4A3IJ

Rna polymerase ii binary complex with dna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3iJ00
3HEFA 2FX0A 3SJMA 1VF9A 2L7MP 3HBLA 3F0CA 2LY9A 1H88C 1YRNA 5EGOA 3ZQIA 4M3GA 1Z77A 3LOCA 3BQYA 3JRGA 3CMYA 4AUXA 1IJWC 3A03A 4XRSG 5FJ8J 4HNVA 3BTJA 1WCMJ 2R5ZA 4DYQA 3LSRA 4B4CA 1B8IA 5E3LA 1JKRC 2HQ5A 2FD5A 1LE8A 1IRZA 1TWCJ 1ETVA 5EZGA 4B3AA 5M3MJ 4IHYA 1HDDC 2MSYA 3S16J 3HGYA 2VPRA 1DU0A 1FJLA 2DMPA 5FLMJ 4GFBA 5J1RA 5M5WJ 2Y30A 2K9NA 2M9HA 1JGGA 3GTKJ 1VFCA 2HYJA 2JA5J 5IP6A 5M5YJ 5K7FA 1MH3A 4M3FA 2VUMJ 3RQIA 2EH3A 3HB9A 3Q0WA 2EZHA 5FKNA 3TEDA 5M5XJ 2FJ1A 1IV6A 1FIAA 4FE4A 5GPCA 2TCTA 4C3IJ 9ANTA 3JRCA 4JYKA 3QPLA 5EYRA 2XGEA 3CQZJ 2ELKA 2ECCA 2G0EA 3BTLA 3D1NI 1UHSA 3LSJA 2LLKA 2B63J 1ETWA 2XPVA 1TWGJ 4X1EA 3A01A 4A3JJ 3MVPA 1O4XA 4V2FA 1K83J 3A02A 1ZR2A 3FKIJ 2NOGA 2MW8A 2IBDA 4A3FJ 1BW6A 2HI3A 1LFBA 4M3EA 1G2HA 1JTXA 3IH4A 4IHXA 3S14J 3G1OA 1IC8A 3FK6A 2OF7A 2X9DA 1RKTA 1B72A 1HF0A 3LSGA 1F43A 1WI3A 2MG4A 3JRDA 3HOUJ 3HOZJ 5J3LA 3Q0VA 2PMZN 2LP0A 1JUPA 1VI0A 1BL0A 1RETA 3CCYA 1I50J 1T33A 2NVXJ 1LFUP 3K7AJ 4XK4A 1Q1VA 2QF7A 4FCYA 4A3GJ 2XRLA 2NS7A 3GTQJ 2NS8A 1IGNA 5E3MA 4IEJA 1TC3C 1MBKA 4MFEA 2I10A 3ZQGA 5K7ZA 1MNMC 2NVQJ 2M0CA 3QPSA 4B1RA 2R0QC 2EZIA 1UG2A 3FIWA 1MBGA 3C2BA 5IYCJ 3PO2J 2DA2A 2VKVA 1FIPA 4D7NA 2GLOA 2L7ZA 3M4OJ 2O8KA 1GDTA 2ECBA 1TWAJ 3LSPA 5JLWA 1AU7A 3B6CA 2R7ZJ 5IYDJ 3MN2A 3BR5A 1A5JA 3DEWA 1IDYA 4I76A 3S1QJ 5J1UA 1E3OC 3H3VK 4UUSB 1GUUA 2P81A 2COBA 2N8GA 2K40A 2D5VA 3RZDJ 2EZKA 1F36A 3PM1A 3JRHA 5FKMA 2LD5A 4IHWA 2CUEA 2GM4A 4A3BJ 5EF6A 4A3CJ 4A3MJ 3OSGA 1I3QJ 1A6IA 2DA6A 3BR0A 1U78A 3S2HJ 3TP0A 2JN6A 2E1OA 2MGQA 3RZOJ 2CQXA 1QPIA 5IPAA 2ME6A 1X2NA 2ZB9A 3Q3SA 5FKLA 1AKHB 3DCFA 3M3YJ 3TW6A 1U8BA 5IOZA 1MSEC 1ETKA 1U9NA 2R93J 2EZLA 5E3OA 3RKQA 2FQ4A 5K7HA 2HOSA 4JX4A 1BA5A 2LTPA 2Y9YA 3BQZA 4DW6A 4MLOA 5HODA 1MBEA 2XB0X 3IV5A 3S1MJ 1GT0C 2M8GX 1TWFJ 2L9RA 1FEXA 2IAIA 2NVYJ 2JJ7A 2DMQA 4DZPA 3BG9A 4L5EA 4BBSJ 4I6ZA 1PUFB 2JA8J 1WPKA 2WAQN 2KT0A 2HXOA 1HCRA 5FLVA 3E7LA 3ZQHA 4QIWN 1DU6A 2WV1A 5F08A 1APLC 1JTYA 3JR9A 1WH5A 4XRSA 3SFIA 1ZTRA 2XGCA 5EEAA 1HDPA 4A3KJ 4EEFG 1MBHA 3IH2A 1JT6A 2L7FP 4JX5A 4BKXA 1R9TJ 2VKEA 2EBIA 1D5YA 3BR3A 3JRAA 3GTGJ 1EF4A 2DA5A 3HOXJ 1BW5A 1RPWA 3BT9A 4UUSA 1IDZA 4XRMA 1OCTC 3BR1A 1Y1WJ 1IG7A 3S1NJ 4ABZA 1OFCX 2EQRA 4Y7NJ 2CRGA 3H0GJ 2H8RA 4BXXJ 1H89C 4W1UA 3W6VA 1K61A 1JJ6C 2XPWA 2E2HJ 2DA4A 3WHBA 1ETQA 3TW7A 4C2MJ 2XB5A 1W0UA 3ZQLA 3GTOJ 1W0TA 2JA6J 5F0FA 1QVUA 5DTDA 3IH3A 3Q0UA 3I4MJ 1HOMA 5C44J 1HLVA 2XGDA 4XICA 2K9QA 5EDNA 1AKHA 2AO9A 4XIDA 4DYRA 3HKZN 3HDDA 4A3DJ 2CJJA 3GBGA 1MBFA 5J1YA 4FISA 3BTIA 3LNQA 2R5YB 4MO7A 3HOWJ 4C3JJ 2WB1N 2LR8A 5M3FJ 2M2EA 5IOYA 3MKLA 1Y1VJ 2LK2A 1ZGWA 2E2JJ 2O9LA 3B6AA 3TP3A 3FISA 1X2MA 4D5FA 5EG0B 3JREA 2QCOA 3WHCA 4UUTA 1PUFA 1X58A 1ITYA 4A3LJ 2YUSA 3OOUA 2O7OA 4JP0A 2JWTA 2HOTA 2L0KA 2AHQA 1QVTA 2LFBA 2LKXA 4AYBN 1SANA 3BG5A 4DZJA 2IEKA 2DA3A 4D7MA 4NDLA 2X6OA 1JT0A 4QSHA 1S7EA 3HGGA 4AC0A 4A3IJ 4BY7J 3JRBA 1IUFA 2HDDA 3K2AA 5F04A 5C4XJ 5F27A 3S17J 2DN0A 1JUMA 3S15J 5EZHA 2JMWA 4CYCB 2ID3A 4FE7A 1ZK8A 4MFDA 3GTPJ 3G1MA 3S1RJ 1ZKGA 2CQQA 1SFOJ 3O8GA 1RR7A 1OJLA 1AHDP 2E2IJ 2Y31A 2Y2ZA 4A69C 1JJ8C 3O8HA 2M34A 1NTCA 2JK3A 2DTZA 1WH7A 2VI6A 1POGA 1NK2P 2TRTA 5C3EJ 1UMQA 1JKPC 1CQTA 1MSFC 4M3BA 4BY1J 3VPRA 4S0HB 5DS9A 4A3EJ 5F1JA 4G12A 3HOYJ 2DJNA 2DMUA 3FK7A 3OIOA 1GV5A 1YRNB 3QQAA 1ETOA 1ETYA 2R92J 5EGOB 2HXIA 4IHVA 2XPUA 3SDGA 4BBRJ 4J19A 4DYCA 2KDZA 2Y0SN 2DMTA 2R5ZB 3NARA 2OPTA 3UKGA 1XS9A 3CDLA 1QRYA 1B8IB 2R5YA 1LE8B 1GV2A 2H1KA 1T56A 3GTLJ 5GP9A 5IP7J 2DMNA 3L1PA 1JKQC 2E19A 1U9OA 2CU7A 2RAEA 4W97A 1H8AC 5EG0A 4M6VA 4RBOA 1ETXA 5IYBJ 5IP9J 2GBYA 1ORKA 3BR6A 1RKWA 3NAUA 4FTHA 1ZR4A 1Z0XA 2NVTJ 3HM5A 5C4JJ 1XG1A 3PO3J 3HOVJ 2DA7A 4M3DA 3JRFA 3I4NJ 4MIMA 4D5CA 3G1LA 1RESA 3OSFA 3ZOBA 2Y9ZA 5E3NA 4RDUA 5BNGA 1MH4A 2DA1A 4V2GA 4QTRA 1FTTA 3BG3A 1TWHJ 1MBJA 3BTCA 1ZQ3P 1WGXA 3A01B 1FTZA 4Y52J 4A93J 3BR2A 5FKOA 5GPAA 1BJZA 5JLXA 2YU9J 1OCPA 4X6AJ 3S2DJ 4LOCA 5F0HA 2ME0A 2HOAA 2XSDC 1I6HJ 2LVSA 2CUFA 4CYCA 3GTMJ 4JX6A 1P7JA 2W48A 5F0CA 2ID6A 3ZQCA 2K9SA 1B72B 1NK3P 1JUSA 1ENHA 2JA7J 5FKKA 3ZQFA 1GVDA 1P7IA 2X48A 4C3HJ 3JRIA 1JKOC 1VNDA 2YS9A 3GTJJ 1XC5A
chains in the Genus database with same CATH superfamily
1VZ0A 2I8DA 3SJMA 5KVRA 1PUEE 2ESHA 1JXSA 4UVCA 4BYYA 2KJCA 2KRFA 3CCLI 2MC4A 1ZN2A 3EYIA 3L2RA 4M3GA 4KFCA 2EINH 4P5OA 3LFUA 1V5FA 3PUFA 4AUXA 3A03A 4GGGA 3IRQA 4BDYA 1UJ8A 4A6DA 5E3LA 4UVBA 3WTYC 2ZSHB 2FD5A 1R6RA 4BNCA 3JTHA 2QSFX 3KCCA 5CYVA 5M3MJ 3LL7A 3HGYA 1VQ5I 1DU0A 1FJLA 4M72A 4M74A 4F55A 5FLMJ 1FYLA 1WQ2A 4GFBA 3DF8A 1RC9A 3F8FA 2Y30A 2GA1A 5BPIA 5HS9A 4WF2A 1QQIA 1V54H 2HYJA 2JA5J 5D6EA 1VQMI 1VQ9I 2LNBA 3LSHA 2EH3A 3HB9A 1JHHA 4A12A 4I2OA 1K6OA 3BPVA 1QGPA 3VWBA 2LDUA 3IC7A 3JRCA 3AFHA 2H6CA 1MMDA 1WJEA 2PLYA 3D5RC 3D1NI 3LSJA 2LLKA 5CVVA 2B63J 2KJBA 2ICWG 2P5LC 1LJ9A 3MVPA 4I98B 1MD0A 1U5TB 1YS6A 1K83J 4NUBA 5HVQC 3P7NA 2NOGA 3QP5A 2IBDA 3K2ZA 4UB8C 3I56I 2DW4A 2W4SA 3J7AO 2WBMA 2E5NA 3W6KB 2IVMA 1D0ZA 1KZHA 2DJIA 4EJWA 1G2HA 3S14J 3FDYA 2ZMEA 1IC8A 3SZTA 2O5RA 1YIJI 2X9DA 1OMIA 3MAJA 2RN7A 1Z7LA 4BE0A 1ZH5A 1WHUA 2VQHA 2A6HF 3LSGA 4KT5C 1F43A 1WI3A 2EILH 2RV8A 3KYDB 3JRDA 3HOZJ 1WJFA 1JUPA 2P5KA 2VXZA 3MZ8A 1BL0A 1RETA 3CCYA 1T33A 2R7RA 3K7AJ 4RGXA 3KFWX 1Q1VA 2DT5A 1OKRA 4B48A 1REPC 5E1XA 3IKVA 4IEJA 3GX4X 1TC3C 2F4MB 3BP8A 4HOBA 2XVCA 4KMFA 3ZQGA 3ZN1A 2M0CA 5LGNA 4B1RA 3SYTA 1P2FA 1Z6TA 1MNEA 3C2BA 5CJ9A 3HL2A 4XSXF 2VKVA 2DQRA 2QGUA 2F48A 2LREA 2ECBA 4UUVA 1FOWA 2R7OA 1Z91A 2E5ZA 2W1OA 5JLWA 2LY2A 2HKXA 3PQKA 1AU7A 2DU9A 5IYDJ 1R5ID 3MN2A 3BR5A 1O57A 3T0YA 3MKYB 3I4PA 3HSEA 4XL9A 2UUZA 4PSXA 3L2CA 3FXOA 1HW5A 2COBA 4HX4A 3C3WA 2N8GA 2BW3B 4GO1A 3ROUA 1F36A 2M4GA 4KIFA 4I99C 3PIOF 3JRHA 3DTEA 4AIHA 3HHGA 3KZZA 4XRFA 1CF7A 2CUZA 3E5XA 4IHWA 2GM4A 5EF6A 3GLLA 5CKTA 5CVIA 4A3MJ 4RMNA 6PAXA 1K6YA 3K4LA 5LHGA 1I3QJ 3K4JA 3MKWB 1U78A 2ZSIB 2JPBA 3G6EI 2CQXA 5EEGA 1DUXC 5IPAA 4AWXB 3FXKA 1V4RA 5L3EA 4E70A 2BHYA 1O3RA 1TP4A 2OAZA 3CUQB 1J7KA 1KU3A 3ELKA 4XKBA 5HOOA 4KA4A 1LDJA 5DDGA 2E1MC 3JW4A 5KK1A 5E1WA 5IOZA 3E6BA 1ETKA 1U9NA 3MWMA 3V7SA 5E3OA 4PFPA 4BS9A 2F5DA 3LSKA 4G6TB 5K7HA 2WV0A 2FBIA 3DBRB 1QO0D 3BQZA 1N25A 1J09A 1UHMA 3I9V2 1UAAA 2K27A 3IV5A 1IW7F 4YIFA 5JHFA 2W82A 3DKXA 2M45A 2K86A 2GA2A 3AG2H 4CZCA 1IRFA 2Y75A 2KMUA 4XR6A 1FMVA 3DTKA 2DMQA 3ZMZA 5B66C 2W85A 5L3DA 4IX7A 2IGKA 4KNYA 5ERIA 1PUFB 5LHHA 1IN4A 5FLVA 3E7LA 3I5UA 2WV1A 3KP7A 1H9GA 1KU9A 3DXJF 1T38A 3A2KA 5F08A 2ZFUA 3OOPA 1APLC 3BZKA 2M7BA 2QYOA 1L3LA 4AIKA 4BE2A 3SFIA 1Z67A 3CMAI 1XDSA 1P6RA 2L7FP 4OAZA 4BKXA 1R9TJ 2EBIA 4LK0F 4XN3A 4OIOF 2A6TA 3CMMA 1J5YA 1R1TA 3M8EA 3HOXJ 4Z6YA 3QAHA 4F92B 5KCMA 2BE5F 3WE2A 5E18F 3BR1A 4RAYA 1Y1WJ 4ABZA 2DO7A 2EQRA 4F93B 2Y69H 2CUJA 3H0GJ 1YJWI 2H8RA 4BXXJ 2WWYA 4W1UA 2BBYA 3AKZA 2GXBA 1K61A 1P4XA 2C6YA 1Z21A 1USTA 3H0DA 2XB5A 3FWEA 4LLGF 1FNNA 4I0AA 3S93A 2JA6J 3F3XA 5F0FA 2BVLA 3A1YA 3IH3A 1X3WB 1BC7C 2X6XA 3TOAA 3QYBA 1YHQI 2K9QA 1AKHA 2AO9A 2A6EF 1ZRFA 3HDDA 5J4VA 4IRIA 1H0MA 3FHZA 5JHUA 2HKOA 3C2GA 5J1YA 2P4WA 2HDWA 3M9AA 3V8LA 2L01A 2R5YB 4MO7A 2NOJB 4PGHA 4PJJA 1LDKB 2M30A 3NQOA 2XAFA 2WB1N 2OZ6A 5HDKA 5M3FJ 3VOEA 3OYLA 4PJMA 2Z33A 3BWGA 3DEEA 3WTSC 2V1NA 2P7VB 1G3TA 5A2QK 4IRHA 2CV2A 3CUOA 4XLCA 4KT6A 1X58A 3HJEA 1ITYA 3F23A 1MGTA 3OOUA 2PMUA 1IXCA 2L0KA 2ZJ2A 4NNJA 1J2XA 2M4KA 3FKJA 4EGYA 1WVRA 2LFBA 2JVGA 4HDVA 2YX7A 4Y3OA 2EV5A 2IEKA 2Z1DA 4F52A 3KEOA 3QYEA 3CCEI 3HGGA 4LIVA 2Z99A 2UWMA 4BY7J 2A5YB 1IUFA 3D0SA 3CCVI 5F04A 5L3FA 1LKXA 2VT3A 5TRDA 2H94A 1T0FC 3TMOA 4EJOA 2EB7A 3FXJA 4KN7X 3VYSB 3DTIA 1X1CA 5AIPA 3SXYA 3G1MA 2F6CA 3S1RJ 4P55A 1MJAA 1ERDA 2Y31A 1WJBA 2Y2ZA 1NTCA 4E7SA 2FSWA 1KYWA 3RJPA 3V7RA 4UHTA 4XM3A 1POGA 3MKZA 1QU3A 3ESWB 2WY7Q 3MEXA 1T2KA 4M3BA 3BG6A 3PNTA 4G7HF 5DS9A 3HOYJ 2HZTA 1K78A 2DMUA 5E8IA 3FK7A 2K9LA 3OIOA 2ZXJA 3VYUB 2HXIA 5EEHA 4IHVA 2XPUA 3RKXA 2A3SA 4J19A 2Y0SN 3X2QH 1OISA 3ONQA 2W25A 3F21A 4HW0A 1VQNI 3EETA 3AL0B 2LOOA 4K2EA 2G7HA 1GV2A 3OYDA 2H1KA 5FROA 4ZTJA 3GTLJ 2BW3A 2FNPA 5GP9A 4AYBA 2DMNA 4G7ZF 4EJVA 3L1PA 1MDMA 2NNNA 2E19A 1U9OA 2CU7A 2KIQA 2RAEA 1LDDA 2BV6A 4W97A 3VFZA 1K4TA 1H8AC 4ENMA 2MABA 3OYEA 2F5VA 3RI4A 5IP9J 3LAPA 2HEOA 3GXOA 2QLZA 2A68F 1ORKA 2LY1A 1IXRC 1UB9A 2FQ3A 4E7JA 1Z0XA 2NVTJ 4B43A 1OYIA 3IL2A 3FXRA 4EVIA 1X19A 3JRFA 3KP6A 1SFXA 2K3PA 1KQ8A 4D5CA 2QQ9A 1RESA 3ZOBA 2Y9ZA 5E3NA 5FGMA 2DXIA 1R4MB 1S7AA 2IA1A 2VJ5A 3VSKA 5D6FA 5JFRA 5DYMA 1W1WE 2GAUA 1M1EB 4B44A 4LLLA 2BGCA 4J00A 1O7FA 4A93J 2F5FA 3GFIA 1G3SA 5L3GA 4CCLA 2Y48A 2O03A 1FLIA 2V7FA 1R4NB 5JLXA 2HVRA 2YU9J 3H1CA 1MIJA 2FXAA 4DQ2A 2XSDC 3IWFA 2LVSA 2DFHA 2ZMEB 2ZKZA 2W48A 5F0CA 4MTDA 4ZYAA 1WRJA 1S3JA 2AQEA 2OCEA 1SAUA 2QQ8A 3EQLF 1T08B 2MD0A 1JUSA 2IA0A 3CDIA 4Q48A 4GYIA 1NK3P 1YTYA 1ZLJA 2X48A 2JTVA 4IF4A 1JKOC 2L3DA 2OZUA 4ON0A 2VC0A 2NXNB 1X1AA 1SVOA 3C7JA 2WY8Q 2QWWA 3CCJI 2EA4A 3H92A 1VF9A 3HBLA 3RTRA 2XF6A 3VB2A 4I01A 2PG4A 1PVEA 3ZQIA 4A0ZA 2UXXA 4A6EA 5B1AH 1G4DA 3MQ0A 3LOCA 3BQYA 3JRGA 4R1HA 4RM3A 3WU2C 4R79A 2GIVA 3LSRA 2KRHA 4B4CA 4OMYA 5LEKA 1IN7A 1B8IA 4P9UA 2HQ5A 1DGWY 1TWCJ 2DFFA 2PJRA 4B3AA 1FOYA 3BJAA 1HDDC 2MSYA 2VBYA 4IZZA 4D1QA 2VPRA 4ZYHA 1B59A 3V7CA 4XLNF 1JE8A 3ASNH 1A35A 5ICCA 5E20A 1B9NA 4D0PA 1ZRCA 5M5YJ 5K7FA 1MH3A 2VUMJ 3RQIA 1PP8F 4BU2A 1VQKI 2EZHA 5FKNA 5M5XJ 3WTXC 4E7LA 1FIAA 2PX9A 3KP2A 5GPCA 4YIRX 5FB2A 2LH9A 2R7VA 1Y39A 5LRRA 2KDOA 1CF7B 4EMSA 2ELKA 3PFIA 4S05A 2ECCA 2G0EA 1UHSA 4IPAA 1R36A 2DI3A 3TDUC 5B1BH 1V55H 3U9GA 1O4XA 1BJAA 2Q0OA 3A02A 2OJED 4FX0A 2CQNA 4XORA 2G7UA 1ZR2A 2DODA 5IT9Z 1FMWA 2LF7A 1WJDA 2FMYA 1FPQA 4OU0A 1E3PA 1BW6A 2HI3A 4HLXA 1LFBA 2DPDA 3EDPA 2KZVA 3FK6A 4PGGA 2R3SA 4ZC3A 1RKTA 2F5CA 3MMYB 3LFKA 1B72A 1RUNA 4L5JA 2MG4A 2QVOA 2Z16A 1L0OC 4BXFA 2OV7A 1QZYA 1UG0A 4HF1A 3RPQA 3H5AA 2PMZN 2VBZA 1VI0A 4RAZA 3CP2A 1WJCA 2NVXJ 3CCQI 1LFUP 4O5VA 2QF7A 4BE1A 4FCYA 4A3GJ 2ZFWA 1PYVA 1ZGAA 2D1VA 2NS8A 2VB6A 3HRMA 4GXOA 4MFEA 5K7ZA 2NVQJ 3V8KA 2QM3A 2DCEA 4XKCA 3ZCOA 4BEHA 5D5XB 4BJ6C 2EZIA 4HLYA 1UG2A 4ZYDA 3ABLH 1YO5C 1OPCA 1IUYA 5IYCJ 3ZMVA 3PO2J 1X1PA 1XCBA 2NNYA 2L7ZA 3TQNA 2ZXWH 2FOKA 2HU9A 2MLGA 4HRIA 4MTEA 1AA7A 3KPHA 4AU7A 4DGWB 1RR8C 2QBYA 3PSFA 1A5JA 2FU4A 3GEZA 3ABMH 3BPXA 1XGMA 4UV9A 5FLXZ 3BLYA 3CC2I 1XSVA 1J0RA 3KP5A 3IKTA 1QPMA 2X85A 1TBXA 5H6QA 2K40A 3HTUA 3RYRA 3U21A 3LMMA 1A31A 1Y56A 2VC1A 2ZMEC 2D45A 5FKMA 2LD5A 2GWRA 3LWFA 2CUEA 2X51A 1BIAA 2RVCA 1DPRA 4Y33A 2HVSA 3OSGA 1A6IA 5KAFC 3BR0A 2JRTA 3RZOJ 4M6XA 1USSA 5CVUA 1QPIA 1UHWA 1R00A 5JI6A 4XLFA 4QLCU 4RS8A 3Q3SA 2LC2A 5LGUA 4HF0A 3OYCA 2XV4S 1LUJB 1AKHB 1TT0A 2KHMA 2VT2A 3M3YJ 2KP6A 3HUGA 4A0YA 5K1YA 5AIQA 2R93J 2EZLA 2FQ4A 2KZGA 4JX4A 1DP7P 2LTPA 2MC3A 2KISA 4YFNF 4BGDA 1I5ZA 3I0TA 3AG1H 2IJLA 4DW6A 4XMYA 5HODA 1ODDA 1S5LC 2CV0A 2DT7B 2QUFA 1EH6A 3DP7A 1TWFJ 2COMA 4FHTA 1FEXA 5LRSA 1AWCA 4DZPA 3BZCA 1MJBA 2JA8J 1N77A 2HYFA 2WAQN 2ESNA 2KT0A 3ASOH 3JAMK 2H6BA 2MA3A 5HNHA 4ZZDA 3GLXA 3E6CC 3S3NA 3I3LA 1O3SA 4IXAA 2E1CA 3T8TA 1W5CC 4XRSA 2XGCA 2Z2SB 1FY7A 3CCSI 5J4YA 4EEFG 3IH2A 1JT6A 4J01A 2XHKA 4JX5A 1OCZH 1I6XA 2HTSA 2GQQA 4QWQA 3JRAA 3ULQB 1DP3A 4RGUA 3PQJA 1A6QA 4CZZA 1I1GA 3E5QA 2R7DA 3A0HC 2UZKA 3BT9A 2DTRA 4UUSA 1IDZA 2OQGA 3GCMA 3DKWA 3OL3A 3REOA 3H9GA 1OFCX 2VBWA 2O6GE 2CRGA 4C2UA 3HTSB 4G6DA 3DQVC 4P1WA 4OIRF 2XPWA 2E1NA 2H09A 2E2HJ 2DA4A 1XB4A 4ESBA 1D0YA 3HPHA 1ETQA 3TW7A 1BOBA 5GAEJ 1RIOH 2XSJC 3GTOJ 4GCVA 4IO9F 1J59A 3Q0UA 4DJAA 2GOXB 3J7AY 4KMUX 2MH9A 2OU2A 3GZNB 2XGDA 1K78B 2KPMA 1BOAA 2XAQA 2JVHA 3W2WA 2CV1A 2DOEA 2GZWA 4JBAA 5DUKA 4A3DJ 1MW7A 1DPUA 3OYKA 2YSRA 4NQWA 4L9NA 5TGTA 1FOKA 3QU3A 4Q4ZF 1SD5A 2M2EA 1P9QC 3KIOA 1KU7A 2P8TA 5IOYA 2XUBA 3QRFF 5HS7A 1ZGWA 2E2JJ 3E0JB 1MDMB 3B6AA 4U0YA 1ACIA 3N97A 1W7PA 3RKWA 4FASD 1TL8A 3JREA 1KA8A 2KLOA 2DFEA 3HHHA 3U1KA 2Z5UA 2P0WA 1RI7A 2VKHA 1X1DA 2XIGA 1S6LA 2G9WA 2OQRA 1UFMA 2VE8A 5CVJA 3HIFA 4BQNA 2V1UA 2Q1ZB 2NRAC 3OL4A 2AHQA 3SZPA 3A4CA 1SANA 2B7EA 3CZ6A 4DZJA 2DA3A 1Z05A 1OR7C 5BS6A 3Q5FA 3I54A 2X6OA 3R0JA 1H9TA 2ISYA 3K4NA 1S7EA 4AC0A 1TTYA 4QPQA 4ZZLA 3S2WA 1Z3YA 1F9NA 3DU6A 3CTAA 3SHFA 2HDDA 4WXDA 3K1NA 2LSOA 1YW8A 3KE2A 3G71I 2UV1A 5D4SA 4I0BA 3RPUD 1ZREA 2DN0A 1YG2A 2IS6A 1JUMA 2VOPA 4HAMA 2JMWA 4NC6A 2VKDA 1XGOA 1ZK8A 3GTPJ 2HS5A 3FX3A 1ZKGA 5F64A 4XQFA 1SFOJ 3PL8A 3O8GA 2E2IJ 3EYYA 3TO7A 4HYEA 2LKPA 4A69C 2M34A 2JK3A 2BHZA 3T5XA 2M8EA 3BCAA 1Q1HA 2YPRA 2R7XA 3SQNA 2V1XA 4S04A 1JKPC 2JUCA 1CQTA 2WB1A 3CCMI 5D8LB 3VPRA 4EGZA 2MBFA 4A3EJ 2M5WA 4G12A 3Q9VA 3QQAA 3N05A 5HLIA 5DCFA 2P6TA 1FC3A 3ABKH 2DMTA 1SD4A 1U5TC 2OPTA 3GFMA 3KP3A 5DV5A 3JAMZ 1B8IB 1ONVA 2CFOA 2PJRB 2HGCA 2CMPA 3QOEA 4B8XA 5IP7J 4XLPF 2HPIA 3NWTA 2OCCH 1X3UA 4EM1A 5CQEA 3LSMA 3GVAA 5EG0A 1D5VA 4RBOA 1LVAA 2K02A 2F4OB 1RRJA 2ZO4A 1E2XA 5E8GA 3SEQA 3BR6A 1RKWA 3NAUA 3ZQQA 4FTHA 2KQRA 3QYFA 3H3ZA 1VQLI 5B5EC 1XG1A 3PO3J 4MEYF 5D5VB 3ISPA 2HWVA 3PJRA 3HOVJ 4M3DA 1F4KA 2DK5A 4F3QA 4RDUA 5BNGA 2QQBA 4BDZA 2J5PA 1P92A 1G3WA 2F2EA 1MH4A 2V9VA 4PDKA 4O3MA 3RQ4A 1FP2A 3OV8A 4Q47A 4XONA 1FTTA 1ZQ3P 4BHBA 4CA0A 1O3TA 4Y52J 1W5TA 1BC8C 4L9JA 3J81K 4ZDOA 3DPTA 1FSEA 1P4WA 1BJZA 1FBSA 2K3FA 1HA8A 3HYIA 2CQKA 4LOCA 5DUIA 2HOAA 1HKQA 1I6HJ 1LEBA 1OCCH 4LD5A 4B47A 2CUFA 2K5CA 3GTMJ 1F1ZA 4JX6A 1XPXA 2JPCA 4WX9A 3LSTA 2JSCA 3ZQCA 3WODF 3G3ZA 1B72B 2Y0SA 1ON1A 1J9IA 1T98A 2JZYA 2A07F 1P7IA 2VJIA 3FXQA 2A5WA 2IGMA 2LMDA 3JRIA 3JCUC 4HV6A 2YS9A 1XC5A 1O7LA 3WU1B 2FX0A 4KN4X 2X4HA 2L7MP 3I58A 2LY9A 4KDPA 2L4AA 3R6SA 4HDUA 5EGOA 4P96A 5H2FC 1Z77A 2FNAA 2MD5A 2X1CA 4YRVA 1CGPA 2NAZA 2VLAA 4BEHB 2STTA 3CMYA 5FFZA 4C30A 4XRSG 3IAS2 3WGHA 4HNVA 4RB2C 1HKSA 4OIPF 1WCMJ 2R5ZA 3ML6A 4IJAA 4LB5A 4PCQA 3MZYA 1JKRC 5DCMA 1R58A 5E1ZB 5EZGA 1LEAA 4HEA2 4IHYA 3S16J 1GXPA 1IN8A 1STZA 4M71A 2QBYB 3NRVA 3CUQC 4F7ZA 5J1RA 4NC7A 2K9NA 3GFJA 2M9HA 1JGGA 2V6EA 1YYVA 3Q9SA 3IAM2 4CCNA 1VFCA 1YW7A 4M3FA 5IT9K 3HRSA 3LA2A 1R49A 3Q0WA 2ZJRF 1WI9A 3L2QA 4NHJA 1IV6A 2KL4A 2TCTA 2P7CB 4C3IJ 9ANTA 3FMSA 3F6OA 3DPLC 4LMYA 3WGGA 2AXTC 3GMEA 3BTLA 3D5SC 4CCJA 4HNTA 1ETWA 2ADUA 1TWGJ 4X1EA 1XMAA 4V2FA 1UZCA 2HQNA 2V6CA 4WCGA 5BPDA 2MW8A 3EUHC 4A3FJ 3SZGA 3CMEI 4EJUA 1ULYA 4ZJZA 3K6GA 1O3QA 1LB2A 3IH4A 4YG2F 4RLFA 4IHXA 1E17A 2DOAA 3G1OA 3QU6A 4FETA 2QKMB 2OF7A 2LBFA 3HUGB 1LQ1A 3QOPA 1SVMA 2CW0F 1ZAOA 1TNSA 4UXNA 3GYHX 5EJCA 4KITB 3ZMDA 3ERMA 5J3LA 2BXZA 3E6DA 2BZTA 3GUDA 2LP0A 2VXDA 1C0WA 2IT0A 4L9TA 2PFBA 4WK8F 2B9SA 2BOLA 3A0BC 1I50J 2E34A 3OIPA 1SFUA 1BM9A 4IHSA 2BY2A 2XRLA 2NS7A 3F8MA 3ZMUA 3GTQJ 1ZG5A 2IS4A 4E6KG 2EFQA 5E3MA 1IGNA 3V4GA 5K5QA 1MBKA 2I10A 4O6JA 2QEXI 1SFEA 3FMRA 5ED4A 4U88A 3QPSA 3SFZA 4LG0A 3W2VA 2PBIA 4UB6C 2W24A 4CO8A 5FLXK 1A04A 4AVPA 3WG7H 2L9NA 1BR2A 4DNCA 2LG4A 2DA2A 1T0FA 3G73A 2KIUA 4ESJA 4C9YA 1SFKA 1R71A 2L9VA 3B6CA 2R7ZJ 1YQAA 5BOXA 2XC7A 2HPMA 3NWSA 2XKPA 3HXLA 5DM6F 3DEWA 3OIQA 2L54A 3S1QJ 5GTIC 4LIUA 3T1BA 4MQ9F 4I02A 5J1UA 3F9KA 3J81Z 1E3OC 5J8FA 3H3VK 4UUSB 1GUUA 2CQ7A 3LSIA 1Y8RB 3TOBA 4GRIA 1G3YA 4MHGA 2JA2A 4ITVA 4XLAA 2D5VA 2DAOA 2E35A 2EZKA 4EM0B 3RZDJ 1FP1D 3BDDA 3KP4A 5KAIC 1X1BA 3OYHA 4KISA 4LJZF 4ANJA 2BYVE 3C18A 1XCVA 2HR3A 1QA6A 5KNLA 4A3BJ 4Q5SF 4A3CJ 4TV7A 2IPQX 2R7WA 2RNJA 5GTHC 4BHCA 2CW7A 3D5LA 2DA6A 5DD4A 4EM2A 3TP0A 2E1OA 2HYGD 2MGQA 2PMZA 3S32A 5ILSA 3L2UA 4BQAA 3BG7A 3FHNA 1IRGA 4HA8A 3VSLA 1OCRH 2QKLB 1W36D 3DCFA 3ZMTA 1TLHB 3K1MA 5ILUA 4ZYGA 1HSJA 1U8BA 2DPUA 2HOSA 1BA5A 2RQPA 1D1BA 2LF8A 2Y9YA 4NQWB 2FBHA 5TJJA 1WWXA 3R4KA 1E3HA 3O2PE 1PP7U 5H6RA 1IV8A 4IOCF 4MLOA 3H5NA 2ELHA 1EH8A 1TQIA 4MQVA 1MMGA 3S1MJ 2QENA 4BXUA 1W7PB 3WTZA 2L5QA 3P9KA 2L9RA 2CG4A 2IAIA 3PNYA 4N0BA 3BG9A 4L5EA 5ICFA 1R7JA 2Y0MA 1WPKA 3MZHA 1HCRA 2HXOA 1XD7A 2CH0A 3F8BA 1X4OA 4GDFA 4H0EA 3N4MA 1MMSA 3JR9A 3AAFA 1ZHFA 4JK1X 1WH5A 4WXHA 5FD6A 2RREA 1TZLA 1HDPA 4A3KJ 2CYYA 4XN0A 2W7NA 2VKEA 2EV6A 1D5YA 2OA4A 2OD5A 1G59A 2WC2A 4HBLA 5DD8A 4C2TA 2DA5A 3K9TA 4Z2YA 3TDZC 1BW5A 1RPWA 4N9IA 1T6SA 2MLKA 1I3AA 2Q8KA 2QSGX 4II2A 2QZ8A 4Y13A 4KICA 5F1RA 3AL0C 2X1DA 1OCTC 1IG7A 4Y7NJ 3KETA 4YIIA 1XN7A 3TGNA 2BY0A 4X0GA 1UELB 4H4KC 1JJ6C 4OMZA 2CWEA 4LK1F 1D1CA 3WHBA 3FMQA 1OYWA 1U6GA 2DYSH 3LA3A 4BAYA 4XBFA 4AM3A 3DU5A 1EJ9A 3SDBA 1W0TA 4DIQA 1U3EM 1VQ6I 5DTDA 1N75A 2HQAA 1U0JA 3CESA 3OS2A 1HOMA 4BHPA 5C44J 1HLVA 2EJRA 4XICA 1ZG3A 5J40A 3WTTC 3I59A 4N4NB 1EV7A 3R60A 3HKZN 3WTUC 1BI3A 4EATA 1EKEA 3PSIA 4G9YA 4Y4RA 4A5MA 2VL8A 3JSPA 3S3MA 4M9SA 2WAQA 3E6MA 2XAGA 1MBFA 1TW2A 2PEXA 4FISA 3TO6A 3EUAA 2VN2A 2CW8A 3BTIA 3ECOA 5HDGA 3OS0A 3LNQA 3VODA 4C3JJ 2LR8A 1KYZA 2HFHA 1BR1A 3KX2A 4HZFA 4KYWA 3W6JB 2GOMA 3M8JA 4BQOA 2PMHA 3MFKA 3TP3A 3FISA 3V8JA 1X2MA 4D5FA 5EG0B 2O0YA 2ELJA 2X1EA 5KHDA 2WAFA 4M9ZA 5LEJA 2OTJI 3WHCA 5LGTA 2KKOA 3PUBA 4A3LJ 3EPZA 2YUSA 3CJTB 2F4IA 2JRMA 4JP0A 1XX5A 1I1SA 2D2WA 1GVJA 5AONA 2Q2EA 1HW2A 1QVTA 1SD7A 2OUMA 2LKXA 2R7UA 1YI2I 3H3UA 3FXUA 5HLGA 4ZYEA 1D1AA 1SMTA 4M6YA 3PIPF 5J8CA 1YJ9I 4NDLA 2ISZA 4QSHA 2QSHX 2E1MB 2FF4A 4A3IJ 1ZGJA 2HZDA 2JQ7A 1WKMA 1FX7A 4L0ZB 2NS0A 4PFOA 3K2AA 3CJRB 5GAGJ 5C4XJ 5FD5A 5F27A 1S29A 4B09A 2DFIA 3RPUA 1VQ4I 4PK4A 3K10A 3CO6C 3JSOA 1KQ9A 3S15J 1GHCA 1YX3A 