2L7KA

Solution nmr structure of protein cd1104.2 from clostridium difficile, northeast structural genomics consortium target cfr130
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
b'MIRLTIEETNLLSIYNEGGKRGLMENINAALPFMDEDMRELAKRTLAKIAPLTENEYAELAIFAADEVLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Clostridium difficile
publication title Solution NMR Structure of CfR130 from Clostridium difficile, Northeast Structural Genomics Consortium Target CfR130
rcsb
total genus 20
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14203 TTRAP Putative tranposon-transfer assisting protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1850 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l7kA00
2L7KA
chains in the Genus database with same CATH superfamily
5BQTA 1MH4A 3GCMA 1VQLI 2HZDA 3B6AA 3HUGA 4XK4A 3LA2A 1QZEA 2ZSIB 3LA3A 1JI8A 4ITVA 4Y3OA 1ZG3A 1LJ9A 2V9VA 2X4HA 2EIJH 4L9JA 5CVJA 3HGYA 4QPQA 2PMHA 1Y1WJ 5IPAA 5C3EJ 3UR3C 4OIRF 4EM1A 2R93J 1IN4A 1XSVA 1MJAA 1QPMA 2CG4A 1R58A 1BI1A 5CVUA 4EEFG 3CCEI 3QPHA 2G7UA 2BY0A 2TRTA 5D4SA 2DTZA 3MD2A 1W0TA 1X58A 4V2GA 3W6KB 1FOWA 4UNOA 4IHSA 1W5SA 2O9LA 4XLPF 3BWGA 1UCRA 2M2EA 3ISPA 3JAMK 4BYYA 2ECCA 3D0SA 1ODDA 1UELB 2EIKH 3GLXA 4JK1X 1MBFA 2DXIA 1PYVA 1V55H 2K9SA 3SHFA 1MMSA 1JT6A 1T95A 1U5TC 2EPFA 4MO7A 4RAFA 3IAM2 1D0YA 2D1VA 2P0WA 4M74A 4B48A 4LB6B 1TTYA 2X9DA 3BTIA 1XGMA 2R5YA 1HF0A 3LSGA 4RGUA 1BL0A 1I27A 2EFNA 2IGKA 3LNQA 4AYBA 5BPIA 4BY1J 3DKYA 2HDDA 2YR2A 3CJRB 3ZN1A 1ZG1A 2MC4A 1MBHA 2DA3A 2QQBA 2EINH 3A2KA 1TT5B 4PSXA 2AQEA 1VTNC 2DO7A 2K4JA 2VJ4A 4M3GA 3B6CA 3LSJA 1OCCH 1YIOA 5BNGA 3KYLA 3S3NA 1UHWA 1NK2P 1DP7P 2BW3B 1FWZA 2E5NA 1YTYA 3G71I 5FRMA 1UFMA 2GM4A 5EZGA 1XGSA 4U88A 3T1BA 1HCRA 4A3DJ 2R7TA 2CO5A 3LQQA 4XRMA 1AA7A 4ASNA 4CXFA 4EGYA 4OOIA 1BI3A 2L7KA 3G1MA 4J19A 1R4MB 2HZTA 2Y9YA 2HOSA 4JQFA 4PFPA 1MIJA 3QYFA 2AXTC 5HODA 3TW6A 3TBIA 1U8BA 2DOAA 2DJIA 2CW7A 1V54H 3NARA 3VEPA 3AL0B 2RREA 1T98A 4LIUA 2N8GA 3H36A 3U9GA 3CCJI 2OZ6A 2K85A 1H88C 2Y2ZA 3CC2I 4XL9A 3VB2A 1OISA 1JJ8C 1ZRCA 2RAEA 1AKHA 1I1SA 4RGRA 2NAZA 1RESA 4R79A 1B72A 1OKRA 3HKZA 3VYUB 2XB0X 3LMMA 4QLCU 3DLLF 3P9IA 4MFEA 3O3KA 2ELKA 1IJWC 2KMUA 4DOZA 3VYRB 1YFHA 1MW7A 3LSHA 3ONQA 1B9NA 4G12A 1YI2I 1FPQA 4GCVA 1JUMA 2Q2EA 2FBIA 1KQ8A 3PQJA 1SD6A 4ZZLA 5KNLA 2LY9A 4LMYA 4NBQA 3QYBA 1P9QC 4XBFA 2PJPA 1WPKA 1LFUP 4H4KC 5HDKA 1DU6A 2Y30A 1G59A 3WG9A 2ME6A 4UVBA 2FJ1A 3F23A 3LFUA 1HKTA 1SC7A 2HQAA 3DEEA 1F5TA 1KU7A 4I0AA 4DNCA 4BE1A 3HHHA 1I3AA 2XPUA 1EH8A 2COBA 4LK1F 2VC1A 3HIFA 5JLXA 1AHDP 1JGSA 4NNJA 3GFIA 2F4IA 3COAC 2FRHA 4ON0A 2MA3A 3F9KA 3GFLA 2XKOA 2LDUA 1FIAA 1EF4A 1YS7A 3J81K 4FTHA 3GVAA 3ECOA 2NS0A 3JRCA 2ELHA 4YIIA 3J7ZI 3GTLJ 4X1EA 3HJEA 1B8IB 3I9V2 2F5FA 3OIOA 5DCMA 4LB5A 1TT0A 3MZ8A 2NVUB 3J7AY 1TP4A 5ED4A 3GZNB 2IGNA 4CZZA 3S1MJ 2EFPA 1PUFA 2CV0A 1X3UA 5DYMA 2CUEA 1OR7A 4HRIA 3CMEI 3CJQB 2ZJ2A 3HPGA 2HXIA 2DT5A 1MD0A 2EZIA 4PJJA 3OYHA 3VOEA 4IJAA 1IXSB 3WU1B 2NYXA 3BR1A 3E1SA 4DZPA 4AIDA 1O3RA 2VPLA 1TWHJ 3IKVA 4LK0F 2GXBA 2DPUA 1RNLA 3C7JA 1K6YA 2IPQX 1LE8B 1JTYA 4HLXA 2JUGA 2R7SA 4UY8I 3F3XA 5E1XA 3WGHA 2WV0A 1WJ5A 5JVGF 3F72A 1LVKA 4YFKF 4DBQA 3IRQA 4M9XA 2VLAA 2L9SA 2LFBA 4DYQA 1FC3A 2JSPA 3BQYA 1P7IA 1U5TA 4HPQA 4A3BJ 2BXZA 4ENMA 1R22A 2MH9A 2GWRA 1UZCA 3N05A 2O8KA 2R7XA 2LY2A 3HZJA 3JRBA 2XF5A 2XAHA 3MKLA 3BROA 3TOAA 4N4NB 5J1RA 1O7FA 1S8NA 1XCBA 2MD5A 3KEOA 3IL2A 1XX5A 3OYJA 1WI3A 1TW3A 1HC8A 4P9FA 1Z3XA 1H9TA 3SFIA 3OYAA 5ILVA 5JHFA 2K9MA 1V3FA 1ZAOA 2HYFA 4W97A 4BQOA 3KZYA 1XN7A 2CV1A 3G6EI 4AWXB 2STWA 1DUXC 5GPAA 4NQWA 4EMSA 1WJEA 4D1QA 3CCUI 4V2FA 5KAFC 3K70D 4EATA 3GTKJ 3PIPF 4HEA2 4XN3A 1A31A 3GO5A 1WZ2A 2E71A 4UHTA 3HOZJ 4CA0A 3PIOF 3BJOA 2ZMEA 2AXLA 1QBJA 1YW8A 5IP6A 4IPAA 1Y1VJ 3S32A 1D5VA 4ESFA 3ZQIA 2M87A 3REOA 3JRIA 2LYCA 4C3HJ 4C9YA 5KHDA 1SFOJ 1H0MA 5C44J 5TISC 2NS8A 3KETA 2E1OA 1R5ID 3PNVA 3RPUD 2ELJA 3I54A 2STTA 4I2OA 3O2PE 2WTEA 2VKHA 2EQRA 4HF2A 1RETA 3RI4A 4BGDA 2R7FA 5E3LA 2XAGA 2PQ8A 5TRDA 1ZQ3P 3W6VA 2LP0A 5E17F 1ZRFA 2X6XA 1P6RA 2WC2A 3WTVC 4EJTA 4LD5A 4EJWA 4DYCA 3DBRB 3IH3A 3CLOA 4IHVA 2UV1A 3KEYA 4B4CA 1FJLA 2F4OB 2MSYA 1JHHA 4IEJA 4XOTA 1U6GA 2BBYA 2KDOA 4F91B 4HW0A 3MWMA 2V6EA 4I09A 3H9GA 2VJ5A 3FZVA 1LE8A 2E1NA 2XSJC 3LAJA 4HX8A 2KRCA 4IL6C 1FMWA 1XMXA 1TQMA 2VQGA 5E1WA 1VQ7I 1ON1A 4M3FA 4NC7A 1F1ZA 1TWCJ 2E1MB 1I50J 2FX0A 1JGGA 3BTCA 1QZYA 4KFCA 1PUFB 3GTGJ 2M1BA 3DTEA 3IHUA 3MAJA 1LB2A 3RQ4A 3HGGA 2R5ZB 3TDZC 4EJUA 4BE2A 3DTKA 3I71A 2CV2A 1BI2A 1Z05A 3ML6A 1B8IA 2F5CA 2E2HJ 3C2GA 2MGQA 2FA5A 2HYJA 1Z1DA 4E7KA 2P6SA 2V4JC 2VOOA 2Y31A 3FXLA 4AU7A 1VQ4I 5M3MJ 3D5RC 2EB7A 4IZZA 1ENHA 2I5UA 3WHCA 4BHPA 4XRSA 1HOMA 1F43A 1MBEA 1Z0XA 4XLNF 3GTJJ 4KICA 1KYZA 3R0JA 5FLXK 1T39A 1JKRC 5FRNA 2RV8A 2GOMA 1AWCA 4WWCA 1TLHB 2ZJRF 2Y9ZA 3KYCB 3OIQA 3ZQQA 4DW6A 3HYIA 4BQNA 2QBYB 2K4BA 1BR2A 3CUQA 1BW5A 3KP5A 5EYRA 3LSMA 4YG2F 3PUFA 2J5PA 4KYWA 1XTAA 1IXRC 1MBJA 1YW9A 5FB2A 1LFBA 3FXJA 4E7HA 5LD2C 4A6DA 2CFXA 2E7XA 2L3DA 2O6GE 4LITA 1HSJA 4CSWA 4LLNA 4P5OA 2IVMA 1W7PA 3KE2A 3HL2A 4BXFA 1ACIA 1QO0D 2UZKA 4KDPA 1HA8A 4XM3A 1YG2A 3OR2C 1YIJI 2QQAA 2QQ8A 1D1AA 1WJCA 1USTA 4LLLA 2DYRH 4EJVA 3RYRA 2CQKA 3EDPA 1F4KA 2PJRB 4GFBA 2JPCA 4IVNA 2DA4A 2R7QA 3BTLA 3OWTA 3BG5A 1BIBA 4HF0A 4M6XA 3BTJA 2NNNA 4Q48A 2YU9J 4XKWA 4RAGA 1PUEE 3L2QA 5EEAA 5FFXA 3J7AO 3V8KA 4B8XA 3J81Z 2ID6A 1V5EA 1Z21A 1NK3P 2OA4A 1NG6A 3P9KA 3EETA 1ON2A 2ZJPF 4OIOF 2XGDA 3AG3H 4OIPF 1VQ9I 4V19K 2QM3A 3GX4X 3BZKA 2A5WA 4WXDA 5K1YA 2VC0A 1VF9A 1S9HA 1J5YA 2FQ3A 3FMQA 3FHNA 4AYBN 3WTSC 4XKVA 1JHFA 1MDMB 5CLSA 3WGIA 4BS9A 3T8TA 1X1PA 3K2ZA 5JLWA 4IHWA 1HSTA 2JN6A 1QNTA 2IGMA 2V9PA 1JUPA 2JTVA 1A36A 1BA5A 4CUGA 1YX5A 3DEUA 5IOYA 2QWWA 2IGOA 3HKZN 2CGPA 3AG1H 1HLVA 1OJLA 4D7NA 2OTJI 3FX3A 2FBHA 2HQ5A 1EA3A 4MIMA 2M34A 3L2UA 1D1CA 2KIMA 1IN8A 2OQGA 2ZMEC 5J4YA 1FBQA 3CMMA 2ZO4A 2M8EA 2PEXA 3NEUA 4LIVA 3GBGA 3S93A 3JW4A 1ZLJA 3QODA 1A35A 3S2HJ 1YE9A 1WQ2A 2CMPA 2ZXWH 3I3LA 2LBFA 2WB1A 4E7LA 3GTMJ 1T38A 5F08A 4ENKA 3ZN0A 2DA2A 5DD4A 3IKTA 1OYWA 1OYIA 4GGGA 5HLIA 4N9IA 1P7JA 5A2QK 2NOJB 1N78A 1U0JA 2FF4A 1I39A 4FE7A 1LDKB 4I98B 4PUSA 3QOEA 3S15J 5LLQA 1JE8A 1PJRA 2A07F 2BVLA 5FKNA 2OQRA 4G6QA 4BDZA 2GA1A 4FASD 1IV8A 3Q0VA 2F5VA 2X1CA 2XASA 3C18A 2QA4I 2L9RA 1BIAA 4JX4A 2A3SA 2Y48A 1IN6A 1XS9A 3D1NI 2HKOA 1ZARA 2FOWA 2L02A 3E3VA 5D5XB 2LR8A 1WFXA 3S8PA 3QPTA 3EYIA 1PVEA 1WHUA 1ZH5A 2IS2A 2IBDA 1VI0A 2Z33A 1DGWY 4BEHA 4S05A 3OSFA 1UJ8A 5K5OA 3HUGB 2Q8KA 2CFOA 1CF7A 3J80Z 3DCFA 4U0YA 5KCMA 3RIRA 1BOBA 3CDHA 2NVYJ 1J7KA 5E79C 3GTPJ 3AKZA 2XDVA 2WWYA 3ABTA 4HQEA 4LFUA 5LHGA 3L9FA 5FROA 1TQPA 5CVVA 1K61A 1RKWA 2H8WA 4M73A 1O7LA 3RZDJ 2PI0A 5E8GA 1JKQC 2QZ8A 2OZUA 4B1RA 2DPDA 1ZHFA 5E3MA 4U0VA 5HS8A 4XMYA 1VQPI 4CCMA 2G9WA 3A4CA 3JCUC 2BVMA 2W25A 2DFIA 2XROA 2W82A 1RPWA 1JJ6C 4YRVA 2VONA 2E34A 3PFIA 3BG3A 5LGUA 3ELKA 2M45A 4JX6A 1KQ0A 4E6KG 3BOQA 2LH9A 4S0HB 1D8JA 1MNDA 3AL0C 3ZMDA 3SXYA 5LGTA 2WADA 2GXAA 1D0XA 2L54A 4F52A 1QRYA 2W84A 5FO5A 2YSRA 3CUQC 2EZHA 1MMNA 1CQTA 4HX7A 3BG6A 3OMYA 4C2TA 2HTSA 3V8LA 4DZJA 3MN2A 3GLLA 2QCOA 4HLYA 3E0JB 5DUKA 1WJBA 3QPLA 2V7FA 2FSWA 3S2WA 5D6EA 2JWTA 2WV1A 5AIQA 1T33A 2DFFA 2LKXA 1W36D 1RR8C 2JA2A 4Z2YA 1UHSA 2LREA 3HOXJ 2GXGA 4RDUA 5E8IA 3CP8A 4D5FA 4WXHA 2QSFX 2I8DA 1TL8A 2VXDA 2KIUA 3QWLA 1FP1D 3IP4B 4A3IJ 4GO1A 2HPMA 2PMZA 2EFOA 2HS5A 3ABUA 4UUVA 2L4MA 3BLYA 4KITB 2NRAC 