;  3P7N A;  2WWY A;  1T6S A;  3F6O A;  5FLX Z;  2LF8 A;  2D1V A;  1LKX A;  2K27 A;  4ENN A;  5FFX A;  4KN7 X;  1HQC A;  4RDU A;  4ITV A;  2RV8 A;  3HB9 A;  4IF4 A;  3QU6 A;  3EQL F;  2ZME A;  1T98 A;  2VJ5 A;  3KCC A;  4Y13 A;  1ZG5 A;  1ZGJ A;  1G3Y A;  2Z2S B;  2L5Q A;  4HW0 A;  2X51 A;  4IZZ A;  1IV6 A;  5CJ9 A;  2JUG A;  2ZME B;  1SFX A;  5IYD J;  3HSF A;  4A93 J;  2LF7 A;  2LOO A;  4CCM A;  4XLP F;  2JVG A;  2IBD A;  1YI2 I;  1ZK8 A;  3VYU B;  4UV8 A;  3CUO A;  4EVI A;  5GPC A;  2XHK A;  2VQC A;  1FOX A;  2AXL A;  2NAZ A;  3RKX A;  1XCB A;  3F22 A;  4UUS B;  1VND A;  1Z3Y A;  2BW3 B;  3M1C A;  3TO7 A;  3JRB A;  2Z1D A;  1G3T A;  2F4O B;  1ZYR F;  1ON2 A;  3S93 A;  2JA6 J;  2DI3 A;  1UST A;  5CQE A;  1ZRC A;  1TZL A;  4LFU A;  4CYC A;  3S14 J;  3NWS A;  2A6T A;  3T8T A;  2X6O A;  3ABL H;  1O3R A;  5J3L A;  3LL7 A;  2K4B A;  5J1U A;  1ZG3 A;  3AG2 H;  4P5O A;  5HDK A;  3CO6 C;  3WHB A;  1BC8 C;  1IRG A;  3V7C A;  2ME6 A;  2DFH A;  2VC1 A;  4II3 A;  2V6C A;  4ZYH A;  4C2U A;  4KYW A;  3W3C A;  1VQM I;  1ETQ A;  2TCT A;  3RJP A;  3HOT A;  1YS6 A;  2EIN H;  5CKT A;  3WU1 B;  3VSK A;  4YIR X;  4G8X A;  3NQO A;  3WTW C;  3LQQ A;  3H92 A;  2D1H A;  5D6E A;  1ZKG A;  3IP4 B;  2EZL A;  2VJJ A;  4KT5 C;  2BYV E;  1UFM A;  4C2M J;  3IKT A;  5HLG A;  3D0S A;  3IHU A;  3OR1 C;  1PP7 U;  2WAD A;  1G6N A;  4N9H A;  4DBQ A;  3JCU C;  3G71 I;  4E4H A;  3O6B B;  1QU3 A;  2HQN A;  3E6M A;  3F3X A;  1Z6T A;  1WJD A;  2R93 J;  2LSO A;  5AIP A;  1AU7 A;  2W57 A;  2CUE A;  2OF7 A;  3OS1 A;  2Y75 A;  2DW4 A;  3VSL A;  2XGD A;  4IO9 F;  4RAF A;  2BOL A;  2DA1 A;  3BG3 A;  3A4C A;  3M4O J;  4XOR A;  1V3F A;  1RUN A;  1U6G A;  2WBM A;  3AG4 H;  2ZJQ F;  1ZRE A;  4PJJ A;  1YYV A;  1S6L A;  3PJR A;  3ONQ A;  2VT2 A;  1MBH A;  2GQQ A;  1U0J A;  3U21 A;  3K7A J;  2Z99 A;  1SC7 A;  1S8N A;  1ULY A;  3PFY A;  2K85 A;  1V5E A;  5DTD A;  1X4O A;  2LY9 A;  3BR0 A;  1R1U A;  1E3P A;  2E60 A;  2KHM A;  1VI0 A;  4KNY A;  1HKQ A;  2LC2 A;  3GZN B;  4LG3 A;  5H20 A;  4L5J A;  1SMT A;  4UB6 C;  5EEA A;  2R7V A;  1ODD A;  3K70 D;  4M9Z A;  2VAS A;  2XV4 S;  3KZY A;  3WE2 A;  3KP4 A;  2VT3 A;  1TQI A;  1N25 