2L7KA

Solution nmr structure of protein cd1104.2 from clostridium difficile, northeast structural genomics consortium target cfr130
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
MIRLTIEETNLLSIYNEGGKRGLMENINAALPFMDEDMRELAKRTLAKIAPLTENEYAELAIFAADEVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution NMR Structure of CfR130 from Clostridium difficile, Northeast Structural Genomics Consortium Target CfR130
rcsb
source organism Clostridium difficile
molecule tags Structural genomics, unknown function
total genus 20
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14203 TTRAP Putative tranposon-transfer assisting protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1850 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l7kA00
2L7KA
chains in the Genus database with same CATH superfamily
1FIAA 2E34A 3KYCB 3L2QA 1REPC 2OTLI 1USTA 3R0AA 4EEFG 3J7AY 1YX3A 2EV0A 2VC1A 3GF2A 4WXDA 2DFHA 3F0CA 3GCMA 3UR3C 4A5NA 1AA7A 2YUSA 2COBA 3RJPA 3ZN0A 4D7NA 4IRGA 3IV5A 3FWEA 4B3AA 3S2DJ 5FRMA 4D5CA 4PJLA 1A6IA 1U2WA 2DA2A 3WG9A 2QBYA 4MTDA 4KMFA 4YEJA 2DYSH 1QZZA 1V3FA 3SFZA 1XPXA 1PUFA 2CV0A 3OR1C 2K4BA 3LQRA 3PM1A 3JR9A 4IL6C 2NRAC 1TWFJ 1Y8QB 4ZYEA 4UUTA 2ZCWA 1B8IB 3K0LA 4E7IA 1FMWA 3TMOA 5BS6A 2E36A 1X1PA 5E3MA 3HSFA 1FEXA 4HSTA 1RIOH 4H0EA 3J7YJ 3GTKJ 3WTXC 2HVQA 4AVZA 3K6GA 4QLCU 2M34A 3FXLA 1OCTC 4KIBA 2XKOA 1QQIA 2CJJA 2K40A 3VYTB 4KUMA 2E1NA 3FM5A 2AXTC 3MZ8A 4RAGA 4Y4RA 5BPIA 2X51A 3F22A 1QNTA 3BR2A 2HOEA 4NB5A 4MEXF 4JYKA 3G71I 1JKOC 2A3SA 3JRDA 4BJ6C 1FTZA 1WJFA 5ICFA 5E1XA 1E2XA 1NK2P 4G6QA 1V5GA 4EM1A 3J81Z 3QP5A 3R6SA 1G8XA 3G1LA 1RR8C 1JJ8C 1R5HA 3FIWA 5EG0A 3ABUA 1ZLJA 5TISC 1DGRM 1YOVB 5M5XJ 3EQLF 4XORA 4MFEA 1ZG1A 2QLZA 3CCUI 3TP0A 3SZGA 1ZN2A 2FF4A 2LY9A 2BV6A 1BM9A 3VWBA 1ONVA 4CCNA 1U5TA 1HKQA 2VXZA 4BKXA 5D5VB 2I10A 2Y30A 3ECHA 5LGUA 2H1KA 5CQGA 3A01B 4RLQA 1R49A 2RNJA 4ASNA 3OYJA 1R7JA 2DO7A 2NS8A 3P9IA 1HKSA 3TDUC 4RGSA 4EM0B 1NHAA 3BR0A 4O6JA 4WCGA 4KN4X 2YX7A 4IOCF 4F3QA 3C2GA 3B73A 3S8PA 1QBJA 2HR3A 4V2GA 2HGCA 4GYIA 1O4XA 2VBZA 1MJAA 4UXNA 2JJ7A 1TC3C 3HTUA 4RMNA 2WBMA 1VQLI 1S5LC 2VPLA 1TW2A 2F5CA 3H9QA 4HOBA 3JRAA 3KPHA 3MEXA 1VZ0A 2HNHA 2VKEA 4IOAF 3S3OA 2D5VA 1MH3A 4L5JA 2CQ7A 2PMZN 2BHZA 3OIQA 2C6YA 2NVYJ 3CD6I 4HX8A 2MYSA 2VI6A 3OS2A 3KZYA 2O6GE 2IEKA 4IJAA 4FE7A 2PJPA 2VOPA 3C18A 5M5WJ 4D0PA 4MLOA 3NEUA 2YR2A 4F92B 5LRSA 1OCZH 3BY6A 1Z3XA 2DJIA 3BWGA 2QYOA 3G2BA 2Y9ZA 4M6XA 2M2EA 3KETA 2DI3A 2EA2A 1MDMA 2VXDA 2BY1A 4XNFA 3HG9A 2ISYA 5FKNA 3T5XA 3IRQA 5E18F 5C4JJ 1XGNA 2P6SA 2MH2A 3EUHC 4MO7A 4GO1A 4PUSA 4YIFA 2HOTA 2BEOA 2VB6A 4ZTJA 1G3YA 2L7ZA 3LSIA 2FMLA 5B3SH 4DGWB 2EV6A 4PGHA 2KRCA 1MSEC 4KNYA 1XN7A 2NNYA 4ESJA 4KMUX 2IGKA 3QWLA 2DDAA 2MSYA 3ABTA 3LSHA 3C2BA 1BW5A 1FP1D 3WU0A 1W5SA 3DBHB 4YG2F 3CJTB 3OV8A 3K1PA 1QPIA 3L9FA 3QPHA 1X1AA 4S05A 2WA0A 4QTRA 3DCFA 4MNUA 2JA8J 3OSFA 3QPSA 2F4MB 3OL3A 4EJUA 4FTHA 2R3SA 3GZ6A 2ZMEC 3FZVA 2JTVA 3CC7I 1MZBA 2GXBA 2EWNA 2QSFX 5CVIA 5J1UA 4AYBN 4XLNF 5EEAA 3MKYB 3I64A 3KFWX 4EVIA 1XTAA 2DMQA 2EZLA 2F4IA 1SEUA 2LREA 2ZO4A 2F48A 1V5FA 1IV8A 1Y0NA 4UY8I 1K79A 3SJMA 4XBFA 1L0OC 1G6NA 4C30A 4CICA 3ZMDA 4G9YA 1IW7F 5FO5A 3GXOA 1U9NA 5HNFA 4Y17A 3A0HC 5DEQA 1MBEA 3GLXA 1Q1HA 1G59A 2CUFA 3DBLB 4C2TA 1SANA 3D0SA 1LDDA 4AUXA 2H09A 1QVTA 2V1DA 4FETA 4BS9A 2R7WA 2X6YA 3HC7A 2OF7A 1H89C 3DV8A 1G3SA 2O0YA 3HKZA 2RQPA 4LJZF 1HCRA 1X1DA 5FLVA 2DTZA 3LMMA 3IAM2 2Y75A 1YLFA 4A69C 2DODA 2PG4A 4NC8A 1ZELA 3A03A 4M6YA 2RGVA 4NC6A 1YJ9I 5FKMA 5A2QZ 1IJWC 3KP3A 1P92A 2FX0A 2WAQN 4EJOA 1HF0A 3RSNA 2HQNA 1KU3A 1WI3A 5F04A 3S14J 2HU9A 2XIGA 3DTEA 5FLXK 1TP4A 1N78A 1YYVA 2M45A 1JGGA 3SHFA 3OYGA 3C3WA 5IPAA 4G94A 3GO5A 3F8CA 1LE8A 1BJAA 4CCLA 1N75A 3JRFA 3HOXJ 5FFZA 4OMZA 1A36A 2XPVA 3S32A 5E3LA 4IHWA 2JPCA 3FHNA 2XRLA 2OQRA 2HYGD 2Z1DA 4U0VA 2X0LA 3S1RJ 2QQ9A 2VKDA 5HDKA 1WH7A 2DQRA 2RQQA 3DPLC 3ZQ7A 2A69F 1K78A 2Y0MA 1YTYA 4ABZA 3I0TA 3V7CA 2EPFA 3FBNB 5H6QA 3WHCA 4PK4A 5IP6A 1MNDA 2A6HF 3D1NI 4LG0B 1WJBA 4M3GA 5E8GA 2MH9A 4G6TB 4PDKA 1EH8A 4H4KC 5J3LA 4Z6YA 1TWHJ 3E7LA 2IT0A 2KJBA 2QKLB 2Y0SA 3DLLF 3QQAA 4LK1F 3CJNA 5C44J 2BE5F 1IXCA 3E5XA 5HDNA 6PAXA 3MKLA 4RB2C 1SD4A 3EETA 3RQ4A 3CCVI 2IGOA 1IAWA 1YG2A 2R7UA 2M7BA 1MMGA 3HRUA 2KZGA 1IUYA 3K4CA 3ZQCA 3LSGA 1IRXA 2F6CA 4GXOA 2E5ZA 2FRHA 1ZR4A 2ZXHA 3ESWB 4PGGA 1FYLA 5BNGA 4XM3A 4N0BA 1UAAA 5D5WB 4EQQA 3W2WA 2H94A 2ZJQF 4G6DA 1WFXA 2EFNA 3K9TA 2NVXJ 2D1HA 1ETOA 4YELA 3E5UA 2VJJA 5DCMA 3TW6A 1QRYA 1XS9A 1D5YA 2AS5F 1F9NA 1ZRCA 2ZXIA 4F52A 3RZDJ 1XDUA 2R7OA 1TZLA 2HXIA 1S7AA 4ZDLA 3LNQA 2R7VA 2JPBA 3MN2A 5FRNA 4XR6A 4A0ZA 4ZH4F 1OR7A 2YU3A 3ABLH 3H5AA 4RM3A 3GTQJ 4P5OA 5J40A 2L02A 2K9NA 1S29A 3U2RA 5D4SA 5EDNA 1BOBA 3P7NA 1OYYA 4IHTA 5GAEJ 2RDPA 1ITYA 3FF5A 1BC8C 1OCCH 2FE3A 5K1YA 2L54A 1IXSB 3R0JA 2LG4A 3HHHA 2EIMH 1ZLKA 1Z77A 1VQ6I 3VDXA 3ZMUA 3BP8A 1SAUA 3KZZA 5KNLA 3CDHA 3S3MA 5F1JA 2YU9J 3ZXSA 2Y2ZA 3V8JA 1ZRDA 4IQJA 3RYPA 3R4KA 3WGIA 1P4XA 1UHSA 2H8WA 3CLOA 2OD5A 1TQMA 1X4PA 4NUBA 5BOXA 2ZFUA 4BHPA 1QU3A 2BGCA 2DA3A 1GLNA 1SFOJ 2DBBA 4DYQA 2XAQA 2KHMA 3DTKA 3M4OJ 4A3MJ 1JTXA 3BDDA 3GMEA 2VOOA 1I3QJ 4E4HA 3I54A 3CLQA 2KRFA 3BT9A 3N05A 3ZQLA 4AIHA 2ICWG 1UZCA 3KP4A 3GFLA 3JW4A 4LG3A 2WV1A 5KAFC 2EH3A 5CJ9A 1JT0A 3FMSA 1S7EA 1X3UA 1POGA 4HNVA 4BQQA 3D5SC 3DWLE 3JRCA 1ZGJA 1TW3A 3IAS2 5LRRA 3MCZA 5L3DA 4GDFA 2XV4S 2Z9OA 4OIRF 3Q0WA 2R5ZA 2VQCA 2V26A 1LJ9A 4LIUA 1WI9A 2IVMA 3H5RA 3J80K 1BL0A 3T0YA 1T2KA 5F0HA 3TOBA 4IHXA 2OZUA 2E2HJ 1BR2A 4CHUA 3O2PE 1GVJA 4KICA 1IN5A 2XPUA 1P6RA 1B72B 2HKXA 4KN7X 2PJRA 2ZMEB 1JKRC 3WU2C 5KCMA 1YRNA 4YFXF 4BQOA 2XAHA 3NAUA 4UNOA 4XL9A 2L2OA 3BJ6A 3HRMA 2Y31A 4B47A 1XMAA 4CCKA 2XAJA 3H35A 5B66C 5DD4A 1VQ8I 3OIPA 3OYIA 4AIDA 4EJVA 3P9KA 3TO6A 3IWFA 5HLIA 4XICA 2ELHA 4A0YA 4A12A 2FOWA 2PMUA 3HUGA 5LFAA 1I6XA 4ZC3A 4IRIA 2DT6A 3MQ0A 4U87A 2CV2A 1OJLA 4PJJA 1U5TC 3GZNB 1MBHA 2FNPA 3V42A 1T0FC 2DXIA 1DUXC 2ISZA 3OYCA 2V4JC 3BQZA 2R7FA 3HGYA 2VE8A 3DKYA 3PSIA 3OYBA 3CO7C 4P55A 5F1RA 5IT9Z 1DQUA 1IN6A 5M3MJ 1NTCA 1MKMA 1R5ID 4A5MA 3TKYA 2LSOA 3PFYA 2O03A 2GA1A 3FXRA 1MBJA 3MKWB 1R23A 2LP0A 1EKEA 3LSPA 4Y3OA 3T8RA 2QSHX 4BNCA 2KRHA 3GWZA 3AFHA 4XQFA 4YFKF 2P8TA 2XGXA 4A93J 2FU4A 2M8EA 2M7AA 3KCCA 4XRFA 5DV5A 2PEXA 4LFUA 3ZQFA 4M3FA 3R60A 3CCLI 1FY7A 4ZJZA 1MBGA 2F2EA 4ZYHA 3I55I 2W24A 1X2MA 1R4MB 2KJCA 1OFCX 2DCEA 3TP3A 2OPTA 2H8RA 5CVRA 4G7HF 3KX2A 2ETHA 1F36A 4HRIA 3S3NA 1DU6A 4DYRA 1HW1A 4KT6A 1IGNA 5F64A 2M3AA 2EFOA 3REOA 2DA1A 4ZYAA 3ASOH 3RKQA 3OOPA 3H3ZA 2HYFA 4I01A 4UVCA 5JHFA 3ECOA 2E1MC 2XDVA 1OQYA 3I58A 5B1BH 1T8IA 4XIDA 4AC0A 2JK3A 2LDUA 5FKLA 2CW7A 4BJ5C 3HZJA 3JTHA 2WAFA 4M9XA 2ZFWA 1LKXA 2IAIA 1ZARA 4XKCA 1BR4A 2KMUA 3K4KA 4NDLA 1IRFA 5HS8A 3I59A 1AKHB 4BE2A 3WHBA 5IYCJ 4J01A 2EZKA 1KYWA 1S6LA 5HOOA 3J80Z 3PJRA 1YQAA 1HW5A 3RDIA 2CRGA 2CYYA 3MD2A 4HNUA 1FZPB 2R7XA 5K7HA 2XAUA 3AG1H 3K1NA 3U21A 2IS4A 4AYBA 4N9HA 4ZDPA 4E70A 3GZ5A 5JLWA 4KFCA 1I1SA 2F5EA 4ZZDA 2X1EA 3PFIA 4HV6A 4DQ2A 4IVNA 3FX3A 4CUGA 3KLOA 3Q9SA 1GUUA 3K4JA 3O3KA 1BBYA 2EFQA 4HLYA 1VF9A 2XKPA 3HEFA 1I6HJ 2DYRH 1K6YA 4W97A 4BL0B 1PYVA 4M72A 1N25A 3LOCA 3GFJA 2GOMA 4HZFA 1FYKA 2PQ8A 5FROA 2XF5A 2AXLA 2JT1A 3DQVC 4A3CJ 1YJNI 1YI2I 1DDNA 3QRFF 1YHQI 1DU0A 1YW9A 2HKOA 3ZR8X 1PUEE 2WAEA 1OYIA 1AHDP 5AONA 3CJRB 3JSPA 2ELKA 3IKTA 3CC4I 4BH9A 5D4RA 2GBYA 4BDZA 2WAQA 1MNMC 1VI0A 1ETXA 2V7FA 3OL4A 2QEXI 1I27A 2DLLA 3RKYA 