2RVCA

Solution structure of zalpha domain of goldfish zbp-containing protein kinase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
64
structure length
64
Chain Sequence
MSAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-inducible and double-stranded-dependent eIF-2kina
publication title Solution structure of the Z-DNA binding domain of PKR-like protein kinase from Carassius auratus and quantitative analyses of the intermediate complex during B-Z transition.
pubmed doi rcsb
source organism Carassius auratus
molecule tags Dna binding protein
total genus 24
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rvcA00
2L4MA 4I09A 4HW0A 2L01A 2BEOA 2HZTA 4IRHA 2HWVA 3R4KA 1FBQA 5CVVA 4U0YA 3K1MA 3KP3A 2L4AA 4EM0B 4GCVA 1UB9A 2KIFA 4XLPF 1D5VA 3V7SA 3E6MA 4U88A 1G3WA 1RIOH 4L9VA 3ABTA 4G6QA 1XD7A 1X3UA 2W57A 1TQIA 2HS5A 1FYLA 2O3FA 1DPRA 3RPQA 4EJWA 2KIUA 4K2EA 3JSOA 1FNNA 3QP6A 2VXZA 3R6SA 2RC4A 5HDKA 2EFWA 3RYPA 4NB5A 4M9XA 2RQPA 3LQRA 2FE3A 3JTGA 1WKMA 2K7LA 4AWXB 5K1YA 3HTSB 4HDUA 3FXRA 5AIPA 5D5WB 3IRQA 4G7ZF 1J0RA 4ZYDA 2NYXA 1Z91A 2CGPA 2HKXA 3E6DA 2QQ9A 3EDPA 4IF4A 1S8NA 1FOKA 1I5ZA 1IZ1A 1IW7F 5AIQA 5FFXA 2MC3A 1D3YA 4MTDA 4YIIA 1O3QA 5IT9K 2DPUA 1HW1A 1YS6A 5LRRA 2OD5A 3FM5A 1J5YA 4O5VA 3RYRA 3HHHA 1U2WA 1G3SA 1ZYRF 4R8HA 4A0XA 3EYIA 3WE3A 1YIOA 1SD6A 3PQKA 2O61A 2QYOA 3E5XA 2GXBA 2DW4A 2GZWA 3GZ5A 1LB2A 3RJPA 3GX4X 1OR7A 4KN7X 1U6GA 1B6AA 2R7FA 4L5IA 4M6YA 4A12A 1W7PB 2XV4S 4LD5A 1MZBA 2L3DA 1TNTA 3L2CA 2VBXA 4L18B 3RKXA 2RDPA 5EEGA 3FMSA 4WF2A 1G3TA 3K0LA 4CGZA 1ULYA 5L3EA 3EQLF 3TQNA 2XKPA 5E17F 1GXPA 3HSEA 1DPUA 4AIHA 1SFUA 4YIFA 3FWEA 4LG0A 3WTTC 1LDKB 5FFZA 1T0FA 4AVPA 4RB1A 2A69F 1BOAA 1J59A 1W7PD 4L0YB 3FM3A 4HV6A 4ENNA 2LNBA 3ZN0A 1DDNA 5LEJA 2R3SA 1D8JA 1B4AA 4I2OA 1SD5A 2EV0A 3ZMZA 1K78A 5K5RA 1S6LA 2H94A 1KGSA 2EB7A 3TKYA 2ZBKA 4WCGA 2O6GE 4I0AA 1CF7B 2GWRA 3HRMA 3FXUA 3FF5A 3GF2A 2DLLA 1HKTA 2IJLA 1BI3A 1ZGAA 3D5LA 4MTEA 4BHCA 4U7DA 4ESBA 3FXQA 2G9WA 4G6DA 2ZFWA 2D1VA 2XAGA 5KK1A 2P6TA 1R36A 2Q2EA 3ULQB 4OU0A 1FLIA 3NQOA 2IA1A 3KP2A 2EA4A 5D4SA 1HW2A 3ZQ7A 5CVJA 4EQQA 1QO0D 1IRFA 1HXDA 2XUBA 1IXRC 2NNYA 2OZ6A 1B59A 4UHTA 3F8FA 3KP5A 4HDVA 1P4WA 2WWYA 4EM1A 3TOBA 1S7OA 3FX3A 3WGGA 3TDZC 3WODF 3MZHA 2Z5UA 4UVBA 3JTHA 5BMZA 4EMSA 4A0YA 5ERIA 4RGSA 2FEZA 2ADUA 4Q48A 2FNPA 1HW5A 1XGMA 1S3JA 3E3VA 1J7KA 3ABUA 2BYVE 3S2WA 3MAJA 2A6HF 2CWEA 3W6JB 1PP8F 3CO7C 1IAWA 1T39A 1XSDA 3T8RA 2QBYB 2P5VA 1B9NA 1T38A 1J9IA 4ENMA 2RNJA 2M45A 5HS8A 3WTWC 5CLSA 5HDGA 1ZG1A 3CDHA 3F8BA 2XAFA 1O7LA 1J75A 3P9CA 3RKWA 3SXYA 2QUFA 5DCMA 2K4JA 4YG2F 2ISZA 3DP7A 4HZFA 5FLXK 4L0ZB 2R7DA 4MHGA 3MWMA 3BOQA 1AOYA 1FWZA 5D8KB 2NRAC 1FSEA 2ETHA 4KICA 1SFEA 3GLXA 1XB4A 5JR3A 1XCVA 3KETA 2ZXJA 3FHZA 1B1BA 2AXLA 2LF8A 4BHPA 2JRTA 3GXOA 4HOBA 2VN2A 4U0VA 2OZUA 3GFMA 4P9FA 1YLFA 1TLHB 2DI3A 3C18A 1KA8A 4HLYA 1KU7A 4UNOA 1KYWA 1R58A 3LAJA 2LF7A 3EETA 4P5OA 4Y15A 2PN6A 4XRFA 1HSJA 2NS0A 5HLHA 5HS7A 5HDNA 5LRSA 1A04A 2V1DA 3QOPA 1Z7UA 3H3UA 2H09A 3WTVC 1XMKA 1FBSA 2FBHA 2MH2A 4EM2A 3H3ZA 4N0BA 4GYIA 2CYYA 2Q0OA 3K9TA 1CGPA 1XMAA 1FT9A 2OQGA 4QLCU 3K69A 4IHTA 5L3CA 3CUQB 3J80Z 2F5CA 5L3FA 2V1XA 3M1EA 3HUGA 2HFHA 4AIKA 1P2FA 4UVCA 2E7XA 5E1ZB 1BI0A 3VODA 3BPVA 1DUXC 3LA7A 1TTYA 1PP7U 2YU3A 3B02A 1BIBA 3GFLA 3ISPA 4I02A 5ILUA 3HRSA 4M6XA 2ZCWA 4HF1A 3T5XA 2GA2A 2Z99A 4Y13A 1T2KA 1RI7A 3MEXA 3TO7A 2HTJA 2P7VB 2ESHA 1JE8A 3LWFA 1KU2A 2HQRA 5L3BA 1FY7A 2D45A 2CG4A 3TOAA 3F3XA 2IT0A 4ZH4F 1G4DA 3LA3A 1BC7C 3RPUA 1LVAA 5E20A 1OKRA 3LSTA 1RUOA 1ZRDA 1R1VA 1WRJA 5FD5A 4PGHA 1QZYA 4CXFA 3QU6A 2OAZA 1IN4A 5FLXZ 3RDIA 3CUOA 3R61A 5F6FA 2PMUA 4KT5C 5D5UB 4Q5SF 3JW4A 3JSPA 1IF1A 1XGNA 2RGVA 2V6CA 5CVUA 4FX0A 1T6SA 2CW0F 1QZZA 4KNYA 2STTA 2MLKA 1W5TA 4LLGF 3WTSC 2O03A 5DDGA 2CSOA 3U1DA 3TO6A 2XAQA 2A6EF 4GYGA 2EJRA 1Z1DA 1G3YA 1U5TC 3FMRA 1J2XA 4A6EA 4IRIA 1FBUA 2PI0A 3CJNA 4EJOA 2VE9A 3MZYA 5BPIA 4A6DA 3VB2A 1BC8C 2CO5A 2PEXA 4ENJA 2PG4A 3BY6A 4FT8A 2QM3A 2ZNZA 4G8XA 4HF0A 3J81Z 1LDJA 5DV5A 2ISYA 3I64A 2V79A 3IKTA 1UHWA 2JPCA 4L9JA 1JHFA 2FA5A 1R22A 2J5OA 1MGTA 4HA8A 2AS5F 3WGIA 1IN7A 2FSWA 2DQLA 2MLGA 3DEUA 4IPAA 4GO1A 5D5XB 3HHGA 1S29A 4CDGA 4I98B 1R5GA 1ZLKA 1QPMA 3F8MA 4BYYA 3G3ZA 4MQ9F 3NRVA 2ACJA 4WXDA 1Z05A 2UXNA 1FZPB 5K5OA 2G7HA 2A61A 1U5TB 5D6FA 3P9KA 1WQ2A 1XGOA 5D8LB 3I59B 1S7AA 5J8CA 4IVNA 1TQPA 2OA4A 1W4MA 2A3SA 4A2UA 4LK0F 2YX7A 3C3WA 2BE5F 2RVCA 1K79A 3E5UA 2XAHA 4XBFA 2ZMEB 1F9NA 5CVIA 2PJPA 2W85A 4R1HA 1B9MA 5LHGA 3E97A 2PFBA 2MA3A 3IC7A 3ZMTA 5DCFA 2IRFG 1MKMA 2P5KA 3I58A 3TGNA 5LHHA 4EV0A 2HYFA 3ZPLA 1H9GA 5DD8A 2Y75A 2QLZA 1ZAOA 2MD5A 1P4XA 1REPC 5HOOA 4M9SA 4N9HA 2ELHA 5LHIA 4ESFA 4M73A 1NHAA 1TW3A 3KFWX 1SD7A 3F6VA 3KP7A 4MGRA 2X0LA 1LDDA 5AONA 1UCRA 3M7GA 4CZZA 2M30A 3CUQA 3HOSA 2NAZA 2FF4A 1W5SA 3V7CA 2A07F 3V8KA 1EH7A 5L3DA 5E8IA 2VT2A 4BHBA 4EGYA 3RIRA 3GFIA 1OYYA 4EJUA 2M87A 4IHSA 4LJZF 4QWQA 3BZ6A 5ICGA 1MDMB 5LGTA 5ED4A 4DQ2A 3PFIA 3HSRA 1KQ8A 2A5YB 4UXNA 5ICEA 3L00A 3KLOA 4L9TA 1U78A 4KDPA 3GEZA 2YPRA 5FB2A 3DKWA 2RN7A 1F4KA 2M1BA 5E8GA 1MJAA 4B8XA 1LQ1A 5LGNA 3OOPA 4L9NA 4EJVA 2YX4A 2W24A 4UVAA 4EGZA 3O6BB 1VTNC 1QNTA 4OIPF 1V3FA 3J80K 3WG9A 4P55A 4JK1X 2D1HA 4RAZA 4BAYA 4P9UA 1EV7A 4HAMA 4M72A 2QQAA 3WE2A 5DD4A 1KQ0A 2FOKA 5E1XA 4A5NA 3IWZA 4HLXA 3COAC 2H6BA 1KU3A 2MH9A 1OYIA 2YSRA 2JZYA 1U8RA 3F6OA 2G7UA 4I01A 3H92A 3GW2A 5FD6A 3LAPA 5LEKA 3IL2A 3E6BA 3P7NA 3E5QA 3SFZA 3HSFA 2DTRA 4P96A 3CO6C 1FPQA 1ZH5A 2D2WA 3ZN1A 4B09A 2FNAA 1F1ZA 3I54A 3L9FA 2FQ3A 4KIFA 3GZ6A 5LGUA 2Z3YA 3GYHX 1R1UA 3PQJA 2DK8A 1FYMA 4RB3C 3WU1B 4G7HF 3BP8A 2O8XA 2VT3A 4IXAA 1YYVA 2KIMA 1YW9A 3KCCA 4MEXF 5TRDA 5JI6A 4OIRF 1GXQA 2YR2A 2X4HA 2DK5A 3DF8A 2NNNA 2HKOA 1FYKA 2DU9A 4EVIA 3V7RA 1PUEE 4M71A 4U7BA 4PCQA 3ZMDA 2UZKA 2J5PA 3FZVA 4WXCA 2P4WA 2JSCA 4DNCA 4PDKA 5D5VB 3U9GA 4YFKF 5DEQA 2F2EA 3Q9SA 1XSVA 3LFKA 4RS8A 1IN6A 5ICCA 4Z2YA 2ZMEA 5J8FA 1W7PA 3F72A 3J81K 3WTYC 3HRUA 2W84A 5ICFA 4LGWA 3HYIA 5BS6A 2E7WA 3QRFF 4RGRA 4CYDA 4M9ZA 3BJAA 5DUKA 1HKSA 1UHMA 2PBIA 3ROUA 4HX4A 4L5JA 2ZJ2A 4KMFA 3KP4A 4MQVA 3RI4A 1O3RA 5D4RA 3ECOA 1TQMA 4HV5A 4HF2A 4ZYHA 5JHUA 5J6XA 2VODA 2O0YA 1QQIA 4AIJA 4XLNF 5DUIA 2FRHA 1FC3A 4WXHA 1QBJA 1IN8A 1U3EM 1USSA 1ZG5A 2H27A 1R5HA 3I53A 3SZPA 5HLIA 1KU9A 1L0OC 1K78B 4XSZF 2VOPA 1K6OA 2P7CB 2KJBA 4KN4X 1ZLJA 2EFPA 1CF7A 3ML6A 2L02A 1SD4A 3F22A 1I6XA 3M8EA 1F5TA 3WTUC 1LEBA 1ZN2A 2P6SA 2H6CA 4Q47A 1Z6RA 2F5FA 1PDNC 1O7FA 2XVCA 2DBBA 2PMHA 1E17A 3O2PE 4WK8F 1JHHA 2LDUA 1OMIA 4GGGA 1YFHA 4OMZA 3J7AO 2RKHA 3AAFA 4MNUA 1E2XA 3V8JA 1FSHA 3R0JA 2VONA 2HDCA 3F23A 2V9VA 1BIAA 1TW2A 3GWZA 4KFCA 1P6RA 5BOXA 1Z6TA 3C7JA 4N9IA 3ZMVA 3T8TA 4HQEA 4BXUA 2QENA 1YQAA 4F7ZA 4RGUA 4WWCA 3QPHA 3R60A 2FXAA 4LB5A 3I4PA 5DYMA 4LMYA 2BV6A 4JBAA 4RB2C 4MEYF 5F1RA 3VEPA 3K2ZA 4R79A 2HYGD 1JGSA 3WU0A 4PGGA 1BN5A 3W6KB 5CYVA 2QBYA 3QU3A 5H20A 5BQTA 4BH9A 1OPCA 3WTXC 4U0WA 4ZYEA 4KIGA 4KYWA 2HOEA 4GXOA 2F5EA 3VOEA 3ZMUA 4E70A 1DP7P 2VOOA 5DCMB 4OIOF 2KKOA 1R7JA 1YS7A 2IPQX 3K1NA 4M74A 4RAYA 1LJ9A 3BROA 2IW5A 2VC1A 3SQNA 4H0EA 1O3TA 5KVRA 3L09A 4KIBA 4JQFA 1XGSA 2W25A 1KQ9A 4G94A 3KEOA 5IT3A 3ZP5A 2CFXA 1ON2A 2OBPA 2ESNA 3I71A 2Y0MA 3IRRA 4ASNA 1D8KA 2TDXA 1BM9A 2P5LC 2KJCA 1R00A 4OINF 4OMYA 2MBFA 2E1NA 3GO5A 2ZO4A 3JAMK 2XASA 4RB0A 1MJ9A 3KZYA 1ZREA 1STZA 1R1TA 1YTYA 2GQQA 3CLOA 4NHJA 2EFNA 2EWNA 2JPBA 4ETSA 3CTAA 3N4MA 6PAXA 2FBIA 2ZKZA 5HS9A 1ZARA 2GXGA 1ZG3A 4I7HA 1G6NA 2EK5A 4O3MA 3LQQA 5E1WA 1HQCA 1I1GA 5CJ9A 5H6QA 4TV7A 2HEOA 3HIFA 3EUHA 3TO9A 3BJ6A 2EA2A 4ENKA 1V4RA 2JT1A 2LKPA 3ELKA 4IRGA 1AWCA 2DO7A 1H9TA 1RZ4A 4CO8A 5CVRA 1YO5C 1FX7A 3K1PA 1XDSA 3RKYA 4FX4A 2GIVA 2P8TA 4XSXF 2V1UA 4HX8A 1YW7A 4UV8A 3DPLC 3ZMSA 2Z33A 2K27A 1IRGA 2IVMA 1OYWA 3WTZA 2HR3A 1USTA 1WI9A 3LA2A 5L3GA 4ZZLA 4OOIA 4YFXF 2VBZA 4LK1F 2A68F 4BNCA 1JXSA 2FU4A 4G7OF 1Y0UA 4HQMA 3BWGA 4KMUX 1K7AA 3F21A 1IUYA 3MQ0A 5E18F 3BJOA 4S04A 4S05A 3T0YA 2EFOA 1ON1A 2K4BA 5A2QK 1MJBA 1FP1D 1ONVA 1XN7A 4O6JA 4LFUA 1IXSB 5FO5A 4A0ZA 2OQRA 3VFZA 5IT9Z 1H0MA 3KP6A 3QPTA 2EV6A 2XGXA 2VC0A 2BBYA 2VE8A 2FMLA 2QQBA 2DQRA 2EV5A 3IKVA 3HRTA 3EYYA 3T1BA 2IP2A 3M9AA 3JAMZ 4ON0A 3TDUC 2B0LA 3SZTA 3O3KA 4CHUA 3F8CA 2Z9OA 1EH6A 2K86A 2DAOA 3Q9VA 3MCZA 2VBYA 2FBKA 1SAXA 1XCBA 4UV9A 2WTEA 2QVOA 2FMYA 4EJTA 3BDDA 1ZGJA 2PLYA 2HTSA 1LNWA 3G73A 2L54A 1WWXA 4IJAA 3IHUA 2F5DA 1BBYA 2GAUA 2XIGA 2CQKA 1I1SA 4G9YA 5BPDA 1O3SA 3GVAA 3BPXA 1BI2A 1YG2A 3U2RA 1SFXA 2PQ8A 2E1CA 4WX9A 1KYZA 3P9IA 3DPTA 1SMYF 3E6CC 1ZRFA 1BI1A 3OV8A 1HKQA 3RTRA 3KE2A 3IWFA 2XAJA 3NEUA 1U5TA 4YFNF 1IXCA 3KZZA 4D0PA 4I0BA 1RUNA 3CUQC 3I59A 5H6RA 1P4AA 4LB6B 4RGXA 5TJJA 2XRNA 2HGCA 1Q1HA 1TBXA 1R23A 3HTUA 3REOA 3DXJF 4UUVA 2WV0A 2RV8A 3ECHA 2K02A 2Y48A 1HSTA 5D6EA 2STWA 1BJAA 1O57A 4ZYGA 1GHCA 3DFGA 5K5QA 1UFMA 4Q4ZF 4HYEA 3KLNA 4LLLA 5HVQC 3QP5A 3QAHA 2OU2A 2WC2A 2IA2A 2M8EA 2QZ8A 4NQWA 5LBQA 4KA4A 2QWWA 2Q8KA 5A2QZ 3KEQA 1I27A 3L7WA 2DT5A 1WSUA 3B73A 3D0SA 1RNLA 4LG0B 2KRFA 2M5WA 2XHKA 5JVTA 2COMA 3WGHA 3N97A 4A5MA 1P92A 3DQVC 1EH8A 3DV8A 1YW8A 2HQNA 2IA0A 3I0TA 4PZJA 3I5UA 1TNSA 3V8LA 2GA1A 4CICA 3MFKA 4KUMA 1T98A 1SMTA 5LLQA 1FP2A 1IN5A 4HX7A 4Y17A 1XDUA 2VBWA 2BGCA 2DFIA 1QGPA 2XKOA 1MDMA 1ZHFA 3V4GA 5FGMA 2DPDA 3F8NA 1Z9CA 2JTVA 2UXXA 5EEHA 1XSXA 3Q5FA 5HLGA 2ZNYA 1HBXG 5ILSA 3C1DA 1MD0A 2C6YA 2LSOA 4ZZDA 2EFQA 3GFJA 2XROA 1L3LA 4OIQF 2UWMA 1C0WA 4FHTA 4ESJA 4LLNA 5JFRA 1ODDA 4HBLA 4BQAA 1GVJA 3R0AA 1LEAA 3GUDA 3SHFA 3HOTA 3FMQA 1ZRCA 3ERED 3M8FA 5F64A 5ILVA 4AD9A
chains in the Genus database with same CATH superfamily
2L4MA 2F4IA 2LP0A 4G6TB 1HF0A 2XPWA 2CS3A 4I09A 3ZQGA 2E1MB 2X1DA 4HW0A 2L01A 3RSNA 2BEOA 1ZQ3P 2HZTA 2HQ5A 4IRHA 2HWVA 3R4KA 1FBQA 5CVVA 4U0YA 2LVSA 4DYRA 5EJCA 3UNGC 2LOOA 4M3DA 3K1MA 3KP3A 2DJIA 1FTZA 1EKEA 2L4AA 4EM0B 4GCVA 3S14J 1UB9A 1IG7A 2KIFA 4XLPF 1D5VA 4BU2A 3HBLA 2BVLA 3PIOF 1POGA 2DFEA 3V7SA 3E6MA 4U88A 1G3WA 1RIOH 4L9VA 3ABTA 2K3FA 3IH2A 1XD7A 4G6QA 2LY2A 1X3UA 3ABLH 2W57A 1TQIA 2XGDA 3ASOH 2OTLI 2WA0A 4E7IA 2X6XA 3OYMA 2HS5A 1FYLA 2O3FA 1DPRA 3DKXA 5IY5H 4YIRX 2F48A 1MH3A 3RPQA 4RLFA 5TISC 2IEKA 4EJWA 3OYLA 1JKRC 2KIUA 1PUFA 3S8PA 4K2EA 3JSOA 3IH3A 1FNNA 3DBLB 2XF7A 2VXZA 3QP6A 3K4JA 3R6SA 3KEYA 1VQPI 2RC4A 5HDKA 3BTCA 2EFWA 3RYPA 3GTGJ 2JA6J 1U8BA 1OCRH 4NB5A 2M4KA 2ECCA 4M9XA 1GV2A 2VUMJ 3HOZJ 2RQPA 3LQRA 4BDYA 2FE3A 4JX6A 3JTGA 4XLAA 1WKMA 2K7LA 2L7KA 2ZMEC 4AWXB 4DYCA 1M1EB 5K1YA 3HTSB 4HDUA 3FXRA 5AIPA 5D5WB 1X2MA 2OCEA 3L2RA 2E71A 3IRQA 4G7ZF 1J0RA 3ZQCA 2BY3A 4PJ0C 1X1DA 2KT0A 2NYXA 4ZYDA 1WI3A 4B3XA 1Z91A 1OCTC 2HKXA 2LY9A 2CGPA 3E6DA 2QQ9A 3EDPA 3G2BA 1S8NA 4IF4A 1FOKA 1I5ZA 3JRCA 1IZ1A 2BVMA 2E60A 3HPHA 1IW7F 5EDNA 4BBSJ 1QHGA 5AIQA 1TP4A 4A3KJ 5FFXA 2MC3A 4C30A 1IDYA 1D3YA 3E0JB 4MTDA 2HU9A 1U9OA 3A02A 4XKVA 4YIIA 3ESWB 5KAFC 1RKTA 2HZDA 1O3QA 3A2KA 3M4OJ 5IT9K 4F55A 2DPUA 1HW1A 1K4TA 1YS6A 3DWLE 1Z3XA 5LRRA 5J3LA 2XGCA 2OD5A 1WHUA 3FXJA 5JLWA 3FM5A 2WY8Q 1J5YA 4O5VA 3RYRA 1GDTA 3HHHA 1U2WA 1G3SA 3S1RJ 1ZYRF 5GTIC 4R8HA 1Z7LA 2RQQA 4A3LJ 3TP3A 4A0XA 1FJLA 3EYIA 2DYRH 2HOTA 4NNJA 3WE3A 4IHVA 2F4OB 3AFHA 2I5UA 1YIOA 3FK7A 3VYUB 1SD6A 3CMMA 2DMUA 3PQKA 2E1OA 3CCSI 3LSMA 1VQKI 1TWGJ 1UAAA 2O61A 3EUAA 5F0HA 2H8WA 2B63J 2QYOA 2WB1A 3QWLA 3E5XA 5KNLA 2GXBA 2DW4A 1YIJI 2GZWA 1VQ6I 3GZ5A 3S32A 5IYDJ 1LB2A 3RJPA 1T56A 1ETWA 2XF5A 3HJEA 3GX4X 3S1MJ 1QRYA 5C4XJ 1OR7A 2M34A 2Y2ZA 2XPVA 4KN7X 1U6GA 1B6AA 2R7FA 4L5IA 4M6YA 4A12A 2Z16A 1W7PB 3H9GA 2JK3A 3QYFA 2XV4S 1SVOA 4LD5A 4UUTA 1MZBA 2L3DA 2HDDA 1TNTA 3PNTA 3L2CA 2VBXA 4L18B 3RKXA 5FJ8J 2RDPA 5EEGA 3PO2J 2DA5A 1DGRM 1QVTA 