1H8AC

Crystal structure of ternary protein-dna complex3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
105
structure length
105
Chain Sequence
NPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
total genus 33
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2001-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h8aC01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h8aC02
1PUFB 3FK6A 3JRIA 3IH2A 1WCMJ 5E3LA 1IC8A 1ZTRA 2DMTA 2LKXA 1X2NA 2I10A 4M3EA 2W48A 3FIWA 4FE7A 4A69C 3S17J 1EF4A 5EGOB 4I76A 2LY9A 3HKZN 4NDLA 3S14J 3E7LA 2HOSA 3OSFA 2NOGA 4BBRJ 1AKHB 3HGYA 1R9TJ 3GTOJ 2M0CA 3ZQCA 4JX4A 2VPRA 2Y0SN 3S1MJ 3JRFA 3SJMA 1HCRA 4B1RA 1GV2A 2XRLA 3TP3A 5J3LA 5FKOA 5C3EJ 1I50J 3ZOBA 2O8KA 1IRZA 1GUUA 3S1RJ 5DTDA 4B3AA 5E3OA 1S7EA 5E3MA 1Q1VA 5EEAA 2QCOA 5IPAA 1GDTA 1ETOA 1TC3C 1NK3P 1JUSA 4A3EJ 2LP0A 2NS8A 4MO7A 5IYDJ 2CUFA 2HYJA 5C4XJ 2COBA 2JA5J 2WV1A 2VKEA 1RR7A 5EG0A 3BTCA 1X2MA 3JRAA 4M6VA 1RETA 1TWFJ 2WB1N 2XPVA 1UHSA 2Y9YA 3HB9A 3JR9A 2CQXA 1AKHA 1LE8A 2ME6A 2DA4A 1B8IB 3LSRA 2OF7A 1HDPA 1HDDC 1BW6A 1I6HJ 1ZKGA 3HOUJ 3NARA 5FKKA 3A01A 5GPAA 2L7FP 3HEFA 5E3NA 2DA1A 2MG4A 4C3IJ 2HI3A 2HDDA 5J1RA 4G12A 3W6VA 2Y31A 4W97A 3O8HA 2E2JJ 3A02A 2R5YB 3K7AJ 3CCYA 4AC0A 3HOYJ 5K7FA 3VPRA 3A03A 1IGNA 1LE8B 2L7MP 5M5XJ 4C3JJ 2HXOA 4X6AJ 1POGA 3HOXJ 1H88C 1GV5A 2E2HJ 2DA5A 2X48A 1H8AC 4MFEA 3CQZJ 1XG1A 1RPWA 3SFIA 1ETYA 2YU9J 2DN0A 2YS9A 1JKRC 1BJZA 4BY7J 3Q0WA 2LD5A 1NK2P 3BQYA 5EG0B 2K40A 2P81A 5F27A 5F0HA 3GTMJ 3GTGJ 3TP0A 3S2HJ 3BTLA 1X58A 2JA7J 2XGCA 4CYCA 5EF6A 3BR5A 4FTHA 2GM4A 2DA6A 1MNMC 3B6AA 3HOVJ 1ITYA 5F0FA 1QVUA 1QVTA 5FKNA 3MKLA 1F43A 1MSFC 1ORKA 2DJNA 5K7ZA 1JTXA 5IP9J 1IUFA 1TWCJ 4W1UA 5JLXA 4HNVA 5GP9A 3BTJA 4UUTA 4EEFG 2ELKA 1JJ8C 5IP7J 1GT0C 3S15J 3FKIJ 4B4CA 3F0CA 1IJWC 3BT9A 3LOCA 5HODA 1MBFA 3NAUA 3O8GA 1B72A 4IHVA 1RKTA 2EZLA 3BR3A 1VNDA 1IG7A 5EGOA 3IV5A 4JX6A 4D5CA 4I6ZA 1U78A 3BR0A 4M3FA 4BY1J 2KDZA 3ZQFA 3I4MJ 1P7JA 2M8GX 4FCYA 5DS9A 4MFDA 2LVSA 1SANA 1TWGJ 5IP6A 4XRSG 3LSGA 2NVYJ 5JLWA 1K83J 3BQZA 4JX5A 1OFCX 4UUSB 2Y9ZA 5EZHA 2YUSA 3G1MA 5C44J 4D7MA 4BXXJ 3K2AA 1UMQA 1ETKA 4S0HB 2K9QA 1XS9A 1WH5A 3Q0UA 4D7NA 3S16J 4DZPA 2MSYA 3QQAA 3IH3A 1LFBA 1ZK8A 3HM5A 2K9SA 5M5WJ 4A3GJ 5IOZA 2R0QC 2DMQA 3HBLA 1U9OA 4XRMA 4D5FA 2JWTA 2MGQA 3TEDA 2JA6J 4LOCA 2DA7A 3S1NJ 2DMUA 4GFBA 3BTIA 3ZQLA 2LR8A 2DA2A 3JRDA 2CUEA 4JP0A 5EYRA 4Y7NJ 2E19A 5GPCA 2G0EA 1JUPA 5IYCJ 4AUXA 1FTZA 1T33A 5F1JA 3BR2A 3OSGA 3BG3A 1TWAJ 4A3IJ 1ETQA 4A3KJ 2XGDA 4A3MJ 1DU6A 4DW6A 2R7ZJ 1WPKA 2JK3A 3OOUA 3RQIA 2X9DA 5J1YA 1QRYA 1UG2A 2ECCA 1T56A 2M2EA 4RBOA 2DA3A 4BKXA 2M34A 2DMNA 1JT0A 1A5JA 4A3JJ 3RZDJ 5FJ8J 2VUMJ 4A3LJ 1OJLA 3D1NI 1BW5A 1ZR2A 4QIWN 1QPIA 3B6CA 5F04A 4IHWA 4QSHA 2FQ4A 3L1PA 3JRHA 1MH4A 3WHCA 2X6OA 3JRBA 4V2GA 4DZJA 3C2BA 1HF0A 2K9NA 3UKGA 2EQRA 1FEXA 1D5YA 1W0TA 2XB5A 4XRSA 3GBGA 4XK4A 1JT6A 1I3QJ 2O7OA 1CQTA 2ID3A 3Q0VA 2WAQN 2B63J 2XSDC 1PUFA 2VI6A 1FIAA 5FKMA 1JKQC 1OCPA 1AHDP 1OCTC 2TCTA 2EZHA 3S2DJ 2GBYA 1BA5A 3H3VK 4DYCA 1FJLA 3S1QJ 3QPSA 3Q3SA 3SDGA 2R92J 1B8IA 1MBGA 5BNGA 1HLVA 1WH7A 2TRTA 2EZIA 1JTYA 3TW7A 4QTRA 3HOWJ 1ZR4A 5IYBJ 4IHYA 1MSEC 1FIPA 1APLC 2ME0A 3FK7A 4C3HJ 1ZQ3P 3HOZJ 2M9HA 1U8BA 3MVPA 2FX0A 3JREA 4BBSJ 3CMYA 2EBIA 4A3CJ 3GTQJ 2HQ5A 5C4JJ 1YRNA 2JMWA 2XPUA 4A3BJ 1VI0A 3M4OJ 2H1KA 5K7HA 2R93J 5F08A 2XGEA 2HOTA 1ZGWA 2HOAA 2NVTJ 3TW6A 1LFUP 2JA8J 1RKWA 2N8GA 3ZQHA 5EZGA 2XPWA 3BR1A 3LSJA 1Y1VJ 2Y2ZA 3LSPA 2DMPA 1VF9A 3HGGA 4A3DJ 4J19A 5FLMJ 3FISA 2R5ZB 2OPTA 4FE4A 2LTPA 4M3GA 3GTKJ 5F0CA 1U9NA 2JN6A 2L9RA 4CYCB 1IV6A 1Z0XA 3DEWA 2JJ7A 2AO9A 4A93J 2FJ1A 4UUSA 2GLOA 1Y1WJ 4L5EA 3ZQIA 2CQQA 2EH3A 1SFOJ 3I4NJ 1XC5A 4IHXA 1MBHA 1K61A 1MBKA 5M3FJ 5FLVA 1B72B 1NTCA 4ABZA 3RZOJ 1WI3A 5M3MJ 2MW8A 2CJJA 2O9LA 1JKPC 1AU7A 1Z77A 3HDDA 2E1OA 4M3DA 3DCFA 2PMZN 2IAIA 4XICA 3BR6A 1HOMA 2CRGA 2ZB9A 2QF7A 4M3BA 2R5YA 1MBJA 4C2MJ 3M3YJ 2DTZA 3PM1A 2CU7A 4V2FA 3RKQA 1JUMA 2Y30A 2AHQA 1FTTA 3ZQGA 2ECBA 3PO2J 1JKOC 2LK2A 1E3OC 3CDLA 1H89C 4AYBN 1W0UA 5M5YJ 1F36A 3IH4A 1IDYA 2L0KA 4FISA 3WHBA 1ETXA 1TWHJ 2HXIA 2XB0X 4Y52J 2E2IJ 2EZKA 2L7ZA 3GTLJ 5EDNA 2IEKA 4IEJA 1VFCA 3GTPJ 2LFBA 2NS7A 1JGGA 3BG9A 3MN2A 1MBEA 1A6IA 2H8RA 1JJ6C 1DU0A 1P7IA 1ETVA 2VKVA 3QPLA 2R5ZA 1ENHA 3JRGA 5IOYA 4DYRA 3LNQA 2FD5A 1BL0A 4MLOA 2NVQJ 3H0GJ 2D5VA 4DYQA 4XIDA 2ID6A 3G1LA 5J1UA 2LLKA 3OIOA 2IBDA 1G2HA 4MIMA 3A01B 3G1OA 4X1EA 4A3FJ 2NVXJ 1WGXA 2RAEA 1GVDA 1MH3A 2KT0A 9ANTA 1RESA 4RDUA 3JRCA 1O4XA 1IDZA 3GTJJ 3PO3J 3BG5A 4JYKA 1YRNB 5FKLA 1ETWA
chains in the Genus database with same CATH superfamily
3JRIA 1IC8A 4EGZA 1Y6IA 3U21A 2DOFA 1YHQI 2IP2A 4G94A 5GAHJ 2I10A 1U0JA 2ZXIA 3V7CA 3OYLA 3J7ZI 4M3EA 3A0HC 4FE7A 3C3WA 3ECHA 1EF4A 2PMZA 2V9PA 3O3KA 4CCNA 3I58A 4LMYA 1AOYA 3E7LA 4A5MA 3OSFA 2HOSA 1SAXA 4OMYA 1HQCA 1AKHB 4IRHA 3DF8A 2DFFA 3HUGA 1R9TJ 4M6XA 5FO5A 1FBUA 3HZJA 4LD5A 1UHWA 2VPRA 2Y0SN 1TBXA 3PSIA 1MJAA 3JRFA 2JRTA 2QENA 5C3EJ 5FKOA 2YSRA 3DEEA 1VQOI 3FXMA 5H20A 4CH7A 1UFMA 1O3SA 1GUUA 1L0OC 1S7EA 2VQGA 5E3MA 3OYIA 1LVKA 4ESBA 4XM3A 1LDKB 3HSFA 2OUMA 2IPQX 4BS9A 4A3EJ 4L9JA 4RB1A 5C4XJ 1F5TA 2QKMB 5JR3A 3BTCA 1V5FA 3JRAA 4M6VA 2LF8A 2X1EA 1T39A 4XLFA 1LE8A 3WODF 3K4JA 5D5WB 4P5OA 1BW6A 1R71A 4HSTA 3CC4I 3NARA 1UHMA 1T8IA 2EIMH 2NNYA 3OYHA 4BEHB 2L7FP 3JSPA 1ZRFA 2W25A 2VOPA 2HZDA 1R22A 2OU2A 3CMAI 4G12A 4W97A 1XDSA 4DNCA 2VKDA 2VBXA 3CZ6A 1Z3XA 3K7AJ 3CCYA 4AC0A 3HOYJ 3OWTA 4C3JJ 1WVRA 2KLOA 4BE0A 4X6AJ 3G4SI 1H88C 1P4WA 3MWMA 3K69A 4GYIA 1U3EM 4ENNA 1R5HA 1FYKA 1MNDA 1XG1A 4WX9A 3TO6A 2YU9J 2BHZA 2DN0A 2IRFG 4OU0A 4RM2A 5CVUA 1BJZA 1Y0UA 3DP7A 3Q0WA 3V42A 1G6NA 3A1YA 4F7ZA 4KN4X 2KP6A 3BJ6A 3IWFA 3BQYA 5EG0B 5F27A 1E3PA 3QP6A 2E71A 4BJ6C 2KRFA 3OL4A 3BR5A 3ABTA 2GM4A 2DA6A 3OYDA 2IVMA 3W6KB 4U7DA 3VSKA 3CO7C 4XONA 5FKNA 1U5TB 5F6FA 1F43A 1X3UA 1JE8A 3A4CA 4A0YA 4RM3A 5K7ZA 1QGPA 2XF6A 2ZBKA 5IP9J 5FB2A 1IUFA 2K5CA 1TWCJ 1P2FA 2GA2A 3FBIB 4W1UA 2HQAA 5GP9A 3BTJA 4LLGF 1YW9A 2ELKA 4RB2C 1W7PB 2FF4A 1ZREA 3FKIJ 4HW0A 3HXLA 5HDKA 2OZ6A 3TBIA 4J00A 2DQRA 5FRNA 3DU5A 3GVAA 3V8KA 3FXRA 1LEAA 4L9NA 4IHVA 2QA4I 4N0BA 4NNJA 1EA3A 4DBQA 5LLQA 2DODA 4F92B 2OV7A 2XASA 3IV5A 3W2AA 4D5CA 3BR0A 2DOAA 2Q0OA 1P9QC 2M8GX 2GOMA 2MABA 3EUAA 1G59A 2DFEA 3Q9SA 3RQ4A 1TWGJ 2R7VA 2XROA 3DLLF 4XRSG 2XF5A 1Z6RA 2NVYJ 3LSGA 3ZMTA 5E8IA 3D5SC 1R00A 4BHPA 4BDZA 2VBYA 4KMFA 2LSOA 2M30A 2XAQA 4H0EA 4U0WA 2JTVA 3K6GA 1TZLA 3R0JA 2HPMA 2ZO4A 3I53A 1Y0NA 4O6JA 4F91B 4BXXJ 2QQ9A 2DFHA 2KQRA 1IXRC 2K9QA 1WH5A 4D7NA 1Z3YA 1QBJA 5E1WA 1JXSA 3QQAA 1LFBA 2AXLA 3HM5A 5D8LB 1I39A 4UVCA 5M5WJ 3FX3A 1WKMA 4G7OF 3I54A 4XRFA 1TL8A 4R1HA 1PJRA 3OMYA 4LITA 1GXPA 3BY6A 3HOSA 4Y17A 3ZPLA 4GFBA 5B1BH 1Z91A 4FASD 1OPCA 3ZQLA 4MHGA 3T8TA 3OL3A 2KPMA 4JP0A 1CF7A 5ICEA 1WJ5A 4A2UA 5IYCJ 1VQKI 1T95A 4A3IJ 2X4HA 4A3KJ 1HW5A 4HRIA 1MIJA 2GXGA 1V55H 4A3MJ 2Z33A 1DU6A 1P6RA 4IO9F 5J1YA 3MZYA 4HNTA 4E4HA 4GCVA 1G3SA 2DDAA 4UHTA 4A6DA 2KFDA 1O3TA 1WFXA 2F2EA 4F55A 1HA8A 3CCVI 4IZZA 4HDUA 1BW5A 2PLYA 3GFJA 2FRHA 2ZC2A 3RYPA 1R7JA 2XRNA 3HHGA 1S5LC 1D1BA 5CJ9A 1IXCA 1FX7A 2DPDA 2A3SA 2FQ4A 4KITB 4XLNF 2F5CA 2RQPA 3C2BA 1HF0A 2Z9OA 3EPZA 2DAOA 5FRMA 4M9SA 2Q8KA 3AG3H 2LYCA 3Q9VA 5FFXA 2LNBA 1VQLI 3JAMK 2VQHA 4RAFA 3ESWB 1YJNI 4PZJA 2KKOA 2XUBA 1I3QJ 2VBWA 2O7OA 2WBMA 3TKYA 2A68F 2WAQN 1CQTA 2B63J 3K1MA 3WTSC 3FMQA 2NOJB 2M4KA 4NC8A 1OCPA 3T8RA 2H6BA 1K78A 2TCTA 3S2DJ 3WG7H 1BA5A 4NC7A 2CS3A 4DYCA 1W7PA 3R60A 1WRJA 3SEZA 2R92J 3BG7A 2O0YA 4CA0A 1B4AA 1F1ZA 3JSOA 1WH7A 2WA0A 3OY9A 2UXXA 3TW7A 1WQ2A 5GTIC 3CF5F 3TOBA 1J5YA 4RB3C 2BEOA 2OD5A 2A61A 1MSEC 3VYTB 4HLXA 4BL0B 4ZZLA 3FK7A 3VWBA 2P6SA 4FHTA 2D1HA 2ZSHB 3H5RA 4ON0A 1VQ7I 3ABUA 4BJTA 2COMA 3I0TA 5CVIA 3U2RA 4BBSJ 4ENKA 4NBQA 2EBIA 3GTQJ 2HQ5A 3HRUA 1FNNA 2FMYA 3NWSA 2BZTA 5LFAA 2XPUA 3H9JA 1L3LA 1K6YA 2R93J 1UG0A 2HS5A 2LF7A 2HOTA 3DFGA 3TW6A 3K4LA 5L3FA 5HS9A 4L5JA 2L9SA 1H9TA 2H6CA 5EZGA 3BR1A 1A31A 2Y2ZA 2D1VA 1P4XA 5DCFA 2IA0A 3DPLC 3V7RA 3COAC 3HGGA 2BW3B 4HYEA 1KA8A 3ZN0A 4EM2A 3BOQA 3FISA 4PCQA 2HYFA 1Z21A 4LFUA 2ZFUA 5HLTA 2Z5UA 1P92A 1UJ8A 2CYYA 3QP5A 1FSHA 4HZFA 2B0LA 4FE4A 1UB9A 2X1CA 4DIQA 5F0CA 1U9NA 3GTKJ 2QVOA 5L3DA 1Z7UA 2F5VA 2JN6A 1IO2A 2M4GA 2X1DA 1U6GA 2DYSH 3LFKA 4E7SA 2FJ1A 2GLOA 3J7AO 1FSEA 3KP4A 2EH3A 1BC7C 3KEOA 5M3FJ 4DQ2A 1DDNA 1BI0A 4OIRF 2IW5A 4KUMA 1ZG3A 2F5DA 4IF4A 1O7FA 3DCFA 2EJRA 3I64A 4BACA 4IJAA 3J7AY 4CZZA 1XPXA 1LJ9A 1YO5C 2MH9A 2ZB9A 4LG3A 2JVGA 3FHNA 2ZFWA 3CJNA 1J9IA 3E5QA 2E1MB 2DTZA 1FBQA 2ZMEA 3RI4A 4V2FA 1SFEA 3DKXA 3H1CA 4U7BA 1FTTA 3PO2J 1JKOC 3I71A 3M1CA 1BC8C 1W0UA 1LUJB 5M5YJ 1F36A 3IH4A 