1H8AC

Crystal structure of ternary protein-dna complex3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
105
structure length
105
Chain Sequence
NPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 33
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2001-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h8aC01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h8aC02
2WAQN 4D5CA 1MBFA 1F36A 3HM5A 1AHDP 1RR7A 2EBIA 3D1NI 4LOCA 1WCMJ 5FKMA 1JTXA 5C3EJ 2JA7J 3HOVJ 4IHWA 1DU6A 3Q0WA 1JUSA 2NS8A 2RAEA 1ENHA 2EZIA 3GTPJ 3BR2A 3IH3A 1IDYA 1VNDA 4BY7J 1LFUP 3OOUA 2DMQA 1WH7A 1Q1VA 2FJ1A 2VI6A 1BL0A 2R0QC 1PUFB 3A03A 3IV5A 3I4NJ 4A3IJ 1UMQA 4MFDA 2LTPA 2MW8A 5GP9A 5IP9J 3SDGA 1WH5A 1WI3A 2TCTA 5IOYA 4UUSA 1MBKA 2NVXJ 2JA5J 2O8KA 2GBYA 4XRSG 3ZQFA 5BNGA 4C3JJ 3JRFA 5IYCJ 4I6ZA 4D5FA 1OJLA 5F08A 5K7ZA 3QQAA 3HKZN 4A3EJ 3OIOA 2ID6A 4FE4A 2HOAA 4FE7A 3Q0UA 1YRNB 1YRNA 2CUEA 1JT0A 1H88C 4DYCA 3GTLJ 3BQZA 1T33A 2FX0A 1TWGJ 3M3YJ 5K7HA 1I6HJ 1MSFC 3HGGA 3CMYA 3GBGA 1U8BA 3H0GJ 2I10A 4DW6A 1DU0A 2E2HJ 4JYKA 2G0EA 1CQTA 1ITYA 3LOCA 1GVDA 2R92J 3RZDJ 2TRTA 2ELKA 2MSYA 5F04A 3TEDA 1S7EA 2DMNA 4DYRA 4CYCB 4CYCA 4A3DJ 2HXIA 5C44J 3CQZJ 2XGCA 3BT9A 1FIAA 1IV6A 3WHBA 1UHSA 4X1EA 4BBRJ 1IG7A 2EZLA 2IAIA 2LP0A 1E3OC 1D5YA 1QVTA 3PO2J 5FLMJ 5F1JA 2XSDC 3JRGA 5F0CA 1W0TA 4MFEA 1H89C 2LR8A 1K61A 3S1QJ 1JUMA 2LK2A 1F43A 1LE8A 2OF7A 4I76A 4Y7NJ 2DA3A 1R9TJ 2DA4A 2JMWA 2B63J 3HDDA 2H8RA 4AYBN 2NVYJ 2NOGA 2KT0A 3BR3A 4XRMA 3UKGA 1XC5A 3MVPA 3G1OA 3JRAA 3W6VA 4X6AJ 4M3FA 4MLOA 2ID3A 1I50J 4A3GJ 2D5VA 5GPAA 1B8IA 2HQ5A 4AC0A 5IYDJ 2YS9A 1ETVA 5EZGA 2LFBA 3F0CA 1Z0XA 3NARA 5J1YA 2R5YB 2FD5A 3OSFA 3A01B 2O9LA 5M5YJ 5IYBJ 1XS9A 3FKIJ 4XRSA 2YU9J 1X2NA 5J3LA 1AKHA 3GTOJ 5FJ8J 5IPAA 3DCFA 2NS7A 1HF0A 3BG3A 2XRLA 4J19A 1B72A 2M34A 1EF4A 4BKXA 1P7IA 3S15J 3SFIA 2P81A 2DA6A 2K9QA 1TWHJ 3IH4A 5EGOA 2R5ZA 4QIWN 1Y1WJ 5EEAA 1MBEA 1FIPA 3GTGJ 4A3KJ 2DN0A 5EG0A 4A3JJ 4M3EA 2EZKA 3H3VK 1A6IA 4JX5A 4BXXJ 4M3GA 2ECBA 1RESA 5E3MA 1FJLA 1NTCA 1HOMA 4W97A 1IRZA 3G1MA 3BR5A 5DTDA 3FISA 2DMUA 2Y31A 4UUSB 3S17J 5IOZA 1H8AC 2XPVA 1JKQC 4DZPA 1W0UA 1QVUA 1JJ8C 5C4JJ 2MG4A 4M6VA 2GLOA 2X6OA 2WB1N 4B3AA 4QSHA 3BR6A 1MBGA 3VPRA 4V2FA 3ZQIA 1VFCA 2COBA 3E7LA 2K9NA 1BW5A 1ETYA 2ECCA 5IP6A 4JP0A 4MO7A 2HYJA 3M4OJ 4Y52J 3O8HA 5C4XJ 4EEFG 3FK7A 2IBDA 5M3FJ 2ME0A 3HOZJ 3A02A 1IC8A 2DA2A 1MH4A 4A3BJ 3BG5A 1RKTA 1U9OA 2L7FP 3LSGA 5EYRA 3L1PA 3O8GA 1ZKGA 3JRDA 2IEKA 2W48A 3S14J 2DA1A 2WV1A 1VF9A 3FK6A 1ETKA 1ZK8A 2Y30A 3ZOBA 3TW7A 2CUFA 4B1RA 2JA8J 1ZGWA 3TW6A 1JKOC 1JKRC 2CQXA 3RKQA 2JJ7A 1P7JA 2DA7A 5EZHA 1LE8B 1FEXA 3GTKJ 4IHXA 1FTTA 3G1LA 4V2GA 1WGXA 5F27A 4W1UA 5FKLA 2K40A 2M8GX 1Z77A 2VKEA 3PM1A 2E1OA 3NAUA 2HI3A 5F0FA 5E3OA 4FCYA 4D7MA 2L9RA 1POGA 3CCYA 1GV5A 1JT6A 3LNQA 1HLVA 1HDDC 2R7ZJ 2M9HA 2XGDA 1X2MA 1BA5A 1AU7A 2Y9ZA 3K7AJ 1VI0A 2AO9A 2XB5A 2FQ4A 1B8IB 1BW6A 1MBHA 3IH2A 2QCOA 3SJMA 2X48A 4JX6A 3ZQGA 1ZR4A 2PMZN 1Y1VJ 1U9NA 5EDNA 1T56A 2M0CA 2Y2ZA 4BY1J 2OPTA 1AKHB 3LSRA 2AHQA 2ME6A 1RPWA 3GTQJ 1B72B 3BTLA 1TWFJ 2M2EA 3Q3SA 2YUSA 3LSPA 4DYQA 3S2HJ 5E3NA 1GDTA 2NVQJ 1RKWA 1OCPA 5M3MJ 2LY9A 1APLC 3HBLA 5EGOB 2R5ZB 2LLKA 2DJNA 3RQIA 1JGGA 2DMPA 1I3QJ 5FKKA 1IDZA 2EZHA 5EG0B 4A3LJ 5EF6A 4DZJA 2L0KA 4XICA 2Y0SN 2NVTJ 3BTIA 3GTJJ 3JR9A 3B6AA 2E2JJ 1MBJA 1HDPA 3WHCA 2MGQA 3GTMJ 2CRGA 4FISA 4C3IJ 3PO3J 1ETOA 1JJ6C 1ZTRA 3DEWA 2JA6J 3BTCA 1G2HA 1ETQA 1PUFA 5GPCA 4BBSJ 3ZQCA 1ZQ3P 1ETWA 5J1UA 2L7MP 3HOYJ 3HB9A 4L5EA 5M5WJ 3BG9A 5FKOA 4XIDA 1GT0C 2L7ZA 1LFBA 3S1NJ 4C2MJ 4M3DA 2HXOA 4S0HB 1UG2A 2EQRA 3MN2A 4UUTA 1TWAJ 1IGNA 3S16J 2X9DA 3TP3A 3Q0VA 2XGEA 4M3BA 1U78A 2LKXA 9ANTA 1O4XA 4NDLA 3MKLA 1ORKA 1SANA 3BR1A 4D7NA 1WPKA 3HOWJ 2K9SA 4FTHA 4IEJA 3FIWA 5HODA 3OSGA 2QF7A 1SFOJ 1K83J 3BTJA 1JTYA 2Y9YA 3CDLA 5DS9A 2XPWA 4A69C 4A3CJ 1MH3A 1RETA 1MNMC 1HCRA 3RZOJ 4MIMA 5IP7J 2XB0X 3JRBA 3JRCA 3BR0A 2E19A 1IUFA 1IJWC 2JWTA 4RBOA 2GM4A 4ABZA 2E2IJ 5FLVA 5F0HA 2VPRA 1OCTC 2CU7A 1TC3C 3I4MJ 5J1RA 1JKPC 2CJJA 2CQQA 1MSEC 1XG1A 5K7FA 3JRIA 3B6CA 2KDZA 2R93J 2LD5A 4AUXA 2JK3A 5FKNA 5E3LA 4IHYA 2HOTA 2HDDA 3ZQLA 1X58A 2EH3A 1ETXA 5M5XJ 1FTZA 2N8GA 3JREA 1NK2P 2XPUA 4A3MJ 3HEFA 5JLWA 4B4CA 2O7OA 4C3HJ 4RDUA 1QPIA 1NK3P 4XK4A 2HOSA 2DMTA 3S2DJ 3HOUJ 1GV2A 3S1MJ 1BJZA 2LVSA 3HGYA 4QTRA 2ZB9A 4HNVA 4A93J 2DTZA 1ZR2A 1JUPA 3K2AA 3JRHA 2DA5A 4IHVA 3C2BA 3HOXJ 4JX4A 3LSJA 1OFCX 4G12A 5JLXA 1TWCJ 1A5JA 2H1KA 1GUUA 3ZQHA 2VUMJ 3S1RJ 2R5YA 3BQYA 2JN6A 3A01A 1QRYA 3QPLA 4A3FJ 4GFBA 3TP0A 3QPSA 2VKVA
chains in the Genus database with same CATH superfamily
2WAQN 4D5CA 1F36A 1AHDP 2EBIA 3OIQA 4XKCA 3V8LA 4EJUA 3KEOA 2JVHA 4WF2A 3CCQI 3P9KA 3OYBA 2B9SA 5C3EJ 2FA5A 4I98B 5B1AH 4YEJA 2VBXA 2VT3A 3IH3A 3ERED 3CUQC 1VNDA 4HQEA 3MKZA 1R00A 3CCRI 2VI6A 1XGOA 1BL0A 3L7WA 2PMZA 4IRGA 4LD5A 3I4NJ 2C6YA 3K2ZA 4MFDA 4GGGA 3K4LA 3MZYA 2LNBA 3SDGA 3H1CA 2HVSA 2KRFA 3ISPA 2NVXJ 2BVLA 3ZQFA 3ZN1A 4V19K 3LQQA 4C3JJ 1WJ5A 2W84A 4I6ZA 4D5FA 1QHHD 1FZPB 2GWRA 3ASOH 4KJZA 2QSFX 2YX4A 1Z6RA 3LSKA 4OIRF 3WG7H 5BOXA 2M5WA 2ID6A 2HOAA 2Z16A 3J7AY 3RQ4A 1YRNB 2LYCA 1JT0A 1YRNA 1PUEE 2DTRA 5J4VA 3K4MA 3M3YJ 2V1DA 3GFJA 3IWZA 4A2UA 5K7HA 1Y0NA 3J7YJ 1T38A 2F5DA 5HOOA 3GBGA 2DOEA 3ZR8X 1U8BA 1IN4A 3ECOA 4HF2A 2ZNZA 1XGSA 5B3SH 2V1UA 3HL2A 2VQGA 2TRTA 2ELKA 2G9WA 2JRMA 2MSYA 3QYFA 3WTZA 4RB3C 1VQ6I 5B1BH 4ZC3A 1S7EA 2DMNA 2V9PA 4CYCB 4CYCA 4HDUA 4LG0B 2E60A 5C44J 4NC7A 4G9YA 5KVRA 2UWMA 1ZN2A 4X1EA 2DW4A 2IAIA 2QZ8A 3C18A 2JPBA 3LQRA 3PO2J 3JRGA 4HG2A 2MH2A 1SD6A 2UZKA 1YIOA 1W7PB 2GXBA 2LR8A 4LLNA 4KMFA 3D5LA 3K4CA 2DYSH 4YIIA 1R9TJ 2XAHA 4GYGA 2JMWA 3E6DA 4BE1A 2B63J 1IZ1A 1WKMA 1ON2A 2D45A 2DFFA 3C2GA 3GFIA 2FOKA 3EUHC 2VE9A 2NVYJ 1IUYA 5FD6A 2XVCA 1ZAOA 2M1BA 4PZJA 1MNEA 3DPLC 2KT0A 2PBIA 1OQYA 3KP2A 4I7HA 3KX2A 3UKGA 1ZREA 1HW1A 1OCCH 3TO7A 3FX3A 4MLOA 2KKOA 2B7EA 3I64A 2NYXA 2F2EA 3LA7A 3UNGC 3SXYA 2HR3A 1QHGA 4UV9A 4UHTA 3RPQA 4AC0A 2J5OA 2A07F 1ETVA 2QQ9A 1SMYF 2X0LA 1F4KA 2JPCA 1YS7A 2Q2EB 1T95A 5J1YA 3J81K 2KQRA 2O9LA 2CUZA 5M5YJ 1XS9A 4NB5A 1XX5A 5CVJA 1WWXA 1AKHA 3GTOJ 2YU3A 1O7LA 2ZFWA 4XLNF 4U0WA 1B72A 2M30A 4P96A 4Y3OA 1EF4A 3HRUA 3H9QA 1J9IA 1BIAA 1EH6A 4F92B 3DQVC 1BR2A 3H0DA 4J00A 4U0YA 1I1GA 3GTGJ 3H5AA 3TQNA 4FX4A 2BE5F 3I59B 4AD9A 4A3JJ 1GXQA 4ENJA 3K1MA 4PJLA 4LGWA 4WXHA 2V79A 1SFEA 1D1BA 3C1DA 4BXXJ 2CO5A 1H9TA 3KYDB 1FJLA 2F5CA 3M7GA 3I71A 5DTDA 4OIQF 1K7AA 1S29A 3H35A 2MH9A 2CSOA 3U21A 1ZG5A 3CMMA 4FETA 1JHFA 3L09A 2O0YA 4FQGA 2MLGA 1R4NB 2ZXIA 1O3SA 2IW5A 5K5QA 2KISA 3VPRA 2EFNA 1TNTA 3QU3A 3PQJA 2E5NA 2VJ4A 5DCFA 3E7LA 4IF4A 1GHCA 2Y75A 2ECCA 2K9LA 2WAQA 1X3UA 1X1AA 4Z6YA 1RUNA 3K4NA 1LVAA 3IL2A 3O8HA 4RGUA 2X1DA 2V7FA 4YFXF 1J0RA 5M3FJ 1WQ2A 2VT2A 3CCVI 1E17A 1LDDA 1FOYA 2L7FP 1U9OA 2FBIA 4HX4A 4BJTA 4R1HA 4ZTJA 5LHGA 2ESHA 3MCZA 2MD0A 3RSNA 2HPMA 1R1UA 1BOAA 3FM3A 3OWTA 3BPVA 3T8TA 2W48A 3ESWB 3ZMTA 2KP6A 5L3FA 1G8XA 3LFUA 1ZG1A 3FXKA 2PLYA 3ZOBA 3TW7A 4B1RA 4ZDPA 3MQ0A 1T08B 5TJJA 1FOKA 2ZFUA 1YTYA 3FXLA 1ZLKA 1LE8B 2P0WA 5CJ9A 1MMSA 4IVNA 4IHXA 2OCCH 5DM7F 1FTTA 3T1BA 2M7AA 3MAJA 4V2GA 1VQKI 5KAFC 5F27A 2LBFB 3MWMA 2M8EA 4W1UA 5FKLA 4BNCA 4HEA2 4RAYA 3S3NA 5DM6F 1U5TB 2VKEA 1KONA 1SD7A 5GTIC 4EJVA 2WY8Q 4MHGA 4WK8F 1LB2A 2LREA 4H0EA 3CCYA 1YS6A 1X3ZB 5LEKA 4B09A 2R7WA 3DXJF 4OMYA 2FQ4A 2P5VA 2EILH 3WODF 2XDVA 3S3OA 3M8FA 2RV8A 4XMYA 1MBHA 3WTVC 2CYYA 4K2EA 1XD7A 1HC8A 3C7JA 1A6QA 3RI4A 1NH3A 2WY7Q 4U87A 2IP2A 2XRNA 3B73A 3IKVA 1Y1VJ 3DTKA 2MA3A 4B3XA 2M0CA 2Y2ZA 4GYIA 3NWSA 4UB8C 3PSFA 5HLHA 3Q9SA 2AHQA 2QSHX 4IHTA 2ME6A 1TLHB 4BHBA 3GTQJ 5CKTA 2L02A 2EFPA 3I5UA 1Y6IA 3I9V2 2OQRA 1Z3YA 5HDNA 5E3NA 1GDTA 2JQ7A 1OYIA 1APLC 5IT3A 3CMEI 3WTSC 5JHUA 4E7LA 2K27A 3RQIA 1JGGA 1SFXA 1HA8A 2EZHA 2RQQA 3W2VA 4DGWB 2DFHA 4DZJA 4L0ZB 4L9JA 1IN7A 3ZCOA 4BE0A 2DBBA 1JHHA 4HNTA 1YJWI 1I6XA 2Y0SN 1OKRA 1HXDA 3BTIA 3CJTB 3GTJJ 5J47A 2E2JJ 2CS3A 3MMYB 4CUGA 3K1NA 1E2XA 2MGQA 3GTMJ 3WTWC 2CRGA 3EYYA 4B43A 1RR8C 3CCLI 3F8CA 1ETOA 4ETSA 2EFQA 4RLQA 4G6TB 1R5HA 1R1VA 4EGYA 1H9GA 3DEWA 5DD4A 4IHSA 3BTCA 3CCEI 1KZHA 1NG7A 3CESA 1YW9A 4BBSJ 2V9KA 2HVQA 3CUQB 1ZQ3P 1ETWA 2LH9A 5J1UA 2FU4A 4XN0A 3PFYA 5LEJA 3AG4H 1LFBA 3U1DA 1N77A 2X85A 4S0HB 3I54A 1IAWA 1R49A 2EQRA 3C2HA 5BQTA 3E0JB 2EIMH 5EEGA 3PIOF 1IRXA 1TT0A 1IGNA 1TW2A 3OYNA 1U78A 1OMIA 2M45A 9ANTA 5H20A 3F22A 4MQVA 5LRSA 2K3PA 3BR1A 2XAGA 2A6EF 2VE8A 2IXSA 4RB0A 2V4JC 4IEJA 1K6OA 1SFOJ 4IQJA 1JTYA 1PJRA 5DS9A 3SQNA 2XPWA 2STWA 4RGXA 1DPUA 3HXLA 2KZVA 2HWVA 2HOEA 5FGMA 1FYLA 2DYRH 2HU9A 1MH3A 2CW8A 2LKSA 1FMVA 2WAEA 4MQ9F 2G7HA 3W6JB 3L2VA 3FXOA 4KT5C 2CQKA 1IUFA 5HS8A 