1YJWI

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yjwI00
4IOCF 1YJNI 5JVGF 4IO9F 3PIOF 1S72I 1VQLI 2ZJRF 3CCQI 1VQ4I 3CCJI 2JQ7A 2QA4I 1YJWI 4UY8I 1FOYA 5DM6F 3I56I 3CCMI 3CC7I 2ZJQF 3J7YJ 2OTJI 1YJ9I 1Y39A 1FOXA 3CJTB 1VQ7I 1VQ6I 1VQOI 2E36A 2NXNB 3CCRI 1HC8A 3CMAI 1YIJI 1VQ8I 1YHQI 3CC4I 2E34A 3CCVI 5GAGJ 3PIPF 3CCUI 3CCSI 1FOWA 4IOAF 1VQ5I 2H8WA 5GAHJ 1VQKI 1VQMI 3CC2I 1YI2I 3G4SI 1VQPI 5GAEJ 1QA6A 2FOWA 1MMSA 1VQ9I 3CCLI 3J7ZI 1ACIA 5GADJ 3G71I 4V19K 3CMEI 2K3FA 2OTLI 3CD6I 3DLLF 3G6EI 1VQNI 5DM7F 3CF5F 2ZJPF 3CCEI 2E35A 2QEXI 3I55I 1YITI
chains in the Genus database with same CATH superfamily
2DU9A 3FXMA 2E5ZA 3LSMA 2OPTA 4UVBA 3A01B 3W2VA 5GPCA 4A93J 1L0OC 3SFIA 4X0GA 1YW7A 2VBXA 4JBAA 2L9VA 5DTDA 4RDUA 4N4OB 2F5CA 1SFUA 5D8KB 5FROA 2ZJRF 2A6TA 3CCQI 1TZLA 2L02A 3VDXA 4A2UA 5EEHA 2Z9OA 2R7DA 4HV5A 4KT6A 4IRGA 1K4TA 3LL7A 2BXYA 3WTTC 3FBNB 4DBRA 1QBJA 2VBZA 4LOCA 1XDSA 2STWA 3K1MA 1LQ1A 1F36A 1Z3YA 4A5MA 4BJ5C 1W4MA 1S6LA 2X4HA 3KZIC 2BVLA 2KDZA 2HGCA 3HSRA 1YJ9I 2CQKA 2YX7A 1ZARA 1ODDA 2HXIA 1DU6A 2RGVA 2R7UA 4M6YA 3CCYA 3JCUC 1UHMA 3RJPA 2DAOA 3BG9A 2RV8A 3ELKA 4WX9A 4ZYDA 2HPMA 3F8NA 1HW2A 1FPQA 5E3NA 4MGRA 4RLFA 3F9KA 3CESA 3CC2I 5IOZA 4HQEA 2CRGA 3E5XA 3VSLA 1OKRA 2P0WA 1RNLA 3MKYB 5BNGA 2JN6A 1IN4A 1ON1A 2KL4A 4I7HA 3LAJA 3RIRA 1XPXA 4D9JA 1SVMA 1S8NA 3E1SA 4U88A 4E7SA 2YU3A 3OYGA 1KQ8A 3ZMTA 2E19A 3RDIA 4PJLA 3V4GA 2IRFG 5FD6A 3PSIA 2K27A 3ZMVA 4QPQA 4AM3A 1B72B 3BTLA 2OV7A 2VOPA 1J5YA 4HX7A 2RNGA 3G6EI 4BU2A 1TW2A 4EVIA 1A36A 3OIPA 3JRBA 1WJEA 3LAPA 2P4WA 4XOTA 3W2AA 5EG0B 5D5VB 1R9TJ 3DTIA 1SC7A 5K7FA 1BR4A 2WV0A 3WTSC 1WJ5A 1IN6A 3S1QJ 1XSDA 2IS6A 3BQZA 2ZCWA 2ZXHA 3VYTB 3KP4A 4A0XA 2ZMEC 2ELJA 5H20A 4XLPF 3BTIA 2JK3A 1FT9A 5KCMA 4OOIA 4ITVA 3G3ZA 4IZZA 3RYRA 3S3OA 3H1CA 4M3GA 3QPSA 3KP5A 1WI9A 4I01A 2R7FA 2WAQN 3HG9A 3REOA 3VYUB 3ZMDA 1ETWA 4E4HA 2QUFA 4O5VA 3SFZA 2ZFWA 1D1AA 2IBDA 2NNNA 3K4BA 4ZDOA 1ZGAA 2J5OA 2G7HA 1T98A 4BQOA 2B0LA 3CMYA 2MSYA 3WE2A 2RREA 4BDYA 5J8CA 2DN0A 4XRSA 3HTUA 2FNAA 4BGDA 2IT0A 1YOVB 3AL0B 3M3YJ 1U9OA 4BQNA 5D5XB 3J81Z 4XM3A 2CH0A 1IRFA 1IXSB 1I1GA 2KPMA 2MD5A 2GA1A 4HF2A 2KRHA 3ZQ7A 4MFDA 1X1PA 3MQ0A 3DBHB 5LGNA 3E7LA 3JAMK 2W24A 3KEOA 2IS4A 1D0YA 1ZG3A 3H3UA 3MZ8A 9ANTA 3O3KA 3TO7A 2NXNB 2NNYA 2DFHA 2M0MA 3OYBA 4XOPA 1D5YA 3JRIA 2V4JC 2HDWA 2DXIA 1TWCJ 4D5FA 3H5AA 4CSWA 1T56A 4UV9A 4YIFA 4V2FA 1GV2A 2NOJB 1WJAA 4A12A 1U2WA 1HKQA 4MQVA 3L2CA 1BC7C 1ZGJA 3E6DA 3K1NA 2JVHA 3N4MA 3J81K 2CV2A 1QQIA 1LFUP 3JTGA 4LIVA 3K7AJ 4I0AA 3ERED 3HM5A 2UWMA 3JREA 1F5TA 2XV4S 2EBIA 3IKVA 4U7DA 3J7ZI 2X9DA 2WV1A 5EEGA 5KK1A 2V9KA 4GFBA 2DK5A 5F27A 2OCCH 3H0GJ 3GUDA 1S9HA 1Y0UA 3D5SC 4YIIA 1ON2A 2LKSA 4C30A 1JKOC 3B02A 2EINH 1MIJA 2M4GA 3HGYA 3LSKA 3U9GA 4A3CJ 2IVMA 1ULYA 2NVXJ 2V1UA 2K9QA 3MKWB 4BJ6C 2V1XA 3HKZA 3CCEI 2R7TA 3AG2H 1G3SA 3P5JA 1B4AA 2VC1A 5GTHC 2V7FA 1P2FA 3ZCOA 4HG2A 3X2QH 2K9MA 5CQEA 5HLHA 4FHTA 3F8MA 3KYLA 5M3FJ 4IL6C 5JVGF 2PN6A 2UV1A 2XRLA 5J1UA 1W5SA 5ILUA 3HOXJ 5J4VA 4DGWB 3R6SA 3ZQGA 1X2MA 3S3MA 1R58A 3LQQA 3K4LA 3VWBA 4I6ZA 2DA2A 1BJAA 4ANJA 4R79A 3V7SA 1RRJA 1S29A 1Y56A 1UFMA 3PQJA 3OYNA 2R5ZB 3HUGA 5JHUA 5CLSA 4AIKA 3N05A 2KFDA 2Y31A 3CF2A 3QODA 2XC7A 3KP6A 1K83J 1KQ0A 2IEKA 5AONA 1FOYA 2QVOA 4C9YA 4BYYA 2WB1N 1HSTA 5E3MA 5TGTA 1VF9A 2HQRA 2IGNA 1H89C 4LB5A 4KYWA 2FJ1A 4F93B 1FEXA 1SD6A 4LK0F 2P81A 1X4OA 3UKGA 1U6GA 2H27A 1MH4A 5HVQC 3GYHX 3DQVC 4XONA 1FOXA 4NNJA 3IH4A 2KISA 1B8IA 1ZRDA 3JTHA 3K9TA 3ONQA 5CKTA 3HXLA 3QRFF 4CCOA 2XAGA 2ZMEB 1QVTA 4XRMA 2DQLA 1WI3A 2DFIA 1YHQI 3BG3A 4D7NA 4I2OA 2ME0A 4G7OF 3BLYA 4ENJA 1WJFA 3I71A 3J80Z 3W2WA 2MA3A 4DYRA 1IJWC 1D0ZA 2KKOA 2XAUA 4N4NB 2L7FP 2Z1DA 4WXHA 2LRDA 5LGTA 5ICGA 2CUJA 5GAEJ 4OIQF 4ZYEA 2VQCA 1FYKA 4Y4RA 2W25A 5B3SH 4IKFA 4YRVA 3RPUD 2VASA 2RDPA 1WGXA 5IT3A 1OQYA 2QKMB 5J3LA 1XCBA 3M4OJ 5HDNA 1RUOA 4C3IJ 4UXNA 4P9FA 1N78A 4G9YA 4GGGA 4HSTA 4LJZF 5J6XA 1IGNA 2EZIA 6PAXA 2E60A 2LOOA 1GLNA 4XICA 3FM3A 2JA8J 3PFIA 1MW7A 3BCBA 3KEYA 3K4CA 5DUKA 1QU3A 2HOTA 1NH3A 3S3NA 1BOAA 1MSEC 3BG5A 2HVRA 2QSFX 3HHHA 2BE5F 2PJRA 2BV6A 4KMFA 4ENKA 4RGRA 2XGXA 4BAYA 1MDMB 1X1DA 2E1CA 1T33A 3KYCB 3K4KA 3L2RA 3I0TA 3ZQLA 4PJMA 5FO5A 4CICA 5L3DA 2HYJA 5F6FA 3HOSA 4HLYA 3LOCA 3BR3A 3IC7A 1MH3A 3CZ6A 5BOXA 2E2IJ 2AQEA 1Y0NA 2W57A 4UHTA 2K4JA 3L2QA 4LB6B 2BY0A 3BJAA 1APLC 1QZEA 3FBIB 2H8RA 1KGSA 3C2HA 2VE9A 1HBXG 1CF7A 2VJIA 2FMYA 2HOEA 1W7PA 4OMZA 1FX7A 3FMQA 4XKVA 2XDVA 1X1AA 1XMKA 1GHCA 3I64A 2VL8A 4HF1A 1E3HA 1LVAA 3R60A 5E1ZB 2X6XA 3PJRA 5D5WB 1HOMA 2ZC2A 1WH5A 2JT1A 2QENA 1NHAA 2CMPA 2GIVA 2VN2A 3S1MJ 3HB9A 1Z05A 1J75A 4UUTA 4DNCA 3HOYJ 2FBIA 1VZ0A 4P1WA 1R4MB 3CCRI 3HRTA 4QTRA 4I98B 3M1CA 5GTIC 3DEUA 2COBA 1BJZA 3WG9A 1MJ9A 1T38A 2PX9A 3RKYA 4XIDA 4H0EA 2O8XA 3GWZA 3HKZN 2B7EA 2HWVA 4HA8A 2OZ6A 2HQ5A 3BTJA 4Z2YA 2L9NA 2A61A 2MD0A 3DLAA 3Q9VA 5E1XA 5EYRA 2Y0SN 5K7HA 1VQMI 1F4KA 3DPLC 1YI2I 2KZVA 4ZTJA 1VQPI 1AU7A 3BR6A 3BG6A 4YELA 4EMSA 1Q1VA 4EJWA 2YR2A 3I3LA 1WSUA 2ELHA 3DKYA 2EFWA 2CYYA 2ID6A 3BWGA 3W6JB 1LPQA 3FZVA 1PP7U 1R23A 2VBWA 3KPHA 5LEKA 1XD7A 4GYGA 2JA6J 4PK4A 4GXOA 3ZPLA 2L9SA 5EJCA 4DJAA 3MFKA 4X1EA 2K3FA 2WAFA 3MKLA 2ID3A 2PG4A 5DM7F 2HVSA 2BY3A 5D4RA 3D1NI 1ONVA 2DA1A 2QF7A 2FEZA 3C7JA 4W1UA 3PO2J 2Q0OA 1OCZH 3FKIJ 1DGWY 4DYQA 2QEXI 2CV1A 3CO7C 4BH9A 2DO7A 1EF4A 2HFHA 3KEQA 3OS0A 4W97A 4JQFA 3BT9A 2V9VA 3OOUA 2A07F 1D0XA 2DT6A 4IO9F 2EQRA 4O6JA 2D45A 4H4KC 2LREA 1S72I 5FLXZ 2L2OA 5F08A 1HA8A 2HVQA 2A69F 2Z3YA 1A6QA 2KHMA 3CLOA 4NQWB 4NC6A 1K79A 2P8TA 1M1EB 1SD7A 3P9KA 2IJLA 1I27A 1UG0A 3DPTA 5KVRA 1BI1A 3GCMA 3V8KA 4A5NA 4J01A 3F22A 1FLIA 3WHBA 3F23A 1W0TA 2VIXA 5C3EJ 2X48A 3ZMUA 4UNOA 1STZA 4ETSA 2CQXA 3F6OA 3MCZA 2LH9A 2KRCA 2TCTA 2PMHA 5DUIA 2GXAA 2ZJQF 3CJNA 1FJLA 5HLGA 3DF8A 5FJ8J 5LGUA 4BY7J 4KT5C 4B44A 3S2WA 3K2AA 3TMOA 1YG2A 2AS5F 4BS9A 3JSPA 4HNUA 2DW4A 2P6TA 5LD2C 4M71A 4E7LA 4AD9A 1ZTRA 3KP2A 1KU7A 1B9NA 2FBHA 1YE9A 2CUEA 5FLXK 4DZPA 2FSWA 4WCGA 1MGTA 1TP4A 3WODF 1IN7A 1Z91A 4BEHA 3ECOA 1XX5A 1TWFJ 3PQKA 1FYMA 3VOEA 2VKVA 3QU3A 1JUMA 2JA2A 4BHCA 1IRZA 4YFKF 3CP8A 4B43A 3KIOA 5L3EA 1Z0XA 3FX3A 3W6KB 2EPFA 4DOZA 2V26A 1XMXA 1H9GA 5LHHA 1ZR4A 1AKHA 2BY2A 2F4OB 4Y13A 5FB2A 5K5RA 2CUFA 1WFXA 1SFOJ 3I54A 2WAQA 5IYDJ 1VFCA 1LEAA 4G94A 1QO0D 4FE4A 1UG2A 4XL9A 2YU9J 3TP0A 