2L7KA

Solution nmr structure of protein cd1104.2 from clostridium difficile, northeast structural genomics consortium target cfr130
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
MIRLTIEETNLLSIYNEGGKRGLMENINAALPFMDEDMRELAKRTLAKIAPLTENEYAELAIFAADEVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of CfR130 from Clostridium difficile, Northeast Structural Genomics Consortium Target CfR130
rcsb
source organism Clostridium difficile
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 20
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14203 TTRAP Putative tranposon-transfer assisting protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1850 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l7kA00
2L7KA
chains in the Genus database with same CATH superfamily
4Z6YA 2H8RA 4QLCU 2DT5A 5FKNA 2XF6A 3KYLA 4EM1A 3RQ4A 3AG4H 2AXLA 4O5VA 4L5JA 2WY8Q 1BIAA 1OLTA 2FMLA 3N05A 1T39A 4M6YA 4IRGA 1OKRA 2XASA 1P92A 2CUEA 2JZYA 4MEYF 2PQ8A 2MLKA 2HNHA 1FYKA 4A6EA 2COBA 2OU2A 5J1YA 3DBHB 1QZEA 2BY2A 1MNMC 3R4KA 2M34A 4PFPA 1LE8B 1ZELA 1Z1DA 1N25A 4WK8F 4MEXF 1IXCA 1WJCA 3FIWA 1Y1VJ 2QZ8A 2XPVA 1YX5A 4HQEA 4P96A 2B9SA 2XAJA 1XGSA 2YX7A 2COMA 1DP7P 2GM4A 5CQGA 1XMKA 4E7IA 3WTSC 3E3VA 4F52A 3ROUA 4RB1A 2DQLA 3F8NA 1Y1WJ 4R1HA 3MCZA 4RM3A 4B3AA 3M8JA 1YX3A 5FRMA 1WCMJ 5J3LA 3RPUA 4L5EA 4GGGA 4IRIA 4HNTA 3GZNB 1V5FA 2DMTA 5FJ8J 4B8XA 2BZTA 2E1OA 3GTOJ 2FRHA 3RCOA 3OS0A 4H4KC 3TW7A 1AKHA 2EIJH 1F9NA 4JQFA 3CF5F 1B72A 2HZTA 3G71I 3EUHC 3KZYA 1ETKA 1WQ2A 3IH4A 1MIJA 3BC8A 3LL7A 1LFPA 1T38A 2L9SA 1TP4A 4ZC3A 3OYLA 3BP8A 3AG2H 3WTYC 2ISYA 2B7EA 1SMYF 5CQEA 2KQRA 4Q47A 1U78A 5GPAA 3G1OA 1J75A 5DTDA 2VKDA 5IT9K 5FLXK 4F93B 4L0ZB 3CCUI 1IRXA 4RLFA 2O8XA 1SANA 3DBRB 3QPHA 2MABA 2KZVA 2DAOA 2R5YB 2R93J 2R7XA 3I9V2 4OMZA 2OV7A 1AA7A 3ZMDA 3ZMTA 3Q0UA 9ANTA 4HG2A 1FYMA 3ZPLA 4M6VA 1LQ1A 1I50J 2R7UA 5KAFC 1W5CC 5E3OA 2QQ9A 2ZJQF 4KT6A 4BGDA 2ICWG 4UUSA 1R1UA 2X6XA 4M73A 5AONA 2CO5A 1FTTA 3R60A 1TW3A 5DM6F 1JT0A 2NRAC 4IHXA 1RRJA 3GO5A 1TWFJ 4ABZA 1D1AA 5HDNA 2JUGA 5IPAA 2JVHA 3ERED 2PEXA 1OCCH 4XONA 2FJ1A 1W1WE 2HOSA 3CLOA 2VQLA 3RKYA 2O8KA 1FJLA 2W85A 2JA6J 3LSIA 3PO2J 1ERDA 2IAIA 3DBLB 4A3MJ 2LDUA 1WSUA 1MMNA 3J7AO 1WJDA 1J2XA 2DA7A 4JX4A 1RESA 3G6EI 1LVKA 3CO7C 4YFXF 4Q4ZF 5IYDJ 4ESFA 3CMEI 3HPHA 1BIBA 3MKLA 2ZB9A 4NBQA 2OD5A 3KP7A 1R1VA 2HKOA 3BCAA 5HDGA 1VF9A 5FB2A 5M5WJ 4CZZA 4CCLA 3ASNH 2IS1A 2O3FA 2DI3A 2GBYA 2R3SA 4Y4RA 3PUFA 2VOOA 2EPFA 1IJWC 3K4KA 2UZKA 3A03A 2JWTA 1SEUA 3JRIA 4I0AA 3FMQA 5HS7A 2Z9OA 1ZK8A 2K3FA 2FA5A 1H88C 3BOQA 3QODA 2EFWA 2CG4A 1NG7A 2YPRA 3CP8A 2AXTC 3VDXA 1JE8A 1RI7A 3HHGA 3DLLF 1T56A 3M7GA 5ILUA 2K9MA 2F5FA 2JA8J 4P9UA 2DPUA 3Q9VA 3H9QA 1XSVA 5KNLA 3S1NJ 1RC9A 3DCFA 3KPHA 3I64A 2ESNA 3DKYA 3FK6A 3OY9A 1PUEE 2LMDA 5IYCJ 1J9IA 3VYSB 2L7KA 3I56I 3L2VA 3ABMH 2Y0MA 3PQJA 2KJCA 3L9FA 2JJ7A 3GLLA 2KMUA 3IUOA 3OSGA 3MKZA 2YS9A 3K7AJ 4KJZA 1YS7A 1NK2P 3FDYA 3JTHA 4AIKA 1ZH5A 3V42A 4FHTA 5EG0A 2QF7A 1YI2I 3BROA 2LBFA 2M9HA 4PJJA 1S6LA 3BY6A 3O8GA 4UV9A 5GAHJ 4XLAA 4C3JJ 5A2QZ 4HDUA 1QVUA 3HTSB 3BZKA 3S17J 2R7ZJ 1JI8A 3DEWA 4UY8I 3TO9A 4NQWA 2LNBA 1GUUA 2EWNA 2PX9A 5M5YJ 1GDTA 2H1LA 3WG7H 5EDNA 2L4AA 4KITB 4CXFA 2BVLA 3KFWX 4BKXA 2QUFA 1TWGJ 4FX0A 3BR6A 4N9IA 1YE9A 3EETA 1ZRCA 4U0WA 3IP4B 4BNCA 1MMDA 4OOIA 1W7PB 2E60A 2G9WA 2FD5A 2Y75A 2KJBA 2KIFA 5CVRA 1K6YA 5BOXA 4II2A 1Z91A 4V19K 1HDPA 2L7FP 1RNLA 1ZTRA 5DEQA 4UVAA 4GDFA 3BT9A 2R7RA 2DFHA 1LB2A 1UG0A 1E3PA 2KP6A 3MKYB 3H3VK 4KMUX 1VQOI 2L2OA 2QM3A 4Q5SF 2ZXHA 2VI6A 4PJLA 1TQIA 1HOMA 4ESBA 4U7DA 5FKKA 3PFYA 5L3CA 1FEXA 4O3MA 3IHUA 2L9NA 2IA1A 4XN3A 1I3AA 3AL0C 2CV2A 4A3GJ 3EUHA 1KGSA 4LG3A 2PJRA 3CJQB 3L2WA 1IN7A 3KP6A 1LUJB 1B59A 1QBJA 1MBKA 3S1MJ 1QZYA 2DQRA 2ZXIA 4ON0A 5BPDA 1FOYA 1ZR4A 1ZGWA 4ZJZA 3QWLA 1TNSA 3WODF 5ICEA 1B1BA 3W3CA 5HNHA 1WI3A 4YFNF 5FD5A 2DJNA 2L02A 3L7WA 2AQFA 4MNUA 4UHTA 2WAQA 5IY5H 2P81A 1K61A 4BJ5C 2KFDA 3TP3A 2ZMEC 5KAIC 1LDKB 2OQRA 4FT8A 4DW6A 3V4GA 2Z3YA 1Z9CA 1AWCA 2DA2A 1X1BA 2NS8A 2H09A 5E1WA 1ON1A 3J7YJ 1QQIA 2DA6A 3L2UA 1KQ9A 5E3NA 1DGRM 2D1HA 4D9JA 1GT0C 4M3DA 2CQXA 2EILH 3PM1A 1XG1A 1R7JA 3H3UA 3H1CA 3G4SI 1MBFA 4LMYA 2R5ZB 4L9JA 3CTAA 3KLOA 3WTTC 2JN6A 2QCOA 4JK1X 1BC7C 2GA1A 3QU6A 4KUMA 1Z6RA 3GUDA 4E7HA 4S05A 3M8FA 2LREA 1IDYA 2P0WA 2W4SA 3BR3A 2A6EF 3KZZA 5B5EC 3S3MA 2M0CA 3JRDA 4MFEA 1Y8RB 3ZMZA 3WU1B 2LYCA 2ZJPF 2OA4A 3MMYB 4G6QA 4X6AJ 1KYZA 1FLIA 2R7SA 1R4NB 1OCTC 4CO8A 3ZGKA 5HVQC 2DODA 1ACIA 4P5OA 1YS6A 3QYBA 3CF2A 3KEQA 1Y0NA 2STTA 3P9KA 1J5YA 1P4XA 2YX4A 1QGPA 2JK3A 2PJRB 2JRMA 5F27A 4HV5A 5EEGA 1RR7A 1S8NA 1ETQA 1U5TB 4M3GA 2XF7A 4MQVA 2GOMA 5EGOB 4AIHA 3MVPA 4CH7A 1G3TA 3NQOA 2L7ZA 4RMNA 3EQLF 3I0TA 2LKPA 3VODA 2F4MB 2ADUA 3LSTA 1W0TA 2F2EA 1T8IA 3GTPJ 1KYWA 2JPCA 1HSTA 2ZC2A 2DOAA 2VXZA 2V9VA 4HNUA 3CC7I 3J80Z 4BE1A 2HXIA 3DEUA 4YIRX 2L5QA 4BDYA 4BUPA 1WJ5A 5E79C 2K4JA 4Z2YA 1BR1A 4WX9A 1T0FC 1XMAA 1JXSA 4NNJA 1SAUA 4Q48A 1K83J 4KT5C 1A5JA 2V6EA 3GFMA 2Y9YA 2V79A 2CV0A 2EB7A 4LGWA 2M3AA 5CYVA 1D5VA 1A04A 2NYXA 3CCJI 4PJ0C 3F9KA 4HLXA 3RYRA 3CCVI 1EH8A 2QSFX 4I6ZA 3LQRA 2VB6A 3TGNA 1SFKA 5CPRB 3WTXC 1V54H 1XN7A 3HTUA 2K9QA 3CCRI 2UXXA 1U5TA 3LWFA 3QQAA 2E2JJ 6PAXA 1ZG5A 1K4TA 1G3YA 4LLGF 3JREA 3E7LA 2HR3A 4M71A 3OYDA 4FCYA 1T95A 1IXSB 2NS7A 4F91B 2NVUB 4X1EA 3D0SA 4CCNA 4EATA 1S3JA 3R0JA 4GO1A 3LSRA 4ENMA 4V2GA 1T08B 3MD2A 4EJVA 3GTQJ 2C6YA 3ZRGA 1FBUA 1ODDA 2CQKA 3TMOA 2Z16A 4FE7A 1ZLKA 1WWXA 2HQRA 1LVAA 5K5QA 4EM0B 3KETA 4IOCF 2RREA 2I5UA 3JTGA 1J7KA 3A0BC 2LFBA 2X1EA 1IV6A 3H9GA 3PQKA 5M3FJ 3OR2C 4F3QA 3F23A 1O3TA 1YJNI 1WZ2A 5FD6A 3EYIA 2OQGA 1WPKA 3KP2A 4MQ9F 5D8LB 3AG1H 4A3CJ 1O57A 1XCBA 4EJWA 1UCRA 5B1AH 4UXNA 3OYGA 5EZGA 2VPRA 5JLWA 3OYAA 2VQGA 4HSRA 5EEHA 2LD5A 3HHHA 3CCEI 1XGNA 2EFNA 2XC7A 5IP7J 1RUNA 2IA0A 1V5EA 1JKQC 2M8GX 1ZHFA 4GRIA 5IOZA 1JTXA 2F4IA 3OYIA 1WHUA 1JJ6C 2HS5A 2FU4A 5LHIA 5C4JJ 4IOAF 2DU9A 3J81K 3LSPA 1YO5C 4IQJA 4MHGA 2DFFA 4ZZLA 1WJEA 1XCVA 3HB9A 3F22A 5HS9A 2TCTA 4OAZA 3JAMK 3WTUC 1M1EB 1MGTA 4PDKA 3H9JA 1X3WB 4BXUA 3JCUC 3ZQHA 1BOBA 3A2KA 1I3QJ 2DA1A 3S2HJ 1T0FA 1MDMA 1YLFA 4E7KA 3Q5FA 1FMWA 1E17A 1VI0A 3BTCA 1XTAA 4UNOA 4YIFA 1POGA 1JUPA 1S29A 2X51A 4D0PA 3DTKA 2IGOA 3PNTA 2VQHA 2CJJA 3VYTB 2OZ6A 3TP0A 3RZDJ 3I55I 3HOUJ 2P5KA 3LSMA 3TL4X 4BE2A 3QPSA 2E5NA 2FSWA 2JSCA 3DQVC 3W6KB 2LLKA 2KRFA 4AD9A 2TRTA 4GYGA 4I01A 4PUSA 5DDGA 5D5WB 3OS2A 3JR9A 1I6HJ 5B1BH 2VUMJ 4OAYA 1TNTA 4BACA 5BNGA 2P6TA 2E7WA 4A0XA 2Y48A 3NWSA 1YQAA 3D1NI 1F36A 2Y69H 4IJAA 4U0VA 1MSFC 4IPAA 4EJTA 1V55H 2ELHA 2GIVA 3BG3A 3WGIA 3E0JB 1WH5A 3HOYJ 4XLCA 1R00A 1Z7LA 2P7CB 3S2WA 5JLXA 1YYVA 2A5WA 4ZYAA 1A31A 2F5CA 5HODA 1ZAOA 4TV7A 3OSFA 2EBIA 3OYHA 2CW7A 2XGEA 2O7OA 3GBGA 3I71A 1S7AA 3JRAA 1Z0XA 2BW3A 1IUYA 1YJWI 2A61A 1IC8A 2QEXI 5DS9A 3KP5A 2VJJA 1MBGA 1IV8A 4A2UA 1UZCA 3H36A 1BL0A 4YRVA 3SZTA 1XGOA 1NK3P 1S72I 2QLZA 3FXOA 4DIQA 1ZLJA 3LA2A 4FETA 4KIGA 2X0LA 4RB2C 2LOOA 1W4MA 3LSGA 1S7OA 4G6DA 2ZXJA 1K6OA 4AUXA 1KONA 3AFHA 3QOEA 1NHAA 1A6IA 1Z05A 3I4PA 1B72B 3H5NA 2ZMEA 1X1CA 1KU3A 3BJ6A 4A3LJ 1HSJA 5E8GA 2B63J 3F72A 5E20A 2BHYA 2OCCH 2CFOA 3H3ZA 3OOUA 3JSPA 3DXJF 4M9XA 3ZR8X 3C2BA 1UG2A 4CCMA 5KCMA 2BGCA 3LFUA 4MTEA 2CGPA 2NOJB 1NH3A 1MH4A 2WADA 2M7BA 4ENJA 2GA2A 4AVZA 2LK2A 3S1QJ 3QP6A 2WAQN 5DD8A 2DFIA 1ZR2A 3BJAA 2FQ3A 5D5UB 4W1UA 3AAFA 3A02A 1HKQA 3G3ZA 1BN5A 2W48A 4OIQF 4E7JA 3PJRA 3PO3J 3MN2A 4XLHA 3GEZA 