3HOVJ

Complete rna polymerase ii elongation complex ii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hovJ00
4JX6A 5IP9J 2L7FP 4B1RA 1HOMA 1IRZA 4M3DA 2DMQA 2IEKA 4Y52J 1GUUA 4DW6A 2QCOA 3JRDA 3ZQGA 1X2NA 4C2MJ 2CJJA 2JA6J 3HOUJ 4MFEA 1U9OA 3GTQJ 1UHSA 2FQ4A 4I76A 1AKHA 1E3OC 5FKKA 1B72B 1JT6A 3W6VA 1VF9A 3MVPA 3S14J 4FISA 4RBOA 3HBLA 5K7FA 1NK2P 2WV1A 5E3NA 2HOSA 1TWAJ 1LE8A 1ZKGA 3BQYA 3Q3SA 2VKEA 2NS7A 5C44J 2XGEA 1OJLA 3QPSA 4XRSG 1MBJA 2E2HJ 2KT0A 4MIMA 2GLOA 4DYRA 3IH4A 1XG1A 5C4XJ 3UKGA 5J3LA 3LSJA 3TP0A 1QVTA 1H8AC 5FJ8J 4M6VA 2ECBA 5F0HA 5DTDA 4D7NA 2EQRA 1AKHB 3TEDA 3TW6A 3SDGA 9ANTA 5EZGA 3ZQHA 4IHVA 2LFBA 3HEFA 3OSGA 2R7ZJ 1R9TJ 4IHXA 3S16J 2JA8J 5E3LA 1H88C 1HDPA 1MBEA 1LE8B 5M5YJ 5GPCA 3IH2A 4EEFG 3S2HJ 5EGOA 4A3MJ 2K40A 1PUFA 1A6IA 3GBGA 1AU7A 3HOZJ 2ID3A 3TP3A 3OSFA 2JMWA 2DA6A 2M8GX 1ITYA 3O8GA 3BR0A 4MLOA 2Y0SN 1I50J 3JRHA 2X9DA 2H1KA 4BBRJ 1VFCA 3K2AA 4B3AA 1SANA 3C2BA 2MW8A 2B63J 1TWHJ 1HLVA 2E1OA 5IP6A 3WHCA 3E7LA 1I3QJ 3HKZN 1WCMJ 5IOYA 3JREA 1APLC 2LTPA 1AHDP 1X58A 5JLXA 2EZKA 4UUTA 5EGOB 4BBSJ 4D5CA 3SJMA 1PUFB 3BR1A 1JKOC 1D5YA 2LLKA 4M3BA 2VUMJ 1RR7A 4V2GA 3S17J 2L9RA 2FD5A 1QVUA 2M9HA 5EG0B 4IHWA 3S1MJ 2DJNA 2M0CA 4DZJA 5M5WJ 1Y1WJ 2DTZA 1YRNA 1W0UA 3CMYA 1ZGWA 1ETYA 2YU9J 4BY1J 1WPKA 3M4OJ 4A3DJ 2LKXA 4A93J 3BT9A 1ENHA 2HOAA 2NVXJ 2NS8A 4V2FA 2DMPA 2LVSA 4MFDA 2YS9A 4JP0A 5IYDJ 1ETKA 1IDZA 1RKTA 2XRLA 5M3FJ 1JTXA 3HGGA 3A01A 1JKPC 3HOVJ 3G1MA 2XPVA 2CRGA 1FIAA 2E2IJ 5F0FA 2I10A 4A3EJ 3GTPJ 2OF7A 3O8HA 1YRNB 1DU0A 3ZQFA 4X6AJ 2RAEA 1GVDA 3I4NJ 2MG4A 4A3GJ 1DU6A 1RPWA 5J1YA 2ID6A 4W1UA 3HDDA 1IJWC 2JWTA 2EZIA 4ABZA 1ZR2A 4X1EA 2LP0A 1S7EA 1OFCX 3GTOJ 4BXXJ 3A01B 3LSPA 2HYJA 1WH5A 4FE4A 1H89C 2DA1A 2M2EA 1MNMC 1XS9A 5IYBJ 1IGNA 3ZQCA 3LSRA 2R93J 1RKWA 3B6CA 4I6ZA 1ETOA 4GFBA 4D7MA 5J1RA 3JRCA 2DN0A 2R5ZA 4DYQA 2DA4A 4B4CA 3ZOBA 1BW5A 2XPWA 1HF0A 2MGQA 5J1UA 1MSFC 3BTCA 3JRIA 1IUFA 1IC8A 1T33A 3HOWJ 1JTYA 4MO7A 4IHYA 3IV5A 5E3MA 3S2DJ 2K9NA 1ETWA 1ZK8A 1HCRA 3SFIA 1WGXA 5IOZA 2CQXA 1ETVA 3BTJA 5E3OA 4W97A 1MSEC 2HQ5A 3FK7A 2E19A 2P81A 2R0QC 3BQZA 5IYCJ 4RDUA 2FX0A 3JR9A 1U8BA 2E2JJ 2DMTA 2R5ZB 2DMNA 2LR8A 5F04A 1JGGA 3S1NJ 1JT0A 1MH3A 5FLVA 1MH4A 4CYCA 2M34A 1BL0A 5EG0A 3JRAA 2O8KA 3GTJJ 1GDTA 1RESA 1CQTA 2NVTJ 4QSHA 1WH7A 3BR2A 5DS9A 1MBFA 1U9NA 1POGA 4FTHA 3CCYA 1ORKA 1ZQ3P 2NVYJ 5EZHA 3L1PA 3HOYJ 2GM4A 3HM5A 2XGCA 2Y30A 3H3VK 2WB1N 3CQZJ 1G2HA 3F0CA 4G12A 1VNDA 2JJ7A 2LD5A 4CYCB 1O4XA 3DCFA 3BTIA 4A3BJ 3G1OA 3NARA 4NDLA 4A3LJ 3WHBA 1TWGJ 4A3FJ 4JYKA 2R92J 2L0KA 4M3GA 2QF7A 4D5FA 2H8RA 2Y9YA 4C3HJ 5C3EJ 2VKVA 2YUSA 1QPIA 5IPAA 1P7JA 2HI3A 2GBYA 1BA5A 2CU7A 1ETXA 2KDZA 2VI6A 2XSDC 2HXOA 1JKQC 1IV6A 1RETA 3Q0WA 2L7ZA 4S0HB 1SFOJ 3S15J 2LK2A 3I4MJ 3RZOJ 3K7AJ 4XRSA 3MN2A 1JJ8C 2NOGA 2O7OA 3RQIA 4A3CJ 1K61A 4XICA 4AYBN 5IP7J 1FEXA 1JUMA 3HGYA 5FKMA 1MBHA 2HDDA 4LOCA 4QIWN 3FIWA 3Q0UA 1NTCA 3OOUA 1OCTC 2JK3A 1JJ6C 3NAUA 2LY9A 1U78A 1FJLA 1TWFJ 4A69C 3VPRA 4L5EA 4DZPA 5EF6A 3PO3J 3G1LA 1NK3P 2COBA 1K83J 2DMUA 3ZQIA 5F08A 1VI0A 2Y31A 5GPAA 5EDNA 3BG9A 1B8IA 1ZR4A 1BJZA 3CDLA 3JRGA 1X2MA 5F1JA 5FKLA 1JUPA 5K7ZA 1T56A 4UUSA 2N8GA 3BTLA 3B6AA 2ELKA 3JRBA 5BNGA 1UG2A 2MSYA 2NVQJ 5M5XJ 2JA5J 1EF4A 1FTTA 2TRTA 1HDDC 2X6OA 3BR6A 1FIPA 5FLMJ 1LFUP 1LFBA 1QRYA 1Y1VJ 5FKOA 4M3FA 4BY7J 1Z0XA 3GTMJ 3DEWA 4A3IJ 1B8IB 2PMZN 3JRFA 1GT0C 1I6HJ 4FE7A 1BW6A 1F36A 2W48A 2DA7A 4AC0A 3LOCA 3TW7A 2OPTA 3LSGA 3LNQA 3RZDJ 5C4JJ 3HB9A 4XIDA 2TCTA 4UUSB 4HNVA 3HOXJ 3Q0VA 1TWCJ 4DYCA 3A03A 5F0CA 5F27A 2WAQN 3FKIJ 3D1NI 3IH3A 2XB5A 2FJ1A 2ZB9A 4BKXA 4J19A 4XRMA 2HXIA 5EYRA 1ZTRA 2DA3A 2EH3A 3QQAA 2EZHA 5EEAA 4C3JJ 3MKLA 2DA5A 5GP9A 2AO9A 2AHQA 2CQQA 2CUFA 2R5YA 1Q1VA 2EBIA 4QTRA 2Y2ZA 1WI3A 3ZQLA 1MBKA 3OIOA 1GV5A 1ETQA 2O9LA 3M3YJ 2XB0X 3S1QJ 1F43A 4A3JJ 2Y9ZA 3PO2J 2EZLA 3RKQA 4A3KJ 1XC5A 2CUEA 1JKRC 1IDYA 3QPLA 1W0TA 2L7MP 2G0EA 2JN6A 5JLWA 1IG7A 4JX5A 3BR5A 5HODA 4AUXA 1MBGA 1P7IA 1TC3C 3FISA 1JUSA 2R5YB 3S1RJ 3PM1A 1A5JA 5FKNA 1FTZA 3BR3A 4FCYA 3GTGJ 1Z77A 2XGDA 3GTKJ 2IBDA 2X48A 2HOTA 3H0GJ 1GV2A 2ECCA 5K7HA 5M3MJ 3FK6A 4XK4A 4C3IJ 2ME0A 2JA7J 3BG5A 2K9SA 2K9QA 2VPRA 4JX4A 2ME6A 4Y7NJ 1OCPA 3BG3A 2IAIA 1UMQA 1B72A 2DA2A 2D5VA 3GTLJ 4IEJA 2XPUA 4M3EA 3A02A
chains in the Genus database with same CATH superfamily
1ZLJA 3DBLB 3SHFA 4DJAA 5LRSA 1PUEE 3I5UA 1HOMA 4Q5SF 1XMKA 3DEEA 4PJMA 2XROA 1Z1DA 5D6EA 1G3YA 3RDIA 2DMQA 4P1WA 4Y52J 4Q4ZF 2X85A 1S7OA 4I99C 2CV0A 1O3QA 1X2NA 3I9V2 2F4MB 1KA8A 2O61A 3WTSC 1U9OA 3GTQJ 1MKMA 1FOKA 1ZRDA 1NHAA 2ZO4A 1OR7C 4RGXA 1WKMA 1AKHA 4A6EA 3OYMA 3W6VA 3CUQB 2LC2A 4FISA 5FROA 1UELB 2PX9A 3HBLA 1R5HA 3P5JA 4BJ5C 4NNJA 1LE8A 1S7AA 2ICWG 5D5XB 5C44J 2DPUA 2E2HJ 2KT0A 1RUNA 1QQIA 3CESA 1TBXA 3IKVA 3L9FA 4MIMA 5HS7A 3R6SA 3IH4A 4HLXA 3DF8A 1XG1A 4BS9A 3LSJA 3TP0A 1QVTA 4I0BA 4M6VA 5F0HA 5DTDA 3TMOA 2EQRA 1AKHB 1CF7B 2Q0OA 5ICFA 4IHVA 1WHUA 1DP7P 1FP1D 2FUG2 2EFWA 5JVGF 3WTVC 1R9TJ 2JA8J 3SXYA 5LBQA 1OQYA 2H6CA 1LE8B 5B1AH 3H1CA 3IH2A 4EEFG 5EGOA 3PNVA 1F5TA 2CS3A 4OAYA 1ZLKA 3LFKA 4UV9A 2R3SA 3D5SC 4BAYA 3ZPLA 1FNNA 2JMWA 3L2CA 4U0WA 4MLOA 1ON2A 1VQPI 4HW0A 4WX9A 2EFOA 1VFCA 1VQMI 3OYNA 3K2AA 4NBQA 4D1QA 4CGZA 2OA4A 4M9SA 4HRIA 2LDUA 1TWHJ 1IRXA 4CCNA 5IP6A 4JK1X 4IO9F 5IY5H 3E7LA 3HKZN 4CCMA 1BIAA 1TP4A 2BXZA 5AIPA 1SMTA 1X3UA 2DK8A 2X6XA 2KRFA 5EGOB 4KDPA 1T8IA 3ABUA 1JKOC 1PJRA 1ZGAA 2GXAA 2DOEA 4BDZA 3S17J 1IW7F 2FD5A 1FX7A 5EG0B 4YG2F 2X0LA 2HKOA 3F8FA 5BMZA 4BACA 3BDDA 2K9MA 3CUOA 3OYEA 2DQLA 1YRNA 1D8KA 3M07A 4CICA 2KFDA 2ZC2A 4A3DJ 2P8TA 3BT9A 2HOAA 3S3NA 4G94A 2NS8A 2NVXJ 4V2FA 1Z9CA 1EH7A 1FBSA 3CTAA 3KP2A 3HL2A 4ZTJA 3KEOA 5M3FJ 5GAEJ 3OYFA 3RKXA 3A01A 1JKPC 4XORA 1IV8A 3G1MA 2EWNA 3MZYA 2Y48A 2E5ZA 5ILUA 3C2HA 1F9NA 3GMEA 4A3EJ 2KJBA 4ZH4F 3O8HA 1YRNB 5ILSA 2QYOA 3OYDA 3COAC 4E70A 3J81K 2M4KA 1O7FA 3PIPF 2K4JA 1DQUA 4NC8A 1EH8A 5J1YA 2ID6A 3BC8A 1YS7A 4F52A 3HDDA 2JWTA 2E1MC 3MMYB 2JT1A 3LSIA 4X1EA 4EATA 5LLQA 3VSLA 3HG9A 1OFCX 1O3RA 4XQFA 4BXXJ 3A01B 2XF7A 1DGWY 2HYJA 5K5RA 2F5VA 1ACIA 3G2BA 3PNYA 3KP7A 3ZQCA 3NQOA 4L9TA 1G3WA 4I6ZA 2STWA 2DFEA 4FQGA 4KMFA 5J1RA 5DM7F 4BEHA 2CMPA 4DYQA 4E4HA 5GAGJ 2GIVA 3OYAA 2QBYB 2DOFA 2JSCA 3LA3A 3WE3A 3ECOA 1GHCA 1OYWA 1SVLA 1TZLA 2G7HA 2YPRA 3U1DA 1IUFA 4I2OA 1OCRH 1KYZA 1GVJA 4YFNF 4OAZA 3FXOA 3QYEA 1K6YA 1BBYA 2R7QA 4XOTA 2PMUA 5E3MA 3S2DJ 1TNSA 1R1TA 1T08B 1WGXA 2WAEA 2HQ5A 2OAZA 2P81A 4KN7X 2R0QC 1MDMA 4NB5A 2V26A 5IYCJ 4RDUA 3JR9A 2E2JJ 1U8BA 3RI4A 3FXMA 4BEHB 4WXDA 4B48A 5F04A 3U2RA 1BN5A 1DUXC 3ABLH 1JT0A 4DGWB 2H6BA 4BH9A 4MEXF 1BL0A 2IGNA 5AIQA 3VYTB 2HGCA 3GTJJ 1GDTA 1Z91A 3DTIA 3P7NA 2DT5A 2HYFA 3BR2A 1ZRCA 3M9AA 1MBFA 3DBHB 2MC4A 4ON0A 1ORKA 4GCVA 1ZQ3P 2A69F 3BROA 4U87A 1FC3A 3TOAA 1MDMB 3HM5A 4XSXF 3VEPA 2GM4A 2XGCA 4MQVA 2GIZA 1JHFA 3OYHA 4IPAA 4R1HA 2OU2A 2WB1N 4HDUA 1Z05A 1SVMA 3F0CA 2W84A 3JCUC 2V4JC 5LGTA 5H6RA 1G2HA 2JJ7A 1TTYA 3DCFA 3ZRGA 4NDLA 4RM2A 4EM2A 1O7LA 2JUCA 1WJ5A 3KYDB 4A0YA 2RNJA 1ZYRF 4UB6C 1UJ8A 2W25A 1XMXA 4M3GA 3F6OA 2QF7A 5C3EJ 2XUBA 2AXLA 3RTRA 3GFIA 5IPAA 5A2QK 2GA1A 2ZNYA 2HI3A 2LYCA 4U0YA 1BR1A 4H4KC 2CU7A 1VTNC 2KDZA 2F4IA 5JHUA 1E2XA 2GAUA 2ZBKA 3ZGKA 3CJTB 5CVVA 3WTWC 3OY9A 5LHHA 4XRSA 1Y0NA 1K7AA 3IUOA 2XASA 4CCOA 3FHNA 4PCQA 2XC7A 5IP7J 1B6AA 2F5DA 2FRHA 2K5CA 1JUMA 5GAHJ 1VQ7I 3K70D 2VQHA 1EV7A 3EYIA 5CVRA 1OPCA 2QSHX 3J81Z 1NG6A 1TNTA 1UG0A 2NAZA 3A4CA 3IAS2 4E7IA 1UZCA 3CJQB 1B4AA 3NAUA 3GZ6A 1D1BA 3KP6A 2HQAA 1HW2A 2LNBA 2MH9A 1N25A 4L5EA 2VT2A 2AQEA 1D0YA 3CLQA 3LAJA 4P9UA 2DTRA 1W1WE 3V8KA 3G1LA 4UVCA 3H9GA 1VZ0A 2DMUA 4LG3A 4I0AA 3KETA 2Y31A 5EDNA 1B8IA 1ZR4A 5AONA 2VQLA 5DCMA 2NRAC 2OCEA 1OCCH 3JRGA 2H27A 3DKXA 1X2MA 2R7WA 5F1JA 4ASNA 1WJFA 3EETA 1XGOA 2HR3A 1W5SA 3ROUA 1ONVA 3QOPA 3VSKA 3I0TA 3JRBA 5D4RA 2NVQJ 4LIUA 2V1NA 1S72I 2AS5F 1Z7LA 3BR6A 1LFUP 2ZJ2A 1Z0XA 4A3IJ 1B8IB 3JRFA 5DCMB 4XN3A 3BCBA 3W6JB 1BW6A 1F36A 4YFXF 4S05A 1A35A 1J75A 2ZSIB 2XAHA 3GO5A 3ONQA 2ESHA 2AXTC 3AG3H 2Z2SB 1QZYA 4E7HA 1YHQI 4DYCA 2CQ7A 1U5TA 5F27A 3VODA 4E7LA 3FKIJ 4IVNA 1S8NA 4ZYGA 3D1NI 2JUGA 3OYGA 1YW9A 4IHSA 2FBHA 3K1PA 1R71A 1MJAA 3VYRB 3HSEA 3PFYA 3ZCOA 3RPUA 4XRMA 2F2EA 2RQQA 1Y39A 4FT8A 2UZKA 3H3ZA 3R61A 2FMYA 3FDYA 5L3GA 1JHHA 3K4LA 1IUYA 2ZFUA 5J8FA 3H9QA 2JSPA 1FYMA 1PDNC 2LY1A 2BVMA 3HTSB 1UHWA 2UXNA 4YIRX 5E17F 1U5TB 1LDJA 4TV7A 2V1UA 1ETQA 4EQQA 3M3YJ 2F48A 1JXSA 3RKQA 4A3KJ 2FOWA 4ZYDA 1LDKB 3JSPA 4CA0A 4XN0A 1SVOA 4E7KA 2GA2A 2DODA 1ZELA 3PL8A 4AUXA 4BE1A 2QM3A 1R4NB 1YX5A 2PG4A 1JUSA 4UXNA 1A5JA 3FXQA 3HPHA 3E5QA 2E36A 3GTKJ 2VN2A 4L5IA 3ZN1A 1MZBA 2HOTA 2LY2A 