2NYXA

Crystal structure of rv1404 from mycobacterium tuberculosis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
PATAEESVDVITDALLTASRLLVAISAHSIAQVDENITIPQFRTLVILSNHGPINLATLATLLGVQPSATGRMVDRLVGAELIDRLPHPTSRRELLAALTKRGRDVVRQVTEHRRTEIARIVEQMAPAERHGLVRALTAFTEAGGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable transcriptional regulatory protein, Rv1404
publication title Crystal structure of RV1404 from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 50
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2nyxA01
3W6JB 2E1NA 2MBFA 2UXXA 2KJBA 2OD5A 3H3ZA 1W5SA 5E8GA 5E18F 4DNCA 3IL2A 2Q0OA 1BM9A 3L09A 1EH6A 1FBUA 2K4JA 2RKHA 3MAJA 5ILVA 3BY6A 3ELKA 1FY7A 2XAHA 2OU2A 3FZVA 2NYXA 1I27A 5LBQA 2VBXA 2OQGA 2QQBA 1SD5A 4XRFA 3J81Z 2XKPA 1Q1HA 2Z3YA 1YW9A 2W85A 1OYIA 1AOYA 1MJ9A 2STWA 4Q48A 5LLQA 4ENJA 4HX8A 4HYEA 3O3KA 4JK1X 4A2UA 5DD4A 3IHUA 1ZYRF 1KYZA 3I58A 5FD6A 1LDDA 4YFNF 3M9AA 3E97A 3BJAA 1TNTA 2L4MA 2V6CA 1TQPA 3G3ZA 2RN7A 4FHTA 2DBBA 4EVIA 2GWRA 5CVVA 4KMFA 5HLHA 1ON2A 3GZ6A 2F5DA 1JHHA 4AD9A 5E17F 3VB2A 4G7ZF 2RNJA 2M5WA 4MEYF 3RKWA 2A69F 1ZH5A 1DPUA 4MGRA 1ON1A 1R1UA 2OQRA 3FMQA 2PMUA 4Y13A 3CUOA 1XSVA 2G7UA 1FP1D 4HAMA 1LDJA 4BNCA 1SD4A 2DK8A 1CF7A 2YX7A 2YR2A 5AIQA 1W5TA 2QWWA 3T8TA 1J2XA 5LEJA 3WTUC 4M73A 2M1BA 2WV0A 1FT9A 2K4BA 3QRFF 3IKTA 4R79A 4CHUA 3KE2A 2EJRA 1J59A 2X0LA 3TOAA 1K79A 3EUHA 3FMRA 4EJTA 4EMSA 4KMUX 1W7PA 5TRDA 1U6GA 1S8NA 2C6YA 5LHIA 2A5YB 1IN8A 3LQRA 5D6FA 4WXHA 4QLCU 3ECOA 1F1ZA 5K5OA 5FD5A 3ZPLA 2XV4S 4I0AA 5LRRA 2ZMEA 2VT2A 5L3FA 1WI9A 1P2FA 2AS5F 1J7KA 3FXRA 1ZHFA 4IF4A 3VEPA 3WTWC 3WG9A 1SMYF 1FX7A 4HLYA 2RDPA 2HFHA 1SMTA 3K2ZA 4OMZA 3JTHA 3QOPA 2VONA 3VODA 3GLXA 3F21A 1D8JA 4KICA 4RGXA 2AXLA 4EM2A 3KETA 1SFEA 1S6LA 2A61A 1X3UA 5ERIA 2LF7A 1T39A 5DUKA 4XLPF 1BN5A 2Y48A 4M6XA 3FXUA 1ZG1A 1U78A 1OMIA 5LHGA 2YPRA 1FOKA 1CGPA 3ERED 4MTDA 5FFZA 3QAHA 4ENMA 4PDKA 5LGUA 4U7DA 3MZYA 3WGHA 5E1ZB 3MCZA 1P4XA 1Z7UA 2NRAC 4I01A 3EDPA 2XAFA 4HQMA 1J0RA 2W84A 4OIQF 1O3TA 4PCQA 2IPQX 2LF8A 1HSTA 4H0EA 4G6QA 2ISZA 2K27A 2ADUA 5FFXA 5LEKA 3GF2A 5HOOA 4KNYA 3K1NA 3F72A 2FXAA 1KU3A 3DV8A 1QPMA 4G8XA 3GO5A 3KFWX 4RB3C 2HTSA 3L2CA 2RV8A 2O6GE 1R22A 1XDUA 3E5UA 2HWVA 4FT8A 3TQNA 2HKXA 4PZJA 1R58A 2K86A 1O3RA 5ILUA 2ZJ2A 4LK0F 5IT9K 4U0YA 3I53A 1QZYA 2QYOA 3HSRA 4AIKA 4RAZA 1UB9A 1BC7C 5LGNA 3RJPA 1QZZA 3FHZA 3V8JA 2LKPA 3ZMZA 1S29A 1S7OA 1XD7A 3CJNA 3H3UA 1U3EM 2H6BA 2Z5UA 5JR3A 2HKOA 4TV7A 4CO8A 3T0YA 1LJ9A 2NNYA 1ZGJA 4Z2YA 1U2WA 2EV6A 2F5FA 4WXDA 3NRVA 1LEAA 1QQIA 2CQKA 3M8FA 3HYIA 3IWFA 3ABUA 4I98B 4UNOA 1DPRA 2J5OA 1TLHB 3KEQA 3D0SA 3ZQ7A 2IJLA 3R0JA 3E6DA 2WWYA 2ZNYA 4A5NA 1SAXA 1G3YA 1NHAA 1KU2A 2MA3A 4Q4ZF 4GYGA 3VOEA 1RI7A 1L3LA 1FYMA 2XAJA 4RGUA 3QPHA 2FRHA 1XGNA 1WSUA 4CGZA 3E6BA 4ZYEA 1EV7A 2PG4A 3E5XA 5L3BA 5HS8A 4IVNA 4KFCA 3F22A 3F8MA 1UCRA 1FBQA 3J80K 2FA5A 4MTEA 5TJJA 2XGXA 5DDGA 1D3YA 4I09A 1IUYA 5D6EA 1YW8A 4ESJA 4KYWA 4A6DA 2H94A 2VT3A 2UZKA 5KK1A 5IT9Z 1I5ZA 4MNUA 1YLFA 4G7HF 1BC8C 4YFXF 2FNAA 1VTNC 2BV6A 5FLXK 5EEHA 1WWXA 4ESFA 1UHWA 3LA3A 2R3SA 2GA2A 2DQRA 3K1MA 2PI0A 1Z6RA 4OIOF 2IA2A 2VOOA 3KZZA 1JE8A 3F8FA 1O7LA 3F8NA 3LQQA 1BI1A 5AONA 3H92A 4M6YA 3KLNA 3WGGA 2HR3A 5LHHA 1IN6A 2IP2A 1UHMA 2VN2A 2M8EA 2DK5A 3KLOA 1IW7F 2A6EF 2VE8A 1ULYA 3I59B 2J5PA 3BOQA 2CG4A 3JSPA 3HHHA 2EV0A 2NAZA 4HDUA 2DU9A 3FMSA 3BROA 1P4AA 2PFBA 3BJOA 1KQ8A 5L3CA 4M9SA 5K5RA 4A6EA 1I1GA 2HS5A 4UUVA 5IT3A 3WODF 4BHBA 4ASNA 2CSOA 4UVAA 4A12A 2XKOA 3J80Z 4BYYA 5HS9A 3F6VA 3WTTC 5HDKA 4P9UA 3Q5FA 4N0BA 2V1UA 1SD6A 1BIAA 3JW4A 4A0XA 5LRSA 4WF2A 1O3SA 1HSJA 3SXYA 3GYHX 4QWQA 2PQ8A 2DO7A 3DFGA 3RDIA 3WTXC 4HV6A 4HZFA 2FF4A 3TGNA 1H9TA 2O0YA 1OYWA 5FLXZ 4HV5A 2ZFWA 4P96A 3CO7C 3RPUA 3DPTA 4LMYA 4OOIA 1T2KA 3DP7A 2UWMA 4L0ZB 1MGTA 3OV8A 1R5HA 1F4KA 2Y75A 4KT5C 1SD7A 3BZ6A 3G73A 3V7CA 2Z33A 4NHJA 1U5TB 2ACJA 2L3DA 2O3FA 1ZLJA 4LJZF 4KDPA 5D8KB 3F23A 1MJAA 3ML6A 3QU6A 2VBZA 4YIIA 1USTA 2QBYA 2V79A 3C7JA 3NQOA 1K78A 1FP2A 4Q47A 4CZZA 2QQAA 3ZP5A 3CLOA 4NB5A 5CVIA 4N9IA 3E3VA 1FNNA 4RB0A 2JT1A 4KIBA 1Z1DA 2A6HF 4JBAA 4EJUA 4I02A 2P8TA 2GQQA 2DLLA 2DW4A 4Q5SF 5BQTA 3F6OA 2VE9A 1XN7A 2ISYA 4AWXB 4E70A 4XSZF 4L5JA 3WGIA 3RPQA 4G9YA 3J7AO 1G6NA 3LWFA 5H20A 2BGCA 4M74A 4MEXF 4EV0A 2XVCA 2CW0F 4AIJA 2KIMA 4YIFA 4UHTA 2DTRA 4IRIA 2FE3A 5ICCA 1ZG5A 2EA4A 1TQMA 1KGSA 3ABTA 2DPUA 3CTAA 4IPAA 2ELHA 3CDHA 4L18B 3QPTA 1XCVA 3FM5A 1XCBA 5FGMA 1HW5A 2QM3A 4EJVA 3BWGA 1YFHA 3KZYA 5HDNA 2P6SA 2MC3A 4BH9A 1WKMA 4UVCA 5DCMB 4EGYA 2WC2A 4IRHA 3RKXA 3E5QA 2KKOA 2MLGA 2IVMA 1ZLKA 3I71A 3MWMA 5DV5A 5K1YA 3IKVA 1XGSA 4KN7X 2UXNA 1HW1A 3GFJA 4AIHA 4KIFA 1QBJA 4U88A 4EJWA 4JQFA 1T6SA 2VC1A 2P5VA 1GXPA 5ICGA 3SZPA 2O61A 5HS7A 5H6RA 1P4WA 1Z9CA 1F5TA 2ZNZA 1B9MA 3B02A 4LGWA 2HDCA 1IF1A 1T38A 2EFNA 5HLGA 5DD8A 2KJCA 5BPDA 1FBSA 3O6BB 3WE3A 2STTA 4HA8A 1MDMB 2KIUA 2VODA 1YG2A 4P5OA 4G7OF 5ED4A 2ZCWA 1DUXC 3ZMDA 2WTEA 1ZREA 1XMKA 2GZWA 4S05A 4OINF 2XHKA 2P5LC 1B1BA 5D4RA 3I0TA 5J8CA 1LQ1A 1R1TA 5DYMA 1WQ2A 2CGPA 2LNBA 2HZTA 3E6CC 3LA7A 2HEOA 4HF0A 2OZ6A 4O5VA 1J9IA 2XIGA 1ZRCA 4OMYA 1TTYA 1QO0D 5BPIA 4HW0A 5JHUA 1LVAA 5DEQA 1YYVA 4LFUA 1HXDA 3I64A 4BAYA 3KP4A 1V4RA 2PN6A 1YW7A 2BE5F 2FMYA 4XBFA 3L9FA 3HRTA 3ISPA 4RGRA 4KIGA 2P4WA 4ZYGA 1RNLA 1LEBA 5D5VB 3FXQA 2D1VA 4EGZA 1K6OA 3GUDA 3KP2A 1UFMA 5J8FA 4GO1A 4NQWA 2OA4A 4A0YA 1FSEA 3ECHA 2W57A 5AIPA 2R7FA 2M30A 2OAZA 1KU9A 1U5TA 4I2OA 1T0FA 3ZN0A 4IHTA 2Y0MA 3BJ6A 1TBXA 2ZXJA 2W24A 3R0AA 2QVOA 3LAPA 2NNNA 1KA8A 2L4AA 2FBKA 3JAMK 3P9KA 5CJ9A 4P9FA 3EQLF 1ZRFA 4WWCA 2ZKZA 3ROUA 3N97A 2FMLA 5E1WA 3KCCA 1GXQA 3RYRA 3S2WA 5L3EA 4FX4A 2TDXA 2QUFA 3GFIA 4P55A 2P7CB 1W7PB 1AWCA 3MFKA 1QNTA 2V1XA 1RUOA 1S7AA 1O3QA 3DPLC 1MKMA 1MD0A 4ZH4F 1ZAOA 3P9IA 2HGCA 3U9GA 2D1HA 2E1CA 1LB2A 2CYYA 1V3FA 4MHGA 2V9VA 1BIBA 5F1RA 3SHFA 1B6AA 1E2XA 3V7SA 1G3TA 3HSEA 2EV5A 1HQCA 2H6CA 2P6TA 3IWZA 2ZO4A 1E17A 1IRFA 5E8IA 2PEXA 4G6DA 2FOKA 2DAOA 3V7RA 1IZ1A 2EFOA 1LDKB 5ICFA 2EFPA 2JZYA 1FWZA 4AVPA 3B73A 4HX4A 1B59A 4O3MA 2BBYA 2FU4A 1HKQA 1IN7A 1RZ4A 4ZZLA 2IW5A 3PQKA 1R5GA 5DCMA 4KA4A 5DUIA 5FB2A 1TQIA 3ZMSA 2YU3A 3ZMVA 3R61A 3GFMA 3WU1B 4MQVA 2EK5A 4U0VA 3DXJF 2YX4A 2VOPA 5CVRA 1ZARA 4I7HA 3JAMZ 4LG0B 3OOPA 1TW3A 1XDSA 1ZGAA 2XROA 1I1SA 2KIFA 2IT0A 1J5YA 2FEZA 2QQ9A 2GXBA 5D8LB 5D5UB 5FO5A 3KP5A 4GXOA 4HOBA 1YS6A 1FPQA 3P9CA 2EWNA 1W4MA 1PUEE 2Z9OA 2XAGA 4HQEA 4LB6B 4BQAA 3K0LA 4UVBA 3K1PA 5L3DA 1L0OC 4U0WA 1W7PD 1R1VA 3WTZA 2ETHA 1XSDA 4ON0A 2PJPA 3GEZA 2OZUA 4G94A 3BPXA 3L7WA 4UV9A 2K7LA 2PMHA 4UV8A 2HYGD 1BI0A 3FM3A 1YS7A 5ICEA 2MH9A 4LLLA 3PFIA 1BJAA 4KN4X 1G4DA 3MEXA 3BP8A 4GYIA 1P92A 4IXAA 3TO9A 1D5VA 1TW2A 2COMA 4S04A 3C18A 3JTGA 4HDVA 4M71A 3GVAA 3V4GA 2MD5A 3F8CA 4UXNA 1FSHA 1TNSA 1G3WA 1RUNA 3WTVC 4F7ZA 2IA1A 1U8RA 3HOTA 1P6RA 4ENNA 3WE2A 4L9TA 4EM1A 3GX4X 1S3JA 1EH8A 2DFIA 1PP8F 4HLXA 4Y17A 2KRFA 2R7DA 4RS8A 1BI2A 1JHFA 4ZYHA 3GFLA 3K9TA 4ESBA 3F3XA 2IA0A 1XGOA 1USSA 3EYIA 4I0BA 1IRGA 5BMZA 5E20A 1PDNC 5EEGA 2V1DA 1ZN2A 5DCFA 5BS6A 1C0WA 5JFRA 4A0ZA 2ESNA 1FLIA 2O03A 1JXSA 1Y0UA 4XSXF 4FX0A 2K02A 5J6XA 3BDDA 4WCGA 1FYKA 2RC4A 4PGGA 1IN5A 1Z05A 4U7BA 3D5LA 4L5IA 4L9JA 1PP7U 3SFZA 2FBIA 3ZMTA 1I6XA 2CWEA 2RVCA 3DEUA 3N4MA 1OYYA 4A5MA 4R8HA 5A2QK 3C1DA 3R4KA 1B9NA 1OPCA 3W6KB 1OR7A 1GVJA 3EYYA 3WTSC 3CUQB 4CICA 3QP6A 4O6JA 1YTYA 2FSWA 2RQPA 2VXZA 5JI6A 3QU3A 4RGSA 1D8KA 3HRSA 3LFKA 3T1BA 3I54A 2ZBKA 4D0PA 1YQAA 5HLIA 2DI3A 2GAUA 5F6FA 2B0LA 3HTUA 2P5KA 2QLZA 4WK8F 4XLNF 2PLYA 1WRJA 3KP7A 3EETA 3TO7A 3TDUC 3KEOA 3IC7A 1U5TC 3FX3A 2XRNA 2XASA 4OIRF 1FYLA 3ZN1A 4M9ZA 2Z99A 3PQJA 4ZZDA 1HKSA 2ESHA 2DQLA 3RKYA 5JVTA 5E1XA 3KP6A 2HYFA 2L02A 2QZ8A 3R60A 3I59A 3HSFA 4K2EA 3I5UA 1O7FA 4GGGA 5H6QA 4RB2C 4L9NA 1OKRA 2A3SA 3LAJA 2HOEA 3JSOA 4GCVA 1XGMA 4EJOA 2DPDA 2FQ3A 4HF2A 3HRUA 3IRQA 4LG0A 5CLSA 2JPCA 3V8LA 4R1HA 1YO5C 3MQ0A 5A2QZ 3M7GA 4CYDA 3CO6C 1BBYA 1KQ0A 4EM0B 2X4HA 5D5XB 4L0YB 1EH7A 1XB4A 3NEUA 5F64A 4YFKF 2MLKA 3FF5A 2A68F 1F9NA 1IXRC 2VBYA 5ILSA 1ODDA 1KU7A 3RTRA 3LA2A 1O57A 2GA1A 3P7NA 4PGHA 2HQRA 1DDNA 1BOAA 3T8RA 2IRFG 2M45A 3M8EA 2H27A 1G3SA 3BPVA 1RIOH 2L01A 4B8XA 4WXCA 2PBIA 4MQ9F 3C3WA 4M72A 1IXSB 2EB7A 3CUQC 1R7JA 4KUMA 3IRRA 2QENA 2QBYB 3DF8A 2JTVA 2H09A 2RGVA 2W25A 1K78B 2Q2EA 2FBHA 2BYVE 5LGTA 4HX7A 3Q9VA 4LK1F 3HUGA 4N9HA 3GZ5A 3R6SA 3RYPA 1Z6TA 2EA2A 3U1DA 2GIVA 2JPBA 2F5EA 2A07F 3AAFA 4M9XA 4BHCA 2D45A 2E7XA 1ZRDA 3RI4A 1ONVA 2CFXA 3TOBA 1CF7B 2P7VB 2DT5A 3E6MA 5CYVA 4OU0A 3DKWA 1XMAA 1HW2A 3U2RA 4L9VA 1QGPA 2O8XA 4IJAA 3WTYC 1KQ9A 4RAYA 2VC0A 4LB5A 4YG2F 1R36A 1IAWA 3VFZA 2YSRA 4WX9A 1BI3A 1KYWA 3T5XA 1IXCA 2GXGA 2E7WA 1SFUA 1HBXG 5D4SA 2BEOA 2NS0A 2ZMEB 4IHSA 3TKYA 5HDGA 4HF1A 3ULQB 3QP5A 4BHPA 1K7AA 2LSOA 1MJBA 5K5QA 4ENKA 1H9GA 1H0MA 4LLNA 4CDGA 3HHGA 2HQNA 1IN4A 1HKTA 3HIFA 3TO6A 2D2WA 1LNWA 1J75A 5D5WB 3L00A 5HVQC 5L3GA 1B4AA 1R23A 3J81K 3CUQA 3REOA 5BOXA 1YIOA 4ETSA 2G9WA 1GHCA 2LDUA 3GW2A 2OBPA 3MZHA 4HBLA 5KVRA 3O2PE 1R00A 3I4PA 4IRGA 3SQNA 2JRTA 1FZPB 3DQVC 4Y15A 3RIRA 3HRMA 4EQQA 5CVJA 2G7HA 2F5CA 3M1EA 3WU0A 3COAC 4LLGF 3HOSA 2FNPA 1DP7P 1ZG3A 1REPC 2MH2A 3V8KA 2EFQA 1FC3A 1Z91A 4CXFA 3KP3A 2VBWA 5CVUA 2CO5A 2L54A 1T98A 3ZMUA 2M87A 2F2EA 4BXUA 6PAXA 4ZYDA 2JSCA 1XSXA 4LD5A 3TDZC 1MDMA 1JGSA 3F8BA 3SZTA 2XAQA 3GWZA 1STZA 3FWEA 2HTJA 2XUBA 3Q9SA 3HTSB 2Q8KA 1A04A 4DQ2A 3LSTA 1MZBA 2EFWA 4B09A 4RB1A 3GXOA 1SFXA 3K69A 4OIPF
chains in the Genus database with same CATH superfamily