4E7ZA 2FOWA 4RBOA 3DWLE 5FLVA 3CD6I 4WXDA 3OYKA 1OCTC 3I4MJ 5J1RA 3OYJA 2V6EA 2PI0A 1AOYA 3JRIA 3CZ6A 2DK8A 2VLAA 3KYLA 2R93J 5DD8A 1V54H 4Y15A 1SEUA 3G6EI 3IC7A 2R3SA 1USTA 3DPTA 2QBYA 3GZ5A 3WTUC 3J7ZI 2FBHA 5H6RA 4A6DA 3RPUA 3CJQB 1FTZA 3BDDA 4RB2C 2NNNA 5JLWA 2D1HA 3GZ6A 2O7OA 3HSRA 4XK4A 4KIFA 4Q4ZF 2VXZA 1V5EA 2QLZA 3HOUJ 2LVSA 3D5RC 2P5KA 5LBQA 3OL4A 4G94A 5CVIA 5HLTA 3JRHA 2E71A 4IHVA 5LGNA 2PJRB 3OYEA 2PJRA 2KIFA 3HOXJ 2ZJRF 2KRCA 4O6JA 4F93B 4G12A 5HVQC 3K4JA 5CPRB 3ZQHA 3H3UA 1J75A 2R5YA 2WC2A 3A01A 4A3FJ 4GFBA 4F3QA 3TP0A 2VKVA 3CF5F 1I3AA 3WE2A 3VEPA 1FP2A 2CW0F 4ZYDA 2MD5A 1WCMJ 3BG6A 1FBQA 3SZGA 4E7SA 5BPDA 1DU6A 3DTIA 3KLOA 1JUSA 4XORA 2H09A 2NS8A 3RIRA 1Y8RB 2RAEA 1ENHA 1ULYA 3GTPJ 1U6GA 4GCVA 3BR2A 4AVZA 1D8KA 1IDYA 2XAJA 3Q5FA 3FMRA 3CJNA 2R7XA 2DT5A 3EUAA 2DXIA 3I55I 2OCEA 3CP2A 4DIQA 4A3IJ 2MW8A 3AG3H 1WJBA 4GXOA 1FMWA 1WH5A 4EJOA 4OINF 3KEQA 1FYKA 1WI3A 2FXAA 3HZJA 4IXAA 3IP4B 5DCMA 3HHGA 4EJTA 3B02A 2NVUB 4MGRA 1ZG3A 2CH0A 3LL7A 2R7QA 1MDMB 4RGSA 3HKZN 3NWTA 4FE4A 3HOSA 2CUEA 1H88C 2DQRA 3BQZA 1T33A 5FFXA 3PJRA 4UUVA 2BOLA 2XGXA 1MSFC 3HGGA 2GQQA 2Y0SA 5DYMA 4L18B 1DQUA 5CLSA 1F1ZA 2BW3B 2HQAA 5E79C 4U7DA 3KLNA 3GCMA 2P6SA 1ITYA 3LOCA 4F91B 1Z7UA 1Z6TA 2KL4A 2HYGD 4A0XA 1V3FA 3L2QA 3BG7A 2XSJC 4AM3A 4DYRA 1YITI 2HXIA 4HV6A 2HEOA 4U88A 2KLOA 2XGCA 4BDZA 3N4MA 2RNGA 1IV6A 2LY1A 1YJNI 2DDAA 2VONA 1IG7A 2EZLA 2GAUA 3T5XA 2O03A 2E7XA 3TO6A 2XSDC 4PJ0C 2ZXJA 4L5JA 4I0AA 2ZC2A 3BZKA 1O3TA 1JUMA 3F72A 3IAM2 2J5PA 3FZVA 3LSMA 3HG9A 4Y7NJ 3G2BA 3FBNB 2DA4A 2DLLA 4GO1A 4LIVA 2P6TA 2X4HA 4M74A 4C2UA 1MJBA 2HKOA 3OMYA 3NEUA 4LK0F 3FMQA 1YX5A 3V4GA 3BR3A 3M1EA 1XSXA 4B48A 2OAZA 2VC1A 1R5GA 3SYTA 2EV5A 3MVPA 3G1OA 3JRAA 3W6VA 1X4OA 3BP8A 2EB7A 3QODA 1QU3A 1NG6A 5GAGJ 4G8XA 5L3GA 1B8IA 3BJOA 4KYWA 2O8XA 2RC4A 2KRHA 2BY1A 5IYDJ 4HV5A 3PFIA 2LG4A 1LNWA 1F9NA 1HKSA 2L54A 4LIUA 5GADJ 2JA2A 2ZXHA 4ZYEA 1BR1A 5IYBJ 3FKIJ 1U3EM 4XRSA 3BOQA 1X2NA 5K1YA 3LWFA 2A05A 5IPAA 1ZGJA 3WTTC 1K6YA 3BJAA 4UNOA 2M34A 4BKXA 4ANJA 3GYHX 2GA1A 1DGRM 2R7OA 1MMNA 3IH4A 2R5ZA 4E4HA 5EEAA 1MBEA 1UG0A 1F5TA 1ZRDA 2DN0A 5EG0A 3FKJA 1UB9A 2EZKA 2ESNA 3TOBA 1D3YA 3R4KA 3GMEA 1UHMA 4L0YB 4AIDA 4EGZA 3CDIA 3BC8A 3H92A 1PYVA 1RESA 4M3GA 1IXSB 4I09A 3CC2I 3Q9VA 3BR5A 2CQ7A 2Y31A 2DMUA 1OYYA 2A5YB 2FRHA 4RLFA 2XPVA 5EEHA 4DZPA 3PQKA 1P92A 3IAS2 1V4RA 4LITA 2JZYA 3P9CA 5HNFA 2HPIA 3DV8A 4BHPA 5DV5A 2IRFG 1XMKA 4FX0A 4L9TA 4B3AA 4IL6C 1ZHFA 3G3ZA 3BR6A 1YX3A 4QSHA 1OPCA 2X1CA 4V2FA 5TISC 2XAQA 3BWGA 5KK1A 1VQ9I 2OV7A 3CO7C 5GAHJ 2EV0A 4ZZLA 2JTVA 1PVEA 2HYJA 4IPAA 4PK4A 1JI8A 1YG2A 2CFXA 3EQLF 3L00A 4HX7A 1W36D 4HRIA 2ME0A 2XUBA 1VQNI 4Q48A 2VL8A 2CFOA 2X1EA 3RPUD 3L1PA 3ZP5A 3P5JA 4UXNA 3S8PA 4S05A 2BZTA 3QAHA 2FEZA 3JTGA 4CYDA 1QA6A 2DU9A 5D6EA 1OCRH 2IEKA 3S14J 1W36C 2DA1A 2R7FA 1BI0A 2WV1A 5TGTA 3G4SI 2VC0A 2QYOA 2HTJA 3FK6A 3ERMA 3CCJI 1ETKA 1ZK8A 2ZCWA 2E1MC 3W6KB 5LD2C 1SVOA 4XL9A 5H6QA 2K7LA 2XAUA 2L9SA 2JA8J 1B9MA 2Y69H 1JKOC 1JKRC 2CUJA 2W57A 3QU6A 3H3ZA 4I2OA 4IOCF 3CC4I 1FEXA 3MKWB 1R4MB 2VODA 1PP8F 4B47A 3G1LA 1WGXA 2QVOA 1JXSA 3FHNA 1H0MA 3F8MA 4XRFA 2K40A 3VWBA 2UUZA 1Z77A 3K4KA 3HKZA 3L2UA 2H27A 4A6EA 1FP1D 4QLCU 5D5VB 2F5VA 4NBQA 3NAUA 2HI3A 5F0FA 2QQBA 1C0WA 5E3OA 2VBZA 2L9RA 4WX9A 1HLVA 1JT6A 2R7ZJ 4N4NB 2M9HA 3QP6A 2WWYA 2RVCA 2AO9A 4FT8A 4XLAA 1U0JA 2G7UA 4AIJA 1BBYA 1BW6A 3N97A 4ZYAA 4BQNA 1KU2A 2V26A 3NQOA 2QCOA 3BPXA 3M9AA 3ZQGA 2IA1A 3GFMA 2QGUA 2KPMA 1FT9A 3VSLA 4EM0B 4KUMA 2AXLA 4KN4X 1VTNC 2VKDA 4BY1J 3AG2H 2FUG2 4CICA 2OPTA 4XKWA 1R6RA 4RMNA 1AKHB 3O6BB 5E8GA 1DDNA 1OLTA 3GFLA 4P55A 5LLQA 4XN3A 1VQOI 2Y48A 1BR4A 2ZJPF 1B72B 1FSEA 3BTLA 3FM5A 3LSPA 3S2HJ 3D5SC 2NVQJ 1GLNA 1RKWA 2QUFA 2LLKA 2YSRA 2V9VA 1OISA 2DFEA 2DMPA 1I3QJ 3EUKL 3HPGA 4YFNF 4A3LJ 2FMYA 5EF6A 1Z7LA 2LDUA 2GOMA 2L0KA 5ICGA 2JSCA 4XICA 4UVAA 2OZUA 3BZCA 2IJLA 3KP7A 1O3QA 3N05A 2F5FA 1KGSA 4X0GA 4BL0B 1X19A 3T0YA 1PDNC 3OYAA 2VJJA 3FXUA 2F5EA 1M1EB 4RM3A 3MEXA 4RA2A 1T0FA 5GTHC 4CO8A 4YELA 3JSPA 2ACJA 2A61A 1LFPA 2L9VA 3ZXSA 1IW7F 3VYUB 3DU5A 1ETQA 1W1WE 1PUFA 3HIFA 4E6KG 4Y13A 2ICWG 2E34A 3P7NA 2VBYA 5J6XA 4M9ZA 2L7MP 3DTEA 4ENMA 5HS7A 4L5EA 5M5WJ 4XIDA 2BY0A 2K02A 5ICEA 4YIRX 3TMOA 4M3DA 3O2PE 1UG2A 2JT1A 4U0VA 3R60A 2Z9OA 2QM3A 1SFUA 1TWAJ 4CCLA 3S16J 4G7OF 1LDKB 2XGEA 3HUGB 3HUGA 2VQCA 2YPRA 1J09A 4BH9A 1SANA 1NHAA 3HOWJ 1FY7A 2K9SA 3R6SA 3K1PA 3ABMH 3FIWA 3OSGA 3VB2A 4D0PA 3F6OA 2CV2A 2HZTA 4A3CJ 2H6BA 3LAPA 3U1KA 1HCRA 5IP7J 1Y0UA 2P7VB 3E6BA 4QWQA 5ILSA 4HLYA 1QZEA 4UV8A 5GAEJ 3SEZA 2E19A 2JWTA 2WAFA 1FPQA 4ABZA 5H2FC 1XTAA 1IV8A 2VPRA 2RNJA 4RAGA 4XBFA 3W3CA 1CF7A 1K78A 2CJJA 3DP7A 1G3TA 3L9FA 4ZTFA 2P4WA 3BROA 5FKNA 3FF5A 3MKYB 5E3LA 1MMAA 2HOTA 4HDVA 4HSTA 3ZQLA 3WU2C 2V1XA 1LEBA 4LFUA 4KIGA 3GO5A 6PAXA 5M5XJ 3LA3A 5CQGA 4OIOF 5L3BA 2N8GA 3RKYA 1NK2P 1U2WA 2KJBA 3PNVA 4RDUA 1EH7A 4CCNA 3ZMDA 2OU2A 2MABA 3S2DJ 2DMTA 1OCOH 1AA7A 1S6LA 1XPXA 4KFCA 3DEEA 2DODA 4AVPA 2ZB9A 4A93J 1W5SA 2IPQX 4Y33A 1BIBA 2L7KA 2FQ3A 4XM3A 3DBHB 4I01A 1ZELA 2GXAA 2XF6A 1G4DA 4IO9F 4HQMA 4IRIA 4JX4A 3LAJA 3LSJA 3A4CA 1FNNA 4ESFA 2VUMJ 1D1CA 3I0TA 3BQYA 1E3HA 2JN6A 1I1SA 4PJMA 3ML6A 3HOTA 3QPSA 2L5QA 4ASNA 3F8NA 5K5OA 3ZMSA 3HM5A 1K79A 4UVCA 1SMTA 1LKXA 3TL4X 1S3JA 3L2CA 3TDZC 3ZQQA 2CV1A 2LC2A 4N9HA 5LGUA 4BXFA 1JTXA 4C30A 4BS9A 2JA7J 1R58A 1KQ0A 2E1CA 4IHWA 2IGNA 3Q0WA 3QPTA 1R7JA 2E35A 3ROUA 3CP8A 4F52A 3GW2A 5B5EC 4BY7J 3ZQ7A 4KA4A 1XN7A 1GXPA 1LFUP 1B9NA 2DMQA 1Q1VA 3LFKA 5ILVA 3ELKA 2DDBA 1JE8A 2W85A 3FXJA 3A03A 3JW4A 3IV5A 1X1PA 3PIPF 1P4AA 2IGKA 4PUSA 5IP9J 2VXDA 3FHZA 4NHJA 1S5LC 5IOYA 4UUSA 3IRQA 1MBKA 1IN5A 3DLLF 2M0MA 1ZLJA 2GBYA 2QENA 5BNGA 4KDPA 3ABKH 4E7HA 3JRFA 3FDYA 2OUMA 5F08A 4BQQA 1T39A 1XCBA 5K7ZA 4EVIA 4HZFA 5D5XB 3QQAA 1P4XA 1G3SA 3OIOA 1SD4A 3ZMVA 5F1RA 4FE7A 2L4MA 3Q0UA 3F21A 3GTLJ 5E17F 1JGSA 3GEZA 1QGPA 1TWGJ 2DQLA 2NAZA 3E6CC 3OYFA 2LMDA 2RN7A 1SAUA 2L01A 4PJNA 4M72A 3OYHA 3H0GJ 4BHCA 3KZZA 5D5WB 3KFWX 3K70D 5KCMA 4JYKA 1CQTA 2R92J 1GVDA 2QQ8A 3RZDJ 3HC7A 1J59A 4RAFA 5F04A 3K69A 3RJPA 3OYGA 2IS2A 2ZJQF 5CVUA 2OZ6A 4CGZA 1I27A 4G6DA 1G6NA 1KYWA 3CQZJ 4PFPA 1LEAA 1XGMA 3BT9A 4PJJA 4FHTA 3K70C 3SZPA 3HRMA 3DF8A 3WGIA 1V55H 4BBRJ 5J40A 5FLMJ 5F1JA 2X6WA 4UVBA 2EWNA 4M6XA 2W24A 2Q8KA 3CMAI 3S1QJ 2LK2A 5IY5H 2EA2A 2OF7A 1OYWA 2QBYB 3OV8A 4DJAA 5HLIA 2E1MB 2DT6A 4P5OA 3K4BA 4LLGF 3EDPA 3H5RA 4M9SA 3HPHA 3GLLA 1L0OC 4XRMA 3TO9A 5JVGF 1WJAA 1QZYA 1YW7A 1XC5A 5HNHA 3CLQA 4M3FA 1Z67A 1I50J 2PN6A 2MC4A 3DBLB 1IN8A 2VN2A 2D5VA 4EQQA 5FRNA 2QQAA 2QWWA 5GPAA 1UHWA 4IJAA 2OJED 2K4BA 1WI9A 2GIVA 4R8HA 3A2KA 3PUFA 2YS9A 3V8KA 3F0CA 4EM2A 4ENKA 3R61A 3NARA 2R5YB 3WTXC 2FD5A 3OSFA 3A01B 5D8KB 1PP7U 3RTRA 5J3LA 3VSKA 1T0FC 5BMZA 5FJ8J 3EUHA 2QSGX 2Z2SB 3JTHA 1HF0A 2X6YA 2F6CA 3VDXA 2XRLA 4J19A 1Z05A 4EM1A 4G7HF 3KETA 1EKEA 4YFKF 3S15J 5E20A 4F7ZA 2P81A 2DA6A 1RIOH 2CQNA 3VFZA 5EGOA 1P9QC 2RGVA 4QIWN 2M7BA 3CCMI 5JI6A 4AYBA 4A3KJ 2V1NA 1IO2A 2B0LA 3E5XA 1T2KA 2HVRA 1OR7A 4M3EA 5E1XA 1RNLA 2X6XA 2XAFA 4WXCA 4JX5A 2XKPA 1D0ZA 2ECBA 2K4JA 5E3MA 1NTCA 1HOMA 2MYSA 4HX8A 4CCKA 3X2QH 4W97A 3HTSB 1DPRA 2IGMA 2R7DA 4PGHA 3DKXA 1IRZA 4L9NA 1HKQA 2HTSA 2VQHA 3S17J 4D1QA 5IOZA 5DUIA 4S04A 5DCMB 1W0UA 1B4AA 1P4WA 1QVUA 4TV7A 3IHUA 5C4JJ 3HSEA 4KNYA 4M6VA 2GLOA 2FSWA 1AWCA 4GRIA 2X6OA 2WB1N 3M8JA 4OAYA 2KIMA 3BLYA 2R7TA 1IF1A 3ZQIA 2PMUA 2COBA 2F4IA 2K9NA 1R22A 2UV1A 4HBLA 2VOOA 4MO7A 3EYIA 2WTEA 2BY2A 3M4OJ 4Y52J 3GF2A 1USSA 4NQWA 3S3MA 2BYVE 4ON0A 5LHIA 3V8JA 4UY8I 1RZ4A 4CCMA 3K0LA 3OYMA 3AKZA 1IC8A 1MH4A 3ABLH 3BG5A 1RKTA 1V5FA 3LSGA 2K85A 5EYRA 2P5LC 2Z1DA 3O8GA 1S7OA 3CC7I 2K5CA 3JRDA 2ISYA 2LF7A 4BAYA 5CQEA 1X1DA 2ISZA 4HNUA 1MKMA 4P1WA 2AS5F 1WZ2A 3P9IA 2H8WA 2LRDA 3KZYA 4XLPF 4O3MA 2XF5A 5ICCA 2Y30A 3H5NA 2CUFA 1XMXA 5ILUA 1X3WB 1ZGWA 1W5TA 4HW0A 5D6FA 3RKQA 2JJ7A 1P7JA 2DA7A 3OR2C 2JRTA 5DDGA 3GTKJ 2OTJI 1WFXA 2H6CA 4KISA 2OQGA 2ZMEA 1IRGA 2M8GX 2E1OA 1A31A 1MGTA 4CCJA 4EMSA 4FCYA 1GV5A 1R71A 1BA5A 1X2MA 3GLXA 1AU7A 2Y9ZA 2RKHA 1IRFA 3VOEA 3DKYA 3OS0A 1XSDA 1B8IB 4M73A 4XLFA 2DPUA 4CH7A 2LF8A 1HSJA 2Y0MA 3KP3A 4PDKA 4IKFA 4LB5A 3SJMA 1XMAA 1T6SA 5D8LB 3FXMA 4B8XA 3RKXA 2W25A 2EV6A 2IT0A 4RB1A 2O3FA 1U9NA 4CZZA 3ASNH 2W1OA 2BVMA 3LSRA 1T98A 3A0HC 1ONVA 5FFZA 3RDIA 1FLIA 1RPWA 4BJ6C 3J80Z 4ENNA 3O3KA 1TWFJ 1HKTA 2M2EA 3Q3SA 2YUSA 3T8RA 3VYRB 4BEHA 1XGNA 3AFHA 5FO5A 1S9HA 3DKWA 4N4OB 2LY9A 3HBLA 2R5ZB 2CG4A 1WJEA 2DJNA 2M87A 4FASD 2A68F 1IDZA 2AQFA 2HS5A 3ZMZA 3CCUI 1YFHA 3OYDA 1KU7A 5EG0B 1S7AA 2KIQA 2DJIA 3C3WA 4BE2A 2COMA 3LA2A 1S72I 3RYPA 2FNAA 3FBIB 3JR9A 3B6AA 4WCGA 4WWCA 