4N4OB

Nitrosomonas europea hao soaked in nh2oh
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
53
Chain Sequence
b'SLAPISAKDMLDYLACKDKKPTDVVKSHTEVENGKIVRVKCGDIVALVQKARE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxylamine oxidoreductase
publication title Structural Basis of Biological NO Generation by Octaheme Oxidoreductases.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 9
structure length 53
sequence length 53
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2013-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4n4oB00
4FASD 4N4OB 4N4NB
chains in the Genus database with same CATH superfamily
3KZIC 4G12A 2R7QA 1K78B 2HKOA 1JE8A 1W4MA 1BIBA 1ZRCA 2KIMA 5H20A 4PSWA 1TP4A 2LF8A 4WCGA 4DNCA 2UXNA 1R6RA 2DPUA 1S7AA 2L7KA 3HUGA 5D5UB 1WJBA 3KP3A 2F5DA 3DEUA 1PUFB 3QYEA 1WH7A 1FYLA 2PMZA 1J75A 3D1NI 3M8JA 4KA4A 1K6OA 2UZKA 3MEXA 5FLMJ 2BVMA 3GLLA 1B72A 3K1PA 1H8AC 3SEQA 1SFEA 1R1UA 1JHFA 2VB6A 2DA5A 4IHWA 1FSHA 1WHUA 3HSFA 5EZHA 4U7DA 2V1DA 3J81Z 2IS2A 3CUQA 1XSDA 2HTSA 2QENA 4L18B 3S1MJ 2F6CA 4ZYGA 1J0RA 2QBYA 5K7ZA 1WJFA 3HEFA 2GIVA 2EPFA 3OYDA 3OL3A 3CD6I 3EQLF 1ZG3A 2PLYA 2F5CA 4X1EA 3UNGC 1YRNB 4KNYA 2VOOA 2PMHA 2UV1A 2FOKA 1V3FA 2VBWA 4HDUA 4OINF 4E6KG 1F4KA 3HDDA 1ZHFA 2F2EA 4G7OF 1GHCA 2ZJPF 4IRHA 1V5FA 1ZLJA 2QKMB 3QP6A 4OAYA 4UUTA 3T0YA 3BQZA 4EJVA 3I56I 2HYFA 2ZXWH 3MVPA 1JKOC 4FE7A 4KUMA 3I58A 4ESFA 2Y31A 1RETA 3A03A 4LLLA 3KLOA 3J80K 3OL4A 1RUOA 4UVBA 3R0AA 4PGHA 1BOBA 4X6AJ 3FM3A 1VFCA 5CQEA 3L09A 3TL4X 2M2EA 1NG7A 3PSFA 2ZNYA 3TW7A 3LSTA 4DJAA 4XBFA 1B72B 3PQJA 3HHHA 1HF0A 1A5JA 2PFBA 5C4XJ 1K61A 1E0EA 3OOPA 1U8RA 1D1BA 5FKLA 3T8RA 3ZMTA 4MEYF 3G4SI 1YITI 4I02A 4HZFA 1N75A 1Y8QB 3L2WA 4MLOA 3VYUB 2NVTJ 3CUQB 3OR2C 5IP7J 2G7UA 1TNSA 2M30A 1X1PA 1D8KA 4RAFA 2BEOA 4BY7J 1ON2A 3BT9A 3CO7C 2FF4A 1YJ9I 3CF2A 1FYMA 3I59A 4Y4RA 3V7SA 2XPVA 3DBLB 2QQBA 3CJRB 5KAFC 1K7AA 1ONVA 3N05A 1IF1A 2EILH 2HQNA 4LK1F 1ETVA 4DZPA 1I6XA 4EEFG 2DTZA 2DMQA 5J3LA 2ZMEA 5J1RA 1SVLA 1ZRFA 1JUPA 3P9KA 5B1BH 2E1CA 3HSRA 1IXSB 1OCZH 3SYTA 5M3FJ 2W7NA 3B6AA 3S17J 3HYIA 1NH3A 4QLCU 2Y0SA 3FXJA 2PN6A 4MO7A 2K27A 1Z6TA 2E2IJ 3S2DJ 3K4MA 2EIJH 4RAZA 2LBFA 3UKGA 5IT9Z 1UMQA 2KJBA 4NC8A 3TO7A 1ZG5A 1T39A 3MQ0A 1S5LC 1Z77A 3NAUA 1MDMA 3F0CA 2GQQA 3JR9A 2FBKA 3QODA 3NQOA 1J5YA 2YR2A 1OPCA 2HI3A 2MC4A 5FROA 1UAAA 5DUIA 5D8LB 4HA8A 2NOGA 5BNGA 5K7FA 1Q1HA 2W48A 4BDZA 3DLAA 4ASNA 2H6CA 4U0VA 3Q0WA 4ZDOA 2E7XA 3HXLA 1R5HA 5JHUA 2XPWA 5E79C 3ZOBA 4ZYDA 2DI3A 4M6VA 2WY8Q 3F8FA 5CVVA 1QQIA 3S32A 2ESHA 2K02A 4HX7A 4PSXA 1ETXA 2ZMEB 1JGGA 1B9MA 2B0LA 2OD5A 4D5FA 1TW2A 2UUZA 2E34A 3TO6A 4BKXA 4F55A 2A07F 1KA8A 5FKMA 4XOPA 2VASA 2ELHA 1BL0A 2G7HA 5IOZA 3WG9A 2FBHA 2CUJA 2V26A 2XF6A 2ZJ2A 1MSEC 3TOAA 4G6TB 4B4CA 4G7ZF 4HRIA 4UB8C 5D8KB 1MJAA 1QNTA 2EFNA 3Q0VA 5M3MJ 1MMDA 2A68F 4S04A 2ZJRF 3ABLH 3AAFA 4A3JJ 3BTLA 4EGZA 1W1WE 5KHDA 4D1QA 3EPZA 4UB6C 2QUFA 1JGSA 3CCUI 4EM2A 4L9JA 1R22A 3OIQA 2HWVA 1XGOA 1MBGA 3QAHA 9ANTA 3TOBA 2NNYA 4MFEA 2KT0A 2M4GA 3QRFF 3S3MA 1JT0A 3R0JA 3LSJA 4LB5A 1AA7A 1Z6RA 3OR1C 4HG2A 1MJBA 4B1RA 1X3UA 3PUFA 4RS8A 2CUFA 1NG6A 4RDUA 3TP3A 5ILUA 3WTSC 4J00A 2LG4A 3DFGA 3CDHA 4R79A 1N25A 3DBHB 3SDBA 2OTLI 1LEBA 3VB2A 3ONQA 4DYCA 2VIXA 2LVSA 4ZYAA 2DCEA 3NEUA 4LJZF 3L2RA 1SAXA 2WTEA 3QWLA 4ITVA 3K69A 1HKQA 3LSGA 2CQQA 3I64A 3K4BA 2KPMA 1I3AA 2EV0A 3KP2A 2HDCA 1VQ5I 2K85A 2CW7A 2L54A 3CMYA 1POGA 4LGWA 1SFXA 4E7KA 4QSHA 1WCMJ 1RR7A 5E20A 5F1JA 2MLGA 2XAJA 3AG3H 5KAIC 4DOZA 5E1WA 2X1DA 1YJNI 4IVNA 2YX7A 3L00A 3RQIA 2IA1A 1B59A 2KHMA 3PNVA 4HX4A 2BXZA 3OYAA 3RKXA 5HLTA 1XMXA 4L0YB 2E5NA 3D5LA 3FX3A 5DDGA 5ERIA 2HTJA 2M0CA 4NB5A 3WHCA 4KMUX 3K2AA 3WTXC 3PNTA 2GA1A 1U2WA 2NVUB 2HVSA 3BR2A 2AO9A 2H94A 2KMUA 2XAUA 4GO1A 3CCVI 3OMYA 5KNLA 2X51A 4ESJA 2H27A 2V1NA 3FXLA 5ICCA 5CQGA 4A3FJ 3L2UA 1QBJA 3NWTA 1T08B 1M1EB 3OYFA 4BDYA 2JRMA 3MZYA 3LSMA 3G1MA 1EKEA 3WGGA 2E1OA 2QF7A 3PJRA 1XCVA 3OYLA 1LE8A 2LC2A 2LKSA 2WBMA 4OAZA 1AOYA 1VQOI 2Y2ZA 1B9NA 2LTPA 3L7WA 1HCRA 2R7TA 4AIDA 3HZJA 3T1BA 4YFNF 5A2QZ 5BPIA 4L9VA 1XD7A 1YOVB 1J9IA 3MZHA 1LFBA 1JKPC 2M45A 2ZKZA 3D5RC 3BPXA 2WAEA 2G9WA 2JN6A 2HNHA 4ZTJA 1G3WA 3G73A 5FKNA 4DZJA 1YS7A 5LBQA 1HW1A 2D45A 1P4AA 1MH3A 2FOWA 1FBSA 1X2MA 3VFZA 3WTZA 5GAEJ 1MBJA 2BBYA 1BJZA 2W00A 3JRAA 1UHWA 5J4YA 2MH9A 3TP0A 2IA2A 1T0FA 3I4MJ 1WH5A 1H88C 4X0GA 3RQ4A 3QPHA 1X1DA 3HBLA 1KZHA 4A3IJ 4CHUA 4EM0B 4XL9A 1JKQC 3A2KA 2DFHA 2WAQA 1ERDA 1IDYA 3ERMA 3HOXJ 1U8BA 4LIVA 4OMZA 1LVAA 3ABKH 3GUDA 3SHFA 2E5ZA 1ZYRF 4A0ZA 1XMAA 4XKBA 5E18F 3RJPA 1ETKA 1QGPA 1R49A 5HDKA 1ETQA 4F7ZA 2H1LA 2NVYJ 1YJWI 5IYDJ 2DPDA 2BY1A 3WTYC 3K4NA 5JLXA 3U1DA 2XV4S 2CFOA 3CQZJ 5TJJA 3G1LA 3HOUJ 5E3NA 2A5WA 2J5OA 3BR1A 1FP1D 2HZDA 5F64A 3GFIA 2F4MB 3BTJA 4HOBA 5IY5H 1NTCA 4IF4A 4YFKF 3DPTA 2IGKA 3E5UA 5EGOB 2EBIA 3G71I 1O3QA 5F0FA 2HOTA 4AIKA 3BCBA 4AU7A 1ZGWA 2QVOA 2Z2SB 2GM4A 1LPQA 3I54A 4RLFA 5ICGA 4HX8A 4YG2F 5LLQA 1H0MA 4A2UA 2EA4A 3V42A 1B6AA 5AIQA 1TWFJ 2AQFA 1P7IA 3RPUD 1MIJA 5C4JJ 1VQ8I 1DU0A 1CGPA 1QPIA 2DU9A 3EYYA 2K7LA 5D6FA 2ID6A 3J80Z 2XROA 2E60A 2M3AA 4CH7A 2DMTA 1X1BA 2DK8A 1WJ5A 4I6ZA 2FQ4A 4JP0A 2PQ8A 1PDNC 3ROUA 3KEQA 2CW8A 3RZDJ 4BBSJ 2ZFWA 2BHZA 4EJTA 1FIAA 4M3GA 3HGGA 5IYBJ 4XRMA 1BC7C 2EH3A 3BZ6A 3W2WA 2DQLA 2R7SA 2VC1A 1UCRA 1R1TA 4LITA 4QWQA 4IHXA 3W3CA 3OYKA 3BG9A 4I2OA 4ZC3A 2YPRA 3R61A 5DCMA 3LWFA 1D8JA 3J7YJ 3ZMSA 2ELJA 4P9UA 3AKZA 3J7AY 1P7JA 1IUFA 4PZJA 1R5ID 3V8LA 1ZLKA 4UNOA 4BQNA 3F22A 4UUSA 4RGUA 1XX5A 1GVDA 3BJ6A 4M6YA 4PCQA 2VT3A 5GAGJ 3H3UA 1ZELA 4GYGA 2LRDA 1XDSA 3WODF 1R4MB 4BE0A 1PP7U 2EZIA 3TGNA 1AWCA 1LDKB 3DKWA 5LRSA 4MNUA 4G94A 4AM3A 4AC0A 3ZQHA 3JAMZ 1ACIA 3ZXSA 3BG7A 4JOMA 2DW4A 4P1WA 2FMLA 3AL0B 1LUJB 4N9IA 2D1VA 4OOIA 5EEAA 3CLOA 2PG4A 3HKZA 4LFUA 1Z91A 4ABZA 4G6QA 1IGNA 3GX4X 3ZQCA 3NARA 5IP9J 2GIZA 3C18A 3IAM2 1I50J 3V8JA 4JX4A 2W84A 1S29A 4Y13A 5DCMB 2IEKA 3A1YA 1OCRH 1U5TC 4EVIA 3LOCA 2K9QA 3OY9A 3M3YJ 3E6CC 1ULYA 3FF5A 3PFIA 2FBIA 2GAUA 5E3LA 2OAZA 4XLFA 3KPHA 3HRTA 4I99C 1FPQA 4WXHA 4EATA 1EF4A 1I1GA 2OA4A 3BJOA 2W24A 1WI9A 2QKLB 3BTIA 2EV6A 4L5JA 1USTA 1ODDA 3GTPJ 2FSWA 3FHNA 4QPQA 2GXGA 2KIUA 3U9GA 3I4PA 4ZYEA 3WG7H 4BE1A 4NQWB 4Q48A 1VZ0A 1G8XA 3K1NA 4HPQA 1XGSA 4IRGA 4JYKA 2EIMH 4ENMA 3DKYA 1KU3A 4KJZA 4P55A 4NHJA 1LQ1A 4ETSA 5IYCJ 1SC7A 2XSDC 3F21A 1T2KA 2O5RA 1MH4A 2MC3A 1HW2A 5EF6A 3E6MA 1WVRA 3QYFA 5JHFA 4G9YA 2JUCA 3O8HA 4CCKA 2Y69H 3BR5A 3ZQQA 4NC6A 2DQRA 5J40A 3J7ZI 3GTGJ 4DGWB 1S9HA 1X1AA 1YFHA 1LFPA 4BHPA 4DIQA 1PUFA 1XN7A 3IC7A 2OPTA 2Q2EA 4PJLA 4UVCA 4Y17A 2YSRA 3FHZA 2EZHA 2IP2A 2LF7A 4ZYHA 2V1UA 2D2WA 2F5FA 2X6OA 4XORA 2BV6A 3ZMVA 1YX5A 2CYYA 4CYCB 1BIAA 2YU3A 4LMYA 2NAZA 4E7ZA 1MMGA 5L3GA 4KISA 5HNHA 1IAWA 3VPRA 4RM3A 5GADJ 4U88A 1WRJA 1T6SA 3LFUA 4BHCA 3PQKA 1XDUA 4KIFA 1HC8A 3I0TA 3K9TA 4IHSA 5HS7A 3LQQA 2MD0A 3PM1A 5E8IA 2IA0A 2W25A 3HOZJ 1RNLA 1RKTA 1YRNA 4M6XA 3TDUC 5AIPA 1ZG1A 3SJMA 4MQ9F 1DUXC 1B1BA 4I09A 1W5TA 2JVHA 2LH9A 1F1ZA 3HC7A 3CCJI 2CUEA 2O8XA 4XK4A 2XAHA 1IO2A 1OJLA 4DYQA 1KONA 1TQPA 1ZN2A 5GTHC 1YO5C 3GO5A 1V4RA 4LD5A 3GBGA 1ZGAA 3L9FA 2D5VA 4M3FA 1HLVA 2JUGA 3IH4A 2DODA 1T33A 2Q2EB 3DTIA 4N9HA 3FMQA 2VJ5A 2ZSIB 3CCMI 1O3TA 1R5GA 3M07A 1DP7P 2EZKA 5L3FA 2V9KA 1FWZA 4I0AA 2LFBA 2JA6J 4XLEA 3TQNA 3RI4A 2H8RA 5E1ZB 3RZOJ 4G6DA 1X19A 3F23A 2CWEA 5ED4A 2IS1A 2VT2A 4RGXA 1KGSA 5B1AH 2Y9ZA 4CCJA 3F72A 3FMRA 5C3EJ 5J8CA 2X1CA 