4U0WA 3BR1A 3L00A 2QQ8A 1X4PA 1BIAA 2DK8A 4Q48A 1V5GA 3OS1A 1BA5A 1UZCA 3BJOA 5FKLA 3VODA 2XPUA 2YUSA 4HBLA 4CCLA 4U7BA 2M34A 1NTCA 3KETA 4IHWA 1FMVA 4CA0A 3L2WA 2XAFA 2M0CA 3VFZA 1HW5A 4ESFA 1X1CA 2LYCA 1GDTA 2O03A 2AXLA 2PJPA 2M3AA 4E7KA 2O6GE 1SMTA 2G7UA 2L01A 5A2QZ 4L18B 3AL0C 3ZN0A 3OIOA 1DPRA 4A3EJ 1JHHA 4L5EA 1RUNA 3QYEA 4P96A 2R7VA 4FX0A 2DA5A 3ASNH 2V1NA 4A3JJ 3ABLH 5FRMA 4O3MA 3GMEA 1R22A 4AWXB 2IS1A 1JE8A 2Z99A 1BW6A 4MEYF 4BHBA 2VOOA 2X85A 4KISA 1LE8B 3N97A 4UY8I 3DTEA 1UMQA 2EH3A 2KIQA 2RC4A 3PUBA 2DPUA 1G3YA 2R5YA 1FY7A 1POGA 1ZK8A 2R7QA 4A3FJ 4B48A 4X6AJ 2A5WA 2LP0A 1EH7A 1CGPA 4P55A 3ZQQA 2H6BA 3HRSA 2EA2A 4A3GJ 1IXCA 1B8IB 1RETA 3MKZA 2DA6A 5K5QA 2EWNA 4KN7X 1J09A 3CMMA 2GA2A 1IUFA 3OMYA 5E3LA 3ML6A 2F5EA 4R1HA 4EGYA 3TOAA 1YS6A 2VT3A 1QGPA 5M5WJ 1AA7A 3KP7A 3DBRB 1JKPC 4XN3A 2VONA 3CCUI 3CCSI 2OQGA 1H88C 2K7LA 2NVQJ 3IL2A 1B59A 4UUSA 1PUFA 1QRYA 4GDFA 2HQAA 2KJBA 1JUSA 3S2HJ 4M6VA 1R4NB 3OYHA 3TW6A 3LSRA 4KNYA 1IUYA 1O7LA 2ETHA 4NUBA 3UR3C 5KHDA 2E7XA 5EZHA 3MZYA 1USTA 5JI6A 4HV6A 5CVJA 5J40A 1MMNA 1E2XA 3TQNA 1YLFA 2CFOA 1U5TA 1R1UA 3WGGA 3CLQA 3PNTA 1ENHA 1TNTA 1P92A 1ZREA 2PI0A 2Q8KA 4HX8A 2WTEA 2JZYA 2O7OA 3QAHA 1FP1D 3ZQCA 1N25A 4KIGA 5ICCA 3WTUC 3GBGA 3TO6A 4LITA 3T8RA 4HYEA 4B09A 1OR7A 2ZBKA 1K7AA 4RAFA 1MNMC 2WB1A 4HAMA 1E0EA 3J7AO 4HDVA 3BY6A 2JRTA 1RZ4A 2WY8Q 2A5YB 2EIMH 2LC2A 3PO3J 1MBHA 3HOWJ 2HTJA 2EK5A 4ZH4F 4G7ZF 2WBMA 4D7MA 4BBRJ 4QPOA 1IXRC 2HKOA 4Q47A 2LD5A 4NC8A 3WTVC 4JK1X 1NG7A 4JP0A 2N8GA 2A6EF 2I8DA 3BZ6A 3NARA 4P5OA 3F8BA 1U8RA 4ON0A 2LLKA 2VLAA 3R0AA 1VQLI 2QWWA 1BC8C 4ENNA 2VODA 1O7FA 1O4XA 1SEUA 1XG1A 4IRIA 3GLLA 3PM1A 1OCOH 2XB0X 2AHQA 2VKDA 2P7VB 3ZMSA 2RQPA 4MTDA 1W7PB 2EFNA 3LQRA 4II3A 4AIDA 4EJUA 5EGOB 4QLCU 3HBLA 2ECCA 4YIRX 3IHUA 3EYIA 3B73A 2F4MB 4FISA 4IQJA 2F4IA 1JT6A 1ZG1A 2E2HJ 4DIQA 4XKBA 3I59A 2VJ4A 5HLTA 2ZO4A 4CYCA 3CC7I 2QQAA 1ETVA 2Y9YA 1UB9A 1Z7UA 4XSXF 3A03A 1J2XA 2OTJI 5ED4A 2E71A 2IP2A 3FIWA 3GZ6A 4F52A 1XGMA 2KMUA 1VQ7I 3S17J 1XSVA 1VQ6I 3QYFA 1YS7A 3CUQC 4M3EA 3TKYA 4IRHA 1YIJI 2KIFA 1H8AC 1XGSA 4DBQA 4PGHA 1ETXA 3OWTA 2LY2A 2HQNA 4BACA 1MNDA 3SZPA 3TO9A 5FLVA 2F5DA 2CW8A 2L5QA 4CCMA 1VQ5I 2HTSA 5H6QA 2BZTA 1R49A 4BXUA 5GAHJ 1W36C 2X1DA 3DU5A 4ZC3A 5B1BH 2ESHA 3SXYA 5E3OA 2CGPA 4RMNA 4Y15A 3TW7A 2E1MC 3ABMH 2IA0A 1QHGA 1U0JA 4OAZA 3RTRA 4FTHA 4L0YB 1VQ9I 2JA7J 1IAWA 2HEOA 4UVAA 5KAIC 3EUAA 4C2MJ 1G2HA 1HLVA 4RM3A 4N9HA 2VC0A 1DGRM 2LNBA 5LRRA 2HS5A 3TL4X 1EKEA 1YX5A 2VPRA 2CU7A 3HL2A 5JHFA 1ZAOA 5E8IA 3BR5A 1R1VA 3I4NJ 1WJDA 3RYPA 1IDYA 1GV5A 3RZOJ 4KN4X 1C0WA 2CSOA 4A3MJ 3GX4X 1ETYA 1JJ8C 3A0BC 1OYIA 3DEWA 2FU4A 4PCQA 4S0HB 2DMPA 5FFZA 2XSJC 3I55I 3MMYB 3V8LA 4D1QA 3LSPA 5F1JA 2Y69H 2O61A 3T8TA 2XIGA 4IOCF 3SZTA 1FYLA 2HOSA 3BJ6A 4XNFA 4ZDPA 3H5RA 2Q2EA 5HLIA 5JFRA 3D5LA 4JX4A 4RAGA 2OU2A 2Y2ZA 2E2JJ 1OCRH 2CQ7A 3DTKA 4WF2A 3GTMJ 4U0YA 1B6AA 4M6XA 2EJRA 5F0FA 5FKNA 2QA4I 2DTZA 4V2GA 3HPHA 3IH3A 3AG4H 5LLQA 2Y0SA 4G6DA 1V4RA 3GFLA 5J47A 3F0CA 1ZQ3P 1U5TC 4RB0A 1WVRA 3SHFA 4C2UA 1LB2A 1Z6TA 1ZN2A 1GT0C 3V7RA 2R4GA 2RVCA 4AVZA 3BG7A 2Y75A 3FM5A 5DYMA 4Y7NJ 4GRIA 2CO5A 2ZSIB 2FUG2 3SEZA 1RPWA 2EA4A 2LKXA 2LBFA 1JTYA 2Q1ZB 1BL0A 3EDPA 4PSWA 2Z33A 1V5FA 5CVIA 3LWFA 3PIPF 2M4KA 3HSEA 2CJJA 3GF2A 2LY1A 3V7CA 1XS9A 4FASD 2VB6A 4BKXA 1MBGA 1T0FA 3HTSB 1FBQA 1O3SA 3GXOA 4XLEA 3DKWA 4LG0B 4ZYHA 2VE8A 2GM4A 2VJ5A 3K10A 1AKHB 2IA2A 3I53A 3A2KA 2KJCA 2OCEA 1MMSA 3L2UA 2K02A 3GW2A 2R7OA 4EM1A 2DMQA 1JTXA 4I02A 5IYCJ 3Q0VA 3MN2A 3QPHA 4NC7A 4HNVA 2ACJA 3PUFA 3IUOA 3V8JA 4FE7A 1ACIA 4AYBN 2X0LA 3NEUA 3JRGA 2STTA 1XB4A 5DCMA 2BEOA 4JX6A 4B1RA 3A01A 2HU9A 2DCEA 3E6CC 4MHGA 5C4XJ 2W4SA 3QWLA 1P7IA 4S05A 1DP7P 1VQNI 3R4KA 4LG3A 2GBYA 2GOMA 2IXSA 2LFBA 2WY7Q 3S93A 2W7NA 1WRJA 1FTTA 3ABKH 4ZDLA 4E7HA 2ZSHB 4D0PA 1K6YA 4E7JA 4B3AA 3U2RA 3CUQB 4CCKA 1X3UA 3GTJJ 4ZYGA 3HDDA 3C2GA 2EILH 4L5IA 4ZTFA 2GZWA 1ETOA 2M8EA 3Q9SA 3WU2C 5AIQA 2VQGA 3F8CA 1TQIA 2OA4A 1YJNI 1MBKA 1JGGA 4BBSJ 2FOKA 1YTYA 4FX4A 4MNUA 3EUHA 2R7RA 1GVJA 3RKWA 3OYEA 3PNVA 1HSJA 3FISA 1O3RA 3HOZJ 1DDNA 4RLQA 3VEPA 5K5OA 2E1MB 3PNYA 4F91B 5IOYA 1S7AA 2P5LC 1YRNA 3E5QA 1RI7A 2LSOA 3S14J 1HXDA 4XN0A 4HF0A 1MMAA 2HDDA 2Z5UA 2XKOA 3OSFA 1CQTA 3PFYA 4B4CA 3DKXA 3J80K 4OIRF 4FT8A 2MGQA 2W00A 3KX2A 4AC0A 1Z6RA 1BOBA 5FGMA 3QP5A 4MLOA 4A3IJ 4IPAA 4XRFA 1OFCX 1KQ9A 3KZZA 1T08B 3G1MA 1IG7A 2R93J 5J8FA 2KT0A 1ZGWA 1L3LA 2V6CA 2JMWA 2NYXA 3ASOH 2FXAA 4EQQA 3W3CA 5CYVA 1Q1HA 3OY9A 2M2EA 1PDNC 2HYFA 1A6IA 1VTNC 3ZMZA 3BOQA 4UVCA 2X1EA 1K6OA 1U3EM 5E79C 2DDAA 4UB8C 1R6RA 2FMLA 2OD5A 1PJRA 5D5UB 2Y9ZA 2MG4A 4D5CA 3FMSA 1Z3XA 4E70A 2V6EA 2KRFA 2EZLA 1LDKB 1HF0A 2WA0A 5C4JJ 4UV8A 4L5JA 4UUSB 5J1RA 4CZZA 3F72A 1TWHJ 5DV5A 2PMZA 2GWRA 1IRXA 3RSNA 4ESJA 1FWZA 3M1EA 2LG4A 2GXBA 3W6VA 2QSHX 3H3ZA 1B72A 1MJBA 3RQIA 5DDGA 1P4WA 2UXXA 2M45A 4OMYA 2COMA 5GP9A 2HXOA 4N9IA 4IHVA 2QQBA 4LMYA 1U78A 5EG0A 1KZHA 5DCFA 4BNCA 3FXOA 3OL3A 2A6HF 2MLGA 1TT5B 1U5TB 3Q5FA 3F21A 2CS3A 1MBJA 2ZXJA 3HIFA 3P9IA 5HODA 2ME6A 1W36D 2JSPA 4A6DA 5B5EC 4BE1A 3G71I 4E7ZA 2XVCA 4HPQA 3HSFA 3M07A 1T2KA 2NVUB 1ZHFA 3DLLF 5D6EA 1TW3A 4KFCA 3IAM2 2QGUA 3BZCA 1BN5A 3ZGKA 2ZJPF 2IPQX 4BL0B 2M87A 1N77A 2CFXA 3S1RJ 1YW8A 1PUEE 2XRNA 3CDLA 2F48A 2HI3A 2CQNA 3WGIA 3D5RC 1BBYA 4M9ZA 4A3DJ 2DA3A 1UJ8A 3KCCA 1GXPA 4KITB 1R36A 1Y8RB 1D8KA 5TISC 4Q4ZF 2HNHA 4M3DA 2ZB9A 3P9CA 2LVSA 3VB2A 1VQ4I 1UELB 4RS8A 3K0LA 3DP7A 1I6HJ 3TP3A 2EV0A 1X3WB 4G6QA 1P4XA 5ICFA 3S8PA 4CGZA 2UXNA 2NOGA 5FKOA 4B3XA 2C6YA 1N75A 3OYAA 1RIOH 3E97A 2LY9A 2JTVA 4YFXF 1R5ID 3EPZA 3HRUA 3LA7A 3F8FA 4LGWA 3H3VK 3GEZA 3I59B 3LFKA 5IY5H 1IV8A 5HS9A 2VI6A 3TDZC 2HPIA 1QZYA 1I6XA 1XN7A 1P4AA 4LLLA 3U1KA 3MZHA 2FRHA 4EJTA 4XLNF 4EATA 1B1BA 5HNFA 2W85A 3OYMA 4GCVA 1REPC 1TTYA 3LA2A 5GPAA 1GVDA 4HZFA 4XSZF 1X19A 4M73A 5JLXA 2QM3A 4NBQA 1T6SA 2OZUA 1HCRA 2NS0A 2E34A 5IT9Z 3E3VA 1I3QJ 2BHZA 1HDPA 2XAJA 5FKMA 2K3PA 3MD2A 1T95A 3DXJF 3EUHC 4PJNA 4F92B 2H8WA 4J19A 1W5CC 2JUGA 2JRMA 5M5XJ 2NVYJ 2FQ3A 1SD4A 4JOMA 1E17A 1I1SA 2L7KA 4XORA 1FIAA 2OF7A 4CCNA 4EV0A 3H0DA 4Y17A 5IP6A 2LMDA 3RPUA 2E1OA 4BJTA 3K2ZA 4XMYA 4FCYA 3KLNA 1FSHA 2HDCA 2KIUA 4JYKA 2OQRA 3T5XA 1NK2P 2M7BA 2JPBA 3DV8A 4I09A 2IGMA 1YO5C 4DQ2A 2D1VA 3HPGA 5H6RA 3PL8A 3ESWB 3OOPA 4HDUA 5IT9K 4CDGA 1XMAA 3BR2A 5DEQA 1S5LC 1F9NA 