3F21A

Crystal structure of zalpha in complex with d(cacgtg)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
67
structure length
67
Chain Sequence
LSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Double-stranded RNA-specific adenosine deaminase
publication title The structures of non-CG-repeat Z-DNAs co-crystallized with the Z-DNA-binding domain, hZ{alpha}ADAR1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f21A00
3M8FA 3BWGA 2H27A 3GUDA 4M71A 2DU9A 2O8XA 5ICGA 5LLQA 3V7RA 3GLXA 1JE8A 5CVVA 4OIPF 3BZ6A 2D1VA 1FP1D 3E5UA 3N97A 5CYVA 3WGHA 2ADUA 2LDUA 3ULQB 3WU0A 4HX8A 1YG2A 5ILSA 1MGTA 4LK1F 2KJCA 1J7KA 3LFKA 5DD8A 2PEXA 2HKXA 4UNOA 2QQ9A 5DCMA 4MHGA 2FE3A 3MCZA 1O3RA 3KP7A 5LHIA 4KICA 4M9XA 5FLXZ 5L3FA 2GZWA 4KNYA 3K2ZA 3C7JA 2F5FA 3KFWX 3K69A 4HA8A 2L4AA 2E1NA 4LG0A 3L7WA 4IPAA 3WTZA 2HYGD 3K9TA 1HKSA 3RKXA 2DPDA 2RC4A 1RUNA 3HHHA 3OV8A 2EV0A 1HW1A 2D45A 2O6GE 1TQPA 2F5CA 4AIHA 3GXOA 3F22A 1MJ9A 5JVTA 4HAMA 1K7AA 2K02A 1BIBA 5D4RA 5FD5A 1IN8A 2A61A 5DUKA 1WRJA 2QUFA 1YQAA 4BYYA 1Z7UA 1W7PA 2XASA 1HKTA 2XHKA 2DW4A 2MH9A 1I6XA 4PGGA 3N4MA 2YU3A 4U0YA 3CUQC 3COAC 2LF8A 5ICEA 5HDKA 2EJRA 1XGOA 1ZRCA 4M9SA 1MZBA 4CICA 2PMUA 4B8XA 2M87A 3RYRA 1LDKB 1R7JA 4MQVA 1FSHA 2QQAA 2LF7A 5JHUA 2DPUA 2EA2A 1HQCA 2LNBA 1YW8A 4MQ9F 5CJ9A 2MLKA 2MA3A 2HFHA 1S3JA 1XDUA 1RZ4A 4OIOF 2L3DA 3J80K 2XGXA 1GHCA 2P5VA 1NHAA 4EGYA 2G7UA 1I1GA 2EV5A 1SAXA 4A6DA 1W7PD 2GXGA 3G3ZA 2PN6A 4IF4A 3TGNA 3V8JA 2GA1A 2ZNZA 1H9TA 1WI9A 2P7CB 1EH6A 4A5NA 4KUMA 3I59A 3LA3A 5HLGA 3R60A 4MTDA 1CF7A 3ML6A 4RGRA 4KA4A 1A04A 4XBFA 2MC3A 5AIQA 4D0PA 1TLHB 3RI4A 2H6BA 3L2CA 3H3UA 1Z6RA 3U2RA 4WX9A 3R61A 4L9TA 5F1RA 1IRFA 5L3CA 2YR2A 2MH2A 4IJAA 1FBQA 4WF2A 2J5PA 2K27A 5CLSA 1FZPB 3KLNA 4YG2F 3P7NA 1R22A 4LLNA 1BM9A 3DV8A 3K1MA 2M5WA 2HWVA 2O0YA 1ZYRF 4YFXF 2M8EA 1XCVA 2JT1A 3MAJA 3M8EA 2HQRA 3MQ0A 1LQ1A 4HQMA 1O3SA 5IT9K 2NAZA 2HTSA 1ON1A 4RGSA 3RJPA 2EFNA 1FSEA 4Y17A 2XUBA 2VOOA 1XSXA 1YYVA 2IA0A 3KCCA 5LRRA 1EV7A 4OMZA 3FXQA 4ENNA 1YIOA 2JZYA 2VT2A 2WTEA 2QYOA 4JQFA 3ZPLA 3LWFA 3LA2A 2EWNA 2D1HA 2ACJA 1P4XA 3JW4A 2R3SA 1BN5A 3RPUA 3KEOA 4A2UA 4L9VA 1VTNC 2JSCA 5JFRA 3ERED 4ETSA 1USTA 2PFBA 3RTRA 3BJAA 3DEUA 3E6BA 3WU1B 3LQQA 5D5UB 1TW3A 1FOKA 1YS6A 5HOOA 5D5XB 4HQEA 3GFJA 1BIAA 1IZ1A 2KIUA 1LDJA 4N0BA 3G73A 4G7OF 2PJPA 2IPQX 5L3EA 2KJBA 5E1XA 5BOXA 4KIGA 3SXYA 2VC1A 1DPUA 3ZMTA 5BQTA 2QENA 4TV7A 3QRFF 1XDSA 4EMSA 4OU0A 3K0LA 1HW2A 4G8XA 4N9IA 1PDNC 2F5EA 1ZHFA 2DTRA 1XB4A 5A2QZ 1KU3A 3HSRA 4HDVA 3GFLA 3DFGA 1FC3A 3EYIA 1ZN2A 4IHTA 2HZTA 3O2PE 4EJWA 2P8TA 2P7VB 2W24A 5LRSA 1KQ8A 3MEXA 3V4GA 4EJTA 4RAZA 3ZMUA 4KIFA 3S2WA 3H92A 2D2WA 4XLNF 3J81K 3KZZA 2HS5A 3F8CA 4RB0A 2ZNYA 3DPTA 2VBWA 1G3TA 2DBBA 2C6YA 2FMYA 3BP8A 3HRMA 4I01A 2BGCA 1U6GA 3WTWC 5K5RA 5K5OA 3TDZC 1BBYA 3KE2A 1U3EM 2CG4A 3ELKA 3TOAA 3B02A 3F6VA 3T0YA 5J8CA 4HV5A 4Q47A 2V1DA 1R5GA 1S29A 5JR3A 1TQMA 4M74A 3I4PA 4FHTA 6PAXA 1ZGAA 3IWZA 4I7HA 4LMYA 5E18F 1D5VA 2FBHA 3QP6A 3JAMK 1REPC 2Y0MA 3SQNA 1TQIA 1BOAA 1T98A 4KDPA 1B4AA 2L54A 1CGPA 4WXCA 2VONA 2A6EF 2K4JA 1GXQA 3HOTA 1KA8A 3P9CA 4UHTA 1V3FA 5F6FA 5CVJA 3WTVC 5L3BA 1R00A 2F5DA 4ZYDA 2YX7A 3T1BA 1YTYA 4UVAA 2KIFA 1S7OA 2IA2A 1ZG5A 4I2OA 2PLYA 1XCBA 5HLIA 3V8LA 5DV5A 3F72A 2CSOA 2FNPA 3FMQA 1FNNA 1SMTA 1U5TC 2IVMA 5FLXK 3FXRA 3WTUC 2FBKA 1P2FA 2GAUA 3Q9VA 2M30A 2FOKA 2HR3A 1Z91A 1UB9A 4PZJA 2XV4S 1W5SA 3GWZA 1DUXC 2RKHA 2NRAC 3E6DA 4P9UA 5J6XA 5D5VB 1K79A 1J5YA 3E97A 2L02A 2QBYA 4A0XA 3QPTA 1YFHA 3ABUA 1Z9CA 2FRHA 3TDUC 2IA1A 1YLFA 4OOIA 3CO6C 2IRFG 4GGGA 2MLGA 2ZMEA 3GZ6A 1ZH5A 3DXJF 4EVIA 1B6AA 4EM1A 3HRTA 3LAJA 1QO0D 4WK8F 4MEXF 3DQVC 3DPLC 4EJOA 4AIKA 1K78B 3T8RA 4U88A 5LHGA 3V8KA 3FX3A 2HQNA 3FMRA 3QP5A 1Z05A 5HVQC 1OYYA 2OU2A 4P55A 3K1NA 4UV8A 2L01A 2X4HA 2AXLA 3WTYC 4HF2A 1MDMB 3HSFA 4HOBA 4XLPF 1SFEA 1I1SA 4ENJA 4I98B 4PDKA 3E3VA 4HZFA 4BHCA 5LGUA 1LJ9A 5HDGA 4HDUA 2FU4A 1B1BA 2V6CA 1R36A 1D8JA 4EGZA 2EV6A 5HS8A 4AVPA 1PP7U 2FF4A 3FZVA 4EQQA 3M7GA 1B9MA 4LFUA 3CUQB 4G7ZF 4BQAA 2VE9A 4PGHA 5FD6A 2CFXA 2COMA 3JSOA 4HF0A 1ZRFA 1YW7A 3RKWA 5K5QA 1ZG1A 3K1PA 2UZKA 5ED4A 1KU7A 3HRUA 3ZMSA 5HDNA 3BPVA 1J0RA 3BJOA 1XGNA 4KFCA 4RGXA 3P9KA 5KVRA 1RNLA 5HS7A 1R23A 4G6DA 3SZPA 4MEYF 5DYMA 1O57A 2HTJA 4ON0A 5H6QA 2BBYA 1RI7A 3EETA 4CHUA 1W5TA 1XN7A 3T5XA 2JPCA 3F6OA 4ZZDA 2P5KA 4GCVA 2P4WA 2CGPA 1H9GA 2XAGA 1TBXA 3LAPA 1UFMA 4ZYEA 1L3LA 4R79A 1SFXA 1U8RA 4CGZA 1LB2A 4A0YA 3D0SA 1OYWA 3QU3A 4Q4ZF 1DDNA 2JPBA 5AONA 3TQNA 1FBSA 2O03A 2RDPA 1HSJA 1UHMA 2ZBKA 5DCMB 4PCQA 5E1WA 2M45A 3PQJA 3CTAA 1OYIA 3P9IA 3E5QA 4OMYA 3MWMA 4YFNF 5BMZA 4LG0B 4ENMA 2EA4A 2LKPA 5L3DA 4ZZLA 4WWCA 4LLGF 2X0LA 1ZLKA 1HXDA 1WKMA 3R0AA 2RVCA 2BEOA 3LA7A 3WTTC 2PQ8A 2ESHA 5LBQA 4KN4X 3WE3A 2DO7A 2Z3YA 5LEKA 2DT5A 3KP4A 5FFXA 1F9NA 4ESBA 2WWYA 5A2QK 1D8KA 1S7AA 3I5UA 4KIBA 4E70A 2FSWA 3DKWA 2B0LA 4Q5SF 1OKRA 1XD7A 2H09A 2A6HF 4MTEA 3FXUA 1W7PB 1IAWA 3F3XA 2Q8KA 4NQWA 2F2EA 1ZREA 3T8TA 4XRFA 2EFWA 1IW7F 4HYEA 1ODDA 2GIVA 1FP2A 3CUOA 2FNAA 4LK0F 3MFKA 3AAFA 4ZYHA 4BAYA 3F8NA 1YS7A 5H6RA 2PG4A 5FO5A 2RNJA 3E6MA 1TNSA 4RAYA 1E17A 3ZMVA 3HIFA 3M1EA 2EK5A 4U0VA 2Y48A 3H3ZA 5CVRA 4LB6B 4MGRA 2UWMA 4OIRF 2VXZA 2OD5A 4HLYA 4QWQA 1BC7C 2O3FA 4JBAA 4M72A 2DAOA 3TKYA 4HV6A 1FX7A 4YIIA 2CWEA 5JI6A 1V4RA 4KMUX 1G3SA 5FGMA 2ZXJA 3IKVA 1IN5A 4I02A 4P5OA 3SHFA 1IXCA 4CDGA 2J5OA 2Z9OA 2RGVA 1IN4A 2VBZA 1STZA 3I59B 5BPDA 2BV6A 3U9GA 2YX4A 3VFZA 1CF7B 2HKOA 3GVAA 2W25A 4BHPA 5HS9A 4IHSA 4H0EA 1MD0A 3NEUA 2NYXA 3O3KA 2AS5F 4LD5A 2CO5A 2A69F 3HUGA 2K4BA 4GYIA 1XGMA 5J8FA 3I54A 3MZYA 4Y15A 2ZKZA 1SMYF 5TRDA 1TTYA 5D8LB 2NNNA 4IXAA 3HRSA 3BOQA 3BROA 2GA2A 4UVBA 5E8IA 1LEAA 2YSRA 3REOA 3WG9A 5D8KB 3KP5A 4O6JA 4CYDA 2ISYA 4P96A 2FXAA 2NS0A 4LGWA 4L0ZB 4FX4A 3SZTA 3I64A 5ILVA 1ON2A 2V79A 3C18A 3EQLF 1EH8A 2XRNA 1FPQA 5ICCA 1P4WA 3FWEA 4Y13A 5E8GA 1Z1DA 3RPQA 4UXNA 2IT0A 1F4KA 1Z6TA 1KYWA 4DQ2A 4R8HA 2MBFA 3FHZA 3L9FA 1I5ZA 1HKQA 1BI2A 4AWXB 3IRRA 4HBLA 4L18B 1J2XA 2Y75A 1SD7A 4ASNA 4RS8A 4WCGA 3RYPA 1P4AA 2KRFA 2GWRA 3VODA 2Q0OA 1O3QA 3W6KB 5D4SA 4EM0B 1KQ0A 1KYZA 1IRGA 3GF2A 5ERIA 2E1CA 5TJJA 2FEZA 4GXOA 4U7BA 1X3UA 3ZMDA 4M73A 1U2WA 3IRQA 1OR7A 2NNYA 1EH7A 1S6LA 3KP2A 1R58A 4WXHA 2OZ6A 3KLOA 3U1DA 4YFKF 3F8FA 5EEGA 2RV8A 5H20A 1U5TB 2HDCA 4EJVA 2QLZA 3BDDA 1HSTA 4CO8A 4G7HF 2ETHA 2H94A 1QGPA 2VBXA 4G94A 4Z2YA 4ZYGA 3JAMZ 2QWWA 5LEJA 3I58A 5FFZA 1JHHA 3HOSA 2P6TA 1Q1HA 4G6QA 4BH9A 3FF5A 1QPMA 4EM2A 3IC7A 4HLXA 5K1YA 2Q2EA 2V1UA 2ZJ2A 2XAFA 5E1ZB 4G9YA 3MZHA 4UUVA 3GFIA 1LDDA 2CQKA 1R1UA 1FYMA 4HW0A 1UCRA 2BYVE 2ZFWA 1D3YA 4DNCA 3TO9A 3IWFA 3V7SA 4MNUA 3IHUA 4L9JA 2VOPA 1IF1A 4XSXF 4OINF 5F64A 2W85A 4YIFA 1XGSA 2DFIA 4M9ZA 1O3TA 3E6CC 3RIRA 4L5IA 4RGUA 5CVUA 4EJUA 4I0BA 4A12A 3L09A 4HX4A 5DEQA 4KMFA 5BS6A 5D5WB 2OBPA 2DQLA 1OPCA 4U7DA 2FBIA 2OZUA 3HSEA 5LGNA 3WTSC 5IT3A 3EDPA 2XIGA 3C3WA 5DDGA 1B59A 2EB7A 3ABTA 3GEZA 2XKPA 3NRVA 1UHWA 1SD4A 1FYLA 2UXNA 4F7ZA 1KGSA 1PP8F 4OIQF 1WWXA 1QZYA 2W57A 1RUOA 4RB1A 1LVAA 3SFZA 5DUIA 4CZZA 2CW0F 3KETA 1IUYA 2MD5A 2XAJA 3ZMZA 3B73A 4WXDA 3F8BA 2R7FA 3HHGA 2P6SA 3CDHA 3KZYA 3R4KA 3F23A 2M1BA 1FBUA 3ZP5A 3WTXC 2XROA 3R6SA 4S04A 4ENKA 3TO6A 2VC0A 2ZCWA 5E20A 2PI0A 1USSA 3DP7A 4AIJA 2R7DA 3Q5FA 3ECOA 1LNWA 1E2XA 1TW2A 1J9IA 4FX0A 5D6EA 4L9NA 2XAQA 5D6FA 3ISPA 3KP3A 1TNTA 1K6OA 3RKYA 2ESNA 2HOEA 2JRTA 4BNCA 1ONVA 2ISZA 2GQQA 3QPHA 2V1XA 4XSZF 1HW5A 2STTA 1DPRA 2TDXA 2HYFA 3QAHA 2EFPA 1HBXG 2VODA 3GX4X 5BPIA 5DCFA 3BY6A 2QBYB 4A0ZA 2E7WA 1J59A 4BHBA 2VBYA 2XAHA 3KEQA 4N9HA 4L5JA 4UV9A 1T2KA 1S8NA 1BI1A 2QVOA 5CVIA 3L00A 2STWA 1G6NA 2ZMEB 2A68F 3R0JA 1T6SA 4GO1A 1PUEE 2VE8A 1WSUA 4NB5A 2IW5A 3FMSA 3WODF 2EFOA 2OQRA 1J75A 4JK1X 1JGSA 4IRIA 4KT5C 2E7XA 3WGGA 4M6XA 1IXRC 1W4MA 1MJBA 1GXPA 3J7AO 1AWCA 1XSDA 4NHJA 2ZO4A 3J80Z 2WV0A 1O7LA 2G9WA 3EYYA 1ZAOA 3QOPA 3HYIA 1R5HA 5DD4A 3JSPA 2V9VA 1KU9A 3JTHA 1OMIA 3CJNA 1T0FA 1KQ9A 1H0MA 3F8MA 4CXFA 3I53A 1L0OC 4LJZF 5ICFA 1R1TA 3ECHA 2QM3A 4A5MA 2A5YB 1RIOH 4RB3C 4K2EA 1G3WA 1FLIA 2YPRA 2EFQA 1JXSA 4EV0A 2KKOA 1ZRDA 2Z99A 4P9FA 4ESJA 4O3MA 2KIMA 2Z5UA 3TO7A 1ULYA 2PBIA 4AD9A 2Z33A 4FT8A 4L0YB 4O5VA 1QQIA 4ZH4F 4U0WA 1T38A 5IT9Z 3VB2A 1DP7P 4BXUA 1MKMA 3IKTA 4S05A 2DLLA 3CO7C 1XSVA 4KN7X 2DK5A 1SD5A 3Q9SA 2A3SA 1U5TA 5EEHA 1YW9A 1FT9A 5AIPA 1KU2A 3FM5A 1QZZA 3NQOA 2RN7A 3BPXA 2L4MA 2H6CA 3ROUA 5LHHA 3I71A 3KP6A 1XMKA 1BI3A 2PMHA 2K7LA 1YO5C 3GO5A 4IRGA 1ZLJA 3LQRA 3PFIA 3VEPA 3DF8A 3I0TA 2GXBA 1IXSB 2DI3A 1AOYA 2DQRA 3ZN0A 4LLLA 2FMLA 1BC8C 1XMAA 3F21A 1F5TA 3E5XA 1SD6A 1R1VA 3RDIA 4Q48A 1K78A 2P5LC 4I0AA 2JTVA 2O61A 1FYKA 1WQ2A 5ILUA 2FA5A 4IVNA 1MJAA 2QQBA 5KK1A 3EUHA 2QZ8A 2OQGA 2LSOA 3W6JB 3V7CA 1FWZA 3GFMA 3ZQ7A 2K86A 3PQKA 1ZGJA 1Y0UA 2VN2A 1MDMA 1G3YA 2RQPA 1JHFA 4R1HA 1T39A 4GYGA 1BI0A 1BJAA 1I27A 2FQ3A 3VOEA 4HX7A 4M6YA 5LGTA 4LB5A 3HTSB 1P92A 4ESFA 4RB2C 3WE2A 1C0WA 1LEBA 1ZARA 2HGCA 2OAZA 3HTUA 1QNTA 1U78A 3J81Z 1QBJA 3WGIA 2G7HA 4KYWA 2XVCA 2CYYA 2HEOA 3CLOA 5FB2A 2OA4A 3OOPA 3CUQA 4I09A 1GVJA 2IP2A 1B9NA 4HF1A 3C1DA 4IRHA 1ZG3A 1G4DA 2XKOA 3BJ6A 2BE5F 1F1ZA 2IJLA 2DK8A 5E17F 2UXXA 2W84A 3FM3A 3GYHX 3JTGA 4B09A 5L3GA 3M9AA 4QLCU 2ELHA 3D5LA 1FY7A 3QU6A 2VT3A 3TOBA 4UVCA 4A6EA 3GZ5A 2WC2A 1P6RA 1IN6A 1O7FA 3O6BB 2A07F 3IL2A 3GW2A 5HLHA 1SFUA 1IN7A 3LSTA 3ZN1A
chains in the Genus database with same CATH superfamily
2DFHA 2XB0X 3BWGA 3M8FA 1JUSA 2H27A 3GUDA 4B47A 4M71A 2LY9A 4M3DA 2M4GA 2DU9A 2HYJA 2O8XA 5ICGA 5E3LA 3CCUI 1BR2A 5LLQA 2NVUB 3A02A 3V7RA 4Y52J 3GLXA 1ZR2A 3QQAA 5JLXA 1JE8A 3CCMI 5CVVA 4OIPF 3G4SI 3BZ6A 2XF6A 1MW7A 2D1VA 1B72B 1FP1D 1MSEC 3JRGA 3TP3A 3E5UA 3N97A 3DPUA 1YITI 3HUGB 5CYVA 3MD2A 3WGHA 3QODA 2ADUA 1OCRH 2LDUA 1Z21A 2RREA 3SEZA 1D5YA 3ULQB 3WU0A 1WVRA 2RNGA 4HX8A 1QRYA 3PSIA 1YG2A 3ASOH 1YRNB 5ILSA 1MGTA 4LK1F 3HL2A 2KJCA 4DZJA 1J7KA 3LFKA 5DD8A 2PEXA 5FKLA 4CCJA 2HKXA 1MNEA 2XGEA 4UNOA 2QQ9A 3CLQA 5DCMA 4MHGA 1POGA 2FE3A 3MCZA 3MMYB 1O3RA 3E1SA 3KP7A 5LHIA 4KICA 4M9XA 1Y8QB 5FLXZ 5L3FA 2GZWA 4KNYA 3K2ZA 3C7JA 2F5FA 4ZJZA 3TEDA 1NH3A 3KFWX 3K69A 2CW8A 3AL0C 3H5RA 2HI3A 1QZEA 1WH5A 4HA8A 2L4AA 2PMZN 3A2KA 3PL8A 2E1NA 3EUHC 1MMAA 3VYRB 4LG0A 2LOOA 3L7WA 4IPAA 3WTZA 4B48A 2HYGD 2WAFA 3K9TA 1HKSA 3RKXA 2DPDA 2RC4A 5GPCA 1RUNA 2DXIA 3HHHA 3OV8A 1UELB 2EV0A 1HW1A 1TP4A 2D45A 2O6GE 3PIPF 1TQPA 2F5CA 3MVPA 1X4PA 4AIHA 1G8XA 3GXOA 4AM3A 3F22A 1MJ9A 5HNFA 3C2GA 2HPMA 1D0YA 2XB5A 1IJWC 5JVTA 1D0ZA 4HAMA 4MFEA 1K7AA 1X4OA 2K02A 3A1YA 3BG9A 1BIBA 2B63J 2JQ7A 5D4RA 1GV2A 1V54H 3HKZN 5FD5A 1IN8A 2A61A 3Q0WA 3SZGA 1BOBA 1ETKA 5DUKA 1WRJA 2QUFA 1YQAA 5EF6A 2EQRA 1MH4A 4BYYA 2DA4A 1Z7UA 2ZJRF 4HSTA 1W7PA 2XASA 1HKTA 2XHKA 2DW4A 2MH9A 1I6XA 4PGGA 5EYRA 3N4MA 2DJIA 2YU3A 4U0YA 1Z3YA 1VQKI 3CUQC 5GPAA 3COAC 4DOZA 2LF8A 5ICEA 5HDKA 2EJRA 1XGOA 5J4YA 1ZRCA 3K4CA 2KLOA 2BHZA 4LOCA 1MZBA 4M9SA 4UY8I 4CICA 2VKHA 2VXDA 4ZC3A 2PMUA 1AKHB 3S15J 3JRIA 1CQTA 4B8XA 4BY1J 1RESA 1JT6A 2M87A 3RYRA 1LDKB 4XKCA 1DGRM 1R7JA 2A05A 4MQVA 3OSGA 2JUGA 1FSHA 1NG7A 2QQAA 3HGGA 3UNGC 3AG3H 3S8PA 1YJWI 2LF7A 3WHBA 5LFAA 5CQGA 5JHUA 2DPUA 2E35A 2EA2A 1HQCA 5FKMA 4HSRA 3CP8A 1IC8A 2LNBA 1YW8A 4MQ9F 2ZSHB 5CJ9A 2CQNA 2MLKA 2YU9J 3HOWJ 3NAUA 2MA3A 2HFHA 3C2BA 2ECBA 1S3JA 4IOCF 3OIOA 1HA8A 1XDUA 1RZ4A 2L7KA 4OIOF 2L3DA 3J80K 2XGXA 1GHCA 2P5VA 3FDYA 4IHWA 1NHAA 3EUKL 4PFOA 4EGYA 4BXXJ 2HVRA 2G7UA 1I1GA 2EV5A 2JA6J 2X1CA 2BZTA 1SAXA 2IS6A 4A6DA 1LFBA 1W7PD 3OS2A 2GXGA 3G3ZA 2PN6A 4IF4A 2X6YA 3TGNA 3V8JA 4ZDOA 2GA1A 1LVKA 2ZNZA 1H9TA 1X1DA 1WI9A 2P7CB 1EH6A 4F3QA 4BE1A 4A5NA 2JK3A 4KUMA 3I59A 3LA3A 5HLGA 