3HOVJ

Complete rna polymerase ii elongation complex ii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hovJ00
2WAQN 4RDUA 1MBKA 1WGXA 4M3BA 2R93J 2ELKA 1QPIA 1JGGA 2ID6A 3IH3A 1BJZA 4DZJA 1GV5A 4FISA 5J3LA 4AUXA 3JRBA 2XB5A 4I6ZA 2DA3A 2ECBA 2CUFA 1QVTA 4BBRJ 1VI0A 1GT0C 3GTLJ 2XB0X 1K83J 1UG2A 1BA5A 3HOVJ 2CQXA 3RQIA 4DYCA 1X2NA 3GTQJ 2CU7A 3RZDJ 3QPSA 1IG7A 3JRAA 4LOCA 2LLKA 2IAIA 3HBLA 5M5WJ 1F43A 3K7AJ 2VKEA 3HGGA 5M3MJ 5EGOB 2CQQA 3TP0A 4MO7A 1U78A 2NVYJ 2Y9YA 2R7ZJ 2R5ZA 5IYBJ 2R92J 3PO2J 1TWHJ 2HDDA 1MBFA 4IHWA 1MNMC 3G1OA 4L5EA 1ETXA 2CUEA 1W0TA 3D1NI 4FCYA 4S0HB 5C3EJ 2WB1N 2X9DA 3Q0WA 4W97A 4MLOA 1H8AC 1IUFA 1RKWA 3TEDA 2JA6J 1T56A 4V2GA 5EG0A 1VF9A 3JRFA 3GBGA 4HNVA 1R9TJ 2DMTA 1TWFJ 3GTJJ 2DMNA 3SFIA 1AU7A 3MKLA 5IYDJ 2LKXA 1H88C 2FD5A 2LK2A 3C2BA 2D5VA 2L0KA 3OOUA 1TC3C 1X2MA 3Q0VA 1Y1VJ 2VUMJ 4M6VA 1D5YA 3HDDA 1B72A 2EQRA 3UKGA 1XS9A 1Z77A 5EG0B 1E3OC 3Q0UA 4RBOA 2EZLA 3S14J 3BQZA 2NOGA 1BW5A 3GTPJ 2MGQA 3BR2A 3A01B 2KDZA 2DA4A 2Y2ZA 1F36A 1P7IA 1DU0A 2NVTJ 2EH3A 3PM1A 3TW7A 1LFUP 1HLVA 2MW8A 1ETYA 5IP7J 3A03A 4ABZA 2YUSA 3RZOJ 3TP3A 5E3LA 3RKQA 5IOZA 4JX6A 2DN0A 1U8BA 1W0UA 4M3EA 1XG1A 3A01A 9ANTA 1YRNA 4G12A 1HOMA 3CMYA 2K9QA 5K7HA 1GDTA 3JREA 2QF7A 1TWGJ 5J1YA 1QRYA 4CYCB 3LSRA 4JX4A 1FIPA 3HM5A 1RETA 1JJ8C 1HDPA 3JRDA 4D5FA 4D7NA 2DA2A 4C3JJ 4XRSA 3PO3J 2ZB9A 2LTPA 2B63J 2DA5A 1WH7A 3S1RJ 3DEWA 1B8IB 4A3DJ 2CJJA 1JTYA 2P81A 2HOSA 4QSHA 3S16J 2DA1A 4QIWN 1G2HA 1ZR4A 3BT9A 5GPCA 1WI3A 3FKIJ 4A3LJ 1U9NA 4J19A 4IHXA 2L9RA 3K2AA 2EBIA 5IP6A 4BBSJ 1MH4A 1YRNB 1X58A 2MSYA 2Y0SN 4AYBN 2HI3A 3E7LA 4JP0A 3G1MA 1HDDC 1UHSA 2YU9J 2OPTA 2H8RA 3HB9A 2XGCA 5F0FA 1BW6A 2YS9A 1JT6A 1FTZA 1A5JA 1JUMA 3GTMJ 3BG5A 5F1JA 3SJMA 4Y52J 2XGEA 3LSGA 2MG4A 3BR5A 1EF4A 2NS7A 2JA5J 2JMWA 1JUPA 3ZQGA 5EDNA 3BR1A 2JWTA 2HQ5A 1Z0XA 2NVQJ 1IV6A 5EYRA 3BTIA 2WV1A 2R0QC 2COBA 3B6AA 3MN2A 1A6IA 5IPAA 1ZK8A 4M3DA 3B6CA 1VFCA 3S17J 2M34A 3BTCA 3Q3SA 1RR7A 4A93J 4CYCA 5E3MA 1S7EA 3BG3A 4A3BJ 2Y9ZA 2W48A 5FKKA 5J1UA 4XIDA 3G1LA 1O4XA 2GLOA 3BG9A 5EF6A 3OIOA 2DMQA 4I76A 4QTRA 4A3FJ 4GFBA 1JKRC 3CCYA 2ME6A 4X1EA 2ID3A 5IYCJ 1ZQ3P 1LE8A 3BTJA 2H1KA 2XSDC 5K7ZA 2LD5A 2M2EA 4BY7J 1AKHA 2R5ZB 1H89C 2Y31A 1APLC 3QPLA 2EZHA 2EZKA 4UUSA 4DZPA 2M8GX 4UUTA 5FLMJ 4FTHA 4NDLA 1RESA 3BR6A 3IH2A 3HOWJ 1PUFA 1TWCJ 4A69C 1XC5A 2X48A 2JK3A 3LSPA 5FKOA 1ITYA 2HXIA 4MFEA 5EZHA 2L7FP 1ETQA 1JKPC 4W1UA 4UUSB 1IDZA 3SDGA 5DS9A 2DA6A 1AHDP 4V2FA 2G0EA 4B1RA 4IHYA 2HOTA 4C3HJ 2VI6A 3S1NJ 1GVDA 2LFBA 3CQZJ 1ETOA 2FX0A 1JKOC 4A3JJ 4XRMA 1I50J 1WCMJ 1OFCX 2IBDA 1FJLA 5F04A 3ZQIA 1LE8B 5FKMA 3BR3A 4Y7NJ 1HF0A 1CQTA 4BXXJ 2TCTA 5DTDA 4B3AA 1TWAJ 4C3IJ 1ETVA 3F0CA 1IRZA 5GP9A 2QCOA 1SFOJ 2E2IJ 3BQYA 2AO9A 5E3NA 4BKXA 2E19A 2K40A 1RKTA 4MFDA 5M3FJ 1ZR2A 2M9HA 2DJNA 2DA7A 2LR8A 4DYQA 1DU6A 1ZTRA 2X6OA 3IH4A 4EEFG 1PUFB 2E2JJ 1JTXA 3OSFA 2E2HJ 5J1RA 3FK6A 3I4MJ 1BL0A 3M4OJ 1FIAA 1NTCA 3TW6A 2O8KA 2VPRA 2DTZA 5GPAA 3ZQHA 1U9OA 4FE7A 3HOUJ 3ZQLA 3WHCA 3VPRA 1JKQC 3O8HA 1ENHA 3DCFA 1JUSA 5F08A 3HOYJ 1FTTA 1P7JA 3IV5A 4D5CA 3LOCA 3FISA 3FIWA 4A3KJ 5EGOA 3JRHA 2HYJA 1ORKA 2L7MP 4A3MJ 3S1QJ 4A3EJ 5C4XJ 2LVSA 2R5YA 2XPUA 5EEAA 3I4NJ 3L1PA 2L7ZA 3GTGJ 3ZQFA 4IHVA 3S2HJ 2HOAA 5M5XJ 2VKVA 1B72B 2LY9A 3JRGA 3O8GA 1MBJA 4MIMA 2GM4A 2DMPA 3OSGA 2XGDA 4B4CA 1WH5A 2ECCA 3HOZJ 1ETWA 3FK7A 2XPWA 1GV2A 5C44J 3MVPA 4C2MJ 3GTKJ 2TRTA 2I10A 5E3OA 3NAUA 2CRGA 3ZOBA 3JRIA 2XPVA 5C4JJ 2FQ4A 1ZGWA 4M3GA 3GTOJ 3HKZN 4XRSG 4IEJA 4A3GJ 1MBEA 2JJ7A 1JJ6C 1AKHB 2ME0A 3H0GJ 1K61A 2EZIA 3LSJA 4XICA 1HCRA 1OCPA 2LP0A 4A3CJ 2KT0A 3BR0A 2IEKA 1IDYA 1NK3P 5M5YJ 5FKLA 4A3IJ 1MH3A 2K9NA 2GBYA 1Y1WJ 1T33A 1OCTC 5JLWA 1UMQA 3WHBA 2N8GA 3BTLA 2JN6A 1I6HJ 1I3QJ 1LFBA 5IOYA 2O9LA 4JYKA 5FKNA 5FLVA 4JX5A 1IGNA 2JA7J 3NARA 4DW6A 1B8IA 2NVXJ 3ZQCA 2O7OA 3S1MJ 1MSFC 3JR9A 3W6VA 4AC0A 3CDLA 5JLXA 1VNDA 5K7FA 1ETKA 4DYRA 3HGYA 5IP9J 2NS8A 1ZKGA 1IC8A 1POGA 3A02A 5EZGA 1GUUA 1SANA 4D7MA 5BNGA 5FJ8J 1FEXA 2AHQA 4M3FA 1RPWA 1NK2P 2R5YB 1MSEC 1MBHA 4BY1J 2PMZN 2K9SA 2DMUA 5HODA 2XRLA 3JRCA 5F27A 1MBGA 5F0CA 3HOXJ 2M0CA 2RAEA 2Y30A 2HXOA 3QQAA 1OJLA 2E1OA 3LNQA 2JA8J 4X6AJ 5F0HA 1IJWC 1Q1VA 1WPKA 4XK4A 1QVUA 4FE4A 3H3VK 3M3YJ 2FJ1A 1JT0A 3S15J 3HEFA 3S2DJ 2OF7A
chains in the Genus database with same CATH superfamily
2R7RA 2P8TA 4RDUA 1W36C 5GAHJ 2KFDA 4KFCA 4I0BA 3HJEA 1VQ4I 4MTDA 2R7TA 1MD0A 2IS2A 2H09A 4CH7A 2A6TA 4B48A 1SAXA 1RUOA 5J3LA 2OCEA 4QLCU 1WJEA 1F5TA 4FX4A 3CCLI 4NQWB 5LFAA 1GT0C 2XB0X 4C2TA 3WE3A 2O03A 4Q47A 1LDJA 4RM3A 2COMA 1B59A 4XL9A 3GVAA 2JPBA 2Y0MA 3I5UA 4PSWA 5A2QZ 2DO7A 4R79A 1IG7A 2O3FA 1IRGA 2A6HF 4ZDOA 2DT5A 3E5UA 2ZJPF 5B5EC 2V4JC 1LEAA 5M5WJ 1H9TA 2VKEA 3HGGA 5M3MJ 1XN7A 3OIQA 2JUGA 5EGOB 3N4MA 2CQQA 3TP0A 1U78A 3WTWC 1FP1D 2NVYJ 1LUJB 3EPZA 4ENMA 2G7HA 1X1BA 2R92J 3PO2J 4IHWA 4EM0B 4GGGA 4IX7A 2K85A 4L5EA 2UXXA 2Z33A 1KQ8A 4BNCA 1YYVA 3CP8A 1ZAOA 1S9HA 2ZXWH 4AIHA 5JFRA 2WB1N 4W97A 4MLOA 1W36D 4UV8A 5DDGA 3TEDA 5EG0A 1D3YA 4F93B 4HNVA 3ESWB 3OS2A 1YJNI 2WV0A 4EGZA 2DMTA 1EKEA 3C1DA 3L9FA 1O7LA 3GTJJ 2DMNA 4E7SA 2ZFWA 3IKTA 3K4CA 3MKLA 4Q48A 4Y13A 3QU3A 3C2BA 4BHPA 2PLYA 4CGZA 1Y39A 1X2MA 1TC3C 1Y1VJ 5CLSA 4N4OB 3BOQA 4YG2F 3HDDA 2A5YB 4CHUA 4L5IA 5HVQC 3JW4A 1YQAA 3DEUA 2IS1A 2JVGA 2M1BA 3K4NA 4BE1A 3AFHA 2PJRB 3S3MA 5DEQA 1BW5A 1Q1HA 4E7IA 4IOAF 2NVTJ 4ANJA 2Q2EA 1HLVA 2V9VA 1LFUP 1S3JA 1ETYA 2DXIA 2Q2EB 3DQVC 3A03A 3GW2A 2IGKA 3RZOJ 2A3SA 3KPHA 3TP3A 1DPRA 1X1PA 3PNTA 4XOPA 3RKQA 1W0UA 2DU9A 2BHZA 3WTYC 4BHBA 5HNFA 4HW0A 2ACJA 2VOPA 5B1BH 4WXHA 3BZCA 5E1WA 4LK0F 2HDWA 2ADUA 1HKQA 1WFXA 4LJZF 5HLGA 1U5TC 1FIPA 3PL8A 4HEA2 4KUMA 2CH0A 1U8RA 3JRDA 4HV6A 4O6JA 3WTVC 4XRSA 2FBIA 1IN8A 1SEUA 1TP4A 2ZB9A 4EV0A 1BN5A 1O57A 2B63J 5IT3A 3QRFF 1SD7A 4LFUA 4LG3A 1WH7A 2XKOA 4TV7A 3REOA 3DEWA 3OYNA 3S1RJ 2CG4A 1B8IB 4KNYA 1MW7A 1Y56A 4PZJA 2G9WA 1WKMA 1REPC 2QBYB 3S16J 1OR7C 4QIWN 2DCEA 4XKCA 1USSA 4A3LJ 2XC7A 4LLNA 1EH8A 3OYKA 4I01A 2EB7A 3V4GA 2Y0SN 1DDNA 3G1MA 1FMWA 2X6XA 4BYYA 3HL2A 2OPTA 2XGCA 3AAFA 1BW6A 1I1GA 1YS7A 2YS9A 4O3MA 1L3LA 3GTMJ 3M7GA 4FX0A 4BQOA 5EEHA 4AVPA 1T8IA 4O5VA 3SZTA 5EDNA 1N25A 3NWTA 2OZ6A 2WC2A 2DDAA 4NC6A 4C9YA 2KIQA 2COBA 2UXNA 3MN2A 4L5JA 4WX9A 3LQQA 3M9AA 3QP6A 3B6CA 3K1NA 3K4LA 1VFCA 1V5FA 4LGWA 3TOAA 1XMKA 5GAEJ 4A93J 5TGTA 4CYCA 4AD9A 4Q5SF 5KAIC 3ZMUA 4A0ZA 2Y9ZA 2LH9A 1Y6IA 4OIRF 4H0EA 2VB6A 5FKKA 5FROA 4LG0A 1Z05A 4YRVA 1FYKA 1CGPA 4QTRA 4RLFA 4L9VA 4GFBA 2JSPA 3MZHA 4HF1A 3ERED 4CCNA 2CQNA 1ZQ3P 3L2CA 2ZKZA 4FETA 1JHFA 3K69A 3VYUB 3IWFA 5ILVA 1K79A 1QZZA 3K2ZA 3H9GA 4BY7J 2A61A 4DBRA 1IRFA 2V6EA 4HNTA 2B0LA 4N0BA 3H9JA 1TQMA 2XF6A 4Y3OA 4KA4A 1P4XA 2EZHA 4A6DA 5BPDA 1OKRA 2OD5A 3RPUA 4FTHA 2PBIA 1BC8C 5TRDA 2EIJH 3OYAA 2MABA 4KICA 1PUFA 1TWCJ 2EINH 3DU6A 3A0HC 3S32A 2NS0A 3Q5FA 2L3DA 2JK3A 5ICFA 2D45A 1ITYA 1YFHA 3W2VA 2H27A 5JVTA 2L7FP 3HRMA 1Z7LA 1ETQA 3OL3A 3VDXA 2BY2A 4RM2A 3F3XA 3X2QH 1HKTA 4IJAA 4AIKA 1IDZA 3G6EI 3SDGA 4UV9A 1AHDP 4G7OF 1HQCA 2G0EA 3QPTA 4IHYA 3S1NJ 4PFOA 2VI6A 3L2QA 1K78B 3CD6I 1R49A 1F9NA 1G3YA 1JKOC 1J09A 4XRMA 2ZXIA 1WCMJ 1OFCX 3OMYA 4E7HA 3MZ8A 3O6BB 2HGCA 3CMMA 1V3FA 3HG9A 5HS8A 5FKMA 4ZC3A 2RN7A 3M07A 2QEXI 3QOEA 3CCMI 1HF0A 4BXXJ 3J80Z 2TCTA 4MNUA 2ETHA 1ETVA 4UVAA 2KLOA 1IRZA 1YW7A 3M8JA 3TO7A 3GMEA 3HTUA 1XCVA 5AONA 4CO8A 3J7ZI 2IT0A 2E2IJ 3BQYA 2AO9A 1B9NA 1OCOH 2GIVA 2KIMA 3V7CA 3PIPF 4RB2C 2E19A 4NB5A 4L9TA 5KVRA 5J8CA 5M3FJ 4KISA 1ZELA 2DJNA 2M9HA 2DA7A 2LR8A 3K1MA 2X6YA 1YLFA 4IRHA 1DU6A 1R5GA 3FXRA 2OAZA 4KN7X 4EEFG 3GFIA 4XQFA 3RYPA 1PUFB 3ASOH 3U21A 3GZ6A 2BW3A 1LNWA 1XGOA 2ZCWA 3K4KA 1YX5A 3FK6A 3OWTA 1JXSA 2DYRH 1XTAA 1BL0A 2O8KA 2C6YA 5LGNA 4FE7A 3OL4A 1BIAA 3VPRA 2HVSA 2EFPA 5ERIA 3O8HA 2HPIA 1FTTA 1S7OA 4HNUA 5HLIA 1RZ4A 3MQ0A 1OPCA 2IXSA 2K7LA 1FY7A 4U88A 3HYIA 5EGOA 4A3KJ 2HVRA 3ASNH 1KU2A 4L9JA 3GTLJ 3KP7A 2R4GA 4Z2YA 4RGSA 2Y69H 2HYJA 2L7MP 2CW7A 5GTHC 4RAFA 1T08B 2ZMEB 4A3EJ 4ZTJA 4IPAA 2L9VA 2PJPA 1XGMA 4BEHA 5EEAA 1FBSA 3L1PA 3FXQA 3RIRA 4EJTA 3RI4A 1GXQA 2DAOA 4HOBA 3VSKA 4Y33A 1J5YA 1B72B 2LY9A 2L02A 2ISYA 5KCMA 3O8GA 3LSTA 4EVIA 4C2UA 1FOYA 1MBJA 4ESBA 2Z99A 1QZYA 4ZYHA 5HS7A 2BBYA 3KZZA 1WH5A 2GXGA 3DP7A 4GYIA 2UV1A 5LEKA 3WODF 2XPWA 1NH3A 1GV2A 5C44J 4PK4A 1D5VA 2MH2A 1PVEA 3IHUA 2M30A 5KHDA 1GHCA 2EA2A 3EYYA 3Q9VA 2CFOA 2K9LA 3NQOA 3COAC 4HPQA 3ZOBA 4RLQA 2FQ4A 3B73A 3HKZN 3EDPA 5EJCA 5DM7F 2IGNA 4A3GJ 1WRJA 2JJ7A 5JI6A 1AKHB 2ME0A 1R6RA 1K61A 2EZIA 1NG7A 3AG1H 3AG4H 3ZQ7A 2KT0A 1E3HA 3RTRA 3I56I 1FT9A 5FKLA 2X1EA 2X1CA 3HIFA 3FXJA 1Y1WJ 3DFGA 3PQKA 1J9IA 4HSTA 1UMQA 3BZKA 2P4WA 