1WGXA

Solution structure of rsgi ruh-022, a myb dna-binding domain in human cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
GSSGSSGDKEWNEKELQKLHCAFASLPKHKPGFWSEVAAAVGSRSPEECQRKYMENPRGKGSQKHVTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords KIAA1903 protein
publication title Solution structure of RSGI RUH-022, a myb DNA-binding domain in human cDNA
rcsb
source organism Homo sapiens
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wgxA00
1IV6A 2CJJA 2JWTA 3Q0VA 5IP7J 1TWHJ 5IYBJ 3B6CA 2VI6A 1VI0A 5C4XJ 1ZTRA 5FJ8J 3H3VK 4B3AA 4AYBN 1OCPA 2MGQA 3FK7A 2M8GX 1BA5A 5EZHA 2MW8A 3CMYA 4QTRA 3TP3A 3MVPA 4RDUA 1ENHA 4UUSA 2WV1A 1JTYA 1JKRC 1K61A 2L7MP 2LVSA 5F0CA 2R93J 4BBSJ 1JJ6C 1IDZA 1TWAJ 1YRNA 2K40A 2XGDA 4G12A 4MFEA 2P81A 3ZQGA 2EBIA 2DMPA 3O8HA 2LK2A 2NVYJ 1VNDA 2LKXA 1T33A 2LP0A 3GTOJ 5E3NA 4D5CA 1LFBA 2DA1A 1ETKA 1W0TA 3S16J 3JRHA 2L7ZA 5IOYA 3M4OJ 4XRSG 2HOAA 1WCMJ 2JA5J 5EG0A 3NARA 2CUFA 2DA2A 1ETOA 4DW6A 2YUSA 1WH5A 2MG4A 1ORKA 2FD5A 4RBOA 1APLC 4DZJA 1NK3P 4IHVA 1BJZA 4JP0A 3ZQFA 2RAEA 1H89C 1H88C 1HCRA 4D7MA 1VFCA 1LFUP 3A02A 3GTPJ 1UHSA 2DA4A 4Y7NJ 3C2BA 3JRFA 4MIMA 1AU7A 1TWFJ 2CRGA 2NVXJ 3OOUA 2R7ZJ 1T56A 3LSRA 1AKHA 5M5YJ 2GBYA 5M5WJ 3K2AA 4MLOA 3ZQLA 2EZIA 4HNVA 4D7NA 1TWCJ 1Z0XA 3IH2A 2B63J 5IYDJ 1A5JA 1HDPA 2R92J 2DMTA 5FLMJ 5J1YA 3A01B 1GT0C 2HYJA 2NVTJ 4FISA 3JRIA 1SFOJ 4XRSA 1P7JA 2HDDA 2HXOA 1VF9A 2CQQA 3HEFA 5K7HA 3LNQA 1ZGWA 1ZK8A 2E2IJ 4C3IJ 1YRNB 1IG7A 2XPWA 1R9TJ 3LSGA 4A3MJ 1PUFA 4J19A 3HGYA 4L5EA 2R0QC 4GFBA 3PO3J 3RZOJ 5BNGA 1U78A 2XB5A 1ETYA 3S1MJ 3HBLA 1MBFA 1JTXA 4BY1J 2ME6A 5EF6A 5EEAA 4C3HJ 5IYCJ 3ZQIA 5C3EJ 4X1EA 1HF0A 1QVTA 2DN0A 3K7AJ 2CQXA 2ZB9A 1GV2A 2IAIA 2D5VA 4I6ZA 4M6VA 3BTCA 2YU9J 1K83J 3S2DJ 3E7LA 4B1RA 2AHQA 4BKXA 2M9HA 5GPCA 3TW7A 3GTJJ 5DTDA 2L7FP 1IUFA 2LR8A 2XB0X 4A3EJ 1JT0A 1ETVA 1GVDA 4JX5A 2VKEA 4A3IJ 3LOCA 1AKHB 1F43A 4M3EA 4M3GA 2DMQA 3PM1A 3RKQA 3IV5A 3A01A 2VUMJ 3JRGA 2N8GA 1WH7A 4FTHA 3IH4A 2DMNA 1IJWC 3GTLJ 2X6OA 3HGGA 1IRZA 3FKIJ 2LY9A 3I4NJ 3MN2A 1BW5A 1MBHA 1MH3A 2WAQN 4XIDA 1HOMA 2JJ7A 2JK3A 3BG9A 1UG2A 2M34A 2R5YA 1NTCA 1QPIA 1B8IB 5FKLA 1Y1WJ 2E1OA 1E3OC 2ID3A 3OSFA 3HOYJ 2OF7A 4AC0A 2YS9A 1OFCX 5J3LA 5F1JA 3BR1A 3BTIA 4FE7A 1O4XA 1PUFB 1CQTA 1RPWA 2GM4A 1POGA 2HXIA 2LLKA 1ZR4A 1XS9A 1GV5A 5K7ZA 3F0CA 2O9LA 2EZLA 5M3FJ 2K9NA 3BG5A 4BXXJ 1EF4A 3BG3A 3HB9A 2FJ1A 4A3LJ 1LE8B 2L0KA 5IPAA 1WGXA 3HOZJ 5GP9A 4CYCB 1UMQA 2NVQJ 3S1QJ 2CUEA 1IGNA 5FLVA 1I6HJ 2HQ5A 1FJLA 1JUSA 3ZQHA 3W6VA 2JA7J 4DYRA 2DJNA 1X2NA 1HDDC 1RETA 4I76A 3GTMJ 3QQAA 1XG1A 2I10A 2H1KA 2EZHA 3GTKJ 3CCYA 1D5YA 1B72B 3TEDA 1JKOC 3HM5A 4JX4A 3B6AA 5EZGA 2R5ZB 2VPRA 2HOTA 3BR2A 5E3OA 3S17J 2HI3A 2X9DA 1JUPA 3SDGA 1JGGA 4ABZA 1FIAA 1TWGJ 2EQRA 2JN6A 3VPRA 1NK2P 1JJ8C 2VKVA 4XK4A 4S0HB 4C3JJ 2GLOA 2ECBA 3FK6A 3ZQCA 4QIWN 2NS7A 2TRTA 1S7EA 3RZDJ 4XRMA 1B8IA 3BQYA 2Y30A 4JX6A 1I50J 3LSPA 4IHXA 1U9NA 3TW6A 3CQZJ 2QCOA 1HLVA 2WB1N 4M3FA 1RKWA 2MSYA 1W0UA 2R5YB 3Q0UA 4A93J 3BQZA 3BTLA 1FEXA 5EGOB 2DTZA 3TP0A 1QRYA 5F0FA 3JRBA 1MH4A 2Y2ZA 5EDNA 2TCTA 4A3GJ 2JA6J 4QSHA 1LE8A 3JR9A 4MFDA 4DYQA 2PMZN 1WPKA 3HOWJ 4CYCA 3FIWA 1RESA 5K7FA 2ID6A 1QVUA 1FIPA 5F27A 5FKNA 3OIOA 2M0CA 1MBKA 9ANTA 1MSFC 3S1RJ 2DA5A 1B72A 2FQ4A 2R5ZA 1MNMC 1RR7A 1U8BA 4Y52J 3WHCA 3RQIA 4FE4A 2EZKA 5DS9A 4FCYA 4BBRJ 4A3FJ 3BR3A 3NAUA 2COBA 2Y0SN 2E2JJ 2FX0A 4IHWA 1IC8A 3L1PA 4V2FA 1ETWA 1X2MA 2IEKA 1H8AC 2XGCA 1Z77A 5C4JJ 1AHDP 2EH3A 1OJLA 5IP9J 1DU0A 4XICA 5E3LA 3QPSA 5HODA 3S14J 1WI3A 2L9RA 2G0EA 4DZPA 1DU6A 5FKOA 5EGOA 2KDZA 4B4CA 2DA3A 3FISA 5J1RA 1A6IA 1ZR2A 1BW6A 3G1MA 3S2HJ 5E3MA 2LD5A 2ECCA 4A3CJ 2OPTA 1XC5A 1I3QJ 2XPVA 4A69C 4IEJA 3I4MJ 5EYRA 4M3BA 3HDDA 2LFBA 4V2GA 1JKPC 3JRCA 2E19A 1MSEC 2NOGA 5IP6A 3WHBA 1JUMA 3JRAA 1JKQC 3ZOBA 1MBGA 1ETQA 3JRDA 2E2HJ 1GUUA 4W1UA 3HKZN 2K9QA 4A3KJ 4DYCA 3QPLA 3GTQJ 2Y9YA 3Q3SA 2NS8A 4M3DA 1P7IA 1ITYA 4LOCA 2HOSA 1U9OA 2H8RA 2IBDA 2Y31A 3OSGA 1X58A 2W48A 1RKTA 2K9SA 3BT9A 4NDLA 3D1NI 3HOXJ 1JT6A 3BR0A 2AO9A 3BTJA 1Y1VJ 1IDYA 3IH3A 4A3JJ 5F04A 2DA6A 2JMWA 2CU7A 5J1UA 3DEWA 2ME0A 2JA8J 2QF7A 3O8GA 1FTZA 1TC3C 2ELKA 2O7OA 3BR6A 2X48A 1G2HA 2XPUA 4UUTA 3GBGA 1Q1VA 5GPAA 4UUSB 2DA7A 3Q0WA 3SFIA 5M3MJ 3DCFA 3G1OA 4EEFG 3PO2J 3G1LA 3M3YJ 5M5XJ 1GDTA 5JLWA 1ZQ3P 3GTGJ 3S15J 5IOZA 3BR5A 4JYKA 5FKKA 4A3BJ 2LTPA 3MKLA 3S1NJ 3A03A 3UKGA 1OCTC 1MBEA 4AUXA 4MO7A 5F0HA 1MBJA 4BY7J 2KT0A 1BL0A 4W97A 4A3DJ 2DMUA 5F08A 2M2EA 2XGEA 3JREA 1FTTA 1SANA 5JLXA 3HOVJ 1F36A 4X6AJ 5EG0B 5FKMA 3HOUJ 3H0GJ 2XSDC 3LSJA 4IHYA 2O8KA 5C44J 4D5FA 1ZKGA 2XRLA 3SJMA 1ETXA 3CDLA 2Y9ZA 4C2MJ
chains in the Genus database with same CATH superfamily
1VQ6I 1LNWA 5E20A 3RIRA 2EA2A 1IV6A 3EUKL 1FMWA 4RGXA 3HPGA 1QU3A 1BOAA 1PDNC 3V8JA 1VI0A 4G6TB 5FJ8J 2IS4A 2LG4A 3CO7C 3CMAI 4AYBN 1OCPA 2MGQA 2R7VA 2V9KA 1G4DA 5D5UB 4MEYF 2ZMEB 2M8GX 2GXBA 4O3MA 4GO1A 5D8LB 3WTVC 3ONQA 2F4IA 2DBBA 2WV1A 4IL6C 4UUSA 2R7XA 2DQRA 1K61A 1G6NA 1VQKI 3TOAA 1BI3A 2IXSA 1R5ID 1SMYF 4HX4A 1IDZA 4EJOA 2G7UA 5ICCA 3K10A 3Q9VA 2XIGA 1V3FA 4AIDA 1YS6A 3S3MA 2PLYA 3O8HA 4XKVA 1VNDA 2M4GA 3GTOJ 3L2QA 5ILSA 1Z1DA 1D3YA 2EFOA 2L7ZA 2XC7A 3OYNA 2DI3A 2ISYA 4XRSG 3M4OJ 2HOAA 4FT8A 4U88A 2JA5J 5EG0A 4HZFA 2CWEA 4RAZA 1ETOA 3WTTC 1FYKA 3F8NA 2MG4A 4RBOA 1APLC 5TGTA 1OR7A 2D1VA 3FXKA 1HKTA 4N9HA 4NQWB 1WJDA 2DOFA 4MNUA 1LFUP 3QYBA 3A02A 1N77A 3GTPJ 4RB2C 4H4KC 1W5SA 1N78A 3JRFA 3FXUA 3FHNA 3D0SA 1TWFJ 2CRGA 3GZ5A 3EYIA 2PMZA 3AG2H 4KDPA 2R7ZJ 5BQTA 1PP7U 3LSRA 1BBYA 3E97A 3J7YJ 5HS7A 4BE2A 3FM3A 4MLOA 4LK0F 2XF5A 4HNVA 4D7NA 4B48A 2XAJA 2JPBA 1Z0XA 3IH2A 4H0EA 4RGUA 1LVAA 1A5JA 2EILH 5DM7F 2VJJA 1XD7A 3CUQA 5FLMJ 4LD5A 3HTUA 3A01B 4FISA 1HSTA 3LWFA 3TQNA 2CQQA 2LKPA 3BZKA 2V9PA 5K7HA 2FEZA 3FMRA 5JHFA 1J2XA 1ZGWA 1ZK8A 1VQ5I 1Y8RB 2XPWA 4A3MJ 1UJ8A 2EWNA 3R60A 3CCUI 3AG4H 2E60A 3KP5A 1W1WE 4RLQA 2RDPA 4J19A 4R8HA 2K85A 2PEXA 4GFBA 3PO3J 4AYBA 1UELB 2Y69H 2GZWA 2E35A 3HBLA 1KU3A 5HVQC 4UNOA 3S1MJ 4WK8F 1DDNA 4UXNA 3JSOA 1G3YA 2KIMA 3ZQIA 2Z2SB 1B9MA 2ZSIB 5GADJ 2DTRA 3HG9A 1A6QA 1Z3YA 2CQXA 1ZRFA 1VQLI 1YE9A 1YG2A 1Z05A 2VE8A 3G4SI 4F92B 5FD5A 1K83J 1FMVA 5GAHJ 1O7LA 3E7LA 4B1RA 1WWXA 3GEZA 5LGTA 5GPCA 3ISPA 1O3TA 1OKRA 4XM3A 5HDKA 2QQBA 1TTYA 2LR8A 4A0ZA 1KQ9A 4OINF 2KL4A 2V9VA 1TT0A 1W4MA 3ABKH 2CYYA 3L00A 2ZJQF 5E17F 3WGIA 1Z3XA 1VQ8I 1OCRH 4II3A 3PL8A 3HRMA 3VWBA 3RYPA 3GMEA 3DF8A 3SZGA 2R7DA 1WI9A 2VBYA 4M3GA 4M71A 3W2WA 2DMQA 4BXUA 3CC2I 2KHMA 4LG3A 4BHCA 3BDDA 3I54A 3LMMA 1ZRCA 2A6HF 2H27A 3H3ZA 3HGGA 1IRZA 1SFUA 4BE1A 2V7FA 2GQQA 1BW5A 3LQQA 5GAGJ 2M0MA 1MH3A 3L2WA 2R5YA 2JK3A 2VKHA 1UG2A 1TQPA 3BG9A 3J80K 4BACA 1TLHB 4G7HF 3L2VA 2BEOA 1NTCA 2L02A 1QPIA 2X6WA 4CCMA 2GOMA 1Y1WJ 1FWZA 3L2CA 3HOYJ 2OF7A 3EETA 5K5OA 2L4AA 5J3LA 1O4XA 1CQTA 1MJBA 1ZR4A 3E3VA 3EPZA 5FRNA 2XV4S 1GV5A 5K7ZA 4RB1A 3OL4A 2MYSA 3ECHA 3CCLI 5M3FJ 4UVCA 1BIBA 1IV8A 2BW3B 2L5QA 1I5ZA 1I3AA 2R7OA 4HV6A 1LE8B 1HA8A 2L0KA 4KUMA 3RCOA 3HOZJ 1Y6IA 2P0WA 1H0MA 1KQ8A 2QQ8A 3ABTA 1FJLA 2IGKA 1UG0A 2LKSA 1K78B 5J8FA 3DBHB 3DKYA 4DYRA 2QBYA 1P4AA 1UZCA 1Y0NA 1DGRM 2P4WA 4CXFA 4PDKA 4I76A 3GTMJ 3F8FA 1B4AA 1XG1A 4NUBA 3GYHX 2B7EA 2H1KA 3GTKJ 1TQMA 3HM5A 3H36A 1C0WA 1OYIA 1MMNA 2K4BA 4OIRF 3WTSC 1FP2A 2CQ7A 4LGWA 3BCBA 1S7OA 1HW1A 5H6RA 4L9NA 4ABZA 2TDXA 1IRGA 2EQRA 2JN6A 1X4OA 1KZHA 1JJ8C 1KU7A 4RB0A 1EV7A 2GIVA 3ZQCA 1SAXA 4RMNA 1EH7A 3FHZA 2XHKA 1B8IA 4XLHA 1I50J 3OYCA 1U9NA 4KA4A 2JPCA 3VYUB 4HDUA 3CQZJ 3ESWB 3J80Z 1XCBA 1RKWA 4M3FA 3IHUA 5HDNA 1W0UA 3CESA 3DU6A 3Q0UA 4A93J 2V1XA 3J81K 3S32A 2L9NA 4E7ZA 1YIOA 4JQFA 1QRYA 3CF5F 3JRBA 1T8IA 2NAZA 4XKWA 2JVGA 3U9GA 2Q0OA 2CG4A 5KAIC 2H6CA 3JW4A 2IA1A 2HDCA 4DYQA 4CYCA 3FIWA 2VKDA 3IWZA 4L9JA 2A07F 5K7FA 5LEKA 1P6RA 1FIPA 5FKNA 3PNTA 3TDZC 4ZYGA 1BIAA 1MBKA 4O6JA 2CSOA 2LH9A 1OR7C 2FU4A 3DQVC 1FSHA 2EK5A 2R4GA 2VQGA 2D2WA 2R5ZA 2NOJB 4M6YA 3S2WA 1SC7A 5L3BA 2WAFA 4KMFA 4A3FJ 3BR3A 3M8FA 4N0BA 1LKXA 4U0VA 4L5JA 2FNAA 3CUOA 3I9V2 1XGOA 4HRIA 2A3SA 4S05A 2QA4I 1ETWA 2IEKA 4IX7A 3PQKA 4IQJA 4HX7A 3KLNA 2R3SA 3F6OA 3I58A 2IGMA 5HNHA 3QPHA 4MEXF 3BPXA 2UXNA 1K7AA 3GFLA 5E3LA 3QPSA 3T0YA 5HODA 2KQRA 2L9RA 1OCOH 2WADA 3CUQC 5KAFC 2HR3A 3BOQA 5FKOA 3O3KA 1DUXC 2RN7A 2DA3A 4IQ4A 1B1BA 3FISA 3U1DA 5D6EA 1UHWA 3VYTB 3DPUA 3S2HJ 3J81Z 3FMSA 2ECCA 2OPTA 1XC5A 4AD9A 2XPVA 4HAMA 3EUHA 1TW3A 4LITA 2LBFB 2LSOA 4M3BA 2QENA 1SFXA 2M3AA 2DAOA 5J4VA 3TDUC 5BOXA 1YI2I 5CQEA 2FMYA 3K4JA 3IAM2 3E6MA 5D8KB 3OYEA 1E2XA 3MFKA 4C9YA 1LQ1A 3CCRI 1DP3A 2QQAA 3WE3A 2KFDA 1YS7A 3JTGA 3ZMVA 2FXAA 2DT5A 5CPRB 1V4RA 3V42A 2F5DA 2Z5UA 2E2HJ 2NRAC 4DBRA 3HKZN 4XORA 3KYCB 1FPQA 3QPLA 3GTQJ 2P5LC 