4A3IJ

Rna polymerase ii binary complex with dna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3iJ00
2NS8A 2WV1A 1RPWA 1Z0XA 2HOAA 5C4JJ 4M6VA 4V2GA 2LP0A 2EZLA 3IH2A 2FD5A 3JRCA 2HQ5A 5IP6A 1MBEA 2LKXA 2JJ7A 1WPKA 4B1RA 4G12A 3Q0UA 3S17J 3HOZJ 4J19A 5K7HA 5M3MJ 3I4NJ 3ZOBA 2D5VA 2DA1A 4QIWN 1RETA 1VFCA 4A3LJ 3BTIA 1PUFA 1IGNA 3BR0A 4LOCA 5FLVA 1IRZA 3BG9A 2TCTA 3TW7A 1B8IA 2HI3A 2QF7A 1FEXA 1B72A 2N8GA 1OCPA 3HGGA 3LNQA 4RBOA 1SFOJ 2VI6A 3JRFA 1WGXA 3OSGA 1MNMC 1FIAA 5JLXA 1LE8B 5IOZA 1UHSA 2L7ZA 2LK2A 5FJ8J 1X2NA 1U9OA 1MH4A 1CQTA 1HDDC 4A3FJ 5FKOA 2Y2ZA 2R5YB 5GPAA 1MBFA 1LFBA 1H89C 5EG0B 1K83J 1TWCJ 4BXXJ 3HBLA 1QVTA 2M0CA 5HODA 4QTRA 1TWHJ 1ORKA 1HF0A 2CJJA 2IBDA 5IPAA 4BY1J 2L7FP 2VKVA 5F27A 2HXIA 3PO2J 3M4OJ 1JTYA 3GTPJ 1A5JA 1IC8A 2EBIA 2EZHA 4W1UA 5FKLA 4B3AA 3JRIA 1JTXA 5M5WJ 1JJ6C 3S1NJ 3SFIA 1SANA 1TWFJ 2ID3A 2LR8A 3D1NI 2NOGA 2KDZA 3HEFA 2HOSA 1Y1VJ 1ETOA 1FIPA 4DZJA 2DTZA 4D5CA 3HDDA 1RR7A 4A3JJ 4D7MA 4A3MJ 3OIOA 2HOTA 3GTMJ 2LFBA 2CUFA 3RKQA 2K9QA 2M8GX 5GP9A 1P7JA 2DA6A 4A3CJ 3M3YJ 2E1OA 4B4CA 4IEJA 1GDTA 2R92J 4FISA 3CMYA 1ETVA 4M3EA 3WHCA 4W97A 4EEFG 5M5XJ 4XRSA 1F36A 5C4XJ 1RESA 3GTLJ 3MN2A 3IH4A 3DEWA 3JRGA 4FE7A 4S0HB 1MH3A 2AHQA 2L7MP 2DMQA 1ZR2A 4A3DJ 2AO9A 4I76A 3MVPA 4XRSG 3ZQGA 3JREA 4X6AJ 1QVUA 2JK3A 1HLVA 2CRGA 1W0TA 3UKGA 3L1PA 2DMTA 1IG7A 2OF7A 2JA7J 1I3QJ 4M3FA 1HDPA 2M34A 2H1KA 4JP0A 2ECBA 1ETKA 1GV5A 5C44J 1MBKA 5DTDA 3ZQFA 1WI3A 5E3MA 1BW6A 5C3EJ 1LE8A 4BY7J 4IHVA 3BR6A 2HDDA 4MFEA 5J3LA 1POGA 2K9SA 5EEAA 5EGOB 4D7NA 2R5YA 2MG4A 1DU6A 3A01B 2W48A 2X48A 4CYCB 3G1OA 1APLC 2EH3A 3LOCA 3HOUJ 2DA5A 1T56A 1OFCX 2ECCA 4L5EA 1GV2A 2DJNA 3BR5A 2XRLA 2P81A 4FTHA 2Y31A 1ZQ3P 1R9TJ 1JKQC 2L0KA 4MIMA 1U9NA 3W6VA 1NK3P 1IV6A 1YRNB 3BR1A 2LTPA 5E3OA 2NVYJ 3GTKJ 5FKKA 3NAUA 4MLOA 1U8BA 3JR9A 4DYRA 2PMZN 1JUSA 1VNDA 2XGCA 4JX6A 1ZGWA 2FQ4A 3BTCA 1E3OC 2E19A 1BW5A 4DYQA 3HOWJ 4IHWA 2JA6J 3S2DJ 5IYBJ 3CDLA 3ZQIA 3LSRA 1NK2P 1JUMA 2EZKA 1H88C 4V2FA 1AU7A 3DCFA 4X1EA 2WB1N 1K61A 3FK7A 5IYCJ 2MGQA 3GBGA 3C2BA 1XG1A 5DS9A 5E3LA 2VUMJ 3S15J 1WCMJ 2DA7A 1ENHA 1AKHA 1I50J 5F1JA 1AHDP 4FCYA 1H8AC 3B6AA 3JRAA 3G1LA 3E7LA 4IHYA 3JRHA 5J1RA 2GLOA 1EF4A 2FX0A 3BR3A 3MKLA 4XICA 3OSFA 2VPRA 1WH7A 5F04A 2E2JJ 2EQRA 2HYJA 1GT0C 1ZK8A 2YS9A 3QPSA 5FKNA 4I6ZA 3BG3A 1T33A 2JA8J 1ETWA 3JRBA 1UMQA 2MW8A 2DN0A 5EZGA 1S7EA 1B8IB 4HNVA 1P7IA 4XK4A 3F0CA 2L9RA 3CQZJ 2I10A 2ZB9A 5EZHA 1TC3C 1XC5A 1IJWC 1LFUP 1ETQA 3NARA 1JT0A 3SDGA 4UUSB 2H8RA 1RKWA 4RDUA 4C2MJ 4CYCA 4DYCA 3FK6A 4XRMA 4DZPA 2JA5J 2NVTJ 4C3IJ 1HCRA 2Y0SN 1ZKGA 5J1YA 2LY9A 2XB5A 3K7AJ 3TP0A 5BNGA 2Y9ZA 2M2EA 1BL0A 4C3HJ 1HOMA 5GPCA 3BR2A 2R5ZB 1JGGA 3HOYJ 1JKOC 1ZR4A 5E3NA 5K7FA 2XPWA 2IAIA 2KT0A 1GVDA 3S1MJ 4M3BA 2K40A 3IH3A 1YRNA 3S1QJ 4MO7A 2Y30A 3BTLA 2ME0A 2DA3A 2ELKA 3GTQJ 1FTZA 1OJLA 4BBSJ 3HGYA 4XIDA 3O8GA 1NTCA 2ID6A 5IP7J 2VKEA 3FKIJ 3S14J 5JLWA 2NVQJ 1IUFA 4BKXA 3GTOJ 2G0EA 2HXOA 1X58A 3HM5A 5EG0A 2COBA 2X9DA 3H3VK 2JWTA 4DW6A 2TRTA 3LSJA 3Q0VA 3ZQLA 4D5FA 1W0UA 2QCOA 4A69C 1JJ8C 3I4MJ 3S1RJ 3SJMA 3CCYA 4M3DA 1Y1WJ 3QQAA 1JUPA 2O9LA 1D5YA 1WH5A 2GM4A 1O4XA 3HOXJ 2EZIA 1BJZA 3BTJA 3ZQHA 1QPIA 2O8KA 1Q1VA 2O7OA 4FE4A 2XGEA 3IV5A 1JKPC 4JX5A 5IP9J 4A3GJ 2RAEA 4ABZA 4BBRJ 2DA2A 2LD5A 3S2HJ 2MSYA 4NDLA 1VI0A 3Q0WA 4A3BJ 3OOUA 5IOYA 3RZDJ 3QPLA 5M3FJ 5EDNA 2OPTA 3Q3SA 1U78A 2R7ZJ 1Z77A 2YU9J 3B6CA 2XB0X 1XS9A 1IDZA 1ZTRA 4GFBA 2DA4A 1QRYA 4UUSA 2XPVA 5F0HA 3LSPA 2XPUA 3ZQCA 4A3EJ 2R93J 1I6HJ 3RQIA 4IHXA 3K2AA 2IEKA 5IYDJ 5EYRA 5F0FA 2CQQA 2YUSA 4UUTA 2R5ZA 1JKRC 3A02A 2LVSA 1PUFB 3HOVJ 5M5YJ 4C3JJ 1MBJA 1MSEC 3GTGJ 1GUUA 5J1UA 3LSGA 2XGDA 3G1MA 2E2IJ 1B72B 3PO3J 2E2HJ 4A3IJ 3BT9A 2JN6A 1ITYA 9ANTA 3HB9A 1MBHA 5FKMA 2DMUA 2CU7A 3TW6A 5EGOA 3S16J 3H0GJ 3A01A 1VF9A 1MBGA 1BA5A 1IDYA 4JX4A 2ME6A 3FIWA 5K7ZA 2NVXJ 5EF6A 1FTTA 5F08A 1DU0A 4M3GA 4A93J 2DMNA 3O8HA 3TEDA 3FISA 3A03A 2X6OA 4A3KJ 2GBYA 4AYBN 2CQXA 2XSDC 2JMWA 3BG5A 2NS7A 2LLKA 1AKHB 1F43A 5FLMJ 3BQYA 1FJLA 3PM1A 1TWAJ 3TP3A 1OCTC 3JRDA 1MSFC 1TWGJ 2FJ1A 2Y9YA 4JYKA 1A6IA 3VPRA 2CUEA 4AUXA 1G2HA 2R0QC 2B63J 1RKTA 4QSHA 4AC0A 3HKZN 3WHBA 1ETYA 2WAQN 4MFDA 3BQZA 4Y52J 2K9NA 5F0CA 2M9HA 4Y7NJ 1UG2A 3RZOJ 1JT6A 2DMPA 1ETXA 3GTJJ 1X2MA
chains in the Genus database with same CATH superfamily
4OMZA 2HYFA 2ZMEB 2W25A 3ONQA 2CSOA 3QP6A 4Y15A 5C4JJ 3CCEI 2DOEA 2FD5A 2Q8KA 3BCAA 1HKTA 4XMYA 2LKXA 3F21A 2IS6A 2L02A 1U5TA 2JJ7A 2CW8A 1WPKA 5DEQA 4KFCA 3Q0UA 3HOZJ 1YS7A 4O3MA 4AIDA 5M3MJ 2D5VA 2DA1A 4BHCA 1A31A 5F64A 3H1CA 4A3LJ 1PUFA 1OYWA 1T39A 3HYIA 5L3BA 3V8JA 1IRZA 2IGOA 3GLXA 2RREA 2HWVA 3I71A 4PUSA 2Z9OA 3TOBA 4KN7X 2IA2A 1VTNC 4UNOA 1FEXA 5E1WA 1B72A 4O5VA 3V8KA 4IRHA 3AFHA 1K6YA 3OSGA 2CO5A 1MNMC 1ZREA 1LE8B 2FE3A 3KEYA 2ESNA 3PIPF 3MFKA 3HTUA 1FYLA 5FJ8J 2RQPA 1X2NA 3P7NA 1U9OA 1MH4A 1CQTA 1HDDC 1VQ8I 5K1YA 3CD6I 2QEXI 4XBFA 4BE1A 2PLYA 5B66C 1VQ4I 1UHWA 5EG0B 2BGCA 5E1XA 5ED4A 2ZXJA 3F23A 5HS8A 1K83J 1TWCJ 1ZRFA 3HBLA 1QVTA 1NG6A 2M0CA 1R36A 3F6VA 3MWMA 1TWHJ 5HODA 4QTRA 1HF0A 2CJJA 4OMYA 2IBDA 1FC3A 1VQ5I 3ZCOA 2HXIA 2DOAA 3QYFA 4WXHA 4HRIA 4M9XA 2CH0A 3K0LA 1IC8A 5HS7A 2BY1A 1QHGA 1TT5B 2CMPA 2R4GA 1J0RA 3DPUA 3JRIA 3IWFA 3CESA 1N77A 3TMOA 2JUCA 3SFIA 1I6XA 3KPHA 2LR8A 1KQ9A 3ROUA 2NOGA 2KDZA 3SZPA 4BJ5C 2DI3A 4IKFA 1YIJI 1ETOA 4B3XA 1C0WA 3MKZA 1L0OC 2DTZA 2WA0A 3HDDA 4D7MA 2MA3A 2OC6A 3DP7A 3BP8A 3GZ6A 5DUIA 4A3MJ 5H6RA 3OIOA 4BUPA 2HOTA 3GTMJ 1PP8F 1OQYA 1KYWA 1BN5A 2E1MC 2MH2A 1P7JA 5HOOA 2E1OA 1T6SA 4ESFA 3JCUC 2PQ8A 4P9FA 1MMNA 3T0YA 3OWTA 2CW7A 1R1UA 4F91B 2BW3A 1F36A 4NHJA 5C4XJ 4Y3OA 2HEOA 2OZUA 3B73A 4XLAA 4MEXF 1DGWY 2AHQA 2HQNA 2A68F 2L7MP 2FXAA 2VXZA 1LVKA 4ENJA 2H6BA 2OZ6A 2W7NA 3MVPA 5J47A 3ZQGA 5KVRA 4IXAA 5DCFA 5DUKA 5F6FA 4RMNA 4XLFA 4X6AJ 4EV0A 3S32A 4KISA 1FOXA 2KRCA 3UKGA 5EJCA 1SMTA 2DMTA 1IG7A 3BZCA 1NG7A 4CO8A 2OF7A 2LY1A 2M7BA 5CVVA 5DM6F 1X1PA 2HPMA 4LMYA 5AIQA 4XKBA 2R7RA 3KCCA 3RPUD 4ON0A 2TDXA 4A5MA 1ONVA 3KETA 5BPDA 3E1SA 1MBKA 3VFZA 5DTDA 2Y48A 5E3MA 3TDZC 1S5LC 5C3EJ 1LQ1A 1YW7A 3L2WA 2LF7A 2LF8A 5IT9Z 1AWCA 3QRFF 3TQNA 3GUDA 2R5YA 4D7NA 3CC4I 4P55A 2JVHA 2MG4A 4I99C 3NQOA 5D8KB 3IC7A 5D6FA 3IL2A 4X0GA 3K4MA 2OU2A 1F1ZA 2Q2EB 2PX9A 3L2RA 3KEOA 5D6EA 2UXXA 3LOCA 4YFNF 3L2UA 3CMAI 3OYIA 2LH9A 3CCQI 4ZYEA 1UB9A 1OCRH 1GV2A 1LNWA 2DJNA 1JE8A 2XRLA 4RB0A 4L9VA 5HLGA 2JTVA 2QQ8A 3GMEA 1ZQ3P 1YS6A 1Y6IA 5CLSA 5HS9A 1R9TJ 1S72I 4MIMA 1HA8A 3W6VA 4Q47A 1YQAA 2WAEA 3NRVA 1P6RA 3WU1B 3REOA 2LTPA 5E20A 1YTYA 3GTKJ 3R6SA 4MLOA 2KMUA 2EFPA 4JX6A 2W4SA 1VNDA 3SEQA 3VSKA 3J7YJ 3BTCA 2MC4A 2FRHA 1YITI 1E3OC 3H5AA 3BWGA 2ADUA 2FA5A 4AIKA 4ZZDA 3PIOF 2Z1DA 3KEQA 1YG2A 2JA6J 2W84A 2O6GE 3CDLA 1XMAA 4XN3A 1YOVB 3SFZA 1NK2P 1JUMA 2HVQA 2Y0MA 4MGRA 4ZJZA 4HBLA 2VJIA 3CUQA 3DCFA 3WTZA 4LITA 1A36A 4G6QA 1X1AA 2MGQA 3GBGA 5IYCJ 2CV1A 2XF7A 3U1KA 1KA8A 5E3LA 3CCJI 3BZKA 1UELB 1WCMJ 2MLGA 3F22A 1ENHA 1I50J 2F5CA 3JRAA 4IHYA 4ITVA 3J81K 1D0ZA 3JRHA 1U5TB 3ZRGA 2WWYA 4B47A 1EF4A 3HUGA 3BR3A 3MKLA 3QOEA 4I7HA 5L3FA 2FNPA 1K78A 2VPRA 4U0WA 3WU0A 1MD0A 1Z21A 2XIGA 4WK8F 2E2JJ 1GT0C 1UCRA 2PMZA 1HKQA 2VC0A 1W5CC 3BG3A 2LNBA 1T33A 2MYSA 2ZXIA 1Z3YA 2HTJA 3V8LA 3VDXA 2RGVA 3HPGA 2HKXA 4WXCA 5LLQA 4ZYHA 3RKXA 2DK5A 2IJLA 1A6QA 2EJRA 2FU4A 5HDNA 3WTSC 1TNSA 4B09A 5EZHA 4K2EA 3WG7H 3ZN0A 5D5UB 5JHUA 1ETQA 3DV8A 2PI0A 1RKWA 4LGWA 4CYCA 4JOMA 3OIQA 4P1WA 4DYCA 5JI6A 1Z1DA 4C2TA 2NVTJ 3FBNB 5K5QA 2Y75A 1G3SA 1ON2A 4PJMA 3TP0A 2ZSHB 5GPCA 4CGZA 4BXUA 4YFKF 5E3NA 2JZYA 1DUXC 4XLNF 2F5FA 3RQ4A 2R7DA 2EB7A 3ZQ7A 4M3BA 1LUJB 2KRHA 3IH3A 5ERIA 2HR3A 2G7HA 2O3FA 4CCMA 3DKYA 3FMQA 1V55H 4B8XA 2DA3A 2X6YA 4BE0A 4G7OF 3MAJA 2XROA 3RPUA 3V42A 3QODA 2ID6A 2KIUA 1EA3A 2V9KA 3GTOJ 4N4NB 4EJUA 1Y39A 5BPIA 3DFGA 2OV7A 1IO2A 4S04A 4AU7A 1RR8C 2PJPA 3WTWC 4M72A 4B48A 1T0FC 2X9DA 2JWTA 1IN4A 4IQJA 4DW6A 4A0XA 4BNCA 3CCVI 2LRDA 3Q0VA 1W0UA 3Q9SA 2QVOA 2ZNYA 1PP7U 1FLIA 4V19K 4N9IA 5DCMA 2Z16A 3CCSI 1IN7A 3D5RC 2BW3B 2X1CA 1Y1WJ 3VSLA 2HU9A 1JUPA 3A1YA 4E70A 3LQQA 1QBJA 2V7FA 3UNGC 1O4XA 1FP2A 1OPCA 4HYEA 2KP6A 2P4WA 1FWZA 4EM2A 4LK0F 3BTJA 1G3TA 1T8IA 1S9HA 2O7OA 3JAMK 5CJ9A 4XOTA 2Y69H 2WY7Q 1RZ4A 3W2WA 3FMSA 3RYRA 2IPQX 4A3GJ 4BBRJ 4WF2A 4ZTJA 2EK5A 2O03A 2VJJA 4A2UA 3F72A 1RRJA 3FXLA 4NDLA 1ZRCA 3Q0WA 4A3BJ 3JSOA 5M3FJ 2BV6A 4D9JA 1BJAA 4EJWA 1V5FA 1Z77A 1Y56A 3CMEI 2YU9J 2XF5A 4AWXB 1MGTA 3ZP5A 3FXUA 1DPRA 2DA4A 2A61A 2GWRA 1HQCA 1XCVA 2KFDA 3DXJF 3AAFA 2XPUA 3GYHX 4DGWB 3K2AA 5IYDJ 1U0JA 3ZR8X 4C9YA 3E5UA 1FSEA 3H9QA 1NHAA 2DBBA 2L4MA 5EYRA 1SEUA 2YPRA 1QHHD 1LEBA 3GFMA 4ASNA 4LB5A 2CS3A 1TQMA 