1NTCA

Solution structure of the dna-binding domain of ntrc with three alanine substitutions
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
MDLPGELFEASTPDSPSHLPPDSWATLLAQWADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGAATLTAKLKELGME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the DNA-binding domain of NtrC with three alanine substitutions.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transcription regulation
molecule keywords PROTEIN (NITROGEN REGULATION PROTEIN (NTRC))
total genus 18
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ntcA00
1IDYA 2XB0X 2ECCA 1H89C 1JTYA 2DA5A 3BR1A 3BTLA 2LKXA 2LP0A 2L7ZA 4B3AA 3S2DJ 2R92J 1IG7A 1U9OA 4JYKA 4A3MJ 5EGOA 4IHYA 1YRNA 1MH4A 3FKIJ 2E2JJ 1LE8A 3Q0VA 1JKRC 1WPKA 2M0CA 2PMZN 4BBSJ 2Y9YA 3QPLA 5J1UA 3IV5A 3LNQA 2AO9A 3FK6A 2VPRA 3IH4A 5FJ8J 2LY9A 3LSPA 2ELKA 2DMNA 2TRTA 1JJ6C 4FISA 3S1QJ 5DTDA 2NVTJ 3RKQA 3S15J 1H8AC 1NTCA 2LTPA 2CQQA 4IHVA 4MO7A 1Y1WJ 2X48A 1E3OC 4W97A 2GM4A 1ZR4A 2NOGA 2VKEA 2XPUA 1ENHA 1FTTA 2NS7A 2MSYA 3BG3A 3B6AA 2EBIA 2XSDC 2Y2ZA 1MBGA 1BL0A 2HOTA 4NDLA 3JREA 3TP3A 5IYCJ 3JRDA 4ABZA 1OJLA 3HB9A 5F27A 3GTPJ 3TW6A 3BTIA 5GPAA 5FKOA 1EF4A 4W1UA 2K40A 2ZB9A 4FE7A 4DYCA 4A3EJ 1MSEC 3HOZJ 3H0GJ 2E19A 5FKKA 1QRYA 1MBKA 2EQRA 3LOCA 5FLMJ 3A02A 2LFBA 2YUSA 2O9LA 3HDDA 2DMUA 2K9NA 3ZOBA 3PO3J 2DA6A 1X2NA 1JKOC 1FTZA 5FKNA 1X58A 4D5FA 4MLOA 4B4CA 3PO2J 2IAIA 1ETQA 4CYCB 2L7MP 1B8IA 2M8GX 3S1MJ 1IRZA 3G1LA 2TCTA 3JRCA 2MGQA 3UKGA 1P7IA 2JA8J 1F36A 3ZQGA 3SJMA 2GBYA 4JX4A 3PM1A 3HKZN 3O8HA 5EF6A 3HM5A 2R5YA 1Y1VJ 2JA7J 2XGDA 4I6ZA 1JJ8C 1HDDC 4DW6A 3E7LA 1MBHA 1H88C 2YS9A 3LSJA 4A3BJ 1FIAA 1UMQA 4QIWN 2MW8A 2E2HJ 5C4JJ 2X9DA 3K2AA 2Y30A 1QPIA 3B6CA 1VNDA 2E1OA 1ETWA 3GTGJ 3HEFA 2JA6J 3NARA 2KT0A 5J1YA 3BT9A 2R5YB 3TP0A 2FJ1A 3O8GA 5IP7J 3TEDA 2XPVA 4JX6A 1Q1VA 1TWCJ 2ID6A 5E3OA 2VKVA 3G1OA 1AKHB 1I3QJ 1Z0XA 2M9HA 1LFUP 3HOVJ 2DA3A 3NAUA 2R0QC 3ZQHA 1B72B 3M3YJ 2DA2A 1TC3C 4XIDA 5E3NA 3BTCA 2HXIA 2HOAA 2N8GA 1U9NA 5M3MJ 1ZQ3P 4MFDA 3GTQJ 2ME0A 3IH2A 3HGGA 4A69C 5M5XJ 3OOUA 4L5EA 3ZQIA 3LSGA 1IUFA 4JX5A 3BG5A 4FE4A 4M6VA 1IJWC 2XGEA 1ZK8A 3HOYJ 4DYRA 4UUTA 5IP9J 4UUSA 4C2MJ 5J1RA 5EDNA 4A3KJ 2LK2A 3JRIA 5F0HA 4Y7NJ 2Y9ZA 1VI0A 4IHWA 2CJJA 3LSRA 1MNMC 1VFCA 1MBFA 3DCFA 1T56A 2FX0A 1BJZA 5FKMA 3HOXJ 1JUSA 1X2MA 4DZJA 2QCOA 2EZIA 2H1KA 2XGCA 5F1JA 2Y31A 2EH3A 1IC8A 5K7FA 4I76A 4LOCA 3WHBA 2EZHA 1YRNB 3BG9A 2X6OA 4J19A 3HOUJ 4M3DA 2NVXJ 2XPWA 4XRMA 3HBLA 2D5VA 3BR2A 5BNGA 1TWFJ 4M3GA 4X1EA 4QSHA 2DA1A 3GTLJ 4RBOA 1DU6A 1JKQC 1QVTA 4M3FA 3IH3A 5M5WJ 5EEAA 1APLC 5C4XJ 1FEXA 1G2HA 4D7MA 3I4MJ 2AHQA 3H3VK 1JUMA 3MVPA 3BQZA 5F0FA 9ANTA 1VF9A 3GTOJ 2LVSA 2DA4A 5K7ZA 2WB1N 2IBDA 4A3JJ 4AYBN 4EEFG 1SFOJ 5K7HA 5IPAA 3C2BA 2HDDA 1IDZA 1GVDA 4MFEA 3MKLA 2DJNA 4M3BA 3S1NJ 1UG2A 4JP0A 2O7OA 3ZQFA 3RZOJ 3GTMJ 1ORKA 1P7JA 4M3EA 3GTJJ 2DMQA 1WH7A 4IEJA 5F04A 3OIOA 1NK2P 3FIWA 4IHXA 4XICA 4V2GA 2WAQN 5HODA 2DN0A 2NVQJ 2HOSA 2DA7A 3FK7A 1B72A 2XRLA 2W48A 3JRFA 2B63J 3VPRA 2R93J 3OSFA 2RAEA 2LR8A 1PUFA 5FKLA 1TWHJ 5EZGA 4C3JJ 4HNVA 2GLOA 4A3GJ 1NK3P 1F43A 1UHSA 1BW6A 1JUPA 3CDLA 4CYCA 3GBGA 2JN6A 2ECBA 3BTJA 1BA5A 2CRGA 4BY7J 1AHDP 3CQZJ 1K83J 5IYBJ 4AC0A 1SANA 5FLVA 1K61A 1CQTA 1ETYA 5C44J 5JLXA 1GV2A 2XB5A 1U8BA 1ETOA 2JJ7A 1GUUA 1WGXA 5IOYA 2O8KA 5F0CA 2MG4A 1MBEA 3WHCA 4XRSG 2M2EA 1ZKGA 5EG0B 1OCTC 2QF7A 1POGA 3CCYA 1MBJA 4BBRJ 4B1RA 4C3HJ 5GP9A 1O4XA 3JRBA 1MSFC 4MIMA 4A3DJ 1HCRA 2NVYJ 2CU7A 1A6IA 1RESA 5F08A 2HXOA 1HLVA 2G0EA 1U78A 3A03A 1QVUA 1GDTA 1JTXA 3Q0UA 4C3IJ 3K7AJ 1RETA 3JRAA 4AUXA 3S1RJ 4QTRA 5IP6A 2IEKA 3W6VA 5EYRA 2JK3A 3RQIA 1FJLA 2ID3A 1FIPA 3DEWA 2DTZA 3GTKJ 4GFBA 2YU9J 3SFIA 4D7NA 2CUFA 1MH3A 3A01A 3BR3A 3ZQCA 1WH5A 2LLKA 2LD5A 2L7FP 2P81A 2EZKA 1W0UA 4A3IJ 1WI3A 5EG0A 4DYQA 3MN2A 1I50J 1RKWA 4A93J 1RR7A 1D5YA 1LFBA 3JRHA 3S14J 3RZDJ 4S0HB 2R5ZA 4XK4A 2HQ5A 4RDUA 2ME6A 1ZR2A 2JA5J 2K9SA 2R7ZJ 1A5JA 2OPTA 5IOZA 3CMYA 3F0CA 1BW5A 1B8IB 5GPCA 1TWAJ 2M34A 3G1MA 4XRSA 3BQYA 2K9QA 3A01B 2R5ZB 3OSGA 3S17J 3L1PA 1XS9A 3I4NJ 1ETKA 3QQAA 1ETVA 4X6AJ 2KDZA 1AU7A 2VI6A 5J3LA 1ITYA 3M4OJ 2COBA 2FD5A 2OF7A 4BKXA 2HI3A 5DS9A 1JT0A 1WCMJ 2E2IJ 5JLWA 1XC5A 4Y52J 1R9TJ 5M3FJ 3S2HJ 2H8RA 1IV6A 1Z77A 2L0KA 2WV1A 2I10A 3Q0WA 5E3MA 3Q3SA 2CQXA 2DMPA 5IYDJ 5M5YJ 2CUEA 1W0TA 1HF0A 3BR0A 4DZPA 1IGNA 2L9RA 3BR5A 5C3EJ 2DMTA 5EZHA 4FCYA 1JKPC 3TW7A 1GV5A 1JT6A 2VUMJ 3SDGA 1I6HJ 1HOMA 4UUSB 4BXXJ 2FQ4A 3BR6A 4A3LJ 3FISA 1JGGA 2JWTA 4A3FJ 3HGYA 1ZTRA 4A3CJ 4FTHA 1RPWA 1GT0C 4V2FA 3HOWJ 1S7EA 1T33A 1DU0A 1OCPA 3ZQLA 3D1NI 3S16J 1LE8B 1RKTA 2Y0SN 1PUFB 1ZGWA 2JMWA 5EGOB 2NS8A 3JR9A 4G12A 3JRGA 2HYJA 3QPSA 1TWGJ 1OFCX 1XG1A 4D5CA 4BY1J 1ETXA 1HDPA 5E3LA 2EZLA 1AKHA
chains in the Genus database with same CATH superfamily
3OYKA 3CCEI 3CCMI 4A5MA 3W2AA 1H89C 5J40A 2L54A 4M74A 2LOOA 3BTLA 4E7SA 1EH7A 4R79A 2YX7A 3GFMA 4FASD 4B3AA 3OY9A 4RAGA 5HS8A 2VQLA 3S2DJ 1X1BA 2PMHA 3RCOA 5JFRA 3F8CA 1DUXC 3K70D 4EJOA 4HYEA 2W4SA 5ICCA 4HQEA 1YRNA 4CHUA 3KYDB 1T8IA 2W24A 3OYMA 4XSZF 1WPKA 1JKRC 2Y9YA 5J1UA 4BACA 2AO9A 2BY0A 1R1VA 2JVHA 3BP8A 4AU7A 2VE9A 3PIPF 3WGGA 4CSWA 5IT3A 3W2VA 3FXQA 3PQKA 5DTDA 2EV0A 2NVTJ 4A6EA 1E3OC 2L5QA 4QPQA 1LKXA 1V3FA 2LKSA 1UAAA 2XPUA 2DK8A 4LIUA 2K86A 2JPBA 4P55A 2NS7A 2RQQA 1FTTA 2BZTA 1O57A 2Q1ZB 1DGRM 3B6AA 2EBIA 3I56I 2Y2ZA 2DPUA 1BL0A 2HOTA 3SZGA 1Y39A 3JREA 5IYCJ 4EATA 2VQCA 3HYIA 4ABZA 4F93B 3EPZA 1J59A 2R7TA 2DOAA 2PG4A 2K4BA 5L3DA 3I58A 3I54A 3FXUA 2WA0A 3FWEA 4AD9A 1J2XA 4ETSA 2FF4A 3O6BB 5FKOA 4F7ZA 1FBUA 1BC7C 4HRIA 4AYBA 4A3EJ 2HS5A 1MSEC 4PFOA 1EA3A 5FROA 4AM3A 5FKKA 3I3LA 3CCQI 3BOQA 3I59B 4NQWA 3N4MA 1FZPB 2HPMA 1SFXA 1RR8C 4KT6A 4HF1A 2YPRA 2VJ5A 3ZOBA 1SAXA 2GA2A 4ZTJA 3FMQA 4D5FA 3R0AA 2XRNA 2EB7A 3H1CA 1ETQA 4CYCB 1FP2A 3A0BC 2LMDA 3CUOA 5ICFA 3S1MJ 1IRZA 3G1LA 2MGQA 2UXNA 2DXIA 3ERMA 1YYVA 2QGUA 3HUGA 2QSGX 4JX4A 3HKZN 2Q2EA 2XGDA 4NHJA 4DW6A 1U6GA 1YX5A 2QUFA 5ERIA 3HOSA 1YHQI 3J7AO 2VBWA 2UZKA 1GXQA 1MMAA 3TO9A 2IVMA 5LFAA 3DP7A 5GTHC 4L0YB 1IXSB 3WTYC 3B6CA 5HOOA 3ZGKA 3GTGJ 1XGSA 3DPLC 2R3SA 1BN5A 3HEFA 3TDZC 3PSIA 3T5XA 1WRJA 3KX2A 2I5UA 3VYRB 2VASA 2JA6J 3K9TA 3DV8A 2WADA 2EWNA 2R5YB 2HVSA 4I0AA 4M6YA 3O8GA 2MFZA 1PYVA 1P4AA 3K4KA 4XKWA 2JQ7A 3TEDA 1QHGA 1Q1VA 2L4AA 3EETA 4HG2A 1YX3A 1S9HA 2V1UA 2CS3A 4PZJA 3CMAI 3ABLH 1OMIA 1PJRA 1W5CC 3HOVJ 2K9MA 2DA3A 3QU3A 2P5LC 3V8KA 4H0EA 1B72B 3VODA 4DGWB 2Z99A 3U1DA 2LY2A 5L3CA 3PUFA 5M3MJ 1ZQ3P 2JVGA 3GTQJ 1VQNI 3A2KA 3LQQA 4IZZA 1TQMA 3EUHC 5M5XJ 1IUFA 4JX5A 3BG5A 2L7KA 2NNYA 3K69A 1AA7A 4WF2A 3M8FA 4I98B 3L9FA 2ZO4A 4ON0A 5E17F 1ZK8A 4RGRA 3FXRA 4DYRA 2VBZA 1K4SA 1T38A 4XR6A 2H6BA 3KEYA 4XLNF 4ITVA 4BJ5C 3BCAA 4EV0A 2W82A 4HPQA 1VI0A 4M9SA 2V9VA 2XVCA 2CJJA 1MBFA 4AVZA 3DCFA 3P9IA 2FX0A 4JOMA 1BJZA 1MMNA 3EQLF 5FKMA 3BJAA 3HOXJ 4AIJA 3HKZA 2K3PA 2H1KA 2BBYA 2M7AA 3HL2A 2ETHA 1WFXA 2DTRA 2EH3A 3DXJF 3AAFA 4E70A 5K7FA 4IL6C 1QPMA 2UV1A 2STWA 2D1VA 2LNBA 3LAJA 2DAOA 4RLQA 3S3OA 2CUJA 1B4AA 3GLXA 3FXMA 3HBLA 4UVBA 2EA2A 3V8LA 5CVUA 4X1EA 2DA1A 4XM3A 1DU6A 2E7XA 5CVVA 2BY2A 2O61A 3WE3A 2DOFA 2P5VA 4XKVA 3LA7A 1A36A 1FEXA 1G2HA 3GCMA 1WKMA 4M71A 3L7WA 2DBBA 3H3VK 3A1YA 4L0ZB 3ZN1A 3HSRA 9ANTA 3GTOJ 2LVSA 5K7ZA 5FGMA 3K6GA 4EJVA 1ZELA 5BQTA 3WTZA 1IZ1A 4LLNA 3FM3A 3BZKA 4MFEA 4U0VA 3MKLA 3UNGC 2DJNA 4M3BA 4L18B 1IN8A 4HV5A 4L5JA 3GTMJ 3ML6A 4M3EA 4A5NA 2DMQA 1WH7A 4UVAA 5F6FA 4D0PA 4U7DA 3NEUA 1BC8C 2GIVA 4PJMA 3W6KB 1G4DA 1S3JA 4IHXA 4V2GA 3HHHA 1SD5A 2LF7A 2HOSA 3BJOA 3FK7A 2LSOA 2P0WA 2B63J 2KRHA 1YS7A 3VPRA 3AG1H 2R93J 4R1HA 3CJRB 2ZJRF 2LR8A 4PJNA 1EH6A 2DW4A 4OAZA 4B43A 4BS9A 3CO6C 1CGPA 2OD5A 4HLYA 1QHHD 4A3GJ 3KZZA 1JUPA 1LVKA 3CMMA 3S8PA 4CDGA 3V7RA 3BTJA 4BL0B 5KAIC 1LJ9A 1AHDP 1KU3A 3J7AY 5IYBJ 1NH3A 1SANA 4WWCA 1K61A 1TT0A 1OLTA 2EIJH 4M73A 3LSMA 2XB5A 4WX9A 1U8BA 1BI1A 3RSNA 3OIQA 1J5YA 4BHCA 3B02A 3HC7A 1MMSA 3L2CA 1MBEA 2FBHA 5FRNA 3GLLA 4I2OA 2HOEA 4NNJA 1ZKGA 3LL7A 5B1BH 2QF7A 5HLHA 4Y15A 1S8NA 3OS0A 1RUOA 2HVRA 4BBRJ 2O5RA 3ONQA 4C3HJ 4FHTA 4EVIA 2VODA 1D1AA 1Z7UA 5DYMA 1MSFC 4MIMA 3PSFA 5EEGA 2WY7Q 1YE9A 3G3ZA 1XTAA 4J00A 2XAGA 1J09A 1HW5A 3KIOA 1HLVA 4LG0A 1U78A 5E20A 5BPDA 2EV5A 5DD8A 3CUQB 3H5RA 2NNNA 4C3IJ 5D5WB 4QWQA 2F4OB 4N9HA 2HKOA 2ELJA 2ZMEC 3JRAA 1H0MA 1S7OA 4QTRA 5CQEA 3OYCA 5GAEJ 5F1RA 1G3TA 2ID3A 1K78A 5L3EA 3AG4H 1GVJA 1B1BA 2BV6A 2VXZA 5KCMA 2YU9J 2A6HF 1YFHA 5CPRB 3M9AA 1MH3A 2OQGA 4MGRA 1ZARA 1XD7A 1JHHA 2L7FP 3H3UA 2VPLA 4WXDA 2EFWA 5EG0A 5LEKA 1I50J 4IRGA 4S0HB 2ZJPF 2DPDA 1GHCA 1MDMB 1ZR2A 4NUBA 2R7ZJ 3L2VA 4G6DA 4HV6A 2XAHA 2OPTA 3KPHA 3QYEA 2W25A 4BE1A 5LBQA 2X85A 1YQAA 3S3NA 