2HEOA 4LLGF 3S1QJ 3MAJA 1O57A 1IDZA 1V5GA 2O9LA 1TT5B 2HXOA 5GP9A 3ZQGA 4CICA 4IEJA 4S05A 2PMUA 3HOVJ 5D6EA 2Q8KA 3MKYB 4E7JA 1VQ6I 4HQMA 4A0XA 4KIBA 2IS6A 4QPOA 3WTUC 3DCFA 1UFMA 2L02A 2R7OA 4M74A 1IRGA 1DGRM 5GPCA 1YIOA 2DA6A 2VL8A 5TGTA 1WFXA 2A61A 1RPWA 2V9VA 1FY7A 3AL0C 2O0YA 3M7GA 3HHGA 1SMYF 4NC7A 3K70D 3S3OA 2CS3A 4EJUA 1MJ9A 2L9NA 5CVUA 4PGGA 3MCZA 5HLHA 3ABTA 2R7FA 4E7SA 5FB2A 2DFEA 2LREA 4QIWN 3VDXA 4M9ZA 2R93J 1LNWA 5FLXK 3C2GA 5TISC 2VQLA 4PJJA 1XMKA 2KISA 1F43A 1XTAA 4BEHA 2X6WA 4O6JA 4BJ6C 4HNTA 2BY3A 3OOUA 2JTVA 4UHTA 3GXOA 1IRFA 2WB1N 3A0HC 1FSEA 4BU2A 3PUBA 4BYYA 5K5RA 3IL2A 2BE5F 3K4LA 2BXYA 5FKKA 4DBRA 2P4WA 4PUSA 3LNQA 3KP6A 2XGDA 3TO9A 3V4GA 2VQCA 4D7MA 1ITYA 1S8NA 2L0KA 2L5QA 4E7HA 2V79A 4FT8A 1IRZA 1E3PA 1FIPA 3P5JA 1BR2A 2LSOA 4BHBA 3HOWJ 5HVQC 2EFQA 2DA7A 3PNYA 1R00A 2IRFG 5K7HA 2AS5F 4XRSG 3Q9SA 3CMEI 2FJ1A 2VODA 5J47A 1F9NA 1WQ2A 2CU7A 2OU2A 4E7IA 1R23A 5J1YA 4B09A 3MKLA 2HQ5A 2FX0A 3I3LA 4NDLA 1MW7A 3JRHA 1VTNC 3C3WA 4IO9F 2JPBA 3VSKA 3CTAA 2FNPA 3GMEA 2JWTA 5CJ9A 3RTRA 4AIHA 4DBQA 2I10A 3DXJF 4RAYA 4BEHB 3GCMA 4N4OB 3OYJA 4CZZA 1ETOA 2K9SA 1WGXA 3ABMH 3F8BA 3KFWX 5D5WB 1G4DA 2CO5A 1A6QA 1ETWA 2HPIA 2RNJA 4XSZF 3FXRA 2A05A 2DA2A 5EG0A 3H0DA 5E3MA 1ZK8A 1I3QJ 2JA7J 3BR3A 2X4HA 1QHGA 4GFBA 1HDDC 3CDLA 2BYVE 4IJAA 3OYGA 2CMPA 4FISA 4XLNF 1HXDA 3GZ5A 5B3SH 2L01A 4OU0A 4XN3A 4BNCA 2O8KA 2R7XA 2AXTC 5L3DA 3ZQIA 4E70A 4B44A 2YU9J 1BW6A 5GAHJ 2M9HA 2WAFA 3JRBA 4HSTA 2M87A 3W6VA 4MGRA 4PK4A 5JLWA 4A3EJ 4IQJA 2HFHA 2R7UA 4Y52J 1SVMA 1GXPA 4II3A 5FFZA 4UUVA 1G6NA 2M5WA 3JTHA 2KIQA 1SD4A 3KIOA 4HBLA 1DPRA 1G3YA 2DT5A 2JSCA 3JRCA 4CUGA 1GV2A 3S3NA 4IPAA 5H6QA 4BQOA 2NS7A 2O61A 4A0YA 3IH2A 1SD7A 2O6GE 3PO2J 1JJ8C 2TDXA 2EV5A 3HPGA 3D5SC 3K6GA 3F6VA 1RRJA 2HDDA 1U9OA 2MGQA 5EG0B 1O7FA 3E97A 4XKVA 3S2HJ 2I5UA 3FXMA 3P7NA 1DGWY 1FEXA 2ZBKA 4HW0A 2HVQA 1XSXA 1T8IA 2VQGA 5D5VB 5AONA 2Y75A 3L2QA 5JFRA 2R7ZJ 4ZH4F 2N8GA 2X6XA 4H4KC 4LG0A 1PVEA 3WU0A 3G6EI 2DOFA 4GDFA 4BBRJ 1SANA 2XVCA 1O3RA 3EUAA 1RIOH 4BL0B 4R1HA 2LNBA 3CUOA 5L3CA 2XGCA 4WXCA 2W82A 3HGYA 3BCAA 3MKZA 5J4VA 2MABA 3QQAA 2EK5A 3PIPF 4C2TA 2VBYA 4XLHA 3KZYA 1OCCH 5BPDA 1MNDA 1QRYA 2E19A 4Q4ZF 1FTTA 1UHMA 3E0JB 4Y15A 4IHVA 4XM3A 3FDYA 1SMTA 4LIUA 4BY1J 5F1RA 3ML6A 3ECHA 1ETYA 1HQCA 1FLIA 1X4PA 3FK6A 3CC2I 3G2BA 2QCOA 5J1UA 2PX9A 4B43A 4KT6A 5DUKA 1CF7A 3LMMA 4D9JA 1OLTA 3FIWA 2E1MC 1OR7C 5DD4A 2JQ7A 4LG0B 5HLIA 2X6YA 2HDWA 3K4JA 1JTYA 2JJ7A 4RGSA 3SFIA 2RDPA 2RVCA 2FD5A 2HKXA 2ZO4A 2CQKA 1LDJA 4NNJA 2K9NA 5DTDA 3OS0A 1TQMA 2CW0F 2WA0A 3LFKA 1GXQA 3IV5A 4XOTA 2ZXIA 5HLGA 1MBHA 3ZMZA 3H35A 1U5TB 5JI6A 1JHHA 1UZCA 2OCEA 4L5IA 1VQ7I 1IG7A 1MSFC 4MTEA 4C2UA 3H5RA 3B6CA 2YS9A 3C2BA 4OIRF 3IKTA 2H6BA 3DF8A 2A6TA 5CKTA 4HQEA 5JVTA 3J81K 3HOSA 1W7PD 3WTTC 1ZAOA 5LGNA 2AHQA 1USSA 2KFDA 1GVJA 3VODA 2CV2A 1TT0A 1BBYA 1D0XA 2V9PA 2RAEA 1R7JA 1ZKGA 5EGOA 1N78A 2DT7B 3Q5FA 4YEJA 3GFMA 1NK2P 1CF7B 3BDDA 4ZZLA 3AG1H 3I53A 1V54H 3M1CA 2KLOA 1IN4A 1HBXG 1O4XA 5F0CA 2KDZA 1YI2I 3RKYA 1WI3A 2RQPA 3L1PA 3DP7A 3K70C 3ZR8X 4FHTA 1IV6A 5LEKA 5HODA 4PJ0C 2HXIA 1SD6A 4A5NA 1E3HA 2ZXHA 1T98A 3SXYA 1WSUA 3KEYA 3PIOF 4ZTFA 1RI7A 3OYEA 2VJJA 2HGCA 2X48A 4ENJA 4I98B 4KITB 2L3DA 2BY2A 2HU9A 4KDPA 2JMWA 2L7ZA 2ZJQF 1O3SA 2IT0A 2X0LA 2A6HF 3ZQLA 1YS6A 4F93B 4UY8I 2FMYA 2Z3YA 3JW4A 3JRDA 3JCUC 1U6GA 1ON1A 1Z9CA 5D5XB 2DMPA 3OYNA 2RV8A 4A69C 3I5UA 1FOWA 1L3LA 4BXXJ 1BW5A 2RNGA 2XGXA 1MBKA 2YX4A 1APLC 2PJRA 2Y9YA 4HNUA 2VKVA 2Q1ZB 2OJED 4Y7NJ 1VQKI 1SD5A 2XB0X 3G3ZA 3WGIA 4XR6A 1U3EM 4ZJZA 4RMNA 4G8XA 1SFKA 1W7PB 1KQ8A 4A6DA 2LP0A 3PSIA 4LB6B 1Y1VJ 2EWNA 1J59A 4BAYA 3HG9A 1XSVA 4HV6A 4B47A 3JRGA 2M7AA 1VQ9I 2X9DA 5F08A 5DCFA 2P7CB 2K4BA 3EYIA 1SFUA 1MBEA 3E6DA 1EV7A 3F8MA 2ZB9A 1P92A 5M5YJ 5IT9K 4L5EA 4BXFA 4EGYA 2O03A 1D5YA 1YW8A 3TW6A 3BZKA 4P9FA 2Y0MA 2IW5A 2VPRA 1I27A 3ASNH 1Y56A 2NS0A 2ME6A 4CYDA 3LSRA 3RPUA 1N77A 2VONA 1NK3P 2QQAA 3JRIA 5E17F 2NS8A 2EQRA 1KQ0A 1TW3A 2EIKH 1X2NA 5K1YA 2PI0A 2XSJC 3MN2A 3KYLA 2ECCA 1BI3A 1IZ1A 3FK7A 3HRMA 2FNAA 5EJCA 1Z67A 1RC9A 1UB9A 3CMMA 2CV1A 4AD9A 4DW6A 3JTGA 2PJRB 3TDZC 2QSFX 5TRDA 1XG1A 3GZ6A 1VQ4I 1ZRDA 3WE3A 2M0MA 4JBAA 5IOYA 1Y1WJ 3W2VA 2FA5A 1HOMA 4HYEA 3FBIB 2X85A 2ESNA 2JZYA 4S0HB 2CFXA 5LD2C 1J7KA 3SFZA 2R7RA 2ZSHB 2JT1A 5HDNA 2L9SA 4W1UA 1Y39A 3CF5F 2MW8A 1Y0UA 3RCOA 3KP4A 4ZZDA 4ENKA 3U21A 3K0LA 2JPCA 1HKSA 4WK8F 1I5ZA 2R7DA 2R0QC 3BJAA 4NQWA 4IZZA 1P4XA 4F91B 3GTOJ 2FUG2 2ISYA 3HOYJ 4II2A 3BOQA 3FBNB 2Z33A 4U0WA 2LKXA 1BI2A 2CSOA 3CJTB 3E7LA 4E7LA 2V6EA 1STZA 1ZREA 3H5AA 4U7BA 4V2GA 1WKMA 4CCNA 2NNNA 4LOCA 2K86A 1R4NB 1WPKA 3C7JA 3ZCOA 1FX7A 4RLQA 3V7RA 4EJOA 4LLNA 2F4IA 4AYBN 1VQLI 2Y30A 4ZDLA 1QVUA 3KX2A 4C3JJ 2GLOA 1EH7A 3CC7I 5DD8A 1D5VA 5FD5A 2Z9OA 2CJJA 5DEQA 1W0UA 2ZNZA 2B7EA 4CO8A 1LJ9A 2EFOA 2IGMA 3RDIA 1QZZA 3CCQI 4BH9A 2R5YB 2MYSA 1GUUA 1R9TJ 3M4OJ 1BR1A 3IKVA 3GFLA 4XMYA 5HDGA 5ICEA 5DV5A 3S1RJ 4CYCA 3CDIA 2VLAA 1MMAA 1LVKA 3LA3A 3DEWA 4WX9A 3I55I 3IAS2 4HF1A 1H89C 3SZTA 2MLKA 5EZGA 5J6XA 1G2HA 1OCOH 2IVMA 2JA2A 5LGTA 2Z99A 3KE2A 2NOJB 3K10A 4UV8A 3HL2A 1Y0NA 5BQTA 2M34A 3H0GJ 2PBIA 2HQRA 3CC4I 1G3SA 1ZTRA 2CUZA 4MFDA 4YIIA 3FXUA 4M71A 1OISA 4EMSA 2L4MA 1W36C 1R1VA 3A02A 1U9NA 2BY0A 2E71A 2BGCA 2YUSA 3GWZA 3LSHA 4BXUA 3OIOA 2IGOA 2XASA 5KCMA 2LKPA 1JTXA 3SQNA 4KYWA 3ELKA 3BR6A 3W6KB 3L2CA 1E3OC 3MWMA 5KVRA 2E2HJ 5KK1A 1XPXA 2DN0A 3GW2A 5GPAA 4IXAA 2CG4A 1D0ZA 2KRCA 3KYDB 2P6TA 2NVXJ 1RUNA 2WV1A 4XN0A 4BGDA 4BJ5C 3OYIA 5JVGF 2E7WA 3LAPA 1VQPI 2IXSA 3QU6A 2QEXI 1VQNI 1FMWA 1Z1DA 2LK2A 3GVAA 3O3KA 2VN2A 4I7HA 2ISZA 2P7VB 3KZZA 4JQFA 2VJ4A 2OTJI 4WF2A 4PJNA 4W97A 4BUPA 2AQEA 2HS5A 1FBUA 4J01A 3CZ6A 2HOAA 3KYCB 1C0WA 1VQMI 3VYTB 4O3MA 1UJ8A 5H6RA 1BI1A 1XCBA 5DM7F 5CPRB 4F92B 4C30A 5BS6A 1D1AA 3FKJA 1KU2A 3KLNA 4HAMA 2W4SA 3A4CA 1D1CA 5J8FA 2WB1A 2Z1DA 1HA8A 4C3HJ 4MHGA 3H3VK 2HOEA 1IN6A 5CLSA 3T5XA 1P2FA 3HOTA 4CA0A 2COBA 2OZ6A 2XKOA 4Z6YA 3E5QA 2R7WA 1PYVA 4PFOA 4ON0A 4CDGA 4E4HA 3DPLC 4LK0F 1T38A 2DA1A 1OR7A 4D0PA 4OWRB 4PFPA 3NWSA 1TNTA 2L2OA 2W1OA 2KZVA 3SZPA 2ADUA 4FQGA 2VPLA 2XAGA 1KU9A 2A3SA 2M4KA 3PL8A 1ZR2A 3I71A 4CXFA 1PJRA 1FP2A 2KRHA 4MQVA 2ELKA 4RB1A 3N97A 3S14J 1YTYA 2OZUA 1B4AA 3HIFA 1Z7LA 1X1CA 2RC4A 2DJNA 1Z3XA 1OYWA 4D5CA 3WTWC 2DMUA 3DWLE 3RSNA 2QYOA 3K7AJ 2JA8J 1YYVA 2ECBA 3GEZA 1K4SA 1MBFA 3WTVC 4A3MJ 2ACJA 4KN4X 4KMFA 3VEPA 2A69F 2QLZA 2XPUA 1FNNA 3NRVA 1TLHB 5E8GA 2RGVA 1DDNA 5DM6F 3MMYB 4AWXB 3DPUA 2L4AA 3Q3SA 3CLQA 1OYIA 5FFXA 3VWBA 3H92A 4HV5A 3PFYA 4HDVA 1WJEA 2V1XA 1S7OA 2F5EA 3LA2A 3I9V2 5FD6A 3CCLI 5M5XJ 2E1MB 3K4CA 4CCLA 3TBIA 3Q9VA 1JT6A 2F5VA 3MZ8A 2LD5A 3HUGB 3TKYA 3R60A 1L0OC 2FEZA 1SVOA 2WC2A 2DFIA 2EFPA 3VSLA 4Q5SF 1GV5A 2V4JC 5ICFA 3FKIJ 4C3IJ 1BC8C 5FGMA 5B5EC 2K9MA 1VF9A 4XSXF 2Z16A 3BROA 3S1NJ 3F6OA 3IHUA 4QTRA 2K40A 2VKDA 3DTEA 2V7FA 2MH2A 2GBYA 1IJWC 4C9YA 3D0SA 3S8PA 3FZVA 2JSPA 3ZRGA 2J5PA 4JX5A 3DLLF 2XF7A 3COAC 2QGUA 4NUBA 4KT5C 2QBYB 2XAFA 2G0EA 2DAOA 3FM5A 3B02A 4JK1X 1PUEE 2WV0A 1X3WB 1ZGJA 2K9LA 5LEJA 2DJIA 4DYRA 2PEXA 4EV0A 5CVJA 3LSPA 2DFFA 2MA3A 2P0WA 2X1EA 2LR8A 3WU1B 1ZH5A 2XKPA 4A3CJ 3BLYA 5CVRA 2PMZN 2XIGA 1OYYA 4M72A 4IRIA 1OFCX 2LLKA 2H8WA 1K4TA 1Y8RB 1G59A 2IS4A 1EH8A 1T56A 4GGGA 3DU6A 1UHSA 3R4KA 5F0HA 1V5EA 3JAMK 4YELA 2EFWA 4U0YA 3LSKA 1BI0A 3OWTA 2CV0A 2M8GX 2F4OB 4HSRA 4A3DJ 1FYKA 2XRNA 2R7VA 1FOXA 3O6BB 5E3OA 1MMSA 1A6IA 3AG2H 1AKHA 3OSGA 