2E35A 1OISA 2VXZA 4AIJA 1IO2A 1OCCH 4RGXA 2R5ZA 1SAXA 1HDDC 4BXXJ 2OC6A 2D5VA 2YX4A 1RESA 2O9LA 2GXGA 4RB1A 2Y48A 1FZPB 3IAS2 5BPIA 4J00A 2E7WA 2X6YA 2Q2EB 3VYRB 2PQ8A 1YFHA 1QHHD 3EQLF 1AHDP 3FXQA 3PIOF 1D3YA 2DODA 5IPAA 4I99C 3AG3H 3ERMA 4IX7A 3WU0A 2XPVA 1BI0A 4I0BA 2RAEA 1XGOA 1ZR2A 3QYBA 2PMZN 2R7WA 4RM2A 3OV8A 2LF8A 1IRGA 1KYZA 1XDUA 4HQMA 2PEXA 1MJAA 2ZFUA 4L9JA 4KICA 1A31A 3OYDA 2AO9A 4LLGF 4BE0A 4XR6A 3E6MA 4HOBA 2CW0F 1V54H 2MYSA 1OCPA 3BDDA 3IKTA 1RR8C 1J59A 4IHXA 2O3FA 3HRMA 3GLXA 3QPLA 3B6AA 3GFIA 4U0VA 4XLAA 2E5NA 4OWRB 3OYKA 1D1BA 2LBFB 3HUGB 4KIBA 4C2TA 4P9UA 3ZRGA 3OR2C 2BYVE 1FTZA 1O3QA 3A1YA 2EIJH 3FHNA 1SVOA 2G0EA 1SMYF 2IW5A 5GAGJ 4EM0B 5AIPA 1T8IA 1T39A 2MLKA 5LRSA 1LDJA 1TBXA 1JKQC 3DU6A 4HLXA 3L9FA 4KJZA 4RAZA 5CVVA 3G4SI 1R00A 1BI3A 2XF6A 4KDPA 5H2FC 4RGUA 4G12A 1E3OC 3LNQA 4LD5A 4XLHA 3ZQHA 1OYYA 2QQ9A 3H9QA 5A2QK 2HOAA 1LUJB 2D2WA 3FF5A 3TOBA 2R7SA 1Z21A 5DCMB 5L3BA 2DA7A 1Y1WJ 2EFQA 1MDMA 3IRRA 4R8HA 2R3SA 4ZJZA 4XKCA 3LSJA 1LNWA 4YG2F 3HOVJ 5EEAA 2M8GX 3FK6A 3FKJA 5J4YA 2P6SA 3GTLJ 2VJJA 2KDOA 3PSFA 1P6RA 2ESNA 3RPQA 1WJCA 1LJ9A 2VBYA 1G3TA 1TQPA 4M74A 3H9JA 1DQUA 2MBFA 4AIHA 5L3CA 2XF5A 3H9GA 1ZRFA 5D8LB 2I5UA 3HZJA 4RBOA 1USSA 1X2NA 2KQRA 1H0MA 1FSEA 2DT5A 2XPWA 3CDHA 1PVEA 2MH2A 3TDUC 4DYCA 4EJOA 1YRNB 1SANA 1WWXA 2DLLA 1IDZA 1R71A 5IYBJ 5FRNA 3CCJI 2JQ7A 2DDBA 1ZELA 1KU3A 1WJBA 1PYVA 3G1LA 1FBUA 2F5FA 3P7NA 3Q0UA 3WTYC 2PJRB 2B63J 3S1NJ 1YJWI 4OU0A 4MEXF 3MEXA 1IN8A 5ICEA 4CO8A 1I50J 4E7IA 1D5VA 5CQGA 2BW3A 3HHGA 4RA2A 2YSRA 2EZKA 1ZYRF 4NB5A 2EZHA 2FA5A 4Y3OA 4IHSA 2GQQA 1Z7LA 2MC3A 1HKSA 4F7ZA 1OYWA 3I56I 3CCMI 4PUSA 5BPDA 2YS9A 2R92J 4RB3C 3OYCA 3AG1H 2HZTA 5LHGA 2PLYA 2ZJ2A 4AYBA 4G8XA 3OS2A 3ZR8X 1AOYA 1CF7B 3M8EA 4CHUA 1J0RA 2EB7A 4B8XA 5D4SA 1VQ8I 3GTGJ 5E18F 1HKTA 2L54A 1JT0A 4IHTA 3LSTA 3ULQB 2K4BA 2MH9A 5CVRA 1DP3A 3FXRA 3WGHA 4LFUA 2VUMJ 3BC8A 5JR3A 1SFKA 3K70C 2H09A 4TV7A 2FNPA 5KAFC 5C44J 1NG6A 2DYSH 2DYRH 3QOEA 1QA6A 3DPUA 1I5ZA 3GVAA 1UAAA 1AWCA 2M7AA 2PFBA 5CVUA 5HNHA 2H6CA 1B9MA 4YEJA 1IV6A 1J7KA 1JHFA 1ETQA 5HS8A 1ORKA 4CYDA 1RR7A 1IW7F 3IP4B 3JAMZ 4A6EA 3NQOA 3SEQA 3CCLI 1BI2A 3EUKL 1BR1A 2DBBA 3DBLB 4A69C 5GADJ 3I4MJ 3GTPJ 3B6CA 3K69A 2RNJA 5FKKA 1EH8A 3FWEA 2K40A 4NDLA 1TT0A 2BOLA 3C18A 2JWTA 2XF7A 1I3AA 2JSCA 1HW1A 2V1DA 4MTEA 3C1DA 3HOTA 1J9IA 1U9NA 4PFOA 3HGGA 4NQWA 2VPLA 1MZBA 3ZP5A 2PBIA 4LK1F 4M3FA 3QU6A 4QSHA 3RKQA 1W1WE 5LEJA 3G2BA 1Z1DA 3SJMA 5DD8A 4AU7A 2JA5J 3MAJA 2J5PA 4OINF 3NRVA 4RAYA 1QZZA 1SD5A 3WE3A 2A3SA 4EM2A 2MABA 1IF1A 2L4AA 3M7GA 4DZJA 4IEJA 1TQMA 1OMIA 1W0UA 3TGNA 1PP8F 1X3ZB 1ZKGA 2XASA 3O6BB 4IXAA 4II2A 2K5CA 2ISZA 1W7PD 4F3QA 4MO7A 1LVKA 1BR2A 4E6KG 2P5KA 5M3MJ 2W1OA 3GFJA 1OPCA 2XKPA 2HYGD 5F04A 4QWQA 1G6NA 5DM6F 4XBFA 3ECHA 3V42A 2CG4A 1XCVA 1XTAA 3M9AA 4PJ0C 5E20A 2BBYA 4MFEA 5BMZA 2OJED 2K9LA 3E5UA 4XKWA 4KA4A 3RQ4A 2RN7A 4Q5SF 4HW0A 3K4MA 1S3JA 1SVLA 3FHZA 1K61A 3GTQJ 2FD5A 2EV6A 1UCRA 3J7YJ 4XK4A 5M5YJ 4MIMA 2H1LA 1QVUA 3BP8A 1OJLA 3S15J 3SYTA 3WTWC 4HRIA 1JUPA 1LDDA 3CC4I 4ESBA 3Q0WA 1OLTA 2AXTC 4GO1A 3KLOA 4KIFA 1FOWA 2NS8A 2BXZA 4PFPA 3QPTA 3OYJA 3JR9A 4IOAF 4QIWN 2NRAC 1VQKI 1X1BA 4L9VA 3T0YA 1FMWA 1OR7C 3JRCA 3IWFA 3I58A 2WAEA 4BQAA 4RGSA 3HJEA 5EZGA 1X58A 1BM9A 1QPMA 1ERDA 1QPIA 4FETA 5TJJA 3BZKA 5E8GA 2CWEA 2P5VA 2VQHA 3CUOA 3KYDB 1UHWA 2IAIA 1R7JA 2IGOA 5DD4A 4BEHB 5F64A 4BY1J 4LLNA 3CDIA 3CMEI 2ICWG 3I9V2 4M3BA 1A04A 1Y6IA 4DW6A 2QCOA 3R0JA 2ADUA 3O8HA 4HSRA 2JVGA 1ITYA 3EETA 4AUXA 3CF5F 2QBYA 3JSOA 3L09A 4CZCA 1IC8A 3MWMA 2QYOA 1RC9A 1FBSA 5E17F 2IGKA 4PGGA 4B47A 1K78A 3F6VA 1UHSA 1MKMA 3S16J 4XLCA 2QKLB 4UUVA 2EV5A 3LMMA 2DPDA 4ABZA 1YITI 1D8JA 1YIOA 1LE8A 4BQQA 4M9SA 4BDZA 2JJ7A 1F43A 3ZN1A 3JRAA 1TLHB 3DCFA 2XROA 5BQTA 3K1PA 3GZ5A 2EFOA 1KA8A 1XC5A 3O8GA 4N0BA 3QQAA 3UNGC 3H5NA 3WU1B 4K2EA 5F0HA 1ZLJA 1DPUA 1E3PA 1HQCA 3KE2A 1QNTA 3FXLA 2OUMA 2OBPA 5FFXA 5FLMJ 2DJNA 5K1YA 1JGSA 2G9WA 3T1BA 3COAC 1FP2A 1GUUA 5HDGA 2HZDA 2WC2A 1DU0A 3GZNB 1WHUA 2JPCA 2WWYA 5IP9J 5FD5A 1Z77A 3ZOBA 4F55A 1WPKA 3BQYA 4XLFA 5ILVA 4NHJA 3LSHA 1R5GA 2DJIA 3ABUA 2L0KA 3WG7H 3HC7A 4UB6C 2DA4A 2M1BA 3IRQA 5LHIA 2DOEA 1H9TA 2Y0MA 3CJRB 3CJTB 4EGZA 2BHYA 2RKHA 2L7ZA 1YX3A 2DOFA 2DFFA 3ZXSA 3FMRA 2R5YB 4CXFA 5K7ZA 1WZ2A 1R1TA 3BTCA 3FXUA 3LSGA 2NS7A 4CUGA 5CPRB 1Y1VJ 1FNNA 4L0ZB 4AVPA 4BHPA 3RI4A 2HR3A 2W82A 3EYYA 1TWAJ 2V79A 2M9HA 2ISYA 3D0SA 3F3XA 3GO5A 2DFEA 4KMUX 5F1RA 3GTKJ 4CCJA 1IZ1A 3DWLE 1VNDA 2A68F 2QLZA 5L3GA 4HEA2 3O2PE 4IQ4A 2P7CB 1KYWA 3WTXC 3K70D 1PUFB 1ZH5A 4IHYA 4XRSG 5LBQA 3MVPA 4V19K 4Y33A 2OTLI 4C3HJ 1KU2A 1DUXC 2H94A 2FF4A 3HOUJ 2M5WA 1I39A 3BCAA 1MD0A 3FK7A 3KP3A 3JRFA 2F5VA 2GOXB 1FC3A 2LKPA 2RQQA 3VYSB 1SFEA 2XGEA 2GIZA 3GFMA 5TRDA 1EA3A 5EGOA 3SDBA 3M8JA 2IS2A 2FX0A 2LR8A 2DT7B 3OYIA 4YFNF 1MMGA 1FOKA 2L9RA 4ASNA 3K4NA 3A02A 5ILSA 1A5JA 1Y8QB 3BPVA 3NWSA 5ERIA 2XSDC 1JI8A 1KU9A 1WQ2A 2BVMA 4C3JJ 1OCTC 1W5TA 1RKWA 1LFPA 1U8BA 2LF7A 4HNTA 2BW3B 5E1WA 2NVTJ 4M9XA 3IV5A 2Z2SB 3KFWX 3G73A 2NAZA 3L7WA 5JLWA 1G3WA 4PSXA 5B66C 3S2DJ 3K6GA 1R5HA 3NAUA 4A3BJ 2UZKA 3AFHA 3L2VA 3VPRA 3SZGA 1TC3C 2XHKA 1JKRC 1S7EA 1T0FC 3IH2A 2BGCA 3C3WA 4PZJA 2Z16A 5B1AH 2O5RA 3KZYA 3L1PA 3GTOJ 1LKXA 3WTZA 2LDUA 2X6OA 3OL4A 3LSIA 1Y39A 2CUZA 3A0HC 4PDKA 3ROUA 1YW9A 5L3FA 1RKTA 2Y30A 2E36A 4Y52J 2XB5A 4ZZDA 4XQFA 2ZXWH 2X51A 2A05A 5HOOA 2CV0A 2VKHA 4WWCA 4ZYAA 3CCVI 2ECBA 2L3DA 2DMTA 3U1DA 3FXJA 4CYCB 4L9NA 1KONA 1JXSA 2O8KA 1TL8A 1BW5A 3SQNA 3ABTA 3A4CA 4OIOF 3JRDA 2KIMA 2FOWA 2ELKA 2VQLA 4KUMA 2JUCA 2K85A 1IN5A 1VI0A 2DTRA 2FBKA 4I76A 4BUPA 3OR1C 3Q3SA 2XGCA 3HYIA 4A3LJ 2XUBA 2KZGA 2VXDA 3ZQFA 2QZ8A 1Z9CA 3QP6A 2XAHA 2MW8A 4M72A 4PJJA 2M30A 3E6BA 1YYVA 3BR0A 2MFZA 3H92A 3OYFA 4OIPF 3E0JB 1NK3P 4LIUA 2I10A 2PMUA 3JRHA 5D6FA 1G59A 2H1KA 1JJ6C 2TRTA 1EH6A 3DEEA 4IF4A 3DFGA 1O3TA 4ENMA 1XSXA 4EEFG 1LFBA 5F0CA 2ZNZA 1SFXA 4IJAA 1P7JA 5EDNA 2V9PA 2R7ZJ 2FE3A 2B9SA 2ZKZA 1ZRCA 5HS7A 2VT2A 3TBIA 3ISPA 3WHCA 1EJ9A 1ETKA 3AKZA 2L4MA 1WKMA 3AAFA 4ZZLA 2LK2A 1TNSA 4IVNA 2KLOA 2VKEA 2O0YA 5EF6A 2R0QC 4S04A 4EJVA 2LTPA 2DMUA 3CTAA 5DS9A 2GAUA 1BIBA 3RKXA 3RZDJ 5LFAA 1MSFC 2W48A 1G8XA 4RB2C 2DOAA 2UUZA 2TDXA 5CJ9A 1F1ZA 2XAQA 1ZG5A 3J7AY 4Z6YA 3LFUA 1EV7A 4G6TB 2AQFA 3CJQB 2W84A 4U87A 2DQRA 5IP7J 4BXFA 1MMDA 2K9SA 3I5UA 1LEBA 2MC4A 4LG0A 2HKXA 3FXKA 4A0ZA 1WH7A 1VQOI 1O57A 3FDYA 4BE2A 1S7OA 1HC8A 3RCOA 1SAUA 1TWGJ 3CMAI 2GLOA 3QOPA 4G7HF 1Z67A 5KNLA 2F2EA 4GYIA 2ZMEA 4JX5A 2K86A 3U21A 4WXDA 4CH7A 5J1YA 3H36A 4A3KJ 2ZXIA 1V3FA 2DMNA 3H35A 3CO6C 2K9NA 3ZQIA 2QSGX 4MQ9F 3I4PA 1MBEA 4WK8F 1V5EA 1G4DA 4L9TA 3OIQA 1GXQA 1XGNA 2FQ4A 4A0YA 2D1HA 2E1NA 2EIKH 2X6WA 1V55H 2CQQA 5BS6A 2ZNYA 2F6CA 3C2BA 2XGDA 3CUQA 1WCMJ 1P9QC 2IA1A 1YQAA 3NWTA 5JVTA 2CW7A 3CQZJ 3K4JA 4HX4A 3G1OA 3OSGA 3SDGA 3OYLA 3R61A 1A35A 2YPRA 2KP6A 2OAZA 3IWZA 4OAYA 1K4SA 1FIPA 3BROA 3CP2A 4FQGA 4WXCA 1ZLKA 3CD6I 2QBYB 2R7XA 1MNEA 3JW4A 3VSKA 2DI3A 2BY1A 2EFPA 3LA3A 1D1CA 1K78B 2WADA 2L7MP 3BPXA 2X1CA 3HEFA 5HDKA 3S32A 3M8FA 3TEDA 1MBFA