3FWEA 5CQEA 4C3JJ 4QPOA 3A0BC 1V54H 1XN7A 1GUUA 2BEOA 1A35A 5J1UA 3LA7A 3LSGA 2RV8A 1IW7F 2CUJA 3G1MA 3R0AA 3SXYA 1J5YA 1XSDA 2JN6A 3HB9A 1BM9A 1MBHA 5TISC 2DMUA 4RS8A 4GO1A 1BIAA 3EPZA 4RAZA 3OR1C 5HNFA 2ZO4A 4LIVA 2R7VA 2KPMA 3OS0A 2D1HA 3FIWA 3VODA 2A6EF 3O8HA 3TEDA 3ABMH 5L3EA 2CQKA 2VC1A 1GXPA 1X3WB 2JPCA 1QGPA 2ZBKA 3C1DA 3CO7C 2JMWA 3BG5A 3OOPA 4G8XA 4QWQA 2X85A 3BQYA 1FJLA 2KIMA 3ML6A 2LKPA 1TWAJ 4IL6C 3TP3A 2CFXA 2K5CA 2B0LA 1KONA 1T95A 1SVLA 4Z2YA 3OIPA 2ZC2A 5FROA 1K78B 1K7AA 1FYKA 2IW5A 4JYKA 1G3YA 4ZTFA 2CUEA 2VBYA 4AUXA 1RKTA 2DU9A 1J2XA 1J59A 3Q9VA 5CVIA 4NQWA 4J01A 2KJBA 4MFDA 2JPBA 2OUMA 3S8PA 1K79A 1UZCA 2V79A 3QYEA 3JSPA 1UG2A 4HX7A 3U2RA 2XAGA 2DMPA 3E97A 2WV1A 3GCMA 1RPWA 2NRAC 4U88A 1LFPA 2M1BA 2FMYA 1Z0XA 2HOAA 3M7GA 1EH7A 4V2GA 2R7WA 4XLCA 1LJ9A 3BG7A 2LBFB 1FMWA 1I1GA 1MBEA 2I8DA 5IP6A 1SD7A 2FNAA 2UXNA 5ICCA 4KJZA 2O5RA 5K5RA 3FZVA 2FQ3A 4KIBA 3HC7A 4G12A 4B1RA 3E0JB 4NBQA 3QOPA 1XDSA 4BHPA 3EQLF 1JGSA 2EFQA 3ZOBA 4QIWN 3T1BA 3IKTA 3U1DA 1FOKA 3BTIA 3ZPLA 3CCMI 1R4MB 1YIOA 2MFZA 4ZYGA 3I64A 3WTUC 1U2WA 3HRTA 3P9CA 1W1WE 3HKZA 3TW7A 4BH9A 4ANJA 4QLCU 1Y8QB 4NC6A 1OISA 1W7PB 2VJ5A 2WAQA 4ZH4F 2BHZA 5CYVA 1OCPA 3LNQA 3WG9A 5KNLA 3JRFA 1WGXA 1FOYA 1FIAA 5JLXA 1S29A 1UHSA 4PZJA 1VQ7I 3MQ0A 2L7ZA 1RUNA 3SEZA 2AQFA 1L3LA 2Y2ZA 1XPXA 4CUGA 2HDWA 2ZJRF 1LFBA 2F5DA 2QSGX 3IAM2 1KU9A 4E7KA 5D4RA 1KGSA 2ZMEC 4BXXJ 2WBMA 2RVCA 4U0VA 3K4KA 4IQ4A 5D5WB 5LEKA 1R4NB 3GZNB 2L7FP 1XX5A 1H9TA 4UV8A 2VKVA 5F27A 4EVIA 3M4OJ 4XSXF 1JTYA 4HNUA 1Z9CA 1Z05A 2EBIA 2EZHA 3CP8A 1ZN2A 4W1UA 5JFRA 2HVRA 5FKLA 4E7JA 1SANA 2ID3A 1D3YA 1SFEA 3TOAA 3OMYA 2HOSA 4E7SA 1FIPA 4DZJA 1X19A 4II3A 1QNTA 1RR7A 2XAHA 2VLAA 5AONA 3RKWA 2RN7A 3HG9A 1WJBA 3DLAA 2GA2A 3RKYA 4D0PA 2LFBA 4DBQA 1HW5A 2L54A 4KUMA 3EDPA 1RI7A 2K9QA 3X2QH 5ILVA 4F7ZA 1WFXA 2DA6A 3P9KA 4M6XA 2I5UA 5TRDA 2R92J 1HW2A 4L9JA 1ZG1A 4BDZA 4W97A 4EEFG 5M5XJ 1RESA 2DOFA 2E1NA 3IH4A 3DEWA 3JRGA 3IKVA 4BQQA 4OOIA 3DKWA 4FE7A 3OL3A 4S0HB 1MH3A 4A6DA 2DMQA 2YSRA 5D5XB 3G71I 2AO9A 4I76A 4XRSG 3E5XA 4KNYA 1TL8A 2O61A 2YU3A 2CRGA 4PJ0C 1RNLA 1WRJA 1IV8A 4S05A 3G2BA 1OLTA 3L1PA 2K27A 1R6RA 5AIPA 2IXSA 3J81Z 1YHQI 4HNTA 1X3UA 2QZ8A 5C44J 2EA2A 3ZQFA 1WI3A 1P92A 1CF7A 4IHVA 2HDDA 2WADA 4L5JA 4MFEA 3LMMA 1VQ6I 5J3LA 1V5EA 4G94A 1I27A 3RPQA 1E2XA 2K9SA 2BYVE 2QWWA 2XF6A 3CF5F 3OYJA 2XRNA 3CC7I 1DU6A 1G4DA 4PDKA 4EM0B 2A5WA 2EA4A 1LDDA 1JI8A 1APLC 2EH3A 4UVBA 3AL0B 3HOUJ 3HL2A 2P7VB 2DYRH 1T56A 1DGRM 2DO7A 4FTHA 3QU3A 2EIJH 3I59A 1ON1A 1G59A 1YLFA 3T8TA 1NK3P 3I58A 1YRNB 4EATA 1USSA 3T8RA 1J75A 3KP6A 3FHZA 1Y8RB 2QYOA 3NAUA 4DYRA 2PMZN 1JUSA 2A69F 2XGCA 3FM5A 3OYBA 1DDNA 3FBIB 3M8EA 2E19A 1BW5A 5ICGA 3G73A 3CDHA 2J5OA 3S2DJ 2L9SA 1IRXA 3ZQQA 3CLQA 4ZDOA 1HSJA 5HDGA 2QBYA 4M6YA 5E1ZB 5FGMA 5KAFC 3DEEA 1Z6RA 3R60A 2DDAA 3GWZA 4V2FA 4BYYA 1H0MA 1O7LA 4X1EA 3RYPA 4PGGA 1K61A 2EWNA 2XKOA 4HA8A 3VYRB 1EJ9A 3LSHA 5DS9A 2QM3A 2V1UA 2VUMJ 2F5VA 5E8IA 4NB5A 3ERED 3C2GA 1AKHA 5J4YA 2KKOA 3B6AA 3IHUA 2J5PA 3E7LA 3W6KB 1E3PA 3AKZA 2VPLA 4F93B 1TQPA 2BBYA 4HQMA 4RAYA 2ZCWA 3KP3A 5F04A 1ZRDA 1Y0NA 4OINF 5FFZA 4L5IA 2AS5F 2STWA 1FBQA 5FRMA 3QPSA 3OS2A 2VB6A 2ELHA 4IRIA 2JA8J 2W57A 3EUAA 2M5WA 4CCOA 3JRBA 2MW8A 2XGXA 5D4SA 1LDKB 3E6BA 2YX7A 1S7EA 4UXNA 4HNVA 2VQCA 1IXSB 2EFWA 4P96A 3BCBA 3IP4B 3F0CA 1PVEA 1QU3A 3PSIA 2L9RA 3OYNA 3L7WA 4HEA2 3JAMZ 3I5UA 4KA4A 2BY0A 1TNTA 1O57A 1SD4A 1YW8A 4PFPA 1XC5A 1ZELA 2KIFA 2VOOA 3I54A 4Y4RA 3FMRA 4PFOA 4YG2F 4EGZA 3FK6A 4OAZA 4XRMA 2EV5A 2H94A 2JA5J 2VIXA 3K1MA 4D1QA 2EV0A 1ZKGA 2VONA 3K7AJ 5BNGA 5A2QK 4C3HJ 3ECHA 4RM3A 1JGGA 1JKOC 3A4CA 4HW0A 1ZR4A 1T08B 2E60A 3WGGA 2IAIA 3K1NA 2KT0A 2K40A 2DFIA 1O3RA 3PUFA 2F4MB 4MO7A 3K4BA 1FTZA 5BMZA 4BBSJ 4XIDA 5IP7J 4GCVA 3DLLF 3B02A 5JLWA 3D0SA 1IUFA 1QQIA 3FXJA 1EH6A 1X58A 3HM5A 2VT3A 4ZDPA 2UUZA 4I0AA 4IHSA 3H3VK 2K86A 3FXRA 5ICFA 5H2FC 3M8FA 3LL7A 4RAFA 2COMA 1Z91A 2PMHA 2ZXWH 4D5FA 2BOLA 2CG4A 1A04A 5B5EC 3L2VA 2Y0SA 2BXYA 3HOTA 1XB4A 3ABLH 4LLLA 1SFUA 3SJMA 1TW2A 2E35A 1PDNC 1MNDA 2KZVA 3MMYB 1R1VA 5LHHA 1MDMA 2QA4I 2O9LA 3WTVC 2GM4A 2ZFWA 3T5XA 3HOXJ 1YJWI 2IRFG 5HNHA 4BEHA 2CUZA 1BJZA 1QPIA 4CCNA 1D5VA 3FM3A 2F6CA 3PNVA 3WTYC 4XRFA 2V6EA 4FASD 1LDJA 1YYVA 4AD9A 2HTSA 4UVCA 1MMDA 2NOJB 3FXKA 5IP9J 2DCEA 2RAEA 3HZJA 2DA2A 2MSYA 3I9V2 4RB1A 4XR6A 5H6QA 3OOUA 2P5LC 2M30A 4EJVA 3QPLA 1T0FA 2GOXB 4OIOF 3Q3SA 2CQ7A 1WJCA 2E1MB 1IXCA 2E7XA 3AG4H 3OY9A 1CF7B 1OCZH 3RJPA 1BI1A 2NVUB 3HRSA 1XMXA 1OR7A 2MH9A 1IDZA 1WHUA 2DPUA 2VQGA 4GFBA 2QQ9A 4UUSA 5L3DA 2RKHA 1B4AA 2R93J 2ICWG 3RQIA 2GOMA 1SD5A 3K1PA 4IHXA 2VQLA 2X6WA 5E18F 3KLNA 4EM1A 5GADJ 3BY6A 4UUTA 2R5ZA 5LGNA 4L9TA 3RCOA 5L3GA 2LY2A 1PUFB 5J8CA 1JHFA 2Z5UA 1WI9A 4U87A 3I59B 5FFXA 2DXIA 4CICA 4ZYDA 3GVAA 3S2WA 1M1EB 5J40A 4KN4X 3ZMVA 2B7EA 4A0YA 4YRVA 4TV7A 2E2IJ 1B72B 3BDDA 5LD2C 2DFFA 2E2HJ 2K3FA 3K9TA 4A3IJ 1UG0A 4LFUA 1B6AA 1ITYA 9ANTA 1LEAA 2QENA 2E1CA 1MNEA 5EGOA 2JSCA 2W1OA 4BS9A 4RGSA 1WJ5A 3S16J 2NAZA 3MZ8A 1HXDA 4G6TB 3QAHA 3A01A 3KZYA 3TBIA 1BI2A 1BA5A 1IDYA 1FTTA 1O3SA 2V1NA 1DU0A 1HBXG 4M3GA 4HX8A 2DMNA 1G6NA 3FISA 4F52A 3A03A 3V7CA 2XSDC 3HOSA 3DTIA 2CGPA 2NS7A 2LLKA 1AKHB 4XLPF 1F43A 5FLMJ 3VYUB 5GTIC 1N75A 3E6CC 1MSFC 3D5LA 2FBIA 1FP1D 3KLOA 1X4OA 1Z6TA 2OD5A 3GFIA 1ULYA 2Y9YA 3KP4A 5FO5A 4RGUA 2HVSA 4ZC3A 2H8WA 1LVAA 4AC0A 2DK8A 3HKZN 3WHBA 3CJNA 3FXMA 1ETYA 2WAQN 3BQZA 3DKXA 5F0CA 2M9HA 2XVCA 1YX5A 4Y7NJ 2L7KA 3ABUA 2HFHA 4OIQF 2OCCH 2B9SA 1ETXA 4Y33A 2V6CA 1OR7C 4KYWA 2IS4A 3SDBA 2HQRA 1SVOA 1OYYA 4KITB 3S3MA 1TZLA 4E7LA 4M6VA 3ABTA 2EZLA 4LIUA 3IH2A 4F3QA 2W00A 2HQ5A 3E6DA 4AYBA 3FHNA 4KT5C 1PUEE 1S3JA 4AIHA 4LG0A 2MD0A 3S17J 4MHGA 3JTGA 4J19A 5K7HA 2A6HF 1RETA 1VFCA 4HF2A 1IGNA 3BR0A 5FLVA 4YIFA 4XN0A 1MIJA 5DM7F 5FD5A 2P5VA 3TDUC 2IS1A 3G3ZA 3QPHA 5BQTA 3CLOA 2DDBA 1B8IA 3EUHC 2HI3A 4RGXA 2N8GA 3HGGA 3EYYA 2VI6A 2EFOA 4JQFA 4Q5SF 2F48A 1YI2I 2IP2A 4MEYF 2E36A 5J6XA 1Z3XA 3HTSB 4EJTA 4UB8C 3O2PE 5FKOA 2R5YB 1D0XA 2D2WA 2X6XA 5HVQC 1S8NA 5D5VB 2IGKA 1H89C 2VXDA 3V4GA 3OYHA 4RGRA 4Z6YA 4MTDA 3VOEA 3RDIA 2W82A 4BY1J 2Q0OA 2WC2A 4I09A 4G9YA 4O6JA 3ZMTA 4FX0A 3DQVC 2NS0A 3GTPJ 2VBZA 3GZ5A 3HSEA 1FNNA 1YJNI 2K4JA 1B1BA 3WODF 1MDMB 3S1NJ 1JTXA 1YW9A 2R3SA 1BIBA 4M9SA 5JVGF 5M5WJ 4H0EA 2FOWA 4IHTA 3EYIA 3LSIA 3F8BA 1ZARA 3D1NI 3IAS2 4EGYA 1FOWA 3MKYB 2KZGA 3WGIA 4L0ZB 3BJOA 1YE9A 3KZIC 3GF2A 4A3JJ 4YEJA 2X4HA 5B1BH 5JHFA 1X1BA 2HPIA 1XGMA 3K70D 4WWCA 1FY7A 3CUQB 5GP9A 1F5TA 2D1VA 3M3YJ 1I39A 1KU2A 3FF5A 2PJRA 2DQRA 1WJEA 2ZMEA 1U6GA 4LJZF 2QGUA 2E7WA 3VYTB 3I53A 3WHCA 4XRSA 2EPFA 4EJOA 2D45A 3ZXSA 2F4OB 3MN2A 4Q48A 4KMUX 3LFUA 4IRGA 2DAOA 4QPQA 4HLYA 3HUGB 2LREA 3MZYA 3KX2A 1GVJA 3JREA 4UV9A 4FQGA 1W0TA 1Z7UA 4ESJA 4ESBA 4UY8I 2R7OA 1WSUA 2R7TA 2YR2A 2JA7J 1RIOH 4GDFA 3CP2A 1EV7A 1W36C 4HOBA 3OL4A 4M3FA 1HDPA 2M34A 3H3UA 3DTKA 2ECBA 1GV5A 2ZJ2A 5CQGA 3H0DA 3TO6A 1LE8A 4BY7J 5HLTA 1V5GA 3CCRI 3H3ZA 4FT8A 1VQOI 4A5NA 2OQGA 2QKLB 3BZ6A 5EEAA 5EGOB 5CVRA 1BBYA 3A01B 1STZA 1MMSA 4XL9A 1FPQA 3KFWX 5KK1A 4CYCB 2R7UA 1WWXA 3K4CA 1BI0A 1FSHA 1IRGA 3V7SA 3RTRA 2H6CA 4L5EA 5D8LB 3BR5A 3ESWB 2P81A 1W5TA 2XAJA 4IF4A 1JKQC 2L0KA 4E4HA 4I2OA 1U9NA 1IV6A 2DLLA 4KMFA 4XSZF 5E3OA 1W4MA 1BR2A 2DT7B 4Y17A 2H1LA 2HS5A 2FMLA 1F9NA 1U8BA 4H4KC 3JR9A 1ZGWA 5A2QZ 2FQ4A 3KYCB 3BJ6A 1BC8C 4DYQA 3HOWJ 4IHWA 2GXGA 3LA3A 1R5GA 5DYMA 5IYBJ 1QZYA 5GTHC 5EEHA 3LSRA 2STTA 2BY3A 2YX4A 2EZKA 1H88C 4CXFA 2IT0A 4L18B 5HDKA 1PJRA 2KISA 3N4MA 5K5OA 3FK7A 2OTJI 5CPRB 4IOAF 4HG2A 2E5ZA 2VKDA 3C2BA 2Z33A 4BGDA 2M7AA 3S15J 1U3EM 2DA7A 4PSXA 2M45A 5DCMB 1B9NA 4CZCA 2ZKZA 4IPAA 1R7JA 1H8AC 2PG4A 2R7FA 1TT0A 3MCZA 4HV6A 2OCEA 5DD4A 5J1RA 3C2HA 3CJRB 4OIRF 3PJRA 2GLOA 3PUBA 2FX0A 1KZHA 4LG0B 1UJ8A 1WH7A 3NEUA 2EQRA 3H92A 3OR2C 1ZK8A 4NC8A 3HRUA 3K4JA 3GLLA 4BDYA 2EIMH 3WE2A 1ETWA 1I5ZA 4HQEA 4JBAA 1B8IB 3OYLA 4XK4A 2ETHA 2CQNA 4LD5A 4XORA 2L9VA 3CQZJ 2ZB9A 4RM2A 4DOZA 1USTA 3F8CA 3S93A 1KQ0A 1W5SA 1TC3C 2A5YB 2M8EA 1P4AA 3EUKL 1DP7P 2FSWA 1JT0A 3L00A 3SDGA 2H8RA 2BZTA 4C2MJ 1ACIA 1P2FA 3L9FA 3LWFA 2Q2EA 2BVMA 4DZPA 4C3IJ 1HCRA 2Y0SN 5J1YA 2LY9A 2M2EA 1QA6A 3ELKA 4M74A 1TLHB 2Z2SB 3BR2A 3HOYJ 5K7FA 1D1BA 2XPWA 3SQNA 2QQAA 3E5QA 3K6GA 1ZLKA 1GVDA 2IA1A 4XQFA 2MBFA 3WTTC 3IWZA 2LKSA 2LYCA 4Y13A 5ILUA 3TO9A 2ESHA 2ME0A 3W2AA 4OWRB 1X1DA 2ELKA 2K7LA 2KJCA 2XAFA 4GYIA 2VE8A 3ULQB 1T38A 1OJLA 1CGPA 3O3KA 3K10A 2GIZA 3K4LA 2VT2A 3O8GA 5IY5H 2R7XA 4OIPF 1R49A 2VKEA 2ZXHA 4BKXA 2LDUA 1KQ8A 2PN6A 2G0EA 2HXOA 2V9PA 2WV0A 4KICA 4AVPA 4E7ZA 1UHMA 5FLXK 1XMKA 3N05A 2ZFUA 3OV8A 1R71A 1BOBA 