4K2EA 2NS8A 2RGVA 3ABMH 1P7IA 1NG7A 3H0DA 1CGPA 3KEOA 5HNFA 2V1UA 1EH6A 4P96A 3H5RA 4A6EA 3K9TA 4E7IA 1IO2A 1SEUA 2HPIA 3ZMDA 2W48A 2HZTA 3QAHA 4IZZA 1J0RA 2FSWA 4DIQA 4NDLA 3ERMA 3Q9SA 3FBNB 3ZXSA 3OYMA 2AO9A 3IH3A 2XAUA 1W5TA 3TO7A 1F4KA 4IXAA 2GXGA 2CQKA 2JMWA 2MA3A 2WY8Q 2QF7A 1G3WA 3CP2A 3RSNA 3LQRA 1TC3C 2UWMA 4HV5A 4BJ5C 2XKOA 3OIPA 2M8EA 2ACJA 3BR6A 1Q1HA 3QP6A 5JFRA 2XPUA 3ZPLA 1Z6TA 3ZCOA 5LRRA 4QPQA 1E3PA 4ASNA 4UUSB 4ZZDA 5M3MJ 3DBLB 1QZEA 3G1OA 4M6XA 3OYJA 3PO2J 3CJTB 1FP1D 5M5XJ 1EJ9A 1RRJA 4YRVA 1SFEA 3IC7A 4QPOA 1ZYRF 5JLWA 2DO7A 2DK5A 1YITI 3HPHA 1ZQ3P 3S15J 2R7QA 4TV7A 3IKTA 5IOZA 2NVUB 3X2QH 2VXDA 1V5EA 3HSFA 4EMSA 2O61A 3S1NJ 3OYDA 2DDBA 2X6YA 2HTJA 5F0HA 4KT5C 1S5LC 2K7LA 3A4CA 4W97A 4XBFA 1KQ0A 3K4CA 1D1CA 4G6QA 4OAYA 3LAPA 4PJMA 3JREA 1SANA 2IJLA 4BDYA 4X6AJ 5EG0B 5FKMA 3FXQA 3K1NA 3LSJA 5D5VB 2O8KA 2ZKZA 1ETXA 1OQYA 2ZMEC 4IRIA 3NWTA 4AIJA 1LDKB 1JI8A 1MD0A 2XAGA 3QU3A 3UNGC 2CJJA 2JUCA 4GYIA 1KYWA 1R5HA 3SZTA 1TWHJ 2L9VA 3B6CA 5IYBJ 1E17A 2WA0A 2DPUA 2VI6A 2CV1A 1ZTRA 2CFOA 3H3VK 3PSFA 1X1CA 1I27A 1SFKA 2ZXJA 1BA5A 4WXDA 5EZHA 4I99C 2CW0F 4ON0A 5FFZA 1V54H 2R7UA 3FDYA 3BZ6A 3TP3A 5L3EA 2LF8A 2PI0A 4XRFA 5L3CA 4CYDA 2VL8A 1JTYA 4NNJA 4PFOA 2VBWA 2RQPA 1FYLA 1D5VA 3V4GA 5F0CA 3NRVA 3ZMTA 3CUQB 3WG9A 1YRNA 4MFEA 3TMOA 3SQNA 3BLYA 2EBIA 2E71A 1I1GA 4HG2A 2Q2EB 1T33A 4P9FA 4XLFA 3BP8A 3D5SC 3I64A 5CJ9A 2FOWA 2XUBA 4D5CA 2QVOA 5F1RA 4FQGA 1MMSA 2RV8A 1ETKA 4HPQA 1R4NB 5L3GA 5IOYA 1ON1A 2HGCA 3A0HC 3GFMA 4HBLA 1T0FA 5ICFA 4B8XA 4FASD 4J00A 3IRRA 2DK8A 1R7JA 2EFPA 3K4NA 2CUFA 2DA2A 2HQRA 2K3FA 2CQNA 2L54A 1REPC 2WB1A 4OWRB 1NK3P 4HA8A 3R0AA 1BJZA 4IHVA 2BHYA 3HXLA 1R49A 4MTDA 1H89C 5D6FA 4D1QA 4HX8A 4D7MA 1USSA 1UHSA 3KLOA 2FBIA 3V8KA 3MKZA 2DA4A 5FLXK 1DPRA 1KGSA 5HLGA 1FX7A 1AU7A 4V19K 2LOOA 1T56A 1AKHA 4ENJA 2NNNA 2GOXB 4LB5A 1P2FA 4L0YB 2GBYA 3W2VA 3FXOA 3HL2A 3BROA 5EJCA 4A0YA 1VQ4I 1HXDA 2HKXA 2L2OA 1TWCJ 2L01A 2M5WA 4KIBA 2B63J 1GLNA 1I6XA 2R92J 3W3CA 3L2RA 4G7ZF 4WWCA 5J1YA 4KIGA 2YR2A 3B02A 2HYJA 1AWCA 3DBRB 3DLAA 3QYEA 2Y0SA 2NVTJ 1FOWA 2JVHA 2FBKA 4ZYAA 1S72I 2EIJH 5K5RA 2HDDA 3F8MA 2HXOA 3R61A 4I2OA 3HEFA 4KNYA 2F5CA 1BI0A 4WXCA 3RPUA 1ZG1A 1JE8A 2E2IJ 3G3ZA 2P6TA 5DD4A 1IG7A 4GRIA 4JBAA 1VQNI 2V6CA 2ZO4A 4DBQA 1PUFA 2OCEA 2X4HA 3ASNH 3HRTA 3GW2A 3GUDA 3DP7A 3K1PA 2R0QC 4IOCF 1GXQA 3RZOJ 4XL9A 4C2TA 2XSJC 1V5FA 2XB5A 3GZNB 1ETYA 4N4NB 4BAYA 2QSHX 1MBFA 4P1WA 1B59A 1J7KA 1D1AA 1MMDA 5IYCJ 4X1EA 5KVRA 3VYSB 4UVAA 2DN0A 1HSJA 3K7AJ 5CLSA 3KYLA 3M07A 3LA7A 1CF7A 1FOXA 4E7KA 1MZBA 2YU9J 1BR4A 4RA2A 1J75A 1XMAA 1G3TA 3S2DJ 2CH0A 3DWLE 5LEJA 2OBPA 3GF2A 4Q48A 4XKBA 5FFXA 3TW7A 3WODF 5FLXZ 2HVSA 1BC7C 2DYRH 2L7FP 2LF7A 1ON2A 1E0EA 1IUFA 2DT7B 3OOPA 3QP5A 4HNTA 2XB0X 4A3EJ 2E5NA 4U87A 3CF2A 1JT0A 1QHGA 3H92A 2QBYB 2IW5A 4PGGA 3CJNA 3LOCA 2KRCA 1QQIA 1F43A 3PSIA 4BQAA 2HFHA 1TQIA 2GIZA 4M3EA 2HU9A 3ZMSA 4OU0A 3I5UA 4FTHA 2DMNA 2HVRA 3NWSA 4UV9A 3A0BC 1MNDA 3CJQB 3CD6I 4IF4A 1X4PA 1BN5A 2RREA 2X6OA 3E1SA 1Z67A 2LY9A 2M7BA 3DV8A 2MH9A 3FM5A 3MN2A 3SZPA 3WGHA 1IRFA 3MCZA 2M34A 2FQ3A 4OIPF 1B8IB 4ZDPA 5FKLA 3F6VA 4FX0A 4BHBA 1Y0UA 1OPCA 5L3FA 4ENNA 1ZLKA 2IP2A 2YS9A 2PMHA 3CMMA 2AXTC 3CC7I 1POGA 5DM6F 3FXLA 3WTWC 5BPIA 1R1TA 2V79A 4KICA 3F0CA 2VODA 2O9LA 1SVMA 4Z2YA 2VT3A 3G71I 3IWFA 3HB9A 3TO9A 1LEAA 4CYCB 1UMQA 2NVQJ 3GZ6A 5FLVA 3R0JA 1JUSA 3ZQHA 4ENKA 1O3RA 2UZKA 1AOYA 4XNFA 4BNCA 2VJ5A 3P9KA 1A35A 5DCMA 2DJNA 2A68F 2V4JC 3MD2A 1D8JA 2STTA 5CVRA 3QQAA 3K70D 4KIFA 3VYRB 2KLOA 3TEDA 4B44A 4JX4A 1P4XA 2EJRA 2ZJRF 2R5ZB 4C2UA 2HOTA 5E3OA 2HI3A 3SDGA 1JUPA 5ED4A 1X1BA 4LB6B 5E1XA 2OJED 2RNJA 4EJTA 5FRMA 4Q5SF 4S0HB 3FK6A 3OV8A 2PMUA 4N9IA 4A12A 3LA2A 2TRTA 1S7EA 4RS8A 3RZDJ 1L0OC 1IXRC 4F55A 2FE3A 3TW6A 4M9XA 3AFHA 4CSWA 2WY7Q 3LSIA 2MSYA 4ESBA 3BQZA 5D4SA 1ZELA 3ABUA 1KU2A 4DNCA 3KEQA 5BS6A 2Y2ZA 4BJ6C 4XQFA 2HTSA 4RGSA 3RQ4A 4EM2A 1YQAA 3JR9A 2RNGA 1WPKA 4M72A 1LVKA 3KCCA 2Z16A 1T0FC 3KPHA 2W57A 1R71A 2PN6A 2LNBA 1IUYA 1QVUA 5F27A 5LHGA 1TL8A 3T8RA 2A6EF 3H9QA 1T38A 9ANTA 4DJAA 1MSFC 5H2FC 3S1RJ 4YEJA 1FBSA 1X1PA 3E5XA 1WRJA 2DA5A 3VDXA 1B6AA 1EH8A 4KN4X 2E1NA 2BHZA 1SVOA 2W00A 2DFFA 2GXAA 3LSMA 4FE4A 2EZKA 2ZFUA 4BGDA 5DS9A 4II2A 1F1ZA 2BYVE 1Z6RA 3CP8A 4G6DA 3OS1A 4XR6A 3OYFA 3OMYA 4CDGA 2JUGA 3L1PA 4PGHA 2KKOA 3I59A 1QO0D 4YELA 2W84A 3DFGA 1X2MA 4F91B 2XGCA 2L4MA 1Z77A 2X1DA 2F48A 1DQUA 3QU6A 1OJLA 4PJ0C 3QYFA 3RDIA 2JZYA 1OISA 3BJOA 2KIFA 1T6SA 2Y48A 3S14J 1W36D 2HOEA 1QGPA 4DZPA 2VONA 2RVCA 5LLQA 2L3DA 1TZLA 3OYHA 1D0XA 2KDZA 1XMKA 2M7AA 4Y15A 2FUG2 2XRNA 1T95A 2HYFA 5J1RA 1ZR2A 4NHJA 3PJRA 3G1MA 3MWMA 3L9FA 3S3NA 5D5WB 2PJRA 4A69C 1I3QJ 3LFKA 3W2AA 2F5FA 1IN8A 4ZZLA 3HDDA 5JI6A 2DOAA 1SD4A 3K4BA 3M7GA 4V2GA 2V6EA 2FNPA 5IP6A 2QSGX 4UV8A 5KHDA 3M9AA 1OMIA 5H6QA 1RNLA 3ZMZA 2VC1A 2DFEA 2BY3A 2PBIA 1LPQA 3V7CA 3ROUA 3IL2A 1NH3A 2E36A 2KP6A 1XGNA 2DQLA 4HF1A 3ZN0A 3JRDA 4XMYA 1GUUA 3KIOA 2O03A 3HOTA 4A3KJ 4DYCA 2AQEA 1WJ5A 5DYMA 1DGWY 2GA1A 2QYOA 2XAHA 4RGRA 4M3DA 1HKSA 3BY6A 4PZJA 2CMPA 2Y31A 1V55H 4Y17A 4IKFA 3OSGA 1SVLA 4RLFA 5B1AH 5A2QK 1RKTA 1KA8A 3WTXC 2P7VB 5LRSA 3HOXJ 2CUZA 3BR0A 2VLAA 4HLXA 1Y1VJ 2B9SA 3DEUA 2HZDA 5J1UA 3WG7H 3DEWA 2HVQA 2BY0A 4B3XA 4XLPF 3HC7A 3LAJA 3I71A 1WHUA 2ELKA 3BC8A 2O7OA 2X48A 3GBGA 4O5VA 3OYAA 3TL4X 5GPAA 1S6LA 3Q0WA 3K4KA 3DCFA 1ODDA 1XGMA 2ZJ2A 4L18B 4XN0A 2IGOA 4ZTFA 1YFHA 1W7PA 1SAUA 3FXJA 4PJJA 3RPUD 2IA0A 2OQRA 1YTYA 3OYGA 4JYKA 2AQFA 2JSCA 2EV0A 3DU5A 3MKLA 4C30A 1MBEA 2P5KA 1WKMA 4EV0A 1YYVA 2CS3A 3CLOA 3BJAA 1SD6A 4RAGA 2ZBKA 3HTSB 4EJWA 3WU1B 4IHYA 4D5FA 4YFXF 3H3UA 3HUGA 3CDLA 3FX3A 4KMUX 3WTZA 4C2MJ 4CZCA 1BI1A 2H6BA 4LIUA 3IRQA 3DTKA 3H1CA 4LMYA 3WU0A 2DODA 2PJPA 2F4MB 4DQ2A 4MHGA 4XOTA 3GLLA 5HLTA 1WJAA 5A2QZ 2F6CA 3QODA 4B3AA 2EFQA 2G7HA 1G59A 5JR3A 1Z9CA 4IOAF 5EEGA 2I5UA 4ZC3A 4MQ9F 1O7FA 1IW7F 2BBYA 2ZCWA 4M73A 3CMYA 4OIQF 1T39A 3MVPA 1WJCA 3EQLF 1WJEA 3LSHA 3AG3H 4I02A 2K86A 3KP2A 4UHTA 1J09A 1QZZA 2L9SA 4HDVA 1Y39A 3REOA 3ZP5A 2WAEA 2R93J 1JJ6C 1TWAJ 2NYXA 2VN2A 3M1EA 3VOEA 2P81A 4ETSA 2K3PA 4IVNA 3PFIA 1IXSB 5JHUA 2LK2A 4A5MA 4MTEA 4IJAA 3P5JA 3HSEA 4AIKA 3F72A 4YIIA 5KNLA 1LFBA 2P6SA 2DA1A 3IUOA 4ZTJA 5DD8A 3H5AA 2E1MB 2VB6A 2KDOA 2QGUA 3O2PE 3NARA 2LMDA 4JOMA 1WH5A 3TGNA 4L5IA 1L3LA 1ORKA 3LA3A 1VQ9I 2CGPA 3CC4I 1EKEA 3CO6C 3VEPA 4CUGA 3BJ6A 2D1HA 3SXYA 1H88C 6PAXA 4Z6YA 4E7SA 2W25A 1N75A 1IN6A 2GA2A 1CF7B 2XF6A 3JAMK 2NVXJ 4E6KG 5EEHA 3DPTA 2LC2A 5M5YJ 2VT2A 2VPLA 5M5WJ 2QKLB 4BQOA 2EZIA 4R1HA 2ZNZA 2R7SA 3C2HA 4BJTA 2UUZA 3IKVA 1QA6A 1B9NA 1IXCA 2KZVA 2E7WA 4BXFA 5IYDJ 1R22A 2XDVA 4EQQA 2MH2A 1XN7A 2DMTA 2QWWA 2PX9A 5HS8A 1J5YA 2OCCH 5BPDA 1GT0C 3HOSA 4PSWA 2K5CA 3KP6A 2VXZA 4WX9A 1J59A 4YIFA 2RC4A 2DPDA 3I55I 1UHMA 2ZFWA 5K5QA 3M8JA 3MKWB 4C3IJ 4PK4A 3CCMI 1YW7A 1W5CC 4GGGA 3BG7A 1BJAA 1U5TA 3ABLH 1G8XA 2ISZA 4L5EA 4AVZA 2IT0A 3H9JA 4E70A 2VE9A 2BW3A 1D8KA 5BNGA 1WJBA 1VZ0A 3OY9A 3A2KA 2KISA 2W85A 2K02A 1JTXA 4FX4A 2ME6A 5EF6A 1QBJA 5C3EJ 5H20A 2RQQA 2XAQA 4BL0B 4UUVA 1HF0A 4GXOA 4HLYA 4LLNA 1VTNC 3GFJA 2FMLA 1K78A 1GV2A 2IAIA 2VQHA 4OAZA 1FOKA 5JVTA 2D5VA 5F6FA 4I6ZA 1Y8QB 2AHQA 4BKXA 4XOPA 2M9HA 3QOEA 4BYYA 5DTDA 4XSZF 1MW7A 2BVMA 1V5GA 2QLZA 4A2UA 3JAMZ 3MAJA 2JQ7A 2EV6A 1G3SA 1GVDA 5AIPA 2CV2A 4JX5A 2JA2A 3CJRB 4J01A 1FOYA 5DCMB 4QLCU 2F2EA 4OMYA 5E8IA 1K79A 1PUEE 1WVRA 2VJ4A 1WJFA 1MMAA 3AG1H 3RKQA 3JRGA 2N8GA 3NQOA 5J40A 3UR3C 1IJWC 2ESNA 1IRXA 3JSPA 3KP3A 4CZZA 2CO5A 3HKZA 2OTJI 5KCMA 2JT1A 2IS2A 2XROA 2QM3A 1MBHA 2WAQN 4XIDA 1HOMA 3F9KA 1R00A 3AAFA 3QRFF 2YSRA 1OLTA 1R1VA 4AWXB 2J5OA 1E3OC 2ID3A 2XVCA 1HW5A 2HQAA 3MZ8A 4LJZF 2BGCA 3R6SA 1RR8C 5CVIA 5F1JA 2KRHA 1OYWA 3BR1A 2GM4A 1RPWA 2HXIA 3TBIA 3DTEA 2XASA 4CCLA 1XS9A 2ZJPF 1MDMA 2EZLA 4EGZA 1YJNI 5DV5A 4BXXJ 2HQNA 4BEHA 3BG3A 2FJ1A 3CCEI 3CCVI 4A3LJ 3PNVA 5L3DA 1YX5A 5IPAA 1WGXA 2KIUA 3C18A 1FNNA 3V7SA 2H09A 3S1QJ 2CUEA 2DOEA 4I01A 3OIQA 3PIPF 1IGNA 4IRHA 2J5PA 1XTAA 5CVJA 3W6VA 4IHTA 1RUOA 4CH7A 3ZMUA 4KJZA 1X2NA 2IRFG 3ELKA 2PG4A 1FYMA 1QZYA 2I10A 3WTYC 2EZHA 3E6BA 4KYWA 1D5YA 1JKOC 3C2GA 4MGRA 3CLQA 3LL7A 5EZGA 1X19A 2VPRA 3H5NA 2WBMA 3BR2A 2M4KA 2YX7A 2ADUA 1PYVA 2O6GE 1JGGA 2R7TA 2BV6A 2QZ8A 4HEA2 3VPRA 4PJLA 1JHHA 1NK2P 3OR2C 2OV7A 1A31A 4KFCA 2ECBA 3I59B 4QIWN 2NS7A 1K4SA 2LREA 4XRMA 2Y30A 1OCCH 4JX6A 1PVEA 5ICEA 1XSDA 1S7AA 1S9HA 2DFIA 5LHIA 3I56I 3SEZA 3V7RA 4GDFA 4U0YA 5HS9A 1O57A 1UB9A 2QCOA 3EUHC 3HRSA 2ICWG 4F93B 2R5YB 3QOPA 3E0JB 3BTLA 3G2BA 2A05A 1S29A 3CZ6A 2MLGA 3S93A 2W24A 3MKYB 2LBFA 2DTZA 4M9ZA 3TP0A 2CW8A 5J6XA 5F0FA 5EDNA 2JA6J 5J47A 5HLIA 1MKMA 2DLLA 4Y4RA 4MFDA 1TNTA 