4A3IJ

Rna polymerase ii binary complex with dna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3iJ00
2QF7A 4CYCB 1Y1VJ 3TW7A 3S1MJ 1IG7A 2VPRA 1JUMA 2NVYJ 2LFBA 2DMQA 3BR0A 2XRLA 3RQIA 1YRNA 3HOZJ 1PUFB 2H1KA 5IOYA 5DTDA 2OPTA 1U78A 5K7ZA 3QQAA 3IH4A 2W48A 1IJWC 1D5YA 3CQZJ 3L1PA 1MH4A 2R0QC 3MKLA 4B1RA 2HDDA 3BR5A 1K61A 2E2IJ 1R9TJ 2B63J 2DMPA 3A03A 4W1UA 3Q0UA 4A3CJ 1ETVA 4V2FA 1Q1VA 3A01A 1K83J 5GPAA 4D5FA 1S7EA 1X2MA 2YUSA 4M3EA 5GPCA 1U9OA 2M2EA 4D5CA 1RKTA 4DZPA 4XRSG 3HOYJ 4MFDA 3TP3A 4XRMA 1ETOA 2XB5A 3PM1A 4ABZA 2I10A 1QVTA 5IP9J 1MBFA 2NS8A 2ECBA 4BY7J 3TW6A 2HI3A 3BTLA 1B8IB 3HOXJ 2NVXJ 1BW5A 3BR2A 1Z0XA 1ENHA 4BXXJ 2WV1A 3D1NI 3OSGA 5C4XJ 2KT0A 3S17J 1TWCJ 2VI6A 1BJZA 1ITYA 3HGGA 3ZOBA 1TWGJ 2L7MP 1OJLA 2GBYA 5F27A 3TP0A 3G1LA 4L5EA 4FTHA 3BTJA 1RPWA 4BBRJ 5E3NA 3ZQGA 5F0FA 4RDUA 1I50J 5F1JA 1LFUP 2K40A 5JLWA 2DN0A 2M34A 3O8HA 3GTOJ 3VPRA 1ETQA 1JJ8C 2K9NA 2X6OA 2XGEA 3I4NJ 3BR3A 1JKRC 2IEKA 1MBHA 2JJ7A 4DZJA 4C3JJ 1HDPA 2CU7A 4MLOA 2ME0A 3S15J 3HBLA 2WB1N 1TWFJ 4QSHA 5EDNA 4BBSJ 3OIOA 2E2HJ 4A3MJ 5F04A 3QPSA 2L9RA 2LR8A 1JKPC 2TRTA 4D7NA 2L7FP 1MSEC 1GV5A 1T56A 5GP9A 2GM4A 1QPIA 1ZQ3P 2PMZN 4A3BJ 2FD5A 1H89C 2DA6A 5E3OA 2DMUA 4QIWN 3CMYA 2CQXA 3FK7A 1WH7A 3HM5A 4W97A 5J1RA 1RR7A 2VKVA 4XK4A 3MVPA 1IDYA 2ECCA 1LFBA 5EEAA 5EYRA 3JRGA 2JA6J 1YRNB 1WCMJ 2E1OA 4M6VA 1P7JA 3RZOJ 1DU0A 2LP0A 5EG0A 1MNMC 1LE8B 3OSFA 5J1UA 1MBEA 5K7FA 5C44J 3S2DJ 3SJMA 3B6CA 4LOCA 5IP7J 1FTTA 5FJ8J 3K2AA 3W6VA 5M3MJ 1XC5A 3BR1A 1U8BA 2VUMJ 2XSDC 3UKGA 2JA7J 3PO3J 3GBGA 2IAIA 2FX0A 2HOAA 4B4CA 5FKKA 3WHCA 2NOGA 1ETXA 3LSPA 2JA5J 3MN2A 5J3LA 3HKZN 1JTYA 2IBDA 4G12A 1NK2P 4DYCA 1ZKGA 3HOWJ 4A3IJ 3IH2A 1MBGA 3BG3A 4AUXA 4A3FJ 2LY9A 3Q0VA 3JRBA 1HF0A 1RESA 1AKHA 1I3QJ 1TC3C 1WGXA 1A5JA 3C2BA 2O7OA 1POGA 3DEWA 5EGOA 3A02A 4D7MA 4M3GA 2AO9A 1VF9A 1RETA 2L0KA 4CYCA 2DA2A 4FE4A 2XPUA 2VKEA 4A3LJ 3G1MA 1FEXA 3GTJJ 5FLMJ 2R92J 5C3EJ 3NARA 2LD5A 1TWHJ 4IHYA 3JR9A 2EZIA 2KDZA 5E3MA 2O9LA 3GTLJ 1JJ6C 2G0EA 2MW8A 5JLXA 1IUFA 4B3AA 2CUFA 1H88C 3HOUJ 3GTPJ 3BTCA 2LKXA 2HOSA 3GTGJ 4MIMA 2DJNA 2GLOA 4A3JJ 2ELKA 4FCYA 1HLVA 1HDDC 2COBA 1P7IA 1QVUA 4DYQA 2TCTA 3GTKJ 3G1OA 2H8RA 3E7LA 2JMWA 4V2GA 3ZQFA 4X1EA 1HCRA 4UUSA 1F43A 5FKMA 2HOTA 5IYCJ 5F08A 5FKLA 2DA5A 5EZGA 9ANTA 4JX6A 2MG4A 3JRHA 3JRAA 2DTZA 5J1YA 1AU7A 4M3DA 3Q3SA 2LLKA 2FJ1A 2Y31A 3CDLA 3H3VK 5IYDJ 1B72A 5EF6A 4EEFG 1B8IA 3SDGA 2MSYA 3ZQCA 4A93J 4A3DJ 3Q0WA 1GT0C 1NK3P 2JA8J 2Y2ZA 1GUUA 2ID6A 3JRDA 1FIPA 4A69C 3FISA 3S1RJ 2XB0X 3BTIA 1RKWA 1ZTRA 2P81A 2NS7A 1HOMA 2EQRA 3JRCA 1H8AC 2DA3A 1O4XA 3M3YJ 3GTQJ 1BA5A 3BQZA 1VNDA 3B6AA 3LNQA 1XS9A 5F0CA 4GFBA 3HGYA 2NVTJ 1MBJA 2HQ5A 1NTCA 2DA7A 1VFCA 1W0TA 1WPKA 2Y30A 5M5YJ 1JT6A 5HODA 2R5ZA 3M4OJ 3BR6A 3A01B 5IPAA 3S1QJ 1AKHB 3ZQHA 1X2NA 4AC0A 1VI0A 1SFOJ 1I6HJ 3HB9A 4HNVA 3LOCA 1OFCX 4J19A 5EGOB 5DS9A 3QPLA 3JREA 1JTXA 1Z77A 4BKXA 2HXIA 1F36A 1IGNA 4MO7A 2R5YA 4Y7NJ 2E19A 1X58A 4IHWA 2DMTA 3F0CA 3FKIJ 1TWAJ 5K7HA 2EBIA 3OOUA 2LVSA 4IHXA 2N8GA 4JP0A 5C4JJ 3GTMJ 2L7ZA 3IH3A 4JX5A 3S14J 1G2HA 5EZHA 3S16J 1UHSA 1GV2A 1JUSA 1UG2A 3I4MJ 1JUPA 2EZLA 4AYBN 3H0GJ 1E3OC 3SFIA 4S0HB 1LE8A 2D5VA 4M3FA 1IDZA 4JYKA 1ZGWA 2O8KA 1OCTC 1ORKA 2X9DA 1CQTA 4IEJA 4UUTA 2LTPA 3TEDA 2YS9A 1QRYA 3S2HJ 2DA1A 4RBOA 5E3LA 2X48A 4I6ZA 2EZKA 2DA4A 3ZQLA 5FLVA 4X6AJ 2XGCA 1AHDP 5FKOA 2LK2A 4C2MJ 2DMNA 1ZR2A 3LSRA 4XRSA 4UUSB 1PUFA 2YU9J 4M3BA 4A3KJ 3JRFA 5M3FJ 5F0HA 1U9NA 4IHVA 1BW6A 2Y9YA 2ID3A 2M9HA 1W0UA 1MBKA 2M0CA 3BQYA 1B72B 3JRIA 1IV6A 1FIAA 1ETWA 2HYJA 5M5WJ 5IOZA 1A6IA 1UMQA 1WH5A 2EH3A 2ZB9A 2JWTA 1JKQC 3S1NJ 5IP6A 2NVQJ 3ZQIA 2XPVA 1BL0A 4XIDA 2Y9ZA 1IC8A 3BG9A 2XGDA 1ETKA 3FK6A 2RAEA 2EZHA 1MSFC 2E2JJ 1ETYA 2K9SA 5EG0B 4NDLA 3RKQA 1XG1A 1JKOC 1SANA 2M8GX 2QCOA 3HDDA 3HOVJ 1T33A 3IV5A 4I76A 3WHBA 2Y0SN 2R7ZJ 1WI3A 4C3HJ 2R5ZB 1ZR4A 3NAUA 4DW6A 2FQ4A 4QTRA 2WAQN 2R93J 2JN6A 3CCYA 1GDTA 4FISA 4Y52J 5BNGA 2AHQA 1FTZA 3HEFA 2XPWA 1MH3A 2OF7A 2ME6A 2MGQA 2CJJA 4MFEA 3LSGA 1ZK8A 1FJLA 2JK3A 4A3EJ 3BT9A 3DCFA 4C3IJ 3FIWA 2K9QA 2R5YB 4FE7A 1DU6A 3LSJA 1JT0A 1EF4A 2HXOA 5IYBJ 4A3GJ 2CQQA 3RZDJ 1APLC 4XICA 4JX4A 3BG5A 1Y1WJ 1IRZA 1JGGA 3K7AJ 4DYRA 5FKNA 1OCPA 2CUEA 3O8GA 5M5XJ 1GVDA 3PO2J 4BY1J 2CRGA
chains in the Genus database with same CATH superfamily
3LA7A 1LEAA 2WAQA 1ERDA 3K10A 1Y1VJ 2EFWA 1QZEA 2MLKA 2A61A 1RR8C 1IG7A 2DW4A 3S1MJ 2V1UA 2W00A 5BMZA 3OYFA 1HSTA 1FNNA 2XKOA 1R00A 2DMQA 1Z9CA 4HBLA 1PUFB 4WK8F 3DEUA 4YRVA 4M71A 1XPXA 4QLCU 1IJWC 2KL4A 2YX7A 1DQUA 1MH4A 3CZ6A 3MKLA 4L5JA 1KQ0A 2YU3A 1Z05A 2E2IJ 5H6QA 1R9TJ 4MEYF 2OZ6A 1YE9A 2OAZA 3SZTA 1ACIA 3Q0UA 4M9ZA 4A3CJ 1RIOH 4XKBA 2QBYB 1Q1VA 1PUEE 2KP6A 3A01A 3MEXA 1K83J 2QUFA 2XAQA 3HRTA 4F52A 5HLTA 2GWRA 5LGUA 1B9MA 3LSHA 2YUSA 2W57A 2CQNA 2VC0A 2BBYA 1IXSB 3ZMDA 1YJWI 4XRSG 4CH7A 3WTUC 2XV4S 5CQEA 4MFDA 2VE9A 2W85A 2Q2EB 3L00A 4ABZA 1QVTA 3ISPA 3K4BA 2IXSA 3TW6A 1OMIA 2HI3A 3BTLA 4M9SA 3HSFA 3HOXJ 2NVXJ 1BW5A 3BR2A 3GVAA 1ENHA 2WV1A 2C6YA 1M1EB 4EV0A 1GXQA 2H6CA 3S17J 3EUAA 2EIKH 2FF4A 5GAHJ 2XAFA 5JI6A 1HC8A 4AWXB 1SVMA 2RC4A 5F27A 1SVLA 1WJ5A 2P8TA 4L5EA 4FTHA 3K0LA 4BBRJ 3OOPA 5F0FA 3GW2A 1U6GA 3W3CA 5DYMA 3ZQQA 2DOAA 4IRHA 1KU9A 3L2RA 1KA8A 4HAMA 3E1SA 2DN0A 1I3AA 2M34A 1KU3A 3O8HA 1G3WA 3FHNA 5E79C 3E6DA 2FNAA 5FO5A 4RGSA 3ABKH 5FGMA 3LA3A 3M8JA 1MBHA 4HG2A 3WG7H 5A2QZ 4P9UA 1WKMA 3RSNA 2QKLB 3HTUA 4AD9A 3IWZA 4KMFA 1HBXG 3WE3A 2VBWA 2IGKA 2ZJ2A 5HLGA 2XF7A 5F04A 2DPUA 2L9RA 4EM0B 2HVQA 2L9SA 3C1DA 3OYDA 3MKYB 2VODA 2KIQA 2L7FP 1T56A 3AKZA 2BOLA 1I5ZA 2HWVA 1P4XA 3OYKA 1EH8A 2E36A 1H89C 5FB2A 4BDZA 5B3SH 3WGGA 4QIWN 4KJZA 3CMYA 1KU7A 1WWXA 2EFNA 2WAEA 1D3YA 1Z7LA 1W5CC 1RR7A 3MVPA 3KEYA 2ECCA 4GRIA 1ZLKA 2OC6A 2KIFA 1LFBA 3RKYA 2Y75A 5EEAA 1I27A 4HQEA 2BXYA 2R7QA 4RAZA 3FKJA 1SFXA 3T8TA 4FX4A 1LE8B 2LRDA 4BHBA 1UZCA 1WFXA 4E70A 1W7PD 3S3MA 3WTSC 1MBEA 2JVGA 1S72I 3KP6A 4N9HA 3SDBA 4CCJA 3K2AA 5M3MJ 3BR1A 4MQVA 1ZG3A 3UKGA 4KNYA 2JA7J 3F8MA 2F4MB 2QQ9A 1R5ID 4RAFA 5JHFA 3OS1A 2HOAA 4PJLA 4ESBA 3VDXA 1EH6A 4LMYA 2JA5J 2XC7A 2R7SA 3CF5F 2VONA 1YW9A 2FMYA 3F8CA 2IBDA 3OIQA 3AL0C 4G12A 1JHFA 3U1KA 2F5CA 3WTZA 3S3OA 2BZTA 3H35A 3OMYA 3DWLE 1MBGA 4MEXF 2LY9A 3Q0VA 1MKMA 3JRBA 3CUQC 1I3QJ 2WAFA 1SD7A 3OWTA 5JVGF 1WGXA 1A5JA 3C2BA 2O7OA 4BEHB 2P6SA 1YIJI 2UUZA 3I5UA 5EGOA 1LVKA 1IN5A 2AO9A 2WY8Q 2BY2A 5HDNA 3HUGA 3OYJA 1H9GA 3FX3A 3J80Z 2DA2A 4OWRB 2PFBA 2XHKA 2HEOA 3VYSB 1TQPA 2VKEA 1JE8A 4A3LJ 3K4JA 5FLMJ 4HX4A 5C3EJ 2IPQX 4RA2A 2H27A 4HX7A 2LD5A 1TWHJ 1USTA 2FOWA 3DPLC 4U7BA 2O9LA 1KYZA 3GCMA 1R4MB 4I01A 2G0EA 1VQMI 3CJRB 1ZLJA 2B0LA 2DYRH 3HOUJ 4BGDA 1BR1A 4ITVA 1FP1D 3GTGJ 2ZMEA 1U2WA 3CJNA 3WU0A 2DJNA 1LB2A 3VOEA 4BUPA 4E7JA 4A3JJ 5BPDA 4IQJA 4A5MA 2DAOA 2DFIA 4IXAA 1Z21A 1NG7A 3QU3A 1P7IA 3GTKJ 2TCTA 4OAZA 3TO6A 3FF5A 2H8RA 3MD2A 2VL8A 4NQWA 3CESA 3CJQB 4KN4X 4X1EA 3EPZA 2HOTA 4P5OA 2DA5A 1USSA 5EZGA 3K2ZA 1MDMA 4JX6A 9ANTA 2MG4A 1XMXA 2WA0A 3H5NA 4EGYA 1B6AA 3OS2A 4M3DA 4XLCA 5EEGA 3ZCOA 1YS6A 1BR2A 2LYCA 1O7FA 2M1BA 1K79A 2MFZA 1U3EM 3S8PA 4I2OA 3PUFA 1IW7F 1XB4A 3EUKL 2DDAA 2VQLA 1ODDA 3FISA 4K2EA 3CC2I 3U2RA 2P81A 2FBKA 5E8GA 4ZTFA 2EQRA 4G6DA 2HYGD 2WY7Q 1O4XA 1QPMA 1T95A 4MNUA 3M3YJ 2J5PA 1WJAA 1W7PB 3AG4H 3LNQA 4YIFA 3BLYA 3WTVC 3I64A 1LJ9A 2LBFB 2BHZA 3KP3A 4MTDA 3V7CA 2JT1A 2X1DA 4RMNA 1X3UA 1IRXA 4U0WA 2W4SA 3EYYA 2EB7A 1VFCA 3GFIA 4BXUA 1EH7A 1WPKA 3H92A 5M5YJ 5GADJ 2R5ZA 3M4OJ 2OJED 2FRHA 3S1QJ 1IN4A 2M87A 2P4WA 4NHJA 1X2NA 1QNTA 1SFOJ 3HB9A 4NC8A 3G6EI 5DD4A 2IGMA 5B66C 4PGGA 4YFNF 2CW8A 5DS9A 1MJBA 3QPLA 1F9NA 1Z6RA 1JTXA 3A4CA 3KLNA 3RYRA 5LEJA 2HXIA 3TL4X 2RVCA 1F36A 4GYGA 2HVRA 4PK4A 1D5VA 2ZNYA 3LQRA 2IP2A 3F0CA 2M45A 3KYLA 1TWAJ 3MZ8A 4II3A 2OQGA 2LC2A 3IKTA 1VQ8I 4IHXA 5D5VB 1DPRA 4UV8A 4I0AA 4JX5A 4XOPA 5D5UB 4H4KC 2HOEA 3M8FA 3I4MJ 2P5LC 2X1CA 2UWMA 3NEUA 4JYKA 1VQ9I 1ZG5A 3TMOA 3W6KB 3ECOA 4RBOA 1REPC 3CMMA 4BU2A 2X48A 2H09A 5DUIA 4ZC3A 2GAUA 4X6AJ 1AHDP 1SFUA 4I98B 4A0ZA 2DMNA 1FSEA 4DNCA 3LSRA 2ELJA 3SQNA 2EFQA 3JRFA 3CMAI 2L9NA 3AG1H 1YO5C 4MHGA 4IHVA 3H3UA 1Y8RB 4FQGA 1EJ9A 2QLZA 3MQ0A 2M9HA 1UG0A 1MBKA 3FXQA 2CGPA 1V55H 3I59A 3F8FA 1ETWA 5DCMA 1A6IA 2QWWA 2MH2A 2EH3A 3E5UA 3O2PE 3R6SA 2XAGA 3AG3H 3RPUA 4HNUA 3RKWA 3GUDA 5J40A 1G3YA 1KZHA 2EPFA 4AIHA 1D0XA 3ZQIA 2NVQJ 3S1NJ 1BL0A 5JR3A 3ZGKA 2DO7A 2RNGA 1BI3A 3CDIA 1FBSA 2DYSH 2VKDA 1ETKA 2A6TA 3ZMTA 1DPUA 2E2JJ 1KQ9A 2PG4A 4BYYA 3RKQA 2NOJB 2H1LA 2L7KA 2M8GX 3K4MA 2EWNA 3HDDA 5F64A 3ABMH 5L3DA 3OYCA 3WHBA 2V26A 3OS0A 3CD6I 1WI3A 3ZPLA 3JAMK 3ZMUA 4IRIA 1HKQA 2KZVA 1MNEA 2XRNA 2WAQN 2OCCH 4QTRA 