3F21A

Crystal structure of zalpha in complex with d(cacgtg)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
67
structure length
67
Chain Sequence
LSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific adenosine deaminase
publication title The structures of non-CG-repeat Z-DNAs co-crystallized with the Z-DNA-binding domain, hZ{alpha}ADAR1
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f21A00
3L9FA 5FB2A 3F6OA 3DEUA 4G94A 5L3GA 1MDMA 4P96A 4NB5A 1S6LA 2CWEA 1HQCA 3D5LA 2F5CA 2PMUA 2Z5UA 2WC2A 5LGNA 4A12A 4IHSA 5LEKA 1HKQA 1UFMA 2XAFA 3KP4A 4Y13A 2HYGD 3GFMA 3LQRA 2JZYA 3MZHA 5EEHA 3L00A 3V7CA 1RI7A 1VTNC 3NQOA 1XSDA 2ESHA 2C6YA 1Z1DA 2FNPA 5BOXA 1OPCA 3ZMSA 3FXUA 5E8GA 2FF4A 4AD9A 1XGNA 1FNNA 3JSPA 3GFJA 4JBAA 3ZQ7A 2ADUA 3HRTA 3CUQC 4MTDA 3OOPA 1V3FA 3ECHA 5HS7A 3F8MA 4CO8A 1XDUA 1LQ1A 3NEUA 3GO5A 1BIAA 2M45A 5HVQC 1FSHA 2PBIA 4LLNA 2V79A 4Q4ZF 2STTA 4A5MA 1RIOH 2VE8A 4QLCU 4CHUA 3PQJA 3FMRA 3DP7A 5K1YA 1QGPA 2FEZA 4WXDA 3V7SA 2RNJA 1XMAA 1GXPA 1FP2A 4ZYEA 4P55A 4Q5SF 1IW7F 1XMKA 4Z2YA 1S7AA 1W7PD 3LAJA 3KE2A 3HHGA 2NS0A 3K0LA 1OKRA 5IT3A 2VC0A 2EFNA 3HHHA 3KLNA 2JTVA 2GAUA 2VN2A 2MBFA 2ZMEB 4EV0A 2JPBA 2V1DA 3DPTA 1QNTA 1LEBA 1TW2A 4KIGA 5D6EA 4TV7A 4OIPF 3CO7C 5E1XA 2IPQX 1ONVA 1R23A 2LNBA 4CZZA 1FX7A 4G9YA 4RGXA 2OBPA 2PEXA 3DPLC 2R7FA 5LLQA 1RNLA 2A6HF 3HSEA 2XAHA 3MCZA 5D5WB 1BI1A 3K69A 3C18A 3I58A 4RGUA 1BC7C 1LDKB 2HR3A 5L3EA 4KMUX 1TLHB 2PQ8A 2EFWA 2ZKZA 1D5VA 4U0WA 1KQ9A 4NHJA 2IA2A 4AWXB 2VC1A 1KQ0A 3RI4A 3KP5A 1GHCA 2O0YA 2FBKA 3ZP5A 1RUNA 2NRAC 2F5EA 4GO1A 3FM3A 1TQIA 3JTGA 2KRFA 3T5XA 4RB1A 4R79A 2ACJA 3EETA 3VODA 5FD6A 1ZG5A 2V1UA 3TDUC 3RIRA 2PMHA 2D1HA 2ZJ2A 2NAZA 2PFBA 3F21A 5LHHA 2F5DA 3GZ5A 2Q2EA 4A0XA 3H92A 3LAPA 3I4PA 1Z6TA 4I98B 4M9SA 5ERIA 3GFIA 4U0VA 1FYKA 1ZARA 3WGGA 4ENJA 1XGMA 1UB9A 1J75A 2FXAA 1SMTA 3I59A 3KFWX 2RVCA 4Q47A 2KIUA 2V6CA 4KICA 3FXQA 4EGYA 1EV7A 4I0AA 3GF2A 4CXFA 5LRSA 2GWRA 3L09A 3DXJF 3K9TA 3W6KB 4EJOA 4UVAA 3N97A 2VODA 4ESBA 3FWEA 1MDMB 3RKWA 1U8RA 3SZTA 1HW5A 3QPHA 4L9NA 3IWZA 2K4JA 5LGUA 3V8LA 3J81Z 2L01A 1TNTA 1S3JA 1P4XA 1USSA 2E1CA 1T6SA 1F4KA 5CVJA 2QM3A 4F7ZA 3JW4A 2W25A 2GXGA 1YTYA 1U3EM 4YFNF 3MAJA 1TW3A 2M5WA 1P6RA 5L3FA 1G3SA 1XGOA 1YQAA 2EFQA 3ZMVA 3ZN1A 2MH2A 1FBQA 1A04A 2RN7A 3WTXC 1ZLKA 2PI0A 2EFPA 3KP2A 5HLHA 4HAMA 5DCMA 4I2OA 2LSOA 4UUVA 4HLYA 3SXYA 1I1SA 3BZ6A 2XGXA 3BY6A 5AIPA 2A69F 1H0MA 2NNYA 2GIVA 2O03A 3PQKA 5TJJA 4WK8F 1P92A 1XB4A 3E6MA 4B8XA 1FPQA 3S2WA 1T2KA 4U7DA 1X3UA 3U2RA 3FXRA 3EUHA 4A2UA 2Z33A 2IA0A 2LF8A 4OMZA 2EV6A 2R7DA 1FYLA 3Q5FA 1O3SA 1FP1D 2DK8A 2CFXA 1HKTA 4ENMA 4KNYA 1R1TA 1YIOA 1MZBA 4P5OA 3R6SA 3J7AO 4GXOA 4LB6B 4LK1F 4PGGA 5IT9K 1TQPA 2VOPA 2GXBA 4IRIA 1MJAA 1IN7A 3FMSA 2BBYA 1OR7A 2FNAA 4HA8A 1W4MA 3HSRA 3EYYA 3ABUA 4KIBA 1BI2A 2MLKA 1U5TC 4XRFA 4EM2A 3FHZA 5BMZA 2HTJA 3E5XA 3GZ6A 4HQEA 1KYZA 4DQ2A 2OD5A 1W5TA 2D2WA 2P6SA 4G6QA 1O3QA 5FFZA 2CGPA 4PGHA 4M6YA 4EM1A 5F64A 1YYVA 3M8EA 5KVRA 5JI6A 3FF5A 1IN8A 2YR2A 3HRUA 1BIBA 2JSCA 1YG2A 1LEAA 5DD8A 3EYIA 1U78A 4U88A 1XN7A 4ASNA 2ZBKA 1JXSA 1DPRA 1K79A 3COAC 1ZHFA 3F6VA 3KZYA 1YS7A 2IT0A 5DUIA 2KIFA 1D3YA 4EVIA 1R1UA 2EA4A 3QPTA 3T0YA 1HW1A 1F9NA 5ED4A 5DDGA 3HYIA 4ESJA 5F1RA 2OA4A 5FGMA 1PUEE 3KP6A 3GVAA 4A0ZA 4HX8A 2WTEA 5J8FA 2P5KA 2DTRA 3HUGA 4WCGA 1WKMA 1REPC 2BGCA 4IVNA 3RYRA 3E5QA 1XSVA 4O6JA 4AIJA 2DPUA 1FC3A 4L5JA 2RV8A 1PP7U 2HOEA 2HEOA 5E1WA 3W6JB 3BOQA 2P6TA 2PG4A 2QVOA 4LD5A 3WTZA 3K2ZA 4Q48A 2XHKA 1P4AA 2VBWA 2X0LA 4N0BA 4LFUA 5H6QA 2QBYA 1K78A 1SD5A 3VB2A 1G6NA 4XBFA 2QQ9A 3AAFA 4FX0A 4M9ZA 2XUBA 1MKMA 1Q1HA 1XCVA 5JFRA 3LSTA 3E6DA 3EDPA 3KCCA 2GA1A 4ZZLA 2H94A 1KQ8A 2EV5A 4CYDA 4M73A 2OQGA 4IXAA 2M1BA 3ELKA 4BH9A 2EFOA 2QQAA 1YLFA 4YFKF 1TNSA 3ZPLA 5LRRA 5DD4A 5DCFA 4KFCA 1UHMA 3TGNA 4HQMA 1BBYA 1K6OA 3OV8A 1FBUA 1Z9CA 1ZH5A 1ZRFA 2XAQA 5DCMB 2YU3A 3TO6A 3ABTA 2JPCA 5LHIA 1KA8A 2XROA 2DAOA 3E3VA 2ZNZA 4MQVA 3V8JA 2ZCWA 4IRGA 1K7AA 1ON2A 4IF4A 2D45A 1LVAA 1MJBA 3DFGA 1E2XA 1B6AA 5FFXA 1KYWA 3T1BA 3WTVC 3O6BB 3P9KA 3BJAA 1QZYA 3C1DA 1AOYA 2KIMA 2CYYA 4BAYA 3F22A 3DF8A 3RYPA 3CDHA 2VOOA 3CJNA 3JAMZ 4YG2F 2VBXA 4L18B 1U2WA 2ISYA 4CGZA 3HOTA 1JHFA 2STWA 4D0PA 1H9GA 1IN5A 1BC8C 4H0EA 2DLLA 2YSRA 4E70A 3N4MA 1IAWA 3J81K 1R5GA 3QRFF 2KJCA 3RJPA 5ILUA 1O3TA 4L9TA 3B02A 4OMYA 1B9MA 1Z7UA 5K5RA 5LEJA 3WGIA 2MD5A 5EEGA 4KN4X 1Z6RA 1EH6A 3GUDA 2FA5A 1BN5A 3ML6A 1SAXA 1IXRC 1L0OC 2P5LC 1R22A 4OIRF 3LFKA 4PDKA 1MGTA 1B4AA 2VT3A 4CDGA 4HLXA 1KU9A 4U0YA 4I09A 2FSWA 5LBQA 3RPQA 5KK1A 3QU6A 1S7OA 1UCRA 2FQ3A 3IWFA 4KA4A 2XIGA 5HS8A 5L3BA 4QWQA 2XASA 1YFHA 2MLGA 3I53A 4WWCA 5LGTA 4MEXF 1MJ9A 4UHTA 4ESFA 3R0AA 1T39A 2DI3A 2Z99A 4WX9A 3CUQA 4AIHA 1BI0A 1O7LA 2P4WA 2HKOA 4EJUA 1J59A 3ULQB 1ULYA 3I54A 1WQ2A 3RTRA 2EB7A 1ZYRF 1EH7A 4MTEA 1FYMA 3JSOA 3BP8A 1BOAA 4UXNA 2RQPA 3M1EA 2YX4A 4ZH4F 1R36A 4M9XA 4S05A 2F5FA 3QOPA 1RUOA 2IA1A 1L3LA 2G7UA 3TKYA 5TRDA 1K78B 1G4DA 2Y75A 4EMSA 1JGSA 3TO7A 4OINF 2QQBA 5E1ZB 2J5PA 3WTUC 1YW9A 3BWGA 2VBYA 2W24A 5JHUA 1PP8F 2O3FA 1R5HA 3C7JA 3WODF 3JTHA 3WTYC 4EM0B 1P2FA 3K1PA 1O3RA 2OZ6A 4L0YB 1G3YA 2TDXA 5HS9A 3QU3A 2VT2A 1IUYA 1B9NA 2J5OA 2K86A 5D8LB 5DV5A 3F72A 4XSXF 2OAZA 5CJ9A 2MH9A 3K1MA 5FD5A 2RDPA 3MFKA 3FMQA 2O8XA 2VE9A 2X4HA 1B1BA 1UHWA 1Z05A 3KP3A 3HRMA 1F5TA 3F23A 4KT5C 4GYGA 3DV8A 5DEQA 2Y0MA 3GFLA 2QYOA 3IRQA 4N9HA 2W84A 3R4KA 5JVTA 5ILSA 4KUMA 5CYVA 1ODDA 3E5UA 4ZYDA 4A5NA 4OIQF 3ZMUA 1LNWA 2EA2A 2EJRA 3IL2A 3F8NA 4AIKA 1GVJA 3QP6A 1BJAA 1I6XA 4U7BA 1S8NA 5E18F 1SD7A 4HZFA 2K27A 1BI3A 4EJTA 1HXDA 2IJLA 2JT1A 4I7HA 4KN7X 3RPUA 3MWMA 3LWFA 2BV6A 4CICA 4HDVA 2E7WA 3ZMTA 5AONA 4PZJA 5L3DA 4O5VA 2AXLA 5HDGA 1DUXC 1NHAA 2QUFA 4M6XA 3E6CC 1I1GA 3H3UA 3WG9A 2PN6A 3R60A 2H09A 5D6FA 1TTYA 1BM9A 2IRFG 4I01A 3ZN0A 3KZZA 2B0LA 3T8RA 1XD7A 1I5ZA 1FZPB 5A2QZ 2L02A 4R8HA 3TQNA 4B09A 4BNCA 2V1XA 1TQMA 2ETHA 4KDPA 3QP5A 2VBZA 2CG4A 4BYYA 1DPUA 4MNUA 1H9TA 5LHGA 3I5UA 2OQRA 2P8TA 3WE2A 4RB0A 4OU0A 5D4SA 2MC3A 4LJZF 1ZGAA 3BJOA 2OZUA 3E6BA 1S29A 3F8CA 3WE3A 4MQ9F 1HW2A 1R1VA 2XAJA 2HWVA 3BDDA 5HDNA 4AVPA 2QENA 2HQRA 1SD6A 3JAMK 4ENNA 1FWZA 2DW4A 2FMYA 4HDUA 2F2EA 5ICFA 2Y48A 2L54A 2DT5A 2ZNYA 4L5IA 3SHFA 3GEZA 5HDKA 3J80Z 3I59B 4IPAA 3NRVA 4N9IA 4M72A 5E8IA 1GXQA 3BPVA 1WWXA 4LG0A 3CUQB 2HGCA 2BYVE 1JHHA 1DDNA 4L9VA 5D5UB 2A07F 1G3WA 2BE5F 2RKHA 4HV6A 3KP7A 5D8KB 3WGHA 3GX4X 1HKSA 2P7VB 3LA7A 4RB3C 3KETA 1OMIA 4HF0A 3MQ0A 4YFXF 3TOAA 4G7HF 2DQRA 1J5YA 2XVCA 2FMLA 4Y15A 4HF1A 1Y0UA 1EH8A 3BJ6A 3L2CA 2L4MA 3DQVC 2RC4A 2BEOA 1XSXA 5BPIA 4HX4A 1T98A 2H6CA 3TO9A 3VOEA 1ZREA 4EGZA 4UVCA 3D0SA 3HTUA 2E7XA 3CUOA 2K02A 1QBJA 1U5TA 3CO6C 3L7WA 3K1NA 1FT9A 4GGGA 1JE8A 2LKPA 2R3SA 3Q9VA 3FX3A 4HX7A 1P4WA 2HYFA 4KYWA 1J7KA 4RB2C 1PDNC 2E1NA 3U1DA 4M71A 3IC7A 1KU3A 4HOBA 1IZ1A 1ZLJA 5HLIA 4ZYGA 1O57A 2CQKA 2HZTA 5E20A 2PLYA 3HTSB 1ZGJA 1R58A 5K5OA 2CO5A 3SFZA 3G73A 2QZ8A 4O3MA 2XKOA 3ZMZA 3REOA 2CW0F 2VXZA 1D8JA 1DP7P 1LDJA 3ECOA 2FOKA 5ICGA 4RAYA 1G3TA 3EQLF 1XCBA 1WRJA 4BXUA 3CTAA 2Z3YA 4ZYHA 1D8KA 1OYWA 2JRTA 3IHUA 2Q8KA 4BHPA 2K4BA 4G7OF 4Y17A 4P9FA 1MD0A 3F8FA 2HKXA 1WSUA 2HS5A 4LGWA 3R61A 2IW5A 5FLXK 5F6FA 2UZKA 4UV8A 2UXXA 4HYEA 3LQQA 3LA3A 1T0FA 4DNCA 2ISZA 3RDIA 1QQIA 2P7CB 2Z9OA 2FU4A 4EQQA 5D4RA 1U6GA 4LLGF 1ZRDA 2XV4S 3VFZA 1FBSA 2FRHA 5ICCA 5DUKA 3GWZA 5E17F 4XLNF 3ERED 5J8CA 2M87A 2XAGA 3PFIA 3R0JA 2Q0OA 4LK0F 2ELHA 3KLOA 1ON1A 4L0ZB 4JQFA 1QZZA 4IJAA 3FZVA 1XGSA 2FBIA 4LMYA 1J0RA 4I02A 5CVUA 2COMA 2UXNA 4MHGA 4I0BA 4A6EA 1IF1A 1AWCA 1IN4A 4G8XA 1CF7A 4G6DA 4RGRA 5L3CA 5BPDA 3I64A 3IKTA 3KEQA 3ZMDA 1T38A 2LF7A 3ISPA 1Z91A 5K5QA 5CVIA 3BROA 1SFUA 1HBXG 1USTA 1LJ9A 5BQTA 1WI9A 5ICEA 1IXCA 2P5VA 4HV5A 4WF2A 3O2PE 5DYMA 2A3SA 1F1ZA 2DO7A 2HDCA 1W7PA 1ZG3A 3QAHA 2H6BA 5CVVA 4IRHA 3P7NA 3RKXA 4LG0B 3VEPA 4LB5A 1O7FA 2A6EF 4UV9A 5HLGA 3IKVA 4EJVA 5AIQA 4L9JA 3I71A 1IXSB 4JK1X 3FM5A 3WU0A 2QBYB 3Q9SA 3WTSC 3ROUA 4XSZF 4A6DA 5A2QK 5FLXZ 5HOOA 2YX7A 4KMFA 1J9IA 2K7LA 1C0WA 4RGSA 3IRRA 4EJWA 3V4GA 3HSFA 2W57A 1YW7A 5D5XB 4NQWA 1OYYA 3GLXA 4A0YA 5JR3A 4RS8A 1YS6A 2OU2A 3O3KA 1SFXA 4HBLA 3LA2A 4FT8A 1LDDA 3G3ZA 3WTTC 3HOSA 2KKOA 2ZXJA 1U5TB 2L4AA 1W5SA 1SD4A 3F8BA 1OYIA 3MZYA 4YIFA 1IRGA 2WWYA 3I0TA 3TDZC 2KJBA 1STZA 1ZRCA 4UVBA 2DPDA 2FBHA 2PJPA 4ON0A 4HF2A 4S04A 3J80K 1ZG1A 5D5VB 3DKWA 4R1HA 4BHBA 1V4RA 4PCQA 2M30A 2YPRA 2RGVA 2HFHA 2EK5A 2W85A 1YO5C 1HSTA 4YIIA 3GXOA 3WTWC 2ZMEA 6PAXA 2NYXA 4FHTA 4BHCA 1ZN2A 2DQLA 1SFEA 2EWNA 1J2XA 4P9UA 1IN6A 1IRFA 2DK5A 2VONA 3V8KA 3BPXA 3H3ZA 2A61A 2A68F 2NNNA 1YW8A 2IVMA 1RZ4A 2GA2A 3SQNA 5ILVA 2DBBA 2CSOA 3HIFA 4BQAA 3M8FA 2GQQA 3C3WA 3TOBA 3E97A 1FLIA 4OOIA 3MEXA 5CLSA 1B59A 4ENKA 4G7ZF 2XRNA 1FSEA 4FX4A 3M9AA 2V9VA 5H20A 3P9CA 5CVRA 1R7JA 3HRSA 2A5YB 1SMYF 4WXCA 4UNOA 3V7RA 3M7GA 4KIFA 1QO0D 2QLZA 1KU2A 4M74A 3SZPA 5FO5A 2HQNA 3CLOA 1ZAOA 2HTSA 1KGSA 2XKPA 3RKYA 4GYIA 4OIOF 5J6XA 1CF7B 1TBXA 4ETSA 3WU1B 2O6GE 2DFIA 2L3DA 2MA3A 4WXHA 2ZFWA 1LB2A 2IP2A 2ESNA 1HSJA 4LLLA 2M8EA 2G7HA 4IHTA 1I27A 2D1VA 2G9WA 4K2EA 4RAZA 1E17A 3F3XA 1R00A 1XDSA 2LDUA 2GZWA 5BS6A 3T8TA 2DU9A 3GW2A 1W7PB 2QWWA 1QPMA 2ZO4A 1CGPA 1FY7A 4ZZDA 4HW0A 2WV0A 5H6RA 4MGRA 1KU7A 3P9IA 2AS5F 3KEOA 3U9GA 2FE3A 4MEYF 2O61A 2UWMA 3B73A 4XLPF 2EV0A 4GCVA 5IT9Z 3GYHX 1FOKA 2H27A
chains in the Genus database with same CATH superfamily
3L9FA 1LPQA 1Z67A 1WCMJ 2QQ8A 5FB2A 4PFPA 3F6OA 2X6YA 3DEUA 4G94A 5L3GA 1MDMA 2KDZA 1VFCA 1OCTC 4XRSG 2K5CA 4P96A 2HOAA 1GVDA 4NB5A 3CESA 3S14J 1S6LA 5CPRB 3H36A 3N05A 2CWEA 3O8GA 1HQCA 3D5LA 2CUEA 5EGOA 2F5CA 2PMUA 4I6ZA 2Z5UA 2WC2A 5LGNA 2M2EA 4A12A 2E1MC 4IHSA 5IOZA 5LEKA 3ZQLA 3GTLJ 2R7UA 1HKQA 1UFMA 2XAFA 2CQ7A 3KP4A 4Y13A 2X1EA 2HYGD 4YIRX 1VQMI 3H1CA 2ZSIB 3GFMA 1DU6A 1K4TA 2EIJH 3LQRA 3PNTA 2JZYA 3MZHA 5EEHA 3L00A 3V7CA 1RI7A 2X9DA 1VTNC 3NQOA 1XSDA 2ESHA 2C6YA 2CQNA 1Z1DA 2FNPA 5BOXA 1OPCA 4NQWB 3ZMSA 2XB0X 3FXUA 5E8GA 2FF4A 3OIOA 1JKRC 4AD9A 1XGNA 1FNNA 3JSPA 1D5YA 3S2DJ 2IS2A 3S17J 3GFJA 4JBAA 3ZQ7A 1N25A 2ADUA 5FKLA 3HRTA 3CUQC 3H0DA 4MTDA 2HVRA 1YRNB 3OOPA 5HLTA 3CCVI 1V3FA 3ECHA 3DWLE 4D5CA 4XM3A 2XC7A 5HS7A 3F8MA 2XF5A 3A01B 4CO8A 1VF9A 1XDUA 1VQKI 1LQ1A 4BBSJ 3NEUA 1A31A 4M3GA 2DA5A 3GO5A 1BIAA 2LY1A 2M45A 4CUGA 1W5CC 1AKHB 5HVQC 1FSHA 2PBIA 4LLNA 4BBRJ 2V79A 3FXLA 3HPGA 3K4KA 3GMEA 3H5NA 4Q4ZF 3L2VA 2STTA 2R7XA 4A5MA 4HNTA 3HDDA 1RIOH 4QTRA 3FXJA 2VE8A 4QLCU 1T33A 4CHUA 2JA6J 3PQJA 3FMRA 3DP7A 4CCNA 5K1YA 1QGPA 2FEZA 2R93J 2OCEA 4WXDA 3V7SA 1W36D 1TC3C 2RNJA 2QGUA 1XMAA 1GXPA 1FP2A 4ZYEA 1UZCA 4P55A 4Q5SF 4E4HA 4I76A 1IW7F 1XMKA 3PFYA 4Z2YA 1S72I 1S7AA 4JYKA 1W7PD 1ERDA 2Y31A 3LAJA 4IZZA 2PMZA 4B1RA 3KE2A 2DA7A 3MN2A 3HL2A 3HHGA 2NS0A 3K0LA 4X0GA 4FE4A 5CQGA 1OKRA 5DM6F 3PL8A 5IT3A 2VC0A 1X4PA 3OOUA 2EFNA 3P5JA 3HHHA 4DBRA 3KLNA 2W82A 2JTVA 2GAUA 2VN2A 2Y0SN 5K7FA 3DKYA 4AYBN 2MBFA 2VKDA 1T8IA 5M5WJ 1VQ4I 2ZMEB 1BR2A 4EV0A 1X1PA 2JPBA 2V1DA 3JREA 1WJFA 3DPTA 1QNTA 1LEBA 1TW2A 2IGOA 4KIGA 3AL0B 2HU9A 5D6EA 1JTXA 4TV7A 4OIPF 2E60A 2W48A 3CO7C 2ZFUA 5E1XA 2V9PA 2IPQX 1ONVA 3EUHC 1R23A 3W2WA 2CH0A 2DDAA 1FTTA 4X1EA 2LNBA 4CZZA 1FX7A 4G9YA 4RGXA 1FOYA 4Y4RA 3A0HC 2OBPA 3I56I 2PEXA 1R6RA 1RR7A 2PJRB 3DPLC 1D0XA 1D1CA 3AG2H 2R7FA 4KJZA 1NK3P 5LLQA 1RNLA 2A6HF 2LP0A 3HSEA 2XAHA 3MCZA 2WB1A 3TMOA 4LIVA 5D5WB 5DM7F 1BI1A 2ZC2A 3E1SA 3K69A 1RPWA 4CCKA 3C18A 3GLLA 4F92B 5CKTA 1XG1A 3I58A 4RGUA 1YX3A 2V4JC 1LDKB 1BC7C 5HNFA 2HR3A 3OS2A 5L3EA 4KMUX 5GADJ 1TLHB 2LK2A 2PQ8A 2EFWA 3VSLA 2ZKZA 1D5VA 1F43A 3PUBA 5EF6A 4U0WA 1KQ9A 4NHJA 2IA2A 3ASOH 2IAIA 3S93A 4AWXB 2JMWA 2VC1A 5GAHJ 