1HKQA

Pps10 plasmid dna replication initiator protein repa. replication inactive, dimeric n-terminal domain.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
QSNKLIESSHTLTLNEKRLVLCAASLIDSRKPLPKDGYLTIRADTFAEVFGIDVKHAYAALDDAATKLFNRDIRRYVKGKVVERMRWVFHVKYREGQGCVELGFSPTIIPHLTMLHKEFTSYQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REPLICATION PROTEIN
publication title A Conformational Switch between Transcriptional Repression and Replication Initiation in Repa Dimerization Domain
pubmed doi rcsb
source organism Pseudomonas savastanoi
molecule tags Dna binding protein
total genus 37
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hkqA00
3F8BA 2QLZA 5E1WA 3ERED 5F6FA 3FMQA 2PEXA 2FBIA 1O3QA 5JVTA 2JRTA 2Y75A 5LRRA 3L00A 1WI9A 3IWFA 2P5VA 4IJAA 4HBLA 3I71A 3V7SA 3ZN0A 2O6GE 3GW2A 4OU0A 2DK8A 2ZNYA 1ZRCA 3WODF 2P5KA 4Q47A 2MBFA 4P9FA 5EEGA 4OIPF 4PGHA 1S7AA 5CVIA 1O3TA 5LRSA 3IKVA 2HOEA 3F8MA 3M8EA 3HTUA 1BBYA 4M9SA 1TNTA 4HX4A 5H20A 1QZZA 1P4XA 5H6QA 1KU7A 3HRSA 2PMHA 4I09A 5ED4A 3QPHA 4I0AA 2MA3A 1Z1DA 5HLGA 1G4DA 5E20A 2STTA 5D8KB 4RB0A 1LQ1A 3TOAA 1TNSA 5DEQA 1YTYA 1DPRA 3GYHX 5D6EA 3K1MA 3EUHA 4MTEA 3KLNA 1FYLA 2CFXA 1XDSA 3HSRA 4EJVA 1MJ9A 4E70A 5DDGA 3ISPA 2CO5A 1ZG1A 1IW7F 5LHGA 3K0LA 1BIAA 2KIUA 2V9VA 1XMAA 2VBXA 4O6JA 1F4KA 3WG9A 3VFZA 4DQ2A 1XMKA 4I01A 1OR7A 1P6RA 5K1YA 1O3SA 2D45A 3BY6A 3LQRA 5E8IA 3D5LA 5BS6A 4IVNA 2O0YA 1JXSA 5HVQC 3GLXA 4LLGF 3TO7A 3QPTA 5BMZA 3LWFA 5DUIA 5BQTA 5CVRA 1YW7A 1Z6TA 2J5OA 4U0WA 5J8FA 1CF7B 4UNOA 5IT9K 2YX4A 3I4PA 3ZMTA 2EA2A 1YQAA 3ECHA 2FEZA 4OOIA 1T2KA 1IN6A 3WU0A 3CO7C 2A68F 1BJAA 2YR2A 1QGPA 4H0EA 2F5FA 2H27A 2QBYB 4HV6A 1ZLKA 1NHAA 4PCQA 3F22A 4LG0A 1BOAA 3HRUA 3D0SA 3LAJA 5K5OA 2EJRA 1HW5A 4BAYA 2ETHA 2VOPA 2J5PA 4BXUA 1MJAA 1J9IA 4KIGA 1D8KA 2EA4A 4I2OA 3RDIA 3MWMA 1TQMA 2M87A 3HTSB 1ZG5A 2CYYA 2JPBA 1FWZA 2D2WA 3E6DA 2EB7A 4NB5A 5L3CA 4G94A 5JHUA 4JBAA 4XRFA 3ZMVA 1PDNC 4RB2C 2EFOA 1QZYA 2FXAA 2VBZA 2ZCWA 1JGSA 2GZWA 2IA2A 4KNYA 2FMYA 1YO5C 2HR3A 2Y48A 3IRQA 1AOYA 3V4GA 4Y17A 3RJPA 2P4WA 2VBWA 4GYIA 2QWWA 1ULYA 3KEQA 5TJJA 3WGIA 2HQNA 4CYDA 5K5QA 1RI7A 5HOOA 3EDPA 3Q5FA 3J81Z 2X0LA 4Z2YA 5LGNA 3L9FA 3TDZC 3V8JA 2XROA 2M5WA 4BNCA 2H6CA 1BN5A 2A69F 4AVPA 4EV0A 4RB1A 2UWMA 1XGSA 2K86A 2H94A 4A0YA 4IRIA 5H6RA 3R0AA 3JAMZ 1IF1A 2DLLA 5DD8A 3KFWX 1USSA 2W57A 2RQPA 1IN5A 3ML6A 2CQKA 1UHWA 4OIQF 2FNAA 4KIBA 4HYEA 1K78B 2K7LA 3IHUA 4Q5SF 3SHFA 4LLNA 2RV8A 4HA8A 3DKWA 3I5UA 5ILVA 1L0OC 5DYMA 3H92A 1FSEA 5A2QK 4HQEA 4L9NA 3BPVA 1MZBA 4G8XA 2NYXA 2ISZA 4KMUX 4GYGA 3R6SA 2HWVA 3EYYA 5JR3A 2ZJ2A 2LNBA 3KP5A 4LK1F 3FM3A 1ZAOA 4WXHA 3G73A 4LB6B 1FNNA 2EFNA 2JPCA 1EH6A 2BBYA 5L3DA 4KA4A 4WK8F 4MGRA 2XV4S 3SZPA 5FLXK 2P5LC 1WWXA 2VOOA 1J59A 1KYWA 1KA8A 4ETSA 4KFCA 4ZYEA 5ICCA 3MQ0A 1T38A 4XLPF 2Q8KA 4MEXF 1R7JA 2ELHA 4ZYDA 1J5YA 3WTWC 5HS8A 3H3ZA 3LAPA 3E6CC 4A5NA 1HSTA 2CG4A 3CTAA 3KP2A 3ZN1A 2NAZA 3T8TA 2ESHA 5CYVA 3I0TA 4M72A 3TO9A 2IA0A 3BP8A 1TW3A 1MDMB 3HSFA 3RYPA 2UZKA 4AIJA 1ZRDA 4N0BA 4ZH4F 3IRRA 1R1VA 4FX4A 2HKOA 4PGGA 1MGTA 1LEAA 2M1BA 3V7CA 1TQPA 1RIOH 1P4AA 2GWRA 5J8CA 1GXPA 4GO1A 2IP2A 4WF2A 1BC8C 2LDUA 1XCBA 4I02A 1J75A 3DEUA 3R4KA 4ZZLA 2OZUA 2IA1A 4CO8A 4A12A 4HLYA 4ZYGA 4HZFA 2WV0A 2MLKA 2R3SA 4A6DA 2L01A 1MJBA 3I54A 1TW2A 4RGXA 3BOQA 1J0RA 2PLYA 4QLCU 4CZZA 1MDMA 2DQLA 1XGNA 2R7FA 3E5XA 3KE2A 2QVOA 1KGSA 3MCZA 2BEOA 2FBHA 2XKPA 1E17A 1YS6A 2ZKZA 1Z05A 1KU2A 1DDNA 4HF0A 3WE3A 3NQOA 4I0BA 1OMIA 4K2EA 1K6OA 3KLOA 4EMSA 1TQIA 2XAHA 2C6YA 2GA1A 2GQQA 2K27A 3VOEA 3V8LA 5JI6A 4EQQA 1ZH5A 1R5HA 1QO0D 2GA2A 4M9ZA 2KIFA 1B4AA 1XSVA 4UV8A 3J80Z 2X4HA 3I64A 2G9WA 4M74A 4MHGA 3S2WA 4LMYA 2PMUA 1FC3A 2STWA 3R61A 2RNJA 3MAJA 2VN2A 2DO7A 3CUQC 2QM3A 1KYZA 5E1XA 1R1TA 4EJOA 5D8LB 3RKXA 4BHCA 1QBJA 4LGWA 1JHHA 1KU9A 2Z5UA 3KEOA 2K4BA 1A04A 2Z3YA 5F1RA 4HV5A 4MEYF 3E5UA 5JFRA 4I7HA 3LQQA 1WRJA 5LEKA 3QP6A 1LJ9A 1HKTA 4P5OA 4DNCA 3QRFF 1CGPA 2YSRA 4FHTA 2HFHA 1ZYRF 1T98A 1HW2A 1D5VA 5CLSA 1K79A 2Z9OA 3RPQA 4ZYHA 3ULQB 3WGGA 4RB3C 3E97A 2A5YB 3WTXC 4JQFA 4UXNA 3C1DA 1KQ9A 5TRDA 1FY7A 3RIRA 1SMTA 1D3YA 3CO6C 4KN4X 5D5WB 3O6BB 1HSJA 1KQ8A 3FXQA 4EVIA 1ZLJA 4HDVA 3SQNA 2L3DA 1O7LA 4OIRF 3K69A 2FOKA 1Z6RA 2F5DA 1SFUA 4L0YB 3DXJF 2ZO4A 1T0FA 2FRHA 1L3LA 1XD7A 2UXXA 2CSOA 5HLIA 3IC7A 1XCVA 3H3UA 3M9AA 2ZNZA 4LG0B 3TO6A 4HDUA 5DCMA 4HW0A 4U0YA 3JSPA 1KQ0A 5E18F 3LSTA 2XVCA 4L9TA 2FF4A 3F6VA 2YX7A 4LD5A 4G7OF 3RTRA 1EH7A 1SMYF 3DQVC 5HDGA 4AD9A 2OD5A 3DFGA 1DPUA 2VXZA 2BV6A 2NNYA 2BE5F 5AIQA 3PFIA 4G7ZF 4I98B 4FT8A 4WX9A 1YLFA 2G7UA 3DV8A 2F2EA 1DUXC 2FA5A 1S6LA 3J80K 1FPQA 1UHMA 3WE2A 5HDNA 2HGCA 1U5TA 1FSHA 1G3YA 4KYWA 4L9JA 2XAFA 1FOKA 2NRAC 3KP7A 4A5MA 1JHFA 3VODA 2XKOA 5CVVA 3F6OA 2W85A 3C3WA 4YFXF 3FF5A 1HQCA 4BQAA 2H09A 5FGMA 1G6NA 4AIKA 2HYGD 1B9MA 2L54A 5DCFA 3GF2A 5L3FA 1FBQA 2DI3A 2K02A 3O3KA 1USTA 4YFKF 3T1BA 1U78A 1H9TA 3MFKA 4WWCA 3JTHA 3FMSA 1YFHA 3BJAA 4UV9A 3U1DA 1IN8A 4NHJA 4QWQA 2CW0F 2IPQX 1IN7A 2PFBA 1BI1A 3OOPA 1P2FA 1O7FA 1R58A 2XASA 2XAQA 3ZMDA 1SD6A 3KCCA 5FFZA 4UVAA 3CDHA 4M9XA 3F3XA 1OYYA 3T0YA 1IXSB 3K1NA 3RI4A 5ICEA 4O5VA 3GFJA 4YFNF 4BHBA 2FMLA 4RGRA 3KP4A 2F5CA 5AONA 1ZHFA 4YG2F 1B6AA 2QUFA 3GWZA 3U9GA 3FM5A 4RS8A 4CHUA 3U2RA 2WWYA 2HTJA 2OQGA 1FX7A 5DUKA 2BYVE 1QQIA 3ECOA 3R60A 3V8KA 4BHPA 1W4MA 1XN7A 1W7PB 4NQWA 2PG4A 1RZ4A 3WTUC 3T5XA 1ZRFA 4O3MA 5LEJA 1IRFA 3E5QA 4XSXF 2EFQA 1IXCA 2MH9A 4Q4ZF 3FWEA 4WXDA 3TOBA 2A07F 1SD7A 3ZMZA 2TDXA 3VEPA 3GVAA 1S3JA 5E17F 3HHHA 4CICA 3BROA 2JZYA 5ICGA 2RGVA 1F9NA 2JSCA 4EJWA 4CXFA 2WC2A 3BWGA 3ZMSA 2Q2EA 3Q9SA 1H0MA 1FP1D 3BJ6A 1V4RA 2EV0A 3GUDA 2DBBA 1G3TA 1TBXA 1W7PA 2DPDA 4KDPA 4N9IA 4L0ZB 2RN7A 2RC4A 3ZP5A 5LGUA 1BI0A 5FFXA 2ZFWA 4WXCA 4U0VA 3WTVC 1J7KA 1OYIA 4MQ9F 4ENKA 5L3EA 3F21A 5KK1A 4ZZDA 4WCGA 2HEOA 4TV7A 2CWEA 3J7AO 2P6TA 2DK5A 3F72A 3TGNA 3MZHA 5AIPA 1J2XA 2KIMA 4KUMA 2JT1A 3COAC 1IN4A 4U7BA 1Z91A 1KU3A 2OA4A 1I27A 1K7AA 2XUBA 1YW9A 3RYRA 4F7ZA 4GXOA 3ZQ7A 3CJNA 3HRMA 3HYIA 5CVUA 5BOXA 1OYWA 5D5XB 1PP7U 5FB2A 4YIFA 3MEXA 3J81K 1EH8A 1F1ZA 1ODDA 4MTDA 2DT5A 5DD4A 3IKTA 3WGHA 3ZPLA 2XAGA 3K9TA 3ROUA 3W6KB 1BI2A 1XGMA 2OQRA 1OPCA 1UCRA 2HQRA 5E1ZB 1SD5A 2O03A 1YS7A 3GFLA 4A0ZA 1FBUA 4D0PA 3I59A 5ILUA 3CUOA 1FZPB 4EGYA 3JAMK 2IT0A 5EEHA 3GO5A 1HBXG 1SAXA 3HIFA 2HTSA 2EK5A 1S7OA 1RNLA 1BIBA 1QNTA 3AAFA 3M8FA 1RUNA 3RKWA 1ONVA 2RKHA 4XSZF 3GZ6A 3FX3A 2XGXA 3REOA 3JSOA 2RVCA 1ZN2A 1D8JA 2L4AA 2NS0A 4HX8A 2A6EF 4KMFA 4EM0B 3JTGA 2VC0A 3T8RA 3E6MA 3LA3A 2L02A 3B73A 5E8GA 2HKXA 5LBQA 4G6QA 2ZMEB 3EYIA 2FNPA 4IXAA 5IT9Z 3C18A 1B59A 2PJPA 3PQKA 1S29A 2FE3A 1FBSA 4MQVA 3HOSA 3LFKA 2LSOA 4G7HF 2EV5A 4UUVA 3B02A 2MH2A 4HF1A 4Y15A 3VB2A 2FQ3A 4HQMA 4R1HA 4LLLA 5DCMB 4L9VA 1R22A 4OIOF 4U7DA 2E7WA 5D5UB 1BI3A 2ESNA 4KICA 2VE9A 2G7HA 4KN7X 4KT5C 4GCVA 5LHHA 2P7VB 3NRVA 4LK0F 1IXRC 2ZMEA 3L2CA 2W24A 3LA7A 4S04A 4JK1X 3SZTA 4A2UA 1QPMA 2A3SA 4RGSA 1XDUA 3EQLF 3CLOA 3QOPA 1XSDA 3K1PA 2WTEA 4U88A 4A0XA 3N4MA 4L5IA 2VC1A 2NNNA 5KVRA 2LKPA 1U5TB 5LHIA 5HS7A 2V1DA 1FLIA 5HS9A 1YW8A 2MLGA 1STZA 1R23A 2XRNA 3TKYA 3E6BA 2KKOA 4ENMA 2P6SA 2Q0OA 1LDJA 3IWZA 1PUEE 2DQRA 3GX4X 2QYOA 3BJOA 4HF2A 1WKMA 3HUGA 2FBKA 2PBIA 2FSWA 2L4MA 4LFUA 2D1HA 3I58A 4R8HA 1HW1A 2DFIA 3WTSC 4G6DA 4MNUA 4L5JA 1O3RA 3F8FA 4M6YA 2VODA 3P9CA 4XBFA 3QU3A 2HDCA 1PP8F 1ZARA 2VT2A 2ZBKA 3LA2A 5BPDA 3KP6A 2DU9A 5ERIA 4IHSA 4RAYA 2O61A 3F8NA 4P96A 2P8TA 1XGOA 1IZ1A 1XSXA 2V1XA 2M8EA 1RUOA 4EM1A 1MKMA 2OAZA 4PDKA 5CJ9A 5A2QZ 2HYFA 3M1EA 2AXLA 1REPC 3ABTA 3SXYA 4OMYA 1Z7UA 2RDPA 1FYKA 1SFEA 1E2XA 1V3FA 2ADUA 4ENNA 3M7GA 1LB2A 3WTYC 6PAXA 4ON0A 1GVJA 3QU6A 5FLXZ 2PN6A 2QENA 4AWXB 1W5SA 2UXNA 3ZMUA 1F5TA 4HLXA 1X3UA 2VE8A 1C0WA 2Y0MA 2B0LA 3ELKA 1Y0UA 3L09A 2GIVA 2IRFG 3I53A 3C7JA 2OU2A 2K4JA 2PI0A 3GFMA 3DPTA 3KZYA 1FP2A 1LEBA 2HS5A 1I1GA 2LF8A 2F5EA 5FD5A 1U3EM 1T39A 1TTYA 2W25A 1CF7A 1YYVA 4KIFA 2V6CA 3N97A 1SD4A 3W6JB 4OINF 1ZG3A 1IRGA 4LB5A 4XLNF 1ZGAA 1ON1A 2KJCA 4R79A 2GXBA 2QQBA 5D4RA 3DF8A 3PQJA 3HHGA 4EM2A 2M45A 2COMA 5L3GA 2PQ8A 2A61A 4YIIA 3JW4A 4IPAA 4ESFA 2GXGA 5D5VB 5HDKA 4BYYA 2CGPA 4B8XA 2QBYA 5ICFA 3V7RA 2D1VA 2YU3A 4IRGA 1B9NA 3RKYA 1GHCA 4N9HA 3BPXA 2ZXJA 3HOTA 1TLHB 3O2PE 1U8RA 4AIHA 3FXRA 3F8CA 1WQ2A 3GEZA 3OV8A 4HAMA 1O57A 2EV6A 2VBYA 1G3SA 2FU4A 1FYMA 2VT3A 2QQ9A 1S8NA 2QZ8A 3GZ5A 2M30A 1U6GA 3CUQB 4IRHA 1VTNC 3DP7A 2Z33A 1ON2A 1JE8A 3P9IA 5F64A 1XB4A 1U5TC 4CDGA 5FO5A 2XIGA 1U2WA 2O3FA 3HSEA 2V79A 4Q48A 1SFXA 4UHTA 1H9GA 2E7XA 2BGCA 1IUYA 4B09A 1EV7A 1FT9A 2A6HF 2W84A 3P7NA 2DW4A 1I1SA 3HRTA 1BC7C 3IL2A 4G9YA 4S05A 5J6XA 1B1BA 1HKQA 2O8XA 3E3VA 3I59B 2IW5A 4HOBA 2AS5F 3MZYA 4P55A 1I6XA 4IHTA 1P92A 1R5GA 4A6EA 1LNWA 5LGTA 2EFPA 4M6XA 1I5ZA 1BM9A 5LLQA 2ISYA 1P4WA 1ZREA 5BPIA 1K78A 4LJZF 2HZTA 3CUQA 1LDDA 4CGZA 1HXDA 2DPUA 3GXOA 1YIOA 1UFMA 1MD0A 3QAHA 1W5TA 2R7DA 4ESJA 3FHZA 2OBPA 4GGGA 3TDUC 1AWCA 1LVAA 4PZJA 2IVMA 1YG2A 3RPUA 2GAUA 3FZVA 3GFIA 3ABUA 2Z99A 2DTRA 3R0JA 2JTVA 4EJUA 4EGZA 4RGUA 2KRFA 4M73A 4BH9A 2H6BA 3WTZA 4RAZA 1IAWA 2P7CB 2XHKA 4Y13A 2LF7A 2V1UA 1WSUA 2IJLA 3K2ZA 3SFZA 4ENJA 3EETA 4ASNA 3FMRA 5K5RA 3QP5A 5IT3A 4OMZA 2EWNA 1Z9CA 2XAJA 1HKSA 5DV5A 5ILSA 3KETA 3WTTC 1DP7P 3BDDA 2KJBA 2OZ6A 4HX7A 3KZZA 1OKRA 3KP3A 4EJTA 5L3BA 1T6SA 4P9UA 1ZGJA 4ESBA 2YPRA 4M71A 2QQAA 3L7WA 2MC3A 2MD5A 3DPLC 1R36A 1UB9A 5D6FA 3NEUA 3G3ZA 2VONA 3BZ6A 4FX0A 1W7PD 3P9KA 2E1NA 1Q1HA 3Q9VA 3F23A 1G3WA 1R1UA 5CVJA 4UVBA 5D4SA 5FD6A 3FXUA 4IF4A 2DAOA 2ACJA 1R00A 1LDKB 5HLHA 3WU1B 1GXQA 2EFWA 2E1CA 4L18B 3TQNA 4UVCA
chains in the Genus database with same CATH superfamily
3F8BA 2QLZA 4BXFA 5E1WA 3S1NJ 3ERED 3PSIA 3CESA 5IP6A 1S5LC 4RAFA 1Y0NA 4XORA 3FMQA 5F6FA 2PEXA 1OCTC 2FBIA 1O3QA 5JVTA 3HDDA 2WADA 5FKOA 4LG3A 4A3DJ 1VQNI 2JRTA 2Y75A 5LRRA 3L00A 1IRXA 5F1JA 1WI9A 2EZLA 1HA8A 3JREA 3AL0B 4A3EJ 3IWFA 2P5VA 4IJAA 4B47A 4HBLA 3I71A 5K7ZA 3V7SA 4A93J 3OS0A 4A69C 1SFOJ 2DA1A 1IO2A 2M7BA 3ZN0A 2QQ8A 2O6GE 3OYHA 3HKZN 2XPUA 5CKTA 3GW2A 1X1CA 4OU0A 2DK8A 2ZNYA 4FQGA 4PJJA 3K70D 1R9TJ 1ZRCA 3WODF 2P5KA 4Q47A 3HUGB 2MBFA 4E6KG 3PJRA 2O5RA 4P9FA 1E3OC 5EEGA 4IX7A 2M34A 3K4NA 2QA4I 2NVXJ 4OIPF 4PGHA 4DW6A 4OAZA 2NS8A 3CP8A 1S7AA 1AU7A 3OIQA 5CVIA 2EH3A 2EBIA 2EZIA 5LRSA 1O3TA 3IKVA 2HOEA 3F8MA 2R7WA 3M8EA 1MSEC 1WFXA 3HTUA 1ETXA 2LBFB 3CQZJ 1BBYA 4M9SA 1TNTA 3ABKH 1FOYA 4HX4A 4PFPA 3OY9A 2KHMA 5H20A 2M0CA 1QZZA 2L9VA 1P4XA 5H6QA 4NC6A 1MNMC 3OYBA 2LP0A 4C2TA 4Y4RA 4QIWN 1KU7A 3HRSA 2PMHA 2X6OA 4I09A 5ED4A 3QPHA 4I0AA 2MA3A 1MBJA 3BR1A 3MKWB 1Z1DA 2L9NA 3PO2J 4IHYA 5HLGA 1G4DA 5E20A 3BR5A 1SVOA 1HC8A 3QOEA 4ZC3A 2STTA 1UG2A 5D8KB 1WJ5A 4RB0A 1X4OA 3K4JA 1LQ1A 3TOAA 1TNSA 2Z2SB 5DEQA 1YTYA 1DPRA 2KFDA 4PJMA 3GYHX 5D6EA 3K1MA 2Y2ZA 1I3AA 3EUHA 3D1NI 3KLNA 4MTEA 1FYLA 2CFXA 5IY5H 3K10A 3VSLA 1XDSA 3ZXSA 4DZJA 3HSRA 4EJVA 1NK2P 4XOPA 1MJ9A 2HXOA 4E70A 5DDGA 3ISPA 2CO5A 3IV5A 3BCAA 1ZG1A 1IW7F 5LHGA 3EUAA 1F43A 5IYCJ 1OISA 3K0LA 1BIAA 1AHDP 2EINH 2KIUA 2V9VA 4B4CA 5HNHA 1XMAA 2VBXA 4PJ0C 4O6JA 1F4KA 3WG9A 1SC7A 1LUJB 4Y33A 3VFZA 1R49A 4DQ2A 2DCEA 1XMKA 2BHYA 1D1AA 4I01A 1OR7A 3OIPA 1P6RA 5K1YA 1O3SA 1NK3P 4CYCA 2YUSA 5E3NA 2D45A 3BY6A 3LQRA 5E8IA 3D5LA 3KZIC 5BS6A 4IVNA 2O0YA 1Z21A 2F4OB 3QWLA 1JXSA 2LBFA 3W2VA 3TBIA 2BY1A 5HVQC 5EYRA 5HLTA 3GLXA 4LLGF 3TO7A 2VB6A 2JUCA 3QPTA 3LSGA 5BMZA 3LWFA 2K3FA 2IAIA 5DUIA 5BQTA 5CVRA 1YW7A 1WJDA 1Z6TA 2J5OA 4U0WA 5J8FA 2QGUA 5IYDJ 3ESWB 2AHQA 1CF7B 4ANJA 4UNOA 4F52A 2KT0A 4F93B 5IT9K 2YX4A 3VDXA 2BW3A 3GTMJ 3HG9A 3I4PA 3VSKA 3ZMTA 2LY1A 4D1QA 5F08A 2EA2A 1YQAA 3LSIA 2DN0A 1ERDA 4FCYA 5EEAA 1YJWI 5EG0A 3VYUB 3ECHA 