3F21A

Crystal structure of zalpha in complex with d(cacgtg)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
67
structure length
67
Chain Sequence
LSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structures of non-CG-repeat Z-DNAs co-crystallized with the Z-DNA-binding domain, hZ{alpha}ADAR1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific adenosine deaminase
total genus 22
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f21A00
1EH6A 4L0YB 4G6DA 4KFCA 5HS7A 4QLCU 3ERED 4EJUA 2MH9A 5HS9A 5ILVA 4KDPA 1U5TA 1P92A 3E97A 3TQNA 3R60A 4IHSA 1ZGAA 3RTRA 3WE2A 4M72A 3RPUA 5ERIA 3SFZA 1ON2A 5L3GA 1MKMA 1W5TA 3WGHA 3ZMSA 4AIJA 3KP3A 3SHFA 1FOKA 1MDMA 4EQQA 1KU3A 4BHPA 4YFXF 4ENMA 5HLIA 1U5TC 2D1VA 2GA1A 2P6TA 2MC3A 4MEYF 3F22A 2CYYA 5JFRA 4ZH4F 2RC4A 3I5UA 1KQ8A 3M9AA 4ZZLA 1T6SA 2Q0OA 4ETSA 5LGUA 1L3LA 4HQEA 2XKPA 2ZXJA 1XCVA 3HRUA 3I4PA 1WSUA 3GF2A 1FBQA 3I71A 1R58A 1BIBA 2L3DA 1BI2A 2HFHA 1G3WA 3NQOA 5DCFA 4GCVA 3F8BA 2COMA 1SD7A 4ZYGA 2GIVA 2XRNA 4U7DA 4M6XA 3BDDA 1F5TA 2BYVE 2V1UA 4LJZF 4YFNF 1STZA 2NS0A 4AVPA 3FXQA 4UUVA 1BI1A 1REPC 2R3SA 3O6BB 2HOEA 1K6OA 2FA5A 4KMFA 3GWZA 3IC7A 5K5QA 2DW4A 3ZQ7A 4DQ2A 2FNAA 3JSOA 3I54A 1KGSA 3FMSA 5CVRA 1BOAA 1HKSA 1CF7A 4BYYA 4MGRA 5D6FA 4UVCA 3HSEA 3CJNA 5L3CA 3G73A 4O5VA 2Q8KA 4KICA 2FSWA 3E6MA 1B59A 1ZGJA 4EMSA 4WWCA 4OU0A 1VTNC 4A0ZA 1ZN2A 3M1EA 2E1NA 2A68F 4GO1A 5FGMA 3FM3A 3KCCA 2M45A 4RAZA 2HWVA 3F8FA 5IT3A 3CTAA 2V6CA 5F64A 4EM0B 2P7VB 1G3TA 2LF7A 1R7JA 5D5UB 2XAFA 1WI9A 3TOBA 5LGTA 2VXZA 3COAC 4EGYA 1FNNA 3E6BA 2OQGA 1LNWA 1S29A 2EA2A 2RV8A 4EVIA 2DT5A 1T0FA 5ILSA 3IWZA 2DO7A 2F5CA 2NYXA 3SQNA 4ZYEA 4G94A 4I0AA 2P5KA 3J81Z 4NB5A 4I0BA 3GFIA 3WG9A 2PMUA 4MTEA 4UXNA 5E17F 2YX7A 1FYLA 1KYZA 4KT5C 1IRGA 5FFXA 2QQBA 3WTUC 5J8CA 6PAXA 1ULYA 2K27A 3R4KA 2VBYA 1P6RA 3ZMUA 4I98B 4EGZA 1G3SA 3N4MA 2BBYA 2VE9A 4M9XA 2L01A 4P55A 4ENKA 2R7DA 2YU3A 1TLHB 1FSEA 2KIMA 4WX9A 2RGVA 1WRJA 1Z05A 3JAMZ 2VONA 4G6QA 1BJAA 2RQPA 2KIUA 3HUGA 3ZMTA 2V1DA 3IHUA 5HLHA 3FHZA 3EETA 1PP8F 2VODA 1RI7A 1K78B 3KEQA 4Q4ZF 4S05A 2EV6A 1P4WA 5DCMA 5LHGA 1AWCA 1BN5A 1J7KA 2IRFG 1O57A 3HHHA 5FB2A 4KIBA 5LBQA 4XRFA 2QZ8A 3JSPA 1XGOA 2NNNA 2XASA 2OQRA 4M74A 1LB2A 3BOQA 4Z2YA 1XGMA 3BZ6A 1D8KA 2XVCA 1ZG1A 2G7UA 2QM3A 3MAJA 4OIRF 1Y0UA 2ZBKA 2HYFA 4M71A 2QLZA 1ZREA 4U0YA 5CVVA 3M8EA 3P9KA 5LEJA 3T5XA 2XGXA 3KP2A 3BPXA 3QP6A 2LF8A 1YS6A 4Q5SF 5D4RA 1MGTA 1EV7A 2V79A 2P8TA 4OINF 2C6YA 1FBUA 1IF1A 4UVBA 2IVMA 3FF5A 1USSA 2FOKA 1DP7P 4PDKA 3E5UA 5A2QK 2DK8A 2HQRA 3F8CA 1P2FA 1Q1HA 1Z6TA 1Z6RA 2JRTA 2HKXA 3KZZA 2HTJA 5EEHA 2CQKA 1HQCA 3EUHA 3LFKA 1GXPA 1IAWA 2QVOA 4ZYDA 3LQQA 2Y0MA 3CO7C 2JSCA 2PEXA 1HKTA 4ENNA 2HEOA 2TDXA 1U5TB 2DK5A 2J5OA 1RNLA 1XB4A 1WKMA 2L02A 1SD4A 4A0XA 2H6BA 1UFMA 3JTHA 1QBJA 3KETA 4G9YA 1FYMA 3HSRA 1ZRCA 5D5VB 4G7ZF 3FXRA 4MHGA 1FP1D 3MZYA 3GFLA 1V3FA 2H94A 2ZNZA 1RUNA 2K02A 3KEOA 1ZH5A 4WXHA 3NEUA 3GXOA 3HRTA 2OA4A 4L5JA 1O7LA 5D5WB 3L00A 1W7PB 3RKXA 4Y17A 5HVQC 4ESJA 3HTUA 4XBFA 3PQJA 5AONA 3ABUA 2P4WA 2QUFA 1LDDA 4P9UA 5TJJA 1QGPA 1ZG3A 2ZNYA 4K2EA 4R79A 1MJ9A 3V8KA 3RKYA 2LNBA 4MQ9F 1OR7A 1PUEE 3KP5A 2D2WA 1J5YA 2VN2A 2K4BA 3FX3A 5E18F 1MDMB 4RB3C 4YG2F 5FLXZ 5JHUA 2F5FA 3RKWA 1XN7A 3KP7A 4O3MA 2DFIA 1E2XA 2DAOA 1R23A 1R5GA 3VFZA 4WXDA 3ZMDA 4WF2A 4KA4A 2BV6A 4H0EA 1B1BA 1USTA 3GVAA 1BM9A 1JXSA 1JHHA 3BPVA 4XLNF 4Y13A 3M8FA 1K78A 2V9VA 4F7ZA 1YW9A 1LDKB 4U0WA 5F6FA 3F23A 4TV7A 4G7OF 3CUQC 1DPRA 1S7OA 4IHTA 4IRHA 4QWQA 3NRVA 5HOOA 1I5ZA 2A07F 1E17A 4A5NA 2RNJA 5CYVA 4I09A 3K1PA 2O61A 1U3EM 1TQIA 4U7BA 2G9WA 3Q9SA 2A3SA 1XSVA 1J0RA 2R7FA 2UXXA 3GLXA 4L9TA 3GEZA 3O2PE 1TW2A 3FMRA 2Q2EA 1CF7B 4LG0B 3BJAA 4BH9A 5CJ9A 4LK1F 1S3JA 3JAMK 3TO6A 2FBHA 1H9GA 4CO8A 3H92A 4BNCA 3L9FA 4KIFA 2QENA 5EEGA 3ZN0A 1EH8A 3V7SA 2EWNA 3WTXC 5D6EA 2STWA 2W25A 4ASNA 1F1ZA 1LVAA 3G3ZA 2P7CB 1FSHA 2YX4A 3J80K 5DUKA 1T98A 2GXBA 4KNYA 3DPTA 3RYRA 5HLGA 3I59B 4MTDA 3I53A 4D0PA 2CG4A 2DBBA 3K69A 2A69F 2XAJA 3BJ6A 3FMQA 4OIQF 4RS8A 2GA2A 3HYIA 1OYYA 2M5WA 3GX4X 1HSTA 1FP2A 1MJAA 3K1NA 2UXNA 3GZ5A 3RJPA 1D5VA 2IP2A 2VT3A 4WK8F 2XIGA 1FZPB 1T38A 1IN8A 3SZTA 3C3WA 5LRRA 1LEBA 4UV8A 2IA1A 4EJOA 5L3DA 4YIFA 2QBYA 1JE8A 5IT9K 5BPIA 2IT0A 2EFOA 3IKTA 2FQ3A 1YLFA 5FLXK 3O3KA 3IRQA 3QPTA 3VB2A 2IJLA 4HDVA 1BC7C 3ZN1A 1QO0D 2Y48A 5D8KB 5LHHA 3KP4A 3V8LA 3EYYA 3BWGA 5K5RA 1Z9CA 1ON1A 2M1BA 4ESBA 5JVTA 2W85A 3LA7A 1XMAA 2EV0A 3DXJF 4HQMA 2YPRA 4AWXB 5E1XA 4EM2A 3IL2A 4U88A 2O3FA 1IUYA 2OD5A 3AAFA 1KA8A 2CW0F 2D45A 3LAPA 3L2CA 3W6KB 1LDJA 2ESNA 2A5YB 4LFUA 3WE3A 3ROUA 1QQIA 3L09A 5TRDA 3HOTA 4LLNA 4FHTA 4HW0A 3V8JA 5ICEA 2JPBA 4AIHA 3D0SA 1FC3A 1Z1DA 3U2RA 1U8RA 4JK1X 2YSRA 3R6SA 1O3RA 3ISPA 4P5OA 3CDHA 3E6CC 2Z9OA 3HOSA 5L3FA 5H6RA 1H0MA 1B4AA 5FFZA 2Y75A 1O7FA 4XLPF 3RDIA 4O6JA 2ZKZA 2M30A 3KE2A 1IW7F 4LGWA 3F8MA 4L5IA 3K1MA 1ZAOA 1XMKA 1W5SA 3C1DA 4LG0A 2M87A 2STTA 2PFBA 3HRMA 1UB9A 5HS8A 1OKRA 3CUOA 4P9FA 1BIAA 2WC2A 1FBSA 3K2ZA 1IRFA 1TTYA 3WTTC 4HX4A 1IXRC 4CXFA 4A5MA 2OZUA 4HAMA 1HBXG 4OOIA 3TO9A 2IA0A 5HDGA 4HF0A 4LD5A 4HDUA 3KLOA 3R0JA 3BY6A 4UV9A 3LAJA 2XV4S 5ICCA 4FT8A 3QRFF 1SMTA 5DDGA 2KRFA 1GXQA 3E6DA 1BBYA 3U1DA 1HKQA 4A0YA 2LDUA 1F9NA 3C18A 1FWZA 4KYWA 1R1VA 5AIPA 4OMZA 4EV0A 1P4XA 3MZHA 2GAUA 1FX7A 2E7WA 4GYIA 2EV5A 1YQAA 3REOA 4XSZF 4RB2C 5LHIA 4GXOA 3D5LA 2ZMEB 4HV5A 1B9NA 2DQLA 3E5QA 4A6EA 4RB1A 1R00A 1R5HA 3L7WA 1UHWA 4DNCA 1QNTA 2PN6A 1QZZA 2XKOA 4FX4A 1B6AA 2ACJA 4HF2A 4RAYA 5K1YA 4LB5A 2ESHA 4CICA 3CUQB 3JTGA 2BE5F 2OZ6A 3EYIA 4L9JA 4HLXA 5KVRA 2FU4A 2IA2A 3KZYA 2WWYA 4RGSA 2O8XA 2KJBA 5L3EA 3MQ0A 3HRSA 4LLGF 3FM5A 3HSFA 5K5OA 2A61A 1U6GA 2QWWA 5BMZA 2FRHA 4AD9A 2MBFA 3DP7A 1C0WA 1SFXA 3RIRA 2P5VA 3ZPLA 1MZBA 3T8TA 5CVJA 4A6DA 1IZ1A 1HXDA 4MEXF 3E3VA 3LA2A 3TDZC 3MWMA 2XHKA 2JZYA 2UWMA 2CGPA 4G7HF 3ZMVA 3GFJA 1TW3A 2XUBA 4EJTA 1Z7UA 3BP8A 3LA3A 4RGUA 1YG2A 3WTYC 2MA3A 4B09A 2EFQA 2CSOA 1UHMA 4BAYA 4N9IA 1QZYA 1V4RA 2HQNA 4OIOF 4IJAA 3MEXA 2ZJ2A 3RYPA 4ON0A 3EQLF 1CGPA 5CVUA 1S7AA 1ZARA 2D1HA 2EB7A 5E8IA 3ELKA 3U9GA 1W7PA 1HSJA 4KMUX 5LEKA 5F1RA 3GUDA 1ONVA 4I7HA 3LQRA 5LGNA 3GO5A 5DEQA 1EH7A 2AXLA 4HZFA 2EK5A 4HX7A 4XSXF 1TQMA 2K86A 2Z5UA 5FD5A 2UZKA 1O3TA 3OOPA 2HTSA 2ZO4A 5FD6A 1HW5A 1J2XA 1OPCA 2W57A 1ZRDA 2P6SA 1FY7A 5KK1A 1R1UA 1P4AA 1H9TA 2EFPA 4ESFA 2FBIA 3DF8A 2ADUA 1R1TA 2NRAC 1HW2A 1LEAA 3T0YA 1TQPA 2PBIA 4LK0F 1TBXA 1DDNA 2MH2A 1YS7A 2GWRA 4Q48A 1RZ4A 1D3YA 1U2WA 4JBAA 4IVNA 1D8JA 3PFIA 3I59A 1KU9A 3M7GA 5HDKA 3HHGA 1OYWA 2LSOA 2BEOA 1BI0A 1IXCA 4N9HA 4NQWA 5D5XB 2DPUA 4R1HA 1YYVA 3QP5A 1XD7A 2MD5A 3P9IA 4MNUA 3J80Z 4BQAA 4P96A 2F5DA 3IWFA 1IN4A 3FXUA 5CLSA 1Z91A 4ENJA 3GYHX 3WTVC 2JTVA 1YW8A 4MQVA 3WTWC 2PLYA 1XDUA 4AIKA 4R8HA 5DD4A 2XAHA 1K79A 1IN6A 1YIOA 1I6XA 2ZCWA 3K9TA 1R22A 2E7XA 4L9NA 2PG4A 2YR2A 3QAHA 4GGGA 2BGCA 4I02A 1RIOH 3P9CA 5L3BA 4M73A 5E20A 5A2QZ 3TKYA 2FBKA 4L0ZB 2Z33A 1WQ2A 3E5XA 3ECOA 1FYKA 2CO5A 3VOEA 5H6QA 4I2OA 1ZG5A 2XROA 2HZTA 3R0AA 1W7PD 4S04A 3OV8A 2PQ8A 2H6CA 4Q47A 2DPDA 5LRSA 2DTRA 3DQVC 2M8EA 2GXGA 2NAZA 2PMHA 1SD5A 4EJVA 4RB0A 4IF4A 3MCZA 3J81K 3I64A 4M6YA 1B9MA 3W6JB 2J5PA 1RUOA 1KU7A 1I27A 2OU2A 4M9ZA 2Z99A 5E1WA 1X3UA 3ULQB 3IKVA 1IXSB 2EFWA 5DV5A 3C7JA 4WXCA 5FO5A 4UNOA 2HDCA 4IXAA 4GYGA 1G3YA 4OMYA 2L4AA 2IPQX 2B0LA 5DD8A 3QPHA 3H3ZA 1YO5C 1XGSA 5AIQA 3T1BA 3Q5FA 1XDSA 3F3XA 1I1SA 5DUIA 2DU9A 2MLKA 2VC1A 2VT2A 2O0YA 1KQ0A 5BPDA 1F4KA 3CUQA 1SFUA 1XCBA 3V7CA 1YW7A 4KUMA 5D4SA 2LKPA 2X4HA 4KN7X 5HDNA 2GZWA 2PI0A 3GFMA 1KU2A 2HR3A 4LB6B 3R61A 2QQ9A 1FLIA 1TNTA 2RVCA 3TGNA 3B73A 2FF4A 3QU3A 4CZZA 3Q9VA 1JHFA 4CHUA 5BOXA 3SZPA 2A6EF 5BS6A 2HGCA 1OYIA 1J9IA 1PP7U 2Z3YA 1XGNA 3KFWX 5J6XA 4B8XA 1O3QA 2VBXA 4NHJA 3CLOA 3GZ6A 3IRRA 2W84A 4PZJA 1YTYA 2V1XA 1DUXC 5DYMA 4CGZA 4YIIA 3BJOA 3WU1B 3WODF 4N0BA 4I01A 3ML6A 3F8NA 1I1GA 5ED4A 2DI3A 1W4MA 2O03A 2WTEA 2XAGA 2O6GE 2QBYB 5IT9Z 4BXUA 1ZLKA 2L54A 3H3UA 1WWXA 2F5EA 3K0LA 3WGIA 3F6OA 3QOPA 4ZZDA 1G4DA 3ABTA 1UCRA 3LSTA 4PGGA 5D8LB 3DV8A 4YFKF 4L18B 2F2EA 1BC8C 1S6LA 1BI3A 3ECHA 1ZYRF 2FE3A 2K7LA 2K4JA 1MJBA 4IRGA 4EM1A 4PGHA 5JR3A 3ZMZA 1LQ1A 5E8GA 1GVJA 2EJRA 2QQAA 2WV0A 3DEUA 2A6HF 1KQ9A 1SFEA 4IRIA 1U78A 4LLLA 2VC0A 3TOAA 3WGGA 3HIFA 5BQTA 1A04A 2DLLA 2XAQA 2ELHA 4EJWA 2L4MA 3WTSC 5JI6A 2ZFWA 3PQKA 4FX0A 1ODDA 1DPUA 4BHCA 2QYOA 1XSXA 1ZLJA 4L9VA 3TDUC 2HKOA 2OBPA 4HLYA 2H27A 5ICGA 3FZVA 4KIGA 1J75A 3V4GA 1AOYA 2GQQA 1K7AA 4BHBA 4A2UA 2RN7A 4HA8A 2RKHA 2CFXA 2OAZA 4RGRA 2H09A 4M9SA 3RI4A 3V7RA 4HV6A 1YFHA 5H20A 2FXAA 2NNYA 2AS5F 2EA4A 2E1CA 3KP6A 3I0TA 1LJ9A 3F72A 2FEZA 4G8XA 4OIPF 1IN7A 3F21A 1ZHFA 1T39A 1SMYF 4LMYA 5LLQA 4ZYHA 3HTSB 3GW2A 3DFGA 1IN5A 3LWFA 4A12A 1G6NA 1HW1A 2X0LA 4UHTA 5CVIA 2KKOA 2FNPA 5ICFA 4RGXA 2ETHA 2W24A 2ISZA 2KIFA 4IPAA 2PJPA 3P7NA 1J59A 2MLGA 3WTZA 2FMLA 1JGSA 2RDPA 2JPCA 3S2WA 1SD6A 3MFKA 4HOBA 1O3SA 2IW5A 3N97A 1PDNC 4PCQA 4HYEA 4KN4X 4HX8A 1T2KA 2KJCA 3SXYA 2VOPA 3I58A 2DQRA 4UVAA 3RPQA 1L0OC 1QPMA 3ZP5A 5ILUA 1GHCA 1XSDA 2VOOA 3JW4A 3B02A 1FT9A 1OMIA 2ZMEA 3DKWA 4HBLA 1ZRFA 3VODA 3TO7A 3KLNA 2VBZA 1SAXA 2ISYA 1FPQA 4HF1A 5DCMB 5E1ZB 3FWEA 3QU6A 4Y15A 3CO6C 1KYWA 5J8FA 2VE8A 2P5LC 4CYDA 2HS5A 2EFNA 4WCGA 2VBWA 4E70A 3BROA 3WU0A 2FMYA 2G7HA 3DPLC 2CWEA 3F6VA 1TNSA 3T8RA 4CDGA 1R36A 3VEPA 3EDPA 4JQFA 2HYGD 1NHAA 1S8NA 1MD0A 2JT1A 3J7AO 4U0VA
chains in the Genus database with same CATH superfamily
1R9TJ 3OYAA 3PIPF 1EH6A 2LVSA 4F92B 4B43A 4L0YB 4G6DA 4KFCA 5HS7A 4QLCU 2Q1ZB 4EJUA 2MH9A 3ERED 3VPRA 2K40A 1BA5A 3PNTA 2R5ZB 4Y33A 5HS9A 1FMWA 1OCZH 5ILVA 4DIQA 4KDPA 1U5TA 1P92A 3E97A 3M8JA 3TQNA 4PSXA 4XORA 3BTJA 3R60A 4IHSA 1ZGAA 3RTRA 1Y39A 3WE2A 1LFPA 5TGTA 4M72A 3RPUA 4CCOA 1RKTA 3HZJA 2QCOA 5ERIA 1MIJA 3SFZA 1ON2A 3A0HC 5F27A 5L3GA 2JSPA 2WAEA 3CQZJ 2VJ5A 1MKMA 1W5TA 3WGHA 3ZMSA 4L5EA 4AIJA 5J4VA 5EDNA 2O5RA 3UR3C 3KP3A 5E3LA 1W1WE 3SHFA 2WB1A 2GOXB 1UMQA 1WCMJ 1MDMA 1FOKA 4EQQA 1KU3A 1QU3A 2XB0X 4E7KA 4BHPA 3BT9A 4YFXF 4ENMA 2XRLA 1AKHB 1YOVB 5HLIA 2XB5A 3AL0C 2B9SA 4RA2A 1U5TC 4GRIA 2D1VA 2GA1A 2RNGA 4E7SA 3E1SA 2HDWA 3VDXA 2P6TA 1Y0NA 2MC3A 3Q3SA 4MEYF 3F22A 2CYYA 5JFRA 4ZH4F 2RC4A 1VQNI 3HXLA 3X2QH 3I5UA 3GTPJ 4BQQA 1F43A 1KQ8A 3M9AA 3DWLE 4ZZLA 3CD6I 2MABA 3VYSB 1T6SA 2VJIA 2Q0OA 4ETSA 5LGUA 2NS8A 3I3LA 1L3LA 2VXDA 4HQEA 4HG2A 3W6VA 1MBGA 1MH4A 2XKPA 2ZXJA 2GOMA 3G71I 1XCVA 3H9QA 3HRUA 3I4PA 1WSUA 3S17J 3GF2A 3O8HA 1X3WB 4PJMA 1FBQA 3OY9A 3I71A 1R58A 3CCYA 2MC4A 1BIBA 3LSPA 1OCTC 4XKBA 2L3DA 3C2BA 1X1AA 2DTZA 4N4NB 1BI2A 4BKXA 1JUMA 4XLHA 2HFHA 1G3WA 3CCUI 1WH7A 2DJNA 3NQOA 5DCFA 1F36A 4GCVA 1A36A 1IRZA 3F8BA 2COMA 4BJTA 1SD7A 4ZYGA 4D5FA 5DM7F 2FUG2 2GIVA 2XRNA 5C44J 4KITB 2ZC2A 4U7DA 1TT5B 4M6XA 4PJ0C 1JKPC 1QVUA 2DYRH 3MKZA 1N25A 5J4YA 3BDDA 3BLYA 3K2AA 3GMEA 1F5TA 2M4KA 3IH2A 3LL7A 2BYVE 2V1UA 5KNLA 2D5VA 1K4SA 3AFHA 1U9OA 4LJZF 1NTCA 4YFNF 1STZA 2NS0A 3K7AJ 2IBDA 4AVPA 3FXQA 3M4OJ 4UUVA 1BI1A 5FKMA 1REPC 2DA4A 2R3SA 2JA8J 2JUGA 2LBFA 2P0WA 3O6BB 2HOEA 1K6OA 2FA5A 4KMFA 3GWZA 3IC7A 5K5QA 4I6ZA 2DW4A 3MKLA 4XKVA 3ZQ7A 1WJCA 4DQ2A 2FNAA 3PIOF 2E34A 3JSOA 2DMPA 3I54A 1KGSA 3FMSA 4CCKA 5CVRA 1DGWY 2KDOA 3W2VA 1BOAA 1HKSA 1CF7A 2R7SA 3CP8A 2QSHX 3PNYA 4BYYA 5M5YJ 4MGRA 5D6FA 4XLFA 2F5VA 4UVCA 3HSEA 1QPIA 3CJNA 5L3CA 3G73A 4O5VA 2Q8KA 1IUFA 2CS3A 4KICA 2FSWA 1VNDA 3E6MA 3QWLA 1B59A 2UUZA 5GTIC 1V55H 1E0EA 1ZGJA 2X1EA 1VI0A 4EMSA 3EPZA 3MD2A 4WWCA 2BY0A 1UHSA 4OU0A 5EYRA 1VTNC 2CMPA 3CCRI 4A0ZA 1ZN2A 3M1EA 4XQFA 1BR4A 2E1NA 2A68F 4W97A 4GO1A 5FGMA 3FM3A 3QPLA 3KCCA 2K9LA 1XC5A 2M45A 4RAZA 2HWVA 3UNGC 2WA0A 3F8FA 2WBMA 5IT3A 2L7MP 