3F21A

Crystal structure of zalpha in complex with d(cacgtg)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
67
structure length
67
Chain Sequence
LSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structures of non-CG-repeat Z-DNAs co-crystallized with the Z-DNA-binding domain, hZ{alpha}ADAR1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific adenosine deaminase
total genus 22
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f21A00
4G7ZF 2ZJ2A 4HX4A 3LWFA 1IN5A 1U5TB 4K2EA 3TDUC 5FO5A 4OINF 4YG2F 4AIKA 2O61A 5KK1A 3J80K 1MDMA 2RN7A 4R79A 3SXYA 4IRGA 3CUQC 5LGNA 3DV8A 2W84A 1SMTA 4HQEA 4AD9A 1W5TA 4N9HA 1G3SA 1XGMA 2XAQA 3MWMA 2M5WA 5K5QA 5FB2A 1I1GA 1O3TA 3B02A 1W7PD 2VONA 2RQPA 1EV7A 1W7PB 1YW8A 2STWA 5HS7A 3KP5A 2O6GE 2D2WA 3HTSB 1TNSA 2LF7A 1ZH5A 3GFJA 5LHGA 4A5NA 5AIQA 3GW2A 1RZ4A 2BBYA 1U2WA 2IPQX 2F5FA 1O7FA 2HOEA 2GIVA 4GYGA 3IL2A 4LD5A 4KA4A 2KIMA 2YR2A 2W25A 1UHWA 2EFOA 3JTGA 1ZHFA 5L3FA 4N0BA 5ILVA 1BC7C 1IN6A 3I5UA 3V7CA 3GEZA 4BQAA 2OQRA 3PFIA 4I09A 3SFZA 2D45A 1LEBA 4UXNA 3EQLF 4G8XA 4IRIA 1MZBA 3IRRA 4BXUA 4F7ZA 1T0FA 4YFXF 2W85A 1R00A 2ZO4A 2Q8KA 5J8FA 2A6EF 4Y15A 2UXXA 3MZYA 1U8RA 2LNBA 2QQ9A 2KKOA 3O6BB 2XKOA 4KFCA 1HBXG 4HF2A 5JI6A 1SFXA 3I59B 1Y0UA 2Z33A 5EEHA 4PCQA 4BHPA 2EFPA 3W6JB 1ZN2A 1J0RA 3O3KA 4Y17A 6PAXA 1U5TC 4ENMA 1CF7A 2VE9A 1D3YA 3FXUA 1IXRC 1HKSA 1MJ9A 3HUGA 2F5DA 1REPC 2F5CA 2CWEA 4WK8F 4A0XA 3IC7A 1SFEA 4BNCA 2BYVE 2IRFG 1S3JA 3S2WA 2A07F 1Z05A 1B4AA 1USTA 1S8NA 2PN6A 1XMAA 4RB1A 2FMLA 4EJVA 3ZQ7A 3WU0A 2KIFA 4IPAA 3GXOA 3F3XA 1OPCA 4HLYA 1R5GA 2PEXA 3E5QA 1ON1A 3K1NA 4I7HA 5FGMA 1Z6RA 1ZREA 1L0OC 3ULQB 3MEXA 5ILSA 1ZAOA 2A61A 2FBHA 4MEYF 3GYHX 2DK5A 1J5YA 1BIAA 3JAMK 2P7CB 4S05A 1W5SA 2EV0A 1RUOA 3ZMVA 1GHCA 3NRVA 4PZJA 3WTSC 1YIOA 2E1CA 1BI1A 4DQ2A 2FNAA 3KCCA 4M71A 1HSTA 3T1BA 5DCMB 1XDUA 4U0VA 4ZYEA 1BI3A 2NNNA 2EWNA 1MDMB 2FA5A 1PUEE 2HYGD 2P6TA 3ZMSA 1OYIA 2FE3A 1DPRA 3RYPA 3Q5FA 1BN5A 4ASNA 2COMA 1QZZA 2JPCA 4RS8A 1XCVA 3F6OA 1K78B 4L9JA 3FMSA 1FC3A 3EYIA 1T98A 2FQ3A 4OU0A 4UV8A 2P5VA 4TV7A 4M9SA 3E5UA 3WODF 3I71A 2RGVA 2RVCA 2IT0A 1XMKA 1DPUA 1LQ1A 4XRFA 3KZYA 1V3FA 1YO5C 2XVCA 1IXCA 1SD4A 2CQKA 2GAUA 2X4HA 1B9NA 3R61A 2PI0A 5L3CA 2VOPA 1XN7A 1UCRA 2EV6A 1FBQA 2Y75A 4JQFA 2CSOA 4CGZA 2CFXA 2EB7A 4EVIA 3FZVA 2RDPA 3KP6A 5E20A 2L02A 1KU2A 1EH6A 1U3EM 5FFZA 2DBBA 1FOKA 2LF8A 1YQAA 4HX8A 3MCZA 1XCBA 4ZH4F 1JXSA 4OMYA 3ZP5A 1J7KA 2YPRA 3GFLA 5CVIA 1F5TA 3RTRA 4LMYA 3ERED 2XAJA 3KEQA 3K2ZA 1J2XA 2W24A 2OZ6A 2A68F 3HRMA 3QU3A 1YW9A 5EEGA 2VXZA 2IW5A 5D6EA 1WRJA 4PDKA 1T2KA 4EJWA 3G73A 5K5OA 1S7OA 4U88A 1QO0D 3GLXA 2MH9A 1R58A 2L3DA 2BGCA 1JHFA 2E7XA 3TGNA 4A2UA 4ZYHA 3RIRA 4UV9A 4FX0A 2UWMA 4LLNA 3R60A 4RAYA 3CLOA 4WCGA 1RUNA 3K9TA 4RB0A 2PG4A 4UNOA 2P4WA 4EM2A 3T5XA 1TBXA 3T0YA 4LLLA 2OZUA 4EJOA 3D0SA 1P4WA 1YFHA 1BC8C 3LAJA 4M9ZA 3WGIA 2MH2A 2HFHA 1BJAA 3M8FA 1ONVA 3B73A 1YYVA 4WXHA 3IKVA 1IN4A 1P6RA 4NB5A 3RKWA 2VT3A 2OD5A 3C7JA 2CO5A 5BPDA 2A6HF 3BDDA 4FX4A 3KE2A 2Z99A 4WF2A 2FEZA 4A5MA 3JSOA 4RGXA 2ESHA 4Q48A 5HLGA 5AONA 2DPDA 1QBJA 5LLQA 3QU6A 2QYOA 4JK1X 5HVQC 5DUIA 2PJPA 3M9AA 3QAHA 1MJAA 5ERIA 2FBKA 5LBQA 3ZN1A 2MLKA 3CO6C 4KUMA 2FSWA 1HQCA 1USSA 1LB2A 4S04A 1O57A 4XSZF 2KRFA 3WE2A 4BHCA 2KIUA 3BP8A 3DF8A 3ECOA 4KMFA 3DP7A 1RNLA 4G6QA 1FSEA 2HGCA 2V6CA 1R22A 4L0ZB 4GGGA 2ZCWA 2D1VA 4IXAA 1S29A 4CZZA 3I0TA 1ZLJA 2GZWA 3DEUA 2ETHA 2ZMEA 2QVOA 3KP2A 5HDGA 1VTNC 3E3VA 2EV5A 1UHMA 3KP3A 4JBAA 1PP7U 1CGPA 1R1VA 3FMQA 4UVBA 1IN8A 2MD5A 1C0WA 4O3MA 1PP8F 3L9FA 1DUXC 2DQRA 3P7NA 3F8NA 1BI0A 1SD6A 1O7LA 5E8IA 2QM3A 4L5IA 4MQVA 2QWWA 4HA8A 3IWZA 3IWFA 4WXCA 4G7HF 4EGZA 2VC0A 2YSRA 2O8XA 5E17F 2MC3A 1R1UA 1P4XA 3BPVA 3JTHA 1WI9A 4MNUA 2B0LA 2K4BA 5J6XA 3GF2A 5DD8A 4PGGA 4ETSA 3AAFA 3IKTA 3WGHA 1TNTA 4L5JA 2GWRA 4M9XA 2R7DA 4ENKA 2NAZA 2XIGA 4EM1A 3BZ6A 2H09A 3SZPA 3FF5A 4AVPA 2WTEA 1NHAA 4ZZDA 4KIGA 1H9TA 3KETA 1JE8A 1V4RA 1ZRDA 3GFIA 1TW2A 4HOBA 4LGWA 4MTDA 1QPMA 3RKYA 2R7FA 4M74A 3I4PA 3HOTA 4ESBA 2KJCA 1KQ8A 2JT1A 4RB2C 3Q9VA 2HQRA 3WU1B 2OA4A 4NHJA 5K5RA 3M1EA 4BHBA 2L4AA 3DKWA 1XB4A 5L3GA 3V7RA 2XGXA 5D8LB 2X0LA 1K6OA 3TO9A 5KVRA 5LRRA 3WTTC 1FYKA 5LRSA 3IHUA 2ESNA 2XUBA 3RI4A 5HLHA 1SD7A 3JW4A 4A0ZA 1JGSA 1XDSA 3MQ0A 4A6EA 1G6NA 4G6DA 3HSEA 2RNJA 3F72A 2Y48A 3KFWX 4YFNF 3C3WA 3H3UA 1F4KA 3OV8A 4OMZA 2BE5F 5LHIA 4AWXB 4AIHA 2ZNYA 5FLXZ 1F9NA 5ICEA 5JFRA 1J59A 3WTYC 2MA3A 1Z1DA 1R7JA 1B1BA 2LKPA 1TQPA 1YTYA 3BJ6A 1O3SA 1HW2A 2FNPA 3T8TA 2BEOA 4I0BA 5IT3A 4E70A 2FBIA 2IA0A 3VODA 5J8CA 4RGRA 1HSJA 3P9IA 4N9IA 3FWEA 4GCVA 1BM9A 5DCFA 2G7HA 2VC1A 1IZ1A 2J5OA 5CVVA 3K1MA 2OU2A 2P6SA 4M6YA 1T39A 3GO5A 3MAJA 2EA4A 2HWVA 3HIFA 1MKMA 2E7WA 3IRQA 4MEXF 1SFUA 2K86A 2W57A 1FX7A 5JHUA 3QP5A 1T38A 3ABTA 1DDNA 1IW7F 2G7UA 4KDPA 2RV8A 4ENJA 2V1XA 4CDGA 4G9YA 3HRSA 3FXRA 3C1DA 1UFMA 4FHTA 4KN7X 2Z3YA 1D5VA 3ELKA 2VT2A 4EQQA 3ZPLA 1FY7A 5ICGA 3BY6A 1XSXA 3FM5A 4KIBA 4M72A 1FBSA 5AIPA 1BOAA 3RKXA 1EH7A 4GYIA 1FLIA 3HOSA 3V8JA 4XBFA 1QQIA 5JVTA 1IAWA 1KA8A 2Z9OA 4Q47A 2L54A 4XLPF 3E6CC 2VBXA 3Q9SA 5D6FA 1ZG1A 3VFZA 2AXLA 3EYYA 3V4GA 4RAZA 1ZARA 5L3BA 1O3QA 2QENA 4HX7A 2PBIA 2VE8A 2STTA 2HR3A 5BS6A 5TJJA 3DQVC 3F6VA 2M8EA 1FT9A 4YFKF 1KU9A 1L3LA 3DXJF 1XGSA 5DUKA 1WQ2A 3K0LA 4LFUA 2ZFWA 5FLXK 2H6BA 3E6BA 2C6YA 3QOPA 1ZGAA 2Y0MA 3TQNA 3LA7A 4O5VA 2QLZA 2EA2A 5CJ9A 3TO6A 3L7WA 4HAMA 3G3ZA 3PQKA 1LJ9A 3DPLC 2H27A 4BAYA 2YX7A 2XAFA 1U6GA 2ACJA 2XKPA 4IHSA 3F8MA 3GFMA 4OIOF 1KYWA 2EFQA 4CICA 3F8FA 2WWYA 2ZBKA 1XGOA 5D5VB 4H0EA 5HLIA 2V9VA 1ZRCA 4L9TA 3SHFA 3TO7A 4P9UA 4FT8A 1O3RA 3LQRA 3E6MA 1U5TA 5DD4A 1HW5A 4L9NA 4BH9A 3WTUC 3WTVC 1QGPA 3N97A 2HYFA 1IN7A 4MGRA 1IRFA 4OIPF 1I5ZA 5DDGA 3E5XA 1DP7P 4HYEA 3CTAA 3GVAA 2ADUA 5A2QK 1P2FA 2R3SA 3LFKA 4LB6B 3CO7C 3CUQB 2UXNA 1S6LA 5F1RA 3L00A 5E1XA 4P55A 3D5LA 3KP7A 3E6DA 2WV0A 3GX4X 4EM0B 4IRHA 4I98B 3EETA 5E18F 1D8JA 4MHGA 3BJOA 4HV5A 1G3YA 3CJNA 3GUDA 4UVAA 2VBZA 1YG2A 5IT9K 1GXPA 3C18A 2HTSA 3HYIA 2UZKA 3T8RA 4ZYDA 4KIFA 4R1HA 1IUYA 5BOXA 4ESJA 2H6CA 3NEUA 5IT9Z 2DFIA 1GVJA 1KQ0A 2V79A 2PFBA 3E97A 3TOBA 1S7AA 2ELHA 4XSXF 5ILUA 3WGGA 5ED4A 2EFNA 2FOKA 1A04A 2A5YB 3QPTA 2PLYA 1SMYF 2EJRA 4UHTA 3WG9A 1IXSB 3HSRA 2QUFA 4EGYA 5ICFA 2XRNA 4IHTA 4HBLA 4ZZLA 2P5KA 2QZ8A 4QWQA 5D5WB 2V1DA 3LAPA 2XROA 1SD5A 3WTWC 3ISPA 1FSHA 2O3FA 2P8TA 2F2EA 5FD6A 1I27A 4ZYGA 4XLNF 1PDNC 3TDZC 4KN4X 2FRHA 2JZYA 4BYYA 3QRFF 3ZMDA 4Y13A 5HDKA 1ZRFA 1B6AA 3BWGA 2XASA 5BPIA 1KGSA 3V7SA 3DFGA 1ON2A 3F8BA 3HSFA 1G3TA 2MLGA 1KU7A 1B9MA 1XSVA 1YLFA 2IA2A 3WE3A 3U2RA 1G4DA 1AWCA 2DW4A 1J75A 4KNYA 2O03A 1E2XA 2JTVA 3LQQA 3DPTA 2ZMEB 1GXQA 3ML6A 1Z7UA 1FPQA 1MJBA 2XHKA 3J81K 1K7AA 2DI3A 2OAZA 3JAMZ 1IRGA 2NRAC 4EJTA 1STZA 3RJPA 2EK5A 2IP2A 3M7GA 1ZG5A 3COAC 3JSPA 2H94A 4HQMA 1P4AA 1OR7A 3PQJA 1KQ9A 4LB5A 4EMSA 4GO1A 1HXDA 2AS5F 2GA2A 1ODDA 5K1YA 2K27A 4KYWA 2PMHA 4RB3C 2NNYA 1FWZA 4R8HA 2M1BA 4B09A 1FP1D 1J9IA 2DTRA 3H92A 1Q1HA 1F1ZA 1I6XA 5E1ZB 4G94A 2L01A 1T6SA 1WWXA 2M45A 4HW0A 4PGHA 4U7DA 1U78A 5DEQA 4HV6A 1HKTA 2FMYA 2DAOA 1EH8A 3FHZA 1FYMA 1Z9CA 1FYLA 3LA2A 3HRUA 2DU9A 3EUHA 3J80Z 2LSOA 5D5UB 3GZ5A 3KP4A 1RI7A 2A69F 1K78A 3I53A 2EFWA 2OQGA 1H9GA 2ZKZA 1LEAA 2G9WA 2P5LC 2ZXJA 2PMUA 1TQMA 4LG0A 2GXGA 2RC4A 3BJAA 4KT5C 4EV0A 4L0YB 2DPUA 3I64A 4D0PA 1KYZA 2VN2A 3CUQA 4G7OF 1W7PA 5FD5A 3L09A 4CO8A 4KMUX 3CDHA 4RGSA 3LSTA 4GXOA 1D8KA 1G3WA 1Z6TA 5L3EA 1YS6A 3VEPA 1K79A 2M87A 2K7LA 2MBFA 3BROA 3HHHA 3BPXA 3R6SA 1LDKB 4HDVA 1QNTA 3H3ZA 4HDUA 2YU3A 3MFKA 2JPBA 3KZZA 3F8CA 3GZ6A 3FM3A 3RPQA 2CYYA 2HTJA 5A2QZ 2ISYA 4IJAA 3KLNA 1FZPB 2XAGA 1W4MA 3K1PA 3P9CA 3ABUA 2P7VB 3TKYA 1MD0A 3U1DA 2WC2A 3I59A 5CYVA 3F23A 3RPUA 3BOQA 4HLXA 4EJUA 4I01A 4OIRF 4M73A 2FF4A 5HDNA 4Z2YA 2HZTA 3FMRA 2GXBA 3ROUA 1FNNA 2A3SA 3F22A 2CG4A 3ZN0A 3SZTA 2QBYA 1R1TA 3QPHA 4P5OA 2BV6A 2O0YA 3O2PE 1R23A 5DCMA 1LVAA 5CVUA 4ESFA 1R5HA 2K4JA 1FBUA 1ZYRF 5LHHA 5FFXA 3R4KA 3LA3A 4B8XA 4IF4A 2NS0A 5E1WA 3ZMZA 2F5EA 4WXDA 3HHGA 3V8LA 3ZMUA 3KLOA 4UUVA 3EDPA 3FXQA 2DLLA 4RGUA 3REOA 1LDDA 3L2CA 5F6FA 2NYXA 4I2OA 5CVRA 3I58A 1BI2A 2TDXA 2XAHA 4OOIA 4YIIA 3K69A 2HKOA 3FX3A 4L9VA 2PQ8A 5D4RA 1HKQA 4CHUA 3VB2A 1BIBA 2HEOA 2FXAA 3W6KB 4WWCA 1TLHB 4LK1F 3MZHA 2E1NA 2QQBA 5F64A 2VBWA 2HDCA 5JR3A 3ZMTA 2Q2EA 1OYWA 4AIJA 4KICA 4WX9A 3SQNA 1OKRA 4CXFA 2QQAA 2IA1A 1YW7A 2IVMA 4Q5SF 4LJZF 4LK0F 1MGTA 3GWZA 3RDIA 2CGPA 2Q0OA 2J5PA 1I1SA 5CLSA 3V8KA 4CYDA 1YS7A 3U9GA 1XD7A 2K02A 4UVCA 2VODA 2JSCA 3R0AA 4I02A 5E8GA 2CW0F 4IVNA 5ICCA 2KJBA 2IJLA 5LGTA 1UB9A 1RIOH 5CVJA 1XGNA 4MTEA 4LG0B 1TTYA 1HW1A 4MQ9F 5LEJA 4P9FA 5H20A 3WTXC 2YX4A 4HF0A 5D5XB 4ENNA 4A0YA 2JRTA 1R36A 4DNCA 4QLCU 4HZFA 1ULYA 4NQWA 1SAXA 2HS5A 3R0JA 4A6DA 3KEOA 3NQOA 3QP6A 5H6RA 2DQLA 1B59A 2Z5UA 4M6XA 2XV4S 4OIQF 1ZG3A 4U7BA 2LDUA 1JHHA 1Z91A 2VOOA 4O6JA 1FP2A 1XSDA 3VOEA 4P96A 1OMIA 2HQNA 2VBYA 3CUOA 1LNWA 5D4SA 2DT5A 5LGUA 1WSUA 1WKMA 3TOAA 3HTUA 5DYMA 2OBPA 1H0MA 5BQTA 1KU3A 5HS9A 4YIFA 3OOPA 5L3DA 4I0AA 2D1HA 4A12A 4LLGF 1LDJA 5TRDA 1TW3A 3ECHA 1ZLKA 2GQQA 4Q4ZF 4L18B 5HS8A 5BMZA 3J81Z 1E17A 1QZYA 3F21A 4U0YA 1ZGJA 1P92A 2DK8A 3HRTA 1TQIA 1BBYA 4ON0A 1CF7B 2GA1A 5H6QA 2ZNZA 3RYRA 1OYYA 1AOYA 2ISZA 2RKHA 2M30A 5D8KB 2FU4A 5HOOA 3P9KA 2DO7A 3M8EA 4U0WA 5LEKA 4HF1A 3I54A 1X3UA 2V1UA 1IF1A 3N4MA 2QBYB 3WTZA 2HKXA 2L4MA 5DV5A 3J7AO
chains in the Genus database with same CATH superfamily
4G7ZF 2ZJ2A 4BDZA 3LSMA 4HX4A 3LWFA 1BL0A 1IN5A 1U5TB 2DMNA 4K2EA 2LK2A 4UB8C 2E60A 4A3FJ 4NDLA 4PJLA 3TDUC 1K83J 5FO5A 4OINF 4YG2F 4AIKA 2O61A 3WHBA 3MN2A 5KK1A 3J80K 1YHQI 1MDMA 2B63J 2RN7A 2LH9A 5FKOA 4R79A 3SXYA 4IRGA 4J19A 2VQLA 3CUQC 4RMNA 5LGNA 4B44A 3DV8A 3IUOA 3KYCB 3CMEI 1SANA 2W84A 1I3AA 3QPSA 1SMTA 4HQEA 3OMYA 4AD9A 1W5TA 2IXSA 2X6YA 3SFIA 1BJZA 4V2FA 1SC7A 1E3HA 4N9HA 1G3SA 1XGMA 2XAQA 3MWMA 1DP3A 2M5WA 2CUJA 4ZDPA 5K5QA 5B1AH 5FB2A 2MG4A 1A31A 3MZ8A 3GBGA 1I1GA 1O3TA 2DA4A 3B02A 4IZZA 3TEDA 1W7PD 2VONA 2RQPA 3HOXJ 3DEWA 1EV7A 1W7PB 1YW8A 2RNGA 2STWA 3JRAA 5HS7A 4IHWA 3KP5A 5GPAA 1WJFA 2DMPA 2R7QA 2O6GE 3JREA 4OAYA 4A69C 4A3DJ 2D2WA 3HTSB 1TNSA 2LF7A 3OIPA 2VASA 4DIQA 1Q1VA 1H88C 1XC5A 1ZH5A 3GFJA 2VKEA 5LHGA 2QKLB 4A3JJ 4A5NA 5AIQA 4HNVA 3GW2A 1GDTA 1VF9A 1RZ4A 2IEKA 1Z77A 2BBYA 1U2WA 2IPQX 2F5FA 2NXNB 3SDGA 4G6TB 1O7FA 2HOEA 1MNDA 3QODA 2X6XA 2GIVA 3KYDB 4NQWB 4GYGA 3IL2A 1GV2A 4LD5A 4KA4A 3MKWB 2KIMA 2YR2A 2W25A 3JRBA 1UHWA 2EFOA 3JTGA 3H0GJ 1ZHFA 4D7MA 5L3FA 4N0BA 1IRXA 5ILVA 1MMDA 1BC7C 4E6KG 5J1UA 1IN6A 3I5UA 2L7MP 5FKNA 3V7CA 3GEZA 3OS0A 4HG2A 3IP4B 2X1CA 4BQAA 2OQRA 3L2RA 3PFIA 1X2MA 2E1MC 4QTRA 2KPMA 4I09A 3SFZA 2D45A 4FE4A 1LEBA 4UXNA 4E4HA 2M7BA 5IPAA 3EQLF 2K3FA 2RQQA 4G8XA 1VQKI 4I6ZA 5M3MJ 2PJRA 4IRIA 2DA3A 1MZBA 3IRRA 1V55H 3H3VK 4B48A 4BXUA 4F7ZA 5H2FC 1T0FA 4YFXF 2TRTA 2W85A 1D0ZA 1PJRA 1R00A 4C2UA 5F0FA 2ZO4A 2Q8KA 5J8FA 1MMSA 2A6EF 2KIQA 2Y31A 4KITB 4Y15A 5J40A 4DGWB 2HPMA 2UXXA 3DWLE 2XSJC 3MZYA 1U8RA 2LNBA 3RKQA 2QQ9A 2KKOA 2W48A 1GUUA 3O6BB 3BT9A 2I10A 1MBEA 2XKOA 2MW8A 4KFCA 2O9LA 2EZHA 1HBXG 4HF2A 3FK6A 1DU0A 5JI6A 1SFXA 5C44J 3I59B 5FROA 4PUSA 3FXLA 1Y0UA 2Z33A 1R9TJ 5EEHA 1X1DA 2CQNA 2DMTA 1AU7A 3IH3A 4PCQA 4BHPA 2EFPA 2F4IA 3W6JB 1ZN2A 1J0RA 3ZQIA 1JUMA 2WA0A 3O3KA 5FRMA 4Y17A 6PAXA 1U5TC 4BUPA 4ENMA 1CF7A 2VE9A 3HOWJ 1BA5A 1D0YA 1D3YA 3FXUA 1IXRC 1HKSA 3RQ4A 3WU2C 4DW6A 3PL8A 1AKHB 1MJ9A 3HUGA 3FXMA 2F5DA 1REPC 2F5CA 2KT0A 3NWTA 3DU5A 2CWEA 4WK8F 2VB6A 1QA6A 4H4KC 2VPLA 4A0XA 4ZYAA 3IC7A 2BVMA 2ECBA 1SFEA 4BNCA 2M4KA 2BYVE 5EEAA 4J01A 4EATA 2IRFG 1S3JA 3S2WA 2A07F 1U9OA 3KEYA 2HOTA 4A3IJ 1RR7A 3I3LA 2R5ZB 