1HKQA

Pps10 plasmid dna replication initiator protein repa. replication inactive, dimeric n-terminal domain.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
QSNKLIESSHTLTLNEKRLVLCAASLIDSRKPLPKDGYLTIRADTFAEVFGIDVKHAYAALDDAATKLFNRDIRRYVKGKVVERMRWVFHVKYREGQGCVELGFSPTIIPHLTMLHKEFTSYQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REPLICATION PROTEIN
publication title A Conformational Switch between Transcriptional Repression and Replication Initiation in Repa Dimerization Domain
pubmed doi rcsb
source organism Pseudomonas savastanoi
molecule tags Dna binding protein
total genus 37
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hkqA00
1W5TA 4UVCA 1W7PA 4ETSA 3W6KB 2WWYA 2XAQA 5DDGA 1YTYA 1MGTA 3Q5FA 2E7WA 4N9IA 2ADUA 1U5TC 2CW0F 2TDXA 4QWQA 2Q2EA 4KIFA 1SFUA 3E6MA 1OMIA 1IXCA 1S6LA 1YO5C 4M6XA 3WTVC 4OIPF 2ZBKA 2XIGA 4LLLA 1H9GA 3HSRA 2VODA 3KP5A 3ZN0A 1FYLA 4M72A 2HZTA 5CVIA 1LVAA 1LB2A 3CTAA 3JW4A 1FP2A 1H0MA 4RGRA 1K6OA 4EGZA 2FF4A 3V8LA 1IW7F 2P5LC 2K02A 2NS0A 1DP7P 2X4HA 1FT9A 1KU7A 1QNTA 2QQ9A 1Y0UA 5ICFA 1W7PB 2JSCA 3QU6A 1OYYA 4IRGA 1U3EM 1ZLKA 2YR2A 2JTVA 5DD8A 5DCMB 2DPDA 4AIKA 5L3GA 4EJWA 3QP5A 4WK8F 3BZ6A 1OPCA 4UUVA 4L9JA 2OBPA 1ZARA 2ZXJA 1F1ZA 3H3ZA 4ON0A 4U88A 2VOPA 4Q48A 2YPRA 1R00A 4FX4A 2W85A 2WV0A 2PQ8A 3ZQ7A 4WXHA 1K78A 4CXFA 3GFMA 3RIRA 1KU2A 1YW8A 5JR3A 3P7NA 1FYKA 2P5KA 2XV4S 3IKVA 2UWMA 4DNCA 4WWCA 1TQIA 2JRTA 4TV7A 5ICEA 2VONA 3R4KA 3J80K 3GUDA 4LLGF 1XGOA 3M9AA 2B0LA 3CUQA 4GO1A 1J5YA 2Q0OA 1MKMA 5E1XA 1S7OA 1B9NA 1TNSA 4XSXF 1EH7A 2H27A 1YW7A 2W84A 3G3ZA 1L0OC 3WTYC 1ZRDA 5CLSA 5L3EA 2EFQA 1I5ZA 4KYWA 1P4AA 2MLKA 2ZMEA 1IN5A 2AS5F 2HEOA 4G94A 2HKOA 5JI6A 1MJAA 1XB4A 1UFMA 2P4WA 3W6JB 1K78B 1ZN2A 5HDNA 4Z2YA 2VC0A 2OZUA 3ZMTA 2UZKA 5K5OA 2EV5A 5LEJA 1KYWA 1HKSA 5CJ9A 1QQIA 5DYMA 1YFHA 1FX7A 1MZBA 2P8TA 3EUHA 1UB9A 4RGSA 1T39A 3T1BA 1DDNA 3GEZA 3LA7A 3T0YA 4XLPF 5D6EA 3E5QA 4D0PA 2VT2A 2M87A 4KNYA 5E1WA 1ZLJA 4PZJA 4ESBA 2HKXA 1LEAA 3CUQB 1P6RA 3I4PA 3KEQA 3NQOA 5F1RA 2XGXA 5IT3A 1E2XA 2K7LA 5CVVA 3SHFA 5D8LB 5CYVA 3KFWX 5LGTA 5DD4A 4N0BA 1IUYA 4JBAA 4GYGA 4B09A 3V8KA 3HSFA 1J9IA 1IN6A 2L02A 2PJPA 1SFXA 3MWMA 3E3VA 3PFIA 3FXQA 2L3DA 1WRJA 2GA1A 3DEUA 3T8TA 4BH9A 1CGPA 4NB5A 4F7ZA 2AXLA 4KICA 2HQRA 2F5CA 1J59A 1TNTA 3FMRA 4YG2F 1KQ8A 3TOBA 1XMAA 5ILSA 3WTZA 5HS9A 2R7FA 2MH2A 3QRFF 3DXJF 3OV8A 1TQMA 2ZNYA 1R36A 2DFIA 2OQGA 3P9IA 5J6XA 2DBBA 4OOIA 2P6SA 4RB3C 3SQNA 5LRSA 2GXBA 4LJZF 2XKOA 2ZO4A 2FA5A 5FB2A 1G3SA 5L3FA 3O3KA 2VXZA 4A0XA 4R1HA 4EQQA 3K1NA 3D0SA 2L54A 1OKRA 1EV7A 1P2FA 2YSRA 3TKYA 5BPDA 1BOAA 2IP2A 4GXOA 5K5RA 1ON1A 5TJJA 3MZYA 2EA4A 5AONA 2PI0A 1XDSA 3QP6A 1WQ2A 2O6GE 2E1CA 5H20A 1T38A 2QLZA 3V7SA 3WODF 1GVJA 3ZMZA 4UHTA 5F64A 4GCVA 3RYPA 1F4KA 3F8NA 1U8RA 5L3DA 3GZ6A 4MNUA 3I71A 5L3BA 3HTSB 3G73A 4WXCA 1K79A 2Y0MA 4L5IA 1TW2A 2KRFA 3RDIA 1TBXA 4M9ZA 4I0AA 2VBZA 4PGHA 4OMYA 2LF8A 2NYXA 3JTHA 2FBIA 2G9WA 4HAMA 1GXQA 3IRQA 1D8KA 4FT8A 4MHGA 3L7WA 2HS5A 4ZYDA 2JPCA 3QPHA 2DW4A 1KU3A 4U7BA 1BI2A 1EH8A 3BWGA 4XBFA 3CUOA 4O6JA 3R0JA 4IJAA 4ESJA 1FY7A 3K69A 1IXRC 2VBWA 1FYMA 5E8IA 1Z9CA 5HS7A 2D45A 1OYIA 3NEUA 2DU9A 2NAZA 2OZ6A 3I54A 3IHUA 1IN4A 2C6YA 5LEKA 2ACJA 1HQCA 3F6VA 3GLXA 2DPUA 1ZG3A 3ECOA 2J5PA 4G7HF 3J81Z 2R7DA 4ZYGA 5BS6A 2LF7A 2QENA 2XRNA 4PCQA 4IVNA 3LA2A 1HBXG 3TGNA 5CVRA 2IJLA 3M1EA 5FO5A 3C3WA 2K4BA 5CVJA 1J0RA 1B59A 2QVOA 2Z99A 2BE5F 4ZYEA 5HOOA 1JE8A 2M1BA 3QPTA 1ZREA 1QZZA 3I58A 1BM9A 2DK5A 3KZYA 3KP2A 3GVAA 1U5TA 1D8JA 4BQAA 1JHHA 1YYVA 2ZNZA 2DO7A 2M30A 3DQVC 2H6CA 3RKXA 4IF4A 1BJAA 5HDKA 4HQEA 2ISZA 4UVAA 4AWXB 1XGMA 3KLOA 2E1NA 4EM0B 1DPUA 2XASA 3J80Z 4CYDA 3KP7A 4M9XA 3CO7C 1DUXC 4HF2A 3F8CA 2RDPA 3I5UA 4HLXA 2NRAC 4LK0F 4OU0A 2IVMA 1O3RA 3FF5A 4HOBA 2L4MA 2PEXA 4UVBA 4ENKA 3Q9SA 3F8FA 5DCMA 3FXUA 3B73A 4LB5A 2D2WA 4L0ZB 2L01A 4EGYA 1SD5A 1JGSA 3H3UA 1U5TB 2EFOA 4OMZA 2OA4A 4EJVA 1RUOA 2EV0A 5ILUA 1Z7UA 4M71A 1L3LA 1GXPA 3ULQB 2STTA 1MD0A 2A5YB 3GO5A 4RGXA 1HSJA 3ABTA 4KT5C 2RGVA 4OIRF 3H92A 4NHJA 2JZYA 4BAYA 4AVPA 2MH9A 5K5QA 1REPC 3KP6A 4LG0A 1BIAA 2ZKZA 1KGSA 2FNAA 4I2OA 1RI7A 3ISPA 3E6DA 4IRIA 3ZMDA 2D1VA 4BYYA 4S05A 2P7CB 1XCVA 3U1DA 3O6BB 3JSOA 2A68F 2HYFA 5ICGA 3HUGA 1XDUA 2VE8A 3J81K 2KIUA 2RC4A 1MJBA 2V6CA 2D1HA 4BHPA 2EK5A 4WCGA 3U2RA 3T5XA 4R79A 3WE2A 3REOA 4A5NA 4UXNA 3MEXA 4I02A 4HF0A 3V4GA 3BJOA 3N4MA 2M8EA 1RUNA 4CICA 4G7ZF 3WTUC 5KVRA 2FQ3A 3L00A 2J5OA 3EETA 3QAHA 2FOKA 4EJOA 3HYIA 1A04A 1HW2A 2BEOA 1QZYA 2CO5A 3I64A 4LG0B 4BNCA 2HWVA 4HX4A 2XHKA 1YQAA 1LDKB 1IRFA 2WTEA 5D4SA 5BPIA 1BI1A 4KN7X 2IT0A 5ICCA 3V8JA 5D5VB 4M9SA 3FX3A 2M45A 3GW2A 2Z33A 3KP4A 1PP8F 3ZP5A 3JAMZ 1ZH5A 4WF2A 2G7UA 3FM5A 3GF2A 2W57A 1XSXA 1ONVA 3P9CA 1P92A 4HBLA 1D3YA 4A0YA 4MEYF 2H6BA 3BY6A 5A2QZ 2F5EA 2MA3A 1JXSA 4XLNF 3CJNA 2MD5A 1U6GA 2FEZA 1F5TA 3MZHA 3FMSA 1B1BA 2PMHA 4FX0A 4M74A 1WKMA 4Y15A 3PQKA 2NNYA 2P7VB 3HRSA 1TLHB 2IW5A 1SMTA 3MQ0A 2PN6A 3HRMA 4ZYHA 3LFKA 2EFNA 1R1VA 3MFKA 2LKPA 5H6RA 4IPAA 3ZMVA 5L3CA 4I01A 3KETA 1SFEA 4G9YA 1D5VA 2ZJ2A 1BC8C 4Q47A 3U9GA 5IT9Z 4MQ9F 1ODDA 1G3WA 1ZHFA 2ELHA 2FNPA 1IN7A 2L4AA 2OU2A 4UV9A 5DCFA 2RQPA 1AOYA 4IHTA 1IRGA 4CO8A 3IL2A 3K9TA 4Y13A 3GFLA 1R58A 1R1TA 5LHHA 2BYVE 3K1MA 2ZFWA 3MCZA 2CGPA 4RAYA 2GIVA 3K0LA 2RNJA 2JT1A 3SZPA 1ZG1A 4ZZLA 4JQFA 2CWEA 2GWRA 3I0TA 2DQRA 1O7FA 4OINF 2Y75A 1KA8A 3N97A 3FHZA 1SD6A 4KA4A 3LSTA 3BPXA 4IHSA 3VEPA 4BHBA 3WG9A 1FPQA 1LDDA 2DI3A 5AIPA 2A69F 1I1GA 3BDDA 5FD6A 3BOQA 1BC7C 2FXAA 1S8NA 2STWA 2ETHA 5BMZA 3JAMK 1J7KA 3M7GA 2P5VA 3GFJA 2QZ8A 2XKPA 3TDZC 4CGZA 3VB2A 1DPRA 5LHIA 5A2QK 1I1SA 2IRFG 1SMYF 4I09A 1MJ9A 3HRUA 5ILVA 1IF1A 2VN2A 1CF7A 1U2WA 2DT5A 2O03A 4AIJA 2CSOA 5LGUA 3IWFA 4PDKA 2FMYA 2FU4A 2KKOA 4S04A 1ON2A 1ZYRF 2R3SA 2QQAA 4RAZA 2F2EA 2HYGD 3BPVA 5IT9K 3V7CA 1UHWA 3LQRA 3F23A 5K1YA 3VODA 4I98B 4N9HA 3IKTA 2VBYA 4EVIA 2O0YA 1LEBA 2A3SA 2FSWA 3C1DA 1XMKA 2PMUA 1YLFA 2DLLA 1FSEA 2XAGA 4EV0A 3QU3A 3WU0A 1CF7B 1ZG5A 3GXOA 3IRRA 4YIFA 1JHFA 1Z05A 1V3FA 5E20A 3LAPA 3BROA 1FLIA 4WXDA 3KLNA 4CDGA 4KN4X 1KQ9A 5HVQC 3KP3A 4LGWA 2PG4A 5FFZA 4EM2A 1WSUA 3S2WA 2EB7A 3WTSC 1IAWA 1HKTA 1Z1DA 4XRFA 1OR7A 5FD5A 4A12A 2F5FA 5FLXK 1G6NA 2EV6A 4KIGA 5BOXA 2V1DA 1FZPB 1XGNA 1X3UA 1LDJA 2KIMA 4BHCA 1LJ9A 4EJTA 4M73A 3ROUA 2DQLA 4BXUA 2V1XA 4ZH4F 2XAFA 4E70A 4Q5SF 1FBQA 3VFZA 1FP1D 2GQQA 2UXXA 4MTEA 1R1UA 1T0FA 2RVCA 2K86A 3F8BA 1HW5A 2EFWA 3PQJA 1U78A 1HXDA 3L2CA 3ZN1A 1USTA 3JSPA 4AIHA 3COAC 1T2KA 4LB6B 5E18F 4G6DA 2DAOA 1BN5A 2F5DA 2IA2A 3DP7A 1J75A 4XSZF 2HQNA 3E5UA 1XCBA 3TDUC 4U0VA 5D6FA 3CO6C 1K7AA 3SZTA 4IRHA 4HA8A 3DKWA 3EYYA 3GFIA 2Y48A 3E5XA 4P5OA 3KEOA 2YU3A 1Z6TA 2FRHA 4AD9A 3M8EA 4RB0A 2MLGA 1RIOH 2V79A 3T8RA 4CHUA 3SXYA 5JHUA 3IC7A 4HV5A 3DFGA 3HHGA 4A0ZA 5JVTA 5D4RA 4YIIA 5FGMA 3I53A 2QM3A 4KMFA 5D5UB 3K2ZA 3CLOA 3FM3A 2HDCA 2VOOA 1XN7A 1W7PD 1O3TA 2BGCA 2GXGA 3LA3A 4L9NA 3F8MA 1PUEE 4A5MA 3RKWA 4JK1X 3GWZA 4LFUA 3HTUA 4UV8A 3GX4X 1E17A 3ZPLA 2DTRA 4A6DA 3VOEA 3RPUA 2KJCA 4I7HA 3TO9A 4HDUA 1XD7A 1AWCA 4FHTA 2HTSA 4MQVA 4MEXF 2O61A 2MBFA 4EM1A 4O5VA 2DK8A 1OYWA 2OAZA 3F21A 3GZ5A 2A6HF 1LQ1A 4EMSA 1USSA 1Q1HA 4L5JA 3WGHA 5LBQA 1YS6A 1SD7A 2H09A 2OQRA 2NNNA 4UNOA 2VC1A 1W5SA 3ML6A 2Z9OA 1FOKA 3R6SA 3CDHA 3R61A 5D8KB 1ZRCA 2G7HA 5HLHA 3R60A 4RB2C 1O3SA 2W25A 3DF8A 5ERIA 4L9VA 3L9FA 4MTDA 3GYHX 3IWZA 3E6BA 4Y17A 2HGCA 2GA2A 1IN8A 2CFXA 2K4JA 1FC3A 5KK1A 5D5WB 2RKHA 2EA2A 4ASNA 3TO6A 1QO0D 1KYZA 3L09A 4A2UA 1TTYA 3ECHA 4U0WA 3K1PA 3F22A 4LLNA 4EJUA 5CVUA 2LDUA 4ENNA 2LNBA 3RYRA 3ABUA 4PGGA 2K27A 1I6XA 2RN7A 2VT3A 4LMYA 2IPQX 2HFHA 1KU9A 1G3TA 3TO7A 5H6QA 2UXNA 1XSVA 4YFXF 3ELKA 4GYIA 1MDMA 4DQ2A 2FBKA 5DUKA 4CZZA 3FXRA 2Q8KA 2IA1A 3OOPA 3WGIA 2XROA 3RJPA 1B6AA 1J2XA 2PBIA 2V9VA 3WTTC 4QLCU 1FSHA 3F72A 1ZRFA 4IXAA 2COMA 2XUBA 2FE3A 4YFNF 2YX7A 2HOEA 4HX8A 4KDPA 3DPLC 1R23A 4U7DA 2H94A 5J8CA 4ENMA 1EH6A 1BI0A 3P9KA 2GAUA 3FWEA 5J8FA 3CUQC 1FBUA 4U0YA 3EQLF 1S29A 4HF1A 2O3FA 3JTGA 3HOSA 3HSEA 4NQWA 1HSTA 3LQQA 1HKQA 2QBYA 1LNWA 2ESHA 4OIQF 4HQMA 3ERED 4HW0A 3RKYA 2QQBA 5LGNA 3SFZA 2O8XA 4KIBA 1SAXA 1MDMB 4KMUX 3MAJA 4P96A 4LD5A 4G8XA 1R22A 1QGPA 2ZMEB 2FBHA 1Z91A 2CQKA 3NRVA 5FLXZ 1YS7A 4L0YB 3E97A 2CG4A 3WE3A 5HLGA 2JPBA 1G4DA 1C0WA 3C18A 5DV5A 2HTJA 2P6TA 5HS8A 2EWNA 1FNNA 1H9TA 2M5WA 3C7JA 4LK1F 1Z6RA 1NHAA 3QOPA 4G6QA 1HW1A 1TW3A 2QBYB 4HX7A 1YIOA 1KQ0A 5E8GA 3E6CC 3FMQA 4HZFA 3RI4A 2EFPA 5JFRA 2A6EF 3KCCA 4I0BA 3HIFA 1O3QA 2YX4A 1GHCA 1VTNC 3EDPA 1I27A 3Q9VA 1RZ4A 3HHHA 1BIBA 2PLYA 2E7XA 3BP8A 2BBYA 4G7OF 1BBYA 5HDGA 3HRTA 3R0AA 2QWWA 2A61A 1T98A 3DV8A 1W4MA 2XAHA 3BJAA 4KUMA 4MGRA 1TQPA 5EEGA 4P55A 4R8HA 3M8FA 2ISYA 4RGUA 5TRDA 2Z3YA 2XVCA 3ZMSA 3LWFA 5FFXA 1STZA 3WTXC 1QBJA 5DEQA 3BJ6A 3ZMUA 2IA0A 1BI3A 1V4RA 3I59A 1FWZA 3F6OA 1S7AA 3LAJA 5DUIA 4K2EA 2PFBA 5AIQA 1PP7U 2CYYA 1UHMA 2MC3A 3TOAA 1R7JA 2VBXA 5HLIA 2X0LA 1IZ1A 1IXSB 3EYIA 2ESNA 2RV8A 4L18B 4WX9A 5E1ZB 1UCRA 1PDNC 3WGGA 2WC2A 5E17F 1G3YA 1FBSA 4OIOF 2QYOA 4GGGA 2V1UA 2KJBA 3TQNA 3D5LA 2FMLA 2W24A 3RTRA 2QUFA 4P9UA 3FZVA 1F9NA 2HR3A 2EJRA 3O2PE 5D5XB 4HLYA 1QPMA 2Z5UA 4L9TA 4ESFA 1XGSA 4YFKF 5BQTA 1XSDA 3WTWC 1WI9A 1RNLA 1ULYA 3J7AO 5LRRA 1YG2A 5F6FA 4Q4ZF 1WWXA 4HYEA 1S3JA 3I59B 4O3MA 1ZGAA 5LLQA 1ZGJA 4A6EA 3KE2A 4B8XA 2XAJA 1P4WA 3B02A 4ENJA 2A07F 3F3XA 1SD4A 6PAXA 3DPTA 2LSOA 1R5HA 2BV6A 3KZZA 3V7RA 1T6SA 1O57A 1P4XA 4RB1A 4RS8A 5EEHA 2GZWA 3HOTA 4HDVA 4P9FA 1YW9A 1ZAOA 1O7LA 4KFCA 1B4AA 5ED4A 3AAFA 4H0EA 4ZZDA 1R5GA 3WU1B 2OD5A 4M6YA 3RPQA 5LHGA 1B9MA 4HV6A 2ZCWA 2VE9A 2KIFA
chains in the Genus database with same CATH superfamily
1TT0A 3I3LA 1W5TA 4UVCA 1W7PA 4ETSA 3Q3SA 2DJIA 4XRSG 3W6KB 2M0CA 2WWYA 1VQOI 3LSHA 2XAQA 5DDGA 1YTYA 1MGTA 3Q5FA 2E7WA 3ZQHA 4N9IA 2ADUA 1X1BA 1U5TC 2DFEA 4I6ZA 3BR1A 3NWTA 2CW0F 4IZZA 2TDXA 4QWQA 2Q2EA 4CSWA 4KIFA 5LD2C 3BR0A 1SFUA 3E6MA 1OMIA 3K4LA 4W1UA 1JUMA 1YOVB 5KAFC 1IXCA 1S5LC 1S6LA 2KISA 1H88C 1YO5C 4M6XA 3WTVC 1N25A 3OIQA 4OAZA 4CCOA 4OIPF 2ZBKA 1X4PA 2XIGA 4LLLA 3BTIA 2PMZN 4JOMA 1H9GA 1Y56A 3HSRA 1JJ6C 2VODA 2NOJB 5J4YA 2E2HJ 1YIJI 3KP5A 3L2QA 4IQJA 3ZN0A 1FYLA 1ETVA 4M72A 2HZTA 4D7NA 3M4OJ 5CVIA 4NDLA 3WHBA 1D1CA 1LVAA 1LB2A 2DT6A 2VI6A 2O5RA 3CTAA 3JW4A 1FP2A 3GZNB 4XLHA 1H0MA 4RGRA 1K6OA 2AXTC 4EGZA 2Z2SB 3MKZA 2FF4A 2QSFX 3V8LA 2WY7Q 2V26A 1IW7F 2P5LC 2K02A 3S1RJ 2OUMA 3KYLA 3CDLA 4X6AJ 3HOYJ 2NS0A 2LBFA 4JYKA 1DP7P 1G59A 2X4HA 1X3WB 1FT9A 1KU7A 2IS1A 1QNTA 3OWTA 2QQ9A 3CCSI 1Y0UA 5ICFA 4F92B 1W7PB 2JN6A 2HI3A 2JSCA 3QU6A 2DFHA 1OYYA 4IRGA 1U3EM 1ZLKA 1H89C 2YR2A 2JTVA 5DD8A 2F4OB 5DCMB 2DPDA 4BY7J 4D1QA 2L0KA 4RBOA 5E3LA 4DYCA 3GTPJ 2Q2EB 2HXIA 2X6XA 4AIKA 5L3GA 2HDDA 4EJWA 1IUFA 2RQQA 2VQHA 3QP5A 2R92J 4WK8F 3BZ6A 3CC7I 3GTKJ 2PX9A 1OPCA 3H36A 4L9JA 4CCJA 4UUVA 3FBIB 2OBPA 1ZARA 2ZXJA 1YJNI 5F27A 2DMUA 2YS9A 2Y0SN 4RAGA 1F1ZA 3H3ZA 4BS9A 3L2RA 4ON0A 3VSLA 2JJ7A 2LLKA 3S93A 5FLVA 4U88A 4ZDPA 3A4CA 2VOPA 4Q48A 1U9OA 3OIOA 2V9PA 2L9VA 4I99C 2YPRA 3CJQB 1R00A 4DZPA 3QYEA 1SFKA 1N75A 4FX4A 3OYIA 2W85A 2BW3A 2WV0A 2PQ8A 3ZQ7A 4AUXA 1FIPA 4WXHA 1K78A 1VQKI 2Y30A 1K83J 2LBFB 4CXFA 1DGRM 3GFMA 2B9SA 3I9V2 4XR6A 3RIRA 1KU2A 1YW8A 3TBIA 5JR3A 1IC8A 3P7NA 1S7EA 3A02A 1FYKA 1WHUA 4A3IJ 2P5KA 2XV4S 3IKVA 3V42A 2UWMA 4PJNA 4DNCA 4WWCA 3A2KA 1TQIA 1S72I 2JRTA 4TV7A 2ME0A 2F6CA 5ICEA 1LFBA 3HUGB 1A35A 3BTLA 3PNVA 3R4KA 2VONA 1D1BA 3J80K 4GRIA 3GUDA 1WJBA 4LLGF 1XGOA 4NUBA 3M9AA 3QWLA 2B0LA 1A5JA 1MMAA 3VYSB 3CUQA 1A36A 4GO1A 2EIMH 1J5YA 3HKZA 5FKMA 2Q0OA 4YRVA 1MKMA 4RM3A 5E1XA 2JA7J 1LKXA 1S7OA 3NARA 1B9NA 1TNSA 4FCYA 4XSXF 1EH7A 3KPHA 2H27A 1YW7A 1R6RA 3FXKA 2W84A 