2R93J 2L54A 3R0JA 3PJRA 3FXMA 1MH3A 2OF7A 4XLEA 1SFKA 1J7KA 3OYMA 2KRHA 2CJJA 4MFEA 2NRAC 1K4TA 1ZK8A 5HS7A 3KCCA 2LG4A 3VEPA 1LEBA 3BT9A 4KA4A 4BDYA 1IXRC 5HDKA 2CV1A 4ENJA 4C3IJ 5BQTA 4NC7A 4OIRF 1CF7B 2BY0A 4HRIA 3B73A 4OIOF 2CQQA 4GGGA 4U0VA 1OR7C 1IN6A 2R3SA 3ZN0A 2XAJA 3BC8A 5CPRB 1JGGA 3K7AJ 4L9VA 3LMMA 1LQ1A 2GIZA 5LHGA 2ZJRF 1UCRA 3S93A 4BH9A 3HIFA 3X2QH 4C30A 4GCVA 4BE2A 1YLFA 1GVDA 1S7AA 3K1PA 4HA8A 4ZYHA 2E7WA 4IF4A 3PNVA 2QF7A 2G7UA 3CUQA 2B7EA 4OAYA 3ZN1A 4ZDLA 1Y39A 3MKZA 3GF2A 3TW7A 2HFHA 1MMSA 2WTEA 1Y0NA 1RNLA 2M7AA 3BR0A 2XRLA 3DU6A 3RQIA 2QYOA 3HOZJ 3DPUA 4AIKA 1O3TA 2E34A 3PL8A 5DTDA 3MMYB 2OPTA 4UVCA 2AQFA 2CFXA 2JVHA 2M7BA 1D5YA 2KZGA 2A6HF 2V1DA 4B1RA 3VWBA 1S8NA 2VQHA 3BPXA 1K61A 3H1CA 4BQQA 2B63J 4DGWB 5E18F 1YJNI 3A03A 3GMEA 1Y56A 2E7XA 4V2FA 3JTHA 4RB2C 3Q5FA 4I09A 4MTEA 4CCMA 1GHCA 2X6XA 2VT3A 1R7JA 2DI3A 2HZTA 4KITB 2BW3A 2EFPA 2V9VA 2F5FA 4J00A 5FD6A 3CMEI 2P7CB 2RGVA 1ETOA 1YX5A 3PNYA 4LFUA 4KFCA 3VODA 2I10A 5IP9J 2CW0F 1MBFA 2NS8A 4ZH4F 2UZKA 3IHUA 3ASNH 1LDKB 2NVUB 4ZYAA 2JUGA 1HW2A 4BXXJ 5TJJA 3D1NI 5CVRA 5LHHA 3OSGA 1IN8A 1OYIA 2IA2A 3TKYA 3BZCA 3RDIA 1P4WA 4KDPA 3ZOBA 4LITA 1ZRDA 1TWGJ 2E1CA 5E8IA 4Y4RA 4NUBA 2QQBA 1RPWA 2DOFA 2GQQA 1I50J 3DPTA 4N0BA 2JTVA 2GA1A 3G3ZA 2DODA 5JLWA 2YSRA 2Y0MA 1AOYA 3DP7A 2O5RA 5LRRA 3COAC 5CYVA 3VPRA 1ETQA 2VOOA 1YQAA 2K9NA 1BIBA 1VQ6I 3QRFF 3BR3A 2IEKA 2JJ7A 5LBQA 1T8IA 1DP3A 3GFMA 3IL2A 4F7ZA 2ZJQF 3JCUC 2KKOA 4MLOA 3RCOA 2EA2A 2ME0A 3HBLA 2ZO4A 3CCEI 2JZYA 2G7HA 4BBSJ 2VN2A 1AWCA 3OIOA 5H6RA 1E17A 1BI0A 2BGCA 5LLQA 2XAHA 4A3MJ 2BY3A 2E2HJ 2LR8A 2K85A 4R1HA 1MSEC 1GV5A 3CJTB 3HRMA 2VB6A 4A3BJ 1A31A 3P9IA 3QOEA 2CQXA 2OZUA 3RJPA 2FQ3A 2CUZA 3CC4I 2M3AA 3R4KA 4OIQF 1PVEA 5EYRA 2JA6J 1FT9A 2KRCA 3G71I 4KUMA 2DFFA 1VQOI 2LP0A 5EG0A 1MNMC 1G59A 2LY1A 4XLNF 3S2DJ 4HDVA 3SJMA 3B6CA 5IP7J 3P5JA 1ZREA 4IKFA 4GYIA 5FJ8J 4V19K 5LHIA 1XC5A 5L3EA 3I3LA 2ZSHB 2K27A 2XSDC 3DQVC 1I39A 3D5LA 3J81K 2PI0A 4FETA 2PMZA 2FX0A 4B4CA 3HL2A 2HQRA 1MGTA 1X1AA 3JAMZ 2KIMA 1ETXA 1YX3A 3MFKA 1WQ2A 2JUCA 3SEZA 4HNTA 2A6EF 3CP8A 1KONA 2IA0A 1G4DA 4B43A 2OQRA 4DYCA 4LK0F 2IW5A 4JOMA 4LB6B 3IH2A 4AUXA 3ULQB 4UY8I 1XSDA 1HF0A 3GZ5A 1AKHA 3TO7A 2Z33A 5L3CA 1O3QA 3DTIA 2L02A 3Q9VA 2HPMA 4EGZA 2LDUA 1TBXA 3DEWA 3CLQA 3A02A 2EV5A 3DBLB 3V8LA 4D7MA 4UB6C 1UJ8A 1VF9A 3VFZA 1FC3A 2NYXA 1R4NB 3KYCB 2O6GE 2XPUA 4CCNA 3LSIA 2FSWA 1FEXA 1WZ2A 3CUOA 1V3FA 3L09A 4UNOA 2R92J 4ZDOA 1OLTA 3LSTA 4HX8A 2Z16A 1VZ0A 2R7VA 3QYEA 2VKHA 3JR9A 2EZIA 3HKZA 3P9CA 3GTLJ 2HS5A 3DBRB 1JJ6C 2P6TA 5JLXA 1FOWA 1W4MA 1U5TB 4LLGF 1YTYA 3TOAA 5K5OA 1Y8QB 5D4SA 3DTEA 2RQQA 3ML6A 3RTRA 3A2KA 3GO5A 1P6RA 2WADA 1PP7U 5DM6F 2M4KA 4N9IA 4FCYA 2QBYA 4YIIA 1YI2I 1WJDA 3H9QA 2L4AA 3RYPA 5LD2C 2JMWA 4V2GA 1BOBA 1RI7A 3OYEA 4LJZF 5F08A 1A36A 3T1BA 3I71A 2DTZA 3E6CC 2ZKZA 1CGPA 2LLKA 3CDLA 2Q2EA 2R7WA 3ERED 5EF6A 2Z2SB 4BQAA 3B02A 4ANJA 2Z9OA 2MSYA 3FMQA 3V8KA 4AIDA 3HC7A 1OR7A 4A3DJ 2JA8J 2DOEA 4CUGA 4CXFA 2Y2ZA 4CSWA 2DBBA 2NXNB 3S1RJ 2BHYA 2XB0X 1OQYA 2GXGA 1ZTRA 1VQ4I 3FXKA 4L5IA 4G7OF 2DQLA 4HPQA 2BXZA 4ZTJA 5E1ZB 4HV6A 3D0SA 3F21A 1BA5A 2VXDA 1IN7A 3B6AA 1E3PA 4N4OB 1IRFA 3LSMA 4J01A 3BROA 2J5OA 3OYHA 1JXSA 5HOOA 2JRTA 5KK1A 1BC8C 4OMZA 2ZXJA 3I55I 4IQ4A 3PUBA 4LG3A 2O8XA 4U87A 3MZYA 3CCLI 1W0TA 3M07A 1FYKA 2Y30A 3JTGA 1VQPI 1X4PA 4XL9A 1PJRA 4YFKF 2RQPA 4RGRA 1K78B 4RM3A 3RKXA 3KP7A 4E7HA 1S6LA 1I6HJ 2M4GA 4AVPA 1DDNA 1P2FA 3BZKA 3LOCA 1XCVA 4OOIA 4ETSA 1OFCX 1X4OA 3CC7I 1TQMA 1KGSA 2MC4A 5EGOB 4UB8C 3ZRGA 5JHUA 4RB0A 3GLLA 1PDNC 4X0GA 2V4JC 4P96A 1TZLA 2DTRA 2MBFA 3UR3C 4EM2A 2IVMA 4MO7A 2VE8A 2G9WA 2QVOA 5L3FA 1K6OA 3PNTA 4HYEA 4IJAA 4PCQA 2K7LA 2V9PA 2A5YB 4A0YA 5H20A 1Q1HA 5K7HA 1SD6A 3OOUA 3DKYA 1P92A 3VSLA 3S16J 2QEXI 1GV2A 1JUSA 1WJEA 1O3SA 1G8XA 1F4KA 3H0GJ 1ZYRF 2PMUA 1LE8A 2KJBA 4M3FA 2CWEA 4RLQA 1IDZA 3LSKA 1B1BA 5K5QA 1ORKA 1RC9A 1OCTC 2DT6A 2X9DA 3F8NA 4IEJA 2P5VA 2LTPA 2P7VB 3PFYA 3TEDA 1QRYA 2DA1A 4DIQA 3BCAA 3BOQA 1BC7C 2L3DA 4XN0A 2EZKA 2M30A 4O3MA 3ZQLA 3K6GA 5DM7F 2E1MB 3H5RA 5FKOA 4XRFA 5HDGA 2IJLA 2P5KA 3FXOA 4BE0A 2YU9J 4M3BA 4A3KJ 5F0HA 1U9NA 4Q4ZF 1MDMB 3J81Z 1J0RA 1BW6A 4A12A 5D5XB 5L3GA 2ID3A 2MYSA 2H8WA 3S3NA 2M0CA 5KCMA 3BQYA 3JRIA 1FIAA 2HYJA 3LFUA 5EJCA 3GLXA 1Z6TA 2XF5A 2KISA 2RN7A 4F55A 4DQ2A 3L9FA 2EIMH 4S04A 5GTIC 1WH5A 2CYYA 4A5NA 2JRMA 2JWTA 3J7AO 4G8XA 2ETHA 5ILVA 3FMRA 4XNFA 4PFOA 5B1BH 3OR1C 1YW7A 3NQOA 2XASA 4BJ6C 3ABUA 2Y9ZA 1IC8A 1F5TA 5E1WA 4E7LA 2Q1ZB 1HA8A 4DBRA 5AIQA 5GAEJ 2EZHA 1MSFC 4Z2YA 3OYIA 3HSRA 4UXNA 4WX9A 4ENNA 1QHGA 2F2EA 2CS3A 3E6BA 4NDLA 1JKOC 4F91B 2K9MA 2QCOA 1QA6A 2R7FA 3HOVJ 3IUOA 2D1HA 3GWZA 2ELHA 4I76A 2NS0A 5HNFA 1W5SA 4GXOA 1J75A 2R7ZJ 2R5ZB 1ZR4A 1UHWA 4CHUA 1MNDA 3NAUA 4DW6A 2MABA 1Z3YA 2KPMA 3CCYA 4PJJA 4FISA 2HU9A 3L2QA 3K1NA 4KIFA 4TV7A 1Z1DA 2BEOA 1EA3A 3HEFA 4Y15A 2MGQA 5IY5H 1RRJA 1B4AA 5TGTA 5BS6A 3EYIA 1DUXC 1IXCA 1OCZH 3QODA 2GOMA 2VT2A 4A3EJ 2O3FA 2R7RA 2PJPA 5FRMA 5FRNA 3FIWA 2L01A 1ZAOA 4XSXF 1V4RA 2L4MA 1XGSA 2YPRA 3DFGA 1EF4A 2KRFA 1VQNI 1I1GA 4Y13A 5E20A 4A3GJ 3ERMA 1APLC 2L2OA 3EUHC 4CA0A 3U21A 4HLYA 2D1VA 4XOTA 4ENMA 4UVBA 5E1XA 4XMYA 4L0ZB 1OCPA 4Q5SF 1XGNA 3WU1B 2CUEA 3K9TA 2CQKA 1TP4A 3O8GA 4QWQA 4HDUA 1C0WA 3HXLA 2Z5UA 2Y0SA 2AS5F 5JFRA 1Z7UA 2DK5A 2ICWG 3WTTC 1N78A 1J9IA 2VJ4A 1XN7A 1T98A 1KQ8A 4D9JA 4CYCB 2V1XA 4E7SA 2ZNZA 3VYRB 4WWCA 3IRRA 1GXPA 5ILSA 1T6SA 4IO9F 1PYVA 2NVYJ 1SVOA 2EV6A 4NBQA 2E71A 5J8FA 1YRNA 3DV8A 1R71A 4OIPF 1W7PA 3F6VA 1EV7A 4HF0A 2LBFA 3I58A 2X1EA 4HZFA 3IH4A 3JSPA 2W48A 3CQZJ 5BPIA 3AAFA 2HDDA 3QPTA 3KYDB 1MJ9A 2XKPA 3LA2A 1JGSA 3BR5A 4L0YB 2LMDA 1YJ9I 2DMPA 4L9JA 4W1UA 1ETVA 3K4LA 3CO7C 2XROA 5J47A 2FBIA 2HTSA 4XM3A 4ZYGA 5GPAA 5D4RA 3JSOA 3DLAA 3W2AA 3KIOA 4PSXA 4D5FA 1S7EA 4PUSA 1FOXA 4M73A 1HW1A 3QP5A 3IAM2 1SC7A 4M3EA 1U9OA 2E1NA 1RKTA 2R7OA 3HOYJ 4XRMA 2R7XA 2QENA 4LB5A 4HF1A 1TT5B 3BCBA 1TLHB 2XF6A 4RGXA 4A6EA 4EM1A 1GLNA 2UV1A 4KISA 1HXDA 4IVNA 1B8IB 1V5EA 4B44A 1Z0XA 3KZZA 4HF2A 5C4XJ 2KT0A 1TWCJ 2VI6A 2LSOA 1BJZA 2HPIA 1JI8A 3FXJA 4Y3OA 1MMNA 1OJLA 2GBYA 4YG2F 2UXNA 3BTJA 4RS8A 2F5VA 3ZQGA 5E3NA 4EATA 3N97A 5CKTA 2D45A 5K1YA 1D0YA 3I4PA 3L2UA 5HLIA 1X1PA 2XIGA 2XGEA 1WJCA 5JVTA 3I4NJ 1BIAA 3L2WA 3KZIC 1JKRC 4LK1F 4P9FA 1QBJA 1YIOA 3FMSA 3S15J 2W1OA 4YEJA 2GA2A 2OD5A 3L2CA 4WCGA 1TWFJ 3EQLF 4EJOA 1ON1A 5FLXK 3FXUA 4DOZA 3PIOF 1DGWY 2GOXB 3DKXA 3TGNA 1QHHD 4B8XA 4G94A 3G4SI 3AL0B 2TRTA 2V9KA 1R36A 5D8KB 4D7NA 2ZJPF 1XSXA 4XKWA 1ZQ3P 2PMZN 4KMUX 4WF2A 3ZXSA 2VASA 4CYDA 2FD5A 2R7DA 2DA6A 5E3OA 3PQJA 4C2UA 1G6NA 3CUQB 3FK7A 3OYLA 3HM5A 4W97A 1O57A 4HEA2 2NNNA 2VKVA 4B09A 5J1RA 4IRGA 1IV8A 2MLGA 1BI2A 1IZ1A 5IT3A 3JRGA 5L3BA 1OCCH 3CF2A 3T0YA 1X3ZB 1WCMJ 4M74A 3K70D 4LLLA 2QQAA 3CLOA 5E17F 1U8RA 2HZDA 5J1UA 1UAAA 3LL7A 5C44J 2WB1A 2X6WA 1OPCA 1U5TC 4S05A 1MJAA 3W6VA 3E3VA 3ELKA 5HS9A 5J6XA 3N4MA 1U8BA 1I1SA 4YFXF 1LDDA 1R1TA 3HPGA 1T39A 4XLHA 2VUMJ 5TRDA 3FZVA 4XORA 3KFWX 5D6EA 3PO3J 2R7TA 3GBGA 1D8KA 1SAUA 1IRGA 1R1UA 5KHDA 3W6JB 4LLNA 2BW3B 4ZDPA 3WHCA 2NOGA 2MC3A 2JSPA 2QA4I 2ESNA 4PDKA 3HZJA 1QO0D 5J3LA 1FBQA 3KP2A 2A3SA 3HKZN 1JTYA 3AG2H 1WJFA 2LF7A 2DT7B 3A0HC 3GFLA 4U88A 1XGOA 4EJVA 4UHTA 1NK2P 4RB1A 2DDBA 2RNJA 1FYMA 1CF7A 3HOWJ 2IS2A 1L3LA 4ON0A 1X1DA 4A3FJ 5LEKA 4BHPA 3OYGA 4LD5A 1TW2A 2CH0A 4F3QA 2VXZA 2EILH 3DEEA 2EJRA 1YFHA 1J2XA 1R58A 3H3ZA 1V5FA 4EVIA 2FA5A 2PX9A 3S32A 1OYYA 4M3GA 1RETA 2O0YA 2CO5A 1SMTA 5D5WB 2E35A 3ROUA 2VLAA 2LKSA 3K4KA 1O3RA 1OYWA 3DLLF 1HKSA 2Y69H 1W5TA 3KE2A 1R1VA 2M8EA 4R79A 1LFPA 2YR2A 4WXDA 3F23A 1YG2A 2FE3A 4G9YA 1BN5A 2KDZA 5CVVA 2MW8A 1B9NA 4PFPA 1H88C 2EV0A 4O5VA 2XUBA 1B59A 1N77A 1XMAA 3BTCA 2HQAA 3L7WA 1IF1A 2LKXA 3LFKA 1GVJA 4MIMA 2BVLA 3HYIA 3WTYC 2HOSA 1RZ4A 4AVZA 5IT9K 1OISA 3SZPA 1HLVA 3ECHA 2COBA 3QP6A 5ERIA 3PSIA 4DYQA 4CCKA 4BXFA 3G1OA 3E7LA 3PQKA 2LY2A 3KP5A 2PJRB 1SD4A 3BJAA 3CCVI 4UUSA 5FKMA 1Y6IA 5IYCJ 5FKLA 2XSJC 5F6FA 1LDJA 1XX5A 3ZMZA 5TISC 2OV7A 3JRAA 5J1YA 2MH9A 3Q3SA 3H3VK 3N05A 4EMSA 3CTAA 3CDHA 3GYHX 1VQLI 5IYDJ 1AA7A 2PQ8A 1B72A 2ZSIB 4EEFG 1K7AA 3SDGA 3V4GA 2KMUA 3R0AA 3ZQCA 4A93J 4L9NA 3HSEA 3EUHA 1GT0C 2EK5A 1FX7A 1J09A 3JRDA 1GUUA 2ID6A 4LG0A 4A69C 5HNHA 4JBAA 4F93B 4CO8A 1RKWA 4ESJA 3HOTA 2VBYA 2GXBA 1ZRFA 1H8AC 1W1WE 2DA3A 1HSJA 3GTQJ 1FMVA 1MMDA 3JW4A 3H5AA 4XKVA 2JPCA 4YIRX 1UFMA 2ZXIA 1SD5A 3C2HA 2UXXA 4HOBA 1DP7P 2NVTJ 2ESHA 4WXCA 3V42A 1TQIA 4IOCF 2Z99A 4HQMA 4RM2A 2ZCWA 2HQNA 2KDOA 3UNGC 3BR6A 2X6YA 5IPAA 4KT6A 4D1QA 3A01B 5ED4A 3REOA 2O03A 2VQGA 1AKHB 2AXLA 1VI0A 2QZ8A 5ICEA 1WI9A 2A5WA 1P4AA 