3GUDA 1SVOA 3VB2A 5LHHA 3ZPLA 5AIPA 1T98A 4QIWN 1IZ1A 1RESA 4BEHB 2L9RA 3DF8A 1JXSA 3CC2I 2R5YA 4NBQA 1OCPA 1DP7P 2XF7A 5EGOB 2W84A 2R7TA 4U88A 3ZOBA 2E7XA 2O9LA 1CGPA 1B9NA 3F8MA 3OMYA 4M74A 1HDDC 4DJAA 2QBYB 2FA5A 2H6BA 4XN0A 3HOSA 1MH4A 1ON1A 4OOIA 3Q0UA 3I9V2 4CYDA 2CGPA 1FBUA 3U9GA 4CZZA 1B9MA 3F9KA 1P9QC 3H9GA 2E2IJ 4JX5A 5FKOA 3MFKA 1ENHA 4G12A 1X19A 2XASA 4U0YA 2FBHA 3OYAA 3E6CC 2OBPA 3PO2J 4I99C 3HGGA 3L2VA 4XLHA 1X4OA 5E17F 3A02A 1YITI 3ZQIA 2R7ZJ 2BW3B 3GLLA 3FXOA 2AQFA 2CQNA 1RUOA 3H0DA 4BGDA 1B8IA 4OINF 4WK8F 1VQ5I 1JHFA 4ON0A 2O8XA 2F5DA 5E8IA 4BBRJ 3HRSA 4KDPA 2E60A 1JTYA 2XRNA 1ETYA 4DBRA 2IBDA 1KU7A 4XKBA 4FX0A 1K7AA 3FMRA 2MC4A 1W4MA 1E3OC 5DDGA 2KIQA 3BQYA 2HZTA 3BG6A 1K4SA 3PNYA 2DFEA 1WSUA 4LB6B 1P7IA 1B59A 3BG9A 4JX4A 1JKQC 4NNJA 1O3SA 1XSVA 4D1QA 5LHIA 3BG3A 1ZAOA 5K5OA 1BN5A 1D0ZA 4RGUA 3WTVC 3TGNA 4C2UA 2JZYA 1SD7A 1VQ7I 3IC7A 3PQJA 1IXRC 4XSXF 2KDOA 4HDUA 3K1MA 4U7DA 3LA3A 3HSRA 1A35A 3HXLA 4QPOA 4A0XA 3VYRB 2VT3A 1XB4A 1U5TB 4Q47A 3I53A 3O8GA 5CVVA 4CDGA 1UFMA 1Z3YA 4UV9A 1JE8A 1GVDA 2K02A 3IH3A 2NVTJ 3JAMK 3ZMVA 1WJCA 1HBXG 1R9TJ 4O3MA 1XDSA 2EQRA 2ZJRF 4KT5C 5HLGA 3HHGA 2HVSA 4CXFA 4IHYA 5ERIA 2LKXA 5LGNA 3ZRGA 3A01A 4BXFA 2ZSHB 2E2JJ 4XOPA 3TW7A 1X1CA 5KVRA 4B48A 4EATA 4M6VA 5FJ8J 4ANJA 1LDKB 5GTHC 4RA2A 3OSGA 2NNNA 4HBLA 2P5LC 1RR7A 3C2HA 4BAYA 5IOYA 2R4GA 3GFIA 3ZGKA 4UUVA 2EB7A 3HRTA 1H9TA 1WGXA 4BDYA 4ETSA 5ICGA 3EYYA 3AG4H 2BBYA 5J1RA 2XB5A 2NOJB 3GW2A 5E3OA 5D5XB 1YIOA 3M1EA 2VJIA 1DGWY 1WKMA 1WRJA 2NAZA 3GTPJ 1WH5A 3CP8A 1ACIA 1V54H 4HF0A 3TEDA 1KU9A 2IA0A 5K7FA 1SFXA 3NQOA 1XCBA 2LNBA 3K4NA 4LD5A 3SXYA 3S2HJ 3LA7A 3EPZA 5ILSA 3FXJA 4FCYA 5TRDA 4MEYF 4M73A 2NOGA 1UB9A 3CCYA 4OAYA 1F1ZA 2M8GX 2O61A 3L2WA 3Q9VA 1XCVA 2E1MB 3OWTA 1WJDA 1R22A 2MLGA 2ID6A 2F4OB 2G0EA 1KQ0A 2CUZA 4UB6C 3KYDB 3PQKA 2XPWA 5E1WA 4CA0A 3BC8A 4XRSA 1FSHA 4AD9A 3RTRA 3JTGA 2A07F 5TJJA 4XOTA 2K9LA 3CDIA 4JBAA 1QA6A 4LIVA 2LF8A 1C0WA 2KP6A 4P96A 4C3IJ 2LLKA 2RV8A 3ML6A 3E5QA 2X48A 4I09A 4DOZA 2IA2A 4HDVA 3TL4X 5D8LB 1OYWA 3UNGC 4B1RA 1F4KA 3AAFA 1R71A 3LWFA 5F27A 1FC3A 1VNDA 2M30A 2ZB9A 4I76A 1W5CC 2Z5UA 3MAJA 3N97A 1ZGWA 3W2AA 1TWCJ 1EV7A 1GV5A 4ZDOA 4Z2YA 2AQEA 1SVLA 3V4GA 4PZJA 1R1VA 4WXHA 2HTSA 3R61A 3ZQHA 2MG4A 1FNNA 5DTDA 2EV5A 1FBQA 3F23A 2OA4A 1I5ZA 3A0BC 2VJ4A 3JSOA 3U1DA 2PBIA 4DNCA 1YJWI 5GP9A 3CF5F 4OIOF 3FK7A 1U78A 3OYLA 3N4MA 1KONA 2DOAA 2JUGA 3T1BA 3HTSB 1JUMA 4II2A 3S2WA 1QZYA 2V6CA 2LKPA 2VN2A 3ONQA 4PCQA 5E3NA 4BUPA 5EYRA 3KZIC 1X58A 4GGGA 1U6GA 1VFCA 3HPHA 3IUOA 2B0LA 3KP6A 3G4SI 1SMYF 4IF4A 1UJ8A 2OJED 2PFBA 3W3CA 1HC8A 2V9VA 1LE8B 3QYEA 2IJLA 3I56I 2O8KA 2OU2A 1TQIA 3HOVJ 1I39A 2I5UA 1FP2A 4DIQA 1KQ8A 3GX4X 1Z7LA 2HQAA 2HTJA 2KIFA 1MIJA 3WGHA 4EGYA 1BW6A 1VQNI 4L9TA 2EILH 4BU2A 2KISA 1H88C 5E79C 1O57A 5GPCA 1ZG5A 3E97A 1U0JA 1W7PA 1JI8A 2HEOA 4M3DA 1S72I 1ZQ3P 4LLNA 4Y33A 1YIJI 2E1OA 4BACA 5FB2A 1XC5A 4M3EA 3Q3SA 5DS9A 2STWA 5AIQA 4PFOA 4EMSA 4A6DA 1CF7A 3GEZA 1F43A 4IPAA 2BYVE 2IA1A 3LSTA 4HG2A 2G7UA 4B43A 2L0KA 4A3EJ 4RGXA 2HPIA 4LG0A 4OWRB 2FOKA 4S04A 4U7BA 2QF7A 3HM5A 4X0GA 4BE0A 1Z67A 3B6AA 2DT5A 2JQ7A 5DYMA 4HV5A 3ZMZA 2XHKA 3SZPA 3IRRA 1JHHA 3BZKA 2OCCH 2MD5A 2CW0F 3NARA 2NXNB 3QOPA 3RQIA 2IS6A 3G1MA 2PX9A 5IYBJ 2LBFA 1VQKI 3OYDA 2LRDA 2GAUA 1QO0D 1SFKA 5ICEA 1OMIA 4IHVA 3ABKH 2E5NA 2P7VB 1RPWA 4BXUA 4F55A 2HDWA 2QCOA 3E1SA 4E7ZA 3UKGA 2B7EA 3DPUA 5HNHA 1KYZA 4P9UA 2ELJA 1HOMA 5EF6A 5DCMB 1BI0A 2ZXWH 4LITA 2MBFA 4K2EA 5ED4A 4LMYA 1D1CA 2JN6A 3BTCA 2ZJ2A 4Y7NJ 4RBOA 2IW5A 2K85A 3PUBA 2V6EA 2WB1A 2WWYA 1MBKA 3SQNA 1B1BA 1JJ6C 4DBQA 4RAFA 2DMTA 1R58A 1JT6A 5JVGF 4OIQF 4NHJA 2DA7A 3G3ZA 1HSTA 1UCRA 1RETA 2MFZA 4CYCB 1HSJA 2ESNA 1XSDA 2QQAA 2DOEA 4ESFA 1G3TA 4N4OB 3IH2A 1RC9A 1PVEA 4G8XA 1U9OA 2MGQA 3EUAA 4UVBA 1TNSA 2VJ5A 1WPKA 4HA8A 1YS7A 2IXSA 3VPRA 5FLXZ 4PJMA 2FD5A 3COAC 1T33A 2JSPA 4UV8A 4XKWA 3ZQQA 5M5YJ 3FXQA 3RPQA 2GLOA 2FEZA 1QHGA 3W6KB 2DQLA 2RREA 1P2FA 4YIRX 3PSFA 1OCRH 2NYXA 2BY0A 2XGCA 1AOYA 1R5GA 1WJEA 1Y0UA 1D0YA 4HSRA 5HS9A 3BG5A 5FD6A 2XVCA 3B02A 2A5YB 4FHTA 4A3FJ 1UMQA 3HOUJ 3CESA 2OV7A 3FBIB 2K9MA 2VQHA 1EH6A 2A6EF 5LBQA 4UUSB 5FLMJ 4BXXJ 3CUQA 2DMPA 2YX4A 3IP4B 4IO9F 3HOYJ 1Y1VJ 2ZNYA 4RS8A 4A3LJ 2X9DA 2KT0A 4HQMA 1GHCA 4RAYA 2HWVA 3RIRA 1W0TA 1ULYA 4XMYA 1ZG3A 5CVUA 4L18B 2DN0A 2R5ZB 2N8GA 4DW6A 1XGMA 2DK5A 2JRTA 1ETQA 1VQOI 5EJCA 2DT7B 5JFRA 3WTTC 5JI6A 4L5IA 4E7HA 1H8AC 3FKIJ 3MKZA 4MQVA 1ZRFA 4YFNF 2Q0OA 1WWXA 5CQEA 3K4LA 1K6OA 1V5EA 1E3HA 3M9AA 2UWMA 3HOZJ 2FQ4A 2XGDA 1TQPA 2ZC2A 2A6TA 1RKTA 3GBGA 3PIOF 1LB2A 1FOXA 2P0WA 1D1AA 2QVOA 1YFHA 2UXNA 2W82A 1K83J 2VASA 1B72A 1FX7A 1RZ4A 2ZMEA 5FGMA 3GTGJ 3H5NA 3FDYA 4LLLA 3OYEA 4HEA2 3WE2A 1HW2A 4XLCA 4XLFA 4AU7A 5CKTA 1Y39A 2A68F 3HUGB 1LNWA 3P9CA 3RPUD 4XRSG 4MQ9F 3EDPA 3D5RC 1TTYA 3J7AO 2V9KA 2VPRA 2M9HA 1IDZA 1I50J 4P1WA 5C4XJ 3JRHA 5J6XA 2DA5A 2OTJI 1YO5C 2BY3A 2QUFA 1G3WA 3DEEA 3CCSI 2DMNA 2HS5A 1RI7A 1S3JA 2OQGA 2VT2A 2X4HA 4PJ0C 2J5PA 3K2ZA 5J4VA 1S9HA 1NH3A 1BR1A 2BOLA 3GTOJ 5EZGA 3M07A 3FM3A 1B6AA 3CUOA 2ZXJA 4JOMA 1IN4A 5J1YA 4RB1A 3F72A 1KA8A 2ZSIB 5CPRB 1HKTA 3HYIA 1UHWA 1BIBA 3ZP5A 3OYNA 3DU5A 2Z16A 2JWTA 2OUMA 3BCAA 3EUKL 2GIZA 3WTSC 5K7ZA 2JA5J 3I71A 2UXXA 2OZ6A 2QZ8A 4BY1J 2K9QA 3WE3A 3TOAA 5DD8A 1TWGJ 1TT5B 1T08B 2PMZA 4BHCA 4PSXA 5F08A 1SAXA 1D5VA 2CQXA 1YS6A 2WC2A 1R1UA 1WQ2A 5ICCA 1ZYRF 2P7CB 3L7WA 2CQQA 1GV2A 3DKXA 3HL2A 2HYJA 2M5WA 3K4BA 2MA3A 3RYRA 1X1BA 3VFZA 2A05A 3OYKA 2Q2EA 4MGRA 3O6BB 4AIKA 3FK6A 4R79A 2X6XA 3QPTA 1Y1WJ 2PLYA 1Z1DA 1UELB 1A04A 3F6OA 4LB5A 1T39A 5KAIC 3HJEA 2ACJA 1AU7A 4GFBA 3FMQA 2VL8A 2ZNZA 1FOKA 1Y8RB 1XX5A 3I4MJ 4KISA 4M71A 1QPMA 2KQRA 1UG2A 2Y69H 4LOCA 2NVUB 1U8RA 1STZA 2M4GA 2KDZA 3VEPA 3S1MJ 1LFBA 2CSOA 1J2XA 1Z9CA 2RAEA 4P9FA 2Z99A 3QYFA 3RKXA 5KK1A 1Z0XA 3A1YA 4CCJA 4RGRA 5KHDA 1FWZA 4BE1A 3VOEA 4NC7A 3I59B 1X2NA 3K10A 2IGMA 3ZMSA 1O7LA 3LL7A 4UB8C 2H27A 5F0CA 3E6MA 4IZZA 3EYIA 5L3GA 4XLPF 2W1OA 4MHGA 5CVJA 1AKHA 3H3UA 1ODDA 1LVAA 2K27A 1APLC 2DPUA 2QQ8A 3J81K 3KEQA 4ITVA 4A3JJ 2IRFG 2EIJH 4I98B 3X2QH 4NQWB 4XSZF 3CCJI 2VQGA 2ADUA 3I5UA 3PNTA 2DJNA 3BG7A 2CWEA 4M9SA 2K9SA 1IV6A 4Q5SF 3H9JA 1J9IA 3OYMA 3ERED 2VKHA 4WX9A 3SYTA 3F8FA 5H2FC 5J47A 3F3XA 1WHUA 2K3PA 4QSHA 4V2FA 2JSCA 2O5RA 2DTRA 1T56A 2KIUA 3QP6A 4BY7J 1D8JA 2E35A 3HBLA 1MBFA 1RUNA 4Y13A 3OY9A 1MJBA 2IP2A 3BJAA 1PJRA 2ESHA 3KEYA 5DUIA 1IN8A 2LC2A 2JMWA 3K69A 3W6VA 2KFDA 4ENMA 3BOQA 3KE2A 2X1CA 3H3VK 3BR3A 2UV1A 1V4RA 2FUG2 2EZIA 3QU3A 2YSRA 4ZZLA 2COMA 3PIPF 4IRHA 4D7MA 4HX7A 3CZ6A 1ZH5A 2K5CA 1FT9A 2O3FA 3CMMA 2WADA 2K7LA 2W57A 3DTIA 3GYHX 4HNTA 1PDNC 1FYMA 4IHSA 1YW7A 2R92J 2LMDA 2B63J 2Q8KA 2R7SA 1I1GA 2RNGA 3WU1B 4RB3C 1IRZA 4I7HA 2P6TA 4C2MJ 4HF2A 4PSWA 1PUFB 1W1WE 2YS9A 4BEHA 2HDDA 4JQFA 1HQCA 3IKVA 3PO3J 5EGOA 5BMZA 2L01A 1GT0C 2HI3A 1A6QA 2H1LA 2RVCA 2LY1A 2A61A 4V19K 3M8JA 3I3LA 1VQ4I 1SD6A 1NK3P 4KA4A 3BCBA 2KLOA 2X6WA 3S1NJ 3OYHA 3VYSB 4AVPA 4JK1X 2OAZA 2KIMA 1XGSA 4R8HA 1ZHFA 2OCEA 3MVPA 3MZYA 2H6CA 2G9WA 1PP8F 1I3AA 3CCEI 1EJ9A 5BQTA 3H1CA 4X1EA 1MW7A 2BW3A 5FFXA 1MD0A 3NWTA 3KLNA 4FASD 1JGSA 1RNLA 2R93J 4L0ZB 4L9JA 1E17A 3AG3H 4L9NA 2VQLA 1NG7A 3DP7A 4II3A 2JA6J 2BXYA 1A31A 4RB0A 3DEUA 4AIJA 1R4NB 2KZVA 2R7RA 5EG0B 4Y52J 5FKKA 1TNTA 2W85A 2GM4A 3C7JA 3S16J 1Z7UA 4FQGA 2KKOA 4O5VA 4A3IJ 2DU9A 4JX6A 5TGTA 2CG4A 5H20A 1OR7C 3E6DA 1TT0A 2M87A 2CW8A 2HFHA 4GRIA 4DYCA 1IC8A 2HPMA 2JRMA 2F5VA 1IRGA 1H9GA 