1NTCA

Solution structure of the dna-binding domain of ntrc with three alanine substitutions
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
MDLPGELFEASTPDSPSHLPPDSWATLLAQWADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGAATLTAKLKELGME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the DNA-binding domain of NtrC with three alanine substitutions.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transcription regulation
molecule keywords PROTEIN (NITROGEN REGULATION PROTEIN (NTRC))
total genus 18
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ntcA00
5JLWA 4BBRJ 3HM5A 1VFCA 4QSHA 4EEFG 1R9TJ 3BR3A 4B3AA 2NS8A 2E2JJ 4IHWA 5E3NA 4M3GA 5FLVA 1X58A 1XC5A 5IP6A 1Y1WJ 1IC8A 3LSJA 1FTZA 2G0EA 4DYCA 1VNDA 4JX4A 1GV2A 3OOUA 3RZDJ 1GVDA 3LSRA 3BQYA 5EG0B 1RETA 1B8IB 1O4XA 3A02A 3LOCA 2I10A 1ITYA 3Q0WA 2K9SA 1ETQA 1BL0A 2Y30A 3HOYJ 1JJ8C 1QVUA 3HOZJ 3JRFA 2H1KA 4IHYA 1MBEA 1BJZA 2L7ZA 3ZQHA 3FK6A 3E7LA 1JT6A 5C4JJ 1MBKA 3TP0A 4QIWN 3S2HJ 4A3EJ 1FIPA 1G2HA 2EZLA 1JUMA 5F0HA 1ZGWA 2MG4A 1H88C 3PO2J 1POGA 1HDPA 1JKQC 3PM1A 1T33A 3ZOBA 2M9HA 1UMQA 3S1QJ 4I6ZA 4AUXA 1AU7A 5EGOA 1I6HJ 3S16J 2E2HJ 4D7NA 2O7OA 5E3LA 1Q1VA 5FKLA 2R0QC 2FJ1A 4A3BJ 4Y7NJ 1RR7A 3JR9A 2HDDA 3I4MJ 1NK2P 3K7AJ 3JRIA 2DMUA 2MW8A 1TWGJ 1I50J 3JREA 2O9LA 4UUTA 1LE8B 4RBOA 1RKWA 2JA6J 1MBGA 4J19A 2IAIA 3ZQGA 4M3FA 2RAEA 3CCYA 1A5JA 3FIWA 3GTPJ 2ID6A 4FE4A 1XS9A 3HOWJ 2K9NA 1ETYA 4A3IJ 4A3MJ 4X6AJ 3H0GJ 5GPCA 5GPAA 2GLOA 5EF6A 1RPWA 2R5YA 1HCRA 2L7FP 1ETXA 2JN6A 3GTMJ 4D5FA 2JJ7A 3LNQA 4FTHA 4XRMA 1F36A 2E2IJ 4BKXA 1VF9A 2HXOA 1JKRC 3GTQJ 1OCTC 1MH3A 5K7HA 5E3OA 2L9RA 4UUSB 3S17J 1FEXA 3BTLA 2JMWA 2DMPA 4XK4A 5F0FA 4JP0A 4MO7A 1SANA 5IP9J 3HGYA 3A03A 5J1YA 3NAUA 2NVTJ 4AYBN 4FE7A 3HOUJ 4BBSJ 4CYCA 1NK3P 2HI3A 2DN0A 2ECBA 2XSDC 3JRGA 2ME0A 3CDLA 3G1MA 1JTXA 1WPKA 3FK7A 5IYBJ 4D7MA 5BNGA 3PO3J 1U9NA 3IH4A 1YRNB 4DYQA 3G1LA 2LTPA 5M5XJ 3GTKJ 5DS9A 1RKTA 5EZGA 4GFBA 1ZK8A 3FKIJ 3BTIA 4NDLA 1TC3C 5F08A 3SFIA 2LK2A 4A3JJ 3OIOA 4AC0A 2VKEA 5DTDA 3GTLJ 2NOGA 3TW7A 1U78A 1X2MA 4XRSG 2JA5J 5C44J 5M5YJ 3RKQA 2VKVA 1SFOJ 5FJ8J 4C3JJ 5HODA 2H8RA 1ETVA 9ANTA 2DA4A 4D5CA 1JKOC 3LSGA 4B1RA 2CQQA 2EQRA 2O8KA 1IRZA 1JUPA 1QRYA 2R5YB 3C2BA 3CQZJ 3BR2A 4C2MJ 2AHQA 1WCMJ 3FISA 2VPRA 1K61A 1OJLA 3S1MJ 1IUFA 1TWCJ 3VPRA 4C3HJ 2MSYA 4DZJA 2L7MP 1IGNA 2M0CA 2EZIA 1H8AC 2E1OA 2QCOA 4S0HB 2JWTA 2DMTA 1JKPC 1CQTA 3Q0UA 2D5VA 1YRNA 2CJJA 5F0CA 3I4NJ 3H3VK 1QVTA 3NARA 5IOYA 1IG7A 2CUEA 2YUSA 2X48A 2HYJA 2K9QA 4RDUA 2AO9A 4CYCB 1T56A 3G1OA 1HDDC 5EGOB 1AKHB 2DA6A 5IPAA 1S7EA 2DJNA 3JRAA 2OPTA 2LP0A 1ZR4A 2KDZA 2HOAA 1U8BA 3QQAA 3BG9A 2X6OA 1ZR2A 5JLXA 5J1RA 1GDTA 1JGGA 2Y9YA 3HDDA 3TP3A 4C3IJ 1LFBA 1ZQ3P 3DEWA 1D5YA 4MFEA 3HKZN 2DA2A 1ORKA 3Q3SA 4FISA 1B72B 4BXXJ 3MN2A 2IEKA 2R5ZB 1WH7A 3S15J 2XRLA 1MBHA 1F43A 4XICA 2OF7A 1A6IA 5EG0A 2CQXA 5F27A 1PUFA 1WGXA 3O8GA 1PUFB 3S1RJ 2W48A 4MLOA 3WHBA 1LE8A 3TW6A 2Y2ZA 3CMYA 2ECCA 2R7ZJ 2XGCA 4M3EA 2LLKA 4DZPA 3W6VA 4W97A 1B72A 2WV1A 2B63J 2Y31A 3HOVJ 1DU6A 1MBFA 3HEFA 4JX5A 3BT9A 4B4CA 4ABZA 1ZKGA 5FKKA 1MNMC 2XGDA 1W0TA 1ETOA 2HOTA 4A69C 1P7JA 2EZKA 5IP7J 1MBJA 3L1PA 4M3DA 2VI6A 2ID3A 2DTZA 5EEAA 2P81A 3OSFA 1UHSA 1HF0A 1Z0XA 2LR8A 3F0CA 2FX0A 2EBIA 2NS7A 4JX6A 4MIMA 5M3MJ 1JJ6C 2FQ4A 2Y0SN 1GV5A 2Y9ZA 1GT0C 2WAQN 5M5WJ 1HLVA 4A3GJ 5GP9A 4A3FJ 1VI0A 5K7FA 1B8IA 4DYRA 5M3FJ 4LOCA 2R92J 3M3YJ 2LY9A 1JT0A 4IEJA 1WH5A 2N8GA 2WB1N 3D1NI 1W0UA 5F1JA 1I3QJ 3IH3A 4MFDA 5F04A 3HOXJ 3ZQCA 2R5ZA 3TEDA 5EZHA 4A3LJ 3HB9A 1GUUA 1P7IA 2LD5A 2DMQA 4HNVA 3GBGA 3BG3A 4A3KJ 3QPSA 4V2FA 3Q0VA 1JTYA 3RQIA 2IBDA 4QTRA 4M3BA 5IYDJ 3B6CA 1BW5A 5EYRA 5C4XJ 2M2EA 2XPVA 4FCYA 1AHDP 3BTCA 2FD5A 4Y52J 2EH3A 3BR1A 1U9OA 3BTJA 5C3EJ 4JYKA 1AKHA 2XPUA 2L0KA 3O8HA 1MSEC 3IH2A 1ETKA 1QPIA 3QPLA 1APLC 3K2AA 2DMNA 1FIAA 2NVQJ 5J3LA 5FLMJ 3JRCA 4IHXA 2TCTA 1ZTRA 3LSPA 1RESA 5K7ZA 3S2DJ 1FJLA 2CU7A 2EZHA 4A3CJ 4G12A 3JRDA 2JA8J 2TRTA 2COBA 2LKXA 3MVPA 2ZB9A 4I76A 3HGGA 1OFCX 5IYCJ 4X1EA 2MGQA 5IOZA 2HOSA 3M4OJ 2XGEA 3DCFA 3ZQIA 2VUMJ 2GM4A 3S14J 1DU0A 3MKLA 1BA5A 1OCPA 4A93J 5EDNA 3IV5A 3RZOJ 4L5EA 2JA7J 1IDZA 3BR0A 3A01B 1TWHJ 5FKNA 2NVYJ 3SJMA 4W1UA 5J1UA 1ETWA 1X2NA 4M6VA 4BY7J 3A01A 1MSFC 2YU9J 1FTTA 2M34A 4V2GA 2ELKA 2K40A 2HQ5A 2LVSA 2JK3A 1TWAJ 4XRSA 1IJWC 4BY1J 3WHCA 3ZQFA 1EF4A 1LFUP 3UKGA 1HOMA 1H89C 1K83J 5FKMA 2DA5A 4IHVA 2CUFA 3JRHA 1Z77A 2XB5A 1BW6A 3BG5A 1WI3A 2DA3A 2E19A 3GTJJ 3BR6A 2XB0X 2YS9A 5FKOA 3GTGJ 1Y1VJ 1ENHA 2CRGA 2KT0A 2DA1A 3B6AA 4A3DJ 1TWFJ 1E3OC 2R93J 1XG1A 2GBYA 1UG2A 4DW6A 2ME6A 2NVXJ 4XIDA 2QF7A 5E3MA 3SDGA 3OSGA 3JRBA 3S1NJ 3BR5A 1JUSA 2HXIA 2X9DA 3ZQLA 2M8GX 3HBLA 2LFBA 3GTOJ 1IV6A 2XPWA 1NTCA 2PMZN 4UUSA 3BQZA 1IDYA 2DA7A 1MH4A
chains in the Genus database with same CATH superfamily
3GEZA 1BN5A 4UVCA 4I09A 2WTEA 1VFCA 3PL8A 4QSHA 1GXPA 3WTVC 2LG4A 3NRVA 4R8HA 2E2JJ 3G71I 3BR3A 2NS8A 2FRHA 2DCEA 4M3GA 1KONA 2KIUA 3MKYB 2UZKA 1X58A 5FLVA 1IC8A 2M3AA 1VQ5I 1QBJA 2OBPA 1K4TA 2L3DA 3RZDJ 2IS2A 2FE3A 3ZN0A 4QLCU 5GAGJ 2V6EA 1AWCA 3FMQA 2I10A 3CLOA 1ETQA 4G7ZF 1HSJA 2Y30A 2MC3A 3CF2A 1QVUA 4P1WA 1Z67A 4MQVA 3JRFA 4BE1A 2H1KA 2K3FA 4BE0A 4KIGA 1BJZA 4OMYA 3K10A 3MD2A 2KIMA 4JK1X 1EJ9A 5DD4A 3ZQHA 4IHSA 3FK6A 3S2HJ 3ZMSA 3CC2I 1IF1A 1JUMA 1TQMA 4NHJA 1LVAA 2L9NA 1ZGWA 1K78B 4ZDLA 2R7TA 1IRXA 1XMAA 3ASNH 5HDNA 3WODF 3F21A 1POGA 2CFOA 3QU3A 3D5SC 2M9HA 3GWZA 1WHUA 1T0FC 3BP8A 4I6ZA 5ED4A 3GX4X 2E2HJ 3DV8A 4XOPA 3TOAA 4CO8A 1YOVB 1MDMB 3WE2A 2FJ1A 3U2RA 1RR7A 2E1CA 3I4MJ 1NK2P 5H6RA 3N4MA 3V8LA 3JREA 1TWGJ 1I50J 2GQQA 5L3EA 3ESWB 2O9LA 4BYYA 2HGCA 1Z21A 3O2PE 2HTSA 1DDNA 2JA6J 1SMYF 1R1VA 3LSMA 4J19A 2IAIA 4ZJZA 2CSOA 1BI2A 1R23A 4J01A 4Z2YA 2EIJH 4XMYA 3F23A 4NNJA 1QZEA 1W36D 3AKZA 2L9VA 3H0GJ 2W00A 5GPCA 1YW9A 5L3BA 4ESBA 3DTKA 4BU2A 1Y8RB 1RPWA 2R5YA 1ETXA 1XDUA 2RQQA 2ZO4A 5H20A 2M0MA 2JN6A 3GTMJ 5K5QA 2W7NA 2IS1A 2GA2A 2NYXA 1F36A 1K79A 2RVCA 1JKRC 4E7KA 1MH3A 4A12A 5IT9Z 1SFXA 2K85A 2W85A 4MQ9F 4ETSA 2JMWA 5FRMA 2EJRA 2DMPA 5LHGA 1TP4A 1L0OC 5J1YA 4HF2A 2NVTJ 3TL4X 1NK3P 2DT5A 1Y39A 4CGZA 4KYWA 2DN0A 2XSDC 2HEOA 3CDLA 4FHTA 2YU3A 5IYBJ 4S04A 4X0GA 1DPUA 1YG2A 1FOWA 1SFEA 3L09A 3QU6A 1U9NA 2F5CA 1XN7A 4A2UA 5M5XJ 2XROA 4KDPA 4D9JA 1IRFA 5DS9A 3GLLA 3OL4A 4G9YA 4CYDA 2FQ3A 3I3LA 5HS7A 1ZK8A 2HR3A 2D45A 3ABLH 3BJOA 3FKIJ 3D5LA 3RKWA 1D1AA 4AC0A 3GTLJ 2FSWA 4DNCA 4XKWA 2GZWA 2OU2A 3CCUI 3C2GA 2HYFA 5TISC 2JA5J 2F4OB 2X1EA 4RLFA 3X2QH 3RKQA 2VKVA 1YS6A 1SFOJ 5LRRA 3MMYB 3V7RA 2DA4A 3EYYA 1JKOC 4CUGA 2PMZA 2ZXHA 2EQRA 3L2VA 1T8IA 1IRZA 1JUPA 4QPQA 2DQRA 3J7YJ 1QRYA 1Z9CA 3ZPLA 4FT8A 4KN7X 3T5XA 3REOA 3KEYA 3GFJA 4EMSA 1WCMJ 3KEQA 1OJLA 5AIQA 1IUFA 5FFXA 4MHGA 4D0PA 1ZLKA 3DU5A 1MGTA 2M0CA 3M8JA 1HSTA 2E1OA 2GIVA 1FWZA 1DPRA 2DMTA 2O3FA 2PMUA 2FMLA 2CJJA 1TZLA 5F0CA 3I4NJ 1MJ9A 1UZCA 3W2VA 4YIRX 2GOMA 1IG7A 2YUSA 2X48A 1FYLA 3J80Z 1UAAA 1DGWY 1XGSA 2EV6A 4AIKA 3GXOA 2VQLA 3EUAA 2UXXA 1T56A 3G1OA 5EGOB 1XMKA 3HSFA 3BG6A 1AKHB 4E6KG 1BI1A 5IPAA 3LMMA 2OPTA 2XVCA 1WJAA 3DPLC 1ACIA 3H3ZA 2F6CA 4IL6C 2X1DA 2KJBA 3HZJA 3BG9A 3KEOA 2FEZA 3KPHA 3HG9A 4B47A 4RGRA 3ECOA 5J1RA 1F9NA 3HSEA 2PN6A 2CQKA 3CCMI 1CF7A 1R4NB 4N9IA 3ZMVA 2KIQA 4ENMA 2A6HF 1QGPA 3OYIA 1I39A 1W1WE 3HKZN 3OYMA 1HBXG 2ZXIA 2ADUA 2DA2A 1XX5A 1BC7C 3EUHA 2CUZA 5KAIC 4M9SA 3S15J 1WH7A 1PUEE 2DT6A 2XRLA 1DUXC 1ZRDA 1TW2A 3HKZA 2M7BA 2BW3A 3IHUA 1N25A 2VQCA 3CC7I 4A6EA 3K1PA 3CJNA 4KIFA 2V1UA 3SXYA 5HLTA 2ESNA 2W48A 4BJ6C 1LE8A 1QPMA 5DM6F 1S7AA 3ONQA 1U6GA 3AG1H 2M4KA 5TJJA 1YIJI 4IF4A 3CCRI 2X6YA 2XGCA 3W2WA 4DZPA 1VQ7I 3H35A 2BY0A 2XHKA 1VZ0A 1YQAA 3I4PA 1B72A 1J5YA 4UVAA 3QP5A 4JX5A 3G73A 2M45A 4HX7A 4LLGF 3A4CA 1W0TA 1ETOA 2HOTA 2RQPA 4XM3A 1BBYA 1O3SA 3K9TA 4IX7A 3LQRA 4KA4A 3HRUA 3L1PA 2ID3A 2OQRA 2DTZA 5EEAA 4RB2C 1I6XA 2P81A 3TOBA 3WTZA 3AG2H 1H9TA 2MD5A 2VBYA 2LKSA 2V1XA 3CUOA 1JJ6C 4L0ZB 1YHQI 1TNSA 2WAQN 1HLVA 1YJWI 3BY6A 4DBRA 5J4VA 2ZJRF 3L2CA 2MH2A 2ZSHB 4BUPA 3WU1B 2JTVA 4CZCA 3M3YJ 4LOCA 1ON2A 3M8EA 5FB2A 4OIQF 2K4BA 4QPOA 1YO5C 2OTJI 2J5PA 2WB1N 1W0UA 2P7VB 4F3QA 3IH3A 4GXOA 3G6EI 4B3XA 2DPUA 4IQ4A 1FC3A 3ZQCA 2KFDA 1LEBA 2QLZA 2ZJQF 1Y0UA 3PJRA 4GDFA 2BXZA 1I3AA 2DMQA 1YW8A 2BY1A 1VQNI 3BG3A 1V5GA 3OV8A 3QPSA 2LNBA 4WF2A 5J8CA 4FX4A 5IYDJ 4LGWA 5EYRA 2ZMEC 5C4XJ 5DV5A 4FCYA 3IP4B 2FNPA 3BTCA 2E71A 4BDZA 1X4PA 4Y52J 1XGMA 5C3EJ 1R5GA 5BQTA 3VYUB 1AKHA 3O8HA 1MZBA 4PK4A 2RDPA 3IH2A 2W84A 2K9LA 3H5RA 5EEGA 5IY5H 1QPIA 1UHWA 3K2AA 2IA2A 1JGSA 2VONA 4HW0A 4ZDPA 5J3LA 5FD6A 2NVQJ 3JRCA 4N4NB 2FBIA 3FXLA 2TCTA 3NQOA 3DF8A 3LSPA 3CO7C 1BIBA 3WG7H 3S2DJ 2KDOA 4G12A 1Y6IA 2JA8J 2VASA 3H36A 2ZB9A 3RCOA 1R22A 