A;  2OAZ A;  1PUE E;  3AL0 C;  2LYC A;  3JSO A;  1BW6 A;  3M07 A;  1K4T A;  2DMU A;  3IRQ A;  3LFU A;  3LOC A;  4ZYG A;  2DOF A;  2ID6 A;  1VQ4 I;  4ENM A;  4DYR A;  1MH3 A;  1REP C;  3CF5 F;  2QWW A;  2WV0 A;  1OJL A;  2FEZ A;  3K4N A;  5A2Q Z;  3OMY A;  2ELH A;  4BXU A;  1OKR A;  4N9I A;  1BL0 A;  4BJ6 C;  3HL2 A;  4OMY A;  2TDX A;  3D5S C;  1B1B A;  2A6H F;  1RKT A;  2VBX A;  4BHC A;  5CVR A;  3E7L A;  3LA2 A;  5E1W A;  3CJQ B;  3S32 A;  3SXY A;  2YPR A;  5K7Z A;  3KZI C;  4XN0 A;  3WTS C;  2XAJ A;  5KK1 A;  5BNG A;  3S3O A;  1Y39 A;  3S1N J;  1TWC J;  4YFX F;  3P5J A;  2FBH A;  5J1R A;  3CCM I;  3BZC A;  2R5Y B;  2EIM H;  2L4M A;  4BY1 J;  1RZ4 A;  3LQR A;  1QZY A;  2X1C A;  3C7J A;  1F1Z A;  2MD5 A;  5IOZ A;  3SZP A;  2IRF G;  1YG2 A;  3CP8 A;  3R0A A;  3HOV J;  1EA3 A;  1D0X A;  3J81 K;  4DZJ A;  1ACI A;  3HGY A;  4ABZ A;  1O3T A;  3HSR A;  5ICC A;  2OQR A;  1ZGA A;  4XLA A;  4QTR A;  2HDC A;  1P4A A;  3JRC A;  2V4J C;  2XAQ A;  1W1W E;  4NC8 A;  3BZK A;  4BE2 A;  2F4M B;  2PLY A;  2BY1 A;  4ZDL A;  4A3K J;  3WGH A;  2E7X A;  5GAG J;  4CZC A;  2MYS A;  2HOS A;  2M2E A;  3A2K A;  5KVR A;  1F36 A;  2PX9 A;  3SZT A;  3KLN A;  1GVD A;  2IGK A;  4BYY A;  2NRA C;  3M1E A;  3OYL A;  1H89 C;  1FIA A;  3FIW A;  1ZG1 A;  2RN7 A;  3DU5 A;  3S1M J;  3ECO A;  4II2 A;  1D3Y A;  3M8E A;  2Y2Z A;  4KIG A;  4LG0 B;  2M7B A;  2VIX A;  1PYV A;  4EEF G;  2DDB A;  3WTT C;  3QAH A;  1BM9 A;  4HNT A;  3WU0 A;  1OMI A;  4YG2 F;  2HYG D;  2PFB A;  3EUH C;  2P5V A;  3HPG A;  5JLW A;  1X3Z B;  2QQ8 A;  4EGZ A;  4F91 B;  1T38 A;  2Q2E A;  3E97 A;  3TBI A;  4FHT A;  4RGU A;  2QA4 I;  2L0K A;  3CP2 A;  5CPR B;  2MAB A;  3RPQ A;  5L3G A;  4E6K G;  1XS9 A;  1X1D A;  2P81 A;  3OYD A;  2IA1 A;  3FXL A;  4HX8 A;  3S1R J;  2X6Y A;  1XD7 A;  3P9K A;  4KT6 A;  4FET A;  2NYX A;  4L0Y B;  1FP1 D;  1RR8 C;  4RLF A;  1XDU A;  3ZMD A;  1JXS A;  3MKL A;  3QP6 A;  4HA8 A;  1SFE A;  2IGM A;  2FNP A;  3ULQ B;  1XX5 A;  4PJ0 C;  1BI3 A;  1YLF A;  2XAU A;  1LFP A;  2K3F A;  3DF8 A;  3LMM A;  3P9I A;  1S9H A;  1Z67 A;  4XRM A;  2PMZ A;  1FOW A;  3VOE A;  1VQN I;  4ON0 A;  2Z3Y A;  5A2Q K;  4IRI A;  2OU2 A;  3QYE