1FIPA 3KYLA 2FXAA 5CYVA 1U3EM 3ERMA 4XLAA 2XGEA 5IP7J 2GIVA 1MMSA 2RKHA 2DFFA 3RCOA 3L09A 3VSLA 1T0FA 2V1XA 2MW8A 3BPXA 5A2QK 4E7KA 4QWQA 1YE9A 3DKWA 2GOXB 2BXZA 5DCFA 2F5FA 2M0MA 2VBXA 5HVQC 3Q5FA 4A3DJ 1IUFA 2QENA 1LQ1A 3BR1A 4G7OF 2CV1A 4A3BJ 1GXQA 2W4SA 2ZKZA 4CCOA 1A5JA 2DK8A 2IS1A 4F91B 4WWCA 2XAGA 1Z91A 2JUCA 1IDYA 3MWMA 4EM2A 4BQNA 5L3BA 3ABMH 5ILUA 5D6EA 1IF1A 2K3FA 3G1OA 1J7KA 1MMDA 4EJTA 2E71A 4CH7A 3JRIA 4L9VA 5LLQA 2ZBKA 3IWZA 2CFXA 4HX4A 5FD5A 4DZPA 5J4YA 1MDMB 2JVHA 2VBYA 3U1KA 4HYEA 1F5TA 5JR3A 2W7NA 2HQ5A 3TDZC 3WTZA 2XSJC 1ZGAA 3M1CA 3GVAA 1Z05A 4B4CA 3CUQC 1E0EA 1ETKA 2FMYA 1LEAA 3WGGA 3V8KA 2DPDA 4MIMA 3CMAI 2CUJA 3T8TA 4FT8A 4UVAA 1FLIA 1J0RA 5LGTA 1EH7A 4PJNA 5BPDA 2BVMA 2LKSA 1WVRA 3BZ6A 3TO7A 1K4TA 3WG7H 9ANTA 3FXMA 3CQZJ 4Y15A 1FTTA 3BTLA 2VKVA 2QKMB 3CDLA 2LH9A 4WF2A 5IT3A 3HIFA 5DUKA 4CO8A 1FOWA 2L5QA 4C3JJ 3F8BA 5D5UB 5EEGA 3IL2A 2WY7Q 3GTJJ 4AM3A 2CUEA 1NG6A 4D5FA 3K2AA 3S17J 4HW0A 4F93B 3FXUA 1T6SA 4L5EA 3TO9A 1S8NA 3E0JB 4BYYA 4ESBA 2HOSA 3ZCOA 5IP9J 2VONA 3QODA 1T95A 3ISPA 3HB9A 1UHMA 2D1VA 2OC6A 3BTIA 1YW8A 3CTAA 3PUFA 2L4MA 3CCMI 4ENKA 3S1QJ 5GADJ 1ETVA 1VTNC 3KP5A 2IS2A 2DW4A 4S0HB 4I6ZA 3A2KA 3CMEI 4FISA 4N4NB 1K61A 5IYDJ 3LFKA 4CGZA 4IEJA 2LY2A 2NS7A 3NRVA 3CMYA 4I2OA 2R7DA 4X6AJ 3K70C 1FOYA 2HOAA 3JAMZ 2E7WA 3BTJA 4L0YB 4XK4A 3BJOA 2J5OA 1U8BA 3KP2A 2VIXA 1WZ2A 2PN6A 1QGPA 2L9VA 1CQTA 3AL0C 2JA7J 1V55H 3BROA 1DPUA 5GAGJ 3QYBA 5HODA 1P4AA 1BC7C 2VBWA 1SC7A 5JHUA 1OCOH 4U0WA 2CH0A 3M7GA 1SFEA 4B09A 1DPRA 2XAFA 5GTIC 3HOWJ 2MD0A 2X6OA 1W5TA 1ZKGA 4HLXA 3OIOA 3DEWA 2BZTA 1Z6TA 3LQQA 2GZWA 4KYWA 3GFMA 3AKZA 4LK0F 3VYUB 3L00A 4A6EA 4AWXB 1OKRA 2TRTA 4YIIA 4OU0A 1K78B 3ELKA 2LD5A 3H92A 1W7PB 2O7OA 5H6RA 2MC3A 4OMYA 2HVRA 2L9NA 4C9YA 5M3FJ 3SDGA 3WTYC 1IN7A 2LF7A 1CF7B 4M3BA 2A5WA 1D1BA 1G4DA 1JUSA 1W7PD 4XONA 3ZN1A 2K86A 1LFPA 2L7FP 1KU2A 4E7SA 1H0MA 1J5YA 4HPQA 2GXGA 3RI4A 4ENNA 5E20A 4E6KG 2Y9YA 4N9IA 2ID3A 4KIGA 2KPMA 3BPVA 4A3GJ 3WODF 3DLAA 3D5LA 1N77A 1BJZA 3O8HA 3V8LA 2WV0A 3W2VA 2XC7A 1VQPI 4XRMA 2VE9A 2Z2SB 2DAOA 1LPQA 2TDXA 4MFDA 3TQNA 2CQKA 2LBFB 3VODA 3VSKA 2CMPA 4KJZA 4ZYGA 3CP2A 1ZK8A 1ZREA 3L2RA 2XB0X 2VLAA 2GWRA 1FBSA 1R6RA 1FSEA 1W36C 1Y6IA 2FBKA 2EBIA 4LLGF 3BR6A 4CZCA 1P7JA 3KEOA 4GYGA 5EEHA 3F21A 5B1AH 3QAHA 2CFOA 3HPGA 2XROA 2LR8A 1MGTA 1ZTRA 1SFUA 2WTEA 5LEJA 2ECBA 5GAHJ 2HZDA 4EGZA 2MABA 1ORKA 3S93A 4I0AA 5IOZA 3S15J 4DZJA 5HLTA 2W25A 2R7QA 2FSWA 1VQMI 1EF4A 2L7MP 3F8NA 2DDBA 4CSWA 4IKFA 4FE4A 2NVQJ 5IT9K 1ZR2A 3LAPA 5B5EC 5JVTA 4HQEA 3DXJF 3SFIA 2EFPA 3GTLJ 5K5RA 1RRJA 2PI0A 1MMAA 4BBSJ 5C3EJ 1IG7A 2AO9A 2FQ3A 3JCUC 2TCTA 3HSEA 2ME0A 1HA8A 1XD7A 2LVSA 2YPRA 4CYCA 3DBRB 2STTA 1XGOA 4XKVA 3ZMTA 4KIFA 4EV0A 1MMNA 2EK5A 3KIOA 4HAMA 2VODA 1Y56A 2DOFA 2X85A 4JP0A 4OAZA 2BHYA 2G7HA 2FJ1A 1JKPC 2UZKA 1D0XA 2M0CA 2P4WA 3OOUA 2NS0A 3H0GJ 3RZOJ 3SZTA 1O7FA 3LA2A 5HDGA 3W6JB 1IO2A 2Y48A 2DMUA 2EINH 3JRGA 4E7LA 2M1BA 3QPLA 1XMXA 3M3YJ 1GXPA 2I8DA 3IH4A 4J00A 1SVMA 2HQRA 1UG0A 1R00A 1O3TA 1BIAA 3ROUA 1XMKA 3CUQB 3JREA 2ME6A 4RLFA 2V9PA 4B44A 1LUJB 2V1UA 5HLHA 5EZHA 1J59A 2RC4A 3I4PA 1TL8A 3EUHA 1YX5A 1Z21A 4UUSA 1BI3A 2GQQA 2Z3YA 5ILVA 5DM6F 4MTEA 1OPCA 1R36A 4Q48A 4XLEA 3QU6A 1LDJA 3SDBA 2PJRB 3OR2C 3BR5A 3K4MA 3OYFA 2R0QC 1WCMJ 5LD2C 1XSXA 1YRNB 1LVKA 2JVGA 3LSKA 2K4JA 1ERDA 3V7SA 2QWWA 1MNEA 2GA2A 3NWSA 1AWCA 1Z6RA 3ZQGA 1RKWA 2BVLA 1G2HA 3FISA 2HXOA 1XG1A 3E3VA 3CCQI 1HXDA 2W00A 3RPUA 1LFUP 4C3HJ 1BI1A 2WY8Q 5GPAA 4ENJA 3Q0VA 3WTUC 1BOAA 3HOTA 2LK2A 5D6FA 3CF2A 1TBXA 1MJ9A 1WJAA 2GXAA 3G6EI 4RDUA 4CCMA 3LSRA 3HKZN 3FXKA 2Z33A 2CS3A 3OS0A 1E3PA 4RM2A 4TV7A 3L1PA 4RAZA 2D2WA 2EZHA 1QHHD 2QM3A 1JUPA 1X3WB 1FPQA 4BHBA 1R1TA 2MLKA 3IHUA 4I02A 5LHGA 1HDPA 2FNAA 2XSDC 2L7KA 2ECCA 3F6VA 1USSA 1VQ9I 2CO5A 1SD5A 4GCVA 2HDCA 1J09A 3AL0B 4A3KJ 1ON2A 2W48A 1GDTA 4XN3A 4M9ZA 3K70D 3WTWC 4B8XA 2ZJPF 4LGWA 5JLXA 2P5VA 3C1DA 2L9SA 3TBIA 4PFPA 4E7JA 3FKJA 3M8FA 1L3LA 1Q1VA 2XF6A 2QGUA 3CCRI 2B9SA 1DP3A 4D9JA 2Q2EB 4KITB 2IGNA 4OIPF 1BI2A 4BJTA 5E1ZB 4IQ4A 3P5JA 3QOEA 2V79A 5CLSA 3A4CA 2EA4A 2DA6A 2LOOA 1LEBA 1FMVA 3CO6C 4BQAA 4I0BA 3OS1A 1O3RA 4A2UA 3SEZA 1KQ9A 3E6BA 3L2UA 2RN7A 2XUBA 2EJRA 3FHZA 4IX7A 4G7ZF 1TWAJ 1P4WA 3RKWA 3LSJA 5DM7F 2Y0SN 4IXAA 5L3CA 2EFWA 4B3XA 1T38A 4WXCA 5L3FA 3ULQB 4FX4A 4J19A 4ZTFA 3V7RA 4YRVA 2LFBA 1S7OA 5D8KB 3SEQA 1HLVA 1OLTA 1QVUA 1EA3A 4W1UA 2AHQA 1PP7U 5IY5H 1W0UA 1TLHB 5LEKA 1M1EB 3CJQB 2X1DA 1KZHA 5J8FA 4F7ZA 4Q4ZF 2UUZA 4QPQA 4R1HA 1ETWA 1X3ZB 2Q1ZB 1WJ5A 3LSMA 5HS7A 3JRBA 2VUMJ 1QZEA 2QSGX 1FJLA 2IPQX 3PL8A 1O3QA 3DPTA 2LYCA 1D3YA 2EIKH 2DFIA 3AG2H 1J75A 1KGSA 4NQWA 3LAJA 1SMTA 2P81A 3J7ZI 4ZYDA 4UHTA 5J8CA 1W36D 2L3DA 2VC0A 2BY2A 3B6CA 3I4NJ 3ASNH 3HDDA 3H36A 3L2CA 2CU7A 2E1CA 2M4KA 2QQBA 2D45A 2WB1N 5F6FA 3G73A 3LFUA 5L3EA 1MSFC 3MZHA 2FBIA 2L4AA 3BLYA 1D8KA 4HF1A 2E19A 3BZCA 4EJWA 5F0FA 3DFGA 3KP7A 1OISA 3DU6A 3K7AJ 2V1NA 3GTMJ 5K5QA 3MMYB 2JA2A 2PMHA 2P5KA 1BA5A 2LTPA 2R5YB 3M8EA 2QA4I 2DA4A 2KL4A 3PNVA 1B4AA
chains in the Genus database with same CATH topology
1T0FC 2DXIA 1SFKA 3L2QA 2E5NA 3J7AY 3OYCA 1YX3A 2V4JC 4PJNA 3UR3C 1AA7A 3DKYA 3PSIA 2BVMA 4F55A 3OYBA 2HDWA 1DQUA 3E1SA 4E7ZA 5FRMA 3DPUA 5HNHA 4PJLA 2ELJA 2QKMB 3PFYA 2LH9A 4YEJA 4LITA 3MKWB 2L5QA 4Y3OA 2WY7Q 2KRHA 2CV0A 3AFHA 4XQFA 1D1CA 3OR1C 1NG6A 3PUBA 2V6EA 2WB1A 4F93B 2M7AA 4E7IA 1FMWA 3TMOA 4DBQA 3E0JB 4HSTA 4ZJZA 3ZCOA 2MFZA 3QODA 1T95A 2HVQA 4AVZA 2OC6A 3K6GA 2DCEA 3VYTB 4N4OB 2IS2A 3KX2A 4HRIA 3A2KA 3EUAA 2VJ5A 3S3NA 4N4NB 4Y4RA 2X51A 2IXSA 4KT6A 2M3AA 4PJMA 4ZYAA 2JSPA 2LY2A 4XKWA 5JHFA 3ZQQA 4BJ6C 1WJFA 1QHGA 2E1MC 2XDVA 3K70C 1V5GA 2RREA 2CW7A 3PSFA 4BJ5C 1G8XA 2WAFA 2VIXA 1LKXA 3AL0C 1WJEA 4XKCA 1BR4A 2KMUA 1D0YA 4HSRA 3K4KA 3QYBA 1DGRM 4XORA 3CESA 4BE2A 2OV7A 3FBIB 2K9MA 2VQHA 4J01A 2CH0A 3SZGA 5HOOA 3PJRA 4HNUA 3MD2A 3VWBA 2R7XA 2MD0A 3IP4B 4CCNA 2XAUA 2VXZA 3U21A 2IS4A 4AYBA 4ZDPA 5CQGA 2X1EA 3AKZA 4RLQA 4XMYA 3OYJA 3VYUB 4CUGA 4F3QA 2DT7B 3K4JA 3C2GA 3PNVA 3S8PA 4E7HA 3MKZA 2HVRA 1K6YA 2L9NA 4RMNA 2WBMA 4C9YA 4BL0B 1PYVA 5CQEA 3K4LA 2VPLA 1V5EA 2GOMA 2UWMA 3H9QA 2A5WA 1D1BA 1VZ0A 2A6TA 2HNHA 3GBGA 5FROA 3S3OA 4XONA 1LFPA 2P0WA 1D1AA 4E7SA 2XF5A 4HPQA 3OIQA 2W82A 2VASA 3DQVC 4E6KG 2MYSA 3OS2A 2KPMA 3ZR8X 3H5NA 3FDYA 2WAEA 3DLAA 4HEA2 3OYEA 4XLCA 3D5LA 4MLOA 4XLFA 3CJRB 4AU7A 5CKTA 1N77A 3W2VA 4F92B 3HUGB 2XC7A 3RPUD 1Z3XA 2DJIA 2Z2SB 3D5RC 3G2BA 4BDZA 2WAQA 2V7FA 2V9KA 3OL4A 2VXDA 4XNFA 2LBFB 3HG9A 4P1WA 3VSKA 2CMPA 4KJZA 3EUHC 3DEEA 3CP2A 4PUSA 3L2RA 2VB6A 2VLAA 4ZTJA 4BEHB 3LSIA 1S9HA 1BR1A 1R6RA 1W36C 2BOLA 4DGWB 2XF7A 1Y6IA 2KRCA 2R7TA 4CZCA 2IGKA 3LSHA 4JOMA 3OMYA 4DJAA 2CFOA 3HPGA 4XN0A 2ZSIB 5CPRB 3HOSA 1X1AA 3I9V2 2WA0A 3OYNA 2HZDA 3DU5A 2MABA 2Z16A 3F9KA 3H9GA 1P9QC 2OUMA 3BCAA 3OL3A 3EUKL 3S93A 5HLTA 2R7QA 1X19A 3OYAA 2PMZA 4PSXA 3L2VA 4CSWA 4XLHA 1X4OA 3MKYB 4IKFA 2F4IA 2BW3B 2LREA 3DKXA 3HL2A 2AQFA 1V5FA 3K4BA 3H0DA 4BGDA 1MMAA 1X1BA 3OYKA 4C30A 4R79A 1HA8A 2X6XA 2E60A 5HNFA 4DBRA 4XKVA 4XKBA 1MMNA 1UELB 2MC4A 1G59A 4C2TA 3BG6A 1Y56A 3PNYA 2R7WA 4BS9A 4FETA 2VL8A 2X6YA 3HC7A 2X85A 4OAZA 3HKZA 4NNJA 4KISA 1X1DA 2KQRA 4D1QA 3LMMA 3IAM2 1D0XA 2M4GA 3OOUA 1D0ZA 4NC8A 4C2UA 1ZELA 3QYFA 4CCJA 3A1YA 4E7LA 5KHDA 2KDOA 3RSNA 4BE1A 4NC7A 2I8DA 3K10A 2IGMA 2HU9A 4J00A 3LL7A 3HXLA 1UG0A 3DTEA 4QPOA 4IZZA 3VYRB 4RLFA 1N78A 2W1OA 4B44A 3OYGA 1Z3YA 1YX5A 1Z21A 1WJCA 4CCLA 3OYDA 