2L7KA

Solution nmr structure of protein cd1104.2 from clostridium difficile, northeast structural genomics consortium target cfr130
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
MIRLTIEETNLLSIYNEGGKRGLMENINAALPFMDEDMRELAKRTLAKIAPLTENEYAELAIFAADEVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Solution NMR Structure of CfR130 from Clostridium difficile, Northeast Structural Genomics Consortium Target CfR130
rcsb
source organism Clostridium difficile
total genus 20
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14203 TTRAP Putative tranposon-transfer assisting protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1850 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l7kA00
2L7KA
chains in the Genus database with same CATH superfamily
2LDUA 3OR1C 4A5NA 3E6BA 1FEXA 4A3CJ 2ZSIB 2F48A 3OYLA 1ZGJA 2IAIA 2HI3A 3WTYC 2HPIA 1N78A 4PJ0C 1I50J 1P7IA 1B4AA 1DUXC 1B6AA 2MH2A 3WU0A 1R4MB 3HUGB 1QGPA 2X1CA 1OJLA 1YX5A 1VQLI 4XNFA 2YUSA 5J4YA 5LEKA 2JSCA 2HQRA 4WX9A 2BGCA 3ESWB 2KL4A 3OYEA 1QRYA 1NK3P 5CLSA 4E7SA 1V55H 2FA5A 5B5EC 2OV7A 3TGNA 3JRCA 1RKTA 1I6XA 2LK2A 1MDMA 4I09A 4BQNA 5IY5H 2K9SA 3ABTA 3FM5A 4KT5C 4DYCA 2HKXA 2FNPA 1ZG5A 2K9MA 3NWSA 2M7BA 3WHBA 4M3GA 4S0HB 2OD5A 4HPQA 1LFPA 2ELHA 3FBNB 4IHSA 2FOWA 1W36C 3L1PA 4ZYDA 4IOAF 3OIPA 2P5KA 4ANJA 4IRIA 5DCFA 1BR4A 2FX0A 3CMEI 1UHMA 1W5CC 1XMXA 4BHBA 4JOMA 5B1AH 1X19A 2MC4A 3H5NA 4M3BA 2P7CB 3UKGA 3HRSA 2ZXWH 1I1SA 1FLIA 4DYRA 1BI3A 2M45A 2ELKA 5FKOA 4XLCA 1Z7LA 2Y0SA 4K2EA 4GFBA 3DQVC 3O6BB 1MNEA 3B02A 2NS7A 4M3FA 4MEXF 2EFPA 1IW7F 4ZYEA 2FF4A 1BJAA 1KQ9A 2GBYA 2LP0A 3OYDA 1FIAA 4BJTA 3ISPA 4LMYA 3FHZA 2ZMEC 3ZQ7A 2LKPA 4BH9A 1D0ZA 2EFNA 2RNJA 3GFLA 4XKBA 1Y8RB 2DPDA 2E1OA 1OISA 1U0JA 3IUOA 4BACA 3EQLF 4NC6A 4B48A 3OYFA 2VBXA 4V19K 2RKHA 4YELA 2RVCA 1R1VA 1B9NA 5GPAA 2JUCA 3QP6A 1ETYA 3ASOH 1FJLA 1RRJA 1IDYA 5E1ZB 3CDLA 4XRFA 1P4XA 4B3AA 1BJZA 2M8GX 3A0HC 4PJJA 2P81A 2LC2A 4UVAA 4YIRX 4IX7A 2DW4A 1W0TA 1OPCA 4XMYA 3ZQQA 3L2QA 3ZP5A 1EF4A 2XF6A 5CYVA 2X6XA 4G7OF 1LDDA 5IYCJ 2O0YA 1FOYA 1UG2A 2FU4A 1LNWA 3FXRA 4F92B 3ABMH 2GXAA 1W7PA 1R58A 3ELKA 2ZJRF 4IPAA 5H6QA 1WGXA 2XPUA 3EUAA 3JRAA 1JXSA 3BCAA 3ZQFA 1ORKA 2PX9A 1T38A 3WE3A 1O3SA 4R8HA 5JR3A 2PQ8A 5LD2C 1FX7A 3J80K 4D7NA 5E1WA 3GBGA 2KJCA 1OMIA 2XGCA 2OQGA 2RNGA 3CMYA 3S3OA 4Y3OA 1YG2A 2K7LA 3WU2C 4Y52J 1ETWA 3W2WA 5CVJA 3S3NA 1MKMA 4MQVA 4GYGA 2QLZA 4HZFA 2OBPA 2M3AA 3G1LA 1ZG1A 5GAHJ 1ZKGA 4IQJA 1XS9A 4L9TA 4U0YA 2NOJB 3KP5A 1B72A 1RZ4A 3PQKA 3U2RA 2AS5F 2P7VB 4M6XA 4F93B 2DMPA 1FBSA 2RC4A 3TQNA 5HS7A 2C6YA 2XGDA 1W36D 2BVLA 1JT6A 1XCBA 2PEXA 4H4KC 3IV5A 1MBJA 5CKTA 3D0SA 3HOSA 5L3FA 3DEEA 4D7MA 2VT3A 3OL4A 1YJNI 1Z3YA 3JTGA 4Y13A 4KYWA 1YW8A 2VBYA 3EUHC 2ICWG 5LHIA 1P92A 4NQWA 2EA2A 3GUDA 4P9FA 1FBUA 3CCMI 2DI3A 3L2WA 3CF5F 4LG3A 3FF5A 4G12A 4E70A 3HDDA 1YW9A 4C3JJ 3OS2A 4S05A 2FUG2 1W5TA 3DEWA 3K4JA 2ZFWA 3K0LA 3JAMK 1F9NA 1YX3A 2BBYA 3PL8A 2K4BA 3U21A 2WAQA 1BOBA 3DLLF 1P7JA 2OU2A 3HYIA 2ZXIA 2WADA 2EQRA 5F27A 1D3YA 3ZMZA 5LLQA 1G2HA 2VJ4A 3I9V2 5EZGA 4I98B 4FCYA 2DK8A 3KX2A 4XN0A 3WG7H 1QNTA 2HVRA 5B66C 4KUMA 3OIOA 2ZMEA 4MIMA 2DA3A 2JA8J 2L9NA 2L54A 4E7JA 2QQAA 1CF7B 2E71A 4II2A 5CVIA 3CUOA 5LRSA 4GYIA 1RNLA 3DFGA 5L3GA 2VQCA 3BTIA 1MNDA 3O8GA 3QYFA 4UV8A 5FRMA 5E79C 3H5RA 2IW5A 1BN5A 1ITYA 3QU6A 2QQ8A 2VBWA 4OINF 3JRGA 3AG1H 3K4BA 1D1CA 1XB4A 3GYHX 5CQGA 4C3HJ 4JX5A 4RAGA 5FJ8J 4JK1X 2RN7A 1OYIA 4JX4A 4GXOA 2LVSA 1IUFA 3TDUC 2FNAA 1OLTA 2OZUA 3R0JA 5HLHA 5HLTA 5ICGA 5K7FA 1B1BA 3MFKA 1E2XA 3ULQB 2A5YB 2K4JA 3HC7A 3SHFA 3DCFA 4XL9A 4MFEA 1BR1A 1J7KA 3K4CA 3TMOA 5M5YJ 3WE2A 4ZTFA 2CU7A 4OIPF 1WH5A 3BR5A 4PGHA 4EVIA 4Y17A 2X1DA 4P55A 3Q3SA 3ZQIA 4O5VA 4ETSA 4IQ4A 2XROA 1AA7A 3BQYA 2ZSHB 4NB5A 3E6MA 1WI9A 3GZ5A 4D9JA 4BHPA 1ACIA 1H89C 1JUMA 2MG4A 4F52A 4I02A 4HV6A 3U1DA 3S3MA 2XAUA 1IN5A 3C3WA 4MO7A 4BJ5C 5M5WJ 4LB6B 3GFIA 3CJRB 2HYJA 2OTJI 3WODF 3KP3A 2EPFA 1FY7A 1SFEA 2ETHA 4LGWA 2ECBA 4EATA 3LSPA 1MBHA 1FSHA 4RMNA 1WSUA 1EJ9A 5D4SA 3PNTA 1P4WA 4PCQA 2R3SA 2L9VA 2HR3A 3A02A 1ZK8A 1IN4A 1MMGA 1LE8A 3S2HJ 4MNUA 2XPWA 1FNNA 3IRRA 2Z99A 2LBFA 5DV5A 4JBAA 3CUQC 3ZMVA 3OYGA 2QZ8A 5IOYA 4XKVA 2WB1A 4QWQA 4BE2A 2A07F 3FXQA 5D6EA 5HS9A 3HOTA 4IKFA 2BW3A 3BR0A 3SYTA 4HLYA 1TWCJ 2FMLA 1ON2A 2W00A 3EUHA 1LKXA 2WTEA 3HJEA 1R49A 2GIVA 2A68F 1JKPC 2CUFA 2ZCWA 1XMAA 2ME0A 4LB5A 4BYYA 4YIFA 4I2OA 1C0WA 2EZHA 4GDFA 1IV8A 2CW8A 3RKWA 2IS2A 1A5JA 3FXJA 1RKWA 4NHJA 3N05A 1MD0A 2B7EA 2VONA 1K79A 3F3XA 5D5XB 1RPWA 1APLC 3NQOA 1R9TJ 3S17J 1SMTA 1XGNA 1ZARA 1VQMI 1M1EB 4QSHA 3LNQA 4CCJA 2KPMA 3ZQCA 5BMZA 5J6XA 5HOOA 1PUEE 1JHFA 1IXSB 2W25A 3ZRGA 4A2UA 4ABZA 1D8KA 2EK5A 5IT3A 5D5UB 2DT5A 3JCUC 1PDNC 2XKOA 2EWNA 1TT5B 2YPRA 4CCNA 1O3QA 2LMDA 3HUGA 5F1RA 3LSKA 4LITA 2LSOA 5LGUA 1PUFB 2NNYA 2HKOA 3NEUA 3S16J 2EINH 3K6GA 1S5LC 1VI0A 3KYLA 2ZO4A 1X2MA 2MH9A 1BM9A 4JYKA 1PVEA 3QPTA 3CC4I 4Q4ZF 1WJCA 4CUGA 4D5CA 2CW0F 1EH8A 4M73A 1T8IA 3RIRA 3HRTA 2WY7Q 3VEPA 2BV6A 3KEYA 1XN7A 4L0ZB 4MFDA 1TL8A 2HQ5A 1ULYA 4MTDA 1SFOJ 1Y39A 3MZHA 4CA0A 1V5FA 1X3WB 3R0AA 1WJAA 2BOLA 3A4CA 1ZGAA 1T98A 3E97A 4C9YA 4U7DA 2E1CA 3QODA 2IJLA 3BP8A 1UJ8A 2KDOA 5DM6F 3A1YA 5EJCA 2LKXA 1ETXA 4G9YA 3B6CA 1R4NB 2L7KA 1OQYA 2UUZA 1WJDA 2IS1A 1QU3A 4CYCB 2TRTA 1G6NA 4MEYF 1ENHA 3I4NJ 1G8XA 4FT8A 2DA6A 4HRIA 4ITVA 2YX4A 4UVBA 1T95A 4B1RA 3DU5A 2XF7A 2H8RA 2GOXB 3TL4X 2KP6A 4RS8A 2ZBKA 4DBRA 1SEUA 1BI2A 1O3TA 3MZ8A 4B4CA 3ZOBA 4P1WA 3V8KA 4A3DJ 3SQNA 2PMZN 4BNCA 2J5OA 5F0HA 4IRGA 4KJZA 1YHQI 3HSEA 3FK6A 4FETA 1BC8C 3FXKA 4PJLA 4BXUA 3C7JA 2X6YA 2EH3A 1OKRA 4UB6C 3PQJA 4UVCA 4RDUA 4L18B 3I56I 2R4GA 1LUJB 4A3GJ 3E5UA 2JN6A 3F6VA 4AVZA 3I54A 2K9NA 1NH3A 3H3ZA 1Q1HA 2TDXA 1RESA 1MMNA 4JP0A 5IP6A 1HW2A 3K4KA 1N75A 1WQ2A 1SD6A 1YO5C 3LSRA 2YX7A 3OV8A 2CJJA 4P5OA 1KGSA 3FWEA 3QOEA 2WC2A 3OYHA 2NS0A 2E2HJ 1OCZH 3ABKH 1FIPA 2CGPA 2HQAA 4GGGA 4HF2A 2OA4A 3L2CA 3ZGKA 3QU3A 5FD6A 4J01A 1VQPI 1Z91A 2CFOA 1FSEA 1PP7U 4M3EA 2E2JJ 2FBKA 4ESJA 4EGZA 4IZZA 2DBBA 2AHQA 2ISYA 3HTSB 4PUSA 1KA8A 1T0FC 1T56A 3PFIA 3AL0C 1ZRFA 4LIVA 2LOOA 2XB0X 3RKYA 5ILVA 2KIQA 2QM3A 2Z16A 2E5ZA 4EJTA 1EH6A 2ESNA 5LHGA 3BR3A 9ANTA 4HOBA 3SDGA 2OZ6A 3L2UA 3BJOA 2LTPA 5K5RA 4RGSA 2E1NA 2QYOA 3FX3A 5DCMB 2KJBA 5EF6A 3E6CC 1YS7A 1QZYA 3J7ZI 1ONVA 2YR2A 2EFOA 1LFBA 2D45A 2P6TA 1LQ1A 5H20A 3OYBA 3BTCA 1WCMJ 4I99C 4AUXA 3GMEA 3VYUB 3BLYA 2G7UA 3FM3A 4DGWB 4C30A 5BPDA 2DA2A 2L01A 2B0LA 3WTUC 3GTGJ 3HGYA 3KP7A 1HOMA 4WF2A 2XSDC 4JQFA 4DQ2A 1V3FA 3ZMUA 1OCCH 2HEOA 3JRFA 4YFXF 2ZJ2A 1MH4A 4B8XA 2VKDA 4KIBA 2EZLA 3CMAI 2FEZA 2JPCA 2F5EA 3LOCA 2CQQA 4HX4A 1WI3A 5DEQA 5EGOB 4CH7A 3RDIA 2DJIA 3FISA 2KRCA 4G6DA 3HBLA 2EIJH 3IH4A 3RZDJ 2A5WA 3M9AA 2L9SA 1DU6A 1U2WA 4GRIA 3D1NI 5F08A 3T5XA 1P6RA 3K1PA 2OF7A 3AAFA 1JI8A 4P9UA 1I5ZA 1P2FA 1N25A 2IGMA 4ENMA 3JRDA 3GWZA 2DTZA 2W82A 1ZREA 2E36A 5EEHA 2D5VA 4EM0B 4M6YA 1VQ6I 3OSFA 2YSRA 3ABLH 3FZVA 1JKRC 1EA3A 2X4HA 4ZJZA 5HNFA 3JRBA 4BUPA 1G4DA 1UCRA 2A6HF 5TRDA 2MD5A 4IXAA 3WTVC 2DMNA 2GM4A 3VDXA 4A3EJ 3K4LA 2H94A 2G9WA 3V4GA 5M3FJ 4EJVA 1ZRCA 3LL7A 2NRAC 4I0BA 4BKXA 4LLLA 5CQEA 4IOCF 3I3LA 3HL2A 3BZ6A 2P4WA 1Z21A 3K10A 2VBZA 3KE2A 1MGTA 3JW4A 1IG7A 2XF5A 4XLHA 3ECHA 3WTWC 1A6IA 1UFMA 3QRFF 1OYYA 3QYEA 1IN8A 3LAPA 3W6VA 1ETVA 2KISA 4Z2YA 4PSWA 5GTIC 2QKMB 4IF4A 1TC3C 3LA7A 3RYRA 3IC7A 4UUSB 2VLAA 1Y56A 4ZZLA 3M1CA 3KP2A 4V2FA 4Y4RA 3KYDB 1HSJA 2HYFA 4KDPA 3IWFA 