3G71I 1Z05A 1B4AA 2VKVA 1USTA 2ZMEC 2VIXA 1S8NA 1SFKA 1EA3A 2K9MA 2H1KA 1X1CA 2PN6A 1UJ8A 1XMAA 1YX5A 1B72B 4RB1A 2FMLA 4EJVA 2LKXA 2VKHA 3BC8A 3HKZN 3ZQ7A 3WU0A 2KIFA 4IPAA 4DJAA 3GXOA 2R93J 3CDIA 2WAQN 3F3XA 1OPCA 4HLYA 5B66C 1TL8A 3TP3A 2MD0A 5JLWA 1R5GA 4FASD 4UUSB 2PEXA 3E5QA 1ON1A 3K1NA 4B3AA 2QKMB 3BR2A 4I7HA 5FGMA 3BTIA 1FTTA 4XKWA 1Z6RA 1ZREA 1L0OC 3ULQB 3K70D 3MEXA 5ILSA 1ZAOA 2A61A 2DA1A 3QYEA 5GAHJ 5E3MA 4C9YA 2ME0A 2QEXI 2FBHA 2M9HA 1ZK8A 4MEYF 3GYHX 1SVMA 2DK5A 3EUAA 3BR6A 1J5YA 1U0JA 1BIAA 3AG2H 1Y8QB 3JAMK 2P7CB 4S05A 1LKXA 1W5SA 3K7AJ 2AO9A 1RPWA 2EV0A 1RUOA 2OC6A 3U1KA 3ZMVA 3CCLI 2WBMA 4FCYA 4V19K 1GHCA 3NRVA 4PZJA 3WTSC 1YIOA 2E1CA 1BI1A 4AYBN 3LOCA 5EGOA 3G1LA 2M0CA 2RAEA 2FNAA 3KCCA 4XLHA 3OIQA 4DQ2A 5KAFC 4M71A 4HSTA 3BG9A 3GTGJ 4A3LJ 5EGOB 1HSTA 3S32A 2E71A 3T1BA 5DCMB 1XDUA 2LP0A 4U0VA 4ZYEA 1BI3A 2PMZN 3WHCA 2R92J 2NNNA 2EWNA 2YUSA 1MDMB 2IS6A 2FA5A 2XB5A 1PUEE 5M5YJ 2HYGD 2P6TA 3KX2A 3ZMSA 1OYIA 2QCOA 2FE3A 3RZDJ 1DPRA 3RYPA 3Q5FA 4BKXA 1BN5A 1UMQA 2CS3A 2COMA 4ASNA 2GM4A 1R71A 3LFUA 3OR2C 1QZZA 2JPCA 3LSGA 3AL0B 1D1CA 4RDUA 4RS8A 1XCVA 3F6OA 1K78B 5FKLA 4L9JA 3FMSA 1FC3A 2ME6A 3EYIA 1FEXA 4LIUA 1T98A 3DLAA 2FQ3A 4OU0A 2P5VA 3DBRB 4UV8A 1VQ9I 4TV7A 4M9SA 2F4MB 3E5UA 4C2MJ 2A05A 3WODF 1IO2A 4Y7NJ 1VQOI 2FD5A 2K9NA 3I71A 2RGVA 3HZJA 2RVCA 5DM7F 1XMKA 2IT0A 1DPUA 4DOZA 1LQ1A 4XRFA 1MSFC 5FKMA 3KZYA 1HDPA 2O7OA 1V3FA 3H9QA 1YO5C 3B6AA 2XVCA 1IXCA 1SD4A 2CQKA 2GAUA 2X4HA 1B9NA 3R61A 2L9RA 3ABLH 3SEZA 1LFBA 3H36A 2PI0A 3ABKH 4ZDLA 3MMYB 3W3CA 2HZDA 5L3CA 2VOPA 1XN7A 2X1DA 1UCRA 2L9SA 2EV6A 4BQNA 3HUGB 1FBQA 5C3EJ 2JA7J 2Y75A 2CQXA 4JQFA 2CSOA 2DT6A 4CGZA 2CFXA 3Q3SA 2EB7A 4EVIA 3FZVA 1ZELA 4HNTA 4FISA 4A3BJ 2RDPA 3KP6A 4M3GA 5E20A 2L02A 1KU2A 3ABMH 3CF5F 1EH6A 3GTPJ 1U3EM 1K6YA 1JJ8C 4I99C 5FFZA 2DBBA 3B6CA 2OTJI 5FLVA 5JVGF 1FOKA 2B7EA 2LF8A 1YQAA 3H1CA 4HX8A 3MCZA 1XCBA 2CFOA 4GRIA 1XS9A 4ZH4F 3S2DJ 1ERDA 1VQ4I 1JXSA 4OMYA 2Y0SA 3ZP5A 1IJWC 1J7KA 2H1LA 4XORA 2YPRA 3GFLA 3TL4X 4XKBA 2Y69H 3A4CA 5CVIA 1F5TA 3RTRA 4LMYA 3ERED 2XAJA 3KEQA 3K2ZA 1J2XA 2KZVA 2W24A 3TBIA 2OZ6A 2A68F 3HRMA 3CCJI 3HPHA 3QU3A 1YW9A 4IOAF 3ZR8X 4E7ZA 3TW7A 5EEGA 2VXZA 4F92B 2IW5A 5D6EA 1WRJA 2EQRA 4XOPA 4PDKA 1T2KA 3L2VA 1BR2A 4HRIA 4EJWA 3G73A 2VPRA 5K5OA 1S7OA 2GIZA 1Y0NA 2BHYA 1EJ9A 3I9V2 1JKQC 2LY1A 3E7LA 4C3HJ 2XRLA 4U88A 5IP6A 1XPXA 3A2KA 1QO0D 2E19A 1WJDA 3GLXA 1SVLA 4F52A 1ZTRA 2MH9A 1R58A 2L3DA 2BGCA 1A35A 1JHFA 2E7XA 5B5EC 2NS7A 5GP9A 2F5VA 3TGNA 3S16J 1TC3C 3C2BA 4A2UA 4ZYHA 1QRYA 1AKHA 2JWTA 3RIRA 4UV9A 1K61A 1I39A 4FX0A 2UWMA 4BBSJ 2L7FP 4LLNA 3R60A 5K7HA 3FBIB 4RAYA 3CLOA 4V2GA 4WCGA 1RUNA 3K9TA 4RB0A 3H35A 2PG4A 1ETWA 2KDZA 3M1CA 4UNOA 4PJJA 2P4WA 1HDDC 2LREA 1BW5A 2XPWA 2XC7A 2KZGA 3L2QA 1WI3A 3CDLA 2NVYJ 3NAUA 4EM2A 3T5XA 1TBXA 3T0YA 1MMAA 4LLLA 1G2HA 3W2AA 2O8KA 4JX6A 4LG3A 4NC7A 2M3AA 2OZUA 5IOZA 2R5YA 1MBHA 4EJOA 3D0SA 3GTLJ 1P4WA 3TMOA 2BHZA 5F1JA 1YFHA 2F48A 1BC8C 1N25A 3LAJA 1X58A 2QF7A 4M9ZA 3WGIA 5E79C 5LFAA 3OSFA 2HVSA 3GTMJ 2MH2A 4RA2A 3A1YA 5FJ8J 3LSPA 2I5UA 2HFHA 1BJAA 4D5CA 3M8FA 1ONVA 1WVRA 2Q1ZB 2VLAA 3B73A 3G2BA 1YYVA 2JVGA 4WXHA 2ID3A 3D5RC 3IKVA 1IN4A 4XLFA 3LL7A 2TCTA 1A6QA 1P6RA 2ELKA 4NB5A 3RKWA 2VJJA 2VT3A 2OD5A 2BY0A 2X48A 3C7JA 2CO5A 2IGKA 3DKYA 3FK7A 2BY3A 4HEA2 5BPDA 1F43A 2A6HF 3BDDA 3K4BA 1EKEA 2CUEA 4ANJA 4FX4A 2XF7A 3KE2A 2Z99A 4UY8I 2VUMJ 1DGWY 4PFOA 4RLFA 4WF2A 2FEZA 4A5MA 1LFUP 4W97A 4CCNA 3JSOA 3OYBA 4RGXA 2ESHA 2N8GA 4YRVA 4Q48A 4II3A 5HLGA 4RM2A 1PVEA 5AONA 2YU9J 2JUGA 3BCAA 2DPDA 1QBJA 4IL6C 2R7OA 5LLQA 3QU6A 2QYOA 4JK1X 5HVQC 5DUIA 1ACIA 2PJPA 1JT0A 5CQEA 3M9AA 3SDBA 3QAHA 1MJAA 2V4JC 5ERIA 2FBKA 5LBQA 3DTEA 3ZN1A 1MNEA 3ZQFA 2MLKA 3D1NI 2NVTJ 1X1PA 3CO6C 4KUMA 1HQCA 1USSA 2FSWA 1LB2A 4S04A 2X9DA 1O57A 3DTIA 4XSZF 2KRFA 3WE2A 4BHCA 2KIUA 4X1EA 5J4YA 3BP8A 3DF8A 3ECOA 3DTKA 3DP7A 4KMFA 2IAIA 4XM3A 2Q2EB 1RNLA 3FKIJ 4G6QA 1SAUA 2E5ZA 1FSEA 4IQ4A 5EJCA 2HGCA 3CC4I 5TISC 2WAQA 2V6CA 1R22A 4L0ZB 4GGGA 1YJNI 2ZCWA 2OTLI 3EUKL 2D1VA 4IXAA 1I3QJ 4GDFA 1S29A 4CZZA 2QGUA 1BR4A 3I0TA 1ZLJA 2GZWA 4ZJZA 2OPTA 3OYNA 1LPQA 1N75A 1POGA 3DEUA 3ASOH 3ZQQA 2ETHA 2ZMEA 2QVOA 3KP2A 5F27A 5HDGA 1VTNC 3E3VA 1J09A 2EV5A 2K40A 3HDDA 2ZXWH 2ZJPF 2DDAA 1UHMA 2EBIA 3KP3A 4JBAA 1PP7U 1CGPA 1R1VA 2M8GX 3FMQA 1NK2P 4UVBA 3HOVJ 2BW3A 1IN8A 2MD5A 3S2HJ 1C0WA 4O3MA 1DGRM 1PP8F 1RESA 3L9FA 1DUXC 2DQRA 5DTDA 1FTZA 3P7NA 3F8NA 1BI0A 1SD6A 2KISA 1O7LA 3GTKJ 4BACA 1OCOH 1MMGA 5E8IA 2A6TA 2LD5A 1BW6A 3U21A 2QM3A 4E7HA 2CQQA 4L5IA 4MQVA 3JRGA 1LVKA 2LLKA 1LUJB 1FIPA 2QWWA 1YE9A 2P0WA 3A01B 4E7LA 4ZC3A 4HA8A 3IWZA 3I4NJ 3IWFA 1ETQA 4WXCA 1YX3A 4G7HF 4EGZA 2VC0A 4N4NB 3ZXSA 4AYBA 1O4XA 1KZHA 3S1RJ 2YSRA 2O8XA 1SFOJ 5E17F 2MC3A 1R1UA 3IV5A 5C4XJ 1OFCX 1P4XA 5IP9J 3BPVA 2BZTA 3JTHA 1RKTA 1WI9A 4L5EA 1IG7A 4MNUA 2B0LA 2K4BA 3EPZA 3S1QJ 2EZIA 2MSYA 5J6XA 2DMUA 3GF2A 5DD8A 3OYCA 2XF5A 4LOCA 4PGGA 4ETSA 2R5ZA 3AAFA 1VFCA 3CCRI 3IKTA 3PNTA 4JP0A 2K3PA 3WGHA 1TNTA 3E0JB 1B8IB 4L5JA 2GWRA 4M9XA 2R7DA 2IS4A 4ENKA 4XN0A 1ETVA 4BGDA 2NAZA 1WJCA 3BG6A 1GVDA 2XIGA 3BG3A 4CUGA 3PNYA 4EM1A 3BZ6A 2H09A 3SZPA 3FF5A 2V26A 3IH4A 4Y4RA 4AVPA 2WTEA 3VSLA 5DS9A 2DXIA 3ONQA 3K6GA 1NHAA 4ZZDA 4XLAA 3A0HC 4KIGA 2Y0SN 1H9TA 1IRZA 3KETA 1IDYA 1JE8A 1V4RA 3PSIA 1ZRDA 3GFIA 2BW3B 1TW2A 4HOBA 3OYLA 4LGWA 4MTDA 2EPFA 3IAM2 1QPMA 1P7JA 3RKYA 2GLOA 1NTCA 2R7FA 1A36A 4M74A 3UR3C 3I4PA 3HOTA 2M7AA 2E35A 4XR6A 4ESBA 2KJCA 1KQ8A 2JT1A 4RB2C 1LE8B 5J4VA 1QVUA 3Q9VA 3FKJA 3A01A 2HQRA 4FETA 3WU1B 4JX4A 2DDBA 3HG9A 4BEHA 2OA4A 4NHJA 5K5RA 2YS9A 3L2UA 2DYSH 4E7SA 3M4OJ 3M1EA 3S3MA 3NWSA 4JYKA 2K9QA 4BHBA 2L4AA 1X4PA 3DKWA 3UNGC 1XB4A 5L3GA 3V7RA 2XGXA 5D8LB 3FDYA 2X0LA 3RZOJ 4UB6C 3JR9A 1K6OA 3TO9A 1XX5A 5KVRA 5LRRA 3OSGA 5F0HA 3WTTC 1FYKA 5LRSA 3OWTA 2HQAA 4LITA 5K7FA 3IHUA 1I50J 2ESNA 2XUBA 4ABZA 2VI6A 1S9HA 2CW8A 1GLNA 3RI4A 3BTCA 2CUZA 2I8DA 4IX7A 2EIJH 5HLHA 3TP0A 1SD7A 5EYRA 3JW4A 4A0ZA 1JGSA 1XDSA 4XLCA 3PO2J 3MQ0A 4M3FA 4A6EA 1G6NA 3X2QH 1JKOC 4G6DA 3ZQGA 2ZXHA 3LSIA 1WPKA 2K85A 1W0TA 2CV0A 3HSEA 3DPUA 2RNJA 1Z7LA 4C30A 2NVQJ 3F72A 2Y48A 3DKXA 5IP7J 3KFWX 1IV8A 4YFNF 3C3WA 3H3UA 3BG7A 1F4KA 3K4JA 1N78A 3OV8A 4OMZA 2BE5F 5LHIA 4IOCF 4AWXB 4AIHA 2V9PA 2ZNYA 4QPOA 4BQOA 4NC8A 2HXOA 5FLXZ 4XK4A 3C2GA 1F9NA 5ICEA 4LIVA 2XB0X 5JFRA 5KNLA 1X3WB 1J59A 2PMZA 5EDNA 2MA3A 3WTYC 1Z1DA 1R7JA 1B1BA 1HC8A 2LFBA 2LKPA 1TQPA 3HGYA 1YTYA 3BJ6A 1O3SA 1HW2A 2H8WA 2NOGA 1CQTA 2FNPA 1D1AA 3ZCOA 4PJMA 3T8TA 2E2IJ 2CQ7A 1JGGA 2BEOA 4I0BA 5IT3A 1DU6A 5EG0B 5FRNA 4E70A 2IA0A 2JUCA 1Y6IA 2FBIA 1MH3A 3VODA 3KIOA 5J8CA 3MKLA 4W1UA 3K4KA 3JRCA 4RGRA 1ZKGA 1HSJA 3P9IA 4Z6YA 4BE0A 4N9IA 3FWEA 5IYDJ 2ZC2A 4YELA 1ORKA 2HPIA 4GCVA 2NS8A 1BM9A 1D0XA 5DCFA 1ETYA 2G7HA 2HQ5A 2M34A 1W36D 2L0KA 2VC1A 5EZHA 5J1YA 2NVXJ 1IZ1A 3CCSI 2JVHA 1EF4A 3ESWB 2J5OA 2HVQA 4M3DA 3S14J 1JTXA 5CVVA 3K1MA 2OU2A 2P6SA 3CCUI 2WY7Q 2E1OA 2KQRA 4F93B 1JUSA 4A3CJ 2ZSHB 3N05A 2R7TA 4M6YA 2HXIA 1T39A 4ITVA 3GO5A 1VNDA 1WH7A 4A3EJ 1TWCJ 3MAJA 2EA4A 2HWVA 1IDZA 3HIFA 2KDOA 2CW7A 1MKMA 2E7WA 3IRQA 4MEXF 1YITI 4AU7A 1FOXA 2FX0A 2R5YB 1SFUA 2VJ4A 2K86A 4PFPA 2W57A 1FX7A 4BDYA 5JHUA 4IKFA 3QP5A 3AG1H 1T38A 4XKVA 1ZQ3P 3ABTA 4XN3A 5B3SH 2W4SA 1DDNA 2Z16A 1K4TA 1IW7F 2G7UA 2K9SA 1WHUA 3KYLA 3S1NJ 4KDPA 2RV8A 4ENJA 2LBFA 2V1XA 2W00A 1FIAA 4CDGA 4G9YA 3E1SA 3HRSA 3FXRA 2JJ7A 3C1DA 1MSEC 1UFMA 4FHTA 3FIWA 4RAGA 4KN7X 2D5VA 1U9NA 3S3NA 2Z3YA 2LBFB 2Y30A 3TW6A 1D5VA 3ELKA 3JRDA 2VT2A 4EQQA 1YJ9I 3ZPLA 1FY7A 4JX5A 3K4CA 5ICGA 3BY6A 1XSXA 3FM5A 4KIBA 1ZR4A 4CH7A 1ZR2A 4M72A 3PSFA 4C3IJ 1FBSA 1FJLA 5AIPA 1BOAA 3RKXA 1EH7A 2LVSA 3CESA 9ANTA 2GBYA 2JSPA 5F08A 4GYIA 3H5RA 4C3JJ 1FLIA 3HOSA 3BLYA 3V8JA 4AC0A 3K70C 4XBFA 1MBKA 1QQIA 3QOEA 4XL9A 4QPQA 5JVTA 1IAWA 2E2JJ 4D9JA 1KA8A 3S15J 2Z9OA 4Q47A 2L54A 4PJNA 4XLPF 3E6CC 3QYFA 2VBXA 3Q9SA 5D6FA 1ZG1A 4YEJA 3VFZA 2AXLA 3EYYA 3V4GA 1RC9A 4RAZA 2DA2A 1ZARA 5L3BA 1WJBA 1O3QA 4E7IA 2QENA 4HX7A 3IH2A 3HOZJ 3I4MJ 2PBIA 2VE8A 2STTA 4XQFA 3JRIA 2IGOA 2HR3A 5BS6A 5TJJA 2AQEA 2DA6A 3DQVC 3C2HA 1YOVB 4MIMA 2CRGA 2JMWA 1QHHD 3Q0VA 3F6VA 4JOMA 3MKYB 3J7AO 3CCEI 2M8EA 1IGNA 1FT9A 2MGQA 2X6OA 4YFKF 1KU9A 4CCJA 1OCZH 1L3LA 3DXJF 1Y1WJ 1XGSA 5DUKA 2OV7A 3HXLA 2LMDA 5IYCJ 1WQ2A 2FOWA 3G1MA 1NK3P 2DTZA 2CV1A 3K0LA 4LFUA 2LKSA 1U8BA 1X19A 2ZFWA 4XKCA 1PUFA 3RCOA 1LFPA 1OCCH 5FLXK 2H6BA 3E6BA 3PIOF 2C6YA 1XTAA 2WADA 3QOPA 1ZGAA 2Y0MA 1QHGA 2WB1A 3TQNA 4E7KA 3LA7A 3ASNH 4O5VA 3OL3A 2QLZA 1KONA 2EA2A 4RAFA 1WH5A 5LD2C 5CJ9A 2OCEA 4A3GJ 2BVLA 3TO6A 3L7WA 4AVZA 4CCMA 4HAMA 3G3ZA 5CQGA 3AFHA 2E1MB 4Y33A 4AIDA 3PQKA 4RLQA 2BXYA 1LJ9A 3DPLC 2VKDA 4BAYA 2H27A 2LYCA 2YX7A 4N4OB 2XAFA 1U6GA 2ACJA 1BR1A 2XKPA 4IHSA 3F8MA 2G0EA 3SEQA 3BR0A 3GFMA 4OIOF 4CA0A 1KYWA 1N77A 2VJIA 2EFQA 3K2AA 4CICA 4BXFA 3F8FA 2ZJQF 2WWYA 3KPHA 4EEFG 1E3OC 2ZBKA 1XGOA 5KHDA 1TT0A 3V42A 5D5VB 5GTHC 5IYBJ 5HLIA 4H0EA 2V9VA 1ZRCA 2R7RA 4L9TA 3SHFA 3TO7A 1WGXA 4P9UA 4FT8A 2BXZA 4IEJA 1O3RA 4BQQA 2LR8A 3LQRA 3E6MA 4BBRJ 3PNVA 2ZXIA 1U5TA 4II2A 1HCRA 5DD4A 1HW5A 2OJED 3OL4A 4L9NA 2ICWG 1HLVA 4CYCB 4BH9A 3WTUC 2CUFA 1S72I 4A3KJ 3WTVC 3CD6I 1Z67A 1QGPA 3N97A 2AXTC 4PSXA 4B4CA 2HYFA 1IN7A 3MVPA 4MGRA 3LSHA 1IRFA 1HA8A 2X1EA 2EZLA 3BR1A 4FE7A 4OIPF 1I5ZA 3HB9A 5DDGA 3E5XA 3QQAA 1DP7P 4HYEA 1WZ2A 3OS2A 4DBQA 3HM5A 5E3LA 3CTAA 2V6EA 3GVAA 2ADUA 1JUPA 4F55A 1UHSA 2VQCA 5A2QK 2LC2A 4D5FA 1P2FA 3Q0WA 1FOYA 1W36C 2R3SA 3FXOA 4ZDOA 3LFKA 2RREA 4LB6B 3CO7C 3BZKA 3CUQB 2UXNA 2VJ5A 1S6LA 1D5YA 3BTLA 1JKRC 5F1RA 4XRSG 3L00A 1K4SA 3A03A 5E1XA 1JT6A 4P55A 3HGGA 3D5LA 3KP7A 2HVRA 3E6DA 5EF6A 2WV0A 3GX4X 4EM0B 1B8IA 3J7YJ 4IRHA 4I98B 3EETA 1V5FA 5E18F 1D8JA 4F3QA 2W82A 4MHGA 3O8HA 1FMVA 3BJOA 4HV5A 3CF2A 2DODA 1G3YA 2X6WA 3CJNA 3GUDA 4UVAA 4G12A 1UG2A 3BR5A 3P5JA 2JN6A 2VBZA 1YG2A 5IT9K 5J1RA 1Y39A 2UV1A 1GXPA 1P7IA 3C18A 2HTSA 3A0BC 4BE1A 3GTQJ 2EIMH 3HYIA 2UZKA 3T8RA 4ZYDA 1UZCA 4KIFA 4R1HA 4B43A 1Y56A 3PUFA 1VQ5I 2NVUB 1IUYA 4DYCA 5BOXA 2VQGA 2H6CA 4M6VA 3OYJA 4ESJA 2DYRH 3CQZJ 4XMYA 3NEUA 3DBLB 3DLLF 5IT9Z 2DFIA 4PJ0C 2AHQA 1GVJA 1KQ0A 3OR1C 2V79A 3OY9A 2PFBA 1JJ6C 4E7JA 3E97A 1BOBA 4D7NA 3TOBA 1S7AA 3MKZA 1FMWA 2JA8J 2R0QC 3W2VA 2ELHA 4XSXF 4XRMA 1Z3XA 5ILUA 5DM6F 3WGGA 4DBRA 2UUZA 5IOYA 5ED4A 4HPQA 2EFNA 3AKZA 4MFEA 3CCQI 2FJ1A 2FOKA 1A04A 3DU6A 2A5YB 3QPTA 1VQMI 3J7ZI 1R49A 2DFHA 2PLYA 1SMYF 2Y9ZA 4NNJA 4XLEA 4IHYA 2EJRA 4UHTA 2HYJA 3WG9A 3RSNA 1IXSB 3HSRA 2HOAA 2QUFA 4EGYA 5ICFA 5HNFA 2XRNA 1RRJA 4IHTA 4HBLA 1YRNA 3F9KA 4ZZLA 2P5KA 2QZ8A 2XPUA 3S3OA 4QWQA 5D5WB 3JRHA 2V1DA 3S8PA 3LAPA 1SD5A 2XROA 3WTWC 3ISPA 1FSHA 2KLOA 2O3FA 2FUG2 1YRNB 1MH4A 3CCYA 4PSWA 2ZB9A 1LE8A 5M3FJ 4XICA 2P8TA 2F2EA 2R7XA 1I27A 4XNFA 4ZYGA 5FD6A 1A5JA 5GTIC 4XLNF 1PDNC 2KMUA 4KN4X 3TDZC 2FRHA 2JZYA 1SVOA 4BYYA 3QRFF 3ZMDA 4CCKA 4Y13A 1E3PA 5HDKA 2F6CA 1ZRFA 2KHMA 1B6AA 3BWGA 2XASA 3HBLA 5BPIA 2XGDA 1KGSA 3V7SA 3DFGA 2XDVA 1ON2A 3F8BA 3GZNB 3HSFA 1G3TA 1S7EA 2MLGA 1ENHA 1KU7A 1B9MA 2DOAA 2IS1A 1XSVA 2CH0A 1YLFA 3FXKA 2HU9A 2IA2A 3WE3A 3U2RA 5CKTA 4YIRX 1G4DA 1AWCA 1Y1VJ 2DW4A 1J75A 3CC2I 3GCMA 4KNYA 2O03A 1M1EB 1E2XA 3G4SI 2KRCA 2JTVA 1MIJA 3BG5A 3LQQA 5GADJ 3DPTA 4IO9F 1OCPA 4IHXA 5FKKA 2ZMEB 3CZ6A 1GXQA 3HEFA 3ML6A 1Z7UA 1FPQA 2XHKA 1MJBA 2EZKA 3GTJJ 1F36A 1MBGA 2HI3A 3J81K 3CMYA 1K7AA 2DI3A 2JA5J 5KAIC 2OAZA 2Z1DA 3JAMZ 2QSGX 4Y3OA 1YIJI 2XPVA 5JHFA 3CP2A 1IRGA 1TWHJ 3QYBA 3RPUD 2NRAC 4EJTA 1STZA 3WG7H 5J3LA 5M5WJ 3RJPA 2EK5A 2IP2A 2IBDA 3M7GA 4OAZA 5CPRB 1ZG5A 2COBA 2M4GA 3COAC 3JSPA 4BY1J 2H94A 4HQMA 1P4AA 1OR7A 3PQJA 1NG6A 