2L7KA

Solution nmr structure of protein cd1104.2 from clostridium difficile, northeast structural genomics consortium target cfr130
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
MIRLTIEETNLLSIYNEGGKRGLMENINAALPFMDEDMRELAKRTLAKIAPLTENEYAELAIFAADEVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution NMR Structure of CfR130 from Clostridium difficile, Northeast Structural Genomics Consortium Target CfR130
rcsb
source organism Clostridium difficile
molecule tags Structural genomics, unknown function
total genus 20
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14203 TTRAP Putative tranposon-transfer assisting protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1850 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l7kA00
2L7KA
chains in the Genus database with same CATH superfamily
1VF9A 1XDSA 2RGVA 2H8WA 1P6RA 4DYQA 4NQWA 2DMPA 1H89C 3JCUC 3K4BA 2Z99A 2R7UA 3SEQA 1WQ2A 5M5XJ 4DBQA 2NVXJ 4Y15A 3WE3A 2XKPA 2HXOA 1ZHFA 3ABTA 2F2EA 5M3MJ 3CP2A 1ZG3A 3CJQB 1PUFB 5HLIA 4L9JA 4GYGA 5EGOB 4JQFA 4M72A 1VNDA 4D1QA 2K4BA 2V1NA 1YE9A 4D9JA 1KQ8A 2L9SA 5C44J 1XPXA 1DGWY 2EIKH 2XB0X 3U2RA 4LLLA 2ELKA 3IRRA 1TTYA 4A3EJ 3F9KA 3S93A 4E7HA 4A5MA 5C4JJ 2M30A 2VASA 1SFKA 4FTHA 4M3FA 1YO5C 4IKFA 4HX4A 2Y30A 3RKQA 1XX5A 1LE8B 1IAWA 2Z16A 5IP7J 3GO5A 3KX2A 3ISPA 5F0FA 2UZKA 4NBQA 2UV1A 2FA5A 1U9OA 2EFQA 4A3CJ 4XLAA 3HG9A 4XKBA 2MABA 1FJLA 3OSGA 4U88A 2BY3A 1B4AA 1O7LA 2KQRA 3BZ6A 4XKCA 4M74A 5FROA 3QAHA 3JRIA 3ZCOA 2BEOA 1WVRA 4PDKA 1MMAA 1XD7A 1MNDA 4Z6YA 2EINH 1ENHA 2CQKA 4I7HA 4RB1A 3WG9A 2DT5A 2ECBA 4AIDA 1G4DA 5FRMA 2K3FA 4MGRA 2BV6A 4CCMA 3FKIJ 4L9TA 3CUQA 5EEHA 2CS3A 2MLGA 3HZJA 3LSRA 1R58A 2NYXA 2OTLI 3H0DA 4A3FJ 2C6YA 4P96A 5ED4A 3L2CA 2M8GX 1W0UA 2BY2A 1X1CA 1I6HJ 3VPRA 4RDUA 2JA8J 3PSFA 3FXLA 4P1WA 3BQZA 3LA2A 3CCQI 3GFMA 4J00A 4FX4A 1WJCA 3FIWA 5F0CA 4U0VA 2AQEA 5CPRB 4IHYA 4EATA 3D5RC 3LWFA 3WTUC 3I59A 5F64A 4CSWA 4CZZA 2HQRA 1YHQI 2KRFA 3DBRB 2ZFUA 1N78A 3CCJI 1GUUA 1Z21A 5HS7A 4I2OA 2ICWG 1SD5A 3BTCA 4XQFA 1PP8F 1GVJA 3JRAA 2CG4A 3RIRA 1WJDA 3JRGA 2X1DA 1VQPI 5CJ9A 2M0CA 1W5SA 1ZR4A 2YS9A 5LEJA 1K6YA 3E5XA 3SDBA 1P9QC 1SFEA 4BQOA 3SEZA 2R5ZB 4S0HB 4E7IA 1O3TA 5LGUA 4LITA 2JVHA 2PN6A 2CFXA 2MSYA 5LGNA 1S72I 1A35A 3GTKJ 4PJ0C 2PFBA 5J6XA 4RMNA 4A3IJ 2XAUA 4M3BA 9ANTA 1X1AA 2NAZA 3CMMA 2L0KA 2JUCA 2ELHA 4WXDA 1XTAA 3GTJJ 3GBGA 2O61A 1RETA 1MW7A 2EFNA 4HF0A 2A5YB 2HZDA 3OYEA 2QA4I 3KETA 2H27A 4W1UA 1SAXA 5D5WB 4UV9A 1ZGWA 1FTTA 5GP9A 1JHFA 3HRTA 2QENA 1X58A 2HFHA 3HPGA 5ICFA 3A2KA 2G0EA 2ME0A 4ITVA 1TNTA 4YIFA 1ERDA 2OF7A 5KVRA 1T6SA 2CUZA 3CO6C 2W24A 4FETA 4V2GA 3T1BA 3VFZA 1A31A 5J8FA 3IAS2 2JJ7A 2MGQA 3MKWB 4EMSA 4BS9A 4F55A 4IO9F 4LK0F 3ZR8X 3ZN1A 1HDDC 4EQQA 2E7WA 1SD4A 4RAGA 2XPVA 5E8IA 4D0PA 1UAAA 5K5QA 1S6LA 2H1LA 2UXNA 1BOBA 1B59A 1TWHJ 4A6EA 4Y7NJ 5E8GA 5BS6A 1X4PA 2EFPA 3QODA 2HQ5A 1T8IA 5F08A 4BQNA 2ACJA 1BBYA 3KP6A 2G7HA 2UUZA 2MG4A 2NS7A 5AIQA 4ENJA 2LF8A 3JRCA 1W1WE 2I10A 3ZRGA 1L0OC 4C30A 4D5FA 3BR0A 4EJOA 3CF5F 3F21A 3PFIA 2EILH 1IN6A 2OJED 1U9NA 2B63J 2PEXA 1FYKA 2VT3A 1REPC 2XKOA 2P7VB 5GTHC 2ISZA 1IRGA 1FEXA 5FLXK 1O3RA 1FYLA 3G71I 3CUOA 4BHCA 2QSGX 2VI6A 4EVIA 1D5YA 4ENNA 5IYCJ 2BYVE 2ZCWA 1Y39A 3V8KA 4XRFA 1ZN2A 4ON0A 5HDKA 2DU9A 3ZPLA 3DEEA 2GWRA 3LAPA 4PFPA 3TOAA 2GM4A 2M34A 3B6AA 1UHSA 5J1RA 3HHHA 2DO7A 2P5VA 5M5WJ 2IPQX 4HF2A 3L2UA 2WA0A 1TT0A 4KIGA 1D1AA 4BH9A 3ZMDA 4N9HA 4PCQA 4IOCF 1U8BA 1XDUA 3HKZA 2DJNA 5FKNA 1LUJB 1LB2A 3PIOF 3AL0C 2Q8KA 1KZHA 1Z0XA 3JRDA 1VZ0A 2NNNA 2OPTA 3QWLA 3UNGC 4RM3A 3AKZA 3ZN0A 3IAM2 1QO0D 3FF5A 4Q48A 2WAQN 2EQRA 4ZDOA 3ZQ7A 4XMYA 2ZJQF 2JPBA 2FMYA 2O9LA 2L7ZA 1FOWA 3R0JA 3RPUD 1VQOI 1AHDP 1H8AC 3GZ6A 2FE3A 3SFIA 3RYPA 1RRJA 2QEXI 2Y0SA 3DQVC 3FXQA 1K4TA 2VBWA 5IY5H 2Y9YA 5D6FA 3M7GA 2M4KA 3M1CA 3ZP5A 4GRIA 4R1HA 5CYVA 2JA6J 3CD6I 1YQAA 1ZR2A 3SDGA 1STZA 2R0QC 2Y9ZA 3CC4I 2DYSH 3OL3A 4BY7J 5DM6F 3S1QJ 4ZC3A 5FLXZ 3VODA 4OIQF 2VBZA 1DU6A 1A04A 5J1YA 2HU9A 1XS9A 3E7LA 3H3VK 2F5DA 3S2WA 5EG0B 1Y56A 4S05A 1XGOA 3G1MA 3I64A 2Y48A 4OAYA 2R7TA 3HPHA 4QPOA 4IRHA 4O3MA 2RKHA 1D1CA 1R1TA 5B3SH 3PSIA 3ZMZA 4XRSG 3KEQA 3ECOA 4KFCA 2X9DA 2AQFA 2DA4A 1BI0A 2JTVA 3H0GJ 2L3DA 2JN6A 1MDMA 2WB1N 1ONVA 1S3JA 4FT8A 2LVSA 5IPAA 4HZFA 2KJBA 3F3XA 1FIAA 4Q47A 1ZELA 1VQ5I 1T98A 4NB5A 4PZJA 3MD2A 3AG2H 5L3DA 1GV5A 2PMZA 2JA7J 5CLSA 2D1HA 4ZYDA 3LA7A 1H9GA 2R7DA 4XL9A 3MN2A 2AO9A 4BU2A 2F5FA 1FBSA 4D5CA 2NNYA 5DD8A 3PNYA 1G3YA 3FXMA 2F5CA 3WGHA 1AKHA 4KICA 2HYGD 5CVVA 3K7AJ 1DUXC 3CLOA 1HKTA 2EZLA 1Z6RA 2I8DA 1RR8C 1FMWA 4C3IJ 3ZMUA 1IUYA 1IUFA 1R4MB 2K9QA 4ENMA 1FY7A 3JTGA 3JRHA 4DBRA 4UNOA 1RKTA 4Y3OA 3C7JA 3FXJA 2M7AA 2HYFA 2DMUA 4AD9A 3HOSA 2DMQA 4E7JA 2UWMA 5CVJA 2WY7Q 1VTNC 3BLYA 1HKQA 2JRMA 2WAEA 3E5QA 2IGOA 2QWWA 3HJEA 3I56I 1OMIA 3GVAA 4CCKA 2DW4A 4B09A 4GDFA 1P2FA 3ERMA 1T95A 4IPAA 4M9ZA 3ZMVA 2HWVA 1IZ1A 3GXOA 4NC7A 4RB0A 2V1UA 2M8EA 1BN5A 4I6ZA 1LFUP 4Q5SF 1FSHA 2LF7A 3WTWC 1S29A 1QNTA 2BHYA 4CCOA 3DKWA 3BZKA 3EUKL 1WRJA 5EEGA 1HOMA 1WWXA 2CSOA 2E1NA 1APLC 2L2OA 4A3BJ 2ECCA 2DI3A 2QF7A 1PUFA 1X2MA 2ISYA 5EGOA 3AG1H 2LYCA 1Z7UA 2YR2A 1TC3C 1SAUA 4DYRA 4HQEA 4GFBA 3ABUA 3L09A 3CQZJ 2BVMA 2VLAA 2LBFB 1JT0A 2LG4A 4B44A 2GXGA 1HLVA 2LREA 1IN5A 2OCEA 5J4VA 4LG3A 4C3HJ 2EIMH 3HB9A 4UUSB 2A3SA 4IVNA 3SZPA 4L5EA 5FB2A 3DWLE 5HS9A 4FASD 1WI3A 2VKHA 2A07F 4UHTA 1LE8A 2E2JJ 4AUXA 3F23A 4HLYA 2H09A 3BG6A 2ZB9A 1LEBA 4QSHA 2VPRA 4GGGA 4I99C 3RZOJ 2OD5A 4XLEA 4YIRX 2DT7B 2GBYA 5K5RA 3B02A 5TRDA 2DA1A 2V1XA 3HM5A 4IHVA 2VQCA 1TWGJ 3GLXA 2E35A 2KRCA 1I3AA 4MIMA 2DN0A 1IV8A 4B3AA 1XB4A 3ZQHA 2CUFA 2E1MB 5D6EA 3S15J 3WTSC 1BIBA 1KA8A 2JA5J 4A69C 2VKDA 4LFUA 4BE2A 2JPCA 2K7LA 2ID3A 5FD5A 1SFXA 1UFMA 2VQGA 4A3JJ 3TGNA 2GA2A 1TQMA 1I1SA 2LC2A 2XV4S 3WGIA 3D5LA 3UKGA 1PYVA 3K2ZA 1YW8A 4L5IA 3RPUA 4AYBA 4AIJA 4BQQA 4Y4RA 4M3DA 1TP4A 3FWEA 5B1BH 2FBKA 3QOPA 4BUPA 3LMMA 5KHDA 4HDUA 4KMFA 1IGNA 1DP7P 1F36A 4U87A 3LSTA 1XGMA 2XB5A 2CUEA 5E79C 4MTEA 4KUMA 5HLTA 3OYCA 5L3FA 5K7HA 1TWAJ 1G6NA 1OYIA 1E3OC 5E1WA 2DPDA 2GXAA 2STWA 1XG1A 2L9RA 3K1NA 2V6CA 2FNPA 4JP0A 3NWSA 2CH0A 5ICGA 1YJWI 2KFDA 3M8EA 1RNLA 5CVRA 2DJIA 3D5SC 1SVOA 1YX5A 2W25A 2XPUA 3JREA 3QRFF 1U6GA 1ZRCA 3VDXA 2R5ZA 2L7KA 1J7KA 3F8BA 4NUBA 5J3LA 4G7ZF 5LRRA 1FTZA 3GZNB 1UG0A 4F92B 1K4SA 3IC7A 3BTJA 2A69F 4RGRA 5J4YA 5D8LB 4XBFA 2CV1A 2K27A 4HV5A 2BVLA 2P5LC 4ZYHA 2EB7A 3KYDB 2COMA 4LMYA 4OMZA 2YU3A 3KFWX 4M73A 1USSA 1V3FA 1WKMA 2X1EA 4XLHA 4IHXA 2YPRA 1QPMA 4EEFG 3VB2A 1X1BA 2HOAA 2QKLB 4HX8A 3R0AA 1Y8QB 3K0LA 3C3WA 3GUDA 3L1PA 1ZG5A 4HSTA 3KP4A 5E3LA 2L4AA 4PGHA 4XKVA 2OU2A 4FHTA 3FISA 4U7DA 3AL0B 2LR8A 4II3A 1QRYA 3QYBA 3VYRB 3ESWB 1E0EA 2W57A 3PL8A 5HDNA 2IEKA 2DMNA 4BNCA 1K79A 1BC7C 1G3WA 1GVDA 2MW8A 3GEZA 4ASNA 4QTRA 1H9TA 2DXIA 2LKXA 2PJRB 5FO5A 2YUSA 1BR1A 5A2QK 3GTOJ 2QVOA 2Z2SB 3ZGKA 1RESA 3E0JB 5CVUA 3LFUA 4WX9A 2CMPA 2RQPA 1S7AA 2VC0A 4MFDA 1SFUA 2AHQA 2RNGA 4IQJA 2HOSA 3DF8A 3DTIA 1UB9A 4G12A 4HYEA 2Y31A 3PIPF 2MD0A 2XAQA 2LTPA 4A93J 2O3FA 1IN4A 1X1DA 2VB6A 5GAHJ 4ZTJA 3LNQA 2BXYA 3TP3A 3OIQA 1ZTRA 4XICA 2NOGA 3HTSB 2VJIA 2LDUA 5HVQC 4XONA 1L3LA 4MQVA 3KYCB 4DJAA 5K7FA 1LPQA 1KYWA 3IWZA 2L54A 1F9NA 3O3KA 1FYMA 2VOPA 2P4WA 2DQLA 1YOVB 1KGSA 1A6QA 3RKWA 2KIMA 2KDOA 2P6SA 2DK8A 2XIGA 5KAIC 3NARA 4BY1J 5DYMA 3GTPJ 3E6MA 4CGZA 2K9LA 4BXUA 2OTJI 2MA3A 3ZQQA 3KEOA 3CCYA 2D1VA 1MJAA 4BEHB 2OC6A 3QU6A 1FZPB 1PJRA 3QYFA 5KNLA 