1QPIA 5A2QZ 2FJ1A 1T0FA 2JUGA 3BQZA 3NRVA 2I5UA 5F1JA 1IXRC 2CFXA 4CCKA 1IRXA 4M72A 4UY8I 1XX5A 2K27A 3I64A 3EPZA 4BJ6C 2QA4I 1IXCA 4L9VA 4NUBA 4E7LA 1IRFA 2R5ZB 2RAEA 3R6SA 4EJUA 1DPUA 2JWTA 3G2BA 2Q2EB 3FXOA 2O61A 5FLXZ 1ZGWA 3VOEA 1IN7A 2CMPA 4G7ZF 1IUYA 3H0GJ 3HEFA 2DYSH 5IP7J 2JQ7A 2FD5A 3BPVA 3WU1B 3OS0A 4A12A 1YFHA 2MC3A 4LD5A 4IVNA 4RB0A 3GCMA 3CJTB 2KRHA 3S2WA 1FOWA 1XGSA 5DUIA 2ZNZA 3DEUA 2DFHA 2X1EA 4CGZA 4CSWA 3GLXA 2L2OA 4RGRA 1A36A 5E8GA 2F5VA 3IH2A 5K7ZA 3BROA 1BC7C 1WPKA 1BBYA 1K6YA 4FX0A 3H3UA 1RUOA 4L5EA 2HU9A 2P0WA 2P5LC 2V1UA 2Y9ZA 5LGNA 1F36A 1TWHJ 1IV6A 2R7DA 3AG2H 2ESHA 5M5XJ 3LFUA 2ISZA 3AG3H 4XM3A 2VQGA 4F55A 3CP8A 2W84A 1Z77A 1PJRA 3B73A 4HEA2 3M1EA 1TP4A 3VB2A 5JLXA 4OMYA 3F9KA 1TZLA 3CCYA 3CUQB 4M9ZA 1YIJI 2I8DA 3CDIA 4GCVA 3CCSI 4LOCA 4JX6A 3F23A 4E7IA 2DA5A 2EIKH 3LSJA 1BA5A 2M34A 2M5WA 1HW5A 1XPXA 2JZYA 1ZN2A 4XOPA 4HSTA 2OCEA 3RZOJ 3HKZN 2HOEA 3BC8A 4U0VA 2D1HA 5KNLA 5F6FA 2R7WA 3GTLJ 4KITB 1Z6RA 1HA8A 1UHSA 2IVMA 1PUFA 3KZYA 3FDYA 2HS5A 3F8NA 3DLAA 1R5GA 4W97A 3W6JB 1QVUA 2XGEA 3MEXA 2BXZA 4L9NA 2LLKA 5GAEJ 2IS4A 4HSRA 1FBQA 4DYQA 3RYPA 2HYGD 2K3PA 2KHMA 3PNVA 4E7KA 4LLNA 4YFKF 5KAIC 3CP2A 4HV5A 1B9MA 2KIUA 3A03A 3JRIA 1F43A 5LHHA 1LB2A 4RLQA 4U0WA 2NS8A 2X51A 3L09A 6PAXA 4XRMA 2M1BA 4UNOA 4KMFA 3CCUI 5B1BH 3HXLA 5J8CA 5HODA 1V5GA 2VUMJ 1ZR2A 2V4JC 3H1CA 2BXYA 3S1NJ 2EV6A 4F3QA 1N77A 1XGMA 2F4MB 4BEHB 2RV8A 3I4PA 2H1KA 1ODDA 4UHTA 2KIFA 3PSFA 3REOA 3GF2A 3LSTA 2B9SA 1UB9A 1JJ6C 1FOKA 2DDAA 4IJAA 2Z9OA 4QTRA 4RGUA 2R7RA 3H92A 3HOUJ 1VNDA 1CQTA 4FQGA 2R5YB 2MW8A 4CYCA 1G59A 5HDGA 3K2ZA 4Q5SF 3OWTA 4B43A 1ZR4A 1WJBA 2WAFA 2ZXJA 3MQ0A 4GO1A 5LBQA 2H09A 2BHYA 4E7HA 3HHGA 4TV7A 1W5SA 2K02A 4BXFA 2E7XA 3PIPF 2EZIA 2R7QA 2LREA 3H5AA 1WJ5A 1DU0A 1SANA 3K1MA 5AIPA 3AKZA 1E3OC 1Z6TA 3IHUA 3WG9A 2PBIA 3HOZJ 2ADUA 2GIZA 2XIGA 4CYDA 2Z3YA 2I10A 4BDZA 2W48A 1JTYA 1R00A 2M8EA 4YRVA 3MKWB 2IT0A 4Q47A 2DYRH 4IHTA 1KU3A 4HAMA 5FLMJ 4XLAA 1HSTA 1WJEA 4UV9A 5C3EJ 1AKHB 4CHUA 3GTMJ 5HLIA 3CO6C 4Q48A 5AONA 2IBDA 4CCOA 2BE5F 4CCMA 1R1TA 2CO5A 2N8GA 4G94A 1NTCA 1MMAA 1SD7A 3M4OJ 3T0YA 5FKMA 2E5NA 4ZDLA 4A0YA 1D5YA 1GVDA 1FTTA 4EJOA 2CQXA 4EM1A 4ZYGA 1L3LA 4Z6YA 3GTOJ 2NVYJ 1BW6A 2K9QA 3BTJA 1Z0XA 1OR7C 1S7OA 2GQQA 4N9HA 1Y8QB 3QPHA 4B47A 2W7NA 1XDSA 5EZHA 4QIWN 4G7HF 3WTSC 1JGGA 5D8KB 4IHXA 3J7AY 4UB8C 2LF7A 5ICEA 1YQAA 3OYMA 2XAQA 2Z33A 3GTKJ 1ZYRF 1R5HA 2NVXJ 1G3SA 2IGOA 4ESFA 3HPGA 3A01B 4LLGF 2DCEA 2PMZA 1STZA 1S29A 5DCMA 4KIFA 5D5WB 3AL0B 2QSFX 2CUZA 1H9GA 1U3EM 3ERMA 3MWMA 1VQOI 1TLHB 3TKYA 1MJBA 5K5OA 2XRLA 2JA6J 1LVAA 2H1LA 3E5XA 3GVAA 3BY6A 4PK4A 4D1QA 3HSRA 1ZTRA 3NAUA 5F04A 2R7SA 1TQPA 3X2QH 1A35A 1FP1D 2RGVA 1FYLA 4IEJA 4B44A 1Q1VA 1YJWI 2MSYA 3ABUA 1HQCA 1GHCA 3F72A 3JSOA 2HNHA 2ID3A 4MLOA 4ZYAA 3DP7A 3PM1A 4AVPA 5C4JJ 1UZCA 2AQEA 3PNYA 4DNCA 4BQAA 3L2VA 2L4AA 3O8HA 1U6GA 5EGOA 2VXZA 3PJRA 4AU7A 1USSA 1YS6A 4G6QA 4DIQA 4XN3A 1D1AA 3FMQA 1JKOC 5IT9Z 1HDPA 2F2EA 4A93J 2HVQA 2X9DA 2HDWA 3WTZA 4A3BJ 3BR2A 3M8JA 1X1AA 3OL3A 1GT0C 3CJNA 5D8LB 3D5LA 4ZTJA 2R92J 2CUEA 3BR6A 3IAM2 4BY1J 5JVTA 5E1XA 5FKKA 2IP2A 3TP3A 3BCBA 3LSMA 4NC7A 3QYBA 5FFZA 1S9HA 1GXPA 2DOAA 4WXCA 2JJ7A 2WY8Q 4N4OB 1RC9A 1MNMC 3F0CA 3H9GA 5TJJA 1QA6A 1BI1A 1YIOA 2O8KA 3GTQJ 3P5JA 1IN6A 1NG6A 2MA3A 3KP4A 2GZWA 2Y69H 4BU2A 5J1UA 2A6EF 3B6AA 3OS1A 3ZQLA 1SFKA 1BIAA 1RUNA 1MBEA 3SZGA 4MTEA 3QPLA 3W2AA 1R5ID 4PFPA 1KU2A 3TOBA 1HKQA 1ZG3A 5H6RA 3JTHA 3L7WA 2JPBA 3DKXA 5HS8A 5FKLA 1X58A 5FO5A 3LMMA 2XAHA 1VQ8I 5D6FA 3GFJA 5E20A 4UUVA 1WKMA 3RSNA 1MW7A 4AC0A 3COAC 2DFEA 3CQZJ 1UAAA 3OYNA 1B8IB 2DT6A 5IYDJ 4PZJA 3TW6A 3CESA 2HXIA 1R6RA 1LEBA 4ZYHA 4ENNA 4WCGA 3HHHA 3H35A 5LEJA 1W0UA 5FGMA 5IYBJ 2QEXI 3HG9A 2M0MA 5K5QA 1TWFJ 4HNVA 2OPTA 5FLVA 5EYRA 4HLXA 3KIOA 1KONA 1OCTC 2PN6A 2MABA 3U1KA 2BY1A 2XVCA 1X3UA 1AWCA 2R5ZA 3R4KA 2XB5A 1L0OC 1K6OA 2FMYA 1BI0A 4II3A 2Z2SB 4KFCA 3ZPLA 4L0YB 3L9FA 5DDGA 2WA0A 1DQUA 2DOFA 1GXQA 2BY3A 2QKLB 1ON1A 1QHGA 1XDUA 2DT7B 2HQNA 2IA0A 1Z3XA 2O5RA 1MBGA 1VQNI 1BOAA 2HZDA 3RPUD 2LF8A 3S8PA 2CRGA 4YFNF 1SFXA 1LEAA 2CUJA 3S32A 3FHNA 1OCOH 3TOAA 4EEFG 3GTJJ 3G73A 2FXAA 2BYVE 2FE3A 4OWRB 4XRSG 4OIQF 4ENJA 4EM2A 2O03A 4CDGA 4QLCU 3MAJA 1MH3A 2NVUB 4ASNA 2XKPA 4FTHA 2RQQA 4E4HA 1O4XA 3ONQA 1K4SA 2LD5A 1QHHD 3QP5A 4CO8A 1IAWA 1LVKA 2ECCA 5JHUA 3KYCB 2AXLA 2WV0A 2L5QA 3G1MA 2E35A 2DQRA 1U9NA 5CPRB 3CUQA 3DPUA 3Q9VA 1IZ1A 3FBIB 4KIGA 3ZMTA 3ERED 4A3JJ 3K9TA 4PJMA 5FFXA 3GZ6A 2RQPA 1EV7A 5LGTA 5DS9A 3J81Z 2GWRA 3BDDA 1AU7A 3OMYA 2VOPA 3SEQA 3I53A 1YW7A 3CF2A 1GLNA 3TO7A 1TNTA 1DP7P 1UHWA 2QWWA 2ZB9A 2LNBA 2V1NA 2A69F 5B3SH 3CZ6A 3I58A 1G3WA 3PO3J 2W24A 3GLLA 5J8FA 2QCOA 3C2HA 1DGRM 1ZHFA 1H8AC 2MD0A 4LJZF 5ILUA 1MSFC 2QSHX 2FQ4A 2BEOA 2W57A 3ECOA 2STWA 5EEAA 3GFMA 2CH0A 1R23A 2HOTA 2DFIA 2QSGX 3CJQB 3EYIA 3IH3A 3Q5FA 2KFDA 3S1RJ 2CSOA 2OAZA 4XRSA 1E0EA 3BG3A 1YRNB 4XLNF 3OR2C 4A6EA 1D1BA 3P9IA 2V9KA 3ZN0A 2LY9A 2Y48A 4A3MJ 4O3MA 2P5VA 2EBIA 4L5IA 2L02A 2Q0OA 4RBOA 2B63J 3PSIA 2CG4A 4AIHA 2D2WA 2EFWA 1XG1A 1WRJA 3JSPA 1U8BA 3MVPA 4IHYA 3K2AA 4BEHA 1T2KA 1ETKA 2VKHA 4XR6A 3V7RA 1MJAA 2MFZA 4AM3A 2H6CA 4A3IJ 4YEJA 4A3FJ 2AQFA 2DQLA 4NDLA 3I55I 1ZLKA 2PJRB 1KYZA 3DV8A 4M9XA 1KQ8A 2L0KA 4RM2A 4IHWA 2R5YA 3WGIA 1H9TA 5HVQC 3J80Z 3HKZA 1VFCA 1HXDA 4FHTA 1JTXA 5H2FC 3VYRB 5J1RA 5E18F 3CC2I 1JUSA 1SVOA 2YS9A 4Y33A 4XKCA 2CS3A 3RPQA 3V8LA 3DTKA 2BHZA 2E7WA 3TW7A 2YU9J 1LDJA 3QPSA 3FXMA 1FT9A 3OY9A 2XGXA 4QPQA 3G3ZA 3CO7C 1VQ7I 2IA2A 2KT0A 1Y6IA 2NVTJ 2ELJA 2ZC2A 5ED4A 4M6VA 3S15J 2R7TA 4EQQA 3DKWA 4ENKA 1V54H 5JI6A 4HYEA 4A0XA 2AXTC 3M8FA 3KLNA 4XOTA 5TISC 2OTLI 2ZFUA 3EETA 2XV4S 3C2GA 1CF7A 1NK2P 2QQ9A 2FBIA 1VQ9I 4AD9A 3TO6A 5DYMA 1AKHA 4BAYA 5ERIA 1AHDP 2P8TA 2HTSA 2OCCH 1P9QC 3OOUA 2WBMA 1WHUA 2H8WA 4XLPF 5C4XJ 1I3AA 1ZELA 2ZJQF 1DP3A 3QWLA 3HPHA 5EG0B 2VI6A 4RLFA 1D0YA 3BJAA 1JT0A 2DMTA 4BY7J 4XICA 5J1YA 1FOXA 2VKEA 1OFCX 3RJPA 1BL0A 4XLFA 2HDDA 2E34A 3SXYA 1A04A 3W6KB 1R36A 2G7HA 2CYYA 2RREA 2HVSA 3JAMZ 2EB7A 2WAEA 4A5MA 2IEKA 2VQLA 4HF0A 3WTXC 2AO9A 2NOGA 2R7OA 2DU9A 2HTJA 2L7ZA 4M74A 2CV2A 3HRUA 4KICA 1R22A 5BNGA 1D5VA 2VE8A 2X6WA 2F5CA 3DXJF 3LSIA 2Q1ZB 2Z5UA 4AIJA 3RKQA 2MLKA 3K4MA 3A01A 2HOAA 2V26A 2D1VA 4AYBN 1I3QJ 4BGDA 3TDZC 2K40A 2KZVA 1SFUA 2HDCA 1QO0D 3Q9SA 2IRFG 4HDUA 1ZRDA 3U9GA 2PI0A 1ZAOA 2O3FA 4LIUA 2HXOA 3MD2A 3F8MA 1J5YA 3MKLA 2P6SA 2K85A 1LPQA 1X2NA 3CCJI 4J00A 3TO9A 2UV1A 1PP8F 3ZN1A 2MBFA 1D8JA 2FBHA 2QF7A 1B59A 3J7YJ 2DAOA 2EIMH 2W4SA 3MZYA 2JVGA 2VL8A 1JGSA 2XUBA 4XSXF 3OYJA 1XSXA 2VE9A 4YIIA 3E3VA 4OIOF 3P7NA 3T8RA 2JA2A 1H88C 4LG0B 1Z67A 5FROA 3N97A 4CXFA 4RB3C 3IRQA 3Q0VA 3MKYB 3CDHA 3VYTB 3F21A 1QZZA 2UXNA 4BL0B 3J81K 1O57A 1UG0A 3DWLE 2KIMA 3I5UA 4F7ZA 3H3VK 4XKWA 3PUBA 4A3LJ 2NVQJ 3M07A 1LFUP 2DN0A 3I71A 2R7UA 3RCOA 3GXOA 2HWVA 1GDTA 4Y15A 1Z05A 4ZDPA 2M4KA 2DJNA 3OIQA 2M9HA 2JA5J 1HDDC 3JR9A 4WXDA 1RETA 1T6SA 3ROUA 2PJPA 1FWZA 4DW6A 4MQ9F 5E17F 4R1HA 4RAFA 1TWAJ 1VTNC 2CQKA 2QENA 1QQIA 3F6OA 1S8NA 5F0FA 3G1OA 2Q8KA 2CV1A 4A0ZA 1O7FA 1YI2I 2V1XA 3DPLC 3Q0WA 1OCPA 1HKTA 3V7CA 2JRTA 2OUMA 3GTPJ 2HZTA 2JRMA 5LFAA 1F4KA 1OYWA 2CW7A 4I76A 4XBFA 1Y0UA 4EV0A 5D5VB 1ERDA 4IO9F 1RR8C 4HQMA 2V79A 3BG9A 1W7PD 3GEZA 4PDKA 5KK1A 2A6TA 1J2XA 3DTEA 4I01A 4BXXJ 4HX7A 2Y31A 4ZZDA 5DTDA 1SMYF 4IL6C 5ICFA 1S72I 3CLOA 2KLOA 1U8RA 4RAYA 4HDVA 4S04A 4FE7A 1B8IA 1TT0A 4M71A 2L4MA 4D0PA 2DDBA 1PYVA 3BG7A 3LA3A 4U88A 2QUFA 