1NTCA

Solution structure of the dna-binding domain of ntrc with three alanine substitutions
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
MDLPGELFEASTPDSPSHLPPDSWATLLAQWADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGAATLTAKLKELGME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulation
molecule keywords PROTEIN (NITROGEN REGULATION PROTEIN (NTRC))
publication title Solution structure of the DNA-binding domain of NtrC with three alanine substitutions.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 18
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ntcA00
1RKWA 2TRTA 5EG0A 4XRSG 1D5YA 3JRDA 3I4NJ 3HGGA 2M2EA 1BW6A 1IC8A 1S7EA 4M3EA 5HODA 3RZDJ 2R5ZA 2CUFA 1MBKA 3NAUA 1WGXA 2P81A 3OIOA 1HLVA 5FKNA 1X2MA 3HDDA 5EEAA 1JKRC 2DA5A 4HNVA 2L7FP 3IV5A 2ME6A 3RQIA 1O4XA 3MN2A 2Y30A 1LE8B 3A02A 5C44J 4A3BJ 5IP9J 4W1UA 2OPTA 4A3DJ 4BY1J 1MH3A 3PO2J 3O8GA 3LSPA 1JT0A 2W48A 3O8HA 1AKHB 1IDYA 2RAEA 1TWFJ 3ZQLA 5E3LA 3VPRA 2LKXA 2X9DA 2XGEA 4D7MA 2R5YA 2DA3A 3TEDA 3HOWJ 4RDUA 3QPLA 2Y9ZA 3BR3A 1HCRA 2LLKA 3DEWA 3FISA 1TWAJ 4CYCA 1IJWC 4UUSA 2HXIA 4M3BA 2DJNA 1P7JA 4A3LJ 1MSFC 3JR9A 3BG9A 1Z77A 1TWGJ 2OF7A 5EGOA 2EQRA 2MGQA 4FTHA 4BBRJ 1HDDC 3CMYA 5JLWA 1HF0A 2R92J 1B8IA 2XB0X 1I3QJ 2KDZA 3S1RJ 4QTRA 3JRGA 3FK6A 3SDGA 2LY9A 4AUXA 2VUMJ 2JA7J 3HOZJ 1W0TA 5DS9A 1YRNA 1U9NA 4MIMA 3ZQGA 1A6IA 1ORKA 1JGGA 2LD5A 5IP6A 4JX6A 1FJLA 1JTYA 3W6VA 3F0CA 1WI3A 2ECBA 3S2HJ 2FQ4A 1AU7A 4JYKA 3GTPJ 5J1RA 1ETOA 3ZQCA 1QVTA 2H8RA 1Z0XA 5EG0B 1QRYA 3K2AA 1MBEA 3WHBA 4W97A 1R9TJ 3H0GJ 4XRSA 3M3YJ 1IG7A 4L5EA 1ZQ3P 3S17J 3A01A 3S1QJ 3G1MA 4IHXA 4C3JJ 2R5ZB 5F0CA 2XSDC 2ID3A 1FTZA 2JA8J 5FKOA 1ZR2A 4FCYA 1ZGWA 1BL0A 3GBGA 1T56A 2CQQA 4C3HJ 2XPUA 1OCTC 9ANTA 1GV2A 2IAIA 2VKEA 3JRFA 1I6HJ 1TWCJ 3BR5A 2XPVA 3OSGA 3GTQJ 2ELKA 4DZJA 2NS8A 1OCPA 3PM1A 2DMQA 2Y2ZA 2D5VA 5FKLA 1WH5A 4DZPA 2R5YB 2EBIA 1MBJA 2M34A 1JT6A 1BA5A 1HDPA 5GPAA 1MH4A 1JTXA 2HQ5A 2PMZN 3ZQHA 1Y1WJ 1APLC 2DMTA 4CYCB 1XC5A 2E19A 4NDLA 4V2FA 3BTCA 1RETA 4MFDA 4BY7J 1MBFA 1ETVA 4UUSB 1OFCX 5FKKA 4JP0A 1PUFA 4FISA 1K61A 2NVYJ 5EGOB 3DCFA 2R93J 5F1JA 1RKTA 2B63J 2X48A 2VKVA 3GTMJ 3MKLA 3IH4A 1ETQA 2O9LA 3HOYJ 4IHYA 1B8IB 2DA2A 5GP9A 2LFBA 4RBOA 2Y0SN 4A3MJ 5K7HA 1YRNB 3Q0VA 2NOGA 4XRMA 5J3LA 5IOYA 3BR6A 3BQYA 3HB9A 4G12A 1VFCA 4X1EA 1VI0A 4B1RA 4DW6A 4D5FA 1BJZA 4A3GJ 3JRAA 3GTLJ 2VPRA 2HOAA 1FIAA 5M5YJ 1RR7A 2LVSA 1ETYA 5M5XJ 4GFBA 4V2GA 4A69C 4ABZA 2CU7A 3ZOBA 3HOUJ 1NTCA 2JWTA 1DU0A 1FEXA 1Q1VA 2LK2A 3A01B 4IEJA 3CQZJ 1JJ6C 2DA6A 3SFIA 1ETXA 3TW6A 3CCYA 2I10A 3LSGA 2K9NA 3BTJA 3RKQA 5C4XJ 1T33A 1H88C 5FLMJ 1F36A 2TCTA 2HYJA 1ENHA 2E2JJ 4A3FJ 1ZTRA 1NK3P 1P7IA 3JRIA 2CRGA 1RESA 2DN0A 3NARA 2DMPA 2ME0A 3E7LA 4C3IJ 3HM5A 2WAQN 4IHWA 1OJLA 2JN6A 3LSRA 2JA6J 1GV5A 1A5JA 2DMUA 2XGDA 3BT9A 5BNGA 2JMWA 5IOZA 3OSFA 3Q0WA 3FKIJ 5IYCJ 2HOTA 4M3FA 2G0EA 3FIWA 1JKQC 2XPWA 2FX0A 2Y31A 5C3EJ 4DYQA 1POGA 4M3DA 2JK3A 1ETWA 2DTZA 3MVPA 2DA1A 1PUFB 3I4MJ 4JX4A 1F43A 1IUFA 4JX5A 2YUSA 2IEKA 1ZR4A 3WHCA 2QCOA 3S1MJ 4Y7NJ 1LFUP 2CUEA 3BTIA 1CQTA 3BR0A 3H3VK 2N8GA 2COBA 3ZQIA 4I76A 2GBYA 5IP7J 3GTOJ 3RZOJ 2GM4A 2L9RA 4J19A 1ITYA 2NVQJ 4D5CA 2M8GX 3HOVJ 4I6ZA 1JUPA 2DA4A 4FE4A 1QPIA 1K83J 4QIWN 4MLOA 4EEFG 2IBDA 5M3FJ 1JKPC 1RPWA 1SANA 3C2BA 3PO3J 3L1PA 1NK2P 1MBGA 2EZIA 3S15J 4B4CA 2Y9YA 2WB1N 5F0FA 1LFBA 2M0CA 3Q3SA 3B6CA 3BR2A 4DYRA 1WCMJ 2LTPA 2NS7A 2NVXJ 3K7AJ 3HOXJ 3HEFA 4M6VA 1X58A 2EH3A 2H1KA 1X2NA 2LP0A 1WH7A 1H89C 2DA7A 2QF7A 2HXOA 5E3OA 3M4OJ 3LSJA 2MG4A 2HDDA 2YS9A 5F04A 1MBHA 1UMQA 3ZQFA 2K9SA 3QQAA 1VF9A 5K7FA 4BXXJ 3BTLA 5J1UA 1MNMC 2XRLA 3JRBA 5FKMA 4M3GA 5EZHA 5E3NA 2HOSA 2CQXA 3CDLA 1FTTA 3JRCA 1GVDA 1W0UA 3JRHA 2LR8A 1B72A 1EF4A 3BG5A 4A93J 5F0HA 4DYCA 1G2HA 2HI3A 2E2IJ 1GT0C 4BKXA 4A3EJ 1ZK8A 2VI6A 1GDTA 3B6AA 5EZGA 2ID6A 2XGCA 5EDNA 2CJJA 2JJ7A 1WPKA 1U78A 4A3CJ 2AO9A 3TP3A 1E3OC 4S0HB 3GTJJ 2NVTJ 5DTDA 4MO7A 2MW8A 2K9QA 4B3AA 2M9HA 5F27A 5M5WJ 4BBSJ 4Y52J 4A3JJ 1VNDA 2ZB9A 3HGYA 3TW7A 4C2MJ 5K7ZA 4IHVA 1IDZA 2K40A 2L7ZA 4A3IJ 1UG2A 2R0QC 4X6AJ 2O8KA 5GPCA 1U9OA 1UHSA 1JUMA 1LE8A 4UUTA 3HKZN 2E1OA 3S2DJ 1JKOC 5EF6A 1BW5A 5M3MJ 1U8BA 3IH3A 2E2HJ 2L0KA 1DU6A 1AKHA 5F08A 5FJ8J 4XICA 3HBLA 5FLVA 3BQZA 3IH2A 2R7ZJ 5JLXA 3GTKJ 2X6OA 1AHDP 5EYRA 3SJMA 3LNQA 2YU9J 3S14J 5E3MA 4FE7A 3JREA 1SFOJ 3BG3A 1TWHJ 5C4JJ 3S16J 3FK7A 3S1NJ 1XS9A 4QSHA 2XB5A 1IGNA 1H8AC 3G1LA 4D7NA 4AC0A 4MFEA 2AHQA 3BR1A 5IYDJ 4XIDA 2ECCA 3GTGJ 3Q0UA 1I50J 2JA5J 1HOMA 2MSYA 4A3KJ 2EZKA 5IPAA 1ETKA 2WV1A 1JJ8C 3LOCA 3UKGA 2O7OA 3G1OA 1XG1A 3OOUA 2EZLA 1FIPA 1JUSA 2KT0A 1IRZA 1TC3C 5J1YA 1IV6A 4XK4A 3TP0A 1GUUA 1B72B 1QVUA 2FJ1A 4LOCA 2EZHA 2L7MP 1ZKGA 1MSEC 2FD5A 4AYBN 5IYBJ 1Y1VJ 2DMNA 3D1NI 2GLOA 3QPSA 3A03A
chains in the Genus database with same CATH superfamily
1U5TC 1RKWA 1W7PD 2UXXA 4UHTA 2QBYB 1WZ2A 3VDXA 5J47A 3CDHA 2M2EA 3BDDA 4XOPA 1OYYA 4M3EA 5K5OA 5HODA 3GEZA 3RZDJ 2QGUA 1K79A 1U2WA 5DDGA 2QKLB 1OCOH 2V9PA 5CPRB 1X2MA 5DUIA 1IXRC 2KQRA 1BC8C 1D0XA 3RQIA 1EH7A 4II2A 1FP1D 5C44J 4Y17A 5IP9J 4A3DJ 4E7ZA 2KKOA 3H35A 1YLFA 2ESHA 5HDNA 5L3CA 3J81K 4U88A 4EVIA 3ZQQA 3LSPA 2RN7A 1BIBA 4HF0A 2Q8KA 3U1DA 3EDPA 1JT0A 2JSCA 3T1BA 1IDYA 4ENJA 4XKVA 1TWFJ 2LKXA 3QP6A 2DA3A 1TW2A 4RDUA 2M0MA 1F4KA 3OYBA 1OQYA 2Y9ZA 4BE2A 1QQIA 1QZYA 1A36A 3FISA 1TWAJ 4EM2A 5KAFC 1MDMA 2P5VA 4UUSA 3DBHB 5ICCA 4C9YA 1EV7A 1Z77A 3NWSA 1SFXA 3ABKH 2XSJC 1J2XA 1GXQA 2RVCA 1XCBA 3U9GA 3FDYA 3RJPA 2R3SA 4FTHA 1HDDC 1KU7A 1HF0A 3KP3A 1B8IA 2XAGA 2DDBA 2JSPA 3B02A 3S1RJ 1FX7A 3I58A 2XKOA 2H09A 3CLOA 3SDGA 1FYKA 4LLGF 2JA7J 3L00A 3HOZJ 4MIMA 2MYSA 4C2UA 5IP6A 4CCMA 1JTYA 1P9QC 5BS6A 4N4NB 1KYWA 2ECBA 2ZFUA 3F8CA 2I5UA 2AQFA 2ZXHA 4HV6A 4XR6A 2H8RA 4XNFA 1YW8A 4GCVA 1IG7A 1ZG1A 3BJ6A 2IA1A 3A01A 4IHSA 2GAUA 1MJAA 3G1MA 3K4BA 4HSRA 2ID3A 1DP7P 1XCVA 1LFPA 4U7BA 3JSPA 1BL0A 3GBGA 1T56A 2CQQA 2M5WA 2KRCA 1G3SA 2BW3A 1GV2A 2XGXA 4ZYGA 3W2AA 4QPOA 2WV0A 4XMYA 4OAYA 2IP2A 3BR5A 2ELKA 2RNJA 2CFOA 2WTEA 1LJ9A 2P4WA 1QHGA 4KA4A 5FKLA 1WH5A 5EEHA 1TW3A 4M9ZA 4DBRA 1LVAA 4KN7X 2EBIA 2F4IA 2O5RA 1SVLA 2QSGX 2G7HA 1EH6A 1BJAA 1HDPA 2H1LA 1WRJA 3M8JA 5GPAA 5TJJA 4WXCA 3K4MA 4OU0A 1CF7A 1JTXA 2HQ5A 3RPUA 4B44A 1S9HA 1D8JA 3QP5A 1DPUA 4MTDA 1Y0UA 4BS9A 2CGPA 3SHFA 2DMTA 1DP3A 2DOEA 2RV8A 4NDLA 5D6FA 2DT5A 1RETA 2ESNA 4BU2A 3CP2A 2M1BA 5L3DA 1J5YA 2DQRA 1K61A 2FU4A 1QHHD 2MFZA 2K5CA 3ZR8X 2R7QA 3DCFA 3QU6A 1RKTA 3E1SA 2B63J 3GTMJ 3J80K 3IH4A 3H9JA 1ETQA 3K1PA 2O9LA 4PUSA 4XLNF 2AQEA 3SEQA 2PJPA 3CC4I 2DA2A 2ZSHB 1WJDA 4RB0A 1QZZA 3QYBA 1K78B 3KEYA 1U5TA 2CYYA 3KCCA 3TO9A 4HNUA 1LPQA 4P55A 5J3LA 5IOYA 3BR6A 3D5RC 4G12A 2VE9A 4X1EA 2I8DA 2ZJQF 1J0RA 2R4GA 4D5FA 2Q1ZB 2X4HA 3JRAA 1UAAA 3GTLJ 3BP8A 1TNSA 3F72A 2ICWG 2VPRA 1FIAA 3H5RA 3LA7A 1RR7A 2FSWA 4MQ9F 3VYSB 3A4CA 4AIKA 2COMA 2NXNB 3V7SA 3HOUJ 3F8NA 4QLCU 3SYTA 3DPUA 1RUNA 5CLSA 1XGOA 1PVEA 3SFIA 4ZH4F 4CHUA 2KHMA 3GUDA 2DFIA 2X51A 5JFRA 2R7SA 4L9JA 3R0JA 2VASA 2VODA 2OQGA 5C4XJ 1T33A 4PJNA 4YFNF 1F36A 5J6XA 4LLNA 5FLXK 1LDJA 1R1TA 1HSTA 2NAZA 1W36D 2GZWA 3OYNA 2QEXI 2CRGA 3L2CA 1MGTA 2DN0A 3ZMSA 1XGMA 3H9GA 4AU7A 4C3IJ 1VQMI 1FNNA 3HM5A 4IHWA 3LSRA 2JT1A 4UXNA 1HKQA 1A5JA 2XGDA 3BT9A 5DCMA 2X1CA 5BNGA 3F21A 4B43A 2P8TA 2M7BA 3SZTA 1IZ1A 3FKIJ 2HOTA 2XDVA 1I1SA 3WGGA 5ILSA 2X6YA 3FIWA 1ON1A 4Z2YA 4KT5C 3CJRB 2EFPA 3V4GA 1POGA 4M3DA 3OS2A 3QRFF 3L2QA 4DGWB 2F5DA 3MVPA 3CO6C 2QA4I 2A5WA 5GTIC 1JGSA 1F43A 2QCOA 3S1MJ 1QO0D 5J4YA 1SFEA 2ETHA 2CUEA 3BTIA 4M6XA 2N8GA 4H0EA 3GTOJ 3F9KA 4LG0B 4XQFA 1HKSA 3E5UA 1E2XA 1PUEE 4J00A 4LGWA 2GA2A 1ULYA 4FE4A 4I02A 3NWTA 4OINF 3BZ6A 1GHCA 4I7HA 4MGRA 5HS8A 4BQAA 3ZRGA 2M4KA 4ZYHA 3MEXA 2ZSIB 2EZIA 3S15J 2LG4A 4HW0A 2LBFA 3CJNA 5F0FA 2L7KA 5GAGJ 3BR2A 5J8FA 1BR1A 1WCMJ 2XRNA 4YRVA 1M1EB 2E1MB 3KZIC 4LD5A 3BCBA 2GQQA 1R1VA 2KJBA 3I53A 3HOXJ 1HW1A 3ZMZA 1FOKA 2L01A 2PMZA 3FXRA 3IKVA 5HDKA 3EUKL 2MH2A 1YJWI 2CWEA 2FMLA 1VQ6I 2DA7A 2DTRA 1UHMA 4OWRB 5E3OA 2DK8A 4BJ6C 2XIGA 3PQJA 2W25A 1TT0A 5F04A 1MBHA 2OTLI 1MJBA 1N77A 3CJTB 3PQKA 3GZ6A 3WE3A 3ZN0A 1PP8F 4BXXJ 1OCZH 2VT3A 3BTLA 5J1UA 3BZKA 4LB6B 3C18A 3JRBA 1WVRA 3BZCA 5ED4A 1J09A 2AXLA 3WTUC 3FHNA 3E0JB 1W0UA 4F91B 1L0OC 2ZJPF 5TISC 4ZTFA 1P4XA 3RKWA 2HZDA 4OAZA 3MZYA 4R79A 1NH3A 5LD2C 2JPBA 2VI6A 2HS5A 1WI9A 3UR3C 1DUXC 1P4WA 4KUMA 3FMSA 1ZRCA 4GRIA 2JJ7A 3RTRA 2QBYA 4P96A 2FOKA 1J7KA 4A3CJ 2UWMA 3TP3A 3K4LA 3E6BA 3HSRA 1UFMA 3GTJJ 2VT2A 1A04A 3DLAA 3JAMK 2MW8A 4L9VA 5E20A 5F27A 3CZ6A 1GXPA 2FMYA 4A3JJ 5DYMA 2ELHA 2ZB9A 3HGYA 3TW7A 4IHVA 4XL9A 5K7ZA 3OIPA 4AM3A 4RM2A 2VKHA 5GPCA 3V8KA 2GIZA 5CYVA 3OR1C 2MD5A 2OBPA 4UVAA 4D0PA 4WCGA 2W85A 2BXZA 