2HPIA 1BI0A 3H0DA 2DFIA 2J5PA 3L2QA 2ELJA 5K7HA 1TL8A 5E8GA 3O6BB 2JA7J 3AG2H 2Z33A 3MWMA 2K9SA 2K9QA 2FE3A 2ZFWA 2HDWA 2VPRA 3P9CA 4JX4A 3LL7A 4KIBA 3RKWA 5LGNA 2XHKA 1LQ1A 2IXSA 2ESNA 2EV5A 2L7KA 2B9SA 4M3EA 2HTSA 1RIOH 1IN6A 3KIOA 2VXZA 5IP9J 1WJCA 2QQBA 2Z16A 5TISC 4B1RA 1KU7A 1IRZA 3WGHA 4AYBA 2RKHA 2ZJPF 3LFUA 3PUFA 1IXCA 2W57A 3AKZA 1C0WA 4XLAA 1N75A 1GUUA 2VASA 3L2RA 1I27A 2IGMA 2IA2A 2QCOA 3JRDA 3ZQGA 1ZAOA 3KZYA 3ERMA 4ANJA 2CJJA 1WJBA 3KZZA 3OS1A 2IS2A 2Q1ZB 1UHSA 4I76A 2XKOA 2JQ7A 4ZYEA 1E3OC 4LB5A 2RQPA 2XSJC 3MVPA 4XLCA 3CLOA 3FBNB 4IF4A 2EILH 1TQMA 3BPVA 2E1CA 5ICCA 3BOQA 2DPDA 1YYVA 2XGEA 1IF1A 4XRSG 4E6KG 4XLNF 2GZWA 1SAUA 1E0EA 2CFOA 2XAGA 2W1OA 3N05A 3BZKA 5FJ8J 4Z6YA 3GF2A 5HDKA 1U8RA 3TEDA 2NYXA 3TW6A 4KA4A 5KAIC 3HEFA 3OSGA 4K2EA 2VBZA 2R7ZJ 2V9VA 2KIMA 2CV1A 2M0MA 5E3LA 1HDPA 2Y0MA 4ENKA 3WTXC 1R7JA 2XAQA 3ECHA 1D0XA 3F22A 2P6TA 1J59A 4EJWA 3DPLC 4KJZA 4OINF 2KRHA 4EGZA 2KRCA 4G6TB 2M8GX 4YIFA 3BCAA 3O8GA 1P9QC 3OIPA 5CYVA 1R36A 1I50J 3MZ8A 4HSTA 3JRHA 2LREA 2QENA 2H1KA 2PFBA 2YSRA 4BBRJ 4CYDA 3AG4H 2X4HA 4L9JA 1SANA 3M8FA 2KMUA 4U0VA 2IGKA 2MW8A 4LGWA 4L0ZB 2B63J 5HNFA 4ENNA 1HLVA 1J0RA 2WY8Q 2CW0F 5JR3A 1WCMJ 3JREA 1APLC 4GYIA 2JA2A 3W2VA 1X58A 5JLXA 4G7ZF 1K79A 2EZKA 4P9FA 2IT0A 1MW7A 1YI2I 2VOOA 1HC8A 2Q2EB 4A5MA 5IT3A 2HVQA 2LBFA 3H35A 4LIVA 4RB2C 5K5QA 3K0LA 4AIJA 4JQFA 2LLKA 3ABMH 4HOBA 4II3A 2A68F 2L9RA 3DKWA 2ETHA 5L3DA 3CCEI 1HBXG 3QYFA 1KU3A 4DZJA 2M0CA 1SFXA 3ZQ7A 4G8XA 1FOWA 4PSXA 1T39A 1U5TC 3QODA 4KISA 1ETYA 1TW3A 1WPKA 3M4OJ 1A04A 3HUGA 1I3AA 2ZJRF 3DFGA 4UV8A 2DMPA 1G3SA 5IT9Z 2L02A 4XSZF 2OD5A 3TDZC 4JP0A 5J6XA 3GLXA 5D5WB 1IDZA 2XRLA 2Y69H 2XF5A 4PGGA 5D5UB 4AD9A 3K4BA 1X1BA 1PP8F 1W4MA 3HOVJ 5J47A 1HKQA 3REOA 4LD5A 1YITI 2O8XA 1FIAA 3EUAA 2OF7A 3I4PA 3QWLA 4N4NB 1MMGA 1DU0A 1KQ0A 2DYRH 3ZQFA 1IN4A 3T8RA 1QHGA 5F1RA 3ASOH 4PK4A 3HUGB 1WZ2A 1Z6TA 2K02A 3L2UA 2STTA 3RPQA 1RPWA 1SC7A 2OUMA 2BBYA 1O57A 1IO2A 4PDKA 1ZG5A 3L2VA 1TQPA 4FETA 3MKYB 5HLTA 1ZG3A 1CF7A 2QSGX 2HTJA 3GTOJ 1XCBA 5H6QA 1QNTA 3GEZA 2M8EA 1H89C 2R7UA 5F64A 2JPBA 2Z99A 4RAYA 2R93J 1RKWA 2P7VB 1XD7A 3ZMZA 5H2FC 3JRCA 5DUIA 4PFOA 4HX8A 4AIDA 2DA4A 2MBFA 3R0JA 1BW5A 1B1BA 2FSWA 1YIOA 2W00A 2VE8A 3ESWB 4NUBA 3SZPA 2GQQA 2QSFX 1JI8A 2Z5UA 2KQRA 1JTYA 4MO7A 5E8IA 3CO6C 3DU6A 4HEA2 4IHYA 4RGUA 1NG7A 4ZYAA 3HRSA 2DYSH 2L4AA 4YELA 1RR8C 3BTJA 2MD5A 4W97A 3FK7A 3SEQA 1EJ9A 1E17A 2FX0A 2DMTA 3N4MA 4IOAF 3WGGA 3PNTA 1MNEA 2DMNA 4GRIA 3R0AA 2MA3A 2UWMA 1V54H 1MH3A 1SD7A 5ILVA 2E1NA 1S5LC 1MH4A 5L3CA 2V79A 3PIOF 4IHTA 2BE5F 5EG0A 4BQAA 2EFQA 4P55A 2HYGD 3QU6A 4CSWA 5DV5A 3HC7A 1RESA 3HSFA 5HLGA 1CQTA 1WH7A 1SD4A 3WU0A 3I3LA 1LNWA 2MFZA 2EIJH 4CZCA 2M3AA 3L00A 1L3LA 3L1PA 2R7SA 2A5YB 3KE2A 4OIRF 5J4YA 2Y30A 4GO1A 5J8CA 2F5CA 2QKMB 4OIPF 3H3VK 1LB2A 1IRGA 3TO7A 1BM9A 1P92A 1UB9A 4G12A 2Y0SA 4EVIA 4KN4X 5FGMA 3SYTA 2VE9A 2CO5A 2IPQX 3BTIA 4A3BJ 3G1OA 4RB3C 5LFAA 3WHBA 1TWGJ 2PQ8A 4A3FJ 3F23A 3GUDA 1X1AA 4NQWA 2VIXA 2XV4S 2P5LC 3WODF 4M6XA 3C18A 3E3VA 4ITVA 2VKVA 4WF2A 3OS2A 3LWFA 2VJIA 1QPIA 1BI3A 1MD0A 4PJJA 1D1AA 3OYCA 4ZDPA 1ETXA 1BA5A 3K6GA 2XSDC 2HXOA 1D5VA 1WJEA 3G71I 2QUFA 3GVAA 1R4MB 2IW5A 4S0HB 1SFOJ 3S15J 1XGSA 3CJRB 3I4MJ 1AA7A 2HZTA 1G6NA 2DW4A 4WWCA 2O7OA 2AQFA 2IA0A 1V55H 1XGNA 3CCQI 4B3XA 2QQ9A 4NQWB 2X51A 1YE9A 4AYBN 5DCFA 3FM3A 5GTHC 2HDDA 2VC1A 2GWRA 4QIWN 1NTCA 2QBYA 1STZA 5EEHA 2JK3A 3O2PE 2DDBA 2K86A 3H5RA 3B02A 4BHBA 3VPRA 4XKBA 2WTEA 2HQNA 1WI9A 5BPIA 5D5VB 1HW1A 1NK3P 1YO5C 3KYLA 2R7OA 4P96A 4ZYHA 5BQTA 5F08A 2WADA 2VODA 2Z3YA 2QA4I 3D5LA 3SQNA 3E6CC 3MQ0A 3OMYA 3CP8A 4BXFA 1RI7A 2KLOA 3HTUA 1JUPA 2ELHA 1T56A 2N8GA 2OV7A 2MLKA 3TGNA 3ML6A 3IL2A 2DT6A 2L5QA 2ADUA 2ELKA 4Y33A 1MGTA 1OISA 4ESJA 2BXYA 2MSYA 1EF4A 5M5XJ 1Y6IA 3CDHA 1RRJA 2ZCWA 1YIJI 3P9IA 1BIBA 3WG7H 1FIPA 1TW2A 4XKCA 2HPMA 1LFBA 3GLLA 1HSTA 2X1DA 2COMA 1B9MA 4M3FA 4ZZDA 1VQNI 3DEWA 1XTAA 4EJVA 4CCKA 4FE7A 1LVAA 2DA7A 4AC0A 1OMIA 3F8NA 2G7UA 2KL4A 5K5OA 3LNQA 1HQCA 4Q48A 2EIKH 2TCTA 2XKPA 1D1CA 2BZTA 2HVSA 3S3OA 1TWCJ 3DPUA 3A03A 3ULQB 5F0CA 3IWFA 4PFPA 3FHZA 1X1PA 2K85A 4HNTA 2XB5A 5KAFC 2BGCA 2EFPA 3JTGA 3G6EI 1R5GA 3LA7A 4J19A 5CVUA 2HXIA 2DA3A 2KZGA 2ZNZA 4XLFA 2EZHA 3A0HC 4KFCA 5HOOA 4C3JJ 2GOMA 2AO9A 2CQQA 2CUFA 4XBFA 4J00A 1Q1VA 4XM3A 1X4OA 3LMMA 4CZZA 2O3FA 3OR2C 2E7WA 2UUZA 3J7ZI 3HHHA 3WE2A 3DV8A 2P5VA 2WA0A 2Y2ZA 1K4TA 5HS9A 3OIQA 1WI3A 1IAWA 2W7NA 3ZQLA 2ZXWH 4OMZA 1GV5A 4LLGF 3H92A 1T0FA 3Q9VA 5D8LB 3S3MA 3H9JA 2HZDA 1X1CA 2CWEA 5J4VA 2Y9ZA 3PO2J 1QA6A 1IN7A 3GFLA 2IS1A 3PQKA 1LDDA 2G0EA 1LJ9A 2JN6A 2VBXA 4HDVA 4RGSA 5JLWA 3RCOA 4O3MA 4X0GA 3FXRA 4G7HF 3FISA 2O03A 5FKNA 1FTZA 3BR3A 3QP5A 2BHZA 1J7KA 2RGVA 2Z1DA 3FF5A 1VQ8I 2FBKA 3H0GJ 3S32A 3C7JA 2OZ6A 1GV2A 3ZMVA 1XDUA 1I1GA 4XK4A 4C3IJ 1BC7C 2MH2A 4M74A 2BY0A 3DPTA 4Y7NJ 4GYGA 3GW2A 3KEQA 2IAIA 1VQ9I 1FPQA 3LQRA 2D5VA 3GTLJ 3CJNA 2E71A 2PEXA 3A02A 2GOXB 2HU9A 1XGMA 3OYBA 5E18F 4RMNA 1FYKA 4M3DA 3FXKA 1PVEA 5JI6A 3HJEA 1O3SA 2IEKA 2VBWA 5JFRA 2V6EA 1H9TA 2VONA 2BYVE 4DW6A 4ENJA 3RYRA 2LOOA 4C2MJ 2JA6J 4MFEA 2VJJA 1ZG1A 2MYSA 1U6GA 2EINH 3PSIA 2A5WA 2PLYA 1VF9A 2BW3B 3V7SA 4GXOA 1YTYA 2BVLA 2LG4A 3S14J 4ESFA 1KU2A 4RBOA 3WU2C 2WV1A 5E3NA 2H09A 3ELKA 3OYKA 4HA8A 2HOSA 1Q1HA 3MFKA 1ZKGA 2KJCA 2VKEA 3FWEA 4BE2A 3NWSA 3K70C 1U0JA 4XRFA 2EV6A 4IZZA 4DYRA 4PJLA 4XKVA 3Q5FA 3CP2A 2HKXA 3MKZA 2IA1A 4KIGA 2ECBA 1D0ZA 3I58A 4D7NA 3L09A 3CCJI 2BEOA 1FWZA 3MKWB 2KIFA 2ZMEB 4HV6A 4OU0A 9ANTA 5EZGA 2PJRB 2EFNA 4FX4A 2DFHA 3R60A 4IHXA 4ETSA 3S16J 3DEUA 3J7YJ 1H88C 3GZNB 1MBEA 2LF7A 2WAFA 2I5UA 2JVGA 1USTA 5GPCA 3AL0B 1KYWA 3S2HJ 2CQKA 1SFUA 4IQJA 3K4NA 1EA3A 4A3MJ 2R7TA 3CC2I 3GBGA 4D0PA 1X3ZB 2ID3A 3TP3A 4YIIA 1K4SA 2DA6A 3K4CA 2JPCA 2ZSHB 3VB2A 3BR0A 1MIJA 4I98B 5EJCA 2PI0A 2Y0SN 3HOTA 3KP3A 3FZVA 3K1MA 4Y17A 4JOMA 3C2BA 3K4KA 3FMQA 3PJRA 2V6CA 3A1YA 2E1OA 1RZ4A 1FYLA 4F92B 3CCRI 4C9YA 2KDOA 4BGDA 3MEXA 1I3QJ 1OLTA 1XCVA 5FFXA 4OIOF 1XN7A 2PMHA 2BY1A 3E97A 4BQOA 4D5CA 3RYPA 1FOXA 4L18B 1WRJA 3DXJF 2VUMJ 1RR7A 4V2GA 2Q8KA 1LEAA 1QVUA 2M9HA 4PGHA 4G6QA 1EH6A 5HS8A 3S1MJ 2DJNA 4XLHA 5HLIA 5M5WJ 3D5RC 1X4PA 3CF2A 3HRUA 3PFIA 4RS8A 3F3XA 4L5JA 5D6FA 1W0UA 3HKZA 3CMYA 4M9XA 4BQNA 4E7SA 2R7DA 2VPLA 4KT5C 3DBRB 4A93J 4ENMA 1ENHA 3BZ6A 5IT9K 2DLLA 5JHFA 4MFDA 2W24A 3VWBA 1RNLA 5CVIA 2YS9A 1ETKA 4MQ9F 2FU4A 4Z2YA 1M1EB 2BY3A 3HGGA 4HZFA 5FRNA 3QPHA 3EDPA 2O6GE 4CUGA 4I7HA 2QQ8A 2DBBA 2XPVA 3IC7A 3S8PA 4A5NA 5F0FA 2I10A 3GTPJ 1SAXA 1Z7UA 2NXNB 2YU3A 1XMAA 2ZXIA 4L9NA 4X6AJ 3K4MA 2CSOA 2IVMA 1T0FC 4UNOA 1GVDA 2P4WA 3RKYA 5LEJA 3I4NJ 2MG4A 3V7RA 4BXUA 1DU6A 1UFMA 4O6JA 3OR1C 2R7VA 4W1UA 3AAFA 1V4RA 1IJWC 4ABZA 2ZXJA 2VJ4A 4LITA 1T38A 1HSJA 1X1DA 2D1VA 2LP0A 1S7EA 1YJNI 2I8DA 1VQ5I 3LSPA 1R6RA 1S6LA 1V3FA 2CV2A 1MNMC 2M2EA 1XS9A 3HZJA 1AWCA 3J80Z 1IGNA 3LSRA 3C1DA 3C2GA 3CMEI 1ON1A 2VJ5A 3K1NA 3TBIA 4GFBA 1IN5A 1KONA 2R5ZA 1BI1A 2VL8A 3DLLF 5GTIC 2XPWA 3M8JA 4E7JA 1QPMA 2M30A 1MSFC 4BJTA 5JVTA 3JRIA 4B09A 3LSMA 1IC8A 1T6SA 3JAMZ 3HOWJ 3CCUI 4BNCA 4AIKA 3ZMUA 1TT0A 1ZK8A 1HCRA 1DGRM 3SFIA 4NC7A 2OBPA 2LMDA 1ETVA 1T95A 5E3OA 2HWVA 4RM3A 1YQAA 4ZDLA 3BZCA 1FSHA 4B47A 2B7EA 1J5YA 2XAFA 1V5EA 2VQCA 3QU3A 4U88A 2R5ZB 1IN8A 3DTEA 2Q2EA 1YX3A 2MC3A 1JGGA 2L9VA 4Y4RA 3MAJA 5FLVA 5TJJA 4CYCA 1ZREA 2V1XA 2DO7A 3I53A 4E7ZA 2K27A 3VFZA 3KPHA 2W4SA 3JRAA 5E1XA 1UCRA 2R7RA 3A0BC 2R7XA 2CQNA 2ZMEC 1ZHFA 2JRTA 2NVTJ 4B8XA 1R49A 2QVOA 3ZMTA 5DS9A 3GX4X 1QHHD 1U9NA 4FTHA 3CCYA 4EM1A 2NVYJ 5EZHA 4F55A 1B59A 1XPXA 3OYLA 4YRVA 3AL0C 4QLCU 1QU3A 3CCSI 3IHUA 4OWRB 1JGSA 4MHGA 3BPXA 4RLFA 5HVQC 2CW8A 1VNDA 1OYYA 1YS6A 2NOJB 2DK5A 3F8CA 2LD5A 4CYCB 4G9YA 4FASD 3OWTA 4A0ZA 2EPFA 4JYKA 3IKTA 2IS4A 2R92J 2VKHA 2L0KA 2M4GA 3CCVI 2H8RA 2CUZA 4C3HJ 3F6VA 1SD5A 1P7JA 3I54A 3F8BA 2GBYA 3TQNA 2HS5A 2X1EA 5CQGA 1JKQC 1P4XA 1RC9A 1XB4A 2M87A 1RETA 3CZ6A 3HSRA 3Q0WA 3WTYC 2L7ZA 4RLQA 3RZOJ 3K7AJ 2A61A 1R23A 1FBQA 3MN2A 2E35A 2XIGA 3ERED 3K4JA 1F1ZA 3RQIA 3TL4X 3RSNA 2DAOA 1K61A 5LEKA 3GFJA 2D2WA 2M45A 2OQGA 2F5FA 1FEXA 5FKMA 1I6XA 2EV0A 1SFEA 4LMYA 2VLAA 4H0EA 1X19A 3OOUA 1XSXA 2JVHA 2KISA 1VQ6I 1SFKA 1MJ9A 4EMSA 3I59A 1JJ6C 3S93A 2LY9A 1U78A 1FJLA 3IWZA 1USSA 2RC4A 2XGXA 3E6MA 4A69C 2P7CB 2O5RA 4KIFA 4EJOA 5B5EC 3PO3J 4LJZF 2K9LA 3BJOA 1R1VA 3G73A 3W3CA 1AOYA 2JRMA 3ZQIA 1TQIA 1WQ2A 2OQRA 1VI0A 3IAM2 5GPAA 4M6YA 1S3JA 2L9NA 1S9HA 3GWZA 3CDLA 3ISPA 5ERIA 1QZEA 2O0YA 4HLYA 3I56I 3LAPA 4ZTFA 5FKLA 1BR4A 5K7ZA 3RQ4A 4UUSA 4BDYA 3I59B 2VXDA 1FSEA 3BTLA 3B6AA 2Z9OA 2M5WA 5HDGA 5BNGA 1UG2A 4BHPA 2JA5J 2F6CA 1YJ9I 2TRTA 