2L3DA 1XSVA 2VKVA 3AFHA 2DK5A 4QPOA 4LK1F 2OQRA 5FKNA 2VT2A 2VOOA 5CVUA 1POGA 3GO5A 5L3BA 3CD6I 1FMVA 2DO7A 2FRHA 1DPRA 1GV2A 3GW2A 1LJ9A 4E7ZA 4G6TB 1XCVA 2XAJA 2DMQA 1HW1A 3E7LA 1X1PA 4PFOA 4WWCA 2HGCA 1K78B 1JHHA 2LY2A 4BE1A 4OAYA 3BZCA 5JLWA 1ETQA 1V5EA 3L00A 3WTTC 4X6AJ 1S6LA 3BZKA 3C1DA 4KN7X 5JVGF 4V2GA 1SC7A 1QZEA 1A31A 5E3NA 3J7AO 1JE8A 4FX4A 4BQOA 4X0GA 2QBYB 2KQRA 3E1SA 3HTUA 3KZIC 5J47A 3A2KA 3E0JB 3SEZA 4C2MJ 1YTYA 1MMDA 4G8XA 4ZC3A 3A0BC 3DF8A 2UXXA 4OOIA 3O2PE 1FP2A 2VASA 1S7AA 2EV0A 2ZNYA 3EDPA 1U5TB 2Y0MA 4MGRA 3OYKA 5F0CA 4ESBA 2CQNA 3JRHA 2O9LA 2K5CA 1G3TA 1O7LA 3KP6A 4EJWA 2K86A 2F5DA 3VODA 2COMA 1R71A 2PMUA 1WH7A 3F8FA 1EKEA 3G6EI 1SD4A 4I6ZA 5EDNA 3ZQGA 3NARA 2LRDA 3ZR8X 2GA2A 2CQ7A 5TGTA 4KISA 2V7FA 2KDZA 3HIFA 3CLQA 2IS6A 2DOEA 3I4MJ 1IO2A 3I59B 5C44J 3IWZA 4BHCA 1USTA 1IDZA 3D5RC 1V4RA 4CZCA 1NHAA 2A61A 2E19A 5K7HA 1CGPA 3BOQA 2Y75A 5A2QK 2K9LA 1SAUA 1A6QA 2VXDA 2WV1A 4AWXB 3S1MJ 2GAUA 2EV5A 1T08B 1HF0A 4FISA 2Y0SN 3LQRA 5IP9J 1WJFA 4P96A 3FXUA 5JFRA 3LFKA 3R61A 1JUPA 3QAHA 1FYKA 5FLXK 1FC3A 3KEOA 3K1NA 2KZGA 2LY1A 3FIWA 1VF9A 5HDKA 2EA4A 3MN2A 1DGWY 2ZXHA 5CVRA 1WZ2A 1QVTA 2X6OA 2BZTA 3W3CA 1IRGA 1SVMA 3M7GA 3D5SC 2ZKZA 4A3KJ 1U78A 4DOZA 4FE4A 1SAXA 1X4PA 1MDMB 4NC8A 3PUFA 2STTA 4XSZF 1YRNA 2IGKA 1MBFA 5HLGA 2LKSA 4AIDA 2H27A 1AOYA 3MKZA 2VIXA 5K1YA 1X3ZB 2JTVA 1YOVB 1XSDA 2RDPA 4BBRJ 4KT6A 5FD5A 2LG4A 5BOXA 1VQ4I 4C2UA 4KMUX 3KPHA 2O8XA 4OIRF 3L2RA 3VYSB 2LH9A 4AIKA 5E3OA 2M7AA 2VJJA 2E2IJ 1G3YA 1U9OA 4OU0A 5EEGA 3BR1A 2V1DA 3VSLA 2PJRA 1TQMA 2PLYA 5BPIA 2HOSA 2M87A 4PGGA 1J75A 1BR2A 4D5FA 3DTIA 1J0RA 1P4AA 4RGXA 2XASA 3HRMA 3CCRI 2YU3A 4N4NB 5IPAA 3CCQI 3S14J 2XDVA 4E6KG 2NAZA 2L9RA 1I27A 5KCMA 4O6JA 2HFHA 5GADJ 1EH7A 5LRRA 2XAGA 1E17A 4DZJA 1YITI 4HBLA 2M4GA 4M9SA 3TEDA 1TNSA 2ME6A 1JKQC 4U87A 2XC7A 2JK3A 4XLEA 3H36A 2QGUA 3HOVJ 1MMSA 1MIJA 3FK7A 3F8BA 1NG7A 3GZNB 3H9QA 2XHKA 1R7JA 4XORA 3LSHA 1XTAA 3Q0UA 4FASD 2EJRA 1WFXA 3P9KA 3BG6A 3WGGA 3HZJA 2E1MB 2NYXA 2MYSA 5L3EA 3KCCA 3RTRA 3FMRA 2GXBA 4RB2C 5KAFC 3BJ6A 2DPUA 4I0AA 4ZDOA 4WK8F 3HGGA 4IRHA 3ZCOA 4LFUA 3G71I 3EYYA 5KHDA 1YLFA 1TTYA 2GA1A 5DUKA 1YJ9I 4M3DA 1K7AA 3EUKL 3ZMSA 3WGHA 2GLOA 3OOPA 5EG0A 1JJ8C 2XAFA 4H0EA 1FPQA 1XGOA 4R79A 3CC7I 2Y30A 3DBRB 2F4IA 3SZTA 3V7SA 3ZQHA 2GXGA 2R7ZJ 3C2BA 1F1ZA 5J4VA 1W7PB 1MBKA 3M3YJ 2G0EA 2JMWA 3KFWX 2IXSA 3K4NA 3OSGA 4A6DA 3SJMA 4HA8A 1KYWA 4WXHA 5ICCA 4C2TA 3QQAA 5KVRA 2VPLA 1R1UA 1GVJA 4LK0F 3LWFA 3DBHB 3K70C 5GAGJ 3E5QA 5E8IA 5M3MJ 3RI4A 1IGNA 4UUSA 3FMSA 4OAZA 3SZPA 5BS6A 1YE9A 2QQBA 2TCTA 2FOKA 3E6DA 5DD8A 1OR7A 2Y2ZA 4A69C 3K69A 1T39A 2WAQN 2UZKA 4CZZA 2FSWA 4HNTA 3GX4X 4EMSA 3N4MA 5AIQA 3KETA 5CVVA 1HC8A 2H6BA 2DLLA 2Q2EA 4KNYA 4HQEA 4L5JA 2EILH 3BWGA 1TQIA 3CCVI 3AG4H 1O3RA 1U5TC 2JA7J 3CMMA 3CTAA 1TWGJ 3SFZA 5GTHC 1B72B 2DFFA 2ID6A 4CICA 2GOMA 3SDBA 4ZH4F 1FMWA 3O3KA 1FYMA 3IKTA 4HX8A 1ZLJA 2VJIA 4UXNA 1REPC 2R7FA 2V9VA 2VODA 3VFZA 2MLGA 2Y9YA 3IP4B 2OJED 2CWEA 1J09A 2K3FA 4BDYA 2IA1A 1IC8A 2BY2A 2JT1A 1WVRA 2JSPA 4LG0A 3RPUA 3H0DA 3BG5A 2Z1DA 5J40A 2X48A 4Y7NJ 2VC1A 4U7BA 3OYCA 1FZPB 3CCLI 2VN2A 1KQ0A 1OCRH 2ZJPF 2CV0A 2XRNA 4NQWB 1SVLA 1Y1VJ 2JVHA 2V6CA 5JHFA 4BQQA 2COBA 4IHVA 2EZKA 2A05A 4F91B 1GUUA 2EFQA 4CCLA 4KA4A 5F64A 2NXNB 2DTRA 1IF1A 3SFIA 3ZMDA 2BVMA 4AYBA 2O7OA 1IJWC 3S2DJ 1WWXA 4N9IA 5J3LA 5HDNA 2IGNA 3VSKA 3QOPA 2X0LA 1Z9CA 4W1UA 5L3DA 1MZBA 3MCZA 1VQKI 2BY0A 3PFYA 2F5FA 1TW3A 2KMUA 3BTLA 4DBQA 3JREA 4X1EA 3RKXA 3FKIJ 3ASNH 1K4TA 2J5PA 3F8CA 3T1BA 3PIOF 2IPQX 1W4MA 4OMZA 3R60A 2ZMEB 3RQ4A 1XMKA 1QPMA 1Y1WJ 2L7FP 4BS9A 3ZXSA 4BE0A 4PSXA 5E3LA 2W1OA 3W2VA 4RA2A 3LA2A 5FRNA 2F4OB 5HNHA 1BW5A 1VQ5I 1FTZA 2V9PA 2DMUA 1Z7UA 1YYVA 2KKOA 4RAZA 5ILSA 3F22A 1I6HJ 2DXIA 3HM5A 2M0CA 3KEQA 3OYIA 3MMYB 1X4OA 2DA7A 1IRZA 5CJ9A 1GV5A 1T33A 1W1WE 5DD4A 2MGQA 3HB9A 2F6CA 2R7XA 4NBQA 2DA1A 3VPRA 3ML6A 1H0MA 2LYCA 5D4RA 1ZQ3P 3C18A 5FB2A 2OC6A 2VC0A 4YG2F 3G4SI 1TW2A 5IOZA 2WB1N 3K70D 2ACJA 3M8EA 2XSJC 5GP9A 1UELB 1QBJA 3S1QJ 2WWYA 1KU7A 5IT9K 1LDKB 4MHGA 5BQTA 4N0BA 2VQHA 2VJ5A 1K78A 2W85A 1MSEC 2KRFA 2R93J 2E60A 1E3HA 1SD5A 1ETOA 4HW0A 1Z1DA 1I39A 1HBXG 4NNJA 3BPXA 3NWTA 4L9JA 4HF1A 1KU9A 2PMHA 4UUTA 3P9CA 3UR3C 1HKSA 2VPRA 1X1DA 1DDNA 3IKVA 1K61A 1X1BA 3DU6A 1XC5A 3WHCA 2R7VA 2QBYA 2R0QC 3KLOA 4J19A 3UNGC 3LSGA 3HSFA 2X85A 4EGYA 2O6GE 3H9JA 3IAS2 2LR8A 5E3MA 3HOYJ 2DA4A 3FKJA 1HLVA 1K83J 3VWBA 3PO2J 1D0XA 2M30A 3TP0A 3BT9A 2A3SA 4BBSJ 1RIOH 3I0TA 2E1MC 5L3CA 1S7EA 4HNUA 1Y0NA 3LAJA 3LQQA 4I7HA 1E3PA 4B09A 1RI7A 4ON0A 2M2EA 1U5TA 2L7MP 2DODA 2VB6A 3V8JA 1J9IA 5DM7F 1S3JA 1X1CA 1TBXA 3IL2A 1LE8B 4XQFA 3DBLB 3DKYA 1UMQA 4XK4A 2LBFB 5GPCA 1XD7A 4RB1A 3V42A 2PFBA 1MJ9A 4XIDA 3S93A 2UWMA 2XPVA 3CCEI 3KZZA 1I1GA 4B3XA 3HOWJ 4PJNA 4RM3A 2BW3B 1RR7A 4XONA 3T8TA 1F5TA 2FQ3A 2V6EA 3RQIA 3TBIA 2NNNA 3I59A 1KZHA 4KN4X 3OYAA 3DPTA 1J59A 1BIBA 2QVOA 4HG2A 1VZ0A 3HOXJ 2LFBA 3FXLA 4C3IJ 3K7AJ 4DJAA 1HCRA 2HPMA 1ZH5A 2PG4A 4DZPA
chains in the Genus database with same CATH topology
4FETA 2HNHA 4MLOA 3OR1C 4PJLA 4ZYAA 1FMVA 2ZSIB 2X6YA 2AQEA 3PNYA 3OYLA 3L2VA 2R4GA 4AVZA 4E7ZA 4G6TB 2HPIA 4PFOA 1N78A 2VXZA 3PJRA 4AU7A 2LY2A 4BE1A 4OAYA 3HUGB 1MMNA 2X1CA 1V5EA 1YX5A 3K4KA 4XN3A 4XNFA 4DIQA 1N75A 1D1AA 2HVQA 4P5OA 2HDWA 2KL4A 3OYEA 3QOEA 3OYHA 4E7SA 3M8JA 1X1AA 2OV7A 3OL3A 2HQAA 4BQOA 4X0GA 3ZGKA 3D5LA 2KQRA 3E1SA 4BQNA 4ZTJA 3IAM2 4J01A 3A2KA 3E0JB 3SEZA 1MMDA 2CFOA 3BCBA 3LSMA 4NC7A 3QYBA 4ZC3A 1S9HA 2K9MA 2DOAA 3NWSA 2M7BA 2WY8Q 4N4OB 4IZZA 3H9GA 4HPQA 4PUSA 1LFPA 3FBNB 1T0FC 2VASA 3AL0C 1NG6A 1W36C 4LIVA 2LOOA 4BU2A 3OIPA 3OYKA 4ANJA 2Z16A 3OS1A 1BR4A 1SFKA 2E5ZA 2K5CA 4JOMA 1X19A 2MC4A 3H5NA 3SZGA 3W2AA 4PFPA 3L2UA 3DKXA 4XLCA 1Z7LA 2Y0SA 3LMMA 3DQVC 1MNEA 2LRDA 3ZR8X 3RSNA 1MW7A 3OYBA 5TGTA 4KISA 2V7FA 3VYUB 3OYDA 3BLYA 2IS6A 1UAAA 4DGWB 3OYNA 4C30A 2DT6A 4BJTA 3D5RC 4CZCA 3CESA 1R6RA 4JQFA 2K9LA 3H35A 1SAUA 2VXDA 1D0ZA 4XKBA 3HG9A 2M0MA 1U0JA 3IUOA 4BACA 2VKDA 4B48A 3OYFA 1WJFA 4YELA 1KONA 2LY1A 2MABA 4CH7A 2DJIA 2KRCA 1DGWY 2ZXHA 4PJJA 2LC2A 4IX7A 3W3CA 4XMYA 3ZQQA 3L2QA 2XF6A 2X6XA 2A5WA 3D5SC 4II3A 2Z2SB 2L9SA 4GRIA 2WA0A 1DQUA 4DOZA 2QKLB 1QHGA 2DT7B 1X4PA 1Z3XA 1JI8A 4F92B 4NC8A 2O5RA 2IGMA 2IGKA 2HZDA 3RPUD 3S8PA 3MKZA 2VIXA 3S32A 2CUJA 2W82A 3FHNA 3EUAA 4KT6A 2LG4A 3BCAA 4OWRB 4C2UA 1EA3A 4ZJZA 3L2RA 5HNFA 3VYSB 4BUPA 2LH9A 5LD2C 2M7AA 2VJJA 3GBGA 3VSLA 2PJRA 3VDXA 2RNGA 3K4LA 3S3OA 4Y3OA 1BR2A 2RQQA 3DTIA 4E4HA 3ONQA 3LL7A 1QHHD 3W2WA 5CQEA 3S3NA 4N4NB 1LVKA 2XDVA 3I3LA 4E6KG 3HL2A 1Z21A 3K10A 2L5QA 2M3AA 5KCMA 5CPRB 2XF5A 4XLHA 3DPUA 4IQJA 2M4GA 3FBIB 3QYEA 2NOJB 4PJMA 4U87A 2XC7A 4PSWA 4XLEA 2QKMB 4F93B 3OMYA 3SEQA 3H9QA 4XORA 1NG7A 1W36D 2BVLA 3CF2A 1Y56A 4H4KC 1GLNA 3LSHA 3M1CA 4FASD 2VLAA 4Y4RA 5CKTA 1WFXA 3HOSA 3BG6A 2V1NA 2E1MB 3DEEA 2MYSA 3CZ6A 3OL4A 2JUGA 1Z3YA 3RTRA 4CCKA 3EUHC 1IRXA 3C2HA 1DGRM 4ZDOA 3EPZA 3ZCOA 4BJ6C 2MD0A 4NUBA 4E7LA 5KHDA 3G2BA 2Q2EB 3L2WA 4LG3A 3EUKL 2CH0A 2CMPA 3OS2A 2FUG2 3CJQB 3K4JA 3OS0A 4R79A 1YX3A 3PL8A 2F4IA 3U21A 2WAQA 1BOBA 1E0EA 3OR2C 1D1BA 2KRHA 2V9KA 2ZXIA 2WADA 2IXSA 3K4NA 2X1EA 2VJ4A 4CSWA 3I9V2 3PSIA 2L2OA 4C2TA 3KX2A 4XN0A 2VPLA 3K70C 2HVRA 2F5VA 4BEHA 2VKHA 2L9NA 4XR6A 1K6YA 2MFZA 4OAZA 4E7JA 4YEJA 1YE9A 2AQFA 2HU9A 2P0WA 4II2A 2PJRB 4RM2A 2VQCA 1MNDA 3LFUA 3QYFA 5FRMA 4XM3A 2VQGA 4F55A 5HVQC 3CP8A 3H5RA 3HKZA 4HNTA 3VYRB 1PJRA 4HEA2 3K4BA 