1H8AC

Crystal structure of ternary protein-dna complex3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
105
structure length
105
Chain Sequence
NPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 33
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2001-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h8aC01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h8aC02
3TP0A 1ETQA 3TP3A 1WGXA 2ID3A 1JKPC 1ETVA 5FKNA 5GPCA 3JREA 1O4XA 5M3FJ 2E2IJ 4FTHA 2LP0A 1X2NA 1IUFA 3QPLA 4CYCA 2O8KA 3ZQFA 2E19A 2DA4A 3BR3A 5J1RA 4BXXJ 2R7ZJ 1DU6A 1T56A 4BBRJ 5C44J 5M3MJ 3LSPA 1JUSA 1NK2P 3HOXJ 1VI0A 2X6OA 2CQQA 4DZJA 3HOUJ 1QPIA 5F0HA 5E3NA 3S1RJ 3PO2J 3A03A 4B3AA 2XPWA 1IV6A 1WPKA 3S15J 5FKOA 3JRGA 1AHDP 1GVDA 3IH2A 2EZHA 1U78A 4Y7NJ 2KT0A 1JT0A 1GV5A 2WAQN 2OF7A 3M4OJ 1Z0XA 3JRDA 1U9OA 4IEJA 3ZQCA 1GT0C 3FK7A 2MW8A 3ZQHA 2R5YB 2LKXA 1ORKA 2EZLA 5F1JA 4A3FJ 1JKOC 3JRBA 3Q0WA 5EG0B 1MNMC 1VNDA 1R9TJ 1U9NA 1VFCA 5IP7J 2JWTA 1H89C 1GV2A 3E7LA 5E3MA 4QIWN 2XRLA 3BTJA 1EF4A 2G0EA 3LSGA 3FK6A 1F36A 5GPAA 3FKIJ 1I6HJ 2NVTJ 4C3HJ 3A01A 2EH3A 5C4XJ 2GM4A 4X6AJ 5K7ZA 1JJ6C 2CQXA 4JX6A 1TWHJ 4UUSB 3RZDJ 2OPTA 1XS9A 2E1OA 1AU7A 2LD5A 4QTRA 3BTCA 5M5WJ 4X1EA 2L9RA 4L5EA 5M5XJ 3BR2A 1JT6A 4IHYA 1LFBA 3GTQJ 1B72B 3BR6A 5BNGA 4S0HB 1HLVA 1ITYA 4JX5A 1Q1VA 4MLOA 1IDYA 5F0FA 3GTOJ 1MH4A 2HYJA 1W0TA 2CRGA 1QRYA 2LFBA 3ZQLA 2HQ5A 5FKLA 3D1NI 1ETXA 5FLVA 1GUUA 1JGGA 1RKTA 1QVTA 3G1LA 3GTJJ 3C2BA 1ETKA 4D5CA 4J19A 5FKKA 5EGOB 2XPUA 1RKWA 1DU0A 4A3IJ 2ZB9A 2NS7A 5FJ8J 2FJ1A 4UUSA 1XC5A 1AKHB 2FX0A 3QPSA 2DMTA 4BY7J 4D7NA 4EEFG 2R5ZB 5F04A 2PMZN 1JTYA 1Z77A 3Q3SA 3BG5A 4RBOA 1K83J 1MSEC 3JR9A 4G12A 5IPAA 1B72A 2YS9A 3Q0VA 2N8GA 2X9DA 1MBGA 2B63J 4D7MA 4A3BJ 3JRCA 3MVPA 1MBKA 1IJWC 2CJJA 2GLOA 3S2HJ 4NDLA 1RETA 2I10A 5E3OA 3ZOBA 2L7MP 4FE4A 1LE8B 1BA5A 2DA3A 1T33A 3S1QJ 4B1RA 3NAUA 2VPRA 3HOVJ 2ECBA 1PUFA 2HXOA 3IH4A 1AKHA 2Y9YA 2WB1N 4C3IJ 1E3OC 2M34A 3GTLJ 3OSFA 3F0CA 2DA2A 3Q0UA 2CUEA 1FIPA 2M2EA 2MG4A 2JA6J 3OIOA 3B6CA 1TWGJ 2P81A 3RZOJ 2Y9ZA 2CUFA 2JA5J 5IYBJ 3LNQA 1G2HA 1IGNA 3BQYA 3CCYA 3CMYA 3BR1A 1A5JA 1NTCA 1LE8A 3L1PA 2Y30A 5IYCJ 1IDZA 1YRNB 4M3FA 4Y52J 1GDTA 1BW5A 3NARA 2JA7J 3LSJA 2X48A 2COBA 4FE7A 2R92J 2WV1A 1CQTA 3WHBA 2ELKA 4BKXA 3DEWA 1WH5A 3BR0A 3TEDA 1MSFC 1X58A 3HGYA 2Y2ZA 4XRSA 3ZQGA 5FKMA 1APLC 4UUTA 3CQZJ 2HXIA 5EDNA 5EEAA 3S17J 1HOMA 2FD5A 1RR7A 2HDDA 1OJLA 1S7EA 2LY9A 2NVYJ 5IOYA 2E2JJ 3H0GJ 1FIAA 1FJLA 1SANA 2R5YA 3JRIA 5IYDJ 1MBHA 1FTZA 5EG0A 5E3LA 4DYQA 2DA6A 2IEKA 1WCMJ 2GBYA 4A3GJ 2YUSA 5C3EJ 1MBEA 2QCOA 4MFDA 3HOWJ 3HKZN 4XRSG 5IP6A 2DMNA 4I76A 2DJNA 3IH3A 2XSDC 3H3VK 4AC0A 1FEXA 3BG3A 1VF9A 1W0UA 1POGA 4BY1J 4M3GA 4XK4A 2LTPA 1NK3P 3MKLA 1LFUP 5J1UA 4A3MJ 3HBLA 4DYRA 1OCTC 2MSYA 3G1OA 2DA7A 4HNVA 2TCTA 1HDDC 1ZKGA 3BTIA 4GFBA 3BTLA 3RQIA 3RKQA 2JN6A 5JLXA 3BQZA 2Y0SN 4LOCA 1QVUA 1K61A 2K9SA 1XG1A 2ECCA 2XGCA 1Y1VJ 3K2AA 1B8IB 5M5YJ 4IHWA 3S14J 3OSGA 3FISA 2DN0A 4CYCB 3I4NJ 2CU7A 5IP9J 1BL0A 4DW6A 5EZHA 2FQ4A 1H8AC 2XB0X 4W97A 3HM5A 1BW6A 3VPRA 2Y31A 4FCYA 5DTDA 4RDUA 3FIWA 2AO9A 5EGOA 1JJ8C 1HCRA 2K9NA 2ME6A 2K9QA 5IOZA 3WHCA 2LVSA 4A69C 1ZR4A 3GTGJ 2R5ZA 3QQAA 2D5VA 2R93J 2IAIA 2XGDA 1WI3A 4A3CJ 2NVQJ 1TC3C 2NOGA 1UHSA 2EBIA 1ZK8A 3TW6A 2EZIA 3PM1A 1B8IA 5K7HA 2EZKA 2MGQA 2ID6A 2VI6A 2VKEA 4A3EJ 4IHVA 3GTPJ 1H88C 2HOTA 2VUMJ 3S1MJ 1P7IA 3O8GA 3UKGA 1FTTA 2RAEA 9ANTA 2XPVA 4MO7A 5FLMJ 1I3QJ 2NS8A 5F08A 2M9HA 4C3JJ 5K7FA 1RESA 2HOAA 4A3DJ 4ABZA 1ZGWA 1OCPA 4B4CA 4A93J 3HB9A 4M3BA 3SJMA 1IG7A 3A01B 2O7OA 1I50J 1Y1WJ 4A3JJ 1JKRC 3S1NJ 1UMQA 1JUPA 4V2FA 3GTKJ 3HOZJ 3HEFA 4V2GA 4XRMA 1ENHA 2DMQA 5J1YA 5F27A 1UG2A 1RPWA 5J3LA 1TWAJ 2DMUA 2LK2A 4DYCA 4A3KJ 2ME0A 4I6ZA 3B6AA 1HF0A 4A3LJ 4M6VA 2EQRA 4AUXA 1ETOA 4DZPA 3S16J 1ETYA 2VKVA 1IRZA 5EF6A 4IHXA 3DCFA 3A02A 3BT9A 1YRNA 1MH3A 1X2MA 1U8BA 3BG9A 3SFIA 4XICA 4C2MJ 1BJZA 2HI3A 2QF7A 3K7AJ 3O8HA 4AYBN 5EYRA 2M8GX 2YU9J 2KDZA 1SFOJ 1HDPA 3LSRA 2JK3A 3I4MJ 5C4JJ 4XIDA 1JKQC 3JRHA 5HODA 5EZGA 2E2HJ 3W6VA 3HOYJ 2XB5A 2IBDA 4D5FA 2K40A 3LOCA 2LR8A 3PO3J 1ETWA 2DMPA 2L0KA 4MFEA 3ZQIA 1F43A 1JTXA 1TWCJ 2DTZA 2H1KA 3TW7A 1ZR2A 2AHQA 3M3YJ 3JRFA 2JMWA 5JLWA 3G1MA 1TWFJ 2HOSA 3BR5A 3GBGA 4M3EA 1D5YA 5DS9A 2LLKA 2L7FP 1A6IA 1MBFA 2DA1A 2XGEA 3HGGA 2DA5A 2W48A 1P7JA 4JP0A 4BBSJ 3HDDA 3MN2A 1ZTRA 2TRTA 1PUFB 2R0QC 2H8RA 2NVXJ 2JA8J 4M3DA 1OFCX 4QSHA 3IV5A 4FISA 4JYKA 3CDLA 4JX4A 2M0CA 1WH7A 2L7ZA 3JRAA 1MBJA 3SDGA 2JJ7A 4W1UA 4MIMA 3GTMJ 1ZQ3P 2O9LA 5GP9A 1JUMA 3S2DJ 5F0CA 1IC8A 3OOUA
chains in the Genus database with same CATH superfamily
1ETQA 1WJEA 4E7JA 3TP3A 5HNHA 1WGXA 4BEHB 1ONVA 2CO5A 2WC2A 2ZSHB 5FKNA 5GPCA 1XX5A 3JREA 3BZKA 3IWZA 4F3QA 1X2NA 4CYCA 3H3ZA 2RKHA 2P6SA 5JI6A 1YQAA 3ZQFA 2DA4A 1W36D 4GYIA 5FFZA 5J1RA 5K5RA 4BXXJ 5DCFA 1D3YA 3KP3A 2QA4I 3SHFA 3LSPA 2DK8A 3CMMA 2IP2A 5TGTA 1IN7A 1UG0A 2LBFA 3S1RJ 4LLNA 3GVAA 1QHHD 2L7KA 5IT9K 2JA2A 2QSGX 1X1AA 1ZG3A 1ZARA 3M8JA 4B3AA 1AHDP 2P0WA 3IH2A 3IHUA 2KT0A 1GV5A 2M30A 4DIQA 2ZMEA 4R1HA 2XAQA 2MW8A 3G71I 4G94A 2LKXA 1ORKA 2EZLA 4E6KG 5F1JA 4A3FJ 3CDHA 3BWGA 3JRBA 5EG0B 1ZREA 1I39A 2W57A 3IRQA 1U9NA 2O03A 1OKRA 1W5TA 4NC6A 3PIOF 2E5ZA 4RM3A 1X4OA 1QA6A 4QIWN 2NNNA 2XRLA 2IGOA 3SFZA 2VONA 4IKFA 4HZFA 3I55I 3FKIJ 2NVTJ 1O3QA 2O3FA 4XN0A 3GW2A 3ECOA 4N4OB 1WJBA 2CQXA 2LMDA 1TWHJ 1IN8A 1IRFA 2RNJA 3W3CA 3OYMA 5ERIA 3RZDJ 1UHMA 2O5RA 4GRIA 2IGKA 2DFFA 2E1OA 2H8WA 4ZYHA 1R7JA 4NUBA 3ASNH 1MDMB 3OR2C 3KE2A 2E1MC 2DAOA 2DQRA 2R7RA 3GTQJ 4Q5SF 1AOYA 3FXKA 5D4SA 1H9GA 5BNGA 3LAPA 3GZNB 2KQRA 1ODDA 1HLVA 2CQ7A 2W25A 3R0JA 4JX5A 1IDYA 5F0FA 2KRFA 4RAGA 3N4MA 5E1WA 4I2OA 1VQLI 4NHJA 3FMQA 3ZQLA 4LB6B 2A05A 4O5VA 5CVJA 1GUUA 2Z2SB 3CJTB 1TW3A 4AIDA 3GTJJ 3C2BA 1ETKA 1YS7A 2XPUA 2DOEA 2ZB9A 4FETA 4UUSA 1FP2A 4LB5A 2PBIA 2EV0A 1W7PD 2Z5UA 4BY7J 2CV0A 1D8JA 1R4MB 2X51A 1Z77A 2FMYA 2V9VA 4H4KC 3P9KA 1TP4A 5LGTA 4ZYEA 2YS9A 4A6EA 2XGXA 2Q1ZB 3L9FA 1MBGA 3F8CA 1SD5A 1WZ2A 3MVPA 1MBKA 2CJJA 3HKZA 5D5XB 1PP8F 3PJRA 5CQEA 2BHZA 2I10A 3ELKA 3I59B 3ZOBA 2A61A 1SC7A 1ZH5A 1T33A 4KIFA 4LG3A 1Y8QB 5F6FA 3CCRI 4B1RA 2UXXA 1FMVA 1SFEA 4YG2F 3HOVJ 2ECBA 2D1HA 1XTAA 3IWFA 1DUXC 1AKHA 2WB1N 2X6WA 4C3IJ 2CW8A 2KL4A 3GTLJ 3OSFA 3HC7A 2H6CA 4EJVA 4OIPF 1B6AA 2HQAA 2Z1DA 1XGSA 2HVSA 2M2EA 2MG4A 1WQ2A 4GYGA 3Q9SA 2IGNA 2CUFA 2JA5J 1YJWI 1G2HA 2OC6A 4CCLA 1IGNA 1GXQA 2VJ5A 4RGSA 4B44A 4LFUA 1NTCA 3L1PA 1YW7A 1MGTA 3WTXC 2A3SA 3SYTA 3ZMZA 4BEHA 1J75A 1TNSA 2NOJB 3VYRB 1YRNB 4M3FA 1MIJA 4ZDPA 4ZYDA 3Q5FA 1GDTA 1BW5A 3RSNA 1W5CC 1X3UA 4Z6YA 3JSPA 2R92J 2WV1A 3ASOH 3DEWA 2ZO4A 2HPMA 2R7UA 2W7NA 2UZKA 1OCCH 3AG1H 4I98B 3G6EI 1MSFC 1D0YA 3HGYA 1SEUA 1PDNC 1MJ9A 5FKMA 1APLC 3GFLA 3TDUC 1XGMA 1J9IA 4DBRA 2A69F 3CQZJ 5KHDA 4F7ZA 1D5VA 5EEAA 2CW7A 4KITB 5D6FA 1L0OC 2BEOA 1OQYA 4A2UA 2K02A 3CF5F 2KHMA 2GIVA 2LY9A 4XOTA 3CCJI 4IHSA 5CVIA 1AWCA 3FX3A 4IOAF 1S3JA 1TLHB 1MBHA 5HVQC 5BPDA 2GWRA 5EG0A 1WWXA 3GLXA 3ESWB 2LDUA 2P8TA 2CMPA 4NC7A 1MBEA 1LEAA 2ESNA 5H20A 2YX4A 3PFYA 4ON0A 3TOAA 2BOLA 1X1DA 1IXCA 5IP6A 4J00A 4I76A 3K4MA 5GAGJ 2MC3A 3K10A 5B1AH 4ITVA 2BXZA 4PGHA 1MNEA 2L4AA 5E1ZB 3K4KA 5J1UA 3E3VA 3HBLA 4A3MJ 3GWZA 3VFZA 1G3TA 3VWBA 4XLPF 4GFBA 1IAWA 3WTUC 3BTLA 4UB8C 4IXAA 3BQZA 4IQ4A 1QVUA 2J5PA 1QNTA 2ECCA 3R0AA 4II3A 1JGSA 4EJWA 1ZELA 3S32A 1UAAA 3E6DA 3NQOA 4AYBA 1B8IB 1I5ZA 4RS8A 4KA4A 3OSGA 1VQ4I 3FISA 3M1EA 1MNDA 2FBHA 3J7AY 2GIZA 3I4NJ 1LVKA 1YITI 5IP9J 3F8NA 1J7KA 1BL0A 4DW6A 5DUIA 3SXYA 1OMIA 5LLQA 3V42A 3WTYC 3K4NA 3DPLC 1GHCA 4RA2A 2M7AA 1BW6A 4YRVA 3HL2A 2F5EA 2X1DA 4HLYA 2AO9A 1YJ9I 3TO6A 1YFHA 3OYEA 1XSDA 1R1VA 3V7CA 2JSCA 1OISA 2HKXA 2H94A 3OYCA 1IRXA 3QQAA 3CC4I 4A3CJ 2IJLA 3W6JB 2GOMA 3MAJA 2MA3A 5HDNA 2RQPA 1T0FA 5D5VB 1VZ0A 4NC8A 3R60A 4LLGF 2DT7B 2EZKA 2MGQA 5L3EA 2LC2A 1QU3A 3I59A 3PL8A 3JAMK 1YS6A 4HPQA 4EV0A 3NWTA 4HDVA 3GXOA 4EVIA 1I3QJ 5F08A 4E7HA 3BJOA 2Y69H 4A3DJ 4JQFA 1YX5A 4QPOA 3V4GA 1IG7A 1MJAA 2ZBKA 2K7LA 3DP7A 3FM5A 4IJAA 3B02A 5LHGA 1LNWA 1UMQA 2RDPA 3GTKJ 1I3AA 4UNOA 4XLHA 1OCOH 2IS4A 1R4NB 1RI7A 2OBPA 4OMYA 3KP2A 3W2AA 3FXQA 3BG7A 1BC8C 1RPWA 2ZSIB 1UCRA 1OYIA 3D0SA 4XSZF 4H0EA 1ACIA 2L2OA 2LK2A 3I0TA 1MKMA 3MZ8A 2PX9A 2OCEA 1W36C 2QBYB 4I6ZA 2R7OA 1HF0A 4A3LJ 1JHHA 5IT9Z 3LSHA 4PJLA 1ETYA 3G3ZA 2FSWA 2VKVA 4ZTJA 3HTSB 2V6EA 2VN2A 2AXTC 4IZZA 3F9KA 1YRNA 4UVAA 2FU4A 1KGSA 4A5MA 3SFIA 2IS1A 1BJAA 3WU0A 3L2CA 3EYYA 1BJZA 4N0BA 4BGDA 1STZA 5EYRA 4LMYA 1Z6TA 2KDZA 3GO5A 4CHUA 2Q2EB 3NRVA 2WTEA 3LSRA 1DGWY 5L3DA 1KYWA 3I4MJ 1G59A 3K9TA 4XIDA 4UVCA 2E2HJ 2EIJH 3FHNA 3VSKA 3HOYJ 5FROA 2LR8A 4GDFA 2AQEA 3KYCB 2DMPA 3RPQA 3CDIA 5LEJA 3TO7A 