4HF2A 4UB8C 3S2WA 1HKTA 2R7SA 2PJPA 2KDOA 3BPVA 3G2BA 4Y52J 3DV8A 2EZKA 2KIQA 3P7NA 4XLHA 4QPQA 4E7LA 1RUOA 2MC3A 4UVAA 3PQKA 1T6SA 2IEKA 2LFBA 2NS7A 2K85A 2I5UA 1MBEA 1IRFA 3M8FA 2V1UA 1YJ9I 1ZH5A 4EJUA 4I0BA 4CXFA 1DU0A 2AS5F 1ETVA 2FA5A 2BOLA 3HOTA 4B43A 4II2A 3LQQA 5ILSA 5BPDA 1USSA 2KRHA 1LDJA 4Q47A 3OS1A 1BOBA 4XR6A 2VLAA 1YI2I 1R49A 4OWRB 4UB6C 3PFYA 1IN6A 1BL0A 1QHHD 2NVQJ 1JHHA 2D5VA 5IY5H 2LLKA 2LREA 1T2KA 2IBDA 4Y3OA 3G1OA 2YU3A 4X1EA 3BDDA 4KICA 1WGXA 2RAEA 3RDIA 4RDUA 3JRCA 1USTA 3GFLA 4AU7A 1YX5A 3DLAA 1MMNA 2DT6A 3MD2A 4BXUA 3BP8A 4JYKA 2OCEA 1ETWA 1O3QA 3ABLH 1U5TA 3RKXA 1WCMJ 2WAFA 2LKXA 5BPIA 3KETA 4IQJA 4BHCA 4EJWA 2EILH 1UZCA 5EJCA 3S17J 1SVMA 4S04A 2G7UA 5EGOB 1YS6A 3HKZN 3D5RC 4GYGA 4UV9A 2E36A 3F6VA 3LWFA 4GRIA 1G8XA 3KE2A 2HVSA 3ZMSA 2RREA 2VIXA 3B73A 1XCBA 3ZMDA 1X4PA 3S1MJ 1MMGA 5J3LA 2JSCA 3I3LA 3RKWA 3ZOBA 2GXBA 4PUSA 2O8KA 1IRZA 2FNPA 1ULYA 2HWVA 5DTDA 1R4MB 5IT9K 4MEYF 5E3OA 2DFIA 3KYDB 1Q1VA 5EEAA 5ICGA 1S72I 1HBXG 2FMLA 1GDTA 3QOPA 4KJZA 1NK3P 5AIQA 1JUSA 2G7HA 2NS8A 4MO7A 2CUFA 2COBA 2JA5J 2WV1A 2GOXB 1QZZA 3GX4X 1X2MA 2VXDA 1TWFJ 2XPVA 3SHFA 3HG9A 1SFXA 2VJ4A 2KMUA 3WE2A 3JR9A 3WGGA 2OCCH 2CQXA 3LAPA 3WU2C 2DLLA 2JUGA 2KIUA 2BHYA 1CF7B 3LSRA 2OF7A 1HDPA 2KHMA 3H36A 3BG6A 1HDDC 5IT3A 1ZKGA 3HOUJ 1XSDA 5J6XA 2E34A 3F3XA 1Y8QB 2A6HF 5FKKA 2XKPA 3A01A 4LK1F 3HEFA 1T08B 2V9VA 5E3NA 3QU3A 4YIIA 3JAMZ 3VDXA 4P9UA 3IRRA 4V19K 1QZYA 2UZKA 3VPRA 3A03A 3WTWC 3QU6A 4FETA 4H4KC 1NH3A 2DJIA 2HXOA 1POGA 2EA2A 5KCMA 3BZKA 3QAHA 3CLOA 3IUOA 2E2HJ 1XN7A 3RTRA 5E8GA 1ERDA 2X48A 4DOZA 1DPRA 3L2WA 4IRIA 4EJVA 5FLXZ 4N9IA 2IS2A 1R1TA 1YLFA 3BZ6A 4BY7J 2XIGA 3ZGKA 2BBYA 4EATA 2VASA 2OAZA 4IRGA 4KFCA 3DWLE 4YG2F 5E17F 1IAWA 2OJED 5F0HA 4ZH4F 1DUXC 3TP0A 5JVGF 1G4DA 2VPLA 3B02A 2CO5A 2M87A 2XGCA 2JA7J 5EF6A 1ONVA 4FTHA 1MNMC 3HOVJ 3VB2A 1QVUA 1QVTA 3H9GA 2Z1DA 3JW4A 4RB0A 4YFKF 2XKOA 3K4MA 2NNNA 3M1EA 2ICWG 2MLGA 5JLXA 1W5SA 1GLNA 1SD6A 1W36D 1JJ8C 1GT0C 3S15J 2HQRA 2ZMEB 1FOWA 2LY2A 3KCCA 3SDBA 1X1BA 5LGNA 1IJWC 3GW2A 1R23A 3LOCA 3M07A 3O8GA 1QNTA 3TGNA 2IGKA 2YR2A 2Y75A 3ERMA 1VNDA 3QRFF 4B44A 2QBYB 4G7HF 5B1AH 1U78A 5FROA 3F6OA 4I6ZA 3IC7A 2ETHA 3GZ6A 2DQLA 1P7JA 5DS9A 3E5XA 5DV5A 4OAYA 2EFNA 3G71I 3F8BA 2VT3A 5IP6A 1ZRDA 2KZGA 3NWTA 5DYMA 4GXOA 4HX4A 3AL0C 1YTYA 2KIMA 3BQZA 4YELA 3HPHA 3OR1C 3WTVC 2Y9ZA 5E20A 2YUSA 5EZHA 4LIVA 2R7FA 1LPQA 1RI7A 3G1MA 4D7MA 4S0HB 3GWZA 4LK0F 3DXJF 3X2QH 4BNCA 3MZ8A 1NG7A 5ICFA 2VB6A 1G3YA 1S9HA 2M7BA 1QPMA 1ZK8A 3DTIA 3PSFA 2K9SA 5TGTA 2F4OB 5IOZA 1HSTA 1ZARA 2L2OA 5L3BA 2W82A 2R0QC 1BOAA 1FP2A 1U9OA 3CUQC 4D5FA 2JWTA 3TEDA 4LOCA 1EH7A 3K4NA 3S1NJ 2DPUA 2K4JA 4EGYA 3OYAA 1K4TA 3LSKA 2W85A 2DA2A 3I59A 1N75A 2L7KA 4M9XA 4Y7NJ 1I1GA 2GQQA 5GPCA 2W00A 2L01A 3ZN1A 2ZJPF 2DOEA 1T33A 4YRVA 1FTZA 3HC7A 3AG1H 5E18F 1YS7A 1YG2A 4PGGA 4DW6A 4DJAA 5HLGA 2R7ZJ 3OOUA 5LHHA 1HKQA 3GO5A 2GIVA 1WHUA 2PN6A 1QRYA 1UG2A 3LQRA 1IV8A 2XGXA 2VJIA 1T56A 2DXIA 1G3TA 2X51A 3HRMA 5GAEJ 4BKXA 2DMNA 1T0FA 1AWCA 1A5JA 5FJ8J 2ELJA 4GDFA 2VUMJ 3WGHA 1OJLA 2Y69H 1X1PA 1OMIA 1WJBA 1ZR2A 3VSLA 1XGNA 1F4KA 4I02A 5LGTA 2E60A 2P4WA 2E5NA 4IHWA 2L9NA 4G9YA 1I1SA 5LGUA 3H35A 3E3VA 3JRBA 4V2GA 4A6EA 2GZWA 3SZGA 2ZNYA 1YIJI 5J47A 1SVLA 2TDXA 3GF2A 5D4SA 4AWXB 3UKGA 5DUIA 1IN8A 2OZUA 5E1ZB 4CDGA 1K7AA 2P5KA 1TNSA 3GEZA 5CKTA 1FOXA 1MW7A 5E79C 1FEXA 1D5YA 2A6EF 3EUKL 3HRSA 4TV7A 1OQYA 5B66C 1KQ9A 2XB5A 1TQPA 2DDBA 5DM7F 2K4BA 4XK4A 3GYHX 1FP1D 5ILVA 3LL7A 4BH9A 5GADJ 1PUFA 2VI6A 4XORA 2PBIA 5FKMA 1EH6A 3F23A 2EV6A 2EZHA 3VOEA 5KK1A 3M8JA 3H3VK 2BY0A 1FJLA 1PDNC 3Q3SA 1LB2A 5LD2C 2UWMA 3PNVA 1XSVA 5L3EA 3K4CA 1SMYF 3DQVC 2EZIA 4MNUA 2LY1A 2LRDA 5DDGA 1RUNA 2HFHA 5HLIA 2IGOA 2WTEA 5JFRA 2ZCWA 2ME0A 2EV0A 2P7VB 3HYIA 2CQ7A 4XOPA 1KU9A 4HF0A 4C3HJ 1U8BA 3MVPA 5ED4A 4M74A 2FX0A 4EJOA 3JREA 2V1XA 2K7LA 2P8TA 3CCEI 1V4RA 5C4JJ 1YRNA 2QQ8A 1YJWI 4MEXF 3TQNA 2JMWA 2A6TA 1S6LA 3ZCOA 1AA7A 1VI0A 3M4OJ 5K7HA 3GZ5A 5F08A 2NVTJ 2DO7A 2K02A 2ESNA 4E7KA 4Q48A 2VL8A 3L2QA 2DI3A 3ZP5A 4HNUA 3F8FA 2DW4A 3L2RA 2V26A 5H2FC 1QA6A 5HDGA 3R61A 1W5CC 2ZMEC 1J75A 1WJEA 4HAMA 4Z2YA 2KIFA 4IKFA 2OPTA 4KN7X 4XQFA 3FDYA 2GIZA 4M3GA 2E1NA 1ODDA 1I3AA 2L9RA 1HKSA 3WG9A 3KP2A 1GHCA 1D1CA 1RC9A 2XAJA 3ZQIA 3ERED 4OIOF 1ZELA 5FLVA 1WJDA 5D5UB 2HKOA 1B72B 3LA3A 1TP4A 4KA4A 1Q1HA 2R7XA 1S8NA 4BQNA 3EUHC 2CJJA 5HDNA 3KEQA 1Z77A 2FNAA 2LH9A 1D1AA 3DKYA 1BI3A 2PMZN 3AAFA 4P55A 3VEPA 4NB5A 2KJBA 4XLEA 4NC6A 3MMYB 4PDKA 3IL2A 4G6DA 4AVPA 3TDZC 4XLCA 2IT0A 4JBAA 3ZQQA 2FUG2 3CJTB 4AD9A 4U87A 2QF7A 2HTSA 4MTDA 2F5FA 3DBRB 1MBJA 4C2MJ 3RKQA 5K5OA 2Y30A 1S7OA 5D5VB 3DBHB 2AHQA 4PJJA 3ABMH 1R36A 4ZZDA 5DEQA 3L7WA 2EPFA 4AM3A 4KT6A 2WY7Q 3S3NA 1MD0A 1TWHJ 2HXIA 5D6FA 1N78A 2D2WA 2AXTC 4RGSA 3CTAA 1X1CA 4IEJA 1LFPA 3GTPJ 1JGGA 4BAYA 4HA8A 1REPC 1PYVA 1JJ6C 2CFOA 4AIDA 3E6BA 2R5ZA 2HVRA 3JRGA 5IOYA 1O3RA 1EV7A 2BXZA 2Z99A 1S7AA 5F1RA 1O7LA 4KMUX 4MLOA 1DP7P 4L0YB 2M8EA 2DYRH 2ID6A 3G1LA 5J1UA 2JZYA 1J0RA 4MIMA 4IL6C 3A01B 1FZPB 4A3FJ 2VONA 1R5ID 2F5EA 2Q2EB 3MKWB 2AQFA 3JTHA 1D5VA 2UV1A 3QODA 4CHUA 3CLQA 2ELHA 2HVQA 1YRNB 4IHYA 1FOKA 1ZGJA 1GXQA 3FK6A 3HUGB 1PUFB 2EK5A 1X2NA 4PK4A 3F72A 3IAS2 4BJ5C 2H27A 1D8JA 3HJEA 2W48A 1E3HA 5D6EA 4CZCA 1QO0D 3CDHA 4YFXF 2XDVA 3O6BB 4OINF 3OYBA 4B8XA 2KJCA 4RLQA 2IGNA 2LC2A 3J80K 4BBRJ 3EYIA 3FMRA 1CGPA 3HGYA 2RDPA 2ZXHA 2A07F 2M0CA 1FMVA 3ZQCA 2Z2SB 1DGRM 3GXOA 3JCUC 2O3FA 4JX4A 2XAUA 3TO7A 4CGZA 3N05A 2PQ8A 3ZR8X 3SJMA 4B1RA 1GV2A 3PUBA 5DCMA 3TP3A 3RKYA 3PNTA 3HKZA 1I50J 3GUDA 1R6RA 4IQ4A 1W1WE 1DGWY 4Y4RA 4ZYDA 3RJPA 4WK8F 3IRQA 2L5QA 4XKWA 1OYIA 2WB1A 3FZVA 1H9GA 1SVOA 1VQNI 4YEJA 1ZLJA 3ZQ7A 1FWZA 4E7JA 1YE9A 2QCOA 3G3ZA 1E17A 2R3SA 5DUKA 1WJCA 3KFWX 5IPAA 2A5YB 1TC3C 4PFPA 1BBYA 2LP0A 2EA4A 5IYDJ 1FMWA 2JPCA 1NG6A 5HLHA 1KQ0A 2VKEA 5EG0A 5KVRA 4RGUA 2V79A 2EFWA 1RETA 4KT5C 2WB1N 1IN4A 2W7NA 1UHSA 2QKLB 3HB9A 5K5RA 4EM0B 1AKHA 2OQGA 2GAUA 2ME6A 1LQ1A 1BI1A 3SFZA 1PUEE 4II3A 1I6HJ 2E7XA 1HW2A 5KHDA 4L9TA 4B48A 5JI6A 3TDUC 4RMNA 4OIPF 1Z9CA 5GPAA 3OYNA 1XTAA 2GA1A 1E0EA 1WJAA 2MG4A 4C3IJ 2HI3A 4GGGA 3LSHA 4RS8A 2Y31A 3HSRA 2E2JJ 1VQ8I 1LEBA 3A02A 3PQJA 3R6SA 5K7FA 2VT2A 1BIAA 1D3YA 2DK5A 5M5XJ 1LE8B 1ZYRF 4XSZF 1W5TA 1MJ9A 2STWA 4KIGA 1GV5A 4A12A 4N4OB 3CJQB 1XGSA 2BVMA 3MCZA 3OYGA 2DA5A 2R7OA 1XB4A 4MFEA 3CQZJ 1ETYA 1XSXA 2EINH 2VQCA 4CCLA 2YS9A 4ITVA 4PGHA 1JKRC 3S32A 3E1SA 3BPXA 2YPRA 2LD5A 1NK2P 2MD5A 3H5NA 2NVUB 5K5QA 2H8WA 3GTMJ 3BTLA 2DBBA 1DQUA 1TQMA 2E35A 3WU1B 2QM3A 4N4NB 5ILUA 1RIOH 1U5TC 3B6AA 2JQ7A 5F0FA 3OYFA 3MKLA 3V8LA 3F21A 3R0AA 4XKCA 3R4KA 1ORKA 4WWCA 1RR8C 1JTXA 3FXUA 3H0DA 3MAJA 2D45A 4N9HA 1WWXA 4PSXA 5FLXK 4EEFG 2P7CB 3A2KA 5IP7J 2OQRA 3SQNA 1Y8RB 3LA7A 3BT9A 5HODA 2WWYA 1X3ZB 2HU9A 3AFHA 2W57A 4G6QA 4BXFA 1RKTA 2EZLA 1QQIA 2YX7A 4E7IA 3DTEA 2X6WA 1KYZA 4P9FA 2HPIA 4BY1J 3LFUA 4M3FA 2MA3A 3CMEI 2KDZA 2X6XA 3HIFA 3ZQFA 3I4MJ 4FCYA 3AG4H 1Z6TA 2LVSA 1SANA 3M8EA 1LKXA 1J7KA 5JLWA 1K83J 2LBFA 4JX5A 3CP8A 1A36A 1VQ9I 2KRCA 4I01A 4RAYA 2O61A 1FYLA 3I5UA 3ULQB 2V6EA 2WAEA 4Y13A 5C44J 1IRGA 3K2AA 5LHGA 1XGOA 2QQAA 4EV0A 4KDPA 2LG4A 3GMEA 3ECOA 4HV5A 5DD8A 1T0FC 3IH3A 3E6CC 1OCZH 1IRXA 1IZ1A 3V4GA 3PFIA 4A3GJ 3J7YJ 1R58A 2HNHA 2DMQA 3HBLA 2XV4S 5B5EC 4A0ZA 3E0JB 3FM5A 1KU3A 1XMAA 5FD6A 4XRMA 4E7HA 2R7DA 2H09A 2CUZA 2HOEA 2MGQA 3VYSB 4E7ZA 2X6YA 4RLFA 2JSPA 2DA7A 4FQGA 2CH0A 1VQPI 3OIQA 4UXNA 2DMUA 3W6JB 1XD7A 1FBSA 3H3ZA 2LR8A 3F9KA 3JRDA 5CVRA 2FXAA 3OYEA 2E19A 3PL8A 4AUXA 3BR2A 4L18B 3OSGA 3MQ0A 3BG3A 1I6XA 3PIPF 1STZA 4CICA 2BGCA 3PJRA 3HRTA 2CWEA 2M5WA 2X9DA 4C2UA 2FOKA 3K70C 2ECCA 1X19A 5TJJA 2M2EA 3S93A 3H92A 2DA3A 1ZLKA 4HF1A 3FXQA 3FWEA 1JT0A 2RGVA 1SC7A 3ZRGA 5ERIA 3MEXA 4JQFA 4A3JJ 5FFZA 4IHSA 4RGXA 2ZJQF 4BQAA 2CGPA 1SMTA 3CUQB 1K4SA 3BZCA 4QIWN 3DEUA 2VXZA 3OR2C 3B6CA 4ZYGA 2LKPA 4IVNA 4QSHA 2PEXA 3L1PA 3ROUA 3KP7A 2FU4A 3WHCA 4LGWA 2RNJA 2J5PA 2VE8A 2VKHA 2X6OA 3GFIA 5BOXA 1TNTA 2CFXA 3O2PE 1HC8A 3L9FA 4BHBA 1MMAA 1FC3A 2O03A 1OLTA 4XN3A 1TLHB 1V5GA 3LSIA 4LG0A 1OYYA 1UCRA 2FBIA 2IA2A 2PG4A 1W0TA 3GBGA 2IA1A 2K3PA 3WU0A 4GO1A 5KAIC 1JT6A 4UV8A 4CCJA 4OAZA 3C18A 2MYSA 3F8NA 2ID3A 3Q0VA 3W3CA 5BS6A 1FIAA 1JKQC 1AHDP 1OCTC 1A35A 3GFMA 3FKJA 5TISC 3S1QJ 4A5NA 4ZJZA 2FE3A 1MBGA 3VYUB 5BNGA 2OTJI 4ANJA 4XOTA 2J5OA 4QTRA 3HOWJ 2RNGA 2ZXJA 4HX8A 3CDIA 1HSJA 2XAHA 4ZYEA 3N97A 1ZAOA 1FIPA 3TMOA 1APLC 3AKZA 2ISZA 1FY7A 3IAM2 2M9HA 1BR4A 5CQEA 3K4BA 4XKVA 4UUVA 1V5EA 2CW7A 3U1DA 1B6AA 2P5VA 1VQ6I 5D5XB 1KQ8A 1MMSA 3KP3A 3K10A 4HBLA 2DTRA 4IHTA 2R7UA 3EUHA 3IP4B 2FEZA 4PJ0C 3CCRI 4A3BJ 2XGEA 3CO6C 3KP6A 2HOAA 4RAZA 