1WGXA

Solution structure of rsgi ruh-022, a myb dna-binding domain in human cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
GSSGSSGDKEWNEKELQKLHCAFASLPKHKPGFWSEVAAAVGSRSPEECQRKYMENPRGKGSQKHVTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-022, a myb DNA-binding domain in human cDNA
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords KIAA1903 protein
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wgxA00
3GTGJ 2LP0A 4UUSA 5GP9A 1OCPA 2CQXA 4MO7A 1ZKGA 4GFBA 5FKKA 3IH3A 2HQ5A 2DJNA 4A3CJ 1X2NA 5EDNA 4C3HJ 4BBSJ 3S2HJ 4C3IJ 3BTIA 3ZQCA 1E3OC 3W6VA 3LSRA 4XIDA 2NVYJ 1LFBA 3S16J 4L5EA 2EH3A 5M5YJ 1AU7A 4UUSB 3JRDA 3FK6A 2X48A 1U9OA 2DA3A 3BTCA 1QRYA 5FKMA 4I6ZA 2CJJA 2O9LA 3S1QJ 1HOMA 5IOZA 3BR5A 3BR1A 4FCYA 2ELKA 3HBLA 1JJ6C 3H0GJ 1Y1WJ 2DMQA 1IDYA 2DMUA 2CUFA 1IUFA 1Y1VJ 2LLKA 2XRLA 3A03A 1B8IA 2XGDA 2M9HA 1TWGJ 1CQTA 2DA7A 1H89C 5J3LA 1GV2A 4JYKA 4M3FA 1Z0XA 4IEJA 3HOWJ 4MLOA 5EYRA 3GBGA 1ZR4A 3CMYA 5K7FA 3HGYA 1B72B 1F43A 1LFUP 1ITYA 1DU0A 1UHSA 5DS9A 1I50J 2ECCA 3HGGA 4DYQA 1TWAJ 4MFDA 3JRHA 1MBEA 4UUTA 1VFCA 2DMPA 4Y52J 1DU6A 2E1OA 2Y9ZA 3M3YJ 2X6OA 3QPSA 5C44J 5FKNA 2GLOA 3RZOJ 2XB5A 1GUUA 3K7AJ 4M3GA 1W0UA 1T56A 1UMQA 3HKZN 3IH2A 1ZR2A 5IP6A 1R9TJ 2XGEA 2QCOA 5M5XJ 3SFIA 3HEFA 4BY1J 1XG1A 2R0QC 1S7EA 3GTLJ 4V2FA 4XRMA 4NDLA 2CUEA 3BR3A 2JMWA 3ZQFA 3BQYA 3A02A 3QQAA 4D7MA 1SANA 1MSEC 1RKTA 3FK7A 1IRZA 2O8KA 3GTKJ 1JT0A 2EZIA 3MVPA 2LVSA 3JRAA 2FD5A 2FQ4A 4XK4A 1ETVA 2PMZN 2QF7A 3JRIA 5F27A 2NS7A 3S14J 4A3EJ 3I4NJ 4DZJA 5F1JA 1MBJA 2KDZA 2K9NA 2IAIA 1QPIA 1TC3C 1MBFA 3PO2J 3DCFA 1WH7A 2LKXA 4BKXA 1ENHA 3G1MA 3MKLA 4LOCA 2LD5A 2YU9J 2ID3A 3TP0A 4B3AA 1I6HJ 1FTZA 4FISA 2R5YA 1APLC 4BY7J 5M3MJ 1JKRC 3BQZA 2KT0A 5FKLA 1D5YA 1P7JA 3SDGA 3JRCA 1RETA 2FX0A 2ECBA 2AHQA 4I76A 1MH3A 5EF6A 2DA5A 5FJ8J 5DTDA 5EG0B 2B63J 4A3IJ 5IPAA 1HLVA 1UG2A 1WH5A 1IC8A 3Q3SA 1GT0C 2MGQA 1F36A 2OF7A 2E2HJ 1O4XA 2JA7J 2HYJA 4W1UA 3A01B 2HXOA 1JTYA 1ETQA 3F0CA 2ME6A 3ZQHA 3LSPA 2HOAA 1U9NA 1B8IB 3L1PA 2O7OA 3NAUA 1ORKA 2DN0A 1G2HA 5F08A 5IOYA 5M5WJ 3RZDJ 1VNDA 4A69C 5IP9J 1JGGA 3TP3A 1JT6A 5HODA 3ZQLA 1FIAA 2WB1N 4CYCB 4JP0A 4Y7NJ 3UKGA 3IV5A 5BNGA 3OOUA 5FLMJ 5GPAA 5E3NA 4A3GJ 1JKPC 2G0EA 1XC5A 2LR8A 4EEFG 1FIPA 1OFCX 4S0HB 4IHXA 4A3KJ 3BG9A 1MNMC 3Q0UA 2GM4A 3HOZJ 2MW8A 4QSHA 2EBIA 2L7FP 5IYBJ 3S1RJ 1MBHA 2XPUA 3IH4A 2XB0X 2JA6J 2L7MP 2HXIA 2ZB9A 5EGOA 2Y0SN 1GVDA 3CDLA 1WI3A 5E3MA 1FJLA 3S15J 3G1OA 1BA5A 2GBYA 5FLVA 2DA2A 1HF0A 2LFBA 3RQIA 5IYDJ 3WHCA 3TW7A 1VF9A 1PUFA 1VI0A 1WCMJ 5E3LA 3O8HA 3OIOA 2EQRA 2DA6A 4M3DA 3GTMJ 5IP7J 3BR0A 2VKVA 3HOYJ 4D7NA 2JA8J 3TEDA 3CQZJ 3HOUJ 2LY9A 1HCRA 2R93J 1U78A 2L0KA 1RR7A 5EZHA 1HDDC 2R92J 2DMTA 2AO9A 1XS9A 3H3VK 1IDZA 2NVTJ 3RKQA 5J1YA 5C3EJ 4HNVA 2M8GX 4M3EA 5JLXA 3NARA 2L7ZA 5K7HA 1JKQC 4CYCA 5M3FJ 2RAEA 1ZQ3P 1EF4A 3BTJA 4C3JJ 4X1EA 2DMNA 2JN6A 3HOVJ 2X9DA 2NVQJ 1BL0A 1FEXA 5EZGA 1ETWA 4X6AJ 1TWCJ 2MG4A 3B6CA 2EZHA 3A01A 1A5JA 1JUMA 1I3QJ 1NK3P 2LTPA 3FKIJ 3JRGA 1K83J 5F04A 2YS9A 1WGXA 2XPVA 2N8GA 4ABZA 2HDDA 3S1NJ 1JTXA 2DTZA 1MH4A 2HI3A 2R5YB 1ETKA 1JUPA 2JJ7A 3OSGA 3C2BA 4QIWN 2Y31A 5FKOA 3E7LA 1AKHA 2HOTA 3D1NI 3I4MJ 2VPRA 2JK3A 1IG7A 4B1RA 1IJWC 4A3LJ 4D5FA 4A3DJ 3ZQGA 2WV1A 4B4CA 1SFOJ 1JKOC 4RDUA 4W97A 1ETYA 1P7IA 2OPTA 1QVTA 4JX4A 1JJ8C 1AHDP 3GTQJ 2E2IJ 1JUSA 4A3MJ 3DEWA 1YRNB 2Y30A 4A3JJ 3HDDA 4AC0A 1HDPA 4A3FJ 3LOCA 3FISA 5GPCA 1IGNA 3TW6A 3GTPJ 5EGOB 1LE8A 1NTCA 1MBGA 2H1KA 5F0FA 1YRNA 2CQQA 3HB9A 3QPLA 3BG3A 1RESA 4M3BA 3JREA 1A6IA 2D5VA 3VPRA 1ZTRA 1BW5A 3HM5A 2XSDC 4G12A 3MN2A 1RPWA 1PUFB 1AKHB 4V2GA 5J1RA 1GDTA 5IYCJ 2M2EA 3JRFA 3GTOJ 4FE4A 5K7ZA 3FIWA 4J19A 4AUXA 2XPWA 3SJMA 2COBA 3WHBA 2TCTA 3B6AA 3S1MJ 1B72A 3BR6A 1Z77A 3HOXJ 3JRBA 3BR2A 2ID6A 4XICA 2R5ZB 2CU7A 2MSYA 4FE7A 2K9SA 3S17J 2L9RA 1K61A 3K2AA 2NS8A 1OCTC 2K40A 4JX6A 1QVUA 1GV5A 2VI6A 2NVXJ 2HOSA 2IEKA 2E19A 3Q0VA 4RBOA 2R7ZJ 2H8RA 2TRTA 2Y9YA 4IHYA 3ZOBA 5JLWA 2ME0A 2LK2A 1RKWA 4A93J 1T33A 4IHVA 2VKEA 3OSFA 1MBKA 2CRGA 4D5CA 5C4JJ 5J1UA 1X2MA 1H88C 1Q1VA 2M34A 4MIMA 9ANTA 4JX5A 1IV6A 1TWFJ 1ZK8A 2JA5J 3PO3J 4BXXJ 3LNQA 1H8AC 2I10A 1ETXA 1U8BA 2JWTA 1LE8B 3BT9A 2FJ1A 1WPKA 2EZKA 2YUSA 5C4XJ 5F0CA 3LSGA 4M6VA 2W48A 1ETOA 2DA1A 3BG5A 3ZQIA 4FTHA 3BTLA 4MFEA 2NOGA 1OJLA 2K9QA 3M4OJ 2EZLA 2Y2ZA 2M0CA 2IBDA 4IHWA 4QTRA 1POGA 2DA4A 4BBRJ 5EEAA 3Q0WA 4C2MJ 5EG0A 3S2DJ 3G1LA 4DYCA 2E2JJ 4DW6A 4XRSG 3CCYA 4AYBN 3PM1A 4XRSA 2XGCA 3O8GA 5F0HA 1ZGWA 1NK2P 1TWHJ 1W0TA 3LSJA 2VUMJ 4DYRA 4DZPA 1BJZA 1X58A 3JR9A 2R5ZA 1MSFC 3GTJJ 2P81A 5E3OA 1FTTA 1BW6A 2WAQN 4A3BJ
chains in the Genus database with same CATH superfamily
2VBXA 2LP0A 4ZYHA 4M6XA 4UUSA 1OCPA 4PDKA 4MO7A 1VQ9I 4JBAA 2UXXA 5FKKA 3CCJI 2ZC2A 1X2NA 5EDNA 3CJQB 2E60A 2QBYA 1YE9A 2LY2A 3ZQCA 1N78A 2FNAA 1IN7A 2X51A 3FXOA 4I0AA 4XIDA 4LIUA 3WU2C 2CV1A 3S16J 2EH3A 3I56I 1V3FA 3L2UA 2WAFA 2GA1A 4B44A 3SEQA 1Z3YA 2CJJA 2XRNA 3OL3A 3OOPA 3S1QJ 3LQQA 2QM3A 3BR1A 4R8HA 2ELKA 3HBLA 4DBQA 5LRSA 4B43A 4MEYF 1VQLI 3CCEI 1Y1WJ 2DMQA 4U0VA 3DBLB 3RPUD 3V7SA 2DMUA 4U0YA 1I27A 4Q4ZF 2R7TA 2DOAA 5D6EA 1ZLJA 1CGPA 2WB1A 2XGDA 5IT3A 4AM3A 5J3LA 1VZ0A 2QYOA 4JYKA 4YIIA 2DOEA 4ITVA 2WWYA 2VQCA 4M3FA 4PJLA 3EETA 1T8IA 1RC9A 3FXLA 4IEJA 3JSPA 1IXCA 4M9SA 1F43A 1SFXA 1WJEA 3ERED 1W4MA 1UHSA 2VIXA 1DGRM 5ICFA 2ECCA 2O5RA 3O2PE 2OZ6A 1TWAJ 4MFDA 1H9GA 4G7OF 4XLCA 4O5VA 1MBEA 2EB7A 3K4JA 2H1LA 4P1WA 1R1VA 4UUTA 5HLIA 3TO6A 4BHBA 3ZXSA 3J80K 1XN7A 2IP2A 3WTSC 1VFCA 4Y52J 1R1TA 4XBFA 2HQRA 4XKWA 3RZOJ 5HVQC 1GUUA 3K7AJ 2XSJC 2VN2A 1Z67A 2R7DA 4NUBA 3OS2A 2QSGX 2Z3YA 1ZR2A 4KISA 4G94A 3RYRA 3ECHA 4V2FA 2IS6A 2CUEA 3BG6A 5HDNA 3J81Z 3ZQFA 1BM9A 4IXAA 2CW0F 4P96A 1RKTA 4L5IA 3EQLF 3L00A 2XROA 3GTKJ 2Q2EA 1JT0A 2IJLA 4I0BA 2V26A 2DFEA 2BXYA 3VODA 4XK4A 4BYYA 2PMZN 5LEJA 3JRIA 3R6SA 2HZDA 2NS7A 1FPQA 2EJRA 3M07A 1MBJA 2L9SA 1WSUA 2IAIA 1MBFA 1LKXA 4BL0B 3H0DA 2GIZA 3DCFA 3U1DA 4IO9F 1FSHA 3I5UA 4BKXA 1PDNC 2L9VA 2UXNA 2YU9J 2ID3A 1DP7P 2OU2A 5LLQA 5DEQA 5KHDA 2VONA 1I6HJ 1FTZA 5CVJA 4BY7J 1JKRC 2F5CA 2ZNZA 1OYIA 3K0LA 4V19K 1W7PD 4MHGA 3IAM2 4NC6A 3JRCA 4M6YA 4PFPA 2ZJQF 4BDYA 2P5VA 4BE2A 2DA5A 1TW2A 4A3IJ 2PG4A 1IC8A 3Q3SA 2E2HJ 3DKYA 2MA3A 1QZYA 4N9IA 2JA7J 1B4AA 1QZEA 2L01A 1XDSA 3I4PA 4W1UA 5D8KB 3AL0C 2HXOA 1KQ8A 1BIAA 1A6QA 3DEUA 3F0CA 3GCMA 4B8XA 2STWA 4HBLA 3ZQHA 1JXSA 1FP2A 2BY0A 1WKMA 1B8IB 2O7OA 4UV9A 4GRIA 1G2HA 4WXHA 3S3MA 1PJRA 5FRMA 4OAYA 1LFPA 1DQUA 3CESA 3DV8A 3JTGA 1FMVA 3FBNB 3DU5A 3WTXC 3VSLA 3LA7A 2O6GE 3CDIA 2IGNA 4Y7NJ 4PCQA 2A05A 3IV5A 1FWZA 2MH2A 2V9PA 4IF4A 5E3NA 4A3GJ 1PVEA 3N4MA 1VQKI 4F3QA 2E71A 4YFNF 2MYSA 1FIPA 3SDBA 3PJRA 4HAMA 4D0PA 4A3KJ 4IHXA 1MNMC 3Q0UA 2GM4A 3ONQA 1EH8A 2MW8A 2OTLI 4XLHA 4E7KA 3M1EA 2OCEA 2Q1ZB 3S1RJ 2MLGA 2XB0X 4XM3A 2KISA 4AU7A 3HTSB 1S7OA 1N75A 2EPFA 4HZFA 5DD4A 2P6SA 3DLLF 1FJLA 1FYLA 5DUKA 1WJAA 2P7CB 1TQPA 2HPIA 4ZZLA 1HF0A 1HSTA 5IYDJ 2QLZA 4U7BA 3TQNA 1XDUA 1FZPB 2QZ8A 1G3TA 4IKFA 3ABUA 2YPRA 5ILVA 4ZYDA 3IC7A 2EFPA 4UV8A 1QO0D 1FOKA 3OIOA 5JVTA 6PAXA 2ETHA 1HSJA 1BR2A 3GTMJ 2K02A 1BOBA 5LGTA 3L2VA 2KFDA 1QZZA 3CQZJ 1MJBA 5K5RA 3RDIA 5K5QA 2BW3B 3KZZA 1VQ6I 2L0KA 5EZHA 1HDDC 3COAC 1XS9A 4PGHA 3T8RA 2NVTJ 3GMEA 2A3SA 2EA2A 1QPMA 2L9NA 1WVRA 1VQNI 4ZH4F 3NARA 3LWFA 1G3YA 2KL4A 2MBFA 2KIUA 2W25A 5M3FJ 4WX9A 4CDGA 5HOOA 3JTHA 1MMDA 3OYDA 2PJRA 2FF4A 4AD9A 2QSHX 5J47A 4AIDA 4BQAA 1FC3A 4P55A 4IL6C 1BL0A 3BWGA 1FEXA 2XV4S 1G8XA 1WJBA 2VJ4A 2VASA 3A01A 1JUMA 4RA2A 3CCVI 2LTPA 4NBQA 2PJRB 1ERDA 1K83J 1B9MA 5ED4A 5F04A 4I02A 2P4WA 1HC8A 2HDDA 4ABZA 3G73A 3CCUI 1MNDA 1XMKA 5KK1A 4P9UA 2DOFA 1Z3XA 1FOYA 3E7LA 3H9QA 5J40A 1OCCH 2CUJA 2LC2A 4HX8A 3ULQB 3GX4X 4PUSA 2DT6A 5E1WA 4Y13A 1YW7A 3OYAA 4HF1A 3F8NA 1ZAOA 3PQKA 3R4KA 4NC8A 3HOTA 4BEHB 1BI1A 1O3QA 2ZKZA 1OQYA 1P7IA 2OUMA 2DBBA 3ABLH 3EYYA 1QVTA 3T8TA 2UZKA 2R7XA 5EEGA 3MZ8A 3OYKA 1DDNA 2Y30A 1X1PA 1JHHA 2H27A 5DYMA 1E0EA 1U8RA 2OC6A 2V6EA 3NWSA 3ZQ7A 1WJCA 4E7HA 5KAIC 1LE8A 3ZGKA 1AOYA 1TZLA 5EEHA 4CUGA 1MBGA 2H1KA 4YIFA 2VLAA 4A6EA 2YSRA 2CQQA 4AVPA 1EH7A 3PSFA 2PI0A 2L2OA 1Q1HA 1V54H 2DFIA 5H20A 3VPRA 2ZXJA 3DU6A 3HM5A 2F5FA 4G12A 2ESNA 3VDXA 3V42A 4EVIA 3QPTA 1XCBA 1PUFB 4Y15A 5IYCJ 3JRFA 3FXMA 2FBKA 2Y0SA 4J19A 3DFGA 1V5FA 4AUXA 4RB3C 5CKTA 3ZMSA 2ICWG 2NRAC 4CCOA 1BR1A 3GZ5A 1B72A 1J5YA 5LHGA 1PP7U 3KCCA 1IN6A 3BY6A 2CU7A 4RMNA 1IF1A 1KYZA 1IN5A 3KYDB 3K2AA 2Z33A 1OCTC 4ANJA 1IN4A 5FLXK 1GV5A 2EINH 1VQ4I 2HOSA 2IEKA 2E19A 2G7UA 3Q0VA 4RBOA 3ISPA 2KRFA 3K2ZA 2R7ZJ 1HKQA 3M1CA 2H8RA 4E70A 1SD6A 2A6TA 5JLWA 1KU7A 2ME0A 1WFXA 3HSFA 4A93J 1R36A 2EILH 2VKEA 4FHTA 2O8XA 1YG2A 2XKOA 3OYLA 4D5CA 2VOPA 