1FZPB 3LSJA 3OYAA 4IZZA 3ZQLA 2QCOA 1ZH5A 1K4TA 1OKRA 1ODDA 2PBIA 2P8TA 1JJ8C 2PJRB 2NXNB 2F2EA 3I4MJ 3U9GA 3S1RJ 2JUGA 2V26A 3C18A 5J4VA 1XSVA 3CCYA 4FX4A 2A05A 3VYSB 4G7HF 3OYKA 1DQUA 5LRRA 2LSOA 2GXAA 4IJAA 1R5HA 5TGTA 4HF1A 2QSFX 1K4SA 3WGHA 1LKXA 3AG1H 2ISYA 3DTEA 1IN5A 2EZIA 3ZQHA 3M1EA 3K2ZA 2MABA 1Q1VA 2UZKA 4HSRA 2K85A 4XNFA 1T98A 4I01A 5FRNA 5B3SH 4HPQA 3TKYA 4BAYA 3IV5A 4KIFA 4ABZA 1ZAOA 4OU0A 3CDIA 4NQWB 2LD5A 3K70C 2M3AA 1VI0A 1IRFA 3AG2H 3RZDJ 2L3DA 3KP7A 5EDNA 1JXSA 4EQQA 4DNCA 1XGOA 1U78A 2JA2A 3LSKA 3JTHA 3MD2A 3OYFA 3B6CA 4A0ZA 4Q4ZF 4L0YB 1ZTRA 3H5RA 4IX7A 3F6OA 3KP2A 1V3FA 1GXQA 1QRYA 3VB2A 2KQRA 4PJLA 1FBSA 4E7HA 5LFAA 5F0HA 1R5ID 1RUOA 2H27A 2QUFA 3I3LA 1IUYA 4LG3A 2XASA 5F0FA 2YUSA 1HSTA 1WJFA 2P6SA 1VQNI 1K6OA 2DT6A 3A02A 2XC7A 3HOVJ 3KYLA 1G8XA 4LB6B 3S3NA 4GGGA 2VASA 3H9GA 1SD6A 5DV5A 1MBJA 3HPHA 1ZG3A 4KDPA 1I1SA 5TJJA 1IN6A 4BJTA 2GZWA 3WE3A 3KIOA 2XHKA 2L9NA 3ABKH 2LG4A 4PGHA 1FMVA 4A12A 2CV2A 2M0MA 5HLIA 3WTXC 4IO9F 1SMYF 3F9KA 3BT9A 5KCMA 2ELJA 4CCLA 4G6DA 1XSXA 3GFJA 4M71A 3LAJA 2HGCA 5FKMA 3F3XA 2CU7A 3TW6A 1MJAA 4XLHA 3ASNH 2CWEA 3H0GJ 1ZLJA 2HZDA 1VF9A 1MBGA 1ZYRF 3J7AY 2ME6A 4JX4A 2BXZA 5F08A 2JRTA 1TW3A 4LK1F 5BS6A 1X1CA 3KZZA 3C3WA 4BJ6C 4P9UA 4A3KJ 1U5TC 3MZHA 2GBYA 3J7ZI 2CYYA 1Q1HA 2CQXA 4AYBN 3QYBA 3ZN1A 3TO7A 3PM1A 1WKMA 2AQEA 1OCTC 3JRDA 4YELA 2FBKA 2L5QA 3A0HC 2FJ1A 1T2KA 4P5OA 4HZFA 1VQMI 3VPRA 5JR3A 2MC3A 2R0QC 3R4KA 4LLNA 2B63J 1J9IA 3F8FA 4QSHA 1W7PD 2V1XA 2X1DA 4CH7A 2G9WA 4Y52J 2K9NA 1I3AA 2F5EA 4B44A 4IOCF 3RZOJ 1JT6A 4PK4A 1VQLI 2Z99A 5B1AH 4MNUA 2A3SA 2NS8A 2O0YA 2ZSIB 1QZEA 2BHYA 3KE2A 3CCUI 4WX9A 1PYVA 1VQPI 4GYGA 2LP0A 1FX7A 2KRFA 2RC4A 3JRCA 4R79A 3LA2A 1YX3A 3HIFA 3RIRA 1BI3A 2JSPA 1R1TA 3L2CA 4RLQA 4HV5A 4RLFA 2M4GA 3CJTB 2QKMB 1X3ZB 3I4NJ 4J00A 1F4KA 2Z3YA 4CSWA 1P9QC 4WXDA 1S6LA 1VZ0A 4LOCA 3BG9A 4ETSA 2XAQA 2TCTA 2MLKA 4XM3A 3ZMDA 4PJNA 1S7AA 2VOPA 1W36D 2QF7A 2HQAA 3P9IA 1QZZA 2XDVA 2BY2A 2DQLA 1SVMA 4A6EA 4RBOA 4HDVA 1SFOJ 3KP5A 2QSHX 1KYZA 5ICEA 1LB2A 5IOZA 2LK2A 3QU6A 4A3FJ 2L01A 2EV6A 4HLXA 4ZDLA 5GPAA 1E3HA 1MBFA 3LAPA 2ZJPF 2L2OA 4M9ZA 2WY8Q 4ENNA 2A07F 3BG6A 1ORKA 4GRIA 5IPAA 4CHUA 3S3OA 2QLZA 4MQ9F 3PO2J 3HSRA 2LC2A 2VKHA 1A5JA 1EH8A 1SAUA 2DFEA 3K69A 1R58A 4B3AA 4HDUA 3PSFA 1JJ6C 2K3PA 3NWTA 2VBWA 3GX4X 1TWFJ 1SC7A 1WVRA 5E8GA 2OTLI 2GXBA 3HEFA 3EUHA 2AXLA 3M8JA 1Y1VJ 4HF0A 4R1HA 2DODA 4D5CA 4UUVA 1V4RA 1XGSA 2W24A 2OBPA 3FKJA 1OCOH 1MJBA 2V1DA 5LGUA 2QBYB 2CUFA 3E3VA 4YIIA 3RKQA 4RA2A 5H20A 3I0TA 4E6KG 2M8GX 3DU5A 4A3CJ 1E0EA 1RC9A 4B4CA 4IEJA 3J80Z 2HNHA 1GDTA 4FISA 3CMYA 1ETVA 4M3EA 1H9GA 3COAC 3GTLJ 2DT5A 2LBFA 2P6TA 4UHTA 1ERDA 4CCKA 3N97A 1YFHA 3L2QA 1ZR2A 4A3DJ 4JK1X 3M07A 4DBRA 3G4SI 4FHTA 2AXTC 1QVUA 2ZJQF 2JK3A 1IXRC 1HLVA 2WTEA 1WZ2A 1XD7A 1HW1A 4XONA 1REPC 1IF1A 3KYDB 3PNYA 1VQKI 2RQQA 1I3QJ 2UV1A 3EETA 2P5KA 3UR3C 5J8FA 2UWMA 1W7PA 2QQBA 2WAFA 3HHHA 2H1KA 3CCLI 4JP0A 1ETKA 1QO0D 2K02A 4F55A 4NNJA 3LFKA 1J7KA 1BW6A 2R7SA 2V4JC 3DF8A 3BJAA 3BR6A 2A6TA 1O7FA 3MKWB 4UVAA 4CZZA 4U7BA 1MMAA 2EFNA 2KL4A 1POGA 3R0JA 3M9AA 3QWLA 3ZMSA 3BC8A 3CUQC 2HKOA 5FB2A 3F8NA 5GAHJ 1KU7A 2W48A 2X48A 4NC7A 3G1OA 3HRMA 3DBHB 4CDGA 1GLNA 2M4KA 4AVZA 4RAGA 1XDUA 3R61A 2DA5A 1OFCX 1D8KA 2ECCA 2E34A 2KIQA 1FBUA 2W85A 4II2A 2Y31A 3K4NA 4HAMA 5KAIC 1O3QA 1XGNA 1OYIA 1QPMA 3OYGA 3OYEA 1IZ1A 2FEZA 3BR1A 2VL8A 3DBRB 2NVYJ 3DU6A 3CMMA 5FKKA 1UFMA 5CKTA 2IS2A 2NNNA 3PFIA 1MJ9A 4AM3A 3RSNA 4E7IA 4PCQA 4HSTA 2RDPA 2VN2A 1Y0UA 3ZQIA 4I98B 1WQ2A 2EINH 2V9VA 1AU7A 4EMSA 2WB1N 1TQIA 3GFLA 3JW4A 1XG1A 4L9NA 5LRSA 2VE9A 5FLXZ 5F1JA 4BXFA 1NH3A 1AHDP 4FCYA 3G1LA 2E71A 4LLGF 3ZMZA 2DPDA 3SZGA 2XSJC 3I55I 4XICA 3OSFA 1ZG5A 1ZGAA 4BEHB 3FXQA 2HYJA 3WU2C 2O8XA 1VQ9I 3W2VA 2JQ7A 2YS9A 5FKNA 2RNGA 4I6ZA 5CVUA 3H5NA 3QP5A 2VQHA 1D1CA 5IT9K 3G6EI 1BR4A 1UMQA 2LMDA 1JHHA 4U7DA 2DN0A 2DYSH 2RNJA 5EZGA 5GAEJ 3GW2A 1P7IA 1TP4A 1D8JA 4XLEA 4BQOA 1DPUA 3BPVA 4CA0A 2HDCA 2XAUA 2I10A 4N9HA 1SFXA 2DJIA 4M73A 1OCCH 5E79C 4DIQA 1IJWC 2IGMA 1LFUP 1YJ9I 2DW4A 3NARA 4CCJA 4UUSB 4RDUA 4HX4A 2HZTA 1J09A 2GQQA 5KHDA 3IRQA 3CO6C 3NWSA 3C7JA 3MEXA 3TGNA 3OS1A 2XB5A 2XUBA 3OYDA 5LGTA 3RI4A 2Y9ZA 1BL0A 1HOMA 4F92B 2R5ZB 2JT1A 5DD8A 1D0YA 4C2UA 1O3TA 2C6YA 2GIVA 4OAYA 4DJAA 3S1MJ 3M1CA 3BLYA 4XKCA 2EILH 1MZBA 3GEZA 5GAGJ 1SAXA 2Y30A 1YRNA 3S1QJ 1U8RA 1LPQA 3BTLA 3W3CA 5L3CA 3GTQJ 4B43A 4N0BA 4BQNA 2VODA 1AA7A 1WJAA 3HGYA 2PMUA 3AG3H 1NTCA 4I0BA 2IA0A 3FKIJ 3S14J 1EKEA 2NYXA 4GXOA 2FBHA 1ZGJA 2NVQJ 2X1EA 1GHCA 2NNYA 3SZTA 5JVTA 2VJ4A 3H36A 1FYMA 5EG0A 2JVGA 2COBA 1B59A 5IT3A 2HYGD 4R8HA 2TRTA 1BR1A 4ZYAA 3H9JA 3CZ6A 3CTAA 4A69C 1G3WA 4YIRX 2DFHA 1MKMA 3HHGA 4YFXF 5LBQA 1N25A 3PL8A 2ISZA 2CFOA 3VWBA 3A2KA 5DDGA 3H35A 4M3DA 2G7UA 3CUOA 3QQAA 2CV0A 2KHMA 1FT9A 2K9LA 4MQVA 1D5YA 1WH5A 2IGNA 3DEUA 3PNTA 4AIJA 1WJDA 2OJED 5E17F 3LQRA 3P5JA 2O8KA 3L09A 3J80K 1MMGA 5BOXA 4FE4A 2XGEA 3PQKA 2R7QA 1JKPC 4JX5A 4BE2A 1HC8A 3ISPA 2X51A 1E17A 3S2HJ 3SYTA 2MD5A 4BHBA 3IUOA 4MTEA 2FF4A 3BOQA 3I56I 1R23A 4XOPA 2KLOA 4IVNA 5IOYA 2FOKA 4XKWA 2OA4A 1SFKA 3V7RA 2OPTA 1Z7LA 1BC7C 3CC2I 4N4OB 2R7ZJ 2XKPA 4FETA 2VBXA 3DBLB 4KT6A 2ACJA 5LHGA 1S7OA 2E5NA 3DPLC 3Q5FA 2JRMA 2XB0X 3D5SC 1XS9A 1AOYA 3F8MA 3AL0C 2XPVA 2GAUA 3LSPA 2P0WA 4PJJA 3ZQCA 4A3EJ 2K9MA 1I6HJ 5ILSA 4BACA 1P4XA 1DP3A 2IEKA 2P7CB 2CQQA 2IVMA 1N78A 2OAZA 1JKRC 2LVSA 4BQAA 5M5YJ 2GA1A 2H09A 1MW7A 3GO5A 3CF2A 3DPTA 3IRRA 1R22A 1MSEC 3GTGJ 1XCBA 3ZMUA 4BU2A 2XGDA 3HSFA 3SHFA 1X4PA 4UB6C 1D1AA 3PO3J 2XV4S 4BL0B 3LSTA 3J7AO 3PFYA 2WB1A 4I02A 1KU3A 1IN8A 3TL4X 3BPXA 2PEXA 1YO5C 2KDOA 2OQRA 4RB2C 4ENMA 4CYDA 1OMIA 3FX3A 2BVLA 2L4AA 3ZGKA 3FDYA 3U21A 5K7ZA 4KIGA 5FD6A 2K4BA 2NVXJ 5EF6A 1Z67A 3HXLA 4A93J 4ZZLA 4RB3C 2FUG2 6PAXA 1B9MA 3ECOA 3VEPA 2X6OA 3DWLE 1HKSA 1P4WA 2DTRA 2X0LA 2F4IA 1XTAA 1UAAA 3BROA 3ASOH 3GXOA 1ZHFA 1BOAA 2BE5F 2M87A 1TTYA 4WCGA 3I4PA 3LSMA 1TWGJ 3PQJA 4PSWA 3OYCA 4NUBA 5CVJA 1R00A 3ERMA 3FXOA 2CW0F 3CJQB 4G7ZF 1A6IA 2HOEA 2EIKH 2ZNZA 1G2HA 3O6BB 4XKVA 5LHIA 3OYMA 2Q1ZB 4DQ2A 2PFBA 5LEJA 3HJEA 3W6JB 5EEGA 3QPTA 5HLHA 3E6MA 4ENKA 4U0YA 1IAWA 3GTJJ 2LOOA 1TBXA 4C30A 5F1RA 1X2MA
chains in the Genus database with same CATH topology
2NS8A 2WV1A 1RPWA 1Z0XA 2HOAA 5C4JJ 4M6VA 4V2GA 2LP0A 2EZLA 3IH2A 2FD5A 3JRCA 2HQ5A 5IP6A 1MBEA 2LKXA 2JJ7A 1WPKA 4B1RA 4G12A 3Q0UA 3S17J 3HOZJ 4J19A 5K7HA 5M3MJ 3I4NJ 3ZOBA 2D5VA 2DA1A 4QIWN 1RETA 1VFCA 4A3LJ 3BTIA 1PUFA 1IGNA 3BR0A 4LOCA 5FLVA 1IRZA 3BG9A 2TCTA 3TW7A 1B8IA 2HI3A 2QF7A 1FEXA 1B72A 2N8GA 1OCPA 3HGGA 3LNQA 4RBOA 1SFOJ 2VI6A 3JRFA 1WGXA 3OSGA 1MNMC 1FIAA 5JLXA 1LE8B 5IOZA 1UHSA 2L7ZA 2LK2A 5FJ8J 1X2NA 1U9OA 1MH4A 1CQTA 1HDDC 4A3FJ 5FKOA 2Y2ZA 2R5YB 5GPAA 1MBFA 1LFBA 1H89C 5EG0B 1K83J 1TWCJ 4BXXJ 3HBLA 1QVTA 2M0CA 5HODA 4QTRA 1TWHJ 1ORKA 1HF0A 2CJJA 2IBDA 5IPAA 4BY1J 2L7FP 2VKVA 5F27A 2HXIA 3PO2J 3M4OJ 1JTYA 3GTPJ 1A5JA 1IC8A 2EBIA 2EZHA 4W1UA 5FKLA 4B3AA 3JRIA 1JTXA 5M5WJ 1JJ6C 3S1NJ 3SFIA 1SANA 1TWFJ 2ID3A 2LR8A 3D1NI 2NOGA 2KDZA 3HEFA 2HOSA 1Y1VJ 1ETOA 1FIPA 4DZJA 2DTZA 4D5CA 3HDDA 1RR7A 4A3JJ 4D7MA 4A3MJ 3OIOA 2HOTA 3GTMJ 2LFBA 2CUFA 3RKQA 2K9QA 2M8GX 5GP9A 1P7JA 2DA6A 4A3CJ 3M3YJ 2E1OA 4B4CA 4IEJA 1GDTA 2R92J 4FISA 3CMYA 1ETVA 4M3EA 3WHCA 4W97A 4EEFG 5M5XJ 4XRSA 1F36A 5C4XJ 1RESA 3GTLJ 3MN2A 3IH4A 3DEWA 3JRGA 4FE7A 4S0HB 1MH3A 2AHQA 2L7MP 2DMQA 1ZR2A 4A3DJ 2AO9A 4I76A 3MVPA 4XRSG 3ZQGA 3JREA 4X6AJ 1QVUA 2JK3A 1HLVA 2CRGA 1W0TA 3UKGA 3L1PA 2DMTA 1IG7A 2OF7A 2JA7J 1I3QJ 4M3FA 1HDPA 2M34A 2H1KA 4JP0A 2ECBA 1ETKA 1GV5A 5C44J 1MBKA 5DTDA 3ZQFA 1WI3A 5E3MA 1BW6A 5C3EJ 1LE8A 4BY7J 4IHVA 3BR6A 2HDDA 4MFEA 5J3LA 1POGA 2K9SA 5EEAA 5EGOB 4D7NA 2R5YA 2MG4A 1DU6A 3A01B 2W48A 2X48A 4CYCB 3G1OA 1APLC 2EH3A 3LOCA 3HOUJ 2DA5A 1T56A 1OFCX 2ECCA 4L5EA 1GV2A 2DJNA 3BR5A 2XRLA 2P81A 4FTHA 2Y31A 1ZQ3P 1R9TJ 1JKQC 2L0KA 4MIMA 1U9NA 3W6VA 1NK3P 1IV6A 1YRNB 3BR1A 2LTPA 5E3OA 2NVYJ 3GTKJ 5FKKA 3NAUA 4MLOA 1U8BA 3JR9A 4DYRA 2PMZN 1JUSA 1VNDA 2XGCA 4JX6A 1ZGWA 2FQ4A 3BTCA 1E3OC 2E19A 1BW5A 4DYQA 3HOWJ 4IHWA 2JA6J 3S2DJ 5IYBJ 3CDLA 3ZQIA 3LSRA 1NK2P 1JUMA 2EZKA 1H88C 4V2FA 1AU7A 3DCFA 4X1EA 2WB1N 1K61A 3FK7A 5IYCJ 2MGQA 3GBGA 3C2BA 1XG1A 5DS9A 5E3LA 2VUMJ 3S15J 1WCMJ 2DA7A 1ENHA 1AKHA 1I50J 5F1JA 1AHDP 4FCYA 1H8AC 3B6AA 3JRAA 3G1LA 3E7LA 4IHYA 3JRHA 5J1RA 2GLOA 1EF4A 2FX0A 3BR3A 3MKLA 4XICA 3OSFA 2VPRA 1WH7A 5F04A 2E2JJ 2EQRA 2HYJA 1GT0C 1ZK8A 2YS9A 3QPSA 5FKNA 4I6ZA 3BG3A 1T33A 2JA8J 1ETWA 3JRBA 1UMQA 2MW8A 2DN0A 5EZGA 1S7EA 1B8IB 4HNVA 1P7IA 4XK4A 3F0CA 2L9RA 3CQZJ 2I10A 2ZB9A 5EZHA 1TC3C 1XC5A 1IJWC 1LFUP 1ETQA 