4Y33A 4XKCA 1D1CA 2CS3A 3F9KA 5CQGA 3DTKA 1TZLA 2I8DA 3OY9A 3CMMA 4QPQA 4E7IA 1OLTA 5HLTA 1Y6IA 2GOMA 3SDBA 1FMWA 2VJIA 2ELJA 4XOPA 4HSTA 3IP4B 3HC7A 4XL9A 1J09A 4BDYA 2R7TA 3BC8A 2JSPA 1BR1A 3K4CA 3TMOA 5KNLA 3H0DA 2Z1DA 2R7WA 4ZTFA 4XOTA 4U7BA 4KITB 3OYCA 2ZFUA 2CV0A 1HA8A 3C2GA 2X1DA 4NQWB 3FDYA 2JVHA 3DLAA 5JHFA 4IQ4A 4BQQA 1P9QC 3OOUA 1AA7A 4F91B 2WBMA 2ZSHB 2IS4A 4HSRA 4CCLA 4D9JA 1ZELA 1DP3A 2KHMA 2K3PA 3PNVA 4F52A 3HPHA 2BVMA 4E7KA 3S3MA 4AYBA 4RLFA 1D0YA 2XAUA 3CP2A 4BJ5C 2IGNA 3VSKA 4XLFA 3CJRB 4RLQA 3PFYA 2X51A 4DBQA 2KMUA 2RREA 2HVSA 4EATA 2WAEA 2VQLA 4RMNA 3HXLA 1V5GA 2R7OA 2V4JC 2CV2A 3PNTA 4F3QA 1N77A 2X6WA 3RQ4A 4BEHB 1MMGA 3LSIA 2Q1ZB 3PSFA 3K4MA 4BS9A 2LBFA 2V26A 3ZXSA 4BE0A 4PSXA 2R7RA 3OYGA 2W1OA 3W2VA 4BGDA 4XKVA 2WB1A 4BE2A 5FRNA 5HNHA 2KZVA 1G59A 3HOTA 4IKFA 2BW3A 3SYTA 2W00A 3OWTA 1LKXA 4B43A 2DXIA 1WJBA 2WAFA 3OYIA 3MMYB 1X4OA 4E7HA 4LIUA 3MD2A 4BXFA 2CW8A 2F6CA 2IS2A 2R7QA 2LREA 3H5AA 2R7XA 1WJ5A 3N05A 4J00A 2UV1A 2LYCA 3AKZA 2W4SA 2JVGA 2OC6A 2VL8A 3OYJA 3K70D 2XSJC 4CCJA 1UELB 2KPMA 4BDZA 1LDKB 5HOOA 3ZRGA 4YRVA 2JA2A 3MKWB 2VQHA 2VJ5A 5FROA 4CCNA 4XLAA 2E60A 3LSKA 4LITA 3MKYB 1WJEA 3VYTB 4BL0B 4NNJA 1UG0A 3DWLE 3K6GA 3NWTA 4XKWA 3PUBA 3KYLA 3UR3C 4CCOA 4CCMA 2R7UA 3RCOA 1X1DA 1MMAA 1X1BA 3DU6A 2R7VA 1WJCA 4CUGA 4ZDPA 2M4KA 3OIQA 2E5NA 4ZDLA 3UNGC 3LSGA 2X85A 3H9JA 3IAS2 2WY7Q 3FKJA 3VWBA 1D0XA 3KEYA 1OR7C 2E1MC 4HNUA 4B47A 2CV1A 2W7NA 4CA0A 1V5FA 2VB6A 3DPLC 1WJAA 2BOLA 3A4CA 3J7AY 3OYMA 1X1CA 2OUMA 4C9YA 4XQFA 3QODA 2IGOA 3DKYA 3HPGA 2CW7A 1ERDA 2KDOA 2LBFB 3A1YA 2DCEA 2PMZA 3V42A 2L7KA 3S93A 2UWMA 2UUZA 4B3XA 3AL0B 4PJNA 1WJDA 4RM3A 2IS1A 1QU3A 2A6TA 2CUZA 3DTEA 2BW3B 4XONA 1G8XA 4HRIA 4ITVA 2V6EA 2KLOA 1T95A 3TBIA 4PK4A 3DU5A 4D1QA 2XF7A 1TT0A 3OYAA 3DPTA 2GOXB 3TL4X 2KP6A 2R7SA 4HG2A 1VZ0A 4DBRA 1PYVA 3BG7A 4DJAA 5LFAA 2HPMA 3AFHA 4P1WA 4QPOA 4B44A 4KJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7K A; 
#chains in the Genus database with same CATH topology
 2LDU A;  3OR1 C;  4A5N A;  3E6B A;  1FEX A;  4A3C J;  2ZSI B;  2F48 A;  3OYL A;  1ZGJ A;  2IAI A;  2HI3 A;  3WTY C;  2HPI A;  1N78 A;  4PJ0 C;  1I50 J;  1P7I A;  1B4A A;  1DUX C;  1B6A A;  2MH2 A;  3WU0 A;  1R4M B;  3HUG B;  1QGP A;  2X1C A;  1OJL A;  1YX5 A;  1VQL I;  4XNF A;  2YUS A;  5J4Y A;  5LEK A;  2JSC A;  2HQR A;  4WX9 A;  2BGC A;  3ESW B;  2KL4 A;  3OYE A;  1QRY A;  1NK3 P;  5CLS A;  4E7S A;  1V55 H;  2FA5 A;  5B5E C;  2OV7 A;  3TGN A;  3JRC A;  1RKT A;  1I6X A;  2LK2 A;  1MDM A;  4I09 A;  4BQN A;  5IY5 H;  2K9S A;  3ABT A;  3FM5 A;  4KT5 C;  4DYC A;  2HKX A;  2FNP A;  1ZG5 A;  2K9M A;  3NWS A;  2M7B A;  3WHB A;  4M3G A;  4S0H B;  2OD5 A;  4HPQ A;  1LFP A;  2ELH A;  3FBN B;  4IHS A;  2FOW A;  1W36 C;  3L1P A;  4ZYD A;  4IOA F;  3OIP A;  2P5K A;  4ANJ A;  4IRI A;  5DCF A;  1BR4 A;  2FX0 A;  3CME I;  1UHM A;  1W5C C;  1XMX A;  4BHB A;  4JOM A;  5B1A H;  1X19 A;  2MC4 A;  3H5N A;  4M3B A;  2P7C B;  3UKG A;  3HRS A;  2ZXW H;  1I1S A;  1FLI A;  4DYR A;  1BI3 A;  2M45 A;  2ELK A;  5FKO A;  4XLC A;  1Z7L A;  2Y0S A;  4K2E A;  4GFB A;  3DQV C;  3O6B B;  1MNE A;  3B02 A;  2NS7 A;  4M3F A;  4MEX F;  2EFP A;  1IW7 F;  4ZYE A;  2FF4 A;  1BJA A;  1KQ9 A;  2GBY A;  2LP0 A;  3OYD A;  1FIA A;  4BJT A;  3ISP A;  4LMY A;  3FHZ A;  2ZME C;  3ZQ7 A;  2LKP A;  4BH9 A;  1D0Z A;  2EFN A;  2RNJ A;  3GFL A;  4XKB A;  1Y8R B;  2DPD A;  2E1O A;  1OIS A;  1U0J A;  3IUO A;  4BAC A;  3EQL F;  4NC6 A;  4B48 A;  3OYF A;  2VBX A;  4V19 K;  2RKH A;  4YEL A;  2RVC A;  1R1V A;  1B9N A;  5GPA A;  2JUC A;  3QP6 A;  1ETY A;  3ASO H;  1FJL A;  1RRJ A;  1IDY A;  5E1Z B;  3CDL A;  4XRF A;  1P4X A;  4B3A A;  1BJZ A;  2M8G X;  3A0H C;  4PJJ A;  2P81 A;  2LC2 A;  4UVA A;  4YIR X;  4IX7 A;  2DW4 A;  1W0T A;  1OPC A;  4XMY A;  3ZQQ A;  3L2Q A;  3ZP5 A;  1EF4 A;  2XF6 A;  5CYV A;  2X6X A;  4G7O F;  1LDD A;  5IYC J;  2O0Y A;  1FOY A;  1UG2 A;  2FU4 A;  1LNW A;  3FXR A;  4F92 B;  3ABM H;  2GXA A;  1W7P A;  1R58 A;  3ELK A;  2ZJR F;  4IPA A;  5H6Q A;  1WGX A;  2XPU A;  3EUA A;  3JRA A;  1JXS A;  3BCA A;  3ZQF A;  1ORK A;  2PX9 A;  1T38 A;  3WE3 A;  1O3S A;  4R8H A;  5JR3 A;  2PQ8 A;  5LD2 C;  1FX7 A;  3J80 K;  4D7N A;  5E1W A;  3GBG A;  2KJC A;  1OMI A;  2XGC A;  2OQG A;  2RNG A;  3CMY A;  3S3O A;  4Y3O A;  1YG2 A;  2K7L A;  3WU2 C;  4Y52 J;  1ETW A;  3W2W A;  5CVJ A;  3S3N A;  1MKM A;  4MQV A;  4GYG A;  2QLZ A;  4HZF A;  2OBP A;  2M3A A;  3G1L A;  1ZG1 A;  5GAH J;  1ZKG A;  4IQJ A;  1XS9 A;  4L9T A;  4U0Y A;  2NOJ B;  3KP5 A;  1B72 A;  1RZ4 A;  3PQK A;  3U2R A;  2AS5 F;  2P7V B;  4M6X A;  4F93 B;  2DMP A;  1FBS A;  2RC4 A;  3TQN A;  5HS7 A;  2C6Y A;  2XGD A;  1W36 D;  2BVL A;  1JT6 A;  1XCB A;  2PEX A;  4H4K C;  3IV5 A;  1MBJ A;  5CKT A;  3D0S A;  3HOS A;  5L3F A;  3DEE A;  4D7M A;  2VT3 A;  3OL4 A;  1YJN I;  1Z3Y A;  3JTG A;  4Y13 A;  4KYW A;  1YW8 A;  2VBY A;  3EUH C;  2ICW G;  5LHI A;  1P92 A;  4NQW A;  2EA2 A;  3GUD A;  4P9F A;  1FBU A;  3CCM I;  2DI3 A;  3L2W A;  3CF5 F;  4LG3 A;  3FF5 A;  4G12 A;  4E70 A;  3HDD A;  1YW9 A;  4C3J J;  3OS2 A;  4S05 A;  2FUG 2;  1W5T A;  3DEW A;  3K4J A;  2ZFW A;  3K0L A;  3JAM K;  1F9N A;  1YX3 A;  2BBY A;  3PL8 A;  2K4B A;  3U21 A;  2WAQ A;  1BOB A;  3DLL F;  1P7J A;  2OU2 A;  3HYI A;  2ZXI A;  2WAD A;  2EQR A;  5F27 A;  1D3Y A;  3ZMZ A;  5LLQ A;  1G2H A;  2VJ4 A;  3I9V 2;  5EZG A;  4I98 B;  4FCY A;  2DK8 A;  3KX2 A;  4XN0 A;  3WG7 H;  1QNT A;  2HVR A;  5B66 C;  4KUM A;  3OIO A;  2ZME A;  4MIM A;  2DA3 A;  2JA8 J;  2L9N A;  2L54 A;  4E7J A;  2QQA A;  1CF7 B;  2E71 A;  4II2 A;  5CVI A;  3CUO A;  5LRS A;  4GYI A;  1RNL A;  3DFG A;  5L3G A;  2VQC A;  3BTI A;  1MND A;  3O8G A;  3QYF A;  4UV8 A;  5FRM A;  5E79 C;  3H5R A;  2IW5 A;  1BN5 A;  1ITY A;  3QU6 A;  2QQ8 A;  2VBW A;  4OIN F;  3JRG A;  3AG1 H;  3K4B A;  1D1C A;  1XB4 A;  3GYH X;  5CQG A;  4C3H J;  4JX5 A;  4RAG A;  5FJ8 J;  4JK1 X;  2RN7 A;  1OYI A;  4JX4 A;  4GXO A;  2LVS A;  1IUF A;  3TDU C;  2FNA A;  1OLT A;  2OZU A;  3R0J A;  5HLH A;  5HLT A;  5ICG A;  5K7F A;  1B1B A;  3MFK A;  1E2X A;  3ULQ B;  2A5Y B;  2K4J A;  3HC7 A;  3SHF A;  3DCF A;  4XL9 A;  4MFE A;  1BR1 A;  1J7K A;  3K4C A;  3TMO A;  5M5Y J;  3WE2 A;  4ZTF A;  2CU7 A;  4OIP F;  1WH5 A;  3BR5 A;  4PGH A;  4EVI A;  4Y17 A;  2X1D A;  4P55 A;  3Q3S A;  3ZQI A;  4O5V A;  4ETS A;  4IQ4 A;  2XRO A;  1AA7 A;  3BQY A;  2ZSH B;  4NB5 A;  3E6M A;  1WI9 A;  3GZ5 A;  4D9J A;  4BHP A;  1ACI A;  1H89 C;  1JUM A;  2MG4 A;  4F52 A;  4I02 A;  4HV6 A;  3U1D A;  3S3M A;  2XAU A;  1IN5 A;  3C3W A;  4MO7 A;  4BJ5 C;  5M5W J;  4LB6 B;  3GFI A;  3CJR B;  2HYJ A;  2OTJ I;  3WOD F;  3KP3 A;  2EPF A;  1FY7 A;  1SFE A;  2ETH A;  4LGW A;  2ECB A;  4EAT A;  3LSP A;  1MBH A;  1FSH A;  4RMN A;  1WSU A;  1EJ9 A;  5D4S A;  3PNT A;  1P4W A;  4PCQ A;  2R3S A;  2L9V A;  2HR3 A;  3A02 A;  1ZK8 A;  1IN4 A;  1MMG A;  1LE8 A;  3S2H J;  4MNU A;  2XPW A;  1FNN A;  3IRR A;  2Z99 A;  2LBF A;  5DV5 A;  4JBA A;  3CUQ C;  3ZMV A;  3OYG A;  2QZ8 A;  5IOY A;  4XKV A;  2WB1 A;  4QWQ A;  4BE2 A;  2A07 F;  3FXQ A;  5D6E A;  5HS9 A;  3HOT A;  4IKF A;  2BW3 A;  3BR0 A;  3SYT A;  4HLY A;  1TWC J;  2FML A;  1ON2 A;  2W00 A;  3EUH A;  1LKX A;  2WTE A;  3HJE A;  1R49 A;  2GIV A;  2A68 F;  1JKP C;  2CUF A;  2ZCW A;  1XMA A;  2ME0 A;  4LB5 A;  4BYY A;  4YIF A;  4I2O