1XX5A 1HDDC 5FLXK 2X6OA 2VT3A 5FLMJ 3JTHA 4CH7A 4F91B 5FRMA 1YW8A 5FKOA 1HXDA 4BY7J 5LGUA 3GTMJ 1KGSA 5CJ9A 4KMUX 3CMAI 3CDIA 1Z3YA 5D8KB 4KICA 3ZP5A 5HDNA 5B1BH 3R4KA 3NEUA 3PQJA 4XLPF 1PYVA 5CLSA 5C4JJ 3QP6A 3IRQA 4UUSB 3RIRA 4HNVA 1OCOH 3HOXJ 2L4MA 4HF2A 3Q0VA 4C30A 2WY7Q 1MMAA 2JTVA 4LFUA 2E34A 3DP7A 1I1SA 2OTJI 3IH3A 4Y3OA 4GDFA 5DM6F 2QGUA 2FJ1A 2ZB9A 3N97A 1FMVA 3QQAA 1VQKI 1LVKA 2FNAA 3JSOA 1T98A 5EEAA 3MKLA 3V7CA 5GP9A 4HQEA 2A07F 2AHQA 1B9NA 1QZZA 4WXCA 4M71A 5BS6A 1Y0UA 4MEYF 3ZR8X 1J2XA 2W85A 2KIQA 2QEXI 4BQQA 4AWXB 4QTRA 4KNYA 4N9HA 4IQ4A 2NVUB 5H20A 1MBKA 3ZXSA 4C2TA 2DFFA 3V42A 1D8JA 5LHGA 3GCMA 1YJWI 1FBUA 4IKFA 5KHDA 1W5TA 1MMSA 1F43A 4A3JJ 2RREA 2CFXA 2L9SA 5ED4A 3EUHA 4YEJA 3TKYA 1XC5A 3OS0A 2L54A 5DD4A 1IDYA 2L7MP 2UXXA 3KP4A 3SZTA 4M73A 1IG7A 3BR5A 5HODA 1W7PD 3CMMA 2DJIA 1MBGA 1TC3C 3J7AY 1BOAA 1IXRC 3BJ6A 3M8EA 5DEQA 1NH3A 3S1RJ 2P0WA 4OOIA 4U7DA 3GTGJ 3L7WA 1LUJB 4BE0A 3ABKH 2IP2A 2XGDA 1DDNA 2X48A 4UVAA 3CCMI 2JZYA 1K78A 3GXOA 2ECCA 5M3MJ 3I55I 2CH0A 3FK6A 2ME0A 3BG5A 1E3HA 3U21A 1S29A 2LRDA 2R4GA 3BLYA 1ERDA 3T1BA 1OCPA 1V5FA 3BG6A 3UNGC 2HOEA 2A6HF 4ZC3A 1OKRA 3M1CA 1B72A 5LRRA 2DA2A 1MJBA 4Y13A 4IEJA 4HAMA 3JW4A 1ZGJA 4BUPA 2LSOA 3K69A 2VQGA 4JX6A 2L7FP 3KLNA 6PAXA 4RB0A 4HF1A 5TGTA 1K78B 2V9PA 3LA2A 1FY7A 1ZN2A 4OMYA 2QQAA 1HA8A 3OOPA 3HOUJ 1QO0D 1WJDA 3C3WA 2XRNA 2FQ4A 3F9KA 1WFXA 4XMYA 3I64A 3KEYA 2CYYA 3W2AA 2H8WA 4RA2A 3H5NA 5FKKA 5LHIA 1B72B 1JT6A 3OYIA 5LD2C 2B0LA 5FD5A 3KZIC 3DWLE 4BYYA 4QPQA 1NK2P 5K7FA 2BV6A 3AFHA 1YLFA 1TWAJ 3Q3SA 3BQYA 4BJ6C 2NS7A 5FLXZ 4EV0A 4P5OA 1OJLA 3QPSA 2F4OB 1MBJA 4MTDA 5KNLA 3PUBA 1HKSA 2FF4A 1VQOI 1TT5B 1JE8A 2GLOA 2RNGA 2HDCA 3G3ZA 1FLIA 5C4XJ 3UKGA 4HF0A 5J3LA 1MNDA 4IXAA 2ZJQF 3HRMA 4U7BA 1FMWA 1GXPA 1UHMA 4XOPA 1H8AC 4AM3A 3DU5A 4NC6A 1WVRA 1G59A 2V9KA 1R1UA 2RN7A 3SDGA 2WV0A 3G4SI 1KQ8A 2YX4A 3ZQHA 3CUQC 2LFBA 2IRFG 3D0SA 4GGGA 3DLAA 2A05A 1GXQA 4N9IA 3WTZA 3E0JB 4BHCA 3MZHA 3FXJA 5M5YJ 1WSUA 4LG0A 4ZZLA 2PMZA 1P4AA 1ODDA 2ZKZA 3ZMSA 2K40A 1PUFA 3DTKA 2KZVA 1A6IA 4UHTA 3WGIA 1AU7A 3M7GA 3HOZJ 2CW7A 3OSFA 1ITYA 3EQLF 3KP5A 2V1DA 3DKYA 3HYIA 1V5GA 2X9DA 2M7BA 4Y15A 1REPC 1WJAA 3VDXA 4AIHA 2WAQA 4B3AA 4CXFA 5GADJ 1IXSB 1T2KA 4LB6B 2DOAA 4F7ZA 1Z67A 2DU9A 2IGOA 3HIFA 3TOBA 3WHCA 5IOYA 2RDPA 3L2WA 4HQMA 2LTPA 1AHDP 2E60A 3ZN0A 3BG7A 4LG0B 4UUTA 2P6SA 1WWXA 4FHTA 4AVPA 4IRIA 4BBSJ 3SJMA 1PUFB 3BR1A 3BP8A 2LF8A 1R5ID 3EPZA 3P9KA 3BJAA 1D5YA 1CGPA 1ZRFA 4N0BA 4KYWA 4M3BA 1DPRA 5E1ZB 4WK8F 2DXIA 1G3TA 4IHWA 4F3QA 2PJPA 2ISZA 1Y1WJ 2DTZA 3KLOA 4XKWA 5E79C 4HYEA 4PUSA 2VB6A 4I02A 5B3SH 4LK1F 2LH9A 1ZGWA 4UB8C 5KK1A 4C2UA 2YU9J 3RJPA 4BY1J 3VOEA 1L0OC 3U9GA 2EA2A 3K2ZA 2LKXA 4A2UA 4L0YB 1YOVB 3CF5F 1VQLI 2M7AA 3HRTA 4WXHA 2LVSA 4RB1A 1BR2A 3KFWX 5IYDJ 1RKTA 4UY8I 1E3PA 1JTXA 2KHMA 1MMDA 2BW3A 2DI3A 2QKLB 3CO7C 2CRGA 2IJLA 2OZUA 2E2IJ 2VC0A 3NWTA 4RGRA 4LLLA 4DBRA 2OCCH 3K9TA 5F6FA 2RAEA 2NNYA 1MMNA 1HKTA 4HNUA 4N4OB 4QPOA 4D9JA 1F4KA 1A36A 4A3GJ 3EUHC 3F21A 3H5AA 2CGPA 4V19K 2EZIA 4HBLA 5CVJA 1ZR2A 3CD6I 2OC6A 3FMSA 4KT6A 3V4GA 4II2A 5BOXA 1U2WA 2ZMEA 1FZPB 3V8JA 1VQ4I 3TDUC 2PJRA 1WH5A 3DQVC 4FE4A 3J80K 2DA1A 3E5XA 3QAHA 4PSWA 2W82A 4S04A 2K3FA 5IYBJ 3ZMDA 3B6CA 3O3KA 5K1YA 1ETOA 3SZGA 4D7MA 2VBYA 1DP3A 5DYMA 2DN0A 2DQRA 2MD0A 2QZ8A 4DBQA 1R58A 4MGRA 4B4CA 3ZOBA 4NHJA 2X6YA 5TRDA 1FT9A 1HF0A 2MGQA 4QWQA 3HOSA 3KCCA 5J1UA 3BTCA 1Y8QB 3JAMK 2KP6A 2CUJA 1T33A 3BY6A 5CKTA 2LKSA 4DNCA 3IV5A 5L3EA 2QWWA 2K9NA 1ETWA 4HX7A 1G8XA 2DCEA 5IOZA 2CQXA 4RAGA 3F72A 1MSEC 4M72A 4I09A 2E19A 3BQZA 1N77A 3GZ5A 1OYIA 4O5VA 2XVCA 5L3BA 1ZH5A 2LR8A 2IS6A 3S1NJ 3HHGA 4F93B 2YR2A 4UVBA 3S2WA 2L01A 2A6EF 5B66C 2M34A 3T5XA 5HNHA 2O8KA 4G7OF 1RUOA 4QSHA 3B73A 1HW5A 3TO9A 3ABTA 1POGA 4R8HA 2MLGA 4A0XA 3HOYJ 2FA5A 2FQ3A 2YX7A 3SDBA 1SD6A 3MCZA 2P5KA 2VKDA 3NRVA 3FKJA 3CQZJ 2WWYA 3CC7I 5FB2A 3FMRA 2PBIA 4MTEA 1O4XA 1LEBA 1ULYA 3IP4B 3NARA 4A3LJ 1PP7U 1H0MA 2KIUA 1Y56A 2WC2A 4I01A 3FXLA 3LSTA 2DDAA 3KX2A 2D1HA 2A6TA 3AG1H 3BWGA 2L3DA 4HV5A 4D5FA 5ICGA 2Y9YA 5E1WA 3V8LA 2ZXHA 3A2KA 2YUSA 5FD6A 3GYHX 1IZ1A 1OR7A 1XDSA 2VI6A 3ASNH 4FX0A 5A2QZ 1I39A 2NNNA 4EJUA 1YFHA 1IV6A 2EIMH 3HPGA 1FP2A 2DT7B 5HLHA 1BC8C 2OTLI 2E7XA 3E6DA 2LK2A 2HNHA 1XSVA 3UR3C 1JJ8C 2NOGA 2XDVA 4Q47A 1I5ZA 4MNUA 4A3CJ 4XICA 4KUMA 3HGYA 2UV1A 1MBHA 4A12A 1DPUA 3FBIB 4LOCA 3FIWA 4IRHA 3Q0UA 3K10A 3OV8A 3T0YA 3FX3A 5BPDA 1Z6RA 2BOLA 4RAZA 5E20A 2EK5A 1YG2A 1OCTC 2F5EA 3QYBA 2ACJA 3EYYA 3WG9A 3W2WA 2V7FA 1GLNA 3WTTC 2FMLA 1A6QA 2H94A 1X3WB 1TWFJ 5DUKA 3IRRA 3GFMA 3QRFF 1YW7A 2Y75A 4DZPA 5FFZA 5EF6A 2R7FA 3PSFA 3KYCB 2COBA 1K83J 1P4WA 3OL3A 3LQQA 4JBAA 4IL6C 4DQ2A 3BG9A 4OIQF 1BJZA 4HG2A 2FNPA 5CPRB 1Z3XA 2EJRA 4XONA 4WCGA 1K6OA 1BI2A 3J7AO 3F8MA 2HVRA 2A3SA 4CCLA 2L2OA 4PJNA 3T8TA 2WBMA 4XNFA 3E5UA 1SMYF 1LFPA 2FBIA 2K7LA 4LK0F 1R22A 4EM0B 2KPMA 1N78A 4B44A 1FTTA 4XLEA 4BL0B 2K3PA 3OL4A 4UUVA 2FXAA 1A31A 4CHUA 1BJAA 5DD8A 4PJ0C 1QRYA 1Y1VJ 1W36D 4BU2A 5ICEA 5L3FA 5J40A 2PMZN 1GT0C 1I6HJ 5KVRA 4XL9A 5D4SA 2W48A 3LSHA 3LOCA 3TW7A 2OPTA 2RVCA 2PN6A 4AU7A 3LSGA 4ZJZA 5FO5A 3RZDJ 1IRFA 2GXGA 4IRGA 1D3YA 3HB9A 4XIDA 2G9WA 4XR6A 3CCLI 3LSKA 2WAQN 2BHYA 2RV8A 3H3UA 3QPTA 1QGPA 4DOZA 2J5OA 1LKXA 1ZARA 4G6DA 3WU1B 4BKXA 2FEZA 4B43A 3I71A 5EYRA 1ZTRA 2EH3A 4L9VA 3RPUD 5KCMA 3H36A 2CG4A 2DA5A 2H1LA 1P2FA 3MD2A 1J9IA 1G4DA 4J01A 2R5YA 1TLHB 2NS0A 2K4BA 4HSRA 4DIQA 4YFKF 2EBIA 3SEZA 4IX7A 5DDGA 4A6DA 1U3EM 1KQ9A 1KZHA 1OCZH 1KU9A 3TO6A 5CQEA 5EEGA 2GXBA 4HX4A 1Z21A 2XAUA 3OIOA 2O9LA 2VOPA 4IOCF 2XB0X 2HQRA 3S1QJ 2EB7A 4AVZA 1W36C 2EZLA 3FXUA 2CUEA 3X2QH 1JKRC 1O3TA 3QPLA 3SFZA 4M9ZA 1W0TA 2MABA 1FOYA 1W7PA 3E1SA 1W5CC 4ESBA 2X1CA 1SEUA 3ZQQA 4JX5A 3WTUC 2WB1A 3OYJA 2QLZA 1P7IA 1LPQA 1H9GA 2KKOA 2R5YB 1EKEA 2OJED 4CO8A 3PM1A 1BOBA 2HFHA 4R79A 3HXLA 2X6WA 4FCYA 4ZDOA 3Q9SA 4RAFA 1J09A 1Y8RB 1Z77A 3EUKL 4LLNA 1R00A 2E5NA 2IBDA 3FM5A 2D45A 2XF6A 2TDXA 2BY2A 2HEOA 3VYUB 2XAJA 3QOEA 4CCJA 2M1BA 3U1KA 3CC4I 4EJTA 2E1MB 4PZJA 1W7PB 2FOKA 3VYSB 2ME6A 2LBFB 3BG3A 1XSDA 2C6YA 1P6RA 4KITB 2ISYA 1UMQA 4IJAA 2EA4A 3M1EA 4HPQA 3E6BA 3CUQA 2LKPA 2XPUA 4EGYA 1UAAA 4CDGA 3W6KB 1QBJA
chains in the Genus database with same CATH topology
4JX6A 5IP9J 2L7FP 4B1RA 1HOMA 1IRZA 4M3DA 2DMQA 2IEKA 4Y52J 1GUUA 4DW6A 2QCOA 3JRDA 3ZQGA 1X2NA 4C2MJ 2CJJA 2JA6J 3HOUJ 4MFEA 1U9OA 3GTQJ 1UHSA 2FQ4A 4I76A 1AKHA 1E3OC 5FKKA 1B72B 1JT6A 3W6VA 1VF9A 3MVPA 3S14J 4FISA 4RBOA 3HBLA 5K7FA 1NK2P 2WV1A 5E3NA 2HOSA 1TWAJ 1LE8A 1ZKGA 3BQYA 3Q3SA 2VKEA 2NS7A 5C44J 2XGEA 1OJLA 3QPSA 4XRSG 1MBJA 2E2HJ 2KT0A 4MIMA 2GLOA 4DYRA 3IH4A 1XG1A 5C4XJ 3UKGA 5J3LA 3LSJA 3TP0A 1QVTA 1H8AC 5FJ8J 4M6VA 2ECBA 5F0HA 5DTDA 4D7NA 2EQRA 1AKHB 3TEDA 3TW6A 3SDGA 9ANTA 5EZGA 3ZQHA 4IHVA 2LFBA 3HEFA 3OSGA 2R7ZJ 1R9TJ 4IHXA 3S16J 2JA8J 5E3LA 1H88C 1HDPA 1MBEA 1LE8B 5M5YJ 5GPCA 3IH2A 4EEFG 3S2HJ 5EGOA 4A3MJ 2K40A 1PUFA 1A6IA 3GBGA 1AU7A 3HOZJ 2ID3A 3TP3A 3OSFA 2JMWA 2DA6A 2M8GX 1ITYA 3O8GA 3BR0A 4MLOA 2Y0SN 1I50J 3JRHA 2X9DA 2H1KA 4BBRJ 1VFCA 3K2AA 4B3AA 1SANA 3C2BA 2MW8A 2B63J 1TWHJ 1HLVA 2E1OA 5IP6A 3WHCA 3E7LA 1I3QJ 3HKZN 1WCMJ 5IOYA 3JREA 1APLC 2LTPA 1AHDP 1X58A 5JLXA 2EZKA 4UUTA 5EGOB 4BBSJ 4D5CA 3SJMA 1PUFB 3BR1A 1JKOC 1D5YA 2LLKA 4M3BA 2VUMJ 1RR7A 4V2GA 3S17J 2L9RA 2FD5A 1QVUA 2M9HA 5EG0B 4IHWA 3S1MJ 2DJNA 2M0CA 4DZJA 5M5WJ 1Y1WJ 2DTZA 1YRNA 1W0UA 3CMYA 1ZGWA 1ETYA 2YU9J 4BY1J 1WPKA 3M4OJ 4A3DJ 2LKXA 4A93J 3BT9A 1ENHA 2HOAA 2NVXJ 2NS8A 4V2FA 2DMPA 2LVSA 4MFDA 2YS9A 4JP0A 5IYDJ 1ETKA 1IDZA 1RKTA 2XRLA 5M3FJ 1JTXA 3HGGA 3A01A 1JKPC 3HOVJ 3G1MA 2XPVA 2CRGA 1FIAA 2E2IJ 5F0FA 2I10A 4A3EJ 3GTPJ 2OF7A 3O8HA 1YRNB 1DU0A 3ZQFA 4X6AJ 2RAEA 1GVDA 3I4NJ 2MG4A 4A3GJ 1DU6A 1RPWA 5J1YA 2ID6A 4W1UA 3HDDA 1IJWC 2JWTA 2EZIA 4ABZA 1ZR2A 4X1EA 2LP0A 1S7EA 1OFCX 3GTOJ 4BXXJ 3A01B 3LSPA 2HYJA 1WH5A 4FE4A 1H89C 2DA1A 2M2EA 1MNMC 1XS9A 5IYBJ 1IGNA 3ZQCA 3LSRA 2R93J 1RKWA 3B6CA 4I6ZA 1ETOA 4GFBA 4D7MA 5J1RA 3JRCA 2DN0A 2R5ZA 4DYQA 2DA4A 4B4CA 3ZOBA 1BW5A 2XPWA 1HF0A 2MGQA 5J1UA 1MSFC 3BTCA 3JRIA 1IUFA 1IC8A 1T33A 3HOWJ 1JTYA 4MO7A 4IHYA 3IV5A 5E3MA 3S2DJ 2K9NA 1ETWA 1ZK8A 1HCRA 3SFIA 1WGXA 5IOZA 2CQXA 1ETVA 3BTJA 5E3OA 4W97A 1MSEC 2HQ5A 3FK7A 2E19A 2P81A 2R0QC 3BQZA 5IYCJ 4RDUA 2FX0A 3JR9A 1U8BA 2E2JJ 2DMTA 2R5ZB 2DMNA 2LR8A 5F04A 1JGGA 3S1NJ 1JT0A 1MH3A 5FLVA 1MH4A 4CYCA 2M34A 1BL0A 5EG0A 3JRAA 2O8KA 3GTJJ 1GDTA 1RESA 1CQTA 2NVTJ 4QSHA 1WH7A 3BR2A 5DS9A 1MBFA 1U9NA 1POGA 4FTHA 3CCYA 1ORKA 1ZQ3P 2NVYJ 5EZHA 3L1PA 3HOYJ 2GM4A 3HM5A 2XGCA 2Y30A 3H3VK 2WB1N 3CQZJ 1G2HA 3F0CA 4G12A 1VNDA 2JJ7A 2LD5A 4CYCB 