4QTRA 3W3CA 3G3ZA 3K4JA 1L0OC 1GT0C 3WTYC 1ZRDA 5CLSA 1JI8A 1GLNA 3DPUA 2ID6A 2QGUA 5L3EA 2EIJH 2Q1ZB 1W36C 1V54H 2EFQA 1Y8RB 1I5ZA 2LK2A 4KYWA 1P4AA 2MLKA 2M8GX 2ZMEA 3DBRB 3O8HA 1HCRA 1FMVA 1IN5A 4F93B 2AS5F 2HEOA 3F9KA 4G94A 3LNQA 2HKOA 5JI6A 3RQIA 3HG9A 2BW3B 4LOCA 1MJAA 1XB4A 2R7XA 1UFMA 2DA6A 2P4WA 3W6JB 1K78B 1VQ9I 1ZN2A 2ZXIA 3JCUC 5HDNA 5KNLA 4Z2YA 2VC0A 2OZUA 2IXSA 3ZMTA 2UZKA 3HOUJ 5K5OA 2EV5A 1Q1VA 3KX2A 5LEJA 1KYWA 5GAGJ 1HKSA 5CJ9A 1D0ZA 1QQIA 5DYMA 1YFHA 1FX7A 1MZBA 2OJED 2LH9A 2P8TA 3GLLA 3MKWB 3AG1H 1YI2I 3EUHA 1UB9A 4JX5A 2X1DA 4RGSA 1T39A 1QPIA 3T1BA 1RETA 1DDNA 3BR2A 1VQLI 2DFFA 3GEZA 3LA7A 3PJRA 3T0YA 4C2MJ 4XLPF 2JK3A 5D6EA 3E5QA 4D0PA 3D5RC 2KLOA 4A3KJ 2VT2A 2M87A 4KNYA 4XLEA 4B48A 5E1WA 3BG3A 1ZLJA 4PZJA 3RSNA 4E7JA 4ESBA 2HZDA 1XPXA 1QVUA 2EZKA 2HKXA 1LEAA 1AU7A 3CUQB 1IGNA 5HNFA 1P6RA 3I4PA 2X6YA 3KEQA 5JHFA 3NQOA 4DZJA 1ZK8A 2L9NA 5F1RA 3LFUA 2XGXA 1IDYA 5IT3A 1E2XA 2K7LA 2E5ZA 3OR2C 5CVVA 3SHFA 1I3AA 3BLYA 1G8XA 3W2VA 3D5SC 5D8LB 4A3JJ 1D1AA 5CYVA 3KFWX 5LGTA 1ZTRA 3H9JA 5DD4A 5F0HA 4N0BA 1IUYA 3I56I 5KHDA 4JBAA 5K7FA 4GYGA 4B09A 2YUSA 2FUG2 3V8KA 3HSFA 1J9IA 1WJ5A 1LFUP 3OL3A 1IN6A 3B6AA 2L02A 4CZCA 2PJPA 2CQXA 1SFXA 3MWMA 3SEQA 3E3VA 3PFIA 3FXQA 2QF7A 1OCTC 2H1LA 2L3DA 1WRJA 5IOZA 2GA1A 1XS9A 3DEUA 3T8TA 4BH9A 4KITB 1CGPA 4NB5A 4F7ZA 2AXLA 4KICA 2DYSH 2HQRA 3G2BA 5KCMA 2WA0A 2F5CA 1J59A 1TNTA 3FMRA 3WHCA 4YG2F 1KQ8A 3TOBA 1XMAA 3HB9A 5ILSA 5HS9A 3WTZA 2CV0A 2R7FA 2MH2A 2WB1A 3QRFF 3DXJF 3OV8A 1TQMA 1TWCJ 2ZNYA 5K7HA 2K85A 1R36A 1ORKA 3I4MJ 2DFIA 2OQGA 1K4TA 3P9IA 5IOYA 5J6XA 2DBBA 1ITYA 3OOUA 4NNJA 1SFOJ 4OOIA 5B1BH 2P6SA 1Y6IA 2ZC2A 1WCMJ 3SQNA 5LRSA 4RB3C 2IGNA 2ZJPF 2GXBA 4LJZF 4A93J 2XKOA 2QKMB 2ZO4A 3ABMH 2FA5A 5DS9A 3QODA 1LFPA 5FB2A 1G3SA 2JWTA 4BUPA 5L3FA 2K9SA 3O3KA 2VXZA 4A0XA 4CCMA 4R1HA 3QPSA 2XDVA 4EQQA 2O8KA 3K1NA 3D0SA 2L54A 1OKRA 1EV7A 1DP3A 1P2FA 2YSRA 3TKYA 5BPDA 2DA2A 2AQEA 1BOAA 1SVMA 2IP2A 4QPOA 3SFIA 4GXOA 4AYBN 2NXNB 3ESWB 3ABLH 2QQ8A 5K5RA 1ON1A 5TJJA 3MZYA 2EA4A 5AONA 2PI0A 1XDSA 3QP6A 1WQ2A 2O6GE 2E1CA 5H20A 2EQRA 4XKBA 4II2A 1T38A 2QLZA 3V7SA 3WODF 4AM3A 1JUSA 4HEA2 1RPWA 1GVJA 3A03A 2XC7A 2XPUA 4FE4A 3LL7A 3ZMZA 4UHTA 2TRTA 5F64A 4GCVA 3RYPA 1F4KA 3F8NA 2CV2A 1U8RA 3BCAA 5L3DA 3GZ6A 4MNUA 4IOAF 1T8IA 3I71A 3PUBA 2IEKA 5L3BA 2JQ7A 3FXJA 3HTSB 3G73A 2GOMA 4WXCA 1O4XA 3HC7A 1K79A 2Y0MA 4L5IA 3ZXSA 1TW2A 2KRFA 3RDIA 2M9HA 2L7ZA 1TBXA 4M9ZA 3S1MJ 4I0AA 2X48A 1IRZA 1TWAJ 2VBZA 3HEFA 4PGHA 4XKWA 2E34A 2LF8A 4OMYA 3BR3A 2NYXA 1B72A 3JTHA 2FBIA 2G9WA 1NG7A 4HAMA 1GXQA 3IRQA 2VJJA 4EATA 1D8KA 4FT8A 4DYQA 3TMOA 2VJ4A 4MHGA 5E3MA 3C2BA 3L7WA 4BQQA 2HS5A 3SZGA 4BQNA 4ZYDA 2JPCA 2MSYA 2DW4A 3QPHA 4IL6C 2HPIA 1FJLA 1KU3A 4BACA 4U7BA 1BI2A 1EH8A 2JVGA 4M3GA 1KONA 3BWGA 4YIRX 4F52A 4XBFA 4PJJA 3CUOA 4O6JA 1LPQA 3UKGA 2Z16A 3R0JA 4IJAA 5GP9A 5M5XJ 2LY9A 4ESJA 3CCRI 1FY7A 1QZEA 3K69A 1IXRC 3A0HC 4IHWA 2VPRA 2VBWA 2K9MA 2KRCA 3EUAA 5F08A 1FYMA 4ANJA 5E8IA 1Z9CA 3SYTA 5HS7A 2D45A 4MLOA 3M3YJ 1OYIA 2IGKA 3GTJJ 3NEUA 3H5NA 2DU9A 2NAZA 2OZ6A 2YU9J 3I54A 3CP8A 3IHUA 1IN4A 2C6YA 5HODA 5LEKA 5EEAA 2ACJA 1CQTA 1HQCA 3F6VA 3GLXA 2DPUA 3FKIJ 1ZG3A 3ECOA 2OCEA 2J5PA 1HDPA 4G7HF 3J81Z 2R7DA 4ZYGA 5BS6A 4ZDOA 2V4JC 2LF7A 2AHQA 4IHYA 4MFEA 2QENA 3FISA 2XRNA 4PCQA 4IVNA 3LA2A 1HBXG 3TGNA 3MN2A 2VB6A 5CVRA 2IJLA 4B44A 1MSEC 3M1EA 5FO5A 3C3WA 2F4MB 2DA4A 2K4BA 5CVJA 1WPKA 1BJZA 1DU6A 3DCFA 1J0RA 1JGGA 4XRMA 1EKEA 1B59A 2QVOA 2Z99A 1B72B 2BE5F 4ZYEA 5HOOA 1JE8A 1S9HA 2D5VA 2M1BA 2EPFA 3QPTA 1ZREA 1QZZA 2DN0A 3I58A 1VQ4I 1FEXA 1BM9A 4HRIA 2DK5A 2JUGA 2TCTA 3KZYA 3KP2A 1RESA 3BTJA 5GAHJ 3IH3A 3GVAA 2DJNA 4KISA 1U5TA 1D8JA 4BQAA 3Q0WA 1JHHA 3DBHB 1YYVA 4LG3A 3K7AJ 4BBRJ 2ZNZA 2DO7A 3OL4A 3CCJI 2ZFUA 2M30A 3DQVC 3VPRA 2AO9A 2H6CA 3RKXA 2EZHA 2NVTJ 2M2EA 4IF4A 1BJAA 3QPLA 2ME6A 4UUSA 3JRHA 4QSHA 2KMUA 3G4SI 5HDKA 1DGWY 2DA3A 2X6WA 3MMYB 4HQEA 3JRGA 1X3ZB 2NVQJ 1VNDA 2EZIA 4A3FJ 5DTDA 2ISZA 4UVAA 4AWXB 1XGMA 1Z77A 4IKFA 5EZGA 2X1CA 2LYCA 2QEXI 3CCMI 2W48A 3KLOA 2E1NA 4EM0B 3J7ZI 3QYBA 4GFBA 3S8PA 3CCQI 3L2VA 1DPUA 2HVSA 4C2TA 1FIAA 2XASA 3HM5A 3G71I 3J80Z 3HDDA 4A3DJ 4XKCA 3ZR8X 4CYDA 2MFZA 1D5YA 2JMWA 3KP7A 4M9XA 1SEUA 3CO7C 1DUXC 1R71A 4HF2A 3F8CA 1YJWI 2MD0A 4A3GJ 2O9LA 2CQNA 3S2HJ 2RDPA 2MC4A 3I5UA 4HLXA 5KAIC 2NRAC 4LK0F 2M4GA 4OU0A 1VQMI 2IVMA 4IHXA 1O3RA 3FF5A 4HOBA 2L4MA 3F0CA 2CUJA 1OR7C 2PEXA 4UVBA 4ENKA 2KHMA 1QRYA 2K3PA 3Q9SA 3F8FA 5DCMA 5IYCJ 4NC8A 4J01A 3CF5F 3FXUA 3B73A 4BDZA 4LB5A 2D2WA 4L0ZB 2L01A 1ERDA 2E35A 4EGYA 1BR2A 2BXYA 1SD5A 1JGSA 3H3UA 1U5TB 2DCEA 1X1DA 3ZQGA 2EFOA 1YJ9I 2WY8Q 2JA2A 4OMZA 2OA4A 2X9DA 4EJVA 2XGEA 1RUOA 2MG4A 2EV0A 5ILUA 4UUSB 3DLAA 1Z7UA 4M71A 5CKTA 4F55A 1L3LA 1GXPA 3ULQB 1T0FC 2STTA 2DODA 1GV2A 1MD0A 2A5YB 3GO5A 4RGXA 4XORA 1HSJA 3ABTA 3CZ6A 4KT5C 2RGVA 4OIRF 2E71A 4DJAA 1W0TA 3H92A 4NHJA 2JZYA 1UELB 2KDOA 2DA1A 4BAYA 2LRDA 3K4KA 1U0JA 4AVPA 3CQZJ 2JRMA 4YEJA 3CMYA 2K3FA 1YHQI 2MH9A 5K5QA 2BY1A 1REPC 3KP6A 4LG0A 2GXAA 1MSFC 3DEEA 1RR7A 1BIAA 2ZKZA 3RZDJ 1KGSA 2FNAA 4I2OA 1RI7A 3VWBA 4IQ4A 1MBJA 3ISPA 3E6DA 1PVEA 4ZTFA 4IRIA 3ZMDA 2D1VA 2DOFA 5J1UA 4BYYA 4HSRA 2M7BA 4S05A 2P7CB 2L2OA 1XCVA 3U1DA 3O6BB 3DBLB 3JSOA 2M3AA 1SVLA 1LE8B 1JT0A 2VUMJ 2A68F 1TT5B 2HYFA 3SJMA 5ICGA 1TC3C 3SDBA 3HUGA 2CS3A 1XDUA 2DMQA 2VE8A 4CYCA 1TZLA 2QCOA 2EBIA 4ZDLA 3OIPA 3J81K 4V2FA 1WH5A 3K4CA 1SANA 2KIUA 5DM7F 3U21A 1VQPI 2RC4A 2K9LA 3CJRB 3PSFA 1MJBA 2V6CA 4Y52J 2D1HA 3LSPA 4BHPA 4HNTA 2EK5A 4WCGA 3U2RA 3T5XA 4R79A 3WE2A 3REOA 4A5NA 4UXNA 5EF6A 3MEXA 3BT9A 3Q0VA 4I02A 4HF0A 5BNGA 1IJWC 2DDAA 1IV6A 2QSGX 3V4GA 3BJOA 1SVOA 3ZQQA 3N4MA 2M8EA 3DU5A 1RUNA 4CICA 2KPMA 4G7ZF 5EYRA 3D1NI 3WTUC 5KVRA 2FQ3A 3L00A 2J5OA 2L7KA 1IO2A 3EETA 3QAHA 2FOKA 3WG7H 3OS2A 4EJOA 2CW7A 2HOTA 3HYIA 1A04A 1HW2A 1HOMA 2E2JJ 2JA5J 2BEOA 3PO2J 1QZYA 2CO5A 3I64A 4LG0B 2ICWG 4BNCA 2HWVA 1POGA 4GDFA 4HX4A 2XHKA 4A3CJ 1J09A 1GUUA 2F5VA 3CMMA 1YQAA 1LDKB 1IRFA 1NH3A 2W82A 2WTEA 5D4SA 1GDTA 2HYJA 5BPIA 1BI1A 3HGGA 4KN7X 2A05A 4XL9A 2IT0A 3HOVJ 5ICCA 2XF6A 2LKSA 3CMEI 3CC4I 3V8JA 5D5VB 4M9SA 3FX3A 1G2HA 4LIVA 1WJAA 2M45A 4QIWN 3GW2A 1VQNI 2E5NA 3HL2A 3SDGA 2R4GA 1VQ5I 1P9QC 3S3MA 1OCOH 2Z33A 3KP4A 3CCVI 4XOTA 4CYCB 1Y1WJ 1PP8F 1W36D 2I10A 4CCLA 3ZP5A 4E7LA 3JAMZ 4IOCF 3P5JA 4M6VA 1ZH5A 4WF2A 4IHVA 2G7UA 3FM5A 2ZSHB 3GF2A 2V1NA 2W57A 1XSXA 1ONVA 3P9CA 2WBMA 1P92A 4HBLA 1D3YA 4PJMA 3FK7A 4B47A 2XSDC 2JUCA 4MEYF 4A0YA 2H6BA 3HOZJ 3BY6A 3BR5A 2F5EA 5A2QZ 2MA3A 2WAFA 1JJ8C 3JR9A 1JXSA 1W5CC 1BOBA 2E60A 4XLNF 1QHHD 2WAQA 1JUPA 5F0CA 3KIOA 1F36A 3CJNA 2MD5A 2HOSA 4BE2A 4HSTA 1U6GA 2FEZA 1F5TA 3MZHA 3FMSA 1B1BA 2PMHA 4DYRA 4FX0A 2DDBA 4M74A 1WKMA 4Y15A 3S3NA 3PQKA 1Y0NA 2NNYA 2P7VB 2H1KA 3HRSA 1TLHB 1WJCA 2IW5A 1SMTA 5J47A 3MQ0A 1ETQA 4PSXA 2PN6A 1R5ID 4HNVA 3HRMA 2A6TA 1PJRA 4ZYHA 1MH4A 1M1EB 3OYAA 2NOGA 4ZTJA 3LFKA 2EFNA 1R1VA 3MFKA 4FISA 1F43A 5M3MJ 2LKPA 4U87A 4H4KC 5H6RA 4IPAA 3ZMVA 1T56A 5L3CA 3ZQCA 4I01A 3OYNA 3KETA 1SFEA 3J7AY 1OQYA 4G9YA 9ANTA 1D0YA 1D5VA 1DQUA 2ZJ2A 1BC8C 4Q47A 3U9GA 5IT9Z 4E7KA 4MQ9F 1ODDA 3JRDA 2VL8A 1E3OC 1G3WA 1ZHFA 2VXDA 2ELHA 3I4NJ 5C3EJ 3DTEA 2FNPA 1IN7A 2PJRA 2L4AA 2OU2A 2LOOA 4RLFA 3H1CA 4UV9A 4QPQA 5DCFA 2RQPA 1AOYA 4JX4A 4IHTA 1IRGA 3ASOH 3DEWA 4KT6A 2XF5A 2WADA 4B1RA 2WV1A 5M5YJ 2XRLA 4CO8A 1VQ7I 3S15J 3HKZN 5EG0A 4A3LJ 4DGWB 5B3SH 3IL2A 1BW6A 1P7IA 2LR8A 3K9TA 4Y13A 3GFLA 1R58A 4XLFA 5C4JJ 3CLQA 4MIMA 4XLCA 5M3FJ 1R1TA 5LHHA 3FXOA 2BYVE 3K1MA 2ZFWA 3MCZA 2CGPA 4RAYA 2GIVA 3K0LA 2RNJA 2IGMA 1JTYA 1HA8A 1ETYA 3H35A 2JT1A 3OYHA 3DTIA 1BR4A 3SZPA 2ZMEC 5IPAA 1JT6A 3CCUI 3GMEA 1ZG1A 4ZZLA 1U9NA 3IAM2 2EH3A 4JQFA 4RAFA 2CWEA 1X1CA 5J3LA 2GWRA 4B3AA 3I0TA 2DQRA 1O7FA 2R5ZA 4OINF 3O8GA 3ZRGA 2Y75A 4XK4A 3JRBA 2VKHA 1X2NA 1KA8A 2KZVA 4N4NB 4BY1J 1FOXA 2LC2A 3N97A 3GTMJ 3FHZA 3LSRA 1MBFA 4BJTA 1A31A 3LSKA 1SD6A 3BZKA 2XAUA 4BJ5C 4KA4A 1I6HJ 1UAAA 5B1AH 3LSTA 3BPXA 2PJRB 4D5FA 1APLC 4IHSA 1AA7A 3VEPA 2KP6A 2X51A 2Y31A 3WG9A 4MO7A 1FPQA 1LDDA 2DI3A 4XMYA 5HLTA 3OYFA 3BG9A 1ZQ3P 2JVHA 5AIPA 5DM6F 3DU6A 2KT0A 4PFPA 2R7WA 1OCCH 2A69F 1I1GA 3BDDA 2M4KA 1E0EA 5IP6A 3CDIA 5FD6A 5EG0B 1Z0XA 3BOQA 4A3BJ 2W1OA 3PFYA 1BC7C 1RR8C 2FXAA 3I55I 3C2HA 1S8NA 1OJLA 1LVKA 2IS2A 2OV7A 2STWA 3GBGA 2R7UA 3JRIA 2ETHA 5BMZA 1I50J 3JAMK 1J7KA 3S14J 3OS1A 3M7GA 2P5VA 3GFJA 2QZ8A 2XKPA 2HVRA 3TDZC 1XG1A 4CGZA 2F4IA 5EGOA 3M8JA 1R49A 3PM1A 5F0FA 2BOLA 1MBKA 2M34A 3VB2A 2DYRH 1DPRA 5LHIA 5A2QK 2OCCH 1I1SA 2IRFG 1SMYF 2E1MC 4AVZA 4I09A 2QKLB 1MJ9A 2R5ZB 2BHZA 3HRUA 4BGDA 5ILVA 1VI0A 1WJDA 4UB6C 4C2UA 2OPTA 4G6TB 3CCEI 1IF1A 2VN2A 1CF7A 5FKKA 2BY2A 1U2WA 1X58A 2DT5A 2IS4A 1HF0A 2O03A 3OYGA 4PK4A 4ZJZA 4AIJA 2JA8J 5TISC 2FQ4A 2XPWA 4HPQA 2CSOA 3AG4H 5LGUA 2LFBA 3IWFA 1YITI 1BR1A 2VQCA 4PDKA 5B5EC 2WB1N 2FMYA 4X1EA 1EF4A 4Y7NJ 2FU4A 4C30A 2DOAA 2KKOA 1VQ8I 1I3QJ 4BQOA 4S04A 1N78A 5TGTA 1ON2A 1ZYRF 3WU2C 3G1OA 1WFXA 2CQ7A 4PSWA 2R3SA 1NG6A 2QQAA 4RAZA 1EJ9A 2F2EA 2XB0X 3PIPF 2HYGD 3BPVA 2ZSIB 3VYRB 3CJTB 4V2GA 2QSHX 3J7YJ 2ID3A 5LFAA 5IT9K 4NBQA 4HG2A 3V7CA 1UHWA 4C3IJ 3LQRA 3F23A 1QVTA 2IBDA 4RM2A 5K1YA 3VODA 1SC7A 4I98B 4N9HA 1GV5A 4Y4RA 2I5UA 5J1RA 3IKTA 2VBYA 4PFOA 4EVIA 2O0YA 1LEBA 5EGOB 3OYMA 1AKHA 2LG4A 4II3A 2FOWA 1N77A 3BTCA 4DOZA 2A3SA 5E3NA 2XB5A 2FSWA 2F48A 3C1DA 4CH7A 1XMKA 1Y8QB 3ZCOA 2PMUA 1YLFA 2DLLA 1FSEA 2XAGA 4F3QA 5F1JA 5CQEA 4EV0A 4ZYAA 3BQZA 3QU3A 3FDYA 3S3OA 3QOEA 1JTXA 2N8GA 3AG3H 3WU0A 4J19A 1CF7B 1ZG5A 3GXOA 3IRRA 5H2FC 4M3FA 2Y2ZA 4YIFA 1JHFA 4DW6A 1Z05A 1V3FA 2L9RA 5E20A 3OS0A 1FTZA 3LAPA 3BROA 1FLIA 2R7RA 1ZR4A 4WXDA 3KLNA 4DIQA 2EZLA 1MNEA 3G1LA 4CDGA 4KN4X 4XN3A 1KQ9A 4V19K 3K70C 4BE1A 5HVQC 2ZXHA 4B43A 2LP0A 1B8IA 2AQFA 1ETKA 3A01B 3KP3A 2GIZA 2IAIA 4LGWA 2PG4A 4XQFA 4M3BA 4XKVA 5FFZA 4EM2A 1WSUA 2GLOA 3S2WA 2EB7A 4J00A 2W00A 3WTSC 5J1YA 1HLVA 1IAWA 1HKTA 1Z1DA 4XRFA 1WI3A 3BG5A 1OR7A 2Y9ZA 5FD5A 4A12A 2F5FA 5FLXK 1G6NA 2EV6A 4IEJA 4KIGA 5BOXA 3VYUB 2QA4I 3W6VA 2V1DA 1NK2P 3HXLA 1FZPB 1X3UA 1XGNA 1LDJA 2KIMA 5M5WJ 3MKYB 2WAEA 5IYDJ 4M3DA 1MIJA 1VF9A 4BHCA 4AU7A 1LJ9A 4EJTA 4CA0A 4M73A 2M0MA 2DQLA 3ROUA 4BXUA 2V1XA 4B4CA 3H9QA 3TP3A 4ZH4F 2XAFA 2BY3A 2PMZA 4E70A 1AKHB 2DT7B 4Q5SF 1FBQA 2HOAA 3VFZA 1AHDP 1FP1D 1OISA 4PJLA 2GQQA 4RMNA 2UXXA 4MTEA 1OFCX 1R1UA 3S32A 1T0FA 4E4HA 1Z7LA 1MMGA 1Z21A 4BJ6C 3H3VK 2RVCA 5GAEJ 3AL0C 1MNDA 2K86A 2DXIA 3F8BA 4AC0A 1HW5A 2CFOA 2EFWA 3HJEA 3PQJA 3LSJA 1U78A 1HXDA 3IH4A 2R5YA 2MW8A 2HU9A 3TP0A 2HQAA 1PUFA 3MKLA 3L2CA 3OYCA 1VFCA 2BZTA 3ZN1A 3ZQLA 1USTA 3JSPA 4AIHA 3COAC 3MZ8A 1T2KA 2Y69H 4P1WA 4LB6B 5E18F 4G6DA 2DAOA 3EUKL 4G12A 1BN5A 2DMTA 2F5DA 2IA2A 3DP7A 1J75A 3S17J 4HNUA 1LE8A 4XSZF 2HQNA 3E5UA 1XCBA 3HGYA 3TDUC 1B8IB 4U0VA 1W1WE 2HVQA 3S1NJ 3QYFA 2DA5A 1YRNA 5D6FA 1UJ8A 3CO6C 1K7AA 1JKQC 3SZTA 3OYLA 4IRHA 4HA8A 2KZGA 1MNMC 1MMDA 3DKWA 3EYYA 4XRSA 3GFIA 2Y48A 3E5XA 4P5OA 3KEOA 3UR3C 3ASNH 2YU3A 2R0QC 1Z6TA 2FRHA 4AD9A 1K4SA 3M8EA 4RB0A 2OC6A 2MLGA 2VLAA 1RIOH 3FK6A 2V79A 1A6IA 4PJ0C 3T8RA 4CHUA 2M7AA 3SXYA 5JHUA 2FJ1A 2VJ5A 2V9KA 3IC7A 3H5RA 4HV5A 3L1PA 3DFGA 2GBYA 3HHGA 4A0ZA 5F04A 5JVTA 5D4RA 1NK3P 3EPZA 4S0HB 4YIIA 2E19A 5FGMA 3LOCA 3LSGA 3I53A 2QM3A 4KMFA 5D5UB 3K2ZA 3CLOA 2XPVA 2Y0SA 3FM3A 2HDCA 1YE9A 5FROA 2RNGA 1XN7A 2EINH 2VOOA 4BXXJ 1W7PD 3S16J 1O3TA 2BGCA 2KFDA 2GXGA 3LA3A 4XIDA 4L9NA 4BKXA 2ZJRF 3F8MA 3HZJA 5IY5H 4A5MA 1PUEE 1ZGWA 1V5EA 3RKWA 3ZQIA 3CD6I 4JK1X 3GWZA 1NTCA 1V5FA 5EZHA 2R5YB 3TW7A 1KZHA 4A69C 4OAYA 1VQ6I 3PIOF 4ITVA 1PUFB 4LFUA 1V5GA 3HTUA 2R7VA 2ZXWH 4UV8A 3GX4X 3Q0UA 3CCLI 1E17A 2NS8A 3ZPLA 2DTRA 4LIUA 4A6DA 4XICA 