3G2BA 1C0WA 3IWFA 3F6VA 2K9LA 3B73A 3IV5A 2KL4A 4WXHA 1X3ZB 4GXOA 5LHGA 4C2MJ 3M1EA 3FBNB 2RGVA 1G3WA 1QPIA 4C2UA 1O3QA 4A3IJ 3GTGJ 2F4OB 4XRMA 4XKWA 5DYMA 1Y0UA 1W36D 2DN0A 3RYPA 2HYFA 5HLIA 2K40A 1SD7A 2V1XA 4CCKA 2ECCA 2XSJC 2P7VB 3M9AA 4ENNA 1BI2A 2MD5A 2A6TA 2EZKA 4NDLA 4XNFA 2B0LA 1YFHA 3RZOJ 2MH9A 2P4WA 3ONQA 2HGCA 3WTZA 2HEOA 4ZZDA 3S14J 3K0LA 4FISA 5J4VA 2OF7A 2DDBA 4O6JA 2HVRA 5F0FA 3V8KA 1UHWA 4ZTJA 2M2EA 3PL8A 3I58A 2QYOA 2K7LA 2QQAA 2F48A 4BEHA 4XN0A 4U7BA 1S7EA 1TW2A 4MTDA 1VQ8I 5C4XJ 4M72A 4HLYA 3F8MA 5JVGF 3V7RA 3GX4X 3GZ5A 4IZZA 2E7XA 3CMYA 1REPC 3GYHX 1PP7U 2IBDA 4V2FA 3WE3A 1IO2A 1EKEA 2BXYA 3ZMUA 4DYRA 2F5VA 4AVPA 3VPRA 3H0DA 2IGKA 2HDCA 1R22A 1P4AA 2W24A 3F3XA 5L3DA 2Q2EA 4PSWA 2WB1A 4ZYGA 2LC2A 3JW4A 3GFLA 2RNJA 3QPTA 4IHVA 2RNGA 4YIIA 1IDZA 2PI0A 3FM5A 3L1PA 3VEPA 3EDPA 1VQKI 2IEKA 2GOXB 3R6SA 4E7ZA 1NG6A 3OYNA 3QAHA 1IAWA 1YIJI 4RDUA 3F8BA 2RQQA 1B6AA 2X1CA 1K4SA 2K4BA 1U9OA 2LSOA 4EQQA 4QWQA 3E97A 1FZPB 1D1CA 2KZGA 3R61A 5IP6A 2R5YA 1DPRA 4XMYA 2LH9A 3OYMA 4B09A 3IKTA 2DOFA 5FGMA 2KIMA 1IN6A 3KIOA 2BBYA 3T5XA 3JRHA 5GTHC 1BM9A 2IS4A 3E1SA 3ISPA 2H6CA 1R1TA 5F1RA 2CV1A 2V4JC 2PFBA 3SYTA 3K1NA 3PFIA 5BS6A 2D45A 4PK4A 2E35A 3U2RA 1H8AC 4B3XA 2CUJA 1R36A 2ZO4A 2GQQA 3JAMZ 5GADJ 2ESHA 4GCVA 1LNWA 3ZQGA 1HW5A 1FBQA 1X58A 1Y8QB 1K78B 3RQIA 2G0EA 1XMXA 2TDXA 1BR4A 4A3DJ 3FMRA 1KQ8A 4B4CA 2OZUA 4KICA 5ED4A 2E1CA 2CWEA 3GF2A 5L3FA 1G2HA 5DUIA 3FX3A 3MZ8A 1LE8A 2X6WA 3CUQA 1FMVA 4IHSA 2VJIA 2DXIA 2EFOA 3M8EA 2FBIA 5JI6A 4PFOA 4WWCA 3S93A 5TISC 2AQEA 3ZOBA 5C3EJ 4Y52J 4IVNA 3W2WA 1P4WA 2W82A 4J00A 1MNEA 1VQMI 3CDHA 1GV2A 3Q3SA 1J59A 4L18B 2VLAA 4E70A 3RKWA 3Q0WA 2IGNA 3TW6A 4A3FJ 2DBBA 3TKYA 4ENKA 4F92B 4UB6C 5F0CA 4MO7A 2R7DA 4BE0A 4Y15A 1SFXA 1TBXA 2VC1A 5EG0B 5IT9Z 4D5FA 2PMHA 4E7SA 3CCLI 5EZHA 1DU6A 3D5SC 1XGMA 2OAZA 3I59B 2E19A 2KPMA 2MLGA 3BR1A 2VPLA 2ELKA 4HA8A 5DUKA 3CCSI 4JYKA 4C3IJ 1DDNA 3HEFA 3K4JA 4UB8C 1I1SA 1PUFA 5K7FA 1UFMA 2E2HJ 2ID3A 1QHHD 3CCYA 5F64A 1WGXA 1WRJA 4BBRJ 2MG4A 2X4HA 4BJ6C 4I98B 2LP0A 3HDDA 4KN4X 3HSEA 4ZDOA 2F5EA 5H20A 2STWA 2ELJA 1TTYA 4C3HJ 2MH2A 2W7NA 1R58A 3AG3H 1Y6IA 3U1DA 4D5CA 1QZZA 4IL6C 3L2RA 3B6CA 5LGNA 3DPLC 4XRFA 5K7HA 2BY0A 2O5RA 1YITI 2VBYA 1TT0A 3E5QA 1XSXA 1IZ1A 3H92A 2XGXA 3OIQA 4AC0A 3EUKL 4G9YA 1W5TA 1EV7A 1D0YA 3KYDB 5L3BA 1XX5A 2RV8A 5D8KB 3A1YA 4F55A 2JA2A 4ZYDA 4BQOA 4G8XA 5LGTA 2X85A 1Z3XA 4FASD 3E5XA 1WKMA 3OYCA 3J81Z 1O7LA 2HVQA 4BQNA 1KQ0A 3KCCA 2A07F 2XDVA 5F0HA 4IEJA 3RPUD 2P6SA 4I7HA 1N75A 2IW5A 3GWZA 3SXYA 3VOEA 1T98A 4A0ZA 1Y56A 3SFIA 4UUSB 1FP1D 2DT6A 3IAS2 4U88A 1ITYA 2QENA 3NAUA 2XAGA 3JRCA 1ON2A 4KFCA 4XRSG 3SEZA 2DCEA 3DEEA 3GW2A 4XORA 2QA4I 1PJRA 3J80K 2MC3A 2GXAA 3FXMA 1LEBA 3IRRA 3DF8A 2AHQA 4N0BA 2IT0A 3M4OJ 2FNPA 2AO9A 1VQLI 3IRQA 1TC3C 2RC4A 1FNNA 1UHMA 4FTHA 4KDPA 2K3PA 3HUGA 3IAM2 3I3LA 5L3GA 3QOPA 3LAJA 2IS2A 1U0JA 1EA3A 2BW3B 3BR0A 5L3EA 4NB5A 1W7PD 3FKIJ 1BC8C 3T1BA 4G7OF 4WXDA 3PNYA 4CDGA 4MIMA 4DJAA 3GTJJ 3SFZA 1O7FA 4ZTFA 4PZJA 1SFOJ 4EEFG 3MKWB 1B9MA 3L2CA 1E3OC 2DDAA 1USTA 1FOKA 2IS6A 1FTZA 2XPWA 3WTVC 3NRVA 2UV1A 1FSEA 1WJAA 2KT0A 2ZNZA 2JA5J 1U8RA 2XROA 3ABLH 3RJPA 4HQMA 3HZJA 5HLTA 2XRLA 1YIOA 2I10A 2HQ5A 5D5VB 1B8IB 2JQ7A 5D5XB 4FE4A 3CQZJ 4DYQA 4CYDA 2EA2A 3GCMA 2ME6A 4KMFA 1X2MA 4XKCA 2DMQA 3CP2A 1MZBA 4ASNA 5GAEJ 5F08A 3SQNA 4ZH4F 3ZMVA 4AIJA 1RKWA 3BDDA 2MYSA 3RPQA 5HNFA 2GWRA 5BQTA 2LR8A 4BDZA 2EZHA 3EUAA 4BHCA 2RAEA 3MEXA 5H6RA 4JX5A 4M3BA 2A68F 4P9FA 2R5ZA 1PDNC 3AKZA 3OL4A 3OYFA 2NVYJ 3OWTA 1T6SA 5J1RA 4JX6A 2NNNA 5E1XA 4ZYHA 4I99C 1YW9A 2HOEA 4LIUA 5CVVA 4CHUA 3M07A 1YTYA 2DA3A 1OCOH 1FOXA 1ZRDA 3GTMJ 3C2GA 3CDIA 4LITA 4J19A 2Q1ZB 2MA3A 2ZMEB 2JRTA 1X4OA 2M7AA 1O3RA 2XPUA 4HYEA 1V3FA 3CJRB 3K1PA 2V9KA 4EVIA 2LY9A 3GXOA 1PVEA 2ZJ2A 2V1DA 2EQRA 1LDJA 4BXXJ 2H6BA 1LKXA 2L4MA 2YR2A 1SVLA 4XBFA 3COAC 3DLAA 4XR6A 3HSRA 4UUVA 4EM2A 3BWGA 2OTLI 1X3UA 5E1ZB 3BPVA 2CUZA 2E1NA 1O4XA 2GZWA 1BI3A 3ZP5A 2KDZA 4RBOA 2E5ZA 1R49A 2CQQA 1TQPA 2RQPA 3F0CA 1IW7F 2BE5F 2W57A 3WU0A 2DO7A 5JVTA 2DMNA 4DZPA 1HQCA 3HM5A 1TQMA 2GIZA 2CH0A 4LJZF 2GAUA 2CS3A 1D0XA 4KN7X 3MAJA 2MW8A 1YW8A 3K6GA 3GTLJ 2WTEA 5LRRA 2LG4A 3M3YJ 2R7QA 1AOYA 1FYLA 1FX7A 4OIRF 2OUMA 1ENHA 1K79A 1TT5B 2DYRH 2XV4S 4XLPF 1G3SA 4DBRA 2KRHA 2P5LC 2KIQA 4RAZA 1Y39A 3BR2A 2NOGA 5M5XJ 1QO0D 2CW0F 2LTPA 2L9VA 3KZIC 3WTWC 4XIDA 3KP4A 3ZXSA 3S2DJ 1I1GA 3BJOA 4EMSA 3S15J 3IH3A 1VQ6I 3FK7A 1Z67A 4JOMA 1FIAA 1MKMA 2QBYB 4BY1J 1JUMA 3ZQQA 1BI1A 3HKZA 4LK1F 2R7FA 3KEYA 4PGHA 3V7SA 2JUCA 1CF7B 2H27A 3CCMI 1FIPA 3NEUA 4D1QA 1R9TJ 4Y7NJ 4OU0A 4XSZF 1HCRA 2WC2A 3P9IA 4DQ2A 4BQAA 2R7WA 2BYVE 4NUBA 4IF4A 2IXSA 3FXUA 3IC7A 3RSNA 4S0HB 2M45A 2M4KA 3A01A 3ABTA 2WY7Q 3WGGA 4A3JJ 3W6JB 4H0EA 2IJLA 1HDDC 3OL3A 2Y31A 2BOLA 1UELB 3OV8A 5KVRA 4L9NA 4IRHA 5FLMJ 1UHSA 1LJ9A 4HOBA 4DYCA 1JKOC 2K9SA 2Z5UA 2XHKA 3LMMA 1U9NA 1DU0A 1XC5A 2WA0A 2W25A 2HOTA 2LY2A 3HSFA 1P6RA 3CLQA 1H9GA 1GV5A 2PMZN 5DCMA 2FBKA 3TDZC 3D5LA 1OCPA 2PJPA 4A69C 4M74A 3A01B 1MBEA 2RDPA 2LKSA 5B66C 4KA4A 1GHCA 2P5VA 2L54A 1X1AA 3R0AA 1U3EM 1G59A 1N77A 2H8WA 1B8IA 2NNYA 1S5LC 4B1RA 4WCGA 4OWRB 3N4MA 2MC4A 2J5PA 4CSWA 4XOTA 3UKGA 2BY1A 2JTVA 2MFZA 1CF7A 2IPQX 4J01A 4FX4A 2UXNA 3F8CA 1GVJA 1QHGA 4M9ZA 3HOVJ 1W36C 3K70C 2QQ8A 3OOPA 4CCOA 5H2FC 2QBYA 3C7JA 3ZQIA 2MGQA 1UMQA 2VQCA 2HZDA 4OINF 3K4CA 2NXNB 3IL2A 2M30A 2ZCWA 2VBXA 2WB1N 2R0QC 1R5HA 1ETXA 1MD0A 2RVCA 4KISA 2VONA 4BHBA 4N9HA 1D5YA 1ETVA 2IVMA 2JT1A 5CKTA 1MMGA 3KYCB 2QKLB 4UV8A 1QNTA 3WG9A 2A05A 1ZKGA 1K7AA 2ZKZA 2ZBKA 2JA7J 4XM3A 2OC6A 4BL0B 1WH7A 1RR8C 2VBZA 2EFPA 1XDUA 4BU2A 2M1BA 4C9YA 4BBSJ 3BG9A 2NVXJ 2FOWA 4RB0A 2VXDA 5A2QK 4IO9F 2Y0SA 3IH2A 1BW5A 2LF7A 4XKVA 3VSKA 5DD4A 2DOEA 3W2VA 2V6CA 3P5JA 3TDUC 3I53A 3UR3C 1OR7A 1WJFA 2K86A 3BG7A 3SJMA 4LIVA 1MBJA 3ERMA 1SC7A 3AL0B 4M3FA 1BJAA 3FXKA 3HBLA 3PNVA 1LEAA 4Y3OA 5LLQA 4ZDLA 4CICA 1BBYA 3B02A 2KLOA 2HFHA 3TBIA 5TGTA 2VL8A 2X6YA 3SHFA 3GMEA 5FRNA 5B3SH 3MQ0A 3EPZA 1EJ9A 4ETSA 4RAYA 3OYJA 2HYJA 3C1DA 1D8KA 2Z1DA 4HNVA 1T2KA 4HF1A 3MFKA 3K4MA 4BH9A 2HQAA 3HC7A 1ULYA 3Q0VA 4N4NB 1TL8A 1Z77A 4XLNF 4IHTA 1R6RA 2LF8A 1KZHA 2BXZA 2OJED 3HIFA 1WJBA 3GLXA 3L09A 4KIBA 5CLSA 2X6OA 4CGZA 4YG2F 2H94A 3B6AA 3VWBA 5ICFA 3HOXJ 4LG0B 1VFCA 1D1BA 4C30A 2L7MP 5H6QA 1TWHJ 4WXCA 3C2HA 4B44A 1YRNB 2AS5F 3CDLA 5KK1A 4G6TB 3ZCOA 5E17F 2WWYA 1I27A 1TWAJ 4BY7J 3SZGA 3ZMSA 4A12A 3KE2A 2GLOA 3OIOA 4X0GA 4I0BA 1JKPC 2N8GA 2X1DA 1H0MA 4WF2A 5CJ9A 2R7TA 2FNAA 4AU7A 1VQ4I 2QSGX 3DTIA 4QTRA 3RKQA 5BPIA 1OISA 1XS9A 2F6CA 2YU9J 2WV0A 3FZVA 4ESJA 3FISA 2VT2A 2VJ4A 4NC8A 2MSYA 1CGPA 5LBQA 1E0EA 1KU7A 1YRNA 1J09A 2FQ4A 2MD0A 5D6FA 4E6KG 1EH7A 1UB9A 4EJOA 3K10A 3A0HC 1VQ7I 3K2AA 1ETWA 2DTRA 2ZFWA 2M0MA 4LLLA 1BJZA 2HKXA 3ABKH 1X2NA 3HL2A 1MNDA 1U5TC 4HF0A 1XSDA 2IGMA 1PUFB 2OTJI 3V8JA 4DBQA 3ZN0A 4HF2A 2FEZA 1SAXA 3VYRB 1E3HA 4N4OB 1ETOA 1BA5A 3OYEA 2L3DA 3T8RA 2ECBA 1ZN2A 1HW2A 3BTJA 1ONVA 3K4BA 1ZYRF 2HXOA 1ORKA 4HZFA 2D2WA 2W1OA 2X9DA 1Z3YA 1XDSA 2BEOA 4L9VA 1OYIA 1FC3A 1TLHB 3HOZJ 1X19A 5IYBJ 1X1PA 2BVMA 2I8DA 3DV8A 3G1MA 4XSXF 3I4NJ 2KKOA 3F8FA 1YW7A 3H35A 2D5VA 1F43A 2EV0A 2IRFG 2DMUA 3S16J 1BOAA 1UJ8A 2ME0A 1GXPA 1FSHA 4JP0A 3ECOA 1XB4A 2PLYA 2XIGA 1L0OC 2PMUA 4ZYEA 4RAFA 4EJUA 1PYVA 4ZDPA 3K70D 3CC4I 1A6QA 2XVCA 2HPMA 1IN8A 5LFAA 1D3YA 3G1LA 2HYGD 2EZIA 4A6DA 4A5NA 3PUBA 1Q1HA 3HG9A 3ABUA 3HOWJ 4RM2A 5TRDA 5KHDA 1DGWY 3UNGC 2O03A 4QPQA 