A;  2UXX A;  2ZC2 A;  2ZXI A;  1G3W A;  3MWM A;  2CW0 F;  5KCM A;  4FCY A;  3BPX A;  4RS8 A;  5HDN A;  4HF1 A;  4UXN A;  1W7P A;  4IKF A;  2GXG A;  2QEX I;  4JX4 A;  1Y0U A;  2IA0 A;  4J01 A;  5FJ8 J;  2JZY A;  2KLO A;  4BDY A;  1P92 A;  2X9D A;  3J7A O;  2EV6 A;  2M8G X;  2XPW A;  4A3D J;  2VOP A;  1MMG A;  4KMF A;  1ON1 A;  1KU9 A;  5LHI A;  3DBH B;  3AAF A;  5BPD A;  2AQE A;  2LFB A;  3BG9 A;  2VOO A;  2FMY A;  1VQP I;  3KP2 A;  1W0T A;  2RVC A;  1FSE A;  3HOX J;  1YRN A;  2EA2 A;  2MBF A;  2OJE D;  3GEZ A;  3TQN A;  2P6S A;  4IOA F;  1YJN I;  4I7H A;  3OWT A;  2OBP A;  2KIQ A;  1MGT A;  1OYI A;  2PMU A;  3H3U A;  1P9Q C;  4PUS A;  1KYW A;  2G7H A;  5HNF A;  4KIS A;  2CYY A;  4HLX A;  1ZGW A;  4L9N A;  5BOX A;  1J7K A;  4FT8 A;  3COA C;  1W36 C;  2CS3 A;  3MQ0 A;  3TED A;  2E1M B;  4FX0 A;  4PGH A;  3OYN A;  2HKX A;  1X1C A;  2K7L A;  4M3E A;  3KIO A;  1JT6 A;  3DPT A;  5BPI A;  3FXM A;  4N4N B;  3LNQ A;  1S72 I;  1S29 A;  5F0H A;  2YU3 A;  5L3E A;  2D2W A;  1FTZ A;  1I1S A;  3ZRG A;  1GXP A;  1J0R A;  3JRE A;  1V5G A;  3F8B A;  3TO6 A;  2RRE A;  4EM1 A;  4LG0 A;  3MKZ A;  2O9L A;  4D9J A;  1X58 A;  4AIJ A;  1VQ9 I;  5JVT A;  3FMQ A;  4XLE A;  3FHZ A;  2L02 A;  2E34 A;  1D5V A;  3VDX A;  2UV1 A;  2RQQ A;  2ZCW A;  3DV8 A;  4M3B A;  5GPA A;  2IGO A;  3J7Z I;  1BJZ A;  5E3O A;  2FF4 A;  4WX9 A;  3RZD J;  2IT0 A;  3GLL A;  4IHW A;  1U5T B;  2KQR A;  4ZJZ A;  1JHF A;  3F6V A;  3MZH A;  1EV7 A;  4JX6 A;  4RM2 A;  4AVZ A;  4EMS A;  4XK4 A;  3BR5 A;  2HOE A;  2LY2 A;  3O8H A;  3OL3 A;  2D5V A;  3DPL C;  3H36 A;  1A36 A;  4YFK F;  2R5Z A;  5D4S A;  3PM1 A;  1P7J A;  1WVR A;  1WWX A;  4I0A A;  3SDB A;  4AD9 A;  2WY8 Q;  5TJJ A;  2F5V A;  3DTE A;  2BGC A;  3NRV A;  4BL0 B;  1F9N A;  4C3J J;  3QPT A;  5IP9 J;  5DD8 A;  1LVA A;  2E7W A;  2VE9 A;  2JMW A;  2VLA A;  4F3Q A;  4HF2 A;  2CUZ A;  3E3V A;  1I6H J;  1IN7 A;  2L7K A;  5F1J A;  4G7O F;  4G6Q A;  5AON A;  2BXZ A;  3L2Q A;  3FIS A;  4B48 A;  3SQN A;  4BGD A;  1QO0 D;  4KMU X;  3IC7 A;  4IX7 A;  3SJM A;  2AS5 F;  5M5W J;  3WG7 H;  3HKZ A;  3B6C A;  1LUJ B;  2V9K A;  1B8I A;  2DN0 A;  1QPM A;  4LJZ F;  3F8C A;  2UZK A;  5E8I A;  