1WKMA 2RQPA 3M3YJ 3K4CA 1XMKA 2VQLA 2IW5A 2D2WA 3ZGKA 5FKLA 3EUHA 4WF2A 1W36C 1B4AA 4J01A 3ZPLA 2HI3A 2Q0OA 1GUUA 1C0WA 1D1BA 2MG4A 1XSXA 2R7RA 2IP2A 1VQKI 2JT1A 4IXAA 4RA2A 2W24A 2H1LA 3DP7A 4XR6A 2ZFWA 2TCTA 4L9TA 2PJRA 5BOXA 1ERDA 5J4VA 5FKOA 3M7GA 5ILSA 3IC7A 2W48A 1BJAA 3SQNA 5GADJ 4UB8C 3H3UA 5DCFA 2DTRA 4HNVA 3S16J 2F6CA 4KJZA 2JQ7A 3M9AA 3HOVJ 2MH2A 3KPHA 1W7PB 3I53A 3EUKL 1B9MA 4I76A 2ID3A 1DPRA 5D4RA 1MNMC 4ZYAA 1D8KA 3OYLA 1KA8A 3FK6A 3BZ6A 2ZSHB 4PZJA 3BJAA 3BR2A 3SDGA 5B3SH 3FKJA 2QBYA 5D8LB 1YITI 3HOSA 2QUFA 3FWEA 3RDIA 3CJNA 2FUG2 2KKOA 2XF7A 3LL7A 4M3DA 2R7WA 1APLC 2XKPA 2ECBA 1U3EM 3OS0A 4A3CJ 2UWMA 2CQNA 1E2XA 2MABA 4OAZA 3ZMZA 1HKSA 3S1RJ 4NC6A 2RQQA 2E1CA 2PN6A 5JVTA 2NVTJ 4CCOA 3O6BB 3BG9A 3KYDB 3OYGA 4B3AA 1RKTA 1MH3A 3PFYA 3JTGA 3ZQGA 2E36A 4HOBA 2R92J 2JSCA 1FYKA 4ESJA 4RB3C 3OR1C 1QA6A 4UV9A 2QENA 1BC7C 4WK8F 4JYKA 2KQRA 4NB5A 1RRJA 2VODA 2L5QA 3A1YA 4FETA 4M3BA 4XLCA 4XIDA 2L9VA 2ACJA 2DAOA 1D3YA 3ZQLA 1GLNA 4G6TB 3ZMUA 4JX5A 3JAMZ 5FD5A 4HV6A 4I01A 2E2JJ 4XLAA 3GMEA 2BHYA 5K7HA 4XQFA 2V1UA 2DOEA 4KUMA 4E7ZA 3RTRA 1R5GA 2HPIA 1SMYF 4A2UA 4D9JA 5LHHA 1FEXA 3BCBA 1NG7A 3DTIA 2V6CA 3E6MA 4BXUA 2KZVA 3ASOH 2PX9A 1ZR4A 1PP7U 1ZTRA 2KDZA 1R5HA 2K7LA 2HOAA 3FXKA 3K9TA 2M0CA 3CDIA 3U2RA 1Z77A 4KIBA 5F04A 2H09A 4A5NA 5J8FA 3FHZA 1YLFA 2ME0A 3W6JB 1FIPA 4BU2A 3MKZA 1Y0UA 3R60A 3WHBA 1J59A 3DPTA 2DMTA 2QYOA 4BE0A 4GYIA 1GXPA 1V5FA 2VN2A 2GIVA 3HTSB 2HR3A 5HVQC 1G4DA 4A0YA 1L3LA 3K69A 1HDPA 1LVAA 2K9LA 2VKVA 3QQAA 1OCZH 3R4KA 1R71A 4OU0A 4PGGA 3Q5FA 3WU2C 2ZMEB 4CCLA 1FBUA 2Z16A 3ZOBA 3ERED 3ZMTA 5E18F 2H8RA 1MSFC 3S17J 3QAHA 2VBZA 4C2UA 5HDNA 3KZIC 4Q4ZF 4QTRA 2LOOA 3ZMSA 1E3PA 1FYMA 4Z6YA 1GV5A 1GT0C 3LQRA 4XORA 4NQWB 2YPRA 2C6YA 2X1EA 3TKYA 4IRHA 2KIFA 5F0FA 3OYIA 5DV5A 3TO6A 1DQUA 2WAEA 4CHUA 2UUZA 4BJ6C 5IT3A 4A6EA 1ETYA 2Z1DA 2CH0A 4MFDA 4KN4X 3TP3A 1J75A 2X6YA 2M0MA 2M7BA 4B3XA 2CQ7A 4EVIA 2XAQA 2QLZA 3CCRI 3F6VA 3D5LA 4KIFA 1MSEC 4XLHA 2FMYA 1IRZA 1H89C 3ZCOA 5L3BA 1RUOA 4ZDPA 3P9CA 3E5QA 3MEXA 4G7HF 1CF7B 5EJCA 4QWQA 4RM3A 3K4JA 1FMVA 3TW7A 1I3QJ 3DBLB 2EH3A 1FX7A 4GXOA 1XDSA 2OC6A 1POGA 1K4TA 5FGMA 2R4GA 2VPRA 4ZH4F 3S3OA 4X6AJ 2HDWA 1TW2A 4AIJA 2EFWA 1O3SA 5HNHA 2HNHA 3T5XA 4IQJA 2DK5A 2ZB9A 1SFEA 2K9QA 3JSOA 5J1UA 4IKFA 3K4NA 2K3FA 2NS7A 3HTUA 3P7NA 2XAUA 3S1NJ 3S14J 4II3A 1MGTA 2MD0A 1QVTA 2W7NA 1VNDA 2HVQA 1OQYA 3OY9A 1WH5A 2BE5F 3KP2A 1UHMA 4RLQA 2Y0SN 3CTAA 3QP5A 3M1EA 5EG0B 2LBFB 4A3KJ 1R9TJ 2NNYA 4KN7X 2P8TA 4M9ZA 1TZLA 1LPQA 1JKPC 1N77A 2XSDC 4UUTA 1KU9A 2CJJA 1K83J 3GUDA 2H6BA 5E3NA 2LNBA 3GFJA 3WE3A 4CYCB 4EGZA 1TNSA 2EV5A 2KFDA 2VT3A 3GXOA 1ETVA 3DLAA 3DWLE 4AD9A 2DW4A 3SZPA 4ZYHA 2L7FP 4O3MA 1IZ1A 1O3QA 1J0RA 1Z9CA 1I5ZA 2HU9A 1R1VA 3BR5A 3GEZA 3LOCA 4QIWN 1SFXA 3CCVI 1ZN2A 5DD8A 4RB1A 1QHHD 2OJED 5J1YA 1KGSA 3CP2A 4IF4A 2AS5F 3SYTA 4M6VA 2CW8A 1S7EA 1E3HA 4HDUA 4G7ZF 1E17A 1SD7A 4XSXF 3SEZA 4XRSG 5D5UB 1WI9A 3CC4I 2ETHA 1YO5C 2P6TA 2Q2EB 2QVOA 3RYPA 4YIRX 1X2MA 2MLKA 3FXOA 5IP9J 4NUBA 3QU6A 5F64A 2O7OA 2LKSA 4NDLA 5GAGJ 1ONVA 3JRAA 1Y39A 2V1DA 1BN5A 3IRRA 5ICCA 2JA7J 1T8IA 1JUSA 2CUJA 5H20A 1B6AA 3GFMA 2M9HA 1WGXA 5IY5H 4O6JA 4PJLA 1TNTA 4Y15A 1SEUA 5BPDA 1HKQA 2WAQN 3NQOA 3CLQA 2OTLI 5LRRA 1T6SA 5TJJA 1KONA 4D7MA 2IRFG 5ERIA 2L01A 3V4GA 3HRUA 3KLNA 4HX4A 3H5NA 4KA4A 2DDBA 4IHYA 4D5CA 3JREA 1O4XA 4RGXA 5EEGA 4OMZA 3PSIA 3BQZA 3H9QA 2QSGX 3OL4A 1ZGAA 3DF8A 5CPRB 3ZQHA 2V1NA 4P9UA 2VBWA 1SVMA 3FBIB 4RBOA 1HW5A 2UXXA 2XVCA 1K7AA 5LFAA 2P5KA 2KPMA 1FT9A 4HSTA 1H9GA 2XRLA 2H94A 4BHCA 1NTCA 4E4HA 1P4XA 2ZKZA 4MHGA 3EQLF 2BYVE 1K4SA 4UXNA 4XOPA 1W5CC 3RPQA 2H6CA 3F8FA 3CO7C 2MFZA 2PBIA 3KP4A 4FQGA 3B02A 4ESBA 1QGPA 3ZRGA 3LWFA 2XF6A 3E5XA 2OD5A 3Q0WA 2VE9A 4BH9A 3C2BA 1ETXA 4HYEA 4EM0B 1IUYA 1FOKA 2EWNA 4NHJA 2X85A 1B59A 3UKGA 1U2WA 3PNYA 3M8EA 4L9VA 1GXQA 2EV0A 1SFUA 1Q1VA 1QVUA 2VJIA 3OYNA 1YHQI 4RLFA 1X19A 3N4MA 1S72I 1W0UA 1BI0A 2A69F 3HOTA 2R5YB 3VSLA 2O8XA 3NAUA 1BR1A 5BMZA 3I55I 4J00A 3HPHA 3WE2A 5JI6A 1UG2A 2R5ZA 4IQ4A 3L2CA 3ABKH 3MZYA 2ZJQF 2HDCA 5EG0A 2FE3A 1BM9A 2WAQA 3L00A 3TDUC 1JXSA 3ZQCA 2LD5A 4RAZA 4XKBA 4AC0A 5AONA 5HDGA 2A6HF 2G7HA 1G3WA 2PG4A 3SJMA 2O0YA 3WG7H 4BL0B 4DIQA 2P7VB 2Z9OA 5EF6A 3CCSI 2HOTA 4PGHA 2DMNA 1EV7A 3E5UA 3U21A 1VQMI 5FFZA 4L0ZB 1TQIA 3S3MA 4OAYA 3GZ6A 1GVJA 1S6LA 2RDPA 3ESWB 5FJ8J 1KQ9A 1ZYRF 1R00A 3S2DJ 1WCMJ 1Z7UA 3U1KA 1M1EB 4ZTJA 2CYYA 3K1NA 4DBRA 1D0ZA 2X51A 1XGNA 1ORKA 1LDJA 3E7LA 1ETKA 1QQIA 1XB4A 4ZZDA 1ZRDA 5DUIA 4S04A 3HOUJ 1FOYA 5IP7J 1IRXA 2XV4S 3ERMA 1MKMA 2JPBA 2DLLA 5EEHA 5ICEA 2JJ7A 4E70A 4F7ZA 1PP8F 4MQ9F 4M9SA 4IOAF 1BR4A 3HRSA 3WU0A 3E6CC 2VI6A 4N9HA 2R7OA 3MKYB 5DDGA 3MZHA 3RKXA 2ZFUA 2FBKA 2JVGA 2K40A 4Y7NJ 1Z7LA 2MBFA 5M5WJ 2X6OA 2XIGA 2GBYA 2CU7A 2OAZA 2LLKA 4BBRJ 2CS3A 4R8HA 5EDNA 2D5VA 1Q1HA 2ZC2A 1MZBA 4I7HA 2IJLA 1B1BA 3HDDA 5B66C 2KJBA 3D5SC 4YIFA 2R0QC 4PJ0C 3E97A 3H3VK 3OYDA 5IT9Z 2QEXI 3IWFA 2YS9A 2WY8Q 4CCKA 3DKXA 2W85A 4BJTA 5KK1A 2DA7A 3F21A 4I0BA 3C2HA 3F6OA 4BY7J 5FLVA 1KYWA 2HOEA 4UVAA 3DKWA 3BY6A 3KIOA 2NVQJ 2JMWA 1S5LC 4Y33A 2DQLA 1EJ9A 2EZKA 1FOXA 3UNGC 2WAFA 3EPZA 2LC2A 4KMUX 4MGRA 4LG0A 4HF1A 4Y52J 3DV8A 3LA7A 2P4WA 2FOKA 3FF5A 4AIHA 2VBYA 4X0GA 1YRNA 1P92A 1TBXA 1ZREA 2Z3YA 4XKCA 2IT0A 2E19A 1UAAA 1A6QA 2EA2A 3KLOA 3PNTA 1HXDA 5H6RA 3TO9A 3B73A 2GLOA 4A3LJ 2F5DA 4F3QA 3NWTA 1YOVB 1XG1A 4A3GJ 1U5TB 3I56I 4BXXJ 2L9NA 4QPOA 3FM3A 1XC5A 3HBLA 1T08B 2ISZA 4A3EJ 1K78B 1XSDA 2ZXHA 2A05A 2LVSA 4U0WA 2E2IJ 2PFBA 1SAXA 1LNWA 2DJNA 2XGEA 4K2EA 5F0CA 1I6XA 5E20A 1IXCA 3CC7I 1IO2A 1WRJA 5LHIA 3KCCA 1T2KA 3CESA 2HGCA 3OYCA 2M5WA 3FXUA 1ETWA 1Z6RA 2L7MP 2EIMH 2G0EA 4RS8A 3PL8A 1ZK8A 2VKDA 2ESNA 1W5TA 3K70C 4CCJA 1XPXA 5DCMB 1WJDA 3CD6I 5ILUA 1HBXG 1IGNA 5CKTA 4RM2A 4TV7A 2H27A 1G3YA 2JZYA 2DN0A 4MLOA 4ENJA 4IHTA 5D5WB 4OINF 2Q1ZB 1BJZA 1E0EA 5L3CA 3CF5F 4UB6C 1JTXA 5K7ZA 2ZXJA 4FHTA 2RVCA 3K10A 2J5OA 3O8HA 3LSTA 4OWRB 4A3FJ 4Y17A 9ANTA 5B5EC 2BHZA 4KT6A 5TGTA 3PUBA 2P7CB 1Y0NA 3M8FA 4UVCA 3SFZA 2IAIA 2IS1A 2RGVA 2BY3A 1BC8C 3K4KA 2CRGA 4F92B 4DGWB 1A5JA 1YS6A 3PQKA 1K78A 3KP7A 5HOOA 2BEOA 1R36A 2L2OA 5HLHA 2V26A 4RB2C 2BZTA 3ABMH 1P4AA 1S7OA 2RNJA 3QP6A 3OYEA 2QKLB 2F48A 5L3DA 2DU9A 3DU6A 4BKXA 4PJNA 3A02A 3PO3J 5IYCJ 4E7SA 2ZCWA 4JOMA 1QPIA 2R7UA 2Z5UA 3LSIA 1XMAA 2LTPA 1RUNA 2QGUA 2KP6A 3RKYA 2V79A 1X1CA 2V9KA 4L9NA 2W1OA 1U9NA 4F55A 4A3JJ 1Y8RB 4EQQA 4DQ2A 1S29A 3FDYA 2Z99A 1YRNB 4A0ZA 2LMDA 4ZYDA 4CO8A 3RCOA 3U1DA 4UUSA 1OCPA 2DBBA 4AUXA 3A0HC 3P5JA 2DT7B 2DMPA 5K5RA 3OYMA 1Z6TA 3L2WA 1AKHB 2R7VA 3MFKA 4MQVA 5LGNA 2QSHX 1ZELA 4ENNA 3BR6A 4CH7A 1SFKA 1FZPB 4BQAA 4LG0B 3L2RA 1SD5A 4ZJZA 4KMFA 3BPVA 4KISA 3A01A 2B63J 3ZQFA 2DA5A 1BBYA 1ETQA 5DTDA 2CSOA 3LFKA 1EKEA 1XGOA 2XAFA 5FLMJ 3JSPA 2L0KA 1KZHA 3R6SA 2MLGA 3CCLI 4C2MJ 3ULQB 5D6FA 3BZCA 4RB0A 5J8CA 1UG0A 1TWGJ 2DA6A 1GHCA 1EH7A 5LEKA 2FEZA 2XB5A 2A5YB 4ETSA 4ANJA 3G4SI 2BY2A 2HVSA 2JRMA 3V7SA 3BT9A 2H1KA 2WA0A 2A68F 1SVLA 5LEJA 1N75A 4FT8A 1G8XA 1TWAJ 3LSRA 4H0EA 4LJZF 3HSEA 3TP0A 4A5MA 4BJ5C 1SAUA 2E60A 4G94A 4XNFA 3RPUA 3S1QJ 3I0TA 2GZWA 3MKWB 1JT0A 2YX4A 2EA4A 2R3SA 2XPVA 2LSOA 5KVRA 3ZXSA 2CW0F 2O3FA 5C4XJ 1HW2A 2QKMB 2DA1A 3FKIJ 1ZKGA 2L7ZA 2HQNA 1ULYA 2LRDA 3H9JA 3R0AA 5CQEA 3HC7A 1GDTA 1STZA 4CICA 5HLGA 3K6GA 4WXCA 2DMQA 2OF7A 2Y0SA 1G2HA 3H0GJ 1FBSA 5B1AH 5FKKA 3RSNA 1QHGA 3PJRA 4FE4A 1VQOI 3T8RA 2P81A 3CCYA 4B47A 2OCCH 2F5EA 3M1CA 2LF8A 4Q47A 3JR9A 