3CMAI 3CTAA 2V6CA 1HF0A 5F64A 1UAAA 4EM0B 2P7VB 5GP9A 1G3TA 4C2UA 2LF7A 1R7JA 3MVPA 2R4GA 5KCMA 1YJNI 2CH0A 4S0HB 5D5UB 2XAFA 3TBIA 1WI9A 2YUSA 1V5EA 2W7NA 3TOBA 5LGTA 5B3SH 2EZIA 1I3QJ 1IV8A 2BHYA 2VXZA 2BVMA 3KEYA 3COAC 5E79C 4EGYA 5CQGA 4HNVA 3FDYA 1FNNA 4II2A 3E6BA 2OQGA 1LNWA 1S29A 1SEUA 3I4MJ 2R7ZJ 2EA2A 2RV8A 4EVIA 2DT5A 1T0FA 5ILSA 3IWZA 2K9NA 2IGOA 1WI3A 1R6RA 3VSLA 2DO7A 3CJQB 3S2HJ 2F5CA 2NYXA 3SQNA 1B8IB 4ZYEA 4G94A 4I0AA 3TP0A 3HOXJ 2P5KA 3PSIA 3J81Z 2VL8A 4NB5A 3OYIA 3CCMI 4XRSG 4I0BA 3GFIA 4J19A 2EINH 3WG9A 1ETOA 1LUJB 2PMUA 4MTEA 4UXNA 2I8DA 2R7OA 1Z7LA 5E17F 2YX7A 3W3CA 3CMEI 4N4OB 1FYLA 1N78A 1KYZA 2HYJA 2WB1N 1VQPI 4KT5C 1IRGA 5FFXA 2QQBA 3WTUC 3TP3A 5J8CA 6PAXA 4V2GA 2EQRA 1ULYA 2OPTA 1FOWA 1G8XA 1GT0C 2K27A 3R4KA 3HOWJ 2VBYA 4NC8A 3ZR8X 2IGMA 4DZJA 5C3EJ 1ITYA 3H36A 4GDFA 1DU6A 1P6RA 3ZMUA 2DT6A 3RZDJ 3FBNB 4I98B 2MGQA 4EGZA 3G6EI 1G3SA 3N4MA 2AQEA 1X1DA 4BXFA 1TWCJ 2LY9A 2BBYA 2VE9A 2DYSH 5KAFC 4M9XA 3L1PA 3MMYB 3BZCA 2L01A 4PJNA 4P55A 4ENKA 1MNMC 1VQKI 2R7DA 2YU3A 1TLHB 4HPQA 4IX7A 3VWBA 1VQOI 1LE8A 1FSEA 2LP0A 1SAUA 2KIMA 2LBFB 5K7ZA 4WX9A 2RGVA 2VPLA 1CQTA 1WRJA 1Z05A 3JAMZ 5LD2C 4QSHA 2VONA 4G6QA 1BJAA 5F0CA 2RQPA 1OR7C 2X85A 1D0ZA 3HGGA 2JK3A 4LIVA 3NWTA 3J7ZI 3CC7I 2KIUA 3HUGA 3ZMTA 4JX5A 2V1DA 3IHUA 5HLHA 3FHZA 3EETA 1PUFA 4D7NA 4UB8C 1PP8F 2VODA 1RI7A 3FISA 1K78B 4XN3A 3KEQA 4Q4ZF 4S05A 1D5YA 2EV6A 1P4WA 5DCMA 2HZDA 4E7IA 5LHGA 1AWCA 1BN5A 4M3BA 1J7KA 3DEWA 2DN0A 2IEKA 3H35A 2LKXA 1J09A 2IRFG 1O57A 3HHHA 4X1EA 5J47A 5FB2A 2ID6A 2AQFA 4KIBA 5LBQA 4XRFA 2QZ8A 3OSFA 3JSPA 2HVRA 1XGOA 2NNNA 2XASA 4E4HA 3WU2C 1VQ5I 2OQRA 1RRJA 4M74A 1LB2A 3BOQA 4FTHA 4Z2YA 2HPIA 3W2WA 1XGMA 2WV1A 3BZ6A 1D8KA 1GVDA 2XVCA 4G12A 4BY1J 1T0FC 1ZG1A 1SANA 4UUSB 2G7UA 2XPVA 3FBIB 3CDLA 2QM3A 3MAJA 2V4JC 3RQ4A 3GTQJ 4PK4A 5DTDA 4OAZA 4OIRF 4HRIA 4IKFA 1Y0UA 3BR2A 2ZMEC 2ZBKA 4V2FA 2HYFA 4M71A 5EEAA 3G4SI 2QLZA 4BDZA 1ZREA 4U0YA 4A3FJ 4RAGA 5CVVA 4XM3A 4Y4RA 3M8EA 3P9KA 4XL9A 5LEJA 3T5XA 2XGXA 3KP2A 1FEXA 2X51A 2X6YA 2KFDA 3BPXA 3FXJA 3QP6A 3ZQFA 3CF5F 5FLVA 2L9SA 2LF8A 5F0FA 1MMGA 1YS6A 1GV2A 2Z2SB 1TL8A 4CYCB 1T95A 1XPXA 5EGOB 2DCEA 4Q5SF 4X0GA 3CCJI 3CJRB 5D4RA 1MGTA 4HNUA 1EV7A 3RZOJ 2V79A 2P8TA 4OINF 2C6YA 1FBUA 3HB9A 4M3EA 4D9JA 5EZGA 1IF1A 1SC7A 4UVBA 2IVMA 3DKXA 2IS4A 1EF4A 2M0MA 4CCNA 3S3OA 3FF5A 4CH7A 3FKIJ 1USSA 2NOJB 2EH3A 1IDYA 4BBRJ 2OC6A 2FOKA 4A3BJ 4XIDA 1DP7P 4PDKA 1P9QC 1IG7A 3E5UA 5A2QK 1OJLA 2MW8A 2XPUA 3JRIA 1OISA 1WGXA 1VF9A 2DK8A 2EZKA 2HQRA 1P2FA 3F8CA 4MFEA 2X9DA 1Q1HA 3L2WA 3PSFA 3SZGA 2JJ7A 2XGDA 1Z6TA 2H1LA 1ZGWA 2F4MB 4YELA 3AG4H 4LIUA 4II3A 3CCSI 4RMNA 1Z6RA 2JRTA 2HKXA 3KZZA 2HTJA 1ZELA 5EEHA 2CQKA 5HNFA 1HQCA 2JA2A 4A3JJ 3HDDA 3EUHA 3LFKA 4DYQA 3N05A 1GXPA 1IAWA 1A5JA 2XSJC 2QVOA 4ZYDA 3EUKL 1Y8RB 3ERMA 1OCOH 4NNJA 3KIOA 2HQ5A 1W5CC 3ZQGA 4DJAA 3C2GA 3LQQA 2Y0MA 3CO7C 2JSCA 4DYRA 2PEXA 1HKTA 4XRSA 1TT0A 1E3OC 4ENNA 2HEOA 2EZLA 4RM2A 1MMDA 2TDXA 1U5TB 2DK5A 2J5OA 4GFBA 1RNLA 3HJEA 1XB4A 4RLFA 1WKMA 1B72A 4Y3OA 2L02A 2QGUA 1SD4A 4A0XA 3HKZA 4FE4A 2H6BA 2LTPA 1UFMA 1XMXA 4C3HJ 4DW6A 3JTHA 1X1CA 1QBJA 1WVRA 3KETA 4G9YA 1FYMA 3HSRA 1ZRCA 5D5VB 4JX6A 4G7ZF 3FXRA 1IV6A 3LSRA 4MHGA 1FP1D 1BL0A 3MZYA 3GFLA 1V3FA 2H94A 1X1PA 2E36A 2UV1A 2ZNZA 5F0HA 1RUNA 2K02A 3D5RC 3KEOA 1ZH5A 4WXHA 3NEUA 3GXOA 3HRTA 3M07A 4AM3A 2OA4A 4L5JA 1O7LA 5D5WB 2X6XA 3L00A 1W7PB 1ZK8A 3A4CA 3ABKH 2P81A 3RKXA 4Y17A 1UG2A 4HSTA 5HVQC 2DOEA 4ESJA 4ITVA 2QQ8A 3HTUA 4XBFA 3PQJA 5IP9J 5AONA 3ABUA 4Y7NJ 3OYNA 2P4WA 2QUFA 1LDDA 2LK2A 4P9UA 5TJJA 1QGPA 1ZG3A 2VKEA 3CESA 2ZNYA 4K2EA 4R79A 1MJ9A 3V8KA 3RKYA 2LNBA 5IP6A 3ABMH 4MQ9F 1OR7A 1S7EA 2H8RA 1PUEE 4A3MJ 1WHUA 3KP5A 2ZJQF 2DDBA 2D2WA 1J5YA 2VN2A 2K4BA 1RESA 4B3XA 1K83J 2O8KA 4AVZA 4D1QA 3FX3A 5E18F 4DBRA 1MDMB 2R5YB 2MFZA 4RB3C 1JTYA 2DA5A 4QPQA 4YG2F 2O9LA 2LMDA 5FLXZ 2E1MC 2OV7A 5JHUA 2F5FA 1OFCX 3RPUD 1OCRH 3RKWA 4BEHA 2RREA 2IXSA 3PUFA 1XN7A 3KP7A 2CFOA 4O3MA 3TW7A 2DFIA 3PJRA 1E2XA 2DAOA 2E2IJ 1R23A 4XK4A 2MG4A 1R5GA 3VFZA 1GDTA 2IGNA 1Z3YA 3CLQA 4M3FA 2BXZA 2Y2ZA 3F9KA 4WXDA 5K7HA 1Y1VJ 3AG3H 4WF2A 2BV6A 3ZMDA 4KA4A 2JMWA 4H0EA 1B1BA 2TRTA 3A0BC 5J1UA 1USTA 2WAFA 3DU5A 3GVAA 1BM9A 2OF7A 1JXSA 1JHHA 1S5LC 3H0GJ 3BPVA 4XLNF 2HXOA 4Y13A 2L0KA 3QPSA 5K7FA 3M8FA 1K78A 2V9VA 4F7ZA 1YW9A 1LDKB 4U0WA 5FRNA 5F6FA 1P7JA 1TWFJ 3F23A 4TV7A 4G7OF 2JN6A 3CUQC 1NK3P 3L2VA 2QA4I 3A01A 2ZJRF 2A6TA 1DPRA 1S7OA 2JWTA 4AU7A 2DMQA 2BY3A 2LD5A 1K61A 4IHTA 4IRHA 2CQNA 1WPKA 4QWQA 3NRVA 4B4CA 4BGDA 5HOOA 1I5ZA 2A07F 3ONQA 1Z0XA 1DP3A 1E17A 4A5NA 2CU7A 2RNJA 5CYVA 4I09A 1RR8C 5JVGF 3K1PA 2O61A 1U3EM 2V7FA 1TQIA 4U7BA 3CCLI 1I50J 2M7AA 2CUJA 2G9WA 3FIWA 2R7TA 3Q9SA 2XPWA 3BG3A 2DMUA 2A3SA 3JRDA 1XSVA 1J0RA 2W00A 1RR7A 1AA7A 2R7FA 2UXXA 4FQGA 3GLXA 4L9TA 3GEZA 3O2PE 1TW2A 3FMRA 3IH4A 3DCFA 2MD0A 2R5YA 3SDBA 2DA6A 2QSFX 3S32A 4Y52J 2Q2EA 1ZR2A 4NBQA 1HCRA 1CF7B 4Z6YA 2I10A 1VQ7I 4LG0B 1IC8A 3BJAA 2LG4A 3AL0B 3ZQCA 1MBEA 4BH9A 4A93J 3JRCA 5CJ9A 4QIWN 4LK1F 3JRAA 1S3JA 1QHHD 3JAMK 4M6VA 2B7EA 3TO6A 2FBHA 1UG0A 4I76A 1H9GA 4CO8A 2WY7Q 3NARA 3H92A 2DDAA 2OJED 4BNCA 3L9FA 4KIFA 1S72I 2QENA 5EEGA 3I4NJ 2MSYA 1EH8A 3ZN0A 3V7SA 4RBOA 1MBFA 3PUBA 2EWNA 1I6HJ 3WTXC 3LOCA 5D6EA 2STWA 2W25A 4BE0A 3PFYA 1F1ZA 1LVAA 1TP4A 3G3ZA 4ASNA 4AUXA 2P7CB 1VFCA 1FSHA 2F48A 2YX4A 2GBYA 3J80K 5DUKA 1T98A 3BR1A 2GXBA 4KNYA 4DOZA 3DPTA 3RYRA 5HLGA 3I59B 4MTDA 3I53A 1ZKGA 4AYBN 4BQNA 4D0PA 1BJZA 3WHCA 1ETWA 2CG4A 3HGYA 3DBHB 2DBBA 1YITI 3K69A 2OTJI 1Z67A 3KX2A 4HNTA 2A69F 1SVLA 2XAJA 3BJ6A 3OYEA 3FMQA 1BW6A 3LSHA 4OIQF 3S1RJ 2VQCA 4RS8A 1Z21A 2GA2A 3HYIA 3OSGA 3HC7A 3BG5A 1DQUA 5GPCA 1VQ6I 1PYVA 1OYYA 2M5WA 3GX4X 1HSTA 1Z77A 2XDVA 2HQAA 4F3QA 3ZQLA 4IZZA 1FP2A 1QRYA 1MJAA 3K1NA 4CUGA 2UXNA 2W48A 3GZ5A 3RJPA 1D5VA 2KZVA 3BG6A 2IP2A 1S9HA 2NXNB 2VT3A 4WK8F 1OCPA 2BY1A 2XIGA 1FZPB 2MYSA 1T38A 4RLQA 1IN8A 4FE7A 3SZTA 1V5FA 3C3WA 4XMYA 5LRRA 1LEBA 1N75A 4UV8A 1U8BA 2IA1A 4EJOA 5L3DA 4YIFA 2QBYA 2CUEA 1JE8A 5IT9K 2QKMB 5BPIA 2CV1A 2H1KA 3JRBA 2IT0A 2EFOA 3I56I 2Z16A 2VUMJ 3GTMJ 2BHZA 2W4SA 3BTCA 3IKTA 1O4XA 2FQ3A 1YLFA 3OYMA 5FLXK 2GM4A 3O3KA 3IRQA 3SEQA 3S2DJ 3QPTA 2KPMA 3PL8A 2Y30A 5DS9A 3A1YA 2VKVA 3FXMA 4A3DJ 3VB2A 3JRGA 2IJLA 4HDVA 4NQWB 1BC7C 1W0UA 3ZN1A 4QTRA 1QO0D 1IO2A 2Y48A 5D8KB 3H3VK 5LHHA 3KP4A 2M3AA 3V8LA 3EYYA 3BWGA 5K5RA 5FKNA 1Z9CA 1GUUA 3E0JB 1ON1A 2M1BA 4C3IJ 3HPHA 4ESBA 1A35A 5JVTA 2W85A 4J01A 3LA7A 1XMAA 2EV0A 3OYJA 3DXJF 1BW5A 2M7BA 4HQMA 5J3LA 2YPRA 3Q0VA 3OYCA 4AWXB 2E1OA 5E1XA 3J7YJ 3WHBA 3ASNH 4EM2A 3IL2A 4DGWB 4U88A 4X6AJ 2O3FA 1IUYA 2OD5A 3AAFA 1Y6IA 2BY2A 1KA8A 2CW0F 1OLTA 2D45A 4J00A 3BTLA 3JCUC 3LAPA 2X1DA 3L2CA 3W6KB 4IHWA 1LDJA 2KT0A 3SFIA 2ESNA 2A5YB 4LFUA 1OQYA 1A6IA 2HOSA 3WE3A 3ROUA 4C30A 4JP0A 2R0QC 2G0EA 1QQIA 4QPOA 2ICWG 3L09A 5TRDA 2NVTJ 5M5XJ 3HOTA 4LLNA 2QF7A 1T08B 4OAYA 4FHTA 2LYCA 2E2HJ 1X1BA 3DBRB 4HW0A 5BNGA 3V8JA 3FXOA 2JPBA 4EEFG 5ICEA 4AIHA 3D0SA 5E3NA 1JT6A 1FC3A 1Z1DA 3U2RA 2IS2A 1U8RA 1FTZA 4JK1X 2YSRA 3ABLH 4ANJA 3R6SA 2KISA 1O3RA 3ISPA 4P5OA 3CDHA 3E6CC 4BE1A 4LITA 2Z9OA 3HOSA 5IOZA 5H6RA 5L3FA 1B4AA 1QHGA 5FFZA 1H0MA 3CCEI 2Y75A 1VZ0A 5IY5H 1O7FA 4DZPA 4XLPF 3RDIA 4CCJA 4UUTA 4ZTFA 4BS9A 2KQRA 2KMUA 4O6JA 2ZKZA 2M30A 3KE2A 4IQJA 3NWSA 3S1NJ 2DOFA 2EIKH 1IW7F 5EGOA 4LGWA 3F8MA 4L5IA 3GTOJ 3K1MA 4F91B 1ZAOA 4LOCA 3AKZA 1XMKA 1W5SA 2EZHA 2CW7A 4KT6A 2BW3B 3C1DA 4LG0A 3K4MA 2BOLA 3L2UA 3BC8A 5F1JA 2LOOA 2M87A 3BQYA 1SVOA 2K9MA 2STTA 2PFBA 3HRMA 3VYUB 3RKQA 4A69C 1UB9A 5HS8A 1OKRA 3CUOA 4P9FA 1BOBA 4BY7J 1BIAA 4C9YA 2WC2A 2Y0SN 1EJ9A 1FBSA 3K2ZA 1IRFA 1RPWA 2ME0A 1TTYA 1TWHJ 1D0YA 3WTTC 4IHYA 2KIQA 4HX4A 1IXRC 4U87A 3LNQA 4CXFA 2K85A 3FHNA 4A5MA 1LFBA 2OZUA 1YX5A 1JKQC 3OYGA 3DBLB 4HAMA 3CP2A 3K70D 2KLOA 1HBXG 4OOIA 1IRXA 2IA0A 3TO9A 5HDGA 4HF0A 4LD5A 1FOYA 2OTLI 1LE8B 4HDUA 5EG0A 3KLOA 3R0JA 3FK6A 3BY6A 4UV9A 3LAJA 2XV4S 5ICCA 2VKHA 4FT8A 3QRFF 1SMTA 1AHDP 5DDGA 2KRFA 1GXQA 5IOYA 4PFPA 3E6DA 2XC7A 1BBYA 3H9GA 3U1DA 1HKQA 4A0YA 2LDUA 2PJRB 1F9NA 1PVEA 5M3FJ 2JRMA 3C18A 1FWZA 4KYWA 1R1VA 2E1MB 3LMMA 5AIPA 1FIPA 1X4OA 4ZJZA 5J1YA 1PUFB 4OMZA 3U21A 2X6WA 4EV0A 4BQOA 3F0CA 1P4XA 3MZHA 1FX7A 2GAUA 4BL0B 2E7WA 4GYIA 4NC7A 4UUSA 2EV5A 1YQAA 3REOA 4BJ6C 1MMSA 3TL4X 1I3AA 4E6KG 3QQAA 1N77A 1YRNB 3ZGKA 4XSZF 3GLLA 4RB2C 5LHIA 4GXOA 3D5LA 5H2FC 2ZMEB 3GTLJ 5HNHA 3BTIA 4HV5A 1B9NA 2DQLA 1JI8A 3E5QA 3B6CA 5CPRB 1HOMA 4A6EA 3C2HA 2B63J 4CDGA 2BVLA 1R00A 4RB1A 1R5HA 3L7WA 1D1CA 4XKWA 1UHWA 4DNCA 1QNTA 2PN6A 1PJRA 1QZZA 2CQ7A 2XKOA 4FX4A 1B6AA 3ZQHA 2ACJA 1YHQI 4HF2A 4RAYA 1UJ8A 1V5GA 5K1YA 5F08A 1SFOJ 3KYCB 4IOCF 4LB5A 2CUZA 2ESHA 4CICA 4RM3A 1K4TA 1DU0A 2JA7J 3CUQB 3K4BA 3JTGA 2BE5F 1M1EB 2R7QA 1ZR4A 2OZ6A 1APLC 3EYIA 4L9JA 4HLXA 2DA1A 5KVRA 1G59A 3WG7H 5JLWA 2FU4A 2IA2A 3KZYA 2WWYA 4RGSA 2O8XA 2KJBA 5L3EA 3MQ0A 1JJ6C 3HRSA 4LLGF 1D1AA 2I5UA 4XRMA 3FM5A 3IH3A 3HSFA 5K5OA 3DEEA 2A61A 1U6GA 1X2NA 1X58A 2QWWA 3O8GA 5BMZA 1MH3A 2DA7A 3CMMA 2FRHA 2M34A 3OMYA 4AD9A 5FROA 2Y9ZA 1ETQA 4E7HA 2MBFA 3KZIC 2OUMA 2CUFA 2NVUB 3DP7A 2DFEA 1YJWI 1SFXA 1C0WA 3RIRA 3LSKA 2IAIA 1WJFA 2P5VA 3A2KA 3ZPLA 2VASA 1MZBA 4BEHB 3T8TA 4D5CA 2BXYA 5CVJA 4A6DA 3A01B 1A6QA 5C4XJ 1IZ1A 1SVMA 1HXDA 4MEXF 2LREA 3E3VA 3LA2A 3TDZC 3MWMA 2XHKA 2JZYA 2UWMA 4XONA 2CGPA 2IS1A 1ETYA 1HLVA 3GCMA 1RETA 4G7HF 5IYBJ 3ZMVA 3GFJA 4FISA 1YRNA 1TW3A 2XUBA 4EJTA 5HLTA 2HOTA 1Z7UA 3BP8A 3LA3A 4RGUA 1YG2A 2R92J 5FKKA 2ZFUA 2VB6A 2DXIA 3WTYC 1R5ID 2MA3A 2WAQN 3E7LA 4B09A 2EFQA 4XICA 2CSOA 1UHMA 4BAYA 4N9IA 1QZYA 2ZJPF 4A3KJ 1V4RA 2HQNA 3ZQIA 4OIOF 3ASOH 3MEXA 4IJAA 1FMVA 2DODA 3K10A 3BR6A 2ZJ2A 3RYPA 4MIMA 3DLAA 4ON0A 2WY8Q 3EQLF 2DMTA 3LSGA 3JRHA 3GTJJ 1AKHA 2FD5A 1CGPA 3M3YJ 2ZXIA 5FLMJ 5GAGJ 2Y0SA 2RQQA 5CVUA 1S7AA 1ZARA 3CF2A 2KL4A 3K4NA 2D1HA 3K4LA 2EB7A 4MO7A 5J1RA 5E8IA 3ELKA 3U9GA 5M5WJ 1W7PA 1HSJA 5IYCJ 4KMUX 5LEKA 2R7UA 5F1RA 2M9HA 3GUDA 4BUPA 1FJLA 2YU9J 1ONVA 2W82A 3OS1A 4ABZA 2OCCH 2W1OA 3HEFA 3LQRA 4I7HA 5LGNA 3K70C 3GO5A 1OCCH 3H5RA 5DEQA 4CA0A 4IHVA 4ZDOA 5GADJ 1XX5A 3IAM2 1EH7A 2AXLA 4HZFA 2EK5A 4HX7A 4XSXF 3ZXSA 4BBSJ 1TQMA 2K86A 3S3NA 2Z5UA 2E71A 5FD5A 2UZKA 1E3PA 1RKWA 1O3TA 3OOPA 3ZCOA 2HTSA 1E3HA 2K9QA 2ZO4A 3HUGB 4XN0A 3OOUA 5FD6A 1HW5A 3OR1C 3CCVI 1J2XA 1OPCA 2V6EA 2FQ4A 2W57A 3VYRB 1ZRDA 2P6SA 3RSNA 1FY7A 1Y8QB 1MNDA 5KK1A 1R1UA 1P4AA 1X2MA 1H9TA 2EFPA 4BACA 4ESFA 1MBHA 4HEA2 2EBIA 2FBIA 3DF8A 4A3LJ 4PUSA 4BJ5C 1VQ4I 2ADUA 1R1TA 1W36C 2NRAC 4F93B 1LEAA 1HW2A 4F52A 3T0YA 1TQPA 3OYBA 4BE2A 2PBIA 4LK0F 2TCTA 1TBXA 3OYFA 2VQGA 2HPMA 4FASD 4OWRB 1LVKA 1DDNA 2MH2A 2X48A 1X19A 1X3ZB 2DFHA 4A3GJ 1HA8A 1YS7A 1YJ9I 2GWRA 4Q48A 1RZ4A 1D3YA 1U2WA 4ZYAA 2ZB9A 2L7KA 2JA5J 4JBAA 4IVNA 2K9SA 1R71A 2LKSA 5TISC 1D8JA 3PFIA 1JJ8C 2R7WA 2ELJA 3I59A 3HBLA 1KU9A 3M7GA 1G2HA 5HDKA 3HHGA 2VI6A 1OYWA 3PO2J 4DBQA 4M3GA 3VYTB 3U1KA 2LSOA 2QSGX 2BEOA 2L7FP 4XOPA 1BI0A 2CW8A 3HOYJ 1IXCA 3LSIA 4N9HA 2E60A 4NQWA 5D5XB 2JUCA 2RAEA 3OL4A 2DPUA 3DLLF 4R1HA 1NG7A 2VLAA 3TW6A 1YYVA 1H88C 3OYDA 2QKLB 2LLKA 3QP5A 1JUPA 1XD7A 2MD5A 3P9IA 1ETVA 4MNUA 3J80Z 1ORKA 1VQMI 1R49A 4BQAA 2V1NA 1MSFC 4PJJA 2AO9A 1NK2P 4P96A 2F5DA 1MBKA 4B48A 3S1QJ 3IWFA 3B6AA 2NS7A 5HODA 1RC9A 3TEDA 1IN4A 4UY8I 3FXUA 1ZTRA 2VQLA 5CLSA 2CQQA 2VKDA 4NDLA 1Z91A 3OIOA 4ENJA 1B72B 1MMNA 4C3JJ 3GYHX 3DTIA 3CMYA 2IS6A 1JKRC 2DOAA 3AG1H 3WTVC 2JTVA 1YW8A 4MQVA 3WTWC 1Q1VA 1XDUA 4AIKA 2PLYA 4R8HA 5DD4A 3S14J 2XAHA 1K79A 2PMZN 2XGEA 2HVSA 1IN6A 2VPRA 3BR5A 2VJ4A 2JVGA 1YIOA 1I6XA 4H4KC 3LSJA 1Y1WJ 1HDDC 2ZCWA 3H5AA 3K9TA 1R22A 2E7XA 4L9NA 2VQHA 2E5ZA 1P7IA 