4HW0A 2ZBKA 4DQ2A 3OYFA 2FEZA 2WV0A 2TDXA 4KT6A 2PJPA 5D4SA 4BE0A 1UHMA 2CO5A 3PUFA 3VSLA 3BCBA 3T0YA 3U9GA 2XGEA 1R5HA 2ZKZA 1U8RA 5JI6A 4P55A 4XM3A 2XF6A 3OS1A 3CP8A 3CDHA 3Q0WA 5A2QZ 1ZKGA 2EZKA 4EM2A 3VYUB 4KISA 2DDBA 4IZZA 5HODA 5DS9A 1T0FC 3GYHX 4YIIA 1VQ8I 5FGMA 3OYGA 1YG2A 1B9NA 2A05A 2OA4A 1X19A 3KCCA 5BPDA 3HYIA 1SD6A 2E7XA 2KIUA 3CDIA 5E18F 3F8CA 3RI4A 3MMYB 4XN3A 1K6OA 2M45A 1YIOA 3JAMK 3S2HJ 5D8KB 1IDYA 4GO1A 2V1DA 4TV7A 2R7SA 1X3WB 2FF4A 3JTHA 3T8TA 2DLLA 3AG4H 2EH3A 4B8XA 1YTYA 1DPUA 3W2AA 4BBSJ 4F52A 4AVZA 1K78B 4P9FA 1RIOH 4FQGA 3TQNA 3S14J 5EG0A 3ZQCA 2A61A 1S9HA 2LOOA 2P8TA 3ABLH 3H5AA 1ACIA 4CICA 3S3OA 4LIUA 2DA2A 4JK1X 2R7RA 3ZMSA 4YFNF 1WHUA 4C2TA 4OIRF 2CWEA 1FP1D 3E3VA 2JMWA 2HTJA 3BROA 4I76A 1R6RA 2VODA 3TO6A 3RQ4A 1B72B 4L5JA 4ZH4F 2HDCA 2O03A 3K70C 4HNUA 1KQ0A 4RB3C 2DOEA 4M6XA 3U1KA 2F4MB 3OYJA 2M5WA 1HW5A 2NOJB 2Q1ZB 4IRGA 1T0FA 2UXXA 1W7PB 1P4AA 3P7NA 5E17F 1Z3XA 4OOIA 2P6TA 3QOEA 1QZEA 2DTZA 2IGMA 5KK1A 2FX0A 5IT3A 5DUKA 3W6JB 1SEUA 5H6QA 4S04A 4FE4A 2E5NA 2W7NA 3JRBA 1G59A 1HF0A 1OFCX 3FK7A 4JYKA 4E7LA 1MSEC 1FNNA 3K4CA 4DZJA 2YU9J 3EUHC 1R1VA 3FBNB 3TKYA 3L2WA 4EJTA 4MLOA 5GAEJ 1R49A 1OR7C 1ZG1A 2B9SA 3N4MA 5F04A 1X3UA 4FCYA 3JAMZ 3HTUA 1IRXA 4MFEA 3Q9VA 5EF6A 2V6EA 2ELJA 2LY2A 2F5VA 1JKRC 1TZLA 4HNVA 3TMOA 4LB5A 1ETXA 2WBMA 4AIKA 1A6IA 2MD5A 3MKLA 2BW3B 3M8JA 2DMTA 5IYBJ 5BNGA 2H1KA 3PUBA 4X1EA 5F0HA 1DU0A 2E1MC 3EQLF 3BY6A 1SC7A 4BYYA 2D5VA 2CQ7A 2DT6A 4HRIA 1Z7LA 1T2KA 3KP3A 3IV5A 1UG2A 3IH3A 2W85A 3K4MA 4KN7X 1MBHA 2IS6A 3B6CA 1WZ2A 2KRHA 2IGKA 2YX4A 3SHFA 2EK5A 3H9GA 1E3PA 1ITYA 2OZUA 4AU7A 1VQ7I 4ESJA 1I27A 2LBFA 1B8IB 1ETOA 3H5NA 2ZMEB 1WCMJ 3EUHA 5E1ZB 3OYHA 5HLHA 3CESA 1MH4A 4PK4A 5LGTA 1YS7A 4ETSA 4P5OA 2IGNA 2O7OA 4LGWA 3DLLF 1OR7A 4UUSA 5CKTA 4HX7A 2K3PA 1BM9A 1JTXA 2XASA 2JQ7A 4E4HA 2W00A 1BJZA 2R7QA 1NG7A 3LOCA 1U0JA 3WTTC 1HQCA 4BHBA 2M1BA 4L9NA 3K1PA 4QWQA 3W2WA 3S1RJ 3PNTA 3RDIA 3CDLA 2QCOA 3M8FA 1J09A 3K69A 3FXKA 1CGPA 4GYIA 1CF7B 3RPQA 4NC6A 2STTA 2FOKA 3V4GA 2MFZA 3KP2A 3ZQGA 1JXSA 3H36A 3CC2I 1BIAA 1LVAA 2BZTA 1TL8A 1Z67A 1Z1DA 5KCMA 2VL8A 3GFLA 3H1CA 4M6YA 5BPIA 3I3LA 2X6WA 1POGA 3BG9A 4WK8F 2E1CA 1IN8A 1HSTA 3QP6A 3BP8A 1D1BA 2HKXA 4HPQA 1MBJA 2Q2EB 3MZYA 2X0LA 2PBIA 2OV7A 5E20A 1W36D 3ULQB 1F4KA 3P9KA 4YFXF 3GX4X 5E3NA 1HXDA 3DEWA 3BC8A 3DPLC 2IS1A 2VE9A 1C0WA 2ESNA 4I0BA 3C2BA 5JFRA 3SFZA 1WH5A 3P9IA 2V9PA 5D5XB 3CJRB 1IXCA 3HIFA 2R5YB 2LMDA 3OOUA 3FXRA 3NRVA 1E17A 5FJ8J 1VQ4I 1FBQA 1I5ZA 2L7FP 1S7EA 5DV5A 1KU7A 3K4KA 1LEAA 1IF1A 4ESBA 2IS4A 2DFHA 1YI2I 1HSJA 1JJ6C 2HQAA 3BCAA 3ZMTA 2N8GA 2Y0MA 3G3ZA 4KIBA 2IA0A 2R7OA 3HBLA 3J7AY 2VPLA 3NEUA 1K83J 1R23A 3SZGA 4B4CA 4XOPA 3QP5A 3GW2A 4C2UA 3MQ0A 4LLNA 2QQ9A 3LFKA 4FE7A 4CO8A 5FLMJ 1MH3A 1E2XA 1XGSA 3HOVJ 3WHBA 3DFGA 1LDJA 1VQ9I 3E6DA 4F91B 4E7SA 3K4JA 3TL4X 2GAUA 1D8KA 2EV6A 2R3SA 2K02A 3OYBA 2JRTA 2GOMA 4ZDPA 4J19A 4GXOA 4L18B 3H3UA 4R79A 5J8CA 3CCMI 3FM3A 1V4RA 3IKTA 3JW4A 1GDTA 5FFZA 2ADUA 2BOLA 3TDUC 3RZDJ 3ZQIA 3CCVI 2PJRA 2H6BA 5DCFA 1GXQA 1MBEA 2R93J 2IS2A 1MMDA 3BJ6A 2R7WA 3FHNA 3M07A 1TWFJ 1EKEA 1T38A 2XF5A 3P5JA 2Y2ZA 2XHKA 4BBRJ 3D1NI 3OR2C 2OQRA 2RC4A 2X48A 5TJJA 4H0EA 1XSDA 4JX5A 1UCRA 1J9IA 3JSOA 1IC8A 2OZ6A 3COAC 2LFBA 5GTIC 1IO2A 3OYMA 1OCPA 2E34A 3WTYC 3HC7A 5BMZA 5K7ZA 1LNWA 2O8KA 3S8PA 1ZH5A 1ON1A 1BW5A 2QSFX 2Y0SN 3DTEA 3OV8A 4HV6A 4C3JJ 1FLIA 2KDZA 2DQRA 1ZGAA 3MZ8A 2XPWA 1JKQC 3HRUA 4X0GA 4AWXB 2R7FA 3T5XA 2X6XA 5FKLA 3OS2A 3A1YA 3MVPA 2LKPA 2QYOA 1JGSA 1UELB 1W36C 2V26A 2EJRA 4G94A 4KN4X 2X85A 3M1EA 1YFHA 5JLXA 2W82A 3OR1C 2A68F 3H9QA 2EA2A 4PJMA 1GLNA 4MQ9F 3LSMA 4G6TB 3TBIA 4WF2A 1TWCJ 4BEHA 1J59A 4Y52J 3E97A 4DW6A 2DA6A 4I02A 5FKKA 3BJAA 3N05A 2P81A 1NK3P 1EJ9A 4HSRA 2CQQA 5F6FA 1MBKA 3VOEA 4V19K 1YRNB 2AXLA 1P7IA 2DODA 4UB6C 2CU7A 1OCOH 1BJAA 2PMUA 1HCRA 4IEJA 4RAFA 3CCRI 1G2HA 5K5OA 3PM1A 3LL7A 1DQUA 2Y69H 2LY1A 3MEXA 1QPIA 4IHWA 2X6OA 1ZGJA 3SJMA 3EYYA 2LNBA 3DU5A 3OY9A 2JSPA 5H20A 3DXJF 4O6JA 5LRSA 1ORKA 5AONA 2PMZN 4F7ZA 3I53A 3OSFA 4B3XA 1D5VA 4G7HF 2QSHX 1NK2P 3OYNA 2MH2A 2CYYA 4CXFA 2Z3YA 1R00A 1U2WA 2V9KA 1WGXA 1AWCA 4U0YA 3NWTA 3V8LA 4YFKF 1GT0C 1O3SA 4LG0B 2CQXA 1JT6A 1SFOJ 1QVUA 3KLNA 4DOZA 1BR4A 3OYIA 2F4IA 3HUGB 1ON2A 1BA5A 5EJCA 3OOPA 1XC5A 4XOTA 1ZLKA 4U0WA 2JA2A 3IH4A 2E36A 5M5YJ 1K78A 3KIOA 1J75A 1ETKA 2GIZA 3QPTA 4LOCA 4G9YA 5TISC 5EZGA 1IV6A 2DPUA 2XRLA 2PMHA 2FXAA 5L3GA 3KYLA 3DP7A 1R5ID 1OCRH 2K9NA 2VXZA 4RS8A 2O5RA 2X4HA 1LKXA 3MAJA 3QU3A 2OQGA 3IHUA 4AIHA 1T39A 4EM0B 4KITB 3SYTA 3GCMA 4KMUX 1U78A 1JTYA 2KJCA 2AS5F 4UB8C 1V5EA 1D0YA 3L2QA 3CZ6A 1QGPA 1RC9A 2TCTA 3MCZA 1B72A 1UHWA 4CHUA 1RUOA 3O2PE 5DCMB 3VSKA 3FM5A 3GTQJ 3LSGA 1T56A 2KHMA 1HA8A 4EV0A 4HAMA 1BI2A 3MKYB 1ETYA 4U7BA 1VQKI 1W7PA 3EUAA 1S7OA 1FMVA 4XLNF 1F43A 2IVMA 3WG7H 2NVUB 4HOBA 3A0HC 4QLCU 2FMLA 4CYDA 3FZVA 1VQLI 2NVTJ 2VQHA 2WV1A 3GF2A 3HGGA 2ZMEC 2JSCA 2Q0OA 1RI7A 1G3SA 1WSUA 4BE1A 3W6VA 3HOTA 3R4KA 3I4MJ 4EM1A 3C18A 1V5FA 3HHGA 4A5NA 2BE5F 4IHSA 2QQAA 4C9YA 2RV8A 3S3NA 3F8FA 2CFOA 3HRSA 1U5TB 3OWTA 3I9V2 1VQ6I 2MBFA 3PO2J 3LSIA 1JKOC 4PGGA 4KYWA 3BTIA 5ICCA 3ZOBA 4ZZLA 2VXDA 3RCOA 4E7KA 1TLHB 3DKYA 4I0AA 4RGXA 3W3CA 1ZYRF 3MKZA 4RGSA 2BW3A 5E1XA 2OBPA 2EWNA 1OCTC 4BQAA 2QLZA 3HXLA 1W4MA 4MNUA 3PO3J 1YW9A 4XRSA 5E3MA 1FOYA 1HW2A 3BR1A 1OPCA 3ML6A 3I4NJ 3WE2A 2CGPA 2EFOA 1ODDA 3V7SA 5L3EA 4BDYA 1YYVA 1FBUA 3OYLA 2YSRA 4IRIA 3VEPA 4XORA 4BXFA 2CV2A 4AYBN 3BG5A 4I09A 3LA3A 1VFCA 3O8GA 2XAFA 1YW7A 4BXXJ 3QPSA 2XF7A 3I54A 1TBXA 5ILUA 3MFKA 4WXCA 1B8IA 4L0ZB 3KP7A 5EZHA 2P0WA 3QQAA 2ZMEA 3E6BA 4JOMA 2X1CA 2HXIA 4Y17A 2NRAC 2KZGA 4N9IA 1UJ8A 4I98B 3K70D 1MNMC 4HDVA 4M71A 2RN7A 1SMYF 4EJUA 3S2DJ 4A0ZA 3DEUA 4Y13A 3JSPA 1IXRC 3Q0UA 4UVCA 4OINF 2KIQA 3HOXJ 3SQNA 3BR6A 2ZSIB 2IA2A 4XLFA 2LH9A 1NTCA 2ZNYA 2G7UA 4E70A 1WJ5A 2HI3A 4FISA 1CF7A 2L02A 1J5YA 4RM2A 3K2AA 2L9NA 2FJ1A 2KZVA 2HKOA 4GCVA 2WWYA 2M2EA 1Q1HA 3TDZC 4ZYGA 5ILSA 2QBYB 4EJWA 1XMXA 3D0SA 5DTDA 3R6SA 1ETQA 1TW3A 5JVTA 2HVRA 3QPHA 3L9FA 3GTMJ 3O6BB 1JUPA 2VOOA 2M7BA 2DA7A 1EV7A 5HS8A 2H8RA 2M9HA 3F0CA 4LB6B 5DUIA 5IP9J 1GXPA 1X2NA 1WJBA 4IHTA 1LDDA 2FQ4A 2Q2EA 3FXUA 3KLOA 5HDGA 4ZDLA 1OQYA 2M4GA 4A3GJ 3FKJA 3RKXA 2CJJA 2IP2A 2QGUA 2XAHA 4A3KJ 4BJTA 1BI1A 1WFXA 2AXTC 1OCCH 1I3QJ 2B7EA 2GLOA 3CCEI 1V54H 3EDPA 2HVQA 5KAFC 1MMNA 4NDLA 2ZO4A 4N0BA 1MSFC 3CUQC 3HOZJ 3J7AO 2R5YA 5ICEA 3BWGA 1D0XA 3A01B 2ZSHB 4KJZA 2K5CA 2COBA 1RZ4A 5ILVA 3S1MJ 2KMUA 4M3GA 1FSEA 1IRFA 3F6OA 4HBLA 3ZXSA 2ME6A 2FU4A 2HNHA 3HSEA 4PSXA 5L3CA 4ZTFA 2R7XA 3CCUI 4XIDA 3IKVA 2NS0A 3BG3A 1R22A 3OL4A 4HF1A 3SZTA 3CMEI 2QQ8A 3L00A 3S17J 2HYJA 5ERIA 3BR3A 2V79A 1IRZA 1JJ8C 1BR2A 4ZYEA 4LK1F 5DDGA 4J01A 2XGCA 3HOYJ 4B43A 1OISA 3TOBA 3L2VA 2DTRA 4M3EA 5H2FC 2KL4A 2VJ5A 3I4PA 3DV8A 2DFFA 5LFAA 4A6DA 2P5KA 3KZYA 4YG2F 1Z6TA 5J1UA 5J47A 4EGYA 1YITI 3CCSI 2HZTA 3UR3C 2LP0A 4PJJA 3KE2A 5DD4A 3W2VA 1F5TA 1IN7A 4MEXF 4XSXF 2WY8Q 1XSVA 4D7MA 4H4KC 2Y75A 4BL0B 3REOA 2DOFA 5LLQA 2ZC2A 3F22A 3IH2A 5IOZA 3FDYA 4Z2YA 5GADJ 4HG2A 1AA7A 5EEAA 4KA4A 4NC8A 3J80K 3FMSA 2DCEA 2VN2A 3VWBA 4RA2A 4G6QA 2JZYA 3DPTA 3O8HA 1GV2A 1W5CC 2FBHA 1W5TA 5CQGA 4UXNA 3FK6A 4ABZA 2DYRH 4XSZF 4A3MJ 1ZRFA 5BQTA 1TT5B 2L9VA 3DCFA 3NQOA 4P9UA 4X6AJ 3DKXA 3K9TA 1O4XA 2W1OA 2CQNA 1N77A 2QZ8A 4CCNA 3CMYA 3WTVC 2CV0A 2E2IJ 1ETWA 1T33A 4R8HA 3GFIA 2RREA 3BQYA 3AFHA 2A6EF 4IQ4A 1MBFA 2LKSA 3BJOA 3F8NA 4RAZA 3G2BA 4G6DA 4BHPA 2HDDA 