3HOVJ

Complete rna polymerase ii elongation complex ii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hovJ00
2L7ZA 2XGEA 2R5ZA 3F0CA 1X2NA 3HM5A 1NK2P 2IBDA 3S15J 1TWCJ 1X2MA 3HOZJ 5E3MA 5EYRA 1XS9A 1GV5A 3JRFA 3TP3A 2HI3A 2EZIA 2WAQN 5FJ8J 2XPVA 1WI3A 2NS7A 1R9TJ 5FLVA 4Y7NJ 3A02A 1SFOJ 4A3BJ 4XIDA 2LY9A 5BNGA 2K9NA 4IHVA 4JP0A 1Q1VA 4S0HB 1UMQA 2CUEA 2NOGA 4A93J 1FIPA 4FCYA 3VPRA 3OIOA 1VNDA 2OPTA 1JJ8C 5GPCA 5IOZA 4M6VA 1IC8A 2XSDC 3UKGA 1AKHB 2HOSA 1IGNA 1TWAJ 2H1KA 3JRIA 3JRDA 2M2EA 2ID3A 3WHCA 2IAIA 1OJLA 3NARA 1BW5A 3PO2J 2XGDA 2GBYA 2LLKA 3QPSA 2XB5A 3BQZA 3DEWA 4AUXA 1I50J 1U78A 1VFCA 1IDZA 2DA5A 1E3OC 3BT9A 3Q0WA 5F0HA 2CRGA 4MFEA 1ETOA 3BTJA 2B63J 1F36A 5FKOA 1HCRA 2GLOA 4QSHA 3SDGA 2M0CA 2DA4A 1W0UA 2LR8A 1ETKA 4C3HJ 3RQIA 2W48A 4D5CA 5IYDJ 2L7MP 4DYRA 2EZKA 2EQRA 1MH4A 2XPWA 2ID6A 2XGCA 3CCYA 3LNQA 2M9HA 1PUFB 4UUTA 3S14J 1I6HJ 2Y0SN 3HKZN 4FE4A 3CMYA 3HOWJ 1QVUA 3LOCA 1H8AC 2MSYA 4BBRJ 3TEDA 1PUFA 5EF6A 1POGA 1HDPA 3QQAA 5E3LA 4BY1J 3RKQA 2K9QA 5EZGA 4FISA 4C3IJ 1BA5A 4M3GA 3S1NJ 1NTCA 2ECCA 4FTHA 5FKKA 4B4CA 1S7EA 3M4OJ 1BL0A 1I3QJ 1UG2A 2R7ZJ 2ME0A 2NVXJ 1G2HA 1NK3P 2PMZN 5M5YJ 2FX0A 3HOUJ 4B3AA 1TWFJ 3JRCA 4BKXA 3B6CA 4A3JJ 1FIAA 1H88C 1Z77A 5J1UA 2TCTA 4ABZA 1IDYA 1ZGWA 1ZKGA 4DYQA 1MBJA 1MBHA 9ANTA 3BG3A 2JN6A 1ENHA 4A3KJ 1RR7A 2HOAA 3BTIA 3GTOJ 5EZHA 4W1UA 3HB9A 1JTXA 2CQXA 2L0KA 1HF0A 1RESA 2LVSA 4JX6A 3BQYA 4DYCA 3Q0VA 4BBSJ 1XG1A 4A3LJ 4DW6A 4DZPA 2M8GX 1ZK8A 1U8BA 2R92J 5EDNA 1ZQ3P 4X1EA 2K40A 2VKVA 2YU9J 2CQQA 3MKLA 2R0QC 2YS9A 3H3VK 2COBA 2Y30A 4L5EA 1EF4A 3BR0A 3JR9A 4A3MJ 5F1JA 2AO9A 5F08A 1ETWA 2HOTA 1RETA 2HQ5A 2DA7A 2LK2A 2X9DA 1MSEC 2DA3A 2YUSA 2RAEA 1B72B 4A3EJ 3MVPA 5EEAA 5IYBJ 3FISA 2OF7A 3HGYA 3B6AA 5J1YA 3GTMJ 1MBKA 1B72A 2WB1N 1GVDA 4I76A 3OOUA 3FIWA 3D1NI 2FD5A 1FJLA 3PM1A 2JA7J 1ORKA 2XB0X 3HDDA 4A3FJ 2KDZA 2LFBA 2XPUA 1K83J 1IJWC 1JKOC 2XRLA 4A3GJ 5FKMA 5M5XJ 2M34A 5F0FA 3S2DJ 5J3LA 3GTQJ 2DA6A 5EGOA 3FK7A 3JREA 1UHSA 1ETQA 5JLWA 5EG0B 1O4XA 2NS8A 3NAUA 5IP6A 3E7LA 4BXXJ 5HODA 3LSGA 2CJJA 3ZOBA 5FLMJ 4XK4A 5EG0A 3JRGA 1BW6A 2DMUA 4HNVA 2VUMJ 3CQZJ 4MO7A 1HLVA 3BR6A 4QTRA 2E2IJ 2JK3A 2DJNA 3FKIJ 2O8KA 2P81A 2JMWA 5DTDA 4X6AJ 1CQTA 3G1MA 3S16J 3JRAA 1JJ6C 4MIMA 5IYCJ 1RPWA 3SJMA 2TRTA 3K2AA 3ZQGA 1A5JA 1VF9A 2ME6A 1D5YA 2CUFA 1P7JA 2DN0A 1IRZA 3ZQLA 1ETXA 1T33A 2DMTA 4MFDA 2EZHA 3BG5A 4RDUA 3WHBA 2E2HJ 3A01B 5IP7J 4V2FA 1JT0A 2K9SA 3OSFA 1W0TA 3GTJJ 1A6IA 2HYJA 1WCMJ 4JX4A 5JLXA 4IHYA 3A01A 4GFBA 4D7MA 4UUSB 5K7FA 5C44J 4Y52J 3RZDJ 3LSPA 3ZQCA 5C4XJ 2EBIA 1HOMA 2FJ1A 4QIWN 4UUSA 4M3FA 2HXOA 1YRNB 4M3EA 3IH2A 2AHQA 3GTGJ 2KT0A 3JRHA 4XRMA 1GT0C 2G0EA 3MN2A 1P7IA 2JA8J 4IHWA 1YRNA 5IOYA 1HDDC 3FK6A 1WPKA 4CYCB 3PO3J 5IPAA 3CDLA 4D5FA 4M3BA 3HOXJ 1TWHJ 3O8GA 4MLOA 3I4NJ 4EEFG 2LTPA 4NDLA 2NVTJ 3GTKJ 3BR1A 1MBFA 1JT6A 1MBEA 1ZTRA 5F0CA 1JGGA 3BG9A 3QPLA 1JKRC 1ETVA 3HOYJ 1LFBA 3HEFA 3BR3A 3ZQIA 4AYBN 4CYCA 3S1RJ 2R5YB 4AC0A 3Q0UA 1DU6A 5K7ZA 5C3EJ 1GUUA 1TC3C 1FEXA 4V2GA 1JUMA 1TWGJ 2R5YA 3BR5A 4JYKA 3SFIA 1H89C 3L1PA 4LOCA 1JKQC 2DMQA 3A03A 4FE7A 1WGXA 4IHXA 4RBOA 1OCPA 3IV5A 1LE8B 2ELKA 2VKEA 3TW7A 2O9LA 5IP9J 1U9NA 1IV6A 1MSFC 5E3OA 3GBGA 3H0GJ 3O8HA 5FKLA 1U9OA 3HBLA 3G1OA 1DU0A 1ZR4A 1LE8A 3TP0A 1MH3A 2QCOA 5EGOB 4I6ZA 3S1QJ 3BR2A 1AKHA 1QRYA 2JA6J 5E3NA 3LSJA 3G1LA 1LFUP 1F43A 1B8IB 5M5WJ 1FTTA 4J19A 1QPIA 3JRBA 4A3IJ 2EH3A 4A3DJ 3C2BA 2Y31A 2LP0A 1ZR2A 3IH4A 2I10A 2ECBA 2O7OA 2NVQJ 1B8IA 2MG4A 1T56A 2X48A 1ITYA 2JA5J 1Y1VJ 5K7HA 1OFCX 1MNMC 2QF7A 4A3CJ 3M3YJ 1ETYA 3TW6A 3OSGA 2DA1A 1Z0XA 4DZJA 2L7FP 5FKNA 2JWTA 1AU7A 1VI0A 3RZOJ 2DTZA 1K61A 4C3JJ 3S17J 3S2HJ 2VPRA 5M3FJ 5GPAA 2H8RA 2N8GA 3ZQFA 1SANA 5F04A 1OCTC 3K7AJ 2GM4A 2D5VA 2LKXA 2DMNA 2E1OA 4G12A 1X58A 3IH3A 3Q3SA 2WV1A 4M3DA 1WH7A 1GDTA 4B1RA 2Y2ZA 4XICA 1AHDP 1XC5A 2X6OA 2JJ7A 3I4MJ 2Y9ZA 2L9RA 4IEJA 4JX5A 4XRSG 5F27A 5C4JJ 1GV2A 2ZB9A 4XRSA 2E2JJ 1FTZA 1WH5A 4BY7J 3GTLJ 2CU7A 2FQ4A 3DCFA 3W6VA 1JUPA 2IEKA 4C2MJ 3BTCA 2MGQA 2E19A 1MBGA 4A69C 5J1RA 2EZLA 3HOVJ 3LSRA 2Y9YA 2DMPA 1JTYA 3BTLA 3ZQHA 5DS9A 1RKTA 1Y1WJ 1JKPC 2NVYJ 2LD5A 1IUFA 2HDDA 1RKWA 2DA2A 3GTPJ 2MW8A 5M3MJ 1JUSA 4W97A 2VI6A 2R93J 1BJZA 1IG7A 2R5ZB 3S1MJ 1QVTA 3HGGA 1APLC 5GP9A 2HXIA 4D7NA
chains in the Genus database with same CATH superfamily
2HPIA 2XGEA 3CD6I 3F0CA 1X2NA 1HSJA 3HJEA 5ICFA 2JUGA 5ILUA 5E3MA 4F91B 3JTGA 1HC8A 2Z99A 3TP3A 2EZIA 4AWXB 2EJRA 1SMYF 5D8KB 4RB1A 4IVNA 1R9TJ 1YW7A 3AG1H 4Y7NJ 3A02A 3I5UA 2P7VB 4A3BJ 3FWEA 1J0RA 2LY9A 4XIDA 4RM3A 1Z7LA 2CUEA 1G8XA 2Z16A 3K4LA 1FIPA 3ZQQA 2PG4A 3CO6C 3OIOA 3FBNB 2ACJA 4E4HA 4F7ZA 5AIPA 1X4PA 1XGOA 2R3SA 1FYLA 3PNYA 1IC8A 1AKHB 2HOSA 2M4GA 3TDUC 5J4VA 3CF2A 1VQ8I 1R23A 1V5FA 1K78A 2H1KA 3TO7A 4HBLA 3JRIA 2K86A 2M0MA 2M2EA 4XQFA 2ID3A 2K4JA 3D5SC 1E3PA 6PAXA 4IZZA 2EB7A 2EA4A 1BW5A 1DPUA 2W00A 2E7XA 3E97A 4HSRA 4M6YA 3REOA 1ZHFA 2WY7Q 2HKOA 1TT5B 2XB5A 3BQZA 2IS2A 2CMPA 1U78A 2WTEA 1S5LC 3CCRI 4YFXF 4U7BA 2IJLA 4R1HA 3GZ6A 2JRMA 4MHGA 2B63J 3OYLA 4ENNA 4XSZF 4QSHA 3DPTA 2DA4A 3VDXA 1D0YA 1ETKA 1R22A 2K5CA 2KPMA 3NWSA 2H6CA 4RB2C 4D5CA 3TKYA 3L2QA 2IGOA 2VQCA 2YX4A 3KE2A 5DCFA 4A0ZA 4P9UA 1K79A 2EZKA 1FMVA 4HX7A 5E20A 1U2WA 2EQRA 1R36A 2D1VA 2PMUA 2XGCA 3BJAA 3CCYA 1MNDA 2ZMEB 4UUTA 1FT9A 3E1SA 4UB6C 4BDZA 2Y0SN 2DO7A 3DU6A 3HOWJ 1W5CC 4MQ9F 1XGNA 1PUFA 3PFIA 3WTWC 3GX4X 3CUQA 2HTJA 3PQKA 2BVMA 4BE2A 3NQOA 4A2UA 3RKQA 1LDDA 3H9JA 4FISA 1R71A 4Y17A 5B66C 4E6KG 1RNLA 4EJVA 4HX8A 4KITB 5E17F 2VONA 4U88A 3T8TA 3CESA 3KP6A 3M7GA 2KP6A 1YIOA 2ME0A 3MZHA 3C7JA 1O3TA 1G2HA 1BI0A 3GFIA 2WA0A 1NK3P 2FX0A 3FX3A 1ZELA 3JRCA 2RDPA 3HRTA 1MDMB 4YFKF 4IX7A 5E79C 5J1UA 3HUGA 1LJ9A 3VOEA 1PP8F 1MJBA 2EV5A 2XAJA 4HAMA 2VPLA 1MBHA 3QYFA 2K7LA 3AFHA 9ANTA 3VODA 2JZYA 1ZAOA 5A2QZ 2JN6A 4A3KJ 2RNGA 1D3YA 2GWRA 4JOMA 4LLNA 2FF4A 2L0KA 1IN4A 2GZWA 2KZGA 4OINF 5JHFA 3C2HA 1BIBA 3BQYA 3HKZA 4KA4A 3ECHA 4CICA 3Q0VA 4BBSJ 3R60A 2MLGA 3CLQA 2OU2A 2LMDA 4DZPA 2M8GX 3TGNA 3W2VA 2BZTA 2CQKA 1XMAA 2R92J 1ZQ3P 5D8LB 2K40A 3ERED 1RIOH 2CQQA 1TQIA 3H3VK 2COBA 2E34A 1J2XA 1S29A 4L9TA 4AIHA 2QBYB 4A3MJ 5AONA 3GZNB 2O8XA 5F08A 2NVUB 1RUOA 2O61A 4XLNF 1GXPA 2HOTA 2O0YA 4B3XA 3J80K 2J5OA 3K4NA 1XD7A 4NC7A 1IZ1A 5D5UB 3FM5A 1I5ZA 3N05A 4A3EJ 1A36A 4PSWA 3CC4I 4EM2A 3FISA 5J47A 3WTSC 1VQ9I 2KKOA 2IGKA 1RUNA 1A31A 2QWWA 2VBXA 3MD2A 3OOUA 4BHBA 3KP7A 1BI1A 5IT3A 4A5NA 1UG0A 3PM1A 3OV8A 1ORKA 1AOYA 2ZFWA 3HC7A 3TOAA 5DV5A 2OD5A 2KDZA 3H92A 4EM1A 3ZMZA 4EGZA 3E6CC 3M8EA 1OYWA 2GIVA 2K02A 3GMEA 2LBFA 3H5NA 3Q5FA 2XRLA 1TP4A 2L54A 2EA2A 3BC8A 4L9VA 1MMAA 4WF2A 1Z21A 2QA4I 5JLWA 1FP2A 3KP4A 3ONQA 2NS8A 5EG0B 2BVLA 4BXXJ 2P8TA 4LB6B 3LSGA 1E0EA 1Z6TA 4EJWA 4BQAA 1P4XA 1J09A 3ZOBA 5JVTA 1R1TA 1BW6A 2VIXA 5HS8A 2VUMJ 3TL4X 3KPHA 5DD8A 3I56I 1T08B 1FYKA 1T0FC 4QTRA 3GVAA 3E6BA 4B09A 3FKIJ 2O8KA 4UHTA 4YIFA 1GLNA 2JMWA 4DOZA 3OR2C 1S6LA 1CQTA 4H4KC 3JRAA 3K10A 3FBIB 4S05A 1A5JA 3DEUA 1D5YA 4OIQF 5D6EA 1HW5A 3ZQLA 1T33A 2DMTA 3O2PE 4AIKA 1BBYA 3CCLI 2Z1DA 1VQ6I 2M87A 4BQQA 5IP7J 2ZJRF 4UV9A 2FU4A 3OWTA 2A6EF 3A01A 3CC2I 3FXKA 4XLHA 1ZYRF 1YO5C 3EYYA 3RKYA 2PQ8A 2EBIA 1HOMA 2FJ1A 1BI3A 1W7PB 3I0TA 1IO2A 2HXOA 4LLGF 1YRNB 1LQ1A 2UXXA 4J01A 4M3EA 3IH2A 3I54A 2JSPA 2DFIA 1Z9CA 1N77A 5CKTA 5LGTA 4F93B 1Z3XA 2KRHA 3MN2A 2W7NA 4XRFA 3E0JB 1NG7A 1HDDC 3A0BC 4D1QA 3LFKA 3WE3A 4G7HF 5IPAA 4D5FA 2YPRA 2HQRA 1ULYA 1VQ5I 4EM0B 3OS1A 3FXUA 3HOXJ 3EUKL 5FFZA 3EUAA 2FUG2 4HF0A 4AIJA 4EEFG 2LTPA 4ZYAA 2NVTJ 4WX9A 4HEA2 3NRVA 4RGSA 3GTKJ 4M9XA 1ZTRA 1E2XA 3QPLA 3R61A 3OS2A 2R7XA 3HOYJ 5LFAA 1FY7A 1MD0A 2FMYA 3BZCA 4EJTA 1Y0UA 4AC0A 4XOPA 1DU6A 2BY0A 1TC3C 2NNYA 1FEXA 1TQPA 2ZXJA 2DFHA 2DQLA 4YIIA 1VQ4I 2XVCA 5ERIA 3OYMA 3O3KA 4ZH4F 4LOCA 1JKQC 2H1LA 1BI2A 1WGXA 2L7KA 4IHXA 5LBQA 2V1XA 1OCPA 2CSOA 4BQNA 1WJDA 2ELKA 2EINH 1IV6A 3H0GJ 1A35A 3WU2C 2OBPA 3FHZA 5ICEA 4YIRX 1Y56A 3T5XA 4Q47A 1ZR4A 2LF7A 3FZVA 1N25A 4RAZA 3H3ZA 2OC6A 3BR2A 1OQYA 3L9FA 3QPTA 3EPZA 4YELA 3COAC 3CJNA 2CW0F 3RKWA 1OR7C 3JRBA 2DFEA 2JVHA 3C2BA 1ZR2A 2LP0A 1K4TA 2COMA 4HZFA 1QO0D 1FOYA 2F4MB 1XSVA 3KEYA 1B8IA 1T56A 2ZSIB 2JA5J 1OFCX 4ANJA 2DT6A 3M3YJ 5TJJA 1TZLA 2C6YA 4I02A 3TW6A 2MH9A 2K27A 2O6GE 1Z0XA 4FX4A 3KP5A 4LGWA 4HV6A 5E8GA 2GOMA 2MD5A 5ILVA 2VJ5A 1AU7A 2JUCA 1P9QC 1VI0A 3RZOJ 1HBXG 4MQVA 2RC4A 2PLYA 1XMKA 3W2AA 2DTZA 2HS5A 1FBQA 1K61A 3S17J 2DU9A 4PFOA 3S2HJ 2XKPA 2RREA 5M3FJ 3SZPA 1DGWY 4RB0A 2N8GA 2XAHA 3ZQFA 1SANA 1K4SA 2E1OA 1X58A 3IH3A 3LA2A 1OCCH 2KDOA 2LREA 1GDTA 2L9NA 4HF1A 2Y2ZA 3DPUA 1XC5A 4HYEA 4G7OF 1VQMI 2GA1A 3VFZA 1FPQA 2VODA 2IS6A 3ZN1A 4BDYA 