2PG4A 2YR2A 3QAHA 4GGGA 3BZKA 4KJZA 3MN2A 2BGCA 4PJLA 4I02A 4XOTA 1RIOH 5GAEJ 2ECBA 3P9CA 5L3BA 4M73A 2K3PA 1WFXA 5E20A 5A2QZ 3TKYA 2FBKA 4L0ZB 2Z33A 3CC4I 1WQ2A 3E5XA 1H8AC 1XG1A 3ECOA 1FYKA 2AXTC 2CO5A 4A3EJ 3MKYB 3SDGA 3VOEA 4B47A 3QODA 3QYBA 5H6QA 4I2OA 1ZG5A 3OYHA 3GTKJ 2XROA 2HZTA 3R0AA 1UZCA 3ZRGA 1W7PD 1V54H 4S04A 2XSDC 2E5NA 5F04A 2CV0A 3OV8A 2PQ8A 2H6CA 3CCQI 3IP4B 3JRFA 4Q47A 1MSEC 3FXKA 2DPDA 2EPFA 5LRSA 2DTRA 2ME6A 2DMNA 3DQVC 2LFBA 3KPHA 1EA3A 2M8EA 1K6YA 2GXGA 2NAZA 2GLOA 2PMHA 3W2AA 4RAFA 2L9RA 2E19A 1SD5A 1ACIA 4EJVA 2WAQA 4E7JA 4RB0A 1MW7A 3HOVJ 4IF4A 3MCZA 4AIDA 3J81K 3I64A 4M6YA 1B9MA 3W6JB 4E7LA 3PNVA 2J5PA 1RUOA 1KU7A 1I27A 2OU2A 4M9ZA 2Z99A 5E1WA 1GLNA 4C2MJ 1X3UA 3BG7A 5FKOA 3ULQB 2VIXA 4MFDA 2A05A 3EUHC 3IKVA 3BCBA 5EZHA 1IXSB 1GV5A 3S8PA 5DV5A 2EFWA 3C7JA 3IAS2 4WXCA 1IGNA 5FO5A 4UNOA 2HDCA 3BR0A 4IXAA 3DU6A 4GYGA 1G3YA 2BZTA 4OMYA 2L4AA 2XF6A 2IPQX 2B0LA 5DD8A 3QPHA 3JR9A 3H3ZA 4CCLA 1YO5C 3HOZJ 4JX4A 1XGSA 1EKEA 5AIQA 3T1BA 3Q5FA 1XDSA 3BG9A 1W0TA 3F3XA 1I1SA 4D7MA 5DUIA 2DU9A 2DA2A 3H5NA 2MLKA 2VC1A 3ZQQA 2VT2A 3H0DA 3L2RA 2O0YA 1KQ0A 5FRMA 2K5CA 5BPDA 1F4KA 1UELB 2DA3A 3CUQA 1LFUP 2KRCA 3DTKA 1SFUA 1XCBA 4XLAA 3V7CA 2ID3A 1YW7A 3LSMA 3PM1A 4KUMA 2KDZA 3FK7A 5D4SA 2LKPA 2X4HA 4KN7X 5HDNA 2GZWA 1WJBA 2LH9A 2PI0A 3GFMA 1KU2A 4IL6C 1POGA 2HR3A 4LB6B 2PMZA 3R61A 2QQ9A 4V19K 2COBA 1FLIA 1TNTA 1X4PA 3MZ8A 2RVCA 3TGNA 3B73A 2FF4A 3QU3A 4CZZA 3Q9VA 1U9NA 5J40A 3S15J 1QVTA 1WJDA 4XLCA 1JHFA 5B66C 4CHUA 2N8GA 5M3MJ 5BOXA 2X6OA 2FOWA 1TWGJ 1IJWC 3SZPA 2A6EF 2CJJA 5BS6A 2HGCA 1OYIA 1J9IA 1PP7U 1JUSA 3BR3A 2KHMA 1MBJA 1WJEA 2Z3YA 1XGNA 2M0CA 9ANTA 4AC0A 3KFWX 3K4CA 1DGRM 5J6XA 4B8XA 4XR6A 2ECCA 1TZLA 5LFAA 2NVYJ 1D1BA 4XKCA 1O3QA 2VBXA 4NHJA 3CLOA 3IV5A 3GZ6A 3RCOA 3IUOA 4BU2A 3OR2C 3OYKA 5B1AH 3IRRA 5B5EC 5E3OA 2DJIA 2Z1DA 2M8GX 2FJ1A 3P5JA 2KRHA 1U0JA 2W84A 3OIQA 4PZJA 1YTYA 2E35A 2V1XA 1DUXC 4LG3A 3OIPA 4A3CJ 5DYMA 4CGZA 2Y69H 3HL2A 2FX0A 2LC2A 4YIIA 3BJOA 2LY2A 3WU1B 3WODF 3ESWB 4N0BA 4CCMA 3FXLA 3K4JA 4I01A 2DFFA 2PX9A 1NG6A 3ML6A 3F8NA 1I1GA 5ED4A 2DI3A 1YX3A 1W4MA 1FOXA 2O03A 2WTEA 2XAGA 2O6GE 2QBYB 2HNHA 2A5WA 4BXUA 5IT9Z 4AYBA 2VJJA 1ZLKA 2AHQA 2L54A 3H3UA 3Q0WA 1WWXA 3OS0A 2F5EA 3K0LA 4NUBA 3WGIA 3F6OA 3QOPA 3HPGA 3K6GA 5KHDA 4ZZDA 4ZC3A 1G4DA 2CQXA 2EILH 3ABTA 5GTHC 1UCRA 3LSTA 3HG9A 5E3MA 4PGGA 5D8LB 3DV8A 2EIMH 2V26A 1YI2I 3GBGA 4YFKF 4L18B 2F2EA 4DYCA 1BC8C 2XGCA 1S6LA 1BI3A 2JVHA 3ECHA 1ZYRF 2FE3A 2K7LA 3M1CA 2K4JA 1MJBA 3AG2H 2LRDA 4IRGA 4EM1A 1VQ9I 4PGHA 3SYTA 5JR3A 3ZMZA 3J7AY 1BR1A 1TC3C 1LQ1A 5E8GA 4KISA 2HVQA 1GVJA 3G2BA 3KYLA 2EJRA 2QQAA 2WV0A 3DEUA 2A6HF 1KQ9A 1SFEA 2EIJH 4IQ4A 1KZHA 1R4NB 4CSWA 2HU9A 2OCEA 5C4JJ 4IRIA 1JTXA 4JOMA 1U78A 4LLLA 4IOAF 4CZCA 2R7XA 3A03A 2VC0A 3H1CA 1QA6A 3QOEA 4P1WA 3TOAA 3FKJA 2HDDA 2O7OA 3WGGA 2WADA 3HIFA 5BQTA 2ZXHA 3K4KA 1R4MB 1A04A 2DLLA 2H8WA 4NC6A 2XAQA 2R7RA 4YEJA 3S1MJ 2QEXI 3SJMA 2ELHA 3BQZA 2Y31A 3G1LA 4B1RA 3OYLA 4CYCA 4EJWA 2L4MA 3WTSC 5JI6A 4I99C 2ZFWA 2DT7B 3G1MA 2NVQJ 1HC8A 2Y9YA 3PQKA 4FX0A 2CV2A 1ODDA 5IYDJ 1DPUA 4BHCA 2QYOA 3CJTB 1XSXA 3Q0UA 1ZLJA 2NOGA 4L9VA 2HKOA 2OBPA 3TDUC 2ZSHB 4HLYA 5ICGA 3FZVA 4KIGA 2H27A 2PJRA 1I39A 1J75A 3GTGJ 3V4GA 2R93J 1AOYA 1TWAJ 2GQQA 1K7AA 2L2OA 1NH3A 4BHBA 3OS2A 2L5QA 2LY1A 1BR2A 4A2UA 2RN7A 2M4GA 2F4IA 4HA8A 3V42A 4B3AA 2L7ZA 2RKHA 5EG0B 2CFXA 2OAZA 5DM6F 4FCYA 4W1UA 4RGRA 2H09A 4M9SA 1H89C 2M2EA 1XS9A 3RI4A 2CRGA 3V7RA 1XTAA 4HV6A 4PFOA 3KYDB 1YFHA 4BXXJ 5H20A 1T8IA 2FXAA 2NNYA 1FTTA 2Q2EB 2HXIA 3DKYA 2JQ7A 4XLEA 1MMAA 2EA4A 2AS5F 2E1CA 4IHXA 3KP6A 4A3IJ 3I0TA 2E2JJ 1LJ9A 3F72A 3H9JA 4ZDLA 3S3MA 3OWTA 2FEZA 2KP6A 4G8XA 4OIPF 1IN7A 3OL3A 2F6CA 3F21A 4RDUA 1ZHFA 1T39A 1VQ8I 1HDPA 3PO3J 1SMYF 1W36D 4LMYA 5LLQA 1T33A 2ZSIB 4MLOA 3I55I 4ZYHA 3HTSB 3GW2A 3VSKA 3DFGA 2V9PA 3EUAA 2L9NA 5JLXA 5CQEA 1JT0A 1IN5A 4XNFA 3LWFA 5FJ8J 3GZNB 4A12A 1G6NA 3A02A 1Z3XA 1ENHA 1HW1A 2X0LA 2ZXWH 4UHTA 2NVXJ 3HOUJ 5CVIA 3UKGA 2KKOA 5KAIC 4YIRX 2FNPA 5ICFA 1ETKA 3DPUA 3G1OA 2ETHA 1LKXA 4RGXA 3D5SC 4BDYA 2L9VA 2W24A 2ISZA 2KIFA 4IPAA 2PJPA 3P7NA 1J59A 2MLGA 5GPAA 4IEJA 3WTZA 3I9V2 3BCAA 2FMLA 2XF5A 1JGSA 1KONA 5JHFA 1D0XA 1IDZA 1ERDA 2X1CA 2RDPA 2JPCA 3S2WA 1A31A 1SD6A 3MFKA 2R5ZA 3L2QA 3CZ6A 4ZDPA 1JKOC 3S16J 1AU7A 3TMOA 2HI3A 2HOAA 4HOBA 3MKWB 1O3SA 2IW5A 1QZEA 5EF6A 3N97A 1PDNC 1SFKA 4PCQA 4HYEA 2IGKA 4JYKA 4KN4X 5FKLA 4HX8A 1T2KA 4PSWA 3S93A 1MNEA 2KJCA 3SXYA 4UB6C 3HM5A 2VOPA 1VQLI 3JREA 4M3DA 3I58A 2DQRA 4UVAA 1FIAA 3RPQA 1L0OC 3LFUA 1QPMA 2XAUA 3ZP5A 5ILUA 1GHCA 1XSDA 2VOOA 3HKZN 3QYEA 1WJAA 3JW4A 3B02A 2KZGA 1YIJI 1FT9A 1OMIA 2F4OB 4G6TB 1WJ5A 4HSRA 2ZMEA 3DKWA 2XF7A 2V9KA 2R7VA 4HBLA 1ZRFA 2YS9A 5GAHJ 3VODA 3TO7A 3KLNA 2VBZA 1SAXA 2ISYA 5IP7J 4YRVA 1FPQA 4HF1A 5DCMB 5E1ZB 3FWEA 3QU6A 1T56A 5IPAA 4Y15A 3CO6C 3NAUA 1ETXA 3D1NI 1KYWA 5J8FA 2K3FA 2VE8A 1JGGA 2P5LC 1ZQ3P 4B44A 5CKTA 4EATA 3SEZA 4CYDA 2BW3A 4FETA 1B8IA 2HS5A 2EFNA 4E7ZA 4WCGA 2VBWA 5B1BH 3RQIA 1LPQA 4E70A 3BROA 3WU0A 4C2TA 1Y56A 2FMYA 2ELKA 2G7HA 3DPLC 2CWEA 3F6VA 4F55A 4ZTJA 1TNSA 3T8RA 2LR8A 1R36A 1YE9A 3EDPA 2GIZA 3DTEA 3QYFA 4JQFA 5EJCA 3VEPA 4IO9F 1WZ2A 3CC2I 2HYGD 1NHAA 1S8NA 1WH5A 3ZOBA 1MD0A 3CDIA 2JA6J 2GXAA 2JT1A 3J7AO 4U0VA
chains in the Genus database with same CATH topology
1EH6A 4L0YB 4G6DA 4KFCA 5HS7A 4QLCU 3ERED 4EJUA 2MH9A 5HS9A 5ILVA 4KDPA 1U5TA 1P92A 3E97A 3TQNA 3R60A 4IHSA 1ZGAA 3RTRA 3WE2A 4M72A 3RPUA 5ERIA 3SFZA 1ON2A 5L3GA 1MKMA 1W5TA 3WGHA 3ZMSA 4AIJA 3KP3A 3SHFA 1FOKA 1MDMA 4EQQA 1KU3A 4BHPA 4YFXF 4ENMA 5HLIA 1U5TC 2D1VA 2GA1A 2P6TA 2MC3A 4MEYF 3F22A 2CYYA 5JFRA 4ZH4F 2RC4A 3I5UA 1KQ8A 3M9AA 4ZZLA 1T6SA 2Q0OA 4ETSA 5LGUA 1L3LA 4HQEA 2XKPA 2ZXJA 1XCVA 3HRUA 3I4PA 1WSUA 3GF2A 1FBQA 3I71A 1R58A 1BIBA 2L3DA 1BI2A 2HFHA 1G3WA 3NQOA 5DCFA 4GCVA 3F8BA 2COMA 1SD7A 4ZYGA 2GIVA 2XRNA 4U7DA 4M6XA 3BDDA 1F5TA 2BYVE 2V1UA 4LJZF 4YFNF 1STZA 2NS0A 4AVPA 3FXQA 4UUVA 1BI1A 1REPC 2R3SA 3O6BB 2HOEA 1K6OA 2FA5A 4KMFA 3GWZA 3IC7A 5K5QA 2DW4A 3ZQ7A 4DQ2A 2FNAA 3JSOA 3I54A 1KGSA 3FMSA 5CVRA 1BOAA 1HKSA 1CF7A 4BYYA 4MGRA 5D6FA 4UVCA 3HSEA 3CJNA 5L3CA 3G73A 4O5VA 2Q8KA 4KICA 2FSWA 3E6MA 1B59A 1ZGJA 4EMSA 4WWCA 4OU0A 1VTNC 4A0ZA 1ZN2A 3M1EA 2E1NA 2A68F 4GO1A 5FGMA 3FM3A 3KCCA 2M45A 4RAZA 2HWVA 3F8FA 5IT3A 3CTAA 2V6CA 5F64A 4EM0B 2P7VB 1G3TA 2LF7A 1R7JA 5D5UB 2XAFA 1WI9A 3TOBA 5LGTA 2VXZA 3COAC 4EGYA 1FNNA 3E6BA 2OQGA 1LNWA 1S29A 2EA2A 2RV8A 4EVIA 2DT5A 1T0FA 5ILSA 3IWZA 2DO7A 2F5CA 2NYXA 3SQNA 4ZYEA 4G94A 4I0AA 2P5KA 3J81Z 4NB5A 4I0BA 3GFIA 3WG9A 2PMUA 4MTEA 4UXNA 5E17F 2YX7A 1FYLA 1KYZA 4KT5C 1IRGA 5FFXA 2QQBA 3WTUC 5J8CA 6PAXA 1ULYA 2K27A 3R4KA 2VBYA 1P6RA 3ZMUA 4I98B 4EGZA 1G3SA 3N4MA 2BBYA 2VE9A 4M9XA 2L01A 4P55A 4ENKA 2R7DA 2YU3A 1TLHB 1FSEA 2KIMA 4WX9A 2RGVA 1WRJA 1Z05A 3JAMZ 2VONA 4G6QA 1BJAA 2RQPA 2KIUA 3HUGA 3ZMTA 2V1DA 3IHUA 5HLHA 3FHZA 3EETA 1PP8F 2VODA 1RI7A 1K78B 3KEQA 4Q4ZF 4S05A 2EV6A 1P4WA 5DCMA 5LHGA 1AWCA 1BN5A 1J7KA 2IRFG 1O57A 3HHHA 5FB2A 4KIBA 5LBQA 4XRFA 2QZ8A 3JSPA 1XGOA 2NNNA 2XASA 2OQRA 4M74A 1LB2A 3BOQA 4Z2YA 1XGMA 3BZ6A 1D8KA 2XVCA 1ZG1A 2G7UA 2QM3A 3MAJA 4OIRF 1Y0UA 2ZBKA 2HYFA 4M71A 2QLZA 1ZREA 4U0YA 5CVVA 3M8EA 3P9KA 5LEJA 3T5XA 2XGXA 3KP2A 3BPXA 3QP6A 2LF8A 1YS6A 4Q5SF 5D4RA 1MGTA 1EV7A 2V79A 2P8TA 4OINF 2C6YA 1FBUA 1IF1A 4UVBA 2IVMA 3FF5A 1USSA 2FOKA 1DP7P 4PDKA 3E5UA 5A2QK 2DK8A 2HQRA 3F8CA 1P2FA 1Q1HA 1Z6TA 1Z6RA 2JRTA 2HKXA 3KZZA 2HTJA 5EEHA 2CQKA 1HQCA 3EUHA 3LFKA 1GXPA 1IAWA 2QVOA 4ZYDA 3LQQA 2Y0MA 3CO7C 2JSCA 2PEXA 1HKTA 4ENNA 2HEOA 2TDXA 1U5TB 2DK5A 2J5OA 1RNLA 1XB4A 1WKMA 2L02A 1SD4A 4A0XA 2H6BA 1UFMA 3JTHA 1QBJA 3KETA 4G9YA 1FYMA 3HSRA 1ZRCA 5D5VB 4G7ZF 3FXRA 4MHGA 1FP1D 3MZYA 3GFLA 1V3FA 2H94A 2ZNZA 1RUNA 2K02A 3KEOA 1ZH5A 4WXHA 3NEUA 3GXOA 3HRTA 2OA4A 4L5JA 1O7LA 5D5WB 3L00A 1W7PB 3RKXA 4Y17A 5HVQC 4ESJA 3HTUA 4XBFA 3PQJA 5AONA 3ABUA 2P4WA 2QUFA 1LDDA 4P9UA 5TJJA 1QGPA 1ZG3A 2ZNYA 4K2EA 4R79A 1MJ9A 3V8KA 3RKYA 2LNBA 4MQ9F 1OR7A 1PUEE 3KP5A 2D2WA 1J5YA 2VN2A 2K4BA 3FX3A 5E18F 1MDMB 4RB3C 4YG2F 5FLXZ 5JHUA 2F5FA 3RKWA 1XN7A 3KP7A 4O3MA 2DFIA 1E2XA 2DAOA 1R23A 1R5GA 3VFZA 4WXDA 3ZMDA 4WF2A 4KA4A 2BV6A 4H0EA 1B1BA 1USTA 3GVAA 1BM9A 1JXSA 1JHHA 3BPVA 4XLNF 4Y13A 3M8FA 1K78A 2V9VA 4F7ZA 1YW9A 1LDKB 4U0WA 5F6FA 3F23A 4TV7A 4G7OF 3CUQC 1DPRA 1S7OA 4IHTA 4IRHA 4QWQA 3NRVA 5HOOA 1I5ZA 2A07F 1E17A 4A5NA 2RNJA 5CYVA 4I09A 3K1PA 2O61A 1U3EM 1TQIA 4U7BA 2G9WA 3Q9SA 2A3SA 1XSVA 1J0RA 2R7FA 2UXXA 3GLXA 4L9TA 3GEZA 3O2PE 1TW2A 3FMRA 2Q2EA 1CF7B 4LG0B 3BJAA 4BH9A 5CJ9A 4LK1F 1S3JA 3JAMK 3TO6A 2FBHA 1H9GA 4CO8A 3H92A 4BNCA 3L9FA 4KIFA 2QENA 5EEGA 3ZN0A 1EH8A 3V7SA 2EWNA 3WTXC 5D6EA 2STWA 2W25A 4ASNA 1F1ZA 1LVAA 3G3ZA 2P7CB 1FSHA 2YX4A 3J80K 5DUKA 1T98A 2GXBA 4KNYA 3DPTA 3RYRA 5HLGA 3I59B 4MTDA 3I53A 4D0PA 2CG4A 2DBBA 3K69A 2A69F 2XAJA 3BJ6A 3FMQA 4OIQF 4RS8A 2GA2A 3HYIA 1OYYA 2M5WA 3GX4X 1HSTA 1FP2A 1MJAA 3K1NA 2UXNA 3GZ5A 3RJPA 1D5VA 2IP2A 2VT3A 4WK8F 2XIGA 1FZPB 1T38A 1IN8A 3SZTA 3C3WA 5LRRA 1LEBA 4UV8A 2IA1A 4EJOA 5L3DA 4YIFA 2QBYA 1JE8A 5IT9K 5BPIA 2IT0A 2EFOA 3IKTA 2FQ3A 1YLFA 5FLXK 3O3KA 3IRQA 3QPTA 3VB2A 2IJLA 4HDVA 1BC7C 3ZN1A 1QO0D 2Y48A 5D8KB 5LHHA 3KP4A 3V8LA 3EYYA 3BWGA 5K5RA 1Z9CA 1ON1A 2M1BA 4ESBA 5JVTA 2W85A 3LA7A 1XMAA 2EV0A 3DXJF 4HQMA 2YPRA 4AWXB 5E1XA 4EM2A 3IL2A 4U88A 2O3FA 1IUYA 2OD5A 3AAFA 1KA8A 2CW0F 2D45A 3LAPA 3L2CA 3W6KB 1LDJA 2ESNA 2A5YB 4LFUA 3WE3A 3ROUA 1QQIA 3L09A 5TRDA 3HOTA 4LLNA 4FHTA 4HW0A 3V8JA 5ICEA 2JPBA 4AIHA 3D0SA 1FC3A 1Z1DA 3U2RA 1U8RA 4JK1X 2YSRA 3R6SA 1O3RA 3ISPA 4P5OA 3CDHA 3E6CC 2Z9OA 3HOSA 5L3FA 5H6RA 1H0MA 1B4AA 5FFZA 2Y75A 1O7FA 4XLPF 3RDIA 4O6JA 2ZKZA 2M30A 3KE2A 1IW7F 4LGWA 3F8MA 4L5IA 3K1MA 1ZAOA 1XMKA 1W5SA 3C1DA 4LG0A 2M87A 2STTA 2PFBA 3HRMA 1UB9A 5HS8A 1OKRA 3CUOA 4P9FA 1BIAA 2WC2A 1FBSA 3K2ZA 1IRFA 1TTYA 3WTTC 4HX4A 1IXRC 4CXFA 4A5MA 2OZUA 4HAMA 1HBXG 4OOIA 3TO9A 2IA0A 5HDGA 4HF0A 4LD5A 4HDUA 3KLOA 3R0JA 3BY6A 4UV9A 3LAJA 2XV4S 5ICCA 4FT8A 3QRFF 1SMTA 5DDGA 2KRFA 1GXQA 3E6DA 1BBYA 3U1DA 1HKQA 4A0YA 2LDUA 1F9NA 3C18A 1FWZA 4KYWA 1R1VA 5AIPA 4OMZA 4EV0A 1P4XA 3MZHA 2GAUA 1FX7A 2E7WA 4GYIA 2EV5A 1YQAA 3REOA 4XSZF 4RB2C 5LHIA 4GXOA 3D5LA 2ZMEB 4HV5A 1B9NA 2DQLA 3E5QA 4A6EA 4RB1A 1R00A 1R5HA 3L7WA 1UHWA 4DNCA 1QNTA 2PN6A 1QZZA 2XKOA 4FX4A 1B6AA 2ACJA 4HF2A 4RAYA 5K1YA 4LB5A 2ESHA 4CICA 3CUQB 3JTGA 2BE5F 2OZ6A 3EYIA 4L9JA 4HLXA 5KVRA 2FU4A 2IA2A 3KZYA 2WWYA 4RGSA 2O8XA 2KJBA 5L3EA 3MQ0A 3HRSA 4LLGF 3FM5A 3HSFA 5K5OA 2A61A 1U6GA 2QWWA 5BMZA 2FRHA 4AD9A 2MBFA 3DP7A 1C0WA 1SFXA 3RIRA 2P5VA 3ZPLA 1MZBA 3T8TA 5CVJA 4A6DA 1IZ1A 1HXDA 4MEXF 3E3VA 3LA2A 3TDZC 3MWMA 2XHKA 2JZYA 2UWMA 2CGPA 4G7HF 3ZMVA 3GFJA 1TW3A 2XUBA 4EJTA 1Z7UA 3BP8A 3LA3A 4RGUA 1YG2A 3WTYC 2MA3A 4B09A 2EFQA 2CSOA 1UHMA 4BAYA 4N9IA 1QZYA 1V4RA 2HQNA 4OIOF 4IJAA 3MEXA 2ZJ2A 3RYPA 4ON0A 3EQLF 1CGPA 5CVUA 1S7AA 1ZARA 2D1HA 2EB7A 5E8IA 3ELKA 3U9GA 1W7PA 1HSJA 4KMUX 5LEKA 5F1RA 3GUDA 1ONVA 4I7HA 3LQRA 5LGNA 3GO5A 5DEQA 1EH7A 2AXLA 4HZFA 2EK5A 4HX7A 4XSXF 1TQMA 2K86A 2Z5UA 5FD5A 2UZKA 1O3TA 3OOPA 2HTSA 2ZO4A 5FD6A 1HW5A 1J2XA 1OPCA 2W57A 1ZRDA 2P6SA 1FY7A 5KK1A 1R1UA 1P4AA 1H9TA 2EFPA 4ESFA 2FBIA 3DF8A 2ADUA 1R1TA 2NRAC 1HW2A 1LEAA 3T0YA 1TQPA 2PBIA 4LK0F 1TBXA 1DDNA 2MH2A 1YS7A 2GWRA 4Q48A 1RZ4A 1D3YA 1U2WA 4JBAA 4IVNA 1D8JA 3PFIA 3I59A 1KU9A 3M7GA 5HDKA 3HHGA 1OYWA 2LSOA 2BEOA 1BI0A 1IXCA 4N9HA 4NQWA 5D5XB 2DPUA 4R1HA 1YYVA 3QP5A 1XD7A 2MD5A 3P9IA 4MNUA 3J80Z 4BQAA 4P96A 2F5DA 3IWFA 1IN4A 3FXUA 5CLSA 1Z91A 4ENJA 3GYHX 3WTVC 2JTVA 1YW8A 4MQVA 3WTWC 2PLYA 1XDUA 4AIKA 4R8HA 5DD4A 2XAHA 