2WAQA 3OYCA 4FE7A 2DA4A 5F0FA 2HPMA 2FEZA 4OOIA 1T2KA 3D5RC 1IN6A 4XLAA 4UY8I 3WU0A 4BACA 1UELB 4CZCA 3CO7C 4B3AA 1FTTA 2NVYJ 2PMZN 2CS3A 2A68F 3DLAA 1BJAA 3A01A 2VQLA 2KL4A 2YR2A 1QGPA 2QSGX 1ETVA 2KZVA 3HEFA 4H0EA 2F5FA 2H27A 2QBYB 4MO7A 4HV6A 5FRMA 4QTRA 2V9KA 2DODA 3G1MA 2F5VA 3D5SC 1ZLKA 3GTQJ 4RLQA 3P5JA 4DBQA 4Z6YA 2CV1A 1NHAA 4PCQA 3F22A 4LG0A 1BOAA 2OF7A 3HRUA 1G2HA 3D0SA 3LAJA 5K5OA 2EJRA 1HW5A 4BAYA 2ETHA 2VOPA 2L7ZA 4UUTA 2J5PA 4ZYAA 4BXUA 1MJAA 4BJ5C 2W82A 1J9IA 1SFKA 4KIGA 3BTCA 1D8KA 2EA4A 4UB8C 2R93J 4I2OA 2ZMEC 3RDIA 1FMWA 2XB0X 3MWMA 2X6WA 1TQMA 2M87A 3W2AA 3HTSB 1ZG5A 2CYYA 2JPBA 1FWZA 1WJBA 2D2WA 1D1BA 1Z3YA 3E6DA 2EB7A 3H5RA 4NB5A 4BU2A 5L3CA 4G94A 5JHUA 4JBAA 4XRFA 3ZMVA 3FXLA 2AO9A 1PDNC 1UHSA 3NAUA 4FETA 4RB2C 2EFOA 1HLVA 1QZYA 2FXAA 2VBZA 2ZCWA 2DFFA 2LK2A 1JGSA 2GZWA 2IA2A 3OWTA 4AIDA 2FMYA 4KNYA 1VFCA 3WU2C 4QPOA 3ZRGA 1YO5C 2HR3A 3L2QA 2JA5J 2Y48A 2VKHA 3IRQA 1AOYA 3E1SA 1JKOC 3V4GA 4Y17A 3H36A 3RJPA 2P4WA 2VBWA 4GYIA 2QWWA 3PUFA 4PFOA 1ULYA 3KEQA 5TJJA 2VI6A 1VQOI 3WGIA 2HQNA 4CYDA 5K5QA 1RI7A 5GTIC 4CUGA 5HOOA 2K9LA 1PJRA 3EDPA 5J1UA 2ZXIA 1QPIA 2O7OA 3IAM2 3Q5FA 3J81Z 2X0LA 4Z2YA 2EIMH 2DDAA 3PFYA 5LGNA 1ZKGA 1IG7A 2YS9A 3L9FA 2VIXA 4P1WA 1RC9A 3TDZC 3ASOH 4GDFA 3GLLA 1WPKA 3V8JA 2XROA 2M5WA 4BNCA 4HEA2 2H6CA 1BN5A 2A69F 4AVPA 4D9JA 4EV0A 4RB1A 4ZTFA 5TISC 1LE8A 4IHWA 2UWMA 1XGSA 4UB6C 1V5FA 2K86A 2H94A 3JRGA 1X1BA 1I6HJ 1QU3A 4I99C 3OR2C 4A0YA 5C3EJ 5EZHA 3PL8A 5GPAA 4IRIA 5H6RA 3R0AA 3JAMZ 1IF1A 2H8RA 3NARA 3OMYA 2DLLA 5DD8A 3KFWX 5DTDA 1USSA 2W57A 2RQPA 1IN5A 3NWTA 3ML6A 3ABLH 2CQKA 1UHWA 2E2IJ 4OIQF 2DXIA 2FNAA 4KIBA 4HYEA 1K78B 2K7LA 3IHUA 3CD6I 4Q5SF 2R0QC 4AYBA 2ZJPF 3SHFA 4LLNA 4KT6A 4RMNA 1K4TA 1T33A 2RV8A 4HA8A 3DKWA 1ACIA 3I5UA 5ILVA 4E7JA 1L0OC 3CZ6A 4L5EA 5GTHC 5DYMA 3H92A 1FSEA 1LKXA 4XRMA 1OJLA 3M3YJ 5A2QK 2BY0A 4HQEA 4L9NA 2XB5A 3BPVA 4A3FJ 1ITYA 1MZBA 4G8XA 2IGKA 2NYXA 2ISZA 2R92J 2XGDA 4KMUX 4GYGA 3R6SA 2HWVA 1FOXA 3EYYA 5JR3A 2ZJ2A 2LNBA 3KP5A 2IEKA 3FM3A 4LK1F 1ZAOA 2V26A 3Q3SA 4WXHA 1YJNI 2ZFUA 3G73A 1IV8A 4LB6B 2M7AA 1FNNA 3PNTA 4XRSG 2CFOA 2EFNA 2JK3A 2JPCA 3AG4H 5GPCA 1EH6A 2BBYA 3QYFA 3EUKL 5L3DA 4KA4A 2HVRA 4WK8F 4MGRA 1MBGA 2XV4S 3SZPA 2ZSIB 3DEWA 4W1UA 5FLXK 1DP3A 3FK7A 2P81A 2P5LC 3BTJA 3HZJA 1WWXA 5KAFC 1JKRC 3HGGA 2VOOA 2LFBA 3HOWJ 3ZCOA 1J59A 1KYWA 1KA8A 4AUXA 4ETSA 4KFCA 2BHZA 5E3LA 4ZYEA 5ICCA 2KQRA 3MQ0A 1W0UA 1T38A 1WZ2A 5J40A 3LNQA 4XLPF 2Q8KA 4MEXF 1VQ7I 1R7JA 2ELHA 1U9OA 2DTZA 4ZYDA 2HDWA 1J5YA 4XONA 2WAFA 5DM6F 3WTWC 5HS8A 3BCBA 3H3ZA 3G4SI 2IS4A 3LAPA 3E6CC 4A5NA 1HSTA 2E5ZA 3CC2I 3H9JA 4LOCA 3TW7A 4RBOA 1VQMI 1W1WE 2E35A 4XR6A 2CG4A 3BG7A 3MN2A 4V2FA 4KITB 3HOXJ 4I6ZA 4BXXJ 3CTAA 3KP2A 3ZN1A 4YRVA 2O9LA 2NAZA 3T8TA 2ESHA 5CYVA 3I0TA 4M72A 3S3OA 5J4YA 1W0TA 3S1RJ 3TO9A 5GADJ 1JKQC 4XNFA 1UG0A 3JRAA 2IA0A 3BP8A 1TW3A 2DOEA 1MDMB 3HSFA 3RYPA 2UZKA 4AIJA 2BZTA 1NG7A 1J09A 1MMNA 1IDYA 2HPIA 2NOGA 1ZRDA 2GOXB 4RAGA 4NUBA 1VQ4I 1WVRA 5KHDA 5K7HA 4N0BA 1BR1A 5M3FJ 4ZH4F 3C2HA 3GTOJ 3IRRA 2I5UA 1R1VA 1TZLA 4FX4A 2HKOA 4PGGA 2H1KA 1MGTA 1LEAA 2M1BA 3V7CA 3J7YJ 2W7NA 4KISA 2VQHA 2Y0SA 3V42A 1TQPA 1RIOH 3CLQA 2K85A 2X48A 2R7ZJ 1HDPA 1P4AA 2GWRA 5M5YJ 4XIDA 3K4BA 5J8CA 3SJMA 1GXPA 4GO1A 2IP2A 4WF2A 3A0BC 1BC8C 2LDUA 2DFEA 3M4OJ 1XCBA 3LOCA 4I02A 1J75A 2R7UA 3BG3A 3DEUA 3CCYA 4QPQA 2K9NA 2Y69H 3FHNA 3R4KA 4ZZLA 3DPUA 1R5ID 2OZUA 1SVMA 2IA1A 4IKFA 1X3ZB 4CA0A 4CO8A 4F55A 1WGXA 4A12A 4HLYA 4ZYGA 4HZFA 2WV0A 3SYTA 2MLKA 2R3SA 3A0HC 2CU7A 4A6DA 4XN3A 1VQPI 5JHFA 1GT0C 2L01A 1MJBA 4D5FA 3I54A 4M3FA 1TW2A 1ZR2A 1WH7A 2OCCH 4RGXA 3BOQA 2FJ1A 4RA2A 1J0RA 2LRDA 4M3EA 2PLYA 1RKTA 2JA2A 1X58A 2WB1N 4QLCU 1N78A 4CZZA 2ELKA 2K5CA 1MDMA 2DQLA 1IUFA 1XGNA 1T95A 2R7FA 3E5XA 3KX2A 3KE2A 2QVOA 1S72I 5DM7F 3W3CA 2VXDA 3ZR8X 2GIZA 1KGSA 1ZELA 3Q0UA 4E7HA 5GAHJ 3MCZA 2BEOA 3OYMA 3FK6A 2FBHA 2XKPA 3JRBA 1E17A 3ZQGA 2ZKZA 1YS6A 2CJJA 1MBKA 1KU2A 1Z05A 1MH3A 3H0DA 1DDNA 4HF0A 3WE3A 2HYJA 3NQOA 1OMIA 4I0BA 4K2EA 3UNGC 1K6OA 1JUPA 3KLOA 3F0CA 3JRIA 4EMSA 1TQIA 2XAHA 4GRIA 3BTIA 2C6YA 2E1MB 2GA1A 4JYKA 2GQQA 1ZQ3P 2K27A 2Z16A 3VOEA 3BG9A 3V8LA 5JI6A 9ANTA 4EQQA 4CCKA 2CQXA 1FTZA 4C3HJ 1ETOA 1RKWA 2LD5A 2CUFA 1ZH5A 1R5HA 2ECCA 1QO0D 2GA2A 4M9ZA 2KIFA 1B4AA 1XSVA 1K4SA 1QVUA 2MW8A 4UV8A 3J80Z 1BA5A 1WJAA 2X4HA 3I64A 2G9WA 3CCUI 1WI3A 4M74A 3PO3J 4MHGA 1OLTA 3QODA 3S2WA 1LFUP 1OCRH 4MIMA 3U21A 5B66C 4LMYA 2PMUA 1E3HA 5IPAA 1FC3A 2ME0A 1XG1A 2HXIA 1Z0XA 2CUZA 3R61A 2STWA 2RNJA 1WH5A 3MAJA 1T08B 1GV5A 3OOUA 2MYSA 3X2QH 2VN2A 2DO7A 4BQQA 3CUQC 2QM3A 3CMMA 1KYZA 5E1XA 4BKXA 1R1TA 2BXYA 4EJOA 5D8LB 3RKXA 4BHCA 1QBJA 4LGWA 1JHHA 3HXLA 1KU9A 2Z5UA 5HODA 3KEOA 2DJIA 2K4BA 5B1AH 3DKYA 1ETYA 1A04A 2Z3YA 3VYSB 4HV5A 4MEYF 5F1RA 4X0GA 2FUG2 3E5UA 5JFRA 3HOVJ 4I7HA 3LQQA 2R5ZA 2JWTA 1WRJA 3FBNB 4HG2A 5LEKA 3QP6A 1Z7LA 1UJ8A 1LJ9A 4G6TB 1HKTA 3GTGJ 4P5OA 2VUMJ 4DNCA 3VYTB 3QRFF 3OSGA 1CGPA 1LPQA 2BY2A 4E7IA 3DBLB 2YSRA 4CYCB 4YIRX 4FHTA 2HFHA 2E1OA 2L2OA 4HPQA 4XLFA 4S0HB 1JKPC 2A05A 1ZYRF 2DDBA 2XF7A 1T98A 1HW2A 1D5VA 5CLSA 1GDTA 1K79A 1SVLA 2EQRA 3FXMA 2Z9OA 3RPQA 3FXOA 2WY8Q 2A6TA 4ZYHA 3ULQB 4M3GA 3WGGA 1K6YA 1S9HA 4RB3C 2M3AA 2XSDC 4XLEA 4CCOA 2FD5A 5C4JJ 2BW3B 3E97A 5FRNA 2A5YB 1MMGA 3WTXC 2PX9A 4JQFA 4Y7NJ 2R7SA 3L2RA 4UXNA 5E3OA 3C1DA 5EJCA 1KQ9A 5TRDA 1FY7A 2MG4A 3RIRA 1SMTA 1D3YA 1EKEA 3CO6C 4KN4X 5D5WB 5EG0B 3O6BB 1HSJA 1P7JA 1KQ8A 1RR7A 3FXQA 4EVIA 1XS9A 3GTKJ 4CCLA 1ZLJA 2LVSA 4HDVA 3SQNA 2L3DA 1O7LA 3RQ4A 4OIRF 4X6AJ 2DYRH 2BOLA 3K69A 1PVEA 3HL2A 2FOKA 3DKXA 1Z6RA 3A01B 2PJRA 2HQAA 2F5DA 2WAEA 3GTLJ 1SFUA 2LKSA 4N4NB 4L0YB 3DXJF 2ZO4A 2JA8J 1T0FA 2FRHA 1L3LA 3FKIJ 2K9MA 1XD7A 2UXXA 2CSOA 5HLIA 3IC7A 2KMUA 2ZJRF 1XCVA 2JSPA 3H3UA 3M9AA 2ZNZA 4LG0B 3TO6A 4HDUA 5DCMA 1Y8QB 4HW0A 3ZGKA 4XKCA 2B7EA 3DCFA 1TT0A 2MC4A 4U0YA 1KQ0A 5E18F 3JSPA 3LSTA 3I4MJ 2XVCA 4L9TA 2FF4A 3F6VA 5KNLA 2YX7A 4LD5A 2EZKA 2XGEA 4G7OF 1CQTA 3W6VA 3DTKA 3RTRA 1EH7A 3ZQLA 1SMYF 3DQVC 3PIPF 5HDGA 4AD9A 4XKBA 2EPFA 1OQYA 2OD5A 3TMOA 3DFGA 1DPUA 2VXZA 3CJRB 2Y9YA 3IH3A 1FIAA 4X1EA 2BV6A 2HVQA 1NH3A 2NNYA 1TWFJ 2RREA 2BE5F 5AIQA 3PFIA 4E4HA 1BR2A 2R7OA 2VJJA 5FLMJ 4G7ZF 4I98B 2VLAA 3E0JB 4FT8A 4WX9A 1YLFA 5F0HA 2G7UA 4HNVA 3DV8A 2F2EA 4A3MJ 1DUXC 2FA5A 3JRFA 1S6LA 3J80K 4A3JJ 2CH0A 2B63J 1HF0A 1FPQA 1UHMA 3DEEA 4J19A 3WE2A 3RZDJ 2FQ4A 4IOAF 1MMDA 4AU7A 2Y31A 1YI2I 2H1LA 5HDNA 2QCOA 2HGCA 2H8WA 1U5TA 1FSHA 1G3YA 4KYWA 1MIJA 4C9YA 1XPXA 3PNVA 4L9JA 3UKGA 3OYAA 3S2DJ 5CQGA 2F6CA 3JR9A 2XAFA 1FOKA 3CP2A 4XQFA 1EJ9A 1K83J 4BE0A 2NRAC 3CDLA 4E7SA 4B3XA 4JOMA 1I3QJ 1G8XA 3KP7A 2Y9ZA 4A5MA 1JHFA 4IO9F 3VODA 2XKOA 3SZGA 1A6QA 5CVVA 3L1PA 3F6OA 2AQEA 3TP0A 2W85A 2LC2A 3C3WA 1LE8B 2DA2A 4YFXF 3FF5A 1HQCA 4JX6A 4BQAA 1D0XA 2NOJB 2H09A 5FGMA 1G6NA 2IGNA 3GBGA 4AIKA 2HYGD 1B9MA 2L54A 5DCFA 3O8HA 3GF2A 5L3FA 1FBQA 3WHCA 3S3NA 3IAS2 5EGOB 2DI3A 1V54H 2K02A 3JRDA 3O3KA 4IQJA 1JTYA 1USTA 4YFKF 1BJZA 4LIUA 1SEUA 3T1BA 1U78A 1H9TA 3MFKA 2E1MC 4WWCA 3SDGA 3JTHA 3FMSA 4BBRJ 2I10A 1YFHA 3BJAA 3ZQFA 4M6VA 4UV9A 2E5NA 1IDZA 3U1DA 1IN8A 1ETKA 4NHJA 4QWQA 2LTPA 2CW0F 2IPQX 1IN7A 2PFBA 2V9PA 1BI1A 3OOPA 2GM4A 1P2FA 3K4CA 4V19K 1O7FA 1R58A 2XASA 2XAQA 3DBRB 3ZMDA 1HOMA 1UMQA 1U0JA 3FXKA 2KPMA 1SD6A 4BL0B 4BY1J 1D5YA 3QYEA 2OPTA 3HC7A 1FIPA 4V2GA 3KCCA 5FFZA 4UVAA 2IS1A 4XL9A 2NVUB 1TWAJ 3CDHA 4M9XA 1RPWA 2ECBA 3AL0C 3F3XA 1OYYA 2DA5A 3HB9A 3T0YA 2VL8A 3TW6A 1IXSB 1PYVA 3K1NA 3RI4A 5ICEA 4O5VA 3GFJA 4YFNF 2ID6A 1POGA 4BHBA 3EUHC 2FMLA 3LSPA 1KZHA 4RGRA 1R4NB 5LD2C 3KP4A 2F5CA 2DFHA 2FOWA 5HNFA 3BR2A 3A1YA 4BJTA 2W00A 5AONA 3VPRA 1ZHFA 2E2HJ 1JJ6C 1HDDC 1UAAA 4YG2F 5H2FC 3HM5A 1B6AA 2QUFA 3GWZA 1JUSA 2DA7A 3U9GA 4RDUA 3OYJA 5J1RA 3FM5A 3M1CA 4RS8A 3MKYB 4CHUA 3H1CA 2M0MA 3U2RA 2WWYA 2HTJA 2HOTA 2OQGA 2Q2EB 1FX7A 5DUKA 4MFEA 2BYVE 1QQIA 3ECOA 3R60A 1OR7C 3V8KA 4BHPA 1W4MA 1XN7A 1W7PB 2ZXWH 3G1LA 4C2MJ 5DS9A 4NQWA 5EGOA 1G59A 4DYRA 3K6GA 4DBRA 4ZDOA 2CV2A 2PG4A 3HKZA 4D7NA 1RZ4A 3WTUC 1BOBA 1QRYA 3T5XA 1ZRFA 4O3MA 5LEJA 3WG7H 4XM3A 1IRFA 3E5QA 4CCNA 3H0GJ 1K61A 4XSXF 3AG2H 1I39A 2EFQA 1B8IA 1IXCA 2MH9A 1FOWA 4XK4A 2V6EA 3CCSI 1MMAA 3S17J 4Q4ZF 3FWEA 4WXDA 3TOBA 2A07F 1SD7A 3CCJI 3ZMZA 2TDXA 3B6AA 2E34A 2XAUA 3VEPA 3GVAA 2ZXHA 1S3JA 5E17F 2BY3A 1BR4A 4F91B 3S16J 1YITI 1VQ6I 3HHHA 3K7AJ 2RQQA 4M3DA 3ASNH 4CICA 3BROA 4XOTA 5C4XJ 2JZYA 5ICGA 3G71I 3HPHA 2RGVA 5GAGJ 1F9NA 3BQYA 2CMPA 2JSCA 5FLVA 3VWBA 5B3SH 4EJWA 4CXFA 4E7KA 1NTCA 4A3KJ 2WC2A 3BWGA 3S8PA 3ZMSA 1X2NA 2Q1ZB 1T8IA 3F9KA 1KONA 2KDOA 2Q2EA 3Q9SA 2W4SA 2FX0A 1H0MA 1FP1D 2LREA 3BJ6A 1V4RA 2EV0A 1N77A 3BQZA 3GUDA 2K9SA 2V1NA 1F36A 3L2UA 2DBBA 2QF7A 1G3TA 1TBXA 1W7PA 2DPDA 1A6IA 3FBIB 4KDPA 4FASD 1H88C 4N9IA 4L0ZB 2RN7A 2KIQA 2RC4A 3ZP5A 5LGUA 1BI0A 1ENHA 3HPGA 4Y52J 5FFXA 2ZFWA 4WXCA 1WJFA 2Z1DA 4U0VA 1IRZA 3WTVC 3RKQA 5J47A 4BE1A 1J7KA 1OYIA 3CCRI 1MNEA 4MQ9F 2X85A 1VQ5I 2JUGA 4ENKA 5L3EA 2R5YB 3F21A 3OYKA 5KK1A 3CDIA 4ZZDA 4WCGA 2HEOA 4TV7A 2CWEA 4E7ZA 5B5EC 3J7AO 3ERMA 1W36C 2P6TA 2DK5A 3S14J 2X1DA 3S15J 3F72A 3TGNA 3MZHA 2DMUA 4NC7A 5AIPA 2LKXA 1SAUA 1J2XA 2KIMA 3I4NJ 4KUMA 3KYCB 3K4KA 3CJQB 2HI3A 3CCVI 1HCRA 1Z67A 2JT1A 3M8JA 4YEJA 3COAC 1IN4A 4U7BA 1PUFA 1Z91A 1Q1VA 1KU3A 4UUSA 2X6YA 2E71A 2OA4A 1I27A 1K7AA 2XUBA 1YW9A 5FROA 3RYRA 4F7ZA 2WY7Q 3H9GA 3S93A 3L2WA 4GXOA 3FISA 3ZQ7A 3CJNA 3HRMA 1JT6A 3HYIA 5CVUA 4E7LA 5BOXA 1OYWA 5D5XB 1MBFA 3KPHA 2E2JJ 1PP7U 5FB2A 1MMSA 4YIFA 3MEXA 3J81K 3GCMA 1EH8A 1F1ZA 1ODDA 4MTDA 2DT5A 5DD4A 1QVTA 3IKTA 3WGHA 2ID3A 1APLC 4J01A 3ZPLA 2XAGA 3K9TA 3ROUA 5F0CA 3W6KB 1BI2A 2OUMA 1XGMA 3HOZJ 1QHHD 2OQRA 2HQ5A 3LSMA 2QSHX 1OPCA 5FKKA 1UCRA 1A36A 3S1MJ 2ZSHB 5E3MA 2HQRA 2WAQN 5E1ZB 4DZPA 1SD5A 2O03A 1YS7A 3CC7I 2W1OA 3GFLA 4A0ZA 2HOSA 1FBUA 2IBDA 2PMZA 3I59A 4D0PA 5ILUA 1OCZH 4HNUA 3I56I 1YRNA 3L2VA 3CUOA 1ZK8A 2LMDA 1FZPB 4EGYA 3CMAI 3JAMK 4DYQA 1P7IA 4LIVA 4ITVA 2IT0A 3OL3A 5EEHA 3H35A 2R5YA 2TCTA 3GO5A 1HBXG 1SAXA 1TT5B 4FTHA 1V5GA 5EF6A 2CW8A 1WHUA 3HIFA 2LYCA 2K40A 3RCOA 2HTSA 3A4CA 2EK5A 2RNGA 1VZ0A 1LVKA 4DJAA 1U8BA 3CC4I 2E36A 4A3BJ 1S7OA 3MMYB 1RNLA 1BIBA 2DA6A 2IGOA 3MKLA 2UUZA 1QNTA 3AAFA 3M8FA 1RUNA 4XICA 3RKWA 3I9V2 1ONVA 2RKHA 4XSZF 3DTIA 2UV1A 4BS9A 2R5ZB 3GZ6A 3FX3A 2VPRA 2XGXA 3REOA 3JSOA 3H3VK 1YHQI 2ZB9A 2RVCA 4XN0A 1ZN2A 1YOVB 1Z77A 1BW5A 3EPZA 5IOZA 2L4AA 1D8JA 5IOYA 3AFHA 2NS0A 2DOFA 4HX8A 1GUUA 3ONQA 2F4MB 2DYSH 2F4IA 1GV2A 2A6EF 4KMFA 4EM0B 1Z3XA 1Y1WJ 3JTGA 3SDBA 3HOUJ 3RQIA 2VC0A 4II3A 3JRCA 3T8RA 2R7TA 3E6MA 3LA3A 4PSWA 1IC8A 2L02A 3CF2A 3ABMH 1DQUA 2KDZA 1V5EA 2MFZA 3B73A 1EF4A 5E8GA 2XC7A 2HKXA 2F48A 4PK4A 5LBQA 4G6QA 2ZMEB 3EYIA 4CSWA 5LFAA 2XF6A 2FNPA 4KJZA 3SFIA 3U1KA 4RM2A 4IXAA 4BEHA 5IT9Z 3G2BA 3SEZA 3C18A 1B59A 2PJPA 3FXJA 2EILH 4ZDLA 3PQKA 1S29A 2FE3A 5EZGA 1FBSA 2JMWA 4II2A 2VQGA 4MQVA 3HOSA 1X1AA 4HNTA 3LFKA 1TL8A 5FKMA 2DMNA 2LSOA 4OAYA 3M07A 4G7HF 2EV5A 4UUVA 3B02A 1RETA 1JT0A 2PJRB 3RPUD 2VKVA 3GZNB 2MH2A 2O8KA 2EZHA 4HF1A 4CH7A 4IZZA 2ELJA 4Y15A 3VB2A 4DIQA 2FQ3A 4HQMA 5KCMA 4BJ6C 3OIOA 3BZCA 4JX5A 1Y56A 2YU9J 1JJ8C 4R1HA 4LLLA 1O4XA 2LY2A 5DCMB 4L9VA 3DWLE 1R22A 2L9RA 2WA0A 4OIOF 4U7DA 2NVTJ 1LFBA 2IGMA 2E7WA 5D5UB 2I8DA 3AG3H 1BI3A 3DU6A 4NBQA 4BUPA 2X1EA 1TC3C 2X51A 2ESNA 4KICA 3UR3C 2DJNA 4A3IJ 2DT6A 1Y1VJ 2JVGA 2VE9A 4IQ4A 4AYBN 3K70C 4GFBA 2G7HA 2LG4A 4KN7X 4QSHA 4KT5C 3CMYA 4GCVA 1Y8RB 4RLFA 5LHHA 2P7VB 5J4VA 3NRVA 3IUOA 4LK0F 3S2HJ 2GBYA 3KYDB 1IXRC 2ZMEA 5FJ8J 3L2CA 3JCUC 2W24A 3LA7A 4S04A 2CW7A 4JK1X 3SZTA 2JJ7A 4A2UA 1QPMA 2A3SA 4RGSA 1YIJI 1XDUA 3EQLF 3CLOA 3BZKA 4HRIA 3OYDA 3QOPA 4IHVA 1XSDA 3K1PA 1FJLA 2WTEA 4U88A 4A0XA 1VI0A 2M4KA 5KAIC 3N4MA 4AM3A 3ZQCA 4L5IA 2MABA 3BC8A 2VC1A 4C2UA 2CUJA 2NNNA 5KVRA 4FE4A 2LKPA 1U5TB 5LHIA 1B72B 3TEDA 5HS7A 2VKEA 2R7QA 5GAEJ 3ZOBA 4ZDPA 1BW6A 2L7KA 2V1DA 1FLIA 4F92B 5HS9A 1YW8A 2MLGA 1STZA 1R23A 2NVQJ 1Y6IA 2DOAA 2XRNA 3TKYA 3I55I 3E6BA 3NWSA 1GLNA 2CQNA 2IXSA 2KKOA 4ENMA 2XRLA 3H5NA 4XLCA 2P6SA 4B48A 1MBHA 2Q0OA 3HGYA 1LDJA 3IWZA 3Q0WA 2VQCA 1PUEE 2DQRA 1OCPA 1WJEA 3GX4X 2QYOA 3BJOA 4HF2A 2HDDA 1WKMA 3G1OA 3DTEA 4M3BA 3A2KA 3HUGA 3K4MA 2FBKA 3ZQQA 2PBIA 2FSWA 2JA7J 2V4JC 2AQFA 2L4MA 4LFUA 4BY7J 2D1HA 3I58A 4R8HA 4W97A 1HW1A 2DFIA 3FKJA 3WTSC 2R7VA 2HU9A 4G6DA 4MNUA 4L5JA 4B44A 3G6EI 1T56A 1O3RA 3F8FA 4M6YA 3ZQHA 2VODA 2OTJI 3P9CA 4XKVA 4XBFA 3CCMI 1R71A 3QU3A 2NXNB 3W2WA 5F04A 4BDYA 1DU0A 4H4KC 2HDCA 1PP8F 1ZARA 2VT2A 2CQQA 2ZBKA 3E7LA 3LA2A 1JTXA 5BPDA 3KP6A 4CCMA 2DU9A 1UZCA 5ERIA 3OYIA 2BXZA 3O8GA 1H89C 4IHSA 4RAYA 2O61A 3F8NA 4P96A 1NG6A 2P8TA 1XGOA 2Y30A 1IZ1A 1XSXA 2V1XA 2LY9A 5JVGF 2KRHA 2M8EA 1RUOA 4EM1A 1MKMA 1VQ9I 4HSRA 3CMEI 2OAZA 1B72A 4PDKA 5CJ9A 2XF5A 5J1YA 5A2QZ 2ZC2A 2HYFA 3M1EA 3QYBA 3OYGA 2AXLA 2E19A 4IEJA 1REPC 3ABTA 3SXYA 4EATA 4OMYA 1Z7UA 2RDPA 2Y0SN 2HZDA 1FYKA 1GVDA 1SFEA 1RRJA 1E2XA 1V3FA 2ADUA 1XX5A 2QEXI 4ENNA 2M8GX 3KYLA 2OJED 3M7GA 4Y3OA 5K7FA 1VQKI 2E60A 1LB2A 2A5WA 3WTYC 5E79C 1A5JA 1ZGWA 6PAXA 4ON0A 2V7FA 1GVJA 3QU6A 1H8AC 1WCMJ 4B43A 5FLXZ 3N05A 2PN6A 2QSFX 3DBHB 2QENA 4AWXB 1W5SA 2UXNA 3AG1H 3MVPA 4NQWB 1OCCH 3ZMUA 4BDZA 1ZTRA 1F5TA 3LMMA 2OCEA 1X1DA 4HLXA 1X3UA 3BR6A 2VE8A 1C0WA 2Y0MA 2B0LA 3OSFA 3ELKA 1Y0UA 4D5CA 3L09A 4IL6C 4RM3A 2GIVA 2IRFG 3I53A 3C7JA 2OU2A 2K4JA 2PI0A 3GFMA 3BG5A 3DPTA 2WB1A 4J00A 2LH9A 4U87A 3KZYA 1FP2A 1LEBA 2JN6A 2BVMA 4D7MA 2HS5A 1B8IB 1I1GA 2LF8A 1TWCJ 2F5EA 2XSJC 3QPSA 2TRTA 5FD5A 1U3EM 2JRMA 5EDNA 1ORKA 1T39A 1TTYA 2XPVA 1D0ZA 2W25A 3FIWA 3J7ZI 3CCQI 2BVLA 1CF7A 2KZGA 1YYVA 3A02A 4KIFA 2HNHA 2ZJQF 2V6CA 1VNDA 3IP4B 3N97A 1SD4A 1FMVA 4OINF 3W6JB 1ZG3A 3TL4X 1IRGA 3H5AA 1D1CA 4LB5A 4XMYA 4XLNF 4AVZA 2R7XA 1ZGAA 2EIKH 1ON1A 2KJCA 4R79A 2OTLI 2GXBA 2QQBA 5FKLA 5D4RA 3DF8A 3PQJA 1S7EA 3HHGA 3PUBA 2COBA 4EM2A 5M5XJ 2M45A 2COMA 3SEQA 1YJ9I 3OYFA 1T0FC 5L3GA 1FEXA 3S3MA 4PUSA 3PSFA 2PQ8A 2A61A 4YIIA 3JW4A 4IPAA 4ESFA 4I76A 2GXGA 5D5VB 2VKDA 4PJLA 4F3QA 4NNJA 2M2EA 5HDKA 2K3PA 3BLYA 4BYYA 2CGPA 2LOOA 4B8XA 3DLLF 3DU5A 1P9QC 2QBYA 5ICFA 3V7RA 2CUEA 1ETQA 2OV7A 3Q0VA 5M3MJ 2MD0A 2IS6A 1D0YA 2D1VA 1TP4A 2YU3A 4A3CJ 4IRGA 1MH4A 1B9NA 2KISA 3RKYA 1GHCA 4N9HA 3BPXA 2ZXJA 3HOTA 3BR3A 1TLHB 3CJTB 3HBLA 1YE9A 1MBEA 3O2PE 2N8GA 1U8RA 4IHXA 1TWHJ 1X3WB 4AIHA 3FXRA 3F8CA 3FDYA 5FKNA 3AKZA 1ZR4A 3GMEA 1WQ2A 3GEZA 4DOZA 3OV8A 1AKHB 1QZEA 4HAMA 3H9QA 1DU6A 1E3PA 2L7FP 2GLOA 2HVSA 4A3GJ 1O57A 2EV6A 2VBYA 1G3SA 2FU4A 1FYMA 2M9HA 2VT3A 2QQ9A 1S8NA 2QZ8A 3GZ5A 4YELA 2P0WA 2M30A 2GOMA 1A31A 1RR8C 1U6GA 2JA6J 1N25A 1R4MB 3CUQB 4IRHA 1VTNC 3DP7A 3QPLA 3ZQIA 2Z33A 3K2AA 5JLXA 1ON2A 1JE8A 3P9IA 4CCJA 1MNDA 5F64A 3LSRA 1XB4A 1JGGA 1U5TC 1MW7A 1EA3A 4CDGA 1PUFB 1JUMA 4UUSB 1RESA 5FO5A 3RZOJ 3S1QJ 2G0EA 2XIGA 1U2WA 3MKZA 3GTPJ 2O3FA 4BE2A 1WJCA 3PM1A 5F27A 3HSEA 2V79A 4Q48A 1SFXA 4UHTA 1H9GA 2E7XA 2BGCA 2GXAA 3LL7A 1IUYA 4B09A 1EV7A 1FT9A 2A6HF 2W84A 3P7NA 2DW4A 3PNYA 3OS1A 3C2BA 1I1SA 4B1RA 3HRTA 5CPRB 2MSYA 1BC7C 3K4LA 3IL2A 1BL0A 4XRSA 4G9YA 4S05A 4HSTA 2W48A 1IJWC 1QA6A 5J6XA 1B1BA 4EEFG 2LR8A 1HKQA 2O8XA 3LSHA 5J3LA 3E3VA 4PSXA 3I59B 2IW5A 4HOBA 2B9SA 2L9SA 4MFDA 3C2GA 1YRNB 1X2MA 2K9QA 5CQEA 3KIOA 1YX3A 2WBMA 2NS7A 2ME6A 2RAEA 1MSFC 2AS5F 1AKHA 2X9DA 3MZ8A 3MZYA 4P55A 2HOAA 1I6XA 4C3JJ 4IHTA 1P92A 1W36D 1R5GA 4G12A 3S32A 4A6EA 3BR0A 1TWGJ 2VASA 1IV6A 4BGDA 1LNWA 1M1EB 5LGTA 5M5WJ 2EFPA 4M6XA 1SANA 1JI8A 2XPWA 1YX5A 2DT7B 1I5ZA 1BM9A 3OL4A 5LLQA 2IS2A 2ISYA 1P4WA 5B1BH 1ZREA 5BPIA 2JVHA 1K78A 4LJZF 2D5VA 2HZTA 1A35A 3CUQA 5IYBJ 1LDDA 4CGZA 1HXDA 3CF5F 3CCEI 2DPUA 3GXOA 1XMXA 5BNGA 1YIOA 2R4GA 1QHGA 5GP9A 1UFMA 2M4GA 1MD0A 1U9NA 3QAHA 1W5TA 2R7DA 2VJ4A 4ESJA 3FHZA 4ZTJA 2OBPA 3KEYA 4GGGA 3TDUC 1AWCA 2XDVA 4JX4A 1LVAA 4NC8A 4PZJA 3JRHA 2IVMA 2WV1A 1VQLI 1YG2A 3LSKA 3B6CA 4PJNA 3RPUA 2GAUA 3FZVA 1X1PA 3GFIA 3ABUA 1R6RA 2Z99A 3OYLA 2DMTA 2DTRA 2KRCA 2CQ7A 3R0JA 2JTVA 3TP3A 4ZJZA 4EJUA 1W5CC 4EGZA 4RGUA 2KRFA 4M73A 4BH9A 2H6BA 2VJIA 2X6XA 4RAZA 3WTZA 1IAWA 2P7CB 1VQ8I 2XHKA 4FISA 3BTLA 4JP0A 2EIJH 4Y13A 3IH2A 4N4OB 2R7RA 1I50J 3WHBA 2LF7A 2V1UA 3J7AY 1WSUA 2IJLA 2L5QA 3OR1C 3GTJJ 4BEHB 3K2ZA 3SFZA 4DYCA 4ENJA 2CRGA 2QKMB 3EETA 4ASNA 3FMRA 5K5RA 1X4PA 1X19A 4OWRB 1V55H 3QP5A 5IT3A 2ICWG 4OMZA 2DMQA 1AA7A 1XC5A 2EWNA 1Z9CA 2MGQA 2OC6A 2XGCA 2XAJA 1HKSA 1VF9A 4BQNA 5DV5A 2VPLA 5ILSA 1E0EA 3KETA 1IGNA 3OYEA 3WTTC 1DP7P 3BDDA 3BG6A 2KJBA 4ABZA 1Y39A 2OZ6A 3QQAA 4HX7A 3HJEA 3KZZA 4BBSJ 4XKWA 1OKRA 4AC0A 3KP3A 1LFPA 4DGWB 4A3LJ 3OYNA 2X1CA 4EJTA 4IOCF 5L3BA 1XTAA 1T6SA 4P9UA 2L0KA 3BT9A 4MLOA 1ZGJA 4ESBA 2YPRA 4M71A 2QQAA 4C3IJ 3L7WA 2CV0A 2MC3A 2MD5A 3DPLC 1R36A 1UB9A 3VYRB 2DMPA 5D6FA 3NEUA 3G3ZA 2VJ5A 3PIOF 1OCOH 2VONA 3A03A 3BZ6A 3RSNA 4NDLA 4BQOA 1N75A 5IP7J 4FX0A 3OS2A 1W7PD 2KLOA 3P9KA 3CCLI 3MD2A 2E1NA 1Q1HA 3Q9VA 2JQ7A 3F23A 2LLKA 2DA3A 1ETWA 1G3WA 5JLWA 5TGTA 1R1UA 3I3LA 5CVJA 4UVBA 5C44J 3IH4A 3HOYJ 2L7MP 4XLHA 5D4SA 5FD6A 3FXUA 4IF4A 1DGRM 2DAOA 2QKLB 2ACJA 5IP9J 1R00A 3LSJA 4LITA 2AXTC 3LFUA 4C30A 1LDKB 5HLHA 3WU1B 1GXQA 2EFWA 2KP6A 2E1CA 1DGWY 4L18B 1OFCX 3TQNA 4UVCA
chains in the Genus database with same CATH topology
3F8BA 2QLZA 5E1WA 3ERED 5F6FA 3FMQA 2PEXA 2FBIA 1O3QA 5JVTA 2JRTA 2Y75A 5LRRA 3L00A 1WI9A 3IWFA 2P5VA 4IJAA 4HBLA 3I71A 3V7SA 3ZN0A 2O6GE 3GW2A 4OU0A 2DK8A 2ZNYA 1ZRCA 3WODF 2P5KA 4Q47A 2MBFA 4P9FA 5EEGA 4OIPF 4PGHA 1S7AA 5CVIA 1O3TA 5LRSA 3IKVA 2HOEA 3F8MA 3M8EA 3HTUA 1BBYA 4M9SA 1TNTA 4HX4A 5H20A 1QZZA 1P4XA 5H6QA 1KU7A 3HRSA 2PMHA 4I09A 5ED4A 3QPHA 4I0AA 2MA3A 1Z1DA 5HLGA 1G4DA 5E20A 2STTA 5D8KB 4RB0A 1LQ1A 3TOAA 1TNSA 5DEQA 1YTYA 1DPRA 3GYHX 5D6EA 3K1MA 3EUHA 4MTEA 3KLNA 1FYLA 2CFXA 1XDSA 3HSRA 4EJVA 1MJ9A 4E70A 5DDGA 3ISPA 2CO5A 1ZG1A 1IW7F 5LHGA 3K0LA 1BIAA 2KIUA 2V9VA 1XMAA 2VBXA 4O6JA 1F4KA 3WG9A 3VFZA 4DQ2A 1XMKA 4I01A 1OR7A 1P6RA 5K1YA 1O3SA 2D45A 3BY6A 3LQRA 5E8IA 3D5LA 5BS6A 4IVNA 2O0YA 1JXSA 5HVQC 3GLXA 4LLGF 3TO7A 3QPTA 5BMZA 3LWFA 5DUIA 5BQTA 5CVRA 1YW7A 1Z6TA 2J5OA 4U0WA 5J8FA 1CF7B 4UNOA 5IT9K 2YX4A 3I4PA 3ZMTA 2EA2A 1YQAA 3ECHA 2FEZA 4OOIA 1T2KA 1IN6A 3WU0A 3CO7C 2A68F 1BJAA 2YR2A 1QGPA 4H0EA 2F5FA 2H27A 2QBYB 4HV6A 1ZLKA 1NHAA 4PCQA 3F22A 4LG0A 1BOAA 3HRUA 3D0SA 3LAJA 5K5OA 2EJRA 1HW5A 4BAYA 2ETHA 2VOPA 2J5PA 4BXUA 1MJAA 1J9IA 4KIGA 1D8KA 2EA4A 4I2OA 3RDIA 3MWMA 1TQMA 2M87A 3HTSB 1ZG5A 2CYYA 2JPBA 1FWZA 2D2WA 3E6DA 2EB7A 4NB5A 5L3CA 4G94A 5JHUA 4JBAA 4XRFA 3ZMVA 1PDNC 4RB2C 2EFOA 1QZYA 2FXAA 2VBZA 2ZCWA 1JGSA 2GZWA 2IA2A 4KNYA 2FMYA 1YO5C 2HR3A 2Y48A 3IRQA 1AOYA 3V4GA 4Y17A 3RJPA 2P4WA 2VBWA 4GYIA 2QWWA 1ULYA 3KEQA 5TJJA 3WGIA 2HQNA 4CYDA 5K5QA 1RI7A 5HOOA 3EDPA 3Q5FA 3J81Z 2X0LA 4Z2YA 5LGNA 3L9FA 3TDZC 3V8JA 2XROA 2M5WA 4BNCA 2H6CA 1BN5A 2A69F 4AVPA 4EV0A 4RB1A 2UWMA 1XGSA 2K86A 2H94A 4A0YA 4IRIA 5H6RA 3R0AA 3JAMZ 1IF1A 2DLLA 5DD8A 3KFWX 1USSA 2W57A 2RQPA 1IN5A 3ML6A 2CQKA 1UHWA 4OIQF 2FNAA 4KIBA 4HYEA 1K78B 2K7LA 3IHUA 4Q5SF 3SHFA 4LLNA 2RV8A 4HA8A 3DKWA 3I5UA 5ILVA 1L0OC 5DYMA 3H92A 1FSEA 5A2QK 4HQEA 4L9NA 3BPVA 1MZBA 4G8XA 2NYXA 2ISZA 4KMUX 4GYGA 3R6SA 2HWVA 3EYYA 5JR3A 2ZJ2A 2LNBA 3KP5A 4LK1F 3FM3A 1ZAOA 4WXHA 3G73A 4LB6B 1FNNA 2EFNA 2JPCA 1EH6A 2BBYA 5L3DA 4KA4A 4WK8F 4MGRA 2XV4S 3SZPA 5FLXK 2P5LC 1WWXA 2VOOA 1J59A 1KYWA 1KA8A 4ETSA 4KFCA 4ZYEA 5ICCA 3MQ0A 1T38A 4XLPF 2Q8KA 4MEXF 1R7JA 2ELHA 4ZYDA 1J5YA 3WTWC 5HS8A 3H3ZA 3LAPA 3E6CC 4A5NA 1HSTA 2CG4A 3CTAA 3KP2A 3ZN1A 2NAZA 3T8TA 2ESHA 5CYVA 3I0TA 4M72A 3TO9A 2IA0A 3BP8A 1TW3A 1MDMB 3HSFA 3RYPA 2UZKA 4AIJA 1ZRDA 4N0BA 4ZH4F 3IRRA 1R1VA 4FX4A 2HKOA 4PGGA 1MGTA 1LEAA 2M1BA 3V7CA 1TQPA 1RIOH 1P4AA 2GWRA 5J8CA 1GXPA 4GO1A 2IP2A 4WF2A 1BC8C 2LDUA 1XCBA 4I02A 1J75A 3DEUA 3R4KA 4ZZLA 2OZUA 2IA1A 4CO8A 4A12A 4HLYA 4ZYGA 4HZFA 2WV0A 2MLKA 2R3SA 4A6DA 2L01A 1MJBA 3I54A 1TW2A 4RGXA 3BOQA 1J0RA 2PLYA 4QLCU 4CZZA 1MDMA 2DQLA 1XGNA 2R7FA 3E5XA 3KE2A 2QVOA 1KGSA 3MCZA 2BEOA 2FBHA 2XKPA 1E17A 1YS6A 2ZKZA 1Z05A 1KU2A 1DDNA 4HF0A 3WE3A 3NQOA 4I0BA 1OMIA 4K2EA 1K6OA 3KLOA 4EMSA 1TQIA 2XAHA 2C6YA 2GA1A 2GQQA 2K27A 3VOEA 3V8LA 5JI6A 4EQQA 1ZH5A 1R5HA 1QO0D 2GA2A 4M9ZA 2KIFA 1B4AA 1XSVA 4UV8A 3J80Z 2X4HA 3I64A 2G9WA 4M74A 4MHGA 3S2WA 4LMYA 2PMUA 1FC3A 2STWA 3R61A 2RNJA 3MAJA 2VN2A 2DO7A 3CUQC 2QM3A 1KYZA 5E1XA 1R1TA 4EJOA 5D8LB 3RKXA 4BHCA 1QBJA 4LGWA 1JHHA 1KU9A 2Z5UA 3KEOA 2K4BA 1A04A 2Z3YA 5F1RA 4HV5A 4MEYF 3E5UA 5JFRA 4I7HA 3LQQA 1WRJA 5LEKA 3QP6A 1LJ9A 1HKTA 4P5OA 4DNCA 3QRFF 1CGPA 2YSRA 4FHTA 2HFHA 1ZYRF 1T98A 1HW2A 1D5VA 5CLSA 1K79A 2Z9OA 3RPQA 4ZYHA 3ULQB 3WGGA 4RB3C 3E97A 2A5YB 3WTXC 4JQFA 4UXNA 3C1DA 1KQ9A 5TRDA 1FY7A 3RIRA 1SMTA 1D3YA 3CO6C 4KN4X 5D5WB 3O6BB 1HSJA 1KQ8A 3FXQA 4EVIA 1ZLJA 4HDVA 3SQNA 2L3DA 1O7LA 4OIRF 3K69A 2FOKA 1Z6RA 2F5DA 1SFUA 4L0YB 3DXJF 2ZO4A 1T0FA 2FRHA 1L3LA 1XD7A 2UXXA 2CSOA 5HLIA 3IC7A 1XCVA 3H3UA 3M9AA 2ZNZA 4LG0B 3TO6A 4HDUA 5DCMA 4HW0A 4U0YA 3JSPA 1KQ0A 5E18F 3LSTA 2XVCA 4L9TA 2FF4A 3F6VA 2YX7A 4LD5A 4G7OF 3RTRA 1EH7A 1SMYF 3DQVC 5HDGA 4AD9A 2OD5A 3DFGA 1DPUA 2VXZA 2BV6A 2NNYA 2BE5F 5AIQA 3PFIA 4G7ZF 4I98B 4FT8A 4WX9A 1YLFA 2G7UA 3DV8A 2F2EA 1DUXC 2FA5A 1S6LA 3J80K 1FPQA 1UHMA 3WE2A 5HDNA 2HGCA 1U5TA 1FSHA 1G3YA 4KYWA 4L9JA 2XAFA 1FOKA 2NRAC 3KP7A 4A5MA 1JHFA 3VODA 2XKOA 5CVVA 3F6OA 2W85A 3C3WA 4YFXF 3FF5A 1HQCA 4BQAA 2H09A 5FGMA 1G6NA 4AIKA 2HYGD 1B9MA 2L54A 5DCFA 3GF2A 5L3FA 1FBQA 2DI3A 2K02A 3O3KA 1USTA 4YFKF 3T1BA 1U78A 1H9TA 3MFKA 4WWCA 3JTHA 3FMSA 1YFHA 3BJAA 4UV9A 3U1DA 1IN8A 4NHJA 4QWQA 2CW0F 2IPQX 1IN7A 2PFBA 1BI1A 3OOPA 1P2FA 1O7FA 1R58A 2XASA 2XAQA 3ZMDA 1SD6A 3KCCA 5FFZA 4UVAA 3CDHA 4M9XA 3F3XA 1OYYA 3T0YA 1IXSB 3K1NA 3RI4A 5ICEA 4O5VA 3GFJA 4YFNF 4BHBA 2FMLA 4RGRA 3KP4A 2F5CA 5AONA 1ZHFA 4YG2F 1B6AA 2QUFA 3GWZA 3U9GA 3FM5A 4RS8A 4CHUA 3U2RA 2WWYA 2HTJA 2OQGA 1FX7A 5DUKA 2BYVE 1QQIA 3ECOA 3R60A 3V8KA 4BHPA 1W4MA 1XN7A 1W7PB 4NQWA 2PG4A 1RZ4A 3WTUC 3T5XA 1ZRFA 4O3MA 5LEJA 1IRFA 3E5QA 4XSXF 2EFQA 1IXCA 2MH9A 4Q4ZF 3FWEA 4WXDA 3TOBA 2A07F 1SD7A 3ZMZA 2TDXA 3VEPA 3GVAA 1S3JA 5E17F 3HHHA 4CICA 3BROA 2JZYA 5ICGA 2RGVA 1F9NA 2JSCA 4EJWA 4CXFA 2WC2A 3BWGA 3ZMSA 2Q2EA 3Q9SA 1H0MA 1FP1D 3BJ6A 1V4RA 2EV0A 3GUDA 2DBBA 1G3TA 1TBXA 1W7PA 2DPDA 4KDPA 4N9IA 4L0ZB 2RN7A 2RC4A 3ZP5A 5LGUA 1BI0A 5FFXA 2ZFWA 4WXCA 4U0VA 3WTVC 1J7KA 1OYIA 4MQ9F 4ENKA 5L3EA 3F21A 5KK1A 4ZZDA 4WCGA 2HEOA 4TV7A 2CWEA 3J7AO 2P6TA 2DK5A 3F72A 3TGNA 3MZHA 5AIPA 1J2XA 2KIMA 4KUMA 2JT1A 3COAC 1IN4A 4U7BA 1Z91A 1KU3A 2OA4A 1I27A 1K7AA 2XUBA 1YW9A 3RYRA 4F7ZA 4GXOA 3ZQ7A 3CJNA 3HRMA 3HYIA 5CVUA 5BOXA 1OYWA 5D5XB 1PP7U 5FB2A 4YIFA 3MEXA 3J81K 1EH8A 1F1ZA 1ODDA 4MTDA 2DT5A 5DD4A 3IKTA 3WGHA 3ZPLA 2XAGA 3K9TA 3ROUA 3W6KB 1BI2A 1XGMA 2OQRA 1OPCA 1UCRA 2HQRA 5E1ZB 1SD5A 2O03A 1YS7A 3GFLA 4A0ZA 1FBUA 4D0PA 3I59A 5ILUA 3CUOA 1FZPB 4EGYA 3JAMK 2IT0A 5EEHA 3GO5A 1HBXG 1SAXA 3HIFA 2HTSA 2EK5A 1S7OA 1RNLA 1BIBA 1QNTA 3AAFA 3M8FA 1RUNA 3RKWA 1ONVA 2RKHA 4XSZF 3GZ6A 3FX3A 2XGXA 3REOA 3JSOA 2RVCA 1ZN2A 1D8JA 2L4AA 2NS0A 4HX8A 2A6EF 4KMFA 4EM0B 3JTGA 2VC0A 3T8RA 3E6MA 3LA3A 2L02A 3B73A 5E8GA 2HKXA 5LBQA 4G6QA 2ZMEB 3EYIA 2FNPA 4IXAA 5IT9Z 3C18A 1B59A 2PJPA 3PQKA 1S29A 2FE3A 1FBSA 4MQVA 3HOSA 3LFKA 2LSOA 4G7HF 2EV5A 4UUVA 3B02A 2MH2A 4HF1A 4Y15A 3VB2A 2FQ3A 4HQMA 4R1HA 4LLLA 5DCMB 4L9VA 1R22A 4OIOF 4U7DA 2E7WA 5D5UB 1BI3A 2ESNA 4KICA 2VE9A 2G7HA 4KN7X 4KT5C 4GCVA 