3F21A

Crystal structure of zalpha in complex with d(cacgtg)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
67
structure length
67
Chain Sequence
LSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structures of non-CG-repeat Z-DNAs co-crystallized with the Z-DNA-binding domain, hZ{alpha}ADAR1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific adenosine deaminase
total genus 22
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f21A00
1J9IA 1FX7A 1CF7A 1TNTA 5LHGA 1G6NA 3ML6A 4B09A 4RAZA 3RPUA 4LG0A 3P9KA 3SXYA 2K4BA 3WGIA 3Q5FA 1FNNA 4BYYA 1AOYA 3R6SA 3E5XA 1J7KA 4EJTA 1KYZA 2X4HA 4HF1A 2PI0A 2FEZA 1FPQA 3PQKA 4WF2A 5LLQA 3RIRA 4IRGA 5HS8A 3T0YA 2RDPA 3DXJF 2E7XA 2FQ3A 3GFLA 2DPDA 3QAHA 1K78A 2E1NA 4L9NA 5AIQA 4ON0A 4A0YA 2LDUA 1SD7A 1EH6A 5L3EA 5LGTA 4OMYA 2P6TA 4G6DA 1HKTA 1R36A 3L9FA 2MLGA 5JVTA 2FNPA 2FA5A 4KIGA 4WCGA 3I64A 3FMRA 1W5TA 4ESFA 4GGGA 2P7VB 2ADUA 2YX4A 4A6EA 3TDZC 2GWRA 5L3CA 2OZ6A 2W84A 2FBHA 3RJPA 1R7JA 2W25A 5CVRA 2CGPA 4OIOF 5FFXA 2VT2A 3E6MA 3TO6A 2R7DA 3Q9SA 1XSVA 4JK1X 2RQPA 3FXRA 4UVAA 1T2KA 3KE2A 3CUQB 1FBQA 4RGRA 2ZCWA 4UV8A 3ZMSA 4G6QA 1FP2A 2PG4A 4KT5C 1SD4A 1O57A 1S6LA 4Q47A 1R5GA 4LLNA 1XGOA 2W85A 4O3MA 4IPAA 3FMQA 1GXQA 4WX9A 1E17A 4ZYEA 1IN5A 1ZLKA 1QPMA 2JT1A 4I98B 3WTZA 4LB5A 1FT9A 2XGXA 4OOIA 4M74A 2IJLA 2A07F 1QGPA 3E6DA 2DQLA 2XROA 5H6RA 1L0OC 2F5FA 4M6XA 3WE2A 1Z7UA 2L4MA 5TRDA 1MGTA 1ZN2A 1XCBA 3F8FA 1LEAA 2STWA 4FX0A 2JPCA 1W5SA 3CO6C 2O6GE 3HSRA 1KA8A 3P9CA 4L0ZB 2CWEA 1WRJA 3DF8A 2DK5A 4B8XA 5HDKA 3IWFA 5LHHA 1BI3A 2VXZA 4R1HA 3DP7A 4PCQA 4ETSA 5JFRA 1K78B 5DCFA 3M8EA 4EV0A 1RIOH 1JHHA 4I0AA 3I5UA 4FT8A 3U9GA 5BPDA 3E6CC 4OINF 1U5TB 2GA2A 4MTEA 2BV6A 1Z9CA 3V8LA 1QZYA 2EFOA 1YYVA 2B0LA 1J75A 1R5HA 1PP8F 1U3EM 2GQQA 2HFHA 3F8NA 2GA1A 1L3LA 2PMHA 5E20A 1RUNA 4RAYA 2Y75A 4WXHA 3G3ZA 3T8RA 2VONA 4YFNF 3DPTA 4RB2C 3KZZA 4MNUA 1IUYA 4AVPA 4LD5A 3ECOA 4U7DA 2G9WA 3T1BA 4BHPA 2XASA 4Q48A 3ZN1A 3JTHA 4DQ2A 1O3QA 4RB1A 4HOBA 1BIAA 3L00A 5E8GA 4LMYA 1YO5C 1NHAA 1GHCA 3VEPA 3LFKA 3K1NA 2M8EA 3QP6A 2HQRA 1XMKA 3ELKA 5F6FA 2FRHA 1LEBA 3EYIA 1B6AA 4M9SA 2JSCA 3R61A 4MTDA 4KMUX 5J8FA 5ICFA 4RGUA 1JXSA 3GZ5A 3BDDA 3ZMUA 2H94A 4MEYF 4MQ9F 4L9TA 1U5TA 4S04A 3CO7C 1XMAA 1R1UA 1B9MA 2J5PA 2L3DA 3HOSA 3HYIA 1D5VA 5EEGA 3MZYA 4MQVA 2ZJ2A 1TW2A 3RKYA 4EM0B 4XLNF 1G3YA 3RKWA 3MCZA 1WWXA 4LLGF 5JI6A 4EM1A 4NHJA 2W57A 2FE3A 4EGYA 1U5TC 2O61A 2YX7A 1I27A 3H3ZA 3ISPA 4HZFA 4I09A 2L4AA 2VC1A 3FM5A 3EUHA 5FFZA 3RYRA 4L5JA 3KLNA 2V6CA 4HX8A 4HAMA 4MGRA 1FYKA 1UHMA 5D8LB 4A2UA 4Y13A 3OV8A 1T98A 3J81Z 2FBKA 5E8IA 2D2WA 5HDGA 4YIFA 1YLFA 2HKOA 1VTNC 4M9XA 3WE3A 4P55A 3HHGA 1HSJA 3J80K 1UHWA 2Z99A 3ZMZA 1MDMA 1USTA 4NQWA 2UXNA 4KUMA 1ZAOA 5D8KB 3ZP5A 2M5WA 1G3TA 3SHFA 5ED4A 4M6YA 1SMYF 1ZGJA 5K5RA 1S8NA 3HSEA 2YSRA 3LAJA 1IXCA 3ROUA 4Q4ZF 4R8HA 3HHHA 2DAOA 3LWFA 3V7RA 4EMSA 2DBBA 3RYPA 1I5ZA 2KKOA 2FNAA 3BOQA 2FSWA 5J6XA 3DFGA 5H6QA 4PZJA 1BI2A 3EQLF 2IRFG 3B73A 1BJAA 4JQFA 3BPVA 1ZARA 4KICA 5HS9A 3BWGA 2DLLA 4G9YA 6PAXA 3TKYA 1FWZA 4WXCA 1IN7A 3AAFA 2QYOA 1HKQA 3BP8A 3COAC 5J8CA 5D4SA 3R4KA 5LGUA 2QM3A 3DPLC 2GXGA 3VODA 4LG0B 1IXRC 1XGMA 3C18A 4KIFA 1XN7A 1FC3A 1IN8A 3V8JA 4M71A 3FXUA 3ZPLA 2VE8A 4A5MA 2H6BA 2KJCA 4KA4A 1MZBA 4P96A 2P5KA 1S7AA 1KQ0A 3FX3A 5F1RA 2A6EF 1T38A 3IWZA 4ZZLA 4BNCA 2XKPA 4M72A 4ENNA 3BY6A 3M9AA 2M87A 1U6GA 3IRRA 1F4KA 2XVCA 3WTYC 2EFWA 4A12A 2Y48A 4G7ZF 1R23A 1XSXA 4LLLA 2JPBA 2R3SA 4AIHA 3IKVA 1F5TA 2RV8A 4U88A 1REPC 1W4MA 3HTSB 2FF4A 4CGZA 1STZA 2CW0F 5L3BA 5D6FA 5FLXZ 1J0RA 3GZ6A 3T8TA 4ZH4F 2P8TA 4TV7A 3PQJA 2O8XA 3D5LA 2BYVE 5ILSA 1FBSA 3C1DA 3I4PA 3M8FA 1KU9A 5H20A 3TOAA 2FMLA 2XAJA 4HYEA 3P9IA 4OU0A 2NNYA 2V79A 3GUDA 3K69A 3WGHA 1WQ2A 1OR7A 1O3RA 5CVUA 4L5IA 1W7PA 2P4WA 1FBUA 4HDUA 2HR3A 1ZH5A 4D0PA 1T6SA 2A69F 1LDDA 1TNSA 4I0BA 2K02A 2WC2A 5D5UB 2QBYA 2Q8KA 2Q2EA 4YFXF 2NNNA 3FZVA 3M1EA 2NYXA 2IP2A 1RI7A 4GXOA 5D5WB 4UHTA 1XGNA 1SFEA 1SMTA 3CTAA 3IRQA 4ESBA 2O03A 4IHTA 2KIFA 1DUXC 2H6CA 2EFNA 1FYLA 3FM3A 2IA1A 4K2EA 1O3TA 2CO5A 1MJAA 3M7GA 1D8JA 5BMZA 5DDGA 3F8BA 3KEOA 3E3VA 4HX7A 4HF0A 5DUIA 5HS7A 1FP1D 1U8RA 3VB2A 4GO1A 3VOEA 1ZG1A 3REOA 4BXUA 5D4RA 2DT5A 4G7HF 2X0LA 3GLXA 2DPUA 2H09A 2L54A 2COMA 1HKSA 1BI1A 2HYFA 4OIPF 3KEQA 4KMFA 1PDNC 5E1WA 2CFXA 2CYYA 1HBXG 5LRRA 1HSTA 4CXFA 5DUKA 1J2XA 5K5OA 2F5DA 2P5LC 3RTRA 3H3UA 1Y0UA 4UVBA 1MD0A 2BBYA 1PUEE 3GO5A 1ON2A 4EQQA 2LSOA 3KLOA 3W6KB 1P2FA 1EH7A 3J7AO 1R1VA 4AWXB 4ENKA 4Z2YA 1HW1A 2ESNA 1EV7A 4ESJA 2E1CA 1J59A 4PGGA 2WTEA 4KDPA 1FZPB 5E17F 1J5YA 2AXLA 2EV6A 1B9NA 1MJBA 2VBYA 3I0TA 2Z33A 2K86A 3R0JA 3I59B 3ERED 3W6JB 3KP3A 5ILVA 1S3JA 1BBYA 3IC7A 3RKXA 1XCVA 4RB3C 2P5VA 2RC4A 1YQAA 3F8MA 2BEOA 4BHCA 5KK1A 4A0ZA 2D1VA 2MBFA 1DP7P 4RS8A 5D5VB 5DV5A 5DD4A 3FHZA 1IN6A 3V7CA 3E5QA 4LK1F 4UV9A 2RGVA 4HV5A 2FOKA 2HS5A 1ZGAA 4E70A 1YTYA 2MH2A 1OYWA 2DU9A 1X3UA 2TDXA 2GAUA 3CLOA 1U2WA 3K2ZA 4U0YA 3ECHA 2HKXA 2YR2A 1ON1A 4LFUA 4BQAA 4XSZF 2OZUA 3R0AA 5DCMA 5E18F 2VODA 4GCVA 2ETHA 1R58A 5CYVA 3ZMDA 4EGZA 1WSUA 3MAJA 3TOBA 2GIVA 1K79A 2G7HA 3FF5A 3JSOA 1V4RA 2EWNA 4O5VA 2QQBA 4CHUA 3KP4A 1LJ9A 4OIRF 3TQNA 3IHUA 2EK5A 2K4JA 1V3FA 2PFBA 2DI3A 2EFPA 1YW9A 5LEKA 1YS6A 1UFMA 2L02A 3JW4A 2QWWA 3CUOA 5D6EA 4EVIA 1KU7A 1OKRA 2XAQA 4L9JA 3KP5A 2YU3A 2K7LA 3KETA 3N97A 3MFKA 3QU3A 2NS0A 1SAXA 2IW5A 3KP2A 4U7BA 2GZWA 3J80Z 1T0FA 1IRGA 2AS5F 1S29A 2PQ8A 2ZKZA 3F21A 2XAGA 1LQ1A 1EH8A 2QENA 2NRAC 1C0WA 1XSDA 5ERIA 3KP7A 2QQ9A 1G3WA 2VT3A 2KIMA 4FHTA 2PMUA 2ELHA 3TDUC 2Z9OA 3JAMZ 1UCRA 1IN4A 2HWVA 4A5NA 5BOXA 1FYMA 3WU1B 5FLXK 1ZYRF 5ILUA 3LA2A 3OOPA 1KQ9A 1PP7U 2NAZA 1QQIA 3BZ6A 4UNOA 3F3XA 4A0XA 2FMYA 3WGGA 4BHBA 2A3SA 5DEQA 1BIBA 3KCCA 4XRFA 3FXQA 5ICCA 2EA4A 1GVJA 1IAWA 4BH9A 2IVMA 2W24A 1FSEA 5L3FA 3GXOA 3MQ0A 4P9FA 2ZFWA 1B4AA 1HXDA 1IZ1A 2OU2A 1P4AA 1KQ8A 1P92A 2XAHA 1FY7A 2PN6A 3K1MA 4WXDA 1R1TA 1BC7C 1FSHA 1O3SA 1H9GA 2XV4S 4G8XA 2DFIA 3GW2A 5CVIA 2IA0A 2ACJA 1SFXA 2A5YB 4I2OA 2ESHA 3V7SA 2HTJA 2R7FA 3WTWC 3CJNA 1ONVA 2DQRA 3E97A 3CUQA 4M9ZA 3HUGA 1ZRCA 3DKWA 4YFKF 4HLXA 4ZYDA 2RNJA 3GX4X 2XAFA 2J5OA 3C7JA 3V4GA 4MHGA 1R22A 1DDNA 1QZZA 4Y17A 4CO8A 1S7OA 4P5OA 4FX4A 2VN2A 3G73A 5A2QK 4R79A 5FD5A 3ZN0A 2F2EA 4ASNA 4O6JA 2IPQX 1HQCA 3R60A 1ZG3A 3Q9VA 3LSTA 4JBAA 2CG4A 4CYDA 2Q0OA 4OMZA 2OD5A 3O6BB 4YIIA 2XKOA 3ULQB 2F5CA 1B59A 4EJWA 3KZYA 1TQPA 4IF4A 5AIPA 1LDJA 3WTVC 4L18B 2OQRA 3QOPA 2HTSA 2STTA 3KP6A 4EJVA 3T5XA 4HDVA 5LGNA 5BPIA 4N9IA 4HLYA 4LB6B 1KYWA 2VE9A 1Z6TA 3MWMA 5IT9K 1A04A 1XD7A 4IJAA 3F23A 5FO5A 3GFMA 2D45A 2QVOA 1HW2A 2HDCA 3E6BA 2CQKA 4P9UA 2LNBA 2Z3YA 3J81K 3GVAA 1ZRFA 2RN7A 5L3GA 4HA8A 4ZYGA 2RVCA 1IF1A 2JRTA 3I71A 2V1DA 1CF7B 1Z05A 4AIJA 4EJUA 3B02A 2DTRA 5ICEA 3LA7A 3WTSC 4CDGA 3GYHX 2ZO4A 4NB5A 2OAZA 1OYIA 3MEXA 5F64A 1D8KA 1YW7A 4CZZA 2XUBA 4KNYA 5K1YA 3GWZA 3HTUA 3HRUA 5IT3A 4WK8F 3FMSA 1JGSA 3F6VA 2A61A 3WODF 5E1XA 5BQTA 5IT9Z 3HIFA 2EV0A 3I58A 4KN7X 1ZREA 1I1SA 5DYMA 1Z6RA 2QBYB 1XGSA 5LBQA 4N0BA 3H92A 4UVCA 4YG2F 3DEUA 1H9TA 5AONA 3EETA 3ZQ7A 5KVRA 3TO7A 5L3DA 3S2WA 4QWQA 1UB9A 2QLZA 4F7ZA 1QBJA 4GYIA 2ZNZA 3L2CA 2P6SA 3MZHA 2HEOA 3L7WA 1P4XA 1IRFA 4EM2A 1ZG5A 4UXNA 2M45A 4U0WA 1W7PB 3RI4A 5HLHA 4L9VA 3P7NA 2OBPA 3ABUA 1MDMB 3HRTA 2LF7A 1O7FA 2UZKA 5DD8A 1XB4A 4IXAA 2KJBA 3EDPA 3BROA 1O7LA 3LAPA 5LHIA 2OQGA 4HQEA 1T39A 1FLIA 1LB2A 2PLYA 4EJOA 1Z1DA 1P6RA 4HV6A 2HZTA 2MLKA 1SD6A 1H0MA 2ZXJA 1JE8A 5HDNA 4KFCA 1ZLJA 1TBXA 1BC8C 2V1UA 1RZ4A 3D0SA 1KU2A 3U2RA 2V1XA 2H27A 1LVAA 3F72A 2JTVA 2EJRA 2YPRA 3BJOA 1MJ9A 2DO7A 3DQVC 2HQNA 1IW7F 2BE5F 3IL2A 3K1PA 1TQIA 3IKTA 2VOOA 1GXPA 1Z91A 2IA2A 4IRHA 1IXSB 3EYYA 1B1BA 1BM9A 4S05A 3K9TA 4IRIA 4HF2A 1BI0A 2ISYA 5JHUA 3QRFF 4RB0A 3JSPA 1YW8A 2LKPA 3HSFA 1F1ZA 4N9HA 2MA3A 2ISZA 1FOKA 2MC3A 4HW0A 2QZ8A 2PJPA 2EV5A 2M1BA 1ODDA 1D3YA 3RPQA 3U1DA 2F5EA 2BGCA 5HOOA 3DV8A 4Q5SF 3K0LA 5CVJA 2EB7A 3WU0A 2VC0A 3I54A 1OYYA 4G94A 1SD5A 4WWCA 3ZMVA 1G4DA 5JR3A 4KYWA 2E7WA 2EA2A 1F9NA 2QQAA 4HQMA 2FU4A 5DCMB 3GF2A 2VOPA 3HRSA 2XIGA 3E5UA 3WTTC 3BPXA 1U78A 4I7HA 3N4MA 3BJ6A 2ZMEA 3HRMA 4LGWA 2LF8A 2OA4A 1E2XA 1Q1HA 2XRNA 2ZNYA 3HOTA 2EFQA 2CSOA 2FBIA 1ZHFA 4L0YB 2M30A 5CJ9A 5E1ZB 3NEUA 2Z5UA 5CVVA 3ABTA 2HGCA 2KIUA 4GYGA 3SZTA 5FB2A 1K6OA 3C3WA 1W7PD 3O3KA 1BOAA 3LQRA 2DW4A 5LRSA 4PDKA 4UUVA 1RUOA 2P7CB 2GXBA 4RGSA 5FGMA 4ENJA 3I59A 2C6YA 4A6DA 3PFIA 2L01A 3BJAA 1BN5A 4KN4X 3VFZA 1DPUA 2ZMEB 2UWMA 5HVQC 2UXXA 2VBWA 5LEJA 2V9VA 3CDHA 3QPHA 1OPCA 5ICGA 1YG2A 1CGPA 2WWYA 1WKMA 3KFWX 3F6OA 2WV0A 2O0YA 2HYGD 4IHSA 2JZYA 1JHFA 4U0VA 4I01A 1R00A 2G7UA 1WI9A 3F8CA 1YS7A 4M73A 4Y15A 1KU3A 1QNTA 5A2QZ 1SFUA 4AD9A 3V8KA 3SQNA 4HX4A 3I53A 4G7OF 5TJJA 1I1GA 3WTXC 3LA3A 1KGSA 1RNLA 3NQOA 3F22A 2VBZA 4ZYHA 2PBIA 3QU6A 2KRFA 5CLSA 4MEXF 1TLHB 2DK8A 2Y0MA 4RGXA 1XDUA 2ZBKA 2IT0A 1LNWA 1I6XA 3ZMTA 1QO0D 2K27A 3NRVA 4DNCA 4XSXF 3WG9A 2HOEA 1K7AA 1DPRA 5K5QA 3GFIA 1TQMA 3SFZA 2A6HF 2RKHA 4IVNA 5HLGA 3SZPA 1ZRDA 3WTUC 3RDIA 2D1HA 4XBFA 4OIQF 1ULYA 3L09A 4I02A 3TO9A 3QPTA 3LQQA 2MH9A 1OMIA 4PGHA 4BAYA 3O2PE 2PEXA 1HW5A 1G3SA 5D5XB 3JAMK 3GEZA 1YFHA 4AIKA 1P4WA 5FD6A 4H0EA 4CICA 1YIOA 5EEHA 4QLCU 5BS6A 4XLPF 3FWEA 4ZZDA 1XDSA 3GFJA 1USSA 4LJZF 1MKMA 1AWCA 4LK0F 1TTYA 1TW3A 2O3FA 2A68F 4KIBA 3TGNA 4HBLA 2MD5A 2QUFA 4ENMA 2FXAA 2VBXA 3CUQC 3JTGA 5HLIA 2XHKA 3QP5A 1LDKB
chains in the Genus database with same CATH superfamily
1K6YA 1UELB 1FX7A 1J9IA 1ACIA 2ICWG 3HC7A 1CF7A 4CCNA 1FJLA 1TNTA 5GADJ 3J7ZI 5LHGA 1G6NA 4D5FA 2W48A 3LSHA 1YRNA 3ML6A 4B09A 4RAZA 3RPUA 4LG0A 3P9KA 3SXYA 3CCJI 1FIAA 2HVQA 2K4BA 3WGIA 3Q5FA 3LSRA 1FNNA 4BYYA 2FUG2 1AOYA 2LKXA 4E7IA 4BE1A 3R6SA 2F48A 3E5XA 2LYCA 1J7KA 2Z1DA 4EJTA 1KYZA 2X4HA 1Y6IA 4HF1A 5GTHC 2VQLA 2PI0A 1IG7A 4RLQA 2ZSHB 2KFDA 2BVLA 2EPFA 2ELKA 2FEZA 2HI3A 1FPQA 2VKHA 3PQKA 4WF2A 4A3KJ 2ZFUA 3JRGA 1LE8A 1VQ5I 4M3GA 3OYKA 2K5CA 3ZQLA 5LLQA 3RIRA 4XR6A 3RZDJ 3CCUI 4IRGA 5HS8A 3T0YA 4CA0A 1VF9A 2RDPA 1YRNB 3DXJF 3TP0A 2E7XA 2N8GA 2FQ3A 3GFLA 2PJRB 2DPDA 3QAHA 4PSXA 5J3LA 1K78A 2E1NA 1TC3C 4BY7J 3C2GA 1JUSA 3KIOA 3VDXA 4L9NA 5AIQA 4ON0A 2JWTA 2LDUA 1SD7A 4A0YA 1EH6A 5L3EA 5LGTA 2R93J 4OMYA 2P6TA 4G6DA 4DYCA 4HNTA 4A3GJ 1R36A 1HKTA 2D5VA 3L9FA 2MLGA 5JVTA 2FNPA 2FA5A 4KIGA 4WCGA 3I64A 2K9QA 2BZTA 3FMRA 1W5TA 1I3QJ 4ESFA 2F6CA 4GGGA 5JVGF 2P7VB 2ADUA 2YX4A 4A6EA 3GTMJ 3TDZC 2GWRA 3FIWA 5L3CA 2OZ6A 2W84A 1LVKA 4M6VA 2FBHA 1YHQI 3RJPA 3S3OA 1R7JA 1R4MB 2L9RA 1GLNA 2W25A 4KJZA 2KQRA 1G8XA 3N05A 4AYBA 3GTPJ 2X1CA 5CVRA 2CGPA 4OIOF 5FFXA 2VT2A 3E6MA 3TO6A 2R7DA 1ZR4A 2JRMA 1YE9A 4U87A 3CQZJ 3Q9SA 2WV1A 1XSVA 4JX6A 4PJMA 4JK1X 4UUSB 2RQPA 3FXRA 2ZJRF 4UVAA 2X6XA 3OYIA 4W1UA 1T56A 1T2KA 1FIPA 3KE2A 1PJRA 3CUQB 1Y8QB 1FBQA 4RGRA 2ZCWA 4UV8A 2QKLB 1TWHJ 3ZMSA 1VNDA 3GLLA 1FP2A 4G6QA 2X85A 2PG4A 4KT5C 1SD4A 1O57A 2HXIA 3OYNA 1S6LA 1OCOH 2E34A 4Q47A 1R5GA 5M3FJ 3BT9A 4PUSA 4LLNA 2HOTA 1XGOA 3F0CA 3PNYA 2W85A 1ETYA 3K4BA 4O3MA 4IPAA 3FMQA 3CC7I 1OCRH 1GXQA 4WX9A 1FOXA 4A3BJ 1R4NB 2GIZA 1E17A 4ZYEA 1FTZA 1IN5A 3B6AA 3S32A 3DLAA 4E4HA 1ZLKA 4DJAA 1QPMA 3ZRGA 1GV5A 2JT1A 2XAUA 4A3JJ 2E1MB 4W97A 1B72B 4I98B 5EEAA 3FKIJ 1T8IA 3WTZA 3MN2A 4LB5A 1FT9A 2XGXA 2CW8A 4OOIA 4M74A 3A03A 2JA7J 2IJLA 1MNDA 2ZXHA 2A07F 4YEJA 3BTCA 1XC5A 1QGPA 3E6DA 2DQLA 3P5JA 2XROA 3IAM2 5H6RA 1HC8A 1L0OC 2F5FA 3L2WA 2QF7A 4M6XA 3WE2A 1Z7UA 2R5ZB 2L4MA 4B47A 4BQOA 5TRDA 1MGTA 2V6EA 1ZN2A 3CJQB 1XCBA 3CCSI 1KZHA 3MKZA 2JA2A 1Z67A 3F8FA 1LEAA 2STWA 3D5SC 4M3EA 4FX0A 3PJRA 3ZR8X 2KL4A 5B1AH 2JPCA 1W5SA 3CO6C 3ABLH 1OFCX 4XICA 2JUGA 2O6GE 3S1MJ 1NG7A 3HSRA 1KA8A 1YX3A 2YUSA 2JJ7A 