1FPQA 2ZXWH 3T8TA 1G3SA 3Q9VA 2FMYA 5AIPA 3WGIA 5HLHA 1S72I 4ZC3A 2R7SA 2ZC2A 2H09A 3DWLE 4QWQA 1Z3YA 2O0YA 1X19A 1ONVA 3IV5A 4L5EA 5K5OA 2JA2A 2B9SA 5CKTA 1FP1D 1R1TA 3A01B 1J59A 4HV5A 4ASNA 3SJMA 4PSWA 1LVKA 4ZYHA 4XLPF 1P6RA 3JSPA 5CJ9A 2P5VA 3OWTA 4UNOA 2L02A 3KLNA 1SC7A 3SFZA 4PJNA 2BZTA 5D4SA 2LVSA 1FSHA 2HQNA 1TWAJ 3F3XA 4O6JA 3ZQFA 1K6YA 2MD0A 1REPC 1O7FA 3HRTA 2IS4A 1EH6A 1D0YA 3EETA 1ZHFA 2CUFA 2KRHA 2L7KA 2XB5A 4BEHB 1G8XA 1MKMA 2E19A 5L3GA 2VQGA 2XB0X 5FKOA 3RIRA 1P4XA 3PSIA 1TWFJ 2JQ7A 2R93J 4N9HA 5L3DA 2JUCA 4L9TA 1UG2A 4KMFA 1YITI 3CDIA 4CCLA 3LSHA 3AG4H 2MABA 2QF7A 3OSGA 2KMUA 3JRBA 1W5TA 3KZZA 4MTDA 4II3A 2X9DA 1K4SA 2PMHA 3Q5FA 2M8GX 3HBLA 3OYJA 1TTYA 3KZIC 4E4HA 5LHHA 4ENKA 3BQZA 3PNTA 2DA7A 1MH4A 4EVIA 5JI6A 4HV6A 3KZYA 1USTA 2FBHA 5JLWA 1DGRM 2MH9A 4BBRJ 3RQ4A 2M8EA 3T8RA 3OYCA 3U1KA 5D4RA 3FHZA 4CZZA 3UNGC 1IW7F 4OWRB 2KP6A 1ZAOA 1RR8C 4B09A 4EEFG 4B3AA 4EGZA 5E3NA 1T2KA 1D1CA 2WAQA 4EM0B 4E7SA 1YJNI 4ENJA 1Y1WJ 3KX2A 1XMXA 4S05A 3LSJA 4G94A 1BIAA 3DKWA 3VB2A 1ZH5A 1GV2A 2K86A 2JSPA 4Z6YA 1P92A 5EG0B 1RETA 1B8IB 4CSWA 4Y13A 1QU3A 3BPVA 2K27A 1ITYA 3VEPA 1R49A 5D5UB 4V19K 4BE2A 1VQKI 2DLLA 2IPQX 3HOZJ 3L00A 4RMNA 2WY7Q 4IHYA 1KU3A 3MCZA 1MBEA 2YX7A 3H9QA 3WTSC 5KHDA 3TMOA 2BHZA 2L7ZA 3BLYA 2C6YA 4RS8A 3N97A 5C4JJ 1MBKA 3JTGA 2K4JA 4OIOF 1G2HA 3L2WA 1KU7A 2ELHA 4KT5C 5F0HA 1FZPB 1H9GA 2MG4A 1USSA 5FGMA 4U88A 1LDDA 1ZGAA 1HDPA 2WAFA 4HX8A 4U0VA 1QZYA 2A5WA 3PM1A 2A68F 2EFWA 2QQAA 4OINF 1AU7A 1RI7A 4I01A 2Q0OA 5EGOA 4BQNA 2OCEA 3S16J 2O7OA 3F8FA 2DOAA 3ISPA 5TGTA 3VYTB 5FKLA 2R0QC 2QKMB 1FMWA 2DDAA 4A3BJ 1KA8A 4Y7NJ 5DD8A 3JR9A 3F8MA 2WADA 3JRIA 4ESFA 3D5RC 2A6EF 2CGPA 1IXSB 1UHMA 2YX4A 3KCCA 1SD5A 3ABTA 3R4KA 2H8WA 1RIOH 1RKWA 1FNNA 4Q5SF 4M3FA 1LKXA 2RAEA 4IPAA 3CCYA 1X3UA 1XD7A 3GTPJ 4ON0A 1ETYA 4A3MJ 5CVVA 2GLOA 2UUZA 4YEJA 1BR4A 1FBUA 1XCBA 2F2EA 2L7FP 3MQ0A 2VBWA 2LSOA 4FTHA 4XKCA 4XRMA 2CW7A 3PSFA 2E1MC 1D8JA 2PX9A 2LH9A 2VBXA 1VF9A 3GTQJ 2JRMA 4ZTJA 5EJCA 2L9RA 3CC4I 2VKDA 2P0WA 1FEXA 3BTLA 3IWZA 1ERDA 1T0FA 2WC2A 1U3EM 5IP9J 2YSRA 3HC7A 1HA8A 2DJIA 4E7JA 4Y33A 4AM3A 4GRIA 3ABUA 4HAMA 2ME0A 3G1MA 2IA1A 1RUNA 2NXNB 2Y48A 3GVAA 5BNGA 1F1ZA 3OYGA 4MTEA 3GCMA 2IGNA 1YRNB 2F5FA 2L4MA 3MEXA 3G1LA 4CHUA 1PVEA 2R7DA 3GTKJ 2BV6A 4UV8A 1ZARA 2MLGA 5F1RA 4GFBA 3D0SA 4OAYA 5CVUA 1SVMA 4U7BA 3QPHA 2VXZA 3HSRA 3FXQA 3CO6C 1N77A 3LAJA 3U21A 4MEYF 5LGUA 4PCQA 3WE3A 3LFKA 5DTDA 1R4MB 4WXDA 2NOGA 5D8KB 2BYVE 2GAUA 2IGKA 4UHTA 3DEUA 1X2MA 4C2TA 4I2OA 3K4BA 2BHYA 4IZZA 2ZCWA 2H1LA 1RNLA 5FJ8J 9ANTA 1S9HA 3C2HA 5D6FA 1MMAA 2H8RA 2RC4A 2M5WA 2Y0MA 4EM1A 4D5CA 3EQLF 4B1RA 2CQQA 3S32A 2CYYA 3G2BA 4HBLA 1Y56A 1W7PD 1OCRH 2W1OA 1ON1A 2H6BA 1G3TA 2OD5A 2ZJPF 3GMEA 2CS3A 4L5IA 3C2BA 2X4HA 3CQZJ 2VE9A 3BR2A 2AHQA 3FISA 2VPRA 1TWCJ 2MSYA 4O3MA 2QQ8A 4A0XA 4XORA 2VB6A 3H5AA 2EZIA 2WV0A 2QUFA 3CMAI 1FMVA 1YX5A 4GGGA 3Q0UA 2D5VA 3CP2A 2H27A 1D3YA 3QYBA 1GHCA 5ICEA 3FM5A 3FXMA 3CCQI 2E34A 2AO9A 5FO5A 4HNUA 3ZQ7A 4PDKA 4I0BA 4CYCB 4KNYA 1SVLA 1HDDC 2MC4A 3DPTA 2JSCA 2DOEA 2V79A 1S7EA 5J4YA 4LG0A 2DJNA 5ERIA 5LGNA 1Q1HA 5BMZA 2KDZA 2ETHA 1EKEA 2R7OA 2E5ZA 3L2QA 2QYOA 1U8BA 2LREA 2LMDA 4F55A 5D8LB 2E1MB 4EATA 2FF4A 5LBQA 1JGGA 2DW4A 2L4AA 2VJJA 3SZGA 3GZNB 4C3IJ 4XBFA 4HNTA 5HS8A 3AL0C 4DBQA 3FDYA 2WWYA 2CMPA 1D5YA 1MW7A 3GYHX 3OMYA 1IAWA 3P9KA 3OYKA 2JPCA 2HKOA 3I53A 1E17A 3MKWB 2EWNA 4ZZLA 3MN2A 2PI0A 4PGGA 2VOOA 2DFHA 1YFHA 1LJ9A 1MIJA 2EIKH 1MBHA 3JAMK 4XICA 3CUQC 2OF7A 4GO1A 1V3FA 5FLXZ 5EG0A 3CCVI 1F5TA 2XASA 5F27A 1PUFA 1WGXA 2E60A 1O57A 1PUFB 2PJPA 1E2XA 3WGHA 3R0AA 2R7VA 3WHBA 3OYNA 1I5ZA 3CCJI 1EH8A 2Y2ZA 4HSTA 4U0YA 3AAFA 3ZP5A 1VQ8I 2ECCA 1SFUA 4G6QA 3KE2A 3T1BA 2A5YB 1UELB 2LLKA 1ZG5A 3W6VA 2P4WA 1SAXA 1TT5B 3HTUA 1YIOA 4W97A 3RYPA 2Y31A 3ZMDA 1JHFA 3HOVJ 4PJMA 3GUDA 3M8FA 2A3SA 4ZTFA 4IRHA 4B8XA 5FKKA 1ZGJA 3M1CA 1XSXA 3N05A 1MNMC 5AONA 3MWMA 1G3WA 4KT6A 1T98A 5H2FC 2DOFA 1MBJA 3KP4A 5HNHA 2P6SA 4M3DA 4NBQA 4RM3A 4IO9F 1FY7A 1WSUA 2Y0SA 2JPBA 3RPQA 3OSFA 1HF0A 4UVBA 4XLCA 1ZYRF 3OYFA 2EBIA 4M71A 2Y75A 4KISA 2Y9ZA 2I5UA 3FXUA 5GTHC 5M5WJ 1KGSA 4A3GJ 3DLAA 1X1AA 3EUHC 2CUJA 4DOZA 1EH7A 4HF1A 3EDPA 5CPRB 3RYRA 5K7FA 1J75A 1UB9A 3BG7A 4NQWA 5M3FJ 3GO5A 4YIIA 3S8PA 3R60A 2LY9A 4OAZA 1ZREA 2HKXA 3ZQQA 2EV0A 4C9YA 5TRDA 2N8GA 2HTJA 4KN4X 4BEHA 5HS9A 1VQLI 1KQ9A 2BE5F 3FKJA 1HXDA 1NG7A 2V4JC 1I3QJ 4MFDA 3H9JA 4UXNA 2W57A 3HOXJ 1GVJA 3HOSA 1OCCH 4ITVA 2K5CA 3VSKA 3DLLF 4A3LJ 1TBXA 2E35A 4CCKA 5KNLA 3MZYA 2LD5A 4RGSA 3S93A 3V8JA 4A3KJ 4P96A 3Q0VA 3HTSB 2IBDA 4RM2A 3T0YA 4QTRA 2CQ7A 4M3BA 3B6CA 2BXYA 5GADJ 1IRGA 2Z2SB 2EFNA 1WZ2A 4EJUA 2HQRA 3C1DA 2FD5A 4ESJA 2LF8A 2EH3A 4PFOA 3BTJA 3LWFA 3M07A 3E5UA 2V9VA 4XLFA 2L0KA 1E3PA 2IGOA 3QODA 5HVQC 2DTRA 4XL9A 2DYRH 1J7KA 1X1DA 3GFMA 3QPLA 2DYSH 2BEOA 4PGHA 1NHAA 1UFMA 1SFKA 3QOEA 1OQYA 1P2FA 1S29A 1YYVA 1RESA 5K7ZA 3H0DA 5DM7F 1XPXA 2CU7A 2CQNA 4L5JA 1IUYA 4KUMA 1TQIA 2FA5A 4L9VA 1KU2A 3JRDA 1BI0A 2OC6A 2XAFA 2OCCH 3EUKL 4RB3C 1OFCX 4X1EA 3ULQB 2M30A 4CICA 2L54A 2EB7A 5IOZA 1J0RA 3DCFA 1G59A 4JBAA 4RAGA 3O6BB 1DU0A 1Y0NA 3MKLA 3VWBA 1BA5A 1N78A 2A6TA 2ISYA 4A93J 2KKOA 1FOXA 4YFKF 5EDNA 3GZ6A 1HW1A 3AL0B 2ZSIB 2LBFA 4RB0A 4U0WA 1D0ZA 4HQMA 3S2WA 5J1UA 3IRQA 1X2NA 1KYWA 1LUJB 3A01A 4NC6A 1MSFC 1WRJA 2LBFB 1FTTA 2M34A 2VJ4A 2XSJC 1KU9A 3CJTB 1Z7UA 2I8DA 4I99C 3W3CA 2FOWA 2HQ5A 2QEXI 2W4SA 3V4GA 2JK3A 1ZRFA 4BY1J 2KRCA 3VFZA 1HOMA 1PJRA 3LQQA 5KAFC 4JOMA 5LD2C 4YFNF 2V6CA 2ZNYA 1Z77A 5ILVA 1WKMA 4G8XA 3BG5A 3IAM2 1BOBA 3BR6A 2YS9A 4RGXA 3K0LA 1Y1VJ 2BVMA 2DA1A 2QENA 2VC0A 3F8BA 3LSKA 3OOPA 3L2RA 4A3DJ 5ICGA 1ZG3A 2EK5A 2OV7A 3SEZA 4DW6A 2ME6A 2KPMA 2KIFA 4AU7A 1WI9A 2HZDA 3KP5A 5E3MA 1FOKA 3SDGA 2KISA 3WTYC 2ELJA 3S1NJ 4BGDA 5HNFA 1HW5A 1X1BA 4F52A 2O8XA 1B59A 3E6BA 1NTCA 4CXFA 3BROA 4P9UA 4HF0A 1LFPA 4IOCF 3PFYA 1A04A 3PQKA 2XUBA 3OIQA 1IV8A 1GLNA 1J09A 5B1AH 1XB4A 2VBZA 1BR2A 3JAMZ 3SDBA 3DTEA 3BZKA 4IRGA 3V42A 5ICCA 1R9TJ 1QA6A 4IHWA 3ZMTA 2DXIA 3BC8A 1IN7A 2JRTA 3K4NA 4ENNA 2OTLI 4BACA 2G0EA 3R0JA 1VNDA 2BY3A 4JX4A 1S3JA 3IKTA 2IRFG 4LK1F 5CVIA 1GVDA 3ML6A 3U9GA 3BQYA 5A2QK 1I1SA 2IP2A 5KCMA 1OR7C 2KRFA 3F72A 1A31A 1S6LA 3I0TA 1FYMA 3KP6A 4C30A 4YRVA 5DUKA 3FBIB 2WB1A 1BL0A 3HOYJ 5E18F 2AQEA 3KETA 3WTWC 2IT0A 4CH7A 4M72A 2XAJA 4M6YA 2OZ6A 4BQQA 5IT9K 1MDMA 1HQCA 3RSNA 4ZH4F 1G3YA 2XDVA 4U7DA 2JVHA 1YTYA 4RA2A 4CCJA 1U8RA 3GFLA 3E7LA 1JT6A 3TP0A 1FIPA 5F64A 2BGCA 1RZ4A 3CLQA 4YELA 1TQPA 2RNGA 5A2QZ 3ABMH 5LEJA 3DBRB 2HPIA 1KYZA 1H88C 4AVZA 1T33A 2DODA 3ZOBA 1SD6A 1UMQA 4P5OA 4AUXA 2R7RA 1B9NA 2JVGA 5B3SH 3C3WA 1I6HJ 2QQ9A 5LLQA 4D7NA 4HYEA 3PUFA 5E3LA 4K2EA 1Z6RA 4HPQA 4BXUA 2ZKZA 1SMTA 2GXGA 1T38A 1FOYA 2XGXA 3K7AJ 3OR2C 4I98B 2MW8A 1L3LA 4L18B 4UUTA 2HFHA 1MJAA 4RBOA 1IXCA 1MBGA 3QYFA 3PQJA 3I54A 3ZQGA 4CA0A 4XR6A 3E3VA 4MNUA 2KQRA 4FASD 3IRRA 4R79A 4BJ5C 3FIWA 2ID6A 3ZMUA 4IVNA 2K9NA 1XS9A 4IHTA 3HOWJ 5GAEJ 5GPAA 2CW8A 2ZXJA 4HQEA 1HCRA 1PYVA 2MA3A 1K6OA 3H5NA 2AXTC 4D5FA 5CLSA 5L3FA 1YW7A 4BJTA 1IXRC 3DQVC 2E2IJ 5F6FA 2Q8KA 3RKYA 4CCOA 4XLEA 5K7HA 1B1BA 4UUSB 4YG2F 2EFOA 2F4MB 4F93B 5BPDA 2F48A 3SZTA 4AIJA 4LG0B 2X51A 2R7QA 3K1NA 4MO7A 3WU0A 1E3HA 4E70A 3NAUA 1U2WA 4AYBN 5CQEA 3BCBA 4CYCA 1O7LA 2PJRB 3PFIA 1BOAA 3LA2A 2ECBA 1Y8QB 2NS0A 4XQFA 4RB1A 3JRGA 1UG0A 1JTXA 1WPKA 1ZRCA 3FK7A 2EV5A 4D7MA 1ZELA 3DKYA 2HS5A 3K70C 1Z91A 3PO3J 3DBHB 4LG3A 4DYQA 3HHHA 3GZ5A 1R1UA 2LTPA 4LIVA 2ZMEB 4PFPA 1RKTA 5EZGA 1X3WB 4HX4A 2WY8Q 1QHGA 4E7IA 2KZVA 2XAHA 3BTIA 4BL0B 3I5UA 2UV1A 4EM2A 5F08A 1U5TC 3SFIA 2PEXA 3E1SA 2LK2A 3PNVA 3E6MA 2ZBKA 1VQ9I 2DAOA 1IO2A 4Q48A 4UUVA 3K4KA 3HPGA 2XV4S 1VQPI 3CZ6A 5M5YJ 2ACJA 2RNJA 4HDUA 5DEQA 2YPRA 5HODA 1ETVA 3ZMZA 2BOLA 1RC9A 3LSGA 3ABKH 3DEEA 4HLYA 3A0BC 1WQ2A 2O8KA 3W6JB 2QA4I 2R5YB 2XAQA 1T95A 4AVPA 2A61A 4F92B 1P4WA 1V54H 3DPUA 3S1MJ 4C3HJ 5LRSA 4DIQA 2L7MP 1IGNA 3KP2A 3LA3A 2QCOA 2Q1ZB 3CJQB 2STWA 1YRNA 1T6SA 1MJBA 2ISZA 1B4AA 3UR3C 3H3VK 1QVTA 2G7UA 3NARA 3RDIA 5IOYA 2CUEA 2HYJA 3LL7A 3G3ZA 2EPFA 4RDUA 2W82A 4CDGA 3K4JA 1V5EA 1KZHA 3ECHA 5J6XA 3KYCB 2LY2A 4FX0A 5J47A 3F8CA 4BQOA 4UB8C 2VT2A 2AXLA 3JRAA 1NG6A 2R7FA 2FU4A 4WWCA 2JUGA 2QQBA 2D1VA 2X6OA 5JVTA 5JLXA 4C2UA 2R7XA 2Y9YA 3HDDA 1ZQ3P 1LFBA 3HXLA 1A35A 3C18A 2E7XA 5LFAA 5D5VB 4MFEA 2V1DA 4Q47A 5E1XA 4RAZA 3LSTA 3CD6I 2HNHA 2R7UA 3FWEA 4FISA 2VLAA 2Q2EA 3BZ6A 2DFFA 3I59A 1R58A 1OISA 2GWRA 2IEKA 1R00A 2VPLA 2HOEA 4HG2A 2PG4A 2J5OA 2QWWA 1IN4A 3GF2A 4N4OB 2FBKA 1A6IA 2Z5UA 1OCZH 2CQXA 3EYIA 3OY9A 1QO0D 2BW3B 3FF5A 4IRIA 4LB6B 3K2ZA 3TW6A 1O3TA 1LB2A 1W5CC 1YJ9I 3FMRA 3SEQA 2Z3YA 2MBFA 4M3EA 2DT7B 3PIPF 5E8GA 1PP8F 1M1EB 3P9CA 