2RVCA

Solution structure of zalpha domain of goldfish zbp-containing protein kinase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
64
structure length
64
Chain Sequence
MSAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Z-DNA binding domain of PKR-like protein kinase from Carassius auratus and quantitative analyses of the intermediate complex during B-Z transition.
pubmed doi rcsb
source organism Carassius auratus
molecule tags Dna binding protein
molecule keywords Interferon-inducible and double-stranded-dependent eIF-2kina
total genus 24
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rvcA00
4PZJA 4G9YA 2GA1A 4CYDA 1RIOH 1XB4A 4BHCA 4L18B 3HYIA 4AWXB 3QU6A 4XBFA 2HTJA 1D8JA 1E17A 5LEKA 2VBWA 3ECOA 1FZPB 3I59B 1T38A 3ZP5A 3K69A 2KJCA 1XD7A 3O2PE 3IRQA 4U0YA 5BMZA 4HOBA 1SD4A 2YR2A 1USSA 3C1DA 3I5UA 1G3YA 5FFXA 2IT0A 1ZH5A 1AOYA 1WQ2A 3E3VA 5HDNA 4FT8A 2DI3A 3ZMDA 2QBYB 5FO5A 2EFWA 2LNBA 3KP3A 3RKWA 1T6SA 2P6SA 1MJAA 3IWFA 4G7HF 4WXHA 2FMLA 4XLPF 5D8LB 2GIVA 1BIBA 5ILUA 3H3UA 3VOEA 2VC1A 2EWNA 5DUIA 4IRIA 2L02A 1PP7U 1B1BA 3PQKA 5HLGA 2FE3A 2KJBA 3KETA 1D5VA 3J7AO 1KGSA 2DW4A 1K78B 3ZN1A 3T0YA 1U78A 2EK5A 2EJRA 5ICGA 4H0EA 3BOQA 3GVAA 1C0WA 1SFEA 1SD6A 4LLLA 1HKSA 2P5KA 3MCZA 4F7ZA 3R60A 4A0XA 3JAMZ 4NQWA 2BV6A 5BOXA 1YLFA 2JSCA 3C7JA 3LAJA 4OMZA 4GGGA 2HR3A 5HS9A 1ZLKA 4ZZLA 4BNCA 5D4RA 5A2QK 1IXRC 1ZLJA 3DKWA 4ESBA 1IN4A 2NNYA 2P4WA 2V9VA 1YIOA 1ZN2A 3F72A 5KVRA 2VE8A 5LBQA 3WU1B 1J7KA 5E1ZB 1T98A 3E6DA 2QBYA 3HSEA 2CW0F 2XGXA 1TQIA 1Z05A 2MBFA 1GVJA 1LNWA 3WU0A 5K5RA 2Z33A 1GXPA 4UVBA 3F23A 3I53A 2OU2A 2DQRA 3H92A 1W5TA 2ACJA 2M8EA 3I4PA 1IZ1A 3V7CA 2VBXA 4HV6A 1OKRA 1O3QA 3FZVA 1ONVA 3G73A 2BBYA 3F8CA 5L3DA 1ZREA 1EH6A 5TJJA 3HIFA 2IA2A 3R0JA 2P7VB 5CLSA 1XSDA 3V8LA 2Q8KA 1RUNA 1O3SA 4HLYA 4L5IA 1F9NA 2HQRA 1STZA 4MQ9F 3WTYC 3K1NA 2W24A 1LDDA 1QZZA 4EJOA 2CG4A 1IRFA 4ETSA 2RQPA 2M5WA 5BPDA 3EYYA 1V3FA 3IHUA 3SHFA 3R0AA 4HBLA 4UVCA 3QPHA 1KYWA 4XRFA 4OMYA 2CFXA 3HHHA 5LGTA 4IVNA 2DU9A 5F6FA 3C18A 3K9TA 3F3XA 3U2RA 5DEQA 4LG0B 3HSFA 2A07F 2UWMA 4Q47A 2PMHA 2GXGA 1TNSA 2E1NA 4IJAA 4IHSA 2QWWA 1HW2A 5CVIA 1LDKB 3E97A 4WXCA 4A12A 5JR3A 2C6YA 1G3TA 1JHFA 4K2EA 4XSXF 1MDMA 4RB0A 1I5ZA 2F5EA 2HFHA 1HSJA 1RI7A 3GUDA 1HW1A 3P9CA 2HKXA 3EDPA 1EV7A 2HDCA 2H6CA 1WI9A 1BN5A 1XGNA 2VT3A 3LA2A 4MNUA 3KZYA 5LRRA 5FD6A 5A2QZ 3DEUA 4A0YA 4QLCU 2O8XA 3HUGA 2Z3YA 1U5TC 2XUBA 5ICEA 3WTUC 4IXAA 4Q5SF 5ILSA 1B4AA 1IN8A 2V1UA 1G6NA 1XMAA 1WKMA 2VOOA 2HGCA 2QQBA 2BE5F 3MAJA 1SMYF 1KQ9A 3NQOA 4P9UA 1G4DA 3PQJA 1FYMA 3R4KA 4NB5A 3IWZA 2XHKA 1REPC 1U5TA 1DPRA 3ZMZA 1TBXA 4MEYF 5DCFA 4OIPF 5D6EA 2V6CA 3RPUA 4O5VA 3CUQB 3VFZA 1RNLA 1YG2A 5LRSA 2R3SA 4MGRA 3GW2A 3NEUA 2MA3A 2MH2A 2QUFA 1KU3A 3T8TA 4CICA 1YS6A 4ENMA 2JZYA 3WTZA 4M6XA 1PUEE 2BGCA 2PQ8A 1Z91A 5H6RA 5DD4A 1O7LA 3MQ0A 4HA8A 4CHUA 1GXQA 4EJVA 3GZ5A 2RVCA 1QQIA 2D1VA 1ZGJA 4M72A 1CF7B 3SZTA 1BBYA 3KZZA 1W7PA 3GF2A 3FMSA 3M7GA 2FOKA 4HV5A 1ON1A 4LK1F 1HXDA 3I0TA 1FWZA 3ABTA 3RIRA 4YG2F 3I54A 1VTNC 2ZO4A 2EV5A 4RGXA 3FF5A 1TQMA 4QWQA 3CJNA 3ZMTA 3DXJF 4UXNA 2JRTA 4ZYHA 3QAHA 4ZYGA 1IN5A 5DDGA 2K7LA 3ZPLA 3F6OA 1WRJA 3KP5A 2FBIA 4RAZA 1UB9A 2XASA 4IHTA 4ZH4F 5DV5A 1O7FA 1ODDA 3GFLA 2VOPA 4U7BA 4M9XA 3AAFA 2XRNA 4I01A 3F21A 2PN6A 3BROA 3HRSA 3RKXA 2V1DA 3WODF 2H94A 3T5XA 2J5OA 2YPRA 4ASNA 2HKOA 3FM3A 4LB6B 2L4MA 3LA3A 3TGNA 3TO7A 4BHPA 4EVIA 5L3CA 1U6GA 1DP7P 3F22A 1B9NA 2O61A 1K7AA 4HX7A 1MKMA 2QENA 2FNAA 2PLYA 1OYIA 4UV8A 3V4GA 4ZYDA 1YW8A 4A5MA 4EJTA 1TTYA 4G6DA 3GXOA 5K5OA 3I71A 1ZRDA 2P7CB 2DT5A 5ILVA 4HQMA 3DFGA 3CTAA 3LQQA 2WWYA 2G7UA 1I27A 4M9SA 3SFZA 2EV0A 3RYRA 5HDKA 4D0PA 3ULQB 3DV8A 1TW3A 4Y17A 2IRFG 4KIGA 1YW9A 2XAFA 1BC8C 3JTGA 1KQ0A 1QO0D 2G7HA 4EGYA 3CLOA 1P4XA 2L01A 2D1HA 1Y0UA 2M87A 1PDNC 3KE2A 4EQQA 2KIFA 2O0YA 4U88A 1J0RA 4G6QA 2CWEA 3F8BA 3D0SA 4L5JA 4EJUA 2OQGA 2M30A 4GO1A 5E1WA 1P92A 4MEXF 2K02A 4HYEA 4R1HA 1W4MA 1HBXG 4MHGA 3IKVA 3G3ZA 5D5XB 4AIHA 4LGWA 2Z99A 5LHIA 3KCCA 2JPCA 1R7JA 5BQTA 2Y75A 1R1TA 4L9TA 3E5XA 2O03A 1XDSA 3DP7A 1U2WA 4HF1A 4CZZA 4PGGA 2RDPA 4BAYA 2RV8A 5CYVA 1T2KA 3BJAA 4L9VA 3EYIA 3KLOA 4UNOA 3HTSB 1MJBA 4HF0A 1H9TA 5JFRA 2HZTA 4LB5A 5CVVA 2ZMEB 2KIUA 4E70A 1BC7C 1BOAA 1F5TA 5EEGA 2K4JA 1G3SA 4Y15A 4AD9A 3OOPA 4U0VA 2EFNA 3J80Z 3WTWC 4Q4ZF 4M6YA 5ICCA 3I58A 4WXDA 4U7DA 4N9HA 1P4AA 5E8GA 4MTEA 1ZG3A 1S6LA 4KICA 2X4HA 5LLQA 1FPQA 3IC7A 3FXQA 2FNPA 5FD5A 1TLHB 3ECHA 5J6XA 2DPUA 5FGMA 3Q9SA 2V1XA 2GWRA 2ZCWA 1MZBA 4A2UA 3I59A 4KMUX 1ZAOA 4CGZA 5ERIA 2XROA 1ZHFA 5LGNA 1FOKA 1I6XA 1G3WA 2RC4A 4KDPA 2VXZA 3HRTA 1GHCA 4ESJA 3MEXA 2DAOA 1B6AA 3GLXA 2F5DA 4IF4A 3TQNA 1IF1A 1FSEA 1UHMA 2STWA 2ELHA 3QU3A 3J81Z 4YIIA 2FQ3A 1J75A 3QRFF 3KFWX 2A69F 2EFPA 1CGPA 5FFZA 2OZUA 3HRMA 4G7ZF 3ELKA 1SD5A 2ISYA 1YQAA 3QP5A 2X0LA 1JHHA 5IT3A 2STTA 4I0BA 3O3KA 2VE9A 2D2WA 2IVMA 5E8IA 3E5QA 2HS5A 1QNTA 3RI4A 1T0FA 3W6JB 2ZJ2A 3P9IA 6PAXA 2EB7A 4UUVA 4KIBA 2WTEA 3B73A 3SXYA 3WE2A 4TV7A 1MDMB 3F8FA 1I1GA 2MLGA 3GEZA 4L0ZB 3ZQ7A 1FP2A 2L4AA 4KNYA 2CSOA 4KUMA 5JI6A 5E20A 2PEXA 4ZYEA 4KMFA 3U1DA 3MFKA 2Q2EA 2ESHA 3DPTA 2ZNYA 4R79A 2ADUA 1J9IA 3ISPA 2VT2A 2Y48A 2PBIA 1FBUA 1D8KA 2HOEA 2CO5A 4AVPA 2LF7A 4YFNF 5JHUA 3ROUA 1HSTA 3WTSC 1OR7A 4OIRF 3E6BA 3OV8A 2V79A 2FSWA 2H6BA 3P9KA 3V7SA 3GYHX 3GZ6A 1Z9CA 3WGIA 1TW2A 2BYVE 3FMQA 3C3WA 1DDNA 5ED4A 5HOOA 3TDZC 3ERED 1HKQA 2P5VA 3WE3A 2IJLA 3CO6C 2CGPA 4HLXA 1FY7A 1FNNA 4I0AA 3TO6A 1B59A 5AIQA 2Q0OA 3FM5A 2GQQA 2FXAA 1S29A 1F1ZA 4NHJA 2W85A 2AS5F 2TDXA 2ESNA 3L09A 3CUQA 4IRHA 5J8CA 1SMTA 3J80K 2OD5A 2COMA 4ENJA 2DQLA 1F4KA 1L0OC 2NYXA 2IA1A 4G7OF 1Z1DA 4EM0B 2UXNA 4BH9A 2OZ6A 1HQCA 1FC3A 4DQ2A 4FHTA 5BPIA 2DO7A 1J2XA 1ULYA 3R61A 1JGSA 4IRGA 1LEBA 3JW4A 1R5HA 5IT9K 2A6EF 1OYYA 1MGTA 4OIQF 2VONA 4GXOA 1XGMA 2FF4A 2R7FA 4EJWA 2A61A 3LAPA 3CDHA 3GWZA 4CDGA 3ABUA 3L00A 2A5YB 3HOTA 2ZNZA 2M45A 2XAGA 4Y13A 4EGZA 2DLLA 2KRFA 4RB2C 1XMKA 1IUYA 3BJ6A 4BQAA 3ZN0A 4HQEA 3K1MA 1A04A 3LFKA 2GZWA 1BI3A 5CJ9A 2K27A 4KT5C 1IXCA 4AIJA 5ICFA 4HX8A 3JTHA 2A3SA 2H27A 5FLXZ 2QQ9A 1S7OA 3Q9VA 1W7PD 4M9ZA 3E6CC 5DYMA 4EMSA 1XCVA 3BPVA 1MD0A 3QPTA 2GXBA 4XLNF 4CXFA 4XSZF 4O6JA 3HTUA 3ZMVA 1K6OA 2XIGA 1ZRCA 5LEJA 4HAMA 1FP1D 1P4WA 1YTYA 5K1YA 1FX7A 2PMUA 3V7RA 4LFUA 3RTRA 2HWVA 4HDUA 2QZ8A 5HLIA 4WK8F 4L0YB 2HYGD 1D3YA 4KN4X 2FEZA 2RNJA 4GYGA 1NHAA 3WTTC 2CQKA 1WWXA 3GFMA 5DCMB 3JSPA 5H6QA 4RB3C 2NNNA 2HYFA 4KYWA 2FA5A 3LA7A 4GYIA 5L3FA 4JK1X 1XGSA 3NRVA 3BZ6A 1WSUA 4PGHA 1W7PB 1R23A 2E1CA 5E17F 2F5CA 1LVAA 3LWFA 3DQVC 4P9FA 4UV9A 1KQ8A 2DTRA 5BS6A 1FLIA 1YYVA 3HSRA 4BHBA 3K2ZA 4N0BA 3EUHA 1YO5C 2P6TA 4EM1A 2ISZA 1XGOA 4I2OA 1IXSB 1R00A 2W57A 2XAQA 3M8EA 1R1VA 4WCGA 3GX4X 3F8NA 2PI0A 3K1PA 4EV0A 3M1EA 2YX4A 2HEOA 2VN2A 4P96A 5H20A 1IW7F 2NS0A 1IRGA 2RKHA 4OU0A 3V8JA 5LHGA 5HVQC 1X3UA 1BIAA 3E5UA 3FMRA 3Q5FA 2DFIA 3BDDA 1T39A 2E7XA 1J5YA 3R6SA 1DPUA 2LSOA 4HW0A 4L9NA 1UHWA 2WV0A 4HDVA 2DPDA 4KFCA 1XDUA 3N97A 4FX4A 2L54A 2PFBA 1KU2A 1SAXA 5FLXK 5EEHA 3TO9A 5LGUA 4PCQA 4M74A 4A6EA 2W25A 2XVCA 2XKPA 3SZPA 3U9GA 1TQPA 3K0LA 4HF2A 4B09A 4M71A 1CF7A 4CO8A 3L9FA 4YFKF 2NRAC 4LJZF 2E7WA 4LLGF 4RGRA 2XKOA 4Q48A 1XSVA 4RB1A 4ENKA 2M1BA 3MWMA 1H9GA 3L7WA 2HTSA 4UHTA 5LHHA 2AXLA 2XAJA 1FBQA 1K79A 1O57A 3GFIA 1IN6A 3CUOA 3TDUC 2PJPA 3FWEA 3JAMK 2FMYA 2WC2A 4S05A 1FSHA 3RYPA 1KU7A 1UFMA 4M73A 5D6FA 1LEAA 1P6RA 4LD5A 2DK5A 4P5OA 3LSTA 2O6GE 1YS7A 1RZ4A 4I02A 4ON0A 4BYYA 4YIFA 4ENNA 5CVJA 4R8HA 5HDGA 4KA4A 4A0ZA 1USTA 2BEOA 3T1BA 1Q1HA 3KP4A 3HRUA 5HS7A 4RAYA 4ZZDA 3VODA 2RGVA 2VC0A 4I7HA 4LG0A 5F1RA 1LB2A 4OIOF 3KEQA 1SFUA 1S7AA 3DF8A 2DK8A 1LDJA 2UXXA 3LQRA 3EETA 3WGGA 4HZFA 2PG4A 2J5PA 1BI0A 2ZXJA 3FXUA 5AIPA 1FYLA 3L2CA 4P55A 4UVAA 4BXUA 1V4RA 2LDUA 3VB2A 3V8KA 3O6BB 3M8FA 1ZGAA 4RS8A 3COAC 5D5UB 4WWCA 2D45A 1BJAA 1R5GA 2EA2A 3REOA 1TNTA 2GAUA 2QQAA 1U3EM 1OMIA 2VBZA 2KKOA 4I09A 4IPAA 5J8FA 1OPCA 2OA4A 2Y0MA 2OBPA 1SD7A 2ZBKA 3TOAA 2IW5A 4OOIA 1P2FA 3ZMUA 4A6DA 5JVTA 5D5WB 3IKTA 5TRDA 3T8RA 4B8XA 1R58A 4HX4A 3RKYA 1UCRA 3VEPA 4U0WA 5DUKA 2FRHA 1BI1A 1BI2A 2MLKA 1K78A 1YW7A 3DPLC 2KIMA 2RN7A 3FX3A 4S04A 1ZYRF 2FU4A 1W5SA 4I98B 4DNCA 3FHZA 3KP2A 4GCVA 1I1SA 1HKTA 3RJPA 2B0LA 2P8TA 1XCBA 1ZG5A 4Z2YA 5D4SA 1KU9A 3S2WA 4PDKA 5D5VB 1DUXC 4N9IA 4ESFA 4LLNA 1E2XA 3WTVC 2JT1A 2LKPA 5DD8A 3ML6A 5HS8A 1JXSA 3W6KB 2EFOA 4G94A 1B9MA 2K4BA 3MZYA 2IPQX 2QVOA 2A6HF 1MJ9A 1R22A 3RPQA 4WX9A 2F5FA 2MC3A 1RUOA 1Z6RA 4JBAA 3F6VA 1BM9A 1FBSA 2P5LC 1O3RA 2NAZA 2YSRA 1O3TA 2EFQA 3HOSA 3FXRA 1LJ9A 3HHGA 2HQNA 3JSOA 1EH8A 3QOPA 3M9AA 1HW5A 2VBYA 1QGPA 2JPBA 2Z9OA 3QP6A 5E18F 3CUQC 3H3ZA 5L3GA 2F2EA 1L3LA 1QZYA 1PP8F 1QPMA 1QBJA 1ZG1A 2QLZA 3WG9A 2L3DA 3P7NA 1AWCA 3GO5A 3TKYA 3WTXC 2MH9A 3MZHA 3BY6A 4AIKA 3N4MA 2XAHA 2A68F 2EA4A 5AONA 5FB2A 1FYKA 4JQFA 1XN7A 1ZRFA 5HLHA 2IP2A 2O3FA 3KP6A 1H0MA 5D8KB 1EH7A 3F8MA 3B02A 2FBKA 3BWGA 1U5TB 2W84A 3E6MA 1R1UA 4OINF 5K5QA 5L3BA 2MD5A 3ZMSA 4EM2A 2DBBA 4L9JA 4A5NA 5CVRA 1YFHA 3PFIA 1JE8A 1OYWA 2XV4S 3BJOA 2FBHA 4WF2A 2OAZA 2YU3A 1R36A 3RDIA 5IT9Z 1J59A 1S8NA 3SQNA 4LK0F 4MQVA 4KIFA 3KEOA 2ETHA 4G8XA 1S3JA 3WGHA 2CYYA 4FX0A 5KK1A 4LMYA 1XSXA 2LF8A 2UZKA 3TOBA 4O3MA 3BP8A 2Z5UA 2OQRA 2YX7A 1KA8A 5E1XA 5L3EA 3BPXA 3J81K 3GFJA 1U8RA 5F64A 4KN7X 2G9WA 2ZFWA 1KYZA 2ZMEA 1FT9A 1SFXA 1ON2A 3CO7C 3KP7A 3I64A 2JTVA 5DCMA 1Z7UA 3IRRA 2QYOA 2R7DA 3EQLF 2IA0A 1ZARA 2H09A 3D5LA 2ZKZA 2QM3A 3KLNA 2VODA 3IL2A 2EV6A 2GA2A 4RGSA 1LQ1A 5CVUA 1IN7A 4RGUA 1IAWA 2K86A 4YFXF 1Z6TA 4MTDA
chains in the Genus database with same CATH superfamily
4PZJA 4PJMA 2DA3A 4G9YA 1BW5A 2GA1A 4CYDA 1RIOH 2QCOA 1XB4A 4BHCA 4L18B 3HYIA 4AWXB 3QU6A 4XBFA 2H8RA 4CZCA 2HTJA 1D8JA 3LSHA 1E17A 2OF7A 5LEKA 4YRVA 2VBWA 3ECOA 3K7AJ 1N25A 1FZPB 3I59B 1VQPI 4M3FA 1T38A 3ZP5A 1WI3A 3K69A 4PJ0C 2KJCA 1XD7A 3O2PE 1ZK8A 4KISA 3IRQA 4U0YA 3A02A 3AG2H 4XQFA 5BMZA 1TZLA 1MH3A 1X1DA 4HOBA 1SD4A 2YR2A 5GTIC 1WJ5A 1USSA 1KONA 2KP6A 3FKIJ 1WJDA 3C1DA 3HGGA 1U9OA 3E7LA 3F0CA 1GV5A 4AC0A 2X1DA 3I5UA 1W1WE 1G3YA 5FFXA 3Q0VA 1MMNA 1JKQC 2IT0A 1ZH5A 1WQ2A 1AOYA 1HOMA 3E3VA 3OYLA 5HDNA 2WAFA 1B8IA 3OYBA 4FT8A 2DI3A 3VYTB 3A01B 3S1QJ 3ZMDA 2LRDA 2QBYB 5FO5A 2EFWA 4IQ4A 2LNBA 3KP3A 3RKWA 1T6SA 2VJ4A 2P6SA 1MJAA 2BY0A 2E2HJ 2R7OA 2DA4A 2DDBA 3IUOA 5EG0A 3IWFA 4G7HF 3S2HJ 4WXHA 4DIQA 3HXLA 2FMLA 4XLPF 5D8LB 3CCVI 2GIVA 2VPRA 1BIBA 2LP0A 2E2IJ 1YIJI 5ILUA 1WZ2A 2LC2A 3H3UA 3MD2A 1D0ZA 3VOEA 1Y1VJ 2GLOA 2VC1A 3G71I 2EWNA 5DUIA 3V42A 4IRIA 2L02A 2O7OA 2N8GA 3MKLA 5JLXA 4BQNA 4CCMA 1PP7U 1B1BA 3PQKA 4AYBA 5HLGA 5GP9A 3BZCA 2FE3A 2KJBA 3KETA 2F48A 2JSPA 4QSHA 1D5VA 1JT0A 3J7AO 3OYJA 1KGSA 2VASA 2DW4A 1HLVA 3L1PA 1K78B 3ZN1A 5IYBJ 3T0YA 1U78A 4FTHA 2DA2A 2GOXB 3DBHB 2LY9A 4ZDOA 5FKNA 2EK5A 4A93J 4D7NA 4B44A 3EUKL 2EJRA 5ICGA 3RKQA 4QPOA 1UELB 1MBKA 4H0EA 3BOQA 3GVAA 3QYBA 1SAUA 3BQZA 1C0WA 1SFEA 1SD6A 4LLLA 4X6AJ 1HKSA 2P5KA 4IHVA 3MCZA 4F7ZA 3R60A 4A0XA 2B9SA 4RAFA 3JAMZ 3LL7A 2K85A 4NQWA 2BV6A 1FJLA 2JRMA 1WPKA 5BOXA 1GT0C 1YLFA 2JSCA 5B1AH 2VB6A 3C7JA 3H0GJ 4YELA 3LAJA 1XS9A 2PMZA 3OYCA 1OFCX 4UB6C 4OMZA 4GGGA 3M3YJ 2HR3A 4XKWA 1VQ9I 1LVKA 1AA7A 5HS9A 1ZLKA 4ZZLA 4BNCA 1X1PA 5D4RA 5A2QK 1IXRC 1ZLJA 3DKWA 3BTJA 4ESBA 3BT9A 3MKYB 5IOZA 1IN4A 1Y8QB 1NH3A 5IYCJ 2KZVA 2NNYA 2P4WA 2V9VA 3W2VA 4LG3A 1YIOA 1ZN2A 2IBDA 3F72A 5KVRA 2VE8A 5LBQA 3WU1B 1WGXA 1J7KA 5E1ZB 1T98A 3E6DA 2QBYA 2FX0A 3HSEA 3OL3A 4UB8C 3L2WA 2CW0F 2XGXA 1ETWA 1TQIA 4Y3OA 1Z05A 2MBFA 1GVJA 2QKMB 2V6EA 3A0HC 1R4MB 2ZJRF 2HOTA 1FIPA 4DYCA 2E1MC 3CCUI 1R4NB 1LNWA 3WU0A 5KAIC 1FTZA 5K5RA 2Z33A 2AQFA 1GXPA 1Y6IA 3HPHA 1PJRA 3S1NJ 4UVBA 