5EZHA 1WSUA 1D3YA 2PQ8A 4IQ4A 3OYAA 2ID3A 4MFDA 1Z3XA 5L3CA 1HSTA 2H8WA 4HQEA 2V26A 3TO9A 4U87A 1RR7A 1OJLA 4IQJA 4N9HA 1ZLKA 2O61A 4BACA 3O8HA 4ZTFA 4KJZA 3RKYA 5HS8A 1DDNA 1OQYA 1KU2A 1S9HA 2VI6A 4LG3A 1NK2P 2TRTA 1UMQA 1BIBA 3FBNB 4BY1J 4IKFA 4EQQA 2EPFA 2DJNA 3IRRA 3ZP5A 1EA3A 1ETYA 5EGOB 1LNWA 4YEJA 1KONA 3SDGA 2VONA 3DPUA 3O6BB 4E7HA 2X0LA 2ZC2A 3M7GA 1PJRA 5H20A 2VQGA 2KDZA 1V5GA 1NH3A 3C2HA 3WTWC 2R5ZB 2R7QA 1RZ4A 2L2OA 3BZ6A 4I7HA 3UKGA 3CDLA 2EWNA 2QQAA 5DCMB 1V3FA 3CJNA 3P5JA 5E79C 5J47A 3KLOA 3VEPA 1FYMA 1IRXA 5JVTA 2A61A 4YFKF 5BMZA 1JKQC 3CC4I 1XDUA 3L09A 3HOSA 4M6VA 4P9FA 5IYBJ 2MYSA 2GBYA 2DOFA 3WTVC 1IXSB 1Z1DA 2P5VA 3R61A 1Y6IA 4ENKA 2EFNA 4A2UA 4ENJA 4E4HA 3HM5A 2W00A 1DGRM 3VYRB 4DBQA 4ASNA 2EIMH 4DOZA 3KYCB 2OTLI 2HNHA 3OS1A 3I4NJ 3H5RA 2O3FA 1NG7A 2GIZA 3BROA 4UVAA 2IRFG 3G2BA 4HF2A 2L7KA 1FBQA 3CJQB 2VASA 2DA1A 4RGSA 2K85A 5FO5A 3W3CA 2TDXA 3BR2A 2AXLA 1FYKA 3TKYA 5FKOA 4L9VA 2M3AA 4HX8A 1IAWA 1LFPA 4CYDA 2RC4A 3BC8A 3BOQA 2LKSA 2ME0A 2YR2A 4CYCA 2V4JC 1PDNC 3J80Z 4V19K 4PUSA 1U2WA 2LBFB 3I53A 1R1UA 1IN5A 2CGPA 3OYNA 2GXAA 4MNUA 1AOYA 5HLTA 1FT9A 1OLTA 1TQMA 5FKKA 4XOTA 3ZQFA 2VODA 1GVDA 2EFOA 3K69A 3DKYA 4C3HJ 4XOPA 1YITI 3RIRA 2XF5A 3HEFA 3H9JA 3AG4H 3F0CA 4G7OF 4E7ZA 3B02A 1VQPI 1H88C 1YRNA 5F6FA 2EFWA 4NBQA 2LRDA 4LG0B 4ZDPA 1IJWC 5FJ8J 1MMAA 3BTJA 4DYQA 1X4PA 2D1HA 2WA0A 4CUGA 4IOAF 3MD2A 1LE8A 1IRZA 1JI8A 1ETVA 3HRUA 3LAJA 1WZ2A 2ZCWA 1TQPA 1IZ1A 1G6NA 5HDNA 4II3A 3G4SI 2DMPA 4CH7A 4LB6B 2R4GA 5M5WJ 1R5HA 3H9QA 2XRNA 4IL6C 3WGIA 4OWRB 4EJTA 1U8RA 2FMLA 2EA2A 3GTKJ 3COAC 1J75A 5IP6A 3ABTA 3V42A 1W4MA 3R0AA 3K70C 1A36A 2YX4A 4E7KA 3E1SA 5D5UB 1S8NA 3TEDA 5E17F 3GO5A 2FJ1A 2NYXA 3CLQA 4FE4A 2ZXIA 3LQRA 3QP6A 2DYRH 2RNGA 4JYKA 3QPLA 4UY8I 4NB5A 5EYRA 5D5WB 2XGEA 2BEOA 2L4MA 3CQZJ 2M0MA 4RM2A 3WU0A 1ZYRF 4UV8A 2HTJA 4PJNA 2XPVA 4PJ0C 4A3JJ 3A01A 2VOOA 3WE3A 1HW1A 1BI2A 1K4SA 1HKTA 3FKIJ 4A5NA 1N78A 3ZMSA 3ZQ7A 2EK5A 2L02A 3OR1C 4QPOA 5CPRB 1ZG1A 2VJJA 1HC8A 4M3EA 3I55I 2K9MA 1W36C 1JTXA 2DDBA 1K7AA 4CCKA 2UXNA 4OINF 4MEXF 1XSXA 2I5UA 3CDHA 2E36A 3L00A 2E7WA 5K5OA 3QPHA 3ZN0A 3OMYA 4I09A 1HF0A 3HOUJ 4RAFA 3CCRI 1MMNA 4HNUA 3CLOA 4LFUA 5L3BA 2V9KA 3Q0VA 5LHIA 3P9CA 2WAEA 3KEYA 3B73A 5TISC 1YLFA 1SC7A 4U0WA 1T95A 2VQCA 3ABUA 3NEUA 1WFXA 4IVNA 4XK4A 3FXMA 1OR7A 3GF2A 2RGVA 2ZNYA 2IXSA 4HV5A 3OYBA 2FEZA 2ZJPF 4HG2A 1MNMC 2R0QC 2R7FA 4U7DA 1MBGA 3FIWA 2AQFA 2JSPA 4D7NA 2GLOA 1FIPA 5DEQA 2RQQA 1I39A 4WXCA 2O8KA 3M4OJ 1OCOH 2BVMA 4G6QA 4HPQA 3F22A 1GDTA 2E71A 1TWAJ 2VE9A 3LSPA 3OY9A 1FBUA 4A0XA 3J7YJ 1IDYA 4I76A 4LGWA 4JOMA 2DQLA 2WTEA 5D4RA 4B3XA 4F91B 5B3SH 1UCRA 2A69F 1YIOA 2P81A 1Z7UA 2A05A 3L2VA 3ZPLA 1QHGA 2DDAA 3DWLE 2OBPA 3GW2A 3PM1A 3S3OA 1FOXA 3CF5F 3QPTA 1W7PD 4AD9A 1Y0UA 3HC7A 4U7BA 3OYJA 3M1EA 3S2HJ 1U5TA 2JN6A 4FX4A 2ME6A 2GXGA 1XMKA 1S7OA 1X2NA 2XKOA 2ZB9A 3K4CA 1K79A 2HDCA 3U2RA 5FKLA 2KFDA 2FUG2 2KRCA 2K7LA 1D8JA 2CSOA 4BQQA 1VQOI 3I59B 4RB3C 3TW6A 1QNTA 3AG3H 5J6XA 2PI0A 3FM5A 1MSEC 3RKQA 3SEZA 3U1DA 1VTNC 5CQGA 2EV0A 1DQUA 4PJLA 1RUOA 4CCOA 2EFPA 1LVKA 4XKWA 3DLLF 1YW9A 3HSFA 3CF2A 1MBEA 2XB0X 3IP4B 3K4MA 1GT0C 3RYPA 2M8GX 4KUMA 1MNDA 4CGZA 3L2WA 3HG9A 2VIXA 2K4BA 2DLLA 3L9FA 2NVYJ 4CDGA 2JJ7A 2Z9OA 4BBSJ 1FSHA 4RLQA 4I6ZA 2VPLA 1NHAA 3KEQA 4XSZF 3FXLA 3OWTA 3ZQHA 4QIWN 1DU6A 4RA2A 5LBQA 5K5RA 2FA5A 2ETHA 4L18B 4KIGA 3DV8A 3OYIA 3K4KA 1MZBA 2IA2A 2Q2EB 2XROA 1JTYA 3LA7A 4WWCA 4GYGA 1VQ7I 1T39A 3K1PA 3W2AA 1ZTRA 5EEAA 1R22A 1BN5A 1MBHA 4E7IA 2ACJA 4JQFA 4L0YB 3CCUI 3BR3A 4XLHA 4XKVA 2NVUB 4PZJA 3GTGJ 1EF4A 2F5EA 1YFHA 2HOEA 3T8RA 3I64A 1R5GA 1ZARA 2HVQA 4KIBA 5D8KB 5JVGF 4IRGA 3F8NA 1TNTA 4XRMA 2HQRA 1P4AA 2FRHA 3S1NJ 4LITA 2WADA 4M9XA 1H89C 4CSWA 2V9PA 3CO7C 1VQ8I 1YOVB 3W6VA 4AIJA 2L9SA 2V1DA 2PJPA 5ILVA 5HNFA 1SVLA 1YX5A 3CC7I 2AS5F 5CVRA 1TT5B 1MJ9A 2E7XA 4C2MJ 1ZELA 1FWZA 3CD6I 3P9IA 2KIMA 1W0UA 2XGXA 2FBKA 3ZQLA 2IS1A 3E97A 3LQQA 2DK8A 4HQMA 3OR2C 1D8KA 1QVUA 1IO2A 2XAHA 3I4MJ 2JUGA 3FZVA 3RSNA 3TL4X 2W57A 1D0XA 3CP8A 5CLSA 1IF1A 5EDNA 4XNFA 2M87A 2ZNZA 4NC8A 4ENNA 4EV0A 3CUQA 2B0LA 1BI0A 4XIDA 4DYRA 1WJAA 3KYLA 1BBYA 2CJJA 4XLEA 4L5IA 5LD2C 3RCOA 3M1CA 1IN6A 4PSWA 3GBGA 2J5OA 3KLNA 3VDXA 3IHUA 2W84A 1HQCA 4Y17A 4YELA 3HOWJ 3K70D 1I27A 3L7WA 4UNOA 3DLAA 3GWZA 1YS7A 4OIQF 3OYGA 2V79A 2E60A 3MKLA 1Y1VJ 2LK2A 1WJ5A 3BY6A 3VYTB 3OYFA 2O9LA 3UNGC 2DT6A 2BY1A 4CXFA 1E0EA 2VJ4A 2X6YA 1SMYF 2RKHA 1V5EA 2QCOA 5DM7F 1BI1A 1JHFA 4UUTA 1PUFA 4HSRA 2EIJH 2O7OA 2JWTA 3FF5A 2HOTA 2BXYA 3EUHA 3J7ZI 4M73A 4RB0A 2ZXHA 1OYYA 3HRTA 4AYBN 3BG5A 1Y8QB 1LPQA 4D7MA 1QHHD 4ETSA 2CFXA 1JT0A 2R7TA 3E5UA 4BH9A 4U0VA 5LFAA 1B6AA 3UR3C 1GLNA 3TBIA 4ZH4F 5A2QZ 1S72I 3JRBA 2FE3A 2XDVA 3QWLA 1SAXA 5GADJ 5ICGA 4BL0B 1QBJA 4CCMA 3GFLA 5LLQA 3S17J 1XTAA 3ZXSA 3WG9A 1BR4A 5FFXA 3FBIB 1Y0NA 2IW5A 5FRNA 4CYCB 4R8HA 4AIDA 1KQ0A 3DFGA 4FE7A 1HBXG 4AVZA 2CQQA 3RDIA 3F72A 3E3VA 3HKZA 1AHDP 2EIKH 2X6WA 3GZ5A 1JJ8C 2M1BA 2DBBA 3JTGA 4OOIA 3ZRGA 2DTZA 1JGSA 1WH7A 4ZDLA 2ZJQF 1Z9CA 2STWA 2CS3A 1R23A 5C3EJ 1MSFC 2O8XA 4D9JA 4YFXF 4S0HB 2MH2A 5F1JA 3HOTA 4CICA 4HSTA 1GV5A 1YRNB 2P6SA 2Z3YA 1ETOA 2R92J 2H1LA 4MGRA 1F5TA 3HPGA 2XAUA 3MCZA 4BBRJ 4DYCA 2YU3A 3NARA 1FZPB 4G8XA 3HZJA 1XS9A 1R1VA 1QRYA 1QZZA 2R5YA 4G94A 5GAHJ 1LE8B 2XAJA 4BJ5C 1T56A 5IT3A 3HSRA 3H36A 1SD6A 5FRMA 3BJ6A 1T8IA 1RNLA 2XF7A 3DBHB 3DBLB 3IUOA 3ECHA 1ZRDA 3I71A 1ETXA 1TW3A 5HLHA 2KIFA 1NG6A 1EH7A 2M7AA 1ZR4A 2IGOA 3C1DA 4BJTA 2IGNA 5BQTA 5ICEA 5C4JJ 3ERED 1B1BA 1G8XA 3F6VA 3S8PA 4LLNA 3ZR8X 2RDPA 3PFYA 1HXDA 1XGSA 2JT1A 2DA7A 2K4JA 4Y15A 2R7SA 3IWZA 4MIMA 4ESFA 3G1LA 2OC6A 1B9MA 3OSFA 1KGSA 3OYMA 3J80K 3DEUA 2ZBKA 1SEUA 2VBXA 1GXQA 4V2GA 4QTRA 3BG3A 2MFZA 1Z6RA 1TWHJ 3K4BA 3QODA 1MBJA 3BTCA 3H35A 4RB1A 1WGXA 3A01B 4CHUA 2IS2A 1FTZA 2QA4I 3EUKL 1XGNA 3F8CA 2H27A 3BCBA 5GPAA 3FM3A 4BUPA 4OAYA 1YE9A 4HX7A 2BY3A 1XMXA 1OCPA 3O3KA 4X6AJ 4RAGA 4FT8A 2FOWA 5F0HA 3GZ6A 3S2DJ 1X3ZB 4DBRA 2PN6A 3KZYA 3PNVA 1W5SA 3M07A 1P7JA 1YJNI 1ON2A 2ID6A 5JR3A 2CO5A 3M8FA 2K9SA 2LYCA 4RGRA 3BJOA 1XSDA 1ENHA 1MKMA 4IHTA 4N4OB 2JA7J 3KZIC 2XASA 4FQGA 3ZGKA 1B4AA 3K0LA 1VNDA 5IY5H 2VQLA 1QZEA 3GTJJ 2IP2A
chains in the Genus database with same CATH topology
3HEFA 2FX0A 3SJMA 1VF9A 2L7MP 3HBLA 3F0CA 2LY9A 1H88C 1YRNA 5EGOA 3ZQIA 4M3GA 1Z77A 3LOCA 3BQYA 3JRGA 3CMYA 4AUXA 1IJWC 3A03A 4XRSG 5FJ8J 4HNVA 3BTJA 1WCMJ 2R5ZA 4DYQA 3LSRA 4B4CA 1B8IA 5E3LA 1JKRC 2HQ5A 2FD5A 1LE8A 1IRZA 1TWCJ 1ETVA 5EZGA 4B3AA 5M3MJ 4IHYA 1HDDC 2MSYA 3S16J 3HGYA 2VPRA 1DU0A 1FJLA 2DMPA 5FLMJ 4GFBA 5J1RA 5M5WJ 2Y30A 2K9NA 2M9HA 1JGGA 3GTKJ 1VFCA 2HYJA 2JA5J 5IP6A 5M5YJ 5K7FA 1MH3A 4M3FA 2VUMJ 3RQIA 2EH3A 3HB9A 3Q0WA 2EZHA 5FKNA 3TEDA 5M5XJ 2FJ1A 1IV6A 1FIAA 4FE4A 5GPCA 2TCTA 4C3IJ 9ANTA 3JRCA 4JYKA 3QPLA 5EYRA 2XGEA 3CQZJ 2ELKA 2ECCA 2G0EA 3BTLA 3D1NI 1UHSA 3LSJA 2LLKA 2B63J 1ETWA 2XPVA 1TWGJ 4X1EA 3A01A 4A3JJ 3MVPA 1O4XA 4V2FA 1K83J 3A02A 1ZR2A 3FKIJ 2NOGA 2MW8A 2IBDA 4A3FJ 1BW6A 2HI3A 1LFBA 4M3EA 1G2HA 1JTXA 3IH4A 4IHXA 3S14J 3G1OA 1IC8A 3FK6A 2OF7A 2X9DA 1RKTA 1B72A 1HF0A 3LSGA 1F43A 1WI3A 2MG4A 3JRDA 3HOUJ 3HOZJ 5J3LA 3Q0VA 2PMZN 2LP0A 1JUPA 1VI0A 1BL0A 1RETA 3CCYA 1I50J 1T33A 2NVXJ 1LFUP 3K7AJ 4XK4A 1Q1VA 2QF7A 4FCYA 4A3GJ 2XRLA 2NS7A 3GTQJ 2NS8A 1IGNA 5E3MA 4IEJA 1TC3C 1MBKA 4MFEA 2I10A 3ZQGA 5K7ZA 1MNMC 2NVQJ 2M0CA 3QPSA 4B1RA 2R0QC 2EZIA 1UG2A 3FIWA 1MBGA 3C2BA 5IYCJ 3PO2J 2DA2A 2VKVA 1FIPA 4D7NA 2GLOA 2L7ZA 3M4OJ 2O8KA 1GDTA 2ECBA 1TWAJ 3LSPA 5JLWA 1AU7A 3B6CA 2R7ZJ 5IYDJ 3MN2A 3BR5A 1A5JA 3DEWA 1IDYA 4I76A 3S1QJ 5J1UA 1E3OC 3H3VK 4UUSB 1GUUA 2P81A 2COBA 2N8GA 2K40A 2D5VA 3RZDJ 2EZKA 1F36A 3PM1A 3JRHA 5FKMA 2LD5A 4IHWA 2CUEA 2GM4A 4A3BJ 5EF6A 4A3CJ 4A3MJ 3OSGA 1I3QJ 1A6IA 2DA6A 3BR0A 1U78A 3S2HJ 3TP0A 2JN6A 2E1OA 2MGQA 3RZOJ 2CQXA 1QPIA 5IPAA 2ME6A 1X2NA 2ZB9A 3Q3SA 5FKLA 1AKHB 3DCFA 3M3YJ 3TW6A 1U8BA 5IOZA 1MSEC 1ETKA 1U9NA 2R93J 2EZLA 5E3OA 3RKQA 2FQ4A 5K7HA 2HOSA 4JX4A 1BA5A 2LTPA 2Y9YA 3BQZA 4DW6A 4MLOA 5HODA 1MBEA 2XB0X 3IV5A 3S1MJ 1GT0C 2M8GX 1TWFJ 2L9RA 1FEXA 2IAIA 2NVYJ 2JJ7A 2DMQA 4DZPA 3BG9A 4L5EA 4BBSJ 4I6ZA 1PUFB 2JA8J 1WPKA 2WAQN 2KT0A 2HXOA 1HCRA 5FLVA 3E7LA 3ZQHA 4QIWN 1DU6A 2WV1A 5F08A 1APLC 1JTYA 3JR9A 1WH5A 4XRSA 3SFIA 1ZTRA 2XGCA 5EEAA 1HDPA 4A3KJ 4EEFG 1MBHA 3IH2A 1JT6A 2L7FP 4JX5A 4BKXA 1R9TJ 2VKEA 2EBIA 1D5YA 3BR3A 3JRAA 3GTGJ 1EF4A 2DA5A 3HOXJ 1BW5A 1RPWA 3BT9A 4UUSA 1IDZA 4XRMA 1OCTC 3BR1A 1Y1WJ 1IG7A 3S1NJ 4ABZA 1OFCX 2EQRA 4Y7NJ 2CRGA 3H0GJ 2H8RA 4BXXJ 1H89C 4W1UA 3W6VA 1K61A 1JJ6C 2XPWA 2E2HJ 2DA4A 3WHBA 1ETQA 3TW7A 4C2MJ 2XB5A 1W0UA 3ZQLA 3GTOJ 1W0TA 