2B63J 1DU6A 2O61A 3HJEA 4FQGA 3BT9A 4H4KC 1UJ8A 3HUGB 4ABZA 3IWFA 2H6CA 1SVOA 3QRFF 5B1BH 4F91B 3U1DA 3BJ6A 1P7JA 5IP7J 2P8TA 1OR7A 2EIMH 2VJ5A 3TDUC 2GXBA 2CG4A 1UHSA 1B6AA 3OYDA 1BR1A 2P5LC 2FX0A 1WJCA 2NS7A 4HZFA 3OYAA 2FQ4A 2Y0SN 1GV5A 4RAFA 1LQ1A 2LKPA 3BJAA 4KICA 1R6RA 5GP9A 5E1ZB 4XONA 1FP2A 2XF5A 1CGPA 1MMNA 2VN2A 1B8IA 4R1HA 3TKYA 1BJAA 4BS9A 2L2OA 1WH5A 3D1NI 1SD7A 2OJED 5F1JA 1P4AA 3AFHA 1YE9A 2V9PA 3J81Z 3E5QA 2WAEA 3K6GA 2F5VA 2MLKA 4XKBA 2R5ZA 2QZ8A 4AIHA 3I59B 2R3SA 3R6SA 5JVGF 2DK8A 1GUUA 1P7IA 1RRJA 2MYSA 3GBGA 4EJOA 4L9NA 4V2FA 3RQIA 1JTYA 2O03A 1WWXA 3OYLA 1R71A 2PLYA 4BNCA 3OIPA 3J7AO 2GIZA 2M2EA 2XPVA 1AHDP 4OIPF 4A0YA 5J8FA 1LEAA 1R36A 2D2WA 2O5RA 1HKSA 4HA8A 4AIDA 3DP7A 4JYKA 1VQOI 2BY2A 1T08B 2IW5A 2PQ8A 3HPHA 1VTNC 1IN5A 2M4GA 3CCSI 2DMNA 1FIAA 5FLMJ 4MEXF 4IHXA 2FOKA 4CCMA 4LLNA 4AYBA 2E36A 2EZHA 3FBNB 2XKPA 4HLXA 4EV0A 2TRTA 3CMEI 4E7ZA 3OYEA 3FXRA 3DU6A 3HGGA 3HRMA 4I02A 1FLIA 1FSEA 2FNAA 3Q9SA 5JHUA 3M4OJ 2XGEA 4XKVA 3ZQIA 2VUMJ 2GM4A 3S14J 4G6DA 1S5LC 4HSRA 3LFUA 1OCPA 3LA7A 3JTHA 1H0MA 2G7HA 1IDZA 3ERED 4B44A 5FKNA 1T39A 2NVYJ 2AS5F 1OPCA 1W7PB 1N75A 2Z16A 4W1UA 2RGVA 1DP7P 1G6NA 1X4OA 1W36C 5H6QA 4BY7J 1F4KA 2COMA 3H3UA 2CV0A 2ELKA 3K4MA 4UB6C 1IJWC 2JZYA 1OKRA 3WHCA 4XOTA 1U5TA 4ZYDA 5LEKA 2B7EA 2VODA 3UKGA 2W24A 2DFIA 4G7HF 1H89C 1K83J 2K7LA 2W25A 5FKMA 3MZ8A 3MAJA 2DA5A 1VQ6I 3KYLA 3ZR8X 4ZDOA 3JRHA 2Z99A 3A1YA 4JQFA 1BW6A 1LNWA 2DA3A 4LLLA 2A05A 5EEHA 2KJCA 2G9WA 1E3OC 4XLAA 1XG1A 1W5SA 3JW4A 4RGUA 5FD5A 2NVXJ 4IOAF 2X1CA 1LDJA 1OYWA 2P5KA 2R4GA 5DCMB 2L5QA 3BR5A 2K02A 4B48A 2HXIA 1XSDA 3GTOJ 2LFBA 4BH9A 2GXAA 5JFRA 4GYIA 2PMZN 5D5WB 4IJAA 1IDYA 3W6KB 3ZCOA 4LMYA 1U0JA 3CMMA 4LK0F 1FT9A 1JHHA 1HC8A 1A6QA 3HUGA 3TO6A 4F7ZA 3O3KA 3HM5A 1X3ZB 3KP3A 4RAYA 5JR3A 3S3OA 2CO5A 2KLOA 4ZYAA 2HVRA 4I7HA 4M74A 5CYVA 4BXFA 4PUSA 3ZN1A 1ZN2A 3F9KA 1XC5A 4HDVA 3V8KA 5IP6A 4XRFA 4BAYA 1STZA 1FTZA 1ODDA 1UCRA 4B43A 4DYCA 1LPQA 2HYGD 4HRIA 3VOEA 2HVQA 3OOUA 1I1GA 2VKHA 2ZJ2A 3LSRA 2STTA 2V7FA 2A69F 1MNEA 2XKOA 3B73A 5HDGA 1O4XA 3WTTC 3A02A 3C7JA 3LOCA 3R61A 5DYMA 3Q0WA 2K9SA 1OCOH 3TDZC 2VJIA 2XAGA 2Q2EB 4N0BA 4ZZDA 1JJ8C 5ILSA 2M7AA 2QSFX 2HU9A 5D5XB 2OZUA 3WG9A 2QBYB 5HLIA 4UY8I 1WJFA 2XRNA 4QIWN 2ZFUA 5E8IA 4J00A 4A3EJ 1WVRA 1OLTA 2EZLA 2JT1A 3I9V2 3I55I 5HLGA 4P55A 2HPMA 2O6GE 3M1EA 3B02A 3PO2J 1JKQC 2BBYA 2NNYA 4WXCA 4PZJA 3S1QJ 5DCFA 3DTIA 3SHFA 3S3NA 1YLFA 3CJRB 1PP7U 1ULYA 2QBYA 1MMSA 4ANJA 1Q1VA 2XF6A 3E5XA 3LAPA 2F5EA 3VDXA 3WTXC 2HDDA 3P5JA 5GTIC 5FRNA 1X1PA 3RTRA 2DMUA 3HOTA 1W4MA 3RJPA 3CUQA 1R5HA 3HHGA 1LE8B 1IN6A 4NUBA 3KP7A 4NC8A 1LDKB 3H9GA 2FUG2 1JE8A 2F4IA 4WXHA 1A5JA 5GAHJ 4FE4A 1D0XA 5ILUA 4X6AJ 2GA1A 5ICFA 4A3IJ 2A07F 2EA4A 4OU0A 5EF6A 3OS1A 3CCLI 1WFXA 2YR2A 3MFKA 3QWLA 2OAZA 3ELKA 3E6DA 3OS2A 2DQLA 2LOOA 2L01A 2JJ7A 1XGNA 3LNQA 2VT3A 3K69A 3IUOA 2NVUB 2HZTA 3K70D 2VXDA 1X1CA 4BKXA 2HXOA 1K7AA 1OCTC 5E3OA 4GYGA 4RLQA 2CWEA 3S17J 4XK4A 2B0LA 3JSOA 2OUMA 2TDXA 5F0FA 1MMGA 2LF7A 4JP0A 2X6WA 1SD4A 1SANA 5BOXA 3HGYA 3A03A 2DDBA 1OYYA 3FXKA 4FE7A 5E20A 4WCGA 3HOUJ 4BBSJ 3VYRB 3HL2A 1XCVA 2HI3A 3HIFA 3K4CA 1QZZA 2R7WA 2QGUA 4M9XA 4AWXB 1PDNC 4DQ2A 1G4DA 1D5VA 3IH4A 1QNTA 2NNNA 3RKXA 2ZMEA 3BCAA 3FZVA 2HQAA 5DUIA 5K1YA 3CF5F 2PBIA 2VQHA 4Y15A 3OYBA 2QSGX 3A0HC 3P9IA 3J81K 1YI2I 2IVMA 1XSVA 3PNYA 5B66C 5HDKA 2BVLA 3VYSB 3A2KA 2KL4A 4NDLA 3L9FA 4KJZA 3WTUC 3V7SA 1TC3C 4EGYA 3GW2A 4A3JJ 3BOQA 3OIOA 5B5EC 4LIUA 2VKEA 1R5ID 3TW7A 1U78A 2AQFA 3VODA 2P6TA 4G6TB 4XRSG 5C44J 5E1WA 5D6EA 2DBBA 2HWVA 4C3JJ 3J7AY 1OMIA 5KVRA 1S7OA 2DU9A 1Z3XA 3G4SI 3IC7A 2X0LA 3HYIA 2IXSA 2KZGA 1ZLJA 3BDDA 3ERMA 3FXJA 2CH0A 3H92A 3LSIA 1Z05A 4C2MJ 1K61A 1FBSA 2NAZA 4OIRF 3VPRA 3I71A 4DZJA 3J7ZI 3V7CA 5KK1A 1H8AC 2UXNA 3FXOA 1XGOA 1WJBA 4MIMA 4S0HB 2JWTA 1JKPC 2H94A 1CQTA 3DBLB 3ZGKA 3CUQB 3S3MA 5BPIA 2E5NA 4EJWA 4KFCA 2XF7A 2P7CB 1WJ5A 2XIGA 2K9QA 2XC7A 4A6DA 4EJTA 2LRDA 2Z1DA 3M9AA 1FYKA 2DA6A 4LFUA 3MKZA 2EA2A 4XN0A 2LP0A 1ZR4A 3CTAA 2HOAA 2FXAA 3QQAA 1JI8A 1ZR2A 1GDTA 5DDGA 3TP3A 1I27A 2EINH 3DEWA 1Z7LA 5HOOA 1RUOA 5LGTA 2KHMA 1ORKA 2NOJB 3Q3SA 1B72B 4BXXJ 2OA4A 3L2UA 2R5ZB 3FMSA 3I64A 1F43A 3IAS2 3WGGA 2NRAC 2QM3A 2HVSA 3F8NA 4A0ZA 3NWSA 3O8GA 4XNFA 5CVRA 3S1RJ 1WJEA 3F6VA 4MLOA 2DI3A 4KIBA 2Y69H 4NQWB 3GFIA 4E7LA 3CMYA 2PFBA 2WA0A 2R7ZJ 3F6OA 2LC2A 3OR1C 1BM9A 4PSXA 1Z6TA 2VOPA 5K5RA 2WV1A 1AOYA 1YX3A 4LD5A 1OYIA 4NB5A 1MBFA 3HEFA 3RI4A 1D8KA 3FM3A 4M73A 2RKHA 4GCVA 4M6XA 4B4CA 1CF7B 1BI3A 1ZKGA 4DGWB 4D1QA 2XGDA 4A69C 2EZKA 4A5NA 1J9IA 1V55H 5FLXK 2IGMA 2V1NA 1K78A 3TO7A 2VI6A 2ESHA 6PAXA 1YS7A 1E0EA 4IQJA 3QPTA 3QP6A 1O3RA 1Z0XA 3F0CA 1Z1DA 2LR8A 2E7WA 3K4LA 3KLOA 3CESA 3NEUA 4JX6A 5DCMA 5M3MJ 2QKLB 4BDYA 1GT0C 1QQIA 1DQUA 1KQ8A 1IZ1A 4XSZF 4PJ0C 1AA7A 1HKQA 2K9MA 4O5VA 4A3FJ 3H1CA 3CP8A 1VI0A 3DKXA 3CCEI 1HW2A 2LY1A 4DYRA 2R92J 1TLHB 5CQGA 2CV2A 1JT0A 4IEJA 1EA3A 3HRSA 4P9FA 5IT3A 4HEA2 2IJLA 4ZYGA 2Z33A 1O3QA 4XLHA 4KITB 4L9JA 4YFXF 2CV1A 1MNDA 3I58A 5F04A 4I0AA 5LHIA 4Y3OA 3DFGA 3CDHA 1QHHD 2D1HA 2F5DA 3EPZA 3TEDA 5EZHA 3HB9A 4ZYEA 4Y4RA 2IS6A 5JHFA 1FX7A 3SQNA 4DJAA 4AD9A 1R7JA 1TL8A 4HNVA 2CFXA 3PIOF 2K3PA 1NH3A 2ZNZA 4XLNF 4YIFA 2GOXB 2L9SA 2LYCA 1BW5A 1VQ4I 3IL2A 3BZCA 2X85A 5CVJA 1U9OA 3BR1A 4KMUX 1C0WA 2EFQA 5L3CA 1J2XA 1TNTA 2XPUA 3IKVA 3J80K 1MSEC 4FETA 4EJVA 1ETKA 2RREA 1XTAA 2EFPA 1GXQA 3JCUC 1APLC 3BPXA 3GLXA 3OS0A 3SZPA 2DK5A 1KQ0A 4HOBA 1ZTRA 1BC8C 3DXJF 4XN3A 2HDWA 1FJLA 4G7OF 5FFZA 4A3CJ 3VSLA 3QAHA 2MFZA 3AG3H 2OQGA 2COBA 2ICWG 3K1MA 4A5MA 4BHBA 2LKXA 4UV9A 3MVPA 4I76A 4IXAA 2UWMA 4BHCA 5IYCJ 2WBMA 1S8NA 2MGQA 3FX3A 1ZG1A 2HOSA 3TGNA 2DO7A 2HDCA 1MMDA 4L0YB 4WX9A 1U5TB 4II2A 1P9QC 3P7NA 4OOIA 3RZOJ 1V4RA 2RV8A 4PJJA 2JA7J 2CW0F 2VC1A 1D1BA 3RPUD 3L7WA 3BR0A 1FBQA 2LDUA 1TW3A 1TWHJ 3WU2C 3PUBA 2V9KA 1MD0A 1SAUA 5E79C 3E6CC 1WJDA 1W7PA 4Q4ZF 1ETWA 2DFEA 4M6VA 3TO9A 3NWTA 3QOPA 3W2AA 2YU9J 4LITA 4CCNA 4V2GA 3ROUA 2K40A 1SEUA 4XRSA 1TT0A 2M87A 3KFWX 4NC7A 4BHPA 1LFUP 1EF4A 4H0EA 4M9ZA 2XAUA 2IA0A 4LJZF 1VQMI 4Y17A 5J40A 3M7GA 3F22A 4IHVA 3COAC 3QYEA 1XDSA 2QVOA 1V5FA 2Z9OA 1B9MA 2ZFWA 1WI3A 4EQQA 3GTJJ 3GTGJ 3OL3A 3TBIA 5BS6A 3SYTA 3KIOA 1ENHA 2CRGA 2KT0A 3B6AA 4U87A 2M1BA 3I56I 1EV7A 2GBYA 3MZHA 2X6XA 3TQNA 1A36A 2V26A 1JXSA 3ASOH 4XIDA 2PJRA 3BWGA 4IKFA 2RN7A 2E1NA 3E0JB 4LB5A 3KYDB 4OMZA 2VL8A 3ZXSA 2EILH 1JUSA 2DPDA 4PJLA 3ZQLA 4TV7A 1HKTA 4BQAA 3E97A 2QSHX 3RPUA 4E7HA 4WK8F 2VIXA 2XPWA 1IV6A 3FHNA 4MGRA 3ZRGA 3OYHA 4UUSA 1DP3A 2VE8A 5FROA 5E17F 4XSXF 1IN8A
chains in the Genus database with same CATH topology
5JLWA 4BBRJ 3HM5A 1VFCA 4QSHA 4EEFG 1R9TJ 3BR3A 4B3AA 2NS8A 2E2JJ 4IHWA 5E3NA 4M3GA 5FLVA 1X58A 1XC5A 5IP6A 1Y1WJ 1IC8A 3LSJA 1FTZA 2G0EA 4DYCA 1VNDA 4JX4A 1GV2A 3OOUA 3RZDJ 1GVDA 3LSRA 3BQYA 5EG0B 1RETA 1B8IB 1O4XA 3A02A 3LOCA 2I10A 1ITYA 3Q0WA 2K9SA 1ETQA 1BL0A 2Y30A 3HOYJ 1JJ8C 1QVUA 3HOZJ 3JRFA 2H1KA 4IHYA 1MBEA 1BJZA 2L7ZA 3ZQHA 3FK6A 3E7LA 1JT6A 5C4JJ 1MBKA 3TP0A 4QIWN 3S2HJ 4A3EJ 1FIPA 1G2HA 2EZLA 1JUMA 5F0HA 1ZGWA 2MG4A 1H88C 3PO2J 1POGA 1HDPA 1JKQC 3PM1A 1T33A 3ZOBA 2M9HA 1UMQA 3S1QJ 4I6ZA 4AUXA 1AU7A 5EGOA 1I6HJ 3S16J 2E2HJ 4D7NA 2O7OA 5E3LA 1Q1VA 5FKLA 2R0QC 2FJ1A 4A3BJ 4Y7NJ 1RR7A 3JR9A 2HDDA 3I4MJ 1NK2P 3K7AJ 3JRIA 2DMUA 2MW8A 1TWGJ 1I50J 3JREA 2O9LA 4UUTA 1LE8B 4RBOA 1RKWA 2JA6J 1MBGA 4J19A 2IAIA 3ZQGA 4M3FA 2RAEA 3CCYA 1A5JA 3FIWA 3GTPJ 2ID6A 4FE4A 1XS9A 3HOWJ 2K9NA 1ETYA 4A3IJ 4A3MJ 4X6AJ 3H0GJ 5GPCA 5GPAA 2GLOA 5EF6A 1RPWA 2R5YA 1HCRA 2L7FP 1ETXA 2JN6A 3GTMJ 4D5FA 2JJ7A 3LNQA 4FTHA 4XRMA 1F36A 2E2IJ 4BKXA 1VF9A 2HXOA 1JKRC 3GTQJ 1OCTC 1MH3A 5K7HA 5E3OA 2L9RA 4UUSB 3S17J 1FEXA 3BTLA 2JMWA 2DMPA 4XK4A 5F0FA 4JP0A 4MO7A 1SANA 5IP9J 3HGYA 3A03A 5J1YA 3NAUA 2NVTJ 4AYBN 4FE7A 3HOUJ 4BBSJ 4CYCA 1NK3P 2HI3A 2DN0A 2ECBA 2XSDC 3JRGA 2ME0A 3CDLA 3G1MA 1JTXA 1WPKA 3FK7A 5IYBJ 4D7MA 5BNGA 3PO3J 1U9NA 3IH4A 1YRNB 4DYQA 3G1LA 2LTPA 5M5XJ 3GTKJ 5DS9A 1RKTA 5EZGA 4GFBA 1ZK8A 3FKIJ 3BTIA 4NDLA 1TC3C 5F08A 3SFIA 2LK2A 4A3JJ 3OIOA 4AC0A 2VKEA 5DTDA 3GTLJ 2NOGA 3TW7A 1U78A 1X2MA 4XRSG 2JA5J 5C44J 5M5YJ 3RKQA 2VKVA 1SFOJ 5FJ8J 4C3JJ 5HODA 2H8RA 1ETVA 9ANTA 2DA4A 4D5CA 1JKOC 3LSGA 4B1RA 2CQQA 2EQRA 2O8KA 1IRZA 1JUPA 1QRYA 2R5YB 3C2BA 3CQZJ 3BR2A 4C2MJ 2AHQA 1WCMJ 3FISA 2VPRA 1K61A 1OJLA 3S1MJ 1IUFA 1TWCJ 3VPRA 4C3HJ 2MSYA 4DZJA 2L7MP 1IGNA 2M0CA 2EZIA 1H8AC 2E1OA 2QCOA 4S0HB 2JWTA 2DMTA 1JKPC 1CQTA 3Q0UA 2D5VA 1YRNA 2CJJA 5F0CA 3I4NJ 3H3VK 1QVTA 3NARA 5IOYA 1IG7A 2CUEA 2YUSA 2X48A 2HYJA 2K9QA 4RDUA 2AO9A 4CYCB 1T56A 3G1OA 1HDDC 5EGOB 1AKHB 2DA6A 5IPAA 1S7EA 2DJNA 3JRAA 2OPTA 2LP0A 1ZR4A 2KDZA 2HOAA 1U8BA 3QQAA 3BG9A 