4RAGA 4X6AJ 3R60A 3RCOA 2KPMA 4C9YA 3ML6A 4MTDA 1CF7A 1RETA 2JVGA 1YJ9I 4RGRA 4KA4A 2EH3A 1A04A 4XBFA 2MC3A 5AIQA 3LSPA 4FETA 5M3MJ 4D0PA 4Y33A 1TLHB 4OAYA 2H6BA 3RI4A 3L2CA 3H3UA 1TWFJ 1Z6RA 3U2RA 2JA2A 4WX9A 2WV1A 3R61A 4L9TA 5F1RA 1IRFA 5L3CA 2YR2A 1A6IA 2MH2A 4G12A 4IJAA 3G1LA 3IUOA 1FBQA 2MABA 4WF2A 2J5PA 2K27A 2FOWA 5CLSA 1FZPB 4U87A 1Z7LA 3KLNA 4YG2F 3P7NA 4UB8C 1R22A 4NDLA 4BQOA 4LLNA 4OAZA 1BM9A 1WJDA 3BT9A 3DV8A 3K1MA 2M5WA 3S1MJ 2HWVA 2W7NA 2O0YA 2V6EA 3OR2C 1ZYRF 4YFXF 3CCRI 1N78A 1TWAJ 2M8EA 1XCVA 4Y3OA 2JT1A 3MAJA 3M8EA 2HQRA 1MH3A 3MQ0A 3ZR8X 5M5YJ 1MBKA 1LQ1A 4UB6C 2Z1DA 4HQMA 1O3SA 5IT9K 1TT5B 4JP0A 2EZIA 2NAZA 2KMUA 2HTSA 4ZTJA 4XIDA 1ON1A 2HDDA 4RGSA 1ETXA 3RJPA 2EFNA 5CQEA 1FSEA 4Y17A 2XUBA 5B66C 2VOOA 2F48A 1FOXA 1XSXA 3L2VA 3W3CA 4BACA 1YYVA 4C3IJ 2IA0A 3KCCA 5LRRA 1EV7A 4E7SA 1K4TA 1BJZA 1FIAA 1WJAA 4BUPA 1YX3A 4OMZA 2EIMH 3FXQA 4ENNA 1YIOA 2JZYA 4AIDA 2VT2A 2WTEA 2LBFA 2QYOA 3FK7A 5DM7F 3K4KA 2BVLA 4JQFA 3ZPLA 3H1CA 3LWFA 2EZLA 3ZQQA 3H9JA 2QKMB 4CYCA 3LA2A 2EWNA 2K9SA 2D1HA 2ACJA 3H0DA 1P4XA 3BZKA 3VYTB 3JW4A 3U1KA 2IGMA 2R3SA 3HOXJ 1BN5A 3RPUA 3CMEI 3CCVI 2UV1A 3KEOA 4LITA 4A2UA 4L9VA 1VTNC 2JSCA 1XPXA 4PUSA 3PNTA 4F55A 4BU2A 4JX6A 5JFRA 3ERED 2ZC2A 4ETSA 1D1BA 4IZZA 2XAUA 2L9NA 1USTA 2PFBA 3RTRA 3BJAA 1X19A 3DEUA 3BR6A 3E6BA 3VDXA 3CMAI 3G71I 2V9KA 3VSKA 3TW7A 1VQ7I 2X48A 3WU1B 3LQQA 5D5UB 1TW3A 3AG4H 1VQPI 1FOKA 1YS6A 5HOOA 2O7OA 3PNVA 5D5XB 3S1QJ 4HQEA 3GFJA 3ZQLA 1BIAA 1IZ1A 2E1MC 2KIUA 1LDJA 3WHCA 4IX7A 3H5AA 4N0BA 3G73A 1JKRC 4G7OF 1RKWA 1WPKA 2IPQX 2PJPA 3L2RA 5M3FJ 2L2OA 2OUMA 5L3EA 2KJBA 3OYKA 5E1XA 4JYKA 5H2FC 5BOXA 4KIGA 2EZKA 1NK3P 3SXYA 2CV2A 2VC1A 1DPUA 2BXZA 3ZMTA 3PO2J 5BQTA 2QENA 4XONA 4TV7A 3QRFF 3LMMA 1XDSA 1UMQA 2JA8J 4EMSA 2KT0A 3K0LA 3LSGA 4OU0A 5EDNA 3SDGA 3L2WA 4Y7NJ 2ICWG 2NXNB 4G8XA 1HW2A 1X2MA 4N9IA 4E7KA 1PDNC 2F5EA 2DFEA 1ZHFA 2DTRA 1LFUP 1VQ5I 1XB4A 5A2QZ 2CH0A 1A6QA 4HG2A 3HOZJ 5EG0A 3I9V2 3RPUD 1KU3A 3HSRA 1W0TA 4HDVA 2VUMJ 3GFLA 3DFGA 4KJZA 1FC3A 1K61A 3EYIA 1ZN2A 3V42A 3S2HJ 4IHTA 2HZTA 2KQRA 3AKZA 3O2PE 2L9VA 4CZCA 4AVZA 4EJWA 2IGKA 3HXLA 1ZR4A 4B44A 3FXOA 2P8TA 2P7VB 1IV8A 3SJMA 4XNFA 2IGOA 2W24A 5LRSA 1KQ8A 3MEXA 1TWHJ 1U0JA 3ERMA 3V4GA 4EJTA 3H3VK 4RAZA 1EA3A 1BA5A 3S17J 5C4XJ 3ZMUA 3OYLA 3CCSI 2MC4A 4KIFA 1A36A 3S2WA 3I4NJ 3GLLA 1HLVA 3H92A 1XG1A 2D2WA 2VI6A 4XLNF 3J81K 3KZZA 1VQ4I 3JRAA 2HS5A 3F8CA 4RB0A 2KISA 2ZNYA 1SAUA 3DPTA 2CMPA 3MKZA 1ERDA 3QYBA 2LLKA 2VBWA 1G3TA 2DBBA 2DCEA 2R7VA 3DEWA 2C6YA 2VASA 1IG7A 2FMYA 3BP8A 3HRMA 1GLNA 2KIQA 4I01A 4J00A 2BGCA 1U6GA 2GBYA 5K5RA 5K5OA 3WTWC 3TDZC 1BBYA 2MGQA 1QHHD 3BQYA 3KE2A 1U3EM 2CG4A 3ELKA 3TOAA 1PUFB 3B02A 2HU9A 3F6VA 3T0YA 2DMNA 1JJ8C 2M34A 4V19K 4Y4RA 5J8CA 1OCCH 4HV5A 4Q47A 2V1DA 1R5GA 1S29A 2HOTA 4XOPA 5JR3A 3MKLA 1W0UA 1TQMA 4M74A 3I4PA 3IH2A 1A5JA 4FHTA 1WJ5A 4BGDA 6PAXA 1ZGAA 1H8AC 4BKXA 3IWZA 4I7HA 4LMYA 2WBMA 4HEA2 5E18F 1D5VA 4I6ZA 2FBHA 2V4JC 3QP6A 3JAMK 1REPC 1X1PA 1MBGA 2Y0MA 3SQNA 1TQIA 1BOAA 1T98A 3U21A 5HODA 4KDPA 1X1BA 4BDZA 1B4AA 1ORKA 2WY8Q 5F0FA 2VJ5A 2L54A 1D0XA 4HNVA 5F1JA 1CGPA 4BL0B 4WXCA 4B43A 1WFXA 3OYGA 3L2UA 3VSLA 3LSIA 2VONA 3ZQIA 2A6EF 2K4JA 1GXQA 2CQXA 3HOTA 1R9TJ 2E71A 1KA8A 2UUZA 3P9CA 4UHTA 2LY2A 1GV5A 1V3FA 3RKQA 5F6FA 1WH7A 2MG4A 2R5YA 1HCRA 2FJ1A 1IRXA 5CVJA 3WTVC 5L3BA 2LG4A 1R00A 1YE9A 1S7EA 2F5DA 4ZYDA 2YX7A 4IQJA 2VJJA 3T1BA 1YTYA 2NOGA 5EGOA 3DTKA 4A3CJ 2X6XA 4UVAA 2KIFA 2VPRA 3K6GA 1S7OA 2IA2A 1ZG5A 1R4MB 2IAIA 4I2OA 4A3MJ 4P1WA 3KYLA 2PLYA 1XCBA 5HLIA 1JUPA 3V8LA 5DV5A 2VJ4A 1DP3A 3F72A 2EINH 3L2QA 3F0CA 1RC9A 2CSOA 2FNPA 3FMQA 1FNNA 1SMTA 1U5TC 2IVMA 5CPRB 3HOUJ 5FLXK 3FXRA 4XOTA 3WTUC 2FBKA 1P2FA 2GAUA 3Q9VA 2M30A 4GFBA 2FOKA 2HR3A 1Z91A 4XRSG 1UB9A 2MYSA 4PZJA 2XV4S 1W5SA 2XGCA 3AFHA 3DTEA 3GWZA 3FBIB 1DUXC 2RKHA 4B3AA 3FISA 2NRAC 2BHYA 3E6DA 2HZDA 3I3LA 1FOWA 4P9UA 1IRZA 5J6XA 5D5VB 1K79A 1J5YA 3E97A 2L02A 3LL7A 2GIZA 1U9NA 2WY7Q 2CW7A 2QBYA 3CJQB 5EZGA 4A0XA 4DZPA 4XMYA 3QPTA 5TGTA 1QU3A 3W2WA 1YFHA 2DA6A 3SFIA 3ABUA 1Z9CA 2FRHA 3TDUC 2IA1A 3I56I 2JA5J 3G2BA 4RM2A 1J09A 1JT0A 1YLFA 5JLWA 4OOIA 3CO6C 1XTAA 3B6CA 2IRFG 2OCEA 2QA4I 2R5ZB 4GGGA 2MLGA 2QEXI 1ZELA 2ZMEA 2KL4A 2HNHA 3GZ6A 1ZH5A 3IV5A 3DXJF 4QPQA 1S72I 1IUFA 4EVIA 1YI2I 1B6AA 4EM1A 2EILH 4F92B 3F9KA 4JX5A 3HRTA 3LAJA 4HRIA 2IS1A 1QO0D 3PIOF 5GADJ 1OLTA 3OIPA 2LR8A 3K10A 3S14J 4WK8F 4C2MJ 3DQVC 1MMGA 3DPLC 4MEXF 3HC7A 1R6RA 1TL8A 4EJOA 4AIKA 4W97A 1K78B 5C3EJ 3T8RA 5GAGJ 1RPWA 3ZQFA 4U88A 5LHGA 3V8KA 4GDFA 2N8GA 3FX3A 4RLQA 3G1MA 2VKDA 3OYEA 3AL0B 2HQNA 2R7XA 4DYQA 3FMRA 3QP5A 1Z05A 1LE8A 4XN0A 4UUSB 1ETVA 2KZGA 4DJAA 5HVQC 2X1DA 2G0EA 1K4SA 9ANTA 4I76A 1YHQI 4NC8A 1OYYA 2OU2A 4P55A 3K1NA 4UV8A 2L01A 1IDYA 2E2HJ 1W5CC 2WAQA 2X4HA 2AXLA 2I8DA 3WTYC 4HF2A 1OFCX 3M1CA 2KP6A 1MDMB 3HSFA 4HOBA 3KEYA 4CCKA 3Q3SA 4XLPF 1O4XA 1SFEA 2IS2A 2E19A 3DTIA 1I1SA 2VJIA 4ENJA 3BCBA 1B8IA 5GAEJ 2RQQA 3OYNA 4I98B 4PDKA 2JJ7A 3E3VA 3Q0VA 3BR1A 4HZFA 3GTQJ 4BHCA 5LGUA 4IKFA 1LJ9A 2V26A 1RRJA 5HDGA 4HDUA 2FU4A 1GUUA 2PJRB 2NOJB 1B1BA 1OCPA 2V6CA 1R36A 1D8JA 3HPHA 4EGZA 2EV6A 2ZXWH 2OTLI 3LFUA 2HDWA 4XRMA 3CF5F 2R7TA 2K3PA 2L9RA 2HQ5A 3D5SC 5HS8A 4AVPA 1PP7U 3BC8A 1H88C 2FF4A 1PYVA 3FZVA 4EQQA 1HDDC 1QVTA 1P7JA 3M7GA 1B9MA 3QYEA 5GP9A 1ZGWA 1IO2A 1SFKA 4LFUA 2LMDA 1EKEA 3CUQB 3A01A 5TISC 1QHGA 2EZHA 2KZVA 4DBQA 2L0KA 3DKXA 4G7ZF 4E7ZA 1YOVB 5K7ZA 5IP6A 2VKVA 4BQAA 4BQNA 2VE9A 4PGHA 5FD6A 2BW3B 1E3HA 2CFXA 2COMA 1OISA 4V2GA 2LYCA 3JSOA 4HF0A 5J47A 5DS9A 1T08B 2IEKA 1YW7A 4X1EA 1ZRFA 3CCQI 2M7BA 3RKWA 5IOZA 5K5QA 1SEUA 3M3YJ 1ZG1A 2M4KA 3FHNA 3K1PA 3AG2H 3KPHA 5IYBJ 2UZKA 5ED4A 1KU7A 1WJFA 2K9MA 3HRUA 2R7QA 2DODA 2WADA 3ZMSA 5HDNA 1N75A 3ABKH 3BPVA 1J0RA 5KAIC 3BJOA 1XGNA 4KFCA 2M0CA 4RGXA 1UJ8A 2VKEA 3P9KA 2HXOA 5KVRA 4CA0A 4D9JA 2ZXHA 1RNLA 3BTCA 3JCUC 5HS7A 1R23A 4G6DA 3SZPA 4MEYF 5DYMA 3PO3J 1O57A 4C3HJ 2HTJA 4ON0A 4JOMA 5H6QA 4BEHA 2BBYA 1RI7A 2Q2EB 2AO9A 4BJTA 2CV1A 3CC4I 4FISA 3ZOBA 1U8BA 2E2JJ 3EETA 1R71A 2VQGA 4CHUA 1W5TA 1KZHA 5B1BH 1XN7A 2R4GA 2KHMA 3T5XA 2JPCA 4F93B 2OJED 3F6OA 1MNDA 4ZZDA 2P5KA 2B9SA 2O9LA 1LKXA 4GCVA 2P4WA 2CGPA 3VPRA 1H9GA 2XAGA 3VWBA 1TBXA 2QKLB 1UFMA 3LAPA 4ZYEA 1L3LA 3SEQA 4R79A 2CQQA 1SFXA 1U8RA 4CGZA 2ZMEC 2Z16A 1LB2A 4A0YA 3D0SA 1OYWA 1VI0A 3QU3A 3HEFA 1I50J 4Q4ZF 1DDNA 4IEJA 1M1EB 1GT0C 2JPBA 5AONA 3TQNA 1FBSA 1JJ6C 2O03A 2RDPA 5HLTA 3OL3A 1HSJA 2DDBA 1UHMA 1Z0XA 4Z6YA 3K4JA 1P9QC 2ZBKA 3BG6A 3GTGJ 5DCMB 4D7NA 4XM3A 3QPLA 4PCQA 5E1WA 2M45A 3PQJA 1Y8RB 3GTOJ 2K5CA 5FRMA 3CTAA 3K70D 1OYIA 2LKXA 1FTTA 3D5RC 3P9IA 3E5QA 3FK6A 2AQFA 3OYJA 2R7ZJ 4OMYA 3MWMA 4YFNF 2DA3A 3FXMA 5BMZA 4LG0B 4ENMA 4H4KC 2EA4A 2LKPA 4PJJA 5L3DA 5FJ8J 3JR9A 4ZZLA 2AXTC 4LLGF 2X0LA 4WWCA 1ZLKA 1HXDA 3QWLA 1WKMA 2LTPA 3PNYA 3R0AA 2RVCA 2O5RA 3K4MA 2BEOA 3LA7A 3WTTC 2PQ8A 1JGGA 1UZCA 3GCMA 4IHXA 2DFFA 1FJLA 2ESHA 3CF2A 4C3JJ 1WJCA 5LBQA 1NTCA 4KN4X 1GVDA 3VYSB 3WE3A 2DO7A 2GLOA 2Z3YA 5LEKA 2DT5A 3KP4A 2ECCA 5FFXA 3BTLA 3DLAA 3TW6A 1F9NA 4ESBA 5K7HA 3HJEA 5A2QK 1D8KA 2WWYA 4C30A 3C2HA 1S7AA 3I5UA 4KIBA 4E70A 1VQ6I 2FSWA 3DKWA 1ACIA 4XORA 2R93J 3BTJA 2B0LA 4LIUA 1OKRA 4Q5SF 1XD7A 2L5QA 2QSGX 1QA6A 2H09A 4NNJA 2A6HF 5JHFA 4MTEA 3BZCA 3FXUA 5E3NA 1W7PB 3CDLA 3OR1C 1IAWA 4A3GJ 5BNGA 3F3XA 2Q8KA 4NQWA 2F2EA 3OS0A 3JRHA 3T8TA 1ZREA 4XRFA 1MMSA 3ZGKA 4E6KG 2LK2A 2EFWA 3DLLF 4BE2A 2XSDC 1IW7F 2F4IA 3K4NA 5HNHA 4IHYA 5KHDA 3S1NJ 1OCOH 4HYEA 2DN0A 1ODDA 4A69C 2GIVA 1FP2A 4XKVA 4A3JJ 2WA0A 3CUOA 4XN3A 3X2QH 2FNAA 2M9HA 4LK0F 3MFKA 3AAFA 4ZYHA 1WJBA 1I39A 5E3MA 3CCLI 3DWLE 3J7AY 4BAYA 3F8NA 2F4OB 3B6AA 2R92J 1JKPC 2DTZA 1YS7A 5H6RA 3SDBA 2Y30A 2PG4A 3DBRB 5FO5A 1Y0NA 2DA5A 3CJRB 2RNJA 4RMNA 3E6MA 4QSHA 4AUXA 1IGNA 1TNSA 2E1MB 4RAYA 4CCOA 3KX2A 1E17A 3H9QA 3BCAA 2K85A 3ZMVA 3HIFA 1P7IA 3M1EA 2KDZA 4YIRX 2EK5A 4U0VA 2Y48A 3H3ZA 5CVRA 4LB6B 3PUFA 1HDPA 3OYBA 3ZQHA 3A0HC 4MGRA 2UWMA 3K70C 4OIRF 2VXZA 2OD5A 4HLYA 4QWQA 1BC7C 1BR1A 2JSPA 2O3FA 4JBAA 2X51A 4M72A 1HOMA 3WG7H 2DAOA 3TKYA 4HV6A 4XLHA 1FX7A 4XQFA 2LC2A 5M5XJ 4BDYA 2M7AA 2LKSA 4YIIA 3ABMH 2CWEA 1TWGJ 5JI6A 1V4RA 4KMUX 3HDDA 4MO7A 2WAEA 2DYRH 2VL8A 1G3SA 1GDTA 5FGMA 4X0GA 2ZXJA 3IKVA 1IN5A 2VB6A 4CH7A 1EJ9A 4I02A 4P5OA 4YRVA 3SHFA 1IXCA 4CDGA 2J5OA 3G6EI 2Z9OA 1T33A 1PVEA 1S9HA 2RGVA 1IN4A 2X6OA 2VBZA 1STZA 3CZ6A 3I59B 5BPDA 2BV6A 3U9GA 2YX4A 3VFZA 4FTHA 2HKOA 1CF7B 3GVAA 2W25A 4BHPA 5HS9A 4AYBN 4IHSA 4BQQA 2K3FA 4II2A 4H0EA 1XX5A 1MD0A 3W6VA 3NEUA 4ZDPA 2NYXA 4ABZA 3O3KA 1B72A 5M5WJ 3OS1A 1BL0A 2XSJC 2AS5F 3S1RJ 4LD5A 4F52A 2NS7A 2CO5A 2A69F 3HUGA 2K4BA 4GYIA 5FRNA 1XGMA 5FKKA 5J8FA 3I54A 1VF9A 3MZYA 2R5ZA 4Y15A 2ZKZA 1SMYF 5TRDA 1TTYA 2Z2SB 5D8LB 2NNNA 2H8WA 1NG6A 2XDVA 3DBHB 4IXAA 3LSRA 3HRSA 1A35A 2Y31A 1YRNA 1U9OA 4NC7A 3TBIA 3BOQA 3LSMA 3BROA 4XKWA 2GA2A 2XRLA 4UVBA 5E8IA 4M3BA 1LEAA 2YSRA 3REOA 4V2FA 1MBEA 3WG9A 5D8KB 2LRDA 3CP2A 1OQYA 3DBLB 3KP5A 4O6JA 4CYDA 2ISYA 4P96A 2FXAA 1SVLA 2NS0A 4LGWA 4L0ZB 3HOVJ 3CCYA 4FX4A 3SZTA 2ZJQF 3I64A 2DT6A 2O8KA 4AYBA 4XLEA 2DJNA 5ILVA 2CJJA 1WZ2A 1ON2A 2V79A 2BY2A 1YIJI 3C18A 1WI3A 3EQLF 1EH8A 2X1EA 1UG2A 3OYAA 2XRNA 1FPQA 2JUCA 2ZB9A 5ICCA 3ZQGA 5J4VA 1APLC 1VQLI 3HOYJ 1MIJA 1RKTA 1P4WA 3FWEA 3N05A 4Y13A 5E8GA 2DYSH 1Z1DA 3RPQA 2XPWA 2QSHX 4UXNA 2HQAA 4FCYA 3NWTA 3ZCOA 2IT0A 5GAHJ 1F4KA 3CCEI 3S16J 1Z6TA 3M07A 1KYWA 1VQ9I 4DQ2A 3H35A 4R8HA 2ME6A 1MBHA 3ZRGA 1Z3XA 2MBFA 2LBFB 1XMXA 1OCZH 3RSNA 3ABLH 3FHZA 3L9FA 1I5ZA 2X9DA 4CYCB 1AU7A 2TCTA 5J3LA 1HKQA 1BI2A 4AWXB 3IRRA 1FMVA 4HBLA 4L18B 3L1PA 2R7UA 2ZXIA 2B7EA 1S5LC 1J2XA 2Y75A 3PUBA 3HG9A 1SD7A 4ASNA 4RS8A 4WCGA 3RYPA 3PM1A 1P4AA 2H8RA 3BR3A 3A0BC 5GTIC 2KRFA 2GWRA 3VODA 3JRDA 2Q0OA 1O3QA 3W6KB 1ETWA 5D4SA 4IOAF 2EIJH 3BR0A 2GOXB 3HB9A 4EM0B 1KQ0A 2CUEA 4RBOA 1KYZA 1IRGA 1BW5A 3GF2A 2DMUA 3PFYA 5GTHC 5ERIA 2JVHA 2E1CA 5F27A 2ZJPF 4C2TA 4XL9A 3OYHA 1AKHA 5TJJA 2BY3A 2FEZA 3ZXSA 4GXOA 5KCMA 4BJ6C 4U7BA 4ZTFA 3KZIC 1X3UA 2LP0A 2Y9YA 3ZMDA 4ANJA 4BS9A 4M73A 3H0GJ 3K2AA 1U2WA 3IRQA 2R7SA 5FROA 1OR7A 2NNYA 1EH7A 1S6LA 2L9SA 3KP2A 5J1RA 1QVUA 2DDAA 1R58A 4WXHA 4ZYAA 2OZ6A 1MNMC 3KLOA 3U1DA 2XC7A 4YFKF 2NVQJ 3F8FA 5EEGA 2FD5A 2RV8A 5H20A 1U5TB 4JX4A 3NWSA 4RDUA 2HDCA 3TL4X 2E1OA 4EJVA 2QQ8A 1E0EA 2CQ7A 2QLZA 1MBFA 2P81A 3BDDA 3LSKA 2LREA 3ZQCA 4RM3A 2F4MB 1HSTA 4CO8A 4G7HF 2QSFX 2ETHA 4D7MA 4II3A 4CCLA 2H94A 4A3KJ 2DOEA 2OC6A 1TT0A 4DBRA 1QGPA 2VBXA 4G94A 2DOFA 3W2VA 3JRCA 1F36A 3RQ4A 4Z2YA 3KIOA 4QPOA 4ZYGA 1JTYA 3JAMZ 2QWWA 5LEJA 3I58A 5FFZA 1JHHA 3HOSA 2P6TA 5C4JJ 1Q1HA 3IAM2 4G6QA 2IXSA 4BH9A 3IH4A 3FF5A 3DCFA 1QPMA 1DGWY 4PK4A 3M8JA 3IAS2 3O8HA 5J40A 4BBRJ 4EM2A 5EG0B 3IC7A 1NK2P 4HLXA 2DA7A 5K1YA 1ZQ3P 2Q2EA 2V1UA 2ZJ2A 2V9PA 4QTRA 2XAFA 5E1ZB 1D1CA 4G9YA 3MZHA 4UUVA 3GFIA 1LDDA 4BXFA 2ELKA 2CQKA 1R1UA 3OY9A 1FYMA 4HW0A 4XRSA 2X85A 4I99C 1UCRA 4A3LJ 2BYVE 2ZFWA 1D3YA 4DNCA 4LIVA 3MN2A 3TO9A 3IWFA 2WAQN 2V7FA 4MNUA 3IHUA 3V7SA 1X3WB 2L7FP 1D1AA 2IS4A 4L9JA 2VOPA 1IF1A 4XSXF 2ZSIB 4OINF 2XGDA 5F64A 4E7HA 1SVMA 2W85A 4YIFA 1XGSA 2DFIA 4KITB 4M9ZA 1O3TA 2D5VA 3E6CC 3RIRA 4L5IA 4RGUA 5CVUA 4XICA 3CESA 4EJUA 4I0BA 3Q0UA 4A12A 3L09A 3OMYA 1FMWA 1I3QJ 2AHQA 4HX4A 5DEQA 4KMFA 3K7AJ 5IY5H 5BS6A 5D5WB 1RR7A 2DQLA 2OBPA 1OPCA 4DGWB 1X58A 3QOEA 4U7DA 2FBIA 3QPSA 2CRGA 2OZUA 3HSEA 3MZ8A 5LGNA 3WTSC 5IT3A 3BR2A 3EDPA 2XIGA 3HZJA 3C3WA 4DW6A 5DDGA 3S32A 2KFDA 1B59A 2CFOA 2EB7A 3A03A 3GTLJ 2HXIA 3ABTA 3PSFA 4XR6A 3GEZA 2XKPA 4AU7A 1WCMJ 3NRVA 1WGXA 1UHWA 1SD4A 2R0QC 3CDIA 1FYLA 3MKYB 2UXNA 3QYFA 3ASNH 2IGNA 4XLAA 4F7ZA 1KGSA 1Y6IA 2FX0A 2JMWA 3FBNB 