4XLAA 1LFUP 3OYKA 3OYMA 3ZQHA 2ESHA 1X1AA 2XPWA 3EYYA 3FF5A 1Y1VJ 2CV2A 1ZN2A 3RPUA 2Z3YA 2DMPA 3MKYB 2JRMA 2EV5A 1FYMA 1R4NB 4MQ9F 3TOAA 1YOVB 1K6OA 5FLMJ 2F4MB 3CESA 2IS4A 3TO9A 1M1EB 1J59A 1D0YA 1OR7A 2QZ8A 3KLOA 1DPUA 3GLLA 2DT5A 4CCOA 3WTXC 3SZTA 2V7FA 2HDWA 2V4JC 3SZPA 4CYCB 1Z0XA 3DEWA 2FSWA 2JJ7A 4A93J 2G9WA 2PFBA 4UUSA 1Z67A 2CQQA 1SFOJ 3I4NJ 1DP3A 1XC5A 4IHXA 4A0XA 3TL4X 1K61A 2QUFA 2JA2A 4IX7A 2L02A 4ABZA 2EB7A 3RZOJ 5HS7A 2L4MA 1WI3A 2KISA 3FM3A 2YX4A 3W2WA 1MGTA 5M3MJ 1HXDA 2MW8A 3FBNB 1JKPC 1AU7A 3HDDA 4M3DA 4ASNA 3OYCA 3I4PA 1SFUA 2GWRA 2IAIA 5JHUA 4XICA 4OIQF 5LRRA 2R7RA 3BR6A 4Q4ZF 1XX5A 3KZZA 2L54A 2CRGA 3K1PA 4Z6YA 2DT7B 2OBPA 1BR1A 2HTJA 4F52A 3WTUC 3GLXA 2Y0MA 3GZNB 3L2UA 1SD4A 2R5YA 2EFQA 1D0XA 4G7ZF 3M3YJ 3T1BA 3L2CA 4G8XA 3C2GA 4J01A 1X1DA 2X85A 3ZQGA 4L0ZB 2LK2A 1E3OC 2WC2A 3P9KA 4AYBN 3KX2A 4E70A 2IJLA 1IDYA 2L0KA 3BCAA 4JK1X 4Y15A 5E1XA 5LEKA 4M73A 3S3OA 2NAZA 1ETXA 1G3WA 3IKTA 1R1UA 3REOA 2WADA 3VFZA 1RRJA 2QSHX 4P1WA 4FX4A 2ADUA 3GTLJ 5EDNA 1VFCA 3DBLB 2WY8Q 3MN2A 2CW0F 4I2OA 1A6IA 1YYVA 2VC1A 1XDUA 4WF2A 3ASNH 1T98A 5HOOA 2VKVA 3HSEA 1U8RA 3FXKA 3QPLA 1MNEA 3S3MA 3NRVA 3LNQA 4MQVA 5DD4A 2R7QA 3FXOA 2VC0A 1MKMA 4HX7A 4RAGA 3WTYC 3H0GJ 5D4RA 4DYQA 1BM9A 4XIDA 3DKWA 3VODA 3LA2A 1V54H 4ESFA 2KZVA 1G2HA 4AYBA 4BQQA 1WZ2A 4G6TB 3OOPA 2W24A 1GVDA 9ANTA 2KT0A 2V6CA 4ENMA 4CYDA 3H5AA 5ICCA 4XLPF 2A05A 3E6MA 3GTJJ 1YITI 3BG5A 4WXCA 5FKLA 5A2QZ 3IH2A 5E3LA 1ZTRA 2DMTA 3BJAA 2B7EA 1PP7U 3RCOA 2E1MC 3QWLA 3I9V2 4RA2A 1ZRCA 1TW3A 2VJJA 3FIWA 2LKSA 4A69C 4Y33A 2BYVE 5EEHA 2K27A 4I76A 2LY9A 4WCGA 1MDMA 2QBYA 1VZ0A 4NDLA 3CCUI 1S3JA 3S14J 4UY8I 4L5IA 4CCKA 2NOGA 4NUBA 4RGRA 3DPTA 2F6CA 2HR3A 4OMZA 3KLNA 4S05A 3QPTA 4MGRA 3GTOJ 3QYBA 3CCMI 3OV8A 3P5JA 4NQWB 5J8FA 1HCRA 3HTUA 2XRLA 2QSFX 3RPQA 2IS6A 1R5GA 4HLYA 3U1KA 1PP8F 1D8KA 4L9VA 4ZTFA 1XMKA 4F93B 2FQ3A 4B3XA 4M6YA 3BROA 3OS0A 1VTNC 2VOOA 3N4MA 3S1RJ 1I27A 4QPOA 3CCQI 2BXYA 1SD7A 3CUOA 3HPGA 4B3AA 1IXSB 2EIKH 3DTKA 3S8PA 1ETOA 1OCRH 1P4AA 1OCOH 2Q2EA 4HSRA 5GAGJ 4P96A 4WXDA 2HYJA 3H9QA 2I8DA 1RR7A 1YW8A 1I5ZA 3BC8A 5EEGA 2VJ5A 1YW7A 1MZBA 2VBZA 1KGSA 2M7AA 4ETSA 1K79A 2Y9YA 2K9LA 1BJAA 2NYXA 1QU3A 1Z7LA 2ZSIB 4KYWA 2DA4A 1B8IB 4BU2A 4FX0A 4XN0A 2XAGA 1V3FA 3HHHA 1WJFA 3CCSI 1MDMB 2ZXWH 3LSTA 2P6TA 3VYRB 4ZDPA 3V7SA 4M71A 2JPBA 2DA1A 4K2EA 3BCBA 2HDDA 5J1RA 4ZTJA 3W6VA 3I55I 3O8HA 3CD6I 2R5YB 2DK8A 1A04A 1TT5B 3ML6A 4OOIA 3K70D 3KP5A 1IGNA 2K86A 3DPUA 2L7MP 2CG4A 2HGCA 4AIKA 3K0LA 3HOXJ 6PAXA 1HW1A 4IPAA 4E6KG 5AIPA 3CP2A 3J81K 1H8AC 1W36C 1BIBA 3SFIA 1RPWA 3HL2A 2WAQA 2R7WA 3A0BC 1E2XA 1W7PD 4B09A 2UXNA 3CJRB 2A5WA 2K40A 2P81A 3GTGJ 4WXHA 4IOAF 1KONA 2QLZA 3S2HJ 1X58A 2CUJA 4C9YA 3JTGA 2FBKA 4HQMA 4CYCA 1K78B 2AQEA 3MFKA 2CW8A 1ON2A 5AONA 2BV6A 3HTSB 2IXSA 5CVVA 1ITYA 3C1DA 2IS1A 1OISA 1FOYA 1MSFC 2QQBA 3BLYA 5BMZA 2BY1A 2XF7A 3SXYA 1B59A 2EFOA 3G73A 5BQTA 2DJNA 2JUCA 5TRDA 2BY3A 2EFPA 1JHFA 1BI2A 1EJ9A 3CC7I 2BVLA 4HNVA 3G6EI 3H3UA 1B9NA 5CLSA 4QLCU 4UUTA 4NQWA 3WE3A 5D8KB 1YIOA 2GXAA 1Z1DA 2W1OA 3MKZA 4B4CA 4EJTA 4LLNA 4BYYA 1ACIA 1FPQA 4CUGA 5HVQC 3F0CA 2PMUA 3V8JA 5J40A 3FXJA 1MBFA 3NAUA 3SYTA 2XAFA 1B72A 2EWNA 2RKHA 5JHFA 1J2XA 3BR3A 5LEJA 2STTA 5LRSA 1IG7A 5EGOA 2MLKA 4JX6A 1TTYA 4YIFA 3J80Z 4HOBA 5CYVA 1UELB 3QYEA 4MFDA 5H6QA 5HNHA 1U2WA 2F48A 2DCEA 1SAUA 4XSXF 3Q5FA 3QPHA 1KYWA 3K1NA 4PFOA 4ZDLA 1BN5A 1OFCX 3FMSA 5CPRB 4UUSB 3AL0B 4Q5SF 3EETA 3K9TA 1WSUA 2NXNB 1JI8A 5KAFC 4LB6B 1IUYA 2F4IA 4HV6A 4BUPA 3T0YA 3L09A 3CCJI 3ZMZA 1UMQA 1ETKA 1ZGAA 3KIOA 1W4MA 2Y0SA 1XS9A 4KIBA 3U9GA 4IOCF 2ZNZA 3Q0UA 4EMSA 4DZPA 3S16J 2VQLA 2MSYA 3IWZA 1OR7C 3ONQA 5FGMA 4X0GA 3WTZA 4NHJA 1LNWA 1YX3A 1BR2A 2MBFA 1ZHFA 2P0WA 2JA6J 3PNYA 3CC2I 4LJZF 4PJNA 1TT0A 4HDVA 2K9MA 2V9KA 3MZHA 2EIJH 3BTIA 2Z16A 3WTTC 3WGIA 2CUEA 1JGSA 5EYRA 2XSJC 1IW7F 2G0EA 1JUPA 4DBRA 4M72A 5FD5A 2BE5F 2ZJ2A 5F1JA 4O5VA 1TWAJ 1PVEA 2LDUA 1ETQA 4UNOA 2XGDA 3RYRA 4ESJA 3UR3C 3ZXSA 2L3DA 4CSWA 1WPKA 2JK3A 2WV0A 3RQIA 4CO8A 4QWQA 2E7WA 2W4SA 2B9SA 4AIHA 4RBOA 4KNYA 3E5UA 2BY2A 3QYFA 2M34A 3BJOA 3PIOF 1OKRA 2PJRA 2RVCA 3KPHA 3RZDJ 2E1CA 3KZYA 4BGDA 3OYJA 4A3LJ 5J4YA 3D1NI 4LLLA 4AVZA 2PX9A 2CSOA 1UAAA 3ASOH 1OYWA 1QPIA 3W2VA 4EVIA 5F04A 1FLIA 2P5LC 2H1LA 2PMHA 3JRHA 1MH4A 2HQNA 4R8HA 1IN5A 3GCMA 3K4KA 2CMPA 2IGMA 5HNFA 4DZJA 3ELKA 2NRAC 1WI9A 2O5RA 2K9NA 2EQRA 2OA4A 5J8CA 2HYGD 2LMDA 2ZJRF 1TQIA 4KISA 4XRSA 3AG2H 4PJLA 3KZIC 1R1VA 2M3AA 2QSGX 3KYCB 4PSWA 2QYOA 2XSDC 5CQGA 4ENJA 2O6GE 1SD5A 2RC4A 2GBYA 1GVJA 2V1DA 2PI0A 2K3FA 1ZG5A 1B1BA 3QOEA 3QPSA 1KU2A 3P9CA 1LVAA 1S29A 3SDGA 2M1BA 5L3CA 1IN7A 3ISPA 4HPQA 4YIRX 2L4AA 1B8IA 3LAJA 1HLVA 3T5XA 2RQQA 2DU9A 1Z05A 3L00A 2ZKZA 3ZMVA 2TRTA 4D1QA 3E6DA 1JTYA 1B9MA 4PJMA 2XVCA 1SFKA 4XNFA 2CQKA 3I59B 3NEUA 3LMMA 4ZYHA 3L2VA 1ZR4A 4U0YA 5IYBJ 1VQMI 1EKEA 1RNLA 1XCVA 2Y48A 2MC4A 4EM1A 3D5LA 1ZQ3P 3HOZJ 4BE2A 1C0WA 3M9AA 2MH2A 2QWWA 4M9ZA 3CMYA 2ACJA 1VQ4I 1QHGA 5JVTA 5HS8A 4A3CJ 3J81Z 1EH8A 4FT8A 3I56I 1MJBA 4BEHA 4I98B 1YQAA 2H1KA 1J09A 3LSMA 1ZGWA 4IXAA 2JA8J 4BE1A 1RKWA 4D9JA 2N8GA 2HDCA 3LSJA 3LSPA 4XBFA 2VODA 3DU6A 4HQEA 1KU7A 2VN2A 4D0PA 2O8XA 2RN7A 1VF9A 3IHUA 3P9IA 3CMMA 4A3DJ 3FHZA 4J19A 3F8MA 3NQOA 3KYLA 2OTLI 4MTEA 2CQNA 2QGUA 3F22A 2R5ZB 1H0MA 4YFNF 1QZEA 2Q1ZB 4LG0B 2LTPA 2BW3A 1ZG1A 3RSNA 1YFHA 2HEOA 3OS2A 1VQ5I 1IV6A 2A69F 5L3GA 2AO9A 1A6QA 1Y1WJ 3CUQA 4L5EA 1MMDA 2XHKA 2RV8A 1MBHA 3EQLF 3M7GA 1KZHA 3RIRA 1MBKA 1NHAA 1D0ZA 1NTCA 1SEUA 3CF2A 4C2TA 4LB5A 2R4GA 5H6RA 2O9LA 5DCMB 4EQQA 2E1OA 2XC7A 2C6YA 4KIFA 1TW2A 3UNGC 4HEA2 4UVBA 4DGWB 5K1YA 4R79A 2VE9A 4BQOA 2M0MA 1X4OA 1HOMA 3K2ZA 2KL4A 4I09A 3BWGA 1N77A 5A2QK 4M3BA 4CCMA 1N25A 4LIUA 3C2HA 5DM6F 3F8CA 1Y39A 3PM1A 4JOMA 2CU7A 3D0SA 3RPUD 1ON1A 1JUMA 2JT1A 4HG2A 1XGMA 2ISYA 4AIJA 2HZTA 1LDDA 2ECBA 4XL9A 4I7HA 2M45A 2V1NA 3CDLA 3OIPA 1H89C 1OCCH 4XMYA 1FT9A 4I0AA 4FISA 3WHBA 3FXLA 3EDPA 4XKBA 2PJRB 2XB0X 5J4VA 2E2IJ 2L7ZA 1F9NA 2CV0A 2L9VA 5LHIA 4O3MA 2FOWA 2FBHA 3BG9A 2LOOA 2HKXA 2W84A 1X3WB 4B47A 2CV1A 2H8RA 1RZ4A 3ABKH 1P7IA 4BDYA 1IF1A 5CVJA 2QEXI 2X0LA 1ENHA 2JVHA 4DYRA 2E5ZA 2FD5A 3C7JA 4U88A 3CCLI 2R7TA 3IKVA 1O57A 3ZMUA 3E97A 2H94A 4I99C 4C30A 4ZDOA 2MFZA 3OIOA 3SEQA 2UUZA 3KEYA 1XMXA 1T38A 5LBQA 4ZYAA 5F64A 5GTHC 2NVXJ 2NS0A 5KNLA 1MH3A 4F3QA 1RESA 3PUFA 2OC6A 1O4XA 2LBFB 5B3SH 1IDZA 3PO3J 1Y56A 2MD0A 4U0VA 5IT9Z 4ZC3A
chains in the Genus database with same CATH topology
1PUFB 3FK6A 3JRIA 3IH2A 1WCMJ 5E3LA 1IC8A 1ZTRA 2DMTA 2LKXA 1X2NA 2I10A 4M3EA 2W48A 3FIWA 4FE7A 4A69C 3S17J 1EF4A 5EGOB 4I76A 2LY9A 3HKZN 4NDLA 3S14J 3E7LA 2HOSA 3OSFA 2NOGA 4BBRJ 1AKHB 3HGYA 1R9TJ 3GTOJ 2M0CA 3ZQCA 4JX4A 2VPRA 2Y0SN 3S1MJ 3JRFA 3SJMA 1HCRA 4B1RA 1GV2A 2XRLA 3TP3A 5J3LA 5FKOA 5C3EJ 1I50J 3ZOBA 2O8KA 1IRZA 1GUUA 3S1RJ 5DTDA 4B3AA 5E3OA 1S7EA 5E3MA 1Q1VA 5EEAA 2QCOA 5IPAA 1GDTA 1ETOA 1TC3C 1NK3P 1JUSA 4A3EJ 2LP0A 2NS8A 4MO7A 5IYDJ 2CUFA 2HYJA 5C4XJ 2COBA 2JA5J 2WV1A 2VKEA 1RR7A 5EG0A 3BTCA 1X2MA 3JRAA 4M6VA 1RETA 1TWFJ 2WB1N 2XPVA 1UHSA 2Y9YA 3HB9A 3JR9A 2CQXA 1AKHA 1LE8A 2ME6A 2DA4A 1B8IB 3LSRA 2OF7A 1HDPA 1HDDC 1BW6A 1I6HJ 1ZKGA 3HOUJ 3NARA 5FKKA 3A01A 5GPAA 2L7FP 3HEFA 5E3NA 2DA1A 2MG4A 4C3IJ 2HI3A 2HDDA 5J1RA 4G12A 3W6VA 2Y31A 4W97A 3O8HA 2E2JJ 3A02A 2R5YB 3K7AJ 3CCYA 4AC0A 3HOYJ 5K7FA 3VPRA 3A03A 1IGNA 1LE8B 2L7MP 5M5XJ 4C3JJ 2HXOA 4X6AJ 1POGA 3HOXJ 1H88C 1GV5A 2E2HJ 2DA5A 2X48A 1H8AC 4MFEA 3CQZJ 1XG1A 1RPWA 3SFIA 1ETYA 2YU9J 2DN0A 2YS9A 1JKRC 1BJZA 4BY7J 3Q0WA 2LD5A 1NK2P 3BQYA 5EG0B 2K40A 2P81A 5F27A 5F0HA 3GTMJ 3GTGJ 3TP0A 3S2HJ 3BTLA 1X58A 2JA7J 2XGCA 4CYCA 5EF6A 3BR5A 4FTHA 2GM4A 2DA6A 1MNMC 3B6AA 3HOVJ 1ITYA 5F0FA 1QVUA 1QVTA 5FKNA 3MKLA 1F43A 1MSFC 1ORKA 2DJNA 5K7ZA 1JTXA 5IP9J 1IUFA 1TWCJ 4W1UA 5JLXA 4HNVA 5GP9A 3BTJA 4UUTA 4EEFG 2ELKA 1JJ8C 5IP7J 1GT0C 3S15J 3FKIJ 4B4CA 3F0CA 1IJWC 3BT9A 3LOCA 5HODA 1MBFA 3NAUA 3O8GA 1B72A 4IHVA 1RKTA 2EZLA 3BR3A 1VNDA 1IG7A 5EGOA 3IV5A 4JX6A 4D5CA 4I6ZA 1U78A 3BR0A 4M3FA 4BY1J 2KDZA 3ZQFA 3I4MJ 1P7JA 2M8GX 4FCYA 5DS9A 4MFDA 2LVSA 1SANA 1TWGJ 5IP6A 4XRSG 3LSGA 2NVYJ 5JLWA 1K83J 3BQZA 4JX5A 1OFCX 4UUSB 2Y9ZA 5EZHA 2YUSA 3G1MA 5C44J 4D7MA 4BXXJ 3K2AA 1UMQA 1ETKA 4S0HB 2K9QA 1XS9A 1WH5A 3Q0UA 4D7NA 3S16J 4DZPA 2MSYA 3QQAA 3IH3A 1LFBA 1ZK8A 3HM5A 2K9SA 5M5WJ 4A3GJ 5IOZA 2R0QC 2DMQA 3HBLA 1U9OA 4XRMA 4D5FA 2JWTA 2MGQA 3TEDA 2JA6J 4LOCA 2DA7A 3S1NJ 2DMUA 4GFBA 3BTIA 3ZQLA 2LR8A 2DA2A 3JRDA 2CUEA 4JP0A 5EYRA 4Y7NJ 2E19A 5GPCA 2G0EA 1JUPA 5IYCJ 4AUXA 1FTZA 1T33A 5F1JA 3BR2A 3OSGA 3BG3A 1TWAJ 4A3IJ 1ETQA 4A3KJ 2XGDA 4A3MJ 1DU6A 4DW6A 2R7ZJ 1WPKA 2JK3A 3OOUA 3RQIA 2X9DA 5J1YA 