1KQ0A 3RI4A 3KP5A 1GHCA 1IDYA 1OCRH 2O0YA 2FBKA 1YX5A 1EJ9A 3ZP5A 1RUNA 5GPAA 2NRAC 2F5EA 4GO1A 3FM3A 1TQIA 3KX2A 1RKWA 3JTGA 4GFBA 2KRFA 3T5XA 4RB1A 1Y6IA 2DTZA 2KLOA 3BZKA 2VB6A 3PIPF 4ZYAA 1UG2A 1YIJI 1QU3A 4BXFA 3B6AA 1LFPA 1TWFJ 4R79A 3M8JA 2ACJA 3EETA 3HJEA 3OYBA 3VODA 5FD6A 1ZG5A 1XS9A 2V1UA 3S1MJ 1JTYA 3TDUC 3RIRA 5J47A 1JGGA 1WJAA 2ZJQF 1VQ6I 3VYTB 1VQ5I 1FOWA 2PMHA 1LUJB 2D1HA 4A3EJ 1VQ8I 2ZJ2A 3S1NJ 2NAZA 1MMGA 2PFBA 3QYFA 3F21A 1MMSA 3FKIJ 2XPVA 2BY1A 5LHHA 1R49A 4D1QA 2F5DA 3GZ5A 3A03A 2R7WA 2Q2EA 4A0XA 3H92A 3LAPA 4F93B 3I4PA 1Z6TA 2XAUA 4I98B 1I6HJ 2X1DA 4M9SA 2G0EA 3NAUA 1QHHD 5ERIA 3GFIA 4U0VA 5E3NA 1FYKA 1ZARA 3WGGA 2XPUA 5JLXA 4ENJA 5E3LA 1VI0A 1XGMA 1UB9A 4CCMA 1J75A 4PUSA 2FXAA 1SMTA 3I59A 3KFWX 2RVCA 4L5EA 2DFFA 4Q47A 3V42A 2UV1A 2KIUA 3SYTA 2V6CA 4KICA 2V6EA 3FXQA 4EGYA 1EV7A 1IUFA 4XORA 4I0AA 3GF2A 1R4MB 3ZQFA 3PO2J 2LC2A 2LYCA 1UELB 1MBFA 1A35A 2CV0A 4CXFA 4A3MJ 5LRSA 1OLTA 3OYIA 2GWRA 1GDTA 2D5VA 3KZIC 3L09A 2M0MA 3FISA 2JN6A 5EG0B 3OYNA 3DXJF 3K9TA 3W6KB 4EJOA 4UVAA 3N97A 2L0KA 4B44A 2VODA 4ESBA 3ABLH 3FWEA 1TWGJ 5HNHA 2X51A 3RKWA 1MDMB 1BR1A 2HQ5A 4JX6A 1U8RA 3SZTA 1HW5A 3QPHA 4L9NA 1IDZA 3IWZA 4BXXJ 1IJWC 2K4JA 5LGUA 2GXAA 5EGOB 2FX0A 3V8LA 3IAM2 3J81Z 2O5RA 3FK6A 1A36A 2L01A 1TNTA 1S3JA 1P4XA 4XLAA 1USSA 2E1CA 2QSGX 4BE0A 2MGQA 1T6SA 1F4KA 1JKQC 5CVJA 1E3OC 2JK3A 2QM3A 4F7ZA 3JW4A 2W25A 2RAEA 5TGTA 3I55I 2GXGA 1WJDA 1YTYA 4M6VA 1U3EM 4YFNF 3MAJA 3ZQQA 5FLMJ 1TW3A 2M5WA 1P6RA 2VPLA 5L3FA 2DCEA 1G3SA 1XGOA 4CH7A 1YQAA 4N4NB 1ZQ3P 1AA7A 2EFQA 3ZMVA 3ZN1A 2MH2A 1WJ5A 2BZTA 1FBQA 2L7KA 1A04A 2RN7A 3WTXC 1ZLKA 2PI0A 4F52A 2EFPA 1MBJA 3KP2A 5HLHA 4HAMA 5DCMA 4I2OA 2LSOA 4UUVA 4HLYA 3SXYA 1I1SA 3BZ6A 3VYRB 2XGXA 3BY6A 5AIPA 3U1KA 1XMXA 2A69F 1H0MA 2NNYA 2GIVA 2O03A 2Y9ZA 2W1OA 3PQKA 5TJJA 4WK8F 1P92A 1XB4A 2M3AA 4DBQA 3E6MA 3BG9A 4B8XA 2CRGA 1FPQA 3S2WA 5IOYA 1T2KA 1HLVA 4U7DA 1X3UA 1TL8A 3U2RA 3A02A 3FXRA 3EUHA 1MIJA 2DMUA 4A2UA 3GTKJ 3I3LA 2Z33A 2BVLA 2IA0A 2IGMA 2LF8A 5J1UA 4DYCA 2HNHA 4KITB 4OMZA 2EV6A 1OCPA 2R7DA 3GTJJ 1FYLA 3Q5FA 1O3SA 3BQYA 1FP1D 1KONA 2DK8A 2CFXA 2DYSH 1FOXA 1HKTA 2JSPA 5FKKA 4ENMA 4RLFA 4KNYA 4U87A 1R1TA 3JRGA 1YIOA 3CJRB 4XK4A 1MZBA 2R7ZJ 4P5OA 4Y52J 3HGGA 1WZ2A 3HKZN 3R6SA 2O9LA 3J7AO 3TBIA 3BTIA 4GXOA 4LB6B 4LK1F 2LD5A 4PGGA 4BY7J 1LE8B 2KPMA 5IT9K 1TQPA 2VOPA 2GXBA 2BY0A 1MJAA 4IRIA 1IN7A 3FMSA 2BBYA 1OR7A 2FNAA 4HA8A 1W4MA 3HSRA 3EYYA 3ABUA 4PFOA 2F4IA 2H1KA 2O8KA 4KIBA 1BI2A 2BW3A 1MNDA 3DEEA 1U5TC 2DA4A 2MLKA 4XRFA 5GPCA 4EM2A 5EEAA 3FHZA 4E7HA 2NVXJ 2WAFA 2R0QC 2DXIA 5BMZA 2HTJA 4XIDA 3E5XA 1POGA 3GZ6A 3JRCA 4HQEA 1KYZA 4JX4A 4DQ2A 2WAQN 3ZRGA 3OYDA 2OD5A 2ZSHB 5K7HA 3CMEI 2BHYA 1W5TA 2D2WA 4QIWN 5IYBJ 2P6SA 4G6QA 3IH2A 3IH4A 5FFZA 1O3QA 2NOJB 2CGPA 4RMNA 2DOEA 4PGHA 3L2QA 2JVHA 3A1YA 3OS1A 1NH3A 4M6YA 4EM1A 5F64A 4IKFA 2A05A 1YYVA 3M8EA 5KVRA 5JI6A 1R4NB 2ZXHA 3FF5A 2DOFA 2M7AA 3CCLI 1IN8A 2LVSA 2YR2A 2GOXB 3DLAA 4XOTA 3S8PA 3HRUA 1BIBA 3QYBA 2JSCA 3S1RJ 1NG7A 2JRMA 3HPHA 1YG2A 2AQFA 1LEAA 1GV5A 5DD8A 3EYIA 1U78A 2X6XA 4U88A 1XN7A 4ASNA 2ZBKA 2AHQA 4A3CJ 1JXSA 1UHSA 4C2MJ 4Z6YA 1DPRA 1U9OA 1ZK8A 1K79A 3ONQA 4B43A 3COAC 1HF0A 2M0CA 1ZHFA 1ETOA 3F6VA 3KZYA 2HPIA 1YS7A 2M7BA 2VIXA 4RAGA 1JJ8C 3S2HJ 2IT0A 5DUIA 2KIFA 1D3YA 1JUMA 2BVMA 4EVIA 3J7AY 1R1UA 2EA4A 3QPTA 1SVMA 2BXYA 3T0YA 4B4CA 1HW1A 1F9NA 2ECBA 1WHUA 5ED4A 2KL4A 4XN3A 5FRMA 5DDGA 3HYIA 4UUSA 4ESJA 2XSDC 3MKZA 1VZ0A 5F1RA 3S16J 2OA4A 1T0FC 1AHDP 2BY3A 2E1OA 5FGMA 3ZCOA 3AFHA 1PUEE 3TL4X 3KP6A 3GVAA 1K4SA 4A0ZA 4HX8A 2NOGA 2W7NA 2WTEA 5J8FA 2P5KA 4JX5A 4BDZA 3ZQHA 1V5EA 1ETQA 2DTRA 1RESA 3HUGA 3EUAA 2Q2EB 4WCGA 1WKMA 4RBOA 2K85A 1REPC 2BGCA 4IVNA 3TP3A 3RYRA 2GOMA 3DEWA 4ZDPA 3E5QA 1XSVA 3O8HA 4O6JA 4A3FJ 1DP3A 2VUMJ 4AIJA 3W3CA 4Y3OA 2DPUA 1FC3A 1ZKGA 5M5YJ 4L5JA 2RV8A 1PP7U 1MBGA 3F9KA 2HOEA 3OS0A 2HEOA 3AG1H 4PJ0C 5E1WA 4C30A 3BOQA 3W6JB 1DGRM 2P6TA 2PG4A 2QVOA 4LD5A 3CC2I 1T56A 5C3EJ 3WTZA 5FKOA 3K2ZA 4Q48A 2XHKA 1P4AA 4JOMA 4ZJZA 3J7YJ 5C44J 2VBWA 2X0LA 4N0BA 4LFUA 4CA0A 3OMYA 2DDBA 5H6QA 2R7SA 3LSRA 4CCLA 3LNQA 3BTCA 4IOAF 1J09A 2HXOA 2QBYA 1K78A 1SD5A 3VB2A 1G6NA 4XBFA 2W00A 2QQ9A 3AAFA 4FX0A 4W97A 4M9ZA 3CC7I 4XKVA 2XUBA 5KCMA 1MKMA 2CW7A 3OYHA 1Q1HA 1X1CA 1XCVA 5JFRA 1D1AA 3LSTA 3E6DA 3EDPA 1RC9A 2A5WA 2ZB9A 3KCCA 1VQPI 2GA1A 4ZZLA 3DU6A 2H94A 1KQ8A 2EV5A 4CYDA 4M73A 2OQGA 2Z2SB 2M1BA 4IXAA 3OWTA 2M9HA 3ELKA 4OWRB 4BACA 2K3PA 4BJ6C 4BH9A 2EFOA 2QQAA 1MMNA 3KIOA 1YLFA 4YFKF 4J19A 3CMMA 2MFZA 3RQIA 1TNSA 1R5ID 3K70D 3ZPLA 2L7ZA 2HI3A 3LSHA 3PSIA 5LRRA 5DD4A 5DCFA 5DS9A 4KFCA 3PNYA 2ZJPF 3K4BA 3GZNB 1GUUA 3CCYA 1UHMA 4AC0A 3TGNA 1PUFA 4A3LJ 4HQMA 2HOSA 1BBYA 3I9V2 1K6OA 2IBDA 3OV8A 1FBUA 1ZELA 1Z9CA 1ZH5A 2ZXWH 1ZRFA 1OCCH 1JUPA 4EATA 2XAQA 5BNGA 5DCMB 2YU3A 2V26A 3H3VK 3TO6A 1Z0XA 2JPCA 3ABTA 4BKXA 5LHIA 3GTGJ 3IAS2 4E7KA 4XNFA 3W2AA 1KA8A 1X3WB 4AYBA 2XROA 3NWTA 1DGWY 2DAOA 1FIAA 3E3VA 2DA1A 2ZNZA 1UJ8A 3FXKA 3K4MA 4BQQA 4MQVA 2XGCA 3V8JA 3OYJA 2QCOA 2L9NA 2DMTA 2ZCWA 4IRGA 1K7AA 4I99C 1ON2A 3BR3A 4IF4A 2L7MP 1LVAA 1MJBA 2D45A 1I50J 1OJLA 3DFGA 1TT5B 3D5SC 1E2XA 4RLQA 1B6AA 1EF4A 2EIKH 3FBIB 2E35A 5FFXA 3MKYB 1KYWA 1BR4A 2NXNB 3T1BA 2OPTA 3WTVC 3O6BB 3P9KA 3IUOA 3A2KA 3BJAA 1QZYA 3C1DA 1S5LC 5F0FA 3GTOJ 1AOYA 2KIMA 5FJ8J 4KISA 2CYYA 1X58A 3LSJA 4CYCB 4BAYA 3F22A 1SANA 3DF8A 4IHVA 2YU9J 3RYPA 1K6YA 2KIQA 1E3HA 1G59A 3CDHA 2VOOA 3CJNA 3JAMZ 3HOUJ 1FIPA 4YG2F 3DCFA 2QSFX 2VBXA 4W1UA 4L18B 4FE7A 1U2WA 4HSRA 2ISYA 4CGZA 3KYDB 3HOTA 2VXDA 1P7JA 1JHFA 4NNJA 1EKEA 2STWA 3QQAA 4D0PA 2EZHA 1H9GA 2MG4A 3KYCB 1IN5A 4M3EA 2X1CA 1BC8C 2VJIA 4ZDOA 5M5XJ 4H0EA 2DLLA 2YSRA 4E70A 3SFIA 2JA5J 3N4MA 3H5RA 1R71A 1IAWA 2B7EA 2Z1DA 2PX9A 3J81K 2EBIA 1R5GA 3DU5A 2AO9A 4XKCA 3QRFF 2WY8Q 2KJCA 3RJPA 3SEQA 5ILUA 1O3TA 2NVQJ 4L9TA 3B02A 4IQJA 4OMYA 2IEKA 2RQQA 1B9MA 1Z7UA 5K5RA 5LEJA 2AXTC 2R7TA 3WHCA 3HOXJ 4Y7NJ 3WGIA 2MD5A 3K4NA 2EILH 3JRDA 5EEGA 2O7OA 3G1LA 4KN4X 1Z6RA 1EH6A 3GUDA 4FTHA 4FETA 3C2GA 2FA5A 1BN5A 5IYDJ 3D5RC 1A6IA 1WJBA 2HZDA 3JRBA 3ML6A 3MKLA 2E2JJ 1IRZA 1MW7A 2CW8A 1SAXA 1IXRC 2DFEA 1L0OC 3BCAA 1V54H 2E34A 3E7LA 3VWBA 4HRIA 2P5LC 1R22A 5B1AH 1WVRA 4OIRF 4V19K 1TT0A 3LFKA 3BG7A 4PDKA 1MGTA 2HXIA 3OIPA 1MMDA 2F4MB 2LKSA 1B4AA 2WAEA 5B1BH 2UUZA 3OYKA 2VT3A 2ZMEC 4CDGA 5LD2C 2R5YA 1WH5A 4HLXA 1KU9A 2EZIA 1OISA 2NVYJ 4DGWB 3ZGKA 3OL3A 3AL0C 1QVUA 4I09A 4AIDA 4U0YA 4HSTA 4MFDA 1SEUA 2FSWA 1Z77A 2I8DA 3RPQA 5KK1A 5LBQA 4BGDA 4F91B 3QU6A 1S7OA 5KNLA 2BOLA 4GRIA 4DZPA 1UCRA 4BJTA 2FQ3A 1N77A 3IWFA 2DYRH 4KA4A 3AG3H 2XIGA 4H4KC 4XKBA 5HS8A 5L3BA 4UUSB 4QWQA 4NUBA 1G2HA 2XASA 1YFHA 3UNGC 5E3OA 2MLGA 3I53A 4WWCA 4FQGA 5JHFA 2CFOA 5LGTA 4QSHA 2H1LA 4AVZA 4MEXF 1ZTRA 1MJ9A 3HUGB 4UHTA 3CCMI 3HOVJ 2VPRA 4ESFA 1VQ7I 1S9HA 3R0AA 4CZCA 5C4JJ 1T39A 3HZJA 3BR5A 2DI3A 1G8XA 2ID6A 2Z99A 4WX9A 5B3SH 3CUQA 4AIHA 5FKNA 2EZLA 3IH3A 2GBYA 2L9VA 1BI0A 1O7LA 2P4WA 2HKOA 4EJUA 5IP7J 1J59A 1ULYA 3ULQB 2OJED 1WQ2A 3I54A 3RTRA 2EB7A 1YITI 1ZYRF 1EH7A 4MTEA 3RPUD 1FYMA 3JSOA 3BP8A 3G1OA 5CQEA 2L9RA 2CV1A 1BOAA 2X6OA 4UXNA 5H2FC 1GLNA 2W4SA 5EZHA 2RQPA 2VKHA 3M1EA 2CMPA 2YX4A 4ZH4F 1R36A 4M9XA 4D9JA 4S05A 3HOZJ 2F5FA 3QOPA 4XR6A 3PM1A 3RZDJ 1RUOA 3CCJI 5GTHC 2IA1A 1L3LA 2G7UA 3TKYA 2XDVA 4A3IJ 3PO3J 5TRDA 3GCMA 1K78B 1M1EB 3BT9A 3DLLF 1G4DA 2Y75A 4EMSA 4QPQA 2EZKA 1JGSA 2KRHA 3TO7A 5M3MJ 4OINF 2RREA 4BJ5C 3OSGA 2QQBA 5E1ZB 2J5PA 3WTUC 4MLOA 2FOWA 3LSGA 1YW9A 3BWGA 2VBYA 4ANJA 2MC4A 4E7IA 2W24A 3CZ6A 3IP4B 5JHUA 2O3FA 1PP8F 1B72A 5KAIC 1R5HA 3C7JA 1LFUP 4DJAA 3CF2A 3WODF 3BZCA 3JTHA 3WTYC 4EM0B 3PIOF 3L1PA 4D7NA 4FCYA 1P2FA 3K1PA 1I39A 1O3RA 3FXMA 1BL0A 2OZ6A 4L0YB 1VQ9I 1G3YA 2TDXA 5HS9A 1R9TJ 3QU3A 3CCUI 5E79C 4V2GA 2VT2A 1IUYA 1B9NA 3Q3SA 2KDOA 2J5OA 2K86A 5D8LB 1SVLA 9ANTA 5DV5A 1PUFB 3F72A 1YRNA 3L2WA 4XSXF 4BEHA 2K40A 3ABKH 2EPFA 2OAZA 5CJ9A 2MH9A 3K1MA 1QRYA 5FD5A 2RDPA 2YS9A 3MFKA 3A01A 2ICWG 3FMQA 1YE9A 2O8XA 2CUJA 3OYGA 2X4HA 2VE9A 4LITA 5FKMA 2LKXA 1B1BA 1UHWA 2HOTA 1Z05A 3KP3A 3M1CA 2KZVA 3HRMA 4BDYA 1F5TA 4KT6A 3TEDA 2M34A 1Y8RB 1V55H 3F23A 4KT5C 4GYGA 3DV8A 5DEQA 2Y0MA 3GFLA 2QYOA 3IRQA 4BS9A 3OY9A 4N9HA 2W84A 3R4KA 5JVTA 1ETKA 5ILSA 1IV6A 4KUMA 3SEZA 5CYVA 1X2NA 1ODDA 3E5UA 1IV8A 2F4OB 4CCJA 4ZYDA 2WAQA 4A5NA 3S1QJ 4OIQF 3ZMUA 1LNWA 4PJNA 2EA2A 2EJRA 3JRIA 3S3NA 3IL2A 2DA6A 3F8NA 2DJNA 2DMQA 4AIKA 1GVJA 2VJ5A 4BQNA 3QP6A 1BJAA 2KRCA 1I6XA 3CLQA 4U7BA 1S8NA 2H8RA 5E18F 1SD7A 2M4KA 3KYLA 2Y69H 4HZFA 2K27A 1BI3A 4JP0A 4EJTA 1HXDA 2R7OA 2E5NA 5JVGF 2IJLA 3GTQJ 2JT1A 2MABA 2VQCA 2LTPA 3CMYA 4RM3A 4I7HA 4C3IJ 4KN7X 4EEFG 3RPUA 3MWMA 1RR8C 1U9NA 4ZTJA 1MH4A 3LWFA 2LH9A 3L2UA 2BV6A 2K9NA 4CICA 4HDVA 4A3BJ 1U8BA 2E7WA 2XGDA 3ZQIA 3ZMTA 2N8GA 5AONA 3E0JB 4PZJA 4ZC3A 5L3DA 5F04A 3CDLA 1YJWI 1ETWA 1MSEC 4O5VA 2AXLA 3HM5A 5HDGA 3OYMA 4ABZA 1DUXC 1BJZA 1NHAA 3WU2C 4DYQA 2QUFA 4M6XA 3E6CC 5M3FJ 3IV5A 1I1GA 2IS1A 4UB6C 3H3UA 3DKXA 3WG9A 2PN6A 1XC5A 3R60A 2H09A 5D6FA 1TTYA 3BR6A 5J4YA 1BM9A 2VKVA 2JWTA 4G12A 4I01A 3ZN0A 3KZZA 2IRFG 4IQ4A 2B0LA 2BXZA 4NC6A 3LMMA 3T8RA 2LBFA 1U0JA 1ETYA 1XD7A 1I5ZA 4IOCF 4IX7A 1FZPB 5A2QZ 2L02A 4R8HA 2X48A 3TQNA 4E7JA 3DPUA 5JLWA 4B09A 4BNCA 5LFAA 3S3OA 2XPWA 3QPSA 2V1XA 1TQMA 2ETHA 2OUMA 4KDPA 3QP5A 2VBZA 2CG4A 1FEXA 4DIQA 3RQ4A 2KHMA 4BYYA 4E6KG 4B3XA 1DPUA 3DTEA 4MNUA 4N4OB 4A69C 1H9TA 2TCTA 5LHGA 3I5UA 2OQRA 2P8TA 3WE2A 2DA2A 4RB0A 3W6VA 1VQLI 4OU0A 4D5FA 1MNEA 2XF7A 5D4SA 3CD6I 2MC3A 4DYRA 4LJZF 1ZGAA 3JRHA 3BJOA 4BUPA 2OZUA 3W2VA 3E6BA 2JUGA 1S29A 4OAYA 4IHWA 4X6AJ 2X6WA 1RRJA 3MVPA 3F8CA 2R5YB 1Y39A 4A3JJ 1MMAA 2LLKA 2E36A 3WE3A 4MQ9F 4RAFA 2XB5A 2KT0A 1QHGA 1HOMA 2OTJI 1HW2A 2DODA 3S15J 1R1VA 2XAJA 3CCRI 1Y0NA 2HWVA 2VQHA 3BDDA 3LSMA 1W0TA 1LKXA 5HDNA 2E1MB 4AVPA 2QENA 3H0GJ 1WH7A 4DW6A 1X2MA 2MW8A 2P81A 2HQRA 1SD6A 3JAMK 4ENNA 1FWZA 1H8AC 2DW4A 2FMYA 2WA0A 5ICFA 1Z21A 2F2EA 4HDUA 3QWLA 1Y8QB 4XQFA 3CP2A 1SFOJ 2VQGA 4G6TB 2GIZA 3OR1C 1V5FA 2Y48A 2L54A 2VJ4A 2DT5A 3MMYB 2ZNYA 3Q0VA 4L5IA 3SHFA 1DU0A 3GEZA 5HDKA 2B9SA 1X1DA 3J80Z 3I59B 4IPAA 3NRVA 2DOAA 4N9IA 4M72A 5E8IA 1GXQA 3BPVA 3HC7A 1WWXA 4UUTA 3CMAI 4LG0A 3Q0UA 2LREA 3CUQB 2HGCA 3HEFA 3M4OJ 3AG4H 2BYVE 3SDBA 1JHHA 1DDNA 2CJJA 4L9VA 5D5UB 3Q0WA 1HDPA 3C2BA 2A07F 1TWCJ 1ETVA 1G3WA 2DT6A 2BE5F 2RKHA 4HV6A 4AUXA 2HYJA 3H9GA 3K4LA 1QA6A 3KP7A 5D8KB 2XRLA 4C2TA 1ZGWA 4HEA2 3OYFA 1V5GA 2E5ZA 3WGHA 1PYVA 3MD2A 2V9KA 3GX4X 1JT6A 1HKSA 5B66C 2P7VB 1MBEA 3LA7A 2KMUA 2FJ1A 2VLAA 4RB3C 5E3MA 3KETA 1OMIA 4HF0A 3MQ0A 4YFXF 1IRXA 3FBNB 3TOAA 4G7HF 2K3FA 1W0UA 2DQRA 2M8GX 1J5YA 2XVCA 2DA3A 1WPKA 2FMLA 4Y15A 4HF1A 4B48A 1FMVA 3EPZA 3K4JA 1Y0UA 1EH8A 3DBRB 3ASNH 3BJ6A 2K9SA 3HG9A 2Q1ZB 2HDDA 3L2CA 2DT7B 3A4CA 1W36C 5IP6A 1WJCA 3DTKA 2L2OA 2L4MA 4B3AA 3LSKA 3DQVC 2RC4A 2BEOA 1XSXA 4XMYA 5BPIA 1B72B 3HBLA 4HX4A 1T98A 2H6CA 3TO9A 3CF5F 3VOEA 2V1NA 1ZR2A 3MKWB 2ME6A 1JT0A 1ZREA 4EGZA 4UVCA 4A3DJ 3D0SA 1T08B 3CJQB 3HTUA 3BQZA 2E7XA 3CUOA 4C3HJ 2K02A 2MSYA 1QBJA 1U5TA 4QPOA 3CO6C 5C4XJ 5B5EC 4BY1J 1SAUA 3L7WA 3K1NA 2R7VA 5HODA 4M3DA 2Y0SA 3JRAA 4BEHB 1FT9A 4BQOA 4S0HB 1N78A 4GGGA 1JE8A 2LKPA 2R3SA 3Q9VA 3FX3A 4IO9F 4NC7A 4HX7A 1P4WA 1OFCX 2HYFA 3RCOA 2CUZA 1XX5A 4KYWA 3OYAA 1J7KA 2JUCA 3GBGA 3H5AA 1B8IA 4RB2C 1PDNC 2E1NA 3U1DA 4M71A 3IC7A 3QPLA 1KU3A 4HOBA 5GP9A 5J3LA 4XRMA 4AM3A 2MD0A 3ZQGA 1IZ1A 1ZLJA 5HLIA 2WADA 4ZYGA 1K83J 2X85A 1O57A 2CQKA 2HZTA 2CQXA 3CP8A 5E20A 4MFEA 4F3QA 2PLYA 1VNDA 1WGXA 3HTSB 1ZGJA 1R58A 5K5OA 2CO5A 3SFZA 2NVTJ 1IO2A 3G73A 4XL9A 5FRNA 2QZ8A 5GTIC 1QZEA 1MNMC 4O3MA 2XKOA 3ZOBA 1GT0C 2CU7A 4XLHA 3ZMZA 