2VPLA 3A2KA 2JRTA 1VZ0A 2L0KA 2VKDA 1KU2A 2STTA 3TGNA 4CCKA 1XD7A 5F08A 3CMAI 5JI6A 2VOPA 1WHUA 5L3EA 5FLVA 3KYCB 2XAFA 1VQ4I 2A6EF 2LDUA 2R7ZJ 4JOMA 3VYRB 5JLXA 2OD5A 1FMWA 4XLFA 1KONA 2FE3A 2YU9J 3S14J 5D4SA 4NHJA 4LIUA 5E79C 3U1KA 1TWHJ 2V1XA 1RUOA 2OJED 1XB4A 3ROUA 3SQNA 3FMRA 3E5QA 1H8AC 4CYDA 2K9MA 2IA2A 3RQ4A 3X2QH 4RAGA 4KIFA 4MFEA 4EJOA 5B5EC 4LK0F 4EJVA 3AG3H 2O3FA 3DP7A 1IW7F 1YE9A 2DU9A 3LSIA 3TDUC 1SAXA 1B59A 1Z67A 2Z1DA 2EIMH 3IRQA 3DFGA 1SD4A 1JJ8C 4CXFA 2O7OA 2W82A 3G1OA 5AIPA 1X3ZB 1QNTA 2EZLA 2D2WA 1FIPA 1DQUA 5J1YA 1GUUA 4CCOA 4I2OA 1R5HA 4LOCA 2CQ7A 1B9MA 4D9JA 3C7JA 2WAFA 2DMNA 5HOOA 4Y33A 2TRTA 4XRSG 1WJAA 4KN4X 1BOAA 4G7HF 2G9WA 2MABA 5LLQA 1C0WA 1Y56A 3W3CA 4I0AA 1SMTA 4NC8A 1ZHFA 3C2HA 2LREA 1O3QA 1MBKA 2QM3A 2P81A 3NAUA 1HLVA 2AS5F 5FKNA 2UZKA 1Z9CA 4CICA 3RIRA 3M7GA 1JKRC 2DA5A 3OS1A 3CUOA 1SMYF 2ME6A 2VONA 2E1MC 2Y30A 3MN2A 3HHGA 2HNHA 1SFUA 2ISZA 1KQ0A 2WC2A 1XSDA 4W1UA 3OL4A 1SVMA 1MZBA 1YW7A 4BY1J 1W7PB 1TLHB 1UJ8A 2QKMB 3O8GA 4XLCA 3GX4X 1MMDA 2DFHA 3ZCOA 2RAEA 3LAPA 1E17A 1NHAA 2X9DA 4XLAA 2XGEA 4D7MA 2CO5A 5A2QZ 4AVZA 4XLHA 4A0YA 5E8IA 3WU1B 1HBXG 1U6GA 2Y69H 1TQIA 2VOOA 4YFXF 3CF2A 3DEWA 3PFIA 1FOXA 4F93B 4G6TB 4O3MA 3KFWX 2P5LC 3OYAA 1XDUA 3IL2A 2DJNA 3BROA 2CMPA 1K6OA 2CQNA 1HXDA 1IN5A 2X1DA 3KP5A 2MGQA 1ZYRF 2HYGD 2QSFX 1FOWA 5JLWA 2R92J 4BE0A 2DK5A 1WKMA 2WY8Q 5IY5H 1I3QJ 3ASNH 2RGVA 2IA0A 3FK6A 4A5NA 1K78A 4A5MA 2A6HF 1IN8A 4L18B 2VUMJ 2RKHA 1T95A 2HQAA 2RREA 3I0TA 4CO8A 2FNPA 5KAIC 2H6CA 3AG2H 1A6IA 1W5TA 1BC7C 1WJ5A 2LD5A 4JX6A 1X19A 3FM5A 1FBSA 1FJLA 2IXSA 3HKZA 3W6VA 1T6SA 3GLLA 5ILUA 3QYFA 1WFXA 3P7NA 4JYKA 3BC8A 5CJ9A 5J1RA 4JBAA 1ETOA 1JE8A 1QVTA 1Z0XA 5EG0B 4GO1A 5DM6F 3K2AA 1MBEA 4AWXB 2PI0A 5CVRA 3VSKA 4M6YA 3H36A 3F8FA 3I71A 4NBQA 4XRSA 1S7AA 4LITA 3J7AO 1ZQ3P 2GA1A 2Z99A 2PG4A 3C1DA 5F0CA 3DTIA 2XSDC 3SFZA 2R5ZB 2JA8J 3GF2A 5FKOA 3HC7A 4IQ4A 3I5UA 4F92B 2OCCH 5F1RA 1ERDA 4C3HJ 1Z91A 3TKYA 2HVRA 4CZCA 2CH0A 4ETSA 4ZTJA 4E7SA 2VKEA 3C3WA 3FZVA 1NG6A 1TL8A 3HSFA 1W5CC 2ISYA 2XPVA 1B6AA 1EH8A 4KISA 3U21A 3ZMDA 4DZJA 1OCPA 1ZREA 2DMQA 2D5VA 2CS3A 2DCEA 1IF1A 2L02A 3PJRA 4PK4A 2R7UA 1YW9A 1TQMA 2R5YB 1TBXA 4M9XA 3J7ZI 4OMYA 3IKTA 3K4KA 1ZG5A 2G7UA 4ESJA 4NUBA 1S29A 1IV8A 3OYFA 1R4NB 2A6TA 1Y1WJ 4WX9A 2D1VA 4BQQA 1V54H 5D5WB 1HW2A 2A05A 3B73A 3CCVI 4CYCB 5CVVA 2QQBA 4V2FA 3V8JA 3BTCA 4DNCA 2EFOA 1MBFA 1OKRA 1TT5B 1OFCX 1USTA 1J59A 4JP0A 5FGMA 4AYBA 3K69A 2EIKH 5F1JA 2R93J 1FBUA 1SVOA 2E5ZA 3F22A 5KHDA 3ABLH 3ZN1A 3I55I 1I3AA 1WJCA 5HS9A 2KISA 5D5UB 3CCUI 2NOJB 3E6MA 4LG0A 5KK1A 1MMNA 3HRUA 2DLLA 1ZARA 3LMMA 3OWTA 4LLLA 2L9NA 4A3MJ 4G9YA 1YRNB 3Q0VA 3L2VA 3V7RA 2NOGA 2HQRA 3BQYA 1VFCA 2OAZA 2VC1A 2H6BA 1MMGA 1DGRM 4KIGA 4A3GJ 3WGIA 4HZFA 4KDPA 3TQNA 1R1UA 1T8IA 5CQGA 3R61A 4YIFA 3K10A 2DW4A 3F6OA 3KZYA 4A69C 3ZGKA 4O5VA 4ABZA 1RC9A 3VOEA 2FA5A 1NTCA 2YU3A 4HLYA 5E1XA 4CCJA 3MKZA 1DU0A 3GFJA 2EV5A 2LK2A 3OOPA 3CQZJ 1JJ6C 1UCRA 3CCYA 4U87A 4HSTA 1T0FC 2P0WA 3LSGA 3WTSC 2K9NA 2ZJ2A 1OMIA 1S72I 5HDGA 1ZH5A 3RKQA 1YITI 1H88C 1R23A 3G2BA 4M73A 2TCTA 2HYJA 1ZN2A 5KNLA 1ENHA 2E2JJ 1ZTRA 2ZXJA 3K9TA 2VL8A 4PSXA 1CGPA 2ME0A 2DDAA 3KP2A 3MKWB 1OJLA 2JN6A 4G94A 1D5VA 3GO5A 3W6JB 5IOZA 4Q5SF 2D1HA 3O3KA 3FHZA 1YI2I 3CMEI 2L2OA 1UELB 4M3FA 1JKQC 2XPWA 3DKWA 2V9VA 4O6JA 4B48A 4F3QA 4RAFA 1DGWY 3LSHA 3HOSA 2XHKA 4GYGA 5BOXA 3M1EA 1PUFB 1XMAA 2YPRA 1ZGJA 2A69F 4JX4A 4UV8A 1RR8C 3K4NA 2YUSA 2IEKA 1LNWA 4ENKA 1BN5A 2WAEA 3ISPA 4I76A 1FMVA 5H6QA 4J19A 4IZZA 4NC6A 1JI8A 2NVQJ 4WXDA 2W7NA 4KFCA 3HOVJ 3K4JA 4RAZA 2DA4A 3HPGA 2PMHA 3PNVA 1BIAA 2R7TA 1LDKB 4KYWA 3GWZA 4EEFG 4E7HA 5M3FJ 4HX8A 3GW2A 3MKYB 4BGDA 2UUZA 1SANA 1R6RA 5DV5A 1R5ID 3M9AA 2NVUB 3CC7I 3L1PA 1NK2P 3VYUB 1R22A 4HF1A 2ZNZA 3P5JA 2GXGA 3OV8A 1I39A 2Y9YA 1JXSA 2WB1N 2GWRA 3V8LA 5ICGA 2M0CA 2MD0A 1Y6IA 2ZXWH 4N0BA 2HU9A 5FD5A 3L2WA 2GXAA 1KYZA 1Y39A 5LGTA 4QPQA 3BY6A 3VWBA 3ASOH 2WBMA 3HUGB 1YX3A 2NS7A 2NVXJ 3K7AJ 4FETA 5B66C 2BY3A 5CKTA 5JHUA 3BJAA 3EUAA 1BOBA 2A3SA 3I54A 2KPMA 2JTVA 2LP0A 3ML6A 4ZZDA 5CQEA 2Q2EB 5B1AH 5J40A 4IOCF 4BDZA 3M4OJ 1EKEA 2HDDA 3BPVA 4XOTA 2EILH 1OLTA 3ECHA 3W2VA 3IWFA 1K6YA 1UMQA 4DOZA 2BHZA 3AAFA 3RSNA 3QQAA 1IN7A 1YX5A 2KLOA 2QYOA 5K7FA 1MNMC 2XRLA 3IP4B 2ZMEB 5E3NA 2QVOA 3A0HC 4JK1X 3CDLA 1FSHA 2OCEA 2V1NA 1KZHA 4IRHA 3JRCA 4OIRF 4X0GA 1B1BA 3JRHA 5AIQA 1EF4A 3BG5A 4B09A 3WTYC 1G2HA 2HI3A 3CCEI 2E2IJ 4A3EJ 1IUYA 3NQOA 4K2EA 2MLGA 2Y75A 2FBIA 3KZZA 2E71A 4V19K 1Z1DA 2W4SA 2FXAA 1XMXA 2Z3YA 3BG7A 5EZGA 5GAHJ 2KZGA 2MC3A 3QOEA 3S32A 2IGKA 3ZPLA 3FBNB 3VEPA 1U78A 2AO9A 3CESA 4L0YB 5DTDA 1VQPI 1PDNC 5F6FA 2Z5UA 3ABUA 2K9QA 3LFUA 3H1CA 3WU0A 5TRDA 1G6NA 2HZTA 1WJFA 1YS7A 4BJTA 4Q4ZF 1R71A 1IDZA 3GVAA 2K40A 2L7ZA 4RGXA 4OIOF 3AL0B 3H9QA 2XAQA 2R0QC 2PMUA 2P5KA 1R58A 1RZ4A 2VIXA 2QLZA 2E1OA 3BWGA 2XROA 1HQCA 3OYEA 5EF6A 2BZTA 1YTYA 1K4SA 4L0ZB 3WG9A 3OMYA 3SXYA 1W7PA 3QYEA 3FKJA 2WY7Q 1FT9A 2W57A 1TP4A 2DFFA 3MFKA 1TQPA 3ESWB 4G7OF 1I6XA 2MA3A 1T0FA 3HBLA 3BQZA 3QODA 1U0JA 3A0BC 4UY8I 3N05A 5EYRA 3LNQA 2E7WA 2EIJH 4RB2C 5FFZA 1SFOJ 3ZP5A 3BG3A 5C4JJ 1RI7A 4CH7A 1FOYA 4BXFA 4HA8A 3LL7A 5FFXA 3GZ5A 4DBQA 1IGNA 3RKXA 3NEUA 2KMUA 3G1LA 5DEQA 2OUMA 4D7NA 3F23A 3OYKA 1G3TA 2ECCA 1AWCA 3I3LA 2JA5J 1HOMA 1YHQI 3EETA 3BPXA 2CUZA 4OMZA 2ZCWA 1T38A 2Z9OA 4BNCA 2WV1A 1DDNA 3KPHA 3ELKA 1V5GA 3HIFA 3CUQB 1XG1A 2JA2A 4PCQA 1W36C 1VQNI 1JUSA 2KT0A 5E18F 1TC3C 2KRHA 2PX9A 3FXUA 1G3YA 1I27A 5AONA 4FASD 3TP0A 1B72B 1P2FA 2FJ1A 3ABMH 1ZKGA 2XVCA 2O6GE 3D1NI 2PLYA 2MLKA 3E3VA 5LEKA 4MQVA 2GLOA 3VODA 2CV2A 3A03A 4I01A 3F3XA 3HRSA 5EG0A 4DJAA 2L5QA 2LOOA 4IRIA 3JRDA 2NNYA 5BPDA 3I4NJ 1PP7U 2HPIA 1IC8A 2KL4A 3H5AA 3DWLE 2R5ZA 2CUFA 1MNEA 5HLGA 2DPUA 1WGXA 2JUCA 2BYVE 3MZ8A 4HNVA 2L7FP 4LG3A 1O4XA 2IW5A 5H20A 2LC2A 3A02A 1LE8B 3CCSI 3E97A 2OPTA 5IT9Z 2KDOA 3M8FA 3PO2J 2Y0SA 1IXCA 2FUG2 1QBJA 1AKHB 2L4AA 4BXUA 4XONA 2ZJRF 3ZQLA 2D45A 3VPRA 2OZUA 5DUKA 1R5GA 1FP2A 1X1CA 5D5VB 2R5YA 3TEDA 3HOWJ 2BVMA 4YIIA 2XAJA 1QZEA 5FROA 2HVSA 3KP4A 3ZMUA 3C2GA 3ZMTA 4HOBA 3J7YJ 1HW5A 2LLKA 1BI0A 1O3RA 5K5RA 5J8CA 2KIFA 3GZNB 4CYCA 3WTXC 2KP6A 3DU5A 3AKZA 1IJWC 2A61A 3FBIB 2HXIA 1P4AA 2BVLA 1P7JA 3CC2I 1MSFC 3JR9A 3BG9A 4A3LJ 4XORA 5LGUA 2H94A 2LF8A 4IXAA 4BBRJ 4XKBA 5ERIA 4J01A 2IJLA 4ESFA 4DQ2A 2BHYA 1X1AA 4GGGA 1I5ZA 4E70A 3K4CA 2XB0X 1VQ5I 1S3JA 1Y0NA 4XLEA 3KP7A 2XF6A 3JRGA 3DBLB 2BW3B 2LY9A 3HPHA 2EFWA 3PUFA 2V1UA 1W0TA 3ZQ7A 1O3TA 2PQ8A 1YRNA 2PFBA 1U9NA 5E1WA 1JGGA 1KQ8A 1X4OA 1ZG3A 1Z3XA 3FXLA 2RDPA 4CGZA 2V79A 1PJRA 2WAQA 4ZC3A 1B4AA 3F0CA 1WI3A 2NRAC 2FQ4A 4MEXF 4YEJA 1AU7A 3PUBA 4U7DA 2XV4S 4KNYA 2OZ6A 4U0YA 3ZQCA 2E36A 3DF8A 3LQRA 1SD5A 1QRYA 2LNBA 3WHBA 4I99C 1R9TJ 4BDYA 2Z16A 1LEBA 3KLOA 3MD2A 2DT6A 2L9VA 2DOAA 3E5XA 4RLQA 2UV1A 2CW8A 2R7WA 2VLAA 4IHXA 1I1GA 4C3JJ 4RB3C 1Z05A 1FTZA 1LKXA 3L2RA 1ZR2A 2PBIA 4LIVA 1ZGWA 1HSJA 2J5OA 4IQJA 1R00A 4MNUA 1S5LC 4PGGA 3GFMA 2XPUA 3SZGA 1OCTC 3QWLA 2LKPA 2KFDA 4HX4A 3S3NA 1FC3A 2OQRA 3JRFA 1TWCJ 3GTQJ 1MKMA 3O2PE 2NS8A 3PM1A 1U5TB 4ON0A 1W1WE 2V9KA 3K0LA 2X0LA 4PFOA 4S04A 2B9SA 2KRFA 4RS8A 5LHHA 1MBJA 2M34A 1BA5A 1UZCA 3DXJF 3IWZA 5KCMA 3OYJA 6PAXA 5L3BA 1H9TA 2FRHA 3FXKA 5LRSA 2WA0A 2RQQA 2X6WA 1Q1HA 3RPQA 2CG4A 1IN6A 3JTHA 3I59B 2HDCA 1IRXA 2EFQA 3ERMA 1RNLA 2MBFA 1FYLA 1D8KA 5CVIA 4MFDA 2K3PA 4BY7J 1ETVA 5EJCA 3ZMVA 3CUQC 5FKKA 1PUFA 2E1NA 2ADUA 1TZLA 5EGOB 2X48A 1VTNC 2JVGA 1XGNA 4XN0A 2EPFA 3HOYJ 2IS2A 4IHYA 2E35A 2BBYA 4ENMA 4BHCA 1KU3A 5GP9A 3EYYA 5H6RA 4EMSA 4RBOA 2R7DA 1XMKA 4GDFA 3QOPA 3JW4A 4IRGA 5K7HA 1GLNA 4A6DA 2LMDA 2ZXIA 4XRMA 4CZZA 3DPTA 5F64A 4IOAF 2VQHA 2HPMA 4CUGA 3DEUA 1BJZA 4HEA2 2V4JC 2V6CA 4AD9A 1HC8A 3DQVC 5A2QK 2HOAA 3L7WA 5M5YJ 2LVSA 1ETYA 5M5XJ 3KP6A 2R7XA 1G4DA 3HUGA 4KITB 2CU7A 3OYDA 3PNTA 2HGCA 3ZOBA 4EJWA 3DV8A 3T8RA 1JHFA 3WTTC 2CV0A 2O0YA 1FEXA 2K4JA 2E60A 2XC7A 5KVRA 2DA6A 3OY9A 3OIQA 1ETXA 3TW6A 1OR7A 4EJTA 1ZLJA 1YG2A 2QWWA 3M8EA 4HLXA 2Q2EA 4RM3A 1IRGA 2KIMA 3RPUD 1A31A 3L2UA 4HYEA 2L54A 2O8XA 4ANJA 5TGTA 1BR2A 4A0XA 4AVPA 2W1OA 2YX7A 1USSA 3RYPA 4A3FJ 2DFEA 1P7IA 1U8RA 4R8HA 2F4MB 1YIJI 1RESA 3NARA 2HDWA 3V42A 1R7JA 2DYSH 2ZMEA 3E7LA 5JVTA 3HHHA 3ERED 5LEJA 3O6BB 4XBFA 4EM0B 4D1QA 3G73A 2DMUA 3K70D 3BLYA 1HA8A 3OSFA 1IAWA 4LMYA 5B1BH 4FX4A 2IGOA 2AXTC 5IYCJ 1LUJB 2LY1A 2Y31A 4A6EA 3RYRA 2CUJA 4IL6C 4RGRA 5C3EJ 2EB7A 2VBWA 4DYQA 1QPMA 2JK3A 3VYTB 1SEUA 2DA1A 2PJRB 2ELJA 5GAEJ 5JVGF 3I4MJ 1IUFA 3T8TA 3CCJI 1Y8RB 2F5CA 2DODA 3GMEA 3WHCA 5DD4A 2VBYA 1K7AA 2DI3A 2HKXA 4E7JA 2M8EA 1YYVA 2L9RA 5E17F 4BQNA 3OYIA 1X1DA 4XKWA 4D5CA 2F5EA 4ZYEA 1YQAA 4M74A 3JSOA 4ESBA 3CCQI 1QPIA 4RB1A 4UNOA 4QIWN 3QPHA 