2JA6J 5F0FA 1QVUA 5DTDA 3IH3A 3Q0UA 3I4MJ 1HOMA 5C44J 1HLVA 2XGDA 4XICA 2K9QA 5EDNA 1AKHA 2AO9A 4XIDA 4DYRA 3HKZN 3HDDA 4A3DJ 2CJJA 3GBGA 1MBFA 5J1YA 4FISA 3BTIA 3LNQA 2R5YB 4MO7A 3HOWJ 4C3JJ 2WB1N 2LR8A 5M3FJ 2M2EA 5IOYA 3MKLA 1Y1VJ 2LK2A 1ZGWA 2E2JJ 2O9LA 3B6AA 3TP3A 3FISA 1X2MA 4D5FA 5EG0B 3JREA 2QCOA 3WHCA 4UUTA 1PUFA 1X58A 1ITYA 4A3LJ 2YUSA 3OOUA 2O7OA 4JP0A 2JWTA 2HOTA 2L0KA 2AHQA 1QVTA 2LFBA 2LKXA 4AYBN 1SANA 3BG5A 4DZJA 2IEKA 2DA3A 4D7MA 4NDLA 2X6OA 1JT0A 4QSHA 1S7EA 3HGGA 4AC0A 4A3IJ 4BY7J 3JRBA 1IUFA 2HDDA 3K2AA 5F04A 5C4XJ 5F27A 3S17J 2DN0A 1JUMA 3S15J 5EZHA 2JMWA 4CYCB 2ID3A 4FE7A 1ZK8A 4MFDA 3GTPJ 3G1MA 3S1RJ 1ZKGA 2CQQA 1SFOJ 3O8GA 1RR7A 1OJLA 1AHDP 2E2IJ 2Y31A 2Y2ZA 4A69C 1JJ8C 3O8HA 2M34A 1NTCA 2JK3A 2DTZA 1WH7A 2VI6A 1POGA 1NK2P 2TRTA 5C3EJ 1UMQA 1JKPC 1CQTA 1MSFC 4M3BA 4BY1J 3VPRA 4S0HB 5DS9A 4A3EJ 5F1JA 4G12A 3HOYJ 2DJNA 2DMUA 3FK7A 3OIOA 1GV5A 1YRNB 3QQAA 1ETOA 1ETYA 2R92J 5EGOB 2HXIA 4IHVA 2XPUA 3SDGA 4BBRJ 4J19A 4DYCA 2KDZA 2Y0SN 2DMTA 2R5ZB 3NARA 2OPTA 3UKGA 1XS9A 3CDLA 1QRYA 1B8IB 2R5YA 1LE8B 1GV2A 2H1KA 1T56A 3GTLJ 5GP9A 5IP7J 2DMNA 3L1PA 1JKQC 2E19A 1U9OA 2CU7A 2RAEA 4W97A 1H8AC 5EG0A 4M6VA 4RBOA 1ETXA 5IYBJ 5IP9J 2GBYA 1ORKA 3BR6A 1RKWA 3NAUA 4FTHA 1ZR4A 1Z0XA 2NVTJ 3HM5A 5C4JJ 1XG1A 3PO3J 3HOVJ 2DA7A 4M3DA 3JRFA 3I4NJ 4MIMA 4D5CA 3G1LA 1RESA 3OSFA 3ZOBA 2Y9ZA 5E3NA 4RDUA 5BNGA 1MH4A 2DA1A 4V2GA 4QTRA 1FTTA 3BG3A 1TWHJ 1MBJA 3BTCA 1ZQ3P 1WGXA 3A01B 1FTZA 4Y52J 4A93J 3BR2A 5FKOA 5GPAA 1BJZA 5JLXA 2YU9J 1OCPA 4X6AJ 3S2DJ 4LOCA 5F0HA 2ME0A 2HOAA 2XSDC 1I6HJ 2LVSA 2CUFA 4CYCA 3GTMJ 4JX6A 1P7JA 2W48A 5F0CA 2ID6A 3ZQCA 2K9SA 1B72B 1NK3P 1JUSA 1ENHA 2JA7J 5FKKA 3ZQFA 1GVDA 1P7IA 2X48A 4C3HJ 3JRIA 1JKOC 1VNDA 2YS9A 3GTJJ 1XC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HEF A;  2FX0 A;  3SJM A;  1VF9 A;  2L7M P;  3HBL A;  3F0C A;  2LY9 A;  1H88 C;  1YRN A;  5EGO A;  3ZQI A;  4M3G A;  1Z77 A;  3LOC A;  3BQY A;  3JRG A;  3CMY A;  4AUX A;  1IJW C;  3A03 A;  4XRS G;  5FJ8 J;  4HNV A;  3BTJ A;  1WCM J;  2R5Z A;  4DYQ A;  3LSR A;  4B4C A;  1B8I A;  5E3L A;  1JKR C;  2HQ5 A;  2FD5 A;  1LE8 A;  1IRZ A;  1TWC J;  1ETV A;  5EZG A;  4B3A A;  5M3M J;  4IHY A;  1HDD C;  2MSY A;  3S16 J;  3HGY A;  2VPR A;  1DU0 A;  1FJL A;  2DMP A;  5FLM J;  4GFB A;  5J1R A;  5M5W J;  2Y30 A;  2K9N A;  2M9H A;  1JGG A;  3GTK J;  1VFC A;  2HYJ A;  2JA5 J;  5IP6 A;  5M5Y J;  5K7F A;  1MH3 A;  4M3F A;  2VUM J;  3RQI A;  2EH3 A;  3HB9 A;  3Q0W A;  2EZH A;  5FKN A;  3TED A;  5M5X J;  2FJ1 A;  1IV6 A;  1FIA A;  4FE4 A;  5GPC A;  2TCT A;  4C3I J;  9ANT A;  3JRC A;  4JYK A;  3QPL A;  5EYR A;  2XGE A;  3CQZ J;  2ELK A;  2ECC A;  2G0E A;  3BTL A;  3D1N I;  1UHS A;  3LSJ A;  2LLK A;  2B63 J;  1ETW A;  2XPV A;  1TWG J;  4X1E A;  3A01 A;  4A3J J;  3MVP A;  1O4X A;  4V2F A;  1K83 J;  3A02 A;  1ZR2 A;  3FKI J;  2NOG A;  2MW8 A;  2IBD A;  4A3F J;  1BW6 A;  2HI3 A;  1LFB A;  4M3E A;  1G2H A;  1JTX A;  3IH4 A;  4IHX A;  3S14 J;  3G1O A;  1IC8 A;  3FK6 A;  2OF7 A;  2X9D A;  1RKT A;  1B72 A;  1HF0 A;  3LSG A;  1F43 A;  1WI3 A;  2MG4 A;  3JRD A;  3HOU J;  3HOZ J;  5J3L A;  3Q0V A;  2PMZ N;  2LP0 A;  1JUP A;  1VI0 A;  1BL0 A;  1RET A;  3CCY A;  1I50 J;  1T33 A;  2NVX J;  1LFU P;  3K7A J;  4XK4 A;  1Q1V A;  2QF7 A;  4FCY A;  4A3G J;  2XRL A;  2NS7 A;  3GTQ J;  2NS8 A;  1IGN A;  5E3M A;  4IEJ A;  1TC3 C;  1MBK A;  4MFE A;  2I10 A;  3ZQG A;  5K7Z A;  1MNM C;  2NVQ J;  2M0C A;  3QPS A;  4B1R A;  2R0Q C;  2EZI A;  1UG2 A;  3FIW A;  1MBG A;  3C2B A;  5IYC J;  3PO2 J;  2DA2 A;  2VKV A;  1FIP A;  4D7N A;  2GLO A;  2L7Z A;  3M4O J;  2O8K A;  1GDT A;  2ECB A;  1TWA J;  3LSP A;  5JLW A;  1AU7 A;  3B6C A;  2R7Z J;  5IYD J;  3MN2 A;  3BR5 A;  1A5J A;  3DEW A;  1IDY A;  4I76 A;  3S1Q J;  5J1U A;  1E3O C;  3H3V K;  4UUS B;  1GUU A;  2P81 A;  2COB A;  2N8G A;  2K40 A;  2D5V A;  3RZD J;  2EZK A;  1F36 A;  3PM1 A;  3JRH A;  5FKM A;  2LD5 A;  4IHW A;  2CUE A;  2GM4 A;  4A3B J;  5EF6 A;  4A3C J;  4A3M J;  3OSG A;  1I3Q J;  1A6I A;  2DA6 A;  3BR0 A;  1U78 A;  3S2H J;  3TP0 A;  2JN6 A;  2E1O A;  2MGQ A;  3RZO J;  2CQX A;  1QPI A;  5IPA A;  2ME6 A;  1X2N A;  2ZB9 A;  3Q3S A;  5FKL A;  1AKH B;  3DCF A;  3M3Y J;  3TW6 A;  1U8B A;  5IOZ A;  1MSE C;  1ETK A;  1U9N A;  2R93 J;  2EZL A;  5E3O A;  3RKQ A;  2FQ4 A;  5K7H A;  2HOS A;  4JX4 A;  1BA5 A;  2LTP A;  2Y9Y A;  3BQZ A;  4DW6 A;  4MLO A;  5HOD A;  1MBE A;  2XB0 X;  3IV5 A;  3S1M J;  1GT0 C;  2M8G X;  1TWF J;  2L9R A;  1FEX A;  2IAI A;  2NVY J;  2JJ7 A;  2DMQ A;  4DZP A;  3BG9 A;  4L5E A;  4BBS J;  4I6Z A;  1PUF B;  2JA8 J;  1WPK A;  2WAQ N;  2KT0 A;  2HXO A;  1HCR A;  5FLV A;  3E7L A;  3ZQH A;  4QIW N;  1DU6 A;  2WV1 A;  5F08 A;  1APL C;  1JTY A;  3JR9 A;  1WH5 A;  4XRS A;  3SFI A;  1ZTR A;  2XGC A;  5EEA A;  1HDP A;  4A3K J;  4EEF G;  1MBH A;  3IH2 A;  1JT6 A;  2L7F P;  4JX5 A;  4BKX A;  1R9T J;  2VKE A;  2EBI A;  1D5Y A;  3BR3 A;  3JRA A;  3GTG J;  1EF4 A;  2DA5 A;  3HOX J;  1BW5 A;  1RPW A;  3BT9 A;  4UUS A;  1IDZ A;  4XRM A;  1OCT C;  3BR1 A;  1Y1W J;  1IG7 A;  3S1N J;  4ABZ A;  1OFC X;  2EQR A;  4Y7N J;  2CRG A;  3H0G J;  2H8R A;  4BXX J;  1H89 C;  4W1U A;  3W6V A;  1K61 A;  1JJ6 C;  2XPW A;  2E2H J;  2DA4 A;  3WHB A;  1ETQ A;  3TW7 A;  4C2M J;  2XB5 A;  1W0U A;  3ZQL A;  3GTO J;  1W0T A;  2JA6 J;  5F0F A;  1QVU A;  5DTD A;  3IH3 A;  3Q0U A;  3I4M J;  1HOM A;  5C44 J;  1HLV A;  2XGD A;  4XIC A;  2K9Q A;  5EDN A;  1AKH A;  2AO9 A;  4XID A;  4DYR A;  3HKZ N;  3HDD A;  4A3D J;  2CJJ A;  3GBG A;  1MBF A;  5J1Y A;  4FIS A;  3BTI A;  3LNQ A;  2R5Y B;  4MO7 A;  3HOW J;  4C3J J;  2WB1 N;  2LR8 A;  5M3F J;  2M2E A;  5IOY A;  3MKL A;  1Y1V J;  2LK2 A;  1ZGW A;  2E2J J;  2O9L A;  3B6A A;  3TP3 A;  3FIS A;  1X2M A;  4D5F A;  5EG0 B;  3JRE A;  2QCO A;  3WHC A;  4UUT A;  1PUF A;  1X58 A;  1ITY A;  4A3L J;  2YUS A;  3OOU A;  2O7O A;  4JP0 A;  2JWT A;  2HOT A;  2L0K A;  2AHQ A;  1QVT A;  2LFB A;  2LKX A;  4AYB N;  1SAN A;  3BG5 A;  4DZJ A;  2IEK A;  2DA3 A;  4D7M A;  4NDL A;  2X6O A;  1JT0 A;  4QSH A;  1S7E A;  3HGG A;  4AC0 A;  4A3I J;  4BY7 J;  3JRB A;  1IUF A;  2HDD A;  3K2A A;  5F04 A;  5C4X J;  5F27 A;  3S17 J;  2DN0 A;  1JUM A;  3S15 J;  5EZH A;  2JMW A;  4CYC B;  2ID3 A;  4FE7 A;  1ZK8 A;  4MFD A;  3GTP J;  3G1M A;  3S1R J;  1ZKG A;  2CQQ A;  1SFO J;  3O8G A;  1RR7 A;  1OJL A;  1AHD P;  2E2I J;  2Y31 A;  2Y2Z A;  4A69 C;  1JJ8 C;  3O8H A;  2M34 A;  1NTC A;  2JK3 A;  2DTZ A;  1WH7 A;  2VI6 A;  1POG A;  1NK2 P;  2TRT A;  5C3E J;  1UMQ A;  1JKP C;  1CQT A;  1MSF C;  4M3B A;  4BY1 J;  3VPR A;  4S0H B;  5DS9 A;  4A3E J;  5F1J A;  4G12 A;  3HOY J;  2DJN A;  2DMU A;  3FK7 A;  3OIO A;  1GV5 A;  1YRN B;  3QQA A;  1ETO A;  1ETY A;  2R92 J;  5EGO B;  2HXI A;  4IHV A;  2XPU A;  3SDG A;  4BBR J;  4J19 A;  4DYC A;  2KDZ A;  2Y0S N;  2DMT A;  2R5Z B;  3NAR A;  2OPT A;  3UKG A;  1XS9 A;  3CDL A;  1QRY A;  1B8I B;  2R5Y A;  1LE8 B;  1GV2 A;  2H1K A;  1T56 A;  3GTL J;  5GP9 A;  5IP7 J;  2DMN A;  3L1P A;  1JKQ C;  2E19 A;  1U9O A;  2CU7 A;  2RAE A;  4W97 A;  1H8A C;  5EG0 A;  4M6V A;  4RBO A;  1ETX A;  5IYB J;  5IP9 J;  2GBY A;  1ORK A;  3BR6 A;  1RKW A;  3NAU A;  4FTH A;  1ZR4 A;  1Z0X A;  2NVT J;  3HM5 A;  5C4J J;  1XG1 A;  3PO3 J;  3HOV J;  2DA7 A;  4M3D A;  3JRF A;  3I4N J;  4MIM A;  4D5C A;  3G1L A;  1RES A;  3OSF A;  3ZOB A;  2Y9Z A;  5E3N A;  4RDU A;  5BNG A;  1MH4 A;  2DA1 A;  4V2G A;  4QTR A;  1FTT A;  3BG3 A;  1TWH J;  1MBJ A;  3BTC A;  1ZQ3 P;  1WGX A;  3A01 B;  1FTZ A;  4Y52 J;  4A93 J;  3BR2 A;  5FKO A;  5GPA A;  1BJZ A;  5JLX A;  2YU9 J;  1OCP A;  4X6A J;  3S2D J;  4LOC A;  5F0H A;  2ME0 A;  2HOA A;  2XSD C;  1I6H J;  2LVS A;  2CUF A;  4CYC A;  3GTM J;  4JX6 A;  1P7J A;  2W48 A;  5F0C A;  2ID6 A;  3ZQC A;  2K9S A;  1B72 B;  1NK3 P;  1JUS A;  1ENH A;  2JA7 J;  5FKK A;  3ZQF A;  1GVD A;  1P7I A;  2X48 A;  4C3H J;  3JRI A;  1JKO C;  1VND A;  2YS9 A;  3GTJ J;  1XC5 A; 
#chains in the Genus database with same CATH topology