4XONA 2PMZN 3HOWJ 4G9YA 5LD2C 2R7RA 4MQVA 1HQCA 1W7PD 1ZGAA 3ML6A 2JRMA 1XDUA 4NB5A 1U3EM 3K70C 3GWZA 3KX2A 2L7KA 3OIOA 4NC8A 2M0CA 4EJVA 2O3FA 4AIHA 4Q47A 5HDGA 3F23A 1BI2A 4HYEA 4YFKF 4B09A 4ZH4F 4IO9F 3GXOA 2WAQA 4UB6C 1B72A 2FQ4A 2H94A 1RR7A 4CCNA 4U0WA 3WHCA 4EM0B 4FCYA 3GVAA 3OYIA 3NAUA 2W82A 2QQ9A 2EB7A 2UV1A 2E2JJ 3I0TA 3T5XA 3CCSI 1IC8A 3WU2C 4V2FA 4PUSA 3FXRA 4UB8C 5JVGF 1K6YA 2Y75A 3U1KA 2MBFA 3J7AY 3CDHA 5C4JJ 1TNSA 1AHDP 3K6GA 4D9JA 2EH3A 1YX3A 3KZIC 4I0AA 1M1EB 1DU0A 2E34A 2LRDA 4D0PA 1WI3A 1YLFA 3I53A 4F52A 3RKYA 2X51A 2HDWA 5EGOA 4B4CA 4YFNF 4LFUA 3BZCA 3PUBA 4BQNA 4I98B 3OL3A 1FY7A 2ELHA 3GLXA 5E3MA 4F3QA 3OYLA 4XLCA 3E6CC 4HSRA 2OQGA 3I4MJ 1XPXA 5EYRA 3BPVA 4XSXF 2LFBA 1U5TC 2XKPA 4YIRX 3VB2A 2E19A 1MSEC 1JXSA 2M1BA 2DW4A 1KONA 1AA7A 1P9QC 1RZ4A 2VOOA 2EA4A 1JUMA 1ZREA 1MJ9A 1W7PB 4PSXA 3ZQ7A 4L0ZB 1R5GA 3OS2A 2YX4A 3WE2A 5E1ZB 3SEQA 1YHQI 2OZ6A 3ZN1A 1ZHFA 1JGSA 4HNUA 4ZDOA 1JKQC 1BM9A 1LDJA 4HQEA 3P9CA 1MBGA 5DDGA 1ETQA 3HRUA 4W1UA 2MC3A 5B66C 2EV5A 4U7BA 2Y9YA 1FT9A 3MZHA 2OU2A 4CO8A 2ETHA 1W36C 2ZXHA 4EJUA 1XSVA 1ZGJA 3PUFA 3HUGB 3N05A 3OYKA 1IN4A 1QHHD 4BDZA 2FBHA 4NC7A 1X58A 4RB3C 2K9SA 3BT9A 3Q5FA 1JT6A 3BTJA 3IAS2 3EYYA 4UVBA 4A3JJ 3F8BA 2DA6A 2RKHA 4EVIA 3MZYA 4QWQA 1QPMA 2CU7A 1XDSA 4X0GA 2JA8J 3K2ZA 5ERIA 3CCJI 2WC2A 4BQQA 1MGTA 2VIXA 3BG6A 3U2RA 5FB2A 3VFZA 3S8PA 2D45A 1Q1VA 4CCKA 4U7DA 3BWGA 2WV0A 2DA7A 2Q2EA 3LSTA 2MLKA 4G8XA 2O8XA 3G1LA 5HOOA 1RIOH 3M3YJ 2Z99A 2HNHA 3M1CA 3TO6A 4WCGA 1GDTA 1E3HA 4Q4ZF 3LSKA 3GTGJ 1LFPA 4HF2A 3CDIA 1YW9A 1WQ2A 2EIKH 3GCMA 3BR5A 3C1DA 2LDUA 3HHGA 4OOIA 5FKKA 1UCRA 1YOVB 3LFUA 4OMZA 3A03A 1OCTC 2QUFA 2GAUA 4MO7A 1ZRDA 2K9LA 2NNYA 1MBJA 3FKJA 4LG0A 2KT0A 1BL0A 5HLHA 4AM3A 1MNEA 2DMUA 4B43A 2QSFX 2KIQA 2M2EA 3D5RC 3T8TA 3H0GJ 1YO5C 4FETA 5C44J 2XRLA 3SJMA 1ERDA 3OWTA 3SHFA 3DLLF 4EM1A 2OTLI 3RPQA 1LUJB 5E79C 2DDAA 2JRTA 2JWTA 5FROA 3Q0VA 5IP7J 1RUNA 3D5LA 3KE2A 5C4XJ 2VASA 3FK7A 5DCFA 2BXYA 4JK1X 3E5QA 1ZN2A 2MW8A 4HQMA 1BC8C 3DKXA 2O5RA 3QPTA 4QTRA 4I0BA 1D0ZA 2X1CA 5J8CA 5IT9K 4RM3A 3COAC 4RDUA 4Y13A 2KZGA 2VJIA 1ENHA 4LLLA 5IT3A 3RJPA 1JKRC 1XB4A 1XSXA 2L7MP 3N4MA 2LVSA 4IHSA 2ZNYA 2E1MC 4RAFA 4BBSJ 2DCEA 3EDPA 2K40A 2XGDA 4G12A 3ZQQA 2VBZA 4UY8I 3ZQGA 3ZGKA 4ESFA 2DMPA 3DPLC 1LJ9A 2NVYJ 4N4OB 2LKXA 2LP0A 3KEYA 1KU9A 4BU2A 4ZDLA 4BE0A 5E3NA 4XN3A 1ZLJA 2H1LA 1W0TA 2VQLA 3JRHA 3S16J 4KN7X 2IVMA 4DGWB 1WCMJ 3A1YA 1U5TB 1QNTA 4LLGF 4DW6A 2YUSA 1SMTA 4RAYA 2FD5A 4P55A 4L9TA 4DZJA 4JP0A 3ZQFA 3MQ0A 2RAEA 3U21A 1ZH5A 1HCRA 1VFCA 2BXZA 2A5YB 2ESHA 4IPAA 2W1OA 2BE5F 3QWLA 2VOPA 4Y7NJ 3C2BA 3MMYB 2IS1A 3C7JA 4MIMA 3FMQA 4M74A 3K4MA 1MMGA 2COMA 3OOUA 2XF7A 2ZMEA 1XX5A 5LHHA 2QKMB 3PQJA 2Z1DA 1DPUA 1FZPB 3K0LA 3K2AA 1F9NA 5FD6A 3ZQLA 2BVLA 2HWVA 5E1WA 3AL0C 2A5WA 1IN7A 4P9UA 4XLEA 3HZJA 4PJNA 3F22A 5IT9Z 1P92A 2LY2A 1ZARA 1HDPA 1NHAA 4P5OA 2CFXA 5KK1A 1TBXA 1GHCA 3JRIA 3KYDB 1P4WA 1SFOJ 4XRSA 1P7JA 3J7AO 1VF9A 3L2UA 1R4MB 3K4LA 5B5EC 4ENMA 3LNQA 4HOBA 3HHHA 1YRNB 4CA0A 1R9TJ 3CTAA 2JSPA 2X1EA 3LSGA 5J4YA 4NC6A 4EATA 2IA2A 1JHFA 2O0YA 2M45A 2MABA 4AVPA 5ILUA 4XKCA 3HGYA 1VQMI 1IF1A 1U78A 5AONA 2VC0A 1VQ7I 1WZ2A 4BY1J 4NQWA 3DXJF 5EEAA 3VSKA 4C3HJ 4CHUA 2P5VA 4CICA 2A69F 2KRFA 3DEEA 1MDMB 1QVTA 4KT6A 3V8LA 1ZG5A 2ZB9A 4BEHB 4M6VA 2LYCA 3BTCA 1Z7LA 3FBIB 3GTJJ 5ICGA 1ETVA 3L7WA 1MJAA 1I1SA 2OA4A 2KMUA 3I3LA 2VKEA 4A3IJ 2K4JA 2CW7A 4L9VA 1AKHB 2P8TA 2UXXA 5GAEJ 5IY5H 3O6BB 1X1DA 3PM1A 2VUMJ 3IV5A 3A01A 1WH7A 2BY2A 2FA5A 3MEXA 1FSEA 2ZXIA 3IH4A 3C3WA 5DEQA 3GTLJ 3SYTA 3M8EA 2EFWA 2W7NA 3E6DA 3FKIJ 4I7HA 1K4TA 1LEBA 3I4NJ 3S3OA 2FRHA 2FF4A 4E4HA 2JJ7A 2MC4A 2KPMA 4WF2A 1XMXA 1U6GA 2HPMA 2E1OA 1R1UA 5ILVA 5LGUA 1IAWA 3OSFA 2E5ZA 1A04A 3W6JB 3ERED 4AC0A 1RC9A 3FZVA 3GO5A 2V26A 1OFCX 1T2KA 1S3JA 4FE7A 3BTIA 1PUFB 2LLKA 1WSUA 4BH9A 1BR1A 4KISA 3TKYA 2HKOA 2OC6A 2K9NA 3RI4A 3BG5A 4HSTA 5D4RA 1Z7UA 3GFIA 1EF4A 3RKXA 4XLNF 4BS9A 5TRDA 5GP9A 3K69A 1J9IA 1IZ1A 5AIQA 1I6HJ 3H35A 2HQ5A 3KP7A 3KZYA 2WWYA 1D0YA 2F4OB 3RYRA 2E7XA 4HW0A 2JA7J 2JTVA 3VODA 3J7ZI 4XLAA 2Z33A 2K9MA 2F5VA 2PQ8A 1HDDC 1RETA 1HKQA 1NG6A 2QEXI 3L09A 4ZYEA 1SD5A 3CCYA 1B72B 1VQPI 3OYBA 1U8RA 3B6AA 1LDDA 3N97A 3S17J 4Y33A 2X9DA 5E8GA 2DJIA 1FIAA 4ZJZA 1TWGJ 3HYIA 5CYVA 3P9IA 3TOBA 4IRGA 2VKVA 5CVUA 4XK4A 4C3JJ 3PFYA 2GLOA 5FO5A 1LB2A 4A0XA 4E7HA 5LGNA 2EIMH 1ZAOA 1YJ9I 3BQYA 3F3XA 4AU7A 2A61A 3LSPA 2BY1A 2EINH 4IHXA 2CV0A 3AL0B 3R4KA 2LY1A 1HLVA 2WB1N 1ZG3A 5CKTA 4NBQA 3JTHA 3ZRGA 1GXPA 3ULQB 1FEXA 5FGMA 5EGOB 2XGXA 2Q1ZB 3ZR8X 2DYSH 2IPQX 3KP4A 2I8DA 1MH4A 2EFNA 2TCTA 2OZUA 3DTIA 4A3GJ 2F5EA 4QSHA 1LE8A 1N25A 2K27A 3HJEA 4OIOF 2B0LA 3NEUA 3E5UA 1RESA 2CUJA 1UAAA 2ID6A 3ECOA 1BOBA 2FOKA 1EA3A 4CCOA 4PFPA 1XCVA 1OCZH 4I09A 1X3WB 3EUAA 2E1CA 4BUPA 3P7NA 2DU9A 1PJRA 1I39A 4E7JA 1BR2A 2HS5A 2M87A 3I4PA 1FLIA 4HF0A 5GTIC 1MNMC 2MD0A 1U8BA 4Y52J 3VSLA 3RQIA 5DUKA 4ANJA 2BOLA 4BBRJ 1HW2A 1Z91A 2COBA 2Y0SN 5DUIA 5B3SH 4E7LA 1A36A 1R36A 1S8NA 2FX0A 4IHWA 2HEOA 1FBQA 2ZXWH 1MIJA 1R23A 1K6OA 2IGNA 2XAFA 3PIOF 1R6RA 2H8WA 1H8AC 1ACIA 3FWEA 1FC3A 5LBQA 3DKWA 3T1BA 5IP9J 2NS0A 2X0LA 4XICA 3IP4B 4LIVA 4KITB 4GCVA 1FBUA 2G0EA 3ASOH 1DU6A 1T08B 3WGGA 1YJWI 2X85A 2Z9OA 1A6IA 1XGSA 3H9GA 1BW6A 3SFZA 2LD5A 4LK1F 2P7CB 3CCQI 4A3CJ 3FXMA 4IEJA 2A6TA 1UFMA 1JKPC 2OUMA 3JRCA 1F5TA 2NOGA 1Z21A 3RKWA 1PP8F 3WHBA 1T98A 3JRAA 2EPFA 1TW2A 3WTUC 4G7OF 3FF5A 1O3SA 5TJJA 2AXLA 2Q8KA 2Y0MA 3W6KB 3HIFA 4CGZA 1OYYA 1IN5A 2DT6A 1X1AA 3ZOBA 2V1DA 1H9GA 2DXIA 1ONVA 3HSRA 3KETA 4ZYHA 2K9QA 2KJBA 2OAZA 3Q3SA 4LG0B 1SD7A 3PNYA 1GVJA 1DP7P 2ZC2A 3OS0A 3G73A 2BZTA 2C6YA 1ITYA 4LOCA 2HOSA 2GWRA 1U9OA 2H8RA 3SDBA 4F7ZA 2IBDA 2R7WA 1ULYA 2G9WA 3AKZA 2VBXA 2STWA 4A5NA 1YIJI 2DFHA 5CQGA 2W4SA 4ZYDA 3D1NI 1D1BA 5B1BH 3BCAA 4B47A 1HBXG 2MD5A 3JCUC 1IDYA 4RM2A 5F04A 1X3UA 1U2WA 5E18F 5F64A 2YPRA 2ME0A 2VQCA 4A6DA 3O8GA 4Y3OA 1FTZA 2R7FA 2ZSHB 3CMEI 1WFXA 4G94A 3B73A 2X6XA 3KZZA 1G2HA 1X3ZB 1YW8A 4UUTA 1U0JA 1TT5B 4PCQA 2MFZA 4GYGA 3G6EI 3OR1C 4M9SA 2ELJA 5D5XB 3SFIA 5TISC 2OD5A 2YU3A 1RI7A 4EEFG 3F21A 2PJRB 2M30A 5K1YA 3GX4X 2KJCA 4R79A 4FHTA 4CCJA 5GTHC 5LFAA 1KYZA 5BMZA 2WTEA 4BHPA 4ESJA 1STZA 4DOZA 4WXHA 1H9TA 1Y56A 3KFWX 2LTPA 5CVVA 4EGYA 4A3BJ 3UKGA 2NXNB 4AUXA 2Z3YA 2AS5F 2IS6A 4BY7J 4A3DJ 4S04A 1HC8A 5F08A 2V1NA 2XGEA 3RTRA 1VQOI 3HOVJ 5JLXA 2PFBA 1F36A 1TP4A 4ITVA 4YG2F 1FTTA 3HOUJ 3K1MA 2XSDC 1O3QA 1ZKGA 2Y9ZA 1USTA 2HYGD 3F8CA 1R58A
chains in the Genus database with same CATH topology
1IV6A 2CJJA 2JWTA 3Q0VA 5IP7J 1TWHJ 5IYBJ 3B6CA 2VI6A 1VI0A 5C4XJ 1ZTRA 5FJ8J 3H3VK 4B3AA 4AYBN 1OCPA 2MGQA 3FK7A 2M8GX 1BA5A 5EZHA 2MW8A 3CMYA 4QTRA 3TP3A 3MVPA 4RDUA 1ENHA 4UUSA 2WV1A 1JTYA 1JKRC 1K61A 2L7MP 2LVSA 5F0CA 2R93J 4BBSJ 1JJ6C 1IDZA 1TWAJ 1YRNA 2K40A 2XGDA 4G12A 4MFEA 2P81A 3ZQGA 2EBIA 2DMPA 3O8HA 2LK2A 2NVYJ 1VNDA 2LKXA 1T33A 2LP0A 3GTOJ 5E3NA 4D5CA 1LFBA 2DA1A 1ETKA 1W0TA 3S16J 3JRHA 2L7ZA 5IOYA 3M4OJ 4XRSG 2HOAA 1WCMJ 2JA5J 5EG0A 3NARA 2CUFA 2DA2A 1ETOA 4DW6A 2YUSA 1WH5A 2MG4A 1ORKA 2FD5A 4RBOA 1APLC 4DZJA 1NK3P 4IHVA 1BJZA 4JP0A 3ZQFA 2RAEA 1H89C 1H88C 1HCRA 4D7MA 1VFCA 1LFUP 3A02A 3GTPJ 1UHSA 2DA4A 4Y7NJ 3C2BA 3JRFA 4MIMA 1AU7A 1TWFJ 2CRGA 2NVXJ 3OOUA 2R7ZJ 1T56A 3LSRA 1AKHA 5M5YJ 2GBYA 5M5WJ 3K2AA 4MLOA 3ZQLA 2EZIA 4HNVA 4D7NA 1TWCJ 1Z0XA 3IH2A 2B63J 5IYDJ 1A5JA 1HDPA 2R92J 2DMTA 5FLMJ 5J1YA 3A01B 1GT0C 2HYJA 2NVTJ 4FISA 3JRIA 1SFOJ 4XRSA 1P7JA 2HDDA 2HXOA 1VF9A 2CQQA 3HEFA 5K7HA 3LNQA 1ZGWA 1ZK8A 2E2IJ 4C3IJ 1YRNB 1IG7A 2XPWA 1R9TJ 3LSGA 4A3MJ 1PUFA 4J19A 3HGYA 4L5EA 2R0QC 4GFBA 3PO3J 3RZOJ 5BNGA 1U78A 2XB5A 1ETYA 3S1MJ 3HBLA 1MBFA 1JTXA 4BY1J 2ME6A 5EF6A 5EEAA 4C3HJ 5IYCJ 3ZQIA 5C3EJ 4X1EA 1HF0A 1QVTA 2DN0A 3K7AJ 2CQXA 2ZB9A 1GV2A 2IAIA 2D5VA 4I6ZA 4M6VA 3BTCA 2YU9J 1K83J 3S2DJ 3E7LA 4B1RA 2AHQA 4BKXA 2M9HA 5GPCA 3TW7A 3GTJJ 5DTDA 2L7FP 1IUFA 2LR8A 2XB0X 4A3EJ 1JT0A 1ETVA 1GVDA 4JX5A 2VKEA 4A3IJ 3LOCA 1AKHB 1F43A 4M3EA 4M3GA 2DMQA 3PM1A 3RKQA 3IV5A 3A01A 2VUMJ 3JRGA 2N8GA 1WH7A 4FTHA 3IH4A 2DMNA 1IJWC 3GTLJ 2X6OA 3HGGA 1IRZA 3FKIJ 2LY9A 3I4NJ 3MN2A 1BW5A 1MBHA 1MH3A 2WAQN 4XIDA 1HOMA 2JJ7A 2JK3A 3BG9A 1UG2A 2M34A 2R5YA 1NTCA 1QPIA 1B8IB 5FKLA 1Y1WJ 2E1OA 1E3OC 2ID3A 3OSFA 3HOYJ 2OF7A 4AC0A 2YS9A 1OFCX 5J3LA 5F1JA 3BR1A 3BTIA 4FE7A 1O4XA 1PUFB 1CQTA 1RPWA 2GM4A 1POGA 2HXIA 2LLKA 1ZR4A 1XS9A 1GV5A 5K7ZA 3F0CA 2O9LA 2EZLA 5M3FJ 2K9NA 3BG5A 4BXXJ 1EF4A 3BG3A 3HB9A 2FJ1A 4A3LJ 1LE8B 2L0KA 5IPAA 1WGXA 3HOZJ 5GP9A 4CYCB 1UMQA 2NVQJ 3S1QJ 2CUEA 1IGNA 5FLVA 1I6HJ 2HQ5A 1FJLA 1JUSA 3ZQHA 3W6VA 2JA7J 4DYRA 2DJNA 1X2NA 1HDDC 1RETA 4I76A 3GTMJ 3QQAA 1XG1A 2I10A 2H1KA 2EZHA 3GTKJ 