2VC0A 3F8BA 2VJJA 4BDZA 2EK5A 1YIOA 3WU0A 3H92A 3KYDB 3MKYB 3NARA 4DW6A 1R4NB 2OUMA 3F8NA 3ZPLA 1SD4A 2VBXA 2CWEA 3OIPA 3JR9A 2DODA 3HPHA 4XNFA 4PUSA 1VTNC 2ZSIB 3CDLA 1ODDA 5K7FA 4DYRA 4BH9A 5H6RA 5IP9J 2JVHA 2FNAA 3WGGA 5GTIC 1X4PA 3CMAI 2NVUB 3BLYA 2LBFA 1ACIA 2HNHA 2X51A 3JAMK 5ILUA 4DQ2A 4M3FA 2K4JA 3FXUA 3P5JA 3HUGA 3WE2A 3DEEA 1IAWA 2CUJA 4PJMA 5J47A 3JRCA 4HRIA 3HUGB 4PJJA 3FHNA 2XV4S 3FWEA 2RAEA 2Y30A 4XM3A 2M45A 5L3GA 2D1VA 2GAUA 4H4KC 2JA8J 1QQIA 4R1HA 3RPQA 4XK4A 4BL0B 1HW1A 3M3YJ 4RB0A 2FJ1A 3V7RA 1O3TA 1MNEA 1QGPA 3KZYA 2QSHX 5FO5A 1AWCA 4M74A 1R4MB 2H6BA 3TDZC 2LDUA 2MFZA 4RB1A 1JGGA 4D1QA 2GA2A 4DZJA 2W24A 1GV5A 4AUXA 2P5VA 2XB5A 1PP8F 2ECBA 2FQ3A 2RQQA 2CUFA 1IXRC 1MGTA 2X6WA 2R7SA 4EM1A 1K83J 2W00A 3PUBA 3VYRB 5ILSA 1M1EB 3R61A 2R7UA 2EIMH 1BBYA 3D5RC 3HOVJ 2DOFA 1X2NA 4DYCA 3KP6A 2VE8A 3MFKA 1IV8A 2KZVA 3BJOA 3FF5A 2Z9OA 2GXBA 2W84A 4YFNF 3SEQA 2I5UA 1TLHB 3IAM2 3OOPA 4LOCA 2IAIA 3F23A 1VQ8I 1UJ8A 3FMSA 2LREA 1QBJA 1F43A 4P55A 4II3A 4CXFA 2VJIA 3LMMA 3JAMZ 2DLLA 2OBPA 2R7ZJ 3GCMA 3L2VA 2K9MA 1MJ9A 3NRVA 1R1TA 1MNMC 1HC8A 1XB4A 5DYMA 2Y0SA 2DBBA 3BG6A 3IUOA 3M1CA 1Y0UA 2CUEA 1OCZH 4HYEA 3MKZA 2K86A 1J59A 3ABLH 2IVMA 1YG2A 1ZG1A 4GRIA 4S0HB 2PMUA 2GQQA 3BCAA 3HXLA 3GFLA 3Q0WA 2LOOA 1LQ1A 1H8AC 1RKWA 2JA6J 4V2GA 3RKWA 3GBGA 4AIDA 1KA8A 1GLNA 3V42A 1TWFJ 5FLXZ 2QWWA 1AU7A 2XAJA 1B1BA 4IO9F 3GUDA 2VQGA 1WJDA 5KAFC 3ZN0A 2D5VA 4Y17A 2R7QA 3OOUA 2VUMJ 3Q0VA 3FM3A 4M6VA 1D5YA 3F9KA 4XKWA 5CVIA 5B3SH 1B72A 3HPGA 2EQRA 1XS9A 3BJAA 2LYCA 5EG0B 3H35A 4RBOA 3BQZA 2QENA 2NOGA 4NHJA 2X85A 4E7JA 4ETSA 2Y2ZA 4CZZA 1P7IA 5IT9Z 4KMFA 3H1CA 5LGTA 3O2PE 3PM1A 3TW7A 1ZN2A 2XAHA 1YIJI 5E79C 1XX5A 2KIFA 4ABZA 1BR2A 4HQMA 4L18B 3J80K 2ZJQF 5IOZA 4KIFA 4BQNA 2CGPA 3M1EA 1XG1A 5ED4A 2XAGA 9ANTA 1HOMA 5CVRA 1TQIA 2Y75A 3J7YJ 3OYJA 3JREA 1TWGJ 3F8FA 4XSXF 1YX3A 3LSRA 4JX4A 2ZC2A 2OA4A 1WJFA 3ZMVA 3CJNA 2VPLA 2PX9A 1JJ8C 4D5FA 2P5LC 1T6SA 3OYGA 3HSEA 2BEOA 1W7PD 3H5AA 1VQNI 2P6TA 2F4MB 3PO3J 4WXCA 3ZMDA 5HLHA 5GADJ 3E1SA 3WGHA 1E2XA 4PJLA 3HRSA 2CJJA 2FMYA 5CKTA 3PFYA 2HOSA 4QSHA 4XLNF 4UHTA 3ISPA 4IVNA 3FKIJ 4YIRX 5DCMB 4J19A 4U7DA 2L9RA 4NUBA 3K2AA 1FBQA 2KHMA 1AOYA 1X58A 1SFUA 3E7LA 4I09A 4G7ZF 3GEZA 1ZG5A 4J01A 1UHSA 4U0VA 4YFKF 2YU9J 3CC2I 1UG0A 2H8RA 1FOXA 4LD5A 5F0FA 1ZLJA 5DUIA 1FTZA 1FYMA 1TT5B 1JUMA 5E8IA 3BG5A 3ML6A 4D9JA 2XGEA 4E70A 5BQTA 4ZDPA 2DI3A 5LRSA 1U3EM 1TL8A 2JA5J 2Q8KA 2WTEA 2E7XA 4Q4ZF 3SHFA 2VKHA 2JWTA 2ZFUA 3K1PA 3JSPA 3TKYA 4XLCA 3U2RA 5F64A 1YJWI 3SQNA 2K02A 3J7AY 1LDKB 4EJUA 3EYIA 2P7VB 4LIVA 2FOWA 3SXYA 1MMDA 2XGXA 1BOAA 3DKWA 3Q3SA 4HSRA 5L3EA 2E1MB 1WJCA 2P6SA 1DP3A 4XKVA 3VSLA 4A3BJ 2ESNA 2W48A 1XMAA 5FRMA 2HDCA 3G1LA 4N9IA 1RC9A 2OQGA 3BG9A 4CZCA 1YITI 2HU9A 1FLIA 1KZHA 1JKRC 1A6QA 3CCYA 2ME6A 1UAAA 2QQBA 4UB6C 1UHWA 2ID3A 5L3FA 2JUCA 2L4MA 2NRAC 4FHTA 5A2QK 1D8KA 2ZBKA 3KYLA 4YEJA 3OYMA 1K78A 3OYCA 4RB3C 2RQPA 1BIBA 1NHAA 2ZJRF 4ESJA 1AKHA 1TZLA 4NC7A 2IA1A 3CCRI 4MQ9F 2LRDA 1BR4A 4P5OA 1U5TA 5F6FA 4DZPA 2PEXA 1SFKA 4UUTA 5BMZA 4NDLA 3VB2A 4F3QA 4KYWA 3IH2A 3TGNA 1O3QA 3HOWJ 2DOAA 1TW2A 2X48A 4C30A 3CCJI 5FKOA 2FF4A 3KLNA 3KIOA 2KPMA 4M71A 1KU3A 1MMNA 3CUOA 1H9GA 3RSNA 3HZJA 4W1UA 2QM3A 4UUSB 2E1MC 5DS9A 2PFBA 4RGXA 4L0YB 3BWGA 2HOTA 1J0RA 1STZA 2R7WA 2OTLI 3F8CA 3ABTA 4E7KA 2BYVE 3OY9A 3KEOA 5DD4A 4ZYDA 1ETOA 2L54A 5DD8A 4LLLA 1I50J 1R7JA 2Q0OA 2IW5A 2VL8A 3ZQIA 4G7HF 3BR3A 1D1CA 1CQTA 4CCOA 4YELA 4CYDA 2HVQA 1DGRM 1N77A 1SFOJ 3E6CC 1D1AA 4PSXA 2AQFA 4IQJA 3W3CA 4KT6A 3CUQC 4RGRA 2E35A 2K40A 2ZMEC 1RKTA 1T39A 3KE2A 1VQ7I 4HZFA 4WWCA 5D6FA 3A0BC 2DJIA 3G4SI 3BJ6A 4EMSA 3V7SA 3K4BA 2W82A 1XCBA 2STWA 3E5XA 2E2JJ 2M0MA 2YU3A 4OINF 3RPUD 2F5FA 1W4MA 3ONQA 3I4MJ 4G9YA 2JZYA 4ITVA 4EJOA 1X4OA 2DT7B 2DTZA 2VPRA 2WAEA 1BR1A 1U9OA 3E6DA 4I7HA 4LB5A 2IS6A 2BY0A 3BDDA 4KN4X 3WHCA 3DKYA 1JKQC 1ENHA 3BPXA 2RGVA 5F08A 2EV5A 2BY3A 4BXFA 3IV5A 3KCCA 3VYSB 1QZEA 1CF7A 3NWSA 1Y0NA 4KMUX 2P0WA 3JRHA 2F5CA 3S1QJ 3W2WA 2XKPA 5C4XJ 2LVSA 3CJQB 2EWNA 2EFQA 2R5YA 2XPUA 3U1KA 2L7ZA 1R5HA 3LL7A 2GOXB 4AU7A 3KP2A 3WU1B 1XMXA 3S2HJ 3JSOA 5CYVA 1MZBA 3M8FA 2Z16A 1LFPA 4MIMA 2GM4A 4BJTA 2DMPA 2HS5A 3OSGA 2NAZA 3ZCOA 1FZPB 3DTIA 1ETWA 3QYEA 1A04A 3I0TA 2UWMA 3MVPA 4U7BA 1T38A 4C2MJ 3GTKJ 1T2KA 3ZQQA 4QPQA 3LA3A 3K70D 5HLTA 3ABMH 2VBYA 1TQPA 2QYOA 2XPVA 5J4VA 1S7AA 4IEJA 1P4AA 1MBEA 2XAUA 1JJ6C 2KJCA 5J40A 2BVLA 2ZXJA 3LSJA 2KKOA 4PFPA 5FB2A 1YE9A 1IDYA 5M5YJ 4A3IJ 1MH3A 2K9NA 3CF2A 3ZMTA 2KMUA 2QBYA 1OCTC 5FD5A 5JLWA 1R00A 3WHBA 1ULYA 3GFJA 2GOMA 2N8GA 1B9MA 2QQ8A 4XR6A 1VQLI 1I6HJ 3ABKH 1OQYA 3DF8A 5FLVA 4AM3A 3GLXA 3BCBA 2WA0A 1W5CC 2NVXJ 3QP5A 4HDVA 3ZQCA 1TW3A 3JCUC 2VN2A 3W6VA 2VBZA 1U5TB 3A4CA 1LEBA 2W4SA 1VNDA 1ETKA 2K3FA 3HGYA 4JOMA 2FEZA 4U87A 1YOVB 2NS8A 4I02A 4XLFA 5J6XA 1MJBA 2BXZA 1POGA 3A02A 1GUUA 1SANA 3FKJA 3KP5A 1R23A 5D8LB 4IRIA 1BI2A 2LY1A 2GIZA 2AHQA 1Z6TA 1RPWA 2KP6A 4M73A 1MSEC 2STTA 2DQLA 1I5ZA 1KYZA 2BVMA 2K9SA 3RYRA 3GWZA 1K6YA 3EETA 5F0CA 3LAJA 2L4AA 2WWYA 3VFZA 4I0AA 2H1LA 2M0CA 4KIBA 2PQ8A 3FXKA 2X1DA 1Z7UA 1ONVA 4JK1X 1X19A 3QQAA 1VQPI 3ZMSA 1OJLA 2FU4A 5D5XB 1CF7B 3ECOA 4F92B 1Q1VA 4XLHA 3H3VK 1NG6A 3S15J 3K4MA 2DYSH 3KLOA 1T98A 2FBHA 3HHHA 2WBMA 1WQ2A 3T8RA 4AWXB 2GWRA 2BOLA 1IUYA 1PUEE 3RCOA 1QPIA 2M7AA 3R4KA 2WAQA 2B7EA 3IH3A 3EUHA 1BJZA 3WU2C 3JRBA 1ZREA 2DA3A 1QVTA 2VT3A 3IC7A 1XDSA 1VI0A 4BBRJ 4D0PA 1HXDA 2HWVA 2BXYA 3K9TA 3OYEA 3S3OA 2HEOA 1UG2A 1BA5A 4K2EA 1Z1DA 3LA7A 2CQXA 1N75A 3RQIA 3AL0B 3BP8A 1Z9CA 3GTQJ 4OAZA 2HQAA 2CU7A 3LFUA 4AIJA 1KONA 2DPDA 2IRFG 1MNDA 1S29A 3K7AJ 2I8DA 4B3XA 1TTYA 2QSGX 1FX7A 1JE8A 2E34A 2H8WA 1IN7A 3A1YA 1R5ID 1J7KA 5IYBJ 1H0MA 3KFWX 1ON1A 2CMPA 1TWHJ 4N4NB 1MBFA 3EQLF 2HDDA 1MMSA 4XOTA 3G1OA 3G73A 2LBFB 5LHHA 3C2HA 4P9UA 1ETXA 2R7OA 5TJJA 5H20A 1W0TA 2ZSHB 5J4YA 4KJZA 3D1NI 2LC2A 4XRFA 2BY1A 4KIGA 4FCYA 2VXZA 2VKDA 1P6RA 2LSOA 3RJPA 2F48A 1XSDA 5B1AH 4P1WA 1T56A 1VF9A 1MMGA 2L9SA 2Z1DA 2MYSA 3CTAA 4OMZA 1R9TJ 5K5OA 3SFIA 3T5XA 1H88C 3N05A 4HQEA 3D0SA 2P7CB 5FRNA 2VBWA 3OYBA 1G6NA 2ISZA 4JQFA 3FXOA 3WTSC 1DP7P 1A31A 4KITB 2D2WA 5CVJA 1E3OC 1RNLA 2L2OA 3S14J 2MGQA 3BR2A 2PG4A 3A01B 2KDZA 3UR3C 2DA4A 1F36A 1SD6A 1WJAA 4HX8A 2EH3A 3DWLE 3DTEA 1V54H 2MW8A 4ZZLA 1A35A 2JA2A 2M8EA 5IP7J 3CCSI 2YUSA 4CDGA 3LAPA 2QSFX 3HC7A 3BZ6A 1SD5A 1I3AA 3WG9A 4JX6A 2DN0A 3O3KA 1U8BA 1ZYRF 4PJ0C 4M3EA 2VJ5A 3DPTA 2RKHA 2Q1ZB 3P9IA 5L3CA 3CMYA 3ZP5A 2NXNB 5K7HA 2ELJA 1R71A 5DCFA 1K6OA 1QRYA 2NYXA 3F72A 2EPFA 3VWBA 3HM5A 1C0WA 2JPCA 1HDPA 4FQGA 3D5SC 2LMDA 1K4TA 4HA8A 4D7NA 1SMTA 2DA2A 3CCUI 1KU7A 1IN5A 2LTPA 3TOBA 5JHUA 3JTGA 4HF2A 3NEUA 2B9SA 1UB9A 5B66C 2DA5A 3MZYA 3DPLC 4EJWA 4XMYA 4XLEA 2ZO4A 4L0ZB 2M7BA 4A3DJ 4HLXA 1OMIA 4MQVA 1TT0A 4G94A 4A5NA 4ZDLA 1YHQI 4U0WA 2QLZA 3GZ5A 1WI3A 3LA2A 4XLAA 4DJAA 2ESHA 1U9NA 3RKXA 5ICGA 5JVGF 2MC4A 2FSWA 4BBSJ 3HOSA 3VOEA 1YRNB 3LQRA 2MSYA 2HI3A 1QO0D 1HDDC 3IKVA 4WCGA 1JT6A 4CCKA 1R1VA 3U9GA 4UVBA 3SJMA 4BXUA 4Y52J 2YX4A 1HW5A 3LSGA 3MEXA 4ESFA 2CSOA 4RAZA 1Z21A 1X3ZB 1HW2A 2JMWA 1JUPA 4R8HA 3R0AA 5FLXK 4DOZA 3BR1A 2XVCA 2HQ5A 2R7XA 3KZIC 3WG7H 3DBRB 2OV7A 3BTIA 2WV1A 4B44A 3IWZA 2QGUA 1A6IA 2CYYA 1ZK8A 1ZRCA 3R60A 2M34A 2H6CA 3BTCA 2OCCH 1VQKI 3DKXA 2ICWG 5L3BA 4IHSA 3D5LA 4LK1F 3L7WA 3MMYB 1P9QC 1FYLA 3PSIA 5E3MA 2IJLA 1BI1A 2H94A 1W7PA 2DK8A 5J1UA 5BS6A 1O4XA 4IQ4A 1FOWA 3FMRA 5BPIA 2GLOA 5EF6A 3OIOA 3GF2A 3PNVA 1OYWA 2E1CA 2BE5F 5IT9K 4IF4A 4PGHA 5IYCJ 2K3PA 1VQ9I 1ZGAA 1LE8A 2H1KA 3SZPA 2XASA 4A6EA 1I39A 2XSDC 1IRXA 2LF7A 2DPUA 5K7ZA 3T1BA 5D5VB 2O6GE 1KU9A 3LSIA 4EJVA 2F5VA 1UELB 1J75A 2P5KA 4MEYF 1Z3YA 4RS8A 5L3DA 2Y31A 3MD2A 2DFEA 5CVUA 1FOKA 5LRRA 2DDBA 4F91B 2KDOA 3QPLA 2VQLA 3L00A 1MKMA 4E4HA 1F4KA 1SAUA 1Z6RA 2M8GX 5FLMJ 4BE2A 1RESA 1R1UA 4B09A 1XC5A 2IP2A 3LSPA 3CP2A 1QU3A 4MFEA 2ZMEA 3G2BA 2R3SA 2KZGA 4OIPF 5DV5A 1JKPC 2NOJB 2L7KA 4IRGA 3VODA 2VOOA 1XSXA 3L2RA 2EILH 4B1RA 2VQHA 3I53A 5HNHA 2EFWA 1V5GA 1GVDA 2HKXA 2LFBA 4BUPA 3CQZJ 2HPMA 1ZH5A 2KJBA 1YW8A 4A3JJ 2KRHA 3IP4B 3GZNB 4KT5C 2IBDA 2OU2A 1LE8B 4WXDA 1QHHD 2W1OA 4JBAA 1D0ZA 1MJAA 1JI8A 5DCMA 1WHUA 1LVAA 2CQKA 1TWAJ 3AG3H 2E36A 3H5RA 1OCCH 4ZYGA 2VLAA 2VJ4A 2PJRA 4G8XA 4F55A 1FSHA 3H5NA 3OR2C 4XLPF 4ON0A 2QQ9A 2XUBA 4BKXA 4B8XA 4MFDA 3PNYA 3SYTA 1BJAA 3C2GA 2PI0A 2HQRA 1ZLKA 4HX7A 2FE3A 4XN0A 3DBHB 3H0DA 3FMQA 3CZ6A 3FXLA 2A69F 2E2HJ 4RAYA 5J1RA 3I3LA 5F1RA 3VEPA 4A5MA 3M4OJ 3J81Z 5GPAA 3ZQHA 3ZXSA 4DIQA 4UUVA 2M3AA 2Z3YA 1PP7U 2GZWA 1OLTA 2YX7A 2DOEA 3HOUJ 1OYYA 2DFFA 3MKWB 1HKSA 1KQ9A 1IN6A 3DCFA 1JUSA 3C7JA 1DGWY 1V5EA 2JSCA 1RI7A 4D5CA 