4ITVA 1N75A 4NQWB 2VQGA 2HVSA 3PNTA 3BG7A 3S32A 3FHNA 4XLEA 3H9JA 3SDBA 3ZRGA 2PJRB 3OR2C 3OYMA 4BXFA 2VKHA 2Z1DA 2ZSHB 3K4MA 3SYTA 2CUJA 2VKDA 4XOPA 1X1CA 3OYFA 4B48A 2RQQA 3DPLC 4EATA 5LD2C 4ANJA 1LDKB 2K3PA 1LVKA 2JVGA 3LSKA 2O5RA 3C2HA 3FBNB 2R4GA 4PK4A 3ZGKA 1MNDA 1ERDA 4BDYA 1MNEA 3NWSA 1WJBA 4G6TB 3OY9A 4H4KC 2BVLA 1PJRA 3KEYA 2LC2A 2QKLB 2W00A 2Y0SA 2NOJB 2X1CA 2UV1A 2FUG2 3V42A 2VJIA 1DGWY 2WY8Q 3CP8A 3CZ6A 3HOTA 3CF2A 3RQ4A 2IGOA 3K4NA 2K5CA 1WJAA 2R7UA 2M7BA 1MMGA 3CMMA 3K4CA 4CCMA 3LSGA 3EPZA 1IRXA 2F6CA 2WADA 2E5ZA 2ZXHA 3DTIA 2CS3A 3OS0A 4RM2A 4HNTA 4OAYA 4XM3A 1QHHD 2R7SA 3L2WA 1UAAA 2E1MB 2RNGA 3OWTA 1WJDA 3W2WA 1WFXA 2CUZA 4CA0A 4PSWA 2L7KA 3BC8A 4BEHA 4JQFA 4YELA 3RTRA 2VJJA 1J09A 3AL0B 4XOTA 2K9LA 2LY1A 2ZXIA 4XN3A 4F52A 3M8JA 4LIVA 3K70D 3I3LA 2KP6A 2R7OA 1TZLA 4ZDLA 2R7VA 3BCBA 4DOZA 5FRNA 2KLOA 3TL4X 4XR6A 2L9SA 2X6WA 3UNGC 3OYHA 3TBIA 3VYSB 4PFPA 4E7JA 3FKJA 3H5AA 2XF6A 4RM3A 4P5OA 1BOBA 1DP3A 4D9JA 2Q2EB 3W2AA 4KITB 2IGNA 2LG4A 4ZDOA 1MW7A 2BW3A 2AQEA 4BJTA 3VDXA 4IQ4A 3NWTA 3QOEA 4FASD 1SAUA 5KNLA 3S3MA 3A4CA 2LOOA 3ZXSA 1FMVA 4IQJA 2VQLA 1NG7A 3OS1A 4II3A 2VJ4A 3SEZA 3L2UA 4NUBA 1X4PA 4IX7A 2KZVA 2ZFUA 2R7RA 1QU3A 3OYLA 1KONA 2DOAA 2JUGA 4B3XA 1GLNA 4II2A 5TGTA 2KHMA 3DTKA 4ZTFA 4YRVA 4E4HA 3SEQA 3ONQA 1OR7C 4BUPA 1OLTA 1EA3A 1TT0A 3N05A 3HPHA 3IUOA 2CW8A 4GRIA 2HPMA 4LG3A 2F5VA 3CJQB 2X1DA 3KYLA 3W3CA 3QYEA 4XLAA 2UUZA 4QPQA 4BQQA 3D5SC 3DWLE 2Q1ZB 4DIQA 3IAS2 1Z7LA 1WJ5A 3LSMA 2HQAA 3RCOA 3VSLA 2VQCA 2V26A 3PL8A 4E7KA 1YE9A 4LIUA 2GOXB 2M0MA 3DPTA 4BU2A 3H5RA 2LYCA 5HVQC 1U0JA 1JI8A 2CV1A 4Y33A 2W4SA 1BR2A 4CCOA 4BACA 1W36D 2IS1A 4PFOA 4F91B 2PJRA 2M4KA 5KCMA 4BQNA 4BQOA 3LFUA 4XL9A 2L2OA 4HG2A 4B47A 4CCKA 4B43A 3H35A 1MMDA 2HPIA 3BLYA 3OIPA 4CH7A 3OYIA 4OWRB 4U7BA 4X0GA 4BE0A 2JVHA 3DU6A 2V1NA 2W7NA 2XSJC 3M1CA 5LFAA 4ZC3A 3MMYB 2JA2A 2DT6A 4U87A 2IS6A 2CV2A 1E0EA 4PJJA 2LBFA 2KL4A 2LRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7K A; 
#chains in the Genus database with same CATH topology
 1FIA A;  2E34 A;  3KYC B;  3L2Q A;  1REP C;  2OTL I;  1UST A;  3R0A A;  4EEF G;  3J7A Y;  1YX3 A;  2EV0 A;  2VC1 A;  3GF2 A;  4WXD A;  2DFH A;  3F0C A;  3GCM A;  3UR3 C;  4A5N A;  1AA7 A;  2YUS A;  2COB A;  3RJP A;  3ZN0 A;  4D7N A;  4IRG A;  3IV5 A;  3FWE A;  4B3A A;  3S2D J;  5FRM A;  4D5C A;  4PJL A;  1A6I A;  1U2W A;  2DA2 A;  3WG9 A;  2QBY A;  4MTD A;  4KMF A;  4YEJ A;  2DYS H;  1QZZ A;  1V3F A;  3SFZ A;  1XPX A;  1PUF A;  2CV0 A;  3OR1 C;  2K4B A;  3LQR A;  3PM1 A;  3JR9 A;  4IL6 C;  2NRA C;  1TWF J;  1Y8Q B;  4ZYE A;  4UUT A;  2ZCW A;  1B8I B;  3K0L A;  4E7I A;  1FMW A;  3TMO A;  5BS6 A;  2E36 A;  1X1P A;  5E3M A;  3HSF A;  1FEX A;  4HST A;  1RIO H;  4H0E A;  3J7Y J;  3GTK J;  3WTX C;  2HVQ A;  4AVZ A;  3K6G A;  4QLC U;  2M34 A;  3FXL A;  1OCT C;  4KIB A;  2XKO A;  1QQI A;  2CJJ A;  2K40 A;  3VYT B;  4KUM A;  2E1N A;  3FM5 A;  2AXT C;  3MZ8 A;  4RAG A;  4Y4R A;  5BPI A;  2X51 A;  3F22 A;  1QNT A;  3BR2 A;  2HOE A;  4NB5 A;  4MEX F;  4JYK A;  3G71 I;  1JKO C;  2A3S A;  3JRD A;  4BJ6 C;  1FTZ A;  1WJF A;  5ICF A;  5E1X A;  1E2X A;  1NK2 P;  4G6Q A;  1V5G A;  4EM1 A;  3J81 Z;  3QP5 A;  3R6S A;  1G8X A;  3G1L A;  1RR8 C;  1JJ8 C;  1R5H A;  3FIW A;  5EG0 A;  3ABU A;  1ZLJ A;  5TIS C;  1DGR M;  1YOV B;  5M5X J;  3EQL F;  4XOR A;  4MFE A;  1ZG1 A;  2QLZ A;  3CCU I;  3TP0 A;  3SZG A;  1ZN2 A;  2FF4 A;  2LY9 A;  2BV6 A;  1BM9 A;  3VWB A;  1ONV A;  4CCN A;  1U5T A;  1HKQ A;  2VXZ A;  4BKX A;  5D5V B;  2I10 A;  2Y30 A;  3ECH A;  5LGU A;  2H1K A;  5CQG A;  3A01 B;  4RLQ A;  1R49 A;  2RNJ A;  4ASN A;  3OYJ A;  1R7J A;  2DO7 A;  2NS8 A;  3P9I A;  1HKS A;  3TDU C;  4RGS A;  4EM0 B;  1NHA A;  3BR0 A;  4O6J A;  4WCG A;  4KN4 X;  2YX7 A;  4IOC F;  4F3Q A;  3C2G A;  3B73 A;  3S8P A;  1QBJ A;  2HR3 A;  4V2G A;  2HGC A;  4GYI A;  1O4X A;  2VBZ A;  1MJA A;  4UXN A;  2JJ7 A;  1TC3 C;  3HTU A;  4RMN A;  2WBM A;  1VQL I;  1S5L C;  2VPL A;  1TW2 A;  2F5C A;  3H9Q A;  4HOB A;  3JRA A;  3KPH A;  3MEX A;  1VZ0 A;  2HNH A;  2VKE A;  4IOA F;  3S3O A;  2D5V A;  1MH3 A;  4L5J A;  2CQ7 A;  2PMZ N;  2BHZ A;  3OIQ A;  2C6Y A;  2NVY J;  3CD6 I;  4HX8 A;  2MYS A;  2VI6 A;  3OS2 A;  3KZY A;  2O6G E;  2IEK A;  4IJA A;  4FE7 A;  2PJP A;  2VOP A;  3C18 A;  5M5W J;  4D0P A;  4MLO A;  3NEU A;  2YR2 A;  4F92 B;  5LRS A;  1OCZ H;  3BY6 A;  1Z3X A;  2DJI A;  3BWG A;  2QYO A;  3G2B A;  2Y9Z A;  4M6X A;  2M2E A;  3KET A;  2DI3 A;  2EA2 A;  1MDM A;  2VXD A;  2BY1 A;  4XNF A;  3HG9 A;  2ISY A;  5FKN A;  3T5X A;  3IRQ A;  5E18 F;  5C4J J;  1XGN A;  2P6S A;  2MH2 A;  3EUH C;  4MO7 A;  4GO1 A;  4PUS A;  4YIF A;  2HOT A;  2BEO A;  2VB6 A;  4ZTJ A;  1G3Y A;  2L7Z A;  3LSI A;  2FML A;  5B3S H;  4DGW B;  2EV6 A;  4PGH A;  2KRC A;  1MSE C;  4KNY A;  1XN7 A;  2NNY A;  4ESJ A;  4KMU X;  2IGK A;  3QWL A;  2DDA A;  2MSY A;  3ABT A;  3LSH A;  3C2B A;  1BW5 A;  1FP1 D;  3WU0 A;  1W5S A;  3DBH B;  4YG2 F;  3CJT B;  3OV8 A;  3K1P A;  1QPI A;  3L9F A;  3QPH A;  1X1A A;  4S05 A;  2WA0 A;  4QTR A;  3DCF A;  4MNU A;  2JA8 J;  3OSF A;  3QPS A;  2F4M B;  3OL3 A;  4EJU A;  4FTH A;  2R3S A;  3GZ6 A;  2ZME C;  3FZV A;  2JTV A;  3CC7 I;  1MZB A;  2GXB A;  2EWN A;  2QSF X;  5CVI A;  5J1U A;  4AYB N;  4XLN F;  5EEA A;  3MKY B;  3I64 A;  3KFW X;  4EVI A;  1XTA A;  2DMQ A;  2EZL A;  2F4I A;  1SEU A;  2LRE A;  2ZO4 A;  2F48 A;  1V5F A;  1IV8 A;  1Y0N A;  4UY8 I;  1K79 A;  3SJM A;  4XBF A;  1L0O C;  1G6N A;  4C30 A;  4CIC A;  3ZMD A;  4G9Y A;  1IW7 F;  5FO5 A;  3GXO A;  1U9N A;  5HNF A;  4Y17 A;  3A0H C;  5DEQ A;  1MBE A;  3GLX A;  1Q1H A;  1G59 A;  2CUF A;  3DBL B;  4C2T A;  1SAN A;  3D0S A;  1LDD A;  4AUX A;  2H09 A;  1QVT A;  2V1D A;  4FET A;  4BS9 A;  2R7W A;  2X6Y A;  3HC7 A;  2OF7 A;  1H89 C;  3DV8 A;  1G3S A;  2O0Y A;  3HKZ A;  2RQP A;  4LJZ F;  1HCR A;  1X1D A;  5FLV A;  2DTZ A;  3LMM A;  3IAM 2;  2Y75 A;  1YLF A;  4A69 C;  2DOD A;  2PG4 A;  4NC8 A;  1ZEL A;  3A03 A;  4M6Y A;  2RGV A;  4NC6 A;  1YJ9 I;  5FKM A;  5A2Q Z;  1IJW C;  3KP3 A;  1P92 A;  2FX0 A;  2WAQ N;  4EJO A;  1HF0 A;  3RSN A;  2HQN A;  1KU3 A;  1WI3 A;  5F04 A;  3S14 J;  2HU9 A;  2XIG A;  3DTE A;  5FLX K;  1TP4 A;  1N78 A;  1YYV A;  2M45 A;  1JGG A;  3SHF A;  3OYG A;  3C3W A;  5IPA A;  4G94 A;  3GO5 A;  3F8C A;  1LE8 A;  1BJA A;  4CCL A;  1N75 A;  3JRF A;  3HOX J;  5FFZ A;  4OMZ A;  1A36 A;  2XPV A;  3S32 A;  5E3L A;  4IHW A;  2JPC A;  3FHN A;  2XRL A;  2OQR A;  2HYG D;  2Z1D A;  4U0V A;  2X0L A;  3S1R J;  2QQ9 A;  2VKD A;  5HDK A;  1WH7 A;  2DQR A;  2RQQ A;  3DPL C;  3ZQ7 A;  2A69 F;  1K78 A;  2Y0M A;  1YTY A;  4ABZ A;  3I0T A;  3V7C A;  2EPF A;  3FBN B;  5H6Q A;  3WHC A;  4PK4 A;  5IP6 A;  1MND A;  2A6H F;  3D1N I;  4LG0 B;  1WJB A;  4M3G A;  5E8G A;  2MH9 A;  4G6T B;  4PDK A;  1EH8 A;  4H4K C;  5J3L A;  4Z6Y A;  1TWH J;  3E7L A;  2IT0 A;  2KJB A;  2QKL B;  2Y0S A;  3DLL F;  3QQA A;  4LK1 F;  3CJN A;  5C44 J;  2BE5 F;  1IXC A;  3E5X A;  5HDN A;  6PAX A;  3MKL A;  4RB2 C;  1SD4 A;  3EET A;  3RQ4 A;  3CCV I;  2IGO A;  1IAW A;  1YG2 A;  2R7U A;  2M7B A;  1MMG A;  3HRU A;  2KZG A;  1IUY A;  3K4C A;  3ZQC A;  3LSG A;  1IRX A;  2F6C A;  4GXO A;  2E5Z A;  2FRH A;  1ZR4 A;  2ZXH A;  3ESW B;  4PGG A;  1FYL A;  5BNG A;  4XM3 A;  4N0B A;  1UAA A;  5D5W B;  4EQQ A;  3W2W A;  2H94 A;  2ZJQ F;  4G6D A;  1WFX A;  