2DA4A 3W6JB 2HVQA 2E1NA 2XPUA 2GOXB 4EEFG 1IC8A 2OTJI 3FIWA 2MBFA 3S1NJ 2UXXA 3KYCB 3H1CA 2KJBA 3MMYB 2PX9A 3EUHC 2OD5A 4DZJA 1OR7C 3H3ZA 1W5SA 5E8GA 5E18F 2E2IJ 2G0EA 4DNCA 4ABZA 3OIQA 3KPHA 3IL2A 2Q0OA 1BM9A 3DTEA 3L09A 1EH6A 1YJWI 3L2RA 1FBUA 2XF7A 2PJRB 2K4JA 2RKHA 3MAJA 4P1WA 5ILVA 3BY6A 3ELKA 1FY7A 1X1BA 5E3MA 2XAHA 5EEAA 2OU2A 1FOYA 3FZVA 2NYXA 3M07A 1I27A 4FQGA 2CUZA 4MFDA 4XK4A 5LBQA 1J09A 2X51A 5LFAA 5JLXA 2VBXA 2E36A 2E2HJ 2OQGA 1DU6A 2ZMEC 4CCMA 2QQBA 1GUUA 1SD5A 4XRFA 3J81Z 2XKPA 1A6QA 1Q1HA 5K7ZA 2Z3YA 1JUPA 1D0XA 1YW9A 2K40A 2W85A 3DPUA 1OYIA 1AOYA 1MJ9A 2STWA 4Q48A 5LLQA 4ENJA 4HX8A 4HYEA 2EZKA 3O3KA 3K4LA 4JK1X 4A2UA 5DD4A 1K4SA 3IHUA 3LSRA 1ZYRF 3L2WA 1KYZA 4GDFA 3I58A 3HPGA 2Q1ZB 5E3LA 5FD6A 4PJLA 1YRNB 1LDDA 1LUJB 5C4JJ 4YFNF 3ZQQA 4RBOA 3L1PA 2LTPA 3IV5A 3M9AA 1N25A 3E97A 3BJAA 2HI3A 1TNTA 4H4KC 2L4MA 2V6CA 1TQPA 3G3ZA 2RN7A 4E4HA 1LKXA 4FHTA 2DBBA 4I76A 2YUSA 4EVIA 1LPQA 4AUXA 2R5YA 2GWRA 5CVVA 3LMMA 1IJWC 1VQ9I 2XSDC 4KMFA 5HLHA 1ON2A 3DTIA 3GZ6A 2R7TA 3DEWA 2F5DA 2Z2SB 1X19A 5M3MJ 1SFOJ 4XKVA 1JHHA 4AD9A 5GADJ 2CV0A 3PO3J 3H5NA 3VB2A 2RNJA 3HKZA 4G7ZF 5E17F 2M5WA 3O8GA 4MEYF 2XAUA 2M0MA 2HZDA 3RKWA 2A69F 1ZH5A 1DPUA 4MGRA 4IEJA 1ON1A 3C2HA 1R1UA 2OQRA 3FMQA 2XSJC 2PMUA 4Y13A 1OQYA 3PUBA 1JT0A 3OYFA 3CUOA 1XSVA 2G7UA 1JKPC 1FP1D 1Z7LA 2CUJA 1D5YA 2QSFX 4HAMA 1LDJA 5H2FC 4XRMA 2GLOA 4BNCA 5FKNA 5JHFA 2B7EA 5EZGA 1BA5A 1HA8A 1TWCJ 1EA3A 1SD4A 2DK8A 3A02A 4PUSA 4DJAA 3AFHA 1P7IA 1CF7A 2YX7A 4UY8I 4FE4A 3K4NA 3S8PA 2YR2A 1YHQI 5AIQA 4C2MJ 3SFIA 1W5TA 2QWWA 2WV1A 3T8TA 3QWLA 2L0KA 1J2XA 5LEJA 3WTUC 4Y4RA 4M73A 2WAFA 2M1BA 2WV0A 1FT9A 2LBFB 2K4BA 3QRFF 2W82A 3IKTA 3KYLA 3G71I 4R79A 1MBGA 2KIQA 3BTLA 1QA6A 4CHUA 2L7ZA 3KE2A 3VYTB 5FRMA 2EJRA 1J59A 3F0CA 4C3IJ 2X0LA 3TOAA 1K79A 3EUHA 3FMRA 1S72I 1FMVA 3IP4B 4EJTA 3FBIB 2NVUB 4EMSA 4KMUX 1RR8C 2IGNA 1W7PA 3FXKA 1WVRA 5TRDA 1U6GA 3ZQIA 1S8NA 2KISA 5LHIA 2A5YB 5C44J 1IN8A 2VLAA 2C6YA 3IH4A 2IGMA 3LQRA 5D6FA 3TP0A 1D0YA 4BJTA 4WXHA 2CV1A 4QLCU 2DMQA 3ECOA 3A01B 4BY1J 2A6TA 1F1ZA 5K5OA 5FD5A 5F1JA 3ZPLA 3S2DJ 4DGWB 2JN6A 2XV4S 4I0AA 3MKZA 5LRRA 2ZMEA 2VT2A 1X4PA 5L3FA 4F93B 1GLNA 5FKLA 1WI9A 2MG4A 2AHQA 1P2FA 2M4KA 2AS5F 1J7KA 2DA2A 1WPKA 3FXRA 1DGWY 1ZHFA 4IF4A 3K6GA 3VEPA 3WTWC 3WG9A 1SMYF 4A3MJ 1FX7A 3VSKA 3FDYA 4HLYA 2XDVA 2QSGX 4BE2A 2RDPA 2HFHA 1SMTA 3K2ZA 4OMZA 2JVGA 4BL0B 4BGDA 1VQ5I 3JTHA 3QOPA 3S3MA 2VONA 2AO9A 3VODA 1W0TA 3NWTA 3GLXA 1UZCA 3F21A 3LSKA 1D8JA 2Y69H 4XIDA 2OPTA 4KICA 4RGXA 1MNEA 2GOMA 1R5ID 2CUFA 2AXLA 4EM2A 3KETA 1SFEA 2R7ZJ 1QRYA 2RQQA 1S6LA 1D0ZA 2A61A 1X3UA 2R5ZB 4YIRX 3ZQLA 3JRGA 3HM5A 1MIJA 5TISC 5ERIA 4BJ5C 5IP7J 2LF7A 1T39A 1K61A 4QTRA 1VQMI 5DUKA 3SEQA 4XLPF 3PNTA 1BN5A 2Y48A 4M6XA 4PSWA 3SDBA 3FXUA 1ZG1A 1U78A 4IKFA 1OMIA 4Y3OA 5LHGA 2YPRA 4XORA 1FOKA 2M9HA 3DLLF 3WG7H 1CGPA 4DYRA 5FROA 2UUZA 1ETOA 3DWLE 4LIVA 5GPCA 3ERED 4MIMA 4MTDA 3OYJA 5FFZA 3QAHA 4ENMA 4PDKA 5LGUA 4U7DA 3MZYA 4RM2A 3WGHA 5E1ZB 4RLQA 1P9QC 3MCZA 1P4XA 2DN0A 2EPFA 1Z7UA 2NVTJ 2L9NA 2NRAC 4I01A 3EDPA 1SFKA 2XAFA 2ZXHA 4HQMA 1J0RA 1LFUP 2W84A 4OIQF 1O3TA 1X1CA 3HBLA 1V5GA 4PCQA 4BXFA 2QEXI 1R4MB 2LC2A 4AIDA 2DOFA 1X4OA 3H5AA 3CQZJ 2IPQX 2LF8A 1HSTA 2EINH 4BE0A 4H0EA 4G6QA 2ISZA 2K27A 2ADUA 1IV6A 1Z3XA 5FFXA 5LEKA 3GF2A 4J19A 5KAFC 5HOOA 4BEHA 4KNYA 4A3EJ 5FKOA 3K1NA 3F72A 1W36C 2FXAA 2K3FA 1KU3A 3DV8A 1Y1WJ 1QPMA 4G8XA 3GO5A 2F4IA 3KFWX 4D1QA 2DODA 4S0HB 3OYKA 2CS3A 4RB3C 2ICWG 2HTSA 1B72A 3L2CA 1A5JA 2RV8A 1OCPA 3OYAA 2O6GE 3Q0VA 1X1DA 3PUFA 1R22A 1XDUA 4BU2A 3E5UA 2EIKH 2OF7A 2HWVA 3H36A 4FT8A 3TQNA 2HKXA 4PZJA 4A3JJ 1SVLA 3JRBA 1R58A 2K86A 3H0DA 1O3RA 2W48A 5ILUA 3PO2J 2VL8A 2ZJ2A 4BS9A 1T08B 4LK0F 5IT9K 4U0YA 1GDTA 3I53A 1QZYA 2QYOA 3HSRA 1MW7A 4AIKA 4RAZA 3BTIA 3CJTB 3RKQA 1UB9A 3OYMA 3OYIA 5LGNA 1BC7C 2PJRA 1UMQA 2VXDA 3LOCA 3RJPA 4E7HA 4RAGA 2HVRA 4IHXA 1QZZA 3FHZA 3V8JA 2LKPA 3ZMZA 1S29A 2JA5J 3BG6A 1S7OA 1X1AA 1XD7A 3BQYA 3VDXA 2KLOA 4OAZA 3CJNA 3H3UA 1U3EM 2H6BA 3BCBA 2Z5UA 3G1LA 3PFYA 2LKSA 5JR3A 2QGUA 2HKOA 3A4CA 4TV7A 4UB8C 3T0YA 4CO8A 2LOOA 2DT7B 1LJ9A 2NNYA 1ZGJA 3ERMA 3BG3A 4Z2YA 2BOLA 5KCMA 1MH4A 1U2WA 2BVMA 2EV6A 2F5FA 4WXDA 2X6WA 3NRVA 1JGGA 1LEAA 1QQIA 2DA1A 2CQKA 3M8FA 3HYIA 3IWFA 4M3GA 1JKRC 3ABUA 5IY5H 1RESA 2IS6A 4I98B 4UNOA 1DPRA 1RR7A 1MMSA 2J5OA 1TLHB 3KEQA 3D0SA 4BQOA 3ZQ7A 2IJLA 3NWSA 5GP9A 1VQ8I 2MSYA 3R0JA 2NOJB 3E6DA 2WWYA 2Y30A 3VYUB 2Y9YA 3OIPA 1QPIA 4MO7A 2ZNYA 4IHVA 3NAUA 2IS1A 2VQLA 3SEZA 4A5NA 3WU2C 5IOYA 1SAXA 2H1LA 3LFUA 1G3YA 1NHAA 2WB1A 1KU2A 2MA3A 1BR2A 4Q4ZF 2FUG2 4GYGA 3MVPA 1PYVA 3QYFA 1I39A 3VOEA 1RI7A 4DYCA 1L3LA 3M4OJ 4XKCA 2LH9A 1FYMA 2COBA 5C4XJ 3L2UA 4NNJA 4D7MA 3GTPJ 2XAJA 2Y2ZA 3QQAA 5FJ8J 4RGUA 2E71A 2M8GX 3DBLB 3QPHA 3TBIA 2PMZA 2FRHA 1XGNA 2KMUA 2LY2A 2E5ZA 1WSUA 5TGTA 2BY0A 1MBJA 2X85A 4CGZA 4PSXA 3E6BA 4ZYEA 1EV7A 3V42A 2PG4A 3E5XA 3C2BA 5L3BA 2VJJA 4IVNA 5HS8A 3JREA 1YJNI 4KFCA 2HXOA 3F22A 3F8MA 1UCRA 1FBQA 3RPUD 3J80K 2FA5A 4CH7A 2MD0A 2ME0A 4MTEA 4FE7A 4DBQA 5TJJA 2XGXA 2KDOA 1XS9A 3CCEI 2RNGA 3ZXSA 5DDGA 1D3YA 4I09A 1IUYA 5D6EA 1JJ6C 3K4BA 2E1MB 1OJLA 3CCYA 1YW8A 2V9PA 1F36A 5EZHA 2R7RA 4XKBA 4ESJA 4KYWA 3VPRA 5EG0A 5CQEA 5IYCJ 4A6DA 3ASOH 2H94A 2VT3A 1QHHD 2UZKA 2FD5A 4KISA 5KK1A 2XPWA 5IT9Z 5IP6A 1I5ZA 5FLVA 4MNUA 1JT6A 1TZLA 1YLFA 4E7LA 2XC7A 4G7HF 3FK6A 5EDNA 3PL8A 2M4GA 1BC8C 3LSIA 3A0HC 3ASNH 4XLEA 4CYCB 1OISA 1QZEA 1AKHB 2JRMA 4YFXF 2FNAA 5B66C 1VTNC 1VF9A 2BV6A 5FLXK 2K9SA 2BY1A 5EF6A 3OYEA 4BACA 5EEHA 1WWXA 4ESFA 1UHWA 3BLYA 3LA3A 2R3SA 3HPHA 2GA2A 1ZQ3P 1TT5B 2HDDA 3CF5F 2DQRA 2X6XA 3K1MA 2PI0A 1Z6RA 2CU7A 5F08A 4OIOF 2IA2A 2XB5A 2KZVA 2VOOA 3KZZA 3ZGKA 1N77A 1JE8A 3F8FA 1O7LA 3F8NA 4YEJA 3A01A 3RZDJ 3CC7I 4HG2A 3LQQA 1BI1A 5AONA 1OCZH 3H92A 4M6YA 3KLNA 3WGGA 2HR3A 4FASD 5LHHA 1XPXA 4XOTA 1IN6A 2IP2A 1UHMA 3DBHB 2VN2A 1A35A 1MBKA 1IV8A 3HOYJ 2M8EA 1VQPI 2DK5A 3OR2C 4A69C 3OY9A 3KLOA 1IRXA 3TP3A 3OYNA 1FOWA 1IW7F 2A6EF 2LFBA 2W7NA 2VE8A 1ULYA 3I59B 1S9HA 2J5PA 4IQ4A 4XKWA 2BHZA 3BOQA 2CG4A 1O4XA 1V5EA 3JSPA 2ID6A 4C3HJ 3HHHA 4B47A 2EV0A 1POGA 2X6OA 1CQTA 2NAZA 3PIPF 2DU9A 1K6YA 4HDUA 3MD2A 3FMSA 3BROA 3FXJA 1P4AA 1XX5A 2PFBA 1NTCA 2ME6A 3BJOA 1KQ8A 4UB6C 5L3CA 4M9SA 5K5RA 2CJJA 2R5ZA 1XC5A 4A6EA 3UKGA 2DT6A 1I1GA 2O5RA 3FK7A 2RAEA 2BW3B 3CMYA 1K4TA 2VASA 1WH7A 3DCFA 2HS5A 4UUVA 2R92J 1MBFA 5B1AH 2ZFUA 2VB6A 5IT3A 3WODF 2XGEA 4BHBA 4ASNA 3RQIA 1XG1A 2CSOA 4UVAA 4A12A 2XKOA 2DMNA 2ZXIA 4C9YA 3MZ8A 4ZC3A 3JRCA 3W2AA 4A3CJ 3J80Z 4BYYA 5HS9A 5JVGF 3F6VA 1DQUA 2V9KA 3A03A 4E7SA 1FMWA 1TL8A 1KONA 1IGNA 2LMDA 4D5CA 3WTTC 5HDKA 3K10A 4P9UA 3Q5FA 2GXAA 2VUMJ 3CP8A 4N0BA 3LSGA 2V1UA 1SD6A 4N4NB 1BIAA 1G2HA 3JW4A 1N75A 4A0XA 5LRSA 5E3OA 2ZC2A 1YOVB 5HODA 4WF2A 1O3SA 1H89C 1HSJA 3SXYA 5GAHJ 3GYHX 4QWQA 2PQ8A 3CD6I 2DO7A 3DFGA 3RDIA 2TCTA 3WTXC 4HV6A 4HZFA 2FF4A 3RZOJ 5F27A 3TGNA 1H9TA 2O0YA 4A3GJ 3OYDA 5HLTA 2MGQA 1RC9A 3SZGA 2XF6A 1OYWA 5FLXZ 3FXOA 4HV5A 4LITA 1DP3A 2ZFWA 3G4SI 4P96A 2BXYA 1YX3A 3CO7C 3RPUA 3DPTA 3FHNA 1H8AC 4LMYA 4OOIA 1T2KA 3DP7A 4F55A 5FLMJ 4AU7A 2DA6A 2MW8A 2UWMA 3PNYA 5M5WJ 3NARA 4L0ZB 1VQ7I 4NQWB 2R7UA 1MGTA 3OV8A 1R5HA 1F4KA 2Y75A 3HUGB 4KT5C 1SD7A 2JMWA 4PJNA 2DCEA 4YRVA 3BZ6A 4UUSB 2QQ8A 3G73A 3V7CA 2Z33A 2LP0A 1Y56A 1GT0C 1UELB 2ZSIB 1GV2A 4NHJA 1U5TB 4M6VA 2L3DA 3QODA 2ACJA 2O3FA 1ZLJA 2E60A 1WCMJ 4LJZF 4KDPA 5D8KB 3F23A 1MJAA 1XTAA 3ML6A 2Z16A 3QU6A 2NVYJ 3D5SC 2VBZA 2VPRA 4QIWN 4YIIA 2CUEA 1USTA 4BE1A 2QBYA 3G6EI 2V79A 3P5JA 3C7JA 1JUMA 3NQOA 5B1BH 3K4MA 5KAIC 1K78A 2L7MP 4GRIA 1FP2A 2K5CA 4Q47A 4E7IA 1NH3A 4CZZA 2R7SA 2QQAA 3ZP5A 2EZHA 3CLOA 4NB5A 5CVIA 1BR1A 4N9IA 4Y52J 3E3VA 3CCSI 1FNNA 4RB0A 3AL0B 2JT1A 4KIBA 1S7EA 1VQNI 2EBIA 1Z1DA 2A6HF 2M3AA 4F92B 4JBAA 4EJUA 1WJFA 4I02A 2VQGA 1RKTA 2DYRH 3OSGA 3VSLA 2P8TA 1G8XA 2XPVA 2I8DA 3CDLA 4IOAF 2BXZA 2GQQA 3BCAA 4MLOA 5FKKA 2DLLA 1OCCH 2DW4A 4Q5SF 4CSWA 4XLFA 2IXSA 4PJJA 5BQTA 3F6OA 2XGDA 2VE9A 1XN7A 2ISYA 4AWXB 4E70A 2F6CA 3CCLI 4XSZF 3W3CA 4L5JA 1E0EA 3WGIA 2X48A 3HZJA 3RPQA 1MSFC 4G9YA 3JRAA 2P81A 3J7AO 1WGXA 1D1AA 3GZNB 2IBDA 2WAQN 3CP2A 4II2A 1G6NA 3LWFA 5H20A 2BGCA 2HNHA 1ZR4A 1WI3A 1V5FA 3K70D 4M74A 1R9TJ 1TWAJ 4MEXF 5EYRA 4EV0A 3CCVI 2JVHA 2VJ4A 2DFFA 2XVCA 2CW0F 1JKQC 4AIJA 1TWFJ 2KIMA 4YIFA 3HOWJ 4UHTA 2DTRA 1JTXA 4IRIA 2FE3A 5ICCA 1ZG5A 2EA4A 4N4OB 2CH0A 1D1BA 1TQMA 4XLHA 1KGSA 3ABTA 2DPUA 2V6EA 3I3LA 3W2VA 3CTAA 3WHBA 4IZZA 2Y31A 4IPAA 2ELHA 3CDHA 3K70C 4L18B 4E7ZA 3QPTA 3GTGJ 4XMYA 1XCVA 4C2TA 3FM5A 4AYBN 1XCBA 5M3FJ 4QSHA 5FGMA 3I4NJ 1HW5A 2QM3A 4EJVA 3BWGA 2QSHX 4HRIA 1YFHA 3KZYA 5F0CA 5HDNA 2R7VA 2P6SA 2MC3A 2O9LA 3VYRB 4FTHA 3KYDB 2DMUA 4BH9A 1WKMA 3ABKH 4UVCA 4ANJA 5DCMB 2HU9A 4EGYA 2WC2A 4IRHA 3RKXA 3E5QA 1MBEA 2KZGA 4CYCA 1X1PA 2KKOA 2MLGA 3HL2A 2IVMA 1ZLKA 3I71A 3MWMA 2NVXJ 5DV5A 5K1YA 2Z1DA 2DJNA 5DM7F 1AA7A 3IKVA 4HPQA 1XGSA 3CMMA 3PNVA 4KN7X 3M3YJ 2UXNA 1HW1A 3GFJA 3W2WA 4AIHA 4KIFA 1QBJA 3OYBA 4JX5A 4DW6A 2HPIA 4JQFA 1T6SA 2OCEA 1YE9A 4U88A 2VC1A 4EJWA 2R7WA 2P5VA 1GXPA 2DJIA 3L2VA 5ICGA 3SZPA 2H8RA 3CC2I 3IAM2 2MC4A 3AKZA 2V4JC 4IX7A 2O61A 4YELA 5HS7A 5H6RA 4PK4A 2HVSA 1P4WA 3Q0UA 1Z9CA 4PFOA 2HOAA 1F5TA 2ZNZA 2TRTA 1B9MA 3B02A 4LGWA 2HDCA 1IF1A 2M7AA 1T38A 2EFNA 5HLGA 5DD8A 2KJCA 2OC6A 3IUOA 5BPDA 1HLVA 1FTZA 1FBSA 3O6BB 5GAGJ 3WE3A 2STTA 3BR5A 2WY7Q 2K3PA 4HA8A 1MDMB 2KIUA 2VODA 1ETXA 1YG2A 2IAIA 5EGOB 4P5OA 4A93J 4G7OF 1VI0A 3N05A 3HG9A 1VFCA 5ED4A 2ZCWA 4A3IJ 2WAEA 1DUXC 1LFPA 2CFOA 3ZMDA 1WHUA 2WTEA 3AL0C 