1HKQA

Pps10 plasmid dna replication initiator protein repa. replication inactive, dimeric n-terminal domain.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
QSNKLIESSHTLTLNEKRLVLCAASLIDSRKPLPKDGYLTIRADTFAEVFGIDVKHAYAALDDAATKLFNRDIRRYVKGKVVERMRWVFHVKYREGQGCVELGFSPTIIPHLTMLHKEFTSYQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords REPLICATION PROTEIN
publication title A Conformational Switch between Transcriptional Repression and Replication Initiation in Repa Dimerization Domain
pubmed doi rcsb
source organism Pseudomonas savastanoi
total genus 37
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hkqA00
3R0AA 3H3UA 1FWZA 2KKOA 1XCVA 3TO9A 2PMHA 3BJAA 2X0LA 2Z5UA 4CICA 2HYGD 4IJAA 1FBQA 5HDNA 4UXNA 5FD5A 1TQPA 4Q47A 3HSEA 3L09A 1KGSA 3WTYC 3KP4A 1KU2A 2IP2A 1IRGA 2XAHA 1BI0A 4KMFA 3I54A 2JZYA 4YG2F 1ZG1A 2M87A 1ODDA 1FLIA 2A3SA 2D45A 2DFIA 4BHPA 2CG4A 1VTNC 3Q9VA 3MQ0A 3BDDA 3WG9A 2IA1A 4BYYA 4U88A 1D8KA 1YW9A 2LSOA 1BIAA 1KU9A 2VOOA 3RKXA 5A2QZ 1G6NA 1WWXA 5E1XA 2R3SA 1P2FA 5D6FA 5F1RA 3HYIA 3GO5A 4KIFA 3TO7A 4YFKF 3RYRA 1FP2A 3LQQA 3GX4X 1KYZA 2KIMA 2CQKA 1ZG3A 2MC3A 2DLLA 4EJVA 2MLKA 4N9IA 4WXDA 4ENKA 2L01A 1LVAA 2O3FA 3B02A 4HF0A 3HTUA 2O03A 2O0YA 5D8KB 1T38A 3LA7A 4A0YA 2ZXJA 2HGCA 2DPDA 4AWXB 4GYGA 3GVAA 3V8LA 2IVMA 4RS8A 3JSOA 2W24A 3W6KB 1HW1A 2XV4S 4KA4A 3GWZA 1MZBA 4P96A 1H0MA 1W5SA 1XDSA 2XASA 1Z6RA 4L0YB 4O5VA 3I59A 4UNOA 5CVVA 1S3JA 1B1BA 2Y48A 1LEBA 2EFNA 2V9VA 4OMZA 3GF2A 3SZTA 1GHCA 2V6CA 3WU1B 4P9UA 3TQNA 1TW2A 1LB2A 2DK8A 3E6CC 2L54A 3R4KA 4E70A 2HZTA 2HTJA 3CUOA 2Y0MA 2V79A 4CYDA 2VC1A 2JTVA 2B0LA 4MEYF 1HW5A 4KIGA 5L3BA 2ACJA 2EV0A 3DQVC 5KVRA 1HXDA 1IN4A 2ZJ2A 4WCGA 1W7PD 4P9FA 1BI2A 1FP1D 4HDUA 2W25A 1YIOA 3H3ZA 4DNCA 4A12A 3U2RA 2VT3A 4CO8A 3WE2A 4KIBA 1SD6A 1MJBA 2P5LC 1HSTA 2XRNA 2PMUA 2MD5A 3F8NA 4KT5C 3CTAA 5HS9A 3NEUA 5CLSA 3AAFA 5DYMA 4ON0A 1SFUA 2FU4A 3LAJA 3HSFA 4M9SA 1TNTA 2HKOA 3ERED 2D1HA 3DKWA 5HLGA 3HOSA 1HKSA 3P9KA 1TQIA 3T8TA 3MZYA 3CUQA 3O3KA 4EVIA 3F8BA 3TOAA 2W84A 3FM3A 1ZARA 5EEGA 1Z05A 5BS6A 2QQAA 1XB4A 3IRRA 4A6DA 4OIQF 5BQTA 3JSPA 4N9HA 1PP8F 3FXUA 3DPLC 4BHCA 2QQBA 3RKYA 3TDZC 2EFQA 1W5TA 3ABTA 4RB1A 1ZG5A 5TJJA 4A0ZA 4NHJA 1R00A 3KETA 3F8CA 2P5KA 4L18B 3VEPA 2Z9OA 4EJTA 2KIUA 2FNPA 5HDGA 3J80K 4HA8A 3E5XA 1XSXA 5FD6A 1K7AA 1J9IA 3SHFA 1U5TC 3WGHA 1ZRDA 3OOPA 1YS7A 1GXPA 3IWZA 3R60A 2HQRA 4KMUX 1ZAOA 4NB5A 5CVJA 5LBQA 1P4WA 1STZA 4M9XA 4Q48A 1P4AA 2LNBA 3K0LA 3I59B 4EJOA 4HQMA 2M5WA 1Z1DA 5LGUA 3B73A 5ERIA 4A0XA 1Z9CA 4I02A 1O57A 2PI0A 3EYIA 3KCCA 1OYYA 3MCZA 3PQKA 1ZRFA 3V7RA 2CWEA 4UV8A 2IJLA 1HKQA 3V7SA 2XIGA 3F72A 4N0BA 3ZP5A 3KFWX 4ENMA 1UHWA 5ILUA 4BAYA 4LLNA 2ADUA 2VC0A 4EGYA 4CDGA 4YIFA 4GYIA 1XMAA 2A6EF 2BEOA 1WSUA 4I09A 3V8JA 1LJ9A 1XGNA 3KZZA 2RN7A 3CLOA 4OIRF 3OV8A 4HBLA 3FMSA 3I71A 4ESBA 1E2XA 1ZLJA 4LD5A 1FOKA 2CYYA 4L9JA 4HX7A 1GXQA 5FFXA 2UZKA 1XMKA 4U7DA 5FB2A 1B9MA 1I6XA 1BIBA 1K78A 3Q9SA 1T0FA 3FXQA 4BNCA 4TV7A 5DUIA 1U3EM 1DP7P 3HHGA 1BI1A 4IRHA 5E8GA 5DEQA 1ZH5A 2NYXA 1IN7A 2PQ8A 3F21A 3CUQB 2DI3A 2YX7A 3R0JA 2DK5A 3ZQ7A 4ZYGA 1OYWA 3FM5A 2GXGA 2PN6A 2XAFA 2FSWA 3ISPA 1J59A 1XGOA 2RNJA 5K1YA 1D8JA 2IT0A 3S2WA 2RDPA 3FXRA 1MDMA 1ON1A 4YIIA 2IW5A 2Z99A 4A5MA 2ESNA 2EWNA 5AIQA 1U5TB 1R1VA 5AONA 1WRJA 2OZ6A 5E1WA 5ILVA 4G7OF 3E6MA 3WTZA 1FYLA 5F6FA 2L4MA 5E20A 2MA3A 2CGPA 2CFXA 3VFZA 2LF7A 2OZUA 3ZPLA 1DDNA 4I2OA 3SXYA 3KE2A 4FHTA 4ENNA 2H09A 5HS8A 1ZHFA 5L3DA 3RPQA 1I5ZA 5DCMA 1OPCA 2QLZA 4M71A 3I5UA 3M9AA 3TOBA 1I1GA 2ZFWA 4LLLA 2YPRA 3HHHA 3JAMZ 4EMSA 4H0EA 1IN8A 2HWVA 4UVCA 2BGCA 3WTWC 4KUMA 1KU7A 1TBXA 2QYOA 2PFBA 5BPDA 4L5JA 4KFCA 4QWQA 3GLXA 1C0WA 4OIOF 1S7OA 2E7WA 1JHHA 2H6CA 5ED4A 2HOEA 4AVPA 2ZBKA 2LKPA 4Q5SF 5LGNA 4L9NA 2BE5F 2NNYA 1R36A 1TQMA 2E7XA 3I64A 5AIPA 1KQ0A 2FMLA 3BOQA 4IF4A 4U0WA 2K02A 4LK1F 5DD4A 3IL2A 2VODA 3FX3A 2QBYA 4M73A 2NNNA 2XAGA 2VBXA 1FBUA 3NRVA 3RIRA 3FHZA 2ZKZA 4B8XA 4PGHA 3D0SA 4HF1A 2XAJA 5E18F 3LAPA 1XDUA 2GQQA 5HVQC 4AIJA 1H9TA 1CGPA 1FSHA 2FBKA 1SD7A 2YX4A 4HX4A 3T5XA 2RGVA 5FGMA 4ESFA 4HLXA 3QP5A 1YW8A 1J7KA 2OAZA 1DPUA 3JTGA 2NAZA 1XD7A 5L3EA 1K78B 2KIFA 2FMYA 3IHUA 4HX8A 1F5TA 5L3CA 2A07F 5K5RA 1LQ1A 1FYKA 1F1ZA 5IT3A 4ZZLA 1ZGAA 1O3RA 2FOKA 1O3TA 3QP6A 1UCRA 2F5DA 2DBBA 3MZHA 4XBFA 3DPTA 3TKYA 1SMTA 4M74A 1RUOA 4CXFA 2P4WA 1NHAA 2FA5A 3ECOA 1RI7A 1FZPB 2OQRA 4OIPF 3BY6A 3FF5A 1FC3A 4GGGA 5CVUA 1G3SA 1IN5A 3P7NA 1MDMB 2FNAA 1RUNA 2OD5A 2H94A 3O2PE 2KJCA 1XSVA 2TDXA 4JK1X 4M6YA 2YR2A 1G3YA 4PZJA 2D1VA 2VT2A 2V1XA 4WWCA 4XRFA 4CZZA 2OBPA 4MQ9F 4RGRA 2L02A 5D5WB 1IXRC 2A61A 3IKVA 4JBAA 2H6BA 5LRRA 4BH9A 1YG2A 2GA1A 4RB2C 4ASNA 1D3YA 1EH6A 3GFLA 2QVOA 1V4RA 2ZMEA 2ESHA 4G9YA 3RJPA 2DU9A 2FRHA 2Y75A 3T0YA 3VB2A 3HOTA 1ULYA 4HYEA 2GWRA 4EV0A 3WTTC 3C18A 5DCMB 3C1DA 1XGMA 3TO6A 2W57A 2XGXA 4I98B 3VODA 4OINF 3GFIA 2QENA 4I0AA 4U0VA 1A04A 2W85A 3E97A 3W6JB 3I53A 4EM1A 5DD8A 1K79A 2VOPA 3DXJF 1W4MA 2EA4A 2Z33A 4G7ZF 2ZNZA 3RI4A 1I1SA 4IPAA 5BPIA 4FX0A 5DV5A 3EQLF 1OMIA 2RV8A 4LGWA 3M7GA 4R1HA 4K2EA 5E1ZB 3P9IA 2QBYB 2VN2A 3L9FA 4PCQA 3GZ6A 2M1BA 3BROA 3G73A 1K6OA 2HQNA 1XCBA 1I27A 1BJAA 4BXUA 2RQPA 3HRTA 3SQNA 1QGPA 3QU6A 3FMQA 5J8FA 5HLHA 2STTA 2Z3YA 3LA3A 3I58A 2Q0OA 1SD5A 3DP7A 2FF4A 2MH2A 1TLHB 2G9WA 2EK5A 3CUQC 2GAUA 3ABUA 3IRQA 5FFZA 1XSDA 1YO5C 2IA0A 3HTSB 4ZYEA 3ZMTA 5FLXK 4LG0A 4EM2A 2A68F 1HKTA 2UXNA 2FBIA 1O3SA 2WC2A 5D5XB 1B59A 3WTVC 3BJOA 1FYMA 2X4HA 5D4RA 1J2XA 1R5HA 3L2CA 3F8MA 5E17F 1H9GA 2F2EA 1IF1A 2DPUA 2EV5A 1ON2A 4LJZF 3T8RA 4L9VA 4ZZDA 3KZYA 3M1EA 1Q1HA 2Q8KA 1U6GA 2P8TA 2GXBA 2HR3A 5D4SA 1ZYRF 1IXCA 2C6YA 3V7CA 5A2QK 1J0RA 1B4AA 4L0ZB 2WV0A 2ZMEB 5K5OA 3KLNA 3MEXA 2K4JA 4S04A 5JI6A 5H6QA 1YLFA 3WTSC 3N97A 4Y13A 4ESJA 4U7BA 3GEZA 4QLCU 5D5UB 1Z6TA 1TW3A 3TDUC 5LGTA 1CF7A 3I4PA 1F9NA 1BN5A 2DQLA 4G6QA 2G7UA 1R1UA 2DW4A 1Y0UA 4RAYA 2WTEA 2RKHA 2BV6A 4KDPA 1LEAA 3ZMZA 4BQAA 1R22A 2CO5A 3ROUA 4MGRA 4Y17A 2D2WA 2XKOA 4UHTA 5IT9K 2ZO4A 3GFMA 4CHUA 1MJ9A 1S8NA 2EJRA 3E6BA 3WGIA 3GFJA 1FT9A 4I7HA 3ZMDA 3KLOA 1AOYA 1OYIA 4HLYA 2K7LA 3VOEA 1USTA 1QZZA 2A69F 2QWWA 1P6RA 1EH8A 3HIFA 4OU0A 4KYWA 1WI9A 3F6OA 5CJ9A 3RKWA 5DDGA 1O7FA 1PP7U 3BP8A 1LNWA 3EYYA 4ZH4F 4WXCA 4KNYA 3C3WA 4WXHA 2GA2A 3CO6C 3E5QA 2XUBA 2HKXA 5CYVA 1SFXA 1KU3A 1HSJA 2PG4A 3K9TA 4MQVA 4EJWA 1HW2A 4JQFA 1EV7A 2DO7A 4KICA 4HV5A 5TRDA 1J5YA 1ZRCA 1AWCA 4G6DA 4RGXA 1WQ2A 1L0OC 2E1NA 1PUEE 4MHGA 4LG0B 1SMYF 4YFNF 3HRMA 1GVJA 2K4BA 4HOBA 3K1PA 1B9NA 3M8FA 1ONVA 2DT5A 3ZMSA 2HYFA 3J80Z 4MTDA 3FZVA 1U2WA 2FQ3A 2VE8A 3ULQB 2L3DA 5FLXZ 3CDHA 1G3TA 5HDKA 3Q5FA 4LLGF 5BMZA 4MNUA 4RGSA 1S6LA 5H20A 3HRSA 5LEJA 3U1DA 5JFRA 4M9ZA 3CJNA 4B09A 3V8KA 2FEZA 1UHMA 1U78A 2J5OA 2VXZA 3BJ6A 3PFIA 1W7PA 5LHHA 4EM0B 3QU3A 5HLIA 2IRFG 2QM3A 4EQQA 2P7CB 2CSOA 1J75A 2GIVA 2ETHA 5ICFA 4MEXF 1D5VA 3CO7C 4IRGA 2CW0F 2YU3A 3HRUA 1KQ9A 1QZYA 2ISZA 1EH7A 2F5EA 4I0BA 1E17A 2PJPA 1FPQA 1FY7A 1CF7B 3WU0A 1BOAA 3KP5A 1YW7A 1OKRA 2NRAC 5D6EA 1QBJA 3JTHA 4XSZF 1R1TA 2NS0A 4ZYHA 5E8IA 2FXAA 2HS5A 2F5FA 3FMRA 3I0TA 2EB7A 2VONA 2HEOA 3J7AO 2PBIA 3F22A 2XROA 2R7DA 5ICCA 1T39A 2XKPA 4PDKA 2P6SA 2VE9A 2JPCA 3QAHA 2PLYA 2M8EA 5DCFA 5ICGA 4DQ2A 1FBSA 5IT9Z 3D5LA 2J5PA 2P5VA 2IA2A 4GXOA 1FX7A 3RDIA 1X3UA 3F23A 2QQ9A 4RB0A 2LDUA 1XGSA 4WX9A 2JPBA 2QUFA 4U0YA 2OA4A 1KQ8A 1P92A 1USSA 1IW7F 4GCVA 4UUVA 4PGGA 4L9TA 3V4GA 3GYHX 4OMYA 3K2ZA 2MBFA 4LFUA 3GUDA 3REOA 5J8CA 1P4XA 4S05A 4Z2YA 3F8FA 1BI3A 1MD0A 6PAXA 3F6VA 2RVCA 4CGZA 1QPMA 3ML6A 1R5GA 3ECHA 1MJAA 4HW0A 2OU2A 1R7JA 2Q2EA 1MGTA 2JSCA 2DTRA 4M72A 1FSEA 4IHSA 4OOIA 3G3ZA 4XLNF 1IRFA 1ZN2A 4RAZA 1T2KA 2KRFA 3LWFA 2EFPA 3HSRA 3MWMA 2VBZA 2KJBA 5LHIA 3L00A 2L4AA 2LF8A 1KA8A 2QZ8A 2MLGA 4XLPF 4L5IA 5D8LB 2G7HA 3KP2A 2O8XA 2AXLA 3K1NA 2V1DA 1JE8A 4HF2A 2GZWA 3R6SA 1W7PB 3BZ6A 4EJUA 3K69A 1QNTA 3FWEA 5J6XA 1ZREA 2VBWA 4O3MA 3L7WA 4ETSA 2XAQA 3U9GA 1DPRA 3MAJA 5HOOA 2ISYA 1IUYA 1R58A 3ZN0A 2FBHA 1G3WA 1UB9A 3QPHA 1F4KA 2HDCA 1RIOH 5LLQA 1REPC 3ZMVA 3K1MA 3GZ5A 3BWGA 2ZNYA 1TTYA 3ELKA 4G8XA 1SD4A 3J81K 4AD9A 4P5OA 2UWMA 3QPTA 3KEQA 1YQAA 1LDDA 3E3VA 1TNSA 5L3FA 5D5VB 3LSTA 1YS6A 1JHFA 4UVAA 1XN7A 3RPUA 4HDVA 1BM9A 2UXXA 1JXSA 3BPXA 2HFHA 1PDNC 5K5QA 4BHBA 1T98A 1U5TA 3LA2A 4ZYDA 2K86A 4LK0F 1RZ4A 3SZPA 1IAWA 3PQJA 3R61A 2O61A 3E5UA 3DEUA 5H6RA 2RC4A 4A6EA 1YTYA 1ZLKA 2DAOA 3JW4A 5ICEA 1G4DA 3DF8A 4FT8A 5BOXA 1RNLA 4WF2A 5JR3A 2MH9A 2P6TA 2E1CA 4XSXF 3QOPA 3IC7A 1YYVA 3LFKA 4HQEA 2M45A 5CVRA 1HQCA 3KP3A 4MTEA 1Z7UA 4IXAA 5F64A 3JAMK 2BBYA 3TGNA 3M8EA 1LDJA 3ZN1A 1JGSA 2STWA 3C7JA 2XVCA 3EDPA 2A6HF 4F7ZA 3SFZA 1V3FA 1BC8C 4GO1A 1LDKB 4LB5A 3IWFA 1BBYA 3DV8A 2P7VB 3EETA 5HS7A 1O3QA 4IHTA 5EEHA 5ILSA 1S29A 4AIKA 2H27A 5JHUA 4HV6A 3F3XA 2JRTA 3KP7A 1R23A 4G7HF 2VBYA 4HAMA 3LQRA 1U8RA 4Y15A 2O6GE 1B6AA 1QQIA 2JT1A 4LB6B 4LMYA 4R79A 2COMA 3DFGA 4IRIA 2R7FA 4UV9A 3IKTA 3O6BB 4R8HA 3EUHA 3ZMUA 4EGZA 1S7AA 1FNNA 4RGUA 4NQWA 1O7LA 1Z91A 3WGGA 1T6SA 1YFHA 1DUXC 1ZGJA 2PEXA 5DUKA 4HZFA 2BYVE 5JVTA 4ENJA 1MKMA 2EFOA 1HBXG 1IZ1A 3WTUC 2ZCWA 3MFKA 4P55A 3BPVA 1IXSB 3COAC 3NQOA 2EV6A 2OQGA 2F5CA 3WE3A 2XHKA 2K27A 4D0PA 3HUGA 2HTSA 4G94A 5L3GA 2M30A 4FX4A 5LRSA 1BC7C 2WWYA 5CVIA 4Q4ZF 4RB3C 3KP6A 5LEKA 2FE3A 2EFWA 1WKMA 3E6DA 4I01A 5KK1A 3WTXC 1UFMA 3GXOA 4WK8F 3GW2A 4AIHA 2ELHA 3H92A 1QO0D 1IN6A 2DQRA 4UVBA 4KN7X 3RYPA 4KN4X 3N4MA 3QRFF 3WODF 4YFXF 2EA2A 3KEOA 3J81Z 4A5NA 2AS5F 1L3LA 1SAXA 2V1UA 4IVNA 1SFEA 4M6XA 3P9CA 5LHGA 3T1BA 2A5YB 2YSRA 5FO5A 1OR7A 1KYWA 4O6JA 3RTRA 2IPQX 4A2UA
chains in the Genus database with same CATH superfamily
3R0AA 4QSHA 3CCSI 3H3UA 2NS7A 5FKKA 4E7SA 1FWZA 2KKOA 3VSLA 3FHNA 1XCVA 3K4NA 2M0MA 3TO9A 2PMHA 2LRDA 3BJAA 2X0LA 2Z5UA 2G0EA 4CICA 2R0QC 3OYAA 2YU9J 3WHBA 3HOZJ 4C3HJ 2HYGD 4IJAA 2R7TA 2NXNB 1FBQA 4E7HA 5HDNA 3QOEA 4UXNA 5FD5A 4PJLA 3AFHA 1TQPA 4RM3A 3LSHA 4Q47A 3HSEA 2PJRB 2BVMA 3DTEA 3L09A 1KGSA 3WTYC 3KP4A 2Z16A 1KU2A 5FKOA 3LSKA 2HPMA 1WH7A 2IP2A 4XONA 1WGXA 1IRGA 1Z3YA 2VJJA 2XAHA 1BI0A 3K4MA 1A35A 4BQNA 2F5VA 3K4LA 5E3LA 4KMFA 3M3YJ 4Y4RA 3I54A 1H89C 4XRSG 2ZXWH 2RAEA 2JZYA 1BR4A 4U87A 4YG2F 1ZG1A 2M87A 3TW7A 1VQKI 1ODDA 1FLIA 3BTCA 3RCOA 2M4GA 1ITYA 2A3SA 3H0GJ 1YHQI 4E7JA 2GLOA 3OL3A 2D45A 2DFIA 3CCLI 4BHPA 2CG4A 1VTNC 2XGEA 4ZYAA 3Q9VA 3MQ0A 3BDDA 2HXOA 3WG9A 2IA1A 4BYYA 4U88A 1I50J 1D8KA 1YW9A 2NOGA 2LSOA 1BIAA 1KU9A 4RDUA 2VOOA 3RKXA 5A2QZ 3JRBA 1G6NA 4LOCA 1WWXA 3BR5A 5E1XA 2R3SA 1P2FA 3IAM2 5D6FA 3I3LA 2DT6A 5F1RA 1YI2I 1UG2A 3HYIA 2LK2A 3GO5A 5CQGA 4XQFA 5IOZA 2VUMJ 2DXIA 4KIFA 1EA3A 3S1QJ 3TO7A 3K7AJ 4YFKF 5E79C 1IRXA 3RYRA 4CSWA 4NQWB 2CV0A 4PUSA 2PX9A 2IS6A 3HGYA 3PFYA 1FP2A 2VKDA 1W0TA 3LQQA 3GX4X 2BHZA 3W3CA 1KYZA 2KIMA 2CQKA 4AYBA 3G4SI 4FASD 3W6VA 3VYTB 4BGDA 1ZG3A 2MC3A 2V9PA 4ZDLA 2ICWG 1FOXA 2DLLA 2LY2A 4EJVA 2MLKA 4N9IA 4WXDA 1ZKGA 4B48A 3H9QA 3ZR8X 4ENKA 2L01A 4FISA 3G1OA 1LVAA 1KZHA 2O3FA 4B43A 2IEKA 1SANA 4RA2A 3B02A 5CQEA 4HF0A 2RREA 1T33A 3HTUA 5EYRA 1Y1WJ 3A2KA 1GLNA 1R49A 1QVTA 3CDIA 2O03A 2O0YA 4LIUA 3MKZA 4KJZA 5D8KB 3DTKA 3LNQA 2MW8A 2O8KA 1YX3A 3HUGB 1T38A 2L9NA 4I6ZA 2HXIA 3LA7A 1YX5A 5J40A 4A0YA 2ZXJA 5DM6F 1OCTC 4BXFA 2HGCA 2LR8A 2DPDA 4AWXB 4CCJA 3VYSB 4GYGA 2Y9ZA 1UJ8A 1AA7A 3AL0C 3GVAA 1HOMA 3V8LA 2CQNA 2IVMA 1JI8A 4RS8A 3JSOA 2W24A 3W6KB 1ERDA 1HW1A 2XV4S 3MKYB 2JA5J 3RKQA 3GWZA 4KA4A 3QYBA 1GV5A 2LKSA 1YRNA 3PJRA 1IRZA 1MZBA 3QQAA 4P96A 1H0MA 3B6CA 4M3EA 4XICA 1N75A 4BE2A 2OCEA 1Y56A 1W5SA 1EF4A 1XDSA 2XASA 3DBHB 3H5NA 2RQQA 2KFDA 2PMZA 1Z6RA 4L0YB 4O5VA 3I59A 4UNOA 1SC7A 5CVVA 1VQ7I 3CC4I 1E0EA 1S3JA 1B1BA 2HDWA 2HOSA 3K4JA 2Y48A 2V26A 2EFNA 3IH2A 2VB6A 