3VOEA 4C3HJ 5FRNA 3A0BC 2E1OA 3RPUA 2KJCA 1YX3A 3ABKH 3IP4B 4I7HA 3BR6A 3E7LA 1YRNB 2MABA 2LY2A 2LKXA 3TO9A 2LREA 2VE9A 4HDUA 4B3XA 4ZC3A 1XD7A 2I8DA 3IV5A 1AWCA 5J40A 1MBEA 1MH3A 4FHTA 4Z6YA 2HTSA 1ETOA 4MQVA 4MEXF 2O61A 5IYBJ 2MBFA 1OCPA 4UB8C 4EM1A 4X0GA 4O5VA 2DK8A 3E0JB 1OYWA 1VZ0A 4FQGA 2OAZA 3F21A 3GZ5A 4UY8I 1Z67A 3KZIC 1ACIA 1X19A 2A6HF 1LQ1A 2V6EA 3RPUD 4EMSA 1USSA 4NC6A 1Q1HA 4L5JA 3H5AA 3WGHA 3W2WA 5LBQA 3RQ4A 1YS6A 2XGDA 2R7ZJ 1SD7A 2H09A 2OQRA 3M07A 2NNNA 4BU2A 4UNOA 2VC1A 2CMPA 1W5SA 2VQLA 4M3EA 1IRXA 3TW6A 3ML6A 2Z9OA 3CMAI 2K5CA 1FOKA 3R6SA 3KYCB 4FE7A 4BE0A 3CDHA 3R61A 3K10A 5D8KB 1ZRCA 2DA7A 1TL8A 2G7HA 5HLHA 3R60A 3DKYA 1YX5A 4NC7A 4RB2C 1WJEA 1O3SA 2W25A 3DF8A 5ERIA 4L9VA 3OYKA 1TWHJ 3L9FA 5FKNA 4MTDA 3PSIA 3A1YA 3GYHX 3IWZA 3E6BA 4Y17A 2HGCA 2GA2A 1IN8A 2CFXA 2K4JA 5C4XJ 3PO3J 1FC3A 4UUTA 2Y9YA 2G0EA 5KK1A 5D5WB 2RKHA 3HPHA 3OR1C 2EA2A 4ASNA 3TO6A 1MBGA 1QO0D 1Z3YA 4FTHA 1KYZA 5HNHA 1D0XA 3L09A 4A2UA 1R4NB 4EEFG 5E3OA 2CUEA 5GPCA 1TTYA 3B6CA 3ECHA 3JRCA 1ZELA 4U0WA 1E3PA 3K1PA 4RDUA 3F22A 2L7FP 4EJUA 4PUSA 4LLNA 5CVUA 2LDUA 3OSGA 2ECBA 1DU0A 2H8WA 3X2QH 4ENNA 2RREA 2LNBA 2R7OA 3NWSA 3RYRA 2UV1A 2K9QA 2KIQA 3ABUA 3BG6A 4PGGA 3VYTB 3VSKA 2K27A 1I6XA 1WGXA 2RN7A 2VT3A 4LMYA 2IPQX 2HFHA 4XN0A 1KU9A 1G3TA 4JP0A 3DWLE 5H6QA 2UXNA 3BQYA 3K4NA 3TO7A 3H0DA 2CV1A 1XSVA 4YFXF 1W0UA 1GVDA 3ELKA 4GYIA 1MDMA 4DQ2A 3JRFA 2VPLA 1WH7A 3BCBA 1RKWA 1WZ2A 3S1QJ 2FBKA 5DUKA 1FTTA 4CZZA 3FXRA 2Q8KA 1Z3XA 3MVPA 4E7HA 4Y3OA 3OMYA 1T95A 5FJ8J 2IA1A 3OOPA 2BVMA 2CUZA 3WGIA 2XROA 3RJPA 1B6AA 1J2XA 3MD2A 2PBIA 2VQGA 3PNYA 2V9VA 1H8AC 3ONQA 5GPAA 3WTTC 1ETWA 4QLCU 3GTGJ 2P0WA 1X2MA 1FSHA 3F72A 1ZRFA 4IXAA 4E7IA 2COMA 2XUBA 2FE3A 4YFNF 2CW8A 3QQAA 4F91B 2YX7A 2X1EA 5K7ZA 2L5QA 4BL0B 2HOEA 2KRHA 1OLTA 4HX8A 5GTHC 4KDPA 3CCYA 1TP4A 3DPLC 2NS7A 1R23A 4KJZA 4U7DA 2H94A 2EIKH 5J8CA 4ENMA 1EH6A 1BI0A 3P9KA 2BHYA 2GAUA 3DLLF 3FWEA 5J8FA 2VKDA 3CUQC 1QA6A 1FBUA 3SEZA 3ZOBA 4U0YA 1UG0A 1LUJB 1X1AA 3EQLF 1S29A 4HF1A 3HOWJ 2O3FA 3JTGA 3HOSA 3HSEA 4NQWA 4FASD 1HSTA 3LQQA 1HKQA 1IG7A 2QBYA 3DKXA 1LNWA 3FHNA 2XSJC 2CRGA 2ESHA 4RLQA 4MFDA 4OIQF 4HQMA 3ERED 1QU3A 4HW0A 3H0GJ 3RKYA 2OTJI 1K6YA 5GADJ 2QQBA 2WAQN 3SFZA 5LGNA 3LMMA 2O8XA 4DBRA 4KIBA 1SAXA 4CCNA 3W2AA 1MDMB 1OCRH 1WVRA 2O7OA 2E2IJ 4KMUX 1RKTA 3CC2I 3MAJA 4P96A 4LD5A 4AYBA 4G8XA 3IUOA 3IH2A 3VDXA 1R22A 1RRJA 2XGCA 1QGPA 3FBNB 3G1MA 3L2UA 3HOXJ 2ZMEB 1RC9A 4A3MJ 2KL4A 2CJJA 2FBHA 1UZCA 1Z91A 3G6EI 3TL4X 5FKLA 5JLWA 1IV8A 1PYVA 1XC5A 4FETA 2CQKA 2OTLI 3NRVA 2HDWA 5FLXZ 2UUZA 1IDZA 1YS7A 2BY0A 3EUHC 4L0YB 1XX5A 2W7NA 3E97A 3OYBA 2CG4A 2VIXA 2HPMA 3L2WA 2B7EA 4IO9F 3HPGA 2R7QA 3WE3A 5HLGA 2JPBA 4C3JJ 3KYDB 1R4MB 2CU7A 1G4DA 4E6KG 1C0WA 3C18A 2IS6A 5DV5A 2HTJA 2P6TA 5HS8A 2EWNA 1FNNA 3NAUA 1H9TA 2M5WA 3C7JA 2COBA 5IP7J 1BA5A 4LK1F 4IX7A 1Z6RA 4C9YA 1R9TJ 1NHAA 2BVLA 3QOPA 5IP9J 2L7MP 4NQWB 4G6QA 1A6QA 1HW1A 1TW3A 3JRAA 1Y39A 2QBYB 2ZB9A 1YIOA 4HX7A 1KQ0A 5E8GA 3E6CC 3FMQA 1SAUA 5CPRB 4A3EJ 4HZFA 3RI4A 2EFPA 2W4SA 3RKQA 2NVUB 3ZQFA 5JFRA 4XM3A 2A6EF 2DTZA 3KCCA 1MW7A 4I0BA 3HIFA 1E3HA 1O3QA 1T08B 2YX4A 1ZR2A 1GHCA 1VTNC 1EA3A 2FX0A 3K6GA 1MMNA 3EDPA 1I27A 2DMPA 4N4OB 2MGQA 1V55H 3Q9VA 1RZ4A 3HHHA 1BIBA 3TEDA 2PLYA 2R93J 4I76A 2E7XA 2GOXB 1UG2A 3BP8A 4ABZA 2BBYA 2HQ5A 4G7OF 1BBYA 2E1MB 1JKRC 3UNGC 5HDGA 4BEHA 3HRTA 3R0AA 3OSFA 3GTOJ 2QWWA 2A61A 1FOYA 1T98A 2P81A 3DV8A 1W4MA 2XAHA 3BJAA 4KUMA 1MBHA 4MGRA 3OYDA 4D7MA 2MYSA 1TQPA 2BXZA 5EEGA 3IAS2 3BC8A 4P55A 5GTIC 4R8HA 2HNHA 4E7ZA 2R7SA 3LSMA 4BBSJ 3M8FA 3A01A 2CUFA 3K2AA 2VKEA 2RAEA 1JKOC 2ISYA 2R7TA 4RGUA 5TRDA 4CUGA 2Z3YA 2XVCA 1ZKGA 2ZJQF 2CQQA 3ZMSA 1UMQA 3LWFA 5FFXA 1STZA 3H9GA 3WTXC 1QBJA 5DEQA 3BJ6A 4D9JA 3ZMUA 3JREA 2IA0A 2X85A 1BI3A 1QHGA 2LVSA 1TWGJ 1V4RA 3I59A 3K4BA 4XLAA 1HC8A 1FWZA 2JSPA 3ZGKA 3F6OA 2GM4A 4BXFA 1S7AA 1T33A 1XMXA 3LAJA 1K61A 4XONA 2X6OA 2V7FA 5EDNA 2DOEA 5DUIA 4K2EA 2PFBA 5AIQA 4OWRB 1WJFA 1PP7U 2KDZA 1JKPC 2CYYA 1UHMA 2MC3A 3TOAA 1R7JA 2VBXA 3PUFA 2NVYJ 2X0LA 5HLIA 5JLXA 3K4MA 1FMWA 3KEYA 3K70D 3CESA 4JX6A 1IZ1A 3U1KA 1IXSB 2VKVA 3FKJA 3EYIA 3LSIA 2ESNA 2RV8A 4L18B 4WX9A 5E1ZB 1UCRA 1PDNC 2FD5A 2EILH 3WGGA 2NVXJ 2IGOA 2WC2A 3RZOJ 4RA2A 5E17F 2A5WA 1G3YA 1FBSA 2E36A 3AG2H 4OIOF 2QYOA 4GGGA 2V1UA 2K9NA 2DMNA 2KJBA 3CF2A 4BEHB 3TQNA 5JVGF 3D5LA 4XOPA 2FMLA 2Z1DA 2W24A 3S2DJ 3RTRA 1X1PA 2QUFA 1I39A 4P9UA 3FZVA 5E79C 2XF7A 1F9NA 2HR3A 5FKOA 4AIDA 2EJRA 3O2PE 5D5XB 4HLYA 3GTQJ 1QPMA 1OCZH 2Z5UA 3FXMA 4L9TA 4ESFA 3AKZA 1XGSA 3HBLA 4YFKF 5BQTA 2ECCA 3AFHA 1XSDA 3WTWC 1WI9A 1RNLA 1ULYA 1ENHA 3ERMA 3J7AO 5LRRA 1X4OA 1YG2A 1BW5A 5F6FA 4Q4ZF 3E1SA 1WWXA 2CH0A 4HYEA 4Y33A 1Y1VJ 4D5CA 1P7JA 1S3JA 3I59B 4O3MA 1ZGAA 3PNTA 2LY1A 1ZGJA 4A6EA 5LLQA 2B63J 3KE2A 4B8XA 2XAJA 4CCKA 1P4WA 1MMSA 3CP2A 3B02A 3C2GA 3OYJA 4ENJA 2A07F 3N05A 3F3XA 4BDYA 1SD4A 1HDDC 6PAXA 1UHSA 4W97A 5J4VA 5C44J 2KQRA 2VASA 3DPTA 1U8BA 2LSOA 1R5HA 2BV6A 3KZZA 3V7RA 1T6SA 4LITA 1O57A 1P4XA 4RB1A 2H8RA 5FRMA 4RS8A 4XNFA 2ELKA 3DTKA 3RCOA 1XTAA 2LTPA 4DBQA 5EEHA 3FIWA 2GZWA 3HOTA 4HDVA 4P9FA 1YW9A 2L9SA 2OF7A 1ZAOA 1O7LA 3M1CA 1TWFJ 3PL8A 4KFCA 3AL0B 1B4AA 5ED4A 3AAFA 1BL0A 5CQGA 5B66C 4ZZDA 4H0EA 3BG7A 2JA6J 1R5GA 3GCMA 5FLMJ 3WU1B 5EJCA 2OD5A 4M6YA 4E7SA 2K40A 3RPQA 1ETXA 3FXLA 2ELJA 3BZCA 4L5EA 2HXOA 5LHGA 3GTLJ 3OY9A 2LD5A 1B9MA 4YELA 2LMDA 4HV6A 1FOWA 2ZCWA 3OYEA 4BHBA 2KIFA 2VJIA
chains in the Genus database with same CATH topology
1W5TA 4UVCA 1W7PA 4ETSA 3W6KB 2WWYA 2XAQA 5DDGA 1YTYA 1MGTA 3Q5FA 2E7WA 4N9IA 2ADUA 1U5TC 2CW0F 2TDXA 4QWQA 2Q2EA 4KIFA 1SFUA 3E6MA 1OMIA 1IXCA 1S6LA 1YO5C 4M6XA 3WTVC 4OIPF 2ZBKA 2XIGA 4LLLA 1H9GA 3HSRA 2VODA 3KP5A 3ZN0A 1FYLA 4M72A 2HZTA 5CVIA 1LVAA 1LB2A 3CTAA 3JW4A 1FP2A 1H0MA 4RGRA 1K6OA 4EGZA 2FF4A 3V8LA 1IW7F 2P5LC 2K02A 2NS0A 1DP7P 2X4HA 1FT9A 1KU7A 1QNTA 2QQ9A 1Y0UA 5ICFA 1W7PB 2JSCA 3QU6A 1OYYA 4IRGA 1U3EM 1ZLKA 2YR2A 2JTVA 5DD8A 5DCMB 2DPDA 4AIKA 5L3GA 4EJWA 3QP5A 4WK8F 3BZ6A 1OPCA 4UUVA 4L9JA 2OBPA 1ZARA 2ZXJA 1F1ZA 3H3ZA 4ON0A 4U88A 2VOPA 4Q48A 2YPRA 1R00A 4FX4A 2W85A 2WV0A 2PQ8A 3ZQ7A 4WXHA 1K78A 4CXFA 3GFMA 3RIRA 1KU2A 1YW8A 5JR3A 3P7NA 1FYKA 2P5KA 2XV4S 3IKVA 2UWMA 4DNCA 4WWCA 1TQIA 2JRTA 4TV7A 5ICEA 2VONA 3R4KA 3J80K 3GUDA 4LLGF 1XGOA 3M9AA 2B0LA 3CUQA 4GO1A 1J5YA 2Q0OA 1MKMA 5E1XA 1S7OA 1B9NA 1TNSA 4XSXF 1EH7A 2H27A 1YW7A 2W84A 3G3ZA 1L0OC 3WTYC 1ZRDA 5CLSA 5L3EA 2EFQA 1I5ZA 4KYWA 1P4AA 2MLKA 2ZMEA 1IN5A 2AS5F 2HEOA 4G94A 2HKOA 5JI6A 1MJAA 1XB4A 1UFMA 2P4WA 3W6JB 1K78B 1ZN2A 5HDNA 4Z2YA 2VC0A 2OZUA 3ZMTA 2UZKA 5K5OA 2EV5A 5LEJA 1KYWA 1HKSA 5CJ9A 1QQIA 5DYMA 1YFHA 1FX7A 1MZBA 2P8TA 3EUHA 1UB9A 4RGSA 1T39A 3T1BA 1DDNA 3GEZA 3LA7A 3T0YA 4XLPF 5D6EA 3E5QA 4D0PA 2VT2A 2M87A 4KNYA 5E1WA 1ZLJA 4PZJA 4ESBA 2HKXA 1LEAA 3CUQB 1P6RA 3I4PA 3KEQA 3NQOA 5F1RA 2XGXA 5IT3A 1E2XA 2K7LA 5CVVA 3SHFA 5D8LB 5CYVA 3KFWX 5LGTA 5DD4A 4N0BA 1IUYA 4JBAA 4GYGA 4B09A 3V8KA 3HSFA 1J9IA 1IN6A 2L02A 2PJPA 1SFXA 3MWMA 3E3VA 3PFIA 3FXQA 2L3DA 1WRJA 2GA1A 3DEUA 3T8TA 4BH9A 1CGPA 4NB5A 4F7ZA 2AXLA 4KICA 2HQRA 2F5CA 1J59A 1TNTA 3FMRA 4YG2F 1KQ8A 3TOBA 1XMAA 5ILSA 3WTZA 5HS9A 2R7FA 2MH2A 3QRFF 3DXJF 3OV8A 1TQMA 2ZNYA 1R36A 2DFIA 2OQGA 3P9IA 5J6XA 2DBBA 4OOIA 2P6SA 4RB3C 3SQNA 5LRSA 2GXBA 4LJZF 2XKOA 2ZO4A 2FA5A 5FB2A 1G3SA 5L3FA 3O3KA 2VXZA 4A0XA 4R1HA 4EQQA 3K1NA 3D0SA 2L54A 1OKRA 1EV7A 1P2FA 2YSRA 3TKYA 5BPDA 1BOAA 2IP2A 4GXOA 5K5RA 1ON1A 5TJJA 3MZYA 2EA4A 5AONA 2PI0A 1XDSA 3QP6A 1WQ2A 2O6GE 2E1CA 5H20A 1T38A 2QLZA 3V7SA 3WODF 1GVJA 3ZMZA 4UHTA 5F64A 4GCVA 3RYPA 1F4KA 3F8NA 1U8RA 5L3DA 3GZ6A 4MNUA 3I71A 5L3BA 3HTSB 3G73A 4WXCA 1K79A 2Y0MA 4L5IA 1TW2A 2KRFA 3RDIA 1TBXA 4M9ZA 4I0AA 2VBZA 4PGHA 4OMYA 2LF8A 2NYXA 3JTHA 2FBIA 2G9WA 4HAMA 1GXQA 3IRQA 1D8KA 4FT8A 4MHGA 3L7WA 2HS5A 4ZYDA 2JPCA 3QPHA 2DW4A 1KU3A 4U7BA 1BI2A 1EH8A 3BWGA 4XBFA 3CUOA 4O6JA 3R0JA 4IJAA 4ESJA 1FY7A 3K69A 1IXRC 2VBWA 1FYMA 5E8IA 1Z9CA 5HS7A 2D45A 1OYIA 3NEUA 2DU9A 2NAZA 2OZ6A 3I54A 3IHUA 1IN4A 2C6YA 5LEKA 2ACJA 1HQCA 3F6VA 3GLXA 2DPUA 1ZG3A 3ECOA 2J5PA 4G7HF 3J81Z 2R7DA 4ZYGA 5BS6A 2LF7A 2QENA 2XRNA 4PCQA 4IVNA 3LA2A 1HBXG 3TGNA 5CVRA 2IJLA 3M1EA 5FO5A 3C3WA 2K4BA 5CVJA 1J0RA 1B59A 2QVOA 2Z99A 2BE5F 4ZYEA 5HOOA 1JE8A 2M1BA 3QPTA 1ZREA 1QZZA 3I58A 1BM9A 2DK5A 3KZYA 3KP2A 3GVAA 1U5TA 1D8JA 4BQAA 1JHHA 1YYVA 2ZNZA 2DO7A 2M30A 3DQVC 2H6CA 3RKXA 4IF4A 1BJAA 5HDKA 4HQEA 2ISZA 4UVAA 4AWXB 1XGMA 3KLOA 2E1NA 4EM0B 1DPUA 2XASA 3J80Z 4CYDA 3KP7A 4M9XA 3CO7C 1DUXC 4HF2A 3F8CA 2RDPA 3I5UA 4HLXA 2NRAC 4LK0F 4OU0A 2IVMA 1O3RA 3FF5A 4HOBA 2L4MA 2PEXA 4UVBA 4ENKA 3Q9SA 3F8FA 5DCMA 3FXUA 3B73A 4LB5A 2D2WA 4L0ZB 2L01A 4EGYA 1SD5A 1JGSA 3H3UA 1U5TB 2EFOA 4OMZA 2OA4A 4EJVA 1RUOA 2EV0A 5ILUA 1Z7UA 4M71A 1L3LA 1GXPA 3ULQB 2STTA 1MD0A 2A5YB 3GO5A 4RGXA 1HSJA 3ABTA 4KT5C 2RGVA 4OIRF 3H92A 4NHJA 2JZYA 4BAYA 4AVPA 2MH9A 5K5QA 1REPC 3KP6A 4LG0A 1BIAA 2ZKZA 1KGSA 2FNAA 4I2OA 1RI7A 3ISPA 3E6DA 4IRIA 3ZMDA 2D1VA 4BYYA 4S05A 2P7CB 1XCVA 3U1DA 3O6BB 3JSOA 2A68F 2HYFA 5ICGA 3HUGA 1XDUA 2VE8A 3J81K 2KIUA 2RC4A 1MJBA 2V6CA 2D1HA 4BHPA 2EK5A 4WCGA 3U2RA 3T5XA 4R79A 3WE2A 3REOA 4A5NA 4UXNA 3MEXA 4I02A 4HF0A 3V4GA 3BJOA 3N4MA 2M8EA 1RUNA 4CICA 4G7ZF 3WTUC 5KVRA 2FQ3A 3L00A 2J5OA 3EETA 3QAHA 2FOKA 4EJOA 3HYIA 1A04A 1HW2A 2BEOA 1QZYA 2CO5A 3I64A 4LG0B 4BNCA 2HWVA 4HX4A 2XHKA 1YQAA 1LDKB 1IRFA 2WTEA 5D4SA 5BPIA 1BI1A 4KN7X 2IT0A 5ICCA 3V8JA 5D5VB 4M9SA 3FX3A 2M45A 3GW2A 2Z33A 3KP4A 1PP8F 3ZP5A 3JAMZ 1ZH5A 4WF2A 2G7UA 3FM5A 3GF2A 2W57A 1XSXA 1ONVA 3P9CA 1P92A 4HBLA 1D3YA 4A0YA 4MEYF 2H6BA 3BY6A 5A2QZ 2F5EA 2MA3A 1JXSA 4XLNF 3CJNA 2MD5A 1U6GA 2FEZA 1F5TA 3MZHA 3FMSA 1B1BA 2PMHA 4FX0A 4M74A 1WKMA 4Y15A 3PQKA 2NNYA 2P7VB 3HRSA 1TLHB 2IW5A 1SMTA 3MQ0A 2PN6A 3HRMA 4ZYHA 3LFKA 2EFNA 1R1VA 3MFKA 2LKPA 5H6RA 4IPAA 3ZMVA 5L3CA 4I01A 3KETA 1SFEA 4G9YA 1D5VA 2ZJ2A 1BC8C 4Q47A 3U9GA 5IT9Z 4MQ9F 1ODDA 1G3WA 1ZHFA 2ELHA 2FNPA 1IN7A 2L4AA 2OU2A 4UV9A 5DCFA 2RQPA 1AOYA 4IHTA 1IRGA 4CO8A 3IL2A 3K9TA 4Y13A 3GFLA 1R58A 1R1TA 5LHHA 2BYVE 3K1MA 2ZFWA 3MCZA 2CGPA 4RAYA 2GIVA 3K0LA 2RNJA 2JT1A 3SZPA 1ZG1A 4ZZLA 4JQFA 2CWEA 2GWRA 3I0TA 2DQRA 1O7FA 4OINF 2Y75A 1KA8A 3N97A 3FHZA 1SD6A 4KA4A 3LSTA 3BPXA 4IHSA 3VEPA 4BHBA 3WG9A 1FPQA 1LDDA 2DI3A 5AIPA 2A69F 1I1GA 3BDDA 5FD6A 3BOQA 1BC7C 2FXAA 1S8NA 2STWA 2ETHA 5BMZA 3JAMK 1J7KA 3M7GA 2P5VA 3GFJA 2QZ8A 2XKPA 3TDZC 4CGZA 3VB2A 1DPRA 5LHIA 5A2QK 1I1SA 2IRFG 1SMYF 4I09A 1MJ9A 3HRUA 5ILVA 1IF1A 2VN2A 1CF7A 1U2WA 2DT5A 2O03A 4AIJA 2CSOA 5LGUA 3IWFA 4PDKA 2FMYA 2FU4A 2KKOA 4S04A 1ON2A 1ZYRF 2R3SA 2QQAA 4RAZA 2F2EA 2HYGD 3BPVA 5IT9K 3V7CA 1UHWA 3LQRA 3F23A 5K1YA 3VODA 4I98B 4N9HA 3IKTA 2VBYA 4EVIA 2O0YA 1LEBA 2A3SA 2FSWA 3C1DA 1XMKA 2PMUA 1YLFA 2DLLA 1FSEA 2XAGA 4EV0A 3QU3A 3WU0A 1CF7B 1ZG5A 3GXOA 3IRRA 4YIFA 1JHFA 1Z05A 1V3FA 5E20A 3LAPA 3BROA 1FLIA 4WXDA 3KLNA 4CDGA 4KN4X 1KQ9A 5HVQC 3KP3A 4LGWA 2PG4A 5FFZA 4EM2A 1WSUA 3S2WA 2EB7A 3WTSC 1IAWA 1HKTA 1Z1DA 4XRFA 1OR7A 5FD5A 4A12A 2F5FA 5FLXK 1G6NA 2EV6A 4KIGA 5BOXA 2V1DA 1FZPB 1XGNA 1X3UA 1LDJA 2KIMA 4BHCA 1LJ9A 4EJTA 4M73A 3ROUA 2DQLA 4BXUA 2V1XA 4ZH4F 2XAFA 4E70A 4Q5SF 1FBQA 3VFZA 1FP1D 2GQQA 2UXXA 4MTEA 1R1UA 1T0FA 2RVCA 2K86A 3F8BA 1HW5A 2EFWA 3PQJA 1U78A 1HXDA 3L2CA 3ZN1A 1USTA 3JSPA 4AIHA 3COAC 1T2KA 4LB6B 5E18F 4G6DA 2DAOA 1BN5A 2F5DA 2IA2A 3DP7A 1J75A 4XSZF 2HQNA 3E5UA 1XCBA 3TDUC 4U0VA 5D6FA 3CO6C 1K7AA 3SZTA 4IRHA 4HA8A 3DKWA 3EYYA 3GFIA 2Y48A 3E5XA 4P5OA 3KEOA 2YU3A 1Z6TA 2FRHA 4AD9A 3M8EA 4RB0A 2MLGA 1RIOH 2V79A 3T8RA 4CHUA 3SXYA 5JHUA 3IC7A 4HV5A 3DFGA 3HHGA 4A0ZA 5JVTA 5D4RA 4YIIA 5FGMA 3I53A 2QM3A 4KMFA 5D5UB 3K2ZA 3CLOA 