1Z9CA 1W5SA 2BHZA 2C6YA 4Q5SF 3L2UA 1W1WE 1IN7A 1R71A 3IWZA 2VB6A 3ZP5A 2E1MC 4YRVA 2QLZA 2PJRA 4XRSA 3DLLF 4M9XA 3BQYA 4N4OB 2W00A 3S17J 5H6RA 3OYFA 4YIIA 3L1PA 2FEZA 1ETKA 3QQAA 5DDGA 1A6QA 4X6AJ 1DQUA 2KDZA 2K27A 1OCCH 3PNYA 2EFQA 1AU7A 1XCBA 2XKOA 3MWMA 5J3LA 1KQ9A 2QBYA 3KP7A 2XF5A 5JVGF 3QU6A 2X6WA 3E0JB 4UY8I 1O7LA 2RQPA 3IKTA 2ACJA 5FB2A 2V1XA 2HQAA 1JXSA 4EJTA 2KHMA 2VJIA 2P7CB 2PJRB 3F23A 2H8RA 1OR7C 5ILVA 4BNCA 1B9NA 4Q4ZF 3KYCB 3OL4A 2O3FA 1ZRDA 1E3PA 5E18F 4CA0A 2DMPA 1VZ0A 1U5TA 5IYDJ 3F6OA 2IGOA 1J75A 1WJFA 3IAM2 1IGNA 2A6TA 2F48A 2L9RA 2DMTA 1R23A 3SYTA 1ZG3A 1HOMA 3KZIC 3PQJA 1BOBA 2IGKA 2L3DA 4A3FJ 3HGYA 2CW7A 5CKTA 2EIMH 3T8RA 4A3CJ 1X1DA 2XHKA 1I6XA 4S04A 2ICWG 4P9FA 1S7EA 4LLGF 2OCCH 4ZDPA 4LK1F 1LE8B 1IUYA 2Y0SN 3HOTA 2FRHA 1DDNA 5EGOB 3JR9A 2YSRA 3JRGA 3ZMTA 1TWGJ 4OINF 1XG1A 4BY1J 3CP2A 4DJAA 3OYHA 1FOWA 1ETXA 3K0LA 5TRDA 2LG4A 1AKHA 4HNUA 4XLEA 4N9IA 4UVCA 2XASA 4Z6YA 2ECCA 3ZMUA 2VQGA 1ZGAA 3J80Z 2MD5A 3LA2A 2L7ZA 1LEBA 4CGZA 3CJQB 1IG7A 1U9OA 4A3MJ 3CUQA 3F3XA 1SC7A 1W7PD 3AFHA 1MH4A 2F5DA 4QLCU 2ADUA 1M1EB 3VSKA 1WI9A 3Q0VA 2F6CA 2M4KA 5J8CA 4BBSJ 3BG7A 1KYWA 2XAFA 4RAZA 2VPRA 1UFMA 1QZYA 3IP4B 1RRJA 3DU6A 4YIFA 1Z3XA 3F22A 2DT6A 3REOA 1XB4A 1S29A 2TRTA 3D5LA 2F5EA 2DQLA 4FISA 4XQFA 3RPQA 3ZXSA 3S15J 1H8AC 1O3RA 2VL8A 5DUKA 4MO7A 1Y1WJ 1Z21A 2KFDA 3RPUD 2DCEA 4W97A 1LB2A 1ZR4A 2NOGA 1OYIA 4CZCA 1BBYA 2RKHA 2HPIA 2MSYA 3BG3A 4LGWA 2R7QA 1D1CA 1W36D 1RZ4A 2NS0A 1EV7A 2BHYA 4IHSA 4NDLA 2QYOA 4BH9A 1OYYA 1LDJA 3JRDA 5AIPA 1OJLA 2JZYA 1SFKA 4I99C 3HB9A 5HLGA 1HBXG 3TW6A 3QP6A 3WTVC 1W4MA 3TQNA 2H1LA 3LSTA 5DUIA 1YW8A 1ZAOA 3RI4A 2O0YA 4BQQA 4YIRX 3HRTA 3PIOF 1EF4A 1ZHFA 3Q5FA 1BR2A 4FE7A 5LRRA 3H0DA 5F64A 1FYMA 3HOZJ 3H0GJ 4L9VA 1QRYA 1MBKA 2X51A 4HX4A 1MJBA 4IXAA 1D0XA 4BQOA 5DD4A 2IS6A 3D0SA 4NB5A 2FNPA 2LFBA 2YUSA 2O9LA 1O7FA 3CDIA 1WJ5A 2WAEA 2DA6A 3BROA 1Q1HA 3SFZA 1JKOC 3AKZA 1XMKA 1Z7LA 1TNSA 2CG4A 3QPHA 1DP7P 3FDYA 3PL8A 4G7HF 3DKYA 2M8GX 2DT7B 2OQRA 3JRCA 3UKGA 3IWFA 2FBKA 2JA8J 1F36A 3O3KA 2A61A 2R4GA 3PM1A 2ZSIB 3O8HA 5EF6A 3HRUA 5JHFA 1R22A 4CCKA 1YTYA 4OIPF 2JA7J 3QOPA 3FZVA 4BQNA 4YG2F 2RNJA 2MW8A 3O2PE 2HNHA 2VOOA 4DIQA 3G71I 2AQEA 1HC8A 3BY6A 4AVPA 3DKWA 4NQWB 4BJ6C 2V6CA 1BI2A 4XL9A 4MEXF 4CCLA 3BT9A 2HEOA 3F9KA 2GXAA 1ZREA 3LSIA 4C2UA 1U5TC 3HZJA 5IP7J 2VLAA 1ZH5A 2XPVA 2Z2SB 1HW1A 1WZ2A 3R60A 1XDSA 2ISZA 2ID6A 2KMUA 5E3OA 3CCRI 3OR2C 1TBXA 4NC7A 5FO5A 2BE5F 4TV7A 1LFUP 2OA4A 3GZNB 4AIKA 3FXKA 4GYIA 4HAMA 3I71A 1Y0NA 1TC3C 4Y3OA 4UV9A 3BTCA 3LFUA 4ZYGA 1SFEA 2HOAA 3ASOH 5E3NA 4U0YA 3TOAA 4E7IA 3HGGA 3OYDA 3QYBA 2X1EA 2BW3A 4HA8A 2A5YB 3M8JA 5LD2C 4M6VA 2DJIA 2CMPA 1PP7U 2FMYA 4C9YA 3KP4A 2ZSHB 2W57A 4L5IA 2PI0A 1XMAA 2ZXIA 4A3KJ 2LK2A 2DDBA 3KEQA 4Y7NJ 2IA0A 2Y9ZA 2PN6A 1MNMC 3N05A 3R0JA 1T56A 5HVQC 3VYTB 2DLLA 1X2MA 2MA3A 2VT3A 3R6SA 3V7SA 1IC8A 1FSHA 4EJWA 4F3QA 3H36A 5CYVA 2EZHA 3GFLA 3BG9A 4S05A 2X6OA 3HOUJ 2V9PA 2XPWA 4XRMA 2D5VA 1Y8RB 3GWZA 4HQMA 3CC2I 4M3GA 4O6JA 3MZHA 2JA2A 4I02A 5HDKA 5D5UB 1XMXA 2V4JC 3MKWB 3IH3A 5EEAA 2JSPA 4ENJA 4D7MA 3I4MJ 3LSHA 3MVPA 4DBQA 4Y13A 3X2QH 1VF9A 1V54H 2DA4A 3CP8A 5LHHA 1Y0UA 2QKMB 1QNTA 3KEOA 2IA2A 3P9KA 4IPAA 2V9KA 5TJJA 2ZNYA 4RS8A 2KIUA 1BI3A 3K4JA 2G9WA 1N77A 3C2BA 2IXSA 1GVDA 3CESA 4HZFA 2LBFB 1L0OC 1UG2A 3H9QA 3LWFA 2O7OA 4JP0A 5LGNA 3EDPA 1ORKA 1EJ9A 1LPQA 2QEXI 1T39A 2E7WA 4IEJA 2KIFA 3KP5A 1X3ZB 4ENNA 5FLXZ 3FIWA 2HZTA 1KU7A 5HODA 2K02A 1Y8QB 2DN0A 3Q9VA 2QA4I 2E60A 1T98A 3G6EI 3Q9SA 2L02A 1WJBA 1UZCA 5EEHA 1TW3A 1FY7A 3E5UA 1ZG5A 2GIZA 2X0LA 4N4NB 5ED4A 2ESHA 5B5EC 3COAC 4I09A 1NK3P 4IRHA 2JUGA 3QYFA 4HEA2 4CYCA 1R5GA 3ZN0A 2P7VB 2OC6A 5FLXK 1BA5A 3U2RA 1R49A 2P6TA 1K83J 4AC0A 4PJLA 5FLVA 1CQTA 2ZMEA 3BDDA 3WG9A 5C44J 5ICGA 2R7DA 3BZ6A 5JLXA 1N78A 1GV2A 4BXFA 3JSPA 2JJ7A 1WGXA 2O8KA 4OMYA 2MG4A 3K10A 1H9TA 2KRCA 3CMEI 3RJPA 1OCTC 1N75A 3TBIA 3N97A 4HLXA 4B1RA 4P96A 1MMGA 3M07A 1O4XA 1MNDA 1O3QA 2RGVA 3PJRA 1MD0A 5D5XB 1MDMA 1D1BA 1JI8A 3WTWC 2NVYJ 5DCFA 1PP8F 3B73A 2K4JA 1QVUA 2BYVE 1Z6TA 4ZYDA 2KL4A 1YLFA 1JTXA 3FKJA 4G8XA 2UUZA 2L01A 2Z1DA 1OQYA 5IP6A 2IEKA 4ZDLA 2X1CA 4RB1A 1EKEA 1ONVA 2BXYA 2LYCA 1A31A 2JK3A 2EK5A 3PFYA 1FJLA 3DEWA 2F5FA 2JRMA 4GFBA 1T95A 3SFIA 1TQPA 2CUFA 2H94A 3DLAA 1X4OA 3BR3A 2LLKA 4EMSA 2HWVA 2AQFA 3ABUA 4ASNA 1UB9A 4CCJA 2GWRA 3ZR8X 2IW5A 3J81K 4X0GA 3KZYA 3OYGA 4A3IJ 2GAUA 4ENKA 2R7RA 4GDFA 3MN2A 2CWEA 1A04A 4XKCA 2DODA 4BJTA 4A93J 1D5YA 3JRHA 3S14J 2CW0F 4HOBA 1LNWA 2DFFA 3HPHA 4XK4A 4Y17A 3T0YA 4IX7A 1QO0D 2VC0A 2X1DA 4RDUA 5DV5A 2HDCA 2RNGA 1FPQA 2K9SA 4E4HA 5KAFC 5KHDA 3IUOA 1U8RA 2V79A 1U5TB 2BEOA 3F0CA 1BW5A 2OTLI 1B8IB 3GF2A 1OCZH 2X6YA 3ELKA 2HVQA 2Y0MA 3KP2A 3LA3A 3RTRA 3ZRGA 5IY5H 2A5WA 5D4RA 2ZFUA 3HHGA 4Z2YA 4GCVA 2ZXWH 2O03A 3U9GA 1V5FA 1XS9A 2MABA 4WK8F 3A4CA 1CF7B 4GYGA 3SEQA 1ITYA 2COBA 3OYIA 4XLFA 2E36A 4BKXA 2HI3A 3L00A 5H20A 2CGPA 2MBFA 2E2IJ 1XC5A 3H9JA 2W7NA 4A0ZA 2GA1A 1R9TJ 2FBIA 2JRTA 2EPFA 2XDVA 3E1SA 1MZBA 1J0RA 3F8NA 2KKOA 1ZRFA 2I10A 1R1UA 3FM5A 2CYYA 1TW2A 3BCBA 2Q2EB 5M5YJ 3S2WA 4PGHA 2NRAC 3GYHX 4A6DA 2Z9OA 3T1BA 4FCYA 5EZHA 4BDYA 1JKPC 3TW7A 1GV5A 4AWXB 2D2WA 5LHIA 2W1OA 4RB2C 1PDNC 1CF7A 4UUSB 4LITA 4EM0B 5LEJA 4BXXJ 1OR7A 3FXLA 4A3LJ 3G2BA 1WJEA 2XC7A 1JGGA 4ZC3A 2JWTA 4IF4A 4FTHA 1RPWA 3ECOA 2CQ7A 5GADJ 2A3SA 2ZXJA 4G9YA 1ZRCA 1DU0A 3HOWJ 3ZQLA 3D1NI 3S16J 3S3MA 1FBSA 1PUFB 3WTSC 1G6NA 4MEYF 1I5ZA 2JMWA 4ZYAA 4G12A 2XAUA 3FF5A 1OFCX 2ZC2A 1G59A 1HDPA 3GX4X 5E3LA 3MQ0A 5JVTA 3IRRA 2NVQJ 3OYJA 1D0ZA 3CF5F 1VTNC 1IDYA 3F6VA 2EJRA 2XB0X 1KONA 4BAYA 4KICA 1JTYA 3BR1A 2L9VA 2LP0A 4KDPA 5TISC 3RQ4A 1X19A 1KU2A 1XCVA 1Z67A 1K6YA 2QQAA 2JSCA 4PDKA 3DEUA 4CCNA 3CDHA 2BY3A 4ZH4F 3FKIJ 2E2JJ 2A68F 2OZ6A 3K4NA 2M0CA 4MTDA 2OJED 2E35A 2PMZN 2K5CA 3QPLA 4BHPA 3IV5A 2MC4A 3FK6A 3LNQA 4IOAF 5FJ8J 2LY9A 4HSRA 2QQBA 1RC9A 2MLGA 2X4HA 3CLQA 2DK5A 2M87A 1JJ6C 3DEEA 2CQKA 2PBIA 5J47A 5AONA 1NTCA 2CQQA 2P6SA 4IHVA 1KQ8A 2VC1A 1SD7A 4D1QA 2GM4A 2ELHA 2VKEA 1ENHA 3PNTA 3H92A 4EJUA 3DBLB 3GFIA 3OYEA 2Y75A 4RM3A 3QRFF 1G8XA 5L3GA 1Y6IA 2LH9A 5DM6F 2Z33A 2JT1A 3CC7I 3OYNA 3HTSB 1I1SA 4BYYA 4E6KG 1QQIA 2DFEA 3OIPA 4P5OA 5F27A 1ZN2A 1XSVA 2RREA 3GTPJ 3KLOA 1Z91A 4KMUX 2NXNB 2OCEA 4F91B 5GPAA 1WWXA 2HDWA 1FOKA 4W1UA 2K40A 4DYCA 4CH7A 1U2WA 1TQIA 3GMEA 1ZYRF 5B3SH 1MIJA 1BJAA 3C1DA 1JGSA 2EQRA 3DTIA 3LOCA 4V19K 2HFHA 1FOXA 3CLOA 4II3A 1FP1D 4BU2A 3U1KA 2DMUA 2K9NA 3ZMSA 1K4TA 2L9SA 1BR1A 3PO3J 2XKPA 5CVIA 5D6FA 3PO2J 4MLOA 4B4CA 4OMZA 5JR3A 1WJDA 1TT5B 3C3WA 2IAIA 3WE2A 4ESBA 4UB8C 1B8IA 2WB1A 3GXOA 2ZJ2A 1HW2A 2CV0A 4HDVA 3KETA 2QZ8A 3SJMA 4IVNA 5LLQA 3JTGA 3EUAA 3HM5A 4RAYA 3KE2A 4EM1A 4Q47A 2NAZA 3W3CA 2K9LA 1Y1VJ 5D4SA 4I6ZA 1HDDC 3WTUC 3K4LA 1H88C 3GUDA 3LSJA 4A3BJ 1FSEA 2GZWA 2O8XA 4OAYA 1UMQA 4NC6A 2DYSH 4KFCA 4PJJA 4U87A 2E2HJ 1R6RA 4UUVA 5J4YA 1K6OA 3S32A 2X9DA 2F5VA 3K2AA 5J8FA 2JTVA 2E1OA 2V26A 3T8TA 3J7ZI 1XSXA 5FD6A 2EFPA 4RMNA 4U7BA 2KT0A 2KZGA 3R4KA 4B09A 2V1DA 1XDUA 1FWZA 3TP0A 1TTYA 2HQRA 2ZCWA 3K4BA 4JX6A 2B9SA 4CO8A 3F72A 2H09A 1S6LA 3G1OA 1YS6A 1Z0XA 2XGXA 4Y4RA 1ERDA 3OS2A 2ZFWA 4E7LA 2R7FA 2A6EF 4KISA 4F92B 2UWMA 3MD2A 2R0QC 3ZQHA 3M3YJ 1MKMA 2DA2A 4XIDA 3UR3C 5ILUA 1BI0A 2N8GA 1X3UA 3P7NA 3TGNA 1X1AA 1ON2A 1YJNI 3ABTA 2QKLB 4A69C 3OOUA 3ZQIA 4YFKF 5CQGA 1SVMA 4G7ZF 4JQFA 3LQRA 1DP3A 4FE4A 2FXAA 2AXTC 2DU9A 4BE0A 3C18A 2XSJC 4OU0A 2XGEA 4LD5A 3G73A 3HOYJ 5E1ZB 1IXRC 1IRGA 3QOEA 4UUTA 4UUSA 3C2HA 1D3YA 3TDUC 4C2MJ 5J1RA 1VQ7I 5EDNA 3PNVA 1QZEA 1MNEA 2ZMEB 4A0YA 2LF8A 4ZDOA 1REPC 3LSRA 3ZMVA 1VFCA 3OWTA 1ON1A 1RI7A 4XMYA 1F5TA 4DZJA 1T2KA 3QODA 2EZIA 1HSJA 3KFWX 2Y31A 4OIRF 4XRFA 4LOCA 3WHBA 4M3DA 4KUMA 2O6GE 1XPXA 5DEQA 3CD6I 4MTEA 2DI3A 1TWFJ 2NOJB 3GTLJ 3ESWB 1OPCA 1X3WB 1P92A 4RBOA 1U3EM 1JKQC 1QVTA 4M3FA 5M5WJ 1APLC 5AIQA 2D45A 1JUMA 2M0MA 1YITI 3E6CC 4GO1A 5F0FA 4HNTA 2K7LA 3LFKA 2KDOA 2WB1N 1LUJB 3QWLA 1P9QC 4AYBN 4EEFG 2HQNA 1SFOJ 2LBFA 5IPAA 4ZYEA 4BDZA 1NHAA 4KJZA 4RLFA 4P9UA 1VQKI 1S7AA 4HF0A 1IDZA 5K5QA 2HKXA 2Z16A 3QAHA 3VWBA 3S1NJ 1VQLI 4IRIA 2OZUA 4HX7A 1USTA 3ZQFA 1N25A 3WU1B 2FUG2 1P7JA 2LC2A 3AL0B 3WTTC 4ZYHA 3K4MA 3OIOA 1NK2P 3OYLA 3E6DA 2WAQN 2R7XA 3NQOA 4M72A 4PSWA 5KNLA 2XRLA 4EGYA 3BZCA 2W48A 1WQ2A 2FQ3A 3CC4I 2DOEA 2RAEA 2KISA 4WCGA 5FKLA 4PFPA 3TL4X 2RVCA 3EYIA 3ECHA 2CFOA 3GEZA 4PGGA 1GXPA 3VOEA 1JE8A 4XOPA 2Y69H 4E7ZA 2ISYA 2VIXA 1UHSA 3CDLA 3MKZA 4FETA 3GBGA 5E1XA 4B47A 1G3WA 2KZVA 2HGCA 3LSKA 2GXBA 2JN6A 2CRGA 4BE2A 3CQZJ 4HBLA 1IF1A 1X4PA 1R1TA 5KVRA 1W7PA 3TO6A 3ZCOA 2IS2A 1R58A 2G7UA 3AG3H 5CLSA 4ESFA 1GUUA 2IA1A 1B6AA 5IOYA 2W84A 5F0CA 2MH9A 3TKYA 3L2WA 2HZDA 1VQMI 1E17A 