1QRYA 1UG2A 2ECCA 1T56A 2M2EA 4RBOA 2DA3A 4BKXA 2M34A 2DMNA 1JT0A 1A5JA 4A3JJ 3RZDJ 5FJ8J 2VUMJ 4A3LJ 1OJLA 3D1NI 1BW5A 1ZR2A 4QIWN 1QPIA 3B6CA 5F04A 4IHWA 4QSHA 2FQ4A 3L1PA 3JRHA 1MH4A 3WHCA 2X6OA 3JRBA 4V2GA 4DZJA 3C2BA 1HF0A 2K9NA 3UKGA 2EQRA 1FEXA 1D5YA 1W0TA 2XB5A 4XRSA 3GBGA 4XK4A 1JT6A 1I3QJ 2O7OA 1CQTA 2ID3A 3Q0VA 2WAQN 2B63J 2XSDC 1PUFA 2VI6A 1FIAA 5FKMA 1JKQC 1OCPA 1AHDP 1OCTC 2TCTA 2EZHA 3S2DJ 2GBYA 1BA5A 3H3VK 4DYCA 1FJLA 3S1QJ 3QPSA 3Q3SA 3SDGA 2R92J 1B8IA 1MBGA 5BNGA 1HLVA 1WH7A 2TRTA 2EZIA 1JTYA 3TW7A 4QTRA 3HOWJ 1ZR4A 5IYBJ 4IHYA 1MSEC 1FIPA 1APLC 2ME0A 3FK7A 4C3HJ 1ZQ3P 3HOZJ 2M9HA 1U8BA 3MVPA 2FX0A 3JREA 4BBSJ 3CMYA 2EBIA 4A3CJ 3GTQJ 2HQ5A 5C4JJ 1YRNA 2JMWA 2XPUA 4A3BJ 1VI0A 3M4OJ 2H1KA 5K7HA 2R93J 5F08A 2XGEA 2HOTA 1ZGWA 2HOAA 2NVTJ 3TW6A 1LFUP 2JA8J 1RKWA 2N8GA 3ZQHA 5EZGA 2XPWA 3BR1A 3LSJA 1Y1VJ 2Y2ZA 3LSPA 2DMPA 1VF9A 3HGGA 4A3DJ 4J19A 5FLMJ 3FISA 2R5ZB 2OPTA 4FE4A 2LTPA 4M3GA 3GTKJ 5F0CA 1U9NA 2JN6A 2L9RA 4CYCB 1IV6A 1Z0XA 3DEWA 2JJ7A 2AO9A 4A93J 2FJ1A 4UUSA 2GLOA 1Y1WJ 4L5EA 3ZQIA 2CQQA 2EH3A 1SFOJ 3I4NJ 1XC5A 4IHXA 1MBHA 1K61A 1MBKA 5M3FJ 5FLVA 1B72B 1NTCA 4ABZA 3RZOJ 1WI3A 5M3MJ 2MW8A 2CJJA 2O9LA 1JKPC 1AU7A 1Z77A 3HDDA 2E1OA 4M3DA 3DCFA 2PMZN 2IAIA 4XICA 3BR6A 1HOMA 2CRGA 2ZB9A 2QF7A 4M3BA 2R5YA 1MBJA 4C2MJ 3M3YJ 2DTZA 3PM1A 2CU7A 4V2FA 3RKQA 1JUMA 2Y30A 2AHQA 1FTTA 3ZQGA 2ECBA 3PO2J 1JKOC 2LK2A 1E3OC 3CDLA 1H89C 4AYBN 1W0UA 5M5YJ 1F36A 3IH4A 1IDYA 2L0KA 4FISA 3WHBA 1ETXA 1TWHJ 2HXIA 2XB0X 4Y52J 2E2IJ 2EZKA 2L7ZA 3GTLJ 5EDNA 2IEKA 4IEJA 1VFCA 3GTPJ 2LFBA 2NS7A 1JGGA 3BG9A 3MN2A 1MBEA 1A6IA 2H8RA 1JJ6C 1DU0A 1P7IA 1ETVA 2VKVA 3QPLA 2R5ZA 1ENHA 3JRGA 5IOYA 4DYRA 3LNQA 2FD5A 1BL0A 4MLOA 2NVQJ 3H0GJ 2D5VA 4DYQA 4XIDA 2ID6A 3G1LA 5J1UA 2LLKA 3OIOA 2IBDA 1G2HA 4MIMA 3A01B 3G1OA 4X1EA 4A3FJ 2NVXJ 1WGXA 2RAEA 1GVDA 1MH3A 2KT0A 9ANTA 1RESA 4RDUA 3JRCA 1O4XA 1IDZA 3GTJJ 3PO3J 3BG5A 4JYKA 1YRNB 5FKLA 1ETWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUF B;  3FK6 A;  3JRI A;  3IH2 A;  1WCM J;  5E3L A;  1IC8 A;  1ZTR A;  2DMT A;  2LKX A;  1X2N A;  2I10 A;  4M3E A;  2W48 A;  3FIW A;  4FE7 A;  4A69 C;  3S17 J;  1EF4 A;  5EGO B;  4I76 A;  2LY9 A;  3HKZ N;  4NDL A;  3S14 J;  3E7L A;  2HOS A;  3OSF A;  2NOG A;  4BBR J;  1AKH B;  3HGY A;  1R9T J;  3GTO J;  2M0C A;  3ZQC A;  4JX4 A;  2VPR A;  2Y0S N;  3S1M J;  3JRF A;  3SJM A;  1HCR A;  4B1R A;  1GV2 A;  2XRL A;  3TP3 A;  5J3L A;  5FKO A;  5C3E J;  1I50 J;  3ZOB A;  2O8K A;  1IRZ A;  1GUU A;  3S1R J;  5DTD A;  4B3A A;  5E3O A;  1S7E A;  5E3M A;  1Q1V A;  5EEA A;  2QCO A;  5IPA A;  1GDT A;  1ETO A;  1TC3 C;  1NK3 P;  1JUS A;  4A3E J;  2LP0 A;  2NS8 A;  4MO7 A;  5IYD J;  2CUF A;  2HYJ A;  5C4X J;  2COB A;  2JA5 J;  2WV1 A;  2VKE A;  1RR7 A;  5EG0 A;  3BTC A;  1X2M A;  3JRA A;  4M6V A;  1RET A;  1TWF J;  2WB1 N;  2XPV A;  1UHS A;  2Y9Y A;  3HB9 A;  3JR9 A;  2CQX A;  1AKH A;  1LE8 A;  2ME6 A;  2DA4 A;  1B8I B;  3LSR A;  2OF7 A;  1HDP A;  1HDD C;  1BW6 A;  1I6H J;  1ZKG A;  3HOU J;  3NAR A;  5FKK A;  3A01 A;  5GPA A;  2L7F P;  3HEF A;  5E3N A;  2DA1 A;  2MG4 A;  4C3I J;  2HI3 A;  2HDD A;  5J1R A;  4G12 A;  3W6V A;  2Y31 A;  4W97 A;  3O8H A;  2E2J J;  3A02 A;  2R5Y B;  3K7A J;  3CCY A;  4AC0 A;  3HOY J;  5K7F A;  3VPR A;  3A03 A;  1IGN A;  1LE8 B;  2L7M P;  5M5X J;  4C3J J;  2HXO A;  4X6A J;  1POG A;  3HOX J;  1H88 C;  1GV5 A;  2E2H J;  2DA5 A;  2X48 A;  1H8A C;  4MFE A;  3CQZ J;  1XG1 A;  1RPW A;  3SFI A;  1ETY A;  2YU9 J;  2DN0 A;  2YS9 A;  1JKR C;  1BJZ A;  4BY7 J;  3Q0W A;  2LD5 A;  1NK2 P;  3BQY A;  5EG0 B;  2K40 A;  2P81 A;  5F27 A;  5F0H A;  3GTM J;  3GTG J;  3TP0 A;  3S2H J;  3BTL A;  1X58 A;  2JA7 J;  2XGC A;  4CYC A;  5EF6 A;  3BR5 A;  4FTH A;  2GM4 A;  2DA6 A;  1MNM C;  3B6A A;  3HOV J;  1ITY A;  5F0F A;  1QVU A;  1QVT A;  5FKN A;  3MKL A;  1F43 A;  1MSF C;  1ORK A;  2DJN A;  5K7Z A;  1JTX A;  5IP9 J;  1IUF A;  1TWC J;  4W1U A;  5JLX A;  4HNV A;  5GP9 A;  3BTJ A;  4UUT A;  4EEF G;  2ELK A;  1JJ8 C;  5IP7 J;  1GT0 C;  3S15 J;  3FKI J;  4B4C A;  3F0C A;  1IJW C;  3BT9 A;  3LOC A;  5HOD A;  1MBF A;  3NAU A;  3O8G A;  1B72 A;  4IHV A;  1RKT A;  2EZL A;  3BR3 A;  1VND A;  1IG7 A;  5EGO A;  3IV5 A;  4JX6 A;  4D5C A;  4I6Z A;  1U78 A;  3BR0 A;  4M3F A;  4BY1 J;  2KDZ A;  3ZQF A;  3I4M J;  1P7J A;  2M8G X;  4FCY A;  5DS9 A;  4MFD A;  2LVS A;  1SAN A;  1TWG J;  5IP6 A;  4XRS G;  3LSG A;  2NVY J;  5JLW A;  1K83 J;  3BQZ A;  4JX5 A;  1OFC X;  4UUS B;  2Y9Z A;  5EZH A;  2YUS A;  3G1M A;  5C44 J;  4D7M A;  4BXX J;  3K2A A;  1UMQ A;  1ETK A;  4S0H B;  2K9Q A;  1XS9 A;  1WH5 A;  3Q0U A;  4D7N A;  3S16 J;  4DZP A;  2MSY A;  3QQA A;  3IH3 A;  1LFB A;  1ZK8 A;  3HM5 A;  2K9S A;  5M5W J;  4A3G J;  5IOZ A;  2R0Q C;  2DMQ A;  3HBL A;  1U9O A;  4XRM A;  4D5F A;  2JWT A;  2MGQ A;  3TED A;  2JA6 J;  4LOC A;  2DA7 A;  3S1N J;  2DMU A;  4GFB A;  3BTI A;  3ZQL A;  2LR8 A;  2DA2 A;  3JRD A;  2CUE A;  4JP0 A;  5EYR A;  4Y7N J;  2E19 A;  5GPC A;  2G0E A;  1JUP A;  5IYC J;  4AUX A;  1FTZ A;  1T33 A;  5F1J A;  3BR2 A;  3OSG A;  3BG3 A;  1TWA J;  4A3I J;  1ETQ A;  4A3K J;  2XGD A;  4A3M J;  1DU6 A;  4DW6 A;  2R7Z J;  1WPK A;  2JK3 A;  3OOU A;  3RQI A;  2X9D A;  5J1Y A;  1QRY A;  1UG2 A;  2ECC A;  1T56 A;  2M2E A;  4RBO A;  2DA3 A;  4BKX A;  2M34 A;  2DMN A;  1JT0 A;  1A5J A;  4A3J J;  3RZD J;  5FJ8 J;  2VUM J;  4A3L J;  1OJL A;  3D1N I;  1BW5 A;  1ZR2 A;  4QIW N;  1QPI A;  3B6C A;  5F04 A;  4IHW A;  4QSH A;  2FQ4 A;  3L1P A;  3JRH A;  1MH4 A;  3WHC A;  2X6O A;  3JRB A;  4V2G A;  4DZJ A;  3C2B A;  1HF0 A;  2K9N A;  3UKG A;  2EQR A;  1FEX A;  1D5Y A;  1W0T A;  2XB5 A;  4XRS A;  3GBG A;  4XK4 A;  1JT6 A;  1I3Q J;  2O7O A;  1CQT A;  2ID3 A;  3Q0V A;  2WAQ N;  2B63 J;  2XSD C;  1PUF A;  2VI6 A;  1FIA A;  5FKM A;  1JKQ C;  1OCP A;  1AHD P;  1OCT C;  2TCT A;  2EZH A;  3S2D J;  2GBY A;  1BA5 A;  3H3V K;  4DYC A;  1FJL A;  3S1Q J;  3QPS A;  3Q3S A;  3SDG A;  2R92 J;  1B8I A;  1MBG A;  5BNG A;  1HLV A;  1WH7 A;  2TRT A;  2EZI A;  1JTY A;  3TW7 A;  4QTR A;  3HOW J;  1ZR4 A;  5IYB J;  4IHY A;  1MSE C;  1FIP A;  1APL C;  2ME0 A;  3FK7 A;  4C3H J;  1ZQ3 P;  3HOZ J;  2M9H A;  1U8B A;  3MVP A;  2FX0 A;  3JRE A;  4BBS J;  3CMY A;  2EBI A;  4A3C J;  3GTQ J;  2HQ5 A;  5C4J J;  1YRN A;  2JMW A;  2XPU A;  4A3B J;  1VI0 A;  3M4O J;  2H1K A;  5K7H A;  2R93 J;  5F08 A;  2XGE A;  2HOT A;  1ZGW A;  2HOA A;  2NVT J;  3TW6 A;  1LFU P;  2JA8 J;  1RKW A;  2N8G A;  3ZQH A;  5EZG A;  2XPW A;  3BR1 A;  3LSJ A;  1Y1V J;  2Y2Z A;  3LSP A;  2DMP A;  1VF9 A;  3HGG A;  4A3D J;  4J19 A;  5FLM J;  3FIS A;  2R5Z B;  2OPT A;  4FE4 A;  2LTP A;  4M3G A;  3GTK J;  5F0C A;  1U9N A;  2JN6 A;  2L9R A;  4CYC B;  1IV6 A;  1Z0X A;  3DEW A;  2JJ7 A;  2AO9 A;  4A93 J;  2FJ1 A;  4UUS A;  2GLO A;  1Y1W J;  4L5E A;  3ZQI A;  2CQQ A;  2EH3 A;  1SFO J;  3I4N J;  1XC5 A;  4IHX A;  1MBH A;  1K61 A;  1MBK A;  5M3F J;  5FLV A;  1B72 B;  1NTC A;  4ABZ A;  3RZO J;  1WI3 A;  5M3M J;  2MW8 A;  2CJJ A;  2O9L A;  1JKP C;  1AU7 A;  1Z77 A;  3HDD A;  2E1O A;  4M3D A;  3DCF A;  2PMZ N;  2IAI A;  4XIC A;  3BR6 A;  1HOM A;  2CRG A;  2ZB9 A;  2QF7 A;  4M3B A;  2R5Y A;  1MBJ A;  4C2M J;  3M3Y J;  2DTZ A;  3PM1 A;  2CU7 A;  4V2F A;  3RKQ A;  1JUM A;  2Y30 A;  2AHQ A;  1FTT A;  3ZQG A;  2ECB A;  3PO2 J;  1JKO C;  2LK2 A;  1E3O C;  3CDL A;  1H89 C;  4AYB N;  1W0U A;  5M5Y J;  1F36 A;  3IH4 A;  1IDY A;  2L0K A;  4FIS A;  3WHB A;  1ETX A;  1TWH J;  2HXI A;  2XB0 X;  4Y52 J;  2E2I J;  2EZK A;  2L7Z A;  3GTL J;  5EDN A;  2IEK A;  4IEJ A;  1VFC A;  3GTP J;  2LFB A;  2NS7 A;  1JGG A;  3BG9 A;  3MN2 A;  1MBE A;  1A6I A;  2H8R A;  1JJ6 C;  1DU0 A;  1P7I A;  1ETV A;  2VKV A;  3QPL A;  2R5Z A;  1ENH A;  3JRG A;  5IOY A;  4DYR A;  3LNQ A;  2FD5 A;  1BL0 A;  4MLO A;  2NVQ J;  3H0G J;  2D5V A;  4DYQ A;  4XID A;  2ID6 A;  3G1L A;  5J1U A;  2LLK A;  3OIO A;  2IBD A;  1G2H A;  4MIM A;  3A01 B;  3G1O A;  4X1E A;  4A3F J;  2NVX J;  1WGX A;  2RAE A;  1GVD A;  1MH3 A;  2KT0 A;  9ANT A;  1RES A;  4RDU A;  3JRC A;  1O4X A;  1IDZ A;  3GTJ J;  3PO3 J;  3BG5 A;  4JYK A;  1YRN B;  5FKL A;  1ETW A; 
#chains in the Genus database with same CATH topology
