4N4OB

Nitrosomonas europea hao soaked in nh2oh
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
53
Chain Sequence
SLAPISAKDMLDYLACKDKKPTDVVKSHTEVENGKIVRVKCGDIVALVQKARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Biological NO Generation by Octaheme Oxidoreductases.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Hydroxylamine oxidoreductase
total genus 9
structure length 53
sequence length 53
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2013-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4n4oB00
4N4NB 4FASD 4N4OB
chains in the Genus database with same CATH superfamily
2DYRH 3SQNA 3LA3A 3RKYA 3R0JA 2A6EF 3PIOF 1ZG1A 2A69F 3QPHA 3DQVC 4C30A 1ZRFA 3K0LA 3G2BA 2L0KA 2E2IJ 4P9UA 3OSGA 3DCFA 3RDIA 5EG0A 1H8AC 1IAWA 3AL0C 4MHGA 3I4MJ 1V55H 2HYJA 5AONA 3BP8A 4BHBA 4YFXF 1BR1A 2AXLA 1IN5A 1R4NB 2A68F 3K69A 2ZJRF 1YRNB 4G12A 1FC3A 5JVTA 4YELA 3HRUA 3KEOA 1SFOJ 1ZKGA 3ZQQA 2DA3A 5J47A 3DEUA 1Z0XA 3TDUC 5ILSA 3ESWB 2I10A 3ZMUA 1XG1A 5FGMA 5FKNA 2ZSIB 1D0YA 1Y56A 2H1LA 3ERED 2XRNA 4P96A 4L9TA 4PSXA 5DCMB 4Y17A 3SDBA 3LOCA 3WU0A 2WB1A 4DYRA 4Q4ZF 1WI9A 2QKMB 3KLNA 5J1UA 3WGIA 3ASOH 2XAFA 1UG2A 3TKYA 1XMAA 2X1CA 2F4MB 1FYLA 1Y1VJ 1MMDA 2PEXA 3Q9VA 4BH9A 1DU6A 4M3DA 2VKHA 2X0LA 5GAEJ 1BR4A 2FBIA 1D0XA 4CCNA 3S2DJ 1Z21A 1JGGA 3KP5A 2VT3A 3CP8A 4KT6A 3U21A 2UUZA 2R5ZB 4HSRA 4XLFA 2Z33A 3BZ6A 3ULQB 4RMNA 2GOMA 1YFHA 4WX9A 4DJAA 2DA2A 5BMZA 1K7AA 1SAUA 1XSVA 4HRIA 1RIOH 3R60A 2Z99A 1S8NA 4EM0B 1R4MB 3W2AA 4C3JJ 4G9YA 2LMDA 4ESBA 2H1KA 1FEXA 2A6TA 4U87A 1AKHA 1H9TA 2W24A 3I64A 3M4OJ 3G1MA 1OCRH 3BG7A 1T8IA 5JHFA 4HV6A 3WU2C 1QPIA 2E5ZA 4UUVA 1WVRA 4AYBN 2FJ1A 3IKVA 2ZNYA 4AWXB 2EV5A 1YIJI 3QWLA 1WJEA 3K4CA 4P1WA 3OYNA 2L9RA 3FXQA 3VEPA 4XLEA 3DKWA 1TL8A 2M1BA 2BGCA 2HFHA 4D7MA 3ABTA 3EQLF 4GYIA 4C9YA 2L9NA 3KP4A 4D0PA 5FD5A 4ZZDA 3J7YJ 3G1OA 2QGUA 3QODA 5FLMJ 3GTOJ 1E0EA 1QZYA 3CJRB 5B5EC 1JJ8C 5J8FA 1FY7A 3DFGA 3MN2A 1MSEC 1HCRA 2A3SA 3EETA 1MBJA 4Y4RA 5DS9A 4ENMA 1P4XA 2K9QA 2M3AA 4Q47A 1S9HA 1W36D 3L7WA 3WODF 1RKTA 2Y0SN 2VQLA 3KYDB 2KPMA 2E60A 4FISA 5GPAA 2GXAA 3D5SC 3HOZJ 3SDGA 4Y7NJ 3IKTA 4G7ZF 2KISA 1CF7B 1RUOA 3D5RC 3GVAA 2YS9A 1QA6A 3V42A 3JRFA 2MFZA 2IBDA 3HBLA 3ZCOA 2RNGA 1ETKA 1EH8A 2XF5A 2L02A 2ZMEB 4PJLA 5CYVA 3ZQFA 1FTZA 4XRSA 3X2QH 4YFNF 1K61A 2CS3A 1DDNA 3Q0UA 2RVCA 2EZKA 1TTYA 5TISC 1RR7A 2XC7A 4ZTJA 3BLYA 3OOPA 3JAMZ 5DD4A 2QBYB 2DPDA 3AG3H 3H3ZA 1WJCA 3GWZA 4BQQA 3EUHA 1ORKA 2CV2A 3WU1B 1Z05A 5LFAA 5TRDA 4KYWA 3ZN0A 2D1VA 5B1AH 5EF6A 4M6XA 2OQGA 4N4NB 3QQAA 2QQ9A 4DBQA 1G3YA 1TWFJ 2EWNA 1ZYRF 5C3EJ 2ZJQF 3HOVJ 3IV5A 1KQ8A 3FX3A 4XLNF 1E3HA 2L5QA 4LG3A 3S3NA 4ON0A 3OSFA 2RN7A 3BWGA 1CGPA 1S7OA 5KHDA 4A69C 2HGCA 1N77A 4CICA 4AM3A 1ETWA 1R22A 4OWRB 5L3DA 5B1BH 1VF9A 3I4NJ 2JA2A 5L3EA 1RPWA 2K3FA 2YR2A 2IT0A 3F8MA 3HPHA 1VQ5I 2X6XA 2PMZN 3K4BA 4RM2A 5DD8A 4A2UA 3L00A 1SVOA 1KQ9A 5HLGA 3H36A 2JN6A 3HTSB 1RESA 1TWHJ 3K4NA 3IH4A 4A0YA 5HLHA 4XRMA 3F8CA 4IOCF 1I3AA 1YX3A 3F22A 1MJAA 3HGGA 1Y1WJ 2XAQA 1ON1A 5J4YA 4A6EA 4I0BA 4LOCA 2IJLA 1IRFA 2O3FA 3LA7A 4MFDA 4A3EJ 4KNYA 2W00A 4XL9A 2GXGA 2LVSA 1DP3A 2E1MC 4PJJA 1RETA 2P8TA 3E5UA 1D1BA 1JI8A 3CCMI 2CV0A 4BDYA 3DV8A 3FBIB 1SMYF 1Y0NA 1F1ZA 3SZTA 2CV1A 1HSTA 2STWA 4NDLA 4EM2A 1IN4A 2J5PA 1O3TA 4PFOA 4UVAA 1FMVA 1HXDA 1T95A 2Y31A 1OCTC 1JKRC 4AD9A 1GUUA 3ZGKA 2X6WA 4DZJA 4PK4A 3BR5A 2NNNA 2OJED 3S3MA 4TV7A 3QOPA 4OMZA 2K9LA 4ENNA 1W5CC 3ZMVA 1VQPI 2PJRA 1PVEA 3H9JA 2K02A 1I1GA 5CQEA 3A03A 3LSIA 3SYTA 2WB1N 1BA5A 3EPZA 1IDYA 3PO2J 3ABMH 1ZAOA 2IS1A 4ZYAA 1BJZA 3FXKA 2HVSA 2DTRA 1DPRA 3CCLI 1GXPA 1FP1D 1BM9A 1HF0A 2VC0A 3DPTA 2DFIA 2MH2A 3OYEA 3JSPA 4U88A 5CVIA 2M34A 1KQ0A 3HRMA 4Q48A 4E7SA 2VIXA 2Q0OA 1FZPB 1Z7UA 2ZFWA 4WXCA 4JX5A 3NARA 4N9IA 4HA8A 2W48A 5D4RA 3J80K 1E2XA 2HS5A 2CG4A 4BJ5C 1FYMA 2ECBA 1LPQA 4XLAA 4A3KJ 5DUKA 1Z1DA 1W0UA 1QVUA 3HSEA 1OR7A 2R7TA 4L9VA 1SEUA 2JA6J 1EV7A 5KAIC 1GV5A 3HYIA 2QQBA 2L3DA 2F4IA 4PCQA 3JRDA 1HW2A 1VNDA 4I99C 1NG7A 3TMOA 3K2AA 5E1XA 1F36A 2GLOA 4DNCA 1ZARA 3QU3A 3GYHX 3CTAA 2A6HF 1B72B 2O9LA 2ZO4A 3MKWB 2DA4A 4IRHA 3F23A 1MGTA 3L09A 2QBYA 1T98A 5HVQC 2HZDA 3V7CA 4F93B 1KZHA 5K5OA 3HL2A 2JA8J 1UHSA 1ZGAA 5E18F 2GZWA 4BYYA 3MKYB 2W84A 1IDZA 1FPQA 1HKSA 5K5RA 3DWLE 3CC7I 3P9CA 2VQCA 2HR3A 5HOOA 2NVXJ 3Q9SA 4L0ZB 4B48A 2X51A 3MMYB 2KFDA 1MNMC 3ZMZA 3GTKJ 3H3VK 3R61A 3RI4A 2WADA 2DDBA 4IPAA 1TZLA 3E6DA 2L9VA 4LIVA 3ZMTA 5BPIA 4RDUA 3RQIA 2IW5A 3DPUA 2KZVA 2AS5F 3DLAA 1P7JA 3I59A 4HQEA 1XC5A 5ED4A 2ACJA 4IX7A 4II3A 2K27A 1XGMA 2VE9A 1O3RA 1MBKA 2DW4A 2AXTC 3DBLB 5M5YJ 1HA8A 4OIPF 3JRIA 1TQIA 2Y9ZA 2A61A 3IWZA 2IGMA 1OFCX 4B43A 1MH4A 3NRVA 2E1NA 1HQCA 2ESNA 2XGXA 1AHDP 4B3AA 3TW6A 5DM7F 1SVMA 4M9XA 1GT0C 5J1RA 5LHGA 5GPCA 2VBYA 2L4AA 2QZ8A 4Z6YA 1B9NA 1ETYA 3V8LA 5FD6A 4U7BA 1OISA 2BHYA 4BJTA 1ETOA 2G0EA 3OS2A 4G8XA 2CQ7A 4GCVA 4CH7A 3T0YA 2QSFX 3OYMA 1WJDA 1IUYA 1T56A 2CJJA 3FMSA 4N4OB 3AKZA 3PJRA 5AIQA 1X1CA 4L5EA 4ESFA 4BHCA 3K4KA 3WTXC 3JRHA 1J0RA 3K4MA 2F5EA 5C4JJ 1YO5C 5GTIC 3G73A 3SXYA 1I5ZA 3AAFA 2ELHA 5HNHA 1UMQA 2V6CA 4FT8A 4DW6A 5JFRA 1B59A 2M0CA 3LWFA 2FXAA 3OR2C 4R1HA 4B09A 2DPUA 4D5FA 2FA5A 3C3WA 4BQAA 5FB2A 5EDNA 4M6VA 1SC7A 1FX7A 2DT7B 1JKPC 2PJRB 3GBGA 1N78A 2HTSA 3JRGA 2NXNB 3OIOA 5LLQA 5LGTA 1Q1HA 4A3FJ 1FOYA 2A05A 1R5ID 4V2FA 1X3UA 2M87A 2KL4A 3QPTA 2XV4S 1P9QC 2XB5A 2AHQA 2PX9A 3RJPA 2XAHA 2L01A 3TO7A 5H6QA 3FK6A 3F3XA 2JRTA 3N97A 4HAMA 4IXAA 4L9JA 3CCQI 1UJ8A 3ASNH 4JBAA 4A0XA 1FBSA 1Q1VA 1IN6A 1YJWI 2LKSA 2O5RA 3TO9A 4DYCA 3GO5A 3HOUJ 3WHCA 2DBBA 4IF4A 2FQ3A 2Z2SB 4CA0A 2DA6A 1R36A 1ZQ3P 4BXXJ 4E4HA 5KCMA 3CMEI 1S5LC 2F5CA 3BR2A 2FUG2 3MAJA 1WGXA 4HG2A 2F5DA 3D0SA 5H20A 2VUMJ 3G3ZA 2CYYA 1EKEA 5GAGJ 2R93J 2Z3YA 3K1PA 3E6BA 4HQMA 2M2EA 3E7LA 5KVRA 2FEZA 3H3UA 1XPXA 4OU0A 1D8JA 1AU7A 1BW6A 3JR9A 2NVYJ 3GX4X 4MEXF 1B72A 3O3KA 2IA1A 1WQ2A 4AIDA 5H2FC 5F0HA 2LREA 4XRSG 3HGYA 1BN5A 5F1RA 3ABUA 5D5XB 1DQUA 1MBGA 2PMHA 1JJ6C 2P81A 4E7ZA 1HDDC 3TOBA 5GADJ 3GLLA 4MO7A 3CQZJ 3FXUA 4HEA2 3H0GJ 3S15J 4XICA 4UUSA 1XGSA 3FXOA 2HKOA 3C7JA 3LSGA 2JVGA 3J81Z 4U0YA 3ELKA 3OYBA 3TW7A 5LGUA 2IP2A 2ZKZA 4RB1A 1FP2A 3K70D 1WSUA 3I4PA 3MVPA 5E1ZB 2ELKA 2KHMA 4EVIA 1D1AA 2LNBA 1OYYA 3S2HJ 1OCCH 1Z3YA 2CO5A 3I59B 3ECOA 3WTZA 2QSHX 4PGHA 1MMNA 4AIJA 4N0BA 3ISPA 1X1DA 2LTPA 2JA7J 4CZCA 4L9NA 5M5XJ 1YTYA 3F6OA 3CLQA 3BJOA 4ZDPA 3C2GA 3KYCB 3TO6A 3FHZA 2LG4A 2XB0X 5IP6A 1MH3A 1K4TA 4JQFA 3IUOA 2W1OA 4D7NA 3HOYJ 3K4JA 1TC3C 2VLAA 5EGOA 2K9MA 3G4SI 1G3WA 3O6BB 3ZMDA 4O5VA 1T39A 5DTDA 4ANJA 4DGWB 4NUBA 5B3SH 3ML6A 4C2UA 4BY7J 2KZGA 3ABKH 3F8BA 4OIOF 1XGOA 2CUJA 2UWMA 4I76A 4KICA 2VI6A 2V1DA 3D5LA 3S1RJ 1TW3A 3Q3SA 3KIOA 4XMYA 2JVHA 2EH3A 3MKLA 1W36C 1RZ4A 3PSFA 4I02A 3KFWX 2NAZA 1M1EB 5EEAA 1Y39A 1OPCA 1SD5A 3PFYA 1FBUA 4MLOA 2M7BA 3P9IA 3BR3A 1ZK8A 3CUQC 3BR6A 4XSZF 3BTJA 4U0WA 3KE2A 1S7EA 3BG6A 5CVUA 3ZQGA 4XOTA 2DYSH 3BG3A 2K9NA 2NOJB 5HDGA 1ENHA 1V5FA 3L2WA 3FZVA 4LFUA 4MQVA 1QHHD 2HVRA 1O7LA 1H88C 1BR2A 2EFWA 3NEUA 2LOOA 4LD5A 1A36A 2VN2A 3HRTA 3E3VA 1HBXG 3BZCA 1UHWA 1VQNI 3GMEA 2KMUA 2E19A 2UXNA 1TNTA 1YG2A 4Y3OA 3OS0A 2TDXA 3I58A 2F4OB 1IG7A 4EJUA 4HDUA 1AA7A 2HYGD 3H5RA 3KCCA 1PYVA 2Q1ZB 4Z2YA 3W2WA 3CF5F 4Y33A 1ZREA 5C4XJ 3SZPA 3LSTA 5ICGA 5J8CA 1BJAA 3HUGB 2VOPA 1R58A 2CFXA 2KJBA 1OCPA 1LEBA 2BW3B 2LBFA 2W57A 4BDZA 4M74A 1K79A 2IS2A 2D5VA 5HODA 2R7WA 1T0FA 1HC8A 1D0ZA 2N8GA 2YUSA 4IHYA 4HV5A 