chains in the Genus database with same CATH topology
4IOCF 1YJNI 5JVGF 4IO9F 3PIOF 1S72I 1VQLI 2ZJRF 3CCQI 1VQ4I 3CCJI 2JQ7A 2QA4I 1YJWI 4UY8I 1FOYA 5DM6F 3I56I 3CCMI 3CC7I 2ZJQF 3J7YJ 2OTJI 1YJ9I 1Y39A 1FOXA 3CJTB 1VQ7I 1VQ6I 1VQOI 2E36A 2NXNB 3CCRI 1HC8A 3CMAI 1YIJI 1VQ8I 1YHQI 3CC4I 2E34A 3CCVI 5GAGJ 3PIPF 3CCUI 3CCSI 1FOWA 4IOAF 1VQ5I 2H8WA 5GAHJ 1VQKI 1VQMI 3CC2I 1YI2I 3G4SI 1VQPI 5GAEJ 1QA6A 2FOWA 1MMSA 1VQ9I 3CCLI 3J7ZI 1ACIA 5GADJ 3G71I 4V19K 3CMEI 2K3FA 2OTLI 3CD6I 3DLLF 3G6EI 1VQNI 5DM7F 3CF5F 2ZJPF 3CCEI 2E35A 2QEXI 3I55I 1YITI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOC F;  1YJN I;  5JVG F;  4IO9 F;  3PIO F;  1S72 I;  1VQL I;  2ZJR F;  3CCQ I;  1VQ4 I;  3CCJ I;  2JQ7 A;  2QA4 I;  1YJW I;  4UY8 I;  1FOY A;  5DM6 F;  3I56 I;  3CCM I;  3CC7 I;  2ZJQ F;  3J7Y J;  2OTJ I;  1YJ9 I;  1Y39 A;  1FOX A;  3CJT B;  1VQ7 I;  1VQ6 I;  1VQO I;  2E36 A;  2NXN B;  3CCR I;  1HC8 A;  3CMA I;  1YIJ I;  1VQ8 I;  1YHQ I;  3CC4 I;  2E34 A;  3CCV I;  5GAG J;  3PIP F;  3CCU I;  3CCS I;  1FOW A;  4IOA F;  1VQ5 I;  2H8W A;  5GAH J;  1VQK I;  1VQM I;  3CC2 I;  1YI2 I;  3G4S I;  1VQP I;  5GAE J;  1QA6 A;  2FOW A;  1MMS A;  1VQ9 I;  3CCL I;  3J7Z I;  1ACI A;  5GAD J;  3G71 I;  4V19 K;  3CME I;  2K3F A;  2OTL I;  3CD6 I;  3DLL F;  3G6E I;  1VQN I;  5DM7 F;  3CF5 F;  2ZJP F;  3CCE I;  2E35 A;  2QEX I;  3I55 I;  1YIT I; 
#chains in the Genus database with same CATH topology
 2DU9 A;  3FXM A;  2E5Z A;  3LSM A;  2OPT A;  4UVB A;  3A01 B;  3W2V A;  5GPC A;  4A93 J;  1L0O C;  3SFI A;  4X0G A;  1YW7 A;  2VBX A;  4JBA A;  2L9V A;  5DTD A;  4RDU A;  4N4O B;  2F5C A;  1SFU A;  5D8K B;  5FRO A;  2ZJR F;  2A6T A;  3CCQ I;  1TZL A;  2L02 A;  3VDX A;  4A2U A;  5EEH A;  2Z9O A;  2R7D A;  4HV5 A;  4KT6 A;  4IRG A;  1K4T A;  3LL7 A;  2BXY A;  3WTT C;  3FBN B;  4DBR A;  1QBJ A;  2VBZ A;  4LOC A;  1XDS A;  2STW A;  3K1M A;  1LQ1 A;  1F36 A;  1Z3Y A;  4A5M A;  4BJ5 C;  1W4M A;  1S6L A;  2X4H A;  3KZI C;  2BVL A;  2KDZ A;  2HGC A;  3HSR A;  1YJ9 I;  2CQK A;  2YX7 A;  1ZAR A;  1ODD A;  2HXI A;  1DU6 A;  2RGV A;  2R7U A;  4M6Y A;  3CCY A;  3JCU C;  1UHM A;  3RJP A;  2DAO A;  3BG9 A;  2RV8 A;  3ELK A;  4WX9 A;  4ZYD A;  2HPM A;  3F8N A;  1HW2 A;  1FPQ A;  5E3N A;  4MGR A;  4RLF A;  3F9K A;  3CES A;  3CC2 I;  5IOZ A;  4HQE A;  2CRG A;  3E5X A;  3VSL A;  1OKR A;  2P0W A;  1RNL A;  3MKY B;  5BNG A;  2JN6 A;  1IN4 A;  1ON1 A;  2KL4 A;  4I7H A;  3LAJ A;  3RIR A;  1XPX A;  4D9J A;  1SVM A;  1S8N A;  3E1S A;  4U88 A;  4E7S A;  2YU3 A;  3OYG A;  1KQ8 A;  3ZMT A;  2E19 A;  3RDI A;  4PJL A;  3V4G A;  2IRF G;  5FD6 A;  3PSI A;  2K27 A;  3ZMV A;  4QPQ A;  4AM3 A;  1B72 B;  3BTL A;  2OV7 A;  2VOP A;  1J5Y A;  4HX7 A;  2RNG A;  3G6E I;  4BU2 A;  1TW2 A;  4EVI A;  1A36 A;  3OIP A;  3JRB A;  1WJE A;  3LAP A;  2P4W A;  4XOT A;  3W2A A;  5EG0 B;  5D5V B;  1R9T J;  3DTI A;  1SC7 A;  5K7F A;  1BR4 A;  2WV0 A;  3WTS C;  1WJ5 A;  1IN6 A;  3S1Q J;  1XSD A;  2IS6 A;  3BQZ A;  2ZCW A;  2ZXH A;  3VYT B;  3KP4 A;  4A0X A;  2ZME C;  2ELJ A;  5H20 A;  4XLP F;  3BTI A;  2JK3 A;  1FT9 A;  5KCM A;  4OOI A;  4ITV A;  3G3Z A;  4IZZ A;  3RYR A;  3S3O A;  3H1C A;  4M3G A;  3QPS A;  3KP5 A;  1WI9 A;  4I01 A;  2R7F A;  2WAQ N;  3HG9 A;  3REO A;  3VYU B;  3ZMD A;  1ETW A;  4E4H A;  2QUF A;  4O5V A;  3SFZ A;  2ZFW A;  1D1A A;  2IBD A;  2NNN A;  3K4B A;  4ZDO A;  1ZGA A;  2J5O A;  2G7H A;  1T98 A;  4BQO A;  2B0L A;  3CMY A;  2MSY A;  3WE2 A;  2RRE A;  4BDY A;  5J8C A;  2DN0 A;  4XRS A;  3HTU A;  2FNA A;  4BGD A;  2IT0 A;  1YOV B;  3AL0 B;  3M3Y J;  1U9O A;  4BQN A;  5D5X B;  3J81 Z;  4XM3 A;  2CH0 A;  1IRF A;  1IXS B;  1I1G A;  2KPM A;  2MD5 A;  2GA1 A;  4HF2 A;  2KRH A;  3ZQ7 A;  4MFD A;  1X1P A;  3MQ0 A;  3DBH B;  5LGN A;  3E7L A;  3JAM K;  2W24 A;  3KEO A;  2IS4 A;  1D0Y A;  1ZG3 A;  3H3U A;  3MZ8 A;  9ANT A;  3O3K A;  3TO7 A;  2NXN B;  2NNY A;  2DFH A;  2M0M A;  3OYB A;  4XOP A;  1D5Y A;  3JRI A;  2V4J C;  2HDW A;  2DXI A;  1TWC J;  4D5F A;  3H5A A;  4CSW A;  1T56 A;  4UV9 A;  4YIF A;  4V2F A;  1GV2 A;  2NOJ B;  1WJA A;  4A12 A;  1U2W A;  1HKQ A;  4MQV A;  3L2C A;  1BC7 C;  1ZGJ A;  3E6D A;  3K1N A;  2JVH A;  3N4M A;  3J81 K;  2CV2 A;  1QQI A;  1LFU P;  3JTG A;  4LIV A;  3K7A J;  4I0A A;  3ERE D;  3HM5 A;  2UWM A;  3JRE A;  1F5T A;  2XV4 S;  2EBI A;  3IKV A;  4U7D A;  3J7Z I;  2X9D A;  2WV1 A;  5EEG A;  5KK1 A;  2V9K A;  4GFB A;  2DK5 A;  5F27 A;  2OCC H;  3H0G J;  3GUD A;  1S9H A;  1Y0U A;  3D5S C;  4YII A;  1ON2 A;  2LKS A;  4C30 A;  1JKO C;  3B02 A;  2EIN H;  1MIJ A;  2M4G A;  3HGY A;  3LSK A;  3U9G A;  4A3C J;  2IVM A;  1ULY A;  2NVX J;  2V1U A;  2K9Q A;  3MKW B;  4BJ6 C;  2V1X A;  3HKZ A;  3CCE I;  2R7T A;  3AG2 H;  1G3S A;  3P5J A;  1B4A A;  2VC1 A;  5GTH C;  2V7F A;  1P2F A;  3ZCO A;  4HG2 A;  3X2Q H;  2K9M A;  5CQE A;  5HLH A;  4FHT A;  3F8M A;  3KYL A;  5M3F J;  4IL6 C;  5JVG F;  2PN6 A;  2UV1 A;  2XRL A;  5J1U A;  1W5S A;  5ILU A;  3HOX J;  5J4V A;  4DGW B;  3R6S A;  3ZQG A;  1X2M A;  3S3M A;  1R58 A;  3LQQ A;  3K4L A;  3VWB A;  4I6Z A;  2DA2 A;  1BJA A;  4ANJ A;  4R79 A;  3V7S A;  1RRJ A;  1S29 A;  1Y56 A;  1UFM A;  3PQJ A;  3OYN A;  2R5Z B;  3HUG A;  5JHU A;  5CLS A;  4AIK A;  3N05 A;  2KFD A;  2Y31 A;  3CF2 A;  3QOD A;  2XC7 A;  3KP6 A;  1K83 J;  1KQ0 A;  2IEK A;  5AON A;  1FOY A;  2QVO A;  4C9Y A;  4BYY A;  2WB1 N;  1HST A;  5E3M A;  5TGT A;  1VF9 A;  2HQR A;  2IGN A;  1H89 C;  4LB5 A;  4KYW A;  2FJ1 A;  4F93 B;  1FEX A;  1SD6 A;  4LK0 F;  2P81 A;  1X4O A;  3UKG A;  1U6G A;  