1JTXA 1KA8A 2DTZA 4BH9A 2B7EA 2MH9A 1ZR2A 2AHQA 4KYWA 3M3YJ 2PQ8A 5IY5H 2L02A 1VQMI 3QPTA 1TWFJ 4UXNA 3BR5A 2HOSA 4CCOA 3K70C 3PUBA 1U5TC 3IUOA 3M7GA 2CUZA 1X3ZB 4HF2A 2EILH 2JRMA 2DA5A 2W48A 4RGUA 4BBSJ 2CS3A 2XAGA 2YU3A 1PUFB 5LD2C 2EFPA 2F5FA 4IVNA 2NVXJ 1TTYA 1OFCX 2E1NA 3QP6A 2LRDA 4BDZA 1XMXA 3PSIA 2KLOA 3L2QA 2HVRA 2M0CA 1ZLKA 5LFAA 3JRAA 4D1QA 4E4HA 1HSTA 3T5XA 3I64A 4W1UA 1YO5C 4EM0B 1BOBA 4RGRA 4XN3A 5FD5A 4OWRB 2MBFA 1ZQ3P 4KN7X 3S2DJ 4C2TA 4M6YA 3M1CA 4PZJA 1IC8A 3OOUA 1EV7A 3AFHA 2M7BA 4DQ2A 2ZMEB 2ID3A 1JKPC 1CF7B 1LVAA 3DXJF 2ZC2A 2BGCA 3NWSA 1O4XA 2HZTA 4P55A 1ZGJA 4B09A 2LP0A 3QPLA 1IUFA 1YTYA 4CXFA 1B9NA 3HPHA 2E19A 4QPQA 1FY7A 3BR3A 3H5NA 1DU6A 5C44J 2W84A 3REOA 3CF2A 2KP6A 3HOXJ 1WJDA 3QU6A 2V4JC 3IAS2 2GA2A 1XPXA 3HOUJ 5E1XA 3DBLB 4AU7A 5F0HA 1N78A 2FOWA 5DD4A 4CUGA 4BQAA 4OMZA 1T6SA 3K4BA 2XPWA 2EFOA 1KQ0A 4BHCA 3BP8A 3F72A 5DM6F 3VDXA 3ZCOA 2EZHA 5B66C 3EETA 3CJNA 3HZJA 1YYVA 1D1CA 1JT0A 3H0DA 5HS7A 2WAQN 1EJ9A 3SZPA 4IEJA 3ZQCA 2KMUA 3FK7A 3J81K 2R5YB 2OTJI 1BI2A 3IRRA 2QSHX 1JKOC 4A6DA 1R6RA 2FA5A 3GUDA 2YX7A 2X4HA 2ZXIA 1DQUA 2WB1A 1X19A 2BY3A 1R58A 1MNMC 2L9NA 5IP7J 1Y8RB 3AG4H 1E17A 3LQQA 1H89C 1GV2A 3KP7A 2QM3A 1TT0A 2W1OA 3HOSA 2F2EA 3L00A 2G0EA 1HXDA 3LSGA 2R7TA 5E8GA 2NNYA 1I6HJ 3VSLA 1Z91A 5CPRB 1I27A 4C3HJ 2R7VA 2GM4A 4X6AJ 3FDYA 3VYTB 2VJIA 4RLFA 2XRNA 4JX6A 3I71A 3GCMA 4K2EA 2CH0A 4UUSB 1F1ZA 1K4SA 3OYLA 4ETSA 1SVLA 3L2UA 1AU7A 2OTLI 3ZMDA 4QTRA 2G7UA 2GXGA 3BTCA 3C2GA 1V5GA 4WF2A 4BACA 1JT6A 1X1PA 1LFBA 3HHGA 2QBYA 1WKMA 3F8MA 1PUEE 4BJ6C 1F4KA 2V1NA 1U0JA 2G9WA 5D6EA 4F93B 1P6RA 3QAHA 3GTOJ 1MH4A 2QENA 3P9CA 1W0TA 2A07F 4WX9A 2WAEA 2CRGA 1QRYA 3D1NI 4LG0A 1BI3A 1UB9A 2QKLB 2CFXA 3KEOA 3TBIA 3RPUA 4HRIA 1QVTA 3HG9A 4D5CA 4J19A 3PNVA 5EGOB 2IVMA 5L3CA 3CCSI 1D1BA 3F22A 3FBIB 5GTIC 2FJ1A 1XC5A 2CQKA 2Q2EA 2FX0A 3QPSA 5J8CA 2DMTA 2OV7A 5J40A 1K7AA 4KT5C 2BY1A 1ULYA 4XKBA 2RNGA 1R1TA 4TV7A 3JW4A 1OLTA 3BG5A 1MSEC 2LY2A 3I54A 3OIPA 1B72A 1SAXA 2HWVA 3MKZA 3I56I 2KPMA 2X9DA 4D7MA 4PDKA 3RTRA 4HLXA 1BM9A 2CFOA 2KFDA 3IC7A 4N9HA 4GO1A 4Y4RA 2GLOA 4NDLA 1RETA 3H5RA 3V8KA 5ILSA 3CZ6A 3OWTA 1E0EA 2V9PA 5LRRA 5J47A 4F91B 1FSEA 3F21A 2OQRA 1ZN2A 3BCBA 3FMSA 3NAUA 4N4NB 4KDPA 1HA8A 3CLQA 4XLCA 2VPRA 3QU3A 1TNTA 5CKTA 4ZZDA 2D45A 1PUFA 2E7WA 4XLFA 3IP4B 2Y9YA 1ZG5A 4IX7A 2M34A 2IA1A 1JI8A 5KK1A 2DYRH 3F0CA 3DF8A 4ENMA 4MTDA 2VLAA 4CCKA 2UV1A 2H27A 3Q0UA 1UJ8A 4P5OA 4L9TA 4XL9A 4UHTA 2JA6J 4A0ZA 4HSRA 3OIOA 5HOOA 1OYYA 3K69A 1KZHA 3OYHA 1TWGJ 4A5NA 2EV6A 2P81A 3KEQA 2FMLA 4R79A 3RZOJ 3LNQA 2ZCWA 1D8KA 3L2WA 3CUQB 2OJED 4Q4ZF 2F48A 3CCMI 3L09A 2X6XA 2MLKA 3ML6A 3CMYA 3BR1A 2DOAA 1R22A 4KT6A 2XIGA 3CCLI 4G7HF 1LE8A 4Y33A 4IF4A 2DBBA 5IYCJ 2O61A 1CF7A 2XAHA 4Y52J 2EPFA 3CJQB 4Z2YA 5HLHA 4M9ZA 2X48A 2XHKA 4CCNA 1CQTA 3CESA 1BN5A 2YSRA 2CGPA 3OS2A 3OYJA 2E34A 2VE8A 5EJCA 3BR0A 4LJZF 3OYAA 3JAMZ 4U88A 3EUHA 5JVGF 4HDUA 3OYIA 3K70D 5EEGA 5EDNA 3CMAI 3S17J 3GLLA 2IRFG 4E7SA 1P4WA 1HOMA 2FD5A 3DU6A 1J5YA 2IT0A 2PI0A 3CMEI 4XLAA 1S7EA 2LSOA 3AL0B 1GLNA 2E2JJ 3F23A 1HKTA 1FJLA 2VXDA 2MC4A 2OUMA 2R5YA 2ZFWA 1JXSA 3S93A 1BR4A 5E3LA 4DYQA 2DA6A 2IEKA 5ICEA 1WCMJ 2GBYA 5E17F 2A6TA 2B0LA 2VJ4A 1YX3A 2EJRA 2A5WA 2YUSA 5FLXZ 1O7FA 3OR1C 1EH7A 1SFXA 3R4KA 4XLNF 3T0YA 4XRSG 3U9GA 2DMNA 1XD7A 3V7RA 2XSDC 1FEXA 1VQ8I 1R36A 4EQQA 2FUG2 1POGA 2QVOA 4BY1J 1SMTA 1M1EB 2LTPA 2L01A 1NK3P 5J4VA 2XROA 3DU5A 4HNVA 2DA7A 4A12A 1PP7U 4AM3A 4GXOA 1PYVA 1ZKGA 4A0YA 2O8XA 5ED4A 1YI2I 2BXYA 2GXAA 2HZDA 1AKHB 2K4BA 2XKOA 3RQIA 2P6TA 2DTRA 2Y0SN 1HQCA 2XF7A 1Y1VJ 2EIMH 1FBUA 2STWA 3QODA 5M5YJ 3S14J 3V7SA 1QZEA 1U5TB 1FYMA 1DDNA 3HPGA 4ZDOA 5LRSA 3AG2H 1H8AC 1SAUA 3HM5A 4W97A 3WE2A 2JTVA 4M72A 3VYSB 3LQRA 3DTEA 2Y31A 5BQTA 2HTSA 4FCYA 1I1GA 5EGOA 1R71A 2L9SA 4MNUA 1IF1A 3CCQI 3L2RA 2K9QA 5IOZA 2AXLA 3WHCA 5KVRA 2BW3B 5D5UB 5B3SH 2GZWA 2VQHA 2FOKA 3LFUA 3GTGJ 3GF2A 2D5VA 1O3TA 1E3HA 3G4SI 3SZTA 1IO2A 3WGIA 1BBYA 1WI3A 3MKYB 4YIFA 1TC3C 4MTEA 1UHSA 2EBIA 2QYOA 1B1BA 4MEYF 1ZK8A 5TJJA 3TW6A 3PM1A 4HX4A 4HV6A 1T8IA 1P9QC 3FBNB 2R7SA 4RLQA 5K7HA 5TISC 1KYZA 5D8LB 3WG7H 2ID6A 1Y0NA 2VI6A 4A3EJ 2ELJA 4IHVA 1H88C 3S1MJ 3FKJA 4I0BA 1P7IA 5DCMA 4G6QA 1IN5A 4YFNF 5E18F 4E7KA 9ANTA 1FTTA 1W7PB 3OOPA 4BQOA 4L0ZB 3KFWX 5E79C 1F9NA 1SMYF 4HF1A 3S2WA 2DW4A 2RV8A 5K7FA 1RESA 4ANJA 2NRAC 4ABZA 2OZUA 4B4CA 4A93J 4M3BA 3SJMA 3F6OA 4M6XA 2O7OA 3S3MA 4A3JJ 1JKRC 3S1NJ 1U2WA 2WBMA 5HS8A 1MD0A 3OYBA 1ENHA 1NHAA 2HS5A 4I09A 2DMQA 1BI1A 3E5QA 5J1YA 3KYLA 2VOOA 4OINF 4ENKA 2PEXA 1G3SA 1TWAJ 4EM1A 2VB6A 3ZMVA 3MZYA 4DYCA 3GEZA 4A3KJ 5H6RA 2DYSH 2ME0A 4S05A 3CUQA 3I3LA 1OR7A 2EQRA 4AUXA 1QBJA 3C1DA 4EJOA 1YW8A 2XVCA 3CUOA 4JOMA 4XSXF 1IRZA 1S9HA 5HS9A 4ENNA 1Y56A 3BT9A 2A6HF 3HOTA 3H9GA 3DKWA 3BG9A 4C2MJ 1S29A 2QQ8A 2QQ9A 4OAYA 3J81Z 4Y3OA 1WJAA 1EH8A 2UUZA 4LD5A 5AIPA 4ZC3A 3I58A 2M8GX 2PN6A 2YU9J 2EINH 3WU2C 1Z7LA 3E6CC 3TMOA 2WAQA 3ZMTA 5ICGA 1HDPA 2R4GA 4ZTFA 4CCJA 5C4JJ 1KU3A 5HODA 2DXIA 3E6MA 2M3AA 2XB5A 2KJCA 4BE1A 2IBDA 4D5FA 2K40A 3BZ6A 1KQ9A 2HPIA 2HTJA 2P5KA 1VQ6I 1ETWA 4MFEA 3JSOA 1YHQI 3UNGC 1MMNA 3PNTA 4DJAA 4LGWA 4MQ9F 1S8NA 1VQ5I 3JRFA 3U2RA 5JLWA 3G1MA 4P96A 4M3EA 1IUYA 2Q0OA 1REPC 5LGUA 3QOEA 2Y75A 1UFMA 1A6IA 2DA1A 3PQJA 2XGEA 2R7WA 2VKHA 3P5JA 3H1CA 1V5EA 1O3RA 3ABTA 3HDDA 2QLZA 1WJFA 2OAZA 5JFRA 1ZTRA 1ZRDA 2ZXWH 3BJAA 2GA1A 4M3DA 1H9TA 5DYMA 1U6GA 2ISZA 3CDLA 2ADUA 2CQNA 4G6DA 2MH2A 4PFOA 1IXRC 1BOAA 1WH7A 2L7ZA 3LMMA 1MBJA 5CQGA 1TQIA 2QZ8A 2CV2A 1QO0D 2P7CB 2E36A 4E7LA 2KRHA 3LL7A 3GTMJ 3J80K 1RNLA 3DKYA 2O9LA 1JUMA 4RAZA 5F0CA 4AIJA 5FB2A 1O57A 1V54H 3AG3H 3JTGA 3QRFF 3DFGA 3WTVC 1ETVA 4FX0A 2WADA 2K3PA 1Z67A 5M3FJ 1U5TA 2Y0MA 4ZYAA 4OOIA 3ZR8X 3P7NA 4CCMA 1QZYA 2C6YA 5AIQA 4XBFA 1T56A 4BBRJ 3DEUA 1FMWA 2L54A 1NK2P 1SFUA 1XGOA 2KZGA 2X6OA 2XDVA 2CQQA 4DZJA 3E6BA 4F55A 2K3FA 2O0YA 1QPIA 2JRTA 2I8DA 3RPUD 5F64A 1VQOI 1G8XA 4OAZA 1J0RA 2BW3A 3KZIC 3JTHA 1IV6A 2BBYA 4M71A 4HA8A 1GVDA 3D5SC 1IZ1A 4BUPA 4Y7NJ 4RAYA 3KCCA 3HSRA 3M4OJ 2OF7A 1ON1A 1Z0XA 5DDGA 1U9OA 5A2QK 1GT0C 1S7OA 5FLXK 3O3KA 3QP5A 3RKXA 4CDGA 3Q0WA 3CCUI 3A2KA 3FXLA 3MFKA 3CC7I 2VC0A 1VNDA 1R9TJ 1Y6IA 3UR3C 1VFCA 4RB1A 1VQKI 1YOVB 2JWTA 2OCCH 2ZNZA 2EIKH 3E7LA 1W7PA 3BTJA 2ACJA 3EUKL 3JCUC 5LGNA 3WG9A 3O2PE 1KONA 2J5OA 5K5QA 5GPAA 4LG0B 2Z33A 2AQFA 1T38A 1QQIA 1X1BA 3ERMA 4FT8A 2V1DA 4CICA 5C4XJ 1R49A 2L9VA 4GCVA 4BDYA 1D1AA 3HRMA 4EGZA 2BHYA 1SD4A 2PJRB 2OPTA 3K2ZA 4ZZLA 3HHHA 3T8RA 3LA3A 1A04A 3DKXA 2L9RA 3C18A 2F4MB 5B5EC 5M5XJ 2DODA 4BHBA 1CGPA 4A0XA 1VQ9I 4IHYA 3DV8A 2PMHA 1B72B 1WHUA 3PIPF 3WODF 2E5NA 2E7XA 3BR6A 3HRUA 2E1MB 3M8FA 4XM3A 4MLOA 4HNTA 4FX4A 5GADJ 2HYJA 4AVZA 2DI3A 2KRCA 2LFBA 2HQ5A 3IKVA 5FKLA 4G7ZF 3S3OA 3M9AA 4XLEA 4L18B 4KMFA 5DUKA 5FKKA 2L5QA 1FSHA 2BVLA 1RKWA 1DU0A 2A68F 2BVMA 2M8EA 2F4OB 2PFBA 4BHPA 1FPQA 2M1BA 5GAEJ 3N05A 3E5XA 4D7NA 1VQNI 5AONA 2VQCA 4O6JA 4EEFG 5F04A 2R5ZB 2JT1A 2PMZN 2V7FA 1JTYA 3ZXSA 4RBOA 2RGVA 3FXJA 4UY8I 2V79A 3L7WA 5IPAA 2X1CA 1NH3A 5J6XA 5L3GA 2P4WA 2KIFA 3Q0VA 2N8GA 3KP4A 1ZYRF 2EK5A 4BL0B 1A31A 1LJ9A 2IA0A 2WY8Q 4KNYA 1K79A 3B73A 4E7IA 3SEQA 4O3MA 3G2BA 1O3SA 2FQ3A 3CO6C 5KAFC 2HYGD 2L7MP 4G7OF 1IW7F 1LE8B 3OS0A 2DA3A 1BA5A 3TDZC 2EFQA 3PSFA 4RMNA 2XUBA 2ZXHA 1MMAA 1IRGA 2KIQA 2JUGA 4IO9F 2RVCA 4WXDA 4E70A 4PJMA 4KUMA 4N9IA 4RB3C 3H3UA 2HXOA 3IH4A 2EFNA 3OS1A 1E3OC 4KICA 3KETA 2NXNB 2QWWA 4UB6C 1S7AA 4BU2A 2HVQA 2DA2A 2QGUA 3DEEA 1S72I 1RUOA 2CUEA 5HDGA 1W5SA 1Q1HA 2DO7A 2KZVA 3SQNA 4YIRX 1BIAA 5BOXA 2ZNYA 1USSA 5IYBJ 5D8KB 4XORA 2HOEA 4LK1F 3HUGB 4HF0A 3TGNA 4P9UA 4UV9A 3ABLH 1Y0UA 2P5VA 2O6GE 5LEKA 3ABMH 1WSUA 2Y30A 1B59A 3DLAA 3QOPA 1ZLJA 2RREA 1E3PA 3GZ5A 3WGHA 2JA7J 2MFZA 3EDPA 4XKVA 3LSIA 4Y13A 3ZP5A 4XONA 1H0MA 4BKXA 2F6CA 3GFIA 3TQNA 4YFXF 4XR6A 4CZCA 4ENJA 1Y39A 3ROUA 1WH5A 4HG2A 2PMUA 3TEDA 5IT3A 2Y2ZA 3RQ4A 3V8LA 3HSEA 5BPIA 2M45A 2HXIA 2MLGA 4IRGA 4MGRA 4CZZA 2LF7A 3RJPA 4PSXA 1KU7A 1OJLA 5EEHA 5CJ9A 5FRNA 3I9V2 1BR1A 5K1YA 2NVYJ 2CW0F 3H0GJ 2LKSA 1VTNC 1SANA 3HYIA 3JRIA 5IYDJ 1DPRA 2KISA 2FXAA 3ABKH 2LYCA 4A3GJ 3P9IA 1RUNA 1B4AA 1X3WB 4XRFA 2Y48A 4RGXA 2BE5F 3ZMSA 5BS6A 2IS2A 4KIBA 2QCOA 4MFDA 4BQNA 3HOWJ 1HW5A 4FHTA 3K4CA 2DJNA 3BG3A 4PUSA 3ZGKA 1W0UA 1MJBA 3DTIA 1S6LA 2RC4A 1FOKA 3V8JA 1W1WE 2VKDA 3MD2A 3FWEA 2GQQA 3T8TA 1QPMA 3MKLA 1LFUP 4AWXB 4DYRA 1OCTC 2MSYA 3G1OA 4PCQA 3K4LA 2PJRA 2XAJA 1HDDC 2V6CA 3BTIA 2H09A 1RC9A 5CVRA 4V19K 5CLSA 3SDBA 1USTA 5HDKA 4DOZA 4HQMA 3KZYA 1OPCA 4ZYGA 4LITA 5JLXA 2JVGA 4HW0A 1I1SA 2JSPA 3GFMA 1XG1A 2K86A 1XN7A 3A1YA 1LKXA 3K2AA 1A36A 2F5DA 2JVHA 4IHWA 2V9KA 1VQ7I 3J7AO 3DQVC 3F6VA 