3HOTA 4JX5A 5CLSA 5K5OA 1DPRA 5C4JJ 3TBIA 1Z1DA 2P5LC 4XLCA 4IRIA 3MKYB 1L3LA 2A5WA 4MNUA 1R4MB 1J7KA 3BZ6A 1WH5A 2FOKA 3VYSB 2ESNA 3DPLC 2CU7A 1JUPA 4C2MJ 3BTCA 3K4KA 2IA0A 2NAZA 5DCMB 2CUZA 5B3SH 2KJBA 2EZLA 1WRJA 2GAUA 3CLOA 2DMPA 1JTYA 1QZZA 3BTLA 1RKTA 4G7ZF 2HDDA 1RKWA 3IP4B 2EWNA 4L9NA 4GYGA 2QLZA 1VQLI 4HDVA 1B4AA 2VI6A 4I09A 1QBJA 4LG0B 1NH3A 2QGUA 2KMUA 3F6VA 2MYSA 2IGMA 2ZXWH 2FOWA 2LY1A 3DF8A 1QVTA 3S1MJ 3ABLH 1LNWA 4CYCB 3K0LA 4D7NA 5JR3A 1JE8A 3V7CA 2KJCA 2L7ZA 2HVRA 4ZJZA 2BY1A 4Z6YA 3S15J 4KNYA 1X2MA 3HOZJ 1GV5A 2MFZA 3JRFA 1U5TC 2FE3A 3LMMA 2PJRA 1XDSA 2HI3A 4O5VA 5FRNA 1WI3A 1DQUA 4I98B 1VTNC 1X1DA 2VOPA 2E35A 2KIQA 2UV1A 1O7LA 4CCMA 3T8RA 3OYDA 5FD6A 1XSXA 5HVQC 1TNSA 2XSJC 1Q1VA 4S0HB 1EA3A 2DCEA 4Q4ZF 3GEZA 3VPRA 4XKVA 1R5GA 3A1YA 1FLIA 3RIRA 1K78B 3LQRA 2JPBA 2HEOA 3V7RA 1QGPA 2P6TA 2XSDC 4EJUA 3QU6A 1IGNA 2LNBA 1TWAJ 3N4MA 1R5ID 3CZ6A 1R5HA 3JRDA 2FBIA 2FNAA 4G6TB 2F5CA 1P4AA 4HOBA 4AIDA 1HSTA 2R7FA 2XGDA 4ESBA 4D9JA 3I9V2 3OYGA 3UR3C 4RGXA 1IW7F 2Z9OA 1B59A 2X1EA 2DA5A 1E3OC 1G59A 5D4RA 3WTXC 1S9HA 4LMYA 4N4OB 3Q0WA 3G3ZA 3OIQA 2KL4A 1X1BA 2CRGA 4MFEA 3BTJA 3H3UA 3L2CA 1F36A 1HKQA 1HCRA 4OU0A 4B48A 1ONVA 2M0CA 3LFUA 2Y75A 2FEZA 1X3UA 1JHFA 2W48A 3ECOA 1O7FA 4ON0A 3CCJI 2WAQA 5IYDJ 2HU9A 3U2RA 2I8DA 4UNOA 3EDPA 5DUKA 1MH4A 2YX7A 4O3MA 2A3SA 1ZG5A 1SD7A 2ID6A 1W4MA 3CCSI 2M9HA 3WTUC 1Z67A 1PUFB 3FXQA 1I6HJ 2E60A 3HKZN 3CMYA 1QVUA 2K3FA 1POGA 2W4SA 2AQFA 3QQAA 2PJPA 4J00A 4FX0A 3IUOA 3J81Z 2K9QA 2Z2SB 5FO5A 4C3IJ 1OLTA 5IT9Z 1R7JA 4MTEA 3ROUA 1P6RA 1NTCA 2ZBKA 3HZJA 4FTHA 5FKKA 3IL2A 3C3WA 3ELKA 2E5ZA 2DFFA 1BL0A 1UG2A 5GTHC 2XIGA 1O3SA 4RLFA 3SZGA 2NVXJ 2ZNZA 5AIQA 1QZYA 3HOUJ 1P2FA 3ERMA 5K5QA 3MEXA 2V79A 2M4KA 1XMXA 1K7AA 1O3RA 3B6CA 3HUGB 4A3JJ 1LPQA 2GXAA 3QU3A 2IS4A 1STZA 3FMRA 1FIAA 5KAFC 1VQKI 2FRHA 1IDYA 4BHCA 3CF5F 5E1XA 5CJ9A 3DP7A 1LVKA 3LA7A 2NRAC 1S7AA 3BG3A 4M9SA 3VB2A 3F9KA 3ZMDA 4DBRA 1ENHA 5GAGJ 3GF2A 5CQGA 4IXAA 2DYRH 2AS5F 4G6QA 2DXIA 1DDNA 1I6XA 2CQXA 1HF0A 1I3AA 3EETA 4V19K 5CVIA 4DYCA 1W5TA 3MZYA 4WK8F 2JQ7A 4YEJA 1XG1A 2BW3A 4DW6A 5EEGA 1WZ2A 3PNTA 1UHWA 3ABKH 1FWZA 1X19A 3PIOF 2BHYA 4X1EA 3H0DA 1Y39A 3OL4A 3D0SA 1EKEA 3CCUI 5DD4A 5JVGF 4L5EA 3F8MA 2L9SA 2D2WA 3BR0A 4KT6A 2VOOA 1WHUA 2DT7B 2WBMA 3ML6A 4N4NB 4PUSA 1KGSA 2HYFA 4KIFA 3G6EI 1R6RA 1YW8A 1V54H 5F1JA 2AO9A 1ETWA 3FKJA 4KYWA 3OYKA 3LL7A 1RETA 4B43A 4CH7A 3CCMI 1Y8QB 2PMZA 3TOBA 3PUBA 4LG3A 1S3JA 2RAEA 2Z5UA 2M7BA 3K6GA 3HRUA 2EPFA 2DTRA 4M9ZA 3IRRA 5FLXK 2E7WA 3MVPA 3L2VA 2DDAA 2VC0A 2VJJA 1T2KA 2OF7A 4IQJA 3B6AA 1ZLKA 3GTMJ 1ERDA 5FROA 2QQ8A 1MBKA 1IXCA 3MCZA 5L3DA 1IXRC 4QWQA 4LFUA 2D45A 2L4MA 3KFWX 3GXOA 2P0WA 1YHQI 3FIWA 5HDGA 4XOTA 2UUZA 2LBFB 3W6KB 4NUBA 3BLYA 2X6YA 3HDDA 4HQEA 2AQEA 2LFBA 1FZPB 1JHHA 3ZGKA 2KIUA 1JKOC 1XX5A 2X6WA 5FKMA 4QPOA 4EV0A 2CO5A 5M5XJ 1R1UA 2M34A 5LHIA 5TGTA 2CS3A 5J3LA 3A4CA 3FMQA 5EGOA 3R4KA 3E5UA 3JREA 1UHSA 1ETQA 2IGNA 4BHPA 4BS9A 3VWBA 3AAFA 2ZXIA 1W7PD 4XKBA 1SVLA 3FF5A 5FLMJ 1TW2A 2MD0A 1UHMA 4LITA 4HNVA 2XAUA 1MJAA 3CQZJ 1TT0A 1HLVA 4TV7A 3BR6A 4II3A 3LSTA 2E2IJ 4Y4RA 2JK3A 5TRDA 2ZMEC 4BL0B 2OCCH 5KK1A 2JSCA 3P9IA 5DTDA 4FASD 4X6AJ 1LFPA 3S3NA 4AVPA 4ZYGA 4U0YA 1RPWA 4Q5SF 4IL6C 4UVCA 2UXNA 3K2AA 1SMTA 2XROA 2M7AA 1VF9A 2ME6A 1P7JA 1IRZA 2M30A 4IKFA 3K4BA 4NQWA 4MFDA 2XAQA 2EZHA 4F3QA 1U0JA 4JBAA 4M71A 4RM2A 4RLQA 3A01B 1JT0A 1IRGA 1WSUA 4OAYA 3KIOA 1A6IA 1AA7A 3PIPF 3BCAA 1OYIA 1PP7U 4GFBA 5K7FA 2L5QA 5KVRA 3LSKA 2WV0A 3Q9VA 2RVCA 3K4CA 3WTYC 4EATA 2ZFUA 3HSEA 3SEZA 3RZDJ 4Y52J 1SFUA 3P7NA 1G3TA 2G7HA 1D0ZA 2RNJA 3GFMA 1WQ2A 2HZDA 3IHUA 2EFQA 4UUSA 4HLYA 4ZDLA 4ZZLA 5BMZA 4L0YB 2HDCA 3GTGJ 4XRMA 1A04A 3WGIA 2G0EA 2W25A 1TLHB 3DKWA 4IHWA 3I59B 4IQ4A 5J6XA 1KZHA 2OQRA 4CCOA 4IRHA 4JQFA 1MMNA 4PJNA 3RQ4A 1TBXA 2IS1A 2F6CA 3FXJA 3BPXA 1S8NA 3AL0B 1TWHJ 2L3DA 3E6DA 2ISZA 1KU9A 3I4NJ 3DFGA 3RTRA 2LKPA 3B73A 2EK5A 3ESWB 3QPHA 5L3CA 1MBFA 3KEOA 5CVVA 4RB3C 1MBEA 5F0CA 1G4DA 2DK8A 3PSFA 2VT3A 1ETVA 1JKRC 1LFBA 3DBHB 2Q0OA 3WU0A 4UVAA 3OY9A 2V4JC 3BROA 3MQ0A 3ZXSA 3ZRGA 3S1RJ 2XAFA 1V55H 3Q0UA 1IN8A 5K7ZA 1MKMA 3IAM2 2ZNYA 4V2GA 2QQAA 3CDHA 1JUMA 1TWGJ 1ZGAA 4ESFA 3BR5A 4JYKA 2EFPA 1ZARA 3SFIA 2QKLB 2DMQA 2L02A 2WWYA 1A6QA 3A03A 1FX7A 3EUHC 4HDUA 1RI7A 2TDXA 2VKEA 4XSXF 3TW7A 3ZMTA 2O9LA 5IP9J 2LRDA 1U9NA 1MSFC 5E3OA 3GBGA 3L09A 3HBLA 1BIAA 1BJAA 2OA4A 5D5XB 2M5WA 3KLOA 4UVBA 1SD5A 3TP0A 3S93A 2QCOA 3MAJA 4HX4A 5BPIA 5L3GA 4I6ZA 4XLPF 3DBLB 1AKHA 5E3NA 2HNHA 1FBSA 5L3FA 4GDFA 1V3FA 1Z05A 4ASNA 1B8IB 1IUYA 4P1WA 4A3IJ 3C2GA 2B0LA 2X48A 3RPUA 4XBFA 4A6EA 3FXRA 4EQQA 1MNMC 2H94A 3S3OA 4A3CJ 2F48A 1G3WA 2HOEA 4AYBA 2EV0A 4DZJA 1W1WE 3M8FA 5J40A 2VE9A 1WVRA 3K70D 3BCBA 4P5OA 2H6BA 1JI8A 1KONA 3RDIA 3DXJF 2H8RA 4UY8I 4LB5A 1YS7A 3HHGA 5F04A 3VYTB 1BOAA 1OCTC 3K7AJ 3ZMUA 3HIFA 3VSKA 1OKRA 3BPVA 2DMNA 2LOOA 2MBFA 3MMYB 3CCQI 4YFNF 1XGSA 1WH7A 1RZ4A 3V4GA 1W5SA 4HA8A 4KIBA 4XICA 3OMYA 2JJ7A 4BUPA 4DIQA 2Y9ZA 2L9RA 2VT2A 5JFRA 1RRJA 4IEJA 4CYDA 4M74A 4KMFA 3MZ8A 5F27A 3CO7C 4Y13A 3V8LA 4GXOA 2D1HA 2ZO4A 3W6VA 4IJAA 1SFKA 2IEKA 3WGHA 4II2A 5JI6A 1N78A 5KAIC 5J1RA 3HTUA 3HOVJ 4P96A 2RV8A 1FYMA 3FM3A 3ZQHA 1Y1WJ 1SFEA 5JHUA 2Y69H 1F1ZA 2E71A 4OAZA 2MW8A 4RMNA 5M3MJ 4PJ0C 5H6QA 4BACA 3P5JA 1MJ9A 1BN5A 3I3LA 5D4SA 2JVGA 3QWLA 2WAFA 5HLIA 2KLOA 2HXIA 2R5ZA 1H9TA 2PJRB 3HM5A 4D0PA 1SAXA 5EYRA 2R7WA 4NC8A 4IO9F 1XPXA 3CUOA 1CF7B 2WAQN 3JSOA 2QSGX 2Q2EA 3LA3A 3CJTB 1SFOJ 2DAOA 2JA2A 4OIPF 4PK4A 1HQCA 2Y48A 1X1AA 5BNGA 3L2RA 1I27A 3WTTC 1D1BA 1IF1A 4IHVA 4JP0A 3KYCB 1REPC 4A93J 4FCYA 1PDNC 3RI4A 2K3PA 2OUMA 3EQLF 4BEHA 5GPCA 2Z33A 4GCVA 3BOQA 5IOZA 3FDYA 2VC1A 1OCOH 1QNTA 2CV2A 4OOIA 3HSRA 4A5MA 3IC7A 3E5QA 3F8BA 2LF8A 1YE9A 4BQOA 4LIVA 4PGHA 2IAIA 5DUIA 3NARA 2A05A 3LQQA 1KU2A 5CQEA 2IRFG 3K4MA 2DDBA 2BHZA 2LLKA 4MEYF 4OMZA 1UCRA 1VQNI 2XC7A 3DEWA 1VFCA 3Q9SA 1IDZA 1I39A 3BT9A 3L2UA 1Z91A 1X4OA 5KNLA 2MC3A 5BOXA 2FQ3A 4KJZA 1XTAA 2W57A 1SC7A 3J7AY 2DYSH 4GGGA 3L2WA 4HSTA 2GLOA 2LDUA 5FB2A 3MWMA 3CCVI 2LR8A 2HVSA 2H27A 4OWRB 4YRVA 3FXOA 4KISA 3CMAI 2GIZA 1K6OA 4CZZA 4LLLA 1LDJA 4KUMA 2AXLA 2L7MP 2WADA 4HRIA 2X85A 1FBUA 3V7SA 3B02A 4DYRA 3BG6A 3I58A 1DP3A 2E1NA 2PN6A 3JTHA 2WY8Q 5E8IA 2EFWA 3LNQA 5J8CA 5F64A 2IPQX 3H5RA 4RAGA 2XUBA 4FE4A 1YJNI 1H8AC 1T0FA 3NWTA 3ZMSA 5HNFA 2MSYA 4ZZDA 2HTSA 5EF6A 3G2BA 3KETA 2OJED 3J7ZI 3SZTA 5E3LA 3FXLA 1FOXA 1S7OA 1HA8A 1UB9A 4M3GA 1Q1HA 1F5TA 3S1NJ 1BA5A 3J7AO 3SEQA 3HPHA 3T0YA 1KU3A 2ECCA 3M07A 4ENKA 2HFHA 3WGGA 5D6FA 1ON2A 4IPAA 2Q8KA 3RKXA 2PI0A 2W84A 1VQOI 2X4HA 3M4OJ 1LUJB 4RAFA 2R7ZJ 5EEHA 4BXUA 2VB6A 3DTKA 2PMZN 1KU7A 1SEUA 3DWLE 4RGUA 3HSFA 4A6DA 2H8WA 3F6OA 4L5IA 1Z3YA 2V1DA 2K9LA 1BM9A 2TCTA 4ABZA 2E36A 1AWCA 3QRFF 1ZGWA 1ZKGA 4DYQA 1XN7A 3K70C 1K6YA 3J80Z 4ENMA 4ZTJA 1RR7A 3VYRB 2DODA 2HOAA 3BTIA 1S72I 4W1UA 2KISA 3HB9A 2BW3B 4DNCA 2DPUA 2R7TA 1JTXA 2EIKH 2VBZA 1YJWI 2DW4A 4RA2A 4U87A 3ABMH 3RYPA 3SFZA 2A6TA 2VASA 5J8FA 3OYNA 2CV1A 1J75A 3QP5A 4A3LJ 4PJJA 1ZK8A 2AXTC 3WODF 3G73A 4ZDOA 4KN7X 2XASA 3DKYA 4FETA 4IHSA 2R0QC 4NHJA 1T6SA 2Y30A 4F52A 4DQ2A 3IKTA 3WTVC 3JR9A 2V1UA 2UWMA 3E6MA 3BJ6A 2ELJA 2GA2A 2OCEA 3MKZA 2MA3A 2MLKA 5L3BA 4LK0F 5A2QK 4E70A 1PJRA 5LHHA 1ZRDA 4N9IA 2DA3A 3ISPA 1ZG3A 1B1BA 2P4WA 3BDDA 2EV6A 2J5PA 3GLLA 5IYBJ 2R7VA 1SAUA 4U0WA 3HGYA 5J1YA 4I7HA 1OPCA 1B72A 3O6BB 3BJOA 4E7LA 1BOBA 4KMUX 2DJIA 4Y3OA 2F5VA 4U0VA 3U9GA 2VQLA 2FD5A 1FJLA 2CFXA 2HGCA 1JGSA 4A3FJ 2XPUA 3DU5A 1YX5A 2ZCWA 5E18F 1IJWC 2I5UA 5D5VB 2PFBA 5ICCA 4ZYDA 2JT1A 1OR7A 1IN7A 3AG2H 1O4XA 2EFNA 3ULQB 2XF7A 1EV7A 2V9KA 3SDBA 5IP6A 1TNTA 3E7LA 4DGWB 2BXYA 1GXQA 5GTIC 3RYRA 4L9JA 1WFXA 1WKMA 1R00A 4UV8A 4ZDPA 3CUQB 2BXZA 2DMUA 3HYIA 1IN5A 1ACIA 2V7FA 3HTSB 2DJNA 1XCVA 2P81A 3CUQC 2QQBA 2BY2A 4NNJA 5FRMA 3JAMZ 4NQWB 3GW2A 1ZRCA 4MIMA 4EVIA 1T98A 1HXDA 2TRTA 4P55A 3SJMA 2VKDA 2VBWA 1SD6A 1ETXA 4HW0A 2CH0A 1D1AA 2DOAA 4FHTA 3BG5A 3WHBA 4CA0A 1EH6A 4KIGA 2WB1A 1WJFA 2K9SA 3OSFA 1W0TA 3GTJJ 2B9SA 1UJ8A 3QAHA 2HYJA 1WCMJ 2STTA 1QPMA 3F21A 4IHYA 2W85A 3W3CA 4UUSB 2Y0MA 5HS9A 5KCMA 2ESHA 4FQGA 3CMEI 2DI3A 3ZQCA 1ON1A 1Y0NA 1BC8C 1OCRH 4M3FA 2XF5A 3V42A 4HPQA 2F5EA 2L01A 4PJLA 2KT0A 3DEEA 1B9MA 4RAYA 2P5KA 4RS8A 4HV5A 1IV8A 2JPCA 4OIRF 2BOLA 5IOYA 5GAEJ 4QPQA 3BP8A 2EILH 4HNTA 2CGPA 2QVOA 1D0XA 3R6SA 3PO3J 2DOEA 3CDLA 2V9PA 1DP7P 1YS6A 3U1KA 2KIMA 5K1YA 1QHGA 1VZ0A 4EJOA 5B1BH 4BYYA 2A5YB 4M72A 2A68F 3PFYA 5BS6A 4NDLA 3SXYA 1Y6IA 2HWVA 4AD9A 3S32A 2FXAA 4LG0A 4UXNA 1X3WB 2RQQA 1JGGA 1KQ8A 3WG7H 1YYVA 3HEFA 1R58A 3H9GA 3BR3A 3ZQIA 4AYBN 3J7YJ 4CYCA 1YTYA 