 1VZ0 A;  2I8D A;  3SJM A;  5KVR A;  1PUE E;  2ESH A;  1JXS A;  4UVC A;  4BYY A;  2KJC A;  2KRF A;  3CCL I;  2MC4 A;  1ZN2 A;  3EYI A;  3L2R A;  4M3G A;  4KFC A;  2EIN H;  4P5O A;  3LFU A;  1V5F A;  3PUF A;  4AUX A;  3A03 A;  4GGG A;  3IRQ A;  4BDY A;  1UJ8 A;  4A6D A;  5E3L A;  4UVB A;  3WTY C;  2ZSH B;  2FD5 A;  1R6R A;  4BNC A;  3JTH A;  2QSF X;  3KCC A;  5CYV A;  5M3M J;  3LL7 A;  3HGY A;  1VQ5 I;  1DU0 A;  1FJL A;  4M72 A;  4M74 A;  4F55 A;  5FLM J;  1FYL A;  1WQ2 A;  4GFB A;  3DF8 A;  1RC9 A;  3F8F A;  2Y30 A;  2GA1 A;  5BPI A;  5HS9 A;  4WF2 A;  1QQI A;  1V54 H;  2HYJ A;  2JA5 J;  5D6E A;  1VQM I;  1VQ9 I;  2LNB A;  3LSH A;  2EH3 A;  3HB9 A;  1JHH A;  4A12 A;  4I2O A;  1K6O A;  3BPV A;  1QGP A;  3VWB A;  2LDU A;  3IC7 A;  3JRC A;  3AFH A;  2H6C A;  1MMD A;  1WJE A;  2PLY A;  3D5R C;  3D1N I;  3LSJ A;  2LLK A;  5CVV A;  2B63 J;  2KJB A;  2ICW G;  2P5L C;  1LJ9 A;  3MVP A;  4I98 B;  1MD0 A;  1U5T B;  1YS6 A;  1K83 J;  4NUB A;  5HVQ C;  3P7N A;  2NOG A;  3QP5 A;  2IBD A;  3K2Z A;  4UB8 C;  3I56 I;  2DW4 A;  2W4S A;  3J7A O;  2WBM A;  2E5N A;  3W6K B;  2IVM A;  1D0Z A;  1KZH A;  2DJI A;  4EJW A;  1G2H A;  3S14 J;  3FDY A;  2ZME A;  1IC8 A;  3SZT A;  2O5R A;  1YIJ I;  2X9D A;  1OMI A;  3MAJ A;  2RN7 A;  1Z7L A;  4BE0 A;  1ZH5 A;  1WHU A;  2VQH A;  2A6H F;  3LSG A;  4KT5 C;  1F43 A;  1WI3 A;  2EIL H;  2RV8 A;  3KYD B;  3JRD A;  3HOZ J;  1WJF A;  1JUP A;  2P5K A;  2VXZ A;  3MZ8 A;  1BL0 A;  1RET A;  3CCY A;  1T33 A;  2R7R A;  3K7A J;  4RGX A;  3KFW X;  1Q1V A;  2DT5 A;  1OKR A;  4B48 A;  1REP C;  5E1X A;  3IKV A;  4IEJ A;  3GX4 X;  1TC3 C;  2F4M B;  3BP8 A;  4HOB A;  2XVC A;  4KMF A;  3ZQG A;  3ZN1 A;  2M0C A;  5LGN A;  4B1R A;  3SYT A;  1P2F A;  1Z6T A;  1MNE A;  3C2B A;  5CJ9 A;  3HL2 A;  4XSX F;  2VKV A;  2DQR A;  2QGU A;  2F48 A;  2LRE A;  2ECB A;  4UUV A;  1FOW A;  2R7O A;  1Z91 A;  2E5Z A;  2W1O A;  5JLW A;  2LY2 A;  2HKX A;  3PQK A;  1AU7 A;  2DU9 A;  5IYD J;  1R5I D;  3MN2 A;  3BR5 A;  1O57 A;  3T0Y A;  3MKY B;  3I4P A;  3HSE A;  4XL9 A;  2UUZ A;  4PSX A;  3L2C A;  3FXO A;  1HW5 A;  2COB A;  4HX4 A;  3C3W A;  2N8G A;  2BW3 B;  4GO1 A;  3ROU A;  1F36 A;  2M4G A;  4KIF A;  4I99 C;  3PIO F;  3JRH A;  3DTE A;  4AIH A;  3HHG A;  3KZZ A;  4XRF A;  1CF7 A;  2CUZ A;  3E5X A;  4IHW A;  2GM4 A;  5EF6 A;  3GLL A;  5CKT A;  5CVI A;  4A3M J;  4RMN A;  6PAX A;  1K6Y A;  3K4L A;  5LHG A;  1I3Q J;  3K4J A;  3MKW B;  1U78 A;  2ZSI B;  2JPB A;  3G6E I;  2CQX A;  5EEG A;  1DUX C;  5IPA A;  4AWX B;  3FXK A;  1V4R A;  5L3E A;  4E70 A;  2BHY A;  1O3R A;  1TP4 A;  2OAZ A;  3CUQ B;  1J7K A;  1KU3 A;  3ELK A;  4XKB A;  5HOO A;  4KA4 A;  1LDJ A;  5DDG A;  2E1M C;  3JW4 A;  5KK1 A;  5E1W A;  5IOZ A;  3E6B A;  1ETK A;  1U9N A;  3MWM A;  3V7S A;  5E3O A;  4PFP A;  4BS9 A;  2F5D A;  3LSK A;  4G6T B;  5K7H A;  2WV0 A;  2FBI A;  3DBR B;  1QO0 D;  3BQZ A;  1N25 A;  1J09 A;  1UHM A;  3I9V 2;  1UAA A;  2K27 A;  3IV5 A;  1IW7 F;  4YIF A;  5JHF A;  2W82 A;  3DKX A;  2M45 A;  2K86 A;  2GA2 A;  3AG2 H;  4CZC A;  1IRF A;  2Y75 A;  2KMU A;  4XR6 A;  1FMV A;  3DTK A;  2DMQ A;  3ZMZ A;  5B66 C;  2W85 A;  5L3D A;  4IX7 A;  2IGK A;  4KNY A;  5ERI A;  1PUF B;  5LHH A;  1IN4 A;  5FLV A;  3E7L A;  3I5U A;  2WV1 A;  3KP7 A;  1H9G A;  1KU9 A;  3DXJ F;  1T38 A;  3A2K A;  5F08 A;  2ZFU A;  3OOP A;  1APL C;  3BZK A;  2M7B A;  2QYO A;  1L3L A;  4AIK A;  4BE2 A;  3SFI A;  1Z67 A;  3CMA I;  1XDS A;  1P6R A;  2L7F P;  4OAZ A;  4BKX A;  1R9T J;  2EBI A;  4LK0 F;  4XN3 A;  4OIO F;  2A6T A;  3CMM A;  1J5Y A;  1R1T A;  3M8E A;  3HOX J;  4Z6Y A;  3QAH A;  4F92 B;  5KCM A;  2BE5 F;  3WE2 A;  5E18 F;  3BR1 A;  4RAY A;  1Y1W J;  4ABZ A;  2DO7 A;  2EQR A;  4F93 B;  2Y69 H;  2CUJ A;  3H0G J;  1YJW I;  2H8R A;  4BXX J;  2WWY A;  4W1U A;  2BBY A;  3AKZ A;  2GXB A;  1K61 A;  1P4X A;  2C6Y A;  1Z21 A;  1UST A;  3H0D A;  2XB5 A;  3FWE A;  4LLG F;  1FNN A;  4I0A A;  3S93 A;  2JA6 J;  3F3X A;  5F0F A;  2BVL A;  3A1Y A;  3IH3 A;  1X3W B;  1BC7 C;  2X6X A;  3TOA A;  3QYB A;  1YHQ I;  2K9Q A;  1AKH A;  2AO9 A;  2A6E F;  1ZRF A;  3HDD A;  5J4V A;  4IRI A;  1H0M A;  3FHZ A;  5JHU A;  2HKO A;  3C2G A;  5J1Y A;  2P4W A;  2HDW A;  3M9A A;  3V8L A;  2L01 A;  2R5Y B;  4MO7 A;  2NOJ B;  4PGH A;  4PJJ A;  1LDK B;  2M30 A;  3NQO A;  2XAF A;  2WB1 N;  2OZ6 A;  5HDK A;  5M3F J;  3VOE A;  3OYL A;  4PJM A;  2Z33 A;  3BWG A;  3DEE A;  3WTS C;  2V1N A;  2P7V B;  1G3T A;  5A2Q K;  4IRH A;  2CV2 A;  3CUO A;  4XLC A;  4KT6 A;  1X58 A;  3HJE A;  1ITY A;  3F23 A;  1MGT A;  3OOU A;  2PMU A;  1IXC A;  2L0K A;  2ZJ2 A;  4NNJ A;  1J2X A;  2M4K A;  3FKJ A;  4EGY A;  1WVR A;  2LFB A;  2JVG A;  4HDV A;  2YX7 A;  4Y3O A;  2EV5 A;  2IEK A;  2Z1D A;  4F52 A;  3KEO A;  3QYE A;  3CCE I;  3HGG A;  4LIV A;  2Z99 A;  2UWM A;  4BY7 J;  2A5Y B;  1IUF A;  3D0S A;  3CCV I;  5F04 A;  5L3F A;  1LKX A;  2VT3 A;  5TRD A;  2H94 A;  1T0F C;  3TMO A;  4EJO A;  2EB7 A;  3FXJ A;  4KN7 X;  3VYS B;  3DTI A;  1X1C A;  5AIP A;  3SXY A;  3G1M A;  2F6C A;  3S1R J;  4P55 A;  1MJA A;  1ERD A;  2Y31 A;  1WJB A;  2Y2Z A;  1NTC A;  4E7S A;  2FSW A;  1KYW A;  3RJP A;  3V7R A;  4UHT A;  4XM3 A;  1POG A;  3MKZ A;  1QU3 A;  3ESW B;  2WY7 Q;  3MEX A;  1T2K A;  4M3B A;  3BG6 A;  3PNT A;  4G7H F;  5DS9 A;  3HOY J;  2HZT A;  1K78 A;  2DMU A;  5E8I A;  3FK7 A;  2K9L A;  3OIO A;  2ZXJ A;  3VYU B;  2HXI A;  5EEH A;  4IHV A;  2XPU A;  3RKX A;  2A3S A;  4J19 A;  2Y0S N;  3X2Q H;  1OIS A;  3ONQ A;  2W25 A;  3F21 A;  4HW0 A;  1VQN I;  3EET A;  3AL0 B;  2LOO A;  4K2E A;  2G7H A;  1GV2 A;  3OYD A;  2H1K A;  5FRO A;  4ZTJ A;  3GTL J;  2BW3 A;  2FNP A;  5GP9 A;  4AYB A;  2DMN A;  4G7Z F;  4EJV A;  3L1P A;  1MDM A;  2NNN A;  2E19 A;  1U9O A;  2CU7 A;  2KIQ A;  2RAE A;  1LDD A;  2BV6 A;  4W97 A;  3VFZ A;  1K4T A;  1H8A C;  4ENM A;  2MAB A;  3OYE A;  2F5V A;  3RI4 A;  5IP9 J;  3LAP A;  2HEO A;  3GXO A;  2QLZ A;  2A68 F;  1ORK A;  2LY1 A;  1IXR C;  1UB9 A;  2FQ3 A;  4E7J A;  1Z0X A;  2NVT J;  4B43 A;  1OYI A;  3IL2 A;  3FXR A;  4EVI A;  1X19 A;  3JRF A;  3KP6 A;  1SFX A;  2K3P A;  1KQ8 A;  4D5C A;  2QQ9 A;  1RES A;  3ZOB A;  2Y9Z A;  5E3N A;  5FGM A;  2DXI A;  1R4M B;  1S7A A;  2IA1 A;  2VJ5 A;  3VSK A;  5D6F A;  5JFR A;  5DYM A;  1W1W E;  2GAU A;  1M1E B;  4B44 A;  4LLL A;  2BGC A;  4J00 A;  1O7F A;  4A93 J;  2F5F A;  3GFI A;  1G3S A;  5L3G A;  4CCL A;  2Y48 A;  2O03 A;  1FLI A;  2V7F A;  1R4N B;  5JLX A;  2HVR A;  2YU9 J;  3H1C A;  1MIJ A;  2FXA A;  4DQ2 A;  2XSD C;  3IWF A;  2LVS A;  2DFH A;  2ZME B;  2ZKZ A;  2W48 A;  5F0C A;  4MTD A;  4ZYA A;  1WRJ A;  1S3J A;  2AQE A;  2OCE A;  1SAU A;  2QQ8 A;  3EQL F;  1T08 B;  2MD0 A;  1JUS A;  2IA0 A;  3CDI A;  4Q48 A;  4GYI A;  1NK3 P;  1YTY A;  1ZLJ A;  2X48 A;  2JTV A;  4IF4 A;  1JKO C;  2L3D A;  2OZU A;  4ON0 A;  2VC0 A;  2NXN B;  1X1A A;  1SVO A;  3C7J A;  2WY8 Q;  2QWW A;  3CCJ I;  2EA4 A;  3H92 A;  1VF9 A;  3HBL A;  3RTR A;  2XF6 A;  3VB2 A;  4I01 A;  2PG4 A;  1PVE A;  3ZQI A;  4A0Z A;  2UXX A;  4A6E A;  5B1A H;  1G4D A;  3MQ0 A;  3LOC A;  3BQY A;  3JRG A;  4R1H A;  4RM3 A;  3WU2 C;  4R79 A;  2GIV A;  3LSR A;  2KRH A;  4B4C A;  4OMY A;  5LEK A;  1IN7 A;  1B8I A;  4P9U A;  2HQ5 A;  1DGW Y;  1TWC J;  2DFF A;  2PJR A;  4B3A A;  1FOY A;  3BJA A;  1HDD C;  2MSY A;  2VBY A;  4IZZ A;  4D1Q A;  2VPR A;  4ZYH A;  1B59 A;  3V7C A;  4XLN F;  1JE8 A;  3ASN H;  1A35 A;  5ICC A;  5E20 A;  1B9N A;  4D0P A;  1ZRC A;  5M5Y J;  5K7F A;  1MH3 A;  2VUM J;  3RQI A;  1PP8 F;  4BU2 A;  1VQK I;  2EZH A;  5FKN A;  5M5X J;  3WTX C;  4E7L A;  1FIA A;  2PX9 A;  3KP2 A;  5GPC A;  4YIR X;  5FB2 A;  2LH9 A;  2R7V A;  1Y39 A;  5LRR A;  2KDO A;  1CF7 B;  4EMS A;  2ELK A;  3PFI A;  4S05 A;  2ECC A;  2G0E A;  1UHS A;  4IPA A;  1R36 A;  2DI3 A;  3TDU C;  5B1B H;  1V55 H;  3U9G A;  1O4X A;  1BJA A;  2Q0O A;  3A02 A;  2OJE D;  4FX0 A;  2CQN A;  4XOR A;  2G7U A;  1ZR2 A;  2DOD A;  5IT9 Z;  1FMW A;  2LF7 A;  1WJD A;  2FMY A;  1FPQ A;  4OU0 A;  1E3P A;  1BW6 A;  2HI3 A;  4HLX A;  1LFB A;  2DPD A;  3EDP A;  2KZV A;  3FK6 A;  4PGG A;  2R3S A;  4ZC3 A;  1RKT A;  2F5C A;  3MMY B;  3LFK A;  1B72 A;  1RUN A;  4L5J A;  2MG4 A;  2QVO A;  2Z16 A;  1L0O C;  4BXF A;  2OV7 A;  1QZY A;  1UG0 A;  4HF1 A;  3RPQ A;  3H5A A;  2PMZ N;  2VBZ A;  1VI0 A;  4RAZ A;  3CP2 A;  1WJC A;  2NVX J;  3CCQ I;  1LFU P;  4O5V A;  2QF7 A;  4BE1 A;  4FCY A;  4A3G J;  2ZFW A;  1PYV A;  1ZGA A;  2D1V A;  2NS8 A;  2VB6 A;  3HRM A;  4GXO A;  4MFE A;  5K7Z A;  2NVQ J;  3V8K A;  2QM3 A;  2DCE A;  4XKC A;  3ZCO A;  4BEH A;  5D5X B;  4BJ6 C;  2EZI A;  4HLY A;  1UG2 A;  4ZYD A;  3ABL H;  1YO5 C;  1OPC A;  1IUY A;  5IYC J;  3ZMV A;  3PO2 J;  1X1P A;  1XCB A;  2NNY A;  2L7Z A;  3TQN A;  2ZXW H;  2FOK A;  2HU9 A;  2MLG A;  4HRI A;  4MTE A;  1AA7 A;  3KPH A;  4AU7 A;  4DGW B;  1RR8 C;  2QBY A;  3PSF A;  1A5J A;  2FU4 A;  3GEZ A;  3ABM H;  3BPX A;  1XGM A;  4UV9 A;  5FLX Z;  3BLY A;  3CC2 I;  1XSV A;  1J0R A;  3KP5 A;  3IKT A;  1QPM A;  2X85 A;  1TBX A;  