5J1UA 1X2MA 1R6RA 3VYUB 2GXAA 3FXKA 2YX4A 5DM6F 3L09A 5A2QZ 5BOXA 4RM2A 1HW5A 3S32A 1TWFJ 1ZK8A 5FFXA 2DI3A 2E34A 3PO3J 2DDAA 3WGGA 4XQFA 4H4KC 4YEJA 2I10A 1MNEA 1ETXA 3BT9A 3ZR8X 1F1ZA 1CF7B 2EZKA 4LMYA 2P5KA 2YUSA 3RKWA 5C4XJ 5E1XA 3HRMA 4RB0A 4UB6C 2JA2A 2I8DA 3CC7I 3ZQIA 4FTHA 4HPQA 1ZGJA 3W6KB 3TO7A 3BTLA 4MFEA 4ESJA 2NOGA 3GFJA 2Y2ZA 2JSPA 4XKCA 2VJJA 3ZP5A 1SVLA 1K78A 2HZTA 3ASOH 5EG0A 4K2EA 2E2JJ 3CUQA 3D5SC 1DP3A 4EJVA 1IV8A 5JHFA 3PM1A 4U87A 2DODA 2K27A 1WJDA 5F0HA 1QHHD 1XGOA 3D5LA 1W0TA 2VUMJ 2KRHA 5JI6A 2CGPA 3NQOA 3FZVA 5FLXZ 4RGSA 2R5ZA 4ENMA 1MSFC 4XL9A 2RQQA 3GTJJ 2P81A 1PYVA 5E3OA 2WAQN 2VT2A 4LD5A 2YX7A 3GTGJ 5FB2A 5GP9A 2C6YA 4IX7A 1ZKGA 3IH3A 4A3CJ 3E5XA 3OYJA 3HKZA 4C3HJ 3S2HJ 4I01A 2V9KA 1T0FA 1VTNC 1E3OC 2AS5F 2L5QA 1X1BA 3ELKA 1TP4A 3BCBA 3LSRA 4MNUA 1YS7A 3Q5FA 1J9IA 2NVYJ 2KDOA 5M5YJ 4UUSB 5LEKA 1LVAA 3FK6A 2X48A 1U9OA 3CZ6A 3CMAI 3T0YA 4OU0A 2O9LA 1Z6TA 2F5VA 1QNTA 4AYBA 2PX9A 1JJ6C 1J75A 1S6LA 4HX7A 1WI9A 2E5NA 4MEXF 3DKWA 1EV7A 4MTDA 4BDZA 4NHJA 1TWGJ 2CQKA 3VYRB 1H89C 3KE2A 2XHKA 1N25A 5E17F 3GW2A 2HEOA 2OD5A 4KDPA 2PMZA 4CCMA 4ZDPA 4HLYA 1W36C 1ZREA 3IAS2 3U1KA 2EIMH 2BHYA 3SEZA 3HOWJ 4L0ZB 2BXZA 5D5WB 3PNVA 1ZR4A 3CJTB 4ZC3A 2CUZA 2M5WA 3QAHA 2R7RA 4LB5A 2WADA 3LAJA 1VQPI 1I50J 2WY8Q 1V5GA 2CMPA 2BVLA 2V6CA 4RLQA 1X19A 2JTVA 3JRHA 3A2KA 3BROA 4MQVA 3EPZA 2D1HA 3KP7A 5HS7A 4A5NA 2BGCA 1DU6A 3SXYA 4ZJZA 2E1OA 2Y9ZA 5TJJA 4PSXA 1IAWA 4Q48A 2LY1A 2X6OA 2HGCA 1L3LA 3FXQA 5F1RA 2HQNA 2XB5A 4II3A 4KIGA 5GAHJ 4U0WA 4M73A 2HNHA 5IP6A 2QEXI 1O3TA 2QCOA 2PQ8A 3TGNA 3IL2A 3HEFA 2OCCH 1XG1A 3GTLJ 3QP6A 4DIQA 3FHNA 3OYEA 4UVBA 3I55I 1XGSA 3BR3A 2Y48A 2PEXA 4I98B 2RQPA 3OY9A 1SANA 2KJCA 4LK1F 2DTRA 2I5UA 2FD5A 4EM0B 3F6VA 2NVUB 5F27A 1YOVB 3S14J 3I4NJ 1OR7A 4CZZA 2MABA 4DNCA 2O0YA 2XKPA 1B59A 1TC3C 4EATA 3KP2A 2LKXA 1AA7A 3G1MA 2LD5A 3RJPA 2IS4A 1Z9CA 1H9TA 4B3AA 4OINF 1XSDA 1YHQI 3ZMDA 3NEUA 3W6JB 5E8GA 3QWLA 5E20A 3I59A 2AXTC 1LQ1A 3U21A 1NH3A 3S3NA 5FKLA 1R5GA 2L02A 1X1CA 1X1AA 2JSCA 1P7JA 3QOPA 4RAGA 4Z6YA 5FD6A 1D5YA 1NG6A 1MIJA 2W00A 3GLXA 2X4HA 1RETA 1D1BA 3KP3A 2FX0A 2XF7A 4BJTA 4I76A 5LRRA 5EF6A 5EG0B 5FJ8J 2B63J 1LEBA 4L9VA 5IPAA 2IS1A 1I5ZA 1UG2A 3HRSA 3I59B 4F91B 3CMEI 2FMLA 3V7RA 1BBYA 1E3PA 2HYJA 2P7VB 5CVRA 4RLFA 2HWVA 3R0AA 4KN4X 2IS2A 4BE1A 2KLOA 4HQEA 4BQQA 4DOZA 1X3ZB 1D3YA 1BOAA 1ZRDA 2DQRA 2HR3A 2YR2A 1U9NA 2IA0A 3VFZA 4FX0A 5GAEJ 2HU9A 5M5WJ 1HBXG 3RZDJ 1VNDA 4A5MA 4A69C 4XN3A 3CJNA 4PK4A 2Q8KA 4UVCA 3SHFA 3ZQLA 1FIAA 4CYCB 4JP0A 1HW2A 3AFHA 3RSNA 5BNGA 2KKOA 5FRNA 2FU4A 3QYEA 3GZNB 5HS9A 3R60A 3K4MA 2LR8A 4EEFG 1FT9A 4GCVA 4AIKA 5ILSA 1J2XA 2XF5A 1YJWI 1BC8C 3SZGA 1Y56A 1TT0A 2GZWA 3D0SA 2JRMA 1BJAA 2XIGA 2XPUA 3IH4A 2LF8A 3KZIC 5ICCA 2L7MP 2HXIA 3ZRGA 2VJ5A 2NYXA 3RPUA 2FUG2 1UAAA 1XTAA 1WI3A 1IUYA 2VBZA 4ZTFA 1LB2A 1BA5A 1J59A 1ZN2A 2LKPA 5FLVA 1B6AA 5DM7F 1XX5A 2EFWA 3RQIA 4CHUA 2JQ7A 4N0BA 1U2WA 5CVUA 5TRDA 4XONA 4XMYA 2YU3A 1VF9A 3F9KA 2LBFA 3FXRA 5B66C 2E1MC 4P5OA 1K6OA 2WA0A 2WBMA 4HSTA 1YO5C 3C3WA 3M9AA 4BNCA 2CQ7A 1TLHB 3OYHA 2DA6A 2PMUA 3ZN0A 1O3RA 4EJUA 2RNJA 3MZHA 4OIPF 2DYSH 4BQOA 5IP7J 3BR0A 2VKVA 3HOYJ 2V79A 3H3ZA 1ZLKA 4LK0F 2VB6A 4RAFA 5F64A 1WHUA 1RR7A 3P5JA 4UXNA 2R92J 2DMTA 1DUXC 2ELHA 4M74A 2CSOA 3RKQA 4L18B 1EA3A 3HTUA 5J1YA 5C3EJ 3J80Z 3S2WA 2K85A 4IRGA 2BBYA 1T98A 2XF6A 4HNVA 2M8GX 4M3EA 1W5TA 5JLXA 4C30A 3D5RC 3WG7H 4BH9A 1JKQC 4CYCA 1ZQ3P 1HXDA 1U0JA 2X1DA 3CCMI 3BJAA 2V1NA 2AQEA 2W57A 4BHPA 1UB9A 1LDDA 1UFMA 4XSZF 5EZGA 1ETWA 3KPHA 4X6AJ 1TWCJ 3J81K 5L3CA 1USSA 3FKJA 5LBQA 2EFOA 2KZVA 1OYYA 1LDKB 2A61A 2FBIA 3Q9SA 5D5UB 1NHAA 2IA2A 4Y3OA 1WGXA 3DTKA 2PMHA 1ZRFA 4ENNA 2ZBKA 2VXZA 1JUPA 3OSGA 5CLSA 2DK8A 1WRJA 2EA4A 2K9MA 3C2BA 4QIWN 1P4WA 1AKHA 2HOTA 3D1NI 3RQ4A 3FBIB 1SD7A 1UJ8A 2H6BA 2JUGA 2MC3A 3FWEA 4B3XA 1BI2A 2KIMA 2HDWA 3WGIA 2RC4A 2K9LA 2WV1A 2CFXA 2ZFUA 4BACA 3V4GA 1SFOJ 3KEYA 4W97A 1FYMA 2GIVA 4XLAA 1ETYA 3HZJA 1E3HA 2V9VA 4Y33A 3HYIA 2JZYA 2CV2A 4A3MJ 3GTQJ 4U88A 1YRNB 3OYIA 3L2CA 2PLYA 4KT6A 3HDDA 3F8BA 2QUFA 1HDPA 2VQHA 1I3AA 3FISA 3BG7A 3BC8A 3TW6A 1RI7A 1KA8A 4MTEA 3GTPJ 3F21A 1YIJI 2UV1A 4RGUA 3EDPA 2PJPA 3MEXA 5BS6A 4HDVA 4GDFA 4QWQA 5F0FA 1MD0A 1BN5A 4E7SA 4I09A 3K1PA 1R71A 3HB9A 3AKZA 3LSHA 5JR3A 1XGMA 1SMYF 1RESA 3H5NA 3WU1B 1BC7C 3QPHA 3JREA 1A6IA 4QPQA 1SMTA 3R61A 3G6EI 1ZTRA 1BW5A 1RPWA 3MN2A 3MQ0A 3LSKA 3TL4X 4BS9A 1I6XA 2QWWA 4V2GA 5DCFA 1GDTA 4WCGA 5K7ZA 1ODDA 2F4OB 1S9HA 4N4NB 3EUHC 2COBA 3WHBA 3OMYA 3S1MJ 2VOOA 4E7ZA 4CCKA 3I3LA 1Z77A 1LPQA 5B5EC 3HOXJ 3BR2A 2H94A 2MC4A 4CXFA 3TBIA 3WTYC 2F6CA 2R5ZB 1M1EB 1U3EM 4X0GA 2W82A 4WWCA 2K9SA 4JOMA 1T2KA 3S17J 1K61A 3H5AA 2DAOA 2MD0A 3VEPA 1BR4A 1KU2A 1QVUA 4JX6A 2NVXJ 2XAJA 5KAFC 2DYRH 2A5WA 5LFAA 2M3AA 2EIJH 2TRTA 2NOJB 3ZOBA 4ASNA 1LVKA 2LK2A 4CCJA 1RKWA 1HQCA 5DUIA 4MGRA 2QA4I 4CCNA 3QRFF 1MBKA 2CRGA 2EV5A 2R7VA 3Q9VA 1H88C 2M34A 4MIMA 4J00A 4CGZA 3GO5A 4JX5A 2HYFA 3IRRA 3LA3A 5DDGA 5LHHA 3CO6C 2AXLA 2Y69H 2STTA 2JA5J 1X1DA 1T0FC 4HEA2 4RM3A 4KITB 2KIFA 5ICEA 1DPUA 1J7KA 2FJ1A 3FXJA 3FF5A 3PFIA 1KZHA 2R7WA 1YI2I 3LSGA 3CDHA 4LG3A 1FY7A 3QYBA 2OA4A 2W48A 1RNLA 2DA1A 2DT5A 3B02A 3BG5A 2B0LA 4XLPF 1YQAA 2CQNA 3RKXA 1JGSA 1SC7A 3H92A 4PSWA 3BCAA 2FBHA 2V1XA 1OJLA 1IN8A 2K9QA 2EZLA 2QENA 3GEZA 3LSIA 1Z7UA 2IBDA 4IZZA 1K4TA 4C2MJ 3QODA 4A0XA 2K7LA 4LJZF 3UR3C 4DYCA 3HG9A 1OPCA 1XSXA 1MJAA 3ASNH 1TQMA 2R7FA 2XAQA 3WE3A 3CCYA 3GF2A 4AYBN 5H6RA 3O8GA 2Q0OA 4CCLA 1NK2P 1K7AA 3LSJA 5HDKA 5ILUA 4DYRA 4HW0A 2HKXA 3JR9A 3EUKL 5DCMA 2IT0A 4PJ0C 3OYBA 2VBWA 1R5HA 3CP8A 2JPCA 3GUDA 4A3BJ 4WF2A 3ZQQA 2G7HA 2HPMA 4B09A 2IRFG 4N4OB 4ENJA 1IRGA 3BZCA 3FMQA 2L4AA 2CQXA 1J09A 4GFBA 2HQ5A 2DJNA 2ZMEA 1QGPA 4C3IJ 3G3ZA 1Z1DA 4H0EA 3CCRI 1EJ9A 3W6VA 2DLLA 3HHHA 3PUFA 5JFRA 1LJ9A 3GXOA 4GGGA 2W7NA 4L5EA 1AU7A 4U7DA 3WE2A 4MQ9F 3BTCA 3CJRB 2E7XA 2ISYA 1QRYA 5FKMA 3M8EA 1EH6A 1HOMA 2X6YA 2Z99A 4FCYA 2LSOA 3H0GJ 4F93B 3HL2A 1IDYA 1MMGA 1IUFA 1Y1VJ 4HV5A 2LLKA 3P9KA 1YJ9I 1B8IA 1HW1A 3HPHA 2DA7A 4HSRA 4OWRB 1GV2A 3W2AA 2E1CA 1O7FA 4PGGA 4B48A 5DCMB 1K79A 3MAJA 4MLOA 5D5XB 4OMZA 3ZCOA 3GBGA 3CMYA 5K7FA 3HGYA 3DPLC 1B72B 1IRFA 4KMUX 4ZYEA 1LFUP 2M7AA 5J6XA 3K69A 5DS9A 2EV6A 1YW9A 3K70D 3WTTC 4FETA 2QQAA 3O6BB 5LHIA 3HGGA 3IP4B 1OCRH 3CC2I 1ZHFA 1R58A 3OR1C 4PJJA 1I1SA 4M72A 5HLTA 2VL8A 3BJOA 3KEQA 2QVOA 3CO7C 3KIOA 4EGZA 5KVRA 3B73A 3QPSA 5FKNA 2GOMA 3EUHA 3BPVA 2CYYA 4CA0A 4UNOA 1TL8A 1JE8A 4RAZA 4IHTA 5TISC 3HKZN 2IGKA 3IH2A 1R9TJ 4UHTA 2XGEA 1GVJA 4HNTA 1Z21A 3SFIA 1F4KA 2EV0A 1SFUA 3FXUA 4BY1J 1S7EA 3C2GA 5L3FA 2NS0A 5B3SH 4D1QA 3MKYB 3KETA 3BQYA 3ERMA 3CP2A 3J7AO 3QQAA 1OR7C 1MSEC 1XMXA 2OBPA 3OYNA 1WJFA 2KPMA 2ZMEC 2EZIA 3MVPA 3S93A 3ZMVA 4HF2A 2LVSA 3JRAA 2FQ4A 4XSXF 4EV0A 1NG7A 2JT1A 3L2QA 4L0YB 3V7CA 5F1JA 2KDZA 2K9NA 2VODA 2RKHA 2RN7A 5GAGJ 1QPIA 2COMA 2DPUA 3PO2J 2X6XA 1WH7A 1ENHA 3MKLA 3F8MA 4AVZA 4ZDOA 1R7JA 1X3UA 3TP0A 1R49A 3JAMK 2L4MA 2H09A 3WGHA 2LOOA 1R5ID 3JAMZ 5BMZA 4R79A 3KYLA 3F6OA 2HTSA 2R7QA 5FROA 3J7YJ 4FX4A 1MJ9A 2LH9A 2AHQA 4IPAA 4HA8A 4PJNA 1MH3A 3R0JA 1XCVA 3W2VA 2MGQA 3K4KA 1YX3A 3L2RA 1TNSA 3T5XA 1R4MB 4RAYA 4IOCF 2HKOA 3H9JA 3H1CA 1IZ1A 3A01B 1FP1D 3H3UA 3I64A 2ELJA 3DTIA 5H6QA 2R7SA 1S72I 1P6RA 4EJWA 5FO5A 2ME6A 4OIOF 3LSPA 5E79C 1S7AA 4KIBA 3NAUA 2DN0A 3LMMA 1XSVA 3G4SI 3QU3A 2GXBA 1D8KA 1YX5A 1JGGA 2HFHA 1PUEE 4XKBA 3DTEA 5HODA 2WB1N 3E6CC 3IWZA 1ZGAA 1XGNA 2ZJPF 2ACJA 1VQ7I 3HXLA 1B9NA 2JRTA 3OOUA 5FLMJ 3BJ6A 5GPAA 2EFQA 2FQ3A 3E5UA 3P7NA 3IRQA 4EGYA 2G0EA 1XC5A 2ZFWA 4I7HA 4O6JA 1Z05A 2E35A 2IXSA 3VYSB 2KZGA 3RCOA 3JCUC 3BG9A 2CWEA 3N05A 2FEZA 5D4RA 3HOZJ 5J4YA 4QSHA 2EBIA 3PUBA 1A31A 2M4GA 3GVAA 2MLKA 3KEOA 1XMAA 3REOA 3SZPA 3HSEA 2KQRA 2ZB9A 2AQFA 4F92B 2K5CA 5CYVA 2Y0SN 3S8PA 2BY2A 4HLXA 2QQ8A 2ZJRF 3S15J 3G1OA 2GBYA 4KA4A 4EJTA 3DBRB 2M45A 1ZH5A 3WHCA 1L0OC 1YW8A 3KLOA 1TTYA 4FQGA 3K4NA 1PUFA 2OAZA 3KX2A 4HRIA 3HOSA 1VI0A 5E3LA 2E1MB 1KQ9A 3IUOA 2L54A 2X85A 3ECOA 3RTRA 5CVIA 4M3DA 2EWNA 1YYVA 3CF2A 3TKYA 3DQVC 2VT3A 2JA8J 2LF7A 3TEDA 3OIQA 4ZYGA 2LY9A 1U78A 1X3WB 2VE9A 4Q47A 3LQRA 3TOAA 2KRCA 5FFZA 2ESHA 2VC0A 1P4XA 4DQ2A 1HKTA 3BP8A 1IDZA 4KJZA 1G6NA 4LG0A 5F6FA 1FOXA 2A6HF 3IHUA 3P9CA 3GFIA 3N97A 1USTA 2JUCA 2JVGA 2XGXA 3AAFA 4Y4RA 3DLAA 4PZJA 1G4DA 4UVAA 2WC2A 3BTJA 4PJMA 3F72A 3A1YA 3DP7A 1Y8QB 1P92A 3K6GA 4GYGA 4G7HF 3E6DA 3HOVJ 2P6TA 3OWTA 2X9DA 4G6DA 2NVQJ 1ZG5A 2HVSA 2M87A 1Y39A 3EUAA 2LDUA 5CQGA 3WTVC 3B6CA 2EZHA 5FD5A 5HLGA 1T95A 4I99C 1NK3P 2FXAA 4HOBA 3JRGA 2GWRA 1B1BA 5BPIA 4KFCA 2XPVA 2N8GA 1FBQA 5BQTA 3S1NJ 3MKWB 4GYIA 5HNHA 3WTWC 2JJ7A 2QKLB 4LGWA 4RGXA 2Y31A 5FKOA 