3DEEA 1KQ9A 3BQZA 4BU2A 2V9KA 3OYDA 2IGMA 4LB5A 4EMSA 1X3ZB 4GO1A 1HXDA 2AS5F 3HJEA 1ODDA 2GA2A 3LNQA 4GFBA 4S0HB 5K1YA 3OYFA 2K27A 2PMHA 4RB3C 2NNYA 4KYWA 1FWZA 4R8HA 1PYVA 1WJ5A 2M1BA 4B09A 1FP1D 1E0EA 1J9IA 2DTRA 3H92A 3ZOBA 3FISA 1IC8A 1Q1HA 1T8IA 1F1ZA 4OWRB 1I6XA 1GT0C 5E1ZB 4G94A 1WJEA 2L01A 3PO3J 1T6SA 1WWXA 4MLOA 3AL0C 2M45A 4HW0A 3S17J 1ETOA 4BJTA 4PGHA 4U7DA 1U78A 1W5CC 5DEQA 1MMNA 4IQJA 4HV6A 1HKTA 4KJZA 1VQPI 2FMYA 2DAOA 1EH8A 2VXDA 1R4MB 2KL4A 3FHZA 1FYMA 1Z9CA 2EINH 1OCRH 1FYLA 3LA2A 3HRUA 2DU9A 1YI2I 5HLTA 1TWGJ 3EUHA 5EG0A 3J80Z 2LSOA 4DZJA 5D5UB 3GZ5A 3KP4A 1RI7A 2P81A 2XGCA 4BY7J 2A69F 2O5RA 2K5CA 1K78A 3I53A 2EFWA 1P9QC 2VL8A 2IS2A 1VQ7I 1QZEA 1TWFJ 2OQGA 5HODA 5FLMJ 1H9GA 2ZFUA 2ZKZA 3AG4H 1YJWI 1LEAA 5M5XJ 2VQHA 2G9WA 2JA6J 1UG0A 2P5LC 4HSRA 2ECCA 2ZXJA 2DT7B 1FOWA 2CMPA 2PMUA 1TQMA 4I76A 2GXGA 2RC4A 3BJAA 4KT5C 4LG0A 4EV0A 2DPUA 4L0YB 3HOYJ 5JLXA 3I64A 4D0PA 4BEHB 1KYZA 3HKZA 2VN2A 3CUQA 4G7OF 1W7PA 5FD5A 3J7AY 1Y8RB 3L09A 4CO8A 1RR8C 4KMUX 3CDHA 4RGSA 3LSTA 4HNUA 3NARA 4GXOA 1D8KA 2M2EA 1G3WA 1X4OA 1G8XA 1OLTA 1Z6TA 4KISA 5L3EA 1YS6A 1VQLI 3VEPA 2V7FA 4IHVA 2R7SA 3ZQLA 1K79A 2WAEA 2M87A 1Z21A 2K7LA 2MBFA 4BJ5C 1ETKA 3BROA 3CMAI 3EUHC 3H9GA 3HHHA 3PM1A 3BPXA 3R6SA 3I55I 1LDKB 3VSKA 5GAEJ 4HDVA 1NG7A 1QNTA 1GV5A 3H3ZA 2R7WA 2PX9A 4HDUA 2YU3A 3MFKA 2LY9A 2JPBA 3KZZA 3F8CA 3GZ6A 2X51A 1A6IA 3FM3A 3GMEA 4U87A 1OCTC 3FXJA 3RPQA 2CYYA 2HTJA 5A2QZ 2DOEA 4CYCA 2ISYA 3OOUA 3S1MJ 1ETXA 4IJAA 3Q0UA 3KLNA 4BXXJ 1VQ6I 1FZPB 2XAGA 4KT6A 2E2HJ 2OUMA 4DZPA 1W4MA 4X6AJ 3CJRB 2JQ7A 3K1PA 3P9CA 3ABUA 1TWAJ 2P7VB 3CJTB 3CLQA 1MD0A 3TKYA 3U1DA 4NC6A 2Y9YA 2WC2A 3I59A 2E5NA 3K4LA 4B3XA 5CYVA 3PJRA 2DJNA 4BJ6C 3F23A 1VQNI 3RPUA 3BOQA 5EZGA 4HLXA 4M3BA 2BY2A 1B72A 4EJUA 4PK4A 3BQYA 1PUFB 2K9LA 4X0GA 4I01A 4OIRF 4M73A 3F0CA 3RQIA 2FF4A 3VDXA 2DMQA 5HDNA 4Z2YA 3ZQHA 3W2WA 1IUFA 3AG3H 1QVTA 2HZTA 3FMRA 1WFXA 3S93A 2GXBA 3ROUA 2NOJB 1FNNA 5C4JJ 2A3SA 2W1OA 4CCLA 1T33A 4NUBA 1AA7A 3K10A 2XAUA 3F22A 4UUTA 2CG4A 2IGNA 3MD2A 3ZN0A 4CCOA 1R5ID 3SZTA 5KCMA 2QBYA 3QPLA 3GTOJ 5GPCA 1R1TA 4MFDA 3QPHA 2LOOA 4P5OA 2BV6A 2O0YA 4CSWA 4QIWN 3O2PE 4A93J 1R23A 1X1BA 1H8AC 5DCMA 3SZGA 1LVAA 3VYSB 5CVUA 4ESFA 2BY1A 1R5HA 2K4JA 1FBUA 1TT5B 1X1AA 1ZYRF 2XGEA 5FFXA 3R4KA 5LHHA 4XOTA 3LA3A 4B8XA 4IF4A 2HNHA 1V54H 2CJJA 3FBNB 2EIKH 2NS0A 5E1WA 3ZMZA 2F5EA 4WXDA 3L2WA 2GOXB 3HHGA 3H9JA 3V8LA 3ZMUA 3KLOA 1W0UA 2MYSA 1UAAA 3H5NA 2M0MA 4UUVA 3EDPA 3FXQA 2DLLA 1QPIA 4ZTJA 1WCMJ 5E3OA 4RGUA 1AHDP 1OJLA 2A5WA 3G1OA 3IAS2 3REOA 3M8JA 1LDDA 4FTHA 1MNMC 1I6HJ 3L2CA 2JA2A 1NH3A 5F6FA 2NYXA 2AQFA 3K4MA 3OYEA 4I2OA 3LSKA 2LTPA 1SEUA 5CVRA 4MO7A 3I58A 1BI2A 1T0FC 2TDXA 2LG4A 2XAHA 3LMMA 4OOIA 2WV1A 4YIIA 3DCFA 3K69A 2HKOA 3FHNA 3FX3A 1TP4A 4L9VA 2Y2ZA 3HC7A 4M3EA 2R7ZJ 4XIDA 1XG1A 2PQ8A 3H0DA 5D4RA 3OYAA 1HKQA 4J00A 1XMXA 3BCBA 5F0CA 3LSJA 2QQ8A 2B9SA 4CHUA 4D1QA 3VB2A 4C2TA 1BIBA 1RKWA 3PUBA 2HEOA 1MW7A 2FXAA 3BR3A 3W6KB 4WWCA 3OS1A 1JKPC 3O8GA 3VWBA 4BL0B 1TLHB 4LK1F 2L7ZA 3ZGKA 1V5EA 3MZHA 2E1NA 2QQBA 1Z0XA 2DFEA 5F64A 4B1RA 3G6EI 2VBWA 2HDCA 2MFZA 5JR3A 3ZMTA 2Q2EA 1QU3A 1OYWA 2L5QA 3QWLA 2HOSA 4AIJA 4F91B 3OYIA 4ZTFA 5GAGJ 3SJMA 2HDDA 4KICA 4WX9A 3SQNA 1Z3YA 2F4OB 1OKRA 1JI8A 5BNGA 4CXFA 2QQAA 2IA1A 1YW7A 2IVMA 2WB1N 4P1WA 4Q5SF 4LJZF 4LK0F 1MGTA 2E36A 1T95A 3GWZA 3RDIA 2CGPA 3PFYA 3VPRA 4CZCA 1H89C 4RBOA 2GXAA 3OIOA 2Q0OA 3M07A 3HL2A 3ZQCA 1V5GA 2J5PA 2ZJRF 1I1SA 1X2NA 5CLSA 3CCVI 3V8KA 4DYQA 4CYDA 1T56A 1YS7A 3U9GA 1XD7A 2CV2A 2CU7A 2K02A 4AUXA 3M3YJ 2KFDA 3OYGA 4UVCA 2VODA 2JSCA 5K7ZA 3R0AA 4I02A 5E8GA 2CW0F 4IVNA 2DFFA 5ICCA 2KJBA 4AM3A 3BZCA 1IV6A 2IJLA 5LGTA 4QSHA 1UB9A 1RIOH 3CP8A 3JCUC 2WAFA 5CVJA 1XGNA 1T08B 4MTEA 4LG0B 1TTYA 1R4NB 2MC4A 1APLC 1HW1A 4MQ9F 5LEJA 4P9FA 5H20A 3WTXC 2YX4A 4HF0A 5E3NA 5D5XB 4ENNA 4UUSA 2PJRB 4A0YA 2W7NA 2HDWA 1G59A 2JRTA 1R36A 2X85A 4DNCA 4QLCU 2R7VA 4HZFA 1HOMA 2KRHA 3SYTA 1ULYA 2DOFA 4NQWA 1SAXA 2HS5A 2Z2SB 3R0JA 1VZ0A 2DN0A 3GLLA 4A6DA 3I56I 1VI0A 3KEOA 3OYHA 2QSFX 1UELB 1JTYA 3NQOA 3QP6A 4DYRA 5HNHA 2KP6A 2LY2A 5H6RA 1ITYA 3L1PA 2E34A 2XSDC 3CJQB 3LSRA 2DQLA 1B59A 3ZRGA 2Z5UA 4M6XA 2XV4S 4OIQF 2L2OA 2LRDA 1ZG3A 4U7BA 2LDUA 1JHHA 2L7KA 1Z91A 3ERMA 2VOOA 2OF7A 3W6VA 1D1BA 4O6JA 1FP2A 2DJIA 3VOEA 1ZGWA 1XSDA 3PIPF 4P96A 1OMIA 2HQNA 2VBYA 3A02A 3JRFA 3CUOA 1LNWA 5D4SA 2DT5A 5LGUA 3VYRB 1S5LC 3BTJA 3HPGA 2R4GA 3D5SC 1WSUA 2R7UA 1WKMA 2OCCH 3TOAA 3HTUA 5DYMA 2OBPA 2DA7A 1H0MA 5BQTA 2ELJA 1KU3A 5HS9A 4YIFA 1VQ8I 2DA5A 3OOPA 5L3DA 4I0AA 2D1HA 3HOUJ 2V1NA 5F04A 1OR7C 4B47A 4LLGF 4A12A 3CC7I 3H5AA 3OYKA 2QA4I 1LDJA 2ZSIB 5TRDA 4BS9A 3KZIC 3CCMI 3VYUB 1DQUA 1TW3A 3ECHA 1ZLKA 2H8RA 2GQQA 4Q4ZF 2EILH 4L18B 5HS8A 5BMZA 3J81Z 1E17A 1QZYA 1MBJA 3F21A 4U0YA 2L9NA 1ZGJA 1R6RA 2ID6A 1P92A 2DK8A 2MABA 3HRTA 1TQIA 2BOLA 1BBYA 4A3MJ 4ON0A 1CF7B 2QSHX 2GA1A 5H6QA 2ZNZA 3DBHB 1OYYA 3RYRA 1AOYA 2ISZA 2RKHA 2DCEA 2M30A 4XRSA 5D8KB 3K4NA 1MBFA 2FQ4A 2FU4A 5J47A 1OISA 3P9KA 5HOOA 5TGTA 1TZLA 2DO7A 3M8EA 4U0WA 5LEKA 4HF1A 1HF0A 4Y52J 4NBQA 1OQYA 3I54A 1X3UA 1RETA 2L9VA 3CMMA 2V1UA 2XF6A 1WJAA 1IF1A 3OYMA 2JRMA 3VYTB 4RM3A 5B1BH 3N4MA 1W1WE 2EH3A 2QBYB 2WY8Q 2GOMA 3WTZA 2HKXA 5IY5H 2JK3A 4BE2A 2L4MA 4XONA 3UKGA 5DV5A 4FQGA
chains in the Genus database with same CATH topology
4G7ZF 2ZJ2A 4HX4A 3LWFA 1IN5A 1U5TB 4K2EA 3TDUC 5FO5A 4OINF 4YG2F 4AIKA 2O61A 5KK1A 3J80K 1MDMA 2RN7A 4R79A 3SXYA 4IRGA 3CUQC 5LGNA 3DV8A 2W84A 1SMTA 4HQEA 4AD9A 1W5TA 4N9HA 1G3SA 1XGMA 2XAQA 3MWMA 2M5WA 5K5QA 5FB2A 1I1GA 1O3TA 3B02A 1W7PD 2VONA 2RQPA 1EV7A 1W7PB 1YW8A 2STWA 5HS7A 3KP5A 2O6GE 2D2WA 3HTSB 1TNSA 2LF7A 1ZH5A 3GFJA 5LHGA 4A5NA 5AIQA 3GW2A 1RZ4A 2BBYA 1U2WA 2IPQX 2F5FA 1O7FA 2HOEA 2GIVA 4GYGA 3IL2A 4LD5A 4KA4A 2KIMA 2YR2A 2W25A 1UHWA 2EFOA 3JTGA 1ZHFA 5L3FA 4N0BA 5ILVA 1BC7C 1IN6A 3I5UA 3V7CA 3GEZA 4BQAA 2OQRA 3PFIA 4I09A 3SFZA 2D45A 1LEBA 4UXNA 3EQLF 4G8XA 4IRIA 1MZBA 3IRRA 4BXUA 4F7ZA 1T0FA 4YFXF 2W85A 1R00A 2ZO4A 2Q8KA 5J8FA 2A6EF 4Y15A 2UXXA 3MZYA 1U8RA 2LNBA 2QQ9A 2KKOA 3O6BB 2XKOA 4KFCA 1HBXG 4HF2A 5JI6A 1SFXA 3I59B 1Y0UA 2Z33A 5EEHA 4PCQA 4BHPA 2EFPA 3W6JB 1ZN2A 1J0RA 3O3KA 4Y17A 6PAXA 1U5TC 4ENMA 1CF7A 2VE9A 1D3YA 3FXUA 1IXRC 1HKSA 1MJ9A 3HUGA 2F5DA 1REPC 2F5CA 2CWEA 4WK8F 4A0XA 3IC7A 1SFEA 4BNCA 2BYVE 2IRFG 1S3JA 3S2WA 2A07F 1Z05A 1B4AA 1USTA 1S8NA 2PN6A 1XMAA 4RB1A 2FMLA 4EJVA 3ZQ7A 3WU0A 2KIFA 4IPAA 3GXOA 3F3XA 1OPCA 4HLYA 1R5GA 2PEXA 3E5QA 1ON1A 3K1NA 4I7HA 5FGMA 1Z6RA 1ZREA 1L0OC 3ULQB 3MEXA 5ILSA 1ZAOA 2A61A 2FBHA 4MEYF 3GYHX 2DK5A 1J5YA 1BIAA 3JAMK 2P7CB 4S05A 1W5SA 2EV0A 1RUOA 3ZMVA 1GHCA 3NRVA 4PZJA 3WTSC 1YIOA 2E1CA 1BI1A 4DQ2A 2FNAA 3KCCA 4M71A 1HSTA 3T1BA 5DCMB 1XDUA 4U0VA 4ZYEA 1BI3A 2NNNA 2EWNA 1MDMB 2FA5A 1PUEE 2HYGD 2P6TA 3ZMSA 1OYIA 2FE3A 1DPRA 3RYPA 3Q5FA 1BN5A 4ASNA 2COMA 1QZZA 2JPCA 4RS8A 1XCVA 3F6OA 1K78B 4L9JA 3FMSA 1FC3A 3EYIA 1T98A 2FQ3A 4OU0A 4UV8A 2P5VA 4TV7A 4M9SA 3E5UA 3WODF 3I71A 2RGVA 2RVCA 2IT0A 1XMKA 1DPUA 1LQ1A 4XRFA 3KZYA 1V3FA 1YO5C 2XVCA 1IXCA 1SD4A 2CQKA 2GAUA 2X4HA 1B9NA 3R61A 2PI0A 5L3CA 2VOPA 1XN7A 1UCRA 2EV6A 1FBQA 2Y75A 4JQFA 2CSOA 4CGZA 2CFXA 2EB7A 4EVIA 3FZVA 2RDPA 3KP6A 5E20A 2L02A 1KU2A 1EH6A 1U3EM 5FFZA 2DBBA 1FOKA 2LF8A 1YQAA 4HX8A 3MCZA 1XCBA 4ZH4F 1JXSA 4OMYA 3ZP5A 1J7KA 2YPRA 3GFLA 5CVIA 1F5TA 3RTRA 4LMYA 3ERED 2XAJA 3KEQA 3K2ZA 1J2XA 2W24A 2OZ6A 2A68F 3HRMA 3QU3A 1YW9A 5EEGA 2VXZA 2IW5A 5D6EA 1WRJA 4PDKA 1T2KA 4EJWA 3G73A 5K5OA 1S7OA 4U88A 1QO0D 3GLXA 2MH9A 1R58A 2L3DA 2BGCA 1JHFA 2E7XA 3TGNA 4A2UA 4ZYHA 3RIRA 4UV9A 4FX0A 2UWMA 4LLNA 3R60A 4RAYA 3CLOA 4WCGA 1RUNA 3K9TA 4RB0A 2PG4A 4UNOA 2P4WA 4EM2A 3T5XA 1TBXA 3T0YA 4LLLA 2OZUA 4EJOA 3D0SA 1P4WA 1YFHA 1BC8C 3LAJA 4M9ZA 3WGIA 2MH2A 2HFHA 1BJAA 3M8FA 1ONVA 3B73A 1YYVA 4WXHA 3IKVA 1IN4A 1P6RA 4NB5A 3RKWA 2VT3A 2OD5A 3C7JA 2CO5A 5BPDA 2A6HF 3BDDA 4FX4A 3KE2A 2Z99A 4WF2A 2FEZA 4A5MA 3JSOA 4RGXA 2ESHA 4Q48A 5HLGA 5AONA 2DPDA 1QBJA 5LLQA 3QU6A 2QYOA 4JK1X 5HVQC 5DUIA 2PJPA 3M9AA 3QAHA 1MJAA 5ERIA 2FBKA 5LBQA 3ZN1A 2MLKA 3CO6C 4KUMA 2FSWA 1HQCA 1USSA 1LB2A 4S04A 1O57A 4XSZF 2KRFA 3WE2A 4BHCA 2KIUA 3BP8A 3DF8A 3ECOA 4KMFA 3DP7A 1RNLA 4G6QA 1FSEA 2HGCA 2V6CA 1R22A 4L0ZB 4GGGA 2ZCWA 2D1VA 4IXAA 1S29A 4CZZA 3I0TA 1ZLJA 2GZWA 3DEUA 2ETHA 2ZMEA 2QVOA 3KP2A 5HDGA 1VTNC 3E3VA 2EV5A 1UHMA 3KP3A 4JBAA 1PP7U 1CGPA 1R1VA 3FMQA 4UVBA 1IN8A 2MD5A 1C0WA 4O3MA 1PP8F 3L9FA 1DUXC 2DQRA 3P7NA 3F8NA 1BI0A 1SD6A 1O7LA 5E8IA 2QM3A 4L5IA 4MQVA 2QWWA 4HA8A 3IWZA 3IWFA 4WXCA 4G7HF 4EGZA 2VC0A 2YSRA 2O8XA 5E17F 2MC3A 1R1UA 1P4XA 3BPVA 3JTHA 1WI9A 4MNUA 2B0LA 2K4BA 5J6XA 3GF2A 5DD8A 4PGGA 4ETSA 3AAFA 3IKTA 3WGHA 1TNTA 4L5JA 2GWRA 4M9XA 2R7DA 4ENKA 2NAZA 2XIGA 4EM1A 3BZ6A 2H09A 3SZPA 3FF5A 4AVPA 2WTEA 1NHAA 4ZZDA 4KIGA 1H9TA 3KETA 1JE8A 1V4RA 1ZRDA 3GFIA 1TW2A 4HOBA 4LGWA 4MTDA 1QPMA 3RKYA 2R7FA 4M74A 3I4PA 3HOTA 4ESBA 2KJCA 1KQ8A 2JT1A 4RB2C 3Q9VA 2HQRA 3WU1B 2OA4A 4NHJA 5K5RA 3M1EA 4BHBA 2L4AA 3DKWA 1XB4A 5L3GA 3V7RA 2XGXA 5D8LB 2X0LA 1K6OA 3TO9A 5KVRA 5LRRA 3WTTC 1FYKA 5LRSA 3IHUA 2ESNA 2XUBA 3RI4A 5HLHA 1SD7A 3JW4A 4A0ZA 1JGSA 1XDSA 3MQ0A 4A6EA 1G6NA 4G6DA 3HSEA 2RNJA 3F72A 2Y48A 3KFWX 4YFNF 3C3WA 3H3UA 1F4KA 3OV8A 4OMZA 2BE5F 5LHIA 4AWXB 4AIHA 2ZNYA 5FLXZ 1F9NA 5ICEA 5JFRA 1J59A 3WTYC 2MA3A 1Z1DA 1R7JA 1B1BA 2LKPA 1TQPA 1YTYA 3BJ6A 1O3SA 1HW2A 2FNPA 3T8TA 2BEOA 4I0BA 5IT3A 4E70A 2FBIA 2IA0A 3VODA 5J8CA 4RGRA 1HSJA 3P9IA 4N9IA 3FWEA 4GCVA 1BM9A 5DCFA 2G7HA 2VC1A 1IZ1A 2J5OA 5CVVA 3K1MA 2OU2A 2P6SA 4M6YA 1T39A 3GO5A 3MAJA 2EA4A 2HWVA 3HIFA 1MKMA 2E7WA 3IRQA 4MEXF 1SFUA 2K86A 2W57A 1FX7A 5JHUA 3QP5A 1T38A 3ABTA 1DDNA 1IW7F 2G7UA 4KDPA 2RV8A 4ENJA 2V1XA 4CDGA 4G9YA 3HRSA 3FXRA 3C1DA 1UFMA 4FHTA 4KN7X 2Z3YA 1D5VA 3ELKA 2VT2A 4EQQA 3ZPLA 1FY7A 5ICGA 3BY6A 1XSXA 3FM5A 4KIBA 4M72A 1FBSA 5AIPA 1BOAA 3RKXA 1EH7A 4GYIA 1FLIA 3HOSA 3V8JA 4XBFA 1QQIA 5JVTA 1IAWA 1KA8A 2Z9OA 4Q47A 2L54A 4XLPF 3E6CC 2VBXA 3Q9SA 5D6FA 1ZG1A 3VFZA 2AXLA 3EYYA 3V4GA 4RAZA 1ZARA 5L3BA 1O3QA 2QENA 4HX7A 2PBIA 2VE8A 2STTA 2HR3A 5BS6A 5TJJA 3DQVC 3F6VA 2M8EA 1FT9A 4YFKF 1KU9A 1L3LA 3DXJF 1XGSA 5DUKA 1WQ2A 3K0LA 4LFUA 2ZFWA 5FLXK 2H6BA 3E6BA 2C6YA 3QOPA 1ZGAA 2Y0MA 3TQNA 3LA7A 4O5VA 2QLZA 2EA2A 5CJ9A 3TO6A 3L7WA 4HAMA 3G3ZA 3PQKA 1LJ9A 3DPLC 2H27A 4BAYA 2YX7A 2XAFA 1U6GA 2ACJA 2XKPA 4IHSA 3F8MA 3GFMA 4OIOF 1KYWA 2EFQA 4CICA 3F8FA 2WWYA 2ZBKA 1XGOA 5D5VB 4H0EA 5HLIA 2V9VA 1ZRCA 4L9TA 3SHFA 3TO7A 4P9UA 4FT8A 1O3RA 3LQRA 3E6MA 1U5TA 5DD4A 1HW5A 4L9NA 4BH9A 3WTUC 3WTVC 1QGPA 3N97A 2HYFA 1IN7A 4MGRA 1IRFA 4OIPF 1I5ZA 5DDGA 3E5XA 1DP7P 4HYEA 3CTAA 3GVAA 2ADUA 5A2QK 1P2FA 2R3SA 3LFKA 4LB6B 3CO7C 3CUQB 2UXNA 1S6LA 5F1RA 3L00A 5E1XA 4P55A 3D5LA 3KP7A 3E6DA 2WV0A 3GX4X 4EM0B 4IRHA 4I98B 3EETA 5E18F 1D8JA 4MHGA 3BJOA 4HV5A 1G3YA 3CJNA 3GUDA 4UVAA 2VBZA 1YG2A 5IT9K 1GXPA 3C18A 2HTSA 3HYIA 2UZKA 3T8RA 4ZYDA 4KIFA 4R1HA 1IUYA 5BOXA 4ESJA 2H6CA 3NEUA 5IT9Z 2DFIA 1GVJA 1KQ0A 2V79A 2PFBA 3E97A 3TOBA 1S7AA 2ELHA 4XSXF 5ILUA 3WGGA 5ED4A 2EFNA 2FOKA 1A04A 2A5YB 3QPTA 2PLYA 1SMYF 2EJRA 4UHTA 3WG9A 1IXSB 3HSRA 2QUFA 4EGYA 5ICFA 2XRNA 4IHTA 4HBLA 4ZZLA 2P5KA 2QZ8A 4QWQA 5D5WB 2V1DA 3LAPA 2XROA 1SD5A 3WTWC 3ISPA 1FSHA 2O3FA 2P8TA 2F2EA 5FD6A 1I27A 4ZYGA 4XLNF 1PDNC 3TDZC 4KN4X 2FRHA 2JZYA 4BYYA 3QRFF 3ZMDA 4Y13A 5HDKA 1ZRFA 1B6AA 3BWGA 2XASA 5BPIA 1KGSA 3V7SA 3DFGA 1ON2A 3F8BA 3HSFA 1G3TA 2MLGA 1KU7A 1B9MA 1XSVA 1YLFA 2IA2A 3WE3A 3U2RA 1G4DA 1AWCA 2DW4A 1J75A 4KNYA 2O03A 1E2XA 2JTVA 3LQQA 3DPTA 2ZMEB 1GXQA 3ML6A 1Z7UA 1FPQA 1MJBA 2XHKA 3J81K 1K7AA 2DI3A 2OAZA 3JAMZ 1IRGA 2NRAC 4EJTA 1STZA 3RJPA 2EK5A 2IP2A 