1MW7A 2PN6A 1MD0A 4YFKF 3NRVA 2IBDA 1JKPC 3OYLA 1RPWA 1WJEA 3SZPA 3VSLA 1ZRDA 3MWMA 3C2BA 4N4OB 4MTEA 3TOBA 3PO3J 4KICA 3W2WA 4HDVA 2P6SA 4B4CA 5IT3A 4B47A 4E4HA 2QUFA 3B6CA 4DYRA 2BXYA 2W24A 4NC7A 4L9NA 2RC4A 3I4PA 2K3FA 1P92A 4L9TA 1RRJA 4BJ5C 3PFYA 3FXQA 2EA4A 3HEFA 3SDBA 1H0MA 3J7AY 4II3A 4M6VA 3ULQB 4G8XA 2K27A 5D6EA 3GCMA 5HVQC 1FZPB 3LAJA 2H1KA 1WH7A 4NB5A 4U0WA 2BEOA 1LVKA 3CCLI 3M1CA 4Z6YA 3AG4H 4A12A 1H89C 1BI1A 2QF7A 2MG4A 2YS9A 3JTGA 2E1CA 3BCAA 2VC0A 5J4VA 2VQCA 4BE1A 4UV9A 4CCNA 5FO5A 3Q5FA 3ZQFA 4EV0A 2K9SA 5H2FC 1VF9A 3J81Z 1S6LA 1V4RA 3TBIA 5FKMA 3R4KA 4M3GA 5EZHA 4BEHB 3CUQA 1O7LA 3TL4X 3DLLF 2P7VB 3IHUA 4ZDOA 1FSEA 3EUHA 4PZJA 4ZYDA 4NQWB 3ZXSA 1GVDA 3KE2A 2LR8A 3HRMA 1B72A 1U3EM 3IC7A 1IN4A 3FXJA 3WU2C 1NG7A 4S05A 4DYCA 3D5SC 3S2WA 1GT0C 4LK1F 4E7IA 3QAHA 4A0ZA 2GXBA 1ACIA 4KT6A 2DXIA 1KA8A 4IHTA 2XGCA 4L5JA 4P5OA 5EDNA 3CMMA 3LFKA 2FBHA 4L5IA 2E34A 3RDIA 2JVHA 2LKSA 2EA2A 2M4GA 4S0HB 3OYCA 1E3OC 1KGSA 1MJ9A 2IS6A 3L09A 1XSVA 4FX0A 5DM7F 4NNJA 2LRDA 4Y52J 2FQ3A 2WADA 2A07F 4B3XA 4C2MJ 3TMOA 1ZAOA 5L3GA 1TTYA 3CJQB 4LFUA 3CLQA 1UG2A 4I0BA 2LY2A 2O8KA 4IPAA 1JUMA 1LE8A 4UUTA 4ASNA 3S2DJ 1JKOC 1BW5A 3IH3A 1SD7A 1DU6A 3F8BA 2J5PA 1AKHA 1Z7UA 5FB2A 1SD6A 2A68F 3HOTA 5FJ8J 4XICA 1D0ZA 4YG2F 4F55A 2K86A 3IH2A 2DOFA 4TV7A 1FYMA 3OR2C 3GTKJ 2X6OA 3Q9SA 2LH9A 3HL2A 2XF5A 5E3MA 1X1BA 3JREA 1ZELA 3HG9A 5LBQA 3S16J 2EV0A 3DBRB 4QSHA 1R4MB 3WODF 2XB5A 2FBKA 2Y0MA 1MMSA 4CCLA 3U2RA 5BPIA 3CCRI 3BR1A 4KIBA 4XIDA 4HQMA 4Q47A 3N4MA 4Q48A 1I50J 3GTGJ 2BOLA 4BAYA 2JPCA 4WF2A 5LHGA 2MSYA 3KEOA 5FD6A 4A3KJ 2EZKA 1GVJA 5IPAA 2BY2A 2DQLA 4IJAA 3DEEA 3UKGA 4JQFA 3TO6A 1P6RA 1IRZA 3R60A 2H27A 2DBBA 3CO7C 2CFXA 1G3WA 1H9GA 2IPQX 1IV6A 1T2KA 1HKTA 3WTWC 4EQQA 2DT7B 3LSKA 3H0DA 4UVCA 4BHBA 3GLXA 2HTJA 3RI4A 1G8XA 1J75A 2CW0F 1T08B 1F9NA 2VQLA 1IXSB 3LSTA 4WK8F 1ZLKA 1Z7LA 4ZDPA 2WB1A 1ON2A 1D5YA 3HGGA 3PIOF 1BW6A 4OIQF 5K5QA 1F1ZA 1S7EA 1MMAA 1ZRFA 3KYDB 3J80Z 3GYHX 3G3ZA 1BR4A 3OIOA 1EA3A 2ZBKA 3HDDA 4I98B 5EEAA 3IV5A 1YIOA 2EFNA 3KYLA 1VQ8I 2V1DA 4UB6C 2FNAA 4WXHA 3ONQA 1A6QA 5ICEA 4EGYA 4A3BJ 3I9V2 2NNNA 2QQ8A 1MH3A 2QQ9A 2W48A 3O8HA 2TDXA 3QPTA 5E3LA 3WTZA 2P7CB 4MHGA 3CP8A 3WGHA 5L3FA 2M87A 2M45A 3BOQA 3QPLA 3RKYA 3HXLA 5EEGA 1VQ7I 4PJ0C 3BR3A 4EM1A 5D8KB 4HQEA 1HCRA 3I59A 1OPCA 3E6CC 1PYVA 3DU6A 4ZJZA 4LB5A 2VBXA 2ZNYA 4M3BA 2C6YA 1FPQA 1TWGJ 1X3WB 2OF7A 4ITVA 5EGOA 4M71A 5K1YA 1R36A 2EQRA 3H3UA 3OYMA 3CMYA 4IKFA 4IVNA 2R7FA 4RMNA 5E8GA 2EJRA 4UB8C 3EPZA 4HAMA 3S93A 5FLXZ 3IAS2 2M30A 3P9KA 2KDZA 3G71I 4QTRA 1ODDA 2WWYA 4WWCA 4PJMA 4AUXA 4XKCA 3PL8A 1O3SA 2A5YB 1AOYA 2OV7A 2Z2SB 5DS9A 3UNGC 2IT0A 3Q9VA 3ZQGA 1ORKA 1STZA 5ILVA 2DPDA 1XGSA 1LEAA 3D0SA 1Z6RA 3T0YA 2VXZA 4HRIA 2E7XA 3I56I 1YS6A 2O03A 3K2ZA 3S2HJ 2STWA 2HYFA 1OYIA 3GTPJ 1KU9A 5JR3A 2DO7A 2QQAA 2F4OB 4CSWA 3CF5F 4W97A 4BACA 3H0GJ 2K9LA 3M3YJ 1XSXA 4L5EA 3S17J 3S1QJ 3REOA 4QWQA 4P1WA 4HPQA 4PGHA 2KIQA 2R7RA 2VJ5A 4KMUX 2DJIA 1SFKA 2VJ4A 3HZJA 4FCYA 2Y48A 4PJLA 5DD8A 3HJEA 4HX7A 9ANTA 3F6VA 2IAIA 4Y4RA 4A2UA 1FY7A 1I6HJ 2OTJI 4C2TA 5E1ZB 2CV1A 3OSGA 5DCFA 4C30A 3LA3A 2Y2ZA 2XAHA 1N25A 4OIPF 2OU2A 4DZPA 1ONVA 4ZZLA 2K7LA 1JT6A 2B7EA 3T5XA 1MH4A 2BGCA 5HLHA 2PMZN 3ZQHA 2X85A 4CA0A 1APLC 5GADJ 4Y15A 3JCUC 2JQ7A 1XC5A 2E19A 4FT8A 3VFZA 2F5VA 1MDMB 3S3MA 3EQLF 4UUSB 3DKXA 3L9FA 4GXOA 2KIUA 4FISA 2PJRA 2YSRA 2NVYJ 4BYYA 4G6QA 3HTSB 3GFIA 2VKVA 3PIPF 4B8XA 3MKLA 4PSWA 1D3YA 4XSXF 3DTKA 5HNHA 3FXOA 4AIJA 4XLPF 2QSHX 2W00A 1D1BA 4U0VA 5CVJA 1B8IB 2IS4A 2LYCA 3ABTA 1O57A 4IO9F 4H4KC 2IS1A 2BY0A 2LFBA 1OISA 1V3FA 2LF7A 1OR7C 2Y0SN 2QENA 4HF2A 2IVMA 3HTUA 5IT9K 2F5FA 2UXNA 4E7KA 1L3LA 1WQ2A 3HB9A 1VI0A 4B1RA 2YX4A 4DW6A 1T98A 3WE2A 3FM3A 3KIOA 3W6KB 3DKYA 4RGSA 1REPC 3K1MA 3ECOA 2CQKA 1D1AA 2FEZA 2LSOA 1V5FA 1Z21A 2ZMEC 4HV5A 4GFBA 4V2GA 2HTSA 1V5EA 3FXMA 1MNDA 1XTAA 2EV6A 3TDZC 3BJOA 4EATA 3V7CA 1SC7A 2JWTA 1Q1VA 2XASA 3FMQA 3A01B 2DAOA 2ZC2A 2ZKZA 4IEJA 4ZDLA 3WG7H 3JAMZ 3KLNA 3G6EI 1OYWA 2I10A 3HYIA 3LSMA 3QU3A 1SAUA 2K02A 3BTJA 2M3AA 2EWNA 1VQKI 1LDDA 2IGNA 1EJ9A 2VXDA 2VJJA 5FLMJ 4Y13A 2OA4A 4EGZA 1YJNI 3RCOA 5D4RA 3HSEA 3A1YA 1NK3P 3CD6I 4N9HA 2ACJA 2MH9A 3CTAA 3M07A 3JRIA 2PEXA 1R49A 4HNTA 3OYHA 2DMPA 3MQ0A 4BEHA 2WAQN 1YFHA 4MEYF 3KEQA 4UVBA 3R6SA 2L4MA 2JA6J 1GV5A 4NQWA 4BHPA 2JMWA 5HLTA 1VQ9I 3AL0C 4LJZF 1V55H 3F8MA 1IO2A 3Q0WA 1CF7B 2G0EA 3R0AA 2FX0A 1FLIA 2XAUA 4G6DA 4BH9A 4ZYAA 2ZFWA 4P9UA 1ETWA 1WJBA 2DTZA 3N97A 2IRFG 3AFHA 1TNTA 1BBYA 4JX5A 2CW7A 2W84A 1MIJA 1VQLI 1ZR4A 4AIHA 3MAJA 4Y7NJ 1LFUP 1QU3A 1CQTA 3FF5A 4ENNA 3BR0A 3TOAA 3H3VK 2COBA 3ZQIA 2X6XA 5IP7J 2GBYA 2HVQA 1YOVB 2GM4A 3RZOJ 1ITYA 4XRFA 1BI2A 4GYIA 2JUGA 2M8GX 4HDUA 1W4MA 2NYXA 2H8WA 1WSUA 4I6ZA 1JUPA 2Q0OA 3MZHA 1K83J 2R7VA 2KJCA 4MLOA 2DYRH 2K85A 2XUBA 3S8PA 4M72A 2B0LA 3K6GA 1YJ9I 3FWEA 3VB2A 3S3OA 1QGPA 2ZO4A 4HBLA 5HLIA 1MBGA 4DIQA 2VB6A 3PSFA 2HOEA 3CDIA 4XSZF 2JZYA 1LFBA 1W5SA 3K1NA 4HG2A 3Q3SA 1YO5C 1DPRA 2VQGA 3PNYA 1UB9A 1QA6A 4FQGA 2LTPA 1UHWA 2MC4A 3COAC 2EK5A 2IGMA 4BL0B 3EUHC 2P6TA 3GXOA 4I09A 2O61A 1X4PA 2GIVA 3D5LA 3FX3A 5ICFA 1X58A 3IAM2 4YELA 2EH3A 1X2NA 1FWZA 1E0EA 4RGUA 3MMYB 2VN2A 2R7OA 2HXOA 4XN3A 4N9IA 3OYGA 3LSJA 3HRTA 1E3PA 2V6EA 1AA7A 1BI3A 2CSOA 3OL3A 4OOIA 5HS7A 2QZ8A 1O7FA 4XM3A 3IRRA 3DPLC 2HOSA 1XX5A 1F5TA 2CQXA 5GTHC 1FTTA 2BV6A 1Z6TA 5JHFA 5DCMB 1J9IA 3KETA 1Y8QB 5HNFA 4A93J 1BM9A 1WWXA 2HKOA 5F0HA 2FF4A 4KJZA 4BKXA 1ZK8A 3AG1H 2FOWA 4E7LA 1X1PA 5FRMA 1GDTA 3B6AA 2V7FA 2F2EA 2ID6A 1OCCH 5LFAA 2CJJA 1WPKA 4F7ZA 2V26A 2VJIA 1KQ9A 1LQ1A 1JHHA 1N75A 2BY1A 4PJJA 2L9SA 2NVTJ 1IRFA 2VE8A 4AIDA 4MO7A 3MCZA 5LHIA 2YR2A 3H3ZA 4RA2A 3IUOA 4B3AA 2M9HA 4R1HA 5M5WJ 4BBSJ 1FBQA 5FRNA 4E6KG 1VNDA 1Z3YA 4YIRX 2XF7A 4KMFA 1UG0A 4M9SA 1B9NA 4A3IJ 3H5NA 1X3UA 4X6AJ 1S8NA 1U9OA 1T39A 1S7OA 1UHSA 4F52A 3HKZN 3P9IA 2HQNA 4IX7A 1N78A 3CCMI 1D1CA 3DTEA 5M3MJ 2RNGA 3BG6A 1U8BA 2E2HJ 4EJUA 4BQOA 3SEZA 2Z33A 5D8LB 5BQTA 2LBFB 2OC6A 1ZGAA 3LWFA 1G59A 4IF4A 4RLFA 5B3SH 5BMZA 1E3HA 1AHDP 2M7AA 3SJMA 3TO7A 5CVUA 3KX2A 4FE7A 3EYIA 1K4TA 1XPXA 3FK7A 4Y3OA 2VBZA 3S1NJ 1XS9A 3GFLA 1RIOH 2X1EA 2F6CA 4BUPA 4AC0A 1D0YA 2AHQA 3I64A 3WTVC 5IYDJ 3Q0UA 2GOXB 2E5NA 4CDGA 3PSIA 2NS0A 2JRMA 3OS0A 3H92A 5LGNA 1VQOI 1LB2A 2HFHA 1ETKA 1OCRH 3G4SI 2HEOA 3LOCA 1XDSA 3LA2A 2L3DA 4FHTA 4UUVA 3OOUA 3LQQA 4PFPA 2K4BA 2RQPA 5D5XB 4PDKA 2BE5F 4XK4A 2GOMA 2F48A 3E6DA 4G7ZF 1QVUA 2HWVA 2EZHA 3K70C 1XN7A 2L7MP 2KZVA 1MSEC 1A35A 2FD5A 4AYBN 5IYBJ 1Y1VJ 2XKPA 5LRRA 2EINH 2HR3A 4RAYA 3QPSA 4P9FA 3P9CA
chains in the Genus database with same CATH topology
1RKWA 2TRTA 5EG0A 4XRSG 1D5YA 3JRDA 3I4NJ 3HGGA 2M2EA 1BW6A 1IC8A 1S7EA 4M3EA 5HODA 3RZDJ 2R5ZA 2CUFA 1MBKA 3NAUA 1WGXA 2P81A 3OIOA 1HLVA 5FKNA 1X2MA 3HDDA 5EEAA 1JKRC 2DA5A 4HNVA 2L7FP 3IV5A 2ME6A 3RQIA 1O4XA 3MN2A 2Y30A 1LE8B 3A02A 5C44J 4A3BJ 5IP9J 4W1UA 2OPTA 4A3DJ 4BY1J 1MH3A 3PO2J 3O8GA 3LSPA 1JT0A 2W48A 3O8HA 1AKHB 1IDYA 2RAEA 1TWFJ 3ZQLA 5E3LA 3VPRA 2LKXA 2X9DA 2XGEA 4D7MA 2R5YA 2DA3A 3TEDA 3HOWJ 4RDUA 3QPLA 2Y9ZA 3BR3A 1HCRA 2LLKA 3DEWA 3FISA 1TWAJ 4CYCA 1IJWC 4UUSA 2HXIA 4M3BA 2DJNA 1P7JA 4A3LJ 1MSFC 3JR9A 3BG9A 1Z77A 1TWGJ 2OF7A 5EGOA 2EQRA 2MGQA 4FTHA 4BBRJ 1HDDC 3CMYA 5JLWA 1HF0A 2R92J 1B8IA 2XB0X 1I3QJ 2KDZA 3S1RJ 4QTRA 3JRGA 3FK6A 3SDGA 2LY9A 4AUXA 2VUMJ 2JA7J 3HOZJ 1W0TA 5DS9A 1YRNA 1U9NA 4MIMA 3ZQGA 1A6IA 1ORKA 1JGGA 2LD5A 5IP6A 4JX6A 1FJLA 1JTYA 3W6VA 3F0CA 1WI3A 2ECBA 3S2HJ 2FQ4A 1AU7A 4JYKA 3GTPJ 5J1RA 1ETOA 3ZQCA 1QVTA 2H8RA 1Z0XA 5EG0B 1QRYA 3K2AA 1MBEA 3WHBA 4W97A 1R9TJ 3H0GJ 4XRSA 3M3YJ 1IG7A 4L5EA 1ZQ3P 3S17J 3A01A 3S1QJ 3G1MA 4IHXA 4C3JJ 2R5ZB 5F0CA 2XSDC 2ID3A 1FTZA 2JA8J 5FKOA 1ZR2A 4FCYA 1ZGWA 1BL0A 3GBGA 1T56A 2CQQA 4C3HJ 2XPUA 1OCTC 9ANTA 1GV2A 2IAIA 2VKEA 3JRFA 1I6HJ 1TWCJ 3BR5A 2XPVA 3OSGA 3GTQJ 2ELKA 4DZJA 2NS8A 1OCPA 3PM1A 2DMQA 2Y2ZA 2D5VA 5FKLA 1WH5A 4DZPA 2R5YB 2EBIA 1MBJA 2M34A 1JT6A 1BA5A 1HDPA 5GPAA 1MH4A 1JTXA 2HQ5A 2PMZN 3ZQHA 1Y1WJ 1APLC 2DMTA 4CYCB 1XC5A 2E19A 4NDLA 4V2FA 3BTCA 1RETA 4MFDA 4BY7J 1MBFA 1ETVA 4UUSB 1OFCX 5FKKA 4JP0A 1PUFA 4FISA 1K61A 2NVYJ 5EGOB 3DCFA 2R93J 5F1JA 1RKTA 2B63J 2X48A 2VKVA 3GTMJ 3MKLA 3IH4A 1ETQA 2O9LA 3HOYJ 4IHYA 1B8IB 2DA2A 5GP9A 2LFBA 4RBOA 2Y0SN 4A3MJ 5K7HA 1YRNB 3Q0VA 2NOGA 4XRMA 5J3LA 5IOYA 3BR6A 3BQYA 3HB9A 4G12A 1VFCA 4X1EA 1VI0A 4B1RA 4DW6A 4D5FA 1BJZA 4A3GJ 3JRAA 3GTLJ 2VPRA 2HOAA 1FIAA 5M5YJ 1RR7A 2LVSA 1ETYA 5M5XJ 4GFBA 4V2GA 4A69C 4ABZA 2CU7A 3ZOBA 3HOUJ 1NTCA 2JWTA 1DU0A 1FEXA 1Q1VA 2LK2A 3A01B 4IEJA 3CQZJ 1JJ6C 2DA6A 3SFIA 1ETXA 3TW6A 3CCYA 2I10A 3LSGA 2K9NA 3BTJA 3RKQA 5C4XJ 1T33A 1H88C 5FLMJ 1F36A 2TCTA 2HYJA 1ENHA 