3F23A 1IDZA 3I53A 3CP2A 2OU2A 2DQRA 2E35A 4IHWA 2O5RA 3HL2A 1MBEA 1BW6A 3H92A 1W5TA 1DP3A 2ACJA 1Z67A 1ZGWA 4FASD 5E79C 2M8EA 2XSDC 3DLLF 2OTJI 3I4PA 1IZ1A 1GLNA 2UV1A 3V7CA 2VBXA 4HV6A 1OKRA 1O3QA 1W36C 3FZVA 1ONVA 3G73A 2BBYA 3F8CA 1K6YA 2VJ5A 4ABZA 4CUGA 1JT6A 1YX5A 5L3DA 1ZREA 1EH6A 3PSIA 3VSLA 4ZTFA 5TJJA 1LPQA 4PJLA 3HIFA 3M07A 2IA2A 2X1CA 3R0JA 2P7VB 5CLSA 3TBIA 3CCRI 4L5EA 4F92B 1XSDA 5GPCA 3V8LA 2RAEA 2NVYJ 4F52A 1JTYA 3PL8A 2Q8KA 1RUNA 1O3SA 4HLYA 2BVMA 3JRBA 4L5IA 2XPVA 3IV5A 4RAGA 4XN0A 3BC8A 3LSIA 1F9NA 2HQRA 1STZA 2IGNA 2L9NA 4MQ9F 1X58A 3WTYC 3K1NA 2W24A 1LDDA 1QZZA 4KT6A 4EJOA 1XG1A 2CG4A 1IRFA 2R4GA 3ZQHA 4F55A 3BTCA 4A3FJ 1TWAJ 4ETSA 2M34A 3ONQA 2L9SA 1HDPA 2RQPA 2M5WA 2ECBA 5BPDA 1Y1WJ 1RKTA 3OIOA 3EYYA 1V3FA 2DODA 3IHUA 1GV2A 2HU9A 3SHFA 1WH5A 4CYCA 1MNEA 3CC2I 3R0AA 4HBLA 4UVCA 3QPHA 1KYWA 4XRFA 2KDZA 4OMYA 3CZ6A 1H8AC 2CFXA 3HHHA 4PFOA 4PJNA 3L2RA 5LGTA 4IVNA 2W4SA 2DU9A 2AQEA 3OR1C 1RC9A 5F6FA 1I3AA 3C18A 3K9TA 1JUPA 3F3XA 2H1LA 3EUHC 3U2RA 2PMZN 3I4MJ 5DEQA 5IPAA 4E7LA 3HSFA 4LG0B 2A07F 3KX2A 2UWMA 1LFPA 3GTOJ 3G6EI 4Q47A 4BQQA 2PMHA 1YHQI 3VYUB 2GXGA 2R7QA 4F93B 4B47A 5B5EC 2EIJH 4BBSJ 1TNSA 2E1NA 4IJAA 4IHSA 2GIZA 2L0KA 2NXNB 2WY8Q 2QWWA 3O8GA 3OSFA 1JKOC 1HW2A 5CVIA 1LDKB 2HPMA 3E97A 4WXCA 3OR2C 2ME0A 3DPUA 3ZR8X 2OV7A 4A12A 1MH4A 5JR3A 2C6YA 4I99C 1G3TA 5IYDJ 1EF4A 2BY2A 2F5VA 1NG6A 1JHFA 3OS1A 2JWTA 2HOSA 3PUFA 4A3GJ 3BG5A 4K2EA 4XSXF 3SEQA 3UNGC 1MDMA 1F36A 2WV1A 4RB0A 1I5ZA 1JUMA 2F5EA 2HFHA 2EZLA 4ZJZA 3CD6I 5K7FA 1HSJA 4BEHA 1RI7A 5M3FJ 3GUDA 4AVZA 3PNTA 3OY9A 1HW1A 3P9CA 3FK7A 2HKXA 2ICWG 2IGMA 2Q2EB 2LREA 3EDPA 1EV7A 2HDCA 1NG7A 2H6CA 1WI9A 1BN5A 1XGNA 1SEUA 3EUAA 2NS8A 4KJZA 4GRIA 4IOAF 2VT3A 3LA2A 4MNUA 4LIUA 3KZYA 5LRRA 5FD6A 1TC3C 2F4IA 5A2QZ 4II3A 3DEUA 4A0YA 4QLCU 2O8XA 4QPQA 2VUMJ 3HUGA 2L5QA 4C3IJ 3DTKA 3ASOH 2Z3YA 1U5TC 2KRCA 2XUBA 4DYRA 3DBRB 4CCLA 1ZKGA 5ICEA 4CYCB 2DTZA 3WTUC 2X1EA 3FXLA 2V4JC 2HXIA 4IXAA 5J3LA 2HNHA 1T33A 4Q5SF 5E3OA 3M8JA 2R7WA 5ILSA 1B4AA 2JMWA 1IN8A 3H1CA 2V1UA 2KT0A 3DTEA 2DOAA 1MMDA 1VQMI 1G6NA 3HGYA 1XMAA 1WKMA 2VOOA 1VI0A 2Y2ZA 4MFDA 3ZXSA 1X3ZB 2HGCA 3TL4X 1K4SA 2QQBA 2BE5F 4QIWN 3BCBA 3MAJA 2L7MP 1SMYF 2E71A 3OYEA 2F4OB 1KQ9A 3C2BA 3NQOA 3NWTA 4P9UA 1V54H 1G4DA 1E0EA 3PQJA 1FYMA 3HM5A 3R4KA 2R7SA 2K9MA 4NB5A 3AKZA 3IWZA 2CW8A 2XHKA 1REPC 1U5TA 3S16J 1DPRA 2MG4A 3SFIA 1TBXA 3ZMZA 4HSRA 2EZIA 4MEYF 3KYDB 5DCFA 1OCZH 2VIXA 2VJJA 5D6EA 1K83J 4OIPF 3FXOA 2V6CA 3RPUA 4O5VA 3CUQB 2LY2A 3VFZA 4C9YA 1RNLA 1YG2A 2FUG2 3G2BA 1RESA 1ETKA 2WADA 5LRSA 2R3SA 4MGRA 5EZGA 3GW2A 2OCEA 3NEUA 2MA3A 2MH2A 2WA0A 4FISA 2QUFA 1KU3A 1Y8RB 3T8TA 4XRSG 2QF7A 2A6TA 4CICA 4I76A 3AL0C 1YS6A 1YE9A 1QVTA 2XF7A 4ENMA 2JZYA 1GUUA 2KFDA 3WTZA 3Q3SA 4M6XA 1PUEE 2ME6A 3HJEA 2Y9YA 1T95A 2BGCA 4BY7J 2PQ8A 4IKFA 1Z91A 2KHMA 3HPGA 5H6RA 3C2HA 5DD4A 2E1OA 5J4YA 2DA6A 4EATA 1MMSA 1O7LA 1DU6A 2JN6A 3MQ0A 3JRHA 2LD5A 3CF5F 2COBA 4HA8A 5FROA 4CHUA 2MABA 1GXQA 4EJVA 1IUFA 4J01A 3GZ5A 2RVCA 5J47A 1QQIA 2D1VA 2BOLA 1ZGJA 1WFXA 3BCAA 4M72A 1CF7B 3SZTA 1BBYA 3KZZA 1X2NA 3SZGA 1W7PA 3ZQFA 1S7EA 4BU2A 3GF2A 3FMSA 3M7GA 2VQHA 2FOKA 4HV5A 3CMAI 3GMEA 1ON1A 4BUPA 1VF9A 3I55I 4LK1F 4A3JJ 1HXDA 3CDIA 4C30A 3I0TA 2YU9J 4BL0B 3Q0UA 1FWZA 3ABTA 3RIRA 4DGWB 4YG2F 5E3LA 1Z7LA 3I54A 1VTNC 2KMUA 4UUSA 3M4OJ 2OJED 2ZO4A 2EV5A 4RGXA 2RNGA 3FF5A 1HDDC 1TQMA 2E5ZA 4QWQA 4Z6YA 3CJNA 3ZMTA 3DXJF 4UXNA 2JQ7A 2JRTA 2YUSA 4ZYHA 4V19K 3QAHA 1FOXA 4ZYGA 1IN5A 5DDGA 2R7RA 1E3OC 2K7LA 3ZPLA 3F6OA 1WRJA 2KDOA 5IY5H 3KP5A 2X6WA 2X6OA 2R5YA 2DJIA 3OYGA 5M5YJ 3IAM2 2FBIA 1LUJB 2LR8A 4RAZA 1UB9A 2DT7B 2XASA 4IHTA 2B63J 2JUGA 4ZH4F 1RETA 3QOEA 5DV5A 2X6XA 4NC8A 1O7FA 1ODDA 3GFLA 1D1CA 2VOPA 1SVMA 4M9XA 4U7BA 3AAFA 4GFBA 2OPTA 2M7BA 2XRNA 4I01A 3F21A 2PN6A 4AYBN 3VPRA 3HBLA 3W6VA 3AG4H 3BROA 2ZSIB 3HRSA 3RKXA 1PUFB 2V1DA 1T8IA 5FLMJ 2K9NA 1MBFA 3PUBA 3A0BC 1VQ7I 3WODF 1RR7A 2H94A 2J5OA 3T5XA 2YPRA 4ASNA 3H0DA 4XONA 2HKOA 4PJJA 3FBNB 3FM3A 3TMOA 4LB6B 2DMPA 2L4MA 2XRLA 3LA3A 4D7MA 3BLYA 1PYVA 3TGNA 3TO7A 4XOTA 1IRXA 4BHPA 4EVIA 5L3CA 3DEWA 1U6GA 1VQNI 1DP7P 3F22A 1B9NA 1LFUP 2O61A 2R7TA 4LOCA 5J40A 1K7AA 3FBIB 4HX7A 3GTPJ 1MKMA 2QENA 2FNAA 2PLYA 3H5NA 5KAFC 2M4GA 3OOUA 1OYIA 3FXMA 4UV8A 3V4GA 3CCQI 4ZYDA 1YW8A 4A5MA 5GPAA 4XNFA 4EJTA 2HYJA 1SFKA 1TTYA 4G6DA 4HNVA 1IV8A 3GXOA 5K5OA 5EDNA 3I71A 1ZRDA 2P7CB 2DT5A 5ILVA 4HQMA 3DFGA 3CTAA 3LQQA 4IX7A 2WWYA 2LVSA 2G7UA 1I27A 4M9SA 3SFZA 3OYAA 2EV0A 3CLQA 3H35A 2OC6A 3RYRA 5HDKA 3NWSA 3S93A 4D0PA 1UMQA 3ULQB 1JKPC 2LOOA 1Q1VA 2TCTA 1ZR2A 1VQKI 3HDDA 3PNVA 3DV8A 1ETOA 2ZJPF 1TW3A 4Y17A 1E3PA 1YOVB 2IRFG 1BJZA 2Q1ZB 3IH2A 1A5JA 1MMGA 4KIGA 3OYNA 5C44J 1YW9A 4C3HJ 1IJWC 4UUSB 4E7ZA 3KYCB 1O4XA 3DU5A 3GTMJ 2XAFA 3IH4A 1Z21A 1BC8C 1I6HJ 3JTGA 1V55H 3A2KA 1KQ0A 1QO0D 1X1AA 2G7HA 4EGYA 2VKHA 1S9HA 3CLOA 1IRZA 1P4XA 3HG9A 2F6CA 2V26A 2JA2A 2L01A 2D1HA 2W7NA 1A35A 2OUMA 1Y0UA 2XB5A 2M87A 4M3GA 2JK3A 4Y33A 5FKMA 1PDNC 3KE2A 4EQQA 3QPSA 2KIFA 2O0YA 4U88A 1J0RA 4G6QA 2CWEA 1IO2A 3F8BA 2WBMA 3D0SA 4L5JA 2X9DA 4N4NB 1ETXA 4EJUA 2IS2A 2OQGA 3TP0A 1UAAA 3K6GA 4V2GA 4DZPA 5J4VA 4A3BJ 1N77A 2M30A 4GO1A 5E1WA 5JLWA 1P92A 4OAZA 4MEXF 2K02A 4HYEA 1P9QC 3BR2A 2XDVA 2M0MA 1Z3YA 2WB1A 4R1HA 4IHYA 3H5RA 2DDAA 5K7HA 1W4MA 3ZGKA 1QVUA 4RM3A 1HBXG 4IEJA 1A6IA 4MHGA 3IKVA 3RZOJ 1JI8A 3G3ZA 5D5XB 4AIHA 4LGWA 4B48A 2Z99A 2DXIA 5LHIA 3KCCA 3MVPA 2JPCA 1R7JA 1AHDP 5BQTA 2Y75A 1TWFJ 2MSYA 1R1TA 3WU2C 1E3HA 5E3NA 2VLAA 1FOYA 2FJ1A 4L9TA 3E5XA 2R7XA 2O03A 1D5YA 4HSTA 3LSJA 2E19A 2HDDA 3U21A 1XDSA 3DP7A 1JGGA 1ZQ3P 1U2WA 3CCMI 1LKXA 3CJTB 4HF1A 1WJCA 4CZZA 4PGGA 2RDPA 1ERDA 4BAYA 2RV8A 4M3EA 5CYVA 1T2KA 1WJBA 3BJAA 4V2FA 5EGOA 4L9VA 3S3OA 1ORKA 3EYIA 1TWHJ 1DGRM 3OIPA 3KLOA 4UNOA 3HTSB 2DFHA 4I6ZA 4BEHB 1MJBA 4HF0A 1H9TA 5JFRA 2HZTA 4LB5A 5CVVA 2ZMEB 1GVDA 3O8HA 1Y56A 2KIUA 3H9JA 4E70A 1BC7C 1BOAA 2MGQA 2PJRB 2L2OA 1QHHD 1F5TA 1XC5A 1V5EA 5EEGA 2K4JA 3DEEA 3HOUJ 1G3SA 4Y15A 4RMNA 4AD9A 2FOWA 3OOPA 5DM6F 4U0VA 3VDXA 5BNGA 2EFNA 2W48A 3FXKA 3J80Z 4JOMA 3LSKA 3WTWC 2ZJQF 3CJRB 1TT5B 1B72A 2E2JJ 4Q4ZF 4M6YA 1YJNI 2LMDA 4NC6A 2XF6A 5ICCA 2XGDA 3I58A 4WXDA 4N9HA 4U7DA 4BY1J 1P4AA 2VKDA 5E8GA 4MTEA 1ZG3A 1S6LA 4KICA 2K9LA 2X4HA 3PFYA 5LLQA 1FPQA 1WVRA 3IC7A 3OYIA 3FXQA 3W3CA 1MBHA 2DMUA 2FNPA 3JRAA 5FD5A 1TLHB 2KPMA 5B1BH 2NOJB 3OL4A 3ECHA 3GCMA 1MSFC 5J6XA 3D5SC 5FGMA 2DPUA 1X4OA 1DGWY 3EPZA 2KZGA 3Q9SA 2LY1A 1FEXA 1ITYA 2V1XA 2P81A 2GOMA 2GWRA 4PSWA 2EBIA 2ZCWA 1MZBA 4E7KA 4A2UA 3FHNA 3DKXA 3U1KA 3I59A 4HPQA 4KMUX 1ZAOA 4CGZA 5ERIA 4LIVA 4DZJA 2XROA 1ZHFA 5LGNA 1FOKA 1I6XA 1G3WA 2RC4A 4KDPA 2VXZA 3PO3J 4FCYA 3HRTA 1GHCA 4ESJA 1EJ9A 3MEXA 2DAOA 5HODA 1B6AA 3GLXA 1B8IB 1HCRA 2F5DA 4IF4A 3TQNA 1IF1A 1FSEA 4MFEA 2CH0A 1HF0A 4F3QA 2YS9A 4B4CA 3CC7I 1UHMA 2STWA 3G1MA 2ELHA 2CV0A 3QU3A 4B43A 3ABLH 1YITI 3J81Z 4YIIA 4XLEA 2FQ3A 5KCMA 1J75A 5EJCA 3A01A 3QRFF 5EG0B 2X48A 3KFWX 2R7VA 4BE1A 1P7IA 2A69F 2EZKA 1VQ6I 2HZDA 2EFPA 2BXYA 2A05A 2MC4A 9ANTA 1CGPA 5JVGF 4HEA2 3ASNH 3DKYA 1WJAA 2DFFA 5FFZA 4A3EJ 2OZUA 3HRMA 4G7ZF 3WHCA 1QZEA 2ZMEC 1U8BA 4CCNA 3ELKA 4FETA 1SD5A 1TT0A 2E34A 2BVLA 3QODA 1FMWA 2ISYA 1YQAA 3QP5A 2X0LA 1JHHA 5IT3A 2STTA 1TWGJ 4I0BA 1D0XA 1RKWA 2KIQA 1N78A 1YX3A 3O3KA 2E60A 2VE9A 3CCSI 3SJMA 2D2WA 2IVMA 5E8IA 3E5QA 2HS5A 4UY8I 4XIDA 1QNTA 5CQGA 3RI4A 1T0FA 5F08A 1ZELA 3W6JB 2VKVA 2ZJ2A 3P9IA 3GTLJ 6PAXA 2EB7A 4UUVA 4KIBA 2ZC2A 2WTEA 3B73A 2LTPA 1YRNA 2ID6A 2M4KA 1VQ8I 5DM7F 3SXYA 3K2AA 4BXFA 3WE2A 5FKOA 2CRGA 1R5ID 2P0WA 4TV7A 1MDMB 1UG2A 1QRYA 3F8FA 1SANA 2K9QA 1I1GA 4X0GA 3JCUC 3PJRA 2MLGA 3JRFA 3GEZA 1LE8B 4A3IJ 4L0ZB 2MW8A 4JX6A 3ZQ7A 1D1BA 1FP2A 1X1BA 3QQAA 2L4AA 4KNYA 2CSOA 4KUMA 5JI6A 5E20A 2PEXA 4ZYEA 2GXAA 4KMFA 3U1DA 2LKSA 4BBRJ 3MFKA 4E7HA 2Q2EA 2KL4A 2ESHA 3DPTA 2ZNYA 4R79A 2ADUA 1J9IA 4XLFA 3LMMA 2M3AA 3ISPA 2AO9A 4NQWB 4QTRA 2VT2A 2Y48A 3CMEI 4Y7NJ 3K70C 2PBIA 1FBUA 1MIJA 2DOEA 1AKHB 1BR2A 1R71A 4BJTA 1D8KA 1PVEA 2HOEA 2CO5A 3HUGB 3OS0A 4AVPA 2NOGA 2LF7A 4YFNF 1ZTRA 2LLKA 1HSTA 3ABMH 3ROUA 5JHUA 3WTSC 1OR7A 4OIRF 2LH9A 3E6BA 1XX5A 1OJLA 2IAIA 4ANJA 3OV8A 2V79A 2FSWA 2H6BA 3P9KA 2V9PA 3V7SA 2Y30A 3GYHX 2JVGA 1PUFA 2DOFA 3GZ6A 1Z9CA 3CMYA 2D5VA 3WGIA 1TW2A 1D0YA 5CPRB 2BYVE 3FMQA 1YI2I 2DYSH 2K5CA 3C3WA 3K70D 3S14J 1DDNA 5ED4A 5HOOA 3TDZC 1CQTA 3ZQCA 3S1MJ 1A6QA 3ERED 1HKQA 2P5VA 2Z16A 3WE3A 3KPHA 4J00A 2IJLA 3BR5A 4XL9A 5F27A 4F91B 3OYKA 3CO6C 1W36D 2CGPA 4HLXA 1FY7A 2E5NA 1FNNA 3UR3C 4I0AA 3TO6A 1B59A 3E0JB 2ZXIA 4E7SA 3LNQA 1IGNA 2CV2A 4W1UA 4IQJA 3GTJJ 2G0EA 2UUZA 5AIQA 3BG7A 4RA2A 5IP6A 4BACA 2Q0OA 3FM5A 1JJ6C 3SDBA 2GQQA 2FXAA 1OQYA 1R9TJ 1S29A 1F1ZA 4NHJA 5LD2C 2W85A 2AS5F 2DN0A 2QEXI 3CCEI 3HOVJ 1MW7A 2ESNA 2TDXA 3OS2A 2BZTA 3L09A 3P5JA 2NVXJ 3CUQA 2CU7A 4IRHA 5J8CA 3CQZJ 2M0CA 4NDLA 1SMTA 3TEDA 4BE0A 4ZDPA 2R5ZA 1X1CA 3J80K 2OD5A 1VQ5I 2COMA 2CS3A 4ENJA 2DQLA 1F4KA 1X3WB 1L0OC 3A4CA 2X6YA 2NYXA 2IA1A 4D5FA 2MYSA 2VL8A 4G7OF 1Z1DA 3HOZJ 3ESWB 4EM0B 2UXNA 4BH9A 2OZ6A 1EA3A 3TW6A 1HQCA 5GAGJ 4D9JA 1QU3A 1X2MA 1FC3A 2JA6J 2GBYA 4CCJA 5EZHA 5KNLA 3FK6A 4DQ2A 4FHTA 5BPIA 3B6AA 2WAEA 2DO7A 1J2XA 5HNHA 1IC8A 1ULYA 3B6CA 1JGSA 1ENHA 3R61A 4IRGA 3UKGA 1LEBA 2EIMH 3JW4A 1R5HA 2E36A 5IT9K 1ACIA 2A6EF 3IAS2 1OYYA 1MGTA 4OIQF 2V7FA 2VONA 4DBRA 3GTKJ 4GXOA 1XGMA 4MLOA 2FF4A 4CA0A 2R7FA 4EJWA 2A61A 2ZXHA 1W0UA 2JA5J 2VQCA 3LAPA 3CDHA 3GWZA 4CDGA 4BDYA 3ABUA 1EKEA 2WY7Q 3L00A 3DBLB 1P7JA 5FKLA 4DW6A 2HOAA 3K4JA 2A5YB 3BR3A 1S5LC 2CMPA 4X1EA 3HOTA 2ZNZA 2M45A 2XAGA 2DA5A 4Y13A 3W2WA 4EGZA 2L7KA 3CCYA 2DLLA 1Y0NA 2KRFA 4A69C 4EEFG 3J7AY 4RB2C 4B3XA 1XMKA 1IUYA 3BJ6A 4W97A 2Y9ZA 4BQAA 1FMVA 3ZN0A 4HQEA 3K4MA 4II2A 3K1MA 2GM4A 1OCOH 1OLTA 4RBOA 1A04A 3LFKA 2GZWA 2XGEA 1BI3A 5CJ9A 3RQ4A 2LYCA 4YIRX 3ZQGA 2K27A 2XPWA 3KZIC 4KT5C 1IXCA 5HNFA 4AIJA 2NVQJ 5B66C 5ICFA 2XGCA 4HX8A 3JTHA 1FIAA 2A3SA 2H27A 1OCTC 5FLXZ 2QQ9A 2IEKA 2JJ7A 4H4KC 1S7OA 3Q9VA 2WAQA 2EINH 1W7PD 4M9ZA 3E6CC 3MKZA 2ID3A 3E1SA 5DYMA 1XCVA 2QGUA 3BPVA 4EMSA 5KHDA 1MD0A 3QPTA 2GXBA 4XLNF 4CXFA 4N4OB 3JRCA 3J7YJ 1IG7A 4XSZF 3H9GA 4O6JA 3HTUA 3ZMVA 3BQYA 2XIGA 1K6OA 5LEJA 1ZRCA 4HAMA 1FP1D 1P4WA 3MN2A 1RPWA 4B3AA 1FX7A 5K1YA 2LKXA 1YTYA 2PMUA 4MO7A 3V7RA 1ZR4A 2CV1A 3BG6A 4LFUA 5K7ZA 4BXXJ 2R5ZB 1IV6A 2OCCH 3RTRA 3S15J 3PO2J 3Q0WA 3JRIA 2HWVA 4HDUA 2QZ8A 4XKCA 4NUBA 5HLIA 2JA8J 4WK8F 5E3MA 4L0YB 2VQGA 2HYGD 4NNJA 1D3YA 4KN4X 2FEZA 2B7EA 3DWLE 2RNJA 3HKZN 3CESA 4GYGA 1T56A 1NHAA 3OYMA 3AG3H 3WTTC 1WH7A 2CQKA 3HOWJ 4XRMA 1WWXA 2W1OA 2LK2A 3N05A 3GFMA 5DCMB 1ETQA 3CCLI 2K3FA 3JSPA 1YJWI 5H6QA 2DMQA 3WHBA 4AUXA 4JX4A 4RB3C 1XPXA 2NNNA 1LFBA 2HYFA 3KEYA 4G6TB 4KYWA 1KZHA 4XMYA 2FA5A 3LFUA 3LA7A 4GYIA 5FKKA 2RREA 5L3FA 4A3MJ 4OAYA 2F4MB 4NBQA 3BTIA 3VWBA 4JK1X 2LFBA 1UG0A 2EQRA 4C2UA 2JA7J 1XGSA 3NRVA 3BZ6A 3JR9A 1WSUA 4PGHA 4CCKA 1W7PB 1R23A 2E1CA 5E17F 3PM1A 2IS4A 2F5CA 1LVAA 5DTDA 3LWFA 3DQVC 4FE4A 1MSEC 1BA5A 2HQ5A 2BW3B 4P1WA 4P9FA 1V5GA 4UV9A 2DTRA 1KQ8A 5BS6A 3H9QA 5H2FC 1FLIA 4A3CJ 5IP9J 1T08B 1YYVA 2DMTA 3F9KA 4PFPA 3HSRA 2WB1N 4BHBA 1ETVA 4S0HB 3K2ZA 4N0BA 3EUHA 1MBJA 1DQUA 2TRTA 3S8PA 2VXDA 1YO5C 1SVOA 2P6TA 3AG1H 5FRMA 3A1YA 2CQXA 1WHUA 4EM1A 2ISZA 1XGOA 4I2OA 1IXSB 2H8WA 5TISC 3D5RC 3S2DJ 1R00A 2W57A 2XAQA 4FE7A 3M8EA 1R1VA 3CJQB 4XN3A 1YJ9I 4WCGA 1OISA 2QKLB 3F8NA 3GX4X 3K1PA 4EV0A 2PI0A 3M1EA 3CC4I 2YX4A 2HEOA 1G2HA 2VN2A 1W5CC 4P96A 5H20A 4BJ5C 1IW7F 1UZCA 2NS0A 1IRGA 3I4NJ 2RKHA 4OU0A 3V8JA 5LHGA 2XAUA 5HVQC 1X3UA 4BDZA 1BIAA 3E5UA 3FMRA 3Q5FA 1TP4A 2DFIA 3BDDA 2E7XA 3S3MA 3CDLA 3ZQQA 1T39A 3BG9A 2CUJA 1J5YA 2HPIA 3R6SA 4DYQA 