4IRIA 3BZ6A 3MMYB 2O3FA 3U9GA 4CSWA 3E97A 2HDCA 4D5FA 2X1EA 1DPRA 5L3BA 4B4CA 2XUBA 4E4HA 2OPTA 2OV7A 3L7WA 4JX4A 2CH0A 2WAEA 1JJ8C 1AHDP 2CV0A 1JUSA 4HF0A 3DEWA 1ONVA 1TT5B 4KYWA 3FM5A 4A3JJ 1KU9A 2CO5A 4AC0A 5K5OA 3LOCA 1IGNA 4ZTJA 2JVHA 2RV8A 4G6QA 4XLEA 5EGOB 4BE0A 2JPBA 1NTCA 4EJOA 1W5CC 2CS3A 1YRNA 1T38A 2CG4A 2BHZA 1S3JA 2MD5A 1C0WA 3BG3A 1XB4A 4DBRA 5H2FC 2J5PA 2LKSA 4EM1A 1RRJA 2VQGA 5CQEA 1AKHB 3GTOJ 2M2EA 1OYWA 3FIWA 4WXDA 3CLQA 4A0ZA 4AIJA 2IW5A 4C2UA 3BR6A 4BJ5C 4KMFA 1BI3A 1YLFA 2ID6A 2IGMA 2FSWA 2VQLA 4UY8I 1S29A 1W5SA 1ZG3A 4XRFA 1WQ2A 4FE7A 2L9RA 2NS8A 4F7ZA 1YFHA 3OIPA 2R7UA 1LEAA 2VC1A 3ZN1A 3K10A 1ZYRF 4BUPA 4AWXB 4ESFA 4ETSA 2DK5A 1D8JA 2Y9YA 3M7GA 1UHMA 3QU6A 1Y0NA 4F55A 2L3DA 1QU3A 2M4KA 1E2XA 1T33A 2J5OA 2RGVA 4QPOA 4IHVA 2GA2A 3LSTA 3OSFA 1F5TA 3CF5F 2OTJI 4Z2YA 5C4JJ 1D0XA 3K4CA 3AG2H 4OOIA 5J8FA 2VJIA 3TMOA 5CJ9A 9ANTA 4UUVA 5ICGA 1KONA 2MFZA 5HDGA 4TV7A 1XPXA 1IV6A 1JHFA 3PSIA 2HQAA 3VYTB 3OYFA 4BXXJ 5B1AH 4G9YA 3ZMZA 3RKYA 1U8BA 2JWTA 2G9WA 5IY5H 5L3EA 5AIQA 3KYCB 3FMSA 1K78B 5F0CA 4M6VA 3LA2A 1ETOA 5AIPA 3RPQA 4CH7A 4FT8A 3DXJF 4IQJA 1RUNA 3LFUA 1LDJA 1VQ5I 2ZNYA 1OLTA 2A69F 1G59A 2KHMA 2D1VA 1WJ5A 1W36D 3F8CA 1POGA 3WG9A 3H5RA 4HG2A 1ULYA 1T08B 3Q0WA 4BJ6C 4PFOA 2H8WA 4DJAA 5EJCA 1U5TC 1O7LA 2ISZA 3S2DJ 3G1LA 3PIPF 3FHZA 3CMMA 4UB8C 2XC7A 3QYFA 2F5DA 2CFOA 3OYGA 3ZMUA 3MKZA 3OYCA 1TNTA 2UUZA 4EMSA 3I9V2 4XRSA 3IWFA 2W84A 1YITI 4ESBA 2XGCA 3T1BA 3OR2C 1SD4A 1H0MA 1J0RA 3CCSI 3BPXA 4DZPA 3HPGA 3CLOA 2LMDA 1I39A 4BAYA 1DGWY 1MMNA 2XAHA 4YELA 2VKDA 2H6CA 2X6WA 3DEEA 3F3XA 5L3DA 3GWZA 2Z1DA 3SYTA 3DPTA 2FOKA 3OS0A 2D45A 2DT7B 5BPDA 1K4SA 4A12A 1D0ZA 4RB2C 2FOWA 2A07F 2FA5A 4CZCA 3K4BA 3HHGA 2ZSHB 4BBSJ 5JVGF 1SFEA 4BXFA 3BTIA 1S5LC 1SVMA 4JK1X 5JHUA 3DWLE 4BXUA 1LFBA 5B1BH 4G8XA 3RI4A 2BZTA 3JRDA 2DA3A 2E7WA 1MKMA 2GQQA 5D4SA 3JSOA 1TQIA 2M8EA 4I6ZA 5IOZA 3BR5A 1W1WE 2M7BA 3CD6I 2D2WA 2CUFA 2XAUA 5E8IA 1KU3A 1V55H 5DV5A 4EM2A 2K4BA 2K86A 2W85A 2XRLA 3A03A 1FNNA 1VQMI 2M9HA 1CQTA 3C1DA 3CTAA 2HYGD 3RIRA 1GXQA 5J4VA 2DQLA 4XOTA 1R22A 4M9XA 2FMYA 4YFKF 4OAZA 1HA8A 3CUQC 1Z0XA 2DU9A 3WU0A 4II2A 3DBHB 4FASD 4HNUA 2BEOA 5EYRA 2BW3A 3DKXA 1FLIA 2F48A 2GAUA 2L7KA 5HNFA 1ITYA 3OV8A 3SZTA 1DU0A 1YTYA 1BIBA 1KQ0A 4XLFA 1Z7LA 4LFUA 4DYQA 3MZYA 1MMAA 4YG2F 1MZBA 2DDBA 2KJBA 1K6YA 3VWBA 2DMPA 2Y75A 3K70C 3M3YJ 4LB6B 3E5QA 5C44J 2GLOA 2RVCA 4AIHA 1D0YA 3AG1H 1STZA 1RUOA 2PFBA 4M3GA 4J01A 1W0UA 1T56A 1FBUA 1AWCA 3TO9A 4C9YA 1UMQA 2R7OA 3W2WA 2M0MA 2ZO4A 5M5XJ 3DPUA 1D5VA 2HOEA 2Z2SB 2R0QC 5GADJ 1SAUA 4LITA 4XRMA 4NDLA 2JMWA 2E1NA 4KN7X 1MMSA 3LL7A 3A02A 4D7MA 3RYPA 4CO8A 3FK7A 1IRZA 3E3VA 2O8KA 2QBYB 3WTUC 4OIQF 3AG4H 1F9NA 4IJAA 1ETVA 3MFKA 2RDPA 3C2HA 1QA6A 1X4OA 2QF7A 2LRDA 4A3EJ 1A04A 4DZJA 4NC7A 2LYCA 2IGOA 3I54A 3I53A 4LOCA 2B7EA 4O3MA 3QOEA 2R4GA 2HVRA 3DF8A 4KNYA 1KYWA 2DPDA 2OJED 5ERIA 3M8FA 2W1OA 4XOPA 3PQJA 4FISA 2R5YA 1ZG1A 1APLC 2TDXA 5M3MJ 2QQ9A 3BQZA 4LIVA 3NRVA 1MDMB 2KT0A 5FGMA 1FSEA 3SDGA 1Z6RA 2LBFB 4L9TA 4WXCA 2W24A 1LUJB 2DO7A 2ECBA 2K3PA 4GO1A 5KCMA 1MW7A 2LNBA 5DTDA 1HLVA 1WH5A 1GT0C 1MGTA 1F36A 2OF7A 2VBYA 3KLNA 1RIOH 1O4XA 3C18A 4L5JA 4G6TB 5D6FA 5GTIC 1JTYA 1ETQA 5D8LB 3BZKA 2HOAA 2LG4A 3LAPA 1U5TA 2ZXWH 2PBIA 3L1PA 1YS6A 4RB1A 4I2OA 2OQRA 1ORKA 1X4PA 5F08A 5IOYA 4S04A 3H36A 3HJEA 2K3FA 3A0BC 2F4MB 5IP9J 3E1SA 4HDUA 3TP3A 3HUGB 1JT6A 1FOWA 1Y0UA 2NXNB 4Y17A 3WTZA 3E6BA 3UKGA 2M1BA 3FMRA 5LGUA 2Z5UA 3FX3A 2BY1A 3LSMA 2A68F 2RREA 4HV6A 2BYVE 2K4JA 4KIFA 4XLNF 2WTEA 1JKPC 2DCEA 3K4LA 1OFCX 1ON2A 3U2RA 1I1GA 1Y8RB 3L9FA 4S0HB 1S8NA 1ZELA 2IA1A 1KGSA 2L7FP 1XD7A 5IYBJ 1SAXA 1Z91A 1MBHA 3A4CA 3G2BA 2JA6J 4ENKA 3L2WA 5TGTA 2FNPA 2FE3A 1VQOI 3OS1A 5EGOA 2ZCWA 3ABKH 1GVDA 3CDLA 5E3MA 3CCQI 2HTJA 5IT9K 5E1ZB 4RS8A 3J7ZI 2Z16A 1D1CA 3ESWB 1MDMA 2GXGA 1GXPA 2DA2A 1QBJA 3HSRA 1G3WA 2A6EF 2LFBA 2ADUA 2NAZA 2O03A 1WWXA 1PP8F 2P0WA 2GOXB 3CC4I 2DFFA 2WY7Q 3TW7A 2DJIA 3TOBA 4Q5SF 3TDZC 4NNJA 2NNNA 1SD5A 3ROUA 3M8JA 2VE8A 2R3SA 2KIQA 4GXOA 3FDYA 1WCMJ 2V7FA 2CW8A 3O8HA 1A35A 1W7PB 4G7ZF 2EQRA 5AONA 4R1HA 4KICA 1FBSA 2O61A 4D7NA 3HOUJ 1HCRA 2R93J 1ON1A 1O3SA 1ZRCA 1A36A 4IVNA 3KP6A 3OYMA 1E17A 2AO9A 3H3VK 2DXIA 4NQWB 3CCLI 4OIRF 2VXDA 3H9GA 2W4SA 2ZXIA 2RNGA 3SQNA 2L7ZA 5K7HA 3KP5A 4M9ZA 2RAEA 2XASA 3EYIA 1UCRA 2ZSIB 1EF4A 3E6MA 2XDVA 3SFZA 4C3JJ 1BI0A 2EK5A 4X1EA 4BQNA 3AL0B 2DMNA 1RZ4A 3F22A 3GYHX 2JN6A 4HX4A 3PNTA 1Y6IA 2BOLA 3HIFA 4M71A 1SFKA 2E5ZA 1JI8A 5LD2C 2MG4A 3K1MA 1U6GA 4L9NA 3CUQB 3H35A 3PNYA 4YFXF 1A5JA 1I3QJ 3P9IA 3LFKA 1IW7F 1T6SA 4IRHA 1P9QC 3FKIJ 3K9TA 5J8CA 1R23A 3PL8A 2YS9A 2QGUA 3PFYA 1R00A 1UELB 1REPC 1JTXA 2DTZA 1MH4A 2HI3A 3HUGA 1ETKA 2R5YB 4E6KG 3K1NA 2VKHA 3A0HC 3I4MJ 4F52A 1OMIA 2VPRA 3QP5A 1R1UA 2JK3A 4LLLA 5KNLA 1IG7A 1IRXA 4B1RA 2F2EA 2BVMA 1GLNA 5D5VB 1IJWC 4A3LJ 1WZ2A 3I71A 4A3DJ 3ZQGA 4BGDA 3ABTA 1JKOC 3UNGC 4RDUA 5DD8A 2X0LA 3E0JB 2E2IJ 2E36A 1W7PA 2NNYA 3KFWX 1QHGA 2FRHA 4JQFA 3VSKA 2IVMA 4A6DA 2BV6A 2ZJ2A 3WODF 4A3FJ 4A0YA 3TDUC 5GPCA 2BE5F 2VPLA 4E7LA 1FYKA 2V1UA 2V4JC 4B47A 1O57A 1U5TB 3VB2A 2KMUA 4XORA 3HRTA 3HRUA 3G71I 5LGNA 4KT5C 1EKEA 1YJNI 3ABMH 3QPLA 3FM3A 2P5LC 2DW4A 4M3BA 4IHSA 1OISA 2P8TA 2QKMB 3IKTA 2D5VA 1FX7A 3JW4A 3F8FA 2ZXHA 2XSDC 1OCZH 4XKVA 2X1CA 4IOAF 1FMWA 3MD2A 3IKVA 1OCOH 4YIRX 3VOEA 5J1RA 2F4IA 2WV0A 4FE4A 4YRVA 3S3OA 4CICA 2Z9OA 2XPWA 1TW3A 3SJMA 2TCTA 3B6AA 2PN6A 3C7JA 1D1AA 2M30A 2OZUA 3BLYA 3JRBA 1HKSA 2QQBA 2Y0MA 4XICA 1UZCA 4N9HA 4HYEA 1ZARA 2MSYA 4ZYAA 3W3CA 4E7IA 2DFHA 1T39A 2K40A 4BU2A 2MH9A 2Q2EB 2XAFA 2VI6A 4XNFA 5CPRB 4E7JA 4QLCU 1UHWA 3I0TA 1V4RA 3V8JA 2ZMEB 2EIKH 2IPQX 2HS5A 1TBXA 4ON0A 4IHYA 2UWMA 3J7AY 1SVOA 1OKRA 2B9SA 3MWMA 1SEUA 2F5EA 2KP6A 3F23A 1ACIA 5HLHA 4XR6A 2HVQA 1CF7A 1IO2A 4ZDLA 2CW7A 4A2UA 3BDDA 1VQ8I 5E18F 1Q1VA 1P4AA 3I58A 5L3GA 4L9JA 3CUOA 4C2TA 3ZMTA 3OL4A 4LLGF 3V8KA 1YIOA 3LNQA 1H8AC 5HS8A 1LE8B 3X2QH 1IXRC 5K1YA 3ML6A 1WPKA 4LG0B 3HC7A 3BOQA 1RR8C 3MCZA 3V8LA 5A2QK 4IQ4A 2WAQA 4P9FA 4CYDA 3NWTA 3O3KA 4BHCA 5GTHC 4KUMA 3M4OJ 3KP4A 2M0CA 4RGRA 4BEHA 4HQMA 4NB5A 4D9JA 4QTRA 3ZPLA 4IHWA 1G3SA 2XVCA 2DA4A 3AG3H 4BBRJ 5EEAA 1N77A 2V1DA 4OMYA 4S05A 4DGWB 2QSFX 3KZYA 4WK8F 3PIOF 4NQWA 4DW6A 2OQGA 4XRSG 4EQQA 1V5EA 5IT9Z 3GZ6A 2A5YB 1UG0A 2LREA 1IXSB 4XN0A 1ZGWA 2BY3A 4ZZDA 1TWHJ 1P2FA 4LLNA 1R4NB 1QQIA 3GFMA 1BJZA 1X58A 3GLLA 2EFNA 5CVVA 2XAGA 1GHCA 1LNWA 1FTTA 1BW6A 3GFLA
chains in the Genus database with same CATH topology
3GTGJ 2LP0A 4UUSA 5GP9A 1OCPA 2CQXA 4MO7A 1ZKGA 4GFBA 5FKKA 3IH3A 2HQ5A 2DJNA 4A3CJ 1X2NA 5EDNA 4C3HJ 4BBSJ 3S2HJ 4C3IJ 3BTIA 3ZQCA 1E3OC 3W6VA 3LSRA 4XIDA 2NVYJ 1LFBA 3S16J 4L5EA 2EH3A 5M5YJ 1AU7A 4UUSB 3JRDA 3FK6A 2X48A 1U9OA 2DA3A 3BTCA 1QRYA 5FKMA 4I6ZA 2CJJA 2O9LA 3S1QJ 1HOMA 5IOZA 3BR5A 3BR1A 4FCYA 2ELKA 3HBLA 1JJ6C 3H0GJ 1Y1WJ 2DMQA 1IDYA 2DMUA 2CUFA 1IUFA 1Y1VJ 2LLKA 2XRLA 3A03A 1B8IA 2XGDA 2M9HA 1TWGJ 1CQTA 2DA7A 1H89C 5J3LA 1GV2A 4JYKA 4M3FA 1Z0XA 4IEJA 3HOWJ 4MLOA 5EYRA 3GBGA 1ZR4A 3CMYA 5K7FA 3HGYA 1B72B 1F43A 1LFUP 1ITYA 1DU0A 1UHSA 5DS9A 1I50J 2ECCA 3HGGA 4DYQA 1TWAJ 4MFDA 3JRHA 1MBEA 4UUTA 1VFCA 2DMPA 4Y52J 1DU6A 2E1OA 2Y9ZA 3M3YJ 2X6OA 3QPSA 5C44J 5FKNA 2GLOA 3RZOJ 2XB5A 1GUUA 3K7AJ 4M3GA 1W0UA 1T56A 1UMQA 3HKZN 3IH2A 1ZR2A 5IP6A 1R9TJ 2XGEA 2QCOA 5M5XJ 3SFIA 3HEFA 4BY1J 1XG1A 2R0QC 1S7EA 3GTLJ 4V2FA 4XRMA 4NDLA 2CUEA 3BR3A 2JMWA 3ZQFA 3BQYA 3A02A 3QQAA 4D7MA 1SANA 1MSEC 1RKTA 3FK7A 1IRZA 2O8KA 3GTKJ 1JT0A 2EZIA 3MVPA 2LVSA 3JRAA 2FD5A 2FQ4A 4XK4A 1ETVA 2PMZN 2QF7A 3JRIA 5F27A 2NS7A 3S14J 4A3EJ 3I4NJ 4DZJA 5F1JA 1MBJA 2KDZA 2K9NA 2IAIA 1QPIA 1TC3C 1MBFA 3PO2J 3DCFA 1WH7A 2LKXA 4BKXA 1ENHA 3G1MA 3MKLA 4LOCA 2LD5A 2YU9J 2ID3A 3TP0A 4B3AA 1I6HJ 1FTZA 4FISA 2R5YA 1APLC 4BY7J 5M3MJ 1JKRC 3BQZA 2KT0A 5FKLA 1D5YA 1P7JA 3SDGA 3JRCA 1RETA 2FX0A 2ECBA 2AHQA 4I76A 1MH3A 5EF6A 2DA5A 5FJ8J 5DTDA 5EG0B 2B63J 4A3IJ 5IPAA 1HLVA 1UG2A 1WH5A 1IC8A 3Q3SA 1GT0C 2MGQA 1F36A 2OF7A 2E2HJ 1O4XA 2JA7J 2HYJA 4W1UA 3A01B 2HXOA 1JTYA 1ETQA 3F0CA 2ME6A 3ZQHA 3LSPA 2HOAA 1U9NA 1B8IB 3L1PA 2O7OA 3NAUA 1ORKA 2DN0A 1G2HA 5F08A 5IOYA 5M5WJ 3RZDJ 1VNDA 4A69C 5IP9J 1JGGA 3TP3A 1JT6A 5HODA 3ZQLA 1FIAA 2WB1N 4CYCB 4JP0A 4Y7NJ 3UKGA 3IV5A 5BNGA 3OOUA 5FLMJ 5GPAA 5E3NA 4A3GJ 1JKPC 2G0EA 1XC5A 2LR8A 4EEFG 1FIPA 1OFCX 4S0HB 4IHXA 4A3KJ 3BG9A 1MNMC 3Q0UA 2GM4A 3HOZJ 2MW8A 4QSHA 2EBIA 2L7FP 5IYBJ 3S1RJ 1MBHA 2XPUA 3IH4A 2XB0X 2JA6J 2L7MP 2HXIA 2ZB9A 5EGOA 2Y0SN 1GVDA 3CDLA 1WI3A 5E3MA 1FJLA 3S15J 3G1OA 1BA5A 2GBYA 5FLVA 2DA2A 1HF0A 2LFBA 3RQIA 5IYDJ 3WHCA 3TW7A 1VF9A 1PUFA 1VI0A 1WCMJ 5E3LA 3O8HA 3OIOA 2EQRA 2DA6A 4M3DA 3GTMJ 5IP7J 