1K79A 1IN6A 1YIOA 1I6XA 2ZCWA 3K9TA 1R22A 2E7XA 4L9NA 2PG4A 2YR2A 3QAHA 4GGGA 2BGCA 4I02A 1RIOH 3P9CA 5L3BA 4M73A 5E20A 5A2QZ 3TKYA 2FBKA 4L0ZB 2Z33A 1WQ2A 3E5XA 3ECOA 1FYKA 2CO5A 3VOEA 5H6QA 4I2OA 1ZG5A 2XROA 2HZTA 3R0AA 1W7PD 4S04A 3OV8A 2PQ8A 2H6CA 4Q47A 2DPDA 5LRSA 2DTRA 3DQVC 2M8EA 2GXGA 2NAZA 2PMHA 1SD5A 4EJVA 4RB0A 4IF4A 3MCZA 3J81K 3I64A 4M6YA 1B9MA 3W6JB 2J5PA 1RUOA 1KU7A 1I27A 2OU2A 4M9ZA 2Z99A 5E1WA 1X3UA 3ULQB 3IKVA 1IXSB 2EFWA 5DV5A 3C7JA 4WXCA 5FO5A 4UNOA 2HDCA 4IXAA 4GYGA 1G3YA 4OMYA 2L4AA 2IPQX 2B0LA 5DD8A 3QPHA 3H3ZA 1YO5C 1XGSA 5AIQA 3T1BA 3Q5FA 1XDSA 3F3XA 1I1SA 5DUIA 2DU9A 2MLKA 2VC1A 2VT2A 2O0YA 1KQ0A 5BPDA 1F4KA 3CUQA 1SFUA 1XCBA 3V7CA 1YW7A 4KUMA 5D4SA 2LKPA 2X4HA 4KN7X 5HDNA 2GZWA 2PI0A 3GFMA 1KU2A 2HR3A 4LB6B 3R61A 2QQ9A 1FLIA 1TNTA 2RVCA 3TGNA 3B73A 2FF4A 3QU3A 4CZZA 3Q9VA 1JHFA 4CHUA 5BOXA 3SZPA 2A6EF 5BS6A 2HGCA 1OYIA 1J9IA 1PP7U 2Z3YA 1XGNA 3KFWX 5J6XA 4B8XA 1O3QA 2VBXA 4NHJA 3CLOA 3GZ6A 3IRRA 2W84A 4PZJA 1YTYA 2V1XA 1DUXC 5DYMA 4CGZA 4YIIA 3BJOA 3WU1B 3WODF 4N0BA 4I01A 3ML6A 3F8NA 1I1GA 5ED4A 2DI3A 1W4MA 2O03A 2WTEA 2XAGA 2O6GE 2QBYB 5IT9Z 4BXUA 1ZLKA 2L54A 3H3UA 1WWXA 2F5EA 3K0LA 3WGIA 3F6OA 3QOPA 4ZZDA 1G4DA 3ABTA 1UCRA 3LSTA 4PGGA 5D8LB 3DV8A 4YFKF 4L18B 2F2EA 1BC8C 1S6LA 1BI3A 3ECHA 1ZYRF 2FE3A 2K7LA 2K4JA 1MJBA 4IRGA 4EM1A 4PGHA 5JR3A 3ZMZA 1LQ1A 5E8GA 1GVJA 2EJRA 2QQAA 2WV0A 3DEUA 2A6HF 1KQ9A 1SFEA 4IRIA 1U78A 4LLLA 2VC0A 3TOAA 3WGGA 3HIFA 5BQTA 1A04A 2DLLA 2XAQA 2ELHA 4EJWA 2L4MA 3WTSC 5JI6A 2ZFWA 3PQKA 4FX0A 1ODDA 1DPUA 4BHCA 2QYOA 1XSXA 1ZLJA 4L9VA 3TDUC 2HKOA 2OBPA 4HLYA 2H27A 5ICGA 3FZVA 4KIGA 1J75A 3V4GA 1AOYA 2GQQA 1K7AA 4BHBA 4A2UA 2RN7A 4HA8A 2RKHA 2CFXA 2OAZA 4RGRA 2H09A 4M9SA 3RI4A 3V7RA 4HV6A 1YFHA 5H20A 2FXAA 2NNYA 2AS5F 2EA4A 2E1CA 3KP6A 3I0TA 1LJ9A 3F72A 2FEZA 4G8XA 4OIPF 1IN7A 3F21A 1ZHFA 1T39A 1SMYF 4LMYA 5LLQA 4ZYHA 3HTSB 3GW2A 3DFGA 1IN5A 3LWFA 4A12A 1G6NA 1HW1A 2X0LA 4UHTA 5CVIA 2KKOA 2FNPA 5ICFA 4RGXA 2ETHA 2W24A 2ISZA 2KIFA 4IPAA 2PJPA 3P7NA 1J59A 2MLGA 3WTZA 2FMLA 1JGSA 2RDPA 2JPCA 3S2WA 1SD6A 3MFKA 4HOBA 1O3SA 2IW5A 3N97A 1PDNC 4PCQA 4HYEA 4KN4X 4HX8A 1T2KA 2KJCA 3SXYA 2VOPA 3I58A 2DQRA 4UVAA 3RPQA 1L0OC 1QPMA 3ZP5A 5ILUA 1GHCA 1XSDA 2VOOA 3JW4A 3B02A 1FT9A 1OMIA 2ZMEA 3DKWA 4HBLA 1ZRFA 3VODA 3TO7A 3KLNA 2VBZA 1SAXA 2ISYA 1FPQA 4HF1A 5DCMB 5E1ZB 3FWEA 3QU6A 4Y15A 3CO6C 1KYWA 5J8FA 2VE8A 2P5LC 4CYDA 2HS5A 2EFNA 4WCGA 2VBWA 4E70A 3BROA 3WU0A 2FMYA 2G7HA 3DPLC 2CWEA 3F6VA 1TNSA 3T8RA 4CDGA 1R36A 3VEPA 3EDPA 4JQFA 2HYGD 1NHAA 1S8NA 1MD0A 2JT1A 3J7AO 4U0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH6 A;  4L0Y B;  4G6D A;  4KFC A;  5HS7 A;  4QLC U;  3ERE D;  4EJU A;  2MH9 A;  5HS9 A;  5ILV A;  4KDP A;  1U5T A;  1P92 A;  3E97 A;  3TQN A;  3R60 A;  4IHS A;  1ZGA A;  3RTR A;  3WE2 A;  4M72 A;  3RPU A;  5ERI A;  3SFZ A;  1ON2 A;  5L3G A;  1MKM A;  1W5T A;  3WGH A;  3ZMS A;  4AIJ A;  3KP3 A;  3SHF A;  1FOK A;  1MDM A;  4EQQ A;  1KU3 A;  4BHP A;  4YFX F;  4ENM A;  5HLI A;  1U5T C;  2D1V A;  2GA1 A;  2P6T A;  2MC3 A;  4MEY F;  3F22 A;  2CYY A;  5JFR A;  4ZH4 F;  2RC4 A;  3I5U A;  1KQ8 A;  3M9A A;  4ZZL A;  1T6S A;  2Q0O A;  4ETS A;  5LGU A;  1L3L A;  4HQE A;  2XKP A;  2ZXJ A;  1XCV A;  3HRU A;  3I4P A;  1WSU A;  3GF2 A;  1FBQ A;  3I71 A;  1R58 A;  1BIB A;  2L3D A;  1BI2 A;  2HFH A;  1G3W A;  3NQO A;  5DCF A;  4GCV A;  3F8B A;  2COM A;  1SD7 A;  4ZYG A;  2GIV A;  2XRN A;  4U7D A;  4M6X A;  3BDD A;  1F5T A;  2BYV E;  2V1U A;  4LJZ F;  4YFN F;  1STZ A;  2NS0 A;  4AVP A;  3FXQ A;  4UUV A;  1BI1 A;  1REP C;  2R3S A;  3O6B B;  2HOE A;  1K6O A;  2FA5 A;  4KMF A;  3GWZ A;  3IC7 A;  5K5Q A;  2DW4 A;  3ZQ7 A;  4DQ2 A;  2FNA A;  3JSO A;  3I54 A;  1KGS A;  3FMS A;  5CVR A;  1BOA A;  1HKS A;  1CF7 A;  4BYY A;  4MGR A;  5D6F A;  4UVC A;  3HSE A;  3CJN A;  5L3C A;  3G73 A;  4O5V A;  2Q8K A;  4KIC A;  2FSW A;  3E6M A;  1B59 A;  1ZGJ A;  4EMS A;  4WWC A;  4OU0 A;  1VTN C;  4A0Z A;  1ZN2 A;  3M1E A;  2E1N A;  2A68 F;  4GO1 A;  5FGM A;  3FM3 A;  3KCC A;  2M45 A;  4RAZ A;  2HWV A;  3F8F A;  5IT3 A;  3CTA A;  2V6C A;  5F64 A;  4EM0 B;  2P7V B;  1G3T A;  2LF7 A;  1R7J A;  5D5U B;  2XAF A;  1WI9 A;  3TOB A;  5LGT A;  2VXZ A;  3COA C;  4EGY A;  1FNN A;  3E6B A;  2OQG A;  1LNW A;  1S29 A;  2EA2 A;  2RV8 A;  4EVI A;  2DT5 A;  1T0F A;  5ILS A;  3IWZ A;  2DO7 A;  2F5C A;  2NYX A;  3SQN A;  4ZYE A;  4G94 A;  4I0A A;  2P5K A;  3J81 Z;  4NB5 A;  4I0B A;  3GFI A;  3WG9 A;  2PMU A;  4MTE A;  4UXN A;  5E17 F;  2YX7 A;  1FYL A;  1KYZ A;  4KT5 C;  1IRG A;  5FFX A;  2QQB A;  3WTU C;  5J8C A;  6PAX A;  1ULY A;  2K27 A;  3R4K A;  2VBY A;  1P6R A;  3ZMU A;  4I98 B;  4EGZ A;  1G3S A;  3N4M A;  2BBY A;  2VE9 A;  4M9X A;  2L01 A;  4P55 A;  4ENK A;  2R7D A;  2YU3 A;  1TLH B;  1FSE A;  2KIM A;  4WX9 A;  2RGV A;  1WRJ A;  1Z05 A;  3JAM Z;  2VON A;  4G6Q A;  1BJA A;  2RQP A;  2KIU A;  3HUG A;  3ZMT A;  2V1D A;  3IHU A;  5HLH A;  3FHZ A;  3EET A;  1PP8 F;  2VOD A;  1RI7 A;  1K78 B;  3KEQ A;  4Q4Z F;  4S05 A;  2EV6 A;  1P4W A;  5DCM A;  5LHG A;  1AWC A;  1BN5 A;  1J7K A;  2IRF G;  1O57 A;  3HHH A;  5FB2 A;  4KIB A;  5LBQ A;  4XRF A;  2QZ8 A;  3JSP A;  1XGO A;  2NNN A;  2XAS A;  2OQR A;  4M74 A;  1LB2 A;  3BOQ A;  4Z2Y A;  1XGM A;  3BZ6 A;  1D8K A;  2XVC A;  1ZG1 A;  2G7U A;  2QM3 A;  3MAJ A;  4OIR F;  1Y0U A;  2ZBK A;  2HYF A;  4M71 A;  2QLZ A;  1ZRE A;  4U0Y A;  5CVV A;  3M8E A;  3P9K A;  5LEJ A;  3T5X A;  2XGX A;  3KP2 A;  3BPX A;  3QP6 A;  2LF8 A;  1YS6 A;  4Q5S F;  5D4R A;  1MGT A;  1EV7 A;  2V79 A;  2P8T A;  4OIN F;  2C6Y A;  1FBU A;  1IF1 A;  4UVB A;  2IVM A;  3FF5 A;  1USS A;  2FOK A;  1DP7 P;  4PDK A;  3E5U A;  5A2Q K;  2DK8 A;  2HQR A;  3F8C A;  1P2F A;  1Q1H A;  1Z6T A;  1Z6R A;  2JRT A;  2HKX A;  3KZZ A;  2HTJ A;  5EEH A;  2CQK A;  1HQC A;  3EUH A;  3LFK A;  1GXP A;  1IAW A;  2QVO A;  4ZYD A;  3LQQ A;  2Y0M A;  3CO7 C;  2JSC A;  2PEX A;  1HKT A;  4ENN A;  2HEO A;  2TDX A;  1U5T B;  2DK5 A;  2J5O A;  1RNL A;  1XB4 A;  1WKM A;  2L02 A;  1SD4 A;  4A0X A;  2H6B A;  1UFM A;  3JTH A;  1QBJ A;  3KET A;  4G9Y A;  1FYM A;  3HSR A;  1ZRC A;  5D5V B;  4G7Z F;  3FXR A;  4MHG A;  1FP1 D;  3MZY A;  3GFL A;  1V3F A;  2H94 A;  2ZNZ A;  1RUN A;  2K02 A;  3KEO A;  1ZH5 A;  4WXH A;  3NEU A;  3GXO A;  3HRT A;  2OA4 A;  4L5J A;  1O7L A;  5D5W B;  3L00 A;  1W7P B;  3RKX A;  4Y17 A;  5HVQ C;  4ESJ A;  3HTU A;  4XBF A;  3PQJ A;  5AON A;  3ABU A;  2P4W A;  2QUF A;  1LDD A;  4P9U A;  5TJJ A;  1QGP A;  1ZG3 A;  2ZNY A;  4K2E A;  4R79 A;  1MJ9 A;  3V8K A;  3RKY A;  2LNB A;  4MQ9 F;  1OR7 A;  1PUE E;  3KP5 A;  2D2W A;  1J5Y A;  2VN2 A;  2K4B A;  3FX3 A;  5E18 F;  1MDM B;  4RB3 C;  4YG2 F;  5FLX Z;  5JHU A;  2F5F A;  3RKW A;  1XN7 A;  3KP7 A;  4O3M A;  2DFI A;  1E2X A;  2DAO A;  1R23 A;  1R5G A;  3VFZ A;  4WXD A;  3ZMD A;  4WF2 A;  4KA4 A;  2BV6 A;  4H0E A;  1B1B A;  1UST A;  3GVA A;  1BM9 A;  1JXS A;  1JHH A;  3BPV A;  4XLN F;  4Y13 A;  3M8F A;  1K78 A;  2V9V A;  4F7Z A;  1YW9 A;  1LDK B;  4U0W A;  5F6F A;  3F23 A;  4TV7 A;  4G7O F;  3CUQ C;  1DPR A;  1S7O A;  4IHT A;  4IRH A;  4QWQ A;  3NRV A;  5HOO A;  1I5Z A;  2A07 F;  1E17 A;  4A5N A;  2RNJ A;  5CYV A;  4I09 A;  3K1P A;  2O61 A;  1U3E M;  1TQI A;  4U7B A;  2G9W A;  3Q9S A;  2A3S A;  1XSV A;  1J0R A;  2R7F A;  2UXX A;  3GLX A;  4L9T A;  3GEZ A;  3O2P E;  1TW2 A;  3FMR A;  2Q2E A;  1CF7 B;  4LG0 B;  3BJA A;  4BH9 A;  5CJ9 A;  4LK1 F;  1S3J A;  3JAM K;  3TO6 A;  2FBH A;  1H9G A;  4CO8 A;  3H92 A;  4BNC A;  3L9F A;  4KIF A;  2QEN A;  5EEG A;  3ZN0 A;  1EH8 A;  3V7S A;  2EWN A;  3WTX C;  5D6E A;  2STW A;  2W25 A;  4ASN A;  1F1Z A;  1LVA A;  3G3Z A;  2P7C B;  1FSH A;  2YX4 A;  3J80 K;  5DUK A;  1T98 A;  2GXB A;  4KNY A;  3DPT A;  3RYR A;  5HLG A;  3I59 B;  4MTD A;  3I53 A;  4D0P A;  2CG4 A;  2DBB A;  3K69 A;  2A69 F;  2XAJ A;  3BJ6 A;  3FMQ A;  4OIQ F;  4RS8 A;  2GA2 A;  3HYI A;  1OYY A;  2M5W A;  3GX4 X;  1HST A;  1FP2 A;  1MJA A;  3K1N A;  2UXN A;  3GZ5 A;  3RJP A;  1D5V A;  2IP2 A;  2VT3 A;  4WK8 F;  2XIG A;  1FZP B;  1T38 A;  1IN8 A;  3SZT A;  3C3W A;  5LRR A;  1LEB A;  4UV8 A;  2IA1 A;  4EJO A;  5L3D A;  4YIF A;  2QBY A;  1JE8 A;  5IT9 K;  5BPI A;  2IT0 A;  2EFO A;  3IKT A;  2FQ3 A;  1YLF A;  5FLX K;  3O3K A;  3IRQ A;  3QPT A;  3VB2 A;  2IJL A;  4HDV A;  1BC7 C;  3ZN1 A;  1QO0 D;  2Y48 A;  5D8K B;  5LHH A;  3KP4 A;  3V8L A;  3EYY A;  3BWG A;  5K5R A;  1Z9C A;  1ON1 A;  2M1B A;  4ESB A;  5JVT A;  2W85 A;  3LA7 A;  1XMA A;  2EV0 A;  3DXJ F;  4HQM A;  2YPR A;  4AWX B;  5E1X A;  4EM2 A;  3IL2 A;  4U88 A;  2O3F A;  1IUY A;  2OD5 A;  3AAF A;  1KA8 A;  2CW0 F;  2D45 A;  3LAP A;  3L2C A;  3W6K B;  1LDJ A;  2ESN A;  2A5Y B;  4LFU A;  3WE3 A;  3ROU A;  1QQI A;  3L09 A;  5TRD A;  3HOT A;  4LLN A;  4FHT A;  4HW0 A;  3V8J A;  5ICE A;  2JPB A;  4AIH A;  3D0S A;  1FC3 A;  1Z1D A;  3U2R A;  1U8R A;  4JK1 X;  2YSR A;  3R6S A;  1O3R A;  3ISP A;  4P5O A;  3CDH A;  3E6C C;  2Z9O A;  3HOS A;  5L3F A;  5H6R A;  1H0M A;  1B4A A;  5FFZ A;  2Y75 A;  1O7F A;  4XLP F;  3RDI A;  4O6J A;  2ZKZ A;  2M30 A;  3KE2 A;  1IW7 F;  4LGW A;  3F8M A;  4L5I A;  3K1M A;  1ZAO A;  1XMK A;  1W5S A;  3C1D A;  4LG0 A;  2M87 A;  2STT A;  2PFB A;  3HRM A;  1UB9 A;  5HS8 A;  1OKR A;  3CUO A;  4P9F A;  1BIA A;  2WC2 A;  1FBS A;  3K2Z A;  1IRF A;  1TTY A;  3WTT C;  4HX4 A;  1IXR C;  4CXF A;  4A5M A;  2OZU A;  4HAM A;  1HBX G;  4OOI A;  3TO9 A;  2IA0 A;  5HDG A;  4HF0 A;  4LD5 A;  4HDU A;  3KLO A;  3R0J A;  3BY6 A;  4UV9 A;  3LAJ A;  2XV4 S;  5ICC A;  4FT8 A;  3QRF F;  1SMT A;  5DDG A;  2KRF A;  1GXQ A;  3E6D A;  1BBY A;  3U1D A;  1HKQ A;  4A0Y A;  2LDU A;  1F9N A;  3C18 A;  1FWZ A;  4KYW A;  1R1V A;  5AIP A;  4OMZ A;  4EV0 A;  1P4X A;  3MZH A;  2GAU A;  1FX7 A;  2E7W A;  4GYI A;  2EV5 A;  1YQA A;  3REO A;  4XSZ F;  4RB2 C;  5LHI A;  4GXO A;  3D5L A;  2ZME B;  4HV5 A;  1B9N A;  2DQL A;  3E5Q A;  4A6E A;  4RB1 A;  1R00 A;  1R5H A;  3L7W A;  1UHW A;  4DNC A;  1QNT A;  2PN6 A;  1QZZ A;  2XKO A;  4FX4 A;  1B6A A;  2ACJ A;  4HF2 A;  4RAY A;  5K1Y A;  4LB5 A;  2ESH A;  4CIC A;  3CUQ B;  3JTG A;  2BE5 F;  2OZ6 A;  3EYI A;  4L9J A;  4HLX A;  5KVR A;  2FU4 A;  2IA2 A;  3KZY A;  2WWY A;  4RGS A;  2O8X A;  2KJB A;  5L3E A;  3MQ0 A;  3HRS A;  4LLG F;  3FM5 A;  3HSF A;  5K5O A;  2A61 A;  1U6G A;  2QWW A;  5BMZ A;  2FRH A;  4AD9 A;  2MBF A;  3DP7 A;  1C0W A;  1SFX A;  3RIR A;  2P5V A;  3ZPL A;  1MZB A;  3T8T A;  5CVJ A;  4A6D A;  1IZ1 A;  1HXD A;  4MEX F;  3E3V A;  3LA2 A;  3TDZ C;  3MWM A;  2XHK A;  2JZY A;  2UWM A;  2CGP A;  4G7H F;  3ZMV A;  3GFJ A;  1TW3 A;  2XUB A;  4EJT A;  1Z7U A;  3BP8 A;  3LA3 A;  4RGU A;  1YG2 A;  3WTY C;  2MA3 A;  4B09 A;  2EFQ A;  2CSO A;  1UHM A;  4BAY A;  4N9I A;  1QZY A;  1V4R A;  2HQN A;  4OIO F;  4IJA A;  3MEX A;  2ZJ2 A;  3RYP A;  4ON0 A;  3EQL F;  1CGP A;  5CVU A;  1S7A A;  1ZAR A;  2D1H A;  2EB7 A;  5E8I A;  3ELK A;  3U9G A;  1W7P A;  1HSJ A;  4KMU X;  5LEK A;  5F1R A;  3GUD A;  1ONV A;  4I7H A;  3LQR A;  5LGN A;  3GO5 A;  5DEQ A;  1EH7 A;  2AXL A;  4HZF A;  2EK5 A;  4HX7 A;  4XSX F;  1TQM A;  2K86 A;  2Z5U A;  5FD5 A;  2UZK A;  1O3T A;  3OOP A;  2HTS A;  2ZO4 A;  5FD6 A;  1HW5 A;  1J2X A;  1OPC A;  2W57 A;  1ZRD A;  2P6S A;  1FY7 A;  5KK1 A;  1R1U A;  1P4A A;  1H9T A;  2EFP A;  4ESF A;  2FBI A;  3DF8 A;  2ADU A;  1R1T A;  2NRA C;  1HW2 A;  1LEA A;  3T0Y A;  1TQP A;  2PBI A;  4LK0 F;  1TBX A;  1DDN A;  2MH2 A;  1YS7 A;  2GWR A;  4Q48 A;  1RZ4 A;  1D3Y A;  1U2W