3V7RA 1XCBA 3L2RA 1WFXA 2OPTA 1NG6A 2KLOA 3GTJJ 2L7MP 2ETHA 4IL6C 2VBZA 3B02A 2HI3A 3SFIA 5FLXK 4Y15A 4OIQF 4OINF 3PIPF 2Z5UA 1X2NA 3HEFA 2DMQA 4LMYA 3J7AO 3SFZA 1ZLJA 1U5TB 2L2OA 4PGGA 1CQTA 2R7XA 4JX6A 1YW8A 3CUQB 5EEGA 4O6JA 4EJTA 5FRNA 5JI6A 3CCYA 1RKWA 3ABLH 3BT9A 2VC1A 3TOAA 1KGSA 3ZQIA 4UUSB 2E7WA 3S32A 4J01A 4KA4A 3AG2H 1VQKI 3I56I 2HWVA 1H9GA 4PJNA 2L7ZA 2NRAC 2I8DA 1W1WE 1R1VA 2JWTA 4RGUA 1B6AA 3CCUI 2DA5A 2X1DA 4CGZA 3L9FA 5BQTA 5EEHA 1SFEA 2OU2A 2W7NA 1WJAA 5E1WA 3TGNA 3WG7H 4B8XA 3RCOA 2ECCA 1NK3P 3CMYA 2EILH 3MZ8A 3IP4B 3CESA 3OL3A 3HB9A 5FKMA 2P5KA 3W6JB 2R7VA 2MLGA 1U8BA 2OBPA 1FMWA 3DU6A 1Y8QB 1YIOA 1MNEA 2DOAA 4ZYGA 4EGZA 1VTNC 2XSDC 5IT3A 2HEOA 3H92A 3DP7A 5EGOB 2CW0F 1QQIA 2R7UA 1TBXA 2K40A 1IN8A 3J81K 3JTHA 3H0DA 3HG9A 3M3YJ 1WCMJ 3KETA 3O8GA 3GFLA 3F9KA 1T0FC 3C1DA 2DN0A 3PUBA 2BBYA 1WPKA 3P7NA 1O57A 4IKFA 3LA2A 1GXQA 2ID6A 5IP9J 4XLCA 2R7RA 4LLLA 5HDKA 4E70A 3FWEA 3VYUB 4XKWA 4F91B 3PO3J 4GFBA 2CGPA 3MCZA 3T5XA 1LEAA 2EA4A 3FIWA 4KN7X 3IRRA 4AIHA 3S8PA 3FM5A 4S04A 4QLCU 4YIFA 4GO1A 1FSEA 3OMYA 4HF0A 2IPQX 4OAYA 4IOAF 5HS9A 5ILVA 4OIRF 4CCMA 1ONVA 4NBQA 2YU9J 2V1XA 1IV6A 3KP3A 1OMIA 1XMKA 2R7ZJ 1OQYA 1JHFA 4S0HB 4UV8A 4BQNA 2Y75A 3HSRA 4BY1J 4FCYA 3FKIJ 2P6TA 2LK2A 4MTDA 1S72I 1XDUA 4LJZF 3FXMA 3S1MJ 1XSDA 4J00A 3BJAA 4IO9F 2QVOA 4LGWA 1IRGA 2PG4A 3HHGA 2E71A 3SHFA 3CMAI 2BOLA 3ZP5A 3GTQJ 1LE8B 2VKDA 1GVDA 3GZNB 4KIFA 2LKXA 1WZ2A 3FISA 1R71A 1P92A 1R6RA 2G9WA 3VSLA 4LK1F 3L2CA 4P9FA 4I09A 4H4KC 3UNGC 4A3GJ 3ROUA 3DKXA 3A1YA 4XQFA 1D1CA 3HUGA 3PFIA 5LHHA 1QRYA 5D5VB 2QCOA 3A01A 2BW3A 2LBFB 4XK4A 1B9MA 4GGGA 2GXBA 2JUGA 3I5UA 3W3CA 1VFCA 4V19K 2HOEA 4FE7A 2LKPA 1FOXA 4XORA 4GXOA 2CQKA 2QUFA 3GF2A 1TLHB 2K4BA 1OYIA 1HDPA 2PFBA 2Q8KA 3OV8A 3EUAA 4XN0A 5A2QK 1XCVA 1OCZH 5CQGA 3DBHB 1GHCA 1U9OA 3A0HC 1VQ7I 2CQNA 2IXSA 1U5TA 3HDDA 2O6GE 2NYXA 2A5WA 3CUQA 1MD0A 3RTRA 4M3FA 1UZCA 5E3MA 1KU7A 3QYBA 2FMLA 2KIQA 1A6IA 1XMXA 1LKXA 5F64A 4CYCB 3RZDJ 4PDKA 1VQ4I 2FE3A 2HVQA 1FT9A 2VXZA 2Y69H 1BIBA 5CPRB 4FETA 4F55A 1IW7F 4XNFA 3HOSA 2LYCA 4L18B 1F43A 2F48A 1VQ8I 2EINH 2JA5J 3ZQ7A 2DTZA 1FOWA 1DP7P 2XSJC 1XN7A 2FU4A 1G8XA 1G6NA 2K9SA 4RAZA 4I6ZA 2ZCWA 3ZQLA 5ICFA 4XLPF 1SFXA 2OCCH 2KRHA 3BG5A 3EYYA 4ZC3A 2QA4I 1MJ9A 2EZHA 1ZR2A 5FLXZ 2JPCA 3CJQB 2QEXI 3F21A 4G7OF 1DGRM 1SAXA 1STZA 2BVLA 5B66C 3E5XA 2RDPA 1ZG5A 4C2TA 2EIMH 3FBNB 4XLHA 4YEJA 4AIKA 2FD5A 2G7UA 4WXHA 1GLNA 5GTHC 2YSRA 4BE1A 3JSOA 2DFFA 3TL4X 1TNSA 1R49A 2X6YA 4RS8A 1YJ9I 2ZBKA 2EFOA 2TRTA 3BPVA 3C2BA 2HOSA 1TT0A 2R7SA 2BVMA 3Q0VA 5CJ9A 3GLXA 3WE2A 5BS6A 1U78A 1BOBA 3AL0B 2EB7A 3FM3A 4LLGF 1KU3A 1G3SA 3T8TA 1H89C 3L2VA 1KONA 2XGCA 4RBOA 3W2VA 4RB2C 2XASA 4I7HA 1IV8A 2VXDA 4EM1A 1DPUA 2NS8A 3LMMA 5CLSA 3TP3A 2JJ7A 4BACA 3OYCA 4JYKA 2ID3A 2LFBA 1G4DA 4PUSA 2P4WA 3OYDA 1J2XA 3HM5A 1YITI 1JGSA 2VJ4A 3ZXSA 1A31A 2XGDA 5IPAA 2CRGA 2M45A 4RAFA 2OTLI 2V4JC 4ETSA 3WTUC 3RPUD 2Y9YA 4XKBA 3ZMSA 5JLXA 1JE8A 1XDSA 4OMYA 1O3SA 4NQWA 4A12A 2FX0A 1U3EM 1BW5A 4WK8F 1O4XA 3IH2A 4IZZA 4BEHB 2B9SA 1IXRC 3NWTA 2B7EA 4C3IJ 3S1QJ 2GBYA 1LE8A 3CC4I 2KP6A 4C2MJ 1IUFA 4KN4X 4FTHA 3MZHA 1IRXA 3IRQA 5BNGA 2WV0A 2MW8A 2GA1A 2M8EA 5CVRA 4ABZA 2WAFA 1D5YA 1GV2A 3TP0A 2LR8A 4LK0F 3WGGA 4RB0A 3KZYA 2Y0MA 2DMTA 1Z77A 3PQJA 3A01B 2GIVA 3L2QA 2DI3A 3OYJA 3CC2I 4A3DJ 3CUOA 2HKXA 2K7LA 4KMUX 5D4SA 4ZJZA 4CCJA 3V7SA 1IC8A 3H9QA 1Z7LA 2J5OA 2DJIA 3BTCA 4UY8I 3N05A 3U1KA 2K86A 1ERDA 3HTUA 1VI0A 4M3BA 2BY1A 5JVGF 4CO8A 3GTGJ 3OWTA 2CW7A 3IHUA 4HNTA 2K85A 4DOZA 1ETXA 2WV1A 5IOYA 2STTA 2R4GA 2RREA 5HNFA 2HOTA 4IHSA 5IYDJ 1MIJA 3OOUA 3P5JA 4BJ6C 3COAC 1FSHA 3FXLA 1ETVA 2BYVE 4CCOA 1W5TA 4A3MJ 2PJPA 1YS7A 5DV5A 4KITB 2KIFA 3G6EI 4CYCA 2XPUA 3CCEI 2V7FA 3NWSA 1RC9A 1J59A 4X6AJ 4JP0A 3AG1H 3BCAA 2IGOA 4IEJA 4HDVA 1U8RA 1YYVA 4MTEA 3H35A 5ICEA 2R0QC 2OV7A 1REPC 3WG9A 2MYSA 3GEZA 1P4AA 4DQ2A 3B73A 4BE2A 2L9SA 4M3GA 3H9GA 4YIRX 4RLQA 4E7IA 3VFZA 3HZJA 2ZC2A 5A2QZ 4M6YA 4G7HF 1B1BA 3RKWA 4F7ZA 2IVMA 2MC4A 2ISYA 1QPMA 5IT9Z 1X1BA 2OA4A 3T8RA 2HQRA 4ZDOA 2GA2A 1JKQC 3CZ6A 1ZR4A 4XOPA 1X1PA 4HYEA 2W82A 1XTAA 2JT1A 4RGRA 1ZRDA 1Z3XA 3QU6A 2IAIA 1MJBA 2M9HA 3AFHA 5DM6F 4O3MA 4HX4A 1QHGA 3RPQA 3R4KA 3OIPA 4HLXA 1X3ZB 1EF4A 1DGWY 5LEJA 2GOXB 2JPBA 3LFUA 1JT0A 1OKRA 3VYTB 3V8JA 1LQ1A 5EZGA 1ODDA 1QNTA 2P5VA 3CLOA 2HPIA 3OYAA 1RUNA 1S29A 1P4WA 2PLYA 3LSJA 2DJNA 5K7ZA 5E3OA 1U6GA 2DFEA 3L1PA 3HOTA 2DDAA 1R5HA 1FOKA 2V1UA 5E79C 2XHKA 1R5GA 3BTLA 5GAHJ 3OYIA 1D3YA 3NQOA 2LY2A 2WAEA 5KK1A 3J7ZI 3OYGA 3RZOJ 1JT6A 1UELB 2E7XA 1H0MA 2V9KA 4FX4A 2EZLA 4IQ4A 1YE9A 5DDGA 1Z9CA 2NVTJ 3TBIA 1J9IA 4LB5A 1Y8RB 4CDGA 4L0YB 1W7PB 2KQRA 1YS6A 2ZXHA 2VOOA 1AOYA 2EIKH 3H5AA 1K6YA 3S3OA 2XKOA 1V4RA 4ENJA 1QZEA 2AO9A 4CSWA 4IRIA 2W85A 1OLTA 4MGRA 2DOFA 1LFPA 3HHHA 5IT9K 3TDZC 1QVTA 4R79A 1TWGJ 4RA2A 4PSWA 4NQWB 3S17J 1V5EA 1NTCA 3IC7A 3AG4H 4BE0A 3V4GA 3FXJA 3OIQA 3A02A 3EYIA 2DT5A 3E5QA 4BEHA 2ISZA 2D1HA 5BPDA 1ZHFA 2M8GX 4QSHA 1VQLI 1I3QJ 1MKMA 3T1BA 5IYBJ 1LDKB 2HQ5A 2ZNZA 2OCEA 1QGPA 1BIAA 2VT2A 5HLTA 2R92J 1Y0UA 3K10A 2IRFG 1JUPA 1ZRCA 1BL0A 1IXSB 4ZZLA 1TWCJ 4IHVA 1A35A 3VB2A 2VJJA 3VYSB 1UHMA 1IZ1A 2C6YA 5LEKA 3KP7A 3JTGA 2H09A 2XAGA 3ERMA 3KEQA 2XF7A 4YRVA 2DMPA 4GRIA 1YLFA 3LQRA 1L3LA 3HSFA 2QLZA 5FO5A 2E35A 1RI7A 1MMAA 1IF1A 2Z1DA 1ZGWA 1E3OC 1HKTA 5M3FJ 2VONA 2VJ5A 5H6RA 3VDXA 2R7DA 3HOWJ 2F5VA 2JZYA 1GVJA 2NS0A 4IRGA 2VE8A 3PQKA 3WTYC 2D45A 1TQMA 1DUXC 1XGNA 2BHZA 2VB6A 3WTTC 2XAJA 3A0BC 2ME6A 4CXFA 2JSCA 3R0AA 3CF2A 5CVJA 1MZBA 5FKOA 2FRHA 2LRDA 2VKEA 2XRLA 3WGHA 3WHBA 3BC8A 1JXSA 2DA7A 3CJNA 3OYHA 1VQ9I 2R7FA 2XGEA 1G3TA 5E3NA 3ECHA 4FASD 3M9AA 4ZH4F 4KUMA 3I55I 2H6BA 1X4OA 1I27A 2EPFA 4WWCA 3JRAA 3L2UA 1LFUP 1E17A 4D1QA 1D5VA 3HPGA 4NC6A 2YX4A 3BROA 1ACIA 2O61A 5BOXA 2CSOA 2PQ8A 1V3FA 4ZYDA 2E2JJ 2MD5A 1YW9A 4HZFA 2KT0A 1V54H 4BBRJ 3K70C 2V6EA 1KU9A 1KYZA 4UVCA 1R1UA 3RIRA 2CUEA 1T38A 2IS4A 4F3QA 1ZG3A 4MNUA 3LAJA 5GP9A 2RGVA 3BCBA 1I6HJ 3BQYA 5IY5H 1T33A 1O3QA 3K6GA 3S93A 4RGXA 2OZUA 2MSYA 3B6CA 3CP2A 4UXNA 1HLVA 1NH3A 3PNVA 3K9TA 2JMWA 4FE4A 2V1NA 2HQAA 2X85A 2A5YB 4U0VA 3CCSI 1MMSA 3V8KA 2PMUA 1R1TA 3OS1A 2MGQA 1B8IA 2KJCA 3J7AY 3IAS2 2WA0A 2P6SA 3E97A 4D5CA 4NB5A 1FTTA 5LRSA 4I2OA 3CMMA 2ADUA 3WTSC 3RPUA 1UB9A 2DA1A 3LSMA 4A6DA 2MBFA 4EGYA 2GM4A 4E7HA 3MWMA 1P2FA 2DMUA 1YI2I 3E6CC 2COMA 3VWBA 4UNOA 2E34A 2ICWG 3I3LA 3QP6A 4M72A 1QBJA 3VOEA 2AQEA 3KX2A 2IS6A 5D6EA 3WTWC 3GZ5A 3FF5A 5J4VA 1EH7A 3JW4A 4EJVA 2KDZA 3CD6I 2W25A 1DU0A 4EATA 4UVBA 4ZDLA 2X4HA 4JOMA 3OL4A 4Q5SF 2EQRA 2ZXWH 5F04A 4A3CJ 1W7PA 1LDDA 3SZGA 2GAUA 2ZSHB 3KLOA 1J09A 3MFKA 3BG9A 2X9DA 1R00A 2CQXA 2JTVA 2ZMEC 4OAZA 4ZYHA 2ZXIA 4HLYA 2YX7A 5DEQA 5AIPA 4UHTA 2VBWA 5D5UB 3M8FA 4UUTA 2H94A 4NHJA 2P5LC 3OYLA 1VQ6I 2OTJI 2XDVA 3E0JB 4BUPA 2FNPA 2L4MA 1ZGJA 1HW1A 3RYRA 1PUFA 1LUJB 4S05A 4IJAA 4HF1A 2R3SA 1U5TC 4QPOA 3BOQA 3ZR8X 3FKJA 3B6AA 2LY9A 2DFHA 2HU9A 1I39A 2FSWA 2B63J 1BOAA 4XKCA 2RNJA 3PSIA 1X4PA 3I53A 2VASA 2OD5A 4XKVA 4BS9A 4G6TB 2RQPA 5L3CA 3DKYA 3KP6A 1V5GA 1XB4A 2DXIA 1YOVB 5IYCJ 1SANA 3QPLA 1R9TJ 1ZN2A 9ANTA 4OOIA 3M7GA 2E36A 2WY7Q 3M8JA 1P7IA 6PAXA 1W4MA 3RKQA 5EJCA 1EA3A 4HPQA 3OYFA 4X0GA 1MDMB 4KFCA 1TT5B 2Q2EA 4ASNA 2M30A 1HOMA 3DTEA 2V79A 1R23A 3KYLA 2GQQA 1LNWA 1UAAA 2EV6A 2Z9OA 2JK3A 2CFOA 2ZB9A 2OUMA 5LBQA 2R7OA 1VQMI 4X1EA 5DCFA 2H8RA 1T08B 3DEEA 4CHUA 4XR6A 3I9V2 5FROA 2IGKA 1BBYA 2YU3A 3M8EA 4R8HA 1TW2A 2R7QA 