3TW7 A;  3MZY A;  4IOC F;  4IL6 C;  1R23 A;  1ETW A;  2R7O A;  1R58 A;  4A0Y A;  4M6V A;  2ELK A;  1Y1W J;  2PN6 A;  2X85 A;  1UJ8 A;  2XUB A;  3D5R C;  3HYI A;  4NBQ A;  3W6K B;  4CH7 A;  5C44 J;  1O7F A;  3CCQ I;  4KA4 A;  2F4I A;  1T08 B;  4RGX A;  3MAJ A;  1ZR4 A;  1KYZ A;  4Q5S F;  2CUF A;  1MBF A;  2ZFW A;  3LFK A;  3GF2 A;  2WB1 A;  2Z9O A;  2ZSH B;  3DBR B;  1JHH A;  1R1V A;  5FFZ A;  3RDI A;  3TKY A;  3OYH A;  1RUO A;  1LQ1 A;  2JRT A;  2VB6 A;  1X2N A;  1ERD A;  3BLY A;  3G2B A;  3K1P A;  1MNM C;  5HLH A;  3I59 A;  4AYB A;  5LRS A;  3K0L A;  2KZG A;  1SAN A;  2A61 A;  4UVB A;  4R79 A;  3RQI A;  1D8K A;  1LDD A;  1UZC A;  3DCF A;  4ESF A;  3KEY A;  3T0Y A;  5BS6 A;  2EH3 A;  3KX2 A;  1W5T A;  3U1D A;  3K6G A;  1ZAO A;  4O5V A;  4BBS J;  1LVK A;  1FWZ A;  2FOW A;  2RNJ A;  4RAG A;  4XLF A;  5BMZ A;  2NOJ B;  2STW A;  4HNU A;  3KZZ A;  1O3Q A;  2EJR A;  5GP9 A;  2Z16 A;  3CJN A;  3PO3 J;  3C1D A;  3ISP A;  2KL4 A;  2FBK A;  3BPV A;  4IHV A;  3IV5 A;  3PUB A;  3CC2 I;  2BV6 A;  2R92 J;  5IT3 A;  1QNT A;  3ABT A;  2EB7 A;  2H8W A;  2L4A A;  2GZW A;  2QLZ A;  3DFG A;  4Q4Z F;  4L0Z B;  2E2J J;  3EDP A;  1IXS B;  1J5Y A;  4RGR A;  3Q9V A;  1W5C C;  3HBL A;  2W25 A;  4G9Y A;  1D5Y A;  2FA5 A;  2W82 A;  4EGY A;  1EKE A;  2R4G A;  2B63 J;  3IWF A;  3ZMT A;  2RC4 A;  1ETO A;  5DV5 A;  2MW8 A;  2QSG X;  2EFN A;  2KIS A;  2XSD C;  3QRF F;  1UG0 A;  1OCP A;  4BEH A;  4HRI A;  1L3L A;  3BCA A;  1HC8 A;  3Q0W A;  3Q0V A;  1VTN C;  4RGS A;  4A2U A;  3OY9 A;  3QPL A;  1NTC A;  4MHG A;  4N0B A;  2IEK A;  4E70 A;  2FML A;  3I54 A;  1RRJ A;  1F5T A;  2JVH A;  4FIS A;  4R1H A;  3GTG J;  3GX4 X;  4W1U A;  1D1C A;  3KYL A;  2DAO A;  2H09 A;  3EYY A;  1YQA A;  1IXC A;  2DMQ A;  4D7M A;  4Y52 J;  2K5C A;  2QSF X;  3ZQH A;  1XGM A;  2X1D A;  2DA4 A;  2J5P A;  3DLA A;  4B3X A;  4KFC A;  4I99 C;  1T39 A;  2ME0 A;  1XSX A;  5DCM B;  1WQ2 A;  4A0Z A;  1O57 A;  2NNY A;  3AKZ A;  3PFI A;  2PJR B;  2MA3 A;  4A69 C;  4YIF A;  3DTK A;  1UHW A;  3HEF A;  4RB2 C;  1X4P A;  2YS9 A;  2OZ6 A;  2XPU A;  4HG2 A;  2KZV A;  1SEU A;  5C4J J;  3CDI A;  4I0B A;  3OYG A;  4U7D A;  4A3E J;  1TWG J;  2HTJ A;  