1SVMA 1MBJA 1HDPA 2IS4A 3WHCA 1UAAA 2A6HF 3TKYA 4FISA 4C3IJ 2E36A 1MMDA 3PO3J 1ACIA 1JJ6C 1ZTRA 1L3LA 1QO0D 5TRDA 2DOFA 4GDFA 1VQ8I 3AG1H 2IGOA 4HPQA 4CXFA 1WRJA 4HYEA 3AL0B 1QZZA 4A5NA 5GPCA 4QPOA 1BI3A 4M6YA 2L2OA 2BXYA 2ZNYA 3BCAA 1EV7A 3E5UA 4C9YA 2RREA 4E70A 1Q1HA 3HOYJ 3V7SA 3BG9A 4HAMA 4L5IA 4OU0A 2V6CA 2R7VA 3KP5A 2LY2A 2E1NA 1GT0C 1A36A 3KIOA 4RAZA 1Z3XA 4AIHA 4A0ZA 2QA4I 2Z5UA 3MN2A 4UUTA 2CGPA 4LB6B 3Q0VA 5L3CA 4M3BA 1REPC 2LKXA 1SFKA 1ORKA 5JVTA 1HW5A 4BGDA 4RM2A 5FD5A 3ABUA 3ULQB 4OWRB 3QOEA 2Y9YA 3DU6A 1YLFA 2YR2A 2P7CB 1N75A 4ZH4F 1IXCA 1B1BA 2AXTC 3SZTA 1MNMC 1R36A 2CWEA 2M4GA 3RZOJ 4MIMA 2XB0X 2NXNB 3E3VA 4LG0A 3BR0A 3PNYA 4HF1A 4CHUA 4E7IA 2DO7A 1QPMA 2WB1A 3WGHA 2EFOA 4RS8A 2CU7A 1TC3C 2PJPA 3HYIA 1TL8A 1JKPC 1ERDA 4HSRA 1P2FA 3DFGA 2CQQA 4BJ5C 2X51A 3OOPA 4YRVA 1XG1A 2VB6A 5K7FA 1W7PA 4ZDLA 3B6CA 2KDZA 2LD5A 4AUXA 4ZZDA 4R79A 4CA0A 4G7ZF 3QPHA 2VASA 2DT7B 2HDDA 4HA8A 4OIPF 2A5WA 2NS0A 1D0XA 5D5UB 4CDGA 2IA0A 1YHQI 1G3YA 3JREA 2AQEA 5HDGA 3TDUC 4A3MJ 3F3XA 2HZDA 4DNCA 4NC8A 1YO5C 1N78A 4B4CA 2PEXA 4C3HJ 2GZWA 3F9KA 1QPIA 1QBJA 2HOSA 3REOA 4C2TA 3S1MJ 5J8CA 2ETHA 1TNSA 3HGYA 2LOOA 1MJAA 3SEQA 3QYBA 4II3A 2H94A 4HNVA 2GA2A 1A35A 2EPFA 2M4KA 3CJRB 3PL8A 4JOMA 4ZYHA 3AAFA 1ZR2A 1JUPA 1OR7C 4KICA 2DA5A 3HHHA 2L3DA 1EH8A 4DQ2A 4E7JA 1OFCX 5JLXA 1TWCJ 1A5JA 4M71A 2H1KA 4BU2A 1MD0A 2Q2EA 4XNFA 5E18F 3QPLA 3CTAA 3WTYC 2NOJB 1X1CA 4JK1X 1MBFA 1VQ5I 1RR7A 3D1NI 2PX9A 4LOCA 1Y39A 2ZO4A 3K6GA 3LSTA 3ABTA 5FKMA 2OTLI 2HQRA 2KDOA 3HOVJ 1LDJA 3KP6A 3S2WA 2ZSHB 1RI7A 3TOAA 2EZIA 3A0BC 1MW7A 2EK5A 1P6RA 1FSHA 3I59A 2RDPA 3OOUA 2VPLA 1WH7A 3E5QA 3I53A 2CW7A 2FJ1A 2ELHA 1VZ0A 4M9XA 4I99C 1SC7A 1UFMA 3JSOA 2R0QC 1PUFB 1UMQA 4DBQA 2XKOA 3TGNA 2HDWA 2LTPA 1MJ9A 5GP9A 4PFOA 3IKTA 2W82A 1QNTA 1B6AA 5HDKA 4ZJZA 2TCTA 1XDUA 3S32A 2JA5J 2O8KA 4LMYA 4XRSG 4BACA 3ZN0A 5IYCJ 1YOVB 3V42A 1OJLA 2WADA 1ZGAA 2EIKH 4I02A 1BN5A 3J80K 1R1TA 3I3LA 4A3EJ 3LSHA 1XCVA 2OA4A 2ELJA 1U8RA 1ON1A 3I58A 4DYCA 2FX0A 2HDCA 2O5RA 5AIQA 1W5CC 1I6HJ 3CMYA 1YJ9I 1DP3A 1DGWY 2I10A 4QPQA 4DW6A 2VKHA 3JAMZ 1DU0A 2ZMEC 3OY9A 2E2HJ 2R7SA 2G0EA 3R0AA 2KIUA 4OMZA 2BV6A 4KIBA 3TEDA 3GUDA 5LHHA 5LGTA 2RQPA 4A3DJ 1DP7P 4MNUA 4IX7A 5F64A 2A6TA 2CMPA 1VQMI 1FIAA 4XSXF 1EA3A 4G6QA 3WHBA 1WJDA 1UHSA 3PNTA 5KNLA 2I8DA 4LJZF 2LP0A 1E3OC 4XLEA 1W4MA 1D5YA 1QVTA 2NNYA 1CF7B 1K78B 1E0EA 5ICFA 4YIFA 5F0CA 1W0TA 4MFEA 3ZMUA 1K4SA 1H89C 4MEXF 1TP4A 3V7CA 1K61A 1BM9A 4XLHA 1F43A 1LE8A 4I76A 2DA3A 2F48A 2IA2A 2OBPA 2XHKA 3LSIA 3MZ8A 1BI1A 2JUCA 3KE2A 2LBFA 2O6GE 3HDDA 2EJRA 2H8RA 4AYBN 3I4PA 4JBAA 3QOPA 2ADUA 2FBKA 1U5TA 3RYRA 2D2WA 2NOGA 2WA0A 1J7KA 1D1AA 3SFZA 2D1VA 2GOXB 1I5ZA 1K4TA 2UXXA 4EV0A 4X6AJ 3W2WA 1VQLI 3WG9A 2ID3A 1Z1DA 1QQIA 5E8IA 3KCCA 4A3GJ 2IS1A 2BXZA 2HQ5A 1BC7C 4L9VA 4D9JA 2PFBA 4UB6C 3QYEA 4J01A 3E6MA 1YIJI 2DPDA 2GXGA 3ECHA 3DEUA 2LFBA 2FF4A 5EZGA 2Z3YA 3IRRA 2HNHA 3OYLA 3GX4X 1Z0XA 2MLKA 4ITVA 4PSWA 3OYIA 2KFDA 1WJFA 1X1BA 5HS9A 2BHZA 5FROA 1ZRCA 2CV0A 1ZARA 2YU9J 5LFAA 5ED4A 5CYVA 3ZPLA 1TT5B 2NS7A 3DCFA 1EJ9A 3BG3A 4HLXA 3QRFF 2PMHA 2XROA 4PSXA 1P7IA 1RUOA 1IN6A 4CCOA 3SFIA 5IT9Z 1Z21A 2L9NA 2K9QA 1TWHJ 3COAC 3AL0C 2KJCA 3CO6C 1Y1WJ 2QKMB 1V5GA 3OL3A 1FIPA 4Y17A 2HKXA 4XR6A 1GVJA 2K3FA 1LQ1A 5BPIA 3GVAA 3H3VK 1HQCA 1ODDA 3QP5A 4AWXB 2JUGA 4XKVA 1A6IA 3GWZA 4MEYF 4BUPA 2JVGA 1X4PA 2BHYA 1N25A 3J7AO 4A5MA 3G1MA 3VYTB 3FISA 3CF2A 1ZYRF 1WHUA 4UUSB 2BEOA 1KYZA 1KA8A 2VBWA 2VJ5A 2WV0A 4BXUA 1H8AC 1JKQC 3R0JA 5ERIA 2Z33A 2Q1ZB 3MZHA 1JJ8C 2MC3A 2MG4A 4F55A 1J2XA 1BC8C 3KYCB 1YE9A 3VYSB 4ZYGA 2KMUA 5KAIC 1MBGA 2YX7A 3SDBA 1VFCA 4ESJA 1A04A 5L3EA 3HTUA 3K9TA 1BW5A 1ETYA 3CUQA 5IP6A 4JP0A 1W7PD 4BYYA 2XASA 4O5VA 1WVRA 2FNPA 3GXOA 5B66C 5FLXZ 5C4XJ 4EEFG 3FK7A 3G73A 2IBDA 1YI2I 2FE3A 3HOZJ 3V7RA 2DFIA 2EIJH 4AU7A 3A02A 4KT6A 2DA2A 4Z2YA 4XONA 1TQMA 1UELB 1HW2A 4OOIA 4A3BJ 1XB4A 3E97A 1ZKGA 3CCSI 4Q47A 1TW3A 4Q5SF 4NC6A 1VF9A 5HLGA 2STTA 4XQFA 2EINH 1G3WA 3H9JA 4LG3A 4AIKA 5AONA 2DI3A 3TW6A 4II2A 2CQXA 5A2QZ 1KQ8A 1WSUA 1OCZH 2ZKZA 5E1WA 5EZHA 3MD2A 3DBRB 1TQPA 4JQFA 3IWFA 2O61A 2A3SA 1LVKA 1Z91A 2OD5A 3LMMA 4KITB 2ZSIB 1TZLA 3M07A 4PGGA 2DK5A 2W4SA 3PM1A 3KP4A 1YW8A 3M8EA 4XSZF 4XOPA 1UZCA 2NRAC 3K10A 3BCBA 1D8JA 3ZGKA 3EPZA 4D7MA 1POGA 2M3AA 3BY6A 5CVVA 3LNQA 1HDDC 2IVMA 2XGDA 1WJCA 3K7AJ 1VI0A 2XB5A 1FYMA 4E7KA 4BQAA 3JCUC 4Y4RA 1SVLA 3UR3C 5D4SA 1TQIA 4P9UA 3MFKA 5JHFA 3CUOA 2UXNA 2EA4A 3SHFA 3IH2A 2R4GA 3JAMK 2X48A 4JX6A 1D0YA 1VQ4I 1MNDA 2VOPA 1LJ9A 4B44A 4BDYA 4XKBA 1YYVA 2OC6A 1ZR4A 2PMZN 3RCOA 1TTYA 2BGCA 5EDNA 1T56A 1LPQA 4BQOA 2W7NA 1T8IA 1MZBA 1KQ9A 4MTDA 5K5RA 1MMGA 2GIZA 4A12A 1J5YA 3VODA 5FRMA 1ZRFA 4DYQA 1YQAA 1OCPA 2H1LA 3IUOA 2TDXA 4DOZA 4DBRA 5M3MJ 5EGOB 1Y56A 3CLOA 4IRHA 3WU1B 3WE3A 1FBUA 4XOTA 5FKKA 3PSIA 4P9FA 1RC9A 1FC3A 4IZZA 1IXRC 1I39A 1ZH5A 3U2RA 1LUJB 4U7BA 3FXRA 4N0BA 2NVTJ 2HQNA 4KN7X 1FOXA 4EJWA 5BS6A 2K9MA 1XSVA 2EFWA 2LKPA 3QWLA 4ESBA 4N9IA 2KZGA 3KZIC 2K86A 3W2AA 3M1CA 2ZBKA 3OYCA 1SD5A 2VQLA 1S8NA 3ONQA 2JSPA 3A1YA 3H36A 5AIPA 2JA6J 3TBIA 1G2HA 2Q0OA 1B59A 5JR3A 2A69F 3CDHA 5L3DA 3ZRGA 3ZQCA 3RKWA 1HBXG 5FB2A 4IQ4A 3L2RA 3NRVA 3HB9A 1KU3A 5J4YA 4NQWB 1KU9A 5FKOA 1R5ID 3KPHA 1VQ7I 3FWEA 2F4OB 2L7ZA 1D5VA 2KHMA 3S1NJ 3F8FA 4C2MJ 4NNJA 2HXOA 2VJIA 1MDMA 4CZCA 1FOWA 1R23A 2X9DA 2ZXWH 3TP3A 3S93A 1Y8QB 4CSWA 2DCEA 1O4XA 4NDLA 2XV4S 3MKLA 5IT9K 3OIPA 4D7NA 1WPKA 3F23A 5LRRA 2F4MB 2BY3A 5JFRA 4FTHA 2R7UA 2P8TA 5HODA 2QF7A 1K83J 3CDLA 3BTJA 2DOAA 2Z99A 2W00A 3HJEA 2BW3A 3KEYA 4YG2F 1SAXA 3HRSA 4A69C 2XF7A 4KMUX 2L4AA 1U5TC 4MTEA 3OS2A 1RETA 1FX7A 5DUKA 3J81Z 1FWZA 5F6FA 5J8FA 2MBFA 3JRBA 2PG4A 4EATA 3DLAA 2LSOA 5KHDA 5CVRA 1RRJA 1HSTA 3JRCA 2HGCA 1IJWC 4H4KC 2ZMEB 3G71I 3D0SA 2WBMA 2GM4A 2E2IJ 1VQPI 5F0HA 3U9GA 3F6VA 2DAOA 4NUBA 3HRTA 1UJ8A 1BOBA 3DPUA 3OR1C 3BJ6A 3F8BA 1MIJA 4ZDOA 3GZNB 1MSEC 1UCRA 3FXQA 3EETA 2IS6A 2XC7A 2BBYA 2JK3A 2HFHA 3I56I 1O57A 1FBSA 3WGGA 4IHYA 1DUXC 4LK1F 1X58A 2EH3A 4PCQA 1ETXA 4I0BA 2HYFA 5D4RA 5FLXK 2XIGA 3BZ6A 1STZA 2XPUA 4HF0A 1BI2A 4HOBA 3WU0A 4A0YA 1O7FA 3HEFA 2I5UA 2QEXI 4OAZA 1NK3P 1GV2A 2E5ZA 1BJZA 3FMSA 5E1ZB 4QTRA 2FMLA 2DTZA 4LLLA 3H9GA 2PQ8A 1XDSA 1Z9CA 3K2AA 1E3PA 2VIXA 2E7WA 3C2BA 4BEHB 4XLCA 1CGPA 5EJCA 1BJAA 3HSFA 3E1SA 1O3RA 2QKLB 1TBXA 1GUUA 4IOAF 4RGRA 2MFZA 3PUBA 2R7RA 3S1RJ 5DEQA 3L2WA 2ZJ2A 5A2QK 1QRYA 1G59A 3OS1A
chains in the Genus database with same CATH topology
2WAQN 4D5CA 1MBFA 1F36A 3HM5A 1AHDP 1RR7A 2EBIA 3D1NI 4LOCA 1WCMJ 5FKMA 1JTXA 5C3EJ 2JA7J 3HOVJ 4IHWA 1DU6A 3Q0WA 1JUSA 2NS8A 2RAEA 1ENHA 2EZIA 3GTPJ 3BR2A 3IH3A 1IDYA 1VNDA 4BY7J 1LFUP 3OOUA 2DMQA 1WH7A 1Q1VA 2FJ1A 2VI6A 1BL0A 2R0QC 1PUFB 3A03A 3IV5A 3I4NJ 4A3IJ 1UMQA 4MFDA 2LTPA 2MW8A 5GP9A 5IP9J 3SDGA 1WH5A 1WI3A 2TCTA 5IOYA 4UUSA 1MBKA 2NVXJ 2JA5J 2O8KA 2GBYA 4XRSG 3ZQFA 5BNGA 4C3JJ 3JRFA 5IYCJ 4I6ZA 4D5FA 1OJLA 5F08A 5K7ZA 3QQAA 3HKZN 4A3EJ 3OIOA 2ID6A 4FE4A 2HOAA 4FE7A 3Q0UA 1YRNB 1YRNA 2CUEA 1JT0A 1H88C 4DYCA 3GTLJ 3BQZA 1T33A 2FX0A 1TWGJ 3M3YJ 5K7HA 1I6HJ 1MSFC 3HGGA 3CMYA 3GBGA 1U8BA 3H0GJ 2I10A 4DW6A 1DU0A 2E2HJ 4JYKA 2G0EA 1CQTA 1ITYA 3LOCA 1GVDA 2R92J 3RZDJ 2TRTA 2ELKA 2MSYA 5F04A 3TEDA 1S7EA 2DMNA 4DYRA 4CYCB 4CYCA 4A3DJ 2HXIA 5C44J 3CQZJ 2XGCA 3BT9A 1FIAA 1IV6A 3WHBA 1UHSA 4X1EA 4BBRJ 1IG7A 2EZLA 2IAIA 2LP0A 1E3OC 1D5YA 1QVTA 3PO2J 5FLMJ 5F1JA 2XSDC 3JRGA 5F0CA 1W0TA 4MFEA 1H89C 2LR8A 1K61A 3S1QJ 1JUMA 2LK2A 1F43A 1LE8A 2OF7A 4I76A 4Y7NJ 2DA3A 1R9TJ 2DA4A 2JMWA 2B63J 3HDDA 2H8RA 4AYBN 2NVYJ 2NOGA 2KT0A 3BR3A 4XRMA 3UKGA 1XC5A 3MVPA 3G1OA 3JRAA 3W6VA 4X6AJ 4M3FA 4MLOA 2ID3A 1I50J 4A3GJ 2D5VA 5GPAA 1B8IA 2HQ5A 4AC0A 5IYDJ 2YS9A 1ETVA 5EZGA 2LFBA 3F0CA 1Z0XA 3NARA 5J1YA 2R5YB 2FD5A 3OSFA 3A01B 2O9LA 5M5YJ 5IYBJ 1XS9A 3FKIJ 4XRSA 2YU9J 1X2NA 5J3LA 1AKHA 3GTOJ 5FJ8J 5IPAA 3DCFA 2NS7A 1HF0A 3BG3A 2XRLA 4J19A 1B72A 2M34A 1EF4A 4BKXA 1P7IA 3S15J 3SFIA 2P81A 2DA6A 2K9QA 1TWHJ 3IH4A 5EGOA 2R5ZA 4QIWN 1Y1WJ 5EEAA 1MBEA 1FIPA 3GTGJ 4A3KJ 2DN0A 5EG0A 4A3JJ 4M3EA 2EZKA 3H3VK 1A6IA 4JX5A 4BXXJ 4M3GA 2ECBA 1RESA 5E3MA 1FJLA 1NTCA 1HOMA 4W97A 1IRZA 3G1MA 3BR5A 5DTDA 3FISA 2DMUA 2Y31A 4UUSB 3S17J 5IOZA 1H8AC 2XPVA 1JKQC 4DZPA 1W0UA 1QVUA 1JJ8C 5C4JJ 2MG4A 4M6VA 2GLOA 2X6OA 2WB1N 4B3AA 4QSHA 3BR6A 1MBGA 3VPRA 4V2FA 3ZQIA 1VFCA 2COBA 3E7LA 2K9NA 1BW5A 1ETYA 2ECCA 5IP6A 4JP0A 4MO7A 2HYJA 3M4OJ 4Y52J 3O8HA 5C4XJ 4EEFG 3FK7A 2IBDA 5M3FJ 2ME0A 3HOZJ 3A02A 1IC8A 2DA2A 1MH4A 4A3BJ 3BG5A 1RKTA 1U9OA 2L7FP 3LSGA 5EYRA 3L1PA 3O8GA 1ZKGA 3JRDA 2IEKA 2W48A 3S14J 2DA1A 2WV1A 1VF9A 3FK6A 1ETKA 1ZK8A 2Y30A 3ZOBA 3TW7A 2CUFA 4B1RA 2JA8J 1ZGWA 3TW6A 1JKOC 