2KKOA 5ICCA 3KEYA 2CU7A 1ZGAA 1O7LA 1QHGA 1BIBA 2FQ4A 2DFIA 5DCMB 2DJIA 4ESFA 3OL4A 4L5IA 3K6GA 5D5WB 3LSMA 3FIWA 4HV5A 2ME6A 4OIRF 3LA2A 1KU2A 2VBYA 4P9FA 4NNJA 3FMRA 4Q48A 2JPCA 4A69C 5LHIA 1WVRA 2ICWG 1ZR4A 2R5ZA 6PAXA 1N77A 4EMSA 2FBKA 3CCEI 4BXFA 2IAIA 2W24A 2XGDA 2XAUA 3SZGA 1MW7A 2NVQJ 4YEJA 2KIUA 4D9JA 2L4MA 2E1CA 4ESBA 4XKWA 2D1VA 2VUMJ 2X85A 1X4PA 2I5UA 3O8GA 3UKGA 2WAFA 2XPVA 3J80Z 2BV6A 4MO7A 2IS6A 2VBWA 2M9HA 2CUJA 4C3JJ 2COMA 2IGMA 2UWMA 3EUAA 2JPBA 3GFJA 1ZGWA 3BPXA 3BY6A 3OMYA 3WTWC 3A01B 1VQPI 1Y1WJ 1R5HA 1QZZA 3FXMA 4WXHA 5J4YA 2ZJRF 1JUPA 4MHGA 4AVPA 3HOZJ 3DPTA 1V3FA 2VT3A 4P1WA 3WTTC 3FHZA 3AKZA 3VOEA 5F27A 4UUVA 1UG2A 5FD6A 2WV0A 3BPVA 3KZZA 1IXSB 1J09A 1R5GA 3KP5A 3ABUA 1KU9A 3K1NA 1T95A 3HUGA 4HOBA 2CG4A 1ETOA 3OYKA 4DZPA 1U3EM 3WTSC 5EF6A 4IHXA 3E97A 4DNCA 3DCFA 1P2FA 1MH3A 1RZ4A 2YR2A 1UZCA 3QWLA 2OZ6A 4YIIA 3VYUB 2RN7A 5A2QZ 2A5YB 1T98A 2QF7A 2HR3A 1D0XA 3BOQA 3K7AJ 2FNPA 3FXUA 1HSJA 1SFOJ 3W6KB 4ZDLA 4U0VA 5JR3A 5K5OA 1XMAA 3CC2I 3D5RC 3FF5A 4JBAA 2ETHA 1IN6A 1ZHFA 4II2A 3QYBA 4KN4X 5EZGA 2GXBA 1FOWA 1C0WA 5HLGA 1TW2A 4UV8A 2VIXA 1KQ8A 3ZQ7A 3PO3J 4C30A 3RIRA 2NYXA 1R00A 3ZQIA 1TWCJ 2OU2A 4GGGA 2VQGA 2ZJPF 2H1KA 4LIUA 3DBRB 3O6BB 2JMWA 5HLTA 3PNYA 3GBGA 3MKWB 1YE9A 5DS9A 3J7ZI 4L0YB 2BZTA 3D5LA 4FASD 2YPRA 1DGRM 4AD9A 2MYSA 2DQLA 1Z7UA 4JP0A 1P7JA 2VJJA 3LWFA 3GYHX 4M74A 4F92B 2R0QC 1XSVA 5ICFA 1FC3A 2JUCA 3OL3A 5HNFA 2LH9A 4XQFA 4HX7A 1Z3XA 4QSHA 3FXOA 4JYKA 2HNHA 3R6SA 4OU0A 1XDUA 5L3BA 1BC7C 4JX4A 3ERED 2VQLA 2DFEA 3SDGA 1FYKA 2STTA 1EA3A 3QYEA 2FNAA 2CV1A 5GAHJ 1HW1A 1XB4A 1DP7P 2VE9A 1TT5B 2F5CA 1J2XA 1I6XA 1LDDA 3I4PA 5D4RA 2ZMEC 1F5TA 4I99C 3HRSA 1G6NA 3OIQA 3WGGA 3BZCA 3TP0A 4DBQA 4QLCU 1HBXG 3PQKA 3A4CA 3HIFA 3VB2A 3ZN0A 3ZRGA 1T08B 1FLIA 2VXZA 1ZRCA 2NS0A 4FTHA 2E2IJ 2VASA 2O8KA 4R8HA 2RQQA 3J7YJ 4RB2C 3GZ6A 2R7ZJ 4Y15A 2PMZA 3TL4X 1AA7A 5M3MJ 4C2UA 2R7QA 3EUHC 1JUSA 3ISPA 4CO8A 4U87A 1VI0A 5DEQA 2CWEA 5FFXA 1K4TA 2GOXB 5E3NA 1XDSA 3RKYA 3PO2J 3A03A 2IW5A 4HNUA 1WPKA 2DDAA 3S15J 5FKOA 3JRGA 3KLOA 2HKOA 2R7DA 1U78A 2VL8A 1XCVA 2DFHA 3RKWA 2M87A 3CTAA 3JRDA 2JQ7A 3QYFA 4M73A 3ZQHA 1G4DA 2OQGA 4PK4A 1E2XA 3CD6I 2ESHA 4JK1X 4Y17A 3DWLE 3L2VA 1FBSA 4B48A 4M9SA 2IPQX 2OD5A 2ZJ2A 5E3MA 1P4AA 2A6EF 1V5FA 1XSXA 3LSKA 1EF4A 3N97A 4U0WA 1HC8A 1NG6A 3FK6A 1F36A 4ZJZA 5TRDA 2V1UA 4WWCA 1BR2A 2NVUB 1YIOA 3A01A 1LDJA 2XASA 2EH3A 1FYLA 5K7ZA 4BJ5C 4EATA 2D2WA 2BY0A 4KFCA 1JJ6C 1FNNA 3CP8A 1FWZA 1DP3A 2XV4S 1XS9A 2LD5A 3M07A 3W2WA 4NQWB 5M5WJ 4B43A 4X1EA 1PJRA 4BE0A 4L5EA 1YIJI 3MEXA 3NEUA 3BR2A 3VODA 3LSTA 3FM3A 2BY2A 1YLFA 2XC7A 3WTZA 4BNCA 3K0LA 2ZFUA 1MZBA 1Z6RA 4PSWA 4S0HB 2W82A 2K9LA 2VC1A 3ZMUA 1Q1VA 1ITYA 3RYPA 3I53A 1V4RA 1MMGA 2HQRA 3ECHA 3S8PA 1ZG1A 2NAZA 1K6OA 4IL6C 3CCVI 2GAUA 4C9YA 1ETXA 5DV5A 5FLVA 5JVTA 3OYGA 2ZJQF 2FBIA 1JGGA 2JZYA 4G9YA 1RKTA 3G1LA 1XMKA 3GMEA 3DPUA 2LF8A 4A3IJ 3ZPLA 2NS7A 5FJ8J 2K85A 3CP2A 4KISA 2EB7A 4IRHA 1UHWA 2HU9A 1A6QA 1TL8A 3I5UA 3KLNA 3IKTA 3Q3SA 2XSJC 2FF4A 2W85A 3MQ0A 1K83J 1MDMA 5DM7F 3GX4X 3JR9A 4L5JA 3MCZA 4G12A 1J59A 2WY7Q 4PJ0C 1N75A 3TOBA 4XNFA 3LAJA 2V1XA 1K78B 4BQQA 1IV8A 1LPQA 2B63J 4A3BJ 4B8XA 3C7JA 4YELA 3JRCA 1IJWC 2XKPA 3A0HC 2R7XA 1FX7A 3S2HJ 1Z21A 4PJJA 4F52A 5E3OA 3WU1B 1P4XA 4FE4A 5E20A 3DLLF 4PGGA 3MZHA 1SD6A 2DK5A 2B9SA 1JHFA 4U7DA 4L9VA 4J01A 3S1QJ 4DGWB 4EGYA 1B9MA 1HW2A 5FRMA 1GVJA 4BE2A 1Z1DA 2K5CA 5E8IA 3U1DA 4HX8A 3H92A 1IN4A 2EA4A 2HQNA 1R5ID 3OYFA 1FIPA 3B6CA 3CUQC 1LUJB 1ZAOA 2DCEA 5FGMA 4CA0A 1OR7C 2Y9ZA 3ZN1A 2DT6A 3OYDA 4B47A 2EWNA 3CO7C 2P7VB 1EH6A 1Z05A 3BQYA 4I02A 4UVBA 2LG4A 3CCYA 1FZPB 4NB5A 4OIQF 1A5JA 2DOFA 3PFIA 1UELB 1IDZA 2F5VA 4L9NA 3BROA 3H9QA 3NARA 2ZKZA 2H6BA 3LSJA 3OY9A 4I01A 2Q8KA 3RI4A 2COBA 4FE7A 5J8FA 4KIGA 3BLYA 3WHBA 2ELKA 3COAC 1NG7A 2DT5A 1S5LC 3IAM2 3KYDB 5L3FA 2DPUA 3CJRB 2EFWA 3HTUA 1TZLA 1X58A 4XRSA 3IL2A 3HSFA 3ZQGA 4IPAA 1R1UA 1FT9A 3OV8A 4XMYA 4UUTA 2FEZA 3E5UA 2KJBA 3KPHA 2E35A 5CYVA 2TDXA 1RR8C 2DPDA 3HXLA 3AL0C 4QWQA 2F4IA 2LOOA 1RR7A 3K4JA 2HDDA 2PLYA 4L9JA 4AIKA 2P5LC 1EKEA 4WK8F 3T1BA 5IOYA 2V26A 2IA2A 1YJNI 4OIOF 1FIAA 4RAFA 2PJPA 1V55H 2H1LA 5FO5A 4CYDA 2K4JA 1G3WA 1D0ZA 1FTZA 1YG2A 4RM2A 2UXNA 2DU9A 1Z9CA 5C3EJ 5ILVA 3BG6A 1GXPA 1OYWA 1HKSA 3HKZN 2K27A 1K6YA 4HQEA 1OCZH 3IH3A 3H3VK 4AC0A 1VF9A 2QQAA 4U0YA 2AS5F 4M3GA 1R23A 5JHUA 2W4SA 4XK4A 2G7HA 4IOCF 2L3DA 3BDDA 2M4GA 4I7HA 2LKPA 4MQVA 2TCTA 4CSWA 2HYFA 4U7BA 4Q47A 3LA7A 2QUFA 4IRIA 1SFKA 1HKQA 4YFKF 2X0LA 5KAIC 4NQWA 3RKQA 1T0FC 4EM2A 2JN6A 5KNLA 3EYIA 1ERDA 4LOCA 3Q9VA 1K61A 1T2KA 2K9SA 2XGCA 3SEZA 4ESJA 3CLOA 2VBZA 2QKMB 3RYRA 3A0BC 2DN0A 4HYEA 4CYCB 2ISYA 4IHTA 3BCAA 4MEXF 2VODA 2M0MA 5EZHA 5ILUA 2XB0X 2K9MA 2W00A 3F8FA 4G8XA 2KDOA 3E0JB 4XOPA 3VPRA 5DTDA 4RDUA 1FOYA 3KX2A 4B3XA 1JJ8C 1HCRA 2VT2A 4G6TB 2R3SA 2LBFB 2K9NA 3KP6A 3KIOA 4HSTA 2LVSA 3RCOA 3BJ6A 2CYYA 2M4KA 3FZVA 2HFHA 5B1BH 1TQPA 3RDIA 2Y0SA 4FQGA 2KIMA 2R93J 5F1RA 4BAYA 4KJZA 2Z99A 2NOGA 4BS9A 1K78A 2EZIA 3EPZA 3X2QH 1B8IA 1RRJA 2Z3YA 1SVMA 4XKCA 2ELHA 3F3XA 4BJTA 3EQLF 2X1EA 1WFXA 3WE3A 2VKEA 3GTPJ 1XCBA 5H6QA 4D0PA 1LFPA 3C2HA 2HOTA 1X1CA 2Z16A 3H36A 5CVVA 2RAEA 5CVUA 3U1KA 3S3NA 5FLMJ 2NS8A 4EJUA 3AAFA 3QPHA 5DD8A 2HOAA 4NBQA 1OCPA 4E7ZA 2CSOA 3HB9A 5H2FC 1L3LA 2E71A 2M5WA 1I50J 1WRJA 4V2FA 4KMUX 3HEFA 1MMDA 2QSFX 2XF5A 4V2GA 4XRMA 2R7FA 1LB2A 5HLIA 1OCRH 5J3LA 2DMUA 3HRTA 1FBQA 2Z9OA 2X6YA 3H35A 1ON2A 1TQMA 1U8RA 2MABA 3B6AA 2XF6A 1WI9A 3H5AA 4M6VA 3DTKA 3K1PA 3OYNA 2HEOA 2EA2A 3S16J 2E60A 2XAFA 4BYYA 4RB0A 1N25A 2LY1A 4HBLA 3A02A 1DPUA 4LIVA 3TO9A 1X2MA 1U8BA 4IQJA 3MMYB 5JHFA 3LFKA 4XICA 1RIOH 4PFPA 1ZRFA 2HI3A 3C3WA 3O8HA 3F8BA 4AYBN 3TKYA 1A35A 4M9XA 3W2VA 2VBXA 2WA0A 3M8EA 3K1MA 4HEA2 1WJCA 1LQ1A 1LEBA 2JK3A 2MD5A 4CGZA 1MMSA 2FRHA 1JKQC 3JRHA 4BXUA 1JE8A 3ZQQA 3W6VA 3FXRA 3U21A 5KCMA 3VEPA 1PVEA 3LOCA 5BMZA 1G3YA 2PG4A 2QQBA 2L0KA 4S04A 5LBQA 1TBXA 1Z3YA 1QGPA 2FE3A 1F43A 3TW7A 4X0GA 2ZXJA 2MD0A 3BC8A 1D5YA 1W4MA 2LLKA 2IXSA 1FOXA 4WCGA 2VOPA 2WWYA 2DDBA 2VPLA 1P92A 1BI0A 1MBFA 2L7FP 3R61A 3HGGA 4I0AA 1WJ5A 3MN2A 2TRTA 2H8RA 2HDCA 1XGNA 2HDWA 2JA8J 3MWMA 4CH7A 3H9JA 1FP1D 2QEXI 3PUFA 1LDKB 3G73A 4HAMA 1T39A 3IV5A 4FISA 4LK0F 1YW9A 2DLLA 3ONQA 1SD7A 4ZH4F 2LNBA 5LHHA 2JJ7A 3HJEA 4PJNA 4WXCA 4ASNA 4AIHA 4MIMA 3DBHB 1SVOA 3ULQB 2HGCA 2EV5A 3E1SA 4LLLA 4EJTA 5GTHC 5GP9A 2LREA 2OA4A 2BYVE
chains in the Genus database with same CATH topology
3TP0A 1ETQA 3TP3A 1WGXA 2ID3A 1JKPC 1ETVA 5FKNA 5GPCA 3JREA 1O4XA 5M3FJ 2E2IJ 4FTHA 2LP0A 1X2NA 1IUFA 3QPLA 4CYCA 2O8KA 3ZQFA 2E19A 2DA4A 3BR3A 5J1RA 4BXXJ 2R7ZJ 1DU6A 1T56A 4BBRJ 5C44J 5M3MJ 3LSPA 1JUSA 1NK2P 3HOXJ 1VI0A 2X6OA 2CQQA 4DZJA 3HOUJ 1QPIA 5F0HA 5E3NA 3S1RJ 3PO2J 3A03A 4B3AA 2XPWA 1IV6A 1WPKA 3S15J 5FKOA 3JRGA 1AHDP 1GVDA 3IH2A 2EZHA 1U78A 4Y7NJ 2KT0A 1JT0A 1GV5A 2WAQN 2OF7A 3M4OJ 1Z0XA 3JRDA 1U9OA 4IEJA 3ZQCA 1GT0C 3FK7A 2MW8A 3ZQHA 2R5YB 2LKXA 1ORKA 2EZLA 5F1JA 4A3FJ 1JKOC 3JRBA 3Q0WA 5EG0B 1MNMC 1VNDA 1R9TJ 1U9NA 1VFCA 5IP7J 2JWTA 1H89C 1GV2A 3E7LA 5E3MA 4QIWN 2XRLA 3BTJA 1EF4A 2G0EA 3LSGA 3FK6A 1F36A 5GPAA 3FKIJ 1I6HJ 2NVTJ 4C3HJ 3A01A 2EH3A 5C4XJ 2GM4A 4X6AJ 5K7ZA 1JJ6C 2CQXA 4JX6A 1TWHJ 4UUSB 3RZDJ 2OPTA 1XS9A 2E1OA 1AU7A 2LD5A 4QTRA 3BTCA 5M5WJ 4X1EA 2L9RA 4L5EA 5M5XJ 3BR2A 1JT6A 4IHYA 1LFBA 3GTQJ 1B72B 3BR6A 5BNGA 4S0HB 1HLVA 1ITYA 4JX5A 1Q1VA 4MLOA 1IDYA 5F0FA 3GTOJ 1MH4A 2HYJA 1W0TA 2CRGA 1QRYA 2LFBA 3ZQLA 2HQ5A 5FKLA 3D1NI 1ETXA 5FLVA 1GUUA 1JGGA 1RKTA 1QVTA 3G1LA 3GTJJ 3C2BA 1ETKA 4D5CA 4J19A 5FKKA 5EGOB 2XPUA 1RKWA 1DU0A 4A3IJ 2ZB9A 2NS7A 5FJ8J 2FJ1A 4UUSA 1XC5A 1AKHB 2FX0A 3QPSA 2DMTA 4BY7J 4D7NA 4EEFG 2R5ZB 5F04A 2PMZN 1JTYA 1Z77A 3Q3SA 3BG5A 4RBOA 1K83J 1MSEC 3JR9A 4G12A 5IPAA 1B72A 2YS9A 3Q0VA 2N8GA 2X9DA 1MBGA 2B63J 4D7MA 4A3BJ 3JRCA 3MVPA 1MBKA 1IJWC 2CJJA 2GLOA 3S2HJ 4NDLA 1RETA 2I10A 5E3OA 3ZOBA 2L7MP 4FE4A 1LE8B 1BA5A 2DA3A 1T33A 3S1QJ 4B1RA 3NAUA 2VPRA 3HOVJ 2ECBA 1PUFA 2HXOA 3IH4A 1AKHA 2Y9YA 2WB1N 4C3IJ 1E3OC 2M34A 3GTLJ 3OSFA 3F0CA 2DA2A 3Q0UA 2CUEA 1FIPA 2M2EA 2MG4A 2JA6J 3OIOA 3B6CA 1TWGJ 2P81A 3RZOJ 2Y9ZA 2CUFA 2JA5J 5IYBJ 3LNQA 1G2HA 1IGNA 3BQYA 3CCYA 3CMYA 3BR1A 1A5JA 1NTCA 1LE8A 3L1PA 2Y30A 5IYCJ 1IDZA 1YRNB 4M3FA 4Y52J 1GDTA 1BW5A 3NARA 2JA7J 3LSJA 2X48A 2COBA 4FE7A 2R92J 2WV1A 1CQTA 3WHBA 2ELKA 4BKXA 3DEWA 1WH5A 3BR0A 3TEDA 1MSFC 1X58A 3HGYA 2Y2ZA 4XRSA 3ZQGA 5FKMA 1APLC 4UUTA 3CQZJ 2HXIA 5EDNA 5EEAA 3S17J 1HOMA 2FD5A 1RR7A 2HDDA 1OJLA 1S7EA 2LY9A 2NVYJ 5IOYA 2E2JJ 3H0GJ 1FIAA 1FJLA 1SANA 2R5YA 3JRIA 5IYDJ 1MBHA 1FTZA 5EG0A 5E3LA 4DYQA 2DA6A 2IEKA 1WCMJ 2GBYA 4A3GJ 2YUSA 5C3EJ 1MBEA 2QCOA 