2Y30A 4ITVA 3REOA 2CW0F 2VXZA 3VYSB 1D8JA 2DMNA 1DP7P 3BR0A 1IGNA 1LDJA 3ECOA 3BG6A 2FOKA 5ICGA 2NS8A 3QYEA 4RAYA 1G3TA 1SFKA 3EQLF 1XCBA 4RM2A 5J1YA 2R5ZA 1IG7A 3S3MA 3BR1A 5F0CA 1WRJA 1LE8A 2WV1A 4BXUA 2IS4A 3CTAA 2Z3YA 4ZYHA 1SVOA 1D8KA 1OYWA 2JRTA 3IHUA 3JCUC 2Q8KA 1APLC 1YHQI 4BHPA 3QOEA 2BW3B 2OC6A 2K4BA 4G7OF 4Y17A 4P9FA 1MD0A 3F8FA 5IPAA 2HKXA 3DBLB 4DOZA 3K7AJ 3H9JA 1WSUA 2HS5A 4E7LA 4LGWA 1QVTA 3R61A 2IW5A 3GTMJ 5FLXK 1KZHA 2QKLB 5F6FA 2KZGA 3CQZJ 2NVUB 2KP6A 3ERMA 3MZ8A 2UZKA 5J1RA 2LOOA 4UV8A 4D7MA 2UXXA 4J00A 4HYEA 3LQQA 2JVGA 3LA3A 1T0FA 4DNCA 1X3ZB 1P7IA 2LFBA 2P0WA 2ISZA 3RDIA 1QQIA 2P7CB 2Z9OA 2FU4A 1OQYA 2PMZN 4EQQA 1MH3A 5D4RA 3I4NJ 4HPQA 1U6GA 3PNVA 2R7RA 3OYLA 4FISA 2Y2ZA 4LLGF 1LFBA 2XV4S 1ZRDA 3VFZA 3C2HA 3K6GA 1FBSA 1OCZH 2LBFB 2FRHA 2LG4A 5ICCA 5DUKA 1IC8A 3GWZA 3J7ZI 5E17F 3JR9A 4XLNF 3EUKL 2LY9A 3ERED 5J8CA 2M87A 3LOCA 2XAGA 3CCEI 2ID3A 3PFIA 3R0JA 1OCOH 2Q0OA 4LK0F 2Z16A 4A3KJ 5F08A 2ELHA 3KLOA 1XTAA 3DTIA 1ON1A 1TP4A 1OR7C 4JQFA 1UAAA 4L0ZB 1QZZA 4IJAA 2NS7A 4XRSA 3FZVA 1XGSA 4BE1A 4V2FA 2L9SA 2FBIA 4LMYA 1J0RA 4I02A 4OAZA 2COMA 5CVUA 4E7SA 5IP9J 2UXNA 1ITYA 4MHGA 3CCQI 2K9QA 4I0BA 4A6EA 4IHYA 3TW6A 1IF1A 4XLFA 1AWCA 1IN4A 4C9YA 4G8XA 3AKZA 1CF7A 5K7ZA 2VI6A 4G6DA 4PSXA 4RGRA 5L3CA 5BPDA 5J4VA 3I64A 3IKTA 1Z3YA 3KEQA 3ZMDA 1T38A 4J01A 2WB1N 2LF7A 3ISPA 1Z91A 5K5QA 5CVIA 3BROA 3D1NI 1SFUA 1WI3A 3DBHB 4RDUA 1HBXG 1USTA 1RETA 2QF7A 1LJ9A 5BQTA 3S32A 1WI9A 3CC4I 5ICEA 2AQEA 4C3JJ 3GTPJ 1IXCA 2P5VA 4HV5A 4WF2A 2K9MA 2CS3A 5DTDA 3RZOJ 3O2PE 3B6CA 5DYMA 2A3SA 1VQOI 1F1ZA 4BE2A 1NTCA 1MBKA 2K9LA 2DO7A 2HDCA 1W7PA 1ZG3A 3QAHA 3G4SI 2H6BA 5CVVA 4NBQA 4IRHA 4CCOA 3P7NA 3CJTB 3RKXA 4LG0B 3VEPA 1YJNI 4LB5A 1O7FA 1Y56A 5EDNA 2A6EF 1CQTA 1I3QJ 4IEJA 2WBMA 3H9QA 4UV9A 5HLGA 4IHXA 3IKVA 4EJVA 5AIQA 4L9JA 3I71A 4NDLA 4M3BA 1IXSB 1JJ6C 4JK1X 1O4XA 2DJIA 3FM5A 2H8WA 3WU0A 2IGNA 2QBYB 4IL6C 5GAGJ 3FHNA 4E7ZA 4B47A 3BG3A 3G2BA 3Q9SA 5F0HA 3WTSC 2F48A 3ROUA 3JRFA 4XSZF 5IY5H 4A6DA 4XONA 2DFHA 2EIMH 3FIWA 4XOPA 2QA4I 5A2QK 1FTZA 4C2UA 5FLXZ 5HOOA 2YX7A 5EYRA 2GM4A 4KMFA 5FLVA 1J9IA 1TWHJ 1TZLA 3KEYA 2K7LA 3OYCA 1C0WA 2E2HJ 2OTLI 5FROA 4DZJA 4RGSA 1E3PA 2IGKA 3IRRA 4EJWA 2EINH 4PSWA 3V4GA 3HSFA 4NC8A 2JQ7A 2W57A 1PJRA 1YW7A 5D5XB 4NQWA 1HA8A 1OYYA 1UMQA 3GLXA 3ABMH 4A0YA 5JR3A 2WY7Q 4PK4A 3OR2C 1A6QA 1MBHA 4RS8A 1YS6A 2OU2A 1LVKA 2VQLA 3X2QH 3O3KA 3VPRA 1SFXA 3M07A 2XGEA 4HBLA 3VYUB 4ZDLA 3LA2A 4FT8A 1LDDA 2I5UA 3HKZA 3TW7A 3OL4A 3G3ZA 2IS6A 5IYCJ 4II2A 3SZGA 1E0EA 1WJEA 2A6TA 5EZGA 3KPHA 3TP0A 1YJ9I 1ETXA 3WTTC 3HOSA 2KKOA 2ZXJA 4YEJA 2V7FA 1U5TB 2VKEA 2L4AA 2FD5A 5GAEJ 3FKJA 1W5SA 1SD4A 3HOYJ 3BC8A 3F8BA 1OYIA 3L2RA 5KAFC 2HDWA 1ZR4A 3MZYA 1AKHA 4YIFA 1IRGA 2OV7A 1T95A 2WWYA 2OF7A 3I0TA 3TDZC 2OCCH 2JA7J 2KJBA 3NARA 4PJMA 1HCRA 2LRDA 3NWSA 1B8IB 1STZA 1ZRCA 1BOBA 3ESWB 4UVBA 2DPDA 2FBHA 2L7FP 4AU7A 4XN0A 2PJPA 1N75A 4CSWA 2FQ4A 4ON0A 4HF2A 3QODA 1MSFC 2IXSA 4S04A 3J80K 2GLOA 1ZG1A 2KISA 4HG2A 3DKWA 5D5VB 1ACIA 2KQRA 4R1HA 4XKWA 4BU2A 4BHBA 3U21A 2E71A 2LY2A 2CV2A 2ECCA 1V4RA 2XF6A 3LSIA 3OIQA 4PCQA 4UY8I 2M30A 1Y1VJ 2YPRA 3CCSI 2HPMA 4CYCA 4GDFA 1DQUA 3RSNA 3SDGA 3UKGA 2RGVA 2JJ7A 2HFHA 2EK5A 2W85A 2RNGA 4XLEA 3BCBA 4A3GJ 1YO5C 1HSTA 5EJCA 5F1JA 4YIIA 1NG6A 3GXOA 3WTWC 2R5ZB 1GV2A 2ZMEA 2HVQA 4PJJA 6PAXA 5TISC 2NYXA 2CUFA 4LOCA 3K10A 4FHTA 4BHCA 1D0ZA 1ZN2A 2CQQA 2DQLA 2EH3A 5KHDA 1SFEA 2EWNA 1J2XA 4P9UA 1S7EA 1IN6A 1IRFA 3K2AA 3ZXSA 4BL0B 2DK5A 2QKMB 3VSKA 1HC8A 4P1WA 2VJJA 2VONA 3PJRA 3PUFA 3V8KA 3BPXA 2ME0A 3H3ZA 5F27A 2ZXIA 2A61A 2A68F 2NNNA 1YW8A 2Y9YA 4II3A 2IVMA 1FMWA 3F0CA 1VQNI 1RZ4A 2GA2A 3FDYA 3SQNA 2COBA 4LIUA 5ILVA 2PJRA 2DBBA 2CSOA 3HIFA 4BQAA 3LFUA 3M8FA 2GQQA 3ZQCA 2ELJA 3C3WA 2QSHX 3TOBA 3E97A 1BA5A 1W1WE 1YOVB 1FLIA 4OOIA 3MEXA 3BR2A 5CLSA 1A5JA 1UG0A 3OYEA 2B63J 1HDDC 1B59A 2E2IJ 4ENKA 4F55A 4FASD 1P9QC 1YI2I 4PJLA 4G7ZF 3I4MJ 2XRNA 1FSEA 2HVSA 3PSFA 4FX4A 3M9AA 2V9VA 1F36A 5H20A 2VL8A 3UR3C 1Z3XA 2FUG2 3P9CA 5CVRA 1R7JA 1I3AA 2MYSA 3M3YJ 3HRSA 2DMPA 2A5YB 1SMYF 4WXCA 1JI8A 4UNOA 3V7RA 2R4GA 3M7GA 2BHZA 1JUSA 4KIFA 1QO0D 2QLZA 1D0YA 1H88C 1KU2A 3G1MA 3HGYA 4M74A 2I10A 3SZPA 3ZR8X 5FO5A 3WG7H 4HNUA 2HQNA 5J40A 2KFDA 1XPXA 3CLOA 1ZAOA 2HTSA 3OSFA 1KGSA 4UB8C 4MIMA 2XKPA 2E19A 4GYIA 3RKYA 4YRVA 1ENHA 4OIOF 2JA2A 2XSJC 3BG5A 4MO7A 3LL7A 2TRTA 4Y33A 5J6XA 3BLYA 2F5VA 4XICA 1CF7B 1BW5A 1TBXA 4ETSA 3WU1B 2R7QA 2O6GE 2LMDA 3WHBA 2DFIA 2JA8J 2YUSA 2L3DA 2VASA 1ORKA 1WFXA 2MA3A 3G71I 4WXHA 2ZFWA 2L5QA 1LB2A 2IP2A 1JKPC 2ESNA 1X19A 1HSJA 4LLLA 2M8EA 2G7HA 4HNVA 4IHTA 4YELA 3HB9A 1I27A 2D1VA 2G9WA 3SJMA 4K2EA 3LSPA 4XLCA 4RAZA 2HQAA 3HOWJ 3K4CA 1E17A 3A0BC 1X1BA 3G6EI 3F3XA 1H89C 1R00A 1XDSA 2LDUA 2GZWA 1K61A 3BTJA 5BS6A 2F6CA 3T8TA 2DU9A 3GW2A 1W7PB 2QWWA 3VDXA 1QPMA 1Y1WJ 2ZO4A 1CGPA 2DN0A 1FY7A 2EQRA 4ZZDA 4HW0A 4RA2A 2QEXI 4ZTFA 1QPIA 3K70C 1X4OA 2WV0A 4LG3A 1PVEA 1RKTA 5H6RA 4A93J 4MGRA 2M4GA 3HXLA 1KU7A 3P9IA 1AU7A 2ELKA 2AS5F 3KEOA 4M3FA 1BW6A 2BY2A 3RKQA 3U9GA 2FE3A 1NK2P 4MEYF 2LR8A 3CDIA 1D1BA 2O61A 2UWMA 3B73A 3FK7A 4XLPF 1FJLA 1Q1VA 2EV0A 1EA3A 4GCVA 2ZJRF 1SC7A 2R92J 3GYHX 1TWAJ 5IT9Z 5EG0A 3BTLA 1FOKA 3FXOA 2H27A 3H35A 1X1AA 1JKOC 1Z7LA
chains in the Genus database with same CATH topology
3L9FA 5FB2A 3F6OA 3DEUA 4G94A 5L3GA 1MDMA 4P96A 4NB5A 1S6LA 2CWEA 1HQCA 3D5LA 2F5CA 2PMUA 2Z5UA 2WC2A 5LGNA 4A12A 4IHSA 5LEKA 1HKQA 1UFMA 2XAFA 3KP4A 4Y13A 2HYGD 3GFMA 3LQRA 2JZYA 3MZHA 5EEHA 3L00A 3V7CA 1RI7A 1VTNC 3NQOA 1XSDA 2ESHA 2C6YA 1Z1DA 2FNPA 5BOXA 1OPCA 3ZMSA 3FXUA 5E8GA 2FF4A 4AD9A 1XGNA 1FNNA 3JSPA 3GFJA 4JBAA 3ZQ7A 2ADUA 3HRTA 3CUQC 4MTDA 3OOPA 1V3FA 3ECHA 5HS7A 3F8MA 4CO8A 1XDUA 1LQ1A 3NEUA 3GO5A 1BIAA 2M45A 5HVQC 1FSHA 2PBIA 4LLNA 2V79A 4Q4ZF 2STTA 4A5MA 1RIOH 2VE8A 4QLCU 4CHUA 3PQJA 3FMRA 3DP7A 5K1YA 1QGPA 2FEZA 4WXDA 3V7SA 2RNJA 1XMAA 1GXPA 1FP2A 4ZYEA 4P55A 4Q5SF 1IW7F 1XMKA 4Z2YA 1S7AA 1W7PD 3LAJA 3KE2A 3HHGA 2NS0A 3K0LA 1OKRA 5IT3A 2VC0A 2EFNA 3HHHA 3KLNA 2JTVA 2GAUA 2VN2A 2MBFA 2ZMEB 4EV0A 2JPBA 2V1DA 3DPTA 1QNTA 1LEBA 1TW2A 4KIGA 5D6EA 4TV7A 4OIPF 3CO7C 5E1XA 2IPQX 1ONVA 1R23A 2LNBA 4CZZA 1FX7A 4G9YA 4RGXA 2OBPA 2PEXA 3DPLC 2R7FA 5LLQA 1RNLA 2A6HF 3HSEA 2XAHA 3MCZA 5D5WB 1BI1A 3K69A 3C18A 3I58A 4RGUA 1BC7C 1LDKB 2HR3A 5L3EA 4KMUX 1TLHB 2PQ8A 2EFWA 2ZKZA 1D5VA 4U0WA 1KQ9A 4NHJA 2IA2A 4AWXB 2VC1A 1KQ0A 3RI4A 3KP5A 1GHCA 2O0YA 2FBKA 3ZP5A 1RUNA 2NRAC 2F5EA 4GO1A 3FM3A 1TQIA 3JTGA 2KRFA 3T5XA 4RB1A 4R79A 2ACJA 3EETA 3VODA 5FD6A 1ZG5A 2V1UA 3TDUC 3RIRA 2PMHA 2D1HA 2ZJ2A 2NAZA 2PFBA 3F21A 5LHHA 2F5DA 3GZ5A 2Q2EA 4A0XA 3H92A 3LAPA 3I4PA 1Z6TA 4I98B 4M9SA 5ERIA 3GFIA 4U0VA 1FYKA 1ZARA 3WGGA 4ENJA 1XGMA 1UB9A 1J75A 2FXAA 1SMTA 3I59A 3KFWX 2RVCA 4Q47A 2KIUA 2V6CA 4KICA 3FXQA 4EGYA 1EV7A 4I0AA 3GF2A 4CXFA 5LRSA 2GWRA 3L09A 3DXJF 3K9TA 3W6KB 4EJOA 4UVAA 3N97A 2VODA 4ESBA 3FWEA 1MDMB 3RKWA 1U8RA 3SZTA 1HW5A 3QPHA 4L9NA 3IWZA 2K4JA 5LGUA 3V8LA 3J81Z 2L01A 1TNTA 1S3JA 1P4XA 1USSA 2E1CA 1T6SA 1F4KA 5CVJA 2QM3A 4F7ZA 3JW4A 2W25A 2GXGA 1YTYA 1U3EM 4YFNF 3MAJA 1TW3A 2M5WA 1P6RA 5L3FA 1G3SA 1XGOA 1YQAA 2EFQA 3ZMVA 3ZN1A 2MH2A 1FBQA 1A04A 2RN7A 3WTXC 1ZLKA 2PI0A 2EFPA 3KP2A 5HLHA 4HAMA 5DCMA 4I2OA 2LSOA 4UUVA 4HLYA 3SXYA 1I1SA 3BZ6A 2XGXA 3BY6A 5AIPA 2A69F 1H0MA 2NNYA 2GIVA 2O03A 3PQKA 5TJJA 4WK8F 1P92A 1XB4A 3E6MA 4B8XA 1FPQA 3S2WA 1T2KA 4U7DA 1X3UA 3U2RA 3FXRA 3EUHA 4A2UA 2Z33A 2IA0A 2LF8A 4OMZA 2EV6A 2R7DA 1FYLA 3Q5FA 1O3SA 1FP1D 2DK8A 2CFXA 1HKTA 4ENMA 4KNYA 1R1TA 1YIOA 1MZBA 4P5OA 3R6SA 3J7AO 4GXOA 4LB6B 4LK1F 4PGGA 5IT9K 1TQPA 2VOPA 2GXBA 4IRIA 1MJAA 1IN7A 3FMSA 2BBYA 1OR7A 2FNAA 4HA8A 1W4MA 3HSRA 3EYYA 3ABUA 4KIBA 1BI2A 2MLKA 1U5TC 4XRFA 4EM2A 3FHZA 5BMZA 2HTJA 3E5XA 3GZ6A 4HQEA 1KYZA 4DQ2A 2OD5A 1W5TA 2D2WA 2P6SA 4G6QA 1O3QA 5FFZA 2CGPA 4PGHA 4M6YA 4EM1A 5F64A 1YYVA 3M8EA 5KVRA 5JI6A 3FF5A 1IN8A 2YR2A 3HRUA 1BIBA 2JSCA 1YG2A 1LEAA 5DD8A 3EYIA 1U78A 4U88A 1XN7A 4ASNA 2ZBKA 1JXSA 1DPRA 1K79A 3COAC 1ZHFA 3F6VA 3KZYA 1YS7A 2IT0A 5DUIA 2KIFA 1D3YA 4EVIA 1R1UA 2EA4A 3QPTA 3T0YA 1HW1A 1F9NA 5ED4A 5DDGA 3HYIA 4ESJA 5F1RA 2OA4A 5FGMA 1PUEE 3KP6A 3GVAA 4A0ZA 4HX8A 2WTEA 5J8FA 2P5KA 2DTRA 3HUGA 4WCGA 1WKMA 1REPC 2BGCA 4IVNA 3RYRA 3E5QA 1XSVA 4O6JA 4AIJA 2DPUA 1FC3A 4L5JA 2RV8A 1PP7U 2HOEA 2HEOA 5E1WA 3W6JB 3BOQA 2P6TA 2PG4A 2QVOA 4LD5A 3WTZA 3K2ZA 4Q48A 2XHKA 1P4AA 2VBWA 2X0LA 4N0BA 4LFUA 5H6QA 2QBYA 1K78A 1SD5A 3VB2A 1G6NA 4XBFA 2QQ9A 3AAFA 4FX0A 4M9ZA 2XUBA 1MKMA 1Q1HA 1XCVA 5JFRA 3LSTA 3E6DA 3EDPA 3KCCA 2GA1A 4ZZLA 2H94A 1KQ8A 2EV5A 4CYDA 4M73A 2OQGA 4IXAA 2M1BA 3ELKA 4BH9A 2EFOA 2QQAA 1YLFA 4YFKF 1TNSA 3ZPLA 5LRRA 5DD4A 5DCFA 4KFCA 1UHMA 3TGNA 4HQMA 1BBYA 1K6OA 3OV8A 1FBUA 1Z9CA 1ZH5A 1ZRFA 2XAQA 5DCMB 2YU3A 3TO6A 3ABTA 2JPCA 5LHIA 1KA8A 2XROA 2DAOA 3E3VA 2ZNZA 4MQVA 3V8JA 2ZCWA 4IRGA 1K7AA 1ON2A 4IF4A 2D45A 1LVAA 1MJBA 3DFGA 1E2XA 1B6AA 5FFXA 1KYWA 3T1BA 3WTVC 3O6BB 3P9KA 3BJAA 1QZYA 3C1DA 1AOYA 2KIMA 2CYYA 4BAYA 3F22A 3DF8A 3RYPA 3CDHA 2VOOA 3CJNA 3JAMZ 4YG2F 2VBXA 4L18B 1U2WA 2ISYA 4CGZA 3HOTA 1JHFA 2STWA 4D0PA 1H9GA 1IN5A 1BC8C 4H0EA 2DLLA 2YSRA 4E70A 3N4MA 1IAWA 3J81K 1R5GA 3QRFF 2KJCA 3RJPA 5ILUA 1O3TA 4L9TA 3B02A 4OMYA 1B9MA 1Z7UA 5K5RA 5LEJA 3WGIA 2MD5A 5EEGA 4KN4X 1Z6RA 1EH6A 3GUDA 2FA5A 1BN5A 3ML6A 1SAXA 1IXRC 1L0OC 2P5LC 1R22A 4OIRF 3LFKA 4PDKA 1MGTA 1B4AA 2VT3A 4CDGA 4HLXA 1KU9A 4U0YA 4I09A 2FSWA 5LBQA 3RPQA 5KK1A 3QU6A 1S7OA 1UCRA 2FQ3A 3IWFA 4KA4A 2XIGA 5HS8A 5L3BA 4QWQA 2XASA 1YFHA 2MLGA 3I53A 4WWCA 5LGTA 4MEXF 1MJ9A 4UHTA 4ESFA 3R0AA 1T39A 2DI3A 2Z99A 4WX9A 3CUQA 4AIHA 1BI0A 1O7LA 2P4WA 2HKOA 4EJUA 1J59A 3ULQB 1ULYA 3I54A 1WQ2A 3RTRA 2EB7A 1ZYRF 1EH7A 4MTEA 1FYMA 3JSOA 3BP8A 1BOAA 4UXNA 2RQPA 3M1EA 2YX4A 4ZH4F 1R36A 4M9XA 4S05A 2F5FA 3QOPA 1RUOA 2IA1A 1L3LA 2G7UA 3TKYA 5TRDA 1K78B 1G4DA 2Y75A 4EMSA 1JGSA 3TO7A 4OINF 2QQBA 5E1ZB 2J5PA 3WTUC 1YW9A 3BWGA 2VBYA 2W24A 5JHUA 1PP8F 2O3FA 1R5HA 3C7JA 3WODF 3JTHA 3WTYC 4EM0B 1P2FA 3K1PA 1O3RA 2OZ6A 4L0YB 1G3YA 2TDXA 5HS9A 3QU3A 2VT2A 1IUYA 1B9NA 2J5OA 2K86A 5D8LB 5DV5A 3F72A 4XSXF 2OAZA 5CJ9A 2MH9A 3K1MA 5FD5A 2RDPA 3MFKA 3FMQA 2O8XA 2VE9A 2X4HA 1B1BA 1UHWA 1Z05A 3KP3A 3HRMA 1F5TA 3F23A 4KT5C 4GYGA 3DV8A 5DEQA 2Y0MA 3GFLA 2QYOA 3IRQA 4N9HA 2W84A 3R4KA 5JVTA 5ILSA 4KUMA 5CYVA 1ODDA 3E5UA 4ZYDA 4A5NA 4OIQF 3ZMUA 1LNWA 2EA2A 2EJRA 3IL2A 3F8NA 4AIKA 1GVJA 3QP6A 1BJAA 1I6XA 4U7BA 1S8NA 5E18F 1SD7A 4HZFA 2K27A 1BI3A 4EJTA 1HXDA 2IJLA 2JT1A 4I7HA 4KN7X 3RPUA 3MWMA 3LWFA 2BV6A 4CICA 4HDVA 2E7WA 3ZMTA 5AONA 4PZJA 5L3DA 4O5VA 2AXLA 5HDGA 1DUXC 1NHAA 2QUFA 4M6XA 3E6CC 1I1GA 3H3UA 3WG9A 2PN6A 3R60A 2H09A 5D6FA 1TTYA 1BM9A 2IRFG 4I01A 3ZN0A 3KZZA 2B0LA 3T8RA 1XD7A 1I5ZA 1FZPB 5A2QZ 2L02A 4R8HA 3TQNA 4B09A 4BNCA 2V1XA 1TQMA 2ETHA 4KDPA 3QP5A 2VBZA 2CG4A 4BYYA 1DPUA 4MNUA 1H9TA 5LHGA 3I5UA 2OQRA 2P8TA 3WE2A 4RB0A 4OU0A 5D4SA 2MC3A 4LJZF 1ZGAA 3BJOA 2OZUA 3E6BA 1S29A 3F8CA 3WE3A 4MQ9F 1HW2A 1R1VA 2XAJA 2HWVA 3BDDA 5HDNA 4AVPA 2QENA 2HQRA 1SD6A 3JAMK 4ENNA 1FWZA 2DW4A 2FMYA 4HDUA 2F2EA 5ICFA 2Y48A 2L54A 2DT5A 2ZNYA 4L5IA 3SHFA 3GEZA 5HDKA 3J80Z 3I59B 4IPAA 3NRVA 4N9IA 4M72A 5E8IA 1GXQA 3BPVA 1WWXA 4LG0A 3CUQB 2HGCA 2BYVE 1JHHA 1DDNA 4L9VA 5D5UB 2A07F 1G3WA 2BE5F 2RKHA 4HV6A 3KP7A 5D8KB 3WGHA 3GX4X 1HKSA 2P7VB 3LA7A 4RB3C 3KETA 1OMIA 4HF0A 3MQ0A 4YFXF 3TOAA 4G7HF 2DQRA 1J5YA 2XVCA 2FMLA 4Y15A 4HF1A 1Y0UA 1EH8A 3BJ6A 3L2CA 2L4MA 3DQVC 2RC4A 2BEOA 1XSXA 5BPIA 4HX4A 1T98A 2H6CA 3TO9A 3VOEA 1ZREA 4EGZA 4UVCA 3D0SA 3HTUA 2E7XA 3CUOA 2K02A 1QBJA 1U5TA 3CO6C 3L7WA 3K1NA 1FT9A 4GGGA 1JE8A 2LKPA 2R3SA 3Q9VA 3FX3A 4HX7A 1P4WA 