2ELKA 1DPUA 4RDUA 2LSOA 1N75A 3I3LA 4HW0A 2Y0SN 4L9NA 1UHWA 2WV0A 2VJIA 3JREA 4HDVA 2DPDA 4KFCA 1XDUA 3N97A 2V9KA 1QHGA 2KRHA 1BR4A 4E4HA 4FX4A 4AU7A 2L54A 2PFBA 1KU2A 2LBFA 2Y69H 1SAXA 4IZZA 3HZJA 5FLXK 5EEHA 3TO9A 3G1OA 3MMYB 4PCQA 4D5CA 5LGUA 3J7ZI 4M74A 3SDGA 2CJJA 4A6EA 2W25A 2XVCA 2XKPA 4BQOA 1WCMJ 3SZPA 2AXTC 1VNDA 3U9GA 1TQPA 1BR1A 3K0LA 4HF2A 2HVRA 3IH3A 4B09A 4M71A 3ZRGA 1TWCJ 1CF7A 4CO8A 3L9FA 1OCCH 4YFKF 2EIKH 2NRAC 4LJZF 5FRNA 3MZ8A 2E7WA 4LLGF 4RGRA 2XKOA 4Q48A 1XSVA 2L7ZA 4RB1A 5EGOB 1G59A 1SVLA 4ENKA 3C2GA 2Y0SA 2M1BA 1TL8A 3GBGA 5FLVA 2VI6A 3MWMA 3I9V2 1H9GA 3W2AA 1FTTA 3L7WA 3H5AA 2HTSA 5TGTA 2LG4A 4UHTA 3JRGA 5LHHA 2AXLA 2K40A 3FDYA 2NVUB 1NTCA 2HI3A 5IP7J 3AFHA 1X4PA 5M3MJ 2XAJA 1FBQA 1K79A 1O57A 1IDYA 3GFIA 2BW3A 3HB9A 4XKBA 2IGKA 1IN6A 3CUOA 3TDUC 5JHFA 3FWEA 2PJPA 2BXZA 3ERMA 3JAMK 2FMYA 4XICA 2WC2A 2V1NA 4S05A 1FSHA 2XC7A 4A3DJ 2QQ8A 3RYPA 3D1NI 4J19A 1KU7A 2A5WA 1UFMA 4M73A 5D6FA 4XM3A 1LEAA 1P6RA 1K61A 4LD5A 2ZSHB 3FKJA 2DK5A 2M7AA 1BOBA 5F0CA 4P5OA 5GAHJ 2KISA 3LSTA 2O6GE 4HRIA 1YS7A 1MNMC 1HA8A 2JVHA 4CCOA 2R5YB 2IS6A 2R93J 5IOYA 4GDFA 4D1QA 2VPLA 1RZ4A 4I02A 1M1EB 2DYRH 4ZTJA 4ON0A 4BYYA 4YIFA 4ENNA 1MNDA 5CVJA 1VQOI 4R8HA 5M5WJ 5HDGA 3H36A 4KA4A 4A0ZA 1USTA 2BEOA 2XSJC 3T1BA 3TP3A 2ZB9A 1Q1HA 3KP4A 2JUCA 3HRUA 1VFCA 4PSXA 3VYRB 5HS7A 4RAYA 4ZZDA 4AM3A 2AHQA 3VODA 2RGVA 2VC0A 5EEAA 3L2VA 4FQGA 4I7HA 3FISA 2DFEA 4LG0A 5F1RA 3LSRA 1LB2A 4OIOF 3KEQA 1SFUA 3SYTA 1V5FA 1UJ8A 1S7AA 3DF8A 2VKEA 2K9SA 2DK8A 4AIDA 1LDJA 2R0QC 2NVTJ 3RZDJ 2EPFA 5F0FA 2UXXA 4IO9F 2LBFB 2O8KA 3LQRA 4ZDLA 3EETA 4RM2A 3WGGA 4HZFA 2PG4A 2XF5A 3GZNB 2J5PA 4MIMA 1BI0A 2Y31A 1A36A 2CQQA 2ZXJA 3FXUA 4XRSA 2OTLI 5AIPA 4DOZA 1RRJA 1FYLA 3L2CA 3K4CA 3OYFA 2L9VA 4M6VA 4P55A 2FQ4A 4UVAA 4BXUA 5C4JJ 1V4RA 2LDUA 3VB2A 2MFZA 2CQNA 3QYEA 2I5UA 3V8KA 3O6BB 3M8FA 1ZGAA 4RS8A 4DJAA 3COAC 5D5UB 5F0HA 3ABKH 4WWCA 2D45A 3BR0A 1BJAA 1R5GA 5B3SH 2EA2A 1FOWA 1TNTA 3REOA 2GAUA 2QQAA 3KYLA 1OMIA 1SC7A 1U3EM 2VBZA 4ITVA 2BHYA 3RSNA 3S17J 2KKOA 3BG3A 3DLAA 3QPLA 4I09A 2BY3A 4XKVA 4XOPA 3K4LA 4IPAA 4CH7A 3QWLA 5J8FA 3H3VK 1OPCA 1WJEA 2OA4A 2Y0MA 5C4XJ 3BTLA 3BR1A 3X2QH 4U87A 3K10A 2ECCA 2OBPA 1POGA 1SD7A 2ZBKA 1WJFA 3TOAA 5HLTA 2IW5A 4HG2A 4BGDA 2L7FP 4NC7A 4OOIA 1P2FA 3ZMUA 4A6DA 2QSFX 5JVTA 2EILH 4Y4RA 5D5WB 3IKTA 5TRDA 3T8RA 4B8XA 1R58A 4HX4A 1JUSA 3RKYA 1UCRA 4XORA 3GLLA 3VSKA 3HKZA 2CQ7A 3VEPA 1NK2P 4U0WA 3RPUD 5DUKA 5CQEA 2PX9A 5C3EJ 2HXOA 2FRHA 1BI1A 1Z77A 1BI2A 2MLKA 3L2UA 1K78A 2DA1A 4PK4A 3LSGA 2WAQN 1YW7A 3DPLC 4XLHA 2FD5A 2KIMA 1BL0A 2IXSA 2RN7A 3FX3A 4S04A 1ZYRF 1I3QJ 2FU4A 3MKWB 2H1KA 1W5SA 1R6RA 1QA6A 2RQQA 4I98B 4DNCA 2M8GX 4YEJA 5CKTA 3FHZA 3KIOA 3KP2A 4GCVA 4BJ6C 1I1SA 1HKTA 3RJPA 2B0LA 2P8TA 1XCBA 4IOCF 2DCEA 1ZG5A 4Z2YA 5D4SA 2I8DA 3CP8A 3FXJA 1KU9A 3CF2A 3S2WA 3RQIA 1JKRC 4PDKA 1MBGA 5D5VB 1DUXC 4N9IA 3BR6A 4BS9A 4ESFA 2IS1A 4LLNA 1J09A 1E2XA 3WTVC 2JT1A 3I56I 2LKPA 5DD8A 2Z2SB 4CSWA 3ML6A 4A3LJ 5HS8A 1JXSA 2HQAA 2M9HA 3OSGA 3HEFA 1Z0XA 2L9RA 3W6KB 2EFOA 4G94A 1B9MA 2K4BA 4B1RA 1VZ0A 3MZYA 2IPQX 2QVOA 3G4SI 2A6HF 2CFOA 2DJNA 2R92J 5J1YA 2BHZA 4A3KJ 1MJ9A 1R22A 2R7ZJ 3RPQA 4WX9A 2F5FA 1X19A 2MC3A 1RUOA 1Z6RA 4JBAA 5F04A 3F6VA 2CUFA 1BM9A 1FBSA 2P5LC 4ZC3A 4DBQA 2PJRA 1O3RA 3NAUA 2NAZA 2YSRA 2VQLA 1O3TA 2EFQA 3LOCA 3AL0B 3HOSA 1U9NA 3FXRA 1LJ9A 2DT6A 3WG7H 3HHGA 2HQNA 3JSOA 1EH8A 3QOPA 2XPUA 3ZOBA 3M9AA 1HW5A 2VBYA 1SFOJ 1QGPA 2JPBA 3ZCOA 3IP4B 2HDWA 2Z9OA 3QP6A 5E18F 2DMNA 3CUQC 3H3ZA 5L3GA 1QPIA 2F2EA 1L3LA 1VQLI 1G8XA 1QZYA 1PP8F 1YRNB 2I10A 1JTXA 3DU6A 3K4BA 1I39A 1QPMA 1QBJA 1ZG1A 2QLZA 5EF6A 3WG9A 2L3DA 3CMMA 4C2TA 3LSMA 3P7NA 2W00A 3OMYA 4JYKA 3RCOA 1AWCA 3GO5A 3TKYA 5FJ8J 4BE2A 2O9LA 4KITB 1R49A 3WTXC 2QSGX 2MH9A 3PIPF 1VQ4I 2W82A 3VYSB 1RR8C 3LSPA 3MZHA 3BY6A 4AIKA 3N4MA 3HOYJ 3K4NA 1OCPA 1NK3P 2XAHA 2A68F 4XK4A 3FIWA 4XLCA 2EA4A 4UUTA 5AONA 5FB2A 1FYKA 3OIQA 4JQFA 2Z1DA 4OWRB 4E7JA 3QYFA 5M5XJ 3OWTA 1XN7A 1ZRFA 4RLFA 5HLHA 2IP2A 2O3FA 3KP6A 1H0MA 5D8KB 1EH7A 1HC8A 3F8MA 3B02A 1OR7C 2FBKA 3BWGA 1H88C 1U5TB 2W84A 3E6MA 1R1UA 4OINF 3OYDA 5K5QA 1Y39A 5L3BA 2MD5A 2KQRA 1S72I 3ZMSA 4EM2A 2DBBA 4L9JA 4IHXA 2K3PA 4BKXA 2MD0A 4A5NA 5CVRA 4G12A 1YFHA 1UHSA 3PFIA 3K4KA 5F1JA 3TW7A 1JE8A 3GTQJ 3ZQIA 1OYWA 2XV4S 5EYRA 3BJOA 2FBHA 4ZYAA 2HVSA 3L2QA 1XTAA 4WF2A 2XB0X 2OAZA 5GAEJ 4C2MJ 2YU3A 1R36A 5GADJ 3G1LA 3RDIA 5IT9Z 1J59A 2IGOA 3PNYA 1S8NA 3BZKA 4E7IA 4PUSA 2HVQA 3SQNA 1XMXA 4LK0F 4MQVA 1MMAA 1W0TA 4KIFA 3M1CA 3SEZA 3KEOA 2ETHA 3HOXJ 3S1RJ 4G8XA 1S3JA 4LITA 4Y52J 3ZQLA 3WGHA 3PSFA 2CYYA 4FX0A 5KK1A 4LMYA 1XSXA 1T0FC 2LF8A 3OYHA 3TOBA 2UZKA 4O3MA 5J1UA 3BP8A 2EH3A 2Z5UA 1K4TA 2OQRA 2YX7A 2EZHA 4IL6C 1KA8A 5E1XA 4E6KG 5L3EA 1I50J 1GDTA 3BPXA 3J81K 3GFJA 2E1MB 1U8RA 4C3JJ 5F64A 2ZXWH 4KN7X 2G9WA 3JRDA 2ZFWA 5GTHC 3S32A 1KYZA 2CUZA 2DA7A 1AU7A 1LE8A 2ZMEA 1FT9A 1SFXA 2M2EA 1ON2A 2ELJA 3CO7C 3KP7A 3PIOF 3I64A 2NS7A 2CUEA 2JTVA 3DCFA 5DCMA 2QSHX 5DS9A 1Z3XA 1H89C 1Z7UA 3IRRA 5J1RA 2QYOA 2R7DA 3A03A 3EQLF 3NARA 4M3DA 3CCJI 2KLOA 2CW7A 1U0JA 4JP0A 2IA0A 1ZARA 3D5LA 2H09A 2ZKZA 2QM3A 3KLNA 2QA4I 4HNUA 2VODA 1JJ8C 3IL2A 4HNTA 2EV6A 1B72B 2ZFUA 2GA2A 1DU0A 4JX5A 4XR6A 4RGSA 1F43A 1AKHA 3S3NA 1LQ1A 1D1AA 5CVUA 2BY1A 1A31A 1IN7A 2X85A 4RGUA 4M3BA 1IAWA 2K86A 3GTGJ 3DTIA 3HC7A 1OCRH 4XLAA 4RLQA 4YFXF 5LFAA 1Z6TA 2X51A 2R7UA 4MTDA 1ETYA 1APLC
chains in the Genus database with same CATH topology
4PZJA 4G9YA 2GA1A 4CYDA 1RIOH 1XB4A 4BHCA 4L18B 3HYIA 4AWXB 3QU6A 4XBFA 2HTJA 1D8JA 1E17A 5LEKA 2VBWA 3ECOA 1FZPB 3I59B 1T38A 3ZP5A 3K69A 2KJCA 1XD7A 3O2PE 3IRQA 4U0YA 5BMZA 4HOBA 1SD4A 2YR2A 1USSA 3C1DA 3I5UA 1G3YA 5FFXA 2IT0A 1ZH5A 1AOYA 1WQ2A 3E3VA 5HDNA 4FT8A 2DI3A 3ZMDA 2QBYB 5FO5A 2EFWA 2LNBA 3KP3A 3RKWA 1T6SA 2P6SA 1MJAA 3IWFA 4G7HF 4WXHA 2FMLA 4XLPF 5D8LB 2GIVA 1BIBA 5ILUA 3H3UA 3VOEA 2VC1A 2EWNA 5DUIA 4IRIA 2L02A 1PP7U 1B1BA 3PQKA 5HLGA 2FE3A 2KJBA 3KETA 1D5VA 3J7AO 1KGSA 2DW4A 1K78B 3ZN1A 3T0YA 1U78A 2EK5A 2EJRA 5ICGA 4H0EA 3BOQA 3GVAA 1C0WA 1SFEA 1SD6A 4LLLA 1HKSA 2P5KA 3MCZA 4F7ZA 3R60A 4A0XA 3JAMZ 4NQWA 2BV6A 5BOXA 1YLFA 2JSCA 3C7JA 3LAJA 4OMZA 4GGGA 2HR3A 5HS9A 1ZLKA 4ZZLA 4BNCA 5D4RA 5A2QK 1IXRC 1ZLJA 3DKWA 4ESBA 1IN4A 2NNYA 2P4WA 2V9VA 1YIOA 1ZN2A 3F72A 5KVRA 2VE8A 5LBQA 3WU1B 1J7KA 5E1ZB 1T98A 3E6DA 2QBYA 3HSEA 2CW0F 2XGXA 1TQIA 1Z05A 2MBFA 1GVJA 1LNWA 3WU0A 5K5RA 2Z33A 1GXPA 4UVBA 3F23A 3I53A 2OU2A 2DQRA 3H92A 1W5TA 2ACJA 2M8EA 3I4PA 1IZ1A 3V7CA 2VBXA 4HV6A 1OKRA 1O3QA 3FZVA 1ONVA 3G73A 2BBYA 3F8CA 5L3DA 1ZREA 1EH6A 5TJJA 3HIFA 2IA2A 3R0JA 2P7VB 5CLSA 1XSDA 3V8LA 2Q8KA 1RUNA 1O3SA 4HLYA 4L5IA 1F9NA 2HQRA 1STZA 4MQ9F 3WTYC 3K1NA 2W24A 1LDDA 1QZZA 4EJOA 2CG4A 1IRFA 4ETSA 2RQPA 2M5WA 5BPDA 3EYYA 1V3FA 3IHUA 3SHFA 3R0AA 4HBLA 4UVCA 3QPHA 1KYWA 4XRFA 4OMYA 2CFXA 3HHHA 5LGTA 4IVNA 2DU9A 5F6FA 3C18A 3K9TA 3F3XA 3U2RA 5DEQA 4LG0B 3HSFA 2A07F 2UWMA 4Q47A 2PMHA 2GXGA 1TNSA 2E1NA 4IJAA 4IHSA 2QWWA 1HW2A 5CVIA 1LDKB 3E97A 4WXCA 4A12A 5JR3A 2C6YA 1G3TA 1JHFA 4K2EA 4XSXF 1MDMA 4RB0A 1I5ZA 2F5EA 2HFHA 1HSJA 1RI7A 3GUDA 1HW1A 3P9CA 2HKXA 3EDPA 1EV7A 2HDCA 2H6CA 1WI9A 1BN5A 1XGNA 2VT3A 3LA2A 4MNUA 3KZYA 5LRRA 5FD6A 5A2QZ 3DEUA 4A0YA 4QLCU 2O8XA 3HUGA 2Z3YA 1U5TC 2XUBA 5ICEA 3WTUC 4IXAA 4Q5SF 5ILSA 1B4AA 1IN8A 2V1UA 1G6NA 1XMAA 1WKMA 2VOOA 2HGCA 2QQBA 2BE5F 3MAJA 1SMYF 1KQ9A 3NQOA 4P9UA 1G4DA 3PQJA 1FYMA 3R4KA 4NB5A 3IWZA 2XHKA 1REPC 1U5TA 1DPRA 3ZMZA 1TBXA 4MEYF 5DCFA 4OIPF 5D6EA 2V6CA 3RPUA 4O5VA 3CUQB 3VFZA 1RNLA 1YG2A 5LRSA 2R3SA 4MGRA 3GW2A 3NEUA 2MA3A 2MH2A 2QUFA 1KU3A 3T8TA 4CICA 1YS6A 4ENMA 2JZYA 3WTZA 4M6XA 1PUEE 2BGCA 2PQ8A 1Z91A 5H6RA 5DD4A 1O7LA 3MQ0A 4HA8A 4CHUA 1GXQA 4EJVA 3GZ5A 2RVCA 1QQIA 2D1VA 1ZGJA 4M72A 1CF7B 3SZTA 1BBYA 3KZZA 1W7PA 3GF2A 3FMSA 3M7GA 2FOKA 4HV5A 1ON1A 4LK1F 1HXDA 3I0TA 1FWZA 3ABTA 3RIRA 4YG2F 3I54A 1VTNC 2ZO4A 2EV5A 4RGXA 3FF5A 1TQMA 4QWQA 3CJNA 3ZMTA 3DXJF 4UXNA 2JRTA 4ZYHA 3QAHA 4ZYGA 1IN5A 5DDGA 2K7LA 3ZPLA 3F6OA 1WRJA 3KP5A 2FBIA 4RAZA 1UB9A 2XASA 4IHTA 4ZH4F 5DV5A 1O7FA 1ODDA 3GFLA 2VOPA 4U7BA 4M9XA 3AAFA 2XRNA 4I01A 3F21A 2PN6A 3BROA 3HRSA 3RKXA 2V1DA 3WODF 2H94A 3T5XA 2J5OA 2YPRA 4ASNA 2HKOA 3FM3A 4LB6B 2L4MA 3LA3A 3TGNA 3TO7A 4BHPA 4EVIA 5L3CA 1U6GA 1DP7P 3F22A 1B9NA 2O61A 1K7AA 4HX7A 1MKMA 2QENA 2FNAA 2PLYA 1OYIA 4UV8A 3V4GA 4ZYDA 1YW8A 4A5MA 4EJTA 1TTYA 4G6DA 3GXOA 5K5OA 3I71A 1ZRDA 2P7CB 2DT5A 5ILVA 4HQMA 3DFGA 3CTAA 3LQQA 2WWYA 2G7UA 1I27A 4M9SA 3SFZA 2EV0A 3RYRA 5HDKA 4D0PA 3ULQB 3DV8A 1TW3A 4Y17A 2IRFG 4KIGA 1YW9A 2XAFA 1BC8C 3JTGA 1KQ0A 1QO0D 2G7HA 4EGYA 3CLOA 1P4XA 2L01A 2D1HA 1Y0UA 2M87A 1PDNC 3KE2A 4EQQA 2KIFA 2O0YA 4U88A 1J0RA 4G6QA 2CWEA 3F8BA 3D0SA 4L5JA 4EJUA 2OQGA 2M30A 4GO1A 5E1WA 1P92A 4MEXF 2K02A 4HYEA 4R1HA 1W4MA 1HBXG 4MHGA 3IKVA 3G3ZA 5D5XB 4AIHA 4LGWA 2Z99A 5LHIA 3KCCA 2JPCA 1R7JA 5BQTA 2Y75A 1R1TA 4L9TA 3E5XA 2O03A 1XDSA 3DP7A 1U2WA 4HF1A 4CZZA 4PGGA 2RDPA 4BAYA 2RV8A 5CYVA 1T2KA 3BJAA 4L9VA 3EYIA 3KLOA 4UNOA 3HTSB 1MJBA 4HF0A 1H9TA 5JFRA 2HZTA 4LB5A 5CVVA 2ZMEB 2KIUA 4E70A 1BC7C 1BOAA 1F5TA 5EEGA 2K4JA 1G3SA 4Y15A 4AD9A 3OOPA 4U0VA 2EFNA 3J80Z 3WTWC 4Q4ZF 4M6YA 5ICCA 3I58A 4WXDA 4U7DA 4N9HA 1P4AA 5E8GA 4MTEA 1ZG3A 1S6LA 4KICA 2X4HA 5LLQA 1FPQA 3IC7A 3FXQA 2FNPA 5FD5A 1TLHB 3ECHA 5J6XA 2DPUA 5FGMA 3Q9SA 2V1XA 2GWRA 2ZCWA 1MZBA 4A2UA 3I59A 4KMUX 1ZAOA 4CGZA 5ERIA 2XROA 1ZHFA 5LGNA 1FOKA 1I6XA 1G3WA 2RC4A 4KDPA 2VXZA 3HRTA 1GHCA 4ESJA 3MEXA 2DAOA 1B6AA 3GLXA 2F5DA 4IF4A 3TQNA 1IF1A 1FSEA 1UHMA 2STWA 2ELHA 3QU3A 3J81Z 4YIIA 2FQ3A 1J75A 3QRFF 3KFWX 2A69F 2EFPA 1CGPA 5FFZA 2OZUA 3HRMA 4G7ZF 3ELKA 1SD5A 2ISYA 1YQAA 3QP5A 2X0LA 1JHHA 5IT3A 2STTA 4I0BA 3O3KA 2VE9A 2D2WA 2IVMA 5E8IA 3E5QA 2HS5A 1QNTA 3RI4A 1T0FA 3W6JB 2ZJ2A 3P9IA 6PAXA 2EB7A 4UUVA 4KIBA 2WTEA 3B73A 3SXYA 3WE2A 4TV7A 1MDMB 3F8FA 1I1GA 2MLGA 3GEZA 4L0ZB 3ZQ7A 1FP2A 2L4AA 4KNYA 2CSOA 4KUMA 5JI6A 5E20A 2PEXA 4ZYEA 4KMFA 3U1DA 3MFKA 2Q2EA 2ESHA 3DPTA 2ZNYA 4R79A 2ADUA 1J9IA 3ISPA 2VT2A 2Y48A 2PBIA 1FBUA 1D8KA 2HOEA 2CO5A 4AVPA 2LF7A 4YFNF 5JHUA 3ROUA 1HSTA 3WTSC 1OR7A 4OIRF 3E6BA 3OV8A 2V79A 2FSWA 2H6BA 3P9KA 3V7SA 3GYHX 3GZ6A 1Z9CA 3WGIA 1TW2A 2BYVE 3FMQA 3C3WA 1DDNA 5ED4A 5HOOA 3TDZC 3ERED 1HKQA 2P5VA 3WE3A 2IJLA 3CO6C 2CGPA 4HLXA 1FY7A 1FNNA 4I0AA 3TO6A 1B59A 5AIQA 2Q0OA 3FM5A 2GQQA 2FXAA 1S29A 1F1ZA 4NHJA 2W85A 2AS5F 2TDXA 2ESNA 3L09A 3CUQA 4IRHA 5J8CA 1SMTA 3J80K 2OD5A 2COMA 4ENJA 2DQLA 1F4KA 1L0OC 2NYXA 2IA1A 4G7OF 1Z1DA 4EM0B 2UXNA 4BH9A 2OZ6A 1HQCA 1FC3A 4DQ2A 4FHTA 5BPIA 2DO7A 1J2XA 1ULYA 3R61A 1JGSA 4IRGA 1LEBA 3JW4A 1R5HA 5IT9K 2A6EF 1OYYA 1MGTA 4OIQF 2VONA 4GXOA 1XGMA 2FF4A 2R7FA 4EJWA 2A61A 3LAPA 3CDHA 3GWZA 4CDGA 3ABUA 3L00A 2A5YB 3HOTA 2ZNZA 2M45A 2XAGA 4Y13A 4EGZA 2DLLA 2KRFA 4RB2C 1XMKA 1IUYA 3BJ6A 4BQAA 3ZN0A 4HQEA 3K1MA 1A04A 3LFKA 2GZWA 1BI3A 5CJ9A 2K27A 4KT5C 1IXCA 4AIJA 5ICFA 4HX8A 3JTHA 2A3SA 2H27A 5FLXZ 2QQ9A 1S7OA 3Q9VA 1W7PD 4M9ZA 3E6CC 5DYMA 4EMSA 1XCVA 3BPVA 1MD0A 3QPTA 2GXBA 4XLNF 4CXFA 4XSZF 4O6JA 3HTUA 3ZMVA 1K6OA 2XIGA 1ZRCA 5LEJA 4HAMA 1FP1D 1P4WA 1YTYA 5K1YA 1FX7A 2PMUA 3V7RA 4LFUA 3RTRA 2HWVA 4HDUA 2QZ8A 5HLIA 4WK8F 4L0YB 2HYGD 1D3YA 4KN4X 2FEZA 2RNJA 4GYGA 1NHAA 3WTTC 2CQKA 1WWXA 3GFMA 5DCMB 3JSPA 5H6QA 4RB3C 2NNNA 2HYFA 4KYWA 2FA5A 3LA7A 4GYIA 5L3FA 4JK1X 1XGSA 3NRVA 3BZ6A 1WSUA 4PGHA 1W7PB 1R23A 2E1CA 5E17F 2F5CA 1LVAA 3LWFA 3DQVC 4P9FA 4UV9A 1KQ8A 2DTRA 5BS6A 1FLIA 1YYVA 3HSRA 4BHBA 3K2ZA 4N0BA 3EUHA 1YO5C 2P6TA 4EM1A 2ISZA 1XGOA 4I2OA 1IXSB 1R00A 2W57A 2XAQA 3M8EA 1R1VA 4WCGA 3GX4X 3F8NA 2PI0A 3K1PA 4EV0A 3M1EA 2YX4A 2HEOA 2VN2A 4P96A 5H20A 1IW7F 2NS0A 1IRGA 2RKHA 4OU0A 