1MBJA 4YELA 2R7SA 3VYUB 4YFNF 5GP9A 5BS6A 1AWCA 3R61A 4DOZA 3WTXC 1BIAA 3JRBA 2IGMA 4PJ0C 2H27A 1HCRA 1V55H 2CU7A 3AG2H 2NYXA 3CCLI 2KIQA 1RESA 2FSWA 3ZPLA 1OCOH 4LFUA 2XIGA 4XN0A 1ULYA 2JUCA 3KP6A 2VONA 1HKTA 1IO2A 3NRVA 3K1NA 1GDTA 3Q0UA 2Z3YA 2GOXB 2PMUA 3OMYA 2FMLA 5GAHJ 3S1RJ 1VQPI 4HF2A 1VQ5I 1XGNA 2VXDA 5E1WA 4M6XA 1WHUA 2HTSA 2FOWA 1FIPA 1DPRA 3I4PA 4AIHA 3IKVA 2L9NA 3HPGA 2X6XA 1STZA 4I7HA 1LEAA 2DT5A 5JI6A 2OTJI 5CJ9A 3ZQCA 1WH5A 1SMTA 2P81A 3V42A 1I1GA 4RM2A 2DYRH 5A2QK 4G94A 3JCUC 3KCCA 3K4CA 4PUSA 4XBFA 1RR7A 3RZDJ 3WU0A 3QP5A 2R5ZA 5FRMA 2PFBA 2CH0A 2ME6A 2JA5J 5D6EA 4BUPA 2BXZA 4UNOA 2IP2A 3FX3A 1ZG1A 2F5CA 3DBRB 2VBYA 3HSFA 3V8JA 1QGPA 4FX0A 4EQQA 5GPCA 4JBAA 3I64A 1TWAJ 3C7JA 5D5VB 3BWGA 2A05A 1FYLA 2M34A 1R4MB 3H5NA 2CFXA 2CO5A 1R4NB 3FBIB 3D5RC 1HQCA 3OYBA 2K9QA 4A0XA 3OOPA 3BC8A 3OSGA 3FXOA 1RIOH 3OS1A 2P4WA 2H6CA 2VI6A 4G6TB 4LB5A 1TLHB 4G7OF 4KA4A 2MD0A 1LFPA 3BPXA 1IN4A 4HW0A 5DS9A 2IGNA 1JT0A 2NVUB 1WCMJ 1R00A 5JLWA 4HDUA 4IO9F 4Y52J 1SD6A 2QVOA 3GFJA 2VKDA 2CV2A 4E7HA 3NWSA 4A2UA 1Z77A 2DDAA 4ZZLA 3I9V2 3Q0WA 4CZZA 3Q3SA 2EILH 1O3TA 4E7JA 1ODDA 1U0JA 4AIDA 3SEZA 2ZNZA 5CVRA 3RDIA 1MMDA 3SZTA 5C3EJ 4IOCF 5E8GA 3V7CA 2XROA 1IRFA 2VUMJ 1SVLA 5GTIC 1I27A 1UELB 3HSEA 2FQ4A 3BR6A 4I01A 4WXCA 1IV8A 2IPQX 2M7BA 3VDXA 3FXJA 5H6QA 2M30A 4K2EA 2PJPA 4V2FA 4XLHA 1YG2A 1P4WA 1T33A 1OCPA 3CTAA 3VEPA 1RKTA 2HYFA 4ZZDA 1VQ4I 1QZZA 4A12A 2HTJA 2CUZA 1LDKB 2D1HA 2VJJA 3C2GA 3I53A 2CQNA 1ZGWA 1D8KA 2BVMA 3OR1C 3QPSA 3MKYB 3W6JB 1ZLKA 1UG0A 2QENA 3GZ5A 3DTKA 1T0FC 2WV0A 4IQ4A 4EGZA 1Z05A 4C2TA 3ABMH 3CJNA 2XV4S 1Z3YA 2DA5A 1S72I 1D8JA 2EA4A 2LKXA 3HXLA 1B59A 2TDXA 2R92J 4JYKA 4KIGA 5EGOA 2EINH 4KIFA 4IHYA 4KMFA 4PSXA 1I39A 1MGTA 1LE8A 4J01A 2RC4A 3DU5A 4UHTA 2R7VA 2UXXA 4LLLA 2M45A 2GOMA 2OBPA 2YX4A 3IH4A 3LSPA 5GAGJ 3H9GA 1NG7A 1R5HA 2ELKA 1UJ8A 3JTHA 1USSA 3EYYA 4U88A 2DMNA 3M1CA 4MQ9F 4CYDA 3FBNB 3MAJA 1FC3A 1IAWA 1QA6A 3S1QJ 2KRFA 4GRIA 3RKQA 3PUBA 2DFHA 1GLNA 2KQRA 2LTPA 2QM3A 4O3MA 2X48A 3CUQC 2XUBA 1PVEA 1R5ID 2MLKA 5E79C 1BR4A 4LG0B 3IC7A 1YI2I 2XSDC 2DO7A 1MBGA 1MJAA 2BOLA 1R7JA 1SAUA 5L3BA 3TP3A 5BMZA 2HR3A 1KZHA 2FOKA 1YO5C 3IAS2 3CO7C 4LIVA 3WG7H 4P1WA 4XN3A 1FLIA 2E5NA 4MQVA 1TP4A 1ZGJA 3BTIA 2WBMA 4RGXA 5ICEA 2M8EA 4B44A 1HA8A 2ZB9A 5HNHA 1YJWI 2F4IA 2DFIA 5ILSA 1TNTA 3GW2A 4H4KC 2OV7A 2E19A 3DPTA 5K1YA 2VN2A 4XLAA 5HLTA 5FLMJ 3A02A 3E6BA 3CZ6A 3HDDA 2KJCA 3OL3A 1D5VA 1OKRA 4DNCA 4CICA 1X2NA 1FTZA 5FKNA 1X58A 2KJBA 2OAZA 2AS5F 1E2XA 2ZBKA 2ZKZA 3JAMZ 1FYKA 4OIQF 4CCMA 3K70C 3JSOA 2E1NA 1X1CA 2L7MP 5D8KB 2TCTA 3W2WA 4KNYA 4E7KA 1P7IA 1NG6A 3ZQGA 2GBYA 1HKSA 2BGCA 3E5XA 5FFZA 4OIOF 4DQ2A 3RPUA 5J6XA 3ULQB 3IRQA 2M4GA 2R5YA 2CV1A 1JJ8C 1T0FA 3KYLA 2WAQA 3FMRA 3E7LA 3DBHB 1MBHA 2YS9A 4RB0A 3GVAA 1SD4A 1KYZA 1FIAA 4QIWN 2QBYB 1WJCA 4UV8A 4B8XA 5C4JJ 3CCUI 2Y30A 1F4KA 1QPIA 3EUKL 2GQQA 4B48A 4M9ZA 2PLYA 1VNDA 3VB2A 1ETWA 4IJAA 2M5WA 2M1BA 2P5KA 1LDDA 2MH2A 3J81Z 2BVLA 3M1EA 4KYWA 1VQ8I 3HRSA 3NARA 1K78B 4RGUA 5J1YA 5TGTA 4XKBA 1OCRH 4KT5C 2FJ1A 3DTEA 5D8LB 2COMA 2LREA 4RB3C 5B1AH 3SDBA 1YW9A 1TWCJ 2E71A 3ZQ7A 3MFKA 4XSXF 2I8DA 2VKVA 1I3AA 1AKHB 1I3QJ 3WODF 2M9HA 1R36A 3HTUA 5H2FC 1V5GA 5CVJA 4B3XA 3GO5A 3NAUA 4EM2A 2HXIA 3AL0C 1IN6A 2VKHA 1U9NA 1J9IA 4MFDA 3V4GA 2ME0A 3DF8A 3IH2A 2HU9A 2XAQA 2OUMA 5IT9K 4L5EA 3LSGA 2L4MA 2XAJA 4BQAA 3RYPA 3IHUA 1F9NA 1SVOA 4UB6C 2AXLA 1IJWC 1K79A 3LAPA 5IP9J 2V6EA 2QSFX 3TMOA 4GGGA 3JRIA 3E97A 5F0HA 4LMYA 1DPUA 4IHWA 4NBQA 2MC3A 1XGOA 2BW3B 3M7GA 4CUGA 1D0YA 1JUSA 1IN5A 3P5JA 1SMYF 2QCOA 2XGCA 3ZQQA 2K3FA 5F1JA 3VSLA 1YOVB 5A2QZ 4I76A 1YRNB 3L09A 3U21A 5HNFA 4HSTA 4J19A 2K85A 5KK1A 3WGHA 3F21A 2NVXJ 5K5OA 3K1PA 1V5EA 2DQRA 2E5ZA 3BR2A 3HUGB 5BNGA 4QSHA 2QQ8A 1VQ9I 3SQNA 1W36C 3L2QA 4IKFA 5C4XJ 2J5PA 4FX4A 2VE8A 2AHQA 3BQZA 2IJLA 5BPIA 4I0BA 1WVRA 3E5QA 3J80K 4XORA 1Z6RA 2IBDA 4A3JJ 2ZXHA 2STTA 2VJ4A 2BY1A 3M8EA 5K7HA 5DM7F 2G7HA 2HDDA 1BM9A 5EJCA 1UCRA 5LGUA 2E1MB 3HJEA 3MZ8A 2YU3A 2PEXA 3ZMDA 1YIJI 3HG9A 2FE3A 2E34A 3P9CA 3RZOJ 1P2FA 4ZJZA 3GTJJ 2VT2A 2J5OA 5E8IA 2LRDA 2YR2A 4YFXF 5F04A 1S5LC 3JAMK 1BOAA 2WTEA 3I0TA 5HDGA 1SFUA 3DFGA 4RGSA 4LJZF 4XICA 4RA2A 1QBJA 3MZYA 4OOIA 2DA7A 2Q8KA 3E3VA 2VQHA 1B72A 2CSOA 3MMYB 3KLNA 4YEJA 1JHFA 1C0WA 3JRFA 4L9NA 1Z1DA 3OSFA 4XLPF 1W7PB 2PQ8A 2FNAA 1PUFA 3TO7A 1E0EA 3ABKH 1TWHJ 4ENMA 1PUEE 4RAFA 5EZGA 4C3JJ 4HNVA 2ESNA 2GLOA 4R8HA 3CCSI 1LQ1A 1F43A 4MHGA 1KQ0A 1BW6A 3ISPA 3JW4A 3RYRA 2ECBA 3DKXA 6PAXA 4BY7J 1FOYA 1LVAA 2WC2A 1ETYA 2R7UA 3I59A 1Y56A 1E3HA 1W5TA 3VYSB 3H5AA 1ETOA 4L9TA 1HKQA 4XOTA 3SZPA 4DBRA 3RKXA 4ZTFA 2RDPA 2L2OA 3WHCA 2LY1A 1V4RA 2MYSA 4XRSG 2M2EA 2F2EA 3BLYA 3D5SC 1F1ZA 3QPTA 4KITB 5EG0B 1POGA 3CCYA 3MCZA 2KPMA 1UHMA 2B0LA 1H9GA 5HDNA 2W85A 3I5UA 1RUNA 1MJ9A 1IW7F 4A3DJ 1A6IA 2PX9A 1XSDA 2EFNA 3GZ6A 1XGMA 5F08A 2ZJQF 2HXOA 1XN7A 3TOBA 2G0EA 3A03A 2IS1A 3S93A 2R7WA 4PK4A 1BIBA 3K7AJ 2B7EA 4OWRB 1HSTA 1KU9A 2QSHX 2JPCA 1RETA 4AUXA 4QPOA 3A0HC 3DWLE 4F55A 2KLOA 3W6VA 3F8BA 1T6SA 1T08B 5EYRA 3RQIA 2Y0SA 3CJTB 1FNNA 4UXNA 3OYAA 2DTZA 2WY8Q 5HS9A 2QWWA 2VBXA 4FT8A 3GTKJ 5K5RA 1O3SA 5JHUA 4II2A 1FMVA 1YW7A 2A69F 1G3SA 2LKPA 2M3AA 2XF6A 4Y33A 4HX8A 3A01A 1VQOI 3H35A 2PMZA 4KIBA 2LD5A 2EV6A 3ASNH 4ANJA 2EZKA 4LG3A 1W0UA 1WI3A 4DYQA 4JK1X 1VQ6I 1RKWA 3KP3A 1FMWA 1P6RA 2QQ9A 1AOYA 1LFBA 4LB6B 1YIOA 5B66C 3CF2A 3F8FA 2V7FA 5J4VA 2GXGA 2HQ5A 1TL8A 4LK0F 5IT9Z 1A5JA 1XX5A 4NC8A 5IOZA 3CMYA 5HS7A 3CCVI 4XONA 1FBQA 3ERED 2E1CA 3RKWA 4BGDA 2RN7A 2FU4A 1KA8A 3HRMA 3G1MA 1IRXA 3BG6A 2EFOA 3VFZA 3MEXA 3NWTA 3HIFA 2OU2A 1QU3A 4BHBA 1G3YA 3A01B 4GXOA 5FD5A 2R5ZB 4IHTA 5LRSA 3H3ZA 2KIMA 2RV8A 3I4NJ 1ETVA 4XNFA 3ROUA 2IT0A 1OYWA 3FHZA 3BPVA 3L2RA 2V1NA 3FHNA 3M4OJ 2FD5A 5LGTA 2HYGD 2OF7A 4O5VA 3G4SI 2A07F 5HLIA 5FFXA 4Q48A 3LMMA 1SEUA 4IQJA 3DPUA 3K2ZA 3FMSA 4L9JA 4KN4X 2EIKH 3SXYA 3WU2C 3ZMZA 1ACIA 1TZLA 3RIRA 5M3FJ 3S2HJ 3I55I 3WGIA 4BXUA 2IS4A 1IV6A 1P4XA 2L0KA 2WV1A 4ESJA 2LDUA 1MW7A 2P8TA 5E3MA 5DCMA 2CQXA 2H8WA 2WAFA 1KGSA 3OV8A 3CCJI 3F8MA 2CUEA 1W0TA 2Y48A 1UHWA 1HF0A 3BR0A 4DZPA 2Z5UA 4U0WA 3K1MA 2WWYA 1RNLA 2R7OA 3BR5A 4G6QA 3IL2A 2IRFG 5BOXA 1JT6A 2FA5A 3J7YJ 3SDGA 2CW8A 1X1PA 4D9JA 1HXDA 1I6HJ 1K7AA 1WJAA 2KP6A 2Q0OA 4WXHA 4N0BA 3FISA 4BEHB 1OISA 1L3LA 4XLCA 3RKYA 1ZTRA 1FX7A 4CXFA 1GT0C 5LHGA 3BJ6A 1YJ9I 4F52A 4MNUA 4C30A 3DQVC 4PCQA 1WSUA 1A35A 1ZLJA 1EH8A 3E6MA 1IXCA 2NS8A 2F4MB 2HYJA 1FT9A 3PFIA 4KN7X 4D5CA 3EUHA 1B9MA 2VOPA 2XF7A 5DCMB 4CCOA 5L3FA 1J7KA 4D7NA 2EZLA 4FQGA 3SHFA 4BEHA 1DGWY
chains in the Genus database with same CATH topology
1IDYA 2XB0X 2ECCA 1H89C 1JTYA 2DA5A 3BR1A 3BTLA 2LKXA 2LP0A 2L7ZA 4B3AA 3S2DJ 2R92J 1IG7A 1U9OA 4JYKA 4A3MJ 5EGOA 4IHYA 1YRNA 1MH4A 3FKIJ 2E2JJ 1LE8A 3Q0VA 1JKRC 1WPKA 2M0CA 2PMZN 4BBSJ 2Y9YA 3QPLA 5J1UA 3IV5A 3LNQA 2AO9A 3FK6A 2VPRA 3IH4A 5FJ8J 2LY9A 3LSPA 2ELKA 2DMNA 2TRTA 1JJ6C 4FISA 3S1QJ 5DTDA 2NVTJ 3RKQA 3S15J 1H8AC 1NTCA 2LTPA 2CQQA 4IHVA 4MO7A 1Y1WJ 2X48A 1E3OC 4W97A 2GM4A 1ZR4A 2NOGA 2VKEA 2XPUA 1ENHA 1FTTA 2NS7A 2MSYA 3BG3A 3B6AA 2EBIA 2XSDC 2Y2ZA 1MBGA 1BL0A 2HOTA 4NDLA 3JREA 3TP3A 5IYCJ 3JRDA 4ABZA 1OJLA 3HB9A 5F27A 3GTPJ 3TW6A 3BTIA 5GPAA 5FKOA 1EF4A 4W1UA 2K40A 2ZB9A 4FE7A 4DYCA 4A3EJ 1MSEC 3HOZJ 3H0GJ 2E19A 5FKKA 1QRYA 1MBKA 2EQRA 3LOCA 5FLMJ 3A02A 2LFBA 2YUSA 2O9LA 3HDDA 2DMUA 2K9NA 3ZOBA 3PO3J 2DA6A 1X2NA 1JKOC 1FTZA 5FKNA 1X58A 4D5FA 4MLOA 4B4CA 3PO2J 2IAIA 1ETQA 4CYCB 2L7MP 1B8IA 2M8GX 3S1MJ 1IRZA 3G1LA 2TCTA 3JRCA 2MGQA 3UKGA 1P7IA 2JA8J 1F36A 3ZQGA 3SJMA 2GBYA 4JX4A 3PM1A 3HKZN 3O8HA 5EF6A 3HM5A 2R5YA 1Y1VJ 2JA7J 2XGDA 4I6ZA 1JJ8C 1HDDC 4DW6A 3E7LA 1MBHA 1H88C 2YS9A 3LSJA 4A3BJ 1FIAA 1UMQA 4QIWN 2MW8A 2E2HJ 5C4JJ 2X9DA 3K2AA 2Y30A 1QPIA 3B6CA 1VNDA 2E1OA 1ETWA 3GTGJ 3HEFA 2JA6J 3NARA 2KT0A 5J1YA 3BT9A 2R5YB 3TP0A 2FJ1A 3O8GA 5IP7J 3TEDA 2XPVA 4JX6A 1Q1VA 1TWCJ 2ID6A 5E3OA 2VKVA 3G1OA 1AKHB 1I3QJ 1Z0XA 2M9HA 1LFUP 3HOVJ 2DA3A 3NAUA 2R0QC 3ZQHA 1B72B 3M3YJ 2DA2A 1TC3C 4XIDA 5E3NA 3BTCA 2HXIA 2HOAA 2N8GA 1U9NA 5M3MJ 1ZQ3P 4MFDA 3GTQJ 2ME0A 3IH2A 3HGGA 4A69C 5M5XJ 3OOUA 4L5EA 3ZQIA 3LSGA 1IUFA 4JX5A 3BG5A 4FE4A 4M6VA 1IJWC 2XGEA 1ZK8A 3HOYJ 4DYRA 4UUTA 5IP9J 4UUSA 4C2MJ 5J1RA 5EDNA 4A3KJ 2LK2A 3JRIA 5F0HA 4Y7NJ 2Y9ZA 1VI0A 4IHWA 2CJJA 3LSRA 1MNMC 1VFCA 1MBFA 3DCFA 1T56A 2FX0A 1BJZA 5FKMA 3HOXJ 1JUSA 1X2MA 4DZJA 2QCOA 2EZIA 2H1KA 2XGCA 5F1JA 2Y31A 2EH3A 1IC8A 5K7FA 4I76A 4LOCA 3WHBA 2EZHA 1YRNB 3BG9A 2X6OA 4J19A 3HOUJ 4M3DA 2NVXJ 2XPWA 4XRMA 3HBLA 2D5VA 3BR2A 5BNGA 1TWFJ 4M3GA 4X1EA 4QSHA 2DA1A 3GTLJ 4RBOA 1DU6A 1JKQC 1QVTA 4M3FA 3IH3A 5M5WJ 5EEAA 1APLC 5C4XJ 1FEXA 1G2HA 4D7MA 3I4MJ 2AHQA 3H3VK 