2HYFA 4KYWA 1J7KA 4RB2C 1PDNC 2E1NA 3U1DA 4M71A 3IC7A 1KU3A 4HOBA 1IZ1A 1ZLJA 5HLIA 4ZYGA 1O57A 2CQKA 2HZTA 5E20A 2PLYA 3HTSB 1ZGJA 1R58A 5K5OA 2CO5A 3SFZA 3G73A 2QZ8A 4O3MA 2XKOA 3ZMZA 3REOA 2CW0F 2VXZA 1D8JA 1DP7P 1LDJA 3ECOA 2FOKA 5ICGA 4RAYA 1G3TA 3EQLF 1XCBA 1WRJA 4BXUA 3CTAA 2Z3YA 4ZYHA 1D8KA 1OYWA 2JRTA 3IHUA 2Q8KA 4BHPA 2K4BA 4G7OF 4Y17A 4P9FA 1MD0A 3F8FA 2HKXA 1WSUA 2HS5A 4LGWA 3R61A 2IW5A 5FLXK 5F6FA 2UZKA 4UV8A 2UXXA 4HYEA 3LQQA 3LA3A 1T0FA 4DNCA 2ISZA 3RDIA 1QQIA 2P7CB 2Z9OA 2FU4A 4EQQA 5D4RA 1U6GA 4LLGF 1ZRDA 2XV4S 3VFZA 1FBSA 2FRHA 5ICCA 5DUKA 3GWZA 5E17F 4XLNF 3ERED 5J8CA 2M87A 2XAGA 3PFIA 3R0JA 2Q0OA 4LK0F 2ELHA 3KLOA 1ON1A 4L0ZB 4JQFA 1QZZA 4IJAA 3FZVA 1XGSA 2FBIA 4LMYA 1J0RA 4I02A 5CVUA 2COMA 2UXNA 4MHGA 4I0BA 4A6EA 1IF1A 1AWCA 1IN4A 4G8XA 1CF7A 4G6DA 4RGRA 5L3CA 5BPDA 3I64A 3IKTA 3KEQA 3ZMDA 1T38A 2LF7A 3ISPA 1Z91A 5K5QA 5CVIA 3BROA 1SFUA 1HBXG 1USTA 1LJ9A 5BQTA 1WI9A 5ICEA 1IXCA 2P5VA 4HV5A 4WF2A 3O2PE 5DYMA 2A3SA 1F1ZA 2DO7A 2HDCA 1W7PA 1ZG3A 3QAHA 2H6BA 5CVVA 4IRHA 3P7NA 3RKXA 4LG0B 3VEPA 4LB5A 1O7FA 2A6EF 4UV9A 5HLGA 3IKVA 4EJVA 5AIQA 4L9JA 3I71A 1IXSB 4JK1X 3FM5A 3WU0A 2QBYB 3Q9SA 3WTSC 3ROUA 4XSZF 4A6DA 5A2QK 5FLXZ 5HOOA 2YX7A 4KMFA 1J9IA 2K7LA 1C0WA 4RGSA 3IRRA 4EJWA 3V4GA 3HSFA 2W57A 1YW7A 5D5XB 4NQWA 1OYYA 3GLXA 4A0YA 5JR3A 4RS8A 1YS6A 2OU2A 3O3KA 1SFXA 4HBLA 3LA2A 4FT8A 1LDDA 3G3ZA 3WTTC 3HOSA 2KKOA 2ZXJA 1U5TB 2L4AA 1W5SA 1SD4A 3F8BA 1OYIA 3MZYA 4YIFA 1IRGA 2WWYA 3I0TA 3TDZC 2KJBA 1STZA 1ZRCA 4UVBA 2DPDA 2FBHA 2PJPA 4ON0A 4HF2A 4S04A 3J80K 1ZG1A 5D5VB 3DKWA 4R1HA 4BHBA 1V4RA 4PCQA 2M30A 2YPRA 2RGVA 2HFHA 2EK5A 2W85A 1YO5C 1HSTA 4YIIA 3GXOA 3WTWC 2ZMEA 6PAXA 2NYXA 4FHTA 4BHCA 1ZN2A 2DQLA 1SFEA 2EWNA 1J2XA 4P9UA 1IN6A 1IRFA 2DK5A 2VONA 3V8KA 3BPXA 3H3ZA 2A61A 2A68F 2NNNA 1YW8A 2IVMA 1RZ4A 2GA2A 3SQNA 5ILVA 2DBBA 2CSOA 3HIFA 4BQAA 3M8FA 2GQQA 3C3WA 3TOBA 3E97A 1FLIA 4OOIA 3MEXA 5CLSA 1B59A 4ENKA 4G7ZF 2XRNA 1FSEA 4FX4A 3M9AA 2V9VA 5H20A 3P9CA 5CVRA 1R7JA 3HRSA 2A5YB 1SMYF 4WXCA 4UNOA 3V7RA 3M7GA 4KIFA 1QO0D 2QLZA 1KU2A 4M74A 3SZPA 5FO5A 2HQNA 3CLOA 1ZAOA 2HTSA 1KGSA 2XKPA 3RKYA 4GYIA 4OIOF 5J6XA 1CF7B 1TBXA 4ETSA 3WU1B 2O6GE 2DFIA 2L3DA 2MA3A 4WXHA 2ZFWA 1LB2A 2IP2A 2ESNA 1HSJA 4LLLA 2M8EA 2G7HA 4IHTA 1I27A 2D1VA 2G9WA 4K2EA 4RAZA 1E17A 3F3XA 1R00A 1XDSA 2LDUA 2GZWA 5BS6A 3T8TA 2DU9A 3GW2A 1W7PB 2QWWA 1QPMA 2ZO4A 1CGPA 1FY7A 4ZZDA 4HW0A 2WV0A 5H6RA 4MGRA 1KU7A 3P9IA 2AS5F 3KEOA 3U9GA 2FE3A 4MEYF 2O61A 2UWMA 3B73A 4XLPF 2EV0A 4GCVA 5IT9Z 3GYHX 1FOKA 2H27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L9F A;  5FB2 A;  3F6O A;  3DEU A;  4G94 A;  5L3G A;  1MDM A;  4P96 A;  4NB5 A;  1S6L A;  2CWE A;  1HQC A;  3D5L A;  2F5C A;  2PMU A;  2Z5U A;  2WC2 A;  5LGN A;  4A12 A;  4IHS A;  5LEK A;  1HKQ A;  1UFM A;  2XAF A;  3KP4 A;  4Y13 A;  2HYG D;  3GFM A;  3LQR A;  2JZY A;  3MZH A;  5EEH A;  3L00 A;  3V7C A;  1RI7 A;  1VTN C;  3NQO A;  1XSD A;  2ESH A;  2C6Y A;  1Z1D A;  2FNP A;  5BOX A;  1OPC A;  3ZMS A;  3FXU A;  5E8G A;  2FF4 A;  4AD9 A;  1XGN A;  1FNN A;  3JSP A;  3GFJ A;  4JBA A;  3ZQ7 A;  2ADU A;  3HRT A;  3CUQ C;  4MTD A;  3OOP A;  1V3F A;  3ECH A;  5HS7 A;  3F8M A;  4CO8 A;  1XDU A;  1LQ1 A;  3NEU A;  3GO5 A;  1BIA A;  2M45 A;  5HVQ C;  1FSH A;  2PBI A;  4LLN A;  2V79 A;  4Q4Z F;  2STT A;  4A5M A;  1RIO H;  2VE8 A;  4QLC U;  4CHU A;  3PQJ A;  3FMR A;  3DP7 A;  5K1Y A;  1QGP A;  2FEZ A;  4WXD A;  3V7S A;  2RNJ A;  1XMA A;  1GXP A;  1FP2 A;  4ZYE A;  4P55 A;  4Q5S F;  1IW7 F;  1XMK A;  4Z2Y A;  1S7A A;  1W7P D;  3LAJ A;  3KE2 A;  3HHG A;  2NS0 A;  3K0L A;  1OKR A;  5IT3 A;  2VC0 A;  2EFN A;  3HHH A;  3KLN A;  2JTV A;  2GAU A;  2VN2 A;  2MBF A;  2ZME B;  4EV0 A;  2JPB A;  2V1D A;  3DPT A;  1QNT A;  1LEB A;  1TW2 A;  4KIG A;  5D6E A;  4TV7 A;  4OIP F;  3CO7 C;  5E1X A;  2IPQ X;  1ONV A;  1R23 A;  2LNB A;  4CZZ A;  1FX7 A;  4G9Y A;  4RGX A;  2OBP A;  2PEX A;  3DPL C;  2R7F A;  5LLQ A;  1RNL A;  2A6H F;  3HSE A;  2XAH A;  3MCZ A;  5D5W B;  1BI1 A;  3K69 A;  3C18 A;  3I58 A;  4RGU A;  1BC7 C;  1LDK B;  2HR3 A;  5L3E A;  4KMU X;  1TLH B;  2PQ8 A;  2EFW A;  2ZKZ A;  1D5V A;  4U0W A;  1KQ9 A;  4NHJ A;  2IA2 A;  4AWX B;  2VC1 A;  1KQ0 A;  3RI4 A;  3KP5 A;  1GHC A;  2O0Y A;  2FBK A;  3ZP5 A;  1RUN A;  2NRA C;  2F5E A;  4GO1 A;  3FM3 A;  1TQI A;  3JTG A;  2KRF A;  3T5X A;  4RB1 A;  4R79 A;  2ACJ A;  3EET A;  3VOD A;  5FD6 A;  1ZG5 A;  2V1U A;  3TDU C;  3RIR A;  2PMH A;  2D1H A;  2ZJ2 A;  2NAZ A;  2PFB A;  3F21 A;  5LHH A;  2F5D A;  3GZ5 A;  2Q2E A;  4A0X A;  3H92 A;  3LAP A;  3I4P A;  1Z6T A;  4I98 B;  4M9S A;  5ERI A;  3GFI A;  4U0V A;  1FYK A;  1ZAR A;  3WGG A;  4ENJ A;  1XGM A;  1UB9 A;  1J75 A;  2FXA A;  1SMT A;  3I59 A;  3KFW X;  2RVC A;  4Q47 A;  2KIU A;  2V6C A;  4KIC A;  3FXQ A;  4EGY A;  1EV7 A;  4I0A A;  3GF2 A;  4CXF A;  5LRS A;  2GWR A;  3L09 A;  3DXJ F;  3K9T A;  3W6K B;  4EJO A;  4UVA A;  3N97 A;  2VOD A;  4ESB A;  3FWE A;  1MDM B;  3RKW A;  1U8R A;  3SZT A;  1HW5 A;  3QPH A;  4L9N A;  3IWZ A;  2K4J A;  5LGU A;  3V8L A;  3J81 Z;  2L01 A;  1TNT A;  1S3J A;  1P4X A;  1USS A;  2E1C A;  1T6S A;  1F4K A;  5CVJ A;  2QM3 A;  4F7Z A;  3JW4 A;  2W25 A;  2GXG A;  1YTY A;  1U3E M;  4YFN F;  3MAJ A;  1TW3 A;  2M5W A;  1P6R A;  5L3F A;  1G3S A;  1XGO A;  1YQA A;  2EFQ A;  3ZMV A;  3ZN1 A;  2MH2 A;  1FBQ A;  1A04 A;  2RN7 A;  3WTX C;  1ZLK A;  2PI0 A;  2EFP A;  3KP2 A;  5HLH A;  4HAM A;  5DCM A;  4I2O A;  2LSO A;  4UUV A;  4HLY A;  3SXY A;  1I1S A;  3BZ6 A;  2XGX A;  3BY6 A;  5AIP A;  2A69 F;  1H0M A;  2NNY A;  2GIV A;  2O03 A;  3PQK A;  5TJJ A;  4WK8 F;  1P92 A;  1XB4 A;  3E6M A;  4B8X A;  1FPQ A;  3S2W A;  1T2K A;  4U7D A;  1X3U A;  3U2R A;  3FXR A;  3EUH A;  4A2U A;  2Z33 A;  2IA0 A;  2LF8 A;  4OMZ A;  2EV6 A;  2R7D A;  1FYL A;  3Q5F A;  1O3S A;  1FP1 D;  2DK8 A;  2CFX A;  1HKT A;  4ENM A;  4KNY A;  1R1T A;  1YIO A;  1MZB A;  4P5O A;  3R6S A;  3J7A O;  4GXO A;  4LB6 B;  4LK1 F;  4PGG A;  5IT9 K;  1TQP A;  2VOP A;  2GXB A;  4IRI A;  1MJA A;  1IN7 A;  3FMS A;  2BBY A;  1OR7 A;  2FNA A;  4HA8 A;  1W4M A;  3HSR A;  3EYY A;  3ABU A;  4KIB A;  1BI2 A;  2MLK A;  1U5T C;  4XRF A;  4EM2 A;  3FHZ A;  5BMZ A;  2HTJ A;  3E5X A;  3GZ6 A;  4HQE A;  1KYZ A;  4DQ2 A;  2OD5 A;  1W5T A;  2D2W A;  2P6S A;  4G6Q A;  1O3Q A;  5FFZ A;  2CGP A;  4PGH A;  4M6Y A;  4EM1 A;  5F64 A;  1YYV A;  3M8E A;  5KVR A;  5JI6 A;  3FF5 A;  1IN8 A;  2YR2 A;  3HRU A;  1BIB A;  2JSC A;  1YG2 A;  1LEA A;  5DD8 A;  3EYI A;  1U78 A;  4U88 A;  1XN7 A;  4ASN A;  2ZBK A;  1JXS A;  1DPR A;  1K79 A;  3COA C;  1ZHF A;  3F6V A;  3KZY A;  1YS7 A;  2IT0 A;  5DUI A;  2KIF A;  1D3Y A;  4EVI A;  1R1U A;  2EA4 A;  3QPT A;  3T0Y A;  1HW1 A;  1F9N A;  5ED4 A;  5DDG A;  3HYI A;  4ESJ A;  5F1R A;  2OA4 A;  5FGM A;  1PUE E;  3KP6 A;  3GVA A;  4A0Z A;  4HX8 A;  2WTE A;  5J8F A;  2P5K A;  2DTR A;  3HUG A;  4WCG A;  1WKM A;  1REP C;  2BGC A;  4IVN A;  3RYR A;  3E5Q A;  1XSV A;  4O6J A;  4AIJ A;  2DPU A;  1FC3 A;  4L5J A;  2RV8 A;  1PP7 U;  2HOE A;  2HEO A;  5E1W A;  3W6J B;  3BOQ A;  2P6T A;  2PG4 A;  2QVO A;  4LD5 A;  3WTZ A;  3K2Z A;  4Q48 A;  2XHK A;  1P4A A;  2VBW A;  2X0L A;  4N0B A;  4LFU A;  5H6Q A;  2QBY A;  1K78 A;  1SD5 A;  3VB2 A;  1G6N A;  4XBF A;  2QQ9 A;  3AAF A;  4FX0 A;  4M9Z A;  2XUB A;  1MKM A;  1Q1H A;  1XCV A;  5JFR A;  3LST A;  3E6D A;  3EDP A;  3KCC A;  2GA1 A;  4ZZL A;  2H94 A;  1KQ8 A;  2EV5 A;  4CYD A;  4M73 A;  2OQG A;  4IXA A;  2M1B A;  3ELK A;  4BH9 A;  2EFO A;  2QQA A;  1YLF A;  4YFK F;  1TNS A;  3ZPL A;  5LRR A;  5DD4 A;  5DCF A;  4KFC A;  1UHM A;  3TGN A;  4HQM A;  1BBY A;  1K6O A;  3OV8 A;  1FBU A;  1Z9C A;  1ZH5 A;  1ZRF A;  2XAQ A;  5DCM B;  2YU3 A;  3TO6 A;  3ABT A;  2JPC A;  5LHI A;  1KA8 A;  2XRO A;  2DAO A;  3E3V A;  2ZNZ A;  4MQV A;  3V8J A;  2ZCW A;  4IRG A;  1K7A A;  1ON2 A;  4IF4 A;  2D45 A;  1LVA A;  1MJB A;  3DFG A;  1E2X A;  1B6A A;  5FFX A;  1KYW A;  3T1B A;  3WTV C;  3O6B B;  3P9K A;  3BJA A;  1QZY A;  3C1D A;  1AOY A;  2KIM A;  2CYY A;  4BAY A;  3F22 A;  3DF8 A;  3RYP A;  3CDH A;  2VOO A;  3CJN A;  3JAM Z;  4YG2 F;  2VBX A;  4L18 B;  1U2W A;  2ISY A;  4CGZ A;  3HOT A;  1JHF A;  2STW A;  4D0P A;  1H9G A;  1IN5 A;  1BC8 C;  4H0E A;  2DLL A;  2YSR A;  4E70 A;  3N4M A;  1IAW A;  3J81 K;  1R5G A;  3QRF F;  2KJC A;  3RJP A;  5ILU A;  1O3T A;  4L9T A;  3B02 A;  4OMY A;  1B9M A;  1Z7U A;  5K5R A;  5LEJ A;  3WGI A;  2MD5 A;  5EEG A;  4KN4 X;  1Z6R A;  1EH6 A;  3GUD A;  2FA5 A;  1BN5 A;  3ML6 A;  1SAX A;  1IXR C;  1L0O C;  2P5L C;  1R22 A;  4OIR F;  3LFK A;  4PDK A;  1MGT A;  1B4A A;  2VT3 A;  4CDG A;  4HLX A;  1KU9 A;  4U0Y A;  4I09 A;  2FSW A;  5LBQ A;  3RPQ A;  5KK1 A;  3QU6 A;  1S7O A;  1UCR A;  2FQ3 A;  3IWF A;  4KA4 A;  2XIG A;  5HS8 A;  5L3B A;  4QWQ A;  2XAS A;  1YFH A;  2MLG A;  3I53 A;  4WWC A;  5LGT A;  4MEX F;  1MJ9 A;  4UHT A;  4ESF A;  3R0A A;  1T39 A;  2DI3 A;  2Z99 A;  4WX9 A;  3CUQ A;  4AIH A;  1BI0 A;  1O7L A;  2P4W A;  2HKO A;  4EJU A;  1J59 A;  3ULQ B;  1ULY A;  3I54 A;  1WQ2 A;  3RTR A;  2EB7 A;  1ZYR F;  1EH7 A;  4MTE A;  1FYM A;  3JSO A;  3BP8 A;  1BOA A;  4UXN A;  2RQP A;  3M1E A;  2YX4 A;  4ZH4 F;  1R36 A;  4M9X A;  4S05 A;  2F5F A;  3QOP A;  1RUO A;  2IA1 A;  1L3L A;  2G7U A;  3TKY A;  5TRD A;  1K78 B;  1G4D A;  2Y75 A;  4EMS A;  1JGS A;  3TO7 A;  4OIN F;  2QQB A;  5E1Z B;  2J5P A;  3WTU C;  1YW9 A;  3BWG A;  2VBY A;  2W24 A;  5JHU A;  1PP8 F;  2O3F A;  1R5H A;  3C7J A;  3WOD F;  3JTH A;  3WTY C;  4EM0 B;  1P2F A;  3K1P A;  1O3R A;  2OZ6 A;  4L0Y B;  1G3Y A;  2TDX A;  5HS9 A;  3QU3 A;  2VT2 A;  1IUY A;  1B9N A;  2J5O A;  2K86 A;  5D8L B;  5DV5 A;  3F72 A;  4XSX F;  2OAZ A;  5CJ9 A;  2MH9 A;  3K1M A;  5FD5 A;  2RDP A;  3MFK A;  3FMQ A;  2O8X A;  2VE9 A;  2X4H A;  1B1B A;  1UHW A;  1Z05 A;  3KP3 A;  3HRM A;  1F5T A;  3F23 A;  4KT5 C;  4GYG A;  3DV8 A;  5DEQ A;  2Y0M A;  3GFL A;  2QYO A;  3IRQ A;  4N9H A;  2W84 A;  3R4K A;  5JVT A;  5ILS A;  4KUM A;  5CYV A;  1ODD A;  3E5U A;  4ZYD A;  4A5N A;  4OIQ F;  3ZMU A;  1LNW A;  2EA2 A;  2EJR A;  3IL2 A;  3F8N A;  4AIK A;  1GVJ A;  3QP6 A;  1BJA A;  1I6X A;  4U7B A;  1S8N A;  5E18 F;  1SD7 A;  4HZF A;  2K27 A;  1BI3 A;  4EJT A;  1HXD A;  2IJL A;  2JT1 A;  4I7H A;  4KN7 X;  3RPU A;  3MWM A;  3LWF A;  2BV6 A;  4CIC A;  4HDV A;  2E7W A;  3ZMT A;  5AON A;  4PZJ A;  5L3D A;  4O5V A;  2AXL A;  5HDG A;  1DUX C;  1NHA A;  2QUF A;  4M6X A;  3E6C C;  1I1G A;  3H3U A;  3WG9 A;  2PN6 A;  3R60 A;  2H09 A;  5D6F A;  1TTY A;  1BM9 A;  2IRF G;  4I01 A;  3ZN0 A;  3KZZ A;  2B0L A;  3T8R A;  1XD7 A;  1I5Z A;  1FZP B;  5A2Q Z;  2L02 A;  4R8H A;  3TQN A;  4B09 A;  4BNC A;  2V1X A;  1TQM A;  2ETH A;  4KDP A;  3QP5 A;  2VBZ A;  2CG4 A;  4BYY A;  1DPU A;  4MNU A;  1H9T A;  5LHG A;  3I5U A;  2OQR A;  2P8T A;  3WE2 A;  4RB0 A;  4OU0 A;  5D4S A;  2MC3 A;  4LJZ F;  1ZGA A;  3BJO A;  2OZU A;  3E6B A;  1S29 A;  3F8C A;  3WE3 A;  4MQ9 F;  1HW2 A;  1R1V A;  2XAJ A;  2HWV A;  3BDD A;  5HDN A;  4AVP A;  2QEN A;  2HQR A;  1SD6 A;  3JAM K;  4ENN A;  1FWZ A;  2DW4 A;  2FMY A;  4HDU A;  2F2E A;  5ICF A;  2Y48 A;  2L54 A;  2DT5 A;  2ZNY A;  4L5I A;  3SHF A;  3GEZ A;  5HDK A;  3J80 Z;  3I59 B;  4IPA A;  3NRV A;  4N9I A;  4M72 A;  5E8I A;  1GXQ A;  3BPV A;  1WWX A;  4LG0 A;  3CUQ B;  2HGC A;  2BYV E;  1JHH A;  1DDN A;  4L9V A;  5D5U B;  2A07 F;  1G3W A;  2BE5 F;  2RKH A;  4HV6 A;  3KP7 A;  5D8K B;  3WGH A;  3GX4 X;  1HKS A;  2P7V B;  3LA7 A;  4RB3 C;  