2HKOA 3FIWA 1IZ1A 1QHGA 5KNLA 2RVCA 1JGSA 4HBLA 3M8EA 2QUFA 3TO6A 1UFMA 4IKFA 3VYTB 1ZARA 3ERMA 1LVKA 2E71A 2F2EA 4A0YA 4A3MJ 3H3ZA 2WY7Q 1Y8QB 4LG0B 2XAQA 3GYHX 1PYVA 2QZ8A 3OS0A 5JHFA 3I4NJ 4FASD 2HOAA 2YR2A 4EQQA 1LPQA 3CJTB 2RREA 3B02A 4FT8A 5HS9A 4AVZA 3V8KA 1T0FA 2RNJA 2EJRA 4B4CA 3I55I 3HOZJ 3FK7A 3G3ZA 3QU6A 3TBIA 1SFEA 2GA1A 2BHYA 2W25A 3QWLA 2VXDA 4G6QA 3OS1A 4A2UA 2D1HA 2ELHA 1E17A 2I10A 3NAUA 4MTEA 4CA0A 3E5QA 1QPMA 1EA3A 5C4JJ 3GTOJ 4M3GA 3KYCB 2LF8A 4XRSG 1UHMA 3E0JB 1S8NA 4U0YA 3DXJF 5EEGA 1ZRDA 2JRMA 5D5UB 4L9NA 4E7LA 3CUQA 1R58A 4HF0A 5D4RA 3RQ4A 2JQ7A 3BR0A 2IEKA 1NK3P 4RGUA 1S5LC 1LB2A 1VQ5I 1HSJA 3TO9A 4UY8I 1T33A 3L2WA 1Z91A 3PFIA 3CO7C 2V6CA 5AIQA 2JN6A 1LFBA 2O9LA 3I58A 4QWQA 5LD2C 1VQMI 3QYBA 2FBKA 5FKNA 5HDGA 3CCVI 1IGNA 1E3PA 4NC8A 1PJRA 1I6XA 2EA4A 1YW9A 1ON2A 2O7OA 5E20A 5D6EA 4S05A 5HOOA 4AC0A 4M9SA 5JLXA 2EV0A 2MLKA 2A5WA 5LLQA 3L2UA 2PMHA 3EUKL 4B47A 2EFNA 5EZGA 4CUGA 2WADA 5CPRB 5FFZA 1GVJA 5FJ8J 3K70C 3C18A 1X1AA 4XONA 1FEXA 4BY1J 2NNYA 2HZTA 3F6VA 1U0JA 2X0LA 2PMZN 4Y4RA 2IA2A 2XRLA 3H9QA 1G3TA 1WJBA 4XORA 5D8KB 1K7AA 1MBGA 3HOXJ 3ELKA 3A2KA 4PGGA 3IL2A 1D8JA 2HXOA 1FBUA 2F4OB 2E1OA 3SZGA 5ICCA 3LNQA 3CUQB 4GDFA 5K5RA 5F0HA 1IJWC 3V8JA 3W2AA 1QVUA 2LKSA 3MCZA 4HV5A 3CJRB 1U6GA 3L09A 5TISC 4ENKA 4ZH4F 2OF7A 4ZYAA 1E0EA 4RAGA 3OYIA 3KP4A 2WAQN 4MHGA 2RDPA 2O61A 1MBKA 3F21A 1D0XA 1WGXA 3GFMA 4M3BA 2R93J 1XDUA 2ELKA 2IGMA 1WJ5A 2ID6A 3P7NA 1SFXA 2RV8A 3TQNA 4FISA 3ZR8X 4I6ZA 2CS3A 2LKPA 1D1BA 1Z3XA 4M9ZA 2KISA 3N97A 3LSKA 4OAYA 5LHIA 2WB1A 1PDNC 4BS9A 3HOTA 2CUZA 4KDPA 4G6TB 2MD5A 1R36A 3PQJA 2A68F 1G4DA 3DPUA 3FDYA 1HSTA 2QVOA 2DFIA 3QPSA 2A6EF 5LGUA 3JRAA 3RZDJ 2LLKA 4YFXF 5E1ZB 3HBLA 3ROUA 3HRTA 1YS6A 3R6SA 4OWRB 1RR8C 2VIXA 3EUHC 1MIJA 3I59A 4MO7A 4M6YA 2Y9YA 3MAJA 4LIUA 2R5ZA 2LY2A 2VODA 1SVMA 3RKYA 4OMYA 3SFZA 1P2FA 1SVOA 3BG7A 3CESA 4BAYA 1P92A 2XSJC 1BI0A 1XPXA 1VZ0A 1W5TA 2BW3B 4BHCA 1OCRH 4BQQA 5C3EJ 3OV8A 5HDNA 2X9DA 1WVRA 1IUFA 3K0LA 4B43A 3JRFA 3ZGKA 5K5QA 2RC4A 2HFHA 3KEYA 3FHZA 1VQ6I 4F52A 2AS5F 2V9PA 3LFKA 3LSHA 4BJ6C 3WTZA 3J81K 5IYDJ 2LKXA 4P96A 2XHKA 2FD5A 2LK2A 2L0KA 2LNBA 2XF5A 1WI9A 2ZXHA 4J00A 4N9HA 3QODA 2L5QA 3ECHA 2BZTA 2WY8Q 1YJ9I 3UKGA 1Z77A 2FRHA 2FA5A 2HTSA 2V9KA 4IXAA 3Q0UA 1OYIA 2YSRA 3AL0C 1TNSA 1XSVA 2EZLA 3P9KA 3GTPJ 1SC7A 1O3RA 1EJ9A 1B6AA 3IRRA 2VE9A 2V79A 2V1UA 2K4BA 3BROA 4BEHB 3I64A 2Y48A 1DU0A 2V1NA 3PIOF 2YPRA 1IF1A 5E17F 2M4KA 2ZNZA 2OTJI 4QPOA 4P9FA 2Z2SB 2IS4A 4IOCF 4IL6C 1O7FA 3P9CA 5E3LA 3IAS2 3FXMA 1S6LA 4DGWB 4XKBA 2MLGA 3A01A 1YRNA 3TL4X 3K6GA 3E6MA 2FXAA 4G12A 1N78A 1BI3A 1V4RA 2K9QA 4CCLA 5H6QA 1XGSA 1GDTA 2QF7A 5J1YA 3DTKA 3FBIB 4E6KG 5K1YA 4CYCB 2K27A 2V7FA 4I2OA 1QNTA 2HQNA 3FM5A 3E97A 6PAXA 2ZJ2A 3CCQI 1RETA 4NNJA 3EUAA 1YTYA 2VC1A 2EV6A 3CDHA 3FBNB 4C3JJ 2V1DA 4BJ5C 2AXTC 1OR7A 2CO5A 1LKXA 3I54A 1S72I 3H3UA 4M9XA 3HTSB 2AQEA 2HZDA 1YO5C 1T0FC 2JTVA 2MBFA 4DBQA 1JTYA 4CCJA 2P81A 4A12A 4BDYA 2E7WA 3AG2H 2DA1A 4UB8C 1G2HA 1ZR4A 3BT9A 5GPCA 1TNTA 2HOEA 1Z67A 2KL4A 4IHXA 3GX4X 2EBIA 4LMYA 5IP6A 1WWXA 4YIIA 3I71A 1G8XA 1MH4A 4A0XA 4ZZDA 3C3WA 1WZ2A 4I99C 4AYBN 3ZMZA 5E18F 4JP0A 2OZUA 4HAMA 3S93A 3HB9A 2IGOA 1WSUA 2KIUA 2L01A 5FD6A 1A5JA 3HRUA 4GCVA 5F1JA 1G3WA 1SMYF 1R22A 2MG4A 2WAFA 3BR5A 3DLAA 1EF4A 2NS7A 1X3WB 3UNGC 2VT2A 3ZQGA 3OYHA 4PJNA 2JT1A 5E8GA 1OISA 3E6BA 3F8MA 1Z0XA 2IA0A 4M72A 2CV0A 2NVQJ 2DW4A 4EGYA 2J5OA 1IV6A 3HSRA 5LEJA 4WF2A 5EYRA 4ENJA 2R0QC 3B6AA 2L9NA 2F6CA 3K4JA 4M3DA 5IPAA 3S17J 1RR7A 5GAGJ 1FPQA 3J7AO 2W57A 3CLOA 2OC6A 1I27A 3CF5F 1YI2I 1S7EA 3BG3A 4XBFA 4CCMA 2HTJA 5ICEA 1V55H 3CMEI 4IHTA 4PCQA 3LWFA 1GXPA 4XIDA 3GXOA 2HR3A 1K4SA 3QAHA 5CQGA 1SVLA 2KRCA 2DMQA 4I76A 4A3FJ 3CLQA 3H36A 2UUZA 4X1EA 4BE0A 1MDMB 1UCRA 3FX3A 4RMNA 1G3SA 3SDBA 2R7FA 2V1XA 2R7VA 3BTJA 2K5CA 4CICA 2LD5A 1BM9A 2F4IA 5CJ9A 5CVVA 2M2EA 3F22A 5IY5H 4AYBA 4EATA 1LDDA 2R5ZB 1FNNA 2XAFA 4I98B 3OYFA 2DQRA 1H89C 2XIGA 2XF7A 3HSFA 1APLC 4CSWA 5D5WB 2E5NA 2EZKA 4UUSA 2W7NA 3F6OA 3QOPA 1UZCA 2VONA 3OR1C 3HHGA 1BC7C 3BR6A 3K10A 5HDKA 1O3SA 4A69C 4GXOA 3RDIA 3KETA 1F1ZA 1L0OC 3WTXC 2HXIA 4HDUA 1XD7A 2BV6A 2G7UA 2QKLB 5EZHA 4OIQF 4MGRA 2HYGD 4XSZF 3G71I 1IXCA 2DA6A 3BPVA 2E1NA 4V2FA 2OQRA 1IXSB 4C3HJ 3BC8A 1EV7A 2KQRA 2BGCA 2FX0A 1HA8A 1ZG3A 2CQ7A 2XDVA 2X4HA 1W1WE 1FJLA 5F04A 3PUFA 4LLGF 3JTHA 4UXNA 4ASNA 4Y7NJ 1X1DA 2F5EA 4UVCA 5E1XA 5DTDA 1DQUA 2FMLA 2QA4I 3GO5A 4B3AA 1EH6A 4C3IJ 3F0CA 5GP9A 1KQ0A 3FZVA 3DU5A 2QCOA 4II2A 3W6KB 4NQWA 4UNOA 1FC3A 2KRFA 1J2XA 5CQEA 2EFOA 2CW0F 5E3NA 1RUNA 3S8PA 2MD0A 5AIPA 3QYFA 3WGIA 2EIKH 1JHHA 1EH7A 4ZJZA 2FNPA 4ZYEA 1ZR2A 1X3UA 4DYQA 3I9V2 1ZRFA 1ZGJA 3I4PA 4BU2A 2F5DA 1LJ9A 1I1SA 1ZTRA 2M87A 3WTTC 2X6OA 3IH4A 5D4SA 2CV1A 1JTXA 3OSFA 3PJRA 3T0YA 4X0GA 1FIAA 1NTCA 3TW6A 4NBQA 4S04A 2OJED 3V8LA 1U2WA 3ZN1A 2W85A 5LHGA 2PN6A 3ZQLA 3W6JB 2O8XA 1IO2A 5J8FA 2A05A 3T8TA 1MDMA 3HOYJ 3ULQB 1P7JA 4YIFA 4HG2A 3LOCA 4XN3A 3FISA 1HBXG 2UZKA 3R0JA 1W5SA 1KGSA 1TBXA 4BQAA 3S2WA 2XROA 5DUKA 5H2FC 1IW7F 1ORKA 1DUXC 3TDUC 3KEQA 2CW8A 2M5WA 4DNCA 3DV8A 4G6DA 2CFXA 2DK5A 3E3VA 3CC4I 3GTGJ 2E60A 3U1DA 3ZQFA 4BGDA 4IHVA 5M5XJ 1VQOI 2VKVA 3JRGA 2ZNYA 2JRTA 1ERDA 3DBLB 5FFXA 4RA2A 1AA7A 4WK8F 2XGDA 2ECCA 3IRQA 1RRJA 1FMVA 4GYGA 1P4WA 3KP3A 3S3NA 2TRTA 1MMAA 5E3OA 4F7ZA 2E5ZA 4HX4A 3HKZA 2CRGA 2FUG2 4HLYA 3JRIA 1ZGWA 1BOBA 2MH9A 1RIOH 4IZZA 3BY6A 4M6XA 4ENNA 1A36A 5KK1A 5LBQA 3CC7I 3H0GJ 1Y8RB 4LB6B 3SEZA 4XICA 1FSEA 3ABUA 3WTUC 1HCRA 1X1CA 1OCPA 2LP0A 4A3CJ 4LITA 2AXLA 3CDIA 2DTRA 2QKMB 2DFHA 2GBYA 2NNNA 4EM2A 3QPHA 3CO6C 4V19K 4MEXF 4Y15A 1FWZA 3TMOA 3BTLA 2MA3A 1I3QJ 3Q9SA 5IOYA 4JYKA 4OU0A 2GXAA 2FOKA 4OIOF 4JX5A 2JA7J 1B8IA 2RNGA 2VASA 1T95A 2LG4A 3S1MJ 1MSFC 3KX2A 5DM6F 1FP2A 2MC3A 4BACA 5BOXA 2CV2A 2QQAA 1KYWA 2HYFA 2M4GA 4OOIA 4ZTFA 2V26A 1ZKGA 1IC8A 2XRNA 4D7MA 1USTA 5BNGA 3PSFA 3CCEI 2PMZA 1ZHFA 1NK2P 2R5YB 1MBHA 1IN4A 2O0YA 4GO1A 2DMUA 5HODA 2VQCA 5F27A 1G59A 3DLLF 1D0YA 3AKZA 3MWMA 1DPUA 2J5PA 1QA6A 2Z5UA 2DT6A 3OYLA 2A07F 5FGMA 3I59B 4E7ZA 2R7DA 2O5RA 3OYDA 4PDKA 4X6AJ 2IPQX 3GLLA 1B4AA 1WPKA 1W7PB 3ZRGA 4FE4A 3LSMA 1JT0A 1XGNA 3HEFA 5JR3A 3S2DJ 4Z6YA 2TDXA
chains in the Genus database with same CATH topology
2WAQN 4RDUA 1MBKA 1WGXA 4M3BA 2R93J 2ELKA 1QPIA 1JGGA 2ID6A 3IH3A 1BJZA 4DZJA 1GV5A 4FISA 5J3LA 4AUXA 3JRBA 2XB5A 4I6ZA 2DA3A 2ECBA 2CUFA 1QVTA 4BBRJ 1VI0A 1GT0C 3GTLJ 2XB0X 1K83J 1UG2A 1BA5A 3HOVJ 2CQXA 3RQIA 4DYCA 1X2NA 3GTQJ 2CU7A 3RZDJ 3QPSA 1IG7A 3JRAA 4LOCA 2LLKA 2IAIA 3HBLA 5M5WJ 1F43A 3K7AJ 2VKEA 3HGGA 5M3MJ 5EGOB 2CQQA 3TP0A 4MO7A 1U78A 2NVYJ 2Y9YA 2R7ZJ 2R5ZA 5IYBJ 2R92J 3PO2J 1TWHJ 2HDDA 1MBFA 4IHWA 1MNMC 3G1OA 4L5EA 1ETXA 2CUEA 1W0TA 3D1NI 4FCYA 4S0HB 5C3EJ 2WB1N 2X9DA 3Q0WA 4W97A 4MLOA 1H8AC 1IUFA 1RKWA 3TEDA 2JA6J 1T56A 4V2GA 5EG0A 1VF9A 3JRFA 3GBGA 4HNVA 1R9TJ 2DMTA 1TWFJ 3GTJJ 2DMNA 3SFIA 1AU7A 3MKLA 5IYDJ 2LKXA 1H88C 2FD5A 2LK2A 3C2BA 2D5VA 2L0KA 3OOUA 1TC3C 1X2MA 3Q0VA 1Y1VJ 2VUMJ 4M6VA 1D5YA 3HDDA 1B72A 2EQRA 3UKGA 1XS9A 1Z77A 5EG0B 1E3OC 3Q0UA 4RBOA 2EZLA 3S14J 3BQZA 2NOGA 1BW5A 3GTPJ 2MGQA 3BR2A 3A01B 2KDZA 2DA4A 2Y2ZA 1F36A 1P7IA 1DU0A 2NVTJ 2EH3A 3PM1A 3TW7A 1LFUP 1HLVA 2MW8A 1ETYA 5IP7J 3A03A 4ABZA 2YUSA 3RZOJ 3TP3A 5E3LA 3RKQA 5IOZA 4JX6A 2DN0A 1U8BA 1W0UA 4M3EA 1XG1A 3A01A 9ANTA 1YRNA 4G12A 1HOMA 3CMYA 2K9QA 5K7HA 1GDTA 3JREA 2QF7A 1TWGJ 5J1YA 1QRYA 4CYCB 3LSRA 4JX4A 1FIPA 3HM5A 1RETA 1JJ8C 1HDPA 3JRDA 4D5FA 4D7NA 2DA2A 4C3JJ 4XRSA 3PO3J 2ZB9A 2LTPA 2B63J 2DA5A 1WH7A 3S1RJ 3DEWA 1B8IB 4A3DJ 2CJJA 1JTYA 2P81A 2HOSA 4QSHA 3S16J 2DA1A 4QIWN 1G2HA 1ZR4A 3BT9A 5GPCA 1WI3A 3FKIJ 4A3LJ 1U9NA 4J19A 4IHXA 2L9RA 3K2AA 2EBIA 5IP6A 4BBSJ 1MH4A 1YRNB 1X58A 2MSYA 2Y0SN 4AYBN 2HI3A 3E7LA 4JP0A 3G1MA 1HDDC 1UHSA 2YU9J 2OPTA 2H8RA 3HB9A 2XGCA 5F0FA 1BW6A 2YS9A 1JT6A 1FTZA 1A5JA 1JUMA 3GTMJ 3BG5A 5F1JA 3SJMA 4Y52J 2XGEA 3LSGA 2MG4A 3BR5A 1EF4A 2NS7A 2JA5J 2JMWA 1JUPA 3ZQGA 5EDNA 3BR1A 2JWTA 2HQ5A 1Z0XA 2NVQJ 1IV6A 5EYRA 3BTIA 2WV1A 2R0QC 2COBA 3B6AA 3MN2A 1A6IA 5IPAA 1ZK8A 4M3DA 3B6CA 1VFCA 3S17J 2M34A 3BTCA 3Q3SA 1RR7A 4A93J 4CYCA 5E3MA 1S7EA 3BG3A 4A3BJ 2Y9ZA 2W48A 5FKKA 5J1UA 4XIDA 3G1LA 1O4XA 2GLOA 3BG9A 5EF6A 3OIOA 2DMQA 4I76A 4QTRA 4A3FJ 4GFBA 1JKRC 3CCYA 2ME6A 4X1EA 2ID3A 5IYCJ 1ZQ3P 1LE8A 3BTJA 2H1KA 2XSDC 5K7ZA 2LD5A 2M2EA 4BY7J 1AKHA 2R5ZB 1H89C 2Y31A 1APLC 3QPLA 2EZHA 2EZKA 4UUSA 4DZPA 2M8GX 4UUTA 5FLMJ 4FTHA 4NDLA 1RESA 3BR6A 3IH2A 3HOWJ 1PUFA 1TWCJ 4A69C 1XC5A 2X48A 2JK3A 3LSPA 5FKOA 1ITYA 2HXIA 4MFEA 5EZHA 2L7FP 1ETQA 1JKPC 4W1UA 4UUSB 1IDZA 3SDGA 5DS9A 2DA6A 1AHDP 4V2FA 2G0EA 