3V8JA 5LHGA 5HVQC 1X3UA 1BIAA 3E5UA 3FMRA 3Q5FA 2DFIA 3BDDA 1T39A 2E7XA 1J5YA 3R6SA 1DPUA 2LSOA 4HW0A 4L9NA 1UHWA 2WV0A 4HDVA 2DPDA 4KFCA 1XDUA 3N97A 4FX4A 2L54A 2PFBA 1KU2A 1SAXA 5FLXK 5EEHA 3TO9A 5LGUA 4PCQA 4M74A 4A6EA 2W25A 2XVCA 2XKPA 3SZPA 3U9GA 1TQPA 3K0LA 4HF2A 4B09A 4M71A 1CF7A 4CO8A 3L9FA 4YFKF 2NRAC 4LJZF 2E7WA 4LLGF 4RGRA 2XKOA 4Q48A 1XSVA 4RB1A 4ENKA 2M1BA 3MWMA 1H9GA 3L7WA 2HTSA 4UHTA 5LHHA 2AXLA 2XAJA 1FBQA 1K79A 1O57A 3GFIA 1IN6A 3CUOA 3TDUC 2PJPA 3FWEA 3JAMK 2FMYA 2WC2A 4S05A 1FSHA 3RYPA 1KU7A 1UFMA 4M73A 5D6FA 1LEAA 1P6RA 4LD5A 2DK5A 4P5OA 3LSTA 2O6GE 1YS7A 1RZ4A 4I02A 4ON0A 4BYYA 4YIFA 4ENNA 5CVJA 4R8HA 5HDGA 4KA4A 4A0ZA 1USTA 2BEOA 3T1BA 1Q1HA 3KP4A 3HRUA 5HS7A 4RAYA 4ZZDA 3VODA 2RGVA 2VC0A 4I7HA 4LG0A 5F1RA 1LB2A 4OIOF 3KEQA 1SFUA 1S7AA 3DF8A 2DK8A 1LDJA 2UXXA 3LQRA 3EETA 3WGGA 4HZFA 2PG4A 2J5PA 1BI0A 2ZXJA 3FXUA 5AIPA 1FYLA 3L2CA 4P55A 4UVAA 4BXUA 1V4RA 2LDUA 3VB2A 3V8KA 3O6BB 3M8FA 1ZGAA 4RS8A 3COAC 5D5UB 4WWCA 2D45A 1BJAA 1R5GA 2EA2A 3REOA 1TNTA 2GAUA 2QQAA 1U3EM 1OMIA 2VBZA 2KKOA 4I09A 4IPAA 5J8FA 1OPCA 2OA4A 2Y0MA 2OBPA 1SD7A 2ZBKA 3TOAA 2IW5A 4OOIA 1P2FA 3ZMUA 4A6DA 5JVTA 5D5WB 3IKTA 5TRDA 3T8RA 4B8XA 1R58A 4HX4A 3RKYA 1UCRA 3VEPA 4U0WA 5DUKA 2FRHA 1BI1A 1BI2A 2MLKA 1K78A 1YW7A 3DPLC 2KIMA 2RN7A 3FX3A 4S04A 1ZYRF 2FU4A 1W5SA 4I98B 4DNCA 3FHZA 3KP2A 4GCVA 1I1SA 1HKTA 3RJPA 2B0LA 2P8TA 1XCBA 1ZG5A 4Z2YA 5D4SA 1KU9A 3S2WA 4PDKA 5D5VB 1DUXC 4N9IA 4ESFA 4LLNA 1E2XA 3WTVC 2JT1A 2LKPA 5DD8A 3ML6A 5HS8A 1JXSA 3W6KB 2EFOA 4G94A 1B9MA 2K4BA 3MZYA 2IPQX 2QVOA 2A6HF 1MJ9A 1R22A 3RPQA 4WX9A 2F5FA 2MC3A 1RUOA 1Z6RA 4JBAA 3F6VA 1BM9A 1FBSA 2P5LC 1O3RA 2NAZA 2YSRA 1O3TA 2EFQA 3HOSA 3FXRA 1LJ9A 3HHGA 2HQNA 3JSOA 1EH8A 3QOPA 3M9AA 1HW5A 2VBYA 1QGPA 2JPBA 2Z9OA 3QP6A 5E18F 3CUQC 3H3ZA 5L3GA 2F2EA 1L3LA 1QZYA 1PP8F 1QPMA 1QBJA 1ZG1A 2QLZA 3WG9A 2L3DA 3P7NA 1AWCA 3GO5A 3TKYA 3WTXC 2MH9A 3MZHA 3BY6A 4AIKA 3N4MA 2XAHA 2A68F 2EA4A 5AONA 5FB2A 1FYKA 4JQFA 1XN7A 1ZRFA 5HLHA 2IP2A 2O3FA 3KP6A 1H0MA 5D8KB 1EH7A 3F8MA 3B02A 2FBKA 3BWGA 1U5TB 2W84A 3E6MA 1R1UA 4OINF 5K5QA 5L3BA 2MD5A 3ZMSA 4EM2A 2DBBA 4L9JA 4A5NA 5CVRA 1YFHA 3PFIA 1JE8A 1OYWA 2XV4S 3BJOA 2FBHA 4WF2A 2OAZA 2YU3A 1R36A 3RDIA 5IT9Z 1J59A 1S8NA 3SQNA 4LK0F 4MQVA 4KIFA 3KEOA 2ETHA 4G8XA 1S3JA 3WGHA 2CYYA 4FX0A 5KK1A 4LMYA 1XSXA 2LF8A 2UZKA 3TOBA 4O3MA 3BP8A 2Z5UA 2OQRA 2YX7A 1KA8A 5E1XA 5L3EA 3BPXA 3J81K 3GFJA 1U8RA 5F64A 4KN7X 2G9WA 2ZFWA 1KYZA 2ZMEA 1FT9A 1SFXA 1ON2A 3CO7C 3KP7A 3I64A 2JTVA 5DCMA 1Z7UA 3IRRA 2QYOA 2R7DA 3EQLF 2IA0A 1ZARA 2H09A 3D5LA 2ZKZA 2QM3A 3KLNA 2VODA 3IL2A 2EV6A 2GA2A 4RGSA 1LQ1A 5CVUA 1IN7A 4RGUA 1IAWA 2K86A 4YFXF 1Z6TA 4MTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZJ A;  4G9Y A;  2GA1 A;  4CYD A;  1RIO H;  1XB4 A;  4BHC A;  4L18 B;  3HYI A;  4AWX B;  3QU6 A;  4XBF A;  2HTJ A;  1D8J A;  1E17 A;  5LEK A;  2VBW A;  3ECO A;  1FZP B;  3I59 B;  1T38 A;  3ZP5 A;  3K69 A;  2KJC A;  1XD7 A;  3O2P E;  3IRQ A;  4U0Y A;  5BMZ A;  4HOB A;  1SD4 A;  2YR2 A;  1USS A;  3C1D A;  3I5U A;  1G3Y A;  5FFX A;  2IT0 A;  1ZH5 A;  1AOY A;  1WQ2 A;  3E3V A;  5HDN A;  4FT8 A;  2DI3 A;  3ZMD A;  2QBY B;  5FO5 A;  2EFW A;  2LNB A;  3KP3 A;  3RKW A;  1T6S A;  2P6S A;  1MJA A;  3IWF A;  4G7H F;  4WXH A;  2FML A;  4XLP F;  5D8L B;  2GIV A;  1BIB A;  5ILU A;  3H3U A;  3VOE A;  2VC1 A;  2EWN A;  5DUI A;  4IRI A;  2L02 A;  1PP7 U;  1B1B A;  3PQK A;  5HLG A;  2FE3 A;  2KJB A;  3KET A;  1D5V A;  3J7A O;  1KGS A;  2DW4 A;  1K78 B;  3ZN1 A;  3T0Y A;  1U78 A;  2EK5 A;  2EJR A;  5ICG A;  4H0E A;  3BOQ A;  3GVA A;  1C0W A;  1SFE A;  1SD6 A;  4LLL A;  1HKS A;  2P5K A;  3MCZ A;  4F7Z A;  3R60 A;  4A0X A;  3JAM Z;  4NQW A;  2BV6 A;  5BOX A;  1YLF A;  2JSC A;  3C7J A;  3LAJ A;  4OMZ A;  4GGG A;  2HR3 A;  5HS9 A;  1ZLK A;  4ZZL A;  4BNC A;  5D4R A;  5A2Q K;  1IXR C;  1ZLJ A;  3DKW A;  4ESB A;  1IN4 A;  2NNY A;  2P4W A;  2V9V A;  1YIO A;  1ZN2 A;  3F72 A;  5KVR A;  2VE8 A;  5LBQ A;  3WU1 B;  1J7K A;  5E1Z B;  1T98 A;  3E6D A;  2QBY A;  3HSE A;  2CW0 F;  2XGX A;  1TQI A;  1Z05 A;  2MBF A;  1GVJ A;  1LNW A;  3WU0 A;  5K5R A;  2Z33 A;  1GXP A;  4UVB A;  3F23 A;  3I53 A;  2OU2 A;  2DQR A;  3H92 A;  1W5T A;  2ACJ A;  2M8E A;  3I4P A;  1IZ1 A;  3V7C A;  2VBX A;  4HV6 A;  1OKR A;  1O3Q A;  3FZV A;  1ONV A;  3G73 A;  2BBY A;  3F8C A;  5L3D A;  1ZRE A;  1EH6 A;  5TJJ A;  3HIF A;  2IA2 A;  3R0J A;  2P7V B;  5CLS A;  1XSD A;  3V8L A;  2Q8K A;  1RUN A;  1O3S A;  4HLY A;  4L5I A;  1F9N A;  2HQR A;  1STZ A;  4MQ9 F;  3WTY C;  3K1N A;  2W24 A;  1LDD A;  1QZZ A;  4EJO A;  2CG4 A;  1IRF A;  4ETS A;  2RQP A;  2M5W A;  5BPD A;  3EYY A;  1V3F A;  3IHU A;  3SHF A;  3R0A A;  4HBL A;  4UVC A;  3QPH A;  1KYW A;  4XRF A;  4OMY A;  2CFX A;  3HHH A;  5LGT A;  4IVN A;  2DU9 A;  5F6F A;  3C18 A;  3K9T A;  3F3X A;  3U2R A;  5DEQ A;  4LG0 B;  3HSF A;  2A07 F;  2UWM A;  4Q47 A;  2PMH A;  2GXG A;  1TNS A;  2E1N A;  4IJA A;  4IHS A;  2QWW A;  1HW2 A;  5CVI A;  1LDK B;  3E97 A;  4WXC A;  4A12 A;  5JR3 A;  2C6Y A;  1G3T A;  1JHF A;  4K2E A;  4XSX F;  1MDM A;  4RB0 A;  1I5Z A;  2F5E A;  2HFH A;  1HSJ A;  1RI7 A;  3GUD A;  1HW1 A;  3P9C A;  2HKX A;  3EDP A;  1EV7 A;  2HDC A;  2H6C A;  1WI9 A;  1BN5 A;  1XGN A;  2VT3 A;  3LA2 A;  4MNU A;  3KZY A;  5LRR A;  5FD6 A;  5A2Q Z;  3DEU A;  4A0Y A;  4QLC U;  2O8X A;  3HUG A;  2Z3Y A;  1U5T C;  2XUB A;  5ICE A;  3WTU C;  4IXA A;  4Q5S F;  5ILS A;  1B4A A;  1IN8 A;  2V1U A;  1G6N A;  1XMA A;  1WKM A;  2VOO A;  2HGC A;  2QQB A;  2BE5 F;  3MAJ A;  1SMY F;  1KQ9 A;  3NQO A;  4P9U A;  1G4D A;  3PQJ A;  1FYM A;  3R4K A;  4NB5 A;  3IWZ A;  2XHK A;  1REP C;  1U5T A;  1DPR A;  3ZMZ A;  1TBX A;  4MEY F;  5DCF A;  4OIP F;  5D6E A;  2V6C A;  3RPU A;  4O5V A;  3CUQ B;  3VFZ A;  1RNL A;  1YG2 A;  5LRS A;  2R3S A;  4MGR A;  3GW2 A;  3NEU A;  2MA3 A;  2MH2 A;  2QUF A;  1KU3 A;  3T8T A;  4CIC A;  1YS6 A;  4ENM A;  2JZY A;  3WTZ A;  4M6X A;  1PUE E;  2BGC A;  2PQ8 A;  1Z91 A;  5H6R A;  5DD4 A;  1O7L A;  3MQ0 A;  4HA8 A;  4CHU A;  1GXQ A;  4EJV A;  3GZ5 A;  2RVC A;  1QQI A;  2D1V A;  1ZGJ A;  4M72 A;  1CF7 B;  3SZT A;  1BBY A;  3KZZ A;  1W7P A;  3GF2 A;  3FMS A;  3M7G A;  2FOK A;  4HV5 A;  1ON1 A;  4LK1 F;  1HXD A;  3I0T A;  1FWZ A;  3ABT A;  3RIR A;  4YG2 F;  3I54 A;  1VTN C;  2ZO4 A;  2EV5 A;  4RGX A;  3FF5 A;  1TQM A;  4QWQ A;  3CJN A;  3ZMT A;  3DXJ F;  4UXN A;  2JRT A;  4ZYH A;  3QAH A;  4ZYG A;  1IN5 A;  5DDG A;  2K7L A;  3ZPL A;  3F6O A;  1WRJ A;  3KP5 A;  2FBI A;  4RAZ A;  1UB9 A;  2XAS A;  4IHT A;  4ZH4 F;  5DV5 A;  1O7F A;  1ODD A;  3GFL A;  2VOP A;  4U7B A;  4M9X A;  3AAF A;  2XRN A;  4I01 A;  3F21 A;  2PN6 A;  3BRO A;  3HRS A;  3RKX A;  2V1D A;  3WOD F;  2H94 A;  3T5X A;  2J5O A;  2YPR A;  4ASN A;  2HKO A;  3FM3 A;  4LB6 B;  2L4M A;  3LA3 A;  3TGN A;  3TO7 A;  4BHP A;  4EVI A;  5L3C A;  1U6G A;  1DP7 P;  3F22 A;  1B9N A;  2O61 A;  1K7A A;  4HX7 A;  1MKM A;  2QEN A;  2FNA A;  2PLY A;  1OYI A;  4UV8 A;  3V4G A;  4ZYD A;  1YW8 A;  4A5M A;  4EJT A;  1TTY A;  4G6D A;  3GXO A;  5K5O A;  3I71 A;  1ZRD A;  2P7C B;  2DT5 A;  5ILV A;  4HQM A;  3DFG A;  3CTA A;  3LQQ A;  2WWY A;  2G7U A;  1I27 A;  4M9S A;  3SFZ A;  2EV0 A;  3RYR A;  5HDK A;  4D0P A;  3ULQ B;  3DV8 A;  1TW3 A;  4Y17 A;  2IRF G;  4KIG A;  1YW9 A;  2XAF A;  1BC8 C;  3JTG A;  1KQ0 A;  1QO0 D;  2G7H A;  4EGY A;  3CLO A;  1P4X A;  2L01 A;  2D1H A;  1Y0U A;  2M87 A;  1PDN C;  3KE2 A;  4EQQ A;  2KIF A;  2O0Y A;  4U88 A;  1J0R A;  4G6Q A;  2CWE A;  3F8B A;  3D0S A;  4L5J A;  4EJU A;  2OQG A;  2M30 A;  4GO1 A;  5E1W A;  1P92 A;  4MEX F;  2K02 A;  4HYE A;  4R1H A;  1W4M A;  1HBX G;  4MHG A;  3IKV A;  3G3Z A;  5D5X B;  4AIH A;  4LGW A;  2Z99 A;  5LHI A;  3KCC A;  2JPC A;  1R7J A;  5BQT A;  2Y75 A;  1R1T A;  4L9T A;  3E5X A;  2O03 A;  1XDS A;  3DP7 A;  1U2W A;  4HF1 A;  4CZZ A;  4PGG A;  2RDP A;  4BAY A;  2RV8 A;  5CYV A;  1T2K A;  3BJA A;  4L9V A;  3EYI A;  3KLO A;  4UNO A;  3HTS B;  1MJB A;  4HF0 A;  1H9T A;  5JFR A;  2HZT A;  4LB5 A;  5CVV A;  2ZME B;  2KIU A;  4E70 A;  1BC7 C;  1BOA A;  1F5T A;  5EEG A;  2K4J A;  1G3S A;  4Y15 A;  4AD9 A;  3OOP A;  4U0V A;  2EFN A;  3J80 Z;  3WTW C;  4Q4Z F;  4M6Y A;  5ICC A;  3I58 A;  4WXD A;  4U7D A;  4N9H A;  1P4A A;  5E8G A;  4MTE A;  1ZG3 A;  1S6L A;  4KIC A;  2X4H A;  5LLQ A;  1FPQ A;  3IC7 A;  3FXQ A;  2FNP A;  5FD5 A;  1TLH B;  3ECH A;  5J6X A;  2DPU A;  5FGM A;  3Q9S A;  2V1X A;  2GWR A;  2ZCW A;  1MZB A;  4A2U A;  3I59 A;  4KMU X;  1ZAO A;  4CGZ A;  5ERI A;  2XRO A;  1ZHF A;  5LGN A;  1FOK A;  1I6X A;  1G3W A;  2RC4 A;  4KDP A;  2VXZ A;  3HRT A;  1GHC A;  4ESJ A;  3MEX A;  2DAO A;  1B6A A;  3GLX A;  2F5D A;  4IF4 A;  3TQN A;  1IF1 A;  1FSE A;  1UHM A;  2STW A;  2ELH A;  3QU3 A;  3J81 Z;  4YII A;  2FQ3 A;  1J75 A;  3QRF F;  3KFW X;  2A69 F;  2EFP A;  1CGP A;  5FFZ A;  2OZU A;  3HRM A;  4G7Z F;  3ELK A;  1SD5 A;  2ISY A;  1YQA A;  3QP5 A;  2X0L A;  1JHH A;  5IT3 A;  2STT A;  4I0B A;  3O3K A;  2VE9 A;  2D2W A;  2IVM A;  5E8I A;  3E5Q A;  2HS5 A;  1QNT A;  3RI4 A;  1T0F A;  3W6J B;  2ZJ2 A;  3P9I A;  6PAX A;  2EB7 A;  4UUV A;  4KIB A;  2WTE A;  3B73 A;  3SXY A;  3WE2 A;  4TV7 A;  1MDM B;  3F8F A;  1I1G A;  2MLG A;  3GEZ A;  4L0Z B;  3ZQ7 A;  1FP2 A;  2L4A A;  4KNY A;  2CSO A;  4KUM A;  5JI6 A;  5E20 A;  2PEX A;  4ZYE A;  4KMF A;  3U1D A;  3MFK A;  2Q2E A;  2ESH A;  3DPT A;  2ZNY A;  4R79 A;  2ADU A;  1J9I A;  3ISP A;  2VT2 A;  2Y48 A;  2PBI A;  1FBU A;  1D8K A;  2HOE A;  2CO5 A;  4AVP A;  2LF7 A;  4YFN F;  5JHU A;  3ROU A;  1HST A;  3WTS C;  1OR7 A;  4OIR F;  3E6B A;  3OV8 A;  2V79 A;  2FSW A;  2H6B A;  3P9K A;  3V7S A;  3GYH X;  3GZ6 A;  1Z9C A;  3WGI A;  1TW2 A;  2BYV E;  3FMQ A;  3C3W A;  1DDN A;  5ED4 A;  5HOO A;  3TDZ C;  3ERE D;  1HKQ A;  2P5V A;  3WE3 A;  2IJL A;  3CO6 C;  2CGP A;  4HLX A;  1FY7 A;  1FNN A;  4I0A A;  3TO6 A;  1B59 A;  5AIQ A;  2Q0O A;  3FM5 A;  2GQQ A;  2FXA A;  1S29 A;  1F1Z A;  4NHJ A;  2W85 A;  2AS5 F;  2TDX A;  2ESN A;  3L09 A;  3CUQ A;  4IRH A;  5J8C A;  1SMT A;  3J80 K;  2OD5 A;  2COM A;  4ENJ A;  2DQL A;  1F4K A;  1L0O C;  2NYX A;  2IA1 A;  4G7O F;  1Z1D A;  4EM0 B;  2UXN A;  4BH9 A;  2OZ6 A;  1HQC A;  1FC3 A;  4DQ2 A;  4FHT A;  5BPI A;  2DO7 A;  1J2X A;  1ULY A;  3R61 A;  1JGS A;  4IRG A;  1LEB A;  3JW4 A;  1R5H A;  5IT9 K;  2A6E F;  1OYY A;  1MGT A;  4OIQ F;  2VON A;  4GXO A;  1XGM A;  2FF4 A;  2R7F A;  4EJW A;  2A61 A;  3LAP A;  3CDH A;  3GWZ A;  4CDG A;  3ABU A;  3L00 A;  2A5Y B;  3HOT A;  2ZNZ A;  2M45 A;  2XAG A;  4Y13 A;  4EGZ A;  2DLL A;  2KRF A;  4RB2 C;  1XMK A;  1IUY A;  3BJ6 A;  4BQA A;  3ZN0 A;  4HQE A;  3K1M A;  1A04 A;  3LFK A;  2GZW A;  1BI3 A;  5CJ9 A;  2K27 A;  4KT5 C;  1IXC A;  4AIJ A;  5ICF A;  4HX8 A;  3JTH A;  2A3S A;  2H27 A;  5FLX Z;  2QQ9 A;  1S7O A;  3Q9V A;  1W7P D;  4M9Z A;  3E6C C;  5DYM A;  4EMS A;  1XCV A;  3BPV A;  1MD0 A;  3QPT A;  2GXB A;  4XLN F;  4CXF A;  4XSZ F;  4O6J A;  3HTU A;  3ZMV A;  1K6O A;  2XIG A;  1ZRC A;  5LEJ A;  4HAM A;  1FP1 D;  1P4W A;  1YTY A;  5K1Y A;  1FX7 A;  2PMU A;  3V7R A;  4LFU A;  3RTR A;  2HWV A;  4HDU A;  2QZ8 A;  5HLI A;  4WK8 F;  4L0Y B;  2HYG D;  1D3Y A;  4KN4 X;  2FEZ A;  2RNJ A;  4GYG A;  1NHA A;  3WTT C;  2CQK A;  1WWX A;  3GFM A;  5DCM B;  3JSP A;  5H6Q A;  4RB3 C;  2NNN A;  2HYF A;  4KYW A;  2FA5 A;  3LA7 A;  4GYI A;  5L3F A;  4JK1 X;  1XGS A;  3NRV A;  3BZ6 A;  1WSU A;  4PGH A;  1W7P B;  1R23 A;  2E1C A;  5E17 F;  2F5C A;  1LVA A;  3LWF A;  3DQV C;  4P9F A;  4UV9 