3P9CA 3LSPA 4L0ZB 2FX0A 3DCFA 2CWEA 1WRJA 3ABMH 5C3EJ 3DF8A 2DK5A 2M9HA 4B8XA 5HDKA 1MW7A 4IQJA 2MFZA 3IWFA 4F92B 1W0TA 1B72A 2R7WA 4BKXA 5LHHA 1BI3A 3W6VA 2VXZA 2KLOA 3TW7A 4R1HA 2QQ8A 3DP7A 1D5YA 4N4NB 4PCQA 4ETSA 4OAZA 2JUCA 1NK2P 5JFRA 3H0DA 1K78B 5DCFA 2OPTA 4ZDPA 3M8EA 3PNTA 3I55I 4EV0A 5EGOB 1X3ZB 1RIOH 1JHHA 4I0AA 4MO7A 2OF7A 2A6TA 3V42A 3I5UA 4FT8A 3U9GA 5BPDA 3E6CC 4OINF 1U5TB 2GA2A 4MTEA 2FQ4A 4XOTA 4EEFG 2BV6A 1Z9CA 1Y56A 3V8LA 1QZYA 2EFOA 1YYVA 2OTJI 5DM6F 2B0LA 3Q0UA 3FISA 1J75A 1R5HA 2HU9A 1PP8F 1U3EM 2HPMA 2O7OA 1YITI 2GQQA 5HNFA 2HFHA 3F8NA 2GA1A 3GTGJ 3GMEA 1L3LA 2PMHA 4BBSJ 5E20A 3G4SI 4A3FJ 3S2DJ 4AC0A 1RUNA 5K7HA 3OOUA 4RAYA 2Y75A 4WXHA 3G3ZA 3T8RA 3CMYA 1ZQ3P 4N4OB 2VONA 4YFNF 3DPTA 4UB8C 2AHQA 4M3DA 4RB2C 3CCRI 3KZZA 4MNUA 1IUYA 4AVPA 1ZR2A 4LD5A 3ECOA 4U7DA 2YS9A 4I76A 1GVDA 4BQQA 5FJ8J 3G1MA 2G9WA 1DGWY 3T1BA 1Y8RB 1Z3XA 2MYSA 4XKVA 4BHPA 3HXLA 3LSGA 2XASA 1AA7A 4XKCA 3H5AA 2JQ7A 4NBQA 2EIMH 2Y30A 3QYEA 2BHZA 4Q48A 3RSNA 1WVRA 3ZN1A 3JTHA 1X2NA 2F4IA 2WY8Q 3UR3C 4DQ2A 1O3QA 1OLTA 1V55H 5FROA 4HOBA 1ETKA 3I3LA 5IPAA 2V4JC 4RB1A 1BIAA 2CV0A 2B63J 3OIQA 4LG3A 3L00A 5E8GA 4LMYA 1YO5C 3W2AA 1NHAA 2E71A 3CCLI 1GHCA 3VEPA 2ZC2A 3LFKA 3K1NA 3RQIA 2M8EA 3QP6A 2Y69H 2HQRA 1XMKA 3ELKA 5F6FA 2WBMA 2XF7A 4D9JA 2VIXA 5E3LA 4ABZA 3CJRB 2FRHA 1LEBA 4RA2A 1UG2A 3FK6A 1MH4A 1MIJA 3EYIA 1B6AA 1QHHD 3O8GA 3CCVI 4XK4A 4FASD 4M9SA 1Z21A 2JSCA 3R61A 4MTDA 2ZXIA 4BGDA 1AU7A 4KMUX 1U9OA 1U0JA 1G2HA 1ETOA 3M1CA 5J8FA 1WFXA 2V26A 5ICFA 4RGUA 3DKXA 1NG6A 1JXSA 3GZ5A 3BDDA 3ZMUA 2H94A 4MEYF 4MQ9F 3PM1A 1W1WE 2VKEA 4L9TA 1U5TA 4S04A 3CO7C 2CS3A 3FHNA 1A6IA 1XMAA 1R1UA 1B9MA 1X3WB 2E2JJ 2J5PA 2L3DA 4A3EJ 3JRAA 3HOSA 3HYIA 1D5VA 5EEGA 3H9GA 3MZYA 2E2HJ 2NVYJ 4CCOA 4DYQA 2FD5A 4MQVA 5FKLA 5J1RA 3S3MA 4G12A 1MH3A 2ZJ2A 3HPGA 4HSTA 3AG4H 1TW2A 2LC2A 3RKYA 4EM0B 4KITB 4XLNF 4JYKA 1G3YA 2LBFB 5E3NA 2HOAA 3CDLA 3MCZA 1WWXA 3CJTB 4LLGF 3RKWA 1K4SA 5JI6A 2CH0A 1P7IA 3A0BC 4EM1A 3KYLA 1J09A 3IUOA 2X48A 4NHJA 3LSIA 2L0KA 2DA6A 3IH4A 2DMTA 3PL8A 2CV1A 2W57A 2FE3A 4EGYA 1U5TC 2O61A 2WAQA 4IKFA 2I8DA 2YX7A 1IRXA 1SVOA 1NTCA 1I27A 3H3ZA 3BG7A 3ISPA 4RLFA 2VQHA 4HZFA 3RKQA 4HG2A 2DYSH 5IP6A 4I09A 2GOMA 2L4AA 2VC1A 2LY9A 3FM5A 3EUHA 1VI0A 5FFZA 3RYRA 4L5JA 3DU6A 3KLNA 2V6CA 1B8IA 1VQ9I 4HX8A 1XG1A 4HAMA 2EIJH 2EH3A 4MGRA 2LP0A 4CCKA 1Y39A 2XPUA 1FYKA 4B3XA 3JRHA 1UHMA 4KT6A 5D8LB 4A2UA 4Y13A 3OV8A 2IS4A 1X1AA 1KONA 1T98A 3J81Z 1Z7LA 1WPKA 2FBKA 3S3NA 5E8IA 2D2WA 2R7SA 5HDGA 4YIFA 3ZOBA 1MBHA 1YLFA 1WJAA 3UNGC 1S7EA 1D0ZA 2HKOA 4HRIA 1X1DA 1VTNC 4M9XA 3WE3A 4P55A 3HHGA 2IGOA 1HSJA 3J80K 1UHWA 2Z99A 3WHCA 3ZMZA 1MDMA 4XONA 1USTA 4NQWA 3LL7A 1RR8C 2UXNA 4KUMA 1ZAOA 3G71I 2AXTC 5D8KB 3ZP5A 4X6AJ 4E7KA 2M5WA 4BS9A 1G3TA 3HJEA 3SHFA 5ED4A 1UJ8A 3HEFA 4M6YA 4V19K 1SANA 1SMYF 1ZGJA 2MG4A 5K5RA 1S8NA 3HSEA 5KHDA 4QPOA 2YSRA 1SEUA 3LAJA 1BR4A 4D1QA 1IXCA 2KRHA 1OQYA 3ROUA 3J7YJ 4Q4ZF 3LOCA 5EG0A 2ZMEC 4R8HA 3K6GA 4OWRB 4UUTA 3HHHA 2DAOA 4XLFA 3LWFA 5F1JA 1JJ8C 3V7RA 4EMSA 2DBBA 2R7RA 4DIQA 3RYPA 5GPAA 5TISC 1AHDP 1I5ZA 2KKOA 3DTKA 2FNAA 1JGGA 3BOQA 2FSWA 5J6XA 3DFGA 5H6QA 4PZJA 1BI2A 3EQLF 2IRFG 4Y7NJ 3B73A 4XNFA 1BJAA 4JQFA 3S16J 3BPVA 2QA4I 1ZARA 4KICA 5HS9A 5KAFC 3BR6A 3BWGA 2TRTA 5EYRA 4ZC3A 2DLLA 4G9YA 4JX4A 6PAXA 3TKYA 1FWZA 1ETQA 3BLYA 4L5EA 4WXCA 1IN7A 2CUEA 3MVPA 5E79C 4BQNA 3ZQCA 3AAFA 2QYOA 1HKQA 4J19A 3BP8A 1AKHA 5F27A 3CF2A 2OC6A 3COAC 5J8CA 5D4SA 3QYBA 1BA5A 3R4KA 5LGUA 2QM3A 3DPLC 3BR1A 2GXGA 3VODA 2NS8A 4LG0B 4ZTJA 3KYDB 5HODA 3FK7A 1IXRC 1XGMA 4E7JA 3A2KA 5K7FA 2R92J 3QPLA 1ZGWA 3JRDA 3C18A 4KIFA 2WAQN 1XN7A 1FC3A 2EILH 1IN8A 3AG2H 3V8JA 3CF5F 1PUFB 1O4XA 1IDYA 4M71A 3FXUA 1WJEA 1GV2A 2L5QA 3ZPLA 2O9LA 2VE8A 2KZVA 3BCBA 4A5MA 2H6BA 2KJCA 4KA4A 4A3LJ 1MZBA 3FXKA 4P96A 2MC4A 2P5KA 2W4SA 2UUZA 1S7AA 3AG3H 4XL9A 4CYCA 3H0GJ 3HOXJ 3L2VA 5FLVA 1KQ0A 3FX3A 3OYMA 5F1RA 2A6EF 1T38A 3IWZA 1ETXA 2HQ5A 2UV1A 3HUGB 4ZZLA 4UY8I 4BNCA 3AL0C 3CESA 2XKPA 4M72A 4ENNA 3BY6A 4IOCF 3M9AA 2M87A 1U6GA 3EUKL 3IRRA 1F4KA 3OL4A 2XVCA 3WTYC 2EFWA 4A12A 2Y48A 4G7ZF 1R23A 3TP3A 1RKWA 1XSXA 1A31A 2YU9J 4LLLA 3DLLF 2JPBA 2R3SA 4AIHA 3IKVA 1F5TA 2RV8A 3SZGA 4U88A 4ZJZA 3CZ6A 2DTZA 1REPC 1W4MA 2CUZA 2DCEA 1R49A 3HTSB 2FF4A 4CGZA 3BZCA 1OCTC 2Q1ZB 3FBIB 1STZA 2CQQA 2CW0F 5L3BA 3EUHC 4IO9F 1YIJI 4V2FA 5D6FA 1QPIA 5FLXZ 1JKRC 3SDBA 1X1CA 3HOUJ 5FKNA 1J0RA 5CQGA 5IP7J 3GZ6A 1MBEA 2EZHA 4DZJA 3T8TA 3BG9A 1EA3A 1POGA 4ZH4F 5J4YA 2P8TA 4TV7A 2M4GA 3HDDA 3PQJA 2O8XA 2IBDA 3D5LA 2CUFA 2DMNA 2BYVE 2M3AA 2EIKH 4RM3A 5ILSA 1LE8B 1FBSA 1TWAJ 4A69C 3C1DA 3CMAI 4CCJA 1JT0A 3I4PA 1LFBA 4BY1J 3M07A 3M8FA 2W82A 1KU9A 2H1KA 2WB1A 5H20A 4Z6YA 2L7KA 1P9QC 3VSKA 1OCPA 3TOAA 2VLAA 2FMLA 2XAJA 4HYEA 3P9IA 1QRYA 2E5NA 4OU0A 5H2FC 2KDOA 2NNYA 1NH3A 2V79A 1X19A 3GUDA 3K69A 1K4TA 4CYCB 3WGHA 1WQ2A 1OR7A 5CVUA 1O3RA 1IC8A 4L5IA 1W7PA 4RMNA 1MMSA 2P4WA 1R6RA 1FBUA 1WJCA 2Y0SA 4HDUA 4ZDLA 3LNQA 2VL8A 2HR3A 3VSLA 1ZH5A 4NC8A 2JVHA 2GLOA 1VQLI 4DBQA 1I50J 4D0PA 1T6SA 2A69F 1LDDA 2WY7Q 5FKKA 3ERMA 1TNSA 4I0BA 5B5EC 1JKOC 2K02A 2WC2A 5D5UB 2QBYA 2Q8KA 2X1DA 4ITVA 4XRSG 2Q2EA 4F52A 4YFXF 4B1RA 4AYBN 4A3MJ 2XPWA 2ME6A 3UKGA 2NNNA 2E1MC 3FZVA 3LFUA 4PJ0C 3M1EA 4DOZA 2NYXA 1EJ9A 2EZLA 4QIWN 4GRIA 2IP2A 1RI7A 2LY2A 4GXOA 5D5WB 4UHTA 1XGNA 1SFEA 1SMTA 3CTAA 4B48A 3Q0VA 3IRQA 2R0QC 1Y1VJ 4ESBA 2O03A 4IHTA 2KIFA 1DUXC 2H6CA 2L2OA 2EFNA 4D5CA 5TGTA 3DWLE 1FYLA 2H1LA 3PUBA 3FM3A 2L7FP 2IA1A 1HDDC 4K2EA 1A5JA 2KP6A 1WJFA 1ORKA 4YRVA 1O3TA 2CO5A 5EJCA 1M1EB 3S8PA 4XLHA 1MJAA 3M7GA 2K3PA 1D8JA 3C2HA 3OYFA 3M3YJ 5BMZA 5GAHJ 2LKSA 5DDGA 3F8BA 1IJWC 3KEOA 3OWTA 3E3VA 4HX7A 4HF0A 3SYTA 5DUIA 2Z16A 5HS7A 1FP1D 4XOPA 1U8RA 3VB2A 4GO1A 4BE2A 3VOEA 1ZG1A 1YI2I 3REOA 2A5WA 3QPSA 1WJ5A 4XN0A 4BXUA 3DBHB 5LFAA 5D4RA 2DT5A 4G7HF 4RDUA 1V5EA 3OSFA 2X0LA 3GLXA 5JHFA 2DPUA 1N78A 2QGUA 4ANJA 2H09A 1X2MA 2L54A 2COMA 1D0YA 1MMDA 2XRLA 1HKSA 1BI1A 1QVUA 2HYFA 4ZYAA 4QTRA 3BR2A 3K70C 4HSRA 2QCOA 4OIPF 3KEQA 4KMFA 3SDGA 1A36A 4A3DJ 1PDNC 2ZJQF 1I6HJ 5E1WA 3K4KA 2CFXA 2CYYA 1HBXG 1K61A 5LRRA 2B9SA 5FLMJ 3BZKA 1HSTA 2DDAA 5E3OA 5DUKA 2IEKA 3G2BA 4CXFA 2DDBA 1J2XA 5K5OA 1Z77A 2F5DA 2P5LC 2V9PA 2VJJA 3GCMA 3RTRA 3H3UA 1WI3A 1Y0UA 1W5CC 2OUMA 4UVBA 2AO9A 1MD0A 2BBYA 1PUEE 2JMWA 3GO5A 1ON2A 4EQQA 2LSOA 2PMZN 3WG7H 3KLOA 2M7BA 1SAUA 3W6KB 1P2FA 1EH7A 2XGEA 1V5FA 1SC7A 3J7AO 1OCZH 1PVEA 3CP8A 2XB0X 1R1VA 4AWXB 3GTQJ 1T95A 3OIPA 3GTOJ 4ENKA 1MBKA 3FKJA 3IH2A 3CP2A 4Z2YA 1HW1A 2ESNA 2VI6A 5B66C 1EV7A 2XB5A 4FCYA 3H9QA 2BW3A 4ESJA 2R7VA 1UZCA 3GTLJ 2E1CA 2IGNA 2HOSA 1CQTA 1J59A 4PGGA 2WTEA 2V7FA 4KDPA 1JUMA 2BVMA 1FZPB 3BR0A 4DBRA 5E17F 1JUPA 1J5YA 2AXLA 1RRJA 4C3HJ 2EV6A 1B9NA 1MJBA 1JKQC 2CFOA 1DGRM 2VBYA 3I0TA 2Z33A 1YJNI 2K86A 2LH9A 4M3FA 4C3IJ 3R0JA 3I59B 4HNUA 1BW6A 1BR1A 3ERED 2X1EA 3W6JB 3BG3A 3KP3A 5ILVA 3ABKH 4BJ6C 4CSWA 1S3JA 2R5ZA 2E19A 4H4KC 1BBYA 3IC7A 3RKXA 1VFCA 1BR2A 1XCVA 1H89C 4RB3C 2P5VA 2VB6A 2RC4A 1YQAA 3F8MA 2BEOA 1FMWA 4BHCA 5KK1A 3OSGA 1X4OA 2PX9A 3ESWB 3I56I 1DU0A 4A0ZA 2D1VA 2MBFA 2QEXI 3ZXSA 1DP7P 3BCAA 4RS8A 1TWFJ 5D5VB 3G1LA 4XLAA 1WH5A 1QVTA 1IV8A 5DV5A 5DD4A 3ZQQA 3I9V2 3FHZA 2DJNA 2V1NA 3OS1A 2HVRA 1IN6A 1ZELA 2VASA 2X9DA 4NQWB 3ZQFA 4BU2A 2K9LA 3V7CA 2HZDA 2DOFA 3PO3J 2LRDA 3E5QA 4LK1F 4UV9A 2RGVA 4UUSA 4HV5A 1XMXA 1VQMI 2FOKA 2HS5A 1W0UA 1ZGAA 4E70A 2MW8A 3VYTB 2MH2A 1YTYA 1OYWA 2DU9A 1X3UA 2TDXA 2GAUA 3CLOA 1U2WA 4M3BA 3K2ZA 5FKMA 4U0YA 3ECHA 2HKXA 2YR2A 1ON1A 4LFUA 3RPUD 4BQAA 4MIMA 4XRSA 4NNJA 4XSZF 1R9TJ 3K4NA 2OZUA 3R0AA 5DCMA 2M7AA 2DFFA 5E18F 2HDWA 2JA6J 2VODA 4J01A 2LY1A 4V2GA 1MNEA 2ETHA 1R58A 4GCVA 5CYVA 3ZMDA 4EGZA 4FTHA 1WSUA 1JTYA 3MAJA 3TOBA 2GIVA 2H8RA 3S93A 1K79A 5F08A 4BACA 2G7HA 4IHYA 1DU6A 3AFHA 2JK3A 3FF5A 3JSOA 1RKTA 3HBLA 2MGQA 1V4RA 1DP3A 3BTJA 1WJDA 2DN0A 5FRNA 2EWNA 4O5VA 2QQBA 2CJJA 4CHUA 3KP4A 4CCMA 3NAUA 1LJ9A 1P7JA 5BNGA 3DTEA 4OIRF 2NVTJ 3TQNA 3IHUA 2EK5A 2K4JA 1JI8A 1V3FA 2PFBA 3KPHA 2DI3A 2EFPA 2E2IJ 1YW9A 2KISA 3BQYA 1Q1VA 1YS6A 5LEKA 1UFMA 2L02A 2E60A 3NWTA 1E3OC 5DM7F 3JW4A 2QWWA 3DPUA 3CUOA 1DQUA 5D6EA 1SVLA 4EVIA 1OKRA 1KU7A 2XAQA 1HA8A 4AIDA 2DODA 4L9JA 3KP5A 4LITA 1ZKGA 2YU3A 2K7LA 1BL0A 1WCMJ 3KETA 3N97A 3H3VK 2V9KA 3MFKA 3QU3A 2E1OA 2NS0A 1SAXA 2IW5A 2IAIA 3VYSB 3KP2A 2CQNA 3CCMI 3MKLA 2L9SA 1YOVB 4U7BA 2GZWA 2LTPA 3J80Z 4IHVA 2BXZA 2XPVA 4F3QA 1YJ9I 1T0FA 1IRGA 2L9NA 4D7NA 2AS5F 1S29A 2PQ8A 2ZKZA 2BY0A 5EZGA 4IL6C 3F21A 3CC4I 2XAGA 1LQ1A 1EH8A 2QENA 1NK3P 2NRAC 1C0WA 1U8BA 1XSDA 5ERIA 3KP7A 1F43A 1RR7A 4CUGA 4AUXA 3A01B 1UG0A 3AG1H 2QQ9A 1G3WA 2VT3A 2KIMA 3ONQA 4D7MA 4FHTA 2HYJA 4P1WA 1EKEA 3K10A 1ZTRA 2PMUA 3ZQIA 2ELHA 3TDUC 1MSFC 1WJBA 5M5XJ 2COBA 2Z9OA 3SJMA 3S15J 3JAMZ 1UCRA 1IN4A 2HWVA 2VJ4A 2A05A 4A5NA 5BOXA 2XGDA 1FYMA 2WADA 3WU1B 5FLXK 2XF6A 1ZYRF 1G59A 4B43A 3H5RA 3RQ4A 3ZQGA 1JTXA 3I4MJ 1XX5A 5ILUA 5DS9A 3LA2A 3D5RC 3QWLA 3BR3A 3OOPA 1KQ9A 2LR8A 2ID6A 1PP7U 2OV7A 4PJLA 2NAZA 2E35A 1QQIA 2RREA 2K85A 3BZ6A 1OCCH 2HPIA 4UNOA 3F3XA 1LFUP 2ME0A 5EZHA 3H35A 4A0XA 2FMYA 3WGGA 4BHBA 4QPQA 2A3SA 4X0GA 5DEQA 1BIBA 2EZKA 3KCCA 4XRFA 3FXQA 5ICCA 2EA4A 1QA6A 1WGXA 3H1CA 2DFHA 3H36A 1V54H 1GVJA 1IAWA 3DKYA 4BH9A 2DFEA 2EINH 3M8JA 2IVMA 2W24A 2HQAA 2DA5A 2VJ5A 5F0FA 1FSEA 5L3FA 3OYGA 3HGGA 3GXOA 3KEYA 2W00A 3W2VA 3MQ0A 2DOAA 2F5VA 4XM3A 4P9FA 2ZFWA 1B4AA 4ZTFA 2R4GA 3SFIA 1A6QA 1SVMA 2F4OB 3K4MA 1HXDA 1TT5B 1IZ1A 2OU2A 1P4AA 1KQ8A 1P92A 2XAHA 4XQFA 1FOWA 3S17J 5M3MJ 1FY7A 4X1EA 4BEHB 2PN6A 3K1MA 4WXDA 1R1TA 1BC7C 1FSHA 1O3SA 1H9GA 2XV4S 4G8XA 2DFIA 3GW2A 5CVIA 2DJIA 2IA0A 2I10A 3LSJA 3CDIA 1MSEC 2ACJA 2DA1A 2DA2A 1SFXA 2A5YB 4I2OA 1VZ0A 2ESHA 3OS0A 3EPZA 4JOMA 3NARA 3V7SA 2HTJA 2R7FA 3WTWC 1VQ7I 3CJNA 3PFYA 1ONVA 4Y3OA 3AKZA 2DQRA 1GUUA 3E97A 2R5YB 3CUQA 4M9ZA 3HUGA 1ZRCA 3CCYA 3DKWA 3BG6A 1V5GA 1Z3YA 4BUPA 4HLXA 4YFKF 1ERDA 4ZYDA 3PIPF 2RNJA 3GX4X 2XAFA 2J5OA 2M0MA 3C7JA 4HPQA 1E3HA 1MMAA 1R22A 4NC6A 3BR5A 1QZZA 4MHGA 3V4GA 1DDNA 3GTKJ 4Y17A 1D1BA 4I99C 3HB9A 1W36C 1Z0XA 2F4MB 3MMYB 4CO8A 1S7OA 3CMMA 4XN3A 5C44J 1JJ6C 2M8GX 4P5OA 3GTJJ 4FX4A 3ASNH 2VN2A 3W3CA 3G73A 3PO2J 2OCCH 2RQQA 4HEA2 4R79A 5A2QK 5FD5A 3ZN0A 4QSHA 2F2EA 4ASNA 3PUFA 3HOVJ 4O6JA 3SEQA 5FRMA 5HNHA 1H88C 2IPQX 1HQCA 4Y52J 3R60A 1ZG3A 3Q9VA 3LSTA 4JBAA 2CG4A 2DOEA 4CYDA 2BHYA 2Q0OA 3F9KA 4OMZA 2OD5A 3JRFA 5KCMA 1MNMC 3O6BB 4YIIA 2XKOA 3ULQB 1A35A 2F5CA 3E1SA 1B59A 2NS7A 4EJWA 1FEXA 3HPHA 3KZYA 1TQPA 5IYBJ 4IF4A 5AIPA 2EZIA 2O5RA 5EG0B 4BE0A 2MD0A 1LDJA 3WTVC 4L18B 3OYAA 2OQRA 3QOPA 2HTSA 2STTA 2DA3A 2WB1N 1APLC 4ZDOA 2Y2ZA 3CD6I 4E7ZA 4G6TB 3KP6A 4EJVA 3T5XA 4HDVA 5LGNA 4RBOA 5BPIA 4N9IA 4HLYA 1Y1WJ 3OYCA 2R7TA 4LB6B 1KYWA 2RAEA 1Z6TA 2VE9A 3MWMA 5IT9K 1A04A 1XD7A 3FXJA 4IJAA 3F23A 5FO5A 3GFMA 5CPRB 5J1YA 9ANTA 1RESA 1VQPI 2D45A 1IRZA 2QVOA 1HW2A 3BTLA 1X58A 1OJLA 2HDCA 3E6BA 5J1UA 3VYRB 5J47A 2CQKA 3Q3SA 4P9UA 4C9YA 2LNBA 4HNVA 2Z3YA 1XPXA 3J81K 1TP4A 1Y0NA 2XC7A 2JA5J 3GVAA 5EGOA 2RN7A 1ZRFA 5L3GA 3LSKA 3K4LA 4HA8A 3NWSA 3CCQI 3A02A 4ZYGA 2L9VA 2LLKA 5CQEA 2RVCA 1IF1A 2EQRA 2DMUA 2JRTA 2VPRA 2V1DA 3I71A 1CF7B 4A93J 1Z05A 2GOXB 3OYJA 2GM4A 2P0WA 4AIJA 4EJUA 4CCLA 3B02A 1SFOJ 2DTRA 3RCOA 5ICEA 3LA7A 3WTSC 4CDGA 3GYHX 2ZO4A 4NB5A 1T08B 2OAZA 3M4OJ 2TCTA 1OYIA 3MEXA 5F64A 3K4JA 3IP4B 1D8KA 5IYCJ 4XMYA 1TL8A 1YW7A 4CZZA 2XUBA 1LPQA 4KNYA 5JLXA 2RNGA 5K1YA 3GWZA 2MSYA 3HTUA 3HRUA 5IT3A 1JKPC 3JCUC 4WK8F 3O8HA 3FMSA 1JGSA 3F6VA 2VXDA 1ITYA 2A61A 3WODF 4PSWA 5E1XA 5BQTA 5IT9Z 3HIFA 1S5LC 2QSFX 4E7SA 2EV0A 3I58A 2KHMA 4KN7X 4CH7A 1MBJA 2DMPA 2ELJA 5IYDJ 1VQ8I 3TW6A 