2K5CA 2L9RA 2E71A 5ICGA 2J5OA 1JKRC 3E5UA 5JR3A 3BTLA 4LD5A 5AIQA 3GTKJ 3H5RA 3U9GA 1R5GA 3BZ6A 3KEOA 1VQNI 3W6VA 5TJJA 5IOYA 2ZNYA 3CZ6A 4PJMA 1QPMA 1ZQ3P 2EFQA 2XB0X 2OCEA 5LD2C 3ASOH 5F6FA 4BEHB 2EV5A 2LVSA 5FFXA 1HKTA 1KU2A 1RPWA 4G7HF 1LDDA 2M8EA 4U87A 1SD4A 2VC0A 5HS8A 1SFUA 4A5MA 4BJTA 4ANJA 4KNYA 2XGDA 3FXQA 5HOOA 1LPQA 2XF5A 1XD7A 5K5OA 2G7HA 1A36A 2HWVA 2CMPA 1MMAA 3SDGA 1WI9A 3CO6C 2DK8A 1HXDA 4HAMA 4GYIA 2YU3A 5F04A 3K1MA 4RLQA 2QGUA 3QRFF 1AKHB 1SVMA 4CYCA 2FOKA 3JSOA 3V7CA 3BG5A 3I54A 5EGOA 3HRUA 4RA2A 3S1RJ 1F4KA 4GFBA 2OBPA 2XB5A 3QP5A 4NC6A 3OYBA 4D7NA 3BZCA 4K2EA 2E34A 2DFEA 2NVQJ 3O2PE 3RIRA 5LHHA 1Z7UA 2EIMH 2Q0OA 3CUQB 2G7UA 1AHDP 5K1YA 2E36A 2XGCA 5CVJA 1QVTA 4HRIA 4OIPF 3CJNA 2VODA 1VQ5I 2E1MB 1V4RA 2XUBA 4LFUA 2DMPA 2E2IJ 2L0KA 4UVBA 1SMTA 5EYRA 1G6NA 3BQZA 3F6OA 3MZYA 4B43A 4R79A 5LRSA 1DP3A 2VE8A 1R5ID 2WAEA 2K27A 2JSPA 3MZHA 1B9NA 3ULQB 1G4DA 2H1KA 4I09A 3T8TA 1F5TA 1MJBA 4BS9A 2WAFA 1QA6A 1VNDA 2K85A 3KLNA 4IXAA 1HW1A 2NAZA 3K69A 1KA8A 2KHMA 3C18A 3ZQFA 3L00A 2XSDC 4MLOA 2W00A 2VKVA 2CFXA 4Y33A 5F1JA 3DU5A 3BPXA 5K5RA 2GXBA 1TWCJ 3BR5A 1RUOA 3WHCA 4A3EJ 4W97A 1B4AA 1QU3A 2XAQA 2PG4A 4UVCA 2A69F 3ECHA 4HEA2 4RAGA 3BTIA 3U1KA 3F21A 3I59A 3DP7A 2LY1A 3E6MA 3I5UA 4I02A 3GFJA 2VBWA 1T33A 3PIOF 1W0UA 3D5RC 3FXJA 3IKVA 2P8TA 1MW7A 3E6BA 3FWEA 1Q1VA 2HDDA 3K2ZA 1BR2A 2V9PA 1STZA 2Y30A 3A4CA 4G12A 3BLYA 1RZ4A 5JHFA 3K4LA 5E3LA 2VE9A 3P7NA 1MDMB 1SD5A 2FXAA 1SFEA 5J8CA 2Q8KA 3HRTA 4XICA 1LFUP 3NARA 3FF5A 2XKOA 2R92J 3VFZA 1ETYA 1USSA 4NHJA 3PSIA 1IUFA 1ZG1A 3KX2A 3JRBA 2X48A 3W2AA 4LOCA 3FBIB 1AU7A 3HXLA 2V1UA 3HRMA 2OPTA 3BQYA 4YFKF 4FQGA 1H9TA 1R4MB 2O9LA 1IF1A 2HQNA 1G8XA 1VTNC 2O61A 4XQFA 1IRZA 3IWZA 1OPCA 2CUFA 1QRYA 3HYIA 2DT7B 5FLVA 2DTZA 2IP2A 5J4YA 1IN4A 3CUQC 1P7IA 1K78A 3LNQA 4M3EA 2DA5A 4L5IA 3TO7A 3RI4A 3DKWA 3J7ZI 2V26A 4XRSA 3DKXA 1WVRA 1X4PA 4NQWB 3QPLA 4QIWN 4HX8A 2XAUA 1Z21A 2EJRA 2FF4A 2R4GA 1FWZA 2YSRA 4IKFA 5J1UA 5HDKA 1OMIA 2ZXWH 4PCQA 4NC7A 1P7JA 1N78A 1ZGAA 3S32A 1BW6A 3GVAA 2XRNA 5DM7F 1U6GA 1I5ZA 2W84A 3OMYA 3X2QH 3S3OA 1JGGA 3WGHA 1W7PA 4QPOA 4II3A 1FY7A 3HGYA 3V8LA 4IX7A 2BY3A 3QU3A 4JBAA 4DZJA 3DTEA 3OIPA 5AIPA 2CQ7A 3DWLE 1FBSA 4U0YA 2CSOA 4KYWA 1CQTA 4Y17A 4B48A 1IXRC 5J40A 1ZRFA 2V7FA 4Y13A 4RGRA 3RKXA 5D4RA 3RDIA 1ZARA 5FROA 1HA8A 4HBLA 1U2WA 4A3KJ 1ZG3A 3S8PA 3ESWB 2XKPA 2Y9ZA 1YHQI 4OIOF 4E7LA 4AWXB 3EYYA 1YG2A 3HKZN 4HX4A 2Z33A 2ZFUA 4YELA 1HF0A 1A35A 1JTYA 3FHNA 2QWWA 2EINH 3OR1C 4L9TA 1DPUA 3DU6A 2EH3A 5ERIA 3TOAA 2EK5A 3LA3A 3WU2C 4DGWB 1MJAA 3REOA 2DPDA 4F7ZA 5BMZA 2VIXA 1J0RA 1IGNA 3BCBA 4BHPA 5ILVA 5J8FA 3LA7A 4AYBA 2A6HF 2NVTJ 2QSHX 1I39A 2VN2A 1P2FA 1BI0A 2V1NA 3NWTA 4LK0F 2O0YA 1MMSA 5D4SA 3QYFA 4I76A 2HVSA 2R7OA 1DQUA 3K4NA 5FKMA 2HOAA 2ID6A 3LSHA 5FFZA 2ZSHB 3C3WA 3E6DA 2DA4A 2VKEA 3JRGA 3GZ6A 2M4GA 1JJ8C 4DOZA 2QVOA 4LB6B 3VYUB 2UUZA 1HLVA 5LGUA 1YOVB 2FX0A 3WE2A 3DFGA 5HLHA 1WFXA 3KP3A 3FMSA 3VSLA 1IRGA 1MBHA 3TO6A 4UUTA 2L01A 2A3SA 1GVDA 4A3BJ 2NS0A 5JHUA 2HPIA 5CVIA 3LAPA 2JPBA 1HKSA 5E8IA 1F1ZA 4XL9A 2HTJA 2Q2EB 1R23A 3TOBA 4PSXA 5DCFA 4EGZA 5K7ZA 1VQPI 1FT9A 2VT3A 2ZJRF 1RKTA 3P9CA 5ICCA 1W5SA 2FUG2 4RGUA 1FPQA 2HDWA 3PSFA 1PP8F 2DK5A 3LFKA 2K02A 5CVUA 3N97A 3HPGA 1OYWA 2LRDA 3ZQLA 4RGSA 2Y2ZA 3CMAI 3CMMA 4L0YB 2VASA 2QQBA 1OJLA 2CYYA 5FKOA 2WBMA 2BV6A 2D1VA 2PMZA 1VZ0A 2Z2SB 3HRSA 4B47A 4G94A 4D7MA 2DJIA 3HJEA 3GFIA 4PJNA 1IRFA 4KIFA 5ILSA 3OS1A 2FBHA 1OFCX 2JVGA 3H5AA 4HW0A 4M6XA 4YEJA 5DCMB 5HLGA 2A5YB 2FMYA 2CQNA 4MFDA 1HBXG 3I4MJ 3ZQ7A 3O6BB 4MGRA 4EV0A 3BG6A 5FKLA 4XK4A 2DW4A 1P9QC 1Z6TA 2M5WA 4BQQA 1YJ9I 1JUSA 1EF4A 1I6XA 1V5GA 4XLFA 4XOPA 4BXFA 4CUGA 3FM3A 2E1MC 1JT6A 3LOCA 5E3MA 3ML6A 2Y0SN 2KDOA 4ITVA 3ZQCA 2EIKH 3QYEA 3J7AY 2ETHA 2DLLA 1RIOH 5EJCA 4E4HA 2KRCA 1JHFA 1MH3A 4CA0A 1L3LA 4C2TA 1TZLA 3K9TA 3OYKA 5GTIC 4XLEA 5LEKA 4AYBN 3E6CC 4CCJA 2DYSH 2IA2A 1EH6A 4IHYA 4XKBA 1FP2A 1JGSA 1APLC 5GPCA 1SVOA 3CD6I 5IP9J 3T0YA 3ZN1A 3G73A 2BHZA 3LSKA 1JHHA 3SEQA 2O6GE 3HOTA 2CW8A 2LKXA 3O8HA 2FE3A 4QSHA 1R71A 4A93J 1ZGJA 2VKHA 2XAFA 2Z99A 3M1CA 5FO5A 1OCZH 2XAHA 2ZSIB 1UAAA 4G7ZF 4LLNA 3HUGB 1S9HA 3FHZA 4HPQA 3CCQI 2PN6A 2K9NA 2GXGA 3U21A 2EV6A 4LG0A 3PIPF 4HDVA 2ACJA 2QKMB 5J6XA 3JRFA 1LFBA 4EGYA 2HI3A 3TEDA 2RKHA 4AM3A 4BYYA 4A0YA 4OMYA 1E2XA 1NTCA 3FXRA 4HSTA 2EZLA 2UWMA 1DUXC 2HTSA 4CYCB 3LQQA 5FLXZ 5EF6A 1ZREA 1SD6A 3S3NA 2YUSA 4HV6A 4IQ4A 5GP9A 4RB3C 3DPTA 1XPXA 2JMWA 1U8BA 2KISA 5IT3A 4R8HA 2PBIA 5DV5A 4HX7A 2VJ5A 3FKJA 2ISZA 1OYYA 3RTRA 3DPUA 4BAYA 2F5DA 5GAGJ 2HU9A 3CESA 3CUOA 3FXLA 3HGGA 3SZPA 3HOSA 3CC2I 1HC8A 2R7VA 1D8JA 1OQYA 1VQ9I 4CZCA 2EA4A 1GLNA 5LEJA 5E18F 5C44J 1O3SA 4P1WA 1FOWA 1KU9A 1OR7C 3TQNA 1OCRH 1MJ9A 1IN5A 5JFRA 3MWMA 1D0ZA 3CJTB 4DNCA 3Q9SA 3ELKA 2KIUA 4LB5A 5EEAA 1X1DA 4M9SA 5M3MJ 1GXQA 1H89C 5J47A 4RGXA 4S04A 4RS8A 3L2QA 4AIDA 2WV1A 3WHBA 4PGGA 1RETA 2LBFB 4I2OA 3SDBA 1IG7A 2CRGA 2MBFA 4P55A 2CU7A 1MSEC 4IHWA 2VOPA 3LSJA 5D6EA 2RN7A 3O3KA 3H0GJ 3VB2A 2M87A
chains in the Genus database with same CATH topology
3PNYA 2Z16A 3TMOA 4DJAA 4ZTFA 3MKWB 2RREA 4RLQA 2X1EA 2XF6A 3H9GA 3KYLA 2UV1A 3RQ4A 3OR2C 4F3QA 1WJAA 2WY8Q 1OLTA 3N05A 5HLTA 3OYBA 3OYGA 2HNHA 3OYAA 2VQGA 4HSRA 4HRIA 4XKCA 2XC7A 2E1MB 3CP2A 1V5EA 4GRIA 2F4IA 3OYIA 4PFPA 2MYSA 1ZELA 1DP3A 4B43A 4R79A 1WJCA 4IQJA 2WAEA 5HNFA 2JSPA 1WJEA 1YX5A 4OAZA 4BDZA 4BS9A 2WAFA 3EUAA 3H9JA 5CQGA 4E7IA 2KHMA 4F52A 4MLOA 1BOBA 2W00A 3A2KA 4Y33A 3AKZA 3DU5A 3OL4A 4RM3A 3OYFA 3M8JA 1YX3A 5FRMA 3OWTA 4E7KA 4HNTA 1V5FA 1FMWA 4LIUA 1QU3A 3RCOA 3OS0A 4H4KC 4HEA2 4JQFA 2X51A 3DTKA 2IGOA 3PNTA 2VQHA 3VYTB 3C2GA 3EUHC 4LITA 2Q1ZB 2LY1A 3BC8A 1X4OA 2M7AA 3LSMA 3LL7A 1LFPA 3TL4X 4BE2A 2E5NA 2L9SA 3DQVC 4ZC3A 3OYLA 3D5RC 3CJRB 2V9KA 1MW7A 5CQEA 2KQRA 1BR2A 4PUSA 1LKXA 3OS2A 3A4CA 3BLYA 3DLAA 4OAYA 4XR6A 5JHFA 3K4LA 2VKDA 4BACA 2CUZA 4F93B 3NWSA 1IRXA 4RLFA 2E5ZA 2MABA 2KZVA 2R7XA 3I9V2 3E0JB 2OV7A 2CH0A 1AA7A 4XLCA 3PSIA 1Z7LA 4HG2A 2CS3A 1D0XA 2A5WA 4ZYAA 3KX2A 3K6GA 2R7UA 3OYHA 2CW7A 2LG4A 3W2AA 4KT6A 3FBIB 2R7QA 4BGDA 2X6XA 3GBGA 3HXLA 2OUMA 2BW3A 4DBRA 2KRHA 2VJJA 1D1AA 2JUGA 4YRVA 3ZXSA 2JVHA 1G8XA 4DIQA 4XONA 4FETA 4XQFA 4JOMA 2LOOA 3LSGA 2VQLA 1ERDA 2DT7B 3LSIA 3ZQQA 3HKZA 1KONA 3AFHA 3KEYA 1MMNA 3QOEA 1WJDA 3H5NA 1X1CA 1LVKA 4D1QA 2V26A 3DKXA 2CFOA 3HPHA 1X4PA 2R7WA 4NUBA 3OOUA 4NQWB 2IXSA 3RSNA 2XAUA 1Z21A 3BCAA 3ZR8X 2M4KA 2R4GA 4CCMA 5KCMA 4IKFA 2WY7Q 4CCLA 3LFUA 2IS1A 4NC7A 2NOJB 4Y4RA 1N78A 2WADA 2M7BA 3S32A 3OL3A 4AVZA 2BOLA 1UELB 3K4KA 3OMYA 3S3OA 4QPOA 4II3A 3LMMA 4IX7A 2WA0A 3QODA 4E7JA 3PJRA 2LY2A 3DTEA 3OIPA 3DWLE 4XLHA 3G2BA 1NG7A 3D5LA 4B48A 2K9LA 3CP8A 2KL4A 2V7FA 3VDXA 2K9MA 1X1AA 1G59A 1N77A 1HA8A 5FROA 3FBNB 3H9QA 4OWRB 4C2UA 2MC4A 4CSWA 4XOTA 5KNLA 3S8PA 2MFZA 4E7LA 3DKYA 4J01A 3OY9A 4XKWA 1QHGA 1W36D 2ZFUA 4YELA 1W36C 3VYSB 2L7KA 3K70C 4CCOA 3FHNA 3L2VA 3OR1C 4CCKA 3DU6A 2XSJC 2VQCA 2KMUA 3IUOA 2A6TA 2HZDA 4XNFA 4DGWB 3MKZA 3K4CA 3ONQA 4KJZA 3FDYA 2VIXA 3V42A 3BCBA 2LBFA 2HVRA 4KISA 4PJJA 4AYBA 5CKTA 4XLAA 1MMGA 2QKLB 4ZTJA 2V1NA 3NWTA 3PL8A 1JI8A 3QYFA 2HVSA 4BEHA 4XM3A 1DQUA 2R7OA 2OC6A 3K4NA 4XN0A 4BL0B 4U7BA 3LSHA 2ZSHB 4BU2A 4C9YA 4KITB 2BVLA 2M4GA 2VXDA 4DOZA 2Y0SA 4IZZA 3VYUB 2UUZA 4XKVA 3VSKA 1YE9A 3W2VA 3UR3C 3IP4B 1WJFA 3BG7A 1MMDA 4LIVA 1WFXA 2F5VA 3AL0B 3VSLA 2E60A 3H0DA 2IGKA 3PNVA 4Y3OA 1K6YA 4II2A 4ZDLA 4PSWA 2WB1A 2KLOA 2LC2A 3TBIA 2HPIA 5TGTA 