5H6Q A;  2K40 A;  3HTU A;  3RYR A;  3U21 A;  3LMM A;  1A31 A;  1Y56 A;  2VC1 A;  2ZME C;  2D45 A;  5FKM A;  2LD5 A;  2GWR A;  3LWF A;  2CUE A;  2X51 A;  1BIA A;  2RVC A;  1DPR A;  4Y33 A;  2HVS A;  3OSG A;  1A6I A;  5KAF C;  3BR0 A;  2JRT A;  3RZO J;  4M6X A;  1USS A;  5CVU A;  1QPI A;  1UHW A;  1R00 A;  5JI6 A;  4XLF A;  4QLC U;  4RS8 A;  3Q3S A;  2LC2 A;  5LGU A;  4HF0 A;  3OYC A;  2XV4 S;  1LUJ B;  1AKH B;  1TT0 A;  2KHM A;  2VT2 A;  3M3Y J;  2KP6 A;  3HUG A;  4A0Y A;  5K1Y A;  5AIQ A;  2R93 J;  2EZL A;  2FQ4 A;  2KZG A;  4JX4 A;  1DP7 P;  2LTP A;  2MC3 A;  2KIS A;  4YFN F;  4BGD A;  1I5Z A;  3I0T A;  3AG1 H;  2IJL A;  4DW6 A;  4XMY A;  5HOD A;  1ODD A;  1S5L C;  2CV0 A;  2DT7 B;  2QUF A;  1EH6 A;  3DP7 A;  1TWF J;  2COM A;  4FHT A;  1FEX A;  5LRS A;  1AWC A;  4DZP A;  3BZC A;  1MJB A;  2JA8 J;  1N77 A;  2HYF A;  2WAQ N;  2ESN A;  2KT0 A;  3ASO H;  3JAM K;  2H6B A;  2MA3 A;  5HNH A;  4ZZD A;  3GLX A;  3E6C C;  3S3N A;  3I3L A;  1O3S A;  4IXA A;  2E1C A;  3T8T A;  1W5C C;  4XRS A;  2XGC A;  2Z2S B;  1FY7 A;  3CCS I;  5J4Y A;  4EEF G;  3IH2 A;  1JT6 A;  4J01 A;  2XHK A;  4JX5 A;  1OCZ H;  1I6X A;  2HTS A;  2GQQ A;  4QWQ A;  3JRA A;  3ULQ B;  1DP3 A;  4RGU A;  3PQJ A;  1A6Q A;  4CZZ A;  1I1G A;  3E5Q A;  2R7D A;  3A0H C;  2UZK A;  3BT9 A;  2DTR A;  4UUS A;  1IDZ A;  2OQG A;  3GCM A;  3DKW A;  3OL3 A;  3REO A;  3H9G A;  1OFC X;  2VBW A;  2O6G E;  2CRG A;  4C2U A;  3HTS B;  4G6D A;  3DQV C;  4P1W A;  4OIR F;  2XPW A;  2E1N A;  2H09 A;  2E2H J;  2DA4 A;  1XB4 A;  4ESB A;  1D0Y A;  3HPH A;  1ETQ A;  3TW7 A;  1BOB A;  5GAE J;  1RIO H;  2XSJ C;  3GTO J;  4GCV A;  4IO9 F;  1J59 A;  3Q0U A;  4DJA A;  2GOX B;  3J7A Y;  4KMU X;  2MH9 A;  2OU2 A;  3GZN B;  2XGD A;  1K78 B;  2KPM A;  1BOA A;  2XAQ A;  2JVH A;  3W2W A;  2CV1 A;  2DOE A;  2GZW A;  4JBA A;  5DUK A;  4A3D J;  1MW7 A;  1DPU A;  3OYK A;  2YSR A;  4NQW A;  4L9N A;  5TGT A;  1FOK A;  3QU3 A;  4Q4Z F;  1SD5 A;  2M2E A;  1P9Q C;  3KIO A;  1KU7 A;  2P8T A;  5IOY A;  2XUB A;  3QRF F;  5HS7 A;  1ZGW A;  2E2J J;  3E0J B;  1MDM B;  3B6A A;  4U0Y A;  1ACI A;  3N97 A;  1W7P A;  3RKW A;  4FAS D;  1TL8 A;  3JRE A;  1KA8 A;  2KLO A;  2DFE A;  3HHH A;  3U1K A;  2Z5U A;  2P0W A;  1RI7 A;  2VKH A;  1X1D A;  2XIG A;  1S6L A;  2G9W A;  2OQR A;  1UFM A;  2VE8 A;  5CVJ A;  3HIF A;  4BQN A;  2V1U A;  2Q1Z B;  2NRA C;  3OL4 A;  2AHQ A;  3SZP A;  3A4C A;  1SAN A;  2B7E A;  3CZ6 A;  4DZJ A;  2DA3 A;  1Z05 A;  1OR7 C;  5BS6 A;  3Q5F A;  3I54 A;  2X6O A;  3R0J A;  1H9T A;  2ISY A;  3K4N A;  1S7E A;  4AC0 A;  1TTY A;  4QPQ A;  4ZZL A;  3S2W A;  1Z3Y A;  1F9N A;  3DU6 A;  3CTA A;  3SHF A;  2HDD A;  4WXD A;  3K1N A;  2LSO A;  1YW8 A;  3KE2 A;  3G71 I;  2UV1 A;  5D4S A;  4I0B A;  3RPU D;  1ZRE A;  2DN0 A;  1YG2 A;  2IS6 A;  1JUM A;  2VOP A;  4HAM A;  2JMW A;  4NC6 A;  2VKD A;  1XGO A;  1ZK8 A;  3GTP J;  2HS5 A;  3FX3 A;  1ZKG A;  5F64 A;  4XQF A;  1SFO J;  3PL8 A;  3O8G A;  2E2I J;  3EYY A;  3TO7 A;  4HYE A;  2LKP A;  4A69 C;  2M34 A;  2JK3 A;  2BHZ A;  3T5X A;  2M8E A;  3BCA A;  1Q1H A;  2YPR A;  2R7X A;  3SQN A;  2V1X A;  4S04 A;  1JKP C;  2JUC A;  1CQT A;  2WB1 A;  3CCM I;  5D8L B;  3VPR A;  4EGZ A;  2MBF A;  4A3E J;  2M5W A;  4G12 A;  3Q9V A;  3QQA A;  3N05 A;  5HLI A;  5DCF A;  2P6T A;  1FC3 A;  3ABK H;  2DMT A;  1SD4 A;  1U5T C;  2OPT A;  3GFM A;  3KP3 A;  5DV5 A;  3JAM Z;  1B8I B;  1ONV A;  2CFO A;  2PJR B;  2HGC A;  2CMP A;  3QOE A;  4B8X A;  5IP7 J;  4XLP F;  2HPI A;  3NWT A;  2OCC H;  1X3U A;  4EM1 A;  5CQE A;  3LSM A;  3GVA A;  5EG0 A;  1D5V A;  4RBO A;  1LVA A;  2K02 A;  2F4O B;  1RRJ A;  2ZO4 A;  1E2X A;  5E8G A;  3SEQ A;  3BR6 A;  1RKW A;  3NAU A;  3ZQQ A;  4FTH A;  2KQR A;  3QYF A;  3H3Z A;  1VQL I;  5B5E C;  1XG1 A;  3PO3 J;  4MEY F;  5D5V B;  3ISP A;  2HWV A;  3PJR A;  3HOV J;  4M3D A;  1F4K A;  2DK5 A;  4F3Q A;  4RDU A;  5BNG A;  2QQB A;  4BDZ A;  2J5P A;  1P92 A;  1G3W A;  2F2E A;  1MH4 A;  2V9V A;  4PDK A;  4O3M A;  3RQ4 A;  1FP2 A;  3OV8 A;  4Q47 A;  4XON A;  1FTT A;  1ZQ3 P;  4BHB A;  4CA0 A;  1O3T A;  4Y52 J;  1W5T A;  1BC8 C;  4L9J A;  3J81 K;  4ZDO A;  3DPT A;  1FSE A;  1P4W A;  1BJZ A;  1FBS A;  2K3F A;  1HA8 A;  3HYI A;  2CQK A;  4LOC A;  5DUI A;  2HOA A;  1HKQ A;  1I6H J;  1LEB A;  1OCC H;  4LD5 A;  4B47 A;  2CUF A;  2K5C A;  3GTM J;  1F1Z A;  4JX6 A;  1XPX A;  2JPC A;  4WX9 A;  3LST A;  2JSC A;  3ZQC A;  3WOD F;  3G3Z A;  1B72 B;  2Y0S A;  1ON1 A;  1J9I A;  1T98 A;  2JZY A;  2A07 F;  1P7I A;  2VJI A;  3FXQ A;  2A5W A;  2IGM A;  2LMD A;  3JRI A;  3JCU C;  4HV6 A;  2YS9 A;  1XC5 A;  1O7L A;  3WU1 B;  2FX0 A;  4KN4 X;  2X4H A;  2L7M P;  3I58 A;  2LY9 A;  4KDP A;  2L4A A;  3R6S A;  4HDU A;  5EGO A;  4P96 A;  5H2F C;  1Z77 A;  2FNA A;  2MD5 A;  2X1C A;  4YRV A;  1CGP A;  2NAZ A;  2VLA A;  4BEH B;  2STT A;  3CMY A;  5FFZ A;  4C30 A;  4XRS G;  3IAS 2;  3WGH A;  4HNV A;  4RB2 C;  1HKS A;  4OIP F;  1WCM J;  2R5Z A;  3ML6 A;  4IJA A;  4LB5 A;  4PCQ A;  3MZY A;  1JKR C;  5DCM A;  1R58 A;  5E1Z B;  5EZG A;  1LEA A;  4HEA 2;  4IHY A;  3S16 J;  1GXP A;  1IN8 A;  1STZ A;  4M71 A;  2QBY B;  3NRV A;  3CUQ C;  4F7Z A;  5J1R A;  4NC7 A;  2K9N A;  3GFJ A;  2M9H A;  1JGG A;  2V6E A;  1YYV A;  3Q9S A;  3IAM 2;  4CCN A;  1VFC A;  1YW7 A;  4M3F A;  5IT9 K;  3HRS A;  3LA2 A;  1R49 A;  3Q0W A;  2ZJR F;  1WI9 A;  3L2Q A;  4NHJ A;  1IV6 A;  2KL4 A;  2TCT A;  2P7C B;  4C3I J;  9ANT A;  3FMS A;  3F6O A;  3DPL C;  4LMY A;  3WGG A;  2AXT C;  3GME A;  3BTL A;  3D5S C;  4CCJ A;  4HNT A;  1ETW A;  2ADU A;  1TWG J;  4X1E A;  1XMA A;  4V2F A;  1UZC A;  2HQN A;  2V6C A;  4WCG A;  5BPD A;  2MW8 A;  3EUH C;  4A3F J;  3SZG A;  3CME I;  4EJU A;  1ULY A;  4ZJZ A;  3K6G A;  1O3Q A;  1LB2 A;  3IH4 A;  4YG2 F;  4RLF A;  4IHX A;  1E17 A;  2DOA A;  3G1O A;  3QU6 A;  4FET A;  2QKM B;  2OF7 A;  2LBF A;  3HUG B;  1LQ1 A;  3QOP A;  1SVM A;  2CW0 F;  1ZAO A;  1TNS A;  4UXN A;  3GYH X;  5EJC A;  4KIT B;  3ZMD A;  3ERM A;  5J3L A;  2BXZ A;  3E6D A;  2BZT A;  3GUD A;  2LP0 A;  2VXD A;  1C0W A;  2IT0 A;  4L9T A;  2PFB A;  4WK8 F;  2B9S A;  2BOL A;  3A0B C;  1I50 J;  2E34 A;  3OIP A;  1SFU A;  1BM9 A;  4IHS A;  2BY2 A;  2XRL A;  2NS7 A;  3F8M A;  3ZMU A;  3GTQ J;  1ZG5 A;  2IS4 A;  4E6K G;  2EFQ A;  5E3M A;  1IGN A;  3V4G A;  5K5Q A;  1MBK A;  2I10 A;  4O6J A;  2QEX I;  1SFE A;  3FMR A;  5ED4 A;  4U88 A;  3QPS A;  3SFZ A;  4LG0 A;  3W2V A;  2PBI A;  4UB6 C;  2W24 A;  4CO8 A;  5FLX K;  1A04 A;  4AVP A;  3WG7 H;  2L9N A;  1BR2 A;  4DNC A;  2LG4 A;  2DA2 A;  1T0F A;  3G73 A;  2KIU A;  4ESJ A;  4C9Y A;  1SFK A;  1R71 A;  2L9V A;  3B6C A;  2R7Z J;  1YQA A;  5BOX A;  2XC7 A;  2HPM A;  3NWS A;  2XKP A;  3HXL A;  5DM6 F;  3DEW A;  3OIQ A;  2L54 A;  3S1Q J;  5GTI C;  4LIU A;  3T1B A;  4MQ9 F;  4I02 A;  5J1U A;  3F9K A;  3J81 Z;  1E3O C;  5J8F A;  3H3V K;  4UUS B;  1GUU A;  2CQ7 A;  3LSI A;  1Y8R B;  3TOB A;  4GRI A;  1G3Y A;  4MHG A;  2JA2 A;  4ITV A;  4XLA A;  2D5V A;  2DAO A;  2E35 A;  2EZK A;  4EM0 B;  3RZD J;  1FP1 D;  3BDD A;  3KP4 A;  5KAI C;  1X1B A;  3OYH A;  4KIS A;  4LJZ F;  4ANJ A;  2BYV E;  3C18 A;  1XCV A;  2HR3 A;  1QA6 A;  5KNL A;  4A3B J;  4Q5S F;  4A3C J;  4TV7 A;  2IPQ X;  2R7W A;  2RNJ A;  5GTH C;  4BHC A;  2CW7 A;  3D5L A;  2DA6 A;  5DD4 A;  4EM2 A;  3TP0 A;  2E1O A;  2HYG D;  2MGQ A;  2PMZ A;  3S32 A;  5ILS A;  3L2U A;  4BQA A;  3BG7 A;  3FHN A;  1IRG A;  4HA8 A;  3VSL A;  1OCR H;  2QKL B;  1W36 D;  3DCF A;  3ZMT A;  1TLH B;  3K1M A;  5ILU A;  4ZYG A;  1HSJ A;  1U8B A;  2DPU A;  2HOS A;  1BA5 A;  2RQP A;  1D1B A;  2LF8 A;  2Y9Y A;  4NQW B;  2FBH A;  5TJJ A;  1WWX A;  3R4K A;  1E3H A;  3O2P E;  1PP7 U;  5H6R A;  1IV8 A;  4IOC F;  4MLO A;  3H5N A;  2ELH A;  1EH8 A;  1TQI A;  4MQV A;  1MMG A;  3S1M J;  2QEN A;  4BXU A;  1W7P B;  3WTZ A;  2L5Q A;  3P9K A;  2L9R A;  2CG4 A;  2IAI A;  3PNY A;  4N0B A;  3BG9 A;  4L5E A;  5ICF A;  1R7J A;  2Y0M A;  1WPK A;  3MZH A;  1HCR A;  2HXO A;  1XD7 A;  2CH0 A;  3F8B A;  1X4O A;  4GDF A;  4H0E A;  3N4M A;  1MMS A;  3JR9 A;  3AAF A;  1ZHF A;  4JK1 X;  1WH5 A;  4WXH A;  5FD6 A;  2RRE A;  1TZL A;  1HDP A;  4A3K J;  2CYY A;  4XN0 A;  2W7N A;  2VKE A;  2EV6 A;  1D5Y A;  2OA4 A;  2OD5 A;  1G59 A;  2WC2 A;  4HBL A;  5DD8 A;  4C2T A;  2DA5 A;  3K9T A;  4Z2Y A;  3TDZ C;  1BW5 A;  1RPW A;  4N9I A;  1T6S A;  2MLK A;  1I3A A;  2Q8K A;  2QSG X;  4II2 A;  2QZ8 A;  4Y13 A;  4KIC A;  5F1R A;  3AL0 C;  2X1D A;  1OCT C;  1IG7 A;  4Y7N J;  3KET A;  4YII A;  1XN7 A;  3TGN A;  