2X6OA 1ZR2A 5JLXA 5J1RA 1GDTA 1JGGA 2Y9YA 3HDDA 3TP3A 4C3IJ 1LFBA 1ZQ3P 3DEWA 1D5YA 4MFEA 3HKZN 2DA2A 1ORKA 3Q3SA 4FISA 1B72B 4BXXJ 3MN2A 2IEKA 2R5ZB 1WH7A 3S15J 2XRLA 1MBHA 1F43A 4XICA 2OF7A 1A6IA 5EG0A 2CQXA 5F27A 1PUFA 1WGXA 3O8GA 1PUFB 3S1RJ 2W48A 4MLOA 3WHBA 1LE8A 3TW6A 2Y2ZA 3CMYA 2ECCA 2R7ZJ 2XGCA 4M3EA 2LLKA 4DZPA 3W6VA 4W97A 1B72A 2WV1A 2B63J 2Y31A 3HOVJ 1DU6A 1MBFA 3HEFA 4JX5A 3BT9A 4B4CA 4ABZA 1ZKGA 5FKKA 1MNMC 2XGDA 1W0TA 1ETOA 2HOTA 4A69C 1P7JA 2EZKA 5IP7J 1MBJA 3L1PA 4M3DA 2VI6A 2ID3A 2DTZA 5EEAA 2P81A 3OSFA 1UHSA 1HF0A 1Z0XA 2LR8A 3F0CA 2FX0A 2EBIA 2NS7A 4JX6A 4MIMA 5M3MJ 1JJ6C 2FQ4A 2Y0SN 1GV5A 2Y9ZA 1GT0C 2WAQN 5M5WJ 1HLVA 4A3GJ 5GP9A 4A3FJ 1VI0A 5K7FA 1B8IA 4DYRA 5M3FJ 4LOCA 2R92J 3M3YJ 2LY9A 1JT0A 4IEJA 1WH5A 2N8GA 2WB1N 3D1NI 1W0UA 5F1JA 1I3QJ 3IH3A 4MFDA 5F04A 3HOXJ 3ZQCA 2R5ZA 3TEDA 5EZHA 4A3LJ 3HB9A 1GUUA 1P7IA 2LD5A 2DMQA 4HNVA 3GBGA 3BG3A 4A3KJ 3QPSA 4V2FA 3Q0VA 1JTYA 3RQIA 2IBDA 4QTRA 4M3BA 5IYDJ 3B6CA 1BW5A 5EYRA 5C4XJ 2M2EA 2XPVA 4FCYA 1AHDP 3BTCA 2FD5A 4Y52J 2EH3A 3BR1A 1U9OA 3BTJA 5C3EJ 4JYKA 1AKHA 2XPUA 2L0KA 3O8HA 1MSEC 3IH2A 1ETKA 1QPIA 3QPLA 1APLC 3K2AA 2DMNA 1FIAA 2NVQJ 5J3LA 5FLMJ 3JRCA 4IHXA 2TCTA 1ZTRA 3LSPA 1RESA 5K7ZA 3S2DJ 1FJLA 2CU7A 2EZHA 4A3CJ 4G12A 3JRDA 2JA8J 2TRTA 2COBA 2LKXA 3MVPA 2ZB9A 4I76A 3HGGA 1OFCX 5IYCJ 4X1EA 2MGQA 5IOZA 2HOSA 3M4OJ 2XGEA 3DCFA 3ZQIA 2VUMJ 2GM4A 3S14J 1DU0A 3MKLA 1BA5A 1OCPA 4A93J 5EDNA 3IV5A 3RZOJ 4L5EA 2JA7J 1IDZA 3BR0A 3A01B 1TWHJ 5FKNA 2NVYJ 3SJMA 4W1UA 5J1UA 1ETWA 1X2NA 4M6VA 4BY7J 3A01A 1MSFC 2YU9J 1FTTA 2M34A 4V2GA 2ELKA 2K40A 2HQ5A 2LVSA 2JK3A 1TWAJ 4XRSA 1IJWC 4BY1J 3WHCA 3ZQFA 1EF4A 1LFUP 3UKGA 1HOMA 1H89C 1K83J 5FKMA 2DA5A 4IHVA 2CUFA 3JRHA 1Z77A 2XB5A 1BW6A 3BG5A 1WI3A 2DA3A 2E19A 3GTJJ 3BR6A 2XB0X 2YS9A 5FKOA 3GTGJ 1Y1VJ 1ENHA 2CRGA 2KT0A 2DA1A 3B6AA 4A3DJ 1TWFJ 1E3OC 2R93J 1XG1A 2GBYA 1UG2A 4DW6A 2ME6A 2NVXJ 4XIDA 2QF7A 5E3MA 3SDGA 3OSGA 3JRBA 3S1NJ 3BR5A 1JUSA 2HXIA 2X9DA 3ZQLA 2M8GX 3HBLA 2LFBA 3GTOJ 1IV6A 2XPWA 1NTCA 2PMZN 4UUSA 3BQZA 1IDYA 2DA7A 1MH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLW A;  4BBR J;  3HM5 A;  1VFC A;  4QSH A;  4EEF G;  1R9T J;  3BR3 A;  4B3A A;  2NS8 A;  2E2J J;  4IHW A;  5E3N A;  4M3G A;  5FLV A;  1X58 A;  1XC5 A;  5IP6 A;  1Y1W J;  1IC8 A;  3LSJ A;  1FTZ A;  2G0E A;  4DYC A;  1VND A;  4JX4 A;  1GV2 A;  3OOU A;  3RZD J;  1GVD A;  3LSR A;  3BQY A;  5EG0 B;  1RET A;  1B8I B;  1O4X A;  3A02 A;  3LOC A;  2I10 A;  1ITY A;  3Q0W A;  2K9S A;  1ETQ A;  1BL0 A;  2Y30 A;  3HOY J;  1JJ8 C;  1QVU A;  3HOZ J;  3JRF A;  2H1K A;  4IHY A;  1MBE A;  1BJZ A;  2L7Z A;  3ZQH A;  3FK6 A;  3E7L A;  1JT6 A;  5C4J J;  1MBK A;  3TP0 A;  4QIW N;  3S2H J;  4A3E J;  1FIP A;  1G2H A;  2EZL A;  1JUM A;  5F0H A;  1ZGW A;  2MG4 A;  1H88 C;  3PO2 J;  1POG A;  1HDP A;  1JKQ C;  3PM1 A;  1T33 A;  3ZOB A;  2M9H A;  1UMQ A;  3S1Q J;  4I6Z A;  4AUX A;  1AU7 A;  5EGO A;  1I6H J;  3S16 J;  2E2H J;  4D7N A;  2O7O A;  5E3L A;  1Q1V A;  5FKL A;  2R0Q C;  2FJ1 A;  4A3B J;  4Y7N J;  1RR7 A;  3JR9 A;  2HDD A;  3I4M J;  1NK2 P;  3K7A J;  3JRI A;  2DMU A;  2MW8 A;  1TWG J;  1I50 J;  3JRE A;  2O9L A;  4UUT A;  1LE8 B;  4RBO A;  1RKW A;  2JA6 J;  1MBG A;  4J19 A;  2IAI A;  3ZQG A;  4M3F A;  2RAE A;  3CCY A;  1A5J A;  3FIW A;  3GTP J;  2ID6 A;  4FE4 A;  1XS9 A;  3HOW J;  2K9N A;  1ETY A;  4A3I J;  4A3M J;  4X6A J;  3H0G J;  5GPC A;  5GPA A;  2GLO A;  5EF6 A;  1RPW A;  2R5Y A;  1HCR A;  2L7F P;  1ETX A;  2JN6 A;  3GTM J;  4D5F A;  2JJ7 A;  3LNQ A;  4FTH A;  4XRM A;  1F36 A;  2E2I J;  4BKX A;  1VF9 A;  2HXO A;  1JKR C;  3GTQ J;  1OCT C;  1MH3 A;  5K7H A;  5E3O A;  2L9R A;  4UUS B;  3S17 J;  1FEX A;  3BTL A;  2JMW A;  2DMP A;  4XK4 A;  5F0F A;  4JP0 A;  4MO7 A;  1SAN A;  5IP9 J;  3HGY A;  3A03 A;  5J1Y A;  3NAU A;  2NVT J;  4AYB N;  4FE7 A;  3HOU J;  4BBS J;  4CYC A;  1NK3 P;  2HI3 A;  2DN0 A;  2ECB A;  2XSD C;  3JRG A;  2ME0 A;  3CDL A;  3G1M A;  1JTX A;  1WPK A;  3FK7 A;  5IYB J;  4D7M A;  5BNG A;  3PO3 J;  1U9N A;  3IH4 A;  1YRN B;  4DYQ A;  3G1L A;  2LTP A;  5M5X J;  3GTK J;  5DS9 A;  1RKT A;  5EZG A;  4GFB A;  1ZK8 A;  3FKI J;  3BTI A;  4NDL A;  1TC3 C;  5F08 A;  3SFI A;  2LK2 A;  4A3J J;  3OIO A;  4AC0 A;  2VKE A;  5DTD A;  3GTL J;  2NOG A;  3TW7 A;  1U78 A;  1X2M A;  4XRS G;  2JA5 J;  5C44 J;  5M5Y J;  3RKQ A;  2VKV A;  1SFO J;  5FJ8 J;  4C3J J;  5HOD A;  2H8R A;  1ETV A;  9ANT A;  2DA4 A;  4D5C A;  1JKO C;  3LSG A;  4B1R A;  2CQQ A;  2EQR A;  2O8K A;  1IRZ A;  1JUP A;  1QRY A;  2R5Y B;  3C2B A;  3CQZ J;  3BR2 A;  4C2M J;  2AHQ A;  1WCM J;  3FIS A;  2VPR A;  1K61 A;  1OJL A;  3S1M J;  1IUF A;  1TWC J;  3VPR A;  4C3H J;  2MSY A;  4DZJ A;  2L7M P;  1IGN A;  2M0C A;  2EZI A;  1H8A C;  2E1O A;  2QCO A;  4S0H B;  2JWT A;  2DMT A;  1JKP C;  1CQT A;  3Q0U A;  2D5V A;  1YRN A;  2CJJ A;  5F0C A;  3I4N J;  3H3V K;  1QVT A;  3NAR A;  5IOY A;  1IG7 A;  2CUE A;  2YUS A;  2X48 A;  2HYJ A;  2K9Q A;  4RDU A;  2AO9 A;  4CYC B;  1T56 A;  3G1O A;  1HDD C;  5EGO B;  1AKH B;  2DA6 A;  5IPA A;  1S7E A;  2DJN A;  3JRA A;  2OPT A;  2LP0 A;  1ZR4 A;  2KDZ A;  2HOA A;  1U8B A;  3QQA A;  3BG9 A;  2X6O A;  1ZR2 A;  5JLX A;  5J1R A;  1GDT A;  1JGG A;  2Y9Y A;  3HDD A;  3TP3 A;  4C3I J;  1LFB A;  1ZQ3 P;  3DEW A;  1D5Y A;  4MFE A;  3HKZ N;  2DA2 A;  1ORK A;  3Q3S A;  4FIS A;  1B72 B;  4BXX J;  3MN2 A;  2IEK A;  2R5Z B;  1WH7 A;  3S15 J;  2XRL A;  1MBH A;  1F43 A;  4XIC A;  2OF7 A;  1A6I A;  5EG0 A;  2CQX A;  5F27 A;  1PUF A;  1WGX A;  3O8G A;  1PUF B;  3S1R J;  2W48 A;  4MLO A;  3WHB A;  1LE8 A;  3TW6 A;  2Y2Z A;  3CMY A;  2ECC A;  2R7Z J;  2XGC A;  4M3E A;  2LLK A;  4DZP A;  3W6V A;  4W97 A;  1B72 A;  2WV1 A;  2B63 J;  2Y31 A;  3HOV J;  1DU6 A;  1MBF A;  3HEF A;  4JX5 A;  3BT9 A;  4B4C A;  4ABZ A;  1ZKG A;  5FKK A;  1MNM C;  2XGD A;  1W0T A;  1ETO A;  2HOT A;  4A69 C;  1P7J A;  2EZK A;  5IP7 J;  1MBJ A;  3L1P A;  4M3D A;  2VI6 A;  2ID3 A;  2DTZ A;  5EEA A;  2P81 A;  3OSF A;  1UHS A;  1HF0 A;  1Z0X A;  2LR8 A;  3F0C A;  2FX0 A;  2EBI A;  2NS7 A;  4JX6 A;  4MIM A;  5M3M J;  1JJ6 C;  2FQ4 A;  2Y0S N;  1GV5 A;  2Y9Z A;  1GT0 C;  2WAQ N;  5M5W J;  1HLV A;  4A3G J;  5GP9 A;  4A3F J;  1VI0 A;  5K7F A;  1B8I A;  4DYR A;  5M3F J;  4LOC A;  2R92 J;  3M3Y J;  2LY9 A;  1JT0 A;  4IEJ A;  1WH5 A;  2N8G A;  2WB1 N;  3D1N I;  1W0U A;  5F1J A;  1I3Q J;  3IH3 A;  4MFD A;  5F04 A;  3HOX J;  3ZQC A;  2R5Z A;  3TED A;  5EZH A;  4A3L J;  3HB9 A;  1GUU A;  1P7I A;  2LD5 A;  2DMQ A;  4HNV A;  3GBG A;  3BG3 A;  4A3K J;  3QPS A;  4V2F A;  3Q0V A;  1JTY A;  3RQI A;  2IBD A;  4QTR A;  4M3B A;  5IYD J;  3B6C A;  1BW5 A;  5EYR A;  5C4X J;  2M2E A;  2XPV A;  4FCY A;  1AHD P;  3BTC A;  2FD5 A;  4Y52 J;  2EH3 A;  3BR1 A;  1U9O A;  3BTJ A;  5C3E J;  4JYK A;  1AKH A;  2XPU A;  2L0K A;  3O8H A;  1MSE C;  3IH2 A;  1ETK A;  1QPI A;  3QPL A;  1APL C;  3K2A A;  2DMN A;  1FIA A;  2NVQ J;  5J3L A;  5FLM J;  3JRC A;  4IHX A;  2TCT A;  1ZTR A;  3LSP A;  1RES A;  5K7Z A;  3S2D J;  1FJL A;  2CU7 A;  2EZH A;  4A3C J;  4G12 A;  3JRD A;  2JA8 J;  2TRT A;  2COB A;  2LKX A;  3MVP A;  2ZB9 A;  4I76 A;  3HGG A;  1OFC X;  5IYC J;  4X1E A;  2MGQ A;  5IOZ A;  2HOS A;  3M4O J;  2XGE A;  3DCF A;  3ZQI A;  2VUM J;  2GM4 A;  3S14 J;  1DU0 A;  3MKL A;  1BA5 A;  1OCP A;  4A93 J;  5EDN A;  3IV5 A;  3RZO J;  4L5E A;  2JA7 J;  1IDZ A;  3BR0 A;  3A01 B;  1TWH J;  5FKN A;  2NVY J;  3SJM A;  4W1U A;  5J1U A;  1ETW A;  1X2N A;  4M6V A;  4BY7 J;  3A01 A;  1MSF C;  2YU9 J;  1FTT A;  2M34 A;  4V2G A;  2ELK A;  2K40 A;  2HQ5 A;  2LVS A;  2JK3 A;  1TWA J;  4XRS A;  1IJW C;  4BY1 J;  3WHC A;  3ZQF A;  1EF4 A;  1LFU P;  3UKG A;  1HOM A;  1H89 C;  1K83 J;  5FKM A;  2DA5 A;  4IHV A;  2CUF A;  3JRH A;  1Z77 A;  2XB5 A;  1BW6 A;  3BG5 A;  1WI3 A;  2DA3 A;  2E19 A;  3GTJ J;  3BR6 A;  2XB0 X;  2YS9 A;  5FKO A;  3GTG J;  1Y1V J;  1ENH A;  2CRG A;  2KT0 A;  2DA1 A;  3B6A A;  4A3D J;  1TWF J;  1E3O C;  2R93 J;  1XG1 A;  2GBY A;  1UG2 A;  4DW6 A;  2ME6 A;  2NVX J;  4XID A;  2QF7 A;  5E3M A;  3SDG A;  3OSG A;  3JRB A;  3S1N J;  3BR5 A;  1JUS A;  2HXI A;  2X9D A;  3ZQL A;  2M8G X;  3HBL A;  2LFB A;  3GTO J;  1IV6 A;  2XPW A;  1NTC A;  2PMZ N;  4UUS A;  3BQZ A;  1IDY A;  2DA7 A;  1MH4 A; 
#chains in the Genus database with same CATH topology