3FM3A 2HDCA 2VOOA 1XN7A 1W7PD 1O3TA 2BGCA 2GXGA 3LA3A 4L9NA 3F8MA 1PUEE 4A5MA 3RKWA 4JK1X 3GWZA 4LFUA 3HTUA 4UV8A 3GX4X 1E17A 3ZPLA 2DTRA 4A6DA 3VOEA 3RPUA 2KJCA 4I7HA 3TO9A 4HDUA 1XD7A 1AWCA 4FHTA 2HTSA 4MQVA 4MEXF 2O61A 2MBFA 4EM1A 4O5VA 2DK8A 1OYWA 2OAZA 3F21A 3GZ5A 2A6HF 1LQ1A 4EMSA 1USSA 1Q1HA 4L5JA 3WGHA 5LBQA 1YS6A 1SD7A 2H09A 2OQRA 2NNNA 4UNOA 2VC1A 1W5SA 3ML6A 2Z9OA 1FOKA 3R6SA 3CDHA 3R61A 5D8KB 1ZRCA 2G7HA 5HLHA 3R60A 4RB2C 1O3SA 2W25A 3DF8A 5ERIA 4L9VA 3L9FA 4MTDA 3GYHX 3IWZA 3E6BA 4Y17A 2HGCA 2GA2A 1IN8A 2CFXA 2K4JA 1FC3A 5KK1A 5D5WB 2RKHA 2EA2A 4ASNA 3TO6A 1QO0D 1KYZA 3L09A 4A2UA 1TTYA 3ECHA 4U0WA 3K1PA 3F22A 4LLNA 4EJUA 5CVUA 2LDUA 4ENNA 2LNBA 3RYRA 3ABUA 4PGGA 2K27A 1I6XA 2RN7A 2VT3A 4LMYA 2IPQX 2HFHA 1KU9A 1G3TA 3TO7A 5H6QA 2UXNA 1XSVA 4YFXF 3ELKA 4GYIA 1MDMA 4DQ2A 2FBKA 5DUKA 4CZZA 3FXRA 2Q8KA 2IA1A 3OOPA 3WGIA 2XROA 3RJPA 1B6AA 1J2XA 2PBIA 2V9VA 3WTTC 4QLCU 1FSHA 3F72A 1ZRFA 4IXAA 2COMA 2XUBA 2FE3A 4YFNF 2YX7A 2HOEA 4HX8A 4KDPA 3DPLC 1R23A 4U7DA 2H94A 5J8CA 4ENMA 1EH6A 1BI0A 3P9KA 2GAUA 3FWEA 5J8FA 3CUQC 1FBUA 4U0YA 3EQLF 1S29A 4HF1A 2O3FA 3JTGA 3HOSA 3HSEA 4NQWA 1HSTA 3LQQA 1HKQA 2QBYA 1LNWA 2ESHA 4OIQF 4HQMA 3ERED 4HW0A 3RKYA 2QQBA 5LGNA 3SFZA 2O8XA 4KIBA 1SAXA 1MDMB 4KMUX 3MAJA 4P96A 4LD5A 4G8XA 1R22A 1QGPA 2ZMEB 2FBHA 1Z91A 2CQKA 3NRVA 5FLXZ 1YS7A 4L0YB 3E97A 2CG4A 3WE3A 5HLGA 2JPBA 1G4DA 1C0WA 3C18A 5DV5A 2HTJA 2P6TA 5HS8A 2EWNA 1FNNA 1H9TA 2M5WA 3C7JA 4LK1F 1Z6RA 1NHAA 3QOPA 4G6QA 1HW1A 1TW3A 2QBYB 4HX7A 1YIOA 1KQ0A 5E8GA 3E6CC 3FMQA 4HZFA 3RI4A 2EFPA 5JFRA 2A6EF 3KCCA 4I0BA 3HIFA 1O3QA 2YX4A 1GHCA 1VTNC 3EDPA 1I27A 3Q9VA 1RZ4A 3HHHA 1BIBA 2PLYA 2E7XA 3BP8A 2BBYA 4G7OF 1BBYA 5HDGA 3HRTA 3R0AA 2QWWA 2A61A 1T98A 3DV8A 1W4MA 2XAHA 3BJAA 4KUMA 4MGRA 1TQPA 5EEGA 4P55A 4R8HA 3M8FA 2ISYA 4RGUA 5TRDA 2Z3YA 2XVCA 3ZMSA 3LWFA 5FFXA 1STZA 3WTXC 1QBJA 5DEQA 3BJ6A 3ZMUA 2IA0A 1BI3A 1V4RA 3I59A 1FWZA 3F6OA 1S7AA 3LAJA 5DUIA 4K2EA 2PFBA 5AIQA 1PP7U 2CYYA 1UHMA 2MC3A 3TOAA 1R7JA 2VBXA 5HLIA 2X0LA 1IZ1A 1IXSB 3EYIA 2ESNA 2RV8A 4L18B 4WX9A 5E1ZB 1UCRA 1PDNC 3WGGA 2WC2A 5E17F 1G3YA 1FBSA 4OIOF 2QYOA 4GGGA 2V1UA 2KJBA 3TQNA 3D5LA 2FMLA 2W24A 3RTRA 2QUFA 4P9UA 3FZVA 1F9NA 2HR3A 2EJRA 3O2PE 5D5XB 4HLYA 1QPMA 2Z5UA 4L9TA 4ESFA 1XGSA 4YFKF 5BQTA 1XSDA 3WTWC 1WI9A 1RNLA 1ULYA 3J7AO 5LRRA 1YG2A 5F6FA 4Q4ZF 1WWXA 4HYEA 1S3JA 3I59B 4O3MA 1ZGAA 5LLQA 1ZGJA 4A6EA 3KE2A 4B8XA 2XAJA 1P4WA 3B02A 4ENJA 2A07F 3F3XA 1SD4A 6PAXA 3DPTA 2LSOA 1R5HA 2BV6A 3KZZA 3V7RA 1T6SA 1O57A 1P4XA 4RB1A 4RS8A 5EEHA 2GZWA 3HOTA 4HDVA 4P9FA 1YW9A 1ZAOA 1O7LA 4KFCA 1B4AA 5ED4A 3AAFA 4H0EA 4ZZDA 1R5GA 3WU1B 2OD5A 4M6YA 3RPQA 5LHGA 1B9MA 4HV6A 2ZCWA 2VE9A 2KIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W5T A;  4UVC A;  1W7P A;  4ETS A;  3W6K B;  2WWY A;  2XAQ A;  5DDG A;  1YTY A;  1MGT A;  3Q5F A;  2E7W A;  4N9I A;  2ADU A;  1U5T C;  2CW0 F;  2TDX A;  4QWQ A;  2Q2E A;  4KIF A;  1SFU A;  3E6M A;  1OMI A;  1IXC A;  1S6L A;  1YO5 C;  4M6X A;  3WTV C;  4OIP F;  2ZBK A;  2XIG A;  4LLL A;  1H9G A;  3HSR A;  2VOD A;  3KP5 A;  3ZN0 A;  1FYL A;  4M72 A;  2HZT A;  5CVI A;  1LVA A;  1LB2 A;  3CTA A;  3JW4 A;  1FP2 A;  1H0M A;  4RGR A;  1K6O A;  4EGZ A;  2FF4 A;  3V8L A;  1IW7 F;  2P5L C;  2K02 A;  2NS0 A;  1DP7 P;  2X4H A;  1FT9 A;  1KU7 A;  1QNT A;  2QQ9 A;  1Y0U A;  5ICF A;  1W7P B;  2JSC A;  3QU6 A;  1OYY A;  4IRG A;  1U3E M;  1ZLK A;  2YR2 A;  2JTV A;  5DD8 A;  5DCM B;  2DPD A;  4AIK A;  5L3G A;  4EJW A;  3QP5 A;  4WK8 F;  3BZ6 A;  1OPC A;  4UUV A;  4L9J A;  2OBP A;  1ZAR A;  2ZXJ A;  1F1Z A;  3H3Z A;  4ON0 A;  4U88 A;  2VOP A;  4Q48 A;  2YPR A;  1R00 A;  4FX4 A;  2W85 A;  2WV0 A;  2PQ8 A;  3ZQ7 A;  4WXH A;  1K78 A;  4CXF A;  3GFM A;  3RIR A;  1KU2 A;  1YW8 A;  5JR3 A;  3P7N A;  1FYK A;  2P5K A;  2XV4 S;  3IKV A;  2UWM A;  4DNC A;  4WWC A;  1TQI A;  2JRT A;  4TV7 A;  5ICE A;  2VON A;  3R4K A;  3J80 K;  3GUD A;  4LLG F;  1XGO A;  3M9A A;  2B0L A;  3CUQ A;  4GO1 A;  1J5Y A;  2Q0O A;  1MKM A;  5E1X A;  1S7O A;  1B9N A;  1TNS A;  4XSX F;  1EH7 A;  2H27 A;  1YW7 A;  2W84 A;  3G3Z A;  1L0O C;  3WTY C;  1ZRD A;  5CLS A;  5L3E A;  2EFQ A;  1I5Z A;  4KYW A;  1P4A A;  2MLK A;  2ZME A;  1IN5 A;  2AS5 F;  2HEO A;  4G94 A;  2HKO A;  5JI6 A;  1MJA A;  1XB4 A;  1UFM A;  2P4W A;  3W6J B;  1K78 B;  1ZN2 A;  5HDN A;  4Z2Y A;  2VC0 A;  2OZU A;  3ZMT A;  2UZK A;  5K5O A;  2EV5 A;  5LEJ A;  1KYW A;  1HKS A;  5CJ9 A;  1QQI A;  5DYM A;  1YFH A;  1FX7 A;  1MZB A;  2P8T A;  3EUH A;  1UB9 A;  4RGS A;  1T39 A;  3T1B A;  1DDN A;  3GEZ A;  3LA7 A;  3T0Y A;  4XLP F;  5D6E A;  3E5Q A;  4D0P A;  2VT2 A;  2M87 A;  4KNY A;  5E1W A;  1ZLJ A;  4PZJ A;  4ESB A;  2HKX A;  1LEA A;  3CUQ B;  1P6R A;  3I4P A;  3KEQ A;  3NQO A;  5F1R A;  2XGX A;  5IT3 A;  1E2X A;  2K7L A;  5CVV A;  3SHF A;  5D8L B;  5CYV A;  3KFW X;  5LGT A;  5DD4 A;  4N0B A;  1IUY A;  4JBA A;  4GYG A;  4B09 A;  3V8K A;  3HSF A;  1J9I A;  1IN6 A;  2L02 A;  2PJP A;  1SFX A;  3MWM A;  3E3V A;  3PFI A;  3FXQ A;  2L3D A;  1WRJ A;  2GA1 A;  3DEU A;  3T8T A;  4BH9 A;  1CGP A;  4NB5 A;  4F7Z A;  2AXL A;  4KIC A;  2HQR A;  2F5C A;  1J59 A;  1TNT A;  3FMR A;  4YG2 F;  1KQ8 A;  3TOB A;  1XMA A;  5ILS A;  3WTZ A;  5HS9 A;  2R7F A;  2MH2 A;  3QRF F;  3DXJ F;  3OV8 A;  1TQM A;  2ZNY A;  1R36 A;  2DFI A;  2OQG A;  3P9I A;  5J6X A;  2DBB A;  4OOI A;  2P6S A;  4RB3 C;  3SQN A;  5LRS A;  2GXB A;  4LJZ F;  2XKO A;  2ZO4 A;  2FA5 A;  5FB2 A;  1G3S A;  5L3F A;  3O3K A;  2VXZ A;  4A0X A;  4R1H A;  4EQQ A;  3K1N A;  3D0S A;  2L54 A;  1OKR A;  1EV7 A;  1P2F A;  2YSR A;  3TKY A;  5BPD A;  1BOA A;  2IP2 A;  4GXO A;  5K5R A;  1ON1 A;  5TJJ A;  3MZY A;  2EA4 A;  5AON A;  2PI0 A;  1XDS A;  3QP6 A;  1WQ2 A;  2O6G E;  2E1C A;  5H20 A;  1T38 A;  2QLZ A;  3V7S A;  3WOD F;  1GVJ A;  3ZMZ A;  4UHT A;  5F64 A;  4GCV A;  3RYP A;  1F4K A;  3F8N A;  1U8R A;  5L3D A;  3GZ6 A;  4MNU A;  3I71 A;  5L3B A;  3HTS B;  3G73 A;  4WXC A;  1K79 A;  2Y0M A;  4L5I A;  1TW2 A;  2KRF A;  3RDI A;  1TBX A;  4M9Z A;  4I0A A;  2VBZ A;  4PGH A;  4OMY A;  2LF8 A;  2NYX A;  3JTH A;  2FBI A;  2G9W A;  4HAM A;  1GXQ A;  3IRQ A;  1D8K A;  4FT8 A;  4MHG A;  3L7W A;  2HS5 A;  4ZYD A;  2JPC A;  3QPH A;  2DW4 A;  1KU3 A;  4U7B A;  1BI2 A;  1EH8 A;  3BWG A;  4XBF A;  3CUO A;  4O6J A;  3R0J A;  4IJA A;  4ESJ A;  1FY7 A;  3K69 A;  1IXR C;  2VBW A;  1FYM A;  5E8I A;  1Z9C A;  5HS7 A;  2D45 A;  1OYI A;  3NEU A;  2DU9 A;  2NAZ A;  2OZ6 A;  3I54 A;  3IHU A;  1IN4 A;  2C6Y A;  5LEK A;  2ACJ A;  1HQC A;  3F6V A;  3GLX A;  2DPU A;  1ZG3 A;  3ECO A;  2J5P A;  4G7H F;  3J81 Z;  2R7D A;  4ZYG A;  5BS6 A;  2LF7 A;  2QEN A;  2XRN A;  4PCQ A;  4IVN A;  3LA2 A;  1HBX G;  3TGN A;  5CVR A;  2IJL A;  3M1E A;  5FO5 A;  3C3W A;  2K4B A;  5CVJ A;  1J0R A;  1B59 A;  2QVO A;  2Z99 A;  2BE5 F;  4ZYE A;  5HOO A;  1JE8 A;  2M1B A;  3QPT A;  1ZRE A;  1QZZ A;  3I58 A;  1BM9 A;  2DK5 A;  3KZY A;  3KP2 A;  3GVA A;  1U5T A;  1D8J A;  4BQA A;  1JHH A;  1YYV A;  2ZNZ A;  2DO7 A;  2M30 A;  3DQV C;  2H6C A;  3RKX A;  4IF4 A;  1BJA A;  5HDK A;  4HQE A;  2ISZ A;  4UVA A;  4AWX B;  1XGM A;  3KLO A;  2E1N A;  4EM0 B;  1DPU A;  2XAS A;  3J80 Z;  4CYD A;  3KP7 A;  4M9X A;  3CO7 C;  1DUX C;  4HF2 A;  3F8C A;  2RDP A;  3I5U A;  4HLX A;  2NRA C;  4LK0 F;  4OU0 A;  2IVM A;  1O3R A;  3FF5 A;  4HOB A;  2L4M A;  2PEX A;  4UVB A;  4ENK A;  3Q9S A;  3F8F A;  5DCM A;  3FXU A;  3B73 A;  4LB5 A;  2D2W A;  4L0Z B;  2L01 A;  4EGY A;  1SD5 A;  1JGS A;  3H3U A;  1U5T B;  2EFO A;  4OMZ A;  2OA4 A;  4EJV A;  1RUO A;  2EV0 A;  5ILU A;  1Z7U A;  4M71 A;  1L3L A;  1GXP A;  3ULQ B;  2STT A;  1MD0 A;  2A5Y B;  3GO5 A;  4RGX A;  1HSJ A;  3ABT A;  4KT5 C;  2RGV A;  4OIR F;  3H92 A;  4NHJ A;  2JZY A;  4BAY A;  4AVP A;  2MH9 A;  5K5Q A;  1REP C;  3KP6 A;  4LG0 A;  1BIA A;  2ZKZ A;  1KGS A;  2FNA A;  4I2O A;  1RI7 A;  3ISP A;  3E6D A;  4IRI A;  3ZMD A;  2D1V A;  4BYY A;  4S05 A;  2P7C B;  1XCV A;  3U1D A;  3O6B B;  3JSO A;  2A68 F;  2HYF A;  5ICG A;  3HUG A;  1XDU A;  2VE8 A;  3J81 K;  2KIU A;  2RC4 A;  1MJB A;  2V6C A;  2D1H A;  4BHP A;  2EK5 A;  4WCG A;  3U2R A;  3T5X A;  4R79 A;  3WE2 A;  3REO A;  4A5N A;  4UXN A;  3MEX A;  4I02 A;  4HF0 A;  3V4G A;  3BJO A;  3N4M A;  2M8E A;  1RUN A;  4CIC A;  4G7Z F;  3WTU C;  5KVR A;  2FQ3 A;  3L00 A;  2J5O A;  3EET A;  3QAH A;  2FOK A;  4EJO A;  3HYI A;  1A04 A;  1HW2 A;  2BEO A;  1QZY A;  2CO5 A;  3I64 A;  4LG0 B;  4BNC A;  2HWV A;  4HX4 A;  2XHK A;  1YQA A;  1LDK B;  1IRF A;  2WTE A;  5D4S A;  5BPI A;  1BI1 A;  4KN7 X;  2IT0 A;  5ICC A;  3V8J A;  5D5V B;  4M9S A;  3FX3 A;  2M45 A;  3GW2 A;  2Z33 A;  3KP4 A;  1PP8 F;  3ZP5 A;  3JAM Z;  1ZH5 A;  4WF2 A;  2G7U A;  3FM5 A;  3GF2 A;  2W57 A;  1XSX A;  1ONV A;  3P9C A;  1P92 A;  4HBL A;  1D3Y A;  4A0Y A;  4MEY F;  2H6B A;  3BY6 A;  5A2Q Z;  2F5E A;  2MA3 A;  1JXS A;  4XLN F;  3CJN A;  2MD5 A;  1U6G A;  2FEZ A;  1F5T A;  3MZH A;  3FMS A;  1B1B A;  2PMH A;  4FX0 A;  4M74 A;  1WKM A;  4Y15 A;  3PQK A;  2NNY A;  2P7V B;  3HRS A;  1TLH B;  2IW5 A;  1SMT A;  3MQ0 A;  2PN6 A;  3HRM A;  4ZYH A;  3LFK A;  2EFN A;  1R1V A;  3MFK A;  2LKP A;  5H6R A;  4IPA A;  3ZMV A;  5L3C A;  4I01 A;  3KET A;  1SFE A;  4G9Y A;  1D5V A;  2ZJ2 A;  1BC8 C;  4Q47 A;  3U9G A;  5IT9 Z;  4MQ9 F;  1ODD A;  1G3W A;  1ZHF A;  2ELH A;  2FNP A;  1IN7 A;  2L4A A;  2OU2 A;  4UV9 A;  5DCF A;  2RQP A;  1AOY A;  4IHT A;  1IRG A;  4CO8 A;  3IL2 A;  3K9T A;  4Y13 A;  3GFL A;  1R58 A;  1R1T A;  5LHH A;  2BYV E;  3K1M A;  2ZFW A;  3MCZ A;  2CGP A;  4RAY A;  2GIV A;  3K0L A;  2RNJ A;  2JT1 A;  3SZP A;  1ZG1 A;  4ZZL A;  4JQF A;  2CWE A;  2GWR A;  3I0T A;  2DQR A;  1O7F A;  4OIN F;  2Y75 A;  1KA8 A;  3N97 A;  3FHZ A;  1SD6 A;  4KA4 A;  3LST A;  3BPX A;  4IHS A;  3VEP A;  4BHB A;  3WG9 A;  1FPQ A;  1LDD A;  2DI3 A;  5AIP A;  2A69 F;  1I1G A;  3BDD A;  5FD6 A;  3BOQ A;  1BC7 C;  2FXA A;  1S8N A;  2STW A;  2ETH A;  5BMZ A;  3JAM K;  1J7K A;  3M7G A;  2P5V A;  3GFJ A;  2QZ8 A;  2XKP A;  3TDZ C;  4CGZ A;  3VB2 A;  1DPR A;  5LHI A;  5A2Q K;  1I1S A;  2IRF G;  1SMY F;  4I09 A;  1MJ9 A;  3HRU A;  5ILV A;  1IF1 A;  2VN2 A;  1CF7 A;  1U2W A;  2DT5 A;  2O03 A;  4AIJ A;  2CSO A;  5LGU A;  3IWF A;  4PDK A;  2FMY A;  2FU4 A;  2KKO A;  4S04 A;  1ON2 A;  1ZYR F;  2R3S A;  2QQA A;  4RAZ A;  2F2E A;  2HYG D;  3BPV A;  5IT9 K;  3V7C A;  1UHW A;  3LQR A;  3F23 A;  5K1Y A;  3VOD A;  4I98 B;  4N9H A;  3IKT A;  2VBY A;  4EVI A;  2O0Y A;  1LEB A;  2A3S A;  2FSW A;  3C1D A;  1XMK A;  2PMU A;  1YLF A;  2DLL A;  1FSE A;  2XAG A;  4EV0 A;  3QU3 A;  3WU0 A;  1CF7 B;  1ZG5 A;  3GXO A;  3IRR A;  4YIF A;  1JHF A;  1Z05 A;  1V3F A;  5E20 A;  3LAP A;  3BRO A;  1FLI A;  4WXD A;  3KLN A;  4CDG A;  4KN4 X;  1KQ9 A;  5HVQ C;  3KP3 A;  4LGW A;  2PG4 A;  5FFZ A;  4EM2 A;  1WSU A;  3S2W A;  2EB7 A;  3WTS C;  1IAW A;  1HKT A;  1Z1D A;  4XRF A;  1OR7 A;  5FD5 A;  4A12 A;  2F5F A;  5FLX K;  1G6N A;  2EV6 A;  4KIG A;  5BOX A;  2V1D A;  1FZP B;  1XGN A;  1X3U A;  1LDJ A;  2KIM A;  4BHC A;  1LJ9 A;  4EJT A;  4M73 A;  3ROU A;  2DQL A;  4BXU A;  2V1X A;  4ZH4 F;  2XAF A;  4E70 A;  4Q5S F;  1FBQ A;  3VFZ A;  1FP1 D;  2GQQ A;  2UXX A;  4MTE A;  1R1U A;  1T0F A;  2RVC A;  2K86 A;  3F8B A;  1HW5 A;  2EFW A;  3PQJ A;  1U78 A;  1HXD A;  3L2C A;  3ZN1 A;  1UST A;  3JSP A;  4AIH A;  3COA C;  1T2K A;  4LB6 B;  5E18 F;  4G6D A;  2DAO A;  1BN5 A;  2F5D A;  2IA2 A;  3DP7 A;  1J75 A;  4XSZ F;  2HQN A;  3E5U A;  1XCB A;  3TDU C;  4U0V A;  5D6F A;  3CO6 C;  1K7A