3M7GA 1ZG5A 3COAC 3JSPA 2H94A 4HQMA 1P4AA 1OR7A 3PQJA 1KQ9A 4LB5A 4EMSA 4GO1A 1HXDA 2AS5F 2GA2A 1ODDA 5K1YA 2K27A 4KYWA 2PMHA 4RB3C 2NNYA 1FWZA 4R8HA 2M1BA 4B09A 1FP1D 1J9IA 2DTRA 3H92A 1Q1HA 1F1ZA 1I6XA 5E1ZB 4G94A 2L01A 1T6SA 1WWXA 2M45A 4HW0A 4PGHA 4U7DA 1U78A 5DEQA 4HV6A 1HKTA 2FMYA 2DAOA 1EH8A 3FHZA 1FYMA 1Z9CA 1FYLA 3LA2A 3HRUA 2DU9A 3EUHA 3J80Z 2LSOA 5D5UB 3GZ5A 3KP4A 1RI7A 2A69F 1K78A 3I53A 2EFWA 2OQGA 1H9GA 2ZKZA 1LEAA 2G9WA 2P5LC 2ZXJA 2PMUA 1TQMA 4LG0A 2GXGA 2RC4A 3BJAA 4KT5C 4EV0A 4L0YB 2DPUA 3I64A 4D0PA 1KYZA 2VN2A 3CUQA 4G7OF 1W7PA 5FD5A 3L09A 4CO8A 4KMUX 3CDHA 4RGSA 3LSTA 4GXOA 1D8KA 1G3WA 1Z6TA 5L3EA 1YS6A 3VEPA 1K79A 2M87A 2K7LA 2MBFA 3BROA 3HHHA 3BPXA 3R6SA 1LDKB 4HDVA 1QNTA 3H3ZA 4HDUA 2YU3A 3MFKA 2JPBA 3KZZA 3F8CA 3GZ6A 3FM3A 3RPQA 2CYYA 2HTJA 5A2QZ 2ISYA 4IJAA 3KLNA 1FZPB 2XAGA 1W4MA 3K1PA 3P9CA 3ABUA 2P7VB 3TKYA 1MD0A 3U1DA 2WC2A 3I59A 5CYVA 3F23A 3RPUA 3BOQA 4HLXA 4EJUA 4I01A 4OIRF 4M73A 2FF4A 5HDNA 4Z2YA 2HZTA 3FMRA 2GXBA 3ROUA 1FNNA 2A3SA 3F22A 2CG4A 3ZN0A 3SZTA 2QBYA 1R1TA 3QPHA 4P5OA 2BV6A 2O0YA 3O2PE 1R23A 5DCMA 1LVAA 5CVUA 4ESFA 1R5HA 2K4JA 1FBUA 1ZYRF 5LHHA 5FFXA 3R4KA 3LA3A 4B8XA 4IF4A 2NS0A 5E1WA 3ZMZA 2F5EA 4WXDA 3HHGA 3V8LA 3ZMUA 3KLOA 4UUVA 3EDPA 3FXQA 2DLLA 4RGUA 3REOA 1LDDA 3L2CA 5F6FA 2NYXA 4I2OA 5CVRA 3I58A 1BI2A 2TDXA 2XAHA 4OOIA 4YIIA 3K69A 2HKOA 3FX3A 4L9VA 2PQ8A 5D4RA 1HKQA 4CHUA 3VB2A 1BIBA 2HEOA 2FXAA 3W6KB 4WWCA 1TLHB 4LK1F 3MZHA 2E1NA 2QQBA 5F64A 2VBWA 2HDCA 5JR3A 3ZMTA 2Q2EA 1OYWA 4AIJA 4KICA 4WX9A 3SQNA 1OKRA 4CXFA 2QQAA 2IA1A 1YW7A 2IVMA 4Q5SF 4LJZF 4LK0F 1MGTA 3GWZA 3RDIA 2CGPA 2Q0OA 2J5PA 1I1SA 5CLSA 3V8KA 4CYDA 1YS7A 3U9GA 1XD7A 2K02A 4UVCA 2VODA 2JSCA 3R0AA 4I02A 5E8GA 2CW0F 4IVNA 5ICCA 2KJBA 2IJLA 5LGTA 1UB9A 1RIOH 5CVJA 1XGNA 4MTEA 4LG0B 1TTYA 1HW1A 4MQ9F 5LEJA 4P9FA 5H20A 3WTXC 2YX4A 4HF0A 5D5XB 4ENNA 4A0YA 2JRTA 1R36A 4DNCA 4QLCU 4HZFA 1ULYA 4NQWA 1SAXA 2HS5A 3R0JA 4A6DA 3KEOA 3NQOA 3QP6A 5H6RA 2DQLA 1B59A 2Z5UA 4M6XA 2XV4S 4OIQF 1ZG3A 4U7BA 2LDUA 1JHHA 1Z91A 2VOOA 4O6JA 1FP2A 1XSDA 3VOEA 4P96A 1OMIA 2HQNA 2VBYA 3CUOA 1LNWA 5D4SA 2DT5A 5LGUA 1WSUA 1WKMA 3TOAA 3HTUA 5DYMA 2OBPA 1H0MA 5BQTA 1KU3A 5HS9A 4YIFA 3OOPA 5L3DA 4I0AA 2D1HA 4A12A 4LLGF 1LDJA 5TRDA 1TW3A 3ECHA 1ZLKA 2GQQA 4Q4ZF 4L18B 5HS8A 5BMZA 3J81Z 1E17A 1QZYA 3F21A 4U0YA 1ZGJA 1P92A 2DK8A 3HRTA 1TQIA 1BBYA 4ON0A 1CF7B 2GA1A 5H6QA 2ZNZA 3RYRA 1OYYA 1AOYA 2ISZA 2RKHA 2M30A 5D8KB 2FU4A 5HOOA 3P9KA 2DO7A 3M8EA 4U0WA 5LEKA 4HF1A 3I54A 1X3UA 2V1UA 1IF1A 3N4MA 2QBYB 3WTZA 2HKXA 2L4MA 5DV5A 3J7AO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7Z F;  2ZJ2 A;  4HX4 A;  3LWF A;  1IN5 A;  1U5T B;  4K2E A;  3TDU C;  5FO5 A;  4OIN F;  4YG2 F;  4AIK A;  2O61 A;  5KK1 A;  3J80 K;  1MDM A;  2RN7 A;  4R79 A;  3SXY A;  4IRG A;  3CUQ C;  5LGN A;  3DV8 A;  2W84 A;  1SMT A;  4HQE A;  4AD9 A;  1W5T A;  4N9H A;  1G3S A;  1XGM A;  2XAQ A;  3MWM A;  2M5W A;  5K5Q A;  5FB2 A;  1I1G A;  1O3T A;  3B02 A;  1W7P D;  2VON A;  2RQP A;  1EV7 A;  1W7P B;  1YW8 A;  2STW A;  5HS7 A;  3KP5 A;  2O6G E;  2D2W A;  3HTS B;  1TNS A;  2LF7 A;  1ZH5 A;  3GFJ A;  5LHG A;  4A5N A;  5AIQ A;  3GW2 A;  1RZ4 A;  2BBY A;  1U2W A;  2IPQ X;  2F5F A;  1O7F A;  2HOE A;  2GIV A;  4GYG A;  3IL2 A;  4LD5 A;  4KA4 A;  2KIM A;  2YR2 A;  2W25 A;  1UHW A;  2EFO A;  3JTG A;  1ZHF A;  5L3F A;  4N0B A;  5ILV A;  1BC7 C;  1IN6 A;  3I5U A;  3V7C A;  3GEZ A;  4BQA A;  2OQR A;  3PFI A;  4I09 A;  3SFZ A;  2D45 A;  1LEB A;  4UXN A;  3EQL F;  4G8X A;  4IRI A;  1MZB A;  3IRR A;  4BXU A;  4F7Z A;  1T0F A;  4YFX F;  2W85 A;  1R00 A;  2ZO4 A;  2Q8K A;  5J8F A;  2A6E F;  4Y15 A;  2UXX A;  3MZY A;  1U8R A;  2LNB A;  2QQ9 A;  2KKO A;  3O6B B;  2XKO A;  4KFC A;  1HBX G;  4HF2 A;  5JI6 A;  1SFX A;  3I59 B;  1Y0U A;  2Z33 A;  5EEH A;  4PCQ A;  4BHP A;  2EFP A;  3W6J B;  1ZN2 A;  1J0R A;  3O3K A;  4Y17 A;  6PAX A;  1U5T C;  4ENM A;  1CF7 A;  2VE9 A;  1D3Y A;  3FXU A;  1IXR C;  1HKS A;  1MJ9 A;  3HUG A;  2F5D A;  1REP C;  2F5C A;  2CWE A;  4WK8 F;  4A0X A;  3IC7 A;  1SFE A;  4BNC A;  2BYV E;  2IRF G;  1S3J A;  3S2W A;  2A07 F;  1Z05 A;  1B4A A;  1UST A;  1S8N A;  2PN6 A;  1XMA A;  4RB1 A;  2FML A;  4EJV A;  3ZQ7 A;  3WU0 A;  2KIF A;  4IPA A;  3GXO A;  3F3X A;  1OPC A;  4HLY A;  1R5G A;  2PEX A;  3E5Q A;  1ON1 A;  3K1N A;  4I7H A;  5FGM A;  1Z6R A;  1ZRE A;  1L0O C;  3ULQ B;  3MEX A;  5ILS A;  1ZAO A;  2A61 A;  2FBH A;  4MEY F;  3GYH X;  2DK5 A;  1J5Y A;  1BIA A;  3JAM K;  2P7C B;  4S05 A;  1W5S A;  2EV0 A;  1RUO A;  3ZMV A;  1GHC A;  3NRV A;  4PZJ A;  3WTS C;  1YIO A;  2E1C A;  1BI1 A;  4DQ2 A;  2FNA A;  3KCC A;  4M71 A;  1HST A;  3T1B A;  5DCM B;  1XDU A;  4U0V A;  4ZYE A;  1BI3 A;  2NNN A;  2EWN A;  1MDM B;  2FA5 A;  1PUE E;  2HYG D;  2P6T A;  3ZMS A;  1OYI A;  2FE3 A;  1DPR A;  3RYP A;  3Q5F A;  1BN5 A;  4ASN A;  2COM A;  1QZZ A;  2JPC A;  4RS8 A;  1XCV A;  3F6O A;  1K78 B;  4L9J A;  3FMS A;  1FC3 A;  3EYI A;  1T98 A;  2FQ3 A;  4OU0 A;  4UV8 A;  2P5V A;  4TV7 A;  4M9S A;  3E5U A;  3WOD F;  3I71 A;  2RGV A;  2RVC A;  2IT0 A;  1XMK A;  1DPU A;  1LQ1 A;  4XRF A;  3KZY A;  1V3F A;  1YO5 C;  2XVC A;  1IXC A;  1SD4 A;  2CQK A;  2GAU A;  2X4H A;  1B9N A;  3R61 A;  2PI0 A;  5L3C A;  2VOP A;  1XN7 A;  1UCR A;  2EV6 A;  1FBQ A;  2Y75 A;  4JQF A;  2CSO A;  4CGZ A;  2CFX A;  2EB7 A;  4EVI A;  3FZV A;  2RDP A;  3KP6 A;  5E20 A;  2L02 A;  1KU2 A;  1EH6 A;  1U3E M;  5FFZ A;  2DBB A;  1FOK A;  2LF8 A;  1YQA A;  4HX8 A;  3MCZ A;  1XCB A;  4ZH4 F;  1JXS A;  4OMY A;  3ZP5 A;  1J7K A;  2YPR A;  3GFL A;  5CVI A;  1F5T A;  3RTR A;  4LMY A;  3ERE D;  2XAJ A;  3KEQ A;  3K2Z A;  1J2X A;  2W24 A;  2OZ6 A;  2A68 F;  3HRM A;  3QU3 A;  1YW9 A;  5EEG A;  2VXZ A;  2IW5 A;  5D6E A;  1WRJ A;  4PDK A;  1T2K A;  4EJW A;  3G73 A;  5K5O A;  1S7O A;  4U88 A;  1QO0 D;  3GLX A;  2MH9 A;  1R58 A;  2L3D A;  2BGC A;  1JHF A;  2E7X A;  3TGN A;  4A2U A;  4ZYH A;  3RIR A;  4UV9 A;  4FX0 A;  2UWM A;  4LLN A;  3R60 A;  4RAY A;  3CLO A;  4WCG A;  1RUN A;  3K9T A;  4RB0 A;  2PG4 A;  4UNO A;  2P4W A;  4EM2 A;  3T5X A;  1TBX A;  3T0Y A;  4LLL A;  2OZU A;  4EJO A;  3D0S A;  1P4W A;  1YFH A;  1BC8 C;  3LAJ A;  4M9Z A;  3WGI A;  2MH2 A;  2HFH A;  1BJA A;  3M8F A;  1ONV A;  3B73 A;  1YYV A;  4WXH A;  3IKV A;  1IN4 A;  1P6R A;  4NB5 A;  3RKW A;  2VT3 A;  2OD5 A;  3C7J A;  2CO5 A;  5BPD A;  2A6H F;  3BDD A;  4FX4 A;  3KE2 A;  2Z99 A;  4WF2 A;  2FEZ A;  4A5M A;  3JSO A;  4RGX A;  2ESH A;  4Q48 A;  5HLG A;  5AON A;  2DPD A;  1QBJ A;  5LLQ A;  3QU6 A;  2QYO A;  4JK1 X;  5HVQ C;  5DUI A;  2PJP A;  3M9A A;  3QAH A;  1MJA A;  5ERI A;  2FBK A;  5LBQ A;  3ZN1 A;  2MLK A;  3CO6 C;  4KUM A;  2FSW A;  1HQC A;  1USS A;  1LB2 A;  4S04 A;  1O57 A;  4XSZ F;  2KRF A;  3WE2 A;  4BHC A;  2KIU A;  3BP8 A;  3DF8 A;  3ECO A;  4KMF A;  3DP7 A;  1RNL A;  4G6Q A;  1FSE A;  2HGC A;  2V6C A;  1R22 A;  4L0Z B;  4GGG A;  2ZCW A;  2D1V A;  4IXA A;  1S29 A;  4CZZ A;  3I0T A;  1ZLJ A;  2GZW A;  3DEU A;  2ETH A;  2ZME A;  2QVO A;  3KP2 A;  5HDG A;  1VTN C;  3E3V A;  2EV5 A;  1UHM A;  3KP3 A;  4JBA A;  1PP7 U;  1CGP A;  1R1V A;  3FMQ A;  4UVB A;  1IN8 A;  2MD5 A;  1C0W A;  4O3M A;  1PP8 F;  3L9F A;  1DUX C;  2DQR A;  3P7N A;  3F8N A;  1BI0 A;  1SD6 A;  1O7L A;  5E8I A;  2QM3 A;  4L5I A;  4MQV A;  2QWW A;  4HA8 A;  3IWZ A;  3IWF A;  4WXC A;  4G7H F;  4EGZ A;  2VC0 A;  2YSR A;  2O8X A;  5E17 F;  2MC3 A;  1R1U A;  1P4X A;  3BPV A;  3JTH A;  1WI9 A;  4MNU A;  2B0L A;  2K4B A;  5J6X A;  3GF2 A;  5DD8 A;  4PGG A;  4ETS A;  3AAF A;  3IKT A;  3WGH A;  1TNT A;  4L5J A;  2GWR A;  4M9X A;  2R7D A;  4ENK A;  2NAZ A;  2XIG A;  4EM1 A;  3BZ6 A;  2H09 A;  3SZP A;  3FF5 A;  4AVP A;  2WTE A;  1NHA A;  4ZZD A;  4KIG A;  1H9T A;  3KET A;  1JE8 A;  1V4R A;  1ZRD A;  3GFI A;  1TW2 A;  4HOB A;  4LGW A;  4MTD A;  1QPM A;  3RKY A;  2R7F A;  4M74 A;  3I4P A;  3HOT A;  4ESB A;  2KJC A;  1KQ8 A;  2JT1 A;  4RB2 C;  3Q9V A;  2HQR A;  3WU1 B;  2OA4 A;  4NHJ A;  5K5R A;  3M1E A;  4BHB A;  2L4A A;  3DKW A;  1XB4 A;  5L3G A;  3V7R A;  2XGX A;  5D8L B;  2X0L A;  1K6O A;  3TO9 A;  5KVR A;  5LRR A;  3WTT C;  1FYK A;  5LRS A;  3IHU A;  2ESN A;  2XUB A;  3RI4 A;  5HLH A;  1SD7 A;  3JW4 A;  4A0Z A;  1JGS A;  1XDS A;  3MQ0 A;  4A6E A;  1G6N A;  4G6D A;  3HSE A;  2RNJ A;  3F72 A;  2Y48 A;  3KFW X;  4YFN F;  3C3W A;  3H3U A;  1F4K A;  3OV8 A;  4OMZ A;  2BE5 F;  5LHI A;  4AWX B;  4AIH A;  2ZNY A;  5FLX Z;  1F9N A;  5ICE A;  5JFR A;  1J59 A;  3WTY C;  2MA3 A;  1Z1D A;  1R7J A;  1B1B A;  2LKP A;  1TQP A;  1YTY A;  3BJ6 A;  1O3S A;  1HW2 A;  2FNP A;  3T8T A;  2BEO A;  4I0B A;  5IT3 A;  4E70 A;  2FBI A;  2IA0 A;  3VOD A;  5J8C A;  4RGR A;  1HSJ A;  3P9I A;  4N9I A;  3FWE A;  4GCV A;  1BM9 A;  5DCF A;  2G7H A;  2VC1 A;  1IZ1 A;  2J5O A;  5CVV A;  3K1M A;  2OU2 A;  2P6S A;  4M6Y A;  1T39 A;  3GO5 A;  3MAJ A;  2EA4 A;  2HWV A;  3HIF A;  1MKM A;  2E7W A;  3IRQ A;  4MEX F;  1SFU A;  2K86 A;  2W57 A;  1FX7 A;  5JHU A;  3QP5 A;  1T38 A;  3ABT A;  1DDN A;  1IW7 F;  2G7U A;  4KDP A;  2RV8 A;  4ENJ A;  2V1X A;  4CDG A;  4G9Y A;  3HRS A;  3FXR A;  3C1D A;  1UFM A;  4FHT A;  4KN7 X;  2Z3Y A;  1D5V A;  3ELK A;  2VT2 A;  4EQQ A;  3ZPL A;  1FY7 A;  5ICG A;  3BY6 A;  1XSX A;  3FM5 A;  4KIB A;  4M72 A;  1FBS A;  5AIP A;  1BOA A;  3RKX A;  1EH7 A;  4GYI A;  1FLI A;  3HOS A;  3V8J A;  4XBF A;  1QQI A;  5JVT A;  1IAW A;  1KA8 A;  2Z9O A;  4Q47 A;  2L54 A;  4XLP F;  3E6C C;  2VBX A;  3Q9S A;  5D6F A;  1ZG1 A;  3VFZ A;  2AXL A;  3EYY A;  3V4G A;  4RAZ A;  1ZAR A;  5L3B A;  1O3Q A;  2QEN A;  4HX7 A;  2PBI A;  2VE8 A;  2STT A;  2HR3 A;  5BS6 A;  5TJJ A;  3DQV C;  3F6V A;  2M8E A;  1FT9 A;  4YFK F;  1KU9 A;  1L3L A;  3DXJ F;  1XGS A;  5DUK A;  1WQ2 A;  3K0L A;  4LFU A;  2ZFW A;  5FLX K;  2H6B A;  3E6B A;  2C6Y A;  3QOP A;  1ZGA A;  2Y0M A;  3TQN A;  3LA7 A;  4O5V A;  2QLZ A;  2EA2 A;  5CJ9 A;  3TO6 A;  3L7W A;  4HAM A;  3G3Z A;  3PQK A;  1LJ9 A;  3DPL C;  2H27 A;  4BAY A;  2YX7 A;  2XAF A;  1U6G A;  2ACJ A;  2XKP A;  4IHS A;  3F8M A;  3GFM A;  4OIO F;  1KYW A;  2EFQ A;  4CIC A;  3F8F A;  2WWY A;  2ZBK A;  1XGO A;  5D5V B;  4H0E A;  5HLI A;  2V9V A;  1ZRC A;  4L9T A;  3SHF A;  3TO7 A;  4P9U A;  4FT8 A;  1O3R A;  3LQR A;  3E6M A;  1U5T A;  5DD4 A;  1HW5 A;  4L9N A;  4BH9 A;  3WTU C;  3WTV C;  1QGP A;  3N97 A;  2HYF A;  1IN7 A;  4MGR A;  1IRF A;  4OIP F;  1I5Z A;  5DDG A;  3E5X A;  1DP7 P;  4HYE A;  3CTA A;  3GVA A;  2ADU A;  5A2Q K;  1P2F A;  2R3S A;  3LFK A;  4LB6 B;  3CO7 C;  3CUQ B;  2UXN A;  1S6L A;  5F1R A;  3L00 A;  5E1X A;  4P55 A;  3D5L A;  3KP7 A;  3E6D A;  2WV0 A;  3GX4 X;  4EM0 B;  4IRH A;  4I98 B;  3EET A;  5E18 F;  1D8J A;  4MHG A;  3BJO A;  4HV5 A;  1G3Y A;  3CJN A;  3GUD A;  4UVA A;  2VBZ A;  1YG2 A;  5IT9 K;  1GXP A;  3C18 A;  2HTS A;  3HYI A;  2UZK A;  3T8R A;  4ZYD A;  4KIF A;  4R1H A;  1IUY A;  5BOX A;  4ESJ A;  2H6C A;  3NEU A;  5IT9 Z;  2DFI A;  1GVJ A;  1KQ0 A;  2V79 A;  2PFB A;  3E97 A;  3TOB A;  1S7A A;  2ELH A;  4XSX F;  5ILU A;  3WGG A;  5ED4 A;  2EFN A;  2FOK A;  1A04 A;  2A5Y B;  3QPT A;  2PLY A;  1SMY F;  2EJR A;  4UHT A;  3WG9 A;  1IXS B;  3HSR A;  2QUF A;  4EGY A;  5ICF A;  2XRN A;  4IHT A;  4HBL A;  4ZZL A;  2P5K A;  2QZ8 A;  4QWQ A;  5D5W B;  2V1D A;  3LAP A;  2XRO A;  1SD5 A;  3WTW C;  3ISP A;  1FSH A;  2O3F A;  2P8T A;  2F2E A;  5FD6 A;  1I27 A;  4ZYG A;  4XLN F;  1PDN C;  3TDZ C;  4KN4 X;  2FRH A;  2JZY A;  4BYY A;  3QRF F;  3ZMD A;  4Y13 A;  5HDK A;  1ZRF