 3GEZ A;  1BN5 A;  4UVC A;  4I09 A;  2WTE A;  1VFC A;  3PL8 A;  4QSH A;  1GXP A;  3WTV C;  2LG4 A;  3NRV A;  4R8H A;  2E2J J;  3G71 I;  3BR3 A;  2NS8 A;  2FRH A;  2DCE A;  4M3G A;  1KON A;  2KIU A;  3MKY B;  2UZK A;  1X58 A;  5FLV A;  1IC8 A;  2M3A A;  1VQ5 I;  1QBJ A;  2OBP A;  1K4T A;  2L3D A;  3RZD J;  2IS2 A;  2FE3 A;  3ZN0 A;  4QLC U;  5GAG J;  2V6E A;  1AWC A;  3FMQ A;  2I10 A;  3CLO A;  1ETQ A;  4G7Z F;  1HSJ A;  2Y30 A;  2MC3 A;  3CF2 A;  1QVU A;  4P1W A;  1Z67 A;  4MQV A;  3JRF A;  4BE1 A;  2H1K A;  2K3F A;  4BE0 A;  4KIG A;  1BJZ A;  4OMY A;  3K10 A;  3MD2 A;  2KIM A;  4JK1 X;  1EJ9 A;  5DD4 A;  3ZQH A;  4IHS A;  3FK6 A;  3S2H J;  3ZMS A;  3CC2 I;  1IF1 A;  1JUM A;  1TQM A;  4NHJ A;  1LVA A;  2L9N A;  1ZGW A;  1K78 B;  4ZDL A;  2R7T A;  1IRX A;  1XMA A;  3ASN H;  5HDN A;  3WOD F;  3F21 A;  1POG A;  2CFO A;  3QU3 A;  3D5S C;  2M9H A;  3GWZ A;  1WHU A;  1T0F C;  3BP8 A;  4I6Z A;  5ED4 A;  3GX4 X;  2E2H J;  3DV8 A;  4XOP A;  3TOA A;  4CO8 A;  1YOV B;  1MDM B;  3WE2 A;  2FJ1 A;  3U2R A;  1RR7 A;  2E1C A;  3I4M J;  1NK2 P;  5H6R A;  3N4M A;  3V8L A;  3JRE A;  1TWG J;  1I50 J;  2GQQ A;  5L3E A;  3ESW B;  2O9L A;  4BYY A;  2HGC A;  1Z21 A;  3O2P E;  2HTS A;  1DDN A;  2JA6 J;  1SMY F;  1R1V A;  3LSM A;  4J19 A;  2IAI A;  4ZJZ A;  2CSO A;  1BI2 A;  1R23 A;  4J01 A;  4Z2Y A;  2EIJ H;  4XMY A;  3F23 A;  4NNJ A;  1QZE A;  1W36 D;  3AKZ A;  2L9V A;  3H0G J;  2W00 A;  5GPC A;  1YW9 A;  5L3B A;  4ESB A;  3DTK A;  4BU2 A;  1Y8R B;  1RPW A;  2R5Y A;  1ETX A;  1XDU A;  2RQQ A;  2ZO4 A;  5H20 A;  2M0M A;  2JN6 A;  3GTM J;  5K5Q A;  2W7N A;  2IS1 A;  2GA2 A;  2NYX A;  1F36 A;  1K79 A;  2RVC A;  1JKR C;  4E7K A;  1MH3 A;  4A12 A;  5IT9 Z;  1SFX A;  2K85 A;  2W85 A;  4MQ9 F;  4ETS A;  2JMW A;  5FRM A;  2EJR A;  2DMP A;  5LHG A;  1TP4 A;  1L0O C;  5J1Y A;  4HF2 A;  2NVT J;  3TL4 X;  1NK3 P;  2DT5 A;  1Y39 A;  4CGZ A;  4KYW A;  2DN0 A;  2XSD C;  2HEO A;  3CDL A;  4FHT A;  2YU3 A;  5IYB J;  4S04 A;  4X0G A;  1DPU A;  1YG2 A;  1FOW A;  1SFE A;  3L09 A;  3QU6 A;  1U9N A;  2F5C A;  1XN7 A;  4A2U A;  5M5X J;  2XRO A;  4KDP A;  4D9J A;  1IRF A;  5DS9 A;  3GLL A;  3OL4 A;  4G9Y A;  4CYD A;  2FQ3 A;  3I3L A;  5HS7 A;  1ZK8 A;  2HR3 A;  2D45 A;  3ABL H;  3BJO A;  3FKI J;  3D5L A;  3RKW A;  1D1A A;  4AC0 A;  3GTL J;  2FSW A;  4DNC A;  4XKW A;  2GZW A;  2OU2 A;  3CCU I;  3C2G A;  2HYF A;  5TIS C;  2JA5 J;  2F4O B;  2X1E A;  4RLF A;  3X2Q H;  3RKQ A;  2VKV A;  1YS6 A;  1SFO J;  5LRR A;  3MMY B;  3V7R A;  2DA4 A;  3EYY A;  1JKO C;  4CUG A;  2PMZ A;  2ZXH A;  2EQR A;  3L2V A;  1T8I A;  1IRZ A;  1JUP A;  4QPQ A;  2DQR A;  3J7Y J;  1QRY A;  1Z9C A;  3ZPL A;  4FT8 A;  4KN7 X;  3T5X A;  3REO A;  3KEY A;  3GFJ A;  4EMS A;  1WCM J;  3KEQ A;  1OJL A;  5AIQ A;  1IUF A;  5FFX A;  4MHG A;  4D0P A;  1ZLK A;  3DU5 A;  1MGT A;  2M0C A;  3M8J A;  1HST A;  2E1O A;  2GIV A;  1FWZ A;  1DPR A;  2DMT A;  2O3F A;  2PMU A;  2FML A;  2CJJ A;  1TZL A;  5F0C A;  3I4N J;  1MJ9 A;  1UZC A;  3W2V A;  4YIR X;  2GOM A;  1IG7 A;  2YUS A;  2X48 A;  1FYL A;  3J80 Z;  1UAA A;  1DGW Y;  1XGS A;  2EV6 A;  4AIK A;  3GXO A;  2VQL A;  3EUA A;  2UXX A;  1T56 A;  3G1O A;  5EGO B;  1XMK A;  3HSF A;  3BG6 A;  1AKH B;  4E6K G;  1BI1 A;  5IPA A;  3LMM A;  2OPT A;  2XVC A;  1WJA A;  3DPL C;  1ACI A;  3H3Z A;  2F6C A;  4IL6 C;  2X1D A;  2KJB A;  3HZJ A;  3BG9 A;  3KEO A;  2FEZ A;  3KPH A;  3HG9 A;  4B47 A;  4RGR A;  3ECO A;  5J1R A;  1F9N A;  3HSE A;  2PN6 A;  2CQK A;  3CCM I;  1CF7 A;  1R4N B;  4N9I A;  3ZMV A;  2KIQ A;  4ENM A;  2A6H F;  1QGP A;  3OYI A;  1I39 A;  1W1W E;  3HKZ N;  3OYM A;  1HBX G;  2ZXI A;  2ADU A;  2DA2 A;  1XX5 A;  1BC7 C;  3EUH A;  2CUZ A;  5KAI C;  4M9S A;  3S15 J;  1WH7 A;  1PUE E;  2DT6 A;  2XRL A;  1DUX C;  1ZRD A;  1TW2 A;  3HKZ A;  2M7B A;  2BW3 A;  3IHU A;  1N25 A;  2VQC A;  3CC7 I;  4A6E A;  3K1P A;  3CJN A;  4KIF A;  2V1U A;  3SXY A;  5HLT A;  2ESN A;  2W48 A;  4BJ6 C;  1LE8 A;  1QPM A;  5DM6 F;  1S7A A;  3ONQ A;  1U6G A;  3AG1 H;  2M4K A;  5TJJ A;  1YIJ I;  4IF4 A;  3CCR I;  2X6Y A;  2XGC A;  3W2W A;  4DZP A;  1VQ7 I;  3H35 A;  2BY0 A;  2XHK A;  1VZ0 A;  1YQA A;  3I4P A;  1B72 A;  1J5Y A;  4UVA A;  3QP5 A;  4JX5 A;  3G73 A;  2M45 A;  4HX7 A;  4LLG F;  3A4C A;  1W0T A;  1ETO A;  2HOT A;  2RQP A;  4XM3 A;  1BBY A;  1O3S A;  3K9T A;  4IX7 A;  3LQR A;  4KA4 A;  3HRU A;  3L1P A;  2ID3 A;  2OQR A;  2DTZ A;  5EEA A;  4RB2 C;  1I6X A;  2P81 A;  3TOB A;  3WTZ A;  3AG2 H;  1H9T A;  2MD5 A;  2VBY A;  2LKS A;  2V1X A;  3CUO A;  1JJ6 C;  4L0Z B;  1YHQ I;  1TNS A;  2WAQ N;  1HLV A;  1YJW I;  3BY6 A;  4DBR A;  5J4V A;  2ZJR F;  3L2C A;  2MH2 A;  2ZSH B;  4BUP A;  3WU1 B;  2JTV A;  4CZC A;  3M3Y J;  4LOC A;  1ON2 A;  3M8E A;  5FB2 A;  4OIQ F;  2K4B A;  4QPO A;  1YO5 C;  2OTJ I;  2J5P A;  2WB1 N;  1W0U A;  2P7V B;  4F3Q A;  3IH3 A;  4GXO A;  3G6E I;  4B3X A;  2DPU A;  4IQ4 A;  1FC3 A;  3ZQC A;  2KFD A;  1LEB A;  2QLZ A;  2ZJQ F;  1Y0U A;  3PJR A;  4GDF A;  2BXZ A;  1I3A A;  2DMQ A;  1YW8 A;  2BY1 A;  1VQN I;  3BG3 A;  1V5G A;  3OV8 A;  3QPS A;  2LNB A;  4WF2 A;  5J8C A;  4FX4 A;  5IYD J;  4LGW A;  5EYR A;  2ZME C;  5C4X J;  5DV5 A;  4FCY A;  3IP4 B;  2FNP A;  3BTC A;  2E71 A;  4BDZ A;  1X4P A;  4Y52 J;  1XGM A;  5C3E J;  1R5G A;  5BQT A;  3VYU B;  1AKH A;  3O8H A;  1MZB A;  4PK4 A;  2RDP A;  3IH2 A;  2W84 A;  2K9L A;  3H5R A;  5EEG A;  5IY5 H;  1QPI A;  1UHW A;  3K2A A;  2IA2 A;  1JGS A;  2VON A;  4HW0 A;  4ZDP A;  5J3L A;  5FD6 A;  2NVQ J;  3JRC A;  4N4N B;  2FBI A;  3FXL A;  2TCT A;  3NQO A;  3DF8 A;  3LSP A;  3CO7 C;  1BIB A;  3WG7 H;  3S2D J;  2KDO A;  4G12 A;  1Y6I A;  2JA8 J;  2VAS A;  3H36 A;  2ZB9 A;  3RCO A;  1R22 A;  1FPQ A;  2ZXW H;  3T8T A;  1G3S A;  3Q9V A;  2FMY A;  5AIP A;  3WGI A;  5HLH A;  1S72 I;  4ZC3 A;  2R7S A;  2ZC2 A;  2H09 A;  3DWL E;  4QWQ A;  1Z3Y A;  2O0Y A;  1X19 A;  1ONV A;  3IV5 A;  4L5E A;  5K5O A;  2JA2 A;  2B9S A;  5CKT A;  1FP1 D;  1R1T A;  3A01 B;  1J59 A;  4HV5 A;  4ASN A;  3SJM A;  4PSW A;  1LVK A;  4ZYH A;  4XLP F;  1P6R A;  3JSP A;  5CJ9 A;  2P5V A;  3OWT A;  4UNO A;  2L02 A;  3KLN A;  1SC7 A;  3SFZ A;  4PJN A;  2BZT A;  5D4S A;  2LVS A;  1FSH A;  2HQN A;  1TWA J;  3F3X A;  4O6J A;  3ZQF A;  1K6Y A;  2MD0 A;  1REP C;  1O7F A;  3HRT A;  2IS4 A;  1EH6 A;  1D0Y A;  3EET A;  1ZHF A;  2CUF A;  2KRH A;  2L7K A;  2XB5 A;  4BEH B;  1G8X A;  1MKM A;  2E19 A;  5L3G A;  2VQG A;  2XB0 X;  5FKO A;  3RIR A;  1P4X A;  3PSI A;  1TWF J;  2JQ7 A;  2R93 J;  4N9H A;  5L3D A;  2JUC A;  4L9T A;  1UG2 A;  4KMF A;  1YIT I;  3CDI A;  4CCL A;  3LSH A;  3AG4 H;  2MAB A;  2QF7 A;  3OSG A;  2KMU A;  3JRB A;  1W5T A;  3KZZ A;  4MTD A;  4II3 A;  2X9D A;  1K4S A;  2PMH A;  3Q5F A;  2M8G X;  3HBL A;  3OYJ A;  1TTY A;  3KZI C;  4E4H A;  5LHH A;  4ENK A;  3BQZ A;  3PNT A;  2DA7 A;  1MH4 A;  4EVI A;  5JI6 A;  4HV6 A;  3KZY A;  1UST A;  2FBH A;  5JLW A;  1DGR M;  2MH9 A;  4BBR J;  3RQ4 A;  2M8E A;  3T8R A;  3OYC A;  3U1K A;  5D4R A;  3FHZ A;  4CZZ A;  3UNG C;  1IW7 F;  4OWR B;  2KP6 A;  1ZAO A;  1RR8 C;  4B09 A;  4EEF G;  4B3A A;  4EGZ A;  5E3N A;  1T2K A;  1D1C A;  2WAQ A;  4EM0 B;  4E7S A;  1YJN I;  4ENJ A;  1Y1W J;  3KX2 A;  1XMX A;  4S05 A;  3LSJ A;  4G94 A;  1BIA A;  3DKW A;  3VB2 A;  1ZH5 A;  1GV2 A;  2K86 A;  2JSP A;  4Z6Y A;  1P92 A;  5EG0 B;  1RET A;  1B8I B;  4CSW A;  4Y13 A;  1QU3 A;  3BPV A;  2K27 A;  1ITY A;  3VEP A;  1R49 A;  5D5U B;  4V19 K;  4BE2 A;  1VQK I;  2DLL A;  2IPQ X;  3HOZ J;  3L00 A;  4RMN A;  2WY7 Q;  4IHY A;  1KU3 A;  3MCZ A;  1MBE A;  2YX7 A;  3H9Q A;  3WTS C;  5KHD A;  3TMO A;  2BHZ A;  2L7Z A;  3BLY A;  2C6Y A;  4RS8 A;  3N97 A;  5C4J J;  1MBK A;  3JTG A;  2K4J A;  4OIO F;  1G2H A;  3L2W A;  1KU7 A;  2ELH A;  4KT5 C;  5F0H A;  1FZP B;  1H9G A;  2MG4 A;  1USS A;  5FGM A;  4U88 A;  1LDD A;  1ZGA A;  1HDP A;  2WAF A;  4HX8 A;  4U0V A;  1QZY A;  2A5W A;  3PM1 A;  2A68 F;  2EFW A;  2QQA A;  4OIN F;  1AU7 A;  1RI7 A;  4I01 A;  2Q0O A;  5EGO A;  4BQN A;  2OCE A;  3S16 J;  2O7O A;  3F8F A;  2DOA A;  3ISP A;  5TGT A;  3VYT B;  5FKL A;  2R0Q C;  2QKM B;  1FMW A;  2DDA A;  4A3B J;  1KA8 A;  4Y7N J;  5DD8 A;  3JR9 A;  3F8M A;  2WAD A;  3JRI A;  4ESF A;  3D5R C;  2A6E F;  2CGP A;  1IXS B;  1UHM A;  2YX4 A;  3KCC A;  1SD5 A;  3ABT A;  3R4K A;  2H8W A;  1RIO H;  1RKW A;  1FNN A;  4Q5S F;  4M3F A;  1LKX A;  2RAE A;  4IPA A;  3CCY A;  1X3U A;  1XD7 A;  3GTP J;  4ON0 A;  1ETY A;  4A3M J;  5CVV A;  2GLO A;  2UUZ A;  4YEJ A;  1BR4 A;  1FBU A;  1XCB A;  2F2E A;  2L7F P;  3MQ0 A;  2VBW A;  2LSO A;  4FTH A;  4XKC A;  4XRM A;  2CW7 A;  3PSF A;  2E1M C;  1D8J A;  2PX9 A;  2LH9 A;  2VBX A;  1VF9 A;  3GTQ J;  2JRM A;  4ZTJ A;  5EJC A;  2L9R A;  3CC4 I;  2VKD A;  2P0W A;  1FEX A;  3BTL A;  3IWZ A;  1ERD A;  1T0F A;  2WC2 A;  1U3E M;  5IP9 J;  2YSR