A;  3SZT A;  4IRH A;  4HA8 A;  3DKW A;  3EYY A;  3GFI A;  2Y48 A;  3E5X A;  4P5O A;  3KEO A;  2YU3 A;  1Z6T A;  2FRH A;  4AD9 A;  3M8E A;  4RB0 A;  2MLG A;  1RIO H;  2V79 A;  3T8R A;  4CHU A;  3SXY A;  5JHU A;  3IC7 A;  4HV5 A;  3DFG A;  3HHG A;  4A0Z A;  5JVT A;  5D4R A;  4YII A;  5FGM A;  3I53 A;  2QM3 A;  4KMF A;  5D5U B;  3K2Z A;  3CLO A;  3FM3 A;  2HDC A;  2VOO A;  1XN7 A;  1W7P D;  1O3T A;  2BGC A;  2GXG A;  3LA3 A;  4L9N A;  3F8M A;  1PUE E;  4A5M A;  3RKW A;  4JK1 X;  3GWZ A;  4LFU A;  3HTU A;  4UV8 A;  3GX4 X;  1E17 A;  3ZPL A;  2DTR A;  4A6D A;  3VOE A;  3RPU A;  2KJC A;  4I7H A;  3TO9 A;  4HDU A;  1XD7 A;  1AWC A;  4FHT A;  2HTS A;  4MQV A;  4MEX F;  2O61 A;  2MBF A;  4EM1 A;  4O5V A;  2DK8 A;  1OYW A;  2OAZ A;  3F21 A;  3GZ5 A;  2A6H F;  1LQ1 A;  4EMS A;  1USS A;  1Q1H A;  4L5J A;  3WGH A;  5LBQ A;  1YS6 A;  1SD7 A;  2H09 A;  2OQR A;  2NNN A;  4UNO A;  2VC1 A;  1W5S A;  3ML6 A;  2Z9O A;  1FOK A;  3R6S A;  3CDH A;  3R61 A;  5D8K B;  1ZRC A;  2G7H A;  5HLH A;  3R60 A;  4RB2 C;  1O3S A;  2W25 A;  3DF8 A;  5ERI A;  4L9V A;  3L9F A;  4MTD A;  3GYH X;  3IWZ A;  3E6B A;  4Y17 A;  2HGC A;  2GA2 A;  1IN8 A;  2CFX A;  2K4J A;  1FC3 A;  5KK1 A;  5D5W B;  2RKH A;  2EA2 A;  4ASN A;  3TO6 A;  1QO0 D;  1KYZ A;  3L09 A;  4A2U A;  1TTY A;  3ECH A;  4U0W A;  3K1P A;  3F22 A;  4LLN A;  4EJU A;  5CVU A;  2LDU A;  4ENN A;  2LNB A;  3RYR A;  3ABU A;  4PGG A;  2K27 A;  1I6X A;  2RN7 A;  2VT3 A;  4LMY A;  2IPQ X;  2HFH A;  1KU9 A;  1G3T A;  3TO7 A;  5H6Q A;  2UXN A;  1XSV A;  4YFX F;  3ELK A;  4GYI A;  1MDM A;  4DQ2 A;  2FBK A;  5DUK A;  4CZZ A;  3FXR A;  2Q8K A;  2IA1 A;  3OOP A;  3WGI A;  2XRO A;  3RJP A;  1B6A A;  1J2X A;  2PBI A;  2V9V A;  3WTT C;  4QLC U;  1FSH A;  3F72 A;  1ZRF A;  4IXA A;  2COM A;  2XUB A;  2FE3 A;  4YFN F;  2YX7 A;  2HOE A;  4HX8 A;  4KDP A;  3DPL C;  1R23 A;  4U7D A;  2H94 A;  5J8C A;  4ENM A;  1EH6 A;  1BI0 A;  3P9K A;  2GAU A;  3FWE A;  5J8F A;  3CUQ C;  1FBU A;  4U0Y A;  3EQL F;  1S29 A;  4HF1 A;  2O3F A;  3JTG A;  3HOS A;  3HSE A;  4NQW A;  1HST A;  3LQQ A;  1HKQ A;  2QBY A;  1LNW A;  2ESH A;  4OIQ F;  4HQM A;  3ERE D;  4HW0 A;  3RKY A;  2QQB A;  5LGN A;  3SFZ A;  2O8X A;  4KIB A;  1SAX A;  1MDM B;  4KMU X;  3MAJ A;  4P96 A;  4LD5 A;  4G8X A;  1R22 A;  1QGP A;  2ZME B;  2FBH A;  1Z91 A;  2CQK A;  3NRV A;  5FLX Z;  1YS7 A;  4L0Y B;  3E97 A;  2CG4 A;  3WE3 A;  5HLG A;  2JPB A;  1G4D A;  1C0W A;  3C18 A;  5DV5 A;  2HTJ A;  2P6T A;  5HS8 A;  2EWN A;  1FNN A;  1H9T A;  2M5W A;  3C7J A;  4LK1 F;  1Z6R A;  1NHA A;  3QOP A;  4G6Q A;  1HW1 A;  1TW3 A;  2QBY B;  4HX7 A;  1YIO A;  1KQ0 A;  5E8G A;  3E6C C;  3FMQ A;  4HZF A;  3RI4 A;  2EFP A;  5JFR A;  2A6E F;  3KCC A;  4I0B A;  3HIF A;  1O3Q A;  2YX4 A;  1GHC A;  1VTN C;  3EDP A;  1I27 A;  3Q9V A;  1RZ4 A;  3HHH A;  1BIB A;  2PLY A;  2E7X A;  3BP8 A;  2BBY A;  4G7O F;  1BBY A;  5HDG A;  3HRT A;  3R0A A;  2QWW A;  2A61 A;  1T98 A;  3DV8 A;  1W4M A;  2XAH A;  3BJA A;  4KUM A;  4MGR A;  1TQP A;  5EEG A;  4P55 A;  4R8H A;  3M8F A;  2ISY A;  4RGU A;  5TRD A;  2Z3Y A;  2XVC A;  3ZMS A;  3LWF A;  5FFX A;  1STZ A;  3WTX C;  1QBJ A;  5DEQ A;  3BJ6 A;  3ZMU A;  2IA0 A;  1BI3 A;  1V4R A;  3I59 A;  1FWZ A;  3F6O A;  1S7A A;  3LAJ A;  5DUI A;  4K2E A;  2PFB A;  5AIQ A;  1PP7 U;  2CYY A;  1UHM A;  2MC3 A;  3TOA A;  1R7J A;  2VBX A;  5HLI A;  2X0L A;  1IZ1 A;  1IXS B;  3EYI A;  2ESN A;  2RV8 A;  4L18 B;  4WX9 A;  5E1Z B;  1UCR A;  1PDN C;  3WGG A;  2WC2 A;  5E17 F;  1G3Y A;  1FBS A;  4OIO F;  2QYO A;  4GGG A;  2V1U A;  2KJB A;  3TQN A;  3D5L A;  2FML A;  2W24 A;  3RTR A;  2QUF A;  4P9U A;  3FZV A;  1F9N A;  2HR3 A;  2EJR A;  3O2P E;  5D5X B;  4HLY A;  1QPM A;  2Z5U A;  4L9T A;  4ESF A;  1XGS A;  4YFK F;  5BQT A;  1XSD A;  3WTW C;  1WI9 A;  1RNL A;  1ULY A;  3J7A O;  5LRR A;  1YG2 A;  5F6F A;  4Q4Z F;  1WWX A;  4HYE A;  1S3J A;  3I59 B;  4O3M A;  1ZGA A;  5LLQ A;  1ZGJ A;  4A6E A;  3KE2 A;  4B8X A;  2XAJ A;  1P4W A;  3B02 A;  4ENJ A;  2A07 F;  3F3X A;  1SD4 A;  6PAX A;  3DPT A;  2LSO A;  1R5H A;  2BV6 A;  3KZZ A;  3V7R A;  1T6S A;  1O57 A;  1P4X A;  4RB1 A;  4RS8 A;  5EEH A;  2GZW A;  3HOT A;  4HDV A;  4P9F A;  1YW9 A;  1ZAO A;  1O7L A;  4KFC A;  1B4A A;  5ED4 A;  3AAF A;  4H0E A;  4ZZD A;  1R5G A;  3WU1 B;  2OD5 A;  4M6Y A;  3RPQ A;  5LHG A;  1B9M A;  4HV6 A;  2ZCW A;  2VE9 A;  2KIF A; 
#chains in the Genus database with same CATH topology
 1TT0 A;  3I3L A;  1W5T A;  4UVC A;  1W7P A;  4ETS A;  3Q3S A;  2DJI A;  4XRS G;  3W6K B;  2M0C A;  2WWY A;  1VQO I;  3LSH A;  2XAQ A;  5DDG A;  1YTY A;  1MGT A;  3Q5F A;  2E7W A;  3ZQH A;  4N9I A;  2ADU A;  1X1B A;  1U5T C;  2DFE A;  4I6Z A;  3BR1 A;  3NWT A;  2CW0 F;  4IZZ A;  2TDX A;  4QWQ A;  2Q2E A;  4CSW A;  4KIF A;  5LD2 C;  3BR0 A;  1SFU A;  3E6M A;  1OMI A;  3K4L A;  4W1U A;  1JUM A;  1YOV B;  5KAF C;  1IXC A;  1S5L C;  1S6L A;  2KIS A;  1H88 C;  1YO5 C;  4M6X A;  3WTV C;  1N25 A;  3OIQ A;  4OAZ A;  4CCO A;  4OIP F;  2ZBK A;  1X4P A;  2XIG A;  4LLL A;  3BTI A;  2PMZ N;  4JOM A;  1H9G A;  1Y56 A;  3HSR A;  1JJ6 C;  2VOD A;  2NOJ B;  5J4Y A;  2E2H J;  1YIJ I;  3KP5 A;  3L2Q A;  4IQJ A;  3ZN0 A;  1FYL A;  1ETV A;  4M72 A;  2HZT A;  4D7N A;  3M4O J;  5CVI A;  4NDL A;  3WHB A;  1D1C A;  1LVA A;  1LB2 A;  2DT6 A;  2VI6 A;  2O5R A;  3CTA A;  3JW4 A;  1FP2 A;  3GZN B;  4XLH A;  1H0M A;  4RGR A;  1K6O A;  2AXT C;  4EGZ A;  2Z2S B;  3MKZ A;  2FF4 A;  2QSF X;  3V8L A;  2WY7 Q;  2V26 A;  1IW7 F;  2P5L C;  2K02 A;  3S1R J;  2OUM A;  3KYL A;  3CDL A;  4X6A J;  3HOY J;  2NS0 A;  2LBF A;  4JYK A;  1DP7 P;  1G59 A;  2X4H A;  1X3W B;  1FT9 A;  1KU7 A;  2IS1 A;  1QNT A;  3OWT A;  2QQ9 A;  3CCS I;  1Y0U A;  5ICF A;  4F92 B;  1W7P B;  2JN6 A;  2HI3 A;  2JSC A;  3QU6 A;  2DFH A;  1OYY A;  4IRG A;  1U3E M;  1ZLK A;  1H89 C;  2YR2 A;  2JTV A;  5DD8 A;  2F4O B;  5DCM B;  2DPD A;  4BY7 J;  4D1Q A;  2L0K A;  4RBO A;  5E3L A;  4DYC A;  3GTP J;  2Q2E B;  2HXI A;  2X6X A;  4AIK A;  5L3G A;  2HDD A;  4EJW A;  1IUF A;  2RQQ A;  2VQH A;  3QP5 A;  2R92 J;  4WK8 F;  3BZ6 A;  3CC7 I;  3GTK J;  2PX9 A;  1OPC A;  3H36 A;  4L9J A;  4CCJ A;  4UUV A;  3FBI B;  2OBP A;  1ZAR A;  2ZXJ A;  1YJN I;  5F27 A;  2DMU A;  2YS9 A;  2Y0S N;  4RAG A;  1F1Z A;  3H3Z A;  4BS9 A;  3L2R A;  4ON0 A;  3VSL A;  2JJ7 A;  2LLK A;  3S93 A;  5FLV A;  4U88 A;  4ZDP A;  3A4C A;  2VOP A;  4Q48 A;  1U9O A;  3OIO A;  2V9P A;  2L9V A;  4I99 C;  2YPR A;  3CJQ B;  1R00 A;  4DZP A;  3QYE A;  1SFK A;  1N75 A;  4FX4 A;  3OYI A;  2W85 A;  2BW3 A;  2WV0 A;  2PQ8 A;  3ZQ7 A;  4AUX A;  1FIP A;  4WXH A;  1K78 A;  1VQK I;  2Y30 A;  1K83 J;  2LBF B;  4CXF A;  1DGR M;  3GFM A;  2B9S A;  3I9V 2;  4XR6 A;  3RIR A;  1KU2 A;  1YW8 A;  3TBI A;  5JR3 A;  1IC8 A;  3P7N A;  1S7E A;  3A02 A;  1FYK A;  1WHU A;  4A3I J;  2P5K A;  2XV4 S;  3IKV A;  3V42 A;  2UWM A;  4PJN A;  4DNC A;  4WWC A;  3A2K A;  1TQI A;  1S72 I;  2JRT A;  4TV7 A;  2ME0 A;  2F6C A;  5ICE A;  1LFB A;  3HUG B;  1A35 A;  3BTL A;  3PNV A;  3R4K A;  2VON A;  1D1B A;  3J80 K;  4GRI A;  3GUD A;  1WJB A;  4LLG F;  1XGO A;  4NUB A;  3M9A A;  3QWL A;  2B0L A;  1A5J A;  1MMA A;  3VYS B;  3CUQ A;  1A36 A;  4GO1 A;  2EIM H;  1J5Y A;  3HKZ A;  5FKM A;  2Q0O A;  4YRV A;  1MKM A;  4RM3 A;  5E1X A;  2JA7 J;  1LKX A;  1S7O A;  3NAR A;  1B9N A;  1TNS A;  4FCY A;  4XSX F;  1EH7 A;  3KPH A;  2H27 A;  1YW7 A;  1R6R A;  3FXK A;  2W84 A;  4QTR A;  3W3C A;  3G3Z A;  3K4J A;  1L0O C;  1GT0 C;  3WTY C;  1ZRD A;  5CLS A;  1JI8 A;  1GLN A;  3DPU A;  2ID6 A;  2QGU A;  5L3E A;  2EIJ H;  2Q1Z B;  1W36 C;  1V54 H;  2EFQ A;  1Y8R B;  1I5Z A;  2LK2 A;  4KYW A;  1P4A A;  2MLK A;  2M8G X;  2ZME A;  3DBR B;  3O8H A;  1HCR A;  1FMV A;  1IN5 A;  4F93 B;  2AS5 F;  2HEO A;  3F9K A;  4G94 A;  3LNQ A;  2HKO A;  5JI6 A;  3RQI A;  3HG9 A;  2BW3 B;  4LOC A;  1MJA A;  1XB4 A;  2R7X A;  1UFM A;  2DA6 A;  2P4W A;  3W6J B;  1K78 B;  1VQ9 I;  1ZN2 A;  2ZXI A;  3JCU C;  5HDN A;  5KNL A;  4Z2Y A;  2VC0 A;  2OZU A;  2IXS A;  3ZMT A;  2UZK A;  3HOU J;  5K5O A;  2EV5 A;  1Q1V A;  3KX2 A;  5LEJ A;  1KYW A;  5GAG J;  1HKS A;  5CJ9 A;  1D0Z A;  1QQI A;  5DYM A;  1YFH A;  1FX7 A;  1MZB A;  2OJE D;  2LH9 A;  2P8T A;  3GLL A;  3MKW B;  3AG1 H;  1YI2 I;  3EUH A;  1UB9 A;  4JX5 A;  2X1D A;  4RGS A;  1T39 A;  1QPI A;  3T1B A;  1RET A;  1DDN A;  3BR2 A;  1VQL I;  2DFF A;  3GEZ A;  3LA7 A;  3PJR A;  3T0Y A;  4C2M J;  4XLP F;  2JK3 A;  5D6E A;  3E5Q A;  4D0P A;  3D5R C;  2KLO A;  4A3K J;  2VT2 A;  2M87 A;  4KNY A;  4XLE A;  4B48 A;  5E1W A;  3BG3 A;  1ZLJ A;  4PZJ A;  3RSN A;  4E7J A;  4ESB A;  2HZD A;  1XPX A;  1QVU A;  2EZK A;  2HKX A;  1LEA A;  1AU7 A;  3CUQ B;  1IGN A;  5HNF A;  1P6R A;  3I4P A;  2X6Y A;  3KEQ A;  5JHF A;  3NQO A;  4DZJ A;  1ZK8 A;  2L9N A;  5F1R A;  3LFU A;  2XGX A;  1IDY A;  5IT3 A;  1E2X A;  2K7L A;  2E5Z A;  3OR2 C;  5CVV A;  3SHF A;  1I3A A;  3BLY A;  1G8X A;  3W2V A;  3D5S C;  5D8L B;  4A3J J;  1D1A A;  5CYV A;  3KFW X;  5LGT A;  1ZTR A;  3H9J A;  5DD4 A;  5F0H A;  4N0B A;  1IUY A;  3I56 I;  5KHD A;  4JBA A;  5K7F A;  4GYG A;  4B09 A;  2YUS A;  2FUG 2;  3V8K A;  3HSF A;  1J9I A;  1WJ5 A;  1LFU P;  3OL3 A;  1IN6 A;  3B6A A;  2L02 A;  4CZC A;  2PJP A;  2CQX A;  1SFX A;  3MWM A;  3SEQ A;  3E3V A;  3PFI A;  3FXQ A;  2QF7 A;  1OCT C;  2H1L A;  2L3D A;  1WRJ A;  5IOZ A;  2GA1 A;  1XS9 A;  3DEU A;  3T8T A;  4BH9 A;  4KIT B;  1CGP A;  4NB5 A;  4F7Z A;  2AXL A;  4KIC A;  2DYS H;  2HQR A;  3G2B A;  5KCM A;  2WA0 A;  2F5C A;  1J59 A;  1TNT A;  3FMR A;  3WHC A;  4YG2 F;  1KQ8 A;  3TOB A;  1XMA A;  3HB9 A;  5ILS A;  5HS9 A;  3WTZ A;  2CV0 A;  2R7F A;  2MH2 A;  2WB1 A;  3QRF F;  3DXJ F;  3OV8 A;  1TQM A;  1TWC J;  2ZNY A;  5K7H A;  2K85 A;  1R36 A;  1ORK A;  3I4M J;  2DFI A;  2OQG A;  1K4T A;  3P9I A;  5IOY A;  5J6X A;  2DBB A;  1ITY A;  3OOU A;  4NNJ A;  1SFO J;  4OOI A;  5B1B H;  2P6S A;  1Y6I A;  2ZC2 A;  1WCM J;  3SQN A;  5LRS A;  4RB3 C;  2IGN A;  2ZJP F;  2GXB A;  4LJZ F;  4A93 J;  2XKO A;  2QKM B;  2ZO4 A;  3ABM H;  2FA5 A;  5DS9 A;  3QOD A;  1LFP A;  5FB2 A;  1G3S A;  2JWT A;  4BUP A;  5L3F A;  2K9S A;  3O3K A;  2VXZ A;  4A0X A;  4CCM A;  4R1H A;  3QPS A;  2XDV A;  4EQQ A;  2O8K A;  3K1N A;  3D0S A;  2L54 A;  1OKR A;  1EV7 A;  1DP3 A;  1P2F A;  2YSR A;  3TKY A;  5BPD A;  2DA2 A;  2AQE A;  1BOA A;  1SVM A;  2IP2 A;  4QPO A;  3SFI A;  4GXO A;  4AYB N;  2NXN B;  3ESW B;  3ABL H;  2QQ8 A;  5K5R A;  1ON1 A;  5TJJ A;  3MZY A;  2EA4 A;  5AON A;  2PI0 A;  1XDS A;  3QP6 A;  1WQ2 A;  2O6G E;  2E1C A;  5H20 A;  2EQR A;  4XKB A;  4II2 A;  1T38 A;  2QLZ A;  3V7S A;  3WOD F;  4AM3 A;  1JUS A;  4HEA 2;  1RPW A;  1GVJ A;  3A03 A;  2XC7 A;  2XPU A;  4FE4 A;  3LL7 A;  3ZMZ A;  4UHT A;  2TRT A;  5F64 A;  4GCV A;  3RYP A;  1F4K A;  3F8N A;  2CV2 A;  1U8R A;  3BCA A;  5L3D A;  3GZ6 A;  4MNU A;  4IOA F;  1T8I A;  3I71 A;  3PUB A;  2IEK A;  5L3B A;  2JQ7 A;  3FXJ A;  3HTS B;  3G73 A;  2GOM A;  4WXC A;  1O4X A;  3HC7 A;  1K79 A;  2Y0M A;  4L5I A;  3ZXS A;  1TW2 A;  2KRF A;  3RDI A;  2M9H A;  2L7Z A;  1TBX A;  4M9Z A;  3S1M J;  4I0A A;  2X48 A;  1IRZ A;  1TWA J;  2VBZ A;  3HEF A;  4PGH A;  4XKW A;  2E34 A;  2LF8 A;  4OMY A;  3BR3 A;  2NYX A;  1B72 A;  3JTH A;  2FBI A;  2G9W A;  1NG7 A;  4HAM A;  1GXQ A;  3IRQ A;  2VJJ A;  4EAT A;  1D8K A;  4FT8 A;  4DYQ A;  3TMO A;  2VJ4 A;  4MHG A;  5E3M A;  3C2B A;  3L7W A;  4BQQ A;  2HS5 A;  3SZG A;  4BQN A;  4ZYD A;  2JPC A;  2MSY A;  2DW4 A;  3QPH A;  4IL6 C;  2HPI