3ZQ7A 1RR8C 2EB7A 5FJ8J 1MGTA 4N0BA 3KP7A 3TMOA 1EA3A 3A0BC 5DYMA 4A93J 4IOCF 4BJTA 1IW7F 4XNFA 3U2RA 2L7FP 1REPC 3JSPA 1SFOJ 3BY6A 5HS9A 2CQNA 1O7LA 2EJRA 2FU4A 2Z5UA 3WGHA 4FASD 1FMVA 2IAIA 3I59B 5K5OA 2ETHA 2M7BA 2K4JA 3BR0A 4XLAA 1TWCJ 1F5TA 3GTKJ 3UR3C 1KQ9A 2IPQX 4IHTA 4NBQA 2KZGA 2ZXJA 4WXDA 2HR3A 1CQTA 3E1SA 2UXXA 2JK3A 4D7NA 3A01A 2QM3A 2HPMA 3RKQA 3DU5A 4A3BJ 1FT9A 3ZN0A 3EUHC 4KFCA 1YIJI 2BZTA 3H9GA 3E6BA 3HRSA 1WJCA 2LBFB 2CRGA 2I8DA 1E2XA 1HSTA 2CGPA 5F04A 2XC7A 1D3YA 1AKHB 2WY7Q 2BW3A 1MDMB 2LY2A 4HLYA 1IXCA 4I01A 2RQQA 5DS9A 1T95A 2EZLA 3P9IA 4A5MA 3KCCA 3VYSB 4XLPF 1TQIA 2KL4A 2KRFA 3ABUA 3IP4B 2FXAA 4DQ2A 1P4WA 3ERED 2HOSA 3CO6C 4Y3OA 5LGUA 2GXBA 3JRFA 3HSEA 4Z2YA 2NYXA 3AFHA 5IPAA 2NVQJ 4P5OA 2ZC2A 2Y0SN 2C6YA 2BVLA 1U5TA 3A01B 1AHDP 3BG6A 2AXLA 1JKRC 5FKOA 3CMAI 1I6HJ 2IGNA 2OQRA 2GOXB 1P9QC 3QU3A 5ILSA 2WWYA 3OYHA 3RYPA 3S2WA 4XQFA 1X3ZB 4KIGA 1FC3A 4H0EA 3R6SA 3IRRA 3V7CA 2BOLA 1W5CC 2EA2A 1EJ9A 3OSFA 4B8XA 1FZPB 1R58A 2QSGX 2BW3B 4XRSA 1Q1VA 1X4OA 1W36D 3OYBA 3RYRA 3LAJA 2OCCH 5LFAA 5FO5A 1QZEA 2VKEA 4RA2A 5EEGA 2QA4I 3SDGA 4FE4A 3MD2A 3LA7A 1W5SA 4K2EA 3JSOA 2M8EA 3HPHA 4I0BA 2Y48A 5B66C 1G3TA 3M1EA 3SEZA 5ILVA 2VBXA 1RKWA 1TZLA 3GTLJ 2RREA 2P8TA 3PO3J 5HOOA 2KQRA 4U87A 1JJ6C 3LL7A 2DO7A 2E2JJ 2HQAA 4B48A 2R4GA 1H9GA 1WJDA 4AUXA 2GOMA 2VE9A 5FLVA 2P81A 1IN8A 4IHYA 1WZ2A 2NRAC 1UG2A 2DK5A 2OBPA 3CJNA 5GTIC 2V6CA 2VBZA 3MKWB 1DPUA 3GTQJ 2STTA 4AIJA 2P5VA 1JI8A 3CCYA 2JA5J 2VXDA 3CUQC 2E36A 3GFJA 1JUMA 2EINH 1V55H 3P9CA 2CQXA 2DYSH 3ESWB 3G1OA 3MFKA 1S7EA 5HS8A 1BOAA 4C2MJ 4XRFA 3QYBA 4UV9A 3KEOA 2MFZA 5JR3A 3HRUA 3IRQA 4RAGA 2H09A 3WHBA 3N4MA 4R8HA 3CESA 3QP5A 3H9QA 3OV8A 4OMYA 1HSJA 2LY1A 2DT6A 5LHGA 1YE9A 1QO0D 1XB4A 3RPQA 1YLFA 5F27A 2L9VA 2E35A 2QZ8A 2LMDA 2DXIA 3HTSB 3LSIA 2FRHA 1DU6A 1W7PA 4O5VA 2XRLA 4L9TA 2H1KA 5H2FC 3CP8A 2D1HA 1ZQ3P 2PJPA 1WWXA 4CSWA 2KKOA 1IXRC 1I39A 4YFXF 3EETA 3GF2A 1WJAA 3GTMJ 1A35A 3OYCA 2Q0OA 3BC8A 3QPLA 3FISA 1IC8A 3H5NA 2GWRA 1H9TA 3S15J 5F6FA 2MG4A 4EM1A 4BE2A 4PDKA 1FBQA 3CCSI 3KETA 1BA5A 3WU2C 4WWCA 3ZN1A 3C1DA 2NXNB 4A6EA 1XS9A 1YX3A 3FXQA 5EYRA 4F52A 4A3LJ 2K5CA 1LFUP 1TWGJ 3OS2A 2DLLA 5BOXA 3RIRA 3BZCA 3ULQB 4CCMA 4RB2C 2VI6A 3ISPA 5IT3A 1FJLA 3F3XA 1D0YA 2XGEA 2ICWG 3FWEA 4B3AA 2TRTA 2CQ7A 2DOAA 4HF0A 3V8KA 2ZMEC 1LE8B 5FRMA 1TWAJ 2DYRH 4GXOA 3Q0UA 1OKRA 4XIDA 3CCRI 1ZARA 1LEAA 4AYBA 2CH0A 3IH3A 2QQ9A 3REOA 2A6EF 3L2VA 3H1CA 1OMIA 4FX4A 3HM5A 3GLXA 1LDDA 3ZMUA 3F8NA 2RN7A 1ENHA 5HNFA 4BACA 3K2ZA 2HVRA 1YQAA 4XKCA 2MSYA 3O2PE 2F48A 1S3JA 4M3BA 1GLNA 3TEDA 1XGNA 1LKXA 1RESA 2ME0A 5M5WJ 4YIFA 1MNMC 3BP8A 1P6RA 4HEA2 1FOKA 4L9NA 1U78A 4GRIA 4ZDPA 4HF2A 4KN7X 2P5KA 4F3QA 1Z05A 5FLXZ 4FX0A 4A3KJ 1RZ4A 1R36A 3RKWA 1PP8F 3DQVC 4GCVA 3I4NJ 1BN5A 3BQYA 1IN5A 1Y6IA 2JRTA 4BS9A 1GT0C 1BR4A 2A5YB 3F8CA 4TV7A 2VC0A 3DV8A 4UVAA 4FETA 4Q47A 2W85A 3S16J 5IP6A 2L9RA 4A12A 2P6SA 2K3PA 3ASOH 3AG4H 4IX7A 2R5ZA 2E1NA 5K5QA 4M9SA 4IKFA 3K4KA 2XAQA 2L7MP 3DBRB 3U1KA 1MMNA 2OQGA 1AU7A 1QVTA 2ZCWA 1MNEA 2JVGA 4ENNA 2R5YA 1B8IA 1Z21A 3FXOA 3X2QH 1E17A 3W2AA 1I1SA 5C44J 2WAQN 2FQ3A 3O8GA 4HLXA 1TWHJ 1QHHD 2WADA 2STWA 2OC6A 2XF5A 4A3GJ 2GZWA 4MIMA 2RKHA 3ZQFA 3F9KA 2MBFA 2QWWA 3OYMA 1MKMA 3T8TA 2VXZA 4OIPF 2DDAA 5LHIA 4IOAF 2COMA 2OUMA 4CCOA 4OIOF 3FMSA 4B3XA 3BG3A 4IQ4A 5EDNA 1HKTA 5E1XA 4RB3C 4XKWA 4FCYA 1U0JA 1S72I 3C2HA 4AVZA 3CP2A 4BQAA 1R71A 3ZPLA 2DDBA 4XLCA 3E3VA 2HYJA 4XONA 1KYZA 2DTRA 1QA6A 4CZCA 4EJWA 3ZGKA 4CGZA 1IUYA 4M73A 3EDPA 2P5LC 2XB5A 2R5ZB 1YHQI 2B63J 5CYVA 1FTZA 3ECOA 3EUKL 5LRRA 2UWMA 1SAUA 4I76A 2LDUA 1B8IB 4N4NB 1K79A 1TTYA 1XC5A 1F36A 4P96A 1KYWA 1W0TA 1ORKA 4UXNA 1TBXA 2VKHA 1KU7A 3H9JA 2LY9A 2GA2A 3QOPA 1BJAA 1IRXA 3ZMDA 1S6LA 4YIRX 4UUSB 2O3FA 3IWZA 4EQQA 3CCEI 1UELB 1JUSA 5FRNA 2DOEA 3VYRB 2XDVA 3HTUA 5CVIA 4KICA 2TCTA 1J09A 1YW9A 1DP3A 2QSHX 2DA3A 1GDTA 4PJMA 1ZR4A 3DKXA 4M3EA 1K83J 3W6JB 3JREA 1XGMA 1NHAA 2DA4A 4L0ZB 3CJQB 1Z0XA 1Z3YA 2KDOA 1EH6A 1YW7A 1MD0A 4GYIA 1BM9A 4HNVA 4V19K 1VNDA 1UG0A 3DTKA 4FTHA 4Y33A 3IWFA 4LG3A 1A36A 2VQHA 3EUHA 4RBOA 3S93A 4AVPA 3DEEA 1OCPA 4J19A 3B73A 4JX6A 3HB9A 3KP5A 6PAXA 3M8FA 2VE8A 1OCTC 2OF7A 3QPTA 2VUMJ 5L3EA 3OS1A 1IN7A 1JXSA 3M9AA 1HDPA 4V2FA 3BWGA 1TL8A 2HZTA 2QQ8A 3BG5A 1DQUA 3QOEA 2K3FA 2B9SA 1A04A 3VOEA 4XICA 4G7HF 1K78A 3J7AO 2IJLA 2ZFUA 4OIQF 3LQRA 5EEHA 2DMNA 4M9XA 2FE3A 4MTDA 2OV7A 5D4RA 2KJCA 4YRVA 1HW5A 2LYCA 3BTCA 3IUOA 1QPMA 1A31A 3GZNB 4ESBA 2DBBA 3ZP5A 1LB2A 3OIPA 1J2XA 4RM2A 2HYGD 5D4SA 2KP6A 3K1MA 3QPSA 1SEUA 3GTJJ 2M1BA 4BQQA 2IBDA 2GXAA 2VJIA 3HKZN 2W57A 1OQYA 3WE2A 2ID3A 1YG2A 1QU3A 1VI0A 1K6YA 2R3SA 1IV8A 3BPVA 1Z7UA 3HJEA 5A2QK 2R92J 2KIFA 4MEXF 2O7OA 1FOYA 1X58A 3M8EA 4RB0A 1MZBA 2MD5A 1QZYA 4ANJA 1T0FC 3H3ZA 3SZGA 3E5XA 2XUBA 5BMZA 3GYHX 4RGRA 4IL6C 2VOPA 5LHHA 3H36A 1TC3C 2LOOA 2BHYA 3FXKA 4M3DA 2XHKA 5L3BA
chains in the Genus database with same CATH topology
2R7QA 3HOSA 1LDKB 4PSWA 3ZXSA 3BG7A 4JOMA 4FASD 1R6RA 2L7KA 2CV2A 1FMVA 1WJBA 4P1WA 1TT0A 3QYEA 1D0XA 3AL0B 2M7BA 1N78A 4XLAA 2DT7B 2PMZA 4YEJA 3UR3C 3M8JA 3HKZA 2BVMA 3M1CA 2KLOA 3E1SA 2HPMA 3K70C 3SEQA 3ZR8X 3DU5A 2VB6A 3IAM2 3EUHC 2IS2A 2ZXHA 3H9GA 3KEYA 4ZTFA 3A1YA 3OYEA 1WJCA 2VJJA 2LBFB 2F6CA 2I8DA 3OY9A 1WJFA 4KITB 2XC7A 2WY7Q 2BW3A 3OYDA 2HU9A 3OL3A 2LY2A 3UNGC 4XLFA 2RQQA 1T95A 2UV1A 4E6KG 4EATA 4F93B 2QKLB 1V5FA 2QKMB 3VYSB 4OAYA 3OYNA 4QPQA 3FHNA 2KL4A 3IP4B 4BE1A 4NQWB 2RNGA 3OL4A 1VZ0A 1G8XA 4HPQA 1BOBA 4Y3OA 5CQEA 2PJRA 3TL4X 3DKYA 4KJZA 1NG7A 4HNUA 3AFHA 3PSFA 2Q1ZB 4P5OA 4DJAA 2BVLA 4XR6A 4ZJZA 3BG6A 4RMNA 1E0EA 1SFKA 1D1BA 2O5RA 3PSIA 2IGNA 2GOXB 1P9QC 3QYFA 3HG9A 4B47A 3OYHA 1N75A 2M7AA 4XQFA 5JHFA 4MLOA 3VYUB 3L2WA 3OR2C 4CCKA 2BOLA 3ZQQA 4DGWB 1S9HA 1X1AA 2BW3B 3CF2A 1X4OA 1LFPA 4Y4RA 4DIQA 3OYBA 1W36D 4BXFA 4PJLA 3CJRB 5LFAA 3N05A 3MD2A 1Y56A 3HPHA 1N77A 4XORA 1YX5A 3SEZA 1TZLA 2RREA 2XSJC 5HOOA 2KQRA 4U87A 3KYLA 4E7ZA 1MMGA 3LL7A 3SYTA 5HNHA 4KISA 2W7NA 3CMMA 4RM3A 2HQAA 2Y0SA 2CV1A 4B48A 2PJRB 3LFUA 2R4GA 1WJDA 3K4MA 2GOMA 2LBFA 2M0MA 3W2VA 2MD0A 4NC8A 3MKWB 3FBIB 2X85A 5LD2C 1JI8A 3QODA 2R7RA 2VXDA 2ZSHB 2JVHA 2LH9A 3HC7A 2L9SA 2MC4A 5FROA 1UAAA 1KONA 3RCOA 3U21A 3GBGA 4BDZA 3DLAA 3QYBA 2MFZA 4IZZA 4ZDOA 4F91B 2JUGA 3CESA 2FUG2 3HXLA 2Q2EB 3DTIA 2VJ5A 2ZSIB 3H9QA 4II2A 3FBNB 2V9KA 4E7LA 2LY1A 2DT6A 4XLEA 1YE9A 2V6EA 2WY8Q 3H5AA 3S32A 4U7BA 1X19A 2DXIA 3LSIA 4PSXA 4CCNA 2IS1A 2UUZA 4CCJA 3CP8A 3ZCOA 4CSWA 4F55A 4RLQA 2X1CA 2F4IA 4XOPA 2VASA 4ZDLA 1V5GA 3KX2A 1WJAA 2CUJA 2V26A 2XF6A 4G6TB 3OYCA 3BC8A 3MKYB 4E7JA 4HRIA 2IS6A 4QPOA 3H5NA 2R7OA 1DGRM 4BE2A 2IGMA 1MMDA 2MYSA 1BR1A 1YX3A 2VL8A 5TGTA 1WFXA 4F52A 4XMYA 5KHDA 4D1QA 2K5CA 3EPZA 3AL0C 3OS2A 2VLAA 1MMAA 1LVKA 4CCMA 4NC7A 3IAS2 3OIQA 3K70D 3S3OA 2CS3A 2L9NA 1D0YA 2JA2A 2M4GA 2NOJB 3K10A 3S3MA 2DOAA 3HL2A 4E7SA 1AA7A 5FRMA 3OR1C 4HG2A 2CUZA 2LREA 3VDXA 4AYBA 1NG6A 1W36C 2CH0A 3L2VA 4J00A 2LG4A 4R79A 3C2GA 2VQLA 3SDBA 4PJJA 3LSHA 2IGOA 4BEHA 2X6WA 5KCMA 3ONQA 4BJ6C 5HNFA 4BACA 4HNTA 2VIXA 4ZYAA 3OOUA 2HVRA 2DCEA 4XKCA 3L2RA 1GLNA 4BU2A 3PUBA 1LKXA 4ITVA 3K4LA 4DBRA 1D0ZA 2KRCA 4PUSA 3LSGA 3K4BA 2KPMA 2VQCA 4HEA2 4GRIA 4ZDPA 4F3QA 2L5QA 4XN0A 4BJ5C 4BGDA 3OYIA 4E7HA 2CW7A 2IXSA 1BR2A 3DQVC 5HVQC 1FMWA 4E7KA 3PNYA 1Y6IA 4BS9A 1BR4A 4JQFA 4DOZA 2VJ4A 2X1DA 4FETA 4PJNA 4BUPA 2AQEA 4E7IA 2KHMA 3PNVA 3OYAA 4J01A 3CZ6A 5HLTA 2K3PA 3I3LA 1MW7A 4IX7A 