A;  1B6A A;  3BWG A;  2XAS A;  5BPI A;  1KGS A;  3V7S A;  3DFG A;  1ON2 A;  3F8B A;  3HSF A;  1G3T A;  2MLG A;  1KU7 A;  1B9M A;  1XSV A;  1YLF A;  2IA2 A;  3WE3 A;  3U2R A;  1G4D A;  1AWC A;  2DW4 A;  1J75 A;  4KNY A;  2O03 A;  1E2X A;  2JTV A;  3LQQ A;  3DPT A;  2ZME B;  1GXQ A;  3ML6 A;  1Z7U A;  1FPQ A;  1MJB A;  2XHK A;  3J81 K;  1K7A A;  2DI3 A;  2OAZ A;  3JAM Z;  1IRG A;  2NRA C;  4EJT A;  1STZ A;  3RJP A;  2EK5 A;  2IP2 A;  3M7G A;  1ZG5 A;  3COA C;  3JSP A;  2H94 A;  4HQM A;  1P4A A;  1OR7 A;  3PQJ A;  1KQ9 A;  4LB5 A;  4EMS A;  4GO1 A;  1HXD A;  2AS5 F;  2GA2 A;  1ODD A;  5K1Y A;  2K27 A;  4KYW A;  2PMH A;  4RB3 C;  2NNY A;  1FWZ A;  4R8H A;  2M1B A;  4B09 A;  1FP1 D;  1J9I A;  2DTR A;  3H92 A;  1Q1H A;  1F1Z A;  1I6X A;  5E1Z B;  4G94 A;  2L01 A;  1T6S A;  1WWX A;  2M45 A;  4HW0 A;  4PGH A;  4U7D A;  1U78 A;  5DEQ A;  4HV6 A;  1HKT A;  2FMY A;  2DAO A;  1EH8 A;  3FHZ A;  1FYM A;  1Z9C A;  1FYL A;  3LA2 A;  3HRU A;  2DU9 A;  3EUH A;  3J80 Z;  2LSO A;  5D5U B;  3GZ5 A;  3KP4 A;  1RI7 A;  2A69 F;  1K78 A;  3I53 A;  2EFW A;  2OQG A;  1H9G A;  2ZKZ A;  1LEA A;  2G9W A;  2P5L C;  2ZXJ A;  2PMU A;  1TQM A;  4LG0 A;  2GXG A;  2RC4 A;  3BJA A;  4KT5 C;  4EV0 A;  4L0Y B;  2DPU A;  3I64 A;  4D0P A;  1KYZ A;  2VN2 A;  3CUQ A;  4G7O F;  1W7P A;  5FD5 A;  3L09 A;  4CO8 A;  4KMU X;  3CDH A;  4RGS A;  3LST A;  4GXO A;  1D8K A;  1G3W A;  1Z6T A;  5L3E A;  1YS6 A;  3VEP A;  1K79 A;  2M87 A;  2K7L A;  2MBF A;  3BRO A;  3HHH A;  3BPX A;  3R6S A;  1LDK B;  4HDV A;  1QNT A;  3H3Z A;  4HDU A;  2YU3 A;  3MFK A;  2JPB A;  3KZZ A;  3F8C A;  3GZ6 A;  3FM3 A;  3RPQ A;  2CYY A;  2HTJ A;  5A2Q Z;  2ISY A;  4IJA A;  3KLN A;  1FZP B;  2XAG A;  1W4M A;  3K1P A;  3P9C A;  3ABU A;  2P7V B;  3TKY A;  1MD0 A;  3U1D A;  2WC2 A;  3I59 A;  5CYV A;  3F23 A;  3RPU A;  3BOQ A;  4HLX A;  4EJU A;  4I01 A;  4OIR F;  4M73 A;  2FF4 A;  5HDN A;  4Z2Y A;  2HZT A;  3FMR A;  2GXB A;  3ROU A;  1FNN A;  2A3S A;  3F22 A;  2CG4 A;  3ZN0 A;  3SZT A;  2QBY A;  1R1T A;  3QPH A;  4P5O A;  2BV6 A;  2O0Y A;  3O2P E;  1R23 A;  5DCM A;  1LVA A;  5CVU A;  4ESF A;  1R5H A;  2K4J A;  1FBU A;  1ZYR F;  5LHH A;  5FFX A;  3R4K A;  3LA3 A;  4B8X A;  4IF4 A;  2NS0 A;  5E1W A;  3ZMZ A;  2F5E A;  4WXD A;  3HHG A;  3V8L A;  3ZMU A;  3KLO A;  4UUV A;  3EDP A;  3FXQ A;  2DLL A;  4RGU A;  3REO A;  1LDD A;  3L2C A;  5F6F A;  2NYX A;  4I2O A;  5CVR A;  3I58 A;  1BI2 A;  2TDX A;  2XAH A;  4OOI A;  4YII A;  3K69 A;  2HKO A;  3FX3 A;  4L9V A;  2PQ8 A;  5D4R A;  1HKQ A;  4CHU A;  3VB2 A;  1BIB A;  2HEO A;  2FXA A;  3W6K B;  4WWC A;  1TLH B;  4LK1 F;  3MZH A;  2E1N A;  2QQB A;  5F64 A;  2VBW A;  2HDC A;  5JR3 A;  3ZMT A;  2Q2E A;  1OYW A;  4AIJ A;  4KIC A;  4WX9 A;  3SQN A;  1OKR A;  4CXF A;  2QQA A;  2IA1 A;  1YW7 A;  2IVM A;  4Q5S F;  4LJZ F;  4LK0 F;  1MGT A;  3GWZ A;  3RDI A;  2CGP A;  2Q0O A;  2J5P A;  1I1S A;  5CLS A;  3V8K A;  4CYD A;  1YS7 A;  3U9G A;  1XD7 A;  2K02 A;  4UVC A;  2VOD A;  2JSC A;  3R0A A;  4I02 A;  5E8G A;  2CW0 F;  4IVN A;  5ICC A;  2KJB A;  2IJL A;  5LGT A;  1UB9 A;  1RIO H;  5CVJ A;  1XGN A;  4MTE A;  4LG0 B;  1TTY A;  1HW1 A;  4MQ9 F;  5LEJ A;  4P9F A;  5H20 A;  3WTX C;  2YX4 A;  4HF0 A;  5D5X B;  4ENN A;  4A0Y A;  2JRT A;  1R36 A;  4DNC A;  4QLC U;  4HZF A;  1ULY A;  4NQW A;  1SAX A;  2HS5 A;  3R0J A;  4A6D A;  3KEO A;  3NQO A;  3QP6 A;  5H6R A;  2DQL A;  1B59 A;  2Z5U A;  4M6X A;  2XV4 S;  4OIQ F;  1ZG3 A;  4U7B A;  2LDU A;  1JHH A;  1Z91 A;  2VOO A;  4O6J A;  1FP2 A;  1XSD A;  3VOE A;  4P96 A;  1OMI A;  2HQN A;  2VBY A;  3CUO A;  1LNW A;  5D4S A;  2DT5 A;  5LGU A;  1WSU A;  1WKM A;  3TOA A;  3HTU A;  5DYM A;  2OBP A;  1H0M A;  5BQT A;  1KU3 A;  5HS9 A;  4YIF A;  3OOP A;  5L3D A;  4I0A A;  2D1H A;  4A12 A;  4LLG F;  1LDJ A;  5TRD A;  1TW3 A;  3ECH A;  1ZLK A;  2GQQ A;  4Q4Z F;  4L18 B;  5HS8 A;  5BMZ A;  3J81 Z;  1E17 A;  1QZY A;  3F21 A;  4U0Y A;  1ZGJ A;  1P92 A;  2DK8 A;  3HRT A;  1TQI A;  1BBY A;  4ON0 A;  1CF7 B;  2GA1 A;  5H6Q A;  2ZNZ A;  3RYR A;  1OYY A;  1AOY A;  2ISZ A;  2RKH A;  2M30 A;  5D8K B;  2FU4 A;  5HOO A;  3P9K A;  2DO7 A;  3M8E A;  4U0W A;  5LEK A;  4HF1 A;  3I54 A;  1X3U A;  2V1U A;  1IF1 A;  3N4M A;  2QBY B;  3WTZ A;  2HKX A;  2L4M A;  5DV5 A;  3J7A O; 
#chains in the Genus database with same CATH topology
 4G7Z F;  2ZJ2 A;  4BDZ A;  3LSM A;  4HX4 A;  3LWF A;  1BL0 A;  1IN5 A;  1U5T B;  2DMN A;  4K2E A;  2LK2 A;  4UB8 C;  2E60 A;  4A3F J;  4NDL A;  4PJL A;  3TDU C;  1K83 J;  5FO5 A;  4OIN F;  4YG2 F;  4AIK A;  2O61 A;  3WHB A;  3MN2 A;  5KK1 A;  3J80 K;  1YHQ I;  1MDM A;  2B63 J;  2RN7 A;  2LH9 A;  5FKO A;  4R79 A;  3SXY A;  4IRG A;  4J19 A;  2VQL A;  3CUQ C;  4RMN A;  5LGN A;  4B44 A;  3DV8 A;  3IUO A;  3KYC B;  3CME I;  1SAN A;  2W84 A;  1I3A A;  3QPS A;  1SMT A;  4HQE A;  3OMY A;  4AD9 A;  1W5T A;  2IXS A;  2X6Y A;  3SFI A;  1BJZ A;  4V2F A;  1SC7 A;  1E3H A;  4N9H A;  1G3S A;  1XGM A;  2XAQ A;  3MWM A;  1DP3 A;  2M5W A;  2CUJ A;  4ZDP A;  5K5Q A;  5B1A H;  5FB2 A;  2MG4 A;  1A31 A;  3MZ8 A;  3GBG A;  1I1G A;  1O3T A;  2DA4 A;  3B02 A;  4IZZ A;  3TED A;  1W7P D;  2VON A;  2RQP A;  3HOX J;  3DEW A;  1EV7 A;  1W7P B;  1YW8 A;  2RNG A;  2STW A;  3JRA A;  5HS7 A;  4IHW A;  3KP5 A;  5GPA A;  1WJF A;  2DMP A;  2R7Q A;  2O6G E;  3JRE A;  4OAY A;  4A69 C;  4A3D J;  2D2W A;  3HTS B;  1TNS A;  2LF7 A;  3OIP A;  2VAS A;  4DIQ A;  1Q1V A;  1H88 C;  1XC5 A;  1ZH5 A;  3GFJ A;  2VKE A;  5LHG A;  2QKL B;  4A3J J;  4A5N A;  5AIQ A;  4HNV A;  3GW2 A;  1GDT A;  1VF9 A;  1RZ4 A;  2IEK A;  1Z77 A;  2BBY A;  1U2W A;  2IPQ X;  2F5F A;  2NXN B;  3SDG A;  4G6T B;  1O7F A;  2HOE A;  1MND A;  3QOD A;  2X6X A;  2GIV A;  3KYD B;  4NQW B;  4GYG A;  3IL2 A;  1GV2 A;  4LD5 A;  4KA4 A;  3MKW B;  2KIM A;  2YR2 A;  2W25 A;  3JRB A;  1UHW A;  2EFO A;  3JTG A;  3H0G J;  1ZHF A;  4D7M A;  5L3F A;  4N0B A;  1IRX A;  5ILV A;  1MMD A;  1BC7 C;  4E6K G;  5J1U A;  1IN6 A;  3I5U A;  2L7M P;  5FKN A;  3V7C A;  3GEZ A;  3OS0 A;  4HG2 A;  3IP4 B;  2X1C A;  4BQA A;  2OQR A;  3L2R A;  3PFI A;  1X2M A;  2E1M C;  4QTR A;  2KPM A;  4I09 A;  3SFZ A;  2D45 A;  4FE4 A;  1LEB A;  4UXN A;  4E4H A;  2M7B A;  5IPA A;  3EQL F;  2K3F A;  2RQQ A;  4G8X A;  1VQK I;  4I6Z A;  5M3M J;  2PJR A;  4IRI A;  2DA3 A;  1MZB A;  3IRR A;  1V55 H;  3H3V K;  4B48 A;  4BXU A;  4F7Z A;  5H2F C;  1T0F A;  4YFX F;  2TRT A;  2W85 A;  1D0Z A;  1PJR A;  1R00 A;  4C2U A;  5F0F A;  2ZO4 A;  2Q8K A;  5J8F A;  1MMS A;  2A6E F;  2KIQ A;  2Y31 A;  4KIT B;  4Y15 A;  5J40 A;  4DGW B;  2HPM A;  2UXX A;  3DWL E;  2XSJ C;  3MZY A;  1U8R A;  2LNB A;  3RKQ A;  2QQ9 A;  2KKO A;  2W48 A;  1GUU A;  3O6B B;  3BT9 A;  2I10 A;  1MBE A;  2XKO A;  2MW8 A;  4KFC A;  2O9L A;  2EZH A;  1HBX G;  4HF2 A;  3FK6 A;  1DU0 A;  5JI6 A;  1SFX A;  5C44 J;  3I59 B;  5FRO A;  4PUS A;  3FXL A;  1Y0U A;  2Z33 A;  1R9T J;  5EEH A;  1X1D A;  2CQN A;  2DMT A;  1AU7 A;  3IH3 A;  4PCQ A;  4BHP A;  2EFP A;  2F4I A;  3W6J B;  1ZN2 A;  1J0R A;  3ZQI A;  1JUM A;  2WA0 A;  3O3K A;  5FRM A;  4Y17 A;  6PAX A;  1U5T C;  4BUP A;  4ENM A;  1CF7 A;  2VE9 A;  3HOW J;  1BA5 A;  1D0Y A;  1D3Y A;  3FXU A;  1IXR C;  1HKS A;  3RQ4 A;  3WU2 C;  4DW6 A;  3PL8 A;  1AKH B;  1MJ9 A;  3HUG A;  3FXM A;  2F5D A;  1REP C;  2F5C A;  2KT0 A;  3NWT A;  3DU5 A;  2CWE A;  4WK8 F;  2VB6 A;  1QA6 A;  4H4K C;  2VPL A;  4A0X A;  4ZYA A;  3IC7 A;  2BVM A;  2ECB A;  1SFE A;  4BNC A;  2M4K A;  2BYV E;  5EEA A;  4J01 A;  4EAT A;  2IRF G;  1S3J A;  3S2W A;  2A07 F;  1U9O A;  3KEY A;  2HOT A;  4A3I J;  1RR7 A;  3I3L A;  2R5Z B;  3G71 I;  1Z05 A;  1B4A A;  2VKV A;  1UST A;  2ZME C;  2VIX A;  1S8N A;  1SFK A;  1EA3 A;  2K9M A;  2H1K A;  1X1C A;  2PN6 A;  1UJ8 A;  1XMA A;  1YX5 A;  1B72 B;  4RB1 A;  2FML A;  4EJV A;  2LKX A;  2VKH A;  3BC8 A;  3HKZ N;  3ZQ7 A;  3WU0 A;  2KIF A;  4IPA A;  4DJA A;  3GXO A;  2R93 J;  3CDI A;  2WAQ N;  3F3X A;  1OPC A;  4HLY A;  5B66 C;  1TL8 A;  3TP3 A;  2MD0 A;  5JLW A;  1R5G A;  4FAS D;  4UUS B;  2PEX A;  3E5Q A;  1ON1 A;  3K1N A;  4B3A A;  2QKM B;  3BR2 A;  4I7H A;  5FGM A;  3BTI A;  1FTT A;  4XKW A;  1Z6R A;  1ZRE A;  1L0O C;  3ULQ B;  3K70 D;  3MEX A;  5ILS A;  1ZAO A;  2A61 A;  2DA1 A;  3QYE A;  5GAH J;  5E3M A;  4C9Y A;  2ME0 A;  2QEX I;  2FBH A;  2M9H A;  1ZK8 A;  4MEY F;  3GYH X;  1SVM A;  2DK5 A;  3EUA A;  3BR6 A;  1J5Y A;  1U0J A;  1BIA A;  3AG2 H;  1Y8Q B;  3JAM K;  2P7C B;  4S05 A;  1LKX A;  1W5S A;  3K7A J;  2AO9 A;  1RPW A;  2EV0 A;  1RUO A;  2OC6 A;  3U1K A;  3ZMV A;  3CCL I;  2WBM A;  4FCY A;  4V19 K;  1GHC A;  3NRV A;  4PZJ A;  3WTS C;  1YIO A;  2E1C A;  1BI1 A;  4AYB N;  3LOC A;  5EGO A;  3G1L A;  2M0C A;  2RAE A;  2FNA A;  3KCC A;  4XLH A;  3OIQ A;  4DQ2 A;  5KAF C;  4M71 A;  4HST A;  3BG9 A;  3GTG J;  4A3L J;  5EGO B;  1HST A;  3S32 A;  2E71 A;  3T1B A;  5DCM B;  1XDU A;  2LP0 A;  4U0V A;  4ZYE A;  1BI3 A;  2PMZ N;  3WHC A;  2R92 J;  2NNN A;  2EWN A;  2YUS A;  1MDM B;  2IS6 A;  2FA5 A;  2XB5 A;  1PUE E;  5M5Y J;  2HYG D;  2P6T A;  3KX2 A;  3ZMS A;  1OYI A;  2QCO A;  2FE3 A;  3RZD J;  1DPR A;  3RYP A;  3Q5F A;  4BKX A;  1BN5 A;  1UMQ A;  2CS3 A;  2COM A;  4ASN A;  2GM4 A;  1R71 A;  3LFU A;  3OR2 C;  1QZZ A;  2JPC A;  3LSG A;  3AL0 B;  1D1C A;  4RDU A;  4RS8 A;  1XCV A;  3F6O A;  1K78 B;  5FKL A;  4L9J A;  3FMS A;  1FC3 A;  2ME6 A;  3EYI A;  1FEX A;  4LIU A;  1T98 A;  3DLA A;  2FQ3 A;  4OU0 A;  2P5V A;  3DBR B;  4UV8 A;  1VQ9 I;  4TV7 A;  4M9S A;  2F4M B;  3E5U A;  4C2M J;  2A05 A;  3WOD F;  1IO2 A;  4Y7N J;  1VQO I;  2FD5 A;  2K9N A;  3I71 A;  2RGV A;  3HZJ A;  2RVC A;  5DM7 F;  1XMK A;  2IT0 A;  1DPU A;  4DOZ A;  1LQ1 A;  4XRF A;  1MSF C;  5FKM A;  3KZY A;  1HDP A;  2O7O A;  1V3F A;  3H9Q A;  1YO5 C;  3B6A A;  2XVC A;  1IXC A;  1SD4 A;  2CQK A;  2GAU A;  2X4H A;  1B9N A;  3R61 A;  2L9R A;  3ABL H;  3SEZ A;  1LFB A;  3H36 A;  2PI0 A;  3ABK H;  4ZDL A;  3MMY B;  3W3C A;  2HZD A;  5L3C A;  2VOP A;  1XN7 A;  2X1D A;  1UCR A;  2L9S A;  2EV6 A;  4BQN A;  3HUG B;  1FBQ A;  5C3E J;  2JA7 J;  2Y75 A;  2CQX A;  4JQF A;  2CSO A;  2DT6 A;  4CGZ A;  2CFX A;  3Q3S A;  2EB7 A;  4EVI A;  3FZV A;  1ZEL A;  4HNT A;  4FIS A;  4A3B J;  2RDP A;  3KP6 A;  4M3G A;  5E20 A;  2L02 A;  1KU2 A;  3ABM H;  3CF5 F;  1EH6 A;  3GTP J;  1U3E M;  1K6Y A;  1JJ8 C;  4I99 C;  5FFZ A;  2DBB A;  3B6C A;  2OTJ I;  5FLV A;  5JVG F;  1FOK A;  2B7E A;  2LF8 A;  1YQA A;  3H1C A;  4HX8 A;  3MCZ A;  1XCB A;  2CFO A;  4GRI A;  1XS9 A;  4ZH4 F;  3S2D J;  1ERD A;  1VQ4 I;  1JXS A;  4OMY A;  2Y0S A;  3ZP5 A;  1IJW C;  1J7K A;  2H1L A;  4XOR A;  2YPR A;  3GFL A;  3TL4 X;  4XKB A;  2Y69 H;  3A4C A;  5CVI A;  1F5T A;  3RTR A;  4LMY A;  3ERE D;  2XAJ A;  3KEQ A;  3K2Z A;  1J2X A;  2KZV A;  2W24 A;  3TBI A;  2OZ6 A;  2A68 F;  3HRM A;  3CCJ I;  3HPH A;  3QU3 A;  1YW9 A;  4IOA F;  3ZR8 X;  4E7Z A;  3TW7 A;  5EEG A;  2VXZ A;  4F92 B;  2IW5 A;  5D6E A;  1WRJ A;  2EQR A;  4XOP A;  4PDK A;  1T2K A;  3L2V A;  1BR2 A;  4HRI A;  4EJW A;  3G73 A;  2VPR A;  5K5O A;  1S7O A;  2GIZ A;  1Y0N A;  2BHY A;  1EJ9 A;  3I9V 2;  1JKQ C;  2LY1 A;  3E7L A;  4C3H J;  2XRL A;  4U88 A;  5IP6 A;  1XPX A;  3A2K A;  1QO0 D;  2E19 A;  1WJD A;  3GLX A;  1SVL A;  4F52 A;  1ZTR A;  2MH9 A;  1R58 A;  2L3D A;  2BGC A;  1A35 A;  1JHF A;  2E7X A;  5B5E C;  2NS7 A;  5GP9 A;  2F5V A;  3TGN A;  3S16 J;  1TC3 C;  3C2B A;  4A2U A;  4ZYH A;  1QRY A;  1AKH A;  2JWT A;  3RIR A;  4UV9 A;  1K61 A;  1I39 A;  