1JKRC 2CQXA 3RKQA 2JJ7A 1P7JA 2DA7A 5EZHA 1LE8B 1FEXA 3GTKJ 4IHXA 1FTTA 3G1LA 4V2GA 1WGXA 5F27A 4W1UA 5FKLA 2K40A 2M8GX 1Z77A 2VKEA 3PM1A 2E1OA 3NAUA 2HI3A 5F0FA 5E3OA 4FCYA 4D7MA 2L9RA 1POGA 3CCYA 1GV5A 1JT6A 3LNQA 1HLVA 1HDDC 2R7ZJ 2M9HA 2XGDA 1X2MA 1BA5A 1AU7A 2Y9ZA 3K7AJ 1VI0A 2AO9A 2XB5A 2FQ4A 1B8IB 1BW6A 1MBHA 3IH2A 2QCOA 3SJMA 2X48A 4JX6A 3ZQGA 1ZR4A 2PMZN 1Y1VJ 1U9NA 5EDNA 1T56A 2M0CA 2Y2ZA 4BY1J 2OPTA 1AKHB 3LSRA 2AHQA 2ME6A 1RPWA 3GTQJ 1B72B 3BTLA 1TWFJ 2M2EA 3Q3SA 2YUSA 3LSPA 4DYQA 3S2HJ 5E3NA 1GDTA 2NVQJ 1RKWA 1OCPA 5M3MJ 2LY9A 1APLC 3HBLA 5EGOB 2R5ZB 2LLKA 2DJNA 3RQIA 1JGGA 2DMPA 1I3QJ 5FKKA 1IDZA 2EZHA 5EG0B 4A3LJ 5EF6A 4DZJA 2L0KA 4XICA 2Y0SN 2NVTJ 3BTIA 3GTJJ 3JR9A 3B6AA 2E2JJ 1MBJA 1HDPA 3WHCA 2MGQA 3GTMJ 2CRGA 4FISA 4C3IJ 3PO3J 1ETOA 1JJ6C 1ZTRA 3DEWA 2JA6J 3BTCA 1G2HA 1ETQA 1PUFA 5GPCA 4BBSJ 3ZQCA 1ZQ3P 1ETWA 5J1UA 2L7MP 3HOYJ 3HB9A 4L5EA 5M5WJ 3BG9A 5FKOA 4XIDA 1GT0C 2L7ZA 1LFBA 3S1NJ 4C2MJ 4M3DA 2HXOA 4S0HB 1UG2A 2EQRA 3MN2A 4UUTA 1TWAJ 1IGNA 3S16J 2X9DA 3TP3A 3Q0VA 2XGEA 4M3BA 1U78A 2LKXA 9ANTA 1O4XA 4NDLA 3MKLA 1ORKA 1SANA 3BR1A 4D7NA 1WPKA 3HOWJ 2K9SA 4FTHA 4IEJA 3FIWA 5HODA 3OSGA 2QF7A 1SFOJ 1K83J 3BTJA 1JTYA 2Y9YA 3CDLA 5DS9A 2XPWA 4A69C 4A3CJ 1MH3A 1RETA 1MNMC 1HCRA 3RZOJ 4MIMA 5IP7J 2XB0X 3JRBA 3JRCA 3BR0A 2E19A 1IUFA 1IJWC 2JWTA 4RBOA 2GM4A 4ABZA 2E2IJ 5FLVA 5F0HA 2VPRA 1OCTC 2CU7A 1TC3C 3I4MJ 5J1RA 1JKPC 2CJJA 2CQQA 1MSEC 1XG1A 5K7FA 3JRIA 3B6CA 2KDZA 2R93J 2LD5A 4AUXA 2JK3A 5FKNA 5E3LA 4IHYA 2HOTA 2HDDA 3ZQLA 1X58A 2EH3A 1ETXA 5M5XJ 1FTZA 2N8GA 3JREA 1NK2P 2XPUA 4A3MJ 3HEFA 5JLWA 4B4CA 2O7OA 4C3HJ 4RDUA 1QPIA 1NK3P 4XK4A 2HOSA 2DMTA 3S2DJ 3HOUJ 1GV2A 3S1MJ 1BJZA 2LVSA 3HGYA 4QTRA 2ZB9A 4HNVA 4A93J 2DTZA 1ZR2A 1JUPA 3K2AA 3JRHA 2DA5A 4IHVA 3C2BA 3HOXJ 4JX4A 3LSJA 1OFCX 4G12A 5JLXA 1TWCJ 1A5JA 2H1KA 1GUUA 3ZQHA 2VUMJ 3S1RJ 2R5YA 3BQYA 2JN6A 3A01A 1QRYA 3QPLA 4A3FJ 4GFBA 3TP0A 3QPSA 2VKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ N;  4D5C A;  1MBF A;  1F36 A;  3HM5 A;  1AHD P;  1RR7 A;  2EBI A;  3D1N I;  4LOC A;  1WCM J;  5FKM A;  1JTX A;  5C3E J;  2JA7 J;  3HOV J;  4IHW A;  1DU6 A;  3Q0W A;  1JUS A;  2NS8 A;  2RAE A;  1ENH A;  2EZI A;  3GTP J;  3BR2 A;  3IH3 A;  1IDY A;  1VND A;  4BY7 J;  1LFU P;  3OOU A;  2DMQ A;  1WH7 A;  1Q1V A;  2FJ1 A;  2VI6 A;  1BL0 A;  2R0Q C;  1PUF B;  3A03 A;  3IV5 A;  3I4N J;  4A3I J;  1UMQ A;  4MFD A;  2LTP A;  2MW8 A;  5GP9 A;  5IP9 J;  3SDG A;  1WH5 A;  1WI3 A;  2TCT A;  5IOY A;  4UUS A;  1MBK A;  2NVX J;  2JA5 J;  2O8K A;  2GBY A;  4XRS G;  3ZQF A;  5BNG A;  4C3J J;  3JRF A;  5IYC J;  4I6Z A;  4D5F A;  1OJL A;  5F08 A;  5K7Z A;  3QQA A;  3HKZ N;  4A3E J;  3OIO A;  2ID6 A;  4FE4 A;  2HOA A;  4FE7 A;  3Q0U A;  1YRN B;  1YRN A;  2CUE A;  1JT0 A;  1H88 C;  4DYC A;  3GTL J;  3BQZ A;  1T33 A;  2FX0 A;  1TWG J;  3M3Y J;  5K7H A;  1I6H J;  1MSF C;  3HGG A;  3CMY A;  3GBG A;  1U8B A;  3H0G J;  2I10 A;  4DW6 A;  1DU0 A;  2E2H J;  4JYK A;  2G0E A;  1CQT A;  1ITY A;  3LOC A;  1GVD A;  2R92 J;  3RZD J;  2TRT A;  2ELK A;  2MSY A;  5F04 A;  3TED A;  1S7E A;  2DMN A;  4DYR A;  4CYC B;  4CYC A;  4A3D J;  2HXI A;  5C44 J;  3CQZ J;  2XGC A;  3BT9 A;  1FIA A;  1IV6 A;  3WHB A;  1UHS A;  4X1E A;  4BBR J;  1IG7 A;  2EZL A;  2IAI A;  2LP0 A;  1E3O C;  1D5Y A;  1QVT A;  3PO2 J;  5FLM J;  5F1J A;  2XSD C;  3JRG A;  5F0C A;  1W0T A;  4MFE A;  1H89 C;  2LR8 A;  1K61 A;  3S1Q J;  1JUM A;  2LK2 A;  1F43 A;  1LE8 A;  2OF7 A;  4I76 A;  4Y7N J;  2DA3 A;  1R9T J;  2DA4 A;  2JMW A;  2B63 J;  3HDD A;  2H8R A;  4AYB N;  2NVY J;  2NOG A;  2KT0 A;  3BR3 A;  4XRM A;  3UKG A;  1XC5 A;  3MVP A;  3G1O A;  3JRA A;  3W6V A;  4X6A J;  4M3F A;  4MLO A;  2ID3 A;  1I50 J;  4A3G J;  2D5V A;  5GPA A;  1B8I A;  2HQ5 A;  4AC0 A;  5IYD J;  2YS9 A;  1ETV A;  5EZG A;  2LFB A;  3F0C A;  1Z0X A;  3NAR A;  5J1Y A;  2R5Y B;  2FD5 A;  3OSF A;  3A01 B;  2O9L A;  5M5Y J;  5IYB J;  1XS9 A;  3FKI J;  4XRS A;  2YU9 J;  1X2N A;  5J3L A;  1AKH A;  3GTO J;  5FJ8 J;  5IPA A;  3DCF A;  2NS7 A;  1HF0 A;  3BG3 A;  2XRL A;  4J19 A;  1B72 A;  2M34 A;  1EF4 A;  4BKX A;  1P7I A;  3S15 J;  3SFI A;  2P81 A;  2DA6 A;  2K9Q A;  1TWH J;  3IH4 A;  5EGO A;  2R5Z A;  4QIW N;  1Y1W J;  5EEA A;  1MBE A;  1FIP A;  3GTG J;  4A3K J;  2DN0 A;  5EG0 A;  4A3J J;  4M3E A;  2EZK A;  3H3V K;  1A6I A;  4JX5 A;  4BXX J;  4M3G A;  2ECB A;  1RES A;  5E3M A;  1FJL A;  1NTC A;  1HOM A;  4W97 A;  1IRZ A;  3G1M A;  3BR5 A;  5DTD A;  3FIS A;  2DMU A;  2Y31 A;  4UUS B;  3S17 J;  5IOZ A;  1H8A C;  2XPV A;  1JKQ C;  4DZP A;  1W0U A;  1QVU A;  1JJ8 C;  5C4J J;  2MG4 A;  4M6V A;  2GLO A;  2X6O A;  2WB1 N;  4B3A A;  4QSH A;  3BR6 A;  1MBG A;  3VPR A;  4V2F A;  3ZQI A;  1VFC A;  2COB A;  3E7L A;  2K9N A;  1BW5 A;  1ETY A;  2ECC A;  5IP6 A;  4JP0 A;  4MO7 A;  2HYJ A;  3M4O J;  4Y52 J;  3O8H A;  5C4X J;  4EEF G;  3FK7 A;  2IBD A;  5M3F J;  2ME0 A;  3HOZ J;  3A02 A;  1IC8 A;  2DA2 A;  1MH4 A;  4A3B J;  3BG5 A;  1RKT A;  1U9O A;  2L7F P;  3LSG A;  5EYR A;  3L1P A;  3O8G A;  1ZKG A;  3JRD A;  2IEK A;  2W48 A;  3S14 J;  2DA1 A;  2WV1 A;  1VF9 A;  3FK6 A;  1ETK A;  1ZK8 A;  2Y30 A;  3ZOB A;  3TW7 A;  2CUF A;  4B1R A;  2JA8 J;  1ZGW A;  3TW6 A;  1JKO C;  1JKR C;  2CQX A;  3RKQ A;  2JJ7 A;  1P7J A;  2DA7 A;  5EZH A;  1LE8 B;  1FEX A;  3GTK J;  4IHX A;  1FTT A;  3G1L A;  4V2G A;  1WGX A;  5F27 A;  4W1U A;  5FKL A;  2K40 A;  2M8G X;  1Z77 A;  2VKE A;  3PM1 A;  2E1O A;  3NAU A;  2HI3 A;  5F0F A;  5E3O A;  4FCY A;  4D7M A;  2L9R A;  1POG A;  3CCY A;  1GV5 A;  1JT6 A;  3LNQ A;  1HLV A;  1HDD C;  2R7Z J;  2M9H A;  2XGD A;  1X2M A;  1BA5 A;  1AU7 A;  2Y9Z A;  3K7A J;  1VI0 A;  2AO9 A;  2XB5 A;  2FQ4 A;  1B8I B;  1BW6 A;  1MBH A;  3IH2 A;  2QCO A;  3SJM A;  2X48 A;  4JX6 A;  3ZQG A;  1ZR4 A;  2PMZ N;  1Y1V J;  1U9N A;  5EDN A;  1T56 A;  2M0C A;  2Y2Z A;  4BY1 J;  2OPT A;  1AKH B;  3LSR A;  2AHQ A;  2ME6 A;  1RPW A;  3GTQ J;  1B72 B;  3BTL A;  1TWF J;  2M2E A;  3Q3S A;  2YUS A;  3LSP A;  4DYQ A;  3S2H J;  5E3N A;  1GDT A;  2NVQ J;  1RKW A;  1OCP A;  5M3M J;  2LY9 A;  1APL C;  3HBL A;  5EGO B;  2R5Z B;  2LLK A;  2DJN A;  3RQI A;  1JGG A;  2DMP A;  1I3Q J;  5FKK A;  1IDZ A;  2EZH A;  5EG0 B;  4A3L J;  5EF6 A;  4DZJ A;  2L0K A;  4XIC A;  2Y0S N;  2NVT J;  3BTI A;  3GTJ J;  3JR9 A;  3B6A A;  2E2J J;  1MBJ A;  1HDP A;  3WHC A;  2MGQ A;  3GTM J;  2CRG A;  4FIS A;  4C3I J;  3PO3 J;  1ETO A;  1JJ6 C;  1ZTR A;  3DEW A;  2JA6 J;  3BTC A;  1G2H A;  1ETQ A;  1PUF A;  5GPC A;  4BBS J;  3ZQC A;  1ZQ3 P;  1ETW A;  5J1U A;  2L7M P;  3HOY J;  3HB9 A;  4L5E A;  5M5W J;  3BG9 A;  5FKO A;  4XID A;  1GT0 C;  2L7Z A;  1LFB A;  3S1N J;  4C2M J;  4M3D A;  2HXO A;  4S0H B;  1UG2 A;  2EQR A;  3MN2 A;  4UUT A;  1TWA J;  1IGN A;  3S16 J;  2X9D A;  3TP3 A;  3Q0V A;  2XGE A;  4M3B A;  1U78 A;  2LKX A;  9ANT A;  1O4X A;  4NDL A;  3MKL A;  1ORK A;  1SAN A;  3BR1 A;  4D7N A;  1WPK A;  3HOW J;  2K9S A;  4FTH A;  4IEJ A;  3FIW A;  5HOD A;  3OSG A;  2QF7 A;  1SFO J;  1K83 J;  3BTJ A;  1JTY A;  2Y9Y A;  3CDL A;  5DS9 A;  2XPW A;  4A69 C;  4A3C J;  1MH3 A;  1RET A;  1MNM C;  1HCR A;  3RZO J;  4MIM A;  5IP7 J;  2XB0 X;  3JRB A;  3JRC A;  3BR0 A;  2E19 A;  1IUF A;  1IJW C;  2JWT A;  4RBO A;  2GM4 A;  4ABZ A;  2E2I J;  5FLV A;  5F0H A;  2VPR A;  1OCT C;  2CU7 A;  1TC3 C;  3I4M J;  5J1R A;  1JKP C;  2CJJ A;  2CQQ A;  1MSE C;  1XG1 A;  5K7F A;  3JRI A;  3B6C A;  2KDZ A;  2R93 J;  2LD5 A;  4AUX A;  2JK3 A;  5FKN A;  5E3L A;  4IHY A;  2HOT A;  2HDD A;  3ZQL A;  1X58 A;  2EH3 A;  1ETX A;  5M5X J;  1FTZ A;  2N8G A;  3JRE A;  1NK2 P;  2XPU A;  4A3M J;  3HEF A;  5JLW A;  4B4C A;  2O7O A;  4C3H J;  4RDU A;  1QPI A;  1NK3 P;  4XK4 A;  2HOS A;  2DMT A;  3S2D J;  3HOU J;  1GV2 A;  3S1M J;  1BJZ A;  2LVS A;  3HGY A;  4QTR A;  2ZB9 A;  4HNV A;  4A93 J;  2DTZ A;  1ZR2 A;  1JUP A;  3K2A A;  3JRH A;  2DA5 A;  4IHV A;  3C2B A;  3HOX J;  4JX4 A;  3LSJ A;  1OFC X;  4G12 A;  5JLX A;  1TWC J;  1A5J A;  2H1K A;  1GUU A;  3ZQH A;  2VUM J;  3S1R J;  2R5Y A;  3BQY A;  2JN6 A;  3A01 A;  1QRY A;  3QPL A;  4A3F J;  4GFB A;  3TP0 A;  3QPS A;  2VKV A; 
#chains in the Genus database with same CATH topology