2H27 A;  1MH4 A;  5HVQ C;  3GYH X;  3DQV C;  4XON A;  1FOX A;  4NNJ A;  3IH4 A;  2KIS A;  1B8I A;  1ZRD A;  3JTH A;  3K9T A;  3ONQ A;  5CKT A;  3HXL A;  3QRF F;  4CCO A;  2XAG A;  2ZME B;  1QVT A;  4XRM A;  2DQL A;  1WI3 A;  2DFI A;  1YHQ I;  3BG3 A;  4D7N A;  4I2O A;  2ME0 A;  4G7O F;  3BLY A;  4ENJ A;  1WJF A;  3I71 A;  3J80 Z;  3W2W A;  2MA3 A;  4DYR A;  1IJW C;  1D0Z A;  2KKO A;  2XAU A;  4N4N B;  2L7F P;  2Z1D A;  4WXH A;  2LRD A;  5LGT A;  5ICG A;  2CUJ A;  5GAE J;  4OIQ F;  4ZYE A;  2VQC A;  1FYK A;  4Y4R A;  2W25 A;  5B3S H;  4IKF A;  4YRV A;  3RPU D;  2VAS A;  2RDP A;  1WGX A;  5IT3 A;  1OQY A;  2QKM B;  5J3L A;  1XCB A;  3M4O J;  5HDN A;  1RUO A;  4C3I J;  4UXN A;  4P9F A;  1N78 A;  4G9Y A;  4GGG A;  4HST A;  4LJZ F;  5J6X A;  1IGN A;  2EZI A;  6PAX A;  2E60 A;  2LOO A;  1GLN A;  4XIC A;  3FM3 A;  2JA8 J;  3PFI A;  1MW7 A;  3BCB A;  3KEY A;  3K4C A;  5DUK A;  1QU3 A;  2HOT A;  1NH3 A;  3S3N A;  1BOA A;  1MSE C;  3BG5 A;  2HVR A;  2QSF X;  3HHH A;  2BE5 F;  2PJR A;  2BV6 A;  4KMF A;  4ENK A;  4RGR A;  2XGX A;  4BAY A;  1MDM B;  1X1D A;  2E1C A;  1T33 A;  3KYC B;  3K4K A;  3L2R A;  3I0T A;  3ZQL A;  4PJM A;  5FO5 A;  4CIC A;  5L3D A;  2HYJ A;  5F6F A;  3HOS A;  4HLY A;  3LOC A;  3BR3 A;  3IC7 A;  1MH3 A;  3CZ6 A;  5BOX A;  2E2I J;  2AQE A;  1Y0N A;  2W57 A;  4UHT A;  2K4J A;  3L2Q A;  4LB6 B;  2BY0 A;  3BJA A;  1APL C;  1QZE A;  3FBI B;  2H8R A;  1KGS A;  3C2H A;  2VE9 A;  1HBX G;  1CF7 A;  2VJI A;  2FMY A;  2HOE A;  1W7P A;  4OMZ A;  1FX7 A;  3FMQ A;  4XKV A;  2XDV A;  1X1A A;  1XMK A;  1GHC A;  3I64 A;  2VL8 A;  4HF1 A;  1E3H A;  1LVA A;  3R60 A;  5E1Z B;  2X6X A;  3PJR A;  5D5W B;  1HOM A;  2ZC2 A;  1WH5 A;  2JT1 A;  2QEN A;  1NHA A;  2CMP A;  2GIV A;  2VN2 A;  3S1M J;  3HB9 A;  1Z05 A;  1J75 A;  4UUT A;  4DNC A;  3HOY J;  2FBI A;  1VZ0 A;  4P1W A;  1R4M B;  3CCR I;  3HRT A;  4QTR A;  4I98 B;  3M1C A;  5GTI C;  3DEU A;  2COB A;  1BJZ A;  3WG9 A;  1MJ9 A;  1T38 A;  2PX9 A;  3RKY A;  4XID A;  4H0E A;  2O8X A;  3GWZ A;  3HKZ N;  2B7E A;  2HWV A;  4HA8 A;  2OZ6 A;  2HQ5 A;  3BTJ A;  4Z2Y A;  2L9N A;  2A61 A;  2MD0 A;  3DLA A;  3Q9V A;  5E1X A;  5EYR A;  2Y0S N;  5K7H A;  1VQM I;  1F4K A;  3DPL C;  1YI2 I;  2KZV A;  4ZTJ A;  1VQP I;  1AU7 A;  3BR6 A;  3BG6 A;  4YEL A;  4EMS A;  1Q1V A;  4EJW A;  2YR2 A;  3I3L A;  1WSU A;  2ELH A;  3DKY A;  2EFW A;  2CYY A;  2ID6 A;  3BWG A;  3W6J B;  1LPQ A;  3FZV A;  1PP7 U;  1R23 A;  2VBW A;  3KPH A;  5LEK A;  1XD7 A;  4GYG A;  2JA6 J;  4PK4 A;  4GXO A;  3ZPL A;  2L9S A;  5EJC A;  4DJA A;  3MFK A;  4X1E A;  2K3F A;  2WAF A;  3MKL A;  2ID3 A;  2PG4 A;  5DM7 F;  2HVS A;  2BY3 A;  5D4R A;  3D1N I;  1ONV A;  2DA1 A;  2QF7 A;  2FEZ A;  3C7J A;  4W1U A;  3PO2 J;  2Q0O A;  1OCZ H;  3FKI J;  1DGW Y;  4DYQ A;  2QEX I;  2CV1 A;  3CO7 C;  4BH9 A;  2DO7 A;  1EF4 A;  2HFH A;  3KEQ A;  3OS0 A;  4W97 A;  4JQF A;  3BT9 A;  2V9V A;  3OOU A;  2A07 F;  1D0X A;  2DT6 A;  4IO9 F;  2EQR A;  4O6J A;  2D45 A;  4H4K C;  2LRE A;  1S72 I;  5FLX Z;  2L2O A;  5F08 A;  1HA8 A;  2HVQ A;  2A69 F;  2Z3Y A;  1A6Q A;  2KHM A;  3CLO A;  4NQW B;  4NC6 A;  1K79 A;  2P8T A;  1M1E B;  1SD7 A;  3P9K A;  2IJL A;  1I27 A;  1UG0 A;  3DPT A;  5KVR A;  1BI1 A;  3GCM A;  3V8K A;  4A5N A;  4J01 A;  3F22 A;  1FLI A;  3WHB A;  3F23 A;  1W0T A;  2VIX A;  5C3E J;  2X48 A;  3ZMU A;  4UNO A;  1STZ A;  4ETS A;  2CQX A;  3F6O A;  3MCZ A;  2LH9 A;  2KRC A;  2TCT A;  2PMH A;  5DUI A;  2GXA A;  2ZJQ F;  3CJN A;  1FJL A;  5HLG A;  3DF8 A;  5FJ8 J;  5LGU A;  4BY7 J;  4KT5 C;  4B44 A;  3S2W A;  3K2A A;  3TMO A;  1YG2 A;  2AS5 F;  4BS9 A;  3JSP A;  4HNU A;  2DW4 A;  2P6T A;  5LD2 C;  4M71 A;  4E7L A;  4AD9 A;  1ZTR A;  3KP2 A;  1KU7 A;  1B9N A;  2FBH A;  1YE9 A;  2CUE A;  5FLX K;  4DZP A;  2FSW A;  4WCG A;  1MGT A;  1TP4 A;  3WOD F;  1IN7 A;  1Z91 A;  4BEH A;  3ECO A;  1XX5 A;  1TWF J;  3PQK A;  1FYM A;  3VOE A;  2VKV A;  3QU3 A;  1JUM A;  2JA2 A;  4BHC A;  1IRZ A;  4YFK F;  3CP8 A;  4B43 A;  3KIO A;  5L3E A;  1Z0X A;  3FX3 A;  3W6K B;  2EPF A;  4DOZ A;  2V26 A;  1XMX A;  1H9G A;  5LHH A;  1ZR4 A;  1AKH A;  2BY2 A;  2F4O B;  4Y13 A;  5FB2 A;  5K5R A;  2CUF A;  1WFX A;  1SFO J;  3I54 A;  2WAQ A;  5IYD J;  1VFC A;  1LEA A;  4G94 A;  1QO0 D;  4FE4 A;  1UG2 A;  4XL9 A;  2YU9 J;  3TP0 A;  4U0W A;  3BR1 A;  3L00 A;  2QQ8 A;  1X4P A;  1BIA A;  2DK8 A;  4Q48 A;  1V5G A;  3OS1 A;  1BA5 A;  1UZC A;  3BJO A;  5FKL A;  3VOD A;  2XPU A;  2YUS A;  4HBL A;  4CCL A;  4U7B A;  2M34 A;  1NTC A;  3KET A;  4IHW A;  1FMV A;  4CA0 A;  3L2W A;  2XAF A;  2M0C A;  3VFZ A;  1HW5 A;  4ESF A;  1X1C A;  2LYC A;  1GDT A;  2O03 A;  2AXL A;  2PJP A;  2M3A A;  4E7K A;  2O6G E;  1SMT A;  2G7U A;  2L01 A;  5A2Q Z;  4L18 B;  3AL0 C;  3ZN0 A;  3OIO A;  1DPR A;  4A3E J;  1JHH A;  4L5E A;  1RUN A;  3QYE A;  4P96 A;  2R7V A;  4FX0 A;  2DA5 A;  3ASN H;  2V1N A;  4A3J J;  3ABL H;  5FRM A;  4O3M A;  3GME A;  1R22 A;  4AWX B;  2IS1 A;  1JE8 A;  2Z99 A;  1BW6 A;  4MEY F;  4BHB A;  2VOO A;  2X85 A;  4KIS A;  1LE8 B;  3N97 A;  4UY8 I;  3DTE A;  1UMQ A;  2EH3 A;  2KIQ A;  2RC4 A;  3PUB A;  2DPU A;  1G3Y A;  2R5Y A;  1FY7 A;  1POG A;  1ZK8 A;  2R7Q A;  4A3F J;  4B48 A;  4X6A J;  2A5W A;  2LP0 A;  1EH7 A;  1CGP A;  4P55 A;  3ZQQ A;  2H6B A;  3HRS A;  2EA2 A;  4A3G J;  1IXC A;  1B8I B;  1RET A;  3MKZ A;  2DA6 A;  5K5Q A;  2EWN A;  4KN7 X;  1J09 A;  3CMM A;  2GA2 A;  1IUF A;  3OMY A;  5E3L A;  3ML6 A;  2F5E A;  4R1H A;  4EGY A;  3TOA A;  1YS6 A;  2VT3 A;  1QGP A;  5M5W J;  1AA7 A;  3KP7 A;  3DBR B;  1JKP C;  4XN3 A;  2VON A;  3CCU I;  3CCS I;  2OQG A;  1H88 C;  2K7L A;  2NVQ J;  3IL2 A;  1B59 A;  4UUS A;  1PUF A;  1QRY A;  4GDF A;  2HQA A;  2KJB A;  1JUS A;  3S2H J;  4M6V A;  1R4N B;  3OYH A;  3TW6 A;  3LSR A;  4KNY A;  1IUY A;  1O7L A;  2ETH A;  4NUB A;  3UR3 C;  5KHD A;  2E7X A;  5EZH A;  3MZY A;  1UST A;  5JI6 A;  4HV6 A;  5CVJ A;  5J40 A;  1MMN A;  1E2X A;  3TQN A;  1YLF A;  2CFO A;  1U5T A;  1R1U A;  3WGG A;  3CLQ A;  3PNT A;  1ENH A;  1TNT A;  1P92 A;  1ZRE A;  2PI0 A;  2Q8K A;  4HX8 A;  2WTE A;  2JZY A;  2O7O A;  3QAH A;  1FP1 D;  3ZQC A;  1N25 A;  4KIG A;  5ICC A;  3WTU C;  3GBG A;  3TO6 A;  4LIT A;  3T8R A;  4HYE A;  4B09 A;  1OR7 A;  2ZBK A;  1K7A