5LHHA 2P7VB 3NRVA 4LK0F 1IXRC 2ZMEA 3L2CA 2W24A 3LA7A 4S04A 4JK1X 3SZTA 4A2UA 1QPMA 2A3SA 4RGSA 1XDUA 3EQLF 3CLOA 3QOPA 1XSDA 3K1PA 2WTEA 4U88A 4A0XA 3N4MA 4L5IA 2VC1A 2NNNA 5KVRA 2LKPA 1U5TB 5LHIA 5HS7A 2V1DA 1FLIA 5HS9A 1YW8A 2MLGA 1STZA 1R23A 2XRNA 3TKYA 3E6BA 2KKOA 4ENMA 2P6SA 2Q0OA 1LDJA 3IWZA 1PUEE 2DQRA 3GX4X 2QYOA 3BJOA 4HF2A 1WKMA 3HUGA 2FBKA 2PBIA 2FSWA 2L4MA 4LFUA 2D1HA 3I58A 4R8HA 1HW1A 2DFIA 3WTSC 4G6DA 4MNUA 4L5JA 1O3RA 3F8FA 4M6YA 2VODA 3P9CA 4XBFA 3QU3A 2HDCA 1PP8F 1ZARA 2VT2A 2ZBKA 3LA2A 5BPDA 3KP6A 2DU9A 5ERIA 4IHSA 4RAYA 2O61A 3F8NA 4P96A 2P8TA 1XGOA 1IZ1A 1XSXA 2V1XA 2M8EA 1RUOA 4EM1A 1MKMA 2OAZA 4PDKA 5CJ9A 5A2QZ 2HYFA 3M1EA 2AXLA 1REPC 3ABTA 3SXYA 4OMYA 1Z7UA 2RDPA 1FYKA 1SFEA 1E2XA 1V3FA 2ADUA 4ENNA 3M7GA 1LB2A 3WTYC 6PAXA 4ON0A 1GVJA 3QU6A 5FLXZ 2PN6A 2QENA 4AWXB 1W5SA 2UXNA 3ZMUA 1F5TA 4HLXA 1X3UA 2VE8A 1C0WA 2Y0MA 2B0LA 3ELKA 1Y0UA 3L09A 2GIVA 2IRFG 3I53A 3C7JA 2OU2A 2K4JA 2PI0A 3GFMA 3DPTA 3KZYA 1FP2A 1LEBA 2HS5A 1I1GA 2LF8A 2F5EA 5FD5A 1U3EM 1T39A 1TTYA 2W25A 1CF7A 1YYVA 4KIFA 2V6CA 3N97A 1SD4A 3W6JB 4OINF 1ZG3A 1IRGA 4LB5A 4XLNF 1ZGAA 1ON1A 2KJCA 4R79A 2GXBA 2QQBA 5D4RA 3DF8A 3PQJA 3HHGA 4EM2A 2M45A 2COMA 5L3GA 2PQ8A 2A61A 4YIIA 3JW4A 4IPAA 4ESFA 2GXGA 5D5VB 5HDKA 4BYYA 2CGPA 4B8XA 2QBYA 5ICFA 3V7RA 2D1VA 2YU3A 4IRGA 1B9NA 3RKYA 1GHCA 4N9HA 3BPXA 2ZXJA 3HOTA 1TLHB 3O2PE 1U8RA 4AIHA 3FXRA 3F8CA 1WQ2A 3GEZA 3OV8A 4HAMA 1O57A 2EV6A 2VBYA 1G3SA 2FU4A 1FYMA 2VT3A 2QQ9A 1S8NA 2QZ8A 3GZ5A 2M30A 1U6GA 3CUQB 4IRHA 1VTNC 3DP7A 2Z33A 1ON2A 1JE8A 3P9IA 5F64A 1XB4A 1U5TC 4CDGA 5FO5A 2XIGA 1U2WA 2O3FA 3HSEA 2V79A 4Q48A 1SFXA 4UHTA 1H9GA 2E7XA 2BGCA 1IUYA 4B09A 1EV7A 1FT9A 2A6HF 2W84A 3P7NA 2DW4A 1I1SA 3HRTA 1BC7C 3IL2A 4G9YA 4S05A 5J6XA 1B1BA 1HKQA 2O8XA 3E3VA 3I59B 2IW5A 4HOBA 2AS5F 3MZYA 4P55A 1I6XA 4IHTA 1P92A 1R5GA 4A6EA 1LNWA 5LGTA 2EFPA 4M6XA 1I5ZA 1BM9A 5LLQA 2ISYA 1P4WA 1ZREA 5BPIA 1K78A 4LJZF 2HZTA 3CUQA 1LDDA 4CGZA 1HXDA 2DPUA 3GXOA 1YIOA 1UFMA 1MD0A 3QAHA 1W5TA 2R7DA 4ESJA 3FHZA 2OBPA 4GGGA 3TDUC 1AWCA 1LVAA 4PZJA 2IVMA 1YG2A 3RPUA 2GAUA 3FZVA 3GFIA 3ABUA 2Z99A 2DTRA 3R0JA 2JTVA 4EJUA 4EGZA 4RGUA 2KRFA 4M73A 4BH9A 2H6BA 3WTZA 4RAZA 1IAWA 2P7CB 2XHKA 4Y13A 2LF7A 2V1UA 1WSUA 2IJLA 3K2ZA 3SFZA 4ENJA 3EETA 4ASNA 3FMRA 5K5RA 3QP5A 5IT3A 4OMZA 2EWNA 1Z9CA 2XAJA 1HKSA 5DV5A 5ILSA 3KETA 3WTTC 1DP7P 3BDDA 2KJBA 2OZ6A 4HX7A 3KZZA 1OKRA 3KP3A 4EJTA 5L3BA 1T6SA 4P9UA 1ZGJA 4ESBA 2YPRA 4M71A 2QQAA 3L7WA 2MC3A 2MD5A 3DPLC 1R36A 1UB9A 5D6FA 3NEUA 3G3ZA 2VONA 3BZ6A 4FX0A 1W7PD 3P9KA 2E1NA 1Q1HA 3Q9VA 3F23A 1G3WA 1R1UA 5CVJA 4UVBA 5D4SA 5FD6A 3FXUA 4IF4A 2DAOA 2ACJA 1R00A 1LDKB 5HLHA 3WU1B 1GXQA 2EFWA 2E1CA 4L18B 3TQNA 4UVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8B A;  2QLZ A;  5E1W A;  3ERE D;  5F6F A;  3FMQ A;  2PEX A;  2FBI A;  1O3Q A;  5JVT A;  2JRT A;  2Y75 A;  5LRR A;  3L00 A;  1WI9 A;  3IWF A;  2P5V A;  4IJA A;  4HBL A;  3I71 A;  3V7S A;  3ZN0 A;  2O6G E;  3GW2 A;  4OU0 A;  2DK8 A;  2ZNY A;  1ZRC A;  3WOD F;  2P5K A;  4Q47 A;  2MBF A;  4P9F A;  5EEG A;  4OIP F;  4PGH A;  1S7A A;  5CVI A;  1O3T A;  5LRS A;  3IKV A;  2HOE A;  3F8M A;  3M8E A;  3HTU A;  1BBY A;  4M9S A;  1TNT A;  4HX4 A;  5H20 A;  1QZZ A;  1P4X A;  5H6Q A;  1KU7 A;  3HRS A;  2PMH A;  4I09 A;  5ED4 A;  3QPH A;  4I0A A;  2MA3 A;  1Z1D A;  5HLG A;  1G4D A;  5E20 A;  2STT A;  5D8K B;  4RB0 A;  1LQ1 A;  3TOA A;  1TNS A;  5DEQ A;  1YTY A;  1DPR A;  3GYH X;  5D6E A;  3K1M A;  3EUH A;  4MTE A;  3KLN A;  1FYL A;  2CFX A;  1XDS A;  3HSR A;  4EJV A;  1MJ9 A;  4E70 A;  5DDG A;  3ISP A;  2CO5 A;  1ZG1 A;  1IW7 F;  5LHG A;  3K0L A;  1BIA A;  2KIU A;  2V9V A;  1XMA A;  2VBX A;  4O6J A;  1F4K A;  3WG9 A;  3VFZ A;  4DQ2 A;  1XMK A;  4I01 A;  1OR7 A;  1P6R A;  5K1Y A;  1O3S A;  2D45 A;  3BY6 A;  3LQR A;  5E8I A;  3D5L A;  5BS6 A;  4IVN A;  2O0Y A;  1JXS A;  5HVQ C;  3GLX A;  4LLG F;  3TO7 A;  3QPT A;  5BMZ A;  3LWF A;  5DUI A;  5BQT A;  5CVR A;  1YW7 A;  1Z6T A;  2J5O A;  4U0W A;  5J8F A;  1CF7 B;  4UNO A;  5IT9 K;  2YX4 A;  3I4P A;  3ZMT A;  2EA2 A;  1YQA A;  3ECH A;  2FEZ A;  4OOI A;  1T2K A;  1IN6 A;  3WU0 A;  3CO7 C;  2A68 F;  1BJA A;  2YR2 A;  1QGP A;  4H0E A;  2F5F A;  2H27 A;  2QBY B;  4HV6 A;  1ZLK A;  1NHA A;  4PCQ A;  3F22 A;  4LG0 A;  1BOA A;  3HRU A;  3D0S A;  3LAJ A;  5K5O A;  2EJR A;  1HW5 A;  4BAY A;  2ETH A;  2VOP A;  2J5P A;  4BXU A;  1MJA A;  1J9I A;  4KIG A;  1D8K A;  2EA4 A;  4I2O A;  3RDI A;  3MWM A;  1TQM A;  2M87 A;  3HTS B;  1ZG5 A;  2CYY A;  2JPB A;  1FWZ A;  2D2W A;  3E6D A;  2EB7 A;  4NB5 A;  5L3C A;  4G94 A;  5JHU A;  4JBA A;  4XRF A;  3ZMV A;  1PDN C;  4RB2 C;  2EFO A;  1QZY A;  2FXA A;  2VBZ A;  2ZCW A;  1JGS A;  2GZW A;  2IA2 A;  4KNY A;  2FMY A;  1YO5 C;  2HR3 A;  2Y48 A;  3IRQ A;  1AOY A;  3V4G A;  4Y17 A;  3RJP A;  2P4W A;  2VBW A;  4GYI A;  2QWW A;  1ULY A;  3KEQ A;  5TJJ A;  3WGI A;  2HQN A;  4CYD A;  5K5Q A;  1RI7 A;  5HOO A;  3EDP A;  3Q5F A;  3J81 Z;  2X0L A;  4Z2Y A;  5LGN A;  3L9F A;  3TDZ C;  3V8J A;  2XRO A;  2M5W A;  4BNC A;  2H6C A;  1BN5 A;  2A69 F;  4AVP A;  4EV0 A;  4RB1 A;  2UWM A;  1XGS A;  2K86 A;  2H94 A;  4A0Y A;  4IRI A;  5H6R A;  3R0A A;  3JAM Z;  1IF1 A;  2DLL A;  5DD8 A;  3KFW X;  1USS A;  2W57 A;  2RQP A;  1IN5 A;  3ML6 A;  2CQK A;  1UHW A;  4OIQ F;  2FNA A;  4KIB A;  4HYE A;  1K78 B;  2K7L A;  3IHU A;  4Q5S F;  3SHF A;  4LLN A;  2RV8 A;  4HA8 A;  3DKW A;  3I5U A;  5ILV A;  1L0O C;  5DYM A;  3H92 A;  1FSE A;  5A2Q K;  4HQE A;  4L9N A;  3BPV A;  1MZB A;  4G8X A;  2NYX A;  2ISZ A;  4KMU X;  4GYG A;  3R6S A;  2HWV A;  3EYY A;  5JR3 A;  2ZJ2 A;  2LNB A;  3KP5 A;  4LK1 F;  3FM3 A;  1ZAO A;  4WXH A;  3G73 A;  4LB6 B;  1FNN A;  2EFN A;  2JPC A;  1EH6 A;  2BBY A;  5L3D A;  4KA4 A;  4WK8 F;  4MGR A;  2XV4 S;  3SZP A;  5FLX K;  2P5L C;  1WWX A;  2VOO A;  1J59 A;  1KYW A;  1KA8 A;  4ETS A;  4KFC A;  4ZYE A;  5ICC A;  3MQ0 A;  1T38 A;  4XLP F;  2Q8K A;  4MEX F;  1R7J A;  2ELH A;  4ZYD A;  1J5Y A;  3WTW C;  5HS8 A;  3H3Z A;  3LAP A;  3E6C C;  4A5N A;  1HST A;  2CG4 A;  3CTA A;  3KP2 A;  3ZN1 A;  2NAZ A;  3T8T A;  2ESH A;  5CYV A;  3I0T A;  4M72 A;  3TO9 A;  2IA0 A;  3BP8 A;  1TW3 A;  1MDM B;  3HSF A;  3RYP A;  2UZK A;  4AIJ A;  1ZRD A;  4N0B A;  4ZH4 F;  3IRR A;  1R1V A;  4FX4 A;  2HKO A;  4PGG A;  1MGT A;  1LEA A;  2M1B A;  3V7C A;  1TQP A;  1RIO H;  1P4A A;  2GWR A;  5J8C A;  1GXP A;  4GO1 A;  2IP2 A;  4WF2 A;  1BC8 C;  2LDU A;  1XCB A;  4I02 A;  1J75 A;  3DEU A;  3R4K A;  4ZZL A;  2OZU A;  2IA1 A;  4CO8 A;  4A12 A;  4HLY A;  4ZYG A;  4HZF A;  2WV0 A;  2MLK A;  2R3S A;  4A6D A;  2L01 A;  1MJB A;  3I54 A;  1TW2 A;  4RGX A;  3BOQ A;  1J0R A;  2PLY A;  4QLC U;  4CZZ A;  1MDM A;  2DQL A;  1XGN A;  2R7F A;  3E5X A;  3KE2 A;  2QVO A;  1KGS A;  3MCZ A;  2BEO A;  2FBH A;  2XKP A;  1E17 A;  1YS6 A;  2ZKZ A;  1Z05 A;  1KU2 A;  1DDN A;  4HF0 A;  3WE3 A;  3NQO A;  4I0B A;  1OMI A;  4K2E A;  1K6O A;  3KLO A;  4EMS A;  1TQI A;  2XAH A;  2C6Y A;  2GA1 A;  2GQQ A;  2K27 A;  3VOE A;  3V8L A;  5JI6 A;  4EQQ A;  1ZH5 A;  1R5H A;  1QO0 D;  2GA2 A;  4M9Z A;  2KIF A;  1B4A A;  1XSV A;  4UV8 A;  3J80 Z;  2X4H A;  3I64 A;  2G9W A;  4M74 A;  4MHG A;  3S2W A;  4LMY A;  2PMU A;  1FC3 A;  2STW A;  3R61 A;  2RNJ A;  3MAJ A;  2VN2 A;  2DO7 A;  3CUQ C;  2QM3 A;  1KYZ A;  5E1X A;  1R1T A;  4EJO A;  5D8L B;  3RKX A;  4BHC A;  1QBJ A;  4LGW A;  1JHH A;  1KU9 A;  2Z5U A;  3KEO A;  2K4B A;  1A04 A;  2Z3Y A;  5F1R A;  4HV5 A;  4MEY F;  3E5U A;  5JFR A;  4I7H A;  3LQQ A;  1WRJ A;  5LEK A;  3QP6 A;  1LJ9 A;  1HKT A;  4P5O A;  4DNC A;  3QRF F;  1CGP A;  2YSR A;  4FHT A;  2HFH A;  1ZYR F;  1T98 A;  1HW2 A;  1D5V A;  5CLS A;  1K79 A;  2Z9O A;  3RPQ A;  4ZYH A;  3ULQ B;  3WGG A;  4RB3 C;  3E97 A;  2A5Y B;  3WTX C;  4JQF A;  4UXN A;  3C1D A;  1KQ9 A;  5TRD A;  1FY7 A;  3RIR A;  1SMT A;  1D3Y A;  3CO6 C;  4KN4 X;  5D5W B;  3O6B B;  1HSJ A;  1KQ8 A;  3FXQ A;  4EVI A;  1ZLJ A;  4HDV A;  3SQN A;  2L3D A;  1O7L A;  4OIR F;  3K69 A;  2FOK A;  1Z6R A;  2F5D A;  1SFU A;  4L0Y B;  3DXJ F;  2ZO4 A;  1T0F A;  2FRH A;  1L3L A;  1XD7 A;  2UXX A;  2CSO A;  5HLI A;  3IC7 A;  1XCV A;  3H3U A;  3M9A A;  2ZNZ A;  4LG0 B;  3TO6 A;  4HDU A;  5DCM A;  4HW0 A;  4U0Y A;  3JSP A;  1KQ0 A;  5E18 F;  3LST A;  2XVC A;  4L9T A;  2FF4 A;  3F6V A;  2YX7 A;  4LD5 A;  4G7O F;  3RTR A;  1EH7 A;  1SMY F;  3DQV C;  5HDG A;  4AD9 A;  2OD5 A;  3DFG A;  1DPU A;  2VXZ A;  2BV6 A;  2NNY A;  2BE5 F;  5AIQ A;  3PFI A;  4G7Z F;  4I98 B;  4FT8 A;  4WX9 A;  1YLF A;  2G7U A;  3DV8 A;  2F2E A;  1DUX C;  2FA5 A;  1S6L A;  3J80 K;  1FPQ A;  1UHM A;  3WE2 A;  5HDN A;  2HGC A;  1U5T A;  1FSH A;  1G3Y A;  4KYW A;  4L9J A;  2XAF A;  1FOK A;  2NRA C;  3KP7 A;  4A5M A;  1JHF A;  3VOD A;  2XKO A;  5CVV A;  3F6O A;  2W85 A;  3C3W A;  4YFX F;  3FF5 A;  1HQC A;  4BQA A;  2H09 A;  5FGM A;  1G6N A;  4AIK A;  2HYG D;  1B9M A;  2L54 A;  5DCF A;  3GF2 A;  5L3F A;  1FBQ A;  2DI3 A;  2K02 A;  3O3K A;  1UST A;  4YFK F;  3T1B A;  1U78 A;  1H9T A;  3MFK A;  4WWC A;  3JTH A;  3FMS A;  1YFH A;  3BJA A;  4UV9 A;  3U1D A;  1IN8 A;  4NHJ A;  4QWQ A;  2CW0 F;  2IPQ X;  1IN7 A;  2PFB A;  1BI1 A;  3OOP A;  1P2F A;  1O7F A;  1R58 A;  2XAS A;  2XAQ A;  3ZMD A;  1SD6 A;  3KCC A;  5FFZ A;  4UVA A;  3CDH A;  4M9X A;  3F3X A;  1OYY A;  3T0Y A;  1IXS B;  3K1N A;  3RI4 A;  5ICE A;  4O5V A;  3GFJ A;  4YFN F;  4BHB A;  2FML A;  4RGR A;  3KP4 A;  2F5C A;  5AON A;  1ZHF A;  4YG2 F;  1B6A A;  2QUF A;  3GWZ A;  3U9G A;  3FM5 A;  4RS8 A;  4CHU A;  3U2R A;  2WWY A;  2HTJ A;  2OQG A;  1FX7 A;  5DUK A;  2BYV E;  1QQI A;  3ECO A;  3R60 A;  3V8K A;  4BHP A;  1W4M A;  1XN7 A;  1W7P B;  4NQW A;  2PG4 A;  1RZ4 A;  3WTU C;  3T5X A;  1ZRF A;  4O3M A;  5LEJ A;  1IRF A;  3E5Q A;  4XSX F;  2EFQ A;  1IXC A;  2MH9 A;  4Q4Z F;  3FWE A;  4WXD A;  3TOB A;  2A07 F;  1SD7 A;  3ZMZ A;  2TDX A;  3VEP A;  3GVA A;  1S3J A;  5E17 F;  3HHH A;  4CIC A;  3BRO A;  2JZY A;  5ICG A;  2RGV A;  1F9N A;  2JSC A;  4EJW A;  4CXF A;  2WC2 A;  3BWG A;  3ZMS A;  2Q2E A;  3Q9S A;  1H0M A;  1FP1 D;  3BJ6 A;  1V4R A;  2EV0 A;  3GUD A;  2DBB A;  1G3T A;  1TBX A;  1W7P A;  2DPD A;  4KDP A;  4N9I A;  4L0Z B;  2RN7 A;  2RC4 A;  3ZP5 A;  5LGU A;  1BI0 A;  5FFX A;  2ZFW A;  4WXC A;  4U0V A;  3WTV C;  1J7K A;  1OYI A;  4MQ9 F;  4ENK A;  5L3E A;  3F21 A;  5KK1 A;  4ZZD A;  4WCG A;  2HEO A;  4TV7 A;  2CWE A;  3J7A O;  2P6T A;  2DK5 A;  3F72 A;  3TGN A;  3MZH A;  5AIP A;  1J2X A;  2KIM A;  4KUM A;  2JT1 A;  3COA C;  1IN4 A;  4U7B A;  1Z91 A;  1KU3 A;  2OA4 A;  1I27 A;  1K7A A;  2XUB A;  1YW9 A;  3RYR A;  4F7Z A;  4GXO A;  3ZQ7 A;  3CJN A;  3HRM A;  3HYI A;  5CVU A;  5BOX A;  1OYW A;  5D5X B;  1PP7 U;  5FB2 A;  4YIF A;  3MEX A;  3J81 K;  1EH8 A;  1F1Z A;  1ODD A;  4MTD A;  2DT5 A;  5DD4 A;  3IKT A;  3WGH A;  3ZPL A;  2XAG A;  3K9T A;  3ROU A;  3W6K B;  1BI2 A;  1XGM A;  2OQR A;  1OPC A;  1UCR A;  2HQR A;  5E1Z B;  1SD5 A;  2O03 A;  1YS7 A;  3GFL A;  4A0Z A;  1FBU A;  4D0P A;  3I59 A;  5ILU A;  3CUO A;  1FZP B;  4EGY A;  3JAM K;  2IT0 A;  5EEH A;  3GO5 A;  1HBX G;  1SAX A;  3HIF A;  2HTS A;  2EK5 A;  1S7O A;  1RNL A;  1BIB A;  1QNT A;  3AAF A;  3M8F A;  1RUN A;  3RKW A;  1ONV A;  2RKH A;  4XSZ F;  3GZ6 A;  3FX3 A;  2XGX A;  3REO A;  3JSO A;  2RVC A;  1ZN2 A;  1D8J A;  2L4A A;  2NS0 A;  4HX8 A;  2A6E F;  4KMF A;  4EM0 B;  3JTG A;  2VC0 A;  3T8R A;  3E6M A;  3LA3 A;  2L02 A;  3B73 A;  5E8G A;  2HKX A;  5LBQ A;  4G6Q A;  2ZME B;  3EYI A;  2FNP A;  4IXA A;  5IT9 Z;  3C18 