5LHH A;  3FZV A;  4E7S A;  1TWH J;  3JRH A;  4XM3 A;  1DDN A;  3N4M A;  1R71 A;  2R3S A;  3WG9 A;  1FZP B;  3GWZ A;  5CVI A;  3VPR A;  2HQA A;  2L7Z A;  1GDT A;  3M8J A;  1LFU P;  1JJ8 C;  2EIJ H;  2HVQ A;  1DGR M;  3GCM A;  3TDZ C;  3KEQ A;  5ICG A;  1T56 A;  4BY7 J;  2CH0 A;  4EAT A;  1Y0N A;  3S2W A;  3F0C A;  1B8I B;  3GTL J; 
#chains in the Genus database with same CATH homology
 1IC8 A;  2DA6 A;  3BTL A;  3HOY J;  4GFB A;  1ZQ3 P;  5EEA A;  4D5C A;  1Z77 A;  5EYR A;  1CQT A;  1FJL A;  1I50 J;  1ITY A;  5F04 A;  1JUP A;  4JP0 A;  3OSG A;  1BW6 A;  2DMU A;  2LTP A;  3LOC A;  3MN2 A;  1JKP C;  2ID6 A;  4BBR J;  1U8B A;  2DTZ A;  3L1P A;  2JWT A;  3MVP A;  1GT0 C;  4DYR A;  1MH3 A;  4G12 A;  5FKK A;  3H0G J;  1WH5 A;  1OJL A;  3G1M A;  4MLO A;  1H88 C;  4C3I J;  4A3M J;  1WI3 A;  3IH2 A;  5EGO A;  1BL0 A;  2QF7 A;  1RKT A;  2YU9 J;  3E7L A;  5FKO A;  1MBG A;  2G0E A;  5K7Z A;  5BNG A;  2FD5 A;  5IP7 J;  1AHD P;  3S1N J;  1GV5 A;  1TWC J;  2LKX A;  2LK2 A;  5J1R A;  5IPA A;  4M3F A;  1DU6 A;  2AO9 A;  2R5Y B;  4BY1 J;  3DEW A;  2QCO A;  1ZR2 A;  5IOZ A;  2HQ5 A;  3HOV J;  1XG1 A;  2LR8 A;  3HKZ N;  1OCT C;  3NAU A;  1RES A;  2CRG A;  3S15 J;  4AC0 A;  5M3M J;  4DZJ A;  1I3Q J;  3HGY A;  4ABZ A;  3ZQL A;  3HGG A;  1E3O C;  2M9H A;  4QTR A;  2TRT A;  2E2I J;  3JRC A;  5F08 A;  3UKG A;  2NVT J;  4A3B J;  2DA3 A;  5FKN A;  2ID3 A;  2O7O A;  1MH4 A;  2VPR A;  1QVT A;  1WCM J;  2COB A;  4A3K J;  2NVQ J;  2NVX J;  2HOS A;  3W6V A;  2M2E A;  1F36 A;  3IH3 A;  1X2M A;  3HOZ J;  3ZOB A;  2ECC A;  4IHY A;  1MBE A;  1GVD A;  1JTX A;  2HI3 A;  2EZI A;  4BKX A;  2Y9Y A;  2GM4 A;  1FEX A;  4I76 A;  1H89 C;  1FIA A;  3FIW A;  3S1M J;  2Y2Z A;  1APL C;  4B3A A;  3CDL A;  3ZQC A;  4EEF G;  1HF0 A;  2I10 A;  2CJJ A;  4D5F A;  4A3C J;  2PMZ N;  2JN6 A;  3S16 J;  1QPI A;  4DZP A;  1MSF C;  1UHS A;  1K83 J;  1MBK A;  1LE8 A;  3LSP A;  1B72 B;  1P7I A;  5JLW A;  2DMP A;  1WPK A;  2L0K A;  2L9R A;  5M5X J;  1IDY A;  2CQQ A;  1LE8 B;  2EBI A;  1IJW C;  1B72 A;  4UUT A;  1XS9 A;  4QIW N;  5M5Y J;  2P81 A;  3S1R J;  2CQX A;  4J19 A;  1NK3 P;  4A3F J;  4MIM A;  3S2D J;  4V2G A;  1FTT A;  4AYB N;  