A;  4RAF A;  1MNM C;  2WB1 A;  4HAM A;  1E0E A;  3J7A O;  4HDV A;  3BY6 A;  2JRT A;  1RZ4 A;  2WY8 Q;  2A5Y B;  2EIM H;  2LC2 A;  3PO3 J;  1MBH A;  3HOW J;  2HTJ A;  2EK5 A;  4ZH4 F;  4G7Z F;  2WBM A;  4D7M A;  4BBR J;  4QPO A;  1IXR C;  2HKO A;  4Q47 A;  2LD5 A;  4NC8 A;  3WTV C;  4JK1 X;  1NG7 A;  4JP0 A;  2N8G A;  2A6E F;  2I8D A;  3BZ6 A;  3NAR A;  4P5O A;  3F8B A;  1U8R A;  4ON0 A;  2LLK A;  2VLA A;  3R0A A;  1VQL I;  2QWW A;  1BC8 C;  4ENN A;  2VOD A;  1O7F A;  1O4X A;  1SEU A;  1XG1 A;  4IRI A;  3GLL A;  3PM1 A;  1OCO H;  2XB0 X;  2AHQ A;  2VKD A;  2P7V B;  3ZMS A;  2RQP A;  4MTD A;  1W7P B;  2EFN A;  3LQR A;  4II3 A;  4AID A;  4EJU A;  5EGO B;  4QLC U;  3HBL A;  2ECC A;  4YIR X;  3IHU A;  3EYI A;  3B73 A;  2F4M B;  4FIS A;  4IQJ A;  2F4I A;  1JT6 A;  1ZG1 A;  2E2H J;  4DIQ A;  4XKB A;  3I59 A;  2VJ4 A;  5HLT A;  2ZO4 A;  4CYC A;  3CC7 I;  2QQA A;  1ETV A;  2Y9Y A;  1UB9 A;  1Z7U A;  4XSX F;  3A03 A;  1J2X A;  2OTJ I;  5ED4 A;  2E71 A;  2IP2 A;  3FIW A;  3GZ6 A;  4F52 A;  1XGM A;  2KMU A;  1VQ7 I;  3S17 J;  1XSV A;  1VQ6 I;  3QYF A;  1YS7 A;  3CUQ C;  4M3E A;  3TKY A;  4IRH A;  1YIJ I;  2KIF A;  1H8A C;  1XGS A;  4DBQ A;  4PGH A;  1ETX A;  3OWT A;  2LY2 A;  2HQN A;  4BAC A;  1MND A;  3SZP A;  3TO9 A;  5FLV A;  2F5D A;  2CW8 A;  2L5Q A;  4CCM A;  1VQ5 I;  2HTS A;  5H6Q A;  2BZT A;  1R49 A;  4BXU A;  5GAH J;  1W36 C;  2X1D A;  3DU5 A;  4ZC3 A;  5B1B H;  2ESH A;  3SXY A;  5E3O A;  2CGP A;  4RMN A;  4Y15 A;  3TW7 A;  2E1M C;  3ABM H;  2IA0 A;  1QHG A;  1U0J A;  4OAZ A;  3RTR A;  4FTH A;  4L0Y B;  1VQ9 I;  2JA7 J;  1IAW A;  2HEO A;  4UVA A;  5KAI C;  3EUA A;  4C2M J;  1G2H A;  1HLV A;  4RM3 A;  4N9H A;  2VC0 A;  1DGR M;  2LNB A;  5LRR A;  2HS5 A;  3TL4 X;  1EKE A;  1YX5 A;  2VPR A;  2CU7 A;  3HL2 A;  5JHF A;  1ZAO A;  5E8I A;  3BR5 A;  1R1V A;  3I4N J;  1WJD A;  3RYP A;  1IDY A;  1GV5 A;  3RZO J;  4KN4 X;  1C0W A;  2CSO A;  4A3M J;  3GX4 X;  1ETY A;  1JJ8 C;  3A0B C;  1OYI A;  3DEW A;  2FU4 A;  4PCQ A;  4S0H B;  2DMP A;  5FFZ A;  2XSJ C;  3I55 I;  3MMY B;  3V8L A;  4D1Q A;  3LSP A;  5F1J A;  2Y69 H;  2O61 A;  3T8T A;  2XIG A;  4IOC F;  3SZT A;  1FYL A;  2HOS A;  3BJ6 A;  4XNF A;  4ZDP A;  3H5R A;  2Q2E A;  5HLI A;  5JFR A;  3D5L A;  4JX4 A;  4RAG A;  2OU2 A;  2Y2Z A;  2E2J J;  1OCR H;  2CQ7 A;  3DTK A;  4WF2 A;  3GTM J;  4U0Y A;  1B6A A;  4M6X A;  2EJR A;  5F0F A;  5FKN A;  2QA4 I;  2DTZ A;  4V2G A;  3HPH A;  3IH3 A;  3AG4 H;  5LLQ A;  2Y0S A;  4G6D A;  1V4R A;  3GFL A;  5J47 A;  3F0C A;  1ZQ3 P;  1U5T C;  4RB0 A;  1WVR A;  3SHF A;  4C2U A;  1LB2 A;  1Z6T A;  1ZN2 A;  1GT0 C;  3V7R A;  2R4G A;  2RVC A;  4AVZ A;  3BG7 A;  2Y75 A;  3FM5 A;  5DYM A;  4Y7N J;  4GRI A;  2CO5 A;  2ZSI B;  2FUG 2;  3SEZ A;  1RPW A;  2EA4 A;  2LKX A;  2LBF A;  1JTY A;  2Q1Z B;  1BL0 A;  3EDP A;  4PSW A;  2Z33 A;  1V5F A;  5CVI A;  3LWF A;  3PIP F;  2M4K A;  3HSE A;  2CJJ A;  3GF2 A;  2LY1 A;  3V7C A;  1XS9 A;  4FAS D;  2VB6 A;  4BKX A;  1MBG A;  1T0F A;  3HTS B;  1FBQ A;  1O3S A;  3GXO A;  4XLE A;  3DKW A;  4LG0 B;  4ZYH A;  2VE8 A;  2GM4 A;  2VJ5 A;  3K10 A;  1AKH B;  2IA2 A;  3I53 A;  3A2K A;  2KJC A;  2OCE A;  1MMS A;  3L2U A;  2K02 A;  3GW2 A;  2R7O A;  4EM1 A;  2DMQ A;  1JTX A;  4I02 A;  5IYC J;  3Q0V A;  3MN2 A;  3QPH A;  4NC7 A;  4HNV A;  2ACJ A;  3PUF A;  3IUO A;  3V8J A;  4FE7 A;  1ACI A;  4AYB N;  2X0L A;  3NEU A;  3JRG A;  2STT A;  1XB4 A;  5DCM A;  2BEO A;  4JX6 A;  4B1R A;  3A01 A;  2HU9 A;  2DCE A;  3E6C C;  4MHG A;  5C4X J;  2W4S A;  3QWL A;  1P7I A;  4S05 A;  1DP7 P;  1VQN I;  3R4K A;  4LG3 A;  2GBY A;  2GOM A;  2IXS A;  2LFB A;  2WY7 Q;  3S93 A;  2W7N A;  1WRJ A;  1FTT A;  3ABK H;  4ZDL A;  4E7H A;  2ZSH B;  4D0P A;  1K6Y A;  4E7J A;  4B3A A;  3U2R A;  3CUQ B;  4CCK A;  1X3U A;  3GTJ J;  4ZYG A;  3HDD A;  3C2G A;  2EIL H;  4L5I A;  4ZTF A;  2GZW A;  1ETO A;  2M8E A;  3Q9S A;  3WU2 C;  5AIQ A;  2VQG A;  3F8C A;  1TQI A;  2OA4 A;  1YJN I;  1MBK A;  1JGG A;  4BBS J;  2FOK A;  1YTY A;  4FX4 A;  4MNU A;  3EUH A;  2R7R A;  1GVJ A;  3RKW A;  3OYE A;  3PNV A;  1HSJ A;  3FIS A;  1O3R A;  3HOZ J;  1DDN A;  4RLQ A;  3VEP A;  5K5O A;  2E1M B;  3PNY A;  4F91 B;  5IOY A;  1S7A A;  2P5L C;  1YRN A;  3E5Q A;  1RI7 A;  2LSO A;  3S14 J;  1HXD A;  4XN0 A;  4HF0 A;  1MMA A;  2HDD A;  2Z5U A;  2XKO A;  3OSF A;  1CQT A;  3PFY A;  4B4C A;  3DKX A;  3J80 K;  4OIR F;  4FT8 A;  2MGQ A;  2W00 A;  3KX2 A;  4AC0 A;  1Z6R A;  1BOB A;  5FGM A;  3QP5 A;  4MLO A;  4A3I J;  4IPA A;  4XRF A;  1OFC X;  1KQ9 A;  3KZZ A;  1T08 B;  3G1M A;  1IG7 A;  2R93 J;  5J8F A;  2KT0 A;  1ZGW A;  1L3L A;  2V6C A;  2JMW A;  2NYX A;  3ASO H;  2FXA A;  4EQQ A;  3W3C A;  5CYV A;  1Q1H A;  3OY9 A;  2M2E A;  1PDN C;  2HYF A;  1A6I A;  1VTN C;  3ZMZ A;  3BOQ A;  4UVC A;  2X1E A;  1K6O A;  1U3E M;  5E79 C;  2DDA A;  4UB8 C;  1R6R A;  2FML A;  2OD5 A;  1PJR A;  5D5U B;  2Y9Z A;  2MG4 A;  4D5C A;  3FMS A;  1Z3X A;  4E70 A;  2V6E A;  2KRF A;  2EZL A;  1LDK B;  1HF0 A;  2WA0 A;  5C4J J;  4UV8 A;  4L5J A;  4UUS B;  5J1R A;  4CZZ A;  3F72 A;  1TWH J;  5DV5 A;  2PMZ A;  2GWR A;  1IRX A;  3RSN A;  4ESJ A;  1FWZ A;  3M1E A;  2LG4 A;  2GXB A;  3W6V A;  2QSH X;  3H3Z A;  1B72 A;  1MJB A;  3RQI A;  5DDG A;  1P4W A;  2UXX A;  2M45 A;  4OMY A;  2COM A;  5GP9 A;  2HXO A;  4N9I A;  4IHV A;  2QQB A;  4LMY A;  1U78 A;  5EG0 A;  1KZH A;  5DCF A;  4BNC A;  3FXO A;  3OL3 A;  2A6H F;  2MLG A;  1TT5 B;  1U5T B;  3Q5F A;  3F21 A;  2CS3 A;  1MBJ A;  2ZXJ A;  3HIF A;  3P9I A;  5HOD A;  2ME6 A;  1W36 D;  2JSP A;  4A6D A;  5B5E C;  4BE1 A;  3G71 I;  4E7Z A;  2XVC A;  4HPQ A;  3HSF A;  3M07 A;  1T2K A;  2NVU B;  1ZHF A;  3DLL F;  5D6E A;  1TW3 A;  4KFC A;  3IAM 2;  2QGU A;  3BZC A;  1BN5 A;  3ZGK A;  2ZJP F;  2IPQ X;  4BL0 B;  2M87 A;  1N77 A;  2CFX A;  3S1R J;  1YW8 A;  1PUE E;  2XRN A;  3CDL A;  2F48 A;  2HI3 A;  2CQN A;  3WGI A;  3D5R C;  1BBY A;  4M9Z A;  4A3D J;  2DA3 A;  1UJ8 A;  3KCC A;  1GXP A;  4KIT B;  1R36 A;  1Y8R B;  1D8K A;  5TIS C;  4Q4Z F;  2HNH A;  4M3D A;  2ZB9 A;  3P9C A;  2LVS A;  3VB2 A;  1VQ4 I;  1UEL B;  4RS8 A;  3K0L A;  3DP7 A;  1I6H J;  3TP3 A;  2EV0 A;  1X3W B;  4G6Q A;  1P4X A;  5ICF A;  3S8P A;  4CGZ A;  2UXN A;  2NOG A;  5FKO A;  4B3X A;  2C6Y A;  