4MFDA 3HOWJ 3HKZN 4XRSG 5IP6A 2DMNA 4I76A 2DJNA 3IH3A 2XSDC 3H3VK 4AC0A 1FEXA 3BG3A 1VF9A 1W0UA 1POGA 4BY1J 4M3GA 4XK4A 2LTPA 1NK3P 3MKLA 1LFUP 5J1UA 4A3MJ 3HBLA 4DYRA 1OCTC 2MSYA 3G1OA 2DA7A 4HNVA 2TCTA 1HDDC 1ZKGA 3BTIA 4GFBA 3BTLA 3RQIA 3RKQA 2JN6A 5JLXA 3BQZA 2Y0SN 4LOCA 1QVUA 1K61A 2K9SA 1XG1A 2ECCA 2XGCA 1Y1VJ 3K2AA 1B8IB 5M5YJ 4IHWA 3S14J 3OSGA 3FISA 2DN0A 4CYCB 3I4NJ 2CU7A 5IP9J 1BL0A 4DW6A 5EZHA 2FQ4A 1H8AC 2XB0X 4W97A 3HM5A 1BW6A 3VPRA 2Y31A 4FCYA 5DTDA 4RDUA 3FIWA 2AO9A 5EGOA 1JJ8C 1HCRA 2K9NA 2ME6A 2K9QA 5IOZA 3WHCA 2LVSA 4A69C 1ZR4A 3GTGJ 2R5ZA 3QQAA 2D5VA 2R93J 2IAIA 2XGDA 1WI3A 4A3CJ 2NVQJ 1TC3C 2NOGA 1UHSA 2EBIA 1ZK8A 3TW6A 2EZIA 3PM1A 1B8IA 5K7HA 2EZKA 2MGQA 2ID6A 2VI6A 2VKEA 4A3EJ 4IHVA 3GTPJ 1H88C 2HOTA 2VUMJ 3S1MJ 1P7IA 3O8GA 3UKGA 1FTTA 2RAEA 9ANTA 2XPVA 4MO7A 5FLMJ 1I3QJ 2NS8A 5F08A 2M9HA 4C3JJ 5K7FA 1RESA 2HOAA 4A3DJ 4ABZA 1ZGWA 1OCPA 4B4CA 4A93J 3HB9A 4M3BA 3SJMA 1IG7A 3A01B 2O7OA 1I50J 1Y1WJ 4A3JJ 1JKRC 3S1NJ 1UMQA 1JUPA 4V2FA 3GTKJ 3HOZJ 3HEFA 4V2GA 4XRMA 1ENHA 2DMQA 5J1YA 5F27A 1UG2A 1RPWA 5J3LA 1TWAJ 2DMUA 2LK2A 4DYCA 4A3KJ 2ME0A 4I6ZA 3B6AA 1HF0A 4A3LJ 4M6VA 2EQRA 4AUXA 1ETOA 4DZPA 3S16J 1ETYA 2VKVA 1IRZA 5EF6A 4IHXA 3DCFA 3A02A 3BT9A 1YRNA 1MH3A 1X2MA 1U8BA 3BG9A 3SFIA 4XICA 4C2MJ 1BJZA 2HI3A 2QF7A 3K7AJ 3O8HA 4AYBN 5EYRA 2M8GX 2YU9J 2KDZA 1SFOJ 1HDPA 3LSRA 2JK3A 3I4MJ 5C4JJ 4XIDA 1JKQC 3JRHA 5HODA 5EZGA 2E2HJ 3W6VA 3HOYJ 2XB5A 2IBDA 4D5FA 2K40A 3LOCA 2LR8A 3PO3J 1ETWA 2DMPA 2L0KA 4MFEA 3ZQIA 1F43A 1JTXA 1TWCJ 2DTZA 2H1KA 3TW7A 1ZR2A 2AHQA 3M3YJ 3JRFA 2JMWA 5JLWA 3G1MA 1TWFJ 2HOSA 3BR5A 3GBGA 4M3EA 1D5YA 5DS9A 2LLKA 2L7FP 1A6IA 1MBFA 2DA1A 2XGEA 3HGGA 2DA5A 2W48A 1P7JA 4JP0A 4BBSJ 3HDDA 3MN2A 1ZTRA 2TRTA 1PUFB 2R0QC 2H8RA 2NVXJ 2JA8J 4M3DA 1OFCX 4QSHA 3IV5A 4FISA 4JYKA 3CDLA 4JX4A 2M0CA 1WH7A 2L7ZA 3JRAA 1MBJA 3SDGA 2JJ7A 4W1UA 4MIMA 3GTMJ 1ZQ3P 2O9LA 5GP9A 1JUMA 3S2DJ 5F0CA 1IC8A 3OOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP0 A;  1ETQ A;  3TP3 A;  1WGX A;  2ID3 A;  1JKP C;  1ETV A;  5FKN A;  5GPC A;  3JRE A;  1O4X A;  5M3F J;  2E2I J;  4FTH A;  2LP0 A;  1X2N A;  1IUF A;  3QPL A;  4CYC A;  2O8K A;  3ZQF A;  2E19 A;  2DA4 A;  3BR3 A;  5J1R A;  4BXX J;  2R7Z J;  1DU6 A;  1T56 A;  4BBR J;  5C44 J;  5M3M J;  3LSP A;  1JUS A;  1NK2 P;  3HOX J;  1VI0 A;  2X6O A;  2CQQ A;  4DZJ A;  3HOU J;  1QPI A;  5F0H A;  5E3N A;  3S1R J;  3PO2 J;  3A03 A;  4B3A A;  2XPW A;  1IV6 A;  1WPK A;  3S15 J;  5FKO A;  3JRG A;  1AHD P;  1GVD A;  3IH2 A;  2EZH A;  1U78 A;  4Y7N J;  2KT0 A;  1JT0 A;  1GV5 A;  2WAQ N;  2OF7 A;  3M4O J;  1Z0X A;  3JRD A;  1U9O A;  4IEJ A;  3ZQC A;  1GT0 C;  3FK7 A;  2MW8 A;  3ZQH A;  2R5Y B;  2LKX A;  1ORK A;  2EZL A;  5F1J A;  4A3F J;  1JKO C;  3JRB A;  3Q0W A;  5EG0 B;  1MNM C;  1VND A;  1R9T J;  1U9N A;  1VFC A;  5IP7 J;  2JWT A;  1H89 C;  1GV2 A;  3E7L A;  5E3M A;  4QIW N;  2XRL A;  3BTJ A;  1EF4 A;  2G0E A;  3LSG A;  3FK6 A;  1F36 A;  5GPA A;  3FKI J;  1I6H J;  2NVT J;  4C3H J;  3A01 A;  2EH3 A;  5C4X J;  2GM4 A;  4X6A J;  5K7Z A;  1JJ6 C;  2CQX A;  4JX6 A;  1TWH J;  4UUS B;  3RZD J;  2OPT A;  1XS9 A;  2E1O A;  1AU7 A;  2LD5 A;  4QTR A;  3BTC A;  5M5W J;  4X1E A;  2L9R A;  4L5E A;  5M5X J;  3BR2 A;  1JT6 A;  4IHY A;  1LFB A;  3GTQ J;  1B72 B;  3BR6 A;  5BNG A;  4S0H B;  1HLV A;  1ITY A;  4JX5 A;  1Q1V A;  4MLO A;  1IDY A;  5F0F A;  3GTO J;  1MH4 A;  2HYJ A;  1W0T A;  2CRG A;  1QRY A;  2LFB A;  3ZQL A;  2HQ5 A;  5FKL A;  3D1N I;  1ETX A;  5FLV A;  1GUU A;  1JGG A;  1RKT A;  1QVT A;  3G1L A;  3GTJ J;  3C2B A;  1ETK A;  4D5C A;  4J19 A;  5FKK A;  5EGO B;  2XPU A;  1RKW A;  1DU0 A;  4A3I J;  2ZB9 A;  2NS7 A;  5FJ8 J;  2FJ1 A;  4UUS A;  1XC5 A;  1AKH B;  2FX0 A;  3QPS A;  2DMT A;  4BY7 J;  4D7N A;  4EEF G;  2R5Z B;  5F04 A;  2PMZ N;  1JTY A;  1Z77 A;  3Q3S A;  3BG5 A;  4RBO A;  1K83 J;  1MSE C;  3JR9 A;  4G12 A;  5IPA A;  1B72 A;  2YS9 A;  3Q0V A;  2N8G A;  2X9D A;  1MBG A;  2B63 J;  4D7M A;  4A3B J;  3JRC A;  3MVP A;  1MBK A;  1IJW C;  2CJJ A;  2GLO A;  3S2H J;  4NDL A;  1RET A;  2I10 A;  5E3O A;  3ZOB A;  2L7M P;  4FE4 A;  1LE8 B;  1BA5 A;  2DA3 A;  1T33 A;  3S1Q J;  4B1R A;  3NAU A;  2VPR A;  3HOV J;  2ECB A;  1PUF A;  2HXO A;  3IH4 A;  1AKH A;  2Y9Y A;  2WB1 N;  4C3I J;  1E3O C;  2M34 A;  3GTL J;  3OSF A;  3F0C A;  2DA2 A;  3Q0U A;  2CUE A;  1FIP A;  2M2E A;  2MG4 A;  2JA6 J;  3OIO A;  3B6C A;  1TWG J;  2P81 A;  3RZO J;  2Y9Z A;  2CUF A;  2JA5 J;  5IYB J;  3LNQ A;  1G2H A;  1IGN A;  3BQY A;  3CCY A;  3CMY A;  3BR1 A;  1A5J A;  1NTC A;  1LE8 A;  3L1P A;  2Y30 A;  5IYC J;  1IDZ A;  1YRN B;  4M3F A;  4Y52 J;  1GDT A;  1BW5 A;  3NAR A;  2JA7 J;  3LSJ A;  2X48 A;  2COB A;  4FE7 A;  2R92 J;  2WV1 A;  1CQT A;  3WHB A;  2ELK A;  4BKX A;  3DEW A;  1WH5 A;  3BR0 A;  3TED A;  1MSF C;  1X58 A;  3HGY A;  2Y2Z A;  4XRS A;  3ZQG A;  5FKM A;  1APL C;  4UUT A;  3CQZ J;  2HXI A;  5EDN A;  5EEA A;  3S17 J;  1HOM A;  2FD5 A;  1RR7 A;  2HDD A;  1OJL A;  1S7E A;  2LY9 A;  2NVY J;  5IOY A;  2E2J J;  3H0G J;  1FIA A;  1FJL A;  1SAN A;  2R5Y A;  3JRI A;  5IYD J;  1MBH A;  1FTZ A;  5EG0 A;  5E3L A;  4DYQ A;  2DA6 A;  2IEK A;  1WCM J;  2GBY A;  4A3G J;  2YUS A;  5C3E J;  1MBE A;  2QCO A;  4MFD A;  3HOW J;  3HKZ N;  4XRS G;  5IP6 A;  2DMN A;  4I76 A;  2DJN A;  3IH3 A;  2XSD C;  3H3V K;  4AC0 A;  1FEX A;  3BG3 A;  1VF9 A;  1W0U A;  1POG A;  4BY1 J;  4M3G A;  4XK4 A;  2LTP A;  1NK3 P;  3MKL A;  1LFU P;  5J1U A;  4A3M J;  3HBL A;  4DYR A;  1OCT C;  2MSY A;  3G1O A;  2DA7 A;  4HNV A;  2TCT A;  1HDD C;  1ZKG A;  3BTI A;  4GFB A;  3BTL A;  3RQI A;  3RKQ A;  2JN6 A;  5JLX A;  3BQZ A;  2Y0S N;  4LOC A;  1QVU A;  1K61 A;  2K9S A;  1XG1 A;  2ECC A;  2XGC A;  1Y1V J;  3K2A A;  1B8I B;  5M5Y J;  4IHW A;  3S14 J;  3OSG A;  3FIS A;  2DN0 A;  4CYC B;  3I4N J;  2CU7 A;  5IP9 J;  1BL0 A;  4DW6 A;  5EZH A;  2FQ4 A;  1H8A C;  2XB0 X;  4W97 A;  3HM5 A;  1BW6 A;  3VPR A;  2Y31 A;  4FCY A;  5DTD A;  4RDU A;  3FIW A;  2AO9 A;  5EGO A;  1JJ8 C;  1HCR A;  2K9N A;  2ME6 A;  2K9Q A;  5IOZ A;  3WHC A;  2LVS A;  4A69 C;  1ZR4 A;  3GTG J;  2R5Z A;  3QQA A;  2D5V A;  2R93 J;  2IAI A;  2XGD A;  1WI3 A;  4A3C J;  2NVQ J;  1TC3 C;  2NOG A;  1UHS A;  2EBI A;  1ZK8 A;  3TW6 A;  2EZI A;  3PM1 A;  1B8I A;  5K7H A;  2EZK A;  2MGQ A;  2ID6 A;  2VI6 A;  2VKE A;  4A3E J;  4IHV A;  3GTP J;  1H88 C;  2HOT A;  2VUM J;  3S1M J;  1P7I A;  3O8G A;  3UKG A;  1FTT A;  2RAE A;  9ANT A;  2XPV A;  4MO7 A;  5FLM J;  1I3Q J;  2NS8 A;  5F08 A;  2M9H A;  4C3J J;  5K7F A;  1RES A;  2HOA A;  4A3D J;  4ABZ A;  1ZGW A;  1OCP A;  4B4C A;  4A93 J;  3HB9 A;  4M3B A;  3SJM A;  1IG7 A;  3A01 B;  2O7O A;  1I50 J;  1Y1W J;  4A3J J;  1JKR C;  3S1N J;  1UMQ A;  1JUP A;  4V2F A;  3GTK J;  3HOZ J;  3HEF A;  4V2G A;  4XRM A;  1ENH A;  2DMQ A;  5J1Y A;  5F27 A;  1UG2 A;  1RPW A;  5J3L A;  1TWA J;  2DMU A;  2LK2 A;  4DYC A;  4A3K J;  2ME0 A;  4I6Z A;  3B6A A;  1HF0 A;  4A3L J;  4M6V A;  2EQR A;  4AUX A;  1ETO A;  4DZP A;  3S16 J;  1ETY A;  2VKV A;  1IRZ A;  5EF6 A;  4IHX A;  3DCF A;  3A02 A;  3BT9 A;  1YRN A;  1MH3 A;  1X2M A;  1U8B A;  3BG9 A;  3SFI A;  4XIC A;  4C2M J;  1BJZ A;  2HI3 A;  2QF7 A;  3K7A J;  3O8H A;  4AYB N;  5EYR A;  2M8G X;  2YU9 J;  2KDZ A;  1SFO J;  1HDP A;  3LSR A;  2JK3 A;  3I4M J;  5C4J J;  4XID A;  1JKQ C;  3JRH A;  5HOD A;  5EZG A;  2E2H J;  3W6V A;  3HOY J;  2XB5 A;  2IBD A;  4D5F A;  2K40 A;  3LOC A;  2LR8 A;  3PO3 J;  1ETW A;  2DMP A;  2L0K A;  4MFE A;  3ZQI A;  1F43 A;  1JTX A;  1TWC J;  2DTZ A;  2H1K A;  3TW7 A;  1ZR2 A;  2AHQ A;  3M3Y J;  3JRF A;  2JMW A;  5JLW A;  3G1M A;  1TWF J;  2HOS A;  3BR5 A;  3GBG A;  4M3E A;  1D5Y A;  5DS9 A;  2LLK A;  2L7F P;  1A6I A;  1MBF A;  2DA1 A;  2XGE A;  3HGG A;  2DA5 A;  2W48 A;  1P7J A;  4JP0 A;  4BBS J;  3HDD A;  3MN2 A;  1ZTR A;  2TRT A;  1PUF B;  2R0Q C;  2H8R A;  2NVX J;  2JA8 J;  4M3D A;  1OFC X;  4QSH A;  3IV5 A;  4FIS A;  4JYK A;  3CDL A;  4JX4 A;  2M0C A;  1WH7 A;  2L7Z A;  3JRA A;  1MBJ A;  3SDG A;  2JJ7 A;  4W1U A;  4MIM A;  3GTM J;  1ZQ3 P;  2O9L A;  5GP9 A;  1JUM A;  3S2D J;  5F0C A;  1IC8 A;  3OOU A; 
#chains in the Genus database with same CATH topology