A;  4JBA A;  4IVN A;  1D8J A;  3PFI A;  3I59 A;  1KU9 A;  3M7G A;  5HDK A;  3HHG A;  1OYW A;  2LSO A;  2BEO A;  1BI0 A;  1IXC A;  4N9H A;  4NQW A;  5D5X B;  2DPU A;  4R1H A;  1YYV A;  3QP5 A;  1XD7 A;  2MD5 A;  3P9I A;  4MNU A;  3J80 Z;  4BQA A;  4P96 A;  2F5D A;  3IWF A;  1IN4 A;  3FXU A;  5CLS A;  1Z91 A;  4ENJ A;  3GYH X;  3WTV C;  2JTV A;  1YW8 A;  4MQV A;  3WTW C;  2PLY A;  1XDU A;  4AIK A;  4R8H A;  5DD4 A;  2XAH A;  1K79 A;  1IN6 A;  1YIO A;  1I6X A;  2ZCW A;  3K9T A;  1R22 A;  2E7X A;  4L9N A;  2PG4 A;  2YR2 A;  3QAH A;  4GGG A;  2BGC A;  4I02 A;  1RIO H;  3P9C A;  5L3B A;  4M73 A;  5E20 A;  5A2Q Z;  3TKY A;  2FBK A;  4L0Z B;  2Z33 A;  1WQ2 A;  3E5X A;  3ECO A;  1FYK A;  2CO5 A;  3VOE A;  5H6Q A;  4I2O A;  1ZG5 A;  2XRO A;  2HZT A;  3R0A A;  1W7P D;  4S04 A;  3OV8 A;  2PQ8 A;  2H6C A;  4Q47 A;  2DPD A;  5LRS A;  2DTR A;  3DQV C;  2M8E A;  2GXG A;  2NAZ A;  2PMH A;  1SD5 A;  4EJV A;  4RB0 A;  4IF4 A;  3MCZ A;  3J81 K;  3I64 A;  4M6Y A;  1B9M A;  3W6J B;  2J5P A;  1RUO A;  1KU7 A;  1I27 A;  2OU2 A;  4M9Z A;  2Z99 A;  5E1W A;  1X3U A;  3ULQ B;  3IKV A;  1IXS B;  2EFW A;  5DV5 A;  3C7J A;  4WXC A;  5FO5 A;  4UNO A;  2HDC A;  4IXA A;  4GYG A;  1G3Y A;  4OMY A;  2L4A A;  2IPQ X;  2B0L A;  5DD8 A;  3QPH A;  3H3Z A;  1YO5 C;  1XGS A;  5AIQ A;  3T1B A;  3Q5F A;  1XDS A;  3F3X A;  1I1S A;  5DUI A;  2DU9 A;  2MLK A;  2VC1 A;  2VT2 A;  2O0Y A;  1KQ0 A;  5BPD A;  1F4K A;  3CUQ A;  1SFU A;  1XCB A;  3V7C A;  1YW7 A;  4KUM A;  5D4S A;  2LKP A;  2X4H A;  4KN7 X;  5HDN A;  2GZW A;  2PI0 A;  3GFM A;  1KU2 A;  2HR3 A;  4LB6 B;  3R61 A;  2QQ9 A;  1FLI A;  1TNT A;  2RVC A;  3TGN A;  3B73 A;  2FF4 A;  3QU3 A;  4CZZ A;  3Q9V A;  1JHF A;  4CHU A;  5BOX A;  3SZP A;  2A6E F;  5BS6 A;  2HGC A;  1OYI A;  1J9I A;  1PP7 U;  2Z3Y A;  1XGN A;  3KFW X;  5J6X A;  4B8X A;  1O3Q A;  2VBX A;  4NHJ A;  3CLO A;  3GZ6 A;  3IRR A;  2W84 A;  4PZJ A;  1YTY A;  2V1X A;  1DUX C;  5DYM A;  4CGZ A;  4YII A;  3BJO A;  3WU1 B;  3WOD F;  4N0B A;  4I01 A;  3ML6 A;  3F8N A;  1I1G A;  5ED4 A;  2DI3 A;  1W4M A;  2O03 A;  2WTE A;  2XAG A;  2O6G E;  2QBY B;  5IT9 Z;  4BXU A;  1ZLK A;  2L54 A;  3H3U A;  1WWX A;  2F5E A;  3K0L A;  3WGI A;  3F6O A;  3QOP A;  4ZZD A;  1G4D A;  3ABT A;  1UCR A;  3LST A;  4PGG A;  5D8L B;  3DV8 A;  4YFK F;  4L18 B;  2F2E A;  1BC8 C;  1S6L A;  1BI3 A;  3ECH A;  1ZYR F;  2FE3 A;  2K7L A;  2K4J A;  1MJB A;  4IRG A;  4EM1 A;  4PGH A;  5JR3 A;  3ZMZ A;  1LQ1 A;  5E8G A;  1GVJ A;  2EJR A;  2QQA A;  2WV0 A;  3DEU A;  2A6H F;  1KQ9 A;  1SFE A;  4IRI A;  1U78 A;  4LLL A;  2VC0 A;  3TOA A;  3WGG A;  3HIF A;  5BQT A;  1A04 A;  2DLL A;  2XAQ A;  2ELH A;  4EJW A;  2L4M A;  3WTS C;  5JI6 A;  2ZFW A;  3PQK A;  4FX0 A;  1ODD A;  1DPU A;  4BHC A;  2QYO A;  1XSX A;  1ZLJ A;  4L9V A;  3TDU C;  2HKO A;  2OBP A;  4HLY A;  2H27 A;  5ICG A;  3FZV A;  4KIG A;  1J75 A;  3V4G A;  1AOY A;  2GQQ A;  1K7A A;  4BHB A;  4A2U A;  2RN7 A;  4HA8 A;  2RKH A;  2CFX A;  2OAZ A;  4RGR A;  2H09 A;  4M9S A;  3RI4 A;  3V7R A;  4HV6 A;  1YFH A;  5H20 A;  2FXA A;  2NNY A;  2AS5 F;  2EA4 A;  2E1C A;  3KP6 A;  3I0T A;  1LJ9 A;  3F72 A;  2FEZ A;  4G8X A;  4OIP F;  1IN7 A;  3F21 A;  1ZHF A;  1T39 A;  1SMY F;  4LMY A;  5LLQ A;  4ZYH A;  3HTS B;  3GW2 A;  3DFG A;  1IN5 A;  3LWF A;  4A12 A;  1G6N A;  1HW1 A;  2X0L A;  4UHT A;  5CVI A;  2KKO A;  2FNP A;  5ICF A;  4RGX A;  2ETH A;  2W24 A;  2ISZ A;  2KIF A;  4IPA A;  2PJP A;  3P7N A;  1J59 A;  2MLG A;  3WTZ A;  2FML A;  1JGS A;  2RDP A;  2JPC A;  3S2W A;  1SD6 A;  3MFK A;  4HOB A;  1O3S A;  2IW5 A;  3N97 A;  1PDN C;  4PCQ A;  4HYE A;  4KN4 X;  4HX8 A;  1T2K A;  2KJC A;  3SXY A;  2VOP A;  3I58 A;  2DQR A;  4UVA A;  3RPQ A;  1L0O C;  1QPM A;  3ZP5 A;  5ILU A;  1GHC A;  1XSD A;  2VOO A;  3JW4 A;  3B02 A;  1FT9 A;  1OMI A;  2ZME A;  3DKW A;  4HBL A;  1ZRF A;  3VOD A;  3TO7 A;  3KLN A;  2VBZ A;  1SAX A;  2ISY A;  1FPQ A;  4HF1 A;  5DCM B;  5E1Z B;  3FWE A;  3QU6 A;  4Y15 A;  3CO6 C;  1KYW A;  5J8F A;  2VE8 A;  2P5L C;  4CYD A;  2HS5 A;  2EFN A;  4WCG A;  2VBW A;  4E70 A;  3BRO A;  3WU0 A;  2FMY A;  2G7H A;  3DPL C;  2CWE A;  3F6V A;  1TNS A;  3T8R A;  4CDG A;  1R36 A;  3VEP A;  3EDP A;  4JQF A;  2HYG D;  1NHA A;  1S8N A;  1MD0 A;  2JT1 A;  3J7A O;  4U0V A; 
#chains in the Genus database with same CATH topology
 1R9T J;  3OYA A;  3PIP F;  1EH6 A;  2LVS A;  4F92 B;  4B43 A;  4L0Y B;  4G6D A;  4KFC A;  5HS7 A;  4QLC U;  2Q1Z B;  4EJU A;  2MH9 A;  3ERE D;  3VPR A;  2K40 A;  1BA5 A;  3PNT A;  2R5Z B;  4Y33 A;  5HS9 A;  1FMW A;  1OCZ H;  5ILV A;  4DIQ A;  4KDP A;  1U5T A;  1P92 A;  3E97 A;  3M8J A;  3TQN A;  4PSX A;  4XOR A;  3BTJ A;  3R60 A;  4IHS A;  1ZGA A;  3RTR A;  1Y39 A;  3WE2 A;  1LFP A;  5TGT A;  4M72 A;  3RPU A;  4CCO A;  1RKT A;  3HZJ A;  2QCO A;  5ERI A;  1MIJ A;  3SFZ A;  1ON2 A;  3A0H C;  5F27 A;  5L3G A;  2JSP A;  2WAE A;  3CQZ J;  2VJ5 A;  1MKM A;  1W5T A;  3WGH A;  3ZMS A;  4L5E A;  4AIJ A;  5J4V A;  5EDN A;  2O5R A;  3UR3 C;  3KP3 A;  5E3L A;  1W1W E;  3SHF A;  2WB1 A;  2GOX B;  1UMQ A;  1WCM J;  1MDM A;  1FOK A;  4EQQ A;  1KU3 A;  1QU3 A;  2XB0 X;  4E7K A;  4BHP A;  3BT9 A;  4YFX F;  4ENM A;  2XRL A;  1AKH B;  1YOV B;  5HLI A;  2XB5 A;  3AL0 C;  2B9S A;  4RA2 A;  1U5T C;  4GRI A;  2D1V A;  2GA1 A;  2RNG A;  4E7S A;  3E1S A;  2HDW A;  3VDX A;  2P6T A;  1Y0N A;  2MC3 A;  3Q3S A;  4MEY F;  3F22 A;  2CYY A;  5JFR A;  4ZH4 F;  2RC4 A;  1VQN I;  3HXL A;  3X2Q H;  3I5U A;  3GTP J;  4BQQ A;  1F43 A;  1KQ8 A;  3M9A A;  3DWL E;  4ZZL A;  3CD6 I;  2MAB A;  3VYS B;  1T6S A;  2VJI A;  2Q0O A;  4ETS A;  5LGU A;  2NS8 A;  3I3L A;  1L3L A;  2VXD A;  4HQE A;  4HG2 A;  3W6V A;  1MBG A;  1MH4 A;  2XKP A;  2ZXJ A;  2GOM A;  3G71 I;  1XCV A;  3H9Q A;  3HRU A;  3I4P A;  1WSU A;  3S17 J;  3GF2 A;  3O8H A;  1X3W B;  4PJM A;  1FBQ A;  3OY9 A;  3I71 A;  1R58 A;  3CCY A;  2MC4 A;  1BIB A;  3LSP A;  1OCT C;  4XKB A;  2L3D A;  3C2B A;  1X1A A;  2DTZ A;  4N4N B;  1BI2 A;  4BKX A;  1JUM A;  4XLH A;  2HFH A;  1G3W A;  3CCU I;  1WH7 A;  2DJN A;  3NQO A;  5DCF A;  1F36 A;  4GCV A;  1A36 A;  1IRZ A;  3F8B A;  2COM A;  4BJT A;  1SD7 A;  4ZYG A;  4D5F A;  5DM7 F;  2FUG 2;  2GIV A;  2XRN A;  5C44 J;  4KIT B;  2ZC2 A;  4U7D A;  1TT5 B;  4M6X A;  4PJ0 C;  1JKP C;  1QVU A;  2DYR H;  3MKZ A;  1N25 A;  5J4Y A;  3BDD A;  3BLY A;  3K2A A;  3GME A;  1F5T A;  2M4K A;  3IH2 A;  3LL7 A;  2BYV E;  2V1U A;  5KNL A;  2D5V A;  1K4S A;  3AFH A;  1U9O A;  4LJZ F;  1NTC A;  4YFN F;  1STZ A;  2NS0 A;  3K7A J;  2IBD A;  4AVP A;  3FXQ A;  3M4O J;  4UUV A;  1BI1 A;  5FKM A;  1REP C;  2DA4 A;  2R3S A;  2JA8 J;  2JUG A;  2LBF A;  2P0W A;  3O6B B;  2HOE A;  1K6O A;  2FA5 A;  4KMF A;  3GWZ A;  3IC7 A;  5K5Q A;  4I6Z A;  2DW4 A;  3MKL A;  4XKV A;  3ZQ7 A;  1WJC A;  4DQ2 A;  2FNA A;  3PIO F;  2E34 A;  3JSO A;  2DMP A;  3I54 A;  1KGS A;  3FMS A;  4CCK A;  5CVR A;  1DGW Y;  2KDO A;  3W2V A;  1BOA A;  1HKS A;  1CF7 A;  2R7S A;  3CP8 A;  2QSH X;  3PNY A;  4BYY A;  5M5Y J;  4MGR A;  5D6F A;  4XLF A;  2F5V A;  4UVC A;  3HSE A;  1QPI A;  3CJN A;  5L3C A;  3G73 A;  4O5V A;  2Q8K A;  1IUF A;  2CS3 A;  4KIC A;  2FSW A;  1VND A;  3E6M A;  3QWL A;  1B59 A;  2UUZ A;  5GTI C;  1V55 H;  1E0E A;  1ZGJ A;  2X1E A;  1VI0 A;  4EMS A;  3EPZ A;  3MD2 A;  4WWC A;  2BY0 A;  1UHS A;  4OU0 A;  5EYR A;  1VTN C;  2CMP A;  3CCR I;  4A0Z A;  1ZN2 A;  3M1E A;  4XQF A;  1BR4 A;  2E1N A;  2A68 F;  4W97 A;  4GO1 A;  5FGM A;  3FM3 A;  3QPL A;  3KCC A;  2K9L A;  1XC5 A;  2M45 A;  4RAZ A;  2HWV A;  3UNG C;  2WA0 A;  3F8F A;  2WBM A;  5IT3 A;  2L7M P;  3CMA I;  3CTA A;  2V6C A;  1HF0 A;  5F64 A;  1UAA A;  4EM0 B;  2P7V B;  5GP9 A;  1G3T A;  4C2U A;  2LF7 A;  1R7J A;  3MVP A;  2R4G A;  5KCM A;  1YJN I;  2CH0 A;  4S0H B;  5D5U B;  2XAF A;  3TBI A;  1WI9 A;  2YUS A;  1V5E A;  2W7N A;  3TOB A;  5LGT A;  5B3S H;  2EZI A;  1I3Q J;  1IV8 A;  2BHY A;  2VXZ A;  2BVM A;  3KEY A;  3COA C;  5E79 C;  4EGY A;  5CQG A;  4HNV A;  3FDY A;  1FNN A;  4II2 A;  3E6B A;  2OQG A;  1LNW A;  1S29 A;  1SEU A;  3I4M J;  2R7Z J;  2EA2 A;  2RV8 A;  4EVI A;  2DT5 A;  1T0F A;  5ILS A;  3IWZ A;  2K9N A;  2IGO A;  1WI3 A;  1R6R A;  3VSL A;  2DO7 A;  3CJQ B;  3S2H J;  2F5C A;  2NYX A;  3SQN A;  1B8I B;  4ZYE A;  4G94 A;  4I0A A;  3TP0 A;  3HOX J;  2P5K A;  3PSI A;  3J81 Z;  2VL8 A;  4NB5 A;  3OYI A;  3CCM I;  4XRS G;  4I0B A;  3GFI A;  4J19 A;  2EIN H;  3WG9 A;  1ETO A;  1LUJ B;  2PMU A;  4MTE A;  4UXN A;  2I8D A;  2R7O A;  1Z7L A;  5E17 F;  2YX7 A;  3W3C A;  3CME I;  4N4O B;  1FYL A;  1N78 A;  1KYZ A;  2HYJ A;  2WB1 N;  1VQP I;  4KT5 C;  1IRG A;  5FFX A;  2QQB A;  3WTU C;  3TP3 A;  5J8C A;  6PAX A;  4V2G A;  2EQR A;  1ULY A;  2OPT A;  1FOW A;  1G8X A;  1GT0 C;  2K27 A;  3R4K A;  3HOW J;  2VBY A;  4NC8 A;  3ZR8 X;  2IGM A;  4DZJ A;  5C3E J;  1ITY A;  3H36 A;  4GDF A;  1DU6 A;  1P6R A;  3ZMU A;  2DT6 A;  3RZD J;  3FBN B;  4I98 B;  2MGQ A;  4EGZ A;  3G6E I;  1G3S A;  3N4M A;  2AQE A;  1X1D A;  4BXF A;  1TWC J;  2LY9 A;  2BBY A;  2VE9 A;  2DYS H;  5KAF C;  4M9X A;  3L1P A;  3MMY B;  3BZC A;  2L01 A;  4PJN A;  4P55 A;  4ENK A;  1MNM C;  1VQK I;  2R7D A;  2YU3 A;  1TLH B;  4HPQ A;  4IX7 A;  3VWB A;  1VQO I;  1LE8 A;  1FSE A;  2LP0 A;  1SAU A;  2KIM A;  2LBF B;  5K7Z A;  4WX9 A;  2RGV A;  2VPL A;  1CQT A;  1WRJ A;  1Z05 A;  3JAM Z;  5LD2 C;  4QSH A;  2VON A;  4G6Q A;  1BJA A;  5F0C A;  2RQP A;  1OR7 C;  2X85 A;  1D0Z A;  3HGG A;  2JK3 A;  4LIV A;  3NWT A;  3J7Z I;  3CC7 I;  2KIU A;  3HUG A;  3ZMT A;  4JX5 A;  2V1D A;  3IHU A;  5HLH A;  3FHZ A;  3EET A;  1PUF A;  4D7N A;  4UB8 C;  1PP8 F;  2VOD A;  1RI7 A;  3FIS A;  1K78 B;  4XN3 A;  3KEQ A;  4Q4Z F;  4S05 A;  1D5Y A;  2EV6 A;  1P4W A;  5DCM A;  2HZD A;  4E7I A;  5LHG A;  1AWC A;  1BN5 A;  4M3B A;  1J7K A;  3DEW A;  2DN0 A;  2IEK A;  3H35 A;  2LKX A;  1J09 A;  2IRF G;  1O57 A;  3HHH A;  4X1E A;  5J47 A;  5FB2 A;  2ID6 A;  2AQF A;  4KIB A;  5LBQ A;  4XRF A;  2QZ8 A;  3OSF A;  3JSP A;  2HVR A;  1XGO A;  2NNN A;  2XAS A;  4E4H A;  3WU2 C;  1VQ5 I;  2OQR A;  1RRJ A;  4M74 A;  1LB2 A;  3BOQ A;  4FTH A;  4Z2Y A;  2HPI A;  3W2W A;  1XGM A;  2WV1 A;  3BZ6 A;  1D8K A;  1GVD A;  2XVC A;  4G12 A;  4BY1 J;  1T0F C;  1ZG1 A;  1SAN A;  4UUS B;  2G7U A;  2XPV A;  3FBI B;  3CDL A;  2QM3 A;  3MAJ A;  2V4J C;  3RQ4 A;  3GTQ J;  4PK4 A;  5DTD A;  4OAZ A;  4OIR F;  4HRI A;  4IKF A;  1Y0U A;  3BR2 A;  2ZME C;  2ZBK A;  4V2F A;  2HYF A;  4M71 A;  5EEA A;  3G4S I;  2QLZ A;  4BDZ A;  1ZRE A;  4U0Y A;  4A3F J;  4RAG A;  5CVV A;  4XM3 A;  4Y4R A;  3M8E A;  3P9K A;  4XL9 A;  5LEJ A;  3T5X A;  2XGX A;  3KP2 A;  1FEX A;  2X51 A;  2X6Y A;  2KFD A;  3BPX A;  3FXJ A;  3QP6 A;  3ZQF A;  3CF5 F;  5FLV A;  2L9S A;  2LF8 A;  5F0F A;  1MMG A;  1YS6 A;  1GV2 A;  2Z2S B;  1TL8 A;  4CYC B;  1T95 A;  1XPX A;  5EGO B;  2DCE A;  4Q5S F;  4X0G A;  3CCJ I;  3CJR B;  5D4R A;  1MGT A;  4HNU A;  1EV7 A;  3RZO J;  2V79 A;  2P8T A;  4OIN F;  2C6Y A;  1FBU A;  3HB9 A;  4M3E A;  4D9J A;  5EZG A;  1IF1 A;  1SC7 A;  4UVB A;  2IVM A;  3DKX A;  2IS4 A;  1EF4 A;  2M0M A;  4CCN A;  3S3O A;  3FF5 A;  4CH7 A;  3FKI J;  1USS A;  2NOJ B;  2EH3 A;  1IDY A;  4BBR J;  2OC6 A;  2FOK A;  4A3B J;  4XID A;  1DP7 P;  4PDK A;  1P9Q C;  1IG7 A;  3E5U A;  5A2Q K;  1OJL A;  2MW8 A;  2XPU A;  3JRI A;  1OIS A;  1WGX A;  1VF9 A;  2DK8 A;  2EZK A;  2HQR A;  1P2F A;  3F8C A;  4MFE A;  2X9D A;  1Q1H A;  3L2W A;  3PSF A;  3SZG A;  2JJ7 A;  2XGD A;  1Z6T A;  