1YJWI

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yjwI00
2K3FA 2NXNB 4IOAF 1QA6A 1VQ9I 4IOCF 1YI2I 2OTLI 2QEXI 2ZJPF 1S72I 2ZJRF 1FOXA 1YHQI 1VQ4I 1MMSA 2E34A 3CCMI 3CCJI 1VQKI 4UY8I 1VQMI 4V19K 1YJ9I 3G6EI 1YITI 1VQ6I 3CMEI 3CCVI 3J7ZI 5JVGF 1VQ5I 1VQLI 3G4SI 3CCSI 1Y39A 3CCRI 3CC4I 1FOWA 1VQPI 2QA4I 2FOWA 3CCQI 2OTJI 5GAEJ 3PIOF 5DM6F 3PIPF 3CMAI 1VQNI 5DM7F 3J7YJ 2JQ7A 1VQ8I 3CF5F 5GAHJ 1HC8A 1YJNI 2E35A 1VQ7I 4IO9F 5GADJ 3DLLF 3CCEI 3CC7I 2H8WA 3CJTB 3G71I 3CC2I 1YJWI 3I56I 1ACIA 3CD6I 3CCLI 3CCUI 1YIJI 2E36A 1VQOI 3I55I 5GAGJ 1FOYA 2ZJQF
chains in the Genus database with same CATH superfamily
1X1DA 2K3FA 3U9GA 2I10A 2LH9A 1TWFJ 2I8DA 4YIFA 4E4HA 1BI1A 4GRIA 3Q0UA 1JUMA 1OYIA 2R0QC 5EGOB 3NWTA 2FXAA 1YRNA 3M8FA 3OMYA 4PJJA 4IVNA 1N75A 2JK3A 1UZCA 2DA4A 5J47A 3E0JB 3E7LA 3O2PE 5K7FA 5LHIA 2CUFA 4M6VA 3S17J 3LSIA 3B02A 5IPAA 4V19K 4BXUA 1LNWA 3TMOA 1FEXA 1YW8A 4P96A 2FRHA 2YUSA 5M5XJ 3KPHA 2RQPA 3QODA 5DCMB 4BE2A 3PL8A 1HDPA 3MKLA 2JRTA 2DI3A 3VYRB 3WTZA 3OR2C 3H3ZA 4II3A 3AL0B 1ZGAA 3EETA 2JSPA 1Y39A 2VXDA 3CQZJ 2V1NA 3MD2A 3BZCA 4L9VA 3GF2A 4UB8C 1EH8A 3LAJA 2HQRA 2YSRA 5IYBJ 3KFWX 5CQEA 4BU2A 4E6KG 5GAEJ 3ABKH 4F7ZA 3CCYA 3GZNB 2BGCA 1QPMA 2DXIA 2VOPA 3TQNA 2L02A 1Q1VA 3A2KA 3HYIA 3CO6C 1AA7A 3CUOA 3S1RJ 5DEQA 2MSYA 3GYHX 2DW4A 2QQAA 3IAM2 1X1BA 3BG5A 4ZZDA 2K5CA 1WJAA 3CDLA 2M0CA 1SFKA 1BIBA 3I58A 3DLAA 2P7VB 3FHNA 4C30A 3KLOA 4HDVA 1A35A 4JK1X 3KP3A 2HEOA 3BC8A 2CV0A 4A0ZA 1Z9CA 1FSEA 4PK4A 3H0DA 4L18B 3MKYB 2WA0A 2HS5A 2GZWA 2NOGA 1BC7C 1RZ4A 3PM1A 4EJUA 4YFNF 3TEDA 4OMYA 3KX2A 2L9NA 2NVYJ 4XQFA 3JRFA 4ENJA 1LFPA 2OU2A 2QZ8A 3H92A 4FISA 2D45A 2EJRA 1QZEA 3L00A 2BHZA 1R00A 5IOYA 1AOYA 3I5UA 2Z2SB 1SD5A 1JTXA 2WAEA 1OKRA 3W6JB 2KQRA 1R22A 3JSPA 1LQ1A 3E6BA 1WI9A 1D8KA 2W82A 3BT9A 5JVTA 2VJJA 5HODA 5GPCA 3BQYA 1R4MB 4EM0B 4JX6A 4CCKA 3WU1B 3BG6A 1JJ8C 3OYJA 1ETXA 2Y9ZA 3GBGA 3F23A 3I9V2 3FMRA 2BZTA 3I53A 1B1BA 5J8FA 3OYLA 1WSUA 1P7JA 1FZPB 2LTPA 4E7LA 5JI6A 1O3QA 1V5GA 2R7SA 1BW6A 3RKQA 2VOOA 1F4KA 1KU2A 4HNTA 2ZMEC 3OYKA 3VYUB 4Y7NJ 3HTSB 1S7AA 4XLPF 3OIOA 2CV2A 1BOBA 1XDSA 4CDGA 5TISC 4AIHA 1Z6RA 5HLIA 2DN0A 3A4CA 3CLQA 2XROA 2DA6A 2EFQA 3IKVA 4ITVA 4L9NA 1FY7A 1LKXA 4K2EA 3AFHA 4Y52J 3TW6A 1UJ8A 4BYYA 2A3SA 2PFBA 3F9KA 1T08B 1SAXA 2HFHA 2PX9A 3BTJA 1YO5C 2O6GE 3I0TA 4MEXF 1I3QJ 3MKWB 5GTIC 3QPLA 1F9NA 3C2HA 3A0BC 5DD4A 4I09A 2VI6A 1SFUA 1G8XA 4A2UA 4FETA 2F4MB 4A0XA 4AIJA 1XMKA 5CVJA 1NK2P 3CUQC 2W24A 2ZJ2A 5F04A 2V9PA 5E8IA 2KFDA 1MH3A 1ONVA 1ZG1A 2FBKA 1JXSA 1HCRA 4J00A 1WJ5A 2HQ5A 4BHPA 3WTTC 2F5EA 1R1UA 4LB5A 2M5WA 4A3IJ 2IA1A 4DYRA 3F8MA 4FCYA 2V9VA 3FMSA 3K2AA 2A6EF 1UG2A 2XAUA 5LRRA 2R7QA 3FBNB 1GDTA 2ZFWA 1VQ7I 2DAOA 1ZH5A 2IGKA 2IS4A 3DLLF 4IL6C 4RB3C 2R7RA 2DDAA 3IRQA 3HG9A 4YFKF 1Z91A 4NC7A 5IY5H 1RRJA 4FX4A 1PUFA 2YX7A 1D1AA 3MKZA 1JHFA 2ME0A 4NQWA 4I0AA 3T8TA 3I54A 3OSFA 2LY1A 3U21A 1DPUA 3PO2J 4BL0B 4A5NA 2BXZA 4MNUA 2M45A 3D5SC 2KRHA 3JRCA 1G3SA 3ESWB 4ENMA 3HHGA 4KDPA 3F8BA 4FTHA 3F8NA 2QEXI 4ZTFA 2PMUA 2VC0A 2K02A 1XSDA 3FKJA 1R4NB 2MH9A 4UUTA 3WTSC 2ZJRF 2MA3A 2MLGA 3BP8A 1SFXA 3S2WA 3K6GA 1CGPA 1QO0D 3WTUC 5E18F 4XN0A 4B1RA 3T8RA 2V7FA 4EM1A 4UNOA 4BJ6C 3HEFA 4OINF 4XKBA 4I7HA 2JT1A 3P5JA 1KU3A 2LMDA 2LY2A 3JAMK 2KLOA 3BQZA 2E71A 4NQWB 1E3OC 3PNTA 3SZPA 1WGXA 1L3LA 2HDDA 1MBFA 2F5DA 4XRFA 4IEJA 2LREA 1FWZA 3PFYA 4PUSA 5TJJA 2JVHA 3F6OA 2K7LA 4IZZA 4U87A 2HU9A 2BY3A 4LG0A 4G6TB 4HX4A 1K78B 1I1SA 3FM5A 1G59A 1JT6A 5BPIA 1HOMA 3JREA 5BNGA 1XN7A 3BR1A 3LAPA 2DBBA 4EGYA 2X6YA 4LK1F 3FWEA 1HKSA 4MFEA 3E5XA 2L7MP 2DQLA 5DM6F 4A3JJ 4EATA 3IL2A 3E97A 3HSRA 3ECHA 4UVAA 3CLOA 1JI8A 1UB9A 5DM7F 3BR2A 3R60A 3FXRA 3Q9SA 5E1ZB 4EEFG 1N25A 4A3MJ 4IHVA 1HKTA 2K3PA 3DTKA 3E6DA 1ON1A 4DBQA 2K9LA 3GMEA 2MC4A 4M71A 2XKPA 2K85A 1XGMA 1BJZA 3L7WA 4N0BA 3QU6A 2QWWA 4E7HA 2DA7A 3QPTA 3MMYB 1O7LA 4LG0B 2AQFA 2X51A 2EK5A 1LDJA 1S6LA 2XB0X 5LHGA 3LA7A 5GPAA 3EQLF 3TGNA 1YS7A 4N4NB 2BVMA 4L0YB 4L0ZB 1MNEA 3KP7A 5CVVA 3GTQJ 3HOWJ 5D8KB 2D1VA 3HPHA 3CD6I 2Q2EA 4KYWA 3AG3H 2W4SA 3K7AJ 4CYDA 4C2MJ 1ZG5A 1X2NA 1QVUA 3S3MA 4BXXJ 1BOAA 2BHYA 3DTEA 5J1YA 2AXTC 3PNVA 3S1NJ 2B9SA 2L0KA 2M3AA 1IXRC 1O57A 2Y0SA 4GO1A 2NVUB 1O3SA 1GHCA 3IHUA 4V2GA 1MNMC 2OTLI 3TKYA 1FSHA 1B9MA 3GLLA 2M87A 1SMYF 2CFXA 3FXJA 4HRIA 4AWXB 3VOEA 5LGUA 4E7KA 2RN7A 4F52A 4LMYA 4B8XA 2PLYA 2L9SA 1U8RA 2OV7A 1HQCA 4B09A 5C44J 4HX8A 2EFPA 4Z2YA 3JAMZ 3JTGA 1JT0A 3RKXA 4ZYAA 1Z7LA 3H36A 5DTDA 5D4SA 1RKWA 5E3MA 4FE7A 2QQ9A 5D6FA 3Q9VA 1IV6A 1YJ9I 1U2WA 1HBXG 3BZKA 1YITI 3G1MA 2Q2EB 4XRSG 2A05A 2VBZA 2VQLA 4D9JA 1IUFA 1I39A 2F5CA 3TO9A 3TOAA 3DBRB 1TT0A 2Y2ZA 4RAGA 4HQMA 2L4MA 2KIFA 4XLHA 4P9UA 3BR3A 4KJZA 5BMZA 4M9ZA 4A3FJ 1Z77A 2NOJB 4MHGA 2CW0F 5FKOA 2WADA 1K4TA 2CQKA 1S5LC 4L5EA 2X6WA 3KP6A 2HVSA 1NTCA 2FQ4A 1TQIA 2L7KA 4AU7A 4R79A 3TO6A 1FTZA 4RLFA 1OCRH 2MFZA 1FNNA 3ABMH 1T33A 2VQGA 3IH3A 5TGTA 5KNLA 3MZYA 2H27A 1VQ8I 2XAJA 2GLOA 3KE2A 2KP6A 2L5QA 1XD7A 4ZYDA 2ZFUA 2DA2A 2PMZN 1ENHA 5EEGA 2OA4A 3CF5F 1SMTA 5DDGA 3M8JA 4UVBA 1IN5A 3K1MA 1FIAA 3PUBA 5CVRA 2XPVA 1RR8C 4FE4A 4N9IA 1I50J 1LE8A 3WU2C 1MKMA 2EILH 3C18A 3IH4A 4WXDA 4HZFA 4LFUA 1ZAOA 4AM3A 1XTAA 4FHTA 4IHXA 4IHYA 1IJWC 4RB2C 2HVQA 5J40A 1XGSA 5BS6A 3V7RA 4HV6A 5EG0A 4KIBA 3BPVA 4RGXA 3LFKA 2A61A 2MGQA 5GAGJ 1T0FC 3CJRB 2JRMA 3K70D 2BW3B 3L9FA 4F3QA 1QPIA 3FZVA 3KP5A 2GM4A 2WTEA 2LF8A 2YU9J 1WJDA 1OR7A 4G9YA 3EYYA 1Z1DA 1MW7A 3BTLA 4BBSJ 3RJPA 1H9GA 2XVCA 1E0EA 4A6DA 1FJLA 4O6JA 1W7PD 3CO7C 4NUBA 4EJTA 1A6IA 2R7VA 3DBHB 4U0WA 2LFBA 1P2FA 2GA2A 3EUHA 1TBXA 5E1XA 4KA4A 3JRBA 1LE8B 2L01A 4XLNF 1V5FA 3HKZA 4FX0A 5JFRA 1XC5A 1VQMI 2KKOA 1T38A 2JN6A 2BYVE 5LD2C 4B43A 2ID6A 3HOSA 1IRZA 2F5VA 1J09A 3GXOA 1T6SA 2B7EA 4BQQA 4HF0A 5B3SH 3LFUA 1HKQA 3JSOA 5J4YA 2PBIA 5HNFA 4CZCA 5EG0B 3S1MJ 3GFLA 3W6VA 4AVZA 3K4JA 3E6MA 4N4OB 5EDNA 6PAXA 2EIKH 1J59A 4H0EA 3G4SI 4IRIA 4Q48A 2K4BA 1LVKA 3CJQB 5D8LB 2R5YB 2DOAA 2KMUA 2DK5A 3CCRI 2VQHA 5FRNA 1IRXA 2HOTA 1E17A 2E1OA 3WGHA 4BDZA 2Y31A 1IC8A 2HZDA 3N97A 3PQJA 4E7ZA 3V8LA 1IO2A 3F3XA 4KN4X 2DJNA 1A31A 2NVQJ 3RQIA 3IP4B 3PIOF 3P7NA 4BACA 3HOZJ 4XKCA 2BY1A 4CA0A 1YW9A 1EF4A 4OIOF 4XORA 3DKWA 3J7YJ 2E5ZA 2JUCA 4HG2A 4IF4A 1VNDA 2XB5A 2NNYA 4BY1J 4J01A 4BE0A 4HNVA 4UV8A 4HDUA 3IH2A 3RSNA 3RZOJ 4UV9A 4PGGA 5DD8A 4DZPA 2GOXB 4XR6A 