4PGGA 4IF4A 3G4SI 1U5TA 5F1RA 4M73A 4H0EA 3M8JA 2OZUA 4G8XA 2NOJB 1HW2A 2DT5A 2R5YA 4KFCA 4BE0A 3H36A 1UZCA 3MKWB 2L4AA 4I0AA 2BV6A 4HQMA 3DKXA 1H89C 3ZP5A 4JK1X 3F22A 2CWEA 5DYMA 3R0JA 2P7CB 4FE7A 4F92B 4C30A 1EH7A 3JCUC 3VEPA 1XCBA 3GFLA 3IV5A 2X51A 1UFMA 4XLAA 3ABUA 1ZH5A 3O8HA 4LJZF 1U9OA 1BC7C 3K4JA 1C0WA 3OYJA 2RGVA 2VKHA 1LE8A 3L7WA 2LSOA 4CHUA 1MH3A 2LKSA 4PZJA 1U3EM 3S1QJ 5H6RA 1QRYA 1F43A 2DQRA 2PX9A 5F6FA 1L0OC 5M5WJ 1FTTA 2XRNA 4NC6A 5HNHA 4J19A 4A3DJ 2EH3A 3DLLF 2Y31A 3IH4A 3H9QA 5LHGA 1F4KA 3LWFA 3IWFA 1ITYA 1I1GA 2V26A 1X1CA 3F8CA 5K7HA 1TW3A 2FA5A 2XGXA 4ETSA 2HPMA 4NBQA 2QF7A 1ETYA 2HDWA 2MABA 1JXSA 1MMGA 2MC4A 1OMIA 3FXMA 2DA1A 3M1CA 4XMYA 5CVUA 4MTDA 2VLAA 2F5FA 4PDKA 2CG4A 2DLLA 2L7FP 4G94A 1USSA 2JWTA 1TTYA 2KFDA 2ICWG 2LH9A 3KP3A 3ZQ7A 4C3JJ 1WJ5A 4EMSA 1MMSA 2IP2A 1FP1D 1T8IA 2M1BA 3C18A 4GRIA 2LKXA 2NXNB 1R49A 4IHTA 4UUVA 3LAJA 2WV1A 4GO1A 4M3DA 3KX2A 1SD4A 4L0ZB 2QKMB 1ZGJA 2XKOA 4B1RA 2STWA 1AHDP 1PVEA 1WJBA 2VQGA 2GOXB 2V9VA 2R4GA 4XRSG 3U1DA 5HLGA 2E2JJ 1FTZA 2CQNA 5B5EC 3GTLJ 2QSFX 3OYCA 1KQ9A 1XB4A 1G3SA 3RPQA 2OTLI 3R0AA 1QHHD 2O5RA 2X1DA 4XM3A 3LAPA 1TL8A 2E19A 1MBGA 1GHCA 4A69C 4PFPA 1MNEA 2O3FA 3HRMA 4ESJA 3LSRA 2Y9YA 5H20A 2RQPA 4KICA 1LEAA 1T95A 4BXFA 3K1NA 3GTPJ 2CFOA 2ZJ2A 2X6XA 2R5ZB 3AG3H 1YFHA 3AL0C 1LEBA 5FD5A 5LEKA 4AU7A 2QZ8A 1FNNA 3CCEI 1NK2P 1IRFA 1IRXA 2IBDA 2JTVA 2Q2EB 1TWCJ 2FNPA 4LD5A 1XS9A 2CYYA 2M8EA 3HRSA 2E1MB 5FJ8J 2XPVA 2ZKZA 2P5VA 1QU3A 2NS7A 3OL3A 1SFXA 3HXLA 5FLVA 2GQQA 3PUFA 4BGDA 3OS0A 4N0BA 3OIPA 2KRFA 2K9NA 2XV4S 2E1MC 3PNVA 5E1WA 4BEHB 2OAZA 1UMQA 2NOGA 2B7EA 2WAEA 3QOEA 2KZVA 1BR4A 1VNDA 4PJMA 2OPTA 1JJ8C 2VXZA 1YX3A 2VXDA 4M6VA 3K9TA 3UKGA 2XDVA 3KYLA 1KQ0A 4N9HA 2F2EA 4XN0A 3H35A 3ASNH 4YG2F 3GUDA 2VE8A 1OISA 2R7RA 4C2TA 2HYGD 3WHCA 3ZN0A 3F72A 5HOOA 2K4BA 2F5DA 1OJLA 4DJAA 4WXCA 3KZYA 4I01A 3PO2J 3ZMVA 2GBYA 1V5EA 3EYIA 3QPSA 3CTAA 3QYBA 4AUXA 1I50J 4I0BA 4B8XA 3F23A 3DV8A 2L9VA 3A0HC 3T1BA 2WC2A 5F0HA 3W2WA 5CVJA 5HDKA 1ETOA 5FKOA 1WJAA 3HHHA 1YJ9I 1YLFA 3SDGA 2BBYA 2CW8A 2YSRA 4BJ5C 1NG6A 1W0UA 3F8NA 4C3HJ 5LRSA 3RQIA 5K5RA 1USTA 1ODDA 1HW1A 3S2WA 3GLXA 2XPWA 4KT5C 2IW5A 1XGMA 1ZLJA 3S14J 2A6HF 1NHAA 4XORA 1BR1A 2W24A 1ZRFA 4IRGA 3LOCA 3MFKA 3V8KA 1ZN2A 4R79A 2VL8A 4BBRJ 3TEDA 1W36D 1G3YA 2YR2A 2ZMEA 2BY3A 1PUEE 2P6SA 1HDPA 5ED4A 4BY1J 2EFOA 5EZGA 4B44A 2HZTA 1CGPA 4AVZA 1J59A 2L2OA 4LIUA 2RN7A 2IA1A 1EH8A 2BGCA 4U7DA 3AKZA 5ILSA 4B4CA 1WJCA 1S7EA 2CUJA 3A2KA 5H2FC 3OYIA 4IOCF 2K85A 1I3QJ 2DPDA 2ETHA 3CC7I 1YG2A 2ZXHA 3WTZA 4WCGA 3I64A 5M5YJ 2DK5A 4B3AA 2BEOA 1TWFJ 3K69A 4BKXA 4A0XA 2QQ9A 5DEQA 2LG4A 2QSHX 2F4OB 2OTJI 3CP8A 4ZYEA 5CVRA 5HDNA 3H5AA 4LK1F 3OYAA 1BR2A 3P9CA 1Z77A 2HQAA 5DM6F 2VN2A 1U8RA 1H88C 3GWZA 1MDMA 1FOWA 1UELB 3K1PA 1D8KA 3DLAA 1MBJA 2MH2A 3OR1C 1MW7A 2K9MA 4C9YA 4HNUA 5HS7A 4R8HA 2VQHA 2VBYA 3E3VA 2FSWA 4ZC3A 2KIFA 3DTIA 3ZR8X 3J81K 3GTOJ 3JAMK 5EZHA 3U21A 5IT9K 2PMHA 5FLXZ 1R1VA 3GZ5A 1RESA 2LVSA 4JX6A 3I59A 2Y0SA 2ZJQF 3ZCOA 2QENA 4E7ZA 1KA8A 3S3MA 1U8BA 3OYFA 5EDNA 1YQAA 3VSLA 2VKVA 5HLHA 2YU9J 3MKLA 3C1DA 2A07F 2YS9A 3OYBA 4S04A 3P9KA 3S8PA 2HR3A 3GCMA 1EF4A 1FSEA 5GADJ 4MEXF 1D1CA 2V6EA 2BE5F 2KHMA 4NB5A 2HQ5A 2DA7A 4BH9A 2QBYA 3LSHA 2LK2A 2X9DA 1MSEC 3CJQB 4BJTA 3IRQA 2YUSA 1H9GA 2Z3YA 3I4PA 3KLNA 1B72B 1ZREA 4B47A 3ASOH 3KZIC 5EEAA 2OZ6A 5EJCA 3EUHA 5IY5H 3LSMA 2WB1N 1GVDA 4I76A 2Q1ZB 4XN3A 3QODA 2R7DA 1WI9A 3D1NI 4MGRA 4WXHA 2QEXI 4E7IA 2JA7J 1YITI 2XB0X 3NEUA 1K83J 2QYOA 5LLQA 4XLEA 4A3GJ 3GFJA 1X3ZB 3WE2A 5F0FA 3S2DJ 3WU1B 3CMMA 3GTQJ 4KDPA 2DA6A 3WG9A 4HF2A 3FK7A 1M1EB 4I99C 3NAUA 1XSDA 3M9AA 3AG4H 5HODA 1G6NA 1YIJI 4O6JA 3OYEA 3FHNA 4UB8C 1LVAA 2CJJA 3JRGA 3HG9A 4XK4A 5EG0A 2VJ4A 4X0GA 4XL9A 5TISC 4MO7A 2R7SA 4CGZA 2F4IA 3KYDB 5E1ZB 3SQNA 1Y8RB 2A69F 4Z2YA 3HOSA 3IWZA 2O03A 3CDIA 2VJIA 3GO5A 4E7KA 4BJ6C 2ZSHB 2CV0A 3CP2A 1OCZH 1QZEA 3G1MA 1IAWA 3S16J 3SYTA 4ZTFA 2IXSA 5IYCJ 1H0MA 1JJ6C 3ZQGA 1GVJA 2ELHA 2CUFA 2DN0A 5ICGA 3TMOA 3RCOA 4F55A 4RDUA 2E2HJ 4BAYA 4V2FA 4CSWA 4XLFA 3DQVC 2QUFA 2XAGA 1VQ7I 4WWCA 5KHDA 4IOAF 4JX4A 2M45A 5JLXA 4D7MA 5C44J 5LEJA 3LSPA 1J5YA 3GYHX 1P4WA 2DOFA 4G9YA 5C4XJ 4CUGA 4QIWN 3X2QH 2W1OA 3IAS2 4CO8A 1FOKA 1J9IA 4Y15A 1IN6A 1E17A 2AHQA 1B9NA 1OYYA 3JRHA 2G7UA 1IXSB 2IVMA 1GT0C 5CPRB 1RR8C 1SVMA 1W7PA 4ENJA 1P7IA 2JA8J 3D5LA 1YRNA 2V6CA 5J4YA 2CQ7A 3FK6A 5LD2C 1TQMA 2FBHA 1WPKA 4XKCA 1U6GA 1FMWA 1W36C 4GYIA 1P92A 4M3BA 4DBQA 3O8GA 4MLOA 1UAAA 2QM3A 1MIJA 5FGMA 2G9WA 3N97A 5DM7F 2R7QA 1D8JA 2GXGA 3ZPLA 2X0LA 2M3AA 3QOPA 4AM3A 3BR1A 2ZJPF 1O3QA 1JT6A 1YI2I 1HKSA 1U5TB 3BG9A 3RPUD 4P9FA 1FSHA 3IKVA 3L00A 5LRRA 1EJ9A 4PCQA 4FT8A 2BYVE 3I55I 3KEQA 3G71I 1T39A 3I71A 3LSIA 2R5YB 4A0YA 4ZYHA 2CW7A 3F8FA 2E1CA 2IT0A 1D5VA 5C3EJ 2DBBA 1MMDA 1QQIA 2HVQA 3VYUB 4XNFA 1GUUA 3SHFA 4PSXA 3TO9A 5LGUA 1B6AA 4RGRA 1KYWA 3DBRB 1LKXA 1F9NA 2NS0A 3I53A 1CF7A 1QA6A 2JRTA 3L1PA 2V1NA 3JW4A 4K2EA 3HL2A 4RBOA 3BZKA 4L18B 1LE8B 1XDUA 4CZCA 3JSPA 4KN4X 3TO6A 5FKLA 4A12A 2E5NA 1T38A 3PQJA 1V4RA 2LC2A 3G1OA 1DU0A 5BPDA 3KZZA 1DGRM 3PSIA 5EGOB 1V5GA 3W6JB 4CCNA 2JA6J 1I1SA 2R7OA 4G6DA 3LSJA 3G1LA 1LFUP 4QLCU 1LB2A 1QPIA 2H09A 1YOVB 2I10A 4CCLA 2ECBA 2O7OA 3BWGA 3TDZC 1O57A 3K1MA 1MZBA 2NVQJ 5LGNA 4E7JA 2MG4A 1Z7UA 4XR6A 1Y1VJ 4CXFA 2RKHA 1X1PA 5FFXA 4CCKA 2W82A 3M1EA 2EIJH 2HKXA 3OSGA 1YW9A 4OIOF 2FMLA 3D5RC 3PJRA 1HKTA 2LYCA 3ABTA 2UZKA 5FKNA 4E7SA 1ZG1A 5D5WB 3FMSA 2NYXA 1VQPI 2LY2A 3V8JA 4HLXA 3H1CA 3UNGC 3PL8A 1FC3A 2VPRA 2X1CA 5BQTA 4Q48A 5GPAA 3QYEA 2PBIA 3KCCA 4BNCA 2GM4A 4WXDA 4E7HA 2D5VA 2ISYA 4G12A 1MGTA 3Q3SA 3OYHA 1DUXC 3CJRB 1WJEA 5CYVA 1WWXA 2NNNA 2R7UA 5HLTA 3QP6A 3F3XA 2X6OA 1Z6RA 2A61A 4BU2A 4L5JA 2IA2A 3I4MJ 3RJPA 1RC9A 3BY6A 1GV2A 1N75A 2ZB9A 4XRSA 4HG2A 3DTEA 4BY7J 2KQRA 4OMYA 5B1AH 4CDGA 2FQ4A 2HQNA 3DCFA 3RSNA 1LDKB 5L3EA 2ADUA 2XF6A 2PEXA 3E5XA 2MGQA 3KP2A 4XONA 3HPGA 1R4NB 3K2ZA 4M6XA 2ZC2A 4Y33A 1E3HA 2FBKA 5DDGA 4I2OA 5DS9A 2EIMH 1JKPC 4BE1A 1KYZA 4C2UA 5DCMA 2NVYJ 2LD5A 1IUFA 3TQNA 2DA2A 1JUSA 4W97A 2R93J 1BJZA 3OOPA 1IG7A 5GAHJ 2YU3A 1PYVA 4ITVA 2XHKA 2OQGA 3BG7A 2GXBA 2OV7A 3HGGA 5GP9A 4XKWA 2KRCA 4CCJA 4EGYA 1APLC 1SVOA
chains in the Genus database with same CATH topology
2L7ZA 2XGEA 2R5ZA 3F0CA 1X2NA 3HM5A 1NK2P 2IBDA 3S15J 1TWCJ 1X2MA 3HOZJ 5E3MA 5EYRA 1XS9A 1GV5A 3JRFA 3TP3A 2HI3A 2EZIA 2WAQN 5FJ8J 2XPVA 1WI3A 2NS7A 1R9TJ 5FLVA 4Y7NJ 3A02A 1SFOJ 4A3BJ 4XIDA 2LY9A 5BNGA 2K9NA 4IHVA 4JP0A 1Q1VA 4S0HB 1UMQA 2CUEA 2NOGA 4A93J 1FIPA 4FCYA 3VPRA 3OIOA 1VNDA 2OPTA 1JJ8C 5GPCA 5IOZA 4M6VA 1IC8A 2XSDC 3UKGA 1AKHB 2HOSA 1IGNA 1TWAJ 2H1KA 3JRIA 3JRDA 2M2EA 2ID3A 3WHCA 2IAIA 1OJLA 3NARA 1BW5A 3PO2J 2XGDA 2GBYA 2LLKA 3QPSA 2XB5A 3BQZA 3DEWA 4AUXA 1I50J 1U78A 1VFCA 1IDZA 2DA5A 1E3OC 3BT9A 3Q0WA 5F0HA 2CRGA 4MFEA 1ETOA 3BTJA 2B63J 1F36A 5FKOA 1HCRA 2GLOA 4QSHA 3SDGA 2M0CA 2DA4A 1W0UA 2LR8A 1ETKA 4C3HJ 3RQIA 2W48A 4D5CA 5IYDJ 2L7MP 4DYRA 2EZKA 2EQRA 1MH4A 2XPWA 2ID6A 2XGCA 3CCYA 3LNQA 2M9HA 1PUFB 4UUTA 3S14J 1I6HJ 2Y0SN 3HKZN 4FE4A 3CMYA 3HOWJ 1QVUA 3LOCA 1H8AC 2MSYA 4BBRJ 3TEDA 1PUFA 5EF6A 1POGA 1HDPA 3QQAA 5E3LA 4BY1J 3RKQA 2K9QA 5EZGA 4FISA 4C3IJ 1BA5A 4M3GA 3S1NJ 1NTCA 2ECCA 4FTHA 5FKKA 4B4CA 1S7EA 3M4OJ 1BL0A 1I3QJ 1UG2A 2R7ZJ 2ME0A 2NVXJ 1G2HA 1NK3P 2PMZN 5M5YJ 2FX0A 3HOUJ 4B3AA 1TWFJ 3JRCA 4BKXA 3B6CA 4A3JJ 1FIAA 1H88C 1Z77A 5J1UA 2TCTA 4ABZA 1IDYA 1ZGWA 1ZKGA 4DYQA 1MBJA 1MBHA 9ANTA 3BG3A 2JN6A 1ENHA 4A3KJ 1RR7A 2HOAA 3BTIA 3GTOJ 5EZHA 4W1UA 3HB9A 1JTXA 2CQXA 2L0KA 1HF0A 1RESA 2LVSA 4JX6A 3BQYA 4DYCA 3Q0VA 4BBSJ 1XG1A 4A3LJ 4DW6A 4DZPA 2M8GX 1ZK8A 1U8BA 2R92J 5EDNA 1ZQ3P 4X1EA 2K40A 2VKVA 2YU9J 2CQQA 3MKLA 2R0QC 2YS9A 3H3VK 2COBA 2Y30A 4L5EA 1EF4A 3BR0A 3JR9A 4A3MJ 5F1JA 2AO9A 5F08A 1ETWA 2HOTA 1RETA 2HQ5A 2DA7A 2LK2A 2X9DA 1MSEC 2DA3A 2YUSA 2RAEA 1B72B 4A3EJ 3MVPA 5EEAA 5IYBJ 3FISA 2OF7A 3HGYA 3B6AA 5J1YA 3GTMJ 1MBKA 1B72A 2WB1N 1GVDA 4I76A 3OOUA 3FIWA 3D1NI 2FD5A 1FJLA 3PM1A 2JA7J 1ORKA 2XB0X 3HDDA 4A3FJ 2KDZA 2LFBA 2XPUA 1K83J 1IJWC 1JKOC 2XRLA 4A3GJ 5FKMA 5M5XJ 2M34A 5F0FA 3S2DJ 5J3LA 3GTQJ 2DA6A 5EGOA 3FK7A 3JREA 1UHSA 1ETQA 5JLWA 5EG0B 1O4XA 2NS8A 3NAUA 5IP6A 3E7LA 4BXXJ 5HODA 3LSGA 2CJJA 3ZOBA 5FLMJ 4XK4A 5EG0A 3JRGA 1BW6A 2DMUA 4HNVA 2VUMJ 3CQZJ 4MO7A 1HLVA 3BR6A 4QTRA 2E2IJ 2JK3A 2DJNA 3FKIJ 2O8KA 2P81A 2JMWA 5DTDA 4X6AJ 1CQTA 3G1MA 3S16J 3JRAA 1JJ6C 4MIMA 5IYCJ 1RPWA 3SJMA 2TRTA 3K2AA 3ZQGA 1A5JA 1VF9A 2ME6A 1D5YA 2CUFA 1P7JA 2DN0A 1IRZA 3ZQLA 1ETXA 1T33A 2DMTA 4MFDA 2EZHA 3BG5A 4RDUA 3WHBA 2E2HJ 3A01B 5IP7J 4V2FA 1JT0A 2K9SA 3OSFA 1W0TA 3GTJJ 1A6IA 2HYJA 1WCMJ 