3CCYA 1D5YA 1B72B 3TEDA 1JKOC 3HM5A 4JX4A 3B6AA 5EZGA 2R5ZB 2VPRA 2HOTA 3BR2A 5E3OA 3S17J 2HI3A 2X9DA 1JUPA 3SDGA 1JGGA 4ABZA 1FIAA 1TWGJ 2EQRA 2JN6A 3VPRA 1NK2P 1JJ8C 2VKVA 4XK4A 4S0HB 4C3JJ 2GLOA 2ECBA 3FK6A 3ZQCA 4QIWN 2NS7A 2TRTA 1S7EA 3RZDJ 4XRMA 1B8IA 3BQYA 2Y30A 4JX6A 1I50J 3LSPA 4IHXA 1U9NA 3TW6A 3CQZJ 2QCOA 1HLVA 2WB1N 4M3FA 1RKWA 2MSYA 1W0UA 2R5YB 3Q0UA 4A93J 3BQZA 3BTLA 1FEXA 5EGOB 2DTZA 3TP0A 1QRYA 5F0FA 3JRBA 1MH4A 2Y2ZA 5EDNA 2TCTA 4A3GJ 2JA6J 4QSHA 1LE8A 3JR9A 4MFDA 4DYQA 2PMZN 1WPKA 3HOWJ 4CYCA 3FIWA 1RESA 5K7FA 2ID6A 1QVUA 1FIPA 5F27A 5FKNA 3OIOA 2M0CA 1MBKA 9ANTA 1MSFC 3S1RJ 2DA5A 1B72A 2FQ4A 2R5ZA 1MNMC 1RR7A 1U8BA 4Y52J 3WHCA 3RQIA 4FE4A 2EZKA 5DS9A 4FCYA 4BBRJ 4A3FJ 3BR3A 3NAUA 2COBA 2Y0SN 2E2JJ 2FX0A 4IHWA 1IC8A 3L1PA 4V2FA 1ETWA 1X2MA 2IEKA 1H8AC 2XGCA 1Z77A 5C4JJ 1AHDP 2EH3A 1OJLA 5IP9J 1DU0A 4XICA 5E3LA 3QPSA 5HODA 3S14J 1WI3A 2L9RA 2G0EA 4DZPA 1DU6A 5FKOA 5EGOA 2KDZA 4B4CA 2DA3A 3FISA 5J1RA 1A6IA 1ZR2A 1BW6A 3G1MA 3S2HJ 5E3MA 2LD5A 2ECCA 4A3CJ 2OPTA 1XC5A 1I3QJ 2XPVA 4A69C 4IEJA 3I4MJ 5EYRA 4M3BA 3HDDA 2LFBA 4V2GA 1JKPC 3JRCA 2E19A 1MSEC 2NOGA 5IP6A 3WHBA 1JUMA 3JRAA 1JKQC 3ZOBA 1MBGA 1ETQA 3JRDA 2E2HJ 1GUUA 4W1UA 3HKZN 2K9QA 4A3KJ 4DYCA 3QPLA 3GTQJ 2Y9YA 3Q3SA 2NS8A 4M3DA 1P7IA 1ITYA 4LOCA 2HOSA 1U9OA 2H8RA 2IBDA 2Y31A 3OSGA 1X58A 2W48A 1RKTA 2K9SA 3BT9A 4NDLA 3D1NI 3HOXJ 1JT6A 3BR0A 2AO9A 3BTJA 1Y1VJ 1IDYA 3IH3A 4A3JJ 5F04A 2DA6A 2JMWA 2CU7A 5J1UA 3DEWA 2ME0A 2JA8J 2QF7A 3O8GA 1FTZA 1TC3C 2ELKA 2O7OA 3BR6A 2X48A 1G2HA 2XPUA 4UUTA 3GBGA 1Q1VA 5GPAA 4UUSB 2DA7A 3Q0WA 3SFIA 5M3MJ 3DCFA 3G1OA 4EEFG 3PO2J 3G1LA 3M3YJ 5M5XJ 1GDTA 5JLWA 1ZQ3P 3GTGJ 3S15J 5IOZA 3BR5A 4JYKA 5FKKA 4A3BJ 2LTPA 3MKLA 3S1NJ 3A03A 3UKGA 1OCTC 1MBEA 4AUXA 4MO7A 5F0HA 1MBJA 4BY7J 2KT0A 1BL0A 4W97A 4A3DJ 2DMUA 5F08A 2M2EA 2XGEA 3JREA 1FTTA 1SANA 5JLXA 3HOVJ 1F36A 4X6AJ 5EG0B 5FKMA 3HOUJ 3H0GJ 2XSDC 3LSJA 4IHYA 2O8KA 5C44J 4D5FA 1ZKGA 2XRLA 3SJMA 1ETXA 3CDLA 2Y9ZA 4C2MJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV6 A;  2CJJ A;  2JWT A;  3Q0V A;  5IP7 J;  1TWH J;  5IYB J;  3B6C A;  2VI6 A;  1VI0 A;  5C4X J;  1ZTR A;  5FJ8 J;  3H3V K;  4B3A A;  4AYB N;  1OCP A;  2MGQ A;  3FK7 A;  2M8G X;  1BA5 A;  5EZH A;  2MW8 A;  3CMY A;  4QTR A;  3TP3 A;  3MVP A;  4RDU A;  1ENH A;  4UUS A;  2WV1 A;  1JTY A;  1JKR C;  1K61 A;  2L7M P;  2LVS A;  5F0C A;  2R93 J;  4BBS J;  1JJ6 C;  1IDZ A;  1TWA J;  1YRN A;  2K40 A;  2XGD A;  4G12 A;  4MFE A;  2P81 A;  3ZQG A;  2EBI A;  2DMP A;  3O8H A;  2LK2 A;  2NVY J;  1VND A;  2LKX A;  1T33 A;  2LP0 A;  3GTO J;  5E3N A;  4D5C A;  1LFB A;  2DA1 A;  1ETK A;  1W0T A;  3S16 J;  3JRH A;  2L7Z A;  5IOY A;  3M4O J;  4XRS G;  2HOA A;  1WCM J;  2JA5 J;  5EG0 A;  3NAR A;  2CUF A;  2DA2 A;  1ETO A;  4DW6 A;  2YUS A;  1WH5 A;  2MG4 A;  1ORK A;  2FD5 A;  4RBO A;  1APL C;  4DZJ A;  1NK3 P;  4IHV A;  1BJZ A;  4JP0 A;  3ZQF A;  2RAE A;  1H89 C;  1H88 C;  1HCR A;  4D7M A;  1VFC A;  1LFU P;  3A02 A;  3GTP J;  1UHS A;  2DA4 A;  4Y7N J;  3C2B A;  3JRF A;  4MIM A;  1AU7 A;  1TWF J;  2CRG A;  2NVX J;  3OOU A;  2R7Z J;  1T56 A;  3LSR A;  1AKH A;  5M5Y J;  2GBY A;  5M5W J;  3K2A A;  4MLO A;  3ZQL A;  2EZI A;  4HNV A;  4D7N A;  1TWC J;  1Z0X A;  3IH2 A;  2B63 J;  5IYD J;  1A5J A;  1HDP A;  2R92 J;  2DMT A;  5FLM J;  5J1Y A;  3A01 B;  1GT0 C;  2HYJ A;  2NVT J;  4FIS A;  3JRI A;  1SFO J;  4XRS A;  1P7J A;  2HDD A;  2HXO A;  1VF9 A;  2CQQ A;  3HEF A;  5K7H A;  3LNQ A;  1ZGW A;  1ZK8 A;  2E2I J;  4C3I J;  1YRN B;  1IG7 A;  2XPW A;  1R9T J;  3LSG A;  4A3M J;  1PUF A;  4J19 A;  3HGY A;  4L5E A;  2R0Q C;  4GFB A;  3PO3 J;  3RZO J;  5BNG A;  1U78 A;  2XB5 A;  1ETY A;  3S1M J;  3HBL A;  1MBF A;  1JTX A;  4BY1 J;  2ME6 A;  5EF6 A;  5EEA A;  4C3H J;  5IYC J;  3ZQI A;  5C3E J;  4X1E A;  1HF0 A;  1QVT A;  2DN0 A;  3K7A J;  2CQX A;  2ZB9 A;  1GV2 A;  2IAI A;  2D5V A;  4I6Z A;  4M6V A;  3BTC A;  2YU9 J;  1K83 J;  3S2D J;  3E7L A;  4B1R A;  2AHQ A;  4BKX A;  2M9H A;  5GPC A;  3TW7 A;  3GTJ J;  5DTD A;  2L7F P;  1IUF A;  2LR8 A;  2XB0 X;  4A3E J;  1JT0 A;  1ETV A;  1GVD A;  4JX5 A;  2VKE A;  4A3I J;  3LOC A;  1AKH B;  1F43 A;  4M3E A;  4M3G A;  2DMQ A;  3PM1 A;  3RKQ A;  3IV5 A;  3A01 A;  2VUM J;  3JRG A;  2N8G A;  1WH7 A;  4FTH A;  3IH4 A;  2DMN A;  1IJW C;  3GTL J;  2X6O A;  3HGG A;  1IRZ A;  3FKI J;  2LY9 A;  3I4N J;  3MN2 A;  1BW5 A;  1MBH A;  1MH3 A;  2WAQ N;  4XID A;  1HOM A;  2JJ7 A;  2JK3 A;  3BG9 A;  1UG2 A;  2M34 A;  2R5Y A;  1NTC A;  1QPI A;  1B8I B;  5FKL A;  1Y1W J;  2E1O A;  1E3O C;  2ID3 A;  3OSF A;  3HOY J;  2OF7 A;  4AC0 A;  2YS9 A;  1OFC X;  5J3L A;  5F1J A;  3BR1 A;  3BTI A;  4FE7 A;  1O4X A;  1PUF B;  1CQT A;  1RPW A;  2GM4 A;  1POG A;  2HXI A;  2LLK A;  1ZR4 A;  1XS9 A;  1GV5 A;  5K7Z A;  3F0C A;  2O9L A;  2EZL A;  5M3F J;  2K9N A;  3BG5 A;  4BXX J;  1EF4 A;  3BG3 A;  3HB9 A;  2FJ1 A;  4A3L J;  1LE8 B;  2L0K A;  5IPA A;  1WGX A;  3HOZ J;  5GP9 A;  4CYC B;  1UMQ A;  2NVQ J;  3S1Q J;  2CUE A;  1IGN A;  5FLV A;  1I6H J;  2HQ5 A;  1FJL A;  1JUS A;  3ZQH A;  3W6V A;  2JA7 J;  4DYR A;  2DJN A;  1X2N A;  1HDD C;  1RET A;  4I76 A;  3GTM J;  3QQA A;  1XG1 A;  2I10 A;  2H1K A;  2EZH A;  3GTK J;  3CCY A;  1D5Y A;  1B72 B;  3TED A;  1JKO C;  3HM5 A;  4JX4 A;  3B6A A;  5EZG A;  2R5Z B;  2VPR A;  2HOT A;  3BR2 A;  5E3O A;  3S17 J;  2HI3 A;  2X9D A;  1JUP A;  3SDG A;  1JGG A;  4ABZ A;  1FIA A;  1TWG J;  2EQR A;  2JN6 A;  3VPR A;  1NK2 P;  1JJ8 C;  2VKV A;  4XK4 A;  4S0H B;  4C3J J;  2GLO A;  2ECB A;  3FK6 A;  3ZQC A;  4QIW N;  2NS7 A;  2TRT A;  1S7E A;  3RZD J;  4XRM A;  1B8I A;  3BQY A;  2Y30 A;  4JX6 A;  1I50 J;  3LSP A;  4IHX A;  1U9N A;  3TW6 A;  3CQZ J;  2QCO A;  1HLV A;  2WB1 N;  4M3F A;  1RKW A;  2MSY A;  1W0U A;  2R5Y B;  3Q0U A;  4A93 J;  3BQZ A;  3BTL A;  1FEX A;  5EGO B;  2DTZ A;  3TP0 A;  1QRY A;  5F0F A;  3JRB A;  1MH4 A;  2Y2Z A;  5EDN A;  2TCT A;  4A3G J;  2JA6 J;  4QSH A;  1LE8 A;  3JR9 A;  4MFD A;  4DYQ A;  2PMZ N;  1WPK A;  3HOW J;  4CYC A;  3FIW A;  1RES A;  5K7F A;  2ID6 A;  1QVU A;  1FIP A;  5F27 A;  5FKN A;  3OIO A;  2M0C A;  1MBK A;  9ANT A;  1MSF C;  3S1R J;  2DA5 A;  1B72 A;  2FQ4 A;  2R5Z A;  1MNM C;  1RR7 A;  1U8B A;  4Y52 J;  3WHC A;  3RQI A;  4FE4 A;  2EZK A;  5DS9 A;  4FCY A;  4BBR J;  4A3F J;  3BR3 A;  3NAU A;  2COB A;  2Y0S N;  2E2J J;  2FX0 A;  4IHW A;  1IC8 A;  3L1P A;  4V2F A;  1ETW A;  1X2M A;  2IEK A;  1H8A C;  2XGC A;  1Z77 A;  5C4J J;  1AHD P;  2EH3 A;  1OJL A;  5IP9 J;  1DU0 A;  4XIC A;  5E3L A;  3QPS A;  5HOD A;  3S14 J;  1WI3 A;  2L9R A;  2G0E A;  4DZP A;  1DU6 A;  5FKO A;  5EGO A;  2KDZ A;  4B4C A;  2DA3 A;  3FIS A;  5J1R A;  1A6I A;  1ZR2 A;  1BW6 A;  3G1M A;  3S2H J;  5E3M A;  2LD5 A;  2ECC A;  4A3C J;  2OPT A;  1XC5 A;  1I3Q J;  2XPV A;  4A69 C;  4IEJ A;  3I4M J;  5EYR A;  4M3B A;  3HDD A;  2LFB A;  4V2G A;  1JKP C;  3JRC A;  2E19 A;  1MSE C;  2NOG A;  5IP6 A;  3WHB A;  1JUM A;  3JRA A;  1JKQ C;  3ZOB A;  1MBG A;  1ETQ A;  3JRD A;  2E2H J;  1GUU A;  4W1U A;  3HKZ N;  2K9Q A;  4A3K J;  4DYC A;  3QPL A;  3GTQ J;  2Y9Y A;  3Q3S A;  2NS8 A;  4M3D A;  1P7I A;  1ITY A;  4LOC A;  2HOS A;  1U9O A;  2H8R A;  2IBD A;  2Y31 A;  3OSG A;  1X58 A;  2W48 A;  1RKT A;  2K9S A;  3BT9 A;  4NDL A;  3D1N I;  3HOX J;  1JT6 A;  3BR0 A;  2AO9 A;  3BTJ A;  1Y1V J;  1IDY A;  3IH3 A;  4A3J J;  5F04 A;  2DA6 A;  2JMW A;  2CU7 A;  5J1U A;  3DEW A;  2ME0 A;  2JA8 J;  2QF7 A;  3O8G A;  1FTZ A;  1TC3 C;  2ELK A;  2O7O A;  3BR6 A;  2X48 A;  1G2H A;  2XPU A;  4UUT A;  3GBG A;  1Q1V A;  5GPA A;  4UUS B;  2DA7 A;  3Q0W A;  3SFI A;  5M3M J;  3DCF A;  3G1O A;  4EEF G;  3PO2 J;  3G1L A;  3M3Y J;  5M5X J;  1GDT A;  5JLW A;  1ZQ3 P;  3GTG J;  3S15 J;  5IOZ A;  3BR5 A;  4JYK A;  5FKK A;  4A3B J;  2LTP A;  3MKL A;  3S1N J;  3A03 A;  3UKG A;  1OCT C;  1MBE A;  4AUX A;  4MO7 A;  5F0H A;  1MBJ A;  4BY7 J;  2KT0 A;  1BL0 A;  4W97 A;  4A3D J;  2DMU A;  5F08 A;  2M2E A;  2XGE A;  3JRE A;  1FTT A;  1SAN A;  5JLX A;  3HOV J;  1F36 A;  4X6A J;  5EG0 B;  5FKM A;  3HOU J;  3H0G J;  2XSD C;  3LSJ A;  4IHY A;  2O8K A;  5C44 J;  4D5F A;  1ZKG A;  2XRL A;  3SJM A;  1ETX A;  3CDL A;  2Y9Z A;  4C2M J; 
#chains in the Genus database with same CATH topology