1ZREA 2WAFA 1I1SA 2VPLA 5C4XJ 5DYMA 1N25A 2LG4A 1OR7C 4B44A 1Z6RA 3OYDA 3KYCB 3PNVA 3TEDA 4IZZA 2QBYB 4DYRA 3KZIC 1XGSA 5LBQA 4N0BA 3H92A 4C2MJ 1UHSA 3OYLA 2NXNB 4UVCA 4YG2F 3DEUA 1H8AC 1H9TA 3HKZA 3QODA 5AONA 1HCRA 2M2EA 4A3CJ 4C2UA 3EETA 3ZCOA 1WH7A 3ZQ7A 5KVRA 3U1KA 2E36A 1MMNA 3TO7A 3IH3A 5L3DA 3ZGKA 3DU5A 3S2WA 3FXMA 3VYUB 4A3IJ 4QWQA 1UB9A 1HLVA 2QLZA 4RAGA 4F7ZA 2I5UA 3S1RJ 1QBJA 4GYIA 2IS2A 3JRIA 3S1QJ 1UAAA 2ZNZA 3L2CA 2PJRA 2P6SA 3MZHA 2HEOA 3L7WA 1TT0A 4F93B 1P4XA 1IRFA 3KX2A 4XKBA 4EM2A 1ZG5A 4UXNA 2NVXJ 1RETA 1MMGA 2M45A 4U0WA 4MLOA 1XS9A 2JSPA 1W7PB 3VPRA 2K3FA 3MKYB 2R5YA 5HLHA 3RI4A 4L9VA 2ECCA 2OBPA 2DA4A 3P7NA 3J7AY 3ABUA 5GAEJ 1MDMB 2ZB9A 2DMQA 3HRTA 3A01A 2BY2A 2XGCA 2LF7A 1O7FA 2OCEA 2UZKA 5DD8A 1XB4A 4II3A 4IXAA 1GT0C 2KJBA 3EDPA 2CW7A 3BROA 1O7LA 2JA8J 3LAPA 5LHIA 2OQGA 3FXLA 1OISA 1U9NA 2LREA 2VKVA 3ASOH 4XKWA 4NUBA 4E6KG 4HQEA 1T39A 1FLIA 1LB2A 2PLYA 2X6OA 4EJOA 4BDZA 1Z1DA 1P6RA 4HV6A 2HZTA 2MLKA 2K9SA 1SD6A 2KIQA 3EUAA 1H0MA 1X4PA 2ZXJA 2BY1A 1JE8A 5HDNA 4KFCA 1WZ2A 2FJ1A 1ZLJA 1TBXA 1BC8C 4PFOA 2KPMA 2V1UA 1RZ4A 5GTIC 1I39A 4BXXJ 3QQAA 1B8IB 4Y4RA 1FTTA 2X6WA 3D0SA 1N77A 1KU2A 3U2RA 2V1XA 5C4JJ 2Y0SN 3OMYA 4Y33A 4DZPA 3B6CA 2H27A 1LVAA 3F72A 2JTVA 3K7AJ 2EJRA 4OAYA 2YPRA 3LSMA 3WHBA 3BJOA 1MJ9A 2DO7A 3C2BA 3DQVC 1W36D 2QSGX 2HQNA 3WU2C 1F36A 1IW7F 2BE5F 1X1BA 5IP9J 5EF6A 3IL2A 2K9NA 3K1PA 2CV2A 1TQIA 2M0CA 4LIVA 3IKTA 2NVQJ 3BC8A 3L2RA 3DEEA 3CC2I 2VOOA 1R5ID 1GXPA 3DBLB 1Z91A 2IA2A 2M34A 4IRHA 4MFEA 1IGNA 1IXSB 3EYYA 1B1BA 1BM9A 4S05A 3K9TA 1S9HA 4NC7A 3JR9A 4IRIA 2R7UA 2XF5A 4HF2A 1BI0A 2Q2EB 3W2WA 2LK2A 2ISYA 2KMUA 5JHUA 3QRFF 1PUFA 4RB0A 2HDDA 3S14J 1HDPA 5GPCA 3JSPA 4KISA 4BL0B 4XLEA 1YW8A 1XTAA 2QKMB 2LKPA 3HSFA 1VQOI 1F1ZA 4N9HA 2MA3A 2ISZA 1FOKA 2DXIA 2MC3A 4HW0A 2QZ8A 4IOAF 1D1AA 3GBGA 2IXSA 3OL3A 2PJPA 2EV5A 2M1BA 5B1BH 1VQKI 1ODDA 4PJNA 1D3YA 2LOOA 3RPQA 3IAS2 3U1DA 3HOZJ 1VQ6I 3PSFA 2LFBA 2XDVA 2F5EA 2BGCA 5F0HA 3Q0WA 2BXYA 4FE4A 5HOOA 3G1OA 3DV8A 3FDYA 1RC9A 2KT0A 3BTIA 1LUJB 3QYFA 3JRCA 4Q5SF 2VQCA 3K0LA 2R7ZJ 5CVJA 5K7ZA 1E3PA 2EB7A 3WU0A 4XIDA 2VC0A 3I54A 1OYYA 1JT6A 4G94A 1SD5A 2PMZA 2X6YA 4WWCA 4JP0A 4C30A 2EBIA 3ZMVA 3TL4X 1G4DA 2R7QA 1HOMA 5JR3A 2Y9YA 4BBRJ 2HXOA 4KYWA 1FMVA 2NOJB 3DTIA 2E7WA 2EA2A 1F9NA 2QQAA 3K70D 3H9JA 4HQMA 4B3AA 1UMQA 2FU4A 2DA7A 3I4NJ 5DCMB 2R7OA 3GF2A 4PK4A 2VOPA 3HRSA 2XIGA 3E5UA 4RAFA 3WTTC 3BPXA 1U78A 3G6EI 3OR1C 4I7HA 1ZK8A 3N4MA 3BJ6A 2VUMJ 3L1PA 3HL2A 2ZMEA 3HRMA 2BY3A 1ETWA 1RPWA 1IDZA 2IGMA 4LGWA 4GFBA 2LF8A 4EATA 1LFPA 2ECBA 2K9MA 1E2XA 2OA4A 1Q1HA 2XRNA 1GDTA 5F04A 2ZNYA 2AQEA 3HOTA 2EFQA 2CSOA 2FBIA 4XRMA 1K83J 1ZHFA 4L0YB 2M30A 5CJ9A 5E1ZB 3CLQA 1PYVA 1SFKA 1YX5A 4YELA 3NEUA 4YIRX 2FOWA 2Z5UA 5CVVA 1X1PA 3ABTA 3LMMA 5GP9A 2KZGA 2HGCA 2KIUA 4GYGA 2Y9ZA 3SZTA 4LOCA 1TZLA 3S1NJ 5FB2A 5J40A 3C3WA 1K6OA 2LMDA 3SEZA 2K40A 1W7PD 3O3KA 1BOAA 3LQRA 2ZSIB 4S0HB 2HNHA 4B4CA 1D0XA 2DW4A 3HM5A 5LRSA 4PDKA 3OYEA 4UUVA 3PIOF 2VJIA 1RUOA 2P7CB 2GXBA 4RGSA 1TWGJ 5FGMA 5LD2C 4ENJA 3I59A 2C6YA 4A6DA 1FOYA 3HG9A 2CUJA 3PFIA 2L01A 3BJAA 1BN5A 4KN4X 5CKTA 1E0EA 4BJTA 3VFZA 2X51A 2HVSA 1AKHB 4J00A 2Y31A 1DPUA 2ZMEB 2WAEA 2UWMA 5HVQC 2UXXA 2ZJPF 1TWCJ 2VBWA 4XORA 3U21A 4AM3A 5LEJA 2V9VA 5DTDA 1BW5A 3CDHA 3QPHA 1OPCA 1MBFA 3HGYA 1YG2A 5ICGA 4DGWB 3MKWB 1CGPA 2WWYA 2JN6A 1WKMA 2G0EA 3KFWX 3F6OA 5J4VA 2WV0A 2O0YA 2HYGD 4BJ5C 4IHSA 2JZYA 4UB6C 1JHFA 5B3SH 4C2TA 3BG5A 4U0VA 4I01A 1R00A 2G7UA 1T33A 1WI9A 3F8CA 1YS7A 5FKOA 1T0FC 2XSJC 4IHXA 1QU3A 2CRGA 4M73A 2KRCA 4Y15A 1KU3A 5IOZA 1QNTA 5IY5H 1BOBA 3JRBA 5A2QZ 2Z2SB 1SFUA 4AVZA 3HOWJ 3DBRB 4AD9A 3V8KA 4JX5A 4C3JJ 5M5YJ 2MABA 1ETVA 3E7LA 4HX4A 3SQNA 3H5NA 3A0HC 2ZXWH 3MZ8A 3I53A 4FISA 3FXOA 4G7OF 3HZJA 5TJJA 1I1GA 3WTXC 1N75A 3LA3A 4FE7A 4DW6A 1QHGA 4FETA 1KGSA 2WA0A 2B7EA 1IV6A 2W1OA 2AQFA 1RNLA 3HKZN 1I3AA 3NQOA 3F22A 2VBZA 1IUFA 4ZYHA 1R71A 2PBIA 2BW3B 2P81A 3BQZA 3OYBA 2LD5A 2IGKA 3QU6A 2W7NA 3D1NI 2KRFA 4IQ4A 3OR2C 4BDYA 3OIOA 2BOLA 5CLSA 4BEHA 3A4CA 3L2QA 4I6ZA 4MEXF 1TLHB 4PFPA 2DK8A 3TBIA 2Y0MA 2GBYA 4RGXA 1D1CA 4MFDA 2VKDA 2IS6A 3X2QH 1XDUA 2ZBKA 2IT0A 2QSHX 1LNWA 1YJWI 1I6XA 3ZMTA 1HF0A 3TMOA 2NVUB 3VWBA 3RZOJ 3FBNB 1QO0D 2K27A 3NRVA 4DNCA 3MD2A 4XSXF 1VQNI 2R7XA 3WG9A 2HOEA 2L7MP 2DYRH 1K7AA 1DPRA 5K5QA 3E0JB 2CMPA 2JVGA 3GFIA 2LVSA 1TQMA 3SFZA 4F55A 2A6HF 2NOGA 2XSDC 3K4CA 2RKHA 4IVNA 5HLGA 5KAIC 3SZPA 4II2A 3WTUC 1ZRDA 5IOYA 5M5WJ 3RDIA 2CU7A 2D1HA 2M4KA 4XBFA 4IHWA 4OIQF 1ULYA 4E7HA 3L09A 3OY9A 4I02A 3TO9A 3QPTA 3LQQA 2MH9A 1OMIA 4PGHA 2L7ZA 4BAYA 3O2PE 2LBFA 3AL0B 1LKXA 4IEJA 1WHUA 4CZCA 2PEXA 1HW5A 1MBGA 3DEWA 1G3SA 2CQXA 2OJED 5D5XB 3OYHA 3JAMK 3GEZA 1YFHA 2CQ7A 5EDNA 4AIKA 3S2HJ 4F91B 1P4WA 4AU7A 2DT6A 3A1YA 5FD6A 3CMEI 5JLWA 4H0EA 4CICA 4FQGA 1YIOA 5EEHA 2H8WA 4QLCU 5BS6A 5HLTA 3OS2A 1S72I 4XLPF 4E7LA 3HOYJ 2OTLI 1IO2A 3FWEA 4ZZDA 2DT7B 4BXFA 2KDZA 1XDSA 4GDFA 3GFJA 1USSA 4RM2A 4LJZF 5E3MA 1VQ4I 1MKMA 3PSIA 1AWCA 4LK0F 3K2AA 5F0CA 1TTYA 3IV5A 1BJZA 1TW3A 2O3FA 1ENHA 2A68F 1EF4A 4NDLA 3CCEI 2O8KA 2E5ZA 4KIBA 3TGNA 4HBLA 1QZEA 5KNLA 5GAGJ 2MD5A 2QUFA 4ENMA 4IX7A 4XLCA 2VQGA 3L2UA 2FXAA 2GXAA 3QOEA 2ID3A 3JREA 3ZQHA 4PJJA 2IS1A 2VBXA 3CUQC 3JTGA 5HLIA 3GZNB 2XHKA 3QP5A 4LIUA 1LDKB
chains in the Genus database with same CATH topology
1J9IA 1FX7A 1CF7A 1TNTA 5LHGA 1G6NA 3ML6A 4B09A 4RAZA 3RPUA 4LG0A 3P9KA 3SXYA 2K4BA 3WGIA 3Q5FA 1FNNA 4BYYA 1AOYA 3R6SA 3E5XA 1J7KA 4EJTA 1KYZA 2X4HA 4HF1A 2PI0A 2FEZA 1FPQA 3PQKA 4WF2A 5LLQA 3RIRA 4IRGA 5HS8A 3T0YA 2RDPA 3DXJF 2E7XA 2FQ3A 3GFLA 2DPDA 3QAHA 1K78A 2E1NA 4L9NA 5AIQA 4ON0A 4A0YA 2LDUA 1SD7A 1EH6A 5L3EA 5LGTA 4OMYA 2P6TA 4G6DA 1HKTA 1R36A 3L9FA 2MLGA 5JVTA 2FNPA 2FA5A 4KIGA 4WCGA 3I64A 3FMRA 1W5TA 4ESFA 4GGGA 2P7VB 2ADUA 2YX4A 4A6EA 3TDZC 2GWRA 5L3CA 2OZ6A 2W84A 2FBHA 3RJPA 1R7JA 2W25A 5CVRA 2CGPA 4OIOF 5FFXA 2VT2A 3E6MA 3TO6A 2R7DA 3Q9SA 1XSVA 4JK1X 2RQPA 3FXRA 4UVAA 1T2KA 3KE2A 3CUQB 1FBQA 4RGRA 2ZCWA 4UV8A 3ZMSA 4G6QA 1FP2A 2PG4A 4KT5C 1SD4A 1O57A 1S6LA 4Q47A 1R5GA 4LLNA 1XGOA 2W85A 4O3MA 4IPAA 3FMQA 1GXQA 4WX9A 1E17A 4ZYEA 1IN5A 1ZLKA 1QPMA 2JT1A 4I98B 3WTZA 4LB5A 1FT9A 2XGXA 4OOIA 4M74A 2IJLA 2A07F 1QGPA 3E6DA 2DQLA 2XROA 5H6RA 1L0OC 2F5FA 4M6XA 3WE2A 1Z7UA 2L4MA 5TRDA 1MGTA 1ZN2A 1XCBA 3F8FA 1LEAA 2STWA 4FX0A 2JPCA 1W5SA 3CO6C 2O6GE 3HSRA 1KA8A 3P9CA 4L0ZB 2CWEA 1WRJA 3DF8A 2DK5A 4B8XA 5HDKA 3IWFA 5LHHA 1BI3A 2VXZA 4R1HA 3DP7A 4PCQA 4ETSA 5JFRA 1K78B 5DCFA 3M8EA 4EV0A 1RIOH 1JHHA 4I0AA 3I5UA 4FT8A 3U9GA 5BPDA 3E6CC 4OINF 1U5TB 2GA2A 4MTEA 2BV6A 1Z9CA 3V8LA 1QZYA 2EFOA 1YYVA 2B0LA 1J75A 1R5HA 1PP8F 1U3EM 2GQQA 2HFHA 3F8NA 2GA1A 1L3LA 2PMHA 5E20A 1RUNA 4RAYA 2Y75A 4WXHA 3G3ZA 3T8RA 2VONA 4YFNF 3DPTA 4RB2C 3KZZA 4MNUA 1IUYA 4AVPA 4LD5A 3ECOA 4U7DA 2G9WA 3T1BA 4BHPA 2XASA 4Q48A 3ZN1A 3JTHA 4DQ2A 1O3QA 4RB1A 4HOBA 1BIAA 3L00A 5E8GA 4LMYA 1YO5C 1NHAA 1GHCA 3VEPA 3LFKA 3K1NA 2M8EA 3QP6A 2HQRA 1XMKA 3ELKA 5F6FA 2FRHA 1LEBA 3EYIA 1B6AA 4M9SA 2JSCA 3R61A 4MTDA 4KMUX 5J8FA 5ICFA 4RGUA 1JXSA 3GZ5A 3BDDA 3ZMUA 2H94A 4MEYF 4MQ9F 4L9TA 1U5TA 4S04A 3CO7C 1XMAA 1R1UA 1B9MA 2J5PA 2L3DA 3HOSA 3HYIA 1D5VA 5EEGA 3MZYA 4MQVA 2ZJ2A 1TW2A 3RKYA 4EM0B 4XLNF 1G3YA 3RKWA 3MCZA 1WWXA 4LLGF 5JI6A 4EM1A 4NHJA 2W57A 2FE3A 4EGYA 1U5TC 2O61A 2YX7A 1I27A 3H3ZA 3ISPA 4HZFA 4I09A 2L4AA 2VC1A 3FM5A 3EUHA 5FFZA 3RYRA 4L5JA 3KLNA 2V6CA 4HX8A 4HAMA 4MGRA 1FYKA 1UHMA 5D8LB 4A2UA 4Y13A 3OV8A 1T98A 3J81Z 2FBKA 5E8IA 2D2WA 5HDGA 4YIFA 1YLFA 2HKOA 1VTNC 4M9XA 3WE3A 4P55A 3HHGA 1HSJA 3J80K 1UHWA 2Z99A 3ZMZA 1MDMA 1USTA 4NQWA 2UXNA 4KUMA 1ZAOA 5D8KB 3ZP5A 2M5WA 1G3TA 3SHFA 5ED4A 4M6YA 1SMYF 1ZGJA 5K5RA 1S8NA 3HSEA 2YSRA 3LAJA 1IXCA 3ROUA 4Q4ZF 4R8HA 3HHHA 2DAOA 3LWFA 3V7RA 4EMSA 2DBBA 3RYPA 1I5ZA 2KKOA 2FNAA 3BOQA 2FSWA 5J6XA 3DFGA 5H6QA 4PZJA 1BI2A 3EQLF 2IRFG 3B73A 1BJAA 4JQFA 3BPVA 1ZARA 4KICA 5HS9A 3BWGA 2DLLA 4G9YA 6PAXA 3TKYA 1FWZA 4WXCA 1IN7A 3AAFA 2QYOA 1HKQA 3BP8A 3COAC 5J8CA 5D4SA 3R4KA 5LGUA 2QM3A 3DPLC 2GXGA 3VODA 4LG0B 1IXRC 1XGMA 3C18A 4KIFA 1XN7A 1FC3A 1IN8A 3V8JA 4M71A 3FXUA 3ZPLA 2VE8A 4A5MA 2H6BA 2KJCA 4KA4A 1MZBA 4P96A 2P5KA 1S7AA 1KQ0A 3FX3A 5F1RA 2A6EF 1T38A 3IWZA 4ZZLA 4BNCA 2XKPA 4M72A 4ENNA 3BY6A 3M9AA 2M87A 1U6GA 3IRRA 1F4KA 2XVCA 3WTYC 2EFWA 4A12A 2Y48A 4G7ZF 1R23A 1XSXA 4LLLA 2JPBA 2R3SA 4AIHA 3IKVA 1F5TA 2RV8A 4U88A 1REPC 1W4MA 3HTSB 2FF4A 4CGZA 1STZA 2CW0F 5L3BA 5D6FA 5FLXZ 1J0RA 3GZ6A 3T8TA 4ZH4F 2P8TA 4TV7A 3PQJA 2O8XA 3D5LA 2BYVE 5ILSA 1FBSA 3C1DA 3I4PA 3M8FA 1KU9A 5H20A 3TOAA 2FMLA 2XAJA 4HYEA 3P9IA 4OU0A 2NNYA 2V79A 3GUDA 3K69A 3WGHA 1WQ2A 1OR7A 1O3RA 5CVUA 4L5IA 1W7PA 2P4WA 1FBUA 4HDUA 2HR3A 1ZH5A 4D0PA 1T6SA 2A69F 1LDDA 1TNSA 4I0BA 2K02A 2WC2A 5D5UB 2QBYA 2Q8KA 2Q2EA 4YFXF 2NNNA 3FZVA 3M1EA 2NYXA 2IP2A 1RI7A 4GXOA 5D5WB 4UHTA 1XGNA 1SFEA 1SMTA 3CTAA 3IRQA 4ESBA 2O03A 4IHTA 2KIFA 1DUXC 2H6CA 2EFNA 1FYLA 3FM3A 2IA1A 4K2EA 1O3TA 2CO5A 1MJAA 3M7GA 1D8JA 5BMZA 5DDGA 3F8BA 3KEOA 3E3VA 4HX7A 4HF0A 5DUIA 5HS7A 1FP1D 1U8RA 3VB2A 4GO1A 3VOEA 1ZG1A 3REOA 4BXUA 5D4RA 2DT5A 4G7HF 2X0LA 3GLXA 2DPUA 2H09A 2L54A 2COMA 1HKSA 1BI1A 2HYFA 4OIPF 3KEQA 4KMFA 1PDNC 5E1WA 2CFXA 2CYYA 1HBXG 5LRRA 1HSTA 4CXFA 5DUKA 1J2XA 5K5OA 2F5DA 2P5LC 3RTRA 3H3UA 1Y0UA 4UVBA 1MD0A 2BBYA 1PUEE 3GO5A 1ON2A 4EQQA 2LSOA 3KLOA 3W6KB 1P2FA 1EH7A 3J7AO 1R1VA 4AWXB 4ENKA 4Z2YA 1HW1A 2ESNA 1EV7A 4ESJA 2E1CA 1J59A 4PGGA 2WTEA 4KDPA 1FZPB 5E17F 1J5YA 2AXLA 2EV6A 1B9NA 1MJBA 2VBYA 3I0TA 2Z33A 2K86A 3R0JA 3I59B 3ERED 3W6JB 3KP3A 5ILVA 1S3JA 1BBYA 3IC7A 3RKXA 1XCVA 4RB3C 2P5VA 2RC4A 1YQAA 3F8MA 2BEOA 4BHCA 5KK1A 4A0ZA 2D1VA 2MBFA 1DP7P 4RS8A 5D5VB 5DV5A 5DD4A 3FHZA 1IN6A 3V7CA 3E5QA 4LK1F 4UV9A 2RGVA 4HV5A 2FOKA 2HS5A 1ZGAA 4E70A 1YTYA 2MH2A 1OYWA 2DU9A 1X3UA 2TDXA 2GAUA 3CLOA 1U2WA 3K2ZA 4U0YA 3ECHA 2HKXA 2YR2A 1ON1A 4LFUA 4BQAA 4XSZF 2OZUA 3R0AA 5DCMA 5E18F 2VODA 4GCVA 2ETHA 1R58A 5CYVA 3ZMDA 4EGZA 1WSUA 3MAJA 3TOBA 2GIVA 1K79A 2G7HA 3FF5A 3JSOA 1V4RA 2EWNA 4O5VA 2QQBA 4CHUA 3KP4A 1LJ9A 4OIRF 3TQNA 3IHUA 2EK5A 2K4JA 1V3FA 2PFBA 2DI3A 2EFPA 1YW9A 5LEKA 1YS6A 1UFMA 2L02A 3JW4A 2QWWA 3CUOA 5D6EA 4EVIA 1KU7A 1OKRA 2XAQA 4L9JA 3KP5A 2YU3A 2K7LA 3KETA 3N97A 3MFKA 3QU3A 2NS0A 1SAXA 2IW5A 3KP2A 4U7BA 2GZWA 3J80Z 1T0FA 1IRGA 2AS5F 1S29A 2PQ8A 2ZKZA 3F21A 2XAGA 1LQ1A 1EH8A 2QENA 2NRAC 1C0WA 1XSDA 5ERIA 3KP7A 2QQ9A 1G3WA 2VT3A 2KIMA 4FHTA 2PMUA 2ELHA 3TDUC 2Z9OA 3JAMZ 1UCRA 1IN4A 2HWVA 4A5NA 5BOXA 1FYMA 3WU1B 5FLXK 1ZYRF 5ILUA 3LA2A 3OOPA 1KQ9A 1PP7U 2NAZA 1QQIA 3BZ6A 4UNOA 3F3XA 4A0XA 2FMYA 3WGGA 4BHBA 2A3SA 5DEQA 1BIBA 3KCCA 4XRFA 3FXQA 5ICCA 2EA4A 1GVJA 1IAWA 4BH9A 2IVMA 2W24A 1FSEA 5L3FA 3GXOA 3MQ0A 4P9FA 2ZFWA 1B4AA 1HXDA 1IZ1A 2OU2A 1P4AA 1KQ8A 1P92A 2XAHA 1FY7A 2PN6A 3K1MA 4WXDA 1R1TA 1BC7C 1FSHA 1O3SA 1H9GA 2XV4S 4G8XA 2DFIA 3GW2A 5CVIA 2IA0A 2ACJA 1SFXA 2A5YB 4I2OA 2ESHA 3V7SA 2HTJA 2R7FA 3WTWC 3CJNA 1ONVA 2DQRA 3E97A 3CUQA 4M9ZA 3HUGA 1ZRCA 3DKWA 4YFKF 4HLXA 4ZYDA 2RNJA 3GX4X 2XAFA 2J5OA 3C7JA 3V4GA 4MHGA 1R22A 1DDNA 1QZZA 4Y17A 4CO8A 1S7OA 4P5OA 4FX4A 2VN2A 3G73A 5A2QK 4R79A 5FD5A 3ZN0A 2F2EA 4ASNA 4O6JA 2IPQX 1HQCA 3R60A 1ZG3A 3Q9VA 3LSTA 4JBAA 2CG4A 4CYDA 2Q0OA 4OMZA 2OD5A 3O6BB 4YIIA 2XKOA 3ULQB 2F5CA 1B59A 4EJWA 3KZYA 1TQPA 4IF4A 5AIPA 1LDJA 3WTVC 4L18B 2OQRA 3QOPA 2HTSA 2STTA 3KP6A 4EJVA 3T5XA 4HDVA 5LGNA 5BPIA 4N9IA 4HLYA 4LB6B 1KYWA 2VE9A 1Z6TA 3MWMA 5IT9K 1A04A 1XD7A 4IJAA 3F23A 5FO5A 3GFMA 2D45A 2QVOA 1HW2A 2HDCA 3E6BA 2CQKA 4P9UA 2LNBA 2Z3YA 3J81K 3GVAA 1ZRFA 2RN7A 5L3GA 4HA8A 4ZYGA 2RVCA 1IF1A 2JRTA 3I71A 2V1DA 1CF7B 1Z05A 4AIJA 4EJUA 3B02A 2DTRA 5ICEA 3LA7A 