2H1L A;  1ZGW A;  2F4M B;  4YEL A;  3AG4 H;  4LIU A;  4II3 A;  3CCS I;  4RMN A;  1Z6R A;  2JRT A;  2HKX A;  3KZZ A;  2HTJ A;  1ZEL A;  5EEH A;  2CQK A;  5HNF A;  1HQC A;  2JA2 A;  4A3J J;  3HDD A;  3EUH A;  3LFK A;  4DYQ A;  3N05 A;  1GXP A;  1IAW A;  1A5J A;  2XSJ C;  2QVO A;  4ZYD A;  3EUK L;  1Y8R B;  3ERM A;  1OCO H;  4NNJ A;  3KIO A;  2HQ5 A;  1W5C C;  3ZQG A;  4DJA A;  3C2G A;  3LQQ A;  2Y0M A;  3CO7 C;  2JSC A;  4DYR A;  2PEX A;  1HKT A;  4XRS A;  1TT0 A;  1E3O C;  4ENN A;  2HEO A;  2EZL A;  4RM2 A;  1MMD A;  2TDX A;  1U5T B;  2DK5 A;  2J5O A;  4GFB A;  1RNL A;  3HJE A;  1XB4 A;  4RLF A;  1WKM A;  1B72 A;  4Y3O A;  2L02 A;  2QGU A;  1SD4 A;  4A0X A;  3HKZ A;  4FE4 A;  2H6B A;  2LTP A;  1UFM A;  1XMX A;  4C3H J;  4DW6 A;  3JTH A;  1X1C A;  1QBJ A;  1WVR A;  3KET A;  4G9Y A;  1FYM A;  3HSR A;  1ZRC A;  5D5V B;  4JX6 A;  4G7Z F;  3FXR A;  1IV6 A;  3LSR A;  4MHG A;  1FP1 D;  1BL0 A;  3MZY A;  3GFL A;  1V3F A;  2H94 A;  1X1P A;  2E36 A;  2UV1 A;  2ZNZ A;  5F0H A;  1RUN A;  2K02 A;  3D5R C;  3KEO A;  1ZH5 A;  4WXH A;  3NEU A;  3GXO A;  3HRT A;  3M07 A;  4AM3 A;  2OA4 A;  4L5J A;  1O7L A;  5D5W B;  2X6X A;  3L00 A;  1W7P B;  1ZK8 A;  3A4C A;  3ABK H;  2P81 A;  3RKX A;  4Y17 A;  1UG2 A;  4HST A;  5HVQ C;  2DOE A;  4ESJ A;  4ITV A;  2QQ8 A;  3HTU A;  4XBF A;  3PQJ A;  5IP9 J;  5AON A;  3ABU A;  4Y7N J;  3OYN A;  2P4W A;  2QUF A;  1LDD A;  2LK2 A;  4P9U A;  5TJJ A;  1QGP A;  1ZG3 A;  2VKE A;  3CES A;  2ZNY A;  4K2E A;  4R79 A;  1MJ9 A;  3V8K A;  3RKY A;  2LNB A;  5IP6 A;  3ABM H;  4MQ9 F;  1OR7 A;  1S7E A;  2H8R A;  1PUE E;  4A3M J;  1WHU A;  3KP5 A;  2ZJQ F;  2DDB A;  2D2W A;  1J5Y A;  2VN2 A;  2K4B A;  1RES A;  4B3X A;  1K83 J;  2O8K A;  4AVZ A;  4D1Q A;  3FX3 A;  5E18 F;  4DBR A;  1MDM B;  2R5Y B;  2MFZ A;  4RB3 C;  1JTY A;  2DA5 A;  4QPQ A;  4YG2 F;  2O9L A;  2LMD A;  5FLX Z;  2E1M C;  2OV7 A;  5JHU A;  2F5F A;  1OFC X;  3RPU D;  1OCR H;  3RKW A;  4BEH A;  2RRE A;  2IXS A;  3PUF A;  1XN7 A;  3KP7 A;  2CFO A;  4O3M A;  3TW7 A;  2DFI A;  3PJR A;  1E2X A;  2DAO A;  2E2I J;  1R23 A;  4XK4 A;  2MG4 A;  1R5G A;  3VFZ A;  1GDT A;  2IGN A;  1Z3Y A;  3CLQ A;  4M3F A;  2BXZ A;  2Y2Z A;  3F9K A;  4WXD A;  5K7H A;  1Y1V J;  3AG3 H;  4WF2 A;  2BV6 A;  3ZMD A;  4KA4 A;  2JMW A;  4H0E A;  1B1B A;  2TRT A;  3A0B C;  5J1U A;  1UST A;  2WAF A;  3DU5 A;  3GVA A;  1BM9 A;  2OF7 A;  1JXS A;  1JHH A;  1S5L C;  3H0G J;  3BPV A;  4XLN F;  2HXO A;  4Y13 A;  2L0K A;  3QPS A;  5K7F A;  3M8F A;  1K78 A;  2V9V A;  4F7Z A;  1YW9 A;  1LDK B;  4U0W A;  5FRN A;  5F6F A;  1P7J A;  1TWF J;  3F23 A;  4TV7 A;  4G7O F;  2JN6 A;  3CUQ C;  1NK3 P;  3L2V A;  2QA4 I;  3A01 A;  2ZJR F;  2A6T A;  1DPR A;  1S7O A;  2JWT A;  4AU7 A;  2DMQ A;  2BY3 A;  2LD5 A;  1K61 A;  4IHT A;  4IRH A;  2CQN A;  1WPK A;  4QWQ A;  3NRV A;  4B4C A;  4BGD A;  5HOO A;  1I5Z A;  2A07 F;  3ONQ A;  1Z0X A;  1DP3 A;  1E17 A;  4A5N A;  2CU7 A;  2RNJ A;  5CYV A;  4I09 A;  1RR8 C;  5JVG F;  3K1P A;  2O61 A;  1U3E M;  2V7F A;  1TQI A;  4U7B A;  3CCL I;  1I50 J;  2M7A A;  2CUJ A;  2G9W A;  3FIW A;  2R7T A;  3Q9S A;  2XPW A;  3BG3 A;  2DMU A;  2A3S A;  3JRD A;  1XSV A;  1J0R A;  2W00 A;  1RR7 A;  1AA7 A;  2R7F A;  2UXX A;  4FQG A;  3GLX A;  4L9T A;  3GEZ A;  3O2P E;  1TW2 A;  3FMR A;  3IH4 A;  3DCF A;  2MD0 A;  2R5Y A;  3SDB A;  2DA6 A;  2QSF X;  3S32 A;  4Y52 J;  2Q2E A;  1ZR2 A;  4NBQ A;  1HCR A;  1CF7 B;  4Z6Y A;  2I10 A;  1VQ7 I;  4LG0 B;  1IC8 A;  3BJA A;  2LG4 A;  3AL0 B;  3ZQC A;  1MBE A;  4BH9 A;  4A93 J;  3JRC A;  5CJ9 A;  4QIW N;  4LK1 F;  3JRA A;  1S3J A;  1QHH D;  3JAM K;  4M6V A;  2B7E A;  3TO6 A;  2FBH A;  1UG0 A;  4I76 A;  1H9G A;  4CO8 A;  2WY7 Q;  3NAR A;  3H92 A;  2DDA A;  2OJE D;  4BNC A;  3L9F A;  4KIF A;  1S72 I;  2QEN A;  5EEG A;  3I4N J;  2MSY A;  1EH8 A;  3ZN0 A;  3V7S A;  4RBO A;  1MBF A;  3PUB A;  2EWN A;  1I6H J;  3WTX C;  3LOC A;  5D6E A;  2STW A;  2W25 A;  4BE0 A;  3PFY A;  1F1Z A;  1LVA A;  1TP4 A;  3G3Z A;  4ASN A;  4AUX A;  2P7C B;  1VFC A;  1FSH A;  2F48 A;  2YX4 A;  2GBY A;  3J80 K;  5DUK A;  1T98 A;  3BR1 A;  2GXB A;  4KNY A;  4DOZ A;  3DPT A;  3RYR A;  5HLG A;  3I59 B;  4MTD A;  3I53 A;  1ZKG A;  4AYB N;  4BQN A;  4D0P A;  1BJZ A;  3WHC A;  1ETW A;  2CG4 A;  3HGY A;  3DBH B;  2DBB A;  1YIT I;  3K69 A;  2OTJ I;  1Z67 A;  3KX2 A;  4HNT A;  2A69 F;  1SVL A;  2XAJ A;  3BJ6 A;  3OYE A;  3FMQ A;  1BW6 A;  3LSH A;  4OIQ F;  3S1R J;  2VQC A;  4RS8 A;  1Z21 A;  2GA2 A;  3HYI A;  3OSG A;  3HC7 A;  3BG5 A;  1DQU A;  5GPC A;  1VQ6 I;  1PYV A;  1OYY A;  2M5W A;  3GX4 X;  1HST A;  1Z77 A;  2XDV A;  2HQA A;  4F3Q A;  3ZQL A;  4IZZ A;  1FP2 A;  1QRY A;  1MJA A;  3K1N A;  4CUG A;  2UXN A;  2W48 A;  3GZ5 A;  3RJP A;  1D5V A;  2KZV A;  3BG6 A;  2IP2 A;  1S9H A;  2NXN B;  2VT3 A;  4WK8 F;  1OCP A;  2BY1 A;  2XIG A;  1FZP B;  2MYS A;  1T38 A;  4RLQ A;  1IN8 A;  4FE7 A;  3SZT A;  1V5F A;  3C3W A;  4XMY A;  5LRR A;  1LEB A;  1N75 A;  4UV8 A;  1U8B A;  2IA1 A;  4EJO A;  5L3D A;  4YIF A;  2QBY A;  2CUE A;  1JE8 A;  5IT9 K;  2QKM B;  5BPI A;  2CV1 A;  2H1K A;  3JRB A;  2IT0 A;  2EFO A;  3I56 I;  2Z16 A;  2VUM J;  3GTM J;  2BHZ A;  2W4S A;  3BTC A;  3IKT A;  1O4X A;  2FQ3 A;  1YLF A;  3OYM A;  5FLX K;  2GM4 A;  3O3K A;  3IRQ A;  3SEQ A;  3S2D J;  3QPT A;  2KPM A;  3PL8 A;  2Y30 A;  5DS9 A;  3A1Y A;  2VKV A;  3FXM A;  4A3D J;  3VB2 A;  3JRG A;  2IJL A;  4HDV A;  4NQW B;  1BC7 C;  1W0U A;  3ZN1 A;  4QTR A;  1QO0 D;  1IO2 A;  2Y48 A;  5D8K B;  3H3V K;  5LHH A;  3KP4 A;  2M3A A;  3V8L A;  3EYY A;  3BWG A;  5K5R A;  5FKN A;  1Z9C A;  1GUU A;  3E0J B;  1ON1 A;  2M1B A;  4C3I J;  3HPH A;  4ESB A;  1A35 A;  5JVT A;  2W85 A;  4J01 A;  3LA7 A;  1XMA A;  2EV0 A;  3OYJ A;  3DXJ F;  1BW5 A;  2M7B A;  4HQM A;  5J3L A;  2YPR A;  3Q0V A;  3OYC A;  4AWX B;  2E1O A;  5E1X A;  3J7Y J;  3WHB A;  3ASN H;  4EM2 A;  3IL2 A;  4DGW B;  4U88 A;  4X6A J;  2O3F A;  1IUY A;  2OD5 A;  3AAF A;  1Y6I A;  2BY2 A;  1KA8 A;  2CW0 F;  1OLT A;  2D45 A;  4J00 A;  3BTL A;  3JCU C;  3LAP A;  2X1D A;  3L2C A;  3W6K B;  4IHW A;  1LDJ A;  2KT0 A;  3SFI A;  2ESN A;  2A5Y B;  4LFU A;  1OQY A;  1A6I A;  2HOS A;  3WE3 A;  3ROU A;  4C30 A;  4JP0 A;  2R0Q C;  2G0E A;  1QQI A;  4QPO A;  2ICW G;  3L09 A;  5TRD A;  2NVT J;  5M5X J;  3HOT A;  4LLN A;  2QF7 A;  1T08 B;  4OAY A;  4FHT A;  2LYC A;  2E2H J;  1X1B A;  3DBR B;  4HW0 A;  5BNG A;  3V8J A;  3FXO A;  2JPB A;  4EEF G;  5ICE A;  4AIH A;  3D0S A;  5E3N A;  1JT6 A;  1FC3 A;  1Z1D A;  3U2R A;  2IS2 A;  1U8R A;  1FTZ A;  4JK1 X;  2YSR A;  3ABL H;  4ANJ A;  3R6S A;  2KIS A;  1O3R A;  3ISP A;  4P5O A;  3CDH A;  3E6C C;  4BE1 A;  4LIT A;  2Z9O A;  3HOS A;  5IOZ A;  5H6R A;  5L3F A;  1B4A A;  1QHG A;  5FFZ A;  1H0M A;  3CCE I;  2Y75 A;  1VZ0 A;  5IY5 H;  1O7F A;  4DZP A;  4XLP F;  3RDI A;  4CCJ A;  4UUT A;  4ZTF A;  4BS9 A;  2KQR A;  2KMU A;  4O6J A;  2ZKZ A;  2M30 A;  3KE2 A;  4IQJ A;  3NWS A;  3S1N J;  2DOF A;  2EIK H;  1IW7 F;  5EGO A;  4LGW A;  3F8M A;  4L5I A;  3GTO J;  3K1M A;  4F91 B;  1ZAO A;  4LOC A;  3AKZ A;  1XMK A;  1W5S A;  2EZH A;  2CW7 A;  4KT6 A;  2BW3 B;  3C1D A;  4LG0 A;  3K4M A;  2BOL A;  3L2U A;  3BC8 A;  5F1J A;  2LOO A;  2M87 A;  3BQY A;  1SVO A;  2K9M A;  2STT A;  2PFB A;  3HRM A;  3VYU B;  3RKQ A;  4A69 C;  1UB9 A;  5HS8 A;  1OKR A;  3CUO A;  4P9F A;  1BOB A;  4BY7 J;  1BIA A;  4C9Y A;  2WC2 A;  2Y0S N;  1EJ9 A;  1FBS A;  3K2Z A;  1IRF A;  1RPW A;  2ME0 A;  1TTY A;  1TWH J;  1D0Y A;  3WTT C;  4IHY A;  2KIQ A;  4HX4 A;  1IXR C;  4U87 A;  3LNQ A;  4CXF A;  2K85 A;  3FHN A;  4A5M A;  1LFB A;  2OZU A;  1YX5 A;  1JKQ C;  3OYG A;  3DBL B;  4HAM A;  3CP2 A;  3K70 D;  2KLO A;  1HBX G;  4OOI A;  1IRX A;  2IA0 A;  3TO9 A;  5HDG A;  4HF0 A;  4LD5 A;  1FOY A;  2OTL I;  1LE8 B;  4HDU A;  5EG0 A;  3KLO A;  3R0J A;  3FK6 A;  3BY6 A;  4UV9 A;  3LAJ A;  2XV4 S;  5ICC A;  2VKH A;  4FT8 A;  3QRF F;  1SMT A;  1AHD P;  5DDG A;  2KRF A;  1GXQ A;  5IOY A;  4PFP A;  3E6D A;  2XC7 A;  1BBY A;  3H9G A;  3U1D A;  1HKQ A;  4A0Y A;  2LDU A;  2PJR B;  1F9N A;  1PVE A;  5M3F J;  2JRM A;  3C18 A;  1FWZ A;  4KYW A;  1R1V A;  2E1M B;  3LMM A;  5AIP A;  1FIP A;  1X4O A;  4ZJZ A;  5J1Y A;  1PUF B;  4OMZ A;  3U21 A;  2X6W A;  4EV0 A;  4BQO A;  3F0C A;  1P4X A;  3MZH A;  1FX7 A;  2GAU A;  4BL0 B;  2E7W A;  4GYI A;  4NC7 A;  4UUS A;  2EV5 A;  1YQA A;  3REO A;  4BJ6 C;  1MMS A;  3TL4 X;  1I3A A;  4E6K G;  3QQA A;  1N77 A;  1YRN B;  3ZGK A;  4XSZ F;  3GLL A;  4RB2 C;  5LHI A;  4GXO A;  3D5L A;  5H2F C;  2ZME B;  3GTL J;  5HNH A;  3BTI A;  4HV5 A;  1B9N A;  2DQL A;  1JI8 A;  3E5Q A;  3B6C A;  5CPR B;  1HOM A;  4A6E A;  3C2H A;  2B63 J;  4CDG A;  2BVL A;  1R00 A;  4RB1 A;  1R5H A;  3L7W A;  1D1C A;  4XKW A;  1UHW A;  4DNC A;  1QNT A;  2PN6 A;  1PJR A;  1QZZ A;  2CQ7 A;  2XKO A;  4FX4 A;  1B6A A;  3ZQH A;  2ACJ A;  1YHQ I;  4HF2 A;  4RAY A;  1UJ8 A;  1V5G A;  5K1Y A;  5F08 A;  1SFO J;  3KYC B;  4IOC F;  4LB5 A;  2CUZ A;  2ESH A;  4CIC A;  4RM3 A;  1K4T A;  1DU0 A;  2JA7 J;  3CUQ B;  3K4B A;  3JTG A;  2BE5 F;  1M1E B;  2R7Q A;  1ZR4 A;  2OZ6 A;  1APL C;  3EYI A;  4L9J A;  4HLX A;  2DA1 A;  5KVR A;  1G59 A;  3WG7 H;  5JLW A;  2FU4 A;  2IA2 A;  3KZY A;  2WWY A;  4RGS A;  2O8X A;  2KJB A;  5L3E A;  3MQ0 A;  1JJ6 C;  3HRS A;  4LLG F;  1D1A A;  2I5U A;  4XRM A;  3FM5 A;  3IH3 A;  3HSF A;  5K5O A;  3DEE A;  2A61 A;  1U6G A;  1X2N A;  1X58 A;  2QWW A;  3O8G A;  5BMZ A;  1MH3 A;  2DA7 A;  3CMM A;  2FRH A;  2M34 A;  3OMY A;  4AD9 A;  5FRO A;  2Y9Z A;  1ETQ A;  4E7H A;  2MBF A;  3KZI C;  2OUM A;  2CUF A;  2NVU B;  3DP7 A;  2DFE A;  1YJW I;  1SFX A;  1C0W A;  3RIR A;  3LSK A;  2IAI A;  1WJF A;  2P5V A;  3A2K A;  3ZPL A;  2VAS A;  1MZB A;  4BEH B;  3T8T A;  4D5C A;  2BXY A;  5CVJ A;  4A6D A;  3A01 B;  1A6Q A;  5C4X J;  1IZ1 A;  1SVM A;  1HXD A;  4MEX F;  2LRE A;  3E3V A;  3LA2 A;  3TDZ C;  3MWM A;  2XHK A;  2JZY A;  2UWM A;  4XON A;  2CGP A;  2IS1 A;  1ETY A;  1HLV A;  3GCM A;  1RET A;  4G7H F;  5IYB J;  3ZMV A;  3GFJ A;  4FIS A;  1YRN A;  1TW3 A;  2XUB A;  4EJT A;  5HLT A;  2HOT A;  1Z7U A;  3BP8 A;  3LA3 A;  4RGU A;  1YG2 A;  2R92 J;  5FKK A;  2ZFU A;  2VB6 A;  2DXI A;  3WTY C;  1R5I D;  2MA3 A;  2WAQ N;  3E7L A;  4B09 A;  2EFQ A;  4XIC A;  2CSO A;  1UHM A;  4BAY A;  4N9I A;  1QZY A;  2ZJP F;  4A3K J;  1V4R A;  2HQN A;  3ZQI A;  4OIO F;  3ASO H;  3MEX A;  4IJA A;  1FMV A;  2DOD A;  3K10 A;  3BR6 A;  2ZJ2 A;  3RYP A;  4MIM A;  3DLA A;  4ON0 A;  2WY8 Q;  3EQL F;  2DMT A;  3LSG A;  3JRH A;  3GTJ J;  1AKH A;  2FD5 A;  1CGP A;  3M3Y J;  2ZXI A;  5FLM J;  5GAG J;  2Y0S A;  2RQQ A;  5CVU A;  1S7A A;  1ZAR A;  3CF2 A;  2KL4 A;  3K4N A;  2D1H A;  3K4L A;  2EB7 A;  4MO7 A;  5J1R A;  5E8I A;  3ELK A;  3U9G A;  5M5W J;  1W7P A;  1HSJ A;  5IYC J;  4KMU X;  5LEK A;  2R7U A;  5F1R A;  2M9H A;  3GUD A;  4BUP A;  1FJL A;  2YU9 J;  1ONV A;  2W82 A;  3OS1 A;  4ABZ A;  2OCC H;  2W1O A;  3HEF A;  3LQR A;  4I7H A;  5LGN A;  3K70 C;  3GO5 A;  1OCC H;  3H5R A;  5DEQ A;  4CA0 A;  4IHV A;  4ZDO A;  5GAD J;  1XX5 A;  3IAM 2;  1EH7 A;  2AXL A;  4HZF A;  2EK5 A;  4HX7 A;  4XSX F;  3ZXS A;  4BBS J;  1TQM A;  2K86 A;  3S3N A;  2Z5U A;  2E71 A;  5FD5 A;  2UZK A;  1E3P A;  1RKW A;  1O3T A;  3OOP A;  3ZCO A;  2HTS A;  1E3H A;  2K9Q A;  2ZO4 A;  3HUG B;  4XN0 A;  3OOU A;  5FD6 A;  1HW5 A;  3OR1 C;  3CCV I;  1J2X A;  1OPC A;  2V6E A;  2FQ4 A;  2W57 A;  3VYR B;  1ZRD A;  2P6S A;  3RSN A;  1FY7 A;  1Y8Q B;  1MND