A;  1C0W A;  2EZH A;  4GDF A;  1IV8 A;  2CW8 A;  3RKW A;  2IS2 A;  1A5J A;  3FXJ A;  1RKW A;  4NHJ A;  3N05 A;  1MD0 A;  2B7E A;  2VON A;  1K79 A;  3F3X A;  5D5X B;  1RPW A;  1APL C;  3NQO A;  1R9T J;  3S17 J;  1SMT A;  1XGN A;  1ZAR A;  1VQM I;  1M1E B;  4QSH A;  3LNQ A;  4CCJ A;  2KPM A;  3ZQC A;  5BMZ A;  5J6X A;  5HOO A;  1PUE E;  1JHF A;  1IXS B;  2W25 A;  3ZRG A;  4A2U A;  4ABZ A;  1D8K A;  2EK5 A;  5IT3 A;  5D5U B;  2DT5 A;  3JCU C;  1PDN C;  2XKO A;  2EWN A;  1TT5 B;  2YPR A;  4CCN A;  1O3Q A;  2LMD A;  3HUG A;  5F1R A;  3LSK A;  4LIT A;  2LSO A;  5LGU A;  1PUF B;  2NNY A;  2HKO A;  3NEU A;  3S16 J;  2EIN H;  3K6G A;  1S5L C;  1VI0 A;  3KYL A;  2ZO4 A;  1X2M A;  2MH9 A;  1BM9 A;  4JYK A;  1PVE A;  3QPT A;  3CC4 I;  4Q4Z F;  1WJC A;  4CUG A;  4D5C A;  2CW0 F;  1EH8 A;  4M73 A;  1T8I A;  3RIR A;  3HRT A;  2WY7 Q;  3VEP A;  2BV6 A;  3KEY A;  1XN7 A;  4L0Z B;  4MFD A;  1TL8 A;  2HQ5 A;  1ULY A;  4MTD A;  1SFO J;  1Y39 A;  3MZH A;  4CA0 A;  1V5F A;  1X3W B;  3R0A A;  1WJA A;  2BOL A;  3A4C A;  1ZGA A;  1T98 A;  3E97 A;  4C9Y A;  4U7D A;  2E1C A;  3QOD A;  2IJL A;  3BP8 A;  1UJ8 A;  2KDO A;  5DM6 F;  3A1Y A;  5EJC A;  2LKX A;  1ETX A;  4G9Y A;  3B6C A;  1R4N B;  2L7K A;  1OQY A;  2UUZ A;  1WJD A;  2IS1 A;  1QU3 A;  4CYC B;  2TRT A;  1G6N A;  4MEY F;  1ENH A;  3I4N J;  1G8X A;  4FT8 A;  2DA6 A;  4HRI A;  4ITV A;  2YX4 A;  4UVB A;  1T95 A;  4B1R A;  3DU5 A;  2XF7 A;  2H8R A;  2GOX B;  3TL4 X;  2KP6 A;  4RS8 A;  2ZBK A;  4DBR A;  1SEU A;  1BI2 A;  1O3T A;  3MZ8 A;  4B4C A;  3ZOB A;  4P1W A;  3V8K A;  4A3D J;  3SQN A;  2PMZ N;  4BNC A;  2J5O A;  5F0H A;  4IRG A;  4KJZ A;  1YHQ I;  3HSE A;  3FK6 A;  4FET A;  1BC8 C;  3FXK A;  4PJL A;  4BXU A;  3C7J A;  2X6Y A;  2EH3 A;  1OKR A;  4UB6 C;  3PQJ A;  4UVC A;  4RDU A;  4L18 B;  3I56 I;  2R4G A;  1LUJ B;  4A3G J;  3E5U A;  2JN6 A;  3F6V A;  4AVZ A;  3I54 A;  2K9N A;  1NH3 A;  3H3Z A;  1Q1H A;  2TDX A;  1RES A;  1MMN A;  4JP0 A;  5IP6 A;  1HW2 A;  3K4K A;  1N75 A;  1WQ2 A;  1SD6 A;  1YO5 C;  3LSR A;  2YX7 A;  3OV8 A;  2CJJ A;  4P5O A;  1KGS A;  3FWE A;  3QOE A;  2WC2 A;  3OYH A;  2NS0 A;  2E2H J;  1OCZ H;  3ABK H;  1FIP A;  2CGP A;  2HQA A;  4GGG A;  4HF2 A;  2OA4 A;  3L2C A;  3ZGK A;  3QU3 A;  5FD6 A;  4J01 A;  1VQP I;  1Z91 A;  2CFO A;  1FSE A;  1PP7 U;  4M3E A;  2E2J J;  2FBK A;  4ESJ A;  4EGZ A;  4IZZ A;  2DBB A;  2AHQ A;  2ISY A;  3HTS B;  4PUS A;  1KA8 A;  1T0F C;  1T56 A;  3PFI A;  3AL0 C;  1ZRF A;  4LIV A;  2LOO A;  2XB0 X;  3RKY A;  5ILV A;  2KIQ A;  2QM3 A;  2Z16 A;  2E5Z A;  4EJT A;  1EH6 A;  2ESN A;  5LHG A;  3BR3 A;  9ANT A;  4HOB A;  3SDG A;  2OZ6 A;  3L2U A;  3BJO A;  2LTP A;  5K5R A;  4RGS A;  2E1N A;  2QYO A;  3FX3 A;  5DCM B;  2KJB A;  5EF6 A;  3E6C C;  1YS7 A;  1QZY A;  3J7Z I;  1ONV A;  2YR2 A;  2EFO A;  1LFB A;  2D45 A;  2P6T A;  1LQ1 A;  5H20 A;  3OYB A;  3BTC A;  1WCM J;  4I99 C;  4AUX A;  3GME A;  3VYU B;  3BLY A;  2G7U A;  3FM3 A;  4DGW B;  4C30 A;  5BPD A;  2DA2 A;  2L01 A;  2B0L A;  3WTU C;  3GTG J;  3HGY A;  3KP7 A;  1HOM A;  4WF2 A;  2XSD C;  4JQF A;  4DQ2 A;  1V3F A;  3ZMU A;  1OCC H;  2HEO A;  3JRF A;  4YFX F;  2ZJ2 A;  1MH4 A;  4B8X A;  2VKD A;  4KIB A;  2EZL A;  3CMA I;  2FEZ A;  2JPC A;  2F5E A;  3LOC A;  2CQQ A;  4HX4 A;  1WI3 A;  5DEQ A;  5EGO B;  4CH7 A;  3RDI A;  2DJI A;  3FIS A;  2KRC A;  4G6D A;  3HBL A;  2EIJ H;  3IH4 A;  3RZD J;  2A5W A;  3M9A A;  2L9S A;  1DU6 A;  1U2W A;  4GRI A;  3D1N I;  5F08 A;  3T5X A;  1P6R A;  3K1P A;  2OF7 A;  3AAF A;  1JI8 A;  4P9U A;  1I5Z A;  1P2F A;  1N25 A;  2IGM A;  4ENM A;  3JRD A;  3GWZ A;  2DTZ A;  2W82 A;  1ZRE A;  2E36 A;  5EEH A;  2D5V A;  4EM0 B;  4M6Y A;  1VQ6 I;  3OSF A;  2YSR A;  3ABL H;  3FZV A;  1JKR C;  1EA3 A;  2X4H A;  4ZJZ A;  5HNF A;  3JRB A;  4BUP A;  1G4D A;  1UCR A;  2A6H F;  5TRD A;  2MD5 A;  4IXA A;  3WTV C;  2DMN A;  2GM4 A;  3VDX A;  4A3E J;  3K4L A;  2H94 A;  2G9W A;  3V4G A;  5M3F J;  4EJV A;  1ZRC A;  3LL7 A;  2NRA C;  4I0B A;  4BKX A;  4LLL A;  5CQE A;  4IOC F;  3I3L A;  3HL2 A;  3BZ6 A;  2P4W A;  1Z21 A;  3K10 A;  2VBZ A;  3KE2 A;  1MGT A;  3JW4 A;  1IG7 A;  2XF5 A;  4XLH A;  3ECH A;  3WTW C;  1A6I A;  1UFM A;  3QRF F;  1OYY A;  3QYE A;  1IN8 A;  3LAP A;  3W6V A;  1ETV A;  2KIS A;  4Z2Y A;  4PSW A;  5GTI C;  2QKM B;  4IF4 A;  1TC3 C;  3LA7 A;  3RYR A;  3IC7 A;  4UUS B;  2VLA A;  1Y56 A;  4ZZL A;  3M1C A;  3KP2 A;  4V2F A;  4Y4R A;  3KYD B;  1HSJ A;  2HYF A;  4KDP A;  3IWF A;  1QPI A;  5A2Q Z;  2FJ1 A;  1T0F A;  2JUG A;  3BQZ A;  3NRV A;  2I5U A;  5F1J A;  1IXR C;  2CFX A;  4CCK A;  1IRX A;  4M72 A;  4UY8 I;  1XX5 A;  2K27 A;  3I64 A;  3EPZ A;  4BJ6 C;  2QA4 I;  1IXC A;  4L9V A;  4NUB A;  4E7L A;  1IRF A;  2R5Z B;  2RAE A;  3R6S A;  4EJU A;  1DPU A;  2JWT A;  3G2B A;  2Q2E B;  3FXO A;  2O61 A;  5FLX Z;  1ZGW A;  3VOE A;  1IN7 A;  2CMP A;  4G7Z F;  1IUY A;  3H0G J;  3HEF A;  2DYS H;  5IP7 J;  2JQ7 A;  2FD5 A;  3BPV A;  3WU1 B;  3OS0 A;  4A12 A;  1YFH A;  2MC3 A;  4LD5 A;  4IVN A;  4RB0 A;  3GCM A;  3CJT B;  2KRH A;  3S2W A;  1FOW A;  1XGS A;  5DUI A;  2ZNZ A;  3DEU A;  2DFH A;  2X1E A;  4CGZ A;  4CSW A;  3GLX A;  2L2O A;  4RGR A;  1A36 A;  5E8G A;  2F5V A;  3IH2 A;  5K7Z A;  3BRO A;  1BC7 C;  1WPK A;  1BBY A;  1K6Y A;  4FX0 A;  3H3U A;  1RUO A;  4L5E A;  2HU9 A;  2P0W A;  2P5L C;  2V1U A;  2Y9Z A;  5LGN A;  1F36 A;  1TWH J;  1IV6 A;  2R7D A;  3AG2 H;  2ESH A;  5M5X J;  3LFU A;  2ISZ A;  3AG3 H;  4XM3 A;  2VQG A;  4F55 A;  3CP8 A;  2W84 A;  1Z77 A;  1PJR A;  3B73 A;  4HEA 2;  3M1E A;  1TP4 A;  3VB2 A;  5JLX A;  4OMY A;  3F9K A;  1TZL A;  3CCY A;  3CUQ B;  4M9Z A;  1YIJ I;  2I8D A;  3CDI A;  4GCV A;  3CCS I;  4LOC A;  4JX6 A;  3F23 A;  4E7I A;  2DA5 A;  2EIK H;  3LSJ A;  1BA5 A;  2M34 A;  2M5W A;  1HW5 A;  1XPX A;  2JZY A;  1ZN2 A;  4XOP A;  4HST A;  2OCE A;  3RZO J;  3HKZ N;  2HOE A;  3BC8 A;  4U0V A;  2D1H A;  5KNL A;  5F6F A;  2R7W A;  3GTL J;  4KIT B;  1Z6R A;  1HA8 A;  1UHS A;  2IVM A;  1PUF A;  3KZY A;  3FDY A;  2HS5 A;  3F8N A;  3DLA A;  1R5G A;  4W97 A;  3W6J B;  1QVU A;  2XGE A;  3MEX A;  2BXZ A;  4L9N A;  2LLK A;  5GAE J;  2IS4 A;  4HSR A;  1FBQ A;  4DYQ A;  3RYP A;  2HYG D;  2K3P A;  2KHM A;  3PNV A;  4E7K A;  4LLN A;  4YFK F;  5KAI C;  3CP2 A;  4HV5 A;  1B9M A;  2KIU A;  3A03 A;  3JRI A;  1F43 A;  5LHH A;  1LB2 A;  4RLQ A;  4U0W A;  2NS8 A;  2X51 A;  3L09 A;  6PAX A;  4XRM A;  2M1B A;  4UNO A;  4KMF A;  3CCU I;  5B1B H;  3HXL A;  5J8C A;  5HOD A;  1V5G A;  2VUM J;  1ZR2 A;  2V4J C;  3H1C A;  2BXY A;  3S1N J;  2EV6 A;  4F3Q A;  1N77 A;  1XGM A;  2F4M B;  4BEH B;  2RV8 A;  3I4P A;  2H1K A;  1ODD A;  4UHT A;  2KIF A;  3PSF A;  3REO A;  3GF2 A;  3LST A;  2B9S A;  1UB9 A;  1JJ6 C;  1FOK A;  2DDA A;  4IJA A;  2Z9O A;  4QTR A;  4RGU A;  2R7R A;  3H92 A;  3HOU J;  1VND A;  1CQT A;  4FQG A;  2R5Y B;  2MW8 A;  4CYC A;  1G59 A;  5HDG A;  3K2Z A;  4Q5S F;  3OWT A;  4B43 A;  1ZR4 A;  1WJB A;  2WAF A;  2ZXJ A;  3MQ0 A;  4GO1 A;  5LBQ A;  2H09 A;  2BHY A;  4E7H A;  3HHG A;  4TV7 A;  1W5S A;  2K02 A;  4BXF A;  2E7X A;  3PIP F;  2EZI A;  2R7Q A;  2LRE A;  3H5A A;  1WJ5 A;  1DU0 A;  1SAN A;  3K1M A;  5AIP A;  3AKZ A;  1E3O C;  1Z6T A;  3IHU A;  3WG9 A;  2PBI A;  3HOZ J;  2ADU A;  2GIZ A;  2XIG A;  4CYD A;  2Z3Y A;  2I10 A;  4BDZ A;  2W48 A;  1JTY A;  1R00 A;  2M8E A;  4YRV A;  3MKW