2E2JJ 4A3FJ 1ZTRA 1NK3P 1P7IA 3JRIA 2CRGA 1RESA 2DN0A 3NARA 2DMPA 2ME0A 3E7LA 4C3IJ 3HM5A 2WAQN 4IHWA 1OJLA 2JN6A 3LSRA 2JA6J 1GV5A 1A5JA 2DMUA 2XGDA 3BT9A 5BNGA 2JMWA 5IOZA 3OSFA 3Q0WA 3FKIJ 5IYCJ 2HOTA 4M3FA 2G0EA 3FIWA 1JKQC 2XPWA 2FX0A 2Y31A 5C3EJ 4DYQA 1POGA 4M3DA 2JK3A 1ETWA 2DTZA 3MVPA 2DA1A 1PUFB 3I4MJ 4JX4A 1F43A 1IUFA 4JX5A 2YUSA 2IEKA 1ZR4A 3WHCA 2QCOA 3S1MJ 4Y7NJ 1LFUP 2CUEA 3BTIA 1CQTA 3BR0A 3H3VK 2N8GA 2COBA 3ZQIA 4I76A 2GBYA 5IP7J 3GTOJ 3RZOJ 2GM4A 2L9RA 4J19A 1ITYA 2NVQJ 4D5CA 2M8GX 3HOVJ 4I6ZA 1JUPA 2DA4A 4FE4A 1QPIA 1K83J 4QIWN 4MLOA 4EEFG 2IBDA 5M3FJ 1JKPC 1RPWA 1SANA 3C2BA 3PO3J 3L1PA 1NK2P 1MBGA 2EZIA 3S15J 4B4CA 2Y9YA 2WB1N 5F0FA 1LFBA 2M0CA 3Q3SA 3B6CA 3BR2A 4DYRA 1WCMJ 2LTPA 2NS7A 2NVXJ 3K7AJ 3HOXJ 3HEFA 4M6VA 1X58A 2EH3A 2H1KA 1X2NA 2LP0A 1WH7A 1H89C 2DA7A 2QF7A 2HXOA 5E3OA 3M4OJ 3LSJA 2MG4A 2HDDA 2YS9A 5F04A 1MBHA 1UMQA 3ZQFA 2K9SA 3QQAA 1VF9A 5K7FA 4BXXJ 3BTLA 5J1UA 1MNMC 2XRLA 3JRBA 5FKMA 4M3GA 5EZHA 5E3NA 2HOSA 2CQXA 3CDLA 1FTTA 3JRCA 1GVDA 1W0UA 3JRHA 2LR8A 1B72A 1EF4A 3BG5A 4A93J 5F0HA 4DYCA 1G2HA 2HI3A 2E2IJ 1GT0C 4BKXA 4A3EJ 1ZK8A 2VI6A 1GDTA 3B6AA 5EZGA 2ID6A 2XGCA 5EDNA 2CJJA 2JJ7A 1WPKA 1U78A 4A3CJ 2AO9A 3TP3A 1E3OC 4S0HB 3GTJJ 2NVTJ 5DTDA 4MO7A 2MW8A 2K9QA 4B3AA 2M9HA 5F27A 5M5WJ 4BBSJ 4Y52J 4A3JJ 1VNDA 2ZB9A 3HGYA 3TW7A 4C2MJ 5K7ZA 4IHVA 1IDZA 2K40A 2L7ZA 4A3IJ 1UG2A 2R0QC 4X6AJ 2O8KA 5GPCA 1U9OA 1UHSA 1JUMA 1LE8A 4UUTA 3HKZN 2E1OA 3S2DJ 1JKOC 5EF6A 1BW5A 5M3MJ 1U8BA 3IH3A 2E2HJ 2L0KA 1DU6A 1AKHA 5F08A 5FJ8J 4XICA 3HBLA 5FLVA 3BQZA 3IH2A 2R7ZJ 5JLXA 3GTKJ 2X6OA 1AHDP 5EYRA 3SJMA 3LNQA 2YU9J 3S14J 5E3MA 4FE7A 3JREA 1SFOJ 3BG3A 1TWHJ 5C4JJ 3S16J 3FK7A 3S1NJ 1XS9A 4QSHA 2XB5A 1IGNA 1H8AC 3G1LA 4D7NA 4AC0A 4MFEA 2AHQA 3BR1A 5IYDJ 4XIDA 2ECCA 3GTGJ 3Q0UA 1I50J 2JA5J 1HOMA 2MSYA 4A3KJ 2EZKA 5IPAA 1ETKA 2WV1A 1JJ8C 3LOCA 3UKGA 2O7OA 3G1OA 1XG1A 3OOUA 2EZLA 1FIPA 1JUSA 2KT0A 1IRZA 1TC3C 5J1YA 1IV6A 4XK4A 3TP0A 1GUUA 1B72B 1QVUA 2FJ1A 4LOCA 2EZHA 2L7MP 1ZKGA 1MSEC 2FD5A 4AYBN 5IYBJ 1Y1VJ 2DMNA 3D1NI 2GLOA 3QPSA 3A03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKW A;  2TRT A;  5EG0 A;  4XRS G;  1D5Y A;  3JRD A;  3I4N J;  3HGG A;  2M2E A;  1BW6 A;  1IC8 A;  1S7E A;  4M3E A;  5HOD A;  3RZD J;  2R5Z A;  2CUF A;  1MBK A;  3NAU A;  1WGX A;  2P81 A;  3OIO A;  1HLV A;  5FKN A;  1X2M A;  3HDD A;  5EEA A;  1JKR C;  2DA5 A;  4HNV A;  2L7F P;  3IV5 A;  2ME6 A;  3RQI A;  1O4X A;  3MN2 A;  2Y30 A;  1LE8 B;  3A02 A;  5C44 J;  4A3B J;  5IP9 J;  4W1U A;  2OPT A;  4A3D J;  4BY1 J;  1MH3 A;  3PO2 J;  3O8G A;  3LSP A;  1JT0 A;  2W48 A;  3O8H A;  1AKH B;  1IDY A;  2RAE A;  1TWF J;  3ZQL A;  5E3L A;  3VPR A;  2LKX A;  2X9D A;  2XGE A;  4D7M A;  2R5Y A;  2DA3 A;  3TED A;  3HOW J;  4RDU A;  3QPL A;  2Y9Z A;  3BR3 A;  1HCR A;  2LLK A;  3DEW A;  3FIS A;  1TWA J;  4CYC A;  1IJW C;  4UUS A;  2HXI A;  4M3B A;  2DJN A;  1P7J A;  4A3L J;  1MSF C;  3JR9 A;  3BG9 A;  1Z77 A;  1TWG J;  2OF7 A;  5EGO A;  2EQR A;  2MGQ A;  4FTH A;  4BBR J;  1HDD C;  3CMY A;  5JLW A;  1HF0 A;  2R92 J;  1B8I A;  2XB0 X;  1I3Q J;  2KDZ A;  3S1R J;  4QTR A;  3JRG A;  3FK6 A;  3SDG A;  2LY9 A;  4AUX A;  2VUM J;  2JA7 J;  3HOZ J;  1W0T A;  5DS9 A;  1YRN A;  1U9N A;  4MIM A;  3ZQG A;  1A6I A;  1ORK A;  1JGG A;  2LD5 A;  5IP6 A;  4JX6 A;  1FJL A;  1JTY A;  3W6V A;  3F0C A;  1WI3 A;  2ECB A;  3S2H J;  2FQ4 A;  1AU7 A;  4JYK A;  3GTP J;  5J1R A;  1ETO A;  3ZQC A;  1QVT A;  2H8R A;  1Z0X A;  5EG0 B;  1QRY A;  3K2A A;  1MBE A;  3WHB A;  4W97 A;  1R9T J;  3H0G J;  4XRS A;  3M3Y J;  1IG7 A;  4L5E A;  1ZQ3 P;  3S17 J;  3A01 A;  3S1Q J;  3G1M A;  4IHX A;  4C3J J;  2R5Z B;  5F0C A;  2XSD C;  2ID3 A;  1FTZ A;  2JA8 J;  5FKO A;  1ZR2 A;  4FCY A;  1ZGW A;  1BL0 A;  3GBG A;  1T56 A;  2CQQ A;  4C3H J;  2XPU A;  1OCT C;  9ANT A;  1GV2 A;  2IAI A;  2VKE A;  3JRF A;  1I6H J;  1TWC J;  3BR5 A;  2XPV A;  3OSG A;  3GTQ J;  2ELK A;  4DZJ A;  2NS8 A;  1OCP A;  3PM1 A;  2DMQ A;  2Y2Z A;  2D5V A;  5FKL A;  1WH5 A;  4DZP A;  2R5Y B;  2EBI A;  1MBJ A;  2M34 A;  1JT6 A;  1BA5 A;  1HDP A;  5GPA A;  1MH4 A;  1JTX A;  2HQ5 A;  2PMZ N;  3ZQH A;  1Y1W J;  1APL C;  2DMT A;  4CYC B;  1XC5 A;  2E19 A;  4NDL A;  4V2F A;  3BTC A;  1RET A;  4MFD A;  4BY7 J;  1MBF A;  1ETV A;  4UUS B;  1OFC X;  5FKK A;  4JP0 A;  1PUF A;  4FIS A;  1K61 A;  2NVY J;  5EGO B;  3DCF A;  2R93 J;  5F1J A;  1RKT A;  2B63 J;  2X48 A;  2VKV A;  3GTM J;  3MKL A;  3IH4 A;  1ETQ A;  2O9L A;  3HOY J;  4IHY A;  1B8I B;  2DA2 A;  5GP9 A;  2LFB A;  4RBO A;  2Y0S N;  4A3M J;  5K7H A;  1YRN B;  3Q0V A;  2NOG A;  4XRM A;  5J3L A;  5IOY A;  3BR6 A;  3BQY A;  3HB9 A;  4G12 A;  1VFC A;  4X1E A;  1VI0 A;  4B1R A;  4DW6 A;  4D5F A;  1BJZ A;  4A3G J;  3JRA A;  3GTL J;  2VPR A;  2HOA A;  1FIA A;  5M5Y J;  1RR7 A;  2LVS A;  1ETY A;  5M5X J;  4GFB A;  4V2G A;  4A69 C;  4ABZ A;  2CU7 A;  3ZOB A;  3HOU J;  1NTC A;  2JWT A;  1DU0 A;  1FEX A;  1Q1V A;  2LK2 A;  3A01 B;  4IEJ A;  3CQZ J;  1JJ6 C;  2DA6 A;  3SFI A;  1ETX A;  3TW6 A;  3CCY A;  2I10 A;  3LSG A;  2K9N A;  3BTJ A;  3RKQ A;  5C4X J;  1T33 A;  1H88 C;  5FLM J;  1F36 A;  2TCT A;  2HYJ A;  1ENH A;  2E2J J;  4A3F J;  1ZTR A;  1NK3 P;  1P7I A;  3JRI A;  2CRG A;  1RES A;  2DN0 A;  3NAR A;  2DMP A;  2ME0 A;  3E7L A;  4C3I J;  3HM5 A;  2WAQ N;  4IHW A;  1OJL A;  2JN6 A;  3LSR A;  2JA6 J;  1GV5 A;  1A5J A;  2DMU A;  2XGD A;  3BT9 A;  5BNG A;  2JMW A;  5IOZ A;  3OSF A;  3Q0W A;  3FKI J;  5IYC J;  2HOT A;  4M3F A;  2G0E A;  3FIW A;  1JKQ C;  2XPW A;  2FX0 A;  2Y31 A;  5C3E J;  4DYQ A;  1POG A;  4M3D A;  2JK3 A;  1ETW A;  2DTZ A;  3MVP A;  2DA1 A;  1PUF B;  3I4M J;  4JX4 A;  1F43 A;  1IUF A;  4JX5 A;  2YUS A;  2IEK A;  1ZR4 A;  3WHC A;  2QCO A;  3S1M J;  4Y7N J;  1LFU P;  2CUE A;  3BTI A;  1CQT A;  3BR0 A;  3H3V K;  2N8G A;  2COB A;  3ZQI A;  4I76 A;  2GBY A;  5IP7 J;  3GTO J;  3RZO J;  2GM4 A;  2L9R A;  4J19 A;  1ITY A;  2NVQ J;  4D5C A;  2M8G X;  3HOV J;  4I6Z A;  1JUP A;  2DA4 A;  4FE4 A;  1QPI A;  1K83 J;  4QIW N;  4MLO A;  4EEF G;  2IBD A;  5M3F J;  1JKP C;  1RPW A;  1SAN A;  3C2B A;  3PO3 J;  3L1P A;  1NK2 P;  1MBG A;  2EZI A;  3S15 J;  4B4C A;  2Y9Y A;  2WB1 N;  5F0F A;  1LFB A;  2M0C A;  3Q3S A;  3B6C A;  3BR2 A;  4DYR A;  1WCM J;  2LTP A;  2NS7 A;  2NVX J;  3K7A J;  3HOX J;  3HEF A;  4M6V A;  1X58 A;  2EH3 A;  2H1K A;  1X2N A;  2LP0 A;  1WH7 A;  1H89 C;  2DA7 A;  2QF7 A;  2HXO A;  5E3O A;  3M4O J;  3LSJ A;  2MG4 A;  2HDD A;  2YS9 A;  5F04 A;  1MBH A;  1UMQ A;  3ZQF A;  2K9S A;  3QQA A;  1VF9 A;  5K7F A;  4BXX J;  3BTL A;  5J1U A;  1MNM C;  2XRL A;  3JRB A;  5FKM A;  4M3G A;  5EZH A;  5E3N A;  2HOS A;  2CQX A;  3CDL A;  1FTT A;  3JRC A;  1GVD A;  1W0U A;  3JRH A;  2LR8 A;  1B72 A;  1EF4 A;  3BG5 A;  4A93 J;  5F0H A;  4DYC A;  1G2H A;  2HI3 A;  2E2I J;  1GT0 C;  4BKX A;  4A3E J;  1ZK8 A;  2VI6 A;  1GDT A;  3B6A A;  5EZG A;  2ID6 A;  2XGC A;  5EDN A;  2CJJ A;  2JJ7 A;  1WPK A;  1U78 A;  4A3C J;  2AO9 A;  3TP3 A;  1E3O C;  4S0H B;  3GTJ J;  2NVT J;  5DTD A;  4MO7 A;  2MW8 A;  2K9Q A;  4B3A A;  2M9H A;  5F27 A;  5M5W J;  4BBS J;  4Y52 J;  4A3J J;  1VND A;  2ZB9 A;  3HGY A;  3TW7 A;  4C2M J;  5K7Z A;  4IHV A;  1IDZ A;  2K40 A;  2L7Z A;  4A3I J;  1UG2 A;  2R0Q C;  4X6A J;  2O8K A;  5GPC A;  1U9O A;  1UHS A;  1JUM A;  1LE8 A;  4UUT A;  3HKZ N;  2E1O A;  3S2D J;  1JKO C;  5EF6 A;  1BW5 A;  5M3M J;  1U8B A;  3IH3 A;  2E2H J;  2L0K A;  1DU6 A;  1AKH A;  5F08 A;  5FJ8 J;  4XIC A;  3HBL A;  5FLV A;  3BQZ A;  3IH2 A;  2R7Z J;  5JLX A;  3GTK J;  2X6O A;  1AHD P;  5EYR A;  3SJM A;  3LNQ A;  2YU9 J;  3S14 J;  5E3M A;  4FE7 A;  3JRE A;  1SFO J;  3BG3 A;  1TWH J;  5C4J J;  3S16 J;  3FK7 A;  3S1N J;  1XS9 A;  4QSH A;  2XB5 A;  1IGN A;  1H8A C;  3G1L A;  4D7N A;  4AC0 A;  4MFE A;  2AHQ A;  3BR1 A;  5IYD J;  4XID A;  2ECC A;  3GTG J;  3Q0U A;  1I50 J;  2JA5 J;  1HOM A;  2MSY A;  4A3K J;  2EZK A;  5IPA A;  1ETK A;  2WV1 A;  1JJ8 C;  3LOC A;  3UKG A;  2O7O A;  3G1O A;  1XG1 A;  3OOU A;  2EZL A;  1FIP A;  1JUS A;  2KT0 A;  1IRZ A;  1TC3 C;  5J1Y A;  1IV6 A;  4XK4 A;  3TP0 A;  1GUU A;  1B72 B;  1QVU A;  2FJ1 A;  4LOC A;  2EZH A;  2L7M P;  1ZKG A;  1MSE C;  2FD5 A;  4AYB N;  5IYB J;  1Y1V J;  2DMN A;  3D1N I;  2GLO A;  3QPS A;  3A03 A; 
#chains in the Genus database with same CATH topology