2EFN A;  3K9T A;  2NVX J;  2D1H A;  1ETO A;  4YEL A;  3E5U A;  2VJJ A;  5DCM A;  3TW6 A;  1QRY A;  1XS9 A;  1D5Y A;  2AS5 F;  1F9N A;  1ZRC A;  2ZXI A;  4F52 A;  3RZD J;  1XDU A;  2R7O A;  1TZL A;  2HXI A;  1S7A A;  4ZDL A;  3LNQ A;  2R7V A;  2JPB A;  3MN2 A;  5FRN A;  4XR6 A;  4A0Z A;  4ZH4 F;  1OR7 A;  2YU3 A;  3ABL H;  3H5A A;  4RM3 A;  3GTQ J;  4P5O A;  5J40 A;  2L02 A;  2K9N A;  1S29 A;  3U2R A;  5D4S A;  5EDN A;  1BOB A;  3P7N A;  1OYY A;  4IHT A;  5GAE J;  2RDP A;  1ITY A;  3FF5 A;  1BC8 C;  1OCC H;  2FE3 A;  5K1Y A;  2L54 A;  1IXS B;  3R0J A;  2LG4 A;  3HHH A;  2EIM H;  1ZLK A;  1Z77 A;  1VQ6 I;  3VDX A;  3ZMU A;  3BP8 A;  1SAU A;  3KZZ A;  5KNL A;  3CDH A;  3S3M A;  5F1J A;  2YU9 J;  3ZXS A;  2Y2Z A;  3V8J A;  1ZRD A;  4IQJ A;  3RYP A;  3R4K A;  3WGI A;  1P4X A;  1UHS A;  2H8W A;  3CLO A;  2OD5 A;  1TQM A;  1X4P A;  4NUB A;  5BOX A;  2ZFU A;  4BHP A;  1QU3 A;  2BGC A;  2DA3 A;  1GLN A;  1SFO J;  2DBB A;  4DYQ A;  2XAQ A;  2KHM A;  3DTK A;  3M4O J;  4A3M J;  1JTX A;  3BDD A;  3GME A;  2VOO A;  1I3Q J;  4E4H A;  3I54 A;  3CLQ A;  2KRF A;  3BT9 A;  3N05 A;  3ZQL A;  4AIH A;  2ICW G;  1UZC A;  3KP4 A;  3GFL A;  3JW4 A;  4LG3 A;  2WV1 A;  5KAF C;  2EH3 A;  5CJ9 A;  1JT0 A;  3FMS A;  1S7E A;  1X3U A;  1POG A;  4HNV A;  4BQQ A;  3D5S C;  3DWL E;  3JRC A;  1ZGJ A;  1TW3 A;  3IAS 2;  5LRR A;  3MCZ A;  5L3D A;  4GDF A;  2XV4 S;  2Z9O A;  4OIR F;  3Q0W A;  2R5Z A;  2VQC A;  2V26 A;  1LJ9 A;  4LIU A;  1WI9 A;  2IVM A;  3H5R A;  3J80 K;  1BL0 A;  3T0Y A;  1T2K A;  5F0H A;  3TOB A;  4IHX A;  2OZU A;  2E2H J;  1BR2 A;  4CHU A;  3O2P E;  1GVJ A;  4KIC A;  1IN5 A;  2XPU A;  1P6R A;  1B72 B;  2HKX A;  4KN7 X;  2PJR A;  2ZME B;  1JKR C;  3WU2 C;  5KCM A;  1YRN A;  4YFX F;  4BQO A;  2XAH A;  3NAU A;  4UNO A;  4XL9 A;  2L2O A;  3BJ6 A;  3HRM A;  2Y31 A;  4B47 A;  1XMA A;  4CCK A;  2XAJ A;  3H35 A;  5B66 C;  5DD4 A;  1VQ8 I;  3OIP A;  3OYI A;  4AID A;  4EJV A;  3P9K A;  3TO6 A;  3IWF A;  5HLI A;  4XIC A;  2ELH A;  4A0Y A;  4A12 A;  2FOW A;  2PMU A;  3HUG A;  5LFA A;  1I6X A;  4ZC3 A;  4IRI A;  2DT6 A;  3MQ0 A;  4U87 A;  2CV2 A;  1OJL A;  4PJJ A;  1U5T C;  3GZN B;  1MBH A;  2FNP A;  3V42 A;  1T0F C;  2DXI A;  1DUX C;  2ISZ A;  3OYC A;  2V4J C;  3BQZ A;  2R7F A;  3HGY A;  2VE8 A;  3DKY A;  3PSI A;  3OYB A;  3CO7 C;  4P55 A;  5F1R A;  5IT9 Z;  1DQU A;  1IN6 A;  5M3M J;  1NTC A;  1MKM A;  1R5I D;  4A5M A;  3TKY A;  2LSO A;  3PFY A;  2O03 A;  2GA1 A;  3FXR A;  1MBJ A;  3MKW B;  1R23 A;  2LP0 A;  1EKE A;  3LSP A;  4Y3O A;  3T8R A;  2QSH X;  4BNC A;  2KRH A;  3GWZ A;  3AFH A;  4XQF A;  4YFK F;  2P8T A;  2XGX A;  4A93 J;  2FU4 A;  2M8E A;  2M7A A;  3KCC A;  4XRF A;  5DV5 A;  2PEX A;  4LFU A;  3ZQF A;  4M3F A;  3R60 A;  3CCL I;  1FY7 A;  4ZJZ A;  1MBG A;  2F2E A;  4ZYH A;  3I55 I;  2W24 A;  1X2M A;  1R4M B;  2KJC A;  1OFC X;  2DCE A;  3TP3 A;  2OPT A;  2H8R A;  5CVR A;  4G7H F;  3KX2 A;  2ETH A;  1F36 A;  4HRI A;  3S3N A;  1DU6 A;  4DYR A;  1HW1 A;  4KT6 A;  1IGN A;  5F64 A;  2M3A A;  2EFO A;  3REO A;  2DA1 A;  4ZYA A;  3ASO H;  3RKQ A;  3OOP A;  3H3Z A;  2HYF A;  4I01 A;  4UVC A;  5JHF A;  3ECO A;  2E1M C;  2XDV A;  1OQY A;  3I58 A;  5B1B H;  1T8I A;  4XID A;  4AC0 A;  2JK3 A;  2LDU A;  5FKL A;  2CW7 A;  4BJ5 C;  3HZJ A;  3JTH A;  2WAF A;  4M9X A;  2ZFW A;  1LKX A;  2IAI A;  1ZAR A;  4XKC A;  1BR4 A;  2KMU A;  3K4K A;  4NDL A;  1IRF A;  5HS8 A;  3I59 A;  1AKH B;  4BE2 A;  3WHB A;  5IYC J;  4J01 A;  2EZK A;  1KYW A;  1S6L A;  5HOO A;  3J80 Z;  3PJR A;  1YQA A;  1HW5 A;  3RDI A;  2CRG A;  2CYY A;  3MD2 A;  4HNU A;  1FZP B;  2R7X A;  5K7H A;  2XAU A;  3AG1 H;  3K1N A;  3U21 A;  2IS4 A;  4AYB A;  4N9H A;  4ZDP A;  4E70 A;  3GZ5 A;  5JLW A;  4KFC A;  1I1S A;  2F5E A;  4ZZD A;  2X1E A;  3PFI A;  4HV6 A;  4DQ2 A;  4IVN A;  3FX3 A;  4CUG A;  3KLO A;  3Q9S A;  1GUU A;  3K4J A;  3O3K A;  1BBY A;  2EFQ A;  4HLY A;  1VF9 A;  2XKP A;  3HEF A;  1I6H J;  2DYR H;  1K6Y A;  4W97 A;  4BL0 B;  1PYV A;  4M72 A;  1N25 A;  3LOC A;  3GFJ A;  2GOM A;  4HZF A;  1FYK A;  2PQ8 A;  5FRO A;  2XF5 A;  2AXL A;  2JT1 A;  3DQV C;  4A3C J;  1YJN I;  1YI2 I;  1DDN A;  3QRF F;  1YHQ I;  1DU0 A;  1YW9 A;  2HKO A;  3ZR8 X;  1PUE E;  2WAE A;  1OYI A;  1AHD P;  5AON A;  3CJR B;  3JSP A;  2ELK A;  3IKT A;  3CC4 I;  4BH9 A;  5D4R A;  2GBY A;  4BDZ A;  2WAQ A;  1MNM C;  1VI0 A;  1ETX A;  2V7F A;  3OL4 A;  2QEX I;  1I27 A;  2DLL A;  3RKY A;  3GUD A;  1SVO A;  3VB2 A;  5LHH A;  3ZPL A;  5AIP A;  1T98 A;  4QIW N;  1IZ1 A;  1RES A;  4BEH B;  2L9R A;  3DF8 A;  1JXS A;  3CC2 I;  2R5Y A;  4NBQ A;  1OCP A;  1DP7 P;  2XF7 A;  5EGO B;  2W84 A;  2R7T A;  4U88 A;  3ZOB A;  2E7X A;  2O9L A;  1CGP A;  1B9N A;  3F8M A;  3OMY A;  4M74 A;  1HDD C;  4DJA A;  2QBY B;  2FA5 A;  2H6B A;  4XN0 A;  3HOS A;  1MH4 A;  1ON1 A;  4OOI A;  3Q0U A;  3I9V 2;  4CYD A;  2CGP A;  1FBU A;  3U9G A;  4CZZ A;  1B9M A;  3F9K A;  1P9Q C;  3H9G A;  2E2I J;  4JX5 A;  5FKO A;  3MFK A;  1ENH A;  4G12 A;  1X19 A;  2XAS A;  4U0Y A;  2FBH A;  3OYA A;  3E6C C;  2OBP A;  3PO2 J;  4I99 C;  3HGG A;  3L2V A;  4XLH A;  1X4O A;  5E17 F;  3A02 A;  1YIT I;  3ZQI A;  2R7Z J;  2BW3 B;  3GLL A;  3FXO A;  2AQF A;  2CQN A;  1RUO A;  3H0D A;  4BGD A;  1B8I A;  4OIN F;  4WK8 F;  1VQ5 I;  1JHF A;  4ON0 A;  2O8X A;  2F5D A;  5E8I A;  4BBR J;  3HRS A;  4KDP A;  2E60 A;  1JTY A;  2XRN A;  1ETY A;  4DBR A;  2IBD A;  1KU7 A;  4XKB A;  4FX0 A;  1K7A A;  3FMR A;  2MC4 A;  1W4M A;  1E3O C;  5DDG A;  2KIQ A;  3BQY A;  2HZT A;  3BG6 A;  1K4S A;  3PNY A;  2DFE A;  1WSU A;  4LB6 B;  1P7I A;  1B59 A;  3BG9 A;  4JX4 A;  1JKQ C;  4NNJ A;  1O3S A;  1XSV A;  4D1Q A;  5LHI A;  3BG3 A;  1ZAO A;  5K5O A;  1BN5 A;  1D0Z A;  4RGU A;  3WTV C;  3TGN A;  4C2U A;  2JZY A;  1SD7 A;  1VQ7 I;  3IC7 A;  3PQJ A;  1IXR C;  4XSX F;  2KDO A;  4HDU A;  3K1M A;  4U7D A;  3LA3 A;  3HSR A;  1A35 A;  3HXL A;  4QPO A;  4A0X A;  3VYR B;  2VT3 A;  1XB4 A;  1U5T B;  4Q47 A;  3I53 A;  3O8G A;  5CVV A;  4CDG A;  1UFM A;  1Z3Y A;  4UV9 A;  1JE8 A;  1GVD A;  2K02 A;  3IH3 A;  2NVT J;  3JAM K;  3ZMV A;  1WJC A;  1HBX G;  1R9T J;  4O3M A;  1XDS A;  2EQR A;  2ZJR F;  4KT5 C;  5HLG A;  3HHG A;  2HVS A;  4CXF A;  4IHY A;  5ERI A;  2LKX A;  5LGN A;  3ZRG A;  3A01 A;  4BXF A;  2ZSH B;  2E2J J;  4XOP A;  3TW7 A;  1X1C A;  5KVR A;  4B48 A;  4EAT A;  4M6V A;  5FJ8 J;  4ANJ A;  1LDK B;  5GTH C;  4RA2 A;  3OSG A;  2NNN A;  4HBL A;  2P5L C;  1RR7 A;  3C2H A;  4BAY A;  5IOY A;  2R4G A;  3GFI A;  3ZGK A;  4UUV A;  2EB7 A;  3HRT A;  1H9T A;  1WGX A;  4BDY A;  4ETS A;  5ICG A;  3EYY A;  3AG4 H;  2BBY A;  5J1R A;  2XB5 A;  2NOJ B;  3GW2 A;  5E3O A;  5D5X B;  1YIO A;  3M1E A;  2VJI A;  1DGW Y;  1WKM A;  1WRJ A;  2NAZ A;  3GTP J;  1WH5 A;  3CP8 A;  1ACI A;  1V54 H;  4HF0 A;  3TED A;  1KU9 A;  2IA0 A;  5K7F A;  1SFX A;  3NQO A;  1XCB A;  2LNB A;  3K4N A;  4LD5 A;  3SXY A;  3S2H J;  3LA7 A;  3EPZ A;  5ILS A;  3FXJ A;  4FCY A;  5TRD A;  4MEY F;  4M73 A;  2NOG A;  1UB9 A;  3CCY A;  4OAY A;  1F1Z A;  2M8G X;  2O61 A;  3L2W A;  3Q9V A;  1XCV A;  2E1M B;  3OWT A;  1WJD A;  1R22 A;  2MLG A;  2ID6 A;  2F4O B;  2G0E A;  1KQ0 A;  2CUZ A;  4UB6 C;  3KYD B;  3PQK A;  2XPW A;  5E1W A;  4CA0 A;  3BC8 A;  4XRS A;  1FSH A;  4AD9 A;  3RTR A;  3JTG A;  2A07 F;  5TJJ A;  4XOT A;  2K9L A;  3CDI A;  4JBA A;  1QA6 A;  4LIV A;  2LF8 