 1ETQ A;  1WJE A;  4E7J A;  3TP3 A;  5HNH A;  1WGX A;  4BEH B;  1ONV A;  2CO5 A;  2WC2 A;  2ZSH B;  5FKN A;  5GPC A;  1XX5 A;  3JRE A;  3BZK A;  3IWZ A;  4F3Q A;  1X2N A;  4CYC A;  3H3Z A;  2RKH A;  2P6S A;  5JI6 A;  1YQA A;  3ZQF A;  2DA4 A;  1W36 D;  4GYI A;  5FFZ A;  5J1R A;  5K5R A;  4BXX J;  5DCF A;  1D3Y A;  3KP3 A;  2QA4 I;  3SHF A;  3LSP A;  2DK8 A;  3CMM A;  2IP2 A;  5TGT A;  1IN7 A;  1UG0 A;  2LBF A;  3S1R J;  4LLN A;  3GVA A;  1QHH D;  2L7K A;  5IT9 K;  2JA2 A;  2QSG X;  1X1A A;  1ZG3 A;  1ZAR A;  3M8J A;  4B3A A;  1AHD P;  2P0W A;  3IH2 A;  3IHU A;  2KT0 A;  1GV5 A;  2M30 A;  4DIQ A;  2ZME A;  4R1H A;  2XAQ A;  2MW8 A;  3G71 I;  4G94 A;  2LKX A;  1ORK A;  2EZL A;  4E6K G;  5F1J A;  4A3F J;  3CDH A;  3BWG A;  3JRB A;  5EG0 B;  1ZRE A;  1I39 A;  2W57 A;  3IRQ A;  1U9N A;  2O03 A;  1OKR A;  1W5T A;  4NC6 A;  3PIO F;  2E5Z A;  4RM3 A;  1X4O A;  1QA6 A;  4QIW N;  2NNN A;  2XRL A;  2IGO A;  3SFZ A;  2VON A;  4IKF A;  4HZF A;  3I55 I;  3FKI J;  2NVT J;  1O3Q A;  2O3F A;  4XN0 A;  3GW2 A;  3ECO A;  4N4O B;  1WJB A;  2CQX A;  2LMD A;  1TWH J;  1IN8 A;  1IRF A;  2RNJ A;  3W3C A;  3OYM A;  5ERI A;  3RZD J;  1UHM A;  2O5R A;  4GRI A;  2IGK A;  2DFF A;  2E1O A;  2H8W A;  4ZYH A;  1R7J A;  4NUB A;  3ASN H;  1MDM B;  3OR2 C;  3KE2 A;  2E1M C;  2DAO A;  2DQR A;  2R7R A;  3GTQ J;  4Q5S F;  1AOY A;  3FXK A;  5D4S A;  1H9G A;  5BNG A;  3LAP A;  3GZN B;  2KQR A;  1ODD A;  1HLV A;  2CQ7 A;  2W25 A;  3R0J A;  4JX5 A;  1IDY A;  5F0F A;  2KRF A;  4RAG A;  3N4M A;  5E1W A;  4I2O A;  1VQL I;  4NHJ A;  3FMQ A;  3ZQL A;  4LB6 B;  2A05 A;  4O5V A;  5CVJ A;  1GUU A;  2Z2S B;  3CJT B;  1TW3 A;  4AID A;  3GTJ J;  3C2B A;  1ETK A;  1YS7 A;  2XPU A;  2DOE A;  2ZB9 A;  4FET A;  4UUS A;  1FP2 A;  4LB5 A;  2PBI A;  2EV0 A;  1W7P D;  2Z5U A;  4BY7 J;  2CV0 A;  1D8J A;  1R4M B;  2X51 A;  1Z77 A;  2FMY A;  2V9V A;  4H4K C;  3P9K A;  1TP4 A;  5LGT A;  4ZYE A;  2YS9 A;  4A6E A;  2XGX A;  2Q1Z B;  3L9F A;  1MBG A;  3F8C A;  1SD5 A;  1WZ2 A;  3MVP A;  1MBK A;  2CJJ A;  3HKZ A;  5D5X B;  1PP8 F;  3PJR A;  5CQE A;  2BHZ A;  2I10 A;  3ELK A;  3I59 B;  3ZOB A;  2A61 A;  1SC7 A;  1ZH5 A;  1T33 A;  4KIF A;  4LG3 A;  1Y8Q B;  5F6F A;  3CCR I;  4B1R A;  2UXX A;  1FMV A;  1SFE A;  4YG2 F;  3HOV J;  2ECB A;  2D1H A;  1XTA A;  3IWF A;  1DUX C;  1AKH A;  2WB1 N;  2X6W A;  4C3I J;  2CW8 A;  2KL4 A;  3GTL J;  3OSF A;  3HC7 A;  2H6C A;  4EJV A;  4OIP F;  1B6A A;  2HQA A;  2Z1D A;  1XGS A;  2HVS A;  2M2E A;  2MG4 A;  1WQ2 A;  4GYG A;  3Q9S A;  2IGN A;  2CUF A;  2JA5 J;  1YJW I;  1G2H A;  2OC6 A;  4CCL A;  1IGN A;  1GXQ A;  2VJ5 A;  4RGS A;  4B44 A;  4LFU A;  1NTC A;  3L1P A;  1YW7 A;  1MGT A;  3WTX C;  2A3S A;  3SYT A;  3ZMZ A;  4BEH A;  1J75 A;  1TNS A;  2NOJ B;  3VYR B;  1YRN B;  4M3F A;  1MIJ A;  4ZDP A;  4ZYD A;  3Q5F A;  1GDT A;  1BW5 A;  3RSN A;  1W5C C;  1X3U A;  4Z6Y A;  3JSP A;  2R92 J;  2WV1 A;  3ASO H;  3DEW A;  2ZO4 A;  2HPM A;  2R7U A;  2W7N A;  2UZK A;  1OCC H;  3AG1 H;  4I98 B;  3G6E I;  1MSF C;  1D0Y A;  3HGY A;  1SEU A;  1PDN C;  1MJ9 A;  5FKM A;  1APL C;  3GFL A;  3TDU C;  1XGM A;  1J9I A;  4DBR A;  2A69 F;  3CQZ J;  5KHD A;  4F7Z A;  1D5V A;  5EEA A;  2CW7 A;  4KIT B;  5D6F A;  1L0O C;  2BEO A;  1OQY A;  4A2U A;  2K02 A;  3CF5 F;  2KHM A;  2GIV A;  2LY9 A;  4XOT A;  3CCJ I;  4IHS A;  5CVI A;  1AWC A;  3FX3 A;  4IOA F;  1S3J A;  1TLH B;  1MBH A;  5HVQ C;  5BPD A;  2GWR A;  5EG0 A;  1WWX A;  3GLX A;  3ESW B;  2LDU A;  2P8T A;  2CMP A;  4NC7 A;  1MBE A;  1LEA A;  2ESN A;  5H20 A;  2YX4 A;  3PFY A;  4ON0 A;  3TOA A;  2BOL A;  1X1D A;  1IXC A;  5IP6 A;  4J00 A;  4I76 A;  3K4M A;  5GAG J;  2MC3 A;  3K10 A;  5B1A H;  4ITV A;  2BXZ A;  4PGH A;  1MNE A;  2L4A A;  5E1Z B;  3K4K A;  5J1U A;  3E3V A;  3HBL A;  4A3M J;  3GWZ A;  3VFZ A;  1G3T A;  3VWB A;  4XLP F;  4GFB A;  1IAW A;  3WTU C;  3BTL A;  4UB8 C;  4IXA A;  3BQZ A;  4IQ4 A;  1QVU A;  2J5P A;  1QNT A;  2ECC A;  3R0A A;  4II3 A;  1JGS A;  4EJW A;  1ZEL A;  3S32 A;  1UAA A;  3E6D A;  3NQO A;  4AYB A;  1B8I B;  1I5Z A;  4RS8 A;  4KA4 A;  3OSG A;  1VQ4 I;  3FIS A;  3M1E A;  1MND A;  2FBH A;  3J7A Y;  2GIZ A;  3I4N J;  1LVK A;  1YIT I;  5IP9 J;  3F8N A;  1J7K A;  1BL0 A;  4DW6 A;  5DUI A;  3SXY A;  1OMI A;  5LLQ A;  3V42 A;  3WTY C;  3K4N A;  3DPL C;  1GHC A;  4RA2 A;  2M7A A;  1BW6 A;  4YRV A;  3HL2 A;  2F5E A;  2X1D A;  4HLY A;  2AO9 A;  1YJ9 I;  3TO6 A;  1YFH A;  3OYE A;  1XSD A;  1R1V A;  3V7C A;  2JSC A;  1OIS A;  2HKX A;  2H94 A;  3OYC A;  1IRX A;  3QQA A;  3CC4 I;  4A3C J;  2IJL A;  3W6J B;  2GOM A;  3MAJ A;  2MA3 A;  5HDN A;  2RQP A;  1T0F A;  5D5V B;  1VZ0 A;  4NC8 A;  3R60 A;  4LLG F;  2DT7 B;  2EZK A;  2MGQ A;  5L3E A;  2LC2 A;  1QU3 A;  3I59 A;  3PL8 A;  3JAM K;  1YS6 A;  4HPQ A;  4EV0 A;  3NWT A;  4HDV A;  3GXO A;  4EVI A;  1I3Q J;  5F08 A;  4E7H A;  3BJO A;  2Y69 H;  4A3D J;  4JQF A;  1YX5 A;  4QPO A;  3V4G A;  1IG7 A;  1MJA A;  2ZBK A;  2K7L A;  3DP7 A;  3FM5 A;  4IJA A;  3B02 A;  5LHG A;  1LNW A;  1UMQ A;  2RDP A;  3GTK J;  1I3A A;  4UNO A;  4XLH A;  1OCO H;  2IS4 A;  1R4N B;  1RI7 A;  2OBP A;  4OMY A;  3KP2 A;  3W2A A;  3FXQ A;  3BG7 A;  1BC8 C;  1RPW A;  2ZSI B;  1UCR A;  1OYI A;  3D0S A;  4XSZ F;  4H0E A;  1ACI A;  2L2O A;  2LK2 A;  3I0T A;  1MKM A;  3MZ8 A;  2PX9 A;  2OCE A;  1W36 C;  2QBY B;  4I6Z A;  2R7O A;  1HF0 A;  4A3L J;  1JHH A;  5IT9 Z;  3LSH A;  4PJL A;  1ETY A;  3G3Z A;  2FSW A;  2VKV A;  4ZTJ A;  3HTS B;  2V6E A;  2VN2 A;  2AXT C;  4IZZ A;  3F9K A;  1YRN A;  4UVA A;  2FU4 A;  1KGS A;  4A5M A;  3SFI A;  2IS1 A;  1BJA A;  3WU0 A;  3L2C A;  3EYY A;  1BJZ A;  4N0B A;  4BGD A;  1STZ A;  5EYR A;  4LMY A;  1Z6T A;  2KDZ A;  3GO5 A;  4CHU A;  2Q2E B;  3NRV A;  2WTE A;  3LSR A;  1DGW Y;  5L3D A;  1KYW A;  3I4M J;  1G59 A;  3K9T A;  4XID A;  4UVC A;  2E2H J;  2EIJ H;  3FHN A;  3VSK A;  3HOY J;  5FRO A;  2LR8 A;  4GDF A;  2AQE A;  3KYC B;  2DMP A;  3RPQ A;  3CDI A;  5LEJ A;  3TO7 A;  1JTX A;  1KA8 A;  2DTZ A;  4BH9 A;  2B7E A;  2MH9 A;  1ZR2 A;  2AHQ A;  4KYW A;  3M3Y J;  2PQ8 A;  5IY5 H;  2L02 A;  1VQM I;  3QPT A;  1TWF J;  4UXN A;  3BR5 A;  2HOS A;  4CCO A;  3K70 C;  3PUB A;  1U5T C;  3IUO A;  3M7G A;  2CUZ A;  1X3Z B;  4HF2 A;  2EIL H;  2JRM A;  2DA5 A;  2W48 A;  4RGU A;  4BBS J;  2CS3 A;  2XAG A;  2YU3 A;  1PUF B;  5LD2 C;  2EFP A;  2F5F A;  4IVN A;  2NVX J;  1TTY A;  1OFC X;  2E1N A;  3QP6 A;  2LRD A;  4BDZ A;  1XMX A;  3PSI A;  2KLO A;  3L2Q A;  2HVR A;  2M0C A;  1ZLK A;  5LFA A;  3JRA A;  4D1Q A;  4E4H A;  1HST A;  3T5X A;  3I64 A;  4W1U A;  1YO5 C;  4EM0 B;  1BOB A;  4RGR A;  4XN3 A;  5FD5 A;  4OWR B;  2MBF A;  1ZQ3 P;  4KN7 X;  3S2D J;  4C2T A;  4M6Y A;  3M1C A;  4PZJ A;  1IC8 A;  3OOU A;  1EV7 A;  3AFH A;  2M7B A;  4DQ2 A;  2ZME B;  2ID3 A;  1JKP C;  1CF7 B;  1LVA A;  3DXJ F;  2ZC2 A;  2BGC A;  3NWS A;  1O4X A;  2HZT A;  4P55 A;  1ZGJ A;  4B09 A;  2LP0 A;  3QPL A;  1IUF A;  1YTY A;  4CXF A;  1B9N A;  3HPH A;  2E19 A;  4QPQ A;  1FY7 A;  3BR3 A;  3H5N A;  1DU6 A;  5C44 J;  2W84 A;  3REO A;  3CF2 A;  2KP6 A;  3HOX J;  1WJD A;  3QU6 A;  2V4J C;  3IAS 2;  2GA2 A;  1XPX A;  3HOU J;  5E1X A;  3DBL B;  4AU7 A;  5F0H A;  1N78 A;  2FOW A;  5DD4 A;  4CUG A;  4BQA A;  4OMZ A;  1T6S A;  3K4B A;  2XPW A;  2EFO A;  1KQ0 A;  4BHC A;  3BP8 A;  3F72 A;  5DM6 F;  3VDX A;  3ZCO A;  2EZH A;  5B66 C;  3EET A;  3CJN A;  3HZJ A;  1YYV A;  1D1C A;  1JT0 A;  3H0D A;  5HS7 A;  2WAQ N;  1EJ9 A;  3SZP A;  4IEJ A;  3ZQC A;  2KMU A;  3FK7 A;  3J81 K;  2R5Y B;  2OTJ I;  1BI2 A;  3IRR A;  2QSH X;  1JKO C;  4A6D A;  1R6R A;  2FA5 A;  3GUD A;  2YX7 A;  2X4H A;  2ZXI A;  1DQU A;  2WB1 A;  1X19 A;  2BY3 A;  1R58 A;  1MNM C;  2L9N A;  5IP7 J;  1Y8R B;  3AG4 H;  1E17 A;  3LQQ A;  1H89 C;  1GV2 A;  3KP7 A;  2QM3 A;  1TT0 A;  2W1O A;  3HOS A;  2F2E A;  3L00 A;  2G0E A;  1HXD A;  3LSG A;  2R7T A;  5E8G A;  2NNY A;  1I6H J;  3VSL A;  1Z91 A;  5CPR B;  1I27 A;  4C3H J;  2R7V A;  2GM4 A;  4X6A J;  3FDY A;  3VYT B;  2VJI A;  4RLF A;  2XRN A;  4JX6 A;  3I71 A;  3GCM A;  4K2E A;  2CH0 A;  4UUS B;  1F1Z A;  1K4S A;  3OYL A;  4ETS A;  1SVL A;  3L2U A;  1AU7 A;  2OTL I;  3ZMD A;  4QTR A;  2G7U A;  2GXG A;  3BTC A;  3C2G A;  1V5G A;  4WF2 A;  4BAC A;  1JT6 A;  1X1P A;  1LFB A;  3HHG A;  2QBY A;  1WKM A;  3F8M A;  1PUE E;  4BJ6 C;  1F4K A;  2V1N A;  1U0J A;  2G9W A;  5D6E A;  4F93 B;  1P6R A;  3QAH A;  3GTO J;  1MH4 A;  2QEN A;  3P9C A;  1W0T A;  2A07 F;  4WX9 A;  2WAE A;  2CRG A;  1QRY A;  3D1N I;  4LG0 A;  1BI3 A;  1UB9 A;  2QKL B;  2CFX A;  3KEO A;  3TBI A;  3RPU A;  4HRI A;  1QVT A;  3HG9 A;  4D5C A;  4J19 A;  3PNV A;  5EGO B;  2IVM A;  5L3C A;  3CCS I;  1D1B A;  3F22 A;  3FBI B;  5GTI C;  2FJ1 A;  1XC5 A;  2CQK A;  2Q2E A;  2FX0 A;  3QPS A;  5J8C A;  2DMT A;  2OV7 A;  5J40 A;  1K7A A;  4KT5 C;  2BY1 A;  1ULY A;  4XKB A;  2RNG A;  1R1T A;  4TV7 A;  3JW4 A;  1OLT A;  3BG5 