A;  1B59 A;  2PJP A;  3PQK A;  1S29 A;  2FE3 A;  1FBS A;  4MQV A;  3HOS A;  3LFK A;  2LSO A;  4G7H F;  2EV5 A;  4UUV A;  3B02 A;  2MH2 A;  4HF1 A;  4Y15 A;  3VB2 A;  2FQ3 A;  4HQM A;  4R1H A;  4LLL A;  5DCM B;  4L9V A;  1R22 A;  4OIO F;  4U7D A;  2E7W A;  5D5U B;  1BI3 A;  2ESN A;  4KIC A;  2VE9 A;  2G7H A;  4KN7 X;  4KT5 C;  4GCV A;  5LHH A;  2P7V B;  3NRV A;  4LK0 F;  1IXR C;  2ZME A;  3L2C A;  2W24 A;  3LA7 A;  4S04 A;  4JK1 X;  3SZT A;  4A2U A;  1QPM A;  2A3S A;  4RGS A;  1XDU A;  3EQL F;  3CLO A;  3QOP A;  1XSD A;  3K1P A;  2WTE A;  4U88 A;  4A0X A;  3N4M A;  4L5I A;  2VC1 A;  2NNN A;  5KVR A;  2LKP A;  1U5T B;  5LHI A;  5HS7 A;  2V1D A;  1FLI A;  5HS9 A;  1YW8 A;  2MLG A;  1STZ A;  1R23 A;  2XRN A;  3TKY A;  3E6B A;  2KKO A;  4ENM A;  2P6S A;  2Q0O A;  1LDJ A;  3IWZ A;  1PUE E;  2DQR A;  3GX4 X;  2QYO A;  3BJO A;  4HF2 A;  1WKM A;  3HUG A;  2FBK A;  2PBI A;  2FSW A;  2L4M A;  4LFU A;  2D1H A;  3I58 A;  4R8H A;  1HW1 A;  2DFI A;  3WTS C;  4G6D A;  4MNU A;  4L5J A;  1O3R A;  3F8F A;  4M6Y A;  2VOD A;  3P9C A;  4XBF A;  3QU3 A;  2HDC A;  1PP8 F;  1ZAR A;  2VT2 A;  2ZBK A;  3LA2 A;  5BPD A;  3KP6 A;  2DU9 A;  5ERI A;  4IHS A;  4RAY A;  2O61 A;  3F8N A;  4P96 A;  2P8T A;  1XGO A;  1IZ1 A;  1XSX A;  2V1X A;  2M8E A;  1RUO A;  4EM1 A;  1MKM A;  2OAZ A;  4PDK A;  5CJ9 A;  5A2Q Z;  2HYF A;  3M1E A;  2AXL A;  1REP C;  3ABT A;  3SXY A;  4OMY A;  1Z7U A;  2RDP A;  1FYK A;  1SFE A;  1E2X A;  1V3F A;  2ADU A;  4ENN A;  3M7G A;  1LB2 A;  3WTY C;  6PAX A;  4ON0 A;  1GVJ A;  3QU6 A;  5FLX Z;  2PN6 A;  2QEN A;  4AWX B;  1W5S A;  2UXN A;  3ZMU A;  1F5T A;  4HLX A;  1X3U A;  2VE8 A;  1C0W A;  2Y0M A;  2B0L A;  3ELK A;  1Y0U A;  3L09 A;  2GIV A;  2IRF G;  3I53 A;  3C7J A;  2OU2 A;  2K4J A;  2PI0 A;  3GFM A;  3DPT A;  3KZY A;  1FP2 A;  1LEB A;  2HS5 A;  1I1G A;  2LF8 A;  2F5E A;  5FD5 A;  1U3E M;  1T39 A;  1TTY A;  2W25 A;  1CF7 A;  1YYV A;  4KIF A;  2V6C A;  3N97 A;  1SD4 A;  3W6J B;  4OIN F;  1ZG3 A;  1IRG A;  4LB5 A;  4XLN F;  1ZGA A;  1ON1 A;  2KJC A;  4R79 A;  2GXB A;  2QQB A;  5D4R A;  3DF8 A;  3PQJ A;  3HHG A;  4EM2 A;  2M45 A;  2COM A;  5L3G A;  2PQ8 A;  2A61 A;  4YII A;  3JW4 A;  4IPA A;  4ESF A;  2GXG A;  5D5V B;  5HDK A;  4BYY A;  2CGP A;  4B8X A;  2QBY A;  5ICF A;  3V7R A;  2D1V A;  2YU3 A;  4IRG A;  1B9N A;  3RKY A;  1GHC A;  4N9H A;  3BPX A;  2ZXJ A;  3HOT A;  1TLH B;  3O2P E;  1U8R A;  4AIH A;  3FXR A;  3F8C A;  1WQ2 A;  3GEZ A;  3OV8 A;  4HAM A;  1O57 A;  2EV6 A;  2VBY A;  1G3S A;  2FU4 A;  1FYM A;  2VT3 A;  2QQ9 A;  1S8N A;  2QZ8 A;  3GZ5 A;  2M30 A;  1U6G A;  3CUQ B;  4IRH A;  1VTN C;  3DP7 A;  2Z33 A;  1ON2 A;  1JE8 A;  3P9I A;  5F64 A;  1XB4 A;  1U5T C;  4CDG A;  5FO5 A;  2XIG A;  1U2W A;  2O3F A;  3HSE A;  2V79 A;  4Q48 A;  1SFX A;  4UHT A;  1H9G A;  2E7X A;  2BGC A;  1IUY A;  4B09 A;  1EV7 A;  1FT9 A;  2A6H F;  2W84 A;  3P7N A;  2DW4 A;  1I1S A;  3HRT A;  1BC7 C;  3IL2 A;  4G9Y A;  4S05 A;  5J6X A;  1B1B A;  1HKQ A;  2O8X A;  3E3V A;  3I59 B;  2IW5 A;  4HOB A;  2AS5 F;  3MZY A;  4P55 A;  1I6X A;  4IHT A;  1P92 A;  1R5G A;  4A6E A;  1LNW A;  5LGT A;  2EFP A;  4M6X A;  1I5Z A;  1BM9 A;  5LLQ A;  2ISY A;  1P4W A;  1ZRE A;  5BPI A;  1K78 A;  4LJZ F;  2HZT A;  3CUQ A;  1LDD A;  4CGZ A;  1HXD A;  2DPU A;  3GXO A;  1YIO A;  1UFM A;  1MD0 A;  3QAH A;  1W5T A;  2R7D A;  4ESJ A;  3FHZ A;  2OBP A;  4GGG A;  3TDU C;  1AWC A;  1LVA A;  4PZJ A;  2IVM A;  1YG2 A;  3RPU A;  2GAU A;  3FZV A;  3GFI A;  3ABU A;  2Z99 A;  2DTR A;  3R0J A;  2JTV A;  4EJU A;  4EGZ A;  4RGU A;  2KRF A;  4M73 A;  4BH9 A;  2H6B A;  3WTZ A;  4RAZ A;  1IAW A;  2P7C B;  2XHK A;  4Y13 A;  2LF7 A;  2V1U A;  1WSU A;  2IJL A;  3K2Z A;  3SFZ A;  4ENJ A;  3EET A;  4ASN A;  3FMR A;  5K5R A;  3QP5 A;  5IT3 A;  4OMZ A;  2EWN A;  1Z9C A;  2XAJ A;  1HKS A;  5DV5 A;  5ILS A;  3KET A;  3WTT C;  1DP7 P;  3BDD A;  2KJB A;  2OZ6 A;  4HX7 A;  3KZZ A;  1OKR A;  3KP3 A;  4EJT A;  5L3B A;  1T6S A;  4P9U A;  1ZGJ A;  4ESB A;  2YPR A;  4M71 A;  2QQA A;  3L7W A;  2MC3 A;  2MD5 A;  3DPL C;  1R36 A;  1UB9 A;  5D6F A;  3NEU A;  3G3Z A;  2VON A;  3BZ6 A;  4FX0 A;  1W7P D;  3P9K A;  2E1N A;  1Q1H A;  3Q9V A;  3F23 A;  1G3W A;  1R1U A;  5CVJ A;  4UVB A;  5D4S A;  5FD6 A;  3FXU A;  4IF4 A;  2DAO A;  2ACJ A;  1R00 A;  1LDK B;  5HLH A;  3WU1 B;  1GXQ A;  2EFW A;  2E1C A;  4L18 B;  3TQN A;  4UVC A; 
#chains in the Genus database with same CATH topology
 3F8B A;  2QLZ A;  4BXF A;  5E1W A;  3S1N J;  3ERE D;  3PSI A;  3CES A;  5IP6 A;  1S5L C;  4RAF A;  1Y0N A;  4XOR A;  3FMQ A;  5F6F A;  2PEX A;  1OCT C;  2FBI A;  1O3Q A;  5JVT A;  3HDD A;  2WAD A;  5FKO A;  4LG3 A;  4A3D J;  1VQN I;  2JRT A;  2Y75 A;  5LRR A;  3L00 A;  1IRX A;  5F1J A;  1WI9 A;  2EZL A;  1HA8 A;  3JRE A;  3AL0 B;  4A3E J;  3IWF A;  2P5V A;  4IJA A;  4B47 A;  4HBL A;  3I71 A;  5K7Z A;  3V7S A;  4A93 J;  3OS0 A;  4A69 C;  1SFO J;  2DA1 A;  1IO2 A;  2M7B A;  3ZN0 A;  2QQ8 A;  2O6G E;  3OYH A;  3HKZ N;  2XPU A;  5CKT A;  3GW2 A;  1X1C A;  4OU0 A;  2DK8 A;  2ZNY A;  4FQG A;  4PJJ A;  3K70 D;  1R9T J;  1ZRC A;  3WOD F;  2P5K A;  4Q47 A;  3HUG B;  2MBF A;  4E6K G;  3PJR A;  2O5R A;  4P9F A;  1E3O C;  5EEG A;  4IX7 A;  2M34 A;  3K4N A;  2QA4 I;  2NVX J;  4OIP F;  4PGH A;  4DW6 A;  4OAZ A;  2NS8 A;  3CP8 A;  1S7A A;  1AU7 A;  3OIQ A;  5CVI A;  2EH3 A;  2EBI A;  2EZI A;  5LRS A;  1O3T A;  3IKV A;  2HOE A;  3F8M A;  2R7W A;  3M8E A;  1MSE C;  1WFX A;  3HTU A;  1ETX A;  2LBF B;  3CQZ J;  1BBY A;  4M9S A;  1TNT A;  3ABK H;  1FOY A;  4HX4 A;  4PFP A;  3OY9 A;  2KHM A;  5H20 A;  2M0C A;  1QZZ A;  2L9V A;  1P4X A;  5H6Q A;  4NC6 A;  1MNM C;  3OYB A;  2LP0 A;  4C2T A;  4Y4R A;  4QIW N;  1KU7 A;  3HRS A;  2PMH A;  2X6O A;  4I09 A;  5ED4 A;  3QPH A;  4I0A A;  2MA3 A;  1MBJ A;  3BR1 A;  3MKW B;  1Z1D A;  2L9N A;  3PO2 J;  4IHY A;  5HLG A;  1G4D A;  5E20 A;  3BR5 A;  1SVO A;  1HC8 A;  3QOE A;  4ZC3 A;  2STT A;  1UG2 A;  5D8K B;  1WJ5 A;  4RB0 A;  1X4O A;  3K4J A;  1LQ1 A;  3TOA A;  1TNS A;  2Z2S B;  5DEQ A;  1YTY A;  1DPR A;  2KFD A;  4PJM A;  3GYH X;  5D6E A;  3K1M A;  2Y2Z A;  1I3A A;  3EUH A;  3D1N I;  3KLN A;  4MTE A;  1FYL A;  2CFX A;  5IY5 H;  3K10 A;  3VSL A;  1XDS A;  3ZXS A;  4DZJ A;  3HSR A;  4EJV A;  1NK2 P;  4XOP A;  1MJ9 A;  2HXO A;  4E70 A;  5DDG A;  3ISP A;  2CO5 A;  3IV5 A;  3BCA A;  1ZG1 A;  1IW7 F;  5LHG A;  3EUA A;  1F43 A;  5IYC J;  1OIS A;  3K0L A;  1BIA A;  1AHD P;  2EIN H;  2KIU A;  2V9V A;  4B4C A;  5HNH A;  1XMA A;  2VBX A;  4PJ0 C;  4O6J A;  1F4K A;  3WG9 A;  1SC7 A;  1LUJ B;  4Y33 A;  3VFZ A;  1R49 A;  4DQ2 A;  2DCE A;  1XMK A;  2BHY A;  1D1A A;  4I01 A;  1OR7 A;  3OIP A;  1P6R A;  5K1Y A;  1O3S A;  1NK3 P;  4CYC A;  2YUS A;  5E3N A;  2D45 A;  3BY6 A;  3LQR A;  5E8I A;  3D5L A;  3KZI C;  5BS6 A;  4IVN A;  2O0Y A;  1Z21 A;  2F4O B;  3QWL A;  1JXS A;  2LBF A;  3W2V A;  3TBI A;  2BY1 A;  5HVQ C;  5EYR A;  5HLT A;  3GLX A;  4LLG F;  3TO7 A;  2VB6 A;  2JUC A;  3QPT A;  3LSG A;  5BMZ A;  3LWF A;  2K3F A;  2IAI A;  5DUI A;  5BQT A;  5CVR A;  1YW7 A;  1WJD A;  1Z6T A;  2J5O A;  4U0W A;  5J8F A;  2QGU A;  5IYD J;  3ESW B;  2AHQ A;  1CF7 B;  4ANJ A;  4UNO A;  4F52 A;  2KT0 A;  4F93 B;  5IT9 K;  2YX4 A;  3VDX A;  2BW3 A;  3GTM J;  3HG9 A;  3I4P A;  3VSK A;  3ZMT A;  2LY1 A;  4D1Q A;  5F08 A;  2EA2 A;  1YQA A;  3LSI A;  2DN0 A;  1ERD A;  4FCY A;  5EEA A;  1YJW I;  5EG0 A;  3VYU B;  3ECH A;  2WAQ A;  3OYC A;  4FE7 A;  2DA4 A;  5F0F A;  2HPM A;  2FEZ A;  4OOI A;  1T2K A;  3D5R C;  1IN6 A;  4XLA A;  4UY8 I;  3WU0 A;  4BAC A;  1UEL B;  4CZC A;  3CO7 C;  4B3A A;  1FTT A;  2NVY J;  2PMZ N;  2CS3 A;  2A68 F;  3DLA A;  1BJA A;  3A01 A;  2VQL A;  2KL4 A;  2YR2 A;  1QGP A;  2QSG X;  1ETV A;  2KZV A;  3HEF A;  4H0E A;  2F5F A;  2H27 A;  2QBY B;  4MO7 A;  4HV6 A;  5FRM A;  4QTR A;  2V9K A;  2DOD A;  3G1M A;  2F5V A;  3D5S C;  1ZLK A;  3GTQ J;  4RLQ A;  3P5J A;  4DBQ A;  4Z6Y A;  2CV1 A;  1NHA A;  4PCQ A;  3F22 A;  4LG0 A;  1BOA A;  2OF7 A;  3HRU A;  1G2H A;  3D0S A;  3LAJ A;  5K5O A;  2EJR A;  1HW5 A;  4BAY A;  2ETH A;  2VOP A;  2L7Z A;  4UUT A;  2J5P A;  4ZYA A;  4BXU A;  1MJA A;  4BJ5 C;  2W82 A;  1J9I A;  1SFK A;  4KIG A;  3BTC A;  1D8K A;  2EA4 A;  4UB8 C;  2R93 J;  4I2O A;  2ZME C;  3RDI A;  1FMW A;  2XB0 X;  3MWM A;  2X6W A;  1TQM A;  2M87 A;  3W2A A;  3HTS B;  1ZG5 A;  2CYY A;  2JPB A;  1FWZ A;  1WJB A;  2D2W A;  1D1B A;  1Z3Y A;  3E6D A;  2EB7 A;  3H5R A;  4NB5 A;  4BU2 A;  5L3C A;  4G94 A;  5JHU A;  4JBA A;  4XRF A;  3ZMV A;  3FXL A;  2AO9 A;  1PDN C;  1UHS A;  3NAU A;  4FET A;  4RB2 C;  2EFO A;  1HLV A;  1QZY A;  2FXA A;  2VBZ A;  2ZCW A;  2DFF A;  2LK2 A;  1JGS A;  2GZW A;  2IA2 A;  3OWT A;  4AID A;  2FMY A;  4KNY A;  1VFC A;  3WU2 C;  4QPO A;  3ZRG A;  1YO5 C;  2HR3 A;  3L2Q A;  2JA5 J;  2Y48 A;  2VKH A;  3IRQ A;  1AOY A;  3E1S A;  1JKO C;  3V4G A;  4Y17 A;  3H36 A;  3RJP A;  2P4W A;  2VBW A;  4GYI A;  2QWW A;  3PUF A;  4PFO A;  1ULY A;  3KEQ A;  5TJJ A;  2VI6 A;  1VQO I;  3WGI A;  2HQN A;  4CYD A;  5K5Q A;  1RI7 A;  5GTI C;  4CUG A;  5HOO A;  2K9L A;  1PJR A;  3EDP A;  5J1U A;  2ZXI A;  1QPI A;  2O7O A;  3IAM 2;  3Q5F A;  3J81 Z;  2X0L A;  4Z2Y A;  2EIM H;  2DDA A;  3PFY A;  5LGN A;  1ZKG A;  1IG7 A;  2YS9 A;  3L9F A;  2VIX A;  4P1W A;  1RC9 A;  3TDZ C;  3ASO H;  4GDF A;  3GLL A;  1WPK A;  3V8J A;  2XRO A;  2M5W A;  4BNC A;  4HEA 2;  2H6C A;  1BN5 A;  2A69 F;  4AVP A;  4D9J A;  4EV0 A;  4RB1 A;  4ZTF A;  5TIS C;  1LE8 A;  4IHW A;  2UWM A;  1XGS A;  4UB6 C;  1V5F A;  2K86 A;  2H94 A;  3JRG A;  1X1B A;  1I6H J;  1QU3 A;  4I99 C;  3OR2 C;  4A0Y A;  5C3E J;  5EZH A;  3PL8 A;  5GPA A;  4IRI A;  5H6R A;  3R0A A;  3JAM Z;  1IF1 A;  2H8R A;  3NAR A;  3OMY A;  2DLL A;  5DD8 A;  3KFW X;  5DTD A;  1USS A;  2W57 A;  2RQP A;  1IN5 A;  3NWT A;  3ML6 A;  3ABL H;  2CQK A;  1UHW A;  2E2I J;  4OIQ F;  2DXI A;  2FNA A;  4KIB A;  4HYE A;  1K78 B;  2K7L A;  3IHU A;  3CD6 I;  4Q5S F;  2R0Q C;  4AYB A;  2ZJP F;  3SHF A;  4LLN A;  4KT6 A;  4RMN A;  1K4T A;  1T33 A;  2RV8 A;  4HA8 A;  3DKW A;  1ACI A;  3I5U A;  5ILV A;  4E7J A;  1L0O C;  3CZ6 A;  4L5E A;  5GTH C;  5DYM A;  3H92 A;  1FSE A;  1LKX A;  4XRM A;  1OJL A;  3M3Y J;  5A2Q K;  2BY0 A;  4HQE A;  4L9N A;  2XB5 A;  3BPV A;  4A3F J;  1ITY A;  1MZB A;  4G8X A;  2IGK A;  2NYX A;  2ISZ A;  2R92 J;  2XGD A;  4KMU X;  4GYG A;  3R6S A;  2HWV A;  1FOX A;  3EYY A;  5JR3 A;  2ZJ2 A;  2LNB A;  3KP5 A;  2IEK A;  3FM3 A;  4LK1 F;  1ZAO A;  2V26 A;  3Q3S A;  4WXH A;  1YJN I;  2ZFU A;  3G73 A;  1IV8 A;  4LB6 B;  2M7A A;  1FNN A;  3PNT A;  4XRS G;  2CFO A;  2EFN A;  2JK3 A;  2JPC A;  3AG4 H;  5GPC A;  1EH6 A;  2BBY A;  3QYF A;  3EUK L;  5L3D A;  4KA4 A;  2HVR A;  4WK8 F;  4MGR A;  1MBG A;  2XV4 S;  3SZP A;  2ZSI B;  3DEW A;  4W1U A;  5FLX K;  1DP3 A;  3FK7 A;  2P81 A;  2P5L C;  3BTJ A;  3HZJ A;  1WWX A;  5KAF C;  1JKR C;  3HGG A;  2VOO A;  2LFB A;  3HOW J;  3ZCO A;  1J59 A;  1KYW A;  1KA8 A;  4AUX A;  4ETS A;  4KFC A;  2BHZ A;  5E3L A;  4ZYE A;  5ICC A;  2KQR A;  3MQ0 A;  1W0U A;  1T38 A;  1WZ2 A;  5J40 A;  3LNQ A;  4XLP F;  2Q8K A;  4MEX F;  1VQ7 I;  1R7J A;  2ELH A;  1U9O A;  2DTZ A;  4ZYD A;  2HDW A;  1J5Y A;  4XON A;  2WAF A;  5DM6 F;  3WTW C;  5HS8 A;  3BCB A;  3H3Z A;  3G4S I;  2IS4 A;  3LAP A;  3E6C C;  4A5N A;  1HST A;  2E5Z A;  3CC2 I;  3H9J A;  4LOC A;  3TW7 A;  4RBO A;  1VQM I;  1W1W E;  2E35 A;  4XR6 A;  2CG4 A;  3BG7 A;  3MN2 A;  4V2F A;  4KIT B;  3HOX J;  4I6Z A;  4BXX J;  3CTA A;  