B;  2IT0 A;  4Q47 A;  2DYR H;  4IHT A;  1KU3 A;  4HAM A;  5FLM J;  4XLA A;  1HST A;  1WJE A;  4UV9 A;  5C3E J;  1AKH B;  4CHU A;  3GTM J;  5HLI A;  3CO6 C;  4Q48 A;  5AON A;  2IBD A;  4CCO A;  2BE5 F;  4CCM A;  1R1T A;  2CO5 A;  2N8G A;  4G94 A;  1NTC A;  1MMA A;  1SD7 A;  3M4O J;  3T0Y A;  5FKM A;  2E5N A;  4ZDL A;  4A0Y A;  1D5Y A;  1GVD A;  1FTT A;  4EJO A;  2CQX A;  4EM1 A;  4ZYG A;  1L3L A;  4Z6Y A;  3GTO J;  2NVY J;  1BW6 A;  2K9Q A;  3BTJ A;  1Z0X A;  1OR7 C;  1S7O A;  2GQQ A;  4N9H A;  1Y8Q B;  3QPH A;  4B47 A;  2W7N A;  1XDS A;  5EZH A;  4QIW N;  4G7H F;  3WTS C;  1JGG A;  5D8K B;  4IHX A;  3J7A Y;  4UB8 C;  2LF7 A;  5ICE A;  1YQA A;  3OYM A;  2XAQ A;  2Z33 A;  3GTK J;  1ZYR F;  1R5H A;  2NVX J;  1G3S A;  2IGO A;  4ESF A;  3HPG A;  3A01 B;  4LLG F;  2DCE A;  2PMZ A;  1STZ A;  1S29 A;  5DCM A;  4KIF A;  5D5W B;  3AL0 B;  2QSF X;  2CUZ A;  1H9G A;  1U3E M;  3ERM A;  3MWM A;  1VQO I;  1TLH B;  3TKY A;  1MJB A;  5K5O A;  2XRL A;  2JA6 J;  1LVA A;  2H1L A;  3E5X A;  3GVA A;  3BY6 A;  4PK4 A;  4D1Q A;  3HSR A;  1ZTR A;  3NAU A;  5F04 A;  2R7S A;  1TQP A;  3X2Q H;  1A35 A;  1FP1 D;  2RGV A;  1FYL A;  4IEJ A;  4B44 A;  1Q1V A;  1YJW I;  2MSY A;  3ABU A;  1HQC A;  1GHC A;  3F72 A;  3JSO A;  2HNH A;  2ID3 A;  4MLO A;  4ZYA A;  3DP7 A;  3PM1 A;  4AVP A;  5C4J J;  1UZC A;  2AQE A;  3PNY A;  4DNC A;  4BQA A;  3L2V A;  2L4A A;  3O8H A;  1U6G A;  5EGO A;  2VXZ A;  3PJR A;  4AU7 A;  1USS A;  1YS6 A;  4G6Q A;  4DIQ A;  4XN3 A;  1D1A A;  3FMQ A;  1JKO C;  5IT9 Z;  1HDP A;  2F2E A;  4A93 J;  2HVQ A;  2X9D A;  2HDW A;  3WTZ A;  4A3B J;  3BR2 A;  3M8J A;  1X1A A;  3OL3 A;  1GT0 C;  3CJN A;  5D8L B;  3D5L A;  4ZTJ A;  2R92 J;  2CUE A;  3BR6 A;  3IAM 2;  4BY1 J;  5JVT A;  5E1X A;  5FKK A;  2IP2 A;  3TP3 A;  3BCB A;  3LSM A;  4NC7 A;  3QYB A;  5FFZ A;  1S9H A;  1GXP A;  2DOA A;  4WXC A;  2JJ7 A;  2WY8 Q;  4N4O B;  1RC9 A;  1MNM C;  3F0C A;  3H9G A;  5TJJ A;  1QA6 A;  1BI1 A;  1YIO A;  2O8K A;  3GTQ J;  3P5J A;  1IN6 A;  1NG6 A;  2MA3 A;  3KP4 A;  2GZW A;  2Y69 H;  4BU2 A;  5J1U A;  2A6E F;  3B6A A;  3OS1 A;  3ZQL A;  1SFK A;  1BIA A;  1RUN A;  1MBE A;  3SZG A;  4MTE A;  3QPL A;  3W2A A;  1R5I D;  4PFP A;  1KU2 A;  3TOB A;  1HKQ A;  1ZG3 A;  5H6R A;  3JTH A;  3L7W A;  2JPB A;  3DKX A;  5HS8 A;  5FKL A;  1X58 A;  5FO5 A;  3LMM A;  2XAH A;  1VQ8 I;  5D6F A;  3GFJ A;  5E20 A;  4UUV A;  1WKM A;  3RSN A;  1MW7 A;  4AC0 A;  3COA C;  2DFE A;  3CQZ J;  1UAA A;  3OYN A;  1B8I B;  2DT6 A;  5IYD J;  4PZJ A;  3TW6 A;  3CES A;  2HXI A;  1R6R A;  1LEB A;  4ZYH A;  4ENN A;  4WCG A;  3HHH A;  3H35 A;  5LEJ A;  1W0U A;  5FGM A;  5IYB J;  2QEX I;  3HG9 A;  2M0M A;  5K5Q A;  1TWF J;  4HNV A;  2OPT A;  5FLV A;  5EYR A;  4HLX A;  3KIO A;  1KON A;  1OCT C;  2PN6 A;  2MAB A;  3U1K A;  2BY1 A;  2XVC A;  1X3U A;  1AWC A;  2R5Z A;  3R4K A;  2XB5 A;  1L0O C;  1K6O A;  2FMY A;  1BI0 A;  4II3 A;  2Z2S B;  4KFC A;  3ZPL A;  4L0Y B;  3L9F A;  5DDG A;  2WA0 A;  1DQU A;  2DOF A;  1GXQ A;  2BY3 A;  2QKL B;  1ON1 A;  1QHG A;  1XDU A;  2DT7 B;  2HQN A;  2IA0 A;  1Z3X A;  2O5R A;  1MBG A;  1VQN I;  1BOA A;  2HZD A;  3RPU D;  2LF8 A;  3S8P A;  2CRG A;  4YFN F;  1SFX A;  1LEA A;  2CUJ A;  3S32 A;  3FHN A;  1OCO H;  3TOA A;  4EEF G;  3GTJ J;  3G73 A;  2FXA A;  2BYV E;  2FE3 A;  4OWR B;  4XRS G;  4OIQ F;  4ENJ A;  4EM2 A;  2O03 A;  4CDG A;  4QLC U;  3MAJ A;  1MH3 A;  2NVU B;  4ASN A;  2XKP A;  4FTH A;  2RQQ A;  4E4H A;  1O4X A;  3ONQ A;  1K4S A;  2LD5 A;  1QHH D;  3QP5 A;  4CO8 A;  1IAW A;  1LVK A;  2ECC A;  5JHU A;  3KYC B;  2AXL A;  2WV0 A;  2L5Q A;  3G1M A;  2E35 A;  2DQR A;  1U9N A;  5CPR B;  3CUQ A;  3DPU A;  3Q9V A;  1IZ1 A;  3FBI B;  4KIG A;  3ZMT A;  3ERE D;  4A3J J;  3K9T A;  4PJM A;  5FFX A;  3GZ6 A;  2RQP A;  1EV7 A;  5LGT A;  5DS9 A;  3J81 Z;  2GWR A;  3BDD A;  1AU7 A;  3OMY A;  2VOP A;  3SEQ A;  3I53 A;  1YW7 A;  3CF2 A;  1GLN A;  3TO7 A;  1TNT A;  1DP7 P;  1UHW A;  2QWW A;  2ZB9 A;  2LNB A;  2V1N A;  2A69 F;  5B3S H;  3CZ6 A;  3I58 A;  1G3W A;  3PO3 J;  2W24 A;  3GLL A;  5J8F A;  2QCO A;  3C2H A;  1DGR M;  1ZHF A;  1H8A C;  2MD0 A;  4LJZ F;  5ILU A;  1MSF C;  2QSH X;  2FQ4 A;  2BEO A;  2W57 A;  3ECO A;  2STW A;  5EEA A;  3GFM A;  2CH0 A;  1R23 A;  2HOT A;  2DFI A;  2QSG X;  3CJQ B;  3EYI A;  3IH3 A;  3Q5F A;  2KFD A;  3S1R J;  2CSO A;  2OAZ A;  4XRS A;  1E0E A;  3BG3 A;  1YRN B;  4XLN F;  3OR2 C;  4A6E A;  1D1B A;  3P9I A;  2V9K A;  3ZN0 A;  2LY9 A;  2Y48 A;  4A3M J;  4O3M A;  2P5V A;  2EBI A;  4L5I A;  2L02 A;  2Q0O A;  4RBO A;  2B63 J;  3PSI A;  2CG4 A;  4AIH A;  2D2W A;  2EFW A;  1XG1 A;  1WRJ A;  3JSP A;  1U8B A;  3MVP A;  4IHY A;  3K2A A;  4BEH A;  1T2K A;  1ETK A;  2VKH A;  4XR6 A;  3V7R A;  1MJA A;  2MFZ A;  4AM3 A;  2H6C A;  4A3I J;  4YEJ A;  4A3F J;  2AQF A;  2DQL A;  4NDL A;  3I55 I;  1ZLK A;  2PJR B;  1KYZ A;  3DV8 A;  4M9X A;  1KQ8 A;  2L0K A;  4RM2 A;  4IHW A;  2R5Y A;  3WGI A;  1H9T A;  5HVQ C;  3J80 Z;  3HKZ A;  1VFC A;  1HXD A;  4FHT A;  1JTX A;  5H2F C;  3VYR B;  5J1R A;  5E18 F;  3CC2 I;  1JUS A;  1SVO A;  2YS9 A;  4Y33 A;  4XKC A;  2CS3 A;  3RPQ A;  3V8L A;  3DTK A;  2BHZ A;  2E7W A;  3TW7 A;  2YU9 J;  1LDJ A;  3QPS A;  3FXM A;  1FT9 A;  3OY9 A;  2XGX A;  4QPQ A;  3G3Z A;  3CO7 C;  1VQ7 I;  2IA2 A;  2KT0 A;  1Y6I A;  2NVT J;  2ELJ A;  2ZC2 A;  5ED4 A;  4M6V A;  3S15 J;  2R7T A;  4EQQ A;  3DKW A;  4ENK A;  1V54 H;  5JI6 A;  4HYE A;  4A0X A;  2AXT C;  3M8F A;  3KLN A;  4XOT A;  5TIS C;  2OTL I;  2ZFU A;  3EET A;  2XV4 S;  3C2G A;  1CF7 A;  1NK2 P;  2QQ9 A;  2FBI A;  1VQ9 I;  4AD9 A;  3TO6 A;  5DYM A;  1AKH A;  4BAY A;  5ERI A;  1AHD P;  2P8T A;  2HTS A;  2OCC H;  1P9Q C;  3OOU A;  2WBM A;  1WHU A;  2H8W A;  4XLP F;  5C4X J;  1I3A A;  1ZEL A;  2ZJQ F;  1DP3 A;  3QWL A;  3HPH A;  5EG0 B;  2VI6 A;  4RLF A;  1D0Y A;  3BJA A;  1JT0 A;  2DMT A;  4BY7 J;  4XIC A;  5J1Y A;  1FOX A;  2VKE A;  1OFC X;  3RJP A;  1BL0 A;  4XLF A;  2HDD A;  2E34 A;  3SXY A;  1A04 A;  3W6K B;  1R36 A;  2G7H A;  2CYY A;  2RRE A;  2HVS A;  3JAM Z;  2EB7 A;  2WAE A;  4A5M A;  2IEK A;  2VQL A;  4HF0 A;  3WTX C;  2AO9 A;  2NOG A;  2R7O A;  2DU9 A;  2HTJ A;  2L7Z A;  4M74 A;  2CV2 A;  3HRU A;  4KIC A;  1R22 A;  5BNG A;  1D5V A;  2VE8 A;  2X6W A;  2F5C A;  3DXJ F;  3LSI A;  2Q1Z B;  2Z5U A;  4AIJ A;  3RKQ A;  2MLK A;  3K4M A;  3A01 A;  2HOA A;  2V26 A;  2D1V A;  4AYB N;  1I3Q J;  4BGD A;  3TDZ C;  2K40 A;  2KZV A;  1SFU A;  2HDC A;  1QO0 D;  3Q9S A;  2IRF G;  4HDU A;  1ZRD A;  3U9G A;  2PI0 A;  1ZAO A;  2O3F A;  4LIU A;  2HXO A;  3MD2 A;  3F8M A;  1J5Y A;  3MKL A;  2P6S A;  2K85 A;  1LPQ A;  1X2N A;  3CCJ I;  4J00 A;  3TO9 A;  2UV1 A;  1PP8 F;  3ZN1 A;  2MBF A;  1D8J A;  2FBH A;  2QF7 A;  1B59 A;  3J7Y J;  2DAO A;  2EIM H;  2W4S A;  3MZY A;  2JVG A;  2VL8 A;  1JGS A;  2XUB A;  4XSX F;  3OYJ A;  1XSX A;  2VE9 A;  4YII A;  3E3V A;  4OIO F;  3P7N A;  3T8R A;  2JA2 A;  1H88 C;  4LG0 B;  1Z67 A;  5FRO A;  3N97 A;  4CXF A;  4RB3 C;  3IRQ A;  3Q0V A;  3MKY B;  3CDH A;  3VYT B;  3F21 A;  1QZZ A;  2UXN A;  4BL0 B;  3J81 K;  1O57 A;  1UG0 A;  3DWL E;  2KIM A;  3I5U A;  4F7Z A;  3H3V K;  4XKW A;  3PUB A;  4A3L J;  2NVQ J;  3M07 A;  1LFU P;  2DN0 A;  3I71 A;  2R7U A;  3RCO A;  3GXO A;  2HWV A;  1GDT A;  4Y15 A;  1Z05 A;  4ZDP A;  2M4K A;  2DJN A;  3OIQ A;  2M9H A;  2JA5 J;  1HDD C;  3JR9 