3KET A;  1OMI A;  4HF0 A;  3MQ0 A;  4YFX F;  3TOA A;  4G7H F;  2DQR A;  1J5Y A;  2XVC A;  2FML A;  4Y15 A;  4HF1 A;  1Y0U A;  1EH8 A;  3BJ6 A;  3L2C A;  2L4M A;  3DQV C;  2RC4 A;  2BEO A;  1XSX A;  5BPI A;  4HX4 A;  1T98 A;  2H6C A;  3TO9 A;  3VOE A;  1ZRE A;  4EGZ A;  4UVC A;  3D0S A;  3HTU A;  2E7X A;  3CUO A;  2K02 A;  1QBJ A;  1U5T A;  3CO6 C;  3L7W A;  3K1N A;  1FT9 A;  4GGG A;  1JE8 A;  2LKP A;  2R3S A;  3Q9V A;  3FX3 A;  4HX7 A;  1P4W A;  2HYF A;  4KYW A;  1J7K A;  4RB2 C;  1PDN C;  2E1N A;  3U1D A;  4M71 A;  3IC7 A;  1KU3 A;  4HOB A;  1IZ1 A;  1ZLJ A;  5HLI A;  4ZYG A;  1O57 A;  2CQK A;  2HZT A;  5E20 A;  2PLY A;  3HTS B;  1ZGJ A;  1R58 A;  5K5O A;  2CO5 A;  3SFZ A;  3G73 A;  2QZ8 A;  4O3M A;  2XKO A;  3ZMZ A;  3REO A;  2CW0 F;  2VXZ A;  1D8J A;  1DP7 P;  1LDJ A;  3ECO A;  2FOK A;  5ICG A;  4RAY A;  1G3T A;  3EQL F;  1XCB A;  1WRJ A;  4BXU A;  3CTA A;  2Z3Y A;  4ZYH A;  1D8K A;  1OYW A;  2JRT A;  3IHU A;  2Q8K A;  4BHP A;  2K4B A;  4G7O F;  4Y17 A;  4P9F A;  1MD0 A;  3F8F A;  2HKX A;  1WSU A;  2HS5 A;  4LGW A;  3R61 A;  2IW5 A;  5FLX K;  5F6F A;  2UZK A;  4UV8 A;  2UXX A;  4HYE A;  3LQQ A;  3LA3 A;  1T0F A;  4DNC A;  2ISZ A;  3RDI A;  1QQI A;  2P7C B;  2Z9O A;  2FU4 A;  4EQQ A;  5D4R A;  1U6G A;  4LLG F;  1ZRD A;  2XV4 S;  3VFZ A;  1FBS A;  2FRH A;  5ICC A;  5DUK A;  3GWZ A;  5E17 F;  4XLN F;  3ERE D;  5J8C A;  2M87 A;  2XAG A;  3PFI A;  3R0J A;  2Q0O A;  4LK0 F;  2ELH A;  3KLO A;  1ON1 A;  4L0Z B;  4JQF A;  1QZZ A;  4IJA A;  3FZV A;  1XGS A;  2FBI A;  4LMY A;  1J0R A;  4I02 A;  5CVU A;  2COM A;  2UXN A;  4MHG A;  4I0B A;  4A6E A;  1IF1 A;  1AWC A;  1IN4 A;  4G8X A;  1CF7 A;  4G6D A;  4RGR A;  5L3C A;  5BPD A;  3I64 A;  3IKT A;  3KEQ A;  3ZMD A;  1T38 A;  2LF7 A;  3ISP A;  1Z91 A;  5K5Q A;  5CVI A;  3BRO A;  1SFU A;  1HBX G;  1UST A;  1LJ9 A;  5BQT A;  1WI9 A;  5ICE A;  1IXC A;  2P5V A;  4HV5 A;  4WF2 A;  3O2P E;  5DYM A;  2A3S A;  1F1Z A;  2DO7 A;  2HDC A;  1W7P A;  1ZG3 A;  3QAH A;  2H6B A;  5CVV A;  4IRH A;  3P7N A;  3RKX A;  4LG0 B;  3VEP A;  4LB5 A;  1O7F A;  2A6E F;  4UV9 A;  5HLG A;  3IKV A;  4EJV A;  5AIQ A;  4L9J A;  3I71 A;  1IXS B;  4JK1 X;  3FM5 A;  3WU0 A;  2QBY B;  3Q9S A;  3WTS C;  3ROU A;  4XSZ F;  4A6D A;  5A2Q K;  5FLX Z;  5HOO A;  2YX7 A;  4KMF A;  1J9I A;  2K7L A;  1C0W A;  4RGS A;  3IRR A;  4EJW A;  3V4G A;  3HSF A;  2W57 A;  1YW7 A;  5D5X B;  4NQW A;  1OYY A;  3GLX A;  4A0Y A;  5JR3 A;  4RS8 A;  1YS6 A;  2OU2 A;  3O3K A;  1SFX A;  4HBL A;  3LA2 A;  4FT8 A;  1LDD A;  3G3Z A;  3WTT C;  3HOS A;  2KKO A;  2ZXJ A;  1U5T B;  2L4A A;  1W5S A;  1SD4 A;  3F8B A;  1OYI A;  3MZY A;  4YIF A;  1IRG A;  2WWY A;  3I0T A;  3TDZ C;  2KJB A;  1STZ A;  1ZRC A;  4UVB A;  2DPD A;  2FBH A;  2PJP A;  4ON0 A;  4HF2 A;  4S04 A;  3J80 K;  1ZG1 A;  5D5V B;  3DKW A;  4R1H A;  4BHB A;  1V4R A;  4PCQ A;  2M30 A;  2YPR A;  2RGV A;  2HFH A;  2EK5 A;  2W85 A;  1YO5 C;  1HST A;  4YII A;  3GXO A;  3WTW C;  2ZME A;  6PAX A;  2NYX A;  4FHT A;  4BHC A;  1ZN2 A;  2DQL A;  1SFE A;  2EWN A;  1J2X A;  4P9U A;  1IN6 A;  1IRF A;  2DK5 A;  2VON A;  3V8K A;  3BPX A;  3H3Z A;  2A61 A;  2A68 F;  2NNN A;  1YW8 A;  2IVM A;  1RZ4 A;  2GA2 A;  3SQN A;  5ILV A;  2DBB A;  2CSO A;  3HIF A;  4BQA A;  3M8F A;  2GQQ A;  3C3W A;  3TOB A;  3E97 A;  1FLI A;  4OOI A;  3MEX A;  5CLS A;  1B59 A;  4ENK A;  4G7Z F;  2XRN A;  1FSE A;  4FX4 A;  3M9A A;  2V9V A;  5H20 A;  3P9C A;  5CVR A;  1R7J A;  3HRS A;  2A5Y B;  1SMY F;  4WXC A;  4UNO A;  3V7R A;  3M7G A;  4KIF A;  1QO0 D;  2QLZ A;  1KU2 A;  4M74 A;  3SZP A;  5FO5 A;  2HQN A;  3CLO A;  1ZAO A;  2HTS A;  1KGS A;  2XKP A;  3RKY A;  4GYI A;  4OIO F;  5J6X A;  1CF7 B;  1TBX A;  4ETS A;  3WU1 B;  2O6G E;  2DFI A;  2L3D A;  2MA3 A;  4WXH A;  2ZFW A;  1LB2 A;  2IP2 A;  2ESN A;  1HSJ A;  4LLL A;  2M8E A;  2G7H A;  4IHT A;  1I27 A;  2D1V A;  2G9W A;  4K2E A;  4RAZ A;  1E17 A;  3F3X A;  1R00 A;  1XDS A;  2LDU A;  2GZW A;  5BS6 A;  3T8T A;  2DU9 A;  3GW2 A;  1W7P B;  2QWW A;  1QPM A;  2ZO4 A;  1CGP A;  1FY7 A;  4ZZD A;  4HW0 A;  2WV0 A;  5H6R A;  4MGR A;  1KU7 A;  3P9I A;  2AS5 F;  3KEO A;  3U9G A;  2FE3 A;  4MEY F;  2O61 A;  2UWM A;  3B73 A;  4XLP F;  2EV0 A;  4GCV A;  5IT9 Z;  3GYH X;  1FOK A;  2H27 A; 
#chains in the Genus database with same CATH topology
 3L9F A;  1LPQ A;  1Z67 A;  1WCM J;  2QQ8 A;  5FB2 A;  4PFP A;  3F6O A;  2X6Y A;  3DEU A;  4G94 A;  5L3G A;  1MDM A;  2KDZ A;  1VFC A;  1OCT C;  4XRS G;  2K5C A;  4P96 A;  2HOA A;  1GVD A;  4NB5 A;  3CES A;  3S14 J;  1S6L A;  5CPR B;  3H36 A;  3N05 A;  2CWE A;  3O8G A;  1HQC A;  3D5L A;  2CUE A;  5EGO A;  2F5C A;  2PMU A;  4I6Z A;  2Z5U A;  2WC2 A;  5LGN A;  2M2E A;  4A12 A;  2E1M C;  4IHS A;  5IOZ A;  5LEK A;  3ZQL A;  3GTL J;  2R7U A;  1HKQ A;  1UFM A;  2XAF A;  2CQ7 A;  3KP4 A;  4Y13 A;  2X1E A;  2HYG D;  4YIR X;  1VQM I;  3H1C A;  2ZSI B;  3GFM A;  1DU6 A;  1K4T A;  2EIJ H;  3LQR A;  3PNT A;  2JZY A;  3MZH A;  5EEH A;  3L00 A;  3V7C A;  1RI7 A;  2X9D A;  1VTN C;  3NQO A;  1XSD A;  2ESH A;  2C6Y A;  2CQN A;  1Z1D A;  2FNP A;  5BOX A;  1OPC A;  4NQW B;  3ZMS A;  2XB0 X;  3FXU A;  5E8G A;  2FF4 A;  3OIO A;  1JKR C;  4AD9 A;  1XGN A;  1FNN A;  3JSP A;  1D5Y A;  3S2D J;  2IS2 A;  3S17 J;  3GFJ A;  4JBA A;  3ZQ7 A;  1N25 A;  2ADU A;  5FKL A;  3HRT A;  3CUQ C;  3H0D A;  4MTD A;  2HVR A;  1YRN B;  3OOP A;  5HLT A;  3CCV I;  1V3F A;  3ECH A;  3DWL E;  4D5C A;  4XM3 A;  2XC7 A;  5HS7 A;  3F8M A;  2XF5 A;  3A01 B;  4CO8 A;  1VF9 A;  1XDU A;  1VQK I;  1LQ1 A;  4BBS J;  3NEU A;  1A31 A;  4M3G A;  2DA5 A;  3GO5 A;  1BIA A;  2LY1 A;  2M45 A;  4CUG A;  1W5C C;  1AKH B;  5HVQ C;  1FSH A;  2PBI A;  4LLN A;  4BBR J;  2V79 A;  3FXL A;  3HPG A;  3K4K A;  3GME A;  3H5N A;  4Q4Z F;  3L2V A;  2STT A;  2R7X A;  4A5M A;  4HNT A;  3HDD A;  1RIO H;  4QTR A;  3FXJ A;  2VE8 A;  4QLC U;  1T33 A;  4CHU A;  2JA6 J;  3PQJ A;  3FMR A;  3DP7 A;  4CCN A;  5K1Y A;  1QGP A;  2FEZ A;  2R93 J;  2OCE A;  4WXD A;  3V7S A;  1W36 D;  1TC3 C;  2RNJ A;  2QGU A;  1XMA A;  1GXP A;  1FP2 A;  4ZYE A;  1UZC A;  4P55 A;  4Q5S F;  4E4H A;  4I76 A;  1IW7 F;  1XMK A;  3PFY A;  4Z2Y A;  1S72 I;  1S7A A;  4JYK A;  1W7P D;  1ERD A;  2Y31 A;  3LAJ A;  4IZZ A;  2PMZ A;  4B1R A;  3KE2 A;  2DA7 A;  3MN2 A;  3HL2 A;  3HHG A;  2NS0 A;  3K0L A;  4X0G A;  4FE4 A;  5CQG A;  1OKR A;  5DM6 F;  3PL8 A;  5IT3 A;  2VC0 A;  1X4P A;  3OOU A;  2EFN A;  3P5J A;  3HHH A;  4DBR A;  3KLN A;  2W82 A;  2JTV A;  2GAU A;  2VN2 A;  2Y0S N;  5K7F A;  3DKY A;  4AYB N;  2MBF A;  2VKD A;  1T8I A;  5M5W J;  1VQ4 I;  2ZME B;  1BR2 A;  4EV0 A;  1X1P A;  2JPB A;  2V1D A;  3JRE A;  1WJF A;  3DPT A;  1QNT A;  1LEB A;  1TW2 A;  2IGO A;  4KIG A;  3AL0 B;  2HU9 A;  5D6E A;  1JTX A;  4TV7 A;  4OIP F;  2E60 A;  2W48 A;  3CO7 C;  2ZFU A;  5E1X A;  2V9P A;  2IPQ X;  1ONV A;  3EUH C;  1R23 A;  3W2W A;  2CH0 A;  2DDA A;  1FTT A;  4X1E A;  2LNB A;  4CZZ A;  1FX7 A;  4G9Y A;  4RGX A;  1FOY A;  4Y4R A;  3A0H C;  2OBP A;  3I56 I;  2PEX A;  1R6R A;  1RR7 A;  2PJR B;  3DPL C;  1D0X A;  1D1C A;  3AG2 H;  2R7F A;  4KJZ A;  1NK3 P;  5LLQ A;  1RNL A;  2A6H F;  2LP0 A;  3HSE A;  2XAH A;  3MCZ A;  2WB1 A;  3TMO A;  4LIV A;  5D5W B;  5DM7 F;  1BI1 A;  2ZC2 A;  3E1S A;  3K69 A;  1RPW A;  4CCK A;  3C18 A;  3GLL A;  4F92 B;  5CKT A;  1XG1 A;  3I58 A;  4RGU A;  1YX3 A;  2V4J C;  1LDK B;  1BC7 C;  5HNF A;  2HR3 A;  3OS2 A;  5L3E A;  4KMU X;  5GAD J;  1TLH B;  2LK2 A;  2PQ8 A;  2EFW A;  3VSL A;  2ZKZ A;  1D5V A;  1F43 A;  3PUB A;  5EF6 A;  4U0W A;  1KQ9 A;  4NHJ A;  2IA2 A;  3ASO H;  2IAI A;  3S93 A;  4AWX B;  2JMW A;  2VC1 A;  5GAH J;  1KQ0 A;  3RI4 A;  3KP5 A;  1GHC A;  1IDY A;  1OCR H;  2O0Y A;  2FBK A;  1YX5 A;  1EJ9 A;  3ZP5 A;  1RUN A;  5GPA A;  2NRA C;  2F5E A;  4GO1 A;  3FM3 A;  1TQI A;  3KX2 A;  1RKW A;  3JTG A;  4GFB A;  2KRF A;  3T5X A;  4RB1 A;  1Y6I A;  2DTZ A;  2KLO A;  3BZK A;  2VB6 A;  3PIP F;  4ZYA A;  1UG2 A;  1YIJ I;  1QU3 A;  4BXF A;  3B6A A;  1LFP A;  1TWF J;  4R79 A;  3M8J A;  2ACJ A;  3EET A;  3HJE A;  3OYB A;  3VOD A;  5FD6 A;  1ZG5 A;  1XS9 A;  2V1U A;  3S1M J;  1JTY A;  3TDU C;  3RIR A;  5J47 A;  1JGG A;  1WJA A;  2ZJQ F;  1VQ6 I;  3VYT B;  1VQ5 I;  1FOW A;  2PMH A;  1LUJ B;  2D1H A;  4A3E J;  1VQ8 I;  2ZJ2 A;  3S1N J;  2NAZ A;  1MMG A;  2PFB A;  3QYF A;  3F21 A;  1MMS A;  3FKI J;  2XPV A;  2BY1 A;  5LHH A;  1R49 A;  4D1Q A;  2F5D A;  3GZ5 A;  3A03 A;  2R7W A;  2Q2E A;  4A0X A;  3H92 A;  3LAP A;  4F93 B;  3I4P A;  1Z6T A;  2XAU A;  4I98 B;  1I6H J;  2X1D A;  4M9S A;  2G0E A;  3NAU A;  1QHH D;  5ERI A;  3GFI A;  4U0V A;  5E3N A;  1FYK A;  1ZAR A;  3WGG A;  2XPU A;  5JLX A;  4ENJ A;  5E3L A;  1VI0 A;  1XGM A;  1UB9 A;  4CCM A;  1J75 A;  4PUS A;  2FXA A;  1SMT A;  3I59 A;  3KFW X;  2RVC A;  4L5E A;  2DFF A;  4Q47 A;  3V42 A;  2UV1 A;  2KIU A;  3SYT A;  2V6C A;  4KIC A;  2V6E A;  3FXQ A;  4EGY A;  1EV7 A;  1IUF A;  4XOR A;  4I0A A;  3GF2 A;  1R4M B;  3ZQF A;  3PO2 J;  2LC2 A;  2LYC A;  1UEL B;  1MBF A;  1A35 A;  2CV0 A;  4CXF A;  4A3M J;  5LRS A;  1OLT A;  3OYI A;  2GWR A;  1GDT A;  2D5V A;  3KZI C;  3L09 A;  2M0M A;  3FIS A;  2JN6 A;  5EG0 B;  3OYN A;  3DXJ F;  3K9T A;  3W6K B;  4EJO A;  4UVA A;  3N97 A;  2L0K A;  4B44 A;  2VOD A;  4ESB A;  3ABL H;  3FWE A;  1TWG J;  5HNH A;  2X51 A;  3RKW A;  1MDM B;  1BR1 A;  2HQ5 A;  4JX6 A;  1U8R A;  3SZT A;  1HW5 A;  3QPH A;  4L9N A;  1IDZ A;  3IWZ A;  4BXX J;  1IJW C;  2K4J A;  5LGU A;  2GXA A;  5EGO B;  2FX0 A;  3V8L A;  3IAM 2;  3J81 Z;  2O5R A;  3FK6 A;  1A36 A;  2L01 A;  1TNT A;  1S3J A;  1P4X A;  4XLA A;  1USS A;  2E1C A;  2QSG X;  4BE0 A;  2MGQ A;  1T6S A;  1F4K A;  1JKQ C;  5CVJ A;  1E3O C;  2JK3 A;  2QM3 A;  4F7Z A;  3JW4 A;  2W25 A;  2RAE A;  5TGT A;  3I55 I;  2GXG A;  1WJD A;  1YTY A;  4M6V A;  1U3E M;  4YFN F;  3MAJ A;  3ZQQ A;  5FLM J;  1TW3 A;  2M5W A;  1P6R A;  2VPL A;  5L3F A;  2DCE A;  1G3S A;  1XGO A;  4CH7 A;  1YQA A;  4N4N B;  1ZQ3 P;  1AA7 A;  2EFQ A;  3ZMV A;  3ZN1 A;  2MH2 A;  1WJ5 A;  2BZT A;  1FBQ A;  2L7K A;  1A04 A;  2RN7 A;  3WTX C;  1ZLK A;  2PI0 A;  4F52 A;  2EFP A;  1MBJ A;  3KP2 A;  5HLH A;  4HAM A;  5DCM A;  4I2O A;  2LSO A;  4UUV A;  4HLY A;  3SXY A;  1I1S A;  3BZ6 A;  3VYR B;  2XGX A;  3BY6 A;  5AIP A;  3U1K A;  1XMX A;  2A69 F;  1H0M A;  2NNY A;  2GIV A;  2O03 A;  2Y9Z A;  2W1O A;  3PQK A;  5TJJ A;  4WK8 F;  1P92 A;  1XB4 A;  2M3A A;  4DBQ A;  3E6M A;  3BG9 A;  4B8X A;  2CRG A;  1FPQ A;  3S2W A;  5IOY A;  1T2K A;  1HLV A;  4U7D A;  1X3U A;  1TL8 A;  3U2R A;  3A02 A;  3FXR A;  3EUH A;  1MIJ A;  2DMU A;  4A2U A;  3GTK J;  3I3L A;  2Z33 A;  2BVL A;  2IA0 A;  2IGM A;  2LF8 A;  5J1U A;  4DYC A;  2HNH A;  4KIT B;  4OMZ A;  2EV6 A;  1OCP A;  2R7D A;  3GTJ J;  1FYL A;  3Q5F A;  1O3S A;  3BQY A;  1FP1 D;  1KON A;  2DK8 A;  2CFX A;  2DYS H;  1FOX A;  1HKT A;  2JSP A;  5FKK A;  4ENM A;  4RLF A;  4KNY A;  4U87 A;  1R1T A;  3JRG A;  1YIO A;  3CJR B;  4XK4 A;  1MZB A;  2R7Z J;  4P5O A;  4Y52 J;  3HGG A;  1WZ2 A;  3HKZ N;  3R6S A;  2O9L A;  3J7A O;  3TBI A;  3BTI A;  4GXO A;  4LB6 B;  4LK1 F;  2LD5 A;  4PGG A;  4BY7 J;  1LE8 B;  2KPM A;  5IT9 K;  1TQP A;  2VOP A;  2GXB A;  2BY0 A;  1MJA A;  4IRI A;  1IN7 A;  3FMS A;  2BBY A;  1OR7 A;  2FNA A;  4HA8 A;  1W4M A;  3HSR A;  3EYY A;  3ABU A;  4PFO A;  2F4I A;  2H1K A;  2O8K A;  4KIB A;  1BI2 A;  2BW3 A;  1MND A;  3DEE A;  1U5T C;  2DA4 A;  2MLK A;  4XRF A;  5GPC A;  4EM2 A;  5EEA A;  3FHZ A;  4E7H A;  