A;  3HC7 A;  1HA8 A;  2DJI A;  4E7J A;  4Y33 A;  4AM3 A;  4GRI A;  3ABU A;  4HAM A;  2ME0 A;  3G1M A;  2IA1 A;  1RUN A;  2NXN B;  2Y48 A;  3GVA A;  5BNG A;  1F1Z A;  3OYG A;  4MTE A;  3GCM A;  2IGN A;  1YRN B;  2F5F A;  2L4M A;  3MEX A;  3G1L A;  4CHU A;  1PVE A;  2R7D A;  3GTK J;  2BV6 A;  4UV8 A;  1ZAR A;  2MLG A;  5F1R A;  4GFB A;  3D0S A;  4OAY A;  5CVU A;  1SVM A;  4U7B A;  3QPH A;  2VXZ A;  3HSR A;  3FXQ A;  3CO6 C;  1N77 A;  3LAJ A;  3U21 A;  4MEY F;  5LGU A;  4PCQ A;  3WE3 A;  3LFK A;  5DTD A;  1R4M B;  4WXD A;  2NOG A;  5D8K B;  2BYV E;  2GAU A;  2IGK A;  4UHT A;  3DEU A;  1X2M A;  4C2T A;  4I2O A;  3K4B A;  2BHY A;  4IZZ A;  2ZCW A;  2H1L A;  1RNL A;  5FJ8 J;  9ANT A;  1S9H A;  3C2H A;  5D6F A;  1MMA A;  2H8R A;  2RC4 A;  2M5W A;  2Y0M A;  4EM1 A;  4D5C A;  3EQL F;  4B1R A;  2CQQ A;  3S32 A;  2CYY A;  3G2B A;  4HBL A;  1Y56 A;  1W7P D;  1OCR H;  2W1O A;  1ON1 A;  2H6B A;  1G3T A;  2OD5 A;  2ZJP F;  3GME A;  2CS3 A;  4L5I A;  3C2B A;  2X4H A;  3CQZ J;  2VE9 A;  3BR2 A;  2AHQ A;  3FIS A;  2VPR A;  1TWC J;  2MSY A;  4O3M A;  2QQ8 A;  4A0X A;  4XOR A;  2VB6 A;  3H5A A;  2EZI A;  2WV0 A;  2QUF A;  3CMA I;  1FMV A;  1YX5 A;  4GGG A;  3Q0U A;  2D5V A;  3CP2 A;  2H27 A;  1D3Y A;  3QYB A;  1GHC A;  5ICE A;  3FM5 A;  3FXM A;  3CCQ I;  2E34 A;  2AO9 A;  5FO5 A;  4HNU A;  3ZQ7 A;  4PDK A;  4I0B A;  4CYC B;  4KNY A;  1SVL A;  1HDD C;  2MC4 A;  3DPT A;  2JSC A;  2DOE A;  2V79 A;  1S7E A;  5J4Y A;  4LG0 A;  2DJN A;  5ERI A;  5LGN A;  1Q1H A;  5BMZ A;  2KDZ A;  2ETH A;  1EKE A;  2R7O A;  2E5Z A;  3L2Q A;  2QYO A;  1U8B A;  2LRE A;  2LMD A;  4F55 A;  5D8L B;  2E1M B;  4EAT A;  2FF4 A;  5LBQ A;  1JGG A;  2DW4 A;  2L4A A;  2VJJ A;  3SZG A;  3GZN B;  4C3I J;  4XBF A;  4HNT A;  5HS8 A;  3AL0 C;  4DBQ A;  3FDY A;  2WWY A;  2CMP A;  1D5Y A;  1MW7 A;  3GYH X;  3OMY A;  1IAW A;  3P9K A;  3OYK A;  2JPC A;  2HKO A;  3I53 A;  1E17 A;  3MKW B;  2EWN A;  4ZZL A;  3MN2 A;  2PI0 A;  4PGG A;  2VOO A;  2DFH A;  1YFH A;  1LJ9 A;  1MIJ A;  2EIK H;  1MBH A;  3JAM K;  4XIC A;  3CUQ C;  2OF7 A;  4GO1 A;  1V3F A;  5FLX Z;  5EG0 A;  3CCV I;  1F5T A;  2XAS A;  5F27 A;  1PUF A;  1WGX A;  2E60 A;  1O57 A;  1PUF B;  2PJP A;  1E2X A;  3WGH A;  3R0A A;  2R7V A;  3WHB A;  3OYN A;  1I5Z A;  3CCJ I;  1EH8 A;  2Y2Z A;  4HST A;  4U0Y A;  3AAF A;  3ZP5 A;  1VQ8 I;  2ECC A;  1SFU A;  4G6Q A;  3KE2 A;  3T1B A;  2A5Y B;  1UEL B;  2LLK A;  1ZG5 A;  3W6V A;  2P4W A;  1SAX A;  1TT5 B;  3HTU A;  1YIO A;  4W97 A;  3RYP A;  2Y31 A;  3ZMD A;  1JHF A;  3HOV J;  4PJM A;  3GUD A;  3M8F A;  2A3S A;  4ZTF A;  4IRH A;  4B8X A;  5FKK A;  1ZGJ A;  3M1C A;  1XSX A;  3N05 A;  1MNM C;  5AON A;  3MWM A;  1G3W A;  4KT6 A;  1T98 A;  5H2F C;  2DOF A;  1MBJ A;  3KP4 A;  5HNH A;  2P6S A;  4M3D A;  4NBQ A;  4RM3 A;  4IO9 F;  1FY7 A;  1WSU A;  2Y0S A;  2JPB A;  3RPQ A;  3OSF A;  1HF0 A;  4UVB A;  4XLC A;  1ZYR F;  3OYF A;  2EBI A;  4M71 A;  2Y75 A;  4KIS A;  2Y9Z A;  2I5U A;  3FXU A;  5GTH C;  5M5W J;  1KGS A;  4A3G J;  3DLA A;  1X1A A;  3EUH C;  2CUJ A;  4DOZ A;  1EH7 A;  4HF1 A;  3EDP A;  5CPR B;  3RYR A;  5K7F A;  1J75 A;  1UB9 A;  3BG7 A;  4NQW A;  5M3F J;  3GO5 A;  4YII A;  3S8P A;  3R60 A;  2LY9 A;  4OAZ A;  1ZRE A;  2HKX A;  3ZQQ A;  2EV0 A;  4C9Y A;  5TRD A;  2N8G A;  2HTJ A;  4KN4 X;  4BEH A;  5HS9 A;  1VQL I;  1KQ9 A;  2BE5 F;  3FKJ A;  1HXD A;  1NG7 A;  2V4J C;  1I3Q J;  4MFD A;  3H9J A;  4UXN A;  2W57 A;  3HOX J;  1GVJ A;  3HOS A;  1OCC H;  4ITV A;  2K5C A;  3VSK A;  3DLL F;  4A3L J;  1TBX A;  2E35 A;  4CCK A;  5KNL A;  3MZY A;  2LD5 A;  4RGS A;  3S93 A;  3V8J A;  4A3K J;  4P96 A;  3Q0V A;  3HTS B;  2IBD A;  4RM2 A;  3T0Y A;  4QTR A;  2CQ7 A;  4M3B A;  3B6C A;  2BXY A;  5GAD J;  1IRG A;  2Z2S B;  2EFN A;  1WZ2 A;  4EJU A;  2HQR A;  3C1D A;  2FD5 A;  4ESJ A;  2LF8 A;  2EH3 A;  4PFO A;  3BTJ A;  3LWF A;  3M07 A;  3E5U A;  2V9V A;  4XLF A;  2L0K A;  1E3P A;  2IGO A;  3QOD A;  5HVQ C;  2DTR A;  4XL9 A;  2DYR H;  1J7K A;  1X1D A;  3GFM A;  3QPL A;  2DYS H;  2BEO A;  4PGH A;  1NHA A;  1UFM A;  1SFK A;  3QOE A;  1OQY A;  1P2F A;  1S29 A;  1YYV A;  1RES A;  5K7Z A;  3H0D A;  5DM7 F;  1XPX A;  2CU7 A;  2CQN A;  4L5J A;  1IUY A;  4KUM A;  1TQI A;  2FA5 A;  4L9V A;  1KU2 A;  3JRD A;  1BI0 A;  2OC6 A;  2XAF A;  2OCC H;  3EUK L;  4RB3 C;  1OFC X;  4X1E A;  3ULQ B;  2M30 A;  4CIC A;  2L54 A;  2EB7 A;  5IOZ A;  1J0R A;  3DCF A;  1G59 A;  4JBA A;  4RAG A;  3O6B B;  1DU0 A;  1Y0N A;  3MKL A;  3VWB A;  1BA5 A;  1N78 A;  2A6T A;  2ISY A;  4A93 J;  2KKO A;  1FOX A;  4YFK F;  5EDN A;  3GZ6 A;  1HW1 A;  3AL0 B;  2ZSI B;  2LBF A;  4RB0 A;  4U0W A;  1D0Z A;  4HQM A;  3S2W A;  5J1U A;  3IRQ A;  1X2N A;  1KYW A;  1LUJ B;  3A01 A;  4NC6 A;  1MSF C;  1WRJ A;  2LBF B;  1FTT A;  2M34 A;  2VJ4 A;  2XSJ C;  1KU9 A;  3CJT B;  1Z7U A;  2I8D A;  4I99 C;  3W3C A;  2FOW A;  2HQ5 A;  2QEX I;  2W4S A;  3V4G A;  2JK3 A;  1ZRF A;  4BY1 J;  2KRC A;  3VFZ A;  1HOM A;  1PJR A;  3LQQ A;  5KAF C;  4JOM A;  5LD2 C;  4YFN F;  2V6C A;  2ZNY A;  1Z77 A;  5ILV A;  1WKM A;  4G8X A;  3BG5 A;  3IAM 2;  1BOB A;  3BR6 A;  2YS9 A;  4RGX A;  3K0L A;  1Y1V J;  2BVM A;  2DA1 A;  2QEN A;  2VC0 A;  3F8B A;  3LSK A;  3OOP A;  3L2R A;  4A3D J;  5ICG A;  1ZG3 A;  2EK5 A;  2OV7 A;  3SEZ A;  4DW6 A;  2ME6 A;  2KPM A;  2KIF A;  4AU7 A;  1WI9 A;  2HZD A;  3KP5 A;  5E3M A;  1FOK A;  3SDG A;  2KIS A;  3WTY C;  2ELJ A;  3S1N J;  4BGD A;  5HNF A;  1HW5 A;  1X1B A;  4F52 A;  2O8X A;  1B59 A;  3E6B A;  1NTC A;  4CXF A;  3BRO A;  4P9U A;  4HF0 A;  1LFP A;  4IOC F;  3PFY A;  1A04 A;  3PQK A;  2XUB A;  3OIQ A;  1IV8 A;  1GLN A;  1J09 A;  5B1A H;  1XB4 A;  2VBZ A;  1BR2 A;  3JAM Z;  3SDB A;  3DTE A;  3BZK A;  4IRG A;  3V42 A;  5ICC A;  1R9T J;  1QA6 A;  4IHW A;  3ZMT A;  2DXI A;  3BC8 A;  1IN7 A;  2JRT A;  3K4N A;  4ENN A;  2OTL I;  4BAC A;  2G0E A;  3R0J A;  1VND A;  2BY3 A;  4JX4 A;  1S3J A;  3IKT A;  2IRF G;  4LK1 F;  5CVI A;  1GVD A;  3ML6 A;  3U9G A;  3BQY A;  5A2Q K;  1I1S A;  2IP2 A;  5KCM A;  1OR7 C;  2KRF A;  3F72 A;  1A31 A;  1S6L A;  3I0T A;  1FYM A;  3KP6 A;  4C30 A;  4YRV A;  5DUK A;  3FBI B;  2WB1 A;  1BL0 A;  3HOY J;  5E18 F;  2AQE A;  3KET A;  3WTW C;  2IT0 A;  4CH7 A;  4M72 A;  2XAJ A;  4M6Y A;  2OZ6 A;  4BQQ A;  5IT9 K;  1MDM A;  1HQC A;  3RSN A;  4ZH4 F;  1G3Y A;  2XDV A;  4U7D A;  2JVH A;  1YTY A;  4RA2 A;  4CCJ A;  1U8R A;  3GFL A;  3E7L A;  1JT6 A;  3TP0 A;  1FIP A;  5F64 A;  2BGC A;  1RZ4 A;  3CLQ A;  4YEL A;  1TQP A;  2RNG A;  5A2Q Z;  3ABM H;  5LEJ A;  3DBR B;  2HPI A;  1KYZ A;  1H88 C;  4AVZ A;  1T33 A;  2DOD A;  3ZOB A;  1SD6 A;  1UMQ A;  4P5O A;  4AUX A;  2R7R A;  1B9N A;  2JVG A;  5B3S H;  3C3W A;  1I6H J;  2QQ9 A;  5LLQ A;  4D7N A;  4HYE A;  3PUF A;  5E3L A;  4K2E A;  1Z6R A;  4HPQ A;  4BXU A;  2ZKZ A;  1SMT A;  2GXG A;  1T38 A;  1FOY A;  2XGX A;  3K7A J;  3OR2 C;  4I98 B;  2MW8 A;  1L3L A;  4L18 B;  4UUT A;  2HFH A;  1MJA A;  4RBO A;  1IXC A;  1MBG A;  3QYF A;  3PQJ A;  3I54 A;  3ZQG A;  4CA0 A;  4XR6 A;  3E3V A;  4MNU A;  2KQR A;  4FAS D;  3IRR A;  4R79 A;  4BJ5 C;  3FIW A;  2ID6 A;  3ZMU A;  4IVN A;  2K9N A;  1XS9 A;  4IHT A;  3HOW J;  5GAE J;  5GPA A;  2CW8 A;  2ZXJ A;  4HQE A;  1HCR A;  1PYV A;  2MA3 A;  1K6O A;  3H5N A;  2AXT C;  4D5F A;  5CLS A;  5L3F A;  1YW7 A;  4BJT A;  1IXR C;  3DQV C;  2E2I J;  5F6F A;  2Q8K A;  3RKY A;  4CCO A;  4XLE A;  5K7H A;  1B1B A;  4UUS B;  4YG2 F;  2EFO A;  2F4M B;  4F93 B;  5BPD A;  2F48 A;  3SZT A;  4AIJ A;  4LG0 B;  2X51 A;  2R7Q A;  3K1N A;  4MO7 A;  3WU0 A;  1E3H A;  4E70 A;  3NAU A;  1U2W A;  4AYB N;  5CQE A;  3BCB A;  4CYC A;  1O7L A;  2PJR B;  3PFI A;  1BOA A;  3LA2 A;  2ECB A;  1Y8Q B;  2NS0 A;  4XQF A;  4RB1 A;  3JRG A;  1UG0 A;  1JTX A;  1WPK A;  1ZRC A;  3FK7 A;  2EV5 A;  4D7M A;  1ZEL A;  3DKY A;  2HS5 A;  3K70 C;  1Z91 A;  3PO3 J;  3DBH B;  4LG3 A;  4DYQ A;  3HHH A;  3GZ5 A;  1R1U A;  2LTP A;  4LIV A;  2ZME B;  4PFP A;  1RKT A;  5EZG A;  1X3W B;  4HX4 A;  2WY8 Q;  1QHG A;  4E7I A;  2KZV A;  2XAH A;  3BTI A;  4BL0 B;  3I5U A;  2UV1 A;  4EM2 A;  5F08 A;  1U5T C;  3SFI A;  2PEX A;  3E1S A;  2LK2 A;  3PNV A;  3E6M A;  2ZBK A;  1VQ9 I;  2DAO A;  1IO2 A;  4Q48 A;  4UUV A;  3K4K A;  3HPG A;  2XV4 S;  1VQP I;  3CZ6 A;  5M5Y J;  2ACJ A;  2RNJ A;  4HDU A;  5DEQ A;  2YPR A;  5HOD A;  1ETV A;  3ZMZ A;  2BOL A;  1RC9 A;  3LSG A;  3ABK H;  3DEE A;  4HLY A;  3A0B C;  1WQ2 A;  2O8K A;  3W6J B;  2QA4 I;  2R5Y B;  2XAQ A;  1T95 A;  4AVP A;  2A61 A;  4F92 B;  1P4W A;  1V54 H;  3DPU A;  3S1M J;  4C3H J;  5LRS A;  4DIQ A;  