2VL8A 2X6YA 2R7RA 5FRNA 1UG0A 2RNGA 3EPZA 2KP6A 3MKYB 4XL9A 2L2OA 3OYJA 2Q2EB 2ZXHA 2Z1DA 4PSXA 2GOXB 4PJLA 4E7ZA 1NG6A 3K4MA 3OYNA 2HQAA 3HC7A 4N4NB 3PFYA 1R6RA 2RQQA 2X1CA 2FUG2 1WJBA 3PSFA 2HDWA 2L9NA 1D1CA 4XN3A 4XMYA 2LH9A 3HPGA 3OYMA 2LRDA 3AL0C 2CV2A 3VWBA 1D1BA 4C30A 4LG3A 2PJRA 3CJQB 3L2WA 3CMMA 2VASA 3C2HA 4B44A 2IS4A 2WBMA 3E1SA 2ZXIA 3ZCOA 4G6TB 2Z2SB 2PMZA 1VZ0A 4B47A 4ZJZA 2CV1A 2DJIA 2V4JC 3SYTA 4PJNA 3SZGA 4PK4A 3W3CA 4B3XA 3OS1A 3H5AA 2JVGA 4X0GA 4YEJA 2CUJA 5HNHA 2IS6A 2X1DA 2AQFA 2WAQA 2R7TA 3BG6A 4BJ5C 1P9QC 1BR4A 4BQQA 4AU7A 3DTIA 1LDKB 1V5GA 4XLFA 4XOPA 4BXFA 4CUGA 2F6CA 2E1MC 1X1BA 2X6WA 1FMVA 2VJ4A 4NC8A 2VJIA 1E0EA 2DXIA 2KDOA 4ITVA 4PFOA 1J09A 3S93A 3QYEA 3L2UA 2AQEA 1DGRM 3J7AY 2MD0A 3W2WA 4D9JA 4E6KG 2W82A 4J00A 1MNEA 2VLAA 3K10A 2IGNA 4E4HA 2KRCA 4CA0A 4F92B 4C2TA 1TZLA 2M0MA 3OYKA 4BE0A 4XLEA 3HL2A 4CCJA 1MNDA 4XKBA 2IGMA 4E7HA 4E7SA 4DBQA 2LREA 2P0WA 2W4SA 3D5SC 3S3MA 2KPMA 3LSKA 3SEQA 3VYRB 2VPLA 4N4OB 3HOTA 2CW8A 2LYCA 3K4JA 3OYEA 3MMYB 2VKHA 3M1CA 1QHHD 3K4BA 2R7SA 3ZGKA 5HVQC 1UAAA 2ZSIB 3HUGB 4P5OA 4BJ6C 1S9HA 3QYBA 2W1OA 4HPQA 3CF2A 3U21A 1Z3YA 4ZDOA 2QKMB 2PJRB 1X19A 2ELJA 1MMAA 2BVMA 2I8DA 2W7NA 2XF7A 2GOMA 1Y6IA 4CH7A 4RMNA 3H35A 3L2RA 4HSTA 2UWMA 3DPLC 2O5RA 1TT0A 3S3NA 3OIQA 3EUKL 1PYVA 4IQ4A 4ZDPA 1D0YA 3DPTA 2DOAA 3K70D 2VXZA 3A1YA 4F55A 2JA2A 2HPMA 4BQOA 4HNUA 5LFAA 2X85A 1Z3XA 4FASD 4BE1A 2L5QA 4BDYA 3OYCA 4BUPA 1WJ5A 2HVQA 3PUBA 4BQNA 3HG9A 2XDVA 4RM2A 1BR1A 3RPUD 1T0FC 2VJ5A 3FKJA 4NNJA 5KHDA 1DGWY 1SAUA 3UNGC 1N75A 4QPQA 3RTRA 2V6EA 3DPUA 2K5CA 3HOSA 2HU9A 3CESA 2R7VA 1Y56A 2CV0A 2DT6A 3IAS2 2M3AA 4CZCA 1GLNA 3H5RA 3F9KA 4P1WA 3SEZA 1OR7C 2DCEA 3DEEA 3CZ6A 2VB6A 4XORA 4PJMA 1D0ZA 1PJRA 1SFKA 5CPRB 5LD2C 4BEHB 1X1DA 4U87A 3L2QA 3OYDA 1T95A 4F91B 4BJTA 2LBFB 4ANJA 2K3PA 4CCNA 3SDBA 4EATA 5HOOA 3IAM2 3I3LA 2IS2A 1U0JA 1EA3A 2XF5A 2BW3B 3MD2A 3ZRGA 2CMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7K A; 
#chains in the Genus database with same CATH topology
 4Z6Y A;  2H8R A;  4QLC U;  2DT5 A;  5FKN A;  2XF6 A;  3KYL A;  4EM1 A;  3RQ4 A;  3AG4 H;  2AXL A;  4O5V A;  4L5J A;  2WY8 Q;  1BIA A;  1OLT A;  2FML A;  3N05 A;  1T39 A;  4M6Y A;  4IRG A;  1OKR A;  2XAS A;  1P92 A;  2CUE A;  2JZY A;  4MEY F;  2PQ8 A;  2MLK A;  2HNH A;  1FYK A;  4A6E A;  2COB A;  2OU2 A;  5J1Y A;  3DBH B;  1QZE A;  2BY2 A;  1MNM C;  3R4K A;  2M34 A;  4PFP A;  1LE8 B;  1ZEL A;  1Z1D A;  1N25 A;  4WK8 F;  4MEX F;  1IXC A;  1WJC A;  3FIW A;  1Y1V J;  2QZ8 A;  2XPV A;  1YX5 A;  4HQE A;  4P96 A;  2B9S A;  2XAJ A;  1XGS A;  2YX7 A;  2COM A;  1DP7 P;  2GM4 A;  5CQG A;  1XMK A;  4E7I A;  3WTS C;  3E3V A;  4F52 A;  3ROU A;  4RB1 A;  2DQL A;  3F8N A;  1Y1W J;  4R1H A;  3MCZ A;  4RM3 A;  4B3A A;  3M8J A;  1YX3 A;  5FRM A;  1WCM J;  5J3L A;  3RPU A;  4L5E A;  4GGG A;  4IRI A;  4HNT A;  3GZN B;  1V5F A;  2DMT A;  5FJ8 J;  4B8X A;  2BZT A;  2E1O A;  3GTO J;  2FRH A;  3RCO A;  3OS0 A;  4H4K C;  3TW7 A;  1AKH A;  2EIJ H;  1F9N A;  4JQF A;  3CF5 F;  1B72 A;  2HZT A;  3G71 I;  3EUH C;  3KZY A;  1ETK A;  1WQ2 A;  3IH4 A;  1MIJ A;  3BC8 A;  3LL7 A;  1LFP A;  1T38 A;  2L9S A;  1TP4 A;  4ZC3 A;  3OYL A;  3BP8 A;  3AG2 H;  3WTY C;  2ISY A;  2B7E A;  1SMY F;  5CQE A;  2KQR A;  4Q47 A;  1U78 A;  5GPA A;  3G1O A;  1J75 A;  5DTD A;  2VKD A;  5IT9 K;  5FLX K;  4F93 B;  4L0Z B;  3CCU I;  1IRX A;  4RLF A;  2O8X A;  1SAN A;  3DBR B;  3QPH A;  2MAB A;  2KZV A;  2DAO A;  2R5Y B;  2R93 J;  2R7X A;  3I9V 2;  4OMZ A;  2OV7 A;  1AA7 A;  3ZMD A;  3ZMT A;  3Q0U A;  9ANT A;  4HG2 A;  1FYM A;  3ZPL A;  4M6V A;  1LQ1 A;  1I50 J;  2R7U A;  5KAF C;  1W5C C;  5E3O A;  2QQ9 A;  2ZJQ F;  4KT6 A;  4BGD A;  2ICW G;  4UUS A;  1R1U A;  2X6X A;  4M73 A;  5AON A;  2CO5 A;  1FTT A;  3R60 A;  1TW3 A;  5DM6 F;  1JT0 A;  2NRA C;  4IHX A;  1RRJ A;  3GO5 A;  1TWF J;  4ABZ A;  1D1A A;  5HDN A;  2JUG A;  5IPA A;  2JVH A;  3ERE D;  2PEX A;  1OCC H;  4XON A;  2FJ1 A;  1W1W E;  2HOS A;  3CLO A;  2VQL A;  3RKY A;  2O8K A;  1FJL A;  2W85 A;  2JA6 J;  3LSI A;  3PO2 J;  1ERD A;  2IAI A;  3DBL B;  4A3M J;  2LDU A;  1WSU A;  1MMN A;  3J7A O;  1WJD A;  1J2X A;  2DA7 A;  4JX4 A;  1RES A;  3G6E I;  1LVK A;  3CO7 C;  4YFX F;  4Q4Z F;  5IYD J;  4ESF A;  3CME I;  3HPH A;  1BIB A;  3MKL A;  2ZB9 A;  4NBQ A;  2OD5 A;  3KP7 A;  1R1V A;  2HKO A;  3BCA A;  5HDG A;  1VF9 A;  5FB2 A;  5M5W J;  4CZZ A;  4CCL A;  3ASN H;  2IS1 A;  2O3F A;  2DI3 A;  2GBY A;  2R3S A;  4Y4R A;  3PUF A;  2VOO A;  2EPF A;  1IJW C;  3K4K A;  2UZK A;  3A03 A;  2JWT A;  1SEU A;  3JRI A;  4I0A A;  3FMQ A;  5HS7 A;  2Z9O A;  1ZK8 A;  2K3F A;  2FA5 A;  1H88 C;  3BOQ A;  3QOD A;  2EFW A;  2CG4 A;  1NG7 A;  2YPR A;  3CP8 A;  2AXT C;  3VDX A;  1JE8 A;  1RI7 A;  3HHG A;  3DLL F;  1T56 A;  3M7G A;  5ILU A;  2K9M A;  2F5F A;  2JA8 J;  4P9U A;  2DPU A;  3Q9V A;  3H9Q A;  1XSV A;  5KNL A;  3S1N J;  1RC9 A;  3DCF A;  3KPH A;  3I64 A;  2ESN A;  3DKY A;  3FK6 A;  3OY9 A;  1PUE E;  2LMD A;  5IYC J;  1J9I A;  3VYS B;  2L7K A;  3I56 I;  3L2V A;  3ABM H;  2Y0M A;  3PQJ A;  2KJC A;  3L9F A;  2JJ7 A;  3GLL A;  2KMU A;  3IUO A;  3OSG A;  3MKZ A;  2YS9 A;  3K7A J;  4KJZ A;  1YS7 A;  1NK2 P;  3FDY A;  3JTH A;  4AIK A;  1ZH5 A;  3V42 A;  4FHT A;  5EG0 A;  2QF7 A;  1YI2 I;  3BRO A;  2LBF A;  2M9H A;  4PJJ A;  1S6L A;  3BY6 A;  3O8G A;  4UV9 A;  5GAH J;  4XLA A;  4C3J J;  5A2Q Z;  4HDU A;  1QVU A;  3HTS B;  3BZK A;  3S17 J;  2R7Z J;  1JI8 A;  3DEW A;  4UY8 I;  3TO9 A;  4NQW A;  2LNB A;  1GUU A;  2EWN A;  2PX9 A;  5M5Y J;  1GDT A;  2H1L A;  3WG7 H;  5EDN A;  2L4A A;  4KIT B;  4CXF A;  2BVL A;  3KFW X;  4BKX A;  2QUF A;  1TWG J;  4FX0 A;  3BR6 A;  4N9I A;  1YE9 A;  3EET A;  1ZRC A;  4U0W A;  3IP4 B;  4BNC A;  1MMD A;  4OOI A;  1W7P B;  2E60 A;  2G9W A;  2FD5 A;  2Y75 A;  2KJB A;  2KIF A;  5CVR A;  1K6Y A;  5BOX A;  4II2 A;  1Z91 A;  4V19 K;  1HDP A;  2L7F P;  1RNL A;  1ZTR A;  5DEQ A;  4UVA A;  4GDF A;  3BT9 A;  2R7R A;  2DFH A;  1LB2 A;  1UG0 A;  1E3P A;  2KP6 A;  3MKY B;  3H3V K;  4KMU X;  1VQO I;  2L2O A;  2QM3 A;  4Q5S F;  2ZXH A;  2VI6 A;  4PJL A;  1TQI A;  1HOM A;  4ESB A;  4U7D A;  5FKK A;  3PFY A;  5L3C A;  1FEX A;  4O3M A;  3IHU A;  2L9N A;  2IA1 A;  4XN3 A;  1I3A A;  3AL0 C;  2CV2 A;  4A3G J;  3EUH A;  1KGS A;  4LG3 A;  2PJR A;  3CJQ B;  3L2W A;  1IN7 A;  3KP6 A;  1LUJ B;  1B59 A;  1QBJ A;  1MBK A;  3S1M J;  1QZY A;  2DQR A;  2ZXI A;  4ON0 A;  5BPD A;  1FOY A;  1ZR4 A;  1ZGW A;  4ZJZ A;  3QWL A;  1TNS A;  3WOD F;  5ICE A;  1B1B A;  3W3C A;  5HNH A;  1WI3 A;  4YFN F;  5FD5 A;  2DJN A;  2L02 A;  3L7W A;  2AQF A;  4MNU A;  4UHT A;  2WAQ A;  5IY5 H;  2P81 A;  1K61 A;  4BJ5 C;  2KFD A;  3TP3 A;  2ZME C;  5KAI C;  1LDK B;  2OQR A;  4FT8 A;  4DW6 A;  3V4G A;  2Z3Y A;  1Z9C A;  1AWC A;  2DA2 A;  1X1B A;  2NS8 A;  2H09 A;  5E1W A;  1ON1 A;  3J7Y J;  1QQI A;  2DA6 A;  3L2U A;  1KQ9 A;  5E3N A;  1DGR M;  2D1H A;  4D9J A;  1GT0 C;  4M3D A;  2CQX A;  2EIL H;  3PM1 A;  1XG1 A;  1R7J A;  3H3U A;  3H1C A;  3G4S I;  1MBF A;  4LMY A;  2R5Z B;  4L9J A;  3CTA A;  3KLO A;  3WTT C;  2JN6 A;  2QCO A;  4JK1 X;  1BC7 C;  2GA1 A;  3QU6 A;  4KUM A;  1Z6R A;  3GUD A;  4E7H A;  4S05 A;  3M8F A;  2LRE A;  1IDY A;  2P0W A;  2W4S A;  3BR3 A;  2A6E F;  3KZZ A;  5B5E C;  3S3M A;  2M0C A;  3JRD A;  4MFE A;  1Y8R B;  3ZMZ A;  3WU1 B;  2LYC A;  2ZJP F;  2OA4 