2NVX J;  2WAF A;  2R0Q C;  2DXI A;  5BMZ A;  2HTJ A;  4XID A;  3E5X A;  1POG A;  3GZ6 A;  3JRC A;  4HQE A;  1KYZ A;  4JX4 A;  4DQ2 A;  2WAQ N;  3ZRG A;  3OYD A;  2OD5 A;  2ZSH B;  5K7H A;  3CME I;  2BHY A;  1W5T A;  2D2W A;  4QIW N;  5IYB J;  2P6S A;  4G6Q A;  3IH2 A;  3IH4 A;  5FFZ A;  1O3Q A;  2NOJ B;  2CGP A;  4RMN A;  2DOE A;  4PGH A;  3L2Q A;  2JVH A;  3A1Y A;  3OS1 A;  1NH3 A;  4M6Y A;  4EM1 A;  5F64 A;  4IKF A;  2A05 A;  1YYV A;  3M8E A;  5KVR A;  5JI6 A;  1R4N B;  2ZXH A;  3FF5 A;  2DOF A;  2M7A A;  3CCL I;  1IN8 A;  2LVS A;  2YR2 A;  2GOX B;  3DLA A;  4XOT A;  3S8P A;  3HRU A;  1BIB A;  3QYB A;  2JSC A;  3S1R J;  1NG7 A;  2JRM A;  3HPH A;  1YG2 A;  2AQF A;  1LEA A;  1GV5 A;  5DD8 A;  3EYI A;  1U78 A;  2X6X A;  4U88 A;  1XN7 A;  4ASN A;  2ZBK A;  2AHQ A;  4A3C J;  1JXS A;  1UHS A;  4C2M J;  4Z6Y A;  1DPR A;  1U9O A;  1ZK8 A;  1K79 A;  3ONQ A;  4B43 A;  3COA C;  1HF0 A;  2M0C A;  1ZHF A;  1ETO A;  3F6V A;  3KZY A;  2HPI A;  1YS7 A;  2M7B A;  2VIX A;  4RAG A;  1JJ8 C;  3S2H J;  2IT0 A;  5DUI A;  2KIF A;  1D3Y A;  1JUM A;  2BVM A;  4EVI A;  3J7A Y;  1R1U A;  2EA4 A;  3QPT A;  1SVM A;  2BXY A;  3T0Y A;  4B4C A;  1HW1 A;  1F9N A;  2ECB A;  1WHU A;  5ED4 A;  2KL4 A;  4XN3 A;  5FRM A;  5DDG A;  3HYI A;  4UUS A;  4ESJ A;  2XSD C;  3MKZ A;  1VZ0 A;  5F1R A;  3S16 J;  2OA4 A;  1T0F C;  1AHD P;  2BY3 A;  2E1O A;  5FGM A;  3ZCO A;  3AFH A;  1PUE E;  3TL4 X;  3KP6 A;  3GVA A;  1K4S A;  4A0Z A;  4HX8 A;  2NOG A;  2W7N A;  2WTE A;  5J8F A;  2P5K A;  4JX5 A;  4BDZ A;  3ZQH A;  1V5E A;  1ETQ A;  2DTR A;  1RES A;  3HUG A;  3EUA A;  2Q2E B;  4WCG A;  1WKM A;  4RBO A;  2K85 A;  1REP C;  2BGC A;  4IVN A;  3TP3 A;  3RYR A;  2GOM A;  3DEW A;  4ZDP A;  3E5Q A;  1XSV A;  3O8H A;  4O6J A;  4A3F J;  1DP3 A;  2VUM J;  4AIJ A;  3W3C A;  4Y3O A;  2DPU A;  1FC3 A;  1ZKG A;  5M5Y J;  4L5J A;  2RV8 A;  1PP7 U;  1MBG A;  3F9K A;  2HOE A;  3OS0 A;  2HEO A;  3AG1 H;  4PJ0 C;  5E1W A;  4C30 A;  3BOQ A;  3W6J B;  1DGR M;  2P6T A;  2PG4 A;  2QVO A;  4LD5 A;  3CC2 I;  1T56 A;  5C3E J;  3WTZ A;  5FKO A;  3K2Z A;  4Q48 A;  2XHK A;  1P4A A;  4JOM A;  4ZJZ A;  3J7Y J;  5C44 J;  2VBW A;  2X0L A;  4N0B A;  4LFU A;  4CA0 A;  3OMY A;  2DDB A;  5H6Q A;  2R7S A;  3LSR A;  4CCL A;  3LNQ A;  3BTC A;  4IOA F;  1J09 A;  2HXO A;  2QBY A;  1K78 A;  1SD5 A;  3VB2 A;  1G6N A;  4XBF A;  2W00 A;  2QQ9 A;  3AAF A;  4FX0 A;  4W97 A;  4M9Z A;  3CC7 I;  4XKV A;  2XUB A;  5KCM A;  1MKM A;  2CW7 A;  3OYH A;  1Q1H A;  1X1C A;  1XCV A;  5JFR A;  1D1A A;  3LST A;  3E6D A;  3EDP A;  1RC9 A;  2A5W A;  2ZB9 A;  3KCC A;  1VQP I;  2GA1 A;  4ZZL A;  3DU6 A;  2H94 A;  1KQ8 A;  2EV5 A;  4CYD A;  4M73 A;  2OQG A;  2Z2S B;  2M1B A;  4IXA A;  3OWT A;  2M9H A;  3ELK A;  4OWR B;  4BAC A;  2K3P A;  4BJ6 C;  4BH9 A;  2EFO A;  2QQA A;  1MMN A;  3KIO A;  1YLF A;  4YFK F;  4J19 A;  3CMM A;  2MFZ A;  3RQI A;  1TNS A;  1R5I D;  3K70 D;  3ZPL A;  2L7Z A;  2HI3 A;  3LSH A;  3PSI A;  5LRR A;  5DD4 A;  5DCF A;  5DS9 A;  4KFC A;  3PNY A;  2ZJP F;  3K4B A;  3GZN B;  1GUU A;  3CCY A;  1UHM A;  4AC0 A;  3TGN A;  1PUF A;  4A3L J;  4HQM A;  2HOS A;  1BBY A;  3I9V 2;  1K6O A;  2IBD A;  3OV8 A;  1FBU A;  1ZEL A;  1Z9C A;  1ZH5 A;  2ZXW H;  1ZRF A;  1OCC H;  1JUP A;  4EAT A;  2XAQ A;  5BNG A;  5DCM B;  2YU3 A;  2V26 A;  3H3V K;  3TO6 A;  1Z0X A;  2JPC A;  3ABT A;  4BKX A;  5LHI A;  3GTG J;  3IAS 2;  4E7K A;  4XNF A;  3W2A A;  1KA8 A;  1X3W B;  4AYB A;  2XRO A;  3NWT A;  1DGW Y;  2DAO A;  1FIA A;  3E3V A;  2DA1 A;  2ZNZ A;  1UJ8 A;  3FXK A;  3K4M A;  4BQQ A;  4MQV A;  2XGC A;  3V8J A;  3OYJ A;  2QCO A;  2L9N A;  2DMT A;  2ZCW A;  4IRG A;  1K7A A;  4I99 C;  1ON2 A;  3BR3 A;  4IF4 A;  2L7M P;  1LVA A;  1MJB A;  2D45 A;  1I50 J;  1OJL A;  3DFG A;  1TT5 B;  3D5S C;  1E2X A;  4RLQ A;  1B6A A;  1EF4 A;  2EIK H;  3FBI B;  2E35 A;  5FFX A;  3MKY B;  1KYW A;  1BR4 A;  2NXN B;  3T1B A;  2OPT A;  3WTV C;  3O6B B;  3P9K A;  3IUO A;  3A2K A;  3BJA A;  1QZY A;  3C1D A;  1S5L C;  5F0F A;  3GTO J;  1AOY A;  2KIM A;  5FJ8 J;  4KIS A;  2CYY A;  1X58 A;  3LSJ A;  4CYC B;  4BAY A;  3F22 A;  1SAN A;  3DF8 A;  4IHV A;  2YU9 J;  3RYP A;  1K6Y A;  2KIQ A;  1E3H A;  1G59 A;  3CDH A;  2VOO A;  3CJN A;  3JAM Z;  3HOU J;  1FIP A;  4YG2 F;  3DCF A;  2QSF X;  2VBX A;  4W1U A;  4L18 B;  4FE7 A;  1U2W A;  4HSR A;  2ISY A;  4CGZ A;  3KYD B;  3HOT A;  2VXD A;  1P7J A;  1JHF A;  4NNJ A;  1EKE A;  2STW A;  3QQA A;  4D0P A;  2EZH A;  1H9G A;  2MG4 A;  3KYC B;  1IN5 A;  4M3E A;  2X1C A;  1BC8 C;  2VJI A;  4ZDO A;  5M5X J;  4H0E A;  2DLL A;  2YSR A;  4E70 A;  3SFI A;  2JA5 J;  3N4M A;  3H5R A;  1R71 A;  1IAW A;  2B7E A;  2Z1D A;  2PX9 A;  3J81 K;  2EBI A;  1R5G A;  3DU5 A;  2AO9 A;  4XKC A;  3QRF F;  2WY8 Q;  2KJC A;  3RJP A;  3SEQ A;  5ILU A;  1O3T A;  2NVQ J;  4L9T A;  3B02 A;  4IQJ A;  4OMY A;  2IEK A;  2RQQ A;  1B9M A;  1Z7U A;  5K5R A;  5LEJ A;  2AXT C;  2R7T A;  3WHC A;  3HOX J;  4Y7N J;  3WGI A;  2MD5 A;  3K4N A;  2EIL H;  3JRD A;  5EEG A;  2O7O A;  3G1L A;  4KN4 X;  1Z6R A;  1EH6 A;  3GUD A;  4FTH A;  4FET A;  3C2G A;  2FA5 A;  1BN5 A;  5IYD J;  3D5R C;  1A6I A;  1WJB A;  2HZD A;  3JRB A;  3ML6 A;  3MKL A;  2E2J J;  1IRZ A;  1MW7 A;  2CW8 A;  1SAX A;  1IXR C;  2DFE A;  1L0O C;  3BCA A;  1V54 H;  2E34 A;  3E7L A;  3VWB A;  4HRI A;  2P5L C;  1R22 A;  5B1A H;  1WVR A;  4OIR F;  4V19 K;  1TT0 A;  3LFK A;  3BG7 A;  4PDK A;  1MGT A;  2HXI A;  3OIP A;  1MMD A;  2F4M B;  2LKS A;  1B4A A;  2WAE A;  5B1B H;  2UUZ A;  3OYK A;  2VT3 A;  2ZME C;  4CDG A;  5LD2 C;  2R5Y A;  1WH5 A;  4HLX A;  1KU9 A;  2EZI A;  1OIS A;  2NVY J;  4DGW B;  3ZGK A;  3OL3 A;  3AL0 C;  1QVU A;  4I09 A;  4AID A;  4U0Y A;  4HST A;  4MFD A;  1SEU A;  2FSW A;  1Z77 A;  2I8D A;  3RPQ A;  5KK1 A;  5LBQ A;  4BGD A;  4F91 B;  3QU6 A;  1S7O A;  5KNL A;  2BOL A;  4GRI A;  4DZP A;  1UCR A;  4BJT A;  2FQ3 A;  1N77 A;  3IWF A;  2DYR H;  4KA4 A;  3AG3 H;  2XIG A;  4H4K C;  4XKB A;  5HS8 A;  5L3B A;  4UUS B;  4QWQ A;  4NUB A;  1G2H A;  2XAS A;  1YFH A;  3UNG C;  5E3O A;  2MLG A;  3I53 A;  4WWC A;  4FQG A;  5JHF A;  2CFO A;  5LGT A;  4QSH A;  2H1L A;  4AVZ A;  4MEX F;  1ZTR A;  1MJ9 A;  3HUG B;  4UHT A;  3CCM I;  3HOV J;  2VPR A;  4ESF A;  1VQ7 I;  1S9H A;  3R0A A;  4CZC A;  5C4J J;  1T39 A;  3HZJ A;  3BR5 A;  2DI3 A;  1G8X A;  2ID6 A;  2Z99 A;  4WX9 A;  5B3S H;  3CUQ A;  4AIH A;  5FKN A;  2EZL A;  3IH3 A;  2GBY A;  2L9V A;  1BI0 A;  1O7L A;  2P4W A;  2HKO A;  4EJU A;  5IP7 J;  1J59 A;  1ULY A;  3ULQ B;  2OJE D;  1WQ2 A;  3I54 A;  3RTR A;  2EB7 A;  1YIT I;  1ZYR F;  1EH7 A;  4MTE A;  3RPU D;  1FYM A;  3JSO A;  3BP8 A;  3G1O A;  5CQE A;  2L9R A;  2CV1 A;  1BOA A;  2X6O A;  4UXN A;  5H2F C;  1GLN A;  2W4S A;  5EZH A;  2RQP A;  2VKH A;  3M1E A;  2CMP A;  2YX4 A;  4ZH4 F;  1R36 A;  4M9X A;  4D9J A;  4S05 A;  3HOZ J;  2F5F A;  3QOP A;  4XR6 A;  3PM1 A;  3RZD J;  1RUO A;  3CCJ I;  5GTH C;  2IA1 A;  1L3L A;  2G7U A;  3TKY A;  2XDV A;  4A3I J;  3PO3 J;  5TRD A;  3GCM A;  1K78 B;  1M1E B;  3BT9 A;  3DLL F;  1G4D A;  2Y75 A;  4EMS A;  4QPQ A;  2EZK A;  1JGS A;  2KRH A;  3TO7 A;  5M3M J;  4OIN F;  2RRE A;  4BJ5 C;  3OSG A;  2QQB A;  5E1Z B;  2J5P A;  3WTU C;  4MLO A;  2FOW A;  3LSG A;  1YW9 A;  3BWG A;  2VBY A;  4ANJ A;  2MC4 A;  4E7I A;  2W24 A;  3CZ6 A;  3IP4 B;  5JHU A;  2O3F A;  1PP8 F;  1B72 A;  5KAI C;  1R5H A;  3C7J A;  1LFU P;  4DJA A;  3CF2 A;  3WOD F;  3BZC A;  3JTH A;  3WTY C;  4EM0 B;  3PIO F;  3L1P A;  4D7N A;  4FCY A;  1P2F A;  3K1P A;  1I39 A;  1O3R A;  3FXM A;  1BL0 A;  2OZ6 A;  4L0Y B;  1VQ9 I;  1G3Y A;  2TDX A;  5HS9 A;  1R9T J;  3QU3 A;  3CCU I;  5E79 C;  4V2G A;  2VT2 A;  1IUY A;  1B9N A;  3Q3S A;  2KDO A;  2J5O A;  2K86 A;  5D8L B;  1SVL A;  9ANT A;  5DV5 A;  1PUF B;  3F72 A;  1YRN A;  3L2W A;  4XSX F;  4BEH A;  2K40 A;  3ABK H;  2EPF A;  2OAZ A;  5CJ9 A;  2MH9 A;  3K1M A;  1QRY A;  5FD5 A;  2RDP A;  2YS9 A;  3MFK A;  3A01 A;  2ICW G;  3FMQ A;  1YE9 A;  2O8X A;  2CUJ A;  3OYG A;  2X4H A;  2VE9 A;  4LIT A;  5FKM A;  2LKX A;  1B1B A;  1UHW A;  2HOT A;  1Z05 A;  3KP3 A;  3M1C A;  2KZV A;  3HRM A;  4BDY A;  1F5T A;  4KT6 A;  3TED A;  2M34 A;  1Y8R B;  1V55 H;  3F23 A;  4KT5 C;  4GYG A;  3DV8 A;  5DEQ A;  2Y0M A;  3GFL A;  2QYO A;  3IRQ A;  4BS9 A;  3OY9 A;  4N9H A;  2W84 A;  3R4K A;  5JVT A;  1ETK A;  5ILS A;  1IV6 A;  4KUM A;  3SEZ A;  5CYV A;  1X2N A;  1ODD A;  3E5U A;  1IV8 A;  2F4O B;  4CCJ A;  4ZYD A;  2WAQ A;  4A5N A;  3S1Q J;  4OIQ F;  3ZMU A;  1LNW A;  4PJN A;  2EA2 A;  2EJR A;  3JRI A;  3S3N A;  3IL2 A;  2DA6 A;  3F8N A;  2DJN A;  2DMQ A;  4AIK A;  1GVJ A;  2VJ5 A;  4BQN A;  3QP6 A;  1BJA A;  2KRC A;  1I6X A;  3CLQ A;  4U7B A;  1S8N A;  2H8R A;  5E18 F;  1SD7 A;  2M4K A;  3KYL A;  2Y69 H;  4HZF A;  2K27 A;  1BI3 A;  4JP0 A;  4EJT A;  1HXD A;  2R7O A;  2E5N A;  5JVG F;  2IJL A;  3GTQ J;  2JT1 A;  2MAB A;  2VQC A;  2LTP A;  3CMY A;  4RM3 A;  4I7H A;  4C3I J;  4KN7 X;  4EEF G;  3RPU A;  3MWM A;  1RR8 C;  1U9N A;  4ZTJ A;  1MH4 A;  3LWF A;  2LH9 A;  3L2U A;  2BV6 A;  2K9N A;  4CIC A;  4HDV A;  4A3B J;  1U8B A;  2E7W A;  2XGD A;  3ZQI A;  3ZMT A;  2N8G A;  5AON A;  3E0J B;  4PZJ A;  4ZC3 A;  5L3D A;  5F04 A;  3CDL A;  1YJW I;  1ETW A;  1MSE C;  4O5V A;  2AXL A;  3HM5 A;  5HDG A;  3OYM A;  4ABZ A;  1DUX C;  1BJZ A;  1NHA A;  3WU2 C;  4DYQ A;  2QUF A;  4M6X A;  3E6C C;  5M3F J;  3IV5 A;  1I1G A;  2IS1 A;  4UB6 C;  3H3U A;  3DKX A;  3WG9 A;  2PN6 A;  1XC5 A;  3R60 A;  2H09 A;  5D6F A;  1TTY A;  3BR6 A;  5J4Y A;  1BM9 A;  2VKV A;  2JWT A;  4G12 A;  4I01 A;  3ZN0 A;  3KZZ A;  2IRF G;  4IQ4 A;  2B0L A;  2BXZ A;  4NC6 A;  3LMM A;  3T8R A;  2LBF A;  1U0J A;  1ETY A;  1XD7 A;  1I5Z A;  4IOC F;  4IX7 A;  1FZP B;  5A2Q Z;  2L02 A;  4R8H A;  2X48 A;  3TQN A;  4E7J A;  3DPU A;  5JLW A;  4B09 A;  4BNC A;  5LFA A;  3S3O A;  2XPW A;  3QPS A;  2V1X A;  1TQM A;  2ETH A;  2OUM A;  4KDP A;  3QP5 A;  2VBZ A;  2CG4 A;  1FEX A;  4DIQ A;  3RQ4 A;  2KHM A;  4BYY A;  4E6K G;  4B3X A;  1DPU A;  3DTE A;  4MNU A;  4N4O B;  4A69 C;  1H9T A;  2TCT A;  5LHG A;  3I5U A;  2OQR A;  2P8T A;  3WE2 A;  2DA2 A;  4RB0 A;  3W6V A;  1VQL I;  4OU0 A;  4D5F A;  1MNE A;  2XF7 A;  5D4S A;  3CD6 I;  2MC3 A;  4DYR A;  4LJZ F;  1ZGA A;  3JRH A;  3BJO A;  4BUP A;  2OZU A;  3W2V A;  3E6B A;  2JUG A;  1S29 A;  4OAY A;  4IHW A;  4X6A J;  2X6W A;  1RRJ A;  3MVP A;  3F8C A;  2R5Y B;  1Y39 A;  4A3J J;  1MMA A;  2LLK A;  2E36 A;  3WE3 A;  4MQ9 F;  4RAF A;  2XB5 A;  2KT0 A;  1QHG A;  1HOM A;  2OTJ I;  1HW2 A;  2DOD A;  3S15 J;  1R1V A;  2XAJ A;  3CCR I;  1Y0N A;  2HWV A;  2VQH A;  3BDD A;  3LSM A;  1W0T A;  1LKX A;  5HDN A;  2E1M B;  4AVP A;  2QEN A;  3H0G J;  1WH7 A;  4DW6 A;  1X2M A;  2MW8 A;  2P81 A;  2HQR A;  1SD6 A;  3JAM K;  4ENN A;  1FWZ A;  1H8A C;  2DW4 A;  2FMY A;  2WA0 A;  5ICF A;  1Z21 A;  2F2E A;  4HDU A;  3QWL A;  1Y8Q B;  4XQF A;  3CP2 A;  1SFO J;  2VQG A;  4G6T B;  2GIZ A;  3OR1 C;  1V5F A;  2Y48 A;  2L54 A;  2VJ4 A;  2DT5 A;  3MMY B;  2ZNY A;  3Q0V A;  4L5I A;  3SHF A;  1DU0 A;  3GEZ A;  5HDK A;  2B9S A;  1X1D A;  3J80 Z;  3I59 B;  4IPA A;  3NRV A;  2DOA A;  4N9I A;  4M72 A;  5E8I A;  1GXQ A;  3BPV A;  3HC7 A;  1WWX A;  4UUT A;  3CMA I;  4LG0 A;  3Q0U A;  2LRE A;  3CUQ B;  2HGC A;  3HEF A;  3M4O J;  3AG4 H;  2BYV E;  3SDB A;  1JHH A;  1DDN A;  2CJJ A;  4L9V A;  5D5U B;  3Q0W A;  1HDP A;  3C2B A;  2A07 F;  1TWC J;  1ETV A;  1G3W A;  2DT6 A;  2BE5 F;  2RKH A;  4HV6 A;  4AUX A;  