3EDPA 2WAQA 4L5JA 4HOBA 1RR8C 1Y6IA 1JUSA 4KDPA 2NVQJ 1X19A 2EK5A 2E1OA 5K7FA 4A5NA 2FQ4A 1JKOC 4KJZA 5F27A 3BR1A 3MD2A 3BR0A 1YQAA 1XS9A 4B47A 4A3IJ 3F0CA 5TJJA 1LVAA 1SMTA 1MW7A 3VSKA 5LHIA 2UV1A 2EJRA 3CO6C 2RV8A 2JUCA 3O2PE 5M5WJ 5FJ8J 4KIBA 4LB6B 2HOAA 5ERIA 3CO7C 2RAEA 4AUXA 4ZTFA 4M71A 1W5SA 1PP8F 4KMFA 2CMPA 4FQGA 5E3LA 3SJMA 1ULYA 2XIGA 1A04A 2L7KA 1SD4A 3K1NA 4A3BJ 3M1EA 1MBFA 4JK1X 2K5CA 3GFMA 3KZIC 2OZ6A 3W6KB 1A6QA 2BV6A 3BDDA 2LDUA 2QQ8A 3PNTA 3QYFA 4V2GA 1POGA 1B8IB 4A5MA 4GYGA 1MMGA 3GTPJ 1I6XA 3HJEA 4HNUA 5F1JA 2QM3A 5K1YA 5FRMA 2VPRA 1ZLKA 4EEFG 4A3LJ 4KISA 3QYEA 5FKLA 2RC4A 4AVZA 2O8XA 2WC2A 2JRMA 4XIDA 2IGNA 1ZH5A 2G7HA 1K78B 4IHTA 5J3LA 3OY9A 3JRBA 2AQFA 3GFIA 2DOEA 1OCOH 2V9PA 2QQAA 1SFUA 3U1DA 2PBIA 3C2HA 2O7OA 1I50J 1SFKA 1FNNA 4RGSA 1UG0A 4EJOA 2EZIA 2LY1A 5D8LB 3DTKA 5JHUA 2I5UA 4XM3A 1FIAA 4KIGA 3WTVC 3G1LA 3BY6A 5CVVA 2W4SA 4FHTA 2MD0A 2QYOA 3CCJI 3OR1C 3ZPLA 3CDLA 1FIPA 3REOA 4YG2F 1LDJA 3I71A 5LRRA 4LG0A 3ZRGA 4Y13A 3CCVI 3CCRI 5TGTA 2BY0A 2EV0A 2QENA 4G94A 1X3WB 1N25A 3DPLC 5FFZA 2BZTA 4HNVA 1WHUA 1KA8A 3EUKL 3PUFA 2UXXA 1USTA 2CQQA 3O8HA 4PZJA 5IOZA 2WBMA 5E20A 3UR3C 4CZZA 4BKXA 2ESHA 2LF8A 3PM1A 4RM3A 4NC7A 2XPWA 2LH9A 4DYQA 2LC2A 3GTMJ 1WH5A 2HZTA 1TWAJ 1PUFB 2A07F 4NNJA 1G59A 3FMRA 3KEYA 1WJ5A 1HKQA 2Y2ZA 2B0LA 4QWQA 2L54A 3S16J 5E8GA 3K7AJ 3DXJF 1LJ9A 3KP2A 4W97A 2R5YA 3N4MA 1D8KA 3RSNA 3P9KA 4E7JA 4B3XA 4YFKF 1IN7A 1F5TA 3RYPA 4IHXA 2GWRA 4WCGA 4M73A 3PL8A 1UFMA 4M9ZA 1IRZA 3MZYA 4L5IA 2COBA 3BPXA 4K2EA 4CCLA 2FBHA 2E1MB 2XUBA 3LQQA 2HTJA 4CCKA 3IL2A 2TCTA 4RAYA 4H0EA 3H1CA 5HLIA 4EJWA 5J40A 3BZKA 3I54A 2XROA 1X2MA 5M3MJ 3GCMA 4EMSA 3FMQA 4AYBA 3RKXA 1XX5A 2DQLA 2WTEA 3VPRA 2M0MA 3M1CA 2X48A 3HXLA 5ICCA 1WWXA 2WAQN 1MDMA 4UB6C 2Q2EB 3GXOA 3S14J 1XD7A 2BY2A 4A0ZA 4P55A 4XSXF 4RAGA 3HKZA 4I01A 1MBEA 2DCEA 2HXIA 1F4KA 2KDOA 2F6CA 4F92B 2GIZA 2P7CB 5FLVA 2XKPA 5D8KB 2MG4A 3SEQA 1SVLA 1ITYA 3F72A 1GDTA 3ZN1A 3MQ0A 1G2HA 2MH9A 4ESJA 2F2EA 2BY3A 2NNYA 2NS7A 1Z6TA 2VQHA 5FFXA 1Z91A 1J5YA 2QF7A 3UKGA 1IJWC 2WWYA 2DMNA 1OJLA 3VODA 4DIQA 1NK2P 1ON2A 2EBIA 2E2HJ 3FK7A 3BJ6A 1WI3A 2PN6A 5HS8A 3DLLF 2DAOA 1W7PD 2DLLA 2F5FA 4BU2A 3QRFF 3DBRB 4ENKA 1PP7U 1L0OC 2H27A 1XSXA 3S2WA 2DU9A 3LSHA 2ZJ2A 5F08A 4QPQA 1O7FA 2Y0SA 2M7AA 2MA3A 2H6CA 3LSKA 4B1RA 3GTLJ 4MEYF 1HW5A 4UB8C 1ZELA 2D2WA 5J6XA 2V26A 3QAHA 2MABA 3JRCA 2PI0A 2HNHA 2O0YA 4DBRA 1KU2A 2QWWA 2EFPA 1WRJA 4FX0A 5KNLA 4U7DA 2YPRA 2VBXA 4IVNA 3FXRA 1JTYA 4P5OA 4A93J 1BI2A 4MIMA 2Y48A 3FHNA 3ZQCA 3Q5FA 4CYDA 1K78A 4IQJA 3KPHA 2EFNA 4HW0A 3WE3A 2VPLA 2EA2A 2M4GA 1NHAA 5JR3A 4I0AA 4B44A 2IA2A 4BQOA 4DZPA 1W0TA 2O8KA 4BAYA 2LSOA 4M3EA 5FKKA 2P7VB 2VJIA 3F8NA 4IHWA 2L7FP 2XAUA 2OAZA 1USSA 2X1EA 4PFPA 4AVPA 1MNDA 2IEKA 4WXDA 1C0WA 1VZ0A 2NOGA 2Z16A 3BQZA 4ITVA 2KRCA 4LITA 3U2RA 1YW7A 4BXUA 2CUZA 3GZ6A 1AWCA 3DTIA 1BC7C 4QTRA 3LL7A 1JTXA 1RNLA 2ZFUA 1T6SA 1TP4A 5E17F 4XONA 1QO0D 4ZYEA 2K4JA 2PMZA 2M5WA 3QP5A 1UCRA 5F6FA 1MBHA 4LG0B 1Z6RA 4D9JA 1TQPA 2LF7A 1FJLA 4MFEA 2MLKA 1WH7A 1U2WA 2FMYA 4AU7A 3KZZA 4WF2A 5HS7A 3IH3A 3H5NA 3K1MA 4AC0A 2VQGA 2E5NA 5DUIA 3F8FA 3HC7A 4G6DA 2KRFA 5EG0B 3E6MA 1EJ9A 1N75A 3FDYA 2ZJPF 3CJTB 2V9VA 2CH0A 2DK8A 1EH6A 3GW2A 3QOEA 3OYKA 3S1NJ 5L3BA 5J1YA 2DQRA 3SEZA 4HSTA 3E1SA 2FOWA 2KIMA 1SD7A 2BXYA 1YRNA 4PJMA 4CUGA 4BHPA 1FBQA 2CU7A 4MQ9F 4E7KA 2ME0A 2XVCA 2R5YB 1WJBA 4I98B 1IGNA 4N9HA 2LD5A 1APLC 4BNCA 2LP0A 3EUHC 3ZOBA 2VL8A 1WJFA 2UZKA 1F9NA 1BI0A 2HDCA 2EIJH 3DF8A 2ELJA 2Y30A 5D5WB 1QZZA 2FOKA 2IA0A 5DCMA 3HKZN 1PJRA 1LFBA 4C3HJ 4LLNA 3GUDA 2FBKA 1S7AA 2JSPA 4Y52J 3HOXJ 1FWZA 5K5QA 1ETQA 1BI3A 3HRSA 2P0WA 1JUMA 4HF2A 3Q0WA 5E8IA 1I1SA 1OR7C 3IAM2 4XRFA 1X58A 3U9GA 5JLWA 2O03A 2OF7A 3I0TA 4XN3A 3CDHA 3CDIA 3JCUC 2HYFA 1MSFC 1X1AA 2QKLB 5EYRA 5EZHA 2XPVA 4GDFA 2H8WA 4RB3C 1J75A 2DODA 2R5ZA 3HIFA 1P6RA 2HDWA 4EQQA 3LSPA 4M9SA 4KT5C 4QIWN 2E1CA 3QPSA 2MC3A 1KYWA 1S6LA 2QSGX 5DYMA 1YHQI 1YJNI 1WKMA 2EFQA 2HQNA 3K2ZA 2LLKA 2BEOA 3LNQA 4BXFA 5F0CA 1K4SA 3K4LA 4F52A 2WY8Q 1PDNC 4HBLA 3ZQHA 3PNYA 3VYRB 3LAPA 3R6SA 3GFJA 1VQOI 1HSJA 1BC8C 4JX4A 4BL0B 1AKHB 2XF6A 5D6FA 2CWEA 3MEXA 3NAUA 4HX8A 3ONQA 2VODA 2BXZA 2FF4A 5ILUA 4EV0A 1S3JA 1U0JA 2OC6A 2CUFA 1LVKA 3DEWA 2K3PA 1LB2A 2KIUA 3IWFA 1FYKA 5CKTA 5KAFC 2CW8A 3A4CA 5LGNA 2BE5F 4BGDA 1SD6A 2HDDA 1J7KA 1BI1A 1RRJA 5IP7J 1E3PA 1PUEE 4G6QA 2VKVA 4XBFA 2FNAA 2DT6A 1A5JA 1IO2A 1ZTRA 4E6KG 3JREA 3JAMK 3TEDA 3LFKA 2DK5A 5L3FA 3D1NI 4E7LA 1Z67A 4NC8A 1K6OA 3BTIA 3J80Z 2HXOA 2NVUB 1YX5A 2RQQA 4YIIA 3RQ4A 4HX7A 5HDNA 1R7JA 3M07A 3MKZA 3W6VA 4LIUA 3DU5A 2DO7A 3C18A 2M4KA 4RLFA 1K83J 1T2KA 2HPMA 3LSRA 2OQRA 4B4CA 2ZXJA 4BBSJ 4J19A 2X6OA 1CF7A 2KKOA 5LD2C 5K7HA 3F6VA 4II2A 4UV9A 1B4AA 4W1UA 5F0FA 4A3JJ 1IXCA 2RKHA 5C44J 5L3GA 3A2KA 1U9NA 2JQ7A 3G71I 2ZMEA 3TQNA 1JHHA 1OYWA 1QU3A 1FLIA 4PJ0C
chains in the Genus database with same CATH topology
2WY7Q 3GBGA 4C2TA 3M8JA 1N78A 3FBNB 4XLHA 1EA3A 4YEJA 4HPQA 3DQVC 4C30A 3OYFA 4X0GA 2KL4A 1GLNA 3G2BA 1P9QC 4BE1A 3TL4X 3DTEA 3AL0C 3KYLA 1UAAA 2X6YA 2CFOA 2OUMA 2R7OA 3DEEA 1BR1A 4XR6A 3I9V2 1TT0A 5FROA 2BVMA 2R7SA 2IGKA 1BOBA 3AL0B 4YELA 2R7QA 2WAQA 2O5RA 1Y6IA 3ZQQA 3L2VA 1KONA 1X19A 2Z2SB 4CA0A 3W2VA 4E4HA 5KCMA 2VXDA 4KJZA 3MD2A 2FUG2 3LMMA 4HG2A 2ZSIB 4B47A 1D0YA 1Y56A 4BACA 3OYCA 1MW7A 4PSXA 3SDBA 2UV1A 4PUSA 3VSKA 2WB1A 3OYDA 3ZXSA 2VJ4A 2QKMB 4ZTFA 2X1CA 2V4JC 1MMDA 2CMPA 3RPUD 2VKHA 1BR4A 4XKBA 1D0XA 2L7KA 4CCNA 1Z21A 2K5CA 2LREA 3PNTA 1DQUA 4E7ZA 3QYFA 3CP8A 4KT6A 3U21A 1MMGA 2UUZA 4IZZA 4HNUA 4HEA2 4HSRA 5FRMA 4BEHB 4XLFA 3NWTA 4KISA 3QYEA 3LSGA 4RMNA 4AVZA 2GOMA 2JVGA 2IGNA 3OYBA 2KP6A 4DJAA 3OY9A 1IRXA 1SAUA 4HRIA 2AQFA 3K70D 2WAFA 2KHMA 1D1AA 3W2AA 3C2HA 1Z3YA 1SFKA 1UG0A 3L2QA 1MMNA 2LY1A 3DTKA 2A6TA 4U87A 3OYJA 1X1DA 4XM3A 4CZCA 3BG7A 4CCJA 4ZJZA 4ZDPA 3C2GA 1Z7LA 2W4SA 2MD0A 3H9QA 2LG4A 2DJIA 3OR1C 5JHFA 2E5ZA 3N05A 4JQFA 3IUOA 2W1OA 3ZRGA 1ERDA 5TGTA 1WJEA 3K4JA 3DPLC 3K4CA 2VLAA 4P1WA 3OYNA 2K9MA 3OWTA 2CW7A 4HNTA 4XLEA 4DOZA 4ANJA 4DGWB 4NUBA 2R4GA 3EUKL 2RREA 5HNFA 4C2UA 2WBMA 3OOUA 3UR3C 4BJ6C 4C9YA 2L9NA 4RM3A 4NC7A 2CUJA 2UWMA 4CCOA 3QODA 2LH9A 4KITB 1E0EA 3D5LA 2LC2A 3CJRB 4XMYA 2JVHA 2V7FA 3NWSA 4NNJA 4Y4RA 1G59A 1W36C 3BCAA 3KEYA 2IGOA 1WJ5A 2M3AA 3PSFA 1S9HA 1W36D 3H35A 2VQLA 2OV7A 2KPMA 2E60A 3RSNA 3PFYA 3D5SC 4E7JA 4B3XA 2MYSA 2M7BA 4MLOA 4BE2A 2L9SA 3D5RC 3H9GA 4RLQA 3PL8A 3V42A 2MFZA 3ZCOA 4E7IA 2RNGA 4CCLA 2E1MB 2XF5A 4CCKA 3BG6A 4PJLA 2MC4A 1X1BA 2CS3A 4ZDOA 4XOTA 4AYBA 3CZ6A 2NOJB 2XC7A 4ZTJA 4XOPA 2M0MA 1V5FA 3M1CA 3L2WA 3HXLA 3BLYA 1QHHD 2W82A 2HVRA 1BR2A 1Z3XA 2Q2EB 1WJCA 2LOOA 4BQQA 3AFHA 3HKZA 2CV2A 5LFAA 2DCEA 2KDOA 2F6CA 1QHGA 4F92B 3OIPA 4N4NB 1DGWY 2GOXB 2KMUA 3LFUA 3SEQA 4DBQA 3VYTB 4Y3OA 3OS0A 3OYAA 1AA7A 2HPIA 3H5RA 1PYVA 2Q1ZB 3HOTA 3W2WA 2L5QA 2VQHA 4LG3A 4Y33A 3OYIA 3S3NA 2LY2A 2WAEA 3HUGB 4DIQA 5KHDA 3OYGA 1N77A 1UELB 2BW3B 2LBFA 4BDZA 4OWRB 2IS2A 2V9KA 2JA2A 4BU2A 2R7WA 1D0ZA 4IQ4A 1YE9A 3HPHA 3TBIA 3L2RA 1WFXA 2X6XA 4RM2A 3K4BA 3LSHA 2KLOA 2KQRA 1NG6A 2ZXHA 3H5AA 4QPQA 1K6YA 3S3OA 3K4NA 2Y0SA 2M7AA 4CSWA 1YX3A 3LSKA 1OLTA 1LFPA 1ZELA 2V26A 2MABA 2HNHA 4R79A 4DBRA 2L2OA 4PSWA 4NQWB 2R7XA 1V5EA 2W00A 5FRNA 4XL9A 5KNLA 4BE0A 1DP3A 2E1MC 4PJJA 3OIQA 4P5OA 1D1BA 4BEHA 4J01A 3S32A 1JI8A 2CV0A 4BDYA 3FHNA 4PJNA 3FBIB 4IQJA 2CV1A 1LDKB 2I8DA 2VPLA 2M4GA 4B44A 4BQOA 2X1DA 5HLTA 4PFOA 3K10A 