4W97A 1P4WA 1E3HA 2K86A 3H5RA 1BC8C 2VE8A 1FPQA 2EZIA 4OAZA 5F1RA 3GLLA 5IT9K 2L5QA 4F93B 2QQBA 1OKRA 4A2UA 3LSPA 2M87A 2IBDA 1J0RA 3BOQA 2VC1A 3L2RA 4K2EA 3WGGA 3BPVA 3S1NJ 3AAFA 5B5EC 2OUMA 1VI0A 1V55H 1Z05A 2JK3A 2H94A 2ZNZA 3Q9SA 3F6VA 3ONQA 4PJNA 2IT0A 2XSJC 1YRNA 3HSRA 1Y1WJ 1YLFA 3AG3H 4ZYAA 4BKXA 5FFXA 3LSKA 4XK4A 5CVIA 3KPHA 4DNCA 4OIPF 1T08B 2FQ3A 3DBHB 2X51A 4PUSA 5GPCA 3HSFA 3CCLI 2K40A 1PVEA 2E1OA 3J80Z 3IRQA 1QHGA 4FX0A 1XGNA 3LSHA 2XROA 6PAXA 1DP3A 3K6GA 2HVSA 2GZWA 1OYYA 4YRVA 5HOOA 1WJFA 5JHFA 3ABKH 4CYCB 2NVQJ 2XAGA 4YEJA 1FC3A 2WAQA 5LD2C 2KKOA 2HGCA 2GXBA 2H6CA 5JR3A 2PG4A 2HEOA 3CLQA 3V7CA 3I58A 2P7CB 1Z91A 2ZXHA 2GQQA 1LJ9A 4LG0A 2R92J 1YJ9I 1RPWA 3Q0VA 3SXYA 1CQTA 3EYIA 2EZHA 4OIOF 1QBJA 4M6VA 2EBIA 4KNYA 3HUGA 5LHHA 1ZREA 1NH3A 1XSXA 3GFJA 1MZBA 1XMKA 3E5UA 2LSOA 4CCJA 2MH9A 2BGCA 2GIVA 4PSWA 2JT1A 2JWTA 4UUTA 2A6TA 2K9MA 5IOYA 2Z5UA 4BACA 2X6YA 1Y0UA 2KP6A 4PJLA 4RLFA 1S5LC 2ETHA 1U5TC 1K61A 4XLCA 2LLKA 1R5GA 1LQ1A 2PI0A 2O6GE 3BR2A 4IL6C 2EFWA 1MKMA 5GPAA 5IT9Z 2VIXA 2ZJPF 2RQQA 3I0TA 1RR7A 4BJ5C 1S8NA 1IJWC 1AU7A 4B47A 4M9SA 2PLYA 3F72A 3CJNA 1H0MA 4MTDA 2CRGA 2RAEA 1HKSA 2GOXB 2K4JA 3VYTB 2FBIA 1EH8A 1QQIA 2VBYA 3U1DA 2ZJRF 1TNSA 1FWZA 5DCMA 4XN0A 4NQWB 2E2HJ 1R36A 1O7FA 3W6KB 1R9TJ 1PDNC 1JHHA 1I39A 2WB1A 2ZFWA 1VQMI 2W4SA 5F27A 2VT2A 2WC2A 3M4OJ 5FLVA 2L7MP 2F6CA 3ZQLA 1TW2A 2HPIA 1B1BA 2E71A 3LQQA 1X3ZB 5HNHA 1EF4A 2XDVA 1P4XA 3IWFA 3C2HA 4ENKA 1W0TA 3WHCA 1HBXG 2BY0A 5TGTA 1FP2A 3BT9A 4O5VA 1MNEA 1IDZA 2FNAA 1P7JA 1HDPA 1W7PD 4BDZA 1MGTA 3CJTB 3MWMA 1ZQ3P 1KQ9A 1U5TA 1XCVA 3BTLA 4UUVA 3K1MA 5F1JA 2QKMB 3S3MA 2FD5A 4YELA 5JLWA 1IG7A 3ZQFA 1Y0NA 3CO7C 5CQEA 4E6KG 3BR5A 4WXHA 5K1YA 5J40A 2D2WA 2Z9OA 5H6RA 3IUOA 3A02A 3M9AA 1R4NB 2XGXA 4QPQA 4DIQA 2XRNA 2XUBA 2IW5A 3WU2C 4A0XA 5B66C 2Z33A 3J81K 3K4NA 4DZPA 3EETA 1Z3YA 1EH7A 1Z77A 1Y1VJ 3HDDA 3LQRA 4N4OB 2RDPA 3V7RA 5HNFA 3CUQB 3RKYA 3OYDA 2WAFA 3C2GA 3H35A 2CW7A 2LK2A 1KYZA 3CF2A 1OLTA 3HKZN 1VQNI 1SVLA 3DBLB 4C2MJ 4XNFA 3F8MA 3FHZA 1QHHD 3LAJA 3BDDA 4BGDA 2VKVA 3TW7A 1YIJI 2CW0F 2EA4A 5JVGF 2FOWA 2MLKA 2R7VA 4CH7A 3ECHA 4D7NA 3IL2A 3HOUJ 1XN7A 2VJJA 3I59B 4B48A 1R1UA 3N97A 4LIVA 1GHCA 1UMQA 1HW1A 3RYRA 2B0LA 2E5ZA 1TQIA 4E7ZA 1PP7U 4HQMA 5LBQA 2L4MA 3CC7I 1YS6A 3WTXC 1X4OA 3T8RA 3I55I 5DEQA 2M3AA 2HPMA 2KIFA 5EDNA 1IW7F 2HS5A 1MBGA 1OYWA 1NG6A 4RBOA 4ZZDA 3NAUA 5M3FJ 2QBYA 2XC7A 4OMYA 3C1DA 1QZYA 2V9VA 3ELKA 2LRDA 3EPZA 1FX7A 1BW6A 2J5OA 2R7ZJ 4Q4ZF 5FD6A 2V4JC 5BOXA 1OCZH 5E3OA 1O3QA 2XSDC 1MMGA 4UVBA 4XKWA 3CMAI 1FOKA 2W84A 4ESFA 1Z9CA 3P9CA 2XGDA 5AIPA 5JHUA 1G8XA 1KU3A 3TEDA 2Z1DA 3BPXA 3R60A 5GAGJ 1DGRM 1FOXA 2XVCA 4IXAA 2JUGA 5C3EJ 2M0MA 2D45A 4KT5C 1PUEE 2PQ8A 3J81Z 1JUMA 4RAYA 1J2XA 2OCCH 1QA6A 2VJ4A 3HRMA 2VUMJ 4CA0A 1D8JA 1WJEA 1YJNI 3B73A 2BY1A 2ZJ2A 4M9XA 1SMTA 2EIJH 1QU3A 3HEFA 4BAYA 2ZXWH 4RGUA 5D4RA 1KONA 1X1PA 4CCLA 4HNTA 1AOYA 2MYSA 3G1OA 2V7FA 2WTEA 2HOTA 1JE8A 1D3YA 1N25A 2ZXJA 5B1AH 1BI3A 3I71A 3KZIC 1JKPC 4IOAF 4XR6A 1LDKB 5FKMA 2KPMA 3X2QH 3OS0A 3GTGJ 3RTRA 2DBBA 4HEA2 3A01A 1BL0A 4UY8I 3WTZA 1Y8RB 5HLGA 4QIWN 1ZARA 1JUSA 3QYEA 3TO7A 3IP4B 3ABMH 3JRFA 1QVTA 2IAIA 1FIPA 4N4NB 2CW8A 1BOAA 3TO9A 2YX7A 1RKWA 4JX4A 1O57A 1WH7A 4A12A 4A0YA 4XRMA 1XMAA 1TQPA 2A5WA 1MJBA 3HOWJ 2DFEA 3WU1B 3L7WA 1I50J 2HTSA 4A3DJ 2O8XA 3GWZA 3HL2A 3DU6A 2DAOA 3LSJA 2PX9A 1UZCA 3V42A 3E1SA 2QUFA 2VBXA 3M3YJ 2LY9A 4RLQA 4MEYF 3J7YJ 2KLOA 2F5EA 2DK5A 4G7OF 3BG7A 3Q5FA 2F48A 3V8JA 2BXZA 2BHZA 2MC3A 1H88C 4A3LJ 3DTKA 3PFYA 3ROUA 4JX6A 2DA3A 1WJAA 2VQLA 4F3QA 1EA3A 3GMEA 2OAZA 4OU0A 4WWCA 2R4GA 1A36A 3CTAA 3I5UA 1NHAA 1DDNA 2ID6A 3PNVA 1R7JA 4IF4A 1SANA 1XCBA 1LVKA 4IJAA 3FMQA 1KU2A 2F4OB 3DPUA 3G4SI 1B9MA 4BJ6C 1I1GA 3JR9A 2I5UA 2L01A 3FX3A 3RSNA 4AM3A 1OJLA 4CUGA 3TW6A 4EJVA 2DFIA 5L3BA 5LEKA 5FKOA 5FRNA 4LD5A 3RQIA 2WADA 5LHGA 2DDAA 1LFBA 1JI8A 1V5GA 1ETVA 4AC0A 4CDGA 2TRTA 4PFOA 3DLAA 2VONA 1G3TA 4Y33A 3VYSB 1WI9A 4L9VA 1K7AA 1MIJA 1N75A 1R71A 4II2A 1B6AA 2NXNB 1ZK8A 1IXSB 2HDWA 2NS8A 3H92A 5IYDJ 3KZZA 2ESHA 4OWRB 2KT0A 1EH6A 1HC8A 4KIFA 2ZXIA 2J5PA 1MMSA 4NHJA 2IRFG 3OIPA 3G6EI 1A5JA 3FXOA 4ZJZA 4MHGA 4IX7A 4UVAA 1USTA 5D5VB 2XAJA 2EPFA 2G9WA 2HR3A 2A6HF 3KEYA 1ZRDA 1ZLJA 2MC4A 3H3ZA 2FRHA 3WODF 3WU0A 1ZAOA 4NNJA 2IJLA 3S16J 4DGWB 3GZ5A 5LHIA 3E6CC 2QM3A 4KDPA 2W48A 4HA8A 3OMYA 1D0ZA 3PQKA 4I01A 3GTLJ 4XLPF 2HQNA 2BBYA 4B1RA 1ULYA 1SD7A 1SVMA 3KP5A 2FSWA 2RNJA 3MZHA 5DM7F 1MDMB 1KU9A 1M1EB 4CYCA 2IXSA 2K9SA 3A0BC 4LLGF 5D5UB 5EYRA 4V2FA 2VKEA 1RUNA 3G1LA 2NVYJ 1I6XA 2CUJA 1MJ9A 1JGGA 2HOEA 5C4XJ 1YX3A 3S32A 2FUG2 2E19A 3ASOH 4L0YB 3Q3SA 4LJZF 1LFPA 2O0YA 3FMRA 4EGZA 1P92A 1Y6IA 2RVCA 2IA1A 3G73A 1MD0A 4MO7A 2DA5A 2E60A 2EV5A 1WPKA 4CZCA 2K85A 1AKHB 4AVPA 5IP6A 3HGYA 3J7ZI 3OYAA 1QZZA 4DYCA 1DPRA 3PQJA 3U21A 4UV8A 1Q1VA 3A4CA 3R61A 4HLXA 3ASNH 3OIOA 4G8XA 3BZCA 4ANJA 3K4LA 4JBAA 2DOAA 3A03A 1F1ZA 3OYKA 1U3EM 2LD5A 3ERED 2GA1A 3PJRA 3RJPA 2EV0A 2KISA 2JVGA 3TP0A 3FBIB 3QPLA 4RB2C 3K10A 3H9JA 1FT9A 4WCGA
chains in the Genus database with same CATH topology
2VKDA 4BE2A 3OYBA 3ONQA 2VQGA 2GOMA 4PJNA 2XSJC 4ZDPA 2LC2A 3D5LA 4ZYAA 1PYVA 3K4BA 4R79A 2R7UA 3LSKA 4AYBA 4BQQA 4Y4RA 3SEQA 4BUPA 2X51A 2BOLA 3LMMA 4PUSA 4DBQA 5KHDA 1QHGA 3LSHA 4U87A 2PJRA 3CP2A 1DP3A 3CJQB 3K6GA 5HLTA 2HVSA 2IS2A 1MMDA 3OYCA 4YRVA 5HOOA 1WJFA 3FHNA 2R7WA 5JHFA 2XF5A 4JQFA 4YEJA 4D1QA 2V1NA 1YE9A 2WAQA 3OR2C 4D9JA 5LD2C 2L9SA 1DGWY 3NWSA 2CH0A 2DJIA 3OYMA 3D5SC 2ZXHA 1YX5A 3F9KA 3HC7A 3S93A 4E7HA 3VDXA 2L7KA 2VASA 1SFKA 4NUBA 3S8PA 4IKFA 2Z16A 1UG0A 3DTEA 4CCJA 4F92B 3KX2A 4PSWA 2UV1A 2A6TA 2K9MA 4BACA 2X6YA 2KP6A 4PJLA 4RLFA 4XLAA 4X0GA 2CV1A 3HG9A 4XLCA 4XKBA 2MABA 2BVLA 2X6XA 3OS2A 2KQRA 4XKCA 3A1YA 5FROA 2VIXA 1W36C 1UELB 2V26A 3ZCOA 2RQQA 2X1EA 4XLHA 2X85A 4BJ5C 1MMAA 2W82A 3OR1C 1MNDA 1X1BA 3H9QA 2QKLB 4B47A 4PJMA 1GLNA 3LSMA 4G6TB 3TBIA 4BEHA 5FRMA 3VYTB 2GOXB 4HSTA 4CCMA 3N05A 2CS3A 4HSRA 3H0DA 4XN0A 4XKVA 4NQWB 3AL0B 4II3A 3QYBA 3VYRB 1E0EA 1X1CA 3PL8A 2WB1A 3LL7A 3PSFA 1DQUA 4P1WA 2W4SA 4J00A 1WJCA 5CPRB 2AQEA 2LY1A 2F6CA 4EATA 2DXIA 3D5RC 2PJRB 1BR1A 2HPIA 4CSWA 3DU5A 3OY9A 2JSPA 2Z2SB 2ZFUA 5HNHA 3ZGKA 2XDVA 1N78A 3C2HA 1Z21A 4B3XA 3E0JB 4XQFA 3LFUA 5TGTA 2CMPA 1WJDA 2RNGA 3OYNA 1MNEA 2X1DA 4IQJA 3DTIA 2V9KA 4BDZA 3NWTA 2MD0A 1K6YA 3SDBA 1P9QC 4BQOA 2VB6A 1X1DA 3SEZA 4DOZA 4ZTJA 1BR4A 3OYIA 4E7IA 2QKMB 3S3MA 2F4IA 3HUGB 4YELA 3OIQA 4LITA 2JVHA 2VJIA 5CQEA 4XOTA 5HVQC 4XONA 2JA2A 4E6KG 4DJAA 4RMNA 2XAUA 3IUOA 1X1AA 3CMMA 4QPQA 4DIQA 3KYLA 2VXZA 2KDOA 3GBGA 1MW7A 2HZDA 2O5RA 3OYEA 1LKXA 2K9LA 3ZQQA 4KITB 3SYTA 3K4NA 1Z3YA 4BEHB 1V5EA 2OC6A 1D0YA 3L2QA 1PJRA 3QYFA 4N4OB 3CZ6A 5KNLA 5HNFA 3OYFA 3HPGA 3OYDA 4KT6A 2WAFA 3C2GA 3A2KA 4ITVA 3H35A 2CW7A 3VSKA 3LSGA 1ERDA 2KHMA 3CF2A 1HA8A 1OLTA 4BE0A 2CUZA 3MKYB 4FETA 3VSLA 4XNFA 3BCBA 4U7BA 1QHHD 3IAS2 3MKWB 3EUAA 4BS9A 4F55A 1FMVA 4BGDA 3ZR8X 4XM3A 2XF6A 3OS1A 2R7VA 3CP8A 4CH7A 3VYUB 2VJJA 4B48A 1UAAA 4KISA 2VQHA 4IZZA 4LIVA 1BOBA 1T0FC 4E7ZA 2E5ZA 3OYGA 1X4PA 3QODA 4BE1A 1X19A 4BQNA 3HOTA 1V5FA 2UUZA 4C9YA 1X4OA 2M3AA 3MMYB 4XN3A 2HPMA 3S3NA 3ZRGA 4C30A 2CFOA 1NG6A 3OWTA 3I9V2 2XC7A 2R7SA 3EPZA 2LRDA 3LSIA 2VXDA 3RCOA 4E7KA 3DKYA 3W2AA 2V4JC 4F52A 3W3CA 3MKZA 1MMGA 4XKWA 4AVZA 2BW3A 1G8XA 2Z1DA 3HXLA 1DGRM 1S9HA 2LOOA 3H5AA 2JUGA 2M0MA 3S3OA 4LIUA 2R7RA 4BDYA 3DEEA 2VJ4A 4C2TA 4PFPA 4CA0A 3OYLA 4XORA 4BXFA 2CV2A 1WJEA 