1O4XA 3DCFA 3BTIA 4A3BJ 3G1OA 3NARA 4NDLA 4A3LJ 3WHBA 1TWGJ 4A3FJ 4JYKA 2R92J 2L0KA 4M3GA 2QF7A 4D5FA 2H8RA 2Y9YA 4C3HJ 5C3EJ 2VKVA 2YUSA 1QPIA 5IPAA 1P7JA 2HI3A 2GBYA 1BA5A 2CU7A 1ETXA 2KDZA 2VI6A 2XSDC 2HXOA 1JKQC 1IV6A 1RETA 3Q0WA 2L7ZA 4S0HB 1SFOJ 3S15J 2LK2A 3I4MJ 3RZOJ 3K7AJ 4XRSA 3MN2A 1JJ8C 2NOGA 2O7OA 3RQIA 4A3CJ 1K61A 4XICA 4AYBN 5IP7J 1FEXA 1JUMA 3HGYA 5FKMA 1MBHA 2HDDA 4LOCA 4QIWN 3FIWA 3Q0UA 1NTCA 3OOUA 1OCTC 2JK3A 1JJ6C 3NAUA 2LY9A 1U78A 1FJLA 1TWFJ 4A69C 3VPRA 4L5EA 4DZPA 5EF6A 3PO3J 3G1LA 1NK3P 2COBA 1K83J 2DMUA 3ZQIA 5F08A 1VI0A 2Y31A 5GPAA 5EDNA 3BG9A 1B8IA 1ZR4A 1BJZA 3CDLA 3JRGA 1X2MA 5F1JA 5FKLA 1JUPA 5K7ZA 1T56A 4UUSA 2N8GA 3BTLA 3B6AA 2ELKA 3JRBA 5BNGA 1UG2A 2MSYA 2NVQJ 5M5XJ 2JA5J 1EF4A 1FTTA 2TRTA 1HDDC 2X6OA 3BR6A 1FIPA 5FLMJ 1LFUP 1LFBA 1QRYA 1Y1VJ 5FKOA 4M3FA 4BY7J 1Z0XA 3GTMJ 3DEWA 4A3IJ 1B8IB 2PMZN 3JRFA 1GT0C 1I6HJ 4FE7A 1BW6A 1F36A 2W48A 2DA7A 4AC0A 3LOCA 3TW7A 2OPTA 3LSGA 3LNQA 3RZDJ 5C4JJ 3HB9A 4XIDA 2TCTA 4UUSB 4HNVA 3HOXJ 3Q0VA 1TWCJ 4DYCA 3A03A 5F0CA 5F27A 2WAQN 3FKIJ 3D1NI 3IH3A 2XB5A 2FJ1A 2ZB9A 4BKXA 4J19A 4XRMA 2HXIA 5EYRA 1ZTRA 2DA3A 2EH3A 3QQAA 2EZHA 5EEAA 4C3JJ 3MKLA 2DA5A 5GP9A 2AO9A 2AHQA 2CQQA 2CUFA 2R5YA 1Q1VA 2EBIA 4QTRA 2Y2ZA 1WI3A 3ZQLA 1MBKA 3OIOA 1GV5A 1ETQA 2O9LA 3M3YJ 2XB0X 3S1QJ 1F43A 4A3JJ 2Y9ZA 3PO2J 2EZLA 3RKQA 4A3KJ 1XC5A 2CUEA 1JKRC 1IDYA 3QPLA 1W0TA 2L7MP 2G0EA 2JN6A 5JLWA 1IG7A 4JX5A 3BR5A 5HODA 4AUXA 1MBGA 1P7IA 1TC3C 3FISA 1JUSA 2R5YB 3S1RJ 3PM1A 1A5JA 5FKNA 1FTZA 3BR3A 4FCYA 3GTGJ 1Z77A 2XGDA 3GTKJ 2IBDA 2X48A 2HOTA 3H0GJ 1GV2A 2ECCA 5K7HA 5M3MJ 3FK6A 4XK4A 4C3IJ 2ME0A 2JA7J 3BG5A 2K9SA 2K9QA 2VPRA 4JX4A 2ME6A 4Y7NJ 1OCPA 3BG3A 2IAIA 1UMQA 1B72A 2DA2A 2D5VA 3GTLJ 4IEJA 2XPUA 4M3EA 3A02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JX6 A;  5IP9 J;  2L7F P;  4B1R A;  1HOM A;  1IRZ A;  4M3D A;  2DMQ A;  2IEK A;  4Y52 J;  1GUU A;  4DW6 A;  2QCO A;  3JRD A;  3ZQG A;  1X2N A;  4C2M J;  2CJJ A;  2JA6 J;  3HOU J;  4MFE A;  1U9O A;  3GTQ J;  1UHS A;  2FQ4 A;  4I76 A;  1AKH A;  1E3O C;  5FKK A;  1B72 B;  1JT6 A;  3W6V A;  1VF9 A;  3MVP A;  3S14 J;  4FIS A;  4RBO A;  3HBL A;  5K7F A;  1NK2 P;  2WV1 A;  5E3N A;  2HOS A;  1TWA J;  1LE8 A;  1ZKG A;  3BQY A;  3Q3S A;  2VKE A;  2NS7 A;  5C44 J;  2XGE A;  1OJL A;  3QPS A;  4XRS G;  1MBJ A;  2E2H J;  2KT0 A;  4MIM A;  2GLO A;  4DYR A;  3IH4 A;  1XG1 A;  5C4X J;  3UKG A;  5J3L A;  3LSJ A;  3TP0 A;  1QVT A;  1H8A C;  5FJ8 J;  4M6V A;  2ECB A;  5F0H A;  5DTD A;  4D7N A;  2EQR A;  1AKH B;  3TED A;  3TW6 A;  3SDG A;  9ANT A;  5EZG A;  3ZQH A;  4IHV A;  2LFB A;  3HEF A;  3OSG A;  2R7Z J;  1R9T J;  4IHX A;  3S16 J;  2JA8 J;  5E3L A;  1H88 C;  1HDP A;  1MBE A;  1LE8 B;  5M5Y J;  5GPC A;  3IH2 A;  4EEF G;  3S2H J;  5EGO A;  4A3M J;  2K40 A;  1PUF A;  1A6I A;  3GBG A;  1AU7 A;  3HOZ J;  2ID3 A;  3TP3 A;  3OSF A;  2JMW A;  2DA6 A;  2M8G X;  1ITY A;  3O8G A;  3BR0 A;  4MLO A;  2Y0S N;  1I50 J;  3JRH A;  2X9D A;  2H1K A;  4BBR J;  1VFC A;  3K2A A;  4B3A A;  1SAN A;  3C2B A;  2MW8 A;  2B63 J;  1TWH J;  1HLV A;  2E1O A;  5IP6 A;  3WHC A;  3E7L A;  1I3Q J;  3HKZ N;  1WCM J;  5IOY A;  3JRE A;  1APL C;  2LTP A;  1AHD P;  1X58 A;  5JLX A;  2EZK A;  4UUT A;  5EGO B;  4BBS J;  4D5C A;  3SJM A;  1PUF B;  3BR1 A;  1JKO C;  1D5Y A;  2LLK A;  4M3B A;  2VUM J;  1RR7 A;  4V2G A;  3S17 J;  2L9R A;  2FD5 A;  1QVU A;  2M9H A;  5EG0 B;  4IHW A;  3S1M J;  2DJN A;  2M0C A;  4DZJ A;  5M5W J;  1Y1W J;  2DTZ A;  1YRN A;  1W0U A;  3CMY A;  1ZGW A;  1ETY A;  2YU9 J;  4BY1 J;  1WPK A;  3M4O J;  4A3D J;  2LKX A;  4A93 J;  3BT9 A;  1ENH A;  2HOA A;  2NVX J;  2NS8 A;  4V2F A;  2DMP A;  2LVS A;  4MFD A;  2YS9 A;  4JP0 A;  5IYD J;  1ETK A;  1IDZ A;  1RKT A;  2XRL A;  5M3F J;  1JTX A;  3HGG A;  3A01 A;  1JKP C;  3HOV J;  3G1M A;  2XPV A;  2CRG A;  1FIA A;  2E2I J;  5F0F A;  2I10 A;  4A3E J;  3GTP J;  2OF7 A;  3O8H A;  1YRN B;  1DU0 A;  3ZQF A;  4X6A J;  2RAE A;  1GVD A;  3I4N J;  2MG4 A;  4A3G J;  1DU6 A;  1RPW A;  5J1Y A;  2ID6 A;  4W1U A;  3HDD A;  1IJW C;  2JWT A;  2EZI A;  4ABZ A;  1ZR2 A;  4X1E A;  2LP0 A;  1S7E A;  1OFC X;  3GTO J;  4BXX J;  3A01 B;  3LSP A;  2HYJ A;  1WH5 A;  4FE4 A;  1H89 C;  2DA1 A;  2M2E A;  1MNM C;  1XS9 A;  5IYB J;  1IGN A;  3ZQC A;  3LSR A;  2R93 J;  1RKW A;  3B6C A;  4I6Z A;  1ETO A;  4GFB A;  4D7M A;  5J1R A;  3JRC A;  2DN0 A;  2R5Z A;  4DYQ A;  2DA4 A;  4B4C A;  3ZOB A;  1BW5 A;  2XPW A;  1HF0 A;  2MGQ A;  5J1U A;  1MSF C;  3BTC A;  3JRI A;  1IUF A;  1IC8 A;  1T33 A;  3HOW J;  1JTY A;  4MO7 A;  4IHY A;  3IV5 A;  5E3M A;  3S2D J;  2K9N A;  1ETW A;  1ZK8 A;  1HCR A;  3SFI A;  1WGX A;  5IOZ A;  2CQX A;  1ETV A;  3BTJ A;  5E3O A;  4W97 A;  1MSE C;  2HQ5 A;  3FK7 A;  2E19 A;  2P81 A;  2R0Q C;  3BQZ A;  5IYC J;  4RDU A;  2FX0 A;  3JR9 A;  1U8B A;  2E2J J;  2DMT A;  2R5Z B;  2DMN A;  2LR8 A;  5F04 A;  1JGG A;  3S1N J;  1JT0 A;  1MH3 A;  5FLV A;  1MH4 A;  4CYC A;  2M34 A;  1BL0 A;  5EG0 A;  3JRA A;  2O8K A;  3GTJ J;  1GDT A;  1RES A;  1CQT A;  2NVT J;  4QSH A;  1WH7 A;  3BR2 A;  5DS9 A;  1MBF A;  1U9N A;  1POG A;  4FTH A;  3CCY A;  1ORK A;  1ZQ3 P;  2NVY J;  5EZH A;  3L1P A;  3HOY J;  2GM4 A;  3HM5 A;  2XGC A;  2Y30 A;  3H3V K;  2WB1 N;  3CQZ J;  1G2H A;  3F0C A;  4G12 A;  1VND A;  2JJ7 A;  2LD5 A;  4CYC B;  1O4X A;  3DCF A;  3BTI A;  4A3B J;  3G1O A;  3NAR A;  4NDL A;  4A3L J;  3WHB A;  1TWG J;  4A3F J;  4JYK A;  2R92 J;  2L0K A;  4M3G A;  2QF7 A;  4D5F A;  2H8R A;  2Y9Y A;  4C3H J;  5C3E J;  2VKV A;  2YUS A;  1QPI A;  5IPA A;  1P7J A;  2HI3 A;  2GBY A;  1BA5 A;  2CU7 A;  1ETX A;  2KDZ A;  2VI6 A;  2XSD C;  2HXO A;  1JKQ C;  1IV6 A;  1RET A;  3Q0W A;  2L7Z A;  4S0H B;  1SFO J;  3S15 J;  2LK2 A;  3I4M J;  3RZO J;  3K7A J;  4XRS A;  3MN2 A;  1JJ8 C;  2NOG A;  2O7O A;  3RQI A;  4A3C J;  1K61 A;  4XIC A;  4AYB N;  5IP7 J;  1FEX A;  1JUM A;  3HGY A;  5FKM A;  1MBH A;  2HDD A;  4LOC A;  4QIW N;  3FIW A;  3Q0U A;  1NTC A;  3OOU A;  1OCT C;  2JK3 A;  1JJ6 C;  3NAU A;  2LY9 A;  1U78 A;  1FJL A;  1TWF J;  4A69 C;  3VPR A;  4L5E A;  4DZP A;  5EF6 A;  3PO3 J;  3G1L A;  1NK3 P;  2COB A;  1K83 J;  2DMU A;  3ZQI A;  5F08 A;  1VI0 A;  2Y31 A;  5GPA A;  5EDN A;  3BG9 A;  1B8I A;  1ZR4 A;  1BJZ A;  3CDL A;  3JRG A;  1X2M A;  5F1J A;  5FKL A;  1JUP A;  5K7Z A;  1T56 A;  4UUS A;  2N8G A;  3BTL A;  3B6A A;  2ELK A;  3JRB A;  5BNG A;  1UG2 A;  2MSY A;  2NVQ J;  5M5X J;  2JA5 J;  1EF4 A;  1FTT A;  2TRT A;  1HDD C;  2X6O A;  3BR6 A;  1FIP A;  5FLM J;  1LFU P;  1LFB A;  1QRY A;  1Y1V J;  5FKO A;  4M3F A;  4BY7 J;  1Z0X A;  3GTM J;  3DEW A;  4A3I J;  1B8I B;  2PMZ N;  3JRF A;  1GT0 C;  1I6H J;  4FE7 A;  1BW6 A;  1F36 A;  2W48 A;  2DA7 A;  4AC0 A;  3LOC A;  3TW7 A;  2OPT A;  3LSG A;  3LNQ A;  3RZD J;  5C4J J;  3HB9 A;  4XID A;  2TCT A;  4UUS B;  4HNV A;  3HOX J;  3Q0V A;  1TWC J;  4DYC A;  3A03 A;  5F0C A;  5F27 A;  2WAQ N;  3FKI J;  3D1N I;  3IH3 A;  2XB5 A;  2FJ1 A;  2ZB9 A;  4BKX A;  4J19 A;  4XRM A;  2HXI A;  5EYR A;  1ZTR A;  2DA3 A;  2EH3 A;  3QQA A;  2EZH A;  5EEA A;  4C3J J;  3MKL A;  2DA5 A;  5GP9 A;  2AO9 A;  2AHQ A;  2CQQ A;  2CUF A;  2R5Y A;  1Q1V A;  2EBI A;  4QTR A;  2Y2Z A;  1WI3 A;  3ZQL A;  1MBK A;  3OIO A;  1GV5 A;  1ETQ A;  2O9L A;  3M3Y J;  2XB0 X;  3S1Q J;  1F43 A;  4A3J J;  2Y9Z A;  3PO2 J;  2EZL A;  3RKQ A;  4A3K J;  1XC5 A;  2CUE A;  1JKR C;  1IDY A;  3QPL A;  1W0T A;  2L7M P;  2G0E A;  2JN6 A;  5JLW A;  1IG7 A;  4JX5 A;  3BR5 A;  5HOD A;  4AUX A;  1MBG A;  1P7I A;  1TC3 C;  3FIS A;  1JUS A;  2R5Y B;  3S1R J;  3PM1 A;  1A5J A;  5FKN A;  1FTZ A;  3BR3 A;  4FCY A;  3GTG J;  1Z77 A;  2XGD A;  3GTK J;  2IBD A;  2X48 A;  2HOT A;  3H0G J;  1GV2 A;  2ECC A;  5K7H A;  5M3M J;  3FK6 A;  4XK4 A;  4C3I J;  2ME0 A;  2JA7 J;  3BG5 A;  2K9S A;  2K9Q A;  2VPR A;  4JX4 A;  2ME6 A;  4Y7N J;  1OCP A;  3BG3 A;  2IAI A;  1UMQ A;  1B72 A;  2DA2 A;  2D5V A;  3GTL J;  4IEJ A;  2XPU A;  4M3E A;  3A02 A; 
#chains in the Genus database with same CATH topology