A;  1KQ8 A;  2DTR A;  5BS6 A;  1FLI A;  1YYV A;  3HSR A;  4BHB A;  3K2Z A;  4N0B A;  3EUH A;  1YO5 C;  2P6T A;  4EM1 A;  2ISZ A;  1XGO A;  4I2O A;  1IXS B;  1R00 A;  2W57 A;  2XAQ A;  3M8E A;  1R1V A;  4WCG A;  3GX4 X;  3F8N A;  2PI0 A;  3K1P A;  4EV0 A;  3M1E A;  2YX4 A;  2HEO A;  2VN2 A;  4P96 A;  5H20 A;  1IW7 F;  2NS0 A;  1IRG A;  2RKH A;  4OU0 A;  3V8J A;  5LHG A;  5HVQ C;  1X3U A;  1BIA A;  3E5U A;  3FMR A;  3Q5F A;  2DFI A;  3BDD A;  1T39 A;  2E7X A;  1J5Y A;  3R6S A;  1DPU A;  2LSO A;  4HW0 A;  4L9N A;  1UHW A;  2WV0 A;  4HDV A;  2DPD A;  4KFC A;  1XDU A;  3N97 A;  4FX4 A;  2L54 A;  2PFB A;  1KU2 A;  1SAX A;  5FLX K;  5EEH A;  3TO9 A;  5LGU A;  4PCQ A;  4M74 A;  4A6E A;  2W25 A;  2XVC A;  2XKP A;  3SZP A;  3U9G A;  1TQP A;  3K0L A;  4HF2 A;  4B09 A;  4M71 A;  1CF7 A;  4CO8 A;  3L9F A;  4YFK F;  2NRA C;  4LJZ F;  2E7W A;  4LLG F;  4RGR A;  2XKO A;  4Q48 A;  1XSV A;  4RB1 A;  4ENK A;  2M1B A;  3MWM A;  1H9G A;  3L7W A;  2HTS A;  4UHT A;  5LHH A;  2AXL A;  2XAJ A;  1FBQ A;  1K79 A;  1O57 A;  3GFI A;  1IN6 A;  3CUO A;  3TDU C;  2PJP A;  3FWE A;  3JAM K;  2FMY A;  2WC2 A;  4S05 A;  1FSH A;  3RYP A;  1KU7 A;  1UFM A;  4M73 A;  5D6F A;  1LEA A;  1P6R A;  4LD5 A;  2DK5 A;  4P5O A;  3LST A;  2O6G E;  1YS7 A;  1RZ4 A;  4I02 A;  4ON0 A;  4BYY A;  4YIF A;  4ENN A;  5CVJ A;  4R8H A;  5HDG A;  4KA4 A;  4A0Z A;  1UST A;  2BEO A;  3T1B A;  1Q1H A;  3KP4 A;  3HRU A;  5HS7 A;  4RAY A;  4ZZD A;  3VOD A;  2RGV A;  2VC0 A;  4I7H A;  4LG0 A;  5F1R A;  1LB2 A;  4OIO F;  3KEQ A;  1SFU A;  1S7A A;  3DF8 A;  2DK8 A;  1LDJ A;  2UXX A;  3LQR A;  3EET A;  3WGG A;  4HZF A;  2PG4 A;  2J5P A;  1BI0 A;  2ZXJ A;  3FXU A;  5AIP A;  1FYL A;  3L2C A;  4P55 A;  4UVA A;  4BXU A;  1V4R A;  2LDU A;  3VB2 A;  3V8K A;  3O6B B;  3M8F A;  1ZGA A;  4RS8 A;  3COA C;  5D5U B;  4WWC A;  2D45 A;  1BJA A;  1R5G A;  2EA2 A;  3REO A;  1TNT A;  2GAU A;  2QQA A;  1U3E M;  1OMI A;  2VBZ A;  2KKO A;  4I09 A;  4IPA A;  5J8F A;  1OPC A;  2OA4 A;  2Y0M A;  2OBP A;  1SD7 A;  2ZBK A;  3TOA A;  2IW5 A;  4OOI A;  1P2F A;  3ZMU A;  4A6D A;  5JVT A;  5D5W B;  3IKT A;  5TRD A;  3T8R A;  4B8X A;  1R58 A;  4HX4 A;  3RKY A;  1UCR A;  3VEP A;  4U0W A;  5DUK A;  2FRH A;  1BI1 A;  1BI2 A;  2MLK A;  1K78 A;  1YW7 A;  3DPL C;  2KIM A;  2RN7 A;  3FX3 A;  4S04 A;  1ZYR F;  2FU4 A;  1W5S A;  4I98 B;  4DNC A;  3FHZ A;  3KP2 A;  4GCV A;  1I1S A;  1HKT A;  3RJP A;  2B0L A;  2P8T A;  1XCB A;  1ZG5 A;  4Z2Y A;  5D4S A;  1KU9 A;  3S2W A;  4PDK A;  5D5V B;  1DUX C;  4N9I A;  4ESF A;  4LLN A;  1E2X A;  3WTV C;  2JT1 A;  2LKP A;  5DD8 A;  3ML6 A;  5HS8 A;  1JXS A;  3W6K B;  2EFO A;  4G94 A;  1B9M A;  2K4B A;  3MZY A;  2IPQ X;  2QVO A;  2A6H F;  1MJ9 A;  1R22 A;  3RPQ A;  4WX9 A;  2F5F A;  2MC3 A;  1RUO A;  1Z6R A;  4JBA A;  3F6V A;  1BM9 A;  1FBS A;  2P5L C;  1O3R A;  2NAZ A;  2YSR A;  1O3T A;  2EFQ A;  3HOS A;  3FXR A;  1LJ9 A;  3HHG A;  2HQN A;  3JSO A;  1EH8 A;  3QOP A;  3M9A A;  1HW5 A;  2VBY A;  1QGP A;  2JPB A;  2Z9O A;  3QP6 A;  5E18 F;  3CUQ C;  3H3Z A;  5L3G A;  2F2E A;  1L3L A;  1QZY A;  1PP8 F;  1QPM A;  1QBJ A;  1ZG1 A;  2QLZ A;  3WG9 A;  2L3D A;  3P7N A;  1AWC A;  3GO5 A;  3TKY A;  3WTX C;  2MH9 A;  3MZH A;  3BY6 A;  4AIK A;  3N4M A;  2XAH A;  2A68 F;  2EA4 A;  5AON A;  5FB2 A;  1FYK A;  4JQF A;  1XN7 A;  1ZRF A;  5HLH A;  2IP2 A;  2O3F A;  3KP6 A;  1H0M A;  5D8K B;  1EH7 A;  3F8M A;  3B02 A;  2FBK A;  3BWG A;  1U5T B;  2W84 A;  3E6M A;  1R1U A;  4OIN F;  5K5Q A;  5L3B A;  2MD5 A;  3ZMS A;  4EM2 A;  2DBB A;  4L9J A;  4A5N A;  5CVR A;  1YFH A;  3PFI A;  1JE8 A;  1OYW A;  2XV4 S;  3BJO A;  2FBH A;  4WF2 A;  2OAZ A;  2YU3 A;  1R36 A;  3RDI A;  5IT9 Z;  1J59 A;  1S8N A;  3SQN A;  4LK0 F;  4MQV A;  4KIF A;  3KEO A;  2ETH A;  4G8X A;  1S3J A;  3WGH A;  2CYY A;  4FX0 A;  5KK1 A;  4LMY A;  1XSX A;  2LF8 A;  2UZK A;  3TOB A;  4O3M A;  3BP8 A;  2Z5U A;  2OQR A;  2YX7 A;  1KA8 A;  5E1X A;  5L3E A;  3BPX A;  3J81 K;  3GFJ A;  1U8R A;  5F64 A;  4KN7 X;  2G9W A;  2ZFW A;  1KYZ A;  2ZME A;  1FT9 A;  1SFX A;  1ON2 A;  3CO7 C;  3KP7 A;  3I64 A;  2JTV A;  5DCM A;  1Z7U A;  3IRR A;  2QYO A;  2R7D A;  3EQL F;  2IA0 A;  1ZAR A;  2H09 A;  3D5L A;  2ZKZ A;  2QM3 A;  3KLN A;  2VOD A;  3IL2 A;  2EV6 A;  2GA2 A;  4RGS A;  1LQ1 A;  5CVU A;  1IN7 A;  4RGU A;  1IAW A;  2K86 A;  4YFX F;  1Z6T A;  4MTD A; 
#chains in the Genus database with same CATH topology
 4PZJ A;  4PJM A;  2DA3 A;  4G9Y A;  1BW5 A;  2GA1 A;  4CYD A;  1RIO H;  2QCO A;  1XB4 A;  4BHC A;  4L18 B;  3HYI A;  4AWX B;  3QU6 A;  4XBF A;  2H8R A;  4CZC A;  2HTJ A;  1D8J A;  3LSH A;  1E17 A;  2OF7 A;  5LEK A;  4YRV A;  2VBW A;  3ECO A;  3K7A J;  1N25 A;  1FZP B;  3I59 B;  1VQP I;  4M3F A;  1T38 A;  3ZP5 A;  1WI3 A;  3K69 A;  4PJ0 C;  2KJC A;  1XD7 A;  3O2P E;  1ZK8 A;  4KIS A;  3IRQ A;  4U0Y A;  3A02 A;  3AG2 H;  4XQF A;  5BMZ A;  1TZL A;  1MH3 A;  1X1D A;  4HOB A;  1SD4 A;  2YR2 A;  5GTI C;  1WJ5 A;  1USS A;  1KON A;  2KP6 A;  3FKI J;  1WJD A;  3C1D A;  3HGG A;  1U9O A;  3E7L A;  3F0C A;  1GV5 A;  4AC0 A;  2X1D A;  3I5U A;  1W1W E;  1G3Y A;  5FFX A;  3Q0V A;  1MMN A;  1JKQ C;  2IT0 A;  1ZH5 A;  1WQ2 A;  1AOY A;  1HOM A;  3E3V A;  3OYL A;  5HDN A;  2WAF A;  1B8I A;  3OYB A;  4FT8 A;  2DI3 A;  3VYT B;  3A01 B;  3S1Q J;  3ZMD A;  2LRD A;  2QBY B;  5FO5 A;  2EFW A;  4IQ4 A;  2LNB A;  3KP3 A;  3RKW A;  1T6S A;  2VJ4 A;  2P6S A;  1MJA A;  2BY0 A;  2E2H J;  2R7O A;  2DA4 A;  2DDB A;  3IUO A;  5EG0 A;  3IWF A;  4G7H F;  3S2H J;  4WXH A;  4DIQ A;  3HXL A;  2FML A;  4XLP F;  5D8L B;  3CCV I;  2GIV A;  2VPR A;  1BIB A;  2LP0 A;  2E2I J;  1YIJ I;  5ILU A;  1WZ2 A;  2LC2 A;  3H3U A;  3MD2 A;  1D0Z A;  3VOE A;  1Y1V J;  2GLO A;  2VC1 A;  3G71 I;  2EWN A;  5DUI A;  3V42 A;  4IRI A;  2L02 A;  2O7O A;  2N8G A;  3MKL A;  5JLX A;  4BQN A;  4CCM A;  1PP7 U;  1B1B A;  3PQK A;  4AYB A;  5HLG A;  5GP9 A;  3BZC A;  2FE3 A;  2KJB A;  3KET A;  2F48 A;  2JSP A;  4QSH A;  1D5V A;  1JT0 A;  3J7A O;  3OYJ A;  1KGS A;  2VAS A;  2DW4 A;  1HLV A;  3L1P A;  1K78 B;  3ZN1 A;  5IYB J;  3T0Y A;  1U78 A;  4FTH A;  2DA2 A;  2GOX B;  3DBH B;  2LY9 A;  4ZDO A;  5FKN A;  2EK5 A;  4A93 J;  4D7N A;  4B44 A;  3EUK L;  2EJR A;  5ICG A;  3RKQ A;  4QPO A;  1UEL B;  1MBK A;  4H0E A;  3BOQ A;  3GVA A;  3QYB A;  1SAU A;  3BQZ A;  1C0W A;  1SFE A;  1SD6 A;  4LLL A;  4X6A J;  1HKS A;  2P5K A;  4IHV A;  3MCZ A;  4F7Z A;  3R60 A;  4A0X A;  2B9S A;  4RAF A;  3JAM Z;  3LL7 A;  2K85 A;  4NQW A;  2BV6 A;  1FJL A;  2JRM A;  1WPK A;  5BOX A;  1GT0 C;  1YLF A;  2JSC A;  5B1A H;  2VB6 A;  3C7J A;  3H0G J;  4YEL A;  3LAJ A;  1XS9 A;  2PMZ A;  3OYC A;  1OFC X;  4UB6 C;  4OMZ A;  4GGG A;  3M3Y J;  2HR3 A;  4XKW A;  1VQ9 I;  1LVK A;  1AA7 A;  5HS9 A;  1ZLK A;  4ZZL A;  4BNC A;  1X1P A;  5D4R A;  5A2Q K;  1IXR C;  1ZLJ A;  3DKW A;  3BTJ A;  4ESB A;  3BT9 A;  3MKY B;  5IOZ A;  1IN4 A;  1Y8Q B;  1NH3 A;  5IYC J;  2KZV A;  2NNY A;  2P4W A;  2V9V A;  3W2V A;  4LG3 A;  1YIO A;  1ZN2 A;  2IBD A;  3F72 A;  5KVR A;  2VE8 A;  5LBQ A;  3WU1 B;  1WGX A;  1J7K A;  5E1Z B;  1T98 A;  3E6D A;  2QBY A;  2FX0 A;  3HSE A;  3OL3 A;  4UB8 C;  3L2W A;  2CW0 F;  2XGX A;  1ETW A;  1TQI A;  4Y3O A;  1Z05 A;  2MBF A;  1GVJ A;  2QKM B;  2V6E A;  3A0H C;  1R4M B;  2ZJR F;  2HOT A;  1FIP A;  4DYC A;  2E1M C;  3CCU I;  1R4N B;  1LNW A;  3WU0 A;  5KAI C;  1FTZ A;  5K5R A;  2Z33 A;  2AQF A;  1GXP A;  1Y6I A;  3HPH A;  1PJR A;  3S1N J;  4UVB A;  3F23 A;  1IDZ A;  3I53 A;  3CP2 A;  2OU2 A;  2DQR A;  2E35 A;  4IHW A;  2O5R A;  3HL2 A;  1MBE A;  1BW6 A;  3H92 A;  1W5T A;  1DP3 A;  2ACJ A;  1Z67 A;  1ZGW A;  4FAS D;  5E79 C;  2M8E A;  2XSD C;  3DLL F;  2OTJ I;  3I4P A;  1IZ1 A;  1GLN A;  2UV1 A;  3V7C A;  2VBX A;  4HV6 A;  1OKR A;  1O3Q A;  1W36 C;  3FZV A;  1ONV A;  3G73 A;  2BBY A;  3F8C A;  1K6Y A;  2VJ5 A;  4ABZ A;  4CUG A;  1JT6 A;  1YX5 A;  5L3D A;  1ZRE A;  1EH6 A;  3PSI A;  3VSL A;  4ZTF A;  5TJJ A;  1LPQ A;  4PJL A;  3HIF A;  3M07 A;  2IA2 A;  2X1C A;  3R0J A;  2P7V B;  5CLS A;  3TBI A;  3CCR I;  4L5E A;  4F92 B;  1XSD A;  5GPC A;  3V8L A;  2RAE A;  2NVY J;  4F52 A;  1JTY A;  3PL8 A;  2Q8K A;  1RUN A;  1O3S A;  4HLY A;  2BVM A;  3JRB A;  4L5I A;  2XPV A;  3IV5 A;  4RAG A;  4XN0 A;  3BC8 A;  3LSI A;  1F9N A;  2HQR A;  1STZ A;  2IGN A;  2L9N A;  4MQ9 F;  1X58 A;  3WTY C;  3K1N A;  2W24 A;  1LDD A;  1QZZ A;  4KT6 A;  4EJO A;  1XG1 A;  2CG4 A;  1IRF A;  2R4G A;  3ZQH A;  4F55 A;  3BTC A;  4A3F J;  1TWA J;  4ETS A;  2M34 A;  3ONQ A;  2L9S A;  1HDP A;  2RQP A;  2M5W A;  2ECB A;  5BPD A;  1Y1W J;  1RKT A;  3OIO A;  3EYY A;  1V3F A;  2DOD A;  3IHU A;  1GV2 A;  2HU9 A;  3SHF A;  1WH5 A;  4CYC A;  1MNE A;  3CC2 I;  3R0A A;  4HBL A;  4UVC A;  3QPH A;  1KYW A;  4XRF A;  2KDZ A;  4OMY A;  3CZ6 A;  1H8A C;  2CFX A;  3HHH A;  4PFO A;  4PJN A;  3L2R A;  5LGT A;  4IVN A;  2W4S A;  2DU9 A;  2AQE A;  3OR1 C;  1RC9 A;  5F6F A;  1I3A A;  3C18 A;  3K9T A;  1JUP A;  3F3X A;  2H1L A;  3EUH C;  3U2R A;  2PMZ N;  3I4M J;  5DEQ A;  5IPA A;  4E7L A;  3HSF A;  4LG0 B;  2A07 F;  3KX2 A;  2UWM A;  1LFP A;  3GTO J;  3G6E I;  4Q47 A;  4BQQ A;  2PMH A;  1YHQ I;  3VYU B;  2GXG A;  2R7Q A;  4F93 B;  4B47 A;  5B5E C;  2EIJ H;  4BBS J;  1TNS A;  2E1N A;  4IJA A;  4IHS A;  2GIZ A;  2L0K A;  2NXN B;  2WY8 Q;  2QWW A;  3O8G A;  3OSF A;  1JKO C;  1HW2 A;  5CVI A;  1LDK B;  2HPM A;  3E97 A;  4WXC A;  3OR2 C;  2ME0 A;  3DPU A;  3ZR8 X;  2OV7 A;  4A12 A;  1MH4 A;  5JR3 A;  2C6Y A;  4I99 C;  1G3T A;  5IYD J;  1EF4 A;  2BY2 A;  2F5V A;  1NG6 A;  1JHF A;  3OS1 A;  2JWT A;  2HOS A;  3PUF A;  4A3G J;  3BG5 A;  4K2E A;  4XSX F;  3SEQ A;  3UNG C;  1MDM A;  1F36 A;  2WV1 A;  4RB0 A;  1I5Z A;  1JUM A;  2F5E A;  2HFH A;  2EZL A;  4ZJZ A;  3CD6 I;  5K7F A;  1HSJ A;  4BEH A;  1RI7 A;  5M3F J;  3GUD A;  4AVZ A;  3PNT A;  3OY9 A;  1HW1 A;  3P9C A;  3FK7 A;  2HKX A;  2ICW G;  2IGM A;  2Q2E B;  2LRE A;  3EDP A;  1EV7 A;  2HDC A;  1NG7 A;  2H6C A;  1WI9 A;  1BN5 A;  1XGN A;  1SEU A;  3EUA A;  2NS8 A;  4KJZ A;  4GRI A;  4IOA F;  2VT3 A;  3LA2 A;  4MNU A;  4LIU A;  3KZY A;  5LRR A;  5FD6 A;  1TC3 C;  2F4I A;  5A2Q Z;  4II3 A;  3DEU A;  4A0Y A;  4QLC U;  2O8X A;  4QPQ A;  2VUM J;  3HUG A;  2L5Q A;  4C3I J;  3DTK A;  3ASO H;  2Z3Y A;  1U5T C;  2KRC A;  2XUB A;  4DYR A;  3DBR B;  4CCL A;  1ZKG A;  5ICE A;  4CYC B;  2DTZ A;  3WTU C;  2X1E A;  3FXL A;  2V4J C;  2HXI A;  4IXA A;  5J3L A;  2HNH A;  1T33 A;  4Q5S F;  5E3O A;  3M8J A;  2R7W A;  5ILS A;  1B4A A;  2JMW A;  1IN8 A;  3H1C A;  2V1U A;  2KT0 A;  3DTE A;  2DOA A;  1MMD A;  1VQM I;  1G6N A;  3HGY A;  1XMA A;  1WKM A;  2VOO A;  1VI0 A;  2Y2Z A;  4MFD A;  3ZXS A;  1X3Z B;  2HGC A;  3TL4 X;  1K4S A;  2QQB A;  2BE5 F;  4QIW N;  3BCB A;  3MAJ A;  2L7M P;  1SMY F;  2E71 A;  3OYE A;  2F4O B;  1KQ9 A;  3C2B A;  3NQO A;  3NWT A;  4P9U A;  1V54 H;  1G4D A;  1E0E A;  3PQJ A;  1FYM A;  3HM5 A;  3R4K A;  2R7S A;  2K9M A;  4NB5 A;  3AKZ A;  3IWZ A;  2CW8 A;  2XHK A;  1REP C;  1U5T A;  3S16 J;  1DPR A;  2MG4 A;  3SFI A;  1TBX A;  3ZMZ A;  4HSR A;  2EZI A;  4MEY F;  3KYD B;  5DCF A;  1OCZ H;  2VIX A;  2VJJ A;  5D6E A;  1K83 J;  4OIP F;  3FXO A;  2V6C A;  3RPU A;  4O5V A;  3CUQ B;  2LY2 A;  3VFZ A;  4C9Y A;  1RNL A;  1YG2 A;  2FUG 2;  3G2B A;  1RES A;  1ETK A;  2WAD A;  5LRS A;  2R3S A;  4MGR A;  5EZG A;  3GW2 A;  2OCE A;  3NEU A;  2MA3 A;  2MH2 A;  2WA0 A;  4FIS A;  2QUF A;  1KU3 A;  1Y8R B;  3T8T A;  4XRS G;  2QF7 A;  2A6T A;  4CIC A;  4I76 A;  3AL0 