1JUMA 3MVPA 3BQZA 5F0FA 9ANTA 1VF9A 3GTOJ 2LVSA 2DA4A 5K7ZA 2WB1N 2IBDA 4A3JJ 4AYBN 4EEFG 1SFOJ 5K7HA 5IPAA 3C2BA 2HDDA 1IDZA 1GVDA 4MFEA 3MKLA 2DJNA 4M3BA 3S1NJ 1UG2A 4JP0A 2O7OA 3ZQFA 3RZOJ 3GTMJ 1ORKA 1P7JA 4M3EA 3GTJJ 2DMQA 1WH7A 4IEJA 5F04A 3OIOA 1NK2P 3FIWA 4IHXA 4XICA 4V2GA 2WAQN 5HODA 2DN0A 2NVQJ 2HOSA 2DA7A 3FK7A 1B72A 2XRLA 2W48A 3JRFA 2B63J 3VPRA 2R93J 3OSFA 2RAEA 2LR8A 1PUFA 5FKLA 1TWHJ 5EZGA 4C3JJ 4HNVA 2GLOA 4A3GJ 1NK3P 1F43A 1UHSA 1BW6A 1JUPA 3CDLA 4CYCA 3GBGA 2JN6A 2ECBA 3BTJA 1BA5A 2CRGA 4BY7J 1AHDP 3CQZJ 1K83J 5IYBJ 4AC0A 1SANA 5FLVA 1K61A 1CQTA 1ETYA 5C44J 5JLXA 1GV2A 2XB5A 1U8BA 1ETOA 2JJ7A 1GUUA 1WGXA 5IOYA 2O8KA 5F0CA 2MG4A 1MBEA 3WHCA 4XRSG 2M2EA 1ZKGA 5EG0B 1OCTC 2QF7A 1POGA 3CCYA 1MBJA 4BBRJ 4B1RA 4C3HJ 5GP9A 1O4XA 3JRBA 1MSFC 4MIMA 4A3DJ 1HCRA 2NVYJ 2CU7A 1A6IA 1RESA 5F08A 2HXOA 1HLVA 2G0EA 1U78A 3A03A 1QVUA 1GDTA 1JTXA 3Q0UA 4C3IJ 3K7AJ 1RETA 3JRAA 4AUXA 3S1RJ 4QTRA 5IP6A 2IEKA 3W6VA 5EYRA 2JK3A 3RQIA 1FJLA 2ID3A 1FIPA 3DEWA 2DTZA 3GTKJ 4GFBA 2YU9J 3SFIA 4D7NA 2CUFA 1MH3A 3A01A 3BR3A 3ZQCA 1WH5A 2LLKA 2LD5A 2L7FP 2P81A 2EZKA 1W0UA 4A3IJ 1WI3A 5EG0A 4DYQA 3MN2A 1I50J 1RKWA 4A93J 1RR7A 1D5YA 1LFBA 3JRHA 3S14J 3RZDJ 4S0HB 2R5ZA 4XK4A 2HQ5A 4RDUA 2ME6A 1ZR2A 2JA5J 2K9SA 2R7ZJ 1A5JA 2OPTA 5IOZA 3CMYA 3F0CA 1BW5A 1B8IB 5GPCA 1TWAJ 2M34A 3G1MA 4XRSA 3BQYA 2K9QA 3A01B 2R5ZB 3OSGA 3S17J 3L1PA 1XS9A 3I4NJ 1ETKA 3QQAA 1ETVA 4X6AJ 2KDZA 1AU7A 2VI6A 5J3LA 1ITYA 3M4OJ 2COBA 2FD5A 2OF7A 4BKXA 2HI3A 5DS9A 1JT0A 1WCMJ 2E2IJ 5JLWA 1XC5A 4Y52J 1R9TJ 5M3FJ 3S2HJ 2H8RA 1IV6A 1Z77A 2L0KA 2WV1A 2I10A 3Q0WA 5E3MA 3Q3SA 2CQXA 2DMPA 5IYDJ 5M5YJ 2CUEA 1W0TA 1HF0A 3BR0A 4DZPA 1IGNA 2L9RA 3BR5A 5C3EJ 2DMTA 5EZHA 4FCYA 1JKPC 3TW7A 1GV5A 1JT6A 2VUMJ 3SDGA 1I6HJ 1HOMA 4UUSB 4BXXJ 2FQ4A 3BR6A 4A3LJ 3FISA 1JGGA 2JWTA 4A3FJ 3HGYA 1ZTRA 4A3CJ 4FTHA 1RPWA 1GT0C 4V2FA 3HOWJ 1S7EA 1T33A 1DU0A 1OCPA 3ZQLA 3D1NI 3S16J 1LE8B 1RKTA 2Y0SN 1PUFB 1ZGWA 2JMWA 5EGOB 2NS8A 3JR9A 4G12A 3JRGA 2HYJA 3QPSA 1TWGJ 1OFCX 1XG1A 4D5CA 4BY1J 1ETXA 1HDPA 5E3LA 2EZLA 1AKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDY A;  2XB0 X;  2ECC A;  1H89 C;  1JTY A;  2DA5 A;  3BR1 A;  3BTL A;  2LKX A;  2LP0 A;  2L7Z A;  4B3A A;  3S2D J;  2R92 J;  1IG7 A;  1U9O A;  4JYK A;  4A3M J;  5EGO A;  4IHY A;  1YRN A;  1MH4 A;  3FKI J;  2E2J J;  1LE8 A;  3Q0V A;  1JKR C;  1WPK A;  2M0C A;  2PMZ N;  4BBS J;  2Y9Y A;  3QPL A;  5J1U A;  3IV5 A;  3LNQ A;  2AO9 A;  3FK6 A;  2VPR A;  3IH4 A;  5FJ8 J;  2LY9 A;  3LSP A;  2ELK A;  2DMN A;  2TRT A;  1JJ6 C;  4FIS A;  3S1Q J;  5DTD A;  2NVT J;  3RKQ A;  3S15 J;  1H8A C;  1NTC A;  2LTP A;  2CQQ A;  4IHV A;  4MO7 A;  1Y1W J;  2X48 A;  1E3O C;  4W97 A;  2GM4 A;  1ZR4 A;  2NOG A;  2VKE A;  2XPU A;  1ENH A;  1FTT A;  2NS7 A;  2MSY A;  3BG3 A;  3B6A A;  2EBI A;  2XSD C;  2Y2Z A;  1MBG A;  1BL0 A;  2HOT A;  4NDL A;  3JRE A;  3TP3 A;  5IYC J;  3JRD A;  4ABZ A;  1OJL A;  3HB9 A;  5F27 A;  3GTP J;  3TW6 A;  3BTI A;  5GPA A;  5FKO A;  1EF4 A;  4W1U A;  2K40 A;  2ZB9 A;  4FE7 A;  4DYC A;  4A3E J;  1MSE C;  3HOZ J;  3H0G J;  2E19 A;  5FKK A;  1QRY A;  1MBK A;  2EQR A;  3LOC A;  5FLM J;  3A02 A;  2LFB A;  2YUS A;  2O9L A;  3HDD A;  2DMU A;  2K9N A;  3ZOB A;  3PO3 J;  2DA6 A;  1X2N A;  1JKO C;  1FTZ A;  5FKN A;  1X58 A;  4D5F A;  4MLO A;  4B4C A;  3PO2 J;  2IAI A;  1ETQ A;  4CYC B;  2L7M P;  1B8I A;  2M8G X;  3S1M J;  1IRZ A;  3G1L A;  2TCT A;  3JRC A;  2MGQ A;  3UKG A;  1P7I A;  2JA8 J;  1F36 A;  3ZQG A;  3SJM A;  2GBY A;  4JX4 A;  3PM1 A;  3HKZ N;  3O8H A;  5EF6 A;  3HM5 A;  2R5Y A;  1Y1V J;  2JA7 J;  2XGD A;  4I6Z A;  1JJ8 C;  1HDD C;  4DW6 A;  3E7L A;  1MBH A;  1H88 C;  2YS9 A;  3LSJ A;  4A3B J;  1FIA A;  1UMQ A;  4QIW N;  2MW8 A;  2E2H J;  5C4J J;  2X9D A;  3K2A A;  2Y30 A;  1QPI A;  3B6C A;  1VND A;  2E1O A;  1ETW A;  3GTG J;  3HEF A;  2JA6 J;  3NAR A;  2KT0 A;  5J1Y A;  3BT9 A;  2R5Y B;  3TP0 A;  2FJ1 A;  3O8G A;  5IP7 J;  3TED A;  2XPV A;  4JX6 A;  1Q1V A;  1TWC J;  2ID6 A;  5E3O A;  2VKV A;  3G1O A;  1AKH B;  1I3Q J;  1Z0X A;  2M9H A;  1LFU P;  3HOV J;  2DA3 A;  3NAU A;  2R0Q C;  3ZQH A;  1B72 B;  3M3Y J;  2DA2 A;  1TC3 C;  4XID A;  5E3N A;  3BTC A;  2HXI A;  2HOA A;  2N8G A;  1U9N A;  5M3M J;  1ZQ3 P;  4MFD A;  3GTQ J;  2ME0 A;  3IH2 A;  3HGG A;  4A69 C;  5M5X J;  3OOU A;  4L5E A;  3ZQI A;  3LSG A;  1IUF A;  4JX5 A;  3BG5 A;  4FE4 A;  4M6V A;  1IJW C;  2XGE A;  1ZK8 A;  3HOY J;  4DYR A;  4UUT A;  5IP9 J;  4UUS A;  4C2M J;  5J1R A;  5EDN A;  4A3K J;  2LK2 A;  3JRI A;  5F0H A;  4Y7N J;  2Y9Z A;  1VI0 A;  4IHW A;  2CJJ A;  3LSR A;  1MNM C;  1VFC A;  1MBF A;  3DCF A;  1T56 A;  2FX0 A;  1BJZ A;  5FKM A;  3HOX J;  1JUS A;  1X2M A;  4DZJ A;  2QCO A;  2EZI A;  2H1K A;  2XGC A;  5F1J A;  2Y31 A;  2EH3 A;  1IC8 A;  5K7F A;  4I76 A;  4LOC A;  3WHB A;  2EZH A;  1YRN B;  3BG9 A;  2X6O A;  4J19 A;  3HOU J;  4M3D A;  2NVX J;  2XPW A;  4XRM A;  3HBL A;  2D5V A;  3BR2 A;  5BNG A;  1TWF J;  4M3G A;  4X1E A;  4QSH A;  2DA1 A;  3GTL J;  4RBO A;  1DU6 A;  1JKQ C;  1QVT A;  4M3F A;  3IH3 A;  5M5W J;  5EEA A;  1APL C;  5C4X J;  1FEX A;  1G2H A;  4D7M A;  3I4M J;  2AHQ A;  3H3V K;  1JUM A;  3MVP A;  3BQZ A;  5F0F A;  9ANT A;  1VF9 A;  3GTO J;  2LVS A;  2DA4 A;  5K7Z A;  2WB1 N;  2IBD A;  4A3J J;  4AYB N;  4EEF G;  1SFO J;  5K7H A;  5IPA A;  3C2B A;  2HDD A;  1IDZ A;  1GVD A;  4MFE A;  3MKL A;  2DJN A;  4M3B A;  3S1N J;  1UG2 A;  4JP0 A;  2O7O A;  3ZQF A;  3RZO J;  3GTM J;  1ORK A;  1P7J A;  4M3E A;  3GTJ J;  2DMQ A;  1WH7 A;  4IEJ A;  5F04 A;  3OIO A;  1NK2 P;  3FIW A;  4IHX A;  4XIC A;  4V2G A;  2WAQ N;  5HOD A;  2DN0 A;  2NVQ J;  2HOS A;  2DA7 A;  3FK7 A;  1B72 A;  2XRL A;  2W48 A;  3JRF A;  2B63 J;  3VPR A;  2R93 J;  3OSF A;  2RAE A;  2LR8 A;  1PUF A;  5FKL A;  1TWH J;  5EZG A;  4C3J J;  4HNV A;  2GLO A;  4A3G J;  1NK3 P;  1F43 A;  1UHS A;  1BW6 A;  1JUP A;  3CDL A;  4CYC A;  3GBG A;  2JN6 A;  2ECB A;  3BTJ A;  1BA5 A;  2CRG A;  4BY7 J;  1AHD P;  3CQZ J;  1K83 J;  5IYB J;  4AC0 A;  1SAN A;  5FLV A;  1K61 A;  1CQT A;  1ETY A;  5C44 J;  5JLX A;  1GV2 A;  2XB5 A;  1U8B A;  1ETO A;  2JJ7 A;  1GUU A;  1WGX A;  5IOY A;  2O8K A;  5F0C A;  2MG4 A;  1MBE A;  3WHC A;  4XRS G;  2M2E A;  1ZKG A;  5EG0 B;  1OCT C;  2QF7 A;  1POG A;  3CCY A;  1MBJ A;  4BBR J;  4B1R A;  4C3H J;  5GP9 A;  1O4X A;  3JRB A;  1MSF C;  4MIM A;  4A3D J;  1HCR A;  2NVY J;  2CU7 A;  1A6I A;  1RES A;  5F08 A;  2HXO A;  1HLV A;  2G0E A;  1U78 A;  3A03 A;  1QVU A;  1GDT A;  1JTX A;  3Q0U A;  4C3I J;  3K7A J;  1RET A;  3JRA A;  4AUX A;  3S1R J;  4QTR A;  5IP6 A;  2IEK A;  3W6V A;  5EYR A;  2JK3 A;  3RQI A;  1FJL A;  2ID3 A;  1FIP A;  3DEW A;  2DTZ A;  3GTK J;  4GFB A;  2YU9 J;  3SFI A;  4D7N A;  2CUF A;  1MH3 A;  3A01 A;  3BR3 A;  3ZQC A;  1WH5 A;  2LLK A;  2LD5 A;  2L7F P;  2P81 A;  2EZK A;  1W0U A;  4A3I J;  1WI3 A;  5EG0 A;  4DYQ A;  3MN2 A;  1I50 J;  1RKW A;  4A93 J;  1RR7 A;  1D5Y A;  1LFB A;  3JRH A;  3S14 J;  3RZD J;  4S0H B;  2R5Z A;  4XK4 A;  2HQ5 A;  4RDU A;  2ME6 A;  1ZR2 A;  2JA5 J;  2K9S A;  2R7Z J;  1A5J A;  2OPT A;  5IOZ A;  3CMY A;  3F0C A;  1BW5 A;  1B8I B;  5GPC A;  1TWA J;  2M34 A;  3G1M A;  4XRS A;  3BQY A;  2K9Q A;  3A01 B;  2R5Z B;  3OSG A;  3S17 J;  3L1P A;  1XS9 A;  3I4N J;  1ETK A;  3QQA A;  1ETV A;  4X6A J;  2KDZ A;  1AU7 A;  2VI6 A;  5J3L A;  1ITY A;  3M4O J;  2COB A;  2FD5 A;  2OF7 A;  4BKX A;  2HI3 A;  5DS9 A;  1JT0 A;  1WCM J;  2E2I J;  5JLW A;  1XC5 A;  4Y52 J;  1R9T J;  5M3F J;  3S2H J;  2H8R A;  1IV6 A;  1Z77 A;  2L0K A;  2WV1 A;  2I10 A;  3Q0W A;  5E3M A;  3Q3S A;  2CQX A;  2DMP A;  5IYD J;  5M5Y J;  2CUE A;  1W0T A;  1HF0 A;  3BR0 A;  4DZP A;  1IGN A;  2L9R A;  3BR5 A;  5C3E J;  2DMT A;  5EZH A;  4FCY A;  1JKP C;  3TW7 A;  1GV5 A;  1JT6 A;  2VUM J;  3SDG A;  1I6H J;  1HOM A;  4UUS B;  4BXX J;  2FQ4 A;  3BR6 A;  4A3L J;  3FIS A;  1JGG A;  2JWT A;  4A3F J;  3HGY A;  1ZTR A;  4A3C J;  4FTH A;  1RPW A;  1GT0 C;  4V2F A;  3HOW J;  1S7E A;  1T33 A;  1DU0 A;  1OCP A;  3ZQL A;  3D1N I;  3S16 J;  1LE8 B;  1RKT A;  2Y0S N;  1PUF B;  1ZGW A;  2JMW A;  5EGO B;  2NS8 A;  3JR9 A;  4G12 A;  3JRG A;  2HYJ A;  3QPS A;  1TWG J;  1OFC X;  1XG1 A;  4D5C A;  4BY1 J;  1ETX A;  1HDP A;  5E3L A;  2EZL A;  1AKH A; 
#chains in the Genus database with same CATH topology