3F9KA 2LKXA 1PVEA 3FMSA 4I6ZA 3SFIA 2V9KA 3MD2A 2JSPA 4N4OB 4WF2A 1G3TA 3K0LA 1YRNA 4CGZA 1ULYA 2GIZA 5L3EA 3EQLF 4XKCA 1LVKA 3TQNA 2XKPA 5E17F 2JA7J 3S2DJ 1GXPA 1CQTA 3HSEA 1S72I 4MFDA 1JUPA 5K7ZA 1DPUA 4KJZA 3S17J 2VL8A 4AIHA 1SFUA 4YIFA 3FWEA 4XRSA 3BQZA 4CCJA 2Z1DA 4LG0A 3WTTC 1LDKB 5FKOA 3G1OA 5FFZA 1T0FA 4AVPA 3HPGA 4RB1A 2A69F 1BOAA 1J59A 1W7PD 4L0YB 4D7NA 2R5ZB 3FM3A 4HV6A 4ENNA 2VIXA 1YJWI 2HQAA 4XM3A 1IC8A 1MBEA 2LNBA 2E34A 3ZN0A 1DDNA 5LEJA 3W2VA 2R3SA 2K9QA 3I56I 3RKQA 1D8JA 1F43A 4M3FA 1B4AA 4CH7A 1P7IA 2BY2A 4I2OA 1SD5A 5M3MJ 2ZSHB 3GCMA 1JGGA 4BY7J 2QSFX 3JRGA 2EV0A 4XRSG 3ZMZA 2UUZA 4PJLA 1S6LA 5K5RA 2H94A 2OC6A 1KGSA 1ZR2A 1K78A 2X1EA 1X4PA 3NWTA 1X2NA 2EB7A 2I8DA 3TKYA 2ZBKA 3BR3A 1G8XA 4WCGA 1R4MB 3K6GA 3H9QA 2O6GE 4I0AA 1CF7B 2GWRA 3GMEA 3HRMA 3FXUA 3FF5A 3GF2A 2KMUA 2H1LA 2DLLA 1HKTA 4XN3A 2IJLA 3FBNB 3HOWJ 2K9SA 1F36A 3FBIB 3BG7A 1BI3A 1ZGAA 3D5LA 4BEHB 3PL8A 4MTEA 4BHCA 4U7DA 4ESBA 3FXQA 2KLOA 1LFBA 2WV1A 2G9WA 4G6DA 1FOXA 3IP4B 2O9LA 2ZFWA 2Y31A 2D1VA 5HNHA 2NOJB 2XAGA 5EG0B 5KK1A 4IOCF 2P6TA 4CYCA 1R36A 1MNEA 2Q2EA 3ULQB 4IQ4A 4OU0A 1FLIA 3NQOA 2IA1A 3I4NJ 3KP2A 2EA4A 1HC8A 5D4SA 1LE8B 1HW2A 3ZQ7A 2HVRA 5CVJA 1BR1A 4EQQA 5DTDA 3OMYA 1QO0D 1IRFA 1HXDA 1UELB 4QPOA 3JCUC 2XUBA 1IXRC 2NNYA 2OZ6A 1B59A 4UHTA 2VJ4A 3F8FA 2JRMA 3KP5A 3QYBA 4HDVA 2R92J 1P4WA 5C3EJ 4BE0A 2WWYA 2W1OA 4EM1A 2WAQA 1SANA 3AG3H 3BTJA 3TOBA 2EBIA 1S7OA 3H9JA 3FX3A 3K4CA 4UUSA 3WGGA 2LK2A 3TDZC 4OWRB 4D1QA 3LNQA 1I3QJ 1ENHA 3WODF 3MZHA 4LIUA 2Z5UA 4UVBA 3CF5F 3JTHA 5BMZA 4EMSA 3RQIA 4A0YA 5ERIA 1R6RA 2EIKH 4RGSA 3M07A 2FEZA 2KPMA 2ADUA 4Q48A 3DTEA 2CQQA 1ZK8A 4QIWN 2FNPA 4BS9A 4J01A 1P9QC 2L9RA 2A05A 4P1WA 1ZELA 1HW5A 1XGMA 1S3JA 2COBA 1J7KA 2Y69H 3E3VA 3ABUA 2BYVE 3L2QA 3S2WA 3JRAA 3MAJA 2A6HF 2CWEA 3I3LA 1EA3A 3W6JB 1PP8F 3CO7C 1IAWA 1T39A 3RZDJ 2OF7A 1XSDA 3T8RA 3J7AY 2BW3B 2QBYB 2P5VA 3BC8A 2Y9YA 2IS1A 1B9NA 1T38A 1J9IA 2K3PA 4ENMA 2RNJA 1X1PA 1X58A 2M45A 1ZKGA 5HS8A 4IO9F 3WTWC 5CLSA 1VQMI 5HDGA 4IEJA 3UKGA 3S3OA 4Y33A 1ZG1A 4I99C 4FASD 3CDHA 1GVDA 3F8BA 2XAFA 1O7LA 3K4MA 4XQFA 1J75A 4BXFA 3P9CA 3RKWA 1HLVA 4E7JA 2LD5A 3SXYA 2QUFA 3BCBA 3H3VK 5DCMA 3TMOA 2K4JA 4YG2F 3ZOBA 2ISZA 2MG4A 5BNGA 3DP7A 1LKXA 2LBFA 4HZFA 1VQ8I 1X19A 4UY8I 1BJZA 5FLXK 4L0ZB 2R7DA 4MHGA 3G4SI 3MWMA 3BOQA 1AOYA 4M3GA 5FRMA 4C2MJ 1FWZA 4YRVA 3MVPA 5D8KB 2HPIA 2NRAC 1FSEA 4BE1A 4PJJA 2ETHA 4KICA 2ZXHA 1SFEA 3EUHC 2B7EA 2AXTC 3GLXA 1XB4A 1IRZA 5JR3A 1U9NA 1XCVA 3KETA 2ZXJA 3FHZA 1B1BA 2AXLA 3LSIA 2LF8A 4BHPA 1D1CA 2NVTJ 1YX5A 2JRTA 3GXOA 4HOBA 2VN2A 4U0VA 3VYSB 3K4LA 4BL0B 2F6CA 1X1BA 2OZUA 3GFMA 3SDBA 4P9FA 1IV8A 1YLFA 1TLHB 2DI3A 3C18A 1KA8A 5LD2C 4HLYA 1KU7A 3D5RC 4UNOA 1IDZA 1KYWA 1R58A 3LAJA 2LF7A 4IZZA 3HB9A 1TT5B 3EETA 3OS2A 5IOZA 4P5OA 4Y15A 4DGWB 2PN6A 5FKKA 4XRFA 2MSYA 1HSJA 2NS0A 4C2TA 5C4JJ 5HLHA 1DP3A 1DQUA 2M9HA 3OL4A 5HS7A 4Y52J 4KITB 5HDNA 5LRSA 1A04A 2QCOA 2V1DA 2ZJQF 2DA1A 3QOPA 1Z7UA 2ZC2A 1RESA 3OIOA 3H3UA 3O8GA 1AU7A 2H09A 5EZHA 3WTVC 2KISA 1XMKA 2R93J 3K2AA 1KONA 1JJ8C 4CSWA 1FBSA 2FBHA 3BR5A 3K4BA 4XIDA 4FQGA 3A01B 2MH2A 4EM2A 3H3ZA 4N0BA 3BLYA 4GYIA 2CYYA 2Q0OA 4E7KA 1ACIA 3K9TA 1CGPA 1XMAA 2JQ7A 3OYFA 1FT9A 2VQHA 2OQGA 4QLCU 5IPAA 3K69A 4IHTA 3PNVA 1HOMA 1NK2P 2ID6A 4V2FA 3SEZA 5GTHC 4PK4A 1R5ID 3HKZN 1SAUA 2V26A 5L3CA 3DTKA 2M0CA 3CUQB 4XORA 3J80Z 2F5CA 1TWHJ 3AG1H 5L3FA 4CUGA 1AHDP 2V1XA 3S1NJ 1Z3YA 3M1EA 2M2EA 3GTJJ 2Y30A 4ZDPA 2G0EA 2HFHA 2NXNB 3HUGA 3DLAA 4AIKA 2UV1A 2R5ZA 4GDFA 4XLHA 1P2FA 2KDOA 4UVCA 2E7XA 1GLNA 4IHXA 5E1ZB 1IJWC 1BI0A 4HSTA 3BPVA 4NUBA 3VODA 2LRDA 2B9SA 1DUXC 3WG7H 3DTIA 3LA7A 4BUPA 1TTYA 5E3OA 1PP7U 1ETVA 2YU3A 2LMDA 3B02A 5H2FC 1KZHA 2NS8A 1BIBA 1XTAA 3GFLA 3ISPA 4I02A 4BQQA 5ILUA 3HRSA 1Y56A 1WCMJ 4M6XA 3CCUI 4C2UA 2ZCWA 4HF1A 3T5XA 2GA2A 2Z99A 3MKWB 4Y13A 3G71I 5CKTA 3H5RA 1T2KA 4CCKA 1VF9A 1RI7A 5F08A 3MEXA 3TO7A 2HTJA 2PJRA 2P7VB 2ESHA 4DJAA 1JE8A 3LWFA 1MNDA 1KU2A 2CQ7A 1ETKA 4EEFG 3CCRI 2HQRA 5JLXA 1FY7A 5L3BA 2P81A 2D45A 3H0GJ 2JA2A 2CG4A 3TOAA 4RLQA 3F3XA 1APLC 2IT0A 1PYVA 4ZH4F 4A3MJ 3LA3A 1G4DA 1XMXA 1BC7C 3WHBA 4GRIA 3RPUA 1LVAA 3SYTA 5E20A 1OKRA 3LSTA 1RUOA 3NWSA 1ZRDA 4XICA 1R1VA 1WRJA 5FD5A 4PGHA 1QZYA 4CXFA 1TWCJ 3QU6A 4DYQA 2OAZA 1IN4A 5FLXZ 1NTCA 2EIJH 3RDIA 3CUOA 2NS7A 2R7XA 2WAFA 3CF2A 4YELA 3R61A 2BY1A 5B3SH 5F6FA 2ME0A 2PMUA 4KT5C 2OJED 1MMNA 2LG4A 1BL0A 5D5UB 4Q5SF 3JW4A 3JSPA 1IF1A 1XGNA 2IGOA 2RGVA 2V6CA 5CVUA 4FX0A 1T6SA 3Q0WA 2CW0F 1QZZA 1E0EA 4KNYA 2STTA 2MLKA 1W5TA 2WBMA 2MGQA 4LLGF 3WTSC 4PSWA 2O03A 5DDGA 1ORKA 4HNUA 2CSOA 3HOYJ 3CESA 3U1DA 2ZXWH 1MMSA 5DM7F 1BR4A 2EZHA 2XAQA 3TO6A 2A6EF 3AG4H 4GYGA 3OL3A 2M7BA 4UB8C 2E2IJ 2HOAA 2EJRA 2CUFA 4RMNA 4G12A 1Z1DA 4I76A 1G3YA 1D1AA 4QSHA 1U5TC 3FMRA 1J2XA 4XN0A 4A6EA 4IRIA 4AM3A 1FBUA 1YJ9I 2PI0A 3WU2C 4BGDA 4C3IJ 2A6TA 3CJNA 4EJOA 2VE9A 3MZYA 5BPIA 3QPLA 3C2BA 4A6DA 2QEXI 2VQGA 3VB2A 2YUSA 3BT9A 4B4CA 1PJRA 1BC8C 1ETXA 1AA7A 2CO5A 3RQ4A 2IS6A 5K7FA 4ABZA 2JA8J 2M4GA 2PEXA 4ENJA 3VSLA 2ECBA 2PG4A 3BY6A 4FT8A 5HODA 2K9LA 3JRDA 2QM3A 2DYSH 3CC7I 2ZNZA 3X2QH 4A69C 4G8XA 4HF0A 2HYJA 3PSIA 3J81Z 2Y0SN 1LDJA 5DV5A 2ISYA 3L1PA 3I64A 1J09A 2V79A 3IKTA 5EGOB 1UHWA 2JPCA 3OYCA 1B8IB 3CC4I 4L9JA 1JHFA 1OLTA 2ELKA 2F4MB 1R22A 2FA5A 3OR1C 2J5OA 4ZTJA 1MGTA 2FJ1A 2EILH 2CRGA 4FE7A 4HA8A 3WGIA 1IN7A 2AS5F 3A03A 2FSWA 2DQLA 2MLGA 3BZKA 3DEUA 4IPAA 4GO1A 1QU3A 5D5XB 3HHGA 1S29A 4B47A 4CDGA 2LKSA 4MO7A 3OYDA 4I98B 2DA7A 1R5GA 3KYLA 5GPAA 2L2OA 1ZLKA 1Y1WJ 1HA8A 2JVGA 2IGNA 1QPMA 4XKWA 3F8MA 4BYYA 3G3ZA 1YI2I 4MQ9F 4RAFA 3NRVA 4IL6C 2ACJA 4WXDA 2KZVA 1Z05A 2GOMA 2UXNA 3VSKA 1FZPB 3JREA 3H36A 5K5OA 2G7HA 2A61A 1U5TB 1W36D 4A3GJ 3ZQHA 3FISA 2D5VA 3FKJA 4HNTA 2JMWA 4BXXJ 5D6FA 2XB5A 3P9KA 2MC4A 1WQ2A 1XGOA 5D8LB 3S16J 3I59B 2HOSA 1S7AA 4DZPA 4F91B 4F92B 3S2HJ 2LREA 5J8CA 3Q0UA 4IVNA 1TQPA 2OA4A 1W4MA 1QPIA 1VI0A 2A3SA 3ONQA 4A2UA 4LK0F 2QA4I 2QSHX 2YX7A 4IQJA 1XC5A 2WADA 3C3WA 3QODA 2BE5F 2VQCA 2RVCA 4A3DJ 3VYTB 2KQRA 1K79A 3E5UA 2XAHA 4XMYA 1IGNA 4XBFA 1T95A 2ZMEB 1F9NA 5CVIA 2PJPA 2P0WA 2LTPA 4LG3A 3SEQA 2IS2A 3L2UA 2W85A 4R1HA 1B9MA 5LHGA 3E97A 2PFBA 2MA3A 1MMGA 3IC7A 3ZMTA 5DCFA 2IRFG 1MKMA 2P5KA 3LSHA 3I58A 3TGNA 4B44A 5LHHA 2QKMB 4EV0A 2QQ8A 5M5WJ 2R7QA 2HYFA 4II2A 3ZPLA 3HL2A 1H9GA 5DD8A 2Y75A 4W97A 1Y1VJ 2QLZA 4RA2A 3ASNH 1ZAOA 2MD5A 3DPUA 2YS9A 1IUFA 1P4XA 1REPC 5HOOA 4M9SA 5LFAA 1JT0A 4N9HA 3PUFA 2ELHA 5LHIA 3A01A 4ESFA 4M73A 3PFYA 1NHAA 1TW3A 1QVUA 4BDZA 3KFWX 1SD7A 2GM4A 3F6VA 3BG3A 3KP7A 3CP2A 2VKVA 4MGRA 2X0LA 1OCCH 3JR9A 1LDDA 3HXLA 1SEUA 3IAM2 2VXDA 4DBRA 5AONA 5E3MA 3HGGA 5FLMJ 2L7FP 1UCRA 3M7GA 3ZQIA 3LSGA 4CZZA 2M30A 4E7SA 3CMYA 2KRHA 3CUQA 3HOSA 1WJBA 2NAZA 2FF4A 2KP6A 1WPKA 1W5SA 1IO2A 3V7CA 2MFZA 2A07F 3V8KA 5B5EC 1D5YA 1EH7A 5L3DA 1OQYA 5E8IA 4DW6A 1B72B 1AKHB 3OS1A 2VQLA 2VT2A 4BJ6C 4AYBN 1O4XA 1EJ9A 4BHBA 4EGYA 3MZ8A 3RIRA 3GFIA 2JJ7A 1OYYA 3PUBA 1VQ5I 2X48A 4EJUA 2M87A 3OYHA 3ZRGA 4IHSA 4LJZF 4QWQA 1H89C 3BZ6A 4IKFA 1BR2A 3E1SA 5ICGA 3JRFA 2DOEA 1MDMB 5LGTA 5ED4A 4DQ2A 2V7FA 3BR1A 3PFIA 4PFOA 2DA3A 3HSRA 4RAGA 1KQ8A 3H1CA 2A5YB 4UXNA 2BHZA 5ICEA 2DMTA 3L00A 3KLOA 3KYDB 4XNFA 1V5GA 2LFBA 2XB0X 4L9TA 1U78A 2CH0A 2AO9A 2XSJC 3GEZA 2DXIA 4KDPA 1FMWA 3W2WA 2YPRA 4LIVA 5CQEA 5FB2A 3DKWA 2RN7A 1F4KA 2OTJI 2M1BA 5E8GA 1MJAA 4B8XA 1LQ1A 1OCOH 4QPQA 4AIDA 5LGNA 3OOPA 4A93J 3NARA 1WJFA 4L9NA 4BBRJ 2R0QC 1E3HA 5EEAA 4EJVA 2YX4A 4JX5A 5GADJ 1RKWA 1FEXA 2DN0A 2W24A 2XGEA 3ABMH 4UVAA 4EGZA 3O6BB 1VTNC 1ZGWA 2EH3A 1QNTA 2CV2A 2WB1N 1XPXA 1V3FA 4OIPF 3DCFA 1TT0A 4J00A 2K9NA 3PSFA 3J80K 4MFEA 3D1NI 4HRIA 1MSEC 2HI3A 3WG9A 4P55A 2EPFA 1LPQA 1MBKA 1X1AA 1NK3P 1YITI 4JK1X 2D1HA 1JTYA 3MKZA 4RAZA 4BAYA 4RM3A 4P9UA 1EV7A 3RPUD 1SVLA 4HAMA 2L9NA 4M72A 1JKQC 1VQ7I 2QQAA 3WE2A 5DD4A 1KQ0A 2FOKA 5E1XA 3GTOJ 3JRIA 5B66C 3AL0C 2QKLB 4A5NA 3IWZA 4HLXA 3COAC 2H6BA 1KU3A 2MH9A 1OYIA 2DMPA 1UHSA 2K9MA 2YSRA 1LFPA 4HSRA 2JZYA 3GTPJ 4L5EA 3FHNA 1MMDA 3HDDA 3OIPA 1U8RA 1A6IA 3JRBA 2IBDA 2A5WA 3F6OA 5F04A 2G7UA 4I01A 2OUMA 1A31A 4OAZA 1Z77A 3H92A 2R7TA 2X6OA 4XKBA 2AQFA 2CU7A 1MSFC 3GW2A 2M0MA 2KFDA 5FD6A 4LITA 3LAPA 2X1CA 2CQXA 4FCYA 3P5JA 1WJ5A 5LEKA 5M5XJ 3IL2A 3LSKA 3HKZA 3E6BA 3P7NA 3E5QA 2JA5J 3SFZA 1IV6A 2FQ4A 3HSFA 3LSPA 2DTRA 4BY1J 4P96A 3OSFA 3O8HA 2R4GA 3CO6C 1FPQA 1OR7C 3OR2C 5GAEJ 2EIMH 1ZH5A 5IP6A 2D2WA 1JUSA 4BKXA 1IRXA 3ZN1A 4B09A 2FNAA 1F1ZA 3I54A 3L9FA 2FQ3A 4KIFA 3GZ6A 5LGUA 2Z3YA 3GYHX 1R1UA 3GTKJ 3PQJA 1Y39A 2CW8A 2E5ZA 2DK8A 1B8IA 1FYMA 2K5CA 3SJMA 3CCVI 3JRHA 4RB3C 3WU1B 3FXKA 3IV5A 4C3HJ 4G7HF 3BP8A 1Y8RB 2O8XA 1R9TJ 3FXMA 2VT3A 4XLEA 4IXAA 4CCNA 1YYVA 2DA4A 2HVQA 3CQZJ 2X6YA 3PM1A 2NVUB 2DCEA 2KIMA 1YW9A 3DEWA 1YHQI 4A3BJ 2HXOA 3KCCA 3AG2H 4MEXF 5TRDA 3AL0B 5JI6A 1Z0XA 4OIRF 1RC9A 3QQAA 1GXQA 2YR2A 3ZQLA 2X4HA 4U87A 5J47A 2DK5A 4M6VA 5B1AH 3DF8A 2NNNA 1T0FC 2HKOA 3RCOA 2X85A 1FYKA 2DU9A 5F0FA 4EVIA 4E7LA 2FX0A 1MIJA 3V7RA 1PUEE 3K70C 4M71A 4U7BA 2HXIA 3CMAI 4PCQA 3ZMDA 1X3WB 2DOFA 2UZKA 2J5PA 3FZVA 2XPUA 4D5FA 1WFXA 2HVSA 2RAEA 4WXCA 2GBYA 1X1CA 2P4WA 3TEDA 2JSCA 4DNCA 3OYBA 3C2GA 4PDKA 4ZYAA 1ZTRA 5D5VB 1RPWA 2W00A 5J1UA 3ZQQA 5IYCJ 3U9GA 4YFKF 5DEQA 3A0HC 1MW7A 2ZFUA 2F2EA 4XOTA 2R7RA 1DU0A 2R7WA 3Q9SA 2K40A 1S7EA 1XSVA 1WJEA 2DT7B 3CJQB 3LFKA 4RS8A 2XF6A 2L9VA 2WAQN 1IN6A 1S5LC 5J40A 5ICCA 4Z2YA 2W48A 2ZMEA 2XSDC 3DEEA 2VPLA 5J8FA 1W7PA 1OFCX 2PMZN 4KT6A 2V1NA 3TL4X 3F72A 3J81K 3WTYC 1RRJA 1JI8A 3HRUA 2W84A 5ICFA 2L7ZA 4LGWA 3HYIA 1MH4A 5BS6A 2E7WA 3QRFF 3LFUA 4RGRA 4CYDA 4M9ZA 1YRNB 3BJAA 5DUKA 1HKSA 2BXYA 1UHMA 2PBIA 3ROUA 4HX4A 5J1RA 9ANTA 2ZJPF 4L5JA 2ZJ2A 4KMFA 1QZEA 3KIOA 1T08B 3KP4A 1EF4A 1TWAJ 4MQVA 3RI4A 1O3RA 3HOXJ 2KIQA 5D4RA 3ECOA 3IUOA 1TQMA 4HV5A 4HF2A 5HNFA 1W1WE 3ABKH 5IP7J 4ZYHA 4NC6A 5JHUA 1GV5A 5J6XA 1SFKA 3DU5A 1FMVA 1T33A 2VODA 1FIAA 2O0YA 3OYKA 1QQIA 4AIJA 4XLNF 5DUIA 2FRHA 3ZR8X 4ZTFA 1FC3A 4WXHA 1FIPA 5F0CA 1QBJA 1IN8A 3DBHB 1U3EM 1OJLA 1USSA 4CCMA 1ZG5A 5CPRB 2BZTA 3TW7A 2VKHA 2H27A 1R5HA 3I53A 2ZSIB 2RNGA 3SZPA 5HLIA 1A35A 2MD0A 1QA6A 1KU9A 1L0OC 1K78B 2E1MC 3BQYA 2Y0SA 2DJNA 1ETYA 4XSZF 3S1QJ 1D0YA 2VOPA 1K6OA 4ANJA 2BY0A 3L2VA 2AQEA 5TGTA 2P7CB 2KJBA 4KN4X 1ZLJA 1R71A 2EFPA 1CF7A 3ML6A 3ZQFA 4NBQA 3V42A 2L02A 1DU6A 3K70D 1SD4A 5F1JA 1XS9A 3F22A 1I6XA 2CV0A 1T8IA 3M8EA 3G1LA 5GP9A 5IOYA 1F5TA 2OCCH 3GTMJ 4IHWA 2KL4A 4NC8A 3WTUC 4BEHA 2LH9A 2EZKA 2R7ZJ 1LEBA 1ZN2A 3OIQA 2P6SA 2H6CA 2DFHA 4X0GA 3BG5A 4Q47A 1Z6RA 2XDVA 2F5FA 4CYCB 1PDNC 5EG0A 1O7FA 2Q2EB 2XVCA 3CP8A 4XL9A 2DBBA 2H8RA 2PMHA 1E17A 4NC7A 3O2PE 2DTZA 1UMQA 4WK8F 4XLFA 1JHHA 2LDUA 3G1MA 1LE8A 1W36C 1R4NB 1OMIA 4GGGA 4E4HA 5DM6F 1YFHA 2H1KA 1LUJB 4OMZA 4RM2A 3J7AO 3HZJA 1WH7A 2RKHA 4ITVA 1WJDA 3M1CA 4MNUA 3AAFA 1E2XA 2KHMA 3V8JA 3Q0VA 1FSHA 3VYRB 2O5RA 3R0JA 3IH4A 2Q1ZB 2LYCA 2R5YB 2VONA 2HDCA 3F23A 2K85A 2V9VA 3C2HA 1BIAA 1TW2A 2E19A 3GWZA 4KFCA 1P6RA 5FKNA 4ZJZA 5BOXA 1Z6TA 1RETA 3C7JA 4UUSB 4N9IA 3ZMVA 3T8TA 2ELJA 2X6WA 4BJ5C 4HQEA 4BXUA 2ZJRF 4PUSA 4AVZA 2QENA 3CCMI 1YQAA 2NVXJ 3ZCOA 1V5EA 3U21A 4F7ZA 2R7OA 4RGUA 1TL8A 4D9JA 2AHQA 1HCRA 2HDWA 4WWCA 5FKMA 2EQRA 3QPHA 3R60A 4Z6YA 1U0JA 2FXAA 4LB5A 3NAUA 5M3FJ 3I4PA 4AUXA 1H88C 4E7ZA 1ITYA 5DYMA 1N78A 4LMYA 3I4MJ 2QF7A 2BV6A 2WAEA 4JBAA 3MMYB 1X3ZB 3HGYA 4RB2C 4MEYF 5F1RA 1N25A 3S15J 3VEPA 2R7SA 3K2ZA 4R79A 2HYGD 5IP9J 4HEA2 1JGSA 3WU0A 4HPQA 1OISA 3N05A 4PGGA 3D5SC 3BTIA 1BN5A 3W6KB 2BW3A 2XRLA 3PNYA 5CYVA 3QU3A 5H20A 5BQTA 4BH9A 2QBYA 1OPCA 4HNVA 4U0WA 3GZNB 4ZYEA 4KIGA 3WTXC 3OS0A 2EZIA 2GXAA 3BTLA 5IYBJ 1UJ8A 5KHDA 2QSGX 4A3FJ 2LR8A 1K61A 2HOEA 4KYWA 4M3BA 3S3NA 4F3QA 2F5VA 