 3JRI A;  1IC8 A;  4EGZ A;  1Y6I A;  3U21 A;  2DOF A;  1YHQ I;  2IP2 A;  4G94 A;  5GAH J;  2I10 A;  1U0J A;  2ZXI A;  3V7C A;  3OYL A;  3J7Z I;  4M3E A;  3A0H C;  4FE7 A;  3C3W A;  3ECH A;  1EF4 A;  2PMZ A;  2V9P A;  3O3K A;  4CCN A;  3I58 A;  4LMY A;  1AOY A;  3E7L A;  4A5M A;  3OSF A;  2HOS A;  1SAX A;  4OMY A;  1HQC A;  1AKH B;  4IRH A;  3DF8 A;  2DFF A;  3HUG A;  1R9T J;  4M6X A;  5FO5 A;  1FBU A;  3HZJ A;  4LD5 A;  1UHW A;  2VPR A;  2Y0S N;  1TBX A;  3PSI A;  1MJA A;  3JRF A;  2JRT A;  2QEN A;  5C3E J;  5FKO A;  2YSR A;  3DEE A;  1VQO I;  3FXM A;  5H20 A;  4CH7 A;  1UFM A;  1O3S A;  1GUU A;  1L0O C;  1S7E A;  2VQG A;  5E3M A;  3OYI A;  1LVK A;  4ESB A;  4XM3 A;  1LDK B;  3HSF A;  2OUM A;  2IPQ X;  4BS9 A;  4A3E J;  4L9J A;  4RB1 A;  5C4X J;  1F5T A;  2QKM B;  5JR3 A;  3BTC A;  1V5F A;  3JRA A;  4M6V A;  2LF8 A;  2X1E A;  1T39 A;  4XLF A;  1LE8 A;  3WOD F;  3K4J A;  5D5W B;  4P5O A;  1BW6 A;  1R71 A;  4HST A;  3CC4 I;  3NAR A;  1UHM A;  1T8I A;  2EIM H;  2NNY A;  3OYH A;  4BEH B;  2L7F P;  3JSP A;  1ZRF A;  2W25 A;  2VOP A;  2HZD A;  1R22 A;  2OU2 A;  3CMA I;  4G12 A;  4W97 A;  1XDS A;  4DNC A;  2VKD A;  2VBX A;  3CZ6 A;  1Z3X A;  3K7A J;  3CCY A;  4AC0 A;  3HOY J;  3OWT A;  4C3J J;  1WVR A;  2KLO A;  4BE0 A;  4X6A J;  3G4S I;  1H88 C;  1P4W A;  3MWM A;  3K69 A;  4GYI A;  1U3E M;  4ENN A;  1R5H A;  1FYK A;  1MND A;  1XG1 A;  4WX9 A;  3TO6 A;  2YU9 J;  2BHZ A;  2DN0 A;  2IRF G;  4OU0 A;  4RM2 A;  5CVU A;  1BJZ A;  1Y0U A;  3DP7 A;  3Q0W A;  3V42 A;  1G6N A;  3A1Y A;  4F7Z A;  4KN4 X;  2KP6 A;  3BJ6 A;  3IWF A;  3BQY A;  5EG0 B;  5F27 A;  1E3P A;  3QP6 A;  2E71 A;  4BJ6 C;  2KRF A;  3OL4 A;  3BR5 A;  3ABT A;  2GM4 A;  2DA6 A;  3OYD A;  2IVM A;  3W6K B;  4U7D A;  3VSK A;  3CO7 C;  4XON A;  5FKN A;  1U5T B;  5F6F A;  1F43 A;  1X3U A;  1JE8 A;  3A4C A;  4A0Y A;  4RM3 A;  5K7Z A;  1QGP A;  2XF6 A;  2ZBK A;  5IP9 J;  5FB2 A;  1IUF A;  2K5C A;  1TWC J;  1P2F A;  2GA2 A;  3FBI B;  4W1U A;  2HQA A;  5GP9 A;  3BTJ A;  4LLG F;  1YW9 A;  2ELK A;  4RB2 C;  1W7P B;  2FF4 A;  1ZRE A;  3FKI J;  4HW0 A;  3HXL A;  5HDK A;  2OZ6 A;  3TBI A;  4J00 A;  2DQR A;  5FRN A;  3DU5 A;  3GVA A;  3V8K A;  3FXR A;  1LEA A;  4L9N A;  4IHV A;  2QA4 I;  4N0B A;  4NNJ A;  1EA3 A;  4DBQ A;  5LLQ A;  2DOD A;  4F92 B;  2OV7 A;  2XAS A;  3IV5 A;  3W2A A;  4D5C A;  3BR0 A;  2DOA A;  2Q0O A;  1P9Q C;  2M8G X;  2GOM A;  2MAB A;  3EUA A;  1G59 A;  2DFE A;  3Q9S A;  3RQ4 A;  1TWG J;  2R7V A;  2XRO A;  3DLL F;  4XRS G;  2XF5 A;  1Z6R A;  2NVY J;  3LSG A;  3ZMT A;  5E8I A;  3D5S C;  1R00 A;  4BHP A;  4BDZ A;  2VBY A;  4KMF A;  2LSO A;  2M30 A;  2XAQ A;  4H0E A;  4U0W A;  2JTV A;  3K6G A;  1TZL A;  3R0J A;  2HPM A;  2ZO4 A;  3I53 A;  1Y0N A;  4O6J A;  4F91 B;  4BXX J;  2QQ9 A;  2DFH A;  2KQR A;  1IXR C;  2K9Q A;  1WH5 A;  4D7N A;  1Z3Y A;  1QBJ A;  5E1W A;  1JXS A;  3QQA A;  1LFB A;  2AXL A;  3HM5 A;  5D8L B;  1I39 A;  4UVC A;  5M5W J;  3FX3 A;  1WKM A;  4G7O F;  3I54 A;  4XRF A;  1TL8 A;  4R1H A;  1PJR A;  3OMY A;  4LIT A;  1GXP A;  3BY6 A;  3HOS A;  4Y17 A;  3ZPL A;  4GFB A;  5B1B H;  1Z91 A;  4FAS D;  1OPC A;  3ZQL A;  4MHG A;  3T8T A;  3OL3 A;  2KPM A;  4JP0 A;  1CF7 A;  5ICE A;  1WJ5 A;  4A2U A;  5IYC J;  1VQK I;  1T95 A;  4A3I J;  2X4H A;  4A3K J;  1HW5 A;  4HRI A;  1MIJ A;  2GXG A;  1V55 H;  4A3M J;  2Z33 A;  1DU6 A;  1P6R A;  4IO9 F;  5J1Y A;  3MZY A;  4HNT A;  4E4H A;  4GCV A;  1G3S A;  2DDA A;  4UHT A;  4A6D A;  2KFD A;  1O3T A;  1WFX A;  2F2E A;  4F55 A;  1HA8 A;  3CCV I;  4IZZ A;  4HDU A;  1BW5 A;  2PLY A;  3GFJ A;  2FRH A;  2ZC2 A;  3RYP A;  1R7J A;  2XRN A;  3HHG A;  1S5L C;  1D1B A;  5CJ9 A;  1IXC A;  1FX7 A;  2DPD A;  2A3S A;  2FQ4 A;  4KIT B;  4XLN F;  2F5C A;  2RQP A;  3C2B A;  1HF0 A;  2Z9O A;  3EPZ A;  2DAO A;  5FRM A;  4M9S A;  2Q8K A;  3AG3 H;  2LYC A;  3Q9V A;  5FFX A;  2LNB A;  1VQL I;  3JAM K;  2VQH A;  4RAF A;  3ESW B;  1YJN I;  4PZJ A;  2KKO A;  2XUB A;  1I3Q J;  2VBW A;  2O7O A;  2WBM A;  3TKY A;  2A68 F;  2WAQ N;  1CQT A;  2B63 J;  3K1M A;  3WTS C;  3FMQ A;  2NOJ B;  2M4K A;  4NC8 A;  1OCP A;  3T8R A;  2H6B A;  1K78 A;  2TCT A;  3S2D J;  3WG7 H;  1BA5 A;  4NC7 A;  2CS3 A;  4DYC A;  1W7P A;  3R60 A;  1WRJ A;  3SEZ A;  2R92 J;  3BG7 A;  2O0Y A;  4CA0 A;  1B4A A;  1F1Z A;  3JSO A;  1WH7 A;  2WA0 A;  3OY9 A;  2UXX A;  3TW7 A;  1WQ2 A;  5GTI C;  3CF5 F;  3TOB A;  1J5Y A;  4RB3 C;  2BEO A;  2OD5 A;  2A61 A;  1MSE C;  3VYT B;  4HLX A;  4BL0 B;  4ZZL A;  3FK7 A;  3VWB A;  2P6S A;  4FHT A;  2D1H A;  2ZSH B;  3H5R A;  4ON0 A;  1VQ7 I;  3ABU A;  4BJT A;  2COM A;  3I0T A;  5CVI A;  3U2R A;  4BBS J;  4ENK A;  4NBQ A;  2EBI A;  3GTQ J;  2HQ5 A;  3HRU A;  1FNN A;  2FMY A;  3NWS A;  2BZT A;  5LFA A;  2XPU A;  3H9J A;  1L3L A;  1K6Y A;  2R93 J;  1UG0 A;  2HS5 A;  2LF7 A;  2HOT A;  3DFG A;  3TW6 A;  3K4L A;  5L3F A;  5HS9 A;  4L5J A;  2L9S A;  1H9T A;  2H6C A;  5EZG A;  3BR1 A;  1A31 A;  2Y2Z A;  2D1V A;  1P4X A;  5DCF A;  2IA0 A;  3DPL C;  3V7R A;  3COA C;  3HGG A;  2BW3 B;  4HYE A;  1KA8 A;  3ZN0 A;  4EM2 A;  3BOQ A;  3FIS A;  4PCQ A;  2HYF A;  1Z21 A;  4LFU A;  2ZFU A;  5HLT A;  2Z5U A;  1P92 A;  1UJ8 A;  2CYY A;  3QP5 A;  1FSH A;  4HZF A;  2B0L A;  4FE4 A;  1UB9 A;  2X1C A;  4DIQ A;  5F0C A;  1U9N A;  3GTK J;  2QVO A;  5L3D A;  1Z7U A;  2F5V A;  2JN6 A;  1IO2 A;  2M4G A;  2X1D A;  1U6G A;  2DYS H;  3LFK A;  4E7S A;  2FJ1 A;  2GLO A;  3J7A O;  1FSE A;  3KP4 A;  2EH3 A;  1BC7 C;  3KEO A;  5M3F J;  4DQ2 A;  1DDN A;  1BI0 A;  4OIR F;  2IW5 A;  4KUM A;  1ZG3 A;  2F5D A;  4IF4 A;  1O7F A;  3DCF A;  2EJR A;  3I64 A;  4BAC A;  4IJA A;  3J7A Y;  4CZZ A;  1XPX A;  1LJ9 A;  1YO5 C;  2MH9 A;  2ZB9 A;  4LG3 A;  2JVG A;  3FHN A;  2ZFW A;  3CJN A;  1J9I A;  3E5Q A;  2E1M B;  2DTZ A;  1FBQ A;  2ZME A;  3RI4 A;  4V2F A;  1SFE A;  3DKX A;  3H1C A;  4U7B A;  1FTT A;  3PO2 J;  1JKO C;  3I71 A;  3M1C A;  1BC8 C;  1W0U A;  1LUJ B;  5M5Y J;  1F36 A;  3IH4 A;  4HF2 A;  4UB8 C;  3S2W A;  1HKT A;  2R7S A;  2PJP A;  2KDO A;  3BPV A;  3G2B A;  4Y52 J;  3DV8 A;  2EZK A;  2KIQ A;  3P7N A;  4XLH A;  4QPQ A;  4E7L A;  1RUO A;  2MC3 A;  4UVA A;  3PQK A;  1T6S A;  2IEK A;  2LFB A;  2NS7 A;  2K85 A;  2I5U A;  1MBE A;  1IRF A;  3M8F A;  2V1U A;  1YJ9 I;  1ZH5 A;  4EJU A;  4I0B A;  4CXF A;  1DU0 A;  2AS5 F;  1ETV A;  2FA5 A;  2BOL A;  3HOT A;  4B43 A;  4II2 A;  3LQQ A;  5ILS A;  5BPD A;  1USS A;  2KRH A;  1LDJ A;  4Q47 A;  3OS1 A;  1BOB A;  4XR6 A;  2VLA A;  1YI2 I;  1R49 A;  4OWR B;  4UB6 C;  3PFY A;  1IN6 A;  1BL0 A;  1QHH D;  2NVQ J;  1JHH A;  2D5V A;  5IY5 H;  2LLK A;  2LRE A;  1T2K A;  2IBD A;  4Y3O A;  3G1O A;  2YU3 A;  4X1E A;  3BDD A;  4KIC A;  1WGX A;  2RAE A;  3RDI A;  4RDU A;  3JRC A;  1UST A;  3GFL A;  4AU7 A;  1YX5 A;  3DLA A;  1MMN A;  2DT6 A;  3MD2 A;  4BXU A;  3BP8 A;  4JYK A;  2OCE A;  1ETW A;  1O3Q A;  3ABL H;  1U5T A;  3RKX A;  1WCM J;  2WAF A;  2LKX A;  5BPI A;  3KET A;  4IQJ A;  4BHC A;  4EJW A;  2EIL H;  1UZC A;  5EJC A;  3S17 J;  1SVM A;  4S04 A;  2G7U A;  5EGO B;  1YS6 A;  3HKZ N;  3D5R C;  4GYG A;  4UV9 A;  2E36 A;  3F6V A;  3LWF A;  4GRI A;  1G8X A;  3KE2 A;  2HVS A;  3ZMS A;  2RRE A;  2VIX A;  3B73 A;  1XCB A;  3ZMD A;  1X4P A;  3S1M J;  1MMG A;  5J3L A;  2JSC A;  3I3L A;  3RKW A;  3ZOB A;  2GXB A;  4PUS A;  2O8K A;  1IRZ A;  2FNP A;  1ULY A;  2HWV A;  5DTD A;  1R4M B;  5IT9 K;  4MEY F;  5E3O A;  2DFI A;  3KYD B;  1Q1V A;  5EEA A;  5ICG A;  1S72 I;  1HBX G;  2FML A;  1GDT A;  3QOP A;  4KJZ A;  1NK3 P;  5AIQ A;  1JUS A;  2G7H A;  2NS8 A;  4MO7 A;  2CUF A;  2COB A;  2JA5 J;  2WV1 A;  2GOX B;  1QZZ A;  3GX4 X;  1X2M A;  2VXD A;  1TWF J;  2XPV A;  3SHF A;  3HG9 A;  1SFX A;  2VJ4 A;  2KMU A;  3WE2 A;  3JR9 A;  3WGG A;  2OCC H;  2CQX A;  3LAP A;  3WU2 C;  2DLL A;  2JUG A;  2KIU A;  2BHY A;  1CF7 B;  3LSR A;  2OF7 A;  1HDP A;  2KHM A;  3H36 A;  3BG6 A;  1HDD C;  5IT3 A;  1ZKG A;  3HOU J;  1XSD A;  5J6X A;  2E34 A;  3F3X A;  1Y8Q B;  2A6H F;  5FKK A;  2XKP A;  3A01 A;  4LK1 F;  3HEF A;  1T08 B;  2V9V A;  5E3N A;  3QU3 A;  4YII A;  3JAM Z;  3VDX A;  4P9U A;  3IRR A;  4V19 K;  1QZY A;  2UZK A;  3VPR A;  3A03 A;  3WTW C;  3QU6 A;  4FET A;  4H4K C;  1NH3 A;  2DJI A;  2HXO A;  1POG A;  2EA2 A;  5KCM A;  3BZK A;  3QAH A;  3CLO A;  3IUO A;  2E2H J;  1XN7 A;  3RTR A;  5E8G A;  1ERD A;  2X48 A;  4DOZ A;  1DPR A;  3L2W A;  4IRI A;  4EJV A;  5FLX Z;  4N9I A;  2IS2 A;  1R1T A;  1YLF A;  3BZ6 A;  4BY7 J;  2XIG A;  3ZGK A;  2BBY A;  4EAT A;  2VAS A;  2OAZ A;  4IRG A;  4KFC A;  3DWL E;  4YG2 F;  5E17 F;  1IAW A;  2OJE D;  5F0H A;  4ZH4 F;  1DUX C;  3TP0 A;  5JVG F;  1G4D A;  2VPL A;  3B02 A;  2CO5 A;  2M87 A;  2XGC A;  2JA7 J;  5EF6 A;  1ONV A;  4FTH A;  1MNM C;  3HOV J;  3VB2 A;  1QVU A;  1QVT A;  3H9G A;  2Z1D A;  3JW4 A;  4RB0 A;  4YFK F;  2XKO A;  3K4M A;  2NNN A;  3M1E A;  2ICW G;  2MLG A;  5JLX A;  1W5S A;  1GLN A;  