3NARA 1JT0A 3SDGA 4UUSB 2H8RA 1RKWA 4RDUA 4C2MJ 4CYCA 4DYCA 3FK6A 4XRMA 4DZPA 2JA5J 2NVTJ 4C3IJ 1HCRA 2Y0SN 1ZKGA 5J1YA 2LY9A 2XB5A 3K7AJ 3TP0A 5BNGA 2Y9ZA 2M2EA 1BL0A 4C3HJ 1HOMA 5GPCA 3BR2A 2R5ZB 1JGGA 3HOYJ 1JKOC 1ZR4A 5E3NA 5K7FA 2XPWA 2IAIA 2KT0A 1GVDA 3S1MJ 4M3BA 2K40A 3IH3A 1YRNA 3S1QJ 4MO7A 2Y30A 3BTLA 2ME0A 2DA3A 2ELKA 3GTQJ 1FTZA 1OJLA 4BBSJ 3HGYA 4XIDA 3O8GA 1NTCA 2ID6A 5IP7J 2VKEA 3FKIJ 3S14J 5JLWA 2NVQJ 1IUFA 4BKXA 3GTOJ 2G0EA 2HXOA 1X58A 3HM5A 5EG0A 2COBA 2X9DA 3H3VK 2JWTA 4DW6A 2TRTA 3LSJA 3Q0VA 3ZQLA 4D5FA 1W0UA 2QCOA 4A69C 1JJ8C 3I4MJ 3S1RJ 3SJMA 3CCYA 4M3DA 1Y1WJ 3QQAA 1JUPA 2O9LA 1D5YA 1WH5A 2GM4A 1O4XA 3HOXJ 2EZIA 1BJZA 3BTJA 3ZQHA 1QPIA 2O8KA 1Q1VA 2O7OA 4FE4A 2XGEA 3IV5A 1JKPC 4JX5A 5IP9J 4A3GJ 2RAEA 4ABZA 4BBRJ 2DA2A 2LD5A 3S2HJ 2MSYA 4NDLA 1VI0A 3Q0WA 4A3BJ 3OOUA 5IOYA 3RZDJ 3QPLA 5M3FJ 5EDNA 2OPTA 3Q3SA 1U78A 2R7ZJ 1Z77A 2YU9J 3B6CA 2XB0X 1XS9A 1IDZA 1ZTRA 4GFBA 2DA4A 1QRYA 4UUSA 2XPVA 5F0HA 3LSPA 2XPUA 3ZQCA 4A3EJ 2R93J 1I6HJ 3RQIA 4IHXA 3K2AA 2IEKA 5IYDJ 5EYRA 5F0FA 2CQQA 2YUSA 4UUTA 2R5ZA 1JKRC 3A02A 2LVSA 1PUFB 3HOVJ 5M5YJ 4C3JJ 1MBJA 1MSEC 3GTGJ 1GUUA 5J1UA 3LSGA 2XGDA 3G1MA 2E2IJ 1B72B 3PO3J 2E2HJ 4A3IJ 3BT9A 2JN6A 1ITYA 9ANTA 3HB9A 1MBHA 5FKMA 2DMUA 2CU7A 3TW6A 5EGOA 3S16J 3H0GJ 3A01A 1VF9A 1MBGA 1BA5A 1IDYA 4JX4A 2ME6A 3FIWA 5K7ZA 2NVXJ 5EF6A 1FTTA 5F08A 1DU0A 4M3GA 4A93J 2DMNA 3O8HA 3TEDA 3FISA 3A03A 2X6OA 4A3KJ 2GBYA 4AYBN 2CQXA 2XSDC 2JMWA 3BG5A 2NS7A 2LLKA 1AKHB 1F43A 5FLMJ 3BQYA 1FJLA 3PM1A 1TWAJ 3TP3A 1OCTC 3JRDA 1MSFC 1TWGJ 2FJ1A 2Y9YA 4JYKA 1A6IA 3VPRA 2CUEA 4AUXA 1G2HA 2R0QC 2B63J 1RKTA 4QSHA 4AC0A 3HKZN 3WHBA 1ETYA 2WAQN 4MFDA 3BQZA 4Y52J 2K9NA 5F0CA 2M9HA 4Y7NJ 1UG2A 3RZOJ 1JT6A 2DMPA 1ETXA 3GTJJ 1X2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS8 A;  2WV1 A;  1RPW A;  1Z0X A;  2HOA A;  5C4J J;  4M6V A;  4V2G A;  2LP0 A;  2EZL A;  3IH2 A;  2FD5 A;  3JRC A;  2HQ5 A;  5IP6 A;  1MBE A;  2LKX A;  2JJ7 A;  1WPK A;  4B1R A;  4G12 A;  3Q0U A;  3S17 J;  3HOZ J;  4J19 A;  5K7H A;  5M3M J;  3I4N J;  3ZOB A;  2D5V A;  2DA1 A;  4QIW N;  1RET A;  1VFC A;  4A3L J;  3BTI A;  1PUF A;  1IGN A;  3BR0 A;  4LOC A;  5FLV A;  1IRZ A;  3BG9 A;  2TCT A;  3TW7 A;  1B8I A;  2HI3 A;  2QF7 A;  1FEX A;  1B72 A;  2N8G A;  1OCP A;  3HGG A;  3LNQ A;  4RBO A;  1SFO J;  2VI6 A;  3JRF A;  1WGX A;  3OSG A;  1MNM C;  1FIA A;  5JLX A;  1LE8 B;  5IOZ A;  1UHS A;  2L7Z A;  2LK2 A;  5FJ8 J;  1X2N A;  1U9O A;  1MH4 A;  1CQT A;  1HDD C;  4A3F J;  5FKO A;  2Y2Z A;  2R5Y B;  5GPA A;  1MBF A;  1LFB A;  1H89 C;  5EG0 B;  1K83 J;  1TWC J;  4BXX J;  3HBL A;  1QVT A;  2M0C A;  5HOD A;  4QTR A;  1TWH J;  1ORK A;  1HF0 A;  2CJJ A;  2IBD A;  5IPA A;  4BY1 J;  2L7F P;  2VKV A;  5F27 A;  2HXI A;  3PO2 J;  3M4O J;  1JTY A;  3GTP J;  1A5J A;  1IC8 A;  2EBI A;  2EZH A;  4W1U A;  5FKL A;  4B3A A;  3JRI A;  1JTX A;  5M5W J;  1JJ6 C;  3S1N J;  3SFI A;  1SAN A;  1TWF J;  2ID3 A;  2LR8 A;  3D1N I;  2NOG A;  2KDZ A;  3HEF A;  2HOS A;  1Y1V J;  1ETO A;  1FIP A;  4DZJ A;  2DTZ A;  4D5C A;  3HDD A;  1RR7 A;  4A3J J;  4D7M A;  4A3M J;  3OIO A;  2HOT A;  3GTM J;  2LFB A;  2CUF A;  3RKQ A;  2K9Q A;  2M8G X;  5GP9 A;  1P7J A;  2DA6 A;  4A3C J;  3M3Y J;  2E1O A;  4B4C A;  4IEJ A;  1GDT A;  2R92 J;  4FIS A;  3CMY A;  1ETV A;  4M3E A;  3WHC A;  4W97 A;  4EEF G;  5M5X J;  4XRS A;  1F36 A;  5C4X J;  1RES A;  3GTL J;  3MN2 A;  3IH4 A;  3DEW A;  3JRG A;  4FE7 A;  4S0H B;  1MH3 A;  2AHQ A;  2L7M P;  2DMQ A;  1ZR2 A;  4A3D J;  2AO9 A;  4I76 A;  3MVP A;  4XRS G;  3ZQG A;  3JRE A;  4X6A J;  1QVU A;  2JK3 A;  1HLV A;  2CRG A;  1W0T A;  3UKG A;  3L1P A;  2DMT A;  1IG7 A;  2OF7 A;  2JA7 J;  1I3Q J;  4M3F A;  1HDP A;  2M34 A;  2H1K A;  4JP0 A;  2ECB A;  1ETK A;  1GV5 A;  5C44 J;  1MBK A;  5DTD A;  3ZQF A;  1WI3 A;  5E3M A;  1BW6 A;  5C3E J;  1LE8 A;  4BY7 J;  4IHV A;  3BR6 A;  2HDD A;  4MFE A;  5J3L A;  1POG A;  2K9S A;  5EEA A;  5EGO B;  4D7N A;  2R5Y A;  2MG4 A;  1DU6 A;  3A01 B;  2W48 A;  2X48 A;  4CYC B;  3G1O A;  1APL C;  2EH3 A;  3LOC A;  3HOU J;  2DA5 A;  1T56 A;  1OFC X;  2ECC A;  4L5E A;  1GV2 A;  2DJN A;  3BR5 A;  2XRL A;  2P81 A;  4FTH A;  2Y31 A;  1ZQ3 P;  1R9T J;  1JKQ C;  2L0K A;  4MIM A;  1U9N A;  3W6V A;  1NK3 P;  1IV6 A;  1YRN B;  3BR1 A;  2LTP A;  5E3O A;  2NVY J;  3GTK J;  5FKK A;  3NAU A;  4MLO A;  1U8B A;  3JR9 A;  4DYR A;  2PMZ N;  1JUS A;  1VND A;  2XGC A;  4JX6 A;  1ZGW A;  2FQ4 A;  3BTC A;  1E3O C;  2E19 A;  1BW5 A;  4DYQ A;  3HOW J;  4IHW A;  2JA6 J;  3S2D J;  5IYB J;  3CDL A;  3ZQI A;  3LSR A;  1NK2 P;  1JUM A;  2EZK A;  1H88 C;  4V2F A;  1AU7 A;  3DCF A;  4X1E A;  2WB1 N;  1K61 A;  3FK7 A;  5IYC J;  2MGQ A;  3GBG A;  3C2B A;  1XG1 A;  5DS9 A;  5E3L A;  2VUM J;  3S15 J;  1WCM J;  2DA7 A;  1ENH A;  1AKH A;  1I50 J;  5F1J A;  1AHD P;  4FCY A;  1H8A C;  3B6A A;  3JRA A;  3G1L A;  3E7L A;  4IHY A;  3JRH A;  5J1R A;  2GLO A;  1EF4 A;  2FX0 A;  3BR3 A;  3MKL A;  4XIC A;  3OSF A;  2VPR A;  1WH7 A;  5F04 A;  2E2J J;  2EQR A;  2HYJ A;  1GT0 C;  1ZK8 A;  2YS9 A;  3QPS A;  5FKN A;  4I6Z A;  3BG3 A;  1T33 A;  2JA8 J;  1ETW A;  3JRB A;  1UMQ A;  2MW8 A;  2DN0 A;  5EZG A;  1S7E A;  1B8I B;  4HNV A;  1P7I A;  4XK4 A;  3F0C A;  2L9R A;  3CQZ J;  2I10 A;  2ZB9 A;  5EZH A;  1TC3 C;  1XC5 A;  1IJW C;  1LFU P;  1ETQ A;  3NAR A;  1JT0 A;  3SDG A;  4UUS B;  2H8R A;  1RKW A;  4RDU A;  4C2M J;  4CYC A;  4DYC A;  3FK6 A;  4XRM A;  4DZP A;  2JA5 J;  2NVT J;  4C3I J;  1HCR A;  2Y0S N;  1ZKG A;  5J1Y A;  2LY9 A;  2XB5 A;  3K7A J;  3TP0 A;  5BNG A;  2Y9Z A;  2M2E A;  1BL0 A;  4C3H J;  1HOM A;  5GPC A;  3BR2 A;  2R5Z B;  1JGG A;  3HOY J;  1JKO C;  1ZR4 A;  5E3N A;  5K7F A;  2XPW A;  2IAI A;  2KT0 A;  1GVD A;  3S1M J;  4M3B A;  2K40 A;  3IH3 A;  1YRN A;  3S1Q J;  4MO7 A;  2Y30 A;  3BTL A;  2ME0 A;  2DA3 A;  2ELK A;  3GTQ J;  1FTZ A;  1OJL A;  4BBS J;  3HGY A;  4XID A;  3O8G A;  1NTC A;  2ID6 A;  5IP7 J;  2VKE A;  3FKI J;  3S14 J;  5JLW A;  2NVQ J;  1IUF A;  4BKX A;  3GTO J;  2G0E A;  2HXO A;  1X58 A;  3HM5 A;  5EG0 A;  2COB A;  2X9D A;  3H3V K;  2JWT A;  4DW6 A;  2TRT A;  3LSJ A;  3Q0V A;  3ZQL A;  4D5F A;  1W0U A;  2QCO A;  4A69 C;  1JJ8 C;  3I4M J;  3S1R J;  3SJM A;  3CCY A;  4M3D A;  1Y1W J;  3QQA A;  1JUP A;  2O9L A;  1D5Y A;  1WH5 A;  2GM4 A;  1O4X A;  3HOX J;  2EZI A;  1BJZ A;  3BTJ A;  3ZQH A;  1QPI A;  2O8K A;  1Q1V A;  2O7O A;  4FE4 A;  2XGE A;  3IV5 A;  1JKP C;  4JX5 A;  5IP9 J;  4A3G J;  2RAE A;  4ABZ A;  4BBR J;  2DA2 A;  2LD5 A;  3S2H J;  2MSY A;  4NDL A;  1VI0 A;  3Q0W A;  4A3B J;  3OOU A;  5IOY A;  3RZD J;  3QPL A;  5M3F J;  5EDN A;  2OPT A;  3Q3S A;  1U78 A;  2R7Z J;  1Z77 A;  2YU9 J;  3B6C A;  2XB0 X;  1XS9 A;  1IDZ A;  1ZTR A;  4GFB A;  2DA4 A;  1QRY A;  4UUS A;  2XPV A;  5F0H A;  3LSP A;  2XPU A;  3ZQC A;  4A3E J;  2R93 J;  1I6H J;  3RQI A;  4IHX A;  3K2A A;  2IEK A;  5IYD J;  5EYR A;  5F0F A;  2CQQ A;  2YUS A;  4UUT A;  2R5Z A;  1JKR C;  3A02 A;  2LVS A;  1PUF B;  3HOV J;  5M5Y J;  4C3J J;  1MBJ A;  1MSE C;  3GTG J;  1GUU A;  5J1U A;  3LSG A;  2XGD A;  3G1M A;  2E2I J;  1B72 B;  3PO3 J;  2E2H J;  4A3I J;  3BT9 A;  2JN6 A;  1ITY A;  9ANT A;  3HB9 A;  1MBH A;  5FKM A;  2DMU A;  2CU7 A;  3TW6 A;  5EGO A;  3S16 J;  3H0G J;  3A01 A;  1VF9 A;  1MBG A;  1BA5 A;  1IDY A;  4JX4 A;  2ME6 A;  3FIW A;  5K7Z A;  2NVX J;  5EF6 A;  1FTT A;  5F08 A;  1DU0 A;  4M3G A;  4A93 J;  2DMN A;  3O8H A;  3TED A;  3FIS A;  3A03 A;  2X6O A;  4A3K J;  2GBY A;  4AYB N;  2CQX A;  2XSD C;  2JMW A;  3BG5 A;  2NS7 A;  2LLK A;  1AKH B;  1F43 A;  5FLM J;  3BQY A;  1FJL A;  3PM1 A;  1TWA J;  3TP3 A;  1OCT C;  3JRD A;  1MSF C;  1TWG J;  2FJ1 A;  2Y9Y A;  4JYK A;  1A6I A;  3VPR A;  2CUE A;  4AUX A;  1G2H A;  2R0Q C;  2B63 J;  1RKT A;  4QSH A;  4AC0 A;  3HKZ N;  3WHB A;  1ETY A;  2WAQ N;  4MFD A;  3BQZ A;  4Y52 J;  2K9N A;  5F0C A;  2M9H A;  4Y7N J;  1UG2 A;  3RZO J;  1JT6 A;  2DMP A;  1ETX A;  3GTJ J;  1X2M A; 
#chains in the Genus database with same CATH topology