1N75 A;  3OYA A;  1RIO H;  3E97 A;  2LY9 A;  2JTV A;  4YFX F;  1R5I D;  3EPZ A;  3HRU A;  3LA7 A;  3F8F A;  4LGW A;  3H3V K;  3GEZ A;  3I59 B;  3LFK A;  5IY5 H;  1IV8 A;  5HS9 A;  2VI6 A;  3TDZ C;  2HPI A;  1QZY A;  1I6X A;  1XN7 A;  1P4A A;  4LLL A;  3U1K A;  3MZH A;  2FRH A;  4EJT A;  4XLN F;  4EAT A;  1B1B A;  5HNF A;  2W85 A;  3OYM A;  4GCV A;  1REP C;  1TTY A;  3LA2 A;  5GPA A;  1GVD A;  4HZF A;  4XSZ F;  1X19 A;  4M73 A;  5JLX A;  2QM3 A;  4NBQ A;  1T6S A;  2OZU A;  1HCR A;  2NS0 A;  2E34 A;  5IT9 Z;  3E3V A;  1I3Q J;  2BHZ A;  1HDP A;  2XAJ A;  5FKM A;  2K3P A;  3MD2 A;  1T95 A;  3DXJ F;  3EUH C;  4PJN A;  4F92 B;  2H8W A;  4J19 A;  1W5C C;  2JUG A;  2JRM A;  5M5X J;  2NVY J;  2FQ3 A;  1SD4 A;  4JOM A;  1E17 A;  1I1S A;  2L7K A;  4XOR A;  1FIA A;  2OF7 A;  4CCN A;  4EV0 A;  3H0D A;  4Y17 A;  5IP6 A;  2LMD A;  3RPU A;  2E1O A;  4BJT A;  3K2Z A;  4XMY A;  4FCY A;  3KLN A;  1FSH A;  2HDC A;  2KIU A;  4JYK A;  2OQR A;  3T5X A;  1NK2 P;  2M7B A;  2JPB A;  3DV8 A;  4I09 A;  2IGM A;  1YO5 C;  4DQ2 A;  2D1V A;  3HPG A;  5H6R A;  3PL8 A;  3ESW B;  3OOP A;  4HDU A;  5IT9 K;  4CDG A;  1XMA A;  3BR2 A;  5DEQ A;  1S5L C;  1F9N A;  2E35 A;  1OIS A;  2VXZ A;  4AIJ A;  1IO2 A;  1OCC H;  4RGX A;  2R5Z A;  1SAX A;  1HDD C;  4BXX J;  2OC6 A;  2D5V A;  2YX4 A;  1RES A;  2O9L A;  2GXG A;  4RB1 A;  2Y48 A;  1FZP B;  3IAS 2;  5BPI A;  4J00 A;  2E7W A;  2X6Y A;  2Q2E B;  3VYR B;  2PQ8 A;  1YFH A;  1QHH D;  3EQL F;  1AHD P;  3FXQ A;  3PIO F;  1D3Y A;  2DOD A;  5IPA A;  4I99 C;  3AG3 H;  3ERM A;  4IX7 A;  3WU0 A;  2XPV A;  1BI0 A;  4I0B A;  2RAE A;  1XGO A;  1ZR2 A;  3QYB A;  2PMZ N;  2R7W A;  4RM2 A;  3OV8 A;  2LF8 A;  1IRG A;  1KYZ A;  1XDU A;  4HQM A;  2PEX A;  1MJA A;  2ZFU A;  4L9J A;  4KIC A;  1A31 A;  3OYD A;  2AO9 A;  4LLG F;  4BE0 A;  4XR6 A;  3E6M A;  4HOB A;  2CW0 F;  1V54 H;  2MYS A;  1OCP A;  3BDD A;  3IKT A;  1RR8 C;  1J59 A;  4IHX A;  2O3F A;  3HRM A;  3GLX A;  3QPL A;  3B6A A;  3GFI A;  4U0V A;  4XLA A;  2E5N A;  4OWR B;  3OYK A;  1D1B A;  2LBF B;  3HUG B;  4KIB A;  4C2T A;  4P9U A;  3ZRG A;  3OR2 C;  2BYV E;  1FTZ A;  1O3Q A;  3A1Y A;  2EIJ H;  3FHN A;  1SVO A;  2G0E A;  1SMY F;  2IW5 A;  5GAG J;  4EM0 B;  5AIP A;  1T8I A;  1T39 A;  2MLK A;  5LRS A;  1LDJ A;  1TBX A;  1JKQ C;  3DU6 A;  4HLX A;  3L9F A;  4KJZ A;  4RAZ A;  5CVV A;  3G4S I;  1R00 A;  1BI3 A;  2XF6 A;  4KDP A;  5H2F C;  4RGU A;  4G12 A;  1E3O C;  3LNQ A;  4LD5 A;  4XLH A;  3ZQH A;  1OYY A;  2QQ9 A;  3H9Q A;  5A2Q K;  2HOA A;  1LUJ B;  2D2W A;  3FF5 A;  3TOB A;  2R7S A;  1Z21 A;  5DCM B;  5L3B A;  2DA7 A;  1Y1W J;  2EFQ A;  1MDM A;  3IRR A;  4R8H A;  2R3S A;  4ZJZ A;  4XKC A;  3LSJ A;  1LNW A;  4YG2 F;  3HOV J;  5EEA A;  2M8G X;  3FK6 A;  3FKJ A;  5J4Y A;  2P6S A;  3GTL J;  2VJJ A;  2KDO A;  3PSF A;  1P6R A;  2ESN A;  3RPQ A;  1WJC A;  1LJ9 A;  2VBY A;  1G3T A;  1TQP A;  4M74 A;  3H9J A;  1DQU A;  2MBF A;  4AIH A;  5L3C A;  2XF5 A;  3H9G A;  1ZRF A;  5D8L B;  2I5U A;  3HZJ A;  4RBO A;  1USS A;  1X2N A;  2KQR A;  1H0M A;  1FSE A;  2DT5 A;  2XPW A;  3CDH A;  1PVE A;  2MH2 A;  3TDU C;  4DYC A;  4EJO A;  1YRN B;  1SAN A;  1WWX A;  2DLL A;  1IDZ A;  1R71 A;  5IYB J;  5FRN A;  3CCJ I;  2JQ7 A;  2DDB A;  1ZEL A;  1KU3 A;  1WJB A;  1PYV A;  3G1L A;  1FBU A;  2F5F A;  3P7N A;  3Q0U A;  3WTY C;  2PJR B;  2B63 J;  3S1N J;  1YJW I;  4OU0 A;  4MEX F;  3MEX A;  1IN8 A;  5ICE A;  4CO8 A;  1I50 J;  4E7I A;  1D5V A;  5CQG A;  2BW3 A;  3HHG A;  4RA2 A;  2YSR A;  2EZK A;  1ZYR F;  4NB5 A;  2EZH A;  2FA5 A;  4Y3O A;  4IHS A;  2GQQ A;  1Z7L A;  2MC3 A;  1HKS A;  4F7Z A;  1OYW A;  3I56 I;  3CCM I;  4PUS A;  5BPD A;  2YS9 A;  2R92 J;  4RB3 C;  3OYC A;  3AG1 H;  2HZT A;  5LHG A;  2PLY A;  2ZJ2 A;  4AYB A;  4G8X A;  3OS2 A;  3ZR8 X;  1AOY A;  1CF7 B;  3M8E A;  4CHU A;  1J0R A;  2EB7 A;  4B8X A;  5D4S A;  1VQ8 I;  3GTG J;  5E18 F;  1HKT A;  2L54 A;  1JT0 A;  4IHT A;  3LST A;  3ULQ B;  2K4B A;  2MH9 A;  5CVR A;  1DP3 A;  3FXR A;  3WGH A;  4LFU A;  2VUM J;  3BC8 A;  5JR3 A;  1SFK A;  3K70 C;  2H09 A;  4TV7 A;  2FNP A;  5KAF C;  5C44 J;  1NG6 A;  2DYS H;  2DYR H;  3QOE A;  1QA6 A;  3DPU A;  1I5Z A;  3GVA A;  1UAA A;  1AWC A;  2M7A A;  2PFB A;  5CVU A;  5HNH A;  2H6C A;  1B9M A;  4YEJ A;  1IV6 A;  1J7K A;  1JHF A;  1ETQ A;  5HS8 A;  1ORK A;  4CYD A;  1RR7 A;  1IW7 F;  3IP4 B;  3JAM Z;  4A6E A;  3NQO A;  3SEQ A;  3CCL I;  1BI2 A;  3EUK L;  1BR1 A;  2DBB A;  3DBL B;  4A69 C;  5GAD J;  3I4M J;  3GTP J;  3B6C A;  3K69 A;  2RNJ A;  5FKK A;  1EH8 A;  3FWE A;  2K40 A;  4NDL A;  1TT0 A;  2BOL A;  3C18 A;  2JWT A;  2XF7 A;  1I3A A;  2JSC A;  1HW1 A;  2V1D A;  4MTE A;  3C1D A;  3HOT A;  1J9I A;  1U9N A;  4PFO A;  3HGG A;  4NQW A;  2VPL A;  1MZB A;  3ZP5 A;  2PBI A;  4LK1 F;  4M3F A;  3QU6 A;  4QSH A;  3RKQ A;  1W1W E;  5LEJ A;  3G2B A;  1Z1D A;  3SJM A;  5DD8 A;  4AU7 A;  2JA5 J;  3MAJ A;  2J5P A;  4OIN F;  3NRV A;  4RAY A;  1QZZ A;  1SD5 A;  3WE3 A;  2A3S A;  4EM2 A;  2MAB A;  1IF1 A;  2L4A A;  3M7G A;  4DZJ A;  4IEJ A;  1TQM A;  1OMI A;  1W0U A;  3TGN A;  1PP8 F;  1X3Z B;  1ZKG A;  2XAS A;  3O6B B;  4IXA A;  4II2 A;  2K5C A;  2ISZ A;  1W7P D;  4F3Q A;  4MO7 A;  1LVK A;  1BR2 A;  4E6K G;  2P5K A;  5M3M J;  2W1O A;  3GFJ A;  1OPC A;  2XKP A;  2HYG D;  5F04 A;  4QWQ A;  1G6N A;  5DM6 F;  4XBF A;  3ECH A;  3V42 A;  2CG4 A;  1XCV A;  1XTA A;  3M9A A;  4PJ0 C;  5E20 A;  2BBY A;  4MFE A;  5BMZ A;  2OJE D;  2K9L A;  3E5U A;  4XKW A;  4KA4 A;  3RQ4 A;  2RN7 A;  4Q5S F;  4HW0 A;  3K4M A;  1S3J A;  1SVL A;  3FHZ A;  1K61 A;  3GTQ J;  2FD5 A;  2EV6 A;  1UCR A;  3J7Y J;  4XK4 A;  5M5Y J;  4MIM A;  2H1L A;  1QVU A;  3BP8 A;  1OJL A;  3S15 J;  3SYT A;  3WTW C;  4HRI A;  1JUP A;  1LDD A;  3CC4 I;  4ESB A;  3Q0W A;  1OLT A;  2AXT C;  4GO1 A;  3KLO A;  4KIF A;  1FOW A;  2NS8 A;  2BXZ A;  4PFP A;  3QPT A;  3OYJ A;  3JR9 A;  4IOA F;  4QIW N;  2NRA C;  1VQK I;  1X1B A;  4L9V A;  3T0Y A;  1FMW A;  1OR7 C;  3JRC A;  3IWF A;  3I58 A;  2WAE A;  4BQA A;  4RGS A;  3HJE A;  5EZG A;  1X58 A;  1BM9 A;  1QPM A;  1ERD A;  1QPI A;  4FET A;  5TJJ A;  3BZK A;  5E8G A;  2CWE A;  2P5V A;  2VQH A;  3CUO A;  3KYD B;  1UHW A;  2IAI A;  1R7J A;  2IGO A;  5DD4 A;  4BEH B;  5F64 A;  4BY1 J;  4LLN A;  3CDI