 1U5T C;  1RKW A;  1W7P D;  2UXX A;  4UHT A;  2QBY B;  1WZ2 A;  3VDX A;  5J47 A;  3CDH A;  2M2E A;  3BDD A;  4XOP A;  1OYY A;  4M3E A;  5K5O A;  5HOD A;  3GEZ A;  3RZD J;  2QGU A;  1K79 A;  1U2W A;  5DDG A;  2QKL B;  1OCO H;  2V9P A;  5CPR B;  1X2M A;  5DUI A;  1IXR C;  2KQR A;  1BC8 C;  1D0X A;  3RQI A;  1EH7 A;  4II2 A;  1FP1 D;  5C44 J;  4Y17 A;  5IP9 J;  4A3D J;  4E7Z A;  2KKO A;  3H35 A;  1YLF A;  2ESH A;  5HDN A;  5L3C A;  3J81 K;  4U88 A;  4EVI A;  3ZQQ A;  3LSP A;  2RN7 A;  1BIB A;  4HF0 A;  2Q8K A;  3U1D A;  3EDP A;  1JT0 A;  2JSC A;  3T1B A;  1IDY A;  4ENJ A;  4XKV A;  1TWF J;  2LKX A;  3QP6 A;  2DA3 A;  1TW2 A;  4RDU A;  2M0M A;  1F4K A;  3OYB A;  1OQY A;  2Y9Z A;  4BE2 A;  1QQI A;  1QZY A;  1A36 A;  3FIS A;  1TWA J;  4EM2 A;  5KAF C;  1MDM A;  2P5V A;  4UUS A;  3DBH B;  5ICC A;  4C9Y A;  1EV7 A;  1Z77 A;  3NWS A;  1SFX A;  3ABK H;  2XSJ C;  1J2X A;  1GXQ A;  2RVC A;  1XCB A;  3U9G A;  3FDY A;  3RJP A;  2R3S A;  4FTH A;  1HDD C;  1KU7 A;  1HF0 A;  3KP3 A;  1B8I A;  2XAG A;  2DDB A;  2JSP A;  3B02 A;  3S1R J;  1FX7 A;  3I58 A;  2XKO A;  2H09 A;  3CLO A;  3SDG A;  1FYK A;  4LLG F;  2JA7 J;  3L00 A;  3HOZ J;  4MIM A;  2MYS A;  4C2U A;  5IP6 A;  4CCM A;  1JTY A;  1P9Q C;  5BS6 A;  4N4N B;  1KYW A;  2ECB A;  2ZFU A;  3F8C A;  2I5U A;  2AQF A;  2ZXH A;  4HV6 A;  4XR6 A;  2H8R A;  4XNF A;  1YW8 A;  4GCV A;  1IG7 A;  1ZG1 A;  3BJ6 A;  2IA1 A;  3A01 A;  4IHS A;  2GAU A;  1MJA A;  3G1M A;  3K4B A;  4HSR A;  2ID3 A;  1DP7 P;  1XCV A;  1LFP A;  4U7B A;  3JSP A;  1BL0 A;  3GBG A;  1T56 A;  2CQQ A;  2M5W A;  2KRC A;  1G3S A;  2BW3 A;  1GV2 A;  2XGX A;  4ZYG A;  3W2A A;  4QPO A;  2WV0 A;  4XMY A;  4OAY A;  2IP2 A;  3BR5 A;  2ELK A;  2RNJ A;  2CFO A;  2WTE A;  1LJ9 A;  2P4W A;  1QHG A;  4KA4 A;  5FKL A;  1WH5 A;  5EEH A;  1TW3 A;  4M9Z A;  4DBR A;  1LVA A;  4KN7 X;  2EBI A;  2F4I A;  2O5R A;  1SVL A;  2QSG X;  2G7H A;  1EH6 A;  1BJA A;  1HDP A;  2H1L A;  1WRJ A;  3M8J A;  5GPA A;  5TJJ A;  4WXC A;  3K4M A;  4OU0 A;  1CF7 A;  1JTX A;  2HQ5 A;  3RPU A;  4B44 A;  1S9H A;  1D8J A;  3QP5 A;  1DPU A;  4MTD A;  1Y0U A;  4BS9 A;  2CGP A;  3SHF A;  2DMT A;  1DP3 A;  2DOE A;  2RV8 A;  4NDL A;  5D6F A;  2DT5 A;  1RET A;  2ESN A;  4BU2 A;  3CP2 A;  2M1B A;  5L3D A;  1J5Y A;  2DQR A;  1K61 A;  2FU4 A;  1QHH D;  2MFZ A;  2K5C A;  3ZR8 X;  2R7Q A;  3DCF A;  3QU6 A;  1RKT A;  3E1S A;  2B63 J;  3GTM J;  3J80 K;  3IH4 A;  3H9J A;  1ETQ A;  3K1P A;  2O9L A;  4PUS A;  4XLN F;  2AQE A;  3SEQ A;  2PJP A;  3CC4 I;  2DA2 A;  2ZSH B;  1WJD A;  4RB0 A;  1QZZ A;  3QYB A;  1K78 B;  3KEY A;  1U5T A;  2CYY A;  3KCC A;  3TO9 A;  4HNU A;  1LPQ A;  4P55 A;  5J3L A;  5IOY A;  3BR6 A;  3D5R C;  4G12 A;  2VE9 A;  4X1E A;  2I8D A;  2ZJQ F;  1J0R A;  2R4G A;  4D5F A;  2Q1Z B;  2X4H A;  3JRA A;  1UAA A;  3GTL J;  3BP8 A;  1TNS A;  3F72 A;  2ICW G;  2VPR A;  1FIA A;  3H5R A;  3LA7 A;  1RR7 A;  2FSW A;  4MQ9 F;  3VYS B;  3A4C A;  4AIK A;  2COM A;  2NXN B;  3V7S A;  3HOU J;  3F8N A;  4QLC U;  3SYT A;  3DPU A;  1RUN A;  5CLS A;  1XGO A;  1PVE A;  3SFI A;  4ZH4 F;  4CHU A;  2KHM A;  3GUD A;  2DFI A;  2X51 A;  5JFR A;  2R7S A;  4L9J A;  3R0J A;  2VAS A;  2VOD A;  2OQG A;  5C4X J;  1T33 A;  4PJN A;  4YFN F;  1F36 A;  5J6X A;  4LLN A;  5FLX K;  1LDJ A;  1R1T A;  1HST A;  2NAZ A;  1W36 D;  2GZW A;  3OYN A;  2QEX I;  2CRG A;  3L2C A;  1MGT A;  2DN0 A;  3ZMS A;  1XGM A;  3H9G A;  4AU7 A;  4C3I J;  1VQM I;  1FNN A;  3HM5 A;  4IHW A;  3LSR A;  2JT1 A;  4UXN A;  1HKQ A;  1A5J A;  2XGD A;  3BT9 A;  5DCM A;  2X1C A;  5BNG A;  3F21 A;  4B43 A;  2P8T A;  2M7B A;  3SZT A;  1IZ1 A;  3FKI J;  2HOT A;  2XDV A;  1I1S A;  3WGG A;  5ILS A;  2X6Y A;  3FIW A;  1ON1 A;  4Z2Y A;  4KT5 C;  3CJR B;  2EFP A;  3V4G A;  1POG A;  4M3D A;  3OS2 A;  3QRF F;  3L2Q A;  4DGW B;  2F5D A;  3MVP A;  3CO6 C;  2QA4 I;  2A5W A;  5GTI C;  1JGS A;  1F43 A;  2QCO A;  3S1M J;  1QO0 D;  5J4Y A;  1SFE A;  2ETH A;  2CUE A;  3BTI A;  4M6X A;  2N8G A;  4H0E A;  3GTO J;  3F9K A;  4LG0 B;  4XQF A;  1HKS A;  3E5U A;  1E2X A;  1PUE E;  4J00 A;  4LGW A;  2GA2 A;  1ULY A;  4FE4 A;  4I02 A;  3NWT A;  4OIN F;  3BZ6 A;  1GHC A;  4I7H A;  4MGR A;  5HS8 A;  4BQA A;  3ZRG A;  2M4K A;  4ZYH A;  3MEX A;  2ZSI B;  2EZI A;  3S15 J;  2LG4 A;  4HW0 A;  2LBF A;  3CJN A;  5F0F A;  2L7K A;  5GAG J;  3BR2 A;  5J8F A;  1BR1 A;  1WCM J;  2XRN A;  4YRV A;  1M1E B;  2E1M B;  3KZI C;  4LD5 A;  3BCB A;  2GQQ A;  1R1V A;  2KJB A;  3I53 A;  3HOX J;  1HW1 A;  3ZMZ A;  1FOK A;  2L01 A;  2PMZ A;  3FXR A;  3IKV A;  5HDK A;  3EUK L;  2MH2 A;  1YJW I;  2CWE A;  2FML A;  1VQ6 I;  2DA7 A;  2DTR A;  1UHM A;  4OWR B;  5E3O A;  2DK8 A;  4BJ6 C;  2XIG A;  3PQJ A;  2W25 A;  1TT0 A;  5F04 A;  1MBH A;  2OTL I;  1MJB A;  1N77 A;  3CJT B;  3PQK A;  3GZ6 A;  3WE3 A;  3ZN0 A;  1PP8 F;  4BXX J;  1OCZ H;  2VT3 A;  3BTL A;  5J1U A;  3BZK A;  4LB6 B;  3C18 A;  3JRB A;  1WVR A;  3BZC A;  5ED4 A;  1J09 A;  2AXL A;  3WTU C;  3FHN A;  3E0J B;  1W0U A;  4F91 B;  1L0O C;  2ZJP F;  5TIS C;  4ZTF A;  1P4X A;  3RKW A;  2HZD A;  4OAZ A;  3MZY A;  4R79 A;  1NH3 A;  5LD2 C;  2JPB A;  2VI6 A;  2HS5 A;  1WI9 A;  3UR3 C;  1DUX C;  1P4W A;  4KUM A;  3FMS A;  1ZRC A;  4GRI A;  2JJ7 A;  3RTR A;  2QBY A;  4P96 A;  2FOK A;  1J7K A;  4A3C J;  2UWM A;  3TP3 A;  3K4L A;  3E6B A;  3HSR A;  1UFM A;  3GTJ J;  2VT2 A;  1A04 A;  3DLA A;  3JAM K;  2MW8 A;  4L9V A;  5E20 A;  5F27 A;  3CZ6 A;  1GXP A;  2FMY A;  4A3J J;  5DYM A;  2ELH A;  2ZB9 A;  3HGY A;  3TW7 A;  4IHV A;  4XL9 A;  5K7Z A;  3OIP A;  4AM3 A;  4RM2 A;  2VKH A;  5GPC A;  3V8K A;  2GIZ A;  5CYV A;  3OR1 C;  2MD5 A;  2OBP A;  4UVA A;  4D0P A;  4WCG A;  2W85 A;  2BXZ A;  2VPL A;  3A2K A;  2JRT A;  1VZ0 A;  2L0K A;  2VKD A;  1KU2 A;  2STT A;  3TGN A;  4CCK A;  1XD7 A;  5F08 A;  3CMA I;  5JI6 A;  2VOP A;  1WHU A;  5L3E A;  5FLV A;  3KYC B;  2XAF A;  1VQ4 I;  2A6E F;  2LDU A;  2R7Z J;  4JOM A;  3VYR B;  5JLX A;  2OD5 A;  1FMW A;  4XLF A;  1KON A;  2FE3 A;  2YU9 J;  3S14 J;  5D4S A;  4NHJ A;  4LIU A;  5E79 C;  3U1K A;  1TWH J;  2V1X A;  1RUO A;  2OJE D;  1XB4 A;  3ROU A;  3SQN A;  3FMR A;  3E5Q A;  1H8A C;  4CYD A;  2K9M A;  2IA2 A;  3RQ4 A;  3X2Q H;  4RAG A;  4KIF A;  4MFE A;  4EJO A;  5B5E C;  4LK0 F;  4EJV A;  3AG3 H;  2O3F A;  3DP7 A;  1IW7 F;  1YE9 A;  2DU9 A;  3LSI A;  3TDU C;  1SAX A;  1B59 A;  1Z67 A;  2Z1D A;  2EIM H;  3IRQ A;  3DFG A;  1SD4 A;  1JJ8 C;  4CXF A;  2O7O A;  2W82 A;  3G1O A;  5AIP A;  1X3Z B;  1QNT A;  2EZL A;  2D2W A;  1FIP A;  1DQU A;  5J1Y A;  1GUU A;  4CCO A;  4I2O A;  1R5H A;  4LOC A;  2CQ7 A;  1B9M A;  4D9J A;  3C7J A;  2WAF A;  2DMN A;  5HOO A;  4Y33 A;  2TRT A;  4XRS G;  1WJA A;  4KN4 X;  1BOA A;  4G7H F;  2G9W A;  2MAB A;  5LLQ A;  1C0W A;  1Y56 A;  3W3C A;  4I0A A;  1SMT A;  4NC8 A;  1ZHF A;  3C2H A;  2LRE A;  1O3Q A;  1MBK A;  2QM3 A;  2P81 A;  3NAU A;  1HLV A;  2AS5 F;  5FKN A;  2UZK A;  1Z9C A;  4CIC A;  3RIR A;  3M7G A;  1JKR C;  2DA5 A;  3OS1 A;  3CUO A;  1SMY F;  2ME6 A;  2VON A;  2E1M C;  2Y30 A;  3MN2 A;  3HHG A;  2HNH A;  1SFU A;  2ISZ A;  1KQ0 A;  2WC2 A;  1XSD A;  4W1U A;  3OL4 A;  1SVM A;  1MZB A;  1YW7 A;  4BY1 J;  1W7P B;  1TLH B;  1UJ8 A;  2QKM B;  3O8G A;  4XLC A;  3GX4 X;  1MMD A;  2DFH A;  3ZCO A;  2RAE A;  3LAP A;  1E17 A;  1NHA A;  2X9D A;  4XLA A;  2XGE A;  4D7M A;  2CO5 A;  5A2Q Z;  4AVZ A;  4XLH A;  4A0Y A;  5E8I A;  3WU1 B;  1HBX G;  1U6G A;  2Y69 H;  1TQI A;  2VOO A;  4YFX F;  3CF2 A;  3DEW A;  3PFI A;  1FOX A;  4F93 B;  4G6T B;  4O3M A;  3KFW X;  2P5L C;  3OYA A;  1XDU A;  3IL2 A;  2DJN A;  3BRO A;  2CMP A;  1K6O A;  2CQN A;  1HXD A;  1IN5 A;  2X1D A;  3KP5 A;  2MGQ A;  1ZYR F;  2HYG D;  2QSF X;  1FOW A;  5JLW A;  2R92 J;  4BE0 A;  2DK5 A;  1WKM A;  2WY8 Q;  5IY5 H;  1I3Q J;  3ASN H;  2RGV A;  2IA0 A;  3FK6 A;  4A5N A;  1K78 A;  4A5M A;  2A6H F;  1IN8 A;  4L18 B;  2VUM J;  2RKH A;  1T95 A;  2HQA A;  2RRE A;  3I0T A;  4CO8 A;  2FNP A;  5KAI C;  2H6C A;  3AG2 H;  1A6I A;  1W5T A;  1BC7 C;  1WJ5 A;  2LD5 A;  4JX6 A;  1X19 A;  3FM5 A;  1FBS A;  1FJL A;  2IXS A;  3HKZ A;  3W6V A;  1T6S A;  3GLL A;  5ILU A;  3QYF A;  1WFX A;  3P7N A;  4JYK A;  3BC8 A;  5CJ9 A;  5J1R A;  4JBA A;  1ETO A;  1JE8 A;  1QVT A;  1Z0X A;  5EG0 B;  4GO1 A;  5DM6 F;  3K2A A;  1MBE A;  4AWX B;  2PI0 A;  5CVR A;  3VSK A;  4M6Y A;  3H36 A;  3F8F A;  3I71 A;  4NBQ A;  4XRS A;  1S7A A;  4LIT A;  3J7A O;  1ZQ3 P;  2GA1 A;  2Z99 A;  2PG4 A;  3C1D A;  5F0C A;  3DTI A;  2XSD C;  3SFZ A;  2R5Z B;  2JA8 J;  3GF2 A;  5FKO A;  3HC7 A;  4IQ4 A;  3I5U A;  4F92 B;  2OCC H;  5F1R A;  1ERD A;  4C3H J;  1Z91 A;  3TKY A;  2HVR A;  4CZC A;  2CH0 A;  4ETS A;  4ZTJ A;  4E7S A;  2VKE A;  3C3W A;  3FZV A;  1NG6 A;  1TL8 A;  3HSF A;  1W5C C;  2ISY A;  2XPV A;  1B6A A;  1EH8 A;  4KIS A;  3U21 A;  3ZMD A;  4DZJ A;  