4B43A 4GXOA 3FIWA 2NVYJ 3CCJI 2F5EA 3VOEA 1WH5A 3ZMUA 5C44J 4JOMA 4E70A 2Y9ZA 2LC2A 1DP7P 2ZXIA 2VOOA 1MBFA 5DCMB 2PX9A 4OIOF 3MN2A 2KKOA 1R7JA 4RBOA 1VQOI 1YS7A 2LBFB 4AC0A 1H8AC 2IPQX 5J4YA 3K1NA 4M74A 4AYBA 1D1BA 4RAYA 1YJNI 1I6HJ 1LJ9A 3A4CA 3BROA 4F93B 2IW5A 2VC1A 3SQNA 4H0EA 1O3TA 1MNMC 5KVRA 2LY1A 2XAUA 3L09A 4JYKA 1D0ZA 4FE4A 2MW8A 2DFFA 4KIBA 3BG6A 3E7LA 4KISA 3A1YA 4JQFA 1YE9A 4ZC3A 1XGSA 2W25A 1KQ9A 4G94A 1D0XA 3W2AA 3KEOA 4FISA 3CCLI 4MLOA 5IT3A 2CFXA 3PIPF 1ON2A 2OBPA 3ZP5A 3PO3J 2ESNA 3K10A 3I71A 2Y0MA 1UZCA 3IRRA 1MBJA 4ASNA 1VZ0A 3HOVJ 4C9YA 1FOWA 4AU7A 1D8KA 2TDXA 3EUKL 5JHFA 5B1BH 1BM9A 1TC3C 3FKIJ 2P5LC 2KJCA 3DBRB 3K4KA 1R00A 4OINF 4OMYA 2MBFA 2E1NA 3GO5A 1UG2A 2ZO4A 3JAMK 2XASA 1VQ9I 2VI6A 1MBHA 4M3EA 4CA0A 4RB0A 1MJ9A 3A0BC 1NH3A 3KZYA 3G6EI 1ZREA 4JP0A 1STZA 2L5QA 3DU6A 1R1TA 1YTYA 2GQQA 3CLOA 4NHJA 3OYIA 3CDIA 2EFNA 2EWNA 1HDPA 2JPBA 4ETSA 4XK4A 4DIQA 1Z21A 2OPTA 4FTHA 4A3CJ 3CTAA 3N4MA 6PAXA 2X9DA 1I3AA 2FBIA 2E2JJ 2ZKZA 5HS9A 1ZARA 1GT0C 1JJ6C 2GXGA 1ZG3A 4LOCA 4I7HA 1G6NA 4NQWB 2EK5A 1OCZH 4O3MA 3TP0A 3BR2A 2JVHA 3LQQA 3GTLJ 1MBGA 2NOGA 1NG7A 2W4SA 5E1WA 2GLOA 4W1UA 1HQCA 1I1GA 1JKPC 4PJNA 5CJ9A 2ID3A 3SZGA 1Y8QB 5H6QA 1QHHD 2WY7Q 2BXZA 1ETQA 4TV7A 2HEOA 3HIFA 2IAIA 3EUHA 3TO9A 3MKLA 4B1RA 2L7MP 2W82A 2I10A 3BJ6A 4OAYA 2EA2A 5FLVA 4ENKA 3F0CA 1A5JA 5EF6A 1ERDA 1V4RA 2JT1A 2YU9J 1V54H 2E5NA 3HG9A 2CMPA 1R49A 2LKPA 3ELKA 2KZGA 3GLLA 4IRGA 3FK6A 1AWCA 4A3JJ 2DDBA 2DO7A 3LL7A 1G2HA 3LMMA 3HUGB 1H9TA 1TZLA 1RZ4A 4CO8A 3H5AA 5CVRA 2TRTA 1YO5C 2VPRA 1UG0A 3QPSA 3H0DA 1FX7A 3K1PA 2M7AA 5FROA 1JUMA 1XDSA 3RZOJ 3BR6A 3RKYA 4FX4A 1N75A 2GIVA 2L9SA 2V4JC 4YEJA 2P8TA 1FTTA 4XSXF 5DS9A 1XG1A 2V1UA 4HX8A 3BCAA 3CD6I 2FD5A 3H5NA 3OYNA 1YW7A 2N8GA 4UV8A 1Y0NA 3DPLC 3J7YJ 3I55I 3ZMSA 2XC7A 3LSJA 2Z33A 2TCTA 2K27A 1IRGA 3CCEI 2IVMA 2DA2A 1OYWA 3WTZA 2HR3A 2VASA 4BQOA 4CCLA 1USTA 5JVGF 2V9PA 1WI9A 3LA2A 2ME6A 4ZZLA 4OOIA 5L3GA 4YFXF 2E2HJ 2PJRB 2VBZA 1BOBA 4LK1F 2CUJA 2NVQJ 1VFCA 2VJJA 2A68F 3HC7A 1LFUP 2L0KA 2M8GX 1K83J 2MYSA 4BNCA 1JXSA 2FU4A 3KPHA 4G7OF 2JUGA 1RR7A 1Y0UA 4HQMA 1I39A 3BWGA 4KMUX 1K7AA 3F21A 2IGKA 1IUYA 3MQ0A 2W7NA 2R7UA 5E18F 3OYGA 3BJOA 1VQ4I 1JT6A 2EZLA 2M3AA 4S04A 4S05A 3T0YA 1P7JA 1ON1A 2EFOA 4N4NB 2K4BA 2IS4A 3W6VA 3CJRB 3K7AJ 5A2QK 1MJBA 2VKDA 2FUG2 1K4SA 1FP1D 1ONVA 3HOUJ 1W5CC 1XN7A 2BOLA 2VLAA 4IHYA 3SDGA 4O6JA 3CDLA 4IX7A 4LFUA 3UR3C 1IXSB 2E36A 2GOXB 3EPZA 2R5YA 1N77A 3H35A 5FO5A 4A0ZA 1K6YA 2OQRA 3VFZA 1Z67A 5IT9Z 1H0MA 4J19A 3KP6A 3QPTA 2EV6A 5FKLA 1BW5A 2XGXA 2VC0A 1V5FA 2BBYA 2VE8A 2FMLA 4UB6C 5CQGA 4GFBA 2QQBA 3CC2I 2DQRA 4F52A 2EV5A 3CCQI 3IKVA 3HRTA 1I50J 2PMZA 3EYYA 3HEFA 2DMQA 2IP2A 3M9AA 3T1BA 3JAMZ 1Y6IA 4HG2A 4ON0A 3TDUC 1JKOC 2B0LA 3SZTA 2DODA 3O3KA 5GPCA 2ZB9A 4CHUA 3F8CA 2Z9OA 1WJCA 1EH6A 1WJAA 2K86A 1TWFJ 2DAOA 1BA5A 1PUFB 5FRNA 3Q9VA 3MCZA 3GTQJ 5F27A 4RDUA 2VBYA 3K4NA 4ZDOA 2FBKA 4XR6A 3U1KA 1XCBA 3KZIC 1SAXA 4UV9A 2WTEA 5E79C 5M5YJ 5KCMA 3DKYA 2QVOA 1SC7A 2VKEA 2FMYA 5HLTA 4EJTA 4JX4A 3VPRA 3CJTB 4CCOA 1RR8C 4V19K 1WVRA 3BDDA 1ZGJA 5K7HA 2PLYA 2HTSA 1LNWA 3G73A 3B6CA 2L54A 4D7MA 4B3AA 1DGWY 1WWXA 5EGOA 4IJAA 3IHUA 2F5DA 1BBYA 1GUUA 2GAUA 2XIGA 2CUEA 4EATA 4CZCA 4A3EJ 2CQKA 1A6QA 3OYAA 4DZJA 3DLLF 1I1SA 4G9YA 3CMEI 4PJMA 4ZDLA 4XONA 1X4OA 2CUZA 5EZGA 5BPDA 2CQNA 1O3SA 3GVAA 3BPXA 3PJRA 3CCYA 1BI2A 1YG2A 2R7VA 3U2RA 1SFXA 2PQ8A 2E1CA 3TBIA 4WX9A 3OYJA 3S93A 1KYZA 2CW7A 3P9IA 1VQLI 2HNHA 3DPTA 1SMYF 3E6CC 1ZRFA 4A3IJ 1BI1A 4PFPA 3L2WA 3OV8A 1HKQA 3RTRA 3KE2A 3IWFA 3LSRA 2XAJA 2BHYA 3NEUA 2RREA 4II3A 2IXSA 4QTRA 3LOCA 1U5TA 4YFNF 3BZCA 1IXCA 3KZZA 3IAS2 4D0PA 4I0BA 1RUNA 3CUQC 3I59A 2QGUA 5H6RA 1P4AA 4LB6B 5E3LA 1S9HA 4RGXA 5TJJA 1NG6A 2XRNA 2HGCA 3WHCA 1Q1HA 1TBXA 1R23A 3HTUA 3FDYA 3REOA 3DXJF 4X6AJ 4UUVA 2O7OA 2WV0A 2RV8A 3ECHA 4BQNA 1FOYA 2K02A 2Y48A 5EYRA 1HSTA 4X1EA 3OOUA 5D6EA 1HDDC 2STWA 3M3YJ 3I9V2 2CJJA 1BJAA 1O57A 4ZYGA 2DA6A 1GHCA 4PSXA 3Q3SA 2MABA 3DFGA 1SFOJ 1W0TA 5K5QA 1W0UA 4BE2A 1E3OC 1UFMA 5J4VA 4DBQA 1ZR4A 3KX2A 4HYEA 4Q4ZF 3KLNA 4LLLA 5HVQC 2VJIA 4V2GA 3QP5A 2Z2SB 2O8KA 3QAHA 2OU2A 3QYEA 3W3CA 2WC2A 2IA2A 2M8EA 2E35A 2QZ8A 4NQWA 5LBQA 4KA4A 2QWWA 4E7HA 3AKZA 3QOEA 2Q8KA 5A2QZ 3BG9A 3KEQA 1I27A 3L7WA 2DT5A 1BW6A 1WSUA 2HPMA 2FOWA 3OSGA 3B73A 3D0SA 1OCPA 1RNLA 4LG0B 1A36A 2KRFA 3OYEA 3FXLA 2M5WA 2XHKA 1MMAA 5JVTA 1ETOA 4S0HB 2COMA 3CLQA 2KDZA 3ZGKA 3WGHA 3ERMA 4A5MA 3N97A 1P92A 3DQVC 1EH8A 2DDAA 3DV8A 2IGMA 1YW8A 3MKYB 2HQNA 3S3MA 2IA0A 3I0TA 5GAHJ 2VB6A 4PZJA 3I5UA 1TNSA 3V8LA 2GA1A 4CICA 4XOPA 4Y4RA 4BJTA 2V6EA 3MFKA 1VQNI 2EINH 4KUMA 1T98A 1SMTA 3HM5A 5LLQA 2LLKA 1B72A 1AKHA 1FP2A 3ZXSA 2CFOA 4XRMA 4H4KC 2X51A 3VWBA 1IN5A 4HX7A 4Y17A 4Y7NJ 2DMNA 2KRCA 1YOVB 1YX3A 4FETA 1XDUA 3VDXA 1Q1VA 2VBWA 2BGCA 2JN6A 2DFIA 3J7ZI 1QGPA 2OV7A 4MIMA 4D5CA 3FXOA 2VJ5A 5KAIC 5E3NA 2XKOA 1MDMA 1ZHFA 3OWTA 3V4GA 2JUCA 1XX5A 5FGMA 1VNDA 2DPDA 1SVMA 3F8NA 4Y3OA 5J1YA 1Z9CA 4B48A 2JTVA 1JTXA 3B6AA 2UXXA 5EEHA 1XSXA 3TW6A 5HLGA 2ZNYA 3M8JA 4NDLA 3Q5FA 1V55H 1HBXG 5ILSA 5GAGJ 2DOAA 3C1DA 1MD0A 4IOAF 2C6YA 2LSOA 4C3JJ 3BR0A 4ZZDA 1WGXA 4XLCA 3GBGA 2EFQA 3GFJA 2XROA 1L3LA 4E6KG 1G59A 4OIQF 2UWMA 1C0WA 4FHTA 4ESJA 4LLNA 2DT6A 5JFRA 4BACA 1ODDA 4HBLA 4BQAA 3CZ6A 1WZ2A 1GVJA 3R0AA 2JWTA 1LEAA 2CV1A 3GUDA 3SHFA 3HOTA 3FMQA 3KYCB 1ZRCA 3ERED 3M8FA 3OY9A 1E3PA 2ICWG 5F64A 5ILVA 4AD9A 4DOZA
chains in the Genus database with same CATH topology
2L4MA 4I09A 4HW0A 2L01A 2BEOA 2HZTA 4IRHA 2HWVA 3R4KA 1FBQA 5CVVA 4U0YA 3K1MA 3KP3A 2L4AA 4EM0B 4GCVA 1UB9A 2KIFA 4XLPF 1D5VA 3V7SA 3E6MA 4U88A 1G3WA 1RIOH 4L9VA 3ABTA 4G6QA 1XD7A 1X3UA 2W57A 1TQIA 2HS5A 1FYLA 2O3FA 1DPRA 3RPQA 4EJWA 2KIUA 4K2EA 3JSOA 1FNNA 3QP6A 2VXZA 3R6SA 2RC4A 5HDKA 2EFWA 3RYPA 4NB5A 4M9XA 2RQPA 3LQRA 2FE3A 3JTGA 1WKMA 2K7LA 4AWXB 5K1YA 3HTSB 4HDUA 3FXRA 5AIPA 5D5WB 3IRQA 4G7ZF 1J0RA 4ZYDA 2NYXA 1Z91A 2CGPA 2HKXA 3E6DA 2QQ9A 3EDPA 4IF4A 1S8NA 1FOKA 1I5ZA 1IZ1A 1IW7F 5AIQA 5FFXA 2MC3A 1D3YA 4MTDA 4YIIA 1O3QA 5IT9K 2DPUA 1HW1A 1YS6A 5LRRA 2OD5A 3FM5A 1J5YA 4O5VA 3RYRA 3HHHA 1U2WA 1G3SA 1ZYRF 4R8HA 4A0XA 3EYIA 3WE3A 1YIOA 1SD6A 3PQKA 2O61A 2QYOA 3E5XA 2GXBA 2DW4A 2GZWA 3GZ5A 1LB2A 3RJPA 3GX4X 1OR7A 4KN7X 1U6GA 1B6AA 2R7FA 4L5IA 4M6YA 4A12A 1W7PB 2XV4S 4LD5A 1MZBA 2L3DA 1TNTA 3L2CA 2VBXA 4L18B 3RKXA 2RDPA 5EEGA 3FMSA 4WF2A 1G3TA 3K0LA 4CGZA 1ULYA 5L3EA 3EQLF 3TQNA 2XKPA 5E17F 1GXPA 3HSEA 1DPUA 4AIHA 1SFUA 4YIFA 3FWEA 4LG0A 3WTTC 1LDKB 5FFZA 1T0FA 4AVPA 4RB1A 2A69F 1BOAA 1J59A 1W7PD 4L0YB 3FM3A 4HV6A 4ENNA 2LNBA 3ZN0A 1DDNA 5LEJA 2R3SA 1D8JA 1B4AA 4I2OA 1SD5A 2EV0A 3ZMZA 1K78A 5K5RA 1S6LA 2H94A 1KGSA 2EB7A 3TKYA 2ZBKA 4WCGA 2O6GE 4I0AA 1CF7B 2GWRA 3HRMA 3FXUA 3FF5A 3GF2A 2DLLA 1HKTA 2IJLA 1BI3A 1ZGAA 3D5LA 4MTEA 4BHCA 4U7DA 4ESBA 3FXQA 2G9WA 4G6DA 2ZFWA 2D1VA 2XAGA 5KK1A 2P6TA 1R36A 2Q2EA 3ULQB 4OU0A 1FLIA 3NQOA 2IA1A 3KP2A 2EA4A 5D4SA 1HW2A 3ZQ7A 5CVJA 4EQQA 1QO0D 1IRFA 1HXDA 2XUBA 1IXRC 2NNYA 2OZ6A 1B59A 4UHTA 3F8FA 3KP5A 4HDVA 1P4WA 2WWYA 4EM1A 3TOBA 1S7OA 3FX3A 3WGGA 3TDZC 3WODF 3MZHA 2Z5UA 4UVBA 3JTHA 5BMZA 4EMSA 4A0YA 5ERIA 4RGSA 2FEZA 2ADUA 4Q48A 2FNPA 1HW5A 1XGMA 1S3JA 3E3VA 1J7KA 3ABUA 2BYVE 3S2WA 3MAJA 2A6HF 2CWEA 3W6JB 1PP8F 3CO7C 1IAWA 1T39A 1XSDA 3T8RA 2QBYB 2P5VA 1B9NA 1T38A 1J9IA 4ENMA 2RNJA 2M45A 5HS8A 3WTWC 5CLSA 5HDGA 1ZG1A 3CDHA 3F8BA 2XAFA 1O7LA 1J75A 3P9CA 3RKWA 3SXYA 2QUFA 5DCMA 2K4JA 4YG2F 2ISZA 3DP7A 4HZFA 5FLXK 4L0ZB 2R7DA 4MHGA 3MWMA 3BOQA 1AOYA 1FWZA 5D8KB 2NRAC 1FSEA 2ETHA 4KICA 1SFEA 3GLXA 1XB4A 5JR3A 1XCVA 3KETA 2ZXJA 3FHZA 1B1BA 2AXLA 2LF8A 4BHPA 2JRTA 3GXOA 4HOBA 2VN2A 4U0VA 2OZUA 3GFMA 4P9FA 1YLFA 1TLHB 2DI3A 3C18A 1KA8A 4HLYA 1KU7A 4UNOA 1KYWA 1R58A 3LAJA 2LF7A 3EETA 4P5OA 4Y15A 2PN6A 4XRFA 1HSJA 2NS0A 5HLHA 5HS7A 5HDNA 5LRSA 1A04A 2V1DA 3QOPA 1Z7UA 3H3UA 2H09A 3WTVC 1XMKA 1FBSA 2FBHA 2MH2A 4EM2A 3H3ZA 4N0BA 4GYIA 2CYYA 2Q0OA 3K9TA 1CGPA 1XMAA 1FT9A 2OQGA 4QLCU 3K69A 4IHTA 5L3CA 3CUQB 3J80Z 2F5CA 5L3FA 2V1XA 3M1EA 3HUGA 2HFHA 4AIKA 1P2FA 4UVCA 2E7XA 5E1ZB 1BI0A 3VODA 3BPVA 1DUXC 3LA7A 1TTYA 1PP7U 2YU3A 3B02A 1BIBA 3GFLA 3ISPA 4I02A 5ILUA 3HRSA 4M6XA 2ZCWA 4HF1A 3T5XA 2GA2A 2Z99A 4Y13A 1T2KA 1RI7A 3MEXA 3TO7A 2HTJA 2P7VB 2ESHA 1JE8A 3LWFA 1KU2A 2HQRA 5L3BA 1FY7A 2D45A 2CG4A 3TOAA 3F3XA 2IT0A 4ZH4F 1G4DA 3LA3A 1BC7C 3RPUA 1LVAA 5E20A 1OKRA 3LSTA 1RUOA 1ZRDA 1R1VA 1WRJA 5FD5A 4PGHA 1QZYA 4CXFA 3QU6A 2OAZA 1IN4A 5FLXZ 3RDIA 3CUOA 3R61A 5F6FA 2PMUA 4KT5C 5D5UB 4Q5SF 3JW4A 3JSPA 1IF1A 1XGNA 2RGVA 2V6CA 5CVUA 4FX0A 1T6SA 2CW0F 1QZZA 4KNYA 2STTA 2MLKA 1W5TA 4LLGF 3WTSC 2O03A 5DDGA 2CSOA 3U1DA 3TO6A 2XAQA 2A6EF 4GYGA 2EJRA 1Z1DA 1G3YA 1U5TC 3FMRA 1J2XA 4A6EA 4IRIA 1FBUA 2PI0A 3CJNA 4EJOA 2VE9A 3MZYA 5BPIA 4A6DA 3VB2A 1BC8C 2CO5A 2PEXA 4ENJA 2PG4A 3BY6A 4FT8A 2QM3A 2ZNZA 4G8XA 4HF0A 3J81Z 1LDJA 5DV5A 2ISYA 3I64A 2V79A 3IKTA 1UHWA 2JPCA 4L9JA 1JHFA 2FA5A 1R22A 2J5OA 1MGTA 4HA8A 2AS5F 3WGIA 1IN7A 2FSWA 2DQLA 2MLGA 3DEUA 4IPAA 4GO1A 5D5XB 3HHGA 1S29A 4CDGA 4I98B 1R5GA 1ZLKA 1QPMA 3F8MA 4BYYA 3G3ZA 4MQ9F 3NRVA 2ACJA 4WXDA 1Z05A 2UXNA 1FZPB 5K5OA 2G7HA 2A61A 1U5TB 5D6FA 3P9KA 1WQ2A 1XGOA 5D8LB 3I59B 1S7AA 5J8CA 4IVNA 1TQPA 2OA4A 1W4MA 2A3SA 4A2UA 4LK0F 2YX7A 3C3WA 2BE5F 2RVCA 1K79A 3E5UA 2XAHA 4XBFA 2ZMEB 1F9NA 5CVIA 2PJPA 2W85A 4R1HA 1B9MA 5LHGA 3E97A 2PFBA 2MA3A 3IC7A 3ZMTA 5DCFA 2IRFG 1MKMA 2P5KA 3I58A 3TGNA 5LHHA 4EV0A 2HYFA 3ZPLA 1H9GA 5DD8A 2Y75A 2QLZA 1ZAOA 2MD5A 1P4XA 1REPC 5HOOA 4M9SA 4N9HA 2ELHA 5LHIA 4ESFA 4M73A 1NHAA 1TW3A 3KFWX 1SD7A 3F6VA 3KP7A 4MGRA 2X0LA 1LDDA 5AONA 1UCRA 3M7GA 4CZZA 2M30A 3CUQA 3HOSA 2NAZA 2FF4A 1W5SA 3V7CA 2A07F 3V8KA 1EH7A 5L3DA 5E8IA 2VT2A 4BHBA 4EGYA 3RIRA 3GFIA 1OYYA 4EJUA 2M87A 4IHSA 4LJZF 4QWQA 3BZ6A 5ICGA 1MDMB 5LGTA 5ED4A 4DQ2A 3PFIA 3HSRA 1KQ8A 2A5YB 4UXNA 5ICEA 3L00A 3KLOA 4L9TA 1U78A 4KDPA 3GEZA 2YPRA 5FB2A 3DKWA 2RN7A 1F4KA 2M1BA 5E8GA 1MJAA 4B8XA 1LQ1A 5LGNA 3OOPA 4L9NA 4EJVA 2YX4A 2W24A 4UVAA 4EGZA 3O6BB 1VTNC 1QNTA 4OIPF 1V3FA 3J80K 3WG9A 4P55A 4JK1X 2D1HA 4RAZA 4BAYA 4P9UA 1EV7A 4HAMA 4M72A 2QQAA 3WE2A 5DD4A 1KQ0A 2FOKA 5E1XA 4A5NA 3IWZA 4HLXA 3COAC 2H6BA 1KU3A 2MH9A 1OYIA 2YSRA 2JZYA 1U8RA 3F6OA 2G7UA 4I01A 3H92A 3GW2A 5FD6A 3LAPA 5LEKA 3IL2A 3E6BA 3P7NA 3E5QA 3SFZA 3HSFA 2DTRA 4P96A 3CO6C 1FPQA 1ZH5A 2D2WA 3ZN1A 4B09A 2FNAA 1F1ZA 3I54A 3L9FA 2FQ3A 4KIFA 3GZ6A 5LGUA 2Z3YA 3GYHX 1R1UA 3PQJA 2DK8A 1FYMA 4RB3C 3WU1B 4G7HF 3BP8A 2O8XA 2VT3A 4IXAA 1YYVA 2KIMA 1YW9A 3KCCA 4MEXF 5TRDA 5JI6A 4OIRF 1GXQA 2YR2A 2X4HA 2DK5A 3DF8A 2NNNA 2HKOA 1FYKA 2DU9A 4EVIA 3V7RA 1PUEE 4M71A 4U7BA 4PCQA 3ZMDA 2UZKA 2J5PA 3FZVA 4WXCA 2P4WA 2JSCA 4DNCA 4PDKA 5D5VB 3U9GA 4YFKF 5DEQA 2F2EA 3Q9SA 1XSVA 3LFKA 4RS8A 1IN6A 5ICCA 4Z2YA 2ZMEA 5J8FA 1W7PA 3F72A 3J81K 3WTYC 3HRUA 2W84A 5ICFA 4LGWA 3HYIA 5BS6A 2E7WA 3QRFF 4RGRA 4CYDA 4M9ZA 3BJAA 5DUKA 1HKSA 1UHMA 2PBIA 3ROUA 4HX4A 4L5JA 2ZJ2A 4KMFA 3KP4A 4MQVA 3RI4A 1O3RA 5D4RA 3ECOA 1TQMA 4HV5A 4HF2A 4ZYHA 5JHUA 5J6XA 2VODA 2O0YA 1QQIA 4AIJA 4XLNF 5DUIA 2FRHA 1FC3A 4WXHA 1QBJA 1IN8A 1U3EM 1USSA 1ZG5A 2H27A 1R5HA 3I53A 3SZPA 5HLIA 1KU9A 1L0OC 1K78B 4XSZF 2VOPA 1K6OA 2P7CB 2KJBA 4KN4X 1ZLJA 2EFPA 1CF7A 3ML6A 2L02A 1SD4A 3F22A 1I6XA 3M8EA 1F5TA 3WTUC 1LEBA 1ZN2A 2P6SA 2H6CA 4Q47A 1Z6RA 2F5FA 1PDNC 1O7FA 2XVCA 2DBBA 2PMHA 1E17A 3O2PE 4WK8F 1JHHA 2LDUA 1OMIA 4GGGA 1YFHA 4OMZA 3J7AO 2RKHA 3AAFA 4MNUA 1E2XA 3V8JA 1FSHA 3R0JA 2VONA 2HDCA 3F23A 2V9VA 1BIAA 1TW2A 3GWZA 4KFCA 1P6RA 5BOXA 1Z6TA 3C7JA 4N9IA 3ZMVA 3T8TA 4HQEA 4BXUA 2QENA 1YQAA 4F7ZA 4RGUA 4WWCA 3QPHA 3R60A 2FXAA 4LB5A 3I4PA 5DYMA 4LMYA 2BV6A 4JBAA 4RB2C 4MEYF 5F1RA 3VEPA 