1SD6 A;  1W36 D;  1JJ8 C;  1GT0 C;  3S15 J;  2HQR A;  2ZME B;  1FOW A;  2LY2 A;  3KCC A;  3SDB A;  1X1B A;  5LGN A;  1IJW C;  3GW2 A;  1R23 A;  3LOC A;  3M07 A;  3O8G A;  1QNT A;  3TGN A;  2IGK A;  2YR2 A;  2Y75 A;  3ERM A;  1VND A;  3QRF F;  4B44 A;  2QBY B;  4G7H F;  5B1A H;  1U78 A;  5FRO A;  3F6O A;  4I6Z A;  3IC7 A;  2ETH A;  3GZ6 A;  2DQL A;  1P7J A;  5DS9 A;  3E5X A;  5DV5 A;  4OAY A;  2EFN A;  3G71 I;  3F8B A;  2VT3 A;  5IP6 A;  1ZRD A;  2KZG A;  3NWT A;  5DYM A;  4GXO A;  4HX4 A;  3AL0 C;  1YTY A;  2KIM A;  3BQZ A;  4YEL A;  3HPH A;  3OR1 C;  3WTV C;  2Y9Z A;  5E20 A;  2YUS A;  5EZH A;  4LIV A;  2R7F A;  1LPQ A;  1RI7 A;  3G1M A;  4D7M A;  4S0H B;  3GWZ A;  4LK0 F;  3DXJ F;  3X2Q H;  4BNC A;  3MZ8 A;  1NG7 A;  5ICF A;  2VB6 A;  1G3Y A;  1S9H A;  2M7B A;  1QPM A;  1ZK8 A;  3DTI A;  3PSF A;  2K9S A;  5TGT A;  2F4O B;  5IOZ A;  1HST A;  1ZAR A;  2L2O A;  5L3B A;  2W82 A;  2R0Q C;  1BOA A;  1FP2 A;  1U9O A;  3CUQ C;  4D5F A;  2JWT A;  3TED A;  4LOC A;  1EH7 A;  3K4N A;  3S1N J;  2DPU A;  2K4J A;  4EGY A;  3OYA A;  1K4T A;  3LSK A;  2W85 A;  2DA2 A;  3I59 A;  1N75 A;  2L7K A;  4M9X A;  4Y7N J;  1I1G A;  2GQQ A;  5GPC A;  2W00 A;  2L01 A;  3ZN1 A;  2ZJP F;  2DOE A;  1T33 A;  4YRV A;  1FTZ A;  3HC7 A;  3AG1 H;  5E18 F;  1YS7 A;  1YG2 A;  4PGG A;  4DW6 A;  4DJA A;  5HLG A;  2R7Z J;  3OOU A;  5LHH A;  1HKQ A;  3GO5 A;  2GIV A;  1WHU A;  2PN6 A;  1QRY A;  1UG2 A;  3LQR A;  1IV8 A;  2XGX A;  2VJI A;  1T56 A;  2DXI A;  1G3T A;  2X51 A;  3HRM A;  5GAE J;  4BKX A;  2DMN A;  1T0F A;  1AWC A;  1A5J A;  5FJ8 J;  2ELJ A;  4GDF A;  2VUM J;  3WGH A;  1OJL A;  2Y69 H;  1X1P A;  1OMI A;  1WJB A;  1ZR2 A;  3VSL A;  1XGN A;  1F4K A;  4I02 A;  5LGT A;  2E60 A;  2P4W A;  2E5N A;  4IHW A;  2L9N A;  4G9Y A;  1I1S A;  5LGU A;  3H35 A;  3E3V A;  3JRB A;  4V2G A;  4A6E A;  2GZW A;  3SZG A;  2ZNY A;  1YIJ I;  5J47 A;  1SVL A;  2TDX A;  3GF2 A;  5D4S A;  4AWX B;  3UKG A;  5DUI A;  1IN8 A;  2OZU A;  5E1Z B;  4CDG A;  1K7A A;  2P5K A;  1TNS A;  3GEZ A;  5CKT A;  1FOX A;  1MW7 A;  5E79 C;  1FEX A;  1D5Y A;  2A6E F;  3EUK L;  3HRS A;  4TV7 A;  1OQY A;  5B66 C;  1KQ9 A;  2XB5 A;  1TQP A;  2DDB A;  5DM7 F;  2K4B A;  4XK4 A;  3GYH X;  1FP1 D;  5ILV A;  3LL7 A;  4BH9 A;  5GAD J;  1PUF A;  2VI6 A;  4XOR A;  2PBI A;  5FKM A;  1EH6 A;  3F23 A;  2EV6 A;  2EZH A;  3VOE A;  5KK1 A;  3M8J A;  3H3V K;  2BY0 A;  1FJL A;  1PDN C;  3Q3S A;  1LB2 A;  5LD2 C;  2UWM A;  3PNV A;  1XSV A;  5L3E A;  3K4C A;  1SMY F;  3DQV C;  2EZI A;  4MNU A;  2LY1 A;  2LRD A;  5DDG A;  1RUN A;  2HFH A;  5HLI A;  2IGO A;  2WTE A;  5JFR A;  2ZCW A;  2ME0 A;  2EV0 A;  2P7V B;  3HYI A;  2CQ7 A;  4XOP A;  1KU9 A;  4HF0 A;  4C3H J;  1U8B A;  3MVP A;  5ED4 A;  4M74 A;  2FX0 A;  4EJO A;  3JRE A;  2V1X A;  2K7L A;  2P8T A;  3CCE I;  1V4R A;  5C4J J;  1YRN A;  2QQ8 A;  1YJW I;  4MEX F;  3TQN A;  2JMW A;  2A6T A;  1S6L A;  3ZCO A;  1AA7 A;  1VI0 A;  3M4O J;  5K7H A;  3GZ5 A;  5F08 A;  2NVT J;  2DO7 A;  2K02 A;  2ESN A;  4E7K A;  4Q48 A;  2VL8 A;  3L2Q A;  2DI3 A;  3ZP5 A;  4HNU A;  3F8F A;  2DW4 A;  3L2R A;  2V26 A;  5H2F C;  1QA6 A;  5HDG A;  3R61 A;  1W5C C;  2ZME C;  1J75 A;  1WJE A;  4HAM A;  4Z2Y A;  2KIF A;  4IKF A;  2OPT A;  4KN7 X;  4XQF A;  3FDY A;  2GIZ A;  4M3G A;  2E1N A;  1ODD A;  1I3A A;  2L9R A;  1HKS A;  3WG9 A;  3KP2 A;  1GHC A;  1D1C A;  1RC9 A;  2XAJ A;  3ZQI A;  3ERE D;  4OIO F;  1ZEL A;  5FLV A;  1WJD A;  5D5U B;  2HKO A;  1B72 B;  3LA3 A;  1TP4 A;  4KA4 A;  1Q1H A;  2R7X A;  1S8N A;  4BQN A;  3EUH C;  2CJJ A;  5HDN A;  3KEQ A;  1Z77 A;  2FNA A;  2LH9 A;  1D1A A;  3DKY A;  1BI3 A;  2PMZ N;  3AAF A;  4P55 A;  3VEP A;  4NB5 A;  2KJB A;  4XLE A;  4NC6 A;  3MMY B;  4PDK A;  3IL2 A;  4G6D A;  4AVP A;  3TDZ C;  4XLC A;  2IT0 A;  4JBA A;  3ZQQ A;  2FUG 2;  3CJT B;  4AD9 A;  4U87 A;  2QF7 A;  2HTS A;  4MTD A;  2F5F A;  3DBR B;  1MBJ A;  4C2M J;  3RKQ A;  5K5O A;  2Y30 A;  1S7O A;  5D5V B;  3DBH B;  2AHQ A;  4PJJ A;  3ABM H;  1R36 A;  4ZZD A;  5DEQ A;  3L7W A;  2EPF A;  4AM3 A;  4KT6 A;  2WY7 Q;  3S3N A;  1MD0 A;  1TWH J;  2HXI A;  5D6F A;  1N78 A;  2D2W A;  2AXT C;  4RGS A;  3CTA A;  1X1C A;  4IEJ A;  1LFP A;  3GTP J;  1JGG A;  4BAY A;  4HA8 A;  1REP C;  1PYV A;  1JJ6 C;  2CFO A;  4AID A;  3E6B A;  2R5Z A;  2HVR A;  3JRG A;  5IOY A;  1O3R A;  1EV7 A;  2BXZ A;  2Z99 A;  1S7A A;  5F1R A;  1O7L A;  4KMU X;  4MLO A;  1DP7 P;  4L0Y B;  2M8E A;  2DYR H;  2ID6 A;  3G1L A;  5J1U A;  2JZY A;  1J0R A;  4MIM A;  4IL6 C;  3A01 B;  1FZP B;  4A3F J;  2VON A;  1R5I D;  2F5E A;  2Q2E B;  3MKW B;  2AQF A;  3JTH A;  1D5V A;  2UV1 A;  3QOD A;  4CHU A;  3CLQ A;  2ELH A;  2HVQ A;  1YRN B;  4IHY A;  1FOK A;  1ZGJ A;  1GXQ A;  3FK6 A;  3HUG B;  1PUF B;  2EK5 A;  1X2N A;  4PK4 A;  3F72 A;  3IAS 2;  4BJ5 C;  2H27 A;  1D8J A;  3HJE A;  2W48 A;  1E3H A;  5D6E A;  4CZC A;  1QO0 D;  3CDH A;  4YFX F;  2XDV A;  3O6B B;  4OIN F;  3OYB A;  4B8X A;  2KJC A;  4RLQ A;  2IGN A;  2LC2 A;  3J80 K;  4BBR J;  3EYI A;  3FMR A;  1CGP A;  3HGY A;  2RDP A;  2ZXH A;  2A07 F;  2M0C A;  1FMV A;  3ZQC A;  2Z2S B;  1DGR M;  3GXO A;  3JCU C;  2O3F A;  4JX4 A;  2XAU A;  3TO7 A;  4CGZ A;  3N05 A;  2PQ8 A;  3ZR8 X;  3SJM A;  4B1R A;  1GV2 A;  3PUB A;  5DCM A;  3TP3 A;  3RKY A;  3PNT A;  3HKZ A;  1I50 J;  3GUD A;  1R6R A;  4IQ4 A;  1W1W E;  1DGW Y;  4Y4R A;  4ZYD A;  3RJP A;  4WK8 F;  3IRQ A;  2L5Q A;  4XKW A;  1OYI A;  2WB1 A;  3FZV A;  1H9G A;  1SVO A;  1VQN I;  4YEJ A;  1ZLJ A;  3ZQ7 A;  1FWZ A;  4E7J A;  1YE9 A;  2QCO A;  3G3Z A;  1E17 A;  2R3S A;  5DUK A;  1WJC A;  3KFW X;  5IPA A;  2A5Y B;  1TC3 C;  4PFP A;  1BBY A;  2LP0 A;  2EA4 A;  5IYD J;  1FMW A;  2JPC A;  1NG6 A;  5HLH A;  1KQ0 A;  2VKE A;  5EG0 A;  5KVR A;  4RGU A;  2V79 A;  2EFW A;  1RET A;  4KT5 C;  2WB1 N;  1IN4 A;  2W7N A;  1UHS A;  2QKL B;  3HB9 A;  5K5R A;  4EM0 B;  1AKH A;  2OQG A;  2GAU A;  2ME6 A;  1LQ1 A;  1BI1 A;  3SFZ A;  1PUE E;  4II3 A;  1I6H J;  2E7X A;  1HW2 A;  5KHD A;  4L9T A;  4B48 A;  5JI6 A;  3TDU C;  4RMN A;  4OIP F;  1Z9C A;  5GPA A;  3OYN A;  1XTA A;  2GA1 A;  1E0E A;  1WJA A;  2MG4 A;  4C3I J;  2HI3 A;  4GGG A;  3LSH A;  4RS8 A;  2Y31 A;  3HSR A;  2E2J J;  1VQ8 I;  1LEB A;  3A02 A;  3PQJ A;  3R6S A;  5K7F A;  2VT2 A;  1BIA A;  1D3Y A;  2DK5 A;  5M5X J;  1LE8 B;  1ZYR F;  4XSZ F;  1W5T A;  1MJ9 A;  2STW A;  4KIG A;  1GV5 A;  4A12 A;  4N4O B;  3CJQ B;  1XGS A;  2BVM A;  3MCZ A;  3OYG A;  2DA5 A;  2R7O A;  1XB4 A;  4MFE A;  3CQZ J;  1ETY A;  1XSX A;  2EIN H;  2VQC A;  4CCL A;  2YS9 A;  4ITV A;  4PGH A;  1JKR C;  3S32 A;  3E1S A;  3BPX A;  2YPR A;  2LD5 A;  1NK2 P;  2MD5 A;  3H5N A;  2NVU B;  5K5Q A;  2H8W A;  3GTM J;  3BTL A;  2DBB A;  1DQU A;  1TQM A;  2E35 A;  3WU1 B;  2QM3 A;  4N4N B;  5ILU A;  1RIO H;  1U5T C;  3B6A A;  2JQ7 A;  5F0F A;  3OYF A;  3MKL A;  3V8L A;  3F21 A;  3R0A A;  4XKC A;  3R4K A;  1ORK A;  4WWC A;  1RR8 C;  1JTX A;  3FXU A;  3H0D A;  3MAJ A;  2D45 A;  4N9H A;  1WWX A;  4PSX A;  5FLX K;  4EEF G;  2P7C B;  3A2K A;  5IP7 J;  2OQR A;  3SQN A;  1Y8R B;  3LA7 A;  3BT9 A;  5HOD A;  2WWY A;  1X3Z B;  2HU9 A;  3AFH A;  2W57 A;  4G6Q A;  4BXF A;  1RKT A;  2EZL A;  1QQI A;  2YX7 A;  4E7I A;  3DTE A;  2X6W A;  1KYZ A;  4P9F A;  2HPI A;  4BY1 J;  3LFU A;  4M3F A;  2MA3 A;  3CME I;  2KDZ A;  2X6X A;  3HIF A;  3ZQF A;  3I4M J;  4FCY A;  3AG4 H;  1Z6T A;  2LVS A;  1SAN A;  3M8E A;  1LKX A;  1J7K A;  5JLW A;  1K83 J;  2LBF A;  4JX5 A;  3CP8 A;  1A36 A;  1VQ9 I;  2KRC A;  4I01 A;  4RAY A;  2O61 A;  1FYL A;  3I5U A;  3ULQ B;  2V6E A;  2WAE A;  4Y13 A;  5C44 J;  1IRG A;  3K2A A;  5LHG A;  1XGO A;  2QQA A;  4EV0 A;  4KDP A;  2LG4 A;  3GME A;  3ECO A;  4HV5 A;  5DD8 A;  1T0F C;  3IH3 A;  3E6C C;  1OCZ H;  1IRX A;  1IZ1 A;  3V4G A;  3PFI A;  4A3G J;  3J7Y J;  1R58 A;  2HNH A;  2DMQ A;  3HBL A;  2XV4 S;  5B5E C;  4A0Z A;  3E0J B;  3FM5 A;  1KU3 A;  1XMA A;  5FD6 A;  4XRM A;  4E7H A;  2R7D A;  2H09 A;  2CUZ A;  2HOE A;  2MGQ A;  3VYS B;  4E7Z A;  2X6Y A;  4RLF A;  2JSP A;  2DA7 A;  4FQG A;  2CH0 A;  1VQP I;  3OIQ A;  4UXN A;  2DMU A;  3W6J B;  1XD7 A;  1FBS A;  3H3Z A;  2LR8 A;  3F9K A;  3JRD A;  5CVR A;  2FXA A;  3OYE A;  2E19 A;  3PL8 A;  4AUX A;  3BR2 A;  4L18 B;  3OSG A;  3MQ0 A;  3BG3 A;  1I6X A;  3PIP F;  1STZ A;  4CIC A;  2BGC A;  3PJR A;  3HRT A;  2CWE A;  2M5W A;  2X9D A;  4C2U A;  2FOK A;  3K70 C;  2ECC A;  1X19 A;  5TJJ A;  2M2E A;  3S93 A;  3H92 A;  2DA3 A;  1ZLK A;  4HF1 A;  3FXQ A;  3FWE A;  1JT0 A;  2RGV A;  1SC7 A;  3ZRG A;  5ERI A;  3MEX A;  