1R6RA 3RQ4A 3L2UA 2WA0A 1TT0A 3K70C 1D1AA 1QU3A 4HNUA 1KONA 4CCLA 4HNTA 2XF7A 3OYJA 3HKZA 2MYSA 2NOJB 2Q1ZB 2V7FA 2P0WA 3AL0C 4JOMA 2X1CA 1Z3XA 4XR6A 3QOEA 1LDKB 3OS0A 2KPMA 2IGMA 1VZ0A 3RTRA 3UNGC 3K70D 3AKZA 4HEA2 4RM3A 3IAM2 2W7NA 2E5NA 1G59A 4ZDOA 4XMYA 3QYEA 3IP4B 4E7LA 4N4NB 2CW8A 3K4CA 3EUHC 2ZSIB 3FBNB 3RPUD 3L2WA 4XLFA 2LH9A 4MLOA 1OR7C 1WJ5A 2Y0SA 4RM2A 2A5WA 2L9NA 2KZVA 3DQVC 1IRXA 2M4KA 3M1CA 3HL2A 4GRIA 3DU6A 2V6EA 2ELJA 2LY2A 2F5VA 3V42A 3E1SA 3OL3A 1TZLA 3TMOA 2HVRA 4ZC3A 2WBMA 2HU9A 4RLQA 2BW3B 3M8JA 2KLOA 2M7BA 3BG7A 3PUBA 3TL4X 1Y56A 4OAYA 2E1MC 2R7TA 3DTKA 1WJBA 3PFYA 3HPHA 4QPOA 1WJAA 2VQLA 4F3QA 1EA3A 4ZDLA 1D1CA 2R4GA 3PSIA 2DT6A 4HRIA 1Z7LA 2M4GA 3FKJA 2AQFA 3PNVA 4BJTA 1WFXA 3K4MA 1LVKA 2IS6A 2KRHA 3DPUA 2IGKA 4BJ6C 3H9GA 2HVQA 1MMNA 4AU7A 3RSNA 2LBFA 1ZELA 4CUGA 3H5NA 3MD2A 3OYHA 2PMZA 3H9JA 3CESA 5FRNA 4PK4A 4P5OA 2IGNA 2WADA 4XL9A 1D0XA 2ZSHB 1V5GA 5CKTA 1JI8A 4KJZA 2K5CA 2K3PA 4BU2A 4PFOA 3DLAA 2KMUA 4E4HA 2W00A 3PNYA 4Y33A 3VYSB 2R7QA 1NG7A 1U0JA 3ZXSA 1N75A 2HNHA 3W2WA 4PSXA 4ZTFA 3PNTA 2R7XA 4II2A 3OL4A 1J09A 2I8DA 1FMWA 2HDWA 4OWRB 4DBRA 2ZXIA 2MFZA 4Y3OA 1BR2A 4J01A 2M7AA 4E7JA 3OIPA 3HOSA 2UWMA 4B43A 4ZJZA 3L2VA 5KCMA 2WY7Q 2VL8A 3BLYA 4IX7A 2WAEA 2KL4A 2VJ5A 5LFAA 2IGOA 3KEYA 4CCKA 2MC4A 3I3LA 2X6WA 3UR3C 4NNJA 4DGWB 4PJJA 1T95A 3W2VA 4NC7A 3OMYA 1D1BA 1D0ZA 4HPQA 2WY8Q 2Q2EB 4H4KC 2OV7A 4BL0B 4CCOA 1W36D 3FDYA 3EUKL 4HG2A 1AA7A 4NC8A 3BC8A 2DCEA 2L2OA 3DPLC 2IS1A 3VWBA 3DPTA 2IXSA 2LYCA 5CQGA 1SAUA 2BVMA 2VLAA 2LBFB 2LG4A 3CJRB 4B44A 2LREA 2CUJA 3OOUA 4LG3A 1YX3A 3S32A 2FUG2 1LFPA 3DKXA 2W1OA 1Y6IA 1N77A 3K4KA 3DWLE 4CCNA 2E60A 4FASD 2VKHA 2CV0A 4CZCA 2IS4A 2HQAA 3BCAA 3BG6A 2RREA 3OYAA 3AFHA 4IQ4A 2R7OA 3U21A 3J7AY 2VPLA 3A4CA 3G2BA 3SZGA 4XLEA 2DT7B 4ANJA 3K4LA 2DOAA 4XOPA 3H5RA 3OYKA 4OAZA 2VQCA 4C2UA 2KRCA 2L5QA 4F93B 3PJRA 3L2RA 2JVGA 2E1MB 4F91B 3FBIB 4E7SA 3K4JA 3K10A 2OUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7K A; 
#chains in the Genus database with same CATH topology
 1VF9 A;  1XDS A;  2RGV A;  2H8W A;  1P6R A;  4DYQ A;  4NQW A;  2DMP A;  1H89 C;  3JCU C;  3K4B A;  2Z99 A;  2R7U A;  3SEQ A;  1WQ2 A;  5M5X J;  4DBQ A;  2NVX J;  4Y15 A;  3WE3 A;  2XKP A;  2HXO A;  1ZHF A;  3ABT A;  2F2E A;  5M3M J;  3CP2 A;  1ZG3 A;  3CJQ B;  1PUF B;  5HLI A;  4L9J A;  4GYG A;  5EGO B;  4JQF A;  4M72 A;  1VND A;  4D1Q A;  2K4B A;  2V1N A;  1YE9 A;  4D9J A;  1KQ8 A;  2L9S A;  5C44 J;  1XPX A;  1DGW Y;  2EIK H;  2XB0 X;  3U2R A;  4LLL A;  2ELK A;  3IRR A;  1TTY A;  4A3E J;  3F9K A;  3S93 A;  4E7H A;  4A5M A;  5C4J J;  2M30 A;  2VAS A;  1SFK A;  4FTH A;  4M3F A;  1YO5 C;  4IKF A;  4HX4 A;  2Y30 A;  3RKQ A;  1XX5 A;  1LE8 B;  1IAW A;  2Z16 A;  5IP7 J;  3GO5 A;  3KX2 A;  3ISP A;  5F0F A;  2UZK A;  4NBQ A;  2UV1 A;  2FA5 A;  1U9O A;  2EFQ A;  4A3C J;  4XLA A;  3HG9 A;  4XKB A;  2MAB A;  1FJL A;  3OSG A;  4U88 A;  2BY3 A;  1B4A A;  1O7L A;  2KQR A;  3BZ6 A;  4XKC A;  4M74 A;  5FRO A;  3QAH A;  3JRI A;  3ZCO A;  2BEO A;  1WVR A;  4PDK A;  1MMA A;  1XD7 A;  1MND A;  4Z6Y A;  2EIN H;  1ENH A;  2CQK A;  4I7H A;  4RB1 A;  3WG9 A;  2DT5 A;  2ECB A;  4AID A;  1G4D A;  5FRM A;  2K3F A;  4MGR A;  2BV6 A;  4CCM A;  3FKI J;  4L9T A;  3CUQ A;  5EEH A;  2CS3 A;  2MLG A;  3HZJ A;  3LSR A;  1R58 A;  2NYX A;  2OTL I;  3H0D A;  4A3F J;  2C6Y A;  4P96 A;  5ED4 A;  3L2C A;  2M8G X;  1W0U A;  2BY2 A;  1X1C A;  1I6H J;  3VPR A;  4RDU A;  2JA8 J;  3PSF A;  3FXL A;  4P1W A;  3BQZ A;  3LA2 A;  3CCQ I;  3GFM A;  4J00 A;  4FX4 A;  1WJC A;  3FIW A;  5F0C A;  4U0V A;  2AQE A;  5CPR B;  4IHY A;  4EAT A;  3D5R C;  3LWF A;  3WTU C;  3I59 A;  5F64 A;  4CSW A;  4CZZ A;  2HQR A;  1YHQ I;  2KRF A;  3DBR B;  2ZFU A;  1N78 A;  3CCJ I;  1GUU A;  1Z21 A;  5HS7 A;  4I2O A;  2ICW G;  1SD5 A;  3BTC A;  4XQF A;  1PP8 F;  1GVJ A;  3JRA A;  2CG4 A;  3RIR A;  1WJD A;  3JRG A;  2X1D A;  1VQP I;  5CJ9 A;  2M0C A;  1W5S A;  1ZR4 A;  2YS9 A;  5LEJ A;  1K6Y A;  3E5X A;  3SDB A;  1P9Q C;  1SFE A;  4BQO A;  3SEZ A;  2R5Z B;  4S0H B;  4E7I A;  1O3T A;  5LGU A;  4LIT A;  2JVH A;  2PN6 A;  2CFX A;  2MSY A;  5LGN A;  1S72 I;  1A35 A;  3GTK J;  4PJ0 C;  2PFB A;  5J6X A;  4RMN A;  4A3I J;  2XAU A;  4M3B A;  9ANT A;  1X1A A;  2NAZ A;  3CMM A;  2L0K A;  2JUC A;  2ELH A;  4WXD A;  1XTA A;  3GTJ J;  3GBG A;  2O61 A;  1RET A;  1MW7 A;  2EFN A;  4HF0 A;  2A5Y B;  2HZD A;  3OYE A;  2QA4 I;  3KET A;  2H27 A;  4W1U A;  1SAX A;  5D5W B;  4UV9 A;  1ZGW A;  1FTT A;  5GP9 A;  1JHF A;  3HRT A;  2QEN A;  1X58 A;  2HFH A;  3HPG A;  5ICF A;  3A2K A;  2G0E A;  2ME0 A;  4ITV A;  1TNT A;  4YIF A;  1ERD A;  2OF7 A;  5KVR A;  1T6S A;  2CUZ A;  3CO6 C;  2W24 A;  4FET A;  4V2G A;  3T1B A;  3VFZ A;  1A31 A;  5J8F A;  3IAS 2;  2JJ7 A;  2MGQ A;  3MKW B;  4EMS A;  4BS9 A;  4F55 A;  4IO9 F;  4LK0 F;  3ZR8 X;  3ZN1 A;  1HDD C;  4EQQ A;  2E7W A;  1SD4 A;  4RAG A;  2XPV A;  5E8I A;  4D0P A;  1UAA A;  5K5Q A;  1S6L A;  2H1L A;  2UXN A;  1BOB A;  1B59 A;  1TWH J;  4A6E A;  4Y7N J;  5E8G A;  5BS6 A;  1X4P A;  2EFP A;  3QOD A;  2HQ5 A;  1T8I A;  5F08 A;  4BQN A;  2ACJ A;  1BBY A;  3KP6 A;  2G7H A;  2UUZ A;  2MG4 A;  2NS7 A;  5AIQ A;  4ENJ A;  2LF8 A;  3JRC A;  1W1W E;  2I10 A;  3ZRG A;  1L0O C;  4C30 A;  4D5F A;  3BR0 A;  4EJO A;  3CF5 F;  3F21 A;  3PFI A;  2EIL H;  1IN6 A;  2OJE D;  1U9N A;  2B63 J;  2PEX A;  1FYK A;  2VT3 A;  1REP C;  2XKO A;  2P7V B;  5GTH C;  2ISZ A;  1IRG A;  1FEX A;  5FLX K;  1O3R A;  1FYL A;  3G71 I;  3CUO A;  4BHC A;  2QSG X;  2VI6 A;  4EVI A;  1D5Y A;  4ENN A;  5IYC J;  2BYV E;  2ZCW A;  1Y39 A;  3V8K A;  4XRF A;  1ZN2 A;  4ON0 A;  5HDK A;  2DU9 A;  3ZPL A;  3DEE A;  2GWR A;  3LAP A;  4PFP A;  3TOA A;  2GM4 A;  2M34 A;  3B6A A;  1UHS A;  5J1R A;  3HHH A;  2DO7 A;  2P5V A;  5M5W J;  2IPQ X;  4HF2 A;  3L2U A;  2WA0 A;  1TT0 A;  4KIG A;  1D1A A;  4BH9 A;  3ZMD A;  4N9H A;  4PCQ A;  4IOC F;  1U8B A;  1XDU A;  3HKZ A;  2DJN A;  5FKN A;  1LUJ B;  1LB2 A;  3PIO F;  3AL0 C;  2Q8K A;  1KZH A;  1Z0X A;  3JRD A;  1VZ0 A;  2NNN A;  2OPT A;  3QWL A;  3UNG C;  4RM3 A;  3AKZ A;  3ZN0 A;  3IAM 2;  1QO0 D;  3FF5 A;  4Q48 A;  2WAQ N;  2EQR A;  4ZDO A;  3ZQ7 A;  4XMY A;  2ZJQ F;  2JPB A;  2FMY A;  2O9L A;  2L7Z A;  1FOW A;  3R0J A;  3RPU D;  1VQO I;  1AHD P;  1H8A C;  3GZ6 A;  2FE3 A;  3SFI A;  3RYP A;  1RRJ A;  2QEX I;  2Y0S A;  3DQV C;  3FXQ A;  1K4T A;  2VBW A;  5IY5 H;  2Y9Y A;  5D6F A;  3M7G A;  2M4K A;  3M1C A;  3ZP5 A;  4GRI A;  4R1H A;  5CYV A;  2JA6 J;  3CD6 I;  1YQA A;  1ZR2 A;  3SDG A;  1STZ A;  2R0Q C;  2Y9Z A;  3CC4 I;  2DYS H;  3OL3 A;  4BY7 J;  5DM6 F;  3S1Q J;  4ZC3 A;  5FLX Z;  3VOD A;  4OIQ F;  2VBZ A;  1DU6 A;  1A04 A;  5J1Y A;  2HU9 A;  1XS9 A;  3E7L A;  3H3V K;  2F5D A;  3S2W A;  5EG0 B;  1Y56 A;  4S05 A;  1XGO A;  3G1M A;  3I64 A;  2Y48 A;  4OAY A;  2R7T A;  3HPH A;  4QPO A;  4IRH A;  4O3M A;  2RKH A;  1D1C A;  1R1T A;  5B3S H;  3PSI A;  3ZMZ A;  4XRS G;  3KEQ A;  3ECO A;  4KFC A;  2X9D A;  2AQF A;  2DA4 A;  1BI0 A;  2JTV A;  3H0G J;  2L3D A;  2JN6 A;  1MDM A;  2WB1 N;  1ONV A;  1S3J A;  4FT8 A;  2LVS A;  5IPA A;  4HZF A;  2KJB A;  3F3X A;  1FIA A;  4Q47 A;  1ZEL A;  1VQ5 I;  1T98 A;  4NB5 A;  4PZJ A;  3MD2 A;  3AG2 H;  5L3D A;  1GV5 A;  2PMZ A;  2JA7 J;  5CLS A;  2D1H A;  4ZYD A;  3LA7 A;  1H9G A;  2R7D A;  4XL9 A;  3MN2 A;  2AO9 A;  4BU2 A;  2F5F A;  