4B1RA 4IHYA 2HOTA 4C3HJ 2VI6A 3S1NJ 1GVDA 2LFBA 3CQZJ 1ETOA 2FX0A 1JKOC 4A3JJ 4XRMA 1I50J 1WCMJ 1OFCX 2IBDA 1FJLA 5F04A 3ZQIA 1LE8B 5FKMA 3BR3A 4Y7NJ 1HF0A 1CQTA 4BXXJ 2TCTA 5DTDA 4B3AA 1TWAJ 4C3IJ 1ETVA 3F0CA 1IRZA 5GP9A 2QCOA 1SFOJ 2E2IJ 3BQYA 2AO9A 5E3NA 4BKXA 2E19A 2K40A 1RKTA 4MFDA 5M3FJ 1ZR2A 2M9HA 2DJNA 2DA7A 2LR8A 4DYQA 1DU6A 1ZTRA 2X6OA 3IH4A 4EEFG 1PUFB 2E2JJ 1JTXA 3OSFA 2E2HJ 5J1RA 3FK6A 3I4MJ 1BL0A 3M4OJ 1FIAA 1NTCA 3TW6A 2O8KA 2VPRA 2DTZA 5GPAA 3ZQHA 1U9OA 4FE7A 3HOUJ 3ZQLA 3WHCA 3VPRA 1JKQC 3O8HA 1ENHA 3DCFA 1JUSA 5F08A 3HOYJ 1FTTA 1P7JA 3IV5A 4D5CA 3LOCA 3FISA 3FIWA 4A3KJ 5EGOA 3JRHA 2HYJA 1ORKA 2L7MP 4A3MJ 3S1QJ 4A3EJ 5C4XJ 2LVSA 2R5YA 2XPUA 5EEAA 3I4NJ 3L1PA 2L7ZA 3GTGJ 3ZQFA 4IHVA 3S2HJ 2HOAA 5M5XJ 2VKVA 1B72B 2LY9A 3JRGA 3O8GA 1MBJA 4MIMA 2GM4A 2DMPA 3OSGA 2XGDA 4B4CA 1WH5A 2ECCA 3HOZJ 1ETWA 3FK7A 2XPWA 1GV2A 5C44J 3MVPA 4C2MJ 3GTKJ 2TRTA 2I10A 5E3OA 3NAUA 2CRGA 3ZOBA 3JRIA 2XPVA 5C4JJ 2FQ4A 1ZGWA 4M3GA 3GTOJ 3HKZN 4XRSG 4IEJA 4A3GJ 1MBEA 2JJ7A 1JJ6C 1AKHB 2ME0A 3H0GJ 1K61A 2EZIA 3LSJA 4XICA 1HCRA 1OCPA 2LP0A 4A3CJ 2KT0A 3BR0A 2IEKA 1IDYA 1NK3P 5M5YJ 5FKLA 4A3IJ 1MH3A 2K9NA 2GBYA 1Y1WJ 1T33A 1OCTC 5JLWA 1UMQA 3WHBA 2N8GA 3BTLA 2JN6A 1I6HJ 1I3QJ 1LFBA 5IOYA 2O9LA 4JYKA 5FKNA 5FLVA 4JX5A 1IGNA 2JA7J 3NARA 4DW6A 1B8IA 2NVXJ 3ZQCA 2O7OA 3S1MJ 1MSFC 3JR9A 3W6VA 4AC0A 3CDLA 5JLXA 1VNDA 5K7FA 1ETKA 4DYRA 3HGYA 5IP9J 2NS8A 1ZKGA 1IC8A 1POGA 3A02A 5EZGA 1GUUA 1SANA 4D7MA 5BNGA 5FJ8J 1FEXA 2AHQA 4M3FA 1RPWA 1NK2P 2R5YB 1MSEC 1MBHA 4BY1J 2PMZN 2K9SA 2DMUA 5HODA 2XRLA 3JRCA 5F27A 1MBGA 5F0CA 3HOXJ 2M0CA 2RAEA 2Y30A 2HXOA 3QQAA 1OJLA 2E1OA 3LNQA 2JA8J 4X6AJ 5F0HA 1IJWC 1Q1VA 1WPKA 4XK4A 1QVUA 4FE4A 3H3VK 3M3YJ 2FJ1A 1JT0A 3S15J 3HEFA 3S2DJ 2OF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ N;  4RDU A;  1MBK A;  1WGX A;  4M3B A;  2R93 J;  2ELK A;  1QPI A;  1JGG A;  2ID6 A;  3IH3 A;  1BJZ A;  4DZJ A;  1GV5 A;  4FIS A;  5J3L A;  4AUX A;  3JRB A;  2XB5 A;  4I6Z A;  2DA3 A;  2ECB A;  2CUF A;  1QVT A;  4BBR J;  1VI0 A;  1GT0 C;  3GTL J;  2XB0 X;  1K83 J;  1UG2 A;  1BA5 A;  3HOV J;  2CQX A;  3RQI A;  4DYC A;  1X2N A;  3GTQ J;  2CU7 A;  3RZD J;  3QPS A;  1IG7 A;  3JRA A;  4LOC A;  2LLK A;  2IAI A;  3HBL A;  5M5W J;  1F43 A;  3K7A J;  2VKE A;  3HGG A;  5M3M J;  5EGO B;  2CQQ A;  3TP0 A;  4MO7 A;  1U78 A;  2NVY J;  2Y9Y A;  2R7Z J;  2R5Z A;  5IYB J;  2R92 J;  3PO2 J;  1TWH J;  2HDD A;  1MBF A;  4IHW A;  1MNM C;  3G1O A;  4L5E A;  1ETX A;  2CUE A;  1W0T A;  3D1N I;  4FCY A;  4S0H B;  5C3E J;  2WB1 N;  2X9D A;  3Q0W A;  4W97 A;  4MLO A;  1H8A C;  1IUF A;  1RKW A;  3TED A;  2JA6 J;  1T56 A;  4V2G A;  5EG0 A;  1VF9 A;  3JRF A;  3GBG A;  4HNV A;  1R9T J;  2DMT A;  1TWF J;  3GTJ J;  2DMN A;  3SFI A;  1AU7 A;  3MKL A;  5IYD J;  2LKX A;  1H88 C;  2FD5 A;  2LK2 A;  3C2B A;  2D5V A;  2L0K A;  3OOU A;  1TC3 C;  1X2M A;  3Q0V A;  1Y1V J;  2VUM J;  4M6V A;  1D5Y A;  3HDD A;  1B72 A;  2EQR A;  3UKG A;  1XS9 A;  1Z77 A;  5EG0 B;  1E3O C;  3Q0U A;  4RBO A;  2EZL A;  3S14 J;  3BQZ A;  2NOG A;  1BW5 A;  3GTP J;  2MGQ A;  3BR2 A;  3A01 B;  2KDZ A;  2DA4 A;  2Y2Z A;  1F36 A;  1P7I A;  1DU0 A;  2NVT J;  2EH3 A;  3PM1 A;  3TW7 A;  1LFU P;  1HLV A;  2MW8 A;  1ETY A;  5IP7 J;  3A03 A;  4ABZ A;  2YUS A;  3RZO J;  3TP3 A;  5E3L A;  3RKQ A;  5IOZ A;  4JX6 A;  2DN0 A;  1U8B A;  1W0U A;  4M3E A;  1XG1 A;  3A01 A;  9ANT A;  1YRN A;  4G12 A;  1HOM A;  3CMY A;  2K9Q A;  5K7H A;  1GDT A;  3JRE A;  2QF7 A;  1TWG J;  5J1Y A;  1QRY A;  4CYC B;  3LSR A;  4JX4 A;  1FIP A;  3HM5 A;  1RET A;  1JJ8 C;  1HDP A;  3JRD A;  4D5F A;  4D7N A;  2DA2 A;  4C3J J;  4XRS A;  3PO3 J;  2ZB9 A;  2LTP A;  2B63 J;  2DA5 A;  1WH7 A;  3S1R J;  3DEW A;  1B8I B;  4A3D J;  2CJJ A;  1JTY A;  2P81 A;  2HOS A;  4QSH A;  3S16 J;  2DA1 A;  4QIW N;  1G2H A;  1ZR4 A;  3BT9 A;  5GPC A;  1WI3 A;  3FKI J;  4A3L J;  1U9N A;  4J19 A;  4IHX A;  2L9R A;  3K2A A;  2EBI A;  5IP6 A;  4BBS J;  1MH4 A;  1YRN B;  1X58 A;  2MSY A;  2Y0S N;  4AYB N;  2HI3 A;  3E7L A;  4JP0 A;  3G1M A;  1HDD C;  1UHS A;  2YU9 J;  2OPT A;  2H8R A;  3HB9 A;  2XGC A;  5F0F A;  1BW6 A;  2YS9 A;  1JT6 A;  1FTZ A;  1A5J A;  1JUM A;  3GTM J;  3BG5 A;  5F1J A;  3SJM A;  4Y52 J;  2XGE A;  3LSG A;  2MG4 A;  3BR5 A;  1EF4 A;  2NS7 A;  2JA5 J;  2JMW A;  1JUP A;  3ZQG A;  5EDN A;  3BR1 A;  2JWT A;  2HQ5 A;  1Z0X A;  2NVQ J;  1IV6 A;  5EYR A;  3BTI A;  2WV1 A;  2R0Q C;  2COB A;  3B6A A;  3MN2 A;  1A6I A;  5IPA A;  1ZK8 A;  4M3D A;  3B6C A;  1VFC A;  3S17 J;  2M34 A;  3BTC A;  3Q3S A;  1RR7 A;  4A93 J;  4CYC A;  5E3M A;  1S7E A;  3BG3 A;  4A3B J;  2Y9Z A;  2W48 A;  5FKK A;  5J1U A;  4XID A;  3G1L A;  1O4X A;  2GLO A;  3BG9 A;  5EF6 A;  3OIO A;  2DMQ A;  4I76 A;  4QTR A;  4A3F J;  4GFB A;  1JKR C;  3CCY A;  2ME6 A;  4X1E A;  2ID3 A;  5IYC J;  1ZQ3 P;  1LE8 A;  3BTJ A;  2H1K A;  2XSD C;  5K7Z A;  2LD5 A;  2M2E A;  4BY7 J;  1AKH A;  2R5Z B;  1H89 C;  2Y31 A;  1APL C;  3QPL A;  2EZH A;  2EZK A;  4UUS A;  4DZP A;  2M8G X;  4UUT A;  5FLM J;  4FTH A;  4NDL A;  1RES A;  3BR6 A;  3IH2 A;  3HOW J;  1PUF A;  1TWC J;  4A69 C;  1XC5 A;  2X48 A;  2JK3 A;  3LSP A;  5FKO A;  1ITY A;  2HXI A;  4MFE A;  5EZH A;  2L7F P;  1ETQ A;  1JKP C;  4W1U A;  4UUS B;  1IDZ A;  3SDG A;  5DS9 A;  2DA6 A;  1AHD P;  4V2F A;  2G0E A;  4B1R A;  4IHY A;  2HOT A;  4C3H J;  2VI6 A;  3S1N J;  1GVD A;  2LFB A;  3CQZ J;  1ETO A;  2FX0 A;  1JKO C;  4A3J J;  4XRM A;  1I50 J;  1WCM J;  1OFC X;  2IBD A;  1FJL A;  5F04 A;  3ZQI A;  1LE8 B;  5FKM A;  3BR3 A;  4Y7N J;  1HF0 A;  1CQT A;  4BXX J;  2TCT A;  5DTD A;  4B3A A;  1TWA J;  4C3I J;  1ETV A;  3F0C A;  1IRZ A;  5GP9 A;  2QCO A;  1SFO J;  2E2I J;  3BQY A;  2AO9 A;  5E3N A;  4BKX A;  2E19 A;  2K40 A;  1RKT A;  4MFD A;  5M3F J;  1ZR2 A;  2M9H A;  2DJN A;  2DA7 A;  2LR8 A;  4DYQ A;  1DU6 A;  1ZTR A;  2X6O A;  3IH4 A;  4EEF G;  1PUF B;  2E2J J;  1JTX A;  3OSF A;  2E2H J;  5J1R A;  3FK6 A;  3I4M J;  1BL0 A;  3M4O J;  1FIA A;  1NTC A;  3TW6 A;  2O8K A;  2VPR A;  2DTZ A;  5GPA A;  3ZQH A;  1U9O A;  4FE7 A;  3HOU J;  3ZQL A;  3WHC A;  3VPR A;  1JKQ C;  3O8H A;  1ENH A;  3DCF A;  1JUS A;  5F08 A;  3HOY J;  1FTT A;  1P7J A;  3IV5 A;  4D5C A;  3LOC A;  3FIS A;  3FIW A;  4A3K J;  5EGO A;  3JRH A;  2HYJ A;  1ORK A;  2L7M P;  4A3M J;  3S1Q J;  4A3E J;  5C4X J;  2LVS A;  2R5Y A;  2XPU A;  5EEA A;  3I4N J;  3L1P A;  2L7Z A;  3GTG J;  3ZQF A;  4IHV A;  3S2H J;  2HOA A;  5M5X J;  2VKV A;  1B72 B;  2LY9 A;  3JRG A;  3O8G A;  1MBJ A;  4MIM A;  2GM4 A;  2DMP A;  3OSG A;  2XGD A;  4B4C A;  1WH5 A;  2ECC A;  3HOZ J;  1ETW A;  3FK7 A;  2XPW A;  1GV2 A;  5C44 J;  3MVP A;  4C2M J;  3GTK J;  2TRT A;  2I10 A;  5E3O A;  3NAU A;  2CRG A;  3ZOB A;  3JRI A;  2XPV A;  5C4J J;  2FQ4 A;  1ZGW A;  4M3G A;  3GTO J;  3HKZ N;  4XRS G;  4IEJ A;  4A3G J;  1MBE A;  2JJ7 A;  1JJ6 C;  1AKH B;  2ME0 A;  3H0G J;  1K61 A;  2EZI A;  3LSJ A;  4XIC A;  1HCR A;  1OCP A;  2LP0 A;  4A3C J;  2KT0 A;  3BR0 A;  2IEK A;  1IDY A;  1NK3 P;  5M5Y J;  5FKL A;  4A3I J;  1MH3 A;  2K9N A;  2GBY A;  1Y1W J;  1T33 A;  1OCT C;  5JLW A;  1UMQ A;  3WHB A;  2N8G A;  3BTL A;  2JN6 A;  1I6H J;  1I3Q J;  1LFB A;  5IOY A;  2O9L A;  4JYK A;  5FKN A;  5FLV A;  4JX5 A;  1IGN A;  2JA7 J;  3NAR A;  4DW6 A;  1B8I A;  2NVX J;  3ZQC A;  2O7O A;  3S1M J;  1MSF C;  3JR9 A;  3W6V A;  4AC0 A;  3CDL A;  5JLX A;  1VND A;  5K7F A;  1ETK A;  4DYR A;  3HGY A;  5IP9 J;  2NS8 A;  1ZKG A;  1IC8 A;  1POG A;  3A02 A;  5EZG A;  1GUU A;  1SAN A;  4D7M A;  5BNG A;  5FJ8 J;  1FEX A;  2AHQ A;  4M3F A;  1RPW A;  1NK2 P;  2R5Y B;  1MSE C;  1MBH A;  4BY1 J;  2PMZ N;  2K9S A;  2DMU A;  5HOD A;  2XRL A;  3JRC A;  5F27 A;  1MBG A;  5F0C A;  3HOX J;  2M0C A;  2RAE A;  2Y30 A;  2HXO A;  3QQA A;  1OJL A;  2E1O A;  3LNQ A;  2JA8 J;  4X6A J;  5F0H A;  1IJW C;  1Q1V A;  1WPK A;  4XK4 A;  1QVU A;  4FE4 A;  3H3V K;  3M3Y J;  2FJ1 A;  1JT0 A;  3S15 J;  3HEF A;  3S2D J;  2OF7 A; 
#chains in the Genus database with same CATH topology