2BY0 A;  4X0G A;  1UEL B;  4H4K C;  1JJ6 C;  4OMZ A;  2CWE A;  4LK1 F;  1D1C A;  3WHB A;  3FMQ A;  1OYW A;  1U6G A;  2DYS H;  3LA3 A;  4BAY A;  4XBF A;  4AM3 A;  3DU5 A;  1EJ9 A;  3SDB A;  1W0T A;  4DIQ A;  1U3E M;  1VQ6 I;  5DTD A;  1N75 A;  2HQA A;  1U0J A;  3CES A;  3OS2 A;  1HOM A;  4BHP A;  5C44 J;  1HLV A;  2EJR A;  4XIC A;  1ZG3 A;  5J40 A;  3WTT C;  3I59 A;  4N4N B;  1EV7 A;  3R60 A;  3HKZ N;  3WTU C;  1BI3 A;  4EAT A;  1EKE A;  3PSI A;  4G9Y A;  4Y4R A;  4A5M A;  2VL8 A;  3JSP A;  3S3M A;  4M9S A;  2WAQ A;  3E6M A;  2XAG A;  1MBF A;  1TW2 A;  2PEX A;  4FIS A;  3TO6 A;  3EUA A;  2VN2 A;  2CW8 A;  3BTI A;  3ECO A;  5HDG A;  3OS0 A;  3LNQ A;  3VOD A;  4C3J J;  2LR8 A;  1KYZ A;  2HFH A;  1BR1 A;  3KX2 A;  4HZF A;  4KYW A;  3W6J B;  2GOM A;  3M8J A;  4BQO A;  2PMH A;  3MFK A;  3TP3 A;  3FIS A;  3V8J A;  1X2M A;  4D5F A;  5EG0 B;  2O0Y A;  2ELJ A;  2X1E A;  5KHD A;  2WAF A;  4M9Z A;  5LEJ A;  2OTJ I;  3WHC A;  5LGT A;  2KKO A;  3PUB A;  4A3L J;  3EPZ A;  2YUS A;  3CJT B;  2F4I A;  2JRM A;  4JP0 A;  1XX5 A;  1I1S A;  2D2W A;  1GVJ A;  5AON A;  2Q2E A;  1HW2 A;  1QVT A;  1SD7 A;  2OUM A;  2LKX A;  2R7U A;  1YI2 I;  3H3U A;  3FXU A;  5HLG A;  4ZYE A;  1D1A A;  1SMT A;  4M6Y A;  3PIP F;  5J8C A;  1YJ9 I;  4NDL A;  2ISZ A;  4QSH A;  2QSH X;  2E1M B;  2FF4 A;  4A3I J;  1ZGJ A;  2HZD A;  2JQ7 A;  1WKM A;  1FX7 A;  4L0Z B;  2NS0 A;  4PFO A;  3K2A A;  3CJR B;  5GAG J;  5C4X J;  5FD5 A;  5F27 A;  1S29 A;  4B09 A;  2DFI A;  3RPU A;  1VQ4 I;  4PK4 A;  3K10 A;  3CO6 C;  3JSO A;  1KQ9 A;  3S15 J;  1GHC A;  1YX3 A;  5EZH A;  1WSU A;  1D3Y A;  2PQ8 A;  4IQ4 A;  3OYA A;  2ID3 A;  4MFD A;  1Z3X A;  5L3C A;  1HST A;  2H8W A;  4HQE A;  2V26 A;  3TO9 A;  4U87 A;  1RR7 A;  1OJL A;  4IQJ A;  4N9H A;  1ZLK A;  2O61 A;  4BAC A;  3O8H A;  4ZTF A;  4KJZ A;  3RKY A;  5HS8 A;  1DDN A;  1OQY A;  1KU2 A;  1S9H A;  2VI6 A;  4LG3 A;  1NK2 P;  2TRT A;  1UMQ A;  1BIB A;  3FBN B;  4BY1 J;  4IKF A;  4EQQ A;  2EPF A;  2DJN A;  3IRR A;  3ZP5 A;  1EA3 A;  1ETY A;  5EGO B;  1LNW A;  4YEJ A;  1KON A;  3SDG A;  2VON A;  3DPU A;  3O6B B;  4E7H A;  2X0L A;  2ZC2 A;  3M7G A;  1PJR A;  5H20 A;  2VQG A;  2KDZ A;  1V5G A;  1NH3 A;  3C2H A;  3WTW C;  2R5Z B;  2R7Q A;  1RZ4 A;  2L2O A;  3BZ6 A;  4I7H A;  3UKG A;  3CDL A;  2EWN A;  2QQA A;  5DCM B;  1V3F A;  3CJN A;  3P5J A;  5E79 C;  5J47 A;  3KLO A;  3VEP A;  1FYM A;  1IRX A;  5JVT A;  2A61 A;  4YFK F;  5BMZ A;  1JKQ C;  3CC4 I;  1XDU A;  3L09 A;  3HOS A;  4M6V A;  4P9F A;  5IYB J;  2MYS A;  2GBY A;  2DOF A;  3WTV C;  1IXS B;  1Z1D A;  2P5V A;  3R61 A;  1Y6I A;  4ENK A;  2EFN A;  4A2U A;  4ENJ A;  4E4H A;  3HM5 A;  2W00 A;  1DGR M;  3VYR B;  4DBQ A;  4ASN A;  2EIM H;  4DOZ A;  3KYC B;  2OTL I;  2HNH A;  3OS1 A;  3I4N J;  3H5R A;  2O3F A;  1NG7 A;  2GIZ A;  3BRO A;  4UVA A;  2IRF G;  3G2B A;  4HF2 A;  2L7K A;  1FBQ A;  3CJQ B;  2VAS A;  2DA1 A;  4RGS A;  2K85 A;  5FO5 A;  3W3C A;  2TDX A;  3BR2 A;  2AXL A;  1FYK A;  3TKY A;  5FKO A;  4L9V A;  2M3A A;  4HX8 A;  1IAW A;  1LFP A;  4CYD A;  2RC4 A;  3BC8 A;  3BOQ A;  2LKS A;  2ME0 A;  2YR2 A;  4CYC A;  2V4J C;  1PDN C;  3J80 Z;  4V19 K;  4PUS A;  1U2W A;  2LBF B;  3I53 A;  1R1U A;  1IN5 A;  2CGP A;  3OYN A;  2GXA A;  4MNU A;  1AOY A;  5HLT A;  1FT9 A;  1OLT A;  1TQM A;  5FKK A;  4XOT A;  3ZQF A;  2VOD A;  1GVD A;  2EFO A;  3K69 A;  3DKY A;  4C3H J;  4XOP A;  1YIT I;  3RIR A;  2XF5 A;  3HEF A;  3H9J A;  3AG4 H;  3F0C A;  4G7O F;  4E7Z A;  3B02 A;  1VQP I;  1H88 C;  1YRN A;  5F6F A;  2EFW A;  4NBQ A;  2LRD A;  4LG0 B;  4ZDP A;  1IJW C;  5FJ8 J;  1MMA A;  3BTJ A;  4DYQ A;  1X4P A;  2D1H A;  2WA0 A;  4CUG A;  4IOA F;  3MD2 A;  1LE8 A;  1IRZ A;  1JI8 A;  1ETV A;  3HRU A;  3LAJ A;  1WZ2 A;  2ZCW A;  1TQP A;  1IZ1 A;  1G6N A;  5HDN A;  4II3 A;  3G4S I;  2DMP A;  4CH7 A;  4LB6 B;  2R4G A;  5M5W J;  1R5H A;  3H9Q A;  2XRN A;  4IL6 C;  3WGI A;  4OWR B;  4EJT A;  1U8R A;  2FML A;  2EA2 A;  3GTK J;  3COA C;  1J75 A;  5IP6 A;  3ABT A;  3V42 A;  1W4M A;  3R0A A;  3K70 C;  1A36 A;  2YX4 A;  4E7K A;  3E1S A;  5D5U B;  1S8N A;  3TED A;  5E17 F;  3GO5 A;  2FJ1 A;  2NYX A;  3CLQ A;  4FE4 A;  2ZXI A;  3LQR A;  3QP6 A;  2DYR H;  2RNG A;  4JYK A;  3QPL A;  4UY8 I;  4NB5 A;  5EYR A;  5D5W B;  2XGE A;  2BEO A;  2L4M A;  3CQZ J;  2M0M A;  4RM2 A;  3WU0 A;  1ZYR F;  4UV8 A;  2HTJ A;  4PJN A;  2XPV A;  4PJ0 C;  4A3J J;  3A01 A;  2VOO A;  3WE3 A;  1HW1 A;  1BI2 A;  1K4S A;  1HKT A;  3FKI J;  4A5N A;  1N78 A;  3ZMS A;  3ZQ7 A;  2EK5 A;  2L02 A;  3OR1 C;  4QPO A;  5CPR B;  1ZG1 A;  2VJJ A;  1HC8 A;  4M3E A;  3I55 I;  2K9M A;  1W36 C;  1JTX A;  2DDB A;  1K7A A;  4CCK A;  2UXN A;  4OIN F;  4MEX F;  1XSX A;  2I5U A;  3CDH A;  2E36 A;  3L00 A;  2E7W A;  5K5O A;  3QPH A;  3ZN0 A;  3OMY A;  4I09 A;  1HF0 A;  3HOU J;  4RAF A;  3CCR I;  1MMN A;  4HNU A;  3CLO A;  4LFU A;  5L3B A;  2V9K A;  3Q0V A;  5LHI A;  3P9C A;  2WAE A;  3KEY A;  3B73 A;  5TIS C;  1YLF A;  1SC7 A;  4U0W A;  1T95 A;  2VQC A;  3ABU A;  3NEU A;  1WFX A;  4IVN A;  4XK4 A;  3FXM A;  1OR7 A;  3GF2 A;  2RGV A;  2ZNY A;  2IXS A;  4HV5 A;  3OYB A;  2FEZ A;  2ZJP F;  4HG2 A;  1MNM C;  2R0Q C;  2R7F A;  4U7D A;  1MBG A;  3FIW A;  2AQF A;  2JSP A;  4D7N A;  2GLO A;  1FIP A;  5DEQ A;  2RQQ A;  1I39 A;  4WXC A;  2O8K A;  3M4O J;  1OCO H;  2BVM A;  4G6Q A;  4HPQ A;  3F22 A;  1GDT A;  2E71 A;  1TWA J;  2VE9 A;  3LSP A;  3OY9 A;  1FBU A;  4A0X A;  3J7Y J;  1IDY A;  4I76 A;  4LGW A;  4JOM A;  2DQL A;  2WTE A;  5D4R A;  4B3X A;  4F91 B;  5B3S H;  1UCR A;  2A69 F;  1YIO A;  2P81 A;  1Z7U A;  2A05 A;  3L2V A;  3ZPL A;  1QHG A;  2DDA A;  3DWL E;  2OBP A;  3GW2 A;  3PM1 A;  3S3O A;  1FOX A;  3CF5 F;  3QPT A;  1W7P D;  4AD9 A;  1Y0U A;  3HC7 A;  4U7B A;  3OYJ A;  3M1E A;  3S2H J;  1U5T A;  2JN6 A;  4FX4 A;  2ME6 A;  2GXG A;  1XMK A;  1S7O A;  1X2N A;  2XKO A;  2ZB9 A;  3K4C A;  1K79 A;  2HDC A;  3U2R A;  5FKL A;  2KFD A;  2FUG 2;  2KRC A;  2K7L A;  1D8J A;  2CSO A;  4BQQ A;  1VQO I;  3I59 B;  4RB3 C;  3TW6 A;  1QNT A;  3AG3 H;  5J6X A;  2PI0 A;  3FM5 A;  1MSE C;  3RKQ A;  3SEZ A;  3U1D A;  1VTN C;  5CQG A;  2EV0 A;  1DQU A;  4PJL A;  1RUO A;  4CCO A;  2EFP A;  1LVK A;  4XKW A;  3DLL F;  1YW9 A;  3HSF A;  3CF2 A;  1MBE A;  2XB0 X;  3IP4 B;  3K4M A;  1GT0 C;  3RYP A;  2M8G X;  4KUM A;  1MND A;  4CGZ A;  3L2W A;  3HG9 A;  2VIX A;  2K4B A;  2DLL A;  3L9F A;  2NVY J;  4CDG A;  2JJ7 A;  2Z9O A;  4BBS J;  1FSH A;  4RLQ A;  4I6Z A;  2VPL A;  1NHA A;  3KEQ A;  4XSZ F;  3FXL A;  3OWT A;  3ZQH A;  4QIW N;  1DU6 A;  4RA2 A;  5LBQ A;  5K5R A;  2FA5 A;  2ETH A;  4L18 B;  4KIG A;  3DV8 A;  3OYI A;  3K4K A;  1MZB A;  2IA2 A;  2Q2E B;  2XRO A;  1JTY A;  3LA7 A;  4WWC A;  4GYG A;  1VQ7 I;  1T39 A;  3K1P A;  3W2A A;  1ZTR A;  5EEA A;  1R22 A;  1BN5 A;  1MBH A;  4E7I A;  2ACJ A;  4JQF A;  4L0Y B;  3CCU I;  3BR3 A;  4XLH A;  4XKV A;  2NVU B;  4PZJ A;  3GTG J;  1EF4 A;  2F5E A;  1YFH A;  2HOE A;  3T8R A;  3I64 A;  1R5G A;  1ZAR A;  2HVQ A;  4KIB A;  5D8K B;  5JVG F;  4IRG A;  3F8N A;  1TNT A;  4XRM A;  2HQR A;  1P4A A;  2FRH A;  3S1N J;  4LIT A;  2WAD A;  4M9X A;  1H89 C;  4CSW A;  2V9P A;  3CO7 C;  1VQ8 I;  1YOV B;  3W6V A;  4AIJ A;  2L9S A;  2V1D A;  2PJP A;  5ILV A;  5HNF A;  1SVL A;  1YX5 A;  3CC7 I;  2AS5 F;  5CVR A;  1TT5 B;  1MJ9 A;  2E7X A;  4C2M J;  1ZEL A;  1FWZ A;  3CD6 I;  3P9I A;  2KIM A;  1W0U A;  2XGX A;  2FBK A;  3ZQL A;  2IS1 A;  3E97 A;  3LQQ A;  2DK8 A;  4HQM A;  3OR2 C;  1D8K A;  1QVU A;  1IO2 A;  2XAH A;  3I4M J;  2JUG A;  3FZV A;  3RSN A;  3TL4 X;  2W57 A;  1D0X A;  3CP8 A;  5CLS A;  1IF1 A;  5EDN A;  4XNF A;  2M87 A;  2ZNZ A;  4NC8 A;  4ENN A;  4EV0 A;  3CUQ A;  2B0L A;  1BI0 A;  4XID A;  4DYR A;  1WJA A;  3KYL A;  1BBY A;  2CJJ A;  4XLE A;  4L5I A;  5LD2 C;  3RCO A;  3M1C A;  1IN6 A;  4PSW A;  3GBG A;  2J5O A;  3KLN A;  3VDX A;  3IHU A;  2W84 A;  1HQC A;  4Y17 A;  4YEL A;  3HOW J;  3K70 D;  1I27 A;  3L7W A;  4UNO A;  3DLA A;  3GWZ A;  1YS7 A;  4OIQ F;  3OYG A;  2V79 A;  2E60 A;  3MKL A;  1Y1V J;  2LK2 A;  1WJ5 A;  3BY6 A;  3VYT B;  3OYF A;  2O9L A;  3UNG C;  2DT6 A;  2BY1 A;  4CXF A;  1E0E A;  2VJ4 A;  2X6Y A;  1SMY F;  2RKH A;  1V5E A;  2QCO A;  5DM7 F;  1BI1 A;  1JHF A;  4UUT A;  1PUF A;  4HSR A;  2EIJ H;  2O7O A;  2JWT A;  3FF5 A;  2HOT A;  2BXY A;  3EUH A;  3J7Z I;  4M73 A;  4RB0 A;  2ZXH A;  1OYY A;  3HRT A;  4AYB N;  3BG5 A;  1Y8Q B;  1LPQ A;  4D7M A;  1QHH D;  4ETS A;  2CFX A;  1JT0 A;  2R7T A;  3E5U A;  4BH9 A;  4U0V A;  