4FX0 A;  2UWM A;  4BBS J;  2L7F P;  4LLN A;  3R60 A;  5K7H A;  3FBI B;  4RAY A;  3CLO A;  4V2G A;  4WCG A;  1RUN A;  3K9T A;  4RB0 A;  3H35 A;  2PG4 A;  1ETW A;  2KDZ A;  3M1C A;  4UNO A;  4PJJ A;  2P4W A;  1HDD C;  2LRE A;  1BW5 A;  2XPW A;  2XC7 A;  2KZG A;  3L2Q A;  1WI3 A;  3CDL A;  2NVY J;  3NAU A;  4EM2 A;  3T5X A;  1TBX A;  3T0Y A;  1MMA A;  4LLL A;  1G2H A;  3W2A A;  2O8K A;  4JX6 A;  4LG3 A;  4NC7 A;  2M3A A;  2OZU A;  5IOZ A;  2R5Y A;  1MBH A;  4EJO A;  3D0S A;  3GTL J;  1P4W A;  3TMO A;  2BHZ A;  5F1J A;  1YFH A;  2F48 A;  1BC8 C;  1N25 A;  3LAJ A;  1X58 A;  2QF7 A;  4M9Z A;  3WGI A;  5E79 C;  5LFA A;  3OSF A;  2HVS A;  3GTM J;  2MH2 A;  4RA2 A;  3A1Y A;  5FJ8 J;  3LSP A;  2I5U A;  2HFH A;  1BJA A;  4D5C A;  3M8F A;  1ONV A;  1WVR A;  2Q1Z B;  2VLA A;  3B73 A;  3G2B A;  1YYV A;  2JVG A;  4WXH A;  2ID3 A;  3D5R C;  3IKV A;  1IN4 A;  4XLF A;  3LL7 A;  2TCT A;  1A6Q A;  1P6R A;  2ELK A;  4NB5 A;  3RKW A;  2VJJ A;  2VT3 A;  2OD5 A;  2BY0 A;  2X48 A;  3C7J A;  2CO5 A;  2IGK A;  3DKY A;  3FK7 A;  2BY3 A;  4HEA 2;  5BPD A;  1F43 A;  2A6H F;  3BDD A;  3K4B A;  1EKE A;  2CUE A;  4ANJ A;  4FX4 A;  2XF7 A;  3KE2 A;  2Z99 A;  4UY8 I;  2VUM J;  1DGW Y;  4PFO A;  4RLF A;  4WF2 A;  2FEZ A;  4A5M A;  1LFU P;  4W97 A;  4CCN A;  3JSO A;  3OYB A;  4RGX A;  2ESH A;  2N8G A;  4YRV A;  4Q48 A;  4II3 A;  5HLG A;  4RM2 A;  1PVE A;  5AON A;  2YU9 J;  2JUG A;  3BCA A;  2DPD A;  1QBJ A;  4IL6 C;  2R7O A;  5LLQ A;  3QU6 A;  2QYO A;  4JK1 X;  5HVQ C;  5DUI A;  1ACI A;  2PJP A;  1JT0 A;  5CQE A;  3M9A A;  3SDB A;  3QAH A;  1MJA A;  2V4J C;  5ERI A;  2FBK A;  5LBQ A;  3DTE A;  3ZN1 A;  1MNE A;  3ZQF A;  2MLK A;  3D1N I;  2NVT J;  1X1P A;  3CO6 C;  4KUM A;  1HQC A;  1USS A;  2FSW A;  1LB2 A;  4S04 A;  2X9D A;  1O57 A;  3DTI A;  4XSZ F;  2KRF A;  3WE2 A;  4BHC A;  2KIU A;  4X1E A;  5J4Y A;  3BP8 A;  3DF8 A;  3ECO A;  3DTK A;  3DP7 A;  4KMF A;  2IAI A;  4XM3 A;  2Q2E B;  1RNL A;  3FKI J;  4G6Q A;  1SAU A;  2E5Z A;  1FSE A;  4IQ4 A;  5EJC A;  2HGC A;  3CC4 I;  5TIS C;  2WAQ A;  2V6C A;  1R22 A;  4L0Z B;  4GGG A;  1YJN I;  2ZCW A;  2OTL I;  3EUK L;  2D1V A;  4IXA A;  1I3Q J;  4GDF A;  1S29 A;  4CZZ A;  2QGU A;  1BR4 A;  3I0T A;  1ZLJ A;  2GZW A;  4ZJZ A;  2OPT A;  3OYN A;  1LPQ A;  1N75 A;  1POG A;  3DEU A;  3ASO H;  3ZQQ A;  2ETH A;  2ZME A;  2QVO A;  3KP2 A;  5F27 A;  5HDG A;  1VTN C;  3E3V A;  1J09 A;  2EV5 A;  2K40 A;  3HDD A;  2ZXW H;  2ZJP F;  2DDA A;  1UHM A;  2EBI A;  3KP3 A;  4JBA A;  1PP7 U;  1CGP A;  1R1V A;  2M8G X;  3FMQ A;  1NK2 P;  4UVB A;  3HOV J;  2BW3 A;  1IN8 A;  2MD5 A;  3S2H J;  1C0W A;  4O3M A;  1DGR M;  1PP8 F;  1RES A;  3L9F A;  1DUX C;  2DQR A;  5DTD A;  1FTZ A;  3P7N A;  3F8N A;  1BI0 A;  1SD6 A;  2KIS A;  1O7L A;  3GTK J;  4BAC A;  1OCO H;  1MMG A;  5E8I A;  2A6T A;  2LD5 A;  1BW6 A;  3U21 A;  2QM3 A;  4E7H A;  2CQQ A;  4L5I A;  4MQV A;  3JRG A;  1LVK A;  2LLK A;  1LUJ B;  1FIP A;  2QWW A;  1YE9 A;  2P0W A;  3A01 B;  4E7L A;  4ZC3 A;  4HA8 A;  3IWZ A;  3I4N J;  3IWF A;  1ETQ A;  4WXC A;  1YX3 A;  4G7H F;  4EGZ A;  2VC0 A;  4N4N B;  3ZXS A;  4AYB A;  1O4X A;  1KZH A;  3S1R J;  2YSR A;  2O8X A;  1SFO J;  5E17 F;  2MC3 A;  1R1U A;  3IV5 A;  5C4X J;  1OFC X;  1P4X A;  5IP9 J;  3BPV A;  2BZT A;  3JTH A;  1RKT A;  1WI9 A;  4L5E A;  1IG7 A;  4MNU A;  2B0L A;  2K4B A;  3EPZ A;  3S1Q J;  2EZI A;  2MSY A;  5J6X A;  2DMU A;  3GF2 A;  5DD8 A;  3OYC A;  2XF5 A;  4LOC A;  4PGG A;  4ETS A;  2R5Z A;  3AAF A;  1VFC A;  3CCR I;  3IKT A;  3PNT A;  4JP0 A;  2K3P A;  3WGH A;  1TNT A;  3E0J B;  1B8I B;  4L5J A;  2GWR A;  4M9X A;  2R7D A;  2IS4 A;  4ENK A;  4XN0 A;  1ETV A;  4BGD A;  2NAZ A;  1WJC A;  3BG6 A;  1GVD A;  2XIG A;  3BG3 A;  4CUG A;  3PNY A;  4EM1 A;  3BZ6 A;  2H09 A;  3SZP A;  3FF5 A;  2V26 A;  3IH4 A;  4Y4R A;  4AVP A;  2WTE A;  3VSL A;  5DS9 A;  2DXI A;  3ONQ A;  3K6G A;  1NHA A;  4ZZD A;  4XLA A;  3A0H C;  4KIG A;  2Y0S N;  1H9T A;  1IRZ A;  3KET A;  1IDY A;  1JE8 A;  1V4R A;  3PSI A;  1ZRD A;  3GFI A;  2BW3 B;  1TW2 A;  4HOB A;  3OYL A;  4LGW A;  4MTD A;  2EPF A;  3IAM 2;  1QPM A;  1P7J A;  3RKY A;  2GLO A;  1NTC A;  2R7F A;  1A36 A;  4M74 A;  3UR3 C;  3I4P A;  3HOT A;  2M7A A;  2E35 A;  4XR6 A;  4ESB A;  2KJC A;  1KQ8 A;  2JT1 A;  4RB2 C;  1LE8 B;  5J4V A;  1QVU A;  3Q9V A;  3FKJ A;  3A01 A;  2HQR A;  4FET A;  3WU1 B;  4JX4 A;  2DDB A;  3HG9 A;  4BEH A;  2OA4 A;  4NHJ A;  5K5R A;  2YS9 A;  3L2U A;  2DYS H;  4E7S A;  3M4O J;  3M1E A;  3S3M A;  3NWS A;  4JYK A;  2K9Q A;  4BHB A;  2L4A A;  1X4P A;  3DKW A;  3UNG C;  1XB4 A;  5L3G A;  3V7R A;  2XGX A;  5D8L B;  3FDY A;  2X0L A;  3RZO J;  4UB6 C;  3JR9 A;  1K6O A;  3TO9 A;  1XX5 A;  5KVR A;  5LRR A;  3OSG A;  5F0H A;  3WTT C;  1FYK A;  5LRS A;  3OWT A;  2HQA A;  4LIT A;  5K7F A;  3IHU A;  1I50 J;  2ESN A;  2XUB A;  4ABZ A;  2VI6 A;  1S9H A;  2CW8 A;  1GLN A;  3RI4 A;  3BTC A;  2CUZ A;  2I8D A;  4IX7 A;  2EIJ H;  5HLH A;  3TP0 A;  1SD7 A;  5EYR A;  3JW4 A;  4A0Z A;  1JGS A;  1XDS A;  4XLC A;  3PO2 J;  3MQ0 A;  4M3F A;  4A6E A;  1G6N A;  3X2Q H;  1JKO C;  4G6D A;  3ZQG A;  2ZXH A;  3LSI A;  1WPK A;  2K85 A;  1W0T A;  2CV0 A;  3HSE A;  3DPU A;  2RNJ A;  1Z7L A;  4C30 A;  2NVQ J;  3F72 A;  2Y48 A;  3DKX A;  5IP7 J;  3KFW X;  1IV8 A;  4YFN F;  3C3W A;  3H3U A;  3BG7 A;  1F4K A;  3K4J A;  1N78 A;  3OV8 A;  4OMZ A;  2BE5 F;  5LHI A;  4IOC F;  4AWX B;  4AIH A;  2V9P A;  2ZNY A;  4QPO A;  4BQO A;  4NC8 A;  2HXO A;  5FLX Z;  4XK4 A;  3C2G A;  1F9N A;  5ICE A;  4LIV A;  2XB0 X;  5JFR A;  5KNL A;  1X3W B;  1J59 A;  2PMZ A;  5EDN A;  2MA3 A;  3WTY C;  1Z1D A;  1R7J A;  1B1B A;  1HC8 A;  2LFB A;  2LKP A;  1TQP A;  3HGY A;  1YTY A;  3BJ6 A;  1O3S A;  1HW2 A;  2H8W A;  2NOG A;  1CQT A;  2FNP A;  1D1A A;  3ZCO A;  4PJM A;  3T8T A;  2E2I J;  2CQ7 A;  1JGG A;  2BEO A;  4I0B A;  5IT3 A;  1DU6 A;  5EG0 B;  5FRN A;  4E70 A;  2IA0 A;  2JUC A;  1Y6I A;  2FBI A;  1MH3 A;  3VOD A;  3KIO A;  5J8C A;  3MKL A;  4W1U A;  3K4K A;  3JRC A;  4RGR A;  1ZKG A;  1HSJ A;  3P9I A;  4Z6Y A;  4BE0 A;  4N9I A;  3FWE A;  5IYD J;  2ZC2 A;  4YEL A;  1ORK A;  2HPI A;  4GCV A;  2NS8 A;  1BM9 A;  1D0X A;  5DCF A;  1ETY A;  2G7H A;  2HQ5 A;  2M34 A;  1W36 D;  2L0K A;  2VC1 A;  5EZH A;  5J1Y A;  2NVX J;  1IZ1 A;  3CCS I;  2JVH A;  1EF4 A;  3ESW B;  2J5O A;  2HVQ A;  4M3D A;  3S14 J;  1JTX A;  5CVV A;  3K1M A;  2OU2 A;  2P6S A;  3CCU I;  2WY7 Q;  2E1O A;  2KQR A;  4F93 B;  1JUS A;  4A3C J;  2ZSH B;  3N05 A;  2R7T A;  4M6Y A;  2HXI A;  1T39 A;  4ITV A;  3GO5 A;  1VND A;  1WH7 A;  4A3E J;  1TWC J;  3MAJ A;  2EA4 A;  2HWV A;  1IDZ A;  3HIF A;  2KDO A;  2CW7 A;  1MKM A;  2E7W A;  3IRQ A;  4MEX F;  1YIT I;  4AU7 A;  1FOX A;  2FX0 A;  2R5Y B;  1SFU A;  2VJ4 A;  2K86 A;  4PFP A;  2W57 A;  1FX7 A;  4BDY A;  5JHU A;  4IKF A;  3QP5 A;  3AG1 H;  1T38 A;  4XKV A;  1ZQ3 P;  3ABT A;  4XN3 A;  5B3S H;  2W4S A;  1DDN A;  2Z16 A;  1K4T A;  1IW7 F;  2G7U A;  2K9S A;  1WHU A;  3KYL A;  3S1N J;  4KDP A;  2RV8 A;  4ENJ A;  2LBF A;  2V1X A;  2W00 A;  1FIA A;  4CDG A;  4G9Y A;  3E1S A;  3HRS A;  3FXR A;  2JJ7 A;  3C1D A;  1MSE C;  1UFM A;  4FHT A;  3FIW A;  4RAG A;  4KN7 X;  2D5V A;  1U9N A;  3S3N A;  2Z3Y A;  2LBF B;  2Y30 A;  3TW6 A;  1D5V A;  3ELK A;  3JRD A;  2VT2 A;  4EQQ A;  1YJ9 I;  3ZPL A;  1FY7 A;  4JX5 A;  3K4C A;  5ICG A;  3BY6 A;  1XSX A;  3FM5 A;  4KIB A;  1ZR4 A;  4CH7 A;  1ZR2 A;  4M72 A;  3PSF A;  4C3I J;  1FBS A;  1FJL A;  5AIP A;  1BOA A;  3RKX A;  1EH7 A;  2LVS A;  3CES A;  9ANT A;  2GBY A;  2JSP A;  5F08 A;  4GYI A;  3H5R A;  4C3J J;  1FLI A;  3HOS A;  3BLY A;  3V8J A;  4AC0 A;  3K70 C;  4XBF A;  1MBK A;  1QQI A;  3QOE A;  4XL9 A;  4QPQ A;  5JVT A;  1IAW A;  2E2J J;  4D9J A;  1KA8 A;  3S15 J;  2Z9O A;  4Q47 A;  2L54 A;  4PJN A;  4XLP F;  3E6C C;  3QYF A;  2VBX A;  3Q9S A;  5D6F A;  1ZG1 A;  4YEJ A;  3VFZ A;  2AXL A;  3EYY A;  3V4G A;  1RC9 A;  4RAZ A;  2DA2 A;  1ZAR A;  5L3B A;  1WJB A;  1O3Q A;  4E7I A;  2QEN A;  4HX7 A;  3IH2 A;  3HOZ J;  3I4M J;  2PBI A;  2VE8 A;  2STT A;  4XQF A;  3JRI A;  2IGO A;  2HR3 A;  5BS6 A;  5TJJ A;  2AQE A;  2DA6 A;  3DQV C;  3C2H A;  1YOV B;  4MIM A;  2CRG A;  2JMW A;  1QHH D;  3Q0V A;  3F6V A;  4JOM A;  3MKY B;  3J7A O;  3CCE I;  2M8E A;  1IGN A;  1FT9 A;  2MGQ A;  2X6O A;  4YFK F;  1KU9 A;  4CCJ A;  1OCZ H;  1L3L A;  3DXJ F;  1Y1W J;  1XGS A;  5DUK A;  2OV7 A;  3HXL A;  2LMD A;  5IYC J;  1WQ2 A;  2FOW A;  3G1M A;  1NK3 P;  2DTZ A;  2CV1 A;  3K0L A;  4LFU A;  2LKS A;  1U8B A;  1X19 A;  2ZFW A;  4XKC A;  1PUF A;  3RCO A;  1LFP A;  1OCC H;  5FLX K;  2H6B A;  3E6B A;  3PIO F;  2C6Y A;  1XTA A;  2WAD A;  3QOP A;  1ZGA A;  2Y0M A;  1QHG A;  2WB1 A;  3TQN A;  4E7K A;  3LA7 A;  3ASN H;  4O5V A;  3OL3 A;  2QLZ A;  1KON A;  2EA2 A;  4RAF A;  1WH5 A;  5LD2 C;  5CJ9 A;  2OCE A;  4A3G J;  2BVL A;  3TO6 A;  3L7W A;  4AVZ A;  4CCM A;  4HAM A;  3G3Z A;  5CQG A;  3AFH A;  2E1M B;  4Y33 A;  4AID A;  3PQK A;  4RLQ A;  2BXY A;  1LJ9 A;  3DPL C;  2VKD A;  4BAY A;  2H27 A;  2LYC A;  2YX7 A;  4N4O B;  2XAF A;  1U6G A;  2ACJ A;  1BR1 A;  2XKP A;  4IHS A;  3F8M A;  2G0E A;  3SEQ A;  3BR0 A;  3GFM A;  4OIO F;  4CA0 A;  1KYW A;  1N77 A;  2VJI A;  2EFQ A;  3K2A A;  4CIC A;  4BXF A;  3F8F A;  2ZJQ F;  2WWY A;  3KPH A;  4EEF G;  1E3O C;  2ZBK A;  1XGO A;  5KHD A;  1TT0 A;  3V42 A;  5D5V B;  5GTH C;  5IYB J;  5HLI A;  4H0E A;  2V9V A;  1ZRC A;  2R7R A;  4L9T A;  3SHF A;  3TO7 A;  1WGX A;  4P9U A;  4FT8 A;  2BXZ A;  4IEJ A;  1O3R A;  4BQQ A;  2LR8 A;  3LQR A;  3E6M A;  4BBR J;  3PNV A;  2ZXI A;  1U5T A;  4II2 A;  1HCR A;  5DD4 A;  1HW5 A;  2OJE D;  3OL4 A;  4L9N A;  2ICW G;  1HLV A;  4CYC B;  4BH9 A;  3WTU C;  2CUF A;  1S72 I;  4A3K J;  3WTV C;  3CD6 I;  1Z67 A;  1QGP A;  3N97 A;  2AXT C;  4PSX A;  4B4C A;  2HYF A;  1IN7 A;  3MVP A;  4MGR A;  3LSH A;  1IRF A;  1HA8 A;  2X1E A;  2EZL A;  3BR1 A;  4FE7 A;  4OIP F;  1I5Z A;  3HB9 A;  5DDG A;  3E5X A;  3QQA A;  1DP7 P;  4HYE A;  1WZ2 A;  3OS2 A;  4DBQ A;  3HM5 A;  5E3L A;  3CTA A;  2V6E A;  3GVA A;  2ADU A;  1JUP A;  4F55 A;  1UHS A;  2VQC A;  5A2Q K;  2LC2 A;  4D5F A;  1P2F A;  3Q0W A;  1FOY A;  1W36 C;  2R3S A;  3FXO A;  4ZDO A;  3LFK A;  2RRE A;  4LB6 B;  3CO7 C;  3BZK A;  3CUQ B;  2UXN A;  2VJ5 A;  1S6L A;  1D5Y A;  3BTL A;  1JKR C;  5F1R A;  4XRS G;  3L00 A;  1K4S A;  3A03 A;  5E1X A;  1JT6 A;  4P55 A;  3HGG A;  3D5L A;  3KP7 A;  2HVR A;  3E6D A;  5EF6 A;  2WV0 A;  3GX4 X;  4EM0 B;  1B8I A;  3J7Y J;  4IRH A;  4I98 B;  3EET A;  1V5F A;  5E18 F;  1D8J A;  4F3Q A;  2W82 A;  4MHG A;  3O8H A;  1FMV A;  3BJO A;  4HV5 A;  3CF2 A;  2DOD A;  1G3Y A;  2X6W A;  3CJN A;  3GUD A;  4UVA A;  4G12 A;  1UG2 A;  3BR5 A;  3P5J A;  2JN6 A;  2VBZ A;  1YG2 A;  5IT9 K;  5J1R A;  1Y39 A;  2UV1 A;  1GXP A;  1P7I A;  3C18 A;  2HTS A;  3A0B C;  4BE1 A;  3GTQ J;  2EIM H;  3HYI A;  2UZK A;  3T8R A;  4ZYD A;  1UZC A;  4KIF A;  4R1H A;  4B43 A;  1Y56 A;  3PUF A;  1VQ5 I;  2NVU B;  1IUY A;  4DYC A;  5BOX A;  2VQG A;  2H6C A;  4M6V A;  3OYJ A;  4ESJ A;  2DYR H;  3CQZ J;  4XMY A;  3NEU A;  3DBL B;  3DLL F;  5IT9 Z;  2DFI A;  4PJ0 C;  2AHQ A;  1GVJ A;  1KQ0 A;  3OR1 C;  2V79 A;  3OY9 A;  2PFB A;  1JJ6 C;  4E7J A;  3E97 A;  1BOB A;  4D7N A;  3TOB A;  1S7A A;  3MKZ A;  1FMW A;  2JA8 J;  2R0Q C;  3W2V A;  2ELH A;  4XSX F;  4XRM A;  1Z3X A;  5ILU A;  5DM6 F;  3WGG A;  4DBR A;  2UUZ A;  5IOY A;  5ED4 A;  4HPQ A;  2EFN A;  3AKZ A;  4MFE A;  3CCQ I;  2FJ1 A;  2FOK A;  1A04 A;  