A;  1MSE C;  2LY2 A;  3I54 A;  3OIP A;  1B72 A;  1SAX A;  2HWV A;  3MKZ A;  3I56 I;  2KPM A;  2X9D A;  4D7M A;  4PDK A;  3RTR A;  4HLX A;  1BM9 A;  2CFO A;  2KFD A;  3IC7 A;  4N9H A;  4GO1 A;  4Y4R A;  2GLO A;  4NDL A;  1RET A;  3H5R A;  3V8K A;  5ILS A;  3CZ6 A;  3OWT A;  1E0E A;  2V9P A;  5LRR A;  5J47 A;  4F91 B;  1FSE A;  3F21 A;  2OQR A;  1ZN2 A;  3BCB A;  3FMS A;  3NAU A;  4N4N B;  4KDP A;  1HA8 A;  3CLQ A;  4XLC A;  2VPR A;  3QU3 A;  1TNT A;  5CKT A;  4ZZD A;  2D45 A;  1PUF A;  2E7W A;  4XLF A;  3IP4 B;  2Y9Y A;  1ZG5 A;  4IX7 A;  2M34 A;  2IA1 A;  1JI8 A;  5KK1 A;  2DYR H;  3F0C A;  3DF8 A;  4ENM A;  4MTD A;  2VLA A;  4CCK A;  2UV1 A;  2H27 A;  3Q0U A;  1UJ8 A;  4P5O A;  4L9T A;  4XL9 A;  4UHT A;  2JA6 J;  4A0Z A;  4HSR A;  3OIO A;  5HOO A;  1OYY A;  3K69 A;  1KZH A;  3OYH A;  1TWG J;  4A5N A;  2EV6 A;  2P81 A;  3KEQ A;  2FML A;  4R79 A;  3RZO J;  3LNQ A;  2ZCW A;  1D8K A;  3L2W A;  3CUQ B;  2OJE D;  4Q4Z F;  2F48 A;  3CCM I;  3L09 A;  2X6X A;  2MLK A;  3ML6 A;  3CMY A;  3BR1 A;  2DOA A;  1R22 A;  4KT6 A;  2XIG A;  3CCL I;  4G7H F;  1LE8 A;  4Y33 A;  4IF4 A;  2DBB A;  5IYC J;  2O61 A;  1CF7 A;  2XAH A;  4Y52 J;  2EPF A;  3CJQ B;  4Z2Y A;  5HLH A;  4M9Z A;  2X48 A;  2XHK A;  4CCN A;  1CQT A;  3CES A;  1BN5 A;  2YSR A;  2CGP A;  3OS2 A;  3OYJ A;  2E34 A;  2VE8 A;  5EJC A;  3BR0 A;  4LJZ F;  3OYA A;  3JAM Z;  4U88 A;  3EUH A;  5JVG F;  4HDU A;  3OYI A;  3K70 D;  5EEG A;  5EDN A;  3CMA I;  3S17 J;  3GLL A;  2IRF G;  4E7S A;  1P4W A;  1HOM A;  2FD5 A;  3DU6 A;  1J5Y A;  2IT0 A;  2PI0 A;  3CME I;  4XLA A;  1S7E A;  2LSO A;  3AL0 B;  1GLN A;  2E2J J;  3F23 A;  1HKT A;  1FJL A;  2VXD A;  2MC4 A;  2OUM A;  2R5Y A;  2ZFW A;  1JXS A;  3S93 A;  1BR4 A;  5E3L A;  4DYQ A;  2DA6 A;  2IEK A;  5ICE A;  1WCM J;  2GBY A;  5E17 F;  2A6T A;  2B0L A;  2VJ4 A;  1YX3 A;  2EJR A;  2A5W A;  2YUS A;  5FLX Z;  1O7F A;  3OR1 C;  1EH7 A;  1SFX A;  3R4K A;  4XLN F;  3T0Y A;  4XRS G;  3U9G A;  2DMN A;  1XD7 A;  3V7R A;  2XSD C;  1FEX A;  1VQ8 I;  1R36 A;  4EQQ A;  2FUG 2;  1POG A;  2QVO A;  4BY1 J;  1SMT A;  1M1E B;  2LTP A;  2L01 A;  1NK3 P;  5J4V A;  2XRO A;  3DU5 A;  4HNV A;  2DA7 A;  4A12 A;  1PP7 U;  4AM3 A;  4GXO A;  1PYV A;  1ZKG A;  4A0Y A;  2O8X A;  5ED4 A;  1YI2 I;  2BXY A;  2GXA A;  2HZD A;  1AKH B;  2K4B A;  2XKO A;  3RQI A;  2P6T A;  2DTR A;  2Y0S N;  1HQC A;  2XF7 A;  1Y1V J;  2EIM H;  1FBU A;  2STW A;  3QOD A;  5M5Y J;  3S14 J;  3V7S A;  1QZE A;  1U5T B;  1FYM A;  1DDN A;  3HPG A;  4ZDO A;  5LRS A;  3AG2 H;  1H8A C;  1SAU A;  3HM5 A;  4W97 A;  3WE2 A;  2JTV A;  4M72 A;  3VYS B;  3LQR A;  3DTE A;  2Y31 A;  5BQT A;  2HTS A;  4FCY A;  1I1G A;  5EGO A;  1R71 A;  2L9S A;  4MNU A;  1IF1 A;  3CCQ I;  3L2R A;  2K9Q A;  5IOZ A;  2AXL A;  3WHC A;  5KVR A;  2BW3 B;  5D5U B;  5B3S H;  2GZW A;  2VQH A;  2FOK A;  3LFU A;  3GTG J;  3GF2 A;  2D5V A;  1O3T A;  1E3H A;  3G4S I;  3SZT A;  1IO2 A;  3WGI A;  1BBY A;  1WI3 A;  3MKY B;  4YIF A;  1TC3 C;  4MTE A;  1UHS A;  2EBI A;  2QYO A;  1B1B A;  4MEY F;  1ZK8 A;  5TJJ A;  3TW6 A;  3PM1 A;  4HX4 A;  4HV6 A;  1T8I A;  1P9Q C;  3FBN B;  2R7S A;  4RLQ A;  5K7H A;  5TIS C;  1KYZ A;  5D8L B;  3WG7 H;  2ID6 A;  1Y0N A;  2VI6 A;  4A3E J;  2ELJ A;  4IHV A;  1H88 C;  3S1M J;  3FKJ A;  4I0B A;  1P7I A;  5DCM A;  4G6Q A;  1IN5 A;  4YFN F;  5E18 F;  4E7K A;  9ANT A;  1FTT A;  1W7P B;  3OOP A;  4BQO A;  4L0Z B;  3KFW X;  5E79 C;  1F9N A;  1SMY F;  4HF1 A;  3S2W A;  2DW4 A;  2RV8 A;  5K7F A;  1RES A;  4ANJ A;  2NRA C;  4ABZ A;  2OZU A;  4B4C A;  4A93 J;  4M3B A;  3SJM A;  3F6O A;  4M6X A;  2O7O A;  3S3M A;  4A3J J;  1JKR C;  3S1N J;  1U2W A;  2WBM A;  5HS8 A;  1MD0 A;  3OYB A;  1ENH A;  1NHA A;  2HS5 A;  4I09 A;  2DMQ A;  1BI1 A;  3E5Q A;  5J1Y A;  3KYL A;  2VOO A;  4OIN F;  4ENK A;  2PEX A;  1G3S A;  1TWA J;  4EM1 A;  2VB6 A;  3ZMV A;  3MZY A;  4DYC A;  3GEZ A;  4A3K J;  5H6R A;  2DYS H;  2ME0 A;  4S05 A;  3CUQ A;  3I3L A;  1OR7 A;  2EQR A;  4AUX A;  1QBJ A;  3C1D A;  4EJO A;  1YW8 A;  2XVC A;  3CUO A;  4JOM A;  4XSX F;  1IRZ A;  1S9H A;  5HS9 A;  4ENN A;  1Y56 A;  3BT9 A;  2A6H F;  3HOT A;  3H9G A;  3DKW A;  3BG9 A;  4C2M J;  1S29 A;  2QQ8 A;  2QQ9 A;  4OAY A;  3J81 Z;  4Y3O A;  1WJA A;  1EH8 A;  2UUZ A;  4LD5 A;  5AIP A;  4ZC3 A;  3I58 A;  2M8G X;  2PN6 A;  2YU9 J;  2EIN H;  3WU2 C;  1Z7L A;  3E6C C;  3TMO A;  2WAQ A;  3ZMT A;  5ICG A;  1HDP A;  2R4G A;  4ZTF A;  4CCJ A;  5C4J J;  1KU3 A;  5HOD A;  2DXI A;  3E6M A;  2M3A A;  2XB5 A;  2KJC A;  4BE1 A;  2IBD A;  4D5F A;  2K40 A;  3BZ6 A;  1KQ9 A;  2HPI A;  2HTJ A;  2P5K A;  1VQ6 I;  1ETW A;  4MFE A;  3JSO A;  1YHQ I;  3UNG C;  1MMN A;  3PNT A;  4DJA A;  4LGW A;  4MQ9 F;  1S8N A;  1VQ5 I;  3JRF A;  3U2R A;  5JLW A;  3G1M A;  4P96 A;  4M3E A;  1IUY A;  2Q0O A;  1REP C;  5LGU A;  3QOE A;  2Y75 A;  1UFM A;  1A6I A;  2DA1 A;  3PQJ A;  2XGE A;  2R7W A;  2VKH A;  3P5J A;  3H1C A;  1V5E A;  1O3R A;  3ABT A;  3HDD A;  2QLZ A;  1WJF A;  2OAZ A;  5JFR A;  1ZTR A;  1ZRD A;  2ZXW H;  3BJA A;  2GA1 A;  4M3D A;  1H9T A;  5DYM A;  1U6G A;  2ISZ A;  3CDL A;  2ADU A;  2CQN A;  4G6D A;  2MH2 A;  4PFO A;  1IXR C;  1BOA A;  1WH7 A;  2L7Z A;  3LMM A;  1MBJ A;  5CQG A;  1TQI A;  2QZ8 A;  2CV2 A;  1QO0 D;  2P7C B;  2E36 A;  4E7L A;  2KRH A;  3LL7 A;  3GTM J;  3J80 K;  1RNL A;  3DKY A;  2O9L A;  1JUM A;  4RAZ A;  5F0C A;  4AIJ A;  5FB2 A;  1O57 A;  1V54 H;  3AG3 H;  3JTG A;  3QRF F;  3DFG A;  3WTV C;  1ETV A;  4FX0 A;  2WAD A;  2K3P A;  1Z67 A;  5M3F J;  1U5T A;  2Y0M A;  4ZYA A;  4OOI A;  3ZR8 X;  3P7N A;  4CCM A;  1QZY A;  2C6Y A;  5AIQ A;  4XBF A;  1T56 A;  4BBR J;  3DEU A;  1FMW A;  2L54 A;  1NK2 P;  1SFU A;  1XGO A;  2KZG A;  2X6O A;  2XDV A;  2CQQ A;  4DZJ A;  3E6B A;  4F55 A;  2K3F A;  2O0Y A;  1QPI A;  2JRT A;  2I8D A;  3RPU D;  5F64 A;  1VQO I;  1G8X A;  4OAZ A;  1J0R A;  2BW3 A;  3KZI C;  3JTH A;  1IV6 A;  2BBY A;  4M71 A;  4HA8 A;  1GVD A;  3D5S C;  1IZ1 A;  4BUP A;  4Y7N J;  4RAY A;  3KCC A;  3HSR A;  3M4O J;  2OF7 A;  1ON1 A;  1Z0X A;  5DDG A;  1U9O A;  5A2Q K;  1GT0 C;  1S7O A;  5FLX K;  3O3K A;  3QP5 A;  3RKX A;  4CDG A;  3Q0W A;  3CCU I;  3A2K A;  3FXL A;  3MFK A;  3CC7 I;  2VC0 A;  1VND A;  1R9T J;  1Y6I A;  3UR3 C;  1VFC A;  4RB1 A;  1VQK I;  1YOV B;  2JWT A;  2OCC H;  2ZNZ A;  2EIK H;  3E7L A;  1W7P A;  3BTJ A;  2ACJ A;  3EUK L;  3JCU C;  5LGN A;  3WG9 A;  3O2P E;  1KON A;  2J5O A;  5K5Q A;  5GPA A;  4LG0 B;  2Z33 A;  2AQF A;  1T38 A;  1QQI A;  1X1B A;  3ERM A;  4FT8 A;  2V1D A;  4CIC A;  5C4X J;  1R49 A;  2L9V A;  4GCV A;  4BDY A;  1D1A A;  3HRM A;  4EGZ A;  2BHY A;  1SD4 A;  2PJR B;  2OPT A;  3K2Z A;  4ZZL A;  3HHH A;  3T8R A;  3LA3 A;  1A04 A;  3DKX A;  2L9R A;  3C18 A;  2F4M B;  5B5E C;  5M5X J;  2DOD A;  4BHB A;  1CGP A;  4A0X A;  1VQ9 I;  4IHY A;  3DV8 A;  2PMH A;  1B72 B;  1WHU A;  3PIP F;  3WOD F;  2E5N A;  2E7X A;  3BR6 A;  3HRU A;  2E1M B;  3M8F A;  4XM3 A;  4MLO A;  4HNT A;  4FX4 A;  5GAD J;  2HYJ A;  4AVZ A;  2DI3 A;  2KRC A;  2LFB A;  2HQ5 A;  3IKV A;  5FKL A;  4G7Z F;  3S3O A;  3M9A A;  4XLE A;  4L18 B;  4KMF A;  5DUK A;  5FKK A;  2L5Q A;  1FSH A;  2BVL A;  1RKW A;  1DU0 A;  2A68 F;  2BVM A;  2M8E A;  2F4O B;  2PFB A;  4BHP A;  1FPQ A;  2M1B A;  5GAE J;  3N05 A;  3E5X A;  4D7N A;  1VQN I;  5AON A;  2VQC A;  4O6J A;  4EEF G;  5F04 A;  2R5Z B;  2JT1 A;  2PMZ N;  2V7F A;  1JTY A;  3ZXS A;  4RBO A;  2RGV A;  3FXJ A;  4UY8 I;  2V79 A;  3L7W A;  5IPA A;  2X1C A;  1NH3 A;  5J6X A;  5L3G A;  2P4W A;  2KIF A;  3Q0V A;  2N8G A;  3KP4 A;  1ZYR F;  2EK5 A;  4BL0 B;  1A31 A;  1LJ9 A;  2IA0 A;  2WY8 Q;  4KNY A;  1K79 A;  3B73 A;  4E7I A;  3SEQ A;  4O3M A;  3G2B A;  1O3S A;  2FQ3 A;  3CO6 C;  5KAF C;  2HYG D;  2L7M P;  4G7O F;  1IW7 F;  1LE8 B;  3OS0 A;  2DA3 A;  1BA5 A;  3TDZ C;  2EFQ A;  3PSF A;  4RMN A;  2XUB A;  2ZXH A;  1MMA A;  1IRG A;  2KIQ A;  2JUG A;  4IO9 F;  2RVC A;  4WXD A;  4E70 A;  4PJM A;  4KUM A;  4N9I A;  4RB3 C;  3H3U A;  2HXO A;  3IH4 A;  2EFN A;  3OS1 A;  1E3O C;  4KIC A;  3KET A;  2NXN B;  2QWW A;  4UB6 C;  1S7A A;  4BU2 A;  2HVQ A;  2DA2 A;  2QGU A;  3DEE A;  1S72 I;  1RUO A;  2CUE A;  5HDG A;  1W5S A;  1Q1H A;  2DO7 A;  2KZV A;  3SQN A;  4YIR X;  1BIA A;  5BOX A;  2ZNY A;  1USS A;  5IYB J;  5D8K B;  4XOR A;  2HOE A;  4LK1 F;  3HUG B;  4HF0 A;  3TGN A;  4P9U A;  4UV9 A;  3ABL H;  1Y0U A;  2P5V A;  2O6G E;  5LEK A;  3ABM H;  1WSU A;  2Y30 A;  1B59 A;  3DLA A;  3QOP A;  1ZLJ A;  2RRE A;  1E3P A;  3GZ5 A;  3WGH A;  2JA7 J;  2MFZ A;  3EDP A;  4XKV A;  