4JX4A 5JLXA 4IHYA 3A01A 4GFBA 4D7MA 4UUSB 5K7FA 5C44J 4Y52J 3RZDJ 3LSPA 3ZQCA 5C4XJ 2EBIA 1HOMA 2FJ1A 4QIWN 4UUSA 4M3FA 2HXOA 1YRNB 4M3EA 3IH2A 2AHQA 3GTGJ 2KT0A 3JRHA 4XRMA 1GT0C 2G0EA 3MN2A 1P7IA 2JA8J 4IHWA 1YRNA 5IOYA 1HDDC 3FK6A 1WPKA 4CYCB 3PO3J 5IPAA 3CDLA 4D5FA 4M3BA 3HOXJ 1TWHJ 3O8GA 4MLOA 3I4NJ 4EEFG 2LTPA 4NDLA 2NVTJ 3GTKJ 3BR1A 1MBFA 1JT6A 1MBEA 1ZTRA 5F0CA 1JGGA 3BG9A 3QPLA 1JKRC 1ETVA 3HOYJ 1LFBA 3HEFA 3BR3A 3ZQIA 4AYBN 4CYCA 3S1RJ 2R5YB 4AC0A 3Q0UA 1DU6A 5K7ZA 5C3EJ 1GUUA 1TC3C 1FEXA 4V2GA 1JUMA 1TWGJ 2R5YA 3BR5A 4JYKA 3SFIA 1H89C 3L1PA 4LOCA 1JKQC 2DMQA 3A03A 4FE7A 1WGXA 4IHXA 4RBOA 1OCPA 3IV5A 1LE8B 2ELKA 2VKEA 3TW7A 2O9LA 5IP9J 1U9NA 1IV6A 1MSFC 5E3OA 3GBGA 3H0GJ 3O8HA 5FKLA 1U9OA 3HBLA 3G1OA 1DU0A 1ZR4A 1LE8A 3TP0A 1MH3A 2QCOA 5EGOB 4I6ZA 3S1QJ 3BR2A 1AKHA 1QRYA 2JA6J 5E3NA 3LSJA 3G1LA 1LFUP 1F43A 1B8IB 5M5WJ 1FTTA 4J19A 1QPIA 3JRBA 4A3IJ 2EH3A 4A3DJ 3C2BA 2Y31A 2LP0A 1ZR2A 3IH4A 2I10A 2ECBA 2O7OA 2NVQJ 1B8IA 2MG4A 1T56A 2X48A 1ITYA 2JA5J 1Y1VJ 5K7HA 1OFCX 1MNMC 2QF7A 4A3CJ 3M3YJ 1ETYA 3TW6A 3OSGA 2DA1A 1Z0XA 4DZJA 2L7FP 5FKNA 2JWTA 1AU7A 1VI0A 3RZOJ 2DTZA 1K61A 4C3JJ 3S17J 3S2HJ 2VPRA 5M3FJ 5GPAA 2H8RA 2N8GA 3ZQFA 1SANA 5F04A 1OCTC 3K7AJ 2GM4A 2D5VA 2LKXA 2DMNA 2E1OA 4G12A 1X58A 3IH3A 3Q3SA 2WV1A 4M3DA 1WH7A 1GDTA 4B1RA 2Y2ZA 4XICA 1AHDP 1XC5A 2X6OA 2JJ7A 3I4MJ 2Y9ZA 2L9RA 4IEJA 4JX5A 4XRSG 5F27A 5C4JJ 1GV2A 2ZB9A 4XRSA 2E2JJ 1FTZA 1WH5A 4BY7J 3GTLJ 2CU7A 2FQ4A 3DCFA 3W6VA 1JUPA 2IEKA 4C2MJ 3BTCA 2MGQA 2E19A 1MBGA 4A69C 5J1RA 2EZLA 3HOVJ 3LSRA 2Y9YA 2DMPA 1JTYA 3BTLA 3ZQHA 5DS9A 1RKTA 1Y1WJ 1JKPC 2NVYJ 2LD5A 1IUFA 2HDDA 1RKWA 2DA2A 3GTPJ 2MW8A 5M3MJ 1JUSA 4W97A 2VI6A 2R93J 1BJZA 1IG7A 2R5ZB 3S1MJ 1QVTA 3HGGA 1APLC 5GP9A 2HXIA 4D7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7Z A;  2XGE A;  2R5Z A;  3F0C A;  1X2N A;  3HM5 A;  1NK2 P;  2IBD A;  3S15 J;  1TWC J;  1X2M A;  3HOZ J;  5E3M A;  5EYR A;  1XS9 A;  1GV5 A;  3JRF A;  3TP3 A;  2HI3 A;  2EZI A;  2WAQ N;  5FJ8 J;  2XPV A;  1WI3 A;  2NS7 A;  1R9T J;  5FLV A;  4Y7N J;  3A02 A;  1SFO J;  4A3B J;  4XID A;  2LY9 A;  5BNG A;  2K9N A;  4IHV A;  4JP0 A;  1Q1V A;  4S0H B;  1UMQ A;  2CUE A;  2NOG A;  4A93 J;  1FIP A;  4FCY A;  3VPR A;  3OIO A;  1VND A;  2OPT A;  1JJ8 C;  5GPC A;  5IOZ A;  4M6V A;  1IC8 A;  2XSD C;  3UKG A;  1AKH B;  2HOS A;  1IGN A;  1TWA J;  2H1K A;  3JRI A;  3JRD A;  2M2E A;  2ID3 A;  3WHC A;  2IAI A;  1OJL A;  3NAR A;  1BW5 A;  3PO2 J;  2XGD A;  2GBY A;  2LLK A;  3QPS A;  2XB5 A;  3BQZ A;  3DEW A;  4AUX A;  1I50 J;  1U78 A;  1VFC A;  1IDZ A;  2DA5 A;  1E3O C;  3BT9 A;  3Q0W A;  5F0H A;  2CRG A;  4MFE A;  1ETO A;  3BTJ A;  2B63 J;  1F36 A;  5FKO A;  1HCR A;  2GLO A;  4QSH A;  3SDG A;  2M0C A;  2DA4 A;  1W0U A;  2LR8 A;  1ETK A;  4C3H J;  3RQI A;  2W48 A;  4D5C A;  5IYD J;  2L7M P;  4DYR A;  2EZK A;  2EQR A;  1MH4 A;  2XPW A;  2ID6 A;  2XGC A;  3CCY A;  3LNQ A;  2M9H A;  1PUF B;  4UUT A;  3S14 J;  1I6H J;  2Y0S N;  3HKZ N;  4FE4 A;  3CMY A;  3HOW J;  1QVU A;  3LOC A;  1H8A C;  2MSY A;  4BBR J;  3TED A;  1PUF A;  5EF6 A;  1POG A;  1HDP A;  3QQA A;  5E3L A;  4BY1 J;  3RKQ A;  2K9Q A;  5EZG A;  4FIS A;  4C3I J;  1BA5 A;  4M3G A;  3S1N J;  1NTC A;  2ECC A;  4FTH A;  5FKK A;  4B4C A;  1S7E A;  3M4O J;  1BL0 A;  1I3Q J;  1UG2 A;  2R7Z J;  2ME0 A;  2NVX J;  1G2H A;  1NK3 P;  2PMZ N;  5M5Y J;  2FX0 A;  3HOU J;  4B3A A;  1TWF J;  3JRC A;  4BKX A;  3B6C A;  4A3J J;  1FIA A;  1H88 C;  1Z77 A;  5J1U A;  2TCT A;  4ABZ A;  1IDY A;  1ZGW A;  1ZKG A;  4DYQ A;  1MBJ A;  1MBH A;  9ANT A;  3BG3 A;  2JN6 A;  1ENH A;  4A3K J;  1RR7 A;  2HOA A;  3BTI A;  3GTO J;  5EZH A;  4W1U A;  3HB9 A;  1JTX A;  2CQX A;  2L0K A;  1HF0 A;  1RES A;  2LVS A;  4JX6 A;  3BQY A;  4DYC A;  3Q0V A;  4BBS J;  1XG1 A;  4A3L J;  4DW6 A;  4DZP A;  2M8G X;  1ZK8 A;  1U8B A;  2R92 J;  5EDN A;  1ZQ3 P;  4X1E A;  2K40 A;  2VKV A;  2YU9 J;  2CQQ A;  3MKL A;  2R0Q C;  2YS9 A;  3H3V K;  2COB A;  2Y30 A;  4L5E A;  1EF4 A;  3BR0 A;  3JR9 A;  4A3M J;  5F1J A;  2AO9 A;  5F08 A;  1ETW A;  2HOT A;  1RET A;  2HQ5 A;  2DA7 A;  2LK2 A;  2X9D A;  1MSE C;  2DA3 A;  2YUS A;  2RAE A;  1B72 B;  4A3E J;  3MVP A;  5EEA A;  5IYB J;  3FIS A;  2OF7 A;  3HGY A;  3B6A A;  5J1Y A;  3GTM J;  1MBK A;  1B72 A;  2WB1 N;  1GVD A;  4I76 A;  3OOU A;  3FIW A;  3D1N I;  2FD5 A;  1FJL A;  3PM1 A;  2JA7 J;  1ORK A;  2XB0 X;  3HDD A;  4A3F J;  2KDZ A;  2LFB A;  2XPU A;  1K83 J;  1IJW C;  1JKO C;  2XRL A;  4A3G J;  5FKM A;  5M5X J;  2M34 A;  5F0F A;  3S2D J;  5J3L A;  3GTQ J;  2DA6 A;  5EGO A;  3FK7 A;  3JRE A;  1UHS A;  1ETQ A;  5JLW A;  5EG0 B;  1O4X A;  2NS8 A;  3NAU A;  5IP6 A;  3E7L A;  4BXX J;  5HOD A;  3LSG A;  2CJJ A;  3ZOB A;  5FLM J;  4XK4 A;  5EG0 A;  3JRG A;  1BW6 A;  2DMU A;  4HNV A;  2VUM J;  3CQZ J;  4MO7 A;  1HLV A;  3BR6 A;  4QTR A;  2E2I J;  2JK3 A;  2DJN A;  3FKI J;  2O8K A;  2P81 A;  2JMW A;  5DTD A;  4X6A J;  1CQT A;  3G1M A;  3S16 J;  3JRA A;  1JJ6 C;  4MIM A;  5IYC J;  1RPW A;  3SJM A;  2TRT A;  3K2A A;  3ZQG A;  1A5J A;  1VF9 A;  2ME6 A;  1D5Y A;  2CUF A;  1P7J A;  2DN0 A;  1IRZ A;  3ZQL A;  1ETX A;  1T33 A;  2DMT A;  4MFD A;  2EZH A;  3BG5 A;  4RDU A;  3WHB A;  2E2H J;  3A01 B;  5IP7 J;  4V2F A;  1JT0 A;  2K9S A;  3OSF A;  1W0T A;  3GTJ J;  1A6I A;  2HYJ A;  1WCM J;  4JX4 A;  5JLX A;  4IHY A;  3A01 A;  4GFB A;  4D7M A;  4UUS B;  5K7F A;  5C44 J;  4Y52 J;  3RZD J;  3LSP A;  3ZQC A;  5C4X J;  2EBI A;  1HOM A;  2FJ1 A;  4QIW N;  4UUS A;  4M3F A;  2HXO A;  1YRN B;  4M3E A;  3IH2 A;  2AHQ A;  3GTG J;  2KT0 A;  3JRH A;  4XRM A;  1GT0 C;  2G0E A;  3MN2 A;  1P7I A;  2JA8 J;  4IHW A;  1YRN A;  5IOY A;  1HDD C;  3FK6 A;  1WPK A;  4CYC B;  3PO3 J;  5IPA A;  3CDL A;  4D5F A;  4M3B A;  3HOX J;  1TWH J;  3O8G A;  4MLO A;  3I4N J;  4EEF G;  2LTP A;  4NDL A;  2NVT J;  3GTK J;  3BR1 A;  1MBF A;  1JT6 A;  1MBE A;  1ZTR A;  5F0C A;  1JGG A;  3BG9 A;  3QPL A;  1JKR C;  1ETV A;  3HOY J;  1LFB A;  3HEF A;  3BR3 A;  3ZQI A;  4AYB N;  4CYC A;  3S1R J;  2R5Y B;  4AC0 A;  3Q0U A;  1DU6 A;  5K7Z A;  5C3E J;  1GUU A;  1TC3 C;  1FEX A;  4V2G A;  1JUM A;  1TWG J;  2R5Y A;  3BR5 A;  4JYK A;  3SFI A;  1H89 C;  3L1P A;  4LOC A;  1JKQ C;  2DMQ A;  3A03 A;  4FE7 A;  1WGX A;  4IHX A;  4RBO A;  1OCP A;  3IV5 A;  1LE8 B;  2ELK A;  2VKE A;  3TW7 A;  2O9L A;  5IP9 J;  1U9N A;  1IV6 A;  1MSF C;  5E3O A;  3GBG A;  3H0G J;  3O8H A;  5FKL A;  1U9O A;  3HBL A;  3G1O A;  1DU0 A;  1ZR4 A;  1LE8 A;  3TP0 A;  1MH3 A;  2QCO A;  5EGO B;  4I6Z A;  3S1Q J;  3BR2 A;  1AKH A;  1QRY A;  2JA6 J;  5E3N A;  3LSJ A;  3G1L A;  1LFU P;  1F43 A;  1B8I B;  5M5W J;  1FTT A;  4J19 A;  1QPI A;  3JRB A;  4A3I J;  2EH3 A;  4A3D J;  3C2B A;  2Y31 A;  2LP0 A;  1ZR2 A;  3IH4 A;  2I10 A;  2ECB A;  2O7O A;  2NVQ J;  1B8I A;  2MG4 A;  1T56 A;  2X48 A;  1ITY A;  2JA5 J;  1Y1V J;  5K7H A;  1OFC X;  1MNM C;  2QF7 A;  4A3C J;  3M3Y J;  1ETY A;  3TW6 A;  3OSG A;  2DA1 A;  1Z0X A;  4DZJ A;  2L7F P;  5FKN A;  2JWT A;  1AU7 A;  1VI0 A;  3RZO J;  2DTZ A;  1K61 A;  4C3J J;  3S17 J;  3S2H J;  2VPR A;  5M3F J;  5GPA A;  2H8R A;  2N8G A;  3ZQF A;  1SAN A;  5F04 A;  1OCT C;  3K7A J;  2GM4 A;  2D5V A;  2LKX A;  2DMN A;  2E1O A;  4G12 A;  1X58 A;  3IH3 A;  3Q3S A;  2WV1 A;  4M3D A;  1WH7 A;  1GDT A;  4B1R A;  2Y2Z A;  4XIC A;  1AHD P;  1XC5 A;  2X6O A;  2JJ7 A;  3I4M J;  2Y9Z A;  2L9R A;  4IEJ A;  4JX5 A;  4XRS G;  5F27 A;  5C4J J;  1GV2 A;  2ZB9 A;  4XRS A;  2E2J J;  1FTZ A;  1WH5 A;  4BY7 J;  3GTL J;  2CU7 A;  2FQ4 A;  3DCF A;  3W6V A;  1JUP A;  2IEK A;  4C2M J;  3BTC A;  2MGQ A;  2E19 A;  1MBG A;  4A69 C;  5J1R A;  2EZL A;  3HOV J;  3LSR A;  2Y9Y A;  2DMP A;  1JTY A;  3BTL A;  3ZQH A;  5DS9 A;  1RKT A;  1Y1W J;  1JKP C;  2NVY J;  2LD5 A;  1IUF A;  2HDD A;  1RKW A;  2DA2 A;  3GTP J;  2MW8 A;  5M3M J;  1JUS A;  4W97 A;  2VI6 A;  2R93 J;  1BJZ A;  1IG7 A;  2R5Z B;  3S1M J;  1QVT A;  3HGG A;  1APL C;  5GP9 A;  2HXI A;  4D7N A; 
#chains in the Genus database with same CATH topology