3K2ZA 4R79A 2HYGD 1JGSA 3WU0A 4PGGA 1BN5A 3W6KB 5CYVA 2QBYA 3QU3A 5H20A 5BQTA 4BH9A 1OPCA 3WTXC 4U0WA 4ZYEA 4KIGA 4KYWA 2HOEA 4GXOA 2F5EA 3VOEA 3ZMUA 4E70A 1DP7P 2VOOA 5DCMB 4OIOF 2KKOA 1R7JA 1YS7A 2IPQX 3K1NA 4M74A 4RAYA 1LJ9A 3BROA 2IW5A 2VC1A 3SQNA 4H0EA 1O3TA 5KVRA 3L09A 4KIBA 4JQFA 1XGSA 2W25A 1KQ9A 4G94A 3KEOA 5IT3A 3ZP5A 2CFXA 1ON2A 2OBPA 2ESNA 3I71A 2Y0MA 3IRRA 4ASNA 1D8KA 2TDXA 1BM9A 2P5LC 2KJCA 1R00A 4OINF 4OMYA 2MBFA 2E1NA 3GO5A 2ZO4A 3JAMK 2XASA 4RB0A 1MJ9A 3KZYA 1ZREA 1STZA 1R1TA 1YTYA 2GQQA 3CLOA 4NHJA 2EFNA 2EWNA 2JPBA 4ETSA 3CTAA 3N4MA 6PAXA 2FBIA 2ZKZA 5HS9A 1ZARA 2GXGA 1ZG3A 4I7HA 1G6NA 2EK5A 4O3MA 3LQQA 5E1WA 1HQCA 1I1GA 5CJ9A 5H6QA 4TV7A 2HEOA 3HIFA 3EUHA 3TO9A 3BJ6A 2EA2A 4ENKA 1V4RA 2JT1A 2LKPA 3ELKA 4IRGA 1AWCA 2DO7A 1H9TA 1RZ4A 4CO8A 5CVRA 1YO5C 1FX7A 3K1PA 1XDSA 3RKYA 4FX4A 2GIVA 2P8TA 4XSXF 2V1UA 4HX8A 1YW7A 4UV8A 3DPLC 3ZMSA 2Z33A 2K27A 1IRGA 2IVMA 1OYWA 3WTZA 2HR3A 1USTA 1WI9A 3LA2A 5L3GA 4ZZLA 4OOIA 4YFXF 2VBZA 4LK1F 2A68F 4BNCA 1JXSA 2FU4A 4G7OF 1Y0UA 4HQMA 3BWGA 4KMUX 1K7AA 3F21A 1IUYA 3MQ0A 5E18F 3BJOA 4S04A 4S05A 3T0YA 2EFOA 1ON1A 2K4BA 5A2QK 1MJBA 1FP1D 1ONVA 1XN7A 4O6JA 4LFUA 1IXSB 5FO5A 4A0ZA 2OQRA 3VFZA 5IT9Z 1H0MA 3KP6A 3QPTA 2EV6A 2XGXA 2VC0A 2BBYA 2VE8A 2FMLA 2QQBA 2DQRA 2EV5A 3IKVA 3HRTA 3EYYA 3T1BA 2IP2A 3M9AA 3JAMZ 4ON0A 3TDUC 2B0LA 3SZTA 3O3KA 4CHUA 3F8CA 2Z9OA 1EH6A 2K86A 2DAOA 3Q9VA 3MCZA 2VBYA 2FBKA 1SAXA 1XCBA 4UV9A 2WTEA 2QVOA 2FMYA 4EJTA 3BDDA 1ZGJA 2PLYA 2HTSA 1LNWA 3G73A 2L54A 1WWXA 4IJAA 3IHUA 2F5DA 1BBYA 2GAUA 2XIGA 2CQKA 1I1SA 4G9YA 5BPDA 1O3SA 3GVAA 3BPXA 1BI2A 1YG2A 3U2RA 1SFXA 2PQ8A 2E1CA 4WX9A 1KYZA 3P9IA 3DPTA 1SMYF 3E6CC 1ZRFA 1BI1A 3OV8A 1HKQA 3RTRA 3KE2A 3IWFA 2XAJA 3NEUA 1U5TA 4YFNF 1IXCA 3KZZA 4D0PA 4I0BA 1RUNA 3CUQC 3I59A 5H6RA 1P4AA 4LB6B 4RGXA 5TJJA 2XRNA 2HGCA 1Q1HA 1TBXA 1R23A 3HTUA 3REOA 3DXJF 4UUVA 2WV0A 2RV8A 3ECHA 2K02A 2Y48A 1HSTA 5D6EA 2STWA 1BJAA 1O57A 4ZYGA 1GHCA 3DFGA 5K5QA 1UFMA 4Q4ZF 4HYEA 3KLNA 4LLLA 5HVQC 3QP5A 3QAHA 2OU2A 2WC2A 2IA2A 2M8EA 2QZ8A 4NQWA 5LBQA 4KA4A 2QWWA 2Q8KA 5A2QZ 3KEQA 1I27A 3L7WA 2DT5A 1WSUA 3B73A 3D0SA 1RNLA 4LG0B 2KRFA 2M5WA 2XHKA 5JVTA 2COMA 3WGHA 3N97A 4A5MA 1P92A 3DQVC 1EH8A 3DV8A 1YW8A 2HQNA 2IA0A 3I0TA 4PZJA 3I5UA 1TNSA 3V8LA 2GA1A 4CICA 3MFKA 4KUMA 1T98A 1SMTA 5LLQA 1FP2A 1IN5A 4HX7A 4Y17A 1XDUA 2VBWA 2BGCA 2DFIA 1QGPA 2XKOA 1MDMA 1ZHFA 3V4GA 5FGMA 2DPDA 3F8NA 1Z9CA 2JTVA 2UXXA 5EEHA 1XSXA 3Q5FA 5HLGA 2ZNYA 1HBXG 5ILSA 3C1DA 1MD0A 2C6YA 2LSOA 4ZZDA 2EFQA 3GFJA 2XROA 1L3LA 4OIQF 2UWMA 1C0WA 4FHTA 4ESJA 4LLNA 5JFRA 1ODDA 4HBLA 4BQAA 1GVJA 3R0AA 1LEAA 3GUDA 3SHFA 3HOTA 3FMQA 1ZRCA 3ERED 3M8FA 5F64A 5ILVA 4AD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4M A;  4I09 A;  4HW0 A;  2L01 A;  2BEO A;  2HZT A;  4IRH A;  2HWV A;  3R4K A;  1FBQ A;  5CVV A;  4U0Y A;  3K1M A;  3KP3 A;  2L4A A;  4EM0 B;  4GCV A;  1UB9 A;  2KIF A;  4XLP F;  1D5V A;  3V7S A;  3E6M A;  4U88 A;  1G3W A;  1RIO H;  4L9V A;  3ABT A;  4G6Q A;  1XD7 A;  1X3U A;  2W57 A;  1TQI A;  2HS5 A;  1FYL A;  2O3F A;  1DPR A;  3RPQ A;  4EJW A;  2KIU A;  4K2E A;  3JSO A;  1FNN A;  3QP6 A;  2VXZ A;  3R6S A;  2RC4 A;  5HDK A;  2EFW A;  3RYP A;  4NB5 A;  4M9X A;  2RQP A;  3LQR A;  2FE3 A;  3JTG A;  1WKM A;  2K7L A;  4AWX B;  5K1Y A;  3HTS B;  4HDU A;  3FXR A;  5AIP A;  5D5W B;  3IRQ A;  4G7Z F;  1J0R A;  4ZYD A;  2NYX A;  1Z91 A;  2CGP A;  2HKX A;  3E6D A;  2QQ9 A;  3EDP A;  4IF4 A;  1S8N A;  1FOK A;  1I5Z A;  1IZ1 A;  1IW7 F;  5AIQ A;  5FFX A;  2MC3 A;  1D3Y A;  4MTD A;  4YII A;  1O3Q A;  5IT9 K;  2DPU A;  1HW1 A;  1YS6 A;  5LRR A;  2OD5 A;  3FM5 A;  1J5Y A;  4O5V A;  3RYR A;  3HHH A;  1U2W A;  1G3S A;  1ZYR F;  4R8H A;  4A0X A;  3EYI A;  3WE3 A;  1YIO A;  1SD6 A;  3PQK A;  2O61 A;  2QYO A;  3E5X A;  2GXB A;  2DW4 A;  2GZW A;  3GZ5 A;  1LB2 A;  3RJP A;  3GX4 X;  1OR7 A;  4KN7 X;  1U6G A;  1B6A A;  2R7F A;  4L5I A;  4M6Y A;  4A12 A;  1W7P B;  2XV4 S;  4LD5 A;  1MZB A;  2L3D A;  1TNT A;  3L2C A;  2VBX A;  4L18 B;  3RKX A;  2RDP A;  5EEG A;  3FMS A;  4WF2 A;  1G3T A;  3K0L A;  4CGZ A;  1ULY A;  5L3E A;  3EQL F;  3TQN A;  2XKP A;  5E17 F;  1GXP A;  3HSE A;  1DPU A;  4AIH A;  1SFU A;  4YIF A;  3FWE A;  4LG0 A;  3WTT C;  1LDK B;  5FFZ A;  1T0F A;  4AVP A;  4RB1 A;  2A69 F;  1BOA A;  1J59 A;  1W7P D;  4L0Y B;  3FM3 A;  4HV6 A;  4ENN A;  2LNB A;  3ZN0 A;  1DDN A;  5LEJ A;  2R3S A;  1D8J A;  1B4A A;  4I2O A;  1SD5 A;  2EV0 A;  3ZMZ A;  1K78 A;  5K5R A;  1S6L A;  2H94 A;  1KGS A;  2EB7 A;  3TKY A;  2ZBK A;  4WCG A;  2O6G E;  4I0A A;  1CF7 B;  2GWR A;  3HRM A;  3FXU A;  3FF5 A;  3GF2 A;  2DLL A;  1HKT A;  2IJL A;  1BI3 A;  1ZGA A;  3D5L A;  4MTE A;  4BHC A;  4U7D A;  4ESB A;  3FXQ A;  2G9W A;  4G6D A;  2ZFW A;  2D1V A;  2XAG A;  5KK1 A;  2P6T A;  1R36 A;  2Q2E A;  3ULQ B;  4OU0 A;  1FLI A;  3NQO A;  2IA1 A;  3KP2 A;  2EA4 A;  5D4S A;  1HW2 A;  3ZQ7 A;  5CVJ A;  4EQQ A;  1QO0 D;  1IRF A;  1HXD A;  2XUB A;  1IXR C;  2NNY A;  2OZ6 A;  1B59 A;  4UHT A;  3F8F A;  3KP5 A;  4HDV A;  1P4W A;  2WWY A;  4EM1 A;  3TOB A;  1S7O A;  3FX3 A;  3WGG A;  3TDZ C;  3WOD F;  3MZH A;  2Z5U A;  4UVB A;  3JTH A;  5BMZ A;  4EMS A;  4A0Y A;  5ERI A;  4RGS A;  2FEZ A;  2ADU A;  4Q48 A;  2FNP A;  1HW5 A;  1XGM A;  1S3J A;  3E3V A;  1J7K A;  3ABU A;  2BYV E;  3S2W A;  3MAJ A;  2A6H F;  2CWE A;  3W6J B;  1PP8 F;  3CO7 C;  1IAW A;  1T39 A;  1XSD A;  3T8R A;  2QBY B;  2P5V A;  1B9N A;  1T38 A;  1J9I A;  4ENM A;  2RNJ A;  2M45 A;  5HS8 A;  3WTW C;  5CLS A;  5HDG A;  1ZG1 A;  3CDH A;  3F8B A;  2XAF A;  1O7L A;  1J75 A;  3P9C A;  3RKW A;  3SXY A;  2QUF A;  5DCM A;  2K4J A;  4YG2 F;  2ISZ A;  3DP7 A;  4HZF A;  5FLX K;  4L0Z B;  2R7D A;  4MHG A;  3MWM A;  3BOQ A;  1AOY A;  1FWZ A;  5D8K B;  2NRA C;  1FSE A;  2ETH A;  4KIC A;  1SFE A;  3GLX A;  1XB4 A;  5JR3 A;  1XCV A;  3KET A;  2ZXJ A;  3FHZ A;  1B1B A;  2AXL A;  2LF8 A;  4BHP A;  2JRT A;  3GXO A;  4HOB A;  2VN2 A;  4U0V A;  2OZU A;  3GFM A;  4P9F A;  1YLF A;  1TLH B;  2DI3 A;  3C18 A;  1KA8 A;  4HLY A;  1KU7 A;  4UNO A;  1KYW A;  1R58 A;  3LAJ A;  2LF7 A;  3EET A;  4P5O A;  4Y15 A;  2PN6 A;  4XRF A;  1HSJ A;  2NS0 A;  5HLH A;  5HS7 A;  5HDN A;  5LRS A;  1A04 A;  2V1D A;  3QOP A;  1Z7U A;  3H3U A;  2H09 A;  3WTV C;  1XMK A;  1FBS A;  2FBH A;  2MH2 A;  4EM2 A;  3H3Z A;  4N0B A;  4GYI A;  2CYY A;  2Q0O A;  3K9T A;  1CGP A;  1XMA A;  1FT9 A;  2OQG A;  4QLC U;  3K69 A;  4IHT A;  5L3C A;  3CUQ B;  3J80 Z;  2F5C A;  5L3F A;  2V1X A;  3M1E A;  3HUG A;  2HFH A;  4AIK A;  1P2F A;  4UVC A;  2E7X A;  5E1Z B;  1BI0 A;  3VOD A;  3BPV A;  1DUX C;  3LA7 A;  1TTY A;  1PP7 U;  2YU3 A;  3B02 A;  1BIB A;  3GFL A;  3ISP A;  4I02 A;  5ILU A;  3HRS A;  4M6X A;  2ZCW A;  4HF1 A;  3T5X A;  2GA2 A;  2Z99 A;  4Y13 A;  1T2K A;  1RI7 A;  3MEX A;  3TO7 A;  2HTJ A;  2P7V B;  2ESH A;  1JE8 A;  3LWF A;  1KU2 A;  2HQR A;  5L3B A;  1FY7 A;  2D45 A;  2CG4 A;  3TOA A;  3F3X A;  2IT0 A;  4ZH4 F;  1G4D A;  3LA3 A;  1BC7 C;  3RPU A;  1LVA A;  5E20 A;  1OKR A;  3LST A;  1RUO A;  1ZRD A;  1R1V A;  1WRJ A;  5FD5 A;  4PGH A;  1QZY A;  4CXF A;  3QU6 A;  2OAZ A;  1IN4 A;  5FLX Z;  3RDI A;  3CUO A;  3R61 A;  5F6F A;  2PMU A;  4KT5 C;  5D5U B;  4Q5S F;  3JW4 A;  3JSP A;  1IF1 A;  1XGN A;  2RGV A;  2V6C A;  5CVU A;  4FX0 A;  1T6S A;  2CW0 F;  1QZZ A;  4KNY A;  2STT A;  2MLK A;  1W5T A;  4LLG F;  3WTS C;  2O03 A;  5DDG A;  2CSO A;  3U1D A;  3TO6 A;  2XAQ A;  2A6E F;  4GYG A;  2EJR A;  1Z1D A;  1G3Y A;  1U5T C;  3FMR A;  1J2X A;  4A6E A;  4IRI A;  1FBU A;  2PI0 A;  3CJN A;  4EJO A;  2VE9 A;  3MZY A;  5BPI A;  4A6D A;  3VB2 A;  1BC8 C;  2CO5 A;  2PEX A;  4ENJ A;  2PG4 A;  3BY6 A;  4FT8 A;  2QM3 A;  2ZNZ A;  4G8X A;  4HF0 A;  3J81 Z;  1LDJ A;  5DV5 A;  2ISY A;  3I64 A;  2V79 A;  3IKT A;  1UHW A;  2JPC A;  4L9J A;  1JHF A;  2FA5 A;  1R22 A;  2J5O A;  1MGT A;  4HA8 A;  2AS5 F;  3WGI A;  1IN7 A;  2FSW A;  2DQL A;  2MLG A;  3DEU A;  4IPA A;  4GO1 A;  5D5X B;  3HHG A;  1S29 A;  4CDG A;  4I98 B;  1R5G A;  1ZLK A;  1QPM A;  3F8M A;  4BYY A;  3G3Z A;  4MQ9 F;  3NRV A;  2ACJ A;  4WXD A;  1Z05 A;  2UXN A;  1FZP B;  5K5O A;  2G7H A;  2A61 A;  1U5T B;  5D6F A;  3P9K A;  1WQ2 A;  1XGO A;  5D8L B;  3I59 B;  1S7A A;  5J8C A;  4IVN A;  1TQP A;  2OA4 A;  1W4M A;  2A3S A;  4A2U A;  4LK0 F;  2YX7 A;  3C3W A;  2BE5 F;  2RVC A;  1K79 A;  3E5U A;  2XAH A;  4XBF A;  2ZME B;  1F9N A;  5CVI A;  2PJP A;  2W85 A;  4R1H A;  1B9M A;  5LHG A;  3E97 A;  2PFB A;  2MA3 A;  3IC7 A;  3ZMT A;  5DCF A;  2IRF G;  1MKM A;  2P5K A;  3I58 A;  3TGN A;  5LHH A;  4EV0 A;  2HYF A;  3ZPL A;  1H9G A;  5DD8 A;  2Y75 A;  2QLZ A;  1ZAO A;  2MD5 A;  1P4X A;  1REP C;  5HOO A;  4M9S A;  4N9H A;  2ELH A;  5LHI A;  4ESF A;  4M73 A;  1NHA A;  1TW3 A;  3KFW X;  1SD7 A;  3F6V A;  3KP7 A;  4MGR A;  2X0L A;  1LDD A;  5AON A;  1UCR A;  3M7G A;  4CZZ A;  2M30 A;  3CUQ A;  3HOS A;  2NAZ A;  2FF4 A;  1W5S A;  3V7C A;  2A07 F;  3V8K A;  1EH7 A;  5L3D A;  5E8I A;  2VT2 A;  4BHB A;  4EGY A;  3RIR A;  3GFI A;  1OYY A;  4EJU A;  2M87 A;  4IHS A;  4LJZ F;  4QWQ A;  3BZ6 A;  5ICG A;  1MDM B;  5LGT A;  5ED4 A;  4DQ2 A;  3PFI A;  3HSR A;  1KQ8 A;  2A5Y B;  4UXN A;  5ICE A;  3L00 A;  3KLO A;  4L9T A;  1U78 A;  4KDP A;  3GEZ A;  2YPR A;  5FB2 A;  3DKW A;  2RN7 A;  1F4K A;  2M1B A;  5E8G A;  1MJA A;  4B8X A;  1LQ1 A;  5LGN A;  3OOP A;  4L9N A;  4EJV A;  2YX4 A;  2W24 A;  4UVA A;  4EGZ A;  3O6B B;  1VTN C;  1QNT A;  4OIP F;  1V3F A;  3J80 K;  3WG9 A;  4P55 A;  4JK1 X;  2D1H A;  4RAZ A;  4BAY A;  4P9U A;  1EV7 A;  4HAM A;  4M72 A;  2QQA A;  3WE2 A;  5DD4 A;  1KQ0 A;  2FOK A;  5E1X A;  4A5N A;  3IWZ A;  4HLX A;  3COA C;  2H6B A;  1KU3 A;  2MH9 A;  1OYI A;  2YSR A;  2JZY A;  1U8R A;  3F6O A;  2G7U A;  4I01 A;  3H92 A;  3GW2 A;  5FD6 A;  3LAP A;  5LEK A;  3IL2 A;  3E6B A;  3P7N A;  3E5Q A;  3SFZ A;  3HSF A;  2DTR A;  4P96 A;  3CO6 C;  1FPQ A;  1ZH5 A;  2D2W A;  3ZN1 A;  4B09 A;  2FNA A;  1F1Z A;  3I54 A;  3L9F A;  2FQ3 A;  4KIF A;  3GZ6 A;  5LGU A;  2Z3Y A;  3GYH X;  1R1U A;  3PQJ A;  2DK8 A;  1FYM A;  4RB3 C;  3WU1 B;  4G7H F;  3BP8 A;  2O8X A;  2VT3 A;  4IXA A;  1YYV A;  2KIM A;  1YW9 A;  3KCC A;  4MEX F;  5TRD A;  5JI6 A;  4OIR F;  1GXQ A;  2YR2 A;  2X4H A;  2DK5 A;  3DF8 A;  2NNN A;  2HKO A;  1FYK A;  2DU9 A;  4EVI A;  3V7R A;  1PUE E;  4M71 A;  4U7B A;  4PCQ A;  3ZMD A;  2UZK A;  2J5P A;  3FZV A;  4WXC A;  2P4W A;  2JSC A;  4DNC A;  4PDK A;  5D5V B;  3U9G A;  4YFK F;  5DEQ A;  2F2E A;  3Q9S A;  1XSV A;  3LFK A;  4RS8 A;  1IN6 A;  5ICC A;  4Z2Y A;  2ZME A;  5J8F A;  1W7P A;  3F72 A;  3J81 K;  3WTY C;  3HRU A;  2W84 A;  5ICF A;  4LGW A;  3HYI A;  5BS6 A;  2E7W A;  3QRF F;  4RGR A;  4CYD A;  4M9Z A;  3BJA A;  5DUK A;  1HKS A;  1UHM A;  2PBI A;  3ROU A;  4HX4 A;  4L5J A;  2ZJ2 A;  4KMF A;  3KP4 A;  4MQV A;  3RI4 A;  1O3R A;  5D4R A;  3ECO A;  1TQM A;  4HV5 A;  4HF2 A;  4ZYH A;  5JHU A;  5J6X A;  2VOD A;  2O0Y A;  1QQI A;  4AIJ A;  4XLN F;  5DUI A;  2FRH A;  1FC3 A;  4WXH A;  1QBJ A;  1IN8 A;  1U3E M;  1USS A;  1ZG5 A;  2H27 A;  1R5H A;  3I53 A;  3SZP A;  5HLI A;  1KU9 A;  1L0O C;  1K78 B;  4XSZ F;  2VOP A;  1K6O A;  2P7C B;  2KJB A;  4KN4 X;  1ZLJ A;  2EFP A;  1CF7 A;  3ML6 A;  2L02 A;  1SD4 A;  3F22 A;  1I6X A;  3M8E A;  1F5T A;  3WTU C;  1LEB A;  1ZN2 A;  2P6S A;  2H6C A;  4Q47 A;  1Z6R A;  2F5F A;  1PDN C;  1O7F A;  2XVC A;  2DBB A;  2PMH A;  1E17 A;  3O2P E;  4WK8 F;  1JHH A;  2LDU A;  1OMI A;  4GGG A;  1YFH A;  4OMZ A;  3J7A O;  2RKH A;  3AAF A;  4MNU