3LSI A;  4Y13 A;  3ZP5 A;  4XON A;  1H0M A;  4BKX A;  2F6C A;  3GFI A;  3TQN A;  4YFX F;  4XR6 A;  4CZC A;  4ENJ A;  1Y39 A;  3ROU A;  1WH5 A;  4HG2 A;  2PMU A;  3TED A;  5IT3 A;  2Y2Z A;  3RQ4 A;  3V8L A;  3HSE A;  5BPI A;  2M45 A;  2HXI A;  2MLG A;  4IRG A;  4MGR A;  4CZZ A;  2LF7 A;  3RJP A;  4PSX A;  1KU7 A;  1OJL A;  5EEH A;  5CJ9 A;  5FRN A;  3I9V 2;  1BR1 A;  5K1Y A;  2NVY J;  2CW0 F;  3H0G J;  2LKS A;  1VTN C;  1SAN A;  3HYI A;  3JRI A;  5IYD J;  1DPR A;  2KIS A;  2FXA A;  3ABK H;  2LYC A;  4A3G J;  3P9I A;  1RUN A;  1B4A A;  1X3W B;  4XRF A;  2Y48 A;  4RGX A;  2BE5 F;  3ZMS A;  5BS6 A;  2IS2 A;  4KIB A;  2QCO A;  4MFD A;  4BQN A;  3HOW J;  1HW5 A;  4FHT A;  3K4C A;  2DJN A;  3BG3 A;  4PUS A;  3ZGK A;  1W0U A;  1MJB A;  3DTI A;  1S6L A;  2RC4 A;  1FOK A;  3V8J A;  1W1W E;  2VKD A;  3MD2 A;  3FWE A;  2GQQ A;  3T8T A;  1QPM A;  3MKL A;  1LFU P;  4AWX B;  4DYR A;  1OCT C;  2MSY A;  3G1O A;  4PCQ A;  3K4L A;  2PJR A;  2XAJ A;  1HDD C;  2V6C A;  3BTI A;  2H09 A;  1RC9 A;  5CVR A;  4V19 K;  5CLS A;  3SDB A;  1UST A;  5HDK A;  4DOZ A;  4HQM A;  3KZY A;  1OPC A;  4ZYG A;  4LIT A;  5JLX A;  2JVG A;  4HW0 A;  1I1S A;  2JSP A;  3GFM A;  1XG1 A;  2K86 A;  1XN7 A;  3A1Y A;  1LKX A;  3K2A A;  1A36 A;  2F5D A;  2JVH A;  4IHW A;  2V9K A;  1VQ7 I;  3J7A O;  3DQV C;  3F6V A;  2KKO A;  5ICC A;  3KEY A;  2CU7 A;  1ZGA A;  1O7L A;  1QHG A;  1BIB A;  2FQ4 A;  2DFI A;  5DCM B;  2DJI A;  4ESF A;  3OL4 A;  4L5I A;  3K6G A;  5D5W B;  3LSM A;  3FIW A;  4HV5 A;  2ME6 A;  4OIR F;  3LA2 A;  1KU2 A;  2VBY A;  4P9F A;  4NNJ A;  3FMR A;  4Q48 A;  2JPC A;  4A69 C;  5LHI A;  1WVR A;  2ICW G;  1ZR4 A;  2R5Z A;  6PAX A;  1N77 A;  4EMS A;  2FBK A;  3CCE I;  4BXF A;  2IAI A;  2W24 A;  2XGD A;  2XAU A;  3SZG A;  1MW7 A;  2NVQ J;  4YEJ A;  2KIU A;  4D9J A;  2L4M A;  2E1C A;  4ESB A;  4XKW A;  2D1V A;  2VUM J;  2X85 A;  1X4P A;  2I5U A;  3O8G A;  3UKG A;  2WAF A;  2XPV A;  3J80 Z;  2BV6 A;  4MO7 A;  2IS6 A;  2VBW A;  2M9H A;  2CUJ A;  4C3J J;  2COM A;  2IGM A;  2UWM A;  3EUA A;  2JPB A;  3GFJ A;  1ZGW A;  3BPX A;  3BY6 A;  3OMY A;  3WTW C;  3A01 B;  1VQP I;  1Y1W J;  1R5H A;  1QZZ A;  3FXM A;  4WXH A;  5J4Y A;  2ZJR F;  1JUP A;  4MHG A;  4AVP A;  3HOZ J;  3DPT A;  1V3F A;  2VT3 A;  4P1W A;  3WTT C;  3FHZ A;  3AKZ A;  3VOE A;  5F27 A;  4UUV A;  1UG2 A;  5FD6 A;  2WV0 A;  3BPV A;  3KZZ A;  1IXS B;  1J09 A;  1R5G A;  3KP5 A;  3ABU A;  1KU9 A;  3K1N A;  1T95 A;  3HUG A;  4HOB A;  2CG4 A;  1ETO A;  3OYK A;  4DZP A;  1U3E M;  3WTS C;  5EF6 A;  4IHX A;  3E97 A;  4DNC A;  3DCF A;  1P2F A;  1MH3 A;  1RZ4 A;  2YR2 A;  1UZC A;  3QWL A;  2OZ6 A;  4YII A;  3VYU B;  2RN7 A;  5A2Q Z;  2A5Y B;  1T98 A;  2QF7 A;  2HR3 A;  1D0X A;  3BOQ A;  3K7A J;  2FNP A;  3FXU A;  1HSJ A;  1SFO J;  3W6K B;  4ZDL A;  4U0V A;  5JR3 A;  5K5O A;  1XMA A;  3CC2 I;  3D5R C;  3FF5 A;  4JBA A;  2ETH A;  1IN6 A;  1ZHF A;  4II2 A;  3QYB A;  4KN4 X;  5EZG A;  2GXB A;  1FOW A;  1C0W A;  5HLG A;  1TW2 A;  4UV8 A;  2VIX A;  1KQ8 A;  3ZQ7 A;  3PO3 J;  4C30 A;  3RIR A;  2NYX A;  1R00 A;  3ZQI A;  1TWC J;  2OU2 A;  4GGG A;  2VQG A;  2ZJP F;  2H1K A;  4LIU A;  3DBR B;  3O6B B;  2JMW A;  5HLT A;  3PNY A;  3GBG A;  3MKW B;  1YE9 A;  5DS9 A;  3J7Z I;  4L0Y B;  2BZT A;  3D5L A;  4FAS D;  2YPR A;  1DGR M;  4AD9 A;  2MYS A;  2DQL A;  1Z7U A;  4JP0 A;  1P7J A;  2VJJ A;  3LWF A;  3GYH X;  4M74 A;  4F92 B;  2R0Q C;  1XSV A;  5ICF A;  1FC3 A;  2JUC A;  3OL3 A;  5HNF A;  2LH9 A;  4XQF A;  4HX7 A;  1Z3X A;  4QSH A;  3FXO A;  4JYK A;  2HNH A;  3R6S A;  4OU0 A;  1XDU A;  5L3B A;  1BC7 C;  4JX4 A;  3ERE D;  2VQL A;  2DFE A;  3SDG A;  1FYK A;  2STT A;  1EA3 A;  3QYE A;  2FNA A;  2CV1 A;  5GAH J;  1HW1 A;  1XB4 A;  1DP7 P;  2VE9 A;  1TT5 B;  2F5C A;  1J2X A;  1I6X A;  1LDD A;  3I4P A;  5D4R A;  2ZME C;  1F5T A;  4I99 C;  3HRS A;  1G6N A;  3OIQ A;  3WGG A;  3BZC A;  3TP0 A;  4DBQ A;  4QLC U;  1HBX G;  3PQK A;  3A4C A;  3HIF A;  3VB2 A;  3ZN0 A;  3ZRG A;  1T08 B;  1FLI A;  2VXZ A;  1ZRC A;  2NS0 A;  4FTH A;  2E2I J;  2VAS A;  2O8K A;  4R8H A;  2RQQ A;  3J7Y J;  4RB2 C;  3GZ6 A;  2R7Z J;  4Y15 A;  2PMZ A;  3TL4 X;  1AA7 A;  5M3M J;  4C2U A;  2R7Q A;  3EUH C;  1JUS A;  3ISP A;  4CO8 A;  4U87 A;  1VI0 A;  5DEQ A;  2CWE A;  5FFX A;  1K4T A;  2GOX B;  5E3N A;  1XDS A;  3RKY A;  3PO2 J;  3A03 A;  2IW5 A;  4HNU A;  1WPK A;  2DDA A;  3S15 J;  5FKO A;  3JRG A;  3KLO A;  2HKO A;  2R7D A;  1U78 A;  2VL8 A;  1XCV A;  2DFH A;  3RKW A;  2M87 A;  3CTA A;  3JRD A;  2JQ7 A;  3QYF A;  4M73 A;  3ZQH A;  1G4D A;  2OQG A;  4PK4 A;  1E2X A;  3CD6 I;  2ESH A;  4JK1 X;  4Y17 A;  3DWL E;  3L2V A;  1FBS A;  4B48 A;  4M9S A;  2IPQ X;  2OD5 A;  2ZJ2 A;  5E3M A;  1P4A A;  2A6E F;  1V5F A;  1XSX A;  3LSK A;  1EF4 A;  3N97 A;  4U0W A;  1HC8 A;  1NG6 A;  3FK6 A;  1F36 A;  4ZJZ A;  5TRD A;  2V1U A;  4WWC A;  1BR2 A;  2NVU B;  1YIO A;  3A01 A;  1LDJ A;  2XAS A;  2EH3 A;  1FYL A;  5K7Z A;  4BJ5 C;  4EAT A;  2D2W A;  2BY0 A;  4KFC A;  1JJ6 C;  1FNN A;  3CP8 A;  1FWZ A;  1DP3 A;  2XV4 S;  1XS9 A;  2LD5 A;  3M07 A;  3W2W A;  4NQW B;  5M5W J;  4B43 A;  4X1E A;  1PJR A;  4BE0 A;  4L5E A;  1YIJ I;  3MEX A;  3NEU A;  3BR2 A;  3VOD A;  3LST A;  3FM3 A;  2BY2 A;  1YLF A;  2XC7 A;  3WTZ A;  4BNC A;  3K0L A;  2ZFU A;  1MZB A;  1Z6R A;  4PSW A;  4S0H B;  2W82 A;  2K9L A;  2VC1 A;  3ZMU A;  1Q1V A;  1ITY A;  3RYP A;  3I53 A;  1V4R A;  1MMG A;  2HQR A;  3ECH A;  3S8P A;  1ZG1 A;  2NAZ A;  1K6O A;  4IL6 C;  3CCV I;  2GAU A;  4C9Y A;  1ETX A;  5DV5 A;  5FLV A;  5JVT A;  3OYG A;  2ZJQ F;  2FBI A;  1JGG A;  2JZY A;  4G9Y A;  1RKT A;  3G1L A;  1XMK A;  3GME A;  3DPU A;  2LF8 A;  4A3I J;  3ZPL A;  2NS7 A;  5FJ8 J;  2K85 A;  3CP2 A;  4KIS A;  2EB7 A;  4IRH A;  1UHW A;  2HU9 A;  1A6Q A;  1TL8 A;  3I5U A;  3KLN A;  3IKT A;  3Q3S A;  2XSJ C;  2FF4 A;  2W85 A;  3MQ0 A;  1K83 J;  1MDM A;  5DM7 F;  3GX4 X;  3JR9 A;  4L5J A;  3MCZ A;  4G12 A;  1J59 A;  2WY7 Q;  4PJ0 C;  1N75 A;  3TOB A;  4XNF A;  3LAJ A;  2V1X A;  1K78 B;  4BQQ A;  1IV8 A;  1LPQ A;  2B63 J;  4A3B J;  4B8X A;  3C7J A;  4YEL A;  3JRC A;  1IJW C;  2XKP A;  3A0H C;  2R7X A;  1FX7 A;  3S2H J;  1Z21 A;  4PJJ A;  4F52 A;  5E3O A;  3WU1 B;  1P4X A;  4FE4 A;  5E20 A;  3DLL F;  4PGG A;  3MZH A;  1SD6 A;  2DK5 A;  2B9S A;  1JHF A;  4U7D A;  4L9V A;  4J01 A;  3S1Q J;  4DGW B;  4EGY A;  1B9M A;  1HW2 A;  5FRM A;  1GVJ A;  4BE2 A;  1Z1D A;  2K5C A;  5E8I A;  3U1D A;  4HX8 A;  3H92 A;  1IN4 A;  2EA4 A;  2HQN A;  1R5I D;  3OYF A;  1FIP A;  3B6C A;  3CUQ C;  1LUJ B;  1ZAO A;  2DCE A;  5FGM A;  4CA0 A;  1OR7 C;  2Y9Z A;  3ZN1 A;  2DT6 A;  3OYD A;  4B47 A;  2EWN A;  3CO7 C;  2P7V B;  1EH6 A;  1Z05 A;  3BQY A;  4I02 A;  4UVB A;  2LG4 A;  3CCY A;  1FZP B;  4NB5 A;  4OIQ F;  1A5J A;  2DOF A;  3PFI A;  1UEL B;  1IDZ A;  2F5V A;  4L9N A;  3BRO A;  3H9Q A;  3NAR A;  2ZKZ A;  2H6B A;  3LSJ A;  3OY9 A;  4I01 A;  2Q8K A;  3RI4 A;  2COB A;  4FE7 A;  5J8F A;  4KIG A;  3BLY A;  3WHB A;  2ELK A;  3COA C;  1NG7 A;  2DT5 A;  1S5L C;  3IAM 2;  3KYD B;  5L3F A;  2DPU A;  3CJR B;  2EFW A;  3HTU A;  1TZL A;  1X58 A;  4XRS A;  3IL2 A;  3HSF A;  3ZQG A;  4IPA A;  1R1U A;  1FT9 A;  3OV8 A;  4XMY A;  4UUT A;  2FEZ A;  3E5U A;  2KJB A;  3KPH A;  2E35 A;  5CYV A;  2TDX A;  1RR8 C;  2DPD A;  3HXL A;  3AL0 C;  4QWQ A;  2F4I A;  2LOO A;  1RR7 A;  3K4J A;  2HDD A;  2PLY A;  4L9J A;  4AIK A;  2P5L C;  1EKE A;  4WK8 F;  3T1B A;  5IOY A;  2V26 A;  2IA2 A;  1YJN I;  4OIO F;  1FIA A;  4RAF A;  2PJP A;  1V55 H;  2H1L A;  5FO5 A;  4CYD A;  2K4J A;  1G3W A;  1D0Z A;  1FTZ A;  1YG2 A;  4RM2 A;  2UXN A;  2DU9 A;  1Z9C A;  5C3E J;  5ILV A;  3BG6 A;  1GXP A;  1OYW A;  1HKS A;  3HKZ N;  2K27 A;  1K6Y A;  4HQE A;  1OCZ H;  3IH3 A;  3H3V K;  4AC0 A;  1VF9 A;  2QQA A;  4U0Y A;  2AS5 F;  4M3G A;  1R23 A;  5JHU A;  2W4S A;  4XK4 A;  2G7H A;  4IOC F;  2L3D A;  3BDD A;  2M4G A;  4I7H A;  2LKP A;  4MQV A;  2TCT A;  4CSW A;  2HYF A;  4U7B A;  4Q47 A;  3LA7 A;  2QUF A;  4IRI A;  1SFK A;  1HKQ A;  4YFK F;  2X0L A;  5KAI C;  4NQW A;  3RKQ A;  1T0F C;  4EM2 A;  2JN6 A;  5KNL A;  3EYI A;  1ERD A;  4LOC A;  3Q9V A;  1K61 A;  1T2K A;  2K9S A;  2XGC A;  3SEZ A;  4ESJ A;  3CLO A;  2VBZ A;  2QKM B;  3RYR A;  3A0B C;  2DN0 A;  4HYE A;  4CYC B;  2ISY A;  4IHT A;  3BCA A;  4MEX F;  2VOD A;  2M0M A;  5EZH A;  5ILU A;  2XB0 X;  2K9M A;  2W00 A;  3F8F A;  4G8X A;  2KDO A;  3E0J B;  4XOP A;  3VPR A;  5DTD A;  4RDU A;  1FOY A;  3KX2 A;  4B3X A;  1JJ8 C;  1HCR A;  2VT2 A;  4G6T B;  2R3S A;  2LBF B;  2K9N A;  