2E5NA 3VYTB 3D5LA 5CPRB 4F92B 3VSKA 4C30A 4IKFA 3K4KA 1D1AA 3FKJA 3PNTA 3RTRA 1MMNA 4DBQA 2HVSA 1MNEA 2JVGA 2W4SA 3A4CA 2KMUA 1D1CA 2XAUA 4BEHB 2WB1A 2Z1DA 1Z21A 1HA8A 3OMYA 5KNLA 2X51A 4N4OB 2V1NA 3OYJA 3W2AA 5CQGA 2HPIA 3L2UA 3NWTA 4BDYA 3OYFA 1QHHD 2WADA 2OC6A 3HOTA 4CA0A 2XF5A 3LSMA 3H0DA 2R7WA 3PJRA 3F9KA 1PYVA 1QHGA 3OYMA 3OYLA 2LC2A 4PFOA 2WBMA 2VXZA 4OAZA 3OYGA 2R7TA 4E4HA 2CMPA 3DPLC 2OUMA 4OWRB 4CCOA 4PFPA 3NWSA 4B3XA 2L2OA 4IQ4A 2W1OA 2KZVA 4XN3A 2R7XA 2VPLA 4XKWA 3D5RC 1U0JA 2WAEA 2M4KA 3C2HA 3PL8A 4AVZA 3CP2A 2HNHA 4B44A 4ZTJA 4XLCA 4XONA 2WAFA 1PJRA 2KRHA 4HSTA 4CZCA 3ZGKA 2W00A 1Z7LA 4PK4A 4IQJA 2R7UA 1X1CA 4II3A 1Z3XA 3EUKL 2UWMA 3DWLE 3RSNA 1SAUA 4X0GA 3RQ4A 1X1DA 3S3NA 4CUGA 4XL9A 3A2KA 4N4NB 4BQOA 2WAQA 1ERDA 4LIVA 2VKHA 2E5ZA 3H9JA 3HPGA 3D5SC 4XKBA 3K6GA 3MMYB 3DPUA 1IRXA 4XKVA 3VWBA 1UELB 5FRNA 1DGWY 3VYRB 2XDVA 2HVQA 3K4NA 1J09A 3PFYA 1DP3A 1WJEA 2VQGA 2CFOA 4PJMA 3I9V2 3DKXA 3L2QA 2A5WA 2E1MB 2X6XA 3K4CA 4H4KC 2HZDA 1Z3YA 3CJQB 4CCLA 3TBIA 2KDOA 2F5VA 3HUGB 3EUAA 3DPTA 2IGKA 1UG0A 3DTKA 4BL0B 4Y33A 4LG3A 3VSLA 2VQHA 2V4JC 3S93A 2W82A 3DEEA 2K9MA 3BCAA 3MKZA 3BCBA 2MABA 4AU7A 4C2TA 2Z16A 2Z2SB 4XLHA 4RLFA 2VKDA 3OS1A 3DTEA 2V7FA 1MNDA 3V42A 4C9YA 2AQFA 3S8PA 1DQUA 3QOEA 3E0JB 3RPUD 4XM3A 3FDYA 2JSPA 4LIUA 3ZRGA 2XF7A 2ZFUA 4NUBA 1X4PA 2E60A 2OV7A 2M3AA 4CH7A 4YRVA 1X1BA 3G2BA 2LYCA 2K9LA 3IUOA 1WJ5A 2DJIA 3OIPA 4B43A 4RM2A 4KT6A 2KP6A 2CW8A 3LMMA 5CKTA 4D9JA 1OLTA 2P0WA 2X1EA 2E1MC 1OR7C 3BLYA 4BQQA 2VJIA 2X6YA 2HDWA 3K4JA 1QU3A 3W2WA 1G59A 1K6YA 2IS4A 2R7SA 4LITA 3DU6A 3W3CA 1V5EA 3OYKA 4NNJA 4YELA 4ZC3A 3LSKA 3OS0A 3OWTA 2CV0A 2WA0A 4HSRA 4XOTA 2ELJA 2ZXIA 4ANJA 3AKZA 1T0FC 3J7AY 2R7VA 3SZGA 3H35A 4BQNA 4C2UA 3H5RA 1ZELA 3TMOA 1EA3A 2LOOA 2A6TA 2LRDA 4BJTA 4BE0A 4XNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAS D;  4N4O B;  4N4N B; 
#chains in the Genus database with same CATH topology
 3KZI C;  4G12 A;  2R7Q A;  1K78 B;  2HKO A;  1JE8 A;  1W4M A;  1BIB A;  1ZRC A;  2KIM A;  5H20 A;  4PSW A;  1TP4 A;  2LF8 A;  4WCG A;  4DNC A;  2UXN A;  1R6R A;  2DPU A;  1S7A A;  2L7K A;  3HUG A;  5D5U B;  1WJB A;  3KP3 A;  2F5D A;  3DEU A;  1PUF B;  3QYE A;  1WH7 A;  1FYL A;  2PMZ A;  1J75 A;  3D1N I;  3M8J A;  4KA4 A;  1K6O A;  2UZK A;  3MEX A;  5FLM J;  2BVM A;  3GLL A;  1B72 A;  3K1P A;  1H8A C;  3SEQ A;  1SFE A;  1R1U A;  1JHF A;  2VB6 A;  2DA5 A;  4IHW A;  1FSH A;  1WHU A;  3HSF A;  5EZH A;  4U7D A;  2V1D A;  3J81 Z;  2IS2 A;  3CUQ A;  1XSD A;  2HTS A;  2QEN A;  4L18 B;  3S1M J;  2F6C A;  4ZYG A;  1J0R A;  2QBY A;  5K7Z A;  1WJF A;  3HEF A;  2GIV A;  2EPF A;  3OYD A;  3OL3 A;  3CD6 I;  3EQL F;  1ZG3 A;  2PLY A;  2F5C A;  4X1E A;  3UNG C;  1YRN B;  4KNY A;  2VOO A;  2PMH A;  2UV1 A;  2FOK A;  1V3F A;  2VBW A;  4HDU A;  4OIN F;  4E6K G;  1F4K A;  3HDD A;  1ZHF A;  2F2E A;  4G7O F;  1GHC A;  2ZJP F;  4IRH A;  1V5F A;  1ZLJ A;  2QKM B;  3QP6 A;  4OAY A;  4UUT A;  3T0Y A;  3BQZ A;  4EJV A;  3I56 I;  2HYF A;  2ZXW H;  3MVP A;  1JKO C;  4FE7 A;  4KUM A;  3I58 A;  4ESF A;  2Y31 A;  1RET A;  3A03 A;  4LLL A;  3KLO A;  3J80 K;  3OL4 A;  1RUO A;  4UVB A;  3R0A A;  4PGH A;  1BOB A;  4X6A J;  3FM3 A;  1VFC A;  5CQE A;  3L09 A;  3TL4 X;  2M2E A;  1NG7 A;  3PSF A;  2ZNY A;  3TW7 A;  3LST A;  4DJA A;  4XBF A;  1B72 B;  3PQJ A;  3HHH A;  1HF0 A;  1A5J A;  2PFB A;  5C4X J;  1K61 A;  1E0E A;  3OOP A;  1U8R A;  1D1B A;  5FKL A;  3T8R A;  3ZMT A;  4MEY F;  3G4S I;  1YIT I;  4I02 A;  4HZF A;  1N75 A;  1Y8Q B;  3L2W A;  4MLO A;  3VYU B;  2NVT J;  3CUQ B;  3OR2 C;  5IP7 J;  2G7U A;  1TNS A;  2M30 A;  1X1P A;  1D8K A;  4RAF A;  2BEO A;  4BY7 J;  1ON2 A;  3BT9 A;  3CO7 C;  2FF4 A;  1YJ9 I;  3CF2 A;  1FYM A;  3I59 A;  4Y4R A;  3V7S A;  2XPV A;  3DBL B;  2QQB A;  3CJR B;  5KAF C;  1K7A A;  1ONV A;  3N05 A;  1IF1 A;  2EIL H;  2HQN A;  4LK1 F;  1ETV A;  4DZP A;  1I6X A;  4EEF G;  2DTZ A;  2DMQ A;  5J3L A;  2ZME A;  5J1R A;  1SVL A;  1ZRF A;  1JUP A;  3P9K A;  5B1B H;  2E1C A;  3HSR A;  1IXS B;  1OCZ H;  3SYT A;  5M3F J;  2W7N A;  3B6A A;  3S17 J;  3HYI A;  1NH3 A;  4QLC U;  2Y0S A;  3FXJ A;  2PN6 A;  4MO7 A;  2K27 A;  1Z6T A;  2E2I J;  3S2D J;  3K4M A;  2EIJ H;  4RAZ A;  2LBF A;  3UKG A;  5IT9 Z;  1UMQ A;  2KJB A;  4NC8 A;  3TO7 A;  1ZG5 A;  1T39 A;  3MQ0 A;  1S5L C;  1Z77 A;  3NAU A;  1MDM A;  3F0C A;  2GQQ A;  3JR9 A;  2FBK A;  3QOD A;  3NQO A;  1J5Y A;  2YR2 A;  1OPC A;  2HI3 A;  2MC4 A;  5FRO A;  1UAA A;  5DUI A;  5D8L B;  4HA8 A;  2NOG A;  5BNG A;  5K7F A;  1Q1H A;  2W48 A;  4BDZ A;  3DLA A;  4ASN A;  2H6C A;  4U0V A;  3Q0W A;  4ZDO A;  2E7X A;  3HXL A;  1R5H A;  5JHU A;  2XPW A;  5E79 C;  3ZOB A;  4ZYD A;  2DI3 A;  4M6V A;  2WY8 Q;  3F8F A;  5CVV A;  1QQI A;  3S32 A;  2ESH A;  2K02 A;  4HX7 A;  4PSX A;  1ETX A;  2ZME B;  1JGG A;  1B9M A;  2B0L A;  2OD5 A;  4D5F A;  1TW2 A;  2UUZ A;  2E34 A;  3TO6 A;  4BKX A;  4F55 A;  2A07 F;  1KA8 A;  5FKM A;  4XOP A;  2VAS A;  2ELH A;  1BL0 A;  2G7H A;  5IOZ A;  3WG9 A;  2FBH A;  2CUJ A;  2V26 A;  2XF6 A;  2ZJ2 A;  1MSE C;  3TOA A;  4G6T B;  4B4C A;  4G7Z F;  4HRI A;  4UB8 C;  5D8K B;  1MJA A;  1QNT A;  2EFN A;  3Q0V A;  5M3M J;  1MMD A;  2A68 F;  4S04 A;  2ZJR F;  3ABL H;  3AAF A;  4A3J J;  3BTL A;  4EGZ A;  1W1W E;  5KHD A;  4D1Q A;  3EPZ A;  4UB6 C;  2QUF A;  1JGS A;  3CCU I;  4EM2 A;  4L9J A;  1R22 A;  3OIQ A;  2HWV A;  1XGO A;  1MBG A;  3QAH A;  9ANT A;  3TOB A;  2NNY A;  4MFE A;  2KT0 A;  2M4G A;  3QRF F;  3S3M A;  1JT0 A;  3R0J A;  3LSJ A;  4LB5 A;  1AA7 A;  1Z6R A;  3OR1 C;  4HG2 A;  1MJB A;  4B1R A;  1X3U A;  3PUF A;  4RS8 A;  2CUF A;  1NG6 A;  4RDU A;  3TP3 A;  5ILU A;  3WTS C;  4J00 A;  2LG4 A;  3DFG A;  3CDH A;  4R79 A;  1N25 A;  3DBH B;  3SDB A;  2OTL I;  1LEB A;  3VB2 A;  3ONQ A;  4DYC A;  2VIX A;  2LVS A;  4ZYA A;  2DCE A;  3NEU A;  4LJZ F;  3L2R A;  1SAX A;  2WTE A;  3QWL A;  4ITV A;  3K69 A;  1HKQ A;  3LSG A;  2CQQ A;  3I64 A;  3K4B A;  2KPM A;  1I3A A;  2EV0 A;  3KP2 A;  2HDC A;  1VQ5 I;  2K85 A;  2CW7 A;  2L54 A;  3CMY A;  1POG A;  4LGW A;  1SFX A;  4E7K A;  4QSH A;  1WCM J;  1RR7 A;  5E20 A;  5F1J A;  2MLG A;  2XAJ A;  3AG3 H;  5KAI C;  4DOZ A;  5E1W A;  2X1D A;  1YJN I;  4IVN A;  2YX7 A;  3L00 A;  3RQI A;  2IA1 A;  1B59 A;  2KHM A;  3PNV A;  4HX4 A;  2BXZ A;  3OYA A;  3RKX A;  5HLT A;  1XMX A;  4L0Y B;  2E5N A;  3D5L A;  3FX3 A;  5DDG A;  5ERI A;  2HTJ A;  2M0C A;  4NB5 A;  3WHC A;  4KMU X;  3K2A A;  3WTX C;  3PNT A;  2GA1 A;  1U2W A;  2NVU B;  2HVS A;  3BR2 A;  2AO9 A;  2H94 A;  2KMU A;  2XAU A;  4GO1 A;  3CCV I;  3OMY A;  5KNL A;  2X51 A;  4ESJ A;  2H27 A;  2V1N A;  3FXL A;  5ICC A;  5CQG A;  4A3F J;  3L2U A;  1QBJ A;  3NWT A;  1T08 B;  1M1E B;  3OYF A;  4BDY A;  2JRM A;  3MZY A;  3LSM A;  3G1M A;  1EKE A;  3WGG A;  2E1O A;  2QF7 A;  3PJR A;  1XCV A;  3OYL A;  1LE8 A;  2LC2 A;  2LKS A;  2WBM A;  4OAZ A;  1AOY A;  1VQO I;  2Y2Z A;  1B9N A;  2LTP A;  3L7W A;  1HCR A;  2R7T A;  4AID A;  3HZJ A;  3T1B A;  4YFN F;  5A2Q Z;  5BPI A;  4L9V A;  1XD7 A;  1YOV B;  1J9I A;  3MZH A;  1LFB A;  1JKP C;  2M45 A;  2ZKZ A;  3D5R C;  3BPX A;  2WAE A;  2G9W A;  2JN6 A;  2HNH A;  4ZTJ A;  1G3W A;  3G73 A;  5FKN A;  4DZJ A;  1YS7 A;  5LBQ A;  1HW1 A;  2D45 A;  1P4A A;  1MH3 A;  2FOW A;  1FBS A;  1X2M A;  3VFZ A;  3WTZ A;  5GAE J;  1MBJ A;  2BBY A;  1BJZ A;  2W00 