A;  3MMY B;  4G6Q A;  4X6A J;  1KYZ A;  1FLI A;  2R7S A;  1R4N B;  1OCT C;  4CO8 A;  3ZGK A;  5HVQ C;  2DOD A;  1ACI A;  4P5O A;  1YS6 A;  3QYB A;  3CF2 A;  3KEQ A;  1Y0N A;  2STT A;  3P9K A;  1J5Y A;  1P4X A;  2YX4 A;  1QGP A;  2JK3 A;  2PJR B;  2JRM A;  5F27 A;  4HV5 A;  5EEG A;  1RR7 A;  1S8N A;  1ETQ A;  1U5T B;  4M3G A;  2XF7 A;  4MQV A;  2GOM A;  5EGO B;  4AIH A;  3MVP A;  4CH7 A;  1G3T A;  3NQO A;  2L7Z A;  4RMN A;  3EQL F;  3I0T A;  2LKP A;  3VOD A;  2F4M B;  2ADU A;  3LST A;  1W0T A;  2F2E A;  1T8I A;  3GTP J;  1KYW A;  2JPC A;  1HST A;  2ZC2 A;  2DOA A;  2VXZ A;  2V9V A;  4HNU A;  3CC7 I;  3J80 Z;  4BE1 A;  2HXI A;  3DEU A;  4YIR X;  2L5Q A;  4BDY A;  4BUP A;  1WJ5 A;  5E79 C;  2K4J A;  4Z2Y A;  1BR1 A;  4WX9 A;  1T0F C;  1XMA A;  1JXS A;  4NNJ A;  1SAU A;  4Q48 A;  1K83 J;  4KT5 C;  1A5J A;  2V6E A;  3GFM A;  2Y9Y A;  2V79 A;  2CV0 A;  2EB7 A;  4LGW A;  2M3A A;  5CYV A;  1D5V A;  1A04 A;  2NYX A;  3CCJ I;  4PJ0 C;  3F9K A;  4HLX A;  3RYR A;  3CCV I;  1EH8 A;  2QSF X;  4I6Z A;  3LQR A;  2VB6 A;  3TGN A;  1SFK A;  5CPR B;  3WTX C;  1V54 H;  1XN7 A;  3HTU A;  2K9Q A;  3CCR I;  2UXX A;  1U5T A;  3LWF A;  3QQA A;  2E2J J;  6PAX A;  1ZG5 A;  1K4T A;  1G3Y A;  4LLG F;  3JRE A;  3E7L A;  2HR3 A;  4M71 A;  3OYD A;  4FCY A;  1T95 A;  1IXS B;  2NS7 A;  4F91 B;  2NVU B;  4X1E A;  3D0S A;  4CCN A;  4EAT A;  1S3J A;  3R0J A;  4GO1 A;  3LSR A;  4ENM A;  4V2G A;  1T08 B;  3MD2 A;  4EJV A;  3GTQ J;  2C6Y A;  3ZRG A;  1FBU A;  1ODD A;  2CQK A;  3TMO A;  2Z16 A;  4FE7 A;  1ZLK A;  1WWX A;  2HQR A;  1LVA A;  5K5Q A;  4EM0 B;  3KET A;  4IOC F;  2RRE A;  2I5U A;  3JTG A;  1J7K A;  3A0B C;  2LFB A;  2X1E A;  1IV6 A;  3H9G A;  3PQK A;  5M3F J;  3OR2 C;  4F3Q A;  3F23 A;  1O3T A;  1YJN I;  1WZ2 A;  5FD6 A;  3EYI A;  2OQG A;  1WPK A;  3KP2 A;  4MQ9 F;  5D8L B;  3AG1 H;  4A3C J;  1O57 A;  1XCB A;  4EJW A;  1UCR A;  5B1A H;  4UXN A;  3OYG A;  5EZG A;  2VPR A;  5JLW A;  3OYA A;  2VQG A;  4HSR A;  5EEH A;  2LD5 A;  3HHH A;  3CCE I;  1XGN A;  2EFN A;  2XC7 A;  5IP7 J;  1RUN A;  2IA0 A;  1V5E A;  1JKQ C;  2M8G X;  1ZHF A;  4GRI A;  5IOZ A;  1JTX A;  2F4I A;  3OYI A;  1WHU A;  1JJ6 C;  2HS5 A;  2FU4 A;  5LHI A;  5C4J J;  4IOA F;  2DU9 A;  3J81 K;  3LSP A;  1YO5 C;  4IQJ A;  4MHG A;  2DFF A;  4ZZL A;  1WJE A;  1XCV A;  3HB9 A;  3F22 A;  5HS9 A;  2TCT A;  4OAZ A;  3JAM K;  3WTU C;  1M1E B;  1MGT A;  4PDK A;  3H9J A;  1X3W B;  4BXU A;  3JCU C;  3ZQH A;  1BOB A;  3A2K A;  1I3Q J;  2DA1 A;  3S2H J;  1T0F A;  1MDM A;  1YLF A;  4E7K A;  3Q5F A;  1FMW A;  1E17 A;  1VI0 A;  3BTC A;  1XTA A;  4UNO A;  4YIF A;  1POG A;  1JUP A;  1S29 A;  2X51 A;  4D0P A;  3DTK A;  2IGO A;  3PNT A;  2VQH A;  2CJJ A;  3VYT B;  2OZ6 A;  3TP0 A;  3RZD J;  3I55 I;  3HOU J;  2P5K A;  3LSM A;  3TL4 X;  4BE2 A;  3QPS A;  2E5N A;  2FSW A;  2JSC A;  3DQV C;  3W6K B;  2LLK A;  2KRF A;  4AD9 A;  2TRT A;  4GYG A;  4I01 A;  4PUS A;  5DDG A;  5D5W B;  3OS2 A;  3JR9 A;  1I6H J;  5B1B H;  2VUM J;  4OAY A;  1TNT A;  4BAC A;  5BNG A;  2P6T A;  2E7W A;  4A0X A;  2Y48 A;  3NWS A;  1YQA A;  3D1N I;  1F36 A;  2Y69 H;  4IJA A;  4U0V A;  1MSF C;  4IPA A;  4EJT A;  1V55 H;  2ELH A;  2GIV A;  3BG3 A;  3WGI A;  3E0J B;  1WH5 A;  3HOY J;  4XLC A;  1R00 A;  1Z7L A;  2P7C B;  3S2W A;  5JLX A;  1YYV A;  2A5W A;  4ZYA A;  1A31 A;  2F5C A;  5HOD A;  1ZAO A;  4TV7 A;  3OSF A;  2EBI A;  3OYH A;  2CW7 A;  2XGE A;  2O7O A;  3GBG A;  3I71 A;  1S7A A;  3JRA A;  1Z0X A;  2BW3 A;  1IUY A;  1YJW I;  2A61 A;  1IC8 A;  2QEX I;  5DS9 A;  3KP5 A;  2VJJ A;  1MBG A;  1IV8 A;  4A2U A;  1UZC A;  3H36 A;  1BL0 A;  4YRV A;  3SZT A;  1XGO A;  1NK3 P;  1S72 I;  2QLZ A;  3FXO A;  4DIQ A;  1ZLJ A;  3LA2 A;  4FET A;  4KIG A;  2X0L A;  4RB2 C;  2LOO A;  1W4M A;  3LSG A;  1S7O A;  4G6D A;  2ZXJ A;  1K6O A;  4AUX A;  1KON A;  3AFH A;  3QOE A;  1NHA A;  1A6I A;  1Z05 A;  3I4P A;  1B72 B;  3H5N A;  2ZME A;  1X1C A;  1KU3 A;  3BJ6 A;  4A3L J;  1HSJ A;  5E8G A;  2B63 J;  3F72 A;  5E20 A;  2BHY A;  2OCC H;  2CFO A;  3H3Z A;  3OOU A;  3JSP A;  3DXJ F;  4M9X A;  3ZR8 X;  3C2B A;  1UG2 A;  4CCM A;  5KCM A;  2BGC A;  3LFU A;  4MTE A;  2CGP A;  2NOJ B;  1NH3 A;  1MH4 A;  2WAD A;  2M7B A;  4ENJ A;  2GA2 A;  4AVZ A;  2LK2 A;  3S1Q J;  3QP6 A;  2WAQ N;  5DD8 A;  2DFI A;  1ZR2 A;  3BJA A;  2FQ3 A;  5D5U B;  4W1U A;  3AAF A;  3A02 A;  1HKQ A;  3G3Z A;  1BN5 A;  2W48 A;  4OIQ F;  4E7J A;  3PJR A;  3PO3 J;  3MN2 A;  4XLH A;  3GEZ A;  3G2B A;  1C0W A;  3IWF A;  3F6V A;  2K9L A;  3B73 A;  3IV5 A;  2KL4 A;  4WXH A;  1X3Z B;  4GXO A;  5LHG A;  4C2M J;  3M1E A;  3FBN B;  2RGV A;  1G3W A;  1QPI A;  4C2U A;  1O3Q A;  4A3I J;  3GTG J;  2F4O B;  4XRM A;  4XKW A;  5DYM A;  1Y0U A;  1W36 D;  2DN0 A;  3RYP A;  2HYF A;  5HLI A;  2K40 A;  1SD7 A;  2V1X A;  4CCK A;  2ECC A;  2XSJ C;  2P7V B;  3M9A A;  4ENN A;  1BI2 A;  2MD5 A;  2A6T A;  2EZK A;  4NDL A;  4XNF A;  2B0L A;  1YFH A;  3RZO J;  2MH9 A;  2P4W A;  3ONQ A;  2HGC A;  3WTZ A;  2HEO A;  4ZZD A;  3S14 J;  3K0L A;  4FIS A;  5J4V A;  2OF7 A;  2DDB A;  4O6J A;  2HVR A;  5F0F A;  3V8K A;  1UHW A;  4ZTJ A;  2M2E A;  3PL8 A;  3I58 A;  2QYO A;  2K7L A;  2QQA A;  2F48 A;  4BEH A;  4XN0 A;  4U7B A;  1S7E A;  1TW2 A;  4MTD A;  1VQ8 I;  5C4X J;  4M72 A;  4HLY A;  3F8M A;  5JVG F;  3V7R A;  3GX4 X;  3GZ5 A;  4IZZ A;  2E7X A;  3CMY A;  1REP C;  3GYH X;  1PP7 U;  2IBD A;  4V2F A;  3WE3 A;  1IO2 A;  1EKE A;  2BXY A;  3ZMU A;  4DYR A;  2F5V A;  4AVP A;  3VPR A;  3H0D A;  2IGK A;  2HDC A;  1R22 A;  1P4A A;  2W24 A;  3F3X A;  5L3D A;  2Q2E A;  4PSW A;  2WB1 A;  4ZYG A;  2LC2 A;  3JW4 A;  3GFL A;  2RNJ A;  3QPT A;  4IHV A;  2RNG A;  4YII A;  1IDZ A;  2PI0 A;  3FM5 A;  3L1P A;  3VEP A;  3EDP A;  1VQK I;  2IEK A;  2GOX B;  3R6S A;  4E7Z A;  1NG6 A;  3OYN A;  3QAH A;  1IAW A;  1YIJ I;  4RDU A;  3F8B A;  2RQQ A;  1B6A A;  2X1C A;  1K4S A;  2K4B A;  1U9O A;  2LSO A;  4EQQ A;  4QWQ A;  3E97 A;  1FZP B;  1D1C A;  2KZG A;  3R61 A;  5IP6 A;  2R5Y A;  1DPR A;  4XMY A;  2LH9 A;  3OYM A;  4B09 A;  3IKT A;  2DOF A;  5FGM A;  2KIM A;  1IN6 A;  3KIO A;  2BBY A;  3T5X A;  3JRH A;  5GTH C;  1BM9 A;  2IS4 A;  3E1S A;  3ISP A;  2H6C A;  1R1T A;  5F1R A;  2CV1 A;  2V4J C;  2PFB A;  3SYT A;  3K1N A;  3PFI A;  5BS6 A;  2D45 A;  4PK4 A;  2E35 A;  3U2R A;  1H8A C;  4B3X A;  2CUJ A;  1R36 A;  2ZO4 A;  2GQQ A;  3JAM Z;  5GAD J;  2ESH A;  4GCV A;  1LNW A;  3ZQG A;  1HW5 A;  1FBQ A;  1X58 A;  1Y8Q B;  1K78 B;  3RQI A;  2G0E A;  1XMX A;  2TDX A;  1BR4 A;  4A3D J;  3FMR A;  1KQ8 A;  4B4C A;  2OZU A;  4KIC A;  5ED4 A;  2E1C A;  2CWE A;  3GF2 A;  5L3F A;  1G2H A;  5DUI A;  3FX3 A;  3MZ8 A;  1LE8 A;  2X6W A;  3CUQ A;  1FMV A;  4IHS A;  2VJI A;  2DXI A;  2EFO A;  3M8E A;  2FBI A;  5JI6 A;  4PFO A;  4WWC A;  3S93 A;  5TIS C;  2AQE A;  3ZOB A;  5C3E J;  4Y52 J;  4IVN A;  3W2W A;  1P4W A;  2W82 A;  4J00 A;  1MNE A;  1VQM I;  3CDH A;  1GV2 A;  3Q3S A;  1J59 A;  4L18 B;  2VLA A;  4E70 A;  3RKW A;  3Q0W A;  2IGN A;  3TW6 A;  4A3F J;  2DBB A;  3TKY A;  4ENK A;  4F92 B;  4UB6 C;  5F0C A;  4MO7 A;  2R7D A;  4BE0 A;  4Y15 A;  1SFX A;  1TBX A;  2VC1 A;  5EG0 B;  5IT9 Z;  4D5F A;  2PMH A;  4E7S A;  3CCL I;  5EZH A;  1DU6 A;  3D5S C;  1XGM A;  2OAZ A;  3I59 B;  2E19 A;  2KPM A;  2MLG A;  3BR1 A;  2VPL A;  2ELK A;  4HA8 A;  5DUK A;  3CCS I;  4JYK A;  4C3I J;  1DDN A;  