 3OYK A;  3CCE I;  3CCM I;  4A5M A;  3W2A A;  1H89 C;  5J40 A;  2L54 A;  4M74 A;  2LOO A;  3BTL A;  4E7S A;  1EH7 A;  4R79 A;  2YX7 A;  3GFM A;  4FAS D;  4B3A A;  3OY9 A;  4RAG A;  5HS8 A;  2VQL A;  3S2D J;  1X1B A;  2PMH A;  3RCO A;  5JFR A;  3F8C A;  1DUX C;  3K70 D;  4EJO A;  4HYE A;  2W4S A;  5ICC A;  4HQE A;  1YRN A;  4CHU A;  3KYD B;  1T8I A;  2W24 A;  3OYM A;  4XSZ F;  1WPK A;  1JKR C;  2Y9Y A;  5J1U A;  4BAC A;  2AO9 A;  2BY0 A;  1R1V A;  2JVH A;  3BP8 A;  4AU7 A;  2VE9 A;  3PIP F;  3WGG A;  4CSW A;  5IT3 A;  3W2V A;  3FXQ A;  3PQK A;  5DTD A;  2EV0 A;  2NVT J;  4A6E A;  1E3O C;  2L5Q A;  4QPQ A;  1LKX A;  1V3F A;  2LKS A;  1UAA A;  2XPU A;  2DK8 A;  4LIU A;  2K86 A;  2JPB A;  4P55 A;  2NS7 A;  2RQQ A;  1FTT A;  2BZT A;  1O57 A;  2Q1Z B;  1DGR M;  3B6A A;  2EBI A;  3I56 I;  2Y2Z A;  2DPU A;  1BL0 A;  2HOT A;  3SZG A;  1Y39 A;  3JRE A;  5IYC J;  4EAT A;  2VQC A;  3HYI A;  4ABZ A;  4F93 B;  3EPZ A;  1J59 A;  2R7T A;  2DOA A;  2PG4 A;  2K4B A;  5L3D A;  3I58 A;  3I54 A;  3FXU A;  2WA0 A;  3FWE A;  4AD9 A;  1J2X A;  4ETS A;  2FF4 A;  3O6B B;  5FKO A;  4F7Z A;  1FBU A;  1BC7 C;  4HRI A;  4AYB A;  4A3E J;  2HS5 A;  1MSE C;  4PFO A;  1EA3 A;  5FRO A;  4AM3 A;  5FKK A;  3I3L A;  3CCQ I;  3BOQ A;  3I59 B;  4NQW A;  3N4M A;  1FZP B;  2HPM A;  1SFX A;  1RR8 C;  4KT6 A;  4HF1 A;  2YPR A;  2VJ5 A;  3ZOB A;  1SAX A;  2GA2 A;  4ZTJ A;  3FMQ A;  4D5F A;  3R0A A;  2XRN A;  2EB7 A;  3H1C A;  1ETQ A;  4CYC B;  1FP2 A;  3A0B C;  2LMD A;  3CUO A;  5ICF A;  3S1M J;  1IRZ A;  3G1L A;  2MGQ A;  2UXN A;  2DXI A;  3ERM A;  1YYV A;  2QGU A;  3HUG A;  2QSG X;  4JX4 A;  3HKZ N;  2Q2E A;  2XGD A;  4NHJ A;  4DW6 A;  1U6G A;  1YX5 A;  2QUF A;  5ERI A;  3HOS A;  1YHQ I;  3J7A O;  2VBW A;  2UZK A;  1GXQ A;  1MMA A;  3TO9 A;  2IVM A;  5LFA A;  3DP7 A;  5GTH C;  4L0Y B;  1IXS B;  3WTY C;  3B6C A;  5HOO A;  3ZGK A;  3GTG J;  1XGS A;  3DPL C;  2R3S A;  1BN5 A;  3HEF A;  3TDZ C;  3PSI A;  3T5X A;  1WRJ A;  3KX2 A;  2I5U A;  3VYR B;  2VAS A;  2JA6 J;  3K9T A;  3DV8 A;  2WAD A;  2EWN A;  2R5Y B;  2HVS A;  4I0A A;  4M6Y A;  3O8G A;  2MFZ A;  1PYV A;  1P4A A;  3K4K A;  4XKW A;  2JQ7 A;  3TED A;  1QHG A;  1Q1V A;  2L4A A;  3EET A;  4HG2 A;  1YX3 A;  1S9H A;  2V1U A;  2CS3 A;  4PZJ A;  3CMA I;  3ABL H;  1OMI A;  1PJR A;  1W5C C;  3HOV J;  2K9M A;  2DA3 A;  3QU3 A;  2P5L C;  3V8K A;  4H0E A;  1B72 B;  3VOD A;  4DGW B;  2Z99 A;  3U1D A;  2LY2 A;  5L3C A;  3PUF A;  5M3M J;  1ZQ3 P;  2JVG A;  3GTQ J;  1VQN I;  3A2K A;  3LQQ A;  4IZZ A;  1TQM A;  3EUH C;  5M5X J;  1IUF A;  4JX5 A;  3BG5 A;  2L7K A;  2NNY A;  3K69 A;  1AA7 A;  4WF2 A;  3M8F A;  4I98 B;  3L9F A;  2ZO4 A;  4ON0 A;  5E17 F;  1ZK8 A;  4RGR A;  3FXR A;  4DYR A;  2VBZ A;  1K4S A;  1T38 A;  4XR6 A;  2H6B A;  3KEY A;  4XLN F;  4ITV A;  4BJ5 C;  3BCA A;  4EV0 A;  2W82 A;  4HPQ A;  1VI0 A;  4M9S A;  2V9V A;  2XVC A;  2CJJ A;  1MBF A;  4AVZ A;  3DCF A;  3P9I A;  2FX0 A;  4JOM A;  1BJZ A;  1MMN A;  3EQL F;  5FKM A;  3BJA A;  3HOX J;  4AIJ A;  3HKZ A;  2K3P A;  2H1K A;  2BBY A;  2M7A A;  3HL2 A;  2ETH A;  1WFX A;  2DTR A;  2EH3 A;  3DXJ F;  3AAF A;  4E70 A;  5K7F A;  4IL6 C;  1QPM A;  2UV1 A;  2STW A;  2D1V A;  2LNB A;  3LAJ A;  2DAO A;  4RLQ A;  3S3O A;  2CUJ A;  1B4A A;  3GLX A;  3FXM A;  3HBL A;  4UVB A;  2EA2 A;  3V8L A;  5CVU A;  4X1E A;  2DA1 A;  4XM3 A;  1DU6 A;  2E7X A;  5CVV A;  2BY2 A;  2O61 A;  3WE3 A;  2DOF A;  2P5V A;  4XKV A;  3LA7 A;  1A36 A;  1FEX A;  1G2H A;  3GCM A;  1WKM A;  4M71 A;  3L7W A;  2DBB A;  3H3V K;  3A1Y A;  4L0Z B;  3ZN1 A;  3HSR A;  9ANT A;  3GTO J;  2LVS A;  5K7Z A;  5FGM A;  3K6G A;  4EJV A;  1ZEL A;  5BQT A;  3WTZ A;  1IZ1 A;  4LLN A;  3FM3 A;  3BZK A;  4MFE A;  4U0V A;  3MKL A;  3UNG C;  2DJN A;  4M3B A;  4L18 B;  1IN8 A;  4HV5 A;  4L5J A;  3GTM J;  3ML6 A;  4M3E A;  4A5N A;  2DMQ A;  1WH7 A;  4UVA A;  5F6F A;  4D0P A;  4U7D A;  3NEU A;  1BC8 C;  2GIV A;  4PJM A;  3W6K B;  1G4D A;  1S3J A;  4IHX A;  4V2G A;  3HHH A;  1SD5 A;  2LF7 A;  2HOS A;  3BJO A;  3FK7 A;  2LSO A;  2P0W A;  2B63 J;  2KRH A;  1YS7 A;  3VPR A;  3AG1 H;  2R93 J;  4R1H A;  3CJR B;  2ZJR F;  2LR8 A;  4PJN A;  1EH6 A;  2DW4 A;  4OAZ A;  4B43 A;  4BS9 A;  3CO6 C;  1CGP A;  2OD5 A;  4HLY A;  1QHH D;  4A3G J;  3KZZ A;  1JUP A;  1LVK A;  3CMM A;  3S8P A;  4CDG A;  3V7R A;  3BTJ A;  4BL0 B;  5KAI C;  1LJ9 A;  1AHD P;  1KU3 A;  3J7A Y;  5IYB J;  1NH3 A;  1SAN A;  4WWC A;  1K61 A;  1TT0 A;  1OLT A;  2EIJ H;  4M73 A;  3LSM A;  2XB5 A;  4WX9 A;  1U8B A;  1BI1 A;  3RSN A;  3OIQ A;  1J5Y A;  4BHC A;  3B02 A;  3HC7 A;  1MMS A;  3L2C A;  1MBE A;  2FBH A;  5FRN A;  3GLL A;  4I2O A;  2HOE A;  4NNJ A;  1ZKG A;  3LL7 A;  5B1B H;  2QF7 A;  5HLH A;  4Y15 A;  1S8N A;  3OS0 A;  1RUO A;  2HVR A;  4BBR J;  2O5R A;  3ONQ A;  4C3H J;  4FHT A;  4EVI A;  2VOD A;  1D1A A;  1Z7U A;  5DYM A;  1MSF C;  4MIM A;  3PSF A;  5EEG A;  2WY7 Q;  1YE9 A;  3G3Z A;  1XTA A;  4J00 A;  2XAG A;  1J09 A;  1HW5 A;  3KIO A;  1HLV A;  4LG0 A;  1U78 A;  5E20 A;  5BPD A;  2EV5 A;  5DD8 A;  3CUQ B;  3H5R A;  2NNN A;  4C3I J;  5D5W B;  4QWQ A;  2F4O B;  4N9H A;  2HKO A;  2ELJ A;  2ZME C;  3JRA A;  1H0M A;  1S7O A;  4QTR A;  5CQE A;  3OYC A;  5GAE J;  5F1R A;  1G3T A;  2ID3 A;  1K78 A;  5L3E A;  3AG4 H;  1GVJ A;  1B1B A;  2BV6 A;  2VXZ A;  5KCM A;  2YU9 J;  2A6H F;  1YFH A;  5CPR B;  3M9A A;  1MH3 A;  2OQG A;  4MGR A;  1ZAR A;  1XD7 A;  1JHH A;  2L7F P;  3H3U A;  2VPL A;  4WXD A;  2EFW A;  5EG0 A;  5LEK A;  1I50 J;  4IRG A;  4S0H B;  2ZJP F;  2DPD A;  1GHC A;  1MDM B;  1ZR2 A;  4NUB A;  2R7Z J;  3L2V A;  4G6D A;  4HV6 A;  2XAH A;  2OPT A;  3KPH A;  3QYE A;  2W25 A;  4BE1 A;  5LBQ A;  2X85 A;  1YQA A;  3S3N A;  1Z9C A;  1W5S A;  2BHZ A;  2C6Y A;  4Q5S F;  3L2U A;  1W1W E;  1IN7 A;  1R71 A;  3IWZ A;  2VB6 A;  3ZP5 A;  2E1M C;  4YRV A;  2QLZ A;  2PJR A;  4XRS A;  3DLL F;  4M9X A;  3BQY A;  4N4O B;  2W00 A;  3S17 J;  5H6R A;  3OYF A;  4YII A;  3L1P A;  2FEZ A;  1ETK A;  3QQA A;  5DDG A;  1A6Q A;  4X6A J;  1DQU A;  2KDZ A;  2K27 A;  1OCC H;  3PNY A;  2EFQ A;  1AU7 A;  1XCB A;  2XKO A;  3MWM A;  5J3L A;  1KQ9 A;  2QBY A;  3KP7 A;  2XF5 A;  5JVG F;  3QU6 A;  2X6W A;  3E0J B;  4UY8 I;  1O7L A;  2RQP A;  3IKT A;  2ACJ A;  5FB2 A;  2V1X A;  2HQA A;  1JXS A;  4EJT A;  2KHM A;  2VJI A;  2P7C B;  2PJR B;  3F23 A;  2H8R A;  1OR7 C;  5ILV A;  4BNC A;  1B9N A;  4Q4Z F;  3KYC B;  3OL4 A;  2O3F A;  1ZRD A;  1E3P A;  5E18 F;  4CA0 A;  2DMP A;  1VZ0 A;  1U5T A;  5IYD J;  3F6O A;  2IGO A;  1J75 A;  1WJF A;  3IAM 2;  1IGN A;  2A6T A;  2F48 A;  2L9R A;  2DMT A;  1R23 A;  3SYT A;  1ZG3 A;  1HOM A;  3KZI C;  3PQJ A;  1BOB A;  2IGK A;  2L3D A;  4A3F J;  3HGY A;  2CW7 A;  5CKT A;  2EIM H;  3T8R A;  4A3C J;  1X1D A;  2XHK A;  1I6X A;  4S04 A;  2ICW G;  4P9F A;  1S7E A;  4LLG F;  2OCC H;  4ZDP A;  4LK1 F;  1LE8 B;  1IUY A;  2Y0S N;  3HOT A;  2FRH A;  1DDN A;  5EGO B;  3JR9 A;  2YSR A;  3JRG A;  3ZMT A;  1TWG J;  4OIN F;  1XG1 A;  4BY1 J;  3CP2 A;  4DJA A;  3OYH A;  1FOW A;  1ETX A;  3K0L A;  5TRD A;  2LG4 A;  1AKH A;  4HNU A;  4XLE A;  4N9I A;  4UVC A;  2XAS A;  4Z6Y A;  2ECC A;  3ZMU A;  2VQG A;  1ZGA A;  3J80 Z;  2MD5 A;  3LA2 A;  2L7Z A;  1LEB A;  4CGZ A;  3CJQ B;  1IG7 A;  1U9O A;  4A3M J;  3CUQ A;  3F3X A;  1SC7 A;  1W7P D;  3AFH A;  1MH4 A;  2F5D A;  4QLC U;  2ADU A;  1M1E B;  3VSK A;  1WI9 A;  3Q0V A;  2F6C A;  2M4K A;  5J8C A;  4BBS J;  3BG7 A;  1KYW A;  2XAF A;  4RAZ A;  2VPR A;  1UFM A;  1QZY A;  3IP4 B;  1RRJ A;  3DU6 A;  4YIF A;  1Z3X A;  3F22 A;  2DT6 A;  3REO A;  1XB4 A;  1S29 A;  2TRT A;  3D5L A;  2F5E A;  2DQL A;  4FIS A;  4XQF A;  3RPQ A;  3ZXS A;  3S15 J;  1H8A C;  1O3R A;  2VL8 A;  5DUK A;  4MO7 A;  1Y1W J;  1Z21 A;  2KFD A;  3RPU D;  2DCE A;  4W97 A;  1LB2 A;  1ZR4 A;  2NOG A;  1OYI A;  4CZC A;  1BBY A;  2RKH A;  2HPI A;  2MSY A;  3BG3 A;  4LGW A;  2R7Q A;  1D1C A;  1W36 D;  1RZ4 A;  2NS0 A;  1EV7 A;  2BHY A;  4IHS A;  4NDL A;  2QYO A;  4BH9 A;  1OYY A;  1LDJ A;  3JRD A;  5AIP A;  1OJL A;  2JZY A;  1SFK A;  4I99 C;  3HB9 A;  5HLG A;  1HBX G;  3TW6 A;  3QP6 A;  3WTV C;  1W4M A;  3TQN A;  2H1L A;  3LST A;  5DUI A;  1YW8 A;  1ZAO A;  3RI4 A;  2O0Y A;  4BQQ A;  4YIR X;  3HRT A;  3PIO F;  1EF4 A;  1ZHF A;  3Q5F A;  1BR2 A;  4FE7 A;  5LRR A;  3H0D A;  5F64 A;  1FYM A;  3HOZ J;  3H0G J;  4L9V A;  1QRY A;  1MBK A;  2X51 A;  4HX4 A;  1MJB A;  4IXA A;  1D0X A;  4BQO A;  5DD4 A;  2IS6 A;  3D0S A;  4NB5 A;  2FNP A;  2LFB A;  2YUS A;  2O9L A;  1O7F A;  3CDI A;  1WJ5 A;  2WAE A;  2DA6 A;  3BRO A;  1Q1H A;  3SFZ A;  1JKO C;  3AKZ A;  1XMK A;  1Z7L A;  1TNS A;  2CG4 A;  3QPH A;  1DP7 P;  3FDY A;  3PL8 A;  4G7H F;  3DKY A;  2M8G X;  2DT7 B;  2OQR A;  3JRC A;  3UKG A;  3IWF A;  2FBK A;  2JA8 J;  1F36 A;  3O3K A;  2A61 A;  2R4G A;  3PM1 A;  2ZSI B;  3O8H A;  5EF6 