3TGNA 2M8GX 3M07A 2K9NA 3V7RA 1E3OC 2VQCA 1FYLA 3G73A 3WTWC 1WSUA 2BGCA 2EZLA 3Q9VA 2OV7A 3ABLH 1R4NB 1V5GA 3I4MJ 1SVOA 3H1CA 4WCGA 1IDZA 1X1DA 2COMA 3M8JA 1OMIA 4XLEA 4B44A 4Y13A 1IRFA 2YU3A 2JK3A 4AIKA 1N25A 2E1MC 4XLFA 4BEHB 2XPWA 2XUBA 1IN7A 5ICGA 2KJCA 2EJRA 2GOXB 3HG9A 1FTTA 1OLTA 4MTEA 2EV6A 3KEQA 1O57A 3VYTB 3NRVA 1I1GA 1Z67A 2E35A 4YFXF 2VKEA 3G3ZA 4NC8A 5CYVA 1OR7C 1DPUA 1FLIA 1T0FA 4HV5A 4GYGA 4P96A 3Q9SA 3IH4A 2RNGA 3IV5A 2VBXA 2RKHA 2LF7A 3MCZA 1X3ZB 1TWFJ 2A6TA 2Y75A 1NH3A 1HQCA 1SMTA 1XCVA 2XAJA 3OOUA 3BP8A 2JA5J 5ICFA 4G8XA 1RC9A 1MJ9A 3L1PA 3H5AA 5F1RA 3F8NA 3CMYA 5HLTA 2LY1A 5M5YJ 1WWXA 3FM5A 3QYEA 3HRTA 1DDNA 2OU2A 1RR7A 4PK4A 2DFEA 2ADUA 2RC4A 1MBGA 3DEWA 4M71A 2CWEA 2GIZA 1HW1A 4LLGF 4EV0A 3LSKA 4KNYA 1WJFA 4L5EA 5L3FA 1IG7A 1KU3A 5BS6A 3GTQJ 2FU4A 2NXNB 2HXOA 4IO9F 3ROUA 2P5LC 1RI7A 5GTHC 3W3CA 4HG2A 4II2A 1MMGA 4CZCA 1R6RA 2KIQA 3VDXA 3K0LA 1UB9A 4G6DA 4DYRA 3TL4X 1MDMA 1AU7A 4RMNA 1VQ8I 1WH7A 3DPLC 3HXLA 4C30A 1X1AA 2NVXJ 3A03A 1USSA 4LG3A 1K79A 3WODF 1SD4A 3VYSB 5J47A 4LOCA 3FBNB 2X0LA 5L3EA 2EILH 3CCQI 2XRNA 1T0FC 3IWZA 3RKWA 2B0LA 4OMYA 3BR0A 5EGOB 3W2AA 1OCRH 3BG7A 2JVHA 3KZZA 1LFPA 1TC3C 4F93B 5F6FA 5IOZA 4B43A 3CO6C 5JFRA 2PMZN 4A3MJ 5DM6F 2M4GA 2OBPA 2FD5A 2WY7Q 3OYBA 4CYCA 1YJWI 4XONA 3VPRA 2WB1N 1OCOH 2UXNA 3HSFA 3J80K 3MQ0A 2M3AA 2AO9A 4AM3A 1QU3A 1IC8A 2I10A 3EUHC 2NOGA 4HQMA 1OFCX 2ZXIA 4KIGA 1W7PD 4GDFA 3X2QH 4FX0A 5B1BH 4ZC3A 4PFOA 2Y69H 1NHAA 4JBAA 4R1HA 4XSZF 5J40A 1R1UA 1IF1A 2HQRA 4XN0A 2M7AA 3I64A 2FNPA 3OS2A 4LGWA 2ZBKA 4BHBA 1ZLKA 2JA6J 1WJAA 3I5UA 3FXRA 4MEXF 1YW7A 1BOAA 3CMAI 2CQQA 3DPUA 4G9YA 3JRFA 1I6HJ 1IW7F 3CUQB 4GRIA 3GYHX 3FIWA 4I6ZA 2X1DA 3C1DA 3VSKA 4CCNA 4HDVA 4XRFA 2HFHA 4P1WA 1X1BA 3RQIA 1MBKA 4N4OB 3OL3A 3L2VA 3CCMI 1L0OC 3RJPA 2BXYA 3CJTB 3V42A 4KT5C 1QZZA 2EBIA 2XGCA 1X2NA 3DU5A 4FCYA 3IUOA 2E7WA 3FISA 2R7ZJ 2BOLA 2DI3A 1Z3YA 1OYYA 1IUFA 3QU3A 5E3OA 1CGPA 1J9IA 3W2VA 4DJAA 2QF7A 2VT2A 1UMQA 2ESHA 2V1XA 1IAWA 3BPXA 3OYFA 2DMUA 3R61A 5F27A 3SZTA 3KP6A 1ZGWA 3I59B 3LSPA 1V4RA 2L4AA 3GWZA 4PDKA 3FXMA 2M4KA 1MJBA 2K02A 2VE8A 2AHQA 3JTHA 5DS9A 3ZQ7A 5E1ZB 3K4MA 1A6IA 3MVPA 1VZ0A 3GW2A 2LK2A 4Q5SF 3H0DA 1Y8QB 3W2WA 4D0PA 1PDNC 5FLXZ 4A12A 3DFGA 4EJOA 1T56A 2BV6A 3K7AJ 4U7BA 1KU2A 1MMDA 3TOBA 2X6WA 4I99C 2EK5A 1X4PA 4JP0A 1GVDA 3G2BA 2LG4A 4XICA 2FXAA 3H5RA 2JA8J 1J09A 3HOYJ 2PMUA 4QSHA 4W1UA 3T0YA 2XGXA 2GA2A 3L09A 1S3JA 4MTDA 2W4SA 3K2AA 3OOPA 4C3IJ 5IYDJ 5FKMA 1YX3A 2Y0MA 5GAHJ 3K1MA 5IYBJ 1ZG5A 2IA0A 5D8KB 3Q0UA 2DODA 5F0HA 2O03A 3PO2J 2MC3A 4L5IA 4BBSJ 3OV8A 3H35A 4HAMA 3WTZA 3EYYA 1F36A 5HS7A 5H6QA 5GAEJ 1D5YA 4M72A 2HKXA 4IOCF 3CQZJ 3WGGA 5EZHA 1P4WA 3O8GA 4BUPA 2KL4A 3AG4H 2DDAA 4A0XA 3K4LA 1LKXA 3IAS2 3N97A 4EM2A 3NWSA 3TQNA 3FXQA 4RGSA 4UV8A 3A01B 1FP2A 3LAPA 2AQFA 1JKOC 3I58A 1XDUA 4A69C 2EFQA 3I59A 4BQQA 4CDGA 5J6XA 1J2XA 2XHKA 3E6DA 4PSWA 2BY1A 1FSEA 2VIXA 3BR3A 2F4MB 4ZDLA 4UUSB 5IT9K 2ISYA 5J3LA 1LEBA 3HB9A 2D45A 3F22A 1IDYA 3FMSA 4L0YB 4L18B 2RN7A 3DBHB 2K86A 1H8AC 4IRGA 1W1WE 3GTOJ 3OIPA 3HEFA 4N0BA 4L5JA 1P2FA 1MNEA 2LKPA 3H92A 1FY7A 2DOFA 3WTUC 4HA8A 3JRDA 5AIPA 1G3TA 1R7JA 5D5VB 4IHXA 2VJJA 5LBQA 3FK7A 3HM5A 4ZYGA 5M3FJ 3F8CA 4HSRA 4ZYEA 2OPTA 1R23A 1K6OA 1BW6A 3GF2A 1FNNA 1OCTC 3PSFA 3QRFF 1VQ6I 2CQXA 3SEQA 2IS4A 2B9SA 5K5QA 4M3EA 4M6YA 1ETOA 2KLOA 2KHMA 1VQNI 2DQRA 2KZGA 3KX2A 4BNCA 3ASNH 4Y4RA 4A93J 2VASA 2KRHA 2FQ4A 3ZR8X 3OYKA 2XC7A 2IA2A 4BACA 2DK8A 2WBMA 2YUSA 2K5CA 3G1OA 3SDBA 1R49A 2GAUA 4WX9A 2DT6A 3CDLA 2HVRA 2DCEA 4ZDOA 3QOPA 1R1TA 2KISA 2HYGD 2K3PA 3K1PA 5JR3A 4MEYF 6PAXA 1Y56A 3F0CA 2VXZA 4U87A 3RKQA 3MMYB 1U78A 4FISA 1ZGJA 3VWBA 2DYSH 1O3TA 4HNTA 5FD6A 3OS1A 5HS9A 3BC8A 1YQAA 2W57A 2Z2SB 3G1LA 4AVPA 2F2EA 2MW8A 2VUMJ 3TMOA 3K4BA 1U9OA 2JUCA 4MNUA 4YFNF 2R7DA 1HDDC 3VFZA 1X4OA 4OIQF 2M30A 4HNUA 1IV6A 2A61A 1YJ9I 3QPSA 2P5VA 3JRGA 1G6NA 1WVRA 2HWVA 3ECHA 2MYSA 3TO7A 3CF2A 1DGRM 3JRHA 2VOPA 2A6EF 4HZFA 5EGOA 3DXJF 1DP3A 4AVZA 1GV2A 2CUZA 3EUAA 4B09A 2KRFA 4YELA 2VB6A 5GPCA 3TEDA 2GQQA 1Y6IA 2ZNZA 3VODA 3GZ5A 4PJMA 4RAYA 1IN5A 1G3SA 4U7DA 5K7FA 3AG2H 2VL8A 5GP9A 5DEQA 1Z91A 5CVIA 2DFHA 5L3GA 4YEJA 3SZGA 2FNAA 1REPC 1DU0A 2ICWG 2O61A 3FMRA 3KFWX 1EH6A 1ITYA 2JRTA 3AAFA 1XD7A 4BAYA 1RZ4A 1RIOH 3KP3A 4C3JJ 1MMAA 3H3ZA 4IX7A 2IEKA 2O5RA 2W00A 3HHGA 3WTXC 3M4OJ 3F8MA 3I4NJ 3C3WA 3IH2A 4G7OF 3OSGA 1LDDA 5LRSA 2TDXA 1F9NA 1B72B 2OCEA 1LEAA 4IRIA 1IRGA 3I4PA 3ZP5A 5GTIC 1U8RA 3HSRA 1FSHA 4E7JA 1LUJB 2KT0A 3HRMA 5F1JA 2B7EA 3J7YJ 4E7IA 1SANA 1AOYA 2HTJA 3WTYC 3AFHA 2IXSA 2K27A 3RZOJ 5C4JJ 5CVRA 2D1HA 3A0BC 2QQ9A 2X48A 2FMLA 2IS6A 1A04A 3WTTC 2ZNYA 2PLYA 3BJ6A 1FTZA 3PM1A 4ZTFA 2VQHA 1S7AA 3BDDA 4P55A 2E5ZA 5CQGA 1LQ1A 4BDYA 3HOWJ 2YX7A 3F8BA 4PCQA 3CZ6A 3V7CA 5H2FC 3V8JA 2IA1A 3ZMVA 4CYDA 2OUMA 3DQVC 1OPCA 1VFCA 4I02A 1YJNI 3L7WA 5M5XJ 4ABZA 1ZR2A 1YYVA 1VQ5I 5JHUA 2CUFA 5DM7F 1W4MA 5A2QZ 5HNFA 4HBLA 5KAIC 4CGZA 3BCAA 2BW3A 3CUOA 5CJ9A 4O5VA 3Q3SA 2HEOA 4FX4A 1X3WB 3E6BA
chains in the Genus database with same CATH topology
2GOXB 3CP2A 3HG9A 3SYTA 2HZDA 2CW8A 1OLTA 2IGMA 4CUGA 1YX5A 3SEZA 2IGOA 2ZSIB 3VYTB 1JI8A 4ITVA 2Q2EB 4Y3OA 4NUBA 4NC8A 1OR7C 4QPQA 1EA3A 3UR3C 3L2UA 1D1CA 2RNGA 2CUJA 3CMMA 4LIVA 3GBGA 2A6TA 3S93A 4PJLA 3QODA 3OOUA 1YE9A 2CMPA 3I3LA 3MD2A 2LBFA 2WB1A 4E7LA 3H5AA 1KONA 1UELB 5HLTA 2LY1A 2DXIA 1PYVA 2NOJB 1T95A 3QYEA 1U0JA 3H5NA 1N78A 1LDKB 3IAM2 1D0YA 2P0WA 4B48A 4PUSA 4PK4A 3QOEA 1PJRA 2BVLA 4BDZA 4FASD 3PSIA 2F5VA 2X1CA 3H9QA 3LSKA 1WJFA 3OL4A 5CPRB 2V1NA 3LSGA 2IGKA 4AYBA 3FBIB 3DKYA 1WFXA 3CJRB 3S8PA 5LFAA 3W3CA 2KPMA 2MC4A 4HG2A 1MMGA 4HSTA 4II2A 4CZCA 3A2KA 2IS2A 4E4HA 4PSXA 1R6RA 3VDXA 2AQEA 2VJ4A 3TL4X 3S3NA 1DGWY 4XOPA 4BEHA 3KYLA 4RMNA 3DPLC 3HXLA 4C30A 1X1AA 2MFZA 2BW3B 2E5NA 3HUGB 4LG3A 5FRMA 2CFOA 3ZRGA 3VYSB 2R7TA 2XF6A 5KCMA 1BOBA 3FBNB 1AA7A 2X85A 3AKZA 2XDVA 1T0FC 3PNYA 2L7KA 3OYNA 2VJIA 4JQFA 5FROA 4RLFA 4PFPA 3QYFA 3W2AA 3BG7A 2JVHA 1LFPA 1X19A 4F93B 3TBIA 3HOTA 4B43A 2DOAA 2DJIA 3VSLA 2CW7A 3AL0B 1BR1A 2M4GA 2RREA 4XMYA 4CCMA 4J00A 3HPHA 4LIUA 2WY7Q 3A4CA 3OYBA 4IQ4A 2BVMA 2W82A 4XONA 2WAQA 4YRVA 4XL9A 2M3AA 4XKBA 1QU3A 3EUHC 4BL0B 4DIQA 4E6KG 2ZXIA 2LH9A 4R79A 3U21A 1MNDA 3AL0C 3S3MA 4ZC3A 2WADA 3HKZA 4OAYA 3VYUB 4PFOA 3LMMA 1D0XA 4F52A 4XN0A 2M7AA 3OS2A 2KMUA 4DOZA 4ZTJA 1MMNA 3VYRB 4DBRA 1MW7A 1D0ZA 1WJAA 3BG6A 3LSHA 2X51A 3OMYA 4C2TA 3ONQA 3DPUA 1IRXA 4GRIA 5KNLA 3E0JB 1WJBA 2X1DA 3QYBA 1P9QC 2V7FA 3VSKA 1BR4A 4CCNA 4H4KC 2R7OA 1W36D 1G59A 4P1WA 3MKYB 1X1BA 2JA2A 2LREA 2ZFUA 2JVGA 1Z7LA 3OL3A 4N4OB 3L2VA 3CP8A 3LFUA 2HQAA 3DEEA 2CS3A 3V42A 4BE1A 2I8DA 2VXDA 3DU5A 3IP4B 3IUOA 2HPMA 2PMZA 4NNJA 2BOLA 1Z3YA 3D5SC 2F4IA 3BLYA 3F9KA 4KITB 3W2VA 3OYDA 4DJAA 3K4CA 2VQLA 3ZGKA 2WY8Q 4CCKA 3DKXA 1W36C 4BJTA 3OYFA 4J01A 3I9V2 3C2HA 1TT0A 3J7AY 1D1BA 2R7RA 2M4KA 4Y33A 2IGNA 4XR6A 2WAFA 3UNGC 2CV0A 3EPZA 2LC2A 3K4MA 1VZ0A 2PJRA 1ERDA 4HRIA 3H0DA 3W2WA 3CJQB 3HPGA 4PJJA 4X0GA 4U7BA 3OYHA 1MMDA 2X6WA 2VPLA 3E1SA 2F6CA 4KJZA 1X4PA 4XKCA 1K6YA 3G2BA 1UAAA 3EUKL 2JUGA 2LG4A 3H5RA 3PNTA 2R7SA 1J09A 1WJ5A 1LVKA 4ZYAA 4DBQA 3OYLA 4F3QA 2VLAA 3NWTA 2L9SA 2W4SA 2JSPA 2ZSHB 4HPQA 2L9NA 4QPOA 1YX3A 3FKJA 3HOSA 2ZXHA 3N05A 2FUG2 2R7XA 2LY2A 2XF7A 2XF5A 3LL7A 3H35A 2R7WA 4N4NB 3OS0A 2UWMA 2MABA 3OYJA 4OAZA 2RQQA 1Z3XA 3OYAA 4CCOA 4BUPA 2KL4A 5JHFA 3OYGA 2K9MA 3K4LA 1LKXA 3IAS2 3PFYA 4BQOA 3CESA 3NWSA 2CV1A 3OYCA 3OR1C 2AQFA 