 4OMZ A;  2HYF A;  2ZME B;  2W25 A;  3ONQ A;  2CSO A;  3QP6 A;  4Y15 A;  5C4J J;  3CCE I;  2DOE A;  2FD5 A;  2Q8K A;  3BCA A;  1HKT A;  4XMY A;  2LKX A;  3F21 A;  2IS6 A;  2L02 A;  1U5T A;  2JJ7 A;  2CW8 A;  1WPK A;  5DEQ A;  4KFC A;  3Q0U A;  3HOZ J;  1YS7 A;  4O3M A;  4AID A;  5M3M J;  2D5V A;  2DA1 A;  4BHC A;  1A31 A;  5F64 A;  3H1C A;  4A3L J;  1PUF A;  1OYW A;  1T39 A;  3HYI A;  5L3B A;  3V8J A;  1IRZ A;  2IGO A;  3GLX A;  2RRE A;  2HWV A;  3I71 A;  4PUS A;  2Z9O A;  3TOB A;  4KN7 X;  2IA2 A;  1VTN C;  4UNO A;  1FEX A;  5E1W A;  1B72 A;  4O5V A;  3V8K A;  4IRH A;  3AFH A;  1K6Y A;  3OSG A;  2CO5 A;  1MNM C;  1ZRE A;  1LE8 B;  2FE3 A;  3KEY A;  2ESN A;  3PIP F;  3MFK A;  3HTU A;  1FYL A;  5FJ8 J;  2RQP A;  1X2N A;  3P7N A;  1U9O A;  1MH4 A;  1CQT A;  1HDD C;  1VQ8 I;  5K1Y A;  3CD6 I;  2QEX I;  4XBF A;  4BE1 A;  2PLY A;  5B66 C;  1VQ4 I;  1UHW A;  5EG0 B;  2BGC A;  5E1X A;  5ED4 A;  2ZXJ A;  3F23 A;  5HS8 A;  1K83 J;  1TWC J;  1ZRF A;  3HBL A;  1QVT A;  1NG6 A;  2M0C A;  1R36 A;  3F6V A;  3MWM A;  1TWH J;  5HOD A;  4QTR A;  1HF0 A;  2CJJ A;  4OMY A;  2IBD A;  1FC3 A;  1VQ5 I;  3ZCO A;  2HXI A;  2DOA A;  3QYF A;  4WXH A;  4HRI A;  4M9X A;  2CH0 A;  3K0L A;  1IC8 A;  5HS7 A;  2BY1 A;  1QHG A;  1TT5 B;  2CMP A;  2R4G A;  1J0R A;  3DPU A;  3JRI A;  3IWF A;  3CES A;  1N77 A;  3TMO A;  2JUC A;  3SFI A;  1I6X A;  3KPH A;  2LR8 A;  1KQ9 A;  3ROU A;  2NOG A;  2KDZ A;  3SZP A;  4BJ5 C;  2DI3 A;  4IKF A;  1YIJ I;  1ETO A;  4B3X A;  1C0W A;  3MKZ A;  1L0O C;  2DTZ A;  2WA0 A;  3HDD A;  4D7M A;  2MA3 A;  2OC6 A;  3DP7 A;  3BP8 A;  3GZ6 A;  5DUI A;  4A3M J;  5H6R A;  3OIO A;  4BUP A;  2HOT A;  3GTM J;  1PP8 F;  1OQY A;  1KYW A;  1BN5 A;  2E1M C;  2MH2 A;  1P7J A;  5HOO A;  2E1O A;  1T6S A;  4ESF A;  3JCU C;  2PQ8 A;  4P9F A;  1MMN A;  3T0Y A;  3OWT A;  2CW7 A;  1R1U A;  4F91 B;  2BW3 A;  1F36 A;  4NHJ A;  5C4X J;  4Y3O A;  2HEO A;  2OZU A;  3B73 A;  4XLA A;  4MEX F;  1DGW Y;  2AHQ A;  2HQN A;  2A68 F;  2L7M P;  2FXA A;  2VXZ A;  1LVK A;  4ENJ A;  2H6B A;  2OZ6 A;  2W7N A;  3MVP A;  5J47 A;  3ZQG A;  5KVR A;  4IXA A;  5DCF A;  5DUK A;  5F6F A;  4RMN A;  4XLF A;  4X6A J;  4EV0 A;  3S32 A;  4KIS A;  1FOX A;  2KRC A;  3UKG A;  5EJC A;  1SMT A;  2DMT A;  1IG7 A;  3BZC A;  1NG7 A;  4CO8 A;  2OF7 A;  2LY1 A;  2M7B A;  5CVV A;  5DM6 F;  1X1P A;  2HPM A;  4LMY A;  5AIQ A;  4XKB A;  2R7R A;  3KCC A;  3RPU D;  4ON0 A;  2TDX A;  4A5M A;  1ONV A;  3KET A;  5BPD A;  3E1S A;  1MBK A;  3VFZ A;  5DTD A;  2Y48 A;  5E3M A;  3TDZ C;  1S5L C;  5C3E J;  1LQ1 A;  1YW7 A;  3L2W A;  2LF7 A;  2LF8 A;  5IT9 Z;  1AWC A;  3QRF F;  3TQN A;  3GUD A;  2R5Y A;  4D7N A;  3CC4 I;  4P55 A;  2JVH A;  2MG4 A;  4I99 C;  3NQO A;  5D8K B;  3IC7 A;  5D6F A;  3IL2 A;  4X0G A;  3K4M A;  2OU2 A;  1F1Z A;  2Q2E B;  2PX9 A;  3L2R A;  3KEO A;  5D6E A;  2UXX A;  3LOC A;  4YFN F;  3L2U A;  3CMA I;  3OYI A;  2LH9 A;  3CCQ I;  4ZYE A;  1UB9 A;  1OCR H;  1GV2 A;  1LNW A;  2DJN A;  1JE8 A;  2XRL A;  4RB0 A;  4L9V A;  5HLG A;  2JTV A;  2QQ8 A;  3GME A;  1ZQ3 P;  1YS6 A;  1Y6I A;  5CLS A;  5HS9 A;  1R9T J;  1S72 I;  4MIM A;  1HA8 A;  3W6V A;  4Q47 A;  1YQA A;  2WAE A;  3NRV A;  1P6R A;  3WU1 B;  3REO A;  2LTP A;  5E20 A;  1YTY A;  3GTK J;  3R6S A;  4MLO A;  2KMU A;  2EFP A;  4JX6 A;  2W4S A;  1VND A;  3SEQ A;  3VSK A;  3J7Y J;  3BTC A;  2MC4 A;  2FRH A;  1YIT I;  1E3O C;  3H5A A;  3BWG A;  2ADU A;  2FA5 A;  4AIK A;  4ZZD A;  3PIO F;  2Z1D A;  3KEQ A;  1YG2 A;  2JA6 J;  2W84 A;  2O6G E;  3CDL A;  1XMA A;  4XN3 A;  1YOV B;  3SFZ A;  1NK2 P;  1JUM A;  2HVQ A;  2Y0M A;  4MGR A;  4ZJZ A;  4HBL A;  2VJI A;  3CUQ A;  3DCF A;  3WTZ A;  4LIT A;  1A36 A;  4G6Q A;  1X1A A;  2MGQ A;  3GBG A;  5IYC J;  2CV1 A;  2XF7 A;  3U1K A;  1KA8 A;  5E3L A;  3CCJ I;  3BZK A;  1UEL B;  1WCM J;  2MLG A;  3F22 A;  1ENH A;  1I50 J;  2F5C A;  3JRA A;  4IHY A;  4ITV A;  3J81 K;  1D0Z A;  3JRH A;  1U5T B;  3ZRG A;  2WWY A;  4B47 A;  1EF4 A;  3HUG A;  3BR3 A;  3MKL A;  3QOE A;  4I7H A;  5L3F A;  2FNP A;  1K78 A;  2VPR A;  4U0W A;  3WU0 A;  1MD0 A;  1Z21 A;  2XIG A;  4WK8 F;  2E2J J;  1GT0 C;  1UCR A;  2PMZ A;  1HKQ A;  2VC0 A;  1W5C C;  3BG3 A;  2LNB A;  1T33 A;  2MYS A;  2ZXI A;  1Z3Y A;  2HTJ A;  3V8L A;  3VDX A;  2RGV A;  3HPG A;  2HKX A;  4WXC A;  5LLQ A;  4ZYH A;  3RKX A;  2DK5 A;  2IJL A;  1A6Q A;  2EJR A;  2FU4 A;  5HDN A;  3WTS C;  1TNS A;  4B09 A;  5EZH A;  4K2E A;  3WG7 H;  3ZN0 A;  5D5U B;  5JHU A;  1ETQ A;  3DV8 A;  2PI0 A;  1RKW A;  4LGW A;  4CYC A;  4JOM A;  3OIQ A;  4P1W A;  4DYC A;  5JI6 A;  1Z1D A;  4C2T A;  2NVT J;  3FBN B;  5K5Q A;  2Y75 A;  1G3S A;  1ON2 A;  4PJM A;  3TP0 A;  2ZSH B;  5GPC A;  4CGZ A;  4BXU A;  4YFK F;  5E3N A;  2JZY A;  1DUX C;  4XLN F;  2F5F A;  3RQ4 A;  2R7D A;  2EB7 A;  3ZQ7 A;  4M3B A;  1LUJ B;  2KRH A;  3IH3 A;  5ERI A;  2HR3 A;  2G7H A;  2O3F A;  4CCM A;  3DKY A;  3FMQ A;  1V55 H;  4B8X A;  2DA3 A;  2X6Y A;  4BE0 A;  4G7O F;  3MAJ A;  2XRO A;  3RPU A;  3V42 A;  3QOD A;  2ID6 A;  2KIU A;  1EA3 A;  2V9K A;  3GTO J;  4N4N B;  4EJU A;  1Y39 A;  5BPI A;  3DFG A;  2OV7 A;  1IO2 A;  4S04 A;  4AU7 A;  1RR8 C;  2PJP A;  3WTW C;  4M72 A;  4B48 A;  1T0F C;  2X9D A;  2JWT A;  1IN4 A;  4IQJ A;  4DW6 A;  4A0X A;  4BNC A;  3CCV I;  2LRD A;  3Q0V A;  1W0U A;  3Q9S A;  2QVO A;  2ZNY A;  1PP7 U;  1FLI A;  4V19 K;  4N9I A;  5DCM A;  2Z16 A;  3CCS I;  1IN7 A;  3D5R C;  2BW3 B;  2X1C A;  1Y1W J;  3VSL A;  2HU9 A;  1JUP A;  3A1Y A;  4E70 A;  3LQQ A;  1QBJ A;  2V7F A;  3UNG C;  1O4X A;  1FP2 A;  1OPC A;  4HYE A;  2KP6 A;  2P4W A;  1FWZ A;  4EM2 A;  4LK0 F;  3BTJ A;  1G3T A;  1T8I A;  1S9H A;  2O7O A;  3JAM K;  5CJ9 A;  4XOT A;  2Y69 H;  2WY7 Q;  1RZ4 A;  3W2W A;  3FMS A;  3RYR A;  2IPQ X;  4A3G J;  4BBR J;  4WF2 A;  4ZTJ A;  2EK5 A;  2O03 A;  2VJJ A;  4A2U A;  3F72 A;  1RRJ A;  3FXL A;  4NDL A;  1ZRC A;  3Q0W A;  4A3B J;  3JSO A;  5M3F J;  2BV6 A;  4D9J A;  1BJA A;  4EJW A;  1V5F A;  1Z77 A;  1Y56 A;  3CME I;  2YU9 J;  2XF5 A;  4AWX B;  1MGT A;  3ZP5 A;  3FXU A;  1DPR A;  2DA4 A;  2A61 A;  2GWR A;  1HQC A;  1XCV A;  2KFD A;  3DXJ F;  3AAF A;  2XPU A;  3GYH X;  4DGW B;  3K2A A;  5IYD J;  1U0J A;  3ZR8 X;  4C9Y A;  3E5U A;  1FSE A;  3H9Q A;  1NHA A;  2DBB A;  2L4M A;  5EYR A;  1SEU A;  2YPR A;  1QHH D;  1LEB A;  3GFM A;  4ASN A;  4LB5 A;  2CS3 A;  1TQM A;  3FWE A;  5CQE A;  4C3J J;  4QPO A;  3A0B C;  1V54 H;  1XN7 A;  1GUU A;  2BEO A;  1A35 A;  5J1U A;  3LA7 A;  3LSG A;  2RV8 A;  1IW7 F;  2CUJ A;  3G1M A;  3R0A A;  3SXY A;  1J5Y A;  1XSD A;  2JN6 A;  3HB9 A;  1BM9 A;  1MBH A;  5TIS C;  2DMU A;  4RS8 A;  4GO1 A;  1BIA A;  3EPZ A;  4RAZ A;  3OR1 C;  5HNF A;  2ZO4 A;  4LIV A;  2R7V A;  2KPM A;  3OS0 A;  2D1H A;  3FIW A;  3VOD A;  2A6E F;  3O8H A;  3TED A;  3ABM H;  5L3E A;  2CQK A;  2VC1 A;  1GXP A;  1X3W B;  2JPC A;  1QGP A;  2ZBK A;  3C1D A;  3CO7 C;  2JMW A;  3BG5 A;  3OOP A;  4G8X A;  4QWQ A;  2X85 A;  3BQY A;  1FJL A;  2KIM A;  3ML6 A;  2LKP A;  1TWA J;  4IL6 C;  3TP3 A;  2CFX A;  2K5C A;  2B0L A;  1KON A;  1T95 A;  1SVL A;  4Z2Y A;  3OIP A;  2ZC2 A;  5FRO A;  1K78 B;  1K7A A;  1FYK A;  2IW5 A;  4JYK A;  1G3Y A;  4ZTF A;  2CUE A;  2VBY A;  4AUX A;  1RKT A;  2DU9 A;  1J2X A;  1J59 A;  3Q9V A;  5CVI A;  4NQW A;  4J01 A;  2KJB A;  4MFD A;  2JPB A;  2OUM A;  3S8P A;  1K79 A;  1UZC A;  2V79 A;  3QYE A;  3JSP A;  1UG2 A;  4HX7 A;  3U2R A;  2XAG A;  2DMP A;  3E97 A;  2WV1 A;  3GCM A;  1RPW A;  2NRA C;  4U88 A;  1LFP A;  2M1B A;  2FMY A;  1Z0X A;  2HOA A;  3M7G A;  1EH7 A;  4V2G A;  2R7W A;  4XLC A;  1LJ9 A;  3BG7 A;  2LBF B;  1FMW A;  1I1G A;  1MBE A;  2I8D A;  5IP6 A;  1SD7 A;  2FNA A;  2UXN A;  5ICC A;  4KJZ A;  2O5R A;  5K5R A;  3FZV A;  2FQ3 A;  4KIB A;  3HC7 A;  4G12 A;  4B1R A;  3E0J B;  4NBQ A;  3QOP A;  1XDS A;  4BHP A;  3EQL F;  1JGS A;  2EFQ A;  3ZOB A;  4QIW N;  3T1B A;  3IKT A;  3U1D A;  1FOK A;  3BTI A;  3ZPL A;  3CCM I;  1R4M B;  1YIO A;  2MFZ A;  4ZYG A;  3I64 A;  3WTU C;  1U2W A;  3HRT A;  3P9C A;  1W1W E;  3HKZ A;  3TW7 A;  4BH9 A;  4ANJ A;  4QLC U;  1Y8Q B;  4NC6 A;  1OIS A;  1W7P B;  2VJ5 A;  2WAQ A;  4ZH4 F;  2BHZ A;  5CYV A;  1OCP A;  3LNQ A;  3WG9 A;  5KNL A;  3JRF A;  1WGX A;  1FOY A;  1FIA A;  5JLX A;  1S29 A;  1UHS A;  4PZJ A;  1VQ7 I;  3MQ0 A;  2L7Z A;  1RUN A;  3SEZ A;  2AQF A;  1L3L A;  2Y2Z A;  1XPX A;  4CUG A;  2HDW A;  2ZJR F;  1LFB A;  2F5D A;  2QSG X;  3IAM 2;  1KU9 A;  4E7K A;  5D4R A;  1KGS A;  2ZME C;  4BXX J;  2WBM A;  2RVC A;  4U0V A;  3K4K A;  4IQ4 A;  5D5W B;  5LEK A;  1R4N B;  3GZN B;  2L7F P;  1XX5 A;  1H9T A;  4UV8 A;  2VKV A;  5F27 A;  4EVI A;  3M4O J;  4XSX F;  1JTY A;  4HNU A;  1Z9C A;  1Z05 A;  2EBI A;  2EZH A;  3CP8 A;  1ZN2 A;  4W1U A;  5JFR A;  2HVR A;  5FKL A;  4E7J A;  1SAN A;  2ID3 A;  1D3Y A;  1SFE A;  3TOA A;  3OMY A;  2HOS A;  4E7S A;  1FIP A;  4DZJ A;  1X19 A;  4II3 A;  1QNT A;  1RR7 A;  2XAH A;  2VLA A;  5AON A;  3RKW A;  2RN7 A;  3HG9 A;  1WJB A;  3DLA A;  2GA2 A;  3RKY A;  4D0P A;  2LFB A;  