A;  3HRU A;  5JHF A;  1R22 A;  4CCK A;  1YTY A;  4OIP F;  2JA7 J;  3QOP A;  3FZV A;  4BQN A;  4YG2 F;  2RNJ A;  2MW8 A;  3O2P E;  2HNH A;  2VOO A;  4DIQ A;  3G71 I;  2AQE A;  1HC8 A;  3BY6 A;  4AVP A;  3DKW A;  4NQW B;  4BJ6 C;  2V6C A;  1BI2 A;  4XL9 A;  4MEX F;  4CCL A;  3BT9 A;  2HEO A;  3F9K A;  2GXA A;  1ZRE A;  3LSI A;  4C2U A;  1U5T C;  3HZJ A;  5IP7 J;  2VLA A;  1ZH5 A;  2XPV A;  2Z2S B;  1HW1 A;  1WZ2 A;  3R60 A;  1XDS A;  2ISZ A;  2ID6 A;  2KMU A;  5E3O A;  3CCR I;  3OR2 C;  1TBX A;  4NC7 A;  5FO5 A;  2BE5 F;  4TV7 A;  1LFU P;  2OA4 A;  3GZN B;  4AIK A;  3FXK A;  4GYI A;  4HAM A;  3I71 A;  1Y0N A;  1TC3 C;  4Y3O A;  4UV9 A;  3BTC A;  3LFU A;  4ZYG A;  1SFE A;  2HOA A;  3ASO H;  5E3N A;  4U0Y A;  3TOA A;  4E7I A;  3HGG A;  3OYD A;  3QYB A;  2X1E A;  2BW3 A;  4HA8 A;  2A5Y B;  3M8J A;  5LD2 C;  4M6V A;  2DJI A;  2CMP A;  1PP7 U;  2FMY A;  4C9Y A;  3KP4 A;  2ZSH B;  2W57 A;  4L5I A;  2PI0 A;  1XMA A;  2ZXI A;  4A3K J;  2LK2 A;  2DDB A;  3KEQ A;  4Y7N J;  2IA0 A;  2Y9Z A;  2PN6 A;  1MNM C;  3N05 A;  3R0J A;  1T56 A;  5HVQ C;  3VYT B;  2DLL A;  1X2M A;  2MA3 A;  2VT3 A;  3R6S A;  3V7S A;  1IC8 A;  1FSH A;  4EJW A;  4F3Q A;  3H36 A;  5CYV A;  2EZH A;  3GFL A;  3BG9 A;  4S05 A;  2X6O A;  3HOU J;  2V9P A;  2XPW A;  4XRM A;  2D5V A;  1Y8R B;  3GWZ A;  4HQM A;  3CC2 I;  4M3G A;  4O6J A;  3MZH A;  2JA2 A;  4I02 A;  5HDK A;  5D5U B;  1XMX A;  2V4J C;  3MKW B;  3IH3 A;  5EEA A;  2JSP A;  4ENJ A;  4D7M A;  3I4M J;  3LSH A;  3MVP A;  4DBQ A;  4Y13 A;  3X2Q H;  1VF9 A;  1V54 H;  2DA4 A;  3CP8 A;  5LHH A;  1Y0U A;  2QKM B;  1QNT A;  3KEO A;  2IA2 A;  3P9K A;  4IPA A;  2V9K A;  5TJJ A;  2ZNY A;  4RS8 A;  2KIU A;  1BI3 A;  3K4J A;  2G9W A;  1N77 A;  3C2B A;  2IXS A;  1GVD A;  3CES A;  4HZF A;  2LBF B;  1L0O C;  1UG2 A;  3H9Q A;  3LWF A;  2O7O A;  4JP0 A;  5LGN A;  3EDP A;  1ORK A;  1EJ9 A;  1LPQ A;  2QEX I;  1T39 A;  2E7W A;  4IEJ A;  2KIF A;  3KP5 A;  1X3Z B;  4ENN A;  5FLX Z;  3FIW A;  2HZT A;  1KU7 A;  5HOD A;  2K02 A;  1Y8Q B;  2DN0 A;  3Q9V A;  2QA4 I;  2E60 A;  1T98 A;  3G6E I;  3Q9S A;  2L02 A;  1WJB A;  1UZC A;  5EEH A;  1TW3 A;  1FY7 A;  3E5U A;  1ZG5 A;  2GIZ A;  2X0L A;  4N4N B;  5ED4 A;  2ESH A;  5B5E C;  3COA C;  4I09 A;  1NK3 P;  4IRH A;  2JUG A;  3QYF A;  4HEA 2;  4CYC A;  1R5G A;  3ZN0 A;  2P7V B;  2OC6 A;  5FLX K;  1BA5 A;  3U2R A;  1R49 A;  2P6T A;  1K83 J;  4AC0 A;  4PJL A;  5FLV A;  1CQT A;  2ZME A;  3BDD A;  3WG9 A;  5C44 J;  5ICG A;  2R7D A;  3BZ6 A;  5JLX A;  1N78 A;  1GV2 A;  4BXF A;  3JSP A;  2JJ7 A;  1WGX A;  2O8K A;  4OMY A;  2MG4 A;  3K10 A;  1H9T A;  2KRC A;  3CME I;  3RJP A;  1OCT C;  1N75 A;  3TBI A;  3N97 A;  4HLX A;  4B1R A;  4P96 A;  1MMG A;  3M07 A;  1O4X A;  1MND A;  1O3Q A;  2RGV A;  3PJR A;  1MD0 A;  5D5X B;  1MDM A;  1D1B A;  1JI8 A;  3WTW C;  2NVY J;  5DCF A;  1PP8 F;  3B73 A;  2K4J A;  1QVU A;  2BYV E;  1Z6T A;  4ZYD A;  2KL4 A;  1YLF A;  1JTX A;  3FKJ A;  4G8X A;  2UUZ A;  2L01 A;  2Z1D A;  1OQY A;  5IP6 A;  2IEK A;  4ZDL A;  2X1C A;  4RB1 A;  1EKE A;  1ONV A;  2BXY A;  2LYC A;  1A31 A;  2JK3 A;  2EK5 A;  3PFY A;  1FJL A;  3DEW A;  2F5F A;  2JRM A;  4GFB A;  1T95 A;  3SFI A;  1TQP A;  2CUF A;  2H94 A;  3DLA A;  1X4O A;  3BR3 A;  2LLK A;  4EMS A;  2HWV A;  2AQF A;  3ABU A;  4ASN A;  1UB9 A;  4CCJ A;  2GWR A;  3ZR8 X;  2IW5 A;  3J81 K;  4X0G A;  3KZY A;  3OYG A;  4A3I J;  2GAU A;  4ENK A;  2R7R A;  4GDF A;  3MN2 A;  2CWE A;  1A04 A;  4XKC A;  2DOD A;  4BJT A;  4A93 J;  1D5Y A;  3JRH A;  3S14 J;  2CW0 F;  4HOB A;  1LNW A;  2DFF A;  3HPH A;  4XK4 A;  4Y17 A;  3T0Y A;  4IX7 A;  1QO0 D;  2VC0 A;  2X1D A;  4RDU A;  5DV5 A;  2HDC A;  2RNG A;  1FPQ A;  2K9S A;  4E4H A;  5KAF C;  5KHD A;  3IUO A;  1U8R A;  2V79 A;  1U5T B;  2BEO A;  3F0C A;  1BW5 A;  2OTL I;  1B8I B;  3GF2 A;  1OCZ H;  2X6Y A;  3ELK A;  2HVQ A;  2Y0M A;  3KP2 A;  3LA3 A;  3RTR A;  3ZRG A;  5IY5 H;  2A5W A;  5D4R A;  2ZFU A;  3HHG A;  4Z2Y A;  4GCV A;  2ZXW H;  2O03 A;  3U9G A;  1V5F A;  1XS9 A;  2MAB A;  4WK8 F;  3A4C A;  1CF7 B;  4GYG A;  3SEQ A;  1ITY A;  2COB A;  3OYI A;  4XLF A;  2E36 A;  4BKX A;  2HI3 A;  3L00 A;  5H20 A;  2CGP A;  2MBF A;  2E2I J;  1XC5 A;  3H9J A;  2W7N A;  4A0Z A;  2GA1 A;  1R9T J;  2FBI A;  2JRT A;  2EPF A;  2XDV A;  3E1S A;  1MZB A;  1J0R A;  3F8N A;  2KKO A;  1ZRF A;  2I10 A;  1R1U A;  3FM5 A;  2CYY A;  1TW2 A;  3BCB A;  2Q2E B;  5M5Y J;  3S2W A;  4PGH A;  2NRA C;  3GYH X;  4A6D A;  2Z9O A;  3T1B A;  4FCY A;  5EZH A;  4BDY A;  1JKP C;  3TW7 A;  1GV5 A;  4AWX B;  2D2W A;  5LHI A;  2W1O A;  4RB2 C;  1PDN C;  1CF7 A;  4UUS B;  4LIT A;  4EM0 B;  5LEJ A;  4BXX J;  1OR7 A;  3FXL A;  4A3L J;  3G2B A;  1WJE A;  2XC7 A;  1JGG A;  4ZC3 A;  2JWT A;  4IF4 A;  4FTH A;  1RPW A;  3ECO A;  2CQ7 A;  5GAD J;  2A3S A;  2ZXJ A;  4G9Y A;  1ZRC A;  1DU0 A;  3HOW J;  3ZQL A;  3D1N I;  3S16 J;  3S3M A;  1FBS A;  1PUF B;  3WTS C;  1G6N A;  4MEY F;  1I5Z A;  2JMW A;  4ZYA A;  4G12 A;  2XAU A;  3FF5 A;  1OFC X;  2ZC2 A;  1G59 A;  1HDP A;  3GX4 X;  5E3L A;  3MQ0 A;  5JVT A;  3IRR A;  2NVQ J;  3OYJ A;  1D0Z A;  3CF5 F;  1VTN C;  1IDY A;  3F6V A;  2EJR A;  2XB0 X;  1KON A;  4BAY A;  4KIC A;  1JTY A;  3BR1 A;  2L9V A;  2LP0 A;  4KDP A;  5TIS C;  3RQ4 A;  1X19 A;  1KU2 A;  1XCV A;  1Z67 A;  1K6Y A;  2QQA A;  2JSC A;  4PDK A;  3DEU A;  4CCN A;  3CDH A;  2BY3 A;  4ZH4 F;  3FKI J;  2E2J J;  2A68 F;  2OZ6 A;  3K4N A;  2M0C A;  4MTD A;  2OJE D;  2E35 A;  2PMZ N;  2K5C A;  3QPL A;  4BHP A;  3IV5 A;  2MC4 A;  3FK6 A;  3LNQ A;  4IOA F;  5FJ8 J;  2LY9 A;  4HSR A;  2QQB A;  1RC9 A;  2MLG A;  2X4H A;  3CLQ A;  2DK5 A;  2M87 A;  1JJ6 C;  3DEE A;  2CQK A;  2PBI A;  5J47 A;  5AON A;  1NTC A;  2CQQ A;  2P6S A;  4IHV A;  1KQ8 A;  2VC1 A;  1SD7 A;  4D1Q A;  2GM4 A;  2ELH A;  2VKE A;  1ENH A;  3PNT A;  3H92 A;  4EJU A;  3DBL B;  3GFI A;  3OYE A;  2Y75 A;  4RM3 A;  3QRF F;  1G8X A;  5L3G A;  1Y6I A;  2LH9 A;  5DM6 F;  2Z33 A;  2JT1 A;  3CC7 I;  3OYN A;  3HTS B;  1I1S A;  4BYY A;  4E6K G;  1QQI A;  2DFE A;  3OIP A;  4P5O A;  5F27 A;  1ZN2 A;  1XSV A;  2RRE A;  3GTP J;  3KLO A;  1Z91 A;  4KMU X;  2NXN B;  2OCE A;  4F91 B;  5GPA A;  1WWX A;  2HDW A;  1FOK A;  4W1U A;  2K40 A;  4DYC A;  4CH7 A;  1U2W A;  1TQI A;  3GME A;  1ZYR F;  5B3S H;  1MIJ A;  1BJA A;  3C1D A;  1JGS A;  2EQR A;  3DTI A;  3LOC A;  4V19 K;  2HFH A;  1FOX A;  3CLO A;  4II3 A;  1FP1 D;  4BU2 A;  3U1K A;  2DMU A;  2K9N A;  3ZMS A;  1K4T A;  2L9S A;  1BR1 A;  3PO3 J;  2XKP A;  5CVI A;  5D6F A;  3PO2 J;  4MLO A;  4B4C A;  4OMZ A;  5JR3 A;  1WJD A;  1TT5 B;  3C3W A;  2IAI A;  3WE2 A;  4ESB A;  4UB8 C;  1B8I A;  2WB1 A;  3GXO A;  2ZJ2 A;  1HW2 A;  2CV0 A;  4HDV A;  3KET A;  2QZ8 A;  3SJM A;  4IVN A;  5LLQ A;  3JTG A;  3EUA A;  3HM5 A;  4RAY A;  3KE2 A;  4EM1 A;  4Q47 A;  2NAZ A;  3W3C A;  2K9L A;  1Y1V J;  5D4S A;  4I6Z A;  1HDD C;  3WTU C;  3K4L A;  1H88 C;  3GUD A;  3LSJ A;  4A3B J;  1FSE A;  2GZW A;  2O8X A;  4OAY A;  1UMQ A;  4NC6 A;  2DYS H;  4KFC A;  4PJJ A;  4U87 A;  2E2H J;  1R6R A;  4UUV A;  5J4Y A;  1K6O A;  3S32 A;  2X9D A;  2F5V A;  3K2A A;  5J8F A;  2JTV A;  2E1O A;  2V26 A;  3T8T A;  3J7Z I;  1XSX A;  5FD6 A;  2EFP A;  4RMN A;  4U7B A;  2KT0 A;  2KZG A;  3R4K A;  4B09 A;  2V1D A;  1XDU A;  1FWZ A;  3TP0 A;  1TTY A;  2HQR A;  2ZCW A;  3K4B A;  4JX6 A;  2B9S A;  4CO8 A;  3F72 A;  2H09 A;  1S6L A;  3G1O A;  1YS6 A;  1Z0X A;  2XGX A;  4Y4R A;  1ERD A;  3OS2 A;  2ZFW A;  4E7L A;  2R7F A;  2A6E F;  4KIS A;  4F92 B;  2UWM A;  3MD2 A;  2R0Q C;  3ZQH A;  3M3Y J;  1MKM A;  2DA2 A;  4XID A;  3UR3 C;  5ILU A;  1BI0 A;  2N8G A;  1X3U A;  3P7N A;  3TGN A;  1X1A A;  1ON2 A;  1YJN I;  3ABT A;  2QKL B;  4A69 C;  3OOU A;  3ZQI A;  4YFK F;  5CQG A;  1SVM A;  4G7Z F;  4JQF A;  3LQR A;  1DP3 A;  4FE4 A;  2FXA A;  2AXT C;  2DU9 A;  4BE0 A;  3C18 A;  2XSJ C;  4OU0 A;  2XGE A;  4LD5 A;  3G73 A;  3HOY J;  5E1Z B;  1IXR C;  1IRG A;  3QOE A;  4UUT A;  4UUS A;  3C2H A;  1D3Y A;  3TDU C;  4C2M J;  5J1R A;  1VQ7 I;  5EDN A;  3PNV A;  1QZE A;  1MNE A;  2ZME B;  4A0Y A;  2LF8 A;  4ZDO A;  1REP C;  3LSR A;  3ZMV A;  1VFC A;  3OWT A;  1ON1 A;  1RI7 A;  4XMY A;  1F5T A;  4DZJ A;  1T2K A;  3QOD A;  2EZI A;  1HSJ A;  3KFW X;  2Y31 A;  4OIR F;  4XRF A;  4LOC A;  3WHB A;  4M3D A;  4KUM A;  2O6G E;  1XPX A;  5DEQ A;  3CD6 I;  4MTE A;  2DI3 A;  1TWF J;  2NOJ B;  3GTL J;  3ESW B;  1OPC A;  1X3W B;  1P92 A;  4RBO A;  1U3E M;  1JKQ C;  1QVT A;  4M3F A;  5M5W J;  1APL C;  5AIQ A;  2D45 A;  1JUM A;  2M0M A;  1YIT I;  3E6C C;  4GO1 A;  5F0F A;  4HNT A;  