A;  3JRA A;  1UHW A;  5J4Y A;  2MH9 A;  3TP0 A;  2IA2 A;  1T0F A;  3I4M J;  1WH5 A;  1H88 C;  4X0G A;  3RQ4 A;  3QPH A;  1X1D A;  3HBL A;  1KZH A;  4A3I J;  4CHU A;  4EM0 B;  4XL9 A;  1JKQ C;  3A2K A;  2DFH A;  2WAQ A;  1ERD A;  1IDY A;  3ERM A;  3HOX J;  1U8B A;  4LIV A;  4OMZ A;  1LVA A;  3ABK H;  3GUD A;  3SHF A;  2E5Z A;  1ZYR F;  4A0Z A;  1XMA A;  4XKB A;  5E18 F;  3RJP A;  1ETK A;  1QGP A;  1R49 A;  5HDK A;  1ETQ A;  4F7Z A;  2H1L A;  2NVY J;  1YJW I;  5IYD J;  2DPD A;  2BY1 A;  3WTY C;  3K4N A;  5JLX A;  3U1D A;  2XV4 S;  2CFO A;  3CQZ J;  5TJJ A;  3G1L A;  3HOU J;  5E3N A;  2A5W A;  2J5O A;  3BR1 A;  1FP1 D;  2HZD A;  5F64 A;  3GFI A;  2F4M B;  3BTJ A;  4HOB A;  5IY5 H;  1NTC A;  4IF4 A;  4YFK F;  3DPT A;  2IGK A;  3E5U A;  5EGO B;  2EBI A;  3G71 I;  1O3Q A;  5F0F A;  2HOT A;  4AIK A;  3BCB A;  4AU7 A;  1ZGW A;  2QVO A;  2Z2S B;  2GM4 A;  1LPQ A;  3I54 A;  4RLF A;  5ICG A;  4HX8 A;  4YG2 F;  5LLQ A;  1H0M A;  4A2U A;  2EA4 A;  3V42 A;  1B6A A;  5AIQ A;  1TWF J;  2AQF A;  1P7I A;  3RPU D;  1MIJ A;  5C4J J;  1VQ8 I;  1DU0 A;  1CGP A;  1QPI A;  2DU9 A;  3EYY A;  2K7L A;  5D6F A;  2ID6 A;  3J80 Z;  2XRO A;  2E60 A;  2M3A A;  4CH7 A;  2DMT A;  1X1B A;  2DK8 A;  1WJ5 A;  4I6Z A;  2FQ4 A;  4JP0 A;  2PQ8 A;  1PDN C;  3ROU A;  3KEQ A;  2CW8 A;  3RZD J;  4BBS J;  2ZFW A;  2BHZ A;  4EJT A;  1FIA A;  4M3G A;  3HGG A;  5IYB J;  4XRM A;  1BC7 C;  2EH3 A;  3BZ6 A;  3W2W A;  2DQL A;  2R7S A;  2VC1 A;  1UCR A;  1R1T A;  4LIT A;  4QWQ A;  4IHX A;  3W3C A;  3OYK A;  3BG9 A;  4I2O A;  4ZC3 A;  2YPR A;  3R61 A;  5DCM A;  3LWF A;  1D8J A;  3J7Y J;  3ZMS A;  2ELJ A;  4P9U A;  3AKZ A;  3J7A Y;  1P7J A;  1IUF A;  4PZJ A;  1R5I D;  3V8L A;  1ZLK A;  4UNO A;  4BQN A;  3F22 A;  4UUS A;  4RGU A;  1XX5 A;  1GVD A;  3BJ6 A;  4M6Y A;  4PCQ A;  2VT3 A;  5GAG J;  3H3U A;  1ZEL A;  4GYG A;  2LRD A;  1XDS A;  3WOD F;  1R4M B;  4BE0 A;  1PP7 U;  2EZI A;  3TGN A;  1AWC A;  1LDK B;  3DKW A;  5LRS A;  4MNU A;  4G94 A;  4AM3 A;  4AC0 A;  3ZQH A;  3JAM Z;  1ACI A;  3ZXS A;  3BG7 A;  4JOM A;  2DW4 A;  4P1W A;  2FML A;  3AL0 B;  1LUJ B;  4N9I A;  2D1V A;  4OOI A;  5EEA A;  3CLO A;  2PG4 A;  3HKZ A;  4LFU A;  1Z91 A;  4ABZ A;  4G6Q A;  1IGN A;  3GX4 X;  3ZQC A;  3NAR A;  5IP9 J;  2GIZ A;  3C18 A;  3IAM 2;  1I50 J;  3V8J A;  4JX4 A;  2W84 A;  1S29 A;  4Y13 A;  5DCM B;  2IEK A;  3A1Y A;  1OCR H;  1U5T C;  4EVI A;  3LOC A;  2K9Q A;  3OY9 A;  3M3Y J;  3E6C C;  1ULY A;  3FF5 A;  3PFI A;  2FBI A;  2GAU A;  5E3L A;  2OAZ A;  4XLF A;  3KPH A;  3HRT A;  4I99 C;  1FPQ A;  4WXH A;  4EAT A;  1EF4 A;  1I1G A;  2OA4 A;  3BJO A;  2W24 A;  1WI9 A;  2QKL B;  3BTI A;  2EV6 A;  4L5J A;  1UST A;  1ODD A;  3GTP J;  2FSW A;  3FHN A;  4QPQ A;  2GXG A;  2KIU A;  3U9G A;  3I4P A;  4ZYE A;  3WG7 H;  4BE1 A;  4NQW B;  4Q48 A;  1VZ0 A;  1G8X A;  3K1N A;  4HPQ A;  1XGS A;  4IRG A;  4JYK A;  2EIM H;  4ENM A;  3DKY A;  1KU3 A;  4KJZ A;  4P55 A;  4NHJ A;  1LQ1 A;  4ETS A;  5IYC J;  1SC7 A;  2XSD C;  3F21 A;  1T2K A;  2O5R A;  1MH4 A;  2MC3 A;  1HW2 A;  5EF6 A;  3E6M A;  1WVR A;  3QYF A;  5JHF A;  4G9Y A;  2JUC A;  3O8H A;  4CCK A;  2Y69 H;  3BR5 A;  3ZQQ A;  4NC6 A;  2DQR A;  5J40 A;  3J7Z I;  3GTG J;  4DGW B;  1S9H A;  1X1A A;  1YFH A;  1LFP A;  4BHP A;  4DIQ A;  1PUF A;  1XN7 A;  3IC7 A;  2OPT A;  2Q2E A;  4PJL A;  4UVC A;  4Y17 A;  2YSR A;  3FHZ A;  2EZH A;  2IP2 A;  2LF7 A;  4ZYH A;  2V1U A;  2D2W A;  2F5F A;  2X6O A;  4XOR A;  2BV6 A;  3ZMV A;  1YX5 A;  2CYY A;  4CYC B;  1BIA A;  2YU3 A;  4LMY A;  2NAZ A;  4E7Z A;  1MMG A;  5L3G A;  4KIS A;  5HNH A;  1IAW A;  3VPR A;  4RM3 A;  5GAD J;  4U88 A;  1WRJ A;  1T6S A;  3LFU A;  4BHC A;  3PQK A;  1XDU A;  4KIF A;  1HC8 A;  3I0T A;  3K9T A;  4IHS A;  5HS7 A;  3LQQ A;  2MD0 A;  3PM1 A;  5E8I A;  2IA0 A;  2W25 A;  3HOZ J;  1RNL A;  1RKT A;  1YRN A;  4M6X A;  3TDU C;  5AIP A;  1ZG1 A;  3SJM A;  4MQ9 F;  1DUX C;  1B1B A;  4I09 A;  1W5T A;  2JVH A;  2LH9 A;  1F1Z A;  3HC7 A;  3CCJ I;  2CUE A;  2O8X A;  4XK4 A;  2XAH A;  1IO2 A;  1OJL A;  4DYQ A;  1KON A;  1TQP A;  1ZN2 A;  5GTH C;  1YO5 C;  3GO5 A;  1V4R A;  4LD5 A;  3GBG A;  1ZGA A;  3L9F A;  2D5V A;  4M3F A;  1HLV A;  2JUG A;  3IH4 A;  2DOD A;  1T33 A;  2Q2E B;  3DTI A;  4N9H A;  3FMQ A;  2VJ5 A;  2ZSI B;  3CCM I;  1O3T A;  1R5G A;  3M07 A;  1DP7 P;  2EZK A;  5L3F A;  2V9K A;  1FWZ A;  4I0A A;  2LFB A;  2JA6 J;  4XLE A;  3TQN A;  3RI4 A;  2H8R A;  5E1Z B;  3RZO J;  4G6D A;  1X19 A;  3F23 A;  2CWE A;  5ED4 A;  2IS1 A;  2VT2 A;  4RGX A;  1KGS A;  5B1A H;  2Y9Z A;  4CCJ A;  3F72 A;  3FMR A;  5C3E J;  5J8C A;  2X1C A;  2HEO A;  4LLG F;  3S1Q J;  3MAJ A;  1O57 A;  1IDZ A;  1V5G A;  2O9L A;  1TT5 B;  2HXO A;  5GP9 A;  3ZQG A;  4CIC A;  4IEJ A;  4S05 A;  2PMU A;  3HOV J;  5D6E A;  2Q8K A;  3MKY B;  4E7J A;  1VQ6 I;  4HQM A;  4A0X A;  4KIB A;  2IS6 A;  4QPO A;  3WTU C;  3DCF A;  1UFM A;  2L02 A;  2R7O A;  4M74 A;  1IRG A;  1DGR M;  5GPC A;  1YIO A;  2DA6 A;  2VL8 A;  5TGT A;  1WFX A;  2A61 A;  1RPW A;  2V9V A;  1FY7 A;  3AL0 C;  2O0Y A;  3M7G A;  3HHG A;  1SMY F;  4NC7 A;  3K70 D;  3S3O A;  2CS3 A;  4EJU A;  1MJ9 A;  2L9N A;  5CVU A;  4PGG A;  3MCZ A;  5HLH A;  3ABT A;  2R7F A;  4E7S A;  5FB2 A;  2DFE A;  2LRE A;  4QIW N;  3VDX A;  4M9Z A;  2R93 J;  1LNW A;  5FLX K;  3C2G A;  5TIS C;  2VQL A;  4PJJ A;  1XMK A;  2KIS A;  1F43 A;  1XTA A;  4BEH A;  2X6W A;  4O6J A;  4BJ6 C;  4HNT A;  2BY3 A;  3OOU A;  2JTV A;  4UHT A;  3GXO A;  1IRF A;  2WB1 N;  3A0H C;  1FSE A;  4BU2 A;  3PUB A;  4BYY A;  5K5R A;  3IL2 A;  2BE5 F;  3K4L A;  2BXY A;  5FKK A;  4DBR A;  2P4W A;  4PUS A;  3LNQ A;  3KP6 A;  2XGD A;  3TO9 A;  3V4G A;  2VQC A;  4D7M A;  1ITY A;  1S8N A;  2L0K A;  2L5Q A;  4E7H A;  2V79 A;  4FT8 A;  1IRZ A;  1E3P A;  1FIP A;  3P5J A;  1BR2 A;  2LSO A;  4BHB A;  3HOW J;  5HVQ C;  2EFQ A;  2DA7 A;  3PNY A;  1R00 A;  2IRF G;  5K7H A;  2AS5 F;  4XRS G;  3Q9S A;  3CME I;  2FJ1 A;  2VOD A;  5J47 A;  1F9N A;  1WQ2 A;  2CU7 A;  2OU2 A;  4E7I A;  1R23 A;  5J1Y A;  4B09 A;  3MKL A;  2HQ5 A;  2FX0 A;  3I3L A;  4NDL A;  1MW7 A;  3JRH A;  1VTN C;  3C3W A;  4IO9 F;  2JPB A;  3VSK A;  3CTA A;  2FNP A;  3GME A;  2JWT A;  5CJ9 A;  3RTR A;  4AIH A;  4DBQ A;  2I10 A;  3DXJ F;  4RAY A;  4BEH B;  3GCM A;  4N4O B;  3OYJ A;  4CZZ A;  1ETO A;  2K9S A;  1WGX A;  3ABM H;  3F8B A;  3KFW X;  5D5W B;  1G4D A;  2CO5 A;  1A6Q A;  1ETW A;  2HPI A;  2RNJ A;  4XSZ F;  3FXR A;  2A05 A;  2DA2 A;  5EG0 A;  3H0D A;  5E3M A;  1ZK8 A;  1I3Q J;  2JA7 J;  3BR3 A;  2X4H A;  1QHG A;  4GFB A;  1HDD C;  3CDL A;  2BYV E;  4IJA A;  3OYG A;  2CMP A;  4FIS A;  4XLN F;  1HXD A;  3GZ5 A;  5B3S H;  2L01 A;  4OU0 A;  4XN3 A;  4BNC A;  2O8K A;  2R7X A;  2AXT C;  5L3D A;  3ZQI A;  4E70 A;  4B44 A;  2YU9 J;  1BW6 A;  5GAH J;  2M9H A;  2WAF A;  3JRB A;  4HST A;  2M87 A;  3W6V A;  4MGR A;  4PK4 A;  5JLW A;  4A3E J;  4IQJ A;  2HFH A;  2R7U A;  4Y52 J;  1SVM A;  1GXP A;  4II3 A;  5FFZ A;  4UUV A;  1G6N A;  2M5W A;  3JTH A;  2KIQ A;  1SD4 A;  3KIO A;  4HBL A;  1DPR A;  1G3Y A;  2DT5 A;  2JSC A;  3JRC A;  4CUG A;  1GV2 A;  3S3N A;  4IPA A;  5H6Q A;  4BQO A;  2NS7 A;  2O61 A;  4A0Y A;  3IH2 A;  1SD7 A;  2O6G E;  3PO2 J;  1JJ8 C;  2TDX A;  2EV5 A;  3HPG A;  3D5S C;  3K6G A;  3F6V A;  1RRJ A;  2HDD A;  1U9O A;  2MGQ A;  5EG0 B;  1O7F A;  3E97 A;  4XKV