A;  5KK1 A;  1R1U A;  1P4A A;  1X2M A;  1H9T A;  2EFP A;  4BAC A;  4ESF A;  1MBH A;  4HEA 2;  2EBI A;  2FBI A;  3DF8 A;  4A3L J;  4PUS A;  4BJ5 C;  1VQ4 I;  2ADU A;  1R1T A;  1W36 C;  2NRA C;  4F93 B;  1LEA A;  1HW2 A;  4F52 A;  3T0Y A;  1TQP A;  3OYB A;  4BE2 A;  2PBI A;  4LK0 F;  2TCT A;  1TBX A;  3OYF A;  2VQG A;  2HPM A;  4FAS D;  4OWR B;  1LVK A;  1DDN A;  2MH2 A;  2X48 A;  1X19 A;  1X3Z B;  2DFH A;  4A3G J;  1HA8 A;  1YS7 A;  1YJ9 I;  2GWR A;  4Q48 A;  1RZ4 A;  1D3Y A;  1U2W A;  4ZYA A;  2ZB9 A;  2L7K A;  2JA5 J;  4JBA A;  4IVN A;  2K9S A;  1R71 A;  2LKS A;  5TIS C;  1D8J A;  3PFI A;  1JJ8 C;  2R7W A;  2ELJ A;  3I59 A;  3HBL A;  1KU9 A;  3M7G A;  1G2H A;  5HDK A;  3HHG A;  2VI6 A;  1OYW A;  3PO2 J;  4DBQ A;  4M3G A;  3VYT B;  3U1K A;  2LSO A;  2QSG X;  2BEO A;  2L7F P;  4XOP A;  1BI0 A;  2CW8 A;  3HOY J;  1IXC A;  3LSI A;  4N9H A;  2E60 A;  4NQW A;  5D5X B;  2JUC A;  2RAE A;  3OL4 A;  2DPU A;  3DLL F;  4R1H A;  1NG7 A;  2VLA A;  3TW6 A;  1YYV A;  1H88 C;  3OYD A;  2QKL B;  2LLK A;  3QP5 A;  1JUP A;  1XD7 A;  2MD5 A;  3P9I A;  1ETV A;  4MNU A;  3J80 Z;  1ORK A;  1VQM I;  1R49 A;  4BQA A;  2V1N A;  1MSF C;  4PJJ A;  2AO9 A;  1NK2 P;  4P96 A;  2F5D A;  1MBK A;  4B48 A;  3S1Q J;  3IWF A;  3B6A A;  2NS7 A;  5HOD A;  1RC9 A;  3TED A;  1IN4 A;  4UY8 I;  3FXU A;  1ZTR A;  2VQL A;  5CLS A;  2CQQ A;  2VKD A;  4NDL A;  1Z91 A;  3OIO A;  4ENJ A;  1B72 B;  1MMN A;  4C3J J;  3GYH X;  3DTI A;  3CMY A;  2IS6 A;  1JKR C;  2DOA A;  3AG1 H;  3WTV C;  2JTV A;  1YW8 A;  4MQV A;  3WTW C;  1Q1V A;  1XDU A;  4AIK A;  2PLY A;  4R8H A;  5DD4 A;  3S14 J;  2XAH A;  1K79 A;  2PMZ N;  2XGE A;  2HVS A;  1IN6 A;  2VPR A;  3BR5 A;  2VJ4 A;  2JVG A;  1YIO A;  1I6X A;  4H4K C;  3LSJ A;  1Y1W J;  1HDD C;  2ZCW A;  3H5A A;  3K9T A;  1R22 A;  2E7X A;  4L9N A;  2VQH A;  2E5Z A;  1P7I A;  2PG4 A;  2YR2 A;  3QAH A;  4GGG A;  3BZK A;  4KJZ A;  3MN2 A;  2BGC A;  4PJL A;  4I02 A;  4XOT A;  1RIO H;  5GAE J;  2ECB A;  3P9C A;  5L3B A;  4M73 A;  2K3P A;  1WFX A;  5E20 A;  5A2Q Z;  3TKY A;  2FBK A;  4L0Z B;  2Z33 A;  3CC4 I;  1WQ2 A;  3E5X A;  1H8A C;  1XG1 A;  3ECO A;  1FYK A;  2AXT C;  2CO5 A;  4A3E J;  3MKY B;  3SDG A;  3VOE A;  4B47 A;  3QOD A;  3QYB A;  5H6Q A;  4I2O A;  1ZG5 A;  3OYH A;  3GTK J;  2XRO A;  2HZT A;  3R0A A;  1UZC A;  3ZRG A;  1W7P D;  1V54 H;  4S04 A;  2XSD C;  2E5N A;  5F04 A;  2CV0 A;  3OV8 A;  2PQ8 A;  2H6C A;  3CCQ I;  3IP4 B;  3JRF A;  4Q47 A;  1MSE C;  3FXK A;  2DPD A;  2EPF A;  5LRS A;  2DTR A;  2ME6 A;  2DMN A;  3DQV C;  2LFB A;  3KPH A;  1EA3 A;  2M8E A;  1K6Y A;  2GXG A;  2NAZ A;  2GLO A;  2PMH A;  3W2A A;  4RAF A;  2L9R A;  2E19 A;  1SD5 A;  1ACI A;  4EJV A;  2WAQ A;  4E7J A;  4RB0 A;  1MW7 A;  3HOV J;  4IF4 A;  3MCZ A;  4AID A;  3J81 K;  3I64 A;  4M6Y A;  1B9M A;  3W6J B;  4E7L A;  3PNV A;  2J5P A;  1RUO A;  1KU7 A;  1I27 A;  2OU2 A;  4M9Z A;  2Z99 A;  5E1W A;  1GLN A;  4C2M J;  1X3U A;  3BG7 A;  5FKO A;  3ULQ B;  2VIX A;  4MFD A;  2A05 A;  3EUH C;  3IKV A;  3BCB A;  5EZH A;  1IXS B;  1GV5 A;  3S8P A;  5DV5 A;  2EFW A;  3C7J A;  3IAS 2;  4WXC A;  1IGN A;  5FO5 A;  4UNO A;  2HDC A;  3BR0 A;  4IXA A;  3DU6 A;  4GYG A;  1G3Y A;  2BZT A;  4OMY A;  2L4A A;  2XF6 A;  2IPQ X;  2B0L A;  5DD8 A;  3QPH A;  3JR9 A;  3H3Z A;  4CCL A;  1YO5 C;  3HOZ J;  4JX4 A;  1XGS A;  1EKE A;  5AIQ A;  3T1B A;  3Q5F A;  1XDS A;  3BG9 A;  1W0T A;  3F3X A;  1I1S A;  4D7M A;  5DUI A;  2DU9 A;  2DA2 A;  3H5N A;  2MLK A;  2VC1 A;  3ZQQ A;  2VT2 A;  3H0D A;  3L2R A;  2O0Y A;  1KQ0 A;  5FRM A;  2K5C A;  5BPD A;  1F4K A;  1UEL B;  2DA3 A;  3CUQ A;  1LFU P;  2KRC A;  3DTK A;  1SFU A;  1XCB A;  4XLA A;  3V7C A;  2ID3 A;  1YW7 A;  3LSM A;  3PM1 A;  4KUM A;  2KDZ A;  3FK7 A;  5D4S A;  2LKP A;  2X4H A;  4KN7 X;  5HDN A;  2GZW A;  1WJB A;  2LH9 A;  2PI0 A;  3GFM A;  1KU2 A;  4IL6 C;  1POG A;  2HR3 A;  4LB6 B;  2PMZ A;  3R61 A;  2QQ9 A;  4V19 K;  2COB A;  1FLI A;  1TNT A;  1X4P A;  3MZ8 A;  2RVC A;  3TGN A;  3B73 A;  2FF4 A;  3QU3 A;  4CZZ A;  3Q9V A;  1U9N A;  5J40 A;  3S15 J;  1QVT A;  1WJD A;  4XLC A;  1JHF A;  5B66 C;  4CHU A;  2N8G A;  5M3M J;  5BOX A;  2X6O A;  2FOW A;  1TWG J;  1IJW C;  3SZP A;  2A6E F;  2CJJ A;  5BS6 A;  2HGC A;  1OYI A;  1J9I A;  1PP7 U;  1JUS A;  3BR3 A;  2KHM A;  1MBJ A;  1WJE A;  2Z3Y A;  1XGN A;  2M0C A;  9ANT A;  4AC0 A;  3KFW X;  3K4C A;  1DGR M;  5J6X A;  4B8X A;  4XR6 A;  2ECC A;  1TZL A;  5LFA A;  2NVY J;  1D1B A;  4XKC A;  1O3Q A;  2VBX A;  4NHJ A;  3CLO A;  3IV5 A;  3GZ6 A;  3RCO A;  3IUO A;  4BU2 A;  3OR2 C;  3OYK A;  5B1A H;  3IRR A;  5B5E C;  5E3O A;  2DJI A;  2Z1D A;  2M8G X;  2FJ1 A;  3P5J A;  2KRH A;  1U0J A;  2W84 A;  3OIQ A;  4PZJ A;  1YTY A;  2E35 A;  2V1X A;  1DUX C;  4LG3 A;  3OIP A;  4A3C J;  5DYM A;  4CGZ A;  2Y69 H;  3HL2 A;  2FX0 A;  2LC2 A;  4YII A;  3BJO A;  2LY2 A;  3WU1 B;  3WOD F;  3ESW B;  4N0B A;  4CCM A;  3FXL A;  3K4J A;  4I01 A;  2DFF A;  2PX9 A;  1NG6 A;  3ML6 A;  3F8N A;  1I1G A;  5ED4 A;  2DI3 A;  1YX3 A;  1W4M A;  1FOX A;  2O03 A;  2WTE A;  2XAG A;  2O6G E;  2QBY B;  2HNH A;  2A5W A;  4BXU A;  5IT9 Z;  4AYB A;  2VJJ A;  1ZLK A;  2AHQ A;  2L54 A;  3H3U A;  3Q0W A;  1WWX A;  3OS0 A;  2F5E A;  3K0L A;  4NUB A;  3WGI A;  3F6O A;  3QOP A;  3HPG A;  3K6G A;  5KHD A;  4ZZD A;  4ZC3 A;  1G4D A;  2CQX A;  2EIL H;  3ABT A;  5GTH C;  1UCR A;  3LST A;  3HG9 A;  5E3M A;  4PGG A;  5D8L B;  3DV8 A;  2EIM H;  2V26 A;  1YI2 I;  3GBG A;  4YFK F;  4L18 B;  2F2E A;  4DYC A;  1BC8 C;  2XGC A;  1S6L A;  1BI3 A;  2JVH A;  3ECH A;  1ZYR F;  2FE3 A;  2K7L A;  3M1C A;  2K4J A;  1MJB A;  3AG2 H;  2LRD A;  4IRG A;  4EM1 A;  1VQ9 I;  4PGH A;  3SYT A;  5JR3 A;  3ZMZ A;  3J7A Y;  1BR1 A;  1TC3 C;  1LQ1 A;  5E8G A;  4KIS A;  2HVQ A;  1GVJ A;  3G2B A;  3KYL A;  2EJR A;  2QQA A;  2WV0 A;  3DEU A;  2A6H F;  1KQ9 A;  1SFE A;  2EIJ H;  4IQ4 A;  1KZH A;  1R4N B;  4CSW A;  2HU9 A;  2OCE A;  5C4J J;  4IRI A;  1JTX A;  4JOM A;  1U78 A;  4LLL A;  4IOA F;  4CZC A;  2R7X A;  3A03 A;  2VC0 A;  3H1C A;  1QA6 A;  3QOE A;  4P1W A;  3TOA A;  3FKJ A;  2HDD A;  2O7O A;  3WGG A;  2WAD A;  3HIF A;  5BQT A;  2ZXH A;  3K4K A;  1R4M B;  1A04 A;  2DLL A;  2H8W A;  4NC6 A;  2XAQ A;  2R7R A;  4YEJ A;  3S1M J;  2QEX I;  3SJM A;  2ELH A;  3BQZ A;  2Y31 A;  3G1L A;  4B1R A;  3OYL A;  4CYC A;  4EJW A;  2L4M A;  3WTS C;  5JI6 A;  4I99 C;  2ZFW A;  2DT7 B;  3G1M A;  2NVQ J;  1HC8 A;  2Y9Y A;  3PQK A;  4FX0 A;  2CV2 A;  1ODD A;  5IYD J;  1DPU A;  4BHC A;  2QYO A;  3CJT B;  1XSX A;  3Q0U A;  1ZLJ A;  2NOG A;  4L9V A;  2HKO A;  2OBP A;  3TDU C;  2ZSH B;  4HLY A;  5ICG A;  3FZV A;  4KIG A;  2H27 A;  2PJR A;  1I39 A;  1J75 A;  3GTG J;  3V4G A;  2R93 J;  1AOY A;  1TWA J;  2GQQ A;  1K7A A;  2L2O A;  1NH3 A;  4BHB A;  3OS2 A;  2L5Q A;  2LY1 A;  1BR2 A;  4A2U A;  2RN7 A;  2M4G A;  2F4I A;  4HA8 A;  3V42 A;  4B3A A;  2L7Z A;  2RKH A;  5EG0 B;  2CFX A;  2OAZ A;  5DM6 F;  4FCY A;  4W1U A;  4RGR A;  2H09 A;  4M9S A;  1H89 C;  2M2E A;  1XS9 A;  3RI4 A;  2CRG A;  3V7R A;  1XTA A;  4HV6 A;  4PFO A;  3KYD B;  1YFH A;  4BXX J;  5H20 A;  1T8I A;  2FXA A;  2NNY A;  1FTT A;  2Q2E B;  2HXI A;  3DKY A;  2JQ7 A;  4XLE A;  1MMA A;  2EA4 A;  2AS5 F;  2E1C A;  4IHX A;  3KP6 A;  4A3I J;  3I0T A;  2E2J J;  1LJ9 A;  3F72 A;  3H9J A;  4ZDL A;  3S3M A;  3OWT A;  2FEZ A;  2KP6 A;  4G8X A;  4OIP F;  1IN7 A;  3OL3 A;  2F6C A;  3F21 A;  4RDU A;  1ZHF A;  1T39 A;  1VQ8 I;  1HDP A;  3PO3 J;  1SMY F;  1W36 D;  4LMY A;  5LLQ A;  1T33 A;  2ZSI B;  4MLO A;  3I55 I;  4ZYH A;  3HTS B;  3GW2 A;  3VSK A;  3DFG A;  2V9P A;  3EUA A;  2L9N A;  5JLX A;  5CQE A;  1JT0 A;  1IN5 A;  4XNF A;  3LWF A;  5FJ8 J;  3GZN B;  4A12 A;  1G6N A;  3A02 A;  1Z3X A;  1ENH A;  1HW1 A;  2X0L A;  2ZXW H;  4UHT A;  2NVX J;  3HOU J;  5CVI A;  3UKG A;  2KKO A;  5KAI C;  4YIR X;  2FNP A;  5ICF A;  1ETK A;  3DPU A;  3G1O A;  2ETH A;  1LKX A;  4RGX A;  3D5S C;  4BDY A;  2L9V A;  2W24 A;  2ISZ A;  2KIF A;  4IPA A;  2PJP A;  3P7N A;  1J59 A;  2MLG A;  5GPA A;  4IEJ A;  3WTZ A;  3I9V 2;  3BCA A;  2FML A;  2XF5 A;  1JGS A;  1KON A;  5JHF A;  1D0X A;  1IDZ A;  1ERD A;  2X1C A;  2RDP A;  2JPC A;  3S2W A;  1A31 A;  1SD6 A;  3MFK A;  2R5Z A;  3L2Q A;  3CZ6 A;  4ZDP A;  1JKO C;  3S16 J;  1AU7 A;  3TMO A;  2HI3 A;  2HOA A;  4HOB A;  3MKW B;  1O3S A;  2IW5 A;  1QZE A;  5EF6 A;  3N97 A;  1PDN C;  1SFK A;  4PCQ A;  4HYE A;  2IGK A;  4JYK A;  4KN4 X;  5FKL A;  4HX8 A;  1T2K A;  4PSW A;  3S93 A;  1MNE A;  2KJC A;  3SXY A;  4UB6 C;  3HM5 A;  2VOP A;  1VQL I;  3JRE A;  4M3D A;  3I58 A;  2DQR A;  4UVA A;  1FIA A;  3RPQ A;  1L0O C;  3LFU A;  1QPM A;  2XAU A;  3ZP5 A;  5ILU A;  1GHC A;  1XSD A;  2VOO A;  3HKZ N;  3QYE A;  1WJA A;  3JW4 A;  3B02 A;  2KZG A;  1YIJ I;  1FT9 A;  1OMI A;  2F4O B;  4G6T B;  1WJ5 A;  4HSR A;  2ZME A;  3DKW A;  2XF7 A;  2V9K A;  2R7V A;  4HBL A;  1ZRF A;  2YS9 A;  5GAH J;  3VOD A;  3TO7 A;  3KLN A;  2VBZ A;  1SAX A;  2ISY A;  5IP7 J;  4YRV A;  1FPQ A;  4HF1 A;  5DCM B;  5E1Z B;  3FWE A;  3QU6 A;  1T56 A;  5IPA A;  4Y15 A;  3CO6 C;  3NAU A;  1ETX A;  3D1N I;  1KYW A;  5J8F A;  2K3F A;  2VE8 A;  1JGG A;  2P5L C;  1ZQ3 P;  4B44 A;  5CKT A;  4EAT A;  3SEZ A;  4CYD A;  2BW3 A;  4FET A;  1B8I A;  2HS5 A;  2EFN A;  4E7Z A;  4WCG A;  2VBW A;  5B1B H;  3RQI A;  1LPQ A;  4E70 A;  3BRO A;  3WU0 A;  4C2T A;  1Y56 A;  2FMY A;  2ELK A;  2G7H A;  3DPL C;  2CWE A;  3F6V A;  4F55 A;  4ZTJ A;  1TNS A;  3T8R A;  2LR8 A;  1R36 A;  1YE9 A;  3EDP A;  2GIZ A;  3DTE A;  3QYF A;  4JQF A;  5EJC A;  3VEP A;  4IO9 F;  1WZ2 A;  3CC2 I;  2HYG D;  1NHA A;  1S8N A;  1WH5 A;  3ZOB A;  1MD0 A;  3CDI A;  2JA6 J;  2GXA A;  2JT1 A;  3J7A O;  4U0V A; 
#chains in the Genus database with same CATH homology
 1EH6 A;  4L0Y B;  4G6D A;  4KFC A;  5HS7 A;  4QLC U;  3ERE D;  4EJU A;  2MH9 A;  5HS9 A;  5ILV A;  4KDP A;  1U5T A;  1P92 A;  3E97 A;  3TQN A;  3R60 A;  4IHS A;  1ZGA A;  3RTR A;  3WE2 A;  4M72 A;  3RPU A;  5ERI A;  3SFZ A;  1ON2 A;  5L3G A;  1MKM A;  1W5T A;  3WGH A;  3ZMS A;  4AIJ A;  3KP3 A;  3SHF A;  1FOK A;  1MDM A;  4EQQ A;  1KU3 A;  4BHP A;  4YFX F;  4ENM A;  5HLI A;  1U5T C;  2D1V A;  2GA1 A;  2P6T A;  2MC3 A;  4MEY F;  3F22 A;  2CYY A;  5JFR A;  4ZH4 F;  2RC4 A;  3I5U A;  1KQ8 A;  3M9A A;  4ZZL A;  1T6S A;  2Q0O A;  4ETS A;  5LGU A;  1L3L A;  4HQE A;  2XKP A;  2ZXJ A;  1XCV A;  3HRU A;  3I4P A;  1WSU A;  3GF2 A;  1FBQ A;  3I71 A;  1R58 A;  1BIB A;  2L3D A;  1BI2 A;  2HFH A;  1G3W A;  3NQO A;  5DCF A;  4GCV A;  3F8B A;  2COM A;  1SD7 A;  4ZYG A;  2GIV A;  2XRN A;  4U7D A;  4M6X A;  3BDD A;  1F5T A;  2BYV E;  2V1U A;  4LJZ F;  4YFN F;  1STZ A;  2NS0 A;  4AVP A;  3FXQ A;  4UUV A;  1BI1 A;  1REP C;  2R3S A;  3O6B B;  2HOE A;  1K6O A;  2FA5 A;  4KMF A;  3GWZ A;  3IC7 A;  5K5Q A;  2DW4 A;  3ZQ7 A;  4DQ2 A;  2FNA A;  3JSO A;  3I54 A;  1KGS A;  3FMS A;  5CVR A;  1BOA A;  1HKS A;  1CF7 A;  4BYY A;  4MGR A;  5D6F A;  4UVC A;  3HSE A;  3CJN A;  5L3C A;  3G73 A;  4O5V A;  2Q8K A;  4KIC A;  2FSW A;  3E6M A;  1B59 A;  1ZGJ A;  4EMS A;  4WWC A;  4OU0 A;  1VTN C;  4A0Z A;  1ZN2 A;  3M1E A;  2E1N A;  2A68 F;  4GO1 A;  5FGM A;  3FM3 A;  3KCC A;  2M45 A;  4RAZ A;  2HWV A;  3F8F A;  5IT3 A;  3CTA A;  2V6C A;  5F64 A;  4EM0 B;  2P7V B;  1G3T A;  2LF7 A;  1R7J A;  5D5U B;  2XAF A;  1WI9 A;  3TOB A;  5LGT A;  2VXZ A;  3COA C;  4EGY A;  1FNN A;  3E6B A;  2OQG A;  1LNW A;  1S29 A;  2EA2 A;  2RV8 A;  4EVI A;  2DT5 A;  1T0F A;  5ILS A;  3IWZ A;  