3BR0A 2VKVA 3HOYJ 4D7NA 2JA8J 3TEDA 3CQZJ 3HOUJ 2LY9A 1HCRA 2R93J 1U78A 2L0KA 1RR7A 5EZHA 1HDDC 2R92J 2DMTA 2AO9A 1XS9A 3H3VK 1IDZA 2NVTJ 3RKQA 5J1YA 5C3EJ 4HNVA 2M8GX 4M3EA 5JLXA 3NARA 2L7ZA 5K7HA 1JKQC 4CYCA 5M3FJ 2RAEA 1ZQ3P 1EF4A 3BTJA 4C3JJ 4X1EA 2DMNA 2JN6A 3HOVJ 2X9DA 2NVQJ 1BL0A 1FEXA 5EZGA 1ETWA 4X6AJ 1TWCJ 2MG4A 3B6CA 2EZHA 3A01A 1A5JA 1JUMA 1I3QJ 1NK3P 2LTPA 3FKIJ 3JRGA 1K83J 5F04A 2YS9A 1WGXA 2XPVA 2N8GA 4ABZA 2HDDA 3S1NJ 1JTXA 2DTZA 1MH4A 2HI3A 2R5YB 1ETKA 1JUPA 2JJ7A 3OSGA 3C2BA 4QIWN 2Y31A 5FKOA 3E7LA 1AKHA 2HOTA 3D1NI 3I4MJ 2VPRA 2JK3A 1IG7A 4B1RA 1IJWC 4A3LJ 4D5FA 4A3DJ 3ZQGA 2WV1A 4B4CA 1SFOJ 1JKOC 4RDUA 4W97A 1ETYA 1P7IA 2OPTA 1QVTA 4JX4A 1JJ8C 1AHDP 3GTQJ 2E2IJ 1JUSA 4A3MJ 3DEWA 1YRNB 2Y30A 4A3JJ 3HDDA 4AC0A 1HDPA 4A3FJ 3LOCA 3FISA 5GPCA 1IGNA 3TW6A 3GTPJ 5EGOB 1LE8A 1NTCA 1MBGA 2H1KA 5F0FA 1YRNA 2CQQA 3HB9A 3QPLA 3BG3A 1RESA 4M3BA 3JREA 1A6IA 2D5VA 3VPRA 1ZTRA 1BW5A 3HM5A 2XSDC 4G12A 3MN2A 1RPWA 1PUFB 1AKHB 4V2GA 5J1RA 1GDTA 5IYCJ 2M2EA 3JRFA 3GTOJ 4FE4A 5K7ZA 3FIWA 4J19A 4AUXA 2XPWA 3SJMA 2COBA 3WHBA 2TCTA 3B6AA 3S1MJ 1B72A 3BR6A 1Z77A 3HOXJ 3JRBA 3BR2A 2ID6A 4XICA 2R5ZB 2CU7A 2MSYA 4FE7A 2K9SA 3S17J 2L9RA 1K61A 3K2AA 2NS8A 1OCTC 2K40A 4JX6A 1QVUA 1GV5A 2VI6A 2NVXJ 2HOSA 2IEKA 2E19A 3Q0VA 4RBOA 2R7ZJ 2H8RA 2TRTA 2Y9YA 4IHYA 3ZOBA 5JLWA 2ME0A 2LK2A 1RKWA 4A93J 1T33A 4IHVA 2VKEA 3OSFA 1MBKA 2CRGA 4D5CA 5C4JJ 5J1UA 1X2MA 1H88C 1Q1VA 2M34A 4MIMA 9ANTA 4JX5A 1IV6A 1TWFJ 1ZK8A 2JA5J 3PO3J 4BXXJ 3LNQA 1H8AC 2I10A 1ETXA 1U8BA 2JWTA 1LE8B 3BT9A 2FJ1A 1WPKA 2EZKA 2YUSA 5C4XJ 5F0CA 3LSGA 4M6VA 2W48A 1ETOA 2DA1A 3BG5A 3ZQIA 4FTHA 3BTLA 4MFEA 2NOGA 1OJLA 2K9QA 3M4OJ 2EZLA 2Y2ZA 2M0CA 2IBDA 4IHWA 4QTRA 1POGA 2DA4A 4BBRJ 5EEAA 3Q0WA 4C2MJ 5EG0A 3S2DJ 3G1LA 4DYCA 2E2JJ 4DW6A 4XRSG 3CCYA 4AYBN 3PM1A 4XRSA 2XGCA 3O8GA 5F0HA 1ZGWA 1NK2P 1TWHJ 1W0TA 3LSJA 2VUMJ 4DYRA 4DZPA 1BJZA 1X58A 3JR9A 2R5ZA 1MSFC 3GTJJ 2P81A 5E3OA 1FTTA 1BW6A 2WAQN 4A3BJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG J;  2LP0 A;  4UUS A;  5GP9 A;  1OCP A;  2CQX A;  4MO7 A;  1ZKG A;  4GFB A;  5FKK A;  3IH3 A;  2HQ5 A;  2DJN A;  4A3C J;  1X2N A;  5EDN A;  4C3H J;  4BBS J;  3S2H J;  4C3I J;  3BTI A;  3ZQC A;  1E3O C;  3W6V A;  3LSR A;  4XID A;  2NVY J;  1LFB A;  3S16 J;  4L5E A;  2EH3 A;  5M5Y J;  1AU7 A;  4UUS B;  3JRD A;  3FK6 A;  2X48 A;  1U9O A;  2DA3 A;  3BTC A;  1QRY A;  5FKM A;  4I6Z A;  2CJJ A;  2O9L A;  3S1Q J;  1HOM A;  5IOZ A;  3BR5 A;  3BR1 A;  4FCY A;  2ELK A;  3HBL A;  1JJ6 C;  3H0G J;  1Y1W J;  2DMQ A;  1IDY A;  2DMU A;  2CUF A;  1IUF A;  1Y1V J;  2LLK A;  2XRL A;  3A03 A;  1B8I A;  2XGD A;  2M9H A;  1TWG J;  1CQT A;  2DA7 A;  1H89 C;  5J3L A;  1GV2 A;  4JYK A;  4M3F A;  1Z0X A;  4IEJ A;  3HOW J;  4MLO A;  5EYR A;  3GBG A;  1ZR4 A;  3CMY A;  5K7F A;  3HGY A;  1B72 B;  1F43 A;  1LFU P;  1ITY A;  1DU0 A;  1UHS A;  5DS9 A;  1I50 J;  2ECC A;  3HGG A;  4DYQ A;  1TWA J;  4MFD A;  3JRH A;  1MBE A;  4UUT A;  1VFC A;  2DMP A;  4Y52 J;  1DU6 A;  2E1O A;  2Y9Z A;  3M3Y J;  2X6O A;  3QPS A;  5C44 J;  5FKN A;  2GLO A;  3RZO J;  2XB5 A;  1GUU A;  3K7A J;  4M3G A;  1W0U A;  1T56 A;  1UMQ A;  3HKZ N;  3IH2 A;  1ZR2 A;  5IP6 A;  1R9T J;  2XGE A;  2QCO A;  5M5X J;  3SFI A;  3HEF A;  4BY1 J;  1XG1 A;  2R0Q C;  1S7E A;  3GTL J;  4V2F A;  4XRM A;  4NDL A;  2CUE A;  3BR3 A;  2JMW A;  3ZQF A;  3BQY A;  3A02 A;  3QQA A;  4D7M A;  1SAN A;  1MSE C;  1RKT A;  3FK7 A;  1IRZ A;  2O8K A;  3GTK J;  1JT0 A;  2EZI A;  3MVP A;  2LVS A;  3JRA A;  2FD5 A;  2FQ4 A;  4XK4 A;  1ETV A;  2PMZ N;  2QF7 A;  3JRI A;  5F27 A;  2NS7 A;  3S14 J;  4A3E J;  3I4N J;  4DZJ A;  5F1J A;  1MBJ A;  2KDZ A;  2K9N A;  2IAI A;  1QPI A;  1TC3 C;  1MBF A;  3PO2 J;  3DCF A;  1WH7 A;  2LKX A;  4BKX A;  1ENH A;  3G1M A;  3MKL A;  4LOC A;  2LD5 A;  2YU9 J;  2ID3 A;  3TP0 A;  4B3A A;  1I6H J;  1FTZ A;  4FIS A;  2R5Y A;  1APL C;  4BY7 J;  5M3M J;  1JKR C;  3BQZ A;  2KT0 A;  5FKL A;  1D5Y A;  1P7J A;  3SDG A;  3JRC A;  1RET A;  2FX0 A;  2ECB A;  2AHQ A;  4I76 A;  1MH3 A;  5EF6 A;  2DA5 A;  5FJ8 J;  5DTD A;  5EG0 B;  2B63 J;  4A3I J;  5IPA A;  1HLV A;  1UG2 A;  1WH5 A;  1IC8 A;  3Q3S A;  1GT0 C;  2MGQ A;  1F36 A;  2OF7 A;  2E2H J;  1O4X A;  2JA7 J;  2HYJ A;  4W1U A;  3A01 B;  2HXO A;  1JTY A;  1ETQ A;  3F0C A;  2ME6 A;  3ZQH A;  3LSP A;  2HOA A;  1U9N A;  1B8I B;  3L1P A;  2O7O A;  3NAU A;  1ORK A;  2DN0 A;  1G2H A;  5F08 A;  5IOY A;  5M5W J;  3RZD J;  1VND A;  4A69 C;  5IP9 J;  1JGG A;  3TP3 A;  1JT6 A;  5HOD A;  3ZQL A;  1FIA A;  2WB1 N;  4CYC B;  4JP0 A;  4Y7N J;  3UKG A;  3IV5 A;  5BNG A;  3OOU A;  5FLM J;  5GPA A;  5E3N A;  4A3G J;  1JKP C;  2G0E A;  1XC5 A;  2LR8 A;  4EEF G;  1FIP A;  1OFC X;  4S0H B;  4IHX A;  4A3K J;  3BG9 A;  1MNM C;  3Q0U A;  2GM4 A;  3HOZ J;  2MW8 A;  4QSH A;  2EBI A;  2L7F P;  5IYB J;  3S1R J;  1MBH A;  2XPU A;  3IH4 A;  2XB0 X;  2JA6 J;  2L7M P;  2HXI A;  2ZB9 A;  5EGO A;  2Y0S N;  1GVD A;  3CDL A;  1WI3 A;  5E3M A;  1FJL A;  3S15 J;  3G1O A;  1BA5 A;  2GBY A;  5FLV A;  2DA2 A;  1HF0 A;  2LFB A;  3RQI A;  5IYD J;  3WHC A;  3TW7 A;  1VF9 A;  1PUF A;  1VI0 A;  1WCM J;  5E3L A;  3O8H A;  3OIO A;  2EQR A;  2DA6 A;  4M3D A;  3GTM J;  5IP7 J;  3BR0 A;  2VKV A;  3HOY J;  4D7N A;  2JA8 J;  3TED A;  3CQZ J;  3HOU J;  2LY9 A;  1HCR A;  2R93 J;  1U78 A;  2L0K A;  1RR7 A;  5EZH A;  1HDD C;  2R92 J;  2DMT A;  2AO9 A;  1XS9 A;  3H3V K;  1IDZ A;  2NVT J;  3RKQ A;  5J1Y A;  5C3E J;  4HNV A;  2M8G X;  4M3E A;  5JLX A;  3NAR A;  2L7Z A;  5K7H A;  1JKQ C;  4CYC A;  5M3F J;  2RAE A;  1ZQ3 P;  1EF4 A;  3BTJ A;  4C3J J;  4X1E A;  2DMN A;  2JN6 A;  3HOV J;  2X9D A;  2NVQ J;  1BL0 A;  1FEX A;  5EZG A;  1ETW A;  4X6A J;  1TWC J;  2MG4 A;  3B6C A;  2EZH A;  3A01 A;  1A5J A;  1JUM A;  1I3Q J;  1NK3 P;  2LTP A;  3FKI J;  3JRG A;  1K83 J;  5F04 A;  2YS9 A;  1WGX A;  2XPV A;  2N8G A;  4ABZ A;  2HDD A;  3S1N J;  1JTX A;  2DTZ A;  1MH4 A;  2HI3 A;  2R5Y B;  1ETK A;  1JUP A;  2JJ7 A;  3OSG A;  3C2B A;  4QIW N;  2Y31 A;  5FKO A;  3E7L A;  1AKH A;  2HOT A;  3D1N I;  3I4M J;  2VPR A;  2JK3 A;  1IG7 A;  4B1R A;  1IJW C;  4A3L J;  4D5F A;  4A3D J;  3ZQG A;  2WV1 A;  4B4C A;  1SFO J;  1JKO C;  4RDU A;  4W97 A;  1ETY A;  1P7I A;  2OPT A;  1QVT A;  4JX4 A;  1JJ8 C;  1AHD P;  3GTQ J;  2E2I J;  1JUS A;  4A3M J;  3DEW A;  1YRN B;  2Y30 A;  4A3J J;  3HDD A;  4AC0 A;  1HDP A;  4A3F J;  3LOC A;  3FIS A;  5GPC A;  1IGN A;  3TW6 A;  3GTP J;  5EGO B;  1LE8 A;  1NTC A;  1MBG A;  2H1K A;  5F0F A;  1YRN A;  2CQQ A;  3HB9 A;  3QPL A;  3BG3 A;  1RES A;  4M3B A;  3JRE A;  1A6I A;  2D5V A;  3VPR A;  1ZTR A;  1BW5 A;  3HM5 A;  2XSD C;  4G12 A;  3MN2 A;  1RPW A;  1PUF B;  1AKH B;  4V2G A;  5J1R A;  1GDT A;  5IYC J;  2M2E A;  3JRF A;  3GTO J;  4FE4 A;  5K7Z A;  3FIW A;  4J19 A;  4AUX A;  2XPW A;  3SJM A;  2COB A;  3WHB A;  2TCT A;  3B6A A;  3S1M J;  1B72 A;  3BR6 A;  1Z77 A;  3HOX J;  3JRB A;  3BR2 A;  2ID6 A;  4XIC A;  2R5Z B;  2CU7 A;  2MSY A;  4FE7 A;  2K9S A;  3S17 J;  2L9R A;  1K61 A;  3K2A A;  2NS8 A;  1OCT C;  2K40 A;  4JX6 A;  1QVU A;  1GV5 A;  2VI6 A;  2NVX J;  2HOS A;  2IEK A;  2E19 A;  3Q0V A;  4RBO A;  2R7Z J;  2H8R A;  2TRT A;  2Y9Y A;  4IHY A;  3ZOB A;  5JLW A;  2ME0 A;  2LK2 A;  1RKW A;  4A93 J;  1T33 A;  4IHV A;  2VKE A;  3OSF A;  1MBK A;  2CRG A;  4D5C A;  5C4J J;  5J1U A;  1X2M A;  1H88 C;  1Q1V A;  2M34 A;  4MIM A;  9ANT A;  4JX5 A;  1IV6 A;  1TWF J;  1ZK8 A;  2JA5 J;  3PO3 J;  4BXX J;  3LNQ A;  1H8A C;  2I10 A;  1ETX A;  1U8B A;  2JWT A;  1LE8 B;  3BT9 A;  2FJ1 A;  1WPK A;  2EZK A;  2YUS A;  5C4X J;  5F0C A;  3LSG A;  4M6V A;  2W48 A;  1ETO A;  2DA1 A;  3BG5 A;  3ZQI A;  4FTH A;  3BTL A;  4MFE A;  2NOG A;  1OJL A;  2K9Q A;  3M4O J;  2EZL A;  2Y2Z A;  2M0C A;  2IBD A;  4IHW A;  4QTR A;  1POG A;  2DA4 A;  4BBR J;  5EEA A;  3Q0W A;  4C2M J;  5EG0 A;  3S2D J;  3G1L A;  4DYC A;  2E2J J;  4DW6 A;  4XRS G;  3CCY A;  4AYB N;  3PM1 A;  4XRS A;  2XGC A;  3O8G A;  5F0H A;  1ZGW A;  1NK2 P;  1TWH J;  1W0T A;  3LSJ A;  2VUM J;  4DYR A;  4DZP A;  1BJZ A;  1X58 A;  3JR9 A;  2R5Z A;  1MSF C;  3GTJ J;  2P81 A;  5E3O A;  1FTT A;  1BW6 A;  2WAQ N;  4A3B J; 
#chains in the Genus database with same CATH topology