1ZREA 4IQJA 1XMKA 2GZWA 4S05A 4OINF 4XICA 3H3VK 2XHKA 3FKJA 2P5LC 1B1BA 3I0TA 5J8CA 5D4RA 1A6IA 4XQFA 3FKIJ 1R1TA 1LQ1A 3QPSA 4KT6A 1WQ2A 5DYMA 2CGPA 2LNBA 1R4NB 2HZTA 3E6CC 3BZKA 2BW3A 1WJEA 3LA7A 2HEOA 1DU0A 4HF0A 2OZ6A 4ZTJA 2BY3A 4O5VA 1J9IA 3E1SA 2XIGA 2QCOA 1ZRCA 5F04A 1MBHA 4F91B 3K7AJ 4OMYA 1TTYA 3X2QH 1QO0D 2ECCA 5BPIA 2HOTA 4HW0A 1QVUA 5JHUA 1KZHA 1LVAA 2XB0X 5DEQA 2YU9J 1YYVA 3BZCA 2GM4A 1HOMA 4CCJA 4LFUA 1ZKGA 1HF0A 1Z3YA 1HXDA 3I64A 3AG4H 4D7NA 2CW7A 4X6AJ 4BAYA 5J3LA 3CF2A 1V4RA 1Z67A 3KP4A 4AM3A 3TMOA 2PN6A 4NC7A 2HOSA 4A3LJ 4A3KJ 1A31A 1TWHJ 1YW7A 1I6HJ 2L7FP 3OIOA 2M2EA 3JRIA 2OV7A 2BE5F 4F3QA 4HNTA 2I5UA 2FMYA 4XBFA 2VPLA 3L9FA 2IS2A 3HRTA 1F43A 2JWTA 3ISPA 3DEEA 3WHCA 4RGRA 4BBSJ 4C3JJ 4KIGA 2P4WA 4ZYGA 1Y39A 1RNLA 1LEBA 5D5VB 4X0GA 2R5YB 4XLCA 3FXQA 1RKWA 2D1VA 4EGZA 4II3A 3D1NI 4B3AA 1K6OA 2EZLA 1WH5A 3GUDA 3B6CA 3KP2A 1UFMA 5J8FA 4GO1A 2E19A 4NQWA 2OA4A 3FXLA 4A0YA 3ZQGA 1FSEA 1EJ9A 3ECHA 2W57A 1VZ0A 3A0BC 5AIPA 1YRNA 2K9LA 3DU5A 4BY7J 3ZQHA 4UUSA 2R7FA 2QF7A 2M30A 2Y0SN 2OAZA 3LSHA 4HSRA 3B6AA 1KU9A 2DFEA 3CCUI 1OCTC 1U5TA 2F4MB 4I2OA 1T0FA 3ZN0A 4IHTA 2MFZA 3BR1A 1B8IB 1ETWA 4FCYA 2Y0MA 1ERDA 3BJ6A 1TBXA 2ZXJA 2L9VA 2W24A 3R0AA 2EIMH 2QVOA 2L2OA 3E7LA 3LAPA 2NNNA 4AC0A 1ZR2A 1KA8A 5E3NA 2L4AA 1LE8B 2FBKA 4ZYAA 2VQCA 3JAMK 3P9KA 2MYSA 5CJ9A 4P9FA 3GTMJ 3EQLF 3QOEA 4XM3A 2KDZA 1ZRFA 2K9NA 3GLLA 2L9RA 4WWCA 2FJ1A 2R93J 2ZKZA 1LVKA 3OS2A 3ROUA 1TC3C 3N97A 4I99C 2FMLA 5E1WA 1X3WB 3TL4X 1QVTA 2VJ5A 2W00A 3HGYA 3KCCA 1GXQA 3RYRA 1PUFB 3S2WA 5L3EA 4J01A 4FX4A 1JTYA 2TDXA 2QUFA 2KPMA 3GFIA 4P55A 3HDDA 3I9V2 2P7CB 1W7PB 4XRSA 1AWCA 4E7KA 3MFKA 1WJ5A 1QNTA 2V1XA 3BG9A 1RUOA 1S7AA 1O3QA 2UV1A 3DPLC 5DS9A 1MKMA 3JCUC 3UR3C 3LSMA 3S93A 3HXLA 2M0CA 1MD0A 1I3QJ 2A05A 2LBFA 4ZH4F 1ZAOA 4BKXA 3P9IA 2HGCA 3U9GA 2D1HA 4ZTFA 2E1CA 1LB2A 4A3FJ 2CYYA 4FETA 1Y0NA 1V3FA 4RAFA 3KEYA 4MHGA 1RRJA 1BJZA 2R7XA 2V9VA 1BIBA 4ITVA 5F1RA 3SHFA 3S3OA 1B6AA 4XN0A 2JUGA 1E2XA 3V7SA 4OAYA 1G3TA 3HSEA 2EV5A 2ZXWH 1HQCA 2RREA 1SVMA 2H6CA 2P6TA 5B5EC 3IWZA 2ZO4A 4DYQA 1HDDC 1IRFA 1E17A 5E8IA 1WJCA 3FISA 2PEXA 3AG2H 2LY1A 3JRDA 3L2QA 4G6DA 2FOKA 2KFDA 2DAOA 3V7RA 1ETVA 1IZ1A 4RLFA 2EFOA 1IG7A 2HDWA 4RA2A 2DA7A 3SDGA 1LDKB 5ICFA 2EFPA 2JZYA 2LK2A 4OIPF 1SVOA 3HKZN 1FWZA 4AVPA 1VQOI 3B73A 3KZIC 4HX4A 1B59A 2WBMA 1NK3P 2BBYA 4O3MA 2FU4A 1HKQA 1R6RA 4KJZA 1IN7A 1RZ4A 2BY2A 2B63J 4ZZLA 2JSPA 3Q0WA 2IW5A 3PQKA 1R5GA 3QYEA 1PVEA 5DCMA 3BC8A 4KA4A 1AU7A 3TEDA 1ZTRA 4FISA 5DUIA 2X1DA 4F52A 1U9OA 5FB2A 2JK3A 1WJAA 4X1EA 3S1QJ 1TQIA 3ZMSA 2YU3A 3ZMVA 3R61A 1LFBA 3GFMA 3WU1B 4MQVA 3ABLH 2HQAA 2EK5A 4U0VA 3DXJF 5J4YA 2YX4A 3K2AA 2VOPA 2EH3A 2CQXA 1HCRA 5CVRA 1ZARA 2DMPA 4J00A 4I7HA 3JAMZ 3BG5A 4LG0B 3OOPA 1TW3A 1XDSA 1ZGAA 4DOZA 3W6VA 1FTTA 4BUPA 2XROA 4JP0A 1I1SA 1YJ9I 2KIFA 2IT0A 1J5YA 2FEZA 2QQ9A 2GXBA 5D8LB 5D5UB 5FO5A 2O7OA 3KP5A 3AG1H 4GXOA 4HOBA 1YS6A 3ZQFA 3DKYA 1FPQA 3P9CA 4M3EA 2EWNA 5J1YA 3JRHA 5FRNA 2AQEA 1W4MA 3HOXJ 1PUEE 2Z9OA 4BEHB 4CUGA 1YITI 4BDZA 2XAGA 3EPZA 4HQEA 3G2BA 2JA2A 4LB6B 4BQAA 3K0LA 4UVBA 1GV5A 3K1PA 5L3DA 1L0OC 1X2NA 4U0WA 2X9DA 4LIUA 1UG2A 1W7PD 5EGOA 1R1VA 1ORKA 3WTZA 4KITB 2ETHA 1XSDA 4ON0A 2PJPA 3GEZA 1VQLI 2OZUA 2V7FA 4G94A 2R0QC 1P7JA 3BPXA 3L7WA 1H88C 2CRGA 4UV9A 2K7LA 2PMHA 2MABA 4UV8A 2HYGD 1BI0A 3BR2A 3LSPA 3FM3A 1YS7A 2L7KA 2DXIA 5ICEA 2MH9A 2E2JJ 4V2GA 4LLLA 1TT0A 2E1MC 4BQNA 3PFIA 4XLAA 1BJAA 4KN4X 2EZIA 1G4DA 1ACIA 4D5FA 1QHGA 3MEXA 3BP8A 4PJ0C 4GYIA 5K7FA 1P92A 4IXAA 1BL0A 3TO9A 4AVZA 2OTLI 2VIXA 4XOPA 4C2UA 4PJMA 3AG3H 3IH3A 2Q2EB 3VYSB 1D5VA 1TW2A 2COMA 4S04A 3BR3A 3S32A 3C18A 3JTGA 5M5XJ 4QPQA 1ITYA 5HNHA 4CZCA 4HDVA 4M71A 3GVAA 2M34A 1DGRM 2CMPA 3V4GA 2MD5A 2VKDA 3F8CA 4UXNA 4GFBA 2KRCA 1FSHA 2VKHA 3S15J 1PJRA 3EUKL 4UUTA 3OSFA 1TNSA 3BT9A 1G3WA 4RDUA 1SANA 1RUNA 3WTVC 4F7ZA 2IA1A 3O8HA 1NK2P 5J47A 1U8RA 3HOTA 1P6RA 4ENNA 3WE2A 2CQ7A 1MNDA 4L9TA 4G6TB 2F48A 2NVQJ 4EM1A 2FQ4A 3K4KA 3GX4X 1S3JA 2L5QA 2ZSHB 1EH8A 2DFIA 4B4CA 1PP8F 4HLXA 4Y17A 1FJLA 2KRFA 2R7DA 1TWGJ 4RS8A 1BI2A 1JHFA 4ZYHA 3GFLA 3K9TA 2LKXA 4ESBA 2LG4A 1X3ZB 3F3XA 2IA0A 1XGOA 1USSA 3EYIA 4I0BA 1MMNA 1IRGA 5BMZA 2IS4A 1D1CA 2I10A 5E20A 4B3XA 2LLKA 3CCQI 1PDNC 5EEGA 2HYJA 2KRHA 1XMXA 1GVDA 2CV2A 1FOXA 2V1DA 1ZN2A 4JYKA 5DCFA 3DU6A 2BHYA 5BS6A 1NG6A 3BR0A 2DOEA 3GTJJ 1C0WA 1EF4A 1VQ6I 5JFRA 3J7YJ 2CQQA 3RSNA 3FXMA 4A0ZA 2ESNA 1FLIA 2O03A 3OMYA 3ZR8X 1JXSA 4XL9A 2BVLA 3CCRI 2H8WA 1Y0UA 4XSXF 3MN2A 4FX0A 1B8IA 4DIQA 1OCOH 2K02A 5J6XA 3BDDA 4WCGA 1FYKA 2RC4A 4CCKA 4PGGA 1IN5A 1Z05A 5K7HA 4U7BA 3D5LA 2XF5A 2LR8A 1E3HA 3MKWB 4L5IA 5EG0B 2VKEA 4L9JA 1PP7U 3SFZA 2FBIA 4HNUA 1ZK8A 1LE8A 1MSEC 3ZMTA 1I6XA 2CWEA 2RVCA 3DEUA 3H9JA 1OYYA 3N4MA 3S16J 1APLC 3S1MJ 1BR4A 4R8HA 4A5MA 1W5CC 2DOAA 5B3SH 5A2QK 2K9MA 1YI2I 2GBYA 3C1DA 3K4JA 3R4KA 2R7QA 2ECBA 4IHWA 1B9NA 2DA3A 1HC8A 3S1RJ 1PUFA 2NXNB 1OPCA 3W6KB 1OR7A 3S17J 1GVJA 1X2MA 3GCMA 2LYCA 1UJ8A 3EYYA 2GIZA 4LOCA 1R71A 3WTSC 3CUQB 4CICA 3QP6A 2BZTA 4O6JA 2ZJPF 1YTYA 2FSWA 2RQPA 2VXZA 5E79C 2VI6A 5IOZA 3QU3A 5JI6A 2B9SA 4RGSA 1D8KA 1U8BA 3J7AY 3KX2A 1SAUA 3CDIA 3HRSA 3PSFA 1JI8A 3LFKA 3S2HJ 3T1BA 4LG3A 3I54A 2ZBKA 2JA8J 2FX0A 1AKHA 1N78A 4RM3A 4D0PA 2X6YA 1YQAA 5HLIA 2VKVA 2DI3A 1WZ2A 1FEXA 5JLWA 1V55H 2HXIA 1AHDP 4B44A 1SC7A 2GAUA 2OJED 5F6FA 3K4CA 3ZOBA 2B0LA 3CMEI 3HTUA 2P5KA 2QLZA 4DBRA 4WK8F 4XLNF 2PLYA 1TP4A 1WRJA 1ETYA 2ZJQF 2N8GA 1IO2A 3JRFA 3PSIA 3KP7A 3EETA 3TO7A 3BR6A 1ETKA 2WB1N 1I50J 4ZDOA 3TDUC 3KEOA 5CPRB 3IC7A 1U5TC 3FX3A 2XRNA 1T0FC 3H5RA 2XASA 4OIRF 1I3AA 4NBQA 2V1NA 1VQ4I 3PM1A 1FYLA 3ZN1A 4M9ZA 3CLQA 1X58A 1WJBA 2Z99A 3PQJA 4NC8A 4ZZDA 4JX6A 3ZQCA 1U9NA 5DTDA 1HKSA 5EJCA 2ESHA 3VWBA 2NS8A 5HNFA 2DQLA 2LREA 3RKYA 2PMZN 4D9JA 5JVTA 2DMTA 3OL3A 5E1XA 3JR9A 3KP6A 1JJ8C 2HYFA 4CCLA 3OS1A 4JX4A 2L02A 2QZ8A 3R60A 3I59A 3H9QA 3HSFA 4K2EA 1FIAA 3I5UA 1O7FA 4GGGA 5H6QA 3HOUJ 1JUSA 4ZDLA 4RB2C 3GBGA 1S5LC 2E5NA 4L9NA 1ZGWA 1OKRA 3A1YA 2A3SA 4ZDPA 2KHMA 3LAJA 4PFPA 2HOEA 2XRLA 5CKTA 1RETA 1IDZA 3JSOA 4GCVA 1XGMA 4BXXJ 3TW6A 3U1KA 1T33A 4EJOA 1W36D 2DPDA 3LL7A 2FQ3A 4HF2A 3HRUA 3IRQA 2ELKA 4LG0A 2V26A 5CLSA 2JPCA 3V8LA 4R1HA 3CCJI 1Q1VA 1RPWA 5GTHC 1YO5C 3MQ0A 5A2QZ 3M7GA 4CYDA 3CO6C 1BBYA 1YX5A 1KQ0A 2QKMB 4XR6A 1K83J 3Q3SA 2DFHA 3DKXA 4EM0B 2X4HA 5D5XB 3S3NA 1MMGA 4L0YB 1EH7A 1XB4A 3DTKA 3NEUA 5F64A 4YFKF 2MLKA 4I6ZA 1Y8RB 3FF5A 1HDPA 3IH2A 1ENHA 2A68F 1QU3A 5GAEJ 3I55I 1F9NA 1IXRC 3QPLA 4IO9F 3M8JA 3E0JB 2VBYA 5ILSA 2DTZA 2Y9ZA 1ODDA 1KU7A 3RTRA 3LA2A 3QYBA 2WAQA 5GTIC 1O57A 2GA1A 3P7NA 4PGHA 4B1RA 3OS0A 4QPOA 2HQRA 4Y33A 1DDNA 2W4SA 2E34A 1BOAA 2QKLB 3T8RA 2IRFG 2M45A 3OL4A 5IPAA 1MNMC 3M8EA 2AXTC 1Y8QB 2H27A 3CJQB 1G3SA 3BPVA 3H0GJ 1U0JA 1UG0A 3MKLA 2L01A 1RIOH 4IHYA 4G12A 2NS7A 4B8XA 4WXCA 3UNGC 3GTKJ 2PBIA 4XRSG 5M5YJ 2H1KA 1WFXA 3C3WA 4M72A 4MQ9F 1IXSB 2EB7A 2XGCA 3CUQC 4C30A 3S14J 3GTLJ 1R7JA 4KUMA 5IP9J 3IRRA 3RCOA 2QENA 2QA4I 1W1WE 2QBYB 3RQ4A 3U21A 3DF8A 2JTVA 2H09A 2RGVA 2W25A 4AYBA 1K78B 2Q2EA 2FBHA 2BYVE 5LGTA 3I56I 2F4OB 1BW5A 2LRDA 4HX7A 3PIOF 3Q9VA 4LK1F 3HUGA 2OUMA 3CMAI 2X1EA 4N9HA 3GZ5A 3R6SA 2X1CA 3RYPA 3LNQA 1Z6TA 5F0FA 3H9GA 2KT0A 2EA2A 3U1DA 1E3PA 2GIVA 2JPBA 2F5EA 1OCRH 3AAFA 2A07F 2JA6J 4XONA 2OCCH 4M9XA 3HC7A 3C2GA 3A2KA 4BHCA 4EATA 2D45A 2E7XA 3FBNB 5KHDA 1ZRDA 3G1MA 1BOBA 3RI4A 1ONVA 3HGGA 1MMAA 2CFXA 3TOBA 1CF7B 2E1OA 2P7VB 2E35A 1NG7A 1UHSA 2IEKA 4NUBA 2DT5A 1G59A 3E6MA 5CYVA 4OU0A 2HQ5A 4B43A 3D5RC 3DKWA 1SEUA 1XMAA 5J4VA 1HW2A 3U2RA 2L9SA 3OYGA 1UAAA 4L9VA 1QGPA 2O8XA 4XNFA 2WA0A 4CCNA 4NC6A 3BG7A 2LY9A 3CJRB 4IJAA 4B48A 1T95A 3WTYC 4A3BJ 1KQ9A 4RAYA 2R7OA 3GTQJ 2VC0A 3HOVJ 3LSJA 3HJEA 1IDYA 4LB5A 3BTJA 4YG2F 4BBRJ 1R36A 3H35A 1IAWA 3VFZA 4E7JA 1YIJI 2YSRA 4BDYA 3BQZA 3SYTA 4WX9A 2LD5A 1BI3A 2WADA 2HPMA 5BNGA 2KL4A 1KYWA 1FIPA 1Z77A 2ELJA 4RMNA 3ONQA 3T5XA 1IXCA 2GXGA 2E7WA 4Y7NJ 1SFUA 1Y1VJ 2M7BA 1MMDA 1HBXG 5D4SA 4M3DA 2BEOA 2NS0A 1MH3A 4W97A 2ZMEB 4IHSA 1ETQA 2DDAA 2EQRA 3TKYA 5HDGA 4HF1A 2JQ7A 2FOWA 3OWTA 3ULQB 4OWRB 1E3OC 1R49A 5GPAA 3QP5A 4L5EA 1Z21A 4BHPA 3GMEA 1K7AA 2LSOA 1MJBA 2ID3A 3PJRA 2KP6A 4M3FA 5K5QA 1JKOC 4ENKA 1V54H 5LD2C 1H9GA 1H0MA 4LLNA 4U87A 4CDGA 3HOZJ 3HHGA 3ZRGA 2HQNA 3OYLA 1OLTA 1IRZA 2ZB9A 1VQKI 1IN4A 5DM6F 1HKTA 3HIFA 3TO6A 1T8IA 1Y6IA 2A5WA 2D2WA 1LNWA 2DYSH 4CCOA 4Z6YA 3J7ZI 1J75A 5D5WB 3L00A 5HVQC 4V2FA 5L3GA 1IUFA 1B4AA 1R23A 2JUCA 5IYBJ 2W1OA 2EIJH 4DZPA 3CESA 3J81K 3CUQA 5J1UA 2AQFA 5IYDJ 5FKMA 3REOA 5BOXA 1YIOA 2ZJRF 4ETSA 2G9WA 1GHCA 2LDUA 4NDLA 3TW7A 9ANTA 4M3BA 3GW2A 4HEA2 1Z0XA 2IGKA 2OBPA 3OR1C 3MZHA 3F9KA 1BW6A 4HBLA 5KNLA 5KVRA 3O2PE 2IGOA 1R00A 3I4PA 4IRGA 1EKEA 3SQNA 4HNVA 4IOCF 2JRTA 3BTCA 3OYHA 1FZPB 3DQVC 2O8KA 2F5VA 2KQRA 3DBRB 1ZELA 4Y15A 3RIRA 3HRMA 4IL6C 4EQQA 2CQNA 5CVJA 3EUAA 2G7HA 4MFEA 2F5CA 4W1UA 3M1EA 1M1EB 5J40A 3ESWB 3WU0A 3COAC 1W0UA 2CW8A 4LLGF 3HOSA 3MKYB 3ZCOA 3I4MJ 3M1CA 3CZ6A 2NOGA 2FNPA 1DP7P 4BJ6C 1ZG3A 2YS9A 3DLAA 2DA5A 1OFCX 1REPC 2MH2A 3V8KA 4JOMA 2EFQA 1FC3A 1Z91A 2LVSA 4CXFA 3KP3A 2VBWA 2VJIA 4V19K 5CVUA 2CO5A 2JJ7A 2L54A 3ABMH 3SJMA 1T98A 3ZMUA 2Y0SA 5J1RA 2M87A 2K85A 2D5VA 2F2EA 1A36A 3KIOA 2DDBA 4BXUA 4E6KG 5F0HA 4HSTA 6PAXA 2K9QA 3OYCA 2R4GA 3G1OA 4ZYDA 2JSCA 2WY8Q 3IAS2 1XSXA 4LD5A 3TDZC 3CC4I 1MDMA 1JGSA 4CA0A 3F8BA 3SZTA 3CCMI 2XAQA 3GWZA 2JA7J 1STZA 2EILH 2VQHA 2HTJA 3FWEA 1B72B 4BQQA 2XUBA 3Q9SA 1VNDA 3HTSB 2Q8KA 4A3DJ 1A04A 4DQ2A 3LSTA 5CQGA 1MZBA 3HEFA 4B09A 1WJDA 4ZJZA 4RB1A 3GXOA 5C3EJ 2EFWA 3GTOJ 1SFXA 3K69A 3OOUA 3HB9A 4XN3A 2P0WA 1T56A