2V9VA 3Q3SA 3GF2A 4OMZA 3SZTA 1LEBA 1GHCA 2OV7A 2V6CA 2BOLA 3WU1B 2LH9A 4P9UA 2XDVA 4QTRA 3TQNA 1TW2A 1LB2A 1HDPA 2IXSA 2Q1ZB 2DK8A 3E6CC 2L54A 3R4KA 3V42A 4E70A 5EG0B 2HZTA 2HTJA 2VI6A 3CUOA 2Y0MA 3DLAA 2V79A 3DEWA 2VC1A 2JTVA 4CYDA 2B0LA 2K9SA 4MEYF 1HW5A 3QYEA 4KIGA 5L3BA 2EV0A 3DQVC 2ACJA 4LIVA 1AU7A 5KVRA 4E7ZA 3HM5A 1HXDA 1IN4A 2ZJ2A 3M8JA 1W0UA 3QYFA 2Y30A 4E6KG 4WCGA 4XRMA 1W7PD 4P9FA 2JA8J 5HLTA 3DCFA 3BQYA 4II2A 1BI2A 1FP1D 3CCEI 4HDUA 2W25A 3CMMA 1YIOA 3H3ZA 4DNCA 3PSIA 4A12A 3U2RA 1NG7A 2LREA 2VT3A 4QPOA 4CO8A 3L2UA 4ZTJA 3WE2A 2ZC2A 1SD6A 1MJBA 4KIBA 1HSTA 2XRNA 4XLAA 2P5LC 2PMUA 2MD5A 3F8NA 3LSJA 4DYCA 1LKXA 4KT5C 2E36A 2QSGX 2IS2A 3CTAA 5HS9A 2M7AA 4JYKA 3JR9A 3L2RA 4A93J 3NEUA 4PSWA 1AKHA 5CLSA 1JGGA 3AAFA 3PIOF 2QA4I 4A3JJ 3JRGA 5DYMA 4ON0A 2QF7A 3LFUA 1SFUA 2FU4A 4IQJA 3LAJA 5M5XJ 3HSFA 3E1SA 3FIWA 3IUOA 2E34A 2V9KA 2MD0A 2X1DA 1YIJI 4M9SA 1TNTA 2HKOA 3ERED 5FKLA 2D1HA 3DKWA 3ABMH 5HLGA 2X1CA 3HOSA 4CCOA 2O7OA 1MNEA 1OCCH 3DKXA 1HKSA 1BW6A 2VIXA 3P9KA 1TQIA 4A3MJ 3SYTA 3T8TA 1H88C 5IPAA 3KEYA 2JSPA 3MZYA 3P5JA 1SVOA 2V7FA 3CUQA 1TZLA 3O3KA 4EVIA 1I3QJ 2W4SA 3F8BA 3PNTA 4DZJA 3TOAA 3VPRA 3H9GA 3S8PA 3QPSA 3HEFA 3L2WA 1NK3P 1MW7A 2W84A 2CQXA 3FM3A 2ECBA 3HOYJ 3HG9A 1ZARA 5EEGA 1Z05A 3C2HA 1Y1VJ 1MBJA 2JMWA 5BS6A 2UV1A 1DU0A 4C3IJ 2QQAA 1XB4A 2DOFA 3IRRA 4A6DA 2V6EA 1X1AA 1X1PA 2MG4A 5EEAA 4OIQF 4QIWN 5BQTA 2VXDA 3TP0A 4N9HA 3JSPA 1PP8F 3FXUA 2DODA 3NWTA 1ETQA 1OJLA 3DPLC 4F55A 2KMUA 4BHCA 4M3DA 2QQBA 3RKYA 4C2MJ 3GBGA 3TDZC 2DA2A 2Y31A 2EFQA 3TP3A 5IP7J 1W5TA 3ABTA 2X9DA 4RB1A 5TJJA 4A0ZA 1ZG5A 2WAQN 2B9SA 2NVUB 4NHJA 2DFEA 2XB0X 1XPXA 1GUUA 1R00A 2K3FA 4PFPA 3KETA 3F8CA 2P5KA 4L18B 2EINH 2DCEA 3OIQA 3VEPA 2Z9OA 4EJTA 1G2HA 1RPWA 2X51A 5FKNA 3H1CA 2W7NA 2KIUA 2K9MA 2FNPA 5HDGA 3OMYA 3J80K 4HA8A 1VI0A 3E5XA 1XSXA 3W2WA 1VQ6I 5FD6A 1WJCA 1K7AA 1J9IA 3SHFA 1U5TC 3WGHA 3ZXSA 1ZRDA 3OOPA 5J1UA 1YS7A 3ZQLA 1GXPA 3IWZA 1LFBA 3R60A 5B66C 2HQRA 4KMUX 1ZAOA 3CCYA 5GTIC 4NB5A 5CVJA 4PJMA 5LBQA 1P4WA 2EIKH 3BT9A 3A0BC 2KISA 4JP0A 1STZA 2VJ4A 4M9XA 4Q48A 1P4AA 2VASA 2LNBA 1OCRH 3K0LA 2VQCA 3I59B 4EJOA 2E1OA 2Y0SN 4HQMA 2EILH 2QEXI 2M5WA 3HGGA 4XOTA 1Z1DA 5LGUA 1X4OA 1WJBA 3B73A 5ERIA 1R71A 2NVXJ 3LSIA 4A0XA 1Z9CA 4I02A 3A1YA 1O57A 2PI0A 3EYIA 5J47A 3KCCA 1OYYA 3MCZA 4A3LJ 3PQKA 3PUBA 1ZRFA 3V7RA 2CWEA 4BU2A 3OIOA 4UV8A 1HC8A 2IJLA 1HKQA 2BHYA 3V7SA 3BLYA 3CP2A 4XN3A 2XIGA 3F72A 4N0BA 2LD5A 3ZP5A 1IO2A 4IHXA 3KFWX 2WAQA 4ENMA 1UHWA 5ILUA 4BAYA 3ASNH 4LLNA 2ADUA 1MMDA 4XL9A 2VC0A 3GTLJ 2M9HA 4EGYA 4CDGA 4YIFA 4GYIA 1XMAA 2EZKA 4A3IJ 1ENHA 2MGQA 2X48A 3BR0A 2K9NA 2A6EF 2BEOA 3G1MA 3OWTA 1WSUA 2ECCA 4I09A 3V8JA 1LJ9A 1MBHA 1XGNA 3KZZA 2RN7A 4XR6A 3CLOA 4OIRF 3OV8A 4HBLA 2H8RA 3FMSA 4XKVA 1AKHB 3FK6A 4AM3A 3I71A 4ESBA 1E2XA 4BE0A 3E7LA 1ZLJA 4XKWA 4LD5A 1FOKA 1X2NA 2CYYA 2HVRA 4L9JA 4HX7A 1GXQA 3QWLA 5IYCJ 2XGDA 3H5RA 5FFXA 3IP4B 4Y3OA 2UZKA 1XMKA 4U7DA 4RAGA 2EIMH 4DYQA 1RKWA 5FB2A 3CMEI 2R92J 1B9MA 1I6XA 3EUHC 3EUAA 3Q0UA 4XKCA 1BIBA 1Y6IA 1MIJA 5F27A 1K78A 3Q9SA 1T0FA 3FXQA 3GMEA 4BNCA 4TV7A 5K7HA 5DUIA 1U3EM 1DP7P 3HHGA 2X1EA 3Q0WA 2DTZA 1BI1A 2ZXIA 4IRHA 3RSNA 5E8GA 1Y8QB 1MBKA 2K40A 3RPUD 3MMYB 5DEQA 1ZH5A 2NYXA 3BG7A 3CJRB 1O4XA 1OCPA 3G1LA 4BEHA 1IN7A 4DOZA 1XG1A 3BTLA 2PQ8A 1FJLA 3F21A 2QGUA 3CUQB 2DI3A 2YX7A 3R0JA 4ZDPA 2DK5A 3FXMA 1OISA 3ZQ7A 4ZYGA 1OYWA 3FM5A 2GXGA 2HQAA 3BR3A 3CQZJ 1WFXA 2PN6A 2XAFA 4BS9A 4BE1A 2R7WA 2FSWA 3ISPA 3ASOH 1J59A 1XGOA 2RNJA 5B1AH 5K1YA 4F52A 3OYJA 2JN6A 1D8JA 2DJIA 2IT0A 3DPUA 5CKTA 1U0JA 3S2WA 3EUKL 5E3OA 2RDPA 3FXRA 1V5EA 1MDMA 1ON1A 3S1MJ 1I39A 4YIIA 2IW5A 2Z99A 2DDBA 2JUCA 4A5MA 1JKOC 2ESNA 4IQ4A 2EWNA 5AIQA 3CCQI 1U5TB 5EZHA 1R1VA 5AONA 1WRJA 2GM4A 2TCTA 1W5CC 2OZ6A 5E1WA 3HZJA 5ILVA 1ZR4A 1YJWI 2DA4A 4G7OF 2K9LA 1IC8A 3E6MA 3DWLE 2A6TA 3WTZA 1VQ9I 4IHYA 2O5RA 1FYLA 4F93B 5F6FA 3OYEA 2L4MA 4BDZA 1U9NA 5IP6A 3FKIJ 3JRHA 1IUFA 1RR8C 4BY1J 2VJ5A 2LLKA 2WAFA 2BY1A 3S93A 2M3AA 3K2AA 5E20A 1APLC 3H3VK 2MA3A 2CGPA 2CFXA 3J7AY 2ZSHB 3VFZA 3O8HA 2LF7A 2OZUA 3ZPLA 4A3CJ 3A0HC 1DDNA 2R4GA 4I2OA 2M2EA 5GAEJ 2QSFX 3SXYA 4AYBN 3KE2A 1PUFB 4BUPA 1MMSA 4UUSA 4FHTA 3FISA 4ENNA 5FLVA 5JVGF 2VQHA 2LBFA 2H09A 5HS8A 1ZHFA 2LY9A 5L3DA 2LG4A 1WJDA 3RPQA 1I5ZA 5DCMA 1OPCA 2QLZA 5M5WJ 4M71A 3I5UA 3H35A 3M9AA 3TOBA 1D0YA 1I1GA 3WHCA 3HC7A 2ZFWA 4LLLA 2DMQA 2YPRA 3HHHA 4FE7A 1OR7C 3JAMZ 4EMSA 5F08A 4H0EA 1IN8A 2VPLA 2HWVA 5F0FA 4UVCA 3GTGJ 2BGCA 4HSRA 3WTWC 4KUMA 3CJTB 1KU7A 1TBXA 3FK7A 1U8BA 3BZCA 5K7FA 2QYOA 4BKXA 2PFBA 5BPDA 4L5JA 4KFCA 4QWQA 3GLXA 1C0WA 4OIOF 1S7OA 2E7WA 1JHHA 2H6CA 5ED4A 2HOEA 4AVPA 4NC8A 2ZBKA 1ETKA 2LKPA 2XPUA 4B47A 1X4PA 4Q5SF 5LGNA 2E71A 2H1LA 2BE5F 4L9NA 3VYRB 2NNYA 3I9V2 2E35A 1R36A 4GRIA 5IY5H 1TQMA 2E7XA 3I64A 4C2TA 3ERMA 1KQ0A 2IGKA 5AIPA 5BNGA 4Y7NJ 2R5YA 4PJJA 1YJ9I 1EJ9A 2FMLA 3PNYA 4H4KC 1FIPA 3UNGC 3A01A 3BOQA 3PO3J 2V1NA 4IF4A 4XM3A 4U0WA 2K02A 2XF6A 4YEJA 4LK1F 4DGWB 2ZB9A 3OL4A 5DD4A 2PMZN 3IL2A 2VODA 3FX3A 2QBYA 3HPGA 4M73A 2NNNA 2LC2A 3PIPF 2XAGA 2VBXA 1FBUA 1BL0A 4XRSA 2KRCA 3NRVA 3RIRA 4BDYA 3FHZA 5F0CA 2ZKZA 4B8XA 1ZELA 5JLXA 1JJ8C 4PGHA 3D0SA 4HF1A 2XAJA 3GTMJ 5E18F 3LAPA 2WV1A 1XDUA 1QHGA 3K4KA 2GQQA 5HVQC 4AIJA 1H9TA 1T56A 1CGPA 2OPTA 2DOEA 4IHWA 1FSHA 2FBKA 1X3ZB 1SD7A 1RESA 2YX4A 4HX4A 2XC7A 1QVUA 3ZQCA 3T5XA 2RGVA 1JKRC 2HDDA 4PSXA 5FGMA 1VQNI 4ESFA 4I99C 2IBDA 1E3PA 1M1EB 2L0KA 4HLXA 3QP5A 4BXXJ 1I3AA 4MIMA 3U1KA 1YW8A 5H2FC 1J7KA 1K6YA 4D5CA 2OAZA 1DPUA 3NAUA 2UUZA 4XLEA 3JTGA 2NAZA 5J1YA 3S15J 4A69C 2VQLA 4HSTA 1XD7A 3LSGA 4CCLA 5L3EA 5DM7F 1K78B 2KIFA 3LSMA 1WPKA 2FMYA 1ETYA 3IHUA 4HX8A 1TT0A 2XB5A 1F5TA 2DMTA 5L3CA 2O9LA 2A07F 1DGRM 5F0HA 1MNDA 5K5RA 1LQ1A 1G8XA 1FYKA 1T95A 1F1ZA 2Y69H 5IT3A 4ZZLA 4S0HB 4CCMA 1DU6A 1WH5A 4C3JJ 1ZGAA 1O3RA 2FOKA 1VFCA 1O3TA 3QP6A 1UCRA 2F5DA 4W1UA 2DBBA 3MZHA 2CV2A 1HDDC 2DFHA 4XBFA 4N4OB 3DPTA 2R93J 3TKYA 2NOJB 1SMTA 4XKBA 4M74A 1RUOA 4CXFA 2P4WA 1NHAA 2FA5A 4IHVA 2KL4A 3ECOA 2EZIA 1RI7A 1FZPB 2OQRA 4OIPF 5LFAA 4II3A 3BY6A 4G6TB 3K70C 4A3BJ 3FF5A 1FC3A 3FBNB 3VDXA 4GGGA 2QCOA 5CVUA 4B1RA 4BJ6C 1G3SA 5EDNA 1IN5A 3OOUA 3P7NA 3CLQA 2FNAA 1MDMB 1VQPI 2ZSIB 1UHSA 3BR6A 5B5EC 1K4TA 5FLMJ 5M3FJ 1OCZH 1RUNA 2OD5A 2H94A 3O2PE 2HZDA 2KJCA 1XSVA 2TDXA 4CH7A 4JK1X 4M6YA 2YR2A 1G3YA 2EBIA 4PZJA 2D1VA 2VT2A 2V1XA 1RETA 2NVTJ 4WWCA 4XRFA 3OS1A 4CZZA 1P9QC 2OBPA 1LFPA 4YRVA 2FQ4A 2L7KA 4MQ9F 2OC6A 4YELA 3SFIA 4J19A 4RGRA 4F91B 5HNFA 2L02A 2W00A 2VPRA 2VL8A 5D5WB 1IXRC 2A61A 3IKVA 4JOMA 4JBAA 5FKMA 2H6BA 2CUEA 5LRRA 3CCUI 1Z7LA 1OQYA 4M3BA 4BH9A 3LSPA 1R4MB 1YG2A 2GA1A 2AQEA 4RB2C 1QU3A 4ASNA 1D3YA 1EH6A 3GFLA 2JVHA 2M0CA 1V4RA 2QVOA 2ZMEA 2ESHA 3L2VA 4IOAF 4YIRX 3HB9A 4G9YA 4B4CA 1NG6A 3RJPA 2DU9A 2FRHA 2Y75A 4RLQA 4UUSB 2QSHX 3T0YA 4D7MA 3VB2A 1D1CA 4V2FA 1QRYA 2KHMA 5TGTA 2DA3A 3OIPA 1A6IA 3HOTA 2LBFB 1ULYA 4HYEA 3ZCOA 3NARA 4BJTA 2GWRA 4EV0A 1K83J 3WTTC 3C18A 1HF0A 5DCMB 1HA8A 3C1DA 3C2BA 3RQ4A 1TWCJ 1XGMA 1F36A 1TWGJ 3TO6A 1X58A 2W57A 2MYSA 3JRCA 2XGXA 4I98B 4X1EA 3BCAA 3VODA 4OINF 2M34A 1IGNA 3GFIA 2QENA 4I0AA 4U0VA 4JX5A 1A04A 1NTCA 1T8IA 2W85A 4EEFG 3E97A 3W6JB 1FMVA 3I53A 3HOVJ 4EM1A 5DD8A 1K79A 2VOPA 2XSDC 3DXJF 5JHFA 1W4MA 2EA4A 2Z33A 4ABZA 4G7ZF 1SVLA 2A5WA 2AO9A 2ZNZA 3RI4A 3CESA 1I1SA 2JA6J 3GTPJ 4IPAA 1RKTA 1TL8A 5BPIA 5B1BH 4FX0A 1RR7A 2CW7A 5DV5A 2R5YB 3EQLF 2WB1A 1OMIA 2L7MP 2RV8A 4LGWA 3DBRB 5J4VA 3A01B 5M5YJ 3M7GA 4C2UA 1PVEA 4R1HA 2R7QA 5EJCA 4K2EA 2R7UA 5E1ZB 3P9IA 2QBYB 2VN2A 4GFBA 2XAUA 3L9FA 4PCQA 3GZ6A 2M1BA 1Z3XA 3BROA 3G73A 1K6OA 4HG2A 1DQUA 2HQNA 2KDOA 3VSKA 4V2GA 5GPCA 3K70D 3PSFA 4CUGA 4HNTA 1XCBA 1I27A 1BJAA 4BXUA 1IDYA 2RQPA 3HRTA 1WZ2A 3SQNA 2AHQA 1QGPA 3LMMA 4RMNA 1UZCA 3QU6A 2GIZA 3FMQA 4OAZA 5J8FA 2R7OA 2Z3YA 5HLHA 2STTA 5C4XJ 2GXAA 3LA3A 3I58A 1NK2P 2Q0OA 1SD5A 3DP7A 2F4MB 4FTHA 4XOPA 2FF4A 4E4HA 2OTJI 2MH2A 2IGMA 2MABA 1TLHB 2G9WA 3S1RJ 2EK5A 3AG4H 3CUQC 3CZ6A 3SEZA 1BOBA 2GAUA 2X85A 4A3DJ 1WVRA 4UB8C 4CZCA 3ABUA 3IRQA 3I55I 2E1MB 5FFZA 3CCVI 2KT0A 1WJFA 2OF7A 3L2QA 1XSDA 1YO5C 4BACA 2IA0A 3VWBA 3HTSB 2BXYA 4C30A 4ZYEA 3ZMTA 3PM1A 3IH3A 5FLXK 2KQRA 1X2MA 3ABKH 4ZC3A 1ETVA 3OY9A 2Z2SB 4LG0A 4EM2A 2A68F 1OCOH 1VQOI 4G12A 3OS2A 3G2BA 3GCMA 1HKTA 2UXNA 3M4OJ 5E3MA 2FBIA 4P1WA 1J09A 5EGOA 2D5VA 3FKJA 1YRNB 5KAFC 2HI3A 1O3SA 5EF6A 2WC2A 5D5XB 3S14J 2WY8Q 1SAUA 3HOUJ 1MBFA 1WJ5A 1B59A 3WTVC 3BJOA 3QPLA 1FYMA 2X4HA 3B6AA 5TISC 4XN0A 4HRIA 3RQIA 5D4RA 1J2XA 1X1CA 2OCCH 1R5HA 3L2CA 3F8MA 5E17F 1H9GA 4HPQA 2F2EA 4L5EA 3OR1C 1IF1A 2NS8A 2DPUA 2EV5A 1ON2A 4LJZF 3T8RA 2HVQA 1S7EA 4L9VA 3KZYA 4ZZDA 3M1EA 1D1BA 1Q1HA 3C2GA 2Q8KA 1QZEA 2JVGA 1W36C 1U6GA 4NC6A 3PUFA 2P8TA 2B63J 2GXBA 2LVSA 2HR3A 4MFEA 3DTIA 2R7VA 3CP8A 1MH4A 5D4SA 1VQ4I 1QPIA 2HPIA 3SDBA 1FEXA 1ZYRF 2H8WA 4DBRA 1IXCA 1BR1A 1X1DA 2CUJA 2C6YA 4RAFA 3GLLA 1SFKA 2XPWA 2YS9A 3V7CA 3TMOA 4BBRJ 1X1BA 5JLWA 2EH3A 5A2QK 1J0RA 1B4AA 4L0ZB 2WV0A 2ZMEB 5IP9J 3HJEA 2Y2ZA 5K5OA 3KLNA 3MEXA 2K4JA 2IS1A 5F1JA 4X6AJ 4S04A 2K85A 2CQ7A 4FCYA 3S3MA 2W82A 5JI6A 5H6QA 1YLFA 3WTSC 3S16J 3N97A 2DA5A 4Y13A 3CJQB 4ESJA 4U7BA 3GEZA 4W97A 4QLCU 4NUBA 5D5UB 1VNDA 1Z6TA 1TW3A 2M7BA 2EQRA 2DOAA 3TDUC 2KZGA 5LGTA 1CF7A 3I4PA 3D1NI 1F9NA 3K6GA 2XSJC 1BN5A 2DQLA 4G6QA 3OYBA 3GTKJ 2G7UA 3GTJJ 1R1UA 2DW4A 1Y0UA 3S3NA 4RAYA 3LSRA 2WTEA 2R7XA 2L9VA 3OYKA 2RKHA 2BV6A 2KDZA 4KDPA 4D9JA 1LEAA 3ZMZA 4BQAA 1R22A 5FRNA 2CO5A 1VF9A 3ROUA 3HBLA 4MGRA 1POGA 4Y17A 3OYDA 3OSGA 4FQGA 5K7ZA 2D2WA 2XKOA 4UHTA 4IO9F 5IT9K 3K4CA 3OYMA 2ZO4A 1X3WB 3GFMA 3S17J 4CHUA 1MJ9A 1S8NA 2EJRA 3E6BA 1E3OC 2LMDA 3WGIA 3GFJA 1FT9A 1JKPC 4I7HA 3ZMDA 4Y33A 3TBIA 1WCMJ 2CW8A 5J3LA 3KLOA 1AOYA 2CFOA 3BTIA 1OYIA 2KIQA 4HLYA 2BZTA 2K7LA 3VOEA 1USTA 2CMPA 2WADA 1QZZA 2L9RA 2A69F 2QWWA 1P6RA 3AG2H 3K4BA 1EH8A 1P7JA 3HIFA 3FBIB 4OU0A 1V5FA 3KZIC 4KYWA 1WI9A 1X19A 3F6OA 1TT5B 3UR3C 1T0FC 1A31A 2CQQA 2DMUA 5CJ9A 4EATA 3RKWA 3G6EI 5DDGA 3DEEA 1O7FA 4A3EJ 1PP7U 2BY3A 3IH4A 3BP8A 2BVLA 4XLHA 3LL7A 3FXLA 5IOYA 1LNWA 1Y0NA 3Q0VA 1YOVB 3EYYA 4ZH4F 1IDZA 3HOWJ 4WXCA 4KNYA 3C3WA 1YITI 4WXHA 2GA2A 3CO6C 3SDGA 4PJNA 1N25A 2P0WA 3E5QA 2XUBA 3MKWB 2FJ1A 2HKXA 5CYVA 1SFXA 4E7LA 1KU3A 3N05A 2BY0A 1HSJA 2PG4A 3VYUB 2EIJH 3K9TA 4MQVA 4EJWA 3GTQJ 1BA5A 1ETWA 3I4NJ 4NDLA 5HNHA 1HW2A 3WG7H 3E0JB 1XTAA 2F4IA 2LFBA 4BY7J 4JQFA 1EV7A 2DO7A 4KICA 4HV5A 5DTDA 5TRDA 1J5YA 2JQ7A 1ZRCA 5GP9A 2E5NA 3IAS2 1AWCA 1A36A 4G6DA 1KONA 3MN2A 4RGXA 3ZRGA 1WQ2A 1L0OC 2E1NA 1PUEE 4MHGA 4BQOA 4LG0B 1SMYF 4DIQA 4YFNF 4GDFA 4F92B 5KHDA 1FTTA 4CYCA 3HRMA 3F9KA 3MZ8A 1VQMI 1VQ5I 1GVJA 2K4BA 1TP4A 4HOBA 3K1PA 1B9NA 5EGOB 1I6HJ 3UKGA 2DA7A 3M8FA 1ONVA 3A4CA 3FDYA 2DT5A 3H9JA 4NC7A 3ZMSA 2HYFA 1VQ8I 3J80Z 4MTDA 2DMNA 3FZVA 1U2WA 2FQ3A 4V19K 3ZQHA 2VE8A 5E3NA 3HL2A 3ULQB 2L3DA 5FLXZ 4RBOA 4CCNA 3KYCB 3G71I 3CDHA 1G3TA 5HDKA 1HLVA 3Q5FA 2QKMB 4LLGF 5BMZA 4MNUA 4RGSA 1S6LA 5H20A 3HRSA 2XGCA 5LEJA 1YJNI 1N78A 3U1DA 5JFRA 4M9ZA 2W48A 3CJNA 4I76A 4B09A 3V8KA 2HOAA 2FEZA 1LVKA 3JRIA 3ONQA 1UHMA 4ANJA 1U78A 3AG3H 2ID3A 4BL0B 2J5OA 3GZNB 2VXZA 3CD6I 5IYBJ 3BJ6A 1XS9A 1LFUP 3ZQIA 3PFIA 2B7EA 1W7PA 5LHHA 4EM0B 3QU3A 2L2OA 5HLIA 1RC9A 2IRFG 2QM3A 4JX6A 4EQQA 2ZXHA 2DYSH 3BG3A 2GOMA 2X6YA 2P7CB 2CSOA 2K3PA 2M8GX 1J75A 2WA0A 2GIVA 2ETHA 1LE8A 5ICFA 3KYLA 5IYDJ 4MEXF 1D5VA 3ZOBA 3CO7C 4ZDOA 4IRGA 2Y9YA 2CW0F 2YU3A 5KNLA 3S2DJ 1T08B 2DFFA 3HRUA 1KQ9A 3J7ZI 1QZYA 2ISZA 2F4OB 5GAHJ 1EH7A 2F5EA 4I0BA 1MBEA 4M3FA 1E17A 2VKVA 3AG1H 2L7ZA 2WAEA 4FETA 2PJPA 1FPQA 9ANTA 3CC2I 1TWHJ 4A3GJ 3M1CA 1TWAJ 1FY7A 1CF7B 3WU0A 2E2JJ 4J01A 2BW3A 1BOAA 3ZGKA 1MNMC 1A6QA 5C4JJ 