3HEF A;  3K4J A;  4UB8 C;  1I1S A;  1PUF A;  5K7F A;  1UFM A;  2E2H J;  2ID3 A;  1QHH D;  3CCY A;  5F64 A;  1WGX A;  1WRJ A;  4BBR J;  2MG4 A;  2X4H A;  4BJ6 C;  4I98 B;  2LP0 A;  3HDD A;  4KN4 X;  3HSE A;  4ZDO A;  2F5E A;  5H20 A;  2STW A;  2ELJ A;  1TTY A;  4C3H J;  2MH2 A;  2W7N A;  1R58 A;  3AG3 H;  1Y6I A;  3U1D A;  4D5C A;  1QZZ A;  4IL6 C;  3L2R A;  3B6C A;  5LGN A;  3DPL C;  4XRF A;  5K7H A;  2BY0 A;  2O5R A;  1YIT I;  2VBY A;  1TT0 A;  3E5Q A;  1XSX A;  1IZ1 A;  3H92 A;  2XGX A;  3OIQ A;  4AC0 A;  3EUK L;  4G9Y A;  1W5T A;  1EV7 A;  1D0Y A;  3KYD B;  5L3B A;  1XX5 A;  2RV8 A;  5D8K B;  3A1Y A;  4F55 A;  2JA2 A;  4ZYD A;  4BQO A;  4G8X A;  5LGT A;  2X85 A;  1Z3X A;  4FAS D;  3E5X A;  1WKM A;  3OYC A;  3J81 Z;  1O7L A;  2HVQ A;  4BQN A;  1KQ0 A;  3KCC A;  2A07 F;  2XDV A;  5F0H A;  4IEJ A;  3RPU D;  2P6S A;  4I7H A;  1N75 A;  2IW5 A;  3GWZ A;  3SXY A;  3VOE A;  1T98 A;  4A0Z A;  1Y56 A;  3SFI A;  4UUS B;  1FP1 D;  2DT6 A;  3IAS 2;  4U88 A;  1ITY A;  2QEN A;  3NAU A;  2XAG A;  3JRC A;  1ON2 A;  4KFC A;  4XRS G;  3SEZ A;  2DCE A;  3DEE A;  3GW2 A;  4XOR A;  2QA4 I;  1PJR A;  3J80 K;  2MC3 A;  2GXA A;  3FXM A;  1LEB A;  3IRR A;  3DF8 A;  2AHQ A;  4N0B A;  2IT0 A;  3M4O J;  2FNP A;  2AO9 A;  1VQL I;  3IRQ A;  1TC3 C;  2RC4 A;  1FNN A;  1UHM A;  4FTH A;  4KDP A;  2K3P A;  3HUG A;  3IAM 2;  3I3L A;  5L3G A;  3QOP A;  3LAJ A;  2IS2 A;  1U0J A;  1EA3 A;  2BW3 B;  3BR0 A;  5L3E A;  4NB5 A;  1W7P D;  3FKI J;  1BC8 C;  3T1B A;  4G7O F;  4WXD A;  3PNY A;  4CDG A;  4MIM A;  4DJA A;  3GTJ J;  3SFZ A;  1O7F A;  4ZTF A;  4PZJ A;  1SFO J;  4EEF G;  3MKW B;  1B9M A;  3L2C A;  1E3O C;  2DDA A;  1UST A;  1FOK A;  2IS6 A;  1FTZ A;  2XPW A;  3WTV C;  3NRV A;  2UV1 A;  1FSE A;  1WJA A;  2KT0 A;  2ZNZ A;  2JA5 J;  1U8R A;  2XRO A;  3ABL H;  3RJP A;  4HQM A;  3HZJ A;  5HLT A;  2XRL A;  1YIO A;  2I10 A;  2HQ5 A;  5D5V B;  1B8I B;  2JQ7 A;  5D5X B;  4FE4 A;  3CQZ J;  4DYQ A;  4CYD A;  2EA2 A;  3GCM A;  2ME6 A;  4KMF A;  1X2M A;  4XKC A;  2DMQ A;  3CP2 A;  1MZB A;  4ASN A;  5GAE J;  5F08 A;  3SQN A;  4ZH4 F;  3ZMV A;  4AIJ A;  1RKW A;  3BDD A;  2MYS A;  3RPQ A;  5HNF A;  2GWR A;  5BQT A;  2LR8 A;  4BDZ A;  2EZH A;  3EUA A;  4BHC A;  2RAE A;  3MEX A;  5H6R A;  4JX5 A;  4M3B A;  2A68 F;  4P9F A;  2R5Z A;  1PDN C;  3AKZ A;  3OL4 A;  3OYF A;  2NVY J;  3OWT A;  1T6S A;  5J1R A;  4JX6 A;  2NNN A;  5E1X A;  4ZYH A;  4I99 C;  1YW9 A;  2HOE A;  4LIU A;  5CVV A;  4CHU A;  3M07 A;  1YTY A;  2DA3 A;  1OCO H;  1FOX A;  1ZRD A;  3GTM J;  3C2G A;  3CDI A;  4LIT A;  4J19 A;  2Q1Z B;  2MA3 A;  2ZME B;  2JRT A;  1X4O A;  2M7A A;  1O3R A;  2XPU A;  4HYE A;  1V3F A;  3CJR B;  3K1P A;  2V9K A;  4EVI A;  2LY9 A;  3GXO A;  1PVE A;  2ZJ2 A;  2V1D A;  2EQR A;  1LDJ A;  4BXX J;  2H6B A;  1LKX A;  2L4M A;  2YR2 A;  1SVL A;  4XBF A;  3COA C;  3DLA A;  4XR6 A;  3HSR A;  4UUV A;  4EM2 A;  3BWG A;  2OTL I;  1X3U A;  5E1Z B;  3BPV A;  2CUZ A;  2E1N A;  1O4X A;  2GZW A;  1BI3 A;  3ZP5 A;  2KDZ A;  4RBO A;  2E5Z A;  1R49 A;  2CQQ A;  1TQP A;  2RQP A;  3F0C A;  1IW7 F;  2BE5 F;  2W57 A;  3WU0 A;  2DO7 A;  5JVT A;  2DMN A;  4DZP A;  1HQC A;  3HM5 A;  1TQM A;  2GIZ A;  2CH0 A;  4LJZ F;  2GAU A;  2CS3 A;  1D0X A;  4KN7 X;  3MAJ A;  2MW8 A;  1YW8 A;  3K6G A;  3GTL J;  2WTE A;  5LRR A;  2LG4 A;  3M3Y J;  2R7Q A;  1AOY A;  1FYL A;  1FX7 A;  4OIR F;  2OUM A;  1ENH A;  1K79 A;  1TT5 B;  2DYR H;  2XV4 S;  4XLP F;  1G3S A;  4DBR A;  2KRH A;  2P5L C;  2KIQ A;  4RAZ A;  1Y39 A;  3BR2 A;  2NOG A;  5M5X J;  1QO0 D;  2CW0 F;  2LTP A;  2L9V A;  3KZI C;  3WTW C;  4XID A;  3KP4 A;  3ZXS A;  3S2D J;  1I1G A;  3BJO A;  4EMS A;  3S15 J;  3IH3 A;  1VQ6 I;  3FK7 A;  1Z67 A;  4JOM A;  1FIA A;  1MKM A;  2QBY B;  4BY1 J;  1JUM A;  3ZQQ A;  1BI1 A;  3HKZ A;  4LK1 F;  2R7F A;  3KEY A;  4PGH A;  3V7S A;  2JUC A;  1CF7 B;  2H27 A;  3CCM I;  1FIP A;  3NEU A;  4D1Q A;  1R9T J;  4Y7N J;  4OU0 A;  4XSZ F;  1HCR A;  2WC2 A;  3P9I A;  4DQ2 A;  4BQA A;  2R7W A;  2BYV E;  4NUB A;  4IF4 A;  2IXS A;  3FXU A;  3IC7 A;  3RSN A;  4S0H B;  2M45 A;  2M4K A;  3A01 A;  3ABT A;  2WY7 Q;  3WGG A;  4A3J J;  3W6J B;  4H0E A;  2IJL A;  1HDD C;  3OL3 A;  2Y31 A;  2BOL A;  1UEL B;  3OV8 A;  5KVR A;  4L9N A;  4IRH A;  5FLM J;  1UHS A;  1LJ9 A;  4HOB A;  4DYC A;  1JKO C;  2K9S A;  2Z5U A;  2XHK A;  3LMM A;  1U9N A;  1DU0 A;  1XC5 A;  2WA0 A;  2W25 A;  2HOT A;  2LY2 A;  3HSF A;  1P6R A;  3CLQ A;  1H9G A;  1GV5 A;  2PMZ N;  5DCM A;  2FBK A;  3TDZ C;  3D5L A;  1OCP A;  2PJP A;  4A69 C;  4M74 A;  3A01 B;  1MBE A;  2RDP A;  2LKS A;  5B66 C;  4KA4 A;  1GHC A;  2P5V A;  2L54 A;  1X1A A;  3R0A A;  1U3E M;  1G59 A;  1N77 A;  2H8W A;  1B8I A;  2NNY A;  1S5L C;  4B1R A;  4WCG A;  4OWR B;  3N4M A;  2MC4 A;  2J5P A;  4CSW A;  4XOT A;  3UKG A;  2BY1 A;  2JTV A;  2MFZ A;  1CF7 A;  2IPQ X;  4J01 A;  4FX4 A;  2UXN A;  3F8C A;  1GVJ A;  1QHG A;  4M9Z A;  3HOV J;  1W36 C;  3K70 C;  2QQ8 A;  3OOP A;  4CCO A;  5H2F C;  2QBY A;  3C7J A;  3ZQI A;  2MGQ A;  1UMQ A;  2VQC A;  2HZD A;  4OIN F;  3K4C A;  2NXN B;  3IL2 A;  2M30 A;  2ZCW A;  2VBX A;  2WB1 N;  2R0Q C;  1R5H A;  1ETX A;  1MD0 A;  2RVC A;  4KIS A;  2VON A;  4BHB A;  4N9H A;  1D5Y A;  1ETV A;  2IVM A;  2JT1 A;  5CKT A;  1MMG A;  3KYC B;  2QKL B;  4UV8 A;  1QNT A;  3WG9 A;  2A05 A;  1ZKG A;  1K7A A;  2ZKZ A;  2ZBK A;  2JA7 J;  4XM3 A;  2OC6 A;  4BL0 B;  1WH7 A;  1RR8 C;  2VBZ A;  2EFP A;  1XDU A;  4BU2 A;  2M1B A;  4C9Y A;  4BBS J;  3BG9 A;  2NVX J;  2FOW A;  4RB0 A;  2VXD A;  5A2Q K;  4IO9 F;  2Y0S A;  3IH2 A;  1BW5 A;  2LF7 A;  4XKV A;  3VSK A;  5DD4 A;  2DOE A;  3W2V A;  2V6C A;  3P5J A;  3TDU C;  3I53 A;  3UR3 C;  1OR7 A;  1WJF A;  2K86 A;  3BG7 A;  3SJM A;  4LIV A;  1MBJ A;  3ERM A;  1SC7 A;  3AL0 B;  4M3F A;  1BJA A;  3FXK A;  3HBL A;  3PNV A;  1LEA A;  4Y3O A;  5LLQ A;  4ZDL A;  4CIC A;  1BBY A;  3B02 A;  2KLO A;  2HFH A;  3TBI A;  5TGT A;  2VL8 A;  2X6Y A;  3SHF A;  3GME A;  5FRN A;  5B3S H;  3MQ0 A;  3EPZ A;  1EJ9 A;  4ETS A;  4RAY A;  3OYJ A;  2HYJ A;  3C1D A;  1D8K A;  2Z1D A;  4HNV A;  1T2K A;  4HF1 A;  3MFK A;  3K4M A;  4BH9 A;  2HQA A;  3HC7 A;  1ULY A;  3Q0V A;  4N4N B;  1TL8 A;  1Z77 A;  4XLN F;  4IHT A;  1R6R A;  2LF8 A;  1KZH A;  2BXZ A;  2OJE D;  3HIF A;  1WJB A;  3GLX A;  3L09 A;  4KIB A;  5CLS A;  2X6O A;  4CGZ A;  4YG2 F;  2H94 A;  3B6A A;  3VWB A;  5ICF A;  3HOX J;  4LG0 B;  1VFC A;  1D1B A;  4C30 A;  2L7M P;  5H6Q A;  1TWH J;  4WXC A;  3C2H A;  4B44 A;  1YRN B;  2AS5 F;  3CDL A;  5KK1 A;  4G6T B;  3ZCO A;  5E17 F;  2WWY A;  1I27 A;  1TWA J;  4BY7 J;  3SZG A;  3ZMS A;  4A12 A;  3KE2 A;  2GLO A;  3OIO A;  4X0G A;  4I0B A;  1JKP C;  2N8G A;  2X1D A;  1H0M A;  4WF2 A;  5CJ9 A;  2R7T A;  2FNA A;  4AU7 A;  1VQ4 I;  2QSG X;  3DTI A;  4QTR A;  3RKQ A;  5BPI A;  1OIS A;  1XS9 A;  2F6C A;  2YU9 J;  2WV0 A;  3FZV A;  4ESJ A;  3FIS A;  2VT2 A;  2VJ4 A;  4NC8 A;  2MSY A;  1CGP A;  5LBQ A;  1E0E A;  1KU7 A;  1YRN A;  1J09 A;  2FQ4 A;  2MD0 A;  5D6F A;  4E6K G;  1EH7 A;  1UB9 A;  4EJO A;  3K10 A;  3A0H C;  1VQ7 I;  3K2A A;  1ETW A;  2DTR A;  2ZFW A;  2M0M A;  4LLL A;  1BJZ A;  2HKX A;  3ABK H;  1X2N A;  3HL2 A;  1MND A;  1U5T C;  4HF0 A;  1XSD A;  2IGM A;  1PUF B;  2OTJ I;  3V8J A;  4DBQ A;  3ZN0 A;  4HF2 A;  2FEZ A;  1SAX A;  3VYR B;  1E3H A;  4N4O B;  1ETO A;  1BA5 A;  3OYE A;  