4DBQ A;  1HW5 A;  2L54 A;  4KUM A;  3EDP A;  1RI7 A;  2K9Q A;  3X2Q H;  5ILV A;  4F7Z A;  1WFX A;  2DA6 A;  3P9K A;  4M6X A;  2I5U A;  5TRD A;  2R92 J;  1HW2 A;  4L9J A;  1ZG1 A;  4BDZ A;  4W97 A;  4EEF G;  5M5X J;  1RES A;  2DOF A;  2E1N A;  3IH4 A;  3DEW A;  3JRG A;  3IKV A;  4BQQ A;  4OOI A;  3DKW A;  4FE7 A;  3OL3 A;  4S0H B;  1MH3 A;  4A6D A;  2DMQ A;  2YSR A;  5D5X B;  3G71 I;  2AO9 A;  4I76 A;  4XRS G;  3E5X A;  4KNY A;  1TL8 A;  2O61 A;  2YU3 A;  2CRG A;  4PJ0 C;  1RNL A;  1WRJ A;  1IV8 A;  4S05 A;  3G2B A;  1OLT A;  3L1P A;  2K27 A;  1R6R A;  5AIP A;  2IXS A;  3J81 Z;  1YHQ I;  4HNT A;  1X3U A;  2QZ8 A;  5C44 J;  2EA2 A;  3ZQF A;  1WI3 A;  1P92 A;  1CF7 A;  4IHV A;  2HDD A;  2WAD A;  4L5J A;  4MFE A;  3LMM A;  1VQ6 I;  5J3L A;  1V5E A;  4G94 A;  1I27 A;  3RPQ A;  1E2X A;  2K9S A;  2BYV E;  2QWW A;  2XF6 A;  3CF5 F;  3OYJ A;  2XRN A;  3CC7 I;  1DU6 A;  1G4D A;  4PDK A;  4EM0 B;  2A5W A;  2EA4 A;  1LDD A;  1JI8 A;  1APL C;  2EH3 A;  4UVB A;  3AL0 B;  3HOU J;  3HL2 A;  2P7V B;  2DYR H;  1T56 A;  1DGR M;  2DO7 A;  4FTH A;  3QU3 A;  2EIJ H;  3I59 A;  1ON1 A;  1G59 A;  1YLF A;  3T8T A;  1NK3 P;  3I58 A;  1YRN B;  4EAT A;  1USS A;  3T8R A;  1J75 A;  3KP6 A;  3FHZ A;  1Y8R B;  2QYO A;  3NAU A;  4DYR A;  2PMZ N;  1JUS A;  2A69 F;  2XGC A;  3FM5 A;  3OYB A;  1DDN A;  3FBI B;  3M8E A;  2E19 A;  1BW5 A;  5ICG A;  3G73 A;  3CDH A;  2J5O A;  3S2D J;  2L9S A;  1IRX A;  3ZQQ A;  3CLQ A;  4ZDO A;  1HSJ A;  5HDG A;  2QBY A;  4M6Y A;  5E1Z B;  5FGM A;  5KAF C;  3DEE A;  1Z6R A;  3R60 A;  2DDA A;  3GWZ A;  4V2F A;  4BYY A;  1H0M A;  1O7L A;  4X1E A;  3RYP A;  4PGG A;  1K61 A;  2EWN A;  2XKO A;  4HA8 A;  3VYR B;  1EJ9 A;  3LSH A;  5DS9 A;  2QM3 A;  2V1U A;  2VUM J;  2F5V A;  5E8I A;  4NB5 A;  3ERE D;  3C2G A;  1AKH A;  5J4Y A;  2KKO A;  3B6A A;  3IHU A;  2J5P A;  3E7L A;  3W6K B;  1E3P A;  3AKZ A;  2VPL A;  4F93 B;  1TQP A;  2BBY A;  4HQM A;  4RAY A;  2ZCW A;  3KP3 A;  5F04 A;  1ZRD A;  1Y0N A;  4OIN F;  5FFZ A;  4L5I A;  2AS5 F;  2STW A;  1FBQ A;  5FRM A;  3QPS A;  3OS2 A;  2VB6 A;  2ELH A;  4IRI A;  2JA8 J;  2W57 A;  3EUA A;  2M5W A;  4CCO A;  3JRB A;  2MW8 A;  2XGX A;  5D4S A;  1LDK B;  3E6B A;  2YX7 A;  1S7E A;  4UXN A;  4HNV A;  2VQC A;  1IXS B;  2EFW A;  4P96 A;  3BCB A;  3IP4 B;  3F0C A;  1PVE A;  1QU3 A;  3PSI A;  2L9R A;  3OYN A;  3L7W A;  4HEA 2;  3JAM Z;  3I5U A;  4KA4 A;  2BY0 A;  1TNT A;  1O57 A;  1SD4 A;  1YW8 A;  4PFP A;  1XC5 A;  1ZEL A;  2KIF A;  2VOO A;  3I54 A;  4Y4R A;  3FMR A;  4PFO A;  4YG2 F;  4EGZ A;  3FK6 A;  4OAZ A;  4XRM A;  2EV5 A;  2H94 A;  2JA5 J;  2VIX A;  3K1M A;  4D1Q A;  2EV0 A;  1ZKG A;  2VON A;  3K7A J;  5BNG A;  5A2Q K;  4C3H J;  3ECH A;  4RM3 A;  1JGG A;  1JKO C;  3A4C A;  4HW0 A;  1ZR4 A;  1T08 B;  2E60 A;  3WGG A;  2IAI A;  3K1N A;  2KT0 A;  2K40 A;  2DFI A;  1O3R A;  3PUF A;  2F4M B;  4MO7 A;  3K4B A;  1FTZ A;  5BMZ A;  4BBS J;  4XID A;  5IP7 J;  4GCV A;  3DLL F;  3B02 A;  5JLW A;  3D0S A;  1IUF A;  1QQI A;  3FXJ A;  1EH6 A;  1X58 A;  3HM5 A;  2VT3 A;  4ZDP A;  2UUZ A;  4I0A A;  4IHS A;  3H3V K;  2K86 A;  3FXR A;  5ICF A;  5H2F C;  3M8F A;  3LL7 A;  4RAF A;  2COM A;  1Z91 A;  2PMH A;  2ZXW H;  4D5F A;  2BOL A;  2CG4 A;  1A04 A;  5B5E C;  3L2V A;  2Y0S A;  2BXY A;  3HOT A;  1XB4 A;  3ABL H;  4LLL A;  1SFU A;  3SJM A;  1TW2 A;  2E35 A;  1PDN C;  1MND A;  2KZV A;  3MMY B;  1R1V A;  5LHH A;  1MDM A;  2QA4 I;  2O9L A;  3WTV C;  2GM4 A;  2ZFW A;  3T5X A;  3HOX J;  1YJW I;  2IRF G;  5HNH A;  4BEH A;  2CUZ A;  1BJZ A;  1QPI A;  4CCN A;  1D5V A;  3FM3 A;  2F6C A;  3PNV A;  3WTY C;  4XRF A;  2V6E A;  4FAS D;  1LDJ A;  1YYV A;  4AD9 A;  2HTS A;  4UVC A;  1MMD A;  2NOJ B;  3FXK A;  5IP9 J;  2DCE A;  2RAE A;  3HZJ A;  2DA2 A;  2MSY A;  3I9V 2;  4RB1 A;  4XR6 A;  5H6Q A;  3OOU A;  2P5L C;  2M30 A;  4EJV A;  3QPL A;  1T0F A;  2GOX B;  4OIO F;  3Q3S A;  2CQ7 A;  1WJC A;  2E1M B;  1IXC A;  2E7X A;  3AG4 H;  3OY9 A;  1CF7 B;  1OCZ H;  3RJP A;  1BI1 A;  2NVU B;  3HRS A;  1XMX A;  1OR7 A;  2MH9 A;  1IDZ A;  1WHU A;  2DPU A;  2VQG A;  4GFB A;  2QQ9 A;  4UUS A;  5L3D A;  2RKH A;  1B4A A;  2R93 J;  2ICW G;  3RQI A;  2GOM A;  1SD5 A;  3K1P A;  4IHX A;  2VQL A;  2X6W A;  5E18 F;  3KLN A;  4EM1 A;  5GAD J;  3BY6 A;  4UUT A;  2R5Z A;  5LGN A;  4L9T A;  3RCO A;  5L3G A;  2LY2 A;  1PUF B;  5J8C A;  1JHF A;  2Z5U A;  1WI9 A;  4U87 A;  3I59 B;  5FFX A;  2DXI A;  4CIC A;  4ZYD A;  3GVA A;  3S2W A;  1M1E B;  5J40 A;  4KN4 X;  3ZMV A;  2B7E A;  4A0Y A;  4YRV A;  4TV7 A;  2E2I J;  1B72 B;  3BDD A;  5LD2 C;  2DFF A;  2E2H J;  2K3F A;  3K9T A;  4A3I J;  1UG0 A;  4LFU A;  1B6A A;  1ITY A;  9ANT A;  1LEA A;  2QEN A;  2E1C A;  1MNE A;  5EGO A;  2JSC A;  2W1O A;  4BS9 A;  4RGS A;  1WJ5 A;  3S16 J;  2NAZ A;  3MZ8 A;  1HXD A;  4G6T B;  3QAH A;  3A01 A;  3KZY A;  3TBI A;  1BI2 A;  1BA5 A;  1IDY A;  1FTT A;  1O3S A;  2V1N A;  1DU0 A;  1HBX G;  4M3G A;  4HX8 A;  2DMN A;  1G6N A;  3FIS A;  4F52 A;  3A03 A;  3V7C A;  2XSD C;  3HOS A;  3DTI A;  2CGP A;  2NS7 A;  2LLK A;  1AKH B;  4XLP F;  1F43 A;  5FLM J;  3VYU B;  5GTI C;  1N75 A;  3E6C C;  1MSF C;  3D5L A;  2FBI A;  1FP1 D;  3KLO A;  1X4O A;  1Z6T A;  2OD5 A;  3GFI A;  1ULY A;  2Y9Y A;  3KP4 A;  5FO5 A;  4RGU A;  2HVS A;  4ZC3 A;  2H8W A;  1LVA A;  4AC0 A;  2DK8 A;  3HKZ N;  3WHB A;  3CJN A;  3FXM A;  1ETY A;  2WAQ N;  3BQZ A;  3DKX A;  5F0C A;  2M9H A;  2XVC A;  1YX5 A;  4Y7N J;  2L7K A;  3ABU A;  2HFH A;  4OIQ F;  2OCC H;  2B9S A;  1ETX A;  4Y33 A;  2V6C A;  1OR7 C;  4KYW A;  2IS4 A;  3SDB A;  2HQR A;  1SVO A;  1OYY A;  4KIT B;  3S3M A;  1TZL A;  4E7L A;  4M6V A;  3ABT A;  2EZL A;  4LIU A;  3IH2 A;  4F3Q A;  2W00 A;  2HQ5 A;  3E6D A;  4AYB A;  3FHN A;  4KT5 C;  1PUE E;  1S3J A;  4AIH A;  4LG0 A;  2MD0 A;  3S17 J;  4MHG A;  3JTG A;  4J19 A;  5K7H A;  2A6H F;  1RET A;  1VFC A;  4HF2 A;  1IGN A;  3BR0 A;  5FLV A;  4YIF A;  4XN0 A;  1MIJ A;  5DM7 F;  5FD5 A;  2P5V A;  3TDU C;  2IS1 A;  3G3Z A;  3QPH A;  5BQT A;  3CLO A;  2DDB A;  1B8I A;  3EUH C;  2HI3 A;  4RGX A;  2N8G A;  3HGG A;  3EYY A;  2VI6 A;  2EFO A;  4JQF A;  4Q5S F;  2F48 A;  1YI2 I;  2IP2 A;  4MEY F;  2E36 A;  5J6X A;  1Z3X A;  3HTS B;  4EJT A;  4UB8 C;  3O2P E;  5FKO A;  2R5Y B;  1D0X A;  2D2W A;  2X6X A;  5HVQ C;  1S8N A;  5D5V B;  2IGK A;  1H89 C;  2VXD A;  3V4G A;  3OYH A;  4RGR A;  4Z6Y A;  4MTD A;  3VOE A;  3RDI A;  2W82 A;  4BY1 J;  2Q0O A;  2WC2 A;  4I09 A;  4G9Y A;  4O6J A;  3ZMT A;  4FX0 A;  3DQV C;  2NS0 A;  3GTP J;  2VBZ A;  3GZ5 A;  3HSE A;  1FNN A;  1YJN I;  2K4J A;  1B1B A;  3WOD F;  1MDM B;  3S1N J;  1JTX A;  1YW9 A;  2R3S A;  1BIB A;  4M9S A;  5JVG F;  5M5W J;  4H0E A;  2FOW A;  4IHT A;  3EYI A;  3LSI A;  3F8B A;  1ZAR A;  3D1N I;  3IAS 2;  4EGY A;  1FOW A;  3MKY B;  2KZG A;  3WGI A;  4L0Z B;  3BJO A;  1YE9 A;  3KZI C;  3GF2 A;  4A3J J;  4YEJ A;  2X4H A;  5B1B H;  5JHF A;  1X1B A;  2HPI A;  1XGM A;  3K70 D;  4WWC A;  1FY7 A;  3CUQ B;  5GP9 A;  1F5T A;  2D1V A;  3M3Y J;  1I39 A;  1KU2 A;  3FF5 A;  2PJR A;  2DQR A;  1WJE A;  2ZME A;  1U6G A;  4LJZ F;  2QGU A;  2E7W A;  3VYT B;  3I53 A;  3WHC A;  4XRS A;  2EPF A;  4EJO A;  2D45 A;  3ZXS A;  2F4O B;  3MN2 A;  4Q48 A;  4KMU X;  3LFU A;  4IRG A;  2DAO A;  4QPQ A;  4HLY A;  3HUG B;  2LRE A;  3MZY A;  3KX2 A;  1GVJ A;  3JRE A;  4UV9 A;  4FQG A;  1W0T A;  1Z7U A;  4ESJ A;  4ESB A;  4UY8 I;  2R7O A;  1WSU A;  2R7T A;  2YR2 A;  2JA7 J;  1RIO H;  4GDF A;  3CP2 A;  1EV7 A;  1W36 C;  4HOB A;  3OL4 A;  4M3F A;  1HDP A;  2M34 A;  3H3U A;  3DTK A;  2ECB A;  1GV5 A;  2ZJ2 A;  5CQG A;  3H0D A;  3TO6 A;  1LE8 A;  4BY7 J;  5HLT A;  1V5G A;  3CCR I;  3H3Z A;  4FT8 A;  1VQO I;  4A5N A;  2OQG A;  2QKL B;  3BZ6 A;  5EEA A;  5EGO B;  5CVR A;  1BBY A;  3A01 B;  1STZ A;  1MMS A;  4XL9 A;  1FPQ A;  3KFW X;  5KK1 A;  4CYC B;  2R7U A;  1WWX A;  3K4C A;  1BI0 A;  1FSH A;  1IRG A;  3V7S A;  3RTR A;  2H6C A;  4L5E A;  5D8L B;  3BR5 A;  3ESW B;  2P81 A;  1W5T A;  2XAJ A;  4IF4 A;  1JKQ C;  2L0K A;  4E4H A;  4I2O A;  1U9N A;  1IV6 A;  2DLL A;  4KMF A;  4XSZ F;  5E3O A;  1W4M A;  1BR2 A;  2DT7 B;  4Y17 A;  2H1L A;  2HS5 A;  2FML A;  1F9N A;  1U8B A;  4H4K C;  3JR9 A;  1ZGW A;  5A2Q Z;  2FQ4 A;  3KYC B;  3BJ6 A;  1BC8 C;  4DYQ A;  3HOW J;  4IHW A;  2GXG A;  3LA3 A;  1R5G A;  5DYM A;  5IYB J;  1QZY A;  5GTH C;  5EEH A;  3LSR A;  2STT A;  2BY3 A;  2YX4 A;  2EZK A;  1H88 C;  4CXF A;  2IT0 A;  4L18 B;  5HDK A;  1PJR A;  2KIS A;  3N4M A;  5K5O A;  3FK7 A;  2OTJ I;  5CPR B;  