3KP5A 1BJZA 1JUPA 2I8DA 1YW7A 3O8GA 1OKRA 4DZPA 2NRAC 5D6EA 2E19A 3OYCA 1QBJA 3JTHA 2R7ZJ 4XSZF 2ELJA 1R1TA 2IGNA 2NS0A 1B72A 1LPQA 2JK3A 4ZYHA 5E8IA 2DA6A 5LD2C 4ITVA 3SJMA 3S2HJ 1Y39A 2FXAA 2HS5A 1ZK8A 4A3KJ 4IL6C 3OYHA 2V4JC 2X6OA 2F5FA 3HPHA 1AHDP 3FMRA 3I0TA 2EB7A 3OR2C 2VONA 1S72I 2HEOA 1S9HA 3A03A 3J7AO 2PBIA 1ACIA 4FE4A 1Z67A 3F22A 4XLFA 2XROA 2WBMA 1B8IA 2H1KA 2NVQJ 2RNGA 4BBSJ 2R7DA 4BEHB 3K10A 5ICCA 1T39A 2XKPA 4PDKA 2R5ZA 1DGWY 2P6SA 2L9SA 2VE9A 2JPCA 3QAHA 3CF2A 2VLAA 2PLYA 2M8EA 5DCFA 5ICGA 3CMAI 4DQ2A 4IZZA 1W1WE 2VJIA 1FBSA 5IT9Z 3D5LA 2ZJPF 2J5PA 2NVYJ 2P5VA 2IA2A 4GXOA 1N77A 1FX7A 3RDIA 4LITA 2E1MC 1X3UA 3F23A 3FXJA 2QQ9A 3KPHA 4KT6A 4RB0A 2LDUA 1XGSA 3DU6A 4E7IA 5KCMA 4WX9A 2JPBA 2QUFA 4U0YA 1GVDA 1V55H 2OA4A 1KQ8A 1P92A 4ZTFA 3OYFA 3H36A 1USSA 2WB1N 1IW7F 4GCVA 4UUVA 2DN0A 3AKZA 4PGGA 4L9TA 3V4GA 4CCKA 3GYHX 3EPZA 4OMYA 2K9QA 3K2ZA 3DKYA 2MBFA 2IGOA 4LFUA 2KZVA 3GUDA 1YE9A 3REOA 5J8CA 5DS9A 1P4XA 4DJAA 4S05A 1WI3A 2QQ8A 4Z2YA 1VZ0A 3F8FA 4E7KA 2DT7B 1BI3A 1K61A 1MD0A 3X2QH 6PAXA 1OFCX 4DYRA 3CMYA 1MMNA 3F6VA 3CDLA 1IV8A 1ZR2A 1G59A 1GDTA 2XF5A 2RVCA 4CGZA 5FRMA 1QPMA 3ML6A 1R5GA 3ECHA 1SEUA 2M4KA 3MVPA 1FTZA 1MJAA 4HW0A 2OU2A 1R7JA 2Q2EA 1MGTA 2IAIA 2JSCA 3H5AA 2DTRA 4LG3A 3DLLF 4XK4A 2HU9A 2Z1DA 4CYCB 4M72A 1ETOA 1FSEA 4IHSA 4OOIA 4RM2A 3G3ZA 4XLNF 4UY8I 1IRFA 1JUSA 1ZN2A 2EZLA 3KYDB 4M6VA 4RAZA 1T2KA 1D5YA 2KRFA 3ZQGA 3HDDA 1Z0XA 3LWFA 2EFPA 1JJ6C 2E5ZA 3M07A 2VQGA 3HSRA 3MWMA 5F04A 2FX0A 2VBZA 2KJBA 3MD2A 2E60A 4XMYA 5LHIA 3ZQFA 3BG5A 1QHHD 3L00A 1Q1VA 3BZKA 4MO7A 2L4AA 2LF8A 2LTPA 2ELKA 3KIOA 2ZMEC 1KA8A 2QZ8A 2MLGA 4XLPF 3FXKA 2LOOA 4L5IA 5D8LB 2G7HA 4C9YA 1R6RA 2DA1A 2O8XA 3KP2A 1V54H 2BXZA 2AXLA 3K1NA 4D5FA 4HNUA 2V1DA 1JE8A 5CPRB 3GTOJ 4HF2A 2CJJA 2GZWA 4N4NB 3R6SA 3U21A 1W7PB 2ID6A 3BR1A 3F0CA 3BZ6A 4EJUA 1GV2A 3K69A 1P7IA 4XORA 4X0GA 5GTHC 2JWTA 1QNTA 3FWEA 5J6XA 1ZREA 1UAAA 2COBA 3HKZN 2VBWA 4O3MA 1LE8B 3L7WA 4ETSA 2XAQA 3U9GA 1DPRA 3ZQQA 3MAJA 4AVZA 5HOOA 2ISYA 1IUYA 3BG9A 1R58A 3ZN0A 2FBHA 1G3WA 3HOXJ 1WJEA 1UB9A 3QPHA 1F4KA 2HDCA 1RIOH 5B3SH 4J00A 2DYRH 1TWFJ 4XNFA 3LOCA 5LLQA 1FMWA 1F43A 1REPC 1A5JA 3BG6A 4DW6A 1R4NB 2LY1A 3ZMVA 3K1MA 3GZ5A 3BWGA 3WU2C 4B3XA 3BTJA 4KISA 2ZNYA 1TTYA 3ELKA 1CQTA 4IKFA 4G8XA 1SD4A 2BW3B 3J81K 4AD9A 4P5OA 2UWMA 3QPTA 3KEQA 1YQAA 3L1PA 2BY2A 3DU5A 4UUTA 1LDDA 2AQFA 3E3VA 1TNSA 5L3FA 1MBGA 5D5VB 3LSTA 1JKQC 1UG0A 1YS6A 3RZDJ 1V5GA 2ME6A 2X6XA 1B72B 1D0XA 1QA6A 1JHFA 4UVAA 1XN7A 3RPUA 4HDVA 1BM9A 2UXXA 2HOTA 3BPXA 2HFHA 2KLOA 1JXSA 1PDNC 5K5QA 4BHBA 4DBQA 3ESWB 1T98A 1U5TA 3LA2A 4IOCF 4ZYDA 3AL0B 1MMAA 2K86A 1S5LC 1RZ4A 1R5ID 2CRGA 1JTXA 2LP0A 4LK0F 4PFOA 3SZPA 3PQJA 3R61A 3I56I 1IAWA 2O61A 2KPMA 3E5UA 2MFZA 3DEUA 2JA2A 3S1NJ 5H6RA 2RC4A 4A6EA 1YTYA 1D0ZA 5M3MJ 1SVMA 2DAOA 1MMGA 2F48A 3OS0A 3JW4A 1ZLKA 4UB6C 5ICEA 1B8IB 1G4DA 1JTYA 3DF8A 2FOWA 2HYJA 4FT8A 5BOXA 1RNLA 4PK4A 4WF2A 2R5ZB 5JR3A 1K4SA 2MH9A 2P6TA 2JA7J 2E1CA 4XSXF 2X6WA 3PNVA 4D7NA 4BJ5C 3QOPA 3IC7A 3S32A 3TW6A 1YYVA 1UMQA 3LFKA 4HQEA 2M45A 5CVRA 1HQCA 3KP3A 4MTEA 1ZGWA 1Z7UA 1FOYA 3HKZA 3OYGA 1Z21A 4IXAA 5F64A 3IV5A 1JUMA 1PUFA 4HEA2 3JAMK 2XPVA 2BBYA 3TGNA 2CU7A 1JT6A 3M8EA 1LDJA 3ZN1A 1JGSA 2VKEA 2STWA 3C7JA 2GBYA 1MSEC 3A02A 2CUZA 2XVCA 3EDPA 5GAGJ 2XF7A 2A6HF 4F7ZA 3BCBA 3SFZA 4PJ0C 1V3FA 5GADJ 1BC8C 4GO1A 4XLCA 2CV1A 1D1AA 4IEJA 2PJRA 3OYNA 3ABLH 1LDKB 4LB5A 5C3EJ 1PJRA 3IWFA 3MKLA 1BBYA 4ZJZA 2OUMA 3D5SC 3DV8A 3TL4X 2GOXB 2P7VB 3EETA 4A3FJ 2CUFA 5HS7A 1O3QA 4IHTA 5GPAA 2K5CA 5EEHA 5ILSA 1S29A 1BW5A 1WHUA 4AIKA 2JJ7A 2OJED 2H27A 5JHUA 3FXOA 4HV6A 3F3XA 3NWSA 3W2VA 2JRTA 3KP7A 1R23A 4JX4A 4G7HF 4B44A 2VBYA 2ZJRF 4HAMA 3LQRA 3SEQA 2Q2EB 4XIDA 1R9TJ 1U8RA 2TRTA 4Y15A 2O6GE 1ZQ3P 3RZOJ 2FD5A 4AIDA 1B6AA 1QQIA 3S3OA 2JT1A 1JT0A 4MFDA 5FROA 4AUXA 3TEDA 4LB6B 4LMYA 1XC5A 4R79A 3I4MJ 2COMA 2MC4A 2ZJQF 4B3AA 4AC0A 3DFGA 4IRIA 2R7FA 2FUG2 4UV9A 3IKTA 3O6BB 2CS3A 4R8HA 1Z77A 3EUHA 3ZMUA 4EGZA 4NBQA 1S7AA 5EZGA 1FNNA 4Y52J 1NH3A 3CC7I 4RGUA 4OAYA 5HODA 2DJNA 4NQWA 1O7LA 1Z91A 3WGGA 1T6SA 1WJAA 2EZHA 3JCUC 1YFHA 1DUXC 1ZGJA 2L5QA 2PEXA 2LYCA 5DUKA 4D1QA 4KITB 1DP3A 2ME0A 4HZFA 3CF5F 1XX5A 4M3GA 3W2AA 2BYVE 2HVSA 5JVTA 4ENJA 2DDAA 1MKMA 2EFOA 3OYLA 2HQ5A 2WY7Q 2N8GA 1HBXG 1IZ1A 3WTUC 1IV6A 3JRFA 2L7FP 2ZCWA 2IS4A 2VKHA 3MFKA 4Z6YA 1Y8RB 3BQZA 5KAIC 4P55A 2ZFUA 4HNVA 3BPVA 2XRLA 1LUJB 2I10A 2LKXA 1IXSB 1IG7A 1MSFC 2OTLI 3COAC 3OYIA 3NQOA 4QPQA 2EV6A 1GT0C 2EPFA 1PYVA 2OQGA 2F5CA 3WE3A 4IX7A 1MH3A 3CCJI 2XHKA 2K27A 1BR2A 2Y0SA 2CH0A 2W1OA 3HUGA 4D0PA 2KP6A 2HTSA 4G94A 3PO2J 2P81A 3JREA 5L3GA 2M30A 4MLOA 4FX4A 1UELB 3OSFA 3JRAA 3CCRI 1ETXA 1HCRA 5LRSA 3QODA 1BC7C 3KX2A 2WWYA 5CVIA 4Q4ZF 1ORKA 2YUSA 4RB3C 3KP6A 2JUGA 2FE3A 5LEKA 3PL8A 2EFWA 1WKMA 3SZGA 1RRJA 1H8AC 3DBLB 3E6DA 4I01A 2E2HJ 5KK1A 3WTXC 2KRHA 1UFMA 2A05A 3GXOA 1W36D 3GW2A 4WK8F 4AIHA 2ELHA 3H92A 1QO0D 1IN6A 2DQRA 4OWRB 4UVBA 4KN7X 2MSYA 3RYPA 4KN4X 1ZTRA 3N4MA 3JRDA 2F6CA 3QRFF 3WODF 4YFXF 2EA2A 3BR2A 3D5RC 4AU7A 3KEOA 3J81Z 4A5NA 3J7YJ 2AS5F 1L3LA 1XMXA 1FOWA 4RLFA 4BQQA 1SAXA 2V1UA 4IVNA 1OLTA 2E2IJ 4NNJA 1VQLI 4F3QA 2AXTC 5J1RA 1SFEA 4CA0A 5C44J 2DMPA 3CCMI 4M6XA 2I5UA 1E3HA 3P9CA 1EKEA 2JRMA 5EG0A 2R7SA 5LHGA 1SFOJ 3H0DA 5FJ8J 3T1BA 2A5YB 2YSRA 3HXLA 3BC8A 5FO5A 1OR7A 2HNHA 5J4YA 1IJWC 1KYWA 4O6JA 3RTRA 2QKLB 2R7RA 1U9OA 2IPQX 1FIAA 1TC3C 4A2UA
chains in the Genus database with same CATH topology
3R0AA 3H3UA 1FWZA 2KKOA 1XCVA 3TO9A 2PMHA 3BJAA 2X0LA 2Z5UA 4CICA 2HYGD 4IJAA 1FBQA 5HDNA 4UXNA 5FD5A 1TQPA 4Q47A 3HSEA 3L09A 1KGSA 3WTYC 3KP4A 1KU2A 2IP2A 1IRGA 2XAHA 1BI0A 4KMFA 3I54A 2JZYA 4YG2F 1ZG1A 2M87A 1ODDA 1FLIA 2A3SA 2D45A 2DFIA 4BHPA 2CG4A 1VTNC 3Q9VA 3MQ0A 3BDDA 3WG9A 2IA1A 4BYYA 4U88A 1D8KA 1YW9A 2LSOA 1BIAA 1KU9A 2VOOA 3RKXA 5A2QZ 1G6NA 1WWXA 5E1XA 2R3SA 1P2FA 5D6FA 5F1RA 3HYIA 3GO5A 4KIFA 3TO7A 4YFKF 3RYRA 1FP2A 3LQQA 3GX4X 1KYZA 2KIMA 2CQKA 1ZG3A 2MC3A 2DLLA 4EJVA 2MLKA 4N9IA 4WXDA 4ENKA 2L01A 1LVAA 2O3FA 3B02A 4HF0A 3HTUA 2O03A 2O0YA 5D8KB 1T38A 3LA7A 4A0YA 2ZXJA 2HGCA 2DPDA 4AWXB 4GYGA 3GVAA 3V8LA 2IVMA 4RS8A 3JSOA 2W24A 3W6KB 1HW1A 2XV4S 4KA4A 3GWZA 1MZBA 4P96A 1H0MA 1W5SA 1XDSA 2XASA 1Z6RA 4L0YB 4O5VA 3I59A 4UNOA 5CVVA 1S3JA 1B1BA 2Y48A 1LEBA 2EFNA 2V9VA 4OMZA 3GF2A 3SZTA 1GHCA 2V6CA 3WU1B 4P9UA 3TQNA 1TW2A 1LB2A 2DK8A 3E6CC 2L54A 3R4KA 4E70A 2HZTA 2HTJA 3CUOA 2Y0MA 2V79A 4CYDA 2VC1A 2JTVA 2B0LA 4MEYF 1HW5A 4KIGA 5L3BA 2ACJA 2EV0A 3DQVC 5KVRA 1HXDA 1IN4A 2ZJ2A 4WCGA 1W7PD 4P9FA 1BI2A 1FP1D 4HDUA 2W25A 1YIOA 3H3ZA 4DNCA 4A12A 3U2RA 2VT3A 4CO8A 3WE2A 4KIBA 1SD6A 1MJBA 2P5LC 1HSTA 2XRNA 2PMUA 2MD5A 3F8NA 4KT5C 3CTAA 5HS9A 3NEUA 5CLSA 3AAFA 5DYMA 4ON0A 1SFUA 2FU4A 3LAJA 3HSFA 4M9SA 1TNTA 2HKOA 3ERED 2D1HA 3DKWA 5HLGA 3HOSA 1HKSA 3P9KA 1TQIA 3T8TA 3MZYA 3CUQA 3O3KA 4EVIA 3F8BA 3TOAA 2W84A 3FM3A 1ZARA 5EEGA 1Z05A 5BS6A 2QQAA 1XB4A 3IRRA 4A6DA 4OIQF 5BQTA 3JSPA 4N9HA 1PP8F 3FXUA 3DPLC 4BHCA 2QQBA 3RKYA 3TDZC 2EFQA 1W5TA 3ABTA 4RB1A 1ZG5A 5TJJA 4A0ZA 4NHJA 1R00A 3KETA 3F8CA 2P5KA 4L18B 3VEPA 2Z9OA 4EJTA 2KIUA 2FNPA 5HDGA 3J80K 4HA8A 3E5XA 1XSXA 5FD6A 1K7AA 1J9IA 3SHFA 1U5TC 3WGHA 1ZRDA 3OOPA 1YS7A 1GXPA 3IWZA 3R60A 2HQRA 4KMUX 1ZAOA 4NB5A 5CVJA 5LBQA 1P4WA 1STZA 4M9XA 4Q48A 1P4AA 2LNBA 3K0LA 3I59B 4EJOA 4HQMA 2M5WA 1Z1DA 5LGUA 3B73A 5ERIA 4A0XA 1Z9CA 4I02A 1O57A 2PI0A 3EYIA 3KCCA 1OYYA 3MCZA 3PQKA 1ZRFA 3V7RA 2CWEA 4UV8A 2IJLA 1HKQA 3V7SA 2XIGA 3F72A 4N0BA 3ZP5A 3KFWX 4ENMA 1UHWA 5ILUA 4BAYA 4LLNA 2ADUA 2VC0A 4EGYA 4CDGA 4YIFA 4GYIA 1XMAA 2A6EF 2BEOA 1WSUA 4I09A 3V8JA 1LJ9A 1XGNA 3KZZA 2RN7A 3CLOA 4OIRF 3OV8A 4HBLA 3FMSA 3I71A 4ESBA 1E2XA 1ZLJA 4LD5A 1FOKA 2CYYA 4L9JA 4HX7A 1GXQA 5FFXA 2UZKA 1XMKA 4U7DA 5FB2A 1B9MA 1I6XA 1BIBA 1K78A 3Q9SA 1T0FA 3FXQA 4BNCA 4TV7A 5DUIA 1U3EM 1DP7P 3HHGA 1BI1A 4IRHA 5E8GA 5DEQA 1ZH5A 2NYXA 1IN7A 2PQ8A 3F21A 3CUQB 2DI3A 2YX7A 3R0JA 2DK5A 3ZQ7A 4ZYGA 1OYWA 3FM5A 2GXGA 2PN6A 2XAFA 2FSWA 3ISPA 1J59A 1XGOA 2RNJA 5K1YA 1D8JA 2IT0A 3S2WA 2RDPA 3FXRA 1MDMA 1ON1A 4YIIA 2IW5A 2Z99A 4A5MA 2ESNA 2EWNA 5AIQA 1U5TB 1R1VA 5AONA 1WRJA 2OZ6A 5E1WA 5ILVA 4G7OF 3E6MA 3WTZA 1FYLA 5F6FA 2L4MA 5E20A 2MA3A 2CGPA 2CFXA 3VFZA 2LF7A 2OZUA 3ZPLA 1DDNA 4I2OA 3SXYA 3KE2A 4FHTA 4ENNA 2H09A 5HS8A 1ZHFA 5L3DA 3RPQA 1I5ZA 5DCMA 1OPCA 2QLZA 4M71A 3I5UA 3M9AA 3TOBA 1I1GA 2ZFWA 4LLLA 2YPRA 3HHHA 3JAMZ 4EMSA 4H0EA 1IN8A 2HWVA 4UVCA 2BGCA 3WTWC 4KUMA 1KU7A 1TBXA 2QYOA 2PFBA 5BPDA 4L5JA 4KFCA 4QWQA 3GLXA 1C0WA 4OIOF 1S7OA 2E7WA 1JHHA 2H6CA 5ED4A 2HOEA 4AVPA 2ZBKA 2LKPA 4Q5SF 5LGNA 4L9NA 2BE5F 2NNYA 1R36A 1TQMA 2E7XA 3I64A 5AIPA 1KQ0A 2FMLA 3BOQA 4IF4A 4U0WA 2K02A 4LK1F 5DD4A 3IL2A 2VODA 3FX3A 2QBYA 4M73A 2NNNA 2XAGA 2VBXA 1FBUA 3NRVA 3RIRA 3FHZA 2ZKZA 4B8XA 4PGHA 3D0SA 4HF1A 2XAJA 5E18F 3LAPA 1XDUA 2GQQA 5HVQC 4AIJA 1H9TA 1CGPA 1FSHA 2FBKA 1SD7A 2YX4A 4HX4A 3T5XA 2RGVA 5FGMA 4ESFA 4HLXA 3QP5A 1YW8A 1J7KA 2OAZA 1DPUA 3JTGA 2NAZA 1XD7A 5L3EA 1K78B 2KIFA 2FMYA 3IHUA 4HX8A 1F5TA 5L3CA 2A07F 5K5RA 1LQ1A 1FYKA 1F1ZA 5IT3A 4ZZLA 1ZGAA 1O3RA 2FOKA 1O3TA 3QP6A 1UCRA 2F5DA 2DBBA 3MZHA 4XBFA 3DPTA 3TKYA 1SMTA 4M74A 1RUOA 4CXFA 2P4WA 1NHAA 2FA5A 3ECOA 1RI7A 1FZPB 2OQRA 4OIPF 3BY6A 3FF5A 1FC3A 4GGGA 5CVUA 1G3SA 1IN5A 3P7NA 1MDMB 2FNAA 1RUNA 2OD5A 2H94A 3O2PE 2KJCA 1XSVA 2TDXA 4JK1X 4M6YA 2YR2A 1G3YA 4PZJA 2D1VA 2VT2A 2V1XA 4WWCA 4XRFA 4CZZA 2OBPA 4MQ9F 4RGRA 2L02A 5D5WB 1IXRC 2A61A 3IKVA 4JBAA 2H6BA 5LRRA 4BH9A 1YG2A 2GA1A 4RB2C 4ASNA 1D3YA 1EH6A 3GFLA 2QVOA 1V4RA 2ZMEA 2ESHA 4G9YA 3RJPA 2DU9A 2FRHA 2Y75A 3T0YA 3VB2A 3HOTA 1ULYA 4HYEA 2GWRA 4EV0A 3WTTC 3C18A 5DCMB 3C1DA 1XGMA 3TO6A 2W57A 2XGXA 4I98B 3VODA 4OINF 3GFIA 2QENA 4I0AA 4U0VA 1A04A 2W85A 3E97A 3W6JB 3I53A 4EM1A 5DD8A 1K79A 2VOPA 3DXJF 1W4MA 2EA4A 2Z33A 4G7ZF 2ZNZA 3RI4A 1I1SA 4IPAA 5BPIA 4FX0A 5DV5A 3EQLF 1OMIA 2RV8A 4LGWA 3M7GA 4R1HA 4K2EA 5E1ZB 3P9IA 2QBYB 2VN2A 3L9FA 4PCQA 3GZ6A 2M1BA 3BROA 3G73A 1K6OA 2HQNA 1XCBA 1I27A 1BJAA 4BXUA 2RQPA 3HRTA 3SQNA 1QGPA 3QU6A 3FMQA 5J8FA 5HLHA 2STTA 2Z3YA 3LA3A 3I58A 2Q0OA 1SD5A 3DP7A 2FF4A 2MH2A 1TLHB 2G9WA 2EK5A 3CUQC 2GAUA 3ABUA 3IRQA 5FFZA 1XSDA 1YO5C 2IA0A 3HTSB 4ZYEA 3ZMTA 5FLXK 4LG0A 4EM2A 2A68F 1HKTA 2UXNA 2FBIA 1O3SA 2WC2A 5D5XB 1B59A 3WTVC 3BJOA 1FYMA 2X4HA 5D4RA 1J2XA 1R5HA 3L2CA 3F8MA 5E17F 1H9GA 2F2EA 1IF1A 2DPUA 2EV5A 1ON2A 4LJZF 3T8RA 4L9VA 4ZZDA 3KZYA 3M1EA 1Q1HA 2Q8KA 1U6GA 2P8TA 2GXBA 2HR3A 5D4SA 1ZYRF 1IXCA 2C6YA 3V7CA 5A2QK 1J0RA 1B4AA 4L0ZB 2WV0A 2ZMEB 5K5OA 3KLNA 3MEXA 2K4JA 4S04A 5JI6A 5H6QA 1YLFA 3WTSC 3N97A 4Y13A 4ESJA 4U7BA 3GEZA 4QLCU 5D5UB 1Z6TA 1TW3A 3TDUC 5LGTA 1CF7A 3I4PA 1F9NA 1BN5A 2DQLA 4G6QA 2G7UA 1R1UA 2DW4A 1Y0UA 4RAYA 2WTEA 2RKHA 2BV6A 4KDPA 1LEAA 3ZMZA 4BQAA 1R22A 2CO5A 3ROUA 4MGRA 4Y17A 2D2WA 2XKOA 4UHTA 5IT9K 2ZO4A 3GFMA 4CHUA 1MJ9A 1S8NA 2EJRA 3E6BA 3WGIA 3GFJA 1FT9A 4I7HA 3ZMDA 3KLOA 1AOYA 1OYIA 4HLYA 2K7LA 3VOEA 1USTA 1QZZA 2A69F 2QWWA 1P6RA 1EH8A 3HIFA 4OU0A 4KYWA 1WI9A 3F6OA 5CJ9A 3RKWA 5DDGA 1O7FA 1PP7U 3BP8A 1LNWA 3EYYA 4ZH4F 4WXCA 4KNYA 3C3WA 4WXHA 2GA2A 3CO6C 3E5QA 2XUBA 2HKXA 5CYVA 1SFXA 1KU3A 1HSJA 2PG4A 3K9TA 4MQVA 4EJWA 1HW2A 4JQFA 1EV7A 2DO7A 4KICA 4HV5A 5TRDA 1J5YA 1ZRCA 1AWCA 4G6DA 4RGXA 1WQ2A 1L0OC 2E1NA 1PUEE 4MHGA 4LG0B 1SMYF 4YFNF 3HRMA 1GVJA 2K4BA 4HOBA 3K1PA 1B9NA 3M8FA 1ONVA 2DT5A 3ZMSA 2HYFA 3J80Z 4MTDA 3FZVA 1U2WA 2FQ3A 2VE8A 3ULQB 2L3DA 5FLXZ 3CDHA 1G3TA 5HDKA 3Q5FA 4LLGF 5BMZA 4MNUA 4RGSA 1S6LA 5H20A 3HRSA 5LEJA 3U1DA 5JFRA 4M9ZA 3CJNA 4B09A 3V8KA 2FEZA 1UHMA 1U78A 2J5OA 2VXZA 3BJ6A 3PFIA 1W7PA 5LHHA 4EM0B 3QU3A 5HLIA 2IRFG 2QM3A 4EQQA 2P7CB 2CSOA 1J75A 2GIVA 2ETHA 