3KP2 A;  3ZN1 A;  4YRV A;  2O9L A;  2NAZ A;  3T8T A;  2ESH A;  5CYV A;  3I0T A;  4M72 A;  3S3O A;  5J4Y A;  1W0T A;  3S1R J;  3TO9 A;  5GAD J;  1JKQ C;  4XNF A;  1UG0 A;  3JRA A;  2IA0 A;  3BP8 A;  1TW3 A;  2DOE A;  1MDM B;  3HSF A;  3RYP A;  2UZK A;  4AIJ A;  2BZT A;  1NG7 A;  1J09 A;  1MMN A;  1IDY A;  2HPI A;  2NOG A;  1ZRD A;  2GOX B;  4RAG A;  4NUB A;  1VQ4 I;  1WVR A;  5KHD A;  5K7H A;  4N0B A;  1BR1 A;  5M3F J;  4ZH4 F;  3C2H A;  3GTO J;  3IRR A;  2I5U A;  1R1V A;  1TZL A;  4FX4 A;  2HKO A;  4PGG A;  2H1K A;  1MGT A;  1LEA A;  2M1B A;  3V7C A;  3J7Y J;  2W7N A;  4KIS A;  2VQH A;  2Y0S A;  3V42 A;  1TQP A;  1RIO H;  3CLQ A;  2K85 A;  2X48 A;  2R7Z J;  1HDP A;  1P4A A;  2GWR A;  5M5Y J;  4XID A;  3K4B A;  5J8C A;  3SJM A;  1GXP A;  4GO1 A;  2IP2 A;  4WF2 A;  3A0B C;  1BC8 C;  2LDU A;  2DFE A;  3M4O J;  1XCB A;  3LOC A;  4I02 A;  1J75 A;  2R7U A;  3BG3 A;  3DEU A;  3CCY A;  4QPQ A;  2K9N A;  2Y69 H;  3FHN A;  3R4K A;  4ZZL A;  3DPU A;  1R5I D;  2OZU A;  1SVM A;  2IA1 A;  4IKF A;  1X3Z B;  4CA0 A;  4CO8 A;  4F55 A;  1WGX A;  4A12 A;  4HLY A;  4ZYG A;  4HZF A;  2WV0 A;  3SYT A;  2MLK A;  2R3S A;  3A0H C;  2CU7 A;  4A6D A;  4XN3 A;  1VQP I;  5JHF A;  1GT0 C;  2L01 A;  1MJB A;  4D5F A;  3I54 A;  4M3F A;  1TW2 A;  1ZR2 A;  1WH7 A;  2OCC H;  4RGX A;  3BOQ A;  2FJ1 A;  4RA2 A;  1J0R A;  2LRD A;  4M3E A;  2PLY A;  1RKT A;  2JA2 A;  1X58 A;  2WB1 N;  4QLC U;  1N78 A;  4CZZ A;  2ELK A;  2K5C A;  1MDM A;  2DQL A;  1IUF A;  1XGN A;  1T95 A;  2R7F A;  3E5X A;  3KX2 A;  3KE2 A;  2QVO A;  1S72 I;  5DM7 F;  3W3C A;  2VXD A;  3ZR8 X;  2GIZ A;  1KGS A;  1ZEL A;  3Q0U A;  4E7H A;  5GAH J;  3MCZ A;  2BEO A;  3OYM A;  3FK6 A;  2FBH A;  2XKP A;  3JRB A;  1E17 A;  3ZQG A;  2ZKZ A;  1YS6 A;  2CJJ A;  1MBK A;  1KU2 A;  1Z05 A;  1MH3 A;  3H0D A;  1DDN A;  4HF0 A;  3WE3 A;  2HYJ A;  3NQO A;  1OMI A;  4I0B A;  4K2E A;  3UNG C;  1K6O A;  1JUP A;  3KLO A;  3F0C A;  3JRI A;  4EMS A;  1TQI A;  2XAH A;  4GRI A;  3BTI A;  2C6Y A;  2E1M B;  2GA1 A;  4JYK A;  2GQQ A;  1ZQ3 P;  2K27 A;  2Z16 A;  3VOE A;  3BG9 A;  3V8L A;  5JI6 A;  9ANT A;  4EQQ A;  4CCK A;  2CQX A;  1FTZ A;  4C3H J;  1ETO A;  1RKW A;  2LD5 A;  2CUF A;  1ZH5 A;  1R5H A;  2ECC A;  1QO0 D;  2GA2 A;  4M9Z A;  2KIF A;  1B4A A;  1XSV A;  1K4S A;  1QVU A;  2MW8 A;  4UV8 A;  3J80 Z;  1BA5 A;  1WJA A;  2X4H A;  3I64 A;  2G9W A;  3CCU I;  1WI3 A;  4M74 A;  3PO3 J;  4MHG A;  1OLT A;  3QOD A;  3S2W A;  1LFU P;  1OCR H;  4MIM A;  3U21 A;  5B66 C;  4LMY A;  2PMU A;  1E3H A;  5IPA A;  1FC3 A;  2ME0 A;  1XG1 A;  2HXI A;  1Z0X A;  2CUZ A;  3R61 A;  2STW A;  2RNJ A;  1WH5 A;  3MAJ A;  1T08 B;  1GV5 A;  3OOU A;  2MYS A;  3X2Q H;  2VN2 A;  2DO7 A;  4BQQ A;  3CUQ C;  2QM3 A;  3CMM A;  1KYZ A;  5E1X A;  4BKX A;  1R1T A;  2BXY A;  4EJO A;  5D8L B;  3RKX A;  4BHC A;  1QBJ A;  4LGW A;  1JHH A;  3HXL A;  1KU9 A;  2Z5U A;  5HOD A;  3KEO A;  2DJI A;  2K4B A;  5B1A H;  3DKY A;  1ETY A;  1A04 A;  2Z3Y A;  3VYS B;  4HV5 A;  4MEY F;  5F1R A;  4X0G A;  2FUG 2;  3E5U A;  5JFR A;  3HOV J;  4I7H A;  3LQQ A;  2R5Z A;  2JWT A;  1WRJ A;  3FBN B;  4HG2 A;  5LEK A;  3QP6 A;  1Z7L A;  1UJ8 A;  1LJ9 A;  4G6T B;  1HKT A;  3GTG J;  4P5O A;  2VUM J;  4DNC A;  3VYT B;  3QRF F;  3OSG A;  1CGP A;  1LPQ A;  2BY2 A;  4E7I A;  3DBL B;  2YSR A;  4CYC B;  4YIR X;  4FHT A;  2HFH A;  2E1O A;  2L2O A;  4HPQ A;  4XLF A;  4S0H B;  1JKP C;  2A05 A;  1ZYR F;  2DDB A;  2XF7 A;  1T98 A;  1HW2 A;  1D5V A;  5CLS A;  1GDT A;  1K79 A;  1SVL A;  2EQR A;  3FXM A;  2Z9O A;  3RPQ A;  3FXO A;  2WY8 Q;  2A6T A;  4ZYH A;  3ULQ B;  4M3G A;  3WGG A;  1K6Y A;  1S9H A;  4RB3 C;  2M3A A;  2XSD C;  4XLE A;  4CCO A;  2FD5 A;  5C4J J;  2BW3 B;  3E97 A;  5FRN A;  2A5Y B;  1MMG A;  3WTX C;  2PX9 A;  4JQF A;  4Y7N J;  2R7S A;  3L2R A;  4UXN A;  5E3O A;  3C1D A;  5EJC A;  1KQ9 A;  5TRD A;  1FY7 A;  2MG4 A;  3RIR A;  1SMT A;  1D3Y A;  1EKE A;  3CO6 C;  4KN4 X;  5D5W B;  5EG0 B;  3O6B B;  1HSJ A;  1P7J A;  1KQ8 A;  1RR7 A;  3FXQ A;  4EVI A;  1XS9 A;  3GTK J;  4CCL A;  1ZLJ A;  2LVS A;  4HDV A;  3SQN A;  2L3D A;  1O7L A;  3RQ4 A;  4OIR F;  4X6A J;  2DYR H;  2BOL A;  3K69 A;  1PVE A;  3HL2 A;  2FOK A;  3DKX A;  1Z6R A;  3A01 B;  2PJR A;  2HQA A;  2F5D A;  2WAE A;  3GTL J;  1SFU A;  2LKS A;  4N4N B;  4L0Y B;  3DXJ F;  2ZO4 A;  2JA8 J;  1T0F A;  2FRH A;  1L3L A;  3FKI J;  2K9M A;  1XD7 A;  2UXX A;  2CSO A;  5HLI A;  3IC7 A;  2KMU A;  2ZJR F;  1XCV A;  2JSP A;  3H3U A;  3M9A A;  2ZNZ A;  4LG0 B;  3TO6 A;  4HDU A;  5DCM A;  1Y8Q B;  4HW0 A;  3ZGK A;  4XKC A;  2B7E A;  3DCF A;  1TT0 A;  2MC4 A;  4U0Y A;  1KQ0 A;  5E18 F;  3JSP A;  3LST A;  3I4M J;  2XVC A;  4L9T A;  2FF4 A;  3F6V A;  5KNL A;  2YX7 A;  4LD5 A;  2EZK A;  2XGE A;  4G7O F;  1CQT A;  3W6V A;  3DTK A;  3RTR A;  1EH7 A;  3ZQL A;  1SMY F;  3DQV C;  3PIP F;  5HDG A;  4AD9 A;  4XKB A;  2EPF A;  1OQY A;  2OD5 A;  3TMO A;  3DFG A;  1DPU A;  2VXZ A;  3CJR B;  2Y9Y A;  3IH3 A;  1FIA A;  4X1E A;  2BV6 A;  2HVQ A;  1NH3 A;  2NNY A;  1TWF J;  2RRE A;  2BE5 F;  5AIQ A;  3PFI A;  4E4H A;  1BR2 A;  2R7O A;  2VJJ A;  5FLM J;  4G7Z F;  4I98 B;  2VLA A;  3E0J B;  4FT8 A;  4WX9 A;  1YLF A;  5F0H A;  2G7U A;  4HNV A;  3DV8 A;  2F2E A;  4A3M J;  1DUX C;  2FA5 A;  3JRF A;  1S6L A;  3J80 K;  4A3J J;  2CH0 A;  2B63 J;  1HF0 A;  1FPQ A;  1UHM A;  3DEE A;  4J19 A;  3WE2 A;  3RZD J;  2FQ4 A;  4IOA F;  1MMD A;  4AU7 A;  2Y31 A;  1YI2 I;  2H1L A;  5HDN A;  2QCO A;  2HGC A;  2H8W A;  1U5T A;  1FSH A;  1G3Y A;  4KYW A;  1MIJ A;  4C9Y A;  1XPX A;  3PNV A;  4L9J A;  3UKG A;  3OYA A;  3S2D J;  5CQG A;  2F6C A;  3JR9 A;  2XAF A;  1FOK A;  3CP2 A;  4XQF A;  1EJ9 A;  1K83 J;  4BE0 A;  2NRA C;  3CDL A;  4E7S A;  4B3X A;  4JOM A;  1I3Q J;  1G8X A;  3KP7 A;  2Y9Z A;  4A5M A;  1JHF A;  4IO9 F;  3VOD A;  2XKO A;  3SZG A;  1A6Q A;  5CVV A;  3L1P A;  3F6O A;  2AQE A;  3TP0 A;  2W85 A;  2LC2 A;  3C3W A;  1LE8 B;  2DA2 A;  4YFX F;  3FF5 A;  1HQC A;  4JX6 A;  4BQA A;  1D0X A;  2NOJ B;  2H09 A;  5FGM A;  1G6N A;  2IGN A;  3GBG A;  4AIK A;  2HYG D;  1B9M A;  2L54 A;  5DCF A;  3O8H A;  3GF2 A;  5L3F A;  1FBQ A;  3WHC A;  3S3N A;  3IAS 2;  5EGO B;  2DI3 A;  1V54 H;  2K02 A;  3JRD A;  3O3K A;  4IQJ A;  1JTY A;  1UST A;  4YFK F;  1BJZ A;  4LIU A;  1SEU A;  3T1B A;  1U78 A;  1H9T A;  3MFK A;  2E1M C;  4WWC A;  3SDG A;  3JTH A;  3FMS A;  4BBR J;  2I10 A;  1YFH A;  3BJA A;  3ZQF A;  4M6V A;  4UV9 A;  2E5N A;  1IDZ A;  3U1D A;  1IN8 A;  1ETK A;  4NHJ A;  4QWQ A;  2LTP A;  2CW0 F;  2IPQ X;  1IN7 A;  2PFB A;  2V9P A;  1BI1 A;  3OOP A;  2GM4 A;  1P2F A;  3K4C A;  4V19 K;  1O7F A;  1R58 A;  2XAS A;  2XAQ A;  3DBR B;  3ZMD A;  1HOM A;  1UMQ A;  1U0J A;  3FXK A;  2KPM A;  1SD6 A;  4BL0 B;  4BY1 J;  1D5Y A;  3QYE A;  2OPT A;  3HC7 A;  1FIP A;  4V2G A;  3KCC A;  5FFZ A;  4UVA A;  2IS1 A;  4XL9 A;  2NVU B;  1TWA J;  3CDH A;  4M9X A;  1RPW A;  2ECB A;  3AL0 C;  3F3X A;  1OYY A;  2DA5 A;  3HB9 A;  3T0Y A;  2VL8 A;  3TW6 A;  1IXS B;  1PYV A;  3K1N A;  3RI4 A;  5ICE A;  4O5V A;  3GFJ A;  4YFN F;  2ID6 A;  1POG A;  4BHB A;  3EUH C;  2FML A;  3LSP A;  1KZH A;  4RGR A;  1R4N B;  5LD2 C;  3KP4 A;  2F5C A;  2DFH A;  2FOW A;  5HNF A;  3BR2 A;  3A1Y A;  4BJT A;  2W00 A;  5AON A;  3VPR A;  1ZHF A;  2E2H J;  1JJ6 C;  1HDD C;  1UAA A;  4YG2 F;  5H2F C;  3HM5 A;  1B6A A;  2QUF A;  3GWZ A;  1JUS A;  2DA7 A;  3U9G A;  4RDU A;  3OYJ A;  5J1R A;  3FM5 A;  3M1C A;  4RS8 A;  3MKY B;  4CHU A;  3H1C A;  2M0M A;  3U2R A;  2WWY A;  2HTJ A;  2HOT A;  2OQG A;  2Q2E B;  1FX7 A;  5DUK A;  4MFE A;  2BYV E;  1QQI A;  3ECO A;  3R60 A;  1OR7 C;  3V8K A;  4BHP A;  1W4M A;  1XN7 A;  1W7P B;  2ZXW H;  3G1L A;  4C2M J;  5DS9 A;  4NQW A;  5EGO A;  1G59 A;  4DYR A;  3K6G A;  4DBR A;  4ZDO A;  2CV2 A;  2PG4 A;  3HKZ A;  4D7N A;  1RZ4 A;  3WTU C;  1BOB A;  1QRY A;  3T5X A;  1ZRF A;  4O3M A;  5LEJ A;  3WG7 H;  4XM3 A;  1IRF A;  3E5Q A;  4CCN A;  3H0G J;  1K61 A;  4XSX F;  3AG2 H;  1I39 A;  2EFQ A;  1B8I A;  1IXC A;  2MH9 A;  1FOW A;  4XK4 A;  2V6E A;  3CCS I;  1MMA A;  3S17 J;  4Q4Z F;  3FWE A;  4WXD A;  3TOB A;  2A07 F;  1SD7 A;  3CCJ I;  3ZMZ A;  2TDX A;  3B6A A;  2E34 A;  2XAU A;  3VEP A;  3GVA A;  2ZXH A;  1S3J A;  5E17 F;  2BY3 A;  1BR4 A;  4F91 B;  3S16 J;  1YIT I;  1VQ6 I;  3HHH A;  3K7A J;  2RQQ A;  4M3D A;  3ASN H;  4CIC A;  3BRO A;  4XOT A;  5C4X J;  2JZY A;  5ICG A;  3G71 I;  3HPH A;  2RGV A;  5GAG J;  1F9N A;  3BQY A;  2CMP A;  2JSC A;  5FLV A;  3VWB A;  5B3S H;  4EJW A;  4CXF A;  4E7K A;  1NTC A;  4A3K J;  2WC2 A;  3BWG A;  3S8P A;  3ZMS A;  1X2N A;  2Q1Z B;  1T8I A;  3F9K A;  1KON A;  2KDO A;  2Q2E A;  3Q9S A;  2W4S A;  2FX0 A;  1H0M A;  1FP1 D;  2LRE A;  3BJ6 A;  1V4R A;  2EV0 A;  1N77 A;  3BQZ A;  3GUD A;  2K9S A;  2V1N A;  1F36 A;  3L2U A;  2DBB A;  2QF7 A;  1G3T A;  1TBX A;  1W7P A;  2DPD A;  1A6I A;  3FBI B;  4KDP A;  4FAS D;  1H88 C;  4N9I A;  4L0Z B;  2RN7 A;  2KIQ A;  2RC4 A;  3ZP5 A;  5LGU A;  1BI0 A;  1ENH A;  3HPG A;  4Y52 J;  5FFX A;  2ZFW A;  4WXC A;  1WJF A;  2Z1D A;  4U0V A;  1IRZ A;  3WTV C;  3RKQ A;  5J47 A;  4BE1 A;  1J7K A;  1OYI A;  3CCR I;  1MNE A;  4MQ9 F;  2X85 A;  1VQ5 I;  2JUG A;  4ENK A;  5L3E A;  2R5Y B;  3F21 A;  3OYK A;  5KK1 A;  3CDI A;  4ZZD A;  4WCG A;  2HEO A;  4TV7 A;  2CWE A;  4E7Z A;  5B5E C;  3J7A O;  3ERM A;  1W36 C;  2P6T A;  2DK5 A;  3S14 J;  2X1D A;  3S15 J;  3F72 A;  3TGN A;  3MZH A;  2DMU A;  4NC7 A;  5AIP A;  2LKX A;  1SAU A;  1J2X A;  2KIM A;  3I4N J;  4KUM A;  3KYC B;  3K4K A;  3CJQ B;  2HI3 A;  3CCV I;  1HCR A;  1Z67 A;  2JT1 A;  3M8J A;  4YEJ A;  3COA C;  1IN4 A;  4U7B A;  1PUF A;  1Z91 A;  1Q1V A;  1KU3 A;  4UUS A;  2X6Y A;  2E71 A;  2OA4 A;  1I27 A;  1K7A A;  2XUB A;  1YW9 A;  5FRO A;  3RYR A;  4F7Z A;  2WY7 Q;  3H9G A;  3S93 A;  3L2W A;  4GXO A;  3FIS A;  3ZQ7 A;  3CJN A;  3HRM A;  1JT6 A;  3HYI A;  5CVU A;  4E7L A;  5BOX A;  1OYW A;  5D5X B;  1MBF A;  3KPH A;  2E2J J;  1PP7 U;  5FB2 A;  1MMS A;  4YIF A;  3MEX A;  3J81 K;  3GCM A;  1EH8 A;  1F1Z A;  1ODD A;  4MTD A;  2DT5 A;  5DD4 A;  1QVT A;  3IKT A;  3WGH A;  2ID3 A;  1APL C;  4J01 A;  3ZPL A;  2XAG A;  3K9T A;  3ROU A;  5F0C A;  3W6K B;  1BI2 A;  2OUM A;  1XGM A;  3HOZ J;  1QHH D;  2OQR A;  2HQ5 A;  3LSM A;  2QSH X;  1OPC A;  5FKK A;  1UCR A;  1A36 A;  3S1M J;  2ZSH B;  5E3M A;  2HQR A;  2WAQ N;  5E1Z B;  4DZP A;  1SD5 A;  2O03 A;  1YS7 A;  3CC7 I;  2W1O A;  3GFL A;  4A0Z A;  2HOS A;  1FBU A;  2IBD A;  2PMZ A;  3I59 A;  4D0P A;  5ILU A;  1OCZ H;  4HNU A;  3I56 I;  1YRN A;  3L2V A;  3CUO A;  1ZK8 A;  2LMD A;  1FZP B;  4EGY A;  3CMA I;  3JAM K;  4DYQ A;  1P7I A;  4LIV A;  4ITV A;  2IT0 A;  3OL3 A;  5EEH A;  3H35 A;  2R5Y A;  2TCT A;  3GO5 A;  1HBX G;  1SAX A;  1TT5 B;  4FTH A;  1V5G A;  5EF6 A;  2CW8 A;  1WHU A;  3HIF A;  2LYC A;  2K40 A;  3RCO A;  2HTS A;  3A4C A;  2EK5 A;  2RNG A;  1VZ0 A;  1LVK A;  4DJA A;  1U8B A;  3CC4 I;  2E36 A;  4A3B J;  1S7O A;  3MMY B;  1RNL A;  1BIB A;  2DA6 A;  2IGO A;  3MKL A;  2UUZ A;  1QNT A;  3AAF A;  3M8F A;  1RUN A;  4XIC A;  3RKW A;  3I9V 2;  1ONV A;  2RKH A;  4XSZ F;  3DTI A;  2UV1 A;  4BS9 A;  2R5Z B;  3GZ6 A;  3FX3 A;  2VPR A;  2XGX A;  3REO A;  3JSO A;  3H3V K;  1YHQ I;  2ZB9 A;  2RVC A;  4XN0 A;  1ZN2 A;  1YOV B;  1Z77 A;  1BW5 A;  3EPZ A;  5IOZ A;  2L4A A;  1D8J A;  5IOY A;  3AFH A;  2NS0 A;  2DOF A;  4HX8 A;  1GUU A;  3ONQ A;  2F4M B;  2DYS H;  2F4I A;  1GV2 A;  2A6E F;  4KMF A;  4EM0 B;  1Z3X A;  1Y1W J;  3JTG A;  3SDB A;  3HOU J;  3RQI A;  