4IOA F;  4HG2 A;  2E5Z A;  2VKD A;  3C2B A;  2Z33 A;  4BGD A;  2M7A A;  3S15 J;  1U3E M;  2DA7 A;  4PSX A;  2M45 A;  5DCM B;  1B9N A;  4CZC A;  2ZKZ A;  4IPA A;  1R7J A;  1H8A C;  2PG4 A;  2R7F A;  1TT0 A;  3MCZ A;  4HV6 A;  2OCE A;  5DD4 A;  5J1R A;  3C2H A;  3CJR B;  4OIR F;  3PJR A;  2GLO A;  3PUB A;  2FX0 A;  1KZH A;  4LG0 B;  1UJ8 A;  1WH7 A;  3NEU A;  2EQR A;  3H92 A;  3OR2 C;  1ZK8 A;  4NC8 A;  3HRU A;  3K4J A;  3GLL A;  4BDY A;  2EIM H;  3WE2 A;  1ETW A;  1I5Z A;  4HQE A;  4JBA A;  1B8I B;  3OYL A;  4XK4 A;  2ETH A;  2CQN A;  4LD5 A;  4XOR A;  2L9V A;  3CQZ J;  2ZB9 A;  4RM2 A;  4DOZ A;  1UST A;  3F8C A;  3S93 A;  1KQ0 A;  1W5S A;  1TC3 C;  2A5Y B;  2M8E A;  1P4A A;  3EUK L;  1DP7 P;  2FSW A;  1JT0 A;  3L00 A;  3SDG A;  2H8R A;  2BZT A;  4C2M J;  1ACI A;  1P2F A;  3L9F A;  3LWF A;  2Q2E A;  2BVM A;  4DZP A;  4C3I J;  1HCR A;  2Y0S N;  5J1Y A;  2LY9 A;  2M2E A;  1QA6 A;  3ELK A;  4M74 A;  1TLH B;  2Z2S B;  3BR2 A;  3HOY J;  5K7F A;  1D1B A;  2XPW A;  3SQN A;  2QQA A;  3E5Q A;  3K6G A;  1ZLK A;  1GVD A;  2IA1 A;  4XQF A;  2MBF A;  3WTT C;  3IWZ A;  2LKS A;  2LYC A;  4Y13 A;  5ILU A;  3TO9 A;  2ESH A;  2ME0 A;  3W2A A;  4OWR B;  1X1D A;  2ELK A;  2K7L A;  2KJC A;  2XAF A;  4GYI A;  2VE8 A;  3ULQ B;  1T38 A;  1OJL A;  1CGP A;  3O3K A;  3K10 A;  2GIZ A;  3K4L A;  2VT2 A;  3O8G A;  5IY5 H;  2R7X A;  4OIP F;  1R49 A;  2VKE A;  2ZXH A;  4BKX A;  2LDU A;  1KQ8 A;  2PN6 A;  2G0E A;  2HXO A;  2V9P A;  2WV0 A;  4KIC A;  4AVP A;  4E7Z A;  1UHM A;  5FLX K;  1XMK A;  3N05 A;  2ZFU A;  3OV8 A;  1R71 A;  1BOB A;  1FZP B;  3LSJ A;  3OYA A;  4IZZ A;  3ZQL A;  2QCO A;  1ZH5 A;  1K4T A;  1OKR A;  1ODD A;  2PBI A;  2P8T A;  1JJ8 C;  2PJR B;  2NXN B;  2F2E A;  3I4M J;  3U9G A;  3S1R J;  2JUG A;  2V26 A;  3C18 A;  5J4V A;  1XSV A;  3CCY A;  4FX4 A;  2A05 A;  3VYS B;  4G7H F;  3OYK A;  1DQU A;  5LRR A;  2LSO A;  2GXA A;  4IJA A;  1R5H A;  5TGT A;  4HF1 A;  2QSF X;  1K4S A;  3WGH A;  1LKX A;  3AG1 H;  2ISY A;  3DTE A;  1IN5 A;  2EZI A;  3ZQH A;  3M1E A;  3K2Z A;  2MAB A;  1Q1V A;  2UZK A;  4HSR A;  2K85 A;  4XNF A;  1T98 A;  4I01 A;  5FRN A;  5B3S H;  4HPQ A;  3TKY A;  4BAY A;  3IV5 A;  4KIF A;  4ABZ A;  1ZAO A;  4OU0 A;  3CDI A;  4NQW B;  2LD5 A;  3K70 C;  2M3A A;  1VI0 A;  1IRF A;  3AG2 H;  3RZD J;  2L3D A;  3KP7 A;  5EDN A;  1JXS A;  4EQQ A;  4DNC A;  1XGO A;  1U78 A;  2JA2 A;  3LSK A;  3JTH A;  3MD2 A;  3OYF A;  3B6C A;  4A0Z A;  4Q4Z F;  4L0Y B;  1ZTR A;  3H5R A;  4IX7 A;  3F6O A;  3KP2 A;  1V3F A;  1GXQ A;  1QRY A;  3VB2 A;  2KQR A;  4PJL A;  1FBS A;  4E7H A;  5LFA A;  5F0H A;  1R5I D;  1RUO A;  2H27 A;  2QUF A;  3I3L A;  1IUY A;  4LG3 A;  2XAS A;  5F0F A;  2YUS A;  1HST A;  1WJF A;  2P6S A;  1VQN I;  1K6O A;  2DT6 A;  3A02 A;  2XC7 A;  3HOV J;  3KYL A;  1G8X A;  4LB6 B;  3S3N A;  4GGG A;  2VAS A;  3H9G A;  1SD6 A;  5DV5 A;  1MBJ A;  3HPH A;  1ZG3 A;  4KDP A;  1I1S A;  5TJJ A;  1IN6 A;  4BJT A;  2GZW A;  3WE3 A;  3KIO A;  2XHK A;  2L9N A;  3ABK H;  2LG4 A;  4PGH A;  1FMV A;  4A12 A;  2CV2 A;  2M0M A;  5HLI A;  3WTX C;  4IO9 F;  1SMY F;  3F9K A;  3BT9 A;  5KCM A;  2ELJ A;  4CCL A;  4G6D A;  1XSX A;  3GFJ A;  4M71 A;  3LAJ A;  2HGC A;  5FKM A;  3F3X A;  2CU7 A;  3TW6 A;  1MJA A;  4XLH A;  3ASN H;  2CWE A;  3H0G J;  1ZLJ A;  2HZD A;  1VF9 A;  1MBG A;  1ZYR F;  3J7A Y;  2ME6 A;  4JX4 A;  2BXZ A;  5F08 A;  2JRT A;  1TW3 A;  4LK1 F;  5BS6 A;  1X1C A;  3KZZ A;  3C3W A;  4BJ6 C;  4P9U A;  4A3K J;  1U5T C;  3MZH A;  2GBY A;  3J7Z I;  2CYY A;  1Q1H A;  2CQX A;  4AYB N;  3QYB A;  3ZN1 A;  3TO7 A;  3PM1 A;  1WKM A;  2AQE A;  1OCT C;  3JRD A;  4YEL A;  2FBK A;  2L5Q A;  3A0H C;  2FJ1 A;  1T2K A;  4P5O A;  4HZF A;  1VQM I;  3VPR A;  5JR3 A;  2MC3 A;  2R0Q C;  3R4K A;  4LLN A;  2B63 J;  1J9I A;  3F8F A;  4QSH A;  1W7P D;  2V1X A;  2X1D A;  4CH7 A;  2G9W A;  4Y52 J;  2K9N A;  1I3A A;  2F5E A;  4B44 A;  4IOC F;  3RZO J;  1JT6 A;  4PK4 A;  1VQL I;  2Z99 A;  5B1A H;  4MNU A;  2A3S A;  2NS8 A;  2O0Y A;  2ZSI B;  1QZE A;  2BHY A;  3KE2 A;  3CCU I;  4WX9 A;  1PYV A;  1VQP I;  4GYG A;  2LP0 A;  1FX7 A;  2KRF A;  2RC4 A;  3JRC A;  4R79 A;  3LA2 A;  1YX3 A;  3HIF A;  3RIR A;  1BI3 A;  2JSP A;  1R1T A;  3L2C A;  4RLQ A;  4HV5 A;  4RLF A;  2M4G A;  3CJT B;  2QKM B;  1X3Z B;  3I4N J;  4J00 A;  1F4K A;  2Z3Y A;  4CSW A;  1P9Q C;  4WXD A;  1S6L A;  1VZ0 A;  4LOC A;  3BG9 A;  4ETS A;  2XAQ A;  2TCT A;  2MLK A;  4XM3 A;  3ZMD A;  4PJN A;  1S7A A;  2VOP A;  1W36 D;  2QF7 A;  2HQA A;  3P9I A;  1QZZ A;  2XDV A;  2BY2 A;  2DQL A;  1SVM A;  4A6E A;  4RBO A;  4HDV A;  1SFO J;  3KP5 A;  2QSH X;  1KYZ A;  5ICE A;  1LB2 A;  5IOZ A;  2LK2 A;  3QU6 A;  4A3F J;  2L01 A;  2EV6 A;  4HLX A;  4ZDL A;  5GPA A;  1E3H A;  1MBF A;  3LAP A;  2ZJP F;  2L2O A;  4M9Z A;  2WY8 Q;  4ENN A;  2A07 F;  3BG6 A;  1ORK A;  4GRI A;  5IPA A;  4CHU A;  3S3O A;  2QLZ A;  4MQ9 F;  3PO2 J;  3HSR A;  2LC2 A;  2VKH A;  1A5J A;  1EH8 A;  1SAU A;  2DFE A;  3K69 A;  1R58 A;  4B3A A;  4HDU A;  3PSF A;  1JJ6 C;  2K3P A;  3NWT A;  2VBW A;  3GX4 X;  1TWF J;  1SC7 A;  1WVR A;  5E8G A;  2OTL I;  2GXB A;  3HEF A;  3EUH A;  2AXL A;  3M8J A;  1Y1V J;  4HF0 A;  4R1H A;  2DOD A;  4D5C A;  4UUV A;  1V4R A;  1XGS A;  2W24 A;  2OBP A;  3FKJ A;  1OCO H;  1MJB A;  2V1D A;  5LGU A;  2QBY B;  2CUF A;  3E3V A;  4YII A;  3RKQ A;  4RA2 A;  5H20 A;  3I0T A;  4E6K G;  2M8G X;  3DU5 A;  4A3C J;  1E0E A;  1RC9 A;  4B4C A;  4IEJ A;  3J80 Z;  2HNH A;  1GDT A;  4FIS A;  3CMY A;  1ETV A;  4M3E A;  1H9G A;  3COA C;  3GTL J;  2DT5 A;  2LBF A;  2P6T A;  4UHT A;  1ERD A;  4CCK A;  3N97 A;  1YFH A;  3L2Q A;  1ZR2 A;  4A3D J;  4JK1 X;  3M07 A;  4DBR A;  3G4S I;  4FHT A;  2AXT C;  1QVU A;  2ZJQ F;  2JK3 A;  1IXR C;  1HLV A;  2WTE A;  1WZ2 A;  1XD7 A;  1HW1 A;  4XON A;  1REP C;  1IF1 A;  3KYD B;  3PNY A;  1VQK I;  2RQQ A;  1I3Q J;  2UV1 A;  3EET A;  2P5K A;  3UR3 C;  5J8F A;  2UWM A;  1W7P A;  2QQB A;  2WAF A;  3HHH A;  2H1K A;  3CCL I;  4JP0 A;  1ETK A;  1QO0 D;  2K02 A;  4F55 A;  4NNJ A;  3LFK A;  1J7K A;  1BW6 A;  2R7S A;  2V4J C;  3DF8 A;  3BJA A;  3BR6 A;  2A6T A;  1O7F A;  3MKW B;  4UVA A;  4CZZ A;  4U7B A;  1MMA A;  2EFN A;  2KL4 A;  1POG A;  3R0J A;  3M9A A;  3QWL A;  3ZMS A;  3BC8 A;  3CUQ C;  2HKO A;  5FB2 A;  3F8N A;  5GAH J;  1KU7 A;  2W48 A;  2X48 A;  4NC7 A;  3G1O A;  3HRM A;  3DBH B;  4CDG A;  1GLN A;  2M4K A;  4AVZ A;  4RAG A;  1XDU A;  3R61 A;  2DA5 A;  1OFC X;  1D8K A;  2ECC A;  2E34 A;  2KIQ A;  1FBU A;  2W85 A;  4II2 A;  2Y31 A;  3K4N A;  4HAM A;  5KAI C;  1O3Q A;  1XGN A;  1OYI A;  1QPM A;  3OYG A;  3OYE A;  1IZ1 A;  2FEZ A;  3BR1 A;  2VL8 A;  3DBR B;  2NVY J;  3DU6 A;  3CMM A;  5FKK A;  1UFM A;  5CKT A;  2IS2 A;  2NNN A;  3PFI A;  1MJ9 A;  4AM3 A;  3RSN A;  4E7I A;  4PCQ A;  4HST A;  2RDP A;  2VN2 A;  1Y0U A;  3ZQI A;  4I98 B;  1WQ2 A;  2EIN H;  2V9V A;  1AU7 A;  4EMS A;  2WB1 N;  1TQI A;  3GFL A;  3JW4 A;  1XG1 A;  4L9N A;  5LRS A;  2VE9 A;  5FLX Z;  5F1J A;  4BXF A;  1NH3 A;  1AHD P;  4FCY A;  3G1L A;  2E71 A;  4LLG F;  3ZMZ A;  2DPD A;  3SZG A;  2XSJ C;  3I55 I;  4XIC A;  3OSF A;  1ZG5 A;  1ZGA A;  4BEH B;  3FXQ A;  2HYJ A;  3WU2 C;  2O8X A;  1VQ9 I;  3W2V A;  2JQ7 A;  2YS9 A;  5FKN A;  2RNG A;  4I6Z A;  5CVU A;  3H5N A;  3QP5 A;  2VQH A;  1D1C A;  5IT9 K;  3G6E I;  1BR4 A;  1UMQ A;  2LMD A;  1JHH A;  4U7D A;  2DN0 A;  2DYS H;  2RNJ A;  5EZG A;  5GAE J;  3GW2 A;  1P7I A;  1TP4 A;  1D8J A;  4XLE A;  4BQO A;  1DPU A;  3BPV A;  4CA0 A;  2HDC A;  2XAU A;  2I10 A;  4N9H A;  1SFX A;  2DJI A;  4M73 A;  1OCC H;  5E79 C;  4DIQ A;  1IJW C;  2IGM A;  1LFU P;  1YJ9 I;  2DW4 A;  3NAR A;  4CCJ A;  4UUS B;  4RDU A;  4HX4 A;  2HZT A;  1J09 A;  2GQQ A;  5KHD A;  3IRQ A;  3CO6 C;  3NWS A;  3C7J A;  3MEX A;  3TGN A;  3OS1 A;  2XB5 A;  2XUB A;  3OYD A;  5LGT A;  3RI4 A;  2Y9Z A;  1BL0 A;  1HOM A;  4F92 B;  2R5Z B;  2JT1 A;  5DD8 A;  1D0Y A;  4C2U A;  1O3T A;  2C6Y A;  2GIV A;  4OAY A;  4DJA A;  3S1M J;  3M1C A;  3BLY A;  4XKC A;  2EIL H;  1MZB A;  3GEZ A;  5GAG J;  1SAX A;  2Y30 A;  1YRN A;  3S1Q J;  1U8R A;  1LPQ A;  3BTL A;  3W3C A;  5L3C A;  3GTQ J;  4B43 A;  4N0B A;  4BQN A;  2VOD A;  1AA7 A;  1WJA A;  3HGY A;  2PMU A;  3AG3 H;  1NTC A;  4I0B A;  2IA0 A;  3FKI J;  3S14 J;  1EKE A;  2NYX A;  4GXO A;  2FBH A;  1ZGJ A;  2NVQ J;  2X1E A;  1GHC A;  2NNY A;  3SZT A;  5JVT A;  2VJ4 A;  3H36 A;  1FYM A;  5EG0 A;  2JVG A;  2COB A;  1B59 A;  5IT3 A;  2HYG D;  4R8H A;  2TRT A;  1BR1 A;  4ZYA A;  3H9J A;  3CZ6 A;  