 1ZLJ A;  3DBL B;  3SHF A;  4DJA A;  5LRS A;  1PUE E;  3I5U A;  1HOM A;  4Q5S F;  1XMK A;  3DEE A;  4PJM A;  2XRO A;  1Z1D A;  5D6E A;  1G3Y A;  3RDI A;  2DMQ A;  4P1W A;  4Y52 J;  4Q4Z F;  2X85 A;  1S7O A;  4I99 C;  2CV0 A;  1O3Q A;  1X2N A;  3I9V 2;  2F4M B;  1KA8 A;  2O61 A;  3WTS C;  1U9O A;  3GTQ J;  1MKM A;  1FOK A;  1ZRD A;  1NHA A;  2ZO4 A;  1OR7 C;  4RGX A;  1WKM A;  1AKH A;  4A6E A;  3OYM A;  3W6V A;  3CUQ B;  2LC2 A;  4FIS A;  5FRO A;  1UEL B;  2PX9 A;  3HBL A;  1R5H A;  3P5J A;  4BJ5 C;  4NNJ A;  1LE8 A;  1S7A A;  2ICW G;  5D5X B;  5C44 J;  2DPU A;  2E2H J;  2KT0 A;  1RUN A;  1QQI A;  3CES A;  1TBX A;  3IKV A;  3L9F A;  4MIM A;  5HS7 A;  3R6S A;  3IH4 A;  4HLX A;  3DF8 A;  1XG1 A;  4BS9 A;  3LSJ A;  3TP0 A;  1QVT A;  4I0B A;  4M6V A;  5F0H A;  5DTD A;  3TMO A;  2EQR A;  1AKH B;  1CF7 B;  2Q0O A;  5ICF A;  4IHV A;  1WHU A;  1DP7 P;  1FP1 D;  2FUG 2;  2EFW A;  5JVG F;  3WTV C;  1R9T J;  2JA8 J;  3SXY A;  5LBQ A;  1OQY A;  2H6C A;  1LE8 B;  5B1A H;  3H1C A;  3IH2 A;  4EEF G;  5EGO A;  3PNV A;  1F5T A;  2CS3 A;  4OAY A;  1ZLK A;  3LFK A;  4UV9 A;  2R3S A;  3D5S C;  4BAY A;  3ZPL A;  1FNN A;  2JMW A;  3L2C A;  4U0W A;  4MLO A;  1ON2 A;  1VQP I;  4HW0 A;  4WX9 A;  2EFO A;  1VFC A;  1VQM I;  3OYN A;  3K2A A;  4NBQ A;  4D1Q A;  4CGZ A;  2OA4 A;  4M9S A;  4HRI A;  2LDU A;  1TWH J;  1IRX A;  4CCN A;  5IP6 A;  4JK1 X;  4IO9 F;  5IY5 H;  3E7L A;  3HKZ N;  4CCM A;  1BIA A;  1TP4 A;  2BXZ A;  5AIP A;  1SMT A;  1X3U A;  2DK8 A;  2X6X A;  2KRF A;  5EGO B;  4KDP A;  1T8I A;  3ABU A;  1JKO C;  1PJR A;  1ZGA A;  2GXA A;  2DOE A;  4BDZ A;  3S17 J;  1IW7 F;  2FD5 A;  1FX7 A;  5EG0 B;  4YG2 F;  2X0L A;  2HKO A;  3F8F A;  5BMZ A;  4BAC A;  3BDD A;  2K9M A;  3CUO A;  3OYE A;  2DQL A;  1YRN A;  1D8K A;  3M07 A;  4CIC A;  2KFD A;  2ZC2 A;  4A3D J;  2P8T A;  3BT9 A;  2HOA A;  3S3N A;  4G94 A;  2NS8 A;  2NVX J;  4V2F A;  1Z9C A;  1EH7 A;  1FBS A;  3CTA A;  3KP2 A;  3HL2 A;  4ZTJ A;  3KEO A;  5M3F J;  5GAE J;  3OYF A;  3RKX A;  3A01 A;  1JKP C;  4XOR A;  1IV8 A;  3G1M A;  2EWN A;  3MZY A;  2Y48 A;  2E5Z A;  5ILU A;  3C2H A;  1F9N A;  3GME A;  4A3E J;  2KJB A;  4ZH4 F;  3O8H A;  1YRN B;  5ILS A;  2QYO A;  3OYD A;  3COA C;  4E70 A;  3J81 K;  2M4K A;  1O7F A;  3PIP F;  2K4J A;  1DQU A;  4NC8 A;  1EH8 A;  5J1Y A;  2ID6 A;  3BC8 A;  1YS7 A;  4F52 A;  3HDD A;  2JWT A;  2E1M C;  3MMY B;  2JT1 A;  3LSI A;  4X1E A;  4EAT A;  5LLQ A;  3VSL A;  3HG9 A;  1OFC X;  1O3R A;  4XQF A;  4BXX J;  3A01 B;  2XF7 A;  1DGW Y;  2HYJ A;  5K5R A;  2F5V A;  1ACI A;  3G2B A;  3PNY A;  3KP7 A;  3ZQC A;  3NQO A;  4L9T A;  1G3W A;  4I6Z A;  2STW A;  2DFE A;  4FQG A;  4KMF A;  5J1R A;  5DM7 F;  4BEH A;  2CMP A;  4DYQ A;  4E4H A;  5GAG J;  2GIV A;  3OYA A;  2QBY B;  2DOF A;  2JSC A;  3LA3 A;  3WE3 A;  3ECO A;  1GHC A;  1OYW A;  1SVL A;  1TZL A;  2G7H A;  2YPR A;  3U1D A;  1IUF A;  4I2O A;  1OCR H;  1KYZ A;  1GVJ A;  4YFN F;  4OAZ A;  3FXO A;  3QYE A;  1K6Y A;  1BBY A;  2R7Q A;  4XOT A;  2PMU A;  5E3M A;  3S2D J;  1TNS A;  1R1T A;  1T08 B;  1WGX A;  2WAE A;  2HQ5 A;  2OAZ A;  2P81 A;  4KN7 X;  2R0Q C;  1MDM A;  4NB5 A;  2V26 A;  5IYC J;  4RDU A;  3JR9 A;  2E2J J;  1U8B A;  3RI4 A;  3FXM A;  4BEH B;  4WXD A;  4B48 A;  5F04 A;  3U2R A;  1BN5 A;  1DUX C;  3ABL H;  1JT0 A;  4DGW B;  2H6B A;  4BH9 A;  4MEX F;  1BL0 A;  2IGN A;  5AIQ A;  3VYT B;  2HGC A;  3GTJ J;  1GDT A;  1Z91 A;  3DTI A;  3P7N A;  2DT5 A;  2HYF A;  3BR2 A;  1ZRC A;  3M9A A;  1MBF A;  3DBH B;  2MC4 A;  4ON0 A;  1ORK A;  4GCV A;  1ZQ3 P;  2A69 F;  3BRO A;  4U87 A;  1FC3 A;  3TOA A;  1MDM B;  3HM5 A;  4XSX F;  3VEP A;  2GM4 A;  2XGC A;  4MQV A;  2GIZ A;  1JHF A;  3OYH A;  4IPA A;  4R1H A;  2OU2 A;  2WB1 N;  4HDU A;  1Z05 A;  1SVM A;  3F0C A;  2W84 A;  3JCU C;  2V4J C;  5LGT A;  5H6R A;  1G2H A;  2JJ7 A;  1TTY A;  3DCF A;  3ZRG A;  4NDL A;  4RM2 A;  4EM2 A;  1O7L A;  2JUC A;  1WJ5 A;  3KYD B;  4A0Y A;  2RNJ A;  1ZYR F;  4UB6 C;  1UJ8 A;  2W25 A;  1XMX A;  4M3G A;  3F6O A;  2QF7 A;  5C3E J;  2XUB A;  2AXL A;  3RTR A;  3GFI A;  5IPA A;  5A2Q K;  2GA1 A;  2ZNY A;  2HI3 A;  2LYC A;  4U0Y A;  1BR1 A;  4H4K C;  2CU7 A;  1VTN C;  2KDZ A;  2F4I A;  5JHU A;  1E2X A;  2GAU A;  2ZBK A;  3ZGK A;  3CJT B;  5CVV A;  3WTW C;  3OY9 A;  5LHH A;  4XRS A;  1Y0N A;  1K7A A;  3IUO A;  2XAS A;  4CCO A;  3FHN A;  4PCQ A;  2XC7 A;  5IP7 J;  1B6A A;  2F5D A;  2FRH A;  2K5C A;  1JUM A;  5GAH J;  1VQ7 I;  3K70 D;  2VQH A;  1EV7 A;  3EYI A;  5CVR A;  1OPC A;  2QSH X;  3J81 Z;  1NG6 A;  1TNT A;  1UG0 A;  2NAZ A;  3A4C A;  3IAS 2;  4E7I A;  1UZC A;  3CJQ B;  1B4A A;  3NAU A;  3GZ6 A;  1D1B A;  3KP6 A;  2HQA A;  1HW2 A;  2LNB A;  2MH9 A;  1N25 A;  4L5E A;  2VT2 A;  2AQE A;  1D0Y A;  3CLQ A;  3LAJ A;  4P9U A;  2DTR A;  1W1W E;  3V8K A;  3G1L A;  4UVC A;  3H9G A;  1VZ0 A;  2DMU A;  4LG3 A;  4I0A A;  3KET A;  2Y31 A;  5EDN A;  1B8I A;  1ZR4 A;  5AON A;  2VQL A;  5DCM A;  2NRA C;  2OCE A;  1OCC H;  3JRG A;  2H27 A;  3DKX A;  1X2M A;  2R7W A;  5F1J A;  4ASN A;  1WJF A;  3EET A;  1XGO A;  2HR3 A;  1W5S A;  3ROU A;  1ONV A;  3QOP A;  3VSK A;  3I0T A;  3JRB A;  5D4R A;  2NVQ J;  4LIU A;  2V1N A;  1S72 I;  2AS5 F;  1Z7L A;  3BR6 A;  1LFU P;  2ZJ2 A;  1Z0X A;  4A3I J;  1B8I B;  3JRF A;  5DCM B;  4XN3 A;  3BCB A;  3W6J B;  1BW6 A;  1F36 A;  4YFX F;  4S05 A;  1A35 A;  1J75 A;  2ZSI B;  2XAH A;  3GO5 A;  3ONQ A;  2ESH A;  2AXT C;  3AG3 H;  2Z2S B;  1QZY A;  4E7H A;  1YHQ I;  4DYC A;  2CQ7 A;  1U5T A;  5F27 A;  3VOD A;  4E7L A;  3FKI J;  4IVN A;  1S8N A;  4ZYG A;  3D1N I;  2JUG A;  3OYG A;  1YW9 A;  4IHS A;  2FBH A;  3K1P A;  1R71 A;  1MJA A;  3VYR B;  3HSE A;  3PFY A;  3ZCO A;  3RPU A;  4XRM A;  2F2E A;  2RQQ A;  1Y39 A;  4FT8 A;  2UZK A;  3H3Z A;  3R61 A;  2FMY A;  3FDY A;  5L3G A;  1JHH A;  3K4L A;  1IUY A;  2ZFU A;  5J8F A;  3H9Q A;  2JSP A;  1FYM A;  1PDN C;  2LY1 A;  2BVM A;  3HTS B;  1UHW A;  2UXN A;  4YIR X;  5E17 F;  1U5T B;  1LDJ A;  4TV7 A;  2V1U A;  1ETQ A;  4EQQ A;  3M3Y J;  2F48 A;  1JXS A;  3RKQ A;  4A3K J;  2FOW A;  4ZYD A;  1LDK B;  3JSP A;  4CA0 A;  4XN0 A;  1SVO A;  4E7K A;  2GA2 A;  2DOD A;  1ZEL A;  3PL8 A;  4AUX A;  4BE1 A;  2QM3 A;  1R4N B;  1YX5 A;  2PG4 A;  1JUS A;  4UXN A;  1A5J A;  3FXQ A;  3HPH A;  3E5Q A;  2E36 A;  3GTK J;  2VN2 A;  4L5I A;  3ZN1 A;  1MZB A;  2HOT A;  2LY2 A;  2HPI A;  1BI0 A;  3H0D A;  2DFI A;  2J5P A;  3L2Q A;  2ELJ A;  5K7H A;  1TL8 A;  5E8G A;  3O6B B;  2JA7 J;  3AG2 H;  2Z33 A;  3MWM A;  2K9S A;  2K9Q A;  2FE3 A;  2ZFW A;  2HDW A;  2VPR A;  3P9C A;  4JX4 A;  3LL7 A;  4KIB A;  3RKW A;  5LGN A;  2XHK A;  1LQ1 A;  2IXS A;  2ESN A;  2EV5 A;  2L7K A;  2B9S A;  4M3E A;  2HTS A;  1RIO H;  1IN6 A;  3KIO A;  2VXZ A;  5IP9 J;  1WJC A;  2QQB A;  2Z16 A;  5TIS C;  4B1R A;  1KU7 A;  1IRZ A;  3WGH A;  4AYB A;  2RKH A;  2ZJP F;  3LFU A;  3PUF A;  1IXC A;  2W57 A;  3AKZ A;  1C0W A;  4XLA A;  1N75 A;  1GUU A;  2VAS A;  3L2R A;  1I27 A;  2IGM A;  2IA2 A;  2QCO A;  3JRD A;  3ZQG A;  1ZAO A;  3KZY A;  3ERM A;  4ANJ A;  2CJJ A;  1WJB A;  3KZZ A;  3OS1 A;  2IS2 A;  2Q1Z B;  1UHS A;  4I76 A;  2XKO A;  2JQ7 A;  4ZYE A;  1E3O C;  4LB5 A;  2RQP A;  2XSJ C;  3MVP A;  4XLC A;  3CLO A;  3FBN B;  4IF4 A;  2EIL H;  1TQM A;  3BPV A;  2E1C A;  5ICC A;  3BOQ A;  2DPD A;  1YYV A;  2XGE A;  1IF1 A;  4XRS G;  4E6K G;  4XLN F;  2GZW A;  1SAU A;  1E0E A;  2CFO A;  2XAG A;  2W1O A;  3N05 A;  3BZK A;  5FJ8 J;  4Z6Y A;  3GF2 A;  5HDK A;  1U8R A;  3TED A;  2NYX A;  3TW6 A;  4KA4 A;  5KAI C;  3HEF A;  3OSG A;  4K2E A;  2VBZ A;  2R7Z J;  2V9V A;  2KIM A;  2CV1 A;  2M0M A;  5E3L A;  1HDP A;  2Y0M A;  4ENK A;  3WTX C;  1R7J A;  2XAQ A;  3ECH A;  1D0X A;  3F22 A;  2P6T A;  1J59 A;  4EJW A;  3DPL C;  4KJZ A;  4OIN F;  2KRH A;  4EGZ A;  2KRC A;  4G6T B;  2M8G X;  4YIF A;  3BCA A;  3O8G A;  1P9Q C;  3OIP A;  5CYV A;  1R36 A;  1I50 J;  3MZ8 A;  4HST A;  3JRH A;  2LRE A;  2QEN A;  2H1K A;  2PFB A;  2YSR A;  4BBR J;  4CYD A;  3AG4 H;  2X4H A;  4L9J A;  1SAN A;  3M8F A;  2KMU A;  4U0V A;  2IGK A;  2MW8 A;  4LGW A;  4L0Z B;  2B63 J;  5HNF A;  4ENN A;  1HLV A;  1J0R A;  2WY8 Q;  2CW0 F;  5JR3 A;  1WCM J;  3JRE A;  1APL C;  4GYI A;  2JA2 A;  3W2V A;  1X58 A;  5JLX A;  4G7Z F;  1K79 A;  2EZK A;  4P9F A;  2IT0 A;  1MW7 A;  1YI2 I;  2VOO A;  1HC8 A;  2Q2E B;  4A5M A;  5IT3 A;  2HVQ A;  2LBF A;  3H35 A;  4LIV A;  4RB2 C;  5K5Q A;  3K0L A;  4AIJ A;  4JQF A;  2LLK A;  3ABM H;  4HOB A;  4II3 A;  2A68 F;  2L9R A;  3DKW A;  2ETH A;  5L3D A;  3CCE I;  1HBX G;  3QYF A;  1KU3 A;  4DZJ A;  2M0C A;  1SFX A;  3ZQ7 A;  4G8X A;  1FOW A;  4PSX A;  1T39 A;  1U5T C;  3QOD A;  4KIS A;  1ETY A;  1TW3 A;  1WPK A;  3M4O J;  1A04 A;  3HUG A;  1I3A A;  2ZJR F;  3DFG A;  4UV8 A;  2DMP A;  1G3S A;  5IT9 Z;  2L02 A;  4XSZ F;  2OD5 A;  3TDZ C;  4JP0 A;  5J6X A;  3GLX A;  5D5W B;  1IDZ A;  2XRL A;  2Y69 H;  2XF5 A;  4PGG A;  5D5U B;  4AD9 A;  3K4B A;  1X1B A;  1PP8 F;  1W4M A;  3HOV J;  5J47 A;  1HKQ A;  3REO A;  4LD5 A;  1YIT I;  2O8X