3WTSC 4CDGA 3GYHX 2ZO4A 4NB5A 2OAZA 1OYIA 3MEXA 5F64A 1D8KA 1YW7A 4CZZA 2XUBA 4KNYA 5K1YA 3GWZA 3HTUA 3HRUA 5IT3A 4WK8F 3FMSA 1JGSA 3F6VA 2A61A 3WODF 5E1XA 5BQTA 5IT9Z 3HIFA 2EV0A 3I58A 4KN7X 1ZREA 1I1SA 5DYMA 1Z6RA 2QBYB 1XGSA 5LBQA 4N0BA 3H92A 4UVCA 4YG2F 3DEUA 1H9TA 5AONA 3EETA 3ZQ7A 5KVRA 3TO7A 5L3DA 3S2WA 4QWQA 1UB9A 2QLZA 4F7ZA 1QBJA 4GYIA 2ZNZA 3L2CA 2P6SA 3MZHA 2HEOA 3L7WA 1P4XA 1IRFA 4EM2A 1ZG5A 4UXNA 2M45A 4U0WA 1W7PB 3RI4A 5HLHA 4L9VA 3P7NA 2OBPA 3ABUA 1MDMB 3HRTA 2LF7A 1O7FA 2UZKA 5DD8A 1XB4A 4IXAA 2KJBA 3EDPA 3BROA 1O7LA 3LAPA 5LHIA 2OQGA 4HQEA 1T39A 1FLIA 1LB2A 2PLYA 4EJOA 1Z1DA 1P6RA 4HV6A 2HZTA 2MLKA 1SD6A 1H0MA 2ZXJA 1JE8A 5HDNA 4KFCA 1ZLJA 1TBXA 1BC8C 2V1UA 1RZ4A 3D0SA 1KU2A 3U2RA 2V1XA 2H27A 1LVAA 3F72A 2JTVA 2EJRA 2YPRA 3BJOA 1MJ9A 2DO7A 3DQVC 2HQNA 1IW7F 2BE5F 3IL2A 3K1PA 1TQIA 3IKTA 2VOOA 1GXPA 1Z91A 2IA2A 4IRHA 1IXSB 3EYYA 1B1BA 1BM9A 4S05A 3K9TA 4IRIA 4HF2A 1BI0A 2ISYA 5JHUA 3QRFF 4RB0A 3JSPA 1YW8A 2LKPA 3HSFA 1F1ZA 4N9HA 2MA3A 2ISZA 1FOKA 2MC3A 4HW0A 2QZ8A 2PJPA 2EV5A 2M1BA 1ODDA 1D3YA 3RPQA 3U1DA 2F5EA 2BGCA 5HOOA 3DV8A 4Q5SF 3K0LA 5CVJA 2EB7A 3WU0A 2VC0A 3I54A 1OYYA 4G94A 1SD5A 4WWCA 3ZMVA 1G4DA 5JR3A 4KYWA 2E7WA 2EA2A 1F9NA 2QQAA 4HQMA 2FU4A 5DCMB 3GF2A 2VOPA 3HRSA 2XIGA 3E5UA 3WTTC 3BPXA 1U78A 4I7HA 3N4MA 3BJ6A 2ZMEA 3HRMA 4LGWA 2LF8A 2OA4A 1E2XA 1Q1HA 2XRNA 2ZNYA 3HOTA 2EFQA 2CSOA 2FBIA 1ZHFA 4L0YB 2M30A 5CJ9A 5E1ZB 3NEUA 2Z5UA 5CVVA 3ABTA 2HGCA 2KIUA 4GYGA 3SZTA 5FB2A 1K6OA 3C3WA 1W7PD 3O3KA 1BOAA 3LQRA 2DW4A 5LRSA 4PDKA 4UUVA 1RUOA 2P7CB 2GXBA 4RGSA 5FGMA 4ENJA 3I59A 2C6YA 4A6DA 3PFIA 2L01A 3BJAA 1BN5A 4KN4X 3VFZA 1DPUA 2ZMEB 2UWMA 5HVQC 2UXXA 2VBWA 5LEJA 2V9VA 3CDHA 3QPHA 1OPCA 5ICGA 1YG2A 1CGPA 2WWYA 1WKMA 3KFWX 3F6OA 2WV0A 2O0YA 2HYGD 4IHSA 2JZYA 1JHFA 4U0VA 4I01A 1R00A 2G7UA 1WI9A 3F8CA 1YS7A 4M73A 4Y15A 1KU3A 1QNTA 5A2QZ 1SFUA 4AD9A 3V8KA 3SQNA 4HX4A 3I53A 4G7OF 5TJJA 1I1GA 3WTXC 3LA3A 1KGSA 1RNLA 3NQOA 3F22A 2VBZA 4ZYHA 2PBIA 3QU6A 2KRFA 5CLSA 4MEXF 1TLHB 2DK8A 2Y0MA 4RGXA 1XDUA 2ZBKA 2IT0A 1LNWA 1I6XA 3ZMTA 1QO0D 2K27A 3NRVA 4DNCA 4XSXF 3WG9A 2HOEA 1K7AA 1DPRA 5K5QA 3GFIA 1TQMA 3SFZA 2A6HF 2RKHA 4IVNA 5HLGA 3SZPA 1ZRDA 3WTUC 3RDIA 2D1HA 4XBFA 4OIQF 1ULYA 3L09A 4I02A 3TO9A 3QPTA 3LQQA 2MH9A 1OMIA 4PGHA 4BAYA 3O2PE 2PEXA 1HW5A 1G3SA 5D5XB 3JAMK 3GEZA 1YFHA 4AIKA 1P4WA 5FD6A 4H0EA 4CICA 1YIOA 5EEHA 4QLCU 5BS6A 4XLPF 3FWEA 4ZZDA 1XDSA 3GFJA 1USSA 4LJZF 1MKMA 1AWCA 4LK0F 1TTYA 1TW3A 2O3FA 2A68F 4KIBA 3TGNA 4HBLA 2MD5A 2QUFA 4ENMA 2FXAA 2VBXA 3CUQC 3JTGA 5HLIA 2XHKA 3QP5A 1LDKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J9I A;  1FX7 A;  1CF7 A;  1TNT A;  5LHG A;  1G6N A;  3ML6 A;  4B09 A;  4RAZ A;  3RPU A;  4LG0 A;  3P9K A;  3SXY A;  2K4B A;  3WGI A;  3Q5F A;  1FNN A;  4BYY A;  1AOY A;  3R6S A;  3E5X A;  1J7K A;  4EJT A;  1KYZ A;  2X4H A;  4HF1 A;  2PI0 A;  2FEZ A;  1FPQ A;  3PQK A;  4WF2 A;  5LLQ A;  3RIR A;  4IRG A;  5HS8 A;  3T0Y A;  2RDP A;  3DXJ F;  2E7X A;  2FQ3 A;  3GFL A;  2DPD A;  3QAH A;  1K78 A;  2E1N A;  4L9N A;  5AIQ A;  4ON0 A;  4A0Y A;  2LDU A;  1SD7 A;  1EH6 A;  5L3E A;  5LGT A;  4OMY A;  2P6T A;  4G6D A;  1HKT A;  1R36 A;  3L9F A;  2MLG A;  5JVT A;  2FNP A;  2FA5 A;  4KIG A;  4WCG A;  3I64 A;  3FMR A;  1W5T A;  4ESF A;  4GGG A;  2P7V B;  2ADU A;  2YX4 A;  4A6E A;  3TDZ C;  2GWR A;  5L3C A;  2OZ6 A;  2W84 A;  2FBH A;  3RJP A;  1R7J A;  2W25 A;  5CVR A;  2CGP A;  4OIO F;  5FFX A;  2VT2 A;  3E6M A;  3TO6 A;  2R7D A;  3Q9S A;  1XSV A;  4JK1 X;  2RQP A;  3FXR A;  4UVA A;  1T2K A;  3KE2 A;  3CUQ B;  1FBQ A;  4RGR A;  2ZCW A;  4UV8 A;  3ZMS A;  4G6Q A;  1FP2 A;  2PG4 A;  4KT5 C;  1SD4 A;  1O57 A;  1S6L A;  4Q47 A;  1R5G A;  4LLN A;  1XGO A;  2W85 A;  4O3M A;  4IPA A;  3FMQ A;  1GXQ A;  4WX9 A;  1E17 A;  4ZYE A;  1IN5 A;  1ZLK A;  1QPM A;  2JT1 A;  4I98 B;  3WTZ A;  4LB5 A;  1FT9 A;  2XGX A;  4OOI A;  4M74 A;  2IJL A;  2A07 F;  1QGP A;  3E6D A;  2DQL A;  2XRO A;  5H6R A;  1L0O C;  2F5F A;  4M6X A;  3WE2 A;  1Z7U A;  2L4M A;  5TRD A;  1MGT A;  1ZN2 A;  1XCB A;  3F8F A;  1LEA A;  2STW A;  4FX0 A;  2JPC A;  1W5S A;  3CO6 C;  2O6G E;  3HSR A;  1KA8 A;  3P9C A;  4L0Z B;  2CWE A;  1WRJ A;  3DF8 A;  2DK5 A;  4B8X A;  5HDK A;  3IWF A;  5LHH A;  1BI3 A;  2VXZ A;  4R1H A;  3DP7 A;  4PCQ A;  4ETS A;  5JFR A;  1K78 B;  5DCF A;  3M8E A;  4EV0 A;  1RIO H;  1JHH A;  4I0A A;  3I5U A;  4FT8 A;  3U9G A;  5BPD A;  3E6C C;  4OIN F;  1U5T B;  2GA2 A;  4MTE A;  2BV6 A;  1Z9C A;  3V8L A;  1QZY A;  2EFO A;  1YYV A;  2B0L A;  1J75 A;  1R5H A;  1PP8 F;  1U3E M;  2GQQ A;  2HFH A;  3F8N A;  2GA1 A;  1L3L A;  2PMH A;  5E20 A;  1RUN A;  4RAY A;  2Y75 A;  4WXH A;  3G3Z A;  3T8R A;  2VON A;  4YFN F;  3DPT A;  4RB2 C;  3KZZ A;  4MNU A;  1IUY A;  4AVP A;  4LD5 A;  3ECO A;  4U7D A;  2G9W A;  3T1B A;  4BHP A;  2XAS A;  4Q48 A;  3ZN1 A;  3JTH A;  4DQ2 A;  1O3Q A;  4RB1 A;  4HOB A;  1BIA A;  3L00 A;  5E8G A;  4LMY A;  1YO5 C;  1NHA A;  1GHC A;  3VEP A;  3LFK A;  3K1N A;  2M8E A;  3QP6 A;  2HQR A;  1XMK A;  3ELK A;  5F6F A;  2FRH A;  1LEB A;  3EYI A;  1B6A A;  4M9S A;  2JSC A;  3R61 A;  4MTD A;  4KMU X;  5J8F A;  5ICF A;  4RGU A;  1JXS A;  3GZ5 A;  3BDD A;  3ZMU A;  2H94 A;  4MEY F;  4MQ9 F;  4L9T A;  1U5T A;  4S04 A;  3CO7 C;  1XMA A;  1R1U A;  1B9M A;  2J5P A;  2L3D A;  3HOS A;  3HYI A;  1D5V A;  5EEG A;  3MZY A;  4MQV A;  2ZJ2 A;  1TW2 A;  3RKY A;  4EM0 B;  4XLN F;  1G3Y A;  3RKW A;  3MCZ A;  1WWX A;  4LLG F;  5JI6 A;  4EM1 A;  4NHJ A;  2W57 A;  2FE3 A;  4EGY A;  1U5T C;  2O61 A;  2YX7 A;  1I27 A;  3H3Z A;  3ISP A;  4HZF A;  4I09 A;  2L4A A;  2VC1 A;  3FM5 A;  3EUH A;  5FFZ A;  3RYR A;  4L5J A;  3KLN A;  2V6C A;  4HX8 A;  4HAM A;  4MGR A;  1FYK A;  1UHM A;  5D8L B;  4A2U A;  4Y13 A;  3OV8 A;  1T98 A;  3J81 Z;  2FBK A;  5E8I A;  2D2W A;  5HDG A;  4YIF A;  1YLF A;  2HKO A;  1VTN C;  4M9X A;  3WE3 A;  4P55 A;  3HHG A;  1HSJ A;  3J80 K;  1UHW A;  2Z99 A;  3ZMZ A;  1MDM A;  1UST A;  4NQW A;  2UXN A;  4KUM A;  1ZAO A;  5D8K B;  3ZP5 A;  2M5W A;  1G3T A;  3SHF A;  5ED4 A;  4M6Y A;  1SMY F;  1ZGJ A;  5K5R A;  1S8N A;  3HSE A;  2YSR A;  3LAJ A;  1IXC A;  3ROU A;  4Q4Z F;  4R8H A;  3HHH A;  2DAO A;  3LWF A;  3V7R A;  4EMS A;  2DBB A;  3RYP A;  1I5Z A;  2KKO A;  2FNA A;  3BOQ A;  2FSW A;  5J6X A;  3DFG A;  5H6Q A;  4PZJ A;  1BI2 A;  3EQL F;  2IRF G;  3B73 A;  1BJA A;  4JQF A;  3BPV A;  1ZAR A;  4KIC A;  5HS9 A;  3BWG A;  2DLL A;  4G9Y A;  6PAX A;  3TKY A;  1FWZ A;  4WXC A;  1IN7 A;  3AAF A;  2QYO A;  1HKQ A;  3BP8 A;  3COA C;  5J8C A;  5D4S A;  3R4K A;  5LGU A;  2QM3 A;  3DPL C;  2GXG A;  3VOD A;  4LG0 B;  1IXR C;  1XGM A;  3C18 A;  4KIF A;  1XN7 A;  1FC3 A;  1IN8 A;  3V8J A;  4M71 A;  3FXU A;  3ZPL A;  2VE8 A;  4A5M A;  2H6B A;  2KJC A;  4KA4 A;  1MZB A;  4P96 A;  2P5K A;  1S7A A;  1KQ0 A;  3FX3 A;  5F1R A;  2A6E F;  1T38 A;  3IWZ A;  4ZZL A;  4BNC A;  2XKP A;  4M72 A;  4ENN A;  3BY6 A;  3M9A A;  2M87 A;  1U6G A;  3IRR A;  1F4K A;  2XVC A;  3WTY C;  2EFW A;  4A12 A;  2Y48 A;  4G7Z F;  1R23 A;  1XSX A;  4LLL A;  2JPB A;  2R3S A;  4AIH A;  3IKV A;  1F5T A;  2RV8 A;  4U88 A;  1REP C;  1W4M A;  3HTS B;  2FF4 A;  4CGZ A;  1STZ A;  2CW0 F;  5L3B A;  5D6F A;  5FLX Z;  1J0R A;  3GZ6 A;  3T8T A;  4ZH4 F;  2P8T A;  4TV7 A;  3PQJ A;  2O8X A;  3D5L A;  2BYV E;  5ILS A;  1FBS A;  3C1D A;  3I4P A;  3M8F A;  1KU9 A;  5H20 A;  3TOA A;  2FML A;  2XAJ A;  4HYE A;  3P9I A;  4OU0 A;  2NNY A;  2V79 A;  3GUD A;  3K69 A;  3WGH A;  1WQ2 A;  1OR7 A;  1O3R A;  5CVU A;  4L5I A;  1W7P A;  2P4W A;  1FBU A;  4HDU A;  2HR3 A;  1ZH5 A;  4D0P A;  1T6S A;  2A69 F;  1LDD A;  1TNS A;  4I0B A;  2K02 A;  2WC2 A;  5D5U B;  2QBY A;  2Q8K A;  2Q2E A;  4YFX F;  2NNN A;  3FZV A;  3M1E A;  2NYX A;  2IP2 A;  1RI7 A;  4GXO A;  5D5W B;  4UHT A;  1XGN A;  1SFE A;  1SMT A;  3CTA A;  3IRQ A;  4ESB A;  2O03 A;  4IHT A;  2KIF A;  1DUX C;  2H6C A;  2EFN A;  1FYL A;  3FM3 A;  2IA1 A;  4K2E A;  1O3T A;  2CO5 A;  1MJA A;  3M7G A;  1D8J A;  5BMZ A;  5DDG A;  3F8B A;  3KEO A;  3E3V A;  4HX7 A;  4HF0 A;  5DUI A;  5HS7 A;  1FP1 D;  1U8R A;  3VB2 A;  4GO1 A;  3VOE A;  1ZG1 A;  3REO A;  4BXU A;  5D4R A;  2DT5 A;  4G7H F;  2X0L A;  3GLX A;  2DPU A;  2H09 A;  2L54 A;  2COM A;  1HKS A;  1BI1 A;  2HYF A;  4OIP F;  3KEQ A;  4KMF A;  1PDN C;  5E1W A;  2CFX A;  2CYY A;  1HBX G;  5LRR A;  1HST A;  4CXF A;  5DUK A;  1J2X A;  5K5O A;  2F5D A;  2P5L C;  3RTR A;  3H3U A;  1Y0U A;  4UVB A;  1MD0 A;  2BBY A;  1PUE E;  3GO5 A;  1ON2 A;  4EQQ A;  2LSO A;  3KLO A;  3W6K B;  1P2F A;  1EH7 A;  3J7A O;  1R1V A;  4AWX B;  4ENK A;  4Z2Y A;  1HW1 A;  2ESN A;  1EV7 A;  4ESJ A;  2E1C A;  1J59 A;  4PGG A;  2WTE A;  4KDP A;  1FZP B;  5E17 F;  1J5Y A;  2AXL A;  2EV6 A;  1B9N A;  1MJB A;  2VBY A;  3I0T A;  2Z33 A;  2K86 A;  3R0J A;  3I59 B;  3ERE D;  3W6J B;  3KP3 A;  5ILV A;  1S3J A;  1BBY A;  3IC7 A;  3RKX A;  1XCV A;  4RB3 C;  2P5V A;  2RC4 A;  1YQA A;  3F8M A;  2BEO A;  4BHC A;  5KK1 A;  4A0Z A;  2D1V A;  2MBF A;  1DP7 P;  4RS8 A;  5D5V B;  5DV5 A;  5DD4 A;  3FHZ A;  1IN6 A;  3V7C A;  3E5Q A;  4LK1 F;  4UV9 A;  2RGV A;  4HV5 A;  2FOK A;  2HS5 A;  1ZGA A;  4E70 A;  1YTY A;  2MH2 A;  1OYW A;  2DU9 A;  1X3U A;  2TDX A;  2GAU A;  3CLO A;  1U2W A;  3K2Z A;  4U0Y A;  3ECH A;  2HKX A;  2YR2 A;  1ON1 A;  4LFU A;  4BQA A;  4XSZ F;  2OZU A;  3R0A A;  5DCM A;  5E18 F;  2VOD A;  4GCV A;  2ETH A;  1R58 A;  5CYV A;  3ZMD A;  4EGZ A;  1WSU A;  3MAJ A;  3TOB A;  2GIV A;  1K79 A;  2G7H A;  3FF5 A;  3JSO A;  1V4R A;  2EWN A;  4O5V A;  2QQB A;  4CHU A;  3KP4 A;  1LJ9 A;  4OIR F;  3TQN A;  3IHU A;  2EK5 A;  2K4J A;  1V3F A;  2PFB A;  2DI3 A;  2EFP A;  1YW9 A;  5LEK A;  1YS6 A;  1UFM A;  2L02 A;  3JW4 A;  2QWW A;  3CUO A;  5D6E A;  4EVI A;  1KU7 A;  1OKR A;  2XAQ A;  4L9J A;  3KP5 A;  2YU3 A;  2K7L A;  3KET A;  3N97 A;  3MFK A;  3QU3 A;  2NS0 A;  1SAX A;  2IW5 A;  3KP2 A;  4U7B A;  2GZW A;  3J80 Z;  1T0F A;  1IRG A;  2AS5 F;  1S29 A;  2PQ8 A;  2ZKZ A;  3F21 A;  2XAG A;  1LQ1 A;  1EH8 A;  2QEN A;  2NRA C;  1C0W A;  1XSD A;  5ERI A;  3KP7 A;  2QQ9 A;  1G3W A;  2VT3 A;  2KIM A;  4FHT A;  2PMU A;  2ELH A;  3TDU C;  2Z9O A;  3JAM Z;  1UCR A;  1IN4 A;  2HWV A;  4A5N A;  5BOX A;  1FYM A;  3WU1 B;  5FLX K;  1ZYR F;  5ILU A;  3LA2 A;  3OOP A;  1KQ9 A;  1PP7 U;  2NAZ A;  1QQI A;  3BZ6 A;  4UNO A;  3F3X A;  4A0X A;  2FMY A;  3WGG A;  4BHB A;  2A3S A;  5DEQ A;  1BIB A;  3KCC A;  4XRF A;  3FXQ A;  5ICC A;  2EA4 A;  1GVJ A;  1IAW A;  4BH9 A;  2IVM A;  2W24 A;  1FSE A;  5L3F A;  3GXO A;  3MQ0 A;  4P9F A;  2ZFW A;  1B4A A;  1HXD A;  1IZ1 A;  2OU2 A;  1P4A A;  1KQ8 A;  1P92 A;  2XAH A;  1FY7 A;  2PN6 A;  3K1M A;  4WXD A;  1R1T A;  1BC7 C;  1FSH A;  1O3S A;  1H9G A;  2XV4 S;  4G8X A;  2DFI A;  3GW2 A;  5CVI A;  2IA0 A;  2ACJ A;  1SFX A;  2A5Y B;  4I2O A;  2ESH A;  3V7S A;  2HTJ A;  2R7F A;  3WTW C;  3CJN A;  1ONV A;  2DQR A;  3E97 A;  3CUQ A;  4M9Z A;  3HUG A;  1ZRC A;  3DKW A;  4YFK F;  4HLX A;  4ZYD A;  2RNJ A;  3GX4 X;  2XAF A;  2J5O A;  3C7J A;  3V4G A;  4MHG A;  1R22 A;  1DDN A;  1QZZ A;  4Y17 A;  4CO8 A;  1S7O A;  4P5O A;  4FX4 A;  2VN2 A;  3G73 A;  5A2Q K;  4R79 A;  5FD5 A;  3ZN0 A;  2F2E A;  4ASN A;  4O6J A;  2IPQ X;  1HQC A;  3R60 A;  1ZG3 A;  3Q9V A;  3LST A;  4JBA A;  2CG4 A;  4CYD A;  2Q0O A;  4OMZ A;  2OD5 A;  3O6B B;  4YII A;  2XKO A;  3ULQ B;  2F5C A;  1B59 A;  4EJW A;  3KZY A;  1TQP A;  4IF4 A;  5AIP A;  1LDJ A;  3WTV C;  4L18 B;  2OQR A;  3QOP A;  2HTS A;  2STT A;  3KP6 A;  4EJV