A;  3S2H J;  2I5U A;  3FXM A;  3P7N A;  1DGW Y;  1FEX A;  2ZBK A;  4HW0 A;  2HVQ A;  1XSX A;  1T8I A;  2VQG A;  5D5V B;  5AON A;  2Y75 A;  3L2Q A;  5JFR A;  2R7Z J;  4ZH4 F;  2N8G A;  2X6X A;  4H4K C;  4LG0 A;  1PVE A;  3WU0 A;  3G6E I;  2DOF A;  4GDF A;  4BBR J;  1SAN A;  2XVC A;  1O3R A;  3EUA A;  1RIO H;  4BL0 B;  4R1H A;  2LNB A;  3CUO A;  5L3C A;  2XGC A;  4WXC A;  2W82 A;  3HGY A;  3BCA A;  3MKZ A;  5J4V A;  2MAB A;  3QQA A;  2EK5 A;  3PIP F;  4C2T A;  2VBY A;  4XLH A;  3KZY A;  1OCC H;  5BPD A;  1MND A;  1QRY A;  2E19 A;  4Q4Z F;  1FTT A;  1UHM A;  3E0J B;  4Y15 A;  4IHV A;  4XM3 A;  3FDY A;  1SMT A;  4LIU A;  4BY1 J;  5F1R A;  3ML6 A;  3ECH A;  1ETY A;  1HQC A;  1FLI A;  1X4P A;  3FK6 A;  3CC2 I;  3G2B A;  2QCO A;  5J1U A;  2PX9 A;  4B43 A;  4KT6 A;  5DUK A;  1CF7 A;  3LMM A;  4D9J A;  1OLT A;  3FIW A;  2E1M C;  1OR7 C;  5DD4 A;  2JQ7 A;  4LG0 B;  5HLI A;  2X6Y A;  2HDW A;  3K4J A;  1JTY A;  2JJ7 A;  4RGS A;  3SFI A;  2RDP A;  2RVC A;  2FD5 A;  2HKX A;  2ZO4 A;  2CQK A;  1LDJ A;  4NNJ A;  2K9N A;  5DTD A;  3OS0 A;  1TQM A;  2CW0 F;  2WA0 A;  3LFK A;  1GXQ A;  3IV5 A;  4XOT A;  2ZXI A;  5HLG A;  1MBH A;  3ZMZ A;  3H35 A;  1U5T B;  5JI6 A;  1JHH A;  1UZC A;  2OCE A;  4L5I A;  1VQ7 I;  1IG7 A;  1MSF C;  4MTE A;  4C2U A;  3H5R A;  3B6C A;  2YS9 A;  3C2B A;  4OIR F;  3IKT A;  2H6B A;  3DF8 A;  2A6T A;  5CKT A;  4HQE A;  5JVT A;  3J81 K;  3HOS A;  1W7P D;  3WTT C;  1ZAO A;  5LGN A;  2AHQ A;  1USS A;  2KFD A;  1GVJ A;  3VOD A;  2CV2 A;  1TT0 A;  1BBY A;  1D0X A;  2V9P A;  2RAE A;  1R7J A;  1ZKG A;  5EGO A;  1N78 A;  2DT7 B;  3Q5F A;  4YEJ A;  3GFM A;  1NK2 P;  1CF7 B;  3BDD A;  4ZZL A;  3AG1 H;  3I53 A;  1V54 H;  3M1C A;  2KLO A;  1IN4 A;  1HBX G;  1O4X A;  5F0C A;  2KDZ A;  1YI2 I;  3RKY A;  1WI3 A;  2RQP A;  3L1P A;  3DP7 A;  3K70 C;  3ZR8 X;  4FHT A;  1IV6 A;  5LEK A;  5HOD A;  4PJ0 C;  2HXI A;  1SD6 A;  4A5N A;  1E3H A;  2ZXH A;  1T98 A;  3SXY A;  1WSU A;  3KEY A;  3PIO F;  4ZTF A;  1RI7 A;  3OYE A;  2VJJ A;  2HGC A;  2X48 A;  4ENJ A;  4I98 B;  4KIT B;  2L3D A;  2BY2 A;  2HU9 A;  4KDP A;  2JMW A;  2L7Z A;  2ZJQ F;  1O3S A;  2IT0 A;  2X0L A;  2A6H F;  3ZQL A;  1YS6 A;  4F93 B;  4UY8 I;  2FMY A;  2Z3Y A;  3JW4 A;  3JRD A;  3JCU C;  1U6G A;  1ON1 A;  1Z9C A;  5D5X B;  2DMP A;  3OYN A;  2RV8 A;  4A69 C;  3I5U A;  1FOW A;  1L3L A;  4BXX J;  1BW5 A;  2RNG A;  2XGX A;  1MBK A;  2YX4 A;  1APL C;  2PJR A;  2Y9Y A;  4HNU A;  2VKV A;  2Q1Z B;  2OJE D;  4Y7N J;  1VQK I;  1SD5 A;  2XB0 X;  3G3Z A;  3WGI A;  4XR6 A;  1U3E M;  4ZJZ A;  4RMN A;  4G8X A;  1SFK A;  1W7P B;  1KQ8 A;  4A6D A;  2LP0 A;  3PSI A;  4LB6 B;  1Y1V J;  2EWN A;  1J59 A;  4BAY A;  3HG9 A;  1XSV A;  4HV6 A;  4B47 A;  3JRG A;  2M7A A;  1VQ9 I;  2X9D A;  5F08 A;  5DCF A;  2P7C B;  2K4B A;  3EYI A;  1SFU A;  1MBE A;  3E6D A;  1EV7 A;  3F8M A;  2ZB9 A;  1P92 A;  5M5Y J;  5IT9 K;  4L5E A;  4BXF A;  4EGY A;  2O03 A;  1D5Y A;  1YW8 A;  3TW6 A;  3BZK A;  4P9F A;  2Y0M A;  2IW5 A;  2VPR A;  1I27 A;  3ASN H;  1Y56 A;  2NS0 A;  2ME6 A;  4CYD A;  3LSR A;  3RPU A;  1N77 A;  2VON A;  1NK3 P;  2QQA A;  3JRI A;  5E17 F;  2NS8 A;  2EQR A;  1KQ0 A;  1TW3 A;  2EIK H;  1X2N A;  5K1Y A;  2PI0 A;  2XSJ C;  3MN2 A;  3KYL A;  2ECC A;  1BI3 A;  1IZ1 A;  3FK7 A;  3HRM A;  2FNA A;  5EJC A;  1Z67 A;  1RC9 A;  1UB9 A;  3CMM A;  2CV1 A;  4AD9 A;  4DW6 A;  3JTG A;  2PJR B;  3TDZ C;  2QSF X;  5TRD A;  1XG1 A;  3GZ6 A;  1VQ4 I;  1ZRD A;  3WE3 A;  2M0M A;  4JBA A;  5IOY A;  1Y1W J;  3W2V A;  2FA5 A;  1HOM A;  4HYE A;  3FBI B;  2X85 A;  2ESN A;  2JZY A;  4S0H B;  2CFX A;  5LD2 C;  1J7K A;  3SFZ A;  2R7R A;  2ZSH B;  2JT1 A;  5HDN A;  2L9S A;  4W1U A;  1Y39 A;  3CF5 F;  2MW8 A;  1Y0U A;  3RCO A;  3KP4 A;  4ZZD A;  4ENK A;  3U21 A;  3K0L A;  2JPC A;  1HKS A;  4WK8 F;  1I5Z A;  2R7D A;  2R0Q C;  3BJA A;  4NQW A;  4IZZ A;  1P4X A;  4F91 B;  3GTO J;  2FUG 2;  2ISY A;  3HOY J;  4II2 A;  3BOQ A;  3FBN B;  2Z33 A;  4U0W A;  2LKX A;  1BI2 A;  2CSO A;  3CJT B;  3E7L A;  4E7L A;  2V6E A;  1STZ A;  1ZRE A;  3H5A A;  4U7B A;  4V2G A;  1WKM A;  4CCN A;  2NNN A;  4LOC A;  2K86 A;  1R4N B;  1WPK A;  3C7J A;  3ZCO A;  1FX7 A;  4RLQ A;  3V7R A;  4EJO A;  4LLN A;  2F4I A;  4AYB N;  1VQL I;  2Y30 A;  4ZDL A;  1QVU A;  3KX2 A;  4C3J J;  2GLO A;  1EH7 A;  3CC7 I;  5DD8 A;  1D5V A;  5FD5 A;  2Z9O A;  2CJJ A;  5DEQ A;  1W0U A;  2ZNZ A;  2B7E A;  4CO8 A;  1LJ9 A;  2EFO A;  2IGM A;  3RDI A;  1QZZ A;  3CCQ I;  4BH9 A;  2R5Y B;  2MYS A;  1GUU A;  1R9T J;  3M4O J;  1BR1 A;  3IKV A;  3GFL A;  4XMY A;  5HDG A;  5ICE A;  5DV5 A;  3S1R J;  4CYC A;  3CDI A;  2VLA A;  1MMA A;  1LVK A;  3LA3 A;  3DEW A;  4WX9 A;  3I55 I;  3IAS 2;  4HF1 A;  1H89 C;  3SZT A;  2MLK A;  5EZG A;  5J6X A;  1G2H A;  1OCO H;  2IVM A;  2JA2 A;  5LGT A;  2Z99 A;  3KE2 A;  2NOJ B;  3K10 A;  4UV8 A;  3HL2 A;  1Y0N A;  5BQT A;  2M34 A;  3H0G J;  2PBI A;  2HQR A;  3CC4 I;  1G3S A;  1ZTR A;  2CUZ A;  4MFD A;  4YII A;  3FXU A;  4M71 A;  1OIS A;  4EMS A;  2L4M A;  1W36 C;  1R1V A;  3A02 A;  1U9N A;  2BY0 A;  2E71 A;  2BGC A;  2YUS A;  3GWZ A;  3LSH A;  4BXU A;  3OIO A;  2IGO A;  2XAS A;  5KCM A;  2LKP A;  1JTX A;  3SQN A;  4KYW A;  3ELK A;  3BR6 A;  3W6K B;  3L2C A;  1E3O C;  3MWM A;  5KVR A;  2E2H J;  5KK1 A;  1XPX A;  2DN0 A;  3GW2 A;  5GPA A;  4IXA A;  2CG4 A;  1D0Z A;  2KRC A;  3KYD B;  2P6T A;  2NVX J;  1RUN A;  2WV1 A;  4XN0 A;  4BGD A;  4BJ5 C;  3OYI A;  5JVG F;  2E7W A;  3LAP A;  1VQP I;  2IXS A;  3QU6 A;  2QEX I;  1VQN I;  1FMW A;  1Z1D A;  2LK2 A;  3GVA A;  3O3K A;  2VN2 A;  4I7H A;  2ISZ A;  2P7V B;  3KZZ A;  4JQF A;  2VJ4 A;  2OTJ I;  4WF2 A;  4PJN A;  4W97 A;  4BUP A;  2AQE A;  2HS5 A;  1FBU A;  4J01 A;  3CZ6 A;  2HOA A;  3KYC B;  1C0W A;  1VQM I;  3VYT B;  4O3M A;  1UJ8 A;  5H6R A;  1BI1 A;  1XCB A;  5DM7 F;  5CPR B;  4F92 B;  4C30 A;  5BS6 A;  1D1A A;  3FKJ A;  1KU2 A;  3KLN A;  4HAM A;  2W4S A;  3A4C A;  1D1C A;  5J8F A;  2WB1 A;  2Z1D A;  1HA8 A;  4C3H J;  4MHG A;  3H3V K;  2HOE A;  1IN6 A;  5CLS A;  3T5X A;  1P2F A;  3HOT A;  4CA0 A;  2COB A;  2OZ6 A;  2XKO A;  4Z6Y A;  3E5Q A;  2R7W A;  1PYV A;  4PFO A;  4ON0 A;  4CDG A;  4E4H A;  3DPL C;  4LK0 F;  1T38 A;  2DA1 A;  1OR7 A;  4D0P A;  4OWR B;  4PFP A;  3NWS A;  1TNT A;  2L2O A;  2W1O A;  2KZV A;  3SZP A;  2ADU A;  4FQG A;  2VPL A;  2XAG A;  1KU9 A;  2A3S A;  2M4K A;  3PL8 A;  1ZR2 A;  3I71 A;  4CXF A;  1PJR A;  1FP2 A;  2KRH A;  4MQV A;  2ELK A;  4RB1 A;  3N97 A;  3S14 J;  1YTY A;  2OZU A;  1B4A A;  3HIF A;  1Z7L A;  1X1C A;  2RC4 A;  2DJN A;  1Z3X A;  1OYW A;  4D5C A;  3WTW C;  2DMU A;  3DWL E;  3RSN A;  2QYO A;  3K7A J;  2JA8 J;  1YYV A;  2ECB A;  3GEZ A;  1K4S A;  1MBF A;  3WTV C;  4A3M J;  2ACJ A;  4KN4 X;  4KMF A;  3VEP A;  2A69 F;  2QLZ A;  2XPU A;  1FNN A;  3NRV A;  1TLH B;  5E8G A;  2RGV A;  1DDN A;  5DM6 F;  3MMY B;  4AWX B;  3DPU A;  2L4A A;  3Q3S A;  3CLQ A;  1OYI A;  5FFX A;  3VWB A;  3H92 A;  4HV5 A;  3PFY A;  4HDV A;  1WJE A;  2V1X A;  1S7O A;  2F5E A;  3LA2 A;  3I9V 2;  5FD6 A;  3CCL I;  5M5X J;  2E1M B;  3K4C A;  4CCL A;  3TBI A;  3Q9V A;  1JT6 A;  2F5V A;  3MZ8 A;  2LD5 A;  3HUG B;  3TKY A;  3R60 A;  1L0O C;  2FEZ A;  1SVO A;  2WC2 A;  2DFI A;  2EFP A;  3VSL A;  4Q5S F;  1GV5 A;  2V4J C;  5ICF A;  3FKI J;  4C3I J;  1BC8 C;  5FGM A;  5B5E C;  2K9M A;  1VF9 A;  4XSX F;  2Z16 A;  3BRO A;  3S1N J;  3F6O A;  3IHU A;  4QTR A;  2K40 A;  2VKD A;  3DTE A;  2V7F A;  2MH2 A;  2GBY A;  1IJW C;  4C9Y A;  3D0S A;  3S8P A;  3FZV A;  2JSP A;  3ZRG A;  2J5P A;  4JX5 A;  3DLL F;  2XF7 A;  3COA C;  2QGU A;  4NUB A;  4KT5 C;  2QBY B;  2XAF A;  2G0E A;  2DAO A;  3FM5 A;  3B02 A;  4JK1 X;  1PUE E;  2WV0 A;  1X3W B;  1ZGJ A;  2K9L A;  5LEJ A;  2DJI A;  4DYR A;  2PEX A;  4EV0 A;  5CVJ A;  3LSP A;  2DFF A;  2MA3 A;  2P0W A;  2X1E A;  2LR8 A;  3WU1 B;  1ZH5 A;  2XKP A;  4A3C J;  3BLY A;  5CVR A;  2PMZ N;  2XIG A;  1OYY A;  4M72 A;  4IRI A;  1OFC X;  2LLK A;  2H8W A;  1K4T A;  1Y8R B;  1G59 A;  2IS4 A;  1EH8 A;  1T56 A;  4GGG A;  3DU6 A;  1UHS A;  3R4K A;  5F0H A;  1V5E A;  3JAM K;  4YEL A;  2EFW A;  4U0Y A;  3LSK A;  1BI0 A;  3OWT A;  2CV0 A;  2M8G X;  2F4O B;  4HSR A;  4A3D J;  1FYK A;  2XRN A;  2R7V A;  1FOX A;  3O6B B;  5E3O A;  1MMS A;  1A6I A;  3AG2 H;  1AKH A;  3OSG A;  3ZQ7 A;  1RR8 C;  2EB7 A;  5FJ8 J;  1MGT A;  4N0B A;  3KP7 A;  3TMO A;  1EA3 A;  3A0B C;  5DYM A;  4A93 J;  4IOC F;  4BJT A;  1IW7 F;  4XNF A;  3U2R A;  2L7F P;  1REP C;  3JSP A;  1SFO J;  3BY6 A;  5HS9 A;  2CQN A;  1O7L A;  2EJR A;  2FU4 A;  2Z5U A;  3WGH A;  4FAS D;  1FMV A;  2IAI A;  3I59 B;  5K5O A;  2ETH A;  2M7B A;  2K4J A;  3BR0 A;  4XLA A;  1TWC J;  1F5T A;  3GTK J;  3UR3 C;  1KQ9 A;  2IPQ X;  4IHT A;  4NBQ A;  2KZG A;  2ZXJ A;  4WXD A;  2HR3 A;  1CQT A;  3E1S A;  2UXX A;  2JK3 A;  4D7N A;  3A01 A;  2QM3 A;  2HPM A;  3RKQ A;  3DU5 A;  4A3B J;  1FT9 A;  3ZN0 A;  3EUH C;  4KFC A;  1YIJ I;  2BZT A;  3H9G A;  3E6B A;  3HRS A;  1WJC A;  2LBF B;  2CRG A;  2I8D A;  1E2X A;  1HST A;  2CGP A;  5F04 A;  2XC7 A;  1D3Y A;  1AKH B;  2WY7 Q;  2BW3 A;  1MDM B;  2LY2 A;  4HLY A;  1IXC A;  4I01 A;  2RQQ A;  5DS9 A;  1T95 A;  2EZL A;  3P9I A;  4A5M A;  3KCC A;  3VYS B;  4XLP F;  1TQI A;  2KL4 A;  2KRF A;  3ABU A;  3IP4 B;  2FXA A;  4DQ2 A;  1P4W A;  3ERE D;  2HOS A;  3CO6 C;  4Y3O A;  5LGU A;  2GXB A;  3JRF A;  3HSE A;  4Z2Y A;  2NYX A;  3AFH A;  5IPA A;  2NVQ J;  4P5O A;  2ZC2 A;  2Y0S N;  2C6Y A;  2BVL A;  1U5T A;  3A01 B;  1AHD P;  3BG6 A;  2AXL A;  1JKR C;  5FKO A;  3CMA I;  1I6H J;  2IGN A;  2OQR A;  2GOX B;  1P9Q C;  3QU3 A;  5ILS A;  2WWY A;  3OYH A;  3RYP A;  3S2W A;  4XQF A;  1X3Z B;  4KIG A;  1FC3 A;  4H0E A;  3R6S A;  3IRR A;  3V7C A;  2BOL A;  1W5C C;  2EA2 A;  1EJ9 A;  3OSF A;  4B8X A;  1FZP B;  1R58 A;  2QSG X;  2BW3 B;  4XRS A;  1Q1V A;  1X4O A;  1W36 D;  3OYB A;  3RYR A;  3LAJ A;  2OCC H;  5LFA A;  5FO5 A;  1QZE A;  2VKE A;  4RA2 A;  5EEG A;  2QA4 I;  3SDG A;  4FE4 A;  3MD2 A;  3LA7 A;  1W5S A;  4K2E A;  3JSO A;  2M8E A;  3HPH A;  4I0B A;  2Y48 A;  5B66 C;  1G3T A;  3M1E A;  3SEZ A;  5ILV A;  2VBX A;  1RKW A;  1TZL A;  3GTL J;  2RRE A;  2P8T A;  3PO3 J;  5HOO A;  2KQR A;  4U87 A;  1JJ6 C;  3LL7 A;  2DO7 A;  2E2J J;  2HQA A;  4B48 A;  2R4G A;  1H9G A;  1WJD A;  4AUX A;  2GOM A;  2VE9 A;  5FLV A;  2P81 A;  1IN8 A;  4IHY A;  1WZ2 A;  2NRA C;  1UG2 A;  2DK5 A;  2OBP A;  3CJN A;  5GTI C;  2V6C A;  2VBZ A;  3MKW B;  1DPU A;  3GTQ J;  2STT A;  4AIJ A;  2P5V A;  1JI8 A;  3CCY A;  2JA5 J;  2VXD A;  3CUQ C;  2E36 A;  3GFJ A;  1JUM A;  2EIN H;  1V55 H;  3P9C A;  2CQX A;  2DYS H;  3ESW B;  3G1O A;  3MFK A;  1S7E A;  5HS8 A;  1BOA A;  4C2M J;  4XRF A;  3QYB A;  4UV9 A;  3KEO A;  2MFZ A;  5JR3 A;  3HRU A;  3IRQ A;  4RAG A;  2H09 A;  3WHB A;  3N4M A;  4R8H A;  3CES A;  3QP5 A;  3H9Q A;  3OV8 A;  4OMY A;  1HSJ A;  2LY1 A;  2DT6 A;  5LHG A;  1YE9 A;  1QO0 D;  1XB4 A;  3RPQ A;  1YLF A;  5F27 A;  2L9V A;  2E35 A;  2QZ8 A;  2LMD A;  2DXI A;  3HTS B;  3LSI A;  2FRH A;  1DU6 A;  1W7P A;  4O5V A;  2XRL A;  4L9T A;  2H1K A;  5H2F C;  3CP8 A;  2D1H A;  1ZQ3 P;  2PJP A;  1WWX A;  4CSW A;  2KKO A;  1IXR C;  1I39 A;  4YFX F;  3EET A;  3GF2 A;  1WJA A;  3GTM J;  1A35 A;  3OYC A;  2Q0O A;  3BC8 A;  3QPL A;  3FIS A;  1IC8 A;  3H5N A;  2GWR A;  1H9T A;  3S15 J;  5F6F A;  2MG4 A;  4EM1 A;  4BE2 A;  4PDK A;  1FBQ A;  3CCS I;  3KET A;  1BA5 A;  3WU2 C;  4WWC A;  3ZN1 A;  3C1D A;  2NXN B;  4A6E A;  1XS9 A;  1YX3 A;  3FXQ A;  5EYR A;  4F52 A;  4A3L J;  2K5C A;  1LFU P;  1TWG J;  3OS2 A;  2DLL A;  5BOX A;  3RIR A;  3BZC A;  3ULQ B;  4CCM A;  4RB2 C;  2VI6 A;  3ISP A;  5IT3 A;  1FJL A;  3F3X A;  1D0Y A;  2XGE A;  2ICW G;  3FWE A;  4B3A A;  2TRT A;  2CQ7 A;  2DOA A;  4HF0 A;  3V8K A;  2ZME C;  1LE8 B;  5FRM A;  1TWA J;  2DYR H;  4GXO A;  3Q0U A;  1OKR A;  4XID A;  3CCR I;  1ZAR A;  1LEA A;  4AYB A;  2CH0 A;  3IH3 A;  2QQ9 A;  3REO A;  2A6E F;  3L2V A;  3H1C A;  1OMI A;  4FX4 A;  3HM5 A;  3GLX A;  1LDD A;  3ZMU A;  3F8N A;  2RN7 A;  1ENH A;  5HNF A;  4BAC A;  3K2Z A;  2HVR A;  1YQA A;  4XKC A;  2MSY A;  3O2P E;  2F48 A;  1S3J A;  4M3B A;  1GLN A;  3TED A;  1XGN A;  1LKX A;  1RES A;  2ME0 A;  5M5W J;  4YIF A;  1MNM C;  3BP8 A;  1P6R A;  4HEA 2;  1FOK A;  4L9N A;  1U78 A;  4GRI A;  4ZDP A;  4HF2 A;  4KN7 X;  2P5K A;  4F3Q A;  1Z05 A;  5FLX Z;  4FX0 A;  4A3K J;  1RZ4 A;  1R36 A;  3RKW A;  1PP8 F;  3DQV C;  4GCV A;  3I4N J;  1BN5 A;  3BQY A;  1IN5 A;  1Y6I A;  2JRT A;  4BS9 A;  1GT0 C;  1BR4 A;  2A5Y B;  3F8C A;  4TV7 A;  2VC0 A;  3DV8 A;  4UVA A;  4FET A;  4Q47 A;  2W85 A;  3S16 J;  5IP6 A;  2L9R A;  4A12 A;  2P6S A;  2K3P A;  3ASO H;  3AG4 H;  4IX7 A;  2R5Z A;  2E1N A;  5K5Q A;  4M9S A;  4IKF A;  3K4K A;  2XAQ A;  2L7M P;  3DBR B;  3U1K A;  1MMN A;  2OQG A;  1AU7 A;  1QVT A;  2ZCW A;  1MNE A;  2JVG A;  4ENN A;  2R5Y A;  1B8I A;  1Z21 A;  3FXO A;  3X2Q H;  1E17 A;  3W2A A;  1I1S A;  5C44 J;  2WAQ N;  2FQ3 A;  3O8G A;  4HLX A;  1TWH J;  1QHH D;  2WAD A;  2STW A;  2OC6 A;  2XF5 A;  4A3G J;  2GZW A;  4MIM A;  2RKH A;  3ZQF A;  3F9K A;  2MBF A;  2QWW A;  3OYM A;  1MKM A;  3T8T A;  2VXZ A;  4OIP F;  2DDA A;  5LHI A;  4IOA F;  2COM A;  2OUM A;  4CCO A;  4OIO F;  3FMS A;  4B3X A;  3BG3 A;  4IQ4 A;  5EDN A;  1HKT A;  5E1X A;  4RB3 C;  4XKW A;  4FCY A;  1U0J A;  1S72 I;  3C2H A;  4AVZ A;  3CP2 A;  4BQA A;  1R71 A;  3ZPL A;  2DDB A;  4XLC A;  3E3V A;  2HYJ A;  4XON A;  1KYZ A;  2DTR A;  1QA6 A;  4CZC A;  4EJW A;  3ZGK A;  4CGZ A;  1IUY A;  4M73 A;  3EDP A;  2P5L C;  2XB5 A;  2R5Z B;  1YHQ I;  2B63 J;  5CYV A;  1FTZ A;  3ECO A;  3EUK L;  5LRR A;  2UWM A;  1SAU A;  4I76 A;  2LDU A;  1B8I B;  4N4N B;  1K79 A;  1TTY A;  1XC5 A;  1F36 A;  4P96 A;  1KYW A;  1W0T A;  1ORK A;  4UXN A;  1TBX A;  2VKH A;  1KU7 A;  3H9J A;  2LY9 A;  2GA2 A;  3QOP A;  1BJA A;  1IRX A;  3ZMD A;  1S6L A;  4YIR X;  4UUS B;  2O3F A;  3IWZ A;  4EQQ A;  3CCE I;  1UEL B;  1JUS A;  5FRN A;  2DOE A;  3VYR B;  2XDV A;  3HTU A;  5CVI A;  4KIC A;  2TCT A;  1J09 A;  1YW9 A;  1DP3 A;  2QSH X;  2DA3 A;  1GDT A;  4PJM A;  1ZR4 A;  3DKX A;  4M3E A;  1K83 J;  3W6J B;  3JRE A;  1XGM A;  1NHA A;  2DA4 A;  4L0Z B;  3CJQ B;  1Z0X A;  1Z3Y A;  2KDO A;  1EH6 A;  1YW7 A;  1MD0 A;  4GYI A;  1BM9 A;  4HNV A;  4V19 K;  1VND A;  1UG0 A;  3DTK A;  4FTH A;  4Y33 A;  3IWF A;  4LG3 A;  1A36 A;  2VQH A;  3EUH A;  4RBO A;  3S93 A;  4AVP A;  3DEE A;  1OCP A;  4J19 A;  3B73 A;  4JX6 A;  3HB9 A;  3KP5 A;  6PAX A;  3M8F A;  2VE8 A;  1OCT C;  2OF7 A;  3QPT A;  2VUM J;  5L3E A;  3OS1 A;  1IN7 A;  1JXS A;  3M9A A;  1HDP A;  4V2F A;  3BWG A;  1TL8 A;  2HZT A;  2QQ8 A;  3BG5 A;  1DQU A;  3QOE A;  2K3F A;  2B9S A;  1A04 A;  3VOE A;  4XIC A;  4G7H F;  1K78 A;  3J7A O;  2IJL A;  2ZFU A;  4OIQ F;  3LQR A;  5EEH A;  2DMN A;  4M9X A;  2FE3 A;  4MTD A;  2OV7 A;  5D4R A;  2KJC A;  4YRV A;  1HW5 A;  2LYC A;  3BTC A;  3IUO A;  1QPM A;  1A31 A;  3GZN B;  4ESB A;  2DBB A;  3ZP5 A;  1LB2 A;  3OIP A;  1J2X A;  4RM2 A;  2HYG D;  5D4S A;  2KP6 A;  3K1M A;  3QPS A;  1SEU A;  3GTJ J;  2M1B A;  4BQQ A;  2IBD A;  2GXA A;  2VJI A;  3HKZ N;  2W57 A;  1OQY A;  3WE2 A;  2ID3 A;  1YG2 A;  1QU3 A;  1VI0 A;  1K6Y A;  2R3S A;  1IV8 A;  3BPV A;  1Z7U A;  3HJE A;  5A2Q K;  2R92 J;  2KIF A;  4MEX F;  2O7O A;  1FOY A;  1X58 A;  3M8E A;  4RB0 A;  1MZB A;  2MD5 A;  1QZY A;  4ANJ A;  1T0F C;  3H3Z A;  3SZG A;  3E5X A;  2XUB A;  5BMZ A;  3GYH X;  4RGR A;  4IL6 C;  2VOP A;  5LHH A;  3H36 A;  1TC3 C;  2LOO A;  2BHY A;  3FXK A;  4M3D A;  2XHK A;  5L3B A; 