A;  4WXD A;  1RET A;  1T6S A;  3ROU A;  2PJP A;  1FWZ A;  4DW6 A;  4MQ9 F;  5E17 F;  4R1H A;  4RAF A;  1TWA J;  1VTN C;  2CQK A;  2QEN A;  1QQI A;  3F6O A;  1S8N A;  5F0F A;  3G1O A;  2Q8K A;  2CV1 A;  4A0Z A;  1O7F A;  1YI2 I;  2V1X A;  3DPL C;  3Q0W A;  1OCP A;  1HKT A;  3V7C A;  2JRT A;  2OUM A;  3GTP J;  2HZT A;  2JRM A;  5LFA A;  1F4K A;  1OYW A;  2CW7 A;  4I76 A;  4XBF A;  1Y0U A;  4EV0 A;  5D5V B;  1ERD A;  4IO9 F;  1RR8 C;  4HQM A;  2V79 A;  3BG9 A;  1W7P D;  3GEZ A;  4PDK A;  5KK1 A;  2A6T A;  1J2X A;  3DTE A;  4I01 A;  4BXX J;  4HX7 A;  2Y31 A;  4ZZD A;  5DTD A;  1SMY F;  4IL6 C;  5ICF A;  1S72 I;  3CLO A;  2KLO A;  1U8R A;  4RAY A;  4HDV A;  4S04 A;  4FE7 A;  1B8I A;  1TT0 A;  4M71 A;  2L4M A;  4D0P A;  2DDB A;  1PYV A;  3BG7 A;  3LA3 A;  4U88 A;  2QUF A;  2L3D A;  1XSV A;  2VKV A;  3AFH A;  2DK5 A;  4QPO A;  4LK1 F;  2OQR A;  5FKN A;  2VT2 A;  2VOO A;  5CVU A;  1POG A;  3GO5 A;  5L3B A;  3CD6 I;  1FMV A;  2DO7 A;  2FRH A;  1DPR A;  1GV2 A;  3GW2 A;  1LJ9 A;  4E7Z A;  4G6T B;  1XCV A;  2XAJ A;  2DMQ A;  1HW1 A;  3E7L A;  1X1P A;  4PFO A;  4WWC A;  2HGC A;  1K78 B;  1JHH A;  2LY2 A;  4BE1 A;  4OAY A;  3BZC A;  5JLW A;  1ETQ A;  1V5E A;  3L00 A;  3WTT C;  4X6A J;  1S6L A;  3BZK A;  3C1D A;  4KN7 X;  5JVG F;  4V2G A;  1SC7 A;  1QZE A;  1A31 A;  5E3N A;  3J7A O;  1JE8 A;  4FX4 A;  4BQO A;  4X0G A;  2QBY B;  2KQR A;  3E1S A;  3HTU A;  3KZI C;  5J47 A;  3A2K A;  3E0J B;  3SEZ A;  4C2M J;  1YTY A;  1MMD A;  4G8X A;  4ZC3 A;  3A0B C;  3DF8 A;  2UXX A;  4OOI A;  3O2P E;  1FP2 A;  2VAS A;  1S7A A;  2EV0 A;  2ZNY A;  3EDP A;  1U5T B;  2Y0M A;  4MGR A;  3OYK A;  5F0C A;  4ESB A;  2CQN A;  3JRH A;  2O9L A;  2K5C A;  1G3T A;  1O7L A;  3KP6 A;  4EJW A;  2K86 A;  2F5D A;  3VOD A;  2COM A;  1R71 A;  2PMU A;  1WH7 A;  3F8F A;  1EKE A;  3G6E I;  1SD4 A;  4I6Z A;  5EDN A;  3ZQG A;  3NAR A;  2LRD A;  3ZR8 X;  2GA2 A;  2CQ7 A;  5TGT A;  4KIS A;  2V7F A;  2KDZ A;  3HIF A;  3CLQ A;  2IS6 A;  2DOE A;  3I4M J;  1IO2 A;  3I59 B;  5C44 J;  3IWZ A;  4BHC A;  1UST A;  1IDZ A;  3D5R C;  1V4R A;  4CZC A;  1NHA A;  2A61 A;  2E19 A;  5K7H A;  1CGP A;  3BOQ A;  2Y75 A;  5A2Q K;  2K9L A;  1SAU A;  1A6Q A;  2VXD A;  2WV1 A;  4AWX B;  3S1M J;  2GAU A;  2EV5 A;  1T08 B;  1HF0 A;  4FIS A;  2Y0S N;  3LQR A;  5IP9 J;  1WJF A;  4P96 A;  3FXU A;  5JFR A;  3LFK A;  3R61 A;  1JUP A;  3QAH A;  1FYK A;  5FLX K;  1FC3 A;  3KEO A;  3K1N A;  2KZG A;  2LY1 A;  3FIW A;  1VF9 A;  5HDK A;  2EA4 A;  3MN2 A;  1DGW Y;  2ZXH A;  5CVR A;  1WZ2 A;  1QVT A;  2X6O A;  2BZT A;  3W3C A;  1IRG A;  1SVM A;  3M7G A;  3D5S C;  2ZKZ A;  4A3K J;  1U78 A;  4DOZ A;  4FE4 A;  1SAX A;  1X4P A;  1MDM B;  4NC8 A;  3PUF A;  2STT A;  4XSZ F;  1YRN A;  2IGK A;  1MBF A;  5HLG A;  2LKS A;  4AID A;  2H27 A;  1AOY A;  3MKZ A;  2VIX A;  5K1Y A;  1X3Z B;  2JTV A;  1YOV B;  1XSD A;  2RDP A;  4BBR J;  4KT6 A;  5FD5 A;  2LG4 A;  5BOX A;  1VQ4 I;  4C2U A;  4KMU X;  3KPH A;  2O8X A;  4OIR F;  3L2R A;  3VYS B;  2LH9 A;  4AIK A;  5E3O A;  2M7A A;  2VJJ A;  2E2I J;  1G3Y A;  1U9O A;  4OU0 A;  5EEG A;  3BR1 A;  2V1D A;  3VSL A;  2PJR A;  1TQM A;  2PLY A;  5BPI A;  2HOS A;  2M87 A;  4PGG A;  1J75 A;  1BR2 A;  4D5F A;  3DTI A;  1J0R A;  1P4A A;  4RGX A;  2XAS A;  3HRM A;  3CCR I;  2YU3 A;  4N4N B;  5IPA A;  3CCQ I;  3S14 J;  2XDV A;  4E6K G;  2NAZ A;  2L9R A;  1I27 A;  5KCM A;  4O6J A;  2HFH A;  5GAD J;  1EH7 A;  5LRR A;  2XAG A;  1E17 A;  4DZJ A;  1YIT I;  4HBL A;  2M4G A;  4M9S A;  3TED A;  1TNS A;  2ME6 A;  1JKQ C;  4U87 A;  2XC7 A;  2JK3 A;  4XLE A;  3H36 A;  2QGU A;  3HOV J;  1MMS A;  1MIJ A;  3FK7 A;  3F8B A;  1NG7 A;  3GZN B;  3H9Q A;  2XHK A;  1R7J A;  4XOR A;  3LSH A;  1XTA A;  3Q0U A;  4FAS D;  2EJR A;  1WFX A;  3P9K A;  3BG6 A;  3WGG A;  3HZJ A;  2E1M B;  2NYX A;  2MYS A;  5L3E A;  3KCC A;  3RTR A;  3FMR A;  2GXB A;  4RB2 C;  5KAF C;  3BJ6 A;  2DPU A;  4I0A A;  4ZDO A;  4WK8 F;  3HGG A;  4IRH A;  3ZCO A;  4LFU A;  3G71 I;  3EYY A;  5KHD A;  1YLF A;  1TTY A;  2GA1 A;  5DUK A;  1YJ9 I;  4M3D A;  1K7A A;  3EUK L;  3ZMS A;  3WGH A;  2GLO A;  3OOP A;  5EG0 A;  1JJ8 C;  2XAF A;  4H0E A;  1FPQ A;  1XGO A;  4R79 A;  3CC7 I;  2Y30 A;  3DBR B;  2F4I A;  3SZT A;  3V7S A;  3ZQH A;  2GXG A;  2R7Z J;  3C2B A;  1F1Z A;  5J4V A;  1W7P B;  1MBK A;  3M3Y J;  2G0E A;  2JMW A;  3KFW X;  2IXS A;  3K4N A;  3OSG A;  4A6D A;  3SJM A;  4HA8 A;  1KYW A;  4WXH A;  5ICC A;  4C2T A;  3QQA A;  5KVR A;  2VPL A;  1R1U A;  1GVJ A;  4LK0 F;  3LWF A;  3DBH B;  3K70 C;  5GAG J;  3E5Q A;  5E8I A;  5M3M J;  3RI4 A;  1IGN A;  4UUS A;  3FMS A;  4OAZ A;  3SZP A;  5BS6 A;  1YE9 A;  2QQB A;  2TCT A;  2FOK A;  3E6D A;  5DD8 A;  1OR7 A;  2Y2Z A;  4A69 C;  3K69 A;  1T39 A;  2WAQ N;  2UZK A;  4CZZ A;  2FSW A;  4HNT A;  3GX4 X;  4EMS A;  3N4M A;  5AIQ A;  3KET A;  5CVV A;  1HC8 A;  2H6B A;  2DLL A;  2Q2E A;  4KNY A;  4HQE A;  4L5J A;  2EIL H;  3BWG A;  1TQI A;  3CCV I;  3AG4 H;  1O3R A;  1U5T C;  2JA7 J;  3CMM A;  3CTA A;  1TWG J;  3SFZ A;  5GTH C;  1B72 B;  2DFF A;  2ID6 A;  4CIC A;  2GOM A;  3SDB A;  4ZH4 F;  1FMW A;  3O3K A;  1FYM A;  3IKT A;  4HX8 A;  1ZLJ A;  2VJI A;  4UXN A;  1REP C;  2R7F A;  2V9V A;  2VOD A;  3VFZ A;  2MLG A;  2Y9Y A;  3IP4 B;  2OJE D;  2CWE A;  1J09 A;  2K3F A;  4BDY A;  2IA1 A;  1IC8 A;  2BY2 A;  2JT1 A;  1WVR A;  2JSP A;  4LG0 A;  3RPU A;  3H0D A;  3BG5 A;  2Z1D A;  5J40 A;  2X48 A;  4Y7N J;  2VC1 A;  4U7B A;  3OYC A;  1FZP B;  3CCL I;  2VN2 A;  1KQ0 A;  1OCR H;  2ZJP F;  2CV0 A;  2XRN A;  4NQW B;  1SVL A;  1Y1V J;  2JVH A;  2V6C A;  5JHF A;  4BQQ A;  2COB A;  4IHV A;  2EZK A;  2A05 A;  4F91 B;  1GUU A;  2EFQ A;  4CCL A;  4KA4 A;  5F64 A;  2NXN B;  2DTR A;  1IF1 A;  3SFI A;  3ZMD A;  2BVM A;  4AYB A;  2O7O A;  1IJW C;  3S2D J;  1WWX A;  4N9I A;  5J3L A;  5HDN A;  2IGN A;  3VSK A;  3QOP A;  2X0L A;  1Z9C A;  4W1U A;  5L3D A;  1MZB A;  3MCZ A;  1VQK I;  2BY0 A;  3PFY A;  2F5F A;  1TW3 A;  2KMU A;  3BTL A;  4DBQ A;  3JRE A;  4X1E A;  3RKX A;  3FKI J;  3ASN H;  1K4T A;  2J5P A;  3F8C A;  3T1B A;  3PIO F;  2IPQ X;  1W4M A;  4OMZ A;  3R60 A;  2ZME B;  3RQ4 A;  1XMK A;  1QPM A;  1Y1W J;  2L7F P;  4BS9 A;  3ZXS A;  4BE0 A;  4PSX A;  5E3L A;  2W1O A;  3W2V A;  4RA2 A;  3LA2 A;  5FRN A;  2F4O B;  5HNH A;  1BW5 A;  1VQ5 I;  1FTZ A;  2V9P A;  2DMU A;  1Z7U A;  1YYV A;  2KKO A;  4RAZ A;  5ILS A;  3F22 A;  1I6H J;  2DXI A;  3HM5 A;  2M0C A;  3KEQ A;  3OYI A;  3MMY B;  1X4O A;  2DA7 A;  1IRZ A;  5CJ9 A;  1GV5 A;  1T33 A;  1W1W E;  5DD4 A;  2MGQ A;  3HB9 A;  2F6C A;  2R7X A;  4NBQ A;  2DA1 A;  3VPR A;  3ML6 A;  1H0M A;  2LYC A;  5D4R A;  1ZQ3 P;  3C18 A;  5FB2 A;  2OC6 A;  2VC0 A;  4YG2 F;  3G4S I;  1TW2 A;  5IOZ A;  2WB1 N;  3K70 D;  2ACJ A;  3M8E A;  2XSJ C;  5GP9 A;  1UEL B;  1QBJ A;  3S1Q J;  2WWY A;  1KU7 A;  5IT9 K;  1LDK B;  4MHG A;  5BQT A;  4N0B A;  2VQH A;  2VJ5 A;  1K78 A;  2W85 A;  1MSE C;  2KRF A;  2R93 J;  2E60 A;  1E3H A;  1SD5 A;  1ETO A;  4HW0 A;  1Z1D A;  1I39 A;  1HBX G;  4NNJ A;  3BPX A;  3NWT A;  4L9J A;  4HF1 A;  1KU9 A;  2PMH A;  4UUT A;  3P9C A;  3UR3 C;  1HKS A;  2VPR A;  1X1D A;  1DDN A;  3IKV A;  1K61 A;  1X1B A;  3DU6 A;  1XC5 A;  3WHC A;  2R7V A;  2QBY A;  2R0Q C;  3KLO A;  4J19 A;  3UNG C;  3LSG A;  3HSF A;  2X85 A;  4EGY A;  2O6G E;  3H9J A;  3IAS 2;  2LR8 A;  5E3M A;  3HOY J;  2DA4 A;  3FKJ A;  1HLV A;  1K83 J;  3VWB A;  3PO2 J;  1D0X A;  2M30 A;  3TP0 A;  3BT9 A;  2A3S A;  4BBS J;  1RIO H;  3I0T A;  2E1M C;  5L3C A;  1S7E A;  4HNU A;  1Y0N A;  3LAJ A;  3LQQ A;  4I7H A;  1E3P A;  4B09 A;  1RI7 A;  4ON0 A;  2M2E A;  1U5T A;  2L7M P;  2DOD A;  2VB6 A;  3V8J A;  1J9I A;  5DM7 F;  1S3J A;  1X1C A;  1TBX A;  3IL2 A;  1LE8 B;  4XQF A;  3DBL B;  3DKY A;  1UMQ A;  4XK4 A;  2LBF B;  5GPC A;  1XD7 A;  4RB1 A;  3V42 A;  2PFB A;  1MJ9 A;  4XID A;  3S93 A;  2UWM A;  2XPV A;  3CCE I;  3KZZ A;  1I1G A;  4B3X A;  3HOW J;  4PJN A;  4RM3 A;  2BW3 B;  1RR7 A;  4XON A;  3T8T A;  1F5T A;  2FQ3 A;  2V6E A;  3RQI A;  3TBI A;  2NNN A;  3I59 A;  1KZH A;  4KN4 X;  3OYA A;  3DPT A;  1J59 A;  1BIB A;  2QVO A;  4HG2 A;  1VZ0 A;  3HOX J;  2LFB A;  3FXL A;  4C3I J;  3K7A J;  4DJA A;  1HCR A;  2HPM A;  1ZH5 A;  2PG4 A;  4DZP A; 