5ICFA 4MEXF 1D5VA 3CO7C 4IRGA 2CW0F 2YU3A 3HRUA 1KQ9A 1QZYA 2ISZA 1EH7A 2F5EA 4I0BA 1E17A 2PJPA 1FPQA 1FY7A 1CF7B 3WU0A 1BOAA 3KP5A 1YW7A 1OKRA 2NRAC 5D6EA 1QBJA 3JTHA 4XSZF 1R1TA 2NS0A 4ZYHA 5E8IA 2FXAA 2HS5A 2F5FA 3FMRA 3I0TA 2EB7A 2VONA 2HEOA 3J7AO 2PBIA 3F22A 2XROA 2R7DA 5ICCA 1T39A 2XKPA 4PDKA 2P6SA 2VE9A 2JPCA 3QAHA 2PLYA 2M8EA 5DCFA 5ICGA 4DQ2A 1FBSA 5IT9Z 3D5LA 2J5PA 2P5VA 2IA2A 4GXOA 1FX7A 3RDIA 1X3UA 3F23A 2QQ9A 4RB0A 2LDUA 1XGSA 4WX9A 2JPBA 2QUFA 4U0YA 2OA4A 1KQ8A 1P92A 1USSA 1IW7F 4GCVA 4UUVA 4PGGA 4L9TA 3V4GA 3GYHX 4OMYA 3K2ZA 2MBFA 4LFUA 3GUDA 3REOA 5J8CA 1P4XA 4S05A 4Z2YA 3F8FA 1BI3A 1MD0A 6PAXA 3F6VA 2RVCA 4CGZA 1QPMA 3ML6A 1R5GA 3ECHA 1MJAA 4HW0A 2OU2A 1R7JA 2Q2EA 1MGTA 2JSCA 2DTRA 4M72A 1FSEA 4IHSA 4OOIA 3G3ZA 4XLNF 1IRFA 1ZN2A 4RAZA 1T2KA 2KRFA 3LWFA 2EFPA 3HSRA 3MWMA 2VBZA 2KJBA 5LHIA 3L00A 2L4AA 2LF8A 1KA8A 2QZ8A 2MLGA 4XLPF 4L5IA 5D8LB 2G7HA 3KP2A 2O8XA 2AXLA 3K1NA 2V1DA 1JE8A 4HF2A 2GZWA 3R6SA 1W7PB 3BZ6A 4EJUA 3K69A 1QNTA 3FWEA 5J6XA 1ZREA 2VBWA 4O3MA 3L7WA 4ETSA 2XAQA 3U9GA 1DPRA 3MAJA 5HOOA 2ISYA 1IUYA 1R58A 3ZN0A 2FBHA 1G3WA 1UB9A 3QPHA 1F4KA 2HDCA 1RIOH 5LLQA 1REPC 3ZMVA 3K1MA 3GZ5A 3BWGA 2ZNYA 1TTYA 3ELKA 4G8XA 1SD4A 3J81K 4AD9A 4P5OA 2UWMA 3QPTA 3KEQA 1YQAA 1LDDA 3E3VA 1TNSA 5L3FA 5D5VB 3LSTA 1YS6A 1JHFA 4UVAA 1XN7A 3RPUA 4HDVA 1BM9A 2UXXA 1JXSA 3BPXA 2HFHA 1PDNC 5K5QA 4BHBA 1T98A 1U5TA 3LA2A 4ZYDA 2K86A 4LK0F 1RZ4A 3SZPA 1IAWA 3PQJA 3R61A 2O61A 3E5UA 3DEUA 5H6RA 2RC4A 4A6EA 1YTYA 1ZLKA 2DAOA 3JW4A 5ICEA 1G4DA 3DF8A 4FT8A 5BOXA 1RNLA 4WF2A 5JR3A 2MH9A 2P6TA 2E1CA 4XSXF 3QOPA 3IC7A 1YYVA 3LFKA 4HQEA 2M45A 5CVRA 1HQCA 3KP3A 4MTEA 1Z7UA 4IXAA 5F64A 3JAMK 2BBYA 3TGNA 3M8EA 1LDJA 3ZN1A 1JGSA 2STWA 3C7JA 2XVCA 3EDPA 2A6HF 4F7ZA 3SFZA 1V3FA 1BC8C 4GO1A 1LDKB 4LB5A 3IWFA 1BBYA 3DV8A 2P7VB 3EETA 5HS7A 1O3QA 4IHTA 5EEHA 5ILSA 1S29A 4AIKA 2H27A 5JHUA 4HV6A 3F3XA 2JRTA 3KP7A 1R23A 4G7HF 2VBYA 4HAMA 3LQRA 1U8RA 4Y15A 2O6GE 1B6AA 1QQIA 2JT1A 4LB6B 4LMYA 4R79A 2COMA 3DFGA 4IRIA 2R7FA 4UV9A 3IKTA 3O6BB 4R8HA 3EUHA 3ZMUA 4EGZA 1S7AA 1FNNA 4RGUA 4NQWA 1O7LA 1Z91A 3WGGA 1T6SA 1YFHA 1DUXC 1ZGJA 2PEXA 5DUKA 4HZFA 2BYVE 5JVTA 4ENJA 1MKMA 2EFOA 1HBXG 1IZ1A 3WTUC 2ZCWA 3MFKA 4P55A 3BPVA 1IXSB 3COAC 3NQOA 2EV6A 2OQGA 2F5CA 3WE3A 2XHKA 2K27A 4D0PA 3HUGA 2HTSA 4G94A 5L3GA 2M30A 4FX4A 5LRSA 1BC7C 2WWYA 5CVIA 4Q4ZF 4RB3C 3KP6A 5LEKA 2FE3A 2EFWA 1WKMA 3E6DA 4I01A 5KK1A 3WTXC 1UFMA 3GXOA 4WK8F 3GW2A 4AIHA 2ELHA 3H92A 1QO0D 1IN6A 2DQRA 4UVBA 4KN7X 3RYPA 4KN4X 3N4MA 3QRFF 3WODF 4YFXF 2EA2A 3KEOA 3J81Z 4A5NA 2AS5F 1L3LA 1SAXA 2V1UA 4IVNA 1SFEA 4M6XA 3P9CA 5LHGA 3T1BA 2A5YB 2YSRA 5FO5A 1OR7A 1KYWA 4O6JA 3RTRA 2IPQX 4A2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0A A;  3H3U A;  1FWZ A;  2KKO A;  1XCV A;  3TO9 A;  2PMH A;  3BJA A;  2X0L A;  2Z5U A;  4CIC A;  2HYG D;  4IJA A;  1FBQ A;  5HDN A;  4UXN A;  5FD5 A;  1TQP A;  4Q47 A;  3HSE A;  3L09 A;  1KGS A;  3WTY C;  3KP4 A;  1KU2 A;  2IP2 A;  1IRG A;  2XAH A;  1BI0 A;  4KMF A;  3I54 A;  2JZY A;  4YG2 F;  1ZG1 A;  2M87 A;  1ODD A;  1FLI A;  2A3S A;  2D45 A;  2DFI A;  4BHP A;  2CG4 A;  1VTN C;  3Q9V A;  3MQ0 A;  3BDD A;  3WG9 A;  2IA1 A;  4BYY A;  4U88 A;  1D8K A;  1YW9 A;  2LSO A;  1BIA A;  1KU9 A;  2VOO A;  3RKX A;  5A2Q Z;  1G6N A;  1WWX A;  5E1X A;  2R3S A;  1P2F A;  5D6F A;  5F1R A;  3HYI A;  3GO5 A;  4KIF A;  3TO7 A;  4YFK F;  3RYR A;  1FP2 A;  3LQQ A;  3GX4 X;  1KYZ A;  2KIM A;  2CQK A;  1ZG3 A;  2MC3 A;  2DLL A;  4EJV A;  2MLK A;  4N9I A;  4WXD A;  4ENK A;  2L01 A;  1LVA A;  2O3F A;  3B02 A;  4HF0 A;  3HTU A;  2O03 A;  2O0Y A;  5D8K B;  1T38 A;  3LA7 A;  4A0Y A;  2ZXJ A;  2HGC A;  2DPD A;  4AWX B;  4GYG A;  3GVA A;  3V8L A;  2IVM A;  4RS8 A;  3JSO A;  2W24 A;  3W6K B;  1HW1 A;  2XV4 S;  4KA4 A;  3GWZ A;  1MZB A;  4P96 A;  1H0M A;  1W5S A;  1XDS A;  2XAS A;  1Z6R A;  4L0Y B;  4O5V A;  3I59 A;  4UNO A;  5CVV A;  1S3J A;  1B1B A;  2Y48 A;  1LEB A;  2EFN A;  2V9V A;  4OMZ A;  3GF2 A;  3SZT A;  1GHC A;  2V6C A;  3WU1 B;  4P9U A;  3TQN A;  1TW2 A;  1LB2 A;  2DK8 A;  3E6C C;  2L54 A;  3R4K A;  4E70 A;  2HZT A;  2HTJ A;  3CUO A;  2Y0M A;  2V79 A;  4CYD A;  2VC1 A;  2JTV A;  2B0L A;  4MEY F;  1HW5 A;  4KIG A;  5L3B A;  2ACJ A;  2EV0 A;  3DQV C;  5KVR A;  1HXD A;  1IN4 A;  2ZJ2 A;  4WCG A;  1W7P D;  4P9F A;  1BI2 A;  1FP1 D;  4HDU A;  2W25 A;  1YIO A;  3H3Z A;  4DNC A;  4A12 A;  3U2R A;  2VT3 A;  4CO8 A;  3WE2 A;  4KIB A;  1SD6 A;  1MJB A;  2P5L C;  1HST A;  2XRN A;  2PMU A;  2MD5 A;  3F8N A;  4KT5 C;  3CTA A;  5HS9 A;  3NEU A;  5CLS A;  3AAF A;  5DYM A;  4ON0 A;  1SFU A;  2FU4 A;  3LAJ A;  3HSF A;  4M9S A;  1TNT A;  2HKO A;  3ERE D;  2D1H A;  3DKW A;  5HLG A;  3HOS A;  1HKS A;  3P9K A;  1TQI A;  3T8T A;  3MZY A;  3CUQ A;  3O3K A;  4EVI A;  3F8B A;  3TOA A;  2W84 A;  3FM3 A;  1ZAR A;  5EEG A;  1Z05 A;  5BS6 A;  2QQA A;  1XB4 A;  3IRR A;  4A6D A;  4OIQ F;  5BQT A;  3JSP A;  4N9H A;  1PP8 F;  3FXU A;  3DPL C;  4BHC A;  2QQB A;  3RKY A;  3TDZ C;  2EFQ A;  1W5T A;  3ABT A;  4RB1 A;  1ZG5 A;  5TJJ A;  4A0Z A;  4NHJ A;  1R00 A;  3KET A;  3F8C A;  2P5K A;  4L18 B;  3VEP A;  2Z9O A;  4EJT A;  2KIU A;  2FNP A;  5HDG A;  3J80 K;  4HA8 A;  3E5X A;  1XSX A;  5FD6 A;  1K7A A;  1J9I A;  3SHF A;  1U5T C;  3WGH A;  1ZRD A;  3OOP A;  1YS7 A;  1GXP A;  3IWZ A;  3R60 A;  2HQR A;  4KMU X;  1ZAO A;  4NB5 A;  5CVJ A;  5LBQ A;  1P4W A;  1STZ A;  4M9X A;  4Q48 A;  1P4A A;  2LNB A;  3K0L A;  3I59 B;  4EJO A;  4HQM A;  2M5W A;  1Z1D A;  5LGU A;  3B73 A;  5ERI A;  4A0X A;  1Z9C A;  4I02 A;  1O57 A;  2PI0 A;  3EYI A;  3KCC A;  1OYY A;  3MCZ A;  3PQK A;  1ZRF A;  3V7R A;  2CWE A;  4UV8 A;  2IJL A;  1HKQ A;  3V7S A;  2XIG A;  3F72 A;  4N0B A;  3ZP5 A;  3KFW X;  4ENM A;  1UHW A;  5ILU A;  4BAY A;  4LLN A;  2ADU A;  2VC0 A;  4EGY A;  4CDG A;  4YIF A;  4GYI A;  1XMA A;  2A6E F;  2BEO A;  1WSU A;  4I09 A;  3V8J A;  1LJ9 A;  1XGN A;  3KZZ A;  2RN7 A;  3CLO A;  4OIR F;  3OV8 A;  4HBL A;  3FMS A;  3I71 A;  4ESB A;  1E2X A;  1ZLJ A;  4LD5 A;  1FOK A;  2CYY A;  4L9J A;  4HX7 A;  1GXQ A;  5FFX A;  2UZK A;  1XMK A;  4U7D A;  5FB2 A;  1B9M A;  1I6X A;  1BIB A;  1K78 A;  3Q9S A;  1T0F A;  3FXQ A;  4BNC A;  4TV7 A;  5DUI A;  1U3E M;  1DP7 P;  3HHG A;  1BI1 A;  4IRH A;  5E8G A;  5DEQ A;  1ZH5 A;  2NYX A;  1IN7 A;  2PQ8 A;  3F21 A;  3CUQ B;  2DI3 A;  2YX7 A;  3R0J A;  2DK5 A;  3ZQ7 A;  4ZYG A;  1OYW A;  3FM5 A;  2GXG A;  2PN6 A;  2XAF A;  2FSW A;  3ISP A;  1J59 A;  1XGO A;  2RNJ A;  5K1Y A;  1D8J A;  2IT0 A;  3S2W A;  2RDP A;  3FXR A;  1MDM A;  1ON1 A;  4YII A;  2IW5 A;  2Z99 A;  4A5M A;  2ESN A;  2EWN A;  5AIQ A;  1U5T B;  1R1V A;  5AON A;  1WRJ A;  2OZ6 A;  5E1W A;  5ILV A;  4G7O F;  3E6M A;  3WTZ A;  1FYL A;  5F6F A;  2L4M A;  5E20 A;  2MA3 A;  2CGP A;  2CFX A;  3VFZ A;  2LF7 A;  2OZU A;  3ZPL A;  1DDN A;  4I2O A;  3SXY A;  3KE2 A;  4FHT A;  4ENN A;  2H09 A;  5HS8 A;  1ZHF A;  5L3D A;  3RPQ A;  1I5Z A;  5DCM A;  1OPC A;  2QLZ A;  4M71 A;  3I5U A;  3M9A A;  3TOB A;  1I1G A;  2ZFW A;  4LLL A;  2YPR A;  3HHH A;  3JAM Z;  4EMS A;  4H0E A;  1IN8 A;  2HWV A;  4UVC A;  2BGC A;  3WTW C;  4KUM A;  1KU7 A;  1TBX A;  2QYO A;  2PFB A;  5BPD A;  4L5J A;  4KFC A;  4QWQ A;  3GLX A;  1C0W A;  4OIO F;  1S7O A;  2E7W A;  1JHH A;  2H6C A;  5ED4 A;  2HOE A;  4AVP A;  2ZBK A;  2LKP A;  4Q5S F;  5LGN A;  4L9N A;  2BE5 F;  2NNY A;  1R36 A;  1TQM A;  2E7X A;  3I64 A;  5AIP A;  1KQ0 A;  2FML A;  3BOQ A;  4IF4 A;  4U0W A;  2K02 A;  4LK1 F;  5DD4 A;  3IL2 A;  2VOD A;  3FX3 A;  2QBY A;  4M73 A;  2NNN A;  2XAG A;  2VBX A;  1FBU A;  3NRV A;  3RIR A;  3FHZ A;  2ZKZ A;  4B8X A;  4PGH A;  3D0S A;  4HF1 A;  2XAJ A;  5E18 F;  3LAP A;  1XDU A;  2GQQ A;  5HVQ C;  4AIJ A;  1H9T A;  1CGP A;  1FSH A;  2FBK A;  1SD7 A;  2YX4 A;  4HX4 A;  3T5X A;  2RGV A;  5FGM A;  4ESF A;  4HLX A;  3QP5 A;  1YW8 A;  1J7K A;  2OAZ A;  1DPU A;  3JTG A;  2NAZ A;  1XD7 A;  5L3E A;  1K78 B;  2KIF A;  2FMY A;  3IHU A;  4HX8 A;  1F5T A;  5L3C A;  2A07 F;  5K5R A;  1LQ1 A;  1FYK A;  1F1Z A;  5IT3 A;  4ZZL A;  1ZGA A;  1O3R A;  2FOK A;  1O3T A;  3QP6 A;  1UCR A;  2F5D A;  2DBB A;  3MZH A;  4XBF A;  3DPT A;  3TKY A;  1SMT A;  4M74 A;  1RUO A;  4CXF A;  2P4W A;  1NHA A;  2FA5 A;  3ECO A;  1RI7 A;  1FZP B;  2OQR A;  4OIP F;  3BY6 A;  3FF5 A;  1FC3 A;  4GGG A;  5CVU A;  1G3S A;  1IN5 A;  3P7N A;  1MDM B;  2FNA A;  1RUN A;  2OD5 A;  2H94 A;  3O2P E;  2KJC A;  1XSV A;  2TDX A;  4JK1 X;  4M6Y A;  2YR2 A;  1G3Y A;  4PZJ A;  2D1V A;  2VT2 A;  2V1X A;  4WWC A;  4XRF A;  4CZZ A;  2OBP A;  4MQ9 F;  4RGR A;  2L02 A;  5D5W B;  1IXR C;  2A61 A;  3IKV A;  4JBA A;  2H6B A;  5LRR A;  4BH9 A;  1YG2 A;  2GA1 A;  4RB2 C;  4ASN A;  1D3Y A;  1EH6 A;  3GFL A;  2QVO A;  1V4R A;  2ZME A;  2ESH A;  4G9Y A;  3RJP A;  2DU9 A;  2FRH A;  2Y75 A;  3T0Y A;  3VB2 A;  3HOT A;  1ULY A;  4HYE A;  2GWR A;  4EV0 A;  3WTT C;  3C18 A;  5DCM B;  3C1D A;  1XGM A;  3TO6 A;  2W57 A;  2XGX A;  4I98 B;  3VOD A;  4OIN F;  3GFI A;  2QEN A;  4I0A A;  4U0V A;  1A04 A;  2W85 A;  3E97 A;  3W6J B;  3I53 A;  4EM1 A;  5DD8 A;  1K79 A;  2VOP A;  3DXJ F;  1W4M A;  2EA4 A;  2Z33 A;  4G7Z F;  2ZNZ A;  3RI4 A;  1I1S A;  4IPA A;  5BPI A;  4FX0 A;  5DV5 A;  3EQL F;  1OMI A;  2RV8 A;  4LGW A;  3M7G A;  4R1H A;  4K2E A;  5E1Z B;  3P9I A;  2QBY B;  2VN2 A;  3L9F A;  4PCQ A;  3GZ6 A;  2M1B A;  3BRO A;  3G73 A;  1K6O A;  2HQN A;  1XCB A;  1I27 A;  1BJA A;  4BXU A;  2RQP A;  3HRT A;  3SQN A;  1QGP A;  3QU6 A;  3FMQ A;  5J8F A;  5HLH A;  2STT A;  2Z3Y A;  3LA3 A;  3I58 A;  2Q0O A;  1SD5 A;  3DP7 A;  2FF4 A;  2MH2 A;  1TLH B;  2G9W A;  2EK5 A;  3CUQ C;  2GAU A;  3ABU A;  3IRQ A;  5FFZ A;  1XSD A;  1YO5 C;  2IA0 A;  3HTS B;  4ZYE A;  3ZMT A;  5FLX K;  4LG0 A;  4EM2 A;  2A68 F;  1HKT A;  2UXN A;  2FBI A;  1O3S A;  2WC2 A;  5D5X B;  1B59 A;  3WTV C;  3BJO A;  1FYM A;  2X4H A;  5D4R A;  1J2X A;  1R5H A;  3L2C A;  3F8M A;  5E17 F;  1H9G A;  2F2E A;  1IF1 A;  2DPU A;  2EV5 A;  1ON2 A;  4LJZ F;  3T8R A;  4L9V A;  4ZZD A;  3KZY A;  3M1E A;  1Q1H A;  2Q8K A;  1U6G A;  2P8T A;  2GXB A;  2HR3 A;  5D4S A;  1ZYR F;  1IXC A;  2C6Y A;  3V7C A;  5A2Q K;  1J0R A;  1B4A A;  4L0Z B;  2WV0 A;  2ZME B;  5K5O A;  3KLN A;  3MEX A;  2K4J A;  4S04 A;  5JI6 A;  5H6Q A;  1YLF A;  3WTS C;  3N97 A;  4Y13 A;  4ESJ A;  4U7B A;  3GEZ A;  4QLC U;  5D5U B;  1Z6T A;  1TW3 A;  3TDU C;  5LGT A;  1CF7 A;  3I4P A;  1F9N A;  1BN5 A;  2DQL A;  4G6Q A;  2G7U A;  1R1U A;  2DW4 A;  1Y0U A;  4RAY A;  2WTE A;  2RKH A;  2BV6 A;  4KDP A;  1LEA A;  3ZMZ A;  4BQA A;  1R22 A;  2CO5 A;  3ROU A;  4MGR A;  4Y17 A;  2D2W A;  2XKO A;  4UHT A;  5IT9 K;  2ZO4 A;  3GFM A;  4CHU A;  1MJ9 A;  1S8N A;  2EJR A;  3E6B A;  3WGI A;  3GFJ A;  1FT9 A;  4I7H A;  3ZMD A;  3KLO A;  1AOY A;  1OYI A;  4HLY A;  2K7L A;  3VOE A;  1UST A;  1QZZ A;  2A69 F;  2QWW A;  1P6R A;  1EH8 A;  3HIF A;  4OU0 A;  4KYW A;  1WI9 A;  3F6O A;  5CJ9 A;  3RKW A;  5DDG A;  1O7F A;  1PP7 U;  3BP8 A;  1LNW A;  3EYY A;  4ZH4 F;  4WXC A;  4KNY A;  3C3W A;  4WXH A;  2GA2 A;  3CO6 C;  3E5Q A;  2XUB A;  2HKX A;  5CYV A;  1SFX A;  1KU3 A;  1HSJ A;  2PG4 A;  3K9T A;  4MQV A;  4EJW A;  1HW2 A;  4JQF A;  1EV7 A;  2DO7 A;  4KIC A;  4HV5 A;  5TRD A;  1J5Y A;  1ZRC A;  1AWC A;  4G6D A;  4RGX A;  1WQ2 A;  1L0O C;  2E1N A;  1PUE E;  4MHG A;  4LG0 B;  1SMY F;  4YFN F;  3HRM A;  1GVJ A;  2K4B A;  4HOB A;  3K1P A;  1B9N A;  3M8F A;  1ONV A;  2DT5 A;  3ZMS A;  2HYF A;  3J80 Z;  4MTD A;  3FZV A;  1U2W A;  2FQ3 A;  2VE8 A;  3ULQ B;  2L3D A;  