2PEXA 2XVCA 1FSHA 5DD8A 4HNVA 4U0YA 4PJMA 4CZZA 4J19A 1HKTA 5FLXZ 3C18A 4IX7A 4G6QA 2JPBA 3JREA 1Z77A 1J59A 4A0XA 3K4CA 4CGZA 3T5XA 4UVAA 4XKCA 4DBQA 3KX2A 3GZNB 2R5YA 4Y7NJ 2E19A 2MD0A 3W2VA 2W84A 2RREA 3BJ6A 2LVSA 3BDDA 4JP0A 5CVUA 3ZMSA 2L7ZA 3IH3A 4ZZDA 3S14J 1G2HA 5EZHA 3GZ6A 4BNCA 1UG2A 2ZC2A 1JUPA 2EZLA 5CQGA 1E3OC 3SFIA 2D5VA 4Q48A 4QPQA 2PMHA 1ZGWA 4QPOA 1MMGA 2F5EA 3LQQA 1G3SA 1FMWA 4I02A 3WU2C 5HS8A 2VOPA 1Z3XA 3CCJI 2NAZA 3T8RA 3V7SA 2YS9A 3S2HJ 1OCRH 4UV9A 3TBIA 2Y48A 4LIVA 3QYFA 5B5EC 3SZGA 2DA4A 3GEZA 2OCEA 1OKRA 2FU4A 2LK2A 2BV6A 4XRSA 1PUFA 4IHTA 2L9VA 2OTJI 1V5GA 2ZXHA 5D8LB 1YW8A 4D0PA 1D8JA 3RPQA 2BY1A 1HW5A 4CICA 4ASNA 1W0UA 1YITI 3J7AY 3VYUB 3EDPA 3CO6C 2IRFG 1RUNA 2QM3A 5LFAA 4BE1A 1TNSA 1JKQC 3FBNB 4AYBA 5IP6A 2FXAA 2XPVA 4NB5A 2Z3YA 5ICCA 1OCOH 3M1CA 4JK1X 3TQNA 2F5DA 3BG9A 2XGDA 1W36D 1D1BA 2RAEA 1ZGJA 3KZYA 1MIJA 1ETYA 2CV0A 2K9SA 3G2BA 2GIVA 2F48A 2QGUA 4L18B 1XG1A 1SANA 4XN3A 3CCUI 4BQNA 3ESWB 1U0JA 4KIGA 4I7HA 3TDZC 5K5RA 4AU7A 1T33A 5LGTA 3IV5A 3GXOA 2A05A 4XBFA 3CCSI 2Y0SN 2Z1DA 3OYAA 2DPDA 2L5QA 2DFHA 4KYWA 2PBIA 4Y52J 2FBHA 3ABLH 2ACJA 2OBPA 5BNGA 2AHQA 4B3XA 2XPWA 2ME6A 2JQ7A 1U5TA 4XLFA 2X85A 3MZHA 1NH3A 3LSGA 2K02A 1MW7A 1FYLA 1D1CA 2A68F 1FJLA 2XAUA 2LH9A 2K5CA 3DCFA 2VBXA 4O6JA 1K4SA 1HQCA 3IP4B 1N25A 1S5LC 4ESFA 2KLOA 1T0FC 2K3FA 2HTJA 2HXOA 5IYBJ 1QZYA 3GFJA 5IT9Z 3MKWB 3Q9SA 3RZDJ 4ZJZA 3MCZA 2R4GA 3KEOA 1R6RA 1ZRCA 4RAGA 2NNYA 2RDPA 2CMPA 3BG5A 2X0LA 1Y1WJ 2LREA 3L2VA 4GO1A 4KIBA 4PGHA 2W82A 2ZBKA 3GX4X 1A35A 3M1EA 5M5XJ 1DGRM 2ZXWH 3J7YJ 3HUGB 2AQEA 3PO2J 4BY1J 1XCBA 2DJIA 2R7UA 2IS6A 1UHMA 3MWMA 3VYTB 4C2TA 2VPRA 1EKEA 2BVMA 1JUMA 3VB2A 3LAPA 2QKMB 1NG6A 2A69F 3QU6A 2LFBA 3PSFA 5AIPA 1TW3A 2OTLI 2H1KA 5IOYA 5KAFC 1QGPA 4ZYEA 1U78A 5K7ZA 3QQAA 3L1PA 2R0QC 4PZJA 2BE5F 1T38A 1VQ5I 1ZARA 2ZMEB 2CW7A 3TOBA 5EEHA 1YS7A 3F22A 2V79A 2HDWA 1IUYA 2M5WA 2CSOA 3DF8A 3DBHB 4HSRA 4MGRA 1SFEA 5KNLA 2X4HA 3BG7A 2CG4A 3LWFA 1ZG1A 4OMYA 3IWFA 1K78A 4G7HF 3RPUD 2E5ZA 4G6TB 1X2MA 1MZBA 4NQWB 2A07F 2FMLA 4EJTA 2LNBA 4RGUA 3M9AA 5GPCA 2CQ7A 2V1NA 5J4YA 2M2EA 4D5CA 4DZPA 4M6YA 1LNWA 2HR3A 4ZZLA 3TP3A 3PM1A 2XB5A 3HOSA 1KYWA 3BZ6A 2ECBA 2W7NA 4BY7J 5DEQA 1BJAA 2MD5A 3HTSB 3ABTA 1R5HA 2K3PA 3AFHA 1LUJB 4KT5C 2BYVE 1ITYA 1WVRA 3HGGA 4RB3C 2L7MP 4XQFA 4OINF 3K69A 3TP0A 3I9V2 3G1LA 1BR4A 4RDUA 1L0OC 3S2WA 5F1JA 4BEHA 1LFUP 1R5GA 2K40A 2VJJA 1SMYF 2QSFX 3A0BC 1QQIA 3DKWA 3GTOJ 2W24A 2XDVA 4C9YA 1JJ8C 2X6OA 3KLOA 4U7DA 3QAHA 4P55A 1XDSA 2Q0OA 1FOKA 4DZJA 4C3JJ 1HDPA 4IZZA 2CU7A 4E4HA 3I56I 2WB1N 3P9KA 1R22A 4KN7X 3SYTA 4QSHA 5EDNA 3C2GA 4FHTA 3LAJA 3QPSA 3NWTA 3F72A 1JKPC 3WTWC 5LRSA 2DFEA 5ILUA 3WGIA 5CVIA 2FEZA 5GP9A 5KVRA 2OUMA 1YOVB 2GM4A 5GTHC 1QPIA 4II2A 4FASD 3HHGA 1XSVA 2ZFUA 3IRQA 2K86A 1D1AA 1PP8F 2KFDA 3VSKA 4BL0B 5GAGJ 2DMUA 2KQRA 1IAWA 1WH7A 1ZN2A 2QQ8A 2KIUA 4F92B 4OU0A 3OY9A 1F1ZA 2COMA 4XK4A 1IDYA 3QOPA 1UELB 1H9TA 1XMKA 1FWZA 1YRNB 2DU9A 3WGHA 2E1OA 3DXJF 4M6VA 1P7JA 3RZOJ 1DU0A 2X51A 4YELA 3SHFA 5CVJA 3E5XA 3OSFA 4PJNA 1S3JA 2RKHA 4Y17A 4IHSA 3W2WA 3F9KA 4CDGA 4E7ZA 5K7FA 1FZPB 3F3XA 1X19A 3SXYA 3IC7A 5J4VA 2PLYA 4LOCA 1S29A 1FTTA 4XR6A 2FNPA 5ICGA 3OL4A 1X1CA 2KJCA 3E0JB 3SEQA 3FM5A 4A2UA 3HPHA 4B48A 1MD0A 1VTNC 2IAIA 2M0MA 1XD7A 3NRVA 3NWSA 4JQFA 2DT5A 4BAYA 1Z91A 1MMAA 2STTA 5FKKA 3E5QA 3HJEA 3LSPA 1V54H 2HVSA 3MN2A 2Q8KA 2VJ5A 3QPHA 3C7JA 3FDYA 2DK8A 3M8EA 1JHHA 2HDCA 4Y33A 2VBZA 3I59B 3U9GA 3M7GA 1ZKGA 1WJBA 5DCMB 4P1WA 4A3IJ 1S9HA 4LGWA 4PJ0C 3BG3A 4AIJA 2IGNA 4HSTA 1RESA 1FPQA 3V7RA 3DU5A 2OU2A 2CUJA 2ZFWA 4GDFA 1TC3C 2XGXA 5D6FA 2IS4A 1UB9A 3H0DA 2VIXA 1POGA 3K70C 4HLXA 3H9GA 3DTKA 3ZQ7A 3J7ZI 3O3KA 4G7ZF 1SAXA 1LVAA 2L0KA 4CYCA 4FE4A 2PN6A 3G1MA 1TNTA 5FROA 3GTJJ 5ICFA 1G3TA 2LKPA 3NARA 3R60A 1H0MA 4NC6A 4IHYA 4XLPF 5E3MA 4BJTA 4FX0A 1IUFA 4B3AA 2CUFA 3BJOA 2K4BA 3GTPJ 3HRSA 3K1MA 5DUKA 5FD5A 2HKOA 2IGOA 1YHQI 2RV8A 4RLFA 2GLOA 3QWLA 2K4JA 2ELKA 1HDDC 2QSHX 2DLLA 2F4OB 1QVUA 2H6BA 3BPVA 2B9SA 4BHCA 4CCLA 1VQ7I 2K9LA 3ZQFA 1F43A 1HCRA 1ONVA 2WWYA 2WC2A 1E3HA 3JRHA 1AU7A 1ZH5A 1T0FA 2Y31A 2FJ1A 3I0TA 1ON2A 3TDUC 3F8BA 1B8IA 2HKXA 3P7NA 3KETA 2QSGX 3A1YA 3E97A 2YX4A 2EA4A 3Q0WA 1NK3P 2VC1A 2IA1A 5CLSA 1IO2A 3U1DA 4AM3A 1FIPA 4UUVA 2DXIA 3BTIA 2V6CA 4FT8A 1ULYA 2DQRA 1QZZA 2JSCA 4BJ5C 2NS7A 1HOMA 3JRCA 1I6XA 3BQZA 1VNDA 3C3WA 3G73A 3WTXC 3ZR8X 2GXAA 3RIRA 2E5NA 5F0CA 1XS9A 4GFBA 1T08B 3HGYA 3OYNA 2WBMA 2CFOA 3R61A 1MBJA 4M9XA 1A04A 2HQ5A 4BS9A 2F6CA 1NTCA 2DA7A 2HNHA 4HW0A 1R23A 1A6QA 1S7OA 2STWA 1TL8A 3SFZA 3K4NA 1JT6A 4IPAA 5HODA 4A6DA 2DCEA 2O61A 3ZQHA 4AC0A 3CCQI 2IS1A 2ISYA 1ZGAA 1XTAA 2TDXA 4H0EA 1J5YA 1X3WB 3QYBA 1FP2A 3D5RC 1E2XA 4E6KG 4BKXA 1FBUA 2EIJH 5DCFA 5HVQC 2HGCA 1IGNA 6PAXA 1X58A 4IHWA 2I5UA 2DMTA 3KPHA 3D5SC 3FKIJ 3RQ4A 5B1AH 1TTYA 1Y0UA 2EBIA 2HYFA 3BWGA 2N8GA 4IL6C 5C4JJ 3GTMJ 3PIPF 3FBIB 3HHHA 1NHAA 2JA2A 4Z6YA 3BP8A 4BACA 5F1RA 1UHSA 2AXTC 2E60A 1XGMA 4AYBN 3E6MA 3OL3A 4S0HB 3BG6A 3OIPA 4B47A 3OYBA 2O8KA 4DJAA 3ZP5A 5BOXA 5A2QK 1QU3A 2H94A 2P0WA 1CQTA 2LF8A 2EFOA 2V7FA 4EQQA 4UUTA 4EJWA 3CCMI 3EETA 4M6XA 3FXRA 5LGNA 2W25A 1ZELA 5E3LA 3I53A 4I6ZA 4I0BA 2ADUA 2CV2A 3H36A 3WODF 5FLVA 2XGCA 3TO9A 3FXLA 4C2MJ 3IAS2 1ZR2A 3H9JA 3FM3A 4I99C 2MA3A 4UUSB 1BOAA 1D0ZA 4PSWA 4IOAF 3KP4A 5M3FJ 5AONA 2Y9YA 1K6YA 4L9TA 4E7KA 2VJIA 3IKVA 4EJUA 1B72B 1LKXA 1IV6A 3CP2A 5M5WJ 2VPLA 2WV0A 5IOZA 1UMQA 2ZB9A 4ZYDA 3OR2C 4LG0B 1VQKI 1E0EA 4XIDA 3V8JA 1RUOA 4N4NB 5H2FC 3OV8A 3WE2A 3FK6A 4E7IA 1TT0A 3ASOH 4CCOA 3O6BB 2I8DA 3PFIA 5EG0B 4LIUA 2OA4A 2FUG2 4R8HA 5J8CA 1Z67A 3HRUA 4MQ9F 1STZA 1FLIA 4M72A 4CZCA 2D2WA 3I54A 4NNJA 2ZMEC 4WXHA 5DV5A 3HG9A 3ZMVA 4C3HJ 1T2KA 2FOKA 4ENKA 3F6OA 1ZHFA 2FQ4A 4KICA 5HLHA 2JN6A 1BI1A 1GDTA 1SEUA 4XSZF 1LPQA 2V6EA 1BM9A 3RI4A 5KAIC 4BQOA 3ONQA 3WG9A 1FTZA 2EINH 2IT0A 2E1MC 5FFXA 1R49A 4Q47A 1N75A 1FOYA 4RAYA 2JK3A 1FY7A 2KHMA 1X1BA 1WHUA 3FWEA 1BBYA 1YYVA 2K9QA 2R5YB 4FE7A 4HV5A 1WSUA 2VQCA 3LSJA 1JT0A 1DU6A 5FFZA 3MAJA 2PJRA 1KU2A 4XICA 5DDGA 4JX4A 2F4IA 4XONA 1IRZA 3BY6A 3KEQA 1W36C 1WRJA 4DYRA 5FKNA 3J80K 2ISZA 3FHZA 1P9QC 3CCRI 2GZWA 1XDUA 2LOOA 1O7LA 4XLAA 5CJ9A 2CRGA
chains in the Genus database with same CATH topology
2QF7A 4CYCB 1Y1VJ 3TW7A 3S1MJ 1IG7A 2VPRA 1JUMA 2NVYJ 2LFBA 2DMQA 3BR0A 2XRLA 3RQIA 1YRNA 3HOZJ 1PUFB 2H1KA 5IOYA 5DTDA 2OPTA 1U78A 5K7ZA 3QQAA 3IH4A 2W48A 1IJWC 1D5YA 3CQZJ 3L1PA 1MH4A 2R0QC 3MKLA 4B1RA 2HDDA 3BR5A 1K61A 2E2IJ 1R9TJ 2B63J 2DMPA 3A03A 4W1UA 3Q0UA 4A3CJ 1ETVA 4V2FA 1Q1VA 3A01A 1K83J 5GPAA 4D5FA 1S7EA 1X2MA 2YUSA 4M3EA 5GPCA 1U9OA 2M2EA 4D5CA 1RKTA 4DZPA 4XRSG 3HOYJ 4MFDA 3TP3A 4XRMA 1ETOA 2XB5A 3PM1A 4ABZA 2I10A 1QVTA 5IP9J 1MBFA 2NS8A 2ECBA 4BY7J 3TW6A 2HI3A 3BTLA 1B8IB 3HOXJ 2NVXJ 1BW5A 3BR2A 1Z0XA 1ENHA 4BXXJ 2WV1A 3D1NI 3OSGA 5C4XJ 2KT0A 3S17J 1TWCJ 2VI6A 1BJZA 1ITYA 3HGGA 3ZOBA 1TWGJ 2L7MP 1OJLA 2GBYA 5F27A 3TP0A 3G1LA 4L5EA 4FTHA 3BTJA 1RPWA 4BBRJ 5E3NA 3ZQGA 5F0FA 4RDUA 1I50J 5F1JA 1LFUP 2K40A 5JLWA 2DN0A 2M34A 3O8HA 3GTOJ 3VPRA 1ETQA 1JJ8C 2K9NA 2X6OA 2XGEA 3I4NJ 3BR3A 1JKRC 2IEKA 1MBHA 2JJ7A 4DZJA 4C3JJ 1HDPA 2CU7A 4MLOA 2ME0A 3S15J 3HBLA 2WB1N 1TWFJ 4QSHA 5EDNA 4BBSJ 3OIOA 2E2HJ 4A3MJ 5F04A 3QPSA 2L9RA 2LR8A 1JKPC 2TRTA 4D7NA 2L7FP 1MSEC 1GV5A 1T56A 5GP9A 2GM4A 1QPIA 1ZQ3P 2PMZN 4A3BJ 2FD5A 1H89C 2DA6A 5E3OA 2DMUA 4QIWN 3CMYA 2CQXA 3FK7A 1WH7A 3HM5A 4W97A 5J1RA 1RR7A 2VKVA 4XK4A 3MVPA 1IDYA 2ECCA 1LFBA 5EEAA 5EYRA 3JRGA 2JA6J 1YRNB 1WCMJ 2E1OA 4M6VA 1P7JA 3RZOJ 1DU0A 2LP0A 5EG0A 1MNMC 1LE8B 3OSFA 5J1UA 1MBEA 5K7FA 5C44J 3S2DJ 3SJMA 3B6CA 4LOCA 5IP7J 1FTTA 5FJ8J 3K2AA 3W6VA 5M3MJ 1XC5A 3BR1A 1U8BA 2VUMJ 2XSDC 3UKGA 2JA7J 3PO3J 3GBGA 2IAIA 2FX0A 2HOAA 4B4CA 5FKKA 3WHCA 2NOGA 1ETXA 3LSPA 2JA5J 3MN2A 5J3LA 3HKZN 1JTYA 2IBDA 4G12A 1NK2P 4DYCA 1ZKGA 3HOWJ 4A3IJ 3IH2A 1MBGA 3BG3A 4AUXA 4A3FJ 2LY9A 3Q0VA 3JRBA 1HF0A 1RESA 1AKHA 1I3QJ 1TC3C 1WGXA 1A5JA 3C2BA 2O7OA 1POGA 3DEWA 5EGOA 3A02A 4D7MA 4M3GA 2AO9A 1VF9A 1RETA 2L0KA 4CYCA 2DA2A 4FE4A 2XPUA 2VKEA 4A3LJ 3G1MA 1FEXA 3GTJJ 5FLMJ 2R92J 5C3EJ 3NARA 2LD5A 1TWHJ 4IHYA 3JR9A 2EZIA 2KDZA 5E3MA 2O9LA 3GTLJ 1JJ6C 2G0EA 2MW8A 5JLXA 1IUFA 4B3AA 2CUFA 1H88C 3HOUJ 3GTPJ 3BTCA 2LKXA 2HOSA 3GTGJ 4MIMA 2DJNA 2GLOA 4A3JJ 2ELKA 4FCYA 1HLVA 1HDDC 2COBA 1P7IA 1QVUA 4DYQA 2TCTA 3GTKJ 3G1OA 2H8RA 3E7LA 2JMWA 4V2GA 3ZQFA 4X1EA 1HCRA 4UUSA 1F43A 5FKMA 2HOTA 5IYCJ 5F08A 5FKLA 2DA5A 5EZGA 9ANTA 4JX6A 2MG4A 3JRHA 3JRAA 2DTZA 5J1YA 1AU7A 4M3DA 3Q3SA 2LLKA 2FJ1A 2Y31A 3CDLA 3H3VK 5IYDJ 1B72A 5EF6A 4EEFG 1B8IA 3SDGA 2MSYA 3ZQCA 4A93J 4A3DJ 3Q0WA 1GT0C 1NK3P 2JA8J 