A;  3T5X A;  4HDV A;  5LGN A;  5BPI A;  4N9I A;  4HLY A;  4LB6 B;  1KYW A;  2VE9 A;  1Z6T A;  3MWM A;  5IT9 K;  1A04 A;  1XD7 A;  4IJA A;  3F23 A;  5FO5 A;  3GFM A;  2D45 A;  2QVO A;  1HW2 A;  2HDC A;  3E6B A;  2CQK A;  4P9U A;  2LNB A;  2Z3Y A;  3J81 K;  3GVA A;  1ZRF A;  2RN7 A;  5L3G A;  4HA8 A;  4ZYG A;  2RVC A;  1IF1 A;  2JRT A;  3I71 A;  2V1D A;  1CF7 B;  1Z05 A;  4AIJ A;  4EJU A;  3B02 A;  2DTR A;  5ICE A;  3LA7 A;  3WTS C;  4CDG A;  3GYH X;  2ZO4 A;  4NB5 A;  2OAZ A;  1OYI A;  3MEX A;  5F64 A;  1D8K A;  1YW7 A;  4CZZ A;  2XUB A;  4KNY A;  5K1Y A;  3GWZ A;  3HTU A;  3HRU A;  5IT3 A;  4WK8 F;  3FMS A;  1JGS A;  3F6V A;  2A61 A;  3WOD F;  5E1X A;  5BQT A;  5IT9 Z;  3HIF A;  2EV0 A;  3I58 A;  4KN7 X;  1ZRE A;  1I1S A;  5DYM A;  1Z6R A;  2QBY B;  1XGS A;  5LBQ A;  4N0B A;  3H92 A;  4UVC A;  4YG2 F;  3DEU A;  1H9T A;  5AON A;  3EET A;  3ZQ7 A;  5KVR A;  3TO7 A;  5L3D A;  3S2W A;  4QWQ A;  1UB9 A;  2QLZ A;  4F7Z A;  1QBJ A;  4GYI A;  2ZNZ A;  3L2C A;  2P6S A;  3MZH A;  2HEO A;  3L7W A;  1P4X A;  1IRF A;  4EM2 A;  1ZG5 A;  4UXN A;  2M45 A;  4U0W A;  1W7P B;  3RI4 A;  5HLH A;  4L9V A;  3P7N A;  2OBP A;  3ABU A;  1MDM B;  3HRT A;  2LF7 A;  1O7F A;  2UZK A;  5DD8 A;  1XB4 A;  4IXA A;  2KJB A;  3EDP A;  3BRO A;  1O7L A;  3LAP A;  5LHI A;  2OQG A;  4HQE A;  1T39 A;  1FLI A;  1LB2 A;  2PLY A;  4EJO A;  1Z1D A;  1P6R A;  4HV6 A;  2HZT A;  2MLK A;  1SD6 A;  1H0M A;  2ZXJ A;  1JE8 A;  5HDN A;  4KFC A;  1ZLJ A;  1TBX A;  1BC8 C;  2V1U A;  1RZ4 A;  3D0S A;  1KU2 A;  3U2R A;  2V1X A;  2H27 A;  1LVA A;  3F72 A;  2JTV A;  2EJR A;  2YPR A;  3BJO A;  1MJ9 A;  2DO7 A;  3DQV C;  2HQN A;  1IW7 F;  2BE5 F;  3IL2 A;  3K1P A;  1TQI A;  3IKT A;  2VOO A;  1GXP A;  1Z91 A;  2IA2 A;  4IRH A;  1IXS B;  3EYY A;  1B1B A;  1BM9 A;  4S05 A;  3K9T A;  4IRI A;  4HF2 A;  1BI0 A;  2ISY A;  5JHU A;  3QRF F;  4RB0 A;  3JSP A;  1YW8 A;  2LKP A;  3HSF A;  1F1Z A;  4N9H A;  2MA3 A;  2ISZ A;  1FOK A;  2MC3 A;  4HW0 A;  2QZ8 A;  2PJP A;  2EV5 A;  2M1B A;  1ODD A;  1D3Y A;  3RPQ A;  3U1D A;  2F5E A;  2BGC A;  5HOO A;  3DV8 A;  4Q5S F;  3K0L A;  5CVJ A;  2EB7 A;  3WU0 A;  2VC0 A;  3I54 A;  1OYY A;  4G94 A;  1SD5 A;  4WWC A;  3ZMV A;  1G4D A;  5JR3 A;  4KYW A;  2E7W A;  2EA2 A;  1F9N A;  2QQA A;  4HQM A;  2FU4 A;  5DCM B;  3GF2 A;  2VOP A;  3HRS A;  2XIG A;  3E5U A;  3WTT C;  3BPX A;  1U78 A;  4I7H A;  3N4M A;  3BJ6 A;  2ZME A;  3HRM A;  4LGW A;  2LF8 A;  2OA4 A;  1E2X A;  1Q1H A;  2XRN A;  2ZNY A;  3HOT A;  2EFQ A;  2CSO A;  2FBI A;  1ZHF A;  4L0Y B;  2M30 A;  5CJ9 A;  5E1Z B;  3NEU A;  2Z5U A;  5CVV A;  3ABT A;  2HGC A;  2KIU A;  4GYG A;  3SZT A;  5FB2 A;  1K6O A;  3C3W A;  1W7P D;  3O3K A;  1BOA A;  3LQR A;  2DW4 A;  5LRS A;  4PDK A;  4UUV A;  1RUO A;  2P7C B;  2GXB A;  4RGS A;  5FGM A;  4ENJ A;  3I59 A;  2C6Y A;  4A6D A;  3PFI A;  2L01 A;  3BJA A;  1BN5 A;  4KN4 X;  3VFZ A;  1DPU A;  2ZME B;  2UWM A;  5HVQ C;  2UXX A;  2VBW A;  5LEJ A;  2V9V A;  3CDH A;  3QPH A;  1OPC A;  5ICG A;  1YG2 A;  1CGP A;  2WWY A;  1WKM A;  3KFW X;  3F6O A;  2WV0 A;  2O0Y A;  2HYG D;  4IHS A;  2JZY A;  1JHF A;  4U0V A;  4I01 A;  1R00 A;  2G7U A;  1WI9 A;  3F8C A;  1YS7 A;  4M73 A;  4Y15 A;  1KU3 A;  1QNT A;  5A2Q Z;  1SFU A;  4AD9 A;  3V8K A;  3SQN A;  4HX4 A;  3I53 A;  4G7O F;  5TJJ A;  1I1G A;  3WTX C;  3LA3 A;  1KGS A;  1RNL A;  3NQO A;  3F22 A;  2VBZ A;  4ZYH A;  2PBI A;  3QU6 A;  2KRF A;  5CLS A;  4MEX F;  1TLH B;  2DK8 A;  2Y0M A;  4RGX A;  1XDU A;  2ZBK A;  2IT0 A;  1LNW A;  1I6X A;  3ZMT A;  1QO0 D;  2K27 A;  3NRV A;  4DNC A;  4XSX F;  3WG9 A;  2HOE A;  1K7A A;  1DPR A;  5K5Q A;  3GFI A;  1TQM A;  3SFZ A;  2A6H F;  2RKH A;  4IVN A;  5HLG A;  3SZP A;  1ZRD A;  3WTU C;  3RDI A;  2D1H A;  4XBF A;  4OIQ F;  1ULY A;  3L09 A;  4I02 A;  3TO9 A;  3QPT A;  3LQQ A;  2MH9 A;  1OMI A;  4PGH A;  4BAY A;  3O2P E;  2PEX A;  1HW5 A;  1G3S A;  5D5X B;  3JAM K;  3GEZ A;  1YFH A;  4AIK A;  1P4W A;  5FD6 A;  4H0E A;  4CIC A;  1YIO A;  5EEH A;  4QLC U;  5BS6 A;  4XLP F;  3FWE A;  4ZZD A;  1XDS A;  3GFJ A;  1USS A;  4LJZ F;  1MKM A;  1AWC A;  4LK0 F;  1TTY A;  1TW3 A;  2O3F A;  2A68 F;  4KIB A;  3TGN A;  4HBL A;  2MD5 A;  2QUF A;  4ENM A;  2FXA A;  2VBX A;  3CUQ C;  3JTG A;  5HLI A;  2XHK A;  3QP5 A;  1LDK B; 
#chains in the Genus database with same CATH topology
 1K6Y A;  1UEL B;  1FX7 A;  1J9I A;  1ACI A;  2ICW G;  3HC7 A;  1CF7 A;  4CCN A;  1FJL A;  1TNT A;  5GAD J;  3J7Z I;  5LHG A;  1G6N A;  4D5F A;  2W48 A;  3LSH A;  1YRN A;  3ML6 A;  4B09 A;  4RAZ A;  3RPU A;  4LG0 A;  3P9K A;  3SXY A;  3CCJ I;  1FIA A;  2HVQ A;  2K4B A;  3WGI A;  3Q5F A;  3LSR A;  1FNN A;  4BYY A;  2FUG 2;  1AOY A;  2LKX A;  4E7I A;  4BE1 A;  3R6S A;  2F48 A;  3E5X A;  2LYC A;  1J7K A;  2Z1D A;  4EJT A;  1KYZ A;  2X4H A;  1Y6I A;  4HF1 A;  5GTH C;  2VQL A;  2PI0 A;  1IG7 A;  4RLQ A;  2ZSH B;  2KFD A;  2BVL A;  2EPF A;  2ELK A;  2FEZ A;  2HI3 A;  1FPQ A;  2VKH A;  3PQK A;  4WF2 A;  4A3K J;  2ZFU A;  3JRG A;  1LE8 A;  1VQ5 I;  4M3G A;  3OYK A;  2K5C A;  3ZQL A;  5LLQ A;  3RIR A;  4XR6 A;  3RZD J;  3CCU I;  4IRG A;  5HS8 A;  3T0Y A;  4CA0 A;  1VF9 A;  2RDP A;  1YRN B;  3DXJ F;  3TP0 A;  2E7X A;  2N8G A;  2FQ3 A;  3GFL A;  2PJR B;  2DPD A;  3QAH A;  4PSX A;  5J3L A;  1K78 A;  2E1N A;  1TC3 C;  4BY7 J;  3C2G A;  1JUS A;  3KIO A;  3VDX A;  4L9N A;  5AIQ A;  4ON0 A;  2JWT A;  2LDU A;  1SD7 A;  4A0Y A;  1EH6 A;  5L3E A;  5LGT A;  2R93 J;  4OMY A;  2P6T A;  4G6D A;  4DYC A;  4HNT A;  4A3G J;  1R36 A;  1HKT A;  2D5V A;  3L9F A;  2MLG A;  5JVT A;  2FNP A;  2FA5 A;  4KIG A;  4WCG A;  3I64 A;  2K9Q A;  2BZT A;  3FMR A;  1W5T A;  1I3Q J;  4ESF A;  2F6C A;  4GGG A;  5JVG F;  2P7V B;  2ADU A;  2YX4 A;  4A6E A;  3GTM J;  3TDZ C;  2GWR A;  3FIW A;  5L3C A;  2OZ6 A;  2W84 A;  1LVK A;  4M6V A;  2FBH A;  1YHQ I;  3RJP A;  3S3O A;  1R7J A;  1R4M B;  2L9R A;  1GLN A;  2W25 A;  4KJZ A;  2KQR A;  1G8X A;  3N05 A;  4AYB A;  3GTP J;  2X1C A;  5CVR A;  2CGP A;  4OIO F;  5FFX A;  2VT2 A;  3E6M A;  3TO6 A;  2R7D A;  1ZR4 A;  2JRM A;  1YE9 A;  4U87 A;  3CQZ J;  3Q9S A;  2WV1 A;  1XSV A;  4JX6 A;  4PJM A;  4JK1 X;  4UUS B;  2RQP A;  3FXR A;  2ZJR F;  4UVA A;  2X6X A;  3OYI A;  4W1U A;  1T56 A;  1T2K A;  1FIP A;  3KE2 A;  1PJR A;  3CUQ B;  1Y8Q B;  1FBQ A;  4RGR A;  2ZCW A;  4UV8 A;  2QKL B;  1TWH J;  3ZMS A;  1VND A;  3GLL A;  1FP2 A;  4G6Q A;  2X85 A;  2PG4 A;  4KT5 C;  1SD4 A;  1O57 A;  2HXI A;  3OYN A;  1S6L A;  1OCO H;  2E34 A;  4Q47 A;  1R5G A;  5M3F J;  3BT9 A;  4PUS A;  4LLN A;  2HOT A;  1XGO A;  3F0C A;  3PNY A;  2W85 A;  1ETY A;  3K4B A;  4O3M A;  4IPA A;  3FMQ A;  3CC7 I;  1OCR H;  1GXQ A;  4WX9 A;  1FOX A;  4A3B J;  1R4N B;  2GIZ A;  1E17 A;  4ZYE A;  1FTZ A;  1IN5 A;  3B6A A;  3S32 A;  3DLA A;  4E4H A;  1ZLK A;  4DJA A;  1QPM A;  3ZRG A;  1GV5 A;  2JT1 A;  2XAU A;  4A3J J;  2E1M B;  4W97 A;  1B72 B;  4I98 B;  5EEA A;  3FKI J;  1T8I A;  3WTZ A;  3MN2 A;  4LB5 A;  1FT9 A;  2XGX A;  2CW8 A;  4OOI A;  4M74 A;  3A03 A;  2JA7 J;  2IJL A;  1MND A;  2ZXH A;  2A07 F;  4YEJ A;  3BTC A;  1XC5 A;  1QGP A;  3E6D A;  2DQL A;  3P5J A;  2XRO A;  3IAM 2;  5H6R A;  1HC8 A;  1L0O C;  2F5F A;  3L2W A;  2QF7 A;  4M6X A;  3WE2 A;  1Z7U A;  2R5Z B;  2L4M A;  4B47 A;  4BQO A;  5TRD A;  1MGT A;  2V6E A;  1ZN2 A;  3CJQ B;  1XCB A;  3CCS I;  1KZH A;  3MKZ A;  2JA2 A;  1Z67 A;  3F8F A;  1LEA A;  2STW A;  3D5S C;  4M3E A;  4FX0 A;  3PJR A;  3ZR8 X;  2KL4 A;  5B1A H;  2JPC A;  1W5S A;  3CO6 C;  3ABL H;  1OFC X;  4XIC A;  2JUG A;  2O6G E;  3S1M J;  1NG7 A;  3HSR A;  1KA8 A;  1YX3 A;  2YUS A;  2JJ7 A;  3P9C A;  3LSP A;  4L0Z B;  2FX0 A;  3DCF A;  2CWE A;  1WRJ A;  3ABM H;  5C3E J;  3DF8 A;  2DK5 A;  2M9H A;  4B8X A;  5HDK A;  1MW7 A;  4IQJ A;  2MFZ A;  3IWF A;  4F92 B;  1W0T A;  1B72 A;  2R7W A;  4BKX A;  5LHH A;  1BI3 A;  3W6V A;  2VXZ A;  2KLO A;  3TW7 A;  4R1H A;  2QQ8 A;  3DP7 A;  1D5Y A;  4N4N B;  4PCQ A;  4ETS A;  4OAZ A;  2JUC A;  1NK2 P;  5JFR A;  3H0D A;  1K78 B;  5DCF A;  2OPT A;  4ZDP A;  3M8E A;  3PNT A;  3I55 I;  4EV0 A;  5EGO B;  1X3Z B;  1RIO H;  1JHH A;  4I0A A;  4MO7 A;  2OF7 A;  2A6T A;  3V42 A;  3I5U A;  4FT8 A;  3U9G A;  5BPD A;  3E6C C;  4OIN F;  1U5T B;  2GA2 A;  4MTE A;  2FQ4 A;  4XOT A;  4EEF G;  2BV6 A;  1Z9C A;  1Y56 A;  3V8L A;  1QZY A;  2EFO A;  1YYV A;  2OTJ I;  5DM6 F;  2B0L A;  3Q0U A;  3FIS A;  1J75 A;  1R5H A;  2HU9 A;  1PP8 F;  1U3E M;  2HPM A;  2O7O A;  1YIT I;  2GQQ A;  5HNF A;  2HFH A;  3F8N A;  2GA1 A;  3GTG J;  3GME A;  1L3L A;  2PMH A;  4BBS J;  5E20 A;  3G4S I;  4A3F J;  3S2D J;  4AC0 A;  1RUN A;  5K7H A;  3OOU A;  4RAY A;  2Y75 A;  4WXH A;  3G3Z A;  3T8R A;  3CMY A;  1ZQ3 P;  4N4O B;  2VON A;  4YFN F;  3DPT A;  4UB8 C;  2AHQ A;  4M3D A;  4RB2 C;  3CCR I;  3KZZ A;  4MNU A;  1IUY A;  4AVP A;  1ZR2 A;  4LD5 A;  3ECO A;  4U7D A;  2YS9 A;  4I76 A;  1GVD A;  4BQQ A;  5FJ8 J;  3G1M A;  2G9W A;  1DGW Y;  3T1B A;  1Y8R B;  1Z3X A;  2MYS A;  4XKV A;  4BHP A;  3HXL A;  3LSG A;  2XAS A;  1AA7 A;  4XKC A;  3H5A A;  2JQ7 A;  4NBQ A;  2EIM H;  2Y30 A;  3QYE A;  2BHZ A;  4Q48 A;  3RSN A;  1WVR A;  3ZN1 A;  3JTH A;  1X2N A;  2F4I A;  2WY8 Q;  3UR3 C;  4DQ2 A;  1O3Q A;  1OLT A;  1V55 H;  5FRO A;  4HOB A;  1ETK A;  3I3L A;  5IPA A;  2V4J C;  4RB1 A;  1BIA A;  2CV0 A;  2B63 J;  3OIQ A;  4LG3 A;  3L00 A;  5E8G A;  4LMY A;  1YO5 C;  3W2A A;  1NHA A;  2E71 A;  3CCL I;  1GHC A;  3VEP A;  2ZC2 A;  3LFK A;  3K1N A;  3RQI A;  2M8E A;  3QP6 A;  2Y69 H;  2HQR A;  1XMK A;  3ELK A;  5F6F A;  2WBM A;  2XF7 A;  4D9J A;  2VIX A;  5E3L A;  4ABZ A;  3CJR B;  2FRH A;  1LEB A;  4RA2 A;  1UG2 A;  3FK6 A;  1MH4 A;  1MIJ A;  3EYI A;  1B6A A;  1QHH D;  3O8G A;  3CCV I;  4XK4 A;  4FAS D;  4M9S A;  1Z21 A;  2JSC A;  3R61 A;  4MTD A;  2ZXI A;  4BGD A;  1AU7 A;  4KMU X;  1U9O A;  1U0J A;  1G2H A;  1ETO A;  3M1C A;  5J8F A;  1WFX A;  2V26 A;  5ICF A;  4RGU A;  3DKX A;  1NG6 A;  1JXS A;  3GZ5 A;  3BDD A;  3ZMU A;  2H94 A;  4MEY F;  4MQ9 F;  3PM1 A;  1W1W E;  2VKE A;  4L9T A;  1U5T A;  4S04 A;  3CO7 C;  2CS3 A;  3FHN A;  1A6I A;  1XMA A;  1R1U A;  1B9M A;  1X3W B;  2E2J J;  2J5P A;  2L3D A;  4A3E J;  3JRA A;  3HOS A;  3HYI A;  1D5V A;  5EEG A;  3H9G A;  3MZY A;  2E2H J;  2NVY J;  4CCO A;  4DYQ A;  2FD5 A;  4MQV A;  5FKL A;  5J1R A;  3S3M A;  4G12 A;  1MH3 A;  2ZJ2 A;  3HPG A;  4HST A;  3AG4 H;  1TW2 A;  2LC2 A;  3RKY A;  4EM0 B;  4KIT B;  4XLN F;  4JYK A;  1G3Y A;  2LBF B;  5E3N A;  2HOA A;  3CDL A;  3MCZ A;  1WWX A;  3CJT B;  4LLG F;  3RKW A;  1K4S A;  5JI6 A;  2CH0 A;  1P7I A;  3A0B C;  4EM1 A;  3KYL A;  1J09 A;  3IUO A;  2X48 A;  4NHJ A;  3LSI A;  2L0K A;  2DA6 A;  3IH4 A;  2DMT A;  3PL8 A;  2CV1 A;  2W57 A;  2FE3 A;  4EGY A;  1U5T C;  2O61 A;  2WAQ A;  4IKF A;  2I8D A;  2YX7 A;  1IRX A;  1SVO A;  1NTC A;  1I27 A;  3H3Z A;  3BG7 A;  3ISP A;  4RLF A;  2VQH A;  4HZF A;  3RKQ A;  4HG2 A;  2DYS H;  5IP6 A;  4I09 A;  2GOM A;  2L4A A;  2VC1 A;  2LY9 A;  3FM5 A;  3EUH A;  1VI0 A;  5FFZ A;  3RYR A;  4L5J A;  3DU6 A;  3KLN A;  2V6C A;  1B8I A;  1VQ9 I;  4HX8 A;  1XG1 A;  4HAM A;  2EIJ H;  2EH3 A;  4MGR A;  2LP0 A;  4CCK A;  1Y39 A;  2XPU A;  1FYK A;  4B3X A;  3JRH A;  1UHM A;  4KT6 A;  5D8L B;  4A2U A;  4Y13 A;  3OV8 A;  2IS4 A;  1X1A A;  1KON A;  1T98 A;  3J81 Z;  1Z7L A;  1WPK A;  2FBK A;  3S3N A;  5E8I A;  2D2W A;  2R7S A;  5HDG A;  4YIF A;  3ZOB A;  1MBH A;  1YLF A;  1WJA A;  3UNG C;  1S7E A;  1D0Z A;  2HKO A;  4HRI A;  1X1D A;  1VTN C;  