3DU6 A;  2A5Y B;  3QPT A;  1VQM I;  3J7Z I;  1R49 A;  2DFH A;  2PLY A;  1SMY F;  2Y9Z A;  4NNJ A;  4XLE A;  4IHY A;  2EJR A;  4UHT A;  2HYJ A;  3WG9 A;  3RSN A;  1IXS B;  3HSR A;  2HOA A;  2QUF A;  4EGY A;  5ICF A;  5HNF A;  2XRN A;  1RRJ A;  4IHT A;  4HBL A;  1YRN A;  3F9K A;  4ZZL A;  2P5K A;  2QZ8 A;  2XPU A;  3S3O A;  4QWQ A;  5D5W B;  3JRH A;  2V1D A;  3S8P A;  3LAP A;  1SD5 A;  2XRO A;  3WTW C;  3ISP A;  1FSH A;  2KLO A;  2O3F A;  2FUG 2;  1YRN B;  1MH4 A;  3CCY A;  4PSW A;  2ZB9 A;  1LE8 A;  5M3F J;  4XIC A;  2P8T A;  2F2E A;  2R7X A;  1I27 A;  4XNF A;  4ZYG A;  5FD6 A;  1A5J A;  5GTI C;  4XLN F;  1PDN C;  2KMU A;  4KN4 X;  3TDZ C;  2FRH A;  2JZY A;  1SVO A;  4BYY A;  3QRF F;  3ZMD A;  4CCK A;  4Y13 A;  1E3P A;  5HDK A;  2F6C A;  1ZRF A;  2KHM A;  1B6A A;  3BWG A;  2XAS A;  3HBL A;  5BPI A;  2XGD A;  1KGS A;  3V7S A;  3DFG A;  2XDV A;  1ON2 A;  3F8B A;  3GZN B;  3HSF A;  1G3T A;  1S7E A;  2MLG A;  1ENH A;  1KU7 A;  1B9M A;  2DOA A;  2IS1 A;  1XSV A;  2CH0 A;  1YLF A;  3FXK A;  2HU9 A;  2IA2 A;  3WE3 A;  3U2R A;  5CKT A;  4YIR X;  1G4D A;  1AWC A;  1Y1V J;  2DW4 A;  1J75 A;  3CC2 I;  3GCM A;  4KNY A;  2O03 A;  1M1E B;  1E2X A;  3G4S I;  2KRC A;  2JTV A;  1MIJ A;  3BG5 A;  3LQQ A;  5GAD J;  3DPT A;  4IO9 F;  1OCP A;  4IHX A;  5FKK A;  2ZME B;  3CZ6 A;  1GXQ A;  3HEF A;  3ML6 A;  1Z7U A;  1FPQ A;  2XHK A;  1MJB A;  2EZK A;  3GTJ J;  1F36 A;  1MBG A;  2HI3 A;  3J81 K;  3CMY A;  1K7A A;  2DI3 A;  2JA5 J;  5KAI C;  2OAZ A;  2Z1D A;  3JAM Z;  2QSG X;  4Y3O A;  1YIJ I;  2XPV A;  5JHF A;  3CP2 A;  1IRG A;  1TWH J;  3QYB A;  3RPU D;  2NRA C;  4EJT A;  1STZ A;  3WG7 H;  5J3L A;  5M5W J;  3RJP A;  2EK5 A;  2IP2 A;  2IBD A;  3M7G A;  4OAZ A;  5CPR B;  1ZG5 A;  2COB A;  2M4G A;  3COA C;  3JSP A;  4BY1 J;  2H94 A;  4HQM A;  1P4A A;  1OR7 A;  3PQJ A;  1NG6 A;  3DEE A;  1KQ9 A;  3BQZ A;  4BU2 A;  2V9K A;  3OYD A;  2IGM A;  4LB5 A;  4EMS A;  1X3Z B;  4GO1 A;  1HXD A;  2AS5 F;  3HJE A;  1ODD A;  2GA2 A;  3LNQ A;  4GFB A;  4S0H B;  5K1Y A;  3OYF A;  2K27 A;  2PMH A;  4RB3 C;  2NNY A;  4KYW A;  1FWZ A;  4R8H A;  1PYV A;  1WJ5 A;  2M1B A;  4B09 A;  1FP1 D;  1E0E A;  1J9I A;  2DTR A;  3H92 A;  3ZOB A;  3FIS A;  1IC8 A;  1Q1H A;  1T8I A;  1F1Z A;  4OWR B;  1I6X A;  1GT0 C;  5E1Z B;  4G94 A;  1WJE A;  2L01 A;  3PO3 J;  1T6S A;  1WWX A;  4MLO A;  3AL0 C;  2M45 A;  4HW0 A;  3S17 J;  1ETO A;  4BJT A;  4PGH A;  4U7D A;  1U78 A;  1W5C C;  5DEQ A;  1MMN A;  4IQJ A;  4HV6 A;  1HKT A;  4KJZ A;  1VQP I;  2FMY A;  2DAO A;  1EH8 A;  2VXD A;  1R4M B;  2KL4 A;  3FHZ A;  1FYM A;  1Z9C A;  2EIN H;  1OCR H;  1FYL A;  3LA2 A;  3HRU A;  2DU9 A;  1YI2 I;  5HLT A;  1TWG J;  3EUH A;  5EG0 A;  3J80 Z;  2LSO A;  4DZJ A;  5D5U B;  3GZ5 A;  3KP4 A;  1RI7 A;  2P81 A;  2XGC A;  4BY7 J;  2A69 F;  2O5R A;  2K5C A;  1K78 A;  3I53 A;  2EFW A;  1P9Q C;  2VL8 A;  2IS2 A;  1VQ7 I;  1QZE A;  1TWF J;  2OQG A;  5HOD A;  5FLM J;  1H9G A;  2ZFU A;  2ZKZ A;  3AG4 H;  1YJW I;  1LEA A;  5M5X J;  2VQH A;  2G9W A;  2JA6 J;  1UG0 A;  2P5L C;  4HSR A;  2ECC A;  2ZXJ A;  2DT7 B;  1FOW A;  2CMP A;  2PMU A;  1TQM A;  4I76 A;  2GXG A;  2RC4 A;  3BJA A;  4KT5 C;  4LG0 A;  4EV0 A;  2DPU A;  4L0Y B;  3HOY J;  5JLX A;  3I64 A;  4D0P A;  4BEH B;  1KYZ A;  3HKZ A;  2VN2 A;  3CUQ A;  4G7O F;  1W7P A;  5FD5 A;  3J7A Y;  1Y8R B;  3L09 A;  4CO8 A;  1RR8 C;  4KMU X;  3CDH A;  4RGS A;  3LST A;  4HNU A;  3NAR A;  4GXO A;  1D8K A;  2M2E A;  1G3W A;  1X4O A;  1G8X A;  1OLT A;  1Z6T A;  4KIS A;  5L3E A;  1YS6 A;  1VQL I;  3VEP A;  2V7F A;  4IHV A;  2R7S A;  3ZQL A;  1K79 A;  2WAE A;  2M87 A;  1Z21 A;  2K7L A;  2MBF A;  4BJ5 C;  1ETK A;  3BRO A;  3CMA I;  3EUH C;  3H9G A;  3HHH A;  3PM1 A;  3BPX A;  3R6S A;  3I55 I;  1LDK B;  3VSK A;  5GAE J;  4HDV A;  1NG7 A;  1QNT A;  1GV5 A;  3H3Z A;  2R7W A;  2PX9 A;  4HDU A;  2YU3 A;  3MFK A;  2LY9 A;  2JPB A;  3KZZ A;  3F8C A;  3GZ6 A;  2X51 A;  1A6I A;  3FM3 A;  3GME A;  4U87 A;  1OCT C;  3FXJ A;  3RPQ A;  2CYY A;  2HTJ A;  5A2Q Z;  2DOE A;  4CYC A;  2ISY A;  3OOU A;  3S1M J;  1ETX A;  4IJA A;  3Q0U A;  3KLN A;  4BXX J;  1VQ6 I;  1FZP B;  2XAG A;  4KT6 A;  2E2H J;  2OUM A;  4DZP A;  1W4M A;  4X6A J;  3CJR B;  2JQ7 A;  3K1P A;  3P9C A;  3ABU A;  1TWA J;  2P7V B;  3CJT B;  3CLQ A;  1MD0 A;  3TKY A;  3U1D A;  4NC6 A;  2Y9Y A;  2WC2 A;  3I59 A;  2E5N A;  3K4L A;  4B3X A;  5CYV A;  3PJR A;  2DJN A;  4BJ6 C;  3F23 A;  1VQN I;  3RPU A;  3BOQ A;  5EZG A;  4HLX A;  4M3B A;  2BY2 A;  1B72 A;  4EJU A;  4PK4 A;  3BQY A;  1PUF B;  2K9L A;  4X0G A;  4I01 A;  4OIR F;  4M73 A;  3F0C A;  3RQI A;  2FF4 A;  3VDX A;  2DMQ A;  5HDN A;  4Z2Y A;  3ZQH A;  3W2W A;  1IUF A;  3AG3 H;  1QVT A;  2HZT A;  3FMR A;  1WFX A;  3S93 A;  2GXB A;  3ROU A;  2NOJ B;  1FNN A;  5C4J J;  2A3S A;  2W1O A;  4CCL A;  1T33 A;  4NUB A;  1AA7 A;  3K10 A;  2XAU A;  3F22 A;  4UUT A;  2CG4 A;  2IGN A;  3MD2 A;  3ZN0 A;  4CCO A;  1R5I D;  3SZT A;  5KCM A;  2QBY A;  3QPL A;  3GTO J;  5GPC A;  1R1T A;  4MFD A;  3QPH A;  2LOO A;  4P5O A;  2BV6 A;  2O0Y A;  4CSW A;  4QIW N;  3O2P E;  4A93 J;  1R23 A;  1X1B A;  1H8A C;  5DCM A;  3SZG A;  1LVA A;  3VYS B;  5CVU A;  4ESF A;  2BY1 A;  1R5H A;  2K4J A;  1FBU A;  1TT5 B;  1X1A A;  1ZYR F;  2XGE A;  5FFX A;  3R4K A;  5LHH A;  4XOT A;  3LA3 A;  4B8X A;  4IF4 A;  2HNH A;  1V54 H;  2CJJ A;  3FBN B;  2EIK H;  2NS0 A;  5E1W A;  3ZMZ A;  2F5E A;  4WXD A;  3L2W A;  2GOX B;  3HHG A;  3H9J A;  3V8L A;  3ZMU A;  3KLO A;  1W0U A;  2MYS A;  1UAA A;  3H5N A;  2M0M A;  4UUV A;  3EDP A;  3FXQ A;  2DLL A;  1QPI A;  4ZTJ A;  1WCM J;  5E3O A;  4RGU A;  1AHD P;  1OJL A;  2A5W A;  3G1O A;  3IAS 2;  3REO A;  3M8J A;  1LDD A;  4FTH A;  1MNM C;  1I6H J;  3L2C A;  2JA2 A;  1NH3 A;  5F6F A;  2NYX A;  2AQF A;  3K4M A;  3OYE A;  4I2O A;  3LSK A;  2LTP A;  1SEU A;  5CVR A;  4MO7 A;  3I58 A;  1BI2 A;  1T0F C;  2TDX A;  2LG4 A;  2XAH A;  3LMM A;  4OOI A;  2WV1 A;  4YII A;  3DCF A;  3K69 A;  2HKO A;  3FHN A;  3FX3 A;  1TP4 A;  4L9V A;  2Y2Z A;  3HC7 A;  4M3E A;  2R7Z J;  4XID A;  1XG1 A;  2PQ8 A;  3H0D A;  5D4R A;  3OYA A;  1HKQ A;  4J00 A;  1XMX A;  3BCB A;  5F0C A;  3LSJ A;  2QQ8 A;  2B9S A;  4CHU A;  4D1Q A;  3VB2 A;  4C2T A;  1BIB A;  1RKW A;  3PUB A;  2HEO A;  1MW7 A;  2FXA A;  3BR3 A;  3W6K B;  4WWC A;  3OS1 A;  1JKP C;  3O8G A;  3VWB A;  4BL0 B;  1TLH B;  4LK1 F;  2L7Z A;  3ZGK A;  1V5E A;  3MZH A;  2E1N A;  2QQB A;  1Z0X A;  2DFE A;  5F64 A;  4B1R A;  3G6E I;  2VBW A;  2HDC A;  2MFZ A;  5JR3 A;  3ZMT A;  2Q2E A;  1QU3 A;  1OYW A;  2L5Q A;  3QWL A;  2HOS A;  4AIJ A;  4F91 B;  3OYI A;  4ZTF A;  5GAG J;  3SJM A;  2HDD A;  4KIC A;  4WX9 A;  3SQN A;  1Z3Y A;  2F4O B;  1OKR A;  1JI8 A;  5BNG A;  4CXF A;  2QQA A;  2IA1 A;  1YW7 A;  2IVM A;  2WB1 N;  4P1W A;  4Q5S F;  4LJZ F;  4LK0 F;  1MGT A;  2E36 A;  1T95 A;  3GWZ A;  3RDI A;  2CGP A;  3PFY A;  3VPR A;  4CZC A;  1H89 C;  4RBO A;  2GXA A;  3OIO A;  2Q0O A;  3M07 A;  3HL2 A;  3ZQC A;  1V5G A;  2J5P A;  2ZJR F;  1I1S A;  1X2N A;  5CLS A;  3CCV I;  3V8K A;  4DYQ A;  4CYD A;  1T56 A;  1YS7 A;  3U9G A;  1XD7 A;  2CV2 A;  2CU7 A;  2K02 A;  4AUX A;  3M3Y J;  2KFD A;  3OYG A;  4UVC A;  2VOD A;  2JSC A;  5K7Z A;  3R0A A;  4I02 A;  5E8G A;  2CW0 F;  4IVN A;  2DFF A;  5ICC A;  2KJB A;  4AM3 A;  3BZC A;  1IV6 A;  2IJL A;  5LGT A;  4QSH A;  1UB9 A;  1RIO H;  3CP8 A;  3JCU C;  2WAF A;  5CVJ A;  1XGN A;  1T08 B;  4MTE A;  4LG0 B;  1TTY A;  1R4N B;  2MC4 A;  1APL C;  1HW1 A;  4MQ9 F;  5LEJ A;  4P9F A;  5H20 A;  3WTX C;  2YX4 A;  4HF0 A;  5E3N A;  5D5X B;  4ENN A;  4UUS A;  2PJR B;  4A0Y A;  2W7N A;  2HDW A;  1G59 A;  2JRT A;  1R36 A;  2X85 A;  4DNC A;  4QLC U;  2R7V A;  4HZF A;  1HOM A;  2KRH A;  3SYT A;  1ULY A;  2DOF A;  4NQW A;  1SAX A;  2HS5 A;  2Z2S B;  3R0J A;  1VZ0 A;  2DN0 A;  3GLL A;  4A6D A;  3I56 I;  1VI0 A;  3KEO A;  3OYH A;  2QSF X;  1UEL B;  1JTY A;  3NQO A;  3QP6 A;  4DYR A;  5HNH A;  2KP6 A;  2LY2 A;  5H6R A;  1ITY A;  3L1P A;  2E34 A;  2XSD C;  3CJQ B;  3LSR A;  2DQL A;  1B59 A;  3ZRG A;  2Z5U A;  4M6X A;  2XV4 S;  4OIQ F;  2L2O A;  2LRD A;  1ZG3 A;  4U7B A;  2LDU A;  1JHH A;  2L7K A;  1Z91 A;  3ERM A;  2VOO A;  2OF7 A;  3W6V A;  1D1B A;  4O6J A;  1FP2 A;  2DJI A;  3VOE A;  1ZGW A;  1XSD A;  3PIP F;  4P96 A;  1OMI A;  2HQN A;  2VBY A;  3A02 A;  3JRF A;  3CUO A;  1LNW A;  5D4S A;  2DT5 A;  5LGU A;  3VYR B;  1S5L C;  3BTJ A;  3HPG A;  2R4G A;  3D5S C;  1WSU A;  2R7U A;  1WKM A;  2OCC H;  3TOA A;  3HTU A;  5DYM A;  2OBP A;  2DA7 A;  1H0M A;  5BQT A;  2ELJ A;  1KU3 A;  5HS9 A;  4YIF A;  1VQ8 I;  2DA5 A;  3OOP A;  5L3D A;  4I0A A;  2D1H A;  3HOU J;  2V1N A;  5F04 A;  1OR7 C;  4B47 A;  4LLG F;  4A12 A;  3CC7 I;  3H5A A;  3OYK A;  2QA4 I;  1LDJ A;  2ZSI B;  5TRD A;  4BS9 A;  3KZI C;  3CCM I;  3VYU B;  1DQU A;  1TW3 A;  3ECH A;  1ZLK A;  2H8R A;  2GQQ A;  4Q4Z F;  2EIL H;  4L18 B;  5HS8 A;  5BMZ A;  3J81 Z;  1E17 A;  1QZY A;  1MBJ A;  3F21 A;  4U0Y A;  2L9N A;  1ZGJ A;  1R6R A;  2ID6 A;  1P92 A;  2DK8 A;  2MAB A;  3HRT A;  1TQI A;  2BOL A;  1BBY A;  4A3M J;  4ON0 A;  1CF7 B;  2QSH X;  2GA1 A;  5H6Q A;  2ZNZ A;  3DBH B;  1OYY A;  3RYR A;  1AOY A;  2ISZ A;  2RKH A;  2DCE A;  2M30 A;  4XRS A;  5D8K B;  3K4N A;  1MBF A;  2FQ4 A;  2FU4 A;  5J47 A;  1OIS A;  3P9K A;  5HOO A;  5TGT A;  1TZL A;  2DO7 A;  3M8E A;  4U0W A;  5LEK A;  4HF1 A;  1HF0 A;  4Y52 J;  4NBQ A;  1OQY A;  3I54 A;  1X3U A;  1RET A;  2L9V A;  3CMM A;  2V1U A;  2XF6 A;  1WJA A;  1IF1 A;  3OYM A;  2JRM A;  3VYT B;  4RM3 A;  5B1B H;  3N4M A;  1W1W E;  2EH3 A;  2QBY B;  2WY8 Q;  2GOM A;  3WTZ A;  2HKX A;  5IY5 H;  2JK3 A;  4BE2 A;  2L4M A;  4XON A;  3UKG A;  5DV5 A;  4FQG A; 
#chains in the Genus database with same CATH homology
 4G7Z F;  2ZJ2 A;  4HX4 A;  3LWF A;  1IN5 A;  1U5T B;  4K2E A;  3TDU C;  5FO5 A;  4OIN F;  4YG2 F;  4AIK A;  2O61 A;  5KK1 A;  3J80 K;  1MDM A;  2RN7 A;  4R79 A;  3SXY A;  4IRG A;  3CUQ C;  5LGN A;  3DV8 A;  2W84 A;  1SMT A;  4HQE A;  4AD9 A;  1W5T A;  4N9H A;  1G3S A;  1XGM A;  2XAQ A;  3MWM A;  2M5W A;  5K5Q A;  5FB2 A;  1I1G A;  1O3T A;  3B02 A;  1W7P D;  2VON A;  2RQP A;  1EV7 A;  1W7P B;  1YW8 A;  2STW A;  5HS7 A;  3KP5 A;  2O6G E;  2D2W A;  3HTS B;  1TNS A;  2LF7 A;  1ZH5 A;  3GFJ A;  5LHG A;  4A5N A;  5AIQ A;  3GW2 A;  1RZ4 A;  2BBY A;  1U2W A;  2IPQ X;  2F5F A;  1O7F A;  2HOE A;  2GIV A;  4GYG A;  3IL2 A;  4LD5 A;  4KA4 A;  2KIM A;  2YR2 A;  2W25 A;  1UHW A;  2EFO A;  3JTG A;  1ZHF A;  5L3F A;  4N0B A;  5ILV A;  1BC7 C;  1IN6 A;  3I5U A;  3V7C A;  3GEZ A;  4BQA A;  2OQR A;  3PFI A;  4I09 A;  3SFZ A;  2D45 A;  1LEB A;  4UXN A;  3EQL F;  4G8X A;  4IRI A;  1MZB A;  3IRR A;  4BXU A;  4F7Z A;  1T0F A;  4YFX F;  2W85 A;  1R00 A;  2ZO4 A;  2Q8K A;  5J8F A;  2A6E F;  4Y15 A;  2UXX A;  3MZY A;  1U8R A;  2LNB A;  2QQ9 A;  2KKO A;  3O6B B;  2XKO A;  4KFC A;  1HBX G;  4HF2 A;  5JI6 A;  1SFX A;  3I59 B;  1Y0U A;  2Z33 A;  5EEH A;  4PCQ A;  4BHP A;  2EFP A;  3W6J B;  1ZN2 A;  1J0R A;  3O3K A;  4Y17 A;  6PAX A;  1U5T C;  4ENM A;  1CF7 A;  2VE9 A;  1D3Y A;  3FXU A;  1IXR C;  1HKS A;  1MJ9 A;  3HUG A;  2F5D A;  1REP C;  2F5C A;  2CWE A;  4WK8 F;  4A0X A;  3IC7 A;  1SFE A;  4BNC A;  2BYV E;  2IRF G;  1S3J A;  3S2W A;  2A07 F;  1Z05 A;  1B4A A;  1UST A;  1S8N A;  2PN6 A;  1XMA A;  4RB1 A;  2FML A;  4EJV A;  3ZQ7 A;  3WU0 A;  2KIF A;  4IPA A;  3GXO A;  3F3X A;  1OPC A;  4HLY A;  1R5G A;  2PEX A;  3E5Q A;  1ON1 A;  3K1N A;  4I7H A;  5FGM A;  1Z6R