5LFA A;  1B6A A;  3UR3 C;  1GLN A;  3TBI A;  4ZH4 F;  5A2Q Z;  1S72 I;  3JRB A;  2FE3 A;  2XDV A;  3QWL A;  1SAX A;  5GAD J;  5ICG A;  4BL0 B;  1QBJ A;  4CCM A;  3GFL A;  5LLQ A;  3S17 J;  1XTA A;  3ZXS A;  3WG9 A;  1BR4 A;  5FFX A;  3FBI B;  1Y0N A;  2IW5 A;  5FRN A;  4CYC B;  4R8H A;  4AID A;  1KQ0 A;  3DFG A;  4FE7 A;  1HBX G;  4AVZ A;  2CQQ A;  3RDI A;  3F72 A;  3E3V A;  3HKZ A;  1AHD P;  2EIK H;  2X6W A;  3GZ5 A;  1JJ8 C;  2M1B A;  2DBB A;  3JTG A;  4OOI A;  3ZRG A;  2DTZ A;  1JGS A;  1WH7 A;  4ZDL A;  2ZJQ F;  1Z9C A;  2STW A;  2CS3 A;  1R23 A;  5C3E J;  1MSF C;  2O8X A;  4D9J A;  4YFX F;  4S0H B;  2MH2 A;  5F1J A;  3HOT A;  4CIC A;  4HST A;  1GV5 A;  1YRN B;  2P6S A;  2Z3Y A;  1ETO A;  2R92 J;  2H1L A;  4MGR A;  1F5T A;  3HPG A;  2XAU A;  3MCZ A;  4BBR J;  4DYC A;  2YU3 A;  3NAR A;  1FZP B;  4G8X A;  3HZJ A;  1XS9 A;  1R1V A;  1QRY A;  1QZZ A;  2R5Y A;  4G94 A;  5GAH J;  1LE8 B;  2XAJ A;  4BJ5 C;  1T56 A;  5IT3 A;  3HSR A;  3H36 A;  1SD6 A;  5FRM A;  3BJ6 A;  1T8I A;  1RNL A;  2XF7 A;  3DBH B;  3DBL B;  3IUO A;  3ECH A;  1ZRD A;  3I71 A;  1ETX A;  1TW3 A;  5HLH A;  2KIF A;  1NG6 A;  1EH7 A;  2M7A A;  1ZR4 A;  2IGO A;  3C1D A;  4BJT A;  2IGN A;  5BQT A;  5ICE A;  5C4J J;  3ERE D;  1B1B A;  1G8X A;  3F6V A;  3S8P A;  4LLN A;  3ZR8 X;  2RDP A;  3PFY A;  1HXD A;  1XGS A;  2JT1 A;  2DA7 A;  2K4J A;  4Y15 A;  2R7S A;  3IWZ A;  4MIM A;  4ESF A;  3G1L A;  2OC6 A;  1B9M A;  3OSF A;  1KGS A;  3OYM A;  3J80 K;  3DEU A;  2ZBK A;  1SEU A;  2VBX A;  1GXQ A;  4V2G A;  4QTR A;  3BG3 A;  2MFZ A;  1Z6R A;  1TWH J;  3K4B A;  3QOD A;  1MBJ A;  3BTC A;  3H35 A;  4RB1 A;  1WGX A;  3A01 B;  4CHU A;  2IS2 A;  1FTZ A;  2QA4 I;  3EUK L;  1XGN A;  3F8C A;  2H27 A;  3BCB A;  5GPA A;  3FM3 A;  4BUP A;  4OAY A;  1YE9 A;  4HX7 A;  2BY3 A;  1XMX A;  1OCP A;  3O3K A;  4X6A J;  4RAG A;  4FT8 A;  2FOW A;  5F0H A;  3GZ6 A;  3S2D J;  1X3Z B;  4DBR A;  2PN6 A;  3KZY A;  3PNV A;  1W5S A;  3M07 A;  1P7J A;  1YJN I;  1ON2 A;  2ID6 A;  5JR3 A;  2CO5 A;  3M8F A;  2K9S A;  2LYC A;  4RGR A;  3BJO A;  1XSD A;  1ENH A;  1MKM A;  4IHT A;  4N4O B;  2JA7 J;  3KZI C;  2XAS A;  4FQG A;  3ZGK A;  1B4A A;  3K0L A;  1VND A;  5IY5 H;  2VQL A;  1QZE A;  3GTJ J;  2IP2 A; 
#chains in the Genus database with same CATH homology
 3HEF A;  2FX0 A;  3SJM A;  1VF9 A;  2L7M P;  3HBL A;  3F0C A;  2LY9 A;  1H88 C;  1YRN A;  5EGO A;  3ZQI A;  4M3G A;  1Z77 A;  3LOC A;  3BQY A;  3JRG A;  3CMY A;  4AUX A;  1IJW C;  3A03 A;  4XRS G;  5FJ8 J;  4HNV A;  3BTJ A;  1WCM J;  2R5Z A;  4DYQ A;  3LSR A;  4B4C A;  1B8I A;  5E3L A;  1JKR C;  2HQ5 A;  2FD5 A;  1LE8 A;  1IRZ A;  1TWC J;  1ETV A;  5EZG A;  4B3A A;  5M3M J;  4IHY A;  1HDD C;  2MSY A;  3S16 J;  3HGY A;  2VPR A;  1DU0 A;  1FJL A;  2DMP A;  5FLM J;  4GFB A;  5J1R A;  5M5W J;  2Y30 A;  2K9N A;  2M9H A;  1JGG A;  3GTK J;  1VFC A;  2HYJ A;  2JA5 J;  5IP6 A;  5M5Y J;  5K7F A;  1MH3 A;  4M3F A;  2VUM J;  3RQI A;  2EH3 A;  3HB9 A;  3Q0W A;  2EZH A;  5FKN A;  3TED A;  5M5X J;  2FJ1 A;  1IV6 A;  1FIA A;  4FE4 A;  5GPC A;  2TCT A;  4C3I J;  9ANT A;  3JRC A;  4JYK A;  3QPL A;  5EYR A;  2XGE A;  3CQZ J;  2ELK A;  2ECC A;  2G0E A;  3BTL A;  3D1N I;  1UHS A;  3LSJ A;  2LLK A;  2B63 J;  1ETW A;  2XPV A;  1TWG J;  4X1E A;  3A01 A;  4A3J J;  3MVP A;  1O4X A;  4V2F A;  1K83 J;  3A02 A;  1ZR2 A;  3FKI J;  2NOG A;  2MW8 A;  2IBD A;  4A3F J;  1BW6 A;  2HI3 A;  1LFB A;  4M3E A;  1G2H A;  1JTX A;  3IH4 A;  4IHX A;  3S14 J;  3G1O A;  1IC8 A;  3FK6 A;  2OF7 A;  2X9D A;  1RKT A;  1B72 A;  1HF0 A;  3LSG A;  1F43 A;  1WI3 A;  2MG4 A;  3JRD A;  3HOU J;  3HOZ J;  5J3L A;  3Q0V A;  2PMZ N;  2LP0 A;  1JUP A;  1VI0 A;  1BL0 A;  1RET A;  3CCY A;  1I50 J;  1T33 A;  2NVX J;  1LFU P;  3K7A J;  4XK4 A;  1Q1V A;  2QF7 A;  4FCY A;  4A3G J;  2XRL A;  2NS7 A;  3GTQ J;  2NS8 A;  1IGN A;  5E3M A;  4IEJ A;  1TC3 C;  1MBK A;  4MFE A;  2I10 A;  3ZQG A;  5K7Z A;  1MNM C;  2NVQ J;  2M0C A;  3QPS A;  4B1R A;  2R0Q C;  2EZI A;  1UG2 A;  3FIW A;  1MBG A;  3C2B A;  5IYC J;  3PO2 J;  2DA2 A;  2VKV A;  1FIP A;  4D7N A;  2GLO A;  2L7Z A;  3M4O J;  2O8K A;  1GDT A;  2ECB A;  1TWA J;  3LSP A;  5JLW A;  1AU7 A;  3B6C A;  2R7Z J;  5IYD J;  3MN2 A;  3BR5 A;  1A5J A;  3DEW A;  1IDY A;  4I76 A;  3S1Q J;  5J1U A;  1E3O C;  3H3V K;  4UUS B;  1GUU A;  2P81 A;  2COB A;  2N8G A;  2K40 A;  2D5V A;  3RZD J;  2EZK A;  1F36 A;  3PM1 A;  3JRH A;  5FKM A;  2LD5 A;  4IHW A;  2CUE A;  2GM4 A;  4A3B J;  5EF6 A;  4A3C J;  4A3M J;  3OSG A;  1I3Q J;  1A6I A;  2DA6 A;  3BR0 A;  1U78 A;  3S2H J;  3TP0 A;  2JN6 A;  2E1O A;  2MGQ A;  3RZO J;  2CQX A;  1QPI A;  5IPA A;  2ME6 A;  1X2N A;  2ZB9 A;  3Q3S A;  5FKL A;  1AKH B;  3DCF A;  3M3Y J;  3TW6 A;  1U8B A;  5IOZ A;  1MSE C;  1ETK A;  1U9N A;  2R93 J;  2EZL A;  5E3O A;  3RKQ A;  2FQ4 A;  5K7H A;  2HOS A;  4JX4 A;  1BA5 A;  2LTP A;  2Y9Y A;  3BQZ A;  4DW6 A;  4MLO A;  5HOD A;  1MBE A;  2XB0 X;  3IV5 A;  3S1M J;  1GT0 C;  2M8G X;  1TWF J;  2L9R A;  1FEX A;  2IAI A;  2NVY J;  2JJ7 A;  2DMQ A;  4DZP A;  3BG9 A;  4L5E A;  4BBS J;  4I6Z A;  1PUF B;  2JA8 J;  1WPK A;  2WAQ N;  2KT0 A;  2HXO A;  1HCR A;  5FLV A;  3E7L A;  3ZQH A;  4QIW N;  1DU6 A;  2WV1 A;  5F08 A;  1APL C;  1JTY A;  3JR9 A;  1WH5 A;  4XRS A;  3SFI A;  1ZTR A;  2XGC A;  5EEA A;  1HDP A;  4A3K J;  4EEF G;  1MBH A;  3IH2 A;  1JT6 A;  2L7F P;  4JX5 A;  4BKX A;  1R9T J;  2VKE A;  2EBI A;  1D5Y A;  3BR3 A;  3JRA A;  3GTG J;  1EF4 A;  2DA5 A;  3HOX J;  1BW5 A;  1RPW A;  3BT9 A;  4UUS A;  1IDZ A;  4XRM A;  1OCT C;  3BR1 A;  1Y1W J;  1IG7 A;  3S1N J;  4ABZ A;  1OFC X;  2EQR A;  4Y7N J;  2CRG A;  3H0G J;  2H8R A;  4BXX J;  1H89 C;  4W1U A;  3W6V A;  1K61 A;  1JJ6 C;  2XPW A;  2E2H J;  2DA4 A;  3WHB A;  1ETQ A;  3TW7 A;  4C2M J;  2XB5 A;  1W0U A;  3ZQL A;  3GTO J;  1W0T A;  2JA6 J;  5F0F A;  1QVU A;  5DTD A;  3IH3 A;  3Q0U A;  3I4M J;  1HOM A;  5C44 J;  1HLV A;  2XGD A;  4XIC A;  2K9Q A;  5EDN A;  1AKH A;  2AO9 A;  4XID A;  4DYR A;  3HKZ N;  3HDD A;  4A3D J;  2CJJ A;  3GBG A;  1MBF A;  5J1Y A;  4FIS A;  3BTI A;  3LNQ A;  2R5Y B;  4MO7 A;  3HOW J;  4C3J J;  2WB1 N;  2LR8 A;  5M3F J;  2M2E A;  5IOY A;  3MKL A;  1Y1V J;  2LK2 A;  1ZGW A;  2E2J J;  2O9L A;  3B6A A;  3TP3 A;  3FIS A;  1X2M A;  4D5F A;  5EG0 B;  3JRE A;  2QCO A;  3WHC A;  4UUT A;  1PUF A;  1X58 A;  1ITY A;  4A3L J;  2YUS A;  3OOU A;  2O7O A;  4JP0 A;  2JWT A;  2HOT A;  2L0K A;  2AHQ A;  1QVT A;  2LFB A;  2LKX A;  4AYB N;  1SAN A;  3BG5 A;  4DZJ A;  2IEK A;  2DA3 A;  4D7M A;  4NDL A;  2X6O A;  1JT0 A;  4QSH A;  1S7E A;  3HGG A;  4AC0 A;  4A3I J;  4BY7 J;  3JRB A;  1IUF A;  2HDD A;  3K2A A;  5F04 A;  5C4X J;  5F27 A;  3S17 J;  2DN0 A;  1JUM A;  3S15 J;  5EZH A;  2JMW A;  4CYC B;  2ID3 A;  4FE7 A;  1ZK8 A;  4MFD A;  3GTP J;  3G1M A;  3S1R J;  1ZKG A;  2CQQ A;  1SFO J;  3O8G A;  1RR7 A;  1OJL A;  1AHD P;  2E2I J;  2Y31 A;  2Y2Z A;  4A69 C;  1JJ8 C;  3O8H A;  2M34 A;  1NTC A;  2JK3 A;  2DTZ A;  1WH7 A;  2VI6 A;  1POG A;  1NK2 P;  2TRT A;  5C3E J;  1UMQ A;  1JKP C;  1CQT A;  1MSF C;  4M3B A;  4BY1 J;  3VPR A;  4S0H B;  5DS9 A;  4A3E J;  5F1J A;  4G12 A;  3HOY J;  2DJN A;  2DMU A;  3FK7 A;  3OIO A;  1GV5 A;  1YRN B;  3QQA A;  1ETO A;  1ETY A;  2R92 J;  5EGO B;  2HXI A;  4IHV A;  2XPU A;  3SDG A;  4BBR J;  4J19 A;  4DYC A;  2KDZ A;  2Y0S N;  2DMT A;  2R5Z B;  3NAR A;  2OPT A;  3UKG A;  1XS9 A;  3CDL A;  1QRY A;  1B8I B;  2R5Y A;  1LE8 B;  1GV2 A;  2H1K A;  1T56 A;  3GTL J;  5GP9 A;  5IP7 J;  2DMN A;  3L1P A;  1JKQ C;  2E19 A;  1U9O A;  2CU7 A;  2RAE A;  4W97 A;  1H8A C;  5EG0 A;  4M6V A;  4RBO A;  1ETX A;  5IYB J;  5IP9 J;  2GBY A;  1ORK A;  3BR6 A;  1RKW A;  3NAU A;  4FTH A;  1ZR4 A;  1Z0X A;  2NVT J;  3HM5 A;  5C4J J;  1XG1 A;  3PO3 J;  3HOV J;  2DA7 A;  4M3D A;  3JRF A;  3I4N J;  4MIM A;  4D5C A;  3G1L A;  1RES A;  3OSF A;  3ZOB A;  2Y9Z A;  5E3N A;  4RDU A;  5BNG A;  1MH4 A;  2DA1 A;  4V2G A;  4QTR A;  1FTT A;  3BG3 A;  1TWH J;  1MBJ A;  3BTC A;  1ZQ3 P;  1WGX A;  3A01 B;  1FTZ A;  4Y52 J;  4A93 J;  3BR2 A;  5FKO A;  5GPA A;  1BJZ A;  5JLX A;  2YU9 J;  1OCP A;  4X6A J;  3S2D J;  4LOC A;  5F0H A;  2ME0 A;  2HOA A;  2XSD C;  1I6H J;  2LVS A;  2CUF A;  4CYC A;  3GTM J;  4JX6 A;  1P7J A;  2W48 A;  5F0C A;  2ID6 A;  3ZQC A;  2K9S A;  1B72 B;  1NK3 P;  1JUS A;  1ENH A;  2JA7 J;  5FKK A;  3ZQF A;  1GVD A;  1P7I A;  2X48 A;  4C3H J;  3JRI A;  1JKO C;  1VND A;  2YS9 A;  3GTJ J;  1XC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...