1PP8F 3HM5A 3UKGA 4OIQF 1WWXA 2OF7A 4YEJA 1QZYA 2W57A 1V55H 1RUOA 2R7WA 4N4NB 3FIWA 4RB1A 1LVAA 2L7ZA 3SFZA 5DUIA 4CZZA 2HOSA 3HPGA 2CW0F 2FQ4A 2K40A 3KETA 1IUYA 3FXKA 2MD5A 4E7JA 2XAJA 2YS9A 3BTIA 3CMMA 2OCCH 2HPIA 3ZMZA 3B73A 2VQCA 4N4OB 2P0WA 4WXDA 5FKNA 3F8BA 2R7FA 1SFOJ 3HHGA 2P6SA 3CDHA 4B3XA 3KZYA 4E7IA 3BLYA 3R4KA 3F23A 2M1BA 1FBUA 2CUFA 3ZP5A 5CKTA 1JTXA 1Q1VA 3R6SA 4S04A 3WTXC 2XROA 1OCTC 2R5YB 4ENKA 1XS9A 2MSYA 3TO6A 2VC0A 1ZKGA 1FOYA 2I10A 4BY7J 4D1QA 3CQZJ 2ZCWA 5E20A 2PI0A 1USSA 2MFZA 2DA1A 2PMZA 3DP7A 4C2UA 4AIJA 4KISA 4RA2A 2R7DA 2OPTA 2RAEA 3Q5FA 5EGOB 3ECOA 3DKYA 1LNWA 5KNLA 2EPFA 1TW2A 1E2XA 1J9IA 4A93J 4FX0A 5D6EA 4EEFG 5B3SH 1JKQC 2DA2A 4L9NA 5KAFC 2VQHA 3FXLA 2QCOA 1ETYA 2XAQA 3H9GA 1OR7C 1ETOA 3RZDJ 5D6FA 5J1UA 3ISPA 2M3AA 4MLOA 4ZDLA 5B1AH 3CMYA 1JUMA 4M3EA 3BG3A 3GTJJ 2LD5A 3KP3A 1T8IA 1TNTA 1K6OA 5DM6F 2R7OA 3J7ZI 4YELA 5IYCJ 3RKYA 2ESNA 2HOEA 2JRTA 3CD6I 1YX5A 2VQLA 4BNCA 5F08A 1ONVA 5EEAA 1I6HJ 1VQNI 2ISZA 2ZFUA 2GQQA 1VQMI 4A3IJ 3QPHA 2V1XA 4XSZF 3HKZA 2CUJA 1HW5A 2STTA 1DPRA 2TDXA 2HYFA 4CSWA 1HC8A 2OTJI 3QAHA 1LPQA 2BVMA 2EFPA 4PJNA 1MMNA 1HBXG 1DU0A 3SYTA 2VODA 3GX4X 5BPIA 1E3PA 4CCMA 2BOLA 1UAAA 5DCFA 2JWTA 5E79C 2A5WA 3BY6A 2QBYB 4A0ZA 1V5EA 2E7WA 2W48A 4XLFA 1BR4A 1J59A 2QF7A 4BHBA 3GMEA 2VBYA 4FQGA 2XAHA 3KEQA 1KONA 1JI8A 4N9HA 4L5JA 4UV9A 4J19A 5FLMJ 1T2KA 1T95A 1S8NA 1BI1A 2QVOA 4XLCA 1X1AA 5CVIA 3L00A 4D5FA 1ITYA 2STWA 1G6NA 4NBQA 3OOUA 2ZMEB 2A68F 3GZNB 3R0JA 5IP9J 1T6SA 4GO1A 1A31A 1VZ0A 1PUEE 2VE8A 3OL4A 3WU2C 1WSUA 4NB5A 1HF0A 2IW5A 1FTZA 3FMSA 3BQZA 2KRCA 3PJRA 2M2EA 4LG3A 1MBJA 4AC0A 3WODF 2EFOA 1AHDP 2DMQA 4NUBA 2OQRA 2BY0A 2BXYA 3UR3C 1J75A 4JK1X 2CV0A 5C44J 1JGSA 3P5JA 4IRIA 4KT5C 2E7XA 2W82A 3WGGA 1VNDA 4IO9F 2W00A 4M6XA 1PUFA 1TC3C 1IXRC 1W4MA 2YUSA 3NARA 4EATA 1MJBA 1LE8B 1GXPA 3J7AO 2ME0A 1AWCA 1XSDA 4NHJA 3EPZA 2ZO4A 3FXJA 1ZTRA 2FUG2 2JN6A 2WV0A 2Y69H 3J80Z 1YJNI 1O7LA 2G9WA 3FKIJ 2XF5A 3EYYA 2W1OA 3OSFA 3RQIA 1ZAOA 3S3NA 3QOPA 4PSWA 2GOMA 3HYIA 1R5HA 5DD4A 5IOYA 2V9VA 3JSPA 1KU9A 3JTHA 2XPUA 5IYDJ 1OMIA 3CJNA 1T0FA 1FIPA 1KQ9A 4KT6A 1UG0A 2E34A 1H0MA 3F8MA 3BG7A 2ELJA 2Q1ZB 4CXFA 1B8IB 1VFCA 5F0CA 3I53A 5F0HA 1L0OC 4LJZF 3G1OA 5ICFA 1R1TA 3ECHA 3OYFA 2QM3A 2LVSA 4A5MA 2A5YB 3J7YJ 5DTDA 3D1NI 1RIOH 1Y56A 4A3DJ 4RB3C 4K2EA 1G3WA 2MD0A 4CUGA 3K4BA 1FLIA 1K83J 1N25A 2YPRA 2EFQA 3E7LA 4FE4A 1TZLA 1JXSA 4EV0A 4W1UA 3VYUB 2KKOA 1TWCJ 3TMOA 3JRBA 1ZRDA 2Z99A 1Y1VJ 4FE7A 4A3BJ 1N77A 3OIQA 4M3FA 4P9FA 3OYDA 4ESJA 3HBLA 4F91B 4O3MA 2E5ZA 3A01B 2KIMA 2H1KA 3GTMJ 3OYIA 1G59A 3DU6A 2Z5UA 2NVXJ 4IL6C 3TO7A 3ESWB 1ULYA 5EJCA 3HGYA 1FEXA 3OYMA 1V5FA 3CJTB 2KRHA 4J01A 1MSFC 2NVYJ 2PBIA 4S0HB 4AD9A 2V1NA 2IBDA 4D5CA 2Z33A 4FT8A 4L0YB 4O5VA 1QQIA 4ZH4F 2E5NA 4U0WA 1T38A 4PJLA 3S93A 3LOCA 5IT9Z 3VB2A 1DP7P 1XC5A 3CC2I 4BXUA 2CU7A 2DMTA 2ID3A 1DU6A 3OWTA 1Z77A 1I3AA 1MKMA 3IKTA 4S05A 2DLLA 3CO7C 1XSVA 1W36D 4IHVA 4KN7X 2DK5A 3GBGA 1SD5A 2LFBA 3LSHA 3Q9SA 2A3SA 1U5TA 5EEHA 2R7RA 1YW9A 1FT9A 2DOAA 5AIPA 2K9LA 1KU2A 3ONQA 3K4LA 3S2DJ 1R49A 2H1LA 3I55I 3FM5A 1R4NB 2W4SA 4XK4A 4BEHB 2JA7J 2MW8A 2E36A 1QZZA 3NQOA 4QIWN 2QGUA 4B1RA 2RN7A 3BPXA 1WJEA 2KDOA 1E3OC 2L4MA 5J1YA 1OJLA 5E3OA 2E60A 2H6CA 3ROUA 3I71A 5LHHA 3KP6A 4A3FJ 4DIQA 3S3OA 1XMKA 1BI3A 2OV7A 4E4HA 2PMHA 2K7LA 1YO5C 3CCJI 3GO5A 4IRGA 4PJ0C 4A3EJ 1ZLJA 2Y2ZA 3LQRA 1VQ8I 2PX9A 3PFIA 1BW6A 2VLAA 5JVGF 3VEPA 3GTKJ 3DF8A 3I0TA 2GXBA 1IXSB 2DI3A 2M0MA 1AOYA 2DQRA 2HVSA 1X3ZB 3I4MJ 3ZN0A 4LLLA 2FMLA 5B5EC 4FASD 3H5NA 2BY1A 2EIKH 1BC8C 4PJMA 1V5GA 1Y39A 1XMAA 2XPVA 5F04A 3F21A 4DYCA 1F5TA 4HNTA 3E5XA 1SD6A 4MFDA 5FKOA 1LFPA 1R1VA 3RDIA 4Q48A 1K78A 2P5LC 1H89C 4I0AA 2JTVA 1IDZA 2HOAA 2O61A 2VPLA 1FYKA 1WQ2A 4MIMA 5ILUA 1SC7A 4BJ5C 4M6VA 5IPAA 2DT7B 4BE0A 2FA5A 2F6CA 4BBSJ 3JRFA 4IVNA 1MJAA 4L5EA 5EZHA 2QQBA 5KK1A 3BR5A 4PFPA 4UUSA 3EUHA 2GM4A 2QZ8A 3DU5A 3M4OJ 2OQGA 3O8GA 2LSOA 4RLFA 3W6JB 2XF7A 3V7CA 1W1WE 1FWZA 1G2HA 3GFMA 3ZQ7A 2K9NA 1X1CA 2K86A 3PQKA 2GXAA 1T0FC 1SANA 1JKOC 1ZGJA 4OWRB 4NC6A 1Y0UA 2VN2A 1MDMA 2K9QA 1G3YA 2EBIA 1W36C 2RQPA 2F5VA 1JHFA 4R1HA 1Z67A 1T39A 2COBA 5LD2C 4GYGA 4ITVA 1BI0A 3H36A 1F43A 1BJAA 1I27A 3E0JB 4UUTA 2FQ3A 4IQ4A 3VOEA 4HX7A 3FKJA 4M6YA 5LGTA 2CUZA 2PJRA 1RR8C 4LB5A 3HTSB 4HPQA 2NS8A 1K6YA 1P92A 4ESFA 4RB2C 3WE2A 2I5UA 1C0WA 1ZARA 1LEBA 2HGCA 2Y0SN 2OAZA 3JREA 3CC7I 3HTUA 4NQWB 3IH3A 5IP7J 3OYCA 1QNTA 1U78A 3J81Z 1QBJA 3WGIA 2A6TA 2G7HA 2X6WA 1PJRA 2DMPA 4KYWA 2XVCA 2CYYA 2WB1N 2HEOA 3CLOA 5FB2A 4PSXA 2VIXA 2OA4A 2AQEA 3OOPA 3CUQA 2CS3A 2JRMA 3TP0A 4I09A 1DQUA 1GVJA 2LH9A 1ENHA 1B9NA 2IP2A 3W2AA 5FLVA 3IP4B 1ETQA 4HF1A 2ID6A 1SVOA 3MKWB 4B4CA 3C1DA 4XKBA 4IRHA 1Y1WJ 3GTPJ 2BW3A 1R5ID 2M8GX 1ZG3A 4CCNA 1AA7A 3LNQA 1G4DA 4E7LA 2E2IJ 2XKOA 3BJ6A 3A4CA 1UHSA 2BE5F 2LY1A 1F1ZA 3S3MA 2IJLA 4RAFA 3DEEA 3RZOJ 1WHUA 2DK8A 4G6TB 5E17F 2UXXA 2W84A 3EUAA 4M3GA 1EF4A 3FM3A 1QPIA 3GYHX 2L7MP 3JTGA 4B09A 5L3GA 1ZK8A 3KYCB 3M9AA 3BG5A 2HVQA 4HNUA 4QLCU 1IV6A 1T56A 1X2NA 2ELHA 3D5LA 3KYDB 1FY7A 3QU6A 2VT3A 1MMDA 4DYRA 2TRTA 2Y0SA 4UVCA 3TOBA 1LUJB 4A6EA 3GZ5A 2WC2A 1P6RA 2NVTJ 1IN6A 3LSJA 1VQOI 4GRIA 1O7FA 3O6BB 2A07F 3IL2A 3GW2A 5HLHA 2WB1A 5K7FA 2Y9ZA 1SFUA 1IN7A 3LSTA 3ZN1A 3AG1H
chains in the Genus database with same CATH topology
3M8FA 3BWGA 2H27A 3GUDA 4M71A 2DU9A 2O8XA 5ICGA 5LLQA 3V7RA 3GLXA 1JE8A 5CVVA 4OIPF 3BZ6A 2D1VA 1FP1D 3E5UA 3N97A 5CYVA 3WGHA 2ADUA 2LDUA 3ULQB 3WU0A 4HX8A 1YG2A 5ILSA 1MGTA 4LK1F 2KJCA 1J7KA 3LFKA 5DD8A 2PEXA 2HKXA 4UNOA 2QQ9A 5DCMA 4MHGA 2FE3A 3MCZA 1O3RA 3KP7A 5LHIA 4KICA 4M9XA 5FLXZ 5L3FA 2GZWA 4KNYA 3K2ZA 3C7JA 2F5FA 3KFWX 3K69A 4HA8A 2L4AA 2E1NA 4LG0A 3L7WA 4IPAA 3WTZA 2HYGD 3K9TA 1HKSA 3RKXA 2DPDA 2RC4A 1RUNA 3HHHA 3OV8A 2EV0A 1HW1A 2D45A 2O6GE 1TQPA 2F5CA 4AIHA 3GXOA 3F22A 1MJ9A 5JVTA 4HAMA 1K7AA 2K02A 1BIBA 5D4RA 5FD5A 1IN8A 2A61A 5DUKA 1WRJA 2QUFA 1YQAA 4BYYA 1Z7UA 1W7PA 2XASA 1HKTA 2XHKA 2DW4A 2MH9A 1I6XA 4PGGA 3N4MA 2YU3A 4U0YA 3CUQC 3COAC 2LF8A 5ICEA 5HDKA 2EJRA 1XGOA 1ZRCA 4M9SA 1MZBA 4CICA 2PMUA 4B8XA 2M87A 3RYRA 1LDKB 1R7JA 4MQVA 1FSHA 2QQAA 2LF7A 5JHUA 2DPUA 2EA2A 1HQCA 2LNBA 1YW8A 4MQ9F 5CJ9A 2MLKA 2MA3A 2HFHA 1S3JA 1XDUA 1RZ4A 4OIOF 2L3DA 3J80K 2XGXA 1GHCA 2P5VA 1NHAA 4EGYA 2G7UA 1I1GA 2EV5A 1SAXA 4A6DA 1W7PD 2GXGA 3G3ZA 2PN6A 4IF4A 3TGNA 3V8JA 2GA1A 2ZNZA 1H9TA 1WI9A 2P7CB 1EH6A 4A5NA 4KUMA 3I59A 3LA3A 5HLGA 3R60A 4MTDA 1CF7A 3ML6A 4RGRA 4KA4A 1A04A 4XBFA 2MC3A 5AIQA 4D0PA 1TLHB 3RI4A 2H6BA 3L2CA 3H3UA 1Z6RA 3U2RA 4WX9A 3R61A 4L9TA 5F1RA 1IRFA 5L3CA 2YR2A 2MH2A 4IJAA 1FBQA 4WF2A 2J5PA 2K27A 5CLSA 1FZPB 3KLNA 4YG2F 3P7NA 1R22A 4LLNA 1BM9A 3DV8A 3K1MA 2M5WA 2HWVA 2O0YA 1ZYRF 4YFXF 2M8EA 1XCVA 2JT1A 3MAJA 3M8EA 2HQRA 3MQ0A 1LQ1A 4HQMA 1O3SA 5IT9K 2NAZA 2HTSA 1ON1A 4RGSA 3RJPA 2EFNA 1FSEA 4Y17A 2XUBA 2VOOA 1XSXA 1YYVA 2IA0A 3KCCA 5LRRA 1EV7A 4OMZA 3FXQA 4ENNA 1YIOA 2JZYA 2VT2A 2WTEA 2QYOA 4JQFA 3ZPLA 3LWFA 3LA2A 2EWNA 2D1HA 2ACJA 1P4XA 3JW4A 2R3SA 1BN5A 3RPUA 3KEOA 4A2UA 4L9VA 1VTNC 2JSCA 5JFRA 3ERED 4ETSA 1USTA 2PFBA 3RTRA 3BJAA 3DEUA 3E6BA 3WU1B 3LQQA 5D5UB 1TW3A 1FOKA 1YS6A 5HOOA 5D5XB 4HQEA 3GFJA 1BIAA 1IZ1A 2KIUA 1LDJA 4N0BA 3G73A 4G7OF 2PJPA 2IPQX 5L3EA 2KJBA 5E1XA 5BOXA 4KIGA 3SXYA 2VC1A 1DPUA 3ZMTA 5BQTA 2QENA 4TV7A 3QRFF 1XDSA 4EMSA 4OU0A 3K0LA 1HW2A 4G8XA 4N9IA 1PDNC 2F5EA 1ZHFA 2DTRA 1XB4A 5A2QZ 1KU3A 3HSRA 4HDVA 3GFLA 3DFGA 1FC3A 3EYIA 1ZN2A 4IHTA 2HZTA 3O2PE 4EJWA 2P8TA 2P7VB 2W24A 5LRSA 1KQ8A 3MEXA 3V4GA 4EJTA 4RAZA 3ZMUA 4KIFA 3S2WA 3H92A 2D2WA 4XLNF 3J81K 3KZZA 2HS5A 3F8CA 4RB0A 2ZNYA 3DPTA 2VBWA 1G3TA 2DBBA 2C6YA 2FMYA 3BP8A 3HRMA 4I01A 2BGCA 1U6GA 3WTWC 5K5RA 5K5OA 3TDZC 1BBYA 3KE2A 1U3EM 2CG4A 3ELKA 3TOAA 3B02A 3F6VA 3T0YA 5J8CA 4HV5A 4Q47A 2V1DA 1R5GA 1S29A 5JR3A 1TQMA 4M74A 3I4PA 4FHTA 6PAXA 1ZGAA 3IWZA 4I7HA 4LMYA 5E18F 1D5VA 2FBHA 3QP6A 3JAMK 1REPC 2Y0MA 3SQNA 1TQIA 1BOAA 1T98A 4KDPA 1B4AA 2L54A 1CGPA 4WXCA 2VONA 2A6EF 2K4JA 1GXQA 3HOTA 1KA8A 3P9CA 4UHTA 1V3FA 5F6FA 5CVJA 3WTVC 5L3BA 1R00A 2F5DA 4ZYDA 2YX7A 3T1BA 1YTYA 4UVAA 2KIFA 1S7OA 2IA2A 1ZG5A 4I2OA 2PLYA 1XCBA 5HLIA 3V8LA 5DV5A 3F72A 2CSOA 2FNPA 3FMQA 1FNNA 1SMTA 1U5TC 2IVMA 5FLXK 3FXRA 3WTUC 2FBKA 1P2FA 2GAUA 3Q9VA 2M30A 2FOKA 2HR3A 1Z91A 1UB9A 4PZJA 2XV4S 1W5SA 3GWZA 1DUXC 2RKHA 2NRAC 3E6DA 4P9UA 5J6XA 5D5VB 1K79A 1J5YA 3E97A 2L02A 2QBYA 4A0XA 3QPTA 1YFHA 3ABUA 1Z9CA 2FRHA 3TDUC 2IA1A 1YLFA 4OOIA 3CO6C 2IRFG 4GGGA 2MLGA 2ZMEA 3GZ6A 1ZH5A 3DXJF 4EVIA 1B6AA 4EM1A 3HRTA 3LAJA 1QO0D 4WK8F 4MEXF 3DQVC 3DPLC 4EJOA 4AIKA 1K78B 3T8RA 4U88A 5LHGA 3V8KA 3FX3A 2HQNA 3FMRA 3QP5A 1Z05A 5HVQC 1OYYA 2OU2A 4P55A 3K1NA 4UV8A 2L01A 2X4HA 2AXLA 3WTYC 4HF2A 1MDMB 3HSFA 4HOBA 4XLPF 1SFEA 1I1SA 4ENJA 4I98B 4PDKA 3E3VA 4HZFA 4BHCA 5LGUA 1LJ9A 5HDGA 4HDUA 2FU4A 1B1BA 2V6CA 1R36A 1D8JA 4EGZA 2EV6A 5HS8A 4AVPA 1PP7U 2FF4A 3FZVA 4EQQA 3M7GA 1B9MA 4LFUA 3CUQB 4G7ZF 4BQAA 2VE9A 4PGHA 5FD6A 2CFXA 2COMA 3JSOA 4HF0A 1ZRFA 1YW7A 3RKWA 5K5QA 1ZG1A 3K1PA 2UZKA 5ED4A 1KU7A 3HRUA 3ZMSA 5HDNA 3BPVA 1J0RA 3BJOA 1XGNA 4KFCA 4RGXA 3P9KA 5KVRA 1RNLA 5HS7A 1R23A 4G6DA 3SZPA 4MEYF 5DYMA 1O57A 2HTJA 4ON0A 5H6QA 2BBYA 1RI7A 3EETA 4CHUA 1W5TA 1XN7A 3T5XA 2JPCA 3F6OA 4ZZDA 2P5KA 4GCVA 2P4WA 2CGPA 1H9GA 2XAGA 1TBXA 3LAPA 1UFMA 4ZYEA 1L3LA 4R79A 1SFXA 1U8RA 4CGZA 1LB2A 4A0YA 3D0SA 1OYWA 3QU3A 4Q4ZF 1DDNA 2JPBA 5AONA 3TQNA 1FBSA 2O03A 2RDPA 1HSJA 1UHMA 2ZBKA 5DCMB 4PCQA 5E1WA 2M45A 3PQJA 3CTAA 1OYIA 3P9IA 3E5QA 4OMYA 3MWMA 4YFNF 5BMZA 4LG0B 4ENMA 2EA4A 2LKPA 5L3DA 4ZZLA 4WWCA 4LLGF 2X0LA 1ZLKA 1HXDA 1WKMA 3R0AA 2RVCA 2BEOA 3LA7A 3WTTC 2PQ8A 2ESHA 5LBQA 4KN4X 3WE3A 2DO7A 2Z3YA 5LEKA 2DT5A 3KP4A 5FFXA 1F9NA 4ESBA 2WWYA 5A2QK 1D8KA 1S7AA 3I5UA 4KIBA 4E70A 2FSWA 3DKWA 2B0LA 4Q5SF 1OKRA 1XD7A 2H09A 2A6HF 4MTEA 3FXUA 1W7PB 1IAWA 3F3XA 2Q8KA 4NQWA 2F2EA 1ZREA 3T8TA 4XRFA 2EFWA 1IW7F 4HYEA 1ODDA 2GIVA 1FP2A 3CUOA 2FNAA 4LK0F 3MFKA 3AAFA 4ZYHA 4BAYA 3F8NA 1YS7A 5H6RA 2PG4A 5FO5A 2RNJA 3E6MA 1TNSA 4RAYA 1E17A 3ZMVA 3HIFA 3M1EA 2EK5A 4U0VA 2Y48A 3H3ZA 5CVRA 4LB6B 4MGRA 2UWMA 4OIRF 2VXZA 2OD5A 4HLYA 4QWQA 1BC7C 2O3FA 4JBAA 4M72A 2DAOA 3TKYA 4HV6A 1FX7A 4YIIA 2CWEA 5JI6A 1V4RA 4KMUX 1G3SA 5FGMA 2ZXJA 3IKVA 1IN5A 4I02A 4P5OA 3SHFA 1IXCA 4CDGA 2J5OA 2Z9OA 2RGVA 1IN4A 2VBZA 1STZA 3I59B 5BPDA 2BV6A 3U9GA 2YX4A 3VFZA 1CF7B 2HKOA 3GVAA 2W25A 4BHPA 5HS9A 4IHSA 4H0EA 1MD0A 3NEUA 2NYXA 3O3KA 2AS5F 4LD5A 2CO5A 2A69F 3HUGA 2K4BA 4GYIA 1XGMA 5J8FA 3I54A 3MZYA 4Y15A 2ZKZA 1SMYF 5TRDA 1TTYA 5D8LB 2NNNA 4IXAA 3HRSA 3BOQA 3BROA 2GA2A 4UVBA 5E8IA 1LEAA 2YSRA 3REOA 3WG9A 5D8KB 3KP5A 4O6JA 4CYDA 2ISYA 4P96A 2FXAA 2NS0A 4LGWA 4L0ZB 4FX4A 3SZTA 3I64A 5ILVA 1ON2A 2V79A 3C18A 3EQLF 1EH8A 2XRNA 1FPQA 5ICCA 1P4WA 3FWEA 4Y13A 5E8GA 1Z1DA 3RPQA 4UXNA 2IT0A 1F4KA 1Z6TA 1KYWA 4DQ2A 4R8HA 2MBFA 3FHZA 3L9FA 1I5ZA 1HKQA 1BI2A 4AWXB 3IRRA 4HBLA 4L18B 1J2XA 2Y75A 1SD7A 4ASNA 4RS8A 4WCGA 3RYPA 1P4AA 2KRFA 2GWRA 3VODA 2Q0OA 1O3QA 3W6KB 5D4SA 4EM0B 1KQ0A 1KYZA 1IRGA 3GF2A 5ERIA 2E1CA 5TJJA 2FEZA 4GXOA 4U7BA 1X3UA 3ZMDA 4M73A 1U2WA 3IRQA 1OR7A 2NNYA 1EH7A 1S6LA 3KP2A 1R58A 4WXHA 2OZ6A 3KLOA 3U1DA 4YFKF 3F8FA 5EEGA 2RV8A 5H20A 1U5TB 2HDCA 4EJVA 2QLZA 3BDDA 1HSTA 4CO8A 4G7HF 2ETHA 2H94A 1QGPA 2VBXA 4G94A 4Z2YA 4ZYGA 3JAMZ 2QWWA 5LEJA 3I58A 5FFZA 1JHHA 3HOSA 2P6TA 1Q1HA 4G6QA 4BH9A 3FF5A 1QPMA 4EM2A 3IC7A 4HLXA 5K1YA 2Q2EA 2V1UA 2ZJ2A 2XAFA 5E1ZB 4G9YA 3MZHA 4UUVA 3GFIA 1LDDA 2CQKA 1R1UA 1FYMA 4HW0A 1UCRA 2BYVE 2ZFWA 1D3YA 4DNCA 3TO9A 3IWFA 3V7SA 4MNUA 3IHUA 4L9JA 2VOPA 1IF1A 4XSXF 4OINF 5F64A 2W85A 4YIFA 1XGSA 2DFIA 4M9ZA 1O3TA 3E6CC 3RIRA 4L5IA 