#chains in the Genus database with same CATH homology
 4FET A;  2HNH A;  4MLO A;  3OR1 C;  4PJL A;  4ZYA A;  1FMV A;  2ZSI B;  2X6Y A;  2AQE A;  3PNY A;  3OYL A;  3L2V A;  2R4G A;  4AVZ A;  4E7Z A;  4G6T B;  2HPI A;  4PFO A;  1N78 A;  2VXZ A;  3PJR A;  4AU7 A;  2LY2 A;  4BE1 A;  4OAY A;  3HUG B;  1MMN A;  2X1C A;  1V5E A;  1YX5 A;  3K4K A;  4XN3 A;  4XNF A;  4DIQ A;  1N75 A;  1D1A A;  2HVQ A;  4P5O A;  2HDW A;  2KL4 A;  3OYE A;  3QOE A;  3OYH A;  4E7S A;  3M8J A;  1X1A A;  2OV7 A;  3OL3 A;  2HQA A;  4BQO A;  4X0G A;  3ZGK A;  3D5L A;  2KQR A;  3E1S A;  4BQN A;  4ZTJ A;  3IAM 2;  4J01 A;  3A2K A;  3E0J B;  3SEZ A;  1MMD A;  2CFO A;  3BCB A;  3LSM A;  4NC7 A;  3QYB A;  4ZC3 A;  1S9H A;  2K9M A;  2DOA A;  3NWS A;  2M7B A;  2WY8 Q;  4N4O B;  4IZZ A;  3H9G A;  4HPQ A;  4PUS A;  1LFP A;  3FBN B;  1T0F C;  2VAS A;  3AL0 C;  1NG6 A;  1W36 C;  4LIV A;  2LOO A;  4BU2 A;  3OIP A;  3OYK A;  4ANJ A;  2Z16 A;  3OS1 A;  1BR4 A;  1SFK A;  2E5Z A;  2K5C A;  4JOM A;  1X19 A;  2MC4 A;  3H5N A;  3SZG A;  3W2A A;  4PFP A;  3L2U A;  3DKX A;  4XLC A;  1Z7L A;  2Y0S A;  3LMM A;  3DQV C;  1MNE A;  2LRD A;  3ZR8 X;  3RSN A;  1MW7 A;  3OYB A;  5TGT A;  4KIS A;  2V7F A;  3VYU B;  3OYD A;  3BLY A;  2IS6 A;  1UAA A;  4DGW B;  3OYN A;  4C30 A;  2DT6 A;  4BJT A;  3D5R C;  4CZC A;  3CES A;  1R6R A;  4JQF A;  2K9L A;  3H35 A;  1SAU A;  2VXD A;  1D0Z A;  4XKB A;  3HG9 A;  2M0M A;  1U0J A;  3IUO A;  4BAC A;  2VKD A;  4B48 A;  3OYF A;  1WJF A;  4YEL A;  1KON A;  2LY1 A;  2MAB A;  4CH7 A;  2DJI A;  2KRC A;  1DGW Y;  2ZXH A;  4PJJ A;  2LC2 A;  4IX7 A;  3W3C A;  4XMY A;  3ZQQ A;  3L2Q A;  2XF6 A;  2X6X A;  2A5W A;  3D5S C;  4II3 A;  2Z2S B;  2L9S A;  4GRI A;  2WA0 A;  1DQU A;  4DOZ A;  2QKL B;  1QHG A;  2DT7 B;  1X4P A;  1Z3X A;  1JI8 A;  4F92 B;  4NC8 A;  2O5R A;  2IGM A;  2IGK A;  2HZD A;  3RPU D;  3S8P A;  3MKZ A;  2VIX A;  3S32 A;  2CUJ A;  2W82 A;  3FHN A;  3EUA A;  4KT6 A;  2LG4 A;  3BCA A;  4OWR B;  4C2U A;  1EA3 A;  4ZJZ A;  3L2R A;  5HNF A;  3VYS B;  4BUP A;  2LH9 A;  5LD2 C;  2M7A A;  2VJJ A;  3GBG A;  3VSL A;  2PJR A;  3VDX A;  2RNG A;  3K4L A;  3S3O A;  4Y3O A;  1BR2 A;  2RQQ A;  3DTI A;  4E4H A;  3ONQ A;  3LL7 A;  1QHH D;  3W2W A;  5CQE A;  3S3N A;  4N4N B;  1LVK A;  2XDV A;  3I3L A;  4E6K G;  3HL2 A;  1Z21 A;  3K10 A;  2L5Q A;  2M3A A;  5KCM A;  5CPR B;  2XF5 A;  4XLH A;  3DPU A;  4IQJ A;  2M4G A;  3FBI B;  3QYE A;  2NOJ B;  4PJM A;  4U87 A;  2XC7 A;  4PSW A;  4XLE A;  2QKM B;  4F93 B;  3OMY A;  3SEQ A;  3H9Q A;  4XOR A;  1NG7 A;  1W36 D;  2BVL A;  3CF2 A;  1Y56 A;  4H4K C;  1GLN A;  3LSH A;  3M1C A;  4FAS D;  2VLA A;  4Y4R A;  5CKT A;  1WFX A;  3HOS A;  3BG6 A;  2V1N A;  2E1M B;  3DEE A;  2MYS A;  3CZ6 A;  3OL4 A;  2JUG A;  1Z3Y A;  3RTR A;  4CCK A;  3EUH C;  1IRX A;  3C2H A;  1DGR M;  4ZDO A;  3EPZ A;  3ZCO A;  4BJ6 C;  2MD0 A;  4NUB A;  4E7L A;  5KHD A;  3G2B A;  2Q2E B;  3L2W A;  4LG3 A;  3EUK L;  2CH0 A;  2CMP A;  3OS2 A;  2FUG 2;  3CJQ B;  3K4J A;  3OS0 A;  4R79 A;  1YX3 A;  3PL8 A;  2F4I A;  3U21 A;  2WAQ A;  1BOB A;  1E0E A;  3OR2 C;  1D1B A;  2KRH A;  2V9K A;  2ZXI A;  2WAD A;  2IXS A;  3K4N A;  2X1E A;  2VJ4 A;  4CSW A;  3I9V 2;  3PSI A;  2L2O A;  4C2T A;  3KX2 A;  4XN0 A;  2VPL A;  3K70 C;  2HVR A;  2F5V A;  4BEH A;  2VKH A;  2L9N A;  4XR6 A;  1K6Y A;  2MFZ A;  4OAZ A;  4E7J A;  4YEJ A;  1YE9 A;  2AQF A;  2HU9 A;  2P0W A;  4II2 A;  2PJR B;  4RM2 A;  2VQC A;  1MND A;  3LFU A;  3QYF A;  5FRM A;  4XM3 A;  2VQG A;  4F55 A;  5HVQ C;  3CP8 A;  3H5R A;  3HKZ A;  4HNT A;  3VYR B;  1PJR A;  4HEA 2;  3K4B A;  4Y33 A;  4XKC A;  1D1C A;  2CS3 A;  3F9K A;  5CQG A;  3DTK A;  1TZL A;  2I8D A;  3OY9 A;  3CMM A;  4QPQ A;  4E7I A;  1OLT A;  5HLT A;  1Y6I A;  2GOM A;  3SDB A;  1FMW A;  2VJI A;  2ELJ A;  4XOP A;  4HST A;  3IP4 B;  3HC7 A;  4XL9 A;  1J09 A;  4BDY A;  2R7T A;  3BC8 A;  2JSP A;  1BR1 A;  3K4C A;  3TMO A;  5KNL A;  3H0D A;  2Z1D A;  2R7W A;  4ZTF A;  4XOT A;  4U7B A;  4KIT B;  3OYC A;  2ZFU A;  2CV0 A;  1HA8 A;  3C2G A;  2X1D A;  4NQW B;  3FDY A;  2JVH A;  3DLA A;  5JHF A;  4IQ4 A;  4BQQ A;  1P9Q C;  3OOU A;  1AA7 A;  4F91 B;  2WBM A;  2ZSH B;  2IS4 A;  4HSR A;  4CCL A;  4D9J A;  1ZEL A;  1DP3 A;  2KHM A;  2K3P A;  3PNV A;  4F52 A;  3HPH A;  2BVM A;  4E7K A;  3S3M A;  4AYB A;  4RLF A;  1D0Y A;  2XAU A;  3CP2 A;  4BJ5 C;  2IGN A;  3VSK A;  4XLF A;  3CJR B;  4RLQ A;  3PFY A;  2X51 A;  4DBQ A;  2KMU A;  2RRE A;  2HVS A;  4EAT A;  2WAE A;  2VQL A;  4RMN A;  3HXL A;  1V5G A;  2R7O A;  2V4J C;  2CV2 A;  3PNT A;  4F3Q A;  1N77 A;  2X6W A;  3RQ4 A;  4BEH B;  1MMG A;  3LSI A;  2Q1Z B;  3PSF A;  3K4M A;  4BS9 A;  2LBF A;  2V26 A;  3ZXS A;  4BE0 A;  4PSX A;  2R7R A;  3OYG A;  2W1O A;  3W2V A;  4BGD A;  4XKV A;  2WB1 A;  4BE2 A;  5FRN A;  5HNH A;  2KZV A;  1G59 A;  3HOT A;  4IKF A;  2BW3 A;  3SYT A;  2W00 A;  3OWT A;  1LKX A;  4B43 A;  2DXI A;  1WJB A;  2WAF A;  3OYI A;  3MMY B;  1X4O A;  4E7H A;  4LIU A;  3MD2 A;  4BXF A;  2CW8 A;  2F6C A;  2IS2 A;  2R7Q A;  2LRE A;  3H5A A;  2R7X A;  1WJ5 A;  3N05 A;  4J00 A;  2UV1 A;  2LYC A;  3AKZ A;  2W4S A;  2JVG A;  2OC6 A;  2VL8 A;  3OYJ A;  3K70 D;  2XSJ C;  4CCJ A;  1UEL B;  2KPM A;  4BDZ A;  1LDK B;  5HOO A;  3ZRG A;  4YRV A;  2JA2 A;  3MKW B;  2VQH A;  2VJ5 A;  5FRO A;  4CCN A;  4XLA A;  2E60 A;  3LSK A;  4LIT A;  3MKY B;  1WJE A;  3VYT B;  4BL0 B;  4NNJ A;  1UG0 A;  3DWL E;  3K6G A;  3NWT A;  4XKW A;  3PUB A;  3KYL A;  3UR3 C;  4CCO A;  4CCM A;  2R7U A;  3RCO A;  1X1D A;  1MMA A;  1X1B A;  3DU6 A;  2R7V A;  1WJC A;  4CUG A;  4ZDP A;  2M4K A;  3OIQ A;  2E5N A;  4ZDL A;  3UNG C;  3LSG A;  2X85 A;  3H9J A;  3IAS 2;  2WY7 Q;  3FKJ A;  3VWB A;  1D0X A;  3KEY A;  1OR7 C;  2E1M C;  4HNU A;  4B47 A;  2CV1 A;  2W7N A;  4CA0 A;  1V5F A;  2VB6 A;  3DPL C;  1WJA A;  2BOL A;  3A4C A;  3J7A Y;  3OYM A;  1X1C A;  2OUM A;  4C9Y A;  4XQF A;  3QOD A;  2IGO A;  3DKY A;  3HPG A;  2CW7 A;  1ERD A;  2KDO A;  2LBF B;  3A1Y A;  2DCE A;  2PMZ A;  3V42 A;  2L7K A;  3S93 A;  2UWM A;  2UUZ A;  4B3X A;  3AL0 B;  4PJN A;  1WJD A;  4RM3 A;  2IS1 A;  1QU3 A;  2A6T A;  2CUZ A;  3DTE A;  2BW3 B;  4XON A;  1G8X A;  4HRI A;  4ITV A;  2V6E A;  2KLO A;  1T95 A;  3TBI A;  4PK4 A;  3DU5 A;  4D1Q A;  2XF7 A;  1TT0 A;  3OYA A;  3DPT A;  2GOX B;  3TL4 X;  2KP6 A;  2R7S A;  4HG2 A;  1VZ0 A;  4DBR A;  1PYV A;  3BG7 A;  4DJA A;  5LFA A;  2HPM A;  3AFH A;  4P1W A;  4QPO A;  4B44 A;  4KJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...