5FLX Z;  3CDH A;  1G3T A;  5HDK A;  3Q5F A;  4LLG F;  5BMZ A;  4MNU A;  4RGS A;  1S6L A;  5H20 A;  3HRS A;  5LEJ A;  3U1D A;  5JFR A;  4M9Z A;  3CJN A;  4B09 A;  3V8K A;  2FEZ A;  1UHM A;  1U78 A;  2J5O A;  2VXZ A;  3BJ6 A;  3PFI A;  1W7P A;  5LHH A;  4EM0 B;  3QU3 A;  5HLI A;  2IRF G;  2QM3 A;  4EQQ A;  2P7C B;  2CSO A;  1J75 A;  2GIV A;  2ETH A;  5ICF A;  4MEX F;  1D5V A;  3CO7 C;  4IRG A;  2CW0 F;  2YU3 A;  3HRU A;  1KQ9 A;  1QZY A;  2ISZ A;  1EH7 A;  2F5E A;  4I0B A;  1E17 A;  2PJP A;  1FPQ A;  1FY7 A;  1CF7 B;  3WU0 A;  1BOA A;  3KP5 A;  1YW7 A;  1OKR A;  2NRA C;  5D6E A;  1QBJ A;  3JTH A;  4XSZ F;  1R1T A;  2NS0 A;  4ZYH A;  5E8I A;  2FXA A;  2HS5 A;  2F5F A;  3FMR A;  3I0T A;  2EB7 A;  2VON A;  2HEO A;  3J7A O;  2PBI A;  3F22 A;  2XRO A;  2R7D A;  5ICC A;  1T39 A;  2XKP A;  4PDK A;  2P6S A;  2VE9 A;  2JPC A;  3QAH A;  2PLY A;  2M8E A;  5DCF A;  5ICG A;  4DQ2 A;  1FBS A;  5IT9 Z;  3D5L A;  2J5P A;  2P5V A;  2IA2 A;  4GXO A;  1FX7 A;  3RDI A;  1X3U A;  3F23 A;  2QQ9 A;  4RB0 A;  2LDU A;  1XGS A;  4WX9 A;  2JPB A;  2QUF A;  4U0Y A;  2OA4 A;  1KQ8 A;  1P92 A;  1USS A;  1IW7 F;  4GCV A;  4UUV A;  4PGG A;  4L9T A;  3V4G A;  3GYH X;  4OMY A;  3K2Z A;  2MBF A;  4LFU A;  3GUD A;  3REO A;  5J8C A;  1P4X A;  4S05 A;  4Z2Y A;  3F8F A;  1BI3 A;  1MD0 A;  6PAX A;  3F6V A;  2RVC A;  4CGZ A;  1QPM A;  3ML6 A;  1R5G A;  3ECH A;  1MJA A;  4HW0 A;  2OU2 A;  1R7J A;  2Q2E A;  1MGT A;  2JSC A;  2DTR A;  4M72 A;  1FSE A;  4IHS A;  4OOI A;  3G3Z A;  4XLN F;  1IRF A;  1ZN2 A;  4RAZ A;  1T2K A;  2KRF A;  3LWF A;  2EFP A;  3HSR A;  3MWM A;  2VBZ A;  2KJB A;  5LHI A;  3L00 A;  2L4A A;  2LF8 A;  1KA8 A;  2QZ8 A;  2MLG A;  4XLP F;  4L5I A;  5D8L B;  2G7H A;  3KP2 A;  2O8X A;  2AXL A;  3K1N A;  2V1D A;  1JE8 A;  4HF2 A;  2GZW A;  3R6S A;  1W7P B;  3BZ6 A;  4EJU A;  3K69 A;  1QNT A;  3FWE A;  5J6X A;  1ZRE A;  2VBW A;  4O3M A;  3L7W A;  4ETS A;  2XAQ A;  3U9G A;  1DPR A;  3MAJ A;  5HOO A;  2ISY A;  1IUY A;  1R58 A;  3ZN0 A;  2FBH A;  1G3W A;  1UB9 A;  3QPH A;  1F4K A;  2HDC A;  1RIO H;  5LLQ A;  1REP C;  3ZMV A;  3K1M A;  3GZ5 A;  3BWG A;  2ZNY A;  1TTY A;  3ELK A;  4G8X A;  1SD4 A;  3J81 K;  4AD9 A;  4P5O A;  2UWM A;  3QPT A;  3KEQ A;  1YQA A;  1LDD A;  3E3V A;  1TNS A;  5L3F A;  5D5V B;  3LST A;  1YS6 A;  1JHF A;  4UVA A;  1XN7 A;  3RPU A;  4HDV A;  1BM9 A;  2UXX A;  1JXS A;  3BPX A;  2HFH A;  1PDN C;  5K5Q A;  4BHB A;  1T98 A;  1U5T A;  3LA2 A;  4ZYD A;  2K86 A;  4LK0 F;  1RZ4 A;  3SZP A;  1IAW A;  3PQJ A;  3R61 A;  2O61 A;  3E5U A;  3DEU A;  5H6R A;  2RC4 A;  4A6E A;  1YTY A;  1ZLK A;  2DAO A;  3JW4 A;  5ICE A;  1G4D A;  3DF8 A;  4FT8 A;  5BOX A;  1RNL A;  4WF2 A;  5JR3 A;  2MH9 A;  2P6T A;  2E1C A;  4XSX F;  3QOP A;  3IC7 A;  1YYV A;  3LFK A;  4HQE A;  2M45 A;  5CVR A;  1HQC A;  3KP3 A;  4MTE A;  1Z7U A;  4IXA A;  5F64 A;  3JAM K;  2BBY A;  3TGN A;  3M8E A;  1LDJ A;  3ZN1 A;  1JGS A;  2STW A;  3C7J A;  2XVC A;  3EDP A;  2A6H F;  4F7Z A;  3SFZ A;  1V3F A;  1BC8 C;  4GO1 A;  1LDK B;  4LB5 A;  3IWF A;  1BBY A;  3DV8 A;  2P7V B;  3EET A;  5HS7 A;  1O3Q A;  4IHT A;  5EEH A;  5ILS A;  1S29 A;  4AIK A;  2H27 A;  5JHU A;  4HV6 A;  3F3X A;  2JRT A;  3KP7 A;  1R23 A;  4G7H F;  2VBY A;  4HAM A;  3LQR A;  1U8R A;  4Y15 A;  2O6G E;  1B6A A;  1QQI A;  2JT1 A;  4LB6 B;  4LMY A;  4R79 A;  2COM A;  3DFG A;  4IRI A;  2R7F A;  4UV9 A;  3IKT A;  3O6B B;  4R8H A;  3EUH A;  3ZMU A;  4EGZ A;  1S7A A;  1FNN A;  4RGU A;  4NQW A;  1O7L A;  1Z91 A;  3WGG A;  1T6S A;  1YFH A;  1DUX C;  1ZGJ A;  2PEX A;  5DUK A;  4HZF A;  2BYV E;  5JVT A;  4ENJ A;  1MKM A;  2EFO A;  1HBX G;  1IZ1 A;  3WTU C;  2ZCW A;  3MFK A;  4P55 A;  3BPV A;  1IXS B;  3COA C;  3NQO A;  2EV6 A;  2OQG A;  2F5C A;  3WE3 A;  2XHK A;  2K27 A;  4D0P A;  3HUG A;  2HTS A;  4G94 A;  5L3G A;  2M30 A;  4FX4 A;  5LRS A;  1BC7 C;  2WWY A;  5CVI A;  4Q4Z F;  4RB3 C;  3KP6 A;  5LEK A;  2FE3 A;  2EFW A;  1WKM A;  3E6D A;  4I01 A;  5KK1 A;  3WTX C;  1UFM A;  3GXO A;  4WK8 F;  3GW2 A;  4AIH A;  2ELH A;  3H92 A;  1QO0 D;  1IN6 A;  2DQR A;  4UVB A;  4KN7 X;  3RYP A;  4KN4 X;  3N4M A;  3QRF F;  3WOD F;  4YFX F;  2EA2 A;  3KEO A;  3J81 Z;  4A5N A;  2AS5 F;  1L3L A;  1SAX A;  2V1U A;  4IVN A;  1SFE A;  4M6X A;  3P9C A;  5LHG A;  3T1B A;  2A5Y B;  2YSR A;  5FO5 A;  1OR7 A;  1KYW A;  4O6J A;  3RTR A;  2IPQ X;  4A2U A; 
#chains in the Genus database with same CATH topology
 3R0A A;  4QSH A;  3CCS I;  3H3U A;  2NS7 A;  5FKK A;  4E7S A;  1FWZ A;  2KKO A;  3VSL A;  3FHN A;  1XCV A;  3K4N A;  2M0M A;  3TO9 A;  2PMH A;  2LRD A;  3BJA A;  2X0L A;  2Z5U A;  2G0E A;  4CIC A;  2R0Q C;  3OYA A;  2YU9 J;  3WHB A;  3HOZ J;  4C3H J;  2HYG D;  4IJA A;  2R7T A;  2NXN B;  1FBQ A;  4E7H A;  5HDN A;  3QOE A;  4UXN A;  5FD5 A;  4PJL A;  3AFH A;  1TQP A;  4RM3 A;  3LSH A;  4Q47 A;  3HSE A;  2PJR B;  2BVM A;  3DTE A;  3L09 A;  1KGS A;  3WTY C;  3KP4 A;  2Z16 A;  1KU2 A;  5FKO A;  3LSK A;  2HPM A;  1WH7 A;  2IP2 A;  4XON A;  1WGX A;  1IRG A;  1Z3Y A;  2VJJ A;  2XAH A;  1BI0 A;  3K4M A;  1A35 A;  4BQN A;  2F5V A;  3K4L A;  5E3L A;  4KMF A;  3M3Y J;  4Y4R A;  3I54 A;  1H89 C;  4XRS G;  2ZXW H;  2RAE A;  2JZY A;  1BR4 A;  4U87 A;  4YG2 F;  1ZG1 A;  2M87 A;  3TW7 A;  1VQK I;  1ODD A;  1FLI A;  3BTC A;  3RCO A;  2M4G A;  1ITY A;  2A3S A;  3H0G J;  1YHQ I;  4E7J A;  2GLO A;  3OL3 A;  2D45 A;  2DFI A;  3CCL I;  4BHP A;  2CG4 A;  1VTN C;  2XGE A;  4ZYA A;  3Q9V A;  3MQ0 A;  3BDD A;  2HXO A;  3WG9 A;  2IA1 A;  4BYY A;  4U88 A;  1I50 J;  1D8K A;  1YW9 A;  2NOG A;  2LSO A;  1BIA A;  1KU9 A;  4RDU A;  2VOO A;  3RKX A;  5A2Q Z;  3JRB A;  1G6N A;  4LOC A;  1WWX A;  3BR5 A;  5E1X A;  2R3S A;  1P2F A;  3IAM 2;  5D6F A;  3I3L A;  2DT6 A;  5F1R A;  1YI2 I;  1UG2 A;  3HYI A;  2LK2 A;  3GO5 A;  5CQG A;  4XQF A;  5IOZ A;  2VUM J;  2DXI A;  4KIF A;  1EA3 A;  3S1Q J;  3TO7 A;  3K7A J;  4YFK F;  5E79 C;  1IRX A;  3RYR A;  4CSW A;  4NQW B;  2CV0 A;  4PUS A;  2PX9 A;  2IS6 A;  3HGY A;  3PFY A;  1FP2 A;  2VKD A;  1W0T A;  3LQQ A;  3GX4 X;  2BHZ A;  3W3C A;  1KYZ A;  2KIM A;  2CQK A;  4AYB A;  3G4S I;  4FAS D;  3W6V A;  3VYT B;  4BGD A;  1ZG3 A;  2MC3 A;  2V9P A;  4ZDL A;  2ICW G;  1FOX A;  2DLL A;  2LY2 A;  4EJV A;  2MLK A;  4N9I A;  4WXD A;  1ZKG A;  4B48 A;  3H9Q A;  3ZR8 X;  4ENK A;  2L01 A;  4FIS A;  3G1O A;  1LVA A;  1KZH A;  2O3F A;  4B43 A;  2IEK A;  1SAN A;  4RA2 A;  3B02 A;  5CQE A;  4HF0 A;  2RRE A;  1T33 A;  3HTU A;  5EYR A;  1Y1W J;  3A2K A;  1GLN A;  1R49 A;  1QVT A;  3CDI A;  2O03 A;  2O0Y A;  4LIU A;  3MKZ A;  4KJZ A;  5D8K B;  3DTK A;  3LNQ A;  2MW8 A;  2O8K A;  1YX3 A;  3HUG B;  1T38 A;  2L9N A;  4I6Z A;  2HXI A;  3LA7 A;  1YX5 A;  5J40 A;  4A0Y A;  2ZXJ A;  5DM6 F;  1OCT C;  4BXF A;  2HGC A;  2LR8 A;  2DPD A;  4AWX B;  4CCJ A;  3VYS B;  4GYG A;  2Y9Z A;  1UJ8 A;  1AA7 A;  3AL0 C;  3GVA A;  1HOM A;  3V8L A;  2CQN A;  2IVM A;  1JI8 A;  4RS8 A;  3JSO A;  2W24 A;  3W6K B;  1ERD A;  1HW1 A;  2XV4 S;  3MKY B;  2JA5 J;  3RKQ A;  3GWZ A;  4KA4 A;  3QYB A;  1GV5 A;  2LKS A;  1YRN A;  3PJR A;  1IRZ A;  1MZB A;  3QQA A;  4P96 A;  1H0M A;  3B6C A;  4M3E A;  4XIC A;  1N75 A;  4BE2 A;  2OCE A;  1Y56 A;  1W5S A;  1EF4 A;  1XDS A;  2XAS A;  3DBH B;  3H5N A;  2RQQ A;  2KFD A;  2PMZ A;  1Z6R A;  4L0Y B;  4O5V A;  3I59 A;  4UNO A;  1SC7 A;  5CVV A;  1VQ7 I;  3CC4 I;  1E0E A;  1S3J A;  1B1B A;  2HDW A;  2HOS A;  3K4J A;  2Y48 A;  2V26 A;  2EFN A;  3IH2 A;  2VB6 A;  2V9V A;  3Q3S A;  3GF2 A;  4OMZ A;  3SZT A;  1LEB A;  1GHC A;  2OV7 A;  2V6C A;  2BOL A;  3WU1 B;  2LH9 A;  4P9U A;  2XDV A;  4QTR A;  3TQN A;  1TW2 A;  1LB2 A;  1HDP A;  2IXS A;  2Q1Z B;  2DK8 A;  3E6C C;  2L54 A;  3R4K A;  3V42 A;  4E70 A;  5EG0 B;  2HZT A;  2HTJ A;  2VI6 A;  3CUO A;  2Y0M A;  3DLA A;  2V79 A;  3DEW A;  2VC1 A;  2JTV A;  4CYD A;  2B0L A;  2K9S A;  4MEY F;  1HW5 A;  3QYE A;  4KIG A;  5L3B A;  2EV0 A;  3DQV C;  2ACJ A;  4LIV A;  1AU7 A;  5KVR A;  4E7Z A;  3HM5 A;  1HXD A;  1IN4 A;  2ZJ2 A;  3M8J A;  1W0U A;  3QYF A;  2Y30 A;  4E6K G;  4WCG A;  4XRM A;  1W7P D;  4P9F A;  2JA8 J;  5HLT A;  3DCF A;  3BQY A;  4II2 A;  1BI2 A;  1FP1 D;  3CCE I;  4HDU A;  2W25 A;  3CMM A;  1YIO A;  3H3Z A;  4DNC A;  3PSI A;  4A12 A;  3U2R A;  1NG7 A;  2LRE A;  2VT3 A;  4QPO A;  4CO8 A;  3L2U A;  4ZTJ A;  3WE2 A;  2ZC2 A;  1SD6 A;  1MJB A;  4KIB A;  1HST A;  2XRN A;  4XLA A;  2P5L C;  2PMU A;  2MD5 A;  3F8N A;  3LSJ A;  4DYC A;  1LKX A;  4KT5 C;  2E36 A;  2QSG X;  2IS2 A;  3CTA A;  5HS9 A;  2M7A A;  4JYK A;  3JR9 A;  3L2R A;  4A93 J;  3NEU A;  4PSW A;  1AKH A;  5CLS A;  1JGG A;  3AAF A;  3PIO F;  2QA4 I;  4A3J J;  3JRG A;  5DYM A;  4ON0 A;  2QF7 A;  3LFU A;  1SFU A;  2FU4 A;  4IQJ A;  3LAJ A;  5M5X J;  3HSF A;  3E1S A;  3FIW A;  3IUO A;  2E34 A;  2V9K A;  2MD0 A;  2X1D A;  1YIJ I;  4M9S A;  1TNT A;  2HKO A;  3ERE D;  5FKL A;  2D1H A;  3DKW A;  3ABM H;  5HLG A;  2X1C A;  3HOS A;  4CCO A;  2O7O A;  1MNE A;  1OCC H;  3DKX A;  1HKS A;  1BW6 A;  2VIX A;  3P9K A;  1TQI A;  4A3M J;  3SYT A;  3T8T A;  1H88 C;  5IPA A;  3KEY A;  2JSP A;  3MZY A;  3P5J A;  1SVO A;  2V7F A;  3CUQ A;  1TZL A;  3O3K A;  4EVI A;  1I3Q J;  2W4S A;  3F8B A;  3PNT A;  4DZJ A;  3TOA A;  3VPR A;  3H9G A;  3S8P A;  3QPS A;  3HEF A;  3L2W A;  1NK3 P;  1MW7 A;  2W84 A;  2CQX A;  3FM3 A;  2ECB A;  3HOY J;  3HG9 A;  1ZAR A;  5EEG A;  1Z05 A;  3C2H A;  1Y1V J;  1MBJ A;  2JMW A;  5BS6 A;  2UV1 A;  1DU0 A;  4C3I J;  2QQA A;  1XB4 A;  2DOF A;  3IRR A;  4A6D A;  2V6E A;  1X1A A;  1X1P A;  2MG4 A;  5EEA A;  4OIQ F;  4QIW N;  5BQT A;  2VXD A;  3TP0 A;  4N9H A;  3JSP A;  1PP8 F;  3FXU A;  2DOD A;  3NWT A;  1ETQ A;  1OJL A;  3DPL C;  4F55 A;  2KMU A;  4BHC A;  4M3D A;  2QQB A;  3RKY A;  4C2M J;  3GBG A;  3TDZ C;  2DA2 A;  2Y31 A;  2EFQ A;  3TP3 A;  5IP7 J;  1W5T A;  3ABT A;  2X9D A;  4RB1 A;  5TJJ A;  4A0Z A;  1ZG5 A;  2WAQ N;  2B9S A;  2NVU B;  4NHJ A;  2DFE A;  2XB0 X;  1XPX A;  1GUU A;  1R00 A;  2K3F A;  4PFP A;  3KET A;  3F8C A;  2P5K A;  4L18 B;  2EIN H;  2DCE A;  3OIQ A;  3VEP A;  2Z9O A;  4EJT A;  1G2H A;  1RPW A;  2X51 A;  5FKN A;  3H1C A;  2W7N A;  2KIU A;  2K9M A;  2FNP A;  5HDG A;  3OMY A;  3J80 K;  4HA8 A;  1VI0 A;  3E5X A;  1XSX A;  3W2W A;  1VQ6 I;  5FD6 A;  1WJC A;  1K7A A;  1J9I A;  3SHF A;  1U5T C;  3WGH A;  3ZXS A;  1ZRD A;  3OOP A;  5J1U A;  1YS7 A;  3ZQL A;  1GXP A;  3IWZ A;  1LFB A;  3R60 A;  5B66 C;  2HQR A;  4KMU X;  1ZAO A;  3CCY A;  5GTI C;  4NB5 A;  5CVJ A;  4PJM A;  5LBQ A;  1P4W A;  2EIK H;  3BT9 A;  3A0B C;  2KIS A;  4JP0 A;  1STZ A;  2VJ4 A;  4M9X A;  4Q48 A;  1P4A A;  2VAS A;  2LNB A;  1OCR H;  3K0L A;  2VQC A;  3I59 B;  4EJO A;  2E1O A;  2Y0S N;  4HQM A;  2EIL H;  2QEX I;  2M5W A;  3HGG A;  4XOT A;  1Z1D A;  5LGU A;  1X4O A;  1WJB A;  3B73 A;  5ERI A;  1R71 A;  2NVX J;  3LSI A;  4A0X A;  1Z9C A;  4I02 A;  3A1Y A;  1O57 A;  2PI0 A;  3EYI A;  5J47 A;  3KCC A;  1OYY A;  3MCZ A;  4A3L J;  3PQK A;  3PUB A;  1ZRF A;  3V7R A;  2CWE A;  4BU2 A;  3OIO A;  4UV8 A;  1HC8 A;  2IJL A;  1HKQ A;  2BHY A;  3V7S A;  3BLY A;  3CP2 A;  4XN3 A;  2XIG A;  3F72 A;  4N0B A;  2LD5 A;  3ZP5 A;  1IO2 A;  4IHX A;  3KFW X;  2WAQ A;  4ENM A;  1UHW A;  5ILU A;  4BAY A;  3ASN H;  4LLN A;  2ADU A;  1MMD A;  4XL9 A;  2VC0 A;  3GTL J;  2M9H A;  4EGY A;  4CDG A;  4YIF A;  4GYI A;  1XMA A;  2EZK A;  4A3I J;  1ENH A;  2MGQ A;  2X48 A;  3BR0 A;  2K9N A;  2A6E F;  2BEO A;  3G1M A;  3OWT A;  1WSU A;  2ECC A;  4I09 A;  3V8J A;  1LJ9 A;  1MBH A;  1XGN A;  