C;  1YS6 A;  1YE9 A;  1QVT A;  2XF7 A;  4ENM A;  2JZY A;  1GUU A;  2KFD A;  3WTZ A;  3Q3S A;  4M6X A;  1PUE E;  2ME6 A;  3HJE A;  2Y9Y A;  1T95 A;  2BGC A;  4BY7 J;  2PQ8 A;  4IKF A;  1Z91 A;  2KHM A;  3HPG A;  5H6R A;  3C2H A;  5DD4 A;  2E1O A;  5J4Y A;  2DA6 A;  4EAT A;  1MMS A;  1O7L A;  1DU6 A;  2JN6 A;  3MQ0 A;  3JRH A;  2LD5 A;  3CF5 F;  2COB A;  4HA8 A;  5FRO A;  4CHU A;  2MAB A;  1GXQ A;  4EJV A;  1IUF A;  4J01 A;  3GZ5 A;  2RVC A;  5J47 A;  1QQI A;  2D1V A;  2BOL A;  1ZGJ A;  1WFX A;  3BCA A;  4M72 A;  1CF7 B;  3SZT A;  1BBY A;  3KZZ A;  1X2N A;  3SZG A;  1W7P A;  3ZQF A;  1S7E A;  4BU2 A;  3GF2 A;  3FMS A;  3M7G A;  2VQH A;  2FOK A;  4HV5 A;  3CMA I;  3GME A;  1ON1 A;  4BUP A;  1VF9 A;  3I55 I;  4LK1 F;  4A3J J;  1HXD A;  3CDI A;  4C30 A;  3I0T A;  2YU9 J;  4BL0 B;  3Q0U A;  1FWZ A;  3ABT A;  3RIR A;  4DGW B;  4YG2 F;  5E3L A;  1Z7L A;  3I54 A;  1VTN C;  2KMU A;  4UUS A;  3M4O J;  2OJE D;  2ZO4 A;  2EV5 A;  4RGX A;  2RNG A;  3FF5 A;  1HDD C;  1TQM A;  2E5Z A;  4QWQ A;  4Z6Y A;  3CJN A;  3ZMT A;  3DXJ F;  4UXN A;  2JQ7 A;  2JRT A;  2YUS A;  4ZYH A;  4V19 K;  3QAH A;  1FOX A;  4ZYG A;  1IN5 A;  5DDG A;  2R7R A;  1E3O C;  2K7L A;  3ZPL A;  3F6O A;  1WRJ A;  2KDO A;  5IY5 H;  3KP5 A;  2X6W A;  2X6O A;  2R5Y A;  2DJI A;  3OYG A;  5M5Y J;  3IAM 2;  2FBI A;  1LUJ B;  2LR8 A;  4RAZ A;  1UB9 A;  2DT7 B;  2XAS A;  4IHT A;  2B63 J;  2JUG A;  4ZH4 F;  1RET A;  3QOE A;  5DV5 A;  2X6X A;  4NC8 A;  1O7F A;  1ODD A;  3GFL A;  1D1C A;  2VOP A;  1SVM A;  4M9X A;  4U7B A;  3AAF A;  4GFB A;  2OPT A;  2M7B A;  2XRN A;  4I01 A;  3F21 A;  2PN6 A;  4AYB N;  3VPR A;  3HBL A;  3W6V A;  3AG4 H;  3BRO A;  2ZSI B;  3HRS A;  3RKX A;  1PUF B;  2V1D A;  1T8I A;  5FLM J;  2K9N A;  1MBF A;  3PUB A;  3A0B C;  1VQ7 I;  3WOD F;  1RR7 A;  2H94 A;  2J5O A;  3T5X A;  2YPR A;  4ASN A;  3H0D A;  4XON A;  2HKO A;  4PJJ A;  3FBN B;  3FM3 A;  3TMO A;  4LB6 B;  2DMP A;  2L4M A;  2XRL A;  3LA3 A;  4D7M A;  3BLY A;  1PYV A;  3TGN A;  3TO7 A;  4XOT A;  1IRX A;  4BHP A;  4EVI A;  5L3C A;  3DEW A;  1U6G A;  1VQN I;  1DP7 P;  3F22 A;  1B9N A;  1LFU P;  2O61 A;  2R7T A;  4LOC A;  5J40 A;  1K7A A;  3FBI B;  4HX7 A;  3GTP J;  1MKM A;  2QEN A;  2FNA A;  2PLY A;  3H5N A;  5KAF C;  2M4G A;  3OOU A;  1OYI A;  3FXM A;  4UV8 A;  3V4G A;  3CCQ I;  4ZYD A;  1YW8 A;  4A5M A;  5GPA A;  4XNF A;  4EJT A;  2HYJ A;  1SFK A;  1TTY A;  4G6D A;  4HNV A;  1IV8 A;  3GXO A;  5K5O A;  5EDN A;  3I71 A;  1ZRD A;  2P7C B;  2DT5 A;  5ILV A;  4HQM A;  3DFG A;  3CTA A;  3LQQ A;  4IX7 A;  2WWY A;  2LVS A;  2G7U A;  1I27 A;  4M9S A;  3SFZ A;  3OYA A;  2EV0 A;  3CLQ A;  3H35 A;  2OC6 A;  3RYR A;  5HDK A;  3NWS A;  3S93 A;  4D0P A;  1UMQ A;  3ULQ B;  1JKP C;  2LOO A;  1Q1V A;  2TCT A;  1ZR2 A;  1VQK I;  3HDD A;  3PNV A;  3DV8 A;  1ETO A;  2ZJP F;  1TW3 A;  4Y17 A;  1E3P A;  1YOV B;  2IRF G;  1BJZ A;  2Q1Z B;  3IH2 A;  1A5J A;  1MMG A;  4KIG A;  3OYN A;  5C44 J;  1YW9 A;  4C3H J;  1IJW C;  4UUS B;  4E7Z A;  3KYC B;  1O4X A;  3DU5 A;  3GTM J;  2XAF A;  3IH4 A;  1Z21 A;  1BC8 C;  1I6H J;  3JTG A;  1V55 H;  3A2K A;  1KQ0 A;  1QO0 D;  1X1A A;  2G7H A;  4EGY A;  2VKH A;  1S9H A;  3CLO A;  1IRZ A;  1P4X A;  3HG9 A;  2F6C A;  2V26 A;  2JA2 A;  2L01 A;  2D1H A;  2W7N A;  1A35 A;  2OUM A;  1Y0U A;  2XB5 A;  2M87 A;  4M3G A;  2JK3 A;  4Y33 A;  5FKM A;  1PDN C;  3KE2 A;  4EQQ A;  3QPS A;  2KIF A;  2O0Y A;  4U88 A;  1J0R A;  4G6Q A;  2CWE A;  1IO2 A;  3F8B A;  2WBM A;  3D0S A;  4L5J A;  2X9D A;  4N4N B;  1ETX A;  4EJU A;  2IS2 A;  2OQG A;  3TP0 A;  1UAA A;  3K6G A;  4V2G A;  4DZP A;  5J4V A;  4A3B J;  1N77 A;  2M30 A;  4GO1 A;  5E1W A;  5JLW A;  1P92 A;  4OAZ A;  4MEX F;  2K02 A;  4HYE A;  1P9Q C;  3BR2 A;  2XDV A;  2M0M A;  1Z3Y A;  2WB1 A;  4R1H A;  4IHY A;  3H5R A;  2DDA A;  5K7H A;  1W4M A;  3ZGK A;  1QVU A;  4RM3 A;  1HBX G;  4IEJ A;  1A6I A;  4MHG A;  3IKV A;  3RZO J;  1JI8 A;  3G3Z A;  5D5X B;  4AIH A;  4LGW A;  4B48 A;  2Z99 A;  2DXI A;  5LHI A;  3KCC A;  3MVP A;  2JPC A;  1R7J A;  1AHD P;  5BQT A;  2Y75 A;  1TWF J;  2MSY A;  1R1T A;  3WU2 C;  1E3H A;  5E3N A;  2VLA A;  1FOY A;  2FJ1 A;  4L9T A;  3E5X A;  2R7X A;  2O03 A;  1D5Y A;  4HST A;  3LSJ A;  2E19 A;  2HDD A;  3U21 A;  1XDS A;  3DP7 A;  1JGG A;  1ZQ3 P;  1U2W A;  3CCM I;  1LKX A;  3CJT B;  4HF1 A;  1WJC A;  4CZZ A;  4PGG A;  2RDP A;  1ERD A;  4BAY A;  2RV8 A;  4M3E A;  5CYV A;  1T2K A;  1WJB A;  3BJA A;  4V2F A;  5EGO A;  4L9V A;  3S3O A;  1ORK A;  3EYI A;  1TWH J;  1DGR M;  3OIP A;  3KLO A;  4UNO A;  3HTS B;  2DFH A;  4I6Z A;  4BEH B;  1MJB A;  4HF0 A;  1H9T A;  5JFR A;  2HZT A;  4LB5 A;  5CVV A;  2ZME B;  1GVD A;  3O8H A;  1Y56 A;  2KIU A;  3H9J A;  4E70 A;  1BC7 C;  1BOA A;  2MGQ A;  2PJR B;  2L2O A;  1QHH D;  1F5T A;  1XC5 A;  1V5E A;  5EEG A;  2K4J A;  3DEE A;  3HOU J;  1G3S A;  4Y15 A;  4RMN A;  4AD9 A;  2FOW A;  3OOP A;  5DM6 F;  4U0V A;  3VDX A;  5BNG A;  2EFN A;  2W48 A;  3FXK A;  3J80 Z;  4JOM A;  3LSK A;  3WTW C;  2ZJQ F;  3CJR B;  1TT5 B;  1B72 A;  2E2J J;  4Q4Z F;  4M6Y A;  1YJN I;  2LMD A;  4NC6 A;  2XF6 A;  5ICC A;  2XGD A;  3I58 A;  4WXD A;  4N9H A;  4U7D A;  4BY1 J;  1P4A A;  2VKD A;  5E8G A;  4MTE A;  1ZG3 A;  1S6L A;  4KIC A;  2K9L A;  2X4H A;  3PFY A;  5LLQ A;  1FPQ A;  1WVR A;  3IC7 A;  3OYI A;  3FXQ A;  3W3C A;  1MBH A;  2DMU A;  2FNP A;  3JRA A;  5FD5 A;  1TLH B;  2KPM A;  5B1B H;  2NOJ B;  3OL4 A;  3ECH A;  3GCM A;  1MSF C;  5J6X A;  3D5S C;  5FGM A;  2DPU A;  1X4O A;  1DGW Y;  3EPZ A;  2KZG A;  3Q9S A;  2LY1 A;  1FEX A;  1ITY A;  2V1X A;  2P81 A;  2GOM A;  2GWR A;  4PSW A;  2EBI A;  2ZCW A;  1MZB A;  4E7K A;  4A2U A;  3FHN A;  3DKX A;  3U1K A;  3I59 A;  4HPQ A;  4KMU X;  1ZAO A;  4CGZ A;  5ERI A;  4LIV A;  4DZJ A;  2XRO A;  1ZHF A;  5LGN A;  1FOK A;  1I6X A;  1G3W A;  2RC4 A;  4KDP A;  2VXZ A;  3PO3 J;  4FCY A;  3HRT A;  1GHC A;  4ESJ A;  1EJ9 A;  3MEX A;  2DAO A;  5HOD A;  1B6A A;  3GLX A;  1B8I B;  1HCR A;  2F5D A;  4IF4 A;  3TQN A;  1IF1 A;  1FSE A;  4MFE A;  2CH0 A;  1HF0 A;  4F3Q A;  2YS9 A;  4B4C A;  3CC7 I;  1UHM A;  2STW A;  3G1M A;  2ELH A;  2CV0 A;  3QU3 A;  4B43 A;  3ABL H;  1YIT I;  3J81 Z;  4YII A;  4XLE A;  2FQ3 A;  5KCM A;  1J75 A;  5EJC A;  3A01 A;  3QRF F;  5EG0 B;  2X48 A;  3KFW X;  2R7V A;  4BE1 A;  1P7I A;  2A69 F;  2EZK A;  1VQ6 I;  2HZD A;  2EFP A;  2BXY A;  2A05 A;  2MC4 A;  9ANT A;  1CGP A;  5JVG F;  4HEA 2;  3ASN H;  3DKY A;  1WJA A;  2DFF A;  5FFZ A;  4A3E J;  2OZU A;  3HRM A;  4G7Z F;  3WHC A;  1QZE A;  2ZME C;  1U8B A;  4CCN A;  3ELK A;  4FET A;  1SD5 A;  1TT0 A;  2E34 A;  2BVL A;  3QOD A;  1FMW A;  2ISY A;  1YQA A;  3QP5 A;  2X0L A;  1JHH A;  5IT3 A;  2STT A;  1TWG J;  4I0B A;  1D0X A;  1RKW A;  2KIQ A;  1N78 A;  1YX3 A;  3O3K A;  2E60 A;  2VE9 A;  3CCS I;  3SJM A;  2D2W A;  2IVM A;  5E8I A;  3E5Q A;  2HS5 A;  4UY8 I;  4XID A;  1QNT A;  5CQG A;  3RI4 A;  1T0F A;  5F08 A;  1ZEL A;  3W6J B;  2VKV A;  2ZJ2 A;  3P9I A;  3GTL J;  6PAX A;  2EB7 A;  4UUV A;  4KIB A;  2ZC2 A;  2WTE A;  3B73 A;  2LTP A;  1YRN A;  2ID6 A;  2M4K A;  1VQ8 I;  5DM7 F;  3SXY A;  3K2A A;  4BXF A;  3WE2 A;  5FKO A;  2CRG A;  1R5I D;  2P0W A;  4TV7 A;  1MDM B;  1UG2 A;  1QRY A;  3F8F A;  1SAN A;  2K9Q A;  1I1G A;  4X0G A;  3JCU C;  3PJR A;  2MLG A;  3JRF A;  3GEZ A;  1LE8 B;  4A3I J;  4L0Z B;  2MW8 A;  4JX6 A;  3ZQ7 A;  1D1B A;  1FP2 A;  1X1B A;  3QQA A;  2L4A A;  4KNY A;  2CSO A;  4KUM A;  5JI6 A;  5E20 A;  2PEX A;  4ZYE A;  2GXA A;  4KMF A;  3U1D A;  2LKS A;  4BBR J;  3MFK A;  4E7H A;  2Q2E A;  2KL4 A;  2ESH A;  3DPT A;  2ZNY A;  4R79 A;  2ADU A;  1J9I A;  4XLF A;  3LMM A;  2M3A A;  3ISP A;  2AO9 A;  4NQW B;  4QTR A;  2VT2 A;  2Y48 A;  3CME I;  4Y7N J;  3K70 C;  2PBI A;  1FBU A;  1MIJ A;  2DOE A;  1AKH B;  1BR2 A;  1R71 A;  4BJT A;  1D8K A;  1PVE A;  2HOE A;  2CO5 A;  3HUG B;  3OS0 A;  4AVP A;  2NOG A;  2LF7 A;  4YFN F;  1ZTR A;  2LLK A;  1HST A;  3ABM H;  3ROU A;  5JHU A;  3WTS C;  1OR7 A;  4OIR F;  2LH9 A;  3E6B A;  1XX5 A;  1OJL A;  2IAI A;  4ANJ A;  3OV8 A;  2V79 A;  2FSW A;  2H6B A;  3P9K A;  2V9P A;  3V7S A;  2Y30 A;  3GYH X;  2JVG A;  1PUF A;  2DOF A;  3GZ6 A;  1Z9C A;  3CMY A;  2D5V A;  3WGI A;  1TW2 A;  1D0Y A;  5CPR B;  2BYV E;  3FMQ A;  1YI2 I;  2DYS H;  2K5C A;  3C3W A;  3K70 D;  3S14 J;  1DDN A;  5ED4 A;  5HOO A;  3TDZ C;  1CQT A;  3ZQC A;  3S1M J;  1A6Q A;  3ERE D;  1HKQ A;  2P5V A;  2Z16 A;  3WE3 A;  3KPH A;  4J00 A;  2IJL A;  3BR5 A;  4XL9 A;  5F27 A;  4F91 B;  3OYK A;  3CO6 C;  1W36 D;  2CGP A;  4HLX A;  1FY7 A;  2E5N A;  1FNN A;  3UR3 C;  4I0A A;  3TO6 A;  1B59 A;  3E0J B;  2ZXI A;  4E7S A;  3LNQ A;  1IGN A;  2CV2 A;  4W1U A;  4IQJ A;  3GTJ J;  2G0E A;  2UUZ A;  5AIQ A;  3BG7 A;  4RA2 A;  5IP6 A;  4BAC A;  2Q0O A;  3FM5 A;  1JJ6 C;  3SDB A;  2GQQ A;  2FXA A;  1OQY A;  1R9T J;  1S29 A;  1F1Z A;  4NHJ A;  5LD2 C;  2W85 A;  2AS5 F;  2DN0 A;  2QEX I;  3CCE I;  3HOV J;  1MW7 A;  2ESN A;  2TDX A;  3OS2 A;  2BZT A;  3L09 A;  3P5J A;  2NVX J;  3CUQ A;  2CU7 A;  4IRH A;  5J8C A;  3CQZ J;  2M0C A;  4NDL A;  1SMT A;  3TED A;  4BE0 A;  4ZDP A;  2R5Z A;  1X1C A;  3J80 K;  2OD5 A;  1VQ5 I;  2COM A;  2CS3 A;  4ENJ A;  2DQL A;  1F4K A;  1X3W B;  1L0O C;  3A4C A;  2X6Y A;  2NYX A;  2IA1 A;  4D5F A;  2MYS A;  2VL8 A;  4G7O F;  1Z1D A;  3HOZ J;  3ESW B;  4EM0 B;  2UXN A;  4BH9 A;  2OZ6 A;  1EA3 A;  3TW6 A;  1HQC A;  5GAG J;  4D9J A;  1QU3 A;  1X2M A;  1FC3 A;  2JA6 J;  2GBY A;  4CCJ A;  5EZH A;  5KNL A;  3FK6 A;  4DQ2 A;  4FHT A;  5BPI A;  3B6A A;  2WAE A;  2DO7 A;  1J2X A;  5HNH A;  1IC8 A;  1ULY A;  3B6C A;  1JGS A;  1ENH A;  3R61 A;  4IRG A;  3UKG A;  1LEB A;  2EIM H;  3JW4 A;  1R5H A;  2E36 A;  5IT9 K;  1ACI A;  2A6E F;  3IAS 2;  1OYY A;  1MGT A;  4OIQ F;  2V7F A;  2VON A;  4DBR A;  3GTK J;  4GXO A;  1XGM A;  4MLO A;  2FF4 A;  4CA0 A;  2R7F A;  4EJW A;  2A61 A;  2ZXH A;  1W0U A;  2JA5 J;  2VQC A;  3LAP A;  3CDH A;  3GWZ A;  4CDG A;  4BDY A;  3ABU A;  1EKE A;  2WY7 Q;  3L00 A;  3DBL B;  1P7J A;  5FKL A;  4DW6 A;  2HOA A;  3K4J A;  2A5Y B;  3BR3 A;  1S5L C;  2CMP A;  4X1E A;  3HOT A;  2ZNZ A;  2M45 A;  2XAG A;  2DA5 A;  4Y13 A;  3W2W A;  4EGZ A;  2L7K A;  3CCY A;  2DLL A;  1Y0N A;  2KRF A;  4A69 C;  4EEF G;  3J7A Y;  4RB2 C;  4B3X A;  1XMK A;  1IUY A;  3BJ6 A;  4W97 A;  2Y9Z A;  4BQA A;  1FMV A;  3ZN0 A;  4HQE A;  3K4M A;  4II2 A;  3K1M A;  2GM4 A;  1OCO H;  1OLT A;  4RBO A;  1A04 A;  3LFK A;  2GZW A;  2XGE A;  1BI3 A;  5CJ9 A;  3RQ4 A;  2LYC A;  4YIR X;  3ZQG A;  2K27 A;  2XPW A;  3KZI C;  4KT5 C;  1IXC A;  5HNF A;  4AIJ A;  2NVQ J;  5B66 C;  5ICF A;  2XGC A;  4HX8 A;  3JTH A;  1FIA A;  2A3S A;  2H27 A;  1OCT C;  5FLX Z;  2QQ9 A;  2IEK A;  2JJ7 A;  4H4K C;  1S7O A;  3Q9V A;  2WAQ A;  2EIN H;  1W7P D;  4M9Z A;  3E6C C;  3MKZ A;  2ID3 A;  3E1S A;  5DYM A;  1XCV A;  2QGU A;  3BPV A;  4EMS A;  5KHD A;  1MD0 A;  3QPT A;  2GXB A;  4XLN F;  4CXF A;  4N4O B;  3JRC A;  3J7Y J;  1IG7 A;  4XSZ F;  3H9G A;  4O6J A;  3HTU A;  3ZMV A;  3BQY A;  2XIG A;  1K6O A;  5LEJ A;  1ZRC A;  4HAM A;  1FP1 D;  1P4W A;  3MN2 A;  1RPW A;  4B3A A;  1FX7 A;  5K1Y A;  2LKX A;  1YTY A;  2PMU A;  4MO7 A;  3V7R A;  1ZR4 A;  2CV1 A;  3BG6 A;  4LFU A;  5K7Z A;  4BXX J;  2R5Z B;  1IV6 A;  2OCC H;  3RTR A;  3S15 J;  3PO2 J;  3Q0W A;  3JRI A;  2HWV A;  4HDU A;  2QZ8 A;  4XKC A;  4NUB A;  5HLI A;  2JA8 J;  4WK8 F;  5E3M A;  4L0Y B;  2VQG A;  2HYG D;  4NNJ A;  1D3Y A;  4KN4 X;  2FEZ A;  2B7E A;  3DWL E;  2RNJ A;  3HKZ N;  3CES A;  