2PMHA 1HC8A 2L7ZA 2R3SA 2RREA 1WH5A 4ZDPA 1D1BA 3KP2A 2XAGA 4KITB 2KRCA 3DEUA 5M5YJ 2H8RA 5EYRA 3SZTA 3VODA 1ERDA 5L3FA 5KHDA 2R7UA 4BEHB 2EZHA 4E7IA 2JA6J 4XOPA 5D6EA 2X85A 2P5LC 1X4OA 2K40A 4C9YA 2E2HJ 4RGRA 1MMDA 3RIRA 1DU0A 4L5IA 3J80K 3GTMJ 4Y33A 1HW2A 1D8JA 4D7MA 2PEXA 5H2FC 4OU0A 5L3CA 4CO8A 5IT3A 1VQOI 4CZZA 5KAFC 5HNHA 2CW8A 4OIPF 1D5YA 2ZXJA 1Z3YA 2DT6A 2EZKA 4Y15A 2JUGA 4IOCF 2XC7A 2XRLA 3S93A 2A5YB 4G6QA 2E2IJ 4M9XA 2DMTA 2EWNA 2P5VA 2BV6A 2DFFA 2QQ8A 3ZCOA 2FOKA 1S3JA 3U2RA 3FXLA 5CJ9A 2DMPA 2MBFA 1B6AA 2WBMA 3GW2A 3ZMSA 4G94A 2TRTA 3T1BA 2LF7A 2EFOA 3P9IA 1UHMA 1MBJA 2HNHA 3OOPA 4C3HJ 3CCJI 1UHSA 4P1WA 5ICCA 4UY8I 1IUYA 1IDYA 4HEA2 4RGSA 1BA5A 3ERED 3QOPA 2FD5A 4XLCA 1IGNA 2KL4A 2FF4A 3OR1C 4L9TA 4O5VA 3OV8A 3SJMA 4B48A 5TRDA 2QSFX 3HRMA 1I27A 2WAQN 1ON2A 4G6DA 1ZGJA 2QUFA 1TWAJ 2DJIA 2HOAA 3ZQCA 3TL4X 2XAHA 1U3EM 1VQ5I 4G7ZF 2VE8A 2LC2A 4P9FA 3VEPA 1GVJA 5L3GA 1XCVA 4M3FA 1J9IA 5DYMA 3HSFA 2EPFA 3SDGA 2HPMA 4LIVA 4M74A 2R7WA 3ZQGA 2L54A 3CCQI 1Y56A 1T98A 1SFOJ 2IS2A 1PP8F 1B8IA 1OQYA 1IV8A 2OQRA 2H09A 5CLSA 1W36C 2CW7A 3D1NI 1WJFA 2NS8A 2L9RA 4L9JA 2X0LA 3MQ0A 4ZYGA 2XUBA 3K4BA 2ZXHA 4AYBA 1R5ID 2JZYA 4HSRA 2N8GA 4KN7X 2OZ6A 5DCFA 3SFZA 2A5WA 2DQRA 1KA8A 3OY9A 4WXHA 2CH0A 2P81A 1ETOA 4OIQF 3BROA 2VB6A 4WF2A 1ZR2A 2V26A 1ZLKA 2CYYA 2DPDA 3HB9A 5EJCA 3HXLA 2OJED 1YRNB 3EYIA 2UXXA 4UB6C 1U0JA 1OYYA 3G3ZA 3CC2I 2QQBA 2FMYA 4UXNA 1KU9A 3E5UA 3OIPA 4WK8F 3WGIA 2R7ZJ 1M1EB 2WV1A 1QVTA 3J80Z 3LSRA 1VFCA 3M3YJ 3CDHA 2HYJA 4XRSA 5H6RA 4HQEA 3BLYA 2AHQA 1JKPC 4GFBA 2X1CA 5EEHA 3H9JA 5E8GA 3JRIA 2IS6A 4XL9A 3BCBA 2DOEA 5K7HA 2RNGA 2Z3YA 4MIMA 1QHHD 3P9KA 4C2UA 1AU7A 3C2BA 3C2GA 2P4WA 2JPCA 1I3AA 1ZYRF 2VXZA 3FBIB 4JX5A 4XONA 4A69C 2DMUA 2WAFA 4BDYA 1ZN2A 1S72I 3G1LA 2PI0A 4Y3OA 2OUMA 2DA3A 2K9MA 3F72A 3HOYJ 4CGZA 3WG7H 3NARA 4CCJA 2CS3A 4QSHA 2HDCA 2XPUA 5CKTA 2STTA 2DLLA 2X1EA 3OS2A 2XGCA 3JW4A 4PSXA 1T56A 4OOIA 5JLWA 3IUOA 1YE9A 2KISA 5F1JA 3OYIA 4A0YA 1SFEA 5HLHA 3CCVI 2UZKA 4JP0A 5AIPA 2RC4A 4M9SA 4FQGA 3KYCB 2VQCA 4XIDA 3V8JA 4XN3A 1FBQA 3ZR8X 3DTIA 3QYEA 3QYBA 3FISA 1SVMA 2FX0A 4AUXA 1IW7F 1J75A 4RAZA 2DT5A 3A03A 4YFXF 2GXBA 4MGRA 5A2QK 2D1HA 2I5UA 2XAFA 3R4KA 4ZYEA 3IC7A 5KK1A 5K5OA 4HF2A 3B6CA 2CGPA 3K0LA 3ZXSA 2EB7A 3L1PA 1DUXC 5ILUA 4PFOA 1LB2A 2VBXA 2FNPA 4MFDA 1QRYA 4CUGA 2L4AA 2ZMEA 3L2QA 3FHZA 1Z7UA 2H1KA 2OPTA 4EJOA 3HSEA 1Z05A 2RNJA 4UUSA 2LK2A 4CYCA 2XDVA 4RM2A 3AG4H 2L3DA 3OYMA 1EKEA 5BPDA 1Y8RB 1FLIA 2QYOA 3V4GA 3R61A 3J81Z 2LKSA 1HSJA 3Q3SA 2OZUA 4EMSA 1ZGWA 1XPXA 1ZK8A 3CC7I 1JTYA 3FKIJ 4BHBA 4F91B 4YEJA 5L3DA 2LLKA 3G71I 1LEBA 2AS5F 4LLNA 3BTIA 1JGSA 1ACIA 1JKQC 2V1UA 2DOFA 2QKLB 3RKWA 3HRTA 2KDOA 4M6YA 2RGVA 4A3KJ 1KYZA 3QPSA 4GCVA 4BHCA 2DODA 2IRFG 2Z33A 3CUQA 2NS0A 4KIGA 2JA7J 5D5XB 1KYWA 2ZMEB 3H5RA 2GA1A 1HW5A 3DU6A 3LOCA 1N77A 3LSJA 1B4AA 3GWZA 1HF0A 1XSXA 3W6KB 3ZQ7A 3ABUA 3GTJJ 3KZIC 2Y69H 2VPRA 3F22A 3DKXA 3EUAA 4MLOA 1B72A 2STWA 4DYCA 3CESA 1W36D 2V9KA 1AKHA 1HW1A 3FDYA 1H9TA 3G1OA 3RYPA 1WKMA 3BG7A 5CYVA 1U5TC 1ETYA 3AG2H 2Z5UA 3ZQLA 3SEQA 4IRHA 1UG0A 2LY9A 4AIKA 3OYEA 2OBPA 1H0MA 2CUEA 1XDUA 4HOBA 2IT0A 1DPRA 4IJAA 5BOXA 3COAC 2NVXJ 4XKWA 2PG4A 3J7ZI 3CUQB 3ISPA 2A69F 5EZHA 3ZQHA 5ICEA 4ESJA 3FXOA 3CCSI 3AKZA 3OYBA 2HZTA 2HQNA 5A2QZ 1ULYA 3HM5A 1N78A 3I64A 4U88A 1S29A 3N4MA 4RGUA 5C4JJ 2DTZA 4X6AJ 2ESNA 3SYTA 4CHUA 2JSCA 5DS9A 3DEEA 3LMMA 5E1WA 2EZIA 2FU4A 4A3LJ 3GUDA 1F5TA 1B72B 1PUFB 1D3YA 3ECOA 4FT8A 2CQXA 1APLC 1D5VA 3H3VK 1LPQA 2KIMA 2VODA 1ZARA 3HOTA 1AKHB 1P6RA 2FMLA 1TW2A 3ZMVA 4CCMA 1O3TA 3GFMA 1F43A 5J4VA 3OOUA 4PJLA 2O9LA 4OWRB 4WXCA 3IRRA 1OJLA 2V1XA 1GVDA 5FJ8J 1LDDA 1T95A 4ETSA 1NK3P 3DU5A 4WWCA 2FQ3A 1FMWA 3WGGA 3LWFA 4BS9A 5GAHJ 2LVSA 3A1YA 3V7SA 4OMZA 1RC9A 4RAFA 1WI3A 3MVPA 1W5TA 4RLQA 5LEKA 4DQ2A 3HPGA 3PO3J 1G3TA 3H1CA 4LD5A 3RTRA 2ZNZA 1FOKA 3MEXA 3EPZA 4BUPA 2HYGD 2ZXWH 3KYDB 5D4RA 2E60A 4EQQA 1VTNC 2DFEA 3RCOA 2Y30A 1YIJI 3DPLC 3TP0A 2NAZA 2W1OA 2HTJA 4BQOA 2HWVA 3KP4A 3CMMA 1FT9A 3GTGJ 4QLCU 3MN2A 4ZTJA 1SD7A 4LG3A 3O8HA 1W7PA 1WPKA 5DV5A 1T8IA 3HC7A 3DFGA 2O7OA 3H9QA 2OCCH 2NRAC 4DYQA 1X3UA 2AO9A 2MYSA 3BG9A 1FPQA 1RKTA 1SVOA 2W48A 2XGEA 5FFZA 2H94A 2ELKA 4BBRJ 5D5UB 2GXAA 3G2BA 1ZELA 4C3IJ 3LNQA 4QTRA 2H6CA 2F6CA 1DGWY 5HDKA 1Z21A 3ZRGA 1MMSA 2XV4S 3OYDA 1NG7A 2KRFA 2WV0A 4B3XA 4DIQA 1AWCA 2IGMA 1ZRDA 1WQ2A 2EV6A 5GTHC 4BY7J 3FK7A 1YG2A 5FD6A 2M4KA 1P9QC 4HW0A 2M1BA 2MLKA 1X19A 3O6BB 3K10A 3M7GA 3GZ6A 2CG4A 3I3LA 3J7AO 1DDNA 2WAQA 1JE8A 3MZHA 4A3DJ 3BCAA 2BE5F 2CFOA 3OIQA 1ZTRA 3S16J 5FGMA 1W7PB 3CC4I 5KVRA 1TNSA 3JR9A 3BOQA 5HS7A 4DGWB 3KEYA 2ZKZA 2M7BA 1ZRFA 5LRSA 1Z3XA 1EV7A 3M1CA 2OTJI 1NG6A 1U6GA 4M73A 4F92B 2HQAA 1GLNA 5HS9A 3GVAA 2CO5A 2ECCA 3BZ6A 1IN8A 1YQAA 5K1YA 4E7JA 2FEZA 4BQAA 2JQ7A 1X2MA 3W3CA 4BJ5C 1RETA 1GV5A 2HKXA 1I6HJ 2DYSH 4CCNA 1XG1A 5HLTA 5H6QA 1PDNC 2NVTJ 4OIRF 4G7OF 1BW5A 4G7HF 3JRHA 4X1EA 1RI7A 1S7EA 2VJ4A 1SVLA 1ZG3A 1ZQ3P 2EQRA 1RNLA 2CWEA 3K69A 3QP6A 3CCEI 1XGOA 1QGPA 2Z9OA 3DPUA 3HZJA 1BR4A 2FJ1A 5M5WJ 3BWGA 2VPLA 5D5VB 2VASA 1IG7A 3VSKA 4XICA 4ENKA 1R23A 3DF8A 5IYDJ 2UV1A 3CCUI 3ZMUA 3RPQA 3QRFF 1J5YA 2W57A 1W4MA 4NC8A 2QCOA 1J0RA 1FOYA 2ZJQF 2ME6A 2CSOA 4NC6A 2KZGA 3BR6A 1SAUA 4KT5C 3PSFA 1RIOH 3J7AY 2P0WA 1NH3A 4ZH4F 1W0UA 2M8EA 3WE3A 4BKXA 3Q0WA 3TO7A 2IVMA 1XGNA 2E7XA 2LYCA 5B1AH 4NDLA 1VQ4I 1WHUA 1R36A 2CU7A 4KFCA 5FRMA 3VFZA 1B9NA 1ETQA 3CDIA 3ULQB 3GTLJ 1SANA 1A04A 1EH7A 2IAIA 4II2A 2R7TA 2GBYA 3OSGA 4IX7A 1OR7C 1GXQA 1IN6A 2VJIA 2F4OB 3PJRA 4RB1A 2K86A 4M3DA 5F27A 4Y17A 1YOVB 1YTYA 2M9HA 3ASOH 5LEJA 3BJ6A 3TDUC 2L7FP 3FK6A 1FP2A 4EJVA 4ON0A 4KUMA 3L2UA 3TW7A 2A07F 5ERIA 2KJCA 2YR2A 4E7SA 2KT0A 1H89C 1YX5A 4I98B 1T0FA 3SHFA 5L3EA 1LEAA 3K1NA 2MABA 1ZKGA 4MO7A 3HOUJ 2P5KA 3FXMA 1TNTA 4Y13A 1RUNA 3WTWC 2VC1A 1U78A 2GIZA 2DT7B 4IPAA 4L5JA 3FF5A 3I59A 3OWTA 2HGCA 3HRUA 5ED4A 5CVIA 3M07A 1YW7A 2VL8A 1JHHA 1D1CA 2E2JJ 3PQKA 2Y75A 3QAHA 4TV7A 5FKLA 2HR3A 3BR0A 2Q0OA 3WHBA 4A12A 1K4SA 2Y48A 1UAAA 2RQQA 2Z99A 4NBQA 1MJAA 2XPWA 4I01A 2QENA 3GEZA 3O8GA 4XSZF 2E35A 2V79A 3L2CA 1H88C 1XX5A 4QWQA 1YFHA 4ZYHA 4XKVA 2ELHA 1UCRA 1A6QA 2YS9A 3CP8A 2CV1A 3GZ5A 2MD0A 3CZ6A 3QYFA 1EJ9A 3C3WA 3UKGA 1FBUA 2K9NA 4P55A 3ML6A 4XRMA 2QVOA 3M4OJ 1USSA 4G12A 4LIUA 1BR1A 1D0YA 2DMQA 3CCLI 4ABZA 2K27A 4I0BA 2JA8J 2F4IA 