A;  1C0W A;  2KP6 A;  4P96 A;  4C3I J;  2LLK A;  2RV8 A;  3ML6 A;  3E5Q A;  2X48 A;  4I09 A;  4DOZ A;  2IA2 A;  4HDV A;  3TL4 X;  5D8L B;  1OYW A;  3UNG C;  4B1R A;  1F4K A;  3AAF A;  1R71 A;  3LWF A;  5F27 A;  1FC3 A;  1VND A;  2M30 A;  2ZB9 A;  4I76 A;  1W5C C;  2Z5U A;  3MAJ A;  3N97 A;  1ZGW A;  3W2A A;  1TWC J;  1EV7 A;  1GV5 A;  4ZDO A;  4Z2Y A;  2AQE A;  1SVL A;  3V4G A;  4PZJ A;  1R1V A;  4WXH A;  2HTS A;  3R61 A;  3ZQH A;  2MG4 A;  1FNN A;  5DTD A;  2EV5 A;  1FBQ A;  3F23 A;  2OA4 A;  1I5Z A;  3A0B C;  2VJ4 A;  3JSO A;  3U1D A;  2PBI A;  4DNC A;  1YJW I;  5GP9 A;  3CF5 F;  4OIO F;  3FK7 A;  1U78 A;  3OYL A;  3N4M A;  1KON A;  2DOA A;  2JUG A;  3T1B A;  3HTS B;  1JUM A;  4II2 A;  3S2W A;  1QZY A;  2V6C A;  2LKP A;  2VN2 A;  3ONQ A;  4PCQ A;  5E3N A;  4BUP A;  5EYR A;  3KZI C;  1X58 A;  4GGG A;  1U6G A;  1VFC A;  3HPH A;  3IUO A;  2B0L A;  3KP6 A;  3G4S I;  1SMY F;  4IF4 A;  1UJ8 A;  2OJE D;  2PFB A;  3W3C A;  1HC8 A;  2V9V A;  1LE8 B;  3QYE A;  2IJL A;  3I56 I;  2O8K A;  2OU2 A;  1TQI A;  3HOV J;  1I39 A;  2I5U A;  1FP2 A;  4DIQ A;  1KQ8 A;  3GX4 X;  1Z7L A;  2HQA A;  2HTJ A;  2KIF A;  1MIJ A;  3WGH A;  4EGY A;  1BW6 A;  1VQN I;  4L9T A;  2EIL H;  4BU2 A;  2KIS A;  1H88 C;  5E79 C;  1O57 A;  5GPC A;  1ZG5 A;  3E97 A;  1U0J A;  1W7P A;  1JI8 A;  2HEO A;  4M3D A;  1S72 I;  1ZQ3 P;  4LLN A;  4Y33 A;  1YIJ I;  2E1O A;  4BAC A;  5FB2 A;  1XC5 A;  4M3E A;  3Q3S A;  5DS9 A;  2STW A;  5AIQ A;  4PFO A;  4EMS A;  4A6D A;  1CF7 A;  3GEZ A;  1F43 A;  4IPA A;  2BYV E;  2IA1 A;  3LST A;  4HG2 A;  2G7U A;  4B43 A;  2L0K A;  4A3E J;  4RGX A;  2HPI A;  4LG0 A;  4OWR B;  2FOK A;  4S04 A;  4U7B A;  2QF7 A;  3HM5 A;  4X0G A;  4BE0 A;  1Z67 A;  3B6A A;  2DT5 A;  2JQ7 A;  5DYM A;  4HV5 A;  3ZMZ A;  2XHK A;  3SZP A;  3IRR A;  1JHH A;  3BZK A;  2OCC H;  2MD5 A;  2CW0 F;  3NAR A;  2NXN B;  3QOP A;  3RQI A;  2IS6 A;  3G1M A;  2PX9 A;  5IYB J;  2LBF A;  1VQK I;  3OYD A;  2LRD A;  2GAU A;  1QO0 D;  1SFK A;  5ICE A;  1OMI A;  4IHV A;  3ABK H;  2E5N A;  2P7V B;  1RPW A;  4BXU A;  4F55 A;  2HDW A;  2QCO A;  3E1S A;  4E7Z A;  3UKG A;  2B7E A;  3DPU A;  5HNH A;  1KYZ A;  4P9U A;  2ELJ A;  1HOM A;  5EF6 A;  5DCM B;  1BI0 A;  2ZXW H;  4LIT A;  2MBF A;  4K2E A;  5ED4 A;  4LMY A;  1D1C A;  2JN6 A;  3BTC A;  2ZJ2 A;  4Y7N J;  4RBO A;  2IW5 A;  2K85 A;  3PUB A;  2V6E A;  2WB1 A;  2WWY A;  1MBK A;  3SQN A;  1B1B A;  1JJ6 C;  4DBQ A;  4RAF A;  2DMT A;  1R58 A;  1JT6 A;  5JVG F;  4OIQ F;  4NHJ A;  2DA7 A;  3G3Z A;  1HST A;  1UCR A;  1RET A;  2MFZ A;  4CYC B;  1HSJ A;  2ESN A;  1XSD A;  2QQA A;  2DOE A;  4ESF A;  1G3T A;  4N4O B;  3IH2 A;  1RC9 A;  1PVE A;  4G8X A;  1U9O A;  2MGQ A;  3EUA A;  4UVB A;  1TNS A;  2VJ5 A;  1WPK A;  4HA8 A;  1YS7 A;  2IXS A;  3VPR A;  5FLX Z;  4PJM A;  2FD5 A;  3COA C;  1T33 A;  2JSP A;  4UV8 A;  4XKW A;  3ZQQ A;  5M5Y J;  3FXQ A;  3RPQ A;  2GLO A;  2FEZ A;  1QHG A;  3W6K B;  2DQL A;  2RRE A;  1P2F A;  4YIR X;  3PSF A;  1OCR H;  2NYX A;  2BY0 A;  2XGC A;  1AOY A;  1R5G A;  1WJE A;  1Y0U A;  1D0Y A;  4HSR A;  5HS9 A;  3BG5 A;  5FD6 A;  2XVC A;  3B02 A;  2A5Y B;  4FHT A;  4A3F J;  1UMQ A;  3HOU J;  3CES A;  2OV7 A;  3FBI B;  2K9M A;  2VQH A;  1EH6 A;  2A6E F;  5LBQ A;  4UUS B;  5FLM J;  4BXX J;  3CUQ A;  2DMP A;  2YX4 A;  3IP4 B;  4IO9 F;  3HOY J;  1Y1V J;  2ZNY A;  4RS8 A;  4A3L J;  2X9D A;  2KT0 A;  4HQM A;  1GHC A;  4RAY A;  2HWV A;  3RIR A;  1W0T A;  1ULY A;  4XMY A;  1ZG3 A;  5CVU A;  4L18 B;  2DN0 A;  2R5Z B;  2N8G A;  4DW6 A;  1XGM A;  2DK5 A;  2JRT A;  1ETQ A;  1VQO I;  5EJC A;  2DT7 B;  5JFR A;  3WTT C;  5JI6 A;  4L5I A;  4E7H A;  1H8A C;  3FKI J;  3MKZ A;  4MQV A;  1ZRF A;  4YFN F;  2Q0O A;  1WWX A;  5CQE A;  3K4L A;  1K6O A;  1V5E A;  1E3H A;  3M9A A;  2UWM A;  3HOZ J;  2FQ4 A;  2XGD A;  1TQP A;  2ZC2 A;  2A6T A;  1RKT A;  3GBG A;  3PIO F;  1LB2 A;  1FOX A;  2P0W A;  1D1A A;  2QVO A;  1YFH A;  2UXN A;  2W82 A;  1K83 J;  2VAS A;  1B72 A;  1FX7 A;  1RZ4 A;  2ZME A;  5FGM A;  3GTG J;  3H5N A;  3FDY A;  4LLL A;  3OYE A;  4HEA 2;  3WE2 A;  1HW2 A;  4XLC A;  4XLF A;  4AU7 A;  5CKT A;  1Y39 A;  2A68 F;  3HUG B;  1LNW A;  3P9C A;  3RPU D;  4XRS G;  4MQ9 F;  3EDP A;  3D5R C;  1TTY A;  3J7A O;  2V9K A;  2VPR A;  2M9H A;  1IDZ A;  1I50 J;  4P1W A;  5C4X J;  3JRH A;  5J6X A;  2DA5 A;  2OTJ I;  1YO5 C;  2BY3 A;  2QUF A;  1G3W A;  3DEE A;  3CCS I;  2DMN A;  2HS5 A;  1RI7 A;  1S3J A;  2OQG A;  2VT2 A;  2X4H A;  4PJ0 C;  2J5P A;  3K2Z A;  5J4V A;  1S9H A;  1NH3 A;  1BR1 A;  2BOL A;  3GTO J;  5EZG A;  3M07 A;  3FM3 A;  1B6A A;  3CUO A;  2ZXJ A;  4JOM A;  1IN4 A;  5J1Y A;  4RB1 A;  3F72 A;  1KA8 A;  2ZSI B;  5CPR B;  1HKT A;  3HYI A;  1UHW A;  1BIB A;  3ZP5 A;  3OYN A;  3DU5 A;  2Z16 A;  2JWT A;  2OUM A;  3BCA A;  3EUK L;  2GIZ A;  3WTS C;  5K7Z A;  2JA5 J;  3I71 A;  2UXX A;  2OZ6 A;  2QZ8 A;  4BY1 J;  2K9Q A;  3WE3 A;  3TOA A;  5DD8 A;  1TWG J;  1TT5 B;  1T08 B;  2PMZ A;  4BHC A;  4PSX A;  5F08 A;  1SAX A;  1D5V A;  2CQX A;  1YS6 A;  2WC2 A;  1R1U A;  1WQ2 A;  5ICC A;  1ZYR F;  2P7C B;  3L7W A;  2CQQ A;  1GV2 A;  3DKX A;  3HL2 A;  2HYJ A;  2M5W A;  3K4B A;  2MA3 A;  3RYR A;  1X1B A;  3VFZ A;  2A05 A;  3OYK A;  2Q2E A;  4MGR A;  3O6B B;  4AIK A;  3FK6 A;  4R79 A;  2X6X A;  3QPT A;  1Y1W J;  2PLY A;  1Z1D A;  1UEL B;  1A04 A;  3F6O A;  4LB5 A;  1T39 A;  5KAI C;  3HJE A;  2ACJ A;  1AU7 A;  4GFB A;  3FMQ A;  2VL8 A;  2ZNZ A;  1FOK A;  1Y8R B;  1XX5 A;  3I4M J;  4KIS A;  4M71 A;  1QPM A;  2KQR A;  1UG2 A;  2Y69 H;  4LOC A;  2NVU B;  1U8R A;  1STZ A;  2M4G A;  2KDZ A;  3VEP A;  3S1M J;  1LFB A;  2CSO A;  1J2X A;  1Z9C A;  2RAE A;  4P9F A;  2Z99 A;  3QYF A;  3RKX A;  5KK1 A;  1Z0X A;  3A1Y A;  4CCJ A;  4RGR A;  5KHD A;  1FWZ A;  4BE1 A;  3VOE A;  4NC7 A;  3I59 B;  1X2N A;  3K10 A;  2IGM A;  3ZMS A;  1O7L A;  3LL7 A;  4UB8 C;  2H27 A;  5F0C A;  3E6M A;  4IZZ A;  3EYI A;  5L3G A;  4XLP F;  2W1O A;  4MHG A;  5CVJ A;  1AKH A;  3H3U A;  1ODD A;  1LVA A;  2K27 A;  1APL C;  2DPU A;  2QQ8 A;  3J81 K;  3KEQ A;  4ITV A;  4A3J J;  2IRF G;  2EIJ H;  4I98 B;  3X2Q H;  4NQW B;  4XSZ F;  3CCJ I;  2VQG A;  2ADU A;  3I5U A;  3PNT A;  2DJN A;  3BG7 A;  2CWE A;  4M9S A;  2K9S A;  1IV6 A;  4Q5S F;  3H9J A;  1J9I A;  3OYM A;  3ERE D;  2VKH A;  4WX9 A;  3SYT A;  3F8F A;  5H2F C;  5J47 A;  3F3X A;  1WHU A;  2K3P A;  4QSH A;  4V2F A;  2JSC A;  2O5R A;  2DTR A;  1T56 A;  2KIU A;  3QP6 A;  4BY7 J;  1D8J A;  2E35 A;  3HBL A;  1MBF A;  1RUN A;  4Y13 A;  3OY9 A;  1MJB A;  2IP2 A;  3BJA A;  1PJR A;  2ESH A;  3KEY A;  5DUI A;  1IN8 A;  2LC2 A;  2JMW A;  3K69 A;  3W6V A;  2KFD A;  4ENM A;  3BOQ A;  3KE2 A;  2X1C A;  3H3V K;  3BR3 A;  2UV1 A;  1V4R A;  2FUG 2;  2EZI A;  3QU3 A;  2YSR A;  4ZZL A;  2COM A;  3PIP F;  4IRH A;  4D7M A;  4HX7 A;  3CZ6 A;  1ZH5 A;  2K5C A;  1FT9 A;  2O3F A;  3CMM A;  2WAD A;  2K7L A;  2W57 A;  3DTI A;  3GYH X;  4HNT A;  1PDN C;  1FYM A;  4IHS A;  1YW7 A;  2R92 J;  2LMD A;  2B63 J;  2Q8K A;  2R7S A;  1I1G A;  2RNG A;  3WU1 B;  4RB3 C;  1IRZ A;  4I7H A;  2P6T A;  4C2M J;  4HF2 A;  4PSW A;  1PUF B;  1W1W E;  2YS9 A;  4BEH A;  2HDD A;  4JQF A;  1HQC A;  3IKV A;  3PO3 J;  5EGO A;  5BMZ A;  2L01 A;  1GT0 C;  2HI3 A;  1A6Q A;  2H1L A;  2RVC A;  2LY1 A;  2A61 A;  4V19 K;  3M8J A;  3I3L A;  1VQ4 I;  1SD6 A;  1NK3 P;  4KA4 A;  3BCB A;  2KLO A;  2X6W A;  3S1N