 2R7R A;  2P8T A;  4RDU A;  1W36 C;  5GAH J;  2KFD A;  4KFC A;  4I0B A;  3HJE A;  1VQ4 I;  4MTD A;  2R7T A;  1MD0 A;  2IS2 A;  2H09 A;  4CH7 A;  2A6T A;  4B48 A;  1SAX A;  1RUO A;  5J3L A;  2OCE A;  4QLC U;  1WJE A;  1F5T A;  4FX4 A;  3CCL I;  4NQW B;  5LFA A;  1GT0 C;  2XB0 X;  4C2T A;  3WE3 A;  2O03 A;  4Q47 A;  1LDJ A;  4RM3 A;  2COM A;  1B59 A;  4XL9 A;  3GVA A;  2JPB A;  2Y0M A;  3I5U A;  4PSW A;  5A2Q Z;  2DO7 A;  4R79 A;  1IG7 A;  2O3F A;  1IRG A;  2A6H F;  4ZDO A;  2DT5 A;  3E5U A;  2ZJP F;  5B5E C;  2V4J C;  1LEA A;  5M5W J;  1H9T A;  2VKE A;  3HGG A;  5M3M J;  1XN7 A;  3OIQ A;  2JUG A;  5EGO B;  3N4M A;  2CQQ A;  3TP0 A;  1U78 A;  3WTW C;  1FP1 D;  2NVY J;  1LUJ B;  3EPZ A;  4ENM A;  2G7H A;  1X1B A;  2R92 J;  3PO2 J;  4IHW A;  4EM0 B;  4GGG A;  4IX7 A;  2K85 A;  4L5E A;  2UXX A;  2Z33 A;  1KQ8 A;  4BNC A;  1YYV A;  3CP8 A;  1ZAO A;  1S9H A;  2ZXW H;  4AIH A;  5JFR A;  2WB1 N;  4W97 A;  4MLO A;  1W36 D;  4UV8 A;  5DDG A;  3TED A;  5EG0 A;  1D3Y A;  4F93 B;  4HNV A;  3ESW B;  3OS2 A;  1YJN I;  2WV0 A;  4EGZ A;  2DMT A;  1EKE A;  3C1D A;  3L9F A;  1O7L A;  3GTJ J;  2DMN A;  4E7S A;  2ZFW A;  3IKT A;  3K4C A;  3MKL A;  4Q48 A;  4Y13 A;  3QU3 A;  3C2B A;  4BHP A;  2PLY A;  4CGZ A;  1Y39 A;  1X2M A;  1TC3 C;  1Y1V J;  5CLS A;  4N4O B;  3BOQ A;  4YG2 F;  3HDD A;  2A5Y B;  4CHU A;  4L5I A;  5HVQ C;  3JW4 A;  1YQA A;  3DEU A;  2IS1 A;  2JVG A;  2M1B A;  3K4N A;  4BE1 A;  3AFH A;  2PJR B;  3S3M A;  5DEQ A;  1BW5 A;  1Q1H A;  4E7I A;  4IOA F;  2NVT J;  4ANJ A;  2Q2E A;  1HLV A;  2V9V A;  1LFU P;  1S3J A;  1ETY A;  2DXI A;  2Q2E B;  3DQV C;  3A03 A;  3GW2 A;  2IGK A;  3RZO J;  2A3S A;  3KPH A;  3TP3 A;  1DPR A;  1X1P A;  3PNT A;  4XOP A;  3RKQ A;  1W0U A;  2DU9 A;  2BHZ A;  3WTY C;  4BHB A;  5HNF A;  4HW0 A;  2ACJ A;  2VOP A;  5B1B H;  4WXH A;  3BZC A;  5E1W A;  4LK0 F;  2HDW A;  2ADU A;  1HKQ A;  1WFX A;  4LJZ F;  5HLG A;  1U5T C;  1FIP A;  3PL8 A;  4HEA 2;  4KUM A;  2CH0 A;  1U8R A;  3JRD A;  4HV6 A;  4O6J A;  3WTV C;  4XRS A;  2FBI A;  1IN8 A;  1SEU A;  1TP4 A;  2ZB9 A;  4EV0 A;  1BN5 A;  1O57 A;  2B63 J;  5IT3 A;  3QRF F;  1SD7 A;  4LFU A;  4LG3 A;  1WH7 A;  2XKO A;  4TV7 A;  3REO A;  3DEW A;  3OYN A;  3S1R J;  2CG4 A;  1B8I B;  4KNY A;  1MW7 A;  1Y56 A;  4PZJ A;  2G9W A;  1WKM A;  1REP C;  2QBY B;  3S16 J;  1OR7 C;  4QIW N;  2DCE A;  4XKC A;  1USS A;  4A3L J;  2XC7 A;  4LLN A;  1EH8 A;  3OYK A;  4I01 A;  2EB7 A;  3V4G A;  2Y0S N;  1DDN A;  3G1M A;  1FMW A;  2X6X A;  4BYY A;  3HL2 A;  2OPT A;  2XGC A;  3AAF A;  1BW6 A;  1I1G A;  1YS7 A;  2YS9 A;  4O3M A;  1L3L A;  3GTM J;  3M7G A;  4FX0 A;  4BQO A;  5EEH A;  4AVP A;  1T8I A;  4O5V A;  3SZT A;  5EDN A;  1N25 A;  3NWT A;  2OZ6 A;  2WC2 A;  2DDA A;  4NC6 A;  4C9Y A;  2KIQ A;  2COB A;  2UXN A;  3MN2 A;  4L5J A;  4WX9 A;  3LQQ A;  3M9A A;  3QP6 A;  3B6C A;  3K1N A;  3K4L A;  1VFC A;  1V5F A;  4LGW A;  3TOA A;  1XMK A;  5GAE J;  4A93 J;  5TGT A;  4CYC A;  4AD9 A;  4Q5S F;  5KAI C;  3ZMU A;  4A0Z A;  2Y9Z A;  2LH9 A;  1Y6I A;  4OIR F;  4H0E A;  2VB6 A;  5FKK A;  5FRO A;  4LG0 A;  1Z05 A;  4YRV A;  1FYK A;  1CGP A;  4QTR A;  4RLF A;  4L9V A;  4GFB A;  2JSP A;  3MZH A;  4HF1 A;  3ERE D;  4CCN A;  2CQN A;  1ZQ3 P;  3L2C A;  2ZKZ A;  4FET A;  1JHF A;  3K69 A;  3VYU B;  3IWF A;  5ILV A;  1K79 A;  1QZZ A;  3K2Z A;  3H9G A;  4BY7 J;  2A61 A;  4DBR A;  1IRF A;  2V6E A;  4HNT A;  2B0L A;  4N0B A;  3H9J A;  1TQM A;  2XF6 A;  4Y3O A;  4KA4 A;  1P4X A;  2EZH A;  4A6D A;  5BPD A;  1OKR A;  2OD5 A;  3RPU A;  4FTH A;  2PBI A;  1BC8 C;  5TRD A;  2EIJ H;  3OYA A;  2MAB A;  4KIC A;  1PUF A;  1TWC J;  2EIN H;  3DU6 A;  3A0H C;  3S32 A;  2NS0 A;  3Q5F A;  2L3D A;  2JK3 A;  5ICF A;  2D45 A;  1ITY A;  1YFH A;  3W2V A;  2H27 A;  5JVT A;  2L7F P;  3HRM A;  1Z7L A;  1ETQ A;  3OL3 A;  3VDX A;  2BY2 A;  4RM2 A;  3F3X A;  3X2Q H;  1HKT A;  4IJA A;  4AIK A;  1IDZ A;  3G6E I;  3SDG A;  4UV9 A;  1AHD P;  4G7O F;  1HQC A;  2G0E A;  3QPT A;  4IHY A;  3S1N J;  4PFO A;  2VI6 A;  3L2Q A;  1K78 B;  3CD6 I;  1R49 A;  1F9N A;  1G3Y A;  1JKO C;  1J09 A;  4XRM A;  2ZXI A;  1WCM J;  1OFC X;  3OMY A;  4E7H A;  3MZ8 A;  3O6B B;  2HGC A;  3CMM A;  1V3F A;  3HG9 A;  5HS8 A;  5FKM A;  4ZC3 A;  2RN7 A;  3M07 A;  2QEX I;  3QOE A;  3CCM I;  1HF0 A;  4BXX J;  3J80 Z;  2TCT A;  4MNU A;  2ETH A;  1ETV A;  4UVA A;  2KLO A;  1IRZ A;  1YW7 A;  3M8J A;  3TO7 A;  3GME A;  3HTU A;  1XCV A;  5AON A;  4CO8 A;  3J7Z I;  2IT0 A;  2E2I J;  3BQY A;  2AO9 A;  1B9N A;  1OCO H;  2GIV A;  2KIM A;  3V7C A;  3PIP F;  4RB2 C;  2E19 A;  4NB5 A;  4L9T A;  5KVR A;  5J8C A;  5M3F J;  4KIS A;  1ZEL A;  2DJN A;  2M9H A;  2DA7 A;  2LR8 A;  3K1M A;  2X6Y A;  1YLF A;  4IRH A;  1DU6 A;  1R5G A;  3FXR A;  2OAZ A;  4KN7 X;  4EEF G;  3GFI A;  4XQF A;  3RYP A;  1PUF B;  3ASO H;  3U21 A;  3GZ6 A;  2BW3 A;  1LNW A;  1XGO A;  2ZCW A;  3K4K A;  1YX5 A;  3FK6 A;  3OWT A;  1JXS A;  2DYR H;  1XTA A;  1BL0 A;  2O8K A;  2C6Y A;  5LGN A;  4FE7 A;  3OL4 A;  1BIA A;  3VPR A;  2HVS A;  2EFP A;  5ERI A;  3O8H A;  2HPI A;  1FTT A;  1S7O A;  4HNU A;  5HLI A;  1RZ4 A;  3MQ0 A;  1OPC A;  2IXS A;  2K7L A;  1FY7 A;  4U88 A;  3HYI A;  5EGO A;  4A3K J;  2HVR A;  3ASN H;  1KU2 A;  4L9J A;  3GTL J;  3KP7 A;  2R4G A;  4Z2Y A;  4RGS A;  2Y69 H;  2HYJ A;  2L7M P;  2CW7 A;  5GTH C;  4RAF A;  1T08 B;  2ZME B;  4A3E J;  4ZTJ A;  4IPA A;  2L9V A;  2PJP A;  1XGM A;  4BEH A;  5EEA A;  1FBS A;  3L1P A;  3FXQ A;  3RIR A;  4EJT A;  3RI4 A;  1GXQ A;  2DAO A;  4HOB A;  3VSK A;  4Y33 A;  1J5Y A;  1B72 B;  2LY9 A;  2L02 A;  2ISY A;  5KCM A;  3O8G A;  3LST A;  4EVI A;  4C2U A;  1FOY A;  1MBJ A;  4ESB A;  2Z99 A;  1QZY A;  4ZYH A;  5HS7 A;  2BBY A;  3KZZ A;  1WH5 A;  2GXG A;  3DP7 A;  4GYI A;  2UV1 A;  5LEK A;  3WOD F;  2XPW A;  1NH3 A;  1GV2 A;  5C44 J;  4PK4 A;  1D5V A;  2MH2 A;  1PVE A;  3IHU A;  2M30 A;  5KHD A;  1GHC A;  2EA2 A;  3EYY A;  3Q9V A;  2CFO A;  2K9L A;  3NQO A;  3COA C;  4HPQ A;  3ZOB A;  4RLQ A;  2FQ4 A;  3B73 A;  3HKZ N;  3EDP A;  5EJC A;  5DM7 F;  2IGN A;  4A3G J;  1WRJ A;  2JJ7 A;  5JI6 A;  1AKH B;  2ME0 A;  1R6R A;  1K61 A;  2EZI A;  1NG7 A;  3AG1 H;  3AG4 H;  3ZQ7 A;  2KT0 A;  1E3H A;  3RTR A;  3I56 I;  1FT9 A;  5FKL A;  2X1E A;  2X1C A;  3HIF A;  3FXJ A;  1Y1W J;  3DFG A;  3PQK A;  1J9I A;  4HST A;  1UMQ A;  3BZK A;  2P4W A;  2VC0 A;  3F8B A;  2VJJ A;  4BDZ A;  2EK5 A;  1YIO A;  3WU0 A;  3H92 A;  3KYD B;  3MKY B;  3NAR A;  4DW6 A;  1R4N B;  2OUM A;  3F8N A;  3ZPL A;  1SD4 A;  2VBX A;  2CWE A;  3OIP A;  3JR9 A;  2DOD A;  3HPH A;  4XNF A;  4PUS A;  1VTN C;  2ZSI B;  3CDL A;  1ODD A;  5K7F A;  4DYR A;  4BH9 A;  5H6R A;  5IP9 J;  2JVH A;  2FNA A;  3WGG A;  5GTI C;  1X4P A;  3CMA I;  2NVU B;  3BLY A;  2LBF A;  1ACI A;  2HNH A;  2X51 A;  3JAM K;  5ILU A;  4DQ2 A;  4M3F A;  2K4J A;  3FXU A;  3P5J A;  3HUG A;  3WE2 A;  3DEE A;  1IAW A;  2CUJ A;  4PJM A;  5J47 A;  3JRC A;  4HRI A;  3HUG B;  4PJJ A;  3FHN A;  2XV4 S;  3FWE A;  2RAE A;  2Y30 A;  4XM3 A;  2M45 A;  5L3G A;  2D1V A;  2GAU A;  4H4K C;  2JA8 J;  1QQI A;  4R1H A;  3RPQ A;  4XK4 A;  4BL0 B;  1HW1 A;  3M3Y J;  4RB0 A;  2FJ1 A;  3V7R A;  1O3T A;  1MNE A;  1QGP A;  3KZY A;  2QSH X;  5FO5 A;  1AWC A;  4M74 A;  1R4M B;  2H6B A;  3TDZ C;  2LDU A;  2MFZ A;  4RB1 A;  1JGG A;  4D1Q A;  2GA2 A;  4DZJ A;  2W24 A;  1GV5 A;  4AUX A;  2P5V A;  2XB5 A;  1PP8 F;  2ECB A;  2FQ3 A;  2RQQ A;  2CUF A;  1IXR C;  1MGT A;  2X6W A;  2R7S A;  4EM1 A;  1K83 J;  2W00 A;  3PUB A;  3VYR B;  5ILS A;  1M1E B;  3R61 A;  2R7U A;  2EIM H;  1BBY A;  3D5R C;  3HOV J;  2DOF A;  1X2N A;  4DYC A;  3KP6 A;  2VE8 A;  3MFK A;  1IV8 A;  2KZV A;  3BJO A;  3FF5 A;  2Z9O A;  2GXB A;  2W84 A;  4YFN F;  3SEQ A;  2I5U A;  1TLH B;  3IAM 2;  3OOP A;  4LOC A;  2IAI A;  3F23 A;  1VQ8 I;  1UJ8 A;  3FMS A;  2LRE A;  1QBJ A;  1F43 A;  4P55 A;  4II3 A;  4CXF A;  2VJI A;  3LMM A;  3JAM Z;  2DLL A;  2OBP A;  2R7Z J;  3GCM A;  3L2V A;  2K9M A;  1MJ9 A;  3NRV A;  1R1T A;  1MNM C;  1HC8 A;  1XB4 A;  5DYM A;  2Y0S A;  2DBB A;  3BG6 A;  3IUO A;  3M1C A;  1Y0U A;  2CUE A;  1OCZ H;  4HYE A;  3MKZ A;  2K86 A;  1J59 A;  3ABL H;  2IVM A;  1YG2 A;  1ZG1 A;  4GRI A;  4S0H B;  2PMU A;  2GQQ A;  3BCA A;  3HXL A;  3GFL A;  3Q0W A;  2LOO A;  1LQ1 A;  1H8A C;  1RKW A;  2JA6 J;  4V2G A;  3RKW A;  3GBG A;  4AID A;  1KA8 A;  1GLN A;  3V42 A;  1TWF J;  5FLX Z;  2QWW A;  1AU7 A;  2XAJ A;  1B1B A;  4IO9 F;  3GUD A;  2VQG A;  1WJD A;  5KAF C;  3ZN0 A;  2D5V A;  4Y17 A;  2R7Q A;  3OOU A;  2VUM J;  3Q0V A;  3FM3 A;  4M6V A;  1D5Y A;  3F9K A;  4XKW A;  5CVI A;  5B3S H;  1B72 A;  3HPG A;  2EQR A;  1XS9 A;  3BJA A;  2LYC A;  5EG0 B;  3H35 A;  4RBO A;  3BQZ A;  2QEN A;  2NOG A;  4NHJ A;  2X85 A;  4E7J A;  4ETS A;  2Y2Z A;  4CZZ A;  1P7I A;  5IT9 Z;  4KMF A;  3H1C A;  5LGT A;  3O2P E;  3PM1 A;  3TW7 A;  1ZN2 A;  2XAH A;  1YIJ I;  5E79 C;  1XX5 A;  2KIF A;  4ABZ A;  1BR2 A;  4HQM A;  4L18 B;  3J80 K;  2ZJQ F;  5IOZ A;  4KIF A;  4BQN A;  2CGP A;  3M1E A;  1XG1 A;  