2L7M P;  1IGN A;  3KP2 A;  3LA3 A;  2QCO A;  2Q1Z B;  3CJQ B;  2STW A;  1YRN A;  1T6S A;  1MJB A;  2ISZ A;  1B4A A;  3UR3 C;  3H3V K;  1QVT A;  2G7U A;  3NAR A;  3RDI A;  5IOY A;  2CUE A;  2HYJ A;  3LL7 A;  3G3Z A;  2EPF A;  4RDU A;  2W82 A;  4CDG A;  3K4J A;  1V5E A;  1KZH A;  3ECH A;  5J6X A;  3KYC B;  2LY2 A;  4FX0 A;  5J47 A;  3F8C A;  4BQO A;  4UB8 C;  2VT2 A;  2AXL A;  3JRA A;  1NG6 A;  2R7F A;  2FU4 A;  4WWC A;  2JUG A;  2QQB A;  2D1V A;  2X6O A;  5JVT A;  5JLX A;  4C2U A;  2R7X A;  2Y9Y A;  3HDD A;  1ZQ3 P;  1LFB A;  3HXL A;  1A35 A;  3C18 A;  2E7X A;  5LFA A;  5D5V B;  4MFE A;  2V1D A;  4Q47 A;  5E1X A;  4RAZ A;  3LST A;  3CD6 I;  2HNH A;  2R7U A;  3FWE A;  4FIS A;  2VLA A;  2Q2E A;  3BZ6 A;  2DFF A;  3I59 A;  1R58 A;  1OIS A;  2GWR A;  2IEK A;  1R00 A;  2VPL A;  2HOE A;  4HG2 A;  2PG4 A;  2J5O A;  2QWW A;  1IN4 A;  3GF2 A;  4N4O B;  2FBK A;  1A6I A;  2Z5U A;  1OCZ H;  2CQX A;  3EYI A;  3OY9 A;  1QO0 D;  2BW3 B;  3FF5 A;  4IRI A;  4LB6 B;  3K2Z A;  3TW6 A;  1O3T A;  1LB2 A;  1W5C C;  1YJ9 I;  3FMR A;  3SEQ A;  2Z3Y A;  2MBF A;  4M3E A;  2DT7 B;  3PIP F;  5E8G A;  1PP8 F;  1M1E B;  3P9C A;  2B63 J;  1DU6 A;  2O61 A;  3HJE A;  4FQG A;  3BT9 A;  4H4K C;  1UJ8 A;  3HUG B;  4ABZ A;  3IWF A;  2H6C A;  1SVO A;  3QRF F;  5B1B H;  4F91 B;  3U1D A;  3BJ6 A;  1P7J A;  5IP7 J;  2P8T A;  1OR7 A;  2EIM H;  2VJ5 A;  3TDU C;  2GXB A;  2CG4 A;  1UHS A;  1B6A A;  3OYD A;  1BR1 A;  2P5L C;  2FX0 A;  1WJC A;  2NS7 A;  4HZF A;  3OYA A;  2FQ4 A;  2Y0S N;  1GV5 A;  4RAF A;  1LQ1 A;  2LKP A;  3BJA A;  4KIC A;  1R6R A;  5GP9 A;  5E1Z B;  4XON A;  1FP2 A;  2XF5 A;  1CGP A;  1MMN A;  2VN2 A;  1B8I A;  4R1H A;  3TKY A;  1BJA A;  4BS9 A;  2L2O A;  1WH5 A;  3D1N I;  1SD7 A;  2OJE D;  5F1J A;  1P4A A;  3AFH A;  1YE9 A;  2V9P A;  3J81 Z;  3E5Q A;  2WAE A;  3K6G A;  2F5V A;  2MLK A;  4XKB A;  2R5Z A;  2QZ8 A;  4AIH A;  3I59 B;  2R3S A;  3R6S A;  5JVG F;  2DK8 A;  1GUU A;  1P7I A;  1RRJ A;  2MYS A;  3GBG A;  4EJO A;  4L9N A;  4V2F A;  3RQI A;  1JTY A;  2O03 A;  1WWX A;  3OYL A;  1R71 A;  2PLY A;  4BNC A;  3OIP A;  3J7A O;  2GIZ A;  2M2E A;  2XPV A;  1AHD P;  4OIP F;  4A0Y A;  5J8F A;  1LEA A;  1R36 A;  2D2W A;  2O5R A;  1HKS A;  4HA8 A;  4AID A;  3DP7 A;  4JYK A;  1VQO I;  2BY2 A;  1T08 B;  2IW5 A;  2PQ8 A;  3HPH A;  1VTN C;  1IN5 A;  2M4G A;  3CCS I;  2DMN A;  1FIA A;  5FLM J;  4MEX F;  4IHX A;  2FOK A;  4CCM A;  4LLN A;  4AYB A;  2E36 A;  2EZH A;  3FBN B;  2XKP A;  4HLX A;  4EV0 A;  2TRT A;  3CME I;  4E7Z A;  3OYE A;  3FXR A;  3DU6 A;  3HGG A;  3HRM A;  4I02 A;  1FLI A;  1FSE A;  2FNA A;  3Q9S A;  5JHU A;  3M4O J;  2XGE A;  4XKV A;  3ZQI A;  2VUM J;  2GM4 A;  3S14 J;  4G6D A;  1S5L C;  4HSR A;  3LFU A;  1OCP A;  3LA7 A;  3JTH A;  1H0M A;  2G7H A;  1IDZ A;  3ERE D;  4B44 A;  5FKN A;  1T39 A;  2NVY J;  2AS5 F;  1OPC A;  1W7P B;  1N75 A;  2Z16 A;  4W1U A;  2RGV A;  1DP7 P;  1G6N A;  1X4O A;  1W36 C;  5H6Q A;  4BY7 J;  1F4K A;  2COM A;  3H3U A;  2CV0 A;  2ELK A;  3K4M A;  4UB6 C;  1IJW C;  2JZY A;  1OKR A;  3WHC A;  4XOT A;  1U5T A;  4ZYD A;  5LEK A;  2B7E A;  2VOD A;  3UKG A;  2W24 A;  2DFI A;  4G7H F;  1H89 C;  1K83 J;  2K7L A;  2W25 A;  5FKM A;  3MZ8 A;  3MAJ A;  2DA5 A;  1VQ6 I;  3KYL A;  3ZR8 X;  4ZDO A;  3JRH A;  2Z99 A;  3A1Y A;  4JQF A;  1BW6 A;  1LNW A;  2DA3 A;  4LLL A;  2A05 A;  5EEH A;  2KJC A;  2G9W A;  1E3O C;  4XLA A;  1XG1 A;  1W5S A;  3JW4 A;  4RGU A;  5FD5 A;  2NVX J;  4IOA F;  2X1C A;  1LDJ A;  1OYW A;  2P5K A;  2R4G A;  5DCM B;  2L5Q A;  3BR5 A;  2K02 A;  4B48 A;  2HXI A;  1XSD A;  3GTO J;  2LFB A;  4BH9 A;  2GXA A;  5JFR A;  4GYI A;  2PMZ N;  5D5W B;  4IJA A;  1IDY A;  3W6K B;  3ZCO A;  4LMY A;  1U0J A;  3CMM A;  4LK0 F;  1FT9 A;  1JHH A;  1HC8 A;  1A6Q A;  3HUG A;  3TO6 A;  4F7Z A;  3O3K A;  3HM5 A;  1X3Z B;  3KP3 A;  4RAY A;  5JR3 A;  3S3O A;  2CO5 A;  2KLO A;  4ZYA A;  2HVR A;  4I7H A;  4M74 A;  5CYV A;  4BXF A;  4PUS A;  3ZN1 A;  1ZN2 A;  3F9K A;  1XC5 A;  4HDV A;  3V8K A;  5IP6 A;  4XRF A;  4BAY A;  1STZ A;  1FTZ A;  1ODD A;  1UCR A;  4B43 A;  4DYC A;  1LPQ A;  2HYG D;  4HRI A;  3VOE A;  2HVQ A;  3OOU A;  1I1G A;  2VKH A;  2ZJ2 A;  3LSR A;  2STT A;  2V7F A;  2A69 F;  1MNE A;  2XKO A;  3B73 A;  5HDG A;  1O4X A;  3WTT C;  3A02 A;  3C7J A;  3LOC A;  3R61 A;  5DYM A;  3Q0W A;  2K9S A;  1OCO H;  3TDZ C;  2VJI A;  2XAG A;  2Q2E B;  4N0B A;  4ZZD A;  1JJ8 C;  5ILS A;  2M7A A;  2QSF X;  2HU9 A;  5D5X B;  2OZU A;  3WG9 A;  2QBY B;  5HLI A;  4UY8 I;  1WJF A;  2XRN A;  4QIW N;  2ZFU A;  5E8I A;  4J00 A;  4A3E J;  1WVR A;  1OLT A;  2EZL A;  2JT1 A;  3I9V 2;  3I55 I;  5HLG A;  4P55 A;  2HPM A;  2O6G E;  3M1E A;  3B02 A;  3PO2 J;  1JKQ C;  2BBY A;  2NNY A;  4WXC A;  4PZJ A;  3S1Q J;  5DCF A;  3DTI A;  3SHF A;  3S3N A;  1YLF A;  3CJR B;  1PP7 U;  1ULY A;  2QBY A;  1MMS A;  4ANJ A;  1Q1V A;  2XF6 A;  3E5X A;  3LAP A;  2F5E A;  3VDX A;  3WTX C;  2HDD A;  3P5J A;  5GTI C;  5FRN A;  1X1P A;  3RTR A;  2DMU A;  3HOT A;  1W4M A;  3RJP A;  3CUQ A;  1R5H A;  3HHG A;  1LE8 B;  1IN6 A;  4NUB A;  3KP7 A;  4NC8 A;  1LDK B;  3H9G A;  2FUG 2;  1JE8 A;  2F4I A;  4WXH A;  1A5J A;  5GAH J;  4FE4 A;  1D0X A;  5ILU A;  4X6A J;  2GA1 A;  5ICF A;  4A3I J;  2A07 F;  2EA4 A;  4OU0 A;  5EF6 A;  3OS1 A;  3CCL I;  1WFX A;  2YR2 A;  3MFK A;  3QWL A;  2OAZ A;  3ELK A;  3E6D A;  3OS2 A;  2DQL A;  2LOO A;  2L01 A;  2JJ7 A;  1XGN A;  3LNQ A;  2VT3 A;  3K69 A;  3IUO A;  2NVU B;  2HZT A;  3K70 D;  2VXD A;  1X1C A;  4BKX A;  2HXO A;  1K7A A;  1OCT C;  5E3O A;  4GYG A;  4RLQ A;  2CWE A;  3S17 J;  4XK4 A;  2B0L A;  3JSO A;  2OUM A;  2TDX A;  5F0F A;  1MMG A;  2LF7 A;  4JP0 A;  2X6W A;  1SD4 A;  1SAN A;  5BOX A;  3HGY A;  3A03 A;  2DDB A;  1OYY A;  3FXK A;  4FE7 A;  5E20 A;  4WCG A;  3HOU J;  4BBS J;  3VYR B;  3HL2 A;  1XCV A;  2HI3 A;  3HIF A;  3K4C A;  1QZZ A;  2R7W A;  2QGU A;  4M9X A;  4AWX B;  1PDN C;  4DQ2 A;  1G4D A;  1D5V A;  3IH4 A;  1QNT A;  2NNN A;  3RKX A;  2ZME A;  3BCA A;  3FZV A;  2HQA A;  5DUI A;  5K1Y A;  3CF5 F;  2PBI A;  2VQH A;  4Y15 A;  3OYB A;  2QSG X;  3A0H C;  3P9I A;  3J81 K;  1YI2 I;  2IVM A;  1XSV A;  3PNY A;  5B66 C;  5HDK A;  2BVL A;  3VYS B;  3A2K A;  2KL4 A;  4NDL A;  3L9F A;  4KJZ A;  3WTU C;  3V7S A;  1TC3 C;  4EGY A;  3GW2 A;  4A3J J;  3BOQ A;  3OIO A;  5B5E C;  4LIU A;  2VKE A;  1R5I D;  3TW7 A;  1U78 A;  2AQF A;  3VOD A;  2P6T A;  4G6T B;  4XRS G;  5C44 J;  5E1W A;  5D6E A;  2DBB A;  2HWV A;  4C3J J;  3J7A Y;  1OMI A;  5KVR A;  1S7O A;  2DU9 A;  1Z3X A;  3G4S I;  3IC7 A;  2X0L A;  3HYI A;  2IXS A;  2KZG A;  1ZLJ A;  3BDD A;  3ERM A;  3FXJ A;  2CH0 A;  3H92 A;  3LSI A;  1Z05 A;  4C2M J;  1K61 A;  1FBS A;  2NAZ A;  4OIR F;  3VPR A;  3I71 A;  4DZJ A;  3J7Z I;  3V7C A;  5KK1 A;  1H8A C;  2UXN A;  3FXO A;  1XGO A;  1WJB A;  4MIM A;  4S0H B;  2JWT A;  1JKP C;  2H94 A;  1CQT A;  3DBL B;  3ZGK A;  3CUQ B;  3S3M A;  5BPI A;  2E5N A;  4EJW A;  4KFC A;  2XF7 A;  2P7C B;  1WJ5 A;  2XIG A;  2K9Q A;  2XC7 A;  4A6D A;  4EJT A;  2LRD A;  2Z1D A;  3M9A A;  1FYK A;  2DA6 A;  4LFU A;  3MKZ A;  2EA2 A;  4XN0 A;  2LP0 A;  1ZR4 A;  3CTA A;  2HOA A;  2FXA A;  3QQA A;  1JI8 A;  1ZR2 A;  1GDT A;  5DDG A;  3TP3 A;  1I27 A;  2EIN H;  3DEW A;  1Z7L A;  5HOO A;  1RUO A;  5LGT A;  2KHM A;  1ORK A;  2NOJ B;  3Q3S A;  1B72 B;  4BXX J;  2OA4 A;  3L2U A;  2R5Z B;  3FMS A;  3I64 A;  1F43 A;  3IAS 2;  3WGG A;  2NRA C;  2QM3 A;  2HVS A;  3F8N A;  4A0Z A;  3NWS A;  3O8G A;  4XNF A;  5CVR A;  3S1R J;  1WJE A;  3F6V A;  4MLO A;  2DI3 A;  4KIB A;  2Y69 H;  4NQW B;  3GFI A;  4E7L A;  3CMY A;  2PFB A;  2WA0 A;  2R7Z J;  3F6O A;  2LC2 A;  3OR1 C;  1BM9 A;  4PSX A;  1Z6T A;  2VOP A;  5K5R A;  2WV1 A;  1AOY A;  1YX3 A;  4LD5 A;  1OYI A;  4NB5 A;  1MBF A;  3HEF A;  3RI4 A;  1D8K A;  3FM3 A;  4M73 A;  2RKH A;  4GCV A;  4M6X A;  4B4C A;  1CF7 B;  1BI3 A;  1ZKG A;  4DGW B;  4D1Q A;  2XGD A;  4A69 C;  2EZK A;  4A5N A;  1J9I A;  1V55 H;  5FLX K;  2IGM A;  2V1N A;  1K78 A;  3TO7 A;  2VI6 A;  2ESH A;  6PAX A;  1YS7 A;  1E0E A;  4IQJ A;  3QPT A;  3QP6 A;  1O3R A;  1Z0X A;  3F0C A;  1Z1D A;  2LR8 A;  2E7W A;  3K4L A;  3KLO A;  3CES A;  3NEU A;  4JX6 A;  5DCM A;  5M3M J;  2QKL B;  4BDY A;  1GT0 C;  1QQI A;  1DQU A;  1KQ8 A;  1IZ1 A;  4XSZ F;  4PJ0 C;  1AA7 A;  1HKQ A;  2K9M A;  4O5V A;  4A3F J;  3H1C A;  3CP8 A;  1VI0 A;  3DKX A;  3CCE I;  1HW2 A;  2LY1 A;  4DYR A;  2R92 J;  1TLH B;  5CQG A;  2CV2 A;  1JT0 A;  4IEJ A;  1EA3 A;  3HRS A;  4P9F A;  5IT3 A;  4HEA 2;  2IJL A;  4ZYG A;  2Z33 A;  1O3Q A;  4XLH A;  4KIT B;  