 1VQ6 I;  1LNW A;  5E20 A;  3RIR A;  2EA2 A;  1IV6 A;  3EUK L;  1FMW A;  4RGX A;  3HPG A;  1QU3 A;  1BOA A;  1PDN C;  3V8J A;  1VI0 A;  4G6T B;  5FJ8 J;  2IS4 A;  2LG4 A;  3CO7 C;  3CMA I;  4AYB N;  1OCP A;  2MGQ A;  2R7V A;  2V9K A;  1G4D A;  5D5U B;  4MEY F;  2ZME B;  2M8G X;  2GXB A;  4O3M A;  4GO1 A;  5D8L B;  3WTV C;  3ONQ A;  2F4I A;  2DBB A;  2WV1 A;  4IL6 C;  4UUS A;  2R7X A;  2DQR A;  1K61 A;  1G6N A;  1VQK I;  3TOA A;  1BI3 A;  2IXS A;  1R5I D;  1SMY F;  4HX4 A;  1IDZ A;  4EJO A;  2G7U A;  5ICC A;  3K10 A;  3Q9V A;  2XIG A;  1V3F A;  4AID A;  1YS6 A;  3S3M A;  2PLY A;  3O8H A;  4XKV A;  1VND A;  2M4G A;  3GTO J;  3L2Q A;  5ILS A;  1Z1D A;  1D3Y A;  2EFO A;  2L7Z A;  2XC7 A;  3OYN A;  2DI3 A;  2ISY A;  4XRS G;  3M4O J;  2HOA A;  4FT8 A;  4U88 A;  2JA5 J;  5EG0 A;  4HZF A;  2CWE A;  4RAZ A;  1ETO A;  3WTT C;  1FYK A;  3F8N A;  2MG4 A;  4RBO A;  1APL C;  5TGT A;  1OR7 A;  2D1V A;  3FXK A;  1HKT A;  4N9H A;  4NQW B;  1WJD A;  2DOF A;  4MNU A;  1LFU P;  3QYB A;  3A02 A;  1N77 A;  3GTP J;  4RB2 C;  4H4K C;  1W5S A;  1N78 A;  3JRF A;  3FXU A;  3FHN A;  3D0S A;  1TWF J;  2CRG A;  3GZ5 A;  3EYI A;  2PMZ A;  3AG2 H;  4KDP A;  2R7Z J;  5BQT A;  1PP7 U;  3LSR A;  1BBY A;  3E97 A;  3J7Y J;  5HS7 A;  4BE2 A;  3FM3 A;  4MLO A;  4LK0 F;  2XF5 A;  4HNV A;  4D7N A;  4B48 A;  2XAJ A;  2JPB A;  1Z0X A;  3IH2 A;  4H0E A;  4RGU A;  1LVA A;  1A5J A;  2EIL H;  5DM7 F;  2VJJ A;  1XD7 A;  3CUQ A;  5FLM J;  4LD5 A;  3HTU A;  3A01 B;  4FIS A;  1HST A;  3LWF A;  3TQN A;  2CQQ A;  2LKP A;  3BZK A;  2V9P A;  5K7H A;  2FEZ A;  3FMR A;  5JHF A;  1J2X A;  1ZGW A;  1ZK8 A;  1VQ5 I;  1Y8R B;  2XPW A;  4A3M J;  1UJ8 A;  2EWN A;  3R60 A;  3CCU I;  3AG4 H;  2E60 A;  3KP5 A;  1W1W E;  4RLQ A;  2RDP A;  4J19 A;  4R8H A;  2K85 A;  2PEX A;  4GFB A;  3PO3 J;  4AYB A;  1UEL B;  2Y69 H;  2GZW A;  2E35 A;  3HBL A;  1KU3 A;  5HVQ C;  4UNO A;  3S1M J;  4WK8 F;  1DDN A;  4UXN A;  3JSO A;  1G3Y A;  2KIM A;  3ZQI A;  2Z2S B;  1B9M A;  2ZSI B;  5GAD J;  2DTR A;  3HG9 A;  1A6Q A;  1Z3Y A;  2CQX A;  1ZRF A;  1VQL I;  1YE9 A;  1YG2 A;  1Z05 A;  2VE8 A;  3G4S I;  4F92 B;  5FD5 A;  1K83 J;  1FMV A;  5GAH J;  1O7L A;  3E7L A;  4B1R A;  1WWX A;  3GEZ A;  5LGT A;  5GPC A;  3ISP A;  1O3T A;  1OKR A;  4XM3 A;  5HDK A;  2QQB A;  1TTY A;  2LR8 A;  4A0Z A;  1KQ9 A;  4OIN F;  2KL4 A;  2V9V A;  1TT0 A;  1W4M A;  3ABK H;  2CYY A;  3L00 A;  2ZJQ F;  5E17 F;  3WGI A;  1Z3X A;  1VQ8 I;  1OCR H;  4II3 A;  3PL8 A;  3HRM A;  3VWB A;  3RYP A;  3GME A;  3DF8 A;  3SZG A;  2R7D A;  1WI9 A;  2VBY A;  4M3G A;  4M71 A;  3W2W A;  2DMQ A;  4BXU A;  3CC2 I;  2KHM A;  4LG3 A;  4BHC A;  3BDD A;  3I54 A;  3LMM A;  1ZRC A;  2A6H F;  2H27 A;  3H3Z A;  3HGG A;  1IRZ A;  1SFU A;  4BE1 A;  2V7F A;  2GQQ A;  1BW5 A;  3LQQ A;  5GAG J;  2M0M A;  1MH3 A;  3L2W A;  2R5Y A;  2JK3 A;  2VKH A;  1UG2 A;  1TQP A;  3BG9 A;  3J80 K;  4BAC A;  1TLH B;  4G7H F;  3L2V A;  2BEO A;  1NTC A;  2L02 A;  1QPI A;  2X6W A;  4CCM A;  2GOM A;  1Y1W J;  1FWZ A;  3L2C A;  3HOY J;  2OF7 A;  3EET A;  5K5O A;  2L4A A;  5J3L A;  1O4X A;  1CQT A;  1MJB A;  1ZR4 A;  3E3V A;  3EPZ A;  5FRN A;  2XV4 S;  1GV5 A;  5K7Z A;  4RB1 A;  3OL4 A;  2MYS A;  3ECH A;  3CCL I;  5M3F J;  4UVC A;  1BIB A;  1IV8 A;  2BW3 B;  2L5Q A;  1I5Z A;  1I3A A;  2R7O A;  4HV6 A;  1LE8 B;  1HA8 A;  2L0K A;  4KUM A;  3RCO A;  3HOZ J;  1Y6I A;  2P0W A;  1H0M A;  1KQ8 A;  2QQ8 A;  3ABT A;  1FJL A;  2IGK A;  1UG0 A;  2LKS A;  1K78 B;  5J8F A;  3DBH B;  3DKY A;  4DYR A;  2QBY A;  1P4A A;  1UZC A;  1Y0N A;  1DGR M;  2P4W A;  4CXF A;  4PDK A;  4I76 A;  3GTM J;  3F8F A;  1B4A A;  1XG1 A;  4NUB A;  3GYH X;  2B7E A;  2H1K A;  3GTK J;  1TQM A;  3HM5 A;  3H36 A;  1C0W A;  1OYI A;  1MMN A;  2K4B A;  4OIR F;  3WTS C;  1FP2 A;  2CQ7 A;  4LGW A;  3BCB A;  1S7O A;  1HW1 A;  5H6R A;  4L9N A;  4ABZ A;  2TDX A;  1IRG A;  2EQR A;  2JN6 A;  1X4O A;  1KZH A;  1JJ8 C;  1KU7 A;  4RB0 A;  1EV7 A;  2GIV A;  3ZQC A;  1SAX A;  4RMN A;  1EH7 A;  3FHZ A;  2XHK A;  1B8I A;  4XLH A;  1I50 J;  3OYC A;  1U9N A;  4KA4 A;  2JPC A;  3VYU B;  4HDU A;  3CQZ J;  3ESW B;  3J80 Z;  1XCB A;  1RKW A;  4M3F A;  3IHU A;  5HDN A;  1W0U A;  3CES A;  3DU6 A;  3Q0U A;  4A93 J;  2V1X A;  3J81 K;  3S32 A;  2L9N A;  4E7Z A;  1YIO A;  4JQF A;  1QRY A;  3CF5 F;  3JRB A;  1T8I A;  2NAZ A;  4XKW A;  2JVG A;  3U9G A;  2Q0O A;  2CG4 A;  5KAI C;  2H6C A;  3JW4 A;  2IA1 A;  2HDC A;  4DYQ A;  4CYC A;  3FIW A;  2VKD A;  3IWZ A;  4L9J A;  2A07 F;  5K7F A;  5LEK A;  1P6R A;  1FIP A;  5FKN A;  3PNT A;  3TDZ C;  4ZYG A;  1BIA A;  1MBK A;  4O6J A;  2CSO A;  2LH9 A;  1OR7 C;  2FU4 A;  3DQV C;  1FSH A;  2EK5 A;  2R4G A;  2VQG A;  2D2W A;  2R5Z A;  2NOJ B;  4M6Y A;  3S2W A;  1SC7 A;  5L3B A;  2WAF A;  4KMF A;  4A3F J;  3BR3 A;  3M8F A;  4N0B A;  1LKX A;  4U0V A;  4L5J A;  2FNA A;  3CUO A;  3I9V 2;  1XGO A;  4HRI A;  2A3S A;  4S05 A;  2QA4 I;  1ETW A;  2IEK A;  4IX7 A;  3PQK A;  4IQJ A;  4HX7 A;  3KLN A;  2R3S A;  3F6O A;  3I58 A;  2IGM A;  5HNH A;  3QPH A;  4MEX F;  3BPX A;  2UXN A;  1K7A A;  3GFL A;  5E3L A;  3QPS A;  3T0Y A;  5HOD A;  2KQR A;  2L9R A;  1OCO H;  2WAD A;  3CUQ C;  5KAF C;  2HR3 A;  3BOQ A;  5FKO A;  3O3K A;  1DUX C;  2RN7 A;  2DA3 A;  4IQ4 A;  1B1B A;  3FIS A;  3U1D A;  5D6E A;  1UHW A;  3VYT B;  3DPU A;  3S2H J;  3J81 Z;  3FMS A;  2ECC A;  2OPT A;  1XC5 A;  4AD9 A;  2XPV A;  4HAM A;  3EUH A;  1TW3 A;  4LIT A;  2LBF B;  2LSO A;  4M3B A;  2QEN A;  1SFX A;  2M3A A;  2DAO A;  5J4V A;  3TDU C;  5BOX A;  1YI2 I;  5CQE A;  2FMY A;  3K4J A;  3IAM 2;  3E6M A;  5D8K B;  3OYE A;  1E2X A;  3MFK A;  4C9Y A;  1LQ1 A;  3CCR I;  1DP3 A;  2QQA A;  3WE3 A;  2KFD A;  1YS7 A;  3JTG A;  3ZMV A;  2FXA A;  2DT5 A;  5CPR B;  1V4R A;  3V42 A;  2F5D A;  2Z5U A;  2E2H J;  2NRA C;  4DBR A;  3HKZ N;  4XOR A;  3KYC B;  1FPQ A;  3QPL A;  3GTQ J;  2P5L C;  4K2E A;  2NS8 A;  2RGV A;  3ABM H;  1P7I A;  1NG7 A;  3H0D A;  1CGP A;  3KEO A;  5HNF A;  2V1U A;  1EH6 A;  4P96 A;  3H5R A;  4A6E A;  3K9T A;  4E7I A;  1IO2 A;  1SEU A;  2HPI A;  3ZMD A;  2W48 A;  2HZT A;  3QAH A;  4IZZ A;  1J0R A;  2FSW A;  4DIQ A;  4NDL A;  3ERM A;  3Q9S A;  3FBN B;  3ZXS A;  3OYM A;  2AO9 A;  3IH3 A;  2XAU A;  1W5T A;  3TO7 A;  1F4K A;  4IXA A;  2GXG A;  2CQK A;  2JMW A;  2MA3 A;  2WY8 Q;  2QF7 A;  1G3W A;  3CP2 A;  3RSN A;  3LQR A;  1TC3 C;  2UWM A;  4HV5 A;  4BJ5 C;  2XKO A;  3OIP A;  2M8E A;  2ACJ A;  3BR6 A;  1Q1H A;  3QP6 A;  5JFR A;  2XPU A;  3ZPL A;  1Z6T A;  3ZCO A;  5LRR A;  4QPQ A;  1E3P A;  4ASN A;  4UUS B;  4ZZD A;  5M3M J;  3DBL B;  1QZE A;  3G1O A;  4M6X A;  3OYJ A;  3PO2 J;  3CJT B;  1FP1 D;  5M5X J;  1EJ9 A;  1RRJ A;  4YRV A;  1SFE A;  3IC7 A;  4QPO A;  1ZYR F;  5JLW A;  2DO7 A;  2DK5 A;  1YIT I;  3HPH A;  1ZQ3 P;  3S15 J;  2R7Q A;  4TV7 A;  3IKT A;  5IOZ A;  2NVU B;  3X2Q H;  2VXD A;  1V5E A;  3HSF A;  4EMS A;  2O61 A;  3S1N J;  3OYD A;  2DDB A;  2X6Y A;  2HTJ A;  5F0H A;  4KT5 C;  1S5L C;  2K7L A;  3A4C A;  4W97 A;  4XBF A;  1KQ0 A;  3K4C A;  1D1C A;  4G6Q A;  4OAY A;  3LAP A;  4PJM A;  3JRE A;  1SAN A;  2IJL A;  4BDY A;  4X6A J;  5EG0 B;  5FKM A;  3FXQ A;  3K1N A;  3LSJ A;  5D5V B;  2O8K A;  2ZKZ A;  1ETX A;  1OQY A;  2ZME C;  4IRI A;  3NWT A;  4AIJ A;  1LDK B;  1JI8 A;  1MD0 A;  2XAG A;  3QU3 A;  3UNG C;  2CJJ A;  2JUC A;  4GYI A;  1KYW A;  1R5H A;  3SZT A;  1TWH J;  2L9V A;  3B6C A;  5IYB J;  1E17 A;  2WA0 A;  2DPU A;  2VI6 A;  2CV1 A;  1ZTR A;  2CFO A;  3H3V K;  3PSF A;  1X1C A;  1I27 A;  1SFK A;  2ZXJ A;  1BA5 A;  4WXD A;  5EZH A;  4I99 C;  2CW0 F;  4ON0 A;  5FFZ A;  1V54 H;  2R7U A;  3FDY A;  3BZ6 A;  3TP3 A;  5L3E A;  2LF8 A;  2PI0 A;  4XRF A;  5L3C A;  4CYD A;  2VL8 A;  1JTY A;  4NNJ A;  4PFO A;  2VBW A;  2RQP A;  1FYL A;  1D5V A;  3V4G A;  5F0C A;  3NRV A;  3ZMT A;  3CUQ B;  3WG9 A;  1YRN A;  4MFE A;  3TMO A;  3SQN A;  3BLY A;  2EBI A;  2E71 A;  1I1G A;  4HG2 A;  2Q2E B;  1T33 A;  4P9F A;  4XLF A;  3BP8 A;  3D5S C;  3I64 A;  5CJ9 A;  2FOW A;  2XUB A;  4D5C A;  2QVO A;  5F1R A;  4FQG A;  1MMS A;  2RV8 A;  1ETK A;  4HPQ A;  1R4N B;  5L3G A;  5IOY A;  1ON1 A;  2HGC A;  3A0H C;  3GFM A;  4HBL A;  1T0F A;  5ICF A;  4B8X A;  4FAS D;  4J00 A;  3IRR A;  2DK8 A;  1R7J A;  2EFP A;  3K4N A;  2CUF A;  2DA2 A;  2HQR A;  2K3F A;  2CQN A;  2L54 A;  1REP C;  2WB1 A;  4OWR B;  1NK3 P;  4HA8 A;  3R0A A;  1BJZ A;  4IHV A;  2BHY A;  3HXL A;  1R49 A;  4MTD A;  1H89 C;  5D6F A;  4D1Q A;  4HX8 A;  4D7M A;  1USS A;  1UHS A;  3KLO A;  2FBI A;  3V8K A;  3MKZ A;  2DA4 A;  5FLX K;  1DPR A;  1KGS A;  5HLG A;  1FX7 A;  1AU7 A;  4V19 K;  2LOO A;  1T56 A;  1AKH A;  4ENJ A;  2NNN A;  2GOX B;  4LB5 A;  1P2F A;  4L0Y B;  2GBY A;  3W2V A;  3FXO A;  3HL2 A;  3BRO A;  5EJC A;  4A0Y A;  1VQ4 I;  1HXD A;  2HKX A;  2L2O A;  1TWC J;  2L01 A;  2M5W A;  4KIB A;  2B63 J;  1GLN A;  1I6X A;  2R92 J;  3W3C A;  3L2R