1FBS A;  4D5C A;  2NNY A;  5DD8 A;  3PNY A;  1G3Y A;  3FXM A;  2F5C A;  3WGH A;  1AKH A;  4KIC A;  2HYG D;  5CVV A;  3K7A J;  1DUX C;  3CLO A;  1HKT A;  2EZL A;  1Z6R A;  2I8D A;  1RR8 C;  1FMW A;  4C3I J;  3ZMU A;  1IUY A;  1IUF A;  1R4M B;  2K9Q A;  4ENM A;  1FY7 A;  3JTG A;  3JRH A;  4DBR A;  4UNO A;  1RKT A;  4Y3O A;  3C7J A;  3FXJ A;  2M7A A;  2HYF A;  2DMU A;  4AD9 A;  3HOS A;  2DMQ A;  4E7J A;  2UWM A;  5CVJ A;  2WY7 Q;  1VTN C;  3BLY A;  1HKQ A;  2JRM A;  2WAE A;  3E5Q A;  2IGO A;  2QWW A;  3HJE A;  3I56 I;  1OMI A;  3GVA A;  4CCK A;  2DW4 A;  4B09 A;  4GDF A;  1P2F A;  3ERM A;  1T95 A;  4IPA A;  4M9Z A;  3ZMV A;  2HWV A;  1IZ1 A;  3GXO A;  4NC7 A;  4RB0 A;  2V1U A;  2M8E A;  1BN5 A;  4I6Z A;  1LFU P;  4Q5S F;  1FSH A;  2LF7 A;  3WTW C;  1S29 A;  1QNT A;  2BHY A;  4CCO A;  3DKW A;  3BZK A;  3EUK L;  1WRJ A;  5EEG A;  1HOM A;  1WWX A;  2CSO A;  2E1N A;  1APL C;  2L2O A;  4A3B J;  2ECC A;  2DI3 A;  2QF7 A;  1PUF A;  1X2M A;  2ISY A;  5EGO A;  3AG1 H;  2LYC A;  1Z7U A;  2YR2 A;  1TC3 C;  1SAU A;  4DYR A;  4HQE A;  4GFB A;  3ABU A;  3L09 A;  3CQZ J;  2BVM A;  2VLA A;  2LBF B;  1JT0 A;  2LG4 A;  4B44 A;  2GXG A;  1HLV A;  2LRE A;  1IN5 A;  2OCE A;  5J4V A;  4LG3 A;  4C3H J;  2EIM H;  3HB9 A;  4UUS B;  2A3S A;  4IVN A;  3SZP A;  4L5E A;  5FB2 A;  3DWL E;  5HS9 A;  4FAS D;  1WI3 A;  2VKH A;  2A07 F;  4UHT A;  1LE8 A;  2E2J J;  4AUX A;  3F23 A;  4HLY A;  2H09 A;  3BG6 A;  2ZB9 A;  1LEB A;  4QSH A;  2VPR A;  4GGG A;  4I99 C;  3RZO J;  2OD5 A;  4XLE A;  4YIR X;  2DT7 B;  2GBY A;  5K5R A;  3B02 A;  5TRD A;  2DA1 A;  2V1X A;  3HM5 A;  4IHV A;  2VQC A;  1TWG J;  3GLX A;  2E35 A;  2KRC A;  1I3A A;  4MIM A;  2DN0 A;  1IV8 A;  4B3A A;  1XB4 A;  3ZQH A;  2CUF A;  2E1M B;  5D6E A;  3S15 J;  3WTS C;  1BIB A;  1KA8 A;  2JA5 J;  4A69 C;  2VKD A;  4LFU A;  4BE2 A;  2JPC A;  2K7L A;  2ID3 A;  5FD5 A;  1SFX A;  1UFM A;  2VQG A;  4A3J J;  3TGN A;  2GA2 A;  1TQM A;  1I1S A;  2LC2 A;  2XV4 S;  3WGI A;  3D5L A;  3UKG A;  1PYV A;  3K2Z A;  1YW8 A;  4L5I A;  3RPU A;  4AYB A;  4AIJ A;  4BQQ A;  4Y4R A;  4M3D A;  1TP4 A;  3FWE A;  5B1B H;  2FBK A;  3QOP A;  4BUP A;  3LMM A;  5KHD A;  4HDU A;  4KMF A;  1IGN A;  1DP7 P;  1F36 A;  4U87 A;  3LST A;  1XGM A;  2XB5 A;  2CUE A;  5E79 C;  4MTE A;  4KUM A;  5HLT A;  3OYC A;  5L3F A;  5K7H A;  1TWA J;  1G6N A;  1OYI A;  1E3O C;  5E1W A;  2DPD A;  2GXA A;  2STW A;  1XG1 A;  2L9R A;  3K1N A;  2V6C A;  2FNP A;  4JP0 A;  3NWS A;  2CH0 A;  5ICG A;  1YJW I;  2KFD A;  3M8E A;  1RNL A;  5CVR A;  2DJI A;  3D5S C;  1SVO A;  1YX5 A;  2W25 A;  2XPU A;  3JRE A;  3QRF F;  1U6G A;  1ZRC A;  3VDX A;  2R5Z A;  2L7K A;  1J7K A;  3F8B A;  4NUB A;  5J3L A;  4G7Z F;  5LRR A;  1FTZ A;  3GZN B;  1UG0 A;  4F92 B;  1K4S A;  3IC7 A;  3BTJ A;  2A69 F;  4RGR A;  5J4Y A;  5D8L B;  4XBF A;  2CV1 A;  2K27 A;  4HV5 A;  2BVL A;  2P5L C;  4ZYH A;  2EB7 A;  3KYD B;  2COM A;  4LMY A;  4OMZ A;  2YU3 A;  3KFW X;  4M73 A;  1USS A;  1V3F A;  1WKM A;  2X1E A;  4XLH A;  4IHX A;  2YPR A;  1QPM A;  4EEF G;  3VB2 A;  1X1B A;  2HOA A;  2QKL B;  4HX8 A;  3R0A A;  1Y8Q B;  3K0L A;  3C3W A;  3GUD A;  3L1P A;  1ZG5 A;  4HST A;  3KP4 A;  5E3L A;  2L4A A;  4PGH A;  4XKV A;  2OU2 A;  4FHT A;  3FIS A;  4U7D A;  3AL0 B;  2LR8 A;  4II3 A;  1QRY A;  3QYB A;  3VYR B;  3ESW B;  1E0E A;  2W57 A;  3PL8 A;  5HDN A;  2IEK A;  2DMN A;  4BNC A;  1K79 A;  1BC7 C;  1G3W A;  1GVD A;  2MW8 A;  3GEZ A;  4ASN A;  4QTR A;  1H9T A;  2DXI A;  2LKX A;  2PJR B;  5FO5 A;  2YUS A;  1BR1 A;  5A2Q K;  3GTO J;  2QVO A;  2Z2S B;  3ZGK A;  1RES A;  3E0J B;  5CVU A;  3LFU A;  4WX9 A;  2CMP A;  2RQP A;  1S7A A;  2VC0 A;  4MFD A;  1SFU A;  2AHQ A;  2RNG A;  4IQJ A;  2HOS A;  3DF8 A;  3DTI A;  1UB9 A;  4G12 A;  4HYE A;  2Y31 A;  3PIP F;  2MD0 A;  2XAQ A;  2LTP A;  4A93 J;  2O3F A;  1IN4 A;  1X1D A;  2VB6 A;  5GAH J;  4ZTJ A;  3LNQ A;  2BXY A;  3TP3 A;  3OIQ A;  1ZTR A;  4XIC A;  2NOG A;  3HTS B;  2VJI A;  2LDU A;  5HVQ C;  4XON A;  1L3L A;  4MQV A;  3KYC B;  4DJA A;  5K7F A;  1LPQ A;  1KYW A;  3IWZ A;  2L54 A;  1F9N A;  3O3K A;  1FYM A;  2VOP A;  2P4W A;  2DQL A;  1YOV B;  1KGS A;  1A6Q A;  3RKW A;  2KIM A;  2KDO A;  2P6S A;  2DK8 A;  2XIG A;  5KAI C;  3NAR A;  4BY1 J;  5DYM A;  3GTP J;  3E6M A;  4CGZ A;  2K9L A;  4BXU A;  2OTJ I;  2MA3 A;  3ZQQ A;  3KEO A;  3CCY A;  2D1V A;  1MJA A;  4BEH B;  2OC6 A;  3QU6 A;  1FZP B;  1PJR A;  3QYF A;  5KNL A;  4HW0 A;  2ZBK A;  4DQ2 A;  3OYF A;  2FEZ A;  2WV0 A;  2TDX A;  4KT6 A;  2PJP A;  5D4S A;  4BE0 A;  1UHM A;  2CO5 A;  3PUF A;  3VSL A;  3BCB A;  3T0Y A;  3U9G A;  2XGE A;  1R5H A;  2ZKZ A;  1U8R A;  5JI6 A;  4P55 A;  4XM3 A;  2XF6 A;  3OS1 A;  3CP8 A;  3CDH A;  3Q0W A;  5A2Q Z;  1ZKG A;  2EZK A;  4EM2 A;  3VYU B;  4KIS A;  2DDB A;  4IZZ A;  5HOD A;  5DS9 A;  1T0F C;  3GYH X;  4YII A;  1VQ8 I;  5FGM A;  3OYG A;  1YG2 A;  1B9N A;  2A05 A;  2OA4 A;  1X19 A;  3KCC A;  5BPD A;  3HYI A;  1SD6 A;  2E7X A;  2KIU A;  3CDI A;  5E18 F;  3F8C A;  3RI4 A;  3MMY B;  4XN3 A;  1K6O A;  2M45 A;  1YIO A;  3JAM K;  3S2H J;  5D8K B;  1IDY A;  4GO1 A;  2V1D A;  4TV7 A;  2R7S A;  1X3W B;  2FF4 A;  3JTH A;  3T8T A;  2DLL A;  3AG4 H;  2EH3 A;  4B8X A;  1YTY A;  1DPU A;  3W2A A;  4BBS J;  4F52 A;  4AVZ A;  1K78 B;  4P9F A;  1RIO H;  4FQG A;  3TQN A;  3S14 J;  5EG0 A;  3ZQC A;  2A61 A;  1S9H A;  2LOO A;  2P8T A;  3ABL H;  3H5A A;  1ACI A;  4CIC A;  3S3O A;  4LIU A;  2DA2 A;  4JK1 X;  2R7R A;  3ZMS A;  4YFN F;  1WHU A;  4C2T A;  4OIR F;  2CWE A;  1FP1 D;  3E3V A;  2JMW A;  2HTJ A;  3BRO A;  4I76 A;  1R6R A;  2VOD A;  3TO6 A;  3RQ4 A;  1B72 B;  4L5J A;  4ZH4 F;  2HDC A;  2O03 A;  3K70 C;  4HNU A;  1KQ0 A;  4RB3 C;  2DOE A;  4M6X A;  3U1K A;  2F4M B;  3OYJ A;  2M5W A;  1HW5 A;  2NOJ B;  2Q1Z B;  4IRG A;  1T0F A;  2UXX A;  1W7P B;  1P4A A;  3P7N A;  5E17 F;  1Z3X A;  4OOI A;  2P6T A;  3QOE A;  1QZE A;  2DTZ A;  2IGM A;  5KK1 A;  2FX0 A;  5IT3 A;  5DUK A;  3W6J B;  1SEU A;  5H6Q A;  4S04 A;  4FE4 A;  2E5N A;  2W7N A;  3JRB A;  1G59 A;  1HF0 A;  1OFC X;  3FK7 A;  4JYK A;  4E7L A;  1MSE C;  1FNN A;  3K4C A;  4DZJ A;  2YU9 J;  3EUH C;  1R1V A;  3FBN B;  3TKY A;  3L2W A;  4EJT A;  4MLO A;  5GAE J;  1R49 A;  1OR7 C;  1ZG1 A;  2B9S A;  3N4M A;  5F04 A;  1X3U A;  4FCY A;  3JAM Z;  3HTU A;  1IRX A;  4MFE A;  3Q9V A;  5EF6 A;  2V6E A;  2ELJ A;  2LY2 A;  2F5V A;  1JKR C;  1TZL A;  4HNV A;  3TMO A;  4LB5 A;  1ETX A;  2WBM A;  4AIK A;  1A6I A;  2MD5 A;  3MKL A;  2BW3 B;  3M8J A;  2DMT A;  5IYB J;  5BNG A;  2H1K A;  3PUB A;  4X1E A;  5F0H A;  1DU0 A;  2E1M C;  3EQL F;  3BY6 A;  1SC7 A;  4BYY A;  2D5V A;  2CQ7 A;  2DT6 A;  4HRI A;  1Z7L A;  1T2K A;  3KP3 A;  3IV5 A;  1UG2 A;  3IH3 A;  2W85 A;  3K4M A;  4KN7 X;  1MBH A;  2IS6 A;  3B6C A;  1WZ2 A;  2KRH A;  2IGK A;  2YX4 A;  3SHF A;  2EK5 A;  3H9G A;  1E3P A;  1ITY A;  2OZU A;  4AU7 A;  1VQ7 I;  4ESJ A;  1I27 A;  2LBF A;  1B8I B;  1ETO A;  3H5N A;  2ZME B;  1WCM J;  3EUH A;  5E1Z B;  3OYH A;  5HLH A;  3CES A;  1MH4 A;  4PK4 A;  5LGT A;  1YS7 A;  4ETS A;  4P5O A;  2IGN A;  2O7O A;  4LGW A;  3DLL F;  1OR7 A;  4UUS A;  5CKT A;  4HX7 A;  2K3P A;  1BM9 A;  1JTX A;  2XAS A;  2JQ7 A;  4E4H A;  2W00 A;  1BJZ A;  2R7Q A;  1NG7 A;  3LOC A;  1U0J A;  3WTT C;  1HQC A;  4BHB A;  2M1B A;  4L9N A;  3K1P A;  4QWQ A;  3W2W A;  3S1R J;  3PNT A;  3RDI A;  3CDL