2Y2ZA 1GUUA 2ID6A 3JRDA 1FIPA 4A69C 3FISA 3S1RJ 2XB0X 3BTIA 1RKWA 1ZTRA 2P81A 2NS7A 1HOMA 2EQRA 3JRCA 1H8AC 2DA3A 1O4XA 3M3YJ 3GTQJ 1BA5A 3BQZA 1VNDA 3B6AA 3LNQA 1XS9A 5F0CA 4GFBA 3HGYA 2NVTJ 1MBJA 2HQ5A 1NTCA 2DA7A 1VFCA 1W0TA 1WPKA 2Y30A 5M5YJ 1JT6A 5HODA 2R5ZA 3M4OJ 3BR6A 3A01B 5IPAA 3S1QJ 1AKHB 3ZQHA 1X2NA 4AC0A 1VI0A 1SFOJ 1I6HJ 3HB9A 4HNVA 3LOCA 1OFCX 4J19A 5EGOB 5DS9A 3QPLA 3JREA 1JTXA 1Z77A 4BKXA 2HXIA 1F36A 1IGNA 4MO7A 2R5YA 4Y7NJ 2E19A 1X58A 4IHWA 2DMTA 3F0CA 3FKIJ 1TWAJ 5K7HA 2EBIA 3OOUA 2LVSA 4IHXA 2N8GA 4JP0A 5C4JJ 3GTMJ 2L7ZA 3IH3A 4JX5A 3S14J 1G2HA 5EZHA 3S16J 1UHSA 1GV2A 1JUSA 1UG2A 3I4MJ 1JUPA 2EZLA 4AYBN 3H0GJ 1E3OC 3SFIA 4S0HB 1LE8A 2D5VA 4M3FA 1IDZA 4JYKA 1ZGWA 2O8KA 1OCTC 1ORKA 2X9DA 1CQTA 4IEJA 4UUTA 2LTPA 3TEDA 2YS9A 1QRYA 3S2HJ 2DA1A 4RBOA 5E3LA 2X48A 4I6ZA 2EZKA 2DA4A 3ZQLA 5FLVA 4X6AJ 2XGCA 1AHDP 5FKOA 2LK2A 4C2MJ 2DMNA 1ZR2A 3LSRA 4XRSA 4UUSB 1PUFA 2YU9J 4M3BA 4A3KJ 3JRFA 5M3FJ 5F0HA 1U9NA 4IHVA 1BW6A 2Y9YA 2ID3A 2M9HA 1W0UA 1MBKA 2M0CA 3BQYA 1B72B 3JRIA 1IV6A 1FIAA 1ETWA 2HYJA 5M5WJ 5IOZA 1A6IA 1UMQA 1WH5A 2EH3A 2ZB9A 2JWTA 1JKQC 3S1NJ 5IP6A 2NVQJ 3ZQIA 2XPVA 1BL0A 4XIDA 2Y9ZA 1IC8A 3BG9A 2XGDA 1ETKA 3FK6A 2RAEA 2EZHA 1MSFC 2E2JJ 1ETYA 2K9SA 5EG0B 4NDLA 3RKQA 1XG1A 1JKOC 1SANA 2M8GX 2QCOA 3HDDA 3HOVJ 1T33A 3IV5A 4I76A 3WHBA 2Y0SN 2R7ZJ 1WI3A 4C3HJ 2R5ZB 1ZR4A 3NAUA 4DW6A 2FQ4A 4QTRA 2WAQN 2R93J 2JN6A 3CCYA 1GDTA 4FISA 4Y52J 5BNGA 2AHQA 1FTZA 3HEFA 2XPWA 1MH3A 2OF7A 2ME6A 2MGQA 2CJJA 4MFEA 3LSGA 1ZK8A 1FJLA 2JK3A 4A3EJ 3BT9A 3DCFA 4C3IJ 3FIWA 2K9QA 2R5YB 4FE7A 1DU6A 3LSJA 1JT0A 1EF4A 2HXOA 5IYBJ 4A3GJ 2CQQA 3RZDJ 1APLC 4XICA 4JX4A 3BG5A 1Y1WJ 1IRZA 1JGGA 3K7AJ 4DYRA 5FKNA 1OCPA 2CUEA 3O8GA 5M5XJ 1GVDA 3PO2J 4BY1J 2CRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QF7 A;  4CYC B;  1Y1V J;  3TW7 A;  3S1M J;  1IG7 A;  2VPR A;  1JUM A;  2NVY J;  2LFB A;  2DMQ A;  3BR0 A;  2XRL A;  3RQI A;  1YRN A;  3HOZ J;  1PUF B;  2H1K A;  5IOY A;  5DTD A;  2OPT A;  1U78 A;  5K7Z A;  3QQA A;  3IH4 A;  2W48 A;  1IJW C;  1D5Y A;  3CQZ J;  3L1P A;  1MH4 A;  2R0Q C;  3MKL A;  4B1R A;  2HDD A;  3BR5 A;  1K61 A;  2E2I J;  1R9T J;  2B63 J;  2DMP A;  3A03 A;  4W1U A;  3Q0U A;  4A3C J;  1ETV A;  4V2F A;  1Q1V A;  3A01 A;  1K83 J;  5GPA A;  4D5F A;  1S7E A;  1X2M A;  2YUS A;  4M3E A;  5GPC A;  1U9O A;  2M2E A;  4D5C A;  1RKT A;  4DZP A;  4XRS G;  3HOY J;  4MFD A;  3TP3 A;  4XRM A;  1ETO A;  2XB5 A;  3PM1 A;  4ABZ A;  2I10 A;  1QVT A;  5IP9 J;  1MBF A;  2NS8 A;  2ECB A;  4BY7 J;  3TW6 A;  2HI3 A;  3BTL A;  1B8I B;  3HOX J;  2NVX J;  1BW5 A;  3BR2 A;  1Z0X A;  1ENH A;  4BXX J;  2WV1 A;  3D1N I;  3OSG A;  5C4X J;  2KT0 A;  3S17 J;  1TWC J;  2VI6 A;  1BJZ A;  1ITY A;  3HGG A;  3ZOB A;  1TWG J;  2L7M P;  1OJL A;  2GBY A;  5F27 A;  3TP0 A;  3G1L A;  4L5E A;  4FTH A;  3BTJ A;  1RPW A;  4BBR J;  5E3N A;  3ZQG A;  5F0F A;  4RDU A;  1I50 J;  5F1J A;  1LFU P;  2K40 A;  5JLW A;  2DN0 A;  2M34 A;  3O8H A;  3GTO J;  3VPR A;  1ETQ A;  1JJ8 C;  2K9N A;  2X6O A;  2XGE A;  3I4N J;  3BR3 A;  1JKR C;  2IEK A;  1MBH A;  2JJ7 A;  4DZJ A;  4C3J J;  1HDP A;  2CU7 A;  4MLO A;  2ME0 A;  3S15 J;  3HBL A;  2WB1 N;  1TWF J;  4QSH A;  5EDN A;  4BBS J;  3OIO A;  2E2H J;  4A3M J;  5F04 A;  3QPS A;  2L9R A;  2LR8 A;  1JKP C;  2TRT A;  4D7N A;  2L7F P;  1MSE C;  1GV5 A;  1T56 A;  5GP9 A;  2GM4 A;  1QPI A;  1ZQ3 P;  2PMZ N;  4A3B J;  2FD5 A;  1H89 C;  2DA6 A;  5E3O A;  2DMU A;  4QIW N;  3CMY A;  2CQX A;  3FK7 A;  1WH7 A;  3HM5 A;  4W97 A;  5J1R A;  1RR7 A;  2VKV A;  4XK4 A;  3MVP A;  1IDY A;  2ECC A;  1LFB A;  5EEA A;  5EYR A;  3JRG A;  2JA6 J;  1YRN B;  1WCM J;  2E1O A;  4M6V A;  1P7J A;  3RZO J;  1DU0 A;  2LP0 A;  5EG0 A;  1MNM C;  1LE8 B;  3OSF A;  5J1U A;  1MBE A;  5K7F A;  5C44 J;  3S2D J;  3SJM A;  3B6C A;  4LOC A;  5IP7 J;  1FTT A;  5FJ8 J;  3K2A A;  3W6V A;  5M3M J;  1XC5 A;  3BR1 A;  1U8B A;  2VUM J;  2XSD C;  3UKG A;  2JA7 J;  3PO3 J;  3GBG A;  2IAI A;  2FX0 A;  2HOA A;  4B4C A;  5FKK A;  3WHC A;  2NOG A;  1ETX A;  3LSP A;  2JA5 J;  3MN2 A;  5J3L A;  3HKZ N;  1JTY A;  2IBD A;  4G12 A;  1NK2 P;  4DYC A;  1ZKG A;  3HOW J;  4A3I J;  3IH2 A;  1MBG A;  3BG3 A;  4AUX A;  4A3F J;  2LY9 A;  3Q0V A;  3JRB A;  1HF0 A;  1RES A;  1AKH A;  1I3Q J;  1TC3 C;  1WGX A;  1A5J A;  3C2B A;  2O7O A;  1POG A;  3DEW A;  5EGO A;  3A02 A;  4D7M A;  4M3G A;  2AO9 A;  1VF9 A;  1RET A;  2L0K A;  4CYC A;  2DA2 A;  4FE4 A;  2XPU A;  2VKE A;  4A3L J;  3G1M A;  1FEX A;  3GTJ J;  5FLM J;  2R92 J;  5C3E J;  3NAR A;  2LD5 A;  1TWH J;  4IHY A;  3JR9 A;  2EZI A;  2KDZ A;  5E3M A;  2O9L A;  3GTL J;  1JJ6 C;  2G0E A;  2MW8 A;  5JLX A;  1IUF A;  4B3A A;  2CUF A;  1H88 C;  3HOU J;  3GTP J;  3BTC A;  2LKX A;  2HOS A;  3GTG J;  4MIM A;  2DJN A;  2GLO A;  4A3J J;  2ELK A;  4FCY A;  1HLV A;  1HDD C;  2COB A;  1P7I A;  1QVU A;  4DYQ A;  2TCT A;  3GTK J;  3G1O A;  2H8R A;  3E7L A;  2JMW A;  4V2G A;  3ZQF A;  4X1E A;  1HCR A;  4UUS A;  1F43 A;  5FKM A;  2HOT A;  5IYC J;  5F08 A;  5FKL A;  2DA5 A;  5EZG A;  9ANT A;  4JX6 A;  2MG4 A;  3JRH A;  3JRA A;  2DTZ A;  5J1Y A;  1AU7 A;  4M3D A;  3Q3S A;  2LLK A;  2FJ1 A;  2Y31 A;  3CDL A;  3H3V K;  5IYD J;  1B72 A;  5EF6 A;  4EEF G;  1B8I A;  3SDG A;  2MSY A;  3ZQC A;  4A93 J;  4A3D J;  3Q0W A;  1GT0 C;  1NK3 P;  2JA8 J;  2Y2Z A;  1GUU A;  2ID6 A;  3JRD A;  1FIP A;  4A69 C;  3FIS A;  3S1R J;  2XB0 X;  3BTI A;  1RKW A;  1ZTR A;  2P81 A;  2NS7 A;  1HOM A;  2EQR A;  3JRC A;  1H8A C;  2DA3 A;  1O4X A;  3M3Y J;  3GTQ J;  1BA5 A;  3BQZ A;  1VND A;  3B6A A;  3LNQ A;  1XS9 A;  5F0C A;  4GFB A;  3HGY A;  2NVT J;  1MBJ A;  2HQ5 A;  1NTC A;  2DA7 A;  1VFC A;  1W0T A;  1WPK A;  2Y30 A;  5M5Y J;  1JT6 A;  5HOD A;  2R5Z A;  3M4O J;  3BR6 A;  3A01 B;  5IPA A;  3S1Q J;  1AKH B;  3ZQH A;  1X2N A;  4AC0 A;  1VI0 A;  1SFO J;  1I6H J;  3HB9 A;  4HNV A;  3LOC A;  1OFC X;  4J19 A;  5EGO B;  5DS9 A;  3QPL A;  3JRE A;  1JTX A;  1Z77 A;  4BKX A;  2HXI A;  1F36 A;  1IGN A;  4MO7 A;  2R5Y A;  4Y7N J;  2E19 A;  1X58 A;  4IHW A;  2DMT A;  3F0C A;  3FKI J;  1TWA J;  5K7H A;  2EBI A;  3OOU A;  2LVS A;  4IHX A;  2N8G A;  4JP0 A;  5C4J J;  3GTM J;  2L7Z A;  3IH3 A;  4JX5 A;  3S14 J;  1G2H A;  5EZH A;  3S16 J;  1UHS A;  1GV2 A;  1JUS A;  1UG2 A;  3I4M J;  1JUP A;  2EZL A;  4AYB N;  3H0G J;  1E3O C;  3SFI A;  4S0H B;  1LE8 A;  2D5V A;  4M3F A;  1IDZ A;  4JYK A;  1ZGW A;  2O8K A;  1OCT C;  1ORK A;  2X9D A;  1CQT A;  4IEJ A;  4UUT A;  2LTP A;  3TED A;  2YS9 A;  1QRY A;  3S2H J;  2DA1 A;  4RBO A;  5E3L A;  2X48 A;  4I6Z A;  2EZK A;  2DA4 A;  3ZQL A;  5FLV A;  4X6A J;  2XGC A;  1AHD P;  5FKO A;  2LK2 A;  4C2M J;  2DMN A;  1ZR2 A;  3LSR A;  4XRS A;  4UUS B;  1PUF A;  2YU9 J;  4M3B A;  4A3K J;  3JRF A;  5M3F J;  5F0H A;  1U9N A;  4IHV A;  1BW6 A;  2Y9Y A;  2ID3 A;  2M9H A;  1W0U A;  1MBK A;  2M0C A;  3BQY A;  1B72 B;  3JRI A;  1IV6 A;  1FIA A;  1ETW A;  2HYJ A;  5M5W J;  5IOZ A;  1A6I A;  1UMQ A;  1WH5 A;  2EH3 A;  2ZB9 A;  2JWT A;  1JKQ C;  3S1N J;  5IP6 A;  2NVQ J;  3ZQI A;  2XPV A;  1BL0 A;  4XID A;  2Y9Z A;  1IC8 A;  3BG9 A;  2XGD A;  1ETK A;  3FK6 A;  2RAE A;  2EZH A;  1MSF C;  2E2J J;  1ETY A;  2K9S A;  5EG0 B;  4NDL A;  3RKQ A;  1XG1 A;  1JKO C;  1SAN A;  2M8G X;  2QCO A;  3HDD A;  3HOV J;  1T33 A;  3IV5 A;  4I76 A;  3WHB A;  2Y0S N;  2R7Z J;  1WI3 A;  4C3H J;  2R5Z B;  1ZR4 A;  3NAU A;  4DW6 A;  2FQ4 A;  4QTR A;  2WAQ N;  2R93 J;  2JN6 A;  3CCY A;  1GDT A;  4FIS A;  4Y52 J;  5BNG A;  2AHQ A;  1FTZ A;  3HEF A;  2XPW A;  1MH3 A;  2OF7 A;  2ME6 A;  2MGQ A;  2CJJ A;  4MFE A;  3LSG A;  1ZK8 A;  1FJL A;  2JK3 A;  4A3E J;  3BT9 A;  3DCF A;  4C3I J;  3FIW A;  2K9Q A;  2R5Y B;  4FE7 A;  1DU6 A;  3LSJ A;  1JT0 A;  1EF4 A;  2HXO A;  5IYB J;  4A3G J;  2CQQ A;  3RZD J;  1APL C;  4XIC A;  4JX4 A;  3BG5 A;  1Y1W J;  1IRZ A;  1JGG A;  3K7A J;  4DYR A;  5FKN A;  1OCP A;  2CUE A;  3O8G A;  5M5X J;  1GVD A;  3PO2 J;  4BY1 J;  2CRG A; 
#chains in the Genus database with same CATH topology