1FMVA 2W7NA 1T95A 1WJAA 2VJIA 2XAUA 3RCOA 2X1EA 4PFPA 3ZGKA 1MNDA 2X6WA 4PK4A 3IP4B 3CESA 1VZ0A 2Z16A 2VJJA 3OL3A 4ITVA 2KRCA 4LITA 3VYSB 3S3MA 2CUZA 2K9LA 3DTIA 3LL7A 2R7VA 2ZFUA 1FMWA 3DU6A 4XONA 2PJRA 2XF7A 2PMZA 3H9JA 1MNEA 2DOAA 5CQEA 4YRVA 3SYTA 3LSIA 4D9JA 3EPZA 4GRIA 4AU7A 2R7UA 2IS1A 1MMAA 4ZYAA 2Z1DA 2HVSA 3H5NA 2VJ5A 2VQGA 3VDXA 2E5NA 2F5VA 3HC7A 1N75A 3H0DA 3FDYA 3DPTA 3HG9A 2CH0A 3OYEA 3OYKA 3QOEA 2VB6A 3F9KA 1T0FC 3SEZA 4HSTA 3E1SA 4E7SA 2VIXA 3PUBA 3CF2A 4PJMA 4CUGA 2LRDA 4IKFA 3BC8A 3OYHA 4E7KA 2R7RA 4XLCA 1WJBA 4FASD 4BJ5C 3EUHC 3VYUB 4XLAA 2VL8A 1X4OA 1WJFA 4XKWA 4F91B 3L2UA 4D1QA 3HPGA 2ELJA 2R7TA 3S8PA 1PJRA 2F4IA 3OMYA 2JSPA 4OAYA 1NG7A 3TMOA 3K70C 2V6EA 4CCMA 2IS4A 2P0WA 4F3QA 3BCBA 3MKWB 1OR7C 3IAM2 4BQNA 3K6GA 3S93A 5HVQC 2HZDA 4F93B 3CP2A 3HL2A 4XN3A 3PNVA 2V1NA 2HQAA 2X85A 1X1AA 2QKLB 3MKYB 3OS1A 4J00A 3J7AY 3IAS2 2WA0A 3DWLE 2HDWA 2VQCA 5HOOA 2BOLA 4B48A 2X51A 3MMYB 2VKDA 3CMMA 3LSMA 2WADA 1R6RA 1TZLA 3VSLA 4BXFA 4LIVA 4E7HA 3K4LA 4H4KC 3UNGC 4F52A 2WY8Q 3VWBA 3DKXA 3A1YA 2KZVA 3DPUA 3PNYA 3DLAA 1D1CA 3VYRB 4XQFA 3I3LA 4IX7A 2AQEA 2BW3A 3KX2A 4II3A 2LBFB 4BL0B 2IS6A 2XF6A 3ONQA 4ZDLA 4EATA 2JUGA 1HA8A 4JOMA 3W3CA 2IGMA 3OL4A 4B43A 1U0JA 4XORA 3SZGA 2ZSHB 2OC6A 1LVKA 1J09A 2K3PA 5CKTA 2CW8A 3A4CA 3EUAA 4XN0A 4BGDA 5CQGA 4OAZA 2ZXIA 2IXSA 4U7BA 2A5WA 3RTRA 4BJTA 3OS2A 2DT6A 4CH7A 3OYLA 3QYBA 2XDVA 3E0JB 4BUPA 4E6KG 3OYMA 1LKXA 1WJDA 4N4OB 3AKZA 3PJRA 2HVQA 4E7LA 2VXZA 1X1CA 4NC8A 5CPRB 4FETA 4QPOA 1YX5A 2RQQA 3K4KA 3FKJA 2LYCA 4XNFA 3RQ4A 3ZR8X 4F55A 3HOSA 3MKZA 3K4MA 2HU9A 4LIUA 2M4KA 3DU5A 4RLFA 4XKCA 5HNHA 3PSIA 1X4PA 2HPMA 2XSJC 2VASA 1G8XA 3OR2C 4XKVA 4BS9A 4G6TB 5LD2C 2KRHA 3DKYA 4II2A 1V5GA 4ZC3A 3CJQB 2DXIA 3A2KA 1DGRM 2BVLA 1QU3A 2DT7B 2PJRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4N B;  4FAS D;  4N4O B; 
#chains in the Genus database with same CATH topology
 2DYR H;  3SQN A;  3LA3 A;  3RKY A;  3R0J A;  2A6E F;  3PIO F;  1ZG1 A;  2A69 F;  3QPH A;  3DQV C;  4C30 A;  1ZRF A;  3K0L A;  3G2B A;  2L0K A;  2E2I J;  4P9U A;  3OSG A;  3DCF A;  3RDI A;  5EG0 A;  1H8A C;  1IAW A;  3AL0 C;  4MHG A;  3I4M J;  1V55 H;  2HYJ A;  5AON A;  3BP8 A;  4BHB A;  4YFX F;  1BR1 A;  2AXL A;  1IN5 A;  1R4N B;  2A68 F;  3K69 A;  2ZJR F;  1YRN B;  4G12 A;  1FC3 A;  5JVT A;  4YEL A;  3HRU A;  3KEO A;  1SFO J;  1ZKG A;  3ZQQ A;  2DA3 A;  5J47 A;  3DEU A;  1Z0X A;  3TDU C;  5ILS A;  3ESW B;  2I10 A;  3ZMU A;  1XG1 A;  5FGM A;  5FKN A;  2ZSI B;  1D0Y A;  1Y56 A;  2H1L A;  3ERE D;  2XRN A;  4P96 A;  4L9T A;  4PSX A;  5DCM B;  4Y17 A;  3SDB A;  3LOC A;  3WU0 A;  2WB1 A;  4DYR A;  4Q4Z F;  1WI9 A;  2QKM B;  3KLN A;  5J1U A;  3WGI A;  3ASO H;  2XAF A;  1UG2 A;  3TKY A;  1XMA A;  2X1C A;  2F4M B;  1FYL A;  1Y1V J;  1MMD A;  2PEX A;  3Q9V A;  4BH9 A;  1DU6 A;  4M3D A;  2VKH A;  2X0L A;  5GAE J;  1BR4 A;  2FBI A;  1D0X A;  4CCN A;  3S2D J;  1Z21 A;  1JGG A;  3KP5 A;  2VT3 A;  3CP8 A;  4KT6 A;  3U21 A;  2UUZ A;  2R5Z B;  4HSR A;  4XLF A;  2Z33 A;  3BZ6 A;  3ULQ B;  4RMN A;  2GOM A;  1YFH A;  4WX9 A;  4DJA A;  2DA2 A;  5BMZ A;  1K7A A;  1SAU A;  1XSV A;  4HRI A;  1RIO H;  3R60 A;  2Z99 A;  1S8N A;  4EM0 B;  1R4M B;  3W2A A;  4C3J J;  4G9Y A;  2LMD A;  4ESB A;  2H1K A;  1FEX A;  2A6T A;  4U87 A;  1AKH A;  1H9T A;  2W24 A;  3I64 A;  3M4O J;  3G1M A;  1OCR H;  3BG7 A;  1T8I A;  5JHF A;  4HV6 A;  3WU2 C;  1QPI A;  2E5Z A;  4UUV A;  1WVR A;  4AYB N;  2FJ1 A;  3IKV A;  2ZNY A;  4AWX B;  2EV5 A;  1YIJ I;  3QWL A;  1WJE A;  3K4C A;  4P1W A;  3OYN A;  2L9R A;  3FXQ A;  3VEP A;  4XLE A;  3DKW A;  1TL8 A;  2M1B A;  2BGC A;  2HFH A;  4D7M A;  3ABT A;  3EQL F;  4GYI A;  4C9Y A;  2L9N A;  3KP4 A;  4D0P A;  5FD5 A;  4ZZD A;  3J7Y J;  3G1O A;  2QGU A;  3QOD A;  5FLM J;  3GTO J;  1E0E A;  1QZY A;  3CJR B;  5B5E C;  1JJ8 C;  5J8F A;  1FY7 A;  3DFG A;  3MN2 A;  1MSE C;  1HCR A;  2A3S A;  3EET A;  1MBJ A;  4Y4R A;  5DS9 A;  4ENM A;  1P4X A;  2K9Q A;  2M3A A;  4Q47 A;  1S9H A;  1W36 D;  3L7W A;  3WOD F;  1RKT A;  2Y0S N;  2VQL A;  3KYD B;  2KPM A;  2E60 A;  4FIS A;  5GPA A;  2GXA A;  3D5S C;  3HOZ J;  3SDG A;  4Y7N J;  3IKT A;  4G7Z F;  2KIS A;  1CF7 B;  1RUO A;  3D5R C;  3GVA A;  2YS9 A;  1QA6 A;  3V42 A;  3JRF A;  2MFZ A;  2IBD A;  3HBL A;  3ZCO A;  2RNG A;  1ETK A;  1EH8 A;  2XF5 A;  2L02 A;  2ZME B;  4PJL A;  5CYV A;  3ZQF A;  1FTZ A;  4XRS A;  3X2Q H;  4YFN F;  1K61 A;  2CS3 A;  1DDN A;  3Q0U A;  2RVC A;  2EZK A;  1TTY A;  5TIS C;  1RR7 A;  2XC7 A;  4ZTJ A;  3BLY A;  3OOP A;  3JAM Z;  5DD4 A;  2QBY B;  2DPD A;  3AG3 H;  3H3Z A;  1WJC A;  3GWZ A;  4BQQ A;  3EUH A;  1ORK A;  2CV2 A;  3WU1 B;  1Z05 A;  5LFA A;  5TRD A;  4KYW A;  3ZN0 A;  2D1V A;  5B1A H;  5EF6 A;  4M6X A;  2OQG A;  4N4N B;  3QQA A;  2QQ9 A;  4DBQ A;  1G3Y A;  1TWF J;  2EWN A;  1ZYR F;  5C3E J;  2ZJQ F;  3HOV J;  3IV5 A;  1KQ8 A;  3FX3 A;  4XLN F;  1E3H A;  2L5Q A;  4LG3 A;  3S3N A;  4ON0 A;  3OSF A;  2RN7 A;  3BWG A;  1CGP A;  1S7O A;  5KHD A;  4A69 C;  2HGC A;  1N77 A;  4CIC A;  4AM3 A;  1ETW A;  1R22 A;  4OWR B;  5L3D A;  5B1B H;  1VF9 A;  3I4N J;  2JA2 A;  5L3E A;  1RPW A;  2K3F A;  2YR2 A;  2IT0 A;  3F8M A;  3HPH A;  1VQ5 I;  2X6X A;  2PMZ N;  3K4B A;  4RM2 A;  5DD8 A;  4A2U A;  3L00 A;  1SVO A;  1KQ9 A;  5HLG A;  3H36 A;  2JN6 A;  3HTS B;  1RES A;  1TWH J;  3K4N A;  3IH4 A;  4A0Y A;  5HLH A;  4XRM A;  3F8C A;  4IOC F;  1I3A A;  1YX3 A;  3F22 A;  1MJA A;  3HGG A;  1Y1W J;  2XAQ A;  1ON1 A;  5J4Y A;  4A6E A;  4I0B A;  4LOC A;  2IJL A;  1IRF A;  2O3F A;  3LA7 A;  4MFD A;  4A3E J;  4KNY A;  2W00 A;  4XL9 A;  2GXG A;  2LVS A;  1DP3 A;  2E1M C;  4PJJ A;  1RET A;  2P8T A;  3E5U A;  1D1B A;  1JI8 A;  3CCM I;  2CV0 A;  4BDY A;  3DV8 A;  3FBI B;  1SMY F;  1Y0N A;  1F1Z A;  3SZT A;  2CV1 A;  1HST A;  2STW A;  4NDL A;  4EM2 A;  1IN4 A;  2J5P A;  1O3T A;  4PFO A;  4UVA A;  1FMV A;  1HXD A;  1T95 A;  2Y31 A;  1OCT C;  1JKR C;  4AD9 A;  1GUU A;  3ZGK A;  2X6W A;  4DZJ A;  4PK4 A;  3BR5 A;  2NNN A;  2OJE D;  3S3M A;  4TV7 A;  3QOP A;  4OMZ A;  2K9L A;  4ENN A;  1W5C C;  3ZMV A;  1VQP I;  2PJR A;  1PVE A;  3H9J A;  2K02 A;  1I1G A;  5CQE A;  3A03 A;  3LSI A;  3SYT A;  2WB1 N;  1BA5 A;  3EPZ A;  1IDY A;  3PO2 J;  3ABM H;  1ZAO A;  2IS1 A;  4ZYA A;  1BJZ A;  3FXK A;  2HVS A;  2DTR A;  1DPR A;  3CCL I;  1GXP A;  1FP1 D;  1BM9 A;  1HF0 A;  2VC0 A;  3DPT A;  2DFI A;  2MH2 A;  3OYE A;  3JSP A;  4U88 A;  5CVI A;  2M34 A;  1KQ0 A;  3HRM A;  4Q48 A;  4E7S A;  2VIX A;  2Q0O A;  1FZP B;  1Z7U A;  2ZFW A;  4WXC A;  4JX5 A;  3NAR A;  4N9I A;  4HA8 A;  2W48 A;  5D4R A;  3J80 K;  1E2X A;  2HS5 A;  2CG4 A;  4BJ5 C;  1FYM A;  2ECB A;  1LPQ A;  4XLA A;  4A3K J;  5DUK A;  1Z1D A;  1W0U A;  1QVU A;  3HSE A;  1OR7 A;  2R7T A;  4L9V A;  1SEU A;  2JA6 J;  1EV7 A;  5KAI C;  1GV5 A;  3HYI A;  2QQB A;  2L3D A;  2F4I A;  4PCQ A;  3JRD A;  1HW2 A;  1VND A;  4I99 C;  1NG7 A;  3TMO A;  3K2A A;  5E1X A;  1F36 A;  2GLO A;  4DNC A;  1ZAR A;  3QU3 A;  3GYH X;  3CTA A;  2A6H F;  1B72 B;  2O9L A;  2ZO4 A;  3MKW B;  2DA4 A;  4IRH A;  3F23 A;  1MGT A;  3L09 A;  2QBY A;  1T98 A;  5HVQ C;  2HZD A;  3V7C A;  4F93 B;  1KZH A;  5K5O A;  3HL2 A;  2JA8 J;  1UHS A;  1ZGA A;  5E18 F;  2GZW A;  4BYY A;  3MKY B;  2W84 A;  1IDZ A;  1FPQ A;  1HKS A;  5K5R A;  3DWL E;  3CC7 I;  3P9C A;  2VQC A;  2HR3 A;  