3KZZ A;  2RN7 A;  4XR6 A;  3CLO A;  4OIR F;  3OV8 A;  4HBL A;  2H8R A;  3FMS A;  4XKV A;  1AKH B;  3FK6 A;  4AM3 A;  3I71 A;  4ESB A;  1E2X A;  4BE0 A;  3E7L A;  1ZLJ A;  4XKW A;  4LD5 A;  1FOK A;  1X2N A;  2CYY A;  2HVR A;  4L9J A;  4HX7 A;  1GXQ A;  3QWL A;  5IYC J;  2XGD A;  3H5R A;  5FFX A;  3IP4 B;  4Y3O A;  2UZK A;  1XMK A;  4U7D A;  4RAG A;  2EIM H;  4DYQ A;  1RKW A;  5FB2 A;  3CME I;  2R92 J;  1B9M A;  1I6X A;  3EUH C;  3EUA A;  3Q0U A;  4XKC A;  1BIB A;  1Y6I A;  1MIJ A;  5F27 A;  1K78 A;  3Q9S A;  1T0F A;  3FXQ A;  3GME A;  4BNC A;  4TV7 A;  5K7H A;  5DUI A;  1U3E M;  1DP7 P;  3HHG A;  2X1E A;  3Q0W A;  2DTZ A;  1BI1 A;  2ZXI A;  4IRH A;  3RSN A;  5E8G A;  1Y8Q B;  1MBK A;  2K40 A;  3RPU D;  3MMY B;  5DEQ A;  1ZH5 A;  2NYX A;  3BG7 A;  3CJR B;  1O4X A;  1OCP A;  3G1L A;  4BEH A;  1IN7 A;  4DOZ A;  1XG1 A;  3BTL A;  2PQ8 A;  1FJL A;  3F21 A;  2QGU A;  3CUQ B;  2DI3 A;  2YX7 A;  3R0J A;  4ZDP A;  2DK5 A;  3FXM A;  1OIS A;  3ZQ7 A;  4ZYG A;  1OYW A;  3FM5 A;  2GXG A;  2HQA A;  3BR3 A;  3CQZ J;  1WFX A;  2PN6 A;  2XAF A;  4BS9 A;  4BE1 A;  2R7W A;  2FSW A;  3ISP A;  3ASO H;  1J59 A;  1XGO A;  2RNJ A;  5B1A H;  5K1Y A;  4F52 A;  3OYJ A;  2JN6 A;  1D8J A;  2DJI A;  2IT0 A;  3DPU A;  5CKT A;  1U0J A;  3S2W A;  3EUK L;  5E3O A;  2RDP A;  3FXR A;  1V5E A;  1MDM A;  1ON1 A;  3S1M J;  1I39 A;  4YII A;  2IW5 A;  2Z99 A;  2DDB A;  2JUC A;  4A5M A;  1JKO C;  2ESN A;  4IQ4 A;  2EWN A;  5AIQ A;  3CCQ I;  1U5T B;  5EZH A;  1R1V A;  5AON A;  1WRJ A;  2GM4 A;  2TCT A;  1W5C C;  2OZ6 A;  5E1W A;  3HZJ A;  5ILV A;  1ZR4 A;  1YJW I;  2DA4 A;  4G7O F;  2K9L A;  1IC8 A;  3E6M A;  3DWL E;  2A6T A;  3WTZ A;  1VQ9 I;  4IHY A;  2O5R A;  1FYL A;  4F93 B;  5F6F A;  3OYE A;  2L4M A;  4BDZ A;  1U9N A;  5IP6 A;  3FKI J;  3JRH A;  1IUF A;  1RR8 C;  4BY1 J;  2VJ5 A;  2LLK A;  2WAF A;  2BY1 A;  3S93 A;  2M3A A;  3K2A A;  5E20 A;  1APL C;  3H3V K;  2MA3 A;  2CGP A;  2CFX A;  3J7A Y;  2ZSH B;  3VFZ A;  3O8H A;  2LF7 A;  2OZU A;  3ZPL A;  4A3C J;  3A0H C;  1DDN A;  2R4G A;  4I2O A;  2M2E A;  5GAE J;  2QSF X;  3SXY A;  4AYB N;  3KE2 A;  1PUF B;  4BUP A;  1MMS A;  4UUS A;  4FHT A;  3FIS A;  4ENN A;  5FLV A;  5JVG F;  2VQH A;  2LBF A;  2H09 A;  5HS8 A;  1ZHF A;  2LY9 A;  5L3D A;  2LG4 A;  1WJD A;  3RPQ A;  1I5Z A;  5DCM A;  1OPC A;  2QLZ A;  5M5W J;  4M71 A;  3I5U A;  3H35 A;  3M9A A;  3TOB A;  1D0Y A;  1I1G A;  3WHC A;  3HC7 A;  2ZFW A;  4LLL A;  2DMQ A;  2YPR A;  3HHH A;  4FE7 A;  1OR7 C;  3JAM Z;  4EMS A;  5F08 A;  4H0E A;  1IN8 A;  2VPL A;  2HWV A;  5F0F A;  4UVC A;  3GTG J;  2BGC A;  4HSR A;  3WTW C;  4KUM A;  3CJT B;  1KU7 A;  1TBX A;  3FK7 A;  1U8B A;  3BZC A;  5K7F A;  2QYO A;  4BKX A;  2PFB A;  5BPD A;  4L5J A;  4KFC A;  4QWQ A;  3GLX A;  1C0W A;  4OIO F;  1S7O A;  2E7W A;  1JHH A;  2H6C A;  5ED4 A;  2HOE A;  4AVP A;  4NC8 A;  2ZBK A;  1ETK A;  2LKP A;  2XPU A;  4B47 A;  1X4P A;  4Q5S F;  5LGN A;  2E71 A;  2H1L A;  2BE5 F;  4L9N A;  3VYR B;  2NNY A;  3I9V 2;  2E35 A;  1R36 A;  4GRI A;  5IY5 H;  1TQM A;  2E7X A;  3I64 A;  4C2T A;  3ERM A;  1KQ0 A;  2IGK A;  5AIP A;  5BNG A;  4Y7N J;  2R5Y A;  4PJJ A;  1YJ9 I;  1EJ9 A;  2FML A;  3PNY A;  4H4K C;  1FIP A;  3UNG C;  3A01 A;  3BOQ A;  3PO3 J;  2V1N A;  4IF4 A;  4XM3 A;  4U0W A;  2K02 A;  2XF6 A;  4YEJ A;  4LK1 F;  4DGW B;  2ZB9 A;  3OL4 A;  5DD4 A;  2PMZ N;  3IL2 A;  2VOD A;  3FX3 A;  2QBY A;  3HPG A;  4M73 A;  2NNN A;  2LC2 A;  3PIP F;  2XAG A;  2VBX A;  1FBU A;  1BL0 A;  4XRS A;  2KRC A;  3NRV A;  3RIR A;  4BDY A;  3FHZ A;  5F0C A;  2ZKZ A;  4B8X A;  1ZEL A;  5JLX A;  1JJ8 C;  4PGH A;  3D0S A;  4HF1 A;  2XAJ A;  3GTM J;  5E18 F;  3LAP A;  2WV1 A;  1XDU A;  1QHG A;  3K4K A;  2GQQ A;  5HVQ C;  4AIJ A;  1H9T A;  1T56 A;  1CGP A;  2OPT A;  2DOE A;  4IHW A;  1FSH A;  2FBK A;  1X3Z B;  1SD7 A;  1RES A;  2YX4 A;  4HX4 A;  2XC7 A;  1QVU A;  3ZQC A;  3T5X A;  2RGV A;  1JKR C;  2HDD A;  4PSX A;  5FGM A;  1VQN I;  4ESF A;  4I99 C;  2IBD A;  1E3P A;  1M1E B;  2L0K A;  4HLX A;  3QP5 A;  4BXX J;  1I3A A;  4MIM A;  3U1K A;  1YW8 A;  5H2F C;  1J7K A;  1K6Y A;  4D5C A;  2OAZ A;  1DPU A;  3NAU A;  2UUZ A;  4XLE A;  3JTG A;  2NAZ A;  5J1Y A;  3S15 J;  4A69 C;  2VQL A;  4HST A;  1XD7 A;  3LSG A;  4CCL A;  5L3E A;  5DM7 F;  1K78 B;  2KIF A;  3LSM A;  1WPK A;  2FMY A;  1ETY A;  3IHU A;  4HX8 A;  1TT0 A;  2XB5 A;  1F5T A;  2DMT A;  5L3C A;  2O9L A;  2A07 F;  1DGR M;  5F0H A;  1MND A;  5K5R A;  1LQ1 A;  1G8X A;  1FYK A;  1T95 A;  1F1Z A;  2Y69 H;  5IT3 A;  4ZZL A;  4S0H B;  4CCM A;  1DU6 A;  1WH5 A;  4C3J J;  1ZGA A;  1O3R A;  2FOK A;  1VFC A;  1O3T A;  3QP6 A;  1UCR A;  2F5D A;  4W1U A;  2DBB A;  3MZH A;  2CV2 A;  1HDD C;  2DFH A;  4XBF A;  4N4O B;  3DPT A;  2R93 J;  3TKY A;  2NOJ B;  1SMT A;  4XKB A;  4M74 A;  1RUO A;  4CXF A;  2P4W A;  1NHA A;  2FA5 A;  4IHV A;  2KL4 A;  3ECO A;  2EZI A;  1RI7 A;  1FZP B;  2OQR A;  4OIP F;  5LFA A;  4II3 A;  3BY6 A;  4G6T B;  3K70 C;  4A3B J;  3FF5 A;  1FC3 A;  3FBN B;  3VDX A;  4GGG A;  2QCO A;  5CVU A;  4B1R A;  4BJ6 C;  1G3S A;  5EDN A;  1IN5 A;  3OOU A;  3P7N A;  3CLQ A;  2FNA A;  1MDM B;  1VQP I;  2ZSI B;  1UHS A;  3BR6 A;  5B5E C;  1K4T A;  5FLM J;  5M3F J;  1OCZ H;  1RUN A;  2OD5 A;  2H94 A;  3O2P E;  2HZD A;  2KJC A;  1XSV A;  2TDX A;  4CH7 A;  4JK1 X;  4M6Y A;  2YR2 A;  1G3Y A;  2EBI A;  4PZJ A;  2D1V A;  2VT2 A;  2V1X A;  1RET A;  2NVT J;  4WWC A;  4XRF A;  3OS1 A;  4CZZ A;  1P9Q C;  2OBP A;  1LFP A;  4YRV A;  2FQ4 A;  2L7K A;  4MQ9 F;  2OC6 A;  4YEL A;  3SFI A;  4J19 A;  4RGR A;  4F91 B;  5HNF A;  2L02 A;  2W00 A;  2VPR A;  2VL8 A;  5D5W B;  1IXR C;  2A61 A;  3IKV A;  4JOM A;  4JBA A;  5FKM A;  2H6B A;  2CUE A;  5LRR A;  3CCU I;  1Z7L A;  1OQY A;  4M3B A;  4BH9 A;  3LSP A;  1R4M B;  1YG2 A;  2GA1 A;  2AQE A;  4RB2 C;  1QU3 A;  4ASN A;  1D3Y A;  1EH6 A;  3GFL A;  2JVH A;  2M0C A;  1V4R A;  2QVO A;  2ZME A;  2ESH A;  3L2V A;  4IOA F;  4YIR X;  3HB9 A;  4G9Y A;  4B4C A;  1NG6 A;  3RJP A;  2DU9 A;  2FRH A;  2Y75 A;  4RLQ A;  4UUS B;  2QSH X;  3T0Y A;  4D7M A;  3VB2 A;  1D1C A;  4V2F A;  1QRY A;  2KHM A;  5TGT A;  2DA3 A;  3OIP A;  1A6I A;  3HOT A;  2LBF B;  1ULY A;  4HYE A;  3ZCO A;  3NAR A;  4BJT A;  2GWR A;  4EV0 A;  1K83 J;  3WTT C;  3C18 A;  1HF0 A;  5DCM B;  1HA8 A;  3C1D A;  3C2B A;  3RQ4 A;  1TWC J;  1XGM A;  1F36 A;  1TWG J;  3TO6 A;  1X58 A;  2W57 A;  2MYS A;  3JRC A;  2XGX A;  4I98 B;  4X1E A;  3BCA A;  3VOD A;  4OIN F;  2M34 A;  1IGN A;  3GFI A;  2QEN A;  4I0A A;  4U0V A;  4JX5 A;  1A04 A;  1NTC A;  1T8I A;  2W85 A;  4EEF G;  3E97 A;  3W6J B;  1FMV A;  3I53 A;  3HOV J;  4EM1 A;  5DD8 A;  1K79 A;  2VOP A;  2XSD C;  3DXJ F;  5JHF A;  1W4M A;  2EA4 A;  2Z33 A;  4ABZ A;  4G7Z F;  1SVL A;  2A5W A;  2AO9 A;  2ZNZ A;  3RI4 A;  3CES A;  1I1S A;  2JA6 J;  3GTP J;  4IPA A;  1RKT A;  1TL8 A;  5BPI A;  5B1B H;  4FX0 A;  1RR7 A;  2CW7 A;  5DV5 A;  2R5Y B;  3EQL F;  2WB1 A;  1OMI A;  2L7M P;  2RV8 A;  4LGW A;  3DBR B;  5J4V A;  3A01 B;  5M5Y J;  3M7G A;  4C2U A;  1PVE A;  4R1H A;  2R7Q A;  5EJC A;  4K2E A;  2R7U A;  5E1Z B;  3P9I A;  2QBY B;  2VN2 A;  4GFB A;  2XAU A;  3L9F A;  4PCQ A;  3GZ6 A;  2M1B A;  1Z3X A;  3BRO A;  3G73 A;  1K6O A;  4HG2 A;  1DQU A;  2HQN A;  2KDO A;  3VSK A;  4V2G A;  5GPC A;  3K70 D;  3PSF A;  4CUG A;  4HNT A;  1XCB A;  1I27 A;  1BJA A;  4BXU A;  1IDY A;  2RQP A;  3HRT A;  1WZ2 A;  3SQN A;  2AHQ A;  1QGP A;  3LMM A;  4RMN A;  1UZC A;  3QU6 A;  2GIZ A;  3FMQ A;  4OAZ A;  5J8F A;  2R7O A;  2Z3Y A;  5HLH A;  2STT A;  5C4X J;  2GXA A;  3LA3 A;  3I58 A;  1NK2 P;  2Q0O A;  1SD5 A;  3DP7 A;  2F4M B;  4FTH A;  4XOP A;  2FF4 A;  4E4H A;  2OTJ I;  2MH2 A;  2IGM A;  2MAB A;  1TLH B;  2G9W A;  3S1R J;  2EK5 A;  3AG4 H;  3CUQ C;  3CZ6 A;  3SEZ A;  1BOB A;  2GAU A;  2X85 A;  4A3D J;  1WVR A;  4UB8 C;  4CZC A;  3ABU A;  3IRQ A;  3I55 I;  2E1M B;  5FFZ A;  3CCV I;  2KT0 A;  1WJF A;  2OF7 A;  3L2Q A;  1XSD A;  1YO5 C;  4BAC A;  2IA0 A;  3VWB A;  3HTS B;  2BXY A;  4C30 A;  4ZYE A;  3ZMT A;  3PM1 A;  3IH3 A;  5FLX K;  2KQR A;  1X2M A;  3ABK H;  4ZC3 A;  1ETV A;  3OY9 A;  2Z2S B;  4LG0 A;  4EM2 A;  2A68 F;  1OCO H;  1VQO I;  4G12 A;  3OS2 A;  3G2B A;  3GCM A;  1HKT A;  2UXN A;  3M4O J;  5E3M A;  2FBI A;  4P1W A;  1J09 A;  5EGO A;  2D5V A;  3FKJ A;  1YRN B;  5KAF C;  2HI3 A;  1O3S A;  5EF6 A;  2WC2 A;  5D5X B;  3S14 J;  2WY8 Q;  1SAU A;  3HOU J;  1MBF A;  1WJ5 A;  1B59 A;  3WTV C;  3BJO A;  3QPL A;  1FYM A;  2X4H A;  3B6A A;  5TIS C;  4XN0 A;  4HRI A;  3RQI A;  5D4R A;  1J2X A;  1X1C A;  2OCC H;  1R5H A;  3L2C A;  3F8M A;  5E17 F;  1H9G A;  4HPQ A;  2F2E A;  4L5E A;  3OR1 C;  1IF1 A;  2NS8 A;  2DPU A;  2EV5 A;  1ON2 A;  4LJZ F;  3T8R A;  2HVQ A;  1S7E A;  4L9V A;  3KZY A;  4ZZD A;  3M1E A;  1D1B A;  1Q1H A;  3C2G A;  2Q8K A;  1QZE A;  2JVG A;  1W36 C;  1U6G A;  4NC6 A;  3PUF A;  2P8T A;  2B63 J;  2GXB A;  2LVS A;  2HR3 A;  4MFE A;  3DTI A;  2R7V A;  3CP8 A;  1MH4 A;  5D4S A;  1VQ4 I;  1QPI A;  2HPI A;  3SDB A;  1FEX A;  1ZYR F;  2H8W A;  4DBR A;  1IXC A;  1BR1 A;  1X1D A;  2CUJ A;  2C6Y A;  4RAF A;  3GLL A;  1SFK A;  2XPW A;  2YS9 A;  3V7C A;  3TMO A;  4BBR J;  1X1B A;  5JLW A;  2EH3 A;  5A2Q K;  1J0R A;  1B4A A;  4L0Z B;  2WV0 A;  2ZME B;  5IP9 J;  3HJE A;  2Y2Z A;  5K5O A;  3KLN A;  3MEX A;  2K4J A;  2IS1 A;  5F1J A;  4X6A J;  4S04 A;  2K85 A;  2CQ7 A;  4FCY A;  3S3M A;  2W82 A;  5JI6 A;  5H6Q A;  1YLF A;  3WTS C;  3S16 J;  3N97 A;  2DA5 A;  4Y13 A;  3CJQ B;  4ESJ A;  4U7B A;  3GEZ A;  4W97 A;  4QLC U;  4NUB A;  5D5U B;  1VND A;  1Z6T A;  1TW3 A;  2M7B A;  2EQR A;  2DOA A;  3TDU C;  2KZG A;  5LGT A;  1CF7 A;  3I4P A;  3D1N I;  1F9N A;  3K6G A;  2XSJ C;  1BN5 A;  2DQL A;  4G6Q A;  3OYB A;  3GTK J;  2G7U A;  3GTJ J;  1R1U A;  2DW4 A;  1Y0U A;  3S3N A;  4RAY A;  3LSR A;  2WTE A;  2R7X A;  2L9V A;  3OYK A;  2RKH A;  2BV6 A;  2KDZ A;  4KDP A;  4D9J A;  1LEA A;  3ZMZ A;  4BQA A;  1R22 A;  5FRN A;  2CO5 A;  1VF9 A;  3ROU A;  3HBL A;  4MGR A;  1POG A;  4Y17 A;  3OYD A;  3OSG A;  4FQG A;  5K7Z A;  2D2W A;  2XKO A;  4UHT A;  4IO9 F;  5IT9 K;  3K4C A;  3OYM A;  2ZO4 A;  1X3W B;  3GFM A;  3S17 J;  4CHU A;  1MJ9 A;  1S8N A;  2EJR A;  3E6B A;  1E3O C;  2LMD A;  3WGI A;  3GFJ A;  1FT9 A;  1JKP C;  4I7H A;  3ZMD A;  4Y33 A;  3TBI A;  1WCM J;  2CW8 A;  5J3L A;  3KLO A;  1AOY A;  2CFO A;  3BTI A;  1OYI A;  2KIQ A;  4HLY A;  2BZT A;  2K7L A;  3VOE A;  1UST A;  2CMP A;  2WAD A;  1QZZ A;  2L9R A;  2A69 F;  2QWW A;  1P6R A;  3AG2 H;  3K4B A;  1EH8 A;  1P7J A;  3HIF A;  3FBI B;  4OU0 A;  1V5F A;  3KZI C;  4KYW A;  1WI9 A;  1X19 A;  3F6O A;  1TT5 B;  3UR3 C;  1T0F C;  1A31 A;  2CQQ A;  2DMU A;  5CJ9 A;  4EAT A;  3RKW A;  3G6E I;  5DDG A;  3DEE A;  1O7F A;  4A3E J;  1PP7 U;  2BY3 A;  3IH4 A;  3BP8 A;  2BVL A;  4XLH A;  3LL7 A;  3FXL A;  5IOY A;  1LNW A;  1Y0N A;  3Q0V A;  1YOV B;  3EYY A;  4ZH4 F;  1IDZ A;  3HOW J;  4WXC A;  4KNY A;  3C3W A;  1YIT I;  4WXH A;  2GA2 A;  3CO6 C;  3SDG A;  4PJN A;  1N25 A;  2P0W A;  3E5Q A;  2XUB A;  3MKW B;  2FJ1 A;  2HKX A;  5CYV A;  1SFX A;  4E7L A;  1KU3 A;  3N05 A;  2BY0 A;  1HSJ A;  2PG4 A;  3VYU B;  2EIJ H;  3K9T A;  4MQV A;  4EJW A;  3GTQ J;  1BA5 A;  1ETW A;  3I4N J;  4NDL A;  5HNH A;  1HW2 A;  3WG7 H;  3E0J B;  1XTA A;  2F4I A;  2LFB A;  4BY7 J;  4JQF A;  1EV7 A;  2DO7 A;  4KIC A;  4HV5 A;  5DTD A;  5TRD A;  1J5Y A;  2JQ7 A;  1ZRC A;  5GP9 A;  2E5N A;  3IAS 2;  1AWC A;  1A36 A;  4G6D A;  1KON A;  3MN2 A;  4RGX A;  3ZRG A;  1WQ2 A;  