 3LA7 A;  1LEA A;  2WAQ A;  1ERD A;  3K10 A;  1Y1V J;  2EFW A;  1QZE A;  2MLK A;  2A61 A;  1RR8 C;  1IG7 A;  2DW4 A;  3S1M J;  2V1U A;  2W00 A;  5BMZ A;  3OYF A;  1HST A;  1FNN A;  2XKO A;  1R00 A;  2DMQ A;  1Z9C A;  4HBL A;  1PUF B;  4WK8 F;  3DEU A;  4YRV A;  4M71 A;  1XPX A;  4QLC U;  1IJW C;  2KL4 A;  2YX7 A;  1DQU A;  1MH4 A;  3CZ6 A;  3MKL A;  4L5J A;  1KQ0 A;  2YU3 A;  1Z05 A;  2E2I J;  5H6Q A;  1R9T J;  4MEY F;  2OZ6 A;  1YE9 A;  2OAZ A;  3SZT A;  1ACI A;  3Q0U A;  4M9Z A;  4A3C J;  1RIO H;  4XKB A;  2QBY B;  1Q1V A;  1PUE E;  2KP6 A;  3A01 A;  3MEX A;  1K83 J;  2QUF A;  2XAQ A;  3HRT A;  4F52 A;  5HLT A;  2GWR A;  5LGU A;  1B9M A;  3LSH A;  2YUS A;  2W57 A;  2CQN A;  2VC0 A;  2BBY A;  1IXS B;  3ZMD A;  1YJW I;  4XRS G;  4CH7 A;  3WTU C;  2XV4 S;  5CQE A;  4MFD A;  2VE9 A;  2W85 A;  2Q2E B;  3L00 A;  4ABZ A;  1QVT A;  3ISP A;  3K4B A;  2IXS A;  3TW6 A;  1OMI A;  2HI3 A;  3BTL A;  4M9S A;  3HSF A;  3HOX J;  2NVX J;  1BW5 A;  3BR2 A;  3GVA A;  1ENH A;  2WV1 A;  2C6Y A;  1M1E B;  4EV0 A;  1GXQ A;  2H6C A;  3S17 J;  3EUA A;  2EIK H;  2FF4 A;  5GAH J;  2XAF A;  5JI6 A;  1HC8 A;  4AWX B;  1SVM A;  2RC4 A;  5F27 A;  1SVL A;  1WJ5 A;  2P8T A;  4L5E A;  4FTH A;  3K0L A;  4BBR J;  3OOP A;  5F0F A;  3GW2 A;  1U6G A;  3W3C A;  5DYM A;  3ZQQ A;  2DOA A;  4IRH A;  1KU9 A;  3L2R A;  1KA8 A;  4HAM A;  3E1S A;  2DN0 A;  1I3A A;  2M34 A;  1KU3 A;  3O8H A;  1G3W A;  3FHN A;  5E79 C;  3E6D A;  2FNA A;  5FO5 A;  4RGS A;  3ABK H;  5FGM A;  3LA3 A;  3M8J A;  1MBH A;  4HG2 A;  3WG7 H;  5A2Q Z;  4P9U A;  1WKM A;  3RSN A;  2QKL B;  3HTU A;  4AD9 A;  3IWZ A;  4KMF A;  1HBX G;  3WE3 A;  2VBW A;  2IGK A;  2ZJ2 A;  5HLG A;  2XF7 A;  5F04 A;  2DPU A;  2L9R A;  4EM0 B;  2HVQ A;  2L9S A;  3C1D A;  3OYD A;  3MKY B;  2VOD A;  2KIQ A;  2L7F P;  1T56 A;  3AKZ A;  2BOL A;  1I5Z A;  2HWV A;  1P4X A;  3OYK A;  1EH8 A;  2E36 A;  1H89 C;  5FB2 A;  4BDZ A;  5B3S H;  3WGG A;  4QIW N;  4KJZ A;  3CMY A;  1KU7 A;  1WWX A;  2EFN A;  2WAE A;  1D3Y A;  1Z7L A;  1W5C C;  1RR7 A;  3MVP A;  3KEY A;  2ECC A;  4GRI A;  1ZLK A;  2OC6 A;  2KIF A;  1LFB A;  3RKY A;  2Y75 A;  5EEA A;  1I27 A;  4HQE A;  2BXY A;  2R7Q A;  4RAZ A;  3FKJ A;  1SFX A;  3T8T A;  4FX4 A;  1LE8 B;  2LRD A;  4BHB A;  1UZC A;  1WFX A;  4E70 A;  1W7P D;  3S3M A;  3WTS C;  1MBE A;  2JVG A;  1S72 I;  3KP6 A;  4N9H A;  3SDB A;  4CCJ A;  3K2A A;  5M3M J;  3BR1 A;  4MQV A;  1ZG3 A;  3UKG A;  4KNY A;  2JA7 J;  3F8M A;  2F4M B;  2QQ9 A;  1R5I D;  4RAF A;  5JHF A;  3OS1 A;  2HOA A;  4PJL A;  4ESB A;  3VDX A;  1EH6 A;  4LMY A;  2JA5 J;  2XC7 A;  2R7S A;  3CF5 F;  2VON A;  1YW9 A;  2FMY A;  3F8C A;  2IBD A;  3OIQ A;  3AL0 C;  4G12 A;  1JHF A;  3U1K A;  2F5C A;  3WTZ A;  3S3O A;  2BZT A;  3H35 A;  3OMY A;  3DWL E;  1MBG A;  4MEX F;  2LY9 A;  3Q0V A;  1MKM A;  3JRB A;  3CUQ C;  1I3Q J;  2WAF A;  1SD7 A;  3OWT A;  5JVG F;  1WGX A;  1A5J A;  3C2B A;  2O7O A;  4BEH B;  2P6S A;  1YIJ I;  2UUZ A;  3I5U A;  5EGO A;  1LVK A;  1IN5 A;  2AO9 A;  2WY8 Q;  2BY2 A;  5HDN A;  3HUG A;  3OYJ A;  1H9G A;  3FX3 A;  3J80 Z;  2DA2 A;  4OWR B;  2PFB A;  2XHK A;  2HEO A;  3VYS B;  1TQP A;  2VKE A;  1JE8 A;  4A3L J;  3K4J A;  5FLM J;  4HX4 A;  5C3E J;  2IPQ X;  4RA2 A;  2H27 A;  4HX7 A;  2LD5 A;  1TWH J;  1UST A;  2FOW A;  3DPL C;  4U7B A;  2O9L A;  1KYZ A;  3GCM A;  1R4M B;  4I01 A;  2G0E A;  1VQM I;  3CJR B;  1ZLJ A;  2B0L A;  2DYR H;  3HOU J;  4BGD A;  1BR1 A;  4ITV A;  1FP1 D;  3GTG J;  2ZME A;  1U2W A;  3CJN A;  3WU0 A;  2DJN A;  1LB2 A;  3VOE A;  4BUP A;  4E7J A;  4A3J J;  5BPD A;  4IQJ A;  4A5M A;  2DAO A;  2DFI A;  4IXA A;  1Z21 A;  1NG7 A;  3QU3 A;  1P7I A;  3GTK J;  2TCT A;  4OAZ A;  3TO6 A;  3FF5 A;  2H8R A;  3MD2 A;  2VL8 A;  4NQW A;  3CES A;  3CJQ B;  4KN4 X;  4X1E A;  3EPZ A;  2HOT A;  4P5O A;  2DA5 A;  1USS A;  5EZG A;  3K2Z A;  1MDM A;  4JX6 A;  9ANT A;  2MG4 A;  1XMX A;  2WA0 A;  3H5N A;  4EGY A;  1B6A A;  3OS2 A;  4M3D A;  4XLC A;  5EEG A;  3ZCO A;  1YS6 A;  1BR2 A;  2LYC A;  1O7F A;  2M1B A;  1K79 A;  2MFZ A;  1U3E M;  3S8P A;  4I2O A;  3PUF A;  1IW7 F;  1XB4 A;  3EUK L;  2DDA A;  2VQL A;  1ODD A;  3FIS A;  4K2E A;  3CC2 I;  3U2R A;  2P81 A;  2FBK A;  5E8G A;  4ZTF A;  2EQR A;  4G6D A;  2HYG D;  2WY7 Q;  1O4X A;  1QPM A;  1T95 A;  4MNU A;  3M3Y J;  2J5P A;  1WJA A;  1W7P B;  3AG4 H;  3LNQ A;  4YIF A;  3BLY A;  3WTV C;  3I64 A;  1LJ9 A;  2LBF B;  2BHZ A;  3KP3 A;  4MTD A;  3V7C A;  2JT1 A;  2X1D A;  4RMN A;  1X3U A;  1IRX A;  4U0W A;  2W4S A;  3EYY A;  2EB7 A;  1VFC A;  3GFI A;  4BXU A;  1EH7 A;  1WPK A;  3H92 A;  5M5Y J;  5GAD J;  2R5Z A;  3M4O J;  2OJE D;  2FRH A;  3S1Q J;  1IN4 A;  2M87 A;  2P4W A;  4NHJ A;  1X2N A;  1QNT A;  1SFO J;  3HB9 A;  4NC8 A;  3G6E I;  5DD4 A;  2IGM A;  5B66 C;  4PGG A;  4YFN F;  2CW8 A;  5DS9 A;  1MJB A;  3QPL A;  1F9N A;  1Z6R A;  1JTX A;  3A4C A;  3KLN A;  3RYR A;  5LEJ A;  2HXI A;  3TL4 X;  2RVC A;  1F36 A;  4GYG A;  2HVR A;  4PK4 A;  1D5V A;  2ZNY A;  3LQR A;  2IP2 A;  3F0C A;  2M45 A;  3KYL A;  1TWA J;  3MZ8 A;  4II3 A;  2OQG A;  2LC2 A;  3IKT A;  1VQ8 I;  4IHX A;  5D5V B;  1DPR A;  4UV8 A;  4I0A A;  4JX5 A;  4XOP A;  5D5U B;  4H4K C;  2HOE A;  3M8F A;  3I4M J;  2P5L C;  2X1C A;  2UWM A;  3NEU A;  4JYK A;  1VQ9 I;  1ZG5 A;  3TMO A;  3W6K B;  3ECO A;  4RBO A;  1REP C;  3CMM A;  4BU2 A;  2X48 A;  2H09 A;  5DUI A;  4ZC3 A;  2GAU A;  4X6A J;  1AHD P;  1SFU A;  4I98 B;  4A0Z A;  2DMN A;  1FSE A;  4DNC A;  3LSR A;  2ELJ A;  3SQN A;  2EFQ A;  3JRF A;  3CMA I;  2L9N A;  3AG1 H;  1YO5 C;  4MHG A;  4IHV A;  3H3U A;  1Y8R B;  4FQG A;  1EJ9 A;  2QLZ A;  3MQ0 A;  2M9H A;  1UG0 A;  1MBK A;  3FXQ A;  2CGP A;  1V55 H;  3I59 A;  3F8F A;  1ETW A;  5DCM A;  1A6I A;  2QWW A;  2MH2 A;  2EH3 A;  3E5U A;  3O2P E;  3R6S A;  2XAG A;  3AG3 H;  3RPU A;  4HNU A;  3RKW A;  3GUD A;  5J40 A;  1G3Y A;  1KZH A;  2EPF A;  4AIH A;  1D0X A;  3ZQI A;  2NVQ J;  3S1N J;  1BL0 A;  5JR3 A;  3ZGK A;  2DO7 A;  2RNG A;  1BI3 A;  3CDI A;  1FBS A;  2DYS H;  2VKD A;  1ETK A;  2A6T A;  3ZMT A;  1DPU A;  2E2J J;  1KQ9 A;  2PG4 A;  4BYY A;  3RKQ A;  2NOJ B;  2H1L A;  2L7K A;  2M8G X;  3K4M A;  2EWN A;  3HDD A;  5F64 A;  3ABM H;  5L3D A;  3OYC A;  3WHB A;  2V26 A;  3OS0 A;  3CD6 I;  1WI3 A;  3ZPL A;  3JAM K;  3ZMU A;  4IRI A;  1HKQ A;  2KZV A;  1MNE A;  2XRN A;  2WAQ N;  2OCC H;  4QTR A;  2R93 J;  2L54 A;  3R0J A;  3PJR A;  3FXM A;  1MH3 A;  2OF7 A;  4XLE A;  1SFK A;  1J7K A;  3OYM A;  2KRH A;  2CJJ A;  4MFE A;  2NRA C;  1K4T A;  1ZK8 A;  5HS7 A;  3KCC A;  2LG4 A;  3VEP A;  1LEB A;  3BT9 A;  4KA4 A;  4BDY A;  1IXR C;  5HDK A;  2CV1 A;  4ENJ A;  4C3I J;  5BQT A;  4NC7 A;  4OIR F;  1CF7 B;  2BY0 A;  4HRI A;  3B73 A;  4OIO F;  2CQQ A;  4GGG A;  4U0V A;  1OR7 C;  1IN6 A;  2R3S A;  3ZN0 A;  2XAJ A;  3BC8 A;  5CPR B;  1JGG A;  3K7A J;  4L9V A;  3LMM A;  1LQ1 A;  2GIZ A;  5LHG A;  2ZJR F;  1UCR A;  3S93 A;  4BH9 A;  3HIF A;  3X2Q H;  4C30 A;  4GCV A;  4BE2 A;  1YLF A;  1GVD A;  1S7A A;  3K1P A;  4HA8 A;  4ZYH A;  2E7W A;  4IF4 A;  3PNV A;  2QF7 A;  2G7U A;  3CUQ A;  2B7E A;  4OAY A;  3ZN1 A;  4ZDL A;  1Y39 A;  3MKZ A;  3GF2 A;  3TW7 A;  2HFH A;  1MMS A;  2WTE A;  1Y0N A;  1RNL A;  2M7A A;  3BR0 A;  2XRL A;  3DU6 A;  3RQI A;  2QYO A;  3HOZ J;  3DPU A;  4AIK A;  1O3T A;  2E34 A;  3PL8 A;  5DTD A;  3MMY B;  2OPT A;  4UVC A;  2AQF A;  2CFX A;  2JVH A;  2M7B A;  1D5Y A;  2KZG A;  2A6H F;  2V1D A;  4B1R A;  3VWB A;  1S8N A;  2VQH A;  3BPX A;  1K61 A;  3H1C A;  4BQQ A;  2B63 J;  4DGW B;  5E18 F;  1YJN I;  3A03 A;  3GME A;  1Y56 A;  2E7X A;  4V2F A;  3JTH A;  4RB2 C;  3Q5F A;  4I09 A;  4MTE A;  4CCM A;  1GHC A;  2X6X A;  2VT3 A;  1R7J A;  2DI3 A;  2HZT A;  4KIT B;  2BW3 A;  2EFP A;  2V9V A;  2F5F A;  4J00 A;  5FD6 A;  3CME I;  2P7C B;  2RGV A;  1ETO A;  1YX5 A;  3PNY A;  4LFU A;  4KFC A;  3VOD A;  2I10 A;  5IP9 J;  2CW0 F;  1MBF A;  2NS8 A;  4ZH4 F;  2UZK A;  3IHU A;  3ASN H;  1LDK B;  2NVU B;  4ZYA A;  2JUG A;  1HW2 A;  4BXX J;  5TJJ A;  3D1N I;  5CVR A;  5LHH A;  3OSG A;  1IN8 A;  1OYI A;  2IA2 A;  3TKY A;  3BZC A;  3RDI A;  1P4W A;  4KDP A;  3ZOB A;  4LIT A;  1ZRD A;  1TWG J;  2E1C A;  5E8I A;  4Y4R A;  4NUB A;  2QQB A;  1RPW A;  2DOF A;  2GQQ A;  1I50 J;  3DPT A;  4N0B A;  2JTV A;  2GA1 A;  3G3Z A;  2DOD A;  5JLW A;  2YSR A;  2Y0M A;  1AOY A;  3DP7 A;  2O5R A;  5LRR A;  3COA C;  5CYV A;  3VPR A;  1ETQ A;  2VOO A;  1YQA A;  2K9N A;  1BIB A;  1VQ6 I;  3QRF F;  3BR3 A;  2IEK A;  2JJ7 A;  5LBQ A;  1T8I A;  1DP3 A;  3GFM A;  3IL2 A;  4F7Z A;  2ZJQ F;  3JCU C;  2KKO A;  4MLO A;  3RCO A;  2EA2 A;  2ME0 A;  3HBL A;  2ZO4 A;  3CCE I;  2JZY A;  2G7H A;  4BBS J;  2VN2 A;  1AWC A;  3OIO A;  5H6R A;  1E17 A;  1BI0 A;  2BGC A;  5LLQ A;  2XAH A;  4A3M J;  2BY3 A;  2E2H J;  2LR8 A;  2K85 A;  4R1H A;  1MSE C;  1GV5 A;  3CJT B;  3HRM A;  2VB6 A;  4A3B J;  1A31 A;  3P9I A;  3QOE A;  2CQX A;  2OZU A;  3RJP A;  2FQ3 A;  2CUZ A;  3CC4 I;  2M3A A;  3R4K A;  4OIQ F;  1PVE A;  5EYR A;  2JA6 J;  1FT9 A;  2KRC A;  