5HOO A;  2NVX J;  3Q9S A;  4L0Z B;  4B48 A;  2X51 A;  3MMY B;  2KFD A;  1MNM C;  3ZMZ A;  3GTK J;  3H3V K;  3R61 A;  3RI4 A;  2WAD A;  2DDB A;  4IPA A;  1TZL A;  3E6D A;  2L9V A;  4LIV A;  3ZMT A;  5BPI A;  4RDU A;  3RQI A;  2IW5 A;  3DPU A;  2KZV A;  2AS5 F;  3DLA A;  1P7J A;  3I59 A;  4HQE A;  1XC5 A;  5ED4 A;  2ACJ A;  4IX7 A;  4II3 A;  2K27 A;  1XGM A;  2VE9 A;  1O3R A;  1MBK A;  2DW4 A;  2AXT C;  3DBL B;  5M5Y J;  1HA8 A;  4OIP F;  3JRI A;  1TQI A;  2Y9Z A;  2A61 A;  3IWZ A;  2IGM A;  1OFC X;  4B43 A;  1MH4 A;  3NRV A;  2E1N A;  1HQC A;  2ESN A;  2XGX A;  1AHD P;  4B3A A;  3TW6 A;  5DM7 F;  1SVM A;  4M9X A;  1GT0 C;  5J1R A;  5LHG A;  5GPC A;  2VBY A;  2L4A A;  2QZ8 A;  4Z6Y A;  1B9N A;  1ETY A;  3V8L A;  5FD6 A;  4U7B A;  1OIS A;  2BHY A;  4BJT A;  1ETO A;  2G0E A;  3OS2 A;  4G8X A;  2CQ7 A;  4GCV A;  4CH7 A;  3T0Y A;  2QSF X;  3OYM A;  1WJD A;  1IUY A;  1T56 A;  2CJJ A;  3FMS A;  4N4O B;  3AKZ A;  3PJR A;  5AIQ A;  1X1C A;  4L5E A;  4ESF A;  4BHC A;  3K4K A;  3WTX C;  3JRH A;  1J0R A;  3K4M A;  2F5E A;  5C4J J;  1YO5 C;  5GTI C;  3G73 A;  3SXY A;  1I5Z A;  3AAF A;  2ELH A;  5HNH A;  1UMQ A;  2V6C A;  4FT8 A;  4DW6 A;  5JFR A;  1B59 A;  2M0C A;  3LWF A;  2FXA A;  3OR2 C;  4R1H A;  4B09 A;  2DPU A;  4D5F A;  2FA5 A;  3C3W A;  4BQA A;  5FB2 A;  5EDN A;  4M6V A;  1SC7 A;  1FX7 A;  2DT7 B;  1JKP C;  2PJR B;  3GBG A;  1N78 A;  2HTS A;  3JRG A;  2NXN B;  3OIO A;  5LLQ A;  5LGT A;  1Q1H A;  4A3F J;  1FOY A;  2A05 A;  1R5I D;  4V2F A;  1X3U A;  2M87 A;  2KL4 A;  3QPT A;  2XV4 S;  1P9Q C;  2XB5 A;  2AHQ A;  2PX9 A;  3RJP A;  2XAH A;  2L01 A;  3TO7 A;  5H6Q A;  3FK6 A;  3F3X A;  2JRT A;  3N97 A;  4HAM A;  4IXA A;  4L9J A;  3CCQ I;  1UJ8 A;  3ASN H;  4JBA A;  4A0X A;  1FBS A;  1Q1V A;  1IN6 A;  1YJW I;  2LKS A;  2O5R A;  3TO9 A;  4DYC A;  3GO5 A;  3HOU J;  3WHC A;  2DBB A;  4IF4 A;  2FQ3 A;  2Z2S B;  4CA0 A;  2DA6 A;  1R36 A;  1ZQ3 P;  4BXX J;  4E4H A;  5KCM A;  3CME I;  1S5L C;  2F5C A;  3BR2 A;  2FUG 2;  3MAJ A;  1WGX A;  4HG2 A;  2F5D A;  3D0S A;  5H20 A;  2VUM J;  3G3Z A;  2CYY A;  1EKE A;  5GAG J;  2R93 J;  2Z3Y A;  3K1P A;  3E6B A;  4HQM A;  2M2E A;  3E7L A;  5KVR A;  2FEZ A;  3H3U A;  1XPX A;  4OU0 A;  1D8J A;  1AU7 A;  1BW6 A;  3JR9 A;  2NVY J;  3GX4 X;  4MEX F;  1B72 A;  3O3K A;  2IA1 A;  1WQ2 A;  4AID A;  5H2F C;  5F0H A;  2LRE A;  4XRS G;  3HGY A;  1BN5 A;  5F1R A;  3ABU A;  5D5X B;  1DQU A;  1MBG A;  2PMH A;  1JJ6 C;  2P81 A;  4E7Z A;  1HDD C;  3TOB A;  5GAD J;  3GLL A;  4MO7 A;  3CQZ J;  3FXU A;  4HEA 2;  3H0G J;  3S15 J;  4XIC A;  4UUS A;  1XGS A;  3FXO A;  2HKO A;  3C7J A;  3LSG A;  2JVG A;  3J81 Z;  4U0Y A;  3ELK A;  3OYB A;  3TW7 A;  5LGU A;  2IP2 A;  2ZKZ A;  4RB1 A;  1FP2 A;  3K70 D;  1WSU A;  3I4P A;  3MVP A;  5E1Z B;  2ELK A;  2KHM A;  4EVI A;  1D1A A;  2LNB A;  1OYY A;  3S2H J;  1OCC H;  1Z3Y A;  2CO5 A;  3I59 B;  3ECO A;  3WTZ A;  2QSH X;  4PGH A;  1MMN A;  4AIJ A;  4N0B A;  3ISP A;  1X1D A;  2LTP A;  2JA7 J;  4CZC A;  4L9N A;  5M5X J;  1YTY A;  3F6O A;  3CLQ A;  3BJO A;  4ZDP A;  3C2G A;  3KYC B;  3TO6 A;  3FHZ A;  2LG4 A;  2XB0 X;  5IP6 A;  1MH3 A;  1K4T A;  4JQF A;  3IUO A;  2W1O A;  4D7N A;  3HOY J;  3K4J A;  1TC3 C;  2VLA A;  5EGO A;  2K9M A;  3G4S I;  1G3W A;  3O6B B;  3ZMD A;  4O5V A;  1T39 A;  5DTD A;  4ANJ A;  4DGW B;  4NUB A;  5B3S H;  3ML6 A;  4C2U A;  4BY7 J;  2KZG A;  3ABK H;  3F8B A;  4OIO F;  1XGO A;  2CUJ A;  2UWM A;  4I76 A;  4KIC A;  2VI6 A;  2V1D A;  3D5L A;  3S1R J;  1TW3 A;  3Q3S A;  3KIO A;  4XMY A;  2JVH A;  2EH3 A;  3MKL A;  1W36 C;  1RZ4 A;  3PSF A;  4I02 A;  3KFW X;  2NAZ A;  1M1E B;  5EEA A;  1Y39 A;  1OPC A;  1SD5 A;  3PFY A;  1FBU A;  4MLO A;  2M7B A;  3P9I A;  3BR3 A;  1ZK8 A;  3CUQ C;  3BR6 A;  4XSZ F;  3BTJ A;  4U0W A;  3KE2 A;  1S7E A;  3BG6 A;  5CVU A;  3ZQG A;  4XOT A;  2DYS H;  3BG3 A;  2K9N A;  2NOJ B;  5HDG A;  1ENH A;  1V5F A;  3L2W A;  3FZV A;  4LFU A;  4MQV A;  1QHH D;  2HVR A;  1O7L A;  1H88 C;  1BR2 A;  2EFW A;  3NEU A;  2LOO A;  4LD5 A;  1A36 A;  2VN2 A;  3HRT A;  3E3V A;  1HBX G;  3BZC A;  1UHW A;  1VQN I;  3GME A;  2KMU A;  2E19 A;  2UXN A;  1TNT A;  1YG2 A;  4Y3O A;  3OS0 A;  2TDX A;  3I58 A;  2F4O B;  1IG7 A;  4EJU A;  4HDU A;  1AA7 A;  2HYG D;  3H5R A;  3KCC A;  1PYV A;  2Q1Z B;  4Z2Y A;  3W2W A;  3CF5 F;  4Y33 A;  1ZRE A;  5C4X J;  3SZP A;  3LST A;  5ICG A;  5J8C A;  1BJA A;  3HUG B;  2VOP A;  1R58 A;  2CFX A;  2KJB A;  1OCP A;  1LEB A;  2BW3 B;  2LBF A;  2W57 A;  4BDZ A;  4M74 A;  1K79 A;  2IS2 A;  2D5V A;  5HOD A;  2R7W A;  1T0F A;  1HC8 A;  1D0Z A;  2N8G A;  2YUS A;  4IHY A;  4HV5 A;  3V7R A;  1XCB A;  3L2R A;  1WFX A;  2OPT A;  1NG6 A;  2KLO A;  3GTJ J;  2L7M P;  2ETH A;  4IL6 C;  2VBZ A;  3B02 A;  2HI3 A;  3SFI A;  5FLX K;  4Y15 A;  4OIQ F;  4OIN F;  3PIP F;  2Z5U A;  1X2N A;  3HEF A;  2DMQ A;  4LMY A;  3J7A O;  3SFZ A;  1ZLJ A;  1U5T B;  2L2O A;  4PGG A;  1CQT A;  2R7X A;  4JX6 A;  1YW8 A;  3CUQ B;  5EEG A;  4O6J A;  4EJT A;  5FRN A;  5JI6 A;  3CCY A;  1RKW A;  3ABL H;  3BT9 A;  2VC1 A;  3TOA A;  1KGS A;  3ZQI A;  4UUS B;  2E7W A;  3S32 A;  4J01 A;  4KA4 A;  3AG2 H;  1VQK I;  3I56 I;  2HWV A;  1H9G A;  4PJN A;  2L7Z A;  2NRA C;  2I8D A;  1W1W E;  1R1V A;  2JWT A;  4RGU A;  1B6A A;  3CCU I;  2DA5 A;  2X1D A;  4CGZ A;  3L9F A;  5BQT A;  5EEH A;  1SFE A;  2OU2 A;  2W7N A;  1WJA A;  5E1W A;  3TGN A;  3WG7 H;  4B8X A;  3RCO A;  2ECC A;  1NK3 P;  3CMY A;  2EIL H;  3MZ8 A;  3IP4 B;  3CES A;  3OL3 A;  3HB9 A;  5FKM A;  2P5K A;  3W6J B;  2R7V A;  2MLG A;  1U8B A;  2OBP A;  1FMW A;  3DU6 A;  1Y8Q B;  1YIO A;  1MNE A;  2DOA A;  4ZYG A;  4EGZ A;  1VTN C;  2XSD C;  5IT3 A;  2HEO A;  3H92 A;  3DP7 A;  5EGO B;  2CW0 F;  1QQI A;  2R7U A;  1TBX A;  2K40 A;  1IN8 A;  3J81 K;  3JTH A;  3H0D A;  3HG9 A;  3M3Y J;  1WCM J;  3KET A;  3O8G A;  3GFL A;  3F9K A;  1T0F C;  3C1D A;  2DN0 A;  3PUB A;  2BBY A;  1WPK A;  3P7N A;  1O57 A;  4IKF A;  3LA2 A;  1GXQ A;  2ID6 A;  5IP9 J;  4XLC A;  2R7R A;  4LLL A;  5HDK A;  4E70 A;  3FWE A;  3VYU B;  4XKW A;  4F91 B;  3PO3 J;  4GFB A;  2CGP A;  3MCZ A;  3T5X A;  1LEA A;  2EA4 A;  3FIW A;  4KN7 X;  3IRR A;  4AIH A;  3S8P A;  3FM5 A;  4S04 A;  4QLC U;  4YIF A;  4GO1 A;  1FSE A;  3OMY A;  4HF0 A;  2IPQ X;  4OAY A;  4IOA F;  5HS9 A;  5ILV A;  4OIR F;  4CCM A;  1ONV A;  4NBQ A;  2YU9 J;  2V1X A;  1IV6 A;  3KP3 A;  1OMI A;  1XMK A;  2R7Z J;  1OQY A;  1JHF A;  4S0H B;  4UV8 A;  4BQN A;  2Y75 A;  3HSR A;  4BY1 J;  4FCY A;  3FKI J;  2P6T A;  2LK2 A;  4MTD A;  1S72 I;  1XDU A;  4LJZ F;  3FXM A;  3S1M J;  1XSD A;  4J00 A;  3BJA A;  4IO9 F;  2QVO A;  4LGW A;  1IRG A;  2PG4 A;  3HHG A;  2E71 A;  3SHF A;  3CMA I;  2BOL A;  3ZP5 A;  3GTQ J;  1LE8 B;  2VKD A;  1GVD A;  3GZN B;  4KIF A;  2LKX A;  1WZ2 A;  3FIS A;  1R71 A;  1P92 A;  1R6R A;  2G9W A;  3VSL A;  4LK1 F;  3L2C A;  4P9F A;  4I09 A;  4H4K C;  3UNG C;  4A3G J;  3ROU A;  3DKX A;  3A1Y A;  4XQF A;  1D1C A;  3HUG A;  3PFI A;  5LHH A;  1QRY A;  5D5V B;  2QCO A;  3A01 A;  2BW3 A;  2LBF B;  4XK4 A;  1B9M A;  4GGG A;  2GXB A;  2JUG A;  3I5U A;  3W3C A;  1VFC A;  4V19 K;  2HOE A;  4FE7 A;  2LKP A;  1FOX A;  4XOR A;  4GXO A;  2CQK A;  2QUF A;  3GF2 A;  1TLH B;  2K4B A;  1OYI A;  1HDP A;  2PFB A;  2Q8K A;  3OV8 A;  3EUA A;  4XN0 A;  5A2Q K;  1XCV A;  1OCZ H;  5CQG A;  3DBH B;  