A;  4G7Z F;  4WWC A;  5J1Y A;  4KIG A;  2YR2 A;  3B02 A;  2HYJ A;  1AWC A;  3DBR B;  3DLA A;  3QYE A;  2Y0S A;  2NVT J;  1FOW A;  2JVH A;  2FBK A;  4ZYA A;  1S72 I;  2EIJ H;  5K5R A;  2HDD A;  3F8M A;  2HXO A;  3R61 A;  4I2O A;  3HEF A;  4KNY A;  2F5C A;  1BI0 A;  4WXC A;  3RPU A;  1ZG1 A;  1JE8 A;  2E2I J;  3G3Z A;  2P6T A;  5DD4 A;  1IG7 A;  4GRI A;  4JBA A;  1VQN I;  2V6C A;  2ZO4 A;  4DBQ A;  1PUF A;  2OCE A;  2X4H A;  3ASN H;  3HRT A;  3GW2 A;  3GUD A;  3DP7 A;  3K1P A;  2R0Q C;  4IOC F;  1GXQ A;  3RZO J;  4XL9 A;  4C2T A;  2XSJ C;  1V5F A;  2XB5 A;  3GZN B;  1ETY A;  4N4N B;  4BAY A;  2QSH X;  1MBF A;  4P1W A;  1B59 A;  1J7K A;  1D1A A;  1MMD A;  5IYC J;  4X1E A;  5KVR A;  3VYS B;  4UVA A;  2DN0 A;  1HSJ A;  3K7A J;  5CLS A;  3KYL A;  3M07 A;  3LA7 A;  1CF7 A;  1FOX A;  4E7K A;  1MZB A;  2YU9 J;  1BR4 A;  4RA2 A;  1J75 A;  1XMA A;  1G3T A;  3S2D J;  2CH0 A;  3DWL E;  5LEJ A;  2OBP A;  3GF2 A;  4Q48 A;  4XKB A;  5FFX A;  3TW7 A;  3WOD F;  5FLX Z;  2HVS A;  1BC7 C;  2DYR H;  2L7F P;  2LF7 A;  1ON2 A;  1E0E A;  1IUF A;  2DT7 B;  3OOP A;  3QP5 A;  4HNT A;  2XB0 X;  4A3E J;  2E5N A;  4U87 A;  3CF2 A;  1JT0 A;  1QHG A;  3H92 A;  2QBY B;  2IW5 A;  4PGG A;  3CJN A;  3LOC A;  2KRC A;  1QQI A;  1F43 A;  3PSI A;  4BQA A;  2HFH A;  1TQI A;  2GIZ A;  4M3E A;  2HU9 A;  3ZMS A;  4OU0 A;  3I5U A;  4FTH A;  2DMN A;  2HVR A;  3NWS A;  4UV9 A;  3A0B C;  1MND A;  3CJQ B;  3CD6 I;  4IF4 A;  1X4P A;  1BN5 A;  2RRE A;  2X6O A;  3E1S A;  1Z67 A;  2LY9 A;  2M7B A;  3DV8 A;  2MH9 A;  3FM5 A;  3MN2 A;  3SZP A;  3WGH A;  1IRF A;  3MCZ A;  2M34 A;  2FQ3 A;  4OIP F;  1B8I B;  4ZDP A;  5FKL A;  3F6V A;  4FX0 A;  4BHB A;  1Y0U A;  1OPC A;  5L3F A;  4ENN A;  1ZLK A;  2IP2 A;  2YS9 A;  2PMH A;  3CMM A;  2AXT C;  3CC7 I;  1POG A;  5DM6 F;  3FXL A;  3WTW C;  5BPI A;  1R1T A;  2V79 A;  4KIC A;  3F0C A;  2VOD A;  2O9L A;  1SVM A;  4Z2Y A;  2VT3 A;  3G71 I;  3IWF A;  3HB9 A;  3TO9 A;  1LEA A;  4CYC B;  1UMQ A;  2NVQ J;  3GZ6 A;  5FLV A;  3R0J A;  1JUS A;  3ZQH A;  4ENK A;  1O3R A;  2UZK A;  1AOY A;  4XNF A;  4BNC A;  2VJ5 A;  3P9K A;  1A35 A;  5DCM A;  2DJN A;  2A68 F;  2V4J C;  3MD2 A;  1D8J A;  2STT A;  5CVR A;  3QQA A;  3K70 D;  4KIF A;  3VYR B;  2KLO A;  3TED A;  4B44 A;  4JX4 A;  1P4X A;  2EJR A;  2ZJR F;  2R5Z B;  4C2U A;  2HOT A;  5E3O A;  2HI3 A;  3SDG A;  1JUP A;  5ED4 A;  1X1B A;  4LB6 B;  5E1X A;  2OJE D;  2RNJ A;  4EJT A;  5FRM A;  4Q5S F;  4S0H B;  3FK6 A;  3OV8 A;  2PMU A;  4N9I A;  4A12 A;  3LA2 A;  2TRT A;  1S7E A;  4RS8 A;  3RZD J;  1L0O C;  1IXR C;  4F55 A;  2FE3 A;  3TW6 A;  4M9X A;  3AFH A;  4CSW A;  2WY7 Q;  3LSI A;  2MSY A;  4ESB A;  3BQZ A;  5D4S A;  1ZEL A;  3ABU A;  1KU2 A;  4DNC A;  3KEQ A;  5BS6 A;  2Y2Z A;  4BJ6 C;  4XQF A;  2HTS A;  4RGS A;  3RQ4 A;  4EM2 A;  1YQA A;  3JR9 A;  2RNG A;  1WPK A;  4M72 A;  1LVK A;  3KCC A;  2Z16 A;  1T0F C;  3KPH A;  2W57 A;  1R71 A;  2PN6 A;  2LNB A;  1IUY A;  1QVU A;  5F27 A;  5LHG A;  1TL8 A;  3T8R A;  2A6E F;  3H9Q A;  1T38 A;  9ANT A;  4DJA A;  1MSF C;  5H2F C;  3S1R J;  4YEJ A;  1FBS A;  1X1P A;  3E5X A;  1WRJ A;  2DA5 A;  3VDX A;  1B6A A;  1EH8 A;  4KN4 X;  2E1N A;  2BHZ A;  1SVO A;  2W00 A;  2DFF A;  2GXA A;  3LSM A;  4FE4 A;  2EZK A;  2ZFU A;  4BGD A;  5DS9 A;  4II2 A;  1F1Z A;  2BYV E;  1Z6R A;  3CP8 A;  4G6D A;  3OS1 A;  4XR6 A;  3OYF A;  3OMY A;  4CDG A;  2JUG A;  3L1P A;  4PGH A;  2KKO A;  3I59 A;  1QO0 D;  4YEL A;  2W84 A;  3DFG A;  1X2M A;  4F91 B;  2XGC A;  2L4M A;  1Z77 A;  2X1D A;  2F48 A;  1DQU A;  3QU6 A;  1OJL A;  4PJ0 C;  3QYF A;  3RDI A;  2JZY A;  1OIS A;  3BJO A;  2KIF A;  1T6S A;  2Y48 A;  3S14 J;  1W36 D;  2HOE A;  1QGP A;  4DZP A;  2VON A;  2RVC A;  5LLQ A;  2L3D A;  1TZL A;  3OYH A;  1D0X A;  2KDZ A;  1XMK A;  2M7A A;  4Y15 A;  2FUG 2;  2XRN A;  1T95 A;  2HYF A;  5J1R A;  1ZR2 A;  4NHJ A;  3PJR A;  3G1M A;  3MWM A;  3L9F A;  3S3N A;  5D5W B;  2PJR A;  4A69 C;  1I3Q J;  3LFK A;  3W2A A;  2F5F A;  1IN8 A;  4ZZL A;  3HDD A;  5JI6 A;  2DOA A;  1SD4 A;  3K4B A;  3M7G A;  4V2G A;  2V6E A;  2FNP A;  5IP6 A;  2QSG X;  4UV8 A;  5KHD A;  3M9A A;  1OMI A;  5H6Q A;  1RNL A;  3ZMZ A;  2VC1 A;  2DFE A;  2BY3 A;  2PBI A;  1LPQ A;  3V7C A;  3ROU A;  3IL2 A;  1NH3 A;  2E36 A;  2KP6 A;  1XGN A;  2DQL A;  4HF1 A;  3ZN0 A;  3JRD A;  4XMY A;  1GUU A;  3KIO A;  2O03 A;  3HOT A;  4A3K J;  4DYC A;  2AQE A;  1WJ5 A;  5DYM A;  1DGW Y;  2GA1 A;  2QYO A;  2XAH A;  4RGR A;  4M3D A;  1HKS A;  3BY6 A;  4PZJ A;  2CMP A;  2Y31 A;  1V55 H;  4Y17 A;  4IKF A;  3OSG A;  1SVL A;  4RLF A;  5B1A H;  5A2Q K;  1RKT A;  1KA8 A;  3WTX C;  2P7V B;  5LRS A;  3HOX J;  2CUZ A;  3BR0 A;  2VLA A;  4HLX A;  1Y1V J;  2B9S A;  3DEU A;  2HZD A;  5J1U A;  3WG7 H;  3DEW A;  2HVQ A;  2BY0 A;  4B3X A;  4XLP F;  3HC7 A;  3LAJ A;  3I71 A;  1WHU A;  2ELK A;  3BC8 A;  2O7O A;  2X48 A;  3GBG A;  4O5V A;  3OYA A;  3TL4 X;  5GPA A;  1S6L A;  3Q0W A;  3K4K A;  3DCF A;  1ODD A;  1XGM A;  2ZJ2 A;  4L18 B;  4XN0 A;  2IGO A;  4ZTF A;  1YFH A;  1W7P A;  1SAU A;  3FXJ A;  4PJJ A;  3RPU D;  2IA0 A;  2OQR A;  1YTY A;  3OYG A;  4JYK A;  2AQF A;  2JSC A;  2EV0 A;  3DU5 A;  3MKL A;  4C30 A;  1MBE A;  2P5K A;  1WKM A;  4EV0 A;  1YYV A;  2CS3 A;  3CLO A;  3BJA A;  1SD6 A;  4RAG A;  2ZBK A;  3HTS B;  4EJW A;  3WU1 B;  4IHY A;  4D5F A;  4YFX F;  3H3U A;  3HUG A;  3CDL A;  3FX3 A;  4KMU X;  3WTZ A;  4C2M J;  4CZC A;  1BI1 A;  2H6B A;  4LIU A;  3IRQ A;  3DTK A;  3H1C A;  4LMY A;  3WU0 A;  2DOD A;  2PJP A;  2F4M B;  4DQ2 A;  4MHG A;  4XOT A;  3GLL A;  5HLT A;  1WJA A;  5A2Q Z;  2F6C A;  3QOD A;  4B3A A;  2EFQ A;  2G7H A;  1G59 A;  5JR3 A;  1Z9C A;  4IOA F;  5EEG A;  2I5U A;  4ZC3 A;  4MQ9 F;  1O7F A;  1IW7 F;  2BBY A;  2ZCW A;  4M73 A;  3CMY A;  4OIQ F;  1T39 A;  3MVP A;  1WJC A;  3EQL F;  1WJE A;  3LSH A;  3AG3 H;  4I02 A;  2K86 A;  3KP2 A;  4UHT A;  1J09 A;  1QZZ A;  2L9S A;  4HDV A;  1Y39 A;  3REO A;  3ZP5 A;  2WAE A;  2R93 J;  1JJ6 C;  1TWA J;  2NYX A;  2VN2 A;  3M1E A;  3VOE A;  2P81 A;  4ETS A;  2K3P A;  4IVN A;  3PFI A;  1IXS B;  5JHU A;  2LK2 A;  4A5M A;  4MTE A;  4IJA A;  3P5J A;  3HSE A;  4AIK A;  3F72 A;  4YII A;  5KNL A;  1LFB A;  2P6S A;  2DA1 A;  3IUO A;  4ZTJ A;  5DD8 A;  3H5A A;  2E1M B;  2VB6 A;  2KDO A;  2QGU A;  3O2P E;  3NAR A;  2LMD A;  4JOM A;  1WH5 A;  3TGN A;  4L5I A;  1L3L A;  1ORK A;  3LA3 A;  1VQ9 I;  2CGP A;  3CC4 I;  1EKE A;  3CO6 C;  3VEP A;  4CUG A;  3BJ6 A;  2D1H A;  3SXY A;  1H88 C;  6PAX A;  4Z6Y A;  4E7S A;  2W25 A;  1N75 A;  1IN6 A;  2GA2 A;  1CF7 B;  2XF6 A;  3JAM K;  2NVX J;  4E6K G;  5EEH A;  3DPT A;  2LC2 A;  5M5Y J;  2VT2 A;  2VPL A;  5M5W J;  2QKL B;  4BQO A;  2EZI A;  4R1H A;  2ZNZ A;  2R7S A;  3C2H A;  4BJT A;  2UUZ A;  3IKV A;  1QA6 A;  1B9N A;  1IXC A;  2KZV A;  2E7W A;  4BXF A;  5IYD J;  1R22 A;  2XDV A;  4EQQ A;  2MH2 A;  1XN7 A;  2DMT A;  2QWW A;  2PX9 A;  5HS8 A;  1J5Y A;  2OCC H;  5BPD A;  1GT0 C;  3HOS A;  4PSW A;  2K5C A;  3KP6 A;  2VXZ A;  4WX9 A;  1J59 A;  4YIF A;  2RC4 A;  2DPD A;  3I55 I;  1UHM A;  2ZFW A;  5K5Q A;  3M8J A;  3MKW B;  4C3I J;  4PK4 A;  3CCM I;  1YW7 A;  1W5C C;  4GGG A;  3BG7 A;  1BJA A;  1U5T A;  3ABL H;  1G8X A;  2ISZ A;  4L5E A;  4AVZ A;  2IT0 A;  3H9J A;  4E70 A;  2VE9 A;  2BW3 A;  1D8K A;  5BNG A;  1WJB A;  1VZ0 A;  3OY9 A;  3A2K A;  2KIS A;  2W85 A;  2K02 A;  1JTX A;  4FX4 A;  2ME6 A;  5EF6 A;  1QBJ A;  5C3E J;  5H20 A;  2RQQ A;  2XAQ A;  4BL0 B;  4UUV A;  1HF0 A;  4GXO A;  4HLY A;  4LLN A;  1VTN C;  3GFJ A;  2FML A;  1K78 A;  1GV2 A;  2IAI A;  2VQH A;  4OAZ A;  1FOK A;  5JVT A;  2D5V A;  5F6F A;  4I6Z A;  1Y8Q B;  2AHQ A;  4BKX A;  4XOP A;  2M9H A;  3QOE A;  4BYY A;  5DTD A;  4XSZ F;  1MW7 A;  2BVM A;  1V5G A;  2QLZ A;  4A2U A;  3JAM Z;  3MAJ A;  2JQ7 A;  2EV6 A;  1G3S A;  1GVD A;  5AIP A;  2CV2 A;  4JX5 A;  2JA2 A;  3CJR B;  4J01 A;  1FOY A;  5DCM B;  4QLC U;  2F2E A;  4OMY A;  5E8I A;  1K79 A;  1PUE E;  1WVR A;  2VJ4 A;  1WJF A;  1MMA A;  3AG1 H;  3RKQ A;  3JRG A;  2N8G A;  3NQO A;  5J40 A;  3UR3 C;  1IJW C;  2ESN A;  1IRX A;  3JSP A;  3KP3 A;  4CZZ A;  2CO5 A;  3HKZ A;  2OTJ I;  5KCM A;  2JT1 A;  2IS2 A;  2XRO A;  2QM3 A;  1MBH A;  2WAQ N;  4XID A;  1HOM A;  3F9K A;  1R00 A;  3AAF A;  3QRF F;  2YSR A;  1OLT A;  1R1V A;  4AWX B;  2J5O A;  1E3O C;  2ID3 A;  2XVC A;  1HW5 A;  2HQA A;  3MZ8 A;  4LJZ F;  2BGC A;  3R6S A;  1RR8 C;  5CVI A;  5F1J A;  2KRH A;  1OYW A;  3BR1 A;  2GM4 A;  1RPW A;  2HXI A;  3TBI A;  3DTE A;  2XAS A;  4CCL A;  1XS9 A;  2ZJP F;  1MDM A;  2EZL A;  4EGZ A;  1YJN