 2HPI A;  2XGE A;  3CD6 I;  3F0C A;  1X2N A;  1HSJ A;  3HJE A;  5ICF A;  2JUG A;  5ILU A;  5E3M A;  4F91 B;  3JTG A;  1HC8 A;  2Z99 A;  3TP3 A;  2EZI A;  4AWX B;  2EJR A;  1SMY F;  5D8K B;  4RB1 A;  4IVN A;  1R9T J;  1YW7 A;  3AG1 H;  4Y7N J;  3A02 A;  3I5U A;  2P7V B;  4A3B J;  3FWE A;  1J0R A;  2LY9 A;  4XID A;  4RM3 A;  1Z7L A;  2CUE A;  1G8X A;  2Z16 A;  3K4L A;  1FIP A;  3ZQQ A;  2PG4 A;  3CO6 C;  3OIO A;  3FBN B;  2ACJ A;  4E4H A;  4F7Z A;  5AIP A;  1X4P A;  1XGO A;  2R3S A;  1FYL A;  3PNY A;  1IC8 A;  1AKH B;  2HOS A;  2M4G A;  3TDU C;  5J4V A;  3CF2 A;  1VQ8 I;  1R23 A;  1V5F A;  1K78 A;  2H1K A;  3TO7 A;  4HBL A;  3JRI A;  2K86 A;  2M0M A;  2M2E A;  4XQF A;  2ID3 A;  2K4J A;  3D5S C;  1E3P A;  6PAX A;  4IZZ A;  2EB7 A;  2EA4 A;  1BW5 A;  1DPU A;  2W00 A;  2E7X A;  3E97 A;  4HSR A;  4M6Y A;  3REO A;  1ZHF A;  2WY7 Q;  2HKO A;  1TT5 B;  2XB5 A;  3BQZ A;  2IS2 A;  2CMP A;  1U78 A;  2WTE A;  1S5L C;  3CCR I;  4YFX F;  4U7B A;  2IJL A;  4R1H A;  3GZ6 A;  2JRM A;  4MHG A;  2B63 J;  3OYL A;  4ENN A;  4XSZ F;  4QSH A;  3DPT A;  2DA4 A;  3VDX A;  1D0Y A;  1ETK A;  1R22 A;  2K5C A;  2KPM A;  3NWS A;  2H6C A;  4RB2 C;  4D5C A;  3TKY A;  3L2Q A;  2IGO A;  2VQC A;  2YX4 A;  3KE2 A;  5DCF A;  4A0Z A;  4P9U A;  1K79 A;  2EZK A;  1FMV A;  4HX7 A;  5E20 A;  1U2W A;  2EQR A;  1R36 A;  2D1V A;  2PMU A;  2XGC A;  3BJA A;  3CCY A;  1MND A;  2ZME B;  4UUT A;  1FT9 A;  3E1S A;  4UB6 C;  4BDZ A;  2Y0S N;  2DO7 A;  3DU6 A;  3HOW J;  1W5C C;  4MQ9 F;  1XGN A;  1PUF A;  3PFI A;  3WTW C;  3GX4 X;  3CUQ A;  2HTJ A;  3PQK A;  2BVM A;  4BE2 A;  3NQO A;  4A2U A;  3RKQ A;  1LDD A;  3H9J A;  4FIS A;  1R71 A;  4Y17 A;  5B66 C;  4E6K G;  1RNL A;  4EJV A;  4HX8 A;  4KIT B;  5E17 F;  2VON A;  4U88 A;  3T8T A;  3CES A;  3KP6 A;  3M7G A;  2KP6 A;  1YIO A;  2ME0 A;  3MZH A;  3C7J A;  1O3T A;  1G2H A;  1BI0 A;  3GFI A;  2WA0 A;  1NK3 P;  2FX0 A;  3FX3 A;  1ZEL A;  3JRC A;  2RDP A;  3HRT A;  1MDM B;  4YFK F;  4IX7 A;  5E79 C;  5J1U A;  3HUG A;  1LJ9 A;  3VOE A;  1PP8 F;  1MJB A;  2EV5 A;  2XAJ A;  4HAM A;  2VPL A;  1MBH A;  3QYF A;  2K7L A;  3AFH A;  9ANT A;  3VOD A;  2JZY A;  1ZAO A;  5A2Q Z;  2JN6 A;  4A3K J;  2RNG A;  1D3Y A;  2GWR A;  4JOM A;  4LLN A;  2FF4 A;  2L0K A;  1IN4 A;  2GZW A;  2KZG A;  4OIN F;  5JHF A;  3C2H A;  1BIB A;  3BQY A;  3HKZ A;  4KA4 A;  3ECH A;  4CIC A;  3Q0V A;  4BBS J;  3R60 A;  2MLG A;  3CLQ A;  2OU2 A;  2LMD A;  4DZP A;  2M8G X;  3TGN A;  3W2V A;  2BZT A;  2CQK A;  1XMA A;  2R92 J;  1ZQ3 P;  5D8L B;  2K40 A;  3ERE D;  1RIO H;  2CQQ A;  1TQI A;  3H3V K;  2COB A;  2E34 A;  1J2X A;  1S29 A;  4L9T A;  4AIH A;  2QBY B;  4A3M J;  5AON A;  3GZN B;  2O8X A;  5F08 A;  2NVU B;  1RUO A;  2O61 A;  4XLN F;  1GXP A;  2HOT A;  2O0Y A;  4B3X A;  3J80 K;  2J5O A;  3K4N A;  1XD7 A;  4NC7 A;  1IZ1 A;  5D5U B;  3FM5 A;  1I5Z A;  3N05 A;  4A3E J;  1A36 A;  4PSW A;  3CC4 I;  4EM2 A;  3FIS A;  5J47 A;  3WTS C;  1VQ9 I;  2KKO A;  2IGK A;  1RUN A;  1A31 A;  2QWW A;  2VBX A;  3MD2 A;  3OOU A;  4BHB A;  3KP7 A;  1BI1 A;  5IT3 A;  4A5N A;  1UG0 A;  3PM1 A;  3OV8 A;  1ORK A;  1AOY A;  2ZFW A;  3HC7 A;  3TOA A;  5DV5 A;  2OD5 A;  2KDZ A;  3H92 A;  4EM1 A;  3ZMZ A;  4EGZ A;  3E6C C;  3M8E A;  1OYW A;  2GIV A;  2K02 A;  3GME A;  2LBF A;  3H5N A;  3Q5F A;  2XRL A;  1TP4 A;  2L54 A;  2EA2 A;  3BC8 A;  4L9V A;  1MMA A;  4WF2 A;  1Z21 A;  2QA4 I;  5JLW A;  1FP2 A;  3KP4 A;  3ONQ A;  2NS8 A;  5EG0 B;  2BVL A;  4BXX J;  2P8T A;  4LB6 B;  3LSG A;  1E0E A;  1Z6T A;  4EJW A;  4BQA A;  1P4X A;  1J09 A;  3ZOB A;  5JVT A;  1R1T A;  1BW6 A;  2VIX A;  5HS8 A;  2VUM J;  3TL4 X;  3KPH A;  5DD8 A;  3I56 I;  1T08 B;  1FYK A;  1T0F C;  4QTR A;  3GVA A;  3E6B A;  4B09 A;  3FKI J;  2O8K A;  4UHT A;  4YIF A;  1GLN A;  2JMW A;  4DOZ A;  3OR2 C;  1S6L A;  1CQT A;  4H4K C;  3JRA A;  3K10 A;  3FBI B;  4S05 A;  1A5J A;  3DEU A;  1D5Y A;  4OIQ F;  5D6E A;  1HW5 A;  3ZQL A;  1T33 A;  2DMT A;  3O2P E;  4AIK A;  1BBY A;  3CCL I;  2Z1D A;  1VQ6 I;  2M87 A;  4BQQ A;  5IP7 J;  2ZJR F;  4UV9 A;  2FU4 A;  3OWT A;  2A6E F;  3A01 A;  3CC2 I;  3FXK A;  4XLH A;  1ZYR F;  1YO5 C;  3EYY A;  3RKY A;  2PQ8 A;  2EBI A;  1HOM A;  2FJ1 A;  1BI3 A;  1W7P B;  3I0T A;  1IO2 A;  2HXO A;  4LLG F;  1YRN B;  1LQ1 A;  2UXX A;  4J01 A;  4M3E A;  3IH2 A;  3I54 A;  2JSP A;  2DFI A;  1Z9C A;  1N77 A;  5CKT A;  5LGT A;  4F93 B;  1Z3X A;  2KRH A;  3MN2 A;  2W7N A;  4XRF A;  3E0J B;  1NG7 A;  1HDD C;  3A0B C;  4D1Q A;  3LFK A;  3WE3 A;  4G7H F;  5IPA A;  4D5F A;  2YPR A;  2HQR A;  1ULY A;  1VQ5 I;  4EM0 B;  3OS1 A;  3FXU A;  3HOX J;  3EUK L;  5FFZ A;  3EUA A;  2FUG 2;  4HF0 A;  4AIJ A;  4EEF G;  2LTP A;  4ZYA A;  2NVT J;  4WX9 A;  4HEA 2;  3NRV A;  4RGS A;  3GTK J;  4M9X A;  1ZTR A;  1E2X A;  3QPL A;  3R61 A;  3OS2 A;  2R7X A;  3HOY J;  5LFA A;  1FY7 A;  1MD0 A;  2FMY A;  3BZC A;  4EJT A;  1Y0U A;  4AC0 A;  4XOP A;  1DU6 A;  2BY0 A;  1TC3 C;  2NNY A;  1FEX A;  1TQP A;  2ZXJ A;  2DFH A;  2DQL A;  4YII A;  1VQ4 I;  2XVC A;  5ERI A;  3OYM A;  3O3K A;  4ZH4 F;  4LOC A;  1JKQ C;  2H1L A;  1BI2 A;  1WGX A;  2L7K A;  4IHX A;  5LBQ A;  2V1X A;  1OCP A;  2CSO A;  4BQN A;  1WJD A;  2ELK A;  2EIN H;  1IV6 A;  3H0G J;  1A35 A;  3WU2 C;  2OBP A;  3FHZ A;  5ICE A;  4YIR X;  1Y56 A;  3T5X A;  4Q47 A;  1ZR4 A;  2LF7 A;  3FZV A;  1N25 A;  4RAZ A;  3H3Z A;  2OC6 A;  3BR2 A;  1OQY A;  3L9F A;  3QPT A;  3EPZ A;  4YEL A;  3COA C;  3CJN A;  2CW0 F;  3RKW A;  1OR7 C;  3JRB A;  2DFE A;  2JVH A;  3C2B A;  1ZR2 A;  2LP0 A;  1K4T A;  2COM A;  4HZF A;  1QO0 D;  1FOY A;  2F4M B;  1XSV A;  3KEY A;  1B8I A;  1T56 A;  2ZSI B;  2JA5 J;  1OFC X;  4ANJ A;  2DT6 A;  3M3Y J;  5TJJ A;  1TZL A;  2C6Y A;  4I02 A;  3TW6 A;  2MH9 A;  2K27 A;  2O6G E;  1Z0X A;  4FX4 A;  3KP5 A;  4LGW A;  4HV6 A;  5E8G A;  2GOM A;  2MD5 A;  5ILV A;  2VJ5 A;  1AU7 A;  2JUC A;  1P9Q C;  1VI0 A;  3RZO J;  1HBX G;  4MQV A;  2RC4 A;  2PLY A;  1XMK A;  3W2A A;  2DTZ A;  2HS5 A;  1FBQ A;  1K61 A;  3S17 J;  2DU9 A;  4PFO A;  3S2H J;  2XKP A;  2RRE A;  5M3F J;  3SZP A;  1DGW Y;  4RB0 A;  2N8G A;  2XAH A;  3ZQF A;  1SAN A;  1K4S A;  2E1O A;  1X58 A;  3IH3 A;  3LA2 A;  1OCC H;  2KDO A;  2LRE A;  1GDT A;  2L9N A;  4HF1 A;  2Y2Z A;  3DPU A;  1XC5 A;  4HYE A;  4G7O F;  1VQM I;  2GA1 A;  3VFZ A;  1FPQ A;  2VOD A;  2IS6 A;  3ZN1 A;  4BDY A;  3HOT A;  4JX5 A;  5CLS A;  5K5O A;  1DPR A;  5C4J J;  3TBI A;  1Z1D A;  2P5L C;  4XLC A;  4IRI A;  3MKY B;  1L3L A;  2A5W A;  4MNU A;  1R4M B;  1J7K A;  3BZ6 A;  1WH5 A;  2FOK A;  3VYS B;  2ESN A;  3DPL C;  2CU7 A;  1JUP A;  4C2M J;  3BTC A;  3K4K A;  2IA0 A;  2NAZ A;  5DCM B;  2CUZ A;  5B3S H;  2KJB A;  2EZL A;  1WRJ A;  2GAU A;  3CLO A;  2DMP A;  1JTY A;  1QZZ A;  3BTL A;  1RKT A;  4G7Z F;  2HDD A;  1RKW A;  3IP4 B;  2EWN A;  4L9N A;  4GYG A;  2QLZ A;  1VQL I;  4HDV A;  1B4A A;  2VI6 A;  4I09 A;  1QBJ A;  4LG0 B;  1NH3 A;  2QGU A;  2KMU A;  3F6V A;  2MYS A;  2IGM A;  2ZXW H;  2FOW A;  2LY1 A;  3DF8 A;  1QVT A;  3S1M J;  3ABL H;  1LNW A;  4CYC B;  3K0L A;  4D7N A;  5JR3 A;  1JE8 A;  3V7C A;  2KJC A;  2L7Z A;  2HVR A;  4ZJZ A;  2BY1 A;  4Z6Y A;  3S15 J;  4KNY A;  1X2M A;  3HOZ J;  1GV5 A;  2MFZ A;  3JRF A;  1U5T C;  2FE3 A;  3LMM A;  2PJR A;  1XDS A;  2HI3 A;  4O5V A;  5FRN A;  1WI3 A;  1DQU A;  4I98 B;  1VTN C;  1X1D A;  2VOP A;  2E35 A;  2KIQ A;  2UV1 A;  1O7L A;  4CCM A;  3T8R A;  3OYD A;  5FD6 A;  1XSX A;  5HVQ C;  1TNS A;  2XSJ C;  1Q1V A;  4S0H B;  1EA3 A;  2DCE A;  4Q4Z F;  3GEZ A;  3VPR A;  4XKV A;  1R5G A;  3A1Y A;  1FLI A;  3RIR A;  1K78 B;  3LQR A;  2JPB A;  2HEO A;  3V7R A;  1QGP A;  2P6T A;  2XSD C;  4EJU A;  3QU6 A;  1IGN A;  2LNB A;  1TWA J;  3N4M A;  1R5I D;  3CZ6 A;  1R5H A;  3JRD A;  2FBI A;  2FNA A;  4G6T B;  2F5C A;  1P4A A;  4HOB A;  4AID A;  1HST A;  2R7F A;  2XGD A;  4ESB A;  4D9J A;  3I9V 2;  3OYG A;  3UR3 C;  4RGX A;  1IW7 F;  2Z9O A;  1B59 A;  2X1E A;  2DA5 A;  1E3O C;  1G59 A;  5D4R A;  3WTX C;  1S9H A;  4LMY A;  4N4O B;  3Q0W A;  3G3Z A;  3OIQ A;  2KL4 A;  1X1B A;  2CRG A;  4MFE A;  3BTJ A;  3H3U A;  3L2C A;  1F36 A;  1HKQ A;  1HCR A;  4OU0 A;  4B48 A;  1ONV A;  2M0C A;  3LFU A;  2Y75 A;  2FEZ A;  1X3U A;  1JHF A;  2W48 A;  3ECO A;  1O7F A;  4ON0 A;  3CCJ I;  2WAQ A;  5IYD J;  2HU9 A;  3U2R A;  2I8D A;  4UNO A;  3EDP A;  5DUK A;  1MH4 A;  2YX7 A;  4O3M A;  2A3S A;  1ZG5 A;  1SD7 A;  2ID6 A;  1W4M A;  3CCS I;  2M9H A;  3WTU C;  1Z67 A;  1PUF B;  3FXQ A;  1I6H J;  2E60 A;  3HKZ N;  3CMY A;  1QVU A;  2K3F A;  1POG A;  2W4S A;  2AQF A;  3QQA A;  2PJP A;  4J00 A;  4FX0 A;  3IUO A;  3J81 Z;  2K9Q A;  2Z2S B;  5FO5 A;  4C3I J;  1OLT A;  5IT9 Z;  1R7J A;  4MTE A;  3ROU A;  1P6R A;  1NTC A;  2ZBK A;  3HZJ A;  4FTH A;  5FKK A;  3IL2 A;  3C3W A;  3ELK A;  2E5Z A;  2DFF A;  1BL0 A;  1UG2 A;  5GTH C;  2XIG A;  1O3S A;  4RLF A;  3SZG A;  2NVX J;  2ZNZ A;  5AIQ A;  1QZY A;  3HOU J;  1P2F A;  3ERM A;  5K5Q A;  3MEX A;  2V79 A;  2M4K A;  1XMX A;  1K7A A;  1O3R A;  3B6C A;  3HUG B;  4A3J J;  