4JQF A;  4A3J J;  5FFZ A;  4IHS A;  4RGX A;  2ZJQ F;  4BQA A;  2CGP A;  1SMT A;  3CUQ B;  1K4S A;  3BZC A;  4QIW N;  3DEU A;  2VXZ A;  3OR2 C;  3B6C A;  4ZYG A;  2LKP A;  4IVN A;  4QSH A;  2PEX A;  3L1P A;  3ROU A;  3KP7 A;  2FU4 A;  3WHC A;  4LGW A;  2RNJ A;  2J5P A;  2VE8 A;  2VKH A;  2X6O A;  3GFI A;  5BOX A;  1TNT A;  2CFX A;  3O2P E;  1HC8 A;  3L9F A;  4BHB A;  1MMA A;  1FC3 A;  2O03 A;  1OLT A;  4XN3 A;  1TLH B;  1V5G A;  3LSI A;  4LG0 A;  1OYY A;  1UCR A;  2FBI A;  2IA2 A;  2PG4 A;  1W0T A;  3GBG A;  2IA1 A;  2K3P A;  3WU0 A;  4GO1 A;  5KAI C;  1JT6 A;  4UV8 A;  4CCJ A;  4OAZ A;  3C18 A;  2MYS A;  3F8N A;  2ID3 A;  3Q0V A;  3W3C A;  5BS6 A;  1FIA A;  1JKQ C;  1AHD P;  1OCT C;  1A35 A;  3GFM A;  3FKJ A;  5TIS C;  3S1Q J;  4A5N A;  4ZJZ A;  2FE3 A;  1MBG A;  3VYU B;  5BNG A;  2OTJ I;  4ANJ A;  4XOT A;  2J5O A;  4QTR A;  3HOW J;  2RNG A;  2ZXJ A;  4HX8 A;  3CDI A;  1HSJ A;  2XAH A;  4ZYE A;  3N97 A;  1ZAO A;  1FIP A;  3TMO A;  1APL C;  3AKZ A;  2ISZ A;  1FY7 A;  3IAM 2;  2M9H A;  1BR4 A;  5CQE A;  3K4B A;  4XKV A;  4UUV A;  1V5E A;  2CW7 A;  3U1D A;  1B6A A;  2P5V A;  1VQ6 I;  5D5X B;  1KQ8 A;  1MMS A;  3KP3 A;  3K10 A;  4HBL A;  2DTR A;  4IHT A;  2R7U A;  3EUH A;  3IP4 B;  2FEZ A;  4PJ0 C;  3CCR I;  4A3B J;  2XGE A;  3CO6 C;  3KP6 A;  2HOA A;  4RAZ A;  4XLA A;  1LFU P;  3OYK A;  3OYM A;  3ZQH A;  2ESH A;  1X1A A;  2XPW A;  3EYY A;  3FF5 A;  1Y1V J;  2CV2 A;  1ZN2 A;  3RPU A;  2Z3Y A;  2DMP A;  3MKY B;  2JRM A;  2EV5 A;  1FYM A;  1R4N B;  4MQ9 F;  3TOA A;  1YOV B;  1K6O A;  5FLM J;  2F4M B;  3CES A;  2IS4 A;  3TO9 A;  1M1E B;  1J59 A;  1D0Y A;  1OR7 A;  2QZ8 A;  3KLO A;  1DPU A;  3GLL A;  2DT5 A;  4CCO A;  3WTX C;  3SZT A;  2V7F A;  2HDW A;  2V4J C;  3SZP A;  4CYC B;  1Z0X A;  3DEW A;  2FSW A;  2JJ7 A;  4A93 J;  2G9W A;  2PFB A;  4UUS A;  1Z67 A;  2CQQ A;  1SFO J;  3I4N J;  1DP3 A;  1XC5 A;  4IHX A;  4A0X A;  3TL4 X;  1K61 A;  2QUF A;  2JA2 A;  4IX7 A;  2L02 A;  4ABZ A;  2EB7 A;  3RZO J;  5HS7 A;  2L4M A;  1WI3 A;  2KIS A;  3FM3 A;  2YX4 A;  3W2W A;  1MGT A;  5M3M J;  1HXD A;  2MW8 A;  3FBN B;  1JKP C;  1AU7 A;  3HDD A;  4M3D A;  4ASN A;  3OYC A;  3I4P A;  1SFU A;  2GWR A;  2IAI A;  5JHU A;  4XIC A;  4OIQ F;  5LRR A;  2R7R A;  3BR6 A;  4Q4Z F;  1XX5 A;  3KZZ A;  2L54 A;  2CRG A;  3K1P A;  4Z6Y A;  2DT7 B;  2OBP A;  1BR1 A;  2HTJ A;  4F52 A;  3WTU C;  3GLX A;  2Y0M A;  3GZN B;  3L2U A;  1SD4 A;  2R5Y A;  2EFQ A;  1D0X A;  4G7Z F;  3M3Y J;  3T1B A;  3L2C A;  4G8X A;  3C2G A;  4J01 A;  1X1D A;  2X85 A;  3ZQG A;  4L0Z B;  2LK2 A;  1E3O C;  2WC2 A;  3P9K A;  4AYB N;  3KX2 A;  4E70 A;  2IJL A;  1IDY A;  2L0K A;  3BCA A;  4JK1 X;  4Y15 A;  5E1X A;  5LEK A;  4M73 A;  3S3O A;  2NAZ A;  1ETX A;  1G3W A;  3IKT A;  1R1U A;  3REO A;  2WAD A;  3VFZ A;  1RRJ A;  2QSH X;  4P1W A;  4FX4 A;  2ADU A;  3GTL J;  5EDN A;  1VFC A;  3DBL B;  2WY8 Q;  3MN2 A;  2CW0 F;  4I2O A;  1A6I A;  1YYV A;  2VC1 A;  1XDU A;  4WF2 A;  3ASN H;  1T98 A;  5HOO A;  2VKV A;  3HSE A;  1U8R A;  3FXK A;  3QPL A;  1MNE A;  3S3M A;  3NRV A;  3LNQ A;  4MQV A;  5DD4 A;  2R7Q A;  3FXO A;  2VC0 A;  1MKM A;  4HX7 A;  4RAG A;  3WTY C;  3H0G J;  5D4R A;  4DYQ A;  1BM9 A;  4XID A;  3DKW A;  3VOD A;  3LA2 A;  1V54 H;  4ESF A;  2KZV A;  1G2H A;  4AYB A;  4BQQ A;  1WZ2 A;  4G6T B;  3OOP A;  2W24 A;  1GVD A;  9ANT A;  2KT0 A;  2V6C A;  4ENM A;  4CYD A;  3H5A A;  5ICC A;  4XLP F;  2A05 A;  3E6M A;  3GTJ J;  1YIT I;  3BG5 A;  4WXC A;  5FKL A;  5A2Q Z;  3IH2 A;  5E3L A;  1ZTR A;  2DMT A;  3BJA A;  2B7E A;  1PP7 U;  3RCO A;  2E1M C;  3QWL A;  3I9V 2;  4RA2 A;  1ZRC A;  1TW3 A;  2VJJ A;  3FIW A;  2LKS A;  4A69 C;  4Y33 A;  2BYV E;  5EEH A;  2K27 A;  4I76 A;  2LY9 A;  4WCG A;  1MDM A;  2QBY A;  1VZ0 A;  4NDL A;  3CCU I;  1S3J A;  3S14 J;  4UY8 I;  4L5I A;  4CCK A;  2NOG A;  4NUB A;  4RGR A;  3DPT A;  2F6C A;  2HR3 A;  4OMZ A;  3KLN A;  4S05 A;  3QPT A;  4MGR A;  3GTO J;  3QYB A;  3CCM I;  3OV8 A;  3P5J A;  4NQW B;  5J8F A;  1HCR A;  3HTU A;  2XRL A;  2QSF X;  3RPQ A;  2IS6 A;  1R5G A;  4HLY A;  3U1K A;  1PP8 F;  1D8K A;  4L9V A;  4ZTF A;  1XMK A;  4F93 B;  2FQ3 A;  4B3X A;  4M6Y A;  3BRO A;  3OS0 A;  1VTN C;  2VOO A;  3N4M A;  3S1R J;  1I27 A;  4QPO A;  3CCQ I;  2BXY A;  1SD7 A;  3CUO A;  3HPG A;  4B3A A;  1IXS B;  2EIK H;  3DTK A;  3S8P A;  1ETO A;  1OCR H;  1P4A A;  1OCO H;  2Q2E A;  4HSR A;  5GAG J;  4P96 A;  4WXD A;  2HYJ A;  3H9Q A;  2I8D A;  1RR7 A;  1YW8 A;  1I5Z A;  3BC8 A;  5EEG A;  2VJ5 A;  1YW7 A;  1MZB A;  2VBZ A;  1KGS A;  2M7A A;  4ETS A;  1K79 A;  2Y9Y A;  2K9L A;  1BJA A;  2NYX A;  1QU3 A;  1Z7L A;  2ZSI B;  4KYW A;  2DA4 A;  1B8I B;  4BU2 A;  4FX0 A;  4XN0 A;  2XAG A;  1V3F A;  3HHH A;  1WJF A;  3CCS I;  1MDM B;  2ZXW H;  3LST A;  2P6T A;  3VYR B;  4ZDP A;  3V7S A;  4M71 A;  2JPB A;  2DA1 A;  4K2E A;  3BCB A;  2HDD A;  5J1R A;  4ZTJ A;  3W6V A;  3I55 I;  3O8H A;  3CD6 I;  2R5Y B;  2DK8 A;  1A04 A;  1TT5 B;  3ML6 A;  4OOI A;  3K70 D;  3KP5 A;  1IGN A;  2K86 A;  3DPU A;  2L7M P;  2CG4 A;  2HGC A;  4AIK A;  3K0L A;  3HOX J;  6PAX A;  1HW1 A;  4IPA A;  4E6K G;  5AIP A;  3CP2 A;  3J81 K;  1H8A C;  1W36 C;  1BIB A;  3SFI A;  1RPW A;  3HL2 A;  2WAQ A;  2R7W A;  3A0B C;  1E2X A;  1W7P D;  4B09 A;  2UXN A;  3CJR B;  2A5W A;  2K40 A;  2P81 A;  3GTG J;  4WXH A;  4IOA F;  1KON A;  2QLZ A;  3S2H J;  1X58 A;  2CUJ A;  4C9Y A;  3JTG A;  2FBK A;  4HQM A;  4CYC A;  1K78 B;  2AQE A;  3MFK A;  2CW8 A;  1ON2 A;  5AON A;  2BV6 A;  3HTS B;  2IXS A;  5CVV A;  1ITY A;  3C1D A;  2IS1 A;  1OIS A;  1FOY A;  1MSF C;  2QQB A;  3BLY A;  5BMZ A;  2BY1 A;  2XF7 A;  3SXY A;  1B59 A;  2EFO A;  3G73 A;  5BQT A;  2DJN A;  2JUC A;  5TRD A;  2BY3 A;  2EFP A;  1JHF A;  1BI2 A;  1EJ9 A;  3CC7 I;  2BVL A;  4HNV A;  3G6E I;  3H3U A;  1B9N A;  5CLS A;  4QLC U;  4UUT A;  4NQW A;  3WE3 A;  5D8K B;  1YIO A;  2GXA A;  1Z1D A;  2W1O A;  3MKZ A;  4B4C A;  4EJT A;  4LLN A;  4BYY A;  1ACI A;  1FPQ A;  4CUG A;  5HVQ C;  3F0C A;  2PMU A;  3V8J A;  5J40 A;  3FXJ A;  1MBF A;  3NAU A;  3SYT A;  2XAF A;  1B72 A;  2EWN A;  2RKH A;  5JHF A;  1J2X A;  3BR3 A;  5LEJ A;  2STT A;  5LRS A;  1IG7 A;  5EGO A;  2MLK A;  4JX6 A;  1TTY A;  4YIF A;  3J80 Z;  4HOB A;  5CYV A;  1UEL B;  3QYE A;  4MFD A;  5H6Q A;  5HNH A;  1U2W A;  2F48 A;  2DCE A;  1SAU A;  4XSX F;  3Q5F A;  3QPH A;  1KYW A;  3K1N A;  4PFO A;  4ZDL A;  1BN5 A;  1OFC X;  3FMS A;  5CPR B;  4UUS B;  3AL0 B;  4Q5S F;  3EET A;  3K9T A;  1WSU A;  2NXN B;  1JI8 A;  5KAF C;  4LB6 B;  1IUY A;  2F4I A;  4HV6 A;  4BUP A;  3T0Y A;  3L09 A;  3CCJ I;  3ZMZ A;  1UMQ A;  1ETK A;  1ZGA A;  3KIO A;  1W4M A;  2Y0S A;  1XS9 A;  4KIB A;  3U9G A;  4IOC F;  2ZNZ A;  3Q0U A;  4EMS A;  4DZP A;  3S16 J;  2VQL A;  2MSY A;  3IWZ A;  1OR7 C;  3ONQ A;  5FGM A;  4X0G A;  3WTZ A;  4NHJ A;  1LNW A;  1YX3 A;  1BR2 A;  2MBF A;  1ZHF A;  2P0W A;  2JA6 J;  3PNY A;  3CC2 I;  4LJZ F;  4PJN A;  1TT0 A;  4HDV A;  2K9M A;  2V9K A;  3MZH A;  2EIJ H;  3BTI A;  2Z16 A;  3WTT C;  3WGI A;  2CUE A;  1JGS A;  5EYR A;  2XSJ C;  1IW7 F;  2G0E A;  1JUP A;  4DBR A;  4M72 A;  5FD5 A;  2BE5 F;  2ZJ2 A;  5F1J A;  4O5V A;  1TWA J;  1PVE A;  2LDU A;  1ETQ A;  4UNO A;  2XGD A;  3RYR A;  4ESJ A;  3UR3 C;  3ZXS A;  2L3D A;  4CSW A;  1WPK A;  2JK3 A;  2WV0 A;  3RQI A;  4CO8 A;  4QWQ A;  2E7W A;  2W4S A;  2B9S A;  4AIH A;  4RBO A;  4KNY A;  3E5U A;  2BY2 A;  3QYF A;  2M34 A;  3BJO A;  3PIO F;  1OKR A;  2PJR A;  2RVC A;  3KPH A;  3RZD J;  2E1C A;  3KZY A;  4BGD A;  3OYJ A;  4A3L J;  5J4Y A;  3D1N I;  4LLL A;  4AVZ A;  2PX9 A;  2CSO A;  1UAA A;  3ASO H;  1OYW A;  1QPI A;  3W2V A;  4EVI A;  5F04 A;  1FLI A;  2P5L C;  2H1L A;  2PMH A;  3JRH A;  1MH4 A;  2HQN A;  4R8H A;  1IN5 A;  3GCM A;  3K4K A;  2CMP A;  2IGM A;  5HNF A;  4DZJ A;  3ELK A;  2NRA C;  1WI9 A;  2O5R A;  2K9N A;  2EQR A;  2OA4 A;  5J8C A;  2HYG D;  2LMD A;  2ZJR F;  1TQI A;  4KIS A;  4XRS A;  3AG2 H;  4PJL A;  3KZI C;  1R1V A;  2M3A A;  2QSG X;  3KYC B;  4PSW A;  2QYO A;  2XSD C;  5CQG A;  4ENJ A;  2O6G E;  1SD5 A;  2RC4 A;  2GBY A;  1GVJ A;  2V1D A;  2PI0 A;  2K3F A;  1ZG5 A;  1B1B A;  3QOE A;  3QPS A;  1KU2 A;  3P9C A;  1LVA A;  1S29 A;  3SDG A;  2M1B A;  5L3C A;  1IN7 A;  3ISP A;  4HPQ A;  4YIR X;  2L4A A;  1B8I A;  3LAJ A;  1HLV A;  3T5X A;  2RQQ A;  2DU9 A;  1Z05 A;  3L00 A;  2ZKZ A;  3ZMV A;  2TRT A;  4D1Q A;  3E6D A;  1JTY A;  1B9M A;  4PJM A;  2XVC A;  1SFK A;  4XNF A;  2CQK A;  3I59 B;  3NEU A;  3LMM A;  4ZYH A;  3L2V A;  1ZR4 A;  4U0Y A;  5IYB J;  1VQM I;  1EKE A;  