4A3BJ 3T0YA 2R5ZA 1V3FA 1O7FA 4C2TA 2ICWG 3JTHA 3I59B 4O3MA 3PSIA 1T2KA 4A3GJ 5FLVA 2JMWA 4DOZA 4HV5A 1ZHFA 3KCCA 2G7UA 2YPRA 2FSWA 3TP3A 1RPWA 4XMYA 1R9TJ 1MMAA 2MG4A 2ZBKA 3MFKA 5HOOA 1K6OA 3LSHA 3CF2A 1Z0XA 1CQTA 2GXGA 4RBOA 1VZ0A 4B4CA 5IP6A 2LSOA 4GYIA 1T39A 3LQQA 3LSTA 1VQKI 2COMA 4CCLA 4UHTA 2FE3A 2HOSA 1RUOA 5ILVA 1W5CC 5J1UA 3BTCA 3OYCA 1KGSA 1R71A 2VKHA 3RPUD 3ZMDA 4D1QA 1UHWA 2KIQA 4GDFA 3SFIA 1MJBA 1MH4A 4HA8A 2M34A 3H0GJ 3CTAA 3L2RA 3HHHA 5H20A 5FROA 2R5ZB 1P7IA 1L0OC 4KIFA 2B0LA 4Y4RA 1HDDC 1RR7A 3ABLH 4BAYA 4Q4ZF 1FYKA 1LDKB 4PZJA 5CVUA 3WG9A 2QA4I 2FA5A 4U0YA 5C4XJ 2XAQA 5DUIA 4HNUA 3E6CC 3AL0C 1HLVA 1SEUA 4S05A 4JX4A 3R0JA 4DZJA 4WCGA 1TWCJ 4ZJZA 2IJLA 1U9NA 2XKOA 1HA8A 4CXFA 2P7CB 1GV2A 1VQNI 1QZZA 4PJNA 1PVEA 5AONA 4M3EA 5F08A 1BJAA 1OCCH 5LHHA 1S8NA 4BNCA 1FYLA 2EV5A 3RDIA 2PJPA 1Q1HA 2QF7A 4PFPA 2E1MB 2Y0SN 3KIOA 3P9CA 5E3NA 1YJNI 2QSGX 2QM3A 3D5RC 4FASD 2M0MA 3SZGA 2WY7Q 5IP7J 4NHJA 1HSTA 2UUZA 1IF1A 3QQAA 4AVPA 1OISA 4M3GA 3H5NA 4P5OA 2V6EA 3RKYA 2IW5A 4X0GA 1FYMA 1BI3A 3K4LA 3ZQIA 3R0AA 4RA2A 2VN2A 1G3YA 1R58A 1K6YA 2P8TA 2V1DA 1Y0NA 2OQGA 1SC7A 3NRVA 2G0EA 5KCMA 2HI3A 3I55I 1X4PA 5IT9K 1DQUA 2LNBA 2E1NA 3S3OA 1BN5A 3K1PA 1UELB 5IYCJ 1TL8A 1DP7P 1X3ZB 4IOAF 2BOLA 3OL3A 1WJCA 5D5WB 2IGOA 2EFWA 2CMPA 2IXSA 4LGWA 1REPC 3S1QJ 3J81K 3DBLB 4AD9A 3EDPA 3OS1A 4KICA 2EV0A 4LITA 4CICA 4EVIA 2X4HA 2B63J 2AXLA 4IHWA 1XS9A 1IN7A 4IHSA 4ZZLA 2M8GX 1B8IB 2WY8Q 2K9SA 3NWSA 3M9AA 1ZREA 3ZQQA 2EBIA 2Y9YA 3V42A 5LGTA 5C3EJ 1OLTA 4DBRA 2K9QA 2CQNA 5K5RA 3CMEI 5E20A 4GGGA 2EA2A 3VB2A 2MH2A 2QLZA 4BGDA 1IXSB 2ECBA 3W2WA 5HVQC 2MC3A 2PN6A 4KMUX 3FXUA 3GCMA 3BDDA 4PSWA 4A3EJ 2QBYA 4HBLA 1JUSA 4IQJA 1Y6IA 3QU3A 3ROUA 2TDXA 1TP4A 2LKPA 1OMIA 4XK4A 4HX7A 3K4NA 2GWRA 3OYGA 3A0HC 4BJTA 2WWYA 1FTTA 1KONA 3BR5A 3W2VA 1VI0A 1K7AA 1XMAA 2A68F 5GP9A 5CPRB 1V55H 1JGGA 1ZRCA 4XM3A 2R7DA 1FP1D 2DFHA 3HIFA 2IPQX 3GO5A 2KHMA 2LKXA 2E19A 2V6CA 3GFJA 1G3WA 2DTRA 3ZMZA 2VT3A 3IAS2 1FX7A 1GUUA 3WTXC 2H1LA 4PJMA 3LSMA 1YYVA 2W84A 3F8CA 4XSXF 2DDBA 2WB1N 2XASA 3DPTA 1FBSA 1OCZH 5FD5A 2NNNA 2AQEA 5F0CA 2XSJC 1W1WE 2EINH 1BL0A 1QU3A 2DFIA 1MJ9A 5F64A 4NNJA 5HLGA 2CUJA 2GQQA 2EH3A 4C3JJ 3H9GA 2QBYB 1RESA 3QP5A 2XSDC 1WVRA 2EZLA 3HKZN 3KLNA 3HL2A 3AG1H 5IT9Z 3OYAA 1I5ZA 1X58A 5B66C 4Q5SF 1LVAA 4HLXA 4YELA 1MSFC 3HOXJ 2ISYA 4DNCA 1R5GA 5IP9J 2JPBA 3E3VA 1QNTA 2PMZA 1YS6A 2HVRA 3S2DJ 5B5EC 3ZP5A 3MCZA 2O5RA 2P6SA 4F55A 4A5MA 1ZLJA 3C7JA 2V4JC 2R92J 3HGGA 4B47A 1B59A 1O4XA 1BI0A 2PQ8A 3D5LA 1U8BA 2VT2A 1Y0UA 1IXCA 5FO5A 2IBDA 1C0WA 2XRNA 2IA2A 5J3LA 3I71A 4OAZA 2KDZA 3JRGA 2OAZA 3FMQA 2Y0MA 3C1DA 3VPRA 3F6VA 4W97A 1VQ6I 3WHCA 2X6XA 3GFIA 1ODDA 2R7XA 2ACJA 4UUSB 4CYCB 1EA3A 3V7CA 5JLXA 2K4JA 4HF1A 4UUVA 1VQLI 5E3LA 2KZVA 4BXFA 2ESHA 1CF7A 2EIMH 2XGDA 3UNGC 3BJAA 3BJOA 5F6FA 4J19A 3L09A 2GIVA 4I99C 4KNYA 4LLGF 2M30A 5HDGA 2DPUA 3WU0A 1TQPA 5ICFA 3VSLA 3LSPA 2VJ5A 3DWLE 2KIUA 2XIGA 3L2VA 2NYXA 2ZO4A 4XLAA 2L2OA 2VKEA 1IAWA 4JYKA 2XF7A 5F0FA 3PIPF 5ICGA 4KMFA 3U1KA 1O3RA 2O03A 1NHAA 4IXAA 3F8FA 1E2XA 1QQIA 2XF6A 4W1UA 2CUZA 2EA4A 1MBEA 4PJ0C 4LB6B 1U5TA 4QPOA 3DEWA 3M8EA 2MD5A 4I2OA 3S2HJ 3N05A 4V2FA 5J6XA 2O8XA 5GADJ 2VLAA 1K78A 4GYGA 3M1EA 2W85A 2A6TA 2DA1A 3DKYA 1CF7B 1K83J 2O0YA 4EJWA 1R5HA 1X1PA 3LSKA 2YU3A 3DXJF 1YJWI 5BQTA 3ZPLA 2XGXA 3MZ8A 3GTPJ 2JJ7A 3K2ZA 3OS0A 2LRDA 2ZSHB 1F1ZA 4ZC3A 3CJNA 5LLQA 4RDUA 3LL7A 3Q0VA 3HOVJ 2E36A 1OYWA 2BBYA 5CQGA 2QGUA 3TBIA 2W7NA 1V4RA 2FNAA 1QA6A 4MQ9F 3ABTA 2X1DA 2DU9A 3ZQFA 4A93J 3GTKJ 1P4XA 3A01A 3JRDA 2HPIA 1V54H 1D0ZA 4BQNA 3L2WA 1U5TB 3LQRA 2VBYA 3CP2A 3OYFA 4RB0A 3E1SA 4XLFA 1JKOC 2JVGA 3ZGKA 2YX4A 1PUEE 3K70C 1U9OA 5JHUA 3KEOA 1PP7U 1ETKA 3NEUA 1KZHA 1GXPA 1FMVA 1SD4A 3RYRA 2XF5A 5FB2A 5E3OA 4JBAA 1WJBA 1WFXA 3ERMA 2ZCWA 1MMGA 3AAFA 1R1TA 1R6RA 1OFCX 3UR3C 1TW3A 4Q47A 3FXQA 3WTYC 3S8PA 1QBJA 1ZR4A 3HJEA 5E17F 1A36A 5EZGA 4ZDOA 4AYBN 2HTSA 1BBYA 2E5NA 5JHFA 2CQQA 1LUJB 3V8KA 3ZOBA 2RVCA 1W0TA 4ESBA 1R1VA 2E1CA 3S14J 3A01B 2IGNA 1KQ8A 1VQPI 2J5PA 2IP2A 3WTVC 2LD5A 4XLEA 3FX3A 4I6ZA 2CQ7A 2JTVA 1FIPA 4DJAA 5L3BA 3ELKA 1G2HA 4N9HA 3SXYA 5K5QA 2VKVA 2G9WA 4Z6YA 4U7BA 3VDXA 3DP7A 4KISA 2HKOA 3BY6A 3KEQA 2HXOA 1USTA 3K4CA 4R1HA 1ETVA 5AIQA 1I6XA 2G7HA 2L9VA 3RQ4A 3WE2A 4AC0A 2VONA 4U7DA 1UFMA 2LBFA 2IA0A 3X2QH 3DV8A 3HBLA 5HDNA 3JCUC 3PNYA 2NS7A 2BY0A 3Q5FA 3OYNA 3OYHA 4JQFA 2VUMJ 2BEOA 2HOEA 2R7OA 4RM3A 3B73A 3GLXA 4HYEA 1WWXA 1D0XA 2BXYA 4QPQA 4D7NA 1X1CA 5F1RA 2C6YA 5F0HA 2H8WA 3CJTB 3RI4A 1BI2A 2F2EA 2Z1DA 2LG4A 1TWGJ 1KQ0A 4HAMA 1XCBA 1P4WA 4M3BA 4XOTA 5EEAA 2DYRH 2M2EA 4IRGA 3F0CA 5FLXK 1X1AA 1ORKA 4BE1A 1Z6TA 1P4AA 1R49A 1MDMA 4EV0A 4ASNA 2JA5J 1E3PA 2DMNA 1YLFA 2RKHA 1MBKA 2ETHA 1W5SA 1V5EA 4LK0F 3HGYA 2HDWA 2RDPA 2O3FA 2CJJA 2LBFB 2ZSIB 2EIJH 1LFUP 3IWFA 3K4MA 1BIAA 5FKMA 1POGA 3I4NJ 2VKDA 1A5JA 1Z67A 2KPMA 4I02A 1TWHJ 4OAYA 2ZJPF 4R8HA 3R6SA 4YIIA 3VYSB 3H5AA 1FOXA 2BVLA 1YHQI 5HS8A 3KYLA 3T5XA 1MMNA 2RAEA 3FIWA 3NQOA 4ENNA 2O61A 2E34A 1JUPA 2VIXA 3CCMI 2ZXIA 5DUKA 1MD0A 3RPUA 4M72A 3S3NA 4LJZF 1IN4A 4S04A 2LDUA 3VWBA 3QWLA 4YIRX 3GX4X 2R93J 1OCTC 3TDZC 3PUFA 3HDDA 1MDMB 4RS8A 2BW3A 2X9DA 4A3CJ 2J5OA 3KETA 5FKNA 4D5FA 5M3MJ 5KAIC 9ANTA 1QZYA 1JKRC 1TQMA 3IV5A 2HXIA 3HUGA 2OCEA 4YG2F 2WC2A 1MIJA 3KZYA 5ILSA 5K7ZA 1WH7A 3QPHA 5LFAA 1YX3A 3MWMA 1MNDA 5EF6A 4MTEA 3I4MJ 2A6HF 1K79A 2XHKA 1YIOA 2O8KA 1DP3A 4YRVA 1STZA 4WX9A 3CMAI 4LLLA 4G8XA 1WCMJ 3JRAA 1HXDA 4LOCA 1IRFA 3IKTA 3G73A 4GXOA 1XB4A 2DCEA 2ZNYA 3H3UA 2OC6A 3BPXA 1GT0C 3S15J 2ZC2A 3S32A 3EUHC 2D5VA 2FBHA 1LJ9A 5FKKA 2UXNA 3SQNA 4CH7A 4HSTA 2Z16A 3ZN1A 2VBWA 1MSEC 2EFNA 3DCFA 3I4PA 2R5YA 1S9HA 4B3AA 2WB1A 1BR2A 3REOA 4A6EA 1DGRM 3HUGB 5JR3A 3OL4A 2OD5A 2D2WA 5FLXZ 1S7OA 3WODF 1MBHA 3B6AA 3IWZA 3EUKL 4IQ4A 1AHDP 3GTOJ 3NAUA 3ONQA 4ZDLA 5FLMJ 2HYFA 1IZ1A 3W2AA 3ZMTA 4UVCA 4MQVA 2F5FA 2ZB9A 3QOEA 4MTDA 2M7AA 2H6BA 5FFXA 4EM2A 2NXNB 4ESFA 2W00A 1WRJA 1VQ9I 1OCOH 2ISZA 3FM3A 1YI2I 4PGHA 1TTYA 1G4DA 2MW8A 1I1GA 3K9TA 4RAYA 1LFBA 3CMYA 2PJRA 3O3KA 5E79C 1ETWA 1TZLA 4RMNA 5LBQA 3VYTB 1Y1VJ 1X3WB 2LOOA 2Q1ZB 4BEHA 1OCPA 3KZZA 2VE9A 4U0VA 1OPCA 1R7JA 4XBFA 4QIWN 3F21A 1VF9A 5M3FJ 4PDKA 4F93B 3ZN0A 3G6EI 2TCTA 1MBGA 3LSGA 3BG3A 3A02A 4CSWA 1MZBA 1KU7A 5JVGF 2QSHX 4JOMA 4NB5A 1G6NA 1JJ6C 1TC3C 4XNFA 3ASNH 3PFIA 2LP0A 1ITYA 1MGTA 1BM9A 1Y1WJ 2RV8A 2UWMA 1FOWA 2Q8KA 2QKMB 3FXKA 2DO7A 4ANJA 2FOWA 1J2XA 4CCOA 1P92A 5LGNA 3RZDJ 2DA5A 2W25A 2IEKA 1EH6A 2F48A 2PJRB 1TT5B 2P6TA 5J1RA 4HLYA 2E7WA 3E5QA 4E70A 2E1MC 2BY2A 2JA2A 3SDBA 1DU6A 2JWTA 1WJEA 4D0PA 1FC3A 3HRSA 2X6OA 3TOBA 1BC8C 1XMXA 3D0SA 2R7FA 4AIDA 3HTUA 2LR8A 2R4GA 2CRGA 2DK8A 1TLHB 3K4KA 2ADUA 4B44A 4EGZA 1UMQA 4IHTA 2GOMA 2COBA 4H4KC 5B1BH 4HPQA 5EGOA 2ID3A 4S0HB 4DW6A 2OF7A 4IO9F 2IS1A 4KT6A 4BH9A 4IKFA 4PCQA 1F36A 2X48A 4M6XA 1IRGA 1QHGA 1J7KA 1H8AC 4D5CA 3LA3A 1PJRA 5IOZA 2GAUA 4MEYF 3SEZA 3I56I 2KJBA 2ELJA 1XSVA 1Y8QB 1KQ9A 1K61A 3U1DA 1PYVA 1SD6A 5J8CA 1WZ2A 1E3HA 3H35A 3MAJA 5DCMA 2FUG2 2FBIA 2M4GA 4I76A 1IDZA 3DQVC 3LA2A