1LPQ A;  2GXA A;  3QU3 A;  2IS4 A;  1STZ A;  3FMR A;  1FIA A;  5KAF C;  1VQK I;  2FRH A;  1IDY A;  4BHC A;  3CF5 F;  5E1X A;  5CJ9 A;  3DP7 A;  1LVK A;  3LA7 A;  2NRA C;  1S7A A;  3BG3 A;  4M9S A;  3VB2 A;  3F9K A;  3ZMD A;  4DBR A;  1ENH A;  5GAG J;  3GF2 A;  5CQG A;  4IXA A;  2DYR H;  2AS5 F;  4G6Q A;  2DXI A;  1DDN A;  1I6X A;  2CQX A;  1HF0 A;  1I3A A;  3EET A;  4V19 K;  5CVI A;  4DYC A;  1W5T A;  3MZY A;  4WK8 F;  2JQ7 A;  4YEJ A;  1XG1 A;  2BW3 A;  4DW6 A;  5EEG A;  1WZ2 A;  3PNT A;  1UHW A;  3ABK H;  1FWZ A;  1X19 A;  3PIO F;  2BHY A;  4X1E A;  3H0D A;  1Y39 A;  3OL4 A;  3D0S A;  1EKE A;  3CCU I;  5DD4 A;  5JVG F;  4L5E A;  3F8M A;  2L9S A;  2D2W A;  3BR0 A;  4KT6 A;  2VOO A;  1WHU A;  2DT7 B;  2WBM A;  3ML6 A;  4N4N B;  4PUS A;  1KGS A;  2HYF A;  4KIF A;  3G6E I;  1R6R A;  1YW8 A;  1V54 H;  5F1J A;  2AO9 A;  1ETW A;  3FKJ A;  4KYW A;  3OYK A;  3LL7 A;  1RET A;  4B43 A;  4CH7 A;  3CCM I;  1Y8Q B;  2PMZ A;  3TOB A;  3PUB A;  4LG3 A;  1S3J A;  2RAE A;  2Z5U A;  2M7B A;  3K6G A;  3HRU A;  2EPF A;  2DTR A;  4M9Z A;  3IRR A;  5FLX K;  2E7W A;  3MVP A;  3L2V A;  2DDA A;  2VC0 A;  2VJJ A;  1T2K A;  2OF7 A;  4IQJ A;  3B6A A;  1ZLK A;  3GTM J;  1ERD A;  5FRO A;  2QQ8 A;  1MBK A;  1IXC A;  3MCZ A;  5L3D A;  1IXR C;  4QWQ A;  4LFU A;  2D45 A;  2L4M A;  3KFW X;  3GXO A;  2P0W A;  1YHQ I;  3FIW A;  5HDG A;  4XOT A;  2UUZ A;  2LBF B;  3W6K B;  4NUB A;  3BLY A;  2X6Y A;  3HDD A;  4HQE A;  2AQE A;  2LFB A;  1FZP B;  1JHH A;  3ZGK A;  2KIU A;  1JKO C;  1XX5 A;  2X6W A;  5FKM A;  4QPO A;  4EV0 A;  2CO5 A;  5M5X J;  1R1U A;  2M34 A;  5LHI A;  5TGT A;  2CS3 A;  5J3L A;  3A4C A;  3FMQ A;  5EGO A;  3R4K A;  3E5U A;  3JRE A;  1UHS A;  1ETQ A;  2IGN A;  4BHP A;  4BS9 A;  3VWB A;  3AAF A;  2ZXI A;  1W7P D;  4XKB A;  1SVL A;  3FF5 A;  5FLM J;  1TW2 A;  2MD0 A;  1UHM A;  4LIT A;  4HNV A;  2XAU A;  1MJA A;  3CQZ J;  1TT0 A;  1HLV A;  4TV7 A;  3BR6 A;  4II3 A;  3LST A;  2E2I J;  4Y4R A;  2JK3 A;  5TRD A;  2ZME C;  4BL0 B;  2OCC H;  5KK1 A;  2JSC A;  3P9I A;  5DTD A;  4FAS D;  4X6A J;  1LFP A;  3S3N A;  4AVP A;  4ZYG A;  4U0Y A;  1RPW A;  4Q5S F;  4IL6 C;  4UVC A;  2UXN A;  3K2A A;  1SMT A;  2XRO A;  2M7A A;  1VF9 A;  2ME6 A;  1P7J A;  1IRZ A;  2M30 A;  4IKF A;  3K4B A;  4NQW A;  4MFD A;  2XAQ A;  2EZH A;  4F3Q A;  1U0J A;  4JBA A;  4M71 A;  4RM2 A;  4RLQ A;  3A01 B;  1JT0 A;  1IRG A;  1WSU A;  4OAY A;  3KIO A;  1A6I A;  1AA7 A;  3PIP F;  3BCA A;  1OYI A;  1PP7 U;  4GFB A;  5K7F A;  2L5Q A;  5KVR A;  3LSK A;  2WV0 A;  3Q9V A;  2RVC A;  3K4C A;  3WTY C;  4EAT A;  2ZFU A;  3HSE A;  3SEZ A;  3RZD J;  4Y52 J;  1SFU A;  3P7N A;  1G3T A;  2G7H A;  1D0Z A;  2RNJ A;  3GFM A;  1WQ2 A;  2HZD A;  3IHU A;  2EFQ A;  4UUS A;  4HLY A;  4ZDL A;  4ZZL A;  5BMZ A;  4L0Y B;  2HDC A;  3GTG J;  4XRM A;  1A04 A;  3WGI A;  2G0E A;  2W25 A;  1TLH B;  3DKW A;  4IHW A;  3I59 B;  4IQ4 A;  5J6X A;  1KZH A;  2OQR A;  4CCO A;  4IRH A;  4JQF A;  1MMN A;  4PJN A;  3RQ4 A;  1TBX A;  2IS1 A;  2F6C A;  3FXJ A;  3BPX A;  1S8N A;  3AL0 B;  1TWH J;  2L3D A;  3E6D A;  2ISZ A;  1KU9 A;  3I4N J;  3DFG A;  3RTR A;  2LKP A;  3B73 A;  2EK5 A;  3ESW B;  3QPH A;  5L3C A;  1MBF A;  3KEO A;  5CVV A;  4RB3 C;  1MBE A;  5F0C A;  1G4D A;  2DK8 A;  3PSF A;  2VT3 A;  1ETV A;  1JKR C;  1LFB A;  3DBH B;  2Q0O A;  3WU0 A;  4UVA A;  3OY9 A;  2V4J C;  3BRO A;  3MQ0 A;  3ZXS A;  3ZRG A;  3S1R J;  2XAF A;  1V55 H;  3Q0U A;  1IN8 A;  5K7Z A;  1MKM A;  3IAM 2;  2ZNY A;  4V2G A;  2QQA A;  3CDH A;  1JUM A;  1TWG J;  1ZGA A;  4ESF A;  3BR5 A;  4JYK A;  2EFP A;  1ZAR A;  3SFI A;  2QKL B;  2DMQ A;  2L02 A;  2WWY A;  1A6Q A;  3A03 A;  1FX7 A;  3EUH C;  4HDU A;  1RI7 A;  2TDX A;  2VKE A;  4XSX F;  3TW7 A;  3ZMT A;  2O9L A;  5IP9 J;  2LRD A;  1U9N A;  1MSF C;  5E3O A;  3GBG A;  3L09 A;  3HBL A;  1BIA A;  1BJA A;  2OA4 A;  5D5X B;  2M5W A;  3KLO A;  4UVB A;  1SD5 A;  3TP0 A;  3S93 A;  2QCO A;  3MAJ A;  4HX4 A;  5BPI A;  5L3G A;  4I6Z A;  4XLP F;  3DBL B;  1AKH A;  5E3N A;  2HNH A;  1FBS A;  5L3F A;  4GDF A;  1V3F A;  1Z05 A;  4ASN A;  1B8I B;  1IUY A;  4P1W A;  4A3I J;  3C2G A;  2B0L A;  2X48 A;  3RPU A;  4XBF A;  4A6E A;  3FXR A;  4EQQ A;  1MNM C;  2H94 A;  3S3O A;  4A3C J;  2F48 A;  1G3W A;  2HOE A;  4AYB A;  2EV0 A;  4DZJ A;  1W1W E;  3M8F A;  5J40 A;  2VE9 A;  1WVR A;  3K70 D;  3BCB A;  4P5O A;  2H6B A;  1JI8 A;  1KON A;  3RDI A;  3DXJ F;  2H8R A;  4UY8 I;  4LB5 A;  1YS7 A;  3HHG A;  5F04 A;  3VYT B;  1BOA A;  1OCT C;  3K7A J;  3ZMU A;  3HIF A;  3VSK A;  1OKR A;  3BPV A;  2DMN A;  2LOO A;  2MBF A;  3MMY B;  3CCQ I;  4YFN F;  1XGS A;  1WH7 A;  1RZ4 A;  3V4G A;  1W5S A;  4HA8 A;  4KIB A;  4XIC A;  3OMY A;  2JJ7 A;  4BUP A;  4DIQ A;  2Y9Z A;  2L9R A;  2VT2 A;  5JFR A;  1RRJ A;  4IEJ A;  4CYD A;  4M74 A;  4KMF A;  3MZ8 A;  5F27 A;  3CO7 C;  4Y13 A;  3V8L A;  4GXO A;  2D1H A;  2ZO4 A;  3W6V A;  4IJA A;  1SFK A;  2IEK A;  3WGH A;  4II2 A;  5JI6 A;  1N78 A;  5KAI C;  5J1R A;  3HTU A;  3HOV J;  4P96 A;  2RV8 A;  1FYM A;  3FM3 A;  3ZQH A;  1Y1W J;  1SFE A;  5JHU A;  2Y69 H;  1F1Z A;  2E71 A;  4OAZ A;  2MW8 A;  4RMN A;  5M3M J;  4PJ0 C;  5H6Q A;  4BAC A;  3P5J A;  1MJ9 A;  1BN5 A;  3I3L A;  5D4S A;  2JVG A;  3QWL A;  2WAF A;  5HLI A;  2KLO A;  2HXI A;  2R5Z A;  1H9T A;  2PJR B;  3HM5 A;  4D0P A;  1SAX A;  5EYR A;  2R7W A;  4NC8 A;  4IO9 F;  1XPX A;  3CUO A;  1CF7 B;  2WAQ N;  3JSO A;  2QSG X;  2Q2E A;  3LA3 A;  3CJT B;  1SFO J;  2DAO A;  2JA2 A;  4OIP F;  4PK4 A;  1HQC A;  2Y48 A;  1X1A A;  5BNG A;  3L2R A;  1I27 A;  3WTT C;  1D1B A;  1IF1 A;  4IHV A;  4JP0 A;  3KYC B;  1REP C;  4A93 J;  4FCY A;  1PDN C;  3RI4 A;  2K3P A;  2OUM A;  3EQL F;  4BEH A;  5GPC A;  2Z33 A;  4GCV A;  3BOQ A;  5IOZ A;  3FDY A;  2VC1 A;  1OCO H;  1QNT A;  2CV2 A;  4OOI A;  3HSR A;  4A5M A;  3IC7 A;  3E5Q A;  3F8B A;  2LF8 A;  1YE9 A;  4BQO A;  4LIV A;  4PGH A;  2IAI A;  5DUI A;  3NAR A;  2A05 A;  3LQQ A;  1KU2 A;  5CQE A;  2IRF G;  3K4M A;  2DDB A;  2BHZ A;  2LLK A;  4MEY F;  4OMZ A;  1UCR A;  1VQN I;  2XC7 A;  3DEW A;  1VFC A;  3Q9S A;  1IDZ A;  1I39 A;  3BT9 A;  3L2U A;  1Z91 A;  1X4O A;  5KNL A;  2MC3 A;  5BOX A;  2FQ3 A;  4KJZ A;  1XTA A;  2W57 A;  1SC7 A;  3J7A Y;  2DYS H;  4GGG A;  3L2W A;  4HST A;  2GLO A;  2LDU A;  5FB2 A;  3MWM A;  3CCV I;  2LR8 A;  2HVS A;  2H27 A;  4OWR B;  4YRV A;  3FXO A;  4KIS A;  3CMA I;  2GIZ A;  1K6O A;  4CZZ A;  4LLL A;  1LDJ A;  4KUM A;  2AXL A;  2L7M P;  2WAD A;  4HRI A;  2X85 A;  1FBU A;  3V7S A;  3B02 A;  4DYR A;  3BG6 A;  3I58 A;  1DP3 A;  2E1N A;  2PN6 A;  3JTH A;  2WY8 Q;  5E8I A;  2EFW A;  3LNQ A;  5J8C A;  5F64 A;  2IPQ X;  3H5R A;  4RAG A;  2XUB A;  4FE4 A;  1YJN I;  1H8A C;  1T0F A;  3NWT A;  3ZMS A;  5HNF A;  2MSY A;  4ZZD A;  2HTS A;  5EF6 A;  3G2B A;  3KET A;  2OJE D;  3J7Z I;  3SZT A;  5E3L A;  3FXL A;  1FOX A;  1S7O A;  1HA8 A;  1UB9 A;  4M3G A;  1Q1H A;  1F5T A;  3S1N J;  1BA5 A;  3J7A O;  3SEQ A;  3HPH A;  3T0Y A;  1KU3 A;  2ECC A;  3M07 A;  4ENK A;  2HFH A;  3WGG A;  5D6F A;  1ON2 A;  4IPA A;  2Q8K A;  3RKX A;  2PI0 A;  2W84 A;  1VQO I;  2X4H A;  3M4O J;  1LUJ B;  4RAF A;  2R7Z J;  5EEH A;  4BXU A;  2VB6 A;  3DTK A;  2PMZ N;  1KU7 A;  1SEU A;  3DWL E;  4RGU A;  3HSF A;  4A6D A;  2H8W A;  3F6O A;  4L5I A;  1Z3Y A;  2V1D A;  2K9L A;  1BM9 A;  2TCT A;  4ABZ A;  2E36 A;  1AWC A;  3QRF F;  1ZGW A;  1ZKG A;  4DYQ A;  1XN7 A;  3K70 C;  1K6Y A;  3J80 Z;  4ENM A;  4ZTJ A;  1RR7 A;  3VYR B;  2DOD A;  2HOA A;  3BTI A;  1S72 I;  4W1U A;  2KIS A;  3HB9 A;  2BW3 B;  4DNC A;  2DPU A;  2R7T A;  1JTX A;  2EIK H;  2VBZ A;  1YJW I;  2DW4 A;  4RA2 A;  4U87 A;  3ABM H;  3RYP A;  3SFZ A;  2A6T A;  2VAS A;  5J8F A;  3OYN A;  2CV1 A;  1J75 A;  3QP5 A;  4A3L J;  4PJJ A;  1ZK8 A;  2AXT C;  3WOD F;  3G73 A;  4ZDO A;  4KN7 X;  2XAS A;  3DKY A;  4FET A;  4IHS A;  2R0Q C;  4NHJ A;  1T6S A;  2Y30 A;  4F52 A;  4DQ2 A;  3IKT A;  3WTV C;  3JR9 A;  2V1U A;  2UWM A;  3E6M A;  3BJ6 A;  2ELJ A;  2GA2 A;  2OCE A;  3MKZ A;  2MA3 A;  2MLK A;  5L3B A;  4LK0 F;  5A2Q K;  4E70 A;  1PJR A;  5LHH A;  1ZRD A;  4N9I A;  2DA3 A;  3ISP A;  1ZG3 A;  1B1B A;  2P4W A;  3BDD A;  2EV6 A;  2J5P A;  3GLL A;  5IYB J;  2R7V A;  1SAU A;  4U0W A;  3HGY A;  5J1Y A;  4I7H A;  1OPC A;  1B72 A;  3O6B B;  3BJO A;  4E7L A;  1BOB A;  4KMU X;  2DJI A;  4Y3O A;  2F5V A;  4U0V A;  3U9G A;  2VQL A;  2FD5 A;  1FJL A;  2CFX A;  2HGC A;  1JGS A;  4A3F J;  2XPU A;  3DU5 A;  1YX5 A;  2ZCW A;  5E18 F;  1IJW C;  2I5U A;  5D5V B;  2PFB