4RGUA 5CVUA 4EJUA 4I0BA 4A12A 3L09A 4HX4A 5DEQA 4KMFA 5BS6A 5D5WB 2OBPA 2DQLA 1OPCA 4U7DA 2FBIA 2OZUA 3HSEA 5LGNA 3WTSC 5IT3A 3EDPA 2XIGA 3C3WA 5DDGA 1B59A 2EB7A 3ABTA 3GEZA 2XKPA 3NRVA 1UHWA 1SD4A 1FYLA 2UXNA 4F7ZA 1KGSA 1PP8F 4OIQF 1WWXA 1QZYA 2W57A 1RUOA 4RB1A 1LVAA 3SFZA 5DUIA 4CZZA 2CW0F 3KETA 1IUYA 2MD5A 2XAJA 3ZMZA 3B73A 4WXDA 3F8BA 2R7FA 3HHGA 2P6SA 3CDHA 3KZYA 3R4KA 3F23A 2M1BA 1FBUA 3ZP5A 3WTXC 2XROA 3R6SA 4S04A 4ENKA 3TO6A 2VC0A 2ZCWA 5E20A 2PI0A 1USSA 3DP7A 4AIJA 2R7DA 3Q5FA 3ECOA 1LNWA 1E2XA 1TW2A 1J9IA 4FX0A 5D6EA 4L9NA 2XAQA 5D6FA 3ISPA 3KP3A 1TNTA 1K6OA 3RKYA 2ESNA 2HOEA 2JRTA 4BNCA 1ONVA 2ISZA 2GQQA 3QPHA 2V1XA 4XSZF 1HW5A 2STTA 1DPRA 2TDXA 2HYFA 3QAHA 2EFPA 1HBXG 2VODA 3GX4X 5BPIA 5DCFA 3BY6A 2QBYB 4A0ZA 2E7WA 1J59A 4BHBA 2VBYA 2XAHA 3KEQA 4N9HA 4L5JA 4UV9A 1T2KA 1S8NA 1BI1A 2QVOA 5CVIA 3L00A 2STWA 1G6NA 2ZMEB 2A68F 3R0JA 1T6SA 4GO1A 1PUEE 2VE8A 1WSUA 4NB5A 2IW5A 3FMSA 3WODF 2EFOA 2OQRA 1J75A 4JK1X 1JGSA 4IRIA 4KT5C 2E7XA 3WGGA 4M6XA 1IXRC 1W4MA 1MJBA 1GXPA 3J7AO 1AWCA 1XSDA 4NHJA 2ZO4A 3J80Z 2WV0A 1O7LA 2G9WA 3EYYA 1ZAOA 3QOPA 3HYIA 1R5HA 5DD4A 3JSPA 2V9VA 1KU9A 3JTHA 1OMIA 3CJNA 1T0FA 1KQ9A 1H0MA 3F8MA 4CXFA 3I53A 1L0OC 4LJZF 5ICFA 1R1TA 3ECHA 2QM3A 4A5MA 2A5YB 1RIOH 4RB3C 4K2EA 1G3WA 1FLIA 2YPRA 2EFQA 1JXSA 4EV0A 2KKOA 1ZRDA 2Z99A 4P9FA 4ESJA 4O3MA 2KIMA 2Z5UA 3TO7A 1ULYA 2PBIA 4AD9A 2Z33A 4FT8A 4L0YB 4O5VA 1QQIA 4ZH4F 4U0WA 1T38A 5IT9Z 3VB2A 1DP7P 4BXUA 1MKMA 3IKTA 4S05A 2DLLA 3CO7C 1XSVA 4KN7X 2DK5A 1SD5A 3Q9SA 2A3SA 1U5TA 5EEHA 1YW9A 1FT9A 5AIPA 1KU2A 3FM5A 1QZZA 3NQOA 2RN7A 3BPXA 2L4MA 2H6CA 3ROUA 5LHHA 3I71A 3KP6A 1XMKA 1BI3A 2PMHA 2K7LA 1YO5C 3GO5A 4IRGA 1ZLJA 3LQRA 3PFIA 3VEPA 3DF8A 3I0TA 2GXBA 1IXSB 2DI3A 1AOYA 2DQRA 3ZN0A 4LLLA 2FMLA 1BC8C 1XMAA 3F21A 1F5TA 3E5XA 1SD6A 1R1VA 3RDIA 4Q48A 1K78A 2P5LC 4I0AA 2JTVA 2O61A 1FYKA 1WQ2A 5ILUA 2FA5A 4IVNA 1MJAA 2QQBA 5KK1A 3EUHA 2QZ8A 2OQGA 2LSOA 3W6JB 3V7CA 1FWZA 3GFMA 3ZQ7A 2K86A 3PQKA 1ZGJA 1Y0UA 2VN2A 1MDMA 1G3YA 2RQPA 1JHFA 4R1HA 1T39A 4GYGA 1BI0A 1BJAA 1I27A 2FQ3A 3VOEA 4HX7A 4M6YA 5LGTA 4LB5A 3HTSB 1P92A 4ESFA 4RB2C 3WE2A 1C0WA 1LEBA 1ZARA 2HGCA 2OAZA 3HTUA 1QNTA 1U78A 3J81Z 1QBJA 3WGIA 2G7HA 4KYWA 2XVCA 2CYYA 2HEOA 3CLOA 5FB2A 2OA4A 3OOPA 3CUQA 4I09A 1GVJA 2IP2A 1B9NA 4HF1A 3C1DA 4IRHA 1ZG3A 1G4DA 2XKOA 3BJ6A 2BE5F 1F1ZA 2IJLA 2DK8A 5E17F 2UXXA 2W84A 3FM3A 3GYHX 3JTGA 4B09A 5L3GA 3M9AA 4QLCU 2ELHA 3D5LA 1FY7A 3QU6A 2VT3A 3TOBA 4UVCA 4A6EA 3GZ5A 2WC2A 1P6RA 1IN6A 1O7FA 3O6BB 2A07F 3IL2A 3GW2A 5HLHA 1SFUA 1IN7A 3LSTA 3ZN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8F A;  3BWG A;  2H27 A;  3GUD A;  4M71 A;  2DU9 A;  2O8X A;  5ICG A;  5LLQ A;  3V7R A;  3GLX A;  1JE8 A;  5CVV A;  4OIP F;  3BZ6 A;  2D1V A;  1FP1 D;  3E5U A;  3N97 A;  5CYV A;  3WGH A;  2ADU A;  2LDU A;  3ULQ B;  3WU0 A;  4HX8 A;  1YG2 A;  5ILS A;  1MGT A;  4LK1 F;  2KJC A;  1J7K A;  3LFK A;  5DD8 A;  2PEX A;  2HKX A;  4UNO A;  2QQ9 A;  5DCM A;  4MHG A;  2FE3 A;  3MCZ A;  1O3R A;  3KP7 A;  5LHI A;  4KIC A;  4M9X A;  5FLX Z;  5L3F A;  2GZW A;  4KNY A;  3K2Z A;  3C7J A;  2F5F A;  3KFW X;  3K69 A;  4HA8 A;  2L4A A;  2E1N A;  4LG0 A;  3L7W A;  4IPA A;  3WTZ A;  2HYG D;  3K9T A;  1HKS A;  3RKX A;  2DPD A;  2RC4 A;  1RUN A;  3HHH A;  3OV8 A;  2EV0 A;  1HW1 A;  2D45 A;  2O6G E;  1TQP A;  2F5C A;  4AIH A;  3GXO A;  3F22 A;  1MJ9 A;  5JVT A;  4HAM A;  1K7A A;  2K02 A;  1BIB A;  5D4R A;  5FD5 A;  1IN8 A;  2A61 A;  5DUK A;  1WRJ A;  2QUF A;  1YQA A;  4BYY A;  1Z7U A;  1W7P A;  2XAS A;  1HKT A;  2XHK A;  2DW4 A;  2MH9 A;  1I6X A;  4PGG A;  3N4M A;  2YU3 A;  4U0Y A;  3CUQ C;  3COA C;  2LF8 A;  5ICE A;  5HDK A;  2EJR A;  1XGO A;  1ZRC A;  4M9S A;  1MZB A;  4CIC A;  2PMU A;  4B8X A;  2M87 A;  3RYR A;  1LDK B;  1R7J A;  4MQV A;  1FSH A;  2QQA A;  2LF7 A;  5JHU A;  2DPU A;  2EA2 A;  1HQC A;  2LNB A;  1YW8 A;  4MQ9 F;  5CJ9 A;  2MLK A;  2MA3 A;  2HFH A;  1S3J A;  1XDU A;  1RZ4 A;  4OIO F;  2L3D A;  3J80 K;  2XGX A;  1GHC A;  2P5V A;  1NHA A;  4EGY A;  2G7U A;  1I1G A;  2EV5 A;  1SAX A;  4A6D A;  1W7P D;  2GXG A;  3G3Z A;  2PN6 A;  4IF4 A;  3TGN A;  3V8J A;  2GA1 A;  2ZNZ A;  1H9T A;  1WI9 A;  2P7C B;  1EH6 A;  4A5N A;  4KUM A;  3I59 A;  3LA3 A;  5HLG A;  3R60 A;  4MTD A;  1CF7 A;  3ML6 A;  4RGR A;  4KA4 A;  1A04 A;  4XBF A;  2MC3 A;  5AIQ A;  4D0P A;  1TLH B;  3RI4 A;  2H6B A;  3L2C A;  3H3U A;  1Z6R A;  3U2R A;  4WX9 A;  3R61 A;  4L9T A;  5F1R A;  1IRF A;  5L3C A;  2YR2 A;  2MH2 A;  4IJA A;  1FBQ A;  4WF2 A;  2J5P A;  2K27 A;  5CLS A;  1FZP B;  3KLN A;  4YG2 F;  3P7N A;  1R22 A;  4LLN A;  1BM9 A;  3DV8 A;  3K1M A;  2M5W A;  2HWV A;  2O0Y A;  1ZYR F;  4YFX F;  2M8E A;  1XCV A;  2JT1 A;  3MAJ A;  3M8E A;  2HQR A;  3MQ0 A;  1LQ1 A;  4HQM A;  1O3S A;  5IT9 K;  2NAZ A;  2HTS A;  1ON1 A;  4RGS A;  3RJP A;  2EFN A;  1FSE A;  4Y17 A;  2XUB A;  2VOO A;  1XSX A;  1YYV A;  2IA0 A;  3KCC A;  5LRR A;  1EV7 A;  4OMZ A;  3FXQ A;  4ENN A;  1YIO A;  2JZY A;  2VT2 A;  2WTE A;  2QYO A;  4JQF A;  3ZPL A;  3LWF A;  3LA2 A;  2EWN A;  2D1H A;  2ACJ A;  1P4X A;  3JW4 A;  2R3S A;  1BN5 A;  3RPU A;  3KEO A;  4A2U A;  4L9V A;  1VTN C;  2JSC A;  5JFR A;  3ERE D;  4ETS A;  1UST A;  2PFB A;  3RTR A;  3BJA A;  3DEU A;  3E6B A;  3WU1 B;  3LQQ A;  5D5U B;  1TW3 A;  1FOK A;  1YS6 A;  5HOO A;  5D5X B;  4HQE A;  3GFJ A;  1BIA A;  1IZ1 A;  2KIU A;  1LDJ A;  4N0B A;  3G73 A;  4G7O F;  2PJP A;  2IPQ X;  5L3E A;  2KJB A;  5E1X A;  5BOX A;  4KIG A;  3SXY A;  2VC1 A;  1DPU A;  3ZMT A;  5BQT A;  2QEN A;  4TV7 A;  3QRF F;  1XDS A;  4EMS A;  4OU0 A;  3K0L A;  1HW2 A;  4G8X A;  4N9I A;  1PDN C;  2F5E A;  1ZHF A;  2DTR A;  1XB4 A;  5A2Q Z;  1KU3 A;  3HSR A;  4HDV A;  3GFL A;  3DFG A;  1FC3 A;  3EYI A;  1ZN2 A;  4IHT A;  2HZT A;  3O2P E;  4EJW A;  2P8T A;  2P7V B;  2W24 A;  5LRS A;  1KQ8 A;  3MEX A;  3V4G A;  4EJT A;  4RAZ A;  3ZMU A;  4KIF A;  3S2W A;  3H92 A;  2D2W A;  4XLN F;  3J81 K;  3KZZ A;  2HS5 A;  3F8C A;  4RB0 A;  2ZNY A;  3DPT A;  2VBW A;  1G3T A;  2DBB A;  2C6Y A;  2FMY A;  3BP8 A;  3HRM A;  4I01 A;  2BGC A;  1U6G A;  3WTW C;  5K5R A;  5K5O A;  3TDZ C;  1BBY A;  3KE2 A;  1U3E M;  2CG4 A;  3ELK A;  3TOA A;  3B02 A;  3F6V A;  3T0Y A;  5J8C A;  4HV5 A;  4Q47 A;  2V1D A;  1R5G A;  1S29 A;  5JR3 A;  1TQM A;  4M74 A;  3I4P A;  4FHT A;  6PAX A;  1ZGA A;  3IWZ A;  4I7H A;  4LMY A;  5E18 F;  1D5V A;  2FBH A;  3QP6 A;  3JAM K;  1REP C;  2Y0M A;  3SQN A;  1TQI A;  1BOA A;  1T98 A;  4KDP A;  1B4A A;  2L54 A;  1CGP A;  4WXC A;  2VON A;  2A6E F;  2K4J A;  1GXQ A;  3HOT A;  1KA8 A;  3P9C A;  4UHT A;  1V3F A;  5F6F A;  5CVJ A;  3WTV C;  5L3B A;  1R00 A;  2F5D A;  4ZYD A;  2YX7 A;  3T1B A;  1YTY A;  4UVA A;  2KIF A;  1S7O A;  2IA2 A;  1ZG5 A;  4I2O A;  2PLY A;  1XCB A;  5HLI A;  3V8L A;  5DV5 A;  3F72 A;  2CSO A;  2FNP A;  3FMQ A;  1FNN A;  1SMT A;  1U5T C;  2IVM A;  5FLX K;  3FXR A;  3WTU C;  2FBK A;  1P2F A;  2GAU A;  3Q9V A;  2M30 A;  2FOK A;  2HR3 A;  1Z91 A;  1UB9 A;  4PZJ A;  2XV4 S;  1W5S A;  3GWZ A;  1DUX C;  2RKH A;  2NRA C;  3E6D A;  4P9U A;  5J6X A;  5D5V B;  1K79 A;  1J5Y A;  3E97 A;  2L02 A;  2QBY A;  4A0X A;  3QPT A;  1YFH A;  3ABU A;  1Z9C A;  2FRH A;  3TDU C;  2IA1 A;  1YLF A;  4OOI A;  3CO6 C;  2IRF G;  4GGG A;  2MLG A;  2ZME A;  3GZ6 A;  1ZH5 A;  3DXJ F;  4EVI A;  1B6A A;  4EM1 A;  3HRT A;  3LAJ A;  1QO0 D;  4WK8 F;  4MEX F;  3DQV C;  3DPL C;  4EJO A;  4AIK A;  1K78 B;  3T8R A;  4U88 A;  5LHG A;  3V8K A;  3FX3 A;  2HQN A;  3FMR A;  3QP5 A;  1Z05 A;  5HVQ C;  1OYY A;  2OU2 A;  4P55 A;  3K1N A;  4UV8 A;  2L01 A;  2X4H A;  2AXL A;  3WTY C;  4HF2 A;  1MDM B;  3HSF A;  4HOB A;  4XLP F;  1SFE A;  1I1S A;  4ENJ A;  4I98 B;  4PDK A;  3E3V A;  4HZF A;  4BHC A;  5LGU A;  1LJ9 A;  5HDG A;  4HDU A;  2FU4 A;  1B1B A;  2V6C A;  1R36 A;  1D8J A;  4EGZ A;  2EV6 A;  5HS8 A;  4AVP A;  1PP7 U;  2FF4 A;  3FZV A;  4EQQ A;  3M7G A;  1B9M A;  4LFU A;  3CUQ B;  4G7Z F;  4BQA A;  2VE9 A;  4PGH A;  5FD6 A;  2CFX A;  2COM A;  3JSO A;  4HF0 A;  1ZRF A;  1YW7 A;  3RKW A;  5K5Q A;  1ZG1 A;  3K1P A;  2UZK A;  5ED4 A;  1KU7 A;  3HRU A;  3ZMS A;  5HDN A;  3BPV A;  1J0R A;  3BJO A;  1XGN A;  4KFC A;  4RGX A;  3P9K A;  5KVR A;  1RNL A;  5HS7 A;  1R23 A;  4G6D A;  3SZP A;  4MEY F;  5DYM A;  1O57 A;  2HTJ A;  4ON0 A;  5H6Q A;  2BBY A;  1RI7 A;  3EET A;  4CHU A;  1W5T A;  1XN7 A;  3T5X A;  2JPC A;  3F6O A;  4ZZD A;  2P5K A;  4GCV A;  2P4W A;  2CGP A;  1H9G A;  2XAG A;  1TBX A;  3LAP A;  1UFM A;  4ZYE A;  1L3L A;  4R79 A;  1SFX A;  1U8R A;  4CGZ A;  1LB2 A;  4A0Y A;  3D0S A;  1OYW A;  3QU3 A;  4Q4Z F;  1DDN A;  2JPB A;  5AON A;  3TQN A;  1FBS A;  2O03 A;  2RDP A;  1HSJ A;  1UHM A;  2ZBK A;  5DCM B;  4PCQ A;  5E1W A;  2M45 A;  3PQJ A;  3CTA A;  1OYI A;  3P9I A;  3E5Q A;  4OMY A;  3MWM A;  4YFN F;  5BMZ A;  4LG0 B;  4ENM A;  2EA4 A;  2LKP A;  5L3D A;  4ZZL A;  4WWC A;  4LLG F;  2X0L A;  1ZLK A;  1HXD A;  1WKM A;  3R0A A;  2RVC A;  2BEO A;  3LA7 A;  3WTT C;  2PQ8 A;  2ESH A;  5LBQ A;  4KN4 X;  3WE3 A;  2DO7 A;  2Z3Y A;  5LEK A;  2DT5 A;  3KP4 A;  5FFX A;  1F9N A;  4ESB A;  2WWY A;  5A2Q K;  1D8K A;  1S7A A;  3I5U A;  4KIB A;  4E70 A;  2FSW A;  3DKW A;  2B0L A;  4Q5S F;  1OKR A;  1XD7 A;  2H09 A;  2A6H F;  4MTE A;  3FXU A;  1W7P B;  1IAW A;  3F3X A;  2Q8K A;  4NQW A;  2F2E A;  1ZRE A;  3T8T A;  4XRF A;  2EFW A;  1IW7 F;  4HYE A;  1ODD A;  2GIV A;  1FP2 A;  3CUO A;  2FNA A;  4LK0 F;  3MFK A;  3AAF A;  4ZYH A;  4BAY A;  3F8N A;  1YS7 A;  5H6R A;  2PG4 A;  5FO5 A;  2RNJ A;  3E6M A;  1TNS A;  4RAY A;  1E17 A;  3ZMV A;  3HIF A;  3M1E A;  2EK5 A;  4U0V A;  2Y48 A;  3H3Z A;  5CVR A;  4LB6 B;  4MGR A;  2UWM A;  4OIR F;  2VXZ A;  2OD5 A;  4HLY A;  4QWQ A;  1BC7 C;  2O3F A;  4JBA A;  4M72 A;  2DAO A;  3TKY A;  4HV6 A;  1FX7 A;  4YII A;  2CWE A;  5JI6 A;  1V4R A;  4KMU X;  1G3S A;  5FGM A;  2ZXJ A;  3IKV A;  1IN5 A;  4I02 A;  4P5O A;  3SHF A;  1IXC A;  4CDG A;  2J5O A;  2Z9O A;  2RGV A;  1IN4 A;  2VBZ A;  1STZ A;  3I59 B;  5BPD A;  2BV6 A;  3U9G A;  2YX4 A;  3VFZ A;  1CF7 B;  2HKO A;  3GVA A;  2W25 A;  4BHP A;  5HS9 A;  4IHS A;  4H0E A;  1MD0 A;  3NEU A;  2NYX A;  3O3K A;  2AS5 F;  4LD5 A;  2CO5 A;  2A69 F;  3HUG A;  2K4B A;  4GYI A;  1XGM A;  5J8F A;  3I54 A;  3MZY A;  4Y15 A;  2ZKZ A;  1SMY F;  5TRD A;  1TTY A;  5D8L B;  2NNN A;  4IXA A;  3HRS A;  3BOQ A;  3BRO A;  2GA2 A;  4UVB A;  5E8I A;  1LEA A;  2YSR A;  3REO A;  3WG9 A;  5D8K B;  3KP5 A;  4O6J A;  4CYD A;  2ISY A;  4P96 A;  2FXA A;  2NS0 A;  4LGW A;  4L0Z B;  4FX4 A;  3SZT A;  3I64 A;  5ILV A;  1ON2 A;  2V79 A;  3C18 A;  3EQL F;  1EH8 A;  2XRN A;  1FPQ A;  5ICC A;  1P4W A;  3FWE A;  4Y13 A;  5E8G A;  1Z1D A;  3RPQ A;  4UXN A;  2IT0 A;  1F4K A;  1Z6T A;  1KYW A;  4DQ2 A;  4R8H A;  2MBF A;  3FHZ A;  3L9F A;  1I5Z A;  1HKQ A;  1BI2 A;  4AWX B;  3IRR A;  4HBL A;  4L18 B;  1J2X A;  2Y75 A;  1SD7 A;  4ASN A;  4RS8 A;  4WCG A;  3RYP A;  1P4A A;  2KRF A;  2GWR A;  3VOD A;  2Q0O A;  1O3Q A;  3W6K B;  5D4S A;  4EM0 B;  1KQ0 A;  1KYZ A;  1IRG A;  3GF2 A;  5ERI A;  2E1C A;  5TJJ A;  2FEZ A;  4GXO A;  4U7B A;  1X3U A;  3ZMD A;  4M73 A;  1U2W A;  3IRQ A;  1OR7 A;  2NNY A;  1EH7 A;  1S6L A;  3KP2 A;  1R58 A;  4WXH A;  2OZ6 A;  3KLO A;  3U1D A;  4YFK F;  3F8F A;  5EEG A;  2RV8 A;  5H20 A;  1U5T B;  2HDC A;  4EJV A;  2QLZ A;  3BDD A;  1HST A;  4CO8 A;  4G7H F;  2ETH A;  2H94 A;  1QGP A;  2VBX A;  4G94 A;  4Z2Y A;  4ZYG A;  3JAM Z;  2QWW A;  5LEJ A;  3I58 A;  5FFZ A;  1JHH A;  3HOS A;  2P6T A;  