A;  1E2X A;  3V8J A;  1FSH A;  3R0J A;  2VON A;  2HDC A;  3F23 A;  2V9V A;  1BIA A;  1TW2 A;  3GWZ A;  4KFC A;  1P6R A;  5BOX A;  1Z6T A;  3C7J A;  4N9I A;  3ZMV A;  3T8T A;  4HQE A;  4BXU A;  2QEN A;  1YQA A;  4F7Z A;  4RGU A;  4WWC A;  3QPH A;  3R60 A;  2FXA A;  4LB5 A;  3I4P A;  5DYM A;  4LMY A;  2BV6 A;  4JBA A;  4RB2 C;  4MEY F;  5F1R A;  3VEP A;  3K2Z A;  4R79 A;  2HYG D;  1JGS A;  3WU0 A;  4PGG A;  1BN5 A;  3W6K B;  5CYV A;  2QBY A;  3QU3 A;  5H20 A;  5BQT A;  4BH9 A;  1OPC A;  3WTX C;  4U0W A;  4ZYE A;  4KIG A;  4KYW A;  2HOE A;  4GXO A;  2F5E A;  3VOE A;  3ZMU A;  4E70 A;  1DP7 P;  2VOO A;  5DCM B;  4OIO F;  2KKO A;  1R7J A;  1YS7 A;  2IPQ X;  3K1N A;  4M74 A;  4RAY A;  1LJ9 A;  3BRO A;  2IW5 A;  2VC1 A;  3SQN A;  4H0E A;  1O3T A;  5KVR A;  3L09 A;  4KIB A;  4JQF A;  1XGS A;  2W25 A;  1KQ9 A;  4G94 A;  3KEO A;  5IT3 A;  3ZP5 A;  2CFX A;  1ON2 A;  2OBP A;  2ESN A;  3I71 A;  2Y0M A;  3IRR A;  4ASN A;  1D8K A;  2TDX A;  1BM9 A;  2P5L C;  2KJC A;  1R00 A;  4OIN F;  4OMY A;  2MBF A;  2E1N A;  3GO5 A;  2ZO4 A;  3JAM K;  2XAS A;  4RB0 A;  1MJ9 A;  3KZY A;  1ZRE A;  1STZ A;  1R1T A;  1YTY A;  2GQQ A;  3CLO A;  4NHJ A;  2EFN A;  2EWN A;  2JPB A;  4ETS A;  3CTA A;  3N4M A;  6PAX A;  2FBI A;  2ZKZ A;  5HS9 A;  1ZAR A;  2GXG A;  1ZG3 A;  4I7H A;  1G6N A;  2EK5 A;  4O3M A;  3LQQ A;  5E1W A;  1HQC A;  1I1G A;  5CJ9 A;  5H6Q A;  4TV7 A;  2HEO A;  3HIF A;  3EUH A;  3TO9 A;  3BJ6 A;  2EA2 A;  4ENK A;  1V4R A;  2JT1 A;  2LKP A;  3ELK A;  4IRG A;  1AWC A;  2DO7 A;  1H9T A;  1RZ4 A;  4CO8 A;  5CVR A;  1YO5 C;  1FX7 A;  3K1P A;  1XDS A;  3RKY A;  4FX4 A;  2GIV A;  2P8T A;  4XSX F;  2V1U A;  4HX8 A;  1YW7 A;  4UV8 A;  3DPL C;  3ZMS A;  2Z33 A;  2K27 A;  1IRG A;  2IVM A;  1OYW A;  3WTZ A;  2HR3 A;  1UST A;  1WI9 A;  3LA2 A;  5L3G A;  4ZZL A;  4OOI A;  4YFX F;  2VBZ A;  4LK1 F;  2A68 F;  4BNC A;  1JXS A;  2FU4 A;  4G7O F;  1Y0U A;  4HQM A;  3BWG A;  4KMU X;  1K7A A;  3F21 A;  1IUY A;  3MQ0 A;  5E18 F;  3BJO A;  4S04 A;  4S05 A;  3T0Y A;  2EFO A;  1ON1 A;  2K4B A;  5A2Q K;  1MJB A;  1FP1 D;  1ONV A;  1XN7 A;  4O6J A;  4LFU A;  1IXS B;  5FO5 A;  4A0Z A;  2OQR A;  3VFZ A;  5IT9 Z;  1H0M A;  3KP6 A;  3QPT A;  2EV6 A;  2XGX A;  2VC0 A;  2BBY A;  2VE8 A;  2FML A;  2QQB A;  2DQR A;  2EV5 A;  3IKV A;  3HRT A;  3EYY A;  3T1B A;  2IP2 A;  3M9A A;  3JAM Z;  4ON0 A;  3TDU C;  2B0L A;  3SZT A;  3O3K A;  4CHU A;  3F8C A;  2Z9O A;  1EH6 A;  2K86 A;  2DAO A;  3Q9V A;  3MCZ A;  2VBY A;  2FBK A;  1SAX A;  1XCB A;  4UV9 A;  2WTE A;  2QVO A;  2FMY A;  4EJT A;  3BDD A;  1ZGJ A;  2PLY A;  2HTS A;  1LNW A;  3G73 A;  2L54 A;  1WWX A;  4IJA A;  3IHU A;  2F5D A;  1BBY A;  2GAU A;  2XIG A;  2CQK A;  1I1S A;  4G9Y A;  5BPD A;  1O3S A;  3GVA A;  3BPX A;  1BI2 A;  1YG2 A;  3U2R A;  1SFX A;  2PQ8 A;  2E1C A;  4WX9 A;  1KYZ A;  3P9I A;  3DPT A;  1SMY F;  3E6C C;  1ZRF A;  1BI1 A;  3OV8 A;  1HKQ A;  3RTR A;  3KE2 A;  3IWF A;  2XAJ A;  3NEU A;  1U5T A;  4YFN F;  1IXC A;  3KZZ A;  4D0P A;  4I0B A;  1RUN A;  3CUQ C;  3I59 A;  5H6R A;  1P4A A;  4LB6 B;  4RGX A;  5TJJ A;  2XRN A;  2HGC A;  1Q1H A;  1TBX A;  1R23 A;  3HTU A;  3REO A;  3DXJ F;  4UUV A;  2WV0 A;  2RV8 A;  3ECH A;  2K02 A;  2Y48 A;  1HST A;  5D6E A;  2STW A;  1BJA A;  1O57 A;  4ZYG A;  1GHC A;  3DFG A;  5K5Q A;  1UFM A;  4Q4Z F;  4HYE A;  3KLN A;  4LLL A;  5HVQ C;  3QP5 A;  3QAH A;  2OU2 A;  2WC2 A;  2IA2 A;  2M8E A;  2QZ8 A;  4NQW A;  5LBQ A;  4KA4 A;  2QWW A;  2Q8K A;  5A2Q Z;  3KEQ A;  1I27 A;  3L7W A;  2DT5 A;  1WSU A;  3B73 A;  3D0S A;  1RNL A;  4LG0 B;  2KRF A;  2M5W A;  2XHK A;  5JVT A;  2COM A;  3WGH A;  3N97 A;  4A5M A;  1P92 A;  3DQV C;  1EH8 A;  3DV8 A;  1YW8 A;  2HQN A;  2IA0 A;  3I0T A;  4PZJ A;  3I5U A;  1TNS A;  3V8L A;  2GA1 A;  4CIC A;  3MFK A;  4KUM A;  1T98 A;  1SMT A;  5LLQ A;  1FP2 A;  1IN5 A;  4HX7 A;  4Y17 A;  1XDU A;  2VBW A;  2BGC A;  2DFI A;  1QGP A;  2XKO A;  1MDM A;  1ZHF A;  3V4G A;  5FGM A;  2DPD A;  3F8N A;  1Z9C A;  2JTV A;  2UXX A;  5EEH A;  1XSX A;  3Q5F A;  5HLG A;  2ZNY A;  1HBX G;  5ILS A;  3C1D A;  1MD0 A;  2C6Y A;  2LSO A;  4ZZD A;  2EFQ A;  3GFJ A;  2XRO A;  1L3L A;  4OIQ F;  2UWM A;  1C0W A;  4FHT A;  4ESJ A;  4LLN A;  5JFR A;  1ODD A;  4HBL A;  4BQA A;  1GVJ A;  3R0A A;  1LEA A;  3GUD A;  3SHF A;  3HOT A;  3FMQ A;  1ZRC A;  3ERE D;  3M8F A;  5F64 A;  5ILV A;  4AD9 A; 
#chains in the Genus database with same CATH topology
 2L4M A;  2F4I A;  2LP0 A;  4G6T B;  1HF0 A;  2XPW A;  2CS3 A;  4I09 A;  3ZQG A;  2E1M B;  2X1D A;  4HW0 A;  2L01 A;  3RSN A;  2BEO A;  1ZQ3 P;  2HZT A;  2HQ5 A;  4IRH A;  2HWV A;  3R4K A;  1FBQ A;  5CVV A;  4U0Y A;  2LVS A;  4DYR A;  5EJC A;  3UNG C;  2LOO A;  4M3D A;  3K1M A;  3KP3 A;  2DJI A;  1FTZ A;  1EKE A;  2L4A A;  4EM0 B;  4GCV A;  3S14 J;  1UB9 A;  1IG7 A;  2KIF A;  4XLP F;  1D5V A;  4BU2 A;  3HBL A;  2BVL A;  3PIO F;  1POG A;  2DFE A;  3V7S A;  3E6M A;  4U88 A;  1G3W A;  1RIO H;  4L9V A;  3ABT A;  2K3F A;  3IH2 A;  1XD7 A;  4G6Q A;  2LY2 A;  1X3U A;  3ABL H;  2W57 A;  1TQI A;  2XGD A;  3ASO H;  2OTL I;  2WA0 A;  4E7I A;  2X6X A;  3OYM A;  2HS5 A;  1FYL A;  2O3F A;  1DPR A;  3DKX A;  5IY5 H;  4YIR X;  2F48 A;  1MH3 A;  3RPQ A;  4RLF A;  5TIS C;  2IEK A;  4EJW A;  3OYL A;  1JKR C;  2KIU A;  1PUF A;  3S8P A;  4K2E A;  3JSO A;  3IH3 A;  1FNN A;  3DBL B;  2XF7 A;  2VXZ A;  3QP6 A;  3K4J A;  3R6S A;  3KEY A;  1VQP I;  2RC4 A;  5HDK A;  3BTC A;  2EFW A;  3RYP A;  3GTG J;  2JA6 J;  1U8B A;  1OCR H;  4NB5 A;  2M4K A;  2ECC A;  4M9X A;  1GV2 A;  2VUM J;  3HOZ J;  2RQP A;  3LQR A;  4BDY A;  2FE3 A;  4JX6 A;  3JTG A;  4XLA A;  1WKM A;  2K7L A;  2L7K A;  2ZME C;  4AWX B;  4DYC A;  1M1E B;  5K1Y A;  3HTS B;  4HDU A;  3FXR A;  5AIP A;  5D5W B;  1X2M A;  2OCE A;  3L2R A;  2E71 A;  3IRQ A;  4G7Z F;  1J0R A;  3ZQC A;  2BY3 A;  4PJ0 C;  1X1D A;  2KT0 A;  2NYX A;  4ZYD A;  1WI3 A;  4B3X A;  1Z91 A;  1OCT C;  2HKX A;  2LY9 A;  2CGP A;  3E6D A;  2QQ9 A;  3EDP A;  3G2B A;  1S8N A;  4IF4 A;  1FOK A;  1I5Z A;  3JRC A;  1IZ1 A;  2BVM A;  2E60 A;  3HPH A;  1IW7 F;  5EDN A;  4BBS J;  1QHG A;  5AIQ A;  1TP4 A;  4A3K J;  5FFX A;  2MC3 A;  4C30 A;  1IDY A;  1D3Y A;  3E0J B;  4MTD A;  2HU9 A;  1U9O A;  3A02 A;  4XKV A;  4YII A;  3ESW B;  5KAF C;  1RKT A;  2HZD A;  1O3Q A;  3A2K A;  3M4O J;  5IT9 K;  4F55 A;  2DPU A;  1HW1 A;  1K4T A;  1YS6 A;  3DWL E;  1Z3X A;  5LRR A;  5J3L A;  2XGC A;  2OD5 A;  1WHU A;  3FXJ A;  5JLW A;  3FM5 A;  2WY8 Q;  1J5Y A;  4O5V A;  3RYR A;  1GDT A;  3HHH A;  1U2W A;  1G3S A;  3S1R J;  1ZYR F;  5GTI C;  4R8H A;  1Z7L A;  2RQQ A;  4A3L J;  3TP3 A;  4A0X A;  1FJL A;  3EYI A;  2DYR H;  2HOT A;  4NNJ A;  3WE3 A;  4IHV A;  2F4O B;  3AFH A;  2I5U A;  1YIO A;  3FK7 A;  3VYU B;  1SD6 A;  3CMM A;  2DMU A;  3PQK A;  2E1O A;  3CCS I;  3LSM A;  1VQK I;  1TWG J;  1UAA A;  2O61 A;  3EUA A;  5F0H A;  2H8W A;  2B63 J;  2QYO A;  2WB1 A;  3QWL A;  3E5X A;  5KNL A;  2GXB A;  2DW4 A;  1YIJ I;  2GZW A;  1VQ6 I;  3GZ5 A;  3S32 A;  5IYD J;  1LB2 A;  3RJP A;  1T56 A;  1ETW A;  2XF5 A;  3HJE A;  3GX4 X;  3S1M J;  1QRY A;  5C4X J;  1OR7 A;  2M34 A;  2Y2Z A;  2XPV A;  4KN7 X;  1U6G A;  1B6A A;  2R7F A;  4L5I A;  4M6Y A;  4A12 A;  2Z16 A;  1W7P B;  3H9G A;  2JK3 A;  3QYF A;  2XV4 S;  1SVO A;  4LD5 A;  4UUT A;  1MZB A;  2L3D A;  2HDD A;  1TNT A;  3PNT A;  3L2C A;  2VBX A;  4L18 B;  3RKX A;  5FJ8 J;  2RDP A;  5EEG A;  3PO2 J;  2DA5 A;  1DGR M;  1QVT A;  3F9K A;  2LKX A;  1PVE A;  3FMS A;  4I6Z A;  3SFI A;  2V9K A;  3MD2 A;  2JSP A;  4N4O B;  4WF2 A;  1G3T A;  3K0L A;  1YRN A;  4CGZ A;  1ULY A;  2GIZ A;  5L3E A;  3EQL F;  4XKC A;  1LVK A;  3TQN A;  2XKP A;  5E17 F;  2JA7 J;  3S2D J;  1GXP A;  1CQT A;  3HSE A;  1S72 I;  4MFD A;  1JUP A;  5K7Z A;  1DPU A;  4KJZ A;  3S17 J;  2VL8 A;  4AIH A;  1SFU A;  4YIF A;  3FWE A;  4XRS A;  3BQZ A;  4CCJ A;  2Z1D A;  4LG0 A;  3WTT C;  1LDK B;  5FKO A;  3G1O A;  5FFZ A;  1T0F A;  4AVP A;  3HPG A;  4RB1 A;  2A69 F;  1BOA A;  1J59 A;  1W7P D;  4L0Y B;  4D7N A;  2R5Z B;  3FM3 A;  4HV6 A;  4ENN A;  2VIX A;  1YJW I;  2HQA A;  4XM3 A;  1IC8 A;  1MBE A;  2LNB A;  2E34 A;  3ZN0 A;  1DDN A;  5LEJ A;  3W2V A;  2R3S A;  2K9Q A;  3I56 I;  3RKQ A;  1D8J A;  1F43 A;  4M3F A;  1B4A A;  4CH7 A;  1P7I A;  2BY2 A;  4I2O A;  1SD5 A;  5M3M J;  2ZSH B;  3GCM A;  1JGG A;  4BY7 J;  2QSF X;  3JRG A;  2EV0 A;  4XRS G;  3ZMZ A;  2UUZ A;  4PJL A;  1S6L A;  5K5R A;  2H94 A;  2OC6 A;  1KGS A;  1ZR2 A;  1K78 A;  2X1E A;  1X4P A;  3NWT A;  1X2N A;  2EB7 A;  2I8D A;  3TKY A;  2ZBK A;  3BR3 A;  1G8X A;  4WCG A;  1R4M B;  3K6G A;  3H9Q A;  2O6G E;  4I0A A;  1CF7 B;  2GWR A;  3GME A;  3HRM A;  3FXU A;  3FF5 A;  3GF2 A;  2KMU A;  2H1L A;  2DLL A;  1HKT A;  4XN3 A;  2IJL A;  3FBN B;  3HOW J;  2K9S A;  1F36 A;  3FBI B;  3BG7 A;  1BI3 A;  1ZGA A;  3D5L A;  4BEH B;  3PL8 A;  4MTE A;  4BHC A;  4U7D A;  4ESB A;  3FXQ A;  2KLO A;  1LFB A;  2WV1 A;  2G9W A;  4G6D A;  1FOX A;  3IP4 B;  2O9L A;  2ZFW A;  2Y31 A;  2D1V A;  5HNH A;  2NOJ B;  2XAG A;  5EG0 B;  5KK1 A;  4IOC F;  2P6T A;  4CYC A;  1R36 A;  1MNE A;  2Q2E A;  3ULQ B;  4IQ4 A;  4OU0 A;  1FLI A;  3NQO A;  2IA1 A;  3I4N J;  3KP2 A;  2EA4 A;  1HC8 A;  5D4S A;  1LE8 B;  1HW2 A;  3ZQ7 A;  2HVR A;  5CVJ A;  1BR1 A;  4EQQ A;  5DTD A;  3OMY A;  1QO0 D;  1IRF A;  1HXD A;  1UEL B;  4QPO A;  3JCU C;  2XUB A;  1IXR C;  2NNY A;  2OZ6 A;  1B59 A;  4UHT A;  2VJ4 A;  3F8F A;  2JRM A;  3KP5 A;  3QYB A;  4HDV A;  2R92 J;  1P4W A;  5C3E J;  4BE0 A;  2WWY A;  2W1O A;  4EM1 A;  2WAQ A;  1SAN A;  3AG3 H;  3BTJ A;  3TOB A;  2EBI A;  1S7O A;  3H9J A;  3FX3 A;  3K4C A;  4UUS A;  3WGG A;  2LK2 A;  3TDZ C;  4OWR B;  4D1Q A;  3LNQ A;  1I3Q J;  1ENH A;  3WOD F;  3MZH A;  4LIU A;  2Z5U A;  4UVB A;  3CF5 F;  3JTH A;  5BMZ A;  4EMS A;  3RQI A;  4A0Y A;  5ERI A;  1R6R A;  2EIK H;  4RGS A;  3M07 A;  2FEZ A;  2KPM A;  2ADU A;  4Q48 A;  3DTE A;  2CQQ A;  1ZK8 A;  4QIW N;  2FNP A;  4BS9 A;  4J01 A;  1P9Q C;  2L9R A;  2A05 A;  4P1W A;  1ZEL A;  1HW5 A;  1XGM A;  1S3J A;  2COB A;  1J7K A;  2Y69 H;  3E3V A;  3ABU A;  2BYV E;  3L2Q A;  3S2W A;  3JRA A;  3MAJ A;  2A6H F;  2CWE A;  3I3L A;  1EA3 A;  3W6J B;  1PP8 F;  3CO7 C;  1IAW A;  1T39 A;  3RZD J;  2OF7 A;  1XSD A;  3T8R A;  3J7A Y;  2BW3 B;  2QBY B;  2P5V A;  3BC8 A;  2Y9Y A;  2IS1 A;  1B9N A;  1T38 A;  1J9I A;  2K3P A;  4ENM A;  2RNJ A;  1X1P A;  1X58 A;  2M45 A;  1ZKG A;  5HS8 A;  4IO9 F;  3WTW C;  5CLS A;  1VQM I;  5HDG A;  4IEJ A;  3UKG A;  3S3O A;  4Y33 A;  1ZG1 A;  4I99 C;  4FAS D;  3CDH A;  1GVD A;  3F8B A;  2XAF A;  1O7L A;  3K4M A;  4XQF A;  1J75 A;  4BXF A;  3P9C A;  3RKW A;  1HLV A;  4E7J A;  2LD5 A;  3SXY A;  2QUF A;  3BCB A;  3H3V K;  5DCM A;  3TMO A;  2K4J A;  4YG2 F;  3ZOB A;  2ISZ A;  2MG4 A;  5BNG A;  3DP7 A;  1LKX A;  2LBF A;  4HZF A;  1VQ8 I;  1X19 A;  4UY8 I;  1BJZ A;  5FLX K;  4L0Z B;  2R7D A;  4MHG A;  3G4S I;  3MWM A;  3BOQ A;  1AOY A;  4M3G A;  5FRM A;  4C2M J;  1FWZ A;  4YRV A;  3MVP A;  5D8K B;  2HPI A;  2NRA C;  1FSE A;  4BE1 A;  4PJJ A;  2ETH A;  4KIC A;  2ZXH A;  1SFE A;  3EUH C;  2B7E A;  2AXT C;  3GLX A;  1XB4 A;  1IRZ A;  5JR3 A;  1U9N A;  1XCV A;  3KET A;  2ZXJ A;  3FHZ A;  1B1B A;  2AXL A;  3LSI A;  2LF8 A;  4BHP A;  1D1C A;  2NVT J;  1YX5 A;  2JRT A;  3GXO A;  4HOB A;  2VN2 A;  4U0V A;  3VYS B;  3K4L A;  4BL0 B;  2F6C A;  1X1B A;  2OZU A;  3GFM A;  3SDB A;  4P9F A;  1IV8 A;  1YLF A;  1TLH B;  2DI3 A;  3C18 A;  1KA8 A;  5LD2 C;  4HLY A;  1KU7 A;  3D5R C;  4UNO