1OCP A;  1ZRE A;  2DMQ A;  2D5V A;  2CS3 A;  2DCE A;  1IF1 A;  2L02 A;  3PJR A;  4PK4 A;  2R7U A;  1YW9 A;  1TQM A;  2R5Y B;  1TBX A;  4M9X A;  3J7Z I;  4OMY A;  3IKT A;  3K4K A;  1ZG5 A;  2G7U A;  4ESJ A;  4NUB A;  1S29 A;  1IV8 A;  3OYF A;  1R4N B;  2A6T A;  1Y1W J;  4WX9 A;  2D1V A;  4BQQ A;  1V54 H;  5D5W B;  1HW2 A;  2A05 A;  3B73 A;  3CCV I;  4CYC B;  5CVV A;  2QQB A;  4V2F A;  3V8J A;  3BTC A;  4DNC A;  2EFO A;  1MBF A;  1OKR A;  1TT5 B;  1OFC X;  1UST A;  1J59 A;  4JP0 A;  5FGM A;  4AYB A;  3K69 A;  2EIK H;  5F1J A;  2R93 J;  1FBU A;  1SVO A;  2E5Z A;  3F22 A;  5KHD A;  3ABL H;  3ZN1 A;  3I55 I;  1I3A A;  1WJC A;  5HS9 A;  2KIS A;  5D5U B;  3CCU I;  2NOJ B;  3E6M A;  4LG0 A;  5KK1 A;  1MMN A;  3HRU A;  2DLL A;  1ZAR A;  3LMM A;  3OWT A;  4LLL A;  2L9N A;  4A3M J;  4G9Y A;  1YRN B;  3Q0V A;  3L2V A;  3V7R A;  2NOG A;  2HQR A;  3BQY A;  1VFC A;  2OAZ A;  2VC1 A;  2H6B A;  1MMG A;  1DGR M;  4KIG A;  4A3G J;  3WGI A;  4HZF A;  4KDP A;  3TQN A;  1R1U A;  1T8I A;  5CQG A;  3R61 A;  4YIF A;  3K10 A;  2DW4 A;  3F6O A;  3KZY A;  4A69 C;  3ZGK A;  4O5V A;  4ABZ A;  1RC9 A;  3VOE A;  2FA5 A;  1NTC A;  2YU3 A;  4HLY A;  5E1X A;  4CCJ A;  3MKZ A;  1DU0 A;  3GFJ A;  2EV5 A;  2LK2 A;  3OOP A;  3CQZ J;  1JJ6 C;  1UCR A;  3CCY A;  4U87 A;  4HST A;  1T0F C;  2P0W A;  3LSG A;  3WTS C;  2K9N A;  2ZJ2 A;  1OMI A;  1S72 I;  5HDG A;  1ZH5 A;  3RKQ A;  1YIT I;  1H88 C;  1R23 A;  3G2B A;  4M73 A;  2TCT A;  2HYJ A;  1ZN2 A;  5KNL A;  1ENH A;  2E2J J;  1ZTR A;  2ZXJ A;  3K9T A;  2VL8 A;  4PSX A;  1CGP A;  2ME0 A;  2DDA A;  3KP2 A;  3MKW B;  1OJL A;  2JN6 A;  4G94 A;  1D5V A;  3GO5 A;  3W6J B;  5IOZ A;  4Q5S F;  2D1H A;  3O3K A;  3FHZ A;  1YI2 I;  3CME I;  2L2O A;  1UEL B;  4M3F A;  1JKQ C;  2XPW A;  3DKW A;  2V9V A;  4O6J A;  4B48 A;  4F3Q A;  4RAF A;  1DGW Y;  3LSH A;  3HOS A;  2XHK A;  4GYG A;  5BOX A;  3M1E A;  1PUF B;  1XMA A;  2YPR A;  1ZGJ A;  2A69 F;  4JX4 A;  4UV8 A;  1RR8 C;  3K4N A;  2YUS A;  2IEK A;  1LNW A;  4ENK A;  1BN5 A;  2WAE A;  3ISP A;  4I76 A;  1FMV A;  5H6Q A;  4J19 A;  4IZZ A;  4NC6 A;  1JI8 A;  2NVQ J;  4WXD A;  2W7N A;  4KFC A;  3HOV J;  3K4J A;  4RAZ A;  2DA4 A;  3HPG A;  2PMH A;  3PNV A;  1BIA A;  2R7T A;  1LDK B;  4KYW A;  3GWZ A;  4EEF G;  4E7H A;  5M3F J;  4HX8 A;  3GW2 A;  3MKY B;  4BGD A;  2UUZ A;  1SAN A;  1R6R A;  5DV5 A;  1R5I D;  3M9A A;  2NVU B;  3CC7 I;  3L1P A;  1NK2 P;  3VYU B;  1R22 A;  4HF1 A;  2ZNZ A;  3P5J A;  2GXG A;  3OV8 A;  1I39 A;  2Y9Y A;  1JXS A;  2WB1 N;  2GWR A;  3V8L A;  5ICG A;  2M0C A;  2MD0 A;  1Y6I A;  2ZXW H;  4N0B A;  2HU9 A;  5FD5 A;  3L2W A;  2GXA A;  1KYZ A;  1Y39 A;  5LGT A;  4QPQ A;  3BY6 A;  3VWB A;  3ASO H;  2WBM A;  3HUG B;  1YX3 A;  2NS7 A;  2NVX J;  3K7A J;  4FET A;  5B66 C;  2BY3 A;  5CKT A;  5JHU A;  3BJA A;  3EUA A;  1BOB A;  2A3S A;  3I54 A;  2KPM A;  2JTV A;  2LP0 A;  3ML6 A;  4ZZD A;  5CQE A;  2Q2E B;  5B1A H;  5J40 A;  4IOC F;  4BDZ A;  3M4O J;  1EKE A;  2HDD A;  3BPV A;  4XOT A;  2EIL H;  1OLT A;  3ECH A;  3W2V A;  3IWF A;  1K6Y A;  1UMQ A;  4DOZ A;  2BHZ A;  3AAF A;  3RSN A;  3QQA A;  1IN7 A;  1YX5 A;  2KLO A;  2QYO A;  5K7F A;  1MNM C;  2XRL A;  3IP4 B;  2ZME B;  5E3N A;  2QVO A;  3A0H C;  4JK1 X;  3CDL A;  1FSH A;  2OCE A;  2V1N A;  1KZH A;  4IRH A;  3JRC A;  4OIR F;  4X0G A;  1B1B A;  3JRH A;  5AIQ A;  1EF4 A;  3BG5 A;  4B09 A;  3WTY C;  1G2H A;  2HI3 A;  3CCE I;  2E2I J;  4A3E J;  1IUY A;  3NQO A;  4K2E A;  2MLG A;  2Y75 A;  2FBI A;  3KZZ A;  2E71 A;  4V19 K;  1Z1D A;  2W4S A;  2FXA A;  1XMX A;  2Z3Y A;  3BG7 A;  5EZG A;  5GAH J;  2KZG A;  2MC3 A;  3QOE A;  3S32 A;  2IGK A;  3ZPL A;  3FBN B;  3VEP A;  1U78 A;  2AO9 A;  3CES A;  4L0Y B;  5DTD A;  1VQP I;  1PDN C;  5F6F A;  2Z5U A;  3ABU A;  2K9Q A;  3LFU A;  3H1C A;  3WU0 A;  5TRD A;  1G6N A;  2HZT A;  1WJF A;  1YS7 A;  4BJT A;  4Q4Z F;  1R71 A;  1IDZ A;  3GVA A;  2K40 A;  2L7Z A;  4RGX A;  4OIO F;  3AL0 B;  3H9Q A;  2XAQ A;  2R0Q C;  2PMU A;  2P5K A;  1R58 A;  1RZ4 A;  2VIX A;  2QLZ A;  2E1O A;  3BWG A;  2XRO A;  1HQC A;  3OYE A;  5EF6 A;  2BZT A;  1YTY A;  1K4S A;  4L0Z B;  3WG9 A;  3OMY A;  3SXY A;  1W7P A;  3QYE A;  3FKJ A;  2WY7 Q;  1FT9 A;  2W57 A;  1TP4 A;  2DFF A;  3MFK A;  1TQP A;  3ESW B;  4G7O F;  1I6X A;  2MA3 A;  1T0F A;  3HBL A;  3BQZ A;  3QOD A;  1U0J A;  3A0B C;  4UY8 I;  3N05 A;  5EYR A;  3LNQ A;  2E7W A;  2EIJ H;  4RB2 C;  5FFZ A;  1SFO J;  3ZP5 A;  3BG3 A;  5C4J J;  1RI7 A;  4CH7 A;  1FOY A;  4BXF A;  4HA8 A;  3LL7 A;  5FFX A;  3GZ5 A;  4DBQ A;  1IGN A;  3RKX A;  3NEU A;  2KMU A;  3G1L A;  5DEQ A;  2OUM A;  4D7N A;  3F23 A;  3OYK A;  1G3T A;  2ECC A;  1AWC A;  3I3L A;  2JA5 J;  1HOM A;  1YHQ I;  3EET A;  3BPX A;  2CUZ A;  4OMZ A;  2ZCW A;  1T38 A;  2Z9O A;  4BNC A;  2WV1 A;  1DDN A;  3KPH A;  3ELK A;  1V5G A;  3HIF A;  3CUQ B;  1XG1 A;  2JA2 A;  4PCQ A;  1W36 C;  1VQN I;  1JUS A;  2KT0 A;  5E18 F;  1TC3 C;  2KRH A;  2PX9 A;  3FXU A;  1G3Y A;  1I27 A;  5AON A;  4FAS D;  3TP0 A;  1B72 B;  1P2F A;  2FJ1 A;  3ABM H;  1ZKG A;  2XVC A;  2O6G E;  3D1N I;  2PLY A;  2MLK A;  3E3V A;  5LEK A;  4MQV A;  2GLO A;  3VOD A;  2CV2 A;  3A03 A;  4I01 A;  3F3X A;  3HRS A;  5EG0 A;  4DJA A;  2L5Q A;  2LOO A;  4IRI A;  3JRD A;  2NNY A;  5BPD A;  3I4N J;  1PP7 U;  2HPI A;  1IC8 A;  2KL4 A;  3H5A A;  3DWL E;  2R5Z A;  2CUF A;  1MNE A;  5HLG A;  2DPU A;  1WGX A;  2JUC A;  2BYV E;  3MZ8 A;  4HNV A;  2L7F P;  4LG3 A;  1O4X A;  2IW5 A;  5H20 A;  2LC2 A;  3A02 A;  1LE8 B;  3CCS I;  3E97 A;  2OPT A;  5IT9 Z;  2KDO A;  3M8F A;  3PO2 J;  2Y0S A;  1IXC A;  2FUG 2;  1QBJ A;  1AKH B;  2L4A A;  4BXU A;  4XON A;  2ZJR F;  3ZQL A;  2D45 A;  3VPR A;  2OZU A;  5DUK A;  1R5G A;  1FP2 A;  1X1C A;  5D5V B;  2R5Y A;  3TED A;  3HOW J;  2BVM A;  4YII A;  2XAJ A;  1QZE A;  5FRO A;  2HVS A;  3KP4 A;  3ZMU A;  3C2G A;  3ZMT A;  4HOB A;  3J7Y J;  1HW5 A;  2LLK A;  1BI0 A;  1O3R A;  5K5R A;  5J8C A;  2KIF A;  3GZN B;  4CYC A;  3WTX C;  2KP6 A;  3DU5 A;  3AKZ A;  1IJW C;  2A61 A;  3FBI B;  2HXI A;  1P4A A;  2BVL A;  1P7J A;  3CC2 I;  1MSF C;  3JR9 A;  3BG9 A;  4A3L J;  4XOR A;  5LGU A;  2H94 A;  2LF8 A;  4IXA A;  4BBR J;  4XKB A;  5ERI A;  4J01 A;  2IJL A;  4ESF A;  4DQ2 A;  2BHY A;  1X1A A;  4GGG A;  1I5Z A;  4E70 A;  3K4C A;  2XB0 X;  1VQ5 I;  1S3J A;  1Y0N A;  4XLE A;  3KP7 A;  2XF6 A;  3JRG A;  3DBL B;  2BW3 B;  2LY9 A;  3HPH A;  2EFW A;  3PUF A;  2V1U A;  1W0T A;  3ZQ7 A;  1O3T A;  2PQ8 A;  1YRN A;  2PFB A;  1U9N A;  5E1W A;  1JGG A;  1KQ8 A;  1X4O A;  1ZG3 A;  1Z3X A;  3FXL A;  2RDP A;  4CGZ A;  2V79 A;  1PJR A;  2WAQ A;  4ZC3 A;  1B4A A;  3F0C A;  1WI3 A;  2NRA C;  2FQ4 A;  4MEX F;  4YEJ A;  1AU7 A;  3PUB A;  4U7D A;  2XV4 S;  4KNY A;  2OZ6 A;  4U0Y A;  3ZQC A;  2E36 A;  3DF8 A;  3LQR A;  1SD5 A;  1QRY A;  2LNB A;  3WHB A;  4I99 C;  1R9T J;  4BDY A;  2Z16 A;  1LEB A;  3KLO A;  3MD2 A;  2DT6 A;  2L9V A;  2DOA A;  3E5X A;  4RLQ A;  2UV1 A;  2CW8 A;  2R7W A;  2VLA A;  4IHX A;  1I1G A;  4C3J J;  4RB3 C;  1Z05 A;  1FTZ A;  1LKX A;  3L2R A;  1ZR2 A;  2PBI A;  4LIV A;  1ZGW A;  1HSJ A;  2J5O A;  4IQJ A;  1R00 A;  4MNU A;  1S5L C;  4PGG A;  3GFM A;  2XPU A;  3SZG A;  1OCT C;  3QWL A;  2LKP A;  2KFD A;  4HX4 A;  3S3N A;  1FC3 A;  2OQR A;  3JRF A;  1TWC J;  3GTQ J;  1MKM A;  3O2P E;  2NS8 A;  3PM1 A;  1U5T B;  4ON0 A;  1W1W E;  2V9K A;  3K0L A;  2X0L A;  4PFO A;  4S04 A;  2B9S A;  2KRF A;  4RS8 A;  5LHH A;  1MBJ A;  2M34 A;  1BA5 A;  1UZC A;  3DXJ F;  3IWZ A;  5KCM A;  3OYJ A;  6PAX A;  5L3B A;  1H9T A;  2FRH A;  3FXK A;  5LRS A;  2WA0 A;  2RQQ A;  2X6W A;  1Q1H A;  3RPQ A;  2CG4 A;  1IN6 A;  3JTH A;  3I59 B;  2HDC A;  1IRX A;  2EFQ A;  3ERM A;  1RNL A;  2MBF A;  1FYL A;  1D8K A;  5CVI A;  4MFD A;  2K3P A;  4BY7 J;  1ETV A;  5EJC A;  3ZMV A;  3CUQ C;  5FKK A;  1PUF A;  2E1N A;  2ADU A;  1TZL A;  5EGO B;  2X48 A;  1VTN C;  2JVG A;  1XGN A;  4XN0 A;  2EPF A;  3HOY J;  2IS2 A;  4IHY A;  2E35 A;  2BBY A;  4ENM A;  4BHC A;  1KU3 A;  5GP9 A;  3EYY A;  5H6R A;  4EMS A;  4RBO A;  2R7D A;  1XMK A;  4GDF A;  3QOP A;  3JW4 A;  4IRG A;  5K7H A;  1GLN A;  4A6D A;  2LMD A;  2ZXI A;  4XRM A;  4CZZ A;  3DPT A;  5F64 A;  4IOA F;  2VQH A;  2HPM A;  4CUG A;  3DEU A;  1BJZ A;  4HEA 2;  2V4J C;  2V6C A;  4AD9 A;  1HC8 A;  3DQV C;  5A2Q K;  2HOA A;  3L7W A;  5M5Y J;  2LVS A;  1ETY A;  5M5X J;  3KP6 A;  2R7X A;  1G4D A;  3HUG A;  4KIT B;  2CU7 A;  3OYD A;  3PNT A;  2HGC A;  3ZOB A;  4EJW A;  3DV8 A;  3T8R A;  1JHF A;  3WTT C;  2CV0 A;  2O0Y A;  1FEX A;  2K4J A;  2E60 A;  2XC7 A;  5KVR A;  2DA6 