3CTA A;  4A69 C;  1G3W A;  4YIR X;  2DFH A;  1MKM A;  3HHG A;  4YFX F;  5LBQ A;  1N25 A;  3PL8 A;  2ISZ A;  2CFO A;  3VWB A;  3A2K A;  5DDG A;  3H35 A;  4M3D A;  2G7U A;  3CUO A;  3QQA A;  2CV0 A;  2KHM A;  1FT9 A;  2K9L A;  4MQV A;  1D5Y A;  1WH5 A;  2IGN A;  3DEU A;  3PNT A;  4AIJ A;  1WJD A;  2OJE D;  5E17 F;  3LQR A;  3P5J A;  2O8K A;  3L09 A;  3J80 K;  1MMG A;  5BOX A;  4FE4 A;  2XGE A;  3PQK A;  2R7Q A;  1JKP C;  4JX5 A;  4BE2 A;  1HC8 A;  3ISP A;  2X51 A;  1E17 A;  3S2H J;  3SYT A;  2MD5 A;  4BHB A;  3IUO A;  4MTE A;  2FF4 A;  3BOQ A;  3I56 I;  1R23 A;  4XOP A;  2KLO A;  4IVN A;  5IOY A;  2FOK A;  4XKW A;  2OA4 A;  1SFK A;  3V7R A;  2OPT A;  1Z7L A;  1BC7 C;  3CC2 I;  4N4O B;  2R7Z J;  2XKP A;  4FET A;  2VBX A;  3DBL B;  4KT6 A;  2ACJ A;  5LHG A;  1S7O A;  2E5N A;  3DPL C;  3Q5F A;  2JRM A;  2XB0 X;  3D5S C;  1XS9 A;  1AOY A;  3F8M A;  3AL0 C;  2XPV A;  2GAU A;  3LSP A;  2P0W A;  4PJJ A;  3ZQC A;  4A3E J;  2K9M A;  1I6H J;  5ILS A;  4BAC A;  1P4X A;  1DP3 A;  2IEK A;  2P7C B;  2CQQ A;  2IVM A;  1N78 A;  2OAZ A;  1JKR C;  2LVS A;  4BQA A;  5M5Y J;  2GA1 A;  2H09 A;  1MW7 A;  3GO5 A;  3CF2 A;  3DPT A;  3IRR A;  1R22 A;  1MSE C;  3GTG J;  1XCB A;  3ZMU A;  4BU2 A;  2XGD A;  3HSF A;  3SHF A;  1X4P A;  4UB6 C;  1D1A A;  3PO3 J;  2XV4 S;  4BL0 B;  3LST A;  3J7A O;  3PFY A;  2WB1 A;  4I02 A;  1KU3 A;  1IN8 A;  3TL4 X;  3BPX A;  2PEX A;  1YO5 C;  2KDO A;  2OQR A;  4RB2 C;  4ENM A;  4CYD A;  1OMI A;  3FX3 A;  2BVL A;  2L4A A;  3ZGK A;  3FDY A;  3U21 A;  5K7Z A;  4KIG A;  5FD6 A;  2K4B A;  2NVX J;  5EF6 A;  1Z67 A;  3HXL A;  4A93 J;  4ZZL A;  4RB3 C;  2FUG 2;  6PAX A;  1B9M A;  3ECO A;  3VEP A;  2X6O A;  3DWL E;  1HKS A;  1P4W A;  2DTR A;  2X0L A;  2F4I A;  1XTA A;  1UAA A;  3BRO A;  3ASO H;  3GXO A;  1ZHF A;  1BOA A;  2BE5 F;  2M87 A;  1TTY A;  4WCG A;  3I4P A;  3LSM A;  1TWG J;  3PQJ A;  4PSW A;  3OYC A;  4NUB A;  5CVJ A;  1R00 A;  3ERM A;  3FXO A;  2CW0 F;  3CJQ B;  4G7Z F;  1A6I A;  2HOE A;  2EIK H;  2ZNZ A;  1G2H A;  3O6B B;  4XKV A;  5LHI A;  3OYM A;  2Q1Z B;  4DQ2 A;  2PFB A;  5LEJ A;  3HJE A;  3W6J B;  5EEG A;  3QPT A;  5HLH A;  3E6M A;  4ENK A;  4U0Y A;  1IAW A;  3GTJ J;  2LOO A;  1TBX A;  4C30 A;  5F1R A;  1X2M A; 
#chains in the Genus database with same CATH homology
 2NS8 A;  2WV1 A;  1RPW A;  1Z0X A;  2HOA A;  5C4J J;  4M6V A;  4V2G A;  2LP0 A;  2EZL A;  3IH2 A;  2FD5 A;  3JRC A;  2HQ5 A;  5IP6 A;  1MBE A;  2LKX A;  2JJ7 A;  1WPK A;  4B1R A;  4G12 A;  3Q0U A;  3S17 J;  3HOZ J;  4J19 A;  5K7H A;  5M3M J;  3I4N J;  3ZOB A;  2D5V A;  2DA1 A;  4QIW N;  1RET A;  1VFC A;  4A3L J;  3BTI A;  1PUF A;  1IGN A;  3BR0 A;  4LOC A;  5FLV A;  1IRZ A;  3BG9 A;  2TCT A;  3TW7 A;  1B8I A;  2HI3 A;  2QF7 A;  1FEX A;  1B72 A;  2N8G A;  1OCP A;  3HGG A;  3LNQ A;  4RBO A;  1SFO J;  2VI6 A;  3JRF A;  1WGX A;  3OSG A;  1MNM C;  1FIA A;  5JLX A;  1LE8 B;  5IOZ A;  1UHS A;  2L7Z A;  2LK2 A;  5FJ8 J;  1X2N A;  1U9O A;  1MH4 A;  1CQT A;  1HDD C;  4A3F J;  5FKO A;  2Y2Z A;  2R5Y B;  5GPA A;  1MBF A;  1LFB A;  1H89 C;  5EG0 B;  1K83 J;  1TWC J;  4BXX J;  3HBL A;  1QVT A;  2M0C A;  5HOD A;  4QTR A;  1TWH J;  1ORK A;  1HF0 A;  2CJJ A;  2IBD A;  5IPA A;  4BY1 J;  2L7F P;  2VKV A;  5F27 A;  2HXI A;  3PO2 J;  3M4O J;  1JTY A;  3GTP J;  1A5J A;  1IC8 A;  2EBI A;  2EZH A;  4W1U A;  5FKL A;  4B3A A;  3JRI A;  1JTX A;  5M5W J;  1JJ6 C;  3S1N J;  3SFI A;  1SAN A;  1TWF J;  2ID3 A;  2LR8 A;  3D1N I;  2NOG A;  2KDZ A;  3HEF A;  2HOS A;  1Y1V J;  1ETO A;  1FIP A;  4DZJ A;  2DTZ A;  4D5C A;  3HDD A;  1RR7 A;  4A3J J;  4D7M A;  4A3M J;  3OIO A;  2HOT A;  3GTM J;  2LFB A;  2CUF A;  3RKQ A;  2K9Q A;  2M8G X;  5GP9 A;  1P7J A;  2DA6 A;  4A3C J;  3M3Y J;  2E1O A;  4B4C A;  4IEJ A;  1GDT A;  2R92 J;  4FIS A;  3CMY A;  1ETV A;  4M3E A;  3WHC A;  4W97 A;  4EEF G;  5M5X J;  4XRS A;  1F36 A;  5C4X J;  1RES A;  3GTL J;  3MN2 A;  3IH4 A;  3DEW A;  3JRG A;  4FE7 A;  4S0H B;  1MH3 A;  2AHQ A;  2L7M P;  2DMQ A;  1ZR2 A;  4A3D J;  2AO9 A;  4I76 A;  3MVP A;  4XRS G;  3ZQG A;  3JRE A;  4X6A J;  1QVU A;  2JK3 A;  1HLV A;  2CRG A;  1W0T A;  3UKG A;  3L1P A;  2DMT A;  1IG7 A;  2OF7 A;  2JA7 J;  1I3Q J;  4M3F A;  1HDP A;  2M34 A;  2H1K A;  4JP0 A;  2ECB A;  1ETK A;  1GV5 A;  5C44 J;  1MBK A;  5DTD A;  3ZQF A;  1WI3 A;  5E3M A;  1BW6 A;  5C3E J;  1LE8 A;  4BY7 J;  4IHV A;  3BR6 A;  2HDD A;  4MFE A;  5J3L A;  1POG A;  2K9S A;  5EEA A;  5EGO B;  4D7N A;  2R5Y A;  2MG4 A;  1DU6 A;  3A01 B;  2W48 A;  2X48 A;  4CYC B;  3G1O A;  1APL C;  2EH3 A;  3LOC A;  3HOU J;  2DA5 A;  1T56 A;  1OFC X;  2ECC A;  4L5E A;  1GV2 A;  2DJN A;  3BR5 A;  2XRL A;  2P81 A;  4FTH A;  2Y31 A;  1ZQ3 P;  1R9T J;  1JKQ C;  2L0K A;  4MIM A;  1U9N A;  3W6V A;  1NK3 P;  1IV6 A;  1YRN B;  3BR1 A;  2LTP A;  5E3O A;  2NVY J;  3GTK J;  5FKK A;  3NAU A;  4MLO A;  1U8B A;  3JR9 A;  4DYR A;  2PMZ N;  1JUS A;  1VND A;  2XGC A;  4JX6 A;  1ZGW A;  2FQ4 A;  3BTC A;  1E3O C;  2E19 A;  1BW5 A;  4DYQ A;  3HOW J;  4IHW A;  2JA6 J;  3S2D J;  5IYB J;  3CDL A;  3ZQI A;  3LSR A;  1NK2 P;  1JUM A;  2EZK A;  1H88 C;  4V2F A;  1AU7 A;  3DCF A;  4X1E A;  2WB1 N;  1K61 A;  3FK7 A;  5IYC J;  2MGQ A;  3GBG A;  3C2B A;  1XG1 A;  5DS9 A;  5E3L A;  2VUM J;  3S15 J;  1WCM J;  2DA7 A;  1ENH A;  1AKH A;  1I50 J;  5F1J A;  1AHD P;  4FCY A;  1H8A C;  3B6A A;  3JRA A;  3G1L A;  3E7L A;  4IHY A;  3JRH A;  5J1R A;  2GLO A;  1EF4 A;  2FX0 A;  3BR3 A;  3MKL A;  4XIC A;  3OSF A;  2VPR A;  1WH7 A;  5F04 A;  2E2J J;  2EQR A;  2HYJ A;  1GT0 C;  1ZK8 A;  2YS9 A;  3QPS A;  5FKN A;  4I6Z A;  3BG3 A;  1T33 A;  2JA8 J;  1ETW A;  3JRB A;  1UMQ A;  2MW8 A;  2DN0 A;  5EZG A;  1S7E A;  1B8I B;  4HNV A;  1P7I A;  4XK4 A;  3F0C A;  2L9R A;  3CQZ J;  2I10 A;  2ZB9 A;  5EZH A;  1TC3 C;  1XC5 A;  1IJW C;  1LFU P;  1ETQ A;  3NAR A;  1JT0 A;  3SDG A;  4UUS B;  2H8R A;  1RKW A;  4RDU A;  4C2M J;  4CYC A;  4DYC A;  3FK6 A;  4XRM A;  4DZP A;  2JA5 J;  2NVT J;  4C3I J;  1HCR A;  2Y0S N;  1ZKG A;  5J1Y A;  2LY9 A;  2XB5 A;  3K7A J;  3TP0 A;  5BNG A;  2Y9Z A;  2M2E A;  1BL0 A;  4C3H J;  1HOM A;  5GPC A;  3BR2 A;  2R5Z B;  1JGG A;  3HOY J;  1JKO C;  1ZR4 A;  5E3N A;  5K7F A;  2XPW A;  2IAI A;  2KT0 A;  1GVD A;  3S1M J;  4M3B A;  2K40 A;  3IH3 A;  1YRN A;  3S1Q J;  4MO7 A;  2Y30 A;  3BTL A;  2ME0 A;  2DA3 A;  2ELK A;  3GTQ J;  1FTZ A;  1OJL A;  4BBS J;  3HGY A;  4XID A;  3O8G A;  1NTC A;  2ID6 A;  5IP7 J;  2VKE A;  3FKI J;  3S14 J;  5JLW A;  2NVQ J;  1IUF A;  4BKX A;  3GTO J;  2G0E A;  2HXO A;  1X58 A;  3HM5 A;  5EG0 A;  2COB A;  2X9D A;  3H3V K;  2JWT A;  4DW6 A;  2TRT A;  3LSJ A;  3Q0V A;  3ZQL A;  4D5F A;  1W0U A;  2QCO A;  4A69 C;  1JJ8 C;  3I4M J;  3S1R J;  3SJM A;  3CCY A;  4M3D A;  1Y1W J;  3QQA A;  1JUP A;  2O9L A;  1D5Y A;  1WH5 A;  2GM4 A;  1O4X A;  3HOX J;  2EZI A;  1BJZ A;  3BTJ A;  3ZQH A;  1QPI A;  2O8K A;  1Q1V A;  2O7O A;  4FE4 A;  2XGE A;  3IV5 A;  1JKP C;  4JX5 A;  5IP9 J;  4A3G J;  2RAE A;  4ABZ A;  4BBR J;  2DA2 A;  2LD5 A;  3S2H J;  2MSY A;  4NDL A;  1VI0 A;  3Q0W A;  4A3B J;  3OOU A;  5IOY A;  3RZD J;  3QPL A;  5M3F J;  5EDN A;  2OPT A;  3Q3S A;  1U78 A;  2R7Z J;  1Z77 A;  2YU9 J;  3B6C A;  2XB0 X;  1XS9 A;  1IDZ A;  1ZTR A;  4GFB A;  2DA4 A;  1QRY A;  4UUS A;  2XPV A;  5F0H A;  3LSP A;  2XPU A;  3ZQC A;  4A3E J;  2R93 J;  1I6H J;  3RQI A;  4IHX A;  3K2A A;  2IEK A;  5IYD J;  5EYR A;  5F0F A;  2CQQ A;  2YUS A;  4UUT A;  2R5Z A;  1JKR C;  3A02 A;  2LVS A;  1PUF B;  3HOV J;  5M5Y J;  4C3J J;  1MBJ A;  1MSE C;  3GTG J;  1GUU A;  5J1U A;  3LSG A;  2XGD A;  3G1M A;  2E2I J;  1B72 B;  3PO3 J;  2E2H J;  4A3I J;  3BT9 A;  2JN6 A;  1ITY A;  9ANT A;  3HB9 A;  1MBH A;  5FKM A;  2DMU A;  2CU7 A;  3TW6 A;  5EGO A;  3S16 J;  3H0G J;  3A01 A;  1VF9 A;  1MBG A;  1BA5 A;  1IDY A;  4JX4 A;  2ME6 A;  3FIW A;  5K7Z A;  2NVX J;  5EF6 A;  1FTT A;  5F08 A;  1DU0 A;  4M3G A;  4A93 J;  2DMN A;  3O8H A;  3TED A;  3FIS A;  3A03 A;  2X6O A;  4A3K J;  2GBY A;  4AYB N;  2CQX A;  2XSD C;  2JMW A;  3BG5 A;  2NS7 A;  2LLK A;  1AKH B;  1F43 A;  5FLM J;  3BQY A;  1FJL A;  3PM1 A;  1TWA J;  3TP3 A;  1OCT C;  3JRD A;  1MSF C;  1TWG J;  2FJ1 A;  2Y9Y A;  4JYK A;  1A6I A;  3VPR A;  2CUE A;  4AUX A;  1G2H A;  2R0Q C;  2B63 J;  1RKT A;  4QSH A;  4AC0 A;  3HKZ N;  3WHB A;  1ETY A;  2WAQ N;  4MFD A;  3BQZ A;  4Y52 J;  2K9N A;  5F0C A;  2M9H A;  4Y7N J;  1UG2 A;  3RZO J;  1JT6 A;  2DMP A;  1ETX A;  3GTJ J;  1X2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...