chains in the Genus database with same CATH topology
3W6JB 2E1NA 2MBFA 2UXXA 2KJBA 2OD5A 3H3ZA 1W5SA 5E8GA 5E18F 4DNCA 3IL2A 2Q0OA 1BM9A 3L09A 1EH6A 1FBUA 2K4JA 2RKHA 3MAJA 5ILVA 3BY6A 3ELKA 1FY7A 2XAHA 2OU2A 3FZVA 2NYXA 1I27A 5LBQA 2VBXA 2OQGA 2QQBA 1SD5A 4XRFA 3J81Z 2XKPA 1Q1HA 2Z3YA 1YW9A 2W85A 1OYIA 1AOYA 1MJ9A 2STWA 4Q48A 5LLQA 4ENJA 4HX8A 4HYEA 3O3KA 4JK1X 4A2UA 5DD4A 3IHUA 1ZYRF 1KYZA 3I58A 5FD6A 1LDDA 4YFNF 3M9AA 3E97A 3BJAA 1TNTA 2L4MA 2V6CA 1TQPA 3G3ZA 2RN7A 4FHTA 2DBBA 4EVIA 2GWRA 5CVVA 4KMFA 5HLHA 1ON2A 3GZ6A 2F5DA 1JHHA 4AD9A 5E17F 3VB2A 4G7ZF 2RNJA 2M5WA 4MEYF 3RKWA 2A69F 1ZH5A 1DPUA 4MGRA 1ON1A 1R1UA 2OQRA 3FMQA 2PMUA 4Y13A 3CUOA 1XSVA 2G7UA 1FP1D 4HAMA 1LDJA 4BNCA 1SD4A 2DK8A 1CF7A 2YX7A 2YR2A 5AIQA 1W5TA 2QWWA 3T8TA 1J2XA 5LEJA 3WTUC 4M73A 2M1BA 2WV0A 1FT9A 2K4BA 3QRFF 3IKTA 4R79A 4CHUA 3KE2A 2EJRA 1J59A 2X0LA 3TOAA 1K79A 3EUHA 3FMRA 4EJTA 4EMSA 4KMUX 1W7PA 5TRDA 1U6GA 1S8NA 2C6YA 5LHIA 2A5YB 1IN8A 3LQRA 5D6FA 4WXHA 4QLCU 3ECOA 1F1ZA 5K5OA 5FD5A 3ZPLA 2XV4S 4I0AA 5LRRA 2ZMEA 2VT2A 5L3FA 1WI9A 1P2FA 2AS5F 1J7KA 3FXRA 1ZHFA 4IF4A 3VEPA 3WTWC 3WG9A 1SMYF 1FX7A 4HLYA 2RDPA 2HFHA 1SMTA 3K2ZA 4OMZA 3JTHA 3QOPA 2VONA 3VODA 3GLXA 3F21A 1D8JA 4KICA 4RGXA 2AXLA 4EM2A 3KETA 1SFEA 1S6LA 2A61A 1X3UA 5ERIA 2LF7A 1T39A 5DUKA 4XLPF 1BN5A 2Y48A 4M6XA 3FXUA 1ZG1A 1U78A 1OMIA 5LHGA 2YPRA 1FOKA 1CGPA 3ERED 4MTDA 5FFZA 3QAHA 4ENMA 4PDKA 5LGUA 4U7DA 3MZYA 3WGHA 5E1ZB 3MCZA 1P4XA 1Z7UA 2NRAC 4I01A 3EDPA 2XAFA 4HQMA 1J0RA 2W84A 4OIQF 1O3TA 4PCQA 2IPQX 2LF8A 1HSTA 4H0EA 4G6QA 2ISZA 2K27A 2ADUA 5FFXA 5LEKA 3GF2A 5HOOA 4KNYA 3K1NA 3F72A 2FXAA 1KU3A 3DV8A 1QPMA 4G8XA 3GO5A 3KFWX 4RB3C 2HTSA 3L2CA 2RV8A 2O6GE 1R22A 1XDUA 3E5UA 2HWVA 4FT8A 3TQNA 2HKXA 4PZJA 1R58A 2K86A 1O3RA 5ILUA 2ZJ2A 4LK0F 5IT9K 4U0YA 3I53A 1QZYA 2QYOA 3HSRA 4AIKA 4RAZA 1UB9A 1BC7C 5LGNA 3RJPA 1QZZA 3FHZA 3V8JA 2LKPA 3ZMZA 1S29A 1S7OA 1XD7A 3CJNA 3H3UA 1U3EM 2H6BA 2Z5UA 5JR3A 2HKOA 4TV7A 4CO8A 3T0YA 1LJ9A 2NNYA 1ZGJA 4Z2YA 1U2WA 2EV6A 2F5FA 4WXDA 3NRVA 1LEAA 1QQIA 2CQKA 3M8FA 3HYIA 3IWFA 3ABUA 4I98B 4UNOA 1DPRA 2J5OA 1TLHB 3KEQA 3D0SA 3ZQ7A 2IJLA 3R0JA 3E6DA 2WWYA 2ZNYA 4A5NA 1SAXA 1G3YA 1NHAA 1KU2A 2MA3A 4Q4ZF 4GYGA 3VOEA 1RI7A 1L3LA 1FYMA 2XAJA 4RGUA 3QPHA 2FRHA 1XGNA 1WSUA 4CGZA 3E6BA 4ZYEA 1EV7A 2PG4A 3E5XA 5L3BA 5HS8A 4IVNA 4KFCA 3F22A 3F8MA 1UCRA 1FBQA 3J80K 2FA5A 4MTEA 5TJJA 2XGXA 5DDGA 1D3YA 4I09A 1IUYA 5D6EA 1YW8A 4ESJA 4KYWA 4A6DA 2H94A 2VT3A 2UZKA 5KK1A 5IT9Z 1I5ZA 4MNUA 1YLFA 4G7HF 1BC8C 4YFXF 2FNAA 1VTNC 2BV6A 5FLXK 5EEHA 1WWXA 4ESFA 1UHWA 3LA3A 2R3SA 2GA2A 2DQRA 3K1MA 2PI0A 1Z6RA 4OIOF 2IA2A 2VOOA 3KZZA 1JE8A 3F8FA 1O7LA 3F8NA 3LQQA 1BI1A 5AONA 3H92A 4M6YA 3KLNA 3WGGA 2HR3A 5LHHA 1IN6A 2IP2A 1UHMA 2VN2A 2M8EA 2DK5A 3KLOA 1IW7F 2A6EF 2VE8A 1ULYA 3I59B 2J5PA 3BOQA 2CG4A 3JSPA 3HHHA 2EV0A 2NAZA 4HDUA 2DU9A 3FMSA 3BROA 1P4AA 2PFBA 3BJOA 1KQ8A 5L3CA 4M9SA 5K5RA 4A6EA 1I1GA 2HS5A 4UUVA 5IT3A 3WODF 4BHBA 4ASNA 2CSOA 4UVAA 4A12A 2XKOA 3J80Z 4BYYA 5HS9A 3F6VA 3WTTC 5HDKA 4P9UA 3Q5FA 4N0BA 2V1UA 1SD6A 1BIAA 3JW4A 4A0XA 5LRSA 4WF2A 1O3SA 1HSJA 3SXYA 3GYHX 4QWQA 2PQ8A 2DO7A 3DFGA 3RDIA 3WTXC 4HV6A 4HZFA 2FF4A 3TGNA 1H9TA 2O0YA 1OYWA 5FLXZ 4HV5A 2ZFWA 4P96A 3CO7C 3RPUA 3DPTA 4LMYA 4OOIA 1T2KA 3DP7A 2UWMA 4L0ZB 1MGTA 3OV8A 1R5HA 1F4KA 2Y75A 4KT5C 1SD7A 3BZ6A 3G73A 3V7CA 2Z33A 4NHJA 1U5TB 2ACJA 2L3DA 2O3FA 1ZLJA 4LJZF 4KDPA 5D8KB 3F23A 1MJAA 3ML6A 3QU6A 2VBZA 4YIIA 1USTA 2QBYA 2V79A 3C7JA 3NQOA 1K78A 1FP2A 4Q47A 4CZZA 2QQAA 3ZP5A 3CLOA 4NB5A 5CVIA 4N9IA 3E3VA 1FNNA 4RB0A 2JT1A 4KIBA 1Z1DA 2A6HF 4JBAA 4EJUA 4I02A 2P8TA 2GQQA 2DLLA 2DW4A 4Q5SF 5BQTA 3F6OA 2VE9A 1XN7A 2ISYA 4AWXB 4E70A 4XSZF 4L5JA 3WGIA 3RPQA 4G9YA 3J7AO 1G6NA 3LWFA 5H20A 2BGCA 4M74A 4MEXF 4EV0A 2XVCA 2CW0F 4AIJA 2KIMA 4YIFA 4UHTA 2DTRA 4IRIA 2FE3A 5ICCA 1ZG5A 2EA4A 1TQMA 1KGSA 3ABTA 2DPUA 3CTAA 4IPAA 2ELHA 3CDHA 4L18B 3QPTA 1XCVA 3FM5A 1XCBA 5FGMA 1HW5A 2QM3A 4EJVA 3BWGA 1YFHA 3KZYA 5HDNA 2P6SA 2MC3A 4BH9A 1WKMA 4UVCA 5DCMB 4EGYA 2WC2A 4IRHA 3RKXA 3E5QA 2KKOA 2MLGA 2IVMA 1ZLKA 3I71A 3MWMA 5DV5A 5K1YA 3IKVA 1XGSA 4KN7X 2UXNA 1HW1A 3GFJA 4AIHA 4KIFA 1QBJA 4U88A 4EJWA 4JQFA 1T6SA 2VC1A 2P5VA 1GXPA 5ICGA 3SZPA 2O61A 5HS7A 5H6RA 1P4WA 1Z9CA 1F5TA 2ZNZA 1B9MA 3B02A 4LGWA 2HDCA 1IF1A 1T38A 2EFNA 5HLGA 5DD8A 2KJCA 5BPDA 1FBSA 3O6BB 3WE3A 2STTA 4HA8A 1MDMB 2KIUA 2VODA 1YG2A 4P5OA 4G7OF 5ED4A 2ZCWA 1DUXC 3ZMDA 2WTEA 1ZREA 1XMKA 2GZWA 4S05A 4OINF 2XHKA 2P5LC 1B1BA 5D4RA 3I0TA 5J8CA 1LQ1A 1R1TA 5DYMA 1WQ2A 2CGPA 2LNBA 2HZTA 3E6CC 3LA7A 2HEOA 4HF0A 2OZ6A 4O5VA 1J9IA 2XIGA 1ZRCA 4OMYA 1TTYA 1QO0D 5BPIA 4HW0A 5JHUA 1LVAA 5DEQA 1YYVA 4LFUA 1HXDA 3I64A 4BAYA 3KP4A 1V4RA 2PN6A 1YW7A 2BE5F 2FMYA 4XBFA 3L9FA 3HRTA 3ISPA 4RGRA 4KIGA 2P4WA 4ZYGA 1RNLA 1LEBA 5D5VB 3FXQA 2D1VA 4EGZA 1K6OA 3GUDA 3KP2A 1UFMA 5J8FA 4GO1A 4NQWA 2OA4A 4A0YA 1FSEA 3ECHA 2W57A 5AIPA 2R7FA 2M30A 2OAZA 1KU9A 1U5TA 4I2OA 1T0FA 3ZN0A 4IHTA 2Y0MA 3BJ6A 1TBXA 2ZXJA 2W24A 3R0AA 2QVOA 3LAPA 2NNNA 1KA8A 2L4AA 2FBKA 3JAMK 3P9KA 5CJ9A 4P9FA 3EQLF 1ZRFA 4WWCA 2ZKZA 3ROUA 3N97A 2FMLA 5E1WA 3KCCA 1GXQA 3RYRA 3S2WA 5L3EA 4FX4A 2TDXA 2QUFA 3GFIA 4P55A 2P7CB 1W7PB 1AWCA 3MFKA 1QNTA 2V1XA 1RUOA 1S7AA 1O3QA 3DPLC 1MKMA 1MD0A 4ZH4F 1ZAOA 3P9IA 2HGCA 3U9GA 2D1HA 2E1CA 1LB2A 2CYYA 1V3FA 4MHGA 2V9VA 1BIBA 5F1RA 3SHFA 1B6AA 1E2XA 3V7SA 1G3TA 3HSEA 2EV5A 1HQCA 2H6CA 2P6TA 3IWZA 2ZO4A 1E17A 1IRFA 5E8IA 2PEXA 4G6DA 2FOKA 2DAOA 3V7RA 1IZ1A 2EFOA 1LDKB 5ICFA 2EFPA 2JZYA 1FWZA 4AVPA 3B73A 4HX4A 1B59A 4O3MA 2BBYA 2FU4A 1HKQA 1IN7A 1RZ4A 4ZZLA 2IW5A 3PQKA 1R5GA 5DCMA 4KA4A 5DUIA 5FB2A 1TQIA 3ZMSA 2YU3A 3ZMVA 3R61A 3GFMA 3WU1B 4MQVA 2EK5A 4U0VA 3DXJF 2YX4A 2VOPA 5CVRA 1ZARA 4I7HA 3JAMZ 4LG0B 3OOPA 1TW3A 1XDSA 1ZGAA 2XROA 1I1SA 2KIFA 2IT0A 1J5YA 2FEZA 2QQ9A 2GXBA 5D8LB 5D5UB 5FO5A 3KP5A 4GXOA 4HOBA 1YS6A 1FPQA 3P9CA 2EWNA 1W4MA 1PUEE 2Z9OA 2XAGA 4HQEA 4LB6B 4BQAA 3K0LA 4UVBA 3K1PA 5L3DA 1L0OC 4U0WA 1W7PD 1R1VA 3WTZA 2ETHA 1XSDA 4ON0A 2PJPA 3GEZA 2OZUA 4G94A 3BPXA 3L7WA 4UV9A 2K7LA 2PMHA 4UV8A 2HYGD 1BI0A 3FM3A 1YS7A 5ICEA 2MH9A 4LLLA 3PFIA 1BJAA 4KN4X 1G4DA 3MEXA 3BP8A 4GYIA 1P92A 4IXAA 3TO9A 1D5VA 1TW2A 2COMA 4S04A 3C18A 3JTGA 4HDVA 4M71A 3GVAA 3V4GA 2MD5A 3F8CA 4UXNA 1FSHA 1TNSA 1G3WA 1RUNA 3WTVC 4F7ZA 2IA1A 1U8RA 3HOTA 1P6RA 4ENNA 3WE2A 4L9TA 4EM1A 3GX4X 1S3JA 1EH8A 2DFIA 1PP8F 4HLXA 4Y17A 2KRFA 2R7DA 4RS8A 1BI2A 1JHFA 4ZYHA 3GFLA 3K9TA 4ESBA 3F3XA 2IA0A 1XGOA 1USSA 3EYIA 4I0BA 1IRGA 5BMZA 5E20A 1PDNC 5EEGA 2V1DA 1ZN2A 5DCFA 5BS6A 1C0WA 5JFRA 4A0ZA 2ESNA 1FLIA 2O03A 1JXSA 1Y0UA 4XSXF 4FX0A 2K02A 5J6XA 3BDDA 4WCGA 1FYKA 2RC4A 4PGGA 1IN5A 1Z05A 4U7BA 3D5LA 4L5IA 4L9JA 1PP7U 3SFZA 2FBIA 3ZMTA 1I6XA 2CWEA 2RVCA 3DEUA 3N4MA 1OYYA 4A5MA 4R8HA 5A2QK 3C1DA 3R4KA 1B9NA 1OPCA 3W6KB 1OR7A 1GVJA 3EYYA 3WTSC 3CUQB 4CICA 3QP6A 4O6JA 1YTYA 2FSWA 2RQPA 2VXZA 5JI6A 3QU3A 4RGSA 1D8KA 3HRSA 3LFKA 3T1BA 3I54A 2ZBKA 4D0PA 1YQAA 5HLIA 2DI3A 2GAUA 5F6FA 2B0LA 3HTUA 2P5KA 2QLZA 4WK8F 4XLNF 2PLYA 1WRJA 3KP7A 3EETA 3TO7A 3TDUC 3KEOA 3IC7A 1U5TC 3FX3A 2XRNA 2XASA 4OIRF 1FYLA 3ZN1A 4M9ZA 2Z99A 3PQJA 4ZZDA 1HKSA 2ESHA 2DQLA 3RKYA 5JVTA 5E1XA 3KP6A 2HYFA 2L02A 2QZ8A 3R60A 3I59A 3HSFA 4K2EA 3I5UA 1O7FA 4GGGA 5H6QA 4RB2C 4L9NA 1OKRA 2A3SA 3LAJA 2HOEA 3JSOA 4GCVA 1XGMA 4EJOA 2DPDA 2FQ3A 4HF2A 3HRUA 3IRQA 4LG0A 5CLSA 2JPCA 3V8LA 4R1HA 1YO5C 3MQ0A 5A2QZ 3M7GA 4CYDA 3CO6C 1BBYA 1KQ0A 4EM0B 2X4HA 5D5XB 4L0YB 1EH7A 1XB4A 3NEUA 5F64A 4YFKF 2MLKA 3FF5A 2A68F 1F9NA 1IXRC 2VBYA 5ILSA 1ODDA 1KU7A 3RTRA 3LA2A 1O57A 2GA1A 3P7NA 4PGHA 2HQRA 1DDNA 1BOAA 3T8RA 2IRFG 2M45A 3M8EA 2H27A 1G3SA 3BPVA 1RIOH 2L01A 4B8XA 4WXCA 2PBIA 4MQ9F 3C3WA 4M72A 1IXSB 2EB7A 3CUQC 1R7JA 4KUMA 3IRRA 2QENA 2QBYB 3DF8A 2JTVA 2H09A 2RGVA 2W25A 1K78B 2Q2EA 2FBHA 2BYVE 5LGTA 4HX7A 3Q9VA 4LK1F 3HUGA 4N9HA 3GZ5A 3R6SA 3RYPA 1Z6TA 2EA2A 3U1DA 2GIVA 2JPBA 2F5EA 2A07F 3AAFA 4M9XA 4BHCA 2D45A 2E7XA 1ZRDA 3RI4A 1ONVA 2CFXA 3TOBA 1CF7B 2P7VB 2DT5A 3E6MA 5CYVA 4OU0A 3DKWA 1XMAA 1HW2A 3U2RA 4L9VA 1QGPA 2O8XA 4IJAA 3WTYC 1KQ9A 4RAYA 2VC0A 4LB5A 4YG2F 1R36A 1IAWA 3VFZA 2YSRA 4WX9A 1BI3A 1KYWA 3T5XA 1IXCA 2GXGA 2E7WA 1SFUA 1HBXG 5D4SA 2BEOA 2NS0A 2ZMEB 4IHSA 3TKYA 5HDGA 4HF1A 3ULQB 3QP5A 4BHPA 1K7AA 2LSOA 1MJBA 5K5QA 4ENKA 1H9GA 1H0MA 4LLNA 4CDGA 3HHGA 2HQNA 1IN4A 1HKTA 3HIFA 3TO6A 2D2WA 1LNWA 1J75A 5D5WB 3L00A 5HVQC 5L3GA 1B4AA 1R23A 3J81K 3CUQA 3REOA 5BOXA 1YIOA 4ETSA 2G9WA 1GHCA 2LDUA 3GW2A 2OBPA 3MZHA 4HBLA 5KVRA 3O2PE 1R00A 3I4PA 4IRGA 3SQNA 2JRTA 1FZPB 3DQVC 4Y15A 3RIRA 3HRMA 4EQQA 5CVJA 2G7HA 2F5CA 3M1EA 3WU0A 3COAC 4LLGF 3HOSA 2FNPA 1DP7P 1ZG3A 1REPC 2MH2A 3V8KA 2EFQA 1FC3A 1Z91A 4CXFA 3KP3A 2VBWA 5CVUA 2CO5A 2L54A 1T98A 3ZMUA 2M87A 2F2EA 4BXUA 6PAXA 4ZYDA 2JSCA 1XSXA 4LD5A 3TDZC 1MDMA 1JGSA 3F8BA 3SZTA 2XAQA 3GWZA 1STZA 3FWEA 2HTJA 2XUBA 3Q9SA 3HTSB 2Q8KA 1A04A 4DQ2A 3LSTA 1MZBA 2EFWA 4B09A 4RB1A 3GXOA 1SFXA 3K69A 4OIPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W6J B;  2E1N A;  2MBF A;  2UXX A;  2KJB A;  2OD5 A;  3H3Z A;  1W5S A;  5E8G A;  5E18 F;  4DNC A;  3IL2 A;  2Q0O A;  1BM9 A;  3L09 A;  1EH6 A;  1FBU A;  2K4J A;  2RKH A;  3MAJ A;  5ILV A;  3BY6 A;  3ELK A;  1FY7 A;  2XAH A;  2OU2 A;  3FZV A;  2NYX A;  1I27 A;  5LBQ A;  2VBX A;  2OQG A;  2QQB A;  1SD5 A;  4XRF A;  3J81 Z;  2XKP A;  1Q1H A;  2Z3Y A;  1YW9 A;  2W85 A;  1OYI A;  1AOY A;  1MJ9 A;  2STW A;  4Q48 A;  5LLQ A;  4ENJ A;  4HX8 A;  4HYE