A;  3CME I;  2ICW G;  3I9V 2;  4M3B A;  1A04 A;  1Y6I A;  4DW6 A;  2QCO A;  3R0J A;  2ADU A;  3O8H A;  4HSR A;  2JVG A;  1ITY A;  3EET A;  4AUX A;  3CF5 F;  2QBY A;  3JSO A;  3L09 A;  4CZC A;  1IC8 A;  3MWM A;  2QYO A;  1RC9 A;  1FBS A;  5E17 F;  2IGK A;  4PGG A;  4B47 A;  1K78 A;  3F6V A;  1UHS A;  1MKM A;  3S16 J;  4XLC A;  2QKL B;  4UUV A;  2EV5 A;  3LMM A;  2DPD A;  4ABZ A;  1YIT I;  1D8J A;  1YIO A;  1LE8 A;  4BQQ A;  4M9S A;  4BDZ A;  2JJ7 A;  1F43 A;  3ZN1 A;  3JRA A;  1TLH B;  3DCF A;  2XRO A;  5BQT A;  3K1P A;  3GZ5 A;  2EFO A;  1KA8 A;  1XC5 A;  3O8G A;  4N0B A;  3QQA A;  3UNG C;  3H5N A;  3WU1 B;  4K2E A;  5F0H A;  1ZLJ A;  1DPU A;  1E3P A;  1HQC A;  3KE2 A;  1QNT A;  3FXL A;  2OUM A;  2OBP A;  5FFX A;  5FLM J;  2DJN A;  5K1Y A;  1JGS A;  2G9W A;  3T1B A;  3COA C;  1FP2 A;  1GUU A;  5HDG A;  2HZD A;  2WC2 A;  1DU0 A;  3GZN B;  1WHU A;  2JPC A;  2WWY A;  5IP9 J;  5FD5 A;  1Z77 A;  3ZOB A;  4F55 A;  1WPK A;  3BQY A;  4XLF A;  5ILV A;  4NHJ A;  3LSH A;  1R5G A;  2DJI A;  3ABU A;  2L0K A;  3WG7 H;  3HC7 A;  4UB6 C;  2DA4 A;  2M1B A;  3IRQ A;  5LHI A;  2DOE A;  1H9T A;  2Y0M A;  3CJR B;  3CJT B;  4EGZ A;  2BHY A;  2RKH A;  2L7Z A;  1YX3 A;  2DOF A;  2DFF A;  3ZXS A;  3FMR A;  2R5Y B;  4CXF A;  5K7Z A;  1WZ2 A;  1R1T A;  3BTC A;  3FXU A;  3LSG A;  2NS7 A;  4CUG A;  5CPR B;  1Y1V J;  1FNN A;  4L0Z B;  4AVP A;  4BHP A;  3RI4 A;  2HR3 A;  2W82 A;  3EYY A;  1TWA J;  2V79 A;  2M9H A;  2ISY A;  3D0S A;  3F3X A;  3GO5 A;  2DFE A;  4KMU X;  5F1R A;  3GTK J;  4CCJ A;  1IZ1 A;  3DWL E;  1VND A;  2A68 F;  2QLZ A;  5L3G A;  4HEA 2;  3O2P E;  4IQ4 A;  2P7C B;  1KYW A;  3WTX C;  3K70 D;  1PUF B;  1ZH5 A;  4IHY A;  4XRS G;  5LBQ A;  3MVP A;  4V19 K;  4Y33 A;  2OTL I;  4C3H J;  1KU2 A;  1DUX C;  2H94 A;  2FF4 A;  3HOU J;  2M5W A;  1I39 A;  3BCA A;  1MD0 A;  3FK7 A;  3KP3 A;  3JRF A;  2F5V A;  2GOX B;  1FC3 A;  2LKP A;  2RQQ A;  3VYS B;  1SFE A;  2XGE A;  2GIZ A;  3GFM A;  5TRD A;  1EA3 A;  5EGO A;  3SDB A;  3M8J A;  2IS2 A;  2FX0 A;  2LR8 A;  2DT7 B;  3OYI A;  4YFN F;  1MMG A;  1FOK A;  2L9R A;  4ASN A;  3K4N A;  3A02 A;  5ILS A;  1A5J A;  1Y8Q B;  3BPV A;  3NWS A;  5ERI A;  2XSD C;  1JI8 A;  1KU9 A;  1WQ2 A;  2BVM A;  4C3J J;  1OCT C;  1W5T A;  1RKW A;  1LFP A;  1U8B A;  2LF7 A;  4HNT A;  2BW3 B;  5E1W A;  2NVT J;  4M9X A;  3IV5 A;  2Z2S B;  3KFW X;  3G73 A;  2NAZ A;  3L7W A;  5JLW A;  1G3W A;  4PSX A;  5B66 C;  3S2D J;  3K6G A;  1R5H A;  3NAU A;  4A3B J;  2UZK A;  3AFH A;  3L2V A;  3VPR A;  3SZG A;  1TC3 C;  2XHK A;  1JKR C;  1S7E A;  1T0F C;  3IH2 A;  2BGC A;  3C3W A;  4PZJ A;  2Z16 A;  5B1A H;  2O5R A;  3KZY A;  3L1P A;  3GTO J;  1LKX A;  3WTZ A;  2LDU A;  2X6O A;  3OL4 A;  3LSI A;  1Y39 A;  2CUZ A;  3A0H C;  4PDK A;  3ROU A;  1YW9 A;  5L3F A;  1RKT A;  2Y30 A;  2E36 A;  4Y52 J;  2XB5 A;  4ZZD A;  4XQF A;  2ZXW H;  2X51 A;  2A05 A;  5HOO A;  2CV0 A;  2VKH A;  4WWC A;  4ZYA A;  3CCV I;  2ECB A;  2L3D A;  2DMT A;  3U1D A;  3FXJ A;  4CYC B;  4L9N A;  1KON A;  1JXS A;  2O8K A;  1TL8 A;  1BW5 A;  3SQN A;  3ABT A;  3A4C A;  4OIO F;  3JRD A;  2KIM A;  2FOW A;  2ELK A;  2VQL A;  4KUM A;  2JUC A;  2K85 A;  1IN5 A;  1VI0 A;  2DTR A;  2FBK A;  4I76 A;  4BUP A;  3OR1 C;  3Q3S A;  2XGC A;  3HYI A;  4A3L J;  2XUB A;  2KZG A;  2VXD A;  3ZQF A;  2QZ8 A;  1Z9C A;  3QP6 A;  2XAH A;  2MW8 A;  4M72 A;  4PJJ A;  2M30 A;  3E6B A;  1YYV A;  3BR0 A;  2MFZ A;  3H92 A;  3OYF A;  4OIP F;  3E0J B;  1NK3 P;  4LIU A;  2I10 A;  2PMU A;  3JRH A;  5D6F A;  1G59 A;  2H1K A;  1JJ6 C;  2TRT A;  1EH6 A;  3DEE A;  4IF4 A;  3DFG A;  1O3T A;  4ENM A;  1XSX A;  4EEF G;  1LFB A;  5F0C A;  2ZNZ A;  1SFX A;  4IJA A;  1P7J A;  5EDN A;  2V9P A;  2R7Z J;  2FE3 A;  2B9S A;  2ZKZ A;  1ZRC A;  5HS7 A;  2VT2 A;  3TBI A;  3ISP A;  3WHC A;  1EJ9 A;  1ETK A;  3AKZ A;  2L4M A;  1WKM A;  3AAF A;  4ZZL A;  2LK2 A;  1TNS A;  4IVN A;  2KLO A;  2VKE A;  2O0Y A;  5EF6 A;  2R0Q C;  4S04 A;  4EJV A;  2LTP A;  2DMU A;  3CTA A;  5DS9 A;  2GAU A;  1BIB A;  3RKX A;  3RZD J;  5LFA A;  1MSF C;  2W48 A;  1G8X A;  4RB2 C;  2DOA A;  2UUZ A;  2TDX A;  5CJ9 A;  1F1Z A;  2XAQ A;  1ZG5 A;  3J7A Y;  4Z6Y A;  3LFU A;  1EV7 A;  4G6T B;  2AQF A;  3CJQ B;  2W84 A;  4U87 A;  2DQR A;  5IP7 J;  4BXF A;  1MMD A;  2K9S A;  3I5U A;  1LEB A;  2MC4 A;  4LG0 A;  2HKX A;  3FXK A;  4A0Z A;  1WH7 A;  1VQO I;  1O57 A;  3FDY A;  4BE2 A;  1S7O A;  1HC8 A;  3RCO A;  1SAU A;  1TWG J;  3CMA I;  2GLO A;  3QOP A;  4G7H F;  1Z67 A;  5KNL A;  2F2E A;  4GYI A;  2ZME A;  4JX5 A;  2K86 A;  3U21 A;  4WXD A;  4CH7 A;  5J1Y A;  3H36 A;  4A3K J;  2ZXI A;  1V3F A;  2DMN A;  3H35 A;  3CO6 C;  2K9N A;  3ZQI A;  2QSG X;  4MQ9 F;  3I4P A;  1MBE A;  4WK8 F;  1V5E A;  1G4D A;  4L9T A;  3OIQ A;  1GXQ A;  1XGN A;  2FQ4 A;  4A0Y A;  2D1H A;  2E1N A;  2EIK H;  2X6W A;  1V55 H;  2CQQ A;  5BS6 A;  2ZNY A;  2F6C A;  3C2B A;  2XGD A;  3CUQ A;  1WCM J;  1P9Q C;  2IA1 A;  1YQA A;  3NWT A;  5JVT A;  2CW7 A;  3CQZ J;  3K4J A;  4HX4 A;  3G1O A;  3OSG A;  3SDG A;  3OYL A;  3R61 A;  1A35 A;  2YPR A;  2KP6 A;  2OAZ A;  3IWZ A;  4OAY A;  1K4S A;  1FIP A;  3BRO A;  3CP2 A;  4FQG A;  4WXC A;  1ZLK A;  3CD6 I;  2QBY B;  2R7X A;  1MNE A;  3JW4 A;  3VSK A;  2DI3 A;  2BY1 A;  2EFP A;  3LA3 A;  1D1C A;  1K78 B;  2WAD A;  2L7M P;  3BPX A;  2X1C A;  3HEF A;  5HDK A;  3S32 A;  3M8F A;  3TED A;  1MBF A; 
#chains in the Genus database with same CATH homology
 4IOC F;  1YJN I;  5JVG F;  4IO9 F;  3PIO F;  1S72 I;  1VQL I;  2ZJR F;  3CCQ I;  1VQ4 I;  3CCJ I;  2JQ7 A;  2QA4 I;  1YJW I;  4UY8 I;  1FOY A;  5DM6 F;  3I56 I;  3CCM I;  3CC7 I;  2ZJQ F;  3J7Y J;  2OTJ I;  1YJ9 I;  1Y39 A;  1FOX A;  3CJT B;  1VQ7 I;  1VQ6 I;  1VQO I;  2E36 A;  2NXN B;  3CCR I;  1HC8 A;  3CMA I;  1YIJ I;  1VQ8 I;  1YHQ I;  3CC4 I;  2E34 A;  3CCV I;  5GAG J;  3PIP F;  3CCU I;  3CCS I;  1FOW A;  4IOA F;  1VQ5 I;  2H8W A;  5GAH J;  1VQK I;  1VQM I;  3CC2 I;  1YI2 I;  3G4S I;  1VQP I;  5GAE J;  1QA6 A;  2FOW A;  1MMS A;  1VQ9 I;  3CCL I;  3J7Z I;  1ACI A;  5GAD J;  3G71 I;  4V19 K;  3CME I;  2K3F A;  2OTL I;  3CD6 I;  3DLL F;  3G6E I;  1VQN I;  5DM7 F;  3CF5 F;  2ZJP F;  3CCE I;  2E35 A;  2QEX I;  3I55 I;  1YIT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...