chains in the Genus database with same CATH topology
2K3FA 2NXNB 4IOAF 1QA6A 1VQ9I 4IOCF 1YI2I 2OTLI 2QEXI 2ZJPF 1S72I 2ZJRF 1FOXA 1YHQI 1VQ4I 1MMSA 2E34A 3CCMI 3CCJI 1VQKI 4UY8I 1VQMI 4V19K 1YJ9I 3G6EI 1YITI 1VQ6I 3CMEI 3CCVI 3J7ZI 5JVGF 1VQ5I 1VQLI 3G4SI 3CCSI 1Y39A 3CCRI 3CC4I 1FOWA 1VQPI 2QA4I 2FOWA 3CCQI 2OTJI 5GAEJ 3PIOF 5DM6F 3PIPF 3CMAI 1VQNI 5DM7F 3J7YJ 2JQ7A 1VQ8I 3CF5F 5GAHJ 1HC8A 1YJNI 2E35A 1VQ7I 4IO9F 5GADJ 3DLLF 3CCEI 3CC7I 2H8WA 3CJTB 3G71I 3CC2I 1YJWI 3I56I 1ACIA 3CD6I 3CCLI 3CCUI 1YIJI 2E36A 1VQOI 3I55I 5GAGJ 1FOYA 2ZJQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3F A;  2NXN B;  4IOA F;  1QA6 A;  1VQ9 I;  4IOC F;  1YI2 I;  2OTL I;  2QEX I;  2ZJP F;  1S72 I;  2ZJR F;  1FOX A;  1YHQ I;  1VQ4 I;  1MMS A;  2E34 A;  3CCM I;  3CCJ I;  1VQK I;  4UY8 I;  1VQM I;  4V19 K;  1YJ9 I;  3G6E I;  1YIT I;  1VQ6 I;  3CME I;  3CCV I;  3J7Z I;  5JVG F;  1VQ5 I;  1VQL I;  3G4S I;  3CCS I;  1Y39 A;  3CCR I;  3CC4 I;  1FOW A;  1VQP I;  2QA4 I;  2FOW A;  3CCQ I;  2OTJ I;  5GAE J;  3PIO F;  5DM6 F;  3PIP F;  3CMA I;  1VQN I;  5DM7 F;  3J7Y J;  2JQ7 A;  1VQ8 I;  3CF5 F;  5GAH J;  1HC8 A;  1YJN I;  2E35 A;  1VQ7 I;  4IO9 F;  5GAD J;  3DLL F;  3CCE I;  3CC7 I;  2H8W A;  3CJT B;  3G71 I;  3CC2 I;  1YJW I;  3I56 I;  1ACI A;  3CD6 I;  3CCL I;  3CCU I;  1YIJ I;  2E36 A;  1VQO I;  3I55 I;  5GAG J;  1FOY A;  2ZJQ F; 
#chains in the Genus database with same CATH topology
 1X1D A;  2K3F A;  3U9G A;  2I10 A;  2LH9 A;  1TWF J;  2I8D A;  4YIF A;  4E4H A;  1BI1 A;  4GRI A;  3Q0U A;  1JUM A;  1OYI A;  2R0Q C;  5EGO B;  3NWT A;  2FXA A;  1YRN A;  3M8F A;  3OMY A;  4PJJ A;  4IVN A;  1N75 A;  2JK3 A;  1UZC A;  2DA4 A;  5J47 A;  3E0J B;  3E7L A;  3O2P E;  5K7F A;  5LHI A;  2CUF A;  4M6V A;  3S17 J;  3LSI A;  3B02 A;  5IPA A;  4V19 K;  4BXU A;  1LNW A;  3TMO A;  1FEX A;  1YW8 A;  4P96 A;  2FRH A;  2YUS A;  5M5X J;  3KPH A;  2RQP A;  3QOD A;  5DCM B;  4BE2 A;  3PL8 A;  1HDP A;  3MKL A;  2JRT A;  2DI3 A;  3VYR B;  3WTZ A;  3OR2 C;  3H3Z A;  4II3 A;  3AL0 B;  1ZGA A;  3EET A;  2JSP A;  1Y39 A;  2VXD A;  3CQZ J;  2V1N A;  3MD2 A;  3BZC A;  4L9V A;  3GF2 A;  4UB8 C;  1EH8 A;  3LAJ A;  2HQR A;  2YSR A;  5IYB J;  3KFW X;  5CQE A;  4BU2 A;  4E6K G;  5GAE J;  3ABK H;  4F7Z A;  3CCY A;  3GZN B;  2BGC A;  1QPM A;  2DXI A;  2VOP A;  3TQN A;  2L02 A;  1Q1V A;  3A2K A;  3HYI A;  3CO6 C;  1AA7 A;  3CUO A;  3S1R J;  5DEQ A;  2MSY A;  3GYH X;  2DW4 A;  2QQA A;  3IAM 2;  1X1B A;  3BG5 A;  4ZZD A;  2K5C A;  1WJA A;  3CDL A;  2M0C A;  1SFK A;  1BIB A;  3I58 A;  3DLA A;  2P7V B;  3FHN A;  4C30 A;  3KLO A;  4HDV A;  1A35 A;  4JK1 X;  3KP3 A;  2HEO A;  3BC8 A;  2CV0 A;  4A0Z A;  1Z9C A;  1FSE A;  4PK4 A;  3H0D A;  4L18 B;  3MKY B;  2WA0 A;  2HS5 A;  2GZW A;  2NOG A;  1BC7 C;  1RZ4 A;  3PM1 A;  4EJU A;  4YFN F;  3TED A;  4OMY A;  3KX2 A;  2L9N A;  2NVY J;  4XQF A;  3JRF A;  4ENJ A;  1LFP A;  2OU2 A;  2QZ8 A;  3H92 A;  4FIS A;  2D45 A;  2EJR A;  1QZE A;  3L00 A;  2BHZ A;  1R00 A;  5IOY A;  1AOY A;  3I5U A;  2Z2S B;  1SD5 A;  1JTX A;  2WAE A;  1OKR A;  3W6J B;  2KQR A;  1R22 A;  3JSP A;  1LQ1 A;  3E6B A;  1WI9 A;  1D8K A;  2W82 A;  3BT9 A;  5JVT A;  2VJJ A;  5HOD A;  5GPC A;  3BQY A;  1R4M B;  4EM0 B;  4JX6 A;  4CCK A;  3WU1 B;  3BG6 A;  1JJ8 C;  3OYJ A;  1ETX A;  2Y9Z A;  3GBG A;  3F23 A;  3I9V 2;  3FMR A;  2BZT A;  3I53 A;  1B1B A;  5J8F A;  3OYL A;  1WSU A;  1P7J A;  1FZP B;  2LTP A;  4E7L A;  5JI6 A;  1O3Q A;  1V5G A;  2R7S A;  1BW6 A;  3RKQ A;  2VOO A;  1F4K A;  1KU2 A;  4HNT A;  2ZME C;  3OYK A;  3VYU B;  4Y7N J;  3HTS B;  1S7A A;  4XLP F;  3OIO A;  2CV2 A;  1BOB A;  1XDS A;  4CDG A;  5TIS C;  4AIH A;  1Z6R A;  5HLI A;  2DN0 A;  3A4C A;  3CLQ A;  2XRO A;  2DA6 A;  2EFQ A;  3IKV A;  4ITV A;  4L9N A;  1FY7 A;  1LKX A;  4K2E A;  3AFH A;  4Y52 J;  3TW6 A;  1UJ8 A;  4BYY A;  2A3S A;  2PFB A;  3F9K A;  1T08 B;  1SAX A;  2HFH A;  2PX9 A;  3BTJ A;  1YO5 C;  2O6G E;  3I0T A;  4MEX F;  1I3Q J;  3MKW B;  5GTI C;  3QPL A;  1F9N A;  3C2H A;  3A0B C;  5DD4 A;  4I09 A;  2VI6 A;  1SFU A;  1G8X A;  4A2U A;  4FET A;  2F4M B;  4A0X A;  4AIJ A;  1XMK A;  5CVJ A;  1NK2 P;  3CUQ C;  2W24 A;  2ZJ2 A;  5F04 A;  2V9P A;  5E8I A;  2KFD A;  1MH3 A;  1ONV A;  1ZG1 A;  2FBK A;  1JXS A;  1HCR A;  4J00 A;  1WJ5 A;  2HQ5 A;  4BHP A;  3WTT C;  2F5E A;  1R1U A;  4LB5 A;  2M5W A;  4A3I J;  2IA1 A;  4DYR A;  3F8M A;  4FCY A;  2V9V A;  3FMS A;  3K2A A;  2A6E F;  1UG2 A;  2XAU A;  5LRR A;  2R7Q A;  3FBN B;  1GDT A;  2ZFW A;  1VQ7 I;  2DAO A;  1ZH5 A;  2IGK A;  2IS4 A;  3DLL F;  4IL6 C;  4RB3 C;  2R7R A;  2DDA A;  3IRQ A;  3HG9 A;  4YFK F;  1Z91 A;  4NC7 A;  5IY5 H;  1RRJ A;  4FX4 A;  1PUF A;  2YX7 A;  1D1A A;  3MKZ A;  1JHF A;  2ME0 A;  4NQW A;  4I0A A;  3T8T A;  3I54 A;  3OSF A;  2LY1 A;  3U21 A;  1DPU A;  3PO2 J;  4BL0 B;  4A5N A;  2BXZ A;  4MNU A;  2M45 A;  3D5S C;  2KRH A;  3JRC A;  1G3S A;  3ESW B;  4ENM A;  3HHG A;  4KDP A;  3F8B A;  4FTH A;  3F8N A;  2QEX I;  4ZTF A;  2PMU A;  2VC0 A;  2K02 A;  1XSD A;  3FKJ A;  1R4N B;  2MH9 A;  4UUT A;  3WTS C;  2ZJR F;  2MA3 A;  2MLG A;  3BP8 A;  1SFX A;  3S2W A;  3K6G A;  1CGP A;  1QO0 D;  3WTU C;  5E18 F;  4XN0 A;  4B1R A;  3T8R A;  2V7F A;  4EM1 A;  4UNO A;  4BJ6 C;  3HEF A;  4OIN F;  4XKB A;  4I7H A;  2JT1 A;  3P5J A;  1KU3 A;  2LMD A;  2LY2 A;  3JAM K;  2KLO A;  3BQZ A;  2E71 A;  4NQW B;  1E3O C;  3PNT A;  3SZP A;  1WGX A;  1L3L A;  2HDD A;  1MBF A;  2F5D A;  4XRF A;  4IEJ A;  2LRE A;  1FWZ A;  3PFY A;  4PUS A;  5TJJ A;  2JVH A;  3F6O A;  2K7L A;  