1WJEA 4D1QA 3PL8A 3K70D 4EATA 2VKDA 4BQQA 2KQRA 3K70C 4PSWA 2L5QA 3A1YA 4FETA 4CCJA 1WJDA 2VIXA 4HEA2 4XN3A 4XLCA 4ZDLA 5CKTA 4RM2A 1GLNA 4CA0A 4G6TB 3S32A 4MLOA 4XLAA 2LYCA 2Q1ZB 3OIPA 1E0EA 1MNEA 4C9YA 5KHDA 4XQFA 4E7ZA 3RTRA 3K10A 2HPIA 2VJJA 3PNVA 3RPUD 4OWRB 2ELJA 4D9JA 4HSRA 3BCBA 3PUBA 4KT6A 2VKHA 5TGTA 1NG7A 3DTIA 3PSFA 2KZVA 4BGDA 2IS1A 3SEQA 3K4KA 4F92B 2IS4A 4DGWB 5HOOA 2KLOA 2KHMA 2X6XA 3KX2A 2L2OA 2V26A 4Y4RA 2VASA 2KRHA 3ZR8X 4BU2A 3OYEA 3OYKA 2XC7A 3MKZA 4BACA 2QKLB 3DPTA 2WBMA 4BE0A 2UV1A 3DU6A 4PJNA 2K5CA 3KEYA 3SDBA 1V5FA 4E7SA 4JOMA 2R7UA 2DT6A 3LSIA 4XOTA 5HVQC 2HVRA 2KP6A 4F91B 2KDOA 2DCEA 4ZDOA 2V6EA 2K9LA 3H9GA 1X1CA 2V9KA 2K3PA 2VJ5A 2XSJC 1Y56A 2VXZA 4U87A 2W1OA 3MMYB 2KRCA 4F55A 1FMWA 3VWBA 2VQGA 4HNTA 3OS1A 3FDYA 4CCLA 3BC8A 2Z2SB 2Z16A 4NC7A 3RCOA 4C2UA 3TMOA 2E1MB 3K4BA 2DT7B 3OYMA 3L2WA 2LOOA 2R7VA 1X4OA 1ZELA 4CH7A 4XORA 1SFKA 3DTEA 4NQWB 3L2RA 2X1EA 4HNUA 4ZJZA 4KISA 3RQ4A 3OYIA 2MYSA 4BE2A 3DTKA 1DQUA 2WAEA 3CF2A 2CV2A 2UUZA 1DGRM 4BJ6C 3C2GA 2Z1DA 2CH0A 4E7KA 2V4JC 2X6YA 1DP3A 2M0MA 4AVZA 4AU7A 2M7BA 2CUZA 3EUAA 4B3XA 3D5RC 4IZZA 4YELA 2VB6A 3D5LA 1Y6IA 4XLHA 4PJMA 3ZCOA 2VL8A 4ZDPA 5FRNA 2GOMA 1UG0A 4YEJA 3SZGA 3OIQA 3ZQQA 4RM3A 3K4JA 4BQNA 1FMVA 1BR2A 4ANJA 3LSMA 2OC6A 2R4GA 1MMAA 2HVSA 4IX7A 2WA0A 2O5RA 2W00A 5LD2C 4E7HA 3S3OA 2HDWA 1N75A 4LITA 4CSWA 5HNHA 1G8XA 4P5OA 2HNHA 3HL2A 4IQJA 4BXFA 4BJ5C 1SAUA 2E60A 4XNFA 4IKFA 3K4NA 1HA8A 3MKWB 4XM3A 3ZXSA 3OR2C 2QKMB 1D1AA 1WJCA 2XAUA 2LRDA 3H9JA 4II3A 4E7JA 2MD0A 5CQEA 3HC7A 2W7NA 4E7IA 2PJRB 2HVQA 3K6GA 2R7QA 2IXSA 3AFHA 3OWTA 3OY9A 4RLQA 2Y0SA 4XKWA 3L2QA 3PJRA 2LBFB 1QHGA 3RSNA 2IS6A 4B47A 4ZTFA 2VQHA 1TZLA 3M1CA 2E5ZA 5CQGA 4BDYA 1N77A 1V5EA 1Z21A 3CZ6A 1NG6A 2VQCA 2OUMA 3DQVC 2OV7A 3DLAA 3DWLE 1V5GA 1X1DA 3M8JA 2A5WA 4XLEA 4B44A 5HNFA 3BCAA 2BW3A 1S9HA 2HU9A 3FHNA 2E1MC 4XLFA 4XKVA 4BEHB 4BS9A 1QHHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7K A; 
#chains in the Genus database with same CATH topology
 5BQT A;  1MH4 A;  3GCM A;  1VQL I;  2HZD A;  3B6A A;  3HUG A;  4XK4 A;  3LA2 A;  1QZE A;  2ZSI B;  3LA3 A;  1JI8 A;  4ITV A;  4Y3O A;  1ZG3 A;  1LJ9 A;  2V9V A;  2X4H A;  2EIJ H;  4L9J A;  5CVJ A;  3HGY A;  4QPQ A;  2PMH A;  1Y1W J;  5IPA A;  5C3E J;  3UR3 C;  4OIR F;  4EM1 A;  2R93 J;  1IN4 A;  1XSV A;  1MJA A;  1QPM A;  2CG4 A;  1R58 A;  1BI1 A;  5CVU A;  4EEF G;  3CCE I;  3QPH A;  2G7U A;  2BY0 A;  2TRT A;  5D4S A;  2DTZ A;  3MD2 A;  1W0T A;  1X58 A;  4V2G A;  3W6K B;  1FOW A;  4UNO A;  4IHS A;  1W5S A;  2O9L A;  4XLP F;  3BWG A;  1UCR A;  2M2E A;  3ISP A;  3JAM K;  4BYY A;  2ECC A;  3D0S A;  1ODD A;  1UEL B;  2EIK H;  3GLX A;  4JK1 X;  1MBF A;  2DXI A;  1PYV A;  1V55 H;  2K9S A;  3SHF A;  1MMS A;  1JT6 A;  1T95 A;  1U5T C;  2EPF A;  4MO7 A;  4RAF A;  3IAM 2;  1D0Y A;  2D1V A;  2P0W A;  4M74 A;  4B48 A;  4LB6 B;  1TTY A;  2X9D A;  3BTI A;  1XGM A;  2R5Y A;  1HF0 A;  3LSG A;  4RGU A;  1BL0 A;  1I27 A;  2EFN A;  2IGK A;  3LNQ A;  4AYB A;  5BPI A;  4BY1 J;  3DKY A;  2HDD A;  2YR2 A;  3CJR B;  3ZN1 A;  1ZG1 A;  2MC4 A;  1MBH A;  2DA3 A;  2QQB A;  2EIN H;  3A2K A;  1TT5 B;  4PSX A;  2AQE A;  1VTN C;  2DO7 A;  2K4J A;  2VJ4 A;  4M3G A;  3B6C A;  3LSJ A;  1OCC H;  1YIO A;  5BNG A;  3KYL A;  3S3N A;  1UHW A;  1NK2 P;  1DP7 P;  2BW3 B;  1FWZ A;  2E5N A;  1YTY A;  3G71 I;  5FRM A;  1UFM A;  2GM4 A;  5EZG A;  1XGS A;  4U88 A;  3T1B A;  1HCR A;  4A3D J;  2R7T A;  2CO5 A;  3LQQ A;  4XRM A;  1AA7 A;  4ASN A;  4CXF A;  4EGY A;  4OOI A;  1BI3 A;  2L7K A;  3G1M A;  4J19 A;  1R4M B;  2HZT A;  2Y9Y A;  2HOS A;  4JQF A;  4PFP A;  1MIJ A;  3QYF A;  2AXT C;  5HOD A;  3TW6 A;  3TBI A;  1U8B A;  2DOA A;  2DJI A;  2CW7 A;  1V54 H;  3NAR A;  3VEP A;  3AL0 B;  2RRE A;  1T98 A;  4LIU A;  2N8G A;  3H36 A;  3U9G A;  3CCJ I;  2OZ6 A;  2K85 A;  1H88 C;  2Y2Z A;  3CC2 I;  4XL9 A;  3VB2 A;  1OIS A;  1JJ8 C;  1ZRC A;  2RAE A;  1AKH A;  1I1S A;  4RGR A;  2NAZ A;  1RES A;  4R79 A;  1B72 A;  1OKR A;  3HKZ A;  3VYU B;  2XB0 X;  3LMM A;  4QLC U;  3DLL F;  3P9I A;  4MFE A;  3O3K A;  2ELK A;  1IJW C;  2KMU A;  4DOZ A;  3VYR B;  1YFH A;  1MW7 A;  3LSH A;  3ONQ A;  1B9N A;  4G12 A;  1YI2 I;  1FPQ A;  4GCV A;  1JUM A;  2Q2E A;  2FBI A;  1KQ8 A;  3PQJ A;  1SD6 A;  4ZZL A;  5KNL A;  2LY9 A;  4LMY A;  4NBQ A;  3QYB A;  1P9Q C;  4XBF A;  2PJP A;  1WPK A;  1LFU P;  4H4K C;  5HDK A;  1DU6 A;  2Y30 A;  1G59 A;  3WG9 A;  2ME6 A;  4UVB A;  2FJ1 A;  3F23 A;  3LFU A;  1HKT A;  1SC7 A;  2HQA A;  3DEE A;  1F5T A;  1KU7 A;  4I0A A;  4DNC A;  4BE1 A;  3HHH A;  1I3A A;  2XPU A;  1EH8 A;  2COB A;  4LK1 F;  2VC1 A;  3HIF A;  5JLX A;  1AHD P;  1JGS A;  4NNJ A;  3GFI A;  2F4I A;  3COA C;  2FRH A;  4ON0 A;  2MA3 A;  3F9K A;  3GFL A;  2XKO A;  2LDU A;  1FIA A;  1EF4 A;  1YS7 A;  3J81 K;  4FTH A;  3GVA A;  3ECO A;  2NS0 A;  3JRC A;  2ELH A;  4YII A;  3J7Z I;  3GTL J;  4X1E A;  3HJE A;  1B8I B;  3I9V 2;  2F5F A;  3OIO A;  5DCM A;  4LB5 A;  1TT0 A;  3MZ8 A;  2NVU B;  3J7A Y;  1TP4 A;  5ED4 A;  3GZN B;  2IGN A;  4CZZ A;  3S1M J;  2EFP A;  1PUF A;  2CV0 A;  1X3U A;  5DYM A;  2CUE A;  1OR7 A;  4HRI A;  3CME I;  3CJQ B;  2ZJ2 A;  3HPG A;  2HXI A;  2DT5 A;  1MD0 A;  2EZI A;  4PJJ A;  3OYH A;  3VOE A;  4IJA A;  1IXS B;  3WU1 B;  2NYX A;  3BR1 A;  3E1S A;  4DZP A;  4AID A;  1O3R A;  2VPL A;  1TWH J;  3IKV A;  4LK0 F;  2GXB A;  2DPU A;  1RNL A;  3C7J A;  1K6Y A;  2IPQ X;  1LE8 B;  1JTY A;  4HLX A;  2JUG A;  2R7S A;  4UY8 I;  3F3X A;  5E1X A;  3WGH A;  2WV0 A;  1WJ5 A;  5JVG F;  3F72 A;  1LVK A;  4YFK F;  4DBQ A;  3IRQ A;  4M9X A;  2VLA A;  2L9S A;  2LFB A;  4DYQ A;  1FC3 A;  2JSP A;  3BQY A;  1P7I A;  1U5T A;  4HPQ A;  4A3B J;  2BXZ A;  4ENM A;  1R22 A;  2MH9 A;  2GWR A;  1UZC A;  3N05 A;  2O8K A;  2R7X A;  2LY2 A;  3HZJ A;  3JRB A;  2XF5 A;  2XAH A;  3MKL A;  3BRO A;  3TOA A;  4N4N B;  5J1R A;  1O7F A;  1S8N A;  1XCB A;  2MD5 A;  3KEO A;  3IL2 A;  1XX5 A;  3OYJ A;  1WI3 A;  1TW3 A;  1HC8 A;  4P9F A;  1Z3X A;  1H9T A;  3SFI A;  3OYA A;  5ILV A;  5JHF A;  2K9M A;  1V3F A;  1ZAO A;  2HYF A;  4W97 A;  4BQO A;  3KZY A;  1XN7 A;  2CV1 A;  3G6E I;  4AWX B;  2STW A;  1DUX C;  5GPA A;  4NQW A;  4EMS A;  1WJE A;  4D1Q A;  3CCU I;  4V2F A;  5KAF C;  3K70 D;  4EAT A;  3GTK J;  3PIP F;  4HEA 2;  4XN3 A;  1A31 A;  3GO5 A;  1WZ2 A;  2E71 A;  4UHT A;  3HOZ J;  4CA0 A;  3PIO F;  3BJO A;  2ZME A;  2AXL A;  1QBJ A;  1YW8 A;  5IP6 A;  4IPA A;  1Y1V J;  3S32 A;  1D5V A;  4ESF A;  3ZQI A;  2M87 A;  3REO A;  3JRI A;  2LYC A;  4C3H J;  4C9Y A;  5KHD A;  1SFO J;  1H0M A;  5C44 J;  5TIS C;  2NS8 A;  3KET A;  2E1O A;  1R5I D;  3PNV A;  3RPU D;  2ELJ A;  3I54 A;  2STT A;  4I2O A;  3O2P E;  2WTE A;  2VKH A;  2EQR A;  4HF2 A;  1RET A;  3RI4 A;  4BGD A;  2R7F A;  5E3L A;  2XAG A;  2PQ8 A;  5TRD A;  1ZQ3 P;  3W6V A;  2LP0 A;  5E17 F;  1ZRF A;  2X6X A;  1P6R A;  2WC2 A;  3WTV C;  4EJT A;  4LD5 A;  4EJW A;  4DYC A;  3DBR B;  3IH3 A;  3CLO A;  4IHV A;  2UV1 A;  3KEY A;  4B4C A;  1FJL A;  2F4O B;  2MSY A;  1JHH A;  4IEJ A;  4XOT A;  1U6G A;  2BBY A;  2KDO A;  4F91 B;  4HW0 A;  3MWM A;  2V6E A;  4I09 A;  3H9G A;  2VJ5 A;  3FZV A;  1LE8 A;  2E1N A;  2XSJ C;  3LAJ A;  4HX8 A;  2KRC A;  4IL6 C;  1FMW A;  1XMX A;  1TQM A;  2VQG A;  5E1W A;  1VQ7 I;  1ON1 A;  4M3F A;  4NC7 A;  1F1Z A;  1TWC J;  2E1M B;  1I50 J;  2FX0 A;  1JGG A;  3BTC