A;  1FIA A;  3EUA A;  2OF7 A;  3I4P A;  3QWL A;  4N4N B;  1MMG A;  1DU0 A;  1KQ0 A;  2DYR H;  3ZQF A;  1IN4 A;  3T8R A;  1QHG A;  5F1R A;  3ASO H;  4PK4 A;  3HUG B;  1WZ2 A;  1Z6T A;  2K02 A;  3L2U A;  2STT A;  3RPQ A;  1RPW A;  1SC7 A;  2OUM A;  2BBY A;  1O57 A;  1IO2 A;  4PDK A;  1ZG5 A;  3L2V A;  1TQP A;  4FET A;  3MKY B;  5HLT A;  1ZG3 A;  1CF7 A;  2QSG X;  2HTJ A;  3GTO J;  1XCB A;  5H6Q A;  1QNT A;  3GEZ A;  2M8E A;  1H89 C;  2R7U A;  5F64 A;  2JPB A;  2Z99 A;  4RAY A;  2R93 J;  1RKW A;  2P7V B;  1XD7 A;  3ZMZ A;  5H2F C;  3JRC A;  5DUI A;  4PFO A;  4HX8 A;  4AID A;  2DA4 A;  2MBF A;  3R0J A;  1BW5 A;  1B1B A;  2FSW A;  1YIO A;  2W00 A;  2VE8 A;  3ESW B;  4NUB A;  3SZP A;  2GQQ A;  2QSF X;  1JI8 A;  2Z5U A;  2KQR A;  1JTY A;  4MO7 A;  5E8I A;  3CO6 C;  3DU6 A;  4HEA 2;  4IHY A;  4RGU A;  1NG7 A;  4ZYA A;  3HRS A;  2DYS H;  2L4A A;  4YEL A;  1RR8 C;  3BTJ A;  2MD5 A;  4W97 A;  3FK7 A;  3SEQ A;  1EJ9 A;  1E17 A;  2FX0 A;  2DMT A;  3N4M A;  4IOA F;  3WGG A;  3PNT A;  1MNE A;  2DMN A;  4GRI A;  3R0A A;  2MA3 A;  2UWM A;  1V54 H;  1MH3 A;  1SD7 A;  5ILV A;  2E1N A;  1S5L C;  1MH4 A;  5L3C A;  2V79 A;  3PIO F;  4IHT A;  2BE5 F;  5EG0 A;  4BQA A;  2EFQ A;  4P55 A;  2HYG D;  3QU6 A;  4CSW A;  5DV5 A;  3HC7 A;  1RES A;  3HSF A;  5HLG A;  1CQT A;  1WH7 A;  1SD4 A;  3WU0 A;  3I3L A;  1LNW A;  2MFZ A;  2EIJ H;  4CZC A;  2M3A A;  3L00 A;  1L3L A;  3L1P A;  2R7S A;  2A5Y B;  3KE2 A;  4OIR F;  5J4Y A;  2Y30 A;  4GO1 A;  5J8C A;  2F5C A;  2QKM B;  4OIP F;  3H3V K;  1LB2 A;  1IRG A;  3TO7 A;  1BM9 A;  1P92 A;  1UB9 A;  4G12 A;  2Y0S A;  4EVI A;  4KN4 X;  5FGM A;  3SYT A;  2VE9 A;  2CO5 A;  2IPQ X;  3BTI A;  4A3B J;  3G1O A;  4RB3 C;  5LFA A;  3WHB A;  1TWG J;  2PQ8 A;  4A3F J;  3F23 A;  3GUD A;  1X1A A;  4NQW A;  2VIX A;  2XV4 S;  2P5L C;  3WOD F;  4M6X A;  3C18 A;  3E3V A;  4ITV A;  2VKV A;  4WF2 A;  3OS2 A;  3LWF A;  2VJI A;  1QPI A;  1BI3 A;  1MD0 A;  4PJJ A;  1D1A A;  3OYC A;  4ZDP A;  1ETX A;  1BA5 A;  3K6G A;  2XSD C;  2HXO A;  1D5V A;  1WJE A;  3G71 I;  2QUF A;  3GVA A;  1R4M B;  2IW5 A;  4S0H B;  1SFO J;  3S15 J;  1XGS A;  3CJR B;  3I4M J;  1AA7 A;  2HZT A;  1G6N A;  2DW4 A;  4WWC A;  2O7O A;  2AQF A;  2IA0 A;  1V55 H;  1XGN A;  3CCQ I;  4B3X A;  2QQ9 A;  4NQW B;  2X51 A;  1YE9 A;  4AYB N;  5DCF A;  3FM3 A;  5GTH C;  2HDD A;  2VC1 A;  2GWR A;  4QIW N;  1NTC A;  2QBY A;  1STZ A;  5EEH A;  2JK3 A;  3O2P E;  2DDB A;  2K86 A;  3H5R A;  3B02 A;  4BHB A;  3VPR A;  4XKB A;  2WTE A;  2HQN A;  1WI9 A;  5BPI A;  5D5V B;  1HW1 A;  1NK3 P;  1YO5 C;  3KYL A;  2R7O A;  4P96 A;  4ZYH A;  5BQT A;  5F08 A;  2WAD A;  2VOD A;  2Z3Y A;  2QA4 I;  3D5L A;  3SQN A;  3E6C C;  3MQ0 A;  3OMY A;  3CP8 A;  4BXF A;  1RI7 A;  2KLO A;  3HTU A;  1JUP A;  2ELH A;  1T56 A;  2N8G A;  2OV7 A;  2MLK A;  3TGN A;  3ML6 A;  3IL2 A;  2DT6 A;  2L5Q A;  2ADU A;  2ELK A;  4Y33 A;  1MGT A;  1OIS A;  4ESJ A;  2BXY A;  2MSY A;  1EF4 A;  5M5X J;  1Y6I A;  3CDH A;  1RRJ A;  2ZCW A;  1YIJ I;  3P9I A;  1BIB A;  3WG7 H;  1FIP A;  1TW2 A;  4XKC A;  2HPM A;  1LFB A;  3GLL A;  1HST A;  2X1D A;  2COM A;  1B9M A;  4M3F A;  4ZZD A;  1VQN I;  3DEW A;  1XTA A;  4EJV A;  4CCK A;  4FE7 A;  1LVA A;  2DA7 A;  4AC0 A;  1OMI A;  3F8N A;  2G7U A;  2KL4 A;  5K5O A;  3LNQ A;  1HQC A;  4Q48 A;  2EIK H;  2TCT A;  2XKP A;  1D1C A;  2BZT A;  2HVS A;  3S3O A;  1TWC J;  3DPU A;  3A03 A;  3ULQ B;  5F0C A;  3IWF A;  4PFP A;  3FHZ A;  1X1P A;  2K85 A;  4HNT A;  2XB5 A;  5KAF C;  2BGC A;  2EFP A;  3JTG A;  3G6E I;  1R5G A;  3LA7 A;  4J19 A;  5CVU A;  2HXI A;  2DA3 A;  2KZG A;  2ZNZ A;  4XLF A;  2EZH A;  3A0H C;  4KFC A;  5HOO A;  4C3J J;  2GOM A;  2AO9 A;  2CQQ A;  2CUF A;  4XBF A;  4J00 A;  1Q1V A;  4XM3 A;  1X4O A;  3LMM A;  4CZZ A;  2O3F A;  3OR2 C;  2E7W A;  2UUZ A;  3J7Z I;  3HHH A;  3WE2 A;  3DV8 A;  2P5V A;  2WA0 A;  2Y2Z A;  1K4T A;  5HS9 A;  3OIQ A;  1WI3 A;  1IAW A;  2W7N A;  3ZQL A;  2ZXW H;  4OMZ A;  1GV5 A;  4LLG F;  3H92 A;  1T0F A;  3Q9V A;  5D8L B;  3S3M A;  3H9J A;  2HZD A;  1X1C A;  2CWE A;  5J4V A;  2Y9Z A;  3PO2 J;  1QA6 A;  1IN7 A;  3GFL A;  2IS1 A;  3PQK A;  1LDD A;  2G0E A;  1LJ9 A;  2JN6 A;  2VBX A;  4HDV A;  4RGS A;  5JLW A;  3RCO A;  4O3M A;  4X0G A;  3FXR A;  4G7H F;  3FIS A;  2O03 A;  5FKN A;  1FTZ A;  3BR3 A;  3QP5 A;  2BHZ A;  1J7K A;  2RGV A;  2Z1D A;  3FF5 A;  1VQ8 I;  2FBK A;  3H0G J;  3S32 A;  3C7J A;  2OZ6 A;  1GV2 A;  3ZMV A;  1XDU A;  1I1G A;  4XK4 A;  4C3I J;  1BC7 C;  2MH2 A;  4M74 A;  2BY0 A;  3DPT A;  4Y7N J;  4GYG A;  3GW2 A;  3KEQ A;  2IAI A;  1VQ9 I;  1FPQ A;  3LQR A;  2D5V A;  3GTL J;  3CJN A;  2E71 A;  2PEX A;  3A02 A;  2GOX B;  2HU9 A;  1XGM A;  3OYB A;  5E18 F;  4RMN A;  1FYK A;  4M3D A;  3FXK A;  1PVE A;  5JI6 A;  3HJE A;  1O3S A;  2IEK A;  2VBW A;  5JFR A;  2V6E A;  1H9T A;  2VON A;  2BYV E;  4DW6 A;  4ENJ A;  3RYR A;  2LOO A;  4C2M J;  2JA6 J;  4MFE A;  2VJJ A;  1ZG1 A;  2MYS A;  1U6G A;  2EIN H;  3PSI A;  2A5W A;  2PLY A;  1VF9 A;  2BW3 B;  3V7S A;  4GXO A;  1YTY A;  2BVL A;  2LG4 A;  3S14 J;  4ESF A;  1KU2 A;  4RBO A;  3WU2 C;  2WV1 A;  5E3N A;  2H09 A;  3ELK A;  3OYK A;  4HA8 A;  2HOS A;  1Q1H A;  3MFK A;  1ZKG A;  2KJC A;  2VKE A;  3FWE A;  4BE2 A;  3NWS A;  3K70 C;  1U0J A;  4XRF A;  2EV6 A;  4IZZ A;  4DYR A;  4PJL A;  4XKV A;  3Q5F A;  3CP2 A;  2HKX A;  3MKZ A;  2IA1 A;  4KIG A;  2ECB A;  1D0Z A;  3I58 A;  4D7N A;  3L09 A;  3CCJ I;  2BEO A;  1FWZ A;  3MKW B;  2KIF A;  2ZME B;  4HV6 A;  4OU0 A;  9ANT A;  5EZG A;  2PJR B;  2EFN A;  4FX4 A;  2DFH A;  3R60 A;  4IHX A;  4ETS A;  3S16 J;  3DEU A;  3J7Y J;  1H88 C;  3GZN B;  1MBE A;  2LF7 A;  2WAF A;  2I5U A;  2JVG A;  1UST A;  5GPC A;  3AL0 B;  1KYW A;  3S2H J;  2CQK A;  1SFU A;  4IQJ A;  3K4N A;  1EA3 A;  4A3M J;  2R7T A;  3CC2 I;  3GBG A;  4D0P A;  1X3Z B;  2ID3 A;  3TP3 A;  4YII A;  1K4S A;  2DA6 A;  3K4C A;  2JPC A;  2ZSH B;  3VB2 A;  3BR0 A;  1MIJ A;  4I98 B;  5EJC A;  2PI0 A;  2Y0S N;  3HOT A;  3KP3 A;  3FZV A;  3K1M A;  4Y17 A;  4JOM A;  3C2B A;  3K4K A;  3FMQ A;  3PJR A;  2V6C A;  3A1Y A;  2E1O A;  1RZ4 A;  1FYL A;  4F92 B;  3CCR I;  4C9Y A;  2KDO A;  4BGD A;  3MEX A;  1I3Q J;  1OLT A;  1XCV A;  5FFX A;  4OIO F;  1XN7 A;  2PMH A;  2BY1 A;  3E97 A;  4BQO A;  4D5C A;  3RYP A;  1FOX A;  4L18 B;  1WRJ A;  3DXJ F;  2VUM J;  1RR7 A;  4V2G A;  2Q8K A;  1LEA A;  1QVU A;  2M9H A;  4PGH A;  4G6Q A;  1EH6 A;  5HS8 A;  3S1M J;  2DJN A;  4XLH A;  5HLI A;  5M5W J;  3D5R C;  1X4P A;  3CF2 A;  3HRU A;  3PFI A;  4RS8 A;  3F3X A;  4L5J A;  5D6F A;  1W0U A;  3HKZ A;  3CMY A;  4M9X A;  4BQN A;  4E7S A;  2R7D A;  2VPL A;  4KT5 C;  3DBR B;  4A93 J;  4ENM A;  1ENH A;  3BZ6 A;  5IT9 K;  2DLL A;  5JHF A;  4MFD A;  2W24 A;  3VWB A;  1RNL A;  5CVI A;  2YS9 A;  1ETK A;  4MQ9 F;  2FU4 A;  4Z2Y A;  1M1E B;  2BY3 A;  3HGG A;  4HZF A;  5FRN A;  3QPH A;  3EDP A;  2O6G E;  4CUG A;  4I7H A;  2QQ8 A;  2DBB A;  2XPV A;  3IC7 A;  3S8P A;  4A5N A;  5F0F A;  2I10 A;  3GTP J;  1SAX A;  1Z7U A;  2NXN B;  2YU3 A;  1XMA A;  2ZXI A;  4L9N A;  4X6A J;  3K4M A;  2CSO A;  2IVM A;  1T0F C;  4UNO A;  1GVD A;  2P4W A;  3RKY A;  5LEJ A;  3I4N J;  2MG4 A;  3V7R A;  4BXU A;  1DU6 A;  1UFM A;  4O6J A;  3OR1 C;  2R7V A;  4W1U A;  3AAF A;  1V4R A;  1IJW C;  4ABZ A;  2ZXJ A;  2VJ4 A;  4LIT A;  1T38 A;  1HSJ A;  1X1D A;  2D1V A;  2LP0 A;  1S7E A;  1YJN I;  2I8D A;  1VQ5 I;  3LSP A;  1R6R A;  1S6L A;  1V3F A;  2CV2 A;  1MNM C;  2M2E A;  1XS9 A;  3HZJ A;  1AWC A;  3J80 Z;  1IGN A;  3LSR A;  3C1D A;  3C2G A;  3CME I;  1ON1 A;  2VJ5 A;  3K1N A;  3TBI A;  4GFB A;  1IN5 A;  1KON A;  2R5Z A;  1BI1 A;  2VL8 A;  3DLL F;  5GTI C;  2XPW A;  3M8J A;  4E7J A;  1QPM A;  2M30 A;  1MSF C;  4BJT A;  5JVT A;  3JRI A;  4B09 A;  3LSM A;  1IC8 A;  1T6S A;  3JAM Z;  3HOW J;  3CCU I;  4BNC A;  4AIK A;  3ZMU A;  1TT0 A;  1ZK8 A;  1HCR A;  1DGR M;  3SFI A;  4NC7 A;  2OBP A;  2LMD A;  1ETV A;  1T95 A;  5E3O A;  2HWV A;  4RM3 A;  1YQA A;  4ZDL A;  3BZC A;  1FSH A;  4B47 A;  2B7E A;  1J5Y A;  2XAF A;  1V5E A;  2VQC A;  3QU3 A;  4U88 A;  2R5Z B;  1IN8 A;  3DTE A;  2Q2E A;  1YX3 A;  2MC3 A;  1JGG A;  2L9V A;  4Y4R A;  3MAJ A;  5FLV A;  5TJJ A;  4CYC A;  1ZRE A;  2V1X A;  2DO7 A;  3I53 A;  4E7Z A;  2K27 A;  3VFZ A;  3KPH A;  2W4S A;  3JRA A;  5E1X A;  1UCR A;  2R7R A;  3A0B C;  2R7X A;  2CQN A;  2ZME C;  1ZHF A;  2JRT A;  2NVT J;  4B8X A;  1R49 A;  2QVO A;  3ZMT A;  5DS9 A;  3GX4 X;  1QHH D;  1U9N A;  4FTH A;  3CCY A;  4EM1 A;  2NVY J;  5EZH A;  4F55 