A;  1FJL A;  1KU3 A;  4BAC A;  4U7B A;  1BI2 A;  1EH8 A;  2JVG A;  4M3G A;  1KON A;  3BWG A;  4YIR X;  4F52 A;  4XBF A;  4PJJ A;  3CUO A;  4O6J A;  1LPQ A;  3UKG A;  2Z16 A;  3R0J A;  4IJA A;  5GP9 A;  5M5X J;  2LY9 A;  4ESJ A;  3CCR I;  1FY7 A;  1QZE A;  3K69 A;  1IXR C;  3A0H C;  4IHW A;  2VPR A;  2VBW A;  2K9M A;  2KRC A;  3EUA A;  5F08 A;  1FYM A;  4ANJ A;  5E8I A;  1Z9C A;  3SYT A;  5HS7 A;  2D45 A;  4MLO A;  3M3Y J;  1OYI A;  2IGK A;  3GTJ J;  3NEU A;  3H5N A;  2DU9 A;  2NAZ A;  2OZ6 A;  2YU9 J;  3I54 A;  3CP8 A;  3IHU A;  1IN4 A;  2C6Y A;  5HOD A;  5LEK A;  5EEA A;  2ACJ A;  1CQT A;  1HQC A;  3F6V A;  3GLX A;  2DPU A;  3FKI J;  1ZG3 A;  3ECO A;  2OCE A;  2J5P A;  1HDP A;  4G7H F;  3J81 Z;  2R7D A;  4ZYG A;  5BS6 A;  4ZDO A;  2V4J C;  2LF7 A;  2AHQ A;  4IHY A;  4MFE A;  2QEN A;  3FIS A;  2XRN A;  4PCQ A;  4IVN A;  3LA2 A;  1HBX G;  3TGN A;  3MN2 A;  2VB6 A;  5CVR A;  2IJL A;  4B44 A;  1MSE C;  3M1E A;  5FO5 A;  3C3W A;  2F4M B;  2DA4 A;  2K4B A;  5CVJ A;  1WPK A;  1BJZ A;  1DU6 A;  3DCF A;  1J0R A;  1JGG A;  4XRM A;  1EKE A;  1B59 A;  2QVO A;  2Z99 A;  1B72 B;  2BE5 F;  4ZYE A;  5HOO A;  1JE8 A;  1S9H A;  2D5V A;  2M1B A;  2EPF A;  3QPT A;  1ZRE A;  1QZZ A;  2DN0 A;  3I58 A;  1VQ4 I;  1FEX A;  1BM9 A;  4HRI A;  2DK5 A;  2JUG A;  2TCT A;  3KZY A;  3KP2 A;  1RES A;  3BTJ A;  5GAH J;  3IH3 A;  3GVA A;  2DJN A;  4KIS A;  1U5T A;  1D8J A;  4BQA A;  3Q0W A;  1JHH A;  3DBH B;  1YYV A;  4LG3 A;  3K7A J;  4BBR J;  2ZNZ A;  2DO7 A;  3OL4 A;  3CCJ I;  2ZFU A;  2M30 A;  3DQV C;  3VPR A;  2AO9 A;  2H6C A;  3RKX A;  2EZH A;  2NVT J;  2M2E A;  4IF4 A;  1BJA A;  3QPL A;  2ME6 A;  4UUS A;  3JRH A;  4QSH A;  2KMU A;  3G4S I;  5HDK A;  1DGW Y;  2DA3 A;  2X6W A;  3MMY B;  4HQE A;  3JRG A;  1X3Z B;  2NVQ J;  1VND A;  2EZI A;  4A3F J;  5DTD A;  2ISZ A;  4UVA A;  4AWX B;  1XGM A;  1Z77 A;  4IKF A;  5EZG A;  2X1C A;  2LYC A;  2QEX I;  3CCM I;  2W48 A;  3KLO A;  2E1N A;  4EM0 B;  3J7Z I;  3QYB A;  4GFB A;  3S8P A;  3CCQ I;  3L2V A;  1DPU A;  2HVS A;  4C2T A;  1FIA A;  2XAS A;  3HM5 A;  3G71 I;  3J80 Z;  3HDD A;  4A3D J;  4XKC A;  3ZR8 X;  4CYD A;  2MFZ A;  1D5Y A;  2JMW A;  3KP7 A;  4M9X A;  1SEU A;  3CO7 C;  1DUX C;  1R71 A;  4HF2 A;  3F8C A;  1YJW I;  2MD0 A;  4A3G J;  2O9L A;  2CQN A;  3S2H J;  2RDP A;  2MC4 A;  3I5U A;  4HLX A;  5KAI C;  2NRA C;  4LK0 F;  2M4G A;  4OU0 A;  1VQM I;  2IVM A;  4IHX A;  1O3R A;  3FF5 A;  4HOB A;  2L4M A;  3F0C A;  2CUJ A;  1OR7 C;  2PEX A;  4UVB A;  4ENK A;  2KHM A;  1QRY A;  2K3P A;  3Q9S A;  3F8F A;  5DCM A;  5IYC J;  4NC8 A;  4J01 A;  3CF5 F;  3FXU A;  3B73 A;  4BDZ A;  4LB5 A;  2D2W A;  4L0Z B;  2L01 A;  1ERD A;  2E35 A;  4EGY A;  1BR2 A;  2BXY A;  1SD5 A;  1JGS A;  3H3U A;  1U5T B;  2DCE A;  1X1D A;  3ZQG A;  2EFO A;  1YJ9 I;  2WY8 Q;  2JA2 A;  4OMZ A;  2OA4 A;  2X9D A;  4EJV A;  2XGE A;  1RUO A;  2MG4 A;  2EV0 A;  5ILU A;  4UUS B;  3DLA A;  1Z7U A;  4M71 A;  5CKT A;  4F55 A;  1L3L A;  1GXP A;  3ULQ B;  1T0F C;  2STT A;  2DOD A;  1GV2 A;  1MD0 A;  2A5Y B;  3GO5 A;  4RGX A;  4XOR A;  1HSJ A;  3ABT A;  3CZ6 A;  4KT5 C;  2RGV A;  4OIR F;  2E71 A;  4DJA A;  1W0T A;  3H92 A;  4NHJ A;  2JZY A;  1UEL B;  2KDO A;  2DA1 A;  4BAY A;  2LRD A;  3K4K A;  1U0J A;  4AVP A;  3CQZ J;  2JRM A;  4YEJ A;  3CMY A;  2K3F A;  1YHQ I;  2MH9 A;  5K5Q A;  2BY1 A;  1REP C;  3KP6 A;  4LG0 A;  2GXA A;  1MSF C;  3DEE A;  1RR7 A;  1BIA A;  2ZKZ A;  3RZD J;  1KGS A;  2FNA A;  4I2O A;  1RI7 A;  3VWB A;  4IQ4 A;  1MBJ A;  3ISP A;  3E6D A;  1PVE A;  4ZTF A;  4IRI A;  3ZMD A;  2D1V A;  2DOF A;  5J1U A;  4BYY A;  4HSR A;  2M7B A;  4S05 A;  2P7C B;  2L2O A;  1XCV A;  3U1D A;  3O6B B;  3DBL B;  3JSO A;  2M3A A;  1SVL A;  1LE8 B;  1JT0 A;  2VUM J;  2A68 F;  1TT5 B;  2HYF A;  3SJM A;  5ICG A;  1TC3 C;  3SDB A;  3HUG A;  2CS3 A;  1XDU A;  2DMQ A;  2VE8 A;  4CYC A;  1TZL A;  2QCO A;  2EBI A;  4ZDL A;  3OIP A;  3J81 K;  4V2F A;  1WH5 A;  3K4C A;  1SAN A;  2KIU A;  5DM7 F;  3U21 A;  1VQP I;  2RC4 A;  2K9L A;  3CJR B;  3PSF A;  1MJB A;  2V6C A;  4Y52 J;  2D1H A;  3LSP A;  4BHP A;  4HNT A;  2EK5 A;  4WCG A;  3U2R A;  3T5X A;  4R79 A;  3WE2 A;  3REO A;  4A5N A;  4UXN A;  5EF6 A;  3MEX A;  3BT9 A;  3Q0V A;  4I02 A;  4HF0 A;  5BNG A;  1IJW C;  2DDA A;  1IV6 A;  2QSG X;  3V4G A;  3BJO A;  1SVO A;  3ZQQ A;  3N4M A;  2M8E A;  3DU5 A;  1RUN A;  4CIC A;  2KPM A;  4G7Z F;  5EYR A;  3D1N I;  3WTU C;  5KVR A;  2FQ3 A;  3L00 A;  2J5O A;  2L7K A;  1IO2 A;  3EET A;  3QAH A;  2FOK A;  3WG7 H;  3OS2 A;  4EJO A;  2CW7 A;  2HOT A;  3HYI A;  1A04 A;  1HW2 A;  1HOM A;  2E2J J;  2JA5 J;  2BEO A;  3PO2 J;  1QZY A;  2CO5 A;  3I64 A;  4LG0 B;  2ICW G;  4BNC A;  2HWV A;  1POG A;  4GDF A;  4HX4 A;  2XHK A;  4A3C J;  1J09 A;  1GUU A;  2F5V A;  3CMM A;  1YQA A;  1LDK B;  1IRF A;  1NH3 A;  2W82 A;  2WTE A;  5D4S A;  1GDT A;  2HYJ A;  5BPI A;  1BI1 A;  3HGG A;  4KN7 X;  2A05 A;  4XL9 A;  2IT0 A;  3HOV J;  5ICC A;  2XF6 A;  2LKS A;  3CME I;  3CC4 I;  3V8J A;  5D5V B;  4M9S A;  3FX3 A;  1G2H A;  4LIV A;  1WJA A;  2M45 A;  4QIW N;  3GW2 A;  1VQN I;  2E5N A;  3HL2 A;  3SDG A;  2R4G A;  1VQ5 I;  1P9Q C;  3S3M A;  1OCO H;  2Z33 A;  3KP4 A;  3CCV I;  4XOT A;  4CYC B;  1Y1W J;  1PP8 F;  1W36 D;  2I10 A;  4CCL A;  3ZP5 A;  4E7L A;  3JAM Z;  4IOC F;  3P5J A;  4M6V A;  1ZH5 A;  4WF2 A;  4IHV A;  2G7U A;  3FM5 A;  2ZSH B;  3GF2 A;  2V1N A;  2W57 A;  1XSX A;  1ONV A;  3P9C A;  2WBM A;  1P92 A;  4HBL A;  1D3Y A;  4PJM A;  3FK7 A;  4B47 A;  2XSD C;  2JUC A;  4MEY F;  4A0Y A;  2H6B A;  3HOZ J;  3BY6 A;  3BR5 A;  2F5E A;  5A2Q Z;  2MA3 A;  2WAF A;  1JJ8 C;  3JR9 A;  1JXS A;  1W5C C;  1BOB A;  2E60 A;  4XLN F;  1QHH D;  2WAQ A;  1JUP A;  5F0C A;  3KIO A;  1F36 A;  3CJN A;  2MD5 A;  2HOS A;  4BE2 A;  4HST A;  1U6G A;  2FEZ A;  1F5T A;  3MZH A;  3FMS A;  1B1B A;  2PMH A;  4DYR A;  4FX0 A;  2DDB A;  4M74 A;  1WKM A;  4Y15 A;  3S3N A;  3PQK A;  1Y0N A;  2NNY A;  2P7V B;  2H1K A;  3HRS A;  1TLH B;  1WJC A;  2IW5 A;  1SMT A;  5J47 A;  3MQ0 A;  1ETQ A;  4PSX A;  2PN6 A;  1R5I D;  4HNV A;  3HRM A;  2A6T A;  1PJR A;  4ZYH A;  1MH4 A;  1M1E B;  3OYA A;  2NOG A;  4ZTJ A;  3LFK A;  2EFN A;  1R1V A;  3MFK A;  4FIS A;  1F43 A;  5M3M J;  2LKP A;  4U87 A;  4H4K C;  5H6R A;  4IPA A;  3ZMV A;  1T56 A;  5L3C A;  3ZQC A;  4I01 A;  3OYN A;  3KET A;  1SFE A;  3J7A Y;  1OQY A;  4G9Y A;  9ANT A;  1D0Y A;  1D5V A;  1DQU A;  2ZJ2 A;  1BC8 C;  4Q47 A;  3U9G A;  5IT9 Z;  4E7K A;  4MQ9 F;  1ODD A;  3JRD A;  2VL8 A;  1E3O C;  1G3W A;  1ZHF A;  2VXD A;  2ELH A;  3I4N J;  5C3E J;  3DTE A;  2FNP A;  1IN7 A;  2PJR A;  2L4A A;  2OU2 A;  2LOO A;  4RLF A;  3H1C A;  4UV9 A;  4QPQ A;  5DCF A;  2RQP A;  1AOY A;  4JX4 A;  4IHT A;  1IRG A;  3ASO H;  3DEW A;  4KT6 A;  2XF5 A;  2WAD A;  4B1R A;  2WV1 A;  5M5Y J;  2XRL A;  4CO8 A;  1VQ7 I;  3S15 J;  3HKZ N;  5EG0 A;  4A3L J;  4DGW B;  5B3S H;  3IL2 A;  1BW6 A;  1P7I A;  2LR8 A;  3K9T A;  4Y13 A;  3GFL A;  1R58 A;  4XLF A;  5C4J J;  3CLQ A;  4MIM A;  4XLC A;  5M3F J;  1R1T A;  5LHH A;  3FXO A;  2BYV E;  3K1M A;  2ZFW A;  3MCZ A;  2CGP A;  4RAY A;  2GIV A;  3K0L A;  2RNJ A;  2IGM A;  1JTY A;  1HA8 A;  1ETY A;  3H35 A;  2JT1 A;  3OYH A;  3DTI A;  1BR4 A;  3SZP A;  2ZME C;  5IPA A;  1JT6 A;  3CCU I;  3GME A;  1ZG1 A;  4ZZL A;  1U9N A;  3IAM 2;  2EH3 A;  4JQF A;  4RAF A;  2CWE A;  1X1C A;  5J3L A;  2GWR A;  4B3A A;  3I0T A;  2DQR A;  1O7F A;  2R5Z A;  4OIN F;  3O8G A;  3ZRG A;  2Y75 A;  4XK4 A;  3JRB A;  2VKH A;  1X2N A;  1KA8 A;  2KZV A;  4N4N B;  4BY1 J;  1FOX A;  2LC2 A;  3N97 A;  3GTM J;  3FHZ A;  3LSR A;  1MBF A;  4BJT A;  1A31 A;  3LSK A;  1SD6 A;  3BZK A;  2XAU A;  4BJ5 C;  4KA4 A;  1I6H J;  1UAA A;  5B1A H;  3LST A;  3BPX A;  2PJR B;  4D5F A;  1APL C;  4IHS A;  1AA7 A;  3VEP A;  2KP6 A;  2X51 A;  2Y31 A;  3WG9 A;  4MO7 A;  1FPQ A;  1LDD A;  2DI3 A;  4XMY A;  5HLT A;  3OYF A;  3BG9 A;  1ZQ3 P;  2JVH A;  5AIP A;  5DM6 F;  3DU6 A;  2KT0 A;  4PFP A;  2R7W A;  1OCC H;  2A69 F;  1I1G A;  3BDD A;  2M4K A;  1E0E A;  5IP6 A;  3CDI A;  5FD6 A;  5EG0 B;  1Z0X A;  3BOQ A;  4A3B J;  2W1O A;  3PFY A;  1BC7 C;  1RR8 C;  2FXA A;  3I55 I;  3C2H A;  1S8N A;  1OJL A;  1LVK A;  2IS2 A;  2OV7 A;  2STW A;  3GBG A;  2R7U A;  3JRI A;  2ETH A;  5BMZ A;  1I50 J;  3JAM K;  1J7K A;  3S14 J;  3OS1 A;  3M7G A;  2P5V A;  3GFJ A;  2QZ8 A;  2XKP A;  2HVR A;  3TDZ C;  1XG1 A;  4CGZ A;  2F4I A;  5EGO A;  3M8J A;  1R49 A;  3PM1 A;  5F0F A;  2BOL A;  1MBK A;  2M34 A;  3VB2 A;  2DYR H;  1DPR A;  5LHI A;  5A2Q K;  2OCC H;  1I1S A;  2IRF G;  1SMY F;  2E1M C;  4AVZ A;  4I09 A;  2QKL B;  1MJ9 A;  2R5Z B;  2BHZ A;  3HRU A;  4BGD A;  5ILV A;  1VI0 A;  1WJD A;  4UB6 C;  4C2U A;  2OPT A;  4G6T B;  3CCE I;  1IF1 A;  2VN2 A;  1CF7 A;  5FKK A;  2BY2 A;  1U2W A;  1X58 A;  2DT5 A;  2IS4 A;  1HF0 A;  2O03 A;  3OYG A;  4PK4 A;  4ZJZ A;  4AIJ A;  2JA8 J;  5TIS C;  2FQ4 A;  2XPW A;  4HPQ A;  2CSO A;  3AG4 H;  5LGU A;  2LFB A;  3IWF A;  1YIT I;  1BR1 A;  2VQC A;  4PDK A;  5B5E C;  2WB1 N;  2FMY A;  4X1E A;  1EF4 A;  4Y7N J;  2FU4 A;  4C30 A;  2DOA A;  2KKO A;  1VQ8 I;  1I3Q J;  4BQO A;  4S04 A;  1N78 A;  5TGT A;  1ON2 A;  1ZYR F;  3WU2 C;  3G1O A;  1WFX A;  2CQ7 A;  4PSW A;  2R3S A;  1NG6 A;  2QQA A;  4RAZ A;  1EJ9 A;  2F2E A;  2XB0 X;  3PIP F;  2HYG D;  3BPV A;  2ZSI B;  3VYR B;  3CJT B;  4V2G A;  2QSH X;  3J7Y J;  2ID3 A;  5LFA A;  5IT9 K;  4NBQ A;  4HG2 A;  3V7C A;  1UHW A;  4C3I J;  3LQR A;  3F23 A;  1QVT A;  2IBD A;  4RM2 A;  5K1Y A;  3VOD A;  1SC7 A;  4I98 B;  4N9H A;  1GV5 A;  4Y4R A;  2I5U A;  5J1R A;  3IKT A;  2VBY A;  4PFO A;  4EVI A;  2O0Y A;  1LEB A;  5EGO B;  3OYM A;  1AKH A;  2LG4 A;  4II3 A;  2FOW A;  1N77 A;  3BTC A;  4DOZ A;  2A3S A;  5E3N A;  2XB5 A;  2FSW A;  2F48 A;  3C1D A;  4CH7 A;  1XMK A;  1Y8Q B;  3ZCO A;  2PMU A;  1YLF A;  2DLL A;  1FSE A;  2XAG A;  4F3Q A;  5F1J A;  5CQE A;  4EV0 A;  4ZYA A;  3BQZ A;  3QU3 A;  3FDY A;  3S3O A;  3QOE A;  1JTX A;  2N8G A;  3AG3 H;  3WU0 A;  4J19 A;  1CF7 B;  1ZG5 A;  3GXO A;  3IRR A;  5H2F C;  4M3F A;  2Y2Z A;  4YIF A;  1JHF A;  4DW6 A;  1Z05 A;  1V3F A;  2L9R A;  5E20 A;  3OS0 A;  1FTZ A;  3LAP A;  3BRO A;  1FLI A;  2R7R A;  1ZR4 A;  4WXD A;  3KLN A;  4DIQ A;  2EZL A;  1MNE A;  3G1L A;  4CDG A;  4KN4 X;  4XN3 A;  1KQ9 A;  4V19 K;  3K70 C;  4BE1 A;  5HVQ C;  2ZXH A;  4B43 A;  2LP0 A;  1B8I A;  2AQF A;  1ETK A;  3A01 B;  3KP3 A;  2GIZ A;  2IAI A;  4LGW A;  2PG4 A;  4XQF A;  4M3B A;  4XKV A;  5FFZ A;  4EM2 A;  1WSU A;  2GLO A;  3S2W A;  2EB7 A;  4J00 A;  2W00 A;  3WTS C;  5J1Y A;  1HLV A;  1IAW A;  1HKT A;  1Z1D A;  4XRF A;  1WI3 A;  3BG5 A;  1OR7 A;  2Y9Z A;  5FD5 A;  4A12 A;  2F5F A;  5FLX K;  1G6N A;  2EV6 A;  4IEJ A;  4KIG A;  5BOX A;  3VYU B;  2QA4 I;  3W6V A;  2V1D A;  1NK2 P;  3HXL A;  1FZP B;  1X3U A;  1XGN A;  1LDJ A;  2KIM A;  5M5W J;  3MKY B;  2WAE A;  5IYD J;  4M3D A;  1MIJ A;  1VF9 A;  4BHC A;  4AU7 A;  1LJ9 A;  4EJT A;  4CA0 A;  4M73 A;  2M0M A;  2DQL A;  3ROU A;  4BXU A;  2V1X A;  4B4C A;  3H9Q A;  3TP3 A;  4ZH4 F;  2XAF A;  2BY3 A;  2PMZ A;  4E70 A;  1AKH B;  2DT7 B;  4Q5S F;  1FBQ A;  2HOA A;  3VFZ A;  1AHD P;  1FP1 D;  1OIS A;  4PJL A;  2GQQ A;  4RMN A;  2UXX A;  4MTE A;  1OFC X;  1R1U A;  3S32 A;  1T0F A;  4E4H A;  1Z7L A;  1MMG A;  1Z21 A;  4BJ6 C;  3H3V K;  2RVC A;  5GAE J;  3AL0 C;  1MND A;  2K86 A;  2DXI A;  3F8B A;  4AC0 A;  1HW5 A;  2CFO A;  2EFW A;  3HJE A;  3PQJ A;  3LSJ A;  1U78 A;  1HXD A;  3IH4 A;  2R5Y A;  2MW8 A;  2HU9 A;  3TP0 A;  