A;  3O3K A;  4JK1 X;  4A2U A;  5DD4 A;  3IHU A;  1ZYR F;  1KYZ A;  3I58 A;  5FD6 A;  1LDD A;  4YFN F;  3M9A A;  3E97 A;  3BJA A;  1TNT A;  2L4M A;  2V6C A;  1TQP A;  3G3Z A;  2RN7 A;  4FHT A;  2DBB A;  4EVI A;  2GWR A;  5CVV A;  4KMF A;  5HLH A;  1ON2 A;  3GZ6 A;  2F5D A;  1JHH A;  4AD9 A;  5E17 F;  3VB2 A;  4G7Z F;  2RNJ A;  2M5W A;  4MEY F;  3RKW A;  2A69 F;  1ZH5 A;  1DPU A;  4MGR A;  1ON1 A;  1R1U A;  2OQR A;  3FMQ A;  2PMU A;  4Y13 A;  3CUO A;  1XSV A;  2G7U A;  1FP1 D;  4HAM A;  1LDJ A;  4BNC A;  1SD4 A;  2DK8 A;  1CF7 A;  2YX7 A;  2YR2 A;  5AIQ A;  1W5T A;  2QWW A;  3T8T A;  1J2X A;  5LEJ A;  3WTU C;  4M73 A;  2M1B A;  2WV0 A;  1FT9 A;  2K4B A;  3QRF F;  3IKT A;  4R79 A;  4CHU A;  3KE2 A;  2EJR A;  1J59 A;  2X0L A;  3TOA A;  1K79 A;  3EUH A;  3FMR A;  4EJT A;  4EMS A;  4KMU X;  1W7P A;  5TRD A;  1U6G A;  1S8N A;  2C6Y A;  5LHI A;  2A5Y B;  1IN8 A;  3LQR A;  5D6F A;  4WXH A;  4QLC U;  3ECO A;  1F1Z A;  5K5O A;  5FD5 A;  3ZPL A;  2XV4 S;  4I0A A;  5LRR A;  2ZME A;  2VT2 A;  5L3F A;  1WI9 A;  1P2F A;  2AS5 F;  1J7K A;  3FXR A;  1ZHF A;  4IF4 A;  3VEP A;  3WTW C;  3WG9 A;  1SMY F;  1FX7 A;  4HLY A;  2RDP A;  2HFH A;  1SMT A;  3K2Z A;  4OMZ A;  3JTH A;  3QOP A;  2VON A;  3VOD A;  3GLX A;  3F21 A;  1D8J A;  4KIC A;  4RGX A;  2AXL A;  4EM2 A;  3KET A;  1SFE A;  1S6L A;  2A61 A;  1X3U A;  5ERI A;  2LF7 A;  1T39 A;  5DUK A;  4XLP F;  1BN5 A;  2Y48 A;  4M6X A;  3FXU A;  1ZG1 A;  1U78 A;  1OMI A;  5LHG A;  2YPR A;  1FOK A;  1CGP A;  3ERE D;  4MTD A;  5FFZ A;  3QAH A;  4ENM A;  4PDK A;  5LGU A;  4U7D A;  3MZY A;  3WGH A;  5E1Z B;  3MCZ A;  1P4X A;  1Z7U A;  2NRA C;  4I01 A;  3EDP A;  2XAF A;  4HQM A;  1J0R A;  2W84 A;  4OIQ F;  1O3T A;  4PCQ A;  2IPQ X;  2LF8 A;  1HST A;  4H0E A;  4G6Q A;  2ISZ A;  2K27 A;  2ADU A;  5FFX A;  5LEK A;  3GF2 A;  5HOO A;  4KNY A;  3K1N A;  3F72 A;  2FXA A;  1KU3 A;  3DV8 A;  1QPM A;  4G8X A;  3GO5 A;  3KFW X;  4RB3 C;  2HTS A;  3L2C A;  2RV8 A;  2O6G E;  1R22 A;  1XDU A;  3E5U A;  2HWV A;  4FT8 A;  3TQN A;  2HKX A;  4PZJ A;  1R58 A;  2K86 A;  1O3R A;  5ILU A;  2ZJ2 A;  4LK0 F;  5IT9 K;  4U0Y A;  3I53 A;  1QZY A;  2QYO A;  3HSR A;  4AIK A;  4RAZ A;  1UB9 A;  1BC7 C;  5LGN A;  3RJP A;  1QZZ A;  3FHZ A;  3V8J A;  2LKP A;  3ZMZ A;  1S29 A;  1S7O A;  1XD7 A;  3CJN A;  3H3U A;  1U3E M;  2H6B A;  2Z5U A;  5JR3 A;  2HKO A;  4TV7 A;  4CO8 A;  3T0Y A;  1LJ9 A;  2NNY A;  1ZGJ A;  4Z2Y A;  1U2W A;  2EV6 A;  2F5F A;  4WXD A;  3NRV A;  1LEA A;  1QQI A;  2CQK A;  3M8F A;  3HYI A;  3IWF A;  3ABU A;  4I98 B;  4UNO A;  1DPR A;  2J5O A;  1TLH B;  3KEQ A;  3D0S A;  3ZQ7 A;  2IJL A;  3R0J A;  3E6D A;  2WWY A;  2ZNY A;  4A5N A;  1SAX A;  1G3Y A;  1NHA A;  1KU2 A;  2MA3 A;  4Q4Z F;  4GYG A;  3VOE A;  1RI7 A;  1L3L A;  1FYM A;  2XAJ A;  4RGU A;  3QPH A;  2FRH A;  1XGN A;  1WSU A;  4CGZ A;  3E6B A;  4ZYE A;  1EV7 A;  2PG4 A;  3E5X A;  5L3B A;  5HS8 A;  4IVN A;  4KFC A;  3F22 A;  3F8M A;  1UCR A;  1FBQ A;  3J80 K;  2FA5 A;  4MTE A;  5TJJ A;  2XGX A;  5DDG A;  1D3Y A;  4I09 A;  1IUY A;  5D6E A;  1YW8 A;  4ESJ A;  4KYW A;  4A6D A;  2H94 A;  2VT3 A;  2UZK A;  5KK1 A;  5IT9 Z;  1I5Z A;  4MNU A;  1YLF A;  4G7H F;  1BC8 C;  4YFX F;  2FNA A;  1VTN C;  2BV6 A;  5FLX K;  5EEH A;  1WWX A;  4ESF A;  1UHW A;  3LA3 A;  2R3S A;  2GA2 A;  2DQR A;  3K1M A;  2PI0 A;  1Z6R A;  4OIO F;  2IA2 A;  2VOO A;  3KZZ A;  1JE8 A;  3F8F A;  1O7L A;  3F8N A;  3LQQ A;  1BI1 A;  5AON A;  3H92 A;  4M6Y A;  3KLN A;  3WGG A;  2HR3 A;  5LHH A;  1IN6 A;  2IP2 A;  1UHM A;  2VN2 A;  2M8E A;  2DK5 A;  3KLO A;  1IW7 F;  2A6E F;  2VE8 A;  1ULY A;  3I59 B;  2J5P A;  3BOQ A;  2CG4 A;  3JSP A;  3HHH A;  2EV0 A;  2NAZ A;  4HDU A;  2DU9 A;  3FMS A;  3BRO A;  1P4A A;  2PFB A;  3BJO A;  1KQ8 A;  5L3C A;  4M9S A;  5K5R A;  4A6E A;  1I1G A;  2HS5 A;  4UUV A;  5IT3 A;  3WOD F;  4BHB A;  4ASN A;  2CSO A;  4UVA A;  4A12 A;  2XKO A;  3J80 Z;  4BYY A;  5HS9 A;  3F6V A;  3WTT C;  5HDK A;  4P9U A;  3Q5F A;  4N0B A;  2V1U A;  1SD6 A;  1BIA A;  3JW4 A;  4A0X A;  5LRS A;  4WF2 A;  1O3S A;  1HSJ A;  3SXY A;  3GYH X;  4QWQ A;  2PQ8 A;  2DO7 A;  3DFG A;  3RDI A;  3WTX C;  4HV6 A;  4HZF A;  2FF4 A;  3TGN A;  1H9T A;  2O0Y A;  1OYW A;  5FLX Z;  4HV5 A;  2ZFW A;  4P96 A;  3CO7 C;  3RPU A;  3DPT A;  4LMY A;  4OOI A;  1T2K A;  3DP7 A;  2UWM A;  4L0Z B;  1MGT A;  3OV8 A;  1R5H A;  1F4K A;  2Y75 A;  4KT5 C;  1SD7 A;  3BZ6 A;  3G73 A;  3V7C A;  2Z33 A;  4NHJ A;  1U5T B;  2ACJ A;  2L3D A;  2O3F A;  1ZLJ A;  4LJZ F;  4KDP A;  5D8K B;  3F23 A;  1MJA A;  3ML6 A;  3QU6 A;  2VBZ A;  4YII A;  1UST A;  2QBY A;  2V79 A;  3C7J A;  3NQO A;  1K78 A;  1FP2 A;  4Q47 A;  4CZZ A;  2QQA A;  3ZP5 A;  3CLO A;  4NB5 A;  5CVI A;  4N9I A;  3E3V A;  1FNN A;  4RB0 A;  2JT1 A;  4KIB A;  1Z1D A;  2A6H F;  4JBA A;  4EJU A;  4I02 A;  2P8T A;  2GQQ A;  2DLL A;  2DW4 A;  4Q5S F;  5BQT A;  3F6O A;  2VE9 A;  1XN7 A;  2ISY A;  4AWX B;  4E70 A;  4XSZ F;  4L5J A;  3WGI A;  3RPQ A;  4G9Y A;  3J7A O;  1G6N A;  3LWF A;  5H20 A;  2BGC A;  4M74 A;  4MEX F;  4EV0 A;  2XVC A;  2CW0 F;  4AIJ A;  2KIM A;  4YIF A;  4UHT A;  2DTR A;  4IRI A;  2FE3 A;  5ICC A;  1ZG5 A;  2EA4 A;  1TQM A;  1KGS A;  3ABT A;  2DPU A;  3CTA A;  4IPA A;  2ELH A;  3CDH A;  4L18 B;  3QPT A;  1XCV A;  3FM5 A;  1XCB A;  5FGM A;  1HW5 A;  2QM3 A;  4EJV A;  3BWG A;  1YFH A;  3KZY A;  5HDN A;  2P6S A;  2MC3 A;  4BH9 A;  1WKM A;  4UVC A;  5DCM B;  4EGY A;  2WC2 A;  4IRH A;  3RKX A;  3E5Q A;  2KKO A;  2MLG A;  2IVM A;  1ZLK A;  3I71 A;  3MWM A;  5DV5 A;  5K1Y A;  3IKV A;  1XGS A;  4KN7 X;  2UXN A;  1HW1 A;  3GFJ A;  4AIH A;  4KIF A;  1QBJ A;  4U88 A;  4EJW A;  4JQF A;  1T6S A;  2VC1 A;  2P5V A;  1GXP A;  5ICG A;  3SZP A;  2O61 A;  5HS7 A;  5H6R A;  1P4W A;  1Z9C A;  1F5T A;  2ZNZ A;  1B9M A;  3B02 A;  4LGW A;  2HDC A;  1IF1 A;  1T38 A;  2EFN A;  5HLG A;  5DD8 A;  2KJC A;  5BPD A;  1FBS A;  3O6B B;  3WE3 A;  2STT A;  4HA8 A;  1MDM B;  2KIU A;  2VOD A;  1YG2 A;  4P5O A;  4G7O F;  5ED4 A;  2ZCW A;  1DUX C;  3ZMD A;  2WTE A;  1ZRE A;  1XMK A;  2GZW A;  4S05 A;  4OIN F;  2XHK A;  2P5L C;  1B1B A;  5D4R A;  3I0T A;  5J8C A;  1LQ1 A;  1R1T A;  5DYM A;  1WQ2 A;  2CGP A;  2LNB A;  2HZT A;  3E6C C;  3LA7 A;  2HEO A;  4HF0 A;  2OZ6 A;  4O5V A;  1J9I A;  2XIG A;  1ZRC A;  4OMY A;  1TTY A;  1QO0 D;  5BPI A;  4HW0 A;  5JHU A;  1LVA A;  5DEQ A;  1YYV A;  4LFU A;  1HXD A;  3I64 A;  4BAY A;  3KP4 A;  1V4R A;  2PN6 A;  1YW7 A;  2BE5 F;  2FMY A;  4XBF A;  3L9F A;  3HRT A;  3ISP A;  4RGR A;  4KIG A;  2P4W A;  4ZYG A;  1RNL A;  1LEB A;  5D5V B;  3FXQ A;  2D1V A;  4EGZ A;  1K6O A;  3GUD A;  3KP2 A;  1UFM A;  5J8F A;  4GO1 A;  4NQW A;  2OA4 A;  4A0Y A;  1FSE A;  3ECH A;  2W57 A;  5AIP A;  2R7F A;  2M30 A;  2OAZ A;  1KU9 A;  1U5T A;  4I2O A;  1T0F A;  3ZN0 A;  4IHT A;  2Y0M A;  3BJ6 A;  1TBX A;  2ZXJ A;  2W24 A;  3R0A A;  2QVO A;  3LAP A;  2NNN A;  1KA8 A;  2L4A A;  2FBK A;  3JAM K;  3P9K A;  5CJ9 A;  4P9F A;  3EQL F;  1ZRF A;  4WWC A;  2ZKZ A;  3ROU A;  3N97 A;  2FML A;  5E1W A;  3KCC A;  1GXQ A;  3RYR A;  3S2W A;  5L3E A;  4FX4 A;  2TDX A;  2QUF A;  3GFI A;  4P55 A;  2P7C B;  1W7P B;  1AWC A;  3MFK A;  1QNT A;  2V1X A;  1RUO A;  1S7A A;  1O3Q A;  3DPL C;  1MKM A;  1MD0 A;  4ZH4 F;  1ZAO A;  3P9I A;  2HGC A;  3U9G A;  2D1H A;  2E1C A;  1LB2 A;  2CYY A;  1V3F A;  4MHG A;  2V9V A;  1BIB A;  5F1R A;  3SHF A;  1B6A A;  1E2X A;  3V7S A;  1G3T A;  3HSE A;  2EV5 A;  1HQC A;  2H6C A;  2P6T A;  3IWZ A;  2ZO4 A;  1E17 A;  1IRF A;  5E8I A;  2PEX A;  4G6D A;  2FOK A;  2DAO A;  3V7R A;  1IZ1 A;  2EFO A;  1LDK B;  5ICF A;  2EFP A;  2JZY A;  1FWZ A;  4AVP A;  3B73 A;  4HX4 A;  1B59 A;  4O3M A;  2BBY A;  2FU4 A;  1HKQ A;  1IN7 A;  1RZ4 A;  4ZZL A;  2IW5 A;  3PQK A;  1R5G A;  5DCM A;  4KA4 A;  5DUI A;  5FB2 A;  1TQI A;  3ZMS A;  2YU3 A;  3ZMV A;  3R61 A;  3GFM A;  3WU1 B;  4MQV A;  2EK5 A;  4U0V A;  3DXJ F;  2YX4 A;  2VOP A;  5CVR A;  1ZAR A;  4I7H A;  3JAM Z;  4LG0 B;  3OOP A;  1TW3 A;  1XDS A;  1ZGA A;  2XRO A;  1I1S A;  2KIF A;  2IT0 A;  1J5Y A;  2FEZ A;  2QQ9 A;  2GXB A;  5D8L B;  5D5U B;  5FO5 A;  3KP5 A;  4GXO A;  4HOB A;  1YS6 A;  1FPQ A;  3P9C A;  2EWN A;  1W4M A;  1PUE E;  2Z9O A;  2XAG A;  4HQE A;  4LB6 B;  4BQA A;  3K0L A;  4UVB A;  3K1P A;  5L3D A;  1L0O C;  4U0W A;  1W7P D;  1R1V A;  3WTZ A;  2ETH A;  1XSD A;  4ON0 A;  2PJP A;  3GEZ A;  2OZU A;  4G94 A;  3BPX A;  3L7W A;  4UV9 A;  2K7L A;  2PMH A;  4UV8 A;  2HYG D;  1BI0 A;  3FM3 A;  1YS7 A;  5ICE A;  2MH9 A;  4LLL A;  3PFI A;  1BJA A;  4KN4 X;  1G4D A;  3MEX A;  3BP8 A;  4GYI A;  1P92 A;  4IXA A;  3TO9 A;  1D5V A;  1TW2 A;  2COM A;  4S04 A;  3C18 A;  3JTG A;  4HDV A;  4M71 A;  3GVA A;  3V4G A;  2MD5 A;  3F8C A;  4UXN A;  1FSH A;  1TNS A;  1G3W A;  1RUN A;  3WTV C;  4F7Z A;  2IA1 A;  1U8R A;  3HOT A;  1P6R A;  4ENN A;  3WE2 A;  4L9T A;  4EM1 A;  3GX4 X;  1S3J A;  1EH8 A;  2DFI A;  1PP8 F;  4HLX A;  4Y17 A;  2KRF A;  2R7D A;  4RS8 A;  1BI2 A;  1JHF A;  4ZYH A;  3GFL A;  3K9T A;  4ESB A;  3F3X A;  2IA0 A;  1XGO A;  1USS A;  3EYI A;  4I0B A;  1IRG A;  5BMZ A;  5E20 A;  1PDN C;  5EEG A;  2V1D A;  1ZN2 A;  5DCF A;  5BS6 A;  1C0W A;  5JFR A;  4A0Z A;  2ESN A;  1FLI A;  2O03 A;  1JXS A;  1Y0U A;  4XSX F;  4FX0 A;  2K02 A;  5J6X A;  3BDD A;  4WCG A;  1FYK A;  2RC4 A;  4PGG A;  1IN5 A;  1Z05 A;  4U7B A;  3D5L A;  4L5I A;  4L9J A;  1PP7 U;  3SFZ A;  2FBI A;  3ZMT