1GHC A;  1U9O A;  3A0H C;  1VQ7 I;  2CQN A;  2IXS A;  1U5T A;  3HDD A;  2O6G E;  2NYX A;  2A5W A;  3CUQ A;  1MD0 A;  3RTR A;  4M3F A;  1UZC A;  5E3M A;  1KU7 A;  3QYB A;  2FML A;  2KIQ A;  1A6I A;  1XMX A;  1LKX A;  5F64 A;  4CYC B;  3RZD J;  4PDK A;  1VQ4 I;  2FE3 A;  2HVQ A;  1FT9 A;  2VXZ A;  2Y69 H;  1BIB A;  5CPR B;  4FET A;  4F55 A;  1IW7 F;  4XNF A;  3HOS A;  2LYC A;  4L18 B;  1F43 A;  2F48 A;  1VQ8 I;  2EIN H;  2JA5 J;  3ZQ7 A;  2DTZ A;  1FOW A;  1DP7 P;  2XSJ C;  1XN7 A;  2FU4 A;  1G8X A;  1G6N A;  2K9S A;  4RAZ A;  4I6Z A;  2ZCW A;  3ZQL A;  5ICF A;  4XLP F;  1SFX A;  2OCC H;  2KRH A;  3BG5 A;  3EYY A;  4ZC3 A;  2QA4 I;  1MJ9 A;  2EZH A;  1ZR2 A;  5FLX Z;  2JPC A;  3CJQ B;  2QEX I;  3F21 A;  4G7O F;  1DGR M;  1SAX A;  1STZ A;  2BVL A;  5B66 C;  3E5X A;  2RDP A;  1ZG5 A;  4C2T A;  2EIM H;  3FBN B;  4XLH A;  4YEJ A;  4AIK A;  2FD5 A;  2G7U A;  4WXH A;  1GLN A;  5GTH C;  2YSR A;  4BE1 A;  3JSO A;  2DFF A;  3TL4 X;  1TNS A;  1R49 A;  2X6Y A;  4RS8 A;  1YJ9 I;  2ZBK A;  2EFO A;  2TRT A;  3BPV A;  3C2B A;  2HOS A;  1TT0 A;  2R7S A;  2BVM A;  3Q0V A;  5CJ9 A;  3GLX A;  3WE2 A;  5BS6 A;  1U78 A;  1BOB A;  3AL0 B;  2EB7 A;  3FM3 A;  4LLG F;  1KU3 A;  1G3S A;  3T8T A;  1H89 C;  3L2V A;  1KON A;  2XGC A;  4RBO A;  3W2V A;  4RB2 C;  2XAS A;  4I7H A;  1IV8 A;  2VXD A;  4EM1 A;  1DPU A;  2NS8 A;  3LMM A;  5CLS A;  3TP3 A;  2JJ7 A;  4BAC A;  3OYC A;  4JYK A;  2ID3 A;  2LFB A;  1G4D A;  4PUS A;  2P4W A;  3OYD A;  1J2X A;  3HM5 A;  1YIT I;  1JGS A;  2VJ4 A;  3ZXS A;  1A31 A;  2XGD A;  5IPA A;  2CRG A;  2M45 A;  4RAF A;  2OTL I;  2V4J C;  4ETS A;  3WTU C;  3RPU D;  2Y9Y A;  4XKB A;  3ZMS A;  5JLX A;  1JE8 A;  1XDS A;  4OMY A;  1O3S A;  4NQW A;  4A12 A;  2FX0 A;  1U3E M;  1BW5 A;  4WK8 F;  1O4X A;  3IH2 A;  4IZZ A;  4BEH B;  2B9S A;  1IXR C;  3NWT A;  2B7E A;  4C3I J;  3S1Q J;  2GBY A;  1LE8 A;  3CC4 I;  2KP6 A;  4C2M J;  1IUF A;  4KN4 X;  4FTH A;  3MZH A;  1IRX A;  3IRQ A;  5BNG A;  2WV0 A;  2MW8 A;  2GA1 A;  2M8E A;  5CVR A;  4ABZ A;  2WAF A;  1D5Y A;  1GV2 A;  3TP0 A;  2LR8 A;  4LK0 F;  3WGG A;  4RB0 A;  3KZY A;  2Y0M A;  2DMT A;  1Z77 A;  3PQJ A;  3A01 B;  2GIV A;  3L2Q A;  2DI3 A;  3OYJ A;  3CC2 I;  4A3D J;  3CUO A;  2HKX A;  2K7L A;  4KMU X;  5D4S A;  4ZJZ A;  4CCJ A;  3V7S A;  1IC8 A;  3H9Q A;  1Z7L A;  2J5O A;  2DJI A;  3BTC A;  4UY8 I;  3N05 A;  3U1K A;  2K86 A;  1ERD A;  3HTU A;  1VI0 A;  4M3B A;  2BY1 A;  5JVG F;  4CO8 A;  3GTG J;  3OWT A;  2CW7 A;  3IHU A;  4HNT A;  2K85 A;  4DOZ A;  1ETX A;  2WV1 A;  5IOY A;  2STT A;  2R4G A;  2RRE A;  5HNF A;  2HOT A;  4IHS A;  5IYD J;  1MIJ A;  3OOU A;  3P5J A;  4BJ6 C;  3COA C;  1FSH A;  3FXL A;  1ETV A;  2BYV E;  4CCO A;  1W5T A;  4A3M J;  2PJP A;  1YS7 A;  5DV5 A;  4KIT B;  2KIF A;  3G6E I;  4CYC A;  2XPU A;  3CCE I;  2V7F A;  3NWS A;  1RC9 A;  1J59 A;  4X6A J;  4JP0 A;  3AG1 H;  3BCA A;  2IGO A;  4IEJ A;  4HDV A;  1U8R A;  1YYV A;  4MTE A;  3H35 A;  5ICE A;  2R0Q C;  2OV7 A;  1REP C;  3WG9 A;  2MYS A;  3GEZ A;  1P4A A;  4DQ2 A;  3B73 A;  4BE2 A;  2L9S A;  4M3G A;  3H9G A;  4YIR X;  4RLQ A;  4E7I A;  3VFZ A;  3HZJ A;  2ZC2 A;  5A2Q Z;  4M6Y A;  4G7H F;  1B1B A;  3RKW A;  4F7Z A;  2IVM A;  2MC4 A;  2ISY A;  1QPM A;  5IT9 Z;  1X1B A;  2OA4 A;  3T8R A;  2HQR A;  4ZDO A;  2GA2 A;  1JKQ C;  3CZ6 A;  1ZR4 A;  4XOP A;  1X1P A;  4HYE A;  2W82 A;  1XTA A;  2JT1 A;  4RGR A;  1ZRD A;  1Z3X A;  3QU6 A;  2IAI A;  1MJB A;  2M9H A;  3AFH A;  5DM6 F;  4O3M A;  4HX4 A;  1QHG A;  3RPQ A;  3R4K A;  3OIP A;  4HLX A;  1X3Z B;  1EF4 A;  1DGW Y;  5LEJ A;  2GOX B;  2JPB A;  3LFU A;  1JT0 A;  1OKR A;  3VYT B;  3V8J A;  1LQ1 A;  5EZG A;  1ODD A;  1QNT A;  2P5V A;  3CLO A;  2HPI A;  3OYA A;  1RUN A;  1S29 A;  1P4W A;  2PLY A;  3LSJ A;  2DJN A;  5K7Z A;  5E3O A;  1U6G A;  2DFE A;  3L1P A;  3HOT A;  2DDA A;  1R5H A;  1FOK A;  2V1U A;  5E79 C;  2XHK A;  1R5G A;  3BTL A;  5GAH J;  3OYI A;  1D3Y A;  3NQO A;  2LY2 A;  2WAE A;  5KK1 A;  3J7Z I;  3OYG A;  3RZO J;  1JT6 A;  1UEL B;  2E7X A;  1H0M A;  2V9K A;  4FX4 A;  2EZL A;  4IQ4 A;  1YE9 A;  5DDG A;  1Z9C A;  2NVT J;  3TBI A;  1J9I A;  4LB5 A;  1Y8R B;  4CDG A;  4L0Y B;  1W7P B;  2KQR A;  1YS6 A;  2ZXH A;  2VOO A;  1AOY A;  2EIK H;  3H5A A;  1K6Y A;  3S3O A;  2XKO A;  1V4R A;  4ENJ A;  1QZE A;  2AO9 A;  4CSW A;  4IRI A;  2W85 A;  1OLT A;  4MGR A;  2DOF A;  1LFP A;  3HHH A;  5IT9 K;  3TDZ C;  1QVT A;  4R79 A;  1TWG J;  4RA2 A;  4PSW A;  4NQW B;  3S17 J;  1V5E A;  1NTC A;  3IC7 A;  3AG4 H;  4BE0 A;  3V4G A;  3FXJ A;  3OIQ A;  3A02 A;  3EYI A;  2DT5 A;  3E5Q A;  4BEH A;  2ISZ A;  2D1H A;  5BPD A;  1ZHF A;  2M8G X;  4QSH A;  1VQL I;  1I3Q J;  1MKM A;  3T1B A;  5IYB J;  1LDK B;  2HQ5 A;  2ZNZ A;  2OCE A;  1QGP A;  1BIA A;  2VT2 A;  5HLT A;  2R92 J;  1Y0U A;  3K10 A;  2IRF G;  1JUP A;  1ZRC A;  1BL0 A;  1IXS B;  4ZZL A;  1TWC J;  4IHV A;  1A35 A;  3VB2 A;  2VJJ A;  3VYS B;  1UHM A;  1IZ1 A;  2C6Y A;  5LEK A;  3KP7 A;  3JTG A;  2H09 A;  2XAG A;  3ERM A;  3KEQ A;  2XF7 A;  4YRV A;  2DMP A;  4GRI A;  1YLF A;  3LQR A;  1L3L A;  3HSF A;  2QLZ A;  5FO5 A;  2E35 A;  1RI7 A;  1MMA A;  1IF1 A;  2Z1D A;  1ZGW A;  1E3O C;  1HKT A;  5M3F J;  2VON A;  2VJ5 A;  5H6R A;  3VDX A;  2R7D A;  3HOW J;  2F5V A;  2JZY A;  1GVJ A;  2NS0 A;  4IRG A;  2VE8 A;  3PQK A;  3WTY C;  2D45 A;  1TQM A;  1DUX C;  1XGN A;  2BHZ A;  2VB6 A;  3WTT C;  2XAJ A;  3A0B C;  2ME6 A;  4CXF A;  2JSC A;  3R0A A;  3CF2 A;  5CVJ A;  1MZB A;  5FKO A;  2FRH A;  2LRD A;  2VKE A;  2XRL A;  3WGH A;  3WHB A;  3BC8 A;  1JXS A;  2DA7 A;  3CJN A;  3OYH A;  1VQ9 I;  2R7F A;  2XGE A;  1G3T A;  5E3N A;  3ECH A;  4FAS D;  3M9A A;  4ZH4 F;  4KUM A;  3I55 I;  2H6B A;  1X4O A;  1I27 A;  2EPF A;  4WWC A;  3JRA A;  3L2U A;  1LFU P;  1E17 A;  4D1Q A;  1D5V A;  3HPG A;  4NC6 A;  2YX4 A;  3BRO A;  1ACI A;  2O61 A;  5BOX A;  2CSO A;  2PQ8 A;  1V3F A;  4ZYD A;  2E2J J;  2MD5 A;  1YW9 A;  4HZF A;  2KT0 A;  1V54 H;  4BBR J;  3K70 C;  2V6E A;  1KU9 A;  1KYZ A;  4UVC A;  1R1U A;  3RIR A;  2CUE A;  1T38 A;  2IS4 A;  4F3Q A;  1ZG3 A;  4MNU A;  3LAJ A;  5GP9 A;  2RGV A;  3BCB A;  1I6H J;  3BQY A;  5IY5 H;  1T33 A;  1O3Q A;  3K6G A;  3S93 A;  4RGX A;  2OZU A;  2MSY A;  3B6C A;  3CP2 A;  4UXN A;  1HLV A;  1NH3 A;  3PNV A;  3K9T A;  2JMW A;  4FE4 A;  2V1N A;  2HQA A;  2X85 A;  2A5Y B;  4U0V A;  3CCS I;  1MMS A;  3V8K A;  2PMU A;  1R1T A;  3OS1 A;  2MGQ A;  1B8I A;  2KJC A;  3J7A Y;  3IAS 2;  2WA0 A;  2P6S A;  3E97 A;  4D5C A;  4NB5 A;  1FTT A;  5LRS A;  4I2O A;  3CMM A;  2ADU A;  3WTS C;  3RPU A;  1UB9 A;  2DA1 A;  3LSM A;  4A6D A;  2MBF A;  4EGY A;  2GM4 A;  4E7H A;  3MWM A;  1P2F A;  2DMU A;  1YI2 I;  3E6C C;  2COM A;  3VWB A;  4UNO A;  2E34 A;  2ICW G;  3I3L A;  3QP6 A;  4M72 A;  1QBJ A;  3VOE A;  2AQE A;  3KX2 A;  2IS6 A;  5D6E A;  3WTW C;  3GZ5 A;  3FF5 A;  5J4V A;  1EH7 A;  3JW4 A;  4EJV A;  2KDZ A;  3CD6 I;  2W25 A;  1DU0 A;  4EAT A;  4UVB A;  4ZDL A;  2X4H A;  4JOM A;  3OL4 A;  4Q5S F;  2EQR A;  2ZXW H;  5F04 A;  4A3C J;  1W7P A;  1LDD A;  3SZG A;  2GAU A;  2ZSH B;  3KLO A;  1J09 A;  3MFK A;  3BG9 A;  2X9D A;  1R00 A;  2CQX A;  2JTV A;  2ZME C;  4OAZ A;  4ZYH A;  2ZXI A;  4HLY A;  2YX7 A;  5DEQ A;  5AIP A;  4UHT A;  2VBW A;  5D5U B;  3M8F A;  4UUT A;  2H94 A;  4NHJ A;  2P5L C;  3OYL A;  1VQ6 I;  2OTJ I;  2XDV A;  