 2VBX A;  2LP0 A;  4ZYH A;  4M6X A;  4UUS A;  1OCP A;  4PDK A;  4MO7 A;  1VQ9 I;  4JBA A;  2UXX A;  5FKK A;  3CCJ I;  2ZC2 A;  1X2N A;  5EDN A;  3CJQ B;  2E60 A;  2QBY A;  1YE9 A;  2LY2 A;  3ZQC A;  1N78 A;  2FNA A;  1IN7 A;  2X51 A;  3FXO A;  4I0A A;  4XID A;  4LIU A;  3WU2 C;  2CV1 A;  3S16 J;  2EH3 A;  3I56 I;  1V3F A;  3L2U A;  2WAF A;  2GA1 A;  4B44 A;  3SEQ A;  1Z3Y A;  2CJJ A;  2XRN A;  3OL3 A;  3OOP A;  3S1Q J;  3LQQ A;  2QM3 A;  3BR1 A;  4R8H A;  2ELK A;  3HBL A;  4DBQ A;  5LRS A;  4B43 A;  4MEY F;  1VQL I;  3CCE I;  1Y1W J;  2DMQ A;  4U0V A;  3DBL B;  3RPU D;  3V7S A;  2DMU A;  4U0Y A;  1I27 A;  4Q4Z F;  2R7T A;  2DOA A;  5D6E A;  1ZLJ A;  1CGP A;  2WB1 A;  2XGD A;  5IT3 A;  4AM3 A;  5J3L A;  1VZ0 A;  2QYO A;  4JYK A;  4YII A;  2DOE A;  4ITV A;  2WWY A;  2VQC A;  4M3F A;  4PJL A;  3EET A;  1T8I A;  1RC9 A;  3FXL A;  4IEJ A;  3JSP A;  1IXC A;  4M9S A;  1F43 A;  1SFX A;  1WJE A;  3ERE D;  1W4M A;  1UHS A;  2VIX A;  1DGR M;  5ICF A;  2ECC A;  2O5R A;  3O2P E;  2OZ6 A;  1TWA J;  4MFD A;  1H9G A;  4G7O F;  4XLC A;  4O5V A;  1MBE A;  2EB7 A;  3K4J A;  2H1L A;  4P1W A;  1R1V A;  4UUT A;  5HLI A;  3TO6 A;  4BHB A;  3ZXS A;  3J80 K;  1XN7 A;  2IP2 A;  3WTS C;  1VFC A;  4Y52 J;  1R1T A;  4XBF A;  2HQR A;  4XKW A;  3RZO J;  5HVQ C;  1GUU A;  3K7A J;  2XSJ C;  2VN2 A;  1Z67 A;  2R7D A;  4NUB A;  3OS2 A;  2QSG X;  2Z3Y A;  1ZR2 A;  4KIS A;  4G94 A;  3RYR A;  3ECH A;  4V2F A;  2IS6 A;  2CUE A;  3BG6 A;  5HDN A;  3J81 Z;  3ZQF A;  1BM9 A;  4IXA A;  2CW0 F;  4P96 A;  1RKT A;  4L5I A;  3EQL F;  3L00 A;  2XRO A;  3GTK J;  2Q2E A;  1JT0 A;  2IJL A;  4I0B A;  2V26 A;  2DFE A;  2BXY A;  3VOD A;  4XK4 A;  4BYY A;  2PMZ N;  5LEJ A;  3JRI A;  3R6S A;  2HZD A;  2NS7 A;  1FPQ A;  2EJR A;  3M07 A;  1MBJ A;  2L9S A;  1WSU A;  2IAI A;  1MBF A;  1LKX A;  4BL0 B;  3H0D A;  2GIZ A;  3DCF A;  3U1D A;  4IO9 F;  1FSH A;  3I5U A;  4BKX A;  1PDN C;  2L9V A;  2UXN A;  2YU9 J;  2ID3 A;  1DP7 P;  2OU2 A;  5LLQ A;  5DEQ A;  5KHD A;  2VON A;  1I6H J;  1FTZ A;  5CVJ A;  4BY7 J;  1JKR C;  2F5C A;  2ZNZ A;  1OYI A;  3K0L A;  4V19 K;  1W7P D;  4MHG A;  3IAM 2;  4NC6 A;  3JRC A;  4M6Y A;  4PFP A;  2ZJQ F;  4BDY A;  2P5V A;  4BE2 A;  2DA5 A;  1TW2 A;  4A3I J;  2PG4 A;  1IC8 A;  3Q3S A;  2E2H J;  3DKY A;  2MA3 A;  1QZY A;  4N9I A;  2JA7 J;  1B4A A;  1QZE A;  2L01 A;  1XDS A;  3I4P A;  4W1U A;  5D8K B;  3AL0 C;  2HXO A;  1KQ8 A;  1BIA A;  1A6Q A;  3DEU A;  3F0C A;  3GCM A;  4B8X A;  2STW A;  4HBL A;  3ZQH A;  1JXS A;  1FP2 A;  2BY0 A;  1WKM A;  1B8I B;  2O7O A;  4UV9 A;  4GRI A;  1G2H A;  4WXH A;  3S3M A;  1PJR A;  5FRM A;  4OAY A;  1LFP A;  1DQU A;  3CES A;  3DV8 A;  3JTG A;  1FMV A;  3FBN B;  3DU5 A;  3WTX C;  3VSL A;  3LA7 A;  2O6G E;  3CDI A;  2IGN A;  4Y7N J;  4PCQ A;  2A05 A;  3IV5 A;  1FWZ A;  2MH2 A;  2V9P A;  4IF4 A;  5E3N A;  4A3G J;  1PVE A;  3N4M A;  1VQK I;  4F3Q A;  2E71 A;  4YFN F;  2MYS A;  1FIP A;  3SDB A;  3PJR A;  4HAM A;  4D0P A;  4A3K J;  4IHX A;  1MNM C;  3Q0U A;  2GM4 A;  3ONQ A;  1EH8 A;  2MW8 A;  2OTL I;  4XLH A;  4E7K A;  3M1E A;  2OCE A;  2Q1Z B;  3S1R J;  2MLG A;  2XB0 X;  4XM3 A;  2KIS A;  4AU7 A;  3HTS B;  1S7O A;  1N75 A;  2EPF A;  4HZF A;  5DD4 A;  2P6S A;  3DLL F;  1FJL A;  1FYL A;  5DUK A;  1WJA A;  2P7C B;  1TQP A;  2HPI A;  4ZZL A;  1HF0 A;  1HST A;  5IYD J;  2QLZ A;  4U7B A;  3TQN A;  1XDU A;  1FZP B;  2QZ8 A;  1G3T A;  4IKF A;  3ABU A;  2YPR A;  5ILV A;  4ZYD A;  3IC7 A;  2EFP A;  4UV8 A;  1QO0 D;  1FOK A;  3OIO A;  5JVT A;  6PAX A;  2ETH A;  1HSJ A;  1BR2 A;  3GTM J;  2K02 A;  1BOB A;  5LGT A;  3L2V A;  2KFD A;  1QZZ A;  3CQZ J;  1MJB A;  5K5R A;  3RDI A;  5K5Q A;  2BW3 B;  3KZZ A;  1VQ6 I;  2L0K A;  5EZH A;  1HDD C;  3COA C;  1XS9 A;  4PGH A;  3T8R A;  2NVT J;  3GME A;  2A3S A;  2EA2 A;  1QPM A;  2L9N A;  1WVR A;  1VQN I;  4ZH4 F;  3NAR A;  3LWF A;  1G3Y A;  2KL4 A;  2MBF A;  2KIU A;  2W25 A;  5M3F J;  4WX9 A;  4CDG A;  5HOO A;  3JTH A;  1MMD A;  3OYD A;  2PJR A;  2FF4 A;  4AD9 A;  2QSH X;  5J47 A;  4AID A;  4BQA A;  1FC3 A;  4P55 A;  4IL6 C;  1BL0 A;  3BWG A;  1FEX A;  2XV4 S;  1G8X A;  1WJB A;  2VJ4 A;  2VAS A;  3A01 A;  1JUM A;  4RA2 A;  3CCV I;  2LTP A;  4NBQ A;  2PJR B;  1ERD A;  1K83 J;  1B9M A;  5ED4 A;  5F04 A;  4I02 A;  2P4W A;  1HC8 A;  2HDD A;  4ABZ A;  3G73 A;  3CCU I;  1MND A;  1XMK A;  5KK1 A;  4P9U A;  2DOF A;  1Z3X A;  1FOY A;  3E7L A;  3H9Q A;  5J40 A;  1OCC H;  2CUJ A;  2LC2 A;  4HX8 A;  3ULQ B;  3GX4 X;  4PUS A;  2DT6 A;  5E1W A;  4Y13 A;  1YW7 A;  3OYA A;  4HF1 A;  3F8N A;  1ZAO A;  3PQK A;  3R4K A;  4NC8 A;  3HOT A;  4BEH B;  1BI1 A;  1O3Q A;  2ZKZ A;  1OQY A;  1P7I A;  2OUM A;  2DBB A;  3ABL H;  3EYY A;  1QVT A;  3T8T A;  2UZK A;  2R7X A;  5EEG A;  3MZ8 A;  3OYK A;  1DDN A;  2Y30 A;  1X1P A;  1JHH A;  2H27 A;  5DYM A;  1E0E A;  1U8R A;  2OC6 A;  2V6E A;  3NWS A;  3ZQ7 A;  1WJC A;  4E7H A;  5KAI C;  1LE8 A;  3ZGK A;  1AOY A;  1TZL A;  5EEH A;  4CUG A;  1MBG A;  2H1K A;  4YIF A;  2VLA A;  4A6E A;  2YSR A;  2CQQ A;  4AVP A;  1EH7 A;  3PSF A;  2PI0 A;  2L2O A;  1Q1H A;  1V54 H;  2DFI A;  5H20 A;  3VPR A;  2ZXJ A;  3DU6 A;  3HM5 A;  2F5F A;  4G12 A;  2ESN A;  3VDX A;  3V42 A;  4EVI A;  3QPT A;  1XCB A;  1PUF B;  4Y15 A;  5IYC J;  3JRF A;  3FXM A;  2FBK A;  2Y0S A;  4J19 A;  3DFG A;  1V5F A;  4AUX A;  4RB3 C;  5CKT A;  3ZMS A;  2ICW G;  2NRA C;  4CCO A;  1BR1 A;  3GZ5 A;  1B72 A;  1J5Y A;  5LHG A;  1PP7 U;  3KCC A;  1IN6 A;  3BY6 A;  2CU7 A;  4RMN A;  1IF1 A;  1KYZ A;  1IN5 A;  3KYD B;  3K2A A;  2Z33 A;  1OCT C;  4ANJ A;  1IN4 A;  5FLX K;  1GV5 A;  2EIN H;  1VQ4 I;  2HOS A;  2IEK A;  2E19 A;  2G7U A;  3Q0V A;  4RBO A;  3ISP A;  2KRF A;  3K2Z A;  2R7Z J;  1HKQ A;  3M1C A;  2H8R A;  4E70 A;  1SD6 A;  2A6T A;  5JLW A;  1KU7 A;  2ME0 A;  1WFX A;  3HSF A;  4A93 J;  1R36 A;  2EIL H;  2VKE A;  4FHT A;  2O8X A;  1YG2 A;  2XKO A;  3OYL A;  4D5C A;  2VOP A;  5J1U A;  1X2M A;  1R6R A;  3VYU B;  2GXA A;  3FXK A;  2YX4 A;  5DM6 F;  3L09 A;  5A2Q Z;  5BOX A;  4RM2 A;  1HW5 A;  3S32 A;  1TWF J;  1ZK8 A;  5FFX A;  2DI3 A;  2E34 A;  3PO3 J;  2DDA A;  3WGG A;  4XQF A;  4H4K C;  4YEJ A;  2I10 A;  1MNE A;  1ETX A;  3BT9 A;  3ZR8 X;  1F1Z A;  1CF7 B;  2EZK A;  4LMY A;  2P5K A;  2YUS A;  3RKW A;  5C4X J;  5E1X A;  3HRM A;  4RB0 A;  4UB6 C;  2JA2 A;  2I8D A;  3CC7 I;  3ZQI A;  4FTH A;  4HPQ A;  1ZGJ A;  3W6K B;  3TO7 A;  3BTL A;  4MFE A;  4ESJ A;  2NOG A;  3GFJ A;  2Y2Z A;  2JSP A;  4XKC A;  2VJJ A;  3ZP5 A;  1SVL A;  1K78 A;  2HZT A;  3ASO H;  5EG0 A;  4K2E A;  2E2J J;  3CUQ A;  3D5S C;  1DP3 A;  4EJV A;  1IV8 A;  5JHF A;  3PM1 A;  4U87 A;  2DOD A;  2K27 A;  1WJD A;  5F0H A;  1QHH D;  1XGO A;  3D5L A;  1W0T A;  2VUM J;  2KRH A;  5JI6 A;  2CGP A;  3NQO A;  3FZV A;  5FLX Z;  4RGS A;  2R5Z A;  4ENM A;  1MSF C;  4XL9 A;  2RQQ A;  3GTJ J;  2P81 A;  1PYV A;  5E3O A;  2WAQ N;  2VT2 A;  4LD5 A;  2YX7 A;  3GTG J;  5FB2 A;  5GP9 A;  2C6Y A;  4IX7 A;  1ZKG A;  3IH3 A;  4A3C J;  3E5X A;  3OYJ A;  3HKZ A;  4C3H J;  3S2H J;  4I01 A;  2V9K A;  1T0F A;  1VTN C;  1E3O C;  2AS5 F;  2L5Q A;  1X1B A;  3ELK A;  1TP4 A;  3BCB A;  3LSR A;  4MNU A;  1YS7 A;  3Q5F A;  1J9I A;  2NVY J;  2KDO A;  5M5Y J;  4UUS B;  5LEK A;  1LVA A;  3FK6 A;  2X48 A;  1U9O A;  3CZ6 A;  3CMA I;  3T0Y A;  4OU0 A;  2O9L A;  1Z6T A;  2F5V A;  1QNT A;  4AYB A;  2PX9 A;  1JJ6 C;  1J75 A;  1S6L A;  4HX7 A;  1WI9 A;  2E5N A;  4MEX F;  3DKW A;  1EV7 A;  4MTD A;  4BDZ A;  4NHJ A;  1TWG J;  2CQK A;  3VYR B;  1H89 C;  3KE2 A;  2XHK A;  1N25 A;  5E17 F;  3GW2 A;  2HEO A;  2OD5 A;  4KDP A;  2PMZ A;  4CCM A;  4ZDP A;  4HLY A;  1W36 C;  1ZRE A;  3IAS 2;  3U1K A;  2EIM H;  2BHY A;  3SEZ A;  3HOW J;  4L0Z B;  2BXZ A;  5D5W B;  3PNV A;  1ZR4 A;  3CJT B;  4ZC3 A;  2CUZ A;  2M5W A;  3QAH A;  2R7R A;  4LB5 A;  2WAD A;  3LAJ A;  1VQP I;  1I50 J;  2WY8 Q;  1V5G A;  2CMP A;  2BVL A;  2V6C A;  4RLQ A;  1X19 A;  2JTV A;  3JRH A;  3A2K A;  3BRO A;  4MQV A;  3EPZ A;  2D1H A;  3KP7 A;  5HS7 A;  4A5N A;  2BGC A;  1DU6 A;  3SXY A;  4ZJZ A;  2E1O A;  2Y9Z A;  5TJJ A;  4PSX A;  1IAW A;  4Q48 A;  2LY1 A;  2X6O A;  2HGC A;  1L3L A;  3FXQ A;  5F1R A;  2HQN A;  2XB5 A;  4II3 A;  4KIG A;  5GAH J;  4U0W A;  4M73 A;  2HNH A;  5IP6 A;  2QEX I;  1O3T A;  2QCO A;  2PQ8 A;  3TGN A;  3IL2 A;  3HEF A;  2OCC H;  1XG1 A;  3GTL J;  3QP6 A;  4DIQ A;  3FHN A;  3OYE A;  4UVB A;  3I55 I;  1XGS A;  3BR3 A;  2Y48 A;  2PEX A;  4I98 B;  2RQP A;  3OY9 A;  1SAN A;  2KJC A;  4LK1 F;  2DTR A;  2I5U A;  2FD5 A;  4EM0 B;  3F6V A;  2NVU B;  5F27 A;  1YOV B;  3S14 J;  3I4N J;  1OR7 A;  4CZZ A;  2MAB A;  4DNC A;  2O0Y A;  2XKP A;  1B59 A;  1TC3 C;  4EAT A;  3KP2 A;  2LKX A;  1AA7 A;  3G1M A;  2LD5 A;  3RJP A;  2IS4 A;  1Z9C A;  1H9T A;  4B3A A;  4OIN F;  1XSD A;  1YHQ I;  3ZMD A;  3NEU A;  3W6J B;  5E8G A;  3QWL A;  5E20 A;  3I59 A;  2AXT C;  1LQ1 A;  3U21 A;  1NH3 