A;  1QZY A;  4KFC A;  1PUF B;  3GTG J;  2M1B A;  3DTE A;  3IHU A;  3MAJ A;  1LB2 A;  3RQ4 A;  3HGG A;  2R5Z B;  3TDZ C;  4EJU A;  4BE2 A;  3DTK A;  3I71 A;  2CV2 A;  1BI2 A;  1Z05 A;  3ML6 A;  1B8I A;  2F5C A;  2E2H J;  3C2G A;  2MGQ A;  2FA5 A;  2HYJ A;  1Z1D A;  4E7K A;  2P6S A;  2V4J C;  2VOO A;  2Y31 A;  3FXL A;  4AU7 A;  1VQ4 I;  5M3M J;  3D5R C;  2EB7 A;  4IZZ A;  1ENH A;  2I5U A;  3WHC A;  4BHP A;  4XRS A;  1HOM A;  1F43 A;  1MBE A;  1Z0X A;  4XLN F;  3GTJ J;  4KIC A;  1KYZ A;  3R0J A;  5FLX K;  1T39 A;  1JKR C;  5FRN A;  2RV8 A;  2GOM A;  1AWC A;  4WWC A;  1TLH B;  2ZJR F;  2Y9Z A;  3KYC B;  3OIQ A;  3ZQQ A;  4DW6 A;  3HYI A;  4BQN A;  2QBY B;  2K4B A;  1BR2 A;  3CUQ A;  1BW5 A;  3KP5 A;  5EYR A;  3LSM A;  4YG2 F;  3PUF A;  2J5P A;  4KYW A;  1XTA A;  1IXR C;  1MBJ A;  1YW9 A;  5FB2 A;  1LFB A;  3FXJ A;  4E7H A;  5LD2 C;  4A6D A;  2CFX A;  2E7X A;  2L3D A;  2O6G E;  4LIT A;  1HSJ A;  4CSW A;  4LLN A;  4P5O A;  2IVM A;  1W7P A;  3KE2 A;  3HL2 A;  4BXF A;  1ACI A;  1QO0 D;  2UZK A;  4KDP A;  1HA8 A;  4XM3 A;  1YG2 A;  3OR2 C;  1YIJ I;  2QQA A;  2QQ8 A;  1D1A A;  1WJC A;  1UST A;  4LLL A;  2DYR H;  4EJV A;  3RYR A;  2CQK A;  3EDP A;  1F4K A;  2PJR B;  4GFB A;  2JPC A;  4IVN A;  2DA4 A;  2R7Q A;  3BTL A;  3OWT A;  3BG5 A;  1BIB A;  4HF0 A;  4M6X A;  3BTJ A;  2NNN A;  4Q48 A;  2YU9 J;  4XKW A;  4RAG A;  1PUE E;  3L2Q A;  5EEA A;  5FFX A;  3J7A O;  3V8K A;  4B8X A;  3J81 Z;  2ID6 A;  1V5E A;  1Z21 A;  1NK3 P;  2OA4 A;  1NG6 A;  3P9K A;  3EET A;  1ON2 A;  2ZJP F;  4OIO F;  2XGD A;  3AG3 H;  4OIP F;  1VQ9 I;  4V19 K;  2QM3 A;  3GX4 X;  3BZK A;  2A5W A;  4WXD A;  5K1Y A;  2VC0 A;  1VF9 A;  1S9H A;  1J5Y A;  2FQ3 A;  3FMQ A;  3FHN A;  4AYB N;  3WTS C;  4XKV A;  1JHF A;  1MDM B;  5CLS A;  3WGI A;  4BS9 A;  3T8T A;  1X1P A;  3K2Z A;  5JLW A;  4IHW A;  1HST A;  2JN6 A;  1QNT A;  2IGM A;  2V9P A;  1JUP A;  2JTV A;  1A36 A;  1BA5 A;  4CUG A;  1YX5 A;  3DEU A;  5IOY A;  2QWW A;  2IGO A;  3HKZ N;  2CGP A;  3AG1 H;  1HLV A;  1OJL A;  4D7N A;  2OTJ I;  3FX3 A;  2FBH A;  2HQ5 A;  1EA3 A;  4MIM A;  2M34 A;  3L2U A;  1D1C A;  2KIM A;  1IN8 A;  2OQG A;  2ZME C;  5J4Y A;  1FBQ A;  3CMM A;  2ZO4 A;  2M8E A;  2PEX A;  3NEU A;  4LIV A;  3GBG A;  3S93 A;  3JW4 A;  1ZLJ A;  3QOD A;  1A35 A;  3S2H J;  1YE9 A;  1WQ2 A;  2CMP A;  2ZXW H;  3I3L A;  2LBF A;  2WB1 A;  4E7L A;  3GTM J;  1T38 A;  5F08 A;  4ENK A;  3ZN0 A;  2DA2 A;  5DD4 A;  3IKT A;  1OYW A;  1OYI A;  4GGG A;  5HLI A;  4N9I A;  1P7J A;  5A2Q K;  2NOJ B;  1N78 A;  1U0J A;  2FF4 A;  1I39 A;  4FE7 A;  1LDK B;  4I98 B;  4PUS A;  3QOE A;  3S15 J;  5LLQ A;  1JE8 A;  1PJR A;  2A07 F;  2BVL A;  5FKN A;  2OQR A;  4G6Q A;  4BDZ A;  2GA1 A;  4FAS D;  1IV8 A;  3Q0V A;  2F5V A;  2X1C A;  2XAS A;  3C18 A;  2QA4 I;  2L9R A;  1BIA A;  4JX4 A;  2A3S A;  2Y48 A;  1IN6 A;  1XS9 A;  3D1N I;  2HKO A;  1ZAR A;  2FOW A;  2L02 A;  3E3V A;  5D5X B;  2LR8 A;  1WFX A;  3S8P A;  3QPT A;  3EYI A;  1PVE A;  1WHU A;  1ZH5 A;  2IS2 A;  2IBD A;  1VI0 A;  2Z33 A;  1DGW Y;  4BEH A;  4S05 A;  3OSF A;  1UJ8 A;  5K5O A;  3HUG B;  2Q8K A;  2CFO A;  1CF7 A;  3J80 Z;  3DCF A;  4U0Y A;  5KCM A;  3RIR A;  1BOB A;  3CDH A;  2NVY J;  1J7K A;  5E79 C;  3GTP J;  3AKZ A;  2XDV A;  2WWY A;  3ABT A;  4HQE A;  4LFU A;  5LHG A;  3L9F A;  5FRO A;  1TQP A;  5CVV A;  1K61 A;  1RKW A;  2H8W A;  4M73 A;  1O7L A;  3RZD J;  2PI0 A;  5E8G A;  1JKQ C;  2QZ8 A;  2OZU A;  4B1R A;  2DPD A;  1ZHF A;  5E3M A;  4U0V A;  5HS8 A;  4XMY A;  1VQP I;  4CCM A;  2G9W A;  3A4C A;  3JCU C;  2BVM A;  2W25 A;  2DFI A;  2XRO A;  2W82 A;  1RPW A;  1JJ6 C;  4YRV A;  2VON A;  2E34 A;  3PFI A;  3BG3 A;  5LGU A;  3ELK A;  2M45 A;  4JX6 A;  1KQ0 A;  4E6K G;  3BOQ A;  2LH9 A;  4S0H B;  1D8J A;  1MND A;  3AL0 C;  3ZMD A;  3SXY A;  5LGT A;  2WAD A;  2GXA A;  1D0X A;  2L54 A;  4F52 A;  1QRY A;  2W84 A;  5FO5 A;  2YSR A;  3CUQ C;  2EZH A;  1MMN A;  1CQT A;  4HX7 A;  3BG6 A;  3OMY A;  4C2T A;  2HTS A;  3V8L A;  4DZJ A;  3MN2 A;  3GLL A;  2QCO A;  4HLY A;  3E0J B;  5DUK A;  1WJB A;  3QPL A;  2V7F A;  2FSW A;  3S2W A;  5D6E A;  2JWT A;  2WV1 A;  5AIQ A;  1T33 A;  2DFF A;  2LKX A;  1W36 D;  1RR8 C;  2JA2 A;  4Z2Y A;  1UHS A;  2LRE A;  3HOX J;  2GXG A;  4RDU A;  5E8I A;  3CP8 A;  4D5F A;  4WXH A;  2QSF X;  2I8D A;  1TL8 A;  2VXD A;  2KIU A;  3QWL A;  1FP1 D;  3IP4 B;  4A3I J;  4GO1 A;  2HPM A;  2PMZ A;  2EFO A;  2HS5 A;  3ABU A;  4UUV A;  2L4M A;  3BLY A;  4KIT B;  2NRA C;  1WKM A;  2RQP A;  3M3Y J;  3K4C A;  1XMK A;  2VQL A;  2IW5 A;  2D2W A;  3ZGK A;  5FKL A;  3EUH A;  4WF2 A;  1W36 C;  1B4A A;  4J01 A;  3ZPL A;  2HI3 A;  2Q0O A;  1GUU A;  1C0W A;  1D1B A;  2MG4 A;  1XSX A;  2R7R A;  2IP2 A;  1VQK I;  2JT1 A;  4IXA A;  4RA2 A;  2W24 A;  2H1L A;  3DP7 A;  4XR6 A;  2ZFW A;  2TCT A;  4L9T A;  2PJR A;  5BOX A;  1ERD A;  5J4V A;  5FKO A;  3M7G A;  5ILS A;  3IC7 A;  2W48 A;  1BJA A;  3SQN A;  5GAD J;  4UB8 C;  3H3U A;  5DCF A;  2DTR A;  4HNV A;  3S16 J;  2F6C A;  4KJZ A;  2JQ7 A;  3M9A A;  3HOV J;  2MH2 A;  3KPH A;  1W7P B;  3I53 A;  3EUK L;  1B9M A;  4I76 A;  2ID3 A;  1DPR A;  5D4R A;  1MNM C;  4ZYA A;  1D8K A;  3OYL A;  1KA8 A;  3FK6 A;  3BZ6 A;  2ZSH B;  4PZJ A;  3BJA A;  3BR2 A;  3SDG A;  5B3S H;  3FKJ A;  2QBY A;  5D8L B;  1YIT I;  3HOS A;  2QUF A;  3FWE A;  3RDI A;  3CJN A;  2FUG 2;  2KKO A;  2XF7 A;  3LL7 A;  4M3D A;  2R7W A;  1APL C;  2XKP A;  2ECB A;  1U3E M;  3OS0 A;  4A3C J;  2UWM A;  2CQN A;  1E2X A;  2MAB A;  4OAZ A;  3ZMZ A;  1HKS A;  3S1R J;  4NC6 A;  2RQQ A;  2E1C A;  2PN6 A;  5JVT A;  2NVT J;  4CCO A;  3O6B B;  3BG9 A;  3KYD B;  3OYG A;  4B3A A;  1RKT A;  1MH3 A;  3PFY A;  3JTG A;  3ZQG A;  2E36 A;  4HOB A;  2R92 J;  2JSC A;  1FYK A;  4ESJ A;  4RB3 C;  3OR1 C;  1QA6 A;  4UV9 A;  2QEN A;  1BC7 C;  4WK8 F;  4JYK A;  2KQR A;  4NB5 A;  1RRJ A;  2VOD A;  2L5Q A;  3A1Y A;  4FET A;  4M3B A;  4XLC A;  4XID A;  2L9V A;  2ACJ A;  2DAO A;  1D3Y A;  3ZQL A;  1GLN A;  4G6T B;  3ZMU A;  4JX5 A;  3JAM Z;  5FD5 A;  4HV6 A;  4I01 A;  2E2J J;  4XLA A;  3GME A;  2BHY A;  5K7H A;  4XQF A;  2V1U A;  2DOE A;  4KUM A;  4E7Z A;  3RTR A;  1R5G A;  2HPI A;  1SMY F;  4A2U A;  4D9J A;  5LHH A;  1FEX A;  3BCB A;  1NG7 A;  3DTI A;  2V6C A;  3E6M A;  4BXU A;  2KZV A;  3ASO H;  2PX9 A;  1ZR4 A;  1PP7 U;  1ZTR A;  2KDZ A;  1R5H A;  2K7L A;  2HOA A;  3FXK A;  3K9T A;  2M0C A;  3CDI A;  3U2R A;  1Z77 A;  4KIB A;  5F04 A;  2H09 A;  4A5N A;  5J8F A;  3FHZ A;  1YLF A;  2ME0 A;  3W6J B;  1FIP A;  4BU2 A;  3MKZ A;  1Y0U A;  3R60 A;  3WHB A;  1J59 A;  3DPT A;  2DMT A;  2QYO A;  4BE0 A;  4GYI A;  1GXP A;  1V5F A;  2VN2 A;  2GIV A;  3HTS B;  2HR3 A;  5HVQ C;  1G4D A;  4A0Y A;  1L3L A;  3K69 A;  1HDP A;  1LVA A;  2K9L A;  2VKV A;  3QQA A;  1OCZ H;  3R4K A;  1R71 A;  4OU0 A;  4PGG A;  3Q5F A;  3WU2 C;  2ZME B;  4CCL A;  1FBU A;  2Z16 A;  3ZOB A;  3ERE D;  3ZMT A;  5E18 F;  2H8R A;  1MSF C;  3S17 J;  3QAH A;  2VBZ A;  4C2U A;  5HDN A;  3KZI C;  4Q4Z F;  4QTR A;  2LOO A;  3ZMS A;  1E3P A;  1FYM A;  4Z6Y A;  1GV5 A;  1GT0 C;  3LQR A;  4XOR A;  4NQW B;  2YPR A;  2C6Y A;  2X1E A;  3TKY A;  4IRH A;  2KIF A;  5F0F A;  3OYI A;  5DV5 A;  3TO6 A;  1DQU A;  2WAE A;  4CHU A;  2UUZ A;  4BJ6 C;  5IT3 A;  4A6E A;  1ETY A;  2Z1D A;  2CH0 A;  4MFD A;  4KN4 X;  3TP3 A;  1J75 A;  2X6Y A;  2M0M A;  2M7B A;  4B3X A;  2CQ7 