A;  1IDZ A;  1KYW A;  1R58 A;  3LAJ A;  2LF7 A;  4IZZ A;  3HB9 A;  1TT5 B;  3EET A;  3OS2 A;  5IOZ A;  4P5O A;  4Y15 A;  4DGW B;  2PN6 A;  5FKK A;  4XRF A;  2MSY A;  1HSJ A;  2NS0 A;  4C2T A;  5C4J J;  5HLH A;  1DP3 A;  1DQU A;  2M9H A;  3OL4 A;  5HS7 A;  4Y52 J;  4KIT B;  5HDN A;  5LRS A;  1A04 A;  2QCO A;  2V1D A;  2ZJQ F;  2DA1 A;  3QOP A;  1Z7U A;  2ZC2 A;  1RES A;  3OIO A;  3H3U A;  3O8G A;  1AU7 A;  2H09 A;  5EZH A;  3WTV C;  2KIS A;  1XMK A;  2R93 J;  3K2A A;  1KON A;  1JJ8 C;  4CSW A;  1FBS A;  2FBH A;  3BR5 A;  3K4B A;  4XID A;  4FQG A;  3A01 B;  2MH2 A;  4EM2 A;  3H3Z A;  4N0B A;  3BLY A;  4GYI A;  2CYY A;  2Q0O A;  4E7K A;  1ACI A;  3K9T A;  1CGP A;  1XMA A;  2JQ7 A;  3OYF A;  1FT9 A;  2VQH A;  2OQG A;  4QLC U;  5IPA A;  3K69 A;  4IHT A;  3PNV A;  1HOM A;  1NK2 P;  2ID6 A;  4V2F A;  3SEZ A;  5GTH C;  4PK4 A;  1R5I D;  3HKZ N;  1SAU A;  2V26 A;  5L3C A;  3DTK A;  2M0C A;  3CUQ B;  4XOR A;  3J80 Z;  2F5C A;  1TWH J;  3AG1 H;  5L3F A;  4CUG A;  1AHD P;  2V1X A;  3S1N J;  1Z3Y A;  3M1E A;  2M2E A;  3GTJ J;  2Y30 A;  4ZDP A;  2G0E A;  2HFH A;  2NXN B;  3HUG A;  3DLA A;  4AIK A;  2UV1 A;  2R5Z A;  4GDF A;  4XLH A;  1P2F A;  2KDO A;  4UVC A;  2E7X A;  1GLN A;  4IHX A;  5E1Z B;  1IJW C;  1BI0 A;  4HST A;  3BPV A;  4NUB A;  3VOD A;  2LRD A;  2B9S A;  1DUX C;  3WG7 H;  3DTI A;  3LA7 A;  4BUP A;  1TTY A;  5E3O A;  1PP7 U;  1ETV A;  2YU3 A;  2LMD A;  3B02 A;  5H2F C;  1KZH A;  2NS8 A;  1BIB A;  1XTA A;  3GFL A;  3ISP A;  4I02 A;  4BQQ A;  5ILU A;  3HRS A;  1Y56 A;  1WCM J;  4M6X A;  3CCU I;  4C2U A;  2ZCW A;  4HF1 A;  3T5X A;  2GA2 A;  2Z99 A;  3MKW B;  4Y13 A;  3G71 I;  5CKT A;  3H5R A;  1T2K A;  4CCK A;  1VF9 A;  1RI7 A;  5F08 A;  3MEX A;  3TO7 A;  2HTJ A;  2PJR A;  2P7V B;  2ESH A;  4DJA A;  1JE8 A;  3LWF A;  1MND A;  1KU2 A;  2CQ7 A;  1ETK A;  4EEF G;  3CCR I;  2HQR A;  5JLX A;  1FY7 A;  5L3B A;  2P81 A;  2D45 A;  3H0G J;  2JA2 A;  2CG4 A;  3TOA A;  4RLQ A;  3F3X A;  1APL C;  2IT0 A;  1PYV A;  4ZH4 F;  4A3M J;  3LA3 A;  1G4D A;  1XMX A;  1BC7 C;  3WHB A;  4GRI A;  3RPU A;  1LVA A;  3SYT A;  5E20 A;  1OKR A;  3LST A;  1RUO A;  3NWS A;  1ZRD A;  4XIC A;  1R1V A;  1WRJ A;  5FD5 A;  4PGH A;  1QZY A;  4CXF A;  1TWC J;  3QU6 A;  4DYQ A;  2OAZ A;  1IN4 A;  5FLX Z;  1NTC A;  2EIJ H;  3RDI A;  3CUO A;  2NS7 A;  2R7X A;  2WAF A;  3CF2 A;  4YEL A;  3R61 A;  2BY1 A;  5B3S H;  5F6F A;  2ME0 A;  2PMU A;  4KT5 C;  2OJE D;  1MMN A;  2LG4 A;  1BL0 A;  5D5U B;  4Q5S F;  3JW4 A;  3JSP A;  1IF1 A;  1XGN A;  2IGO A;  2RGV A;  2V6C A;  5CVU A;  4FX0 A;  1T6S A;  3Q0W A;  2CW0 F;  1QZZ A;  1E0E A;  4KNY A;  2STT A;  2MLK A;  1W5T A;  2WBM A;  2MGQ A;  4LLG F;  3WTS C;  4PSW A;  2O03 A;  5DDG A;  1ORK A;  4HNU A;  2CSO A;  3HOY J;  3CES A;  3U1D A;  2ZXW H;  1MMS A;  5DM7 F;  1BR4 A;  2EZH A;  2XAQ A;  3TO6 A;  2A6E F;  3AG4 H;  4GYG A;  3OL3 A;  2M7B A;  4UB8 C;  2E2I J;  2HOA A;  2EJR A;  2CUF A;  4RMN A;  4G12 A;  1Z1D A;  4I76 A;  1G3Y A;  1D1A A;  4QSH A;  1U5T C;  3FMR A;  1J2X A;  4XN0 A;  4A6E A;  4IRI A;  4AM3 A;  1FBU A;  1YJ9 I;  2PI0 A;  3WU2 C;  4BGD A;  4C3I J;  2A6T A;  3CJN A;  4EJO A;  2VE9 A;  3MZY A;  5BPI A;  3QPL A;  3C2B A;  4A6D A;  2QEX I;  2VQG A;  3VB2 A;  2YUS A;  3BT9 A;  4B4C A;  1PJR A;  1BC8 C;  1ETX A;  1AA7 A;  2CO5 A;  3RQ4 A;  2IS6 A;  5K7F A;  4ABZ A;  2JA8 J;  2M4G A;  2PEX A;  4ENJ A;  3VSL A;  2ECB A;  2PG4 A;  3BY6 A;  4FT8 A;  5HOD A;  2K9L A;  3JRD A;  2QM3 A;  2DYS H;  3CC7 I;  2ZNZ A;  3X2Q H;  4A69 C;  4G8X A;  4HF0 A;  2HYJ A;  3PSI A;  3J81 Z;  2Y0S N;  1LDJ A;  5DV5 A;  2ISY A;  3L1P A;  3I64 A;  1J09 A;  2V79 A;  3IKT A;  5EGO B;  1UHW A;  2JPC A;  3OYC A;  1B8I B;  3CC4 I;  4L9J A;  1JHF A;  1OLT A;  2ELK A;  2F4M B;  1R22 A;  2FA5 A;  3OR1 C;  2J5O A;  4ZTJ A;  1MGT A;  2FJ1 A;  2EIL H;  2CRG A;  4FE7 A;  4HA8 A;  3WGI A;  1IN7 A;  2AS5 F;  3A03 A;  2FSW A;  2DQL A;  2MLG A;  3BZK A;  3DEU A;  4IPA A;  4GO1 A;  1QU3 A;  5D5X B;  3HHG A;  1S29 A;  4B47 A;  4CDG A;  2LKS A;  4MO7 A;  3OYD A;  4I98 B;  2DA7 A;  1R5G A;  3KYL A;  5GPA A;  2L2O A;  1ZLK A;  1Y1W J;  1HA8 A;  2JVG A;  2IGN A;  1QPM A;  4XKW A;  3F8M A;  4BYY A;  3G3Z A;  1YI2 I;  4MQ9 F;  4RAF A;  3NRV A;  4IL6 C;  2ACJ A;  4WXD A;  2KZV A;  1Z05 A;  2GOM A;  2UXN A;  3VSK A;  1FZP B;  3JRE A;  3H36 A;  5K5O A;  2G7H A;  2A61 A;  1U5T B;  1W36 D;  4A3G J;  3ZQH A;  3FIS A;  2D5V A;  3FKJ A;  4HNT A;  2JMW A;  4BXX J;  5D6F A;  2XB5 A;  3P9K A;  2MC4 A;  1WQ2 A;  1XGO A;  5D8L B;  3S16 J;  3I59 B;  2HOS A;  1S7A A;  4DZP A;  4F91 B;  4F92 B;  3S2H J;  2LRE A;  5J8C A;  3Q0U A;  4IVN A;  1TQP A;  2OA4 A;  1W4M A;  1QPI A;  1VI0 A;  2A3S A;  3ONQ A;  4A2U A;  4LK0 F;  2QA4 I;  2QSH X;  2YX7 A;  4IQJ A;  1XC5 A;  2WAD A;  3C3W A;  3QOD A;  2BE5 F;  2VQC A;  2RVC A;  4A3D J;  3VYT B;  2KQR A;  1K79 A;  3E5U A;  2XAH A;  4XMY A;  1IGN A;  4XBF A;  1T95 A;  2ZME B;  1F9N A;  5CVI A;  2PJP A;  2P0W A;  2LTP A;  4LG3 A;  3SEQ A;  2IS2 A;  3L2U A;  2W85 A;  4R1H A;  1B9M A;  5LHG A;  3E97 A;  2PFB A;  2MA3 A;  1MMG A;  3IC7 A;  3ZMT A;  5DCF A;  2IRF G;  1MKM A;  2P5K A;  3LSH A;  3I58 A;  3TGN A;  4B44 A;  5LHH A;  2QKM B;  4EV0 A;  2QQ8 A;  5M5W J;  2R7Q A;  2HYF A;  4II2 A;  3ZPL A;  3HL2 A;  1H9G A;  5DD8 A;  2Y75 A;  4W97 A;  1Y1V J;  2QLZ A;  4RA2 A;  3ASN H;  1ZAO A;  2MD5 A;  3DPU A;  2YS9 A;  1IUF A;  1P4X A;  1REP C;  5HOO A;  4M9S A;  5LFA A;  1JT0 A;  4N9H A;  3PUF A;  2ELH A;  5LHI A;  3A01 A;  4ESF A;  4M73 A;  3PFY A;  1NHA A;  1TW3 A;  1QVU A;  4BDZ A;  3KFW X;  1SD7 A;  2GM4 A;  3F6V A;  3BG3 A;  3KP7 A;  3CP2 A;  2VKV A;  4MGR A;  2X0L A;  1OCC H;  3JR9 A;  1LDD A;  3HXL A;  1SEU A;  3IAM 2;  2VXD A;  4DBR A;  5AON A;  5E3M A;  3HGG A;  5FLM J;  2L7F P;  1UCR A;  3M7G A;  3ZQI A;  3LSG A;  4CZZ A;  2M30 A;  4E7S A;  3CMY A;  2KRH A;  3CUQ A;  3HOS A;  1WJB A;  2NAZ A;  2FF4 A;  2KP6 A;  1WPK A;  1W5S A;  1IO2 A;  3V7C A;  2MFZ A;  2A07 F;  3V8K A;  5B5E C;  1D5Y A;  1EH7 A;  5L3D A;  1OQY A;  5E8I A;  4DW6 A;  1B72 B;  1AKH B;  3OS1 A;  2VQL A;  2VT2 A;  4BJ6 C;  4AYB N;  1O4X A;  1EJ9 A;  4BHB A;  4EGY A;  3MZ8 A;  3RIR A;  3GFI A;  2JJ7 A;  1OYY A;  3PUB A;  1VQ5 I;  2X48 A;  4EJU A;  2M87 A;  3OYH A;  3ZRG A;  4IHS A;  4LJZ F;  4QWQ A;  1H89 C;  3BZ6 A;  4IKF A;  1BR2 A;  3E1S A;  5ICG A;  3JRF A;  2DOE A;  1MDM B;  5LGT A;  5ED4 A;  4DQ2 A;  2V7F A;  3BR1 A;  3PFI A;  4PFO A;  2DA3 A;  3HSR A;  4RAG A;  1KQ8 A;  3H1C A;  2A5Y B;  4UXN A;  2BHZ A;  5ICE A;  2DMT A;  3L00 A;  3KLO A;  3KYD B;  4XNF A;  1V5G A;  2LFB A;  2XB0 X;  4L9T A;  1U78 A;  2CH0 A;  2AO9 A;  2XSJ C;  3GEZ A;  2DXI A;  4KDP A;  1FMW A;  3W2W A;  2YPR A;  4LIV A;  5CQE A;  5FB2 A;  3DKW A;  2RN7 A;  1F4K A;  2OTJ I;  2M1B A;  5E8G A;  1MJA A;  4B8X A;  1LQ1 A;  1OCO H;  4QPQ A;  4AID A;  5LGN A;  3OOP A;  4A93 J;  3NAR A;  1WJF A;  4L9N A;  4BBR J;  2R0Q C;  1E3H A;  5EEA A;  4EJV A;  2YX4 A;  4JX5 A;  5GAD J;  1RKW A;  1FEX A;  2DN0 A;  2W24 A;  2XGE A;  3ABM H;  4UVA A;  4EGZ A;  3O6B B;  1VTN C;  1ZGW A;  2EH3 A;  1QNT A;  2CV2 A;  2WB1 N;  1XPX A;  1V3F A;  4OIP F;  3DCF A;  1TT0 A;  4J00 A;  2K9N A;  3PSF A;  3J80 K;  4MFE A;  3D1N I;  4HRI A;  1MSE C;  2HI3 A;  3WG9 A;  4P55 A;  2EPF A;  1LPQ A;  1MBK A;  1X1A A;  1NK3 P;  1YIT I;  4JK1 X;  2D1H A;  1JTY A;  3MKZ A;  4RAZ A;  4BAY A;  4RM3 A;  4P9U A;  1EV7 A;  3RPU D;  1SVL A;  4HAM A;  2L9N A;  4M72 A;  1JKQ C;  1VQ7 I;  2QQA A;  3WE2 A;  5DD4 A;  1KQ0 A;  2FOK A;  5E1X A;  3GTO J;  3JRI A;  5B66 C;  3AL0 C;  2QKL B;  4A5N A;  3IWZ A;  4HLX A;  3COA C;  2H6B A;  1KU3 A;  2MH9 A;  1OYI A;  2DMP A;  1UHS A;  2K9M A;  2YSR A;  1LFP A;  4HSR A;  2JZY A;  3GTP J;  4L5E A;  3FHN A;  1MMD A;  3HDD A;  3OIP A;  1U8R A;  1A6I A;  3JRB A;  2IBD A;  2A5W A;  3F6O A;  5F04 A;  2G7U A;  4I01 A;  2OUM A;  1A31 A;  4OAZ A;  1Z77 A;  3H92 A;  2R7T A;  2X6O A;  4XKB A;  2AQF A;  2CU7 A;  1MSF C;  3GW2 A;  2M0M A;  2KFD A;  5FD6 A;  4LIT A;  3LAP A;  2X1C A;  2CQX A;  4FCY A;  3P5J A;  1WJ5 A;  5LEK A;  5M5X J;  3IL2 A;  3LSK A;  3HKZ A;  3E6B A;  3P7N A;  3E5Q A;  2JA5 J;  3SFZ A;  1IV6 A;  2FQ4 A;  3HSF A;  3LSP A;  2DTR A;  4BY1 J;  4P96 A;  3OSF A;  3O8H A;  2R4G A;  3CO6 C;  1FPQ A;  1OR7 C;  3OR2 C;  5GAE J;  2EIM H;  1ZH5 A;  5IP6 A;  2D2W A;  1JUS A;  4BKX A;  1IRX A;  3ZN1 A;  4B09 A;  2FNA A;  1F1Z A;  3I54 A;  3L9F A;  2FQ3 A;  4KIF A;  3GZ6 A;  5LGU A;  2Z3Y A;  3GYH X;  1R1U A;  3GTK J;  3PQJ A;  1Y39 A;  2CW8 A;  2E5Z A;  2DK8 A;  1B8I A;  1FYM A;  2K5C A;  3SJM A;  3CCV I;  3JRH A;  4RB3 C;  3WU1 B;  3FXK A;  3IV5 A;  4C3H J;  4G7H F;  3BP8 A;  1Y8R B;  2O8X A;  1R9T J;  3FXM A;  2VT3 A;  4XLE A;  4IXA A;  4CCN A;  1YYV A;  2DA4 A;  2HVQ A;  3CQZ J;  2X6Y A;  3PM1 A;  2NVU B;  2DCE A;  2KIM A;  1YW9 A;  3DEW A;  1YHQ I;  4A3B J;  2HXO A;  3KCC A;  3AG2 H;  4MEX F;  5TRD A;  3AL0 B;  5JI6 A;  1Z0X A;  4OIR F;  1RC9 A;  3QQA A;  1GXQ A;  2YR2 A;  3ZQL A;  2X4H A;  4U87 A;  5J47 A;  2DK5 A;  4M6V A;  5B1A H;  3DF8 A;  2NNN A;  1T0F C;  2HKO A;  3RCO A;  2X85 A;  1FYK A;  2DU9 A;  5F0F A;  4EVI A;  4E7L A;  2FX0 A;  1MIJ A;  3V7R A;  1PUE E;  3K70 C;  4M71 A;  4U7B A;  2HXI A;  3CMA I;  4PCQ A;  3ZMD A;  1X3W B;  2DOF A;  2UZK A;  2J5P A;  3FZV A;  2XPU A;  4D5F A;  1WFX A;  2HVS A;  2RAE A;  4WXC A;  2GBY A;  1X1C A;  2P4W A;  3TED A;  2JSC A;  4DNC A;  3OYB A;  3C2G A;  4PDK A;  4ZYA A;  1ZTR A;  5D5V B;  1RPW A;  2W00 A;  5J1U A;  3ZQQ A;  5IYC J;  3U9G A;  4YFK F;  5DEQ A;  3A0H C;  1MW7 A;  2ZFU A;  2F2E A;  4XOT A;  2R7R A;  1DU0 A;  2R7W A;  3Q9S A;  2K40 A;  1S7E A;  1XSV A;  1WJE A;  2DT7 B;  3CJQ B;  3LFK A;  4RS8 A;  2XF6 A;  2L9V A;  2WAQ N;  1IN6 A;  1S5L C;  5J40 A;  5ICC A;  4Z2Y A;  2W48 A;  2ZME A;  2XSD C;  3DEE A;  2VPL A;  5J8F A;  1W7P A;  1OFC X;  2PMZ N;  4KT6 A;  2V1N A;  3TL4 X;  3F72 A;  3J81 K;  3WTY C;  1RRJ A;  1JI8 A;  3HRU A;  2W84 A;  5ICF A;  2L7Z A;  4LGW A;  3HYI A;  1MH4 A;  5BS6 A;  2E7W A;  3QRF F;  3LFU A;  4RGR A;  4CYD A;  4M9Z A;  1YRN B;  3BJA A;  5DUK A;  1HKS A;  2BXY A;  1UHM A;  2PBI A;  3ROU A;  4HX4 A;  5J1R A;  9ANT A;  2ZJP F;  4L5J A;  2ZJ2 A;  4KMF A;  1QZE A;  3KIO A;  1T08 B;  3KP4 A;  1EF4 A;  1TWA J;  4MQV A;  3RI4 A;  1O3R A;  3HOX J;  2KIQ A;  5D4R A;  3ECO A;  3IUO A;  1TQM A;  4HV5 A;  4HF2 A;  5HNF A;  1W1W E;  3ABK H;  5IP7 J;  4ZYH A;  4NC6 A;  5JHU A;  1GV5 A;  5J6X A;  1SFK A;  3DU5 A;  1FMV A;  1T33 A;  2VOD A;  1FIA A;  2O0Y A;  3OYK A;  1QQI A;  4AIJ A;  4XLN F;  5DUI A;  2FRH A;  3ZR8 X;  4ZTF A;  1FC3 A;  4WXH A;  1FIP A;  5F0C A;  1QBJ A;  1IN8 A;  3DBH B;  1U3E M;  1OJL A;  1USS A;  4CCM A;  1ZG5 A;  5CPR B;  2BZT A;  3TW7 A;  2VKH A;  2H27 A;  1R5H A;  3I53 A;  2ZSI B;  2RNG A;  3SZP A;  5HLI A;  1A35 A;  2MD0 A;  1QA6 A;  1KU9 A;  1L0O C;  1K78 B;  2E1M C;  3BQY A;  2Y0S A;  2DJN A;  1ETY A;  4XSZ F;  3S1Q J;  1D0Y A;  2VOP A;  1K6O A;  4ANJ A;  2BY0 A;  3L2V A;  2AQE A;  5TGT A;  2P7C B;  2KJB A;  4KN4 X;  1ZLJ A;  1R71 A;  2EFP A;  1CF7 A;  3ML6 A;  3ZQF A;  4NBQ A;  3V42 A;  2L02 A;  1DU6 A;  3K70 D;  1SD4 A;  5F1J A;  1XS9 A;  3F22 A;  1I6X A;  2CV0 A;  1T8I A;  3M8E A;  3G1L A;  5GP9 A;  5IOY A;  1F5T A;  2OCC H;  3GTM J;  4IHW A;  2KL4 A;  4NC8 A;  3WTU C;  4BEH A;  2LH9 A;  2EZK A;  2R7Z J;  1LEB A;  1ZN2 A;  3OIQ A;  2P6S A;  2H6C A;  2DFH A;  4X0G A;  3BG5 A;  4Q47 A;  1Z6R A;  2XDV A;  2F5F