3E0J B;  4BUP A;  2FNP A;  2L4M A;  1ZGJ A;  1HW1 A;  3RYR A;  1PUF A;  1LUJ B;  4S05 A;  4IJA A;  4HF1 A;  2R3S A;  1U5T C;  4QPO A;  3BOQ A;  3ZR8 X;  3FKJ A;  3B6A A;  2LY9 A;  2DFH A;  2HU9 A;  1I39 A;  2FSW A;  2B63 J;  1BOA A;  4XKC A;  2RNJ A;  3PSI A;  1X4P A;  3I53 A;  2VAS A;  2OD5 A;  4XKV A;  4BS9 A;  4G6T B;  2RQP A;  5L3C A;  3DKY A;  3KP6 A;  1V5G A;  1XB4 A;  2DXI A;  1YOV B;  5IYC J;  1SAN A;  3QPL A;  1R9T J;  1ZN2 A;  9ANT A;  4OOI A;  3M7G A;  2E36 A;  2WY7 Q;  3M8J A;  1P7I A;  6PAX A;  1W4M A;  3RKQ A;  5EJC A;  1EA3 A;  4HPQ A;  3OYF A;  4X0G A;  1MDM B;  4KFC A;  1TT5 B;  2Q2E A;  4ASN A;  2M30 A;  1HOM A;  3DTE A;  2V79 A;  1R23 A;  3KYL A;  2GQQ A;  1LNW A;  1UAA A;  2EV6 A;  2Z9O A;  2JK3 A;  2CFO A;  2ZB9 A;  2OUM A;  5LBQ A;  2R7O A;  1VQM I;  4X1E A;  5DCF A;  2H8R A;  1T08 B;  3DEE A;  4CHU A;  4XR6 A;  3I9V 2;  5FRO A;  2IGK A;  1BBY A;  2YU3 A;  3M8E A;  4R8H A;  1TW2 A;  2R7Q A;  3EDP A;  2WAQ A;  4L5J A;  4HOB A;  1RR8 C;  1Y6I A;  1JUS A;  4KDP A;  2NVQ J;  1X19 A;  2EK5 A;  2E1O A;  5K7F A;  4A5N A;  2FQ4 A;  1JKO C;  4KJZ A;  5F27 A;  3BR1 A;  3MD2 A;  3BR0 A;  1YQA A;  1XS9 A;  4B47 A;  4A3I J;  3F0C A;  5TJJ A;  1LVA A;  1SMT A;  1MW7 A;  3VSK A;  5LHI A;  2UV1 A;  2EJR A;  3CO6 C;  2RV8 A;  2JUC A;  3O2P E;  5M5W J;  5FJ8 J;  4KIB A;  4LB6 B;  2HOA A;  5ERI A;  3CO7 C;  2RAE A;  4AUX A;  4ZTF A;  4M71 A;  1W5S A;  1PP8 F;  4KMF A;  2CMP A;  4FQG A;  5E3L A;  3SJM A;  1ULY A;  2XIG A;  1A04 A;  2L7K A;  1SD4 A;  3K1N A;  4A3B J;  3M1E A;  1MBF A;  4JK1 X;  2K5C A;  3GFM A;  3KZI C;  2OZ6 A;  3W6K B;  1A6Q A;  2BV6 A;  3BDD A;  2LDU A;  2QQ8 A;  3PNT A;  3QYF A;  4V2G A;  1POG A;  1B8I B;  4A5M A;  4GYG A;  1MMG A;  3GTP J;  1I6X A;  3HJE A;  4HNU A;  5F1J A;  2QM3 A;  5K1Y A;  5FRM A;  2VPR A;  1ZLK A;  4EEF G;  4A3L J;  4KIS A;  3QYE A;  5FKL A;  2RC4 A;  4AVZ A;  2O8X A;  2WC2 A;  2JRM A;  4XID A;  2IGN A;  1ZH5 A;  2G7H A;  1K78 B;  4IHT A;  5J3L A;  3OY9 A;  3JRB A;  2AQF A;  3GFI A;  2DOE A;  1OCO H;  2V9P A;  2QQA A;  1SFU A;  3U1D A;  2PBI A;  3C2H A;  2O7O A;  1I50 J;  1SFK A;  1FNN A;  4RGS A;  1UG0 A;  4EJO A;  2EZI A;  2LY1 A;  5D8L B;  3DTK A;  5JHU A;  2I5U A;  4XM3 A;  1FIA A;  4KIG A;  3WTV C;  3G1L A;  3BY6 A;  5CVV A;  2W4S A;  4FHT A;  2MD0 A;  2QYO A;  3CCJ I;  3OR1 C;  3ZPL A;  3CDL A;  1FIP A;  3REO A;  4YG2 F;  1LDJ A;  3I71 A;  5LRR A;  4LG0 A;  3ZRG A;  4Y13 A;  3CCV I;  3CCR I;  5TGT A;  2BY0 A;  2EV0 A;  2QEN A;  4G94 A;  1X3W B;  1N25 A;  3DPL C;  5FFZ A;  2BZT A;  4HNV A;  1WHU A;  1KA8 A;  3EUK L;  3PUF A;  2UXX A;  1UST A;  2CQQ A;  3O8H A;  4PZJ A;  5IOZ A;  2WBM A;  5E20 A;  3UR3 C;  4CZZ A;  4BKX A;  2ESH A;  2LF8 A;  3PM1 A;  4RM3 A;  4NC7 A;  2XPW A;  2LH9 A;  4DYQ A;  2LC2 A;  3GTM J;  1WH5 A;  2HZT A;  1TWA J;  1PUF B;  2A07 F;  4NNJ A;  1G59 A;  3FMR A;  3KEY A;  1WJ5 A;  1HKQ A;  2Y2Z A;  2B0L A;  4QWQ A;  2L54 A;  3S16 J;  5E8G A;  3K7A J;  3DXJ F;  1LJ9 A;  3KP2 A;  4W97 A;  2R5Y A;  3N4M A;  1D8K A;  3RSN A;  3P9K A;  4E7J A;  4B3X A;  4YFK F;  1IN7 A;  1F5T A;  3RYP A;  4IHX A;  2GWR A;  4WCG A;  4M73 A;  3PL8 A;  1UFM A;  4M9Z A;  1IRZ A;  3MZY A;  4L5I A;  2COB A;  3BPX A;  4K2E A;  4CCL A;  2FBH A;  2E1M B;  2XUB A;  3LQQ A;  2HTJ A;  4CCK A;  3IL2 A;  2TCT A;  4RAY A;  4H0E A;  3H1C A;  5HLI A;  4EJW A;  5J40 A;  3BZK A;  3I54 A;  2XRO A;  1X2M A;  5M3M J;  3GCM A;  4EMS A;  3FMQ A;  4AYB A;  3RKX A;  1XX5 A;  2DQL A;  2WTE A;  3VPR A;  2M0M A;  3M1C A;  2X48 A;  3HXL A;  5ICC A;  1WWX A;  2WAQ N;  1MDM A;  4UB6 C;  2Q2E B;  3GXO A;  3S14 J;  1XD7 A;  2BY2 A;  4A0Z A;  4P55 A;  4XSX F;  4RAG A;  3HKZ A;  4I01 A;  1MBE A;  2DCE A;  2HXI A;  1F4K A;  2KDO A;  2F6C A;  4F92 B;  2GIZ A;  2P7C B;  5FLV A;  2XKP A;  5D8K B;  2MG4 A;  3SEQ A;  1SVL A;  1ITY A;  3F72 A;  1GDT A;  3ZN1 A;  3MQ0 A;  1G2H A;  2MH9 A;  4ESJ A;  2F2E A;  2BY3 A;  2NNY A;  2NS7 A;  1Z6T A;  2VQH A;  5FFX A;  1Z91 A;  1J5Y A;  2QF7 A;  3UKG A;  1IJW C;  2WWY A;  2DMN A;  1OJL A;  3VOD A;  4DIQ A;  1NK2 P;  1ON2 A;  2EBI A;  2E2H J;  3FK7 A;  3BJ6 A;  1WI3 A;  2PN6 A;  5HS8 A;  3DLL F;  2DAO A;  1W7P D;  2DLL A;  2F5F A;  4BU2 A;  3QRF F;  3DBR B;  4ENK A;  1PP7 U;  1L0O C;  2H27 A;  1XSX A;  3S2W A;  2DU9 A;  3LSH A;  2ZJ2 A;  5F08 A;  4QPQ A;  1O7F A;  2Y0S A;  2M7A A;  2MA3 A;  2H6C A;  3LSK A;  4B1R A;  3GTL J;  4MEY F;  1HW5 A;  4UB8 C;  1ZEL A;  2D2W A;  5J6X A;  2V26 A;  3QAH A;  2MAB A;  3JRC A;  2PI0 A;  2HNH A;  2O0Y A;  4DBR A;  1KU2 A;  2QWW A;  2EFP A;  1WRJ A;  4FX0 A;  5KNL A;  4U7D A;  2YPR A;  2VBX A;  4IVN A;  3FXR A;  1JTY A;  4P5O A;  4A93 J;  1BI2 A;  4MIM A;  2Y48 A;  3FHN A;  3ZQC A;  3Q5F A;  4CYD A;  1K78 A;  4IQJ A;  3KPH A;  2EFN A;  4HW0 A;  3WE3 A;  2VPL A;  2EA2 A;  2M4G A;  1NHA A;  5JR3 A;  4I0A A;  4B44 A;  2IA2 A;  4BQO A;  4DZP A;  1W0T A;  2O8K A;  4BAY A;  2LSO A;  4M3E A;  5FKK A;  2P7V B;  2VJI A;  3F8N A;  4IHW A;  2L7F P;  2XAU A;  2OAZ A;  1USS A;  2X1E A;  4PFP A;  4AVP A;  1MND A;  2IEK A;  4WXD A;  1C0W A;  1VZ0 A;  2NOG A;  2Z16 A;  3BQZ A;  4ITV A;  2KRC A;  4LIT A;  3U2R A;  1YW7 A;  4BXU A;  2CUZ A;  3GZ6 A;  1AWC A;  3DTI A;  1BC7 C;  4QTR A;  3LL7 A;  1JTX A;  1RNL A;  2ZFU A;  1T6S A;  1TP4 A;  5E17 F;  4XON A;  1QO0 D;  4ZYE A;  2K4J A;  2PMZ A;  2M5W A;  3QP5 A;  1UCR A;  5F6F A;  1MBH A;  4LG0 B;  1Z6R A;  4D9J A;  1TQP A;  2LF7 A;  1FJL A;  4MFE A;  2MLK A;  1WH7 A;  1U2W A;  2FMY A;  4AU7 A;  3KZZ A;  4WF2 A;  5HS7 A;  3IH3 A;  3H5N A;  3K1M A;  4AC0 A;  2VQG A;  2E5N A;  5DUI A;  3F8F A;  3HC7 A;  4G6D A;  2KRF A;  5EG0 B;  3E6M A;  1EJ9 A;  1N75 A;  3FDY A;  2ZJP F;  3CJT B;  2V9V A;  2CH0 A;  2DK8 A;  1EH6 A;  3GW2 A;  3QOE A;  3OYK A;  3S1N J;  5L3B A;  5J1Y A;  2DQR A;  3SEZ A;  4HST A;  3E1S A;  2FOW A;  2KIM A;  1SD7 A;  2BXY A;  1YRN A;  4PJM A;  4CUG A;  4BHP A;  1FBQ A;  2CU7 A;  4MQ9 F;  4E7K A;  2ME0 A;  2XVC A;  2R5Y B;  1WJB A;  4I98 B;  1IGN A;  4N9H A;  2LD5 A;  1APL C;  4BNC A;  2LP0 A;  3EUH C;  3ZOB A;  2VL8 A;  1WJF A;  2UZK A;  1F9N A;  1BI0 A;  2HDC A;  2EIJ H;  3DF8 A;  2ELJ A;  2Y30 A;  5D5W B;  1QZZ A;  2FOK A;  2IA0 A;  5DCM A;  3HKZ N;  1PJR A;  1LFB A;  4C3H J;  4LLN A;  3GUD A;  2FBK A;  1S7A A;  2JSP A;  4Y52 J;  3HOX J;  1FWZ A;  5K5Q A;  1ETQ A;  1BI3 A;  3HRS A;  2P0W A;  1JUM A;  4HF2 A;  3Q0W A;  5E8I A;  1I1S A;  1OR7 C;  3IAM 2;  4XRF A;  1X58 A;  3U9G A;  5JLW A;  2O03 A;  2OF7 A;  3I0T A;  4XN3 A;  3CDH A;  3CDI A;  3JCU C;  2HYF A;  1MSF C;  1X1A A;  2QKL B;  5EYR A;  5EZH A;  2XPV A;  4GDF A;  2H8W A;  4RB3 C;  1J75 A;  2DOD A;  2R5Z A;  3HIF A;  1P6R A;  2HDW A;  4EQQ A;  3LSP A;  4M9S A;  4KT5 C;  4QIW N;  2E1C A;  3QPS A;  2MC3 A;  1KYW A;  1S6L A;  2QSG X;  5DYM A;  1YHQ I;  1YJN I;  1WKM A;  2EFQ A;  2HQN A;  3K2Z A;  2LLK A;  2BEO A;  3LNQ A;  4BXF A;  5F0C A;  1K4S A;  3K4L A;  4F52 A;  2WY8 Q;  1PDN C;  4HBL A;  3ZQH A;  3PNY A;  3VYR B;  3LAP A;  3R6S A;  3GFJ A;  1VQO I;  1HSJ A;  1BC8 C;  4JX4 A;  4BL0 B;  1AKH B;  2XF6 A;  5D6F A;  2CWE A;  3MEX A;  3NAU A;  4HX8 A;  3ONQ A;  2VOD A;  2BXZ A;  2FF4 A;  5ILU A;  4EV0 A;  1S3J A;  1U0J A;  2OC6 A;  2CUF A;  1LVK A;  3DEW A;  2K3P A;  1LB2 A;  2KIU A;  3IWF A;  1FYK A;  5CKT A;  5KAF C;  2CW8 A;  3A4C A;  5LGN A;  2BE5 F;  4BGD A;  1SD6 A;  2HDD A;  1J7K A;  1BI1 A;  1RRJ A;  5IP7 J;  1E3P A;  1PUE E;  4G6Q A;  2VKV A;  4XBF A;  2FNA A;  2DT6 A;  1A5J A;  1IO2 A;  1ZTR A;  4E6K G;  3JRE A;  3JAM K;  3TED A;  3LFK A;  2DK5 A;  5L3F A;  3D1N I;  4E7L A;  1Z67 A;  4NC8 A;  1K6O A;  3BTI A;  3J80 Z;  2HXO A;  2NVU B;  1YX5 A;  2RQQ A;  4YII A;  3RQ4 A;  4HX7 A;  5HDN A;  1R7J A;  3M07 A;  3MKZ A;  3W6V A;  4LIU A;  3DU5 A;  2DO7 A;  3C18 A;  2M4K A;  4RLF A;  1K83 J;  1T2K A;  2HPM A;  3LSR A;  2OQR A;  4B4C A;  2ZXJ A;  4BBS J;  4J19 A;  2X6O A;  1CF7 A;  2KKO A;  5LD2 C;  5K7H A;  3F6V A;  4II2 A;  4UV9 A;  1B4A A;  4W1U A;  5F0F A;  4A3J J;  1IXC A;  2RKH A;  5C44 J;  5L3G A;  3A2K A;  1U9N A;  2JQ7 A;  3G71 I;  2ZME A;  3TQN A;  1JHH A;  1OYW A;  1QU3 A;  1FLI A;  4PJ0 C; 