A;  1I6X A;  2CWE A;  2RVC A;  3DEU A;  3N4M A;  1OYY A;  4A5M A;  4R8H A;  5A2Q K;  3C1D A;  3R4K A;  1B9N A;  1OPC A;  3W6K B;  1OR7 A;  1GVJ A;  3EYY A;  3WTS C;  3CUQ B;  4CIC A;  3QP6 A;  4O6J A;  1YTY A;  2FSW A;  2RQP A;  2VXZ A;  5JI6 A;  3QU3 A;  4RGS A;  1D8K A;  3HRS A;  3LFK A;  3T1B A;  3I54 A;  2ZBK A;  4D0P A;  1YQA A;  5HLI A;  2DI3 A;  2GAU A;  5F6F A;  2B0L A;  3HTU A;  2P5K A;  2QLZ A;  4WK8 F;  4XLN F;  2PLY A;  1WRJ A;  3KP7 A;  3EET A;  3TO7 A;  3TDU C;  3KEO A;  3IC7 A;  1U5T C;  3FX3 A;  2XRN A;  2XAS A;  4OIR F;  1FYL A;  3ZN1 A;  4M9Z A;  2Z99 A;  3PQJ A;  4ZZD A;  1HKS A;  2ESH A;  2DQL A;  3RKY A;  5JVT A;  5E1X A;  3KP6 A;  2HYF A;  2L02 A;  2QZ8 A;  3R60 A;  3I59 A;  3HSF A;  4K2E A;  3I5U A;  1O7F A;  4GGG A;  5H6Q A;  4RB2 C;  4L9N A;  1OKR A;  2A3S A;  3LAJ A;  2HOE A;  3JSO A;  4GCV A;  1XGM A;  4EJO A;  2DPD A;  2FQ3 A;  4HF2 A;  3HRU A;  3IRQ A;  4LG0 A;  5CLS A;  2JPC A;  3V8L A;  4R1H A;  1YO5 C;  3MQ0 A;  5A2Q Z;  3M7G A;  4CYD A;  3CO6 C;  1BBY A;  1KQ0 A;  4EM0 B;  2X4H A;  5D5X B;  4L0Y B;  1EH7 A;  1XB4 A;  3NEU A;  5F64 A;  4YFK F;  2MLK A;  3FF5 A;  2A68 F;  1F9N A;  1IXR C;  2VBY A;  5ILS A;  1ODD A;  1KU7 A;  3RTR A;  3LA2 A;  1O57 A;  2GA1 A;  3P7N A;  4PGH A;  2HQR A;  1DDN A;  1BOA A;  3T8R A;  2IRF G;  2M45 A;  3M8E A;  2H27 A;  1G3S A;  3BPV A;  1RIO H;  2L01 A;  4B8X A;  4WXC A;  2PBI A;  4MQ9 F;  3C3W A;  4M72 A;  1IXS B;  2EB7 A;  3CUQ C;  1R7J A;  4KUM A;  3IRR A;  2QEN A;  2QBY B;  3DF8 A;  2JTV A;  2H09 A;  2RGV A;  2W25 A;  1K78 B;  2Q2E A;  2FBH A;  2BYV E;  5LGT A;  4HX7 A;  3Q9V A;  4LK1 F;  3HUG A;  4N9H A;  3GZ5 A;  3R6S A;  3RYP A;  1Z6T A;  2EA2 A;  3U1D A;  2GIV A;  2JPB A;  2F5E A;  2A07 F;  3AAF A;  4M9X A;  4BHC A;  2D45 A;  2E7X A;  1ZRD A;  3RI4 A;  1ONV A;  2CFX A;  3TOB A;  1CF7 B;  2P7V B;  2DT5 A;  3E6M A;  5CYV A;  4OU0 A;  3DKW A;  1XMA A;  1HW2 A;  3U2R A;  4L9V A;  1QGP A;  2O8X A;  4IJA A;  3WTY C;  1KQ9 A;  4RAY A;  2VC0 A;  4LB5 A;  4YG2 F;  1R36 A;  1IAW A;  3VFZ A;  2YSR A;  4WX9 A;  1BI3 A;  1KYW A;  3T5X A;  1IXC A;  2GXG A;  2E7W A;  1SFU A;  1HBX G;  5D4S A;  2BEO A;  2NS0 A;  2ZME B;  4IHS A;  3TKY A;  5HDG A;  4HF1 A;  3ULQ B;  3QP5 A;  4BHP A;  1K7A A;  2LSO A;  1MJB A;  5K5Q A;  4ENK A;  1H9G A;  1H0M A;  4LLN A;  4CDG A;  3HHG A;  2HQN A;  1IN4 A;  1HKT A;  3HIF A;  3TO6 A;  2D2W A;  1LNW A;  1J75 A;  5D5W B;  3L00 A;  5HVQ C;  5L3G A;  1B4A A;  1R23 A;  3J81 K;  3CUQ A;  3REO A;  5BOX A;  1YIO A;  4ETS A;  2G9W A;  1GHC A;  2LDU A;  3GW2 A;  2OBP A;  3MZH A;  4HBL A;  5KVR A;  3O2P E;  1R00 A;  3I4P A;  4IRG A;  3SQN A;  2JRT A;  1FZP B;  3DQV C;  4Y15 A;  3RIR A;  3HRM A;  4EQQ A;  5CVJ A;  2G7H A;  2F5C A;  3M1E A;  3WU0 A;  3COA C;  4LLG F;  3HOS A;  2FNP A;  1DP7 P;  1ZG3 A;  1REP C;  2MH2 A;  3V8K A;  2EFQ A;  1FC3 A;  1Z91 A;  4CXF A;  3KP3 A;  2VBW A;  5CVU A;  2CO5 A;  2L54 A;  1T98 A;  3ZMU A;  2M87 A;  2F2E A;  4BXU A;  6PAX A;  4ZYD A;  2JSC A;  1XSX A;  4LD5 A;  3TDZ C;  1MDM A;  1JGS A;  3F8B A;  3SZT A;  2XAQ A;  3GWZ A;  1STZ A;  3FWE A;  2HTJ A;  2XUB A;  3Q9S A;  3HTS B;  2Q8K A;  1A04 A;  4DQ2 A;  3LST A;  1MZB A;  2EFW A;  4B09 A;  4RB1 A;  3GXO A;  1SFX A;  3K69 A;  4OIP F; 
#chains in the Genus database with same CATH topology
 2DA4 A;  3W6J B;  2HVQ A;  2E1N A;  2XPU A;  2GOX B;  4EEF G;  1IC8 A;  2OTJ I;  3FIW A;  2MBF A;  3S1N J;  2UXX A;  3KYC B;  3H1C A;  2KJB A;  3MMY B;  2PX9 A;  3EUH C;  2OD5 A;  4DZJ A;  1OR7 C;  3H3Z A;  1W5S A;  5E8G A;  5E18 F;  2E2I J;  2G0E A;  4DNC A;  4ABZ A;  3OIQ A;  3KPH A;  3IL2 A;  2Q0O A;  1BM9 A;  3DTE A;  3L09 A;  1EH6 A;  1YJW I;  3L2R A;  1FBU A;  2XF7 A;  2PJR B;  2K4J A;  2RKH A;  3MAJ A;  4P1W A;  5ILV A;  3BY6 A;  3ELK A;  1FY7 A;  1X1B A;  5E3M A;  2XAH A;  5EEA A;  2OU2 A;  1FOY A;  3FZV A;  2NYX A;  3M07 A;  1I27 A;  4FQG A;  2CUZ A;  4MFD A;  4XK4 A;  5LBQ A;  1J09 A;  2X51 A;  5LFA A;  5JLX A;  2VBX A;  2E36 A;  2E2H J;  2OQG A;  1DU6 A;  2ZME C;  4CCM A;  2QQB A;  1GUU A;  1SD5 A;  4XRF A;  3J81 Z;  2XKP A;  1A6Q A;  1Q1H A;  5K7Z A;  2Z3Y A;  1JUP A;  1D0X A;  1YW9 A;  2K40 A;  2W85 A;  3DPU A;  1OYI A;  1AOY A;  1MJ9 A;  2STW A;  4Q48 A;  5LLQ A;  4ENJ A;  4HX8 A;  4HYE A;  2EZK A;  3O3K A;  3K4L A;  4JK1 X;  4A2U A;  5DD4 A;  1K4S A;  3IHU A;  3LSR A;  1ZYR F;  3L2W A;  1KYZ A;  4GDF A;  3I58 A;  3HPG A;  2Q1Z B;  5E3L A;  5FD6 A;  4PJL A;  1YRN B;  1LDD A;  1LUJ B;  5C4J J;  4YFN F;  3ZQQ A;  4RBO A;  3L1P A;  2LTP A;  3IV5 A;  3M9A A;  1N25 A;  3E97 A;  3BJA A;  2HI3 A;  1TNT A;  4H4K C;  2L4M A;  2V6C A;  1TQP A;  3G3Z A;  2RN7 A;  4E4H A;  1LKX A;  4FHT A;  2DBB A;  4I76 A;  2YUS A;  4EVI A;  1LPQ A;  4AUX A;  2R5Y A;  2GWR A;  5CVV A;  3LMM A;  1IJW C;  1VQ9 I;  2XSD C;  4KMF A;  5HLH A;  1ON2 A;  3DTI A;  3GZ6 A;  2R7T A;  3DEW A;  2F5D A;  2Z2S B;  1X19 A;  5M3M J;  1SFO J;  4XKV A;  1JHH A;  4AD9 A;  5GAD J;  2CV0 A;  3PO3 J;  3H5N A;  3VB2 A;  2RNJ A;  3HKZ A;  4G7Z F;  5E17 F;  2M5W A;  3O8G A;  4MEY F;  2XAU A;  2M0M A;  2HZD A;  3RKW A;  2A69 F;  1ZH5 A;  1DPU A;  4MGR A;  4IEJ A;  1ON1 A;  3C2H A;  1R1U A;  2OQR A;  3FMQ A;  2XSJ C;  2PMU A;  4Y13 A;  1OQY A;  3PUB A;  1JT0 A;  3OYF A;  3CUO A;  1XSV A;  2G7U A;  1JKP C;  1FP1 D;  1Z7L A;  2CUJ A;  1D5Y A;  2QSF X;  4HAM A;  1LDJ A;  5H2F C;  4XRM A;  2GLO A;  4BNC A;  5FKN A;  5JHF A;  2B7E A;  5EZG A;  1BA5 A;  1HA8 A;  1TWC J;  1EA3 A;  1SD4 A;  2DK8 A;  3A02 A;  4PUS A;  4DJA A;  3AFH A;  1P7I A;  1CF7 A;  2YX7 A;  4UY8 I;  4FE4 A;  3K4N A;  3S8P A;  2YR2 A;  1YHQ I;  5AIQ A;  4C2M J;  3SFI A;  1W5T A;  2QWW A;  2WV1 A;  3T8T A;  3QWL A;  2L0K A;  1J2X A;  5LEJ A;  3WTU C;  4Y4R A;  4M73 A;  2WAF A;  2M1B A;  2WV0 A;  1FT9 A;  2LBF B;  2K4B A;  3QRF F;  2W82 A;  3IKT A;  3KYL A;  3G71 I;  4R79 A;  1MBG A;  2KIQ A;  3BTL A;  1QA6 A;  4CHU A;  2L7Z A;  3KE2 A;  3VYT B;  5FRM A;  2EJR A;  1J59 A;  3F0C A;  4C3I J;  2X0L A;  3TOA A;  1K79 A;  3EUH A;  3FMR A;  1S72 I;  1FMV A;  3IP4 B;  4EJT A;  3FBI B;  2NVU B;  4EMS A;  4KMU X;  1RR8 C;  2IGN A;  1W7P A;  3FXK A;  1WVR A;  5TRD A;  1U6G A;  3ZQI A;  1S8N A;  2KIS A;  5LHI A;  2A5Y B;  5C44 J;  1IN8 A;  2VLA A;  2C6Y A;  3IH4 A;  2IGM A;  3LQR A;  5D6F A;  3TP0 A;  1D0Y A;  4BJT A;  4WXH A;  2CV1 A;  4QLC U;  2DMQ A;  3ECO A;  3A01 B;  4BY1 J;  2A6T A;  1F1Z A;  5K5O A;  5FD5 A;  5F1J A;  3ZPL A;  3S2D J;  4DGW B;  2JN6 A;  2XV4 S;  4I0A A;  3MKZ A;  5LRR A;  2ZME A;  2VT2 A;  1X4P A;  5L3F A;  4F93 B;  1GLN A;  5FKL A;  1WI9 A;  2MG4 A;  2AHQ A;  1P2F A;  2M4K A;  2AS5 F;  1J7K A;  2DA2 A;  1WPK A;  3FXR A;  1DGW Y;  1ZHF A;  4IF4 A;  3K6G A;  3VEP A;  3WTW C;  3WG9 A;  1SMY F;  4A3M J;  1FX7 A;  3VSK A;  3FDY A;  4HLY A;  2XDV A;  2QSG X;  4BE2 A;  2RDP A;  2HFH A;  1SMT A;  3K2Z A;  4OMZ A;  2JVG A;  4BL0 B;  4BGD A;  1VQ5 I;  3JTH A;  3QOP A;  3S3M A;  2VON A;  2AO9 A;  3VOD A;  1W0T A;  3NWT A;  3GLX A;  1UZC A;  3F21 A;  3LSK A;  1D8J A;  2Y69 H;  4XID A;  2OPT A;  4KIC A;  4RGX A;  1MNE A;  2GOM A;  1R5I D;  2CUF A;  2AXL A;  4EM2 A;  3KET A;  1SFE A;  2R7Z J;  1QRY A;  2RQQ A;  1S6L A;  1D0Z A;  2A61 A;  1X3U A;  2R5Z B;  4YIR X;  3ZQL A;  3JRG A;  3HM5 A;  1MIJ A;  5TIS C;  5ERI A;  4BJ5 C;  5IP7 J;  2LF7 A;  1T39 A;  1K61 A;  4QTR A;  1VQM I;  5DUK A;  3SEQ A;  4XLP F;  3PNT A;  1BN5 A;  2Y48 A;  4M6X A;  4PSW A;  3SDB A;  3FXU A;  1ZG1 A;  1U78 A;  4IKF A;  1OMI A;  4Y3O A;  5LHG A;  2YPR A;  4XOR A;  1FOK A;  2M9H A;  3DLL F;  3WG7 H;  1CGP A;  4DYR A;  5FRO A;  2UUZ A;  1ETO A;  3DWL E;  4LIV A;  5GPC A;  3ERE D;  4MIM A;  4MTD A;  3OYJ A;  5FFZ A;  3QAH A;  4ENM A;  4PDK A;  5LGU A;  4U7D A;  3MZY A;  4RM2 A;  3WGH A;  5E1Z B;  4RLQ A;  1P9Q C;  3MCZ A;  1P4X A;  2DN0 A;  2EPF A;  1Z7U A;  2NVT J;  2L9N A;  2NRA C;  4I01 A;  3EDP A;  1SFK A;  2XAF A;  2ZXH A;  4HQM A;  1J0R A;  1LFU P;  2W84 A;  4OIQ F;  1O3T A;  1X1C A;  3HBL A;  1V5G A;  4PCQ A;  4BXF A;  2QEX I;  1R4M B;  2LC2 A;  4AID A;  2DOF A;  1X4O A;  3H5A A;  3CQZ J;  2IPQ X;  2LF8 A;  1HST A;  2EIN H;  4BE0 A;  4H0E A;  4G6Q A;  2ISZ A;  2K27 A;  2ADU A;  1IV6 A;  1Z3X A;  5FFX A;  5LEK A;  3GF2 A;  4J19 A;  5KAF C;  5HOO A;  4BEH A;  4KNY A;  4A3E J;  5FKO A;  3K1N A;  3F72 A;  1W36 C;  2FXA A;  2K3F A;  1KU3 A;  3DV8 A;  1Y1W J;  1QPM A;  4G8X A;  3GO5 A;  2F4I A;  3KFW X;  4D1Q A;  2DOD A;  4S0H B;  3OYK A;  2CS3 A;  4RB3 C;  2ICW G;  2HTS A;  1B72 A;  3L2C A;  1A5J A;  2RV8 A;  1OCP A;  3OYA A;  2O6G E;  3Q0V A;  1X1D A;  3PUF A;  1R22 A;  1XDU A;  4BU2 A;  3E5U A;  2EIK H;  2OF7 A;  2HWV A;  3H36 A;  4FT8 A;  3TQN A;  2HKX A;  4PZJ A;  4A3J J;  1SVL A;  3JRB A;  1R58 A;  2K86 A;  3H0D A;  1O3R A;  2W48 A;  5ILU A;  3PO2 J;  2VL8 A;  2ZJ2 A;  4BS9 A;  1T08 B;  4LK0 F;  5IT9 K;  4U0Y A;  1GDT A;  3I53 A;  1QZY A;  2QYO A;  3HSR A;  1MW7 A;  4AIK A;  4RAZ A;  3BTI A;  3CJT B;  3RKQ A;  1UB9 A;  3OYM A;  3OYI A;  5LGN A;  1BC7 C;  2PJR A;  1UMQ A;  2VXD A;  3LOC A;  3RJP A;  4E7H A;  4RAG A;  2HVR A;  4IHX A;  1QZZ A;  3FHZ A;  3V8J A;  2LKP A;  3ZMZ A;  1S29 A;  2JA5 J;  3BG6 A;  1S7O A;  1X1A A;  1XD7 A;  3BQY A;  3VDX A;  2KLO A;  4OAZ A;  3CJN A;  3H3U A;  1U3E M;  2H6B A;  3BCB A;  2Z5U A;  3G1L A;  3PFY A;  2LKS A;  5JR3 A;  2QGU A;  2HKO A;  3A4C A;  4TV7 