A;  5ICC A;  4ZYD A;  2JT1 A;  1OR7 A;  1IN7 A;  3AG2 H;  1O4X A;  2EFN A;  3ULQ B;  2XF7 A;  1EV7 A;  2V9K A;  3SDB A;  5IP6 A;  1TNT A;  3E7L A;  4DGW B;  2BXY A;  1GXQ A;  5GTI C;  3RYR A;  4L9J A;  1WFX A;  1WKM A;  1R00 A;  4UV8 A;  4ZDP A;  3CUQ B;  2BXZ A;  2DMU A;  3HYI A;  1IN5 A;  1ACI A;  2V7F A;  3HTS B;  2DJN A;  1XCV A;  2P81 A;  3CUQ C;  2QQB A;  2BY2 A;  4NNJ A;  5FRM A;  3JAM Z;  4NQW B;  3GW2 A;  1ZRC A;  4MIM A;  4EVI A;  1T98 A;  1HXD A;  2TRT A;  4P55 A;  3SJM A;  2VKD A;  2VBW A;  1SD6 A;  1ETX A;  4HW0 A;  2CH0 A;  1D1A A;  2DOA A;  4FHT A;  3BG5 A;  3WHB A;  4CA0 A;  1EH6 A;  4KIG A;  2WB1 A;  1WJF A;  2K9S A;  3OSF A;  1W0T A;  3GTJ J;  2B9S A;  1UJ8 A;  3QAH A;  2HYJ A;  1WCM J;  2STT A;  1QPM A;  3F21 A;  4IHY A;  2W85 A;  3W3C A;  4UUS B;  2Y0M A;  5HS9 A;  5KCM A;  2ESH A;  4FQG A;  3CME I;  2DI3 A;  3ZQC A;  1ON1 A;  1Y0N A;  1BC8 C;  1OCR H;  4M3F A;  2XF5 A;  3V42 A;  4HPQ A;  2F5E A;  2L01 A;  4PJL A;  2KT0 A;  3DEE A;  1B9M A;  4RAY A;  2P5K A;  4RS8 A;  4HV5 A;  1IV8 A;  2JPC A;  4OIR F;  2BOL A;  5IOY A;  5GAE J;  4QPQ A;  3BP8 A;  2EIL H;  4HNT A;  2CGP A;  2QVO A;  1D0X A;  3R6S A;  3PO3 J;  2DOE A;  3CDL A;  2V9P A;  1DP7 P;  1YS6 A;  3U1K A;  2KIM A;  5K1Y A;  1QHG A;  1VZ0 A;  4EJO A;  5B1B H;  4BYY A;  2A5Y B;  4M72 A;  2A68 F;  3PFY A;  5BS6 A;  4NDL A;  3SXY A;  1Y6I A;  2HWV A;  4AD9 A;  3S32 A;  2FXA A;  4LG0 A;  4UXN A;  1X3W B;  2RQQ A;  1JGG A;  1KQ8 A;  3WG7 H;  1YYV A;  3HEF A;  1R58 A;  3H9G A;  3BR3 A;  3ZQI A;  4AYB N;  3J7Y J;  4CYC A;  1YTY A;  4PGG A;  4IF4 A;  3G4S I;  1U5T A;  5F1R A;  4M73 A;  4H0E A;  3M8J A;  2OZU A;  4G8X A;  2NOJ B;  1HW2 A;  2DT5 A;  2R5Y A;  4KFC A;  4BE0 A;  3H36 A;  1UZC A;  3MKW B;  2L4A A;  4I0A A;  2BV6 A;  4HQM A;  3DKX A;  1H89 C;  3ZP5 A;  4JK1 X;  3F22 A;  2CWE A;  5DYM A;  3R0J A;  2P7C B;  4FE7 A;  4F92 B;  4C30 A;  1EH7 A;  3JCU C;  3VEP A;  1XCB A;  3GFL A;  3IV5 A;  2X51 A;  1UFM A;  4XLA A;  3ABU A;  1ZH5 A;  3O8H A;  4LJZ F;  1U9O A;  1BC7 C;  3K4J A;  1C0W A;  3OYJ A;  2RGV A;  2VKH A;  1LE8 A;  3L7W A;  2LSO A;  4CHU A;  1MH3 A;  2LKS A;  4PZJ A;  1U3E M;  3S1Q J;  5H6R A;  1QRY A;  1F43 A;  2DQR A;  2PX9 A;  5F6F A;  1L0O C;  5M5W J;  1FTT A;  2XRN A;  4NC6 A;  5HNH A;  4J19 A;  4A3D J;  2EH3 A;  3DLL F;  2Y31 A;  3IH4 A;  3H9Q A;  5LHG A;  1F4K A;  3LWF A;  3IWF A;  1ITY A;  1I1G A;  2V26 A;  1X1C A;  3F8C A;  5K7H A;  1TW3 A;  2FA5 A;  2XGX A;  4ETS A;  2HPM A;  4NBQ A;  2QF7 A;  1ETY A;  2HDW A;  2MAB A;  1JXS A;  1MMG A;  2MC4 A;  1OMI A;  3FXM A;  2DA1 A;  3M1C A;  4XMY A;  5CVU A;  4MTD A;  2VLA A;  2F5F A;  4PDK A;  2CG4 A;  2DLL A;  2L7F P;  4G94 A;  1USS A;  2JWT A;  1TTY A;  2KFD A;  2ICW G;  2LH9 A;  3KP3 A;  3ZQ7 A;  4C3J J;  1WJ5 A;  4EMS A;  1MMS A;  2IP2 A;  1FP1 D;  1T8I A;  2M1B A;  3C18 A;  4GRI A;  2LKX A;  2NXN B;  1R49 A;  4IHT A;  4UUV A;  3LAJ A;  2WV1 A;  4GO1 A;  4M3D A;  3KX2 A;  1SD4 A;  4L0Z B;  2QKM B;  1ZGJ A;  2XKO A;  4B1R A;  2STW A;  1AHD P;  1PVE A;  1WJB A;  2VQG A;  2GOX B;  2V9V A;  2R4G A;  4XRS G;  3U1D A;  5HLG A;  2E2J J;  1FTZ A;  2CQN A;  5B5E C;  3GTL J;  2QSF X;  3OYC A;  1KQ9 A;  1XB4 A;  1G3S A;  3RPQ A;  2OTL I;  3R0A A;  1QHH D;  2O5R A;  2X1D A;  4XM3 A;  3LAP A;  1TL8 A;  2E19 A;  1MBG A;  1GHC A;  4A69 C;  4PFP A;  1MNE A;  2O3F A;  3HRM A;  4ESJ A;  3LSR A;  2Y9Y A;  5H20 A;  2RQP A;  4KIC A;  1LEA A;  1T95 A;  4BXF A;  3K1N A;  3GTP J;  2CFO A;  2ZJ2 A;  2X6X A;  2R5Z B;  3AG3 H;  1YFH A;  3AL0 C;  1LEB A;  5FD5 A;  5LEK A;  4AU7 A;  2QZ8 A;  1FNN A;  3CCE I;  1NK2 P;  1IRF A;  1IRX A;  2IBD A;  2JTV A;  2Q2E B;  1TWC J;  2FNP A;  4LD5 A;  1XS9 A;  2CYY A;  2M8E A;  3HRS A;  2E1M B;  5FJ8 J;  2XPV A;  2ZKZ A;  2P5V A;  1QU3 A;  2NS7 A;  3OL3 A;  1SFX A;  3HXL A;  5FLV A;  2GQQ A;  3PUF A;  4BGD A;  3OS0 A;  4N0B A;  3OIP A;  2KRF A;  2K9N A;  2XV4 S;  2E1M C;  3PNV A;  5E1W A;  4BEH B;  2OAZ A;  1UMQ A;  2NOG A;  2B7E A;  2WAE A;  3QOE A;  2KZV A;  1BR4 A;  1VND A;  4PJM A;  2OPT A;  1JJ8 C;  2VXZ A;  1YX3 A;  2VXD A;  4M6V A;  3K9T A;  3UKG A;  2XDV A;  3KYL A;  1KQ0 A;  4N9H A;  2F2E A;  4XN0 A;  3H35 A;  3ASN H;  4YG2 F;  3GUD A;  2VE8 A;  1OIS A;  2R7R A;  4C2T A;  2HYG D;  3WHC A;  3ZN0 A;  3F72 A;  5HOO A;  2K4B A;  2F5D A;  1OJL A;  4DJA A;  4WXC A;  3KZY A;  4I01 A;  3PO2 J;  3ZMV A;  2GBY A;  1V5E A;  3EYI A;  3QPS A;  3CTA A;  3QYB A;  4AUX A;  1I50 J;  4I0B A;  4B8X A;  3F23 A;  3DV8 A;  2L9V A;  3A0H C;  3T1B A;  2WC2 A;  5F0H A;  3W2W A;  5CVJ A;  5HDK A;  1ETO A;  5FKO A;  1WJA A;  3HHH A;  1YJ9 I;  1YLF A;  3SDG A;  2BBY A;  2CW8 A;  2YSR A;  4BJ5 C;  1NG6 A;  1W0U A;  3F8N A;  4C3H J;  5LRS A;  3RQI A;  5K5R A;  1UST A;  1ODD A;  1HW1 A;  3S2W A;  3GLX A;  2XPW A;  4KT5 C;  2IW5 A;  1XGM A;  1ZLJ A;  3S14 J;  2A6H F;  1NHA A;  4XOR A;  1BR1 A;  2W24 A;  1ZRF A;  4IRG A;  3LOC A;  3MFK A;  3V8K A;  1ZN2 A;  4R79 A;  2VL8 A;  4BBR J;  3TED A;  1W36 D;  1G3Y A;  2YR2 A;  2ZME A;  2BY3 A;  1PUE E;  2P6S A;  1HDP A;  5ED4 A;  4BY1 J;  2EFO A;  5EZG A;  4B44 A;  2HZT A;  1CGP A;  4AVZ A;  1J59 A;  2L2O A;  4LIU A;  2RN7 A;  2IA1 A;  1EH8 A;  2BGC A;  4U7D A;  3AKZ A;  5ILS A;  4B4C A;  1WJC A;  1S7E A;  2CUJ A;  3A2K A;  5H2F C;  3OYI A;  4IOC F;  2K85 A;  1I3Q J;  2DPD A;  2ETH A;  3CC7 I;  1YG2 A;  2ZXH A;  3WTZ A;  4WCG A;  3I64 A;  5M5Y J;  2DK5 A;  4B3A A;  2BEO A;  1TWF J;  3K69 A;  4BKX A;  4A0X A;  2QQ9 A;  5DEQ A;  2LG4 A;  2QSH X;  2F4O B;  2OTJ I;  3CP8 A;  4ZYE A;  5CVR A;  5HDN A;  3H5A A;  4LK1 F;  3OYA A;  1BR2 A;  3P9C A;  1Z77 A;  2HQA A;  5DM6 F;  2VN2 A;  1U8R A;  1H88 C;  3GWZ A;  1MDM A;  1FOW A;  1UEL B;  3K1P A;  1D8K A;  3DLA A;  1MBJ A;  2MH2 A;  3OR1 C;  1MW7 A;  2K9M A;  4C9Y A;  4HNU A;  5HS7 A;  4R8H A;  2VQH A;  2VBY A;  3E3V A;  2FSW A;  4ZC3 A;  2KIF A;  3DTI A;  3ZR8 X;  3J81 K;  3GTO J;  3JAM K;  5EZH A;  3U21 A;  5IT9 K;  2PMH A;  5FLX Z;  1R1V A;  3GZ5 A;  1RES A;  2LVS A;  4JX6 A;  3I59 A;  2Y0S A;  2ZJQ F;  3ZCO A;  2QEN A;  4E7Z A;  1KA8 A;  3S3M A;  1U8B A;  3OYF A;  5EDN A;  1YQA A;  3VSL A;  2VKV A;  5HLH A;  2YU9 J;  3MKL A;  3C1D A;  2A07 F;  2YS9 A;  3OYB A;  4S04 A;  3P9K A;  3S8P A;  2HR3 A;  3GCM A;  1EF4 A;  1FSE A;  5GAD J;  4MEX F;  1D1C A;  2V6E A;  2BE5 F;  2KHM A;  4NB5 A;  2HQ5 A;  2DA7 A;  4BH9 A;  2QBY A;  3LSH A;  2LK2 A;  2X9D A;  1MSE C;  3CJQ B;  4BJT A;  3IRQ A;  2YUS A;  1H9G A;  2Z3Y A;  3I4P A;  3KLN A;  1B72 B;  1ZRE A;  4B47 A;  3ASO H;  3KZI C;  5EEA A;  2OZ6 A;  5EJC A;  3EUH A;  5IY5 H;  3LSM A;  2WB1 N;  1GVD A;  4I76 A;  2Q1Z B;  4XN3 A;  3QOD A;  2R7D A;  1WI9 A;  3D1N I;  4MGR A;  4WXH A;  2QEX I;  4E7I A;  2JA7 J;  1YIT I;  2XB0 X;  3NEU A;  1K83 J;  2QYO A;  5LLQ A;  4XLE A;  4A3G J;  3GFJ A;  1X3Z B;  3WE2 A;  5F0F A;  3S2D J;  3WU1 B;  3CMM A;  3GTQ J;  4KDP A;  2DA6 A;  3WG9 A;  4HF2 A;  3FK7 A;  1M1E B;  4I99 C;  3NAU A;  1XSD A;  3M9A A;  3AG4 H;  5HOD A;  1G6N A;  1YIJ I;  4O6J A;  3OYE A;  3FHN A;  4UB8 C;  1LVA A;  2CJJ A;  3JRG A;  3HG9 A;  4XK4 A;  5EG0 A;  2VJ4 A;  4X0G A;  4XL9 A;  5TIS C;  4MO7 A;  2R7S A;  4CGZ A;  2F4I A;  3KYD B;  5E1Z B;  3SQN A;  1Y8R B;  2A69 F;  4Z2Y A;  3HOS A;  3IWZ A;  2O03 A;  3CDI A;  2VJI A;  3GO5 A;  4E7K A;  4BJ6 C;  2ZSH B;  2CV0 A;  3CP2 A;  1OCZ H;  1QZE A;  3G1M A;  1IAW A;  3S16 J;  3SYT A;  4ZTF A;  2IXS A;  5IYC J;  1H0M A;  1JJ6 C;  3ZQG A;  1GVJ A;  2ELH A;  2CUF A;  2DN0 A;  5ICG A;  3TMO A;  3RCO A;  4F55 A;  4RDU A;  2E2H J;  4BAY A;  4V2F A;  4CSW A;  4XLF A;  3DQV C;  2QUF A;  2XAG A;  1VQ7 I;  4WWC A;  5KHD A;  4IOA F;  4JX4 A;  2M45 A;  5JLX A;  4D7M A;  5C44 J;  5LEJ A;  3LSP A;  1J5Y A;  3GYH X;  1P4W A;  2DOF A;  4G9Y A;  5C4X J;  4CUG A;  4QIW N;  3X2Q H;  2W1O A;  3IAS 2;  4CO8 A;  1FOK A;  1J9I A;  4Y15 A;  1IN6 A;  1E17 A;  2AHQ A;  1B9N A;  1OYY A;  3JRH A;  2G7U A;  1IXS B;  2IVM A;  1GT0 C;  5CPR B;  1RR8 C;  1SVM A;  1W7P A;  4ENJ A;  1P7I A;  2JA8 J;  3D5L A;  1YRN A;  2V6C A;  5J4Y A;  2CQ7 A;  3FK6 A;  5LD2 C;  1TQM A;  2FBH A;  1WPK A;  4XKC A;  1U6G A;  1FMW A;  1W36 C;  4GYI A;  1P92 A;  4M3B A;  4DBQ A;  3O8G A;  4MLO A;  1UAA A;  2QM3 A;  1MIJ A;  5FGM A;  2G9W A;  3N97 A;  5DM7 F;  2R7Q A;  1D8J A;  2GXG A;  3ZPL A;  2X0L A;  2M3A A;  3QOP A;  4AM3 A;  3BR1 A;  2ZJP F;  1O3Q A;  1JT6 A;  1YI2 I;  1HKS A;  1U5T B;  3BG9 A;  3RPU D;  4P9F A;  1FSH A;  3IKV A;  3L00 A;  5LRR