 2WAQ N;  4D5C A;  1F36 A;  1AHD P;  2EBI A;  3OIQ A;  4XKC A;  3V8L A;  4EJU A;  3KEO A;  2JVH A;  4WF2 A;  3CCQ I;  3P9K A;  3OYB A;  2B9S A;  5C3E J;  2FA5 A;  4I98 B;  5B1A H;  4YEJ A;  2VBX A;  2VT3 A;  3IH3 A;  3ERE D;  3CUQ C;  1VND A;  4HQE A;  3MKZ A;  1R00 A;  3CCR I;  2VI6 A;  1XGO A;  1BL0 A;  3L7W A;  2PMZ A;  4IRG A;  4LD5 A;  3I4N J;  2C6Y A;  3K2Z A;  4MFD A;  4GGG A;  3K4L A;  3MZY A;  2LNB A;  3SDG A;  3H1C A;  2HVS A;  2KRF A;  3ISP A;  2NVX J;  2BVL A;  3ZQF A;  3ZN1 A;  4V19 K;  3LQQ A;  4C3J J;  1WJ5 A;  2W84 A;  4I6Z A;  4D5F A;  1QHH D;  1FZP B;  2GWR A;  3ASO H;  4KJZ A;  2QSF X;  2YX4 A;  1Z6R A;  3LSK A;  4OIR F;  3WG7 H;  5BOX A;  2M5W A;  2ID6 A;  2HOA A;  2Z16 A;  3J7A Y;  3RQ4 A;  1YRN B;  2LYC A;  1JT0 A;  1YRN A;  1PUE E;  2DTR A;  5J4V A;  3K4M A;  3M3Y J;  2V1D A;  3GFJ A;  3IWZ A;  4A2U A;  5K7H A;  1Y0N A;  3J7Y J;  1T38 A;  2F5D A;  5HOO A;  3GBG A;  2DOE A;  3ZR8 X;  1U8B A;  1IN4 A;  3ECO A;  4HF2 A;  2ZNZ A;  1XGS A;  5B3S H;  2V1U A;  3HL2 A;  2VQG A;  2TRT A;  2ELK A;  2G9W A;  2JRM A;  2MSY A;  3QYF A;  3WTZ A;  4RB3 C;  1VQ6 I;  5B1B H;  4ZC3 A;  1S7E A;  2DMN A;  2V9P A;  4CYC B;  4CYC A;  4HDU A;  4LG0 B;  2E60 A;  5C44 J;  4NC7 A;  4G9Y A;  5KVR A;  2UWM A;  1ZN2 A;  4X1E A;  2DW4 A;  2IAI A;  2QZ8 A;  3C18 A;  2JPB A;  3LQR A;  3PO2 J;  3JRG A;  4HG2 A;  2MH2 A;  1SD6 A;  2UZK A;  1YIO A;  1W7P B;  2GXB A;  2LR8 A;  4LLN A;  4KMF A;  3D5L A;  3K4C A;  2DYS H;  4YII A;  1R9T J;  2XAH A;  4GYG A;  2JMW A;  3E6D A;  4BE1 A;  2B63 J;  1IZ1 A;  1WKM A;  1ON2 A;  2D45 A;  2DFF A;  3C2G A;  3GFI A;  2FOK A;  3EUH C;  2VE9 A;  2NVY J;  1IUY A;  5FD6 A;  2XVC A;  1ZAO A;  2M1B A;  4PZJ A;  1MNE A;  3DPL C;  2KT0 A;  2PBI A;  1OQY A;  3KP2 A;  4I7H A;  3KX2 A;  3UKG A;  1ZRE A;  1HW1 A;  1OCC H;  3TO7 A;  3FX3 A;  4MLO A;  2KKO A;  2B7E A;  3I64 A;  2NYX A;  2F2E A;  3LA7 A;  3UNG C;  3SXY A;  2HR3 A;  1QHG A;  4UV9 A;  4UHT A;  3RPQ A;  4AC0 A;  2J5O A;  2A07 F;  1ETV A;  2QQ9 A;  1SMY F;  2X0L A;  1F4K A;  2JPC A;  1YS7 A;  2Q2E B;  1T95 A;  5J1Y A;  3J81 K;  2KQR A;  2O9L A;  2CUZ A;  5M5Y J;  1XS9 A;  4NB5 A;  1XX5 A;  5CVJ A;  1WWX A;  1AKH A;  3GTO J;  2YU3 A;  1O7L A;  2ZFW A;  4XLN F;  4U0W A;  1B72 A;  2M30 A;  4P96 A;  4Y3O A;  1EF4 A;  3HRU A;  3H9Q A;  1J9I A;  1BIA A;  1EH6 A;  4F92 B;  3DQV C;  1BR2 A;  3H0D A;  4J00 A;  4U0Y A;  1I1G A;  3GTG J;  3H5A A;  3TQN A;  4FX4 A;  2BE5 F;  3I59 B;  4AD9 A;  4A3J J;  1GXQ A;  4ENJ A;  3K1M A;  4PJL A;  4LGW A;  4WXH A;  2V79 A;  1SFE A;  1D1B A;  3C1D A;  4BXX J;  2CO5 A;  1H9T A;  3KYD B;  1FJL A;  2F5C A;  3M7G A;  3I71 A;  5DTD A;  4OIQ F;  1K7A A;  1S29 A;  3H35 A;  2MH9 A;  2CSO A;  3U21 A;  1ZG5 A;  3CMM A;  4FET A;  1JHF A;  3L09 A;  2O0Y A;  4FQG A;  2MLG A;  1R4N B;  2ZXI A;  1O3S A;  2IW5 A;  5K5Q A;  2KIS A;  3VPR A;  2EFN A;  1TNT A;  3QU3 A;  3PQJ A;  2E5N A;  2VJ4 A;  5DCF A;  3E7L A;  4IF4 A;  1GHC A;  2Y75 A;  2ECC A;  2K9L A;  2WAQ A;  1X3U A;  1X1A A;  4Z6Y A;  1RUN A;  3K4N A;  1LVA A;  3IL2 A;  3O8H A;  4RGU A;  2X1D A;  2V7F A;  4YFX F;  1J0R A;  5M3F J;  1WQ2 A;  2VT2 A;  3CCV I;  1E17 A;  1LDD A;  1FOY A;  2L7F P;  1U9O A;  2FBI A;  4HX4 A;  4BJT A;  4R1H A;  4ZTJ A;  5LHG A;  2ESH A;  3MCZ A;  2MD0 A;  3RSN A;  2HPM A;  1R1U A;  1BOA A;  3FM3 A;  3OWT A;  3BPV A;  3T8T A;  2W48 A;  3ESW B;  3ZMT A;  2KP6 A;  5L3F A;  1G8X A;  3LFU A;  1ZG1 A;  3FXK A;  2PLY A;  3ZOB A;  3TW7 A;  4B1R A;  4ZDP A;  3MQ0 A;  1T08 B;  5TJJ A;  1FOK A;  2ZFU A;  1YTY A;  3FXL A;  1ZLK A;  1LE8 B;  2P0W A;  5CJ9 A;  1MMS A;  4IVN A;  4IHX A;  2OCC H;  5DM7 F;  1FTT A;  3T1B A;  2M7A A;  3MAJ A;  4V2G A;  1VQK I;  5KAF C;  5F27 A;  2LBF B;  3MWM A;  2M8E A;  4W1U A;  5FKL A;  4BNC A;  4HEA 2;  4RAY A;  3S3N A;  5DM6 F;  1U5T B;  2VKE A;  1KON A;  1SD7 A;  5GTI C;  4EJV A;  2WY8 Q;  4MHG A;  4WK8 F;  1LB2 A;  2LRE A;  4H0E A;  3CCY A;  1YS6 A;  1X3Z B;  5LEK A;  4B09 A;  2R7W A;  3DXJ F;  4OMY A;  2FQ4 A;  2P5V A;  2EIL H;  3WOD F;  2XDV A;  3S3O A;  3M8F A;  2RV8 A;  4XMY A;  1MBH A;  3WTV C;  2CYY A;  4K2E A;  1XD7 A;  1HC8 A;  3C7J A;  1A6Q A;  3RI4 A;  1NH3 A;  2WY7 Q;  4U87 A;  2IP2 A;  2XRN A;  3B73 A;  3IKV A;  1Y1V J;  3DTK A;  2MA3 A;  4B3X A;  2M0C A;  2Y2Z A;  4GYI A;  3NWS A;  4UB8 C;  3PSF A;  5HLH A;  3Q9S A;  2AHQ A;  2QSH X;  4IHT A;  2ME6 A;  1TLH B;  4BHB A;  3GTQ J;  5CKT A;  2L02 A;  2EFP A;  3I5U A;  1Y6I A;  3I9V 2;  2OQR A;  1Z3Y A;  5HDN A;  5E3N A;  1GDT A;  2JQ7 A;  1OYI A;  1APL C;  5IT3 A;  3CME I;  3WTS C;  5JHU A;  4E7L A;  2K27 A;  3RQI A;  1JGG A;  1SFX A;  1HA8 A;  2EZH A;  2RQQ A;  3W2V A;  4DGW B;  2DFH A;  4DZJ A;  4L0Z B;  4L9J A;  1IN7 A;  3ZCO A;  4BE0 A;  2DBB A;  1JHH A;  4HNT A;  1YJW I;  1I6X A;  2Y0S N;  1OKR A;  1HXD A;  3BTI A;  3CJT B;  3GTJ J;  5J47 A;  2E2J J;  2CS3 A;  3MMY B;  4CUG A;  3K1N A;  1E2X A;  2MGQ A;  3GTM J;  3WTW C;  2CRG A;  3EYY A;  4B43 A;  1RR8 C;  3CCL I;  3F8C A;  1ETO A;  4ETS A;  2EFQ A;  4RLQ A;  4G6T B;  1R5H A;  1R1V A;  4EGY A;  1H9G A;  3DEW A;  5DD4 A;  4IHS A;  3BTC A;  3CCE I;  1KZH A;  1NG7 A;  3CES A;  1YW9 A;  4BBS J;  2V9K A;  2HVQ A;  3CUQ B;  1ZQ3 P;  1ETW A;  2LH9 A;  5J1U A;  2FU4 A;  4XN0 A;  3PFY A;  5LEJ A;  3AG4 H;  1LFB A;  3U1D A;  1N77 A;  2X85 A;  4S0H B;  3I54 A;  1IAW A;  1R49 A;  2EQR A;  3C2H A;  5BQT A;  3E0J B;  2EIM H;  5EEG A;  3PIO F;  1IRX A;  1TT0 A;  1IGN A;  1TW2 A;  3OYN A;  1U78 A;  1OMI A;  2M45 A;  9ANT A;  5H20 A;  3F22 A;  4MQV A;  5LRS A;  2K3P A;  3BR1 A;  2XAG A;  2A6E F;  2VE8 A;  2IXS A;  4RB0 A;  2V4J C;  4IEJ A;  1K6O A;  1SFO J;  4IQJ A;  1JTY A;  1PJR A;  5DS9 A;  3SQN A;  2XPW A;  2STW A;  4RGX A;  1DPU A;  3HXL A;  2KZV A;  2HWV A;  2HOE A;  5FGM A;  1FYL A;  2DYR H;  2HU9 A;  1MH3 A;  2CW8 A;  2LKS A;  1FMV A;  2WAE A;  4MQ9 F;  2G7H A;  3W6J B;  3L2V A;  3FXO A;  4KT5 C;  2CQK A;  1IUF A;  5HS8 A;  4E7Z A;  2FOW A;  4RBO A;  3DWL E;  5FLV A;  3CD6 I;  4WXD A;  3OYK A;  1OCT C;  3I4M J;  5J1R A;  3OYJ A;  2V6E A;  2PI0 A;  1AOY A;  3JRI A;  3CZ6 A;  2DK8 A;  2VLA A;  3KYL A;  2R93 J;  5DD8 A;  1V54 H;  4Y15 A;  1SEU A;  3G6E I;  3IC7 A;  2R3S A;  1UST A;  3DPT A;  2QBY A;  3GZ5 A;  3WTU C;  3J7Z I;  2FBH A;  5H6R A;  4A6D A;  3RPU A;  3CJQ B;  1FTZ A;  3BDD A;  4RB2 C;  2NNN A;  5JLW A;  2D1H A;  3GZ6 A;  2O7O A;  3HSR A;  4XK4 A;  4KIF A;  4Q4Z F;  2VXZ A;  1V5E A;  2QLZ A;  3HOU J;  2LVS A;  3D5R C;  2P5K A;  5LBQ A;  3OL4 A;  4G94 A;  5CVI A;  5HLT A;  3JRH A;  2E71 A;  4IHV A;  5LGN A;  2PJR B;  3OYE A;  2PJR A;  2KIF A;  3HOX J;  2ZJR F;  2KRC A;  4O6J A;  4F93 B;  4G12 A;  5HVQ C;  3K4J A;  5CPR B;  3ZQH A;  3H3U A;  1J75 A;  2R5Y A;  2WC2 A;  3A01 A;  4A3F J;  4GFB A;  4F3Q A;  3TP0 A;  2VKV A;  3CF5 F;  1I3A A;  3WE2 A;  3VEP A;  1FP2 A;  2CW0 F;  4ZYD A;  2MD5 A;  1WCM J;  3BG6 A;  1FBQ A;  3SZG A;  4E7S A;  5BPD A;  1DU6 A;  3DTI A;  3KLO A;  1JUS A;  4XOR A;  2H09 A;  2NS8 A;  3RIR A;  1Y8R B;  2RAE A;  1ENH A;  1ULY A;  3GTP J;  1U6G A;  4GCV A;  3BR2 A;  4AVZ A;  1D8K A;  1IDY A;  2XAJ A;  3Q5F A;  3FMR A;  3CJN A;  2R7X A;  2DT5 A;  3EUA A;  2DXI A;  3I55 I;  2OCE A;  3CP2 A;  4DIQ A;  4A3I J;  2MW8 A;  3AG3 H;  1WJB A;  4GXO A;  1FMW A;  1WH5 A;  4EJO A;  4OIN F;  3KEQ A;  1FYK A;  1WI3 A;  2FXA A;  3HZJ A;  4IXA A;  3IP4 B;  5DCM A;  3HHG A;  4EJT A;  3B02 A;  2NVU B;  4MGR A;  1ZG3 A;  2CH0 A;  3LL7 A;  2R7Q A;  1MDM B;  4RGS A;  3HKZ N;  3NWT A;  4FE4 A;  3HOS A;  2CUE A;  1H88 C;  2DQR A;  3BQZ A;  1T33 A;  5FFX A;  3PJR A;  4UUV A;  2BOL A;  2XGX A;  1MSF C;  3HGG A;  2GQQ A;  2Y0S A;  5DYM A;  4L18 B;  1DQU A;  5CLS A;  1F1Z A;  2BW3 B;  2HQA A;  5E79 C;  4U7D A;  3KLN A;  3GCM A;  2P6S A;  1ITY A;  3LOC A;  4F91 B;  1Z7U A;  1Z6T A;  2KL4 A;  2HYG D;  4A0X A;  1V3F A;  3L2Q A;  3BG7 A;  2XSJ C;  4AM3 A;  4DYR A;  1YIT I;  2HXI A;  4HV6 A;  2HEO A;  4U88 A;  2KLO A;  2XGC A;  4BDZ A;  3N4M A;  2RNG A;  1IV6 A;  2LY1 A;  1YJN I;  2DDA A;  2VON A;  1IG7 A;  2EZL A;  2GAU A;  3T5X A;  2O03 A;  2E7X A;  3TO6 A;  2XSD C;  4PJ0 C;  2ZXJ A;  4L5J A;  4I0A A;  2ZC2 A;  3BZK A;  1O3T A;  1JUM A;  3F72 A;  3IAM 2;  2J5P A;  3FZV A;  3LSM A;  3HG9 A;  4Y7N J;  3G2B A;  3FBN B;  2DA4 A;  2DLL A;  4GO1 A;  4LIV A;  2P6T A;  2X4H A;  4M74 A;  4C2U A;  1MJB A;  2HKO A;  3OMY A;  3NEU A;  4LK0 F;  3FMQ A;  1YX5 A;  3V4G A;  3BR3 A;  3M1E A;  1XSX A;  4B48 A;  2OAZ A;  2VC1 A;  1R5G A;  3SYT A;  2EV5 A;  3MVP A;  3G1O A;  3JRA A;  3W6V A;  1X4O A;  3BP8 A;  2EB7 A;  3QOD A;  1QU3 A;  1NG6 A;  5GAG J;  4G8X A;  5L3G A;  1B8I A;  3BJO A;  4KYW A;  2O8X A;  2RC4 A;  2KRH A;  2BY1 A;  5IYD J;  4HV5 A;  3PFI A;  2LG4 A;  1LNW A;  1F9N A;  1HKS A;  2L54 A;  4LIU A;  5GAD J;  2JA2 A;  2ZXH A;  4ZYE A;  1BR1 A;  5IYB J;  3FKI J;  1U3E M;  4XRS A;  3BOQ A;  1X2N A;  5K1Y A;  3LWF A;  2A05 A;  5IPA A;  1ZGJ A;  3WTT C;  1K6Y A;  3BJA A;  4UNO A;  2M34 A;  4BKX A;  4ANJ A;  3GYH X;  2GA1 A;  1DGR M;  2R7O A;  1MMN A;  3IH4 A;  2R5Z A;  4E4H A;  5EEA A;  1MBE A;  1UG0 A;  1F5T A;  1ZRD A;  2DN0 A;  5EG0 A;  3FKJ A;  1UB9 A;  2EZK A;  2ESN A;  3TOB A;  1D3Y A;  3R4K A;  3GME A;  1UHM A;  4L0Y B;  4AID A;  4EGZ A;  3CDI A;  3BC8 A;  3H92 A;  1PYV A;  1RES A;  4M3G A;  1IXS B;  4I09 A;  3CC2 I;  3Q9V A;  3BR5 A;  2CQ7 A;  2Y31 A;  2DMU A;  1OYY A;  2A5Y B;  2FRH A;  4RLF A;  2XPV A;  5EEH A;  4DZP A;  3PQK A;  1P92 A;  3IAS 2;  1V4R A;  4LIT A;  2JZY A;  3P9C A;  5HNF A;  2HPI A;  3DV8 A;  4BHP A;  5DV5 A;  2IRF G;  1XMK A;  4FX0 A;  4L9T A;  4B3A A;  4IL6 C;  1ZHF A;  3G3Z A;  3BR6 A;  1YX3 A;  4QSH A;  1OPC A;  2X1C A;  4V2F A;  5TIS C;  2XAQ A;  3BWG A;  5KK1 A;  1VQ9 I;  2OV7 A;  3CO7 C;  5GAH J;  2EV0 A;  4ZZL A;  2JTV A;  1PVE A;  2HYJ A;  4IPA A;  4PK4 A;  1JI8 A;  1YG2 A;  2CFX A;  3EQL F;  3L00 A;  4HX7 A;  1W36 D;  4HRI A;  2ME0 A;  2XUB A;  1VQN I;  4Q48 A;  2VL8 A;  2CFO A;  2X1E A;  3RPU D;  3L1P A;  3ZP5 A;  3P5J A;  4UXN A;  3S8P A;  4S05 A;  2BZT A;  3QAH A;  2FEZ A;  3JTG A;  4CYD A;  1QA6 A;  2DU9 A;  5D6E A;  1OCR H;  2IEK A;  3S14 J;  1W36 C;  2DA1 A;  2R7F A;  1BI0 A;  2WV1 A;  5TGT A;  3G4S I;  2VC0 A;  2QYO A;  2HTJ A;  3FK6 A;  3ERM A;  3CCJ I;  1ETK A;  1ZK8 A;  2ZCW A;  2E1M C;  3W6K B;  5LD2 C;  1SVO A;  4XL9 A;  5H6Q A;  2K7L A;  2XAU A;  2L9S A;  2JA8 J;  1B9M A;  2Y69 H;  1JKO C;  1JKR C;  2CUJ A;  2W57 A;  3QU6 A;  3H3Z A;  4I2O A;  4IOC F;  3CC4 I;  1FEX A;  3MKW B;  1R4M B;  2VOD A;  1PP8 F;  4B47 A;  3G1L A;  1WGX A;  2QVO A;  1JXS A;  3FHN A;  1H0M A;  3F8M A;  4XRF A;  2K40 A;  3VWB A;  2UUZ A;  1Z77 A;  3K4K A;  3HKZ A;  3L2U A;  2H27 A;  4A6E A;  1FP1 D;  4QLC U;  5D5V B;  2F5V A;  4NBQ A;  3NAU A;  2HI3 A;  5F0F A;  2QQB A;  1C0W A;  5E3O A;  2VBZ A;  2L9R A;  4WX9 A;  1HLV A;  1JT6 A;  2R7Z J;  4N4N B;  2M9H A;  3QP6 A;  2WWY A;  2RVC A;  2AO9 A;  4FT8 A;  4XLA A;  1U0J A;  2G7U A;  4AIJ A;  1BBY A;  1BW6 A;  3N97 A;  4ZYA A;  4BQN A;  1KU2 A;  2V26 A;  3NQO A;  2QCO A;  3BPX A;  3M9A A;  3ZQG A;  2IA1 A;  3GFM A;  2QGU A;  2KPM A;  1FT9 A;  3VSL A;  4EM0 B;  4KUM A;  2AXL A;  4KN4 X;  1VTN C;  2VKD A;  4BY1 J;  3AG2 H;  2FUG 2;  4CIC A;  2OPT A;  4XKW A;  1R6R A;  4RMN A;  1AKH B;  3O6B B;  5E8G A;  1DDN A;  1OLT A;  3GFL A;  4P55 A;  5LLQ A;  4XN3 A;  1VQO I;  2Y48 A;  1BR4 A;  2ZJP F;  1B72 B;  1FSE A;  3BTL A;  3FM5 A;  3LSP A;  3S2H J;  3D5S C;  2NVQ J;  1GLN A;  1RKW A;  2QUF A;  2LLK A;  2YSR A;  2V9V A;  1OIS A;  2DFE A;  2DMP A;  1I3Q J;  3EUK L;  3HPG A;  4YFN F;  4A3L J;  2FMY A;  5EF6 A;  1Z7L A;  2LDU A;  2GOM A;  2L0K A;  5ICG A;  2JSC A;  4XIC A;  4UVA A;  2OZU A;  3BZC A;  2IJL A;  3KP7 A;  1O3Q A;  3N05 A;  2F5F A;  1KGS A;  4X0G A;  4BL0 B;  1X19 A;  3T0Y A;  1PDN C;  3OYA A;  2VJJ A;  3FXU A;  2F5E A;  1M1E B;  4RM3 A;  3MEX A;  4RA2 A;  1T0F A;  5GTH C;  4CO8 A;  4YEL A;  3JSP A;  2ACJ A;  2A61 A;  1LFP A;  2L9V A;  3ZXS A;  1IW7 F;  3VYU B;  3DU5 A;  1ETQ A;  1W1W E;  1PUF A;  3HIF A;  4E6K G;  4Y13 A;  2ICW G;  2E34 A;  3P7N A;  2VBY A;  5J6X A;  4M9Z A;  2L7M P;  3DTE A;  4ENM A;  5HS7 A;  4L5E A;  5M5W J;  4XID A;  2BY0 A;  2K02 A;  5ICE A;  4YIR X;  3TMO A;  4M3D A;  3O2P E;  1UG2 A;  2JT1 A;  4U0V A;  3R60 A;  2Z9O A;  2QM3 A;  1SFU A;  1TWA J;  4CCL A;  3S16 J;  4G7O F;  1LDK B;  2XGE A;  3HUG B;  3HUG A;  2VQC A;  2YPR A;  1J09 A;  4BH9 A;  1SAN A;  1NHA A;  3HOW J;  1FY7 A;  2K9S A;  3R6S A;  3K1P A;  3ABM H;  3FIW A;  3OSG A;  3VB2 A;  4D0P A;  3F6O A;  2CV2 A;  2HZT A;  4A3C J;  2H6B A;  3LAP A;  3U1K A;  1HCR A;  5IP7 J;  1Y0U A;  2P7V B;  3E6B A;  4QWQ A;  5ILS A;  4HLY A;  1QZE A;  4UV8 A;  5GAE J;  3SEZ A;  2E19 A;  2JWT A;  2WAF A;  1FPQ A;  4ABZ A;  5H2F C;  1XTA A;  1IV8 A;  2VPR A;  2RNJ A;  4RAG A;  4XBF A;  3W3C A;  1CF7 A;  1K78 A;  2CJJ A;  3DP7 A;  1G3T A;  3L9F A;  4ZTF A;  2P4W A;  3BRO A;  5FKN A;  3FF5 A;  3MKY B;  5E3L A;  1MMA A;  2HOT A;  4HDV A;  4HST A;  3ZQL A;  3WU2 C;  2V1X A;  1LEB A;  4LFU A;  4KIG A;  3GO5 A;  6PAX A;  5M5X J;  3LA3 A;  5CQG A;  4OIO F;  5L3B A;  2N8G A;  3RKY A;  1NK2 P;  1U2W A;  2KJB A;  3PNV A;  4RDU A;  1EH7 A;  4CCN A;  3ZMD A;  2OU2 A;  2MAB A;  3S2D J;  2DMT A;  1OCO H;  1AA7 A;  1S6L A;  1XPX A;  4KFC A;  3DEE A;  2DOD A;  4AVP A;  2ZB9 A;  4A93 J;  1W5S A;  2IPQ X;  4Y33 A;  1BIB A;  2L7K A;  2FQ3 A;  4XM3 A;  3DBH B;  4I01 A;  1ZEL A;  2GXA A;  2XF6 A;  1G4D A;  4IO9 F;  4HQM A;  4IRI A;  4JX4 A;  3LAJ A;  3LSJ A;  3A4C A;  1FNN A;  4ESF A;  2VUM J;  1D1C A;  3I0T A;  3BQY A;  1E3H A;  2JN6 A;  1I1S A;  4PJM A;  3ML6 A;  3HOT A;  3QPS A;  2L5Q A;  4ASN A;  3F8N A;  5K5O A;  3ZMS A;  3HM5 A;  1K79 A;  4UVC A;  1SMT A;  1LKX A;  3TL4 X;  1S3J A;  3L2C A;  3TDZ C;  3ZQQ A;  2CV1 A;  2LC2 A;  4N9H A;  5LGU A;  4BXF A;  1JTX A;  4C30 A;  4BS9 A;  2JA7 J;  1R58 A;  1KQ0 A;  2E1C A;  4IHW A;  2IGN A;  3Q0W A;  3QPT A;  1R7J A;  2E35 A;  3ROU A;  3CP8 A;  4F52 A;  3GW2 A;  5B5E C;  4BY7 J;  3ZQ7 A;  4KA4 A;  1XN7 A;  1GXP A;  1LFU P;  1B9N A;  2DMQ A;  1Q1V A;  3LFK A;  5ILV A;  3ELK A;  2DDB A;  1JE8 A;  2W85 A;  3FXJ A;  3A03 A;  3JW4 A;  3IV5 A;  1X1P A;  3PIP F;  1P4A A;  2IGK A;  4PUS A;  5IP9 J;  2VXD A;  3FHZ A;  4NHJ A;  1S5L C;  5IOY A;  4UUS A;  3IRQ A;  1MBK A;  1IN5 A;  3DLL F;  2M0M A;  1ZLJ A;  2GBY A;  2QEN A;  5BNG A;  4KDP A;  3ABK H;  4E7H A;  3JRF A;  3FDY A;  2OUM A;  5F08 A;  4BQQ A;  1T39 A;  1XCB A;  5K7Z A;  4EVI A;  4HZF A;  5D5X B;  3QQA A;  1P4X A;  1G3S A;  3OIO A;  1SD4 A;  3ZMV A;  5F1R A;  4FE7 A;  2L4M A;  3Q0U A;  3F21 A;  3GTL J;  5E17 F;  1JGS A;  3GEZ A;  1QGP A;  1TWG J;  2DQL A;  2NAZ A;  3E6C C;  3OYF A;  2LMD A;  2RN7 A;  1SAU A;  2L01 A;  4PJN A;  4M72 A;  3OYH A;  3H0G J;  4BHC A;  3KZZ A;  5D5W B;  3KFW X;  3K70 D;  5KCM A;  4JYK A;  1CQT A;  2R92 J;  1GVD A;  2QQ8 A;  3RZD J;  3HC7 A;  1J59 A;  4RAF A;  5F04 A;  3K69 A;  3RJP A;  3OYG A;  2IS2 A;  2ZJQ F;  5CVU A;  2OZ6 A;  4CGZ A;  1I27 A;  4G6D A;  1G6N A;  1KYW A;  3CQZ J;  4PFP A;  1LEA A;  1XGM A;  3BT9 A;  4PJJ A;  4FHT A;  3K70 C;  3SZP A;  3HRM A;  3DF8 A;  3WGI A;  1V55 H;  4BBR J;  5J40 A;  5FLM J;  5F1J A;  2X6W A;  4UVB A;  2EWN A;  4M6X A;  2W24 A;  2Q8K A;  3CMA I;  3S1Q J;  2LK2 A;  5IY5 H;  2EA2 A;  2OF7 A;  1OYW A;  2QBY B;  3OV8 A;  4DJA A;  5HLI A;  2E1M B;  2DT6 A;  4P5O A;  3K4B A;  4LLG F;  3EDP A;  3H5R A;  4M9S A;  3HPH A;  3GLL A;  1L0O C;  4XRM A;  3TO9 A;  5JVG F;  1WJA A;  1QZY A;  1YW7 A;  1XC5 A;  5HNH A;  3CLQ A;  4M3F A;  1Z67 A;  1I50 J;  2PN6 A;  2MC4 A;  3DBL B;  1IN8 A;  2VN2 A;  2D5V A;  4EQQ A;  5FRN A;  2QQA A;  2QWW A;  5GPA A;  1UHW A;  4IJA A;  2OJE D;  2K4B A;  1WI9 A;  2GIV A;  4R8H A;  3A2K A;  3PUF A;  2YS9 A;  3V8K A;  3F0C A;  4EM2 A;  4ENK A;  3R61 A;  3NAR A;  2R5Y B;  3WTX C;  2FD5 A;  3OSF A;  3A01 B;  5D8K B;  1PP7 U;  3RTR A;  5J3L A;  3VSK A;  1T0F C;  5BMZ A;  5FJ8 J;  3EUH A;  2QSG X;  2Z2S B;  3JTH A;  1HF0 A;  2X6Y A;  2F6C A;  3VDX A;  2XRL A;  4J19 A;  1Z05 A;  4EM1 A;  4G7H F;  3KET A;  1EKE A;  4YFK F;  3S15 J;  5E20 A;  4F7Z A;  2P81 A;  2DA6 A;  1RIO H;  2CQN A;  3VFZ A;  5EGO A;  1P9Q C;  2RGV A;  4QIW N;  2M7B A;  3CCM I;  5JI6 A;  4AYB A;  4A3K J;  2V1N A;  1IO2 A;  2B0L A;  3E5X A;  1T2K A;  2HVR A;  1OR7 A;  4M3E A;  5E1X A;  1RNL A;  2X6X A;  2XAF A;  4WXC A;  4JX5 A;  2XKP A;  1D0Z A;  2ECB A;  2K4J A;  5E3M A;  1NTC A;  1HOM A;  2MYS A;  4HX8 A;  4CCK A;  3X2Q H;  4W97 A;  3HTS B;  1DPR A;  2IGM A;  2R7D A;  4PGH A;  3DKX A;  1IRZ A;  4L9N A;  1HKQ A;  2HTS A;  2VQH A;  3S17 J;  4D1Q A;  5IOZ A;  5DUI A;  4S04 A;  5DCM B;  1W0U A;  1B4A A;  1P4W A;  1QVU A;  4TV7 A;  3IHU A;  5C4J J;  3HSE A;  4KNY A;  4M6V A;  2GLO A;  2FSW A;  1AWC A;  4GRI A;  2X6O A;  2WB1 N;  3M8J A;  4OAY A;  2KIM A;  3BLY A;  2R7T A;  1IF1 A;  3ZQI A;  2PMU A;  2COB A;  2F4I A;  2K9N A;  1R22 A;  2UV1 A;  4HBL A;  2VOO A;  4MO7 A;  3EYI A;  2WTE A;  2BY2 A;  3M4O J;  4Y52 J;  3GF2 A;  1USS A;  4NQW A;  3S3M A;  2BYV E;  4ON0 A;  5LHI A;  3V8J A;  4UY8 I;  1RZ4 A;  4CCM A;  3K0L A;  3OYM A;  3AKZ A;  1IC8 A;  1MH4 A;  3ABL H;  3BG5 A;  1RKT A;  1V5F A;  3LSG A;  2K85 A;  5EYR A;  2P5L C;  2Z1D A;  3O8G A;  1S7O A;  3CC7 I;  2K5C A;  3JRD A;  2ISY A;  2LF7 A;  4BAY A;  5CQE A;  1X1D A;  2ISZ A;  4HNU A;  1MKM A;  4P1W A;  