4GYG A;  1T56 A;  1NHA A;  3OYM A;  3AG3 H;  3WTT C;  1WH7 A;  2CQK A;  3HOW J;  4XRM A;  1WWX A;  2W1O A;  2LK2 A;  3N05 A;  3GFM A;  5DCM B;  1ETQ A;  3CCL I;  2K3F A;  3JSP A;  1YJW I;  5H6Q A;  2DMQ A;  3WHB A;  4AUX A;  4JX4 A;  4RB3 C;  1XPX A;  2NNN A;  1LFB A;  2HYF A;  3KEY A;  4G6T B;  4KYW A;  1KZH A;  4XMY A;  2FA5 A;  3LFU A;  3LA7 A;  4GYI A;  5FKK A;  2RRE A;  5L3F A;  4A3M J;  4OAY A;  2F4M B;  4NBQ A;  3BTI A;  3VWB A;  4JK1 X;  2LFB A;  1UG0 A;  2EQR A;  4C2U A;  2JA7 J;  1XGS A;  3NRV A;  3BZ6 A;  3JR9 A;  1WSU A;  4PGH A;  4CCK A;  1W7P B;  1R23 A;  2E1C A;  5E17 F;  3PM1 A;  2IS4 A;  2F5C A;  1LVA A;  5DTD A;  3LWF A;  3DQV C;  4FE4 A;  1MSE C;  1BA5 A;  2HQ5 A;  2BW3 B;  4P1W A;  4P9F A;  1V5G A;  4UV9 A;  2DTR A;  1KQ8 A;  5BS6 A;  3H9Q A;  5H2F C;  1FLI A;  4A3C J;  5IP9 J;  1T08 B;  1YYV A;  2DMT A;  3F9K A;  4PFP A;  3HSR A;  2WB1 N;  4BHB A;  1ETV A;  4S0H B;  3K2Z A;  4N0B A;  3EUH A;  1MBJ A;  1DQU A;  2TRT A;  3S8P A;  2VXD A;  1YO5 C;  1SVO A;  2P6T A;  3AG1 H;  5FRM A;  3A1Y A;  2CQX A;  1WHU A;  4EM1 A;  2ISZ A;  1XGO A;  4I2O A;  1IXS B;  2H8W A;  5TIS C;  3D5R C;  3S2D J;  1R00 A;  2W57 A;  2XAQ A;  4FE7 A;  3M8E A;  1R1V A;  3CJQ B;  4XN3 A;  1YJ9 I;  4WCG A;  1OIS A;  2QKL B;  3F8N A;  3GX4 X;  3K1P A;  4EV0 A;  2PI0 A;  3M1E A;  3CC4 I;  2YX4 A;  2HEO A;  1G2H A;  2VN2 A;  1W5C C;  4P96 A;  5H20 A;  4BJ5 C;  1IW7 F;  1UZC A;  2NS0 A;  1IRG A;  3I4N J;  2RKH A;  4OU0 A;  3V8J A;  5LHG A;  2XAU A;  5HVQ C;  1X3U A;  4BDZ A;  1BIA A;  3E5U A;  3FMR A;  3Q5F A;  1TP4 A;  2DFI A;  3BDD A;  2E7X A;  3S3M A;  3CDL A;  3ZQQ A;  1T39 A;  3BG9 A;  2CUJ A;  1J5Y A;  2HPI A;  3R6S A;  4DYQ A;  2ELK A;  1DPU A;  4RDU A;  2LSO A;  1N75 A;  3I3L A;  4HW0 A;  2Y0S N;  4L9N A;  1UHW A;  2WV0 A;  2VJI A;  3JRE A;  4HDV A;  2DPD A;  4KFC A;  1XDU A;  3N97 A;  2V9K A;  1QHG A;  2KRH A;  1BR4 A;  4E4H A;  4FX4 A;  4AU7 A;  2L54 A;  2PFB A;  1KU2 A;  2LBF A;  2Y69 H;  1SAX A;  4IZZ A;  3HZJ A;  5FLX K;  5EEH A;  3TO9 A;  3G1O A;  3MMY B;  4PCQ A;  4D5C A;  5LGU A;  3J7Z I;  4M74 A;  3SDG A;  2CJJ A;  4A6E A;  2W25 A;  2XVC A;  2XKP A;  4BQO A;  1WCM J;  3SZP A;  2AXT C;  1VND A;  3U9G A;  1TQP A;  1BR1 A;  3K0L A;  4HF2 A;  2HVR A;  3IH3 A;  4B09 A;  4M71 A;  3ZRG A;  1TWC J;  1CF7 A;  4CO8 A;  3L9F A;  1OCC H;  4YFK F;  2EIK H;  2NRA C;  4LJZ F;  5FRN A;  3MZ8 A;  2E7W A;  4LLG F;  4RGR A;  2XKO A;  4Q48 A;  1XSV A;  2L7Z A;  4RB1 A;  5EGO B;  1G59 A;  1SVL A;  4ENK A;  3C2G A;  2Y0S A;  2M1B A;  1TL8 A;  3GBG A;  5FLV A;  2VI6 A;  3MWM A;  3I9V 2;  1H9G A;  3W2A A;  1FTT A;  3L7W A;  3H5A A;  2HTS A;  5TGT A;  2LG4 A;  4UHT A;  3JRG A;  5LHH A;  2AXL A;  2K40 A;  3FDY A;  2NVU B;  1NTC A;  2HI3 A;  5IP7 J;  3AFH A;  1X4P A;  5M3M J;  2XAJ A;  1FBQ A;  1K79 A;  1O57 A;  1IDY A;  3GFI A;  2BW3 A;  3HB9 A;  4XKB A;  2IGK A;  1IN6 A;  3CUO A;  3TDU C;  5JHF A;  3FWE A;  2PJP A;  2BXZ A;  3ERM A;  3JAM K;  2FMY A;  4XIC A;  2WC2 A;  2V1N A;  4S05 A;  1FSH A;  2XC7 A;  4A3D J;  2QQ8 A;  3RYP A;  3D1N I;  4J19 A;  1KU7 A;  2A5W A;  1UFM A;  4M73 A;  5D6F A;  4XM3 A;  1LEA A;  1P6R A;  1K61 A;  4LD5 A;  2ZSH B;  3FKJ A;  2DK5 A;  2M7A A;  1BOB A;  5F0C A;  4P5O A;  5GAH J;  2KIS A;  3LST A;  2O6G E;  4HRI A;  1YS7 A;  1MNM C;  1HA8 A;  2JVH A;  4CCO A;  2R5Y B;  2IS6 A;  2R93 J;  5IOY A;  4GDF A;  4D1Q A;  2VPL A;  1RZ4 A;  4I02 A;  1M1E B;  2DYR H;  4ZTJ A;  4ON0 A;  4BYY A;  4YIF A;  4ENN A;  1MND A;  5CVJ A;  1VQO I;  4R8H A;  5M5W J;  5HDG A;  3H36 A;  4KA4 A;  4A0Z A;  1UST A;  2BEO A;  2XSJ C;  3T1B A;  3TP3 A;  2ZB9 A;  1Q1H A;  3KP4 A;  2JUC A;  3HRU A;  1VFC A;  4PSX A;  3VYR B;  5HS7 A;  4RAY A;  4ZZD A;  4AM3 A;  2AHQ A;  3VOD A;  2RGV A;  2VC0 A;  5EEA A;  3L2V A;  4FQG A;  4I7H A;  3FIS A;  2DFE A;  4LG0 A;  5F1R A;  3LSR A;  1LB2 A;  4OIO F;  3KEQ A;  1SFU A;  3SYT A;  1V5F A;  1UJ8 A;  1S7A A;  3DF8 A;  2VKE A;  2K9S A;  2DK8 A;  4AID A;  1LDJ A;  2R0Q C;  2NVT J;  3RZD J;  2EPF A;  5F0F A;  2UXX A;  4IO9 F;  2LBF B;  2O8K A;  3LQR A;  4ZDL A;  3EET A;  4RM2 A;  3WGG A;  4HZF A;  2PG4 A;  2XF5 A;  3GZN B;  2J5P A;  4MIM A;  1BI0 A;  2Y31 A;  1A36 A;  2CQQ A;  2ZXJ A;  3FXU A;  4XRS A;  2OTL I;  5AIP A;  4DOZ A;  1RRJ A;  1FYL A;  3L2C A;  3K4C A;  3OYF A;  2L9V A;  4M6V A;  4P55 A;  2FQ4 A;  4UVA A;  4BXU A;  5C4J J;  1V4R A;  2LDU A;  3VB2 A;  2MFZ A;  2CQN A;  3QYE A;  2I5U A;  3V8K A;  3O6B B;  3M8F A;  1ZGA A;  4RS8 A;  4DJA A;  3COA C;  5D5U B;  5F0H A;  3ABK H;  4WWC A;  2D45 A;  3BR0 A;  1BJA A;  1R5G A;  5B3S H;  2EA2 A;  1FOW A;  1TNT A;  3REO A;  2GAU A;  2QQA A;  3KYL A;  1OMI A;  1SC7 A;  1U3E M;  2VBZ A;  4ITV A;  2BHY A;  3RSN A;  3S17 J;  2KKO A;  3BG3 A;  3DLA A;  3QPL A;  4I09 A;  2BY3 A;  4XKV A;  4XOP A;  3K4L A;  4IPA A;  4CH7 A;  3QWL A;  5J8F A;  3H3V K;  1OPC A;  1WJE A;  2OA4 A;  2Y0M A;  5C4X J;  3BTL A;  3BR1 A;  3X2Q H;  4U87 A;  3K10 A;  2ECC A;  2OBP A;  1POG A;  1SD7 A;  2ZBK A;  1WJF A;  3TOA A;  5HLT A;  2IW5 A;  4HG2 A;  4BGD A;  2L7F P;  4NC7 A;  4OOI A;  1P2F A;  3ZMU A;  4A6D A;  2QSF X;  5JVT A;  2EIL H;  4Y4R A;  5D5W B;  3IKT A;  5TRD A;  3T8R A;  4B8X A;  1R58 A;  4HX4 A;  1JUS A;  3RKY A;  1UCR A;  4XOR A;  3GLL A;  3VSK A;  3HKZ A;  2CQ7 A;  3VEP A;  1NK2 P;  4U0W A;  3RPU D;  5DUK A;  5CQE A;  2PX9 A;  5C3E J;  2HXO A;  2FRH A;  1BI1 A;  1Z77 A;  1BI2 A;  2MLK A;  3L2U A;  1K78 A;  2DA1 A;  4PK4 A;  3LSG A;  2WAQ N;  1YW7 A;  3DPL C;  4XLH A;  2FD5 A;  2KIM A;  1BL0 A;  2IXS A;  2RN7 A;  3FX3 A;  4S04 A;  1ZYR F;  1I3Q J;  2FU4 A;  3MKW B;  2H1K A;  1W5S A;  1R6R A;  1QA6 A;  2RQQ A;  4I98 B;  4DNC A;  2M8G X;  4YEJ A;  5CKT A;  3FHZ A;  3KIO A;  3KP2 A;  4GCV A;  4BJ6 C;  1I1S A;  1HKT A;  3RJP A;  2B0L A;  2P8T A;  1XCB A;  4IOC F;  2DCE A;  1ZG5 A;  4Z2Y A;  5D4S A;  2I8D A;  3CP8 A;  3FXJ A;  1KU9 A;  3CF2 A;  3S2W A;  3RQI A;  1JKR C;  4PDK A;  1MBG A;  5D5V B;  1DUX C;  4N9I A;  3BR6 A;  4BS9 A;  4ESF A;  2IS1 A;  4LLN A;  1J09 A;  1E2X A;  3WTV C;  2JT1 A;  3I56 I;  2LKP A;  5DD8 A;  2Z2S B;  4CSW A;  3ML6 A;  4A3L J;  5HS8 A;  1JXS A;  2HQA A;  2M9H A;  3OSG A;  3HEF A;  1Z0X A;  2L9R A;  3W6K B;  2EFO A;  4G94 A;  1B9M A;  2K4B A;  4B1R A;  1VZ0 A;  3MZY A;  2IPQ X;  2QVO A;  3G4S I;  2A6H F;  2CFO A;  2DJN A;  2R92 J;  5J1Y A;  2BHZ A;  4A3K J;  1MJ9 A;  1R22 A;  2R7Z J;  3RPQ A;  4WX9 A;  2F5F A;  1X19 A;  2MC3 A;  1RUO A;  1Z6R A;  4JBA A;  5F04 A;  3F6V A;  2CUF A;  1BM9 A;  1FBS A;  2P5L C;  4ZC3 A;  4DBQ A;  2PJR A;  1O3R A;  3NAU A;  2NAZ A;  2YSR A;  2VQL A;  1O3T A;  2EFQ A;  3LOC A;  3AL0 B;  3HOS A;  1U9N A;  3FXR A;  1LJ9 A;  2DT6 A;  3WG7 H;  3HHG A;  2HQN A;  3JSO A;  1EH8 A;  3QOP A;  2XPU A;  3ZOB A;  3M9A A;  1HW5 A;  2VBY A;  1SFO J;  1QGP A;  2JPB A;  3ZCO A;  3IP4 B;  2HDW A;  2Z9O A;  3QP6 A;  5E18 F;  2DMN A;  3CUQ C;  3H3Z A;  5L3G A;  1QPI A;  2F2E A;  1L3L A;  1VQL I;  1G8X A;  1QZY A;  1PP8 F;  1YRN B;  2I10 A;  1JTX A;  3DU6 A;  3K4B A;  1I39 A;  1QPM A;  1QBJ A;  1ZG1 A;  2QLZ A;  5EF6 A;  3WG9 A;  2L3D A;  3CMM A;  4C2T A;  3LSM A;  3P7N A;  2W00 A;  3OMY A;  4JYK A;  3RCO A;  1AWC A;  3GO5 A;  3TKY A;  5FJ8 J;  4BE2 A;  2O9L A;  4KIT B;  1R49 A;  3WTX C;  2QSG X;  2MH9 A;  3PIP F;  1VQ4 I;  2W82 A;  3VYS B;  1RR8 C;  3LSP A;  3MZH A;  3BY6 A;  4AIK A;  3N4M A;  3HOY J;  3K4N A;  1OCP A;  1NK3 P;  2XAH A;  2A68 F;  4XK4 A;  3FIW A;  4XLC A;  2EA4 A;  4UUT A;  5AON A;  5FB2 A;  1FYK A;  3OIQ A;  4JQF A;  2Z1D A;  4OWR B;  4E7J A;  3QYF A;  5M5X J;  3OWT A;  1XN7 A;  1ZRF A;  4RLF A;  5HLH A;  2IP2 A;  2O3F A;  3KP6 A;  1H0M A;  5D8K B;  1EH7 A;  1HC8 A;  3F8M A;  3B02 A;  1OR7 C;  2FBK A;  3BWG A;  1H88 C;  1U5T B;  2W84 A;  3E6M A;  1R1U A;  4OIN F;  3OYD A;  5K5Q A;  1Y39 A;  5L3B A;  2MD5 A;  2KQR A;  1S72 I;  3ZMS A;  4EM2 A;  2DBB A;  4L9J A;  4IHX A;  2K3P A;  4BKX A;  2MD0 A;  4A5N A;  5CVR A;  4G12 A;  1YFH A;  1UHS A;  3PFI A;  3K4K A;  5F1J A;  3TW7 A;  1JE8 A;  3GTQ J;  3ZQI A;  1OYW A;  2XV4 S;  5EYR A;  3BJO A;  2FBH A;  4ZYA A;  2HVS A;  3L2Q A;  1XTA A;  4WF2 A;  2XB0 X;  2OAZ A;  5GAE J;  4C2M J;  2YU3 A;  1R36 A;  5GAD J;  3G1L A;  3RDI A;  5IT9 Z;  1J59 A;  2IGO A;  3PNY A;  1S8N A;  3BZK A;  4E7I A;  4PUS A;  2HVQ A;  3SQN A;  1XMX A;  4LK0 F;  4MQV A;  1MMA A;  1W0T A;  4KIF A;  3M1C A;  3SEZ A;  3KEO A;  2ETH A;  3HOX J;  3S1R J;  4G8X A;  1S3J A;  4LIT A;  4Y52 J;  3ZQL A;  3WGH A;  3PSF A;  2CYY A;  4FX0 A;  5KK1 A;  4LMY A;  1XSX A;  1T0F C;  2LF8 A;  3OYH A;  3TOB A;  2UZK A;  4O3M A;  5J1U A;  3BP8 A;  2EH3 A;  2Z5U A;  1K4T A;  2OQR A;  2YX7 A;  2EZH A;  4IL6 C;  1KA8 A;  5E1X A;  4E6K G;  5L3E A;  1I50 J;  1GDT A;  3BPX A;  3J81 K;  3GFJ A;  2E1M B;  1U8R A;  4C3J J;  5F64 A;  2ZXW H;  4KN7 X;  2G9W A;  3JRD A;  2ZFW A;  5GTH C;  3S32 A;  1KYZ A;  2CUZ A;  2DA7 A;  1AU7 A;  1LE8 A;  2ZME A;  1FT9 A;  1SFX A;  2M2E A;  1ON2 A;  2ELJ A;  3CO7 C;  3KP7 A;  3PIO F;  3I64 A;  2NS7 A;  2CUE A;  2JTV A;  3DCF A;  5DCM A;  2QSH X;  5DS9 A;  1Z3X A;  1H89 C;  1Z7U A;  3IRR A;  5J1R A;  2QYO A;  2R7D A;  3A03 A;  3EQL F;  3NAR A;  4M3D A;  3CCJ I;  2KLO A;  2CW7 A;  1U0J A;  4JP0 A;  2IA0 A;  1ZAR A;  3D5L A;  2H09 A;  2ZKZ A;  2QM3 A;  3KLN A;  2QA4 I;  4HNU A;  2VOD A;  1JJ8 C;  3IL2 A;  4HNT A;  2EV6 A;  1B72 B;  2ZFU A;  2GA2 A;  1DU0 A;  4JX5 A;  4XR6 A;  4RGS A;  1F43 A;  1AKH A;  3S3N A;  1LQ1 A;  1D1A A;  5CVU A;  2BY1 A;  1A31 A;  1IN7 A;  2X85 A;  4RGU A;  4M3B A;  1IAW A;  2K86 A;  3GTG J;  3DTI A;  3HC7 A;  1OCR H;  4XLA A;  4RLQ A;  4YFX F;  5LFA A;  1Z6T A;  2X51 A;  2R7U A;  4MTD A;  1ETY A;  1APL C; 
#chains in the Genus database with same CATH homology