3G71 I;  4KUM A;  2DFF A;  1VQO I;  2LP0 A;  5EG0 A;  1MNM C;  1G59 A;  2LY1 A;  4XLN F;  3S2D J;  4HDV A;  3SJM A;  3B6C A;  5IP7 J;  3P5J A;  1ZRE A;  4IKF A;  4GYI A;  5FJ8 J;  4V19 K;  5LHI A;  1XC5 A;  5L3E A;  3I3L A;  2ZSH B;  2K27 A;  2XSD C;  3DQV C;  1I39 A;  3D5L A;  3J81 K;  2PI0 A;  4FET A;  2PMZ A;  2FX0 A;  4B4C A;  3HL2 A;  2HQR A;  1MGT A;  1X1A A;  3JAM Z;  2KIM A;  1ETX A;  1YX3 A;  3MFK A;  1WQ2 A;  2JUC A;  3SEZ A;  4HNT A;  2A6E F;  3CP8 A;  1KON A;  2IA0 A;  1G4D A;  4B43 A;  2OQR A;  4DYC A;  4LK0 F;  2IW5 A;  4JOM A;  4LB6 B;  3IH2 A;  4AUX A;  3ULQ B;  4UY8 I;  1XSD A;  1HF0 A;  3GZ5 A;  1AKH A;  3TO7 A;  2Z33 A;  5L3C A;  1O3Q A;  3DTI A;  2L02 A;  3Q9V A;  2HPM A;  4EGZ A;  2LDU A;  1TBX A;  3DEW A;  3CLQ A;  3A02 A;  2EV5 A;  3DBL B;  3V8L A;  4D7M A;  4UB6 C;  1UJ8 A;  1VF9 A;  3VFZ A;  1FC3 A;  2NYX A;  1R4N B;  3KYC B;  2O6G E;  2XPU A;  4CCN A;  3LSI A;  2FSW A;  1FEX A;  1WZ2 A;  3CUO A;  1V3F A;  3L09 A;  4UNO A;  2R92 J;  4ZDO A;  1OLT A;  3LST A;  4HX8 A;  2Z16 A;  1VZ0 A;  2R7V A;  3QYE A;  2VKH A;  3JR9 A;  2EZI A;  3HKZ A;  3P9C A;  3GTL J;  2HS5 A;  3DBR B;  1JJ6 C;  2P6T A;  5JLX A;  1FOW A;  1W4M A;  1U5T B;  4LLG F;  1YTY A;  3TOA A;  5K5O A;  1Y8Q B;  5D4S A;  3DTE A;  2RQQ A;  3ML6 A;  3RTR A;  3A2K A;  3GO5 A;  1P6R A;  2WAD A;  1PP7 U;  5DM6 F;  2M4K A;  4N9I A;  4FCY A;  2QBY A;  4YII A;  1YI2 I;  1WJD A;  3H9Q A;  2L4A A;  3RYP A;  5LD2 C;  2JMW A;  4V2G A;  1BOB A;  1RI7 A;  3OYE A;  4LJZ F;  5F08 A;  1A36 A;  3T1B A;  3I71 A;  2DTZ A;  3E6C C;  2ZKZ A;  1CGP A;  2LLK A;  3CDL A;  2Q2E A;  2R7W A;  3ERE D;  5EF6 A;  2Z2S B;  4BQA A;  3B02 A;  4ANJ A;  2Z9O A;  2MSY A;  3FMQ A;  3V8K A;  4AID A;  3HC7 A;  1OR7 A;  4A3D J;  2JA8 J;  2DOE A;  4CUG A;  4CXF A;  2Y2Z A;  4CSW A;  2DBB A;  2NXN B;  3S1R J;  2BHY A;  2XB0 X;  1OQY A;  2GXG A;  1ZTR A;  1VQ4 I;  3FXK A;  4L5I A;  4G7O F;  2DQL A;  4HPQ A;  2BXZ A;  4ZTJ A;  5E1Z B;  4HV6 A;  3D0S A;  3F21 A;  1BA5 A;  2VXD A;  1IN7 A;  3B6A A;  1E3P A;  4N4O B;  1IRF A;  3LSM A;  4J01 A;  3BRO A;  2J5O A;  3OYH A;  1JXS A;  5HOO A;  2JRT A;  5KK1 A;  1BC8 C;  4OMZ A;  2ZXJ A;  3I55 I;  4IQ4 A;  3PUB A;  4LG3 A;  2O8X A;  4U87 A;  3MZY A;  3CCL I;  1W0T A;  3M07 A;  1FYK A;  2Y30 A;  3JTG A;  1VQP I;  1X4P A;  4XL9 A;  1PJR A;  4YFK F;  2RQP A;  4RGR A;  1K78 B;  4RM3 A;  3RKX A;  3KP7 A;  4E7H A;  1S6L A;  1I6H J;  2M4G A;  4AVP A;  1DDN A;  1P2F A;  3BZK A;  3LOC A;  1XCV A;  4OOI A;  4ETS A;  1OFC X;  1X4O A;  3CC7 I;  1TQM A;  1KGS A;  2MC4 A;  5EGO B;  4UB8 C;  3ZRG A;  5JHU A;  4RB0 A;  3GLL A;  1PDN C;  4X0G A;  2V4J C;  4P96 A;  1TZL A;  2DTR A;  2MBF A;  3UR3 C;  4EM2 A;  2IVM A;  4MO7 A;  2VE8 A;  2G9W A;  2QVO A;  5L3F A;  1K6O A;  3PNT A;  4HYE A;  4IJA A;  4PCQ A;  2K7L A;  2V9P A;  2A5Y B;  4A0Y A;  5H20 A;  1Q1H A;  5K7H A;  1SD6 A;  3OOU A;  3DKY A;  1P92 A;  3VSL A;  3S16 J;  2QEX I;  1GV2 A;  1JUS A;  1WJE A;  1O3S A;  1G8X A;  1F4K A;  3H0G J;  1ZYR F;  2PMU A;  1LE8 A;  2KJB A;  4M3F A;  2CWE A;  4RLQ A;  1IDZ A;  3LSK A;  1B1B A;  5K5Q A;  1ORK A;  1RC9 A;  1OCT C;  2DT6 A;  2X9D A;  3F8N A;  4IEJ A;  2P5V A;  2LTP A;  2P7V B;  3PFY A;  3TED A;  1QRY A;  2DA1 A;  4DIQ A;  3BCA A;  3BOQ A;  1BC7 C;  2L3D A;  4XN0 A;  2EZK A;  2M30 A;  4O3M A;  3ZQL A;  3K6G A;  5DM7 F;  2E1M B;  3H5R A;  5FKO A;  4XRF A;  5HDG A;  2IJL A;  2P5K A;  3FXO A;  4BE0 A;  2YU9 J;  4M3B A;  4A3K J;  5F0H A;  1U9N A;  4Q4Z F;  1MDM B;  3J81 Z;  1J0R A;  1BW6 A;  4A12 A;  5D5X B;  5L3G A;  2ID3 A;  2MYS A;  2H8W A;  3S3N A;  2M0C A;  5KCM A;  3BQY A;  3JRI A;  1FIA A;  2HYJ A;  3LFU A;  5EJC A;  3GLX A;  1Z6T A;  2XF5 A;  2KIS A;  2RN7 A;  4F55 A;  4DQ2 A;  3L9F A;  2EIM H;  4S04 A;  5GTI C;  1WH5 A;  2CYY A;  4A5N A;  2JRM A;  2JWT A;  3J7A O;  4G8X A;  2ETH A;  5ILV A;  3FMR A;  4XNF A;  4PFO A;  5B1B H;  3OR1 C;  1YW7 A;  3NQO A;  2XAS A;  4BJ6 C;  3ABU A;  2Y9Z A;  1IC8 A;  1F5T A;  5E1W A;  4E7L A;  2Q1Z B;  1HA8 A;  4DBR A;  5AIQ A;  5GAE J;  2EZH A;  1MSF C;  4Z2Y A;  3OYI A;  3HSR A;  4UXN A;  4WX9 A;  4ENN A;  1QHG A;  2F2E A;  2CS3 A;  3E6B A;  4NDL A;  1JKO C;  4F91 B;  2K9M A;  2QCO A;  1QA6 A;  2R7F A;  3HOV J;  3IUO A;  2D1H A;  3GWZ A;  2ELH A;  4I76 A;  2NS0 A;  5HNF A;  1W5S A;  4GXO A;  1J75 A;  2R7Z J;  2R5Z B;  1ZR4 A;  1UHW A;  4CHU A;  1MND A;  3NAU A;  4DW6 A;  2MAB A;  1Z3Y A;  2KPM A;  3CCY A;  4PJJ A;  4FIS A;  2HU9 A;  3L2Q A;  3K1N A;  4KIF A;  4TV7 A;  1Z1D A;  2BEO A;  1EA3 A;  3HEF A;  4Y15 A;  2MGQ A;  5IY5 H;  1RRJ A;  1B4A A;  5TGT A;  5BS6 A;  3EYI A;  1DUX C;  1IXC A;  1OCZ H;  3QOD A;  2GOM A;  2VT2 A;  4A3E J;  2O3F A;  2R7R A;  2PJP A;  5FRM A;  5FRN A;  3FIW A;  2L01 A;  1ZAO A;  4XSX F;  1V4R A;  2L4M A;  1XGS A;  2YPR A;  3DFG A;  1EF4 A;  2KRF A;  1VQN I;  1I1G A;  4Y13 A;  5E20 A;  4A3G J;  3ERM A;  1APL C;  2L2O A;  3EUH C;  4CA0 A;  3U21 A;  4HLY A;  2D1V A;  4XOT A;  4ENM A;  4UVB A;  5E1X A;  4XMY A;  4L0Z B;  1OCP A;  4Q5S F;  1XGN A;  3WU1 B;  2CUE A;  3K9T A;  2CQK A;  1TP4 A;  3O8G A;  4QWQ A;  4HDU A;  1C0W A;  3HXL A;  2Z5U A;  2Y0S A;  2AS5 F;  5JFR A;  1Z7U A;  2DK5 A;  2ICW G;  3WTT C;  1N78 A;  1J9I A;  2VJ4 A;  1XN7 A;  1T98 A;  1KQ8 A;  4D9J A;  4CYC B;  2V1X A;  4E7S A;  2ZNZ A;  3VYR B;  4WWC A;  3IRR A;  1GXP A;  5ILS A;  1T6S A;  4IO9 F;  1PYV A;  2NVY J;  1SVO A;  2EV6 A;  4NBQ A;  2E71 A;  5J8F A;  1YRN A;  3DV8 A;  1R71 A;  4OIP F;  1W7P A;  3F6V A;  1EV7 A;  4HF0 A;  2LBF A;  3I58 A;  2X1E A;  4HZF A;  3IH4 A;  3JSP A;  2W48 A;  3CQZ J;  5BPI A;  3AAF A;  2HDD A;  3QPT A;  3KYD B;  1MJ9 A;  2XKP A;  3LA2 A;  1JGS A;  3BR5 A;  4L0Y B;  2LMD A;  1YJ9 I;  2DMP A;  4L9J A;  4W1U A;  1ETV A;  3K4L A;  3CO7 C;  2XRO A;  5J47 A;  2FBI A;  2HTS A;  4XM3 A;  4ZYG A;  5GPA A;  5D4R A;  3JSO A;  3DLA A;  3W2A A;  3KIO A;  4PSX A;  4D5F A;  1S7E A;  4PUS A;  1FOX A;  4M73 A;  1HW1 A;  3QP5 A;  3IAM 2;  1SC7 A;  4M3E A;  1U9O A;  2E1N A;  1RKT A;  2R7O A;  3HOY J;  4XRM A;  2R7X A;  2QEN A;  4LB5 A;  4HF1 A;  1TT5 B;  3BCB A;  1TLH B;  2XF6 A;  4RGX A;  4A6E A;  4EM1 A;  1GLN A;  2UV1 A;  4KIS A;  1HXD A;  4IVN A;  1B8I B;  1V5E A;  4B44 A;  1Z0X A;  3KZZ A;  4HF2 A;  5C4X J;  2KT0 A;  1TWC J;  2VI6 A;  2LSO A;  1BJZ A;  2HPI A;  1JI8 A;  3FXJ A;  4Y3O A;  1MMN A;  1OJL A;  2GBY A;  4YG2 F;  2UXN A;  3BTJ A;  4RS8 A;  2F5V A;  3ZQG A;  5E3N A;  4EAT A;  3N97 A;  5CKT A;  2D45 A;  5K1Y A;  1D0Y A;  3I4P A;  3L2U A;  5HLI A;  1X1P A;  2XIG A;  2XGE A;  1WJC A;  5JVT A;  3I4N J;  1BIA A;  3L2W A;  3KZI C;  1JKR C;  4LK1 F;  4P9F A;  1QBJ A;  1YIO A;  3FMS A;  3S15 J;  2W1O A;  4YEJ A;  2GA2 A;  2OD5 A;  3L2C A;  4WCG A;  1TWF J;  3EQL F;  4EJO A;  1ON1 A;  5FLX K;  3FXU A;  4DOZ A;  3PIO F;  1DGW Y;  2GOX B;  3DKX A;  3TGN A;  1QHH D;  4B8X A;  4G94 A;  3G4S I;  3AL0 B;  2TRT A;  2V9K A;  1R36 A;  5D8K B;  4D7N A;  2ZJP F;  1XSX A;  4XKW A;  1ZQ3 P;  2PMZ N;  4KMU X;  4WF2 A;  3ZXS A;  2VAS A;  4CYD A;  2FD5 A;  2R7D A;  2DA6 A;  5E3O A;  3PQJ A;  4C2U A;  1G6N A;  3CUQ B;  3FK7 A;  3OYL A;  3HM5 A;  4W97 A;  1O57 A;  4HEA 2;  2NNN A;  2VKV A;  4B09 A;  5J1R A;  4IRG A;  1IV8 A;  2MLG A;  1BI2 A;  1IZ1 A;  5IT3 A;  3JRG A;  5L3B A;  1OCC H;  3CF2 A;  3T0Y A;  1X3Z B;  1WCM J;  4M74 A;  3K70 D;  4LLL A;  2QQA A;  3CLO A;  5E17 F;  1U8R A;  2HZD A;  5J1U A;  1UAA A;  3LL7 A;  5C44 J;  2WB1 A;  2X6W A;  1OPC A;  1U5T C;  4S05 A;  1MJA A;  3W6V A;  3E3V A;  3ELK A;  5HS9 A;  5J6X A;  3N4M A;  1U8B A;  1I1S A;  4YFX F;  1LDD A;  1R1T A;  3HPG A;  1T39 A;  4XLH A;  2VUM J;  5TRD A;  3FZV A;  4XOR A;  3KFW X;  5D6E A;  3PO3 J;  2R7T A;  3GBG A;  1D8K A;  1SAU A;  1IRG A;  1R1U A;  5KHD A;  3W6J B;  4LLN A;  2BW3 B;  4ZDP A;  3WHC A;  2NOG A;  2MC3 A;  2JSP A;  2QA4 I;  2ESN A;  4PDK A;  3HZJ A;  1QO0 D;  5J3L A;  1FBQ A;  3KP2 A;  2A3S A;  3HKZ N;  1JTY A;  3AG2 H;  1WJF A;  2LF7 A;  2DT7 B;  3A0H C;  3GFL A;  4U88 A;  1XGO A;  4EJV A;  4UHT A;  1NK2 P;  4RB1 A;  2DDB A;  2RNJ A;  1FYM A;  1CF7 A;  3HOW J;  2IS2 A;  1L3L A;  4ON0 A;  1X1D A;  4A3F J;  5LEK A;  4BHP A;  3OYG A;  4LD5 A;  1TW2 A;  2CH0 A;  4F3Q A;  2VXZ A;  2EIL H;  3DEE A;  2EJR A;  1YFH A;  1J2X A;  1R58 A;  3H3Z A;  1V5F A;  4EVI A;  2FA5 A;  2PX9 A;  3S32 A;  1OYY A;  4M3G A;  1RET A;  2O0Y A;  2CO5 A;  1SMT A;  5D5W B;  2E35 A;  3ROU A;  2VLA A;  2LKS A;  3K4K A;  1O3R A;  1OYW A;  3DLL F;  