1L0O C;  2E1N A;  1PUE E;  4MHG A;  4BQO A;  4LG0 B;  1SMY F;  4DIQ A;  4YFN F;  4GDF A;  4F92 B;  5KHD A;  1FTT A;  4CYC A;  3HRM A;  3F9K A;  3MZ8 A;  1VQM I;  1VQ5 I;  1GVJ A;  2K4B A;  1TP4 A;  4HOB A;  3K1P A;  1B9N A;  5EGO B;  1I6H J;  3UKG A;  2DA7 A;  3M8F A;  1ONV A;  3A4C A;  3FDY A;  2DT5 A;  3H9J A;  4NC7 A;  3ZMS A;  2HYF A;  1VQ8 I;  3J80 Z;  4MTD A;  2DMN A;  3FZV A;  1U2W A;  2FQ3 A;  4V19 K;  3ZQH A;  2VE8 A;  5E3N A;  3HL2 A;  3ULQ B;  2L3D A;  5FLX Z;  4RBO A;  4CCN A;  3KYC B;  3G71 I;  3CDH A;  1G3T A;  5HDK A;  1HLV A;  3Q5F A;  2QKM B;  4LLG F;  5BMZ A;  4MNU A;  4RGS A;  1S6L A;  5H20 A;  3HRS A;  2XGC A;  5LEJ A;  1YJN I;  1N78 A;  3U1D A;  5JFR A;  4M9Z A;  2W48 A;  3CJN A;  4I76 A;  4B09 A;  3V8K A;  2HOA A;  2FEZ A;  1LVK A;  3JRI A;  3ONQ A;  1UHM A;  4ANJ A;  1U78 A;  3AG3 H;  2ID3 A;  4BL0 B;  2J5O A;  3GZN B;  2VXZ A;  3CD6 I;  5IYB J;  3BJ6 A;  1XS9 A;  1LFU P;  3ZQI A;  3PFI A;  2B7E A;  1W7P A;  5LHH A;  4EM0 B;  3QU3 A;  2L2O A;  5HLI A;  1RC9 A;  2IRF G;  2QM3 A;  4JX6 A;  4EQQ A;  2ZXH A;  2DYS H;  3BG3 A;  2GOM A;  2X6Y A;  2P7C B;  2CSO A;  2K3P A;  2M8G X;  1J75 A;  2WA0 A;  2GIV A;  2ETH A;  1LE8 A;  5ICF A;  3KYL A;  5IYD J;  4MEX F;  1D5V A;  3ZOB A;  3CO7 C;  4ZDO A;  4IRG A;  2Y9Y A;  2CW0 F;  2YU3 A;  5KNL A;  3S2D J;  1T08 B;  2DFF A;  3HRU A;  1KQ9 A;  3J7Z I;  1QZY A;  2ISZ A;  2F4O B;  5GAH J;  1EH7 A;  2F5E A;  4I0B A;  1MBE A;  4M3F A;  1E17 A;  2VKV A;  3AG1 H;  2L7Z A;  2WAE A;  4FET A;  2PJP A;  1FPQ A;  9ANT A;  3CC2 I;  1TWH J;  4A3G J;  3M1C A;  1TWA J;  1FY7 A;  1CF7 B;  3WU0 A;  2E2J J;  4J01 A;  2BW3 A;  1BOA A;  3ZGK A;  1MNM C;  1A6Q A;  5C4J J;  3KP5 A;  1BJZ A;  1JUP A;  2I8D A;  1YW7 A;  3O8G A;  1OKR A;  4DZP A;  2NRA C;  5D6E A;  2E19 A;  3OYC A;  1QBJ A;  3JTH A;  2R7Z J;  4XSZ F;  2ELJ A;  1R1T A;  2IGN A;  2NS0 A;  1B72 A;  1LPQ A;  2JK3 A;  4ZYH A;  5E8I A;  2DA6 A;  5LD2 C;  4ITV A;  3SJM A;  3S2H J;  1Y39 A;  2FXA A;  2HS5 A;  1ZK8 A;  4A3K J;  4IL6 C;  3OYH A;  2V4J C;  2X6O A;  2F5F A;  3HPH A;  1AHD P;  3FMR A;  3I0T A;  2EB7 A;  3OR2 C;  2VON A;  1S72 I;  2HEO A;  1S9H A;  3A03 A;  3J7A O;  2PBI A;  1ACI A;  4FE4 A;  1Z67 A;  3F22 A;  4XLF A;  2XRO A;  2WBM A;  1B8I A;  2H1K A;  2NVQ J;  2RNG A;  4BBS J;  2R7D A;  4BEH B;  3K10 A;  5ICC A;  1T39 A;  2XKP A;  4PDK A;  2R5Z A;  1DGW Y;  2P6S A;  2L9S A;  2VE9 A;  2JPC A;  3QAH A;  3CF2 A;  2VLA A;  2PLY A;  2M8E A;  5DCF A;  5ICG A;  3CMA I;  4DQ2 A;  4IZZ A;  1W1W E;  2VJI A;  1FBS A;  5IT9 Z;  3D5L A;  2ZJP F;  2J5P A;  2NVY J;  2P5V A;  2IA2 A;  4GXO A;  1N77 A;  1FX7 A;  3RDI A;  4LIT A;  2E1M C;  1X3U A;  3F23 A;  3FXJ A;  2QQ9 A;  3KPH A;  4KT6 A;  4RB0 A;  2LDU A;  1XGS A;  3DU6 A;  4E7I A;  5KCM A;  4WX9 A;  2JPB A;  2QUF A;  4U0Y A;  1GVD A;  1V55 H;  2OA4 A;  1KQ8 A;  1P92 A;  4ZTF A;  3OYF A;  3H36 A;  1USS A;  2WB1 N;  1IW7 F;  4GCV A;  4UUV A;  2DN0 A;  3AKZ A;  4PGG A;  4L9T A;  3V4G A;  4CCK A;  3GYH X;  3EPZ A;  4OMY A;  2K9Q A;  3K2Z A;  3DKY A;  2MBF A;  2IGO A;  4LFU A;  2KZV A;  3GUD A;  1YE9 A;  3REO A;  5J8C A;  5DS9 A;  1P4X A;  4DJA A;  4S05 A;  1WI3 A;  2QQ8 A;  4Z2Y A;  1VZ0 A;  3F8F A;  4E7K A;  2DT7 B;  1BI3 A;  1K61 A;  1MD0 A;  3X2Q H;  6PAX A;  1OFC X;  4DYR A;  3CMY A;  1MMN A;  3F6V A;  3CDL A;  1IV8 A;  1ZR2 A;  1G59 A;  1GDT A;  2XF5 A;  2RVC A;  4CGZ A;  5FRM A;  1QPM A;  3ML6 A;  1R5G A;  3ECH A;  1SEU A;  2M4K A;  3MVP A;  1FTZ A;  1MJA A;  4HW0 A;  2OU2 A;  1R7J A;  2Q2E A;  1MGT A;  2IAI A;  2JSC A;  3H5A A;  2DTR A;  4LG3 A;  3DLL F;  4XK4 A;  2HU9 A;  2Z1D A;  4CYC B;  4M72 A;  1ETO A;  1FSE A;  4IHS A;  4OOI A;  4RM2 A;  3G3Z A;  4XLN F;  4UY8 I;  1IRF A;  1JUS A;  1ZN2 A;  2EZL A;  3KYD B;  4M6V A;  4RAZ A;  1T2K A;  1D5Y A;  2KRF A;  3ZQG A;  3HDD A;  1Z0X A;  3LWF A;  2EFP A;  1JJ6 C;  2E5Z A;  3M07 A;  2VQG A;  3HSR A;  3MWM A;  5F04 A;  2FX0 A;  2VBZ A;  2KJB A;  3MD2 A;  2E60 A;  4XMY A;  5LHI A;  3ZQF A;  3BG5 A;  1QHH D;  3L00 A;  1Q1V A;  3BZK A;  4MO7 A;  2L4A A;  2LF8 A;  2LTP A;  2ELK A;  3KIO A;  2ZME C;  1KA8 A;  2QZ8 A;  2MLG A;  4XLP F;  3FXK A;  2LOO A;  4L5I A;  5D8L B;  2G7H A;  4C9Y A;  1R6R A;  2DA1 A;  2O8X A;  3KP2 A;  1V54 H;  2BXZ A;  2AXL A;  3K1N A;  4D5F A;  4HNU A;  2V1D A;  1JE8 A;  5CPR B;  3GTO J;  4HF2 A;  2CJJ A;  2GZW A;  4N4N B;  3R6S A;  3U21 A;  1W7P B;  2ID6 A;  3BR1 A;  3F0C A;  3BZ6 A;  4EJU A;  1GV2 A;  3K69 A;  1P7I A;  4XOR A;  4X0G A;  5GTH C;  2JWT A;  1QNT A;  3FWE A;  5J6X A;  1ZRE A;  1UAA A;  2COB A;  3HKZ N;  2VBW A;  4O3M A;  1LE8 B;  3L7W A;  4ETS A;  2XAQ A;  3U9G A;  1DPR A;  3ZQQ A;  3MAJ A;  4AVZ A;  5HOO A;  2ISY A;  1IUY A;  3BG9 A;  1R58 A;  3ZN0 A;  2FBH A;  1G3W A;  3HOX J;  1WJE A;  1UB9 A;  3QPH A;  1F4K A;  2HDC A;  1RIO H;  5B3S H;  4J00 A;  2DYR H;  1TWF J;  4XNF A;  3LOC A;  5LLQ A;  1FMW A;  1F43 A;  1REP C;  1A5J A;  3BG6 A;  4DW6 A;  1R4N B;  2LY1 A;  3ZMV A;  3K1M A;  3GZ5 A;  3BWG A;  3WU2 C;  4B3X A;  3BTJ A;  4KIS A;  2ZNY A;  1TTY A;  3ELK A;  1CQT A;  4IKF A;  4G8X A;  1SD4 A;  2BW3 B;  3J81 K;  4AD9 A;  4P5O A;  2UWM A;  3QPT A;  3KEQ A;  1YQA A;  3L1P A;  2BY2 A;  3DU5 A;  4UUT A;  1LDD A;  2AQF A;  3E3V A;  1TNS A;  5L3F A;  1MBG A;  5D5V B;  3LST A;  1JKQ C;  1UG0 A;  1YS6 A;  3RZD J;  1V5G A;  2ME6 A;  2X6X A;  1B72 B;  1D0X A;  1QA6 A;  1JHF A;  4UVA A;  1XN7 A;  3RPU A;  4HDV A;  1BM9 A;  2UXX A;  2HOT A;  3BPX A;  2HFH A;  2KLO A;  1JXS A;  1PDN C;  5K5Q A;  4BHB A;  4DBQ A;  3ESW B;  1T98 A;  1U5T A;  3LA2 A;  4IOC F;  4ZYD A;  3AL0 B;  1MMA A;  2K86 A;  1S5L C;  1RZ4 A;  1R5I D;  2CRG A;  1JTX A;  2LP0 A;  4LK0 F;  4PFO A;  3SZP A;  3PQJ A;  3R61 A;  3I56 I;  1IAW A;  2O61 A;  2KPM A;  3E5U A;  2MFZ A;  3DEU A;  2JA2 A;  3S1N J;  5H6R A;  2RC4 A;  4A6E A;  1YTY A;  1D0Z A;  5M3M J;  1SVM A;  2DAO A;  1MMG A;  2F48 A;  3OS0 A;  3JW4 A;  1ZLK A;  4UB6 C;  5ICE A;  1B8I B;  1G4D A;  1JTY A;  3DF8 A;  2FOW A;  2HYJ A;  4FT8 A;  5BOX A;  1RNL A;  4PK4 A;  4WF2 A;  2R5Z B;  5JR3 A;  1K4S A;  2MH9 A;  2P6T A;  2JA7 J;  2E1C A;  4XSX F;  2X6W A;  3PNV A;  4D7N A;  4BJ5 C;  3QOP A;  3IC7 A;  3S32 A;  3TW6 A;  1YYV A;  1UMQ A;  3LFK A;  4HQE A;  2M45 A;  5CVR A;  1HQC A;  3KP3 A;  4MTE A;  1ZGW A;  1Z7U A;  1FOY A;  3HKZ A;  3OYG A;  1Z21 A;  4IXA A;  5F64 A;  3IV5 A;  1JUM A;  1PUF A;  4HEA 2;  3JAM K;  2XPV A;  2BBY A;  3TGN A;  2CU7 A;  1JT6 A;  3M8E A;  1LDJ A;  3ZN1 A;  1JGS A;  2VKE A;  2STW A;  3C7J A;  2GBY A;  1MSE C;  3A02 A;  2CUZ A;  2XVC A;  3EDP A;  5GAG J;  2XF7 A;  2A6H F;  4F7Z A;  3BCB A;  3SFZ A;  4PJ0 C;  1V3F A;  5GAD J;  1BC8 C;  4GO1 A;  4XLC A;  2CV1 A;  1D1A A;  4IEJ A;  2PJR A;  3OYN A;  3ABL H;  1LDK B;  4LB5 A;  5C3E J;  1PJR A;  3IWF A;  3MKL A;  1BBY A;  4ZJZ A;  2OUM A;  3D5S C;  3DV8 A;  3TL4 X;  2GOX B;  2P7V B;  3EET A;  4A3F J;  2CUF A;  5HS7 A;  1O3Q A;  4IHT A;  5GPA A;  2K5C A;  5EEH A;  5ILS A;  1S29 A;  1BW5 A;  1WHU A;  4AIK A;  2JJ7 A;  2OJE D;  2H27 A;  5JHU A;  3FXO A;  4HV6 A;  3F3X A;  3NWS A;  3W2V A;  2JRT A;  3KP7 A;  1R23 A;  4JX4 A;  4G7H F;  4B44 A;  2VBY A;  2ZJR F;  4HAM A;  3LQR A;  3SEQ A;  2Q2E B;  4XID A;  1R9T J;  1U8R A;  2TRT A;  4Y15 A;  2O6G E;  1ZQ3 P;  3RZO J;  2FD5 A;  4AID A;  1B6A A;  1QQI A;  3S3O A;  2JT1 A;  1JT0 A;  4MFD A;  5FRO A;  4AUX A;  3TED A;  4LB6 B;  4LMY A;  1XC5 A;  4R79 A;  3I4M J;  2COM A;  2MC4 A;  2ZJQ F;  4B3A A;  4AC0 A;  3DFG A;  4IRI A;  2R7F A;  2FUG 2;  4UV9 A;  3IKT A;  3O6B B;  2CS3 A;  4R8H A;  1Z77 A;  3EUH A;  3ZMU A;  4EGZ A;  4NBQ A;  1S7A A;  5EZG A;  1FNN A;  4Y52 J;  1NH3 A;  3CC7 I;  4RGU A;  4OAY A;  5HOD A;  2DJN A;  4NQW A;  1O7L A;  1Z91 A;  3WGG A;  1T6S A;  1WJA A;  2EZH A;  3JCU C;  1YFH A;  1DUX C;  1ZGJ A;  2L5Q A;  2PEX A;  2LYC A;  5DUK A;  4D1Q A;  4KIT B;  1DP3 A;  2ME0 A;  4HZF A;  3CF5 F;  1XX5 A;  4M3G A;  3W2A A;  2BYV E;  2HVS A;  5JVT A;  4ENJ A;  2DDA A;  1MKM A;  2EFO A;  3OYL A;  2HQ5 A;  2WY7 Q;  2N8G A;  1HBX G;  1IZ1 A;  3WTU C;  1IV6 A;  3JRF A;  2L7F P;  2ZCW A;  2IS4 A;  2VKH A;  3MFK A;  4Z6Y A;  1Y8R B;  3BQZ A;  5KAI C;  4P55 A;  2ZFU A;  4HNV A;  3BPV A;  2XRL A;  1LUJ B;  2I10 A;  2LKX A;  1IXS B;  1IG7 A;  1MSF C;  2OTL I;  3COA C;  3OYI A;  3NQO A;  4QPQ A;  2EV6 A;  1GT0 C;  2EPF A;  1PYV A;  2OQG A;  2F5C A;  3WE3 A;  4IX7 A;  1MH3 A;  3CCJ I;  2XHK A;  2K27 A;  1BR2 A;  2Y0S A;  2CH0 A;  2W1O A;  3HUG A;  4D0P A;  2KP6 A;  2HTS A;  4G94 A;  3PO2 J;  2P81 A;  3JRE A;  5L3G A;  2M30 A;  4MLO A;  4FX4 A;  1UEL B;  3OSF A;  3JRA A;  3CCR I;  1ETX A;  1HCR A;  5LRS A;  3QOD A;  1BC7 C;  3KX2 A;  2WWY A;  5CVI A;  4Q4Z F;  1ORK A;  2YUS A;  4RB3 C;  3KP6 A;  2JUG A;  2FE3 A;  5LEK A;  3PL8 A;  2EFW A;  1WKM A;  3SZG A;  1RRJ A;  1H8A C;  3DBL B;  3E6D A;  4I01 A;  2E2H J;  5KK1 A;  3WTX C;  2KRH A;  1UFM A;  2A05 A;  3GXO A;  1W36 D;  3GW2 A;  4WK8 F;  4AIH A;  2ELH A;  3H92 A;  1QO0 D;  1IN6 A;  2DQR A;  4OWR B;  4UVB A;  4KN7 X;  2MSY A;  3RYP A;  4KN4 X;  1ZTR A;  3N4M A;  3JRD A;  2F6C A;  3QRF F;  3WOD F;  4YFX F;  2EA2 A;  3BR2 A;  3D5R C;  4AU7 A;  3KEO A;  3J81 Z;  4A5N A;  3J7Y J;  2AS5 F;  1L3L A;  1XMX A;  1FOW A;  4RLF A;  4BQQ A;  1SAX A;  2V1U A;  4IVN A;  1OLT A;  2E2I J;  4NNJ A;  1VQL I;  4F3Q A;  2AXT C;  5J1R A;  1SFE A;  4CA0 A;  5C44 J;  2DMP A;  3CCM I;  4M6X A;  2I5U A;  1E3H A;  3P9C A;  1EKE A;  2JRM A;  5EG0 A;  2R7S A;  5LHG A;  1SFO J;  3H0D A;  5FJ8 J;  3T1B A;  2A5Y B;  2YSR A;  3HXL A;  3BC8 A;  5FO5 A;  1OR7 A;  2HNH A;  5J4Y A;  1IJW C;  1KYW A;  4O6J A;  3RTR A;  2QKL B;  2R7R A;  1U9O A;  2IPQ X;  1FIA A;  1TC3 C;  4A2U A; 
#chains in the Genus database with same CATH homology