 4PZJ A;  4G9Y A;  2GA1 A;  4CYD A;  1RIO H;  1XB4 A;  4BHC A;  4L18 B;  3HYI A;  4AWX B;  3QU6 A;  4XBF A;  2HTJ A;  1D8J A;  1E17 A;  5LEK A;  2VBW A;  3ECO A;  1FZP B;  3I59 B;  1T38 A;  3ZP5 A;  3K69 A;  2KJC A;  1XD7 A;  3O2P E;  3IRQ A;  4U0Y A;  5BMZ A;  4HOB A;  1SD4 A;  2YR2 A;  1USS A;  3C1D A;  3I5U A;  1G3Y A;  5FFX A;  2IT0 A;  1ZH5 A;  1AOY A;  1WQ2 A;  3E3V A;  5HDN A;  4FT8 A;  2DI3 A;  3ZMD A;  2QBY B;  5FO5 A;  2EFW A;  2LNB A;  3KP3 A;  3RKW A;  1T6S A;  2P6S A;  1MJA A;  3IWF A;  4G7H F;  4WXH A;  2FML A;  4XLP F;  5D8L B;  2GIV A;  1BIB A;  5ILU A;  3H3U A;  3VOE A;  2VC1 A;  2EWN A;  5DUI A;  4IRI A;  2L02 A;  1PP7 U;  1B1B A;  3PQK A;  5HLG A;  2FE3 A;  2KJB A;  3KET A;  1D5V A;  3J7A O;  1KGS A;  2DW4 A;  1K78 B;  3ZN1 A;  3T0Y A;  1U78 A;  2EK5 A;  2EJR A;  5ICG A;  4H0E A;  3BOQ A;  3GVA A;  1C0W A;  1SFE A;  1SD6 A;  4LLL A;  1HKS A;  2P5K A;  3MCZ A;  4F7Z A;  3R60 A;  4A0X A;  3JAM Z;  4NQW A;  2BV6 A;  5BOX A;  1YLF A;  2JSC A;  3C7J A;  3LAJ A;  4OMZ A;  4GGG A;  2HR3 A;  5HS9 A;  1ZLK A;  4ZZL A;  4BNC A;  5D4R A;  5A2Q K;  1IXR C;  1ZLJ A;  3DKW A;  4ESB A;  1IN4 A;  2NNY A;  2P4W A;  2V9V A;  1YIO A;  1ZN2 A;  3F72 A;  5KVR A;  2VE8 A;  5LBQ A;  3WU1 B;  1J7K A;  5E1Z B;  1T98 A;  3E6D A;  2QBY A;  3HSE A;  2CW0 F;  2XGX A;  1TQI A;  1Z05 A;  2MBF A;  1GVJ A;  1LNW A;  3WU0 A;  5K5R A;  2Z33 A;  1GXP A;  4UVB A;  3F23 A;  3I53 A;  2OU2 A;  2DQR A;  3H92 A;  1W5T A;  2ACJ A;  2M8E A;  3I4P A;  1IZ1 A;  3V7C A;  2VBX A;  4HV6 A;  1OKR A;  1O3Q A;  3FZV A;  1ONV A;  3G73 A;  2BBY A;  3F8C A;  5L3D A;  1ZRE A;  1EH6 A;  5TJJ A;  3HIF A;  2IA2 A;  3R0J A;  2P7V B;  5CLS A;  1XSD A;  3V8L A;  2Q8K A;  1RUN A;  1O3S A;  4HLY A;  4L5I A;  1F9N A;  2HQR A;  1STZ A;  4MQ9 F;  3WTY C;  3K1N A;  2W24 A;  1LDD A;  1QZZ A;  4EJO A;  2CG4 A;  1IRF A;  4ETS A;  2RQP A;  2M5W A;  5BPD A;  3EYY A;  1V3F A;  3IHU A;  3SHF A;  3R0A A;  4HBL A;  4UVC A;  3QPH A;  1KYW A;  4XRF A;  4OMY A;  2CFX A;  3HHH A;  5LGT A;  4IVN A;  2DU9 A;  5F6F A;  3C18 A;  3K9T A;  3F3X A;  3U2R A;  5DEQ A;  4LG0 B;  3HSF A;  2A07 F;  2UWM A;  4Q47 A;  2PMH A;  2GXG A;  1TNS A;  2E1N A;  4IJA A;  4IHS A;  2QWW A;  1HW2 A;  5CVI A;  1LDK B;  3E97 A;  4WXC A;  4A12 A;  5JR3 A;  2C6Y A;  1G3T A;  1JHF A;  4K2E A;  4XSX F;  1MDM A;  4RB0 A;  1I5Z A;  2F5E A;  2HFH A;  1HSJ A;  1RI7 A;  3GUD A;  1HW1 A;  3P9C A;  2HKX A;  3EDP A;  1EV7 A;  2HDC A;  2H6C A;  1WI9 A;  1BN5 A;  1XGN A;  2VT3 A;  3LA2 A;  4MNU A;  3KZY A;  5LRR A;  5FD6 A;  5A2Q Z;  3DEU A;  4A0Y A;  4QLC U;  2O8X A;  3HUG A;  2Z3Y A;  1U5T C;  2XUB A;  5ICE A;  3WTU C;  4IXA A;  4Q5S F;  5ILS A;  1B4A A;  1IN8 A;  2V1U A;  1G6N A;  1XMA A;  1WKM A;  2VOO A;  2HGC A;  2QQB A;  2BE5 F;  3MAJ A;  1SMY F;  1KQ9 A;  3NQO A;  4P9U A;  1G4D A;  3PQJ A;  1FYM A;  3R4K A;  4NB5 A;  3IWZ A;  2XHK A;  1REP C;  1U5T A;  1DPR A;  3ZMZ A;  1TBX A;  4MEY F;  5DCF A;  4OIP F;  5D6E A;  2V6C A;  3RPU A;  4O5V A;  3CUQ B;  3VFZ A;  1RNL A;  1YG2 A;  5LRS A;  2R3S A;  4MGR A;  3GW2 A;  3NEU A;  2MA3 A;  2MH2 A;  2QUF A;  1KU3 A;  3T8T A;  4CIC A;  1YS6 A;  4ENM A;  2JZY A;  3WTZ A;  4M6X A;  1PUE E;  2BGC A;  2PQ8 A;  1Z91 A;  5H6R A;  5DD4 A;  1O7L A;  3MQ0 A;  4HA8 A;  4CHU A;  1GXQ A;  4EJV A;  3GZ5 A;  2RVC A;  1QQI A;  2D1V A;  1ZGJ A;  4M72 A;  1CF7 B;  3SZT A;  1BBY A;  3KZZ A;  1W7P A;  3GF2 A;  3FMS A;  3M7G A;  2FOK A;  4HV5 A;  1ON1 A;  4LK1 F;  1HXD A;  3I0T A;  1FWZ A;  3ABT A;  3RIR A;  4YG2 F;  3I54 A;  1VTN C;  2ZO4 A;  2EV5 A;  4RGX A;  3FF5 A;  1TQM A;  4QWQ A;  3CJN A;  3ZMT A;  3DXJ F;  4UXN A;  2JRT A;  4ZYH A;  3QAH A;  4ZYG A;  1IN5 A;  5DDG A;  2K7L A;  3ZPL A;  3F6O A;  1WRJ A;  3KP5 A;  2FBI A;  4RAZ A;  1UB9 A;  2XAS A;  4IHT A;  4ZH4 F;  5DV5 A;  1O7F A;  1ODD A;  3GFL A;  2VOP A;  4U7B A;  4M9X A;  3AAF A;  2XRN A;  4I01 A;  3F21 A;  2PN6 A;  3BRO A;  3HRS A;  3RKX A;  2V1D A;  3WOD F;  2H94 A;  3T5X A;  2J5O A;  2YPR A;  4ASN A;  2HKO A;  3FM3 A;  4LB6 B;  2L4M A;  3LA3 A;  3TGN A;  3TO7 A;  4BHP A;  4EVI A;  5L3C A;  1U6G A;  1DP7 P;  3F22 A;  1B9N A;  2O61 A;  1K7A A;  4HX7 A;  1MKM A;  2QEN A;  2FNA A;  2PLY A;  1OYI A;  4UV8 A;  3V4G A;  4ZYD A;  1YW8 A;  4A5M A;  4EJT A;  1TTY A;  4G6D A;  3GXO A;  5K5O A;  3I71 A;  1ZRD A;  2P7C B;  2DT5 A;  5ILV A;  4HQM A;  3DFG A;  3CTA A;  3LQQ A;  2WWY A;  2G7U A;  1I27 A;  4M9S A;  3SFZ A;  2EV0 A;  3RYR A;  5HDK A;  4D0P A;  3ULQ B;  3DV8 A;  1TW3 A;  4Y17 A;  2IRF G;  4KIG A;  1YW9 A;  2XAF A;  1BC8 C;  3JTG A;  1KQ0 A;  1QO0 D;  2G7H A;  4EGY A;  3CLO A;  1P4X A;  2L01 A;  2D1H A;  1Y0U A;  2M87 A;  1PDN C;  3KE2 A;  4EQQ A;  2KIF A;  2O0Y A;  4U88 A;  1J0R A;  4G6Q A;  2CWE A;  3F8B A;  3D0S A;  4L5J A;  4EJU A;  2OQG A;  2M30 A;  4GO1 A;  5E1W A;  1P92 A;  4MEX F;  2K02 A;  4HYE A;  4R1H A;  1W4M A;  1HBX G;  4MHG A;  3IKV A;  3G3Z A;  5D5X B;  4AIH A;  4LGW A;  2Z99 A;  5LHI A;  3KCC A;  2JPC A;  1R7J A;  5BQT A;  2Y75 A;  1R1T A;  4L9T A;  3E5X A;  2O03 A;  1XDS A;  3DP7 A;  1U2W A;  4HF1 A;  4CZZ A;  4PGG A;  2RDP A;  4BAY A;  2RV8 A;  5CYV A;  1T2K A;  3BJA A;  4L9V A;  3EYI A;  3KLO A;  4UNO A;  3HTS B;  1MJB A;  4HF0 A;  1H9T A;  5JFR A;  2HZT A;  4LB5 A;  5CVV A;  2ZME B;  2KIU A;  4E70 A;  1BC7 C;  1BOA A;  1F5T A;  5EEG A;  2K4J A;  1G3S A;  4Y15 A;  4AD9 A;  3OOP A;  4U0V A;  2EFN A;  3J80 Z;  3WTW C;  4Q4Z F;  4M6Y A;  5ICC A;  3I58 A;  4WXD A;  4U7D A;  4N9H A;  1P4A A;  5E8G A;  4MTE A;  1ZG3 A;  1S6L A;  4KIC A;  2X4H A;  5LLQ A;  1FPQ A;  3IC7 A;  3FXQ A;  2FNP A;  5FD5 A;  1TLH B;  3ECH A;  5J6X A;  2DPU A;  5FGM A;  3Q9S A;  2V1X A;  2GWR A;  2ZCW A;  1MZB A;  4A2U A;  3I59 A;  4KMU X;  1ZAO A;  4CGZ A;  5ERI A;  2XRO A;  1ZHF A;  5LGN A;  1FOK A;  1I6X A;  1G3W A;  2RC4 A;  4KDP A;  2VXZ A;  3HRT A;  1GHC A;  4ESJ A;  3MEX A;  2DAO A;  1B6A A;  3GLX A;  2F5D A;  4IF4 A;  3TQN A;  1IF1 A;  1FSE A;  1UHM A;  2STW A;  2ELH A;  3QU3 A;  3J81 Z;  4YII A;  2FQ3 A;  1J75 A;  3QRF F;  3KFW X;  2A69 F;  2EFP A;  1CGP A;  5FFZ A;  2OZU A;  3HRM A;  4G7Z F;  3ELK A;  1SD5 A;  2ISY A;  1YQA A;  3QP5 A;  2X0L A;  1JHH A;  5IT3 A;  2STT A;  4I0B A;  3O3K A;  2VE9 A;  2D2W A;  2IVM A;  5E8I A;  3E5Q A;  2HS5 A;  1QNT A;  3RI4 A;  1T0F A;  3W6J B;  2ZJ2 A;  3P9I A;  6PAX A;  2EB7 A;  4UUV A;  4KIB A;  2WTE A;  3B73 A;  3SXY A;  3WE2 A;  4TV7 A;  1MDM B;  3F8F A;  1I1G A;  2MLG A;  3GEZ A;  4L0Z B;  3ZQ7 A;  1FP2 A;  2L4A A;  4KNY A;  2CSO A;  4KUM A;  5JI6 A;  5E20 A;  2PEX A;  4ZYE A;  4KMF A;  3U1D A;  3MFK A;  2Q2E A;  2ESH A;  3DPT A;  2ZNY A;  4R79 A;  2ADU A;  1J9I A;  3ISP A;  2VT2 A;  2Y48 A;  2PBI A;  1FBU A;  1D8K A;  2HOE A;  2CO5 A;  4AVP A;  2LF7 A;  4YFN F;  5JHU A;  3ROU A;  1HST A;  3WTS C;  1OR7 A;  4OIR F;  3E6B A;  3OV8 A;  2V79 A;  2FSW A;  2H6B A;  3P9K A;  3V7S A;  3GYH X;  3GZ6 A;  1Z9C A;  3WGI A;  1TW2 A;  2BYV E;  3FMQ A;  3C3W A;  1DDN A;  5ED4 A;  5HOO A;  3TDZ C;  3ERE D;  1HKQ A;  2P5V A;  3WE3 A;  2IJL A;  3CO6 C;  2CGP A;  4HLX A;  1FY7 A;  1FNN A;  4I0A A;  3TO6 A;  1B59 A;  5AIQ A;  2Q0O A;  3FM5 A;  2GQQ A;  2FXA A;  1S29 A;  1F1Z A;  4NHJ A;  2W85 A;  2AS5 F;  2TDX A;  2ESN A;  3L09 A;  3CUQ A;  4IRH A;  5J8C A;  1SMT A;  3J80 K;  2OD5 A;  2COM A;  4ENJ A;  2DQL A;  1F4K A;  1L0O C;  2NYX A;  2IA1 A;  4G7O F;  1Z1D A;  4EM0 B;  2UXN A;  4BH9 A;  2OZ6 A;  1HQC A;  1FC3 A;  4DQ2 A;  4FHT A;  5BPI A;  2DO7 A;  1J2X A;  1ULY A;  3R61 A;  1JGS A;  4IRG A;  1LEB A;  3JW4 A;  1R5H A;  5IT9 K;  2A6E F;  1OYY A;  1MGT A;  4OIQ F;  2VON A;  4GXO A;  1XGM A;  2FF4 A;  2R7F A;  4EJW A;  2A61 A;  3LAP A;  3CDH A;  3GWZ A;  4CDG A;  3ABU A;  3L00 A;  2A5Y B;  3HOT A;  2ZNZ A;  2M45 A;  2XAG A;  4Y13 A;  4EGZ A;  2DLL A;  2KRF A;  4RB2 C;  1XMK A;  1IUY A;  3BJ6 A;  4BQA A;  3ZN0 A;  4HQE A;  3K1M A;  1A04 A;  3LFK A;  2GZW A;  1BI3 A;  5CJ9 A;  2K27 A;  4KT5 C;  1IXC A;  4AIJ A;  5ICF A;  4HX8 A;  3JTH A;  2A3S A;  2H27 A;  5FLX Z;  2QQ9 A;  1S7O A;  3Q9V A;  1W7P D;  4M9Z A;  3E6C C;  5DYM A;  4EMS A;  1XCV A;  3BPV A;  1MD0 A;  3QPT A;  2GXB A;  4XLN F;  4CXF A;  4XSZ F;  4O6J A;  3HTU A;  3ZMV A;  1K6O A;  2XIG A;  1ZRC A;  5LEJ A;  4HAM A;  1FP1 D;  1P4W A;  1YTY A;  5K1Y A;  1FX7 A;  2PMU A;  3V7R A;  4LFU A;  3RTR A;  2HWV A;  4HDU A;  2QZ8 A;  5HLI A;  4WK8 F;  4L0Y B;  2HYG D;  1D3Y A;  4KN4 X;  2FEZ A;  2RNJ A;  4GYG A;  1NHA A;  3WTT C;  2CQK A;  1WWX A;  3GFM A;  5DCM B;  3JSP A;  5H6Q A;  4RB3 C;  2NNN A;  2HYF A;  4KYW A;  2FA5 A;  3LA7 A;  4GYI A;  5L3F A;  4JK1 X;  1XGS A;  3NRV A;  3BZ6 A;  1WSU A;  4PGH A;  1W7P B;  1R23 A;  2E1C A;  5E17 F;  2F5C A;  1LVA A;  3LWF A;  3DQV C;  4P9F A;  4UV9 A;  1KQ8 A;  2DTR A;  5BS6 A;  1FLI A;  1YYV A;  3HSR A;  4BHB A;  3K2Z A;  4N0B A;  3EUH A;  1YO5 C;  2P6T A;  4EM1 A;  2ISZ A;  1XGO A;  4I2O A;  1IXS B;  1R00 A;  2W57 A;  2XAQ A;  3M8E A;  1R1V A;  4WCG A;  3GX4 X;  3F8N A;  2PI0 A;  3K1P A;  4EV0 A;  3M1E A;  2YX4 A;  2HEO A;  2VN2 A;  4P96 A;  5H20 A;  1IW7 F;  2NS0 A;  1IRG A;  2RKH A;  4OU0 A;  3V8J A;  5LHG A;  5HVQ C;  1X3U A;  1BIA A;  3E5U A;  3FMR A;  3Q5F A;  2DFI A;  3BDD A;  1T39 A;  2E7X A;  1J5Y A;  3R6S A;  1DPU A;  2LSO A;  4HW0 A;  4L9N A;  1UHW A;  2WV0 A;  4HDV A;  2DPD A;  4KFC A;  1XDU A;  3N97 A;  4FX4 A;  2L54 A;  2PFB A;  1KU2 A;  1SAX A;  5FLX K;  5EEH A;  3TO9 A;  5LGU A;  4PCQ A;  4M74 A;  4A6E A;  2W25 A;  2XVC A;  2XKP A;  3SZP A;  3U9G A;  1TQP A;  3K0L A;  4HF2 A;  4B09 A;  4M71 A;  1CF7 A;  4CO8 A;  3L9F A;  4YFK F;  2NRA C;  4LJZ F;  2E7W A;  4LLG F;  4RGR A;  2XKO A;  4Q48 A;  1XSV A;  4RB1 A;  4ENK A;  2M1B A;  3MWM A;  1H9G A;  3L7W A;  2HTS A;  4UHT A;  5LHH A;  2AXL A;  2XAJ A;  1FBQ A;  1K79 A;  1O57 A;  3GFI A;  1IN6 A;  3CUO A;  3TDU C;  2PJP A;  3FWE A;  3JAM K;  2FMY A;  2WC2 A;  4S05 A;  1FSH A;  3RYP A;  1KU7 A;  1UFM A;  4M73 A;  5D6F A;  1LEA A;  1P6R A;  4LD5 A;  2DK5 A;  4P5O A;  3LST A;  2O6G E;  1YS7 A;  1RZ4 A;  4I02 A;  4ON0 A;  4BYY A;  4YIF A;  4ENN A;  5CVJ A;  4R8H A;  5HDG A;  4KA4 A;  4A0Z A;  1UST A;  2BEO A;  3T1B A;  1Q1H A;  3KP4 A;  3HRU A;  5HS7 A;  4RAY A;  4ZZD A;  3VOD A;  2RGV A;  2VC0 A;  4I7H A;  4LG0 A;  5F1R A;  1LB2 A;  4OIO F;  3KEQ A;  1SFU A;  1S7A A;  3DF8 A;  2DK8 A;  1LDJ A;  2UXX A;  3LQR A;  3EET A;  3WGG A;  4HZF A;  2PG4 A;  2J5P A;  1BI0 A;  2ZXJ A;  3FXU A;  5AIP A;  1FYL A;  3L2C A;  4P55 A;  4UVA A;  4BXU A;  1V4R A;  2LDU A;  3VB2 A;  3V8K A;  3O6B B;  3M8F A;  1ZGA A;  4RS8 A;  3COA C;  5D5U B;  4WWC A;  2D45 A;  1BJA A;  1R5G A;  2EA2 A;  3REO A;  1TNT A;  2GAU A;  2QQA A;  1U3E M;  1OMI A;  2VBZ A;  2KKO A;  4I09 A;  4IPA A;  5J8F A;  1OPC A;  2OA4 A;  2Y0M A;  2OBP A;  1SD7 A;  2ZBK A;  3TOA A;  2IW5 A;  4OOI A;  1P2F A;  3ZMU A;  4A6D A;  5JVT A;  5D5W B;  3IKT A;  5TRD A;  3T8R A;  4B8X A;  1R58 A;  4HX4 A;  3RKY A;  1UCR A;  3VEP A;  4U0W A;  5DUK A;  2FRH A;  1BI1 A;  1BI2 A;  2MLK A;  1K78 A;  1YW7 A;  3DPL C;  2KIM A;  2RN7 A;  3FX3 A;  4S04 A;  1ZYR F;  2FU4 A;  1W5S A;  4I98 B;  4DNC A;  3FHZ A;  3KP2 A;  4GCV A;  1I1S A;  1HKT A;  3RJP A;  2B0L A;  2P8T A;  1XCB A;  1ZG5 A;  4Z2Y A;  5D4S A;  1KU9 A;  3S2W A;  4PDK A;  5D5V B;  1DUX C;  4N9I A;  4ESF A;  4LLN A;  1E2X A;  3WTV C;  2JT1 A;  2LKP A;  5DD8 A;  3ML6 A;  5HS8 A;  1JXS A;  3W6K B;  2EFO A;  4G94 A;  1B9M A;  2K4B A;  3MZY A;  2IPQ X;  2QVO A;  2A6H F;  1MJ9 A;  1R22 A;  3RPQ A;  4WX9 A;  2F5F A;  2MC3 A;  1RUO A;  1Z6R A;  4JBA A;  3F6V A;  1BM9 A;  1FBS A;  2P5L C;  1O3R A;  2NAZ A;  2YSR A;  1O3T A;  2EFQ A;  3HOS A;  3FXR A;  1LJ9 A;  3HHG A;  2HQN A;  3JSO A;  1EH8 A;  3QOP A;  3M9A A;  1HW5 A;  2VBY A;  1QGP A;  2JPB A;  2Z9O A;  3QP6 A;  5E18 F;  3CUQ C;  3H3Z A;  5L3G A;  2F2E A;  1L3L A;  1QZY A;  1PP8 F;  1QPM A;  1QBJ A;  1ZG1 A;  2QLZ A;  3WG9 A;  2L3D A;  3P7N A;  1AWC A;  3GO5 A;  3TKY A;  3WTX C;  2MH9 A;  3MZH A;  3BY6 A;  4AIK A;  3N4M A;  2XAH A;  2A68 F;  2EA4 A;  5AON A;  5FB2 A;  1FYK A;  4JQF A;  1XN7 A;  1ZRF A;  5HLH A;  2IP2 A;  2O3F A;  3KP6 A;  1H0M A;  5D8K B;  1EH7 A;  3F8M A;  3B02 A;  2FBK A;  3BWG A;  1U5T B;  2W84 A;  3E6M A;  1R1U A;  4OIN F;  5K5Q A;  5L3B A;  2MD5 A;  3ZMS A;  4EM2 A;  2DBB A;  4L9J A;  4A5N A;  5CVR A;  1YFH A;  3PFI A;  1JE8 A;  1OYW A;  2XV4 S;  3BJO A;  2FBH A;  4WF2 A;  2OAZ A;  2YU3 A;  1R36 A;  3RDI A;  5IT9 Z;  1J59 A;  1S8N A;  3SQN A;  4LK0 F;  4MQV A;  4KIF A;  3KEO A;  2ETH A;  4G8X A;  1S3J A;  3WGH A;  2CYY A;  4FX0 A;  5KK1 A;  4LMY A;  1XSX A;  2LF8 A;  2UZK A;  3TOB A;  4O3M A;  3BP8 A;  2Z5U A;  2OQR A;  2YX7 A;  1KA8 A;  5E1X A;  5L3E A;  3BPX A;  3J81 K;  3GFJ A;  1U8R A;  5F64 A;  4KN7 X;  2G9W A;  2ZFW A;  1KYZ A;  2ZME A;  1FT9 A;  1SFX A;  1ON2 A;  3CO7 C;  3KP7 A;  3I64 A;  2JTV A;  5DCM A;  1Z7U A;  3IRR A;  2QYO A;  2R7D A;  3EQL F;  2IA0 A;  1ZAR A;  2H09 A;  3D5L A;  2ZKZ A;  2QM3 A;  3KLN A;  2VOD A;  3IL2 A;  2EV6 A;  2GA2 A;  4RGS A;  1LQ1 A;  5CVU A;  1IN7 A;  4RGU A;  1IAW A;  2K86 A;  4YFX F;  1Z6T A;  4MTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...