2VC0 A;  4II3 A;  3JRC A;  3T8R A;  2R7T A;  3E6M A;  3LA3 A;  4PSW A;  1IC8 A;  2L02 A;  3CF2 A;  3ABM H;  1DQU A;  2KDZ A;  1V5E A;  2MFZ A;  3B73 A;  1EF4 A;  5E8G A;  2XC7 A;  2HKX A;  2F48 A;  4PK4 A;  5LBQ A;  4G6Q A;  2ZME B;  3EYI A;  4CSW A;  5LFA A;  2XF6 A;  2FNP A;  4KJZ A;  3SFI A;  3U1K A;  4RM2 A;  4IXA A;  4BEH A;  5IT9 Z;  3G2B A;  3SEZ A;  3C18 A;  1B59 A;  2PJP A;  3FXJ A;  2EIL H;  4ZDL A;  3PQK A;  1S29 A;  2FE3 A;  5EZG A;  1FBS A;  2JMW A;  4II2 A;  2VQG A;  4MQV A;  3HOS A;  1X1A A;  4HNT A;  3LFK A;  1TL8 A;  5FKM A;  2DMN A;  2LSO A;  4OAY A;  3M07 A;  4G7H F;  2EV5 A;  4UUV A;  3B02 A;  1RET A;  1JT0 A;  2PJR B;  3RPU D;  2VKV A;  3GZN B;  2MH2 A;  2O8K A;  2EZH A;  4HF1 A;  4CH7 A;  4IZZ A;  2ELJ A;  4Y15 A;  3VB2 A;  4DIQ A;  2FQ3 A;  4HQM A;  5KCM A;  4BJ6 C;  3OIO A;  3BZC A;  4JX5 A;  1Y56 A;  2YU9 J;  1JJ8 C;  4R1H A;  4LLL A;  1O4X A;  2LY2 A;  5DCM B;  4L9V A;  3DWL E;  1R22 A;  2L9R A;  2WA0 A;  4OIO F;  4U7D A;  2NVT J;  1LFB A;  2IGM A;  2E7W A;  5D5U B;  2I8D A;  3AG3 H;  1BI3 A;  3DU6 A;  4NBQ A;  4BUP A;  2X1E A;  1TC3 C;  2X51 A;  2ESN A;  4KIC A;  3UR3 C;  2DJN A;  4A3I J;  2DT6 A;  1Y1V J;  2JVG A;  2VE9 A;  4IQ4 A;  4AYB N;  3K70 C;  4GFB A;  2G7H A;  2LG4 A;  4KN7 X;  4QSH A;  4KT5 C;  3CMY A;  4GCV A;  1Y8R B;  4RLF A;  5LHH A;  2P7V B;  5J4V A;  3NRV A;  3IUO A;  4LK0 F;  3S2H J;  2GBY A;  3KYD B;  1IXR C;  2ZME A;  5FJ8 J;  3L2C A;  3JCU C;  2W24 A;  3LA7 A;  4S04 A;  2CW7 A;  4JK1 X;  3SZT A;  2JJ7 A;  4A2U A;  1QPM A;  2A3S A;  4RGS A;  1YIJ I;  1XDU A;  3EQL F;  3CLO A;  3BZK A;  4HRI A;  3OYD A;  3QOP A;  4IHV A;  1XSD A;  3K1P A;  1FJL A;  2WTE A;  4U88 A;  4A0X A;  1VI0 A;  2M4K A;  5KAI C;  3N4M A;  4AM3 A;  3ZQC A;  4L5I A;  2MAB A;  3BC8 A;  2VC1 A;  4C2U A;  2CUJ A;  2NNN A;  5KVR A;  4FE4 A;  2LKP A;  1U5T B;  5LHI A;  1B72 B;  3TED A;  5HS7 A;  2VKE A;  2R7Q A;  5GAE J;  3ZOB A;  4ZDP A;  1BW6 A;  2L7K A;  2V1D A;  1FLI A;  4F92 B;  5HS9 A;  1YW8 A;  2MLG A;  1STZ A;  1R23 A;  2NVQ J;  1Y6I A;  2DOA A;  2XRN A;  3TKY A;  3I55 I;  3E6B A;  3NWS A;  1GLN A;  2CQN A;  2IXS A;  2KKO A;  4ENM A;  2XRL A;  3H5N A;  4XLC A;  2P6S A;  4B48 A;  1MBH A;  2Q0O A;  3HGY A;  1LDJ A;  3IWZ A;  3Q0W A;  2VQC A;  1PUE E;  2DQR A;  1OCP A;  1WJE A;  3GX4 X;  2QYO A;  3BJO A;  4HF2 A;  2HDD A;  1WKM A;  3G1O A;  3DTE A;  4M3B A;  3A2K A;  3HUG A;  3K4M A;  2FBK A;  3ZQQ A;  2PBI A;  2FSW A;  2JA7 J;  2V4J C;  2AQF A;  2L4M A;  4LFU A;  4BY7 J;  2D1H A;  3I58 A;  4R8H A;  4W97 A;  1HW1 A;  2DFI A;  3FKJ A;  3WTS C;  2R7V A;  2HU9 A;  4G6D A;  4MNU A;  4L5J A;  4B44 A;  3G6E I;  1T56 A;  1O3R A;  3F8F A;  4M6Y A;  3ZQH A;  2VOD A;  2OTJ I;  3P9C A;  4XKV A;  4XBF A;  3CCM I;  1R71 A;  3QU3 A;  2NXN B;  3W2W A;  5F04 A;  4BDY A;  1DU0 A;  4H4K C;  2HDC A;  1PP8 F;  1ZAR A;  2VT2 A;  2CQQ A;  2ZBK A;  3E7L A;  3LA2 A;  1JTX A;  5BPD A;  3KP6 A;  4CCM A;  2DU9 A;  1UZC A;  5ERI A;  3OYI A;  2BXZ A;  3O8G A;  1H89 C;  4IHS A;  4RAY A;  2O61 A;  3F8N A;  4P96 A;  1NG6 A;  2P8T A;  1XGO A;  2Y30 A;  1IZ1 A;  1XSX A;  2V1X A;  2LY9 A;  5JVG F;  2KRH A;  2M8E A;  1RUO A;  4EM1 A;  1MKM A;  1VQ9 I;  4HSR A;  3CME I;  2OAZ A;  1B72 A;  4PDK A;  5CJ9 A;  2XF5 A;  5J1Y A;  5A2Q Z;  2ZC2 A;  2HYF A;  3M1E A;  3QYB A;  3OYG A;  2AXL A;  2E19 A;  4IEJ A;  1REP C;  3ABT A;  3SXY A;  4EAT A;  4OMY A;  1Z7U A;  2RDP A;  2Y0S N;  2HZD A;  1FYK A;  1GVD A;  1SFE A;  1RRJ A;  1E2X A;  1V3F A;  2ADU A;  1XX5 A;  2QEX I;  4ENN A;  2M8G X;  3KYL A;  2OJE D;  3M7G A;  4Y3O A;  5K7F A;  1VQK I;  2E60 A;  1LB2 A;  2A5W A;  3WTY C;  5E79 C;  1A5J A;  1ZGW A;  6PAX A;  4ON0 A;  2V7F A;  1GVJ A;  3QU6 A;  1H8A C;  1WCM J;  4B43 A;  5FLX Z;  3N05 A;  2PN6 A;  2QSF X;  3DBH B;  2QEN A;  4AWX B;  1W5S A;  2UXN A;  3AG1 H;  3MVP A;  4NQW B;  1OCC H;  3ZMU A;  4BDZ A;  1ZTR A;  1F5T A;  3LMM A;  2OCE A;  1X1D A;  4HLX A;  1X3U A;  3BR6 A;  2VE8 A;  1C0W A;  2Y0M A;  2B0L A;  3OSF A;  3ELK A;  1Y0U A;  4D5C A;  3L09 A;  4IL6 C;  4RM3 A;  2GIV A;  2IRF G;  3I53 A;  3C7J A;  2OU2 A;  2K4J A;  2PI0 A;  3GFM A;  3BG5 A;  3DPT A;  2WB1 A;  4J00 A;  2LH9 A;  4U87 A;  3KZY A;  1FP2 A;  1LEB A;  2JN6 A;  2BVM A;  4D7M A;  2HS5 A;  1B8I B;  1I1G A;  2LF8 A;  1TWC J;  2F5E A;  2XSJ C;  3QPS A;  2TRT A;  5FD5 A;  1U3E M;  2JRM A;  5EDN A;  1ORK A;  1T39 A;  1TTY A;  2XPV A;  1D0Z A;  2W25 A;  3FIW A;  3J7Z I;  3CCQ I;  2BVL A;  1CF7 A;  2KZG A;  1YYV A;  3A02 A;  4KIF A;  2HNH A;  2ZJQ F;  2V6C A;  1VND A;  3IP4 B;  3N97 A;  1SD4 A;  1FMV A;  4OIN F;  3W6J B;  1ZG3 A;  3TL4 X;  1IRG A;  3H5A A;  1D1C A;  4LB5 A;  4XMY A;  4XLN F;  4AVZ A;  2R7X A;  1ZGA A;  2EIK H;  1ON1 A;  2KJC A;  4R79 A;  2OTL I;  2GXB A;  2QQB A;  5FKL A;  5D4R A;  3DF8 A;  3PQJ A;  1S7E A;  3HHG A;  3PUB A;  2COB A;  4EM2 A;  5M5X J;  2M45 A;  2COM A;  3SEQ A;  1YJ9 I;  3OYF A;  1T0F C;  5L3G A;  1FEX A;  3S3M A;  4PUS A;  3PSF A;  2PQ8 A;  2A61 A;  4YII A;  3JW4 A;  4IPA A;  4ESF A;  4I76 A;  2GXG A;  5D5V B;  2VKD A;  4PJL A;  4F3Q A;  4NNJ A;  2M2E A;  5HDK A;  2K3P A;  3BLY A;  4BYY A;  2CGP A;  2LOO A;  4B8X A;  3DLL F;  3DU5 A;  1P9Q C;  2QBY A;  5ICF A;  3V7R A;  2CUE A;  1ETQ A;  2OV7 A;  3Q0V A;  5M3M J;  2MD0 A;  2IS6 A;  1D0Y A;  2D1V A;  1TP4 A;  2YU3 A;  4A3C J;  4IRG A;  1MH4 A;  1B9N A;  2KIS A;  3RKY A;  1GHC A;  4N9H A;  3BPX A;  2ZXJ A;  3HOT A;  3BR3 A;  1TLH B;  3CJT B;  3HBL A;  1YE9 A;  1MBE A;  3O2P E;  2N8G A;  1U8R A;  4IHX A;  1TWH J;  1X3W B;  4AIH A;  3FXR A;  3F8C A;  3FDY A;  5FKN A;  3AKZ A;  1ZR4 A;  3GME A;  1WQ2 A;  3GEZ A;  4DOZ A;  3OV8 A;  1AKH B;  1QZE A;  4HAM A;  3H9Q A;  1DU6 A;  1E3P A;  2L7F P;  2GLO A;  2HVS A;  4A3G J;  1O57 A;  2EV6 A;  2VBY A;  1G3S A;  2FU4 A;  1FYM A;  2M9H A;  2VT3 A;  2QQ9 A;  1S8N A;  2QZ8 A;  3GZ5 A;  4YEL A;  2P0W A;  2M30 A;  2GOM A;  1A31 A;  1RR8 C;  1U6G A;  2JA6 J;  1N25 A;  1R4M B;  3CUQ B;  4IRH A;  1VTN C;  3DP7 A;  3QPL A;  3ZQI A;  2Z33 A;  3K2A A;  5JLX A;  1ON2 A;  1JE8 A;  3P9I A;  4CCJ A;  1MND A;  5F64 A;  3LSR A;  1XB4 A;  1JGG A;  1U5T C;  1MW7 A;  1EA3 A;  4CDG A;  1PUF B;  1JUM A;  4UUS B;  1RES A;  5FO5 A;  3RZO J;  3S1Q J;  2G0E A;  2XIG A;  1U2W A;  3MKZ A;  3GTP J;  2O3F A;  4BE2 A;  1WJC A;  3PM1 A;  5F27 A;  3HSE A;  2V79 A;  4Q48 A;  1SFX A;  4UHT A;  1H9G A;  2E7X A;  2BGC A;  2GXA A;  3LL7 A;  1IUY A;  4B09 A;  1EV7 A;  1FT9 A;  2A6H F;  2W84 A;  3P7N A;  2DW4 A;  3PNY A;  3OS1 A;  3C2B A;  1I1S A;  4B1R A;  3HRT A;  5CPR B;  2MSY A;  1BC7 C;  3K4L A;  3IL2 A;  1BL0 A;  4XRS A;  4G9Y A;  4S05 A;  4HST A;  2W48 A;  1IJW C;  1QA6 A;  5J6X A;  1B1B A;  4EEF G;  2LR8 A;  1HKQ A;  2O8X A;  3LSH A;  5J3L A;  3E3V A;  4PSX A;  3I59 B;  2IW5 A;  4HOB A;  2B9S A;  2L9S A;  4MFD A;  3C2G A;  1YRN B;  1X2M A;  2K9Q A;  5CQE A;  3KIO A;  1YX3 A;  2WBM A;  2NS7 A;  2ME6 A;  2RAE A;  1MSF C;  2AS5 F;  1AKH A;  2X9D A;  3MZ8 A;  3MZY A;  4P55 A;  2HOA A;  1I6X A;  4C3J J;  4IHT A;  1P92 A;  1W36 D;  1R5G A;  4G12 A;  3S32 A;  4A6E A;  3BR0 A;  1TWG J;  2VAS A;  1IV6 A;  4BGD A;  1LNW A;  1M1E B;  5LGT A;  5M5W J;  2EFP A;  4M6X A;  1SAN A;  1JI8 A;  2XPW A;  1YX5 A;  2DT7 B;  1I5Z A;  1BM9 A;  3OL4 A;  5LLQ A;  2IS2 A;  2ISY A;  1P4W A;  5B1B H;  1ZRE A;  5BPI A;  2JVH A;  1K78 A;  4LJZ F;  2D5V A;  2HZT A;  1A35 A;  3CUQ A;  5IYB J;  1LDD A;  4CGZ A;  1HXD A;  3CF5 F;  3CCE I;  2DPU A;  3GXO A;  1XMX A;  5BNG A;  1YIO A;  2R4G A;  1QHG A;  5GP9 A;  1UFM A;  2M4G A;  1MD0 A;  1U9N A;  3QAH A;  1W5T A;  2R7D A;  2VJ4 A;  4ESJ A;  3FHZ A;  4ZTJ A;  2OBP A;  3KEY A;  4GGG A;  3TDU C;  1AWC A;  2XDV A;  4JX4 A;  1LVA A;  4NC8 A;  4PZJ A;  3JRH A;  2IVM A;  2WV1 A;  1VQL I;  1YG2 A;  3LSK A;  3B6C A;  4PJN A;  3RPU A;  2GAU A;  3FZV A;  1X1P A;  3GFI A;  3ABU A;  1R6R A;  2Z99 A;  3OYL A;  2DMT A;  2DTR A;  2KRC A;  2CQ7 A;  3R0J A;  2JTV A;  3TP3 A;  4ZJZ A;  4EJU A;  1W5C C;  4EGZ A;  4RGU A;  2KRF A;  4M73 A;  4BH9 A;  2H6B A;  2VJI A;  2X6X A;  4RAZ A;  3WTZ A;  1IAW A;  2P7C B;  1VQ8 I;  2XHK A;  4FIS A;  3BTL A;  4JP0 A;  2EIJ H;  4Y13 A;  3IH2 A;  4N4O B;  2R7R A;  1I50 J;  3WHB A;  2LF7 A;  2V1U A;  3J7A Y;  1WSU A;  2IJL A;  2L5Q A;  3OR1 C;  3GTJ J;  4BEH B;  3K2Z A;  3SFZ A;  4DYC A;  4ENJ A;  2CRG A;  2QKM B;  3EET A;  4ASN A;  3FMR A;  5K5R A;  1X4P A;  1X19 A;  4OWR B;  1V55 H;  3QP5 A;  5IT3 A;  2ICW G;  4OMZ A;  2DMQ A;  1AA7 A;  1XC5 A;  2EWN A;  1Z9C A;  2MGQ A;  2OC6 A;  2XGC A;  2XAJ A;  1HKS A;  1VF9 A;  4BQN A;  5DV5 A;  2VPL A;  5ILS A;  1E0E A;  3KET A;  1IGN A;  3OYE A;  3WTT C;  1DP7 P;  3BDD A;  3BG6 A;  2KJB A;  4ABZ A;  1Y39 A;  2OZ6 A;  3QQA A;  4HX7 A;  3HJE A;  3KZZ A;  4BBS J;  4XKW A;  1OKR A;  4AC0 A;  3KP3 A;  1LFP A;  4DGW B;  4A3L J;  3OYN A;  2X1C A;  4EJT A;  4IOC F;  5L3B A;  1XTA A;  1T6S A;  4P9U A;  2L0K A;  3BT9 A;  4MLO A;  1ZGJ A;  4ESB A;  2YPR A;  4M71 A;  2QQA A;  4C3I J;  3L7W A;  2CV0 A;  2MC3 A;  2MD5 A;  3DPL C;  1R36 A;  1UB9 A;  3VYR B;  2DMP A;  5D6F A;  3NEU A;  3G3Z A;  2VJ5 A;  3PIO F;  1OCO H;  2VON A;  3A03 A;  3BZ6 A;  3RSN A;  4NDL A;  4BQO A;  1N75 A;  5IP7 J;  4FX0 A;  3OS2 A;  1W7P D;  2KLO A;  3P9K A;  3CCL I;  3MD2 A;  2E1N A;  1Q1H A;  3Q9V A;  2JQ7 A;  3F23 A;  2LLK A;  2DA3 A;  1ETW A;  1G3W A;  5JLW A;  5TGT A;  1R1U A;  3I3L A;  5CVJ A;  4UVB A;  5C44 J;  3IH4 A;  3HOY J;  2L7M P;  4XLH A;  5D4S A;  5FD6 A;  3FXU A;  4IF4 A;  1DGR M;  2DAO A;  2QKL B;  2ACJ A;  5IP9 J;  1R00 A;  3LSJ A;  4LIT A;  2AXT C;  3LFU A;  4C30 A;  1LDK B;  5HLH A;  3WU1 B;  1GXQ A;  2EFW A;  2KP6 A;  2E1C A;  1DGW Y;  4L18 B;  1OFC X;  3TQN A;  4UVC A; 
#chains in the Genus database with same CATH homology