 3R0A A;  3H3U A;  1FWZ A;  2KKO A;  1XCV A;  3TO9 A;  2PMH A;  3BJA A;  2X0L A;  2Z5U A;  4CIC A;  2HYG D;  4IJA A;  1FBQ A;  5HDN A;  4UXN A;  5FD5 A;  1TQP A;  4Q47 A;  3HSE A;  3L09 A;  1KGS A;  3WTY C;  3KP4 A;  1KU2 A;  2IP2 A;  1IRG A;  2XAH A;  1BI0 A;  4KMF A;  3I54 A;  2JZY A;  4YG2 F;  1ZG1 A;  2M87 A;  1ODD A;  1FLI A;  2A3S A;  2D45 A;  2DFI A;  4BHP A;  2CG4 A;  1VTN C;  3Q9V A;  3MQ0 A;  3BDD A;  3WG9 A;  2IA1 A;  4BYY A;  4U88 A;  1D8K A;  1YW9 A;  2LSO A;  1BIA A;  1KU9 A;  2VOO A;  3RKX A;  5A2Q Z;  1G6N A;  1WWX A;  5E1X A;  2R3S A;  1P2F A;  5D6F A;  5F1R A;  3HYI A;  3GO5 A;  4KIF A;  3TO7 A;  4YFK F;  3RYR A;  1FP2 A;  3LQQ A;  3GX4 X;  1KYZ A;  2KIM A;  2CQK A;  1ZG3 A;  2MC3 A;  2DLL A;  4EJV A;  2MLK A;  4N9I A;  4WXD A;  4ENK A;  2L01 A;  1LVA A;  2O3F A;  3B02 A;  4HF0 A;  3HTU A;  2O03 A;  2O0Y A;  5D8K B;  1T38 A;  3LA7 A;  4A0Y A;  2ZXJ A;  2HGC A;  2DPD A;  4AWX B;  4GYG A;  3GVA A;  3V8L A;  2IVM A;  4RS8 A;  3JSO A;  2W24 A;  3W6K B;  1HW1 A;  2XV4 S;  4KA4 A;  3GWZ A;  1MZB A;  4P96 A;  1H0M A;  1W5S A;  1XDS A;  2XAS A;  1Z6R A;  4L0Y B;  4O5V A;  3I59 A;  4UNO A;  5CVV A;  1S3J A;  1B1B A;  2Y48 A;  1LEB A;  2EFN A;  2V9V A;  4OMZ A;  3GF2 A;  3SZT A;  1GHC A;  2V6C A;  3WU1 B;  4P9U A;  3TQN A;  1TW2 A;  1LB2 A;  2DK8 A;  3E6C C;  2L54 A;  3R4K A;  4E70 A;  2HZT A;  2HTJ A;  3CUO A;  2Y0M A;  2V79 A;  4CYD A;  2VC1 A;  2JTV A;  2B0L A;  4MEY F;  1HW5 A;  4KIG A;  5L3B A;  2ACJ A;  2EV0 A;  3DQV C;  5KVR A;  1HXD A;  1IN4 A;  2ZJ2 A;  4WCG A;  1W7P D;  4P9F A;  1BI2 A;  1FP1 D;  4HDU A;  2W25 A;  1YIO A;  3H3Z A;  4DNC A;  4A12 A;  3U2R A;  2VT3 A;  4CO8 A;  3WE2 A;  4KIB A;  1SD6 A;  1MJB A;  2P5L C;  1HST A;  2XRN A;  2PMU A;  2MD5 A;  3F8N A;  4KT5 C;  3CTA A;  5HS9 A;  3NEU A;  5CLS A;  3AAF A;  5DYM A;  4ON0 A;  1SFU A;  2FU4 A;  3LAJ A;  3HSF A;  4M9S A;  1TNT A;  2HKO A;  3ERE D;  2D1H A;  3DKW A;  5HLG A;  3HOS A;  1HKS A;  3P9K A;  1TQI A;  3T8T A;  3MZY A;  3CUQ A;  3O3K A;  4EVI A;  3F8B A;  3TOA A;  2W84 A;  3FM3 A;  1ZAR A;  5EEG A;  1Z05 A;  5BS6 A;  2QQA A;  1XB4 A;  3IRR A;  4A6D A;  4OIQ F;  5BQT A;  3JSP A;  4N9H A;  1PP8 F;  3FXU A;  3DPL C;  4BHC A;  2QQB A;  3RKY A;  3TDZ C;  2EFQ A;  1W5T A;  3ABT A;  4RB1 A;  1ZG5 A;  5TJJ A;  4A0Z A;  4NHJ A;  1R00 A;  3KET A;  3F8C A;  2P5K A;  4L18 B;  3VEP A;  2Z9O A;  4EJT A;  2KIU A;  2FNP A;  5HDG A;  3J80 K;  4HA8 A;  3E5X A;  1XSX A;  5FD6 A;  1K7A A;  1J9I A;  3SHF A;  1U5T C;  3WGH A;  1ZRD A;  3OOP A;  1YS7 A;  1GXP A;  3IWZ A;  3R60 A;  2HQR A;  4KMU X;  1ZAO A;  4NB5 A;  5CVJ A;  5LBQ A;  1P4W A;  1STZ A;  4M9X A;  4Q48 A;  1P4A A;  2LNB A;  3K0L A;  3I59 B;  4EJO A;  4HQM A;  2M5W A;  1Z1D A;  5LGU A;  3B73 A;  5ERI A;  4A0X A;  1Z9C A;  4I02 A;  1O57 A;  2PI0 A;  3EYI A;  3KCC A;  1OYY A;  3MCZ A;  3PQK A;  1ZRF A;  3V7R A;  2CWE A;  4UV8 A;  2IJL A;  1HKQ A;  3V7S A;  2XIG A;  3F72 A;  4N0B A;  3ZP5 A;  3KFW X;  4ENM A;  1UHW A;  5ILU A;  4BAY A;  4LLN A;  2ADU A;  2VC0 A;  4EGY A;  4CDG A;  4YIF A;  4GYI A;  1XMA A;  2A6E F;  2BEO A;  1WSU A;  4I09 A;  3V8J A;  1LJ9 A;  1XGN A;  3KZZ A;  2RN7 A;  3CLO A;  4OIR F;  3OV8 A;  4HBL A;  3FMS A;  3I71 A;  4ESB A;  1E2X A;  1ZLJ A;  4LD5 A;  1FOK A;  2CYY A;  4L9J A;  4HX7 A;  1GXQ A;  5FFX A;  2UZK A;  1XMK A;  4U7D A;  5FB2 A;  1B9M A;  1I6X A;  1BIB A;  1K78 A;  3Q9S A;  1T0F A;  3FXQ A;  4BNC A;  4TV7 A;  5DUI A;  1U3E M;  1DP7 P;  3HHG A;  1BI1 A;  4IRH A;  5E8G A;  5DEQ A;  1ZH5 A;  2NYX A;  1IN7 A;  2PQ8 A;  3F21 A;  3CUQ B;  2DI3 A;  2YX7 A;  3R0J A;  2DK5 A;  3ZQ7 A;  4ZYG A;  1OYW A;  3FM5 A;  2GXG A;  2PN6 A;  2XAF A;  2FSW A;  3ISP A;  1J59 A;  1XGO A;  2RNJ A;  5K1Y A;  1D8J A;  2IT0 A;  3S2W A;  2RDP A;  3FXR A;  1MDM A;  1ON1 A;  4YII A;  2IW5 A;  2Z99 A;  4A5M A;  2ESN A;  2EWN A;  5AIQ A;  1U5T B;  1R1V A;  5AON A;  1WRJ A;  2OZ6 A;  5E1W A;  5ILV A;  4G7O F;  3E6M A;  3WTZ A;  1FYL A;  5F6F A;  2L4M A;  5E20 A;  2MA3 A;  2CGP A;  2CFX A;  3VFZ A;  2LF7 A;  2OZU A;  3ZPL A;  1DDN A;  4I2O A;  3SXY A;  3KE2 A;  4FHT A;  4ENN A;  2H09 A;  5HS8 A;  1ZHF A;  5L3D A;  3RPQ A;  1I5Z A;  5DCM A;  1OPC A;  2QLZ A;  4M71 A;  3I5U A;  3M9A A;  3TOB A;  1I1G A;  2ZFW A;  4LLL A;  2YPR A;  3HHH A;  3JAM Z;  4EMS A;  4H0E A;  1IN8 A;  2HWV A;  4UVC A;  2BGC A;  3WTW C;  4KUM A;  1KU7 A;  1TBX A;  2QYO A;  2PFB A;  5BPD A;  4L5J A;  4KFC A;  4QWQ A;  3GLX A;  1C0W A;  4OIO F;  1S7O A;  2E7W A;  1JHH A;  2H6C A;  5ED4 A;  2HOE A;  4AVP A;  2ZBK A;  2LKP A;  4Q5S F;  5LGN A;  4L9N A;  2BE5 F;  2NNY A;  1R36 A;  1TQM A;  2E7X A;  3I64 A;  5AIP A;  1KQ0 A;  2FML A;  3BOQ A;  4IF4 A;  4U0W A;  2K02 A;  4LK1 F;  5DD4 A;  3IL2 A;  2VOD A;  3FX3 A;  2QBY A;  4M73 A;  2NNN A;  2XAG A;  2VBX A;  1FBU A;  3NRV A;  3RIR A;  3FHZ A;  2ZKZ A;  4B8X A;  4PGH A;  3D0S A;  4HF1 A;  2XAJ A;  5E18 F;  3LAP A;  1XDU A;  2GQQ A;  5HVQ C;  4AIJ A;  1H9T A;  1CGP A;  1FSH A;  2FBK A;  1SD7 A;  2YX4 A;  4HX4 A;  3T5X A;  2RGV A;  5FGM A;  4ESF A;  4HLX A;  3QP5 A;  1YW8 A;  1J7K A;  2OAZ A;  1DPU A;  3JTG A;  2NAZ A;  1XD7 A;  5L3E A;  1K78 B;  2KIF A;  2FMY A;  3IHU A;  4HX8 A;  1F5T A;  5L3C A;  2A07 F;  5K5R A;  1LQ1 A;  1FYK A;  1F1Z A;  5IT3 A;  4ZZL A;  1ZGA A;  1O3R A;  2FOK A;  1O3T A;  3QP6 A;  1UCR A;  2F5D A;  2DBB A;  3MZH A;  4XBF A;  3DPT A;  3TKY A;  1SMT A;  4M74 A;  1RUO A;  4CXF A;  2P4W A;  1NHA A;  2FA5 A;  3ECO A;  1RI7 A;  1FZP B;  2OQR A;  4OIP F;  3BY6 A;  3FF5 A;  1FC3 A;  4GGG A;  5CVU A;  1G3S A;  1IN5 A;  3P7N A;  1MDM B;  2FNA A;  1RUN A;  2OD5 A;  2H94 A;  3O2P E;  2KJC A;  1XSV A;  2TDX A;  4JK1 X;  4M6Y A;  2YR2 A;  1G3Y A;  4PZJ A;  2D1V A;  2VT2 A;  2V1X A;  4WWC A;  4XRF A;  4CZZ A;  2OBP A;  4MQ9 F;  4RGR A;  2L02 A;  5D5W B;  1IXR C;  2A61 A;  3IKV A;  4JBA A;  2H6B A;  5LRR A;  4BH9 A;  1YG2 A;  2GA1 A;  4RB2 C;  4ASN A;  1D3Y A;  1EH6 A;  3GFL A;  2QVO A;  1V4R A;  2ZME A;  2ESH A;  4G9Y A;  3RJP A;  2DU9 A;  2FRH A;  2Y75 A;  3T0Y A;  3VB2 A;  3HOT A;  1ULY A;  4HYE A;  2GWR A;  4EV0 A;  3WTT C;  3C18 A;  5DCM B;  3C1D A;  1XGM A;  3TO6 A;  2W57 A;  2XGX A;  4I98 B;  3VOD A;  4OIN F;  3GFI A;  2QEN A;  4I0A A;  4U0V A;  1A04 A;  2W85 A;  3E97 A;  3W6J B;  3I53 A;  4EM1 A;  5DD8 A;  1K79 A;  2VOP A;  3DXJ F;  1W4M A;  2EA4 A;  2Z33 A;  4G7Z F;  2ZNZ A;  3RI4 A;  1I1S A;  4IPA A;  5BPI A;  4FX0 A;  5DV5 A;  3EQL F;  1OMI A;  2RV8 A;  4LGW A;  3M7G A;  4R1H A;  4K2E A;  5E1Z B;  3P9I A;  2QBY B;  2VN2 A;  3L9F A;  4PCQ A;  3GZ6 A;  2M1B A;  3BRO A;  3G73 A;  1K6O A;  2HQN A;  1XCB A;  1I27 A;  1BJA A;  4BXU A;  2RQP A;  3HRT A;  3SQN A;  1QGP A;  3QU6 A;  3FMQ A;  5J8F A;  5HLH A;  2STT A;  2Z3Y A;  3LA3 A;  3I58 A;  2Q0O A;  1SD5 A;  3DP7 A;  2FF4 A;  2MH2 A;  1TLH B;  2G9W A;  2EK5 A;  3CUQ C;  2GAU A;  3ABU A;  3IRQ A;  5FFZ A;  1XSD A;  1YO5 C;  2IA0 A;  3HTS B;  4ZYE A;  3ZMT A;  5FLX K;  4LG0 A;  4EM2 A;  2A68 F;  1HKT A;  2UXN A;  2FBI A;  1O3S A;  2WC2 A;  5D5X B;  1B59 A;  3WTV C;  3BJO A;  1FYM A;  2X4H A;  5D4R A;  1J2X A;  1R5H A;  3L2C A;  3F8M A;  5E17 F;  1H9G A;  2F2E A;  1IF1 A;  2DPU A;  2EV5 A;  1ON2 A;  4LJZ F;  3T8R A;  4L9V A;  4ZZD A;  3KZY A;  3M1E A;  1Q1H A;  2Q8K A;  1U6G A;  2P8T A;  2GXB A;  2HR3 A;  5D4S A;  1ZYR F;  1IXC A;  2C6Y A;  3V7C A;  5A2Q K;  1J0R A;  1B4A A;  4L0Z B;  2WV0 A;  2ZME B;  5K5O A;  3KLN A;  3MEX A;  2K4J A;  4S04 A;  5JI6 A;  5H6Q A;  1YLF A;  3WTS C;  3N97 A;  4Y13 A;  4ESJ A;  4U7B A;  3GEZ A;  4QLC U;  5D5U B;  1Z6T A;  1TW3 A;  3TDU C;  5LGT A;  1CF7 A;  3I4P A;  1F9N A;  1BN5 A;  2DQL A;  4G6Q A;  2G7U A;  1R1U A;  2DW4 A;  1Y0U A;  4RAY A;  2WTE A;  2RKH A;  2BV6 A;  4KDP A;  1LEA A;  3ZMZ A;  4BQA A;  1R22 A;  2CO5 A;  3ROU A;  4MGR A;  4Y17 A;  2D2W A;  2XKO A;  4UHT A;  5IT9 K;  2ZO4 A;  3GFM A;  4CHU A;  1MJ9 A;  1S8N A;  2EJR A;  3E6B A;  3WGI A;  3GFJ A;  1FT9 A;  4I7H A;  3ZMD A;  3KLO A;  1AOY A;  1OYI A;  4HLY A;  2K7L A;  3VOE A;  1UST A;  1QZZ A;  2A69 F;  2QWW A;  1P6R A;  1EH8 A;  3HIF A;  4OU0 A;  4KYW A;  1WI9 A;  3F6O A;  5CJ9 A;  3RKW A;  5DDG A;  1O7F A;  1PP7 U;  3BP8 A;  1LNW A;  3EYY A;  4ZH4 F;  4WXC A;  4KNY A;  3C3W A;  4WXH A;  2GA2 A;  3CO6 C;  3E5Q A;  2XUB A;  2HKX A;  5CYV A;  1SFX A;  1KU3 A;  1HSJ A;  2PG4 A;  3K9T A;  4MQV A;  4EJW A;  1HW2 A;  4JQF A;  1EV7 A;  2DO7 A;  4KIC A;  4HV5 A;  5TRD A;  1J5Y A;  1ZRC A;  1AWC A;  4G6D A;  4RGX A;  1WQ2 A;  1L0O C;  2E1N A;  1PUE E;  4MHG A;  4LG0 B;  1SMY F;  4YFN F;  3HRM A;  1GVJ A;  2K4B A;  4HOB A;  3K1P A;  1B9N A;  3M8F A;  1ONV A;  2DT5 A;  3ZMS A;  2HYF A;  3J80 Z;  4MTD A;  3FZV A;  1U2W A;  2FQ3 A;  2VE8 A;  3ULQ B;  2L3D A;  5FLX Z;  3CDH A;  1G3T A;  5HDK A;  3Q5F A;  4LLG F;  5BMZ A;  4MNU A;  4RGS A;  1S6L A;  5H20 A;  3HRS A;  5LEJ A;  3U1D A;  5JFR A;  4M9Z A;  3CJN A;  4B09 A;  3V8K A;  2FEZ A;  1UHM A;  1U78 A;  2J5O A;  2VXZ A;  3BJ6 A;  3PFI A;  1W7P A;  5LHH A;  4EM0 B;  3QU3 A;  5HLI A;  2IRF G;  2QM3 A;  4EQQ A;  2P7C B;  2CSO A;  1J75 A;  2GIV A;  2ETH A;  5ICF A;  4MEX F;  1D5V A;  3CO7 C;  4IRG A;  2CW0 F;  2YU3 A;  3HRU A;  1KQ9 A;  1QZY A;  2ISZ A;  1EH7 A;  2F5E A;  4I0B A;  1E17 A;  2PJP A;  1FPQ A;  1FY7 A;  1CF7 B;  3WU0 A;  1BOA A;  3KP5 A;  1YW7 A;  1OKR A;  2NRA C;  5D6E A;  1QBJ A;  3JTH A;  4XSZ F;  1R1T A;  2NS0 A;  4ZYH A;  5E8I A;  2FXA A;  2HS5 A;  2F5F A;  3FMR A;  3I0T A;  2EB7 A;  2VON A;  2HEO A;  3J7A O;  2PBI A;  3F22 A;  2XRO A;  2R7D A;  5ICC A;  1T39 A;  2XKP A;  4PDK A;  2P6S A;  2VE9 A;  2JPC A;  3QAH A;  2PLY A;  2M8E A;  5DCF A;  5ICG A;  4DQ2 A;  1FBS A;  5IT9 Z;  3D5L A;  2J5P A;  2P5V A;  2IA2 A;  4GXO A;  1FX7 A;  3RDI A;  1X3U A;  3F23 A;  2QQ9 A;  4RB0 A;  2LDU A;  1XGS A;  4WX9 A;  2JPB A;  2QUF A;  4U0Y A;  2OA4 A;  1KQ8 A;  1P92 A;  1USS A;  1IW7 F;  4GCV A;  4UUV A;  4PGG A;  4L9T A;  3V4G A;  3GYH X;  4OMY A;  3K2Z A;  2MBF A;  4LFU A;  3GUD A;  3REO A;  5J8C A;  1P4X A;  4S05 A;  4Z2Y A;  3F8F A;  1BI3 A;  1MD0 A;  6PAX A;  3F6V A;  2RVC A;  4CGZ A;  1QPM A;  3ML6 A;  1R5G A;  3ECH A;  1MJA A;  4HW0 A;  2OU2 A;  1R7J A;  2Q2E A;  1MGT A;  2JSC A;  2DTR A;  4M72 A;  1FSE A;  4IHS A;  4OOI A;  3G3Z A;  4XLN F;  1IRF A;  1ZN2 A;  4RAZ A;  1T2K A;  2KRF A;  3LWF A;  2EFP A;  3HSR A;  3MWM A;  2VBZ A;  2KJB A;  5LHI A;  3L00 A;  2L4A A;  2LF8 A;  1KA8 A;  2QZ8 A;  2MLG A;  4XLP F;  4L5I A;  5D8L B;  2G7H A;  3KP2 A;  2O8X A;  2AXL A;  3K1N A;  2V1D A;  1JE8 A;  4HF2 A;  2GZW A;  3R6S A;  1W7P B;  3BZ6 A;  4EJU A;  3K69 A;  1QNT A;  3FWE A;  5J6X A;  1ZRE A;  2VBW A;  4O3M A;  3L7W A;  4ETS A;  2XAQ A;  3U9G A;  1DPR A;  3MAJ A;  5HOO A;  2ISY A;  1IUY A;  1R58 A;  3ZN0 A;  2FBH A;  1G3W A;  1UB9 A;  3QPH A;  1F4K A;  2HDC A;  1RIO H;  5LLQ A;  1REP C;  3ZMV A;  3K1M A;  3GZ5 A;  3BWG A;  2ZNY A;  1TTY A;  3ELK A;  4G8X A;  1SD4 A;  3J81 K;  4AD9 A;  4P5O A;  2UWM A;  3QPT A;  3KEQ A;  1YQA A;  1LDD A;  3E3V A;  1TNS A;  5L3F A;  5D5V B;  3LST A;  1YS6 A;  1JHF A;  4UVA A;  1XN7 A;  3RPU A;  4HDV A;  1BM9 A;  2UXX A;  1JXS A;  3BPX A;  2HFH A;  1PDN C;  5K5Q A;  4BHB A;  1T98 A;  1U5T A;  3LA2 A;  4ZYD A;  2K86 A;  4LK0 F;  1RZ4 A;  3SZP A;  1IAW A;  3PQJ A;  3R61 A;  2O61 A;  3E5U A;  3DEU A;  5H6R A;  2RC4 A;  4A6E A;  1YTY A;  1ZLK A;  2DAO A;  3JW4 A;  5ICE A;  1G4D A;  3DF8 A;  4FT8 A;  5BOX A;  1RNL A;  4WF2 A;  5JR3 A;  2MH9 A;  2P6T A;  2E1C A;  4XSX F;  3QOP A;  3IC7 A;  1YYV A;  3LFK A;  4HQE A;  2M45 A;  5CVR A;  1HQC A;  3KP3 A;  4MTE A;  1Z7U A;  4IXA A;  5F64 A;  3JAM K;  2BBY A;  3TGN A;  3M8E A;  1LDJ A;  3ZN1 A;  1JGS A;  2STW A;  3C7J A;  2XVC A;  3EDP A;  2A6H F;  4F7Z A;  3SFZ A;  1V3F A;  1BC8 C;  4GO1 A;  1LDK B;  4LB5 A;  3IWF A;  1BBY A;  3DV8 A;  2P7V B;  3EET A;  5HS7 A;  1O3Q A;  4IHT A;  5EEH A;  5ILS A;  1S29 A;  4AIK A;  2H27 A;  5JHU A;  4HV6 A;  3F3X A;  2JRT A;  3KP7 A;  1R23 A;  4G7H F;  2VBY A;  4HAM A;  3LQR A;  1U8R A;  4Y15 A;  2O6G E;  1B6A A;  1QQI A;  2JT1 A;  4LB6 B;  4LMY A;  4R79 A;  2COM A;  3DFG A;  4IRI A;  2R7F A;  4UV9 A;  3IKT A;  3O6B B;  4R8H A;  3EUH A;  3ZMU A;  4EGZ A;  1S7A A;  1FNN A;  4RGU A;  4NQW A;  1O7L A;  1Z91 A;  3WGG A;  1T6S A;  1YFH A;  1DUX C;  1ZGJ A;  2PEX A;  5DUK A;  4HZF A;  2BYV E;  5JVT A;  4ENJ A;  1MKM A;  2EFO A;  1HBX G;  1IZ1 A;  3WTU C;  2ZCW A;  3MFK A;  4P55 A;  3BPV A;  1IXS B;  3COA C;  3NQO A;  2EV6 A;  2OQG A;  2F5C A;  3WE3 A;  2XHK A;  2K27 A;  4D0P A;  3HUG A;  2HTS A;  4G94 A;  5L3G A;  2M30 A;  4FX4 A;  5LRS A;  1BC7 C;  2WWY A;  5CVI A;  4Q4Z F;  4RB3 C;  3KP6 A;  5LEK A;  2FE3 A;  2EFW A;  1WKM A;  3E6D A;  4I01 A;  5KK1 A;  3WTX C;  1UFM A;  3GXO A;  4WK8 F;  3GW2 A;  4AIH A;  2ELH A;  3H92 A;  1QO0 D;  1IN6 A;  2DQR A;  4UVB A;  4KN7 X;  3RYP A;  4KN4 X;  3N4M A;  3QRF F;  3WOD F;  4YFX F;  2EA2 A;  3KEO A;  3J81 Z;  4A5N A;  2AS5 F;  1L3L A;  1SAX A;  2V1U A;  4IVN A;  1SFE A;  4M6X A;  3P9C A;  5LHG A;  3T1B A;  2A5Y B;  2YSR A;  5FO5 A;  1OR7 A;  1KYW A;  4O6J A;  3RTR A;  2IPQ X;  4A2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...