4M9X A;  3WE3 A;  4P55 A;  3HHG A;  2IGO A;  1HSJ A;  3J80 K;  1UHW A;  2Z99 A;  3WHC A;  3ZMZ A;  1MDM A;  4XON A;  1UST A;  4NQW A;  3LL7 A;  1RR8 C;  2UXN A;  4KUM A;  1ZAO A;  3G71 I;  2AXT C;  5D8K B;  3ZP5 A;  4X6A J;  4E7K A;  2M5W A;  4BS9 A;  1G3T A;  3HJE A;  3SHF A;  5ED4 A;  1UJ8 A;  3HEF A;  4M6Y A;  4V19 K;  1SAN A;  1SMY F;  1ZGJ A;  2MG4 A;  5K5R A;  1S8N A;  3HSE A;  5KHD A;  4QPO A;  2YSR A;  1SEU A;  3LAJ A;  1BR4 A;  4D1Q A;  1IXC A;  2KRH A;  1OQY A;  3ROU A;  3J7Y J;  4Q4Z F;  3LOC A;  5EG0 A;  2ZME C;  4R8H A;  3K6G A;  4OWR B;  4UUT A;  3HHH A;  2DAO A;  4XLF A;  3LWF A;  5F1J A;  1JJ8 C;  3V7R A;  4EMS A;  2DBB A;  2R7R A;  4DIQ A;  3RYP A;  5GPA A;  5TIS C;  1AHD P;  1I5Z A;  2KKO A;  3DTK A;  2FNA A;  1JGG A;  3BOQ A;  2FSW A;  5J6X A;  3DFG A;  5H6Q A;  4PZJ A;  1BI2 A;  3EQL F;  2IRF G;  4Y7N J;  3B73 A;  4XNF A;  1BJA A;  4JQF A;  3S16 J;  3BPV A;  2QA4 I;  1ZAR A;  4KIC A;  5HS9 A;  5KAF C;  3BR6 A;  3BWG A;  2TRT A;  5EYR A;  4ZC3 A;  2DLL A;  4G9Y A;  4JX4 A;  6PAX A;  3TKY A;  1FWZ A;  1ETQ A;  3BLY A;  4L5E A;  4WXC A;  1IN7 A;  2CUE A;  3MVP A;  5E79 C;  4BQN A;  3ZQC A;  3AAF A;  2QYO A;  1HKQ A;  4J19 A;  3BP8 A;  1AKH A;  5F27 A;  3CF2 A;  2OC6 A;  3COA C;  5J8C A;  5D4S A;  3QYB A;  1BA5 A;  3R4K A;  5LGU A;  2QM3 A;  3DPL C;  3BR1 A;  2GXG A;  3VOD A;  2NS8 A;  4LG0 B;  4ZTJ A;  3KYD B;  5HOD A;  3FK7 A;  1IXR C;  1XGM A;  4E7J A;  3A2K A;  5K7F A;  2R92 J;  3QPL A;  1ZGW A;  3JRD A;  3C18 A;  4KIF A;  2WAQ N;  1XN7 A;  1FC3 A;  2EIL H;  1IN8 A;  3AG2 H;  3V8J A;  3CF5 F;  1PUF B;  1O4X A;  1IDY A;  4M71 A;  3FXU A;  1WJE A;  1GV2 A;  2L5Q A;  3ZPL A;  2O9L A;  2VE8 A;  2KZV A;  3BCB A;  4A5M A;  2H6B A;  2KJC A;  4KA4 A;  4A3L J;  1MZB A;  3FXK A;  4P96 A;  2MC4 A;  2P5K A;  2W4S A;  2UUZ A;  1S7A A;  3AG3 H;  4XL9 A;  4CYC A;  3H0G J;  3HOX J;  3L2V A;  5FLV A;  1KQ0 A;  3FX3 A;  3OYM A;  5F1R A;  2A6E F;  1T38 A;  3IWZ A;  1ETX A;  2HQ5 A;  2UV1 A;  3HUG B;  4ZZL A;  4UY8 I;  4BNC A;  3AL0 C;  3CES A;  2XKP A;  4M72 A;  4ENN A;  3BY6 A;  4IOC F;  3M9A A;  2M87 A;  1U6G A;  3EUK L;  3IRR A;  1F4K A;  3OL4 A;  2XVC A;  3WTY C;  2EFW A;  4A12 A;  2Y48 A;  4G7Z F;  1R23 A;  3TP3 A;  1RKW A;  1XSX A;  1A31 A;  2YU9 J;  4LLL A;  3DLL F;  2JPB A;  2R3S A;  4AIH A;  3IKV A;  1F5T A;  2RV8 A;  3SZG A;  4U88 A;  4ZJZ A;  3CZ6 A;  2DTZ A;  1REP C;  1W4M A;  2CUZ A;  2DCE A;  1R49 A;  3HTS B;  2FF4 A;  4CGZ A;  3BZC A;  1OCT C;  2Q1Z B;  3FBI B;  1STZ A;  2CQQ A;  2CW0 F;  5L3B A;  3EUH C;  4IO9 F;  1YIJ I;  4V2F A;  5D6F A;  1QPI A;  5FLX Z;  1JKR C;  3SDB A;  1X1C A;  3HOU J;  5FKN A;  1J0R A;  5CQG A;  5IP7 J;  3GZ6 A;  1MBE A;  2EZH A;  4DZJ A;  3T8T A;  3BG9 A;  1EA3 A;  1POG A;  4ZH4 F;  5J4Y A;  2P8T A;  4TV7 A;  2M4G A;  3HDD A;  3PQJ A;  2O8X A;  2IBD A;  3D5L A;  2CUF A;  2DMN A;  2BYV E;  2M3A A;  2EIK H;  4RM3 A;  5ILS A;  1LE8 B;  1FBS A;  1TWA J;  4A69 C;  3C1D A;  3CMA I;  4CCJ A;  1JT0 A;  3I4P A;  1LFB A;  4BY1 J;  3M07 A;  3M8F A;  2W82 A;  1KU9 A;  2H1K A;  2WB1 A;  5H20 A;  4Z6Y A;  2L7K A;  1P9Q C;  3VSK A;  1OCP A;  3TOA A;  2VLA A;  2FML A;  2XAJ A;  4HYE A;  3P9I A;  1QRY A;  2E5N A;  4OU0 A;  5H2F C;  2KDO A;  2NNY A;  1NH3 A;  2V79 A;  1X19 A;  3GUD A;  3K69 A;  1K4T A;  4CYC B;  3WGH A;  1WQ2 A;  1OR7 A;  5CVU A;  1O3R A;  1IC8 A;  4L5I A;  1W7P A;  4RMN A;  1MMS A;  2P4W A;  1R6R A;  1FBU A;  1WJC A;  2Y0S A;  4HDU A;  4ZDL A;  3LNQ A;  2VL8 A;  2HR3 A;  3VSL A;  1ZH5 A;  4NC8 A;  2JVH A;  2GLO A;  1VQL I;  4DBQ A;  1I50 J;  4D0P A;  1T6S A;  2A69 F;  1LDD A;  2WY7 Q;  5FKK A;  3ERM A;  1TNS A;  4I0B A;  5B5E C;  1JKO C;  2K02 A;  2WC2 A;  5D5U B;  2QBY A;  2Q8K A;  2X1D A;  4ITV A;  4XRS G;  2Q2E A;  4F52 A;  4YFX F;  4B1R A;  4AYB N;  4A3M J;  2XPW A;  2ME6 A;  3UKG A;  2NNN A;  2E1M C;  3FZV A;  3LFU A;  4PJ0 C;  3M1E A;  4DOZ A;  2NYX A;  1EJ9 A;  2EZL A;  4QIW N;  4GRI A;  2IP2 A;  1RI7 A;  2LY2 A;  4GXO A;  5D5W B;  4UHT A;  1XGN A;  1SFE A;  1SMT A;  3CTA A;  4B48 A;  3Q0V A;  3IRQ A;  2R0Q C;  1Y1V J;  4ESB A;  2O03 A;  4IHT A;  2KIF A;  1DUX C;  2H6C A;  2L2O A;  2EFN A;  4D5C A;  5TGT A;  3DWL E;  1FYL A;  2H1L A;  3PUB A;  3FM3 A;  2L7F P;  2IA1 A;  1HDD C;  4K2E A;  1A5J A;  2KP6 A;  1WJF A;  1ORK A;  4YRV A;  1O3T A;  2CO5 A;  5EJC A;  1M1E B;  3S8P A;  4XLH A;  1MJA A;  3M7G A;  2K3P A;  1D8J A;  3C2H A;  3OYF A;  3M3Y J;  5BMZ A;  5GAH J;  2LKS A;  5DDG A;  3F8B A;  1IJW C;  3KEO A;  3OWT A;  3E3V A;  4HX7 A;  4HF0 A;  3SYT A;  5DUI A;  2Z16 A;  5HS7 A;  1FP1 D;  4XOP A;  1U8R A;  3VB2 A;  4GO1 A;  4BE2 A;  3VOE A;  1ZG1 A;  1YI2 I;  3REO A;  2A5W A;  3QPS A;  1WJ5 A;  4XN0 A;  4BXU A;  3DBH B;  5LFA A;  5D4R A;  2DT5 A;  4G7H F;  4RDU A;  1V5E A;  3OSF A;  2X0L A;  3GLX A;  5JHF A;  2DPU A;  1N78 A;  2QGU A;  4ANJ A;  2H09 A;  1X2M A;  2L54 A;  2COM A;  1D0Y A;  1MMD A;  2XRL A;  1HKS A;  1BI1 A;  1QVU A;  2HYF A;  4ZYA A;  4QTR A;  3BR2 A;  3K70 C;  4HSR A;  2QCO A;  4OIP F;  3KEQ A;  4KMF A;  3SDG A;  1A36 A;  4A3D J;  1PDN C;  2ZJQ F;  1I6H J;  5E1W A;  3K4K A;  2CFX A;  2CYY A;  1HBX G;  1K61 A;  5LRR A;  2B9S A;  5FLM J;  3BZK A;  1HST A;  2DDA A;  5E3O A;  5DUK A;  2IEK A;  3G2B A;  4CXF A;  2DDB A;  1J2X A;  5K5O A;  1Z77 A;  2F5D A;  2P5L C;  2V9P A;  2VJJ A;  3GCM A;  3RTR A;  3H3U A;  1WI3 A;  1Y0U A;  1W5C C;  2OUM A;  4UVB A;  2AO9 A;  1MD0 A;  2BBY A;  1PUE E;  2JMW A;  3GO5 A;  1ON2 A;  4EQQ A;  2LSO A;  2PMZ N;  3WG7 H;  3KLO A;  2M7B A;  1SAU A;  3W6K B;  1P2F A;  1EH7 A;  2XGE A;  1V5F A;  1SC7 A;  3J7A O;  1OCZ H;  1PVE A;  3CP8 A;  2XB0 X;  1R1V A;  4AWX B;  3GTQ J;  1T95 A;  3OIP A;  3GTO J;  4ENK A;  1MBK A;  3FKJ A;  3IH2 A;  3CP2 A;  4Z2Y A;  1HW1 A;  2ESN A;  2VI6 A;  5B66 C;  1EV7 A;  2XB5 A;  4FCY A;  3H9Q A;  2BW3 A;  4ESJ A;  2R7V A;  1UZC A;  3GTL J;  2E1C A;  2IGN A;  2HOS A;  1CQT A;  1J59 A;  4PGG A;  2WTE A;  2V7F A;  4KDP A;  1JUM A;  2BVM A;  1FZP B;  3BR0 A;  4DBR A;  5E17 F;  1JUP A;  1J5Y A;  2AXL A;  1RRJ A;  4C3H J;  2EV6 A;  1B9N A;  1MJB A;  1JKQ C;  2CFO A;  1DGR M;  2VBY A;  3I0T A;  2Z33 A;  1YJN I;  2K86 A;  2LH9 A;  4M3F A;  4C3I J;  3R0J A;  3I59 B;  4HNU A;  1BW6 A;  1BR1 A;  3ERE D;  2X1E A;  3W6J B;  3BG3 A;  3KP3 A;  5ILV A;  3ABK H;  4BJ6 C;  4CSW A;  1S3J A;  2R5Z A;  2E19 A;  4H4K C;  1BBY A;  3IC7 A;  3RKX A;  1VFC A;  1BR2 A;  1XCV A;  1H89 C;  4RB3 C;  2P5V A;  2VB6 A;  2RC4 A;  1YQA A;  3F8M A;  2BEO A;  1FMW A;  4BHC A;  5KK1 A;  3OSG A;  1X4O A;  2PX9 A;  3ESW B;  3I56 I;  1DU0 A;  4A0Z A;  2D1V A;  2MBF A;  2QEX I;  3ZXS A;  1DP7 P;  3BCA A;  4RS8 A;  1TWF J;  5D5V B;  3G1L A;  4XLA A;  1WH5 A;  1QVT A;  1IV8 A;  5DV5 A;  5DD4 A;  3ZQQ A;  3I9V 2;  3FHZ A;  2DJN A;  2V1N A;  3OS1 A;  2HVR A;  1IN6 A;  1ZEL A;  2VAS A;  2X9D A;  4NQW B;  3ZQF A;  4BU2 A;  2K9L A;  3V7C A;  2HZD A;  2DOF A;  3PO3 J;  2LRD A;  3E5Q A;  4LK1 F;  4UV9 A;  2RGV A;  4UUS A;  4HV5 A;  1XMX A;  1VQM I;  2FOK A;  2HS5 A;  1W0U A;  1ZGA A;  4E70 A;  2MW8 A;  3VYT B;  2MH2 A;  1YTY A;  1OYW A;  2DU9 A;  1X3U A;  2TDX A;  2GAU A;  3CLO A;  1U2W A;  4M3B A;  3K2Z A;  5FKM A;  4U0Y A;  3ECH A;  2HKX A;  2YR2 A;  1ON1 A;  4LFU A;  3RPU D;  4BQA A;  4MIM A;  4XRS A;  4NNJ A;  4XSZ F;  1R9T J;  3K4N A;  2OZU A;  3R0A A;  5DCM A;  2M7A A;  2DFF A;  5E18 F;  2HDW A;  2JA6 J;  2VOD A;  4J01 A;  2LY1 A;  4V2G A;  1MNE A;  2ETH A;  1R58 A;  4GCV A;  5CYV A;  3ZMD A;  4EGZ A;  4FTH A;  1WSU A;  1JTY A;  3MAJ A;  3TOB A;  2GIV A;  2H8R A;  3S93 A;  1K79 A;  5F08 A;  4BAC A;  2G7H A;  4IHY A;  1DU6 A;  3AFH A;  2JK3 A;  3FF5 A;  3JSO A;  1RKT A;  3HBL A;  2MGQ A;  1V4R A;  1DP3 A;  3BTJ A;  1WJD A;  2DN0 A;  5FRN A;  2EWN A;  4O5V A;  2QQB A;  2CJJ A;  4CHU A;  3KP4 A;  4CCM A;  3NAU A;  1LJ9 A;  1P7J A;  5BNG A;  3DTE A;  4OIR F;  2NVT J;  3TQN A;  3IHU A;  2EK5 A;  2K4J A;  1JI8 A;  1V3F A;  2PFB A;  3KPH A;  2DI3 A;  2EFP A;  2E2I J;  1YW9 A;  2KIS A;  3BQY A;  1Q1V A;  1YS6 A;  5LEK A;  1UFM A;  2L02 A;  2E60 A;  3NWT A;  1E3O C;  5DM7 F;  3JW4 A;  2QWW A;  3DPU A;  3CUO A;  1DQU A;  5D6E A;  1SVL A;  4EVI A;  1OKR A;  1KU7 A;  2XAQ A;  1HA8 A;  4AID A;  2DOD A;  4L9J A;  3KP5 A;  4LIT A;  1ZKG A;  2YU3 A;  2K7L A;  1BL0 A;  1WCM J;  3KET A;  3N97 A;  3H3V K;  2V9K A;  3MFK A;  3QU3 A;  2E1O A;  2NS0 A;  1SAX A;  2IW5 A;  2IAI A;  3VYS B;  3KP2 A;  2CQN A;  3CCM I;  3MKL A;  2L9S A;  1YOV B;  4U7B A;  2GZW A;  2LTP A;  3J80 Z;  4IHV A;  2BXZ A;  2XPV A;  4F3Q A;  1YJ9 I;  1T0F A;  1IRG A;  2L9N A;  4D7N A;  2AS5 F;  1S29 A;  2PQ8 A;  2ZKZ A;  2BY0 A;  5EZG A;  4IL6 C;  3F21 A;  3CC4 I;  2XAG A;  1LQ1 A;  1EH8 A;  2QEN A;  1NK3 P;  2NRA C;  1C0W A;  1U8B A;  1XSD A;  5ERI A;  3KP7 A;  1F43 A;  1RR7 A;  4CUG A;  4AUX A;  3A01 B;  1UG0 A;  3AG1 H;  2QQ9 A;  1G3W A;  2VT3 A;  2KIM A;  3ONQ A;  4D7M A;  4FHT A;  2HYJ A;  4P1W A;  1EKE A;  3K10 A;  1ZTR A;  2PMU A;  3ZQI A;  2ELH A;  3TDU C;  1MSF C;  1WJB A;  5M5X J;  2COB A;  2Z9O A;  3SJM A;  3S15 J;  3JAM Z;  1UCR A;  1IN4 A;  2HWV A;  2VJ4 A;  2A05 A;  4A5N A;  5BOX A;  2XGD A;  1FYM A;  2WAD A;  3WU1 B;  5FLX K;  2XF6 A;  1ZYR F;  1G59 A;  4B43 A;  3H5R A;  3RQ4 A;  3ZQG A;  1JTX A;  3I4M J;  1XX5 A;  5ILU A;  5DS9 A;  3LA2 A;  3D5R C;  3QWL A;  3BR3 A;  3OOP A;  1KQ9 A;  2LR8 A;  2ID6 A;  1PP7 U;  2OV7 A;  4PJL A;  2NAZ A;  2E35 A;  1QQI A;  2RRE A;  2K85 A;  3BZ6 A;  1OCC H;  2HPI A;  4UNO A;  3F3X A;  1LFU P;  2ME0 A;  5EZH A;  3H35 A;  4A0X A;  2FMY A;  3WGG A;  4BHB A;  4QPQ A;  2A3S A;  4X0G A;  5DEQ A;  1BIB A;  2EZK A;  3KCC A;  4XRF A;  3FXQ A;  5ICC A;  2EA4 A;  1QA6 A;  1WGX A;  3H1C A;  2DFH A;  3H36 A;  1V54 H;  1GVJ A;  1IAW A;  3DKY A;  4BH9 A;  2DFE A;  2EIN H;  3M8J A;  2IVM A;  2W24 A;  2HQA A;  2DA5 A;  2VJ5 A;  5F0F A;  1FSE A;  5L3F A;  3OYG A;  3HGG A;  3GXO A;  3KEY A;  2W00 A;  3W2V A;  3MQ0 A;  2DOA A;  2F5V A;  4XM3 A;  4P9F A;  2ZFW A;  1B4A A;  4ZTF A;  2R4G A;  3SFI A;  1A6Q A;  1SVM A;  2F4O B;  3K4M A;  1HXD A;  1TT5 B;  1IZ1 A;  2OU2 A;  1P4A A;  1KQ8 A;  1P92 A;  2XAH A;  4XQF A;  1FOW A;  3S17 J;  5M3M J;  1FY7 A;  4X1E A;  4BEH B;  2PN6 A;  3K1M A;  4WXD A;  1R1T A;  1BC7 C;  1FSH A;  1O3S A;  1H9G A;  2XV4 S;  4G8X A;  2DFI A;  3GW2 A;  5CVI A;  2DJI A;  2IA0 A;  2I10 A;  3LSJ A;  3CDI A;  1MSE C;  2ACJ A;  2DA1 A;  2DA2 A;  1SFX A;  2A5Y B;  4I2O A;  1VZ0 A;  2ESH A;  3OS0 A;  3EPZ A;  4JOM A;  3NAR A;  3V7S A;  2HTJ A;  2R7F A;  3WTW C;  1VQ7 I;  3CJN A;  3PFY A;  1ONV A;  4Y3O A;  3AKZ A;  2DQR A;  1GUU A;  3E97 A;  2R5Y B;  3CUQ A;  4M9Z A;  3HUG A;  1ZRC A;  3CCY A;  3DKW A;  3BG6 A;  1V5G A;  1Z3Y A;  4BUP A;  4HLX A;  4YFK F;  1ERD A;  4ZYD A;  3PIP F;  2RNJ A;  3GX4 X;  2XAF A;  2J5O A;  2M0M A;  3C7J A;  4HPQ A;  1E3H A;  1MMA A;  1R22 A;  4NC6 A;  3BR5 A;  1QZZ A;  4MHG A;  3V4G A;  1DDN A;  3GTK J;  4Y17 A;  1D1B A;  4I99 C;  3HB9 A;  1W36 C;  1Z0X A;  2F4M B;  3MMY B;  4CO8 A;  1S7O A;  3CMM A;  4XN3 A;  5C44 J;  1JJ6 C;  2M8G X;  4P5O A;  3GTJ J;  4FX4 A;  3ASN H;  2VN2 A;  3W3C A;  3G73 A;  3PO2 J;  2OCC H;  2RQQ A;  4HEA 2;  4R79 A;  5A2Q K;  5FD5 A;  3ZN0 A;  4QSH A;  2F2E A;  4ASN A;  3PUF A;  3HOV J;  4O6J A;  3SEQ A;  5FRM A;  5HNH A;  1H88 C;  2IPQ X;  1HQC A;  4Y52 J;  3R60 A;  1ZG3 A;  3Q9V A;  3LST A;  4JBA A;  2CG4 A;  2DOE A;  4CYD A;  2BHY A;  2Q0O A;  3F9K A;  4OMZ A;  2OD5 A;  3JRF A;  5KCM A;  1MNM C;  3O6B B;  4YII A;  2XKO A;  3ULQ B;  1A35 A;  2F5C A;  3E1S A;  1B59 A;  2NS7 A;  4EJW A;  1FEX A;  3HPH A;  3KZY A;  1TQP A;  5IYB J;  4IF4 A;  5AIP A;  2EZI A;  2O5R A;  5EG0 B;  4BE0 A;  2MD0 A;  1LDJ A;  3WTV C;  4L18 B;  3OYA A;  2OQR A;  3QOP A;  2HTS A;  2STT A;  2DA3 A;  2WB1 N;  1APL C;  4ZDO A;  2Y2Z A;  3CD6 I;  4E7Z A;  4G6T B;  3KP6 A;  4EJV A;  3T5X A;  4HDV A;  5LGN A;  4RBO A;  5BPI A;  4N9I A;  4HLY A;  1Y1W J;  3OYC A;  2R7T A;  4LB6 B;  1KYW A;  2RAE A;  1Z6T A;  2VE9 A;  3MWM A;  5IT9 K;  1A04 A;  1XD7 A;  3FXJ A;  4IJA A;  3F23 A;  5FO5 A;  3GFM A;  5CPR B;  5J1Y A;  9ANT A;  1RES A;  1VQP I;  2D45 A;  1IRZ A;  2QVO A;  1HW2 A;  3BTL A;  1X58 A;  1OJL A;  2HDC A;  3E6B A;  5J1U A;  3VYR B;  5J47 A;  2CQK A;  3Q3S A;  4P9U A;  4C9Y A;  2LNB A;  4HNV A;  2Z3Y A;  1XPX A;  3J81 K;  1TP4 A;  1Y0N A;  2XC7 A;  2JA5 J;  3GVA A;  5EGO A;  2RN7 A;  1ZRF A;  5L3G A;  3LSK A;  3K4L A;  4HA8 A;  3NWS A;  3CCQ I;  3A02 A;  4ZYG A;  2L9V A;  2LLK A;  5CQE A;  2RVC A;  1IF1 A;  2EQR A;  2DMU A;  2JRT A;  2VPR A;  2V1D A;  3I71 A;  1CF7 B;  4A93 J;  1Z05 A;  2GOX B;  3OYJ A;  2GM4 A;  2P0W A;  4AIJ A;  4EJU A;  4CCL A;  3B02 A;  1SFO J;  2DTR A;  3RCO A;  5ICE A;  3LA7 A;  3WTS C;  4CDG A;  3GYH X;  2ZO4 A;  4NB5 A;  1T08 B;  2OAZ A;  3M4O J;  2TCT A;  1OYI A;  3MEX A;  5F64 A;  3K4J A;  3IP4 B;  1D8K A;  5IYC J;  4XMY A;  1TL8 A;  1YW7 A;  4CZZ A;  2XUB A;  1LPQ A;  4KNY A;  5JLX A;  2RNG A;  5K1Y A;  3GWZ A;  2MSY A;  3HTU A;  3HRU A;  5IT3 A;  1JKP C;  3JCU C;  4WK8 F;  3O8H A;  3FMS A;  1JGS A;  3F6V A;  2VXD A;  1ITY A;  2A61 A;  3WOD F;  4PSW A;  5E1X A;  5BQT A;  5IT9 Z;  3HIF A;  1S5L C;  2QSF X;  4E7S A;  2EV0 A;  3I58 A;  2KHM A;  4KN7 X;  4CH7 A;  1MBJ A;  2DMP A;  2ELJ A;  5IYD J;  1VQ8 I;  3TW6 A;  1ZRE A;  2WAF A;  1I1S A;  2VPL A;  5C4X J;  5DYM A;  1N25 A;  2LG4 A;  1OR7 C;  4B44 A;  1Z6R A;  3OYD A;  3KYC B;  3PNV A;  3TED A;  4IZZ A;  2QBY B;  4DYR A;  3KZI C;  1XGS A;  5LBQ A;  4N0B A;  3H92 A;  4C2M J;  1UHS A;  3OYL A;  2NXN B;  4UVC A;  4YG2 F;  3DEU A;  1H8A C;  1H9T A;  3HKZ A;  3QOD A;  5AON A;  1HCR A;  2M2E A;  4A3C J;  4C2U A;  3EET A;  3ZCO A;  1WH7 A;  3ZQ7 A;  5KVR A;  3U1K A;  2E36 A;  1MMN A;  3TO7 A;  3IH3 A;  5L3D A;  3ZGK A;  3DU5 A;  3S2W A;  3FXM A;  3VYU B;  4A3I J;  4QWQ A;  1UB9 A;  1HLV A;  2QLZ A;  4RAG A;  4F7Z A;  2I5U A;  3S1R J;  1QBJ A;  4GYI A;  2IS2 A;  3JRI A;  3S1Q J;  1UAA A;  2ZNZ A;  3L2C A;  2PJR A;  2P6S A;  3MZH A;  2HEO A;  3L7W A;  1TT0 A;  4F93 B;  1P4X A;  1IRF A;  3KX2 A;  4XKB A;  4EM2 A;  1ZG5 A;  4UXN A;  2NVX J;  1RET A;  1MMG A;  2M45 A;  4U0W A;  4MLO A;  1XS9 A;  2JSP A;  1W7P B;  3VPR A;  2K3F A;  3MKY B;  2R5Y A;  5HLH A;  3RI4 A;  4L9V A;  2ECC A;  2OBP A;  2DA4 A;  3P7N A;  3J7A Y;  3ABU A;  5GAE J;  1MDM B;  2ZB9 A;  2DMQ A;  3HRT A;  3A01 A;  2BY2 A;  2XGC A;  2LF7 A;  1O7F A;  2OCE A;  2UZK A;  5DD8 A;  1XB4 A;  4II3 A;  4IXA A;  1GT0 C;  2KJB A;  3EDP A;  2CW7 A;  3BRO A;  1O7L A;  2JA8 J;  3LAP A;  5LHI A;  2OQG A;  3FXL A;  1OIS A;  1U9N A;  2LRE A;  2VKV A;  3ASO H;  4XKW A;  4NUB A;  4E6K G;  4HQE A;  1T39 A;  1FLI A;  1LB2 A;  2PLY A;  2X6O A;  4EJO A;  4BDZ A;  1Z1D A;  1P6R A;  4HV6 A;  2HZT A;  2MLK A;  2K9S A;  1SD6 A;  2KIQ A;  3EUA A;  1H0M A;  1X4P A;  2ZXJ A;  2BY1 A;  1JE8 A;  5HDN A;  4KFC A;  1WZ2 A;  2FJ1 A;  1ZLJ A;  1TBX A;  1BC8 C;  4PFO A;  2KPM A;  2V1U A;  1RZ4 A;  5GTI C;  1I39 A;  4BXX J;  3QQA A;  1B8I B;  4Y4R A;  1FTT A;  2X6W A;  3D0S A;  1N77 A;  1KU2 A;  3U2R A;  2V1X A;  5C4J J;  2Y0S N;  3OMY A;  4Y33 A;  4DZP A;  3B6C A;  2H27 A;  1LVA A;  3F72 A;  2JTV A;  3K7A J;  2EJR A;  4OAY A;  2YPR A;  3LSM A;  3WHB A;  3BJO A;  1MJ9 A;  2DO7 A;  3C2B A;  3DQV C;  1W36 D;  2QSG X;  2HQN A;  3WU2 C;  1F36 A;  1IW7 F;  2BE5 F;  1X1B A;  5IP9 J;  5EF6 A;  3IL2 A;  2K9N A;  3K1P A;  2CV2 A;  1TQI A;  2M0C A;  4LIV A;  3IKT A;  2NVQ J;  3BC8 A;  3L2R A;  3DEE A;  3CC2 I;  2VOO A;  1R5I D;  1GXP A;  3DBL B;  1Z91 A;  2IA2 A;  2M34 A;  4IRH A;  4MFE A;  1IGN A;  1IXS B;  3EYY A;  1B1B A;  1BM9 A;  4S05 A;  3K9T A;  1S9H A;  4NC7 A;  3JR9 A;  4IRI A;  2R7U A;  2XF5 A;  4HF2 A;  1BI0 A;  2Q2E B;  3W2W A;  2LK2 A;  2ISY A;  2KMU A;  5JHU A;  3QRF F;  1PUF A;  4RB0 A;  2HDD A;  3S14 J;  1HDP A;  5GPC A;  3JSP A;  4KIS A;  4BL0 B;  4XLE A;  1YW8 A;  1XTA A;  2QKM B;  2LKP A;  3HSF A;  1VQO I;  1F1Z A;  4N9H A;  2MA3 A;  2ISZ A;  1FOK A;  2DXI A;  2MC3 A;  4HW0 A;  2QZ8 A;  4IOA F;  1D1A A;  3GBG A;  2IXS A;  3OL3 A;  2PJP A;  2EV5 A;  2M1B A;  5B1B H;  1VQK I;  1ODD A;  4PJN A;  1D3Y A;  2LOO A;  3RPQ A;  3IAS 2;  3U1D A;  3HOZ J;  1VQ6 I;  3PSF A;  2LFB A;  2XDV A;  2F5E A;  2BGC A;  5F0H A;  3Q0W A;  2BXY A;  4FE4 A;  5HOO A;  3G1O A;  3DV8 A;  3FDY A;  1RC9 A;  2KT0 A;  3BTI A;  1LUJ B;  3QYF A;  3JRC A;  4Q5S F;  2VQC A;  3K0L A;  2R7Z J;  5CVJ A;  5K7Z A;  1E3P A;  2EB7 A;  3WU0 A;  4XID A;  2VC0 A;  3I54 A;  1OYY A;  1JT6 A;  4G94 A;  1SD5 A;  2PMZ A;  2X6Y A;  4WWC A;  4JP0 A;  4C30 A;  2EBI A;  3ZMV A;  3TL4 X;  1G4D A;  2R7Q A;  1HOM A;  5JR3 A;  2Y9Y A;  4BBR J;  2HXO A;  4KYW A;  1FMV A;  2NOJ B;  3DTI A;  2E7W A;  2EA2 A;  1F9N A;  2QQA A;  3K70 D;  3H9J A;  4HQM A;  4B3A A;  1UMQ A;  2FU4 A;  2DA7 A;  3I4N J;  5DCM B;  2R7O A;  3GF2 A;  4PK4 A;  2VOP A;  3HRS A;  2XIG A;  3E5U A;  4RAF A;  3WTT C;  3BPX A;  1U78 A;  3G6E I;  3OR1 C;  4I7H A;  1ZK8 A;  3N4M A;  3BJ6 A;  2VUM J;  3L1P A;  3HL2 A;  2ZME A;  3HRM A;  2BY3 A;  1ETW A;  1RPW A;  1IDZ A;  2IGM A;  4LGW A;  4GFB A;  2LF8 A;  4EAT A;  1LFP A;  2ECB A;  2K9M A;  1E2X A;  2OA4 A;  1Q1H A;  2XRN A;  1GDT A;  5F04 A;  2ZNY A;  2AQE A;  3HOT A;  2EFQ A;  2CSO A;  2FBI A;  4XRM A;  1K83 J;  1ZHF A;  4L0Y B;  2M30 A;  5CJ9 A;  5E1Z B;  3CLQ A;  1PYV A;  1SFK A;  1YX5 A;  4YEL A;  3NEU A;  4YIR X;  2FOW A;  2Z5U A;  5CVV A;  1X1P A;  3ABT A;  3LMM A;  5GP9 A;  2KZG A;  2HGC A;  2KIU A;  4GYG A;  2Y9Z A;  3SZT A;  4LOC A;  1TZL A;  3S1N J;  5FB2 A;  5J40 A;  3C3W A;  1K6O A;  2LMD A;  3SEZ A;  2K40 A;  1W7P D;  3O3K A;  1BOA A;  3LQR A;  2ZSI B;  4S0H B;  2HNH A;  4B4C A;  1D0X A;  2DW4 A;  3HM5 A;  5LRS A;  4PDK A;  3OYE A;  4UUV A;  3PIO F;  2VJI A;  1RUO A;  2P7C B;  2GXB A;  4RGS A;  1TWG J;  5FGM A;  5LD2 C;  4ENJ A;  3I59 A;  2C6Y A;  4A6D A;  1FOY A;  3HG9 A;  2CUJ A;  3PFI A;  2L01 A;  3BJA A;  1BN5 A;  4KN4 X;  5CKT A;  1E0E A;  4BJT A;  3VFZ A;  2X51 A;  2HVS A;  1AKH B;  4J00 A;  2Y31 A;  1DPU A;  2ZME B;  2WAE A;  2UWM A;  5HVQ C;  2UXX A;  2ZJP F;  1TWC J;  2VBW A;  4XOR A;  3U21 A;  4AM3 A;  5LEJ A;  2V9V A;  5DTD A;  1BW5 A;  3CDH A;  3QPH A;  1OPC A;  1MBF A;  3HGY A;  1YG2 A;  5ICG A;  4DGW B;  3MKW B;  1CGP A;  2WWY A;  2JN6 A;  1WKM A;  2G0E A;  3KFW X;  3F6O A;  5J4V A;  2WV0 A;  2O0Y A;  2HYG D;  4BJ5 C;  4IHS A;  2JZY A;  4UB6 C;  1JHF A;  5B3S H;  4C2T A;  3BG5 A;  4U0V A;  4I01 A;  1R00 A;  2G7U A;  1T33 A;  1WI9 A;  3F8C A;  1YS7 A;  5FKO A;  1T0F C;  2XSJ C;  4IHX A;  1QU3 A;  2CRG A;  4M73 A;  2KRC A;  4Y15 A;  1KU3 A;  5IOZ A;  1QNT A;  5IY5 H;  1BOB A;  3JRB A;  5A2Q Z;  2Z2S B;  1SFU A;  4AVZ A;  3HOW J;  3DBR B;  4AD9 A;  3V8K A;  4JX5 A;  4C3J J;  5M5Y J;  2MAB A;  1ETV A;  3E7L A;  4HX4 A;  3SQN A;  3H5N A;  3A0H C;  2ZXW H;  3MZ8 A;  3I53 A;  4FIS A;  3FXO A;  4G7O F;  3HZJ A;  5TJJ A;  1I1G A;  3WTX C;  1N75 A;  3LA3 A;  4FE7 A;  4DW6 A;  1QHG A;  4FET A;  1KGS A;  2WA0 A;  2B7E A;  1IV6 A;  2W1O A;  2AQF A;  1RNL A;  3HKZ N;  1I3A A;  3NQO A;  3F22 A;  2VBZ A;  1IUF A;  4ZYH A;  1R71 A;  2PBI A;  2BW3 B;  2P81 A;  3BQZ A;  3OYB A;  2LD5 A;  2IGK A;  3QU6 A;  2W7N A;  3D1N I;  2KRF A;  4IQ4 A;  3OR2 C;  4BDY A;  3OIO A;  2BOL A;  5CLS A;  4BEH A;  3A4C A;  3L2Q A;  4I6Z A;  4MEX F;  1TLH B;  4PFP A;  2DK8 A;  3TBI A;  2Y0M A;  2GBY A;  4RGX A;  1D1C A;  4MFD A;  2VKD A;  2IS6 A;  3X2Q H;  1XDU A;  2ZBK A;  2IT0 A;  2QSH X;  1LNW A;  1YJW I;  1I6X A;  3ZMT A;  1HF0 A;  3TMO A;  2NVU B;  3VWB A;  3RZO J;  3FBN B;  1QO0 D;  2K27 A;  3NRV A;  4DNC A;  3MD2 A;  4XSX F;  1VQN I;  2R7X A;  3WG9 A;  2HOE A;  2L7M P;  2DYR H;  1K7A A;  1DPR A;  5K5Q A;  3E0J B;  2CMP A;  2JVG A;  3GFI A;  2LVS A;  1TQM A;  3SFZ A;  4F55 A;  2A6H F;  2NOG A;  2XSD C;  3K4C A;  2RKH A;  4IVN A;  5HLG A;  5KAI C;  3SZP A;  4II2 A;  3WTU C;  1ZRD A;  5IOY A;  5M5W J;  3RDI A;  2CU7 A;  2D1H A;  2M4K A;  4XBF A;  4IHW A;  4OIQ F;  1ULY A;  4E7H A;  3L09 A;  3OY9 A;  4I02 A;  3TO9 A;  3QPT A;  3LQQ A;  2MH9 A;  1OMI A;  4PGH A;  2L7Z A;  4BAY A;  3O2P E;  2LBF A;  3AL0 B;  1LKX A;  4IEJ A;  1WHU A;  4CZC A;  2PEX A;  1HW5 A;  1MBG A;  3DEW A;  1G3S A;  2CQX A;  2OJE D;  5D5X B;  3OYH A;  3JAM K;  3GEZ A;  1YFH A;  2CQ7 A;  5EDN A;  4AIK A;  3S2H J;  4F91 B;  1P4W A;  4AU7 A;  2DT6 A;  3A1Y A;  5FD6 A;  3CME I;  5JLW A;  4H0E A;  4CIC A;  4FQG A;  1YIO A;  5EEH A;  2H8W A;  4QLC U;  5BS6 A;  5HLT A;  3OS2 A;  1S72 I;  4XLP F;  4E7L A;  3HOY J;  2OTL I;  1IO2 A;  3FWE A;  4ZZD A;  2DT7 B;  4BXF A;  2KDZ A;  1XDS A;  4GDF A;  3GFJ A;  1USS A;  4RM2 A;  4LJZ F;  5E3M A;  1VQ4 I;  1MKM A;  3PSI A;  1AWC A;  4LK0 F;  3K2A A;  5F0C A;  1TTY A;  3IV5 A;  1BJZ A;  1TW3 A;  2O3F A;  1ENH A;  2A68 F;  1EF4 A;  4NDL A;  3CCE I;  2O8K A;  2E5Z A;  4KIB A;  3TGN A;  4HBL A;  1QZE A;  5KNL A;  5GAG J;  2MD5 A;  2QUF A;  4ENM A;  4IX7 A;  4XLC A;  2VQG A;  3L2U A;  2FXA A;  2GXA A;  3QOE A;  2ID3 A;  3JRE A;  3ZQH A;  4PJJ A;  2IS1 A;  2VBX A;  3CUQ C;  3JTG A;  5HLI A;  3GZN B;  2XHK A;  3QP5 A;  4LIU A;  1LDK B; 
#chains in the Genus database with same CATH homology
 1J9I A;  1FX7 A;  1CF7 A;  1TNT A;  5LHG A;  1G6N A;  3ML6 A;  4B09 A;  4RAZ A;  3RPU A;  4LG0 A;  3P9K A;  3SXY A;  2K4B A;  3WGI A;  3Q5F A;  1FNN A;  4BYY A;  1AOY A;  3R6S A;  3E5X A;  1J7K A;  4EJT A;  1KYZ A;  2X4H A;  4HF1 A;  2PI0 A;  2FEZ A;  1FPQ A;  3PQK A;  4WF2 A;  5LLQ A;  3RIR A;  4IRG A;  5HS8 A;  3T0Y A;  2RDP A;  3DXJ F;  2E7X A;  2FQ3 A;  3GFL A;  2DPD A;  3QAH A;  1K78 A;  2E1N A;  4L9N A;  5AIQ A;  4ON0 A;  4A0Y A;  2LDU A;  1SD7 A;  1EH6 A;  5L3E A;  5LGT A;  4OMY A;  2P6T A;  4G6D A;  1HKT A;  1R36 A;  3L9F A;  2MLG A;  5JVT A;  2FNP A;  2FA5 A;  4KIG A;  4WCG A;  3I64 A;  3FMR A;  1W5T A;  4ESF A;  4GGG A;  2P7V B;  2ADU A;  2YX4 A;  4A6E A;  3TDZ C;  2GWR A;  5L3C A;  2OZ6 A;  2W84 A;  2FBH A;  3RJP A;  1R7J A;  2W25 A;  5CVR A;  2CGP A;  4OIO F;  5FFX A;  2VT2 A;  3E6M A;  3TO6 A;  2R7D A;  3Q9S A;  1XSV A;  4JK1 X;  2RQP A;  3FXR A;  4UVA A;  1T2K A;  3KE2 A;  3CUQ B;  1FBQ A;  4RGR A;  2ZCW A;  4UV8 A;  3ZMS A;  4G6Q A;  1FP2 A;  2PG4 A;  4KT5 C;  1SD4 A;  1O57 A;  1S6L A;  4Q47 A;  1R5G A;  4LLN A;  1XGO A;  2W85 A;  4O3M A;  4IPA A;  3FMQ A;  1GXQ A;  4WX9 A;  1E17 A;  4ZYE A;  1IN5 A;  1ZLK A;  1QPM A;  2JT1 A;  4I98 B;  3WTZ A;  4LB5 A;  1FT9 A;  2XGX A;  4OOI A;  4M74 A;  2IJL A;  2A07 F;  1QGP A;  3E6D A;  2DQL A;  2XRO A;  5H6R A;  1L0O C;  2F5F A;  4M6X A;  3WE2 A;  1Z7U A;  2L4M A;  5TRD A;  1MGT A;  1ZN2 A;  1XCB A;  3F8F A;  1LEA A;  2STW A;  4FX0 A;  2JPC A;  1W5S A;  3CO6 C;  2O6G E;  3HSR A;  1KA8 A;  3P9C A;  4L0Z B;  2CWE A;  1WRJ A;  3DF8 A;  2DK5 A;  4B8X A;  5HDK A;  3IWF A;  5LHH A;  1BI3 A;  2VXZ A;  4R1H A;  3DP7 A;  4PCQ A;  4ETS A;  5JFR A;  1K78 B;  5DCF A;  3M8E A;  4EV0 A;  