 3F8B A;  2QLZ A;  5E1W A;  3ERE D;  5F6F A;  3FMQ A;  2PEX A;  2FBI A;  1O3Q A;  5JVT A;  2JRT A;  2Y75 A;  5LRR A;  3L00 A;  1WI9 A;  3IWF A;  2P5V A;  4IJA A;  4HBL A;  3I71 A;  3V7S A;  3ZN0 A;  2O6G E;  3GW2 A;  4OU0 A;  2DK8 A;  2ZNY A;  1ZRC A;  3WOD F;  2P5K A;  4Q47 A;  2MBF A;  4P9F A;  5EEG A;  4OIP F;  4PGH A;  1S7A A;  5CVI A;  1O3T A;  5LRS A;  3IKV A;  2HOE A;  3F8M A;  3M8E A;  3HTU A;  1BBY A;  4M9S A;  1TNT A;  4HX4 A;  5H20 A;  1QZZ A;  1P4X A;  5H6Q A;  1KU7 A;  3HRS A;  2PMH A;  4I09 A;  5ED4 A;  3QPH A;  4I0A A;  2MA3 A;  1Z1D A;  5HLG A;  1G4D A;  5E20 A;  2STT A;  5D8K B;  4RB0 A;  1LQ1 A;  3TOA A;  1TNS A;  5DEQ A;  1YTY A;  1DPR A;  3GYH X;  5D6E A;  3K1M A;  3EUH A;  4MTE A;  3KLN A;  1FYL A;  2CFX A;  1XDS A;  3HSR A;  4EJV A;  1MJ9 A;  4E70 A;  5DDG A;  3ISP A;  2CO5 A;  1ZG1 A;  1IW7 F;  5LHG A;  3K0L A;  1BIA A;  2KIU A;  2V9V A;  1XMA A;  2VBX A;  4O6J A;  1F4K A;  3WG9 A;  3VFZ A;  4DQ2 A;  1XMK A;  4I01 A;  1OR7 A;  1P6R A;  5K1Y A;  1O3S A;  2D45 A;  3BY6 A;  3LQR A;  5E8I A;  3D5L A;  5BS6 A;  4IVN A;  2O0Y A;  1JXS A;  5HVQ C;  3GLX A;  4LLG F;  3TO7 A;  3QPT A;  5BMZ A;  3LWF A;  5DUI A;  5BQT A;  5CVR A;  1YW7 A;  1Z6T A;  2J5O A;  4U0W A;  5J8F A;  1CF7 B;  4UNO A;  5IT9 K;  2YX4 A;  3I4P A;  3ZMT A;  2EA2 A;  1YQA A;  3ECH A;  2FEZ A;  4OOI A;  1T2K A;  1IN6 A;  3WU0 A;  3CO7 C;  2A68 F;  1BJA A;  2YR2 A;  1QGP A;  4H0E A;  2F5F A;  2H27 A;  2QBY B;  4HV6 A;  1ZLK A;  1NHA A;  4PCQ A;  3F22 A;  4LG0 A;  1BOA A;  3HRU A;  3D0S A;  3LAJ A;  5K5O A;  2EJR A;  1HW5 A;  4BAY A;  2ETH A;  2VOP A;  2J5P A;  4BXU A;  1MJA A;  1J9I A;  4KIG A;  1D8K A;  2EA4 A;  4I2O A;  3RDI A;  3MWM A;  1TQM A;  2M87 A;  3HTS B;  1ZG5 A;  2CYY A;  2JPB A;  1FWZ A;  2D2W A;  3E6D A;  2EB7 A;  4NB5 A;  5L3C A;  4G94 A;  5JHU A;  4JBA A;  4XRF A;  3ZMV A;  1PDN C;  4RB2 C;  2EFO A;  1QZY A;  2FXA A;  2VBZ A;  2ZCW A;  1JGS A;  2GZW A;  2IA2 A;  4KNY A;  2FMY A;  1YO5 C;  2HR3 A;  2Y48 A;  3IRQ A;  1AOY A;  3V4G A;  4Y17 A;  3RJP A;  2P4W A;  2VBW A;  4GYI A;  2QWW A;  1ULY A;  3KEQ A;  5TJJ A;  3WGI A;  2HQN A;  4CYD A;  5K5Q A;  1RI7 A;  5HOO A;  3EDP A;  3Q5F A;  3J81 Z;  2X0L A;  4Z2Y A;  5LGN A;  3L9F A;  3TDZ C;  3V8J A;  2XRO A;  2M5W A;  4BNC A;  2H6C A;  1BN5 A;  2A69 F;  4AVP A;  4EV0 A;  4RB1 A;  2UWM A;  1XGS A;  2K86 A;  2H94 A;  4A0Y A;  4IRI A;  5H6R A;  3R0A A;  3JAM Z;  1IF1 A;  2DLL A;  5DD8 A;  3KFW X;  1USS A;  2W57 A;  2RQP A;  1IN5 A;  3ML6 A;  2CQK A;  1UHW A;  4OIQ F;  2FNA A;  4KIB A;  4HYE A;  1K78 B;  2K7L A;  3IHU A;  4Q5S F;  3SHF A;  4LLN A;  2RV8 A;  4HA8 A;  3DKW A;  3I5U A;  5ILV A;  1L0O C;  5DYM A;  3H92 A;  1FSE A;  5A2Q K;  4HQE A;  4L9N A;  3BPV A;  1MZB A;  4G8X A;  2NYX A;  2ISZ A;  4KMU X;  4GYG A;  3R6S A;  2HWV A;  3EYY A;  5JR3 A;  2ZJ2 A;  2LNB A;  3KP5 A;  4LK1 F;  3FM3 A;  1ZAO A;  4WXH A;  3G73 A;  4LB6 B;  1FNN A;  2EFN A;  2JPC A;  1EH6 A;  2BBY A;  5L3D A;  4KA4 A;  4WK8 F;  4MGR A;  2XV4 S;  3SZP A;  5FLX K;  2P5L C;  1WWX A;  2VOO A;  1J59 A;  1KYW A;  1KA8 A;  4ETS A;  4KFC A;  4ZYE A;  5ICC A;  3MQ0 A;  1T38 A;  4XLP F;  2Q8K A;  4MEX F;  1R7J A;  2ELH A;  4ZYD A;  1J5Y A;  3WTW C;  5HS8 A;  3H3Z A;  3LAP A;  3E6C C;  4A5N A;  1HST A;  2CG4 A;  3CTA A;  3KP2 A;  3ZN1 A;  2NAZ A;  3T8T A;  2ESH A;  5CYV A;  3I0T A;  4M72 A;  3TO9 A;  2IA0 A;  3BP8 A;  1TW3 A;  1MDM B;  3HSF A;  3RYP A;  2UZK A;  4AIJ A;  1ZRD A;  4N0B A;  4ZH4 F;  3IRR A;  1R1V A;  4FX4 A;  2HKO A;  4PGG A;  1MGT A;  1LEA A;  2M1B A;  3V7C A;  1TQP A;  1RIO H;  1P4A A;  2GWR A;  5J8C A;  1GXP A;  4GO1 A;  2IP2 A;  4WF2 A;  1BC8 C;  2LDU A;  1XCB A;  4I02 A;  1J75 A;  3DEU A;  3R4K A;  4ZZL A;  2OZU A;  2IA1 A;  4CO8 A;  4A12 A;  4HLY A;  4ZYG A;  4HZF A;  2WV0 A;  2MLK A;  2R3S A;  4A6D A;  2L01 A;  1MJB A;  3I54 A;  1TW2 A;  4RGX A;  3BOQ A;  1J0R A;  2PLY A;  4QLC U;  4CZZ A;  1MDM A;  2DQL A;  1XGN A;  2R7F A;  3E5X A;  3KE2 A;  2QVO A;  1KGS A;  3MCZ A;  2BEO A;  2FBH A;  2XKP A;  1E17 A;  1YS6 A;  2ZKZ A;  1Z05 A;  1KU2 A;  1DDN A;  4HF0 A;  3WE3 A;  3NQO A;  4I0B A;  1OMI A;  4K2E A;  1K6O A;  3KLO A;  4EMS A;  1TQI A;  2XAH A;  2C6Y A;  2GA1 A;  2GQQ A;  2K27 A;  3VOE A;  3V8L A;  5JI6 A;  4EQQ A;  1ZH5 A;  1R5H A;  1QO0 D;  2GA2 A;  4M9Z A;  2KIF A;  1B4A A;  1XSV A;  4UV8 A;  3J80 Z;  2X4H A;  3I64 A;  2G9W A;  4M74 A;  4MHG A;  3S2W A;  4LMY A;  2PMU A;  1FC3 A;  2STW A;  3R61 A;  2RNJ A;  3MAJ A;  2VN2 A;  2DO7 A;  3CUQ C;  2QM3 A;  1KYZ A;  5E1X A;  1R1T A;  4EJO A;  5D8L B;  3RKX A;  4BHC A;  1QBJ A;  4LGW A;  1JHH A;  1KU9 A;  2Z5U A;  3KEO A;  2K4B A;  1A04 A;  2Z3Y A;  5F1R A;  4HV5 A;  4MEY F;  3E5U A;  5JFR A;  4I7H A;  3LQQ A;  1WRJ A;  5LEK A;  3QP6 A;  1LJ9 A;  1HKT A;  4P5O A;  4DNC A;  3QRF F;  1CGP A;  2YSR A;  4FHT A;  2HFH A;  1ZYR F;  1T98 A;  1HW2 A;  1D5V A;  5CLS A;  1K79 A;  2Z9O A;  3RPQ A;  4ZYH A;  3ULQ B;  3WGG A;  4RB3 C;  3E97 A;  2A5Y B;  3WTX C;  4JQF A;  4UXN A;  3C1D A;  1KQ9 A;  5TRD A;  1FY7 A;  3RIR A;  1SMT A;  1D3Y A;  3CO6 C;  4KN4 X;  5D5W B;  3O6B B;  1HSJ A;  1KQ8 A;  3FXQ A;  4EVI A;  1ZLJ A;  4HDV A;  3SQN A;  2L3D A;  1O7L A;  4OIR F;  3K69 A;  2FOK A;  1Z6R A;  2F5D A;  1SFU A;  4L0Y B;  3DXJ F;  2ZO4 A;  1T0F A;  2FRH A;  1L3L A;  1XD7 A;  2UXX A;  2CSO A;  5HLI A;  3IC7 A;  1XCV A;  3H3U A;  3M9A A;  2ZNZ A;  4LG0 B;  3TO6 A;  4HDU A;  5DCM A;  4HW0 A;  4U0Y A;  3JSP A;  1KQ0 A;  5E18 F;  3LST A;  2XVC A;  4L9T A;  2FF4 A;  3F6V A;  2YX7 A;  4LD5 A;  4G7O F;  3RTR A;  1EH7 A;  1SMY F;  3DQV C;  5HDG A;  4AD9 A;  2OD5 A;  3DFG A;  1DPU A;  2VXZ A;  2BV6 A;  2NNY A;  2BE5 F;  5AIQ A;  3PFI A;  4G7Z F;  4I98 B;  4FT8 A;  4WX9 A;  1YLF A;  2G7U A;  3DV8 A;  2F2E A;  1DUX C;  2FA5 A;  1S6L A;  3J80 K;  1FPQ A;  1UHM A;  3WE2 A;  5HDN A;  2HGC A;  1U5T A;  1FSH A;  1G3Y A;  4KYW A;  4L9J A;  2XAF A;  1FOK A;  2NRA C;  3KP7 A;  4A5M A;  1JHF A;  3VOD A;  2XKO A;  5CVV A;  3F6O A;  2W85 A;  3C3W A;  4YFX F;  3FF5 A;  1HQC A;  4BQA A;  2H09 A;  5FGM A;  1G6N A;  4AIK A;  2HYG D;  1B9M A;  2L54 A;  5DCF A;  3GF2 A;  5L3F A;  1FBQ A;  2DI3 A;  2K02 A;  3O3K A;  1UST A;  4YFK F;  3T1B A;  1U78 A;  1H9T A;  3MFK A;  4WWC A;  3JTH A;  3FMS A;  1YFH A;  3BJA A;  4UV9 A;  3U1D A;  1IN8 A;  4NHJ A;  4QWQ A;  2CW0 F;  2IPQ X;  1IN7 A;  2PFB A;  1BI1 A;  3OOP A;  1P2F A;  1O7F A;  1R58 A;  2XAS A;  2XAQ A;  3ZMD A;  1SD6 A;  3KCC A;  5FFZ A;  4UVA A;  3CDH A;  4M9X A;  3F3X A;  1OYY A;  3T0Y A;  1IXS B;  3K1N A;  3RI4 A;  5ICE A;  4O5V A;  3GFJ A;  4YFN F;  4BHB A;  2FML A;  4RGR A;  3KP4 A;  2F5C A;  5AON A;  1ZHF A;  4YG2 F;  1B6A A;  2QUF A;  3GWZ A;  3U9G A;  3FM5 A;  4RS8 A;  4CHU A;  3U2R A;  2WWY A;  2HTJ A;  2OQG A;  1FX7 A;  5DUK A;  2BYV E;  1QQI A;  3ECO A;  3R60 A;  3V8K A;  4BHP A;  1W4M A;  1XN7 A;  1W7P B;  4NQW A;  2PG4 A;  1RZ4 A;  3WTU C;  3T5X A;  1ZRF A;  4O3M A;  5LEJ A;  1IRF A;  3E5Q A;  4XSX F;  2EFQ A;  1IXC A;  2MH9 A;  4Q4Z F;  3FWE A;  4WXD A;  3TOB A;  2A07 F;  1SD7 A;  3ZMZ A;  2TDX A;  3VEP A;  3GVA A;  1S3J A;  5E17 F;  3HHH A;  4CIC A;  3BRO A;  2JZY A;  5ICG A;  2RGV A;  1F9N A;  2JSC A;  4EJW A;  4CXF A;  2WC2 A;  3BWG A;  3ZMS A;  2Q2E A;  3Q9S A;  1H0M A;  1FP1 D;  3BJ6 A;  1V4R A;  2EV0 A;  3GUD A;  2DBB A;  1G3T A;  1TBX A;  1W7P A;  2DPD A;  4KDP A;  4N9I A;  4L0Z B;  2RN7 A;  2RC4 A;  3ZP5 A;  5LGU A;  1BI0 A;  5FFX A;  2ZFW A;  4WXC A;  4U0V A;  3WTV C;  1J7K A;  1OYI A;  4MQ9 F;  4ENK A;  5L3E A;  3F21 A;  5KK1 A;  4ZZD A;  4WCG A;  2HEO A;  4TV7 A;  2CWE A;  3J7A O;  2P6T A;  2DK5 A;  3F72 A;  3TGN A;  3MZH A;  5AIP A;  1J2X A;  2KIM A;  4KUM A;  2JT1 A;  3COA C;  1IN4 A;  4U7B A;  1Z91 A;  1KU3 A;  2OA4 A;  1I27 A;  1K7A A;  2XUB A;  1YW9 A;  3RYR A;  4F7Z A;  4GXO A;  3ZQ7 A;  3CJN A;  3HRM A;  3HYI A;  5CVU A;  5BOX A;  1OYW A;  5D5X B;  1PP7 U;  5FB2 A;  4YIF A;  3MEX A;  3J81 K;  1EH8 A;  1F1Z A;  1ODD A;  4MTD A;  2DT5 A;  5DD4 A;  3IKT A;  3WGH A;  3ZPL A;  2XAG A;  3K9T A;  3ROU A;  3W6K B;  1BI2 A;  1XGM A;  2OQR A;  1OPC A;  1UCR A;  2HQR A;  5E1Z B;  1SD5 A;  2O03 A;  1YS7 A;  3GFL A;  4A0Z A;  1FBU A;  4D0P A;  3I59 A;  5ILU A;  3CUO A;  1FZP B;  4EGY A;  3JAM K;  2IT0 A;  5EEH A;  3GO5 A;  1HBX G;  1SAX A;  3HIF A;  2HTS A;  2EK5 A;  1S7O A;  1RNL A;  1BIB A;  1QNT A;  3AAF A;  3M8F A;  1RUN A;  3RKW A;  1ONV A;  2RKH A;  4XSZ F;  3GZ6 A;  3FX3 A;  2XGX A;  3REO A;  3JSO A;  2RVC A;  1ZN2 A;  1D8J A;  2L4A A;  2NS0 A;  4HX8 A;  2A6E F;  4KMF A;  4EM0 B;  3JTG A;  2VC0 A;  3T8R A;  3E6M A;  3LA3 A;  2L02 A;  3B73 A;  5E8G A;  2HKX A;  5LBQ A;  4G6Q A;  2ZME B;  3EYI A;  2FNP A;  4IXA A;  5IT9 Z;  3C18 A;  1B59 A;  2PJP A;  3PQK A;  1S29 A;  2FE3 A;  1FBS A;  4MQV A;  3HOS A;  3LFK A;  2LSO A;  4G7H F;  2EV5 A;  4UUV A;  3B02 A;  2MH2 A;  4HF1 A;  4Y15 A;  3VB2 A;  2FQ3 A;  4HQM A;  4R1H A;  4LLL A;  5DCM B;  4L9V A;  1R22 A;  4OIO F;  4U7D A;  2E7W A;  5D5U B;  1BI3 A;  2ESN A;  4KIC A;  2VE9 A;  2G7H A;  4KN7 X;  4KT5 C;  4GCV A;  5LHH A;  2P7V B;  3NRV A;  4LK0 F;  1IXR C;  2ZME A;  3L2C A;  2W24 A;  3LA7 A;  4S04 A;  4JK1 X;  3SZT A;  4A2U A;  1QPM A;  2A3S A;  4RGS A;  1XDU A;  3EQL F;  3CLO A;  3QOP A;  1XSD A;  3K1P A;  2WTE A;  4U88 A;  4A0X A;  3N4M A;  4L5I A;  2VC1 A;  2NNN A;  5KVR A;  2LKP A;  1U5T B;  5LHI A;  5HS7 A;  2V1D A;  1FLI A;  5HS9 A;  1YW8 A;  2MLG A;  1STZ A;  1R23 A;  2XRN A;  3TKY A;  3E6B A;  2KKO A;  4ENM A;  2P6S A;  2Q0O A;  1LDJ A;  3IWZ A;  1PUE E;  2DQR A;  3GX4 X;  2QYO A;  3BJO A;  4HF2 A;  1WKM A;  3HUG A;  2FBK A;  2PBI A;  2FSW A;  2L4M A;  4LFU A;  2D1H A;  3I58 A;  4R8H A;  1HW1 A;  2DFI A;  3WTS C;  4G6D A;  4MNU A;  4L5J A;  1O3R A;  3F8F A;  4M6Y A;  2VOD A;  3P9C A;  4XBF A;  3QU3 A;  2HDC A;  1PP8 F;  1ZAR A;  2VT2 A;  2ZBK A;  3LA2 A;  5BPD A;  3KP6 A;  2DU9 A;  5ERI A;  4IHS A;  4RAY A;  2O61 A;  3F8N A;  4P96 A;  2P8T A;  1XGO A;  1IZ1 A;  1XSX A;  2V1X A;  2M8E A;  1RUO A;  4EM1 A;  1MKM A;  2OAZ A;  4PDK A;  5CJ9 A;  5A2Q Z;  2HYF A;  3M1E A;  2AXL A;  1REP C;  3ABT A;  3SXY A;  4OMY A;  1Z7U A;  2RDP A;  1FYK A;  1SFE A;  1E2X A;  1V3F A;  2ADU A;  4ENN A;  3M7G A;  1LB2 A;  3WTY C;  6PAX A;  4ON0 A;  1GVJ A;  3QU6 A;  5FLX Z;  2PN6 A;  2QEN A;  4AWX B;  1W5S A;  2UXN A;  3ZMU A;  1F5T A;  4HLX A;  1X3U A;  2VE8 A;  1C0W A;  2Y0M A;  2B0L A;  3ELK A;  1Y0U A;  3L09 A;  2GIV A;  2IRF G;  3I53 A;  3C7J A;  2OU2 A;  2K4J A;  2PI0 A;  3GFM A;  3DPT A;  3KZY A;  1FP2 A;  1LEB A;  2HS5 A;  1I1G A;  2LF8 A;  2F5E A;  5FD5 A;  1U3E M;  1T39 A;  1TTY A;  2W25 A;  1CF7 A;  1YYV A;  4KIF A;  2V6C A;  3N97 A;  1SD4 A;  3W6J B;  4OIN F;  1ZG3 A;  1IRG A;  4LB5 A;  4XLN F;  1ZGA A;  1ON1 A;  2KJC A;  4R79 A;  2GXB A;  2QQB A;  5D4R A;  3DF8 A;  3PQJ A;  3HHG A;  4EM2 A;  2M45 A;  2COM A;  5L3G A;  2PQ8 A;  2A61 A;  4YII A;  3JW4 A;  4IPA A;  4ESF A;  2GXG A;  5D5V B;  5HDK A;  4BYY A;  2CGP A;  4B8X A;  2QBY A;  5ICF A;  3V7R A;  2D1V A;  2YU3 A;  4IRG A;  1B9N A;  3RKY A;  1GHC A;  4N9H A;  3BPX A;  2ZXJ A;  3HOT A;  1TLH B;  3O2P E;  1U8R A;  4AIH A;  3FXR A;  3F8C A;  1WQ2 A;  3GEZ A;  3OV8 A;  4HAM A;  1O57 A;  2EV6 A;  2VBY A;  1G3S A;  2FU4 A;  1FYM A;  2VT3 A;  2QQ9 A;  1S8N A;  2QZ8 A;  3GZ5 A;  2M30 A;  1U6G A;  3CUQ B;  4IRH A;  1VTN C;  3DP7 A;  2Z33 A;  1ON2 A;  1JE8 A;  3P9I A;  5F64 A;  1XB4 A;  1U5T C;  4CDG A;  5FO5 A;  2XIG A;  1U2W A;  2O3F A;  3HSE A;  2V79 A;  4Q48 A;  1SFX A;  4UHT A;  1H9G A;  2E7X A;  2BGC A;  1IUY A;  4B09 A;  1EV7 A;  1FT9 A;  2A6H F;  2W84 A;  3P7N A;  2DW4 A;  1I1S A;  3HRT A;  1BC7 C;  3IL2 A;  4G9Y A;  4S05 A;  5J6X A;  1B1B A;  1HKQ A;  2O8X A;  3E3V A;  3I59 B;  2IW5 A;  4HOB A;  2AS5 F;  3MZY A;  4P55 A;  1I6X A;  4IHT A;  1P92 A;  1R5G A;  4A6E A;  1LNW A;  5LGT A;  2EFP A;  4M6X A;  1I5Z A;  1BM9 A;  5LLQ A;  2ISY A;  1P4W A;  1ZRE A;  5BPI A;  1K78 A;  4LJZ F;  2HZT A;  3CUQ A;  1LDD A;  4CGZ A;  1HXD A;  2DPU A;  3GXO A;  1YIO A;  1UFM A;  1MD0 A;  3QAH A;  1W5T A;  2R7D A;  4ESJ A;  3FHZ A;  2OBP A;  4GGG A;  3TDU C;  1AWC A;  1LVA A;  4PZJ A;  2IVM A;  1YG2 A;  3RPU A;  2GAU A;  3FZV A;  3GFI A;  3ABU A;  2Z99 A;  2DTR A;  3R0J A;  2JTV A;  4EJU A;  4EGZ A;  4RGU A;  2KRF A;  4M73 A;  4BH9 A;  2H6B A;  3WTZ A;  4RAZ A;  1IAW A;  2P7C B;  2XHK A;  4Y13 A;  2LF7 A;  2V1U A;  1WSU A;  2IJL A;  3K2Z A;  3SFZ A;  4ENJ A;  3EET A;  4ASN A;  3FMR A;  5K5R A;  3QP5 A;  5IT3 A;  4OMZ A;  2EWN A;  1Z9C A;  2XAJ A;  1HKS A;  5DV5 A;  5ILS A;  3KET A;  3WTT C;  1DP7 P;  3BDD A;  2KJB A;  2OZ6 A;  4HX7 A;  3KZZ A;  1OKR A;  3KP3 A;  4EJT A;  5L3B A;  1T6S A;  4P9U A;  1ZGJ A;  4ESB A;  2YPR A;  4M71 A;  2QQA A;  3L7W A;  2MC3 A;  2MD5 A;  3DPL C;  1R36 A;  1UB9 A;  5D6F A;  3NEU A;  3G3Z A;  2VON A;  3BZ6 A;  4FX0 A;  1W7P D;  3P9K A;  2E1N A;  1Q1H A;  3Q9V A;  3F23 A;  1G3W A;  1R1U A;  5CVJ A;  4UVB A;  5D4S A;  5FD6 A;  3FXU A;  4IF4 A;  2DAO A;  2ACJ A;  1R00 A;  1LDK B;  5HLH A;  3WU1 B;  1GXQ A;  2EFW A;  2E1C A;  4L18 B;  3TQN A;  4UVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...