4IZZ A;  4U87 A;  2HU9 A;  2BY3 A;  4LG0 A;  4G6T B;  4HX4 A;  1K78 B;  1I1S A;  3FM5 A;  1G59 A;  1JT6 A;  5BPI A;  1HOM A;  3JRE A;  5BNG A;  1XN7 A;  3BR1 A;  3LAP A;  2DBB A;  4EGY A;  2X6Y A;  4LK1 F;  3FWE A;  1HKS A;  4MFE A;  3E5X A;  2L7M P;  2DQL A;  5DM6 F;  4A3J J;  4EAT A;  3IL2 A;  3E97 A;  3HSR A;  3ECH A;  4UVA A;  3CLO A;  1JI8 A;  1UB9 A;  5DM7 F;  3BR2 A;  3R60 A;  3FXR A;  3Q9S A;  5E1Z B;  4EEF G;  1N25 A;  4A3M J;  4IHV A;  1HKT A;  2K3P A;  3DTK A;  3E6D A;  1ON1 A;  4DBQ A;  2K9L A;  3GME A;  2MC4 A;  4M71 A;  2XKP A;  2K85 A;  1XGM A;  1BJZ A;  3L7W A;  4N0B A;  3QU6 A;  2QWW A;  4E7H A;  2DA7 A;  3QPT A;  3MMY B;  1O7L A;  4LG0 B;  2AQF A;  2X51 A;  2EK5 A;  1LDJ A;  1S6L A;  2XB0 X;  5LHG A;  3LA7 A;  5GPA A;  3EQL F;  3TGN A;  1YS7 A;  4N4N B;  2BVM A;  4L0Y B;  4L0Z B;  1MNE A;  3KP7 A;  5CVV A;  3GTQ J;  3HOW J;  5D8K B;  2D1V A;  3HPH A;  3CD6 I;  2Q2E A;  4KYW A;  3AG3 H;  2W4S A;  3K7A J;  4CYD A;  4C2M J;  1ZG5 A;  1X2N A;  1QVU A;  3S3M A;  4BXX J;  1BOA A;  2BHY A;  3DTE A;  5J1Y A;  2AXT C;  3PNV A;  3S1N J;  2B9S A;  2L0K A;  2M3A A;  1IXR C;  1O57 A;  2Y0S A;  4GO1 A;  2NVU B;  1O3S A;  1GHC A;  3IHU A;  4V2G A;  1MNM C;  2OTL I;  3TKY A;  1FSH A;  1B9M A;  3GLL A;  2M87 A;  1SMY F;  2CFX A;  3FXJ A;  4HRI A;  4AWX B;  3VOE A;  5LGU A;  4E7K A;  2RN7 A;  4F52 A;  4LMY A;  4B8X A;  2PLY A;  2L9S A;  1U8R A;  2OV7 A;  1HQC A;  4B09 A;  5C44 J;  4HX8 A;  2EFP A;  4Z2Y A;  3JAM Z;  3JTG A;  1JT0 A;  3RKX A;  4ZYA A;  1Z7L A;  3H36 A;  5DTD A;  5D4S A;  1RKW A;  5E3M A;  4FE7 A;  2QQ9 A;  5D6F A;  3Q9V A;  1IV6 A;  1YJ9 I;  1U2W A;  1HBX G;  3BZK A;  1YIT I;  3G1M A;  2Q2E B;  4XRS G;  2A05 A;  2VBZ A;  2VQL A;  4D9J A;  1IUF A;  1I39 A;  2F5C A;  3TO9 A;  3TOA A;  3DBR B;  1TT0 A;  2Y2Z A;  4RAG A;  4HQM A;  2L4M A;  2KIF A;  4XLH A;  4P9U A;  3BR3 A;  4KJZ A;  5BMZ A;  4M9Z A;  4A3F J;  1Z77 A;  2NOJ B;  4MHG A;  2CW0 F;  5FKO A;  2WAD A;  1K4T A;  2CQK A;  1S5L C;  4L5E A;  2X6W A;  3KP6 A;  2HVS A;  1NTC A;  2FQ4 A;  1TQI A;  2L7K A;  4AU7 A;  4R79 A;  3TO6 A;  1FTZ A;  4RLF A;  1OCR H;  2MFZ A;  1FNN A;  3ABM H;  1T33 A;  2VQG A;  3IH3 A;  5TGT A;  5KNL A;  3MZY A;  2H27 A;  1VQ8 I;  2XAJ A;  2GLO A;  3KE2 A;  2KP6 A;  2L5Q A;  1XD7 A;  4ZYD A;  2ZFU A;  2DA2 A;  2PMZ N;  1ENH A;  5EEG A;  2OA4 A;  3CF5 F;  1SMT A;  5DDG A;  3M8J A;  4UVB A;  1IN5 A;  3K1M A;  1FIA A;  3PUB A;  5CVR A;  2XPV A;  1RR8 C;  4FE4 A;  4N9I A;  1I50 J;  1LE8 A;  3WU2 C;  1MKM A;  2EIL H;  3C18 A;  3IH4 A;  4WXD A;  4HZF A;  4LFU A;  1ZAO A;  4AM3 A;  1XTA A;  4FHT A;  4IHX A;  4IHY A;  1IJW C;  4RB2 C;  2HVQ A;  5J40 A;  1XGS A;  5BS6 A;  3V7R A;  4HV6 A;  5EG0 A;  4KIB A;  3BPV A;  4RGX A;  3LFK A;  2A61 A;  2MGQ A;  5GAG J;  1T0F C;  3CJR B;  2JRM A;  3K70 D;  2BW3 B;  3L9F A;  4F3Q A;  1QPI A;  3FZV A;  3KP5 A;  2GM4 A;  2WTE A;  2LF8 A;  2YU9 J;  1WJD A;  1OR7 A;  4G9Y A;  3EYY A;  1Z1D A;  1MW7 A;  3BTL A;  4BBS J;  3RJP A;  1H9G A;  2XVC A;  1E0E A;  4A6D A;  1FJL A;  4O6J A;  1W7P D;  3CO7 C;  4NUB A;  4EJT A;  1A6I A;  2R7V A;  3DBH B;  4U0W A;  2LFB A;  1P2F A;  2GA2 A;  3EUH A;  1TBX A;  5E1X A;  4KA4 A;  3JRB A;  1LE8 B;  2L01 A;  4XLN F;  1V5F A;  3HKZ A;  4FX0 A;  5JFR A;  1XC5 A;  1VQM I;  2KKO A;  1T38 A;  2JN6 A;  2BYV E;  5LD2 C;  4B43 A;  2ID6 A;  3HOS A;  1IRZ A;  2F5V A;  1J09 A;  3GXO A;  1T6S A;  2B7E A;  4BQQ A;  4HF0 A;  5B3S H;  3LFU A;  1HKQ A;  3JSO A;  5J4Y A;  2PBI A;  5HNF A;  4CZC A;  5EG0 B;  3S1M J;  3GFL A;  3W6V A;  4AVZ A;  3K4J A;  3E6M A;  4N4O B;  5EDN A;  6PAX A;  2EIK H;  1J59 A;  4H0E A;  3G4S I;  4IRI A;  4Q48 A;  2K4B A;  1LVK A;  3CJQ B;  5D8L B;  2R5Y B;  2DOA A;  2KMU A;  2DK5 A;  3CCR I;  2VQH A;  5FRN A;  1IRX A;  2HOT A;  1E17 A;  2E1O A;  3WGH A;  4BDZ A;  2Y31 A;  1IC8 A;  2HZD A;  3N97 A;  3PQJ A;  4E7Z A;  3V8L A;  1IO2 A;  3F3X A;  4KN4 X;  2DJN A;  1A31 A;  2NVQ J;  3RQI A;  3IP4 B;  3PIO F;  3P7N A;  4BAC A;  3HOZ J;  4XKC A;  2BY1 A;  4CA0 A;  1YW9 A;  1EF4 A;  4OIO F;  4XOR A;  3DKW A;  3J7Y J;  2E5Z A;  2JUC A;  4HG2 A;  4IF4 A;  1VND A;  2XB5 A;  2NNY A;  4BY1 J;  4J01 A;  4BE0 A;  4HNV A;  4UV8 A;  4HDU A;  3IH2 A;  3RSN A;  3RZO J;  4UV9 A;  4PGG A;  5DD8 A;  4DZP A;  2GOX B;  4XR6 A;  2PMH A;  1HC8 A;  2L7Z A;  2R3S A;  2RRE A;  1WH5 A;  4ZDP A;  1D1B A;  3KP2 A;  2XAG A;  4KIT B;  2KRC A;  3DEU A;  5M5Y J;  2H8R A;  5EYR A;  3SZT A;  3VOD A;  1ERD A;  5L3F A;  5KHD A;  2R7U A;  4BEH B;  2EZH A;  4E7I A;  2JA6 J;  4XOP A;  5D6E A;  2X85 A;  2P5L C;  1X4O A;  2K40 A;  4C9Y A;  2E2H J;  4RGR A;  1MMD A;  3RIR A;  1DU0 A;  4L5I A;  3J80 K;  3GTM J;  4Y33 A;  1HW2 A;  1D8J A;  4D7M A;  2PEX A;  5H2F C;  4OU0 A;  5L3C A;  4CO8 A;  5IT3 A;  1VQO I;  4CZZ A;  5KAF C;  5HNH A;  2CW8 A;  4OIP F;  1D5Y A;  2ZXJ A;  1Z3Y A;  2DT6 A;  2EZK A;  4Y15 A;  2JUG A;  4IOC F;  2XC7 A;  2XRL A;  3S93 A;  2A5Y B;  4G6Q A;  2E2I J;  4M9X A;  2DMT A;  2EWN A;  2P5V A;  2BV6 A;  2DFF A;  2QQ8 A;  3ZCO A;  2FOK A;  1S3J A;  3U2R A;  3FXL A;  5CJ9 A;  2DMP A;  2MBF A;  1B6A A;  2WBM A;  3GW2 A;  3ZMS A;  4G94 A;  2TRT A;  3T1B A;  2LF7 A;  2EFO A;  3P9I A;  1UHM A;  1MBJ A;  2HNH A;  3OOP A;  4C3H J;  3CCJ I;  1UHS A;  4P1W A;  5ICC A;  4UY8 I;  1IUY A;  1IDY A;  4HEA 2;  4RGS A;  1BA5 A;  3ERE D;  3QOP A;  2FD5 A;  4XLC A;  1IGN A;  2KL4 A;  2FF4 A;  3OR1 C;  4L9T A;  4O5V A;  3OV8 A;  3SJM A;  4B48 A;  5TRD A;  2QSF X;  3HRM A;  1I27 A;  2WAQ N;  1ON2 A;  4G6D A;  1ZGJ A;  2QUF A;  1TWA J;  2DJI A;  2HOA A;  3ZQC A;  3TL4 X;  2XAH A;  1U3E M;  1VQ5 I;  4G7Z F;  2VE8 A;  2LC2 A;  4P9F A;  3VEP A;  1GVJ A;  5L3G A;  1XCV A;  4M3F A;  1J9I A;  5DYM A;  3HSF A;  2EPF A;  3SDG A;  2HPM A;  4LIV A;  4M74 A;  2R7W A;  3ZQG A;  2L54 A;  3CCQ I;  1Y56 A;  1T98 A;  1SFO J;  2IS2 A;  1PP8 F;  1B8I A;  1OQY A;  1IV8 A;  2OQR A;  2H09 A;  5CLS A;  1W36 C;  2CW7 A;  3D1N I;  1WJF A;  2NS8 A;  2L9R A;  4L9J A;  2X0L A;  3MQ0 A;  4ZYG A;  2XUB A;  3K4B A;  2ZXH A;  4AYB A;  1R5I D;  2JZY A;  4HSR A;  2N8G A;  4KN7 X;  2OZ6 A;  5DCF A;  3SFZ A;  2A5W A;  2DQR A;  1KA8 A;  3OY9 A;  4WXH A;  2CH0 A;  2P81 A;  1ETO A;  4OIQ F;  3BRO A;  2VB6 A;  4WF2 