A;  4EVI A;  2XAQ A;  2QLZ A;  3CCR I;  3F6V A;  3D5L A;  4KIF A;  1MSE C;  4XLH A;  2FMY A;  1IRZ A;  1H89 C;  3ZCO A;  5L3B A;  1RUO A;  4ZDP A;  3P9C A;  3E5Q A;  3MEX A;  4G7H F;  1CF7 B;  5EJC A;  4QWQ A;  4RM3 A;  3K4J A;  1FMV A;  3TW7 A;  1I3Q J;  3DBL B;  2EH3 A;  1FX7 A;  4GXO A;  1XDS A;  2OC6 A;  1POG A;  1K4T A;  5FGM A;  2R4G A;  2VPR A;  4ZH4 F;  3S3O A;  4X6A J;  2HDW A;  1TW2 A;  4AIJ A;  2EFW A;  1O3S A;  5HNH A;  2HNH A;  3T5X A;  4IQJ A;  2DK5 A;  2ZB9 A;  1SFE A;  2K9Q A;  3JSO A;  5J1U A;  4IKF A;  3K4N A;  2K3F A;  2NS7 A;  3HTU A;  3P7N A;  2XAU A;  3S1N J;  3S14 J;  4II3 A;  1MGT A;  2MD0 A;  1QVT A;  2W7N A;  1VND A;  2HVQ A;  1OQY A;  3OY9 A;  1WH5 A;  2BE5 F;  3KP2 A;  1UHM A;  4RLQ A;  2Y0S N;  3CTA A;  3QP5 A;  3M1E A;  5EG0 B;  2LBF B;  4A3K J;  1R9T J;  2NNY A;  4KN7 X;  2P8T A;  4M9Z A;  1TZL A;  1LPQ A;  1JKP C;  1N77 A;  2XSD C;  4UUT A;  1KU9 A;  2CJJ A;  1K83 J;  3GUD A;  2H6B A;  5E3N A;  2LNB A;  3GFJ A;  3WE3 A;  4CYC B;  4EGZ A;  1TNS A;  2EV5 A;  2KFD A;  2VT3 A;  3GXO A;  1ETV A;  3DLA A;  3DWL E;  4AD9 A;  2DW4 A;  3SZP A;  4ZYH A;  2L7F P;  4O3M A;  1IZ1 A;  1O3Q A;  1J0R A;  1Z9C A;  1I5Z A;  2HU9 A;  1R1V A;  3BR5 A;  3GEZ A;  3LOC A;  4QIW N;  1SFX A;  3CCV I;  1ZN2 A;  5DD8 A;  4RB1 A;  1QHH D;  2OJE D;  5J1Y A;  1KGS A;  3CP2 A;  4IF4 A;  2AS5 F;  3SYT A;  4M6V A;  2CW8 A;  1S7E A;  1E3H A;  4HDU A;  4G7Z F;  1E17 A;  1SD7 A;  4XSX F;  3SEZ A;  4XRS G;  5D5U B;  1WI9 A;  3CC4 I;  2ETH A;  1YO5 C;  2P6T A;  2Q2E B;  2QVO A;  3RYP A;  4YIR X;  1X2M A;  2MLK A;  3FXO A;  5IP9 J;  4NUB A;  3QU6 A;  5F64 A;  2O7O A;  2LKS A;  4NDL A;  5GAG J;  1ONV A;  3JRA A;  1Y39 A;  2V1D A;  1BN5 A;  3IRR A;  5ICC A;  2JA7 J;  1T8I A;  1JUS A;  2CUJ A;  5H20 A;  1B6A A;  3GFM A;  2M9H A;  1WGX A;  5IY5 H;  4O6J A;  4PJL A;  1TNT A;  4Y15 A;  1SEU A;  5BPD A;  1HKQ A;  2WAQ N;  3NQO A;  3CLQ A;  2OTL I;  5LRR A;  1T6S A;  5TJJ A;  1KON A;  4D7M A;  2IRF G;  5ERI A;  2L01 A;  3V4G A;  3HRU A;  3KLN A;  4HX4 A;  3H5N A;  4KA4 A;  2DDB A;  4IHY A;  4D5C A;  3JRE A;  1O4X A;  4RGX A;  5EEG A;  4OMZ A;  3PSI A;  3BQZ A;  3H9Q A;  2QSG X;  3OL4 A;  1ZGA A;  3DF8 A;  5CPR B;  3ZQH A;  2V1N A;  4P9U A;  2VBW A;  1SVM A;  3FBI B;  4RBO A;  1HW5 A;  2UXX A;  2XVC A;  1K7A A;  5LFA A;  2P5K A;  2KPM A;  1FT9 A;  4HST A;  1H9G A;  2XRL A;  2H94 A;  4BHC A;  1NTC A;  4E4H A;  1P4X A;  2ZKZ A;  4MHG A;  3EQL F;  2BYV E;  1K4S A;  4UXN A;  4XOP A;  1W5C C;  3RPQ A;  2H6C A;  3F8F A;  3CO7 C;  2MFZ A;  2PBI A;  3KP4 A;  4FQG A;  3B02 A;  4ESB A;  1QGP A;  3ZRG A;  3LWF A;  2XF6 A;  3E5X A;  2OD5 A;  3Q0W A;  2VE9 A;  4BH9 A;  3C2B A;  1ETX A;  4HYE A;  4EM0 B;  1IUY A;  1FOK A;  2EWN A;  4NHJ A;  2X85 A;  1B59 A;  3UKG A;  1U2W A;  3PNY A;  3M8E A;  4L9V A;  1GXQ A;  2EV0 A;  1SFU A;  1Q1V A;  1QVU A;  2VJI A;  3OYN A;  1YHQ I;  4RLF A;  1X19 A;  3N4M A;  1S72 I;  1W0U A;  1BI0 A;  2A69 F;  3HOT A;  2R5Y B;  3VSL A;  2O8X A;  3NAU A;  1BR1 A;  5BMZ A;  3I55 I;  4J00 A;  3HPH A;  3WE2 A;  5JI6 A;  1UG2 A;  2R5Z A;  4IQ4 A;  3L2C A;  3ABK H;  3MZY A;  2ZJQ F;  2HDC A;  5EG0 A;  2FE3 A;  1BM9 A;  2WAQ A;  3L00 A;  3TDU C;  1JXS A;  3ZQC A;  2LD5 A;  4RAZ A;  4XKB A;  4AC0 A;  5AON A;  5HDG A;  2A6H F;  2G7H A;  1G3W A;  2PG4 A;  3SJM A;  2O0Y A;  3WG7 H;  4BL0 B;  4DIQ A;  2P7V B;  2Z9O A;  5EF6 A;  3CCS I;  2HOT A;  4PGH A;  2DMN A;  1EV7 A;  3E5U A;  3U21 A;  1VQM I;  5FFZ A;  4L0Z B;  1TQI A;  3S3M A;  4OAY A;  3GZ6 A;  1GVJ A;  1S6L A;  2RDP A;  3ESW B;  5FJ8 J;  1KQ9 A;  1ZYR F;  1R00 A;  3S2D J;  1WCM J;  1Z7U A;  3U1K A;  1M1E B;  4ZTJ A;  2CYY A;  3K1N A;  4DBR A;  1D0Z A;  2X51 A;  1XGN A;  1ORK A;  1LDJ A;  3E7L A;  1ETK A;  1QQI A;  1XB4 A;  4ZZD A;  1ZRD A;  5DUI A;  4S04 A;  3HOU J;  1FOY A;  5IP7 J;  1IRX A;  2XV4 S;  3ERM A;  1MKM A;  2JPB A;  2DLL A;  5EEH A;  5ICE A;  2JJ7 A;  4E70 A;  4F7Z A;  1PP8 F;  4MQ9 F;  4M9S A;  4IOA F;  1BR4 A;  3HRS A;  3WU0 A;  3E6C C;  2VI6 A;  4N9H A;  2R7O A;  3MKY B;  5DDG A;  3MZH A;  3RKX A;  2ZFU A;  2FBK A;  2JVG A;  2K40 A;  4Y7N J;  1Z7L A;  2MBF A;  5M5W J;  2X6O A;  2XIG A;  2GBY A;  2CU7 A;  2OAZ A;  2LLK A;  4BBR J;  2CS3 A;  4R8H A;  5EDN A;  2D5V A;  1Q1H A;  2ZC2 A;  1MZB A;  4I7H A;  2IJL A;  1B1B A;  3HDD A;  5B66 C;  2KJB A;  3D5S C;  4YIF A;  2R0Q C;  4PJ0 C;  3E97 A;  3H3V K;  3OYD A;  5IT9 Z;  2QEX I;  3IWF A;  2YS9 A;  2WY8 Q;  4CCK A;  3DKX A;  2W85 A;  4BJT A;  5KK1 A;  2DA7 A;  3F21 A;  4I0B A;  3C2H A;  3F6O A;  4BY7 J;  5FLV A;  1KYW A;  2HOE A;  4UVA A;  3DKW A;  3BY6 A;  3KIO A;  2NVQ J;  2JMW A;  1S5L C;  4Y33 A;  2DQL A;  1EJ9 A;  2EZK A;  1FOX A;  3UNG C;  2WAF A;  3EPZ A;  2LC2 A;  4KMU X;  4MGR A;  4LG0 A;  4HF1 A;  4Y52 J;  3DV8 A;  3LA7 A;  2P4W A;  2FOK A;  3FF5 A;  4AIH A;  2VBY A;  4X0G A;  1YRN A;  1P92 A;  1TBX A;  1ZRE A;  2Z3Y A;  4XKC A;  2IT0 A;  2E19 A;  1UAA A;  1A6Q A;  2EA2 A;  3KLO A;  3PNT A;  1HXD A;  5H6R A;  3TO9 A;  3B73 A;  2GLO A;  4A3L J;  2F5D A;  4F3Q A;  3NWT A;  1YOV B;  1XG1 A;  4A3G J;  1U5T B;  3I56 I;  4BXX J;  2L9N A;  4QPO A;  3FM3 A;  1XC5 A;  3HBL A;  1T08 B;  2ISZ A;  4A3E J;  1K78 B;  1XSD A;  2ZXH A;  2A05 A;  2LVS A;  4U0W A;  2E2I J;  2PFB A;  1SAX A;  1LNW A;  2DJN A;  2XGE A;  4K2E A;  5F0C A;  1I6X A;  5E20 A;  1IXC A;  3CC7 I;  1IO2 A;  1WRJ A;  5LHI A;  3KCC A;  1T2K A;  3CES A;  2HGC A;  3OYC A;  2M5W A;  3FXU A;  1ETW A;  1Z6R A;  2L7M P;  2EIM H;  2G0E A;  4RS8 A;  3PL8 A;  1ZK8 A;  2VKD A;  2ESN A;  1W5T A;  3K70 C;  4CCJ A;  1XPX A;  5DCM B;  1WJD A;  3CD6 I;  5ILU A;  1HBX G;  1IGN A;  5CKT A;  4RM2 A;  4TV7 A;  2H27 A;  1G3Y A;  2JZY A;  2DN0 A;  4MLO A;  4ENJ A;  4IHT A;  5D5W B;  4OIN F;  2Q1Z B;  1BJZ A;  1E0E A;  5L3C A;  3CF5 F;  4UB6 C;  1JTX A;  5K7Z A;  2ZXJ A;  4FHT A;  2RVC A;  3K10 A;  2J5O A;  3O8H A;  3LST A;  4OWR B;  4A3F J;  4Y17 A;  9ANT A;  5B5E C;  2BHZ A;  4KT6 A;  5TGT A;  3PUB A;  2P7C B;  1Y0N A;  3M8F A;  4UVC A;  3SFZ A;  2IAI A;  2IS1 A;  2RGV A;  2BY3 A;  1BC8 C;  3K4K A;  2CRG A;  4F92 B;  4DGW B;  1A5J A;  1YS6 A;  3PQK A;  1K78 A;  3KP7 A;  5HOO A;  2BEO A;  1R36 A;  2L2O A;  5HLH A;  2V26 A;  4RB2 C;  2BZT A;  3ABM H;  1P4A A;  1S7O A;  2RNJ A;  3QP6 A;  3OYE A;  2QKL B;  2F48 A;  5L3D A;  2DU9 A;  3DU6 A;  4BKX A;  4PJN A;  3A02 A;  3PO3 J;  5IYC J;  4E7S A;  2ZCW A;  4JOM A;  1QPI A;  2R7U A;  2Z5U A;  3LSI A;  1XMA A;  2LTP A;  1RUN A;  2QGU A;  2KP6 A;  3RKY A;  2V79 A;  1X1C A;  2V9K A;  4L9N A;  2W1O A;  1U9N A;  4F55 A;  4A3J J;  1Y8R B;  4EQQ A;  4DQ2 A;  1S29 A;  3FDY A;  2Z99 A;  1YRN B;  4A0Z A;  2LMD A;  4ZYD A;  4CO8 A;  3RCO A;  3U1D A;  4UUS A;  1OCP A;  2DBB A;  4AUX A;  3A0H C;  3P5J A;  2DT7 B;  2DMP A;  5K5R A;  3OYM A;  1Z6T A;  3L2W A;  1AKH B;  2R7V A;  3MFK A;  4MQV A;  5LGN A;  2QSH X;  1ZEL A;  4ENN A;  3BR6 A;  4CH7 A;  1SFK A;  1FZP B;  4BQA A;  4LG0 B;  3L2R A;  1SD5 A;  4ZJZ A;  4KMF A;  3BPV A;  4KIS A;  3A01 A;  2B63 J;  3ZQF A;  2DA5 A;  1BBY A;  1ETQ A;  5DTD A;  2CSO A;  3LFK A;  1EKE A;  1XGO A;  2XAF A;  5FLM J;  3JSP A;  2L0K A;  1KZH A;  3R6S A;  2MLG A;  3CCL I;  4C2M J;  3ULQ B;  5D6F A;  3BZC A;  4RB0 A;  5J8C A;  1UG0 A;  1TWG J;  2DA6 A;  1GHC A;  1EH7 A;  5LEK A;  2FEZ A;  2XB5 A;  2A5Y B;  4ETS