2K7L A;  3LFK A;  2KDO A;  2WB1 N;  1LUJ B;  3QWL A;  1P9Q C;  4AYB N;  4EEF G;  2HQN A;  1SFO J;  2LBF A;  5IPA A;  4ZYE A;  4BDZ A;  1NHA A;  4KJZ A;  4RLF A;  4P9U A;  1VQK I;  1S7A A;  4HF0 A;  1IDZ A;  5K5Q A;  2HKX A;  2Z16 A;  3QAH A;  3VWB A;  3S1N J;  1VQL I;  4IRI A;  2OZU A;  4HX7 A;  1UST A;  3ZQF A;  1N25 A;  3WU1 B;  2FUG 2;  1P7J A;  2LC2 A;  3AL0 B;  3WTT C;  4ZYH A;  3K4M A;  3OIO A;  1NK2 P;  3OYL A;  3E6D A;  2WAQ N;  2R7X A;  3NQO A;  4M72 A;  4PSW A;  5KNL A;  2XRL A;  4EGY A;  3BZC A;  2W48 A;  1WQ2 A;  2FQ3 A;  3CC4 I;  2DOE A;  2RAE A;  2KIS A;  4WCG A;  5FKL A;  4PFP A;  3TL4 X;  2RVC A;  3EYI A;  3ECH A;  2CFO A;  3GEZ A;  4PGG A;  1GXP A;  3VOE A;  1JE8 A;  4XOP A;  2Y69 H;  4E7Z A;  2ISY A;  2VIX A;  1UHS A;  3CDL A;  3MKZ A;  4FET A;  3GBG A;  5E1X A;  4B47 A;  1G3W A;  2KZV A;  2HGC A;  3LSK A;  2GXB A;  2JN6 A;  2CRG A;  4BE2 A;  3CQZ J;  4HBL A;  1IF1 A;  1X4P A;  1R1T A;  5KVR A;  1W7P A;  3TO6 A;  3ZCO A;  2IS2 A;  1R58 A;  2G7U A;  3AG3 H;  5CLS A;  4ESF A;  1GUU A;  2IA1 A;  1B6A A;  5IOY A;  2W84 A;  5F0C A;  2MH9 A;  3TKY A;  3L2W A;  2HZD A;  1VQM I;  1E17 A;  1MBJ A;  4YEL A;  2R7S A;  3VYU B;  4YFN F;  5GP9 A;  5BS6 A;  1AWC A;  3R61 A;  4DOZ A;  3WTX C;  1BIA A;  3JRB A;  2IGM A;  4PJ0 C;  2H27 A;  1HCR A;  1V55 H;  2CU7 A;  3AG2 H;  2NYX A;  3CCL I;  2KIQ A;  1RES A;  2FSW A;  3ZPL A;  1OCO H;  4LFU A;  2XIG A;  4XN0 A;  1ULY A;  2JUC A;  3KP6 A;  2VON A;  1HKT A;  1IO2 A;  3NRV A;  3K1N A;  1GDT A;  3Q0U A;  2Z3Y A;  2GOX B;  2PMU A;  3OMY A;  2FML A;  5GAH J;  3S1R J;  1VQP I;  4HF2 A;  1VQ5 I;  1XGN A;  2VXD A;  5E1W A;  4M6X A;  1WHU A;  2HTS A;  2FOW A;  1FIP A;  1DPR A;  3I4P A;  4AIH A;  3IKV A;  2L9N A;  3HPG A;  2X6X A;  1STZ A;  4I7H A;  1LEA A;  2DT5 A;  5JI6 A;  2OTJ I;  5CJ9 A;  3ZQC A;  1WH5 A;  1SMT A;  2P81 A;  3V42 A;  1I1G A;  4RM2 A;  2DYR H;  5A2Q K;  4G94 A;  3JCU C;  3KCC A;  3K4C A;  4PUS A;  4XBF A;  1RR7 A;  3RZD J;  3WU0 A;  3QP5 A;  2R5Z A;  5FRM A;  2PFB A;  2CH0 A;  2ME6 A;  2JA5 J;  5D6E A;  4BUP A;  2BXZ A;  4UNO A;  2IP2 A;  3FX3 A;  1ZG1 A;  2F5C A;  3DBR B;  2VBY A;  3HSF A;  3V8J A;  1QGP A;  4FX0 A;  4EQQ A;  5GPC A;  4JBA A;  3I64 A;  1TWA J;  3C7J A;  5D5V B;  3BWG A;  2A05 A;  1FYL A;  2M34 A;  1R4M B;  3H5N A;  2CFX A;  2CO5 A;  1R4N B;  3FBI B;  3D5R C;  1HQC A;  3OYB A;  2K9Q A;  4A0X A;  3OOP A;  3BC8 A;  3OSG A;  3FXO A;  1RIO H;  3OS1 A;  2P4W A;  2H6C A;  2VI6 A;  4G6T B;  4LB5 A;  1TLH B;  4G7O F;  4KA4 A;  2MD0 A;  1LFP A;  3BPX A;  1IN4 A;  4HW0 A;  5DS9 A;  2IGN A;  1JT0 A;  2NVU B;  1WCM J;  1R00 A;  5JLW A;  4HDU A;  4IO9 F;  4Y52 J;  1SD6 A;  2QVO A;  3GFJ A;  2VKD A;  2CV2 A;  4E7H A;  3NWS A;  4A2U A;  1Z77 A;  2DDA A;  4ZZL A;  3I9V 2;  3Q0W A;  4CZZ A;  3Q3S A;  2EIL H;  1O3T A;  4E7J A;  1ODD A;  1U0J A;  4AID A;  3SEZ A;  2ZNZ A;  5CVR A;  3RDI A;  1MMD A;  3SZT A;  5C3E J;  4IOC F;  5E8G A;  3V7C A;  2XRO A;  1IRF A;  2VUM J;  1SVL A;  5GTI C;  1I27 A;  1UEL B;  3HSE A;  2FQ4 A;  3BR6 A;  4I01 A;  4WXC A;  1IV8 A;  2IPQ X;  2M7B A;  3VDX A;  3FXJ A;  5H6Q A;  2M30 A;  4K2E A;  2PJP A;  4V2F A;  4XLH A;  1YG2 A;  1P4W A;  1T33 A;  1OCP A;  3CTA A;  3VEP A;  1RKT A;  2HYF A;  4ZZD A;  1VQ4 I;  1QZZ A;  4A12 A;  2HTJ A;  2CUZ A;  1LDK B;  2D1H A;  2VJJ A;  3C2G A;  3I53 A;  2CQN A;  1ZGW A;  1D8K A;  2BVM A;  3OR1 C;  3QPS A;  3MKY B;  3W6J B;  1ZLK A;  1UG0 A;  2QEN A;  3GZ5 A;  3DTK A;  1T0F C;  2WV0 A;  4IQ4 A;  4EGZ A;  1Z05 A;  4C2T A;  3ABM H;  3CJN A;  2XV4 S;  1Z3Y A;  2DA5 A;  1S72 I;  1D8J A;  2EA4 A;  2LKX A;  3HXL A;  1B59 A;  2TDX A;  2R92 J;  4JYK A;  4KIG A;  5EGO A;  2EIN H;  4KIF A;  4IHY A;  4KMF A;  4PSX A;  1I39 A;  1MGT A;  1LE8 A;  4J01 A;  2RC4 A;  3DU5 A;  4UHT A;  2R7V A;  2UXX A;  4LLL A;  2M45 A;  2GOM A;  2OBP A;  2YX4 A;  3IH4 A;  3LSP A;  5GAG J;  3H9G A;  1NG7 A;  1R5H A;  2ELK A;  1UJ8 A;  3JTH A;  1USS A;  3EYY A;  4U88 A;  2DMN A;  3M1C A;  4MQ9 F;  4CYD A;  3FBN B;  3MAJ A;  1FC3 A;  1IAW A;  1QA6 A;  3S1Q J;  2KRF A;  4GRI A;  3RKQ A;  3PUB A;  2DFH A;  1GLN A;  2KQR A;  2LTP A;  2QM3 A;  4O3M A;  2X48 A;  3CUQ C;  2XUB A;  1PVE A;  1R5I D;  2MLK A;  5E79 C;  1BR4 A;  4LG0 B;  3IC7 A;  1YI2 I;  2XSD C;  2DO7 A;  1MBG A;  1MJA A;  2BOL A;  1R7J A;  1SAU A;  5L3B A;  3TP3 A;  5BMZ A;  2HR3 A;  1KZH A;  2FOK A;  1YO5 C;  3IAS 2;  3CO7 C;  4LIV A;  3WG7 H;  4P1W A;  4XN3 A;  1FLI A;  2E5N A;  4MQV A;  1TP4 A;  1ZGJ A;  3BTI A;  2WBM A;  4RGX A;  5ICE A;  2M8E A;  4B44 A;  1HA8 A;  2ZB9 A;  5HNH A;  1YJW I;  2F4I A;  2DFI A;  5ILS A;  1TNT A;  3GW2 A;  4H4K C;  2OV7 A;  2E19 A;  3DPT A;  5K1Y A;  2VN2 A;  4XLA A;  5HLT A;  5FLM J;  3A02 A;  3E6B A;  3CZ6 A;  3HDD A;  2KJC A;  3OL3 A;  1D5V A;  1OKR A;  4DNC A;  4CIC A;  1X2N A;  1FTZ A;  5FKN A;  1X58 A;  2KJB A;  2OAZ A;  2AS5 F;  1E2X A;  2ZBK A;  2ZKZ A;  3JAM Z;  1FYK A;  4OIQ F;  4CCM A;  3K70 C;  3JSO A;  2E1N A;  1X1C A;  2L7M P;  5D8K B;  2TCT A;  3W2W A;  4KNY A;  4E7K A;  1P7I A;  1NG6 A;  3ZQG A;  2GBY A;  1HKS A;  2BGC A;  3E5X A;  5FFZ A;  4OIO F;  4DQ2 A;  3RPU A;  5J6X A;  3ULQ B;  3IRQ A;  2M4G A;  2R5Y A;  2CV1 A;  1JJ8 C;  1T0F A;  3KYL A;  2WAQ A;  3FMR A;  3E7L A;  3DBH B;  1MBH A;  2YS9 A;  4RB0 A;  3GVA A;  1SD4 A;  1KYZ A;  1FIA A;  4QIW N;  2QBY B;  1WJC A;  4UV8 A;  4B8X A;  5C4J J;  3CCU I;  2Y30 A;  1F4K A;  1QPI A;  3EUK L;  2GQQ A;  4B48 A;  4M9Z A;  2PLY A;  1VND A;  3VB2 A;  1ETW A;  4IJA A;  2M5W A;  2M1B A;  2P5K A;  1LDD A;  2MH2 A;  3J81 Z;  2BVL A;  3M1E A;  4KYW A;  1VQ8 I;  3HRS A;  3NAR A;  1K78 B;  4RGU A;  5J1Y A;  5TGT A;  4XKB A;  1OCR H;  4KT5 C;  2FJ1 A;  3DTE A;  5D8L B;  2COM A;  2LRE A;  4RB3 C;  5B1A H;  3SDB A;  1YW9 A;  1TWC J;  2E71 A;  3ZQ7 A;  3MFK A;  4XSX F;  2I8D A;  2VKV A;  1I3A A;  1AKH B;  1I3Q J;  3WOD F;  2M9H A;  1R36 A;  3HTU A;  5H2F C;  1V5G A;  5CVJ A;  4B3X A;  3GO5 A;  3NAU A;  4EM2 A;  2HXI A;  3AL0 C;  1IN6 A;  2VKH A;  1U9N A;  1J9I A;  4MFD A;  3V4G A;  2ME0 A;  3DF8 A;  3IH2 A;  2HU9 A;  2XAQ A;  2OUM A;  5IT9 K;  4L5E A;  3LSG A;  2L4M A;  2XAJ A;  4BQA A;  3RYP A;  3IHU A;  1F9N A;  1SVO A;  4UB6 C;  2AXL A;  1IJW C;  1K79 A;  3LAP A;  5IP9 J;  2V6E A;  2QSF X;  3TMO A;  4GGG A;  3JRI A;  3E97 A;  5F0H A;  4LMY A;  1DPU A;  4IHW A;  4NBQ A;  2MC3 A;  1XGO A;  2BW3 B;  3M7G A;  4CUG A;  1D0Y A;  1JUS A;  1IN5 A;  3P5J A;  1SMY F;  2QCO A;  2XGC A;  3ZQQ A;  2K3F A;  5F1J A;  3VSL A;  1YOV B;  5A2Q Z;  4I76 A;  1YRN B;  3L09 A;  3U21 A;  5HNF A;  4HST A;  4J19 A;  2K85 A;  5KK1 A;  3WGH A;  3F21 A;  2NVX J;  5K5O A;  3K1P A;  1V5E A;  2DQR A;  2E5Z A;  3BR2 A;  3HUG B;  5BNG A;  4QSH A;  2QQ8 A;  1VQ9 I;  3SQN A;  1W36 C;  3L2Q A;  4IKF A;  5C4X J;  2J5P A;  4FX4 A;  2VE8 A;  2AHQ A;  3BQZ A;  2IJL A;  5BPI A;  4I0B A;  1WVR A;  3E5Q A;  3J80 K;  4XOR A;  1Z6R A;  2IBD A;  4A3J J;  2ZXH A;  2STT A;  2VJ4 A;  2BY1 A;  3M8E A;  5K7H A;  5DM7 F;  2G7H A;  2HDD A;  1BM9 A;  5EJC A;  1UCR A;  5LGU A;  2E1M B;  3HJE A;  3MZ8 A;  2YU3 A;  2PEX A;  3ZMD A;  1YIJ I;  3HG9 A;  2FE3 A;  2E34 A;  3P9C A;  3RZO J;  1P2F A;  4ZJZ A;  3GTJ J;  2VT2 A;  2J5O A;  5E8I A;  2LRD A;  2YR2 A;  4YFX F;  5F04 A;  1S5L C;  3JAM K;  1BOA A;  2WTE A;  3I0T A;  5HDG A;  1SFU A;  3DFG A;  4RGS A;  4LJZ F;  4XIC A;  4RA2 A;  1QBJ A;  3MZY A;  4OOI A;  2DA7 A;  2Q8K A;  3E3V A;  2VQH A;  1B72 A;  2CSO A;  3MMY B;  3KLN A;  4YEJ A;  1JHF A;  1C0W A;  3JRF A;  4L9N A;  1Z1D A;  3OSF A;  4XLP F;  1W7P B;  2PQ8 A;  2FNA A;  1PUF A;  3TO7 A;  1E0E A;  3ABK H;  1TWH J;  4ENM A;  1PUE E;  4RAF A;  5EZG A;  4C3J J;  4HNV A;  2ESN A;  2GLO A;  4R8H A;  3CCS I;  1LQ1 A;  1F43 A;  4MHG A;  1KQ0 A;  1BW6 A;  3ISP A;  3JW4 A;  3RYR A;  2ECB A;  3DKX A;  6PAX A;  4BY7 J;  1FOY A;  1LVA A;  2WC2 A;  1ETY A;  2R7U A;  3I59 A;  1Y56 A;  1E3H A;  1W5T A;  3VYS B;  3H5A A;  1ETO A;  4L9T A;  1HKQ A;  4XOT A;  3SZP A;  4DBR A;  3RKX A;  4ZTF A;  2RDP A;  2L2O A;  3WHC A;  2LY1 A;  1V4R A;  2MYS A;  4XRS G;  2M2E A;  2F2E A;  3BLY A;  3D5S C;  1F1Z A;  3QPT A;  4KIT B;  5EG0 B;  1POG A;  3CCY A;  3MCZ A;  2KPM A;  1UHM A;  2B0L A;  1H9G A;  5HDN A;  2W85 A;  3I5U A;  1RUN A;  1MJ9 A;  1IW7 F;  4A3D J;  1A6I A;  2PX9 A;  1XSD A;  2EFN A;  3GZ6 A;  1XGM A;  5F08 A;  2ZJQ F;  2HXO A;  1XN7 A;  3TOB A;  2G0E A;  3A03 A;  2IS1 A;  3S93 A;  2R7W A;  4PK4 A;  1BIB A;  3K7A J;  2B7E A;  4OWR B;  1HST A;  1KU9 A;  2QSH X;  2JPC A;  1RET A;  4AUX A;  