3KP6 A;  3KIO A;  4HST A;  2LVS A;  3RCO A;  3BJ6 A;  2CYY A;  2M4K A;  3FZV A;  2HFH A;  5B1B H;  1TQP A;  3RDI A;  2Y0S A;  4FQG A;  2KIM A;  2R93 J;  5F1R A;  4BAY A;  4KJZ A;  2Z99 A;  2NOG A;  4BS9 A;  1K78 A;  2EZI A;  3EPZ A;  3X2Q H;  1B8I A;  1RRJ A;  2Z3Y A;  1SVM A;  4XKC A;  2ELH A;  3F3X A;  4BJT A;  3EQL F;  2X1E A;  1WFX A;  3WE3 A;  2VKE A;  3GTP J;  1XCB A;  5H6Q A;  4D0P A;  1LFP A;  3C2H A;  2HOT A;  1X1C A;  2Z16 A;  3H36 A;  5CVV A;  2RAE A;  5CVU A;  3U1K A;  3S3N A;  5FLM J;  2NS8 A;  4EJU A;  3AAF A;  3QPH A;  5DD8 A;  2HOA A;  4NBQ A;  1OCP A;  4E7Z A;  2CSO A;  3HB9 A;  5H2F C;  1L3L A;  2E71 A;  2M5W A;  1I50 J;  1WRJ A;  4V2F A;  4KMU X;  3HEF A;  1MMD A;  2QSF X;  2XF5 A;  4V2G A;  4XRM A;  2R7F A;  1LB2 A;  5HLI A;  1OCR H;  5J3L A;  2DMU A;  3HRT A;  1FBQ A;  2Z9O A;  2X6Y A;  3H35 A;  1ON2 A;  1TQM A;  1U8R A;  2MAB A;  3B6A A;  2XF6 A;  1WI9 A;  3H5A A;  4M6V A;  3DTK A;  3K1P A;  3OYN A;  2HEO A;  2EA2 A;  3S16 J;  2E60 A;  2XAF A;  4BYY A;  4RB0 A;  1N25 A;  2LY1 A;  4HBL A;  3A02 A;  1DPU A;  4LIV A;  3TO9 A;  1X2M A;  1U8B A;  4IQJ A;  3MMY B;  5JHF A;  3LFK A;  4XIC A;  1RIO H;  4PFP A;  1ZRF A;  2HI3 A;  3C3W A;  3O8H A;  3F8B A;  4AYB N;  3TKY A;  1A35 A;  4M9X A;  3W2V A;  2VBX A;  2WA0 A;  3M8E A;  3K1M A;  4HEA 2;  1WJC A;  1LQ1 A;  1LEB A;  2JK3 A;  2MD5 A;  4CGZ A;  1MMS A;  2FRH A;  1JKQ C;  3JRH A;  4BXU A;  1JE8 A;  3ZQQ A;  3W6V A;  3FXR A;  3U21 A;  5KCM A;  3VEP A;  1PVE A;  3LOC A;  5BMZ A;  1G3Y A;  2PG4 A;  2QQB A;  2L0K A;  4S04 A;  5LBQ A;  1TBX A;  1Z3Y A;  1QGP A;  2FE3 A;  1F43 A;  3TW7 A;  4X0G A;  2ZXJ A;  2MD0 A;  3BC8 A;  1D5Y A;  1W4M A;  2LLK A;  2IXS A;  1FOX A;  4WCG A;  2VOP A;  2WWY A;  2DDB A;  2VPL A;  1P92 A;  1BI0 A;  1MBF A;  2L7F P;  3R61 A;  3HGG A;  4I0A A;  1WJ5 A;  3MN2 A;  2TRT A;  2H8R A;  2HDC A;  1XGN A;  2HDW A;  2JA8 J;  3MWM A;  4CH7 A;  3H9J A;  1FP1 D;  2QEX I;  3PUF A;  1LDK B;  3G73 A;  4HAM A;  1T39 A;  3IV5 A;  4FIS A;  4LK0 F;  1YW9 A;  2DLL A;  3ONQ A;  1SD7 A;  4ZH4 F;  2LNB A;  5LHH A;  2JJ7 A;  3HJE A;  4PJN A;  4WXC A;  4ASN A;  4AIH A;  4MIM A;  3DBH B;  1SVO A;  3ULQ B;  2HGC A;  2EV5 A;  3E1S A;  4LLL A;  4EJT A;  5GTH C;  5GP9 A;  2LRE A;  2OA4 A;  2BYV E; 
#chains in the Genus database with same CATH homology
 3TP0 A;  1ETQ A;  3TP3 A;  1WGX A;  2ID3 A;  1JKP C;  1ETV A;  5FKN A;  5GPC A;  3JRE A;  1O4X A;  5M3F J;  2E2I J;  4FTH A;  2LP0 A;  1X2N A;  1IUF A;  3QPL A;  4CYC A;  2O8K A;  3ZQF A;  2E19 A;  2DA4 A;  3BR3 A;  5J1R A;  4BXX J;  2R7Z J;  1DU6 A;  1T56 A;  4BBR J;  5C44 J;  5M3M J;  3LSP A;  1JUS A;  1NK2 P;  3HOX J;  1VI0 A;  2X6O A;  2CQQ A;  4DZJ A;  3HOU J;  1QPI A;  5F0H A;  5E3N A;  3S1R J;  3PO2 J;  3A03 A;  4B3A A;  2XPW A;  1IV6 A;  1WPK A;  3S15 J;  5FKO A;  3JRG A;  1AHD P;  1GVD A;  3IH2 A;  2EZH A;  1U78 A;  4Y7N J;  2KT0 A;  1JT0 A;  1GV5 A;  2WAQ N;  2OF7 A;  3M4O J;  1Z0X A;  3JRD A;  1U9O A;  4IEJ A;  3ZQC A;  1GT0 C;  3FK7 A;  2MW8 A;  3ZQH A;  2R5Y B;  2LKX A;  1ORK A;  2EZL A;  5F1J A;  4A3F J;  1JKO C;  3JRB A;  3Q0W A;  5EG0 B;  1MNM C;  1VND A;  1R9T J;  1U9N A;  1VFC A;  5IP7 J;  2JWT A;  1H89 C;  1GV2 A;  3E7L A;  5E3M A;  4QIW N;  2XRL A;  3BTJ A;  1EF4 A;  2G0E A;  3LSG A;  3FK6 A;  1F36 A;  5GPA A;  3FKI J;  1I6H J;  2NVT J;  4C3H J;  3A01 A;  2EH3 A;  5C4X J;  2GM4 A;  4X6A J;  5K7Z A;  1JJ6 C;  2CQX A;  4JX6 A;  1TWH J;  4UUS B;  3RZD J;  2OPT A;  1XS9 A;  2E1O A;  1AU7 A;  2LD5 A;  4QTR A;  3BTC A;  5M5W J;  4X1E A;  2L9R A;  4L5E A;  5M5X J;  3BR2 A;  1JT6 A;  4IHY A;  1LFB A;  3GTQ J;  1B72 B;  3BR6 A;  5BNG A;  4S0H B;  1HLV A;  1ITY A;  4JX5 A;  1Q1V A;  4MLO A;  1IDY A;  5F0F A;  3GTO J;  1MH4 A;  2HYJ A;  1W0T A;  2CRG A;  1QRY A;  2LFB A;  3ZQL A;  2HQ5 A;  5FKL A;  3D1N I;  1ETX A;  5FLV A;  1GUU A;  1JGG A;  1RKT A;  1QVT A;  3G1L A;  3GTJ J;  3C2B A;  1ETK A;  4D5C A;  4J19 A;  5FKK A;  5EGO B;  2XPU A;  1RKW A;  1DU0 A;  4A3I J;  2ZB9 A;  2NS7 A;  5FJ8 J;  2FJ1 A;  4UUS A;  1XC5 A;  1AKH B;  2FX0 A;  3QPS A;  2DMT A;  4BY7 J;  4D7N A;  4EEF G;  2R5Z B;  5F04 A;  2PMZ N;  1JTY A;  1Z77 A;  3Q3S A;  3BG5 A;  4RBO A;  1K83 J;  1MSE C;  3JR9 A;  4G12 A;  5IPA A;  1B72 A;  2YS9 A;  3Q0V A;  2N8G A;  2X9D A;  1MBG A;  2B63 J;  4D7M A;  4A3B J;  3JRC A;  3MVP A;  1MBK A;  1IJW C;  2CJJ A;  2GLO A;  3S2H J;  4NDL A;  1RET A;  2I10 A;  5E3O A;  3ZOB A;  2L7M P;  4FE4 A;  1LE8 B;  1BA5 A;  2DA3 A;  1T33 A;  3S1Q J;  4B1R A;  3NAU A;  2VPR A;  3HOV J;  2ECB A;  1PUF A;  2HXO A;  3IH4 A;  1AKH A;  2Y9Y A;  2WB1 N;  4C3I J;  1E3O C;  2M34 A;  3GTL J;  3OSF A;  3F0C A;  2DA2 A;  3Q0U A;  2CUE A;  1FIP A;  2M2E A;  2MG4 A;  2JA6 J;  3OIO A;  3B6C A;  1TWG J;  2P81 A;  3RZO J;  2Y9Z A;  2CUF A;  2JA5 J;  5IYB J;  3LNQ A;  1G2H A;  1IGN A;  3BQY A;  3CCY A;  3CMY A;  3BR1 A;  1A5J A;  1NTC A;  1LE8 A;  3L1P A;  2Y30 A;  5IYC J;  1IDZ A;  1YRN B;  4M3F A;  4Y52 J;  1GDT A;  1BW5 A;  3NAR A;  2JA7 J;  3LSJ A;  2X48 A;  2COB A;  4FE7 A;  2R92 J;  2WV1 A;  1CQT A;  3WHB A;  2ELK A;  4BKX A;  3DEW A;  1WH5 A;  3BR0 A;  3TED A;  1MSF C;  1X58 A;  3HGY A;  2Y2Z A;  4XRS A;  3ZQG A;  5FKM A;  1APL C;  4UUT A;  3CQZ J;  2HXI A;  5EDN A;  5EEA A;  3S17 J;  1HOM A;  2FD5 A;  1RR7 A;  2HDD A;  1OJL A;  1S7E A;  2LY9 A;  2NVY J;  5IOY A;  2E2J J;  3H0G J;  1FIA A;  1FJL A;  1SAN A;  2R5Y A;  3JRI A;  5IYD J;  1MBH A;  1FTZ A;  5EG0 A;  5E3L A;  4DYQ A;  2DA6 A;  2IEK A;  1WCM J;  2GBY A;  4A3G J;  2YUS A;  5C3E J;  1MBE A;  2QCO A;  4MFD A;  3HOW J;  3HKZ N;  4XRS G;  5IP6 A;  2DMN A;  4I76 A;  2DJN A;  3IH3 A;  2XSD C;  3H3V K;  4AC0 A;  1FEX A;  3BG3 A;  1VF9 A;  1W0U A;  1POG A;  4BY1 J;  4M3G A;  4XK4 A;  2LTP A;  1NK3 P;  3MKL A;  1LFU P;  5J1U A;  4A3M J;  3HBL A;  4DYR A;  1OCT C;  2MSY A;  3G1O A;  2DA7 A;  4HNV A;  2TCT A;  1HDD C;  1ZKG A;  3BTI A;  4GFB A;  3BTL A;  3RQI A;  3RKQ A;  2JN6 A;  5JLX A;  3BQZ A;  2Y0S N;  4LOC A;  1QVU A;  1K61 A;  2K9S A;  1XG1 A;  2ECC A;  2XGC A;  1Y1V J;  3K2A A;  1B8I B;  5M5Y J;  4IHW A;  3S14 J;  3OSG A;  3FIS A;  2DN0 A;  4CYC B;  3I4N J;  2CU7 A;  5IP9 J;  1BL0 A;  4DW6 A;  5EZH A;  2FQ4 A;  1H8A C;  2XB0 X;  4W97 A;  3HM5 A;  1BW6 A;  3VPR A;  2Y31 A;  4FCY A;  5DTD A;  4RDU A;  3FIW A;  2AO9 A;  5EGO A;  1JJ8 C;  1HCR A;  2K9N A;  2ME6 A;  2K9Q A;  5IOZ A;  3WHC A;  2LVS A;  4A69 C;  1ZR4 A;  3GTG J;  2R5Z A;  3QQA A;  2D5V A;  2R93 J;  2IAI A;  2XGD A;  1WI3 A;  4A3C J;  2NVQ J;  1TC3 C;  2NOG A;  1UHS A;  2EBI A;  1ZK8 A;  3TW6 A;  2EZI A;  3PM1 A;  1B8I A;  5K7H A;  2EZK A;  2MGQ A;  2ID6 A;  2VI6 A;  2VKE A;  4A3E J;  4IHV A;  3GTP J;  1H88 C;  2HOT A;  2VUM J;  3S1M J;  1P7I A;  3O8G A;  3UKG A;  1FTT A;  2RAE A;  9ANT A;  2XPV A;  4MO7 A;  5FLM J;  1I3Q J;  2NS8 A;  5F08 A;  2M9H A;  4C3J J;  5K7F A;  1RES A;  2HOA A;  4A3D J;  4ABZ A;  1ZGW A;  1OCP A;  4B4C A;  4A93 J;  3HB9 A;  4M3B A;  3SJM A;  1IG7 A;  3A01 B;  2O7O A;  1I50 J;  1Y1W J;  4A3J J;  1JKR C;  3S1N J;  1UMQ A;  1JUP A;  4V2F A;  3GTK J;  3HOZ J;  3HEF A;  4V2G A;  4XRM A;  1ENH A;  2DMQ A;  5J1Y A;  5F27 A;  1UG2 A;  1RPW A;  5J3L A;  1TWA J;  2DMU A;  2LK2 A;  4DYC A;  4A3K J;  2ME0 A;  4I6Z A;  3B6A A;  1HF0 A;  4A3L J;  4M6V A;  2EQR A;  4AUX A;  1ETO A;  4DZP A;  3S16 J;  1ETY A;  2VKV A;  1IRZ A;  5EF6 A;  4IHX A;  3DCF A;  3A02 A;  3BT9 A;  1YRN A;  1MH3 A;  1X2M A;  1U8B A;  3BG9 A;  3SFI A;  4XIC A;  4C2M J;  1BJZ A;  2HI3 A;  2QF7 A;  3K7A J;  3O8H A;  4AYB N;  5EYR A;  2M8G X;  2YU9 J;  2KDZ A;  1SFO J;  1HDP A;  3LSR A;  2JK3 A;  3I4M J;  5C4J J;  4XID A;  1JKQ C;  3JRH A;  5HOD A;  5EZG A;  2E2H J;  3W6V A;  3HOY J;  2XB5 A;  2IBD A;  4D5F A;  2K40 A;  3LOC A;  2LR8 A;  3PO3 J;  1ETW A;  2DMP A;  2L0K A;  4MFE A;  3ZQI A;  1F43 A;  1JTX A;  1TWC J;  2DTZ A;  2H1K A;  3TW7 A;  1ZR2 A;  2AHQ A;  3M3Y J;  3JRF A;  2JMW A;  5JLW A;  3G1M A;  1TWF J;  2HOS A;  3BR5 A;  3GBG A;  4M3E A;  1D5Y A;  5DS9 A;  2LLK A;  2L7F P;  1A6I A;  1MBF A;  2DA1 A;  2XGE A;  3HGG A;  2DA5 A;  2W48 A;  1P7J A;  4JP0 A;  4BBS J;  3HDD A;  3MN2 A;  1ZTR A;  2TRT A;  1PUF B;  2R0Q C;  2H8R A;  2NVX J;  2JA8 J;  4M3D A;  1OFC X;  4QSH A;  3IV5 A;  4FIS A;  4JYK A;  3CDL A;  4JX4 A;  2M0C A;  1WH7 A;  2L7Z A;  3JRA A;  1MBJ A;  3SDG A;  2JJ7 A;  4W1U A;  4MIM A;  3GTM J;  1ZQ3 P;  2O9L A;  5GP9 A;  1JUM A;  3S2D J;  5F0C A;  1IC8 A;  3OOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...