A;  2QCO A;  3M8F A;  1J09 A;  3K69 A;  3FXK A;  1CGP A;  4GYI A;  1CF7 B;  3RPQ A;  4NC6 A;  2STT A;  2FOK A;  3V4G A;  2MFZ A;  3KP2 A;  3ZQG A;  1JXS A;  3H36 A;  3CC2 I;  1BIA A;  1LVA A;  2BZT A;  1TL8 A;  1Z67 A;  1Z1D A;  5KCM A;  2VL8 A;  3GFL A;  3H1C A;  4M6Y A;  5BPI A;  3I3L A;  2X6W A;  1POG A;  3BG9 A;  4WK8 F;  2E1C A;  1IN8 A;  1HST A;  3QP6 A;  3BP8 A;  1D1B A;  2HKX A;  4HPQ A;  1MBJ A;  2Q2E B;  3MZY A;  2X0L A;  2PBI A;  2OV7 A;  5E20 A;  1W36 D;  3ULQ B;  1F4K A;  3P9K A;  4YFX F;  3GX4 X;  5E3N A;  1HXD A;  3DEW A;  3BC8 A;  3DPL C;  2IS1 A;  2VE9 A;  1C0W A;  2ESN A;  4I0B A;  3C2B A;  5JFR A;  3SFZ A;  1WH5 A;  3P9I A;  2V9P A;  5D5X B;  3CJR B;  1IXC A;  3HIF A;  2R5Y B;  2LMD A;  3OOU A;  3FXR A;  3NRV A;  1E17 A;  5FJ8 J;  1VQ4 I;  1FBQ A;  1I5Z A;  2L7F P;  1S7E A;  5DV5 A;  1KU7 A;  3K4K A;  1LEA A;  1IF1 A;  4ESB A;  2IS4 A;  2DFH A;  1YI2 I;  1HSJ A;  1JJ6 C;  2HQA A;  3BCA A;  3ZMT A;  2N8G A;  2Y0M A;  3G3Z A;  4KIB A;  2IA0 A;  2R7O A;  3HBL A;  3J7A Y;  2VPL A;  3NEU A;  1K83 J;  1R23 A;  3SZG A;  4B4C A;  4XOP A;  3QP5 A;  3GW2 A;  4C2U A;  3MQ0 A;  4LLN A;  2QQ9 A;  3LFK A;  4FE7 A;  4CO8 A;  5FLM J;  1MH3 A;  1E2X A;  1XGS A;  3HOV J;  3WHB A;  3DFG A;  1LDJ A;  1VQ9 I;  3E6D A;  4F91 B;  4E7S A;  3K4J A;  3TL4 X;  2GAU A;  1D8K A;  2EV6 A;  2R3S A;  2K02 A;  3OYB A;  2JRT A;  2GOM A;  4ZDP A;  4J19 A;  4GXO A;  4L18 B;  3H3U A;  4R79 A;  5J8C A;  3CCM I;  3FM3 A;  1V4R A;  3IKT A;  3JW4 A;  1GDT A;  5FFZ A;  2ADU A;  2BOL A;  3TDU C;  3RZD J;  3ZQI A;  3CCV I;  2PJR A;  2H6B A;  5DCF A;  1GXQ A;  1MBE A;  2R93 J;  2IS2 A;  1MMD A;  3BJ6 A;  2R7W A;  3FHN A;  3M07 A;  1TWF J;  1EKE A;  1T38 A;  2XF5 A;  3P5J A;  2Y2Z A;  2XHK A;  4BBR J;  3D1N I;  3OR2 C;  2OQR A;  2RC4 A;  2X48 A;  5TJJ A;  4H0E A;  1XSD A;  4JX5 A;  1UCR A;  1J9I A;  3JSO A;  1IC8 A;  2OZ6 A;  3COA C;  2LFB A;  5GTI C;  1IO2 A;  3OYM A;  1OCP A;  2E34 A;  3WTY C;  3HC7 A;  5BMZ A;  5K7Z A;  1LNW A;  2O8K A;  3S8P A;  1ZH5 A;  1ON1 A;  1BW5 A;  2QSF X;  2Y0S N;  3DTE A;  3OV8 A;  4HV6 A;  4C3J J;  1FLI A;  2KDZ A;  2DQR A;  1ZGA A;  3MZ8 A;  2XPW A;  1JKQ C;  3HRU A;  4X0G A;  4AWX B;  2R7F A;  3T5X A;  2X6X A;  5FKL A;  3OS2 A;  3A1Y A;  3MVP A;  2LKP A;  2QYO A;  1JGS A;  1UEL B;  1W36 C;  2V26 A;  2EJR A;  4G94 A;  4KN4 X;  2X85 A;  3M1E A;  1YFH A;  5JLX A;  2W82 A;  3OR1 C;  2A68 F;  3H9Q A;  2EA2 A;  4PJM A;  1GLN A;  4MQ9 F;  3LSM A;  4G6T B;  3TBI A;  4WF2 A;  1TWC J;  4BEH A;  1J59 A;  4Y52 J;  3E97 A;  4DW6 A;  2DA6 A;  4I02 A;  5FKK A;  3BJA A;  3N05 A;  2P81 A;  1NK3 P;  1EJ9 A;  4HSR A;  2CQQ A;  5F6F A;  1MBK A;  3VOE A;  4V19 K;  1YRN B;  2AXL A;  1P7I A;  2DOD A;  4UB6 C;  2CU7 A;  1OCO H;  1BJA A;  2PMU A;  1HCR A;  4IEJ A;  4RAF A;  3CCR I;  1G2H A;  5K5O A;  3PM1 A;  3LL7 A;  1DQU A;  2Y69 H;  2LY1 A;  3MEX A;  1QPI A;  4IHW A;  2X6O A;  1ZGJ A;  3SJM A;  3EYY A;  2LNB A;  3DU5 A;  3OY9 A;  2JSP A;  5H20 A;  3DXJ F;  4O6J A;  5LRS A;  1ORK A;  5AON A;  2PMZ N;  4F7Z A;  3I53 A;  3OSF A;  4B3X A;  1D5V A;  4G7H F;  2QSH X;  1NK2 P;  3OYN A;  2MH2 A;  2CYY A;  4CXF A;  2Z3Y A;  1R00 A;  1U2W A;  2V9K A;  1WGX A;  1AWC A;  4U0Y A;  3NWT A;  3V8L A;  4YFK F;  1GT0 C;  1O3S A;  4LG0 B;  2CQX A;  1JT6 A;  1SFO J;  1QVU A;  3KLN A;  4DOZ A;  1BR4 A;  3OYI A;  2F4I A;  3HUG B;  1ON2 A;  1BA5 A;  5EJC A;  3OOP A;  1XC5 A;  4XOT A;  1ZLK A;  4U0W A;  2JA2 A;  3IH4 A;  2E36 A;  5M5Y J;  1K78 A;  3KIO A;  1J75 A;  1ETK A;  2GIZ A;  3QPT A;  4LOC A;  4G9Y A;  5TIS C;  5EZG A;  1IV6 A;  2DPU A;  2XRL A;  2PMH A;  2FXA A;  5L3G A;  3KYL A;  3DP7 A;  1R5I D;  1OCR H;  2K9N A;  2VXZ A;  4RS8 A;  2O5R A;  2X4H A;  1LKX A;  3MAJ A;  3QU3 A;  2OQG A;  3IHU A;  4AIH A;  1T39 A;  4EM0 B;  4KIT B;  3SYT A;  3GCM A;  4KMU X;  1U78 A;  1JTY A;  2KJC A;  2AS5 F;  4UB8 C;  1V5E A;  1D0Y A;  3L2Q A;  3CZ6 A;  1QGP A;  1RC9 A;  2TCT A;  3MCZ A;  1B72 A;  1UHW A;  4CHU A;  1RUO A;  3O2P E;  5DCM B;  3VSK A;  3FM5 A;  3GTQ J;  3LSG A;  1T56 A;  2KHM A;  1HA8 A;  4EV0 A;  4HAM A;  1BI2 A;  3MKY B;  1ETY A;  4U7B A;  1VQK I;  1W7P A;  3EUA A;  1S7O A;  1FMV A;  4XLN F;  1F43 A;  2IVM A;  3WG7 H;  2NVU B;  4HOB A;  3A0H C;  4QLC U;  2FML A;  4CYD A;  3FZV A;  1VQL I;  2NVT J;  2VQH A;  2WV1 A;  3GF2 A;  3HGG A;  2ZME C;  2JSC A;  2Q0O A;  1RI7 A;  1G3S A;  1WSU A;  4BE1 A;  3W6V A;  3HOT A;  3R4K A;  3I4M J;  4EM1 A;  3C18 A;  1V5F A;  3HHG A;  4A5N A;  2BE5 F;  4IHS A;  2QQA A;  4C9Y A;  2RV8 A;  3S3N A;  3F8F A;  2CFO A;  3HRS A;  1U5T B;  3OWT A;  3I9V 2;  1VQ6 I;  2MBF A;  3PO2 J;  3LSI A;  1JKO C;  4PGG A;  4KYW A;  3BTI A;  5ICC A;  3ZOB A;  4ZZL A;  2VXD A;  3RCO A;  4E7K A;  1TLH B;  3DKY A;  4I0A A;  4RGX A;  3W3C A;  1ZYR F;  3MKZ A;  4RGS A;  2BW3 A;  5E1X A;  2OBP A;  2EWN A;  1OCT C;  4BQA A;  2QLZ A;  3HXL A;  1W4M A;  4MNU A;  3PO3 J;  1YW9 A;  4XRS A;  5E3M A;  1FOY A;  1HW2 A;  3BR1 A;  1OPC A;  3ML6 A;  3I4N J;  3WE2 A;  2CGP A;  2EFO A;  1ODD A;  3V7S A;  5L3E A;  4BDY A;  1YYV A;  1FBU A;  3OYL A;  2YSR A;  4IRI A;  3VEP A;  4XOR A;  4BXF A;  2CV2 A;  4AYB N;  3BG5 A;  4I09 A;  3LA3 A;  1VFC A;  3O8G A;  2XAF A;  1YW7 A;  4BXX J;  3QPS A;  2XF7 A;  3I54 A;  1TBX A;  5ILU A;  3MFK A;  4WXC A;  1B8I A;  4L0Z B;  3KP7 A;  5EZH A;  2P0W A;  3QQA A;  2ZME A;  3E6B A;  4JOM A;  2X1C A;  2HXI A;  4Y17 A;  2NRA C;  2KZG A;  4N9I A;  1UJ8 A;  4I98 B;  3K70 D;  1MNM C;  4HDV A;  4M71 A;  2RN7 A;  1SMY F;  4EJU A;  3S2D J;  4A0Z A;  3DEU A;  4Y13 A;  3JSP A;  1IXR C;  3Q0U A;  4UVC A;  4OIN F;  2KIQ A;  3HOX J;  3SQN A;  3BR6 A;  2ZSI B;  2IA2 A;  4XLF A;  2LH9 A;  1NTC A;  2ZNY A;  2G7U A;  4E70 A;  1WJ5 A;  2HI3 A;  4FIS A;  1CF7 A;  2L02 A;  1J5Y A;  4RM2 A;  3K2A A;  2L9N A;  2FJ1 A;  2KZV A;  2HKO A;  4GCV A;  2WWY A;  2M2E A;  1Q1H A;  3TDZ C;  4ZYG A;  5ILS A;  2QBY B;  4EJW A;  1XMX A;  3D0S A;  5DTD A;  3R6S A;  1ETQ A;  1TW3 A;  5JVT A;  2HVR A;  3QPH A;  3L9F A;  3GTM J;  3O6B B;  1JUP A;  2VOO A;  2M7B A;  2DA7 A;  1EV7 A;  5HS8 A;  2H8R A;  2M9H A;  3F0C A;  4LB6 B;  5DUI A;  5IP9 J;  1GXP A;  1X2N A;  1WJB A;  4IHT A;  1LDD A;  2FQ4 A;  2Q2E A;  3FXU A;  3KLO A;  5HDG A;  4ZDL A;  1OQY A;  2M4G A;  4A3G J;  3FKJ A;  3RKX A;  2CJJ A;  2IP2 A;  2QGU A;  2XAH A;  4A3K J;  4BJT A;  1BI1 A;  1WFX A;  2AXT C;  1OCC H;  1I3Q J;  2B7E A;  2GLO A;  3CCE I;  1V54 H;  3EDP A;  2HVQ A;  5KAF C;  1MMN A;  4NDL A;  2ZO4 A;  4N0B A;  1MSF C;  3CUQ C;  3HOZ J;  3J7A O;  2R5Y A;  5ICE A;  3BWG A;  1D0X A;  3A01 B;  2ZSH B;  4KJZ A;  2K5C A;  2COB A;  1RZ4 A;  5ILV A;  3S1M J;  2KMU A;  4M3G A;  1FSE A;  1IRF A;  3F6O A;  4HBL A;  3ZXS A;  2ME6 A;  2FU4 A;  2HNH A;  3HSE A;  4PSX A;  5L3C A;  4ZTF A;  2R7X A;  3CCU I;  4XID A;  3IKV A;  2NS0 A;  3BG3 A;  1R22 A;  3OL4 A;  4HF1 A;  3SZT A;  3CME I;  2QQ8 A;  3L00 A;  3S17 J;  2HYJ A;  5ERI A;  3BR3 A;  2V79 A;  1IRZ A;  1JJ8 C;  1BR2 A;  4ZYE A;  4LK1 F;  5DDG A;  4J01 A;  2XGC A;  3HOY J;  4B43 A;  1OIS A;  3TOB A;  3L2V A;  2DTR A;  4M3E A;  5H2F C;  2KL4 A;  2VJ5 A;  3I4P A;  3DV8 A;  2DFF A;  5LFA A;  4A6D A;  2P5K A;  3KZY A;  4YG2 F;  1Z6T A;  5J1U A;  5J47 A;  4EGY A;  1YIT I;  3CCS I;  2HZT A;  3UR3 C;  2LP0 A;  4PJJ A;  3KE2 A;  5DD4 A;  3W2V A;  1F5T A;  1IN7 A;  4MEX