A;  1B59 A;  1XPX A;  3OYL A;  4YRV A;  3AL0 C;  4QLC U;  1QU3 A;  3CCS I;  3IHU A;  4OWR B;  1JGS A;  4MHG A;  3BPX A;  4RLF A;  5HVQ C;  2CW8 A;  1VND A;  1OYY A;  1YS6 A;  2NOJ B;  2DK5 A;  3F8C A;  2LD5 A;  4CYC B;  4G9Y A;  4FAS D;  3OWT A;  4A0Z A;  2EPF A;  4JYK A;  3IKT A;  2IS4 A;  2R92 J;  2VKH A;  2L0K A;  2M4G A;  3CCV I;  2H8R A;  2CUZ A;  4C3H J;  3F6V A;  1SD5 A;  1P7J A;  3I54 A;  3F8B A;  2GBY A;  3TQN A;  2HS5 A;  2X1E A;  5CQG A;  1JKQ C;  1P4X A;  1RC9 A;  1XB4 A;  2M87 A;  1RET A;  3CZ6 A;  3HSR A;  3Q0W A;  3WTY C;  2L7Z A;  4RLQ A;  3RZO J;  3K7A J;  2A61 A;  1R23 A;  1FBQ A;  3MN2 A;  2E35 A;  2XIG A;  3ERE D;  3K4J A;  1F1Z A;  3RQI A;  3TL4 X;  3RSN A;  2DAO A;  1K61 A;  5LEK A;  3GFJ A;  2D2W A;  2M45 A;  2OQG A;  2F5F A;  1FEX A;  5FKM A;  1I6X A;  2EV0 A;  1SFE A;  4LMY A;  2VLA A;  4H0E A;  1X19 A;  3OOU A;  1XSX A;  2JVH A;  2KIS A;  1VQ6 I;  1SFK A;  1MJ9 A;  4EMS A;  3I59 A;  1JJ6 C;  3S93 A;  2LY9 A;  1U78 A;  1FJL A;  3IWZ A;  1USS A;  2RC4 A;  2XGX A;  3E6M A;  4A69 C;  2P7C B;  2O5R A;  4KIF A;  4EJO A;  5B5E C;  3PO3 J;  4LJZ F;  2K9L A;  3BJO A;  1R1V A;  3G73 A;  3W3C A;  1AOY A;  2JRM A;  3ZQI A;  1TQI A;  1WQ2 A;  2OQR A;  1VI0 A;  3IAM 2;  5GPA A;  4M6Y A;  1S3J A;  2L9N A;  1S9H A;  3GWZ A;  3CDL A;  3ISP A;  5ERI A;  1QZE A;  2O0Y A;  4HLY A;  3I56 I;  3LAP A;  4ZTF A;  5FKL A;  1BR4 A;  5K7Z A;  3RQ4 A;  4UUS A;  4BDY A;  3I59 B;  2VXD A;  1FSE A;  3BTL A;  3B6A A;  2Z9O A;  2M5W A;  5HDG A;  5BNG A;  1UG2 A;  4BHP A;  2JA5 J;  2F6C A;  1YJ9 I;  2TRT A;  1XX5 A;  1HDD C;  5FLX K;  2X6O A;  2VT3 A;  5FLM J;  3JTH A;  4CH7 A;  4F91 B;  5FRM A;  1YW8 A;  5FKO A;  1HXD A;  4BY7 J;  5LGU A;  3GTM J;  1KGS A;  5CJ9 A;  4KMU X;  3CMA I;  3CDI A;  1Z3Y A;  5D8K B;  4KIC A;  3ZP5 A;  5HDN A;  5B1B H;  3R4K A;  3NEU A;  3PQJ A;  4XLP F;  1PYV A;  5CLS A;  5C4J J;  3QP6 A;  3IRQ A;  4UUS B;  3RIR A;  4HNV A;  1OCO H;  3HOX J;  2L4M A;  4HF2 A;  3Q0V A;  4C30 A;  2WY7 Q;  1MMA A;  2JTV A;  4LFU A;  2E34 A;  3DP7 A;  1I1S A;  2OTJ I;  3IH3 A;  4Y3O A;  4GDF A;  5DM6 F;  2QGU A;  2FJ1 A;  2ZB9 A;  3N97 A;  1FMV A;  3QQA A;  1VQK I;  1LVK A;  2FNA A;  3JSO A;  1T98 A;  5EEA A;  3MKL A;  3V7C A;  5GP9 A;  4HQE A;  2A07 F;  2AHQ A;  1B9N A;  1QZZ A;  4WXC A;  4M71 A;  5BS6 A;  1Y0U A;  4MEY F;  3ZR8 X;  1J2X A;  2W85 A;  2KIQ A;  2QEX I;  4BQQ A;  4AWX B;  4QTR A;  4KNY A;  4N9H A;  4IQ4 A;  2NVU B;  5H20 A;  1MBK A;  3ZXS A;  4C2T A;  2DFF A;  3V42 A;  1D8J A;  5LHG A;  3GCM A;  1YJW I;  1FBU A;  4IKF A;  5KHD A;  1W5T A;  1MMS A;  1F43 A;  4A3J J;  2RRE A;  2CFX A;  2L9S A;  5ED4 A;  3EUH A;  4YEJ A;  3TKY A;  1XC5 A;  3OS0 A;  2L54 A;  5DD4 A;  1IDY A;  2L7M P;  2UXX A;  3KP4 A;  3SZT A;  4M73 A;  1IG7 A;  3BR5 A;  5HOD A;  1W7P D;  3CMM A;  2DJI A;  1MBG A;  1TC3 C;  3J7A Y;  1BOA A;  1IXR C;  3BJ6 A;  3M8E A;  5DEQ A;  1NH3 A;  3S1R J;  2P0W A;  4OOI A;  4U7D A;  3GTG J;  3L7W A;  1LUJ B;  4BE0 A;  3ABK H;  2IP2 A;  2XGD A;  1DDN A;  2X48 A;  4UVA A;  3CCM I;  2JZY A;  1K78 A;  3GXO A;  2ECC A;  5M3M J;  3I55 I;  2CH0 A;  3FK6 A;  2ME0 A;  3BG5 A;  1E3H A;  3U21 A;  1S29 A;  2LRD A;  2R4G A;  3BLY A;  1ERD A;  3T1B A;  1OCP A;  1V5F A;  3BG6 A;  3UNG C;  2HOE A;  2A6H F;  4ZC3 A;  1OKR A;  3M1C A;  1B72 A;  5LRR A;  2DA2 A;  1MJB A;  4Y13 A;  4IEJ A;  4HAM A;  3JW4 A;  1ZGJ A;  4BUP A;  2LSO A;  3K69 A;  2VQG A;  4JX6 A;  2L7F P;  3KLN A;  6PAX A;  4RB0 A;  4HF1 A;  5TGT A;  1K78 B;  2V9P A;  3LA2 A;  1FY7 A;  1ZN2 A;  4OMY A;  2QQA A;  1HA8 A;  3OOP A;  3HOU J;  1QO0 D;  1WJD A;  3C3W A;  2XRN A;  2FQ4 A;  3F9K A;  1WFX A;  4XMY A;  3I64 A;  3KEY A;  2CYY A;  3W2A A;  2H8W A;  4RA2 A;  3H5N A;  5FKK A;  5LHI A;  1B72 B;  1JT6 A;  3OYI A;  5LD2 C;  2B0L A;  5FD5 A;  3KZI C;  3DWL E;  4BYY A;  4QPQ A;  1NK2 P;  5K7F A;  2BV6 A;  3AFH A;  1YLF A;  1TWA J;  3Q3S A;  3BQY A;  4BJ6 C;  2NS7 A;  5FLX Z;  4EV0 A;  4P5O A;  1OJL A;  3QPS A;  2F4O B;  1MBJ A;  4MTD A;  5KNL A;  3PUB A;  1HKS A;  2FF4 A;  1VQO I;  1TT5 B;  1JE8 A;  2GLO A;  2RNG A;  2HDC A;  3G3Z A;  1FLI A;  5C4X J;  3UKG A;  4HF0 A;  5J3L A;  1MND A;  4IXA A;  2ZJQ F;  3HRM A;  4U7B A;  1FMW A;  1GXP A;  1UHM A;  4XOP A;  1H8A C;  4AM3 A;  3DU5 A;  4NC6 A;  1WVR A;  1G59 A;  2V9K A;  1R1U A;  2RN7 A;  3SDG A;  2WV0 A;  3G4S I;  1KQ8 A;  2YX4 A;  3ZQH A;  3CUQ C;  2LFB A;  2IRF G;  3D0S A;  4GGG A;  3DLA A;  2A05 A;  1GXQ A;  4N9I A;  3WTZ A;  3E0J B;  4BHC A;  3MZH A;  3FXJ A;  5M5Y J;  1WSU A;  4LG0 A;  4ZZL A;  2PMZ A;  1P4A A;  1ODD A;  2ZKZ A;  3ZMS A;  2K40 A;  1PUF A;  3DTK A;  2KZV A;  1A6I A;  4UHT A;  3WGI A;  1AU7 A;  3M7G A;  3HOZ J;  2CW7 A;  3OSF A;  1ITY A;  3EQL F;  3KP5 A;  2V1D A;  3DKY A;  3HYI A;  1V5G A;  2X9D A;  2M7B A;  4Y15 A;  1REP C;  1WJA A;  3VDX A;  4AIH A;  2WAQ A;  4B3A A;  4CXF A;  5GAD J;  1IXS B;  1T2K A;  4LB6 B;  2DOA A;  4F7Z A;  1Z67 A;  2DU9 A;  2IGO A;  3HIF A;  3TOB A;  3WHC A;  5IOY A;  2RDP A;  3L2W A;  4HQM A;  2LTP A;  1AHD P;  2E60 A;  3ZN0 A;  3BG7 A;  4LG0 B;  4UUT A;  2P6S A;  1WWX A;  4FHT A;  4AVP A;  4IRI A;  4BBS J;  3SJM A;  1PUF B;  3BR1 A;  3BP8 A;  2LF8 A;  1R5I D;  3EPZ A;  3P9K A;  3BJA A;  1D5Y A;  1CGP A;  1ZRF A;  4N0B A;  4KYW A;  4M3B A;  1DPR A;  5E1Z B;  4WK8 F;  2DXI A;  1G3T A;  4IHW A;  4F3Q A;  2PJP A;  2ISZ A;  1Y1W J;  2DTZ A;  3KLO A;  4XKW A;  5E79 C;  4HYE A;  4PUS A;  2VB6 A;  4I02 A;  5B3S H;  4LK1 F;  2LH9 A;  1ZGW A;  4UB8 C;  5KK1 A;  4C2U A;  2YU9 J;  3RJP A;  4BY1 J;  3VOE A;  1L0O C;  3U9G A;  2EA2 A;  3K2Z A;  2LKX A;  4A2U A;  4L0Y B;  1YOV B;  3CF5 F;  1VQL I;  2M7A A;  3HRT A;  4WXH A;  2LVS A;  4RB1 A;  1BR2 A;  3KFW X;  5IYD J;  1RKT A;  4UY8 I;  1E3P A;  1JTX A;  2KHM A;  1MMD A;  2BW3 A;  2DI3 A;  2QKL B;  3CO7 C;  2CRG A;  2IJL A;  2OZU A;  2E2I J;  2VC0 A;  3NWT A;  4RGR A;  4LLL A;  4DBR A;  2OCC H;  3K9T A;  5F6F A;  2RAE A;  2NNY A;  1MMN A;  1HKT A;  4HNU A;  4N4O B;  4QPO A;  4D9J A;  1F4K A;  1A36 A;  4A3G J;  3EUH C;  3F21 A;  3H5A A;  2CGP A;  4V19 K;  2EZI A;  4HBL A;  5CVJ A;  1ZR2 A;  3CD6 I;  2OC6 A;  3FMS A;  4KT6 A;  3V4G A;  4II2 A;  5BOX A;  1U2W A;  2ZME A;  1FZP B;  3V8J A;  1VQ4 I;  3TDU C;  2PJR A;  1WH5 A;  3DQV C;  4FE4 A;  3J80 K;  2DA1 A;  3E5X A;  3QAH A;  4PSW A;  2W82 A;  4S04 A;  2K3F A;  5IYB J;  3ZMD A;  3B6C A;  3O3K A;  5K1Y A;  1ETO A;  3SZG A;  4D7M A;  2VBY A;  1DP3 A;  5DYM A;  2DN0 A;  2DQR A;  2MD0 A;  2QZ8 A;  4DBQ A;  1R58 A;  4MGR A;  4B4C A;  3ZOB A;  4NHJ A;  2X6Y A;  5TRD A;  1FT9 A;  1HF0 A;  2MGQ A;  4QWQ A;  3HOS A;  3KCC A;  5J1U A;  3BTC A;  1Y8Q B;  3JAM K;  2KP6 A;  2CUJ A;  1T33 A;  3BY6 A;  5CKT A;  2LKS A;  4DNC A;  3IV5 A;  5L3E A;  2QWW A;  2K9N A;  1ETW A;  4HX7 A;  1G8X A;  2DCE A;  5IOZ A;  2CQX A;  4RAG A;  3F72 A;  1MSE C;  4M72 A;  4I09 A;  2E19 A;  3BQZ A;  1N77 A;  3GZ5 A;  1OYI A;  4O5V A;  2XVC A;  5L3B A;  1ZH5 A;  2LR8 A;  2IS6 A;  3S1N J;  3HHG A;  4F93 B;  2YR2 A;  4UVB A;  3S2W A;  2L01 A;  2A6E F;  5B66 C;  2M34 A;  3T5X A;  5HNH A;  2O8K A;  4G7O F;  1RUO A;  4QSH A;  3B73 A;  1HW5 A;  3TO9 A;  3ABT A;  1POG A;  4R8H A;  2MLG A;  4A0X A;  3HOY J;  2FA5 A;  2FQ3 A;  2YX7 A;  3SDB A;  1SD6 A;  3MCZ A;  2P5K A;  2VKD A;  3NRV A;  3FKJ A;  3CQZ J;  2WWY A;  3CC7 I;  5FB2 A;  3FMR A;  2PBI A;  4MTE A;  1O4X A;  1LEB A;  1ULY A;  3IP4 B;  3NAR A;  4A3L J;  1PP7 U;  1H0M A;  2KIU A;  1Y56 A;  2WC2 A;  4I01 A;  3FXL A;  3LST A;  2DDA A;  3KX2 A;  2D1H A;  2A6T A;  3AG1 H;  3BWG A;  2L3D A;  4HV5 A;  4D5F A;  5ICG A;  2Y9Y A;  5E1W A;  3V8L A;  2ZXH A;  3A2K A;  2YUS A;  5FD6 A;  3GYH X;  1IZ1 A;  1OR7 A;  1XDS A;  2VI6 A;  3ASN H;  4FX0 A;  5A2Q Z;  1I39 A;  2NNN A;  4EJU A;  1YFH A;  1IV6 A;  2EIM H;  3HPG A;  1FP2 A;  2DT7 B;  5HLH A;  1BC8 C;  2OTL I;  2E7X A;  3E6D A;  2LK2 A;  2HNH A;  1XSV A;  3UR3 C;  1JJ8 C;  2NOG A;  2XDV A;  4Q47 A;  1I5Z A;  4MNU A;  4A3C J;  4XIC A;  4KUM A;  3HGY A;  2UV1 A;  1MBH A;  4A12 A;  1DPU A;  3FBI B;  4LOC A;  3FIW A;  4IRH A;  3Q0U A;  3K10 A;  3OV8 A;  3T0Y A;  3FX3 A;  5BPD A;  1Z6R A;  2BOL A;  4RAZ A;  5E20 A;  2EK5 A;  1YG2 A;  1OCT C;  2F5E A;  3QYB A;  2ACJ A;  3EYY A;  3WG9 A;  3W2W A;  2V7F A;  1GLN A;  3WTT C;  2FML A;  1A6Q A;  2H94 A;  1X3W B;  1TWF J;  5DUK A;  3IRR A;  3GFM A;  3QRF F;  1YW7 A;  2Y75 A;  4DZP A;  5FFZ A;  5EF6 A;  2R7F A;  3PSF A;  3KYC B;  2COB A;  1K83 J;  1P4W A;  3OL3 