4L9J A;  4YFX F;  2CV1 A;  1MND A;  3I58 A;  5F04 A;  4I0A A;  5LHI A;  4Y3O A;  3DFG A;  3CDH A;  1QHH D;  2D1H A;  2F5D A;  3EPZ A;  3TED A;  5EZH A;  3HB9 A;  4ZYE A;  4Y4R A;  2IS6 A;  5JHF A;  1FX7 A;  3SQN A;  4DJA A;  4AD9 A;  1R7J A;  1TL8 A;  4HNV A;  2CFX A;  3PIO F;  2K3P A;  1NH3 A;  2ZNZ A;  4XLN F;  4YIF A;  2GOX B;  2L9S A;  2LYC A;  1BW5 A;  1VQ4 I;  3IL2 A;  3BZC A;  2X85 A;  5CVJ A;  1U9O A;  3BR1 A;  4KMU X;  1C0W A;  2EFQ A;  5L3C A;  1J2X A;  1TNT A;  2XPU A;  3IKV A;  3J80 K;  1MSE C;  4FET A;  4EJV A;  1ETK A;  2RRE A;  1XTA A;  2EFP A;  1GXQ A;  3JCU C;  1APL C;  3BPX A;  3GLX A;  3OS0 A;  3SZP A;  2DK5 A;  1KQ0 A;  4HOB A;  1ZTR A;  1BC8 C;  3DXJ F;  4XN3 A;  2HDW A;  1FJL A;  4G7O F;  5FFZ A;  4A3C J;  3VSL A;  3QAH A;  2MFZ A;  3AG3 H;  2OQG A;  2COB A;  2ICW G;  3K1M A;  4A5M A;  4BHB A;  2LKX A;  4UV9 A;  3MVP A;  4I76 A;  4IXA A;  2UWM A;  4BHC A;  5IYC J;  2WBM A;  1S8N A;  2MGQ A;  3FX3 A;  1ZG1 A;  2HOS A;  3TGN A;  2DO7 A;  2HDC A;  1MMD A;  4L0Y B;  4WX9 A;  1U5T B;  4II2 A;  1P9Q C;  3P7N A;  4OOI A;  3RZO J;  1V4R A;  2RV8 A;  4PJJ A;  2JA7 J;  2CW0 F;  2VC1 A;  1D1B A;  3RPU D;  3L7W A;  3BR0 A;  1FBQ A;  2LDU A;  1TW3 A;  1TWH J;  3WU2 C;  3PUB A;  2V9K A;  1MD0 A;  1SAU A;  5E79 C;  3E6C C;  1WJD A;  1W7P A;  4Q4Z F;  1ETW A;  2DFE A;  4M6V A;  3TO9 A;  3NWT A;  3QOP A;  3W2A A;  2YU9 J;  4LIT A;  4CCN A;  4V2G A;  3ROU A;  2K40 A;  1SEU A;  4XRS A;  1TT0 A;  2M87 A;  3KFW X;  4NC7 A;  4BHP A;  1LFU P;  1EF4 A;  4H0E A;  4M9Z A;  2XAU A;  2IA0 A;  4LJZ F;  1VQM I;  4Y17 A;  5J40 A;  3M7G A;  3F22 A;  4IHV A;  3COA C;  3QYE A;  1XDS A;  2QVO A;  1V5F A;  2Z9O A;  1B9M A;  2ZFW A;  1WI3 A;  4EQQ A;  3GTJ J;  3GTG J;  3OL3 A;  3TBI A;  5BS6 A;  3SYT A;  3KIO A;  1ENH A;  2CRG A;  2KT0 A;  3B6A A;  4U87 A;  2M1B A;  3I56 I;  1EV7 A;  2GBY A;  3MZH A;  2X6X A;  3TQN A;  1A36 A;  2V26 A;  1JXS A;  3ASO H;  4XID A;  2PJR A;  3BWG A;  4IKF A;  2RN7 A;  2E1N A;  3E0J B;  4LB5 A;  3KYD B;  4OMZ A;  2VL8 A;  3ZXS A;  2EIL H;  1JUS A;  2DPD A;  4PJL A;  3ZQL A;  4TV7 A;  1HKT A;  4BQA A;  3E97 A;  2QSH X;  3RPU A;  4E7H A;  4WK8 F;  2VIX A;  2XPW A;  1IV6 A;  3FHN A;  4MGR A;  3ZRG A;  3OYH A;  4UUS A;  1DP3 A;  2VE8 A;  5FRO A;  5E17 F;  4XSX F;  1IN8 A; 
#chains in the Genus database with same CATH homology
 5JLW A;  4BBR J;  3HM5 A;  1VFC A;  4QSH A;  4EEF G;  1R9T J;  3BR3 A;  4B3A A;  2NS8 A;  2E2J J;  4IHW A;  5E3N A;  4M3G A;  5FLV A;  1X58 A;  1XC5 A;  5IP6 A;  1Y1W J;  1IC8 A;  3LSJ A;  1FTZ A;  2G0E A;  4DYC A;  1VND A;  4JX4 A;  1GV2 A;  3OOU A;  3RZD J;  1GVD A;  3LSR A;  3BQY A;  5EG0 B;  1RET A;  1B8I B;  1O4X A;  3A02 A;  3LOC A;  2I10 A;  1ITY A;  3Q0W A;  2K9S A;  1ETQ A;  1BL0 A;  2Y30 A;  3HOY J;  1JJ8 C;  1QVU A;  3HOZ J;  3JRF A;  2H1K A;  4IHY A;  1MBE A;  1BJZ A;  2L7Z A;  3ZQH A;  3FK6 A;  3E7L A;  1JT6 A;  5C4J J;  1MBK A;  3TP0 A;  4QIW N;  3S2H J;  4A3E J;  1FIP A;  1G2H A;  2EZL A;  1JUM A;  5F0H A;  1ZGW A;  2MG4 A;  1H88 C;  3PO2 J;  1POG A;  1HDP A;  1JKQ C;  3PM1 A;  1T33 A;  3ZOB A;  2M9H A;  1UMQ A;  3S1Q J;  4I6Z A;  4AUX A;  1AU7 A;  5EGO A;  1I6H J;  3S16 J;  2E2H J;  4D7N A;  2O7O A;  5E3L A;  1Q1V A;  5FKL A;  2R0Q C;  2FJ1 A;  4A3B J;  4Y7N J;  1RR7 A;  3JR9 A;  2HDD A;  3I4M J;  1NK2 P;  3K7A J;  3JRI A;  2DMU A;  2MW8 A;  1TWG J;  1I50 J;  3JRE A;  2O9L A;  4UUT A;  1LE8 B;  4RBO A;  1RKW A;  2JA6 J;  1MBG A;  4J19 A;  2IAI A;  3ZQG A;  4M3F A;  2RAE A;  3CCY A;  1A5J A;  3FIW A;  3GTP J;  2ID6 A;  4FE4 A;  1XS9 A;  3HOW J;  2K9N A;  1ETY A;  4A3I J;  4A3M J;  4X6A J;  3H0G J;  5GPC A;  5GPA A;  2GLO A;  5EF6 A;  1RPW A;  2R5Y A;  1HCR A;  2L7F P;  1ETX A;  2JN6 A;  3GTM J;  4D5F A;  2JJ7 A;  3LNQ A;  4FTH A;  4XRM A;  1F36 A;  2E2I J;  4BKX A;  1VF9 A;  2HXO A;  1JKR C;  3GTQ J;  1OCT C;  1MH3 A;  5K7H A;  5E3O A;  2L9R A;  4UUS B;  3S17 J;  1FEX A;  3BTL A;  2JMW A;  2DMP A;  4XK4 A;  5F0F A;  4JP0 A;  4MO7 A;  1SAN A;  5IP9 J;  3HGY A;  3A03 A;  5J1Y A;  3NAU A;  2NVT J;  4AYB N;  4FE7 A;  3HOU J;  4BBS J;  4CYC A;  1NK3 P;  2HI3 A;  2DN0 A;  2ECB A;  2XSD C;  3JRG A;  2ME0 A;  3CDL A;  3G1M A;  1JTX A;  1WPK A;  3FK7 A;  5IYB J;  4D7M A;  5BNG A;  3PO3 J;  1U9N A;  3IH4 A;  1YRN B;  4DYQ A;  3G1L A;  2LTP A;  5M5X J;  3GTK J;  5DS9 A;  1RKT A;  5EZG A;  4GFB A;  1ZK8 A;  3FKI J;  3BTI A;  4NDL A;  1TC3 C;  5F08 A;  3SFI A;  2LK2 A;  4A3J J;  3OIO A;  4AC0 A;  2VKE A;  5DTD A;  3GTL J;  2NOG A;  3TW7 A;  1U78 A;  1X2M A;  4XRS G;  2JA5 J;  5C44 J;  5M5Y J;  3RKQ A;  2VKV A;  1SFO J;  5FJ8 J;  4C3J J;  5HOD A;  2H8R A;  1ETV A;  9ANT A;  2DA4 A;  4D5C A;  1JKO C;  3LSG A;  4B1R A;  2CQQ A;  2EQR A;  2O8K A;  1IRZ A;  1JUP A;  1QRY A;  2R5Y B;  3C2B A;  3CQZ J;  3BR2 A;  4C2M J;  2AHQ A;  1WCM J;  3FIS A;  2VPR A;  1K61 A;  1OJL A;  3S1M J;  1IUF A;  1TWC J;  3VPR A;  4C3H J;  2MSY A;  4DZJ A;  2L7M P;  1IGN A;  2M0C A;  2EZI A;  1H8A C;  2E1O A;  2QCO A;  4S0H B;  2JWT A;  2DMT A;  1JKP C;  1CQT A;  3Q0U A;  2D5V A;  1YRN A;  2CJJ A;  5F0C A;  3I4N J;  3H3V K;  1QVT A;  3NAR A;  5IOY A;  1IG7 A;  2CUE A;  2YUS A;  2X48 A;  2HYJ A;  2K9Q A;  4RDU A;  2AO9 A;  4CYC B;  1T56 A;  3G1O A;  1HDD C;  5EGO B;  1AKH B;  2DA6 A;  5IPA A;  1S7E A;  2DJN A;  3JRA A;  2OPT A;  2LP0 A;  1ZR4 A;  2KDZ A;  2HOA A;  1U8B A;  3QQA A;  3BG9 A;  2X6O A;  1ZR2 A;  5JLX A;  5J1R A;  1GDT A;  1JGG A;  2Y9Y A;  3HDD A;  3TP3 A;  4C3I J;  1LFB A;  1ZQ3 P;  3DEW A;  1D5Y A;  4MFE A;  3HKZ N;  2DA2 A;  1ORK A;  3Q3S A;  4FIS A;  1B72 B;  4BXX J;  3MN2 A;  2IEK A;  2R5Z B;  1WH7 A;  3S15 J;  2XRL A;  1MBH A;  1F43 A;  4XIC A;  2OF7 A;  1A6I A;  5EG0 A;  2CQX A;  5F27 A;  1PUF A;  1WGX A;  3O8G A;  1PUF B;  3S1R J;  2W48 A;  4MLO A;  3WHB A;  1LE8 A;  3TW6 A;  2Y2Z A;  3CMY A;  2ECC A;  2R7Z J;  2XGC A;  4M3E A;  2LLK A;  4DZP A;  3W6V A;  4W97 A;  1B72 A;  2WV1 A;  2B63 J;  2Y31 A;  3HOV J;  1DU6 A;  1MBF A;  3HEF A;  4JX5 A;  3BT9 A;  4B4C A;  4ABZ A;  1ZKG A;  5FKK A;  1MNM C;  2XGD A;  1W0T A;  1ETO A;  2HOT A;  4A69 C;  1P7J A;  2EZK A;  5IP7 J;  1MBJ A;  3L1P A;  4M3D A;  2VI6 A;  2ID3 A;  2DTZ A;  5EEA A;  2P81 A;  3OSF A;  1UHS A;  1HF0 A;  1Z0X A;  2LR8 A;  3F0C A;  2FX0 A;  2EBI A;  2NS7 A;  4JX6 A;  4MIM A;  5M3M J;  1JJ6 C;  2FQ4 A;  2Y0S N;  1GV5 A;  2Y9Z A;  1GT0 C;  2WAQ N;  5M5W J;  1HLV A;  4A3G J;  5GP9 A;  4A3F J;  1VI0 A;  5K7F A;  1B8I A;  4DYR A;  5M3F J;  4LOC A;  2R92 J;  3M3Y J;  2LY9 A;  1JT0 A;  4IEJ A;  1WH5 A;  2N8G A;  2WB1 N;  3D1N I;  1W0U A;  5F1J A;  1I3Q J;  3IH3 A;  4MFD A;  5F04 A;  3HOX J;  3ZQC A;  2R5Z A;  3TED A;  5EZH A;  4A3L J;  3HB9 A;  1GUU A;  1P7I A;  2LD5 A;  2DMQ A;  4HNV A;  3GBG A;  3BG3 A;  4A3K J;  3QPS A;  4V2F A;  3Q0V A;  1JTY A;  3RQI A;  2IBD A;  4QTR A;  4M3B A;  5IYD J;  3B6C A;  1BW5 A;  5EYR A;  5C4X J;  2M2E A;  2XPV A;  4FCY A;  1AHD P;  3BTC A;  2FD5 A;  4Y52 J;  2EH3 A;  3BR1 A;  1U9O A;  3BTJ A;  5C3E J;  4JYK A;  1AKH A;  2XPU A;  2L0K A;  3O8H A;  1MSE C;  3IH2 A;  1ETK A;  1QPI A;  3QPL A;  1APL C;  3K2A A;  2DMN A;  1FIA A;  2NVQ J;  5J3L A;  5FLM J;  3JRC A;  4IHX A;  2TCT A;  1ZTR A;  3LSP A;  1RES A;  5K7Z A;  3S2D J;  1FJL A;  2CU7 A;  2EZH A;  4A3C J;  4G12 A;  3JRD A;  2JA8 J;  2TRT A;  2COB A;  2LKX A;  3MVP A;  2ZB9 A;  4I76 A;  3HGG A;  1OFC X;  5IYC J;  4X1E A;  2MGQ A;  5IOZ A;  2HOS A;  3M4O J;  2XGE A;  3DCF A;  3ZQI A;  2VUM J;  2GM4 A;  3S14 J;  1DU0 A;  3MKL A;  1BA5 A;  1OCP A;  4A93 J;  5EDN A;  3IV5 A;  3RZO J;  4L5E A;  2JA7 J;  1IDZ A;  3BR0 A;  3A01 B;  1TWH J;  5FKN A;  2NVY J;  3SJM A;  4W1U A;  5J1U A;  1ETW A;  1X2N A;  4M6V A;  4BY7 J;  3A01 A;  1MSF C;  2YU9 J;  1FTT A;  2M34 A;  4V2G A;  2ELK A;  2K40 A;  2HQ5 A;  2LVS A;  2JK3 A;  1TWA J;  4XRS A;  1IJW C;  4BY1 J;  3WHC A;  3ZQF A;  1EF4 A;  1LFU P;  3UKG A;  1HOM A;  1H89 C;  1K83 J;  5FKM A;  2DA5 A;  4IHV A;  2CUF A;  3JRH A;  1Z77 A;  2XB5 A;  1BW6 A;  3BG5 A;  1WI3 A;  2DA3 A;  2E19 A;  3GTJ J;  3BR6 A;  2XB0 X;  2YS9 A;  5FKO A;  3GTG J;  1Y1V J;  1ENH A;  2CRG A;  2KT0 A;  2DA1 A;  3B6A A;  4A3D J;  1TWF J;  1E3O C;  2R93 J;  1XG1 A;  2GBY A;  1UG2 A;  4DW6 A;  2ME6 A;  2NVX J;  4XID A;  2QF7 A;  5E3M A;  3SDG A;  3OSG A;  3JRB A;  3S1N J;  3BR5 A;  1JUS A;  2HXI A;  2X9D A;  3ZQL A;  2M8G X;  3HBL A;  2LFB A;  3GTO J;  1IV6 A;  2XPW A;  1NTC A;  2PMZ N;  4UUS A;  3BQZ A;  1IDY A;  2DA7 A;  1MH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...