A;  4CYC B;  1PDN C;  5EG0 A;  1O7F A;  2Q2E B;  2XVC A;  3CP8 A;  4XL9 A;  2DBB A;  2H8R A;  2PMH A;  1E17 A;  4NC7 A;  3O2P E;  2DTZ A;  1UMQ A;  4WK8 F;  4XLF A;  1JHH A;  2LDU A;  3G1M A;  1LE8 A;  1W36 C;  1R4N B;  1OMI A;  4GGG A;  4E4H A;  5DM6 F;  1YFH A;  2H1K A;  1LUJ B;  4OMZ A;  4RM2 A;  3J7A O;  3HZJ A;  1WH7 A;  2RKH A;  4ITV A;  1WJD A;  3M1C A;  4MNU A;  3AAF A;  1E2X A;  2KHM A;  3V8J A;  3Q0V A;  1FSH A;  3VYR B;  2O5R A;  3R0J A;  3IH4 A;  2Q1Z B;  2LYC A;  2R5Y B;  2VON A;  2HDC A;  3F23 A;  2K85 A;  2V9V A;  3C2H A;  1BIA A;  1TW2 A;  2E19 A;  3GWZ A;  4KFC A;  1P6R A;  5FKN A;  4ZJZ A;  5BOX A;  1Z6T A;  1RET A;  3C7J A;  4UUS B;  4N9I A;  3ZMV A;  3T8T A;  2ELJ A;  2X6W A;  4BJ5 C;  4HQE A;  4BXU A;  2ZJR F;  4PUS A;  4AVZ A;  2QEN A;  3CCM I;  1YQA A;  2NVX J;  3ZCO A;  1V5E A;  3U21 A;  4F7Z A;  2R7O A;  4RGU A;  1TL8 A;  4D9J A;  2AHQ A;  1HCR A;  2HDW A;  4WWC A;  5FKM A;  2EQR A;  3QPH A;  3R60 A;  4Z6Y A;  1U0J A;  2FXA A;  4LB5 A;  3NAU A;  5M3F J;  3I4P A;  4AUX A;  1H88 C;  4E7Z A;  1ITY A;  5DYM A;  1N78 A;  4LMY A;  3I4M J;  2QF7 A;  2BV6 A;  2WAE A;  4JBA A;  3MMY B;  1X3Z B;  3HGY A;  4RB2 C;  4MEY F;  5F1R A;  1N25 A;  3S15 J;  3VEP A;  2R7S A;  3K2Z A;  4R79 A;  2HYG D;  5IP9 J;  4HEA 2;  1JGS A;  3WU0 A;  4HPQ A;  1OIS A;  3N05 A;  4PGG A;  3D5S C;  3BTI A;  1BN5 A;  3W6K B;  2BW3 A;  2XRL A;  3PNY A;  5CYV A;  3QU3 A;  5H20 A;  5BQT A;  4BH9 A;  2QBY A;  1OPC A;  4HNV A;  4U0W A;  3GZN B;  4ZYE A;  4KIG A;  3WTX C;  3OS0 A;  2EZI A;  2GXA A;  3BTL A;  5IYB J;  1UJ8 A;  5KHD A;  2QSG X;  4A3F J;  2LR8 A;  1K61 A;  2HOE A;  4KYW A;  4M3B A;  3S3N A;  4F3Q A;  2F5V A;  4B43 A;  4GXO A;  3FIW A;  2NVY J;  3CCJ I;  2F5E A;  3VOE A;  1WH5 A;  3ZMU A;  5C44 J;  4JOM A;  4E70 A;  2Y9Z A;  2LC2 A;  1DP7 P;  2ZXI A;  2VOO A;  1MBF A;  5DCM B;  2PX9 A;  4OIO F;  3MN2 A;  2KKO A;  1R7J A;  4RBO A;  1VQO I;  1YS7 A;  2LBF B;  4AC0 A;  1H8A C;  2IPQ X;  5J4Y A;  3K1N A;  4M74 A;  4AYB A;  1D1B A;  4RAY A;  1YJN I;  1I6H J;  1LJ9 A;  3A4C A;  3BRO A;  4F93 B;  2IW5 A;  2VC1 A;  3SQN A;  4H0E A;  1O3T A;  1MNM C;  5KVR A;  2LY1 A;  2XAU A;  3L09 A;  4JYK A;  1D0Z A;  4FE4 A;  2MW8 A;  2DFF A;  4KIB A;  3BG6 A;  3E7L A;  4KIS A;  3A1Y A;  4JQF A;  1YE9 A;  4ZC3 A;  1XGS A;  2W25 A;  1KQ9 A;  4G94 A;  1D0X A;  3W2A A;  3KEO A;  4FIS A;  3CCL I;  4MLO A;  5IT3 A;  2CFX A;  3PIP F;  1ON2 A;  2OBP A;  3ZP5 A;  3PO3 J;  2ESN A;  3K10 A;  3I71 A;  2Y0M A;  1UZC A;  3IRR A;  1MBJ A;  4ASN A;  1VZ0 A;  3HOV J;  4C9Y A;  1FOW A;  4AU7 A;  1D8K A;  2TDX A;  3EUK L;  5JHF A;  5B1B H;  1BM9 A;  1TC3 C;  3FKI J;  2P5L C;  2KJC A;  3DBR B;  3K4K A;  1R00 A;  4OIN F;  4OMY A;  2MBF A;  2E1N A;  3GO5 A;  1UG2 A;  2ZO4 A;  3JAM K;  2XAS A;  1VQ9 I;  2VI6 A;  1MBH A;  4M3E A;  4CA0 A;  4RB0 A;  1MJ9 A;  3A0B C;  1NH3 A;  3KZY A;  3G6E I;  1ZRE A;  4JP0 A;  1STZ A;  2L5Q A;  3DU6 A;  1R1T A;  1YTY A;  2GQQ A;  3CLO A;  4NHJ A;  3OYI A;  3CDI A;  2EFN A;  2EWN A;  1HDP A;  2JPB A;  4ETS A;  4XK4 A;  4DIQ A;  1Z21 A;  2OPT A;  4FTH A;  4A3C J;  3CTA A;  3N4M A;  6PAX A;  2X9D A;  1I3A A;  2FBI A;  2E2J J;  2ZKZ A;  5HS9 A;  1ZAR A;  1GT0 C;  1JJ6 C;  2GXG A;  1ZG3 A;  4LOC A;  4I7H A;  1G6N A;  4NQW B;  2EK5 A;  1OCZ H;  4O3M A;  3TP0 A;  3BR2 A;  2JVH A;  3LQQ A;  3GTL J;  1MBG A;  2NOG A;  1NG7 A;  2W4S A;  5E1W A;  2GLO A;  4W1U A;  1HQC A;  1I1G A;  1JKP C;  4PJN A;  5CJ9 A;  2ID3 A;  3SZG A;  1Y8Q B;  5H6Q A;  1QHH D;  2WY7 Q;  2BXZ A;  1ETQ A;  4TV7 A;  2HEO A;  3HIF A;  2IAI A;  3EUH A;  3TO9 A;  3MKL A;  4B1R A;  2L7M P;  2W82 A;  2I10 A;  3BJ6 A;  4OAY A;  2EA2 A;  5FLV A;  4ENK A;  3F0C A;  1A5J A;  5EF6 A;  1ERD A;  1V4R A;  2JT1 A;  2YU9 J;  1V54 H;  2E5N A;  3HG9 A;  2CMP A;  1R49 A;  2LKP A;  3ELK A;  2KZG A;  3GLL A;  4IRG A;  3FK6 A;  1AWC A;  4A3J J;  2DDB A;  2DO7 A;  3LL7 A;  1G2H A;  3LMM A;  3HUG B;  1H9T A;  1TZL A;  1RZ4 A;  4CO8 A;  3H5A A;  5CVR A;  2TRT A;  1YO5 C;  2VPR A;  1UG0 A;  3QPS A;  3H0D A;  1FX7 A;  3K1P A;  2M7A A;  5FRO A;  1JUM A;  1XDS A;  3RZO J;  3BR6 A;  3RKY A;  4FX4 A;  1N75 A;  2GIV A;  2L9S A;  2V4J C;  4YEJ A;  2P8T A;  1FTT A;  4XSX F;  5DS9 A;  1XG1 A;  2V1U A;  4HX8 A;  3BCA A;  3CD6 I;  2FD5 A;  3H5N A;  3OYN A;  1YW7 A;  2N8G A;  4UV8 A;  1Y0N A;  3DPL C;  3J7Y J;  3I55 I;  3ZMS A;  2XC7 A;  3LSJ A;  2Z33 A;  2TCT A;  2K27 A;  1IRG A;  3CCE I;  2IVM A;  2DA2 A;  1OYW A;  3WTZ A;  2HR3 A;  2VAS A;  4BQO A;  4CCL A;  1UST A;  5JVG F;  2V9P A;  1WI9 A;  3LA2 A;  2ME6 A;  4ZZL A;  4OOI A;  5L3G A;  4YFX F;  2E2H J;  2PJR B;  2VBZ A;  1BOB A;  4LK1 F;  2CUJ A;  2NVQ J;  1VFC A;  2VJJ A;  2A68 F;  3HC7 A;  1LFU P;  2L0K A;  2M8G X;  1K83 J;  2MYS A;  4BNC A;  1JXS A;  2FU4 A;  3KPH A;  4G7O F;  2JUG A;  1RR7 A;  1Y0U A;  4HQM A;  1I39 A;  3BWG A;  4KMU X;  1K7A A;  3F21 A;  2IGK A;  1IUY A;  3MQ0 A;  2W7N A;  2R7U A;  5E18 F;  3OYG A;  3BJO A;  1VQ4 I;  1JT6 A;  2EZL A;  2M3A A;  4S04 A;  4S05 A;  3T0Y A;  1P7J A;  1ON1 A;  2EFO A;  4N4N B;  2K4B A;  2IS4 A;  3W6V A;  3CJR B;  3K7A J;  5A2Q K;  1MJB A;  2VKD A;  2FUG 2;  1K4S A;  1FP1 D;  1ONV A;  3HOU J;  1W5C C;  1XN7 A;  2BOL A;  2VLA A;  4IHY A;  3SDG A;  4O6J A;  3CDL A;  4IX7 A;  4LFU A;  3UR3 C;  1IXS B;  2E36 A;  2GOX B;  3EPZ A;  2R5Y A;  1N77 A;  3H35 A;  5FO5 A;  4A0Z A;  1K6Y A;  2OQR A;  3VFZ A;  1Z67 A;  5IT9 Z;  1H0M A;  4J19 A;  3KP6 A;  3QPT A;  2EV6 A;  5FKL A;  1BW5 A;  2XGX A;  2VC0 A;  1V5F A;  2BBY A;  2VE8 A;  2FML A;  4UB6 C;  5CQG A;  4GFB A;  2QQB A;  3CC2 I;  2DQR A;  4F52 A;  2EV5 A;  3CCQ I;  3IKV A;  3HRT A;  1I50 J;  2PMZ A;  3EYY A;  3HEF A;  2DMQ A;  2IP2 A;  3M9A A;  3T1B A;  3JAM Z;  1Y6I A;  4HG2 A;  4ON0 A;  3TDU C;  1JKO C;  2B0L A;  3SZT A;  2DOD A;  3O3K A;  5GPC A;  2ZB9 A;  4CHU A;  3F8C A;  2Z9O A;  1WJC A;  1EH6 A;  1WJA A;  2K86 A;  1TWF J;  2DAO A;  1BA5 A;  1PUF B;  5FRN A;  3Q9V A;  3MCZ A;  3GTQ J;  5F27 A;  4RDU A;  2VBY A;  3K4N A;  4ZDO A;  2FBK A;  4XR6 A;  3U1K A;  1XCB A;  3KZI C;  1SAX A;  4UV9 A;  2WTE A;  5E79 C;  5M5Y J;  5KCM A;  3DKY A;  2QVO A;  1SC7 A;  2VKE A;  2FMY A;  5HLT A;  4EJT A;  4JX4 A;  3VPR A;  3CJT B;  4CCO A;  1RR8 C;  4V19 K;  1WVR A;  3BDD A;  1ZGJ A;  5K7H A;  2PLY A;  2HTS A;  1LNW A;  3G73 A;  3B6C A;  2L54 A;  4D7M A;  4B3A A;  1DGW Y;  1WWX A;  5EGO A;  4IJA A;  3IHU A;  2F5D A;  1BBY A;  1GUU A;  2GAU A;  2XIG A;  2CUE A;  4EAT A;  4CZC A;  4A3E J;  2CQK A;  1A6Q A;  3OYA A;  4DZJ A;  3DLL F;  1I1S A;  4G9Y A;  3CME I;  4PJM A;  4ZDL A;  4XON A;  1X4O A;  2CUZ A;  5EZG A;  5BPD A;  2CQN A;  1O3S A;  3GVA A;  3BPX A;  3PJR A;  3CCY A;  1BI2 A;  1YG2 A;  2R7V A;  3U2R A;  1SFX A;  2PQ8 A;  2E1C A;  3TBI A;  4WX9 A;  3OYJ A;  3S93 A;  1KYZ A;  2CW7 A;  3P9I A;  1VQL I;  2HNH A;  3DPT A;  1SMY F;  3E6C C;  1ZRF A;  4A3I J;  1BI1 A;  4PFP A;  3L2W A;  3OV8 A;  1HKQ A;  3RTR A;  3KE2 A;  3IWF A;  3LSR A;  2XAJ A;  2BHY A;  3NEU A;  2RRE A;  4II3 A;  2IXS A;  4QTR A;  3LOC A;  1U5T A;  4YFN F;  3BZC A;  1IXC A;  3KZZ A;  3IAS 2;  4D0P A;  4I0B A;  1RUN A;  3CUQ C;  3I59 A;  2QGU A;  5H6R A;  1P4A A;  4LB6 B;  5E3L A;  1S9H A;  4RGX A;  5TJJ A;  1NG6 A;  2XRN A;  2HGC A;  3WHC A;  1Q1H A;  1TBX A;  1R23 A;  3HTU A;  3FDY A;  3REO A;  3DXJ F;  4X6A J;  4UUV A;  2O7O A;  2WV0 A;  2RV8 A;  3ECH A;  4BQN A;  1FOY A;  2K02 A;  2Y48 A;  5EYR A;  1HST A;  4X1E A;  3OOU A;  5D6E A;  1HDD C;  2STW A;  3M3Y J;  3I9V 2;  2CJJ A;  1BJA A;  1O57 A;  4ZYG A;  2DA6 A;  1GHC A;  4PSX A;  3Q3S A;  2MAB A;  3DFG A;  1SFO J;  1W0T A;  5K5Q A;  1W0U A;  4BE2 A;  1E3O C;  1UFM A;  5J4V A;  4DBQ A;  1ZR4 A;  3KX2 A;  4HYE A;  4Q4Z F;  3KLN A;  4LLL A;  5HVQ C;  2VJI A;  4V2G A;  3QP5 A;  2Z2S B;  2O8K A;  3QAH A;  2OU2 A;  3QYE A;  3W3C A;  2WC2 A;  2IA2 A;  2M8E A;  2E35 A;  2QZ8 A;  4NQW A;  5LBQ A;  4KA4 A;  2QWW A;  4E7H A;  3AKZ A;  3QOE A;  2Q8K A;  5A2Q Z;  3BG9 A;  3KEQ A;  1I27 A;  3L7W A;  2DT5 A;  1BW6 A;  1WSU A;  2HPM A;  2FOW A;  3OSG A;  3B73 A;  3D0S A;  1OCP A;  1RNL A;  4LG0 B;  1A36 A;  2KRF A;  3OYE A;  3FXL A;  2M5W A;  2XHK A;  1MMA A;  5JVT A;  1ETO A;  4S0H B;  2COM A;  3CLQ A;  2KDZ A;  3ZGK A;  3WGH A;  3ERM A;  4A5M A;  3N97 A;  1P92 A;  3DQV C;  1EH8 A;  2DDA A;  3DV8 A;  2IGM A;  1YW8 A;  3MKY B;  2HQN A;  3S3M A;  2IA0 A;  3I0T A;  5GAH J;  2VB6 A;  4PZJ A;  3I5U A;  1TNS A;  3V8L A;  2GA1 A;  4CIC A;  4XOP A;  4Y4R A;  4BJT A;  2V6E A;  3MFK A;  1VQN I;  2EIN H;  4KUM A;  1T98 A;  1SMT A;  3HM5 A;  5LLQ A;  2LLK A;  1B72 A;  1AKH A;  1FP2 A;  3ZXS A;  2CFO A;  4XRM A;  4H4K C;  2X51 A;  3VWB A;  1IN5 A;  4HX7 A;  4Y17 A;  4Y7N J;  2DMN A;  2KRC A;  1YOV B;  1YX3 A;  4FET A;  1XDU A;  3VDX A;  1Q1V A;  2VBW A;  2BGC A;  2JN6 A;  2DFI A;  3J7Z I;  1QGP A;  2OV7 A;  4MIM A;  4D5C A;  3FXO A;  2VJ5 A;  5KAI C;  5E3N A;  2XKO A;  1MDM A;  1ZHF A;  3OWT A;  3V4G A;  2JUC A;  1XX5 A;  5FGM A;  1VND A;  2DPD A;  1SVM A;  3F8N A;  4Y3O A;  5J1Y A;  1Z9C A;  4B48 A;  2JTV A;  1JTX A;  3B6A A;  2UXX A;  5EEH A;  1XSX A;  3TW6 A;  5HLG A;  2ZNY A;  3M8J A;  4NDL A;  3Q5F A;  1V55 H;  1HBX G;  5ILS A;  5GAG J;  2DOA A;  3C1D A;  1MD0 A;  4IOA F;  2C6Y A;  2LSO A;  4C3J J;  3BR0 A;  4ZZD A;  1WGX A;  4XLC A;  3GBG A;  2EFQ A;  3GFJ A;  2XRO A;  1L3L A;  4E6K G;  1G59 A;  4OIQ F;  2UWM A;  1C0W A;  4FHT A;  4ESJ A;  4LLN A;  2DT6 A;  5JFR A;  4BAC A;  1ODD A;  4HBL A;  4BQA A;  3CZ6 A;  1WZ2 A;  1GVJ A;  3R0A A;  2JWT A;  1LEA A;  2CV1 A;  3GUD A;  3SHF A;  3HOT A;  3FMQ A;  3KYC B;  1ZRC A;  3ERE D;  3M8F A;  3OY9 A;  1E3P A;  2ICW G;  5F64 A;  5ILV A;  4AD9 A;  4DOZ A; 
#chains in the Genus database with same CATH homology