A;  3LQQ A;  4JBA A;  4IL6 C;  4DQ2 A;  3BG9 A;  4OIQ F;  1BJZ A;  4HG2 A;  2FNP A;  5CPR B;  1Z3X A;  2EJR A;  4XON A;  4WCG A;  1K6O A;  1BI2 A;  3J7A O;  3F8M A;  2HVR A;  2A3S A;  4CCL A;  2L2O A;  4PJN A;  3T8T A;  2WBM A;  4XNF A;  3E5U A;  1SMY F;  1LFP A;  2FBI A;  2K7L A;  4LK0 F;  1R22 A;  4EM0 B;  2KPM A;  1N78 A;  4B44 A;  1FTT A;  4XLE A;  4BL0 B;  2K3P A;  3OL4 A;  4UUV A;  2FXA A;  1A31 A;  4CHU A;  1BJA A;  5DD8 A;  4PJ0 C;  1QRY A;  1Y1V J;  1W36 D;  4BU2 A;  5ICE A;  5L3F A;  5J40 A;  2PMZ N;  1GT0 C;  1I6H J;  5KVR A;  4XL9 A;  5D4S A;  2W48 A;  3LSH A;  3LOC A;  3TW7 A;  2OPT A;  2RVC A;  2PN6 A;  4AU7 A;  3LSG A;  4ZJZ A;  5FO5 A;  3RZD J;  1IRF A;  2GXG A;  4IRG A;  1D3Y A;  3HB9 A;  4XID A;  2G9W A;  4XR6 A;  3CCL I;  3LSK A;  2WAQ N;  2BHY A;  2RV8 A;  3H3U A;  3QPT A;  1QGP A;  4DOZ A;  2J5O A;  1LKX A;  1ZAR A;  4G6D A;  3WU1 B;  4BKX A;  2FEZ A;  4B43 A;  3I71 A;  5EYR A;  1ZTR A;  2EH3 A;  4L9V A;  3RPU D;  5KCM A;  3H36 A;  2CG4 A;  2DA5 A;  2H1L A;  1P2F A;  3MD2 A;  1J9I A;  1G4D A;  4J01 A;  2R5Y A;  1TLH B;  2NS0 A;  2K4B A;  4HSR A;  4DIQ A;  4YFK F;  2EBI A;  3SEZ A;  4IX7 A;  5DDG A;  4A6D A;  1U3E M;  1KQ9 A;  1KZH A;  1OCZ H;  1KU9 A;  3TO6 A;  5CQE A;  5EEG A;  2GXB A;  4HX4 A;  1Z21 A;  2XAU A;  3OIO A;  2O9L A;  2VOP A;  4IOC F;  2XB0 X;  2HQR A;  3S1Q J;  2EB7 A;  4AVZ A;  1W36 C;  2EZL A;  3FXU A;  2CUE A;  3X2Q H;  1JKR C;  1O3T A;  3QPL A;  3SFZ A;  4M9Z A;  1W0T A;  2MAB A;  1FOY A;  1W7P A;  3E1S A;  1W5C C;  4ESB A;  2X1C A;  1SEU A;  3ZQQ A;  4JX5 A;  3WTU C;  2WB1 A;  3OYJ A;  2QLZ A;  1P7I A;  1LPQ A;  1H9G A;  2KKO A;  2R5Y B;  1EKE A;  2OJE D;  4CO8 A;  3PM1 A;  1BOB A;  2HFH A;  4R79 A;  3HXL A;  2X6W A;  4FCY A;  4ZDO A;  3Q9S A;  4RAF A;  1J09 A;  1Y8R B;  1Z77 A;  3EUK L;  4LLN A;  1R00 A;  2E5N A;  2IBD A;  3FM5 A;  2D45 A;  2XF6 A;  2TDX A;  2BY2 A;  2HEO A;  3VYU B;  2XAJ A;  3QOE A;  4CCJ A;  2M1B A;  3U1K A;  3CC4 I;  4EJT A;  2E1M B;  4PZJ A;  1W7P B;  2FOK A;  3VYS B;  2ME6 A;  2LBF B;  3BG3 A;  1XSD A;  2C6Y A;  1P6R A;  4KIT B;  2ISY A;  1UMQ A;  4IJA A;  2EA4 A;  3M1E A;  4HPQ A;  3E6B A;  3CUQ A;  2LKP A;  2XPU A;  4EGY A;  1UAA A;  4CDG A;  3W6K B;  1QBJ A; 
#chains in the Genus database with same CATH homology
 4JX6 A;  5IP9 J;  2L7F P;  4B1R A;  1HOM A;  1IRZ A;  4M3D A;  2DMQ A;  2IEK A;  4Y52 J;  1GUU A;  4DW6 A;  2QCO A;  3JRD A;  3ZQG A;  1X2N A;  4C2M J;  2CJJ A;  2JA6 J;  3HOU J;  4MFE A;  1U9O A;  3GTQ J;  1UHS A;  2FQ4 A;  4I76 A;  1AKH A;  1E3O C;  5FKK A;  1B72 B;  1JT6 A;  3W6V A;  1VF9 A;  3MVP A;  3S14 J;  4FIS A;  4RBO A;  3HBL A;  5K7F A;  1NK2 P;  2WV1 A;  5E3N A;  2HOS A;  1TWA J;  1LE8 A;  1ZKG A;  3BQY A;  3Q3S A;  2VKE A;  2NS7 A;  5C44 J;  2XGE A;  1OJL A;  3QPS A;  4XRS G;  1MBJ A;  2E2H J;  2KT0 A;  4MIM A;  2GLO A;  4DYR A;  3IH4 A;  1XG1 A;  5C4X J;  3UKG A;  5J3L A;  3LSJ A;  3TP0 A;  1QVT A;  1H8A C;  5FJ8 J;  4M6V A;  2ECB A;  5F0H A;  5DTD A;  4D7N A;  2EQR A;  1AKH B;  3TED A;  3TW6 A;  3SDG A;  9ANT A;  5EZG A;  3ZQH A;  4IHV A;  2LFB A;  3HEF A;  3OSG A;  2R7Z J;  1R9T J;  4IHX A;  3S16 J;  2JA8 J;  5E3L A;  1H88 C;  1HDP A;  1MBE A;  1LE8 B;  5M5Y J;  5GPC A;  3IH2 A;  4EEF G;  3S2H J;  5EGO A;  4A3M J;  2K40 A;  1PUF A;  1A6I A;  3GBG A;  1AU7 A;  3HOZ J;  2ID3 A;  3TP3 A;  3OSF A;  2JMW A;  2DA6 A;  2M8G X;  1ITY A;  3O8G A;  3BR0 A;  4MLO A;  2Y0S N;  1I50 J;  3JRH A;  2X9D A;  2H1K A;  4BBR J;  1VFC A;  3K2A A;  4B3A A;  1SAN A;  3C2B A;  2MW8 A;  2B63 J;  1TWH J;  1HLV A;  2E1O A;  5IP6 A;  3WHC A;  3E7L A;  1I3Q J;  3HKZ N;  1WCM J;  5IOY A;  3JRE A;  1APL C;  2LTP A;  1AHD P;  1X58 A;  5JLX A;  2EZK A;  4UUT A;  5EGO B;  4BBS J;  4D5C A;  3SJM A;  1PUF B;  3BR1 A;  1JKO C;  1D5Y A;  2LLK A;  4M3B A;  2VUM J;  1RR7 A;  4V2G A;  3S17 J;  2L9R A;  2FD5 A;  1QVU A;  2M9H A;  5EG0 B;  4IHW A;  3S1M J;  2DJN A;  2M0C A;  4DZJ A;  5M5W J;  1Y1W J;  2DTZ A;  1YRN A;  1W0U A;  3CMY A;  1ZGW A;  1ETY A;  2YU9 J;  4BY1 J;  1WPK A;  3M4O J;  4A3D J;  2LKX A;  4A93 J;  3BT9 A;  1ENH A;  2HOA A;  2NVX J;  2NS8 A;  4V2F A;  2DMP A;  2LVS A;  4MFD A;  2YS9 A;  4JP0 A;  5IYD J;  1ETK A;  1IDZ A;  1RKT A;  2XRL A;  5M3F J;  1JTX A;  3HGG A;  3A01 A;  1JKP C;  3HOV J;  3G1M A;  2XPV A;  2CRG A;  1FIA A;  2E2I J;  5F0F A;  2I10 A;  4A3E J;  3GTP J;  2OF7 A;  3O8H A;  1YRN B;  1DU0 A;  3ZQF A;  4X6A J;  2RAE A;  1GVD A;  3I4N J;  2MG4 A;  4A3G J;  1DU6 A;  1RPW A;  5J1Y A;  2ID6 A;  4W1U A;  3HDD A;  1IJW C;  2JWT A;  2EZI A;  4ABZ A;  1ZR2 A;  4X1E A;  2LP0 A;  1S7E A;  1OFC X;  3GTO J;  4BXX J;  3A01 B;  3LSP A;  2HYJ A;  1WH5 A;  4FE4 A;  1H89 C;  2DA1 A;  2M2E A;  1MNM C;  1XS9 A;  5IYB J;  1IGN A;  3ZQC A;  3LSR A;  2R93 J;  1RKW A;  3B6C A;  4I6Z A;  1ETO A;  4GFB A;  4D7M A;  5J1R A;  3JRC A;  2DN0 A;  2R5Z A;  4DYQ A;  2DA4 A;  4B4C A;  3ZOB A;  1BW5 A;  2XPW A;  1HF0 A;  2MGQ A;  5J1U A;  1MSF C;  3BTC A;  3JRI A;  1IUF A;  1IC8 A;  1T33 A;  3HOW J;  1JTY A;  4MO7 A;  4IHY A;  3IV5 A;  5E3M A;  3S2D J;  2K9N A;  1ETW A;  1ZK8 A;  1HCR A;  3SFI A;  1WGX A;  5IOZ A;  2CQX A;  1ETV A;  3BTJ A;  5E3O A;  4W97 A;  1MSE C;  2HQ5 A;  3FK7 A;  2E19 A;  2P81 A;  2R0Q C;  3BQZ A;  5IYC J;  4RDU A;  2FX0 A;  3JR9 A;  1U8B A;  2E2J J;  2DMT A;  2R5Z B;  2DMN A;  2LR8 A;  5F04 A;  1JGG A;  3S1N J;  1JT0 A;  1MH3 A;  5FLV A;  1MH4 A;  4CYC A;  2M34 A;  1BL0 A;  5EG0 A;  3JRA A;  2O8K A;  3GTJ J;  1GDT A;  1RES A;  1CQT A;  2NVT J;  4QSH A;  1WH7 A;  3BR2 A;  5DS9 A;  1MBF A;  1U9N A;  1POG A;  4FTH A;  3CCY A;  1ORK A;  1ZQ3 P;  2NVY J;  5EZH A;  3L1P A;  3HOY J;  2GM4 A;  3HM5 A;  2XGC A;  2Y30 A;  3H3V K;  2WB1 N;  3CQZ J;  1G2H A;  3F0C A;  4G12 A;  1VND A;  2JJ7 A;  2LD5 A;  4CYC B;  1O4X A;  3DCF A;  3BTI A;  4A3B J;  3G1O A;  3NAR A;  4NDL A;  4A3L J;  3WHB A;  1TWG J;  4A3F J;  4JYK A;  2R92 J;  2L0K A;  4M3G A;  2QF7 A;  4D5F A;  2H8R A;  2Y9Y A;  4C3H J;  5C3E J;  2VKV A;  2YUS A;  1QPI A;  5IPA A;  1P7J A;  2HI3 A;  2GBY A;  1BA5 A;  2CU7 A;  1ETX A;  2KDZ A;  2VI6 A;  2XSD C;  2HXO A;  1JKQ C;  1IV6 A;  1RET A;  3Q0W A;  2L7Z A;  4S0H B;  1SFO J;  3S15 J;  2LK2 A;  3I4M J;  3RZO J;  3K7A J;  4XRS A;  3MN2 A;  1JJ8 C;  2NOG A;  2O7O A;  3RQI A;  4A3C J;  1K61 A;  4XIC A;  4AYB N;  5IP7 J;  1FEX A;  1JUM A;  3HGY A;  5FKM A;  1MBH A;  2HDD A;  4LOC A;  4QIW N;  3FIW A;  3Q0U A;  1NTC A;  3OOU A;  1OCT C;  2JK3 A;  1JJ6 C;  3NAU A;  2LY9 A;  1U78 A;  1FJL A;  1TWF J;  4A69 C;  3VPR A;  4L5E A;  4DZP A;  5EF6 A;  3PO3 J;  3G1L A;  1NK3 P;  2COB A;  1K83 J;  2DMU A;  3ZQI A;  5F08 A;  1VI0 A;  2Y31 A;  5GPA A;  5EDN A;  3BG9 A;  1B8I A;  1ZR4 A;  1BJZ A;  3CDL A;  3JRG A;  1X2M A;  5F1J A;  5FKL A;  1JUP A;  5K7Z A;  1T56 A;  4UUS A;  2N8G A;  3BTL A;  3B6A A;  2ELK A;  3JRB A;  5BNG A;  1UG2 A;  2MSY A;  2NVQ J;  5M5X J;  2JA5 J;  1EF4 A;  1FTT A;  2TRT A;  1HDD C;  2X6O A;  3BR6 A;  1FIP A;  5FLM J;  1LFU P;  1LFB A;  1QRY A;  1Y1V J;  5FKO A;  4M3F A;  4BY7 J;  1Z0X A;  3GTM J;  3DEW A;  4A3I J;  1B8I B;  2PMZ N;  3JRF A;  1GT0 C;  1I6H J;  4FE7 A;  1BW6 A;  1F36 A;  2W48 A;  2DA7 A;  4AC0 A;  3LOC A;  3TW7 A;  2OPT A;  3LSG A;  3LNQ A;  3RZD J;  5C4J J;  3HB9 A;  4XID A;  2TCT A;  4UUS B;  4HNV A;  3HOX J;  3Q0V A;  1TWC J;  4DYC A;  3A03 A;  5F0C A;  5F27 A;  2WAQ N;  3FKI J;  3D1N I;  3IH3 A;  2XB5 A;  2FJ1 A;  2ZB9 A;  4BKX A;  4J19 A;  4XRM A;  2HXI A;  5EYR A;  1ZTR A;  2DA3 A;  2EH3 A;  3QQA A;  2EZH A;  5EEA A;  4C3J J;  3MKL A;  2DA5 A;  5GP9 A;  2AO9 A;  2AHQ A;  2CQQ A;  2CUF A;  2R5Y A;  1Q1V A;  2EBI A;  4QTR A;  2Y2Z A;  1WI3 A;  3ZQL A;  1MBK A;  3OIO A;  1GV5 A;  1ETQ A;  2O9L A;  3M3Y J;  2XB0 X;  3S1Q J;  1F43 A;  4A3J J;  2Y9Z A;  3PO2 J;  2EZL A;  3RKQ A;  4A3K J;  1XC5 A;  2CUE A;  1JKR C;  1IDY A;  3QPL A;  1W0T A;  2L7M P;  2G0E A;  2JN6 A;  5JLW A;  1IG7 A;  4JX5 A;  3BR5 A;  5HOD A;  4AUX A;  1MBG A;  1P7I A;  1TC3 C;  3FIS A;  1JUS A;  2R5Y B;  3S1R J;  3PM1 A;  1A5J A;  5FKN A;  1FTZ A;  3BR3 A;  4FCY A;  3GTG J;  1Z77 A;  2XGD A;  3GTK J;  2IBD A;  2X48 A;  2HOT A;  3H0G J;  1GV2 A;  2ECC A;  5K7H A;  5M3M J;  3FK6 A;  4XK4 A;  4C3I J;  2ME0 A;  2JA7 J;  3BG5 A;  2K9S A;  2K9Q A;  2VPR A;  4JX4 A;  2ME6 A;  4Y7N J;  1OCP A;  3BG3 A;  2IAI A;  1UMQ A;  1B72 A;  2DA2 A;  2D5V A;  3GTL J;  4IEJ A;  2XPU A;  4M3E A;  3A02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...