5ED4 A;  2XAG A;  9ANT A;  1HOM A;  5CVR A;  1TQI A;  2Y75 A;  3J7Y J;  3OYJ A;  3JRE A;  1TWG J;  3F8F A;  4XSX F;  1YX3 A;  3LSR A;  4JX4 A;  2ZC2 A;  2OA4 A;  1WJF A;  3ZMV A;  3CJN A;  2VPL A;  2PX9 A;  1JJ8 C;  4D5F A;  2P5L C;  1T6S A;  3OYG A;  3HSE A;  2BEO A;  1W7P D;  3H5A A;  1VQN I;  2P6T A;  2F4M B;  3PO3 J;  4WXC A;  3ZMD A;  5HLH A;  5GAD J;  3E1S A;  3WGH A;  1E2X A;  4PJL A;  3HRS A;  2CJJ A;  2FMY A;  5CKT A;  3PFY A;  2HOS A;  4QSH A;  4XLN F;  4UHT A;  3ISP A;  4IVN A;  3FKI J;  4YIR X;  5DCM B;  4J19 A;  4U7D A;  2L9R A;  4NUB A;  3K2A A;  1FBQ A;  2KHM A;  1AOY A;  1X58 A;  1SFU A;  3E7L A;  4I09 A;  4G7Z F;  3GEZ A;  1ZG5 A;  4J01 A;  1UHS A;  4U0V A;  4YFK F;  2YU9 J;  3CC2 I;  1UG0 A;  2H8R A;  1FOX A;  4LD5 A;  5F0F A;  1ZLJ A;  5DUI A;  1FTZ A;  1FYM A;  1TT5 B;  1JUM A;  5E8I A;  3BG5 A;  3ML6 A;  4D9J A;  2XGE A;  4E70 A;  5BQT A;  4ZDP A;  2DI3 A;  5LRS A;  1U3E M;  1TL8 A;  2JA5 J;  2Q8K A;  2WTE A;  2E7X A;  4Q4Z F;  3SHF A;  2VKH A;  2JWT A;  2ZFU A;  3K1P A;  3JSP A;  3TKY A;  4XLC A;  3U2R A;  5F64 A;  1YJW I;  3SQN A;  2K02 A;  3J7A Y;  1LDK B;  4EJU A;  3EYI A;  2P7V B;  4LIV A;  2FOW A;  3SXY A;  1MMD A;  2XGX A;  1BOA A;  3DKW A;  3Q3S A;  4HSR A;  5L3E A;  2E1M B;  1WJC A;  2P6S A;  1DP3 A;  4XKV A;  3VSL A;  4A3B J;  2ESN A;  2W48 A;  1XMA A;  5FRM A;  2HDC A;  3G1L A;  4N9I A;  1RC9 A;  2OQG A;  3BG9 A;  4CZC A;  1YIT I;  2HU9 A;  1FLI A;  1KZH A;  1JKR C;  1A6Q A;  3CCY A;  2ME6 A;  1UAA A;  2QQB A;  4UB6 C;  1UHW A;  2ID3 A;  5L3F A;  2JUC A;  2L4M A;  2NRA C;  4FHT A;  5A2Q K;  1D8K A;  2ZBK A;  3KYL A;  4YEJ A;  3OYM A;  1K78 A;  3OYC A;  4RB3 C;  2RQP A;  1BIB A;  1NHA A;  2ZJR F;  4ESJ A;  1AKH A;  1TZL A;  4NC7 A;  2IA1 A;  3CCR I;  4MQ9 F;  2LRD A;  1BR4 A;  4P5O A;  1U5T A;  5F6F A;  4DZP A;  2PEX A;  1SFK A;  4UUT A;  5BMZ A;  4NDL A;  3VB2 A;  4F3Q A;  4KYW A;  3IH2 A;  3TGN A;  1O3Q A;  3HOW J;  2DOA A;  1TW2 A;  2X48 A;  4C30 A;  3CCJ I;  5FKO A;  2FF4 A;  3KLN A;  3KIO A;  2KPM A;  4M71 A;  1KU3 A;  1MMN A;  3CUO A;  1H9G A;  3RSN A;  3HZJ A;  4W1U A;  2QM3 A;  4UUS B;  2E1M C;  5DS9 A;  2PFB A;  4RGX A;  4L0Y B;  3BWG A;  2HOT A;  1J0R A;  1STZ A;  2R7W A;  2OTL I;  3F8C A;  3ABT A;  4E7K A;  2BYV E;  3OY9 A;  3KEO A;  5DD4 A;  4ZYD A;  1ETO A;  2L54 A;  5DD8 A;  4LLL A;  1I50 J;  1R7J A;  2Q0O A;  2IW5 A;  2VL8 A;  3ZQI A;  4G7H F;  3BR3 A;  1D1C A;  1CQT A;  4CCO A;  4YEL A;  4CYD A;  2HVQ A;  1DGR M;  1N77 A;  1SFO J;  3E6C C;  1D1A A;  4PSX A;  2AQF A;  4IQJ A;  3W3C A;  4KT6 A;  3CUQ C;  4RGR A;  2E35 A;  2K40 A;  2ZME C;  1RKT A;  1T39 A;  3KE2 A;  1VQ7 I;  4HZF A;  4WWC A;  5D6F A;  3A0B C;  2DJI A;  3G4S I;  3BJ6 A;  4EMS A;  3V7S A;  3K4B A;  2W82 A;  1XCB A;  2STW A;  3E5X A;  2E2J J;  2M0M A;  2YU3 A;  4OIN F;  3RPU D;  2F5F A;  1W4M A;  3ONQ A;  3I4M J;  4G9Y A;  2JZY A;  4ITV A;  4EJO A;  1X4O A;  2DT7 B;  2DTZ A;  2VPR A;  2WAE A;  1BR1 A;  1U9O A;  3E6D A;  4I7H A;  4LB5 A;  2IS6 A;  2BY0 A;  3BDD A;  4KN4 X;  3WHC A;  3DKY A;  1JKQ C;  1ENH A;  3BPX A;  2RGV A;  5F08 A;  2EV5 A;  2BY3 A;  4BXF A;  3IV5 A;  3KCC A;  3VYS B;  1QZE A;  1CF7 A;  3NWS A;  1Y0N A;  4KMU X;  2P0W A;  3JRH A;  2F5C A;  3S1Q J;  3W2W A;  2XKP A;  5C4X J;  2LVS A;  3CJQ B;  2EWN A;  2EFQ A;  2R5Y A;  2XPU A;  3U1K A;  2L7Z A;  1R5H A;  3LL7 A;  2GOX B;  4AU7 A;  3KP2 A;  3WU1 B;  1XMX A;  3S2H J;  3JSO A;  5CYV A;  1MZB A;  3M8F A;  2Z16 A;  1LFP A;  4MIM A;  2GM4 A;  4BJT A;  2DMP A;  2HS5 A;  3OSG A;  2NAZ A;  3ZCO A;  1FZP B;  3DTI A;  1ETW A;  3QYE A;  1A04 A;  3I0T A;  2UWM A;  3MVP A;  4U7B A;  1T38 A;  4C2M J;  3GTK J;  1T2K A;  3ZQQ A;  4QPQ A;  3LA3 A;  3K70 D;  5HLT A;  3ABM H;  2VBY A;  1TQP A;  2QYO A;  2XPV A;  5J4V A;  1S7A A;  4IEJ A;  1P4A A;  1MBE A;  2XAU A;  1JJ6 C;  2KJC A;  5J40 A;  2BVL A;  2ZXJ A;  3LSJ A;  2KKO A;  4PFP A;  5FB2 A;  1YE9 A;  1IDY A;  5M5Y J;  4A3I J;  1MH3 A;  2K9N A;  3CF2 A;  3ZMT A;  2KMU A;  2QBY A;  1OCT C;  5FD5 A;  5JLW A;  1R00 A;  3WHB A;  1ULY A;  3GFJ A;  2GOM A;  2N8G A;  1B9M A;  2QQ8 A;  4XR6 A;  1VQL I;  1I6H J;  3ABK H;  1OQY A;  3DF8 A;  5FLV A;  4AM3 A;  3GLX A;  3BCB A;  2WA0 A;  1W5C C;  2NVX J;  3QP5 A;  4HDV A;  3ZQC A;  1TW3 A;  3JCU C;  2VN2 A;  3W6V A;  2VBZ A;  1U5T B;  3A4C A;  1LEB A;  2W4S A;  1VND A;  1ETK A;  2K3F A;  3HGY A;  4JOM A;  2FEZ A;  4U87 A;  1YOV B;  2NS8 A;  4I02 A;  4XLF A;  5J6X A;  1MJB A;  2BXZ A;  1POG A;  3A02 A;  1GUU A;  1SAN A;  3FKJ A;  3KP5 A;  1R23 A;  5D8L B;  4IRI A;  1BI2 A;  2LY1 A;  2GIZ A;  2AHQ A;  1Z6T A;  1RPW A;  2KP6 A;  4M73 A;  1MSE C;  2STT A;  2DQL A;  1I5Z A;  1KYZ A;  2BVM A;  2K9S A;  3RYR A;  3GWZ A;  1K6Y A;  3EET A;  5F0C A;  3LAJ A;  2L4A A;  2WWY A;  3VFZ A;  4I0A A;  2H1L A;  2M0C A;  4KIB A;  2PQ8 A;  3FXK A;  2X1D A;  1Z7U A;  1ONV A;  4JK1 X;  1X19 A;  3QQA A;  1VQP I;  3ZMS A;  1OJL A;  2FU4 A;  5D5X B;  1CF7 B;  3ECO A;  4F92 B;  1Q1V A;  4XLH A;  3H3V K;  1NG6 A;  3S15 J;  3K4M A;  2DYS H;  3KLO A;  1T98 A;  2FBH A;  3HHH A;  2WBM A;  1WQ2 A;  3T8R A;  4AWX B;  2GWR A;  2BOL A;  1IUY A;  1PUE E;  3RCO A;  1QPI A;  2M7A A;  3R4K A;  2WAQ A;  2B7E A;  3IH3 A;  3EUH A;  1BJZ A;  3WU2 C;  3JRB A;  1ZRE A;  2DA3 A;  1QVT A;  2VT3 A;  3IC7 A;  1XDS A;  1VI0 A;  4BBR J;  4D0P A;  1HXD A;  2HWV A;  2BXY A;  3K9T A;  3OYE A;  3S3O A;  2HEO A;  1UG2 A;  1BA5 A;  4K2E A;  1Z1D A;  3LA7 A;  2CQX A;  1N75 A;  3RQI A;  3AL0 B;  3BP8 A;  1Z9C A;  3GTQ J;  4OAZ A;  2HQA A;  2CU7 A;  3LFU A;  4AIJ A;  1KON A;  2DPD A;  2IRF G;  1MND A;  1S29 A;  3K7A J;  2I8D A;  4B3X A;  1TTY A;  2QSG X;  1FX7 A;  1JE8 A;  2E34 A;  2H8W A;  1IN7 A;  3A1Y A;  1R5I D;  1J7K A;  5IYB J;  1H0M A;  3KFW X;  1ON1 A;  2CMP A;  1TWH J;  4N4N B;  1MBF A;  3EQL F;  2HDD A;  1MMS A;  4XOT A;  3G1O A;  3G73 A;  2LBF B;  5LHH A;  3C2H A;  4P9U A;  1ETX A;  2R7O A;  5TJJ A;  5H20 A;  1W0T A;  2ZSH B;  5J4Y A;  4KJZ A;  3D1N I;  2LC2 A;  4XRF A;  2BY1 A;  4KIG A;  4FCY A;  2VXZ A;  2VKD A;  1P6R A;  2LSO A;  3RJP A;  2F48 A;  1XSD A;  5B1A H;  4P1W A;  1T56 A;  1VF9 A;  1MMG A;  2L9S A;  2Z1D A;  2MYS A;  3CTA A;  4OMZ A;  1R9T J;  5K5O A;  3SFI A;  3T5X A;  1H88 C;  3N05 A;  4HQE A;  3D0S A;  2P7C B;  5FRN A;  2VBW A;  3OYB A;  1G6N A;  2ISZ A;  4JQF A;  3FXO A;  3WTS C;  1DP7 P;  1A31 A;  4KIT B;  2D2W A;  5CVJ A;  1E3O C;  1RNL A;  2L2O A;  3S14 J;  2MGQ A;  3BR2 A;  2PG4 A;  3A01 B;  2KDZ A;  3UR3 C;  2DA4 A;  1F36 A;  1SD6 A;  1WJA A;  4HX8 A;  2EH3 A;  3DWL E;  3DTE A;  1V54 H;  2MW8 A;  4ZZL A;  1A35 A;  2JA2 A;  2M8E A;  5IP7 J;  3CCS I;  2YUS A;  4CDG A;  3LAP A;  2QSF X;  3HC7 A;  3BZ6 A;  1SD5 A;  1I3A A;  3WG9 A;  4JX6 A;  2DN0 A;  3O3K A;  1U8B A;  1ZYR F;  4PJ0 C;  4M3E A;  2VJ5 A;  3DPT A;  2RKH A;  2Q1Z B;  3P9I A;  5L3C A;  3CMY A;  3ZP5 A;  2NXN B;  5K7H A;  2ELJ A;  1R71 A;  5DCF A;  1K6O A;  1QRY A;  2NYX A;  3F72 A;  2EPF A;  3VWB A;  3HM5 A;  1C0W A;  2JPC A;  1HDP A;  4FQG A;  3D5S C;  2LMD A;  1K4T A;  4HA8 A;  4D7N A;  1SMT A;  2DA2 A;  3CCU I;  1KU7 A;  1IN5 A;  2LTP A;  3TOB A;  5JHU A;  3JTG A;  4HF2 A;  3NEU A;  2B9S A;  1UB9 A;  5B66 C;  2DA5 A;  3MZY A;  3DPL C;  4EJW A;  4XMY A;  4XLE A;  2ZO4 A;  4L0Z B;  2M7B A;  4A3D J;  4HLX A;  1OMI A;  4MQV A;  1TT0 A;  4G94 A;  4A5N A;  4ZDL A;  1YHQ I;  4U0W A;  2QLZ A;  3GZ5 A;  1WI3 A;  3LA2 A;  4XLA A;  4DJA A;  2ESH A;  1U9N A;  3RKX A;  5ICG A;  5JVG F;  2MC4 A;  2FSW A;  4BBS J;  3HOS A;  3VOE A;  1YRN B;  3LQR A;  2MSY A;  2HI3 A;  1QO0 D;  1HDD C;  3IKV A;  4WCG A;  1JT6 A;  4CCK A;  1R1V A;  3U9G A;  4UVB A;  3SJM A;  4BXU A;  4Y52 J;  2YX4 A;  1HW5 A;  3LSG A;  3MEX A;  4ESF A;  2CSO A;  4RAZ A;  1Z21 A;  1X3Z B;  1HW2 A;  2JMW A;  1JUP A;  4R8H A;  3R0A A;  5FLX K;  4DOZ A;  3BR1 A;  2XVC A;  2HQ5 A;  2R7X A;  3KZI C;  3WG7 H;  3DBR B;  2OV7 A;  3BTI A;  2WV1 A;  4B44 A;  3IWZ A;  2QGU A;  1A6I A;  2CYY A;  1ZK8 A;  1ZRC A;  3R60 A;  2M34 A;  2H6C A;  3BTC A;  2OCC H;  1VQK I;  3DKX A;  2ICW G;  5L3B A;  4IHS A;  3D5L A;  4LK1 F;  3L7W A;  3MMY B;  1P9Q C;  1FYL A;  3PSI A;  5E3M A;  2IJL A;  1BI1 A;  2H94 A;  1W7P A;  2DK8 A;  5J1U A;  5BS6 A;  1O4X A;  4IQ4 A;  1FOW A;  3FMR A;  5BPI A;  2GLO A;  5EF6 A;  3OIO A;  3GF2 A;  3PNV A;  1OYW A;  2E1C A;  2BE5 F;  5IT9 K;  4IF4 A;  4PGH A;  5IYC J;  2K3P A;  1VQ9 I;  1ZGA A;  1LE8 A;  2H1K A;  3SZP A;  2XAS A;  4A6E A;  1I39 A;  2XSD C;  