F;  4XSX F;  2WY8 Q;  1XSV A;  4D7M A;  4H4K C;  2Y75 A;  4BL0 B;  3REO A;  2DOF A;  5LLQ A;  2ZC2 A;  3F22 A;  3IH2 A;  5IOZ A;  3FDY A;  4Z2Y A;  5GAD J;  4HG2 A;  1AA7 A;  5EEA A;  4KA4 A;  4NC8 A;  3J80 K;  3FMS A;  2DCE A;  2VN2 A;  3VWB A;  4RA2 A;  4G6Q A;  2JZY A;  3DPT A;  3O8H A;  1GV2 A;  1W5C C;  2FBH A;  1W5T A;  5CQG A;  4UXN A;  3FK6 A;  4ABZ A;  2DYR H;  4XSZ F;  4A3M J;  1ZRF A;  5BQT A;  1TT5 B;  2L9V A;  3DCF A;  3NQO A;  4P9U A;  4X6A J;  3DKX A;  3K9T A;  1O4X A;  2W1O A;  2CQN A;  1N77 A;  2QZ8 A;  4CCN A;  3CMY A;  3WTV C;  2CV0 A;  2E2I J;  1ETW A;  1T33 A;  4R8H A;  3GFI A;  2RRE A;  3BQY A;  3AFH A;  2A6E F;  4IQ4 A;  1MBF A;  2LKS A;  3BJO A;  3F8N A;  4RAZ A;  3G2B A;  4G6D A;  4BHP A;  2HDD A;  4W97 A;  1P4W A;  1E3H A;  2K86 A;  3H5R A;  1BC8 C;  2VE8 A;  1FPQ A;  2EZI A;  4OAZ A;  5F1R A;  3GLL A;  5IT9 K;  2L5Q A;  4F93 B;  2QQB A;  1OKR A;  4A2U A;  3LSP A;  2M87 A;  2IBD A;  1J0R A;  3BOQ A;  2VC1 A;  3L2R A;  4K2E A;  3WGG A;  3BPV A;  3S1N J;  3AAF A;  5B5E C;  2OUM A;  1VI0 A;  1V55 H;  1Z05 A;  2JK3 A;  2H94 A;  2ZNZ A;  3Q9S A;  3F6V A;  3ONQ A;  4PJN A;  2IT0 A;  2XSJ C;  1YRN A;  3HSR A;  1Y1W J;  1YLF A;  3AG3 H;  4ZYA A;  4BKX A;  5FFX A;  3LSK A;  4XK4 A;  5CVI A;  3KPH A;  4DNC A;  4OIP F;  1T08 B;  2FQ3 A;  3DBH B;  2X51 A;  4PUS A;  5GPC A;  3HSF A;  3CCL I;  2K40 A;  1PVE A;  2E1O A;  3J80 Z;  3IRQ A;  1QHG A;  4FX0 A;  1XGN A;  3LSH A;  2XRO A;  6PAX A;  1DP3 A;  3K6G A;  2HVS A;  2GZW A;  1OYY A;  4YRV A;  5HOO A;  1WJF A;  5JHF A;  3ABK H;  4CYC B;  2NVQ J;  2XAG A;  4YEJ A;  1FC3 A;  2WAQ A;  5LD2 C;  2KKO A;  2HGC A;  2GXB A;  2H6C A;  5JR3 A;  2PG4 A;  2HEO A;  3CLQ A;  3V7C A;  3I58 A;  2P7C B;  1Z91 A;  2ZXH A;  2GQQ A;  1LJ9 A;  4LG0 A;  2R92 J;  1YJ9 I;  1RPW A;  3Q0V A;  3SXY A;  1CQT A;  3EYI A;  2EZH A;  4OIO F;  1QBJ A;  4M6V A;  2EBI A;  4KNY A;  3HUG A;  5LHH A;  1ZRE A;  1NH3 A;  1XSX A;  3GFJ A;  1MZB A;  1XMK A;  3E5U A;  2LSO A;  4CCJ A;  2MH9 A;  2BGC A;  2GIV A;  4PSW A;  2JT1 A;  2JWT A;  4UUT A;  2A6T A;  2K9M A;  5IOY A;  2Z5U A;  4BAC A;  2X6Y A;  1Y0U A;  2KP6 A;  4PJL A;  4RLF A;  1S5L C;  2ETH A;  1U5T C;  1K61 A;  4XLC A;  2LLK A;  1R5G A;  1LQ1 A;  2PI0 A;  2O6G E;  3BR2 A;  4IL6 C;  2EFW A;  1MKM A;  5GPA A;  5IT9 Z;  2VIX A;  2ZJP F;  2RQQ A;  3I0T A;  1RR7 A;  4BJ5 C;  1S8N A;  1IJW C;  1AU7 A;  4B47 A;  4M9S A;  2PLY A;  3F72 A;  3CJN A;  1H0M A;  4MTD A;  2CRG A;  2RAE A;  1HKS A;  2GOX B;  2K4J A;  3VYT B;  2FBI A;  1EH8 A;  1QQI A;  2VBY A;  3U1D A;  2ZJR F;  1TNS A;  1FWZ A;  5DCM A;  4XN0 A;  4NQW B;  2E2H J;  1R36 A;  1O7F A;  3W6K B;  1R9T J;  1PDN C;  1JHH A;  1I39 A;  2WB1 A;  2ZFW A;  1VQM I;  2W4S A;  5F27 A;  2VT2 A;  2WC2 A;  3M4O J;  5FLV A;  2L7M P;  2F6C A;  3ZQL A;  1TW2 A;  2HPI A;  1B1B A;  2E71 A;  3LQQ A;  1X3Z B;  5HNH A;  1EF4 A;  2XDV A;  1P4X A;  3IWF A;  3C2H A;  4ENK A;  1W0T A;  3WHC A;  1HBX G;  2BY0 A;  5TGT A;  1FP2 A;  3BT9 A;  4O5V A;  1MNE A;  1IDZ A;  2FNA A;  1P7J A;  1HDP A;  1W7P D;  4BDZ A;  1MGT A;  3CJT B;  3MWM A;  1ZQ3 P;  1KQ9 A;  1U5T A;  1XCV A;  3BTL A;  4UUV A;  3K1M A;  5F1J A;  2QKM B;  3S3M A;  2FD5 A;  4YEL A;  5JLW A;  1IG7 A;  3ZQF A;  1Y0N A;  3CO7 C;  5CQE A;  4E6K G;  3BR5 A;  4WXH A;  5K1Y A;  5J40 A;  2D2W A;  2Z9O A;  5H6R A;  3IUO A;  3A02 A;  3M9A A;  1R4N B;  2XGX A;  4QPQ A;  4DIQ A;  2XRN A;  2XUB A;  2IW5 A;  3WU2 C;  4A0X A;  5B66 C;  2Z33 A;  3J81 K;  3K4N A;  4DZP A;  3EET A;  1Z3Y A;  1EH7 A;  1Z77 A;  1Y1V J;  3HDD A;  3LQR A;  4N4O B;  2RDP A;  3V7R A;  5HNF A;  3CUQ B;  3RKY A;  3OYD A;  2WAF A;  3C2G A;  3H35 A;  2CW7 A;  2LK2 A;  1KYZ A;  3CF2 A;  1OLT A;  3HKZ N;  1VQN I;  1SVL A;  3DBL B;  4C2M J;  4XNF A;  3F8M A;  3FHZ A;  1QHH D;  3LAJ A;  3BDD A;  4BGD A;  2VKV A;  3TW7 A;  1YIJ I;  2CW0 F;  2EA4 A;  5JVG F;  2FOW A;  2MLK A;  2R7V A;  4CH7 A;  3ECH A;  4D7N A;  3IL2 A;  3HOU J;  1XN7 A;  2VJJ A;  3I59 B;  4B48 A;  1R1U A;  3N97 A;  4LIV A;  1GHC A;  1UMQ A;  1HW1 A;  3RYR A;  2B0L A;  2E5Z A;  1TQI A;  4E7Z A;  1PP7 U;  4HQM A;  5LBQ A;  2L4M A;  3CC7 I;  1YS6 A;  3WTX C;  1X4O A;  3T8R A;  3I55 I;  5DEQ A;  2M3A A;  2HPM A;  2KIF A;  5EDN A;  1IW7 F;  2HS5 A;  1MBG A;  1OYW A;  1NG6 A;  4RBO A;  4ZZD A;  3NAU A;  5M3F J;  2QBY A;  2XC7 A;  4OMY A;  3C1D A;  1QZY A;  2V9V A;  3ELK A;  2LRD A;  3EPZ A;  1FX7 A;  1BW6 A;  2J5O A;  2R7Z J;  4Q4Z F;  5FD6 A;  2V4J C;  5BOX A;  1OCZ H;  5E3O A;  1O3Q A;  2XSD C;  1MMG A;  4UVB A;  4XKW A;  3CMA I;  1FOK A;  2W84 A;  4ESF A;  1Z9C A;  3P9C A;  2XGD A;  5AIP A;  5JHU A;  1G8X A;  1KU3 A;  3TED A;  2Z1D A;  3BPX A;  3R60 A;  5GAG J;  1DGR M;  1FOX A;  2XVC A;  4IXA A;  2JUG A;  5C3E J;  2M0M A;  2D45 A;  4KT5 C;  1PUE E;  2PQ8 A;  3J81 Z;  1JUM A;  4RAY A;  1J2X A;  2OCC H;  1QA6 A;  2VJ4 A;  3HRM A;  2VUM J;  4CA0 A;  1D8J A;  1WJE A;  1YJN I;  3B73 A;  2BY1 A;  2ZJ2 A;  4M9X A;  1SMT A;  2EIJ H;  1QU3 A;  3HEF A;  4BAY A;  2ZXW H;  4RGU A;  5D4R A;  1KON A;  1X1P A;  4CCL A;  4HNT A;  1AOY A;  2MYS A;  3G1O A;  2V7F A;  2WTE A;  2HOT A;  1JE8 A;  1D3Y A;  1N25 A;  2ZXJ A;  5B1A H;  1BI3 A;  3I71 A;  3KZI C;  1JKP C;  4IOA F;  4XR6 A;  1LDK B;  5FKM A;  2KPM A;  3X2Q H;  3OS0 A;  3GTG J;  3RTR A;  2DBB A;  4HEA 2;  3A01 A;  1BL0 A;  4UY8 I;  3WTZ A;  1Y8R B;  5HLG A;  4QIW N;  1ZAR A;  1JUS A;  3QYE A;  3TO7 A;  3IP4 B;  3ABM H;  3JRF A;  1QVT A;  2IAI A;  1FIP A;  4N4N B;  2CW8 A;  1BOA A;  3TO9 A;  2YX7 A;  1RKW A;  4JX4 A;  1O57 A;  1WH7 A;  4A12 A;  4A0Y A;  4XRM A;  1XMA A;  1TQP A;  2A5W A;  1MJB A;  3HOW J;  2DFE A;  3WU1 B;  3L7W A;  1I50 J;  2HTS A;  4A3D J;  2O8X A;  3GWZ A;  3HL2 A;  3DU6 A;  2DAO A;  3LSJ A;  2PX9 A;  1UZC A;  3V42 A;  3E1S A;  2QUF A;  2VBX A;  3M3Y J;  2LY9 A;  4RLQ A;  4MEY F;  3J7Y J;  2KLO A;  2F5E A;  2DK5 A;  4G7O F;  3BG7 A;  3Q5F A;  2F48 A;  3V8J A;  2BXZ A;  2BHZ A;  2MC3 A;  1H88 C;  4A3L J;  3DTK A;  3PFY A;  3ROU A;  4JX6 A;  2DA3 A;  1WJA A;  2VQL A;  4F3Q A;  1EA3 A;  3GME A;  2OAZ A;  4OU0 A;  4WWC A;  2R4G A;  1A36 A;  3CTA A;  3I5U A;  1NHA A;  1DDN A;  2ID6 A;  3PNV A;  1R7J A;  4IF4 A;  1SAN A;  1XCB A;  1LVK A;  4IJA A;  3FMQ A;  1KU2 A;  2F4O B;  3DPU A;  3G4S I;  1B9M A;  4BJ6 C;  1I1G A;  3JR9 A;  2I5U A;  2L01 A;  3FX3 A;  3RSN A;  4AM3 A;  1OJL A;  4CUG A;  3TW6 A;  4EJV A;  2DFI A;  5L3B A;  5LEK A;  5FKO A;  5FRN A;  4LD5 A;  3RQI A;  2WAD A;  5LHG A;  2DDA A;  1LFB A;  1JI8 A;  1V5G A;  1ETV A;  4AC0 A;  4CDG A;  2TRT A;  4PFO A;  3DLA A;  2VON A;  1G3T A;  4Y33 A;  3VYS B;  1WI9 A;  4L9V A;  1K7A A;  1MIJ A;  1N75 A;  1R71 A;  4II2 A;  1B6A A;  2NXN B;  1ZK8 A;  1IXS B;  2HDW A;  2NS8 A;  3H92 A;  5IYD J;  3KZZ A;  2ESH A;  4OWR B;  2KT0 A;  1EH6 A;  1HC8 A;  4KIF A;  2ZXI A;  2J5P A;  1MMS A;  4NHJ A;  2IRF G;  3OIP A;  3G6E I;  1A5J A;  3FXO A;  4ZJZ A;  4MHG A;  4IX7 A;  4UVA A;  1UST A;  5D5V B;  2XAJ A;  2EPF A;  2G9W A;  2HR3 A;  2A6H F;  3KEY A;  1ZRD A;  1ZLJ A;  2MC4 A;  3H3Z A;  2FRH A;  3WOD F;  3WU0 A;  1ZAO A;  4NNJ A;  2IJL A;  3S16 J;  4DGW B;  3GZ5 A;  5LHI A;  3E6C C;  2QM3 A;  4KDP A;  2W48 A;  4HA8 A;  3OMY A;  1D0Z A;  3PQK A;  4I01 A;  3GTL J;  4XLP F;  2HQN A;  2BBY A;  4B1R A;  1ULY A;  1SD7 A;  1SVM A;  3KP5 A;  2FSW A;  2RNJ A;  3MZH A;  5DM7 F;  1MDM B;  1KU9 A;  1M1E B;  4CYC A;  2IXS A;  2K9S A;  3A0B C;  4LLG F;  5D5U B;  5EYR A;  4V2F A;  2VKE A;  1RUN A;  3G1L A;  2NVY J;  1I6X A;  2CUJ A;  1MJ9 A;  1JGG A;  2HOE A;  5C4X J;  1YX3 A;  3S32 A;  2FUG 2;  2E19 A;  3ASO H;  4L0Y B;  3Q3S A;  4LJZ F;  1LFP A;  2O0Y A;  3FMR A;  4EGZ A;  1P92 A;  1Y6I A;  2RVC A;  2IA1 A;  3G73 A;  1MD0 A;  4MO7 A;  2DA5 A;  2E60 A;  2EV5 A;  1WPK A;  4CZC A;  2K85 A;  1AKH B;  4AVP A;  5IP6 A;  3HGY A;  3J7Z I;  3OYA A;  1QZZ A;  4DYC A;  1DPR A;  3PQJ A;  3U21 A;  4UV8 A;  1Q1V A;  3A4C A;  3R61 A;  4HLX A;  3ASN H;  3OIO A;  4G8X A;  3BZC A;  4ANJ A;  3K4L A;  4JBA A;  2DOA A;  3A03 A;  1F1Z A;  3OYK A;  1U3E M;  2LD5 A;  3ERE D;  2GA1 A;  3PJR A;  3RJP A;  2EV0 A;  2KIS A;  2JVG A;  3TP0 A;  3FBI B;  3QPL A;  4RB2 C;  3K10 A;  3H9J A;  1FT9 A;  4WCG A; 