A;  1ZR2 A;  2V26 A;  1ZLK A;  2CYY A;  2DPD A;  3HB9 A;  5EJC A;  3HXL A;  2OJE D;  1YRN B;  3EYI A;  2UXX A;  4UB6 C;  1U0J A;  1OYY A;  3G3Z A;  3CC2 I;  2QQB A;  2FMY A;  4UXN A;  1KU9 A;  3E5U A;  3OIP A;  4WK8 F;  3WGI A;  2R7Z J;  1M1E B;  2WV1 A;  1QVT A;  3J80 Z;  3LSR A;  1VFC A;  3M3Y J;  3CDH A;  2HYJ A;  4XRS A;  5H6R A;  4HQE A;  3BLY A;  2AHQ A;  1JKP C;  4GFB A;  2X1C A;  5EEH A;  3H9J A;  5E8G A;  3JRI A;  2IS6 A;  4XL9 A;  3BCB A;  2DOE A;  5K7H A;  2RNG A;  2Z3Y A;  4MIM A;  1QHH D;  3P9K A;  4C2U A;  1AU7 A;  3C2B A;  3C2G A;  2P4W A;  2JPC A;  1I3A A;  1ZYR F;  2VXZ A;  3FBI B;  4JX5 A;  4XON A;  4A69 C;  2DMU A;  2WAF A;  4BDY A;  1ZN2 A;  1S72 I;  3G1L A;  2PI0 A;  4Y3O A;  2OUM A;  2DA3 A;  2K9M A;  3F72 A;  3HOY J;  4CGZ A;  3WG7 H;  3NAR A;  4CCJ A;  2CS3 A;  4QSH A;  2HDC A;  2XPU A;  5CKT A;  2STT A;  2DLL A;  2X1E A;  3OS2 A;  2XGC A;  3JW4 A;  4PSX A;  1T56 A;  4OOI A;  5JLW A;  3IUO A;  1YE9 A;  2KIS A;  5F1J A;  3OYI A;  4A0Y A;  1SFE A;  5HLH A;  3CCV I;  2UZK A;  4JP0 A;  5AIP A;  2RC4 A;  4M9S A;  4FQG A;  3KYC B;  2VQC A;  4XID A;  3V8J A;  4XN3 A;  1FBQ A;  3ZR8 X;  3DTI A;  3QYE A;  3QYB A;  3FIS A;  1SVM A;  2FX0 A;  4AUX A;  1IW7 F;  1J75 A;  4RAZ A;  2DT5 A;  3A03 A;  4YFX F;  2GXB A;  4MGR A;  5A2Q K;  2D1H A;  2I5U A;  2XAF A;  3R4K A;  4ZYE A;  3IC7 A;  5KK1 A;  5K5O A;  4HF2 A;  3B6C A;  2CGP A;  3K0L A;  3ZXS A;  2EB7 A;  3L1P A;  1DUX C;  5ILU A;  4PFO A;  1LB2 A;  2VBX A;  2FNP A;  4MFD A;  1QRY A;  4CUG A;  2L4A A;  2ZME A;  3L2Q A;  3FHZ A;  1Z7U A;  2H1K A;  2OPT A;  4EJO A;  3HSE A;  1Z05 A;  2RNJ A;  4UUS A;  2LK2 A;  4CYC A;  2XDV A;  4RM2 A;  3AG4 H;  2L3D A;  3OYM A;  1EKE A;  5BPD A;  1Y8R B;  1FLI A;  2QYO A;  3V4G A;  3R61 A;  3J81 Z;  2LKS A;  1HSJ A;  3Q3S A;  2OZU A;  4EMS A;  1ZGW A;  1XPX A;  1ZK8 A;  3CC7 I;  1JTY A;  3FKI J;  4BHB A;  4F91 B;  4YEJ A;  5L3D A;  2LLK A;  3G71 I;  1LEB A;  2AS5 F;  4LLN A;  3BTI A;  1JGS A;  1ACI A;  1JKQ C;  2V1U A;  2DOF A;  2QKL B;  3RKW A;  3HRT A;  2KDO A;  4M6Y A;  2RGV A;  4A3K J;  1KYZ A;  3QPS A;  4GCV A;  4BHC A;  2DOD A;  2IRF G;  2Z33 A;  3CUQ A;  2NS0 A;  4KIG A;  2JA7 J;  5D5X B;  1KYW A;  2ZME B;  3H5R A;  2GA1 A;  1HW5 A;  3DU6 A;  3LOC A;  1N77 A;  3LSJ A;  1B4A A;  3GWZ A;  1HF0 A;  1XSX A;  3W6K B;  3ZQ7 A;  3ABU A;  3GTJ J;  3KZI C;  2Y69 H;  2VPR A;  3F22 A;  3DKX A;  3EUA A;  4MLO A;  1B72 A;  2STW A;  4DYC A;  3CES A;  1W36 D;  2V9K A;  1AKH A;  1HW1 A;  3FDY A;  1H9T A;  3G1O A;  3RYP A;  1WKM A;  3BG7 A;  5CYV A;  1U5T C;  1ETY A;  3AG2 H;  2Z5U A;  3ZQL A;  3SEQ A;  4IRH A;  1UG0 A;  2LY9 A;  4AIK A;  3OYE A;  2OBP A;  1H0M A;  2CUE A;  1XDU A;  4HOB A;  2IT0 A;  1DPR A;  4IJA A;  5BOX A;  3COA C;  2NVX J;  4XKW A;  2PG4 A;  3J7Z I;  3CUQ B;  3ISP A;  2A69 F;  5EZH A;  3ZQH A;  5ICE A;  4ESJ A;  3FXO A;  3CCS I;  3AKZ A;  3OYB A;  2HZT A;  2HQN A;  5A2Q Z;  1ULY A;  3HM5 A;  1N78 A;  3I64 A;  4U88 A;  1S29 A;  3N4M A;  4RGU A;  5C4J J;  2DTZ A;  4X6A J;  2ESN A;  3SYT A;  4CHU A;  2JSC A;  5DS9 A;  3DEE A;  3LMM A;  5E1W A;  2EZI A;  2FU4 A;  4A3L J;  3GUD A;  1F5T A;  1B72 B;  1PUF B;  1D3Y A;  3ECO A;  4FT8 A;  2CQX A;  1APL C;  1D5V A;  3H3V K;  1LPQ A;  2KIM A;  2VOD A;  1ZAR A;  3HOT A;  1AKH B;  1P6R A;  2FML A;  1TW2 A;  3ZMV A;  4CCM A;  1O3T A;  3GFM A;  1F43 A;  5J4V A;  3OOU A;  4PJL A;  2O9L A;  4OWR B;  4WXC A;  3IRR A;  1OJL A;  2V1X A;  1GVD A;  5FJ8 J;  1LDD A;  1T95 A;  4ETS A;  1NK3 P;  3DU5 A;  4WWC A;  2FQ3 A;  1FMW A;  3WGG A;  3LWF A;  4BS9 A;  5GAH J;  2LVS A;  3A1Y A;  3V7S A;  4OMZ A;  1RC9 A;  4RAF A;  1WI3 A;  3MVP A;  1W5T A;  4RLQ A;  5LEK A;  4DQ2 A;  3HPG A;  3PO3 J;  1G3T A;  3H1C A;  4LD5 A;  3RTR A;  2ZNZ A;  1FOK A;  3MEX A;  3EPZ A;  4BUP A;  2HYG D;  2ZXW H;  3KYD B;  5D4R A;  2E60 A;  4EQQ A;  1VTN C;  2DFE A;  3RCO A;  2Y30 A;  1YIJ I;  3DPL C;  3TP0 A;  2NAZ A;  2W1O A;  2HTJ A;  4BQO A;  2HWV A;  3KP4 A;  3CMM A;  1FT9 A;  3GTG J;  4QLC U;  3MN2 A;  4ZTJ A;  1SD7 A;  4LG3 A;  3O8H A;  1W7P A;  1WPK A;  5DV5 A;  1T8I A;  3HC7 A;  3DFG A;  2O7O A;  3H9Q A;  2OCC H;  2NRA C;  4DYQ A;  1X3U A;  2AO9 A;  2MYS A;  3BG9 A;  1FPQ A;  1RKT A;  1SVO A;  2W48 A;  2XGE A;  5FFZ A;  2H94 A;  2ELK A;  4BBR J;  5D5U B;  2GXA A;  3G2B A;  1ZEL A;  4C3I J;  3LNQ A;  4QTR A;  2H6C A;  2F6C A;  1DGW Y;  5HDK A;  1Z21 A;  3ZRG A;  1MMS A;  2XV4 S;  3OYD A;  1NG7 A;  2KRF A;  2WV0 A;  4B3X A;  4DIQ A;  1AWC A;  2IGM A;  1ZRD A;  1WQ2 A;  2EV6 A;  5GTH C;  4BY7 J;  3FK7 A;  1YG2 A;  5FD6 A;  2M4K A;  1P9Q C;  4HW0 A;  2M1B A;  2MLK A;  1X19 A;  3O6B B;  3K10 A;  3M7G A;  3GZ6 A;  2CG4 A;  3I3L A;  3J7A O;  1DDN A;  2WAQ A;  1JE8 A;  3MZH A;  4A3D J;  3BCA A;  2BE5 F;  2CFO A;  3OIQ A;  1ZTR A;  3S16 J;  5FGM A;  1W7P B;  3CC4 I;  5KVR A;  1TNS A;  3JR9 A;  3BOQ A;  5HS7 A;  4DGW B;  3KEY A;  2ZKZ A;  2M7B A;  1ZRF A;  5LRS A;  1Z3X A;  1EV7 A;  3M1C A;  2OTJ I;  1NG6 A;  1U6G A;  4M73 A;  4F92 B;  2HQA A;  1GLN A;  5HS9 A;  3GVA A;  2CO5 A;  2ECC A;  3BZ6 A;  1IN8 A;  1YQA A;  5K1Y A;  4E7J A;  2FEZ A;  4BQA A;  2JQ7 A;  1X2M A;  3W3C A;  4BJ5 C;  1RET A;  1GV5 A;  2HKX A;  1I6H J;  2DYS H;  4CCN A;  1XG1 A;  5HLT A;  5H6Q A;  1PDN C;  2NVT J;  4OIR F;  4G7O F;  1BW5 A;  4G7H F;  3JRH A;  4X1E A;  1RI7 A;  1S7E A;  2VJ4 A;  1SVL A;  1ZG3 A;  1ZQ3 P;  2EQR A;  1RNL A;  2CWE A;  3K69 A;  3QP6 A;  3CCE I;  1XGO A;  1QGP A;  2Z9O A;  3DPU A;  3HZJ A;  1BR4 A;  2FJ1 A;  5M5W J;  3BWG A;  2VPL A;  5D5V B;  2VAS A;  1IG7 A;  3VSK A;  4XIC A;  4ENK A;  1R23 A;  3DF8 A;  5IYD J;  2UV1 A;  3CCU I;  3ZMU A;  3RPQ A;  3QRF F;  1J5Y A;  2W57 A;  1W4M A;  4NC8 A;  2QCO A;  1J0R A;  1FOY A;  2ZJQ F;  2ME6 A;  2CSO A;  4NC6 A;  2KZG A;  3BR6 A;  1SAU A;  4KT5 C;  3PSF A;  1RIO H;  3J7A Y;  2P0W A;  1NH3 A;  4ZH4 F;  1W0U A;  2M8E A;  3WE3 A;  4BKX A;  3Q0W A;  3TO7 A;  2IVM A;  1XGN A;  2E7X A;  2LYC A;  5B1A H;  4NDL A;  1VQ4 I;  1WHU A;  1R36 A;  2CU7 A;  4KFC A;  5FRM A;  3VFZ A;  1B9N A;  1ETQ A;  3CDI A;  3ULQ B;  3GTL J;  1SAN A;  1A04 A;  1EH7 A;  2IAI A;  4II2 A;  2R7T A;  2GBY A;  3OSG A;  4IX7 A;  1OR7 C;  1GXQ A;  1IN6 A;  2VJI A;  2F4O B;  3PJR A;  