1Q1H A;  4G6Q A;  4BH9 A;  3FF5 A;  1QPM A;  4EM2 A;  3IC7 A;  4HLX A;  5K1Y A;  2Q2E A;  2V1U A;  2ZJ2 A;  2XAF A;  5E1Z B;  4G9Y A;  3MZH A;  4UUV A;  3GFI A;  1LDD A;  2CQK A;  1R1U A;  1FYM A;  4HW0 A;  1UCR A;  2BYV E;  2ZFW A;  1D3Y A;  4DNC A;  3TO9 A;  3IWF A;  3V7S A;  4MNU A;  3IHU A;  4L9J A;  2VOP A;  1IF1 A;  4XSX F;  4OIN F;  5F64 A;  2W85 A;  4YIF A;  1XGS A;  2DFI A;  4M9Z A;  1O3T A;  3E6C C;  3RIR A;  4L5I A;  4RGU A;  5CVU A;  4EJU A;  4I0B A;  4A12 A;  3L09 A;  4HX4 A;  5DEQ A;  4KMF A;  5BS6 A;  5D5W B;  2OBP A;  2DQL A;  1OPC A;  4U7D A;  2FBI A;  2OZU A;  3HSE A;  5LGN A;  3WTS C;  5IT3 A;  3EDP A;  2XIG A;  3C3W A;  5DDG A;  1B59 A;  2EB7 A;  3ABT A;  3GEZ A;  2XKP A;  3NRV A;  1UHW A;  1SD4 A;  1FYL A;  2UXN A;  4F7Z A;  1KGS A;  1PP8 F;  4OIQ F;  1WWX A;  1QZY A;  2W57 A;  1RUO A;  4RB1 A;  1LVA A;  3SFZ A;  5DUI A;  4CZZ A;  2CW0 F;  3KET A;  1IUY A;  2MD5 A;  2XAJ A;  3ZMZ A;  3B73 A;  4WXD A;  3F8B A;  2R7F A;  3HHG A;  2P6S A;  3CDH A;  3KZY A;  3R4K A;  3F23 A;  2M1B A;  1FBU A;  3ZP5 A;  3WTX C;  2XRO A;  3R6S A;  4S04 A;  4ENK A;  3TO6 A;  2VC0 A;  2ZCW A;  5E20 A;  2PI0 A;  1USS A;  3DP7 A;  4AIJ A;  2R7D A;  3Q5F A;  3ECO A;  1LNW A;  1E2X A;  1TW2 A;  1J9I A;  4FX0 A;  5D6E A;  4L9N A;  2XAQ A;  5D6F A;  3ISP A;  3KP3 A;  1TNT A;  1K6O A;  3RKY A;  2ESN A;  2HOE A;  2JRT A;  4BNC A;  1ONV A;  2ISZ A;  2GQQ A;  3QPH A;  2V1X A;  4XSZ F;  1HW5 A;  2STT A;  1DPR A;  2TDX A;  2HYF A;  3QAH A;  2EFP A;  1HBX G;  2VOD A;  3GX4 X;  5BPI A;  5DCF A;  3BY6 A;  2QBY B;  4A0Z A;  2E7W A;  1J59 A;  4BHB A;  2VBY A;  2XAH A;  3KEQ A;  4N9H A;  4L5J A;  4UV9 A;  1T2K A;  1S8N A;  1BI1 A;  2QVO A;  5CVI A;  3L00 A;  2STW A;  1G6N A;  2ZME B;  2A68 F;  3R0J A;  1T6S A;  4GO1 A;  1PUE E;  2VE8 A;  1WSU A;  4NB5 A;  2IW5 A;  3FMS A;  3WOD F;  2EFO A;  2OQR A;  1J75 A;  4JK1 X;  1JGS A;  4IRI A;  4KT5 C;  2E7X A;  3WGG A;  4M6X A;  1IXR C;  1W4M A;  1MJB A;  1GXP A;  3J7A O;  1AWC A;  1XSD A;  4NHJ A;  2ZO4 A;  3J80 Z;  2WV0 A;  1O7L A;  2G9W A;  3EYY A;  1ZAO A;  3QOP A;  3HYI A;  1R5H A;  5DD4 A;  3JSP A;  2V9V A;  1KU9 A;  3JTH A;  1OMI A;  3CJN A;  1T0F A;  1KQ9 A;  1H0M A;  3F8M A;  4CXF A;  3I53 A;  1L0O C;  4LJZ F;  5ICF A;  1R1T A;  3ECH A;  2QM3 A;  4A5M A;  2A5Y B;  1RIO H;  4RB3 C;  4K2E A;  1G3W A;  1FLI A;  2YPR A;  2EFQ A;  1JXS A;  4EV0 A;  2KKO A;  1ZRD A;  2Z99 A;  4P9F A;  4ESJ A;  4O3M A;  2KIM A;  2Z5U A;  3TO7 A;  1ULY A;  2PBI A;  4AD9 A;  2Z33 A;  4FT8 A;  4L0Y B;  4O5V A;  1QQI A;  4ZH4 F;  4U0W A;  1T38 A;  5IT9 Z;  3VB2 A;  1DP7 P;  4BXU A;  1MKM A;  3IKT A;  4S05 A;  2DLL A;  3CO7 C;  1XSV A;  4KN7 X;  2DK5 A;  1SD5 A;  3Q9S A;  2A3S A;  1U5T A;  5EEH A;  1YW9 A;  1FT9 A;  5AIP A;  1KU2 A;  3FM5 A;  1QZZ A;  3NQO A;  2RN7 A;  3BPX A;  2L4M A;  2H6C A;  3ROU A;  5LHH A;  3I71 A;  3KP6 A;  1XMK A;  1BI3 A;  2PMH A;  2K7L A;  1YO5 C;  3GO5 A;  4IRG A;  1ZLJ A;  3LQR A;  3PFI A;  3VEP A;  3DF8 A;  3I0T A;  2GXB A;  1IXS B;  2DI3 A;  1AOY A;  2DQR A;  3ZN0 A;  4LLL A;  2FML A;  1BC8 C;  1XMA A;  3F21 A;  1F5T A;  3E5X A;  1SD6 A;  1R1V A;  3RDI A;  4Q48 A;  1K78 A;  2P5L C;  4I0A A;  2JTV A;  2O61 A;  1FYK A;  1WQ2 A;  5ILU A;  2FA5 A;  4IVN A;  1MJA A;  2QQB A;  5KK1 A;  3EUH A;  2QZ8 A;  2OQG A;  2LSO A;  3W6J B;  3V7C A;  1FWZ A;  3GFM A;  3ZQ7 A;  2K86 A;  3PQK A;  1ZGJ A;  1Y0U A;  2VN2 A;  1MDM A;  1G3Y A;  2RQP A;  1JHF A;  4R1H A;  1T39 A;  4GYG A;  1BI0 A;  1BJA A;  1I27 A;  2FQ3 A;  3VOE A;  4HX7 A;  4M6Y A;  5LGT A;  4LB5 A;  3HTS B;  1P92 A;  4ESF A;  4RB2 C;  3WE2 A;  1C0W A;  1LEB A;  1ZAR A;  2HGC A;  2OAZ A;  3HTU A;  1QNT A;  1U78 A;  3J81 Z;  1QBJ A;  3WGI A;  2G7H A;  4KYW A;  2XVC A;  2CYY A;  2HEO A;  3CLO A;  5FB2 A;  2OA4 A;  3OOP A;  3CUQ A;  4I09 A;  1GVJ A;  2IP2 A;  1B9N A;  4HF1 A;  3C1D A;  4IRH A;  1ZG3 A;  1G4D A;  2XKO A;  3BJ6 A;  2BE5 F;  1F1Z A;  2IJL A;  2DK8 A;  5E17 F;  2UXX A;  2W84 A;  3FM3 A;  3GYH X;  3JTG A;  4B09 A;  5L3G A;  3M9A A;  4QLC U;  2ELH A;  3D5L A;  1FY7 A;  3QU6 A;  2VT3 A;  3TOB A;  4UVC A;  4A6E A;  3GZ5 A;  2WC2 A;  1P6R A;  1IN6 A;  1O7F A;  3O6B B;  2A07 F;  3IL2 A;  3GW2 A;  5HLH A;  1SFU A;  1IN7 A;  3LST A;  3ZN1 A; 
#chains in the Genus database with same CATH topology
 2DFH A;  2XB0 X;  3BWG A;  3M8F A;  1JUS A;  2H27 A;  3GUD A;  4B47 A;  4M71 A;  2LY9 A;  4M3D A;  2M4G A;  2DU9 A;  2HYJ A;  2O8X A;  5ICG A;  5E3L A;  3CCU I;  1BR2 A;  5LLQ A;  2NVU B;  3A02 A;  3V7R A;  4Y52 J;  3GLX A;  1ZR2 A;  3QQA A;  5JLX A;  1JE8 A;  3CCM I;  5CVV A;  4OIP F;  3G4S I;  3BZ6 A;  2XF6 A;  1MW7 A;  2D1V A;  1B72 B;  1FP1 D;  1MSE C;  3JRG A;  3TP3 A;  3E5U A;  3N97 A;  3DPU A;  1YIT I;  3HUG B;  5CYV A;  3MD2 A;  3WGH A;  3QOD A;  2ADU A;  1OCR H;  2LDU A;  1Z21 A;  2RRE A;  3SEZ A;  1D5Y A;  3ULQ B;  3WU0 A;  1WVR A;  2RNG A;  4HX8 A;  1QRY A;  3PSI A;  1YG2 A;  3ASO H;  1YRN B;  5ILS A;  1MGT A;  4LK1 F;  3HL2 A;  2KJC A;  4DZJ A;  1J7K A;  3LFK A;  5DD8 A;  2PEX A;  5FKL A;  4CCJ A;  2HKX A;  1MNE A;  2XGE A;  4UNO A;  2QQ9 A;  3CLQ A;  5DCM A;  4MHG A;  1POG A;  2FE3 A;  3MCZ A;  3MMY B;  1O3R A;  3E1S A;  3KP7 A;  5LHI A;  4KIC A;  4M9X A;  1Y8Q B;  5FLX Z;  5L3F A;  2GZW A;  4KNY A;  3K2Z A;  3C7J A;  2F5F A;  4ZJZ A;  3TED A;  1NH3 A;  3KFW X;  3K69 A;  2CW8 A;  3AL0 C;  3H5R A;  2HI3 A;  1QZE A;  1WH5 A;  4HA8 A;  2L4A A;  2PMZ N;  3A2K A;  3PL8 A;  2E1N A;  3EUH C;  1MMA A;  3VYR B;  4LG0 A;  2LOO A;  3L7W A;  4IPA A;  3WTZ A;  4B48 A;  2HYG D;  2WAF A;  3K9T A;  1HKS A;  3RKX A;  2DPD A;  2RC4 A;  5GPC A;  1RUN A;  2DXI A;  3HHH A;  3OV8 A;  1UEL B;  2EV0 A;  1HW1 A;  1TP4 A;  2D45 A;  2O6G E;  3PIP F;  1TQP A;  2F5C A;  3MVP A;  1X4P A;  4AIH A;  1G8X A;  3GXO A;  4AM3 A;  3F22 A;  1MJ9 A;  5HNF A;  3C2G A;  2HPM A;  1D0Y A;  2XB5 A;  1IJW C;  5JVT A;  1D0Z A;  4HAM A;  4MFE A;  1K7A A;  1X4O A;  2K02 A;  3A1Y A;  3BG9 A;  1BIB A;  2B63 J;  2JQ7 A;  5D4R A;  1GV2 A;  1V54 H;  3HKZ N;  5FD5 A;  1IN8 A;  2A61 A;  3Q0W A;  3SZG A;  1BOB A;  1ETK A;  5DUK A;  1WRJ A;  2QUF A;  1YQA A;  5EF6 A;  2EQR A;  1MH4 A;  4BYY A;  2DA4 A;  1Z7U A;  2ZJR F;  4HST A;  1W7P A;  2XAS A;  1HKT A;  2XHK A;  2DW4 A;  2MH9 A;  1I6X A;  4PGG A;  5EYR A;  3N4M A;  2DJI A;  2YU3 A;  4U0Y A;  1Z3Y A;  1VQK I;  3CUQ C;  5GPA A;  3COA C;  4DOZ A;  2LF8 A;  5ICE A;  5HDK A;  2EJR A;  1XGO A;  5J4Y A;  1ZRC A;  3K4C A;  2KLO A;  2BHZ A;  4LOC A;  1MZB A;  4M9S A;  4UY8 I;  4CIC A;  2VKH A;  2VXD A;  4ZC3 A;  2PMU A;  1AKH B;  3S15 J;  3JRI A;  1CQT A;  4B8X A;  4BY1 J;  1RES A;  1JT6 A;  2M87 A;  3RYR A;  1LDK B;  4XKC A;  1DGR M;  1R7J A;  2A05 A;  4MQV A;  3OSG A;  2JUG A;  1FSH A;  1NG7 A;  2QQA A;  3HGG A;  3UNG C;  3AG3 H;  3S8P A;  1YJW I;  2LF7 A;  3WHB A;  5LFA A;  5CQG A;  5JHU A;  2DPU A;  2E35 A;  2EA2 A;  1HQC A;  5FKM A;  4HSR A;  3CP8 A;  1IC8 A;  2LNB A;  1YW8 A;  4MQ9 F;  2ZSH B;  5CJ9 A;  2CQN A;  2MLK A;  2YU9 J;  3HOW J;  3NAU A;  2MA3 A;  2HFH A;  3C2B A;  2ECB A;  1S3J A;  4IOC F;  3OIO A;  1HA8 A;  1XDU A;  1RZ4 A;  2L7K A;  4OIO F;  2L3D A;  3J80 K;  2XGX A;  1GHC A;  2P5V A;  3FDY A;  4IHW A;  1NHA A;  3EUK L;  4PFO A;  4EGY A;  4BXX J;  2HVR A;  2G7U A;  1I1G A;  2EV5 A;  2JA6 J;  2X1C A;  2BZT A;  1SAX A;  2IS6 A;  4A6D A;  1LFB A;  1W7P D;  3OS2 A;  2GXG A;  3G3Z A;  2PN6 A;  4IF4 A;  2X6Y A;  3TGN A;  3V8J A;  4ZDO A;  2GA1 A;  1LVK A;  2ZNZ A;  1H9T A;  1X1D A;  1WI9 A;  2P7C B;  1EH6 A;  4F3Q A;  4BE1 A;  4A5N A;  2JK3 A;  4KUM A;  3I59 A;  3LA3 A;  5HLG A;  4RAG A;  4X6A J;  3R60 A;  3RCO A;  2KPM A;  4C9Y A;  3ML6 A;  4MTD A;  1CF7 A;  1RET A;  2JVG A;  1YJ9 I;  4RGR A;  4KA4 A;  2EH3 A;  1A04 A;  4XBF A;  2MC3 A;  5AIQ A;  3LSP A;  4FET A;  5M3M J;  4D0P A;  4Y33 A;  1TLH B;  4OAY A;  2H6B A;  3RI4 A;  3L2C A;  3H3U A;  1TWF J;  1Z6R A;  3U2R A;  2JA2 A;  4WX9 A;  2WV1 A;  3R61 A;  4L9T A;  5F1R A;  1IRF A;  5L3C A;  2YR2 A;  1A6I A;  2MH2 A;  4G12 A;  4IJA A;  3G1L A;  3IUO A;  1FBQ A;  2MAB A;  4WF2 A;  2J5P A;  2K27 A;  2FOW A;  5CLS A;  1FZP B;  4U87 A;  1Z7L A;  3KLN A;  4YG2 F;  3P7N A;  4UB8 C;  1R22 A;  4NDL A;  4BQO A;  4LLN A;  4OAZ A;  1BM9 A;  1WJD A;  3BT9 A;  3DV8 A;  3K1M A;  2M5W A;  3S1M J;  2HWV A;  2W7N A;  2O0Y A;  2V6E A;  3OR2 C;  1ZYR F;  4YFX F;  3CCR I;  1N78 A;  1TWA J;  2M8E A;  1XCV A;  4Y3O A;  2JT1 A;  3MAJ A;  3M8E A;  2HQR A;  1MH3 A;  3MQ0 A;  3ZR8 X;  5M5Y J;  1MBK A;  1LQ1 A;  4UB6 C;  2Z1D A;  4HQM A;  1O3S A;  5IT9 K;  1TT5 B;  4JP0 A;  2EZI A;  2NAZ A;  2KMU A;  2HTS A;  4ZTJ A;  4XID A;  1ON1 A;  2HDD A;  4RGS A;  1ETX A;  3RJP A;  2EFN A;  5CQE A;  1FSE A;  4Y17 A;  2XUB A;  5B66 C;  2VOO A;  2F48 A;  1FOX A;  1XSX A;  3L2V A;  3W3C A;  4BAC A;  1YYV A;  4C3I J;  2IA0 A;  3KCC A;  5LRR A;  1EV7 A;  4E7S A;  1K4T A;  1BJZ A;  1FIA A;  1WJA A;  4BUP A;  1YX3 A;  4OMZ A;  2EIM H;  3FXQ A;  4ENN A;  1YIO A;  2JZY A;  4AID A;  2VT2 A;  2WTE A;  2LBF A;  2QYO A;  3FK7 A;  5DM7 F;  3K4K A;  2BVL A;  4JQF A;  3ZPL A;  3H1C A;  3LWF A;  2EZL A;  3ZQQ A;  3H9J A;  2QKM B;  4CYC A;  3LA2 A;  2EWN A;  2K9S A;  2D1H A;  2ACJ A;  3H0D A;  1P4X A;  3BZK A;  3VYT B;  3JW4 A;  3U1K A;  2IGM A;  2R3S A;  3HOX J;  1BN5 A;  3RPU A;  3CME I;  3CCV I;  2UV1 A;  3KEO A;  4LIT A;  4A2U A;  4L9V A;  1VTN C;  2JSC A;  1XPX A;  4PUS A;  3PNT A;  4F55 A;  4BU2 A;  4JX6 A;  5JFR A;  3ERE D;  2ZC2 A;  4ETS A;  1D1B A;  4IZZ A;  2XAU A;  2L9N A;  1UST A;  2PFB A;  3RTR A;  3BJA A;  1X19 A;  3DEU A;  3BR6 A;  3E6B A;  3VDX A;  3CMA I;  3G71 I;  2V9K A;  3VSK A;  3TW7 A;  1VQ7 I;  2X48 A;  3WU1 B;  3LQQ A;  5D5U B;  1TW3 A;  3AG4 H;  1VQP I;  1FOK A;  1YS6 A;  5HOO A;  2O7O A;  3PNV A;  5D5X B;  3S1Q J;  4HQE A;  3GFJ A;  3ZQL A;  1BIA A;  1IZ1 A;  2E1M C;  2KIU A;  1LDJ A;  3WHC A;  4IX7 A;  3H5A A;  4N0B A;  3G73 A;  1JKR C;  4G7O F;  1RKW A;  1WPK A;  2IPQ X;  2PJP A;  3L2R A;  5M3F J;  2L2O A;  2OUM A;  5L3E A;  2KJB A;  3OYK A;  5E1X A;  4JYK A;  5H2F C;  5BOX A;  4KIG A;  2EZK A;  1NK3 P;  3SXY A;  2CV2 A;  2VC1 A;  1DPU A;  2BXZ A;  3ZMT A;  3PO2 J;  5BQT A;  2QEN A;  4XON A;  4TV7 A;  3QRF F;  3LMM A;  1XDS A;  1UMQ A;  2JA8 J;  4EMS A;  2KT0 A;  3K0L A;  3LSG A;  4OU0 A;  5EDN A;  3SDG A;  3L2W A;  4Y7N J;  2ICW G;  2NXN B;  4G8X A;  1HW2 A;  1X2M A;  4N9I A;  4E7K A;  1PDN C;  2F5E A;  2DFE A;  1ZHF A;  2DTR A;  1LFU P;  1VQ5 I;  1XB4 A;  5A2Q Z;  2CH0 A;  1A6Q A;  4HG2 A;  3HOZ J;  5EG0 A;  3I9V 2;  3RPU D;  1KU3 A;  3HSR A;  1W0T A;  4HDV A;  2VUM J;  3GFL A;  3DFG A;  4KJZ A;  1FC3 A;  1K61 A;  3EYI A;  1ZN2 A;  3V42 A;  3S2H J;  4IHT A;  2HZT A;  2KQR A;  3AKZ A;  3O2P E;  2L9V A;  4CZC A;  4AVZ A;  4EJW A;  2IGK A;  3HXL A;  1ZR4 A;  4B44 A;  3FXO A;  2P8T A;  2P7V B;  1IV8 A;  3SJM A;  4XNF A;  2IGO A;  2W24 A;  5LRS A;  1KQ8 A;  3MEX A;  1TWH J;  1U0J A;  3ERM A;  3V4G A;  4EJT A;  3H3V K;  4RAZ A;  1EA3 A;  1BA5 A;  3S17 J;  5C4X J;  3ZMU A;  3OYL A;  3CCS I;  2MC4 A;  4KIF A;  1A36 A;  3S2W A;  3I4N J;  3GLL A;  1HLV A;  3H92 A;  1XG1 A;  2D2W A;  2VI6 A;  4XLN F;  3J81 K;  3KZZ A;  1VQ4 I;  3JRA A;  2HS5 A;  3F8C A;  4RB0 A;  2KIS A;  2ZNY A;  1SAU A;  3DPT A;  2CMP A;  3MKZ A;  1ERD A;  3QYB A;  2LLK A;  2VBW A;  1G3T A;  2DBB A;  2DCE A;  2R7V A;  3DEW A;  2C6Y A;  2VAS A;  1IG7 A;  2FMY A;  3BP8 A;  3HRM A;  1GLN A;  2KIQ A;  4I01 A;  