#chains in the Genus database with same CATH homology
 2VKD A;  4BE2 A;  3OYB A;  3ONQ A;  2VQG A;  2GOM A;  4PJN A;  2XSJ C;  4ZDP A;  2LC2 A;  3D5L A;  4ZYA A;  1PYV A;  3K4B A;  4R79 A;  2R7U A;  3LSK A;  4AYB A;  4BQQ A;  4Y4R A;  3SEQ A;  4BUP A;  2X51 A;  2BOL A;  3LMM A;  4PUS A;  4DBQ A;  5KHD A;  1QHG A;  3LSH A;  4U87 A;  2PJR A;  3CP2 A;  1DP3 A;  3CJQ B;  3K6G A;  5HLT A;  2HVS A;  2IS2 A;  1MMD A;  3OYC A;  4YRV A;  5HOO A;  1WJF A;  3FHN A;  2R7W A;  5JHF A;  2XF5 A;  4JQF A;  4YEJ A;  4D1Q A;  2V1N A;  1YE9 A;  2WAQ A;  3OR2 C;  4D9J A;  5LD2 C;  2L9S A;  1DGW Y;  3NWS A;  2CH0 A;  2DJI A;  3OYM A;  3D5S C;  2ZXH A;  1YX5 A;  3F9K A;  3HC7 A;  3S93 A;  4E7H A;  3VDX A;  2L7K A;  2VAS A;  1SFK A;  4NUB A;  3S8P A;  4IKF A;  2Z16 A;  1UG0 A;  3DTE A;  4CCJ A;  4F92 B;  3KX2 A;  4PSW A;  2UV1 A;  2A6T A;  2K9M A;  4BAC A;  2X6Y A;  2KP6 A;  4PJL A;  4RLF A;  4XLA A;  4X0G A;  2CV1 A;  3HG9 A;  4XLC A;  4XKB A;  2MAB A;  2BVL A;  2X6X A;  3OS2 A;  2KQR A;  4XKC A;  3A1Y A;  5FRO A;  2VIX A;  1W36 C;  1UEL B;  2V26 A;  3ZCO A;  2RQQ A;  2X1E A;  4XLH A;  2X85 A;  4BJ5 C;  1MMA A;  2W82 A;  3OR1 C;  1MND A;  1X1B A;  3H9Q A;  2QKL B;  4B47 A;  4PJM A;  1GLN A;  3LSM A;  4G6T B;  3TBI A;  4BEH A;  5FRM A;  3VYT B;  2GOX B;  4HST A;  4CCM A;  3N05 A;  2CS3 A;  4HSR A;  3H0D A;  4XN0 A;  4XKV A;  4NQW B;  3AL0 B;  4II3 A;  3QYB A;  3VYR B;  1E0E A;  1X1C A;  3PL8 A;  2WB1 A;  3LL7 A;  3PSF A;  1DQU A;  4P1W A;  2W4S A;  4J00 A;  1WJC A;  5CPR B;  2AQE A;  2LY1 A;  2F6C A;  4EAT A;  2DXI A;  3D5R C;  2PJR B;  1BR1 A;  2HPI A;  4CSW A;  3DU5 A;  3OY9 A;  2JSP A;  2Z2S B;  2ZFU A;  5HNH A;  3ZGK A;  2XDV A;  1N78 A;  3C2H A;  1Z21 A;  4B3X A;  3E0J B;  4XQF A;  3LFU A;  5TGT A;  2CMP A;  1WJD A;  2RNG A;  3OYN A;  1MNE A;  2X1D A;  4IQJ A;  3DTI A;  2V9K A;  4BDZ A;  3NWT A;  2MD0 A;  1K6Y A;  3SDB A;  1P9Q C;  4BQO A;  2VB6 A;  1X1D A;  3SEZ A;  4DOZ A;  4ZTJ A;  1BR4 A;  3OYI A;  4E7I A;  2QKM B;  3S3M A;  2F4I A;  3HUG B;  4YEL A;  3OIQ A;  4LIT A;  2JVH A;  2VJI A;  5CQE A;  4XOT A;  5HVQ C;  4XON A;  2JA2 A;  4E6K G;  4DJA A;  4RMN A;  2XAU A;  3IUO A;  1X1A A;  3CMM A;  4QPQ A;  4DIQ A;  3KYL A;  2VXZ A;  2KDO A;  3GBG A;  1MW7 A;  2HZD A;  2O5R A;  3OYE A;  1LKX A;  2K9L A;  3ZQQ A;  4KIT B;  3SYT A;  3K4N A;  1Z3Y A;  4BEH B;  1V5E A;  2OC6 A;  1D0Y A;  3L2Q A;  1PJR A;  3QYF A;  4N4O B;  3CZ6 A;  5KNL A;  5HNF A;  3OYF A;  3HPG A;  3OYD A;  4KT6 A;  2WAF A;  3C2G A;  3A2K A;  4ITV A;  3H35 A;  2CW7 A;  3VSK A;  3LSG A;  1ERD A;  2KHM A;  3CF2 A;  1HA8 A;  1OLT A;  4BE0 A;  2CUZ A;  3MKY B;  4FET A;  3VSL A;  4XNF A;  3BCB A;  4U7B A;  1QHH D;  3IAS 2;  3MKW B;  3EUA A;  4BS9 A;  4F55 A;  1FMV A;  4BGD A;  3ZR8 X;  4XM3 A;  2XF6 A;  3OS1 A;  2R7V A;  3CP8 A;  4CH7 A;  3VYU B;  2VJJ A;  4B48 A;  1UAA A;  4KIS A;  2VQH A;  4IZZ A;  4LIV A;  1BOB A;  1T0F C;  4E7Z A;  2E5Z A;  3OYG A;  1X4P A;  3QOD A;  4BE1 A;  1X19 A;  4BQN A;  3HOT A;  1V5F A;  2UUZ A;  4C9Y A;  1X4O A;  2M3A A;  3MMY B;  4XN3 A;  2HPM A;  3S3N A;  3ZRG A;  4C30 A;  2CFO A;  1NG6 A;  3OWT A;  3I9V 2;  2XC7 A;  2R7S A;  3EPZ A;  2LRD A;  3LSI A;  2VXD A;  3RCO A;  4E7K A;  3DKY A;  3W2A A;  2V4J C;  4F52 A;  3W3C A;  3MKZ A;  1MMG A;  4XKW A;  4AVZ A;  2BW3 A;  1G8X A;  2Z1D A;  3HXL A;  1DGR M;  1S9H A;  2LOO A;  3H5A A;  2JUG A;  2M0M A;  3S3O A;  4LIU A;  2R7R A;  4BDY A;  3DEE A;  2VJ4 A;  4C2T A;  4PFP A;  4CA0 A;  3OYL A;  4XOR A;  4BXF A;  2CV2 A;  1WJE A;  1R6R A;  3RQ4 A;  3L2U A;  2WA0 A;  1TT0 A;  3K70 C;  1D1A A;  1QU3 A;  4HNU A;  1KON A;  4CCL A;  4HNT A;  2XF7 A;  3OYJ A;  3HKZ A;  2MYS A;  2NOJ B;  2Q1Z B;  2V7F A;  2P0W A;  3AL0 C;  4JOM A;  2X1C A;  1Z3X A;  4XR6 A;  3QOE A;  1LDK B;  3OS0 A;  2KPM A;  2IGM A;  1VZ0 A;  3RTR A;  3UNG C;  3K70 D;  3AKZ A;  4HEA 2;  4RM3 A;  3IAM 2;  2W7N A;  2E5N A;  1G59 A;  4ZDO A;  4XMY A;  3QYE A;  3IP4 B;  4E7L A;  4N4N B;  2CW8 A;  3K4C A;  3EUH C;  2ZSI B;  3FBN B;  3RPU D;  3L2W A;  4XLF A;  2LH9 A;  4MLO A;  1OR7 C;  1WJ5 A;  2Y0S A;  4RM2 A;  2A5W A;  2L9N A;  2KZV A;  3DQV C;  1IRX A;  2M4K A;  3M1C A;  3HL2 A;  4GRI A;  3DU6 A;  2V6E A;  2ELJ A;  2LY2 A;  2F5V A;  3V42 A;  3E1S A;  3OL3 A;  1TZL A;  3TMO A;  2HVR A;  4ZC3 A;  2WBM A;  2HU9 A;  4RLQ A;  2BW3 B;  3M8J A;  2KLO A;  2M7B A;  3BG7 A;  3PUB A;  3TL4 X;  1Y56 A;  4OAY A;  2E1M C;  2R7T A;  3DTK A;  1WJB A;  3PFY A;  3HPH A;  4QPO A;  1WJA A;  2VQL A;  4F3Q A;  1EA3 A;  4ZDL A;  1D1C A;  2R4G A;  3PSI A;  2DT6 A;  4HRI A;  1Z7L A;  2M4G A;  3FKJ A;  2AQF A;  3PNV A;  4BJT A;  1WFX A;  3K4M A;  1LVK A;  2IS6 A;  2KRH A;  3DPU A;  2IGK A;  4BJ6 C;  3H9G A;  2HVQ A;  1MMN A;  4AU7 A;  3RSN A;  2LBF A;  1ZEL A;  4CUG A;  3H5N A;  3MD2 A;  3OYH A;  2PMZ A;  3H9J A;  3CES A;  5FRN A;  4PK4 A;  4P5O A;  2IGN A;  2WAD A;  4XL9 A;  1D0X A;  2ZSH B;  1V5G A;  5CKT A;  1JI8 A;  4KJZ A;  2K5C A;  2K3P A;  4BU2 A;  4PFO A;  3DLA A;  2KMU A;  4E4H A;  2W00 A;  3PNY A;  4Y33 A;  3VYS B;  2R7Q A;  1NG7 A;  1U0J A;  3ZXS A;  1N75 A;  2HNH A;  3W2W A;  4PSX A;  4ZTF A;  3PNT A;  2R7X A;  4II2 A;  3OL4 A;  1J09 A;  2I8D A;  1FMW A;  2HDW A;  4OWR B;  4DBR A;  2ZXI A;  2MFZ A;  4Y3O A;  1BR2 A;  4J01 A;  2M7A A;  4E7J A;  3OIP A;  3HOS A;  2UWM A;  4B43 A;  4ZJZ A;  3L2V A;  5KCM A;  2WY7 Q;  2VL8 A;  3BLY A;  4IX7 A;  2WAE A;  2KL4 A;  2VJ5 A;  5LFA A;  2IGO A;  3KEY A;  4CCK A;  2MC4 A;  3I3L A;  2X6W A;  3UR3 C;  4NNJ A;  4DGW B;  4PJJ A;  1T95 A;  3W2V A;  4NC7 A;  3OMY A;  1D1B A;  1D0Z A;  4HPQ A;  2WY8 Q;  2Q2E B;  4H4K C;  2OV7 A;  4BL0 B;  4CCO A;  1W36 D;  3FDY A;  3EUK L;  4HG2 A;  1AA7 A;  4NC8 A;  3BC8 A;  2DCE A;  2L2O A;  3DPL C;  2IS1 A;  3VWB A;  3DPT A;  2IXS A;  2LYC A;  5CQG A;  1SAU A;  2BVM A;  2VLA A;  2LBF B;  2LG4 A;  3CJR B;  4B44 A;  2LRE A;  2CUJ A;  3OOU A;  4LG3 A;  1YX3 A;  3S32 A;  2FUG 2;  1LFP A;  3DKX A;  2W1O A;  1Y6I A;  1N77 A;  3K4K A;  3DWL E;  4CCN A;  2E60 A;  4FAS D;  2VKH A;  2CV0 A;  4CZC A;  2IS4 A;  2HQA A;  3BCA A;  3BG6 A;  2RRE A;  3OYA A;  3AFH A;  4IQ4 A;  2R7O A;  3U21 A;  3J7A Y;  2VPL A;  3A4C A;  3G2B A;  3SZG A;  4XLE A;  2DT7 B;  4ANJ A;  3K4L A;  2DOA A;  4XOP A;  3H5R A;  3OYK A;  4OAZ A;  2VQC A;  4C2U A;  2KRC A;  2L5Q A;  4F93 B;  3PJR A;  3L2R A;  2JVG A;  2E1M B;  4F91 B;  3FBI B;  4E7S A;  3K4J A;  3K10 A;  2OUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...