I;  5DV5 A;  4BXX J;  2HQN A;  4BEH A;  3BG3 A;  2FJ1 A;  3CCE I;  3CCV I;  4A3L J;  3PNV A;  5L3D A;  1YX5 A;  5IPA A;  1WGX A;  2KIU A;  3C18 A;  1FNN A;  3V7S A;  2H09 A;  3S1Q J;  2CUE A;  2DOE A;  4I01 A;  3OIQ A;  3PIP F;  1IGN A;  4IRH A;  2J5P A;  1XTA A;  5CVJ A;  3W6V A;  4IHT A;  1RUO A;  4CH7 A;  3ZMU A;  4KJZ A;  1X2N A;  2IRF G;  3ELK A;  2PG4 A;  1FYM A;  1QZY A;  2I10 A;  3WTY C;  2EZH A;  3E6B A;  4KYW A;  1D5Y A;  1JKO C;  3C2G A;  4MGR A;  3CLQ A;  3LL7 A;  5EZG A;  1X19 A;  2VPR A;  3H5N A;  2WBM A;  3BR2 A;  2M4K A;  2YX7 A;  2ADU A;  1PYV A;  2O6G E;  1JGG A;  2R7T A;  2BV6 A;  2QZ8 A;  4HEA 2;  3VPR A;  4PJL A;  1JHH A;  1NK2 P;  3OR2 C;  2OV7 A;  1A31 A;  4KFC A;  2ECB A;  3I59 B;  4QIW N;  2NS7 A;  1K4S A;  2LRE A;  4XRM A;  2Y30 A;  1OCC H;  4JX6 A;  1PVE A;  5ICE A;  1XSD A;  1S7A A;  1S9H A;  2DFI A;  5LHI A;  3I56 I;  3SEZ A;  3V7R A;  4GDF A;  4U0Y A;  5HS9 A;  1O57 A;  1UB9 A;  2QCO A;  3EUH C;  3HRS A;  2ICW G;  4F93 B;  2R5Y B;  3QOP A;  3E0J B;  3BTL A;  3G2B A;  2A05 A;  1S29 A;  3CZ6 A;  2MLG A;  3S93 A;  2W24 A;  3MKY B;  2LBF A;  2DTZ A;  4M9Z A;  3TP0 A;  2CW8 A;  5J6X A;  5F0F A;  5EDN A;  2JA6 J;  5J47 A;  5HLI A;  1MKM A;  2DLL A;  4Y4R A;  4MFD A;  1TNT A;  4XON A;  2PMZ N;  3HOW J;  4G9Y A;  5LD2 C;  2R7R A;  4MQV A;  1HQC A;  1W7P D;  1ZGA A;  3ML6 A;  2JRM A;  1XDU A;  4NB5 A;  1U3E M;  3K70 C;  3GWZ A;  3KX2 A;  2L7K A;  3OIO A;  4NC8 A;  2M0C A;  4EJV A;  2O3F A;  4AIH A;  4Q47 A;  5HDG A;  3F23 A;  1BI2 A;  4HYE A;  4YFK F;  4B09 A;  4ZH4 F;  4IO9 F;  3GXO A;  2WAQ A;  4UB6 C;  1B72 A;  2FQ4 A;  2H94 A;  1RR7 A;  4CCN A;  4U0W A;  3WHC A;  4EM0 B;  4FCY A;  3GVA A;  3OYI A;  3NAU A;  2W82 A;  2QQ9 A;  2EB7 A;  2UV1 A;  2E2J J;  3I0T A;  3T5X A;  3CCS I;  1IC8 A;  3WU2 C;  4V2F A;  4PUS A;  3FXR A;  4UB8 C;  5JVG F;  1K6Y A;  2Y75 A;  3U1K A;  2MBF A;  3J7A Y;  3CDH A;  5C4J J;  1TNS A;  1AHD P;  3K6G A;  4D9J A;  2EH3 A;  1YX3 A;  3KZI C;  4I0A A;  1M1E B;  1DU0 A;  2E34 A;  2LRD A;  4D0P A;  1WI3 A;  1YLF A;  3I53 A;  4F52 A;  3RKY A;  2X51 A;  2HDW A;  5EGO A;  4B4C A;  4YFN F;  4LFU A;  3BZC A;  3PUB A;  4BQN A;  4I98 B;  3OL3 A;  1FY7 A;  2ELH A;  3GLX A;  5E3M A;  4F3Q A;  3OYL A;  4XLC A;  3E6C C;  4HSR A;  2OQG A;  3I4M J;  1XPX A;  5EYR A;  3BPV A;  4XSX F;  2LFB A;  1U5T C;  2XKP A;  4YIR X;  3VB2 A;  2E19 A;  1MSE C;  1JXS A;  2M1B A;  2DW4 A;  1KON A;  1AA7 A;  1P9Q C;  1RZ4 A;  2VOO A;  2EA4 A;  1JUM A;  1ZRE A;  1MJ9 A;  1W7P B;  4PSX A;  3ZQ7 A;  4L0Z B;  1R5G A;  3OS2 A;  2YX4 A;  3WE2 A;  5E1Z B;  3SEQ A;  1YHQ I;  2OZ6 A;  3ZN1 A;  1ZHF A;  1JGS A;  4HNU A;  4ZDO A;  1JKQ C;  1BM9 A;  1LDJ A;  4HQE A;  3P9C A;  1MBG A;  5DDG A;  1ETQ A;  3HRU A;  4W1U A;  2MC3 A;  5B66 C;  2EV5 A;  4U7B A;  2Y9Y A;  1FT9 A;  3MZH A;  2OU2 A;  4CO8 A;  2ETH A;  1W36 C;  2ZXH A;  4EJU A;  1XSV A;  1ZGJ A;  3PUF A;  3HUG B;  3N05 A;  3OYK A;  1IN4 A;  1QHH D;  4BDZ A;  2FBH A;  4NC7 A;  1X58 A;  4RB3 C;  2K9S A;  3BT9 A;  3Q5F A;  1JT6 A;  3BTJ A;  3IAS 2;  3EYY A;  4UVB A;  4A3J J;  3F8B A;  2DA6 A;  2RKH A;  4EVI A;  3MZY A;  4QWQ A;  1QPM A;  2CU7 A;  1XDS A;  4X0G A;  2JA8 J;  3K2Z A;  5ERI A;  3CCJ I;  2WC2 A;  4BQQ A;  1MGT A;  2VIX A;  3BG6 A;  3U2R A;  5FB2 A;  3VFZ A;  3S8P A;  2D45 A;  1Q1V A;  4CCK A;  4U7D A;  3BWG A;  2WV0 A;  2DA7 A;  2Q2E A;  3LST A;  2MLK A;  4G8X A;  2O8X A;  3G1L A;  5HOO A;  1RIO H;  3M3Y J;  2Z99 A;  2HNH A;  3M1C A;  3TO6 A;  4WCG A;  1GDT A;  1E3H A;  4Q4Z F;  3LSK A;  3GTG J;  1LFP A;  4HF2 A;  3CDI A;  1YW9 A;  1WQ2 A;  2EIK H;  3GCM A;  3BR5 A;  3C1D A;  2LDU A;  3HHG A;  4OOI A;  5FKK A;  1UCR A;  1YOV B;  3LFU A;  4OMZ A;  3A03 A;  1OCT C;  2QUF A;  2GAU A;  4MO7 A;  1ZRD A;  2K9L A;  2NNY A;  1MBJ A;  3FKJ A;  4LG0 A;  2KT0 A;  1BL0 A;  5HLH A;  4AM3 A;  1MNE A;  2DMU A;  4B43 A;  2QSF X;  2KIQ A;  2M2E A;  3D5R C;  3T8T A;  3H0G J;  1YO5 C;  4FET A;  5C44 J;  2XRL A;  3SJM A;  1ERD A;  3OWT A;  3SHF A;  3DLL F;  4EM1 A;  2OTL I;  3RPQ A;  1LUJ B;  5E79 C;  2DDA A;  2JRT A;  2JWT A;  5FRO A;  3Q0V A;  5IP7 J;  1RUN A;  3D5L A;  3KE2 A;  5C4X J;  2VAS A;  3FK7 A;  5DCF A;  2BXY A;  4JK1 X;  3E5Q A;  1ZN2 A;  2MW8 A;  4HQM A;  1BC8 C;  3DKX A;  2O5R A;  3QPT A;  4QTR A;  4I0B A;  1D0Z A;  2X1C A;  5J8C A;  5IT9 K;  4RM3 A;  3COA C;  4RDU A;  4Y13 A;  2KZG A;  2VJI A;  1ENH A;  4LLL A;  5IT3 A;  3RJP A;  1JKR C;  1XB4 A;  1XSX A;  2L7M P;  3N4M A;  2LVS A;  4IHS A;  2ZNY A;  2E1M C;  4RAF A;  4BBS J;  2DCE A;  3EDP A;  2K40 A;  2XGD A;  4G12 A;  3ZQQ A;  2VBZ A;  4UY8 I;  3ZQG A;  3ZGK A;  4ESF A;  2DMP A;  3DPL C;  1LJ9 A;  2NVY J;  4N4O B;  2LKX A;  2LP0 A;  3KEY A;  1KU9 A;  4BU2 A;  4ZDL A;  4BE0 A;  5E3N A;  4XN3 A;  1ZLJ A;  2H1L A;  1W0T A;  2VQL A;  3JRH A;  3S16 J;  4KN7 X;  2IVM A;  4DGW B;  1WCM J;  3A1Y A;  1U5T B;  1QNT A;  4LLG F;  4DW6 A;  2YUS A;  1SMT A;  4RAY A;  2FD5 A;  4P55 A;  4L9T A;  4DZJ A;  4JP0 A;  3ZQF A;  3MQ0 A;  2RAE A;  3U21 A;  1ZH5 A;  1HCR A;  1VFC A;  2BXZ A;  2A5Y B;  2ESH A;  4IPA A;  2W1O A;  2BE5 F;  3QWL A;  2VOP A;  4Y7N J;  3C2B A;  3MMY B;  2IS1 A;  3C7J A;  4MIM A;  3FMQ A;  4M74 A;  3K4M A;  1MMG A;  2COM A;  3OOU A;  2XF7 A;  2ZME A;  1XX5 A;  5LHH A;  2QKM B;  3PQJ A;  2Z1D A;  1DPU A;  1FZP B;  3K0L A;  3K2A A;  1F9N A;  5FD6 A;  3ZQL A;  2BVL A;  2HWV A;  5E1W A;  3AL0 C;  2A5W A;  1IN7 A;  4P9U A;  4XLE A;  3HZJ A;  4PJN A;  3F22 A;  5IT9 Z;  1P92 A;  2LY2 A;  1ZAR A;  1HDP A;  1NHA A;  4P5O A;  2CFX A;  5KK1 A;  1TBX A;  1GHC A;  3JRI A;  3KYD B;  1P4W A;  1SFO J;  4XRS A;  1P7J A;  3J7A O;  1VF9 A;  3L2U A;  1R4M B;  3K4L A;  5B5E C;  4ENM A;  3LNQ A;  4HOB A;  3HHH A;  1YRN B;  4CA0 A;  1R9T J;  3CTA A;  2JSP A;  2X1E A;  3LSG A;  5J4Y A;  4NC6 A;  4EAT A;  2IA2 A;  1JHF A;  2O0Y A;  2M45 A;  2MAB A;  4AVP A;  5ILU A;  4XKC A;  3HGY A;  1VQM I;  1IF1 A;  1U78 A;  5AON A;  2VC0 A;  1VQ7 I;  1WZ2 A;  4BY1 J;  4NQW A;  3DXJ F;  5EEA A;  3VSK A;  4C3H J;  4CHU A;  2P5V A;  4CIC A;  2A69 F;  2KRF A;  3DEE A;  1MDM B;  1QVT A;  4KT6 A;  3V8L A;  1ZG5 A;  2ZB9 A;  4BEH B;  4M6V A;  2LYC A;  3BTC A;  1Z7L A;  3FBI B;  3GTJ J;  5ICG A;  1ETV A;  3L7W A;  1MJA A;  1I1S A;  2OA4 A;  2KMU A;  3I3L A;  2VKE A;  4A3I J;  2K4J A;  2CW7 A;  4L9V A;  1AKH B;  2P8T A;  2UXX A;  5GAE J;  5IY5 H;  3O6B B;  1X1D A;  3PM1 A;  2VUM J;  3IV5 A;  3A01 A;  1WH7 A;  2BY2 A;  2FA5 A;  3MEX A;  1FSE A;  2ZXI A;  3IH4 A;  3C3W A;  5DEQ A;  3GTL J;  3SYT A;  3M8E A;  2EFW A;  2W7N A;  3E6D A;  3FKI J;  4I7H A;  1K4T A;  1LEB A;  3I4N J;  3S3O A;  2FRH A;  2FF4 A;  4E4H A;  2JJ7 A;  2MC4 A;  2KPM A;  4WF2 A;  1XMX A;  1U6G A;  2HPM A;  2E1O A;  1R1U A;  5ILV A;  5LGU A;  1IAW A;  3OSF A;  2E5Z A;  1A04 A;  3W6J B;  3ERE D;  4AC0 A;  1RC9 A;  3FZV A;  3GO5 A;  2V26 A;  1OFC X;  1T2K A;  1S3J A;  4FE7 A;  3BTI A;  1PUF B;  2LLK A;  1WSU A;  4BH9 A;  1BR1 A;  4KIS A;  3TKY A;  2HKO A;  2OC6 A;  2K9N A;  3RI4 A;  3BG5 A;  4HST A;  5D4R A;  1Z7U A;  3GFI A;  1EF4 A;  3RKX A;  4XLN F;  4BS9 A;  5TRD A;  5GP9 A;  3K69 A;  1J9I A;  1IZ1 A;  5AIQ A;  1I6H J;  3H35 A;  2HQ5 A;  3KP7 A;  3KZY A;  2WWY A;  1D0Y A;  2F4O B;  3RYR A;  2E7X A;  4HW0 A;  2JA7 J;  2JTV A;  3VOD A;  3J7Z I;  4XLA A;  2Z33 A;  2K9M A;  2F5V A;  2PQ8 A;  1HDD C;  1RET A;  1HKQ A;  1NG6 A;  2QEX I;  3L09 A;  4ZYE A;  1SD5 A;  3CCY A;  1B72 B;  1VQP I;  3OYB A;  1U8R A;  3B6A A;  1LDD A;  3N97 A;  3S17 J;  4Y33 A;  2X9D A;  5E8G A;  2DJI A;  1FIA A;  4ZJZ A;  1TWG J;  3HYI A;  5CYV A;  3P9I A;  3TOB A;  4IRG A;  2VKV A;  5CVU A;  4XK4 A;  4C3J J;  3PFY A;  2GLO A;  5FO5 A;  1LB2 A;  4A0X A;  4E7H A;  5LGN A;  2EIM H;  1ZAO A;  1YJ9 I;  3BQY A;  3F3X A;  4AU7 A;  2A61 A;  3LSP A;  2BY1 A;  2EIN H;  4IHX A;  2CV0 A;  3AL0 B;  3R4K A;  2LY1 A;  1HLV A;  2WB1 N;  1ZG3 A;  5CKT A;  4NBQ A;  3JTH A;  3ZRG A;  1GXP A;  3ULQ B;  1FEX A;  5FGM A;  5EGO B;  2XGX A;  2Q1Z B;  3ZR8 X;  2DYS H;  2IPQ X;  3KP4 A;  2I8D A;  1MH4 A;  2EFN A;  2TCT A;  2OZU A;  3DTI A;  4A3G J;  2F5E A;  4QSH A;  1LE8 A;  1N25 A;  2K27 A;  3HJE A;  4OIO F;  2B0L A;  3NEU A;  3E5U A;  1RES A;  2CUJ A;  1UAA A;  2ID6 A;  3ECO A;  1BOB A;  2FOK A;  1EA3 A;  4CCO A;  4PFP A;  1XCV A;  1OCZ H;  4I09 A;  1X3W B;  3EUA A;  2E1C A;  4BUP A;  3P7N A;  2DU9 A;  1PJR A;  1I39 A;  4E7J A;  1BR2 A;  2HS5 A;  2M87 A;  3I4P A;  1FLI A;  4HF0 A;  5GTI C;  1MNM C;  2MD0 A;  1U8B A;  4Y52 J;  3VSL A;  3RQI A;  