A;  3OY9 A;  3OIQ A;  1ETX A;  3TW6 A;  1OR7 A;  4EJT A;  1ZLJ A;  1YG2 A;  2QWW A;  3M8E A;  4HLX A;  2Q2E A;  4RM3 A;  1IRG A;  2KIM A;  3RPU D;  1A31 A;  3L2U A;  4HYE A;  2L54 A;  2O8X A;  4ANJ A;  5TGT A;  1BR2 A;  4A0X A;  4AVP A;  2W1O A;  2YX7 A;  1USS A;  3RYP A;  4A3F J;  2DFE A;  1P7I A;  1U8R A;  4R8H A;  2F4M B;  1YIJ I;  1RES A;  3NAR A;  2HDW A;  3V42 A;  1R7J A;  2DYS H;  2ZME A;  3E7L A;  5JVT A;  3HHH A;  3ERE D;  5LEJ A;  3O6B B;  4XBF A;  4EM0 B;  4D1Q A;  3G73 A;  2DMU A;  3K70 D;  3BLY A;  1HA8 A;  3OSF A;  1IAW A;  4LMY A;  5B1B H;  4FX4 A;  2IGO A;  2AXT C;  5IYC J;  1LUJ B;  2LY1 A;  2Y31 A;  4A6E A;  3RYR A;  2CUJ A;  4IL6 C;  4RGR A;  5C3E J;  2EB7 A;  2VBW A;  4DYQ A;  1QPM A;  2JK3 A;  3VYT B;  1SEU A;  2DA1 A;  2PJR B;  2ELJ A;  5GAE J;  5JVG F;  3I4M J;  1IUF A;  3T8T A;  3CCJ I;  1Y8R B;  2F5C A;  2DOD A;  3GME A;  3WHC A;  5DD4 A;  2VBY A;  1K7A A;  2DI3 A;  2HKX A;  4E7J A;  2M8E A;  1YYV A;  2L9R A;  5E17 F;  4BQN A;  3OYI A;  1X1D A;  4XKW A;  4D5C A;  2F5E A;  4ZYE A;  1YQA A;  4M74 A;  3JSO A;  4ESB A;  3CCQ I;  1QPI A;  4RB1 A;  4UNO A;  4QIW N;  3QPH A;  1MW7 A;  2PN6 A;  1MD0 A;  4YFK F;  3NRV A;  2IBD A;  1JKP C;  3OYL A;  1RPW A;  1WJE A;  3SZP A;  3VSL A;  1ZRD A;  3MWM A;  3C2B A;  4N4O B;  4MTE A;  3TOB A;  3PO3 J;  4KIC A;  3W2W A;  4HDV A;  2P6S A;  4B4C A;  5IT3 A;  4B47 A;  4E4H A;  2QUF A;  3B6C A;  4DYR A;  2BXY A;  2W24 A;  4NC7 A;  4L9N A;  2RC4 A;  3I4P A;  2K3F A;  1P92 A;  4L9T A;  1RRJ A;  4BJ5 C;  3PFY A;  3FXQ A;  2EA4 A;  3HEF A;  3SDB A;  1H0M A;  3J7A Y;  4II3 A;  4M6V A;  3ULQ B;  4G8X A;  2K27 A;  5D6E A;  3GCM A;  5HVQ C;  1FZP B;  3LAJ A;  2H1K A;  1WH7 A;  4NB5 A;  4U0W A;  2BEO A;  1LVK A;  3CCL I;  3M1C A;  4Z6Y A;  3AG4 H;  4A12 A;  1H89 C;  1BI1 A;  2QF7 A;  2MG4 A;  2YS9 A;  3JTG A;  2E1C A;  3BCA A;  2VC0 A;  5J4V A;  2VQC A;  4BE1 A;  4UV9 A;  4CCN A;  5FO5 A;  3Q5F A;  3ZQF A;  4EV0 A;  2K9S A;  5H2F C;  1VF9 A;  3J81 Z;  1S6L A;  1V4R A;  3TBI A;  5FKM A;  3R4K A;  4M3G A;  5EZH A;  4BEH B;  3CUQ A;  1O7L A;  3TL4 X;  3DLL F;  2P7V B;  3IHU A;  4ZDO A;  1FSE A;  3EUH A;  4PZJ A;  4ZYD A;  4NQW B;  3ZXS A;  1GVD A;  3KE2 A;  2LR8 A;  3HRM A;  1B72 A;  1U3E M;  3IC7 A;  1IN4 A;  3FXJ A;  3WU2 C;  1NG7 A;  4S05 A;  4DYC A;  3D5S C;  3S2W A;  1GT0 C;  4LK1 F;  4E7I A;  3QAH A;  4A0Z A;  2GXB A;  1ACI A;  4KT6 A;  2DXI A;  1KA8 A;  4IHT A;  2XGC A;  4L5J A;  4P5O A;  5EDN A;  3CMM A;  3LFK A;  2FBH A;  4L5I A;  2E34 A;  3RDI A;  2JVH A;  2LKS A;  2EA2 A;  2M4G A;  4S0H B;  3OYC A;  1E3O C;  1KGS A;  1MJ9 A;  2IS6 A;  3L09 A;  1XSV A;  4FX0 A;  5DM7 F;  4NNJ A;  2LRD A;  4Y52 J;  2FQ3 A;  2WAD A;  2A07 F;  4B3X A;  4C2M J;  3TMO A;  1ZAO A;  5L3G A;  1TTY A;  3CJQ B;  4LFU A;  3CLQ A;  1UG2 A;  4I0B A;  2LY2 A;  2O8K A;  4IPA A;  1JUM A;  1LE8 A;  4UUT A;  4ASN A;  3S2D J;  1JKO C;  1BW5 A;  3IH3 A;  1SD7 A;  1DU6 A;  3F8B A;  2J5P A;  1AKH A;  1Z7U A;  5FB2 A;  1SD6 A;  2A68 F;  3HOT A;  5FJ8 J;  4XIC A;  1D0Z A;  4YG2 F;  4F55 A;  2K86 A;  3IH2 A;  2DOF A;  4TV7 A;  1FYM A;  3OR2 C;  3GTK J;  2X6O A;  3Q9S A;  2LH9 A;  3HL2 A;  2XF5 A;  5E3M A;  1X1B A;  3JRE A;  1ZEL A;  3HG9 A;  5LBQ A;  3S16 J;  2EV0 A;  3DBR B;  4QSH A;  1R4M B;  3WOD F;  2XB5 A;  2FBK A;  2Y0M A;  1MMS A;  4CCL A;  3U2R A;  5BPI A;  3CCR I;  3BR1 A;  4KIB A;  4XID A;  4HQM A;  4Q47 A;  3N4M A;  4Q48 A;  1I50 J;  3GTG J;  2BOL A;  4BAY A;  2JPC A;  4WF2 A;  5LHG A;  2MSY A;  3KEO A;  5FD6 A;  4A3K J;  2EZK A;  1GVJ A;  5IPA A;  2BY2 A;  2DQL A;  4IJA A;  3DEE A;  3UKG A;  4JQF A;  3TO6 A;  1P6R A;  1IRZ A;  3R60 A;  2H27 A;  2DBB A;  3CO7 C;  2CFX A;  1G3W A;  1H9G A;  2IPQ X;  1IV6 A;  1T2K A;  1HKT A;  3WTW C;  4EQQ A;  2DT7 B;  3LSK A;  3H0D A;  4UVC A;  4BHB A;  3GLX A;  2HTJ A;  3RI4 A;  1G8X A;  1J75 A;  2CW0 F;  1T08 B;  1F9N A;  2VQL A;  1IXS B;  3LST A;  4WK8 F;  1ZLK A;  1Z7L A;  4ZDP A;  2WB1 A;  1ON2 A;  1D5Y A;  3HGG A;  3PIO F;  1BW6 A;  4OIQ F;  5K5Q A;  1F1Z A;  1S7E A;  1MMA A;  1ZRF A;  3KYD B;  3J80 Z;  3GYH X;  3G3Z A;  1BR4 A;  3OIO A;  1EA3 A;  2ZBK A;  3HDD A;  4I98 B;  5EEA A;  3IV5 A;  1YIO A;  2EFN A;  3KYL A;  1VQ8 I;  2V1D A;  4UB6 C;  2FNA A;  4WXH A;  3ONQ A;  1A6Q A;  5ICE A;  4EGY A;  4A3B J;  3I9V 2;  2NNN A;  2QQ8 A;  1MH3 A;  2QQ9 A;  2W48 A;  3O8H A;  2TDX A;  3QPT A;  5E3L A;  3WTZ A;  2P7C B;  4MHG A;  3CP8 A;  3WGH A;  5L3F A;  2M87 A;  2M45 A;  3BOQ A;  3QPL A;  3RKY A;  3HXL A;  5EEG A;  1VQ7 I;  4PJ0 C;  3BR3 A;  4EM1 A;  5D8K B;  4HQE A;  1HCR A;  3I59 A;  1OPC A;  3E6C C;  1PYV A;  3DU6 A;  4ZJZ A;  4LB5 A;  2VBX A;  2ZNY A;  4M3B A;  2C6Y A;  1FPQ A;  1TWG J;  1X3W B;  2OF7 A;  4ITV A;  5EGO A;  4M71 A;  5K1Y A;  1R36 A;  2EQR A;  3H3U A;  3OYM A;  3CMY A;  4IKF A;  4IVN A;  2R7F A;  4RMN A;  5E8G A;  2EJR A;  4UB8 C;  3EPZ A;  4HAM A;  3S93 A;  5FLX Z;  3IAS 2;  2M30 A;  3P9K A;  2KDZ A;  3G71 I;  4QTR A;  1ODD A;  2WWY A;  4WWC A;  4PJM A;  4AUX A;  4XKC A;  3PL8 A;  1O3S A;  2A5Y B;  1AOY A;  2OV7 A;  2Z2S B;  5DS9 A;  3UNG C;  2IT0 A;  3Q9V A;  3ZQG A;  1ORK A;  1STZ A;  5ILV A;  2DPD A;  1XGS A;  1LEA A;  3D0S A;  1Z6R A;  3T0Y A;  2VXZ A;  4HRI A;  2E7X A;  3I56 I;  1YS6 A;  2O03 A;  3K2Z A;  3S2H J;  2STW A;  2HYF A;  1OYI A;  3GTP J;  1KU9 A;  5JR3 A;  2DO7 A;  2QQA A;  2F4O B;  4CSW A;  3CF5 F;  4W97 A;  4BAC A;  3H0G J;  2K9L A;  3M3Y J;  1XSX A;  4L5E A;  3S17 J;  3S1Q J;  3REO A;  4QWQ A;  4P1W A;  4HPQ A;  4PGH A;  2KIQ A;  2R7R A;  2VJ5 A;  4KMU X;  2DJI A;  1SFK A;  2VJ4 A;  3HZJ A;  4FCY A;  2Y48 A;  4PJL A;  5DD8 A;  3HJE A;  4HX7 A;  9ANT A;  3F6V A;  2IAI A;  4Y4R A;  4A2U A;  1FY7 A;  1I6H J;  2OTJ I;  4C2T A;  5E1Z B;  2CV1 A;  3OSG A;  5DCF A;  4C30 A;  3LA3 A;  2Y2Z A;  2XAH A;  1N25 A;  4OIP F;  2OU2 A;  4DZP A;  1ONV A;  4ZZL A;  2K7L A;  1JT6 A;  2B7E A;  3T5X A;  1MH4 A;  2BGC A;  5HLH A;  2PMZ N;  3ZQH A;  2X85 A;  4CA0 A;  1APL C;  5GAD J;  4Y15 A;  3JCU C;  2JQ7 A;  1XC5 A;  2E19 A;  4FT8 A;  3VFZ A;  2F5V A;  1MDM B;  3S3M A;  3EQL F;  4UUS B;  3DKX A;  3L9F A;  4GXO A;  2KIU A;  4FIS A;  2PJR A;  2YSR A;  2NVY J;  4BYY A;  4G6Q A;  3HTS B;  3GFI A;  2VKV A;  3PIP F;  4B8X A;  3MKL A;  4PSW A;  1D3Y A;  4XSX F;  3DTK A;  5HNH A;  3FXO A;  4AIJ A;  4XLP F;  2QSH X;  2W00 A;  1D1B A;  4U0V A;  5CVJ A;  1B8I B;  2IS4 A;  2LYC A;  3ABT A;  1O57 A;  4IO9 F;  4H4K C;  2IS1 A;  2BY0 A;  2LFB A;  1OIS A;  1V3F A;  2LF7 A;  1OR7 C;  2Y0S N;  2QEN A;  4HF2 A;  2IVM A;  3HTU A;  5IT9 K;  2F5F A;  2UXN A;  4E7K A;  1L3L A;  1WQ2 A;  3HB9 A;  1VI0 A;  4B1R A;  2YX4 A;  4DW6 A;  1T98 A;  3WE2 A;  3FM3 A;  3KIO A;  3W6K B;  3DKY A;  4RGS A;  1REP C;  3K1M A;  3ECO A;  2CQK A;  1D1A A;  2FEZ A;  2LSO A;  1V5F A;  1Z21 A;  2ZME C;  4HV5 A;  4GFB A;  4V2G A;  2HTS A;  1V5E A;  3FXM A;  1MND A;  1XTA A;  2EV6 A;  3TDZ C;  3BJO A;  4EAT A;  3V7C A;  1SC7 A;  2JWT A;  1Q1V A;  2XAS A;  3FMQ A;  3A01 B;  2DAO A;  2ZC2 A;  2ZKZ A;  4IEJ A;  4ZDL A;  3WG7 H;  3JAM Z;  3KLN A;  3G6E I;  1OYW A;  2I10 A;  3HYI A;  3LSM A;  3QU3 A;  1SAU A;  2K02 A;  3BTJ A;  2M3A A;  2EWN A;  1VQK I;  1LDD A;  2IGN A;  1EJ9 A;  2VXD A;  2VJJ A;  5FLM J;  4Y13 A;  2OA4 A;  4EGZ A;  1YJN I;  3RCO A;  5D4R A;  3HSE A;  3A1Y A;  1NK3 P;  3CD6 I;  4N9H A;  2ACJ A;  2MH9 A;  3CTA A;  3M07 A;  3JRI A;  2PEX A;  1R49 A;  4HNT A;  3OYH A;  2DMP A;  3MQ0 A;  4BEH A;  2WAQ N;  1YFH A;  4MEY F;  3KEQ A;  4UVB A;  3R6S A;  2L4M A;  2JA6 J;  1GV5 A;  4NQW A;  4BHP A;  2JMW A;  5HLT A;  1VQ9 I;  3AL0 C;  4LJZ F;  1V55 H;  3F8M A;  1IO2 A;  3Q0W A;  1CF7 B;  2G0E A;  3R0A A;  2FX0 A;  1FLI A;  2XAU A;  4G6D A;  4BH9 A;  4ZYA A;  2ZFW A;  4P9U A;  1ETW A;  1WJB A;  2DTZ A;  3N97 A;  2IRF G;  3AFH A;  1TNT A;  1BBY A;  4JX5 A;  2CW7 A;  2W84 A;  1MIJ A;  1VQL I;  1ZR4 A;  4AIH A;  3MAJ A;  4Y7N J;  1LFU P;  1QU3 A;  1CQT A;  3FF5 A;  4ENN A;  3BR0 A;  3TOA A;  3H3V K;  2COB A;  3ZQI A;  2X6X A;  5IP7 J;  2GBY A;  2HVQ A;  1YOV B;  2GM4 A;  3RZO J;  1ITY A;  4XRF A;  1BI2 A;  4GYI A;  2JUG A;  2M8G X;  4HDU A;  1W4M A;  2NYX A;  2H8W A;  1WSU A;  4I6Z A;  1JUP A;  2Q0O A;  3MZH A;  1K83 J;  2R7V A;  2KJC A;  4MLO A;  2DYR H;  2K85 A;  2XUB A;  3S8P A;  4M72 A;  2B0L A;  3K6G A;  1YJ9 I;  3FWE A;  3VB2 A;  3S3O A;  1QGP A;  2ZO4 A;  4HBL A;  5HLI A;  1MBG A;  4DIQ A;  2VB6 A;  3PSF A;  2HOE A;  3CDI A;  4XSZ F;  2JZY A;  1LFB A;  1W5S A;  3K1N A;  4HG2 A;  3Q3S A;  1YO5 C;  1DPR A;  2VQG A;  