2L3D A;  3T8R A;  2ECB A;  1ZN2 A;  1HW2 A;  3BTJ A;  1ONV A;  3K4B A;  1ZYR F;  2HXO A;  1ORK A;  4HZF A;  2D2W A;  2W1O A;  2X9D A;  1Z3Y A;  1XDS A;  2BEO A;  4L9V A;  1OYI A;  1FC3 A;  1TLH B;  3HOZ J;  1X19 A;  5IYB J;  1X1P A;  2BVM A;  2I8D A;  3DV8 A;  3G1M A;  4XSX F;  3I4N J;  2KKO A;  3F8F A;  1YW7 A;  3H35 A;  2D5V A;  1F43 A;  2EV0 A;  2IRF G;  2DMU A;  3S16 J;  1BOA A;  1UJ8 A;  2ME0 A;  1GXP A;  1FSH A;  4JP0 A;  3ECO A;  1XB4 A;  2PLY A;  2XIG A;  1L0O C;  2PMU A;  4ZYE A;  4RAF A;  4EJU A;  1PYV A;  4ZDP A;  3K70 D;  3CC4 I;  1A6Q A;  2XVC A;  2HPM A;  1IN8 A;  5LFA A;  1D3Y A;  3G1L A;  2HYG D;  2EZI A;  4A6D A;  4A5N A;  3PUB A;  1Q1H A;  3HG9 A;  3ABU A;  3HOW J;  4RM2 A;  5TRD A;  5KHD A;  1DGW Y;  3UNG C;  2O03 A;  4QPQ A;  2K5C A;  2L9R A;  2E71 A;  5ICG A;  2J5O A;  1JKR C;  3E5U A;  5JR3 A;  3BTL A;  4LD5 A;  5AIQ A;  3GTK J;  3H5R A;  3U9G A;  1R5G A;  3BZ6 A;  3KEO A;  1VQN I;  3W6V A;  5TJJ A;  5IOY A;  2ZNY A;  3CZ6 A;  4PJM A;  1QPM A;  1ZQ3 P;  2EFQ A;  2XB0 X;  2OCE A;  5LD2 C;  3ASO H;  5F6F A;  4BEH B;  2EV5 A;  2LVS A;  5FFX A;  1HKT A;  1KU2 A;  1RPW A;  4G7H F;  1LDD A;  2M8E A;  4U87 A;  1SD4 A;  2VC0 A;  5HS8 A;  1SFU A;  4A5M A;  4BJT A;  4ANJ A;  4KNY A;  2XGD A;  3FXQ A;  5HOO A;  1LPQ A;  2XF5 A;  1XD7 A;  5K5O A;  2G7H A;  1A36 A;  2HWV A;  2CMP A;  1MMA A;  3SDG A;  1WI9 A;  3CO6 C;  2DK8 A;  1HXD A;  4HAM A;  4GYI A;  2YU3 A;  5F04 A;  3K1M A;  4RLQ A;  2QGU A;  3QRF F;  1AKH B;  1SVM A;  4CYC A;  2FOK A;  3JSO A;  3V7C A;  3BG5 A;  3I54 A;  5EGO A;  3HRU A;  4RA2 A;  3S1R J;  1F4K A;  4GFB A;  2OBP A;  2XB5 A;  3QP5 A;  4NC6 A;  3OYB A;  4D7N A;  3BZC A;  4K2E A;  2E34 A;  2DFE A;  2NVQ J;  3O2P E;  3RIR A;  5LHH A;  1Z7U A;  2EIM H;  2Q0O A;  3CUQ B;  2G7U A;  1AHD P;  5K1Y A;  2E36 A;  2XGC A;  5CVJ A;  1QVT A;  4HRI A;  4OIP F;  3CJN A;  2VOD A;  1VQ5 I;  2E1M B;  1V4R A;  2XUB A;  4LFU A;  2DMP A;  2E2I J;  2L0K A;  4UVB A;  1SMT A;  5EYR A;  1G6N A;  3BQZ A;  3F6O A;  3MZY A;  4B43 A;  4R79 A;  5LRS A;  1DP3 A;  2VE8 A;  1R5I D;  2WAE A;  2K27 A;  2JSP A;  3MZH A;  1B9N A;  3ULQ B;  1G4D A;  2H1K A;  4I09 A;  3T8T A;  1F5T A;  1MJB A;  4BS9 A;  2WAF A;  1QA6 A;  1VND A;  2K85 A;  3KLN A;  4IXA A;  1HW1 A;  2NAZ A;  3K69 A;  1KA8 A;  2KHM A;  3C18 A;  3ZQF A;  3L00 A;  2XSD C;  4MLO A;  2W00 A;  2VKV A;  2CFX A;  4Y33 A;  5F1J A;  3DU5 A;  3BPX A;  5K5R A;  2GXB A;  1TWC J;  3BR5 A;  1RUO A;  3WHC A;  4A3E J;  4W97 A;  1B4A A;  1QU3 A;  2XAQ A;  2PG4 A;  4UVC A;  2A69 F;  3ECH A;  4HEA 2;  4RAG A;  3BTI A;  3U1K A;  3F21 A;  3I59 A;  3DP7 A;  2LY1 A;  3E6M A;  3I5U A;  4I02 A;  3GFJ A;  2VBW A;  1T33 A;  3PIO F;  1W0U A;  3D5R C;  3FXJ A;  3IKV A;  2P8T A;  1MW7 A;  3E6B A;  3FWE A;  1Q1V A;  2HDD A;  3K2Z A;  1BR2 A;  2V9P A;  1STZ A;  2Y30 A;  3A4C A;  4G12 A;  3BLY A;  1RZ4 A;  5JHF A;  3K4L A;  5E3L A;  2VE9 A;  3P7N A;  1MDM B;  1SD5 A;  2FXA A;  1SFE A;  5J8C A;  2Q8K A;  3HRT A;  4XIC A;  1LFU P;  3NAR A;  3FF5 A;  2XKO A;  2R92 J;  3VFZ A;  1ETY A;  1USS A;  4NHJ A;  3PSI A;  1IUF A;  1ZG1 A;  3KX2 A;  3JRB A;  2X48 A;  3W2A A;  4LOC A;  3FBI B;  1AU7 A;  3HXL A;  2V1U A;  3HRM A;  2OPT A;  3BQY A;  4YFK F;  4FQG A;  1H9T A;  1R4M B;  2O9L A;  1IF1 A;  2HQN A;  1G8X A;  1VTN C;  2O61 A;  4XQF A;  1IRZ A;  3IWZ A;  1OPC A;  2CUF A;  1QRY A;  3HYI A;  2DT7 B;  5FLV A;  2DTZ A;  2IP2 A;  5J4Y A;  1IN4 A;  3CUQ C;  1P7I A;  1K78 A;  3LNQ A;  4M3E A;  2DA5 A;  4L5I A;  3TO7 A;  3RI4 A;  3DKW A;  3J7Z I;  2V26 A;  4XRS A;  3DKX A;  1WVR A;  1X4P A;  4NQW B;  3QPL A;  4QIW N;  4HX8 A;  2XAU A;  1Z21 A;  2EJR A;  2FF4 A;  2R4G A;  1FWZ A;  2YSR A;  4IKF A;  5J1U A;  5HDK A;  1OMI A;  2ZXW H;  4PCQ A;  4NC7 A;  1P7J A;  1N78 A;  1ZGA A;  3S32 A;  1BW6 A;  3GVA A;  2XRN A;  5DM7 F;  1U6G A;  1I5Z A;  2W84 A;  3OMY A;  3X2Q H;  3S3O A;  1JGG A;  3WGH A;  1W7P A;  4QPO A;  4II3 A;  1FY7 A;  3HGY A;  3V8L A;  4IX7 A;  2BY3 A;  3QU3 A;  4JBA A;  4DZJ A;  3DTE A;  3OIP A;  5AIP A;  2CQ7 A;  3DWL E;  1FBS A;  4U0Y A;  2CSO A;  4KYW A;  1CQT A;  4Y17 A;  4B48 A;  1IXR C;  5J40 A;  1ZRF A;  2V7F A;  4Y13 A;  4RGR A;  3RKX A;  5D4R A;  3RDI A;  1ZAR A;  5FRO A;  1HA8 A;  4HBL A;  1U2W A;  4A3K J;  1ZG3 A;  3S8P A;  3ESW B;  2XKP A;  2Y9Z A;  1YHQ I;  4OIO F;  4E7L A;  4AWX B;  3EYY A;  1YG2 A;  3HKZ N;  4HX4 A;  2Z33 A;  2ZFU A;  4YEL A;  1HF0 A;  1A35 A;  1JTY A;  3FHN A;  2QWW A;  2EIN H;  3OR1 C;  4L9T A;  1DPU A;  3DU6 A;  2EH3 A;  5ERI A;  3TOA A;  2EK5 A;  3LA3 A;  3WU2 C;  4DGW B;  1MJA A;  3REO A;  2DPD A;  4F7Z A;  5BMZ A;  2VIX A;  1J0R A;  1IGN A;  3BCB A;  4BHP A;  5ILV A;  5J8F A;  3LA7 A;  4AYB A;  2A6H F;  2NVT J;  2QSH X;  1I39 A;  2VN2 A;  1P2F A;  1BI0 A;  2V1N A;  3NWT A;  4LK0 F;  2O0Y A;  1MMS A;  5D4S A;  3QYF A;  4I76 A;  2HVS A;  2R7O A;  1DQU A;  3K4N A;  5FKM A;  2HOA A;  2ID6 A;  3LSH A;  5FFZ A;  2ZSH B;  3C3W A;  3E6D A;  2DA4 A;  2VKE A;  3JRG A;  3GZ6 A;  2M4G A;  1JJ8 C;  4DOZ A;  2QVO A;  4LB6 B;  3VYU B;  2UUZ A;  1HLV A;  5LGU A;  1YOV B;  2FX0 A;  3WE2 A;  3DFG A;  5HLH A;  1WFX A;  3KP3 A;  3FMS A;  3VSL A;  1IRG A;  1MBH A;  3TO6 A;  4UUT A;  2L01 A;  2A3S A;  1GVD A;  4A3B J;  2NS0 A;  5JHU A;  2HPI A;  5CVI A;  3LAP A;  2JPB A;  1HKS A;  5E8I A;  1F1Z A;  4XL9 A;  2HTJ A;  2Q2E B;  1R23 A;  3TOB A;  4PSX A;  5DCF A;  4EGZ A;  5K7Z A;  1VQP I;  1FT9 A;  2VT3 A;  2ZJR F;  1RKT A;  3P9C A;  5ICC A;  1W5S A;  2FUG 2;  4RGU A;  1FPQ A;  2HDW A;  3PSF A;  1PP8 F;  2DK5 A;  3LFK A;  2K02 A;  5CVU A;  3N97 A;  3HPG A;  1OYW A;  2LRD A;  3ZQL A;  4RGS A;  2Y2Z A;  3CMA I;  3CMM A;  4L0Y B;  2VAS A;  2QQB A;  1OJL A;  2CYY A;  5FKO A;  2WBM A;  2BV6 A;  2D1V A;  2PMZ A;  1VZ0 A;  2Z2S B;  3HRS A;  4B47 A;  4G94 A;  4D7M A;  2DJI A;  3HJE A;  3GFI A;  4PJN A;  1IRF A;  4KIF A;  5ILS A;  3OS1 A;  2FBH A;  1OFC X;  2JVG A;  3H5A A;  4HW0 A;  4M6X A;  4YEJ A;  5DCM B;  5HLG A;  2A5Y B;  2FMY A;  2CQN A;  4MFD A;  1HBX G;  3I4M J;  3ZQ7 A;  3O6B B;  4MGR A;  4EV0 A;  3BG6 A;  5FKL A;  4XK4 A;  2DW4 A;  1P9Q C;  1Z6T A;  2M5W A;  4BQQ A;  1YJ9 I;  1JUS A;  1EF4 A;  1I6X A;  1V5G A;  4XLF A;  4XOP A;  4BXF A;  4CUG A;  3FM3 A;  2E1M C;  1JT6 A;  3LOC A;  5E3M A;  3ML6 A;  2Y0S N;  2KDO A;  4ITV A;  3ZQC A;  2EIK H;  3QYE A;  3J7A Y;  2ETH A;  2DLL A;  1RIO H;  5EJC A;  4E4H A;  2KRC A;  1JHF A;  1MH3 A;  4CA0 A;  1L3L A;  4C2T A;  1TZL A;  3K9T A;  3OYK A;  5GTI C;  4XLE A;  5LEK A;  4AYB N;  3E6C C;  4CCJ A;  2DYS H;  2IA2 A;  1EH6 A;  4IHY A;  4XKB A;  1FP2 A;  1JGS A;  1APL C;  5GPC A;  1SVO A;  3CD6 I;  5IP9 J;  3T0Y A;  3ZN1 A;  3G73 A;  2BHZ A;  3LSK A;  1JHH A;  3SEQ A;  2O6G E;  3HOT A;  2CW8 A;  2LKX A;  3O8H A;  2FE3 A;  4QSH A;  1R71 A;  4A93 J;  1ZGJ A;  2VKH A;  2XAF A;  2Z99 A;  3M1C A;  5FO5 A;  1OCZ H;  2XAH A;  2ZSI B;  1UAA A;  4G7Z F;  4LLN A;  3HUG B;  1S9H A;  3FHZ A;  4HPQ A;  3CCQ I;  2PN6 A;  2K9N A;  2GXG A;  3U21 A;  2EV6 A;  4LG0 A;  3PIP F;  4HDV A;  2ACJ A;  2QKM B;  5J6X A;  3JRF A;  1LFB A;  4EGY A;  2HI3 A;  3TED A;  2RKH A;  4AM3 A;  4BYY A;  4A0Y A;  4OMY A;  1E2X A;  1NTC A;  3FXR A;  4HST A;  2EZL A;  2UWM A;  1DUX C;  2HTS A;  4CYC B;  3LQQ A;  5FLX Z;  5EF6 A;  1ZRE A;  1SD6 A;  3S3N A;  2YUS A;  4HV6 A;  4IQ4 A;  5GP9 A;  4RB3 C;  3DPT A;  1XPX A;  2JMW A;  1U8B A;  2KIS A;  5IT3 A;  4R8H A;  2PBI A;  5DV5 A;  4HX7 A;  2VJ5 A;  3FKJ A;  2ISZ A;  1OYY A;  3RTR A;  3DPU A;  4BAY A;  2F5D A;  5GAG J;  2HU9 A;  3CES A;  3CUO A;  3FXL A;  3HGG A;  3SZP A;  3HOS A;  3CC2 I;  1HC8 A;  2R7V A;  1D8J A;  1OQY A;  1VQ9 I;  4CZC A;  2EA4 A;  1GLN A;  5LEJ A;  5E18 F;  5C44 J;  1O3S A;  4P1W A;  1FOW A;  1KU9 A;  1OR7 C;  3TQN A;  1OCR H;  1MJ9 A;  1IN5 A;  5JFR A;  3MWM A;  1D0Z A;  3CJT B;  4DNC A;  3Q9S A;  3ELK A;  2KIU A;  4LB5 A;  5EEA A;  1X1D A;  4M9S A;  5M3M J;  1GXQ A;  1H89 C;  5J47 A;  4RGX A;  4S04 A;  4RS8 A;  3L2Q A;  4AID A;  2WV1 A;  3WHB A;  4PGG A;  1RET A;  2LBF B;  4I2O A;  3SDB A;  1IG7 A;  2CRG A;  2MBF A;  4P55 A;  2CU7 A;  1MSE C;  4IHW A;  2VOP A;  3LSJ A;  5D6E A;  2RN7 A;  3O3K A;  3H0G J;  3VB2 A;  2M87 A; 