1RNL A;  1XCV A;  2Y48 A;  2MC4 A;  4EM1 A;  3D5L A;  1ZQ3 P;  3HOZ J;  4BE2 A;  1C0W A;  3M9A A;  2MH2 A;  2QWW A;  4M9Z A;  3CMY A;  2ACJ A;  1VQ4 I;  1QHG A;  5JVT A;  5HS8 A;  4A3C J;  3J81 Z;  1EH8 A;  4FT8 A;  3I56 I;  1MJB A;  4BEH A;  4I98 B;  1YQA A;  2H1K A;  1J09 A;  3LSM A;  1ZGW A;  4IXA A;  2JA8 J;  4BE1 A;  1RKW A;  4D9J A;  2N8G A;  2HDC A;  3LSJ A;  3LSP A;  4XBF A;  2VOD A;  3DU6 A;  4HQE A;  1KU7 A;  2VN2 A;  4D0P A;  2O8X A;  2RN7 A;  1VF9 A;  3IHU A;  3P9I A;  3CMM A;  4A3D J;  3FHZ A;  4J19 A;  3F8M A;  3NQO A;  3KYL A;  2OTL I;  4MTE A;  2CQN A;  2QGU A;  3F22 A;  2R5Z B;  1H0M A;  4YFN F;  1QZE A;  2Q1Z B;  4LG0 B;  2LTP A;  2BW3 A;  1ZG1 A;  3RSN A;  1YFH A;  2HEO A;  3OS2 A;  1VQ5 I;  1IV6 A;  2A69 F;  5L3G A;  2AO9 A;  1A6Q A;  1Y1W J;  3CUQ A;  4L5E A;  1MMD A;  2XHK A;  2RV8 A;  1MBH A;  3EQL F;  3M7G A;  1KZH A;  3RIR A;  1MBK A;  1NHA A;  1D0Z A;  1NTC A;  1SEU A;  3CF2 A;  4C2T A;  4LB5 A;  2R4G A;  5H6R A;  2O9L A;  5DCM B;  4EQQ A;  2E1O A;  2XC7 A;  2C6Y A;  4KIF A;  1TW2 A;  3UNG C;  4HEA 2;  4UVB A;  4DGW B;  5K1Y A;  4R79 A;  2VE9 A;  4BQO A;  2M0M A;  1X4O A;  1HOM A;  3K2Z A;  2KL4 A;  4I09 A;  3BWG A;  1N77 A;  5A2Q K;  4M3B A;  4CCM A;  1N25 A;  4LIU A;  3C2H A;  5DM6 F;  3F8C A;  1Y39 A;  3PM1 A;  4JOM A;  2CU7 A;  3D0S A;  3RPU D;  1ON1 A;  1JUM A;  2JT1 A;  4HG2 A;  1XGM A;  2ISY A;  4AIJ A;  2HZT A;  1LDD A;  2ECB A;  4XL9 A;  4I7H A;  2M45 A;  2V1N A;  3CDL A;  3OIP A;  1H89 C;  1OCC H;  4XMY A;  1FT9 A;  4I0A A;  4FIS A;  3WHB A;  3FXL A;  3EDP A;  4XKB A;  2PJR B;  2XB0 X;  5J4V A;  2E2I J;  2L7Z A;  1F9N A;  2CV0 A;  2L9V A;  5LHI A;  4O3M A;  2FOW A;  2FBH A;  3BG9 A;  2LOO A;  2HKX A;  2W84 A;  1X3W B;  4B47 A;  2CV1 A;  2H8R A;  1RZ4 A;  3ABK H;  1P7I A;  4BDY A;  1IF1 A;  5CVJ A;  2QEX I;  2X0L A;  1ENH A;  2JVH A;  4DYR A;  2E5Z A;  2FD5 A;  3C7J A;  4U88 A;  3CCL I;  2R7T A;  3IKV A;  1O57 A;  3ZMU A;  3E97 A;  2H94 A;  4I99 C;  4C30 A;  4ZDO A;  2MFZ A;  3OIO A;  3SEQ A;  2UUZ A;  3KEY A;  1XMX A;  1T38 A;  5LBQ A;  4ZYA A;  5F64 A;  5GTH C;  2NVX J;  2NS0 A;  5KNL A;  1MH3 A;  4F3Q A;  1RES A;  3PUF A;  2OC6 A;  1O4X A;  2LBF B;  5B3S H;  1IDZ A;  3PO3 J;  1Y56 A;  2MD0 A;  4U0V A;  5IT9 Z;  4ZC3 A; 
#chains in the Genus database with same CATH homology
 1PUF B;  3FK6 A;  3JRI A;  3IH2 A;  1WCM J;  5E3L A;  1IC8 A;  1ZTR A;  2DMT A;  2LKX A;  1X2N A;  2I10 A;  4M3E A;  2W48 A;  3FIW A;  4FE7 A;  4A69 C;  3S17 J;  1EF4 A;  5EGO B;  4I76 A;  2LY9 A;  3HKZ N;  4NDL A;  3S14 J;  3E7L A;  2HOS A;  3OSF A;  2NOG A;  4BBR J;  1AKH B;  3HGY A;  1R9T J;  3GTO J;  2M0C A;  3ZQC A;  4JX4 A;  2VPR A;  2Y0S N;  3S1M J;  3JRF A;  3SJM A;  1HCR A;  4B1R A;  1GV2 A;  2XRL A;  3TP3 A;  5J3L A;  5FKO A;  5C3E J;  1I50 J;  3ZOB A;  2O8K A;  1IRZ A;  1GUU A;  3S1R J;  5DTD A;  4B3A A;  5E3O A;  1S7E A;  5E3M A;  1Q1V A;  5EEA A;  2QCO A;  5IPA A;  1GDT A;  1ETO A;  1TC3 C;  1NK3 P;  1JUS A;  4A3E J;  2LP0 A;  2NS8 A;  4MO7 A;  5IYD J;  2CUF A;  2HYJ A;  5C4X J;  2COB A;  2JA5 J;  2WV1 A;  2VKE A;  1RR7 A;  5EG0 A;  3BTC A;  1X2M A;  3JRA A;  4M6V A;  1RET A;  1TWF J;  2WB1 N;  2XPV A;  1UHS A;  2Y9Y A;  3HB9 A;  3JR9 A;  2CQX A;  1AKH A;  1LE8 A;  2ME6 A;  2DA4 A;  1B8I B;  3LSR A;  2OF7 A;  1HDP A;  1HDD C;  1BW6 A;  1I6H J;  1ZKG A;  3HOU J;  3NAR A;  5FKK A;  3A01 A;  5GPA A;  2L7F P;  3HEF A;  5E3N A;  2DA1 A;  2MG4 A;  4C3I J;  2HI3 A;  2HDD A;  5J1R A;  4G12 A;  3W6V A;  2Y31 A;  4W97 A;  3O8H A;  2E2J J;  3A02 A;  2R5Y B;  3K7A J;  3CCY A;  4AC0 A;  3HOY J;  5K7F A;  3VPR A;  3A03 A;  1IGN A;  1LE8 B;  2L7M P;  5M5X J;  4C3J J;  2HXO A;  4X6A J;  1POG A;  3HOX J;  1H88 C;  1GV5 A;  2E2H J;  2DA5 A;  2X48 A;  1H8A C;  4MFE A;  3CQZ J;  1XG1 A;  1RPW A;  3SFI A;  1ETY A;  2YU9 J;  2DN0 A;  2YS9 A;  1JKR C;  1BJZ A;  4BY7 J;  3Q0W A;  2LD5 A;  1NK2 P;  3BQY A;  5EG0 B;  2K40 A;  2P81 A;  5F27 A;  5F0H A;  3GTM J;  3GTG J;  3TP0 A;  3S2H J;  3BTL A;  1X58 A;  2JA7 J;  2XGC A;  4CYC A;  5EF6 A;  3BR5 A;  4FTH A;  2GM4 A;  2DA6 A;  1MNM C;  3B6A A;  3HOV J;  1ITY A;  5F0F A;  1QVU A;  1QVT A;  5FKN A;  3MKL A;  1F43 A;  1MSF C;  1ORK A;  2DJN A;  5K7Z A;  1JTX A;  5IP9 J;  1IUF A;  1TWC J;  4W1U A;  5JLX A;  4HNV A;  5GP9 A;  3BTJ A;  4UUT A;  4EEF G;  2ELK A;  1JJ8 C;  5IP7 J;  1GT0 C;  3S15 J;  3FKI J;  4B4C A;  3F0C A;  1IJW C;  3BT9 A;  3LOC A;  5HOD A;  1MBF A;  3NAU A;  3O8G A;  1B72 A;  4IHV A;  1RKT A;  2EZL A;  3BR3 A;  1VND A;  1IG7 A;  5EGO A;  3IV5 A;  4JX6 A;  4D5C A;  4I6Z A;  1U78 A;  3BR0 A;  4M3F A;  4BY1 J;  2KDZ A;  3ZQF A;  3I4M J;  1P7J A;  2M8G X;  4FCY A;  5DS9 A;  4MFD A;  2LVS A;  1SAN A;  1TWG J;  5IP6 A;  4XRS G;  3LSG A;  2NVY J;  5JLW A;  1K83 J;  3BQZ A;  4JX5 A;  1OFC X;  4UUS B;  2Y9Z A;  5EZH A;  2YUS A;  3G1M A;  5C44 J;  4D7M A;  4BXX J;  3K2A A;  1UMQ A;  1ETK A;  4S0H B;  2K9Q A;  1XS9 A;  1WH5 A;  3Q0U A;  4D7N A;  3S16 J;  4DZP A;  2MSY A;  3QQA A;  3IH3 A;  1LFB A;  1ZK8 A;  3HM5 A;  2K9S A;  5M5W J;  4A3G J;  5IOZ A;  2R0Q C;  2DMQ A;  3HBL A;  1U9O A;  4XRM A;  4D5F A;  2JWT A;  2MGQ A;  3TED A;  2JA6 J;  4LOC A;  2DA7 A;  3S1N J;  2DMU A;  4GFB A;  3BTI A;  3ZQL A;  2LR8 A;  2DA2 A;  3JRD A;  2CUE A;  4JP0 A;  5EYR A;  4Y7N J;  2E19 A;  5GPC A;  2G0E A;  1JUP A;  5IYC J;  4AUX A;  1FTZ A;  1T33 A;  5F1J A;  3BR2 A;  3OSG A;  3BG3 A;  1TWA J;  4A3I J;  1ETQ A;  4A3K J;  2XGD A;  4A3M J;  1DU6 A;  4DW6 A;  2R7Z J;  1WPK A;  2JK3 A;  3OOU A;  3RQI A;  2X9D A;  5J1Y A;  1QRY A;  1UG2 A;  2ECC A;  1T56 A;  2M2E A;  4RBO A;  2DA3 A;  4BKX A;  2M34 A;  2DMN A;  1JT0 A;  1A5J A;  4A3J J;  3RZD J;  5FJ8 J;  2VUM J;  4A3L J;  1OJL A;  3D1N I;  1BW5 A;  1ZR2 A;  4QIW N;  1QPI A;  3B6C A;  5F04 A;  4IHW A;  4QSH A;  2FQ4 A;  3L1P A;  3JRH A;  1MH4 A;  3WHC A;  2X6O A;  3JRB A;  4V2G A;  4DZJ A;  3C2B A;  1HF0 A;  2K9N A;  3UKG A;  2EQR A;  1FEX A;  1D5Y A;  1W0T A;  2XB5 A;  4XRS A;  3GBG A;  4XK4 A;  1JT6 A;  1I3Q J;  2O7O A;  1CQT A;  2ID3 A;  3Q0V A;  2WAQ N;  2B63 J;  2XSD C;  1PUF A;  2VI6 A;  1FIA A;  5FKM A;  1JKQ C;  1OCP A;  1AHD P;  1OCT C;  2TCT A;  2EZH A;  3S2D J;  2GBY A;  1BA5 A;  3H3V K;  4DYC A;  1FJL A;  3S1Q J;  3QPS A;  3Q3S A;  3SDG A;  2R92 J;  1B8I A;  1MBG A;  5BNG A;  1HLV A;  1WH7 A;  2TRT A;  2EZI A;  1JTY A;  3TW7 A;  4QTR A;  3HOW J;  1ZR4 A;  5IYB J;  4IHY A;  1MSE C;  1FIP A;  1APL C;  2ME0 A;  3FK7 A;  4C3H J;  1ZQ3 P;  3HOZ J;  2M9H A;  1U8B A;  3MVP A;  2FX0 A;  3JRE A;  4BBS J;  3CMY A;  2EBI A;  4A3C J;  3GTQ J;  2HQ5 A;  5C4J J;  1YRN A;  2JMW A;  2XPU A;  4A3B J;  1VI0 A;  3M4O J;  2H1K A;  5K7H A;  2R93 J;  5F08 A;  2XGE A;  2HOT A;  1ZGW A;  2HOA A;  2NVT J;  3TW6 A;  1LFU P;  2JA8 J;  1RKW A;  2N8G A;  3ZQH A;  5EZG A;  2XPW A;  3BR1 A;  3LSJ A;  1Y1V J;  2Y2Z A;  3LSP A;  2DMP A;  1VF9 A;  3HGG A;  4A3D J;  4J19 A;  5FLM J;  3FIS A;  2R5Z B;  2OPT A;  4FE4 A;  2LTP A;  4M3G A;  3GTK J;  5F0C A;  1U9N A;  2JN6 A;  2L9R A;  4CYC B;  1IV6 A;  1Z0X A;  3DEW A;  2JJ7 A;  2AO9 A;  4A93 J;  2FJ1 A;  4UUS A;  2GLO A;  1Y1W J;  4L5E A;  3ZQI A;  2CQQ A;  2EH3 A;  1SFO J;  3I4N J;  1XC5 A;  4IHX A;  1MBH A;  1K61 A;  1MBK A;  5M3F J;  5FLV A;  1B72 B;  1NTC A;  4ABZ A;  3RZO J;  1WI3 A;  5M3M J;  2MW8 A;  2CJJ A;  2O9L A;  1JKP C;  1AU7 A;  1Z77 A;  3HDD A;  2E1O A;  4M3D A;  3DCF A;  2PMZ N;  2IAI A;  4XIC A;  3BR6 A;  1HOM A;  2CRG A;  2ZB9 A;  2QF7 A;  4M3B A;  2R5Y A;  1MBJ A;  4C2M J;  3M3Y J;  2DTZ A;  3PM1 A;  2CU7 A;  4V2F A;  3RKQ A;  1JUM A;  2Y30 A;  2AHQ A;  1FTT A;  3ZQG A;  2ECB A;  3PO2 J;  1JKO C;  2LK2 A;  1E3O C;  3CDL A;  1H89 C;  4AYB N;  1W0U A;  5M5Y J;  1F36 A;  3IH4 A;  1IDY A;  2L0K A;  4FIS A;  3WHB A;  1ETX A;  1TWH J;  2HXI A;  2XB0 X;  4Y52 J;  2E2I J;  2EZK A;  2L7Z A;  3GTL J;  5EDN A;  2IEK A;  4IEJ A;  1VFC A;  3GTP J;  2LFB A;  2NS7 A;  1JGG A;  3BG9 A;  3MN2 A;  1MBE A;  1A6I A;  2H8R A;  1JJ6 C;  1DU0 A;  1P7I A;  1ETV A;  2VKV A;  3QPL A;  2R5Z A;  1ENH A;  3JRG A;  5IOY A;  4DYR A;  3LNQ A;  2FD5 A;  1BL0 A;  4MLO A;  2NVQ J;  3H0G J;  2D5V A;  4DYQ A;  4XID A;  2ID6 A;  3G1L A;  5J1U A;  2LLK A;  3OIO A;  2IBD A;  1G2H A;  4MIM A;  3A01 B;  3G1O A;  4X1E A;  4A3F J;  2NVX J;  1WGX A;  2RAE A;  1GVD A;  1MH3 A;  2KT0 A;  9ANT A;  1RES A;  4RDU A;  3JRC A;  1O4X A;  1IDZ A;  3GTJ J;  3PO3 J;  3BG5 A;  4JYK A;  1YRN B;  5FKL A;  1ETW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...