A;  1EJ9 A;  4PCQ A;  4FT8 A;  2BYV E;  3I55 I;  3KEQ A;  3G71 I;  1T39 A;  3I71 A;  3LSI A;  2R5Y B;  4A0Y A;  4ZYH A;  2CW7 A;  3F8F A;  2E1C A;  2IT0 A;  1D5V A;  5C3E J;  2DBB A;  1MMD A;  1QQI A;  2HVQ A;  3VYU B;  4XNF A;  1GUU A;  3SHF A;  4PSX A;  3TO9 A;  5LGU A;  1B6A A;  4RGR A;  1KYW A;  3DBR B;  1LKX A;  1F9N A;  2NS0 A;  3I53 A;  1CF7 A;  1QA6 A;  2JRT A;  3L1P A;  2V1N A;  3JW4 A;  4K2E A;  3HL2 A;  4RBO A;  3BZK A;  4L18 B;  1LE8 B;  1XDU A;  4CZC A;  3JSP A;  4KN4 X;  3TO6 A;  5FKL A;  4A12 A;  2E5N A;  1T38 A;  3PQJ A;  1V4R A;  2LC2 A;  3G1O A;  1DU0 A;  5BPD A;  3KZZ A;  1DGR M;  3PSI A;  5EGO B;  1V5G A;  3W6J B;  4CCN A;  2JA6 J;  1I1S A;  2R7O A;  4G6D A;  3LSJ A;  3G1L A;  1LFU P;  4QLC U;  1LB2 A;  1QPI A;  2H09 A;  1YOV B;  2I10 A;  4CCL A;  2ECB A;  2O7O A;  3BWG A;  3TDZ C;  1O57 A;  3K1M A;  1MZB A;  2NVQ J;  5LGN A;  4E7J A;  2MG4 A;  1Z7U A;  4XR6 A;  1Y1V J;  4CXF A;  2RKH A;  1X1P A;  5FFX A;  4CCK A;  2W82 A;  3M1E A;  2EIJ H;  2HKX A;  3OSG A;  1YW9 A;  4OIO F;  2FML A;  3D5R C;  3PJR A;  1HKT A;  2LYC A;  3ABT A;  2UZK A;  5FKN A;  4E7S A;  1ZG1 A;  5D5W B;  3FMS A;  2NYX A;  1VQP I;  2LY2 A;  3V8J A;  4HLX A;  3H1C A;  3UNG C;  3PL8 A;  1FC3 A;  2VPR A;  2X1C A;  5BQT A;  4Q48 A;  5GPA A;  3QYE A;  2PBI A;  3KCC A;  4BNC A;  2GM4 A;  4WXD A;  4E7H A;  2D5V A;  2ISY A;  4G12 A;  1MGT A;  3Q3S A;  3OYH A;  1DUX C;  3CJR B;  1WJE A;  5CYV A;  1WWX A;  2NNN A;  2R7U A;  5HLT A;  3QP6 A;  3F3X A;  2X6O A;  1Z6R A;  2A61 A;  4BU2 A;  4L5J A;  2IA2 A;  3I4M J;  3RJP A;  1RC9 A;  3BY6 A;  1GV2 A;  1N75 A;  2ZB9 A;  4XRS A;  4HG2 A;  3DTE A;  4BY7 J;  2KQR A;  4OMY A;  5B1A H;  4CDG A;  2FQ4 A;  2HQN A;  3DCF A;  3RSN A;  1LDK B;  5L3E A;  2ADU A;  2XF6 A;  2PEX A;  3E5X A;  2MGQ A;  3KP2 A;  4XON A;  3HPG A;  1R4N B;  3K2Z A;  4M6X A;  2ZC2 A;  4Y33 A;  1E3H A;  2FBK A;  5DDG A;  4I2O A;  5DS9 A;  2EIM H;  1JKP C;  4BE1 A;  1KYZ A;  4C2U A;  5DCM A;  2NVY J;  2LD5 A;  1IUF A;  3TQN A;  2DA2 A;  1JUS A;  4W97 A;  2R93 J;  1BJZ A;  3OOP A;  1IG7 A;  5GAH J;  2YU3 A;  1PYV A;  4ITV A;  2XHK A;  2OQG A;  3BG7 A;  2GXB A;  2OV7 A;  3HGG A;  5GP9 A;  4XKW A;  2KRC A;  4CCJ A;  4EGY A;  1APL C;  1SVO A; 
#chains in the Genus database with same CATH homology
 2L7Z A;  2XGE A;  2R5Z A;  3F0C A;  1X2N A;  3HM5 A;  1NK2 P;  2IBD A;  3S15 J;  1TWC J;  1X2M A;  3HOZ J;  5E3M A;  5EYR A;  1XS9 A;  1GV5 A;  3JRF A;  3TP3 A;  2HI3 A;  2EZI A;  2WAQ N;  5FJ8 J;  2XPV A;  1WI3 A;  2NS7 A;  1R9T J;  5FLV A;  4Y7N J;  3A02 A;  1SFO J;  4A3B J;  4XID A;  2LY9 A;  5BNG A;  2K9N A;  4IHV A;  4JP0 A;  1Q1V A;  4S0H B;  1UMQ A;  2CUE A;  2NOG A;  4A93 J;  1FIP A;  4FCY A;  3VPR A;  3OIO A;  1VND A;  2OPT A;  1JJ8 C;  5GPC A;  5IOZ A;  4M6V A;  1IC8 A;  2XSD C;  3UKG A;  1AKH B;  2HOS A;  1IGN A;  1TWA J;  2H1K A;  3JRI A;  3JRD A;  2M2E A;  2ID3 A;  3WHC A;  2IAI A;  1OJL A;  3NAR A;  1BW5 A;  3PO2 J;  2XGD A;  2GBY A;  2LLK A;  3QPS A;  2XB5 A;  3BQZ A;  3DEW A;  4AUX A;  1I50 J;  1U78 A;  1VFC A;  1IDZ A;  2DA5 A;  1E3O C;  3BT9 A;  3Q0W A;  5F0H A;  2CRG A;  4MFE A;  1ETO A;  3BTJ A;  2B63 J;  1F36 A;  5FKO A;  1HCR A;  2GLO A;  4QSH A;  3SDG A;  2M0C A;  2DA4 A;  1W0U A;  2LR8 A;  1ETK A;  4C3H J;  3RQI A;  2W48 A;  4D5C A;  5IYD J;  2L7M P;  4DYR A;  2EZK A;  2EQR A;  1MH4 A;  2XPW A;  2ID6 A;  2XGC A;  3CCY A;  3LNQ A;  2M9H A;  1PUF B;  4UUT A;  3S14 J;  1I6H J;  2Y0S N;  3HKZ N;  4FE4 A;  3CMY A;  3HOW J;  1QVU A;  3LOC A;  1H8A C;  2MSY A;  4BBR J;  3TED A;  1PUF A;  5EF6 A;  1POG A;  1HDP A;  3QQA A;  5E3L A;  4BY1 J;  3RKQ A;  2K9Q A;  5EZG A;  4FIS A;  4C3I J;  1BA5 A;  4M3G A;  3S1N J;  1NTC A;  2ECC A;  4FTH A;  5FKK A;  4B4C A;  1S7E A;  3M4O J;  1BL0 A;  1I3Q J;  1UG2 A;  2R7Z J;  2ME0 A;  2NVX J;  1G2H A;  1NK3 P;  2PMZ N;  5M5Y J;  2FX0 A;  3HOU J;  4B3A A;  1TWF J;  3JRC A;  4BKX A;  3B6C A;  4A3J J;  1FIA A;  1H88 C;  1Z77 A;  5J1U A;  2TCT A;  4ABZ A;  1IDY A;  1ZGW A;  1ZKG A;  4DYQ A;  1MBJ A;  1MBH A;  9ANT A;  3BG3 A;  2JN6 A;  1ENH A;  4A3K J;  1RR7 A;  2HOA A;  3BTI A;  3GTO J;  5EZH A;  4W1U A;  3HB9 A;  1JTX A;  2CQX A;  2L0K A;  1HF0 A;  1RES A;  2LVS A;  4JX6 A;  3BQY A;  4DYC A;  3Q0V A;  4BBS J;  1XG1 A;  4A3L J;  4DW6 A;  4DZP A;  2M8G X;  1ZK8 A;  1U8B A;  2R92 J;  5EDN A;  1ZQ3 P;  4X1E A;  2K40 A;  2VKV A;  2YU9 J;  2CQQ A;  3MKL A;  2R0Q C;  2YS9 A;  3H3V K;  2COB A;  2Y30 A;  4L5E A;  1EF4 A;  3BR0 A;  3JR9 A;  4A3M J;  5F1J A;  2AO9 A;  5F08 A;  1ETW A;  2HOT A;  1RET A;  2HQ5 A;  2DA7 A;  2LK2 A;  2X9D A;  1MSE C;  2DA3 A;  2YUS A;  2RAE A;  1B72 B;  4A3E J;  3MVP A;  5EEA A;  5IYB J;  3FIS A;  2OF7 A;  3HGY A;  3B6A A;  5J1Y A;  3GTM J;  1MBK A;  1B72 A;  2WB1 N;  1GVD A;  4I76 A;  3OOU A;  3FIW A;  3D1N I;  2FD5 A;  1FJL A;  3PM1 A;  2JA7 J;  1ORK A;  2XB0 X;  3HDD A;  4A3F J;  2KDZ A;  2LFB A;  2XPU A;  1K83 J;  1IJW C;  1JKO C;  2XRL A;  4A3G J;  5FKM A;  5M5X J;  2M34 A;  5F0F A;  3S2D J;  5J3L A;  3GTQ J;  2DA6 A;  5EGO A;  3FK7 A;  3JRE A;  1UHS A;  1ETQ A;  5JLW A;  5EG0 B;  1O4X A;  2NS8 A;  3NAU A;  5IP6 A;  3E7L A;  4BXX J;  5HOD A;  3LSG A;  2CJJ A;  3ZOB A;  5FLM J;  4XK4 A;  5EG0 A;  3JRG A;  1BW6 A;  2DMU A;  4HNV A;  2VUM J;  3CQZ J;  4MO7 A;  1HLV A;  3BR6 A;  4QTR A;  2E2I J;  2JK3 A;  2DJN A;  3FKI J;  2O8K A;  2P81 A;  2JMW A;  5DTD A;  4X6A J;  1CQT A;  3G1M A;  3S16 J;  3JRA A;  1JJ6 C;  4MIM A;  5IYC J;  1RPW A;  3SJM A;  2TRT A;  3K2A A;  3ZQG A;  1A5J A;  1VF9 A;  2ME6 A;  1D5Y A;  2CUF A;  1P7J A;  2DN0 A;  1IRZ A;  3ZQL A;  1ETX A;  1T33 A;  2DMT A;  4MFD A;  2EZH A;  3BG5 A;  4RDU A;  3WHB A;  2E2H J;  3A01 B;  5IP7 J;  4V2F A;  1JT0 A;  2K9S A;  3OSF A;  1W0T A;  3GTJ J;  1A6I A;  2HYJ A;  1WCM J;  4JX4 A;  5JLX A;  4IHY A;  3A01 A;  4GFB A;  4D7M A;  4UUS B;  5K7F A;  5C44 J;  4Y52 J;  3RZD J;  3LSP A;  3ZQC A;  5C4X J;  2EBI A;  1HOM A;  2FJ1 A;  4QIW N;  4UUS A;  4M3F A;  2HXO A;  1YRN B;  4M3E A;  3IH2 A;  2AHQ A;  3GTG J;  2KT0 A;  3JRH A;  4XRM A;  1GT0 C;  2G0E A;  3MN2 A;  1P7I A;  2JA8 J;  4IHW A;  1YRN A;  5IOY A;  1HDD C;  3FK6 A;  1WPK A;  4CYC B;  3PO3 J;  5IPA A;  3CDL A;  4D5F A;  4M3B A;  3HOX J;  1TWH J;  3O8G A;  4MLO A;  3I4N J;  4EEF G;  2LTP A;  4NDL A;  2NVT J;  3GTK J;  3BR1 A;  1MBF A;  1JT6 A;  1MBE A;  1ZTR A;  5F0C A;  1JGG A;  3BG9 A;  3QPL A;  1JKR C;  1ETV A;  3HOY J;  1LFB A;  3HEF A;  3BR3 A;  3ZQI A;  4AYB N;  4CYC A;  3S1R J;  2R5Y B;  4AC0 A;  3Q0U A;  1DU6 A;  5K7Z A;  5C3E J;  1GUU A;  1TC3 C;  1FEX A;  4V2G A;  1JUM A;  1TWG J;  2R5Y A;  3BR5 A;  4JYK A;  3SFI A;  1H89 C;  3L1P A;  4LOC A;  1JKQ C;  2DMQ A;  3A03 A;  4FE7 A;  1WGX A;  4IHX A;  4RBO A;  1OCP A;  3IV5 A;  1LE8 B;  2ELK A;  2VKE A;  3TW7 A;  2O9L A;  5IP9 J;  1U9N A;  1IV6 A;  1MSF C;  5E3O A;  3GBG A;  3H0G J;  3O8H A;  5FKL A;  1U9O A;  3HBL A;  3G1O A;  1DU0 A;  1ZR4 A;  1LE8 A;  3TP0 A;  1MH3 A;  2QCO A;  5EGO B;  4I6Z A;  3S1Q J;  3BR2 A;  1AKH A;  1QRY A;  2JA6 J;  5E3N A;  3LSJ A;  3G1L A;  1LFU P;  1F43 A;  1B8I B;  5M5W J;  1FTT A;  4J19 A;  1QPI A;  3JRB A;  4A3I J;  2EH3 A;  4A3D J;  3C2B A;  2Y31 A;  2LP0 A;  1ZR2 A;  3IH4 A;  2I10 A;  2ECB A;  2O7O A;  2NVQ J;  1B8I A;  2MG4 A;  1T56 A;  2X48 A;  1ITY A;  2JA5 J;  1Y1V J;  5K7H A;  1OFC X;  1MNM C;  2QF7 A;  4A3C J;  3M3Y J;  1ETY A;  3TW6 A;  3OSG A;  2DA1 A;  1Z0X A;  4DZJ A;  2L7F P;  5FKN A;  2JWT A;  1AU7 A;  1VI0 A;  3RZO J;  2DTZ A;  1K61 A;  4C3J J;  3S17 J;  3S2H J;  2VPR A;  5M3F J;  5GPA A;  2H8R A;  2N8G A;  3ZQF A;  1SAN A;  5F04 A;  1OCT C;  3K7A J;  2GM4 A;  2D5V A;  2LKX A;  2DMN A;  2E1O A;  4G12 A;  1X58 A;  3IH3 A;  3Q3S A;  2WV1 A;  4M3D A;  1WH7 A;  1GDT A;  4B1R A;  2Y2Z A;  4XIC A;  1AHD P;  1XC5 A;  2X6O A;  2JJ7 A;  3I4M J;  2Y9Z A;  2L9R A;  4IEJ A;  4JX5 A;  4XRS G;  5F27 A;  5C4J J;  1GV2 A;  2ZB9 A;  4XRS A;  2E2J J;  1FTZ A;  1WH5 A;  4BY7 J;  3GTL J;  2CU7 A;  2FQ4 A;  3DCF A;  3W6V A;  1JUP A;  2IEK A;  4C2M J;  3BTC A;  2MGQ A;  2E19 A;  1MBG A;  4A69 C;  5J1R A;  2EZL A;  3HOV J;  3LSR A;  2Y9Y A;  2DMP A;  1JTY A;  3BTL A;  3ZQH A;  5DS9 A;  1RKT A;  1Y1W J;  1JKP C;  2NVY J;  2LD5 A;  1IUF A;  2HDD A;  1RKW A;  2DA2 A;  3GTP J;  2MW8 A;  5M3M J;  1JUS A;  4W97 A;  2VI6 A;  2R93 J;  1BJZ A;  1IG7 A;  2R5Z B;  3S1M J;  1QVT A;  3HGG A;  1APL C;  5GP9 A;  2HXI A;  4D7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...