4RB1 A;  2K86 A;  4M3D A;  5F27 A;  4Y17 A;  1YOV B;  1YTY A;  2M9H A;  3ASO H;  5LEJ A;  3BJ6 A;  3TDU C;  2L7F P;  3FK6 A;  1FP2 A;  4EJV A;  4ON0 A;  4KUM A;  3L2U A;  3TW7 A;  2A07 F;  5ERI A;  2KJC A;  2YR2 A;  4E7S A;  2KT0 A;  1H89 C;  1YX5 A;  4I98 B;  1T0F A;  3SHF A;  5L3E A;  1LEA A;  3K1N A;  2MAB A;  1ZKG A;  4MO7 A;  3HOU J;  2P5K A;  3FXM A;  1TNT A;  4Y13 A;  1RUN A;  3WTW C;  2VC1 A;  1U78 A;  2GIZ A;  2DT7 B;  4IPA A;  4L5J A;  3FF5 A;  3I59 A;  3OWT A;  2HGC A;  3HRU A;  5ED4 A;  5CVI A;  3M07 A;  1YW7 A;  2VL8 A;  1JHH A;  1D1C A;  2E2J J;  3PQK A;  2Y75 A;  3QAH A;  4TV7 A;  5FKL A;  2HR3 A;  3BR0 A;  2Q0O A;  3WHB A;  4A12 A;  1K4S A;  2Y48 A;  1UAA A;  2RQQ A;  2Z99 A;  4NBQ A;  1MJA A;  2XPW A;  4I01 A;  2QEN A;  3GEZ A;  3O8G A;  4XSZ F;  2E35 A;  2V79 A;  3L2C A;  1H88 C;  1XX5 A;  4QWQ A;  1YFH A;  4ZYH A;  4XKV A;  2ELH A;  1UCR A;  1A6Q A;  2YS9 A;  3CP8 A;  2CV1 A;  3GZ5 A;  2MD0 A;  3CZ6 A;  3QYF A;  1EJ9 A;  3C3W A;  3UKG A;  1FBU A;  2K9N A;  4P55 A;  3ML6 A;  4XRM A;  2QVO A;  3M4O J;  1USS A;  4G12 A;  4LIU A;  1BR1 A;  1D0Y A;  2DMQ A;  3CCL I;  4ABZ A;  2K27 A;  4I0B A;  2JA8 J;  2F4I A;  4A3B J;  3T0Y A;  2R5Z A;  1V3F A;  1O7F A;  4C2T A;  2ICW G;  3JTH A;  3I59 B;  4O3M A;  3PSI A;  1T2K A;  4A3G J;  5FLV A;  2JMW A;  4DOZ A;  4HV5 A;  1ZHF A;  3KCC A;  2G7U A;  2YPR A;  2FSW A;  3TP3 A;  1RPW A;  4XMY A;  1R9T J;  1MMA A;  2MG4 A;  2ZBK A;  3MFK A;  5HOO A;  1K6O A;  3LSH A;  3CF2 A;  1Z0X A;  1CQT A;  2GXG A;  4RBO A;  1VZ0 A;  4B4C A;  5IP6 A;  2LSO A;  4GYI A;  1T39 A;  3LQQ A;  3LST A;  1VQK I;  2COM A;  4CCL A;  4UHT A;  2FE3 A;  2HOS A;  1RUO A;  5ILV A;  1W5C C;  5J1U A;  3BTC A;  3OYC A;  1KGS A;  1R71 A;  2VKH A;  3RPU D;  3ZMD A;  4D1Q A;  1UHW A;  2KIQ A;  4GDF A;  3SFI A;  1MJB A;  1MH4 A;  4HA8 A;  2M34 A;  3H0G J;  3CTA A;  3L2R A;  3HHH A;  5H20 A;  5FRO A;  2R5Z B;  1P7I A;  1L0O C;  4KIF A;  2B0L A;  4Y4R A;  1HDD C;  1RR7 A;  3ABL H;  4BAY A;  4Q4Z F;  1FYK A;  1LDK B;  4PZJ A;  5CVU A;  3WG9 A;  2QA4 I;  2FA5 A;  4U0Y A;  5C4X J;  2XAQ A;  5DUI A;  4HNU A;  3E6C C;  3AL0 C;  1HLV A;  1SEU A;  4S05 A;  4JX4 A;  3R0J A;  4DZJ A;  4WCG A;  1TWC J;  4ZJZ A;  2IJL A;  1U9N A;  2XKO A;  1HA8 A;  4CXF A;  2P7C B;  1GV2 A;  1VQN I;  1QZZ A;  4PJN A;  1PVE A;  5AON A;  4M3E A;  5F08 A;  1BJA A;  1OCC H;  5LHH A;  1S8N A;  4BNC A;  1FYL A;  2EV5 A;  3RDI A;  2PJP A;  1Q1H A;  2QF7 A;  4PFP A;  2E1M B;  2Y0S N;  3KIO A;  3P9C A;  5E3N A;  1YJN I;  2QSG X;  2QM3 A;  3D5R C;  4FAS D;  2M0M A;  3SZG A;  2WY7 Q;  5IP7 J;  4NHJ A;  1HST A;  2UUZ A;  1IF1 A;  3QQA A;  4AVP A;  1OIS A;  4M3G A;  3H5N A;  4P5O A;  2V6E A;  3RKY A;  2IW5 A;  4X0G A;  1FYM A;  1BI3 A;  3K4L A;  3ZQI A;  3R0A A;  4RA2 A;  2VN2 A;  1G3Y A;  1R58 A;  1K6Y A;  2P8T A;  2V1D A;  1Y0N A;  2OQG A;  1SC7 A;  3NRV A;  2G0E A;  5KCM A;  2HI3 A;  3I55 I;  1X4P A;  5IT9 K;  1DQU A;  2LNB A;  2E1N A;  3S3O A;  1BN5 A;  3K1P A;  1UEL B;  5IYC J;  1TL8 A;  1DP7 P;  1X3Z B;  4IOA F;  2BOL A;  3OL3 A;  1WJC A;  5D5W B;  2IGO A;  2EFW A;  2CMP A;  2IXS A;  4LGW A;  1REP C;  3S1Q J;  3J81 K;  3DBL B;  4AD9 A;  3EDP A;  3OS1 A;  4KIC A;  2EV0 A;  4LIT A;  4CIC A;  4EVI A;  2X4H A;  2B63 J;  2AXL A;  4IHW A;  1XS9 A;  1IN7 A;  4IHS A;  4ZZL A;  2M8G X;  1B8I B;  2WY8 Q;  2K9S A;  3NWS A;  3M9A A;  1ZRE A;  3ZQQ A;  2EBI A;  2Y9Y A;  3V42 A;  5LGT A;  5C3E J;  1OLT A;  4DBR A;  2K9Q A;  2CQN A;  5K5R A;  3CME I;  5E20 A;  4GGG A;  2EA2 A;  3VB2 A;  2MH2 A;  2QLZ A;  4BGD A;  1IXS B;  2ECB A;  3W2W A;  5HVQ C;  2MC3 A;  2PN6 A;  4KMU X;  3FXU A;  3GCM A;  3BDD A;  4PSW A;  4A3E J;  2QBY A;  4HBL A;  1JUS A;  4IQJ A;  1Y6I A;  3QU3 A;  3ROU A;  2TDX A;  1TP4 A;  2LKP A;  1OMI A;  4XK4 A;  4HX7 A;  3K4N A;  2GWR A;  3OYG A;  3A0H C;  4BJT A;  2WWY A;  1FTT A;  1KON A;  3BR5 A;  3W2V A;  1VI0 A;  1K7A A;  1XMA A;  2A68 F;  5GP9 A;  5CPR B;  1V55 H;  1JGG A;  1ZRC A;  4XM3 A;  2R7D A;  1FP1 D;  2DFH A;  3HIF A;  2IPQ X;  3GO5 A;  2KHM A;  2LKX A;  2E19 A;  2V6C A;  3GFJ A;  1G3W A;  2DTR A;  3ZMZ A;  2VT3 A;  3IAS 2;  1FX7 A;  1GUU A;  3WTX C;  2H1L A;  4PJM A;  3LSM A;  1YYV A;  2W84 A;  3F8C A;  4XSX F;  2DDB A;  2WB1 N;  2XAS A;  3DPT A;  1FBS A;  1OCZ H;  5FD5 A;  2NNN A;  2AQE A;  5F0C A;  2XSJ C;  1W1W E;  2EIN H;  1BL0 A;  1QU3 A;  2DFI A;  1MJ9 A;  5F64 A;  4NNJ A;  5HLG A;  2CUJ A;  2GQQ A;  2EH3 A;  4C3J J;  3H9G A;  2QBY B;  1RES A;  3QP5 A;  2XSD C;  1WVR A;  2EZL A;  3HKZ N;  3KLN A;  3HL2 A;  3AG1 H;  5IT9 Z;  3OYA A;  1I5Z A;  1X58 A;  5B66 C;  4Q5S F;  1LVA A;  4HLX A;  4YEL A;  1MSF C;  3HOX J;  2ISY A;  4DNC A;  1R5G A;  5IP9 J;  2JPB A;  3E3V A;  1QNT A;  2PMZ A;  1YS6 A;  2HVR A;  3S2D J;  5B5E C;  3ZP5 A;  3MCZ A;  2O5R A;  2P6S A;  4F55 A;  4A5M A;  1ZLJ A;  3C7J A;  2V4J C;  2R92 J;  3HGG A;  4B47 A;  1B59 A;  1O4X A;  1BI0 A;  2PQ8 A;  3D5L A;  1U8B A;  2VT2 A;  1Y0U A;  1IXC A;  5FO5 A;  2IBD A;  1C0W A;  2XRN A;  2IA2 A;  5J3L A;  3I71 A;  4OAZ A;  2KDZ A;  3JRG A;  2OAZ A;  3FMQ A;  2Y0M A;  3C1D A;  3VPR A;  3F6V A;  4W97 A;  1VQ6 I;  3WHC A;  2X6X A;  3GFI A;  1ODD A;  2R7X A;  2ACJ A;  4UUS B;  4CYC B;  1EA3 A;  3V7C A;  5JLX A;  2K4J A;  4HF1 A;  4UUV A;  1VQL I;  5E3L A;  2KZV A;  4BXF A;  2ESH A;  1CF7 A;  2EIM H;  2XGD A;  3UNG C;  3BJA A;  3BJO A;  5F6F A;  4J19 A;  3L09 A;  2GIV A;  4I99 C;  4KNY A;  4LLG F;  2M30 A;  5HDG A;  2DPU A;  3WU0 A;  1TQP A;  5ICF A;  3VSL A;  3LSP A;  2VJ5 A;  3DWL E;  2KIU A;  2XIG A;  3L2V A;  2NYX A;  2ZO4 A;  4XLA A;  2L2O A;  2VKE A;  1IAW A;  4JYK A;  2XF7 A;  5F0F A;  3PIP F;  5ICG A;  4KMF A;  3U1K A;  1O3R A;  2O03 A;  1NHA A;  4IXA A;  3F8F A;  1E2X A;  1QQI A;  2XF6 A;  4W1U A;  2CUZ A;  2EA4 A;  1MBE A;  4PJ0 C;  4LB6 B;  1U5T A;  4QPO A;  3DEW A;  3M8E A;  2MD5 A;  4I2O A;  3S2H J;  3N05 A;  4V2F A;  5J6X A;  2O8X A;  5GAD J;  2VLA A;  1K78 A;  4GYG A;  3M1E A;  2W85 A;  2A6T A;  2DA1 A;  3DKY A;  1CF7 B;  1K83 J;  2O0Y A;  4EJW A;  1R5H A;  1X1P A;  3LSK A;  2YU3 A;  3DXJ F;  1YJW I;  5BQT A;  3ZPL A;  2XGX A;  3MZ8 A;  3GTP J;  2JJ7 A;  3K2Z A;  3OS0 A;  2LRD A;  2ZSH B;  1F1Z A;  4ZC3 A;  3CJN A;  5LLQ A;  4RDU