A;  4UB8 C;  3T0Y A;  4CO8 A;  2LOO A;  2DT7 B;  1LJ9 A;  2NNY A;  1ZGJ A;  3ERM A;  3BG3 A;  4Z2Y A;  2BOL A;  5KCM A;  1MH4 A;  1U2W A;  2BVM A;  2EV6 A;  2F5F A;  4WXD A;  2X6W A;  3NRV A;  1JGG A;  1LEA A;  1QQI A;  2DA1 A;  2CQK A;  3M8F A;  3HYI A;  3IWF A;  4M3G A;  1JKR C;  3ABU A;  5IY5 H;  1RES A;  2IS6 A;  4I98 B;  4UNO A;  1DPR A;  1RR7 A;  1MMS A;  2J5O A;  1TLH B;  3KEQ A;  3D0S A;  4BQO A;  3ZQ7 A;  2IJL A;  3NWS A;  5GP9 A;  1VQ8 I;  2MSY A;  3R0J A;  2NOJ B;  3E6D A;  2WWY A;  2Y30 A;  3VYU B;  2Y9Y A;  3OIP A;  1QPI A;  4MO7 A;  2ZNY A;  4IHV A;  3NAU A;  2IS1 A;  2VQL A;  3SEZ A;  4A5N A;  3WU2 C;  5IOY A;  1SAX A;  2H1L A;  3LFU A;  1G3Y A;  1NHA A;  2WB1 A;  1KU2 A;  2MA3 A;  1BR2 A;  4Q4Z F;  2FUG 2;  4GYG A;  3MVP A;  1PYV A;  3QYF A;  1I39 A;  3VOE A;  1RI7 A;  4DYC A;  1L3L A;  3M4O J;  4XKC A;  2LH9 A;  1FYM A;  2COB A;  5C4X J;  3L2U A;  4NNJ A;  4D7M A;  3GTP J;  2XAJ A;  2Y2Z A;  3QQA A;  5FJ8 J;  4RGU A;  2E71 A;  2M8G X;  3DBL B;  3QPH A;  3TBI A;  2PMZ A;  2FRH A;  1XGN A;  2KMU A;  2LY2 A;  2E5Z A;  1WSU A;  5TGT A;  2BY0 A;  1MBJ A;  2X85 A;  4CGZ A;  4PSX A;  3E6B A;  4ZYE A;  1EV7 A;  3V42 A;  2PG4 A;  3E5X A;  3C2B A;  5L3B A;  2VJJ A;  4IVN A;  5HS8 A;  3JRE A;  1YJN I;  4KFC A;  2HXO A;  3F22 A;  3F8M A;  1UCR A;  1FBQ A;  3RPU D;  3J80 K;  2FA5 A;  4CH7 A;  2MD0 A;  2ME0 A;  4MTE A;  4FE7 A;  4DBQ A;  5TJJ A;  2XGX A;  2KDO A;  1XS9 A;  3CCE I;  2RNG A;  3ZXS A;  5DDG A;  1D3Y A;  4I09 A;  1IUY A;  5D6E A;  1JJ6 C;  3K4B A;  2E1M B;  1OJL A;  3CCY A;  1YW8 A;  2V9P A;  1F36 A;  5EZH A;  2R7R A;  4XKB A;  4ESJ A;  4KYW A;  3VPR A;  5EG0 A;  5CQE A;  5IYC J;  4A6D A;  3ASO H;  2H94 A;  2VT3 A;  1QHH D;  2UZK A;  2FD5 A;  4KIS A;  5KK1 A;  2XPW A;  5IT9 Z;  5IP6 A;  1I5Z A;  5FLV A;  4MNU A;  1JT6 A;  1TZL A;  1YLF A;  4E7L A;  2XC7 A;  4G7H F;  3FK6 A;  5EDN A;  3PL8 A;  2M4G A;  1BC8 C;  3LSI A;  3A0H C;  3ASN H;  4XLE A;  4CYC B;  1OIS A;  1QZE A;  1AKH B;  2JRM A;  4YFX F;  2FNA A;  5B66 C;  1VTN C;  1VF9 A;  2BV6 A;  5FLX K;  2K9S A;  2BY1 A;  5EF6 A;  3OYE A;  4BAC A;  5EEH A;  1WWX A;  4ESF A;  1UHW A;  3BLY A;  3LA3 A;  2R3S A;  3HPH A;  2GA2 A;  1ZQ3 P;  1TT5 B;  2HDD A;  3CF5 F;  2DQR A;  2X6X A;  3K1M A;  2PI0 A;  1Z6R A;  2CU7 A;  5F08 A;  4OIO F;  2IA2 A;  2XB5 A;  2KZV A;  2VOO A;  3KZZ A;  3ZGK A;  1N77 A;  1JE8 A;  3F8F A;  1O7L A;  3F8N A;  4YEJ A;  3A01 A;  3RZD J;  3CC7 I;  4HG2 A;  3LQQ A;  1BI1 A;  5AON A;  1OCZ H;  3H92 A;  4M6Y A;  3KLN A;  3WGG A;  2HR3 A;  4FAS D;  5LHH A;  1XPX A;  4XOT A;  1IN6 A;  2IP2 A;  1UHM A;  3DBH B;  2VN2 A;  1A35 A;  1MBK A;  1IV8 A;  3HOY J;  2M8E A;  1VQP I;  2DK5 A;  3OR2 C;  4A69 C;  3OY9 A;  3KLO A;  1IRX A;  3TP3 A;  3OYN A;  1FOW A;  1IW7 F;  2A6E F;  2LFB A;  2W7N A;  2VE8 A;  1ULY A;  3I59 B;  1S9H A;  2J5P A;  4IQ4 A;  4XKW A;  2BHZ A;  3BOQ A;  2CG4 A;  1O4X A;  1V5E A;  3JSP A;  2ID6 A;  4C3H J;  3HHH A;  4B47 A;  2EV0 A;  1POG A;  2X6O A;  1CQT A;  2NAZ A;  3PIP F;  2DU9 A;  1K6Y A;  4HDU A;  3MD2 A;  3FMS A;  3BRO A;  3FXJ A;  1P4A A;  1XX5 A;  2PFB A;  1NTC A;  2ME6 A;  3BJO A;  1KQ8 A;  4UB6 C;  5L3C A;  4M9S A;  5K5R A;  2CJJ A;  2R5Z A;  1XC5 A;  4A6E A;  3UKG A;  2DT6 A;  1I1G A;  2O5R A;  3FK7 A;  2RAE A;  2BW3 B;  3CMY A;  1K4T A;  2VAS A;  1WH7 A;  3DCF A;  2HS5 A;  4UUV A;  2R92 J;  1MBF A;  5B1A H;  2ZFU A;  2VB6 A;  5IT3 A;  3WOD F;  2XGE A;  4BHB A;  4ASN A;  3RQI A;  1XG1 A;  2CSO A;  4UVA A;  4A12 A;  2XKO A;  2DMN A;  2ZXI A;  4C9Y A;  3MZ8 A;  4ZC3 A;  3JRC A;  3W2A A;  4A3C J;  3J80 Z;  4BYY A;  5HS9 A;  5JVG F;  3F6V A;  1DQU A;  2V9K A;  3A03 A;  4E7S A;  1FMW A;  1TL8 A;  1KON A;  1IGN A;  2LMD A;  4D5C A;  3WTT C;  5HDK A;  3K10 A;  4P9U A;  3Q5F A;  2GXA A;  2VUM J;  3CP8 A;  4N0B A;  3LSG A;  2V1U A;  1SD6 A;  4N4N B;  1BIA A;  1G2H A;  3JW4 A;  1N75 A;  4A0X A;  5LRS A;  5E3O A;  2ZC2 A;  1YOV B;  5HOD A;  4WF2 A;  1O3S A;  1H89 C;  1HSJ A;  3SXY A;  5GAH J;  3GYH X;  4QWQ A;  2PQ8 A;  3CD6 I;  2DO7 A;  3DFG A;  3RDI A;  2TCT A;  3WTX C;  4HV6 A;  4HZF A;  2FF4 A;  3RZO J;  5F27 A;  3TGN A;  1H9T A;  2O0Y A;  4A3G J;  3OYD A;  5HLT A;  2MGQ A;  1RC9 A;  3SZG A;  2XF6 A;  1OYW A;  5FLX Z;  3FXO A;  4HV5 A;  4LIT A;  1DP3 A;  2ZFW A;  3G4S I;  4P96 A;  2BXY A;  1YX3 A;  3CO7 C;  3RPU A;  3DPT A;  3FHN A;  1H8A C;  4LMY A;  4OOI A;  1T2K A;  3DP7 A;  4F55 A;  5FLM J;  4AU7 A;  2DA6 A;  2MW8 A;  2UWM A;  3PNY A;  5M5W J;  3NAR A;  4L0Z B;  1VQ7 I;  4NQW B;  2R7U A;  1MGT A;  3OV8 A;  1R5H A;  1F4K A;  2Y75 A;  3HUG B;  4KT5 C;  1SD7 A;  2JMW A;  4PJN A;  2DCE A;  4YRV A;  3BZ6 A;  4UUS B;  2QQ8 A;  3G73 A;  3V7C A;  2Z33 A;  2LP0 A;  1Y56 A;  1GT0 C;  1UEL B;  2ZSI B;  1GV2 A;  4NHJ A;  1U5T B;  4M6V A;  2L3D A;  3QOD A;  2ACJ A;  2O3F A;  1ZLJ A;  2E60 A;  1WCM J;  4LJZ F;  4KDP A;  5D8K B;  3F23 A;  1MJA A;  1XTA A;  3ML6 A;  2Z16 A;  3QU6 A;  2NVY J;  3D5S C;  2VBZ A;  2VPR A;  4QIW N;  4YII A;  2CUE A;  1UST A;  4BE1 A;  2QBY A;  3G6E I;  2V79 A;  3P5J A;  3C7J A;  1JUM A;  3NQO A;  5B1B H;  3K4M A;  5KAI C;  1K78 A;  2L7M P;  4GRI A;  1FP2 A;  2K5C A;  4Q47 A;  4E7I A;  1NH3 A;  4CZZ A;  2R7S A;  2QQA A;  3ZP5 A;  2EZH A;  3CLO A;  4NB5 A;  5CVI A;  1BR1 A;  4N9I A;  4Y52 J;  3E3V A;  3CCS I;  1FNN A;  4RB0 A;  3AL0 B;  2JT1 A;  4KIB A;  1S7E A;  1VQN I;  2EBI A;  1Z1D A;  2A6H F;  2M3A A;  4F92 B;  4JBA A;  4EJU A;  1WJF A;  4I02 A;  2VQG A;  1RKT A;  2DYR H;  3OSG A;  3VSL A;  2P8T A;  1G8X A;  2XPV A;  2I8D A;  3CDL A;  4IOA F;  2BXZ A;  2GQQ A;  3BCA A;  4MLO A;  5FKK A;  2DLL A;  1OCC H;  2DW4 A;  4Q5S F;  4CSW A;  4XLF A;  2IXS A;  4PJJ A;  5BQT A;  3F6O A;  2XGD A;  2VE9 A;  1XN7 A;  2ISY A;  4AWX B;  4E70 A;  2F6C A;  3CCL I;  4XSZ F;  3W3C A;  4L5J A;  1E0E A;  3WGI A;  2X48 A;  3HZJ A;  3RPQ A;  1MSF C;  4G9Y A;  3JRA A;  2P81 A;  3J7A O;  1WGX A;  1D1A A;  3GZN B;  2IBD A;  2WAQ N;  3CP2 A;  4II2 A;  1G6N A;  3LWF A;  5H20 A;  2BGC A;  2HNH A;  1ZR4 A;  1WI3 A;  1V5F A;  3K70 D;  4M74 A;  1R9T J;  1TWA J;  4MEX F;  5EYR A;  4EV0 A;  3CCV I;  2JVH A;  2VJ4 A;  2DFF A;  2XVC A;  2CW0 F;  1JKQ C;  4AIJ A;  1TWF J;  2KIM A;  4YIF A;  3HOW J;  4UHT A;  2DTR A;  1JTX A;  4IRI A;  2FE3 A;  5ICC A;  1ZG5 A;  2EA4 A;  4N4O B;  2CH0 A;  1D1B A;  1TQM A;  4XLH A;  1KGS A;  3ABT A;  2DPU A;  2V6E A;  3I3L A;  3W2V A;  3CTA A;  3WHB A;  4IZZ A;  2Y31 A;  4IPA A;  2ELH A;  3CDH A;  3K70 C;  4L18 B;  4E7Z A;  3QPT A;  3GTG J;  4XMY A;  1XCV A;  4C2T A;  3FM5 A;  4AYB N;  1XCB A;  5M3F J;  4QSH A;  5FGM A;  3I4N J;  1HW5 A;  2QM3 A;  4EJV A;  3BWG A;  2QSH X;  4HRI A;  1YFH A;  3KZY A;  5F0C A;  5HDN A;  2R7V A;  2P6S A;  2MC3 A;  2O9L A;  3VYR B;  4FTH A;  3KYD B;  2DMU A;  4BH9 A;  1WKM A;  3ABK H;  4UVC A;  4ANJ A;  5DCM B;  2HU9 A;  4EGY A;  2WC2 A;  4IRH A;  3RKX A;  3E5Q A;  1MBE A;  2KZG A;  4CYC A;  1X1P A;  2KKO A;  2MLG A;  3HL2 A;  2IVM A;  1ZLK A;  3I71 A;  3MWM A;  2NVX J;  5DV5 A;  5K1Y A;  2Z1D A;  2DJN A;  5DM7 F;  1AA7 A;  3IKV A;  4HPQ A;  1XGS A;  3CMM A;  3PNV A;  4KN7 X;  3M3Y J;  2UXN A;  1HW1 A;  3GFJ A;  3W2W A;  4AIH A;  4KIF A;  1QBJ A;  3OYB A;  4JX5 A;  4DW6 A;  2HPI A;  4JQF A;  1T6S A;  2OCE A;  1YE9 A;  4U88 A;  2VC1 A;  4EJW A;  2R7W A;  2P5V A;  1GXP A;  2DJI A;  3L2V A;  5ICG A;  3SZP A;  2H8R A;  3CC2 I;  3IAM 2;  2MC4 A;  3AKZ A;  2V4J C;  4IX7 A;  2O61 A;  4YEL A;  5HS7 A;  5H6R A;  4PK4 A;  2HVS A;  1P4W A;  3Q0U A;  1Z9C A;  4PFO A;  2HOA A;  1F5T A;  2ZNZ A;  2TRT A;  1B9M A;  3B02 A;  4LGW A;  2HDC A;  1IF1 A;  2M7A A;  1T38 A;  2EFN A;  5HLG A;  5DD8 A;  2KJC A;  2OC6 A;  3IUO A;  5BPD A;  1HLV A;  1FTZ A;  1FBS A;  3O6B B;  5GAG J;  3WE3 A;  2STT A;  3BR5 A;  2WY7 Q;  2K3P A;  4HA8 A;  1MDM B;  2KIU A;  2VOD A;  1ETX A;  1YG2 A;  2IAI A;  5EGO B;  4P5O A;  4A93 J;  4G7O F;  1VI0 A;  3N05 A;  3HG9 A;  1VFC A;  5ED4 A;  2ZCW A;  4A3I J;  2WAE A;  1DUX C;  1LFP A;  2CFO A;  3ZMD A;  1WHU A;  2WTE A;  3AL0 C;  1ZRE A;  4IQJ A;  1XMK A;  2GZW A;  4S05 A;  4OIN F;  4XIC A;  3H3V K;  2XHK A;  3FKJ A;  2P5L C;  1B1B A;  3I0T A;  5J8C A;  5D4R A;  1A6I A;  4XQF A;  3FKI J;  1R1T A;  1LQ1 A;  3QPS A;  4KT6 A;  1WQ2 A;  5DYM A;  2CGP A;  2LNB A;  1R4N B;  2HZT A;  3E6C C;  3BZK A;  2BW3 A;  1WJE A;  3LA7 A;  2HEO A;  1DU0 A;  4HF0 A;  2OZ6 A;  4ZTJ A;  2BY3 A;  4O5V A;  1J9I A;  3E1S A;  2XIG A;  2QCO A;  1ZRC A;  5F04 A;  1MBH A;  4F91 B;  3K7A J;  4OMY A;  1TTY A;  3X2Q H;  1QO0 D;  2ECC A;  5BPI A;  2HOT A;  4HW0 A;  1QVU A;  5JHU A;  1KZH A;  1LVA A;  2XB0 X;  5DEQ A;  2YU9 J;  1YYV A;  3BZC A;  2GM4 A;  1HOM A;  4CCJ A;  4LFU A;  1ZKG A;  1HF0 A;  1Z3Y A;  1HXD A;  3I64 A;  3AG4 H;  4D7N A;  2CW7 A;  4X6A J;  4BAY A;  5J3L A;  3CF2 A;  1V4R A;  1Z67 A;  3KP4 A;  4AM3 A;  3TMO A;  2PN6 A;  4NC7 A;  2HOS A;  4A3L J;  4A3K J;  1A31 A;  1TWH J;  1YW7 A;  1I6H J;  2L7F P;  3OIO A;  2M2E A;  3JRI A;  2OV7 A;  2BE5 F;  4F3Q A;  4HNT A;  2I5U A;  2FMY A;  4XBF A;  2VPL A;  3L9F A;  2IS2 A;  3HRT A;  1F43 A;  2JWT A;  3ISP A;  3DEE A;  3WHC A;  4RGR A;  4BBS J;  4C3J J;  4KIG A;  2P4W A;  4ZYG A;  1Y39 A;  1RNL A;  1LEB A;  5D5V B;  4X0G A;  2R5Y B;  4XLC A;  3FXQ A;  1RKW A;  2D1V A;  4EGZ A;  4II3 A;  3D1N I;  4B3A A;  1K6O A;  2EZL A;  1WH5 A;  3GUD A;  3B6C A;  3KP2 A;  