3MKL A;  1U78 A;  4A3J J;  2NS7 A;  2EZH A;  2JK3 A;  3HOU J;  1IUF A;  2XPV A;  2JA8 J;  4IEJ A;  4XRM A;  5E3L A;  2JA5 J;  1ENH A;  3BTJ A;  3S2H J;  3OSF A;  4QSH A;  1TWF J;  3M3Y J;  3PO2 J;  1MBJ A;  4JX5 A;  5EG0 A;  1H8A C;  3A03 A;  2R0Q C;  4FCY A;  3GTM J;  4A3L J;  3HOW J;  4A3I J;  1IGN A;  3G1O A;  1G2H A;  4JX4 A;  1TC3 C;  1RPW A;  3BTC A;  5FJ8 J;  2H8R A;  2LVS A;  2GBY A;  1Y1V J;  2WB1 N;  2X9D A;  4HNV A;  1HLV A;  2M8G X;  2XPW A;  4A3D J;  4IHX A;  1UMQ A;  5IYB J;  2LFB A;  3BG9 A;  3FKI J;  1W0T A;  1AKH A;  3I4N J;  3HOX J;  1YRN A;  3HM5 A;  3GBG A;  1U9N A;  1VF9 A;  1JGG A;  1F43 A;  5F27 A;  3CQZ J;  4RBO A;  2Y9Z A;  1YRN B;  4DYC A;  3WHC A;  2Y31 A;  3GTO J;  4UUS A;  5JLX A;  5F0F A;  1ZGW A;  1BA5 A;  4Y7N J;  4NDL A;  2DA7 A;  3TED A;  2VKE A;  1WH7 A;  3NAR A;  2FJ1 A;  3CMY A;  3RKQ A;  4X6A J;  4M3E A;  5EG0 B;  3BR1 A;  2DMN A;  2VI6 A;  1JT6 A;  2CU7 A;  2WV1 A;  3LNQ A;  5F0H A;  4MO7 A;  1FTZ A;  3JRE A;  1TWA J;  5FLM J;  2O9L A;  3BR2 A;  1X58 A;  3TP3 A;  3H3V K;  3JRF A;  1A6I A;  2HXI A;  4DYQ A;  1HDD C;  4C3H J;  2JA7 J;  1BW5 A;  4M3D A;  2KDZ A;  4FE7 A;  1IRZ A;  4DW6 A;  5E3N A;  4M3B A;  5GPA A;  3JRA A;  1BJZ A;  3CCY A;  5E3O A;  1AKH B;  2K40 A;  3RZD J;  4IHW A;  2DA2 A;  2MSY A;  2R5Z B;  2XB5 A;  4JX6 A;  4XID A;  2HOA A;  1SFO J;  1QVU A;  1JKO C;  4XK4 A;  3BR5 A;  5M3F J;  1RET A;  2IAI A;  2XB0 X;  2D5V A;  3O8H A;  1HOM A;  3JRD A;  4X1E A;  4W97 A;  2R5Z A;  5E3M A;  3RZO J;  3PM1 A;  1P7J A;  3K2A A;  1GV2 A;  1ORK A;  2HYJ A;  1JJ6 C;  3BR3 A;  2E2H J;  1U9O A;  2E19 A;  2M34 A;  4AUX A;  1Q1V A;  1GUU A;  3ZQI A;  3BQZ A;  1ETX A;  4C3J J;  3A01 B;  3TW6 A;  5IP9 J;  5K7H A;  1JKQ C;  1RKW A;  4V2F A;  1Z0X A;  2JMW A;  2HOT A;  1S7E A;  2K9S A;  1I6H J;  4XRS A;  1ETV A;  1MSE C;  2K9N A;  2W48 A;  2XGE A;  1WGX A;  5F1J A;  1QRY A;  2NS8 A;  5DS9 A;  3LSG A;  3FIS A;  2LP0 A;  2Y30 A;  2NVY J;  2Y0S N;  2L7F P;  3BR6 A;  3SJM A;  5M5W J;  3B6C A;  4MFD A;  1B8I A;  3GTJ J;  2DN0 A;  1EF4 A;  2HXO A;  2EZK A;  3FK6 A;  1PUF A;  1R9T J;  3TW7 A;  3OIO A;  4FE4 A;  2H1K A;  2OPT A;  1ETW A;  4B4C A;  