2HQA A;  1PUF A;  3MKL A;  3L2C A;  3OYC A;  1VFC A;  2BZT A;  3ZN1 A;  3ZQL A;  1UST A;  3JSP A;  4AIH A;  3COA C;  3MZ8 A;  1T2K A;  2Y69 H;  4P1W A;  4LB6 B;  5E18 F;  4G6D A;  2DAO A;  3EUK L;  4G12 A;  1BN5 A;  2DMT A;  2F5D A;  2IA2 A;  3DP7 A;  1J75 A;  3S17 J;  4HNU A;  1LE8 A;  4XSZ F;  2HQN A;  3E5U A;  1XCB A;  3HGY A;  3TDU C;  1B8I B;  4U0V A;  1W1W E;  2HVQ A;  3S1N J;  3QYF A;  2DA5 A;  1YRN A;  5D6F A;  1UJ8 A;  3CO6 C;  1K7A A;  1JKQ C;  3SZT A;  3OYL A;  4IRH A;  4HA8 A;  2KZG A;  1MNM C;  1MMD A;  3DKW A;  3EYY A;  4XRS A;  3GFI A;  2Y48 A;  3E5X A;  4P5O A;  3KEO A;  3UR3 C;  3ASN H;  2YU3 A;  2R0Q C;  1Z6T A;  2FRH A;  4AD9 A;  1K4S A;  3M8E A;  4RB0 A;  2OC6 A;  2MLG A;  2VLA A;  1RIO H;  3FK6 A;  2V79 A;  1A6I A;  4PJ0 C;  3T8R A;  4CHU A;  2M7A A;  3SXY A;  5JHU A;  2FJ1 A;  2VJ5 A;  2V9K A;  3IC7 A;  3H5R A;  4HV5 A;  3L1P A;  3DFG A;  2GBY A;  3HHG A;  4A0Z A;  5F04 A;  5JVT A;  5D4R A;  1NK3 P;  3EPZ A;  4S0H B;  4YII A;  2E19 A;  5FGM A;  3LOC A;  3LSG A;  3I53 A;  2QM3 A;  4KMF A;  5D5U B;  3K2Z A;  3CLO A;  2XPV A;  2Y0S A;  3FM3 A;  2HDC A;  1YE9 A;  5FRO A;  2RNG A;  1XN7 A;  2EIN H;  2VOO A;  4BXX J;  1W7P D;  3S16 J;  1O3T A;  2BGC A;  2KFD A;  2GXG A;  3LA3 A;  4XID A;  4L9N A;  4BKX A;  2ZJR F;  3F8M A;  3HZJ A;  5IY5 H;  4A5M A;  1PUE E;  1ZGW A;  1V5E A;  3RKW A;  3ZQI A;  3CD6 I;  4JK1 X;  3GWZ A;  1NTC A;  1V5F A;  5EZH A;  2R5Y B;  3TW7 A;  1KZH A;  4A69 C;  4OAY A;  1VQ6 I;  3PIO F;  4ITV A;  1PUF B;  4LFU A;  1V5G A;  3HTU A;  2R7V A;  2ZXW H;  4UV8 A;  3GX4 X;  3Q0U A;  3CCL I;  1E17 A;  2NS8 A;  3ZPL A;  2DTR A;  4LIU A;  4A6D A;  4XIC A;  3VOE A;  4C3H J;  5FRN A;  3A0B C;  2E1O A;  3RPU A;  2KJC A;  1YX3 A;  3ABK H;  3IP4 B;  4I7H A;  3BR6 A;  3E7L A;  1YRN B;  2MAB A;  2LY2 A;  2LKX A;  3TO9 A;  2LRE A;  2VE9 A;  4HDU A;  4B3X A;  4ZC3 A;  1XD7 A;  2I8D A;  3IV5 A;  1AWC A;  5J40 A;  1MBE A;  1MH3 A;  4FHT A;  4Z6Y A;  2HTS A;  1ETO A;  4MQV A;  4MEX F;  2O61 A;  5IYB J;  2MBF A;  1OCP A;  4UB8 C;  4EM1 A;  4X0G A;  4O5V A;  2DK8 A;  3E0J B;  1OYW A;  1VZ0 A;  4FQG A;  2OAZ A;  3F21 A;  3GZ5 A;  4UY8 I;  1Z67 A;  3KZI C;  1ACI A;  1X19 A;  2A6H F;  1LQ1 A;  2V6E A;  3RPU D;  4EMS A;  1USS A;  4NC6 A;  1Q1H A;  4L5J A;  3H5A A;  3WGH A;  3W2W A;  5LBQ A;  3RQ4 A;  1YS6 A;  2XGD A;  2R7Z J;  1SD7 A;  2H09 A;  2OQR A;  3M07 A;  2NNN A;  4BU2 A;  4UNO A;  2VC1 A;  2CMP A;  1W5S A;  2VQL A;  4M3E A;  1IRX A;  3TW6 A;  3ML6 A;  2Z9O A;  3CMA I;  2K5C A;  1FOK A;  3R6S A;  3KYC B;  4FE7 A;  4BE0 A;  3CDH A;  3R61 A;  3K10 A;  5D8K B;  1ZRC A;  2DA7 A;  1TL8 A;  2G7H A;  5HLH A;  3R60 A;  3DKY A;  1YX5 A;  4NC7 A;  4RB2 C;  1WJE A;  1O3S A;  2W25 A;  3DF8 A;  5ERI A;  4L9V A;  3OYK A;  1TWH J;  3L9F A;  5FKN A;  4MTD A;  3PSI A;  3A1Y A;  3GYH X;  3IWZ A;  3E6B A;  4Y17 A;  2HGC A;  2GA2 A;  1IN8 A;  2CFX A;  2K4J A;  5C4X J;  3PO3 J;  1FC3 A;  4UUT A;  2Y9Y A;  2G0E A;  5KK1 A;  5D5W B;  2RKH A;  3HPH A;  3OR1 C;  2EA2 A;  4ASN A;  3TO6 A;  1MBG A;  1QO0 D;  1Z3Y A;  4FTH A;  1KYZ A;  5HNH A;  1D0X A;  3L09 A;  4A2U A;  1R4N B;  4EEF G;  5E3O A;  2CUE A;  5GPC A;  1TTY A;  3B6C A;  3ECH A;  3JRC A;  1ZEL A;  4U0W A;  1E3P A;  3K1P A;  4RDU A;  3F22 A;  2L7F P;  4EJU A;  4PUS A;  4LLN A;  5CVU A;  2LDU A;  3OSG A;  2ECB A;  1DU0 A;  2H8W A;  3X2Q H;  4ENN A;  2RRE A;  2LNB A;  2R7O A;  3NWS A;  3RYR A;  2UV1 A;  2K9Q A;  2KIQ A;  3ABU A;  3BG6 A;  4PGG A;  3VYT B;  3VSK A;  2K27 A;  1I6X A;  1WGX A;  2RN7 A;  2VT3 A;  4LMY A;  2IPQ X;  2HFH A;  4XN0 A;  1KU9 A;  1G3T A;  4JP0 A;  3DWL E;  5H6Q A;  2UXN A;  3BQY A;  3K4N A;  3TO7 A;  3H0D A;  2CV1 A;  1XSV A;  4YFX F;  1W0U A;  1GVD A;  3ELK A;  4GYI A;  1MDM A;  4DQ2 A;  3JRF A;  2VPL A;  1WH7 A;  3BCB A;  1RKW A;  1WZ2 A;  3S1Q J;  2FBK A;  5DUK A;  1FTT A;  4CZZ A;  3FXR A;  2Q8K A;  1Z3X A;  3MVP A;  4E7H A;  4Y3O A;  3OMY A;  1T95 A;  5FJ8 J;  2IA1 A;  3OOP A;  2BVM A;  2CUZ A;  3WGI A;  2XRO A;  3RJP A;  1B6A A;  1J2X A;  3MD2 A;  2PBI A;  2VQG A;  3PNY A;  2V9V A;  1H8A C;  3ONQ A;  5GPA A;  3WTT C;  1ETW A;  4QLC U;  3GTG J;  2P0W A;  1X2M A;  1FSH A;  3F72 A;  1ZRF A;  4IXA A;  4E7I A;  2COM A;  2XUB A;  2FE3 A;  4YFN F;  2CW8 A;  3QQA A;  4F91 B;  2YX7 A;  2X1E A;  5K7Z A;  2L5Q A;  4BL0 B;  2HOE A;  2KRH A;  1OLT A;  4HX8 A;  5GTH C;  4KDP A;  3CCY A;  1TP4 A;  3DPL C;  2NS7 A;  1R23 A;  4KJZ A;  4U7D A;  2H94 A;  2EIK H;  5J8C A;  4ENM A;  1EH6 A;  1BI0 A;  3P9K A;  2BHY A;  2GAU A;  3DLL F;  3FWE A;  5J8F A;  2VKD A;  3CUQ C;  1QA6 A;  1FBU A;  3SEZ A;  3ZOB A;  4U0Y A;  1UG0 A;  1LUJ B;  1X1A A;  3EQL F;  1S29 A;  4HF1 A;  3HOW J;  2O3F A;  3JTG A;  3HOS A;  3HSE A;  4NQW A;  4FAS D;  1HST A;  3LQQ A;  1HKQ A;  1IG7 A;  2QBY A;  3DKX A;  1LNW A;  3FHN A;  2XSJ C;  2CRG A;  2ESH A;  4RLQ A;  4MFD A;  4OIQ F;  4HQM A;  3ERE D;  1QU3 A;  4HW0 A;  3H0G J;  3RKY A;  2OTJ I;  1K6Y A;  5GAD J;  2QQB A;  2WAQ N;  3SFZ A;  5LGN A;  3LMM A;  2O8X A;  4DBR A;  4KIB A;  1SAX A;  4CCN A;  3W2A A;  1MDM B;  1OCR H;  1WVR A;  2O7O A;  2E2I J;  4KMU X;  1RKT A;  3CC2 I;  3MAJ A;  4P96 A;  4LD5 A;  4AYB A;  4G8X A;  3IUO A;  3IH2 A;  3VDX A;  1R22 A;  1RRJ A;  2XGC A;  1QGP A;  3FBN B;  3G1M A;  3L2U A;  3HOX J;  2ZME B;  1RC9 A;  4A3M J;  2KL4 A;  2CJJ A;  2FBH A;  1UZC A;  1Z91 A;  3G6E I;  3TL4 X;  5FKL A;  5JLW A;  1IV8 A;  1PYV A;  1XC5 A;  4FET A;  2CQK A;  2OTL I;  3NRV A;  2HDW A;  5FLX Z;  2UUZ A;  1IDZ A;  1YS7 A;  2BY0 A;  3EUH C;  4L0Y B;  1XX5 A;  2W7N A;  3E97 A;  3OYB A;  2CG4 A;  2VIX A;  2HPM A;  3L2W A;  2B7E A;  4IO9 F;  3HPG A;  2R7Q A;  3WE3 A;  5HLG A;  2JPB A;  4C3J J;  3KYD B;  1R4M B;  2CU7 A;  1G4D A;  4E6K G;  1C0W A;  3C18 A;  2IS6 A;  5DV5 A;  2HTJ A;  2P6T A;  5HS8 A;  2EWN A;  1FNN A;  3NAU A;  1H9T A;  2M5W A;  3C7J A;  2COB A;  5IP7 J;  1BA5 A;  4LK1 F;  4IX7 A;  1Z6R A;  4C9Y A;  1R9T J;  1NHA A;  2BVL A;  3QOP A;  5IP9 J;  2L7M P;  4NQW B;  4G6Q A;  1A6Q A;  1HW1 A;  1TW3 A;  3JRA A;  1Y39 A;  2QBY B;  2ZB9 A;  1YIO A;  4HX7 A;  1KQ0 A;  5E8G A;  3E6C C;  3FMQ A;  1SAU A;  5CPR B;  4A3E J;  4HZF A;  3RI4 A;  2EFP A;  2W4S A;  3RKQ A;  2NVU B;  3ZQF A;  5JFR A;  4XM3 A;  2A6E F;  2DTZ A;  3KCC A;  1MW7 A;  4I0B A;  3HIF A;  1E3H A;  1O3Q A;  1T08 B;  2YX4 A;  1ZR2 A;  1GHC A;  1VTN C;  1EA3 A;  2FX0 A;  3K6G A;  1MMN A;  3EDP A;  1I27 A;  2DMP A;  4N4O B;  2MGQ A;  1V55 H;  3Q9V A;  1RZ4 A;  3HHH A;  1BIB A;  3TED A;  2PLY A;  2R93 J;  4I76 A;  2E7X A;  2GOX B;  1UG2 A;  3BP8 A;  4ABZ A;  2BBY A;  2HQ5 A;  4G7O F;  1BBY A;  2E1M B;  1JKR C;  3UNG C;  5HDG A;  4BEH A;  3HRT A;  3R0A A;  3OSF A;  3GTO J;  2QWW A;  2A61 A;  1FOY A;  1T98 A;  2P81 A;  3DV8 A;  1W4M A;  2XAH A;  3BJA A;  4KUM A;  1MBH A;  4MGR A;  3OYD A;  4D7M A;  2MYS A;  1TQP A;  2BXZ A;  5EEG A;  3IAS 2;  3BC8 A;  4P55 A;  5GTI C;  4R8H A;  2HNH A;  4E7Z A;  2R7S A;  3LSM A;  4BBS J;  3M8F A;  3A01 A;  2CUF A;  3K2A A;  2VKE A;  2RAE A;  1JKO C;  2ISY A;  2R7T A;  4RGU A;  5TRD A;  4CUG A;  2Z3Y A;  2XVC A;  1ZKG A;  2ZJQ F;  2CQQ A;  3ZMS A;  1UMQ A;  3LWF A;  5FFX A;  1STZ A;  3H9G A;  3WTX C;  1QBJ A;  5DEQ A;  3BJ6 A;  4D9J A;  3ZMU A;  3JRE A;  2IA0 A;  2X85 A;  1BI3 A;  1QHG A;  2LVS A;  1TWG J;  1V4R A;  3I59 A;  3K4B A;  4XLA A;  1HC8 A;  1FWZ A;  2JSP A;  3ZGK A;  3F6O A;  2GM4 A;  4BXF A;  1S7A A;  1T33 A;  1XMX A;  3LAJ A;  1K61 A;  4XON A;  2X6O A;  2V7F A;  5EDN A;  2DOE A;  5DUI A;  4K2E A;  2PFB A;  5AIQ A;  4OWR B;  1WJF A;  1PP7 U;  2KDZ A;  1JKP C;  2CYY A;  1UHM A;  2MC3 A;  3TOA A;  1R7J A;  2VBX A;  3PUF A;  2NVY J;  2X0L A;  5HLI A;  5JLX A;  3K4M A;  1FMW A;  3KEY A;  3K70 D;  3CES A;  4JX6 A;  1IZ1 A;  3U1K A;  1IXS B;  2VKV A;  3FKJ A;  3EYI A;  3LSI A;  2ESN A;  2RV8 A;  4L18 B;  4WX9 A;  5E1Z B;  1UCR A;  1PDN C;  2FD5 A;  2EIL H;  3WGG A;  2NVX J;  2IGO A;  2WC2 A;  3RZO J;  4RA2 A;  5E17 F;  2A5W A;  1G3Y A;  1FBS A;  2E36 A;  3AG2 H;  4OIO F;  2QYO A;  4GGG A;  2V1U A;  2K9N A;  2DMN A;  2KJB A;  3CF2 A;  4BEH B;  3TQN A;  5JVG F;  3D5L A;  4XOP A;  2FML A;  2Z1D A;  2W24 A;  3S2D J;  3RTR A;  1X1P A;  2QUF A;  1I39 A;  4P9U A;  3FZV A;  5E79 C;  2XF7 A;  1F9N A;  2HR3 A;  5FKO A;  4AID A;  2EJR A;  3O2P E;  5D5X B;  4HLY A;  3GTQ J;  1QPM A;  1OCZ H;  2Z5U A;  3FXM A;  4L9T A;  4ESF A;  3AKZ A;  1XGS A;  3HBL A;  4YFK F;  5BQT A;  2ECC A;  3AFH A;  1XSD A;  3WTW C;  1WI9 A;  1RNL A;  1ULY A;  1ENH A;  3ERM A;  3J7A O;  5LRR A;  1X4O A;  1YG2 A;  1BW5 A;  5F6F A;  4Q4Z F;  3E1S A;  1WWX A;  2CH0 A;  4HYE A;  4Y33 A;  1Y1V J;  4D5C A;  1P7J A;  1S3J A;  3I59 B;  4O3M A;  1ZGA A;  3PNT A;  2LY1 A;  1ZGJ A;  4A6E A;  5LLQ A;  2B63 J;  3KE2 A;  4B8X A;  2XAJ A;  4CCK A;  1P4W A;  1MMS A;  3CP2 A;  3B02 A;  3C2G A;  3OYJ A;  4ENJ A;  2A07 F;  3N05 A;  3F3X A;  4BDY A;  1SD4 A;  1HDD C;  6PAX A;  1UHS A;  4W97 A;  5J4V A;  5C44 J;  2KQR A;  2VAS A;  3DPT A;  1U8B A;  2LSO A;  1R5H A;  2BV6 A;  3KZZ A;  3V7R A;  1T6S A;  4LIT A;  1O57 A;  1P4X A;  4RB1 A;  2H8R A;  5FRM A;  4RS8 A;  4XNF A;  2ELK A;  3DTK A;  3RCO A;  1XTA A;  2LTP A;  4DBQ A;  5EEH A;  3FIW A;  2GZW A;  3HOT A;  4HDV A;  4P9F A;  1YW9 A;  2L9S A;  2OF7 A;  1ZAO A;  1O7L A;  3M1C A;  1TWF J;  3PL8 A;  4KFC A;  3AL0 B;  1B4A A;  5ED4 A;  3AAF A;  1BL0 A;  5CQG A;  5B66 C;  4ZZD A;  4H0E A;  3BG7 A;  2JA6 J;  1R5G A;  3GCM A;  5FLM J;  3WU1 B;  5EJC A;  2OD5 A;  4M6Y A;  4E7S A;  2K40 A;  3RPQ A;  1ETX A;  3FXL A;  2ELJ A;  3BZC A;  4L5E A;  2HXO A;  5LHG A;  3GTL J;  3OY9 A;  2LD5 A;  1B9M A;  4YEL A;  2LMD A;  4HV6 A;  1FOW A;  2ZCW A;  3OYE A;  4BHB A;  2KIF A;  2VJI A; 
#chains in the Genus database with same CATH homology