1HKS A;  2Y69 H;  1W5T A;  3KE2 A;  1R1V A;  2M8E A;  4R79 A;  1LFP A;  2YR2 A;  4WXD A;  3F23 A;  1YG2 A;  2FE3 A;  4G9Y A;  1BN5 A;  2KDZ A;  5CVV A;  2MW8 A;  1B9N A;  4PFP A;  1H88 C;  2EV0 A;  4O5V A;  2XUB A;  1B59 A;  1N77 A;  1XMA A;  3BTC A;  2HQA A;  3L7W A;  1IF1 A;  2LKX A;  3LFK A;  1GVJ A;  4MIM A;  2BVL A;  3HYI A;  3WTY C;  2HOS A;  1RZ4 A;  4AVZ A;  5IT9 K;  1OIS A;  3SZP A;  1HLV A;  3ECH A;  2COB A;  3QP6 A;  5ERI A;  3PSI A;  4DYQ A;  4CCK A;  4BXF A;  3G1O A;  3E7L A;  3PQK A;  2LY2 A;  3KP5 A;  2PJR B;  1SD4 A;  3BJA A;  3CCV I;  4UUS A;  5FKM A;  1Y6I A;  5IYC J;  5FKL A;  2XSJ C;  5F6F A;  1LDJ A;  1XX5 A;  3ZMZ A;  5TIS C;  2OV7 A;  3JRA A;  5J1Y A;  2MH9 A;  3Q3S A;  3H3V K;  3N05 A;  4EMS A;  3CTA A;  3CDH A;  3GYH X;  1VQL I;  5IYD J;  1AA7 A;  2PQ8 A;  1B72 A;  2ZSI B;  4EEF G;  1K7A A;  3SDG A;  3V4G A;  2KMU A;  3R0A A;  3ZQC A;  4A93 J;  4L9N A;  3HSE A;  3EUH A;  1GT0 C;  2EK5 A;  1FX7 A;  1J09 A;  3JRD A;  1GUU A;  2ID6 A;  4LG0 A;  4A69 C;  5HNH A;  4JBA A;  4F93 B;  4CO8 A;  1RKW A;  4ESJ A;  3HOT A;  2VBY A;  2GXB A;  1ZRF A;  1H8A C;  1W1W E;  2DA3 A;  1HSJ A;  3GTQ J;  1FMV A;  1MMD A;  3JW4 A;  3H5A A;  4XKV A;  2JPC A;  4YIR X;  1UFM A;  2ZXI A;  1SD5 A;  3C2H A;  2UXX A;  4HOB A;  1DP7 P;  2NVT J;  2ESH A;  4WXC A;  3V42 A;  1TQI A;  4IOC F;  2Z99 A;  4HQM A;  4RM2 A;  2ZCW A;  2HQN A;  2KDO A;  3UNG C;  3BR6 A;  2X6Y A;  5IPA A;  4KT6 A;  4D1Q A;  3A01 B;  5ED4 A;  3REO A;  2O03 A;  2VQG A;  1AKH B;  2AXL A;  1VI0 A;  2QZ8 A;  5ICE A;  1WI9 A;  2A5W A;  1P4A A;  2PEX A;  2XVC A;  1FSH A;  5DD8 A;  4HNV A;  4U0Y A;  4PJM A;  4CZZ A;  4J19 A;  1HKT A;  5FLX Z;  3C18 A;  4IX7 A;  4G6Q A;  2JPB A;  3JRE A;  1Z77 A;  1J59 A;  4A0X A;  3K4C A;  4CGZ A;  3T5X A;  4UVA A;  4XKC A;  4DBQ A;  3KX2 A;  3GZN B;  2R5Y A;  4Y7N J;  2E19 A;  2MD0 A;  3W2V A;  2W84 A;  2RRE A;  3BJ6 A;  2LVS A;  3BDD A;  4JP0 A;  5CVU A;  3ZMS A;  2L7Z A;  3IH3 A;  4ZZD A;  3S14 J;  1G2H A;  5EZH A;  3GZ6 A;  4BNC A;  1UG2 A;  2ZC2 A;  1JUP A;  2EZL A;  5CQG A;  1E3O C;  3SFI A;  2D5V A;  4Q48 A;  4QPQ A;  2PMH A;  1ZGW A;  4QPO A;  1MMG A;  2F5E A;  3LQQ A;  1G3S A;  1FMW A;  4I02 A;  3WU2 C;  5HS8 A;  2VOP A;  1Z3X A;  3CCJ I;  2NAZ A;  3T8R A;  3V7S A;  2YS9 A;  3S2H J;  1OCR H;  4UV9 A;  3TBI A;  2Y48 A;  4LIV A;  3QYF A;  5B5E C;  3SZG A;  2DA4 A;  3GEZ A;  2OCE A;  1OKR A;  2FU4 A;  2LK2 A;  2BV6 A;  4XRS A;  1PUF A;  4IHT A;  2L9V A;  2OTJ I;  1V5G A;  2ZXH A;  5D8L B;  1YW8 A;  4D0P A;  1D8J A;  3RPQ A;  2BY1 A;  1HW5 A;  4CIC A;  4ASN A;  1W0U A;  1YIT I;  3J7A Y;  3VYU B;  3EDP A;  3CO6 C;  2IRF G;  1RUN A;  2QM3 A;  5LFA A;  4BE1 A;  1TNS A;  1JKQ C;  3FBN B;  4AYB A;  5IP6 A;  2FXA A;  2XPV A;  4NB5 A;  2Z3Y A;  5ICC A;  1OCO H;  3M1C A;  4JK1 X;  3TQN A;  2F5D A;  3BG9 A;  2XGD A;  1W36 D;  1D1B A;  2RAE A;  1ZGJ A;  3KZY A;  1MIJ A;  1ETY A;  2CV0 A;  2K9S A;  3G2B A;  2GIV A;  2F48 A;  2QGU A;  4L18 B;  1XG1 A;  1SAN A;  4XN3 A;  3CCU I;  4BQN A;  3ESW B;  1U0J A;  4KIG A;  4I7H A;  3TDZ C;  5K5R A;  4AU7 A;  1T33 A;  5LGT A;  3IV5 A;  3GXO A;  2A05 A;  4XBF A;  3CCS I;  2Y0S N;  2Z1D A;  3OYA A;  2DPD A;  2L5Q A;  2DFH A;  4KYW A;  2PBI A;  4Y52 J;  2FBH A;  3ABL H;  2ACJ A;  2OBP A;  5BNG A;  2AHQ A;  4B3X A;  2XPW A;  2ME6 A;  2JQ7 A;  1U5T A;  4XLF A;  2X85 A;  3MZH A;  1NH3 A;  3LSG A;  2K02 A;  1MW7 A;  1FYL A;  1D1C A;  2A68 F;  1FJL A;  2XAU A;  2LH9 A;  2K5C A;  3DCF A;  2VBX A;  4O6J A;  1K4S A;  1HQC A;  3IP4 B;  1N25 A;  1S5L C;  4ESF A;  2KLO A;  1T0F C;  2K3F A;  2HTJ A;  2HXO A;  5IYB J;  1QZY A;  3GFJ A;  5IT9 Z;  3MKW B;  3Q9S A;  3RZD J;  4ZJZ A;  3MCZ A;  2R4G A;  3KEO A;  1R6R A;  1ZRC A;  4RAG A;  2NNY A;  2RDP A;  2CMP A;  3BG5 A;  2X0L A;  1Y1W J;  2LRE A;  3L2V A;  4GO1 A;  4KIB A;  4PGH A;  2W82 A;  2ZBK A;  3GX4 X;  1A35 A;  3M1E A;  5M5X J;  1DGR M;  2ZXW H;  3J7Y J;  3HUG B;  2AQE A;  3PO2 J;  4BY1 J;  1XCB A;  2DJI A;  2R7U A;  2IS6 A;  1UHM A;  3MWM A;  3VYT B;  4C2T A;  2VPR A;  1EKE A;  2BVM A;  1JUM A;  3VB2 A;  3LAP A;  2QKM B;  1NG6 A;  2A69 F;  3QU6 A;  2LFB A;  3PSF A;  5AIP A;  1TW3 A;  2OTL I;  2H1K A;  5IOY A;  5KAF C;  1QGP A;  4ZYE A;  1U78 A;  5K7Z A;  3QQA A;  3L1P A;  2R0Q C;  4PZJ A;  2BE5 F;  1T38 A;  1VQ5 I;  1ZAR A;  2ZME B;  2CW7 A;  3TOB A;  5EEH A;  1YS7 A;  3F22 A;  2V79 A;  2HDW A;  1IUY A;  2M5W A;  2CSO A;  3DF8 A;  3DBH B;  4HSR A;  4MGR A;  1SFE A;  5KNL A;  2X4H A;  3BG7 A;  2CG4 A;  3LWF A;  1ZG1 A;  4OMY A;  3IWF A;  1K78 A;  4G7H F;  3RPU D;  2E5Z A;  4G6T B;  1X2M A;  1MZB A;  4NQW B;  2A07 F;  2FML A;  4EJT A;  2LNB A;  4RGU A;  3M9A A;  5GPC A;  2CQ7 A;  2V1N A;  5J4Y A;  2M2E A;  4D5C A;  4DZP A;  4M6Y A;  1LNW A;  2HR3 A;  4ZZL A;  3TP3 A;  3PM1 A;  2XB5 A;  3HOS A;  1KYW A;  3BZ6 A;  2ECB A;  2W7N A;  4BY7 J;  5DEQ A;  1BJA A;  2MD5 A;  3HTS B;  3ABT A;  1R5H A;  2K3P A;  3AFH A;  1LUJ B;  4KT5 C;  2BYV E;  1ITY A;  1WVR A;  3HGG A;  4RB3 C;  2L7M P;  4XQF A;  4OIN F;  3K69 A;  3TP0 A;  3I9V 2;  3G1L A;  1BR4 A;  4RDU A;  1L0O C;  3S2W A;  5F1J A;  4BEH A;  1LFU P;  1R5G A;  2K40 A;  2VJJ A;  1SMY F;  2QSF X;  3A0B C;  1QQI A;  3DKW A;  3GTO J;  2W24 A;  2XDV A;  4C9Y A;  1JJ8 C;  2X6O A;  3KLO A;  4U7D A;  3QAH A;  4P55 A;  1XDS A;  2Q0O A;  1FOK A;  4DZJ A;  4C3J J;  1HDP A;  4IZZ A;  2CU7 A;  4E4H A;  3I56 I;  2WB1 N;  3P9K A;  1R22 A;  4KN7 X;  3SYT A;  4QSH A;  5EDN A;  3C2G A;  4FHT A;  3LAJ A;  3QPS A;  3NWT A;  3F72 A;  1JKP C;  3WTW C;  5LRS A;  2DFE A;  5ILU A;  3WGI A;  5CVI A;  2FEZ A;  5GP9 A;  5KVR A;  2OUM A;  1YOV B;  2GM4 A;  5GTH C;  1QPI A;  4II2 A;  4FAS D;  3HHG A;  1XSV A;  2ZFU A;  3IRQ A;  2K86 A;  1D1A A;  1PP8 F;  2KFD A;  3VSK A;  4BL0 B;  5GAG J;  2DMU A;  2KQR A;  1IAW A;  1WH7 A;  1ZN2 A;  2QQ8 A;  2KIU A;  4F92 B;  4OU0 A;  3OY9 A;  1F1Z A;  2COM A;  4XK4 A;  1IDY A;  3QOP A;  1UEL B;  1H9T A;  1XMK A;  1FWZ A;  1YRN B;  2DU9 A;  3WGH A;  2E1O A;  3DXJ F;  4M6V A;  1P7J A;  3RZO J;  1DU0 A;  2X51 A;  4YEL A;  3SHF A;  5CVJ A;  3E5X A;  3OSF A;  4PJN A;  1S3J A;  2RKH A;  4Y17 A;  4IHS A;  3W2W A;  3F9K A;  4CDG A;  4E7Z A;  5K7F A;  1FZP B;  3F3X A;  1X19 A;  3SXY A;  3IC7 A;  5J4V A;  2PLY A;  4LOC A;  1S29 A;  1FTT A;  4XR6 A;  2FNP A;  5ICG A;  3OL4 A;  1X1C A;  2KJC A;  3E0J B;  3SEQ A;  3FM5 A;  4A2U A;  3HPH A;  4B48 A;  1MD0 A;  1VTN C;  2IAI A;  2M0M A;  1XD7 A;  3NRV A;  3NWS A;  4JQF A;  2DT5 A;  4BAY A;  1Z91 A;  1MMA A;  2STT A;  5FKK A;  3E5Q A;  3HJE A;  3LSP A;  1V54 H;  2HVS A;  3MN2 A;  2Q8K A;  2VJ5 A;  3QPH A;  3C7J A;  3FDY A;  2DK8 A;  3M8E A;  1JHH A;  2HDC A;  4Y33 A;  2VBZ A;  3I59 B;  3U9G A;  3M7G A;  1ZKG A;  1WJB A;  5DCM B;  4P1W A;  4A3I J;  1S9H A;  4LGW A;  4PJ0 C;  3BG3 A;  4AIJ A;  2IGN A;  4HST A;  1RES A;  1FPQ A;  3V7R A;  3DU5 A;  2OU2 A;  2CUJ A;  2ZFW A;  4GDF A;  1TC3 C;  2XGX A;  5D6F A;  2IS4 A;  1UB9 A;  3H0D A;  2VIX A;  1POG A;  3K70 C;  4HLX A;  3H9G A;  3DTK A;  3ZQ7 A;  3J7Z I;  3O3K A;  4G7Z F;  1SAX A;  1LVA A;  2L0K A;  4CYC A;  4FE4 A;  2PN6 A;  3G1M A;  1TNT A;  5FRO A;  3GTJ J;  5ICF A;  1G3T A;  2LKP A;  3NAR A;  3R60 A;  1H0M A;  4NC6 A;  4IHY A;  4XLP F;  5E3M A;  4BJT A;  4FX0 A;  1IUF A;  4B3A A;  2CUF A;  3BJO A;  2K4B A;  3GTP J;  3HRS A;  3K1M A;  5DUK A;  5FD5 A;  2HKO A;  2IGO A;  1YHQ I;  2RV8 A;  4RLF A;  2GLO A;  3QWL A;  2K4J A;  2ELK A;  1HDD C;  2QSH X;  2DLL A;  2F4O B;  1QVU A;  2H6B A;  3BPV A;  2B9S A;  4BHC A;  4CCL A;  1VQ7 I;  2K9L A;  3ZQF A;  1F43 A;  1HCR A;  1ONV A;  2WWY A;  2WC2 A;  1E3H A;  3JRH A;  1AU7 A;  1ZH5 A;  1T0F A;  2Y31 A;  2FJ1 A;  3I0T A;  1ON2 A;  3TDU C;  3F8B A;  1B8I A;  2HKX A;  3P7N A;  3KET A;  2QSG X;  3A1Y A;  3E97 A;  2YX4 A;  2EA4 A;  3Q0W A;  1NK3 P;  2VC1 A;  2IA1 A;  5CLS A;  1IO2 A;  3U1D A;  4AM3 A;  1FIP A;  4UUV A;  2DXI A;  3BTI A;  2V6C A;  4FT8 A;  1ULY A;  2DQR A;  1QZZ A;  2JSC A;  4BJ5 C;  2NS7 A;  1HOM A;  3JRC A;  1I6X A;  3BQZ A;  1VND A;  3C3W A;  3G73 A;  3WTX C;  3ZR8 X;  2GXA A;  3RIR A;  2E5N A;  5F0C A;  1XS9 A;  4GFB A;  1T08 B;  3HGY A;  3OYN A;  2WBM A;  2CFO A;  3R61 A;  1MBJ A;  4M9X A;  1A04 A;  2HQ5 A;  4BS9 A;  2F6C A;  1NTC A;  2DA7 A;  2HNH A;  4HW0 A;  1R23 A;  1A6Q A;  1S7O A;  2STW A;  1TL8 A;  3SFZ A;  3K4N A;  1JT6 A;  4IPA A;  5HOD A;  4A6D A;  2DCE A;  2O61 A;  3ZQH A;  4AC0 A;  3CCQ I;  2IS1 A;  2ISY A;  1ZGA A;  1XTA A;  