3PNY A;  1UB9 A;  1QA6 A;  4FQG A;  2LTP A;  1UHW A;  2MC4 A;  3COA C;  2EK5 A;  2IGM A;  4BL0 B;  3EUH C;  2P6T A;  3GXO A;  4I09 A;  2O61 A;  1X4P A;  2GIV A;  3D5L A;  3FX3 A;  5ICF A;  1X58 A;  3IAM 2;  4YEL A;  2EH3 A;  1X2N A;  1FWZ A;  1E0E A;  4RGU A;  3MMY B;  2VN2 A;  2R7O A;  2HXO A;  4XN3 A;  4N9I A;  3OYG A;  3LSJ A;  3HRT A;  1E3P A;  2V6E A;  1AA7 A;  1BI3 A;  2CSO A;  3OL3 A;  4OOI A;  5HS7 A;  2QZ8 A;  1O7F A;  4XM3 A;  3IRR A;  3DPL C;  2HOS A;  1XX5 A;  1F5T A;  2CQX A;  5GTH C;  1FTT A;  2BV6 A;  1Z6T A;  5JHF A;  5DCM B;  1J9I A;  3KET A;  1Y8Q B;  5HNF A;  4A93 J;  1BM9 A;  1WWX A;  2HKO A;  5F0H A;  2FF4 A;  4KJZ A;  4BKX A;  1ZK8 A;  3AG1 H;  2FOW A;  4E7L A;  1X1P A;  5FRM A;  1GDT A;  3B6A A;  2V7F A;  2F2E A;  2ID6 A;  1OCC H;  5LFA A;  2CJJ A;  1WPK A;  4F7Z A;  2V26 A;  2VJI A;  1KQ9 A;  1LQ1 A;  1JHH A;  1N75 A;  2BY1 A;  4PJJ A;  2L9S A;  2NVT J;  1IRF A;  2VE8 A;  4AID A;  4MO7 A;  3MCZ A;  5LHI A;  2YR2 A;  3H3Z A;  4RA2 A;  3IUO A;  4B3A A;  2M9H A;  4R1H A;  5M5W J;  4BBS J;  1FBQ A;  5FRN A;  4E6K G;  1VND A;  1Z3Y A;  4YIR X;  2XF7 A;  4KMF A;  1UG0 A;  4M9S A;  1B9N A;  4A3I J;  3H5N A;  1X3U A;  4X6A J;  1S8N A;  1U9O A;  1T39 A;  1S7O A;  1UHS A;  4F52 A;  3HKZ N;  3P9I A;  2HQN A;  4IX7 A;  1N78 A;  3CCM I;  1D1C A;  3DTE A;  5M3M J;  2RNG A;  3BG6 A;  1U8B A;  2E2H J;  4EJU A;  4BQO A;  3SEZ A;  2Z33 A;  5D8L B;  5BQT A;  2LBF B;  2OC6 A;  1ZGA A;  3LWF A;  1G59 A;  4IF4 A;  4RLF A;  5B3S H;  5BMZ A;  1E3H A;  1AHD P;  2M7A A;  3SJM A;  3TO7 A;  5CVU A;  3KX2 A;  4FE7 A;  3EYI A;  1K4T A;  1XPX A;  3FK7 A;  4Y3O A;  2VBZ A;  3S1N J;  1XS9 A;  3GFL A;  1RIO H;  2X1E A;  2F6C A;  4BUP A;  4AC0 A;  1D0Y A;  2AHQ A;  3I64 A;  3WTV C;  5IYD J;  3Q0U A;  2GOX B;  2E5N A;  4CDG A;  3PSI A;  2NS0 A;  2JRM A;  3OS0 A;  3H92 A;  5LGN A;  1VQO I;  1LB2 A;  2HFH A;  1ETK A;  1OCR H;  3G4S I;  2HEO A;  3LOC A;  1XDS A;  3LA2 A;  2L3D A;  4FHT A;  4UUV A;  3OOU A;  3LQQ A;  4PFP A;  2K4B A;  2RQP A;  5D5X B;  4PDK A;  2BE5 F;  4XK4 A;  2GOM A;  2F48 A;  3E6D A;  4G7Z F;  1QVU A;  2HWV A;  2EZH A;  3K70 C;  1XN7 A;  2L7M P;  2KZV A;  1MSE C;  1A35 A;  2FD5 A;  4AYB N;  5IYB J;  1Y1V J;  2XKP A;  5LRR A;  2EIN H;  2HR3 A;  4RAY A;  3QPS A;  4P9F A;  3P9C A; 
#chains in the Genus database with same CATH homology
 1RKW A;  2TRT A;  5EG0 A;  4XRS G;  1D5Y A;  3JRD A;  3I4N J;  3HGG A;  2M2E A;  1BW6 A;  1IC8 A;  1S7E A;  4M3E A;  5HOD A;  3RZD J;  2R5Z A;  2CUF A;  1MBK A;  3NAU A;  1WGX A;  2P81 A;  3OIO A;  1HLV A;  5FKN A;  1X2M A;  3HDD A;  5EEA A;  1JKR C;  2DA5 A;  4HNV A;  2L7F P;  3IV5 A;  2ME6 A;  3RQI A;  1O4X A;  3MN2 A;  2Y30 A;  1LE8 B;  3A02 A;  5C44 J;  4A3B J;  5IP9 J;  4W1U A;  2OPT A;  4A3D J;  4BY1 J;  1MH3 A;  3PO2 J;  3O8G A;  3LSP A;  1JT0 A;  2W48 A;  3O8H A;  1AKH B;  1IDY A;  2RAE A;  1TWF J;  3ZQL A;  5E3L A;  3VPR A;  2LKX A;  2X9D A;  2XGE A;  4D7M A;  2R5Y A;  2DA3 A;  3TED A;  3HOW J;  4RDU A;  3QPL A;  2Y9Z A;  3BR3 A;  1HCR A;  2LLK A;  3DEW A;  3FIS A;  1TWA J;  4CYC A;  1IJW C;  4UUS A;  2HXI A;  4M3B A;  2DJN A;  1P7J A;  4A3L J;  1MSF C;  3JR9 A;  3BG9 A;  1Z77 A;  1TWG J;  2OF7 A;  5EGO A;  2EQR A;  2MGQ A;  4FTH A;  4BBR J;  1HDD C;  3CMY A;  5JLW A;  1HF0 A;  2R92 J;  1B8I A;  2XB0 X;  1I3Q J;  2KDZ A;  3S1R J;  4QTR A;  3JRG A;  3FK6 A;  3SDG A;  2LY9 A;  4AUX A;  2VUM J;  2JA7 J;  3HOZ J;  1W0T A;  5DS9 A;  1YRN A;  1U9N A;  4MIM A;  3ZQG A;  1A6I A;  1ORK A;  1JGG A;  2LD5 A;  5IP6 A;  4JX6 A;  1FJL A;  1JTY A;  3W6V A;  3F0C A;  1WI3 A;  2ECB A;  3S2H J;  2FQ4 A;  1AU7 A;  4JYK A;  3GTP J;  5J1R A;  1ETO A;  3ZQC A;  1QVT A;  2H8R A;  1Z0X A;  5EG0 B;  1QRY A;  3K2A A;  1MBE A;  3WHB A;  4W97 A;  1R9T J;  3H0G J;  4XRS A;  3M3Y J;  1IG7 A;  4L5E A;  1ZQ3 P;  3S17 J;  3A01 A;  3S1Q J;  3G1M A;  4IHX A;  4C3J J;  2R5Z B;  5F0C A;  2XSD C;  2ID3 A;  1FTZ A;  2JA8 J;  5FKO A;  1ZR2 A;  4FCY A;  1ZGW A;  1BL0 A;  3GBG A;  1T56 A;  2CQQ A;  4C3H J;  2XPU A;  1OCT C;  9ANT A;  1GV2 A;  2IAI A;  2VKE A;  3JRF A;  1I6H J;  1TWC J;  3BR5 A;  2XPV A;  3OSG A;  3GTQ J;  2ELK A;  4DZJ A;  2NS8 A;  1OCP A;  3PM1 A;  2DMQ A;  2Y2Z A;  2D5V A;  5FKL A;  1WH5 A;  4DZP A;  2R5Y B;  2EBI A;  1MBJ A;  2M34 A;  1JT6 A;  1BA5 A;  1HDP A;  5GPA A;  1MH4 A;  1JTX A;  2HQ5 A;  2PMZ N;  3ZQH A;  1Y1W J;  1APL C;  2DMT A;  4CYC B;  1XC5 A;  2E19 A;  4NDL A;  4V2F A;  3BTC A;  1RET A;  4MFD A;  4BY7 J;  1MBF A;  1ETV A;  4UUS B;  1OFC X;  5FKK A;  4JP0 A;  1PUF A;  4FIS A;  1K61 A;  2NVY J;  5EGO B;  3DCF A;  2R93 J;  5F1J A;  1RKT A;  2B63 J;  2X48 A;  2VKV A;  3GTM J;  3MKL A;  3IH4 A;  1ETQ A;  2O9L A;  3HOY J;  4IHY A;  1B8I B;  2DA2 A;  5GP9 A;  2LFB A;  4RBO A;  2Y0S N;  4A3M J;  5K7H A;  1YRN B;  3Q0V A;  2NOG A;  4XRM A;  5J3L A;  5IOY A;  3BR6 A;  3BQY A;  3HB9 A;  4G12 A;  1VFC A;  4X1E A;  1VI0 A;  4B1R A;  4DW6 A;  4D5F A;  1BJZ A;  4A3G J;  3JRA A;  3GTL J;  2VPR A;  2HOA A;  1FIA A;  5M5Y J;  1RR7 A;  2LVS A;  1ETY A;  5M5X J;  4GFB A;  4V2G A;  4A69 C;  4ABZ A;  2CU7 A;  3ZOB A;  3HOU J;  1NTC A;  2JWT A;  1DU0 A;  1FEX A;  1Q1V A;  2LK2 A;  3A01 B;  4IEJ A;  3CQZ J;  1JJ6 C;  2DA6 A;  3SFI A;  1ETX A;  3TW6 A;  3CCY A;  2I10 A;  3LSG A;  2K9N A;  3BTJ A;  3RKQ A;  5C4X J;  1T33 A;  1H88 C;  5FLM J;  1F36 A;  2TCT A;  2HYJ A;  1ENH A;  2E2J J;  4A3F J;  1ZTR A;  1NK3 P;  1P7I A;  3JRI A;  2CRG A;  1RES A;  2DN0 A;  3NAR A;  2DMP A;  2ME0 A;  3E7L A;  4C3I J;  3HM5 A;  2WAQ N;  4IHW A;  1OJL A;  2JN6 A;  3LSR A;  2JA6 J;  1GV5 A;  1A5J A;  2DMU A;  2XGD A;  3BT9 A;  5BNG A;  2JMW A;  5IOZ A;  3OSF A;  3Q0W A;  3FKI J;  5IYC J;  2HOT A;  4M3F A;  2G0E A;  3FIW A;  1JKQ C;  2XPW A;  2FX0 A;  2Y31 A;  5C3E J;  4DYQ A;  1POG A;  4M3D A;  2JK3 A;  1ETW A;  2DTZ A;  3MVP A;  2DA1 A;  1PUF B;  3I4M J;  4JX4 A;  1F43 A;  1IUF A;  4JX5 A;  2YUS A;  2IEK A;  1ZR4 A;  3WHC A;  2QCO A;  3S1M J;  4Y7N J;  1LFU P;  2CUE A;  3BTI A;  1CQT A;  3BR0 A;  3H3V K;  2N8G A;  2COB A;  3ZQI A;  4I76 A;  2GBY A;  5IP7 J;  3GTO J;  3RZO J;  2GM4 A;  2L9R A;  4J19 A;  1ITY A;  2NVQ J;  4D5C A;  2M8G X;  3HOV J;  4I6Z A;  1JUP A;  2DA4 A;  4FE4 A;  1QPI A;  1K83 J;  4QIW N;  4MLO A;  4EEF G;  2IBD A;  5M3F J;  1JKP C;  1RPW A;  1SAN A;  3C2B A;  3PO3 J;  3L1P A;  1NK2 P;  1MBG A;  2EZI A;  3S15 J;  4B4C A;  2Y9Y A;  2WB1 N;  5F0F A;  1LFB A;  2M0C A;  3Q3S A;  3B6C A;  3BR2 A;  4DYR A;  1WCM J;  2LTP A;  2NS7 A;  2NVX J;  3K7A J;  3HOX J;  3HEF A;  4M6V A;  1X58 A;  2EH3 A;  2H1K A;  1X2N A;  2LP0 A;  1WH7 A;  1H89 C;  2DA7 A;  2QF7 A;  2HXO A;  5E3O A;  3M4O J;  3LSJ A;  2MG4 A;  2HDD A;  2YS9 A;  5F04 A;  1MBH A;  1UMQ A;  3ZQF A;  2K9S A;  3QQA A;  1VF9 A;  5K7F A;  4BXX J;  3BTL A;  5J1U A;  1MNM C;  2XRL A;  3JRB A;  5FKM A;  4M3G A;  5EZH A;  5E3N A;  2HOS A;  2CQX A;  3CDL A;  1FTT A;  3JRC A;  1GVD A;  1W0U A;  3JRH A;  2LR8 A;  1B72 A;  1EF4 A;  3BG5 A;  4A93 J;  5F0H A;  4DYC A;  1G2H A;  2HI3 A;  2E2I J;  1GT0 C;  4BKX A;  4A3E J;  1ZK8 A;  2VI6 A;  1GDT A;  3B6A A;  5EZG A;  2ID6 A;  2XGC A;  5EDN A;  2CJJ A;  2JJ7 A;  1WPK A;  1U78 A;  4A3C J;  2AO9 A;  3TP3 A;  1E3O C;  4S0H B;  3GTJ J;  2NVT J;  5DTD A;  4MO7 A;  2MW8 A;  2K9Q A;  4B3A A;  2M9H A;  5F27 A;  5M5W J;  4BBS J;  4Y52 J;  4A3J J;  1VND A;  2ZB9 A;  3HGY A;  3TW7 A;  4C2M J;  5K7Z A;  4IHV A;  1IDZ A;  2K40 A;  2L7Z A;  4A3I J;  1UG2 A;  2R0Q C;  4X6A J;  2O8K A;  5GPC A;  1U9O A;  1UHS A;  1JUM A;  1LE8 A;  4UUT A;  3HKZ N;  2E1O A;  3S2D J;  1JKO C;  5EF6 A;  1BW5 A;  5M3M J;  1U8B A;  3IH3 A;  2E2H J;  2L0K A;  1DU6 A;  1AKH A;  5F08 A;  5FJ8 J;  4XIC A;  3HBL A;  5FLV A;  3BQZ A;  3IH2 A;  2R7Z J;  5JLX A;  3GTK J;  2X6O A;  1AHD P;  5EYR A;  3SJM A;  3LNQ A;  2YU9 J;  3S14 J;  5E3M A;  4FE7 A;  3JRE A;  1SFO J;  3BG3 A;  1TWH J;  5C4J J;  3S16 J;  3FK7 A;  3S1N J;  1XS9 A;  4QSH A;  2XB5 A;  1IGN A;  1H8A C;  3G1L A;  4D7N A;  4AC0 A;  4MFE A;  2AHQ A;  3BR1 A;  5IYD J;  4XID A;  2ECC A;  3GTG J;  3Q0U A;  1I50 J;  2JA5 J;  1HOM A;  2MSY A;  4A3K J;  2EZK A;  5IPA A;  1ETK A;  2WV1 A;  1JJ8 C;  3LOC A;  3UKG A;  2O7O A;  3G1O A;  1XG1 A;  3OOU A;  2EZL A;  1FIP A;  1JUS A;  2KT0 A;  1IRZ A;  1TC3 C;  5J1Y A;  1IV6 A;  4XK4 A;  3TP0 A;  1GUU A;  1B72 B;  1QVU A;  2FJ1 A;  4LOC A;  2EZH A;  2L7M P;  1ZKG A;  1MSE C;  2FD5 A;  4AYB N;  5IYB J;  1Y1V J;  2DMN A;  3D1N I;  2GLO A;  3QPS A;  3A03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...