1IRX A;  2LF7 A;  2DPU A;  5K7Z A;  3T1B A;  5D5V B;  2O6G E;  1KU9 A;  3LSI A;  4EJV A;  2F5V A;  1UEL B;  1J75 A;  2P5K A;  4MEY F;  1Z3Y A;  4RS8 A;  5L3D A;  2Y31 A;  3MD2 A;  2DFE A;  5CVU A;  1FOK A;  5LRR A;  2DDB A;  4F91 B;  2KDO A;  3QPL A;  2VQL A;  3L00 A;  1MKM A;  4E4H A;  1F4K A;  1SAU A;  1Z6R A;  2M8G X;  5FLM J;  4BE2 A;  1RES A;  1R1U A;  4B09 A;  1XC5 A;  2IP2 A;  3LSP A;  3CP2 A;  1QU3 A;  4MFE A;  2ZME A;  3G2B A;  2R3S A;  2KZG A;  4OIP F;  5DV5 A;  1JKP C;  2NOJ B;  2L7K A;  4IRG A;  3VOD A;  2VOO A;  1XSX A;  3L2R A;  2EIL H;  4B1R A;  2VQH A;  3I53 A;  5HNH A;  2EFW A;  1V5G A;  1GVD A;  2HKX A;  2LFB A;  4BUP A;  3CQZ J;  2HPM A;  1ZH5 A;  2KJB A;  1YW8 A;  4A3J J;  2KRH A;  3IP4 B;  3GZN B;  4KT5 C;  2IBD A;  2OU2 A;  1LE8 B;  4WXD A;  1QHH D;  2W1O A;  4JBA A;  1D0Z A;  1MJA A;  1JI8 A;  5DCM A;  1WHU A;  1LVA A;  2CQK A;  1TWA J;  3AG3 H;  2E36 A;  3H5R A;  1OCC H;  4ZYG A;  2VLA A;  2VJ4 A;  2PJR A;  4G8X A;  4F55 A;  1FSH A;  3H5N A;  3OR2 C;  4XLP F;  4ON0 A;  2QQ9 A;  2XUB A;  4BKX A;  4B8X A;  4MFD A;  3PNY A;  3SYT A;  1BJA A;  3C2G A;  2PI0 A;  2HQR A;  1ZLK A;  4HX7 A;  2FE3 A;  4XN0 A;  3DBH B;  3H0D A;  3FMQ A;  3CZ6 A;  3FXL A;  2A69 F;  2E2H J;  4RAY A;  5J1R A;  3I3L A;  5F1R A;  3VEP A;  4A5M A;  3M4O J;  3J81 Z;  5GPA A;  3ZQH A;  3ZXS A;  4DIQ A;  4UUV A;  2M3A A;  2Z3Y A;  1PP7 U;  2GZW A;  1OLT A;  2YX7 A;  2DOE A;  3HOU J;  1OYY A;  2DFF A;  3MKW B;  1HKS A;  1KQ9 A;  1IN6 A;  3DCF A;  1JUS A;  3C7J A;  1DGW Y;  1V5E A;  2JSC A;  1RI7 A;  4D5C A;  2HKO A;  3FIW A;  1IZ1 A;  1QHG A;  5KNL A;  2RVC A;  1JGS A;  4HBL A;  3M8E A;  2QUF A;  3TO6 A;  1UFM A;  4IKF A;  3VYT B;  1ZAR A;  3ERM A;  1LVK A;  2E71 A;  2F2E A;  4A0Y A;  4A3M J;  3H3Z A;  2WY7 Q;  1Y8Q B;  4LG0 B;  2XAQ A;  3GYH X;  1PYV A;  2QZ8 A;  3OS0 A;  5JHF A;  3I4N J;  4FAS D;  2HOA A;  2YR2 A;  4EQQ A;  1LPQ A;  3CJT B;  2RRE A;  3B02 A;  4FT8 A;  5HS9 A;  4AVZ A;  3V8K A;  1T0F A;  2RNJ A;  2EJR A;  4B4C A;  3I55 I;  3HOZ J;  3FK7 A;  3G3Z A;  3QU6 A;  3TBI A;  1SFE A;  2GA1 A;  2BHY A;  2W25 A;  3QWL A;  2VXD A;  4G6Q A;  3OS1 A;  4A2U A;  2D1H A;  2ELH A;  1E17 A;  2I10 A;  3NAU A;  4MTE A;  4CA0 A;  3E5Q A;  1QPM A;  1EA3 A;  5C4J J;  3GTO J;  4M3G A;  3KYC B;  2LF8 A;  4XRS G;  1UHM A;  3E0J B;  1S8N A;  4U0Y A;  3DXJ F;  5EEG A;  1ZRD A;  2JRM A;  5D5U B;  4L9N A;  4E7L A;  3CUQ A;  1R58 A;  4HF0 A;  5D4R A;  3RQ4 A;  2JQ7 A;  3BR0 A;  2IEK A;  1NK3 P;  4RGU A;  1S5L C;  1LB2 A;  1VQ5 I;  1HSJ A;  3TO9 A;  4UY8 I;  1T33 A;  3L2W A;  1Z91 A;  3PFI A;  3CO7 C;  2V6C A;  5AIQ A;  2JN6 A;  1LFB A;  2O9L A;  3I58 A;  4QWQ A;  5LD2 C;  1VQM I;  3QYB A;  2FBK A;  5FKN A;  5HDG A;  3CCV I;  1IGN A;  1E3P A;  4NC8 A;  1PJR A;  1I6X A;  2EA4 A;  1YW9 A;  1ON2 A;  2O7O A;  5E20 A;  5D6E A;  4S05 A;  5HOO A;  4AC0 A;  4M9S A;  5JLX A;  2EV0 A;  2MLK A;  2A5W A;  5LLQ A;  3L2U A;  2PMH A;  3EUK L;  4B47 A;  2EFN A;  5EZG A;  4CUG A;  2WAD A;  5CPR B;  5FFZ A;  1GVJ A;  5FJ8 J;  3K70 C;  3C18 A;  1X1A A;  4XON A;  1FEX A;  4BY1 J;  2NNY A;  2HZT A;  3F6V A;  1U0J A;  2X0L A;  2PMZ N;  4Y4R A;  2IA2 A;  2XRL A;  3H9Q A;  1G3T A;  1WJB A;  4XOR A;  5D8K B;  1K7A A;  1MBG A;  3HOX J;  3ELK A;  3A2K A;  4PGG A;  3IL2 A;  1D8J A;  2HXO A;  1FBU A;  2F4O B;  2E1O A;  3SZG A;  5ICC A;  3LNQ A;  3CUQ B;  4GDF A;  5K5R A;  5F0H A;  1IJW C;  3V8J A;  3W2A A;  1QVU A;  2LKS A;  3MCZ A;  4HV5 A;  3CJR B;  1U6G A;  3L09 A;  5TIS C;  4ENK A;  4ZH4 F;  2OF7 A;  4ZYA A;  1E0E A;  4RAG A;  3OYI A;  3KP4 A;  2WAQ N;  4MHG A;  2RDP A;  2O61 A;  1MBK A;  3F21 A;  1D0X A;  1WGX A;  3GFM A;  4M3B A;  2R93 J;  1XDU A;  2ELK A;  2IGM A;  1WJ5 A;  2ID6 A;  3P7N A;  1SFX A;  2RV8 A;  3TQN A;  4FIS A;  3ZR8 X;  4I6Z A;  2CS3 A;  2LKP A;  1D1B A;  1Z3X A;  4M9Z A;  2KIS A;  3N97 A;  3LSK A;  4OAY A;  5LHI A;  2WB1 A;  1PDN C;  4BS9 A;  3HOT A;  2CUZ A;  4KDP A;  4G6T B;  2MD5 A;  1R36 A;  3PQJ A;  2A68 F;  1G4D A;  3DPU A;  3FDY A;  1HST A;  2QVO A;  2DFI A;  3QPS A;  2A6E F;  5LGU A;  3JRA A;  3RZD J;  2LLK A;  4YFX F;  5E1Z B;  3HBL A;  3ROU A;  3HRT A;  1YS6 A;  3R6S A;  4OWR B;  1RR8 C;  2VIX A;  3EUH C;  1MIJ A;  3I59 A;  4MO7 A;  4M6Y A;  2Y9Y A;  3MAJ A;  4LIU A;  2R5Z A;  2LY2 A;  2VOD A;  1SVM A;  3RKY A;  4OMY A;  3SFZ A;  1P2F A;  1SVO A;  3BG7 A;  3CES A;  4BAY A;  1P92 A;  2XSJ C;  1BI0 A;  1XPX A;  1VZ0 A;  1W5T A;  2BW3 B;  4BHC A;  1OCR H;  4BQQ A;  5C3E J;  3OV8 A;  5HDN A;  2X9D A;  1WVR A;  1IUF A;  3K0L A;  4B43 A;  3JRF A;  3ZGK A;  5K5Q A;  2RC4 A;  2HFH A;  3KEY A;  3FHZ A;  1VQ6 I;  4F52 A;  2AS5 F;  2V9P A;  3LFK A;  3LSH A;  4BJ6 C;  3WTZ A;  3J81 K;  5IYD J;  2LKX A;  4P96 A;  2XHK A;  2FD5 A;  2LK2 A;  2L0K A;  2LNB A;  2XF5 A;  1WI9 A;  2ZXH A;  4J00 A;  4N9H A;  3QOD A;  2L5Q A;  3ECH A;  2BZT A;  2WY8 Q;  1YJ9 I;  3UKG A;  1Z77 A;  2FRH A;  2FA5 A;  2HTS A;  2V9K A;  4IXA A;  3Q0U A;  1OYI A;  2YSR A;  3AL0 C;  1TNS A;  1XSV A;  2EZL A;  3P9K A;  3GTP J;  1SC7 A;  1O3R A;  1EJ9 A;  1B6A A;  3IRR A;  2VE9 A;  2V79 A;  2V1U A;  2K4B A;  3BRO A;  4BEH B;  3I64 A;  2Y48 A;  1DU0 A;  2V1N A;  3PIO F;  2YPR A;  1IF1 A;  5E17 F;  2M4K A;  2ZNZ A;  2OTJ I;  4QPO A;  4P9F A;  2Z2S B;  2IS4 A;  4IOC F;  4IL6 C;  1O7F A;  3P9C A;  5E3L A;  3IAS 2;  3FXM A;  1S6L A;  4DGW B;  4XKB A;  2MLG A;  3A01 A;  1YRN A;  3TL4 X;  3K6G A;  3E6M A;  2FXA A;  4G12 A;  1N78 A;  1BI3 A;  1V4R A;  2K9Q A;  4CCL A;  5H6Q A;  1XGS A;  1GDT A;  2QF7 A;  5J1Y A;  3DTK A;  3FBI B;  4E6K G;  5K1Y A;  4CYC B;  2K27 A;  2V7F A;  4I2O A;  1QNT A;  2HQN A;  3FM5 A;  3E97 A;  6PAX A;  2ZJ2 A;  3CCQ I;  1RET A;  4NNJ A;  3EUA A;  1YTY A;  2VC1 A;  2EV6 A;  3CDH A;  3FBN B;  4C3J J;  2V1D A;  4BJ5 C;  2AXT C;  1OR7 A;  2CO5 A;  1LKX A;  3I54 A;  1S72 I;  3H3U A;  4M9X A;  3HTS B;  2AQE A;  2HZD A;  1YO5 C;  1T0F C;  2JTV A;  2MBF A;  4DBQ A;  1JTY A;  4CCJ A;  2P81 A;  4A12 A;  4BDY A;  2E7W A;  3AG2 H;  2DA1 A;  4UB8 C;  1G2H A;  1ZR4 A;  3BT9 A;  5GPC A;  1TNT A;  2HOE A;  1Z67 A;  2KL4 A;  4IHX A;  3GX4 X;  2EBI A;  4LMY A;  5IP6 A;  1WWX A;  4YII A;  3I71 A;  1G8X A;  1MH4 A;  4A0X A;  4ZZD A;  3C3W A;  1WZ2 A;  4I99 C;  4AYB N;  3ZMZ A;  5E18 F;  4JP0 A;  2OZU A;  4HAM A;  3S93 A;  3HB9 A;  2IGO A;  1WSU A;  2KIU A;  2L01 A;  5FD6 A;  1A5J A;  3HRU A;  4GCV A;  5F1J A;  1G3W A;  1SMY F;  1R22 A;  2MG4 A;  2WAF A;  3BR5 A;  3DLA A;  1EF4 A;  2NS7 A;  1X3W B;  3UNG C;  2VT2 A;  3ZQG A;  3OYH A;  4PJN A;  2JT1 A;  5E8G A;  1OIS A;  3E6B A;  3F8M A;  1Z0X A;  2IA0 A;  4M72 A;  2CV0 A;  2NVQ J;  2DW4 A;  4EGY A;  2J5O A;  1IV6 A;  3HSR A;  5LEJ A;  4WF2 A;  5EYR A;  4ENJ A;  2R0Q C;  3B6A A;  2L9N A;  2F6C A;  3K4J A;  4M3D A;  5IPA A;  3S17 J;  1RR7 A;  5GAG J;  1FPQ A;  3J7A O;  2W57 A;  3CLO A;  2OC6 A;  1I27 A;  3CF5 F;  1YI2 I;  1S7E A;  3BG3 A;  4XBF A;  4CCM A;  2HTJ A;  5ICE A;  1V55 H;  3CME I;  4IHT A;  4PCQ A;  3LWF A;  1GXP A;  4XID A;  3GXO A;  2HR3 A;  1K4S A;  3QAH A;  5CQG A;  1SVL A;  2KRC A;  2DMQ A;  4I76 A;  4A3F J;  3CLQ A;  3H36 A;  2UUZ A;  4X1E A;  4BE0 A;  1MDM B;  1UCR A;  3FX3 A;  4RMN A;  1G3S A;  3SDB A;  2R7F A;  2V1X A;  2R7V A;  3BTJ A;  2K5C A;  4CIC A;  2LD5 A;  1BM9 A;  2F4I A;  5CJ9 A;  5CVV A;  2M2E A;  3F22 A;  5IY5 H;  4AYB A;  4EAT A;  1LDD A;  2R5Z B;  1FNN A;  2XAF A;  4I98 B;  3OYF A;  2DQR A;  1H89 C;  2XIG A;  2XF7 A;  3HSF A;  1APL C;  4CSW A;  5D5W B;  2E5N A;  2EZK A;  4UUS A;  2W7N A;  3F6O A;  3QOP A;  1UZC A;  2VON A;  3OR1 C;  3HHG A;  1BC7 C;  3BR6 A;  3K10 A;  5HDK A;  1O3S A;  4A69 C;  4GXO A;  3RDI A;  3KET A;  1F1Z A;  1L0O C;  3WTX C;  2HXI A;  4HDU A;  1XD7 A;  2BV6 A;  2G7U A;  2QKL B;  5EZH A;  4OIQ F;  4MGR A;  2HYG D;  4XSZ F;  3G71 I;  1IXC A;  2DA6 A;  3BPV A;  2E1N A;  4V2F A;  2OQR A;  1IXS B;  4C3H J;  3BC8 A;  1EV7 A;  2KQR A;  2BGC A;  2FX0 A;  1HA8 A;  1ZG3 A;  2CQ7 A;  2XDV A;  2X4H A;  1W1W E;  1FJL A;  5F04 A;  3PUF A;  4LLG F;  3JTH A;  4UXN A;  4ASN A;  4Y7N J;  1X1D A;  2F5E A;  4UVC A;  5E1X A;  5DTD A;  1DQU A;  2FML A;  2QA4 I;  3GO5 A;  4B3A A;  1EH6 A;  4C3I J;  3F0C A;  5GP9 A;  1KQ0 A;  3FZV A;  3DU5 A;  2QCO A;  4II2 A;  3W6K B;  4NQW A;  4UNO A;  1FC3 A;  2KRF A;  1J2X A;  5CQE A;  2EFO A;  2CW0 F;  5E3N A;  1RUN A;  3S8P A;  2MD0 A;  5AIP A;  3QYF A;  3WGI A;  2EIK H;  1JHH A;  1EH7 A;  4ZJZ A;  2FNP A;  4ZYE A;  1ZR2 A;  1X3U A;  4DYQ A;  3I9V 2;  1ZRF A;  1ZGJ A;  3I4P A;  4BU2 A;  2F5D A;  1LJ9 A;  1I1S A;  1ZTR A;  2M87 A;  3WTT C;  2X6O A;  3IH4 A;  5D4S A;  2CV1 A;  1JTX A;  3OSF A;  3PJR A;  3T0Y A;  4X0G A;  1FIA A;  1NTC A;  3TW6 A;  4NBQ A;  4S04 A;  2OJE D;  3V8L A;  1U2W A;  3ZN1 A;  2W85 A;  5LHG A;  2PN6 A;  3ZQL A;  3W6J B;  2O8X A;  1IO2 A;  5J8F A;  2A05 A;  3T8T A;  1MDM A;  3HOY J;  3ULQ B;  1P7J A;  4YIF A;  4HG2 A;  3LOC A;  4XN3 A;  3FIS A;  1HBX G;  2UZK A;  3R0J A;  1W5S A;  1KGS A;  1TBX A;  4BQA A;  3S2W A;  2XRO A;  5DUK A;  5H2F C;  1IW7 F;  1ORK A;  1DUX C;  3TDU C;  3KEQ A;  2CW8 A;  2M5W A;  4DNC A;  3DV8 A;  4G6D A;  2CFX A;  2DK5 A;  3E3V A;  3CC4 I;  3GTG J;  2E60 A;  3U1D A;  3ZQF A;  4BGD A;  4IHV A;  5M5X J;  1VQO I;  2VKV A;  3JRG A;  2ZNY A;  2JRT A;  1ERD A;  3DBL B;  5FFX A;  4RA2 A;  1AA7 A;  4WK8 F;  2XGD A;  2ECC A;  3IRQ A;  1RRJ A;  1FMV A;  4GYG A;  1P4W A;  3KP3 A;  3S3N A;  2TRT A;  1MMA A;  5E3O A;  4F7Z A;  2E5Z A;  4HX4 A;  3HKZ A;  2CRG A;  2FUG 2;  4HLY A;  3JRI A;  1ZGW A;  1BOB A;  2MH9 A;  1RIO H;  4IZZ A;  3BY6 A;  4M6X A;  4ENN A;  1A36 A;  5KK1 A;  5LBQ A;  3CC7 I;  3H0G J;  1Y8R B;  4LB6 B;  3SEZ A;  4XIC A;  1FSE A;  3ABU A;  3WTU C;  1HCR A;  1X1C A;  1OCP A;  2LP0 A;  4A3C J;  4LIT A;  2AXL A;  3CDI A;  2DTR A;  2QKM B;  2DFH A;  2GBY A;  2NNN A;  4EM2 A;  3QPH A;  3CO6 C;  4V19 K;  4MEX F;  4Y15 A;  1FWZ A;  3TMO A;  3BTL A;  2MA3 A;  1I3Q J;  3Q9S A;  5IOY A;  4JYK A;  4OU0 A;  2GXA A;  2FOK A;  4OIO F;  4JX5 A;  2JA7 J;  1B8I A;  2RNG A;  2VAS A;  1T95 A;  2LG4 A;  3S1M J;  1MSF C;  3KX2 A;  5DM6 F;  1FP2 A;  2MC3 A;  4BAC A;  5BOX A;  2CV2 A;  2QQA A;  1KYW A;  2HYF A;  2M4G A;  4OOI A;  4ZTF A;  2V26 A;  1ZKG A;  1IC8 A;  2XRN A;  4D7M A;  1UST A;  5BNG A;  3PSF A;  3CCE I;  2PMZ A;  1ZHF A;  1NK2 P;  2R5Y B;  1MBH A;  1IN4 A;  2O0Y A;  4GO1 A;  2DMU A;  5HOD A;  2VQC A;  5F27 A;  1G59 A;  3DLL F;  1D0Y A;  3AKZ A;  3MWM A;  1DPU A;  2J5P A;  1QA6 A;  2Z5U A;  2DT6 A;  3OYL A;  2A07 F;  5FGM A;  3I59 B;  4E7Z A;  2R7D A;  2O5R A;  3OYD A;  4PDK A;  4X6A J;  2IPQ X;  3GLL A;  1B4A A;  1WPK A;  1W7P B;  3ZRG A;  4FE4 A;  3LSM A;  1JT0 A;  1XGN A;  3HEF A;  5JR3 A;  3S2D J;  4Z6Y A;  2TDX A; 
#chains in the Genus database with same CATH homology
 2WAQ N;  4RDU A;  1MBK A;  1WGX A;  4M3B A;  2R93 J;  2ELK A;  1QPI A;  1JGG A;  2ID6 A;  3IH3 A;  1BJZ A;  4DZJ A;  1GV5 A;  4FIS A;  5J3L A;  4AUX A;  3JRB A;  2XB5 A;  4I6Z A;  2DA3 A;  2ECB A;  2CUF A;  1QVT A;  4BBR J;  1VI0 A;  1GT0 C;  3GTL J;  2XB0 X;  1K83 J;  1UG2 A;  1BA5 A;  3HOV J;  2CQX A;  3RQI A;  4DYC A;  1X2N A;  3GTQ J;  2CU7 A;  3RZD J;  3QPS A;  1IG7 A;  3JRA A;  4LOC A;  2LLK A;  2IAI A;  3HBL A;  5M5W J;  1F43 A;  3K7A J;  2VKE A;  3HGG A;  5M3M J;  5EGO B;  2CQQ A;  3TP0 A;  4MO7 A;  1U78 A;  2NVY J;  2Y9Y A;  2R7Z J;  2R5Z A;  5IYB J;  2R92 J;  3PO2 J;  1TWH J;  2HDD A;  1MBF A;  4IHW A;  1MNM C;  3G1O A;  4L5E A;  1ETX A;  2CUE A;  1W0T A;  3D1N I;  4FCY A;  4S0H B;  5C3E J;  2WB1 N;  2X9D A;  3Q0W A;  4W97 A;  4MLO A;  1H8A C;  1IUF A;  1RKW A;  3TED A;  2JA6 J;  1T56 A;  4V2G A;  5EG0 A;  1VF9 A;  3JRF A;  3GBG A;  4HNV A;  1R9T J;  2DMT A;  1TWF J;  3GTJ J;  2DMN A;  3SFI A;  1AU7 A;  3MKL A;  5IYD J;  2LKX A;  1H88 C;  2FD5 A;  2LK2 A;  3C2B A;  2D5V A;  2L0K A;  3OOU A;  1TC3 C;  1X2M A;  3Q0V A;  1Y1V J;  2VUM J;  4M6V A;  1D5Y A;  3HDD A;  1B72 A;  2EQR A;  3UKG A;  1XS9 A;  1Z77 A;  5EG0 B;  1E3O C;  3Q0U A;  4RBO A;  2EZL A;  3S14 J;  3BQZ A;  2NOG A;  1BW5 A;  3GTP J;  2MGQ A;  3BR2 A;  3A01 B;  2KDZ A;  2DA4 A;  2Y2Z A;  1F36 A;  1P7I A;  1DU0 A;  2NVT J;  2EH3 A;  3PM1 A;  3TW7 A;  1LFU P;  1HLV A;  2MW8 A;  1ETY A;  5IP7 J;  3A03 A;  4ABZ A;  2YUS A;  3RZO J;  3TP3 A;  5E3L A;  3RKQ A;  5IOZ A;  4JX6 A;  2DN0 A;  1U8B A;  1W0U A;  4M3E A;  1XG1 A;  3A01 A;  9ANT A;  1YRN A;  4G12 A;  1HOM A;  3CMY A;  2K9Q A;  5K7H A;  1GDT A;  3JRE A;  2QF7 A;  1TWG J;  5J1Y A;  1QRY A;  4CYC B;  3LSR A;  4JX4 A;  1FIP A;  3HM5 A;  1RET A;  1JJ8 C;  1HDP A;  3JRD A;  4D5F A;  4D7N A;  2DA2 A;  4C3J J;  4XRS A;  3PO3 J;  2ZB9 A;  2LTP A;  2B63 J;  2DA5 A;  1WH7 A;  3S1R J;  3DEW A;  1B8I B;  4A3D J;  2CJJ A;  1JTY A;  2P81 A;  2HOS A;  4QSH A;  3S16 J;  2DA1 A;  4QIW N;  1G2H A;  1ZR4 A;  3BT9 A;  5GPC A;  1WI3 A;  3FKI J;  4A3L J;  1U9N A;  4J19 A;  4IHX A;  2L9R A;  3K2A A;  2EBI A;  5IP6 A;  4BBS J;  1MH4 A;  1YRN B;  1X58 A;  2MSY A;  2Y0S N;  4AYB N;  2HI3 A;  3E7L A;  4JP0 A;  3G1M A;  1HDD C;  1UHS A;  2YU9 J;  2OPT A;  2H8R A;  3HB9 A;  2XGC A;  5F0F A;  1BW6 A;  2YS9 A;  1JT6 A;  1FTZ A;  1A5J A;  1JUM A;  3GTM J;  3BG5 A;  5F1J A;  3SJM A;  4Y52 J;  2XGE A;  3LSG A;  2MG4 A;  3BR5 A;  1EF4 A;  2NS7 A;  2JA5 J;  2JMW A;  1JUP A;  3ZQG A;  5EDN A;  3BR1 A;  2JWT A;  2HQ5 A;  1Z0X A;  2NVQ J;  1IV6 A;  5EYR A;  3BTI A;  2WV1 A;  2R0Q C;  2COB A;  3B6A A;  3MN2 A;  1A6I A;  5IPA A;  1ZK8 A;  4M3D A;  3B6C A;  1VFC A;  3S17 J;  2M34 A;  3BTC A;  3Q3S A;  1RR7 A;  4A93 J;  4CYC A;  5E3M A;  1S7E A;  3BG3 A;  4A3B J;  2Y9Z A;  2W48 A;  5FKK A;  5J1U A;  4XID A;  3G1L A;  1O4X A;  2GLO A;  3BG9 A;  5EF6 A;  3OIO A;  2DMQ A;  4I76 A;  4QTR A;  4A3F J;  4GFB A;  1JKR C;  3CCY A;  2ME6 A;  4X1E A;  2ID3 A;  5IYC J;  1ZQ3 P;  1LE8 A;  3BTJ A;  2H1K A;  2XSD C;  5K7Z A;  2LD5 A;  2M2E A;  4BY7 J;  1AKH A;  2R5Z B;  1H89 C;  2Y31 A;  1APL C;  3QPL A;  2EZH A;  2EZK A;  4UUS A;  4DZP A;  2M8G X;  4UUT A;  5FLM J;  4FTH A;  4NDL A;  1RES A;  3BR6 A;  3IH2 A;  3HOW J;  1PUF A;  1TWC J;  4A69 C;  1XC5 A;  2X48 A;  2JK3 A;  3LSP A;  5FKO A;  1ITY A;  2HXI A;  4MFE A;  5EZH A;  2L7F P;  1ETQ A;  1JKP C;  4W1U A;  4UUS B;  1IDZ A;  3SDG A;  5DS9 A;  2DA6 A;  1AHD P;  4V2F A;  2G0E A;  4B1R A;  4IHY A;  2HOT A;  4C3H J;  2VI6 A;  3S1N J;  1GVD A;  2LFB A;  3CQZ J;  1ETO A;  2FX0 A;  1JKO C;  4A3J J;  4XRM A;  1I50 J;  1WCM J;  1OFC X;  2IBD A;  1FJL A;  5F04 A;  3ZQI A;  1LE8 B;  5FKM A;  3BR3 A;  4Y7N J;  1HF0 A;  1CQT A;  4BXX J;  2TCT A;  5DTD A;  4B3A A;  1TWA J;  4C3I J;  1ETV A;  3F0C A;  1IRZ A;  5GP9 A;  2QCO A;  1SFO J;  2E2I J;  3BQY A;  2AO9 A;  5E3N A;  4BKX A;  2E19 A;  2K40 A;  1RKT A;  4MFD A;  5M3F J;  1ZR2 A;  2M9H A;  2DJN A;  2DA7 A;  2LR8 A;  4DYQ A;  1DU6 A;  1ZTR A;  2X6O A;  3IH4 A;  4EEF G;  1PUF B;  2E2J J;  1JTX A;  3OSF A;  2E2H J;  5J1R A;  3FK6 A;  3I4M J;  1BL0 A;  3M4O J;  1FIA A;  1NTC A;  3TW6 A;  2O8K A;  2VPR A;  2DTZ A;  5GPA A;  3ZQH A;  1U9O A;  4FE7 A;  3HOU J;  3ZQL A;  3WHC A;  3VPR A;  1JKQ C;  3O8H A;  1ENH A;  3DCF A;  1JUS A;  5F08 A;  3HOY J;  1FTT A;  1P7J A;  3IV5 A;  4D5C A;  3LOC A;  3FIS A;  3FIW A;  4A3K J;  5EGO A;  3JRH A;  2HYJ A;  1ORK A;  2L7M P;  4A3M J;  3S1Q J;  4A3E J;  5C4X J;  2LVS A;  2R5Y A;  2XPU A;  5EEA A;  3I4N J;  3L1P A;  2L7Z A;  3GTG J;  3ZQF A;  4IHV A;  3S2H J;  2HOA A;  5M5X J;  2VKV A;  1B72 B;  2LY9 A;  3JRG A;  3O8G A;  1MBJ A;  4MIM A;  2GM4 A;  2DMP A;  3OSG A;  2XGD A;  4B4C A;  1WH5 A;  2ECC A;  3HOZ J;  1ETW A;  3FK7 A;  2XPW A;  1GV2 A;  5C44 J;  3MVP A;  4C2M J;  3GTK J;  2TRT A;  2I10 A;  5E3O A;  3NAU A;  2CRG A;  3ZOB A;  3JRI A;  2XPV A;  5C4J J;  2FQ4 A;  1ZGW A;  4M3G A;  3GTO J;  3HKZ N;  4XRS G;  4IEJ A;  4A3G J;  1MBE A;  2JJ7 A;  1JJ6 C;  1AKH B;  2ME0 A;  3H0G J;  1K61 A;  2EZI A;  3LSJ A;  4XIC A;  1HCR A;  1OCP A;  2LP0 A;  4A3C J;  2KT0 A;  3BR0 A;  2IEK A;  1IDY A;  1NK3 P;  5M5Y J;  5FKL A;  4A3I J;  1MH3 A;  2K9N A;  2GBY A;  1Y1W J;  1T33 A;  1OCT C;  5JLW A;  1UMQ A;  3WHB A;  2N8G A;  3BTL A;  2JN6 A;  1I6H J;  1I3Q J;  1LFB A;  5IOY A;  2O9L A;  4JYK A;  5FKN A;  5FLV A;  4JX5 A;  1IGN A;  2JA7 J;  3NAR A;  4DW6 A;  1B8I A;  2NVX J;  3ZQC A;  2O7O A;  3S1M J;  1MSF C;  3JR9 A;  3W6V A;  4AC0 A;  3CDL A;  5JLX A;  1VND A;  5K7F A;  1ETK A;  4DYR A;  3HGY A;  5IP9 J;  2NS8 A;  1ZKG A;  1IC8 A;  1POG A;  3A02 A;  5EZG A;  1GUU A;  1SAN A;  4D7M A;  5BNG A;  5FJ8 J;  1FEX A;  2AHQ A;  4M3F A;  1RPW A;  1NK2 P;  2R5Y B;  1MSE C;  1MBH A;  4BY1 J;  2PMZ N;  2K9S A;  2DMU A;  5HOD A;  2XRL A;  3JRC A;  5F27 A;  1MBG A;  5F0C A;  3HOX J;  2M0C A;  2RAE A;  2Y30 A;  2HXO A;  3QQA A;  1OJL A;  2E1O A;  3LNQ A;  2JA8 J;  4X6A J;  5F0H A;  1IJW C;  1Q1V A;  1WPK A;  4XK4 A;  1QVU A;  4FE4 A;  3H3V K;  3M3Y J;  2FJ1 A;  1JT0 A;  3S15 J;  3HEF A;  3S2D J;  2OF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...