4QPO A;  3A0H C;  3DWL E;  4F55 A;  2KLO A;  3W6V A;  3F8B A;  1T6S A;  1T08 B;  5EYR A;  3RQI A;  2Y0S A;  3CJT B;  1FNN A;  4UXN A;  3OYA A;  2DTZ A;  2WY8 Q;  5HS9 A;  2QWW A;  2VBX A;  4FT8 A;  3GTK J;  5K5R A;  1O3S A;  5JHU A;  4II2 A;  1FMV A;  1YW7 A;  2A69 F;  1G3S A;  2LKP A;  2M3A A;  2XF6 A;  4Y33 A;  4HX8 A;  3A01 A;  1VQO I;  3H35 A;  2PMZ A;  4KIB A;  2LD5 A;  2EV6 A;  3ASN H;  4ANJ A;  2EZK A;  4LG3 A;  1W0U A;  1WI3 A;  4DYQ A;  4JK1 X;  1VQ6 I;  1RKW A;  3KP3 A;  1FMW A;  1P6R A;  2QQ9 A;  1AOY A;  1LFB A;  4LB6 B;  1YIO A;  5B66 C;  3CF2 A;  3F8F A;  2V7F A;  5J4V A;  2GXG A;  2HQ5 A;  1TL8 A;  4LK0 F;  5IT9 Z;  1A5J A;  1XX5 A;  4NC8 A;  5IOZ A;  3CMY A;  5HS7 A;  3CCV I;  4XON A;  1FBQ A;  3ERE D;  2E1C A;  3RKW A;  4BGD A;  2RN7 A;  2FU4 A;  1KA8 A;  3HRM A;  3G1M A;  1IRX A;  3BG6 A;  2EFO A;  3VFZ A;  3MEX A;  3NWT A;  3HIF A;  2OU2 A;  1QU3 A;  4BHB A;  1G3Y A;  3A01 B;  4GXO A;  5FD5 A;  2R5Z B;  4IHT A;  5LRS A;  3H3Z A;  2KIM A;  2RV8 A;  3I4N J;  1ETV A;  4XNF A;  3ROU A;  2IT0 A;  1OYW A;  3FHZ A;  3BPV A;  3L2R A;  2V1N A;  3FHN A;  3M4O J;  2FD5 A;  5LGT A;  2HYG D;  2OF7 A;  4O5V A;  3G4S I;  2A07 F;  5HLI A;  5FFX A;  4Q48 A;  3LMM A;  1SEU A;  4IQJ A;  3DPU A;  3K2Z A;  3FMS A;  4L9J A;  4KN4 X;  2EIK H;  3SXY A;  3WU2 C;  3ZMZ A;  1ACI A;  1TZL A;  3RIR A;  5M3F J;  3S2H J;  3I55 I;  3WGI A;  4BXU A;  2IS4 A;  1IV6 A;  1P4X A;  2L0K A;  2WV1 A;  4ESJ A;  2LDU A;  1MW7 A;  2P8T A;  5E3M A;  5DCM A;  2CQX A;  2H8W A;  2WAF A;  1KGS A;  3OV8 A;  3CCJ I;  3F8M A;  2CUE A;  1W0T A;  2Y48 A;  1UHW A;  1HF0 A;  3BR0 A;  4DZP A;  2Z5U A;  4U0W A;  3K1M A;  2WWY A;  1RNL A;  2R7O A;  3BR5 A;  4G6Q A;  3IL2 A;  2IRF G;  5BOX A;  1JT6 A;  2FA5 A;  3J7Y J;  3SDG A;  2CW8 A;  1X1P A;  4D9J A;  1HXD A;  1I6H J;  1K7A A;  1WJA A;  2KP6 A;  2Q0O A;  4WXH A;  4N0B A;  3FIS A;  4BEH B;  1OIS A;  1L3L A;  4XLC A;  3RKY A;  1ZTR A;  1FX7 A;  4CXF A;  1GT0 C;  5LHG A;  3BJ6 A;  1YJ9 I;  4F52 A;  4MNU A;  4C30 A;  3DQV C;  4PCQ A;  1WSU A;  1A35 A;  1ZLJ A;  1EH8 A;  3E6M A;  1IXC A;  2NS8 A;  2F4M B;  2HYJ A;  1FT9 A;  3PFI A;  4KN7 X;  4D5C A;  3EUH A;  1B9M A;  2VOP A;  2XF7 A;  5DCM B;  4CCO A;  5L3F A;  1J7K A;  4D7N A;  2EZL A;  4FQG A;  3SHF A;  4BEH A;  1DGW Y; 
#chains in the Genus database with same CATH homology
 1IDY A;  2XB0 X;  2ECC A;  1H89 C;  1JTY A;  2DA5 A;  3BR1 A;  3BTL A;  2LKX A;  2LP0 A;  2L7Z A;  4B3A A;  3S2D J;  2R92 J;  1IG7 A;  1U9O A;  4JYK A;  4A3M J;  5EGO A;  4IHY A;  1YRN A;  1MH4 A;  3FKI J;  2E2J J;  1LE8 A;  3Q0V A;  1JKR C;  1WPK A;  2M0C A;  2PMZ N;  4BBS J;  2Y9Y A;  3QPL A;  5J1U A;  3IV5 A;  3LNQ A;  2AO9 A;  3FK6 A;  2VPR A;  3IH4 A;  5FJ8 J;  2LY9 A;  3LSP A;  2ELK A;  2DMN A;  2TRT A;  1JJ6 C;  4FIS A;  3S1Q J;  5DTD A;  2NVT J;  3RKQ A;  3S15 J;  1H8A C;  1NTC A;  2LTP A;  2CQQ A;  4IHV A;  4MO7 A;  1Y1W J;  2X48 A;  1E3O C;  4W97 A;  2GM4 A;  1ZR4 A;  2NOG A;  2VKE A;  2XPU A;  1ENH A;  1FTT A;  2NS7 A;  2MSY A;  3BG3 A;  3B6A A;  2EBI A;  2XSD C;  2Y2Z A;  1MBG A;  1BL0 A;  2HOT A;  4NDL A;  3JRE A;  3TP3 A;  5IYC J;  3JRD A;  4ABZ A;  1OJL A;  3HB9 A;  5F27 A;  3GTP J;  3TW6 A;  3BTI A;  5GPA A;  5FKO A;  1EF4 A;  4W1U A;  2K40 A;  2ZB9 A;  4FE7 A;  4DYC A;  4A3E J;  1MSE C;  3HOZ J;  3H0G J;  2E19 A;  5FKK A;  1QRY A;  1MBK A;  2EQR A;  3LOC A;  5FLM J;  3A02 A;  2LFB A;  2YUS A;  2O9L A;  3HDD A;  2DMU A;  2K9N A;  3ZOB A;  3PO3 J;  2DA6 A;  1X2N A;  1JKO C;  1FTZ A;  5FKN A;  1X58 A;  4D5F A;  4MLO A;  4B4C A;  3PO2 J;  2IAI A;  1ETQ A;  4CYC B;  2L7M P;  1B8I A;  2M8G X;  3S1M J;  1IRZ A;  3G1L A;  2TCT A;  3JRC A;  2MGQ A;  3UKG A;  1P7I A;  2JA8 J;  1F36 A;  3ZQG A;  3SJM A;  2GBY A;  4JX4 A;  3PM1 A;  3HKZ N;  3O8H A;  5EF6 A;  3HM5 A;  2R5Y A;  1Y1V J;  2JA7 J;  2XGD A;  4I6Z A;  1JJ8 C;  1HDD C;  4DW6 A;  3E7L A;  1MBH A;  1H88 C;  2YS9 A;  3LSJ A;  4A3B J;  1FIA A;  1UMQ A;  4QIW N;  2MW8 A;  2E2H J;  5C4J J;  2X9D A;  3K2A A;  2Y30 A;  1QPI A;  3B6C A;  1VND A;  2E1O A;  1ETW A;  3GTG J;  3HEF A;  2JA6 J;  3NAR A;  2KT0 A;  5J1Y A;  3BT9 A;  2R5Y B;  3TP0 A;  2FJ1 A;  3O8G A;  5IP7 J;  3TED A;  2XPV A;  4JX6 A;  1Q1V A;  1TWC J;  2ID6 A;  5E3O A;  2VKV A;  3G1O A;  1AKH B;  1I3Q J;  1Z0X A;  2M9H A;  1LFU P;  3HOV J;  2DA3 A;  3NAU A;  2R0Q C;  3ZQH A;  1B72 B;  3M3Y J;  2DA2 A;  1TC3 C;  4XID A;  5E3N A;  3BTC A;  2HXI A;  2HOA A;  2N8G A;  1U9N A;  5M3M J;  1ZQ3 P;  4MFD A;  3GTQ J;  2ME0 A;  3IH2 A;  3HGG A;  4A69 C;  5M5X J;  3OOU A;  4L5E A;  3ZQI A;  3LSG A;  1IUF A;  4JX5 A;  3BG5 A;  4FE4 A;  4M6V A;  1IJW C;  2XGE A;  1ZK8 A;  3HOY J;  4DYR A;  4UUT A;  5IP9 J;  4UUS A;  4C2M J;  5J1R A;  5EDN A;  4A3K J;  2LK2 A;  3JRI A;  5F0H A;  4Y7N J;  2Y9Z A;  1VI0 A;  4IHW A;  2CJJ A;  3LSR A;  1MNM C;  1VFC A;  1MBF A;  3DCF A;  1T56 A;  2FX0 A;  1BJZ A;  5FKM A;  3HOX J;  1JUS A;  1X2M A;  4DZJ A;  2QCO A;  2EZI A;  2H1K A;  2XGC A;  5F1J A;  2Y31 A;  2EH3 A;  1IC8 A;  5K7F A;  4I76 A;  4LOC A;  3WHB A;  2EZH A;  1YRN B;  3BG9 A;  2X6O A;  4J19 A;  3HOU J;  4M3D A;  2NVX J;  2XPW A;  4XRM A;  3HBL A;  2D5V A;  3BR2 A;  5BNG A;  1TWF J;  4M3G A;  4X1E A;  4QSH A;  2DA1 A;  3GTL J;  4RBO A;  1DU6 A;  1JKQ C;  1QVT A;  4M3F A;  3IH3 A;  5M5W J;  5EEA A;  1APL C;  5C4X J;  1FEX A;  1G2H A;  4D7M A;  3I4M J;  2AHQ A;  3H3V K;  1JUM A;  3MVP A;  3BQZ A;  5F0F A;  9ANT A;  1VF9 A;  3GTO J;  2LVS A;  2DA4 A;  5K7Z A;  2WB1 N;  2IBD A;  4A3J J;  4AYB N;  4EEF G;  1SFO J;  5K7H A;  5IPA A;  3C2B A;  2HDD A;  1IDZ A;  1GVD A;  4MFE A;  3MKL A;  2DJN A;  4M3B A;  3S1N J;  1UG2 A;  4JP0 A;  2O7O A;  3ZQF A;  3RZO J;  3GTM J;  1ORK A;  1P7J A;  4M3E A;  3GTJ J;  2DMQ A;  1WH7 A;  4IEJ A;  5F04 A;  3OIO A;  1NK2 P;  3FIW A;  4IHX A;  4XIC A;  4V2G A;  2WAQ N;  5HOD A;  2DN0 A;  2NVQ J;  2HOS A;  2DA7 A;  3FK7 A;  1B72 A;  2XRL A;  2W48 A;  3JRF A;  2B63 J;  3VPR A;  2R93 J;  3OSF A;  2RAE A;  2LR8 A;  1PUF A;  5FKL A;  1TWH J;  5EZG A;  4C3J J;  4HNV A;  2GLO A;  4A3G J;  1NK3 P;  1F43 A;  1UHS A;  1BW6 A;  1JUP A;  3CDL A;  4CYC A;  3GBG A;  2JN6 A;  2ECB A;  3BTJ A;  1BA5 A;  2CRG A;  4BY7 J;  1AHD P;  3CQZ J;  1K83 J;  5IYB J;  4AC0 A;  1SAN A;  5FLV A;  1K61 A;  1CQT A;  1ETY A;  5C44 J;  5JLX A;  1GV2 A;  2XB5 A;  1U8B A;  1ETO A;  2JJ7 A;  1GUU A;  1WGX A;  5IOY A;  2O8K A;  5F0C A;  2MG4 A;  1MBE A;  3WHC A;  4XRS G;  2M2E A;  1ZKG A;  5EG0 B;  1OCT C;  2QF7 A;  1POG A;  3CCY A;  1MBJ A;  4BBR J;  4B1R A;  4C3H J;  5GP9 A;  1O4X A;  3JRB A;  1MSF C;  4MIM A;  4A3D J;  1HCR A;  2NVY J;  2CU7 A;  1A6I A;  1RES A;  5F08 A;  2HXO A;  1HLV A;  2G0E A;  1U78 A;  3A03 A;  1QVU A;  1GDT A;  1JTX A;  3Q0U A;  4C3I J;  3K7A J;  1RET A;  3JRA A;  4AUX A;  3S1R J;  4QTR A;  5IP6 A;  2IEK A;  3W6V A;  5EYR A;  2JK3 A;  3RQI A;  1FJL A;  2ID3 A;  1FIP A;  3DEW A;  2DTZ A;  3GTK J;  4GFB A;  2YU9 J;  3SFI A;  4D7N A;  2CUF A;  1MH3 A;  3A01 A;  3BR3 A;  3ZQC A;  1WH5 A;  2LLK A;  2LD5 A;  2L7F P;  2P81 A;  2EZK A;  1W0U A;  4A3I J;  1WI3 A;  5EG0 A;  4DYQ A;  3MN2 A;  1I50 J;  1RKW A;  4A93 J;  1RR7 A;  1D5Y A;  1LFB A;  3JRH A;  3S14 J;  3RZD J;  4S0H B;  2R5Z A;  4XK4 A;  2HQ5 A;  4RDU A;  2ME6 A;  1ZR2 A;  2JA5 J;  2K9S A;  2R7Z J;  1A5J A;  2OPT A;  5IOZ A;  3CMY A;  3F0C A;  1BW5 A;  1B8I B;  5GPC A;  1TWA J;  2M34 A;  3G1M A;  4XRS A;  3BQY A;  2K9Q A;  3A01 B;  2R5Z B;  3OSG A;  3S17 J;  3L1P A;  1XS9 A;  3I4N J;  1ETK A;  3QQA A;  1ETV A;  4X6A J;  2KDZ A;  1AU7 A;  2VI6 A;  5J3L A;  1ITY A;  3M4O J;  2COB A;  2FD5 A;  2OF7 A;  4BKX A;  2HI3 A;  5DS9 A;  1JT0 A;  1WCM J;  2E2I J;  5JLW A;  1XC5 A;  4Y52 J;  1R9T J;  5M3F J;  3S2H J;  2H8R A;  1IV6 A;  1Z77 A;  2L0K A;  2WV1 A;  2I10 A;  3Q0W A;  5E3M A;  3Q3S A;  2CQX A;  2DMP A;  5IYD J;  5M5Y J;  2CUE A;  1W0T A;  1HF0 A;  3BR0 A;  4DZP A;  1IGN A;  2L9R A;  3BR5 A;  5C3E J;  2DMT A;  5EZH A;  4FCY A;  1JKP C;  3TW7 A;  1GV5 A;  1JT6 A;  2VUM J;  3SDG A;  1I6H J;  1HOM A;  4UUS B;  4BXX J;  2FQ4 A;  3BR6 A;  4A3L J;  3FIS A;  1JGG A;  2JWT A;  4A3F J;  3HGY A;  1ZTR A;  4A3C J;  4FTH A;  1RPW A;  1GT0 C;  4V2F A;  3HOW J;  1S7E A;  1T33 A;  1DU0 A;  1OCP A;  3ZQL A;  3D1N I;  3S16 J;  1LE8 B;  1RKT A;  2Y0S N;  1PUF B;  1ZGW A;  2JMW A;  5EGO B;  2NS8 A;  3JR9 A;  4G12 A;  3JRG A;  2HYJ A;  3QPS A;  1TWG J;  1OFC X;  1XG1 A;  4D5C A;  4BY1 J;  1ETX A;  1HDP A;  5E3L A;  2EZL A;  1AKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...