A;  3S3N A;  5FKL A;  1R5G A;  2L02 A;  1X1C A;  1X1A A;  2JSC A;  1P7J A;  3QOP A;  4RAG A;  4Z6Y A;  5FD6 A;  1D5Y A;  1NG6 A;  1MIJ A;  2W00 A;  3GLX A;  2X4H A;  1RET A;  1D1B A;  3KP3 A;  2FX0 A;  2XF7 A;  4BJT A;  4I76 A;  5LRR A;  5EF6 A;  5EG0 B;  5FJ8 J;  2B63 J;  1LEB A;  4L9V A;  5IPA A;  2IS1 A;  1I5Z A;  1UG2 A;  3HRS A;  3I59 B;  4F91 B;  3CME I;  2FML A;  3V7R A;  1BBY A;  1E3P A;  2HYJ A;  2P7V B;  5CVR A;  4RLF A;  2HWV A;  3R0A A;  4KN4 X;  2IS2 A;  4BE1 A;  2KLO A;  4HQE A;  4BQQ A;  4DOZ A;  1X3Z B;  1D3Y A;  1BOA A;  1ZRD A;  2DQR A;  2HR3 A;  2YR2 A;  1U9N A;  2IA0 A;  3VFZ A;  4FX0 A;  5GAE J;  2HU9 A;  5M5W J;  1HBX G;  3RZD J;  1VND A;  4A5M A;  4A69 C;  4XN3 A;  3CJN A;  4PK4 A;  2Q8K A;  4UVC A;  3SHF A;  3ZQL A;  1FIA A;  4CYC B;  4JP0 A;  1HW2 A;  3AFH A;  3RSN A;  5BNG A;  2KKO A;  5FRN A;  2FU4 A;  3QYE A;  3GZN B;  5HS9 A;  3R60 A;  3K4M A;  2LR8 A;  4EEF G;  1FT9 A;  4GCV A;  4AIK A;  5ILS A;  1J2X A;  2XF5 A;  1YJW I;  1BC8 C;  3SZG A;  1Y56 A;  1TT0 A;  2GZW A;  3D0S A;  2JRM A;  1BJA A;  2XIG A;  2XPU A;  3IH4 A;  2LF8 A;  3KZI C;  5ICC A;  2L7M P;  2HXI A;  3ZRG A;  2VJ5 A;  2NYX A;  3RPU A;  2FUG 2;  1UAA A;  1XTA A;  1WI3 A;  1IUY A;  2VBZ A;  4ZTF A;  1LB2 A;  1BA5 A;  1J59 A;  1ZN2 A;  2LKP A;  5FLV A;  1B6A A;  5DM7 F;  1XX5 A;  2EFW A;  3RQI A;  4CHU A;  2JQ7 A;  4N0B A;  1U2W A;  5CVU A;  5TRD A;  4XON A;  4XMY A;  2YU3 A;  1VF9 A;  3F9K A;  2LBF A;  3FXR A;  5B66 C;  2E1M C;  4P5O A;  1K6O A;  2WA0 A;  2WBM A;  4HST A;  1YO5 C;  3C3W A;  3M9A A;  4BNC A;  2CQ7 A;  1TLH B;  3OYH A;  2DA6 A;  2PMU A;  3ZN0 A;  1O3R A;  4EJU A;  2RNJ A;  3MZH A;  4OIP F;  2DYS H;  4BQO A;  5IP7 J;  3BR0 A;  2VKV A;  3HOY J;  2V79 A;  3H3Z A;  1ZLK A;  4LK0 F;  2VB6 A;  4RAF A;  5F64 A;  1WHU A;  1RR7 A;  3P5J A;  4UXN A;  2R92 J;  2DMT A;  1DUX C;  2ELH A;  4M74 A;  2CSO A;  3RKQ A;  4L18 B;  1EA3 A;  3HTU A;  5J1Y A;  5C3E J;  3J80 Z;  3S2W A;  2K85 A;  4IRG A;  2BBY A;  1T98 A;  2XF6 A;  4HNV A;  2M8G X;  4M3E A;  1W5T A;  5JLX A;  4C30 A;  3D5R C;  3WG7 H;  4BH9 A;  1JKQ C;  4CYC A;  1ZQ3 P;  1HXD A;  1U0J A;  2X1D A;  3CCM I;  3BJA A;  2V1N A;  2AQE A;  2W57 A;  4BHP A;  1UB9 A;  1LDD A;  1UFM A;  4XSZ F;  5EZG A;  1ETW A;  3KPH A;  4X6A J;  1TWC J;  3J81 K;  5L3C A;  1USS A;  3FKJ A;  5LBQ A;  2EFO A;  2KZV A;  1OYY A;  1LDK B;  2A61 A;  2FBI A;  3Q9S A;  5D5U B;  1NHA A;  2IA2 A;  4Y3O A;  1WGX A;  3DTK A;  2PMH A;  1ZRF A;  4ENN A;  2ZBK A;  2VXZ A;  1JUP A;  3OSG A;  5CLS A;  2DK8 A;  1WRJ A;  2EA4 A;  2K9M A;  3C2B A;  4QIW N;  1P4W A;  1AKH A;  2HOT A;  3D1N I;  3RQ4 A;  3FBI B;  1SD7 A;  1UJ8 A;  2H6B A;  2JUG A;  2MC3 A;  3FWE A;  4B3X A;  1BI2 A;  2KIM A;  2HDW A;  3WGI A;  2RC4 A;  2K9L A;  2WV1 A;  2CFX A;  2ZFU A;  4BAC A;  3V4G A;  1SFO J;  3KEY A;  4W97 A;  1FYM A;  2GIV A;  4XLA A;  1ETY A;  3HZJ A;  1E3H A;  2V9V A;  4Y33 A;  3HYI A;  2JZY A;  2CV2 A;  4A3M J;  3GTQ J;  4U88 A;  1YRN B;  3OYI A;  3L2C A;  2PLY A;  4KT6 A;  3HDD A;  3F8B A;  2QUF A;  1HDP A;  2VQH A;  1I3A A;  3FIS A;  3BG7 A;  3BC8 A;  3TW6 A;  1RI7 A;  1KA8 A;  4MTE A;  3GTP J;  3F21 A;  1YIJ I;  2UV1 A;  4RGU A;  3EDP A;  2PJP A;  3MEX A;  5BS6 A;  4HDV A;  4GDF A;  4QWQ A;  5F0F A;  1MD0 A;  1BN5 A;  4E7S A;  4I09 A;  3K1P A;  1R71 A;  3HB9 A;  3AKZ A;  3LSH A;  5JR3 A;  1XGM A;  1SMY F;  1RES A;  3H5N A;  3WU1 B;  1BC7 C;  3QPH A;  3JRE A;  1A6I A;  4QPQ A;  1SMT A;  3R61 A;  3G6E I;  1ZTR A;  1BW5 A;  1RPW A;  3MN2 A;  3MQ0 A;  3LSK A;  3TL4 X;  4BS9 A;  1I6X A;  2QWW A;  4V2G A;  5DCF A;  1GDT A;  4WCG A;  5K7Z A;  1ODD A;  2F4O B;  1S9H A;  4N4N B;  3EUH C;  2COB A;  3WHB A;  3OMY A;  3S1M J;  2VOO A;  4E7Z A;  4CCK A;  3I3L A;  1Z77 A;  1LPQ A;  5B5E C;  3HOX J;  3BR2 A;  2H94 A;  2MC4 A;  4CXF A;  3TBI A;  3WTY C;  2F6C A;  2R5Z B;  1M1E B;  1U3E M;  4X0G A;  2W82 A;  4WWC A;  2K9S A;  4JOM A;  1T2K A;  3S17 J;  1K61 A;  3H5A A;  2DAO A;  2MD0 A;  3VEP A;  1BR4 A;  1KU2 A;  1QVU A;  4JX6 A;  2NVX J;  2XAJ A;  5KAF C;  2DYR H;  2A5W A;  5LFA A;  2M3A A;  2EIJ H;  2TRT A;  2NOJ B;  3ZOB A;  4ASN A;  1LVK A;  2LK2 A;  4CCJ A;  1RKW A;  1HQC A;  5DUI A;  4MGR A;  2QA4 I;  4CCN A;  3QRF F;  1MBK A;  2CRG A;  2EV5 A;  2R7V A;  3Q9V A;  1H88 C;  2M34 A;  4MIM A;  4J00 A;  4CGZ A;  3GO5 A;  4JX5 A;  2HYF A;  3IRR A;  3LA3 A;  5DDG A;  5LHH A;  3CO6 C;  2AXL A;  2Y69 H;  2STT A;  2JA5 J;  1X1D A;  1T0F C;  4HEA 2;  4RM3 A;  4KIT B;  2KIF A;  5ICE A;  1DPU A;  1J7K A;  2FJ1 A;  3FXJ A;  3FF5 A;  3PFI A;  1KZH A;  2R7W A;  1YI2 I;  3LSG A;  3CDH A;  4LG3 A;  1FY7 A;  3QYB A;  2OA4 A;  2W48 A;  1RNL A;  2DA1 A;  2DT5 A;  3B02 A;  3BG5 A;  2B0L A;  4XLP F;  1YQA A;  2CQN A;  3RKX A;  1JGS A;  1SC7 A;  3H92 A;  4PSW A;  3BCA A;  2FBH A;  2V1X A;  1OJL A;  1IN8 A;  2K9Q A;  2EZL A;  2QEN A;  3GEZ A;  3LSI A;  1Z7U A;  2IBD A;  4IZZ A;  1K4T A;  4C2M J;  3QOD A;  4A0X A;  2K7L A;  4LJZ F;  3UR3 C;  4DYC A;  3HG9 A;  1OPC A;  1XSX A;  1MJA A;  3ASN H;  1TQM A;  2R7F A;  2XAQ A;  3WE3 A;  3CCY A;  3GF2 A;  4AYB N;  5H6R A;  3O8G A;  2Q0O A;  4CCL A;  1NK2 P;  1K7A A;  3LSJ A;  5HDK A;  5ILU A;  4DYR A;  4HW0 A;  2HKX A;  3JR9 A;  3EUK L;  5DCM A;  2IT0 A;  4PJ0 C;  3OYB A;  2VBW A;  1R5H A;  3CP8 A;  2JPC A;  3GUD A;  4A3B J;  4WF2 A;  3ZQQ A;  2G7H A;  2HPM A;  4B09 A;  2IRF G;  4N4O B;  4ENJ A;  1IRG A;  3BZC A;  3FMQ A;  2L4A A;  2CQX A;  1J09 A;  4GFB A;  2HQ5 A;  2DJN A;  2ZME A;  1QGP A;  4C3I J;  3G3Z A;  1Z1D A;  4H0E A;  3CCR I;  1EJ9 A;  3W6V A;  2DLL A;  3HHH A;  3PUF A;  5JFR A;  1LJ9 A;  3GXO A;  4GGG A;  2W7N A;  4L5E A;  1AU7 A;  4U7D A;  3WE2 A;  4MQ9 F;  3BTC A;  3CJR B;  2E7X A;  2ISY A;  1QRY A;  5FKM A;  3M8E A;  1EH6 A;  1HOM A;  2X6Y A;  2Z99 A;  4FCY A;  2LSO A;  3H0G J;  4F93 B;  3HL2 A;  1IDY A;  1MMG A;  1IUF A;  1Y1V J;  4HV5 A;  2LLK A;  3P9K A;  1YJ9 I;  1B8I A;  1HW1 A;  3HPH A;  2DA7 A;  4HSR A;  4OWR B;  1GV2 A;  3W2A A;  2E1C A;  1O7F A;  4PGG A;  4B48 A;  5DCM B;  1K79 A;  3MAJ A;  4MLO A;  5D5X B;  4OMZ A;  3ZCO A;  3GBG A;  3CMY A;  5K7F A;  3HGY A;  3DPL C;  1B72 B;  1IRF A;  4KMU X;  4ZYE A;  1LFU P;  2M7A A;  5J6X A;  3K69 A;  5DS9 A;  2EV6 A;  1YW9 A;  3K70 D;  3WTT C;  4FET A;  2QQA A;  3O6B B;  5LHI A;  3HGG A;  3IP4 B;  1OCR H;  3CC2 I;  1ZHF A;  1R58 A;  3OR1 C;  4PJJ A;  1I1S A;  4M72 A;  5HLT A;  2VL8 A;  3BJO A;  3KEQ A;  2QVO A;  3CO7 C;  3KIO A;  4EGZ A;  5KVR A;  3B73 A;  3QPS A;  5FKN A;  2GOM A;  3EUH A;  3BPV A;  2CYY A;  4CA0 A;  4UNO A;  1TL8 A;  1JE8 A;  4RAZ A;  4IHT A;  5TIS C;  3HKZ N;  2IGK A;  3IH2 A;  1R9T J;  4UHT A;  2XGE A;  1GVJ A;  4HNT A;  1Z21 A;  3SFI A;  1F4K A;  2EV0 A;  1SFU A;  3FXU A;  4BY1 J;  1S7E A;  3C2G A;  5L3F A;  2NS0 A;  5B3S H;  4D1Q A;  3MKY B;  3KET A;  3BQY A;  3ERM A;  3CP2 A;  3J7A O;  3QQA A;  1OR7 C;  1MSE C;  1XMX A;  2OBP A;  3OYN A;  1WJF A;  2KPM A;  2ZME C;  2EZI A;  3MVP A;  3S93 A;  3ZMV A;  4HF2 A;  2LVS A;  3JRA A;  2FQ4 A;  4XSX F;  4EV0 A;  1NG7 A;  2JT1 A;  3L2Q A;  4L0Y B;  3V7C A;  5F1J A;  2KDZ A;  2K9N A;  2VOD A;  2RKH A;  2RN7 A;  5GAG J;  1QPI A;  2COM A;  2DPU A;  3PO2 J;  2X6X A;  1WH7 A;  1ENH A;  3MKL A;  3F8M A;  4AVZ A;  4ZDO A;  1R7J A;  1X3U A;  3TP0 A;  1R49 A;  3JAM K;  2L4M A;  2H09 A;  3WGH A;  2LOO A;  1R5I D;  3JAM Z;  5BMZ A;  4R79 A;  3KYL A;  3F6O A;  2HTS A;  2R7Q A;  5FRO A;  3J7Y J;  4FX4 A;  1MJ9 A;  2LH9 A;  2AHQ A;  4IPA A;  4HA8 A;  4PJN A;  1MH3 A;  3R0J A;  1XCV A;  3W2V A;  2MGQ A;  3K4K A;  1YX3 A;  3L2R A;  1TNS A;  3T5X A;  1R4M B;  4RAY A;  4IOC F;  2HKO A;  3H9J A;  3H1C A;  1IZ1 A;  3A01 B;  1FP1 D;  3H3U A;  3I64 A;  2ELJ A;  3DTI A;  5H6Q A;  2R7S A;  1S72 I;  1P6R A;  4EJW A;  5FO5 A;  2ME6 A;  4OIO F;  3LSP A;  5E79 C;  1S7A A;  4KIB A;  3NAU A;  2DN0 A;  3LMM A;  1XSV A;  3G4S I;  3QU3 A;  2GXB A;  1D8K A;  1YX5 A;  1JGG A;  2HFH A;  1PUE E;  4XKB A;  3DTE A;  5HOD A;  2WB1 N;  3E6C C;  3IWZ A;  1ZGA A;  1XGN A;  2ZJP F;  2ACJ A;  1VQ7 I;  3HXL A;  1B9N A;  2JRT A;  3OOU A;  5FLM J;  3BJ6 A;  5GPA A;  2EFQ A;  2FQ3 A;  3E5U A;  3P7N A;  3IRQ A;  4EGY A;  2G0E A;  1XC5 A;  2ZFW A;  4I7H A;  4O6J A;  1Z05 A;  2E35 A;  2IXS A;  3VYS B;  2KZG A;  3RCO A;  3JCU C;  3BG9 A;  2CWE A;  3N05 A;  2FEZ A;  5D4R A;  3HOZ J;  5J4Y A;  4QSH A;  2EBI A;  3PUB A;  1A31 A;  2M4G A;  3GVA A;  2MLK A;  3KEO A;  1XMA A;  3REO A;  3SZP A;  3HSE A;  2KQR A;  2ZB9 A;  2AQF A;  4F92 B;  2K5C A;  5CYV A;  