4J00 A;  2BGC A;  1U6G A;  2GBY A;  5K5R A;  5K5O A;  3WTW C;  3TDZ C;  1BBY A;  2MGQ A;  1QHH D;  3BQY A;  3KE2 A;  1U3E M;  2CG4 A;  3ELK A;  3TOA A;  1PUF B;  3B02 A;  2HU9 A;  3F6V A;  3T0Y A;  2DMN A;  1JJ8 C;  2M34 A;  4V19 K;  4Y4R A;  5J8C A;  1OCC H;  4HV5 A;  4Q47 A;  2V1D A;  1R5G A;  1S29 A;  2HOT A;  4XOP A;  5JR3 A;  3MKL A;  1W0U A;  1TQM A;  4M74 A;  3I4P A;  3IH2 A;  1A5J A;  4FHT A;  1WJ5 A;  4BGD A;  6PAX A;  1ZGA A;  1H8A C;  4BKX A;  3IWZ A;  4I7H A;  4LMY A;  2WBM A;  4HEA 2;  5E18 F;  1D5V A;  4I6Z A;  2FBH A;  2V4J C;  3QP6 A;  3JAM K;  1REP C;  1X1P A;  1MBG A;  2Y0M A;  3SQN A;  1TQI A;  1BOA A;  1T98 A;  3U21 A;  5HOD A;  4KDP A;  1X1B A;  4BDZ A;  1B4A A;  1ORK A;  2WY8 Q;  5F0F A;  2VJ5 A;  2L54 A;  1D0X A;  4HNV A;  5F1J A;  1CGP A;  4BL0 B;  4WXC A;  4B43 A;  1WFX A;  3OYG A;  3L2U A;  3VSL A;  3LSI A;  2VON A;  3ZQI A;  2A6E F;  2K4J A;  1GXQ A;  2CQX A;  3HOT A;  1R9T J;  2E71 A;  1KA8 A;  2UUZ A;  3P9C A;  4UHT A;  2LY2 A;  1GV5 A;  1V3F A;  3RKQ A;  5F6F A;  1WH7 A;  2MG4 A;  2R5Y A;  1HCR A;  2FJ1 A;  1IRX A;  5CVJ A;  3WTV C;  5L3B A;  2LG4 A;  1R00 A;  1YE9 A;  1S7E A;  2F5D A;  4ZYD A;  2YX7 A;  4IQJ A;  2VJJ A;  3T1B A;  1YTY A;  2NOG A;  5EGO A;  3DTK A;  4A3C J;  2X6X A;  4UVA A;  2KIF A;  2VPR A;  3K6G A;  1S7O A;  2IA2 A;  1ZG5 A;  1R4M B;  2IAI A;  4I2O A;  4A3M J;  4P1W A;  3KYL A;  2PLY A;  1XCB A;  5HLI A;  1JUP A;  3V8L A;  5DV5 A;  2VJ4 A;  1DP3 A;  3F72 A;  2EIN H;  3L2Q A;  3F0C A;  1RC9 A;  2CSO A;  2FNP A;  3FMQ A;  1FNN A;  1SMT A;  1U5T C;  2IVM A;  5CPR B;  3HOU J;  5FLX K;  3FXR A;  4XOT A;  3WTU C;  2FBK A;  1P2F A;  2GAU A;  3Q9V A;  2M30 A;  4GFB A;  2FOK A;  2HR3 A;  1Z91 A;  4XRS G;  1UB9 A;  2MYS A;  4PZJ A;  2XV4 S;  1W5S A;  2XGC A;  3AFH A;  3DTE A;  3GWZ A;  3FBI B;  1DUX C;  2RKH A;  4B3A A;  3FIS A;  2NRA C;  2BHY A;  3E6D A;  2HZD A;  3I3L A;  1FOW A;  4P9U A;  1IRZ A;  5J6X A;  5D5V B;  1K79 A;  1J5Y A;  3E97 A;  2L02 A;  3LL7 A;  2GIZ A;  1U9N A;  2WY7 Q;  2CW7 A;  2QBY A;  3CJQ B;  5EZG A;  4A0X A;  4DZP A;  4XMY A;  3QPT A;  5TGT A;  1QU3 A;  3W2W A;  1YFH A;  2DA6 A;  3SFI A;  3ABU A;  1Z9C A;  2FRH A;  3TDU C;  2IA1 A;  3I56 I;  2JA5 J;  3G2B A;  4RM2 A;  1J09 A;  1JT0 A;  1YLF A;  5JLW A;  4OOI A;  3CO6 C;  1XTA A;  3B6C A;  2IRF G;  2OCE A;  2QA4 I;  2R5Z B;  4GGG A;  2MLG A;  2QEX I;  1ZEL A;  2ZME A;  2KL4 A;  2HNH A;  3GZ6 A;  1ZH5 A;  3IV5 A;  3DXJ F;  4QPQ A;  1S72 I;  1IUF A;  4EVI A;  1YI2 I;  1B6A A;  4EM1 A;  2EIL H;  4F92 B;  3F9K A;  4JX5 A;  3HRT A;  3LAJ A;  4HRI A;  2IS1 A;  1QO0 D;  3PIO F;  5GAD J;  1OLT A;  3OIP A;  2LR8 A;  3K10 A;  3S14 J;  4WK8 F;  4C2M J;  3DQV C;  1MMG A;  3DPL C;  4MEX F;  3HC7 A;  1R6R A;  1TL8 A;  4EJO A;  4AIK A;  4W97 A;  1K78 B;  5C3E J;  3T8R A;  5GAG J;  1RPW A;  3ZQF A;  4U88 A;  5LHG A;  3V8K A;  4GDF A;  2N8G A;  3FX3 A;  4RLQ A;  3G1M A;  2VKD A;  3OYE A;  3AL0 B;  2HQN A;  2R7X A;  4DYQ A;  3FMR A;  3QP5 A;  1Z05 A;  1LE8 A;  4XN0 A;  4UUS B;  1ETV A;  2KZG A;  4DJA A;  5HVQ C;  2X1D A;  2G0E A;  1K4S A;  9ANT A;  4I76 A;  1YHQ I;  4NC8 A;  1OYY A;  2OU2 A;  4P55 A;  3K1N A;  4UV8 A;  2L01 A;  1IDY A;  2E2H J;  1W5C C;  2WAQ A;  2X4H A;  2AXL A;  2I8D A;  3WTY C;  4HF2 A;  1OFC X;  3M1C A;  2KP6 A;  1MDM B;  3HSF A;  4HOB A;  3KEY A;  4CCK A;  3Q3S A;  4XLP F;  1O4X A;  1SFE A;  2IS2 A;  2E19 A;  3DTI A;  1I1S A;  2VJI A;  4ENJ A;  3BCB A;  1B8I A;  5GAE J;  2RQQ A;  3OYN A;  4I98 B;  4PDK A;  2JJ7 A;  3E3V A;  3Q0V A;  3BR1 A;  4HZF A;  3GTQ J;  4BHC A;  5LGU A;  4IKF A;  1LJ9 A;  2V26 A;  1RRJ A;  5HDG A;  4HDU A;  2FU4 A;  1GUU A;  2PJR B;  2NOJ B;  1B1B A;  1OCP A;  2V6C A;  1R36 A;  1D8J A;  3HPH A;  4EGZ A;  2EV6 A;  2ZXW H;  2OTL I;  3LFU A;  2HDW A;  4XRM A;  3CF5 F;  2R7T A;  2K3P A;  2L9R A;  2HQ5 A;  3D5S C;  5HS8 A;  4AVP A;  1PP7 U;  3BC8 A;  1H88 C;  2FF4 A;  1PYV A;  3FZV A;  4EQQ A;  1HDD C;  1QVT A;  1P7J A;  3M7G A;  1B9M A;  3QYE A;  5GP9 A;  1ZGW A;  1IO2 A;  1SFK A;  4LFU A;  2LMD A;  1EKE A;  3CUQ B;  3A01 A;  5TIS C;  1QHG A;  2EZH A;  2KZV A;  4DBQ A;  2L0K A;  3DKX A;  4G7Z F;  4E7Z A;  1YOV B;  5K7Z A;  5IP6 A;  2VKV A;  4BQA A;  4BQN A;  2VE9 A;  4PGH A;  5FD6 A;  2BW3 B;  1E3H A;  2CFX A;  2COM A;  1OIS A;  4V2G A;  2LYC A;  3JSO A;  4HF0 A;  5J47 A;  5DS9 A;  1T08 B;  2IEK A;  1YW7 A;  4X1E A;  1ZRF A;  3CCQ I;  2M7B A;  3RKW A;  5IOZ A;  5K5Q A;  1SEU A;  3M3Y J;  1ZG1 A;  2M4K A;  3FHN A;  3K1P A;  3AG2 H;  3KPH A;  5IYB J;  2UZK A;  5ED4 A;  1KU7 A;  1WJF A;  2K9M A;  3HRU A;  2R7Q A;  2DOD A;  2WAD A;  3ZMS A;  5HDN A;  1N75 A;  3ABK H;  3BPV A;  1J0R A;  5KAI C;  3BJO A;  1XGN A;  4KFC A;  2M0C A;  4RGX A;  1UJ8 A;  2VKE A;  3P9K A;  2HXO A;  5KVR A;  4CA0 A;  4D9J A;  2ZXH A;  1RNL A;  3BTC A;  3JCU C;  5HS7 A;  1R23 A;  4G6D A;  3SZP A;  4MEY F;  5DYM A;  3PO3 J;  1O57 A;  4C3H J;  2HTJ A;  4ON0 A;  4JOM A;  5H6Q A;  4BEH A;  2BBY A;  1RI7 A;  2Q2E B;  2AO9 A;  4BJT A;  2CV1 A;  3CC4 I;  4FIS A;  3ZOB A;  1U8B A;  2E2J J;  3EET A;  1R71 A;  2VQG A;  4CHU A;  1W5T A;  1KZH A;  5B1B H;  1XN7 A;  2R4G A;  2KHM A;  3T5X A;  2JPC A;  4F93 B;  2OJE D;  3F6O A;  1MND A;  4ZZD A;  2P5K A;  2B9S A;  2O9L A;  1LKX A;  4GCV A;  2P4W A;  2CGP A;  3VPR A;  1H9G A;  2XAG A;  3VWB A;  1TBX A;  2QKL B;  1UFM A;  3LAP A;  4ZYE A;  1L3L A;  3SEQ A;  4R79 A;  2CQQ A;  1SFX A;  1U8R A;  4CGZ A;  2ZME C;  2Z16 A;  1LB2 A;  4A0Y A;  3D0S A;  1OYW A;  1VI0 A;  3QU3 A;  3HEF A;  1I50 J;  4Q4Z F;  1DDN A;  4IEJ A;  1M1E B;  1GT0 C;  2JPB A;  5AON A;  3TQN A;  1FBS A;  1JJ6 C;  2O03 A;  2RDP A;  5HLT A;  3OL3 A;  1HSJ A;  2DDB A;  1UHM A;  1Z0X A;  4Z6Y A;  3K4J A;  1P9Q C;  2ZBK A;  3BG6 A;  3GTG J;  5DCM B;  4D7N A;  4XM3 A;  3QPL A;  4PCQ A;  5E1W A;  2M45 A;  3PQJ A;  1Y8R B;  3GTO J;  2K5C A;  5FRM A;  3CTA A;  3K70 D;  1OYI A;  2LKX A;  1FTT A;  3D5R C;  3P9I A;  3E5Q A;  3FK6 A;  2AQF A;  3OYJ A;  2R7Z J;  4OMY A;  3MWM A;  4YFN F;  2DA3 A;  3FXM A;  5BMZ A;  4LG0 B;  4ENM A;  4H4K C;  2EA4 A;  2LKP A;  4PJJ A;  5L3D A;  5FJ8 J;  3JR9 A;  4ZZL A;  2AXT C;  4LLG F;  2X0L A;  4WWC A;  1ZLK A;  1HXD A;  3QWL A;  1WKM A;  2LTP A;  3PNY A;  3R0A A;  2RVC A;  2O5R A;  3K4M A;  2BEO A;  3LA7 A;  3WTT C;  2PQ8 A;  1JGG A;  1UZC A;  3GCM A;  4IHX A;  2DFF A;  1FJL A;  2ESH A;  3CF2 A;  4C3J J;  1WJC A;  5LBQ A;  1NTC A;  4KN4 X;  1GVD A;  3VYS B;  3WE3 A;  2DO7 A;  2GLO A;  2Z3Y A;  5LEK A;  2DT5 A;  3KP4 A;  2ECC A;  5FFX A;  3BTL A;  3DLA A;  3TW6 A;  1F9N A;  4ESB A;  5K7H A;  3HJE A;  5A2Q K;  1D8K A;  2WWY A;  4C30 A;  3C2H A;  1S7A A;  3I5U A;  4KIB A;  4E70 A;  1VQ6 I;  2FSW A;  3DKW A;  1ACI A;  4XOR A;  2R93 J;  3BTJ A;  2B0L A;  4LIU A;  1OKR A;  4Q5S F;  1XD7 A;  2L5Q A;  2QSG X;  1QA6 A;  2H09 A;  4NNJ A;  2A6H F;  5JHF A;  4MTE A;  3BZC A;  3FXU A;  5E3N A;  1W7P B;  3CDL A;  3OR1 C;  1IAW A;  4A3G J;  5BNG A;  3F3X A;  2Q8K A;  4NQW A;  2F2E A;  3OS0 A;  3JRH A;  3T8T A;  1ZRE A;  4XRF A;  1MMS A;  3ZGK A;  4E6K G;  2LK2 A;  2EFW A;  3DLL F;  4BE2 A;  2XSD C;  1IW7 F;  2F4I A;  3K4N A;  5HNH A;  4IHY A;  5KHD A;  3S1N J;  1OCO H;  4HYE A;  2DN0 A;  1ODD A;  4A69 C;  2GIV A;  1FP2 A;  4XKV A;  4A3J J;  2WA0 A;  3CUO A;  4XN3 A;  3X2Q H;  2FNA A;  2M9H A;  4LK0 F;  3MFK A;  3AAF A;  4ZYH A;  1WJB A;  1I39 A;  5E3M A;  3CCL I;  3DWL E;  3J7A Y;  4BAY A;  3F8N A;  2F4O B;  3B6A A;  2R92 J;  1JKP C;  2DTZ A;  1YS7 A;  5H6R A;  3SDB A;  2Y30 A;  2PG4 A;  3DBR B;  5FO5 A;  1Y0N A;  2DA5 A;  3CJR B;  2RNJ A;  4RMN A;  3E6M A;  4QSH A;  4AUX A;  1IGN A;  1TNS A;  2E1M B;  4RAY A;  4CCO A;  3KX2 A;  1E17 A;  3H9Q A;  3BCA A;  2K85 A;  3ZMV A;  3HIF A;  1P7I A;  3M1E A;  2KDZ A;  4YIR X;  2EK5 A;  4U0V A;  2Y48 A;  3H3Z A;  5CVR A;  4LB6 B;  3PUF A;  1HDP A;  3OYB A;  3ZQH A;  3A0H C;  4MGR A;  2UWM A;  3K70 C;  4OIR F;  2VXZ A;  2OD5 A;  4HLY A;  4QWQ A;  1BC7 C;  1BR1 A;  2JSP A;  2O3F A;  4JBA A;  2X51 A;  4M72 A;  1HOM A;  3WG7 H;  2DAO A;  3TKY A;  4HV6 A;  4XLH A;  1FX7 A;  4XQF A;  2LC2 A;  5M5X J;  4BDY A;  2M7A A;  2LKS A;  4YII A;  3ABM H;  2CWE A;  1TWG J;  5JI6 A;  1V4R A;  4KMU X;  3HDD A;  4MO7 A;  2WAE A;  2DYR H;  2VL8 A;  1G3S A;  1GDT A;  5FGM A;  4X0G A;  2ZXJ A;  3IKV A;  1IN5 A;  2VB6 A;  4CH7 A;  1EJ9 A;  4I02 A;  4P5O A;  4YRV A;  3SHF A;  1IXC A;  4CDG A;  2J5O A;  3G6E I;  2Z9O A;  1T33 A;  1PVE A;  1S9H A;  2RGV A;  1IN4 A;  2X6O A;  2VBZ A;  1STZ A;  3CZ6 A;  3I59 B;  5BPD A;  2BV6 A;  3U9G A;  2YX4 A;  3VFZ A;  4FTH A;  2HKO A;  1CF7 B;  3GVA A;  2W25 A;  4BHP A;  5HS9 A;  4AYB N;  4IHS A;  4BQQ A;  2K3F A;  4II2 A;  4H0E A;  1XX5 A;  1MD0 A;  3W6V A;  3NEU A;  4ZDP A;  2NYX A;  4ABZ A;  3O3K A;  1B72 A;  5M5W J;  3OS1 A;  1BL0 A;  2XSJ C;  2AS5 F;  3S1R J;  4LD5 A;  4F52 A;  2NS7 A;  2CO5 A;  2A69 F;  3HUG A;  2K4B A;  4GYI A;  5FRN A;  1XGM A;  5FKK A;  5J8F A;  3I54 A;  1VF9 A;  3MZY A;  2R5Z A;  4Y15 A;  2ZKZ A;  1SMY F;  5TRD A;  1TTY A;  2Z2S B;  5D8L B;  2NNN A;  2H8W A;  1NG6 A;  2XDV A;  3DBH B;  4IXA A;  3LSR A;  3HRS A;  1A35 A;  2Y31 A;  1YRN A;  1U9O A;  4NC7 A;  3TBI A;  3BOQ A;  3LSM A;  3BRO A;  4XKW A;  2GA2 A;  2XRL A;  4UVB A;  5E8I A;  4M3B A;  1LEA A;  2YSR A;  3REO A;  4V2F A;  1MBE A;  3WG9 A;  5D8K B;  2LRD A;  3CP2 A;  1OQY A;  3DBL B;  3KP5 A;  4O6J A;  4CYD A;  2ISY A;  4P96 A;  2FXA A;  1SVL A;  2NS0 A;  4LGW A;  4L0Z B;  3HOV J;  3CCY A;  4FX4 A;  3SZT A;  2ZJQ F;  3I64 A;  2DT6 A;  2O8K A;  4AYB A;  4XLE A;  2DJN A;  5ILV A;  2CJJ A;  1WZ2 A;  1ON2 A;  2V79 A;  2BY2 A;  1YIJ I;  3C18 A;  1WI3 A;  3EQL F;  1EH8 A;  2X1E A;  1UG2 A;  3OYA A;  2XRN A;  1FPQ A;  2JUC A;  2ZB9 A;  5ICC A;  3ZQG A;  5J4V A;  1APL C;  1VQL I;  3HOY J;  1MIJ A;  1RKT A;  1P4W A;  3FWE A;  3N05 A;  4Y13 A;  5E8G A;  2DYS H;  1Z1D A;  3RPQ A;  2XPW A;  2QSH X;  4UXN A;  2HQA A;  4FCY A;  3NWT A;  3ZCO A;  2IT0 A;  5GAH J;  1F4K A;  3CCE I;  3S16 J;  1Z6T A;  3M07 A;  1KYW A;  1VQ9 I;  4DQ2 A;  3H35 A;  4R8H A;  2ME6 A;  1MBH A;  3ZRG A;  1Z3X A;  2MBF A;  2LBF B;  1XMX A;  1OCZ H;  3RSN A;  3ABL H;  3FHZ A;  3L9F A;  1I5Z A;  2X9D A;  4CYC B;  1AU7 A;  2TCT A;  5J3L A;  1HKQ A;  1BI2 A;  4AWX B;  3IRR A;  1FMV A;  4HBL A;  4L18 B;  3L1P A;  2R7U A;  2ZXI A;  2B7E A;  1S5L C;  1J2X A;  2Y75 A;  3PUB A;  3HG9 A;  1SD7 A;  4ASN A;  4RS8 A;  4WCG A;  3RYP A;  3PM1 A;  1P4A A;  2H8R A;  3BR3 A;  3A0B C;  5GTI C;  2KRF A;  2GWR A;  3VOD A;  3JRD A;  2Q0O A;  1O3Q A;  3W6K B;  1ETW A;  5D4S A;  4IOA F;  2EIJ H;  3BR0 A;  2GOX B;  3HB9 A;  4EM0 B;  1KQ0 A;  2CUE A;  4RBO A;  1KYZ A;  1IRG A;  1BW5 A;  3GF2 A;  2DMU A;  3PFY A;  5GTH C;  5ERI A;  2JVH A;  2E1C A;  5F27 A;  2ZJP F;  4C2T A;  4XL9 A;  3OYH A;  1AKH A;  5TJJ A;  2BY3 A;  2FEZ A;  3ZXS A;  4GXO A;  5KCM A;  4BJ6 C;  4U7B A;  4ZTF A;  3KZI C;  1X3U A;  2LP0 A;  2Y9Y A;  3ZMD A;  4ANJ A;  4BS9 A;  4M73 A;  3H0G J;  3K2A A;  1U2W A;  3IRQ A;  2R7S A;  5FRO A;  1OR7 A;  2NNY A;  1EH7 A;  1S6L A;  2L9S A;  3KP2 A;  5J1R A;  1QVU A;  2DDA A;  1R58 A;  4WXH A;  4ZYA A;  2OZ6 A;  1MNM C;  3KLO A;  3U1D A;  2XC7 A;  4YFK F;  2NVQ J;  3F8F A;  5EEG A;  2FD5 A;  2RV8 A;  5H20 A;  1U5T B;  4JX4 A;  3NWS A;  4RDU A;  2HDC A;  3TL4 X;  2E1O A;  4EJV A;  2QQ8 A;  1E0E A;  2CQ7 A;  2QLZ A;  1MBF A;  2P81 A;  3BDD A;  3LSK A;  2LRE A;  3ZQC A;  4RM3 A;  2F4M B;  