J;  3OYH A;  3VYS B;  4AVP A;  4JK1 X;  2OAZ A;  2KIM A;  1XGS A;  4R8H A;  1ZHF A;  2OCE A;  3MVP A;  3MZY A;  2H6C A;  2G9W A;  1PP8 F;  1I3A A;  3CCE I;  1EJ9 A;  5BQT A;  3H1C A;  4X1E A;  1MW7 A;  2BW3 A;  5FFX A;  1MD0 A;  3NWT A;  3KLN A;  4FAS D;  1JGS A;  1RNL A;  2R93 J;  4L0Z B;  4L9J A;  1E17 A;  3AG3 H;  4L9N A;  2VQL A;  1NG7 A;  3DP7 A;  4II3 A;  2JA6 J;  2BXY A;  1A31 A;  4RB0 A;  3DEU A;  4AIJ A;  1R4N B;  2KZV A;  2R7R A;  5EG0 B;  4Y52 J;  5FKK A;  1TNT A;  2W85 A;  2GM4 A;  3C7J A;  3S16 J;  1Z7U A;  4FQG A;  2KKO A;  4O5V A;  4A3I J;  2DU9 A;  4JX6 A;  5TGT A;  2CG4 A;  5H20 A;  1OR7 C;  3E6D A;  1TT0 A;  2M87 A;  2CW8 A;  2HFH A;  4GRI A;  4DYC A;  1IC8 A;  2HPM A;  2JRM A;  2F5V A;  1IRG A;  1H9G A;  1FIP A;  3KYL A;  2FXA A;  5CYV A;  1U3E M;  3ERM A;  4XLA A;  2XGE A;  5IP7 J;  2GIV A;  1MMS A;  2RKH A;  2DFF A;  3RCO A;  3L09 A;  3VSL A;  1T0F A;  2V1X A;  2MW8 A;  3BPX A;  5A2Q K;  4E7K A;  4QWQ A;  1YE9 A;  3DKW A;  2GOX B;  2BXZ A;  5DCF A;  2F5F A;  2M0M A;  2VBX A;  5HVQ C;  3Q5F A;  4A3D J;  1IUF A;  2QEN A;  1LQ1 A;  3BR1 A;  4G7O F;  2CV1 A;  4A3B J;  1GXQ A;  2W4S A;  2ZKZ A;  4CCO A;  1A5J A;  2DK8 A;  2IS1 A;  4F91 B;  4WWC A;  2XAG A;  1Z91 A;  2JUC A;  1IDY A;  3MWM A;  4EM2 A;  4BQN A;  5L3B A;  3ABM H;  5ILU A;  5D6E A;  1IF1 A;  2K3F A;  3G1O A;  1J7K A;  1MMD A;  4EJT A;  2E71 A;  4CH7 A;  3JRI A;  4L9V A;  5LLQ A;  2ZBK A;  3IWZ A;  2CFX A;  4HX4 A;  5FD5 A;  4DZP A;  5J4Y A;  1MDM B;  2JVH A;  2VBY A;  3U1K A;  4HYE A;  1F5T A;  5JR3 A;  2W7N A;  2HQ5 A;  3TDZ C;  3WTZ A;  2XSJ C;  1ZGA A;  3M1C A;  3GVA A;  1Z05 A;  4B4C A;  3CUQ C;  1E0E A;  1ETK A;  2FMY A;  1LEA A;  3WGG A;  3V8K A;  2DPD A;  4MIM A;  3CMA I;  2CUJ A;  3T8T A;  4FT8 A;  4UVA A;  1FLI A;  1J0R A;  5LGT A;  1EH7 A;  4PJN A;  5BPD A;  2BVM A;  2LKS A;  1WVR A;  3BZ6 A;  3TO7 A;  1K4T A;  3WG7 H;  9ANT A;  3FXM A;  3CQZ J;  4Y15 A;  1FTT A;  3BTL A;  2VKV A;  2QKM B;  3CDL A;  2LH9 A;  4WF2 A;  5IT3 A;  3HIF A;  5DUK A;  4CO8 A;  1FOW A;  2L5Q A;  4C3J J;  3F8B A;  5D5U B;  5EEG A;  3IL2 A;  2WY7 Q;  3GTJ J;  4AM3 A;  2CUE A;  1NG6 A;  4D5F A;  3K2A A;  3S17 J;  4HW0 A;  4F93 B;  3FXU A;  1T6S A;  4L5E A;  3TO9 A;  1S8N A;  3E0J B;  4BYY A;  4ESB A;  2HOS A;  3ZCO A;  5IP9 J;  2VON A;  3QOD A;  1T95 A;  3ISP A;  3HB9 A;  1UHM A;  2D1V A;  2OC6 A;  3BTI A;  1YW8 A;  3CTA A;  3PUF A;  2L4M A;  3CCM I;  4ENK A;  3S1Q J;  5GAD J;  1ETV A;  1VTN C;  3KP5 A;  2IS2 A;  2DW4 A;  4S0H B;  4I6Z A;  3A2K A;  3CME I;  4FIS A;  4N4N B;  1K61 A;  5IYD J;  3LFK A;  4CGZ A;  4IEJ A;  2LY2 A;  2NS7 A;  3NRV A;  3CMY A;  4I2O A;  2R7D A;  4X6A J;  3K70 C;  1FOY A;  2HOA A;  3JAM Z;  2E7W A;  3BTJ A;  4L0Y B;  4XK4 A;  3BJO A;  2J5O A;  1U8B A;  3KP2 A;  2VIX A;  1WZ2 A;  2PN6 A;  1QGP A;  2L9V A;  1CQT A;  3AL0 C;  2JA7 J;  1V55 H;  3BRO A;  1DPU A;  5GAG J;  3QYB A;  5HOD A;  1P4A A;  1BC7 C;  2VBW A;  1SC7 A;  5JHU A;  1OCO H;  4U0W A;  2CH0 A;  3M7G A;  1SFE A;  4B09 A;  1DPR A;  2XAF A;  5GTI C;  3HOW J;  2MD0 A;  2X6O A;  1W5T A;  1ZKG A;  4HLX A;  3OIO A;  3DEW A;  2BZT A;  1Z6T A;  3LQQ A;  2GZW A;  4KYW A;  3GFM A;  3AKZ A;  4LK0 F;  3VYU B;  3L00 A;  4A6E A;  4AWX B;  1OKR A;  2TRT A;  4YII A;  4OU0 A;  1K78 B;  3ELK A;  2LD5 A;  3H92 A;  1W7P B;  2O7O A;  5H6R A;  2MC3 A;  4OMY A;  2HVR A;  2L9N A;  4C9Y A;  5M3F J;  3SDG A;  3WTY C;  1IN7 A;  2LF7 A;  1CF7 B;  4M3B A;  2A5W A;  1D1B A;  1G4D A;  1JUS A;  1W7P D;  4XON A;  3ZN1 A;  2K86 A;  1LFP A;  2L7F P;  1KU2 A;  4E7S A;  1H0M A;  1J5Y A;  4HPQ A;  2GXG A;  3RI4 A;  4ENN A;  5E20 A;  4E6K G;  2Y9Y A;  4N9I A;  2ID3 A;  4KIG A;  2KPM A;  3BPV A;  4A3G J;  3WOD F;  3DLA A;  3D5L A;  1N77 A;  1BJZ A;  3O8H A;  3V8L A;  2WV0 A;  3W2V A;  2XC7 A;  1VQP I;  4XRM A;  2VE9 A;  2Z2S B;  2DAO A;  1LPQ A;  2TDX A;  4MFD A;  3TQN A;  2CQK A;  2LBF B;  3VOD A;  3VSK A;  2CMP A;  4KJZ A;  4ZYG A;  3CP2 A;  1ZK8 A;  1ZRE A;  3L2R A;  2XB0 X;  2VLA A;  2GWR A;  1FBS A;  1R6R A;  1FSE A;  1W36 C;  1Y6I A;  2FBK A;  2EBI A;  4LLG F;  3BR6 A;  4CZC A;  1P7J A;  3KEO A;  4GYG A;  5EEH A;  3F21 A;  5B1A H;  3QAH A;  2CFO A;  3HPG A;  2XRO A;  2LR8 A;  1MGT A;  1ZTR A;  1SFU A;  2WTE A;  5LEJ A;  2ECB A;  5GAH J;  2HZD A;  4EGZ A;  2MAB A;  1ORK A;  3S93 A;  4I0A A;  5IOZ A;  3S15 J;  4DZJ A;  5HLT A;  2W25 A;  2R7Q A;  2FSW A;  1VQM I;  1EF4 A;  2L7M P;  3F8N A;  2DDB A;  4CSW A;  4IKF A;  4FE4 A;  2NVQ J;  5IT9 K;  1ZR2 A;  3LAP A;  5B5E C;  5JVT A;  4HQE A;  3DXJ F;  3SFI A;  2EFP A;  3GTL J;  5K5R A;  1RRJ A;  2PI0 A;  1MMA A;  4BBS J;  5C3E J;  1IG7 A;  2AO9 A;  2FQ3 A;  3JCU C;  2TCT A;  3HSE A;  2ME0 A;  1HA8 A;  1XD7 A;  2LVS A;  2YPR A;  4CYC A;  3DBR B;  2STT A;  1XGO A;  4XKV A;  3ZMT A;  4KIF A;  4EV0 A;  1MMN A;  2EK5 A;  3KIO A;  4HAM A;  2VOD A;  1Y56 A;  2DOF A;  2X85 A;  4JP0 A;  4OAZ A;  2BHY A;  2G7H A;  2FJ1 A;  1JKP C;  2UZK A;  1D0X A;  2M0C A;  2P4W A;  3OOU A;  2NS0 A;  3H0G J;  3RZO J;  3SZT A;  1O7F A;  3LA2 A;  5HDG A;  3W6J B;  1IO2 A;  2Y48 A;  2DMU A;  2EIN H;  3JRG A;  4E7L A;  2M1B A;  3QPL A;  1XMX A;  3M3Y J;  1GXP A;  2I8D A;  3IH4 A;  4J00 A;  1SVM A;  2HQR A;  1UG0 A;  1R00 A;  1O3T A;  1BIA A;  3ROU A;  1XMK A;  3CUQ B;  3JRE A;  2ME6 A;  4RLF A;  2V9P A;  4B44 A;  1LUJ B;  2V1U A;  5HLH A;  5EZH A;  1J59 A;  2RC4 A;  3I4P A;  1TL8 A;  3EUH A;  1YX5 A;  1Z21 A;  4UUS A;  1BI3 A;  2GQQ A;  2Z3Y A;  5ILV A;  5DM6 F;  4MTE A;  1OPC A;  1R36 A;  4Q48 A;  4XLE A;  3QU6 A;  1LDJ A;  3SDB A;  2PJR B;  3OR2 C;  3BR5 A;  3K4M A;  3OYF A;  2R0Q C;  1WCM J;  5LD2 C;  1XSX A;  1YRN B;  1LVK A;  2JVG A;  3LSK A;  2K4J A;  1ERD A;  3V7S A;  2QWW A;  1MNE A;  2GA2 A;  3NWS A;  1AWC A;  1Z6R A;  3ZQG A;  1RKW A;  2BVL A;  1G2H A;  3FIS A;  2HXO A;  1XG1 A;  3E3V A;  3CCQ I;  1HXD A;  2W00 A;  3RPU A;  1LFU P;  4C3H J;  1BI1 A;  2WY8 Q;  5GPA A;  4ENJ A;  3Q0V A;  3WTU C;  1BOA A;  3HOT A;  2LK2 A;  5D6F A;  3CF2 A;  1TBX A;  1MJ9 A;  1WJA A;  2GXA A;  3G6E I;  4RDU A;  4CCM A;  3LSR A;  3HKZ N;  3FXK A;  2Z33 A;  2CS3 A;  3OS0 A;  1E3P A;  4RM2 A;  4TV7 A;  3L1P A;  4RAZ A;  2D2W A;  2EZH A;  1QHH D;  2QM3 A;  1JUP A;  1X3W B;  1FPQ A;  4BHB A;  1R1T A;  2MLK A;  3IHU A;  4I02 A;  5LHG A;  1HDP A;  2FNA A;  2XSD C;  2L7K A;  2ECC A;  3F6V A;  1USS A;  1VQ9 I;  2CO5 A;  1SD5 A;  4GCV A;  2HDC A;  1J09 A;  3AL0 B;  4A3K J;  1ON2 A;  2W48 A;  1GDT A;  4XN3 A;  4M9Z A;  3K70 D;  3WTW C;  4B8X A;  2ZJP F;  4LGW A;  5JLX A;  2P5V A;  3C1D A;  2L9S A;  3TBI A;  4PFP A;  4E7J A;  3FKJ A;  3M8F A;  1L3L A;  1Q1V A;  2XF6 A;  2QGU A;  3CCR I;  2B9S A;  1DP3 A;  4D9J A;  2Q2E B;  4KIT B;  2IGN A;  4OIP F;  1BI2 A;  4BJT A;  5E1Z B;  4IQ4 A;  3P5J A;  3QOE A;  2V79 A;  5CLS A;  3A4C A;  2EA4 A;  2DA6 A;  2LOO A;  1LEB A;  1FMV A;  3CO6 C;  4BQA A;  4I0B A;  3OS1 A;  1O3R A;  4A2U A;  3SEZ A;  1KQ9 A;  3E6B A;  3L2U A;  2RN7 A;  2XUB A;  2EJR A;  3FHZ A;  4IX7 A;  4G7Z F;  1TWA J;  1P4W A;  3RKW A;  3LSJ A;  5DM7 F;  2Y0S N;  4IXA A;  5L3C A;  2EFW A;  4B3X A;  1T38 A;  4WXC A;  5L3F A;  3ULQ B;  4FX4 A;  4J19 A;  4ZTF A;  3V7R A;  4YRV A;  2LFB A;  1S7O A;  5D8K B;  3SEQ A;  1HLV A;  1OLT A;  1QVU A;  1EA3 A;  4W1U A;  2AHQ A;  1PP7 U;  5IY5 H;  1W0U A;  1TLH B;  5LEK A;  1M1E B;  3CJQ B;  2X1D A;  1KZH A;  5J8F A;  4F7Z A;  4Q4Z F;  2UUZ A;  4QPQ A;  4R1H A;  1ETW A;  1X3Z B;  2Q1Z B;  1WJ5 A;  3LSM A;  5HS7 A;  3JRB A;  2VUM J;  1QZE A;  2QSG X;  1FJL A;  2IPQ X;  3PL8 A;  1O3Q A;  3DPT A;  2LYC A;  1D3Y A;  2EIK H;  2DFI A;  3AG2 H;  1J75 A;  1KGS A;  4NQW A;  3LAJ A;  1SMT A;  2P81 A;  3J7Z I;  4ZYD A;  4UHT A;  5J8C A;  1W36 D;  2L3D A;  2VC0 A;  2BY2 A;  3B6C A;  3I4N J;  3ASN H;  3HDD A;  3H36 A;  3L2C A;  2CU7 A;  2E1C A;  2M4K A;  2QQB A;  2D45 A;  2WB1 N;  5F6F A;  3G73 A;  3LFU A;  5L3E A;  1MSF C;  3MZH A;  2FBI A;  2L4A A;  3BLY A;  1D8K A;  4HF1 A;  2E19 A;  3BZC A;  4EJW A;  5F0F A;  3DFG A;  3KP7 A;  1OIS A;  3DU6 A;  3K7A J;  2V1N A;  3GTM J;  5K5Q A;  3MMY B;  2JA2 A;  2PMH A;  2P5K A;  1BA5 A;  2LTP A;  2R5Y B;  3M8E A;  2QA4 I;  2DA4 A;  2KL4 A;  3PNV A;  1B4A A; 