2Y0S N;  3S8P A;  2BY2 A;  4HLX A;  2QQ8 A;  2ZJR F;  3S15 J;  3G1O A;  2GBY A;  4KA4 A;  4EJT A;  3DBR B;  2M45 A;  1ZH5 A;  3WHC A;  1L0O C;  1YW8 A;  3KLO A;  1TTY A;  4FQG A;  3K4N A;  1PUF A;  2OAZ A;  3KX2 A;  4HRI A;  3HOS A;  1VI0 A;  5E3L A;  2E1M B;  1KQ9 A;  3IUO A;  2L54 A;  2X85 A;  3ECO A;  3RTR A;  5CVI A;  4M3D A;  2EWN A;  1YYV A;  3CF2 A;  3TKY A;  3DQV C;  2VT3 A;  2JA8 J;  2LF7 A;  3TED A;  3OIQ A;  4ZYG A;  2LY9 A;  1U78 A;  1X3W B;  2VE9 A;  4Q47 A;  3LQR A;  3TOA A;  2KRC A;  5FFZ A;  2ESH A;  2VC0 A;  1P4X A;  4DQ2 A;  1HKT A;  3BP8 A;  1IDZ A;  4KJZ A;  1G6N A;  4LG0 A;  5F6F A;  1FOX A;  2A6H F;  3IHU A;  3P9C A;  3GFI A;  3N97 A;  1UST A;  2JUC A;  2JVG A;  2XGX A;  3AAF A;  4Y4R A;  3DLA A;  4PZJ A;  1G4D A;  4UVA A;  2WC2 A;  3BTJ A;  4PJM A;  3F72 A;  3A1Y A;  3DP7 A;  1Y8Q B;  1P92 A;  3K6G A;  4GYG A;  4G7H F;  3E6D A;  3HOV J;  2P6T A;  3OWT A;  2X9D A;  4G6D A;  2NVQ J;  1ZG5 A;  2HVS A;  2M87 A;  1Y39 A;  3EUA A;  2LDU A;  5CQG A;  3WTV C;  3B6C A;  2EZH A;  5FD5 A;  5HLG A;  1T95 A;  4I99 C;  1NK3 P;  2FXA A;  4HOB A;  3JRG A;  2GWR A;  1B1B A;  5BPI A;  4KFC A;  2XPV A;  2N8G A;  1FBQ A;  5BQT A;  3S1N J;  3MKW B;  4GYI A;  5HNH A;  3WTW C;  2JJ7 A;  2QKL B;  4LGW A;  4RGX A;  2Y31 A;  5FKO A;  4IRI A;  3BZ6 A;  3MMY B;  2O3F A;  3U9G A;  4CSW A;  3E97 A;  2HDC A;  4D5F A;  2X1E A;  1DPR A;  5L3B A;  4B4C A;  2XUB A;  4E4H A;  2OPT A;  2OV7 A;  3L7W A;  4JX4 A;  2CH0 A;  2WAE A;  1JJ8 C;  1AHD P;  2CV0 A;  1JUS A;  4HF0 A;  3DEW A;  1ONV A;  1TT5 B;  4KYW A;  3FM5 A;  4A3J J;  1KU9 A;  2CO5 A;  4AC0 A;  5K5O A;  3LOC A;  1IGN A;  4ZTJ A;  2JVH A;  2RV8 A;  4G6Q A;  4XLE A;  5EGO B;  4BE0 A;  2JPB A;  1NTC A;  4EJO A;  1W5C C;  2CS3 A;  1YRN A;  1T38 A;  2CG4 A;  2BHZ A;  1S3J A;  2MD5 A;  1C0W A;  3BG3 A;  1XB4 A;  4DBR A;  5H2F C;  2J5P A;  2LKS A;  4EM1 A;  1RRJ A;  2VQG A;  5CQE A;  1AKH B;  3GTO J;  2M2E A;  1OYW A;  3FIW A;  4WXD A;  3CLQ A;  4A0Z A;  4AIJ A;  2IW5 A;  4C2U A;  3BR6 A;  4BJ5 C;  4KMF A;  1BI3 A;  1YLF A;  2ID6 A;  2IGM A;  2FSW A;  2VQL A;  4UY8 I;  1S29 A;  1W5S A;  1ZG3 A;  4XRF A;  1WQ2 A;  4FE7 A;  2L9R A;  2NS8 A;  4F7Z A;  1YFH A;  3OIP A;  2R7U A;  1LEA A;  2VC1 A;  3ZN1 A;  3K10 A;  1ZYR F;  4BUP A;  4AWX B;  4ESF A;  4ETS A;  2DK5 A;  1D8J A;  2Y9Y A;  3M7G A;  1UHM A;  3QU6 A;  1Y0N A;  4F55 A;  2L3D A;  1QU3 A;  2M4K A;  1E2X A;  1T33 A;  2J5O A;  2RGV A;  4QPO A;  4IHV A;  2GA2 A;  3LST A;  3OSF A;  1F5T A;  3CF5 F;  2OTJ I;  4Z2Y A;  5C4J J;  1D0X A;  3K4C A;  3AG2 H;  4OOI A;  5J8F A;  2VJI A;  3TMO A;  5CJ9 A;  9ANT A;  4UUV A;  5ICG A;  1KON A;  2MFZ A;  5HDG A;  4TV7 A;  1XPX A;  1IV6 A;  1JHF A;  3PSI A;  2HQA A;  3VYT B;  3OYF A;  4BXX J;  5B1A H;  4G9Y A;  3ZMZ A;  3RKY A;  1U8B A;  2JWT A;  2G9W A;  5IY5 H;  5L3E A;  5AIQ A;  3KYC B;  3FMS A;  1K78 B;  5F0C A;  4M6V A;  3LA2 A;  1ETO A;  5AIP A;  3RPQ A;  4CH7 A;  4FT8 A;  3DXJ F;  4IQJ A;  1RUN A;  3LFU A;  1LDJ A;  1VQ5 I;  2ZNY A;  1OLT A;  2A69 F;  1G59 A;  2KHM A;  2D1V A;  1WJ5 A;  1W36 D;  3F8C A;  1POG A;  3WG9 A;  3H5R A;  4HG2 A;  1ULY A;  1T08 B;  3Q0W A;  4BJ6 C;  4PFO A;  2H8W A;  4DJA A;  5EJC A;  1U5T C;  1O7L A;  2ISZ A;  3S2D J;  3G1L A;  3PIP F;  3FHZ A;  3CMM A;  4UB8 C;  2XC7 A;  3QYF A;  2F5D A;  2CFO A;  3OYG A;  3ZMU A;  3MKZ A;  3OYC A;  1TNT A;  2UUZ A;  4EMS A;  3I9V 2;  4XRS A;  3IWF A;  2W84 A;  1YIT I;  4ESB A;  2XGC A;  3T1B A;  3OR2 C;  1SD4 A;  1H0M A;  1J0R A;  3CCS I;  3BPX A;  4DZP A;  3HPG A;  3CLO A;  2LMD A;  1I39 A;  4BAY A;  1DGW Y;  1MMN A;  2XAH A;  4YEL A;  2VKD A;  2H6C A;  2X6W A;  3DEE A;  3F3X A;  5L3D A;  3GWZ A;  2Z1D A;  3SYT A;  3DPT A;  2FOK A;  3OS0 A;  2D45 A;  2DT7 B;  5BPD A;  1K4S A;  4A12 A;  1D0Z A;  4RB2 C;  2FOW A;  2A07 F;  2FA5 A;  4CZC A;  3K4B A;  3HHG A;  2ZSH B;  4BBS J;  5JVG F;  1SFE A;  4BXF A;  3BTI A;  1S5L C;  1SVM A;  4JK1 X;  5JHU A;  3DWL E;  4BXU A;  1LFB A;  5B1B H;  4G8X A;  3RI4 A;  2BZT A;  3JRD A;  2DA3 A;  2E7W A;  1MKM A;  2GQQ A;  5D4S A;  3JSO A;  1TQI A;  2M8E A;  4I6Z A;  5IOZ A;  3BR5 A;  1W1W E;  2M7B A;  3CD6 I;  2D2W A;  2CUF A;  2XAU A;  5E8I A;  1KU3 A;  1V55 H;  5DV5 A;  4EM2 A;  2K4B A;  2K86 A;  2W85 A;  2XRL A;  3A03 A;  1FNN A;  1VQM I;  2M9H A;  1CQT A;  3C1D A;  3CTA A;  2HYG D;  3RIR A;  1GXQ A;  5J4V A;  2DQL A;  4XOT A;  1R22 A;  4M9X A;  2FMY A;  4YFK F;  4OAZ A;  1HA8 A;  3CUQ C;  1Z0X A;  2DU9 A;  3WU0 A;  4II2 A;  3DBH B;  4FAS D;  4HNU A;  2BEO A;  5EYR A;  2BW3 A;  3DKX A;  1FLI A;  2F48 A;  2GAU A;  2L7K A;  5HNF A;  1ITY A;  3OV8 A;  3SZT A;  1DU0 A;  1YTY A;  1BIB A;  1KQ0 A;  4XLF A;  1Z7L A;  4LFU A;  4DYQ A;  3MZY A;  1MMA A;  4YG2 F;  1MZB A;  2DDB A;  2KJB A;  1K6Y A;  3VWB A;  2DMP A;  2Y75 A;  3K70 C;  3M3Y J;  4LB6 B;  3E5Q A;  5C44 J;  2GLO A;  2RVC A;  4AIH A;  1D0Y A;  3AG1 H;  1STZ A;  1RUO A;  2PFB A;  4M3G A;  4J01 A;  1W0U A;  1T56 A;  1FBU A;  1AWC A;  3TO9 A;  4C9Y A;  1UMQ A;  2R7O A;  3W2W A;  2M0M A;  2ZO4 A;  5M5X J;  3DPU A;  1D5V A;  2HOE A;  2Z2S B;  2R0Q C;  5GAD J;  1SAU A;  4LIT A;  4XRM A;  4NDL A;  2JMW A;  2E1N A;  4KN7 X;  1MMS A;  3LL7 A;  3A02 A;  4D7M A;  3RYP A;  4CO8 A;  3FK7 A;  1IRZ A;  3E3V A;  2O8K A;  2QBY B;  3WTU C;  4OIQ F;  3AG4 H;  1F9N A;  4IJA A;  1ETV A;  3MFK A;  2RDP A;  3C2H A;  1QA6 A;  1X4O A;  2QF7 A;  2LRD A;  4A3E J;  1A04 A;  4DZJ A;  4NC7 A;  2LYC A;  2IGO A;  3I54 A;  3I53 A;  4LOC A;  2B7E A;  4O3M A;  3QOE A;  2R4G A;  2HVR A;  3DF8 A;  4KNY A;  1KYW A;  2DPD A;  2OJE D;  5ERI A;  3M8F A;  2W1O A;  4XOP A;  3PQJ A;  4FIS A;  2R5Y A;  1ZG1 A;  1APL C;  2TDX A;  5M3M J;  2QQ9 A;  3BQZ A;  4LIV A;  3NRV A;  1MDM B;  2KT0 A;  5FGM A;  1FSE A;  3SDG A;  1Z6R A;  2LBF B;  4L9T A;  4WXC A;  2W24 A;  1LUJ B;  2DO7 A;  2ECB A;  2K3P A;  4GO1 A;  5KCM A;  1MW7 A;  2LNB A;  5DTD A;  1HLV A;  1WH5 A;  1GT0 C;  1MGT A;  1F36 A;  2OF7 A;  2VBY A;  3KLN A;  1RIO H;  1O4X A;  3C18 A;  4L5J A;  4G6T B;  5D6F A;  5GTI C;  1JTY A;  1ETQ A;  5D8L B;  3BZK A;  2HOA A;  2LG4 A;  3LAP A;  1U5T A;  2ZXW H;  2PBI A;  3L1P A;  1YS6 A;  4RB1 A;  4I2O A;  2OQR A;  1ORK A;  1X4P A;  5F08 A;  5IOY A;  4S04 A;  3H36 A;  3HJE A;  2K3F A;  3A0B C;  2F4M B;  5IP9 J;  3E1S A;  4HDU A;  3TP3 A;  3HUG B;  1JT6 A;  1FOW A;  1Y0U A;  2NXN B;  4Y17 A;  3WTZ A;  3E6B A;  3UKG A;  2M1B A;  3FMR A;  5LGU A;  2Z5U A;  3FX3 A;  2BY1 A;  3LSM A;  2A68 F;  2RRE A;  4HV6 A;  2BYV E;  2K4J A;  4KIF A;  4XLN F;  2WTE A;  1JKP C;  2DCE A;  3K4L A;  1OFC X;  1ON2 A;  3U2R A;  1I1G A;  1Y8R B;  3L9F A;  4S0H B;  1S8N A;  1ZEL A;  2IA1 A;  1KGS A;  2L7F P;  1XD7 A;  5IYB J;  1SAX A;  1Z91 A;  1MBH A;  3A4C A;  3G2B A;  2JA6 J;  4ENK A;  3L2W A;  5TGT A;  2FNP A;  2FE3 A;  1VQO I;  3OS1 A;  5EGO A;  2ZCW A;  3ABK H;  1GVD A;  3CDL A;  5E3M A;  3CCQ I;  2HTJ A;  5IT9 K;  5E1Z B;  4RS8 A;  3J7Z I;  2Z16 A;  1D1C A;  3ESW B;  1MDM A;  2GXG A;  1GXP A;  2DA2 A;  1QBJ A;  3HSR A;  1G3W A;  2A6E F;  2LFB A;  2ADU A;  2NAZ A;  2O03 A;  1WWX A;  1PP8 F;  2P0W A;  2GOX B;  3CC4 I;  2DFF A;  2WY7 Q;  3TW7 A;  2DJI A;  3TOB A;  4Q5S F;  3TDZ C;  4NNJ A;  2NNN A;  1SD5 A;  3ROU A;  3M8J A;  2VE8 A;  2R3S A;  2KIQ A;  4GXO A;  3FDY A;  1WCM J;  2V7F A;  2CW8 A;  3O8H A;  1A35 A;  1W7P B;  4G7Z F;  2EQR A;  5AON A;  4R1H A;  4KIC A;  1FBS A;  2O61 A;  4D7N A;  3HOU J;  1HCR A;  2R93 J;  1ON1 A;  1O3S A;  1ZRC A;  1A36 A;  4IVN A;  3KP6 A;  3OYM A;  1E17 A;  2AO9 A;  3H3V K;  2DXI A;  4NQW B;  3CCL I;  4OIR F;  2VXD A;  3H9G A;  2W4S A;  2ZXI A;  2RNG A;  3SQN A;  2L7Z A;  5K7H A;  3KP5 A;  4M9Z A;  2RAE A;  2XAS A;  3EYI A;  1UCR A;  2ZSI B;  1EF4 A;  3E6M A;  2XDV A;  3SFZ A;  4C3J J;  1BI0 A;  2EK5 A;  4X1E A;  4BQN A;  3AL0 B;  2DMN A;  1RZ4 A;  3F22 A;  3GYH X;  2JN6 A;  4HX4 A;  3PNT A;  1Y6I A;  2BOL A;  3HIF A;  4M71 A;  1SFK A;  2E5Z A;  1JI8 A;  5LD2 C;  2MG4 A;  3K1M A;  1U6G A;  4L9N A;  3CUQ B;  3H35 A;  3PNY A;  4YFX F;  1A5J A;  1I3Q J;  3P9I A;  3LFK A;  1IW7 F;  1T6S A;  4IRH A;  1P9Q C;  3FKI J;  3K9T A;  5J8C A;  1R23 A;  3PL8 A;  2YS9 A;  2QGU A;  3PFY A;  1R00 A;  1UEL B;  1REP C;  1JTX A;  2DTZ A;  1MH4 A;  2HI3 A;  3HUG A;  1ETK A;  2R5Y B;  4E6K G;  3K1N A;  2VKH A;  3A0H C;  3I4M J;  4F52 A;  1OMI A;  2VPR A;  3QP5 A;  1R1U A;  2JK3 A;  4LLL A;  5KNL A;  1IG7 A;  1IRX A;  4B1R A;  2F2E A;  2BVM A;  1GLN A;  5D5V B;  1IJW C;  4A3L J;  1WZ2 A;  3I71 A;  4A3D J;  3ZQG A;  4BGD