A;  4ANJ A;  3G4S I;  2BY2 A;  2HVS A;  2JRM A;  3V7S A;  3BT9 A;  2H1K A;  2WA0 A;  2A68 F;  1SVL A;  5LEJ A;  1N75 A;  4FT8 A;  1G8X A;  1TWA J;  3LSR A;  4H0E A;  4LJZ F;  3HSE A;  3TP0 A;  4A5M A;  4BJ5 C;  1SAU A;  2E60 A;  4G94 A;  4XNF A;  3RPU A;  3S1Q J;  3I0T A;  2GZW A;  3MKW B;  1JT0 A;  2YX4 A;  2EA4 A;  2R3S A;  2XPV A;  2LSO A;  5KVR A;  3ZXS A;  2CW0 F;  2O3F A;  5C4X J;  1HW2 A;  2QKM B;  2DA1 A;  3FKI J;  1ZKG A;  2L7Z A;  2HQN A;  1ULY A;  2LRD A;  3H9J A;  3R0A A;  5CQE A;  3HC7 A;  1GDT A;  1STZ A;  4CIC A;  5HLG A;  3K6G A;  4WXC A;  2DMQ A;  2OF7 A;  2Y0S A;  1G2H A;  3H0G J;  1FBS A;  5B1A H;  5FKK A;  3RSN A;  1QHG A;  3PJR A;  4FE4 A;  1VQO I;  3T8R A;  2P81 A;  3CCY A;  4B47 A;  2OCC H;  2F5E A;  3M1C A;  2LF8 A;  4Q47 A;  3JR9 A;  3TGN A;  2M8G X;  3M07 A;  2K9N A;  3V7R A;  1E3O C;  2VQC A;  1FYL A;  3G73 A;  3WTW C;  1WSU A;  2BGC A;  2EZL A;  3Q9V A;  2OV7 A;  3ABL H;  1R4N B;  1V5G A;  3I4M J;  1SVO A;  3H1C A;  4WCG A;  1IDZ A;  1X1D A;  2COM A;  3M8J A;  1OMI A;  4XLE A;  4B44 A;  4Y13 A;  1IRF A;  2YU3 A;  2JK3 A;  4AIK A;  1N25 A;  2E1M C;  4XLF A;  4BEH B;  2XPW A;  2XUB A;  1IN7 A;  5ICG A;  2KJC A;  2EJR A;  2GOX B;  3HG9 A;  1FTT A;  1OLT A;  4MTE A;  2EV6 A;  3KEQ A;  1O57 A;  3VYT B;  3NRV A;  1I1G A;  1Z67 A;  2E35 A;  4YFX F;  2VKE A;  3G3Z A;  4NC8 A;  5CYV A;  1OR7 C;  1DPU A;  1FLI A;  1T0F A;  4HV5 A;  4GYG A;  4P96 A;  3Q9S A;  3IH4 A;  2RNG A;  3IV5 A;  2VBX A;  2RKH A;  2LF7 A;  3MCZ A;  1X3Z B;  1TWF J;  2A6T A;  2Y75 A;  1NH3 A;  1HQC A;  1SMT A;  1XCV A;  2XAJ A;  3OOU A;  3BP8 A;  2JA5 J;  5ICF A;  4G8X A;  1RC9 A;  1MJ9 A;  3L1P A;  3H5A A;  5F1R A;  3F8N A;  3CMY A;  5HLT A;  2LY1 A;  5M5Y J;  1WWX A;  3FM5 A;  3QYE A;  3HRT A;  1DDN A;  2OU2 A;  1RR7 A;  4PK4 A;  2DFE A;  2ADU A;  2RC4 A;  1MBG A;  3DEW A;  4M71 A;  2CWE A;  2GIZ A;  1HW1 A;  4LLG F;  4EV0 A;  3LSK A;  4KNY A;  1WJF A;  4L5E A;  5L3F A;  1IG7 A;  1KU3 A;  5BS6 A;  3GTQ J;  2FU4 A;  2NXN B;  2HXO A;  4IO9 F;  3ROU A;  2P5L C;  1RI7 A;  5GTH C;  3W3C A;  4HG2 A;  4II2 A;  1MMG A;  4CZC A;  1R6R A;  2KIQ A;  3VDX A;  3K0L A;  1UB9 A;  4G6D A;  4DYR A;  3TL4 X;  1MDM A;  1AU7 A;  4RMN A;  1VQ8 I;  1WH7 A;  3DPL C;  3HXL A;  4C30 A;  1X1A A;  2NVX J;  3A03 A;  1USS A;  4LG3 A;  1K79 A;  3WOD F;  1SD4 A;  3VYS B;  5J47 A;  4LOC A;  3FBN B;  2X0L A;  5L3E A;  2EIL H;  3CCQ I;  2XRN A;  1T0F C;  3IWZ A;  3RKW A;  2B0L A;  4OMY A;  3BR0 A;  5EGO B;  3W2A A;  1OCR H;  3BG7 A;  2JVH A;  3KZZ A;  1LFP A;  1TC3 C;  4F93 B;  5F6F A;  5IOZ A;  4B43 A;  3CO6 C;  5JFR A;  2PMZ N;  4A3M J;  5DM6 F;  2M4G A;  2OBP A;  2FD5 A;  2WY7 Q;  3OYB A;  4CYC A;  1YJW I;  4XON A;  3VPR A;  2WB1 N;  1OCO H;  2UXN A;  3HSF A;  3J80 K;  3MQ0 A;  2M3A A;  2AO9 A;  4AM3 A;  1QU3 A;  1IC8 A;  2I10 A;  3EUH C;  2NOG A;  4HQM A;  1OFC X;  2ZXI A;  4KIG A;  1W7P D;  4GDF A;  3X2Q H;  4FX0 A;  5B1B H;  4ZC3 A;  4PFO A;  2Y69 H;  1NHA A;  4JBA A;  4R1H A;  4XSZ F;  5J40 A;  1R1U A;  1IF1 A;  2HQR A;  4XN0 A;  2M7A A;  3I64 A;  2FNP A;  3OS2 A;  4LGW A;  2ZBK A;  4BHB A;  1ZLK A;  2JA6 J;  1WJA A;  3I5U A;  3FXR A;  4MEX F;  1YW7 A;  1BOA A;  3CMA I;  2CQQ A;  3DPU A;  4G9Y A;  3JRF A;  1I6H J;  1IW7 F;  3CUQ B;  4GRI A;  3GYH X;  3FIW A;  4I6Z A;  2X1D A;  3C1D A;  3VSK A;  4CCN A;  4HDV A;  4XRF A;  2HFH A;  4P1W A;  1X1B A;  3RQI A;  1MBK A;  4N4O B;  3OL3 A;  3L2V A;  3CCM I;  1L0O C;  3RJP A;  2BXY A;  3CJT B;  3V42 A;  4KT5 C;  1QZZ A;  2EBI A;  2XGC A;  1X2N A;  3DU5 A;  4FCY A;  3IUO A;  2E7W A;  3FIS A;  2R7Z J;  2BOL A;  2DI3 A;  1Z3Y A;  1OYY A;  1IUF A;  3QU3 A;  5E3O A;  1CGP A;  1J9I A;  3W2V A;  4DJA A;  2QF7 A;  2VT2 A;  1UMQ A;  2ESH A;  2V1X A;  1IAW A;  3BPX A;  3OYF A;  2DMU A;  3R61 A;  5F27 A;  3SZT A;  3KP6 A;  1ZGW A;  3I59 B;  3LSP A;  1V4R A;  2L4A A;  3GWZ A;  4PDK A;  3FXM A;  2M4K A;  1MJB A;  2K02 A;  2VE8 A;  2AHQ A;  3JTH A;  5DS9 A;  3ZQ7 A;  5E1Z B;  3K4M A;  1A6I A;  3MVP A;  1VZ0 A;  3GW2 A;  2LK2 A;  4Q5S F;  3H0D A;  1Y8Q B;  3W2W A;  4D0P A;  1PDN C;  5FLX Z;  4A12 A;  3DFG A;  4EJO A;  1T56 A;  2BV6 A;  3K7A J;  4U7B A;  1KU2 A;  1MMD A;  3TOB A;  2X6W A;  4I99 C;  2EK5 A;  1X4P A;  4JP0 A;  1GVD A;  3G2B A;  2LG4 A;  4XIC A;  2FXA A;  3H5R A;  2JA8 J;  1J09 A;  3HOY J;  2PMU A;  4QSH A;  4W1U A;  3T0Y A;  2XGX A;  2GA2 A;  3L09 A;  1S3J A;  4MTD A;  2W4S A;  3K2A A;  3OOP A;  4C3I J;  5IYD J;  5FKM A;  1YX3 A;  2Y0M A;  5GAH J;  3K1M A;  5IYB J;  1ZG5 A;  2IA0 A;  5D8K B;  3Q0U A;  2DOD A;  5F0H A;  2O03 A;  3PO2 J;  2MC3 A;  4L5I A;  4BBS J;  3OV8 A;  3H35 A;  4HAM A;  3WTZ A;  3EYY A;  1F36 A;  5HS7 A;  5H6Q A;  5GAE J;  1D5Y A;  4M72 A;  2HKX A;  4IOC F;  3CQZ J;  3WGG A;  5EZH A;  1P4W A;  3O8G A;  4BUP A;  2KL4 A;  3AG4 H;  2DDA A;  4A0X A;  3K4L A;  1LKX A;  3IAS 2;  3N97 A;  4EM2 A;  3NWS A;  3TQN A;  3FXQ A;  4RGS A;  4UV8 A;  3A01 B;  1FP2 A;  3LAP A;  2AQF A;  1JKO C;  3I58 A;  1XDU A;  4A69 C;  2EFQ A;  3I59 A;  4BQQ A;  4CDG A;  5J6X A;  1J2X A;  2XHK A;  3E6D A;  4PSW A;  2BY1 A;  1FSE A;  2VIX A;  3BR3 A;  2F4M B;  4ZDL A;  4UUS B;  5IT9 K;  2ISY A;  5J3L A;  1LEB A;  3HB9 A;  2D45 A;  3F22 A;  1IDY A;  3FMS A;  4L0Y B;  4L18 B;  2RN7 A;  3DBH B;  2K86 A;  1H8A C;  4IRG A;  1W1W E;  3GTO J;  3OIP A;  3HEF A;  4N0B A;  4L5J A;  1P2F A;  1MNE A;  2LKP A;  3H92 A;  1FY7 A;  2DOF A;  3WTU C;  4HA8 A;  3JRD A;  5AIP A;  1G3T A;  1R7J A;  5D5V B;  4IHX A;  2VJJ A;  5LBQ A;  3FK7 A;  3HM5 A;  4ZYG A;  5M3F J;  3F8C A;  4HSR A;  4ZYE A;  2OPT A;  1R23 A;  1K6O A;  1BW6 A;  3GF2 A;  1FNN A;  1OCT C;  3PSF A;  3QRF F;  1VQ6 I;  2CQX A;  3SEQ A;  2IS4 A;  2B9S A;  5K5Q A;  4M3E A;  4M6Y A;  1ETO A;  2KLO A;  2KHM A;  1VQN I;  2DQR A;  2KZG A;  3KX2 A;  4BNC A;  3ASN H;  4Y4R A;  4A93 J;  2VAS A;  2KRH A;  2FQ4 A;  3ZR8 X;  3OYK A;  2XC7 A;  2IA2 A;  4BAC A;  2DK8 A;  2WBM A;  2YUS A;  2K5C A;  3G1O A;  3SDB A;  1R49 A;  2GAU A;  4WX9 A;  2DT6 A;  3CDL A;  2HVR A;  2DCE A;  4ZDO A;  3QOP A;  1R1T A;  2KIS A;  2HYG D;  2K3P A;  3K1P A;  5JR3 A;  4MEY F;  6PAX A;  1Y56 A;  3F0C A;  2VXZ A;  4U87 A;  3RKQ A;  3MMY B;  1U78 A;  4FIS A;  1ZGJ A;  3VWB A;  2DYS H;  1O3T A;  4HNT A;  5FD6 A;  3OS1 A;  5HS9 A;  3BC8 A;  1YQA A;  2W57 A;  2Z2S B;  3G1L A;  4AVP A;  2F2E A;  2MW8 A;  2VUM J;  3TMO A;  3K4B A;  1U9O A;  2JUC A;  4MNU A;  4YFN F;  2R7D A;  1HDD C;  3VFZ A;  1X4O A;  4OIQ F;  2M30 A;  4HNU A;  1IV6 A;  2A61 A;  1YJ9 I;  3QPS A;  2P5V A;  3JRG A;  1G6N A;  1WVR A;  2HWV A;  3ECH A;  2MYS A;  3TO7 A;  3CF2 A;  1DGR M;  3JRH A;  2VOP A;  2A6E F;  4HZF A;  5EGO A;  3DXJ F;  1DP3 A;  4AVZ A;  1GV2 A;  2CUZ A;  3EUA A;  4B09 A;  2KRF A;  4YEL A;  2VB6 A;  5GPC A;  3TED A;  2GQQ A;  1Y6I A;  2ZNZ A;  3VOD A;  3GZ5 A;  4PJM A;  4RAY A;  1IN5 A;  1G3S A;  4U7D A;  5K7F A;  3AG2 H;  2VL8 A;  5GP9 A;  5DEQ A;  1Z91 A;  5CVI A;  2DFH A;  5L3G A;  4YEJ A;  3SZG A;  2FNA A;  1REP C;  1DU0 A;  2ICW G;  2O61 A;  3FMR A;  3KFW X;  1EH6 A;  1ITY A;  2JRT A;  3AAF A;  1XD7 A;  4BAY A;  1RZ4 A;  1RIO H;  3KP3 A;  4C3J J;  1MMA A;  3H3Z A;  4IX7 A;  2IEK A;  2O5R A;  2W00 A;  3HHG A;  3WTX C;  3M4O J;  3F8M A;  3I4N J;  3C3W A;  3IH2 A;  4G7O F;  3OSG A;  1LDD A;  5LRS A;  2TDX A;  1F9N A;  1B72 B;  2OCE A;  1LEA A;  4IRI A;  1IRG A;  3I4P A;  3ZP5 A;  5GTI C;  1U8R A;  3HSR A;  1FSH A;  4E7J A;  1LUJ B;  2KT0 A;  3HRM A;  5F1J A;  2B7E A;  3J7Y J;  4E7I A;  1SAN A;  1AOY A;  2HTJ A;  3WTY C;  3AFH A;  2IXS A;  2K27 A;  3RZO J;  5C4J J;  5CVR A;  2D1H A;  3A0B C;  2QQ9 A;  2X48 A;  2FML A;  2IS6 A;  1A04 A;  3WTT C;  2ZNY A;  2PLY A;  3BJ6 A;  1FTZ A;  3PM1 A;  4ZTF A;  2VQH A;  1S7A A;  3BDD A;  4P55 A;  2E5Z A;  5CQG A;  1LQ1 A;  4BDY A;  3HOW J;  2YX7 A;  3F8B A;  4PCQ A;  3CZ6 A;  3V7C A;  5H2F C;  3V8J A;  2IA1 A;  3ZMV A;  4CYD A;  2OUM A;  3DQV C;  1OPC A;  1VFC A;  4I02 A;  1YJN I;  3L7W A;  5M5X J;  4ABZ A;  1ZR2 A;  1YYV A;  1VQ5 I;  5JHU A;  2CUF A;  5DM7 F;  1W4M A;  5A2Q Z;  5HNF A;  4HBL A;  5KAI C;  4CGZ A;  3BCA A;  2BW3 A;  3CUO A;  5CJ9 A;  4O5V A;  3Q3S A;  2HEO A;  4FX4 A;  1X3W B;  3E6B A; 