2HYJ A;  3H9G A;  3K4L A;  1QA6 A;  3KP7 A;  5D8K B;  2XRL A;  4C2T A;  1ZGW A;  4HEA 2;  3OYF A;  1V5G A;  2E5Z A;  3WGH A;  1PYV A;  3MD2 A;  2V9K A;  3GX4 X;  1JT6 A;  1HKS A;  5B66 C;  2P7V B;  1MBE A;  3LA7 A;  2KMU A;  2FJ1 A;  2VLA A;  4RB3 C;  5E3M A;  3KET A;  1OMI A;  4HF0 A;  3MQ0 A;  4YFX F;  1IRX A;  3FBN B;  3TOA A;  4G7H F;  2K3F A;  1W0U A;  2DQR A;  2M8G X;  1J5Y A;  2XVC A;  2DA3 A;  1WPK A;  2FML A;  4Y15 A;  4HF1 A;  4B48 A;  1FMV A;  3EPZ A;  3K4J A;  1Y0U A;  1EH8 A;  3DBR B;  3ASN H;  3BJ6 A;  2K9S A;  3HG9 A;  2Q1Z B;  2HDD A;  3L2C A;  2DT7 B;  3A4C A;  1W36 C;  5IP6 A;  1WJC A;  3DTK A;  2L2O A;  2L4M A;  4B3A A;  3LSK A;  3DQV C;  2RC4 A;  2BEO A;  1XSX A;  4XMY A;  5BPI A;  1B72 B;  3HBL A;  4HX4 A;  1T98 A;  2H6C A;  3TO9 A;  3CF5 F;  3VOE A;  2V1N A;  1ZR2 A;  3MKW B;  2ME6 A;  1JT0 A;  1ZRE A;  4EGZ A;  4UVC A;  4A3D J;  3D0S A;  1T08 B;  3CJQ B;  3HTU A;  3BQZ A;  2E7X A;  3CUO A;  4C3H J;  2K02 A;  2MSY A;  1QBJ A;  1U5T A;  4QPO A;  3CO6 C;  5C4X J;  5B5E C;  4BY1 J;  1SAU A;  3L7W A;  3K1N A;  2R7V A;  5HOD A;  4M3D A;  2Y0S A;  3JRA A;  4BEH B;  1FT9 A;  4BQO A;  4S0H B;  1N78 A;  4GGG A;  1JE8 A;  2LKP A;  2R3S A;  3Q9V A;  3FX3 A;  4IO9 F;  4NC7 A;  4HX7 A;  1P4W A;  1OFC X;  2HYF A;  3RCO A;  2CUZ A;  1XX5 A;  4KYW A;  3OYA A;  1J7K A;  2JUC A;  3GBG A;  3H5A A;  1B8I A;  4RB2 C;  1PDN C;  2E1N A;  3U1D A;  4M71 A;  3IC7 A;  3QPL A;  1KU3 A;  4HOB A;  5GP9 A;  5J3L A;  4XRM A;  4AM3 A;  2MD0 A;  3ZQG A;  1IZ1 A;  1ZLJ A;  5HLI A;  2WAD A;  4ZYG A;  1K83 J;  2X85 A;  1O57 A;  2CQK A;  2HZT A;  2CQX A;  3CP8 A;  5E20 A;  4MFE A;  4F3Q A;  2PLY A;  1VND A;  1WGX A;  3HTS B;  1ZGJ A;  1R58 A;  5K5O A;  2CO5 A;  3SFZ A;  2NVT J;  1IO2 A;  3G73 A;  4XL9 A;  5FRN A;  2QZ8 A;  5GTI C;  1QZE A;  1MNM C;  4O3M A;  2XKO A;  3ZOB A;  1GT0 C;  2CU7 A;  4XLH A;  3ZMZ A;  2Y30 A;  4ITV A;  3REO A;  2CW0 F;  2VXZ A;  3VYS B;  1D8J A;  2DMN A;  1DP7 P;  3BR0 A;  1IGN A;  1LDJ A;  3ECO A;  3BG6 A;  2FOK A;  5ICG A;  2NS8 A;  3QYE A;  4RAY A;  1G3T A;  1SFK A;  3EQL F;  1XCB A;  4RM2 A;  5J1Y A;  2R5Z A;  1IG7 A;  3S3M A;  3BR1 A;  5F0C A;  1WRJ A;  1LE8 A;  2WV1 A;  4BXU A;  2IS4 A;  3CTA A;  2Z3Y A;  4ZYH A;  1SVO A;  1D8K A;  1OYW A;  2JRT A;  3IHU A;  3JCU C;  2Q8K A;  1APL C;  1YHQ I;  4BHP A;  3QOE A;  2BW3 B;  2OC6 A;  2K4B A;  4G7O F;  4Y17 A;  4P9F A;  1MD0 A;  3F8F A;  5IPA A;  2HKX A;  3DBL B;  4DOZ A;  3K7A J;  3H9J A;  1WSU A;  2HS5 A;  4E7L A;  4LGW A;  1QVT A;  3R61 A;  2IW5 A;  3GTM J;  5FLX K;  1KZH A;  2QKL B;  5F6F A;  2KZG A;  3CQZ J;  2NVU B;  2KP6 A;  3ERM A;  3MZ8 A;  2UZK A;  5J1R A;  2LOO A;  4UV8 A;  4D7M A;  2UXX A;  4J00 A;  4HYE A;  3LQQ A;  2JVG A;  3LA3 A;  1T0F A;  4DNC A;  1X3Z B;  1P7I A;  2LFB A;  2P0W A;  2ISZ A;  3RDI A;  1QQI A;  2P7C B;  2Z9O A;  2FU4 A;  1OQY A;  2PMZ N;  4EQQ A;  1MH3 A;  5D4R A;  3I4N J;  4HPQ A;  1U6G A;  3PNV A;  2R7R A;  3OYL A;  4FIS A;  2Y2Z A;  4LLG F;  1LFB A;  2XV4 S;  1ZRD A;  3VFZ A;  3C2H A;  3K6G A;  1FBS A;  1OCZ H;  2LBF B;  2FRH A;  2LG4 A;  5ICC A;  5DUK A;  1IC8 A;  3GWZ A;  3J7Z I;  5E17 F;  3JR9 A;  4XLN F;  3EUK L;  2LY9 A;  3ERE D;  5J8C A;  2M87 A;  3LOC A;  2XAG A;  3CCE I;  2ID3 A;  3PFI A;  3R0J A;  1OCO H;  2Q0O A;  4LK0 F;  2Z16 A;  4A3K J;  5F08 A;  2ELH A;  3KLO A;  1XTA A;  3DTI A;  1ON1 A;  1TP4 A;  1OR7 C;  4JQF A;  1UAA A;  4L0Z B;  1QZZ A;  4IJA A;  2NS7 A;  4XRS A;  3FZV A;  1XGS A;  4BE1 A;  4V2F A;  2L9S A;  2FBI A;  4LMY A;  1J0R A;  4I02 A;  4OAZ A;  2COM A;  5CVU A;  4E7S A;  5IP9 J;  2UXN A;  1ITY A;  4MHG A;  3CCQ I;  2K9Q A;  4I0B A;  4A6E A;  4IHY A;  3TW6 A;  1IF1 A;  4XLF A;  1AWC A;  1IN4 A;  4C9Y A;  4G8X A;  3AKZ A;  1CF7 A;  5K7Z A;  2VI6 A;  4G6D A;  4PSX A;  4RGR A;  5L3C A;  5BPD A;  5J4V A;  3I64 A;  3IKT A;  1Z3Y A;  3KEQ A;  3ZMD A;  1T38 A;  4J01 A;  2WB1 N;  2LF7 A;  3ISP A;  1Z91 A;  5K5Q A;  5CVI A;  3BRO A;  3D1N I;  1SFU A;  1WI3 A;  3DBH B;  4RDU A;  1HBX G;  1UST A;  1RET A;  2QF7 A;  1LJ9 A;  5BQT A;  3S32 A;  1WI9 A;  3CC4 I;  5ICE A;  2AQE A;  4C3J J;  3GTP J;  1IXC A;  2P5V A;  4HV5 A;  4WF2 A;  2K9M A;  2CS3 A;  5DTD A;  3RZO J;  3O2P E;  3B6C A;  5DYM A;  2A3S A;  1VQO I;  1F1Z A;  4BE2 A;  1NTC A;  1MBK A;  2K9L A;  2DO7 A;  2HDC A;  1W7P A;  1ZG3 A;  3QAH A;  3G4S I;  2H6B A;  5CVV A;  4NBQ A;  4IRH A;  4CCO A;  3P7N A;  3CJT B;  3RKX A;  4LG0 B;  3VEP A;  1YJN I;  4LB5 A;  1O7F A;  1Y56 A;  5EDN A;  2A6E F;  1CQT A;  1I3Q J;  4IEJ A;  2WBM A;  3H9Q A;  4UV9 A;  5HLG A;  4IHX A;  3IKV A;  4EJV A;  5AIQ A;  4L9J A;  3I71 A;  4NDL A;  4M3B A;  1IXS B;  1JJ6 C;  4JK1 X;  1O4X A;  2DJI A;  3FM5 A;  2H8W A;  3WU0 A;  2IGN A;  2QBY B;  4IL6 C;  5GAG J;  3FHN A;  4E7Z A;  4B47 A;  3BG3 A;  3G2B A;  3Q9S A;  5F0H A;  3WTS C;  2F48 A;  3ROU A;  3JRF A;  4XSZ F;  5IY5 H;  4A6D A;  4XON A;  2DFH A;  2EIM H;  3FIW A;  4XOP A;  2QA4 I;  5A2Q K;  1FTZ A;  4C2U A;  5FLX Z;  5HOO A;  2YX7 A;  5EYR A;  2GM4 A;  4KMF A;  5FLV A;  1J9I A;  1TWH J;  1TZL A;  3KEY A;  2K7L A;  3OYC A;  1C0W A;  2E2H J;  2OTL I;  5FRO A;  4DZJ A;  4RGS A;  1E3P A;  2IGK A;  3IRR A;  4EJW A;  2EIN H;  4PSW A;  3V4G A;  3HSF A;  4NC8 A;  2JQ7 A;  2W57 A;  1PJR A;  1YW7 A;  5D5X B;  4NQW A;  1HA8 A;  1OYY A;  1UMQ A;  3GLX A;  3ABM H;  4A0Y A;  5JR3 A;  2WY7 Q;  4PK4 A;  3OR2 C;  1A6Q A;  1MBH A;  4RS8 A;  1YS6 A;  2OU2 A;  1LVK A;  2VQL A;  3X2Q H;  3O3K A;  3VPR A;  1SFX A;  3M07 A;  2XGE A;  4HBL A;  3VYU B;  4ZDL A;  3LA2 A;  4FT8 A;  1LDD A;  2I5U A;  3HKZ A;  3TW7 A;  3OL4 A;  3G3Z A;  2IS6 A;  5IYC J;  4II2 A;  3SZG A;  1E0E A;  1WJE A;  2A6T A;  5EZG A;  3KPH A;  3TP0 A;  1YJ9 I;  1ETX A;  3WTT C;  3HOS A;  2KKO A;  2ZXJ A;  4YEJ A;  2V7F A;  1U5T B;  2VKE A;  2L4A A;  2FD5 A;  5GAE J;  3FKJ A;  1W5S A;  1SD4 A;  3HOY J;  3BC8 A;  3F8B A;  1OYI A;  3L2R A;  5KAF C;  2HDW A;  1ZR4 A;  3MZY A;  1AKH A;  4YIF A;  1IRG A;  2OV7 A;  1T95 A;  2WWY A;  2OF7 A;  3I0T A;  3TDZ C;  2OCC H;  2JA7 J;  2KJB A;  3NAR A;  4PJM A;  1HCR A;  2LRD A;  3NWS A;  1B8I B;  1STZ A;  1ZRC A;  1BOB A;  3ESW B;  4UVB A;  2DPD A;  2FBH A;  2L7F P;  4AU7 A;  4XN0 A;  2PJP A;  1N75 A;  4CSW A;  2FQ4 A;  4ON0 A;  4HF2 A;  3QOD A;  1MSF C;  2IXS A;  4S04 A;  3J80 K;  2GLO A;  1ZG1 A;  2KIS A;  4HG2 A;  3DKW A;  5D5V B;  1ACI A;  2KQR A;  4R1H A;  4XKW A;  4BU2 A;  4BHB A;  3U21 A;  2E71 A;  2LY2 A;  2CV2 A;  2ECC A;  1V4R A;  2XF6 A;  3LSI A;  3OIQ A;  4PCQ A;  4UY8 I;  2M30 A;  1Y1V J;  2YPR A;  3CCS I;  2HPM A;  4CYC A;  4GDF A;  1DQU A;  3RSN A;  3SDG A;  3UKG A;  2RGV A;  2JJ7 A;  2HFH A;  2EK5 A;  2W85 A;  2RNG A;  4XLE A;  3BCB A;  4A3G J;  1YO5 C;  1HST A;  5EJC A;  5F1J A;  4YII A;  1NG6 A;  3GXO A;  3WTW C;  2R5Z B;  1GV2 A;  2ZME A;  2HVQ A;  4PJJ A;  6PAX A;  5TIS C;  2NYX A;  2CUF A;  4LOC A;  3K10 A;  4FHT A;  4BHC A;  1D0Z A;  1ZN2 A;  2CQQ A;  2DQL A;  2EH3 A;  5KHD A;  1SFE A;  2EWN A;  1J2X A;  4P9U A;  1S7E A;  1IN6 A;  1IRF A;  3K2A A;  3ZXS A;  4BL0 B;  2DK5 A;  2QKM B;  3VSK A;  1HC8 A;  4P1W A;  2VJJ A;  2VON A;  3PJR A;  3PUF A;  3V8K A;  3BPX A;  2ME0 A;  3H3Z A;  5F27 A;  2ZXI A;  2A61 A;  2A68 F;  2NNN A;  1YW8 A;  2Y9Y A;  4II3 A;  2IVM A;  1FMW A;  3F0C A;  1VQN I;  1RZ4 A;  2GA2 A;  3FDY A;  3SQN A;  2COB A;  4LIU A;  5ILV A;  2PJR A;  2DBB A;  2CSO A;  3HIF A;  4BQA A;  3LFU A;  3M8F A;  2GQQ A;  3ZQC A;  2ELJ A;  3C3W A;  2QSH X;  3TOB A;  3E97 A;  1BA5 A;  1W1W E;  1YOV B;  1FLI A;  4OOI A;  3MEX A;  3BR2 A;  5CLS A;  1A5J A;  1UG0 A;  3OYE A;  2B63 J;  1HDD C;  1B59 A;  2E2I J;  4ENK A;  4F55 A;  4FAS D;  1P9Q C;  1YI2 I;  4PJL A;  4G7Z F;  3I4M J;  2XRN A;  1FSE A;  2HVS A;  3PSF A;  4FX4 A;  3M9A A;  2V9V A;  1F36 A;  5H20 A;  2VL8 A;  3UR3 C;  1Z3X A;  2FUG 2;  3P9C A;  5CVR A;  1R7J A;  1I3A A;  2MYS A;  3M3Y J;  3HRS A;  2DMP A;  2A5Y B;  1SMY F;  4WXC A;  1JI8 A;  4UNO A;  3V7R A;  2R4G A;  3M7G A;  2BHZ A;  1JUS A;  4KIF A;  1QO0 D;  2QLZ A;  1D0Y A;  1H88 C;  1KU2 A;  3G1M A;  3HGY A;  4M74 A;  2I10 A;  3SZP A;  3ZR8 X;  5FO5 A;  3WG7 H;  4HNU A;  2HQN A;  5J40 A;  2KFD A;  1XPX A;  3CLO A;  1ZAO A;  2HTS A;  3OSF A;  1KGS A;  4UB8 C;  4MIM A;  2XKP A;  2E19 A;  4GYI A;  3RKY A;  4YRV A;  1ENH A;  4OIO F;  2JA2 A;  2XSJ C;  3BG5 A;  4MO7 A;  3LL7 A;  2TRT A;  4Y33 A;  5J6X A;  3BLY A;  2F5V A;  4XIC A;  1CF7 B;  1BW5 A;  1TBX A;  4ETS A;  3WU1 B;  2R7Q A;  2O6G E;  2LMD A;  3WHB A;  2DFI A;  2JA8 J;  2YUS A;  2L3D A;  2VAS A;  1ORK A;  1WFX A;  2MA3 A;  3G71 I;  4WXH A;  2ZFW A;  2L5Q A;  1LB2 A;  2IP2 A;  1JKP C;  2ESN A;  1X19 A;  1HSJ A;  4LLL A;  2M8E A;  2G7H A;  4HNV A;  4IHT A;  4YEL A;  3HB9 A;  1I27 A;  2D1V A;  2G9W A;  3SJM A;  4K2E A;  3LSP A;  4XLC A;  4RAZ A;  2HQA A;  3HOW J;  3K4C A;  1E17 A;  3A0B C;  1X1B A;  3G6E I;  3F3X A;  1H89 C;  1R00 A;  1XDS A;  2LDU A;  2GZW A;  1K61 A;  3BTJ A;  5BS6 A;  2F6C A;  3T8T A;  2DU9 A;  3GW2 A;  1W7P B;  2QWW A;  3VDX A;  1QPM A;  1Y1W J;  2ZO4 A;  1CGP A;  2DN0 A;  1FY7 A;  2EQR A;  4ZZD A;  4HW0 A;  4RA2 A;  2QEX I;  4ZTF A;  1QPI A;  3K70 C;  1X4O A;  2WV0 A;  4LG3 A;  1PVE A;  1RKT A;  5H6R A;  4A93 J;  4MGR A;  2M4G A;  3HXL A;  1KU7 A;  3P9I A;  1AU7 A;  2ELK A;  2AS5 F;  3KEO A;  4M3F A;  1BW6 A;  2BY2 A;  3RKQ A;  3U9G A;  2FE3 A;  1NK2 P;  4MEY F;  2LR8 A;  3CDI A;  1D1B A;  2O61 A;  2UWM A;  3B73 A;  3FK7 A;  4XLP F;  1FJL A;  1Q1V A;  2EV0 A;  1EA3 A;  4GCV A;  2ZJR F;  1SC7 A;  2R92 J;  3GYH X;  1TWA J;  5IT9 Z;  5EG0 A;  3BTL A;  1FOK A;  3FXO A;  2H27 A;  3H35 A;  1X1A A;  1JKO C;  1Z7L A; 
#chains in the Genus database with same CATH homology
 3L9F A;  5FB2 A;  3F6O A;  3DEU A;  4G94 A;  5L3G A;  1MDM A;  4P96 A;  4NB5 A;  1S6L A;  2CWE A;  1HQC A;  3D5L A;  2F5C A;  2PMU A;  2Z5U A;  2WC2 A;  5LGN A;  4A12 A;  4IHS A;  5LEK A;  1HKQ A;  1UFM A;  2XAF A;  3KP4 A;  4Y13 A;  2HYG D;  3GFM A;  3LQR A;  2JZY A;  3MZH A;  5EEH A;  3L00 A;  3V7C A;  1RI7 A;  1VTN C;  3NQO A;  1XSD A;  2ESH A;  2C6Y A;  1Z1D A;  2FNP A;  5BOX A;  1OPC A;  3ZMS A;  3FXU A;  5E8G A;  2FF4 A;  4AD9 A;  1XGN A;  1FNN A;  3JSP A;  3GFJ A;  4JBA A;  3ZQ7 A;  2ADU A;  3HRT A;  3CUQ C;  4MTD A;  3OOP A;  1V3F A;  3ECH A;  5HS7 A;  3F8M A;  4CO8 A;  1XDU A;  1LQ1 A;  3NEU A;  3GO5 A;  1BIA A;  2M45 A;  5HVQ C;  1FSH A;  2PBI A;  4LLN A;  2V79 A;  4Q4Z F;  2STT A;  4A5M A;  1RIO H;  2VE8 A;  4QLC U;  4CHU A;  3PQJ A;  3FMR A;  3DP7 A;  5K1Y A;  1QGP A;  2FEZ A;  4WXD A;  3V7S A;  2RNJ A;  1XMA A;  1GXP A;  1FP2 A;  4ZYE A;  4P55 A;  4Q5S F;  1IW7 F;  1XMK A;  4Z2Y A;  1S7A A;  1W7P D;  3LAJ A;  3KE2 A;  3HHG A;  2NS0 A;  3K0L A;  1OKR A;  5IT3 A;  2VC0 A;  2EFN A;  3HHH A;  3KLN A;  2JTV A;  2GAU A;  2VN2 A;  2MBF A;  2ZME B;  4EV0 A;  2JPB A;  2V1D A;  3DPT A;  1QNT A;  1LEB A;  1TW2 A;  4KIG A;  5D6E A;  4TV7 A;  4OIP F;  3CO7 C;  5E1X A;  2IPQ X;  1ONV A;  1R23 A;  2LNB A;  4CZZ A;  1FX7 A;  4G9Y A;  4RGX A;  2OBP A;  2PEX A;  3DPL C;  2R7F A;  5LLQ A;  1RNL A;  2A6H F;  3HSE A;  2XAH A;  3MCZ A;  5D5W B;  1BI1 A;  3K69 A;  3C18 A;  3I58 A;  4RGU A;  1BC7 C;  1LDK B;  2HR3 A;  5L3E A;  4KMU X;  1TLH B;  2PQ8 A;  2EFW A;  2ZKZ A;  1D5V A;  4U0W A;  1KQ9 A;  4NHJ A;  2IA2 A;  4AWX B;  2VC1 A;  1KQ0 A;  3RI4 A;  3KP5 A;  1GHC A;  2O0Y A;  2FBK A;  3ZP5 A;  1RUN A;  2NRA C;  2F5E A;  4GO1 A;  3FM3 A;  1TQI