A;  3ABT A;  1JKO C;  3UNG C;  4RDU A;  5DD8 A;  2X0L A;  3E0J B;  2E2I J;  2E36 A;  1W7P A;  2NNY A;  3KFW X;  1QHG A;  2FRH A;  4JQF A;  3VSK A;  2IVM A;  4A6D A;  2BV6 A;  2ZJ2 A;  3WOD F;  4A3F J;  4A0Y A;  3TDU C;  5GPC A;  2BE5 F;  2VPL A;  4E7L A;  1FYK A;  2V1U A;  2V4J C;  4B47 A;  1O57 A;  1U5T B;  3VB2 A;  2KMU A;  4XOR A;  3HRT A;  3HRU A;  3G71 I;  5LGN A;  4KT5 C;  1EKE A;  1YJN I;  3ABM H;  3QPL A;  3FM3 A;  2P5L C;  2DW4 A;  4M3B A;  4IHS A;  1OIS A;  2P8T A;  2QKM B;  3IKT A;  2D5V A;  1FX7 A;  3JW4 A;  3F8F A;  2ZXH A;  2XSD C;  1OCZ H;  4XKV A;  2X1C A;  4IOA F;  1FMW A;  3MD2 A;  3IKV A;  1OCO H;  4YIR X;  3VOE A;  5J1R A;  2F4I A;  2WV0 A;  4FE4 A;  4YRV A;  3S3O A;  4CIC A;  2Z9O A;  2XPW A;  1TW3 A;  3SJM A;  2TCT A;  3B6A A;  2PN6 A;  3C7J A;  1D1A A;  2M30 A;  2OZU A;  3BLY A;  3JRB A;  1HKS A;  2QQB A;  2Y0M A;  4XIC A;  1UZC A;  4N9H A;  4HYE A;  1ZAR A;  2MSY A;  4ZYA A;  3W3C A;  4E7I A;  2DFH A;  1T39 A;  2K40 A;  4BU2 A;  2MH9 A;  2Q2E B;  2XAF A;  2VI6 A;  4XNF A;  5CPR B;  4E7J A;  4QLC U;  1UHW A;  3I0T A;  1V4R A;  3V8J A;  2ZME B;  2EIK H;  2IPQ X;  2HS5 A;  1TBX A;  4ON0 A;  4IHY A;  2UWM A;  3J7A Y;  1SVO A;  1OKR A;  2B9S A;  3MWM A;  1SEU A;  2F5E A;  2KP6 A;  3F23 A;  1ACI A;  5HLH A;  4XR6 A;  2HVQ A;  1CF7 A;  1IO2 A;  4ZDL A;  2CW7 A;  4A2U A;  3BDD A;  1VQ8 I;  5E18 F;  1Q1V A;  1P4A A;  3I58 A;  5L3G A;  4L9J A;  3CUO A;  4C2T A;  3ZMT A;  3OL4 A;  4LLG F;  3V8K A;  1YIO A;  3LNQ A;  1H8A C;  5HS8 A;  1LE8 B;  3X2Q H;  1IXR C;  5K1Y A;  3ML6 A;  1WPK A;  4LG0 B;  3HC7 A;  3BOQ A;  1RR8 C;  3MCZ A;  3V8L A;  5A2Q K;  4IQ4 A;  2WAQ A;  4P9F A;  4CYD A;  3NWT A;  3O3K A;  4BHC A;  5GTH C;  4KUM A;  3M4O J;  3KP4 A;  2M0C A;  4RGR A;  4BEH A;  4HQM A;  4NB5 A;  4D9J A;  4QTR A;  3ZPL A;  4IHW A;  1G3S A;  2XVC A;  2DA4 A;  3AG3 H;  4BBR J;  5EEA A;  1N77 A;  2V1D A;  4OMY A;  4S05 A;  4DGW B;  2QSF X;  3KZY A;  4WK8 F;  3PIO F;  4NQW A;  4DW6 A;  2OQG A;  4XRS G;  4EQQ A;  1V5E A;  5IT9 Z;  3GZ6 A;  2A5Y B;  1UG0 A;  2LRE A;  1IXS B;  4XN0 A;  1ZGW A;  2BY3 A;  4ZZD A;  1TWH J;  1P2F A;  4LLN A;  1R4N B;  1QQI A;  3GFM A;  1BJZ A;  1X58 A;  3GLL A;  2EFN A;  5CVV A;  2XAG A;  1GHC A;  1LNW A;  1FTT A;  1BW6 A;  3GFL A; 
#chains in the Genus database with same CATH homology
 3GTG J;  2LP0 A;  4UUS A;  5GP9 A;  1OCP A;  2CQX A;  4MO7 A;  1ZKG A;  4GFB A;  5FKK A;  3IH3 A;  2HQ5 A;  2DJN A;  4A3C J;  1X2N A;  5EDN A;  4C3H J;  4BBS J;  3S2H J;  4C3I J;  3BTI A;  3ZQC A;  1E3O C;  3W6V A;  3LSR A;  4XID A;  2NVY J;  1LFB A;  3S16 J;  4L5E A;  2EH3 A;  5M5Y J;  1AU7 A;  4UUS B;  3JRD A;  3FK6 A;  2X48 A;  1U9O A;  2DA3 A;  3BTC A;  1QRY A;  5FKM A;  4I6Z A;  2CJJ A;  2O9L A;  3S1Q J;  1HOM A;  5IOZ A;  3BR5 A;  3BR1 A;  4FCY A;  2ELK A;  3HBL A;  1JJ6 C;  3H0G J;  1Y1W J;  2DMQ A;  1IDY A;  2DMU A;  2CUF A;  1IUF A;  1Y1V J;  2LLK A;  2XRL A;  3A03 A;  1B8I A;  2XGD A;  2M9H A;  1TWG J;  1CQT A;  2DA7 A;  1H89 C;  5J3L A;  1GV2 A;  4JYK A;  4M3F A;  1Z0X A;  4IEJ A;  3HOW J;  4MLO A;  5EYR A;  3GBG A;  1ZR4 A;  3CMY A;  5K7F A;  3HGY A;  1B72 B;  1F43 A;  1LFU P;  1ITY A;  1DU0 A;  1UHS A;  5DS9 A;  1I50 J;  2ECC A;  3HGG A;  4DYQ A;  1TWA J;  4MFD A;  3JRH A;  1MBE A;  4UUT A;  1VFC A;  2DMP A;  4Y52 J;  1DU6 A;  2E1O A;  2Y9Z A;  3M3Y J;  2X6O A;  3QPS A;  5C44 J;  5FKN A;  2GLO A;  3RZO J;  2XB5 A;  1GUU A;  3K7A J;  4M3G A;  1W0U A;  1T56 A;  1UMQ A;  3HKZ N;  3IH2 A;  1ZR2 A;  5IP6 A;  1R9T J;  2XGE A;  2QCO A;  5M5X J;  3SFI A;  3HEF A;  4BY1 J;  1XG1 A;  2R0Q C;  1S7E A;  3GTL J;  4V2F A;  4XRM A;  4NDL A;  2CUE A;  3BR3 A;  2JMW A;  3ZQF A;  3BQY A;  3A02 A;  3QQA A;  4D7M A;  1SAN A;  1MSE C;  1RKT A;  3FK7 A;  1IRZ A;  2O8K A;  3GTK J;  1JT0 A;  2EZI A;  3MVP A;  2LVS A;  3JRA A;  2FD5 A;  2FQ4 A;  4XK4 A;  1ETV A;  2PMZ N;  2QF7 A;  3JRI A;  5F27 A;  2NS7 A;  3S14 J;  4A3E J;  3I4N J;  4DZJ A;  5F1J A;  1MBJ A;  2KDZ A;  2K9N A;  2IAI A;  1QPI A;  1TC3 C;  1MBF A;  3PO2 J;  3DCF A;  1WH7 A;  2LKX A;  4BKX A;  1ENH A;  3G1M A;  3MKL A;  4LOC A;  2LD5 A;  2YU9 J;  2ID3 A;  3TP0 A;  4B3A A;  1I6H J;  1FTZ A;  4FIS A;  2R5Y A;  1APL C;  4BY7 J;  5M3M J;  1JKR C;  3BQZ A;  2KT0 A;  5FKL A;  1D5Y A;  1P7J A;  3SDG A;  3JRC A;  1RET A;  2FX0 A;  2ECB A;  2AHQ A;  4I76 A;  1MH3 A;  5EF6 A;  2DA5 A;  5FJ8 J;  5DTD A;  5EG0 B;  2B63 J;  4A3I J;  5IPA A;  1HLV A;  1UG2 A;  1WH5 A;  1IC8 A;  3Q3S A;  1GT0 C;  2MGQ A;  1F36 A;  2OF7 A;  2E2H J;  1O4X A;  2JA7 J;  2HYJ A;  4W1U A;  3A01 B;  2HXO A;  1JTY A;  1ETQ A;  3F0C A;  2ME6 A;  3ZQH A;  3LSP A;  2HOA A;  1U9N A;  1B8I B;  3L1P A;  2O7O A;  3NAU A;  1ORK A;  2DN0 A;  1G2H A;  5F08 A;  5IOY A;  5M5W J;  3RZD J;  1VND A;  4A69 C;  5IP9 J;  1JGG A;  3TP3 A;  1JT6 A;  5HOD A;  3ZQL A;  1FIA A;  2WB1 N;  4CYC B;  4JP0 A;  4Y7N J;  3UKG A;  3IV5 A;  5BNG A;  3OOU A;  5FLM J;  5GPA A;  5E3N A;  4A3G J;  1JKP C;  2G0E A;  1XC5 A;  2LR8 A;  4EEF G;  1FIP A;  1OFC X;  4S0H B;  4IHX A;  4A3K J;  3BG9 A;  1MNM C;  3Q0U A;  2GM4 A;  3HOZ J;  2MW8 A;  4QSH A;  2EBI A;  2L7F P;  5IYB J;  3S1R J;  1MBH A;  2XPU A;  3IH4 A;  2XB0 X;  2JA6 J;  2L7M P;  2HXI A;  2ZB9 A;  5EGO A;  2Y0S N;  1GVD A;  3CDL A;  1WI3 A;  5E3M A;  1FJL A;  3S15 J;  3G1O A;  1BA5 A;  2GBY A;  5FLV A;  2DA2 A;  1HF0 A;  2LFB A;  3RQI A;  5IYD J;  3WHC A;  3TW7 A;  1VF9 A;  1PUF A;  1VI0 A;  1WCM J;  5E3L A;  3O8H A;  3OIO A;  2EQR A;  2DA6 A;  4M3D A;  3GTM J;  5IP7 J;  3BR0 A;  2VKV A;  3HOY J;  4D7N A;  2JA8 J;  3TED A;  3CQZ J;  3HOU J;  2LY9 A;  1HCR A;  2R93 J;  1U78 A;  2L0K A;  1RR7 A;  5EZH A;  1HDD C;  2R92 J;  2DMT A;  2AO9 A;  1XS9 A;  3H3V K;  1IDZ A;  2NVT J;  3RKQ A;  5J1Y A;  5C3E J;  4HNV A;  2M8G X;  4M3E A;  5JLX A;  3NAR A;  2L7Z A;  5K7H A;  1JKQ C;  4CYC A;  5M3F J;  2RAE A;  1ZQ3 P;  1EF4 A;  3BTJ A;  4C3J J;  4X1E A;  2DMN A;  2JN6 A;  3HOV J;  2X9D A;  2NVQ J;  1BL0 A;  1FEX A;  5EZG A;  1ETW A;  4X6A J;  1TWC J;  2MG4 A;  3B6C A;  2EZH A;  3A01 A;  1A5J A;  1JUM A;  1I3Q J;  1NK3 P;  2LTP A;  3FKI J;  3JRG A;  1K83 J;  5F04 A;  2YS9 A;  1WGX A;  2XPV A;  2N8G A;  4ABZ A;  2HDD A;  3S1N J;  1JTX A;  2DTZ A;  1MH4 A;  2HI3 A;  2R5Y B;  1ETK A;  1JUP A;  2JJ7 A;  3OSG A;  3C2B A;  4QIW N;  2Y31 A;  5FKO A;  3E7L A;  1AKH A;  2HOT A;  3D1N I;  3I4M J;  2VPR A;  2JK3 A;  1IG7 A;  4B1R A;  1IJW C;  4A3L J;  4D5F A;  4A3D J;  3ZQG A;  2WV1 A;  4B4C A;  1SFO J;  1JKO C;  4RDU A;  4W97 A;  1ETY A;  1P7I A;  2OPT A;  1QVT A;  4JX4 A;  1JJ8 C;  1AHD P;  3GTQ J;  2E2I J;  1JUS A;  4A3M J;  3DEW A;  1YRN B;  2Y30 A;  4A3J J;  3HDD A;  4AC0 A;  1HDP A;  4A3F J;  3LOC A;  3FIS A;  5GPC A;  1IGN A;  3TW6 A;  3GTP J;  5EGO B;  1LE8 A;  1NTC A;  1MBG A;  2H1K A;  5F0F A;  1YRN A;  2CQQ A;  3HB9 A;  3QPL A;  3BG3 A;  1RES A;  4M3B A;  3JRE A;  1A6I A;  2D5V A;  3VPR A;  1ZTR A;  1BW5 A;  3HM5 A;  2XSD C;  4G12 A;  3MN2 A;  1RPW A;  1PUF B;  1AKH B;  4V2G A;  5J1R A;  1GDT A;  5IYC J;  2M2E A;  3JRF A;  3GTO J;  4FE4 A;  5K7Z A;  3FIW A;  4J19 A;  4AUX A;  2XPW A;  3SJM A;  2COB A;  3WHB A;  2TCT A;  3B6A A;  3S1M J;  1B72 A;  3BR6 A;  1Z77 A;  3HOX J;  3JRB A;  3BR2 A;  2ID6 A;  4XIC A;  2R5Z B;  2CU7 A;  2MSY A;  4FE7 A;  2K9S A;  3S17 J;  2L9R A;  1K61 A;  3K2A A;  2NS8 A;  1OCT C;  2K40 A;  4JX6 A;  1QVU A;  1GV5 A;  2VI6 A;  2NVX J;  2HOS A;  2IEK A;  2E19 A;  3Q0V A;  4RBO A;  2R7Z J;  2H8R A;  2TRT A;  2Y9Y A;  4IHY A;  3ZOB A;  5JLW A;  2ME0 A;  2LK2 A;  1RKW A;  4A93 J;  1T33 A;  4IHV A;  2VKE A;  3OSF A;  1MBK A;  2CRG A;  4D5C A;  5C4J J;  5J1U A;  1X2M A;  1H88 C;  1Q1V A;  2M34 A;  4MIM A;  9ANT A;  4JX5 A;  1IV6 A;  1TWF J;  1ZK8 A;  2JA5 J;  3PO3 J;  4BXX J;  3LNQ A;  1H8A C;  2I10 A;  1ETX A;  1U8B A;  2JWT A;  1LE8 B;  3BT9 A;  2FJ1 A;  1WPK A;  2EZK A;  2YUS A;  5C4X J;  5F0C A;  3LSG A;  4M6V A;  2W48 A;  1ETO A;  2DA1 A;  3BG5 A;  3ZQI A;  4FTH A;  3BTL A;  4MFE A;  2NOG A;  1OJL A;  2K9Q A;  3M4O J;  2EZL A;  2Y2Z A;  2M0C A;  2IBD A;  4IHW A;  4QTR A;  1POG A;  2DA4 A;  4BBR J;  5EEA A;  3Q0W A;  4C2M J;  5EG0 A;  3S2D J;  3G1L A;  4DYC A;  2E2J J;  4DW6 A;  4XRS G;  3CCY A;  4AYB N;  3PM1 A;  4XRS A;  2XGC A;  3O8G A;  5F0H A;  1ZGW A;  1NK2 P;  1TWH J;  1W0T A;  3LSJ A;  2VUM J;  4DYR A;  4DZP A;  1BJZ A;  1X58 A;  3JR9 A;  2R5Z A;  1MSF C;  3GTJ J;  2P81 A;  5E3O A;  1FTT A;  1BW6 A;  2WAQ N;  4A3B J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...