#chains in the Genus database with same CATH homology
 1T0F C;  2DXI A;  1SFK A;  3L2Q A;  2E5N A;  3J7A Y;  3OYC A;  1YX3 A;  2V4J C;  4PJN A;  3UR3 C;  1AA7 A;  3DKY A;  3PSI A;  2BVM A;  4F55 A;  3OYB A;  2HDW A;  1DQU A;  3E1S A;  4E7Z A;  5FRM A;  3DPU A;  5HNH A;  4PJL A;  2ELJ A;  2QKM B;  3PFY A;  2LH9 A;  4YEJ A;  4LIT A;  3MKW B;  2L5Q A;  4Y3O A;  2WY7 Q;  2KRH A;  2CV0 A;  3AFH A;  4XQF A;  1D1C A;  3OR1 C;  1NG6 A;  3PUB A;  2V6E A;  2WB1 A;  4F93 B;  2M7A A;  4E7I A;  1FMW A;  3TMO A;  4DBQ A;  3E0J B;  4HST A;  4ZJZ A;  3ZCO A;  2MFZ A;  3QOD A;  1T95 A;  2HVQ A;  4AVZ A;  2OC6 A;  3K6G A;  2DCE A;  3VYT B;  4N4O B;  2IS2 A;  3KX2 A;  4HRI A;  3A2K A;  3EUA A;  2VJ5 A;  3S3N A;  4N4N B;  4Y4R A;  2X51 A;  2IXS A;  4KT6 A;  2M3A A;  4PJM A;  4ZYA A;  2JSP A;  2LY2 A;  4XKW A;  5JHF A;  3ZQQ A;  4BJ6 C;  1WJF A;  1QHG A;  2E1M C;  2XDV A;  3K70 C;  1V5G A;  2RRE A;  2CW7 A;  3PSF A;  4BJ5 C;  1G8X A;  2WAF A;  2VIX A;  1LKX A;  3AL0 C;  1WJE A;  4XKC A;  1BR4 A;  2KMU A;  1D0Y A;  4HSR A;  3K4K A;  3QYB A;  1DGR M;  4XOR A;  3CES A;  4BE2 A;  2OV7 A;  3FBI B;  2K9M A;  2VQH A;  4J01 A;  2CH0 A;  3SZG A;  5HOO A;  3PJR A;  4HNU A;  3MD2 A;  3VWB A;  2R7X A;  2MD0 A;  3IP4 B;  4CCN A;  2XAU A;  2VXZ A;  3U21 A;  2IS4 A;  4AYB A;  4ZDP A;  5CQG A;  2X1E A;  3AKZ A;  4RLQ A;  4XMY A;  3OYJ A;  3VYU B;  4CUG A;  4F3Q A;  2DT7 B;  3K4J A;  3C2G A;  3PNV A;  3S8P A;  4E7H A;  3MKZ A;  2HVR A;  1K6Y A;  2L9N A;  4RMN A;  2WBM A;  4C9Y A;  4BL0 B;  1PYV A;  5CQE A;  3K4L A;  2VPL A;  1V5E A;  2GOM A;  2UWM A;  3H9Q A;  2A5W A;  1D1B A;  1VZ0 A;  2A6T A;  2HNH A;  3GBG A;  5FRO A;  3S3O A;  4XON A;  1LFP A;  2P0W A;  1D1A A;  4E7S A;  2XF5 A;  4HPQ A;  3OIQ A;  2W82 A;  2VAS A;  3DQV C;  4E6K G;  2MYS A;  3OS2 A;  2KPM A;  3ZR8 X;  3H5N A;  3FDY A;  2WAE A;  3DLA A;  4HEA 2;  3OYE A;  4XLC A;  3D5L A;  4MLO A;  4XLF A;  3CJR B;  4AU7 A;  5CKT A;  1N77 A;  3W2V A;  4F92 B;  3HUG B;  2XC7 A;  3RPU D;  1Z3X A;  2DJI A;  2Z2S B;  3D5R C;  3G2B A;  4BDZ A;  2WAQ A;  2V7F A;  2V9K A;  3OL4 A;  2VXD A;  4XNF A;  2LBF B;  3HG9 A;  4P1W A;  3VSK A;  2CMP A;  4KJZ A;  3EUH C;  3DEE A;  3CP2 A;  4PUS A;  3L2R A;  2VB6 A;  2VLA A;  4ZTJ A;  4BEH B;  3LSI A;  1S9H A;  1BR1 A;  1R6R A;  1W36 C;  2BOL A;  4DGW B;  2XF7 A;  1Y6I A;  2KRC A;  2R7T A;  4CZC A;  2IGK A;  3LSH A;  4JOM A;  3OMY A;  4DJA A;  2CFO A;  3HPG A;  4XN0 A;  2ZSI B;  5CPR B;  3HOS A;  1X1A A;  3I9V 2;  2WA0 A;  3OYN A;  2HZD A;  3DU5 A;  2MAB A;  2Z16 A;  3F9K A;  3H9G A;  1P9Q C;  2OUM A;  3BCA A;  3OL3 A;  3EUK L;  3S93 A;  5HLT A;  2R7Q A;  1X19 A;  3OYA A;  2PMZ A;  4PSX A;  3L2V A;  4CSW A;  4XLH A;  1X4O A;  3MKY B;  4IKF A;  2F4I A;  2BW3 B;  2LRE A;  3DKX A;  3HL2 A;  2AQF A;  1V5F A;  3K4B A;  3H0D A;  4BGD A;  1MMA A;  1X1B A;  3OYK A;  4C30 A;  4R79 A;  1HA8 A;  2X6X A;  2E60 A;  5HNF A;  4DBR A;  4XKV A;  4XKB A;  1MMN A;  1UEL B;  2MC4 A;  1G59 A;  4C2T A;  3BG6 A;  1Y56 A;  3PNY A;  2R7W A;  4BS9 A;  4FET A;  2VL8 A;  2X6Y A;  3HC7 A;  2X85 A;  4OAZ A;  3HKZ A;  4NNJ A;  4KIS A;  1X1D A;  2KQR A;  4D1Q A;  3LMM A;  3IAM 2;  1D0X A;  2M4G A;  3OOU A;  1D0Z A;  4NC8 A;  4C2U A;  1ZEL A;  3QYF A;  4CCJ A;  3A1Y A;  4E7L A;  5KHD A;  2KDO A;  3RSN A;  4BE1 A;  4NC7 A;  2I8D A;  3K10 A;  2IGM A;  2HU9 A;  4J00 A;  3LL7 A;  3HXL A;  1UG0 A;  3DTE A;  4QPO A;  4IZZ A;  3VYR B;  4RLF A;  1N78 A;  2W1O A;  4B44 A;  3OYG A;  1Z3Y A;  1YX5 A;  1Z21 A;  1WJC A;  4CCL A;  3OYD A;  4ITV A;  1N75 A;  4NQW B;  2VQG A;  2HVS A;  3PNT A;  3BG7 A;  3S32 A;  3FHN A;  4XLE A;  3H9J A;  3SDB A;  3ZRG A;  2PJR B;  3OR2 C;  3OYM A;  4BXF A;  2VKH A;  2Z1D A;  2ZSH B;  3K4M A;  3SYT A;  2CUJ A;  2VKD A;  4XOP A;  1X1C A;  3OYF A;  4B48 A;  2RQQ A;  3DPL C;  4EAT A;  5LD2 C;  4ANJ A;  1LDK B;  2K3P A;  1LVK A;  2JVG A;  3LSK A;  2O5R A;  3C2H A;  3FBN B;  2R4G A;  4PK4 A;  3ZGK A;  1MND A;  1ERD A;  4BDY A;  1MNE A;  3NWS A;  1WJB A;  4G6T B;  3OY9 A;  4H4K C;  2BVL A;  1PJR A;  3KEY A;  2LC2 A;  2QKL B;  2W00 A;  2Y0S A;  2NOJ B;  2X1C A;  2UV1 A;  2FUG 2;  3V42 A;  2VJI A;  1DGW Y;  2WY8 Q;  3CP8 A;  3CZ6 A;  3HOT A;  3CF2 A;  3RQ4 A;  2IGO A;  3K4N A;  2K5C A;  1WJA A;  2R7U A;  2M7B A;  1MMG A;  3CMM A;  3K4C A;  4CCM A;  3LSG A;  3EPZ A;  1IRX A;  2F6C A;  2WAD A;  2E5Z A;  2ZXH A;  3DTI A;  2CS3 A;  3OS0 A;  4RM2 A;  4HNT A;  4OAY A;  4XM3 A;  1QHH D;  2R7S A;  3L2W A;  1UAA A;  2E1M B;  2RNG A;  3OWT A;  1WJD A;  3W2W A;  1WFX A;  2CUZ A;  4CA0 A;  4PSW A;  2L7K A;  3BC8 A;  4BEH A;  4JQF A;  4YEL A;  3RTR A;  2VJJ A;  1J09 A;  3AL0 B;  4XOT A;  2K9L A;  2LY1 A;  2ZXI A;  4XN3 A;  4F52 A;  3M8J A;  4LIV A;  3K70 D;  3I3L A;  2KP6 A;  2R7O A;  1TZL A;  4ZDL A;  2R7V A;  3BCB A;  4DOZ A;  5FRN A;  2KLO A;  3TL4 X;  4XR6 A;  2L9S A;  2X6W A;  3UNG C;  3OYH A;  3TBI A;  3VYS B;  4PFP A;  4E7J A;  3FKJ A;  3H5A A;  2XF6 A;  4RM3 A;  4P5O A;  1BOB A;  1DP3 A;  4D9J A;  2Q2E B;  3W2A A;  4KIT B;  2IGN A;  2LG4 A;  4ZDO A;  1MW7 A;  2BW3 A;  2AQE A;  4BJT A;  3VDX A;  4IQ4 A;  3NWT A;  3QOE A;  4FAS D;  1SAU A;  5KNL A;  3S3M A;  3A4C A;  2LOO A;  3ZXS A;  1FMV A;  4IQJ A;  2VQL A;  1NG7 A;  3OS1 A;  4II3 A;  2VJ4 A;  3SEZ A;  3L2U A;  4NUB A;  1X4P A;  4IX7 A;  2KZV A;  2ZFU A;  2R7R A;  1QU3 A;  3OYL A;  1KON A;  2DOA A;  2JUG A;  4B3X A;  1GLN A;  4II2 A;  5TGT A;  2KHM A;  3DTK A;  4ZTF A;  4YRV A;  4E4H A;  3SEQ A;  3ONQ A;  1OR7 C;  4BUP A;  1OLT A;  1EA3 A;  1TT0 A;  3N05 A;  3HPH A;  3IUO A;  2CW8 A;  4GRI A;  2HPM A;  4LG3 A;  2F5V A;  3CJQ B;  2X1D A;  3KYL A;  3W3C A;  3QYE A;  4XLA A;  2UUZ A;  4QPQ A;  4BQQ A;  3D5S C;  3DWL E;  2Q1Z B;  4DIQ A;  3IAS 2;  1Z7L A;  1WJ5 A;  3LSM A;  2HQA A;  3RCO A;  3VSL A;  2VQC A;  2V26 A;  3PL8 A;  4E7K A;  1YE9 A;  4LIU A;  2GOX B;  2M0M A;  3DPT A;  4BU2 A;  3H5R A;  2LYC A;  5HVQ C;  1U0J A;  1JI8 A;  2CV1 A;  4Y33 A;  2W4S A;  1BR2 A;  4CCO A;  4BAC A;  1W36 D;  2IS1 A;  4PFO A;  4F91 B;  2PJR A;  2M4K A;  5KCM A;  4BQN A;  4BQO A;  3LFU A;  4XL9 A;  2L2O A;  4HG2 A;  4B47 A;  4CCK A;  4B43 A;  3H35 A;  1MMD A;  2HPI A;  3BLY A;  3OIP A;  4CH7 A;  3OYI A;  4OWR B;  4U7B A;  4X0G A;  4BE0 A;  2JVH A;  3DU6 A;  2V1N A;  2W7N A;  2XSJ C;  3M1C A;  5LFA A;  4ZC3 A;  3MMY B;  2JA2 A;  2DT6 A;  4U87 A;  2IS6 A;  2CV2 A;  1E0E A;  4PJJ A;  2LBF A;  2KL4 A;  2LRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...