 1W5T A;  4UVC A;  1W7P A;  4ETS A;  3W6K B;  2WWY A;  2XAQ A;  5DDG A;  1YTY A;  1MGT A;  3Q5F A;  2E7W A;  4N9I A;  2ADU A;  1U5T C;  2CW0 F;  2TDX A;  4QWQ A;  2Q2E A;  4KIF A;  1SFU A;  3E6M A;  1OMI A;  1IXC A;  1S6L A;  1YO5 C;  4M6X A;  3WTV C;  4OIP F;  2ZBK A;  2XIG A;  4LLL A;  1H9G A;  3HSR A;  2VOD A;  3KP5 A;  3ZN0 A;  1FYL A;  4M72 A;  2HZT A;  5CVI A;  1LVA A;  1LB2 A;  3CTA A;  3JW4 A;  1FP2 A;  1H0M A;  4RGR A;  1K6O A;  4EGZ A;  2FF4 A;  3V8L A;  1IW7 F;  2P5L C;  2K02 A;  2NS0 A;  1DP7 P;  2X4H A;  1FT9 A;  1KU7 A;  1QNT A;  2QQ9 A;  1Y0U A;  5ICF A;  1W7P B;  2JSC A;  3QU6 A;  1OYY A;  4IRG A;  1U3E M;  1ZLK A;  2YR2 A;  2JTV A;  5DD8 A;  5DCM B;  2DPD A;  4AIK A;  5L3G A;  4EJW A;  3QP5 A;  4WK8 F;  3BZ6 A;  1OPC A;  4UUV A;  4L9J A;  2OBP A;  1ZAR A;  2ZXJ A;  1F1Z A;  3H3Z A;  4ON0 A;  4U88 A;  2VOP A;  4Q48 A;  2YPR A;  1R00 A;  4FX4 A;  2W85 A;  2WV0 A;  2PQ8 A;  3ZQ7 A;  4WXH A;  1K78 A;  4CXF A;  3GFM A;  3RIR A;  1KU2 A;  1YW8 A;  5JR3 A;  3P7N A;  1FYK A;  2P5K A;  2XV4 S;  3IKV A;  2UWM A;  4DNC A;  4WWC A;  1TQI A;  2JRT A;  4TV7 A;  5ICE A;  2VON A;  3R4K A;  3J80 K;  3GUD A;  4LLG F;  1XGO A;  3M9A A;  2B0L A;  3CUQ A;  4GO1 A;  1J5Y A;  2Q0O A;  1MKM A;  5E1X A;  1S7O A;  1B9N A;  1TNS A;  4XSX F;  1EH7 A;  2H27 A;  1YW7 A;  2W84 A;  3G3Z A;  1L0O C;  3WTY C;  1ZRD A;  5CLS A;  5L3E A;  2EFQ A;  1I5Z A;  4KYW A;  1P4A A;  2MLK A;  2ZME A;  1IN5 A;  2AS5 F;  2HEO A;  4G94 A;  2HKO A;  5JI6 A;  1MJA A;  1XB4 A;  1UFM A;  2P4W A;  3W6J B;  1K78 B;  1ZN2 A;  5HDN A;  4Z2Y A;  2VC0 A;  2OZU A;  3ZMT A;  2UZK A;  5K5O A;  2EV5 A;  5LEJ A;  1KYW A;  1HKS A;  5CJ9 A;  1QQI A;  5DYM A;  1YFH A;  1FX7 A;  1MZB A;  2P8T A;  3EUH A;  1UB9 A;  4RGS A;  1T39 A;  3T1B A;  1DDN A;  3GEZ A;  3LA7 A;  3T0Y A;  4XLP F;  5D6E A;  3E5Q A;  4D0P A;  2VT2 A;  2M87 A;  4KNY A;  5E1W A;  1ZLJ A;  4PZJ A;  4ESB A;  2HKX A;  1LEA A;  3CUQ B;  1P6R A;  3I4P A;  3KEQ A;  3NQO A;  5F1R A;  2XGX A;  5IT3 A;  1E2X A;  2K7L A;  5CVV A;  3SHF A;  5D8L B;  5CYV A;  3KFW X;  5LGT A;  5DD4 A;  4N0B A;  1IUY A;  4JBA A;  4GYG A;  4B09 A;  3V8K A;  3HSF A;  1J9I A;  1IN6 A;  2L02 A;  2PJP A;  1SFX A;  3MWM A;  3E3V A;  3PFI A;  3FXQ A;  2L3D A;  1WRJ A;  2GA1 A;  3DEU A;  3T8T A;  4BH9 A;  1CGP A;  4NB5 A;  4F7Z A;  2AXL A;  4KIC A;  2HQR A;  2F5C A;  1J59 A;  1TNT A;  3FMR A;  4YG2 F;  1KQ8 A;  3TOB A;  1XMA A;  5ILS A;  3WTZ A;  5HS9 A;  2R7F A;  2MH2 A;  3QRF F;  3DXJ F;  3OV8 A;  1TQM A;  2ZNY A;  1R36 A;  2DFI A;  2OQG A;  3P9I A;  5J6X A;  2DBB A;  4OOI A;  2P6S A;  4RB3 C;  3SQN A;  5LRS A;  2GXB A;  4LJZ F;  2XKO A;  2ZO4 A;  2FA5 A;  5FB2 A;  1G3S A;  5L3F A;  3O3K A;  2VXZ A;  4A0X A;  4R1H A;  4EQQ A;  3K1N A;  3D0S A;  2L54 A;  1OKR A;  1EV7 A;  1P2F A;  2YSR A;  3TKY A;  5BPD A;  1BOA A;  2IP2 A;  4GXO A;  5K5R A;  1ON1 A;  5TJJ A;  3MZY A;  2EA4 A;  5AON A;  2PI0 A;  1XDS A;  3QP6 A;  1WQ2 A;  2O6G E;  2E1C A;  5H20 A;  1T38 A;  2QLZ A;  3V7S A;  3WOD F;  1GVJ A;  3ZMZ A;  4UHT A;  5F64 A;  4GCV A;  3RYP A;  1F4K A;  3F8N A;  1U8R A;  5L3D A;  3GZ6 A;  4MNU A;  3I71 A;  5L3B A;  3HTS B;  3G73 A;  4WXC A;  1K79 A;  2Y0M A;  4L5I A;  1TW2 A;  2KRF A;  3RDI A;  1TBX A;  4M9Z A;  4I0A A;  2VBZ A;  4PGH A;  4OMY A;  2LF8 A;  2NYX A;  3JTH A;  2FBI A;  2G9W A;  4HAM A;  1GXQ A;  3IRQ A;  1D8K A;  4FT8 A;  4MHG A;  3L7W A;  2HS5 A;  4ZYD A;  2JPC A;  3QPH A;  2DW4 A;  1KU3 A;  4U7B A;  1BI2 A;  1EH8 A;  3BWG A;  4XBF A;  3CUO A;  4O6J A;  3R0J A;  4IJA A;  4ESJ A;  1FY7 A;  3K69 A;  1IXR C;  2VBW A;  1FYM A;  5E8I A;  1Z9C A;  5HS7 A;  2D45 A;  1OYI A;  3NEU A;  2DU9 A;  2NAZ A;  2OZ6 A;  3I54 A;  3IHU A;  1IN4 A;  2C6Y A;  5LEK A;  2ACJ A;  1HQC A;  3F6V A;  3GLX A;  2DPU A;  1ZG3 A;  3ECO A;  2J5P A;  4G7H F;  3J81 Z;  2R7D A;  4ZYG A;  5BS6 A;  2LF7 A;  2QEN A;  2XRN A;  4PCQ A;  4IVN A;  3LA2 A;  1HBX G;  3TGN A;  5CVR A;  2IJL A;  3M1E A;  5FO5 A;  3C3W A;  2K4B A;  5CVJ A;  1J0R A;  1B59 A;  2QVO A;  2Z99 A;  2BE5 F;  4ZYE A;  5HOO A;  1JE8 A;  2M1B A;  3QPT A;  1ZRE A;  1QZZ A;  3I58 A;  1BM9 A;  2DK5 A;  3KZY A;  3KP2 A;  3GVA A;  1U5T A;  1D8J A;  4BQA A;  1JHH A;  1YYV A;  2ZNZ A;  2DO7 A;  2M30 A;  3DQV C;  2H6C A;  3RKX A;  4IF4 A;  1BJA A;  5HDK A;  4HQE A;  2ISZ A;  4UVA A;  4AWX B;  1XGM A;  3KLO A;  2E1N A;  4EM0 B;  1DPU A;  2XAS A;  3J80 Z;  4CYD A;  3KP7 A;  4M9X A;  3CO7 C;  1DUX C;  4HF2 A;  3F8C A;  2RDP A;  3I5U A;  4HLX A;  2NRA C;  4LK0 F;  4OU0 A;  2IVM A;  1O3R A;  3FF5 A;  4HOB A;  2L4M A;  2PEX A;  4UVB A;  4ENK A;  3Q9S A;  3F8F A;  5DCM A;  3FXU A;  3B73 A;  4LB5 A;  2D2W A;  4L0Z B;  2L01 A;  4EGY A;  1SD5 A;  1JGS A;  3H3U A;  1U5T B;  2EFO A;  4OMZ A;  2OA4 A;  4EJV A;  1RUO A;  2EV0 A;  5ILU A;  1Z7U A;  4M71 A;  1L3L A;  1GXP A;  3ULQ B;  2STT A;  1MD0 A;  2A5Y B;  3GO5 A;  4RGX A;  1HSJ A;  3ABT A;  4KT5 C;  2RGV A;  4OIR F;  3H92 A;  4NHJ A;  2JZY A;  4BAY A;  4AVP A;  2MH9 A;  5K5Q A;  1REP C;  3KP6 A;  4LG0 A;  1BIA A;  2ZKZ A;  1KGS A;  2FNA A;  4I2O A;  1RI7 A;  3ISP A;  3E6D A;  4IRI A;  3ZMD A;  2D1V A;  4BYY A;  4S05 A;  2P7C B;  1XCV A;  3U1D A;  3O6B B;  3JSO A;  2A68 F;  2HYF A;  5ICG A;  3HUG A;  1XDU A;  2VE8 A;  3J81 K;  2KIU A;  2RC4 A;  1MJB A;  2V6C A;  2D1H A;  4BHP A;  2EK5 A;  4WCG A;  3U2R A;  3T5X A;  4R79 A;  3WE2 A;  3REO A;  4A5N A;  4UXN A;  3MEX A;  4I02 A;  4HF0 A;  3V4G A;  3BJO A;  3N4M A;  2M8E A;  1RUN A;  4CIC A;  4G7Z F;  3WTU C;  5KVR A;  2FQ3 A;  3L00 A;  2J5O A;  3EET A;  3QAH A;  2FOK A;  4EJO A;  3HYI A;  1A04 A;  1HW2 A;  2BEO A;  1QZY A;  2CO5 A;  3I64 A;  4LG0 B;  4BNC A;  2HWV A;  4HX4 A;  2XHK A;  1YQA A;  1LDK B;  1IRF A;  2WTE A;  5D4S A;  5BPI A;  1BI1 A;  4KN7 X;  2IT0 A;  5ICC A;  3V8J A;  5D5V B;  4M9S A;  3FX3 A;  2M45 A;  3GW2 A;  2Z33 A;  3KP4 A;  1PP8 F;  3ZP5 A;  3JAM Z;  1ZH5 A;  4WF2 A;  2G7U A;  3FM5 A;  3GF2 A;  2W57 A;  1XSX A;  1ONV A;  3P9C A;  1P92 A;  4HBL A;  1D3Y A;  4A0Y A;  4MEY F;  2H6B A;  3BY6 A;  5A2Q Z;  2F5E A;  2MA3 A;  1JXS A;  4XLN F;  3CJN A;  2MD5 A;  1U6G A;  2FEZ A;  1F5T A;  3MZH A;  3FMS A;  1B1B A;  2PMH A;  4FX0 A;  4M74 A;  1WKM A;  4Y15 A;  3PQK A;  2NNY A;  2P7V B;  3HRS A;  1TLH B;  2IW5 A;  1SMT A;  3MQ0 A;  2PN6 A;  3HRM A;  4ZYH A;  3LFK A;  2EFN A;  1R1V A;  3MFK A;  2LKP A;  5H6R A;  4IPA A;  3ZMV A;  5L3C A;  4I01 A;  3KET A;  1SFE A;  4G9Y A;  1D5V A;  2ZJ2 A;  1BC8 C;  4Q47 A;  3U9G A;  5IT9 Z;  4MQ9 F;  1ODD A;  1G3W A;  1ZHF A;  2ELH A;  2FNP A;  1IN7 A;  2L4A A;  2OU2 A;  4UV9 A;  5DCF A;  2RQP A;  1AOY A;  4IHT A;  1IRG A;  4CO8 A;  3IL2 A;  3K9T A;  4Y13 A;  3GFL A;  1R58 A;  1R1T A;  5LHH A;  2BYV E;  3K1M A;  2ZFW A;  3MCZ A;  2CGP A;  4RAY A;  2GIV A;  3K0L A;  2RNJ A;  2JT1 A;  3SZP A;  1ZG1 A;  4ZZL A;  4JQF A;  2CWE A;  2GWR A;  3I0T A;  2DQR A;  1O7F A;  4OIN F;  2Y75 A;  1KA8 A;  3N97 A;  3FHZ A;  1SD6 A;  4KA4 A;  3LST A;  3BPX A;  4IHS A;  3VEP A;  4BHB A;  3WG9 A;  1FPQ A;  1LDD A;  2DI3 A;  5AIP A;  2A69 F;  1I1G A;  3BDD A;  5FD6 A;  3BOQ A;  1BC7 C;  2FXA A;  1S8N A;  2STW A;  2ETH A;  5BMZ A;  3JAM K;  1J7K A;  3M7G A;  2P5V A;  3GFJ A;  2QZ8 A;  2XKP A;  3TDZ C;  4CGZ A;  3VB2 A;  1DPR A;  5LHI A;  5A2Q K;  1I1S A;  2IRF G;  1SMY F;  4I09 A;  1MJ9 A;  3HRU A;  5ILV A;  1IF1 A;  2VN2 A;  1CF7 A;  1U2W A;  2DT5 A;  2O03 A;  4AIJ A;  2CSO A;  5LGU A;  3IWF A;  4PDK A;  2FMY A;  2FU4 A;  2KKO A;  4S04 A;  1ON2 A;  1ZYR F;  2R3S A;  2QQA A;  4RAZ A;  2F2E A;  2HYG D;  3BPV A;  5IT9 K;  3V7C A;  1UHW A;  3LQR A;  3F23 A;  5K1Y A;  3VOD A;  4I98 B;  4N9H A;  3IKT A;  2VBY A;  4EVI A;  2O0Y A;  1LEB A;  2A3S A;  2FSW A;  3C1D A;  1XMK A;  2PMU A;  1YLF A;  2DLL A;  1FSE A;  2XAG A;  4EV0 A;  3QU3 A;  3WU0 A;  1CF7 B;  1ZG5 A;  3GXO A;  3IRR A;  4YIF A;  1JHF A;  1Z05 A;  1V3F A;  5E20 A;  3LAP A;  3BRO A;  1FLI A;  4WXD A;  3KLN A;  4CDG A;  4KN4 X;  1KQ9 A;  5HVQ C;  3KP3 A;  4LGW A;  2PG4 A;  5FFZ A;  4EM2 A;  1WSU A;  3S2W A;  2EB7 A;  3WTS C;  1IAW A;  1HKT A;  1Z1D A;  4XRF A;  1OR7 A;  5FD5 A;  4A12 A;  2F5F A;  5FLX K;  1G6N A;  2EV6 A;  4KIG A;  5BOX A;  2V1D A;  1FZP B;  1XGN A;  1X3U A;  1LDJ A;  2KIM A;  4BHC A;  1LJ9 A;  4EJT A;  4M73 A;  3ROU A;  2DQL A;  4BXU A;  2V1X A;  4ZH4 F;  2XAF A;  4E70 A;  4Q5S F;  1FBQ A;  3VFZ A;  1FP1 D;  2GQQ A;  2UXX A;  4MTE A;  1R1U A;  1T0F A;  2RVC A;  2K86 A;  3F8B A;  1HW5 A;  2EFW A;  3PQJ A;  1U78 A;  1HXD A;  3L2C A;  3ZN1 A;  1UST A;  3JSP A;  4AIH A;  3COA C;  1T2K A;  4LB6 B;  5E18 F;  4G6D A;  2DAO A;  1BN5 A;  2F5D A;  2IA2 A;  3DP7 A;  1J75 A;  4XSZ F;  2HQN A;  3E5U A;  1XCB A;  3TDU C;  4U0V A;  5D6F A;  3CO6 C;  1K7A A;  3SZT A;  4IRH A;  4HA8 A;  3DKW A;  3EYY A;  3GFI A;  2Y48 A;  3E5X A;  4P5O A;  3KEO A;  2YU3 A;  1Z6T A;  2FRH A;  4AD9 A;  3M8E A;  4RB0 A;  2MLG A;  1RIO H;  2V79 A;  3T8R A;  4CHU A;  3SXY A;  5JHU A;  3IC7 A;  4HV5 A;  3DFG A;  3HHG A;  4A0Z A;  5JVT A;  5D4R A;  4YII A;  5FGM A;  3I53 A;  2QM3 A;  4KMF A;  5D5U B;  3K2Z A;  3CLO A;  3FM3 A;  2HDC A;  2VOO A;  1XN7 A;  1W7P D;  1O3T A;  2BGC A;  2GXG A;  3LA3 A;  4L9N A;  3F8M A;  1PUE E;  4A5M A;  3RKW A;  4JK1 X;  3GWZ A;  4LFU A;  3HTU A;  4UV8 A;  3GX4 X;  1E17 A;  3ZPL A;  2DTR A;  4A6D A;  3VOE A;  3RPU A;  2KJC A;  4I7H A;  3TO9 A;  4HDU A;  1XD7 A;  1AWC A;  4FHT A;  2HTS A;  4MQV A;  4MEX F;  2O61 A;  2MBF A;  4EM1 A;  4O5V A;  2DK8 A;  1OYW A;  2OAZ A;  3F21 A;  3GZ5 A;  2A6H F;  1LQ1 A;  4EMS A;  1USS A;  1Q1H A;  4L5J A;  3WGH A;  5LBQ A;  1YS6 A;  1SD7 A;  2H09 A;  2OQR A;  2NNN A;  4UNO A;  2VC1 A;  1W5S A;  3ML6 A;  2Z9O A;  1FOK A;  3R6S A;  3CDH A;  3R61 A;  5D8K B;  1ZRC A;  2G7H A;  5HLH A;  3R60 A;  4RB2 C;  1O3S A;  2W25 A;  3DF8 A;  5ERI A;  4L9V A;  3L9F A;  4MTD A;  3GYH X;  3IWZ A;  3E6B A;  4Y17 A;  2HGC A;  2GA2 A;  1IN8 A;  2CFX A;  2K4J A;  1FC3 A;  5KK1 A;  5D5W B;  2RKH A;  2EA2 A;  4ASN A;  3TO6 A;  1QO0 D;  1KYZ A;  3L09 A;  4A2U A;  1TTY A;  3ECH A;  4U0W A;  3K1P A;  3F22 A;  4LLN A;  4EJU A;  5CVU A;  2LDU A;  4ENN A;  2LNB A;  3RYR A;  3ABU A;  4PGG A;  2K27 A;  1I6X A;  2RN7 A;  2VT3 A;  4LMY A;  2IPQ X;  2HFH A;  1KU9 A;  1G3T A;  3TO7 A;  5H6Q A;  2UXN A;  1XSV A;  4YFX F;  3ELK A;  4GYI A;  1MDM A;  4DQ2 A;  2FBK A;  5DUK A;  4CZZ A;  3FXR A;  2Q8K A;  2IA1 A;  3OOP A;  3WGI A;  2XRO A;  3RJP A;  1B6A A;  1J2X A;  2PBI A;  2V9V A;  3WTT C;  4QLC U;  1FSH A;  3F72 A;  1ZRF A;  4IXA A;  2COM A;  2XUB A;  2FE3 A;  4YFN F;  2YX7 A;  2HOE A;  4HX8 A;  4KDP A;  3DPL C;  1R23 A;  4U7D A;  2H94 A;  5J8C A;  4ENM A;  1EH6 A;  1BI0 A;  3P9K A;  2GAU A;  3FWE A;  5J8F A;  3CUQ C;  1FBU A;  4U0Y A;  3EQL F;  1S29 A;  4HF1 A;  2O3F A;  3JTG A;  3HOS A;  3HSE A;  4NQW A;  1HST A;  3LQQ A;  1HKQ A;  2QBY A;  1LNW A;  2ESH A;  4OIQ F;  4HQM A;  3ERE D;  4HW0 A;  3RKY A;  2QQB A;  5LGN A;  3SFZ A;  2O8X A;  4KIB A;  1SAX A;  1MDM B;  4KMU X;  3MAJ A;  4P96 A;  4LD5 A;  4G8X A;  1R22 A;  1QGP A;  2ZME B;  2FBH A;  1Z91 A;  2CQK A;  3NRV A;  5FLX Z;  1YS7 A;  4L0Y B;  3E97 A;  2CG4 A;  3WE3 A;  5HLG A;  2JPB A;  1G4D A;  1C0W A;  3C18 A;  5DV5 A;  2HTJ A;  2P6T A;  5HS8 A;  2EWN A;  1FNN A;  1H9T A;  2M5W A;  3C7J A;  4LK1 F;  1Z6R A;  1NHA A;  3QOP A;  4G6Q A;  1HW1 A;  1TW3 A;  2QBY B;  4HX7 A;  1YIO A;  1KQ0 A;  5E8G A;  3E6C C;  3FMQ A;  4HZF A;  3RI4 A;  2EFP A;  5JFR A;  2A6E F;  3KCC A;  4I0B A;  3HIF A;  1O3Q A;  2YX4 A;  1GHC A;  1VTN C;  3EDP A;  1I27 A;  3Q9V A;  1RZ4 A;  3HHH A;  1BIB A;  2PLY A;  2E7X A;  3BP8 A;  2BBY A;  4G7O F;  1BBY A;  5HDG A;  3HRT A;  3R0A A;  2QWW A;  2A61 A;  1T98 A;  3DV8 A;  1W4M A;  2XAH A;  3BJA A;  4KUM A;  4MGR A;  1TQP A;  5EEG A;  4P55 A;  4R8H A;  3M8F A;  2ISY A;  4RGU A;  5TRD A;  2Z3Y A;  2XVC A;  3ZMS A;  3LWF A;  5FFX A;  1STZ A;  3WTX C;  1QBJ A;  5DEQ A;  3BJ6 A;  3ZMU A;  2IA0 A;  1BI3 A;  1V4R A;  3I59 A;  1FWZ A;  3F6O A;  1S7A A;  3LAJ A;  5DUI A;  4K2E A;  2PFB A;  5AIQ A;  1PP7 U;  2CYY A;  1UHM A;  2MC3 A;  3TOA A;  1R7J A;  2VBX A;  5HLI A;  2X0L A;  1IZ1 A;  1IXS B;  3EYI A;  2ESN A;  2RV8 A;  4L18 B;  4WX9 A;  5E1Z B;  1UCR A;  1PDN C;  3WGG A;  2WC2 A;  5E17 F;  1G3Y A;  1FBS A;  4OIO F;  2QYO A;  4GGG A;  2V1U A;  2KJB A;  3TQN A;  3D5L A;  2FML A;  2W24 A;  3RTR A;  2QUF A;  4P9U A;  3FZV A;  1F9N A;  2HR3 A;  2EJR A;  3O2P E;  5D5X B;  4HLY A;  1QPM A;  2Z5U A;  4L9T A;  4ESF A;  1XGS A;  4YFK F;  5BQT A;  1XSD A;  3WTW C;  1WI9 A;  1RNL A;  1ULY A;  3J7A O;  5LRR A;  1YG2 A;  5F6F A;  4Q4Z F;  1WWX A;  4HYE A;  1S3J A;  3I59 B;  4O3M A;  1ZGA A;  5LLQ A;  1ZGJ A;  4A6E A;  3KE2 A;  4B8X A;  2XAJ A;  1P4W A;  3B02 A;  4ENJ A;  2A07 F;  3F3X A;  1SD4 A;  6PAX A;  3DPT A;  2LSO A;  1R5H A;  2BV6 A;  3KZZ A;  3V7R A;  1T6S A;  1O57 A;  1P4X A;  4RB1 A;  4RS8 A;  5EEH A;  2GZW A;  3HOT A;  4HDV A;  4P9F A;  1YW9 A;  1ZAO A;  1O7L A;  4KFC A;  1B4A A;  5ED4 A;  3AAF A;  4H0E A;  4ZZD A;  1R5G A;  3WU1 B;  2OD5 A;  4M6Y A;  3RPQ A;  5LHG A;  1B9M A;  4HV6 A;  2ZCW A;  2VE9 A;  2KIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...