3TP0 A;  4XRS G;  5HOD A;  4L5E A;  5FKL A;  3LSR A;  4M6V A;  2ELK A;  4MFE A;  1Y1W J;  4M3G A;  3BTI A;  3Q3S A;  3ZQG A;  5C44 J;  2XRL A;  1ZR4 A;  1RR7 A;  2CUF A;  1MBF A;  3O8G A;  3BQY A;  3LSJ A;  2WAQ N;  1T33 A;  2ECB A;  3A01 A;  2LLK A;  2K9Q A;  1LFB A;  1VFC A;  4I6Z A;  4BXX J;  1X2N A;  1NK2 P;  1XC5 A;  5IOY A;  2O8K A;  1MNM C;  4JYK A;  3QQA A;  4B1R A;  4XIC A;  5IYC J;  3JRG A;  2KT0 A;  1SAN A;  3RQI A;  3SFI A;  2R7Z J;  3DCF A;  4LOC A;  1UG2 A;  2HDD A;  2JJ7 A;  2EH3 A;  1JUM A;  4RDU A;  4BBS J;  5EZG A;  3A02 A;  5FLV A;  2R5Y A;  1PUF B;  3HB9 A;  2FQ4 A;  3HDD A;  1JUS A;  2DA5 A;  1DU0 A;  5GP9 A;  1O4X A;  3PO3 J;  1IV6 A;  2YUS A;  4IHV A;  3IV5 A;  2DJN A;  5IYD J;  3S1Q J;  2GLO A;  4A93 J;  2XGC A;  2R92 J;  5J1Y A;  5C3E J;  4A3G J;  3S17 J;  5IP6 A;  2IBD A;  1ZK8 A;  3B6A A;  3D1N I;  5GPC A;  4CYC B;  1JT0 A;  2E2J J;  1POG A;  5F0C A;  5EGO B;  4UUS B;  1VND A;  3JRB A;  5C4X J;  3HBL A;  2JA6 J;  1D5Y A;  4CYC A;  2B63 J;  3S14 J;  2X6O A;  1ETO A;  1HDP A;  2MW8 A;  2M0C A;  5J3L A;  5J1U A;  2XSD C;  1OCP A;  1W0U A;  3WHB A;  3Q0W A;  3Q0V A;  2AHQ A;  2ME6 A;  5EF6 A;  2L7M P;  3FK7 A;  3QPL A;  1NTC A;  2E1O A;  2IEK A;  1ETQ A;  1FIP A;  2TCT A;  4FIS A;  9ANT A;  3GTG J;  3IH4 A;  1IG7 A;  4W1U A;  5EZH A;  2ZB9 A;  2LD5 A;  4D7M A;  2DMQ A;  4Y52 J;  3ZQH A;  2DMT A;  3JR9 A;  4FTH A;  1ZKG A;  2DA4 A;  2EZL A;  4C2M J;  2ME0 A;  2NOG A;  3Q0U A;  2X48 A;  1JTY A;  1ETY A;  5FKM A;  4A69 C;  3C2B A;  1K61 A;  3HEF A;  2R93 J;  1AU7 A;  3BG5 A;  2YS9 A;  2CUE A;  2OF7 A;  2XPU A;  2RAE A;  2N8G A;  2XGD A;  3GTP J;  4S0H B;  2EQR A;  5C4J J;  2DA1 A;  3BG3 A;  2VUM J;  3M4O J;  3BT9 A;  4A3E J;  1ZTR A;  1TWG J;  2MG4 A;  5K7F A;  1TWH J;  4D7N A;  1ETK A;  3JRH A;  1MBH A;  3QPS A;  2VKV A;  3K7A J;  1JKR C;  1OFC X;  2FX0 A;  3VPR A;  3I4M J;  2L7Z A;  3SDG A;  1GDT A;  1LFU P;  1JJ8 C;  5DTD A;  2MGQ A;  3GTQ J;  2LY9 A;  3BR0 A;  3GTK J;  3G1L A;  3OOU A;  1T56 A;  1VI0 A;  4BY7 J;  1IDZ A;  3JRI A;  1A5J A;  3ZQF A;  5EDN A;  1HCR A;  3F0C A;  1B8I B;  3GTL J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...