1HST A;  4CO8 A;  4G7H F;  2QSF X;  2ETH A;  4D7M A;  4II3 A;  4CCL A;  2H94 A;  4A3K J;  2DOE A;  2OC6 A;  1TT0 A;  4DBR A;  1QGP A;  2VBX A;  4G94 A;  2DOF A;  3W2V A;  3JRC A;  1F36 A;  3RQ4 A;  4Z2Y A;  3KIO A;  4QPO A;  4ZYG A;  1JTY A;  3JAM Z;  2QWW A;  5LEJ A;  3I58 A;  5FFZ A;  1JHH A;  3HOS A;  2P6T A;  5C4J J;  1Q1H A;  3IAM 2;  4G6Q A;  2IXS A;  4BH9 A;  3IH4 A;  3FF5 A;  3DCF A;  1QPM A;  1DGW Y;  4PK4 A;  3M8J A;  3IAS 2;  3O8H A;  5J40 A;  4BBR J;  4EM2 A;  5EG0 B;  3IC7 A;  1NK2 P;  4HLX A;  2DA7 A;  5K1Y A;  1ZQ3 P;  2Q2E A;  2V1U A;  2ZJ2 A;  2V9P A;  4QTR A;  2XAF A;  5E1Z B;  1D1C A;  4G9Y A;  3MZH A;  4UUV A;  3GFI A;  1LDD A;  4BXF A;  2ELK A;  2CQK A;  1R1U A;  3OY9 A;  1FYM A;  4HW0 A;  4XRS A;  2X85 A;  4I99 C;  1UCR A;  4A3L J;  2BYV E;  2ZFW A;  1D3Y A;  4DNC A;  4LIV A;  3MN2 A;  3TO9 A;  3IWF A;  2WAQ N;  2V7F A;  4MNU A;  3IHU A;  3V7S A;  1X3W B;  2L7F P;  1D1A A;  2IS4 A;  4L9J A;  2VOP A;  1IF1 A;  4XSX F;  2ZSI B;  4OIN F;  2XGD A;  5F64 A;  4E7H A;  1SVM A;  2W85 A;  4YIF A;  1XGS A;  2DFI A;  4KIT B;  4M9Z A;  1O3T A;  2D5V A;  3E6C C;  3RIR A;  4L5I A;  4RGU A;  5CVU A;  4XIC A;  3CES A;  4EJU A;  4I0B A;  3Q0U A;  4A12 A;  3L09 A;  3OMY A;  1FMW A;  1I3Q J;  2AHQ A;  4HX4 A;  5DEQ A;  4KMF A;  3K7A J;  5IY5 H;  5BS6 A;  5D5W B;  1RR7 A;  2DQL A;  2OBP A;  1OPC A;  4DGW B;  1X58 A;  3QOE A;  4U7D A;  2FBI A;  3QPS A;  2CRG A;  2OZU A;  3HSE A;  3MZ8 A;  5LGN A;  3WTS C;  5IT3 A;  3BR2 A;  3EDP A;  2XIG A;  3HZJ A;  3C3W A;  4DW6 A;  5DDG A;  3S32 A;  2KFD A;  1B59 A;  2CFO A;  2EB7 A;  3A03 A;  3GTL J;  2HXI A;  3ABT A;  3PSF A;  4XR6 A;  3GEZ A;  2XKP A;  4AU7 A;  1WCM J;  3NRV A;  1WGX A;  1UHW A;  1SD4 A;  2R0Q C;  3CDI A;  1FYL A;  3MKY B;  2UXN A;  3QYF A;  3ASN H;  2IGN A;  4XLA A;  4F7Z A;  1KGS A;  1Y6I A;  2FX0 A;  2JMW A;  3FBN B;  1PP8 F;  3HM5 A;  3UKG A;  4OIQ F;  1WWX A;  2OF7 A;  4YEJ A;  1QZY A;  2W57 A;  1V55 H;  1RUO A;  2R7W A;  4N4N B;  3FIW A;  4RB1 A;  1LVA A;  2L7Z A;  3SFZ A;  5DUI A;  4CZZ A;  2HOS A;  3HPG A;  2CW0 F;  2FQ4 A;  2K40 A;  3KET A;  1IUY A;  3FXK A;  2MD5 A;  4E7J A;  2XAJ A;  2YS9 A;  3BTI A;  3CMM A;  2OCC H;  2HPI A;  3ZMZ A;  3B73 A;  2VQC A;  4N4O B;  2P0W A;  4WXD A;  5FKN A;  3F8B A;  2R7F A;  1SFO J;  3HHG A;  2P6S A;  3CDH A;  4B3X A;  3KZY A;  4E7I A;  3BLY A;  3R4K A;  3F23 A;  2M1B A;  1FBU A;  2CUF A;  3ZP5 A;  5CKT A;  1JTX A;  1Q1V A;  3R6S A;  4S04 A;  3WTX C;  2XRO A;  1OCT C;  2R5Y B;  4ENK A;  1XS9 A;  2MSY A;  3TO6 A;  2VC0 A;  1ZKG A;  1FOY A;  2I10 A;  4BY7 J;  4D1Q A;  3CQZ J;  2ZCW A;  5E20 A;  2PI0 A;  1USS A;  2MFZ A;  2DA1 A;  2PMZ A;  3DP7 A;  4C2U A;  4AIJ A;  4KIS A;  4RA2 A;  2R7D A;  2OPT A;  2RAE A;  3Q5F A;  5EGO B;  3ECO A;  3DKY A;  1LNW A;  5KNL A;  2EPF A;  1TW2 A;  1E2X A;  1J9I A;  4A93 J;  4FX0 A;  5D6E A;  4EEF G;  5B3S H;  1JKQ C;  2DA2 A;  4L9N A;  5KAF C;  2VQH A;  3FXL A;  2QCO A;  1ETY A;  2XAQ A;  3H9G A;  1OR7 C;  1ETO A;  3RZD J;  5D6F A;  5J1U A;  3ISP A;  2M3A A;  4MLO A;  4ZDL A;  5B1A H;  3CMY A;  1JUM A;  4M3E A;  3BG3 A;  3GTJ J;  2LD5 A;  3KP3 A;  1T8I A;  1TNT A;  1K6O A;  5DM6 F;  2R7O A;  3J7Z I;  4YEL A;  5IYC J;  3RKY A;  2ESN A;  2HOE A;  2JRT A;  3CD6 I;  1YX5 A;  2VQL A;  4BNC A;  5F08 A;  1ONV A;  5EEA A;  1I6H J;  1VQN I;  2ISZ A;  2ZFU A;  2GQQ A;  1VQM I;  4A3I J;  3QPH A;  2V1X A;  4XSZ F;  3HKZ A;  2CUJ A;  1HW5 A;  2STT A;  1DPR A;  2TDX A;  2HYF A;  4CSW A;  1HC8 A;  2OTJ I;  3QAH A;  1LPQ A;  2BVM A;  2EFP A;  4PJN A;  1MMN A;  1HBX G;  1DU0 A;  3SYT A;  2VOD A;  3GX4 X;  5BPI A;  1E3P A;  4CCM A;  2BOL A;  1UAA A;  5DCF A;  2JWT A;  5E79 C;  2A5W A;  3BY6 A;  2QBY B;  4A0Z A;  1V5E A;  2E7W A;  2W48 A;  4XLF A;  1BR4 A;  1J59 A;  2QF7 A;  4BHB A;  3GME A;  2VBY A;  4FQG A;  2XAH A;  3KEQ A;  1KON A;  1JI8 A;  4N9H A;  4L5J A;  4UV9 A;  4J19 A;  5FLM J;  1T2K A;  1T95 A;  1S8N A;  1BI1 A;  2QVO A;  4XLC A;  1X1A A;  5CVI A;  3L00 A;  4D5F A;  1ITY A;  2STW A;  1G6N A;  4NBQ A;  3OOU A;  2ZME B;  2A68 F;  3GZN B;  3R0J A;  5IP9 J;  1T6S A;  4GO1 A;  1A31 A;  1VZ0 A;  1PUE E;  2VE8 A;  3OL4 A;  3WU2 C;  1WSU A;  4NB5 A;  1HF0 A;  2IW5 A;  1FTZ A;  3FMS A;  3BQZ A;  2KRC A;  3PJR A;  2M2E A;  4LG3 A;  1MBJ A;  4AC0 A;  3WOD F;  2EFO A;  1AHD P;  2DMQ A;  4NUB A;  2OQR A;  2BY0 A;  2BXY A;  3UR3 C;  1J75 A;  4JK1 X;  2CV0 A;  5C44 J;  1JGS A;  3P5J A;  4IRI A;  4KT5 C;  2E7X A;  2W82 A;  3WGG A;  1VND A;  4IO9 F;  2W00 A;  4M6X A;  1PUF A;  1TC3 C;  1IXR C;  1W4M A;  2YUS A;  3NAR A;  4EAT A;  1MJB A;  1LE8 B;  1GXP A;  3J7A O;  2ME0 A;  1AWC A;  1XSD A;  4NHJ A;  3EPZ A;  2ZO4 A;  3FXJ A;  1ZTR A;  2FUG 2;  2JN6 A;  2WV0 A;  2Y69 H;  3J80 Z;  1YJN I;  1O7L A;  2G9W A;  3FKI J;  2XF5 A;  3EYY A;  2W1O A;  3OSF A;  3RQI A;  1ZAO A;  3S3N A;  3QOP A;  4PSW A;  2GOM A;  3HYI A;  1R5H A;  5DD4 A;  5IOY A;  2V9V A;  3JSP A;  1KU9 A;  3JTH A;  2XPU A;  5IYD J;  1OMI A;  3CJN A;  1T0F A;  1FIP A;  1KQ9 A;  4KT6 A;  1UG0 A;  2E34 A;  1H0M A;  3F8M A;  3BG7 A;  2ELJ A;  2Q1Z B;  4CXF A;  1B8I B;  1VFC A;  5F0C A;  3I53 A;  5F0H A;  1L0O C;  4LJZ F;  3G1O A;  5ICF A;  1R1T A;  3ECH A;  3OYF A;  2QM3 A;  2LVS A;  4A5M A;  2A5Y B;  3J7Y J;  5DTD A;  3D1N I;  1RIO H;  1Y56 A;  4A3D J;  4RB3 C;  4K2E A;  1G3W A;  2MD0 A;  4CUG A;  3K4B A;  1FLI A;  1K83 J;  1N25 A;  2YPR A;  2EFQ A;  3E7L A;  4FE4 A;  1TZL A;  1JXS A;  4EV0 A;  4W1U A;  3VYU B;  2KKO A;  1TWC J;  3TMO A;  3JRB A;  1ZRD A;  2Z99 A;  1Y1V J;  4FE7 A;  4A3B J;  1N77 A;  3OIQ A;  4M3F A;  4P9F A;  3OYD A;  4ESJ A;  3HBL A;  4F91 B;  4O3M A;  2E5Z A;  3A01 B;  2KIM A;  2H1K A;  3GTM J;  3OYI A;  1G59 A;  3DU6 A;  2Z5U A;  2NVX J;  4IL6 C;  3TO7 A;  3ESW B;  1ULY A;  5EJC A;  3HGY A;  1FEX A;  3OYM A;  1V5F A;  3CJT B;  2KRH A;  4J01 A;  1MSF C;  2NVY J;  2PBI A;  4S0H B;  4AD9 A;  2V1N A;  2IBD A;  4D5C A;  2Z33 A;  4FT8 A;  4L0Y B;  4O5V A;  1QQI A;  4ZH4 F;  2E5N A;  4U0W A;  1T38 A;  4PJL A;  3S93 A;  3LOC A;  5IT9 Z;  3VB2 A;  1DP7 P;  1XC5 A;  3CC2 I;  4BXU A;  2CU7 A;  2DMT A;  2ID3 A;  1DU6 A;  3OWT A;  1Z77 A;  1I3A A;  1MKM A;  3IKT A;  4S05 A;  2DLL A;  3CO7 C;  1XSV A;  1W36 D;  4IHV A;  4KN7 X;  2DK5 A;  3GBG A;  1SD5 A;  2LFB A;  3LSH A;  3Q9S A;  2A3S A;  1U5T A;  5EEH A;  2R7R A;  1YW9 A;  1FT9 A;  2DOA A;  5AIP A;  2K9L A;  1KU2 A;  3ONQ A;  3K4L A;  3S2D J;  1R49 A;  2H1L A;  3I55 I;  3FM5 A;  1R4N B;  2W4S A;  4XK4 A;  4BEH B;  2JA7 J;  2MW8 A;  2E36 A;  1QZZ A;  3NQO A;  4QIW N;  2QGU A;  4B1R A;  2RN7 A;  3BPX A;  1WJE A;  2KDO A;  1E3O C;  2L4M A;  5J1Y A;  1OJL A;  5E3O A;  2E60 A;  2H6C A;  3ROU A;  3I71 A;  5LHH A;  3KP6 A;  4A3F J;  4DIQ A;  3S3O A;  1XMK A;  1BI3 A;  2OV7 A;  4E4H A;  2PMH A;  2K7L A;  1YO5 C;  3CCJ I;  3GO5 A;  4IRG A;  4PJ0 C;  4A3E J;  1ZLJ A;  2Y2Z A;  3LQR A;  1VQ8 I;  2PX9 A;  3PFI A;  1BW6 A;  2VLA A;  5JVG F;  3VEP A;  3GTK J;  3DF8 A;  3I0T A;  2GXB A;  1IXS B;  2DI3 A;  2M0M A;  1AOY A;  2DQR A;  2HVS A;  1X3Z B;  3I4M J;  3ZN0 A;  4LLL A;  2FML A;  5B5E C;  4FAS D;  3H5N A;  2BY1 A;  2EIK H;  1BC8 C;  4PJM A;  1V5G A;  1Y39 A;  1XMA A;  2XPV A;  5F04 A;  3F21 A;  4DYC A;  1F5T A;  4HNT A;  3E5X A;  1SD6 A;  4MFD A;  5FKO A;  1LFP A;  1R1V A;  3RDI A;  4Q48 A;  1K78 A;  2P5L C;  1H89 C;  4I0A A;  2JTV A;  1IDZ A;  2HOA A;  2O61 A;  2VPL A;  1FYK A;  1WQ2 A;  4MIM A;  5ILU A;  1SC7 A;  4BJ5 C;  4M6V A;  5IPA A;  2DT7 B;  4BE0 A;  2FA5 A;  2F6C A;  4BBS J;  3JRF A;  4IVN A;  1MJA A;  4L5E A;  5EZH A;  2QQB A;  5KK1 A;  3BR5 A;  4PFP A;  4UUS A;  3EUH A;  2GM4 A;  2QZ8 A;  3DU5 A;  3M4O J;  2OQG A;  3O8G A;  2LSO A;  4RLF A;  3W6J B;  2XF7 A;  3V7C A;  1W1W E;  1FWZ A;  1G2H A;  3GFM A;  3ZQ7 A;  2K9N A;  1X1C A;  2K86 A;  3PQK A;  2GXA A;  1T0F C;  1SAN A;  1JKO C;  1ZGJ A;  4OWR B;  4NC6 A;  1Y0U A;  2VN2 A;  1MDM A;  2K9Q A;  1G3Y A;  2EBI A;  1W36 C;  2RQP A;  2F5V A;  1JHF A;  4R1H A;  1Z67 A;  1T39 A;  2COB A;  5LD2 C;  4GYG A;  4ITV A;  1BI0 A;  3H36 A;  1F43 A;  1BJA A;  1I27 A;  3E0J B;  4UUT A;  2FQ3 A;  4IQ4 A;  3VOE A;  4HX7 A;  3FKJ A;  4M6Y A;  5LGT A;  2CUZ A;  2PJR A;  1RR8 C;  4LB5 A;  3HTS B;  4HPQ A;  2NS8 A;  1K6Y A;  1P92 A;  4ESF A;  4RB2 C;  3WE2 A;  2I5U A;  1C0W A;  1ZAR A;  1LEB A;  2HGC A;  2Y0S N;  2OAZ A;  3JRE A;  3CC7 I;  3HTU A;  4NQW B;  3IH3 A;  5IP7 J;  3OYC A;  1QNT A;  1U78 A;  3J81 Z;  1QBJ A;  3WGI A;  2A6T A;  2G7H A;  2X6W A;  1PJR A;  2DMP A;  4KYW A;  2XVC A;  2CYY A;  2WB1 N;  2HEO A;  3CLO A;  5FB2 A;  4PSX A;  2VIX A;  2OA4 A;  2AQE A;  3OOP A;  3CUQ A;  2CS3 A;  2JRM A;  3TP0 A;  4I09 A;  1DQU A;  1GVJ A;  2LH9 A;  1ENH A;  1B9N A;  2IP2 A;  3W2A A;  5FLV A;  3IP4 B;  1ETQ A;  4HF1 A;  2ID6 A;  1SVO A;  3MKW B;  4B4C A;  3C1D A;  4XKB A;  4IRH A;  1Y1W J;  3GTP J;  2BW3 A;  1R5I D;  2M8G X;  1ZG3 A;  4CCN A;  1AA7 A;  3LNQ A;  1G4D A;  4E7L A;  2E2I J;  2XKO A;  3BJ6 A;  3A4C A;  1UHS A;  2BE5 F;  2LY1 A;  1F1Z A;  3S3M A;  2IJL A;  4RAF A;  3DEE A;  3RZO J;  1WHU A;  2DK8 A;  4G6T B;  5E17 F;  2UXX A;  2W84 A;  3EUA A;  4M3G A;  1EF4 A;  3FM3 A;  1QPI A;  3GYH X;  2L7M P;  3JTG A;  4B09 A;  5L3G A;  1ZK8 A;  3KYC B;  3M9A A;  3BG5 A;  2HVQ A;  4HNU A;  4QLC U;  1IV6 A;  1T56 A;  1X2N A;  2ELH A;  3D5L A;  3KYD B;  1FY7 A;  3QU6 A;  2VT3 A;  1MMD A;  4DYR A;  2TRT A;  2Y0S A;  4UVC A;  3TOB A;  1LUJ B;  4A6E A;  3GZ5 A;  2WC2 A;  1P6R A;  2NVT J;  1IN6 A;  3LSJ A;  1VQO I;  4GRI A;  1O7F A;  3O6B B;  2A07 F;  3IL2 A;  3GW2 A;  5HLH A;  2WB1 A;  5K7F A;  2Y9Z A;  1SFU A;  1IN7 A;  3LST A;  3ZN1 A;  3AG1 H; 
#chains in the Genus database with same CATH homology
 3M8F A;  3BWG A;  2H27 A;  3GUD A;  4M71 A;  2DU9 A;  2O8X A;  5ICG A;  5LLQ A;  3V7R A;  3GLX A;  1JE8 A;  5CVV A;  4OIP F;  3BZ6 A;  2D1V A;  1FP1 D;  3E5U A;  3N97 A;  5CYV A;  3WGH A;  2ADU A;  2LDU A;  3ULQ B;  3WU0 A;  4HX8 A;  1YG2 A;  5ILS A;  1MGT A;  4LK1 F;  2KJC A;  1J7K A;  3LFK A;  5DD8 A;  2PEX A;  2HKX A;  4UNO A;  2QQ9 A;  5DCM A;  4MHG A;  2FE3 A;  3MCZ A;  1O3R A;  3KP7 A;  5LHI A;  4KIC A;  4M9X A;  5FLX Z;  5L3F A;  2GZW A;  4KNY A;  3K2Z A;  3C7J A;  2F5F A;  3KFW X;  3K69 A;  4HA8 A;  2L4A A;  2E1N A;  4LG0 A;  3L7W A;  4IPA A;  3WTZ A;  2HYG D;  3K9T A;  1HKS A;  3RKX A;  2DPD A;  2RC4 A;  1RUN A;  3HHH A;  3OV8 A;  2EV0 A;  1HW1 A;  2D45 A;  2O6G E;  1TQP A;  2F5C A;  4AIH A;  3GXO A;  3F22 A;  1MJ9 A;  5JVT A;  4HAM A;  1K7A A;  2K02 A;  1BIB A;  5D4R A;  5FD5 A;  1IN8 A;  2A61 A;  5DUK A;  1WRJ A;  2QUF A;  1YQA A;  4BYY A;  1Z7U A;  1W7P A;  2XAS A;  1HKT A;  2XHK A;  2DW4 A;  2MH9 A;  1I6X A;  4PGG A;  3N4M A;  2YU3 A;  4U0Y A;  3CUQ C;  3COA C;  2LF8 A;  5ICE A;  5HDK A;  2EJR A;  1XGO A;  1ZRC A;  4M9S A;  1MZB A;  4CIC A;  2PMU A;  4B8X A;  2M87 A;  3RYR A;  1LDK B;  1R7J A;  4MQV A;  1FSH A;  2QQA A;  2LF7 A;  5JHU A;  2DPU A;  2EA2 A;  1HQC A;  2LNB A;  1YW8 A;  4MQ9 F;  5CJ9 A;  2MLK A;  2MA3 A;  2HFH A;  1S3J A;  1XDU A;  1RZ4 A;  4OIO F;  2L3D A;  3J80 K;  2XGX A;  1GHC A;  2P5V A;  1NHA A;  4EGY A;  2G7U A;  1I1G A;  2EV5 A;  1SAX A;  4A6D A;  1W7P D;  2GXG A;  3G3Z A;  2PN6 A;  4IF4 A;  3TGN A;  3V8J A;  2GA1 A;  2ZNZ A;  1H9T A;  1WI9 A;  2P7C B;  1EH6 A;  4A5N A;  4KUM A;  3I59 A;  3LA3 A;  5HLG A;  3R60 A;  4MTD A;  1CF7 A;  3ML6 A;  4RGR A;  4KA4 A;  1A04 A;  4XBF A;  2MC3 A;  5AIQ A;  4D0P