 2L4M A;  4I09 A;  4HW0 A;  2L01 A;  2BEO A;  2HZT A;  4IRH A;  2HWV A;  3R4K A;  1FBQ A;  5CVV A;  4U0Y A;  3K1M A;  3KP3 A;  2L4A A;  4EM0 B;  4GCV A;  1UB9 A;  2KIF A;  4XLP F;  1D5V A;  3V7S A;  3E6M A;  4U88 A;  1G3W A;  1RIO H;  4L9V A;  3ABT A;  4G6Q A;  1XD7 A;  1X3U A;  2W57 A;  1TQI A;  2HS5 A;  1FYL A;  2O3F A;  1DPR A;  3RPQ A;  4EJW A;  2KIU A;  4K2E A;  3JSO A;  1FNN A;  3QP6 A;  2VXZ A;  3R6S A;  2RC4 A;  5HDK A;  2EFW A;  3RYP A;  4NB5 A;  4M9X A;  2RQP A;  3LQR A;  2FE3 A;  3JTG A;  1WKM A;  2K7L A;  4AWX B;  5K1Y A;  3HTS B;  4HDU A;  3FXR A;  5AIP A;  5D5W B;  3IRQ A;  4G7Z F;  1J0R A;  4ZYD A;  2NYX A;  1Z91 A;  2CGP A;  2HKX A;  3E6D A;  2QQ9 A;  3EDP A;  4IF4 A;  1S8N A;  1FOK A;  1I5Z A;  1IZ1 A;  1IW7 F;  5AIQ A;  5FFX A;  2MC3 A;  1D3Y A;  4MTD A;  4YII A;  1O3Q A;  5IT9 K;  2DPU A;  1HW1 A;  1YS6 A;  5LRR A;  2OD5 A;  3FM5 A;  1J5Y A;  4O5V A;  3RYR A;  3HHH A;  1U2W A;  1G3S A;  1ZYR F;  4R8H A;  4A0X A;  3EYI A;  3WE3 A;  1YIO A;  1SD6 A;  3PQK A;  2O61 A;  2QYO A;  3E5X A;  2GXB A;  2DW4 A;  2GZW A;  3GZ5 A;  1LB2 A;  3RJP A;  3GX4 X;  1OR7 A;  4KN7 X;  1U6G A;  1B6A A;  2R7F A;  4L5I A;  4M6Y A;  4A12 A;  1W7P B;  2XV4 S;  4LD5 A;  1MZB A;  2L3D A;  1TNT A;  3L2C A;  2VBX A;  4L18 B;  3RKX A;  2RDP A;  5EEG A;  3FMS A;  4WF2 A;  1G3T A;  3K0L A;  4CGZ A;  1ULY A;  5L3E A;  3EQL F;  3TQN A;  2XKP A;  5E17 F;  1GXP A;  3HSE A;  1DPU A;  4AIH A;  1SFU A;  4YIF A;  3FWE A;  4LG0 A;  3WTT C;  1LDK B;  5FFZ A;  1T0F A;  4AVP A;  4RB1 A;  2A69 F;  1BOA A;  1J59 A;  1W7P D;  4L0Y B;  3FM3 A;  4HV6 A;  4ENN A;  2LNB A;  3ZN0 A;  1DDN A;  5LEJ A;  2R3S A;  1D8J A;  1B4A A;  4I2O A;  1SD5 A;  2EV0 A;  3ZMZ A;  1K78 A;  5K5R A;  1S6L A;  2H94 A;  1KGS A;  2EB7 A;  3TKY A;  2ZBK A;  4WCG A;  2O6G E;  4I0A A;  1CF7 B;  2GWR A;  3HRM A;  3FXU A;  3FF5 A;  3GF2 A;  2DLL A;  1HKT A;  2IJL A;  1BI3 A;  1ZGA A;  3D5L A;  4MTE A;  4BHC A;  4U7D A;  4ESB A;  3FXQ A;  2G9W A;  4G6D A;  2ZFW A;  2D1V A;  2XAG A;  5KK1 A;  2P6T A;  1R36 A;  2Q2E A;  3ULQ B;  4OU0 A;  1FLI A;  3NQO A;  2IA1 A;  3KP2 A;  2EA4 A;  5D4S A;  1HW2 A;  3ZQ7 A;  5CVJ A;  4EQQ A;  1QO0 D;  1IRF A;  1HXD A;  2XUB A;  1IXR C;  2NNY A;  2OZ6 A;  1B59 A;  4UHT A;  3F8F A;  3KP5 A;  4HDV A;  1P4W A;  2WWY A;  4EM1 A;  3TOB A;  1S7O A;  3FX3 A;  3WGG A;  3TDZ C;  3WOD F;  3MZH A;  2Z5U A;  4UVB A;  3JTH A;  5BMZ A;  4EMS A;  4A0Y A;  5ERI A;  4RGS A;  2FEZ A;  2ADU A;  4Q48 A;  2FNP A;  1HW5 A;  1XGM A;  1S3J A;  3E3V A;  1J7K A;  3ABU A;  2BYV E;  3S2W A;  3MAJ A;  2A6H F;  2CWE A;  3W6J B;  1PP8 F;  3CO7 C;  1IAW A;  1T39 A;  1XSD A;  3T8R A;  2QBY B;  2P5V A;  1B9N A;  1T38 A;  1J9I A;  4ENM A;  2RNJ A;  2M45 A;  5HS8 A;  3WTW C;  5CLS A;  5HDG A;  1ZG1 A;  3CDH A;  3F8B A;  2XAF A;  1O7L A;  1J75 A;  3P9C A;  3RKW A;  3SXY A;  2QUF A;  5DCM A;  2K4J A;  4YG2 F;  2ISZ A;  3DP7 A;  4HZF A;  5FLX K;  4L0Z B;  2R7D A;  4MHG A;  3MWM A;  3BOQ A;  1AOY A;  1FWZ A;  5D8K B;  2NRA C;  1FSE A;  2ETH A;  4KIC A;  1SFE A;  3GLX A;  1XB4 A;  5JR3 A;  1XCV A;  3KET A;  2ZXJ A;  3FHZ A;  1B1B A;  2AXL A;  2LF8 A;  4BHP A;  2JRT A;  3GXO A;  4HOB A;  2VN2 A;  4U0V A;  2OZU A;  3GFM A;  4P9F A;  1YLF A;  1TLH B;  2DI3 A;  3C18 A;  1KA8 A;  4HLY A;  1KU7 A;  4UNO A;  1KYW A;  1R58 A;  3LAJ A;  2LF7 A;  3EET A;  4P5O A;  4Y15 A;  2PN6 A;  4XRF A;  1HSJ A;  2NS0 A;  5HLH A;  5HS7 A;  5HDN A;  5LRS A;  1A04 A;  2V1D A;  3QOP A;  1Z7U A;  3H3U A;  2H09 A;  3WTV C;  1XMK A;  1FBS A;  2FBH A;  2MH2 A;  4EM2 A;  3H3Z A;  4N0B A;  4GYI A;  2CYY A;  2Q0O A;  3K9T A;  1CGP A;  1XMA A;  1FT9 A;  2OQG A;  4QLC U;  3K69 A;  4IHT A;  5L3C A;  3CUQ B;  3J80 Z;  2F5C A;  5L3F A;  2V1X A;  3M1E A;  3HUG A;  2HFH A;  4AIK A;  1P2F A;  4UVC A;  2E7X A;  5E1Z B;  1BI0 A;  3VOD A;  3BPV A;  1DUX C;  3LA7 A;  1TTY A;  1PP7 U;  2YU3 A;  3B02 A;  1BIB A;  3GFL A;  3ISP A;  4I02 A;  5ILU A;  3HRS A;  4M6X A;  2ZCW A;  4HF1 A;  3T5X A;  2GA2 A;  2Z99 A;  4Y13 A;  1T2K A;  1RI7 A;  3MEX A;  3TO7 A;  2HTJ A;  2P7V B;  2ESH A;  1JE8 A;  3LWF A;  1KU2 A;  2HQR A;  5L3B A;  1FY7 A;  2D45 A;  2CG4 A;  3TOA A;  3F3X A;  2IT0 A;  4ZH4 F;  1G4D A;  3LA3 A;  1BC7 C;  3RPU A;  1LVA A;  5E20 A;  1OKR A;  3LST A;  1RUO A;  1ZRD A;  1R1V A;  1WRJ A;  5FD5 A;  4PGH A;  1QZY A;  4CXF A;  3QU6 A;  2OAZ A;  1IN4 A;  5FLX Z;  3RDI A;  3CUO A;  3R61 A;  5F6F A;  2PMU A;  4KT5 C;  5D5U B;  4Q5S F;  3JW4 A;  3JSP A;  1IF1 A;  1XGN A;  2RGV A;  2V6C A;  5CVU A;  4FX0 A;  1T6S A;  2CW0 F;  1QZZ A;  4KNY A;  2STT A;  2MLK A;  1W5T A;  4LLG F;  3WTS C;  2O03 A;  5DDG A;  2CSO A;  3U1D A;  3TO6 A;  2XAQ A;  2A6E F;  4GYG A;  2EJR A;  1Z1D A;  1G3Y A;  1U5T C;  3FMR A;  1J2X A;  4A6E A;  4IRI A;  1FBU A;  2PI0 A;  3CJN A;  4EJO A;  2VE9 A;  3MZY A;  5BPI A;  4A6D A;  3VB2 A;  1BC8 C;  2CO5 A;  2PEX A;  4ENJ A;  2PG4 A;  3BY6 A;  4FT8 A;  2QM3 A;  2ZNZ A;  4G8X A;  4HF0 A;  3J81 Z;  1LDJ A;  5DV5 A;  2ISY A;  3I64 A;  2V79 A;  3IKT A;  1UHW A;  2JPC A;  4L9J A;  1JHF A;  2FA5 A;  1R22 A;  2J5O A;  1MGT A;  4HA8 A;  2AS5 F;  3WGI A;  1IN7 A;  2FSW A;  2DQL A;  2MLG A;  3DEU A;  4IPA A;  4GO1 A;  5D5X B;  3HHG A;  1S29 A;  4CDG A;  4I98 B;  1R5G A;  1ZLK A;  1QPM A;  3F8M A;  4BYY A;  3G3Z A;  4MQ9 F;  3NRV A;  2ACJ A;  4WXD A;  1Z05 A;  2UXN A;  1FZP B;  5K5O A;  2G7H A;  2A61 A;  1U5T B;  5D6F A;  3P9K A;  1WQ2 A;  1XGO A;  5D8L B;  3I59 B;  1S7A A;  5J8C A;  4IVN A;  1TQP A;  2OA4 A;  1W4M A;  2A3S A;  4A2U A;  4LK0 F;  2YX7 A;  3C3W A;  2BE5 F;  2RVC A;  1K79 A;  3E5U A;  2XAH A;  4XBF A;  2ZME B;  1F9N A;  5CVI A;  2PJP A;  2W85 A;  4R1H A;  1B9M A;  5LHG A;  3E97 A;  2PFB A;  2MA3 A;  3IC7 A;  3ZMT A;  5DCF A;  2IRF G;  1MKM A;  2P5K A;  3I58 A;  3TGN A;  5LHH A;  4EV0 A;  2HYF A;  3ZPL A;  1H9G A;  5DD8 A;  2Y75 A;  2QLZ A;  1ZAO A;  2MD5 A;  1P4X A;  1REP C;  5HOO A;  4M9S A;  4N9H A;  2ELH A;  5LHI A;  4ESF A;  4M73 A;  1NHA A;  1TW3 A;  3KFW X;  1SD7 A;  3F6V A;  3KP7 A;  4MGR A;  2X0L A;  1LDD A;  5AON A;  1UCR A;  3M7G A;  4CZZ A;  2M30 A;  3CUQ A;  3HOS A;  2NAZ A;  2FF4 A;  1W5S A;  3V7C A;  2A07 F;  3V8K A;  1EH7 A;  5L3D A;  5E8I A;  2VT2 A;  4BHB A;  4EGY A;  3RIR A;  3GFI A;  1OYY A;  4EJU A;  2M87 A;  4IHS A;  4LJZ F;  4QWQ A;  3BZ6 A;  5ICG A;  1MDM B;  5LGT A;  5ED4 A;  4DQ2 A;  3PFI A;  3HSR A;  1KQ8 A;  2A5Y B;  4UXN A;  5ICE A;  3L00 A;  3KLO A;  4L9T A;  1U78 A;  4KDP A;  3GEZ A;  2YPR A;  5FB2 A;  3DKW A;  2RN7 A;  1F4K A;  2M1B A;  5E8G A;  1MJA A;  4B8X A;  1LQ1 A;  5LGN A;  3OOP A;  4L9N A;  4EJV A;  2YX4 A;  2W24 A;  4UVA A;  4EGZ A;  3O6B B;  1VTN C;  1QNT A;  4OIP F;  1V3F A;  3J80 K;  3WG9 A;  4P55 A;  4JK1 X;  2D1H A;  4RAZ A;  4BAY A;  4P9U A;  1EV7 A;  4HAM A;  4M72 A;  2QQA A;  3WE2 A;  5DD4 A;  1KQ0 A;  2FOK A;  5E1X A;  4A5N A;  3IWZ A;  4HLX A;  3COA C;  2H6B A;  1KU3 A;  2MH9 A;  1OYI A;  2YSR A;  2JZY A;  1U8R A;  3F6O A;  2G7U A;  4I01 A;  3H92 A;  3GW2 A;  5FD6 A;  3LAP A;  5LEK A;  3IL2 A;  3E6B A;  3P7N A;  3E5Q A;  3SFZ A;  3HSF A;  2DTR A;  4P96 A;  3CO6 C;  1FPQ A;  1ZH5 A;  2D2W A;  3ZN1 A;  4B09 A;  2FNA A;  1F1Z A;  3I54 A;  3L9F A;  2FQ3 A;  4KIF A;  3GZ6 A;  5LGU A;  2Z3Y A;  3GYH X;  1R1U A;  3PQJ A;  2DK8 A;  1FYM A;  4RB3 C;  3WU1 B;  4G7H F;  3BP8 A;  2O8X A;  2VT3 A;  4IXA A;  1YYV A;  2KIM A;  1YW9 A;  3KCC A;  4MEX F;  5TRD A;  5JI6 A;  4OIR F;  1GXQ A;  2YR2 A;  2X4H A;  2DK5 A;  3DF8 A;  2NNN A;  2HKO A;  1FYK A;  2DU9 A;  4EVI A;  3V7R A;  1PUE E;  4M71 A;  4U7B A;  4PCQ A;  3ZMD A;  2UZK A;  2J5P A;  3FZV A;  4WXC A;  2P4W A;  2JSC A;  4DNC A;  4PDK A;  5D5V B;  3U9G A;  4YFK F;  5DEQ A;  2F2E A;  3Q9S A;  1XSV A;  3LFK A;  4RS8 A;  1IN6 A;  5ICC A;  4Z2Y A;  2ZME A;  5J8F A;  1W7P A;  3F72 A;  3J81 K;  3WTY C;  3HRU A;  2W84 A;  5ICF A;  4LGW A;  3HYI A;  5BS6 A;  2E7W A;  3QRF F;  4RGR A;  4CYD A;  4M9Z A;  3BJA A;  5DUK A;  1HKS A;  1UHM A;  2PBI A;  3ROU A;  4HX4 A;  4L5J A;  2ZJ2 A;  4KMF A;  3KP4 A;  4MQV A;  3RI4 A;  1O3R A;  5D4R A;  3ECO A;  1TQM A;  4HV5 A;  4HF2 A;  4ZYH A;  5JHU A;  5J6X A;  2VOD A;  2O0Y A;  1QQI A;  4AIJ A;  4XLN F;  5DUI A;  2FRH A;  1FC3 A;  4WXH A;  1QBJ A;  1IN8 A;  1U3E M;  1USS A;  1ZG5 A;  2H27 A;  1R5H A;  3I53 A;  3SZP A;  5HLI A;  1KU9 A;  1L0O C;  1K78 B;  4XSZ F;  2VOP A;  1K6O A;  2P7C B;  2KJB A;  4KN4 X;  1ZLJ A;  2EFP A;  1CF7 A;  3ML6 A;  2L02 A;  1SD4 A;  3F22 A;  1I6X A;  3M8E A;  1F5T A;  3WTU C;  1LEB A;  1ZN2 A;  2P6S A;  2H6C A;  4Q47 A;  1Z6R A;  2F5F A;  1PDN C;  1O7F A;  2XVC A;  2DBB A;  2PMH A;  1E17 A;  3O2P E;  4WK8 F;  1JHH A;  2LDU A;  1OMI A;  4GGG A;  1YFH A;  4OMZ A;  3J7A O;  2RKH A;  3AAF A;  4MNU A;  1E2X A;  3V8J A;  1FSH A;  3R0J A;  2VON A;  2HDC A;  3F23 A;  2V9V A;  1BIA A;  1TW2 A;  3GWZ A;  4KFC A;  1P6R A;  5BOX A;  1Z6T A;  3C7J A;  4N9I A;  3ZMV A;  3T8T A;  4HQE A;  4BXU A;  2QEN A;  1YQA A;  4F7Z A;  4RGU A;  4WWC A;  3QPH A;  3R60 A;  2FXA A;  4LB5 A;  3I4P A;  5DYM A;  4LMY A;  2BV6 A;  4JBA A;  4RB2 C;  4MEY F;  5F1R A;  3VEP A;  3K2Z A;  4R79 A;  2HYG D;  1JGS A;  3WU0 A;  4PGG A;  1BN5 A;  3W6K B;  5CYV A;  2QBY A;  3QU3 A;  5H20 A;  5BQT A;  4BH9 A;  1OPC A;  3WTX C;  4U0W A;  4ZYE A;  4KIG A;  4KYW A;  2HOE A;  4GXO A;  2F5E A;  3VOE A;  3ZMU A;  4E70 A;  1DP7 P;  2VOO A;  5DCM B;  4OIO F;  2KKO A;  1R7J A;  1YS7 A;  2IPQ X;  3K1N A;  4M74 A;  4RAY A;  1LJ9 A;  3BRO A;  2IW5 A;  2VC1 A;  3SQN A;  4H0E A;  1O3T A;  5KVR A;  3L09 A;  4KIB A;  4JQF A;  1XGS A;  2W25 A;  1KQ9 A;  4G94 A;  3KEO A;  5IT3 A;  3ZP5 A;  2CFX A;  1ON2 A;  2OBP A;  2ESN A;  3I71 A;  2Y0M A;  3IRR A;  4ASN A;  1D8K A;  2TDX A;  1BM9 A;  2P5L C;  2KJC A;  1R00 A;  4OIN F;  4OMY A;  2MBF A;  2E1N A;  3GO5 A;  2ZO4 A;  3JAM K;  2XAS A;  4RB0 A;  1MJ9 A;  3KZY A;  1ZRE A;  1STZ A;  1R1T A;  1YTY A;  2GQQ A;  3CLO A;  4NHJ A;  2EFN A;  2EWN A;  2JPB A;  4ETS A;  3CTA A;  3N4M A;  6PAX A;  2FBI A;  2ZKZ A;  5HS9 A;  1ZAR A;  2GXG A;  1ZG3 A;  4I7H A;  1G6N A;  2EK5 A;  4O3M A;  3LQQ A;  5E1W A;  1HQC A;  1I1G A;  5CJ9 A;  5H6Q A;  4TV7 A;  2HEO A;  3HIF A;  3EUH A;  3TO9 A;  3BJ6 A;  2EA2 A;  4ENK A;  1V4R A;  2JT1 A;  2LKP A;  3ELK A;  4IRG A;  1AWC A;  2DO7 A;  1H9T A;  1RZ4 A;  4CO8 A;  5CVR A;  1YO5 C;  1FX7 A;  3K1P A;  1XDS A;  3RKY A;  4FX4 A;  2GIV A;  2P8T A;  4XSX F;  2V1U A;  4HX8 A;  1YW7 A;  4UV8 A;  3DPL C;  3ZMS A;  2Z33 A;  2K27 A;  1IRG A;  2IVM A;  1OYW A;  3WTZ A;  2HR3 A;  1UST A;  1WI9 A;  3LA2 A;  5L3G A;  4ZZL A;  4OOI A;  4YFX F;  2VBZ A;  4LK1 F;  2A68 F;  4BNC A;  1JXS A;  2FU4 A;  4G7O F;  1Y0U A;  4HQM A;  3BWG A;  4KMU X;  1K7A A;  3F21 A;  1IUY A;  3MQ0 A;  5E18 F;  3BJO A;  4S04 A;  4S05 A;  3T0Y A;  2EFO A;  1ON1 A;  2K4B A;  5A2Q K;  1MJB A;  1FP1 D;  1ONV A;  1XN7 A;  4O6J A;  4LFU A;  1IXS B;  5FO5 A;  4A0Z A;  2OQR A;  3VFZ A;  5IT9 Z;  1H0M A;  3KP6 A;  3QPT A;  2EV6 A;  2XGX A;  2VC0 A;  2BBY A;  2VE8 A;  2FML A;  2QQB A;  2DQR A;  2EV5 A;  3IKV A;  3HRT A;  3EYY A;  3T1B A;  2IP2 A;  3M9A A;  3JAM Z;  4ON0 A;  3TDU C;  2B0L A;  3SZT A;  3O3K A;  4CHU A;  3F8C A;  2Z9O A;  1EH6 A;  2K86 A;  2DAO A;  3Q9V A;  3MCZ A;  2VBY A;  2FBK A;  1SAX A;  1XCB A;  4UV9 A;  2WTE A;  2QVO A;  2FMY A;  4EJT A;  3BDD A;  1ZGJ A;  2PLY A;  2HTS A;  1LNW A;  3G73 A;  2L54 A;  1WWX A;  4IJA A;  3IHU A;  2F5D A;  1BBY A;  2GAU A;  2XIG A;  2CQK A;  1I1S A;  4G9Y A;  5BPD A;  1O3S A;  3GVA A;  3BPX A;  1BI2 A;  1YG2 A;  3U2R A;  1SFX A;  2PQ8 A;  2E1C A;  4WX9 A;  1KYZ A;  3P9I A;  3DPT A;  1SMY F;  3E6C C;  1ZRF A;  1BI1 A;  3OV8 A;  1HKQ A;  3RTR A;  3KE2 A;  3IWF A;  2XAJ A;  3NEU A;  1U5T A;  4YFN F;  1IXC A;  3KZZ A;  4D0P A;  4I0B A;  1RUN A;  3CUQ C;  3I59 A;  5H6R A;  1P4A A;  4LB6 B;  4RGX A;  5TJJ A;  2XRN A;  2HGC A;  1Q1H A;  1TBX A;  1R23 A;  3HTU A;  3REO A;  3DXJ F;  4UUV A;  2WV0 A;  2RV8 A;  3ECH A;  2K02 A;  2Y48 A;  1HST A;  5D6E A;  2STW A;  1BJA A;  1O57 A;  4ZYG A;  1GHC A;  3DFG A;  5K5Q A;  1UFM A;  4Q4Z F;  4HYE A;  3KLN A;  4LLL A;  5HVQ C;  3QP5 A;  3QAH A;  2OU2 A;  2WC2 A;  2IA2 A;  2M8E A;  2QZ8 A;  4NQW A;  5LBQ A;  4KA4 A;  2QWW A;  2Q8K A;  5A2Q Z;  3KEQ A;  1I27 A;  3L7W A;  2DT5 A;  1WSU A;  3B73 A;  3D0S A;  1RNL A;  4LG0 B;  2KRF A;  2M5W A;  2XHK A;  5JVT A;  2COM A;  3WGH A;  3N97 A;  4A5M A;  1P92 A;  3DQV C;  1EH8 A;  3DV8 A;  1YW8 A;  2HQN A;  2IA0 A;  3I0T A;  4PZJ A;  3I5U A;  1TNS A;  3V8L A;  2GA1 A;  4CIC A;  3MFK A;  4KUM A;  1T98 A;  1SMT A;  5LLQ A;  1FP2 A;  1IN5 A;  4HX7 A;  4Y17 A;  1XDU A;  2VBW A;  2BGC A;  2DFI A;  1QGP A;  2XKO A;  1MDM A;  1ZHF A;  3V4G A;  5FGM A;  2DPD A;  3F8N A;  1Z9C A;  2JTV A;  2UXX A;  5EEH A;  1XSX A;  3Q5F A;  5HLG A;  2ZNY A;  1HBX G;  5ILS A;  3C1D A;  1MD0 A;  2C6Y A;  2LSO A;  4ZZD A;  2EFQ A;  3GFJ A;  2XRO A;  1L3L A;  4OIQ F;  2UWM A;  1C0W A;  4FHT A;  4ESJ A;  4LLN A;  5JFR A;  1ODD A;  4HBL A;  4BQA A;  1GVJ A;  3R0A A;  1LEA A;  3GUD A;  3SHF A;  3HOT A;  3FMQ A;  1ZRC A;  3ERE D;  3M8F A;  5F64 A;  5ILV A;  4AD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...