2AS5 F;  1WZ2 A;  3P9I A;  2H8W A;  2LRD A;  3KZY A;  4XLP F;  4O3M A;  2XF5 A;  5ICC A;  2Y30 A;  3H5N A;  2CUF A;  1XMX A;  5ILU A;  1X3W B;  1ZGW A;  1W5T A;  4HW0 A;  5D6F A;  3RKQ A;  2JJ7 A;  1P7J A;  2DA7 A;  3OR2 C;  2JRT A;  5DDG A;  3GTK J;  2OTJ I;  1WFX A;  2H6C A;  4KIS A;  2OQG A;  2ZME A;  1IRG A;  2M8G X;  2E1O A;  1A31 A;  1MGT A;  4CCJ A;  4EMS A;  4FCY A;  1GV5 A;  1R71 A;  1BA5 A;  1X2M A;  3GLX A;  1AU7 A;  2Y9Z A;  2RKH A;  1IRF A;  3VOE A;  3DKY A;  3OS0 A;  1XSD A;  1B8I B;  4M73 A;  4XLF A;  2DPU A;  4CH7 A;  2LF8 A;  1HSJ A;  2Y0M A;  3KP3 A;  4PDK A;  4IKF A;  4LB5 A;  3SJM A;  1XMA A;  1T6S A;  5D8L B;  3FXM A;  4B8X A;  3RKX A;  2W25 A;  2EV6 A;  2IT0 A;  4RB1 A;  2O3F A;  1U9N A;  4CZZ A;  3ASN H;  2W1O A;  2BVM A;  3LSR A;  1T98 A;  3A0H C;  1ONV A;  5FFZ A;  3RDI A;  1FLI A;  1RPW A;  4BJ6 C;  3J80 Z;  4ENN A;  3O3K A;  1TWF J;  1HKT A;  2M2E A;  3Q3S A;  2YUS A;  3T8R A;  3VYR B;  4BEH A;  1XGN A;  3AFH A;  5FO5 A;  1S9H A;  3DKW A;  4N4O B;  2LY9 A;  3HBL A;  2R5Z B;  2CG4 A;  1WJE A;  2DJN A;  2M87 A;  4FAS D;  2A68 F;  1IDZ A;  2AQF A;  2HS5 A;  3ZMZ A;  3CCU I;  1YFH A;  3OYD A;  1KU7 A;  5EG0 B;  1S7A A;  2KIQ A;  2DJI A;  3C3W A;  4BE2 A;  2COM A;  3LA2 A;  1S72 I;  3RYP A;  2FNA A;  3FBI B;  3JR9 A;  3B6A A;  4WCG A;  4WWC A;  1SVM A;  1MBJ A;  1HDP A;  2IS4 A;  3WHC A;  1UAA A;  2A6H F;  3TKY A;  4FIS A;  4C3I J;  2E36 A;  1MMD A;  3PO3 J;  1ACI A;  1JJ6 C;  1ZTR A;  1L3L A;  1QO0 D;  5TRD A;  2DOF A;  4GDF A;  1VQ8 I;  3AG1 H;  2IGO A;  4HPQ A;  4CXF A;  1WRJ A;  4HYE A;  3AL0 B;  1QZZ A;  4A5N A;  5GPC A;  4QPO A;  1BI3 A;  4M6Y A;  2L2O A;  2BXY A;  2ZNY A;  3BCA A;  1EV7 A;  3E5U A;  4C9Y A;  2RRE A;  4E70 A;  1Q1H A;  3HOY J;  3V7S A;  3BG9 A;  4HAM A;  4L5I A;  4OU0 A;  2V6C A;  2R7V A;  3KP5 A;  2LY2 A;  2E1N A;  1GT0 C;  1A36 A;  3KIO A;  4RAZ A;  1Z3X A;  4AIH A;  4A0Z A;  2QA4 I;  2Z5U A;  3MN2 A;  4UUT A;  2CGP A;  4LB6 B;  3Q0V A;  5L3C A;  4M3B A;  1REP C;  2LKX A;  1SFK A;  1ORK A;  5JVT A;  1HW5 A;  4BGD A;  4RM2 A;  5FD5 A;  3ABU A;  3ULQ B;  4OWR B;  3QOE A;  2Y9Y A;  3DU6 A;  1YLF A;  2YR2 A;  2P7C B;  1N75 A;  4ZH4 F;  1IXC A;  1B1B A;  2AXT C;  3SZT A;  1MNM C;  1R36 A;  2CWE A;  2M4G A;  3RZO J;  4MIM A;  2XB0 X;  2NXN B;  3E3V A;  4LG0 A;  3BR0 A;  3PNY A;  4HF1 A;  4CHU A;  4E7I A;  2DO7 A;  1QPM A;  2WB1 A;  3WGH A;  2EFO A;  4RS8 A;  2CU7 A;  1TC3 C;  2PJP A;  3HYI A;  1TL8 A;  1JKP C;  1ERD A;  4HSR A;  1P2F A;  3DFG A;  2CQQ A;  4BJ5 C;  2X51 A;  3OOP A;  4YRV A;  1XG1 A;  2VB6 A;  5K7F A;  1W7P A;  4ZDL A;  3B6C A;  2KDZ A;  2LD5 A;  4AUX A;  4ZZD A;  4R79 A;  4CA0 A;  4G7Z F;  3QPH A;  2VAS A;  2DT7 B;  2HDD A;  4HA8 A;  4OIP F;  2A5W A;  2NS0 A;  1D0X A;  5D5U B;  4CDG A;  2IA0 A;  1YHQ I;  1G3Y A;  3JRE A;  2AQE A;  5HDG A;  3TDU C;  4A3M J;  3F3X A;  2HZD A;  4DNC A;  4NC8 A;  1YO5 C;  1N78 A;  4B4C A;  2PEX A;  4C3H J;  2GZW A;  3F9K A;  1QPI A;  1QBJ A;  2HOS A;  3REO A;  4C2T A;  3S1M J;  5J8C A;  2ETH A;  1TNS A;  3HGY A;  2LOO A;  1MJA A;  3SEQ A;  3QYB A;  4II3 A;  2H94 A;  4HNV A;  2GA2 A;  1A35 A;  2EPF A;  2M4K A;  3CJR B;  3PL8 A;  4JOM A;  4ZYH A;  3AAF A;  1ZR2 A;  1JUP A;  1OR7 C;  4KIC A;  2DA5 A;  3HHH A;  2L3D A;  1EH8 A;  4DQ2 A;  4E7J A;  1OFC X;  5JLX A;  1TWC J;  1A5J A;  4M71 A;  2H1K A;  4BU2 A;  1MD0 A;  2Q2E A;  4XNF A;  5E18 F;  3QPL A;  3CTA A;  3WTY C;  2NOJ B;  1X1C A;  4JK1 X;  1MBF A;  1VQ5 I;  1RR7 A;  3D1N I;  2PX9 A;  4LOC A;  1Y39 A;  2ZO4 A;  3K6G A;  3LST A;  3ABT A;  5FKM A;  2OTL I;  2HQR A;  2KDO A;  3HOV J;  1LDJ A;  3KP6 A;  3S2W A;  2ZSH B;  1RI7 A;  3TOA A;  2EZI A;  3A0B C;  1MW7 A;  2EK5 A;  1P6R A;  1FSH A;  3I59 A;  2RDP A;  3OOU A;  2VPL A;  1WH7 A;  3E5Q A;  3I53 A;  2CW7 A;  2FJ1 A;  2ELH A;  1VZ0 A;  4M9X A;  4I99 C;  1SC7 A;  1UFM A;  3JSO A;  2R0Q C;  1PUF B;  1UMQ A;  4DBQ A;  2XKO A;  3TGN A;  2HDW A;  2LTP A;  1MJ9 A;  5GP9 A;  4PFO A;  3IKT A;  2W82 A;  1QNT A;  1B6A A;  5HDK A;  4ZJZ A;  2TCT A;  1XDU A;  3S32 A;  2JA5 J;  2O8K A;  4LMY A;  4XRS G;  4BAC A;  3ZN0 A;  5IYC J;  1YOV B;  3V42 A;  1OJL A;  2WAD A;  1ZGA A;  2EIK H;  4I02 A;  1BN5 A;  3J80 K;  1R1T A;  3I3L A;  4A3E J;  3LSH A;  1XCV A;  2OA4 A;  2ELJ A;  1U8R A;  1ON1 A;  3I58 A;  4DYC A;  2FX0 A;  2HDC A;  2O5R A;  5AIQ A;  1W5C C;  1I6H J;  3CMY A;  1YJ9 I;  1DP3 A;  1DGW Y;  2I10 A;  4QPQ A;  4DW6 A;  2VKH A;  3JAM Z;  1DU0 A;  2ZME C;  3OY9 A;  2E2H J;  2R7S A;  2G0E A;  3R0A A;  2KIU A;  4OMZ A;  2BV6 A;  4KIB A;  3TED A;  3GUD A;  5LHH A;  5LGT A;  2RQP A;  4A3D J;  1DP7 P;  4MNU A;  4IX7 A;  5F64 A;  2A6T A;  2CMP A;  1VQM I;  1FIA A;  4XSX F;  1EA3 A;  4G6Q A;  3WHB A;  1WJD A;  1UHS A;  3PNT A;  5KNL A;  2I8D A;  4LJZ F;  2LP0 A;  1E3O C;  4XLE A;  1W4M A;  1D5Y A;  1QVT A;  2NNY A;  1CF7 B;  1K78 B;  1E0E A;  5ICF A;  4YIF A;  5F0C A;  1W0T A;  4MFE A;  3ZMU A;  1K4S A;  1H89 C;  4MEX F;  1TP4 A;  3V7C A;  1K61 A;  1BM9 A;  4XLH A;  1F43 A;  1LE8 A;  4I76 A;  2DA3 A;  2F48 A;  2IA2 A;  2OBP A;  2XHK A;  3LSI A;  3MZ8 A;  1BI1 A;  2JUC A;  3KE2 A;  2LBF A;  2O6G E;  3HDD A;  2EJR A;  2H8R A;  4AYB N;  3I4P A;  4JBA A;  3QOP A;  2ADU A;  2FBK A;  1U5T A;  3RYR A;  2D2W A;  2NOG A;  2WA0 A;  1J7K A;  1D1A A;  3SFZ A;  2D1V A;  2GOX B;  1I5Z A;  1K4T A;  2UXX A;  4EV0 A;  4X6A J;  3W2W A;  1VQL I;  3WG9 A;  2ID3 A;  1Z1D A;  1QQI A;  5E8I A;  3KCC A;  4A3G J;  2IS1 A;  2BXZ A;  2HQ5 A;  1BC7 C;  4L9V A;  4D9J A;  2PFB A;  4UB6 C;  3QYE A;  4J01 A;  3E6M A;  1YIJ I;  2DPD A;  2GXG A;  3ECH A;  3DEU A;  2LFB A;  2FF4 A;  5EZG A;  2Z3Y A;  3IRR A;  2HNH A;  3OYL A;  3GX4 X;  1Z0X A;  2MLK A;  4ITV A;  4PSW A;  3OYI A;  2KFD A;  1WJF A;  1X1B A;  5HS9 A;  2BHZ A;  5FRO A;  1ZRC A;  2CV0 A;  1ZAR A;  2YU9 J;  5LFA A;  5ED4 A;  5CYV A;  3ZPL A;  1TT5 B;  2NS7 A;  3DCF A;  1EJ9 A;  3BG3 A;  4HLX A;  3QRF F;  2PMH A;  2XRO A;  4PSX A;  1P7I A;  1RUO A;  1IN6 A;  4CCO A;  3SFI A;  5IT9 Z;  1Z21 A;  2L9N A;  2K9Q A;  1TWH J;  3COA C;  3AL0 C;  2KJC A;  3CO6 C;  1Y1W J;  2QKM B;  1V5G A;  3OL3 A;  1FIP A;  4Y17 A;  2HKX A;  4XR6 A;  1GVJ A;  2K3F A;  1LQ1 A;  5BPI A;  3GVA A;  3H3V K;  1HQC A;  1ODD A;  3QP5 A;  4AWX B;  2JUG A;  4XKV A;  1A6I A;  3GWZ A;  4MEY F;  4BUP A;  2JVG A;  1X4P A;  2BHY A;  1N25 A;  3J7A O;  4A5M A;  3G1M A;  3VYT B;  3FIS A;  3CF2 A;  1ZYR F;  1WHU A;  4UUS B;  2BEO A;  1KYZ A;  1KA8 A;  2VBW A;  2VJ5 A;  2WV0 A;  4BXU A;  1H8A C;  1JKQ C;  3R0J A;  5ERI A;  2Z33 A;  2Q1Z B;  3MZH A;  1JJ8 C;  2MC3 A;  2MG4 A;  4F55 A;  1J2X A;  1BC8 C;  3KYC B;  1YE9 A;  3VYS B;  4ZYG A;  2KMU A;  5KAI C;  1MBG A;  2YX7 A;  3SDB A;  1VFC A;  4ESJ A;  1A04 A;  5L3E A;  3HTU A;  3K9T A;  1BW5 A;  1ETY A;  3CUQ A;  5IP6 A;  4JP0 A;  1W7P D;  4BYY A;  2XAS A;  4O5V A;  1WVR A;  2FNP A;  3GXO A;  5B66 C;  5FLX Z;  5C4X J;  4EEF G;  3FK7 A;  3G73 A;  2IBD A;  1YI2 I;  2FE3 A;  3HOZ J;  3V7R A;  2DFI A;  2EIJ H;  4AU7 A;  3A02 A;  4KT6 A;  2DA2 A;  4Z2Y A;  4XON A;  1TQM A;  1UEL B;  1HW2 A;  4OOI A;  4A3B J;  1XB4 A;  3E97 A;  1ZKG A;  3CCS I;  4Q47 A;  1TW3 A;  4Q5S F;  4NC6 A;  1VF9 A;  5HLG A;  2STT A;  4XQF A;  2EIN H;  1G3W A;  3H9J A;  4LG3 A;  4AIK A;  5AON A;  2DI3 A;  3TW6 A;  4II2 A;  2CQX A;  5A2Q Z;  1KQ8 A;  1WSU A;  1OCZ H;  2ZKZ A;  5E1W A;  5EZH A;  3MD2 A;  3DBR B;  1TQP A;  4JQF A;  3IWF A;  2O61 A;  2A3S A;  1LVK A;  1Z91 A;  2OD5 A;  3LMM A;  4KIT B;  2ZSI B;  1TZL A;  3M07 A;  4PGG A;  2DK5 A;  2W4S A;  3PM1 A;  3KP4 A;  1YW8 A;  3M8E A;  4XSZ F;  4XOP A;  1UZC A;  2NRA C;  3K10 A;  3BCB A;  1D8J A;  3ZGK A;  3EPZ A;  4D7M A;  1POG A;  2M3A A;  3BY6 A;  5CVV A;  3LNQ A;  1HDD C;  2IVM A;  2XGD A;  1WJC A;  3K7A J;  1VI0 A;  2XB5 A;  1FYM A;  4E7K A;  4BQA A;  3JCU C;  4Y4R A;  1SVL A;  3UR3 C;  5D4S A;  1TQI A;  4P9U A;  3MFK A;  5JHF A;  3CUO A;  2UXN A;  2EA4 A;  3SHF A;  3IH2 A;  2R4G A;  3JAM K;  2X48 A;  4JX6 A;  1D0Y A;  1VQ4 I;  1MND A;  2VOP A;  1LJ9 A;  4B44 A;  4BDY A;  4XKB A;  1YYV A;  2OC6 A;  1ZR4 A;  2PMZ N;  3RCO A;  1TTY A;  2BGC A;  5EDN A;  1T56 A;  1LPQ A;  4BQO A;  2W7N A;  1T8I A;  1MZB A;  1KQ9 A;  4MTD A;  5K5R A;  1MMG A;  2GIZ A;  4A12 A;  1J5Y A;  3VOD A;  5FRM A;  1ZRF A;  4DYQ A;  1YQA A;  1OCP A;  2H1L A;  3IUO A;  2TDX A;  4DOZ A;  4DBR A;  5M3M J;  5EGO B;  1Y56 A;  3CLO A;  4IRH A;  3WU1 B;  3WE3 A;  1FBU A;  4XOT A;  5FKK A;  3PSI A;  4P9F A;  1RC9 A;  1FC3 A;  4IZZ A;  1IXR C;  