A;  3LL7 A;  3Q0V A;  3HOV J;  2E36 A;  1OYW A;  2BBY A;  5CQG A;  2QGU A;  3TBI A;  2W7N A;  1V4R A;  2FNA A;  1QA6 A;  4MQ9 F;  3ABT A;  2X1D A;  2DU9 A;  3ZQF A;  4A93 J;  3GTK J;  1P4X A;  3A01 A;  3JRD A;  2HPI A;  1V54 H;  1D0Z A;  4BQN A;  3L2W A;  1U5T B;  3LQR A;  2VBY A;  3CP2 A;  3OYF A;  4RB0 A;  3E1S A;  4XLF A;  1JKO C;  2JVG A;  3ZGK A;  2YX4 A;  1PUE E;  3K70 C;  1U9O A;  5JHU A;  3KEO A;  1PP7 U;  1ETK A;  3NEU A;  1KZH A;  1GXP A;  1FMV A;  1SD4 A;  3RYR A;  2XF5 A;  5FB2 A;  5E3O A;  4JBA A;  1WJB A;  1WFX A;  3ERM A;  2ZCW A;  1MMG A;  3AAF A;  1R1T A;  1R6R A;  1OFC X;  3UR3 C;  1TW3 A;  4Q47 A;  3FXQ A;  3WTY C;  3S8P A;  1QBJ A;  1ZR4 A;  3HJE A;  5E17 F;  1A36 A;  5EZG A;  4ZDO A;  4AYB N;  2HTS A;  1BBY A;  2E5N A;  5JHF A;  2CQQ A;  1LUJ B;  3V8K A;  3ZOB A;  2RVC A;  1W0T A;  4ESB A;  1R1V A;  2E1C A;  3S14 J;  3A01 B;  2IGN A;  1KQ8 A;  1VQP I;  2J5P A;  2IP2 A;  3WTV C;  2LD5 A;  4XLE A;  3FX3 A;  4I6Z A;  2CQ7 A;  2JTV A;  1FIP A;  4DJA A;  5L3B A;  3ELK A;  1G2H A;  4N9H A;  3SXY A;  5K5Q A;  2VKV A;  2G9W A;  4Z6Y A;  4U7B A;  3VDX A;  3DP7 A;  4KIS A;  2HKO A;  3BY6 A;  3KEQ A;  2HXO A;  1UST A;  3K4C A;  4R1H A;  1ETV A;  5AIQ A;  1I6X A;  2G7H A;  2L9V A;  3RQ4 A;  3WE2 A;  4AC0 A;  2VON A;  4U7D A;  1UFM A;  2LBF A;  2IA0 A;  3X2Q H;  3DV8 A;  3HBL A;  5HDN A;  3JCU C;  3PNY A;  2NS7 A;  2BY0 A;  3Q5F A;  3OYN A;  3OYH A;  4JQF A;  2VUM J;  2BEO A;  2HOE A;  2R7O A;  4RM3 A;  3B73 A;  3GLX A;  4HYE A;  1WWX A;  1D0X A;  2BXY A;  4QPQ A;  4D7N A;  1X1C A;  5F1R A;  2C6Y A;  5F0H A;  2H8W A;  3CJT B;  3RI4 A;  1BI2 A;  2F2E A;  2Z1D A;  2LG4 A;  1TWG J;  1KQ0 A;  4HAM A;  1XCB A;  1P4W A;  4M3B A;  4XOT A;  5EEA A;  2DYR H;  2M2E A;  4IRG A;  3F0C A;  5FLX K;  1X1A A;  1ORK A;  4BE1 A;  1Z6T A;  1P4A A;  1R49 A;  1MDM A;  4EV0 A;  4ASN A;  2JA5 J;  1E3P A;  2DMN A;  1YLF A;  2RKH A;  1MBK A;  2ETH A;  1W5S A;  1V5E A;  4LK0 F;  3HGY A;  2HDW A;  2RDP A;  2O3F A;  2CJJ A;  2LBF B;  2ZSI B;  2EIJ H;  1LFU P;  3IWF A;  3K4M A;  1BIA A;  5FKM A;  1POG A;  3I4N J;  2VKD A;  1A5J A;  1Z67 A;  2KPM A;  4I02 A;  1TWH J;  4OAY A;  2ZJP F;  4R8H A;  3R6S A;  4YII A;  3VYS B;  3H5A A;  1FOX A;  2BVL A;  1YHQ I;  5HS8 A;  3KYL A;  3T5X A;  1MMN A;  2RAE A;  3FIW A;  3NQO A;  4ENN A;  2O61 A;  2E34 A;  1JUP A;  2VIX A;  3CCM I;  2ZXI A;  5DUK A;  1MD0 A;  3RPU A;  4M72 A;  3S3N A;  4LJZ F;  1IN4 A;  4S04 A;  2LDU A;  3VWB A;  3QWL A;  4YIR X;  3GX4 X;  2R93 J;  1OCT C;  3TDZ C;  3PUF A;  3HDD A;  1MDM B;  4RS8 A;  2BW3 A;  2X9D A;  4A3C J;  2J5O A;  3KET A;  5FKN A;  4D5F A;  5M3M J;  5KAI C;  9ANT A;  1QZY A;  1JKR C;  1TQM A;  3IV5 A;  2HXI A;  3HUG A;  2OCE A;  4YG2 F;  2WC2 A;  1MIJ A;  3KZY A;  5ILS A;  5K7Z A;  1WH7 A;  3QPH A;  5LFA A;  1YX3 A;  3MWM A;  1MND A;  5EF6 A;  4MTE A;  3I4M J;  2A6H F;  1K79 A;  2XHK A;  1YIO A;  2O8K A;  1DP3 A;  4YRV A;  1STZ A;  4WX9 A;  3CMA I;  4LLL A;  4G8X A;  1WCM J;  3JRA A;  1HXD A;  4LOC A;  1IRF A;  3IKT A;  3G73 A;  4GXO A;  1XB4 A;  2DCE A;  2ZNY A;  3H3U A;  2OC6 A;  3BPX A;  1GT0 C;  3S15 J;  2ZC2 A;  3S32 A;  3EUH C;  2D5V A;  2FBH A;  1LJ9 A;  5FKK A;  2UXN A;  3SQN A;  4CH7 A;  4HST A;  2Z16 A;  3ZN1 A;  2VBW A;  1MSE C;  2EFN A;  3DCF A;  3I4P A;  2R5Y A;  1S9H A;  4B3A A;  2WB1 A;  1BR2 A;  3REO A;  4A6E A;  1DGR M;  3HUG B;  5JR3 A;  3OL4 A;  2OD5 A;  2D2W A;  5FLX Z;  1S7O A;  3WOD F;  1MBH A;  3B6A A;  3IWZ A;  3EUK L;  4IQ4 A;  1AHD P;  3GTO J;  3NAU A;  3ONQ A;  4ZDL A;  5FLM J;  2HYF A;  1IZ1 A;  3W2A A;  3ZMT A;  4UVC A;  4MQV A;  2F5F A;  2ZB9 A;  3QOE A;  4MTD A;  2M7A A;  2H6B A;  5FFX A;  4EM2 A;  2NXN B;  4ESF A;  2W00 A;  1WRJ A;  1VQ9 I;  1OCO H;  2ISZ A;  3FM3 A;  1YI2 I;  4PGH A;  1TTY A;  1G4D A;  2MW8 A;  1I1G A;  3K9T A;  4RAY A;  1LFB A;  3CMY A;  2PJR A;  3O3K A;  5E79 C;  1ETW A;  1TZL A;  4RMN A;  5LBQ A;  3VYT B;  1Y1V J;  1X3W B;  2LOO A;  2Q1Z B;  4BEH A;  1OCP A;  3KZZ A;  2VE9 A;  4U0V A;  1OPC A;  1R7J A;  4XBF A;  4QIW N;  3F21 A;  1VF9 A;  5M3F J;  4PDK A;  4F93 B;  3ZN0 A;  3G6E I;  2TCT A;  1MBG A;  3LSG A;  3BG3 A;  3A02 A;  4CSW A;  1MZB A;  1KU7 A;  5JVG F;  2QSH X;  4JOM A;  4NB5 A;  1G6N A;  1JJ6 C;  1TC3 C;  4XNF A;  3ASN H;  3PFI A;  2LP0 A;  1ITY A;  1MGT A;  1BM9 A;  1Y1W J;  2RV8 A;  2UWM A;  1FOW A;  2Q8K A;  2QKM B;  3FXK A;  2DO7 A;  4ANJ A;  2FOW A;  1J2X A;  4CCO A;  1P92 A;  5LGN A;  3RZD J;  2DA5 A;  2W25 A;  2IEK A;  1EH6 A;  2F48 A;  2PJR B;  1TT5 B;  2P6T A;  5J1R A;  4HLY A;  2E7W A;  3E5Q A;  4E70 A;  2E1M C;  2BY2 A;  2JA2 A;  3SDB A;  1DU6 A;  2JWT A;  1WJE A;  4D0P A;  1FC3 A;  3HRS A;  2X6O A;  3TOB A;  1BC8 C;  1XMX A;  3D0S A;  2R7F A;  4AID A;  3HTU A;  2LR8 A;  2R4G A;  2CRG A;  2DK8 A;  1TLH B;  3K4K A;  2ADU A;  4B44 A;  4EGZ A;  1UMQ A;  4IHT A;  2GOM A;  2COB A;  4H4K C;  5B1B H;  4HPQ A;  5EGO A;  2ID3 A;  4S0H B;  4DW6 A;  2OF7 A;  4IO9 F;  2IS1 A;  4KT6 A;  4BH9 A;  4IKF A;  4PCQ A;  1F36 A;  2X48 A;  4M6X A;  1IRG A;  1QHG A;  1J7K A;  1H8A C;  4D5C A;  3LA3 A;  1PJR A;  5IOZ A;  2GAU A;  4MEY F;  3SEZ A;  3I56 I;  2KJB A;  2ELJ A;  1XSV A;  1Y8Q B;  1KQ9 A;  1K61 A;  3U1D A;  1PYV A;  1SD6 A;  5J8C A;  1WZ2 A;  1E3H A;  3H35 A;  3MAJ A;  5DCM A;  2FUG 2;  2FBI A;  2M4G A;  4I76 A;  1IDZ A;  3DQV C;  3LA2 A; 
#chains in the Genus database with same CATH homology
 2K3F A;  2NXN B;  4IOA F;  1QA6 A;  1VQ9 I;  4IOC F;  1YI2 I;  2OTL I;  2QEX I;  2ZJP F;  1S72 I;  2ZJR F;  1FOX A;  1YHQ I;  1VQ4 I;  1MMS A;  2E34 A;  3CCM I;  3CCJ I;  1VQK I;  4UY8 I;  1VQM I;  4V19 K;  1YJ9 I;  3G6E I;  1YIT I;  1VQ6 I;  3CME I;  3CCV I;  3J7Z I;  5JVG F;  1VQ5 I;  1VQL I;  3G4S I;  3CCS I;  1Y39 A;  3CCR I;  3CC4 I;  1FOW A;  1VQP I;  2QA4 I;  2FOW A;  3CCQ I;  2OTJ I;  5GAE J;  3PIO F;  5DM6 F;  3PIP F;  3CMA I;  1VQN I;  5DM7 F;  3J7Y J;  2JQ7 A;  1VQ8 I;  3CF5 F;  5GAH J;  1HC8 A;  1YJN I;  2E35 A;  1VQ7 I;  4IO9 F;  5GAD J;  3DLL F;  3CCE I;  3CC7 I;  2H8W A;  3CJT B;  3G71 I;  3CC2 I;  1YJW I;  3I56 I;  1ACI A;  3CD6 I;  3CCL I;  3CCU I;  1YIJ I;  2E36 A;  1VQO I;  3I55 I;  5GAG J;  1FOY A;  2ZJQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...