2DO7 A;  2F5C A;  2NYX A;  3SQN A;  4ZYE A;  4G94 A;  4I0A A;  2P5K A;  3J81 Z;  4NB5 A;  4I0B A;  3GFI A;  3WG9 A;  2PMU A;  4MTE A;  4UXN A;  5E17 F;  2YX7 A;  1FYL A;  1KYZ A;  4KT5 C;  1IRG A;  5FFX A;  2QQB A;  3WTU C;  5J8C A;  6PAX A;  1ULY A;  2K27 A;  3R4K A;  2VBY A;  1P6R A;  3ZMU A;  4I98 B;  4EGZ A;  1G3S A;  3N4M A;  2BBY A;  2VE9 A;  4M9X A;  2L01 A;  4P55 A;  4ENK A;  2R7D A;  2YU3 A;  1TLH B;  1FSE A;  2KIM A;  4WX9 A;  2RGV A;  1WRJ A;  1Z05 A;  3JAM Z;  2VON A;  4G6Q A;  1BJA A;  2RQP A;  2KIU A;  3HUG A;  3ZMT A;  2V1D A;  3IHU A;  5HLH A;  3FHZ A;  3EET A;  1PP8 F;  2VOD A;  1RI7 A;  1K78 B;  3KEQ A;  4Q4Z F;  4S05 A;  2EV6 A;  1P4W A;  5DCM A;  5LHG A;  1AWC A;  1BN5 A;  1J7K A;  2IRF G;  1O57 A;  3HHH A;  5FB2 A;  4KIB A;  5LBQ A;  4XRF A;  2QZ8 A;  3JSP A;  1XGO A;  2NNN A;  2XAS A;  2OQR A;  4M74 A;  1LB2 A;  3BOQ A;  4Z2Y A;  1XGM A;  3BZ6 A;  1D8K A;  2XVC A;  1ZG1 A;  2G7U A;  2QM3 A;  3MAJ A;  4OIR F;  1Y0U A;  2ZBK A;  2HYF A;  4M71 A;  2QLZ A;  1ZRE A;  4U0Y A;  5CVV A;  3M8E A;  3P9K A;  5LEJ A;  3T5X A;  2XGX A;  3KP2 A;  3BPX A;  3QP6 A;  2LF8 A;  1YS6 A;  4Q5S F;  5D4R A;  1MGT A;  1EV7 A;  2V79 A;  2P8T A;  4OIN F;  2C6Y A;  1FBU A;  1IF1 A;  4UVB A;  2IVM A;  3FF5 A;  1USS A;  2FOK A;  1DP7 P;  4PDK A;  3E5U A;  5A2Q K;  2DK8 A;  2HQR A;  3F8C A;  1P2F A;  1Q1H A;  1Z6T A;  1Z6R A;  2JRT A;  2HKX A;  3KZZ A;  2HTJ A;  5EEH A;  2CQK A;  1HQC A;  3EUH A;  3LFK A;  1GXP A;  1IAW A;  2QVO A;  4ZYD A;  3LQQ A;  2Y0M A;  3CO7 C;  2JSC A;  2PEX A;  1HKT A;  4ENN A;  2HEO A;  2TDX A;  1U5T B;  2DK5 A;  2J5O A;  1RNL A;  1XB4 A;  1WKM A;  2L02 A;  1SD4 A;  4A0X A;  2H6B A;  1UFM A;  3JTH A;  1QBJ A;  3KET A;  4G9Y A;  1FYM A;  3HSR A;  1ZRC A;  5D5V B;  4G7Z F;  3FXR A;  4MHG A;  1FP1 D;  3MZY A;  3GFL A;  1V3F A;  2H94 A;  2ZNZ A;  1RUN A;  2K02 A;  3KEO A;  1ZH5 A;  4WXH A;  3NEU A;  3GXO A;  3HRT A;  2OA4 A;  4L5J A;  1O7L A;  5D5W B;  3L00 A;  1W7P B;  3RKX A;  4Y17 A;  5HVQ C;  4ESJ A;  3HTU A;  4XBF A;  3PQJ A;  5AON A;  3ABU A;  2P4W A;  2QUF A;  1LDD A;  4P9U A;  5TJJ A;  1QGP A;  1ZG3 A;  2ZNY A;  4K2E A;  4R79 A;  1MJ9 A;  3V8K A;  3RKY A;  2LNB A;  4MQ9 F;  1OR7 A;  1PUE E;  3KP5 A;  2D2W A;  1J5Y A;  2VN2 A;  2K4B A;  3FX3 A;  5E18 F;  1MDM B;  4RB3 C;  4YG2 F;  5FLX Z;  5JHU A;  2F5F A;  3RKW A;  1XN7 A;  3KP7 A;  4O3M A;  2DFI A;  1E2X A;  2DAO A;  1R23 A;  1R5G A;  3VFZ A;  4WXD A;  3ZMD A;  4WF2 A;  4KA4 A;  2BV6 A;  4H0E A;  1B1B A;  1UST A;  3GVA A;  1BM9 A;  1JXS A;  1JHH A;  3BPV A;  4XLN F;  4Y13 A;  3M8F A;  1K78 A;  2V9V A;  4F7Z A;  1YW9 A;  1LDK B;  4U0W A;  5F6F A;  3F23 A;  4TV7 A;  4G7O F;  3CUQ C;  1DPR A;  1S7O A;  4IHT A;  4IRH A;  4QWQ A;  3NRV A;  5HOO A;  1I5Z A;  2A07 F;  1E17 A;  4A5N A;  2RNJ A;  5CYV A;  4I09 A;  3K1P A;  2O61 A;  1U3E M;  1TQI A;  4U7B A;  2G9W A;  3Q9S A;  2A3S A;  1XSV A;  1J0R A;  2R7F A;  2UXX A;  3GLX A;  4L9T A;  3GEZ A;  3O2P E;  1TW2 A;  3FMR A;  2Q2E A;  1CF7 B;  4LG0 B;  3BJA A;  4BH9 A;  5CJ9 A;  4LK1 F;  1S3J A;  3JAM K;  3TO6 A;  2FBH A;  1H9G A;  4CO8 A;  3H92 A;  4BNC A;  3L9F A;  4KIF A;  2QEN A;  5EEG A;  3ZN0 A;  1EH8 A;  3V7S A;  2EWN A;  3WTX C;  5D6E A;  2STW A;  2W25 A;  4ASN A;  1F1Z A;  1LVA A;  3G3Z A;  2P7C B;  1FSH A;  2YX4 A;  3J80 K;  5DUK A;  1T98 A;  2GXB A;  4KNY A;  3DPT A;  3RYR A;  5HLG A;  3I59 B;  4MTD A;  3I53 A;  4D0P A;  2CG4 A;  2DBB A;  3K69 A;  2A69 F;  2XAJ A;  3BJ6 A;  3FMQ A;  4OIQ F;  4RS8 A;  2GA2 A;  3HYI A;  1OYY A;  2M5W A;  3GX4 X;  1HST A;  1FP2 A;  1MJA A;  3K1N A;  2UXN A;  3GZ5 A;  3RJP A;  1D5V A;  2IP2 A;  2VT3 A;  4WK8 F;  2XIG A;  1FZP B;  1T38 A;  1IN8 A;  3SZT A;  3C3W A;  5LRR A;  1LEB A;  4UV8 A;  2IA1 A;  4EJO A;  5L3D A;  4YIF A;  2QBY A;  1JE8 A;  5IT9 K;  5BPI A;  2IT0 A;  2EFO A;  3IKT A;  2FQ3 A;  1YLF A;  5FLX K;  3O3K A;  3IRQ A;  3QPT A;  3VB2 A;  2IJL A;  4HDV A;  1BC7 C;  3ZN1 A;  1QO0 D;  2Y48 A;  5D8K B;  5LHH A;  3KP4 A;  3V8L A;  3EYY A;  3BWG A;  5K5R A;  1Z9C A;  1ON1 A;  2M1B A;  4ESB A;  5JVT A;  2W85 A;  3LA7 A;  1XMA A;  2EV0 A;  3DXJ F;  4HQM A;  2YPR A;  4AWX B;  5E1X A;  4EM2 A;  3IL2 A;  4U88 A;  2O3F A;  1IUY A;  2OD5 A;  3AAF A;  1KA8 A;  2CW0 F;  2D45 A;  3LAP A;  3L2C A;  3W6K B;  1LDJ A;  2ESN A;  2A5Y B;  4LFU A;  3WE3 A;  3ROU A;  1QQI A;  3L09 A;  5TRD A;  3HOT A;  4LLN A;  4FHT A;  4HW0 A;  3V8J A;  5ICE A;  2JPB A;  4AIH A;  3D0S A;  1FC3 A;  1Z1D A;  3U2R A;  1U8R A;  4JK1 X;  2YSR A;  3R6S A;  1O3R A;  3ISP A;  4P5O A;  3CDH A;  3E6C C;  2Z9O A;  3HOS A;  5L3F A;  5H6R A;  1H0M A;  1B4A A;  5FFZ A;  2Y75 A;  1O7F A;  4XLP F;  3RDI A;  4O6J A;  2ZKZ A;  2M30 A;  3KE2 A;  1IW7 F;  4LGW A;  3F8M A;  4L5I A;  3K1M A;  1ZAO A;  1XMK A;  1W5S A;  3C1D A;  4LG0 A;  2M87 A;  2STT A;  2PFB A;  3HRM A;  1UB9 A;  5HS8 A;  1OKR A;  3CUO A;  4P9F A;  1BIA A;  2WC2 A;  1FBS A;  3K2Z A;  1IRF A;  1TTY A;  3WTT C;  4HX4 A;  1IXR C;  4CXF A;  4A5M A;  2OZU A;  4HAM A;  1HBX G;  4OOI A;  3TO9 A;  2IA0 A;  5HDG A;  4HF0 A;  4LD5 A;  4HDU A;  3KLO A;  3R0J A;  3BY6 A;  4UV9 A;  3LAJ A;  2XV4 S;  5ICC A;  4FT8 A;  3QRF F;  1SMT A;  5DDG A;  2KRF A;  1GXQ A;  3E6D A;  1BBY A;  3U1D A;  1HKQ A;  4A0Y A;  2LDU A;  1F9N A;  3C18 A;  1FWZ A;  4KYW A;  1R1V A;  5AIP A;  4OMZ A;  4EV0 A;  1P4X A;  3MZH A;  2GAU A;  1FX7 A;  2E7W A;  4GYI A;  2EV5 A;  1YQA A;  3REO A;  4XSZ F;  4RB2 C;  5LHI A;  4GXO A;  3D5L A;  2ZME B;  4HV5 A;  1B9N A;  2DQL A;  3E5Q A;  4A6E A;  4RB1 A;  1R00 A;  1R5H A;  3L7W A;  1UHW A;  4DNC A;  1QNT A;  2PN6 A;  1QZZ A;  2XKO A;  4FX4 A;  1B6A A;  2ACJ A;  4HF2 A;  4RAY A;  5K1Y A;  4LB5 A;  2ESH A;  4CIC A;  3CUQ B;  3JTG A;  2BE5 F;  2OZ6 A;  3EYI A;  4L9J A;  4HLX A;  5KVR A;  2FU4 A;  2IA2 A;  3KZY A;  2WWY A;  4RGS A;  2O8X A;  2KJB A;  5L3E A;  3MQ0 A;  3HRS A;  4LLG F;  3FM5 A;  3HSF A;  5K5O A;  2A61 A;  1U6G A;  2QWW A;  5BMZ A;  2FRH A;  4AD9 A;  2MBF A;  3DP7 A;  1C0W A;  1SFX A;  3RIR A;  2P5V A;  3ZPL A;  1MZB A;  3T8T A;  5CVJ A;  4A6D A;  1IZ1 A;  1HXD A;  4MEX F;  3E3V A;  3LA2 A;  3TDZ C;  3MWM A;  2XHK A;  2JZY A;  2UWM A;  2CGP A;  4G7H F;  3ZMV A;  3GFJ A;  1TW3 A;  2XUB A;  4EJT A;  1Z7U A;  3BP8 A;  3LA3 A;  4RGU A;  1YG2 A;  3WTY C;  2MA3 A;  4B09 A;  2EFQ A;  2CSO A;  1UHM A;  4BAY A;  4N9I A;  1QZY A;  1V4R A;  2HQN A;  4OIO F;  4IJA A;  3MEX A;  2ZJ2 A;  3RYP A;  4ON0 A;  3EQL F;  1CGP A;  5CVU A;  1S7A A;  1ZAR A;  2D1H A;  2EB7 A;  5E8I A;  3ELK A;  3U9G A;  1W7P A;  1HSJ A;  4KMU X;  5LEK A;  5F1R A;  3GUD A;  1ONV A;  4I7H A;  3LQR A;  5LGN A;  3GO5 A;  5DEQ A;  1EH7 A;  2AXL A;  4HZF A;  2EK5 A;  4HX7 A;  4XSX F;  1TQM A;  2K86 A;  2Z5U A;  5FD5 A;  2UZK A;  1O3T A;  3OOP A;  2HTS A;  2ZO4 A;  5FD6 A;  1HW5 A;  1J2X A;  1OPC A;  2W57 A;  1ZRD A;  2P6S A;  1FY7 A;  5KK1 A;  1R1U A;  1P4A A;  1H9T A;  2EFP A;  4ESF A;  2FBI A;  3DF8 A;  2ADU A;  1R1T A;  2NRA C;  1HW2 A;  1LEA A;  3T0Y A;  1TQP A;  2PBI A;  4LK0 F;  1TBX A;  1DDN A;  2MH2 A;  1YS7 A;  2GWR A;  4Q48 A;  1RZ4 A;  1D3Y A;  1U2W A;  4JBA A;  4IVN A;  1D8J A;  3PFI A;  3I59 A;  1KU9 A;  3M7G A;  5HDK A;  3HHG A;  1OYW A;  2LSO A;  2BEO A;  1BI0 A;  1IXC A;  4N9H A;  4NQW A;  5D5X B;  2DPU A;  4R1H A;  1YYV A;  3QP5 A;  1XD7 A;  2MD5 A;  3P9I A;  4MNU A;  3J80 Z;  4BQA A;  4P96 A;  2F5D A;  3IWF A;  1IN4 A;  3FXU A;  5CLS A;  1Z91 A;  4ENJ A;  3GYH X;  3WTV C;  2JTV A;  1YW8 A;  4MQV A;  3WTW C;  2PLY A;  1XDU A;  4AIK A;  4R8H A;  5DD4 A;  2XAH A;  1K79 A;  1IN6 A;  1YIO A;  1I6X A;  2ZCW A;  3K9T A;  1R22 A;  2E7X A;  4L9N A;  2PG4 A;  2YR2 A;  3QAH A;  4GGG A;  2BGC A;  4I02 A;  1RIO H;  3P9C A;  5L3B A;  4M73 A;  5E20 A;  5A2Q Z;  3TKY A;  2FBK A;  4L0Z B;  2Z33 A;  1WQ2 A;  3E5X A;  3ECO A;  1FYK A;  2CO5 A;  3VOE A;  5H6Q A;  4I2O A;  1ZG5 A;  2XRO A;  2HZT A;  3R0A A;  1W7P D;  4S04 A;  3OV8 A;  2PQ8 A;  2H6C A;  4Q47 A;  2DPD A;  5LRS A;  2DTR A;  3DQV C;  2M8E A;  2GXG A;  2NAZ A;  2PMH A;  1SD5 A;  4EJV A;  4RB0 A;  4IF4 A;  3MCZ A;  3J81 K;  3I64 A;  4M6Y A;  1B9M A;  3W6J B;  2J5P A;  1RUO A;  1KU7 A;  1I27 A;  2OU2 A;  4M9Z A;  2Z99 A;  5E1W A;  1X3U A;  3ULQ B;  3IKV A;  1IXS B;  2EFW A;  5DV5 A;  3C7J A;  4WXC A;  5FO5 A;  4UNO A;  2HDC A;  4IXA A;  4GYG A;  1G3Y A;  4OMY A;  2L4A A;  2IPQ X;  2B0L A;  5DD8 A;  3QPH A;  3H3Z A;  1YO5 C;  1XGS A;  5AIQ A;  3T1B A;  3Q5F A;  1XDS A;  3F3X A;  1I1S A;  5DUI A;  2DU9 A;  2MLK A;  2VC1 A;  2VT2 A;  2O0Y A;  1KQ0 A;  5BPD A;  1F4K A;  3CUQ A;  1SFU A;  1XCB A;  3V7C A;  1YW7 A;  4KUM A;  5D4S A;  2LKP A;  2X4H A;  4KN7 X;  5HDN A;  2GZW A;  2PI0 A;  3GFM A;  1KU2 A;  2HR3 A;  4LB6 B;  3R61 A;  2QQ9 A;  1FLI A;  1TNT A;  2RVC A;  3TGN A;  3B73 A;  2FF4 A;  3QU3 A;  4CZZ A;  3Q9V A;  1JHF A;  4CHU A;  5BOX A;  3SZP A;  2A6E F;  5BS6 A;  2HGC A;  1OYI A;  1J9I A;  1PP7 U;  2Z3Y A;  1XGN A;  3KFW X;  5J6X A;  4B8X A;  1O3Q A;  2VBX A;  4NHJ A;  3CLO A;  3GZ6 A;  3IRR A;  2W84 A;  4PZJ A;  1YTY A;  2V1X A;  1DUX C;  5DYM A;  4CGZ A;  4YII A;  3BJO A;  3WU1 B;  3WOD F;  4N0B A;  4I01 A;  3ML6 A;  3F8N A;  1I1G A;  5ED4 A;  2DI3 A;  1W4M A;  2O03 A;  2WTE A;  2XAG A;  2O6G E;  2QBY B;  5IT9 Z;  4BXU A;  1ZLK A;  2L54 A;  3H3U A;  1WWX A;  2F5E A;  3K0L A;  3WGI A;  3F6O A;  3QOP A;  4ZZD A;  1G4D A;  3ABT A;  1UCR A;  3LST A;  4PGG A;  5D8L B;  3DV8 A;  4YFK F;  4L18 B;  2F2E A;  1BC8 C;  1S6L A;  1BI3 A;  3ECH A;  1ZYR F;  2FE3 A;  2K7L A;  2K4J A;  1MJB A;  4IRG A;  4EM1 A;  4PGH A;  5JR3 A;  3ZMZ A;  1LQ1 A;  5E8G A;  1GVJ A;  2EJR A;  2QQA A;  2WV0 A;  3DEU A;  2A6H F;  1KQ9 A;  1SFE A;  4IRI A;  1U78 A;  4LLL A;  2VC0 A;  3TOA A;  3WGG A;  3HIF A;  5BQT A;  1A04 A;  2DLL A;  2XAQ A;  2ELH A;  4EJW A;  2L4M A;  3WTS C;  5JI6 A;  2ZFW A;  3PQK A;  4FX0 A;  1ODD A;  1DPU A;  4BHC A;  2QYO A;  1XSX A;  1ZLJ A;  4L9V A;  3TDU C;  2HKO A;  2OBP A;  4HLY A;  2H27 A;  5ICG A;  3FZV A;  4KIG A;  1J75 A;  3V4G A;  1AOY A;  2GQQ A;  1K7A A;  4BHB A;  4A2U A;  2RN7 A;  4HA8 A;  2RKH A;  2CFX A;  2OAZ A;  4RGR A;  2H09 A;  4M9S A;  3RI4 A;  3V7R A;  4HV6 A;  1YFH A;  5H20 A;  2FXA A;  2NNY A;  2AS5 F;  2EA4 A;  2E1C A;  3KP6 A;  3I0T A;  1LJ9 A;  3F72 A;  2FEZ A;  4G8X A;  4OIP F;  1IN7 A;  3F21 A;  1ZHF A;  1T39 A;  1SMY F;  4LMY A;  5LLQ A;  4ZYH A;  3HTS B;  3GW2 A;  3DFG A;  1IN5 A;  3LWF A;  4A12 A;  1G6N A;  1HW1 A;  2X0L A;  4UHT A;  5CVI A;  2KKO A;  2FNP A;  5ICF A;  4RGX A;  2ETH A;  2W24 A;  2ISZ A;  2KIF A;  4IPA A;  2PJP A;  3P7N A;  1J59 A;  2MLG A;  3WTZ A;  2FML A;  1JGS A;  2RDP A;  2JPC A;  3S2W A;  1SD6 A;  3MFK A;  4HOB A;  1O3S A;  2IW5 A;  3N97 A;  1PDN C;  4PCQ A;  4HYE A;  4KN4 X;  4HX8 A;  1T2K A;  2KJC A;  3SXY A;  2VOP A;  3I58 A;  2DQR A;  4UVA A;  3RPQ A;  1L0O C;  1QPM A;  3ZP5 A;  5ILU A;  1GHC A;  1XSD A;  2VOO A;  3JW4 A;  3B02 A;  1FT9 A;  1OMI A;  2ZME A;  3DKW A;  4HBL A;  1ZRF A;  3VOD A;  3TO7 A;  3KLN A;  2VBZ A;  1SAX A;  2ISY A;  1FPQ A;  4HF1 A;  5DCM B;  5E1Z B;  3FWE A;  3QU6 A;  4Y15 A;  3CO6 C;  1KYW A;  5J8F A;  2VE8 A;  2P5L C;  4CYD A;  2HS5 A;  2EFN A;  4WCG A;  2VBW A;  4E70 A;  3BRO A;  3WU0 A;  2FMY A;  2G7H A;  3DPL C;  2CWE A;  3F6V A;  1TNS A;  3T8R A;  4CDG A;  1R36 A;  3VEP A;  3EDP A;  4JQF A;  2HYG D;  1NHA A;  1S8N A;  1MD0 A;  2JT1 A;  3J7A O;  4U0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...