#chains in the Genus database with same CATH homology
 2WY7 Q;  3GBG A;  4C2T A;  3M8J A;  1N78 A;  3FBN B;  4XLH A;  1EA3 A;  4YEJ A;  4HPQ A;  3DQV C;  4C30 A;  3OYF A;  4X0G A;  2KL4 A;  1GLN A;  3G2B A;  1P9Q C;  4BE1 A;  3TL4 X;  3DTE A;  3AL0 C;  3KYL A;  1UAA A;  2X6Y A;  2CFO A;  2OUM A;  2R7O A;  3DEE A;  1BR1 A;  4XR6 A;  3I9V 2;  1TT0 A;  5FRO A;  2BVM A;  2R7S A;  2IGK A;  1BOB A;  3AL0 B;  4YEL A;  2R7Q A;  2WAQ A;  2O5R A;  1Y6I A;  3ZQQ A;  3L2V A;  1KON A;  1X19 A;  2Z2S B;  4CA0 A;  3W2V A;  4E4H A;  5KCM A;  2VXD A;  4KJZ A;  3MD2 A;  2FUG 2;  3LMM A;  4HG2 A;  2ZSI B;  4B47 A;  1D0Y A;  1Y56 A;  4BAC A;  3OYC A;  1MW7 A;  4PSX A;  3SDB A;  2UV1 A;  4PUS A;  3VSK A;  2WB1 A;  3OYD A;  3ZXS A;  2VJ4 A;  2QKM B;  4ZTF A;  2X1C A;  2V4J C;  1MMD A;  2CMP A;  3RPU D;  2VKH A;  1BR4 A;  4XKB A;  1D0X A;  2L7K A;  4CCN A;  1Z21 A;  2K5C A;  2LRE A;  3PNT A;  1DQU A;  4E7Z A;  3QYF A;  3CP8 A;  4KT6 A;  3U21 A;  1MMG A;  2UUZ A;  4IZZ A;  4HNU A;  4HEA 2;  4HSR A;  5FRM A;  4BEH B;  4XLF A;  3NWT A;  4KIS A;  3QYE A;  3LSG A;  4RMN A;  4AVZ A;  2GOM A;  2JVG A;  2IGN A;  3OYB A;  2KP6 A;  4DJA A;  3OY9 A;  1IRX A;  1SAU A;  4HRI A;  2AQF A;  3K70 D;  2WAF A;  2KHM A;  1D1A A;  3W2A A;  3C2H A;  1Z3Y A;  1SFK A;  1UG0 A;  3L2Q A;  1MMN A;  2LY1 A;  3DTK A;  2A6T A;  4U87 A;  3OYJ A;  1X1D A;  4XM3 A;  4CZC A;  3BG7 A;  4CCJ A;  4ZJZ A;  4ZDP A;  3C2G A;  1Z7L A;  2W4S A;  2MD0 A;  3H9Q A;  2LG4 A;  2DJI A;  3OR1 C;  5JHF A;  2E5Z A;  3N05 A;  4JQF A;  3IUO A;  2W1O A;  3ZRG A;  1ERD A;  5TGT A;  1WJE A;  3K4J A;  3DPL C;  3K4C A;  2VLA A;  4P1W A;  3OYN A;  2K9M A;  3OWT A;  2CW7 A;  4HNT A;  4XLE A;  4DOZ A;  4ANJ A;  4DGW B;  4NUB A;  2R4G A;  3EUK L;  2RRE A;  5HNF A;  4C2U A;  2WBM A;  3OOU A;  3UR3 C;  4BJ6 C;  4C9Y A;  2L9N A;  4RM3 A;  4NC7 A;  2CUJ A;  2UWM A;  4CCO A;  3QOD A;  2LH9 A;  4KIT B;  1E0E A;  3D5L A;  2LC2 A;  3CJR B;  4XMY A;  2JVH A;  2V7F A;  3NWS A;  4NNJ A;  4Y4R A;  1G59 A;  1W36 C;  3BCA A;  3KEY A;  2IGO A;  1WJ5 A;  2M3A A;  3PSF A;  1S9H A;  1W36 D;  3H35 A;  2VQL A;  2OV7 A;  2KPM A;  2E60 A;  3RSN A;  3PFY A;  3D5S C;  4E7J A;  4B3X A;  2MYS A;  2M7B A;  4MLO A;  4BE2 A;  2L9S A;  3D5R C;  3H9G A;  4RLQ A;  3PL8 A;  3V42 A;  2MFZ A;  3ZCO A;  4E7I A;  2RNG A;  4CCL A;  2E1M B;  2XF5 A;  4CCK A;  3BG6 A;  4PJL A;  2MC4 A;  1X1B A;  2CS3 A;  4ZDO A;  4XOT A;  4AYB A;  3CZ6 A;  2NOJ B;  2XC7 A;  4ZTJ A;  4XOP A;  2M0M A;  1V5F A;  3M1C A;  3L2W A;  3HXL A;  3BLY A;  1QHH D;  2W82 A;  2HVR A;  1BR2 A;  1Z3X A;  2Q2E B;  1WJC A;  2LOO A;  4BQQ A;  3AFH A;  3HKZ A;  2CV2 A;  5LFA A;  2DCE A;  2KDO A;  2F6C A;  1QHG A;  4F92 B;  3OIP A;  4N4N B;  1DGW Y;  2GOX B;  2KMU A;  3LFU A;  3SEQ A;  4DBQ A;  3VYT B;  4Y3O A;  3OS0 A;  3OYA A;  1AA7 A;  2HPI A;  3H5R A;  1PYV A;  2Q1Z B;  3HOT A;  3W2W A;  2L5Q A;  2VQH A;  4LG3 A;  4Y33 A;  3OYI A;  3S3N A;  2LY2 A;  2WAE A;  3HUG B;  4DIQ A;  5KHD A;  3OYG A;  1N77 A;  1UEL B;  2BW3 B;  2LBF A;  4BDZ A;  4OWR B;  2IS2 A;  2V9K A;  2JA2 A;  4BU2 A;  2R7W A;  1D0Z A;  4IQ4 A;  1YE9 A;  3HPH A;  3TBI A;  3L2R A;  1WFX A;  2X6X A;  4RM2 A;  3K4B A;  3LSH A;  2KLO A;  2KQR A;  1NG6 A;  2ZXH A;  3H5A A;  4QPQ A;  1K6Y A;  3S3O A;  3K4N A;  2Y0S A;  2M7A A;  4CSW A;  1YX3 A;  3LSK A;  1OLT A;  1LFP A;  1ZEL A;  2V26 A;  2MAB A;  2HNH A;  4R79 A;  4DBR A;  2L2O A;  4PSW A;  4NQW B;  2R7X A;  1V5E A;  2W00 A;  5FRN A;  4XL9 A;  5KNL A;  4BE0 A;  1DP3 A;  2E1M C;  4PJJ A;  3OIQ A;  4P5O A;  1D1B A;  4BEH A;  4J01 A;  3S32 A;  1JI8 A;  2CV0 A;  4BDY A;  3FHN A;  4PJN A;  3FBI B;  4IQJ A;  2CV1 A;  1LDK B;  2I8D A;  2VPL A;  2M4G A;  4B44 A;  4BQO A;  2X1D A;  5HLT A;  4PFO A;  3K10 A;  1FMV A;  2W7N A;  1T95 A;  1WJA A;  2VJI A;  2XAU A;  3RCO A;  2X1E A;  4PFP A;  3ZGK A;  1MND A;  2X6W A;  4PK4 A;  3IP4 B;  3CES A;  1VZ0 A;  2Z16 A;  2VJJ A;  3OL3 A;  4ITV A;  2KRC A;  4LIT A;  3VYS B;  3S3M A;  2CUZ A;  2K9L A;  3DTI A;  3LL7 A;  2R7V A;  2ZFU A;  1FMW A;  3DU6 A;  4XON A;  2PJR A;  2XF7 A;  2PMZ A;  3H9J A;  1MNE A;  2DOA A;  5CQE A;  4YRV A;  3SYT A;  3LSI A;  4D9J A;  3EPZ A;  4GRI A;  4AU7 A;  2R7U A;  2IS1 A;  1MMA A;  4ZYA A;  2Z1D A;  2HVS A;  3H5N A;  2VJ5 A;  2VQG A;  3VDX A;  2E5N A;  2F5V A;  3HC7 A;  1N75 A;  3H0D A;  3FDY A;  3DPT A;  3HG9 A;  2CH0 A;  3OYE A;  3OYK A;  3QOE A;  2VB6 A;  3F9K A;  1T0F C;  3SEZ A;  4HST A;  3E1S A;  4E7S A;  2VIX A;  3PUB A;  3CF2 A;  4PJM A;  4CUG A;  2LRD A;  4IKF A;  3BC8 A;  3OYH A;  4E7K A;  2R7R A;  4XLC A;  1WJB A;  4FAS D;  4BJ5 C;  3EUH C;  3VYU B;  4XLA A;  2VL8 A;  1X4O A;  1WJF A;  4XKW A;  4F91 B;  3L2U A;  4D1Q A;  3HPG A;  2ELJ A;  2R7T A;  3S8P A;  1PJR A;  2F4I A;  3OMY A;  2JSP A;  4OAY A;  1NG7 A;  3TMO A;  3K70 C;  2V6E A;  4CCM A;  2IS4 A;  2P0W A;  4F3Q A;  3BCB A;  3MKW B;  1OR7 C;  3IAM 2;  4BQN A;  3K6G A;  3S93 A;  5HVQ C;  2HZD A;  4F93 B;  3CP2 A;  3HL2 A;  4XN3 A;  3PNV A;  2V1N A;  2HQA A;  2X85 A;  1X1A A;  2QKL B;  3MKY B;  3OS1 A;  4J00 A;  3J7A Y;  3IAS 2;  2WA0 A;  3DWL E;  2HDW A;  2VQC A;  5HOO A;  2BOL A;  4B48 A;  2X51 A;  3MMY B;  2VKD A;  3CMM A;  3LSM A;  2WAD A;  1R6R A;  1TZL A;  3VSL A;  4BXF A;  4LIV A;  4E7H A;  3K4L A;  4H4K C;  3UNG C;  4F52 A;  2WY8 Q;  3VWB A;  3DKX A;  3A1Y A;  2KZV A;  3DPU A;  3PNY A;  3DLA A;  1D1C A;  3VYR B;  4XQF A;  3I3L A;  4IX7 A;  2AQE A;  2BW3 A;  3KX2 A;  4II3 A;  2LBF B;  4BL0 B;  2IS6 A;  2XF6 A;  3ONQ A;  4ZDL A;  4EAT A;  2JUG A;  1HA8 A;  4JOM A;  3W3C A;  2IGM A;  3OL4 A;  4B43 A;  1U0J A;  4XOR A;  3SZG A;  2ZSH B;  2OC6 A;  1LVK A;  1J09 A;  2K3P A;  5CKT A;  2CW8 A;  3A4C A;  3EUA A;  4XN0 A;  4BGD A;  5CQG A;  4OAZ A;  2ZXI A;  2IXS A;  4U7B A;  2A5W A;  3RTR A;  4BJT A;  3OS2 A;  2DT6 A;  4CH7 A;  3OYL A;  3QYB A;  2XDV A;  3E0J B;  4BUP A;  4E6K G;  3OYM A;  1LKX A;  1WJD A;  4N4O B;  3AKZ A;  3PJR A;  2HVQ A;  4E7L A;  2VXZ A;  1X1C A;  4NC8 A;  5CPR B;  4FET A;  4QPO A;  1YX5 A;  2RQQ A;  3K4K A;  3FKJ A;  2LYC A;  4XNF A;  3RQ4 A;  3ZR8 X;  4F55 A;  3HOS A;  3MKZ A;  3K4M A;  2HU9 A;  4LIU A;  2M4K A;  3DU5 A;  4RLF A;  4XKC A;  5HNH A;  3PSI A;  1X4P A;  2HPM A;  2XSJ C;  2VAS A;  1G8X A;  3OR2 C;  4XKV A;  4BS9 A;  4G6T B;  5LD2 C;  2KRH A;  3DKY A;  4II2 A;  1V5G A;  4ZC3 A;  3CJQ B;  2DXI A;  3A2K A;  1DGR M;  2BVL A;  1QU3 A;  2DT7 B;  2PJR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...