A;  1ZRE A;  1L0O C;  3ULQ B;  3MEX A;  5ILS A;  1ZAO A;  2A61 A;  2FBH A;  4MEY F;  3GYH X;  2DK5 A;  1J5Y A;  1BIA A;  3JAM K;  2P7C B;  4S05 A;  1W5S A;  2EV0 A;  1RUO A;  3ZMV A;  1GHC A;  3NRV A;  4PZJ A;  3WTS C;  1YIO A;  2E1C A;  1BI1 A;  4DQ2 A;  2FNA A;  3KCC A;  4M71 A;  1HST A;  3T1B A;  5DCM B;  1XDU A;  4U0V A;  4ZYE A;  1BI3 A;  2NNN A;  2EWN A;  1MDM B;  2FA5 A;  1PUE E;  2HYG D;  2P6T A;  3ZMS A;  1OYI A;  2FE3 A;  1DPR A;  3RYP A;  3Q5F A;  1BN5 A;  4ASN A;  2COM A;  1QZZ A;  2JPC A;  4RS8 A;  1XCV A;  3F6O A;  1K78 B;  4L9J A;  3FMS A;  1FC3 A;  3EYI A;  1T98 A;  2FQ3 A;  4OU0 A;  4UV8 A;  2P5V A;  4TV7 A;  4M9S A;  3E5U A;  3WOD F;  3I71 A;  2RGV A;  2RVC A;  2IT0 A;  1XMK A;  1DPU A;  1LQ1 A;  4XRF A;  3KZY A;  1V3F A;  1YO5 C;  2XVC A;  1IXC A;  1SD4 A;  2CQK A;  2GAU A;  2X4H A;  1B9N A;  3R61 A;  2PI0 A;  5L3C A;  2VOP A;  1XN7 A;  1UCR A;  2EV6 A;  1FBQ A;  2Y75 A;  4JQF A;  2CSO A;  4CGZ A;  2CFX A;  2EB7 A;  4EVI A;  3FZV A;  2RDP A;  3KP6 A;  5E20 A;  2L02 A;  1KU2 A;  1EH6 A;  1U3E M;  5FFZ A;  2DBB A;  1FOK A;  2LF8 A;  1YQA A;  4HX8 A;  3MCZ A;  1XCB A;  4ZH4 F;  1JXS A;  4OMY A;  3ZP5 A;  1J7K A;  2YPR A;  3GFL A;  5CVI A;  1F5T A;  3RTR A;  4LMY A;  3ERE D;  2XAJ A;  3KEQ A;  3K2Z A;  1J2X A;  2W24 A;  2OZ6 A;  2A68 F;  3HRM A;  3QU3 A;  1YW9 A;  5EEG A;  2VXZ A;  2IW5 A;  5D6E A;  1WRJ A;  4PDK A;  1T2K A;  4EJW A;  3G73 A;  5K5O A;  1S7O A;  4U88 A;  1QO0 D;  3GLX A;  2MH9 A;  1R58 A;  2L3D A;  2BGC A;  1JHF A;  2E7X A;  3TGN A;  4A2U A;  4ZYH A;  3RIR A;  4UV9 A;  4FX0 A;  2UWM A;  4LLN A;  3R60 A;  4RAY A;  3CLO A;  4WCG A;  1RUN A;  3K9T A;  4RB0 A;  2PG4 A;  4UNO A;  2P4W A;  4EM2 A;  3T5X A;  1TBX A;  3T0Y A;  4LLL A;  2OZU A;  4EJO A;  3D0S A;  1P4W A;  1YFH A;  1BC8 C;  3LAJ A;  4M9Z A;  3WGI A;  2MH2 A;  2HFH A;  1BJA A;  3M8F A;  1ONV A;  3B73 A;  1YYV A;  4WXH A;  3IKV A;  1IN4 A;  1P6R A;  4NB5 A;  3RKW A;  2VT3 A;  2OD5 A;  3C7J A;  2CO5 A;  5BPD A;  2A6H F;  3BDD A;  4FX4 A;  3KE2 A;  2Z99 A;  4WF2 A;  2FEZ A;  4A5M A;  3JSO A;  4RGX A;  2ESH A;  4Q48 A;  5HLG A;  5AON A;  2DPD A;  1QBJ A;  5LLQ A;  3QU6 A;  2QYO A;  4JK1 X;  5HVQ C;  5DUI A;  2PJP A;  3M9A A;  3QAH A;  1MJA A;  5ERI A;  2FBK A;  5LBQ A;  3ZN1 A;  2MLK A;  3CO6 C;  4KUM A;  2FSW A;  1HQC A;  1USS A;  1LB2 A;  4S04 A;  1O57 A;  4XSZ F;  2KRF A;  3WE2 A;  4BHC A;  2KIU A;  3BP8 A;  3DF8 A;  3ECO A;  4KMF A;  3DP7 A;  1RNL A;  4G6Q A;  1FSE A;  2HGC A;  2V6C A;  1R22 A;  4L0Z B;  4GGG A;  2ZCW A;  2D1V A;  4IXA A;  1S29 A;  4CZZ A;  3I0T A;  1ZLJ A;  2GZW A;  3DEU A;  2ETH A;  2ZME A;  2QVO A;  3KP2 A;  5HDG A;  1VTN C;  3E3V A;  2EV5 A;  1UHM A;  3KP3 A;  4JBA A;  1PP7 U;  1CGP A;  1R1V A;  3FMQ A;  4UVB A;  1IN8 A;  2MD5 A;  1C0W A;  4O3M A;  1PP8 F;  3L9F A;  1DUX C;  2DQR A;  3P7N A;  3F8N A;  1BI0 A;  1SD6 A;  1O7L A;  5E8I A;  2QM3 A;  4L5I A;  4MQV A;  2QWW A;  4HA8 A;  3IWZ A;  3IWF A;  4WXC A;  4G7H F;  4EGZ A;  2VC0 A;  2YSR A;  2O8X A;  5E17 F;  2MC3 A;  1R1U A;  1P4X A;  3BPV A;  3JTH A;  1WI9 A;  4MNU A;  2B0L A;  2K4B A;  5J6X A;  3GF2 A;  5DD8 A;  4PGG A;  4ETS A;  3AAF A;  3IKT A;  3WGH A;  1TNT A;  4L5J A;  2GWR A;  4M9X A;  2R7D A;  4ENK A;  2NAZ A;  2XIG A;  4EM1 A;  3BZ6 A;  2H09 A;  3SZP A;  3FF5 A;  4AVP A;  2WTE A;  1NHA A;  4ZZD A;  4KIG A;  1H9T A;  3KET A;  1JE8 A;  1V4R A;  1ZRD A;  3GFI A;  1TW2 A;  4HOB A;  4LGW A;  4MTD A;  1QPM A;  3RKY A;  2R7F A;  4M74 A;  3I4P A;  3HOT A;  4ESB A;  2KJC A;  1KQ8 A;  2JT1 A;  4RB2 C;  3Q9V A;  2HQR A;  3WU1 B;  2OA4 A;  4NHJ A;  5K5R A;  3M1E A;  4BHB A;  2L4A A;  3DKW A;  1XB4 A;  5L3G A;  3V7R A;  2XGX A;  5D8L B;  2X0L A;  1K6O A;  3TO9 A;  5KVR A;  5LRR A;  3WTT C;  1FYK A;  5LRS A;  3IHU A;  2ESN A;  2XUB A;  3RI4 A;  5HLH A;  1SD7 A;  3JW4 A;  4A0Z A;  1JGS A;  1XDS A;  3MQ0 A;  4A6E A;  1G6N A;  4G6D A;  3HSE A;  2RNJ A;  3F72 A;  2Y48 A;  3KFW X;  4YFN F;  3C3W A;  3H3U A;  1F4K A;  3OV8 A;  4OMZ A;  2BE5 F;  5LHI A;  4AWX B;  4AIH A;  2ZNY A;  5FLX Z;  1F9N A;  5ICE A;  5JFR A;  1J59 A;  3WTY C;  2MA3 A;  1Z1D A;  1R7J A;  1B1B A;  2LKP A;  1TQP A;  1YTY A;  3BJ6 A;  1O3S A;  1HW2 A;  2FNP A;  3T8T A;  2BEO A;  4I0B A;  5IT3 A;  4E70 A;  2FBI A;  2IA0 A;  3VOD A;  5J8C A;  4RGR A;  1HSJ A;  3P9I A;  4N9I A;  3FWE A;  4GCV A;  1BM9 A;  5DCF A;  2G7H A;  2VC1 A;  1IZ1 A;  2J5O A;  5CVV A;  3K1M A;  2OU2 A;  2P6S A;  4M6Y A;  1T39 A;  3GO5 A;  3MAJ A;  2EA4 A;  2HWV A;  3HIF A;  1MKM A;  2E7W A;  3IRQ A;  4MEX F;  1SFU A;  2K86 A;  2W57 A;  1FX7 A;  5JHU A;  3QP5 A;  1T38 A;  3ABT A;  1DDN A;  1IW7 F;  2G7U A;  4KDP A;  2RV8 A;  4ENJ A;  2V1X A;  4CDG A;  4G9Y A;  3HRS A;  3FXR A;  3C1D A;  1UFM A;  4FHT A;  4KN7 X;  2Z3Y A;  1D5V A;  3ELK A;  2VT2 A;  4EQQ A;  3ZPL A;  1FY7 A;  5ICG A;  3BY6 A;  1XSX A;  3FM5 A;  4KIB A;  4M72 A;  1FBS A;  5AIP A;  1BOA A;  3RKX A;  1EH7 A;  4GYI A;  1FLI A;  3HOS A;  3V8J A;  4XBF A;  1QQI A;  5JVT A;  1IAW A;  1KA8 A;  2Z9O A;  4Q47 A;  2L54 A;  4XLP F;  3E6C C;  2VBX A;  3Q9S A;  5D6F A;  1ZG1 A;  3VFZ A;  2AXL A;  3EYY A;  3V4G A;  4RAZ A;  1ZAR A;  5L3B A;  1O3Q A;  2QEN A;  4HX7 A;  2PBI A;  2VE8 A;  2STT A;  2HR3 A;  5BS6 A;  5TJJ A;  3DQV C;  3F6V A;  2M8E A;  1FT9 A;  4YFK F;  1KU9 A;  1L3L A;  3DXJ F;  1XGS A;  5DUK A;  1WQ2 A;  3K0L A;  4LFU A;  2ZFW A;  5FLX K;  2H6B A;  3E6B A;  2C6Y A;  3QOP A;  1ZGA A;  2Y0M A;  3TQN A;  3LA7 A;  4O5V A;  2QLZ A;  2EA2 A;  5CJ9 A;  3TO6 A;  3L7W A;  4HAM A;  3G3Z A;  3PQK A;  1LJ9 A;  3DPL C;  2H27 A;  4BAY A;  2YX7 A;  2XAF A;  1U6G A;  2ACJ A;  2XKP A;  4IHS A;  3F8M A;  3GFM A;  4OIO F;  1KYW A;  2EFQ A;  4CIC A;  3F8F A;  2WWY A;  2ZBK A;  1XGO A;  5D5V B;  4H0E A;  5HLI A;  2V9V A;  1ZRC A;  4L9T A;  3SHF A;  3TO7 A;  4P9U A;  4FT8 A;  1O3R A;  3LQR A;  3E6M A;  1U5T A;  5DD4 A;  1HW5 A;  4L9N A;  4BH9 A;  3WTU C;  3WTV C;  1QGP A;  3N97 A;  2HYF A;  1IN7 A;  4MGR A;  1IRF A;  4OIP F;  1I5Z A;  5DDG A;  3E5X A;  1DP7 P;  4HYE A;  3CTA A;  3GVA A;  2ADU A;  5A2Q K;  1P2F A;  2R3S A;  3LFK A;  4LB6 B;  3CO7 C;  3CUQ B;  2UXN A;  1S6L A;  5F1R A;  3L00 A;  5E1X A;  4P55 A;  3D5L A;  3KP7 A;  3E6D A;  2WV0 A;  3GX4 X;  4EM0 B;  4IRH A;  4I98 B;  3EET A;  5E18 F;  1D8J A;  4MHG A;  3BJO A;  4HV5 A;  1G3Y A;  3CJN A;  3GUD A;  4UVA A;  2VBZ A;  1YG2 A;  5IT9 K;  1GXP A;  3C18 A;  2HTS A;  3HYI A;  2UZK A;  3T8R A;  4ZYD A;  4KIF A;  4R1H A;  1IUY A;  5BOX A;  4ESJ A;  2H6C A;  3NEU A;  5IT9 Z;  2DFI A;  1GVJ A;  1KQ0 A;  2V79 A;  2PFB A;  3E97 A;  3TOB A;  1S7A A;  2ELH A;  4XSX F;  5ILU A;  3WGG A;  5ED4 A;  2EFN A;  2FOK A;  1A04 A;  2A5Y B;  3QPT A;  2PLY A;  1SMY F;  2EJR A;  4UHT A;  3WG9 A;  1IXS B;  3HSR A;  2QUF A;  4EGY A;  5ICF A;  2XRN A;  4IHT A;  4HBL A;  4ZZL A;  2P5K A;  2QZ8 A;  4QWQ A;  5D5W B;  2V1D A;  3LAP A;  2XRO A;  1SD5 A;  3WTW C;  3ISP A;  1FSH A;  2O3F A;  2P8T A;  2F2E A;  5FD6 A;  1I27 A;  4ZYG A;  4XLN F;  1PDN C;  3TDZ C;  4KN4 X;  2FRH A;  2JZY A;  4BYY A;  3QRF F;  3ZMD A;  4Y13 A;  5HDK A;  1ZRF A;  1B6A A;  3BWG A;  2XAS A;  5BPI A;  1KGS A;  3V7S A;  3DFG A;  1ON2 A;  3F8B A;  3HSF A;  1G3T A;  2MLG A;  1KU7 A;  1B9M A;  1XSV A;  1YLF A;  2IA2 A;  3WE3 A;  3U2R A;  1G4D A;  1AWC A;  2DW4 A;  1J75 A;  4KNY A;  2O03 A;  1E2X A;  2JTV A;  3LQQ A;  3DPT A;  2ZME B;  1GXQ A;  3ML6 A;  1Z7U A;  1FPQ A;  1MJB A;  2XHK A;  3J81 K;  1K7A A;  2DI3 A;  2OAZ A;  3JAM Z;  1IRG A;  2NRA C;  4EJT A;  1STZ A;  3RJP A;  2EK5 A;  2IP2 A;  3M7G A;  1ZG5 A;  3COA C;  3JSP A;  2H94 A;  4HQM A;  1P4A A;  1OR7 A;  3PQJ A;  1KQ9 A;  4LB5 A;  4EMS A;  4GO1 A;  1HXD A;  2AS5 F;  2GA2 A;  1ODD A;  5K1Y A;  2K27 A;  4KYW A;  2PMH A;  4RB3 C;  2NNY A;  1FWZ A;  4R8H A;  2M1B A;  4B09 A;  1FP1 D;  1J9I A;  2DTR A;  3H92 A;  1Q1H A;  1F1Z A;  1I6X A;  5E1Z B;  4G94 A;  2L01 A;  1T6S A;  1WWX A;  2M45 A;  4HW0 A;  4PGH A;  4U7D A;  1U78 A;  5DEQ A;  4HV6 A;  1HKT A;  2FMY A;  2DAO A;  1EH8 A;  3FHZ A;  1FYM A;  1Z9C A;  1FYL A;  3LA2 A;  3HRU A;  2DU9 A;  3EUH A;  3J80 Z;  2LSO A;  5D5U B;  3GZ5 A;  3KP4 A;  1RI7 A;  2A69 F;  1K78 A;  3I53 A;  2EFW A;  2OQG A;  1H9G A;  2ZKZ A;  1LEA A;  2G9W A;  2P5L C;  2ZXJ A;  2PMU A;  1TQM A;  4LG0 A;  2GXG A;  2RC4 A;  3BJA A;  4KT5 C;  4EV0 A;  4L0Y B;  2DPU A;  3I64 A;  4D0P A;  1KYZ A;  2VN2 A;  3CUQ A;  4G7O F;  1W7P A;  5FD5 A;  3L09 A;  4CO8 A;  4KMU X;  3CDH A;  4RGS A;  3LST A;  4GXO A;  1D8K A;  1G3W A;  1Z6T A;  5L3E A;  1YS6 A;  3VEP A;  1K79 A;  2M87 A;  2K7L A;  2MBF A;  3BRO A;  3HHH A;  3BPX A;  3R6S A;  1LDK B;  4HDV A;  1QNT A;  3H3Z A;  4HDU A;  2YU3 A;  3MFK A;  2JPB A;  3KZZ A;  3F8C A;  3GZ6 A;  3FM3 A;  3RPQ A;  2CYY A;  2HTJ A;  5A2Q Z;  2ISY A;  4IJA A;  3KLN A;  1FZP B;  2XAG A;  1W4M A;  3K1P A;  3P9C A;  3ABU A;  2P7V B;  3TKY A;  1MD0 A;  3U1D A;  2WC2 A;  3I59 A;  5CYV A;  3F23 A;  3RPU A;  3BOQ A;  4HLX A;  4EJU A;  4I01 A;  4OIR F;  4M73 A;  2FF4 A;  5HDN A;  4Z2Y A;  2HZT A;  3FMR A;  2GXB A;  3ROU A;  1FNN A;  2A3S A;  3F22 A;  2CG4 A;  3ZN0 A;  3SZT A;  2QBY A;  1R1T A;  3QPH A;  4P5O A;  2BV6 A;  2O0Y A;  3O2P E;  1R23 A;  5DCM A;  1LVA A;  5CVU A;  4ESF A;  1R5H A;  2K4J A;  1FBU A;  1ZYR F;  5LHH A;  5FFX A;  3R4K A;  3LA3 A;  4B8X A;  4IF4 A;  2NS0 A;  5E1W A;  3ZMZ A;  2F5E A;  4WXD A;  3HHG A;  3V8L A;  3ZMU A;  3KLO A;  4UUV A;  3EDP A;  3FXQ A;  2DLL A;  4RGU A;  3REO A;  1LDD A;  3L2C A;  5F6F A;  2NYX A;  4I2O A;  5CVR A;  3I58 A;  1BI2 A;  2TDX A;  2XAH A;  4OOI A;  4YII A;  3K69 A;  2HKO A;  3FX3 A;  4L9V A;  2PQ8 A;  5D4R A;  1HKQ A;  4CHU A;  3VB2 A;  1BIB A;  2HEO A;  2FXA A;  3W6K B;  4WWC A;  1TLH B;  4LK1 F;  3MZH A;  2E1N A;  2QQB A;  5F64 A;  2VBW A;  2HDC A;  5JR3 A;  3ZMT A;  2Q2E A;  1OYW A;  4AIJ A;  4KIC A;  4WX9 A;  3SQN A;  1OKR A;  4CXF A;  2QQA A;  2IA1 A;  1YW7 A;  2IVM A;  4Q5S F;  4LJZ F;  4LK0 F;  1MGT A;  3GWZ A;  3RDI A;  2CGP A;  2Q0O A;  2J5P A;  1I1S A;  5CLS A;  3V8K A;  4CYD A;  1YS7 A;  3U9G A;  1XD7 A;  2K02 A;  4UVC A;  2VOD A;  2JSC A;  3R0A A;  4I02 A;  5E8G A;  2CW0 F;  4IVN A;  5ICC A;  2KJB A;  2IJL A;  5LGT A;  1UB9 A;  1RIO H;  5CVJ A;  1XGN A;  4MTE A;  4LG0 B;  1TTY A;  1HW1 A;  4MQ9 F;  5LEJ A;  4P9F A;  5H20 A;  3WTX C;  2YX4 A;  4HF0 A;  5D5X B;  4ENN A;  4A0Y A;  2JRT A;  1R36 A;  4DNC A;  4QLC U;  4HZF A;  1ULY A;  4NQW A;  1SAX A;  2HS5 A;  3R0J A;  4A6D A;  3KEO A;  3NQO A;  3QP6 A;  5H6R A;  2DQL A;  1B59 A;  2Z5U A;  4M6X A;  2XV4 S;  4OIQ F;  1ZG3 A;  4U7B A;  2LDU A;  1JHH A;  1Z91 A;  2VOO A;  4O6J A;  1FP2 A;  1XSD A;  3VOE A;  4P96 A;  1OMI A;  2HQN A;  2VBY A;  3CUO A;  1LNW A;  5D4S A;  2DT5 A;  5LGU A;  1WSU A;  1WKM A;  3TOA A;  3HTU A;  5DYM A;  2OBP A;  1H0M A;  5BQT A;  1KU3 A;  5HS9 A;  4YIF A;  3OOP A;  5L3D A;  4I0A A;  2D1H A;  4A12 A;  4LLG F;  1LDJ A;  5TRD A;  1TW3 A;  3ECH A;  1ZLK A;  2GQQ A;  4Q4Z F;  4L18 B;  5HS8 A;  5BMZ A;  3J81 Z;  1E17 A;  1QZY A;  3F21 A;  4U0Y A;  1ZGJ A;  1P92 A;  2DK8 A;  3HRT A;  1TQI A;  1BBY A;  4ON0 A;  1CF7 B;  2GA1 A;  5H6Q A;  2ZNZ A;  3RYR A;  1OYY A;  1AOY A;  2ISZ A;  2RKH A;  2M30 A;  5D8K B;  2FU4 A;  5HOO A;  3P9K A;  2DO7 A;  3M8E A;  4U0W A;  5LEK A;  4HF1 A;  3I54 A;  1X3U A;  2V1U A;  1IF1 A;  3N4M A;  2QBY B;  3WTZ A;  2HKX A;  2L4M A;  5DV5 A;  3J7A O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...