#chains in the Genus database with same CATH homology
 2GOX B;  3CP2 A;  3HG9 A;  3SYT A;  2HZD A;  2CW8 A;  1OLT A;  2IGM A;  4CUG A;  1YX5 A;  3SEZ A;  2IGO A;  2ZSI B;  3VYT B;  1JI8 A;  4ITV A;  2Q2E B;  4Y3O A;  4NUB A;  4NC8 A;  1OR7 C;  4QPQ A;  1EA3 A;  3UR3 C;  3L2U A;  1D1C A;  2RNG A;  2CUJ A;  3CMM A;  4LIV A;  3GBG A;  2A6T A;  3S93 A;  4PJL A;  3QOD A;  3OOU A;  1YE9 A;  2CMP A;  3I3L A;  3MD2 A;  2LBF A;  2WB1 A;  4E7L A;  3H5A A;  1KON A;  1UEL B;  5HLT A;  2LY1 A;  2DXI A;  1PYV A;  2NOJ B;  1T95 A;  3QYE A;  1U0J A;  3H5N A;  1N78 A;  1LDK B;  3IAM 2;  1D0Y A;  2P0W A;  4B48 A;  4PUS A;  4PK4 A;  3QOE A;  1PJR A;  2BVL A;  4BDZ A;  4FAS D;  3PSI A;  2F5V A;  2X1C A;  3H9Q A;  3LSK A;  1WJF A;  3OL4 A;  5CPR B;  2V1N A;  3LSG A;  2IGK A;  4AYB A;  3FBI B;  3DKY A;  1WFX A;  3CJR B;  3S8P A;  5LFA A;  3W3C A;  2KPM A;  2MC4 A;  4HG2 A;  1MMG A;  4HST A;  4II2 A;  4CZC A;  3A2K A;  2IS2 A;  4E4H A;  4PSX A;  1R6R A;  3VDX A;  2AQE A;  2VJ4 A;  3TL4 X;  3S3N A;  1DGW Y;  4XOP A;  4BEH A;  3KYL A;  4RMN A;  3DPL C;  3HXL A;  4C30 A;  1X1A A;  2MFZ A;  2BW3 B;  2E5N A;  3HUG B;  4LG3 A;  5FRM A;  2CFO A;  3ZRG A;  3VYS B;  2R7T A;  2XF6 A;  5KCM A;  1BOB A;  3FBN B;  1AA7 A;  2X85 A;  3AKZ A;  2XDV A;  1T0F C;  3PNY A;  2L7K A;  3OYN A;  2VJI A;  4JQF A;  5FRO A;  4RLF A;  4PFP A;  3QYF A;  3W2A A;  3BG7 A;  2JVH A;  1LFP A;  1X19 A;  4F93 B;  3TBI A;  3HOT A;  4B43 A;  2DOA A;  2DJI A;  3VSL A;  2CW7 A;  3AL0 B;  1BR1 A;  2M4G A;  2RRE A;  4XMY A;  4CCM A;  4J00 A;  3HPH A;  4LIU A;  2WY7 Q;  3A4C A;  3OYB A;  4IQ4 A;  2BVM A;  2W82 A;  4XON A;  2WAQ A;  4YRV A;  4XL9 A;  2M3A A;  4XKB A;  1QU3 A;  3EUH C;  4BL0 B;  4DIQ A;  4E6K G;  2ZXI A;  2LH9 A;  4R79 A;  3U21 A;  1MND A;  3AL0 C;  3S3M A;  4ZC3 A;  2WAD A;  3HKZ A;  4OAY A;  3VYU B;  4PFO A;  3LMM A;  1D0X A;  4F52 A;  4XN0 A;  2M7A A;  3OS2 A;  2KMU A;  4DOZ A;  4ZTJ A;  1MMN A;  3VYR B;  4DBR A;  1MW7 A;  1D0Z A;  1WJA A;  3BG6 A;  3LSH A;  2X51 A;  3OMY A;  4C2T A;  3ONQ A;  3DPU A;  1IRX A;  4GRI A;  5KNL A;  3E0J B;  1WJB A;  2X1D A;  3QYB A;  1P9Q C;  2V7F A;  3VSK A;  1BR4 A;  4CCN A;  4H4K C;  2R7O A;  1W36 D;  1G59 A;  4P1W A;  3MKY B;  1X1B A;  2JA2 A;  2LRE A;  2ZFU A;  2JVG A;  1Z7L A;  3OL3 A;  4N4O B;  3L2V A;  3CP8 A;  3LFU A;  2HQA A;  3DEE A;  2CS3 A;  3V42 A;  4BE1 A;  2I8D A;  2VXD A;  3DU5 A;  3IP4 B;  3IUO A;  2HPM A;  2PMZ A;  4NNJ A;  2BOL A;  1Z3Y A;  3D5S C;  2F4I A;  3BLY A;  3F9K A;  4KIT B;  3W2V A;  3OYD A;  4DJA A;  3K4C A;  2VQL A;  3ZGK A;  2WY8 Q;  4CCK A;  3DKX A;  1W36 C;  4BJT A;  3OYF A;  4J01 A;  3I9V 2;  3C2H A;  1TT0 A;  3J7A Y;  1D1B A;  2R7R A;  2M4K A;  4Y33 A;  2IGN A;  4XR6 A;  2WAF A;  3UNG C;  2CV0 A;  3EPZ A;  2LC2 A;  3K4M A;  1VZ0 A;  2PJR A;  1ERD A;  4HRI A;  3H0D A;  3W2W A;  3CJQ B;  3HPG A;  4PJJ A;  4X0G A;  4U7B A;  3OYH A;  1MMD A;  2X6W A;  2VPL A;  3E1S A;  2F6C A;  4KJZ A;  1X4P A;  4XKC A;  1K6Y A;  3G2B A;  1UAA A;  3EUK L;  2JUG A;  2LG4 A;  3H5R A;  3PNT A;  2R7S A;  1J09 A;  1WJ5 A;  1LVK A;  4ZYA A;  4DBQ A;  3OYL A;  4F3Q A;  2VLA A;  3NWT A;  2L9S A;  2W4S A;  2JSP A;  2ZSH B;  4HPQ A;  2L9N A;  4QPO A;  1YX3 A;  3FKJ A;  3HOS A;  2ZXH A;  3N05 A;  2FUG 2;  2R7X A;  2LY2 A;  2XF7 A;  2XF5 A;  3LL7 A;  3H35 A;  2R7W A;  4N4N B;  3OS0 A;  2UWM A;  2MAB A;  3OYJ A;  4OAZ A;  2RQQ A;  1Z3X A;  3OYA A;  4CCO A;  4BUP A;  2KL4 A;  5JHF A;  3OYG A;  2K9M A;  3K4L A;  1LKX A;  3IAS 2;  3PFY A;  4BQO A;  3CES A;  3NWS A;  2CV1 A;  3OYC A;  3OR1 C;  2AQF A;  1WJE A;  4D1Q A;  3PL8 A;  3K70 D;  4EAT A;  2VKD A;  4BQQ A;  2KQR A;  3K70 C;  4PSW A;  2L5Q A;  3A1Y A;  4FET A;  4CCJ A;  1WJD A;  2VIX A;  4HEA 2;  4XN3 A;  4XLC A;  4ZDL A;  5CKT A;  4RM2 A;  1GLN A;  4CA0 A;  4G6T B;  3S32 A;  4MLO A;  4XLA A;  2LYC A;  2Q1Z B;  3OIP A;  1E0E A;  1MNE A;  4C9Y A;  5KHD A;  4XQF A;  4E7Z A;  3RTR A;  3K10 A;  2HPI A;  2VJJ A;  3PNV A;  3RPU D;  4OWR B;  2ELJ A;  4D9J A;  4HSR A;  3BCB A;  3PUB A;  4KT6 A;  2VKH A;  5TGT A;  1NG7 A;  3DTI A;  3PSF A;  2KZV A;  4BGD A;  2IS1 A;  3SEQ A;  3K4K A;  4F92 B;  2IS4 A;  4DGW B;  5HOO A;  2KLO A;  2KHM A;  2X6X A;  3KX2 A;  2L2O A;  2V26 A;  4Y4R A;  2VAS A;  2KRH A;  3ZR8 X;  4BU2 A;  3OYE A;  3OYK A;  2XC7 A;  3MKZ A;  4BAC A;  2QKL B;  3DPT A;  2WBM A;  4BE0 A;  2UV1 A;  3DU6 A;  4PJN A;  2K5C A;  3KEY A;  3SDB A;  1V5F A;  4E7S A;  4JOM A;  2R7U A;  2DT6 A;  3LSI A;  4XOT A;  5HVQ C;  2HVR A;  2KP6 A;  4F91 B;  2KDO A;  2DCE A;  4ZDO A;  2V6E A;  2K9L A;  3H9G A;  1X1C A;  2V9K A;  2K3P A;  2VJ5 A;  2XSJ C;  1Y56 A;  2VXZ A;  4U87 A;  2W1O A;  3MMY B;  2KRC A;  4F55 A;  1FMW A;  3VWB A;  2VQG A;  4HNT A;  3OS1 A;  3FDY A;  4CCL A;  3BC8 A;  2Z2S B;  2Z16 A;  4NC7 A;  3RCO A;  4C2U A;  3TMO A;  2E1M B;  3K4B A;  2DT7 B;  3OYM A;  3L2W A;  2LOO A;  2R7V A;  1X4O A;  1ZEL A;  4CH7 A;  4XOR A;  1SFK A;  3DTE A;  4NQW B;  3L2R A;  2X1E A;  4HNU A;  4ZJZ A;  4KIS A;  3RQ4 A;  3OYI A;  2MYS A;  4BE2 A;  3DTK A;  1DQU A;  2WAE A;  3CF2 A;  2CV2 A;  2UUZ A;  1DGR M;  4BJ6 C;  3C2G A;  2Z1D A;  2CH0 A;  4E7K A;  2V4J C;  2X6Y A;  1DP3 A;  2M0M A;  4AVZ A;  4AU7 A;  2M7B A;  2CUZ A;  3EUA A;  4B3X A;  3D5R C;  4IZZ A;  4YEL A;  2VB6 A;  3D5L A;  1Y6I A;  4XLH A;  4PJM A;  3ZCO A;  2VL8 A;  4ZDP A;  5FRN A;  2GOM A;  1UG0 A;  4YEJ A;  3SZG A;  3OIQ A;  3ZQQ A;  4RM3 A;  3K4J A;  4BQN A;  1FMV A;  1BR2 A;  4ANJ A;  3LSM A;  2OC6 A;  2R4G A;  1MMA A;  2HVS A;  4IX7 A;  2WA0 A;  2O5R A;  2W00 A;  5LD2 C;  4E7H A;  3S3O A;  2HDW A;  1N75 A;  4LIT A;  4CSW A;  5HNH A;  1G8X A;  4P5O A;  2HNH A;  3HL2 A;  4IQJ A;  4BXF A;  4BJ5 C;  1SAU A;  2E60 A;  4XNF A;  4IKF A;  3K4N A;  1HA8 A;  3MKW B;  4XM3 A;  3ZXS A;  3OR2 C;  2QKM B;  1D1A A;  1WJC A;  2XAU A;  2LRD A;  3H9J A;  4II3 A;  4E7J A;  2MD0 A;  5CQE A;  3HC7 A;  2W7N A;  4E7I A;  2PJR B;  2HVQ A;  3K6G A;  2R7Q A;  2IXS A;  3AFH A;  3OWT A;  3OY9 A;  4RLQ A;  2Y0S A;  4XKW A;  3L2Q A;  3PJR A;  2LBF B;  1QHG A;  3RSN A;  2IS6 A;  4B47 A;  4ZTF A;  2VQH A;  1TZL A;  3M1C A;  2E5Z A;  5CQG A;  4BDY A;  1N77 A;  1V5E A;  1Z21 A;  3CZ6 A;  1NG6 A;  2VQC A;  2OUM A;  3DQV C;  2OV7 A;  3DLA A;  3DWL E;  1V5G A;  1X1D A;  3M8J A;  2A5W A;  4XLE A;  4B44 A;  5HNF A;  3BCA A;  2BW3 A;  1S9H A;  2HU9 A;  3FHN A;  2E1M C;  4XLF A;  4XKV A;  4BEH B;  4BS9 A;  1QHH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...