A;  3JTG A;  2KRF A;  3T5X A;  4RB1 A;  4R79 A;  2ACJ A;  3EET A;  3VOD A;  5FD6 A;  1ZG5 A;  2V1U A;  3TDU C;  3RIR A;  2PMH A;  2D1H A;  2ZJ2 A;  2NAZ A;  2PFB A;  3F21 A;  5LHH A;  2F5D A;  3GZ5 A;  2Q2E A;  4A0X A;  3H92 A;  3LAP A;  3I4P A;  1Z6T A;  4I98 B;  4M9S A;  5ERI A;  3GFI A;  4U0V A;  1FYK A;  1ZAR A;  3WGG A;  4ENJ A;  1XGM A;  1UB9 A;  1J75 A;  2FXA A;  1SMT A;  3I59 A;  3KFW X;  2RVC A;  4Q47 A;  2KIU A;  2V6C A;  4KIC A;  3FXQ A;  4EGY A;  1EV7 A;  4I0A A;  3GF2 A;  4CXF A;  5LRS A;  2GWR A;  3L09 A;  3DXJ F;  3K9T A;  3W6K B;  4EJO A;  4UVA A;  3N97 A;  2VOD A;  4ESB A;  3FWE A;  1MDM B;  3RKW A;  1U8R A;  3SZT A;  1HW5 A;  3QPH A;  4L9N A;  3IWZ A;  2K4J A;  5LGU A;  3V8L A;  3J81 Z;  2L01 A;  1TNT A;  1S3J A;  1P4X A;  1USS A;  2E1C A;  1T6S A;  1F4K A;  5CVJ A;  2QM3 A;  4F7Z A;  3JW4 A;  2W25 A;  2GXG A;  1YTY A;  1U3E M;  4YFN F;  3MAJ A;  1TW3 A;  2M5W A;  1P6R A;  5L3F A;  1G3S A;  1XGO A;  1YQA A;  2EFQ A;  3ZMV A;  3ZN1 A;  2MH2 A;  1FBQ A;  1A04 A;  2RN7 A;  3WTX C;  1ZLK A;  2PI0 A;  2EFP A;  3KP2 A;  5HLH A;  4HAM A;  5DCM A;  4I2O A;  2LSO A;  4UUV A;  4HLY A;  3SXY A;  1I1S A;  3BZ6 A;  2XGX A;  3BY6 A;  5AIP A;  2A69 F;  1H0M A;  2NNY A;  2GIV A;  2O03 A;  3PQK A;  5TJJ A;  4WK8 F;  1P92 A;  1XB4 A;  3E6M A;  4B8X A;  1FPQ A;  3S2W A;  1T2K A;  4U7D A;  1X3U A;  3U2R A;  3FXR A;  3EUH A;  4A2U A;  2Z33 A;  2IA0 A;  2LF8 A;  4OMZ A;  2EV6 A;  2R7D A;  1FYL A;  3Q5F A;  1O3S A;  1FP1 D;  2DK8 A;  2CFX A;  1HKT A;  4ENM A;  4KNY A;  1R1T A;  1YIO A;  1MZB A;  4P5O A;  3R6S A;  3J7A O;  4GXO A;  4LB6 B;  4LK1 F;  4PGG A;  5IT9 K;  1TQP A;  2VOP A;  2GXB A;  4IRI A;  1MJA A;  1IN7 A;  3FMS A;  2BBY A;  1OR7 A;  2FNA A;  4HA8 A;  1W4M A;  3HSR A;  3EYY A;  3ABU A;  4KIB A;  1BI2 A;  2MLK A;  1U5T C;  4XRF A;  4EM2 A;  3FHZ A;  5BMZ A;  2HTJ A;  3E5X A;  3GZ6 A;  4HQE A;  1KYZ A;  4DQ2 A;  2OD5 A;  1W5T A;  2D2W A;  2P6S A;  4G6Q A;  1O3Q A;  5FFZ A;  2CGP A;  4PGH A;  4M6Y A;  4EM1 A;  5F64 A;  1YYV A;  3M8E A;  5KVR A;  5JI6 A;  3FF5 A;  1IN8 A;  2YR2 A;  3HRU A;  1BIB A;  2JSC A;  1YG2 A;  1LEA A;  5DD8 A;  3EYI A;  1U78 A;  4U88 A;  1XN7 A;  4ASN A;  2ZBK A;  1JXS A;  1DPR A;  1K79 A;  3COA C;  1ZHF A;  3F6V A;  3KZY A;  1YS7 A;  2IT0 A;  5DUI A;  2KIF A;  1D3Y A;  4EVI A;  1R1U A;  2EA4 A;  3QPT A;  3T0Y A;  1HW1 A;  1F9N A;  5ED4 A;  5DDG A;  3HYI A;  4ESJ A;  5F1R A;  2OA4 A;  5FGM A;  1PUE E;  3KP6 A;  3GVA A;  4A0Z A;  4HX8 A;  2WTE A;  5J8F A;  2P5K A;  2DTR A;  3HUG A;  4WCG A;  1WKM A;  1REP C;  2BGC A;  4IVN A;  3RYR A;  3E5Q A;  1XSV A;  4O6J A;  4AIJ A;  2DPU A;  1FC3 A;  4L5J A;  2RV8 A;  1PP7 U;  2HOE A;  2HEO A;  5E1W A;  3W6J B;  3BOQ A;  2P6T A;  2PG4 A;  2QVO A;  4LD5 A;  3WTZ A;  3K2Z A;  4Q48 A;  2XHK A;  1P4A A;  2VBW A;  2X0L A;  4N0B A;  4LFU A;  5H6Q A;  2QBY A;  1K78 A;  1SD5 A;  3VB2 A;  1G6N A;  4XBF A;  2QQ9 A;  3AAF A;  4FX0 A;  4M9Z A;  2XUB A;  1MKM A;  1Q1H A;  1XCV A;  5JFR A;  3LST A;  3E6D A;  3EDP A;  3KCC A;  2GA1 A;  4ZZL A;  2H94 A;  1KQ8 A;  2EV5 A;  4CYD A;  4M73 A;  2OQG A;  4IXA A;  2M1B A;  3ELK A;  4BH9 A;  2EFO A;  2QQA A;  1YLF A;  4YFK F;  1TNS A;  3ZPL A;  5LRR A;  5DD4 A;  5DCF A;  4KFC A;  1UHM A;  3TGN A;  4HQM A;  1BBY A;  1K6O A;  3OV8 A;  1FBU A;  1Z9C A;  1ZH5 A;  1ZRF A;  2XAQ A;  5DCM B;  2YU3 A;  3TO6 A;  3ABT A;  2JPC A;  5LHI A;  1KA8 A;  2XRO A;  2DAO A;  3E3V A;  2ZNZ A;  4MQV A;  3V8J A;  2ZCW A;  4IRG A;  1K7A A;  1ON2 A;  4IF4 A;  2D45 A;  1LVA A;  1MJB A;  3DFG A;  1E2X A;  1B6A A;  5FFX A;  1KYW A;  3T1B A;  3WTV C;  3O6B B;  3P9K A;  3BJA A;  1QZY A;  3C1D A;  1AOY A;  2KIM A;  2CYY A;  4BAY A;  3F22 A;  3DF8 A;  3RYP A;  3CDH A;  2VOO A;  3CJN A;  3JAM Z;  4YG2 F;  2VBX A;  4L18 B;  1U2W A;  2ISY A;  4CGZ A;  3HOT A;  1JHF A;  2STW A;  4D0P A;  1H9G A;  1IN5 A;  1BC8 C;  4H0E A;  2DLL A;  2YSR A;  4E70 A;  3N4M A;  1IAW A;  3J81 K;  1R5G A;  3QRF F;  2KJC A;  3RJP A;  5ILU A;  1O3T A;  4L9T A;  3B02 A;  4OMY A;  1B9M A;  1Z7U A;  5K5R A;  5LEJ A;  3WGI A;  2MD5 A;  5EEG A;  4KN4 X;  1Z6R A;  1EH6 A;  3GUD A;  2FA5 A;  1BN5 A;  3ML6 A;  1SAX A;  1IXR C;  1L0O C;  2P5L C;  1R22 A;  4OIR F;  3LFK A;  4PDK A;  1MGT A;  1B4A A;  2VT3 A;  4CDG A;  4HLX A;  1KU9 A;  4U0Y A;  4I09 A;  2FSW A;  5LBQ A;  3RPQ A;  5KK1 A;  3QU6 A;  1S7O A;  1UCR A;  2FQ3 A;  3IWF A;  4KA4 A;  2XIG A;  5HS8 A;  5L3B A;  4QWQ A;  2XAS A;  1YFH A;  2MLG A;  3I53 A;  4WWC A;  5LGT A;  4MEX F;  1MJ9 A;  4UHT A;  4ESF A;  3R0A A;  1T39 A;  2DI3 A;  2Z99 A;  4WX9 A;  3CUQ A;  4AIH A;  1BI0 A;  1O7L A;  2P4W A;  2HKO A;  4EJU A;  1J59 A;  3ULQ B;  1ULY A;  3I54 A;  1WQ2 A;  3RTR A;  2EB7 A;  1ZYR F;  1EH7 A;  4MTE A;  1FYM A;  3JSO A;  3BP8 A;  1BOA A;  4UXN A;  2RQP A;  3M1E A;  2YX4 A;  4ZH4 F;  1R36 A;  4M9X A;  4S05 A;  2F5F A;  3QOP A;  1RUO A;  2IA1 A;  1L3L A;  2G7U A;  3TKY A;  5TRD A;  1K78 B;  1G4D A;  2Y75 A;  4EMS A;  1JGS A;  3TO7 A;  4OIN F;  2QQB A;  5E1Z B;  2J5P A;  3WTU C;  1YW9 A;  3BWG A;  2VBY A;  2W24 A;  5JHU A;  1PP8 F;  2O3F A;  1R5H A;  3C7J A;  3WOD F;  3JTH A;  3WTY C;  4EM0 B;  1P2F A;  3K1P A;  1O3R A;  2OZ6 A;  4L0Y B;  1G3Y A;  2TDX A;  5HS9 A;  3QU3 A;  2VT2 A;  1IUY A;  1B9N A;  2J5O A;  2K86 A;  5D8L B;  5DV5 A;  3F72 A;  4XSX F;  2OAZ A;  5CJ9 A;  2MH9 A;  3K1M A;  5FD5 A;  2RDP A;  3MFK A;  3FMQ A;  2O8X A;  2VE9 A;  2X4H A;  1B1B A;  1UHW A;  1Z05 A;  3KP3 A;  3HRM A;  1F5T A;  3F23 A;  4KT5 C;  4GYG A;  3DV8 A;  5DEQ A;  2Y0M A;  3GFL A;  2QYO A;  3IRQ A;  4N9H A;  2W84 A;  3R4K A;  5JVT A;  5ILS A;  4KUM A;  5CYV A;  1ODD A;  3E5U A;  4ZYD A;  4A5N A;  4OIQ F;  3ZMU A;  1LNW A;  2EA2 A;  2EJR A;  3IL2 A;  3F8N A;  4AIK A;  1GVJ A;  3QP6 A;  1BJA A;  1I6X A;  4U7B A;  1S8N A;  5E18 F;  1SD7 A;  4HZF A;  2K27 A;  1BI3 A;  4EJT A;  1HXD A;  2IJL A;  2JT1 A;  4I7H A;  4KN7 X;  3RPU A;  3MWM A;  3LWF A;  2BV6 A;  4CIC A;  4HDV A;  2E7W A;  3ZMT A;  5AON A;  4PZJ A;  5L3D A;  4O5V A;  2AXL A;  5HDG A;  1DUX C;  1NHA A;  2QUF A;  4M6X A;  3E6C C;  1I1G A;  3H3U A;  3WG9 A;  2PN6 A;  3R60 A;  2H09 A;  5D6F A;  1TTY A;  1BM9 A;  2IRF G;  4I01 A;  3ZN0 A;  3KZZ A;  2B0L A;  3T8R A;  1XD7 A;  1I5Z A;  1FZP B;  5A2Q Z;  2L02 A;  4R8H A;  3TQN A;  4B09 A;  4BNC A;  2V1X A;  1TQM A;  2ETH A;  4KDP A;  3QP5 A;  2VBZ A;  2CG4 A;  4BYY A;  1DPU A;  4MNU A;  1H9T A;  5LHG A;  3I5U A;  2OQR A;  2P8T A;  3WE2 A;  4RB0 A;  4OU0 A;  5D4S A;  2MC3 A;  4LJZ F;  1ZGA A;  3BJO A;  2OZU A;  3E6B A;  1S29 A;  3F8C A;  3WE3 A;  4MQ9 F;  1HW2 A;  1R1V A;  2XAJ A;  2HWV A;  3BDD A;  5HDN A;  4AVP A;  2QEN A;  2HQR A;  1SD6 A;  3JAM K;  4ENN A;  1FWZ A;  2DW4 A;  2FMY A;  4HDU A;  2F2E A;  5ICF A;  2Y48 A;  2L54 A;  2DT5 A;  2ZNY A;  4L5I A;  3SHF A;  3GEZ A;  5HDK A;  3J80 Z;  3I59 B;  4IPA A;  3NRV A;  4N9I A;  4M72 A;  5E8I A;  1GXQ A;  3BPV A;  1WWX A;  4LG0 A;  3CUQ B;  2HGC A;  2BYV E;  1JHH A;  1DDN A;  4L9V A;  5D5U B;  2A07 F;  1G3W A;  2BE5 F;  2RKH A;  4HV6 A;  3KP7 A;  5D8K B;  3WGH A;  3GX4 X;  1HKS A;  2P7V B;  3LA7 A;  4RB3 C;  3KET A;  1OMI A;  4HF0 A;  3MQ0 A;  4YFX F;  3TOA A;  4G7H F;  2DQR A;  1J5Y A;  2XVC A;  2FML A;  4Y15 A;  4HF1 A;  1Y0U A;  1EH8 A;  3BJ6 A;  3L2C A;  2L4M A;  3DQV C;  2RC4 A;  2BEO A;  1XSX A;  5BPI A;  4HX4 A;  1T98 A;  2H6C A;  3TO9 A;  3VOE A;  1ZRE A;  4EGZ A;  4UVC A;  3D0S A;  3HTU A;  2E7X A;  3CUO A;  2K02 A;  1QBJ A;  1U5T A;  3CO6 C;  3L7W A;  3K1N A;  1FT9 A;  4GGG A;  1JE8 A;  2LKP A;  2R3S A;  3Q9V A;  3FX3 A;  4HX7 A;  1P4W A;  2HYF A;  4KYW A;  1J7K A;  4RB2 C;  1PDN C;  2E1N A;  3U1D A;  4M71 A;  3IC7 A;  1KU3 A;  4HOB A;  1IZ1 A;  1ZLJ A;  5HLI A;  4ZYG A;  1O57 A;  2CQK A;  2HZT A;  5E20 A;  2PLY A;  3HTS B;  1ZGJ A;  1R58 A;  5K5O A;  2CO5 A;  3SFZ A;  3G73 A;  2QZ8 A;  4O3M A;  2XKO A;  3ZMZ A;  3REO A;  2CW0 F;  2VXZ A;  1D8J A;  1DP7 P;  1LDJ A;  3ECO A;  2FOK A;  5ICG A;  4RAY A;  1G3T A;  3EQL F;  1XCB A;  1WRJ A;  4BXU A;  3CTA A;  2Z3Y A;  4ZYH A;  1D8K A;  1OYW A;  2JRT A;  3IHU A;  2Q8K A;  4BHP A;  2K4B A;  4G7O F;  4Y17 A;  4P9F A;  1MD0 A;  3F8F A;  2HKX A;  1WSU A;  2HS5 A;  4LGW A;  3R61 A;  2IW5 A;  5FLX K;  5F6F A;  2UZK A;  4UV8 A;  2UXX A;  4HYE A;  3LQQ A;  3LA3 A;  1T0F A;  4DNC A;  2ISZ A;  3RDI A;  1QQI A;  2P7C B;  2Z9O A;  2FU4 A;  4EQQ A;  5D4R A;  1U6G A;  4LLG F;  1ZRD A;  2XV4 S;  3VFZ A;  1FBS A;  2FRH A;  5ICC A;  5DUK A;  3GWZ A;  5E17 F;  4XLN F;  3ERE D;  5J8C A;  2M87 A;  2XAG A;  3PFI A;  3R0J A;  2Q0O A;  4LK0 F;  2ELH A;  3KLO A;  1ON1 A;  4L0Z B;  4JQF A;  1QZZ A;  4IJA A;  3FZV A;  1XGS A;  2FBI A;  4LMY A;  1J0R A;  4I02 A;  5CVU A;  2COM A;  2UXN A;  4MHG A;  4I0B A;  4A6E A;  1IF1 A;  1AWC A;  1IN4 A;  4G8X A;  1CF7 A;  4G6D A;  4RGR A;  5L3C A;  5BPD A;  3I64 A;  3IKT A;  3KEQ A;  3ZMD A;  1T38 A;  2LF7 A;  3ISP A;  1Z91 A;  5K5Q A;  5CVI A;  3BRO A;  1SFU A;  1HBX G;  1UST A;  1LJ9 A;  5BQT A;  1WI9 A;  5ICE A;  1IXC A;  2P5V A;  4HV5 A;  4WF2 A;  3O2P E;  5DYM A;  2A3S A;  1F1Z A;  2DO7 A;  2HDC A;  1W7P A;  1ZG3 A;  3QAH A;  2H6B A;  5CVV A;  4IRH A;  3P7N A;  3RKX A;  4LG0 B;  3VEP A;  4LB5 A;  1O7F A;  2A6E F;  4UV9 A;  5HLG A;  3IKV A;  4EJV A;  5AIQ A;  4L9J A;  3I71 A;  1IXS B;  4JK1 X;  3FM5 A;  3WU0 A;  2QBY B;  3Q9S A;  3WTS C;  3ROU A;  4XSZ F;  4A6D A;  5A2Q K;  5FLX Z;  5HOO A;  2YX7 A;  4KMF A;  1J9I A;  2K7L A;  1C0W A;  4RGS A;  3IRR A;  4EJW A;  3V4G A;  3HSF A;  2W57 A;  1YW7 A;  5D5X B;  4NQW A;  1OYY A;  3GLX A;  4A0Y A;  5JR3 A;  4RS8 A;  1YS6 A;  2OU2 A;  3O3K A;  1SFX A;  4HBL A;  3LA2 A;  4FT8 A;  1LDD A;  3G3Z A;  3WTT C;  3HOS A;  2KKO A;  2ZXJ A;  1U5T B;  2L4A A;  1W5S A;  1SD4 A;  3F8B A;  1OYI A;  3MZY A;  4YIF A;  1IRG A;  2WWY A;  3I0T A;  3TDZ C;  2KJB A;  1STZ A;  1ZRC A;  4UVB A;  2DPD A;  2FBH A;  2PJP A;  4ON0 A;  4HF2 A;  4S04 A;  3J80 K;  1ZG1 A;  5D5V B;  3DKW A;  4R1H A;  4BHB A;  1V4R A;  4PCQ A;  2M30 A;  2YPR A;  2RGV A;  2HFH A;  2EK5 A;  2W85 A;  1YO5 C;  1HST A;  4YII A;  3GXO A;  3WTW C;  2ZME A;  6PAX A;  2NYX A;  4FHT A;  4BHC A;  1ZN2 A;  2DQL A;  1SFE A;  2EWN A;  1J2X A;  4P9U A;  1IN6 A;  1IRF A;  2DK5 A;  2VON A;  3V8K A;  3BPX A;  3H3Z A;  2A61 A;  2A68 F;  2NNN A;  1YW8 A;  2IVM A;  1RZ4 A;  2GA2 A;  3SQN A;  5ILV A;  2DBB A;  2CSO A;  3HIF A;  4BQA A;  3M8F A;  2GQQ A;  3C3W A;  3TOB A;  3E97 A;  1FLI A;  4OOI A;  3MEX A;  5CLS A;  1B59 A;  4ENK A;  4G7Z F;  2XRN A;  1FSE A;  4FX4 A;  3M9A A;  2V9V A;  5H20 A;  3P9C A;  5CVR A;  1R7J A;  3HRS A;  2A5Y B;  1SMY F;  4WXC A;  4UNO A;  3V7R A;  3M7G A;  4KIF A;  1QO0 D;  2QLZ A;  1KU2 A;  4M74 A;  3SZP A;  5FO5 A;  2HQN A;  3CLO A;  1ZAO A;  2HTS A;  1KGS A;  2XKP A;  3RKY A;  4GYI A;  4OIO F;  5J6X A;  1CF7 B;  1TBX A;  4ETS A;  3WU1 B;  2O6G E;  2DFI A;  2L3D A;  2MA3 A;  4WXH A;  2ZFW A;  1LB2 A;  2IP2 A;  2ESN A;  1HSJ A;  4LLL A;  2M8E A;  2G7H A;  4IHT A;  1I27 A;  2D1V A;  2G9W A;  4K2E A;  4RAZ A;  1E17 A;  3F3X A;  1R00 A;  1XDS A;  2LDU A;  2GZW A;  5BS6 A;  3T8T A;  2DU9 A;  3GW2 A;  1W7P B;  2QWW A;  1QPM A;  2ZO4 A;  1CGP A;  1FY7 A;  4ZZD A;  4HW0 A;  2WV0 A;  5H6R A;  4MGR A;  1KU7 A;  3P9I A;  2AS5 F;  3KEO A;  3U9G A;  2FE3 A;  4MEY F;  2O61 A;  2UWM A;  3B73 A;  4XLP F;  2EV0 A;  4GCV A;  5IT9 Z;  3GYH X;  1FOK A;  2H27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...