5DUK A;  4ANJ A;  2BOL A;  4BBR J;  1HW2 A;  1Z91 A;  2COB A;  2Y0S N;  5DUI A;  5B3S H;  4E7L A;  1A36 A;  1R36 A;  1S8N A;  2FX0 A;  4IHW A;  2HEO A;  1FBQ A;  2ZXW H;  1MIJ A;  1R23 A;  1K6O A;  2IGN A;  2XAF A;  3PIO F;  1R6R A;  2H8W A;  1H8A C;  1ACI A;  3FWE A;  1FC3 A;  5LBQ A;  3DKW A;  3T1B A;  5IP9 J;  2NS0 A;  2X0L A;  4XIC A;  3IP4 B;  4LIV A;  4KIT B;  4GCV A;  1FBU A;  2G0E A;  3ASO H;  1DU6 A;  1T08 B;  3WGG A;  1YJW I;  2X85 A;  2Z9O A;  1A6I A;  1XGS A;  3H9G A;  1BW6 A;  3SFZ A;  2LD5 A;  4LK1 F;  2P7C B;  3CCQ I;  4A3C J;  3FXM A;  4IEJ A;  2A6T A;  1UFM A;  1JKP C;  2OUM A;  3JRC A;  1F5T A;  2NOG A;  1Z21 A;  3RKW A;  1PP8 F;  3WHB A;  1T98 A;  3JRA A;  2EPF A;  1TW2 A;  3WTU C;  4G7O F;  3FF5 A;  1O3S A;  5TJJ A;  2AXL A;  2Q8K A;  2Y0M A;  3W6K B;  3HIF A;  4CGZ A;  1OYY A;  1IN5 A;  2DT6 A;  1X1A A;  3ZOB A;  2V1D A;  1H9G A;  2DXI A;  1ONV A;  3HSR A;  3KET A;  4ZYH A;  2K9Q A;  2KJB A;  2OAZ A;  3Q3S A;  4LG0 B;  1SD7 A;  3PNY A;  1GVJ A;  1DP7 P;  2ZC2 A;  3OS0 A;  3G73 A;  2BZT A;  2C6Y A;  1ITY A;  4LOC A;  2HOS A;  2GWR A;  1U9O A;  2H8R A;  3SDB A;  4F7Z A;  2IBD A;  2R7W A;  1ULY A;  2G9W A;  3AKZ A;  2VBX A;  2STW A;  4A5N A;  1YIJ I;  2DFH A;  5CQG A;  2W4S A;  4ZYD A;  3D1N I;  1D1B A;  5B1B H;  3BCA A;  4B47 A;  1HBX G;  2MD5 A;  3JCU C;  1IDY A;  4RM2 A;  5F04 A;  1X3U A;  1U2W A;  5E18 F;  5F64 A;  2YPR A;  2ME0 A;  2VQC A;  4A6D A;  3O8G A;  4Y3O A;  1FTZ A;  2R7F A;  2ZSH B;  3CME I;  1WFX A;  4G94 A;  3B73 A;  2X6X A;  3KZZ A;  1G2H A;  1X3Z B;  1YW8 A;  4UUT A;  1U0J A;  1TT5 B;  4PCQ A;  2MFZ A;  4GYG A;  3G6E I;  3OR1 C;  4M9S A;  2ELJ A;  5D5X B;  3SFI A;  5TIS C;  2OD5 A;  2YU3 A;  1RI7 A;  4EEF G;  3F21 A;  2PJR B;  2M30 A;  5K1Y A;  3GX4 X;  2KJC A;  4R79 A;  4FHT A;  4CCJ A;  5GTH C;  5LFA A;  1KYZ A;  5BMZ A;  2WTE A;  4BHP A;  4ESJ A;  1STZ A;  4DOZ A;  4WXH A;  1H9T A;  1Y56 A;  3KFW X;  2LTP A;  5CVV A;  4EGY A;  4A3B J;  3UKG A;  2NXN B;  4AUX A;  2Z3Y A;  2AS5 F;  2IS6 A;  4BY7 J;  4A3D J;  4S04 A;  1HC8 A;  5F08 A;  2V1N A;  2XGE A;  3RTR A;  1VQO I;  3HOV J;  5JLX A;  2PFB A;  1F36 A;  1TP4 A;  4ITV A;  4YG2 F;  1FTT A;  3HOU J;  3K1M A;  2XSD C;  1O3Q A;  1ZKG A;  2Y9Z A;  1UST A;  2HYG D;  3F8C A;  1R58 A; 
#chains in the Genus database with same CATH homology
 1IV6 A;  2CJJ A;  2JWT A;  3Q0V A;  5IP7 J;  1TWH J;  5IYB J;  3B6C A;  2VI6 A;  1VI0 A;  5C4X J;  1ZTR A;  5FJ8 J;  3H3V K;  4B3A A;  4AYB N;  1OCP A;  2MGQ A;  3FK7 A;  2M8G X;  1BA5 A;  5EZH A;  2MW8 A;  3CMY A;  4QTR A;  3TP3 A;  3MVP A;  4RDU A;  1ENH A;  4UUS A;  2WV1 A;  1JTY A;  1JKR C;  1K61 A;  2L7M P;  2LVS A;  5F0C A;  2R93 J;  4BBS J;  1JJ6 C;  1IDZ A;  1TWA J;  1YRN A;  2K40 A;  2XGD A;  4G12 A;  4MFE A;  2P81 A;  3ZQG A;  2EBI A;  2DMP A;  3O8H A;  2LK2 A;  2NVY J;  1VND A;  2LKX A;  1T33 A;  2LP0 A;  3GTO J;  5E3N A;  4D5C A;  1LFB A;  2DA1 A;  1ETK A;  1W0T A;  3S16 J;  3JRH A;  2L7Z A;  5IOY A;  3M4O J;  4XRS G;  2HOA A;  1WCM J;  2JA5 J;  5EG0 A;  3NAR A;  2CUF A;  2DA2 A;  1ETO A;  4DW6 A;  2YUS A;  1WH5 A;  2MG4 A;  1ORK A;  2FD5 A;  4RBO A;  1APL C;  4DZJ A;  1NK3 P;  4IHV A;  1BJZ A;  4JP0 A;  3ZQF A;  2RAE A;  1H89 C;  1H88 C;  1HCR A;  4D7M A;  1VFC A;  1LFU P;  3A02 A;  3GTP J;  1UHS A;  2DA4 A;  4Y7N J;  3C2B A;  3JRF A;  4MIM A;  1AU7 A;  1TWF J;  2CRG A;  2NVX J;  3OOU A;  2R7Z J;  1T56 A;  3LSR A;  1AKH A;  5M5Y J;  2GBY A;  5M5W J;  3K2A A;  4MLO A;  3ZQL A;  2EZI A;  4HNV A;  4D7N A;  1TWC J;  1Z0X A;  3IH2 A;  2B63 J;  5IYD J;  1A5J A;  1HDP A;  2R92 J;  2DMT A;  5FLM J;  5J1Y A;  3A01 B;  1GT0 C;  2HYJ A;  2NVT J;  4FIS A;  3JRI A;  1SFO J;  4XRS A;  1P7J A;  2HDD A;  2HXO A;  1VF9 A;  2CQQ A;  3HEF A;  5K7H A;  3LNQ A;  1ZGW A;  1ZK8 A;  2E2I J;  4C3I J;  1YRN B;  1IG7 A;  2XPW A;  1R9T J;  3LSG A;  4A3M J;  1PUF A;  4J19 A;  3HGY A;  4L5E A;  2R0Q C;  4GFB A;  3PO3 J;  3RZO J;  5BNG A;  1U78 A;  2XB5 A;  1ETY A;  3S1M J;  3HBL A;  1MBF A;  1JTX A;  4BY1 J;  2ME6 A;  5EF6 A;  5EEA A;  4C3H J;  5IYC J;  3ZQI A;  5C3E J;  4X1E A;  1HF0 A;  1QVT A;  2DN0 A;  3K7A J;  2CQX A;  2ZB9 A;  1GV2 A;  2IAI A;  2D5V A;  4I6Z A;  4M6V A;  3BTC A;  2YU9 J;  1K83 J;  3S2D J;  3E7L A;  4B1R A;  2AHQ A;  4BKX A;  2M9H A;  5GPC A;  3TW7 A;  3GTJ J;  5DTD A;  2L7F P;  1IUF A;  2LR8 A;  2XB0 X;  4A3E J;  1JT0 A;  1ETV A;  1GVD A;  4JX5 A;  2VKE A;  4A3I J;  3LOC A;  1AKH B;  1F43 A;  4M3E A;  4M3G A;  2DMQ A;  3PM1 A;  3RKQ A;  3IV5 A;  3A01 A;  2VUM J;  3JRG A;  2N8G A;  1WH7 A;  4FTH A;  3IH4 A;  2DMN A;  1IJW C;  3GTL J;  2X6O A;  3HGG A;  1IRZ A;  3FKI J;  2LY9 A;  3I4N J;  3MN2 A;  1BW5 A;  1MBH A;  1MH3 A;  2WAQ N;  4XID A;  1HOM A;  2JJ7 A;  2JK3 A;  3BG9 A;  1UG2 A;  2M34 A;  2R5Y A;  1NTC A;  1QPI A;  1B8I B;  5FKL A;  1Y1W J;  2E1O A;  1E3O C;  2ID3 A;  3OSF A;  3HOY J;  2OF7 A;  4AC0 A;  2YS9 A;  1OFC X;  5J3L A;  5F1J A;  3BR1 A;  3BTI A;  4FE7 A;  1O4X A;  1PUF B;  1CQT A;  1RPW A;  2GM4 A;  1POG A;  2HXI A;  2LLK A;  1ZR4 A;  1XS9 A;  1GV5 A;  5K7Z A;  3F0C A;  2O9L A;  2EZL A;  5M3F J;  2K9N A;  3BG5 A;  4BXX J;  1EF4 A;  3BG3 A;  3HB9 A;  2FJ1 A;  4A3L J;  1LE8 B;  2L0K A;  5IPA A;  1WGX A;  3HOZ J;  5GP9 A;  4CYC B;  1UMQ A;  2NVQ J;  3S1Q J;  2CUE A;  1IGN A;  5FLV A;  1I6H J;  2HQ5 A;  1FJL A;  1JUS A;  3ZQH A;  3W6V A;  2JA7 J;  4DYR A;  2DJN A;  1X2N A;  1HDD C;  1RET A;  4I76 A;  3GTM J;  3QQA A;  1XG1 A;  2I10 A;  2H1K A;  2EZH A;  3GTK J;  3CCY A;  1D5Y A;  1B72 B;  3TED A;  1JKO C;  3HM5 A;  4JX4 A;  3B6A A;  5EZG A;  2R5Z B;  2VPR A;  2HOT A;  3BR2 A;  5E3O A;  3S17 J;  2HI3 A;  2X9D A;  1JUP A;  3SDG A;  1JGG A;  4ABZ A;  1FIA A;  1TWG J;  2EQR A;  2JN6 A;  3VPR A;  1NK2 P;  1JJ8 C;  2VKV A;  4XK4 A;  4S0H B;  4C3J J;  2GLO A;  2ECB A;  3FK6 A;  3ZQC A;  4QIW N;  2NS7 A;  2TRT A;  1S7E A;  3RZD J;  4XRM A;  1B8I A;  3BQY A;  2Y30 A;  4JX6 A;  1I50 J;  3LSP A;  4IHX A;  1U9N A;  3TW6 A;  3CQZ J;  2QCO A;  1HLV A;  2WB1 N;  4M3F A;  1RKW A;  2MSY A;  1W0U A;  2R5Y B;  3Q0U A;  4A93 J;  3BQZ A;  3BTL A;  1FEX A;  5EGO B;  2DTZ A;  3TP0 A;  1QRY A;  5F0F A;  3JRB A;  1MH4 A;  2Y2Z A;  5EDN A;  2TCT A;  4A3G J;  2JA6 J;  4QSH A;  1LE8 A;  3JR9 A;  4MFD A;  4DYQ A;  2PMZ N;  1WPK A;  3HOW J;  4CYC A;  3FIW A;  1RES A;  5K7F A;  2ID6 A;  1QVU A;  1FIP A;  5F27 A;  5FKN A;  3OIO A;  2M0C A;  1MBK A;  9ANT A;  1MSF C;  3S1R J;  2DA5 A;  1B72 A;  2FQ4 A;  2R5Z A;  1MNM C;  1RR7 A;  1U8B A;  4Y52 J;  3WHC A;  3RQI A;  4FE4 A;  2EZK A;  5DS9 A;  4FCY A;  4BBR J;  4A3F J;  3BR3 A;  3NAU A;  2COB A;  2Y0S N;  2E2J J;  2FX0 A;  4IHW A;  1IC8 A;  3L1P A;  4V2F A;  1ETW A;  1X2M A;  2IEK A;  1H8A C;  2XGC A;  1Z77 A;  5C4J J;  1AHD P;  2EH3 A;  1OJL A;  5IP9 J;  1DU0 A;  4XIC A;  5E3L A;  3QPS A;  5HOD A;  3S14 J;  1WI3 A;  2L9R A;  2G0E A;  4DZP A;  1DU6 A;  5FKO A;  5EGO A;  2KDZ A;  4B4C A;  2DA3 A;  3FIS A;  5J1R A;  1A6I A;  1ZR2 A;  1BW6 A;  3G1M A;  3S2H J;  5E3M A;  2LD5 A;  2ECC A;  4A3C J;  2OPT A;  1XC5 A;  1I3Q J;  2XPV A;  4A69 C;  4IEJ A;  3I4M J;  5EYR A;  4M3B A;  3HDD A;  2LFB A;  4V2G A;  1JKP C;  3JRC A;  2E19 A;  1MSE C;  2NOG A;  5IP6 A;  3WHB A;  1JUM A;  3JRA A;  1JKQ C;  3ZOB A;  1MBG A;  1ETQ A;  3JRD A;  2E2H J;  1GUU A;  4W1U A;  3HKZ N;  2K9Q A;  4A3K J;  4DYC A;  3QPL A;  3GTQ J;  2Y9Y A;  3Q3S A;  2NS8 A;  4M3D A;  1P7I A;  1ITY A;  4LOC A;  2HOS A;  1U9O A;  2H8R A;  2IBD A;  2Y31 A;  3OSG A;  1X58 A;  2W48 A;  1RKT A;  2K9S A;  3BT9 A;  4NDL A;  3D1N I;  3HOX J;  1JT6 A;  3BR0 A;  2AO9 A;  3BTJ A;  1Y1V J;  1IDY A;  3IH3 A;  4A3J J;  5F04 A;  2DA6 A;  2JMW A;  2CU7 A;  5J1U A;  3DEW A;  2ME0 A;  2JA8 J;  2QF7 A;  3O8G A;  1FTZ A;  1TC3 C;  2ELK A;  2O7O A;  3BR6 A;  2X48 A;  1G2H A;  2XPU A;  4UUT A;  3GBG A;  1Q1V A;  5GPA A;  4UUS B;  2DA7 A;  3Q0W A;  3SFI A;  5M3M J;  3DCF A;  3G1O A;  4EEF G;  3PO2 J;  3G1L A;  3M3Y J;  5M5X J;  1GDT A;  5JLW A;  1ZQ3 P;  3GTG J;  3S15 J;  5IOZ A;  3BR5 A;  4JYK A;  5FKK A;  4A3B J;  2LTP A;  3MKL A;  3S1N J;  3A03 A;  3UKG A;  1OCT C;  1MBE A;  4AUX A;  4MO7 A;  5F0H A;  1MBJ A;  4BY7 J;  2KT0 A;  1BL0 A;  4W97 A;  4A3D J;  2DMU A;  5F08 A;  2M2E A;  2XGE A;  3JRE A;  1FTT A;  1SAN A;  5JLX A;  3HOV J;  1F36 A;  4X6A J;  5EG0 B;  5FKM A;  3HOU J;  3H0G J;  2XSD C;  3LSJ A;  4IHY A;  2O8K A;  5C44 J;  4D5F A;  1ZKG A;  2XRL A;  3SJM A;  1ETX A;  3CDL A;  2Y9Z A;  4C2M J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...