2TDX A;  4H0E A;  1J5Y A;  1X3W B;  3QYB A;  1FP2 A;  3D5R C;  1E2X A;  4E6K G;  4BKX A;  1FBU A;  2EIJ H;  5DCF A;  5HVQ C;  2HGC A;  1IGN A;  6PAX A;  1X58 A;  4IHW A;  2I5U A;  2DMT A;  3KPH A;  3D5S C;  3FKI J;  3RQ4 A;  5B1A H;  1TTY A;  1Y0U A;  2EBI A;  2HYF A;  3BWG A;  2N8G A;  4IL6 C;  5C4J J;  3GTM J;  3PIP F;  3FBI B;  3HHH A;  1NHA A;  2JA2 A;  4Z6Y A;  3BP8 A;  4BAC A;  5F1R A;  1UHS A;  2AXT C;  2E60 A;  1XGM A;  4AYB N;  3E6M A;  3OL3 A;  4S0H B;  3BG6 A;  3OIP A;  4B47 A;  3OYB A;  2O8K A;  4DJA A;  3ZP5 A;  5BOX A;  5A2Q K;  1QU3 A;  2H94 A;  2P0W A;  1CQT A;  2LF8 A;  2EFO A;  2V7F A;  4EQQ A;  4UUT A;  4EJW A;  3CCM I;  3EET A;  4M6X A;  3FXR A;  5LGN A;  2W25 A;  1ZEL A;  5E3L A;  3I53 A;  4I6Z A;  4I0B A;  2ADU A;  2CV2 A;  3H36 A;  3WOD F;  5FLV A;  2XGC A;  3TO9 A;  3FXL A;  4C2M J;  3IAS 2;  1ZR2 A;  3H9J A;  3FM3 A;  4I99 C;  2MA3 A;  4UUS B;  1BOA A;  1D0Z A;  4PSW A;  4IOA F;  3KP4 A;  5M3F J;  5AON A;  2Y9Y A;  1K6Y A;  4L9T A;  4E7K A;  2VJI A;  3IKV A;  4EJU A;  1B72 B;  1LKX A;  1IV6 A;  3CP2 A;  5M5W J;  2VPL A;  2WV0 A;  5IOZ A;  1UMQ A;  2ZB9 A;  4ZYD A;  3OR2 C;  4LG0 B;  1VQK I;  1E0E A;  4XID A;  3V8J A;  1RUO A;  4N4N B;  5H2F C;  3OV8 A;  3WE2 A;  3FK6 A;  4E7I A;  1TT0 A;  3ASO H;  4CCO A;  3O6B B;  2I8D A;  3PFI A;  5EG0 B;  4LIU A;  2OA4 A;  2FUG 2;  4R8H A;  5J8C A;  1Z67 A;  3HRU A;  4MQ9 F;  1STZ A;  1FLI A;  4M72 A;  4CZC A;  2D2W A;  3I54 A;  4NNJ A;  2ZME C;  4WXH A;  5DV5 A;  3HG9 A;  3ZMV A;  4C3H J;  1T2K A;  2FOK A;  4ENK A;  3F6O A;  1ZHF A;  2FQ4 A;  4KIC A;  5HLH A;  2JN6 A;  1BI1 A;  1GDT A;  1SEU A;  4XSZ F;  1LPQ A;  2V6E A;  1BM9 A;  3RI4 A;  5KAI C;  4BQO A;  3ONQ A;  3WG9 A;  1FTZ A;  2EIN H;  2IT0 A;  2E1M C;  5FFX A;  1R49 A;  4Q47 A;  1N75 A;  1FOY A;  4RAY A;  2JK3 A;  1FY7 A;  2KHM A;  1X1B A;  1WHU A;  3FWE A;  1BBY A;  1YYV A;  2K9Q A;  2R5Y B;  4FE7 A;  4HV5 A;  1WSU A;  2VQC A;  3LSJ A;  1JT0 A;  1DU6 A;  5FFZ A;  3MAJ A;  2PJR A;  1KU2 A;  4XIC A;  5DDG A;  4JX4 A;  2F4I A;  4XON A;  1IRZ A;  3BY6 A;  3KEQ A;  1W36 C;  1WRJ A;  4DYR A;  5FKN A;  3J80 K;  2ISZ A;  3FHZ A;  1P9Q C;  3CCR I;  2GZW A;  1XDU A;  2LOO A;  1O7L A;  4XLA A;  5CJ9 A;  2CRG A; 
#chains in the Genus database with same CATH homology
 2QF7 A;  4CYC B;  1Y1V J;  3TW7 A;  3S1M J;  1IG7 A;  2VPR A;  1JUM A;  2NVY J;  2LFB A;  2DMQ A;  3BR0 A;  2XRL A;  3RQI A;  1YRN A;  3HOZ J;  1PUF B;  2H1K A;  5IOY A;  5DTD A;  2OPT A;  1U78 A;  5K7Z A;  3QQA A;  3IH4 A;  2W48 A;  1IJW C;  1D5Y A;  3CQZ J;  3L1P A;  1MH4 A;  2R0Q C;  3MKL A;  4B1R A;  2HDD A;  3BR5 A;  1K61 A;  2E2I J;  1R9T J;  2B63 J;  2DMP A;  3A03 A;  4W1U A;  3Q0U A;  4A3C J;  1ETV A;  4V2F A;  1Q1V A;  3A01 A;  1K83 J;  5GPA A;  4D5F A;  1S7E A;  1X2M A;  2YUS A;  4M3E A;  5GPC A;  1U9O A;  2M2E A;  4D5C A;  1RKT A;  4DZP A;  4XRS G;  3HOY J;  4MFD A;  3TP3 A;  4XRM A;  1ETO A;  2XB5 A;  3PM1 A;  4ABZ A;  2I10 A;  1QVT A;  5IP9 J;  1MBF A;  2NS8 A;  2ECB A;  4BY7 J;  3TW6 A;  2HI3 A;  3BTL A;  1B8I B;  3HOX J;  2NVX J;  1BW5 A;  3BR2 A;  1Z0X A;  1ENH A;  4BXX J;  2WV1 A;  3D1N I;  3OSG A;  5C4X J;  2KT0 A;  3S17 J;  1TWC J;  2VI6 A;  1BJZ A;  1ITY A;  3HGG A;  3ZOB A;  1TWG J;  2L7M P;  1OJL A;  2GBY A;  5F27 A;  3TP0 A;  3G1L A;  4L5E A;  4FTH A;  3BTJ A;  1RPW A;  4BBR J;  5E3N A;  3ZQG A;  5F0F A;  4RDU A;  1I50 J;  5F1J A;  1LFU P;  2K40 A;  5JLW A;  2DN0 A;  2M34 A;  3O8H A;  3GTO J;  3VPR A;  1ETQ A;  1JJ8 C;  2K9N A;  2X6O A;  2XGE A;  3I4N J;  3BR3 A;  1JKR C;  2IEK A;  1MBH A;  2JJ7 A;  4DZJ A;  4C3J J;  1HDP A;  2CU7 A;  4MLO A;  2ME0 A;  3S15 J;  3HBL A;  2WB1 N;  1TWF J;  4QSH A;  5EDN A;  4BBS J;  3OIO A;  2E2H J;  4A3M J;  5F04 A;  3QPS A;  2L9R A;  2LR8 A;  1JKP C;  2TRT A;  4D7N A;  2L7F P;  1MSE C;  1GV5 A;  1T56 A;  5GP9 A;  2GM4 A;  1QPI A;  1ZQ3 P;  2PMZ N;  4A3B J;  2FD5 A;  1H89 C;  2DA6 A;  5E3O A;  2DMU A;  4QIW N;  3CMY A;  2CQX A;  3FK7 A;  1WH7 A;  3HM5 A;  4W97 A;  5J1R A;  1RR7 A;  2VKV A;  4XK4 A;  3MVP A;  1IDY A;  2ECC A;  1LFB A;  5EEA A;  5EYR A;  3JRG A;  2JA6 J;  1YRN B;  1WCM J;  2E1O A;  4M6V A;  1P7J A;  3RZO J;  1DU0 A;  2LP0 A;  5EG0 A;  1MNM C;  1LE8 B;  3OSF A;  5J1U A;  1MBE A;  5K7F A;  5C44 J;  3S2D J;  3SJM A;  3B6C A;  4LOC A;  5IP7 J;  1FTT A;  5FJ8 J;  3K2A A;  3W6V A;  5M3M J;  1XC5 A;  3BR1 A;  1U8B A;  2VUM J;  2XSD C;  3UKG A;  2JA7 J;  3PO3 J;  3GBG A;  2IAI A;  2FX0 A;  2HOA A;  4B4C A;  5FKK A;  3WHC A;  2NOG A;  1ETX A;  3LSP A;  2JA5 J;  3MN2 A;  5J3L A;  3HKZ N;  1JTY A;  2IBD A;  4G12 A;  1NK2 P;  4DYC A;  1ZKG A;  3HOW J;  4A3I J;  3IH2 A;  1MBG A;  3BG3 A;  4AUX A;  4A3F J;  2LY9 A;  3Q0V A;  3JRB A;  1HF0 A;  1RES A;  1AKH A;  1I3Q J;  1TC3 C;  1WGX A;  1A5J A;  3C2B A;  2O7O A;  1POG A;  3DEW A;  5EGO A;  3A02 A;  4D7M A;  4M3G A;  2AO9 A;  1VF9 A;  1RET A;  2L0K A;  4CYC A;  2DA2 A;  4FE4 A;  2XPU A;  2VKE A;  4A3L J;  3G1M A;  1FEX A;  3GTJ J;  5FLM J;  2R92 J;  5C3E J;  3NAR A;  2LD5 A;  1TWH J;  4IHY A;  3JR9 A;  2EZI A;  2KDZ A;  5E3M A;  2O9L A;  3GTL J;  1JJ6 C;  2G0E A;  2MW8 A;  5JLX A;  1IUF A;  4B3A A;  2CUF A;  1H88 C;  3HOU J;  3GTP J;  3BTC A;  2LKX A;  2HOS A;  3GTG J;  4MIM A;  2DJN A;  2GLO A;  4A3J J;  2ELK A;  4FCY A;  1HLV A;  1HDD C;  2COB A;  1P7I A;  1QVU A;  4DYQ A;  2TCT A;  3GTK J;  3G1O A;  2H8R A;  3E7L A;  2JMW A;  4V2G A;  3ZQF A;  4X1E A;  1HCR A;  4UUS A;  1F43 A;  5FKM A;  2HOT A;  5IYC J;  5F08 A;  5FKL A;  2DA5 A;  5EZG A;  9ANT A;  4JX6 A;  2MG4 A;  3JRH A;  3JRA A;  2DTZ A;  5J1Y A;  1AU7 A;  4M3D A;  3Q3S A;  2LLK A;  2FJ1 A;  2Y31 A;  3CDL A;  3H3V K;  5IYD J;  1B72 A;  5EF6 A;  4EEF G;  1B8I A;  3SDG A;  2MSY A;  3ZQC A;  4A93 J;  4A3D J;  3Q0W A;  1GT0 C;  1NK3 P;  2JA8 J;  2Y2Z A;  1GUU A;  2ID6 A;  3JRD A;  1FIP A;  4A69 C;  3FIS A;  3S1R J;  2XB0 X;  3BTI A;  1RKW A;  1ZTR A;  2P81 A;  2NS7 A;  1HOM A;  2EQR A;  3JRC A;  1H8A C;  2DA3 A;  1O4X A;  3M3Y J;  3GTQ J;  1BA5 A;  3BQZ A;  1VND A;  3B6A A;  3LNQ A;  1XS9 A;  5F0C A;  4GFB A;  3HGY A;  2NVT J;  1MBJ A;  2HQ5 A;  1NTC A;  2DA7 A;  1VFC A;  1W0T A;  1WPK A;  2Y30 A;  5M5Y J;  1JT6 A;  5HOD A;  2R5Z A;  3M4O J;  3BR6 A;  3A01 B;  5IPA A;  3S1Q J;  1AKH B;  3ZQH A;  1X2N A;  4AC0 A;  1VI0 A;  1SFO J;  1I6H J;  3HB9 A;  4HNV A;  3LOC A;  1OFC X;  4J19 A;  5EGO B;  5DS9 A;  3QPL A;  3JRE A;  1JTX A;  1Z77 A;  4BKX A;  2HXI A;  1F36 A;  1IGN A;  4MO7 A;  2R5Y A;  4Y7N J;  2E19 A;  1X58 A;  4IHW A;  2DMT A;  3F0C A;  3FKI J;  1TWA J;  5K7H A;  2EBI A;  3OOU A;  2LVS A;  4IHX A;  2N8G A;  4JP0 A;  5C4J J;  3GTM J;  2L7Z A;  3IH3 A;  4JX5 A;  3S14 J;  1G2H A;  5EZH A;  3S16 J;  1UHS A;  1GV2 A;  1JUS A;  1UG2 A;  3I4M J;  1JUP A;  2EZL A;  4AYB N;  3H0G J;  1E3O C;  3SFI A;  4S0H B;  1LE8 A;  2D5V A;  4M3F A;  1IDZ A;  4JYK A;  1ZGW A;  2O8K A;  1OCT C;  1ORK A;  2X9D A;  1CQT A;  4IEJ A;  4UUT A;  2LTP A;  3TED A;  2YS9 A;  1QRY A;  3S2H J;  2DA1 A;  4RBO A;  5E3L A;  2X48 A;  4I6Z A;  2EZK A;  2DA4 A;  3ZQL A;  5FLV A;  4X6A J;  2XGC A;  1AHD P;  5FKO A;  2LK2 A;  4C2M J;  2DMN A;  1ZR2 A;  3LSR A;  4XRS A;  4UUS B;  1PUF A;  2YU9 J;  4M3B A;  4A3K J;  3JRF A;  5M3F J;  5F0H A;  1U9N A;  4IHV A;  1BW6 A;  2Y9Y A;  2ID3 A;  2M9H A;  1W0U A;  1MBK A;  2M0C A;  3BQY A;  1B72 B;  3JRI A;  1IV6 A;  1FIA A;  1ETW A;  2HYJ A;  5M5W J;  5IOZ A;  1A6I A;  1UMQ A;  1WH5 A;  2EH3 A;  2ZB9 A;  2JWT A;  1JKQ C;  3S1N J;  5IP6 A;  2NVQ J;  3ZQI A;  2XPV A;  1BL0 A;  4XID A;  2Y9Z A;  1IC8 A;  3BG9 A;  2XGD A;  1ETK A;  3FK6 A;  2RAE A;  2EZH A;  1MSF C;  2E2J J;  1ETY A;  2K9S A;  5EG0 B;  4NDL A;  3RKQ A;  1XG1 A;  1JKO C;  1SAN A;  2M8G X;  2QCO A;  3HDD A;  3HOV J;  1T33 A;  3IV5 A;  4I76 A;  3WHB A;  2Y0S N;  2R7Z J;  1WI3 A;  4C3H J;  2R5Z B;  1ZR4 A;  3NAU A;  4DW6 A;  2FQ4 A;  4QTR A;  2WAQ N;  2R93 J;  2JN6 A;  3CCY A;  1GDT A;  4FIS A;  4Y52 J;  5BNG A;  2AHQ A;  1FTZ A;  3HEF A;  2XPW A;  1MH3 A;  2OF7 A;  2ME6 A;  2MGQ A;  2CJJ A;  4MFE A;  3LSG A;  1ZK8 A;  1FJL A;  2JK3 A;  4A3E J;  3BT9 A;  3DCF A;  4C3I J;  3FIW A;  2K9Q A;  2R5Y B;  4FE7 A;  1DU6 A;  3LSJ A;  1JT0 A;  1EF4 A;  2HXO A;  5IYB J;  4A3G J;  2CQQ A;  3RZD J;  1APL C;  4XIC A;  4JX4 A;  3BG5 A;  1Y1W J;  1IRZ A;  1JGG A;  3K7A J;  4DYR A;  5FKN A;  1OCP A;  2CUE A;  3O8G A;  5M5X J;  1GVD A;  3PO2 J;  4BY1 J;  2CRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...