1I39 A;  1ZH5 A;  3U2R A;  1LUJ B;  4U7B A;  3FXR A;  4N0B A;  2NVT J;  2HQN A;  4KN7 X;  1FOX A;  4EJW A;  5BS6 A;  2K9M A;  1XSV A;  2EFW A;  2LKP A;  3QWL A;  4ESB A;  4N9I A;  2KZG A;  3KZI C;  2K86 A;  3W2A A;  3M1C A;  2ZBK A;  3OYC A;  1SD5 A;  2VQL A;  1S8N A;  3ONQ A;  2JSP A;  3A1Y A;  3H36 A;  5AIP A;  2JA6 J;  3TBI A;  1G2H A;  2Q0O A;  1B59 A;  5JR3 A;  2A69 F;  3CDH A;  5L3D A;  3ZRG A;  3ZQC A;  3RKW A;  1HBX G;  5FB2 A;  4IQ4 A;  3L2R A;  3NRV A;  3HB9 A;  1KU3 A;  5J4Y A;  4NQW B;  1KU9 A;  5FKO A;  1R5I D;  3KPH A;  1VQ7 I;  3FWE A;  2F4O B;  2L7Z A;  1D5V A;  2KHM A;  3S1N J;  3F8F A;  4C2M J;  4NNJ A;  2HXO A;  2VJI A;  1MDM A;  4CZC A;  1FOW A;  1R23 A;  2X9D A;  2ZXW H;  3TP3 A;  3S93 A;  1Y8Q B;  4CSW A;  2DCE A;  1O4X A;  4NDL A;  2XV4 S;  3MKL A;  5IT9 K;  3OIP A;  4D7N A;  1WPK A;  3F23 A;  5LRR A;  2F4M B;  2BY3 A;  5JFR A;  4FTH A;  2R7U A;  2P8T A;  5HOD A;  2QF7 A;  1K83 J;  3CDL A;  3BTJ A;  2DOA A;  2Z99 A;  2W00 A;  3HJE A;  2BW3 A;  3KEY A;  4YG2 F;  1SAX A;  3HRS A;  4A69 C;  2XF7 A;  4KMU X;  2L4A A;  1U5T C;  4MTE A;  3OS2 A;  1RET A;  1FX7 A;  5DUK A;  3J81 Z;  1FWZ A;  5F6F A;  5J8F A;  2MBF A;  3JRB A;  2PG4 A;  4EAT A;  3DLA A;  2LSO A;  5KHD A;  5CVR A;  1RRJ A;  1HST A;  3JRC A;  2HGC A;  1IJW C;  4H4K C;  2ZME B;  3G71 I;  3D0S A;  2WBM A;  2GM4 A;  2E2I J;  1VQP I;  5F0H A;  3U9G A;  3F6V A;  2DAO A;  4NUB A;  3HRT A;  1UJ8 A;  1BOB A;  3DPU A;  3OR1 C;  3BJ6 A;  3F8B A;  1MIJ A;  4ZDO A;  3GZN B;  1MSE C;  1UCR A;  3FXQ A;  3EET A;  2IS6 A;  2XC7 A;  2BBY A;  2JK3 A;  2HFH A;  3I56 I;  1O57 A;  1FBS A;  3WGG A;  4IHY A;  1DUX C;  4LK1 F;  1X58 A;  2EH3 A;  4PCQ A;  1ETX A;  4I0B A;  2HYF A;  5D4R A;  5FLX K;  2XIG A;  3BZ6 A;  1STZ A;  2XPU A;  4HF0 A;  1BI2 A;  4HOB A;  3WU0 A;  4A0Y A;  1O7F A;  3HEF A;  2I5U A;  2QEX I;  4OAZ A;  1NK3 P;  1GV2 A;  2E5Z A;  1BJZ A;  3FMS A;  5E1Z B;  4QTR A;  2FML A;  2DTZ A;  4LLL A;  3H9G A;  2PQ8 A;  1XDS A;  1Z9C A;  3K2A A;  1E3P A;  2VIX A;  2E7W A;  3C2B A;  4BEH B;  4XLC A;  1CGP A;  5EJC A;  1BJA A;  3HSF A;  3E1S A;  1O3R A;  2QKL B;  1TBX A;  1GUU A;  4IOA F;  4RGR A;  2MFZ A;  3PUB A;  2R7R A;  3S1R J;  5DEQ A;  3L2W A;  2ZJ2 A;  5A2Q K;  1QRY A;  1G59 A;  3OS1 A; 
#chains in the Genus database with same CATH homology
 2WAQ N;  4D5C A;  1MBF A;  1F36 A;  3HM5 A;  1AHD P;  1RR7 A;  2EBI A;  3D1N I;  4LOC A;  1WCM J;  5FKM A;  1JTX A;  5C3E J;  2JA7 J;  3HOV J;  4IHW A;  1DU6 A;  3Q0W A;  1JUS A;  2NS8 A;  2RAE A;  1ENH A;  2EZI A;  3GTP J;  3BR2 A;  3IH3 A;  1IDY A;  1VND A;  4BY7 J;  1LFU P;  3OOU A;  2DMQ A;  1WH7 A;  1Q1V A;  2FJ1 A;  2VI6 A;  1BL0 A;  2R0Q C;  1PUF B;  3A03 A;  3IV5 A;  3I4N J;  4A3I J;  1UMQ A;  4MFD A;  2LTP A;  2MW8 A;  5GP9 A;  5IP9 J;  3SDG A;  1WH5 A;  1WI3 A;  2TCT A;  5IOY A;  4UUS A;  1MBK A;  2NVX J;  2JA5 J;  2O8K A;  2GBY A;  4XRS G;  3ZQF A;  5BNG A;  4C3J J;  3JRF A;  5IYC J;  4I6Z A;  4D5F A;  1OJL A;  5F08 A;  5K7Z A;  3QQA A;  3HKZ N;  4A3E J;  3OIO A;  2ID6 A;  4FE4 A;  2HOA A;  4FE7 A;  3Q0U A;  1YRN B;  1YRN A;  2CUE A;  1JT0 A;  1H88 C;  4DYC A;  3GTL J;  3BQZ A;  1T33 A;  2FX0 A;  1TWG J;  3M3Y J;  5K7H A;  1I6H J;  1MSF C;  3HGG A;  3CMY A;  3GBG A;  1U8B A;  3H0G J;  2I10 A;  4DW6 A;  1DU0 A;  2E2H J;  4JYK A;  2G0E A;  1CQT A;  1ITY A;  3LOC A;  1GVD A;  2R92 J;  3RZD J;  2TRT A;  2ELK A;  2MSY A;  5F04 A;  3TED A;  1S7E A;  2DMN A;  4DYR A;  4CYC B;  4CYC A;  4A3D J;  2HXI A;  5C44 J;  3CQZ J;  2XGC A;  3BT9 A;  1FIA A;  1IV6 A;  3WHB A;  1UHS A;  4X1E A;  4BBR J;  1IG7 A;  2EZL A;  2IAI A;  2LP0 A;  1E3O C;  1D5Y A;  1QVT A;  3PO2 J;  5FLM J;  5F1J A;  2XSD C;  3JRG A;  5F0C A;  1W0T A;  4MFE A;  1H89 C;  2LR8 A;  1K61 A;  3S1Q J;  1JUM A;  2LK2 A;  1F43 A;  1LE8 A;  2OF7 A;  4I76 A;  4Y7N J;  2DA3 A;  1R9T J;  2DA4 A;  2JMW A;  2B63 J;  3HDD A;  2H8R A;  4AYB N;  2NVY J;  2NOG A;  2KT0 A;  3BR3 A;  4XRM A;  3UKG A;  1XC5 A;  3MVP A;  3G1O A;  3JRA A;  3W6V A;  4X6A J;  4M3F A;  4MLO A;  2ID3 A;  1I50 J;  4A3G J;  2D5V A;  5GPA A;  1B8I A;  2HQ5 A;  4AC0 A;  5IYD J;  2YS9 A;  1ETV A;  5EZG A;  2LFB A;  3F0C A;  1Z0X A;  3NAR A;  5J1Y A;  2R5Y B;  2FD5 A;  3OSF A;  3A01 B;  2O9L A;  5M5Y J;  5IYB J;  1XS9 A;  3FKI J;  4XRS A;  2YU9 J;  1X2N A;  5J3L A;  1AKH A;  3GTO J;  5FJ8 J;  5IPA A;  3DCF A;  2NS7 A;  1HF0 A;  3BG3 A;  2XRL A;  4J19 A;  1B72 A;  2M34 A;  1EF4 A;  4BKX A;  1P7I A;  3S15 J;  3SFI A;  2P81 A;  2DA6 A;  2K9Q A;  1TWH J;  3IH4 A;  5EGO A;  2R5Z A;  4QIW N;  1Y1W J;  5EEA A;  1MBE A;  1FIP A;  3GTG J;  4A3K J;  2DN0 A;  5EG0 A;  4A3J J;  4M3E A;  2EZK A;  3H3V K;  1A6I A;  4JX5 A;  4BXX J;  4M3G A;  2ECB A;  1RES A;  5E3M A;  1FJL A;  1NTC A;  1HOM A;  4W97 A;  1IRZ A;  3G1M A;  3BR5 A;  5DTD A;  3FIS A;  2DMU A;  2Y31 A;  4UUS B;  3S17 J;  5IOZ A;  1H8A C;  2XPV A;  1JKQ C;  4DZP A;  1W0U A;  1QVU A;  1JJ8 C;  5C4J J;  2MG4 A;  4M6V A;  2GLO A;  2X6O A;  2WB1 N;  4B3A A;  4QSH A;  3BR6 A;  1MBG A;  3VPR A;  4V2F A;  3ZQI A;  1VFC A;  2COB A;  3E7L A;  2K9N A;  1BW5 A;  1ETY A;  2ECC A;  5IP6 A;  4JP0 A;  4MO7 A;  2HYJ A;  3M4O J;  4Y52 J;  3O8H A;  5C4X J;  4EEF G;  3FK7 A;  2IBD A;  5M3F J;  2ME0 A;  3HOZ J;  3A02 A;  1IC8 A;  2DA2 A;  1MH4 A;  4A3B J;  3BG5 A;  1RKT A;  1U9O A;  2L7F P;  3LSG A;  5EYR A;  3L1P A;  3O8G A;  1ZKG A;  3JRD A;  2IEK A;  2W48 A;  3S14 J;  2DA1 A;  2WV1 A;  1VF9 A;  3FK6 A;  1ETK A;  1ZK8 A;  2Y30 A;  3ZOB A;  3TW7 A;  2CUF A;  4B1R A;  2JA8 J;  1ZGW A;  3TW6 A;  1JKO C;  1JKR C;  2CQX A;  3RKQ A;  2JJ7 A;  1P7J A;  2DA7 A;  5EZH A;  1LE8 B;  1FEX A;  3GTK J;  4IHX A;  1FTT A;  3G1L A;  4V2G A;  1WGX A;  5F27 A;  4W1U A;  5FKL A;  2K40 A;  2M8G X;  1Z77 A;  2VKE A;  3PM1 A;  2E1O A;  3NAU A;  2HI3 A;  5F0F A;  5E3O A;  4FCY A;  4D7M A;  2L9R A;  1POG A;  3CCY A;  1GV5 A;  1JT6 A;  3LNQ A;  1HLV A;  1HDD C;  2R7Z J;  2M9H A;  2XGD A;  1X2M A;  1BA5 A;  1AU7 A;  2Y9Z A;  3K7A J;  1VI0 A;  2AO9 A;  2XB5 A;  2FQ4 A;  1B8I B;  1BW6 A;  1MBH A;  3IH2 A;  2QCO A;  3SJM A;  2X48 A;  4JX6 A;  3ZQG A;  1ZR4 A;  2PMZ N;  1Y1V J;  1U9N A;  5EDN A;  1T56 A;  2M0C A;  2Y2Z A;  4BY1 J;  2OPT A;  1AKH B;  3LSR A;  2AHQ A;  2ME6 A;  1RPW A;  3GTQ J;  1B72 B;  3BTL A;  1TWF J;  2M2E A;  3Q3S A;  2YUS A;  3LSP A;  4DYQ A;  3S2H J;  5E3N A;  1GDT A;  2NVQ J;  1RKW A;  1OCP A;  5M3M J;  2LY9 A;  1APL C;  3HBL A;  5EGO B;  2R5Z B;  2LLK A;  2DJN A;  3RQI A;  1JGG A;  2DMP A;  1I3Q J;  5FKK A;  1IDZ A;  2EZH A;  5EG0 B;  4A3L J;  5EF6 A;  4DZJ A;  2L0K A;  4XIC A;  2Y0S N;  2NVT J;  3BTI A;  3GTJ J;  3JR9 A;  3B6A A;  2E2J J;  1MBJ A;  1HDP A;  3WHC A;  2MGQ A;  3GTM J;  2CRG A;  4FIS A;  4C3I J;  3PO3 J;  1ETO A;  1JJ6 C;  1ZTR A;  3DEW A;  2JA6 J;  3BTC A;  1G2H A;  1ETQ A;  1PUF A;  5GPC A;  4BBS J;  3ZQC A;  1ZQ3 P;  1ETW A;  5J1U A;  2L7M P;  3HOY J;  3HB9 A;  4L5E A;  5M5W J;  3BG9 A;  5FKO A;  4XID A;  1GT0 C;  2L7Z A;  1LFB A;  3S1N J;  4C2M J;  4M3D A;  2HXO A;  4S0H B;  1UG2 A;  2EQR A;  3MN2 A;  4UUT A;  1TWA J;  1IGN A;  3S16 J;  2X9D A;  3TP3 A;  3Q0V A;  2XGE A;  4M3B A;  1U78 A;  2LKX A;  9ANT A;  1O4X A;  4NDL A;  3MKL A;  1ORK A;  1SAN A;  3BR1 A;  4D7N A;  1WPK A;  3HOW J;  2K9S A;  4FTH A;  4IEJ A;  3FIW A;  5HOD A;  3OSG A;  2QF7 A;  1SFO J;  1K83 J;  3BTJ A;  1JTY A;  2Y9Y A;  3CDL A;  5DS9 A;  2XPW A;  4A69 C;  4A3C J;  1MH3 A;  1RET A;  1MNM C;  1HCR A;  3RZO J;  4MIM A;  5IP7 J;  2XB0 X;  3JRB A;  3JRC A;  3BR0 A;  2E19 A;  1IUF A;  1IJW C;  2JWT A;  4RBO A;  2GM4 A;  4ABZ A;  2E2I J;  5FLV A;  5F0H A;  2VPR A;  1OCT C;  2CU7 A;  1TC3 C;  3I4M J;  5J1R A;  1JKP C;  2CJJ A;  2CQQ A;  1MSE C;  1XG1 A;  5K7F A;  3JRI A;  3B6C A;  2KDZ A;  2R93 J;  2LD5 A;  4AUX A;  2JK3 A;  5FKN A;  5E3L A;  4IHY A;  2HOT A;  2HDD A;  3ZQL A;  1X58 A;  2EH3 A;  1ETX A;  5M5X J;  1FTZ A;  2N8G A;  3JRE A;  1NK2 P;  2XPU A;  4A3M J;  3HEF A;  5JLW A;  4B4C A;  2O7O A;  4C3H J;  4RDU A;  1QPI A;  1NK3 P;  4XK4 A;  2HOS A;  2DMT A;  3S2D J;  3HOU J;  1GV2 A;  3S1M J;  1BJZ A;  2LVS A;  3HGY A;  4QTR A;  2ZB9 A;  4HNV A;  4A93 J;  2DTZ A;  1ZR2 A;  1JUP A;  3K2A A;  3JRH A;  2DA5 A;  4IHV A;  3C2B A;  3HOX J;  4JX4 A;  3LSJ A;  1OFC X;  4G12 A;  5JLX A;  1TWC J;  1A5J A;  2H1K A;  1GUU A;  3ZQH A;  2VUM J;  3S1R J;  2R5Y A;  3BQY A;  2JN6 A;  3A01 A;  1QRY A;  3QPL A;  4A3F J;  4GFB A;  3TP0 A;  3QPS A;  2VKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...