A;  1TLH B;  3RI4 A;  2H6B A;  3L2C A;  3H3U A;  1Z6R A;  3U2R A;  4WX9 A;  3R61 A;  4L9T A;  5F1R A;  1IRF A;  5L3C A;  2YR2 A;  2MH2 A;  4IJA A;  1FBQ A;  4WF2 A;  2J5P A;  2K27 A;  5CLS A;  1FZP B;  3KLN A;  4YG2 F;  3P7N A;  1R22 A;  4LLN A;  1BM9 A;  3DV8 A;  3K1M A;  2M5W A;  2HWV A;  2O0Y A;  1ZYR F;  4YFX F;  2M8E A;  1XCV A;  2JT1 A;  3MAJ A;  3M8E A;  2HQR A;  3MQ0 A;  1LQ1 A;  4HQM A;  1O3S A;  5IT9 K;  2NAZ A;  2HTS A;  1ON1 A;  4RGS A;  3RJP A;  2EFN A;  1FSE A;  4Y17 A;  2XUB A;  2VOO A;  1XSX A;  1YYV A;  2IA0 A;  3KCC A;  5LRR A;  1EV7 A;  4OMZ A;  3FXQ A;  4ENN A;  1YIO A;  2JZY A;  2VT2 A;  2WTE A;  2QYO A;  4JQF A;  3ZPL A;  3LWF A;  3LA2 A;  2EWN A;  2D1H A;  2ACJ A;  1P4X A;  3JW4 A;  2R3S A;  1BN5 A;  3RPU A;  3KEO A;  4A2U A;  4L9V A;  1VTN C;  2JSC A;  5JFR A;  3ERE D;  4ETS A;  1UST A;  2PFB A;  3RTR A;  3BJA A;  3DEU A;  3E6B A;  3WU1 B;  3LQQ A;  5D5U B;  1TW3 A;  1FOK A;  1YS6 A;  5HOO A;  5D5X B;  4HQE A;  3GFJ A;  1BIA A;  1IZ1 A;  2KIU A;  1LDJ A;  4N0B A;  3G73 A;  4G7O F;  2PJP A;  2IPQ X;  5L3E A;  2KJB A;  5E1X A;  5BOX A;  4KIG A;  3SXY A;  2VC1 A;  1DPU A;  3ZMT A;  5BQT A;  2QEN A;  4TV7 A;  3QRF F;  1XDS A;  4EMS A;  4OU0 A;  3K0L A;  1HW2 A;  4G8X A;  4N9I A;  1PDN C;  2F5E A;  1ZHF A;  2DTR A;  1XB4 A;  5A2Q Z;  1KU3 A;  3HSR A;  4HDV A;  3GFL A;  3DFG A;  1FC3 A;  3EYI A;  1ZN2 A;  4IHT A;  2HZT A;  3O2P E;  4EJW A;  2P8T A;  2P7V B;  2W24 A;  5LRS A;  1KQ8 A;  3MEX A;  3V4G A;  4EJT A;  4RAZ A;  3ZMU A;  4KIF A;  3S2W A;  3H92 A;  2D2W A;  4XLN F;  3J81 K;  3KZZ A;  2HS5 A;  3F8C A;  4RB0 A;  2ZNY A;  3DPT A;  2VBW A;  1G3T A;  2DBB A;  2C6Y A;  2FMY A;  3BP8 A;  3HRM A;  4I01 A;  2BGC A;  1U6G A;  3WTW C;  5K5R A;  5K5O A;  3TDZ C;  1BBY A;  3KE2 A;  1U3E M;  2CG4 A;  3ELK A;  3TOA A;  3B02 A;  3F6V A;  3T0Y A;  5J8C A;  4HV5 A;  4Q47 A;  2V1D A;  1R5G A;  1S29 A;  5JR3 A;  1TQM A;  4M74 A;  3I4P A;  4FHT A;  6PAX A;  1ZGA A;  3IWZ A;  4I7H A;  4LMY A;  5E18 F;  1D5V A;  2FBH A;  3QP6 A;  3JAM K;  1REP C;  2Y0M A;  3SQN A;  1TQI A;  1BOA A;  1T98 A;  4KDP A;  1B4A A;  2L54 A;  1CGP A;  4WXC A;  2VON A;  2A6E F;  2K4J A;  1GXQ A;  3HOT A;  1KA8 A;  3P9C A;  4UHT A;  1V3F A;  5F6F A;  5CVJ A;  3WTV C;  5L3B A;  1R00 A;  2F5D A;  4ZYD A;  2YX7 A;  3T1B A;  1YTY A;  4UVA A;  2KIF A;  1S7O A;  2IA2 A;  1ZG5 A;  4I2O A;  2PLY A;  1XCB A;  5HLI A;  3V8L A;  5DV5 A;  3F72 A;  2CSO A;  2FNP A;  3FMQ A;  1FNN A;  1SMT A;  1U5T C;  2IVM A;  5FLX K;  3FXR A;  3WTU C;  2FBK A;  1P2F A;  2GAU A;  3Q9V A;  2M30 A;  2FOK A;  2HR3 A;  1Z91 A;  1UB9 A;  4PZJ A;  2XV4 S;  1W5S A;  3GWZ A;  1DUX C;  2RKH A;  2NRA C;  3E6D A;  4P9U A;  5J6X A;  5D5V B;  1K79 A;  1J5Y A;  3E97 A;  2L02 A;  2QBY A;  4A0X A;  3QPT A;  1YFH A;  3ABU A;  1Z9C A;  2FRH A;  3TDU C;  2IA1 A;  1YLF A;  4OOI A;  3CO6 C;  2IRF G;  4GGG A;  2MLG A;  2ZME A;  3GZ6 A;  1ZH5 A;  3DXJ F;  4EVI A;  1B6A A;  4EM1 A;  3HRT A;  3LAJ A;  1QO0 D;  4WK8 F;  4MEX F;  3DQV C;  3DPL C;  4EJO A;  4AIK A;  1K78 B;  3T8R A;  4U88 A;  5LHG A;  3V8K A;  3FX3 A;  2HQN A;  3FMR A;  3QP5 A;  1Z05 A;  5HVQ C;  1OYY A;  2OU2 A;  4P55 A;  3K1N A;  4UV8 A;  2L01 A;  2X4H A;  2AXL A;  3WTY C;  4HF2 A;  1MDM B;  3HSF A;  4HOB A;  4XLP F;  1SFE A;  1I1S A;  4ENJ A;  4I98 B;  4PDK A;  3E3V A;  4HZF A;  4BHC A;  5LGU A;  1LJ9 A;  5HDG A;  4HDU A;  2FU4 A;  1B1B A;  2V6C A;  1R36 A;  1D8J A;  4EGZ A;  2EV6 A;  5HS8 A;  4AVP A;  1PP7 U;  2FF4 A;  3FZV A;  4EQQ A;  3M7G A;  1B9M A;  4LFU A;  3CUQ B;  4G7Z F;  4BQA A;  2VE9 A;  4PGH A;  5FD6 A;  2CFX A;  2COM A;  3JSO A;  4HF0 A;  1ZRF A;  1YW7 A;  3RKW A;  5K5Q A;  1ZG1 A;  3K1P A;  2UZK A;  5ED4 A;  1KU7 A;  3HRU A;  3ZMS A;  5HDN A;  3BPV A;  1J0R A;  3BJO A;  1XGN A;  4KFC A;  4RGX A;  3P9K A;  5KVR A;  1RNL A;  5HS7 A;  1R23 A;  4G6D A;  3SZP A;  4MEY F;  5DYM A;  1O57 A;  2HTJ A;  4ON0 A;  5H6Q A;  2BBY A;  1RI7 A;  3EET A;  4CHU A;  1W5T A;  1XN7 A;  3T5X A;  2JPC A;  3F6O A;  4ZZD A;  2P5K A;  4GCV A;  2P4W A;  2CGP A;  1H9G A;  2XAG A;  1TBX A;  3LAP A;  1UFM A;  4ZYE A;  1L3L A;  4R79 A;  1SFX A;  1U8R A;  4CGZ A;  1LB2 A;  4A0Y A;  3D0S A;  1OYW A;  3QU3 A;  4Q4Z F;  1DDN A;  2JPB A;  5AON A;  3TQN A;  1FBS A;  2O03 A;  2RDP A;  1HSJ A;  1UHM A;  2ZBK A;  5DCM B;  4PCQ A;  5E1W A;  2M45 A;  3PQJ A;  3CTA A;  1OYI A;  3P9I A;  3E5Q A;  4OMY A;  3MWM A;  4YFN F;  5BMZ A;  4LG0 B;  4ENM A;  2EA4 A;  2LKP A;  5L3D A;  4ZZL A;  4WWC A;  4LLG F;  2X0L A;  1ZLK A;  1HXD A;  1WKM A;  3R0A A;  2RVC A;  2BEO A;  3LA7 A;  3WTT C;  2PQ8 A;  2ESH A;  5LBQ A;  4KN4 X;  3WE3 A;  2DO7 A;  2Z3Y A;  5LEK A;  2DT5 A;  3KP4 A;  5FFX A;  1F9N A;  4ESB A;  2WWY A;  5A2Q K;  1D8K A;  1S7A A;  3I5U A;  4KIB A;  4E70 A;  2FSW A;  3DKW A;  2B0L A;  4Q5S F;  1OKR A;  1XD7 A;  2H09 A;  2A6H F;  4MTE A;  3FXU A;  1W7P B;  1IAW A;  3F3X A;  2Q8K A;  4NQW A;  2F2E A;  1ZRE A;  3T8T A;  4XRF A;  2EFW A;  1IW7 F;  4HYE A;  1ODD A;  2GIV A;  1FP2 A;  3CUO A;  2FNA A;  4LK0 F;  3MFK A;  3AAF A;  4ZYH A;  4BAY A;  3F8N A;  1YS7 A;  5H6R A;  2PG4 A;  5FO5 A;  2RNJ A;  3E6M A;  1TNS A;  4RAY A;  1E17 A;  3ZMV A;  3HIF A;  3M1E A;  2EK5 A;  4U0V A;  2Y48 A;  3H3Z A;  5CVR A;  4LB6 B;  4MGR A;  2UWM A;  4OIR F;  2VXZ A;  2OD5 A;  4HLY A;  4QWQ A;  1BC7 C;  2O3F A;  4JBA A;  4M72 A;  2DAO A;  3TKY A;  4HV6 A;  1FX7 A;  4YII A;  2CWE A;  5JI6 A;  1V4R A;  4KMU X;  1G3S A;  5FGM A;  2ZXJ A;  3IKV A;  1IN5 A;  4I02 A;  4P5O A;  3SHF A;  1IXC A;  4CDG A;  2J5O A;  2Z9O A;  2RGV A;  1IN4 A;  2VBZ A;  1STZ A;  3I59 B;  5BPD A;  2BV6 A;  3U9G A;  2YX4 A;  3VFZ A;  1CF7 B;  2HKO A;  3GVA A;  2W25 A;  4BHP A;  5HS9 A;  4IHS A;  4H0E A;  1MD0 A;  3NEU A;  2NYX A;  3O3K A;  2AS5 F;  4LD5 A;  2CO5 A;  2A69 F;  3HUG A;  2K4B A;  4GYI A;  1XGM A;  5J8F A;  3I54 A;  3MZY A;  4Y15 A;  2ZKZ A;  1SMY F;  5TRD A;  1TTY A;  5D8L B;  2NNN A;  4IXA A;  3HRS A;  3BOQ A;  3BRO A;  2GA2 A;  4UVB A;  5E8I A;  1LEA A;  2YSR A;  3REO A;  3WG9 A;  5D8K B;  3KP5 A;  4O6J A;  4CYD A;  2ISY A;  4P96 A;  2FXA A;  2NS0 A;  4LGW A;  4L0Z B;  4FX4 A;  3SZT A;  3I64 A;  5ILV A;  1ON2 A;  2V79 A;  3C18 A;  3EQL F;  1EH8 A;  2XRN A;  1FPQ A;  5ICC A;  1P4W A;  3FWE A;  4Y13 A;  5E8G A;  1Z1D A;  3RPQ A;  4UXN A;  2IT0 A;  1F4K A;  1Z6T A;  1KYW A;  4DQ2 A;  4R8H A;  2MBF A;  3FHZ A;  3L9F A;  1I5Z A;  1HKQ A;  1BI2 A;  4AWX B;  3IRR A;  4HBL A;  4L18 B;  1J2X A;  2Y75 A;  1SD7 A;  4ASN A;  4RS8 A;  4WCG A;  3RYP A;  1P4A A;  2KRF A;  2GWR A;  3VOD A;  2Q0O A;  1O3Q A;  3W6K B;  5D4S A;  4EM0 B;  1KQ0 A;  1KYZ A;  1IRG A;  3GF2 A;  5ERI A;  2E1C A;  5TJJ A;  2FEZ A;  4GXO A;  4U7B A;  1X3U A;  3ZMD A;  4M73 A;  1U2W A;  3IRQ A;  1OR7 A;  2NNY A;  1EH7 A;  1S6L A;  3KP2 A;  1R58 A;  4WXH A;  2OZ6 A;  3KLO A;  3U1D A;  4YFK F;  3F8F A;  5EEG A;  2RV8 A;  5H20 A;  1U5T B;  2HDC A;  4EJV A;  2QLZ A;  3BDD A;  1HST A;  4CO8 A;  4G7H F;  2ETH A;  2H94 A;  1QGP A;  2VBX A;  4G94 A;  4Z2Y A;  4ZYG A;  3JAM Z;  2QWW A;  5LEJ A;  3I58 A;  5FFZ A;  1JHH A;  3HOS A;  2P6T A;  1Q1H A;  4G6Q A;  4BH9 A;  3FF5 A;  1QPM A;  4EM2 A;  3IC7 A;  4HLX A;  5K1Y A;  2Q2E A;  2V1U A;  2ZJ2 A;  2XAF A;  5E1Z B;  4G9Y A;  3MZH A;  4UUV A;  3GFI A;  1LDD A;  2CQK A;  1R1U A;  1FYM A;  4HW0 A;  1UCR A;  2BYV E;  2ZFW A;  1D3Y A;  4DNC A;  3TO9 A;  3IWF A;  3V7S A;  4MNU A;  3IHU A;  4L9J A;  2VOP A;  1IF1 A;  4XSX F;  4OIN F;  5F64 A;  2W85 A;  4YIF A;  1XGS A;  2DFI A;  4M9Z A;  1O3T A;  3E6C C;  3RIR A;  4L5I A;  4RGU A;  5CVU A;  4EJU A;  4I0B A;  4A12 A;  3L09 A;  4HX4 A;  5DEQ A;  4KMF A;  5BS6 A;  5D5W B;  2OBP A;  2DQL A;  1OPC A;  4U7D A;  2FBI A;  2OZU A;  3HSE A;  5LGN A;  3WTS C;  5IT3 A;  3EDP A;  2XIG A;  3C3W A;  5DDG A;  1B59 A;  2EB7 A;  3ABT A;  3GEZ A;  2XKP A;  3NRV A;  1UHW A;  1SD4 A;  1FYL A;  2UXN A;  4F7Z A;  1KGS A;  1PP8 F;  4OIQ F;  1WWX A;  1QZY A;  2W57 A;  1RUO A;  4RB1 A;  1LVA A;  3SFZ A;  5DUI A;  4CZZ A;  2CW0 F;  3KET A;  1IUY A;  2MD5 A;  2XAJ A;  3ZMZ A;  3B73 A;  4WXD A;  3F8B A;  2R7F A;  3HHG A;  2P6S A;  3CDH A;  3KZY A;  3R4K A;  3F23 A;  2M1B A;  1FBU A;  3ZP5 A;  3WTX C;  2XRO A;  3R6S A;  4S04 A;  4ENK A;  3TO6 A;  2VC0 A;  2ZCW A;  5E20 A;  2PI0 A;  1USS A;  3DP7 A;  4AIJ A;  2R7D A;  3Q5F A;  3ECO A;  1LNW A;  1E2X A;  1TW2 A;  1J9I A;  4FX0 A;  5D6E A;  4L9N A;  2XAQ A;  5D6F A;  3ISP A;  3KP3 A;  1TNT A;  1K6O A;  3RKY A;  2ESN A;  2HOE A;  2JRT A;  4BNC A;  1ONV A;  2ISZ A;  2GQQ A;  3QPH A;  2V1X A;  4XSZ F;  1HW5 A;  2STT A;  1DPR A;  2TDX A;  2HYF A;  3QAH A;  2EFP A;  1HBX G;  2VOD A;  3GX4 X;  5BPI A;  5DCF A;  3BY6 A;  2QBY B;  4A0Z A;  2E7W A;  1J59 A;  4BHB A;  2VBY A;  2XAH A;  3KEQ A;  4N9H A;  4L5J A;  4UV9 A;  1T2K A;  1S8N A;  1BI1 A;  2QVO A;  5CVI A;  3L00 A;  2STW A;  1G6N A;  2ZME B;  2A68 F;  3R0J A;  1T6S A;  4GO1 A;  1PUE E;  2VE8 A;  1WSU A;  4NB5 A;  2IW5 A;  3FMS A;  3WOD F;  2EFO A;  2OQR A;  1J75 A;  4JK1 X;  1JGS A;  4IRI A;  4KT5 C;  2E7X A;  3WGG A;  4M6X A;  1IXR C;  1W4M A;  1MJB A;  1GXP A;  3J7A O;  1AWC A;  1XSD A;  4NHJ A;  2ZO4 A;  3J80 Z;  2WV0 A;  1O7L A;  2G9W A;  3EYY A;  1ZAO A;  3QOP A;  3HYI A;  1R5H A;  5DD4 A;  3JSP A;  2V9V A;  1KU9 A;  3JTH A;  1OMI A;  3CJN A;  1T0F A;  1KQ9 A;  1H0M A;  3F8M A;  4CXF A;  3I53 A;  1L0O C;  4LJZ F;  5ICF A;  1R1T A;  3ECH A;  2QM3 A;  4A5M A;  2A5Y B;  1RIO H;  4RB3 C;  4K2E A;  1G3W A;  1FLI A;  2YPR A;  2EFQ A;  1JXS A;  4EV0 A;  2KKO A;  1ZRD A;  2Z99 A;  4P9F A;  4ESJ A;  4O3M A;  2KIM A;  2Z5U A;  3TO7 A;  1ULY A;  2PBI A;  4AD9 A;  2Z33 A;  4FT8 A;  4L0Y B;  4O5V A;  1QQI A;  4ZH4 F;  4U0W A;  1T38 A;  5IT9 Z;  3VB2 A;  1DP7 P;  4BXU A;  1MKM A;  3IKT A;  4S05 A;  2DLL A;  3CO7 C;  1XSV A;  4KN7 X;  2DK5 A;  1SD5 A;  3Q9S A;  2A3S A;  1U5T A;  5EEH A;  1YW9 A;  1FT9 A;  5AIP A;  1KU2 A;  3FM5 A;  1QZZ A;  3NQO A;  2RN7 A;  3BPX A;  2L4M A;  2H6C A;  3ROU A;  5LHH A;  3I71 A;  3KP6 A;  1XMK A;  1BI3 A;  2PMH A;  2K7L A;  1YO5 C;  3GO5 A;  4IRG A;  1ZLJ A;  3LQR A;  3PFI A;  3VEP A;  3DF8 A;  3I0T A;  2GXB A;  1IXS B;  2DI3 A;  1AOY A;  2DQR A;  3ZN0 A;  4LLL A;  2FML A;  1BC8 C;  1XMA A;  3F21 A;  1F5T A;  3E5X A;  1SD6 A;  1R1V A;  3RDI A;  4Q48 A;  1K78 A;  2P5L C;  4I0A A;  2JTV A;  2O61 A;  1FYK A;  1WQ2 A;  5ILU A;  2FA5 A;  4IVN A;  1MJA A;  2QQB A;  5KK1 A;  3EUH A;  2QZ8 A;  2OQG A;  2LSO A;  3W6J B;  3V7C A;  1FWZ A;  3GFM A;  3ZQ7 A;  2K86 A;  3PQK A;  1ZGJ A;  1Y0U A;  2VN2 A;  1MDM A;  1G3Y A;  2RQP A;  1JHF A;  4R1H A;  1T39 A;  4GYG A;  1BI0 A;  1BJA A;  1I27 A;  2FQ3 A;  3VOE A;  4HX7 A;  4M6Y A;  5LGT A;  4LB5 A;  3HTS B;  1P92 A;  4ESF A;  4RB2 C;  3WE2 A;  1C0W A;  1LEB A;  1ZAR A;  2HGC A;  2OAZ A;  3HTU A;  1QNT A;  1U78 A;  3J81 Z;  1QBJ A;  3WGI A;  2G7H A;  4KYW A;  2XVC A;  2CYY A;  2HEO A;  3CLO A;  5FB2 A;  2OA4 A;  3OOP A;  3CUQ A;  4I09 A;  1GVJ A;  2IP2 A;  1B9N A;  4HF1 A;  3C1D A;  4IRH A;  1ZG3 A;  1G4D A;  2XKO A;  3BJ6 A;  2BE5 F;  1F1Z A;  2IJL A;  2DK8 A;  5E17 F;  2UXX A;  2W84 A;  3FM3 A;  3GYH X;  3JTG A;  4B09 A;  5L3G A;  3M9A A;  4QLC U;  2ELH A;  3D5L A;  1FY7 A;  3QU6 A;  2VT3 A;  3TOB A;  4UVC A;  4A6E A;  3GZ5 A;  2WC2 A;  1P6R A;  1IN6 A;  1O7F A;  3O6B B;  2A07 F;  3IL2 A;  3GW2 A;  5HLH A;  1SFU A;  1IN7 A;  3LST A;  3ZN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...