#chains in the Genus database with same CATH homology
 2R7Q A;  3HOS A;  1LDK B;  4PSW A;  3ZXS A;  3BG7 A;  4JOM A;  4FAS D;  1R6R A;  2L7K A;  2CV2 A;  1FMV A;  1WJB A;  4P1W A;  1TT0 A;  3QYE A;  1D0X A;  3AL0 B;  2M7B A;  1N78 A;  4XLA A;  2DT7 B;  2PMZ A;  4YEJ A;  3UR3 C;  3M8J A;  3HKZ A;  2BVM A;  3M1C A;  2KLO A;  3E1S A;  2HPM A;  3K70 C;  3SEQ A;  3ZR8 X;  3DU5 A;  2VB6 A;  3IAM 2;  3EUH C;  2IS2 A;  2ZXH A;  3H9G A;  3KEY A;  4ZTF A;  3A1Y A;  3OYE A;  1WJC A;  2VJJ A;  2LBF B;  2F6C A;  2I8D A;  3OY9 A;  1WJF A;  4KIT B;  2XC7 A;  2WY7 Q;  2BW3 A;  3OYD A;  2HU9 A;  3OL3 A;  2LY2 A;  3UNG C;  4XLF A;  2RQQ A;  1T95 A;  2UV1 A;  4E6K G;  4EAT A;  4F93 B;  2QKL B;  1V5F A;  2QKM B;  3VYS B;  4OAY A;  3OYN A;  4QPQ A;  3FHN A;  2KL4 A;  3IP4 B;  4BE1 A;  4NQW B;  2RNG A;  3OL4 A;  1VZ0 A;  1G8X A;  4HPQ A;  1BOB A;  4Y3O A;  5CQE A;  2PJR A;  3TL4 X;  3DKY A;  4KJZ A;  1NG7 A;  4HNU A;  3AFH A;  3PSF A;  2Q1Z B;  4P5O A;  4DJA A;  2BVL A;  4XR6 A;  4ZJZ A;  3BG6 A;  4RMN A;  1E0E A;  1SFK A;  1D1B A;  2O5R A;  3PSI A;  2IGN A;  2GOX B;  1P9Q C;  3QYF A;  3HG9 A;  4B47 A;  3OYH A;  1N75 A;  2M7A A;  4XQF A;  5JHF A;  4MLO A;  3VYU B;  3L2W A;  3OR2 C;  4CCK A;  2BOL A;  3ZQQ A;  4DGW B;  1S9H A;  1X1A A;  2BW3 B;  3CF2 A;  1X4O A;  1LFP A;  4Y4R A;  4DIQ A;  3OYB A;  1W36 D;  4BXF A;  4PJL A;  3CJR B;  5LFA A;  3N05 A;  3MD2 A;  1Y56 A;  3HPH A;  1N77 A;  4XOR A;  1YX5 A;  3SEZ A;  1TZL A;  2RRE A;  2XSJ C;  5HOO A;  2KQR A;  4U87 A;  3KYL A;  4E7Z A;  1MMG A;  3LL7 A;  3SYT A;  5HNH A;  4KIS A;  2W7N A;  3CMM A;  4RM3 A;  2HQA A;  2Y0S A;  2CV1 A;  4B48 A;  2PJR B;  3LFU A;  2R4G A;  1WJD A;  3K4M A;  2GOM A;  2LBF A;  2M0M A;  3W2V A;  2MD0 A;  4NC8 A;  3MKW B;  3FBI B;  2X85 A;  5LD2 C;  1JI8 A;  3QOD A;  2R7R A;  2VXD A;  2ZSH B;  2JVH A;  2LH9 A;  3HC7 A;  2L9S A;  2MC4 A;  5FRO A;  1UAA A;  1KON A;  3RCO A;  3U21 A;  3GBG A;  4BDZ A;  3DLA A;  3QYB A;  2MFZ A;  4IZZ A;  4ZDO A;  4F91 B;  2JUG A;  3CES A;  2FUG 2;  3HXL A;  2Q2E B;  3DTI A;  2VJ5 A;  2ZSI B;  3H9Q A;  4II2 A;  3FBN B;  2V9K A;  4E7L A;  2LY1 A;  2DT6 A;  4XLE A;  1YE9 A;  2V6E A;  2WY8 Q;  3H5A A;  3S32 A;  4U7B A;  1X19 A;  2DXI A;  3LSI A;  4PSX A;  4CCN A;  2IS1 A;  2UUZ A;  4CCJ A;  3CP8 A;  3ZCO A;  4CSW A;  4F55 A;  4RLQ A;  2X1C A;  2F4I A;  4XOP A;  2VAS A;  4ZDL A;  1V5G A;  3KX2 A;  1WJA A;  2CUJ A;  2V26 A;  2XF6 A;  4G6T B;  3OYC A;  3BC8 A;  3MKY B;  4E7J A;  4HRI A;  2IS6 A;  4QPO A;  3H5N A;  2R7O A;  1DGR M;  4BE2 A;  2IGM A;  1MMD A;  2MYS A;  1BR1 A;  1YX3 A;  2VL8 A;  5TGT A;  1WFX A;  4F52 A;  4XMY A;  5KHD A;  4D1Q A;  2K5C A;  3EPZ A;  3AL0 C;  3OS2 A;  2VLA A;  1MMA A;  1LVK A;  4CCM A;  4NC7 A;  3IAS 2;  3OIQ A;  3K70 D;  3S3O A;  2CS3 A;  2L9N A;  1D0Y A;  2JA2 A;  2M4G A;  2NOJ B;  3K10 A;  3S3M A;  2DOA A;  3HL2 A;  4E7S A;  1AA7 A;  5FRM A;  3OR1 C;  4HG2 A;  2CUZ A;  2LRE A;  3VDX A;  4AYB A;  1NG6 A;  1W36 C;  2CH0 A;  3L2V A;  4J00 A;  2LG4 A;  4R79 A;  3C2G A;  2VQL A;  3SDB A;  4PJJ A;  3LSH A;  2IGO A;  4BEH A;  2X6W A;  5KCM A;  3ONQ A;  4BJ6 C;  5HNF A;  4BAC A;  4HNT A;  2VIX A;  4ZYA A;  3OOU A;  2HVR A;  2DCE A;  4XKC A;  3L2R A;  1GLN A;  4BU2 A;  3PUB A;  1LKX A;  4ITV A;  3K4L A;  4DBR A;  1D0Z A;  2KRC A;  4PUS A;  3LSG A;  3K4B A;  2KPM A;  2VQC A;  4HEA 2;  4GRI A;  4ZDP A;  4F3Q A;  2L5Q A;  4XN0 A;  4BJ5 C;  4BGD A;  3OYI A;  4E7H A;  2CW7 A;  2IXS A;  1BR2 A;  3DQV C;  5HVQ C;  1FMW A;  4E7K A;  3PNY A;  1Y6I A;  4BS9 A;  1BR4 A;  4JQF A;  4DOZ A;  2VJ4 A;  2X1D A;  4FET A;  4PJN A;  4BUP A;  2AQE A;  4E7I A;  2KHM A;  3PNV A;  3OYA A;  4J01 A;  3CZ6 A;  5HLT A;  2K3P A;  3I3L A;  1MW7 A;  4IX7 A;  2E5N A;  3VYT B;  3D5L A;  5CPR B;  4F92 B;  3VSK A;  4C30 A;  4IKF A;  3K4K A;  1D1A A;  3FKJ A;  3PNT A;  3RTR A;  1MMN A;  4DBQ A;  2HVS A;  1MNE A;  2JVG A;  2W4S A;  3A4C A;  2KMU A;  1D1C A;  2XAU A;  4BEH B;  2WB1 A;  2Z1D A;  1Z21 A;  1HA8 A;  3OMY A;  5KNL A;  2X51 A;  4N4O B;  2V1N A;  3OYJ A;  3W2A A;  5CQG A;  2HPI A;  3L2U A;  3NWT A;  4BDY A;  3OYF A;  1QHH D;  2WAD A;  2OC6 A;  3HOT A;  4CA0 A;  2XF5 A;  3LSM A;  3H0D A;  2R7W A;  3PJR A;  3F9K A;  1PYV A;  1QHG A;  3OYM A;  3OYL A;  2LC2 A;  4PFO A;  2WBM A;  2VXZ A;  4OAZ A;  3OYG A;  2R7T A;  4E4H A;  2CMP A;  3DPL C;  2OUM A;  4OWR B;  4CCO A;  4PFP A;  3NWS A;  4B3X A;  2L2O A;  4IQ4 A;  2W1O A;  2KZV A;  4XN3 A;  2R7X A;  2VPL A;  4XKW A;  3D5R C;  1U0J A;  2WAE A;  2M4K A;  3C2H A;  3PL8 A;  4AVZ A;  3CP2 A;  2HNH A;  4B44 A;  4ZTJ A;  4XLC A;  4XON A;  2WAF A;  1PJR A;  2KRH A;  4HST A;  4CZC A;  3ZGK A;  2W00 A;  1Z7L A;  4PK4 A;  4IQJ A;  2R7U A;  1X1C A;  4II3 A;  1Z3X A;  3EUK L;  2UWM A;  3DWL E;  3RSN A;  1SAU A;  4X0G A;  3RQ4 A;  1X1D A;  3S3N A;  4CUG A;  4XL9 A;  3A2K A;  4N4N B;  4BQO A;  2WAQ A;  1ERD A;  4LIV A;  2VKH A;  2E5Z A;  3H9J A;  3HPG A;  3D5S C;  4XKB A;  3K6G A;  3MMY B;  3DPU A;  1IRX A;  4XKV A;  3VWB A;  1UEL B;  5FRN A;  1DGW Y;  3VYR B;  2XDV A;  2HVQ A;  3K4N A;  1J09 A;  3PFY A;  1DP3 A;  1WJE A;  2VQG A;  2CFO A;  4PJM A;  3I9V 2;  3DKX A;  3L2Q A;  2A5W A;  2E1M B;  2X6X A;  3K4C A;  4H4K C;  2HZD A;  1Z3Y A;  3CJQ B;  4CCL A;  3TBI A;  2KDO A;  2F5V A;  3HUG B;  3EUA A;  3DPT A;  2IGK A;  1UG0 A;  3DTK A;  4BL0 B;  4Y33 A;  4LG3 A;  3VSL A;  2VQH A;  2V4J C;  3S93 A;  2W82 A;  3DEE A;  2K9M A;  3BCA A;  3MKZ A;  3BCB A;  2MAB A;  4AU7 A;  4C2T A;  2Z16 A;  2Z2S B;  4XLH A;  4RLF A;  2VKD A;  3OS1 A;  3DTE A;  2V7F A;  1MND A;  3V42 A;  4C9Y A;  2AQF A;  3S8P A;  1DQU A;  3QOE A;  3E0J B;  3RPU D;  4XM3 A;  3FDY A;  2JSP A;  4LIU A;  3ZRG A;  2XF7 A;  2ZFU A;  4NUB A;  1X4P A;  2E60 A;  2OV7 A;  2M3A A;  4CH7 A;  4YRV A;  1X1B A;  3G2B A;  2LYC A;  2K9L A;  3IUO A;  1WJ5 A;  2DJI A;  3OIP A;  4B43 A;  4RM2 A;  4KT6 A;  2KP6 A;  2CW8 A;  3LMM A;  5CKT A;  4D9J A;  1OLT A;  2P0W A;  2X1E A;  2E1M C;  1OR7 C;  3BLY A;  4BQQ A;  2VJI A;  2X6Y A;  2HDW A;  3K4J A;  1QU3 A;  3W2W A;  1G59 A;  1K6Y A;  2IS4 A;  2R7S A;  4LIT A;  3DU6 A;  3W3C A;  1V5E A;  3OYK A;  4NNJ A;  4YEL A;  4ZC3 A;  3LSK A;  3OS0 A;  3OWT A;  2CV0 A;  2WA0 A;  4HSR A;  4XOT A;  2ELJ A;  2ZXI A;  4ANJ A;  3AKZ A;  1T0F C;  3J7A Y;  2R7V A;  3SZG A;  3H35 A;  4BQN A;  4C2U A;  3H5R A;  1ZEL A;  3TMO A;  1EA3 A;  2LOO A;  2A6T A;  2LRD A;  4BJT A;  4BE0 A;  4XNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...