1RIO H;  1JHH A;  4I0A A;  3I5U A;  4FT8 A;  3U9G A;  5BPD A;  3E6C C;  4OIN F;  1U5T B;  2GA2 A;  4MTE A;  2BV6 A;  1Z9C A;  3V8L A;  1QZY A;  2EFO A;  1YYV A;  2B0L A;  1J75 A;  1R5H A;  1PP8 F;  1U3E M;  2GQQ A;  2HFH A;  3F8N A;  2GA1 A;  1L3L A;  2PMH A;  5E20 A;  1RUN A;  4RAY A;  2Y75 A;  4WXH A;  3G3Z A;  3T8R A;  2VON A;  4YFN F;  3DPT A;  4RB2 C;  3KZZ A;  4MNU A;  1IUY A;  4AVP A;  4LD5 A;  3ECO A;  4U7D A;  2G9W A;  3T1B A;  4BHP A;  2XAS A;  4Q48 A;  3ZN1 A;  3JTH A;  4DQ2 A;  1O3Q A;  4RB1 A;  4HOB A;  1BIA A;  3L00 A;  5E8G A;  4LMY A;  1YO5 C;  1NHA A;  1GHC A;  3VEP A;  3LFK A;  3K1N A;  2M8E A;  3QP6 A;  2HQR A;  1XMK A;  3ELK A;  5F6F A;  2FRH A;  1LEB A;  3EYI A;  1B6A A;  4M9S A;  2JSC A;  3R61 A;  4MTD A;  4KMU X;  5J8F A;  5ICF A;  4RGU A;  1JXS A;  3GZ5 A;  3BDD A;  3ZMU A;  2H94 A;  4MEY F;  4MQ9 F;  4L9T A;  1U5T A;  4S04 A;  3CO7 C;  1XMA A;  1R1U A;  1B9M A;  2J5P A;  2L3D A;  3HOS A;  3HYI A;  1D5V A;  5EEG A;  3MZY A;  4MQV A;  2ZJ2 A;  1TW2 A;  3RKY A;  4EM0 B;  4XLN F;  1G3Y A;  3RKW A;  3MCZ A;  1WWX A;  4LLG F;  5JI6 A;  4EM1 A;  4NHJ A;  2W57 A;  2FE3 A;  4EGY A;  1U5T C;  2O61 A;  2YX7 A;  1I27 A;  3H3Z A;  3ISP A;  4HZF A;  4I09 A;  2L4A A;  2VC1 A;  3FM5 A;  3EUH A;  5FFZ A;  3RYR A;  4L5J A;  3KLN A;  2V6C A;  4HX8 A;  4HAM A;  4MGR A;  1FYK A;  1UHM A;  5D8L B;  4A2U A;  4Y13 A;  3OV8 A;  1T98 A;  3J81 Z;  2FBK A;  5E8I A;  2D2W A;  5HDG A;  4YIF A;  1YLF A;  2HKO A;  1VTN C;  4M9X A;  3WE3 A;  4P55 A;  3HHG A;  1HSJ A;  3J80 K;  1UHW A;  2Z99 A;  3ZMZ A;  1MDM A;  1UST A;  4NQW A;  2UXN A;  4KUM A;  1ZAO A;  5D8K B;  3ZP5 A;  2M5W A;  1G3T A;  3SHF A;  5ED4 A;  4M6Y A;  1SMY F;  1ZGJ A;  5K5R A;  1S8N A;  3HSE A;  2YSR A;  3LAJ A;  1IXC A;  3ROU A;  4Q4Z F;  4R8H A;  3HHH A;  2DAO A;  3LWF A;  3V7R A;  4EMS A;  2DBB A;  3RYP A;  1I5Z A;  2KKO A;  2FNA A;  3BOQ A;  2FSW A;  5J6X A;  3DFG A;  5H6Q A;  4PZJ A;  1BI2 A;  3EQL F;  2IRF G;  3B73 A;  1BJA A;  4JQF A;  3BPV A;  1ZAR A;  4KIC A;  5HS9 A;  3BWG A;  2DLL A;  4G9Y A;  6PAX A;  3TKY A;  1FWZ A;  4WXC A;  1IN7 A;  3AAF A;  2QYO A;  1HKQ A;  3BP8 A;  3COA C;  5J8C A;  5D4S A;  3R4K A;  5LGU A;  2QM3 A;  3DPL C;  2GXG A;  3VOD A;  4LG0 B;  1IXR C;  1XGM A;  3C18 A;  4KIF A;  1XN7 A;  1FC3 A;  1IN8 A;  3V8J A;  4M71 A;  3FXU A;  3ZPL A;  2VE8 A;  4A5M A;  2H6B A;  2KJC A;  4KA4 A;  1MZB A;  4P96 A;  2P5K A;  1S7A A;  1KQ0 A;  3FX3 A;  5F1R A;  2A6E F;  1T38 A;  3IWZ A;  4ZZL A;  4BNC A;  2XKP A;  4M72 A;  4ENN A;  3BY6 A;  3M9A A;  2M87 A;  1U6G A;  3IRR A;  1F4K A;  2XVC A;  3WTY C;  2EFW A;  4A12 A;  2Y48 A;  4G7Z F;  1R23 A;  1XSX A;  4LLL A;  2JPB A;  2R3S A;  4AIH A;  3IKV A;  1F5T A;  2RV8 A;  4U88 A;  1REP C;  1W4M A;  3HTS B;  2FF4 A;  4CGZ A;  1STZ A;  2CW0 F;  5L3B A;  5D6F A;  5FLX Z;  1J0R A;  3GZ6 A;  3T8T A;  4ZH4 F;  2P8T A;  4TV7 A;  3PQJ A;  2O8X A;  3D5L A;  2BYV E;  5ILS A;  1FBS A;  3C1D A;  3I4P A;  3M8F A;  1KU9 A;  5H20 A;  3TOA A;  2FML A;  2XAJ A;  4HYE A;  3P9I A;  4OU0 A;  2NNY A;  2V79 A;  3GUD A;  3K69 A;  3WGH A;  1WQ2 A;  1OR7 A;  1O3R A;  5CVU A;  4L5I A;  1W7P A;  2P4W A;  1FBU A;  4HDU A;  2HR3 A;  1ZH5 A;  4D0P A;  1T6S A;  2A69 F;  1LDD A;  1TNS A;  4I0B A;  2K02 A;  2WC2 A;  5D5U B;  2QBY A;  2Q8K A;  2Q2E A;  4YFX F;  2NNN A;  3FZV A;  3M1E A;  2NYX A;  2IP2 A;  1RI7 A;  4GXO A;  5D5W B;  4UHT A;  1XGN A;  1SFE A;  1SMT A;  3CTA A;  3IRQ A;  4ESB A;  2O03 A;  4IHT A;  2KIF A;  1DUX C;  2H6C A;  2EFN A;  1FYL A;  3FM3 A;  2IA1 A;  4K2E A;  1O3T A;  2CO5 A;  1MJA A;  3M7G A;  1D8J A;  5BMZ A;  5DDG A;  3F8B A;  3KEO A;  3E3V A;  4HX7 A;  4HF0 A;  5DUI A;  5HS7 A;  1FP1 D;  1U8R A;  3VB2 A;  4GO1 A;  3VOE A;  1ZG1 A;  3REO A;  4BXU A;  5D4R A;  2DT5 A;  4G7H F;  2X0L A;  3GLX A;  2DPU A;  2H09 A;  2L54 A;  2COM A;  1HKS A;  1BI1 A;  2HYF A;  4OIP F;  3KEQ A;  4KMF A;  1PDN C;  5E1W A;  2CFX A;  2CYY A;  1HBX G;  5LRR A;  1HST A;  4CXF A;  5DUK A;  1J2X A;  5K5O A;  2F5D A;  2P5L C;  3RTR A;  3H3U A;  1Y0U A;  4UVB A;  1MD0 A;  2BBY A;  1PUE E;  3GO5 A;  1ON2 A;  4EQQ A;  2LSO A;  3KLO A;  3W6K B;  1P2F A;  1EH7 A;  3J7A O;  1R1V A;  4AWX B;  4ENK A;  4Z2Y A;  1HW1 A;  2ESN A;  1EV7 A;  4ESJ A;  2E1C A;  1J59 A;  4PGG A;  2WTE A;  4KDP A;  1FZP B;  5E17 F;  1J5Y A;  2AXL A;  2EV6 A;  1B9N A;  1MJB A;  2VBY A;  3I0T A;  2Z33 A;  2K86 A;  3R0J A;  3I59 B;  3ERE D;  3W6J B;  3KP3 A;  5ILV A;  1S3J A;  1BBY A;  3IC7 A;  3RKX A;  1XCV A;  4RB3 C;  2P5V A;  2RC4 A;  1YQA A;  3F8M A;  2BEO A;  4BHC A;  5KK1 A;  4A0Z A;  2D1V A;  2MBF A;  1DP7 P;  4RS8 A;  5D5V B;  5DV5 A;  5DD4 A;  3FHZ A;  1IN6 A;  3V7C A;  3E5Q A;  4LK1 F;  4UV9 A;  2RGV A;  4HV5 A;  2FOK A;  2HS5 A;  1ZGA A;  4E70 A;  1YTY A;  2MH2 A;  1OYW A;  2DU9 A;  1X3U A;  2TDX A;  2GAU A;  3CLO A;  1U2W A;  3K2Z A;  4U0Y A;  3ECH A;  2HKX A;  2YR2 A;  1ON1 A;  4LFU A;  4BQA A;  4XSZ F;  2OZU A;  3R0A A;  5DCM A;  5E18 F;  2VOD A;  4GCV A;  2ETH A;  1R58 A;  5CYV A;  3ZMD A;  4EGZ A;  1WSU A;  3MAJ A;  3TOB A;  2GIV A;  1K79 A;  2G7H A;  3FF5 A;  3JSO A;  1V4R A;  2EWN A;  4O5V A;  2QQB A;  4CHU A;  3KP4 A;  1LJ9 A;  4OIR F;  3TQN A;  3IHU A;  2EK5 A;  2K4J A;  1V3F A;  2PFB A;  2DI3 A;  2EFP A;  1YW9 A;  5LEK A;  1YS6 A;  1UFM A;  2L02 A;  3JW4 A;  2QWW A;  3CUO A;  5D6E A;  4EVI A;  1KU7 A;  1OKR A;  2XAQ A;  4L9J A;  3KP5 A;  2YU3 A;  2K7L A;  3KET A;  3N97 A;  3MFK A;  3QU3 A;  2NS0 A;  1SAX A;  2IW5 A;  3KP2 A;  4U7B A;  2GZW A;  3J80 Z;  1T0F A;  1IRG A;  2AS5 F;  1S29 A;  2PQ8 A;  2ZKZ A;  3F21 A;  2XAG A;  1LQ1 A;  1EH8 A;  2QEN A;  2NRA C;  1C0W A;  1XSD A;  5ERI A;  3KP7 A;  2QQ9 A;  1G3W A;  2VT3 A;  2KIM A;  4FHT A;  2PMU A;  2ELH A;  3TDU C;  2Z9O A;  3JAM Z;  1UCR A;  1IN4 A;  2HWV A;  4A5N A;  5BOX A;  1FYM A;  3WU1 B;  5FLX K;  1ZYR F;  5ILU A;  3LA2 A;  3OOP A;  1KQ9 A;  1PP7 U;  2NAZ A;  1QQI A;  3BZ6 A;  4UNO A;  3F3X A;  4A0X A;  2FMY A;  3WGG A;  4BHB A;  2A3S A;  5DEQ A;  1BIB A;  3KCC A;  4XRF A;  3FXQ A;  5ICC A;  2EA4 A;  1GVJ A;  1IAW A;  4BH9 A;  2IVM A;  2W24 A;  1FSE A;  5L3F A;  3GXO A;  3MQ0 A;  4P9F A;  2ZFW A;  1B4A A;  1HXD A;  1IZ1 A;  2OU2 A;  1P4A A;  1KQ8 A;  1P92 A;  2XAH A;  1FY7 A;  2PN6 A;  3K1M A;  4WXD A;  1R1T A;  1BC7 C;  1FSH A;  1O3S A;  1H9G A;  2XV4 S;  4G8X A;  2DFI A;  3GW2 A;  5CVI A;  2IA0 A;  2ACJ A;  1SFX A;  2A5Y B;  4I2O A;  2ESH A;  3V7S A;  2HTJ A;  2R7F A;  3WTW C;  3CJN A;  1ONV A;  2DQR A;  3E97 A;  3CUQ A;  4M9Z A;  3HUG A;  1ZRC A;  3DKW A;  4YFK F;  4HLX A;  4ZYD A;  2RNJ A;  3GX4 X;  2XAF A;  2J5O A;  3C7J A;  3V4G A;  4MHG A;  1R22 A;  1DDN A;  1QZZ A;  4Y17 A;  4CO8 A;  1S7O A;  4P5O A;  4FX4 A;  2VN2 A;  3G73 A;  5A2Q K;  4R79 A;  5FD5 A;  3ZN0 A;  2F2E A;  4ASN A;  4O6J A;  2IPQ X;  1HQC A;  3R60 A;  1ZG3 A;  3Q9V A;  3LST A;  4JBA A;  2CG4 A;  4CYD A;  2Q0O A;  4OMZ A;  2OD5 A;  3O6B B;  4YII A;  2XKO A;  3ULQ B;  2F5C A;  1B59 A;  4EJW A;  3KZY A;  1TQP A;  4IF4 A;  5AIP A;  1LDJ A;  3WTV C;  4L18 B;  2OQR A;  3QOP A;  2HTS A;  2STT A;  3KP6 A;  4EJV A;  3T5X A;  4HDV A;  5LGN A;  5BPI A;  4N9I A;  4HLY A;  4LB6 B;  1KYW A;  2VE9 A;  1Z6T A;  3MWM A;  5IT9 K;  1A04 A;  1XD7 A;  4IJA A;  3F23 A;  5FO5 A;  3GFM A;  2D45 A;  2QVO A;  1HW2 A;  2HDC A;  3E6B A;  2CQK A;  4P9U A;  2LNB A;  2Z3Y A;  3J81 K;  3GVA A;  1ZRF A;  2RN7 A;  5L3G A;  4HA8 A;  4ZYG A;  2RVC A;  1IF1 A;  2JRT A;  3I71 A;  2V1D A;  1CF7 B;  1Z05 A;  4AIJ A;  4EJU A;  3B02 A;  2DTR A;  5ICE A;  3LA7 A;  3WTS C;  4CDG A;  3GYH X;  2ZO4 A;  4NB5 A;  2OAZ A;  1OYI A;  3MEX A;  5F64 A;  1D8K A;  1YW7 A;  4CZZ A;  2XUB A;  4KNY A;  5K1Y A;  3GWZ A;  3HTU A;  3HRU A;  5IT3 A;  4WK8 F;  3FMS A;  1JGS A;  3F6V A;  2A61 A;  3WOD F;  5E1X A;  5BQT A;  5IT9 Z;  3HIF A;  2EV0 A;  3I58 A;  4KN7 X;  1ZRE A;  1I1S A;  5DYM A;  1Z6R A;  2QBY B;  1XGS A;  5LBQ A;  4N0B A;  3H92 A;  4UVC A;  4YG2 F;  3DEU A;  1H9T A;  5AON A;  3EET A;  3ZQ7 A;  5KVR A;  3TO7 A;  5L3D A;  3S2W A;  4QWQ A;  1UB9 A;  2QLZ A;  4F7Z A;  1QBJ A;  4GYI A;  2ZNZ A;  3L2C A;  2P6S A;  3MZH A;  2HEO A;  3L7W A;  1P4X A;  1IRF A;  4EM2 A;  1ZG5 A;  4UXN A;  2M45 A;  4U0W A;  1W7P B;  3RI4 A;  5HLH A;  4L9V A;  3P7N A;  2OBP A;  3ABU A;  1MDM B;  3HRT A;  2LF7 A;  1O7F A;  2UZK A;  5DD8 A;  1XB4 A;  4IXA A;  2KJB A;  3EDP A;  3BRO A;  1O7L A;  3LAP A;  5LHI A;  2OQG A;  4HQE A;  1T39 A;  1FLI A;  1LB2 A;  2PLY A;  4EJO A;  1Z1D A;  1P6R A;  4HV6 A;  2HZT A;  2MLK A;  1SD6 A;  1H0M A;  2ZXJ A;  1JE8 A;  5HDN A;  4KFC A;  1ZLJ A;  1TBX A;  1BC8 C;  2V1U A;  1RZ4 A;  3D0S A;  1KU2 A;  3U2R A;  2V1X A;  2H27 A;  1LVA A;  3F72 A;  2JTV A;  2EJR A;  2YPR A;  3BJO A;  1MJ9 A;  2DO7 A;  3DQV C;  2HQN A;  1IW7 F;  2BE5 F;  3IL2 A;  3K1P A;  1TQI A;  3IKT A;  2VOO A;  1GXP A;  1Z91 A;  2IA2 A;  4IRH A;  1IXS B;  3EYY A;  1B1B A;  1BM9 A;  4S05 A;  3K9T A;  4IRI A;  4HF2 A;  1BI0 A;  2ISY A;  5JHU A;  3QRF F;  4RB0 A;  3JSP A;  1YW8 A;  2LKP A;  3HSF A;  1F1Z A;  4N9H A;  2MA3 A;  2ISZ A;  1FOK A;  2MC3 A;  4HW0 A;  2QZ8 A;  2PJP A;  2EV5 A;  2M1B A;  1ODD A;  1D3Y A;  3RPQ A;  3U1D A;  2F5E A;  2BGC A;  5HOO A;  3DV8 A;  4Q5S F;  3K0L A;  5CVJ A;  2EB7 A;  3WU0 A;  2VC0 A;  3I54 A;  1OYY A;  4G94 A;  1SD5 A;  4WWC A;  3ZMV A;  1G4D A;  5JR3 A;  4KYW A;  2E7W A;  2EA2 A;  1F9N A;  2QQA A;  4HQM A;  2FU4 A;  5DCM B;  3GF2 A;  2VOP A;  3HRS A;  2XIG A;  3E5U A;  3WTT C;  3BPX A;  1U78 A;  4I7H A;  3N4M A;  3BJ6 A;  2ZME A;  3HRM A;  4LGW A;  2LF8 A;  2OA4 A;  1E2X A;  1Q1H A;  2XRN A;  2ZNY A;  3HOT A;  2EFQ A;  2CSO A;  2FBI A;  1ZHF A;  4L0Y B;  2M30 A;  5CJ9 A;  5E1Z B;  3NEU A;  2Z5U A;  5CVV A;  3ABT A;  2HGC A;  2KIU A;  4GYG A;  3SZT A;  5FB2 A;  1K6O A;  3C3W A;  1W7P D;  3O3K A;  1BOA A;  3LQR A;  2DW4 A;  5LRS A;  4PDK A;  4UUV A;  1RUO A;  2P7C B;  2GXB A;  4RGS A;  5FGM A;  4ENJ A;  3I59 A;  2C6Y A;  4A6D A;  3PFI A;  2L01 A;  3BJA A;  1BN5 A;  4KN4 X;  3VFZ A;  1DPU A;  2ZME B;  2UWM A;  5HVQ C;  2UXX A;  2VBW A;  5LEJ A;  2V9V A;  3CDH A;  3QPH A;  1OPC A;  5ICG A;  1YG2 A;  1CGP A;  2WWY A;  1WKM A;  3KFW X;  3F6O A;  2WV0 A;  2O0Y A;  2HYG D;  4IHS A;  2JZY A;  1JHF A;  4U0V A;  4I01 A;  1R00 A;  2G7U A;  1WI9 A;  3F8C A;  1YS7 A;  4M73 A;  4Y15 A;  1KU3 A;  1QNT A;  5A2Q Z;  1SFU A;  4AD9 A;  3V8K A;  3SQN A;  4HX4 A;  3I53 A;  4G7O F;  5TJJ A;  1I1G A;  3WTX C;  3LA3 A;  1KGS A;  1RNL A;  3NQO A;  3F22 A;  2VBZ A;  4ZYH A;  2PBI A;  3QU6 A;  2KRF A;  5CLS A;  4MEX F;  1TLH B;  2DK8 A;  2Y0M A;  4RGX A;  1XDU A;  2ZBK A;  2IT0 A;  1LNW A;  1I6X A;  3ZMT A;  1QO0 D;  2K27 A;  3NRV A;  4DNC A;  4XSX F;  3WG9 A;  2HOE A;  1K7A A;  1DPR A;  5K5Q A;  3GFI A;  1TQM A;  3SFZ A;  2A6H F;  2RKH A;  4IVN A;  5HLG A;  3SZP A;  1ZRD A;  3WTU C;  3RDI A;  2D1H A;  4XBF A;  4OIQ F;  1ULY A;  3L09 A;  4I02 A;  3TO9 A;  3QPT A;  3LQQ A;  2MH9 A;  1OMI A;  4PGH A;  4BAY A;  3O2P E;  2PEX A;  1HW5 A;  1G3S A;  5D5X B;  3JAM K;  3GEZ A;  1YFH A;  4AIK A;  1P4W A;  5FD6 A;  4H0E A;  4CIC A;  1YIO A;  5EEH A;  4QLC U;  5BS6 A;  4XLP F;  3FWE A;  4ZZD A;  1XDS A;  3GFJ A;  1USS A;  4LJZ F;  1MKM A;  1AWC A;  4LK0 F;  1TTY A;  1TW3 A;  2O3F A;  2A68 F;  4KIB A;  3TGN A;  4HBL A;  2MD5 A;  2QUF A;  4ENM A;  2FXA A;  2VBX A;  3CUQ C;  3JTG A;  5HLI A;  2XHK A;  3QP5 A;  1LDK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...