#chains in the Genus database with same CATH homology
 3PNY A;  2Z16 A;  3TMO A;  4DJA A;  4ZTF A;  3MKW B;  2RRE A;  4RLQ A;  2X1E A;  2XF6 A;  3H9G A;  3KYL A;  2UV1 A;  3RQ4 A;  3OR2 C;  4F3Q A;  1WJA A;  2WY8 Q;  1OLT A;  3N05 A;  5HLT A;  3OYB A;  3OYG A;  2HNH A;  3OYA A;  2VQG A;  4HSR A;  4HRI A;  4XKC A;  2XC7 A;  2E1M B;  3CP2 A;  1V5E A;  4GRI A;  2F4I A;  3OYI A;  4PFP A;  2MYS A;  1ZEL A;  1DP3 A;  4B43 A;  4R79 A;  1WJC A;  4IQJ A;  2WAE A;  5HNF A;  2JSP A;  1WJE A;  1YX5 A;  4OAZ A;  4BDZ A;  4BS9 A;  2WAF A;  3EUA A;  3H9J A;  5CQG A;  4E7I A;  2KHM A;  4F52 A;  4MLO A;  1BOB A;  2W00 A;  3A2K A;  4Y33 A;  3AKZ A;  3DU5 A;  3OL4 A;  4RM3 A;  3OYF A;  3M8J A;  1YX3 A;  5FRM A;  3OWT A;  4E7K A;  4HNT A;  1V5F A;  1FMW A;  4LIU A;  1QU3 A;  3RCO A;  3OS0 A;  4H4K C;  4HEA 2;  4JQF A;  2X51 A;  3DTK A;  2IGO A;  3PNT A;  2VQH A;  3VYT B;  3C2G A;  3EUH C;  4LIT A;  2Q1Z B;  2LY1 A;  3BC8 A;  1X4O A;  2M7A A;  3LSM A;  3LL7 A;  1LFP A;  3TL4 X;  4BE2 A;  2E5N A;  2L9S A;  3DQV C;  4ZC3 A;  3OYL A;  3D5R C;  3CJR B;  2V9K A;  1MW7 A;  5CQE A;  2KQR A;  1BR2 A;  4PUS A;  1LKX A;  3OS2 A;  3A4C A;  3BLY A;  3DLA A;  4OAY A;  4XR6 A;  5JHF A;  3K4L A;  2VKD A;  4BAC A;  2CUZ A;  4F93 B;  3NWS A;  1IRX A;  4RLF A;  2E5Z A;  2MAB A;  2KZV A;  2R7X A;  3I9V 2;  3E0J B;  2OV7 A;  2CH0 A;  1AA7 A;  4XLC A;  3PSI A;  1Z7L A;  4HG2 A;  2CS3 A;  1D0X A;  2A5W A;  4ZYA A;  3KX2 A;  3K6G A;  2R7U A;  3OYH A;  2CW7 A;  2LG4 A;  3W2A A;  4KT6 A;  3FBI B;  2R7Q A;  4BGD A;  2X6X A;  3GBG A;  3HXL A;  2OUM A;  2BW3 A;  4DBR A;  2KRH A;  2VJJ A;  1D1A A;  2JUG A;  4YRV A;  3ZXS A;  2JVH A;  1G8X A;  4DIQ A;  4XON A;  4FET A;  4XQF A;  4JOM A;  2LOO A;  3LSG A;  2VQL A;  1ERD A;  2DT7 B;  3LSI A;  3ZQQ A;  3HKZ A;  1KON A;  3AFH A;  3KEY A;  1MMN A;  3QOE A;  1WJD A;  3H5N A;  1X1C A;  1LVK A;  4D1Q A;  2V26 A;  3DKX A;  2CFO A;  3HPH A;  1X4P A;  2R7W A;  4NUB A;  3OOU A;  4NQW B;  2IXS A;  3RSN A;  2XAU A;  1Z21 A;  3BCA A;  3ZR8 X;  2M4K A;  2R4G A;  4CCM A;  5KCM A;  4IKF A;  2WY7 Q;  4CCL A;  3LFU A;  2IS1 A;  4NC7 A;  2NOJ B;  4Y4R A;  1N78 A;  2WAD A;  2M7B A;  3S32 A;  3OL3 A;  4AVZ A;  2BOL A;  1UEL B;  3K4K A;  3OMY A;  3S3O A;  4QPO A;  4II3 A;  3LMM A;  4IX7 A;  2WA0 A;  3QOD A;  4E7J A;  3PJR A;  2LY2 A;  3DTE A;  3OIP A;  3DWL E;  4XLH A;  3G2B A;  1NG7 A;  3D5L A;  4B48 A;  2K9L A;  3CP8 A;  2KL4 A;  2V7F A;  3VDX A;  2K9M A;  1X1A A;  1G59 A;  1N77 A;  1HA8 A;  5FRO A;  3FBN B;  3H9Q A;  4OWR B;  4C2U A;  2MC4 A;  4CSW A;  4XOT A;  5KNL A;  3S8P A;  2MFZ A;  4E7L A;  3DKY A;  4J01 A;  3OY9 A;  4XKW A;  1QHG A;  1W36 D;  2ZFU A;  4YEL A;  1W36 C;  3VYS B;  2L7K A;  3K70 C;  4CCO A;  3FHN A;  3L2V A;  3OR1 C;  4CCK A;  3DU6 A;  2XSJ C;  2VQC A;  2KMU A;  3IUO A;  2A6T A;  2HZD A;  4XNF A;  4DGW B;  3MKZ A;  3K4C A;  3ONQ A;  4KJZ A;  3FDY A;  2VIX A;  3V42 A;  3BCB A;  2LBF A;  2HVR A;  4KIS A;  4PJJ A;  4AYB A;  5CKT A;  4XLA A;  1MMG A;  2QKL B;  4ZTJ A;  2V1N A;  3NWT A;  3PL8 A;  1JI8 A;  3QYF A;  2HVS A;  4BEH A;  4XM3 A;  1DQU A;  2R7O A;  2OC6 A;  3K4N A;  4XN0 A;  4BL0 B;  4U7B A;  3LSH A;  2ZSH B;  4BU2 A;  4C9Y A;  4KIT B;  2BVL A;  2M4G A;  2VXD A;  4DOZ A;  2Y0S A;  4IZZ A;  3VYU B;  2UUZ A;  4XKV A;  3VSK A;  1YE9 A;  3W2V A;  3UR3 C;  3IP4 B;  1WJF A;  3BG7 A;  1MMD A;  4LIV A;  1WFX A;  2F5V A;  3AL0 B;  3VSL A;  2E60 A;  3H0D A;  2IGK A;  3PNV A;  4Y3O A;  1K6Y A;  4II2 A;  4ZDL A;  4PSW A;  2WB1 A;  2KLO A;  2LC2 A;  3TBI A;  2HPI A;  5TGT A;  2VL8 A;  2X6Y A;  2R7R A;  5FRN A;  1UG0 A;  2RNG A;  3EPZ A;  2KP6 A;  3MKY B;  4XL9 A;  2L2O A;  3OYJ A;  2Q2E B;  2ZXH A;  2Z1D A;  4PSX A;  2GOX B;  4PJL A;  4E7Z A;  1NG6 A;  3K4M A;  3OYN A;  2HQA A;  3HC7 A;  4N4N B;  3PFY A;  1R6R A;  2RQQ A;  2X1C A;  2FUG 2;  1WJB A;  3PSF A;  2HDW A;  2L9N A;  1D1C A;  4XN3 A;  4XMY A;  2LH9 A;  3HPG A;  3OYM A;  2LRD A;  3AL0 C;  2CV2 A;  3VWB A;  1D1B A;  4C30 A;  4LG3 A;  2PJR A;  3CJQ B;  3L2W A;  3CMM A;  2VAS A;  3C2H A;  4B44 A;  2IS4 A;  2WBM A;  3E1S A;  2ZXI A;  3ZCO A;  4G6T B;  2Z2S B;  2PMZ A;  1VZ0 A;  4B47 A;  4ZJZ A;  2CV1 A;  2DJI A;  2V4J C;  3SYT A;  4PJN A;  3SZG A;  4PK4 A;  3W3C A;  4B3X A;  3OS1 A;  3H5A A;  2JVG A;  4X0G A;  4YEJ A;  2CUJ A;  5HNH A;  2IS6 A;  2X1D A;  2AQF A;  2WAQ A;  2R7T A;  3BG6 A;  4BJ5 C;  1P9Q C;  1BR4 A;  4BQQ A;  4AU7 A;  3DTI A;  1LDK B;  1V5G A;  4XLF A;  4XOP A;  4BXF A;  4CUG A;  2F6C A;  2E1M C;  1X1B A;  2X6W A;  1FMV A;  2VJ4 A;  4NC8 A;  2VJI A;  1E0E A;  2DXI A;  2KDO A;  4ITV A;  4PFO A;  1J09 A;  3S93 A;  3QYE A;  3L2U A;  2AQE A;  1DGR M;  3J7A Y;  2MD0 A;  3W2W A;  4D9J A;  4E6K G;  2W82 A;  4J00 A;  1MNE A;  2VLA A;  3K10 A;  2IGN A;  4E4H A;  2KRC A;  4CA0 A;  4F92 B;  4C2T A;  1TZL A;  2M0M A;  3OYK A;  4BE0 A;  4XLE A;  3HL2 A;  4CCJ A;  1MND A;  4XKB A;  2IGM A;  4E7H A;  4E7S A;  4DBQ A;  2LRE A;  2P0W A;  2W4S A;  3D5S C;  3S3M A;  2KPM A;  3LSK A;  3SEQ A;  3VYR B;  2VPL A;  4N4O B;  3HOT A;  2CW8 A;  2LYC A;  3K4J A;  3OYE A;  3MMY B;  2VKH A;  3M1C A;  1QHH D;  3K4B A;  2R7S A;  3ZGK A;  5HVQ C;  1UAA A;  2ZSI B;  3HUG B;  4P5O A;  4BJ6 C;  1S9H A;  3QYB A;  2W1O A;  4HPQ A;  3CF2 A;  3U21 A;  1Z3Y A;  4ZDO A;  2QKM B;  2PJR B;  1X19 A;  2ELJ A;  1MMA A;  2BVM A;  2I8D A;  2W7N A;  2XF7 A;  2GOM A;  1Y6I A;  4CH7 A;  4RMN A;  3H35 A;  3L2R A;  4HST A;  2UWM A;  3DPL C;  2O5R A;  1TT0 A;  3S3N A;  3OIQ A;  3EUK L;  1PYV A;  4IQ4 A;  4ZDP A;  1D0Y A;  3DPT A;  2DOA A;  3K70 D;  2VXZ A;  3A1Y A;  4F55 A;  2JA2 A;  2HPM A;  4BQO A;  4HNU A;  5LFA A;  2X85 A;  1Z3X A;  4FAS D;  4BE1 A;  2L5Q A;  4BDY A;  3OYC A;  4BUP A;  1WJ5 A;  2HVQ A;  3PUB A;  4BQN A;  3HG9 A;  2XDV A;  4RM2 A;  1BR1 A;  3RPU D;  1T0F C;  2VJ5 A;  3FKJ A;  4NNJ A;  5KHD A;  1DGW Y;  1SAU A;  3UNG C;  1N75 A;  4QPQ A;  3RTR A;  2V6E A;  3DPU A;  2K5C A;  3HOS A;  2HU9 A;  3CES A;  2R7V A;  1Y56 A;  2CV0 A;  2DT6 A;  3IAS 2;  2M3A A;  4CZC A;  1GLN A;  3H5R A;  3F9K A;  4P1W A;  3SEZ A;  1OR7 C;  2DCE A;  3DEE A;  3CZ6 A;  2VB6 A;  4XOR A;  4PJM A;  1D0Z A;  1PJR A;  1SFK A;  5CPR B;  5LD2 C;  4BEH B;  1X1D A;  4U87 A;  3L2Q A;  3OYD A;  1T95 A;  4F91 B;  4BJT A;  2LBF B;  4ANJ A;  2K3P A;  4CCN A;  3SDB A;  4EAT A;  5HOO A;  3IAM 2;  3I3L A;  2IS2 A;  1U0J A;  1EA3 A;  2XF5 A;  2BW3 B;  3MD2 A;  3ZRG A;  2CMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...