1UFM A;  5J8F A;  4GO1 A;  2E19 A;  4NQW A;  2OA4 A;  3FXL A;  4A0Y A;  3ZQG A;  1FSE A;  1EJ9 A;  3ECH A;  2W57 A;  1VZ0 A;  3A0B C;  5AIP A;  1YRN A;  2K9L A;  3DU5 A;  4BY7 J;  3ZQH A;  4UUS A;  2R7F A;  2QF7 A;  2M30 A;  2Y0S N;  2OAZ A;  3LSH A;  4HSR A;  3B6A A;  1KU9 A;  2DFE A;  3CCU I;  1OCT C;  1U5T A;  2F4M B;  4I2O A;  1T0F A;  3ZN0 A;  4IHT A;  2MFZ A;  3BR1 A;  1B8I B;  1ETW A;  4FCY A;  2Y0M A;  1ERD A;  3BJ6 A;  1TBX A;  2ZXJ A;  2L9V A;  2W24 A;  3R0A A;  2EIM H;  2QVO A;  2L2O A;  3E7L A;  3LAP A;  2NNN A;  4AC0 A;  1ZR2 A;  1KA8 A;  5E3N A;  2L4A A;  1LE8 B;  2FBK A;  4ZYA A;  2VQC A;  3JAM K;  3P9K A;  2MYS A;  5CJ9 A;  4P9F A;  3GTM J;  3EQL F;  3QOE A;  4XM3 A;  2KDZ A;  1ZRF A;  2K9N A;  3GLL A;  2L9R A;  4WWC A;  2FJ1 A;  2R93 J;  2ZKZ A;  1LVK A;  3OS2 A;  3ROU A;  1TC3 C;  3N97 A;  4I99 C;  2FML A;  5E1W A;  1X3W B;  3TL4 X;  1QVT A;  2VJ5 A;  2W00 A;  3HGY A;  3KCC A;  1GXQ A;  3RYR A;  1PUF B;  3S2W A;  5L3E A;  4J01 A;  4FX4 A;  1JTY A;  2TDX A;  2QUF A;  2KPM A;  3GFI A;  4P55 A;  3HDD A;  3I9V 2;  2P7C B;  1W7P B;  4XRS A;  1AWC A;  4E7K A;  3MFK A;  1WJ5 A;  1QNT A;  2V1X A;  3BG9 A;  1RUO A;  1S7A A;  1O3Q A;  2UV1 A;  3DPL C;  5DS9 A;  1MKM A;  3JCU C;  3UR3 C;  3LSM A;  3S93 A;  3HXL A;  2M0C A;  1MD0 A;  1I3Q J;  2A05 A;  2LBF A;  4ZH4 F;  1ZAO A;  4BKX A;  3P9I A;  2HGC A;  3U9G A;  2D1H A;  4ZTF A;  2E1C A;  1LB2 A;  4A3F J;  2CYY A;  4FET A;  1Y0N A;  1V3F A;  4RAF A;  3KEY A;  4MHG A;  1RRJ A;  1BJZ A;  2R7X A;  2V9V A;  1BIB A;  4ITV A;  5F1R A;  3SHF A;  3S3O A;  1B6A A;  4XN0 A;  2JUG A;  1E2X A;  3V7S A;  4OAY A;  1G3T A;  3HSE A;  2EV5 A;  2ZXW H;  1HQC A;  2RRE A;  1SVM A;  2H6C A;  2P6T A;  5B5E C;  3IWZ A;  2ZO4 A;  4DYQ A;  1HDD C;  1IRF A;  1E17 A;  5E8I A;  1WJC A;  3FIS A;  2PEX A;  3AG2 H;  2LY1 A;  3JRD A;  3L2Q A;  4G6D A;  2FOK A;  2KFD A;  2DAO A;  3V7R A;  1ETV A;  1IZ1 A;  4RLF A;  2EFO A;  1IG7 A;  2HDW A;  4RA2 A;  2DA7 A;  3SDG A;  1LDK B;  5ICF A;  2EFP A;  2JZY A;  2LK2 A;  4OIP F;  1SVO A;  3HKZ N;  1FWZ A;  4AVP A;  1VQO I;  3B73 A;  3KZI C;  4HX4 A;  1B59 A;  2WBM A;  1NK3 P;  2BBY A;  4O3M A;  2FU4 A;  1HKQ A;  1R6R A;  4KJZ A;  1IN7 A;  1RZ4 A;  2BY2 A;  2B63 J;  4ZZL A;  2JSP A;  3Q0W A;  2IW5 A;  3PQK A;  1R5G A;  3QYE A;  1PVE A;  5DCM A;  3BC8 A;  4KA4 A;  1AU7 A;  3TED A;  1ZTR A;  4FIS A;  5DUI A;  2X1D A;  4F52 A;  1U9O A;  5FB2 A;  2JK3 A;  1WJA A;  4X1E A;  3S1Q J;  1TQI A;  3ZMS A;  2YU3 A;  3ZMV A;  3R61 A;  1LFB A;  3GFM A;  3WU1 B;  4MQV A;  3ABL H;  2HQA A;  2EK5 A;  4U0V A;  3DXJ F;  5J4Y A;  2YX4 A;  3K2A A;  2VOP A;  2EH3 A;  2CQX A;  1HCR A;  5CVR A;  1ZAR A;  2DMP A;  4J00 A;  4I7H A;  3JAM Z;  3BG5 A;  4LG0 B;  3OOP A;  1TW3 A;  1XDS A;  1ZGA A;  4DOZ A;  3W6V A;  1FTT A;  4BUP A;  2XRO A;  4JP0 A;  1I1S A;  1YJ9 I;  2KIF A;  2IT0 A;  1J5Y A;  2FEZ A;  2QQ9 A;  2GXB A;  5D8L B;  5D5U B;  5FO5 A;  2O7O A;  3KP5 A;  3AG1 H;  4GXO A;  4HOB A;  1YS6 A;  3ZQF A;  3DKY A;  1FPQ A;  3P9C A;  4M3E A;  2EWN A;  5J1Y A;  3JRH A;  5FRN A;  2AQE A;  1W4M A;  3HOX J;  1PUE E;  2Z9O A;  4BEH B;  4CUG A;  1YIT I;  4BDZ A;  2XAG A;  3EPZ A;  4HQE A;  3G2B A;  2JA2 A;  4LB6 B;  4BQA A;  3K0L A;  4UVB A;  1GV5 A;  3K1P A;  5L3D A;  1L0O C;  1X2N A;  4U0W A;  2X9D A;  4LIU A;  1UG2 A;  1W7P D;  5EGO A;  1R1V A;  1ORK A;  3WTZ A;  4KIT B;  2ETH A;  1XSD A;  4ON0 A;  2PJP A;  3GEZ A;  1VQL I;  2OZU A;  2V7F A;  4G94 A;  2R0Q C;  1P7J A;  3BPX A;  3L7W A;  1H88 C;  2CRG A;  4UV9 A;  2K7L A;  2PMH A;  2MAB A;  4UV8 A;  2HYG D;  1BI0 A;  3BR2 A;  3LSP A;  3FM3 A;  1YS7 A;  2L7K A;  2DXI A;  5ICE A;  2MH9 A;  2E2J J;  4V2G A;  4LLL A;  1TT0 A;  2E1M C;  4BQN A;  3PFI A;  4XLA A;  1BJA A;  4KN4 X;  2EZI A;  1G4D A;  1ACI A;  4D5F A;  1QHG A;  3MEX A;  3BP8 A;  4PJ0 C;  4GYI A;  5K7F A;  1P92 A;  4IXA A;  1BL0 A;  3TO9 A;  4AVZ A;  2OTL I;  2VIX A;  4XOP A;  4C2U A;  4PJM A;  3AG3 H;  3IH3 A;  2Q2E B;  3VYS B;  1D5V A;  1TW2 A;  2COM A;  4S04 A;  3BR3 A;  3S32 A;  3C18 A;  3JTG A;  5M5X J;  4QPQ A;  1ITY A;  5HNH A;  4CZC A;  4HDV A;  4M71 A;  3GVA A;  2M34 A;  1DGR M;  2CMP A;  3V4G A;  2MD5 A;  2VKD A;  3F8C A;  4UXN A;  4GFB A;  2KRC A;  1FSH A;  2VKH A;  3S15 J;  1PJR A;  3EUK L;  4UUT A;  3OSF A;  1TNS A;  3BT9 A;  1G3W A;  4RDU A;  1SAN A;  1RUN A;  3WTV C;  4F7Z A;  2IA1 A;  3O8H A;  1NK2 P;  5J47 A;  1U8R A;  3HOT A;  1P6R A;  4ENN A;  3WE2 A;  2CQ7 A;  1MND A;  4L9T A;  4G6T B;  2F48 A;  2NVQ J;  4EM1 A;  2FQ4 A;  3K4K A;  3GX4 X;  1S3J A;  2L5Q A;  2ZSH B;  1EH8 A;  2DFI A;  4B4C A;  1PP8 F;  4HLX A;  4Y17 A;  1FJL A;  2KRF A;  2R7D A;  1TWG J;  4RS8 A;  1BI2 A;  1JHF A;  4ZYH A;  3GFL A;  3K9T A;  2LKX A;  4ESB A;  2LG4 A;  1X3Z B;  3F3X A;  2IA0 A;  1XGO A;  1USS A;  3EYI A;  4I0B A;  1MMN A;  1IRG A;  5BMZ A;  2IS4 A;  1D1C A;  2I10 A;  5E20 A;  4B3X A;  2LLK A;  3CCQ I;  1PDN C;  5EEG A;  2HYJ A;  2KRH A;  1XMX A;  1GVD A;  2CV2 A;  1FOX A;  2V1D A;  1ZN2 A;  4JYK A;  5DCF A;  3DU6 A;  2BHY A;  5BS6 A;  1NG6 A;  3BR0 A;  2DOE A;  3GTJ J;  1C0W A;  1EF4 A;  1VQ6 I;  5JFR A;  3J7Y J;  2CQQ A;  3RSN A;  3FXM A;  4A0Z A;  2ESN A;  1FLI A;  2O03 A;  3OMY A;  3ZR8 X;  1JXS A;  4XL9 A;  2BVL A;  3CCR I;  2H8W A;  1Y0U A;  4XSX F;  3MN2 A;  4FX0 A;  1B8I A;  4DIQ A;  1OCO H;  2K02 A;  5J6X A;  3BDD A;  4WCG A;  1FYK A;  2RC4 A;  4CCK A;  4PGG A;  1IN5 A;  1Z05 A;  5K7H A;  4U7B A;  3D5L A;  2XF5 A;  2LR8 A;  1E3H A;  3MKW B;  4L5I A;  5EG0 B;  2VKE A;  4L9J A;  1PP7 U;  3SFZ A;  2FBI A;  4HNU A;  1ZK8 A;  1LE8 A;  1MSE C;  3ZMT A;  1I6X A;  2CWE A;  2RVC A;  3DEU A;  3H9J A;  1OYY A;  3N4M A;  3S16 J;  1APL C;  3S1M J;  1BR4 A;  4R8H A;  4A5M A;  1W5C C;  2DOA A;  5B3S H;  5A2Q K;  2K9M A;  1YI2 I;  2GBY A;  3C1D A;  3K4J A;  3R4K A;  2R7Q A;  2ECB A;  4IHW A;  1B9N A;  2DA3 A;  1HC8 A;  3S1R J;  1PUF A;  2NXN B;  1OPC A;  3W6K B;  1OR7 A;  3S17 J;  1GVJ A;  1X2M A;  3GCM A;  2LYC A;  1UJ8 A;  3EYY A;  2GIZ A;  4LOC A;  1R71 A;  3WTS C;  3CUQ B;  4CIC A;  3QP6 A;  2BZT A;  4O6J A;  2ZJP F;  1YTY A;  2FSW A;  2RQP A;  2VXZ A;  5E79 C;  2VI6 A;  5IOZ A;  3QU3 A;  5JI6 A;  2B9S A;  4RGS A;  1D8K A;  1U8B A;  3J7A Y;  3KX2 A;  1SAU A;  3CDI A;  3HRS A;  3PSF A;  1JI8 A;  3LFK A;  3S2H J;  3T1B A;  4LG3 A;  3I54 A;  2ZBK A;  2JA8 J;  2FX0 A;  1AKH A;  1N78 A;  4RM3 A;  4D0P A;  2X6Y A;  1YQA A;  5HLI A;  2VKV A;  2DI3 A;  1WZ2 A;  1FEX A;  5JLW A;  1V55 H;  2HXI A;  1AHD P;  4B44 A;  1SC7 A;  2GAU A;  2OJE D;  5F6F A;  3K4C A;  3ZOB A;  2B0L A;  3CME I;  3HTU A;  2P5K A;  2QLZ A;  4DBR A;  4WK8 F;  4XLN F;  2PLY A;  1TP4 A;  1WRJ A;  1ETY A;  2ZJQ F;  2N8G A;  1IO2 A;  3JRF A;  3PSI A;  3KP7 A;  3EET A;  3TO7 A;  3BR6 A;  1ETK A;  2WB1 N;  1I50 J;  4ZDO A;  3TDU C;  3KEO A;  5CPR B;  3IC7 A;  1U5T C;  3FX3 A;  2XRN A;  1T0F C;  3H5R A;  2XAS A;  4OIR F;  1I3A A;  4NBQ A;  2V1N A;  1VQ4 I;  3PM1 A;  1FYL A;  3ZN1 A;  4M9Z A;  3CLQ A;  1X58 A;  1WJB A;  2Z99 A;  3PQJ A;  4NC8 A;  4ZZD A;  4JX6 A;  3ZQC A;  1U9N A;  5DTD A;  1HKS A;  5EJC A;  2ESH A;  3VWB A;  2NS8 A;  5HNF A;  2DQL A;  2LRE A;  3RKY A;  2PMZ N;  4D9J A;  5JVT A;  2DMT A;  3OL3 A;  5E1X A;  3JR9 A;  3KP6 A;  1JJ8 C;  2HYF A;  4CCL A;  3OS1 A;  4JX4 A;  2L02 A;  2QZ8 A;  3R60 A;  3I59 A;  3H9Q A;  3HSF A;  4K2E A;  1FIA A;  3I5U A;  1O7F A;  4GGG A;  5H6Q A;  3HOU J;  1JUS A;  4ZDL A;  4RB2 C;  3GBG A;  1S5L C;  2E5N A;  4L9N A;  1ZGW A;  1OKR A;  3A1Y A;  2A3S A;  4ZDP A;  2KHM A;  3LAJ A;  4PFP A;  2HOE A;  2XRL A;  5CKT A;  1RET A;  1IDZ A;  3JSO A;  4GCV A;  1XGM A;  4BXX J;  3TW6 A;  3U1K A;  1T33 A;  4EJO A;  1W36 D;  2DPD A;  3LL7 A;  2FQ3 A;  4HF2 A;  3HRU A;  3IRQ A;  2ELK A;  4LG0 A;  2V26 A;  5CLS A;  2JPC A;  3V8L A;  4R1H A;  3CCJ I;  1Q1V A;  1RPW A;  5GTH C;  1YO5 C;  3MQ0 A;  5A2Q Z;  3M7G A;  4CYD A;  3CO6 C;  1BBY A;  1YX5 A;  1KQ0 A;  2QKM B;  4XR6 A;  1K83 J;  3Q3S A;  2DFH A;  3DKX A;  4EM0 B;  2X4H A;  5D5X B;  3S3N A;  1MMG A;  4L0Y B;  1EH7 A;  1XB4 A;  3DTK A;  3NEU A;  5F64 A;  4YFK F;  2MLK A;  4I6Z A;  1Y8R B;  3FF5 A;  1HDP A;  3IH2 A;  1ENH A;  2A68 F;  1QU3 A;  5GAE J;  3I55 I;  1F9N A;  1IXR C;  3QPL A;  4IO9 F;  3M8J A;  3E0J B;  2VBY A;  5ILS A;  2DTZ A;  2Y9Z A;  1ODD A;  1KU7 A;  3RTR A;  3LA2 A;  3QYB A;  2WAQ A;  5GTI C;  1O57 A;  2GA1 A;  3P7N A;  4PGH A;  4B1R A;  3OS0 A;  4QPO A;  2HQR A;  4Y33 A;  1DDN A;  2W4S A;  2E34 A;  1BOA A;  2QKL B;  3T8R A;  2IRF G;  2M45 A;  3OL4 A;  5IPA A;  1MNM C;  3M8E A;  2AXT C;  1Y8Q B;  2H27 A;  3CJQ B;  1G3S A;  3BPV A;  3H0G J;  1U0J A;  1UG0 A;  3MKL A;  2L01 A;  1RIO H;  4IHY A;  4G12 A;  2NS7 A;  4B8X A;  4WXC A;  3UNG C;  3GTK J;  2PBI A;  4XRS G;  5M5Y J;  2H1K A;  1WFX A;  3C3W A;  4M72 A;  4MQ9 F;  1IXS B;  2EB7 A;  2XGC A;  3CUQ C;  4C30 A;  3S14 J;  3GTL J;  1R7J A;  4KUM A;  5IP9 J;  3IRR A;  3RCO A;  2QEN A;  2QA4 I;  1W1W E;  2QBY B;  3RQ4 A;  3U21 A;  3DF8 A;  2JTV A;  2H09 A;  2RGV A;  2W25 A;  4AYB A;  1K78 B;  2Q2E A;  2FBH A;  2BYV E;  5LGT A;  3I56 I;  2F4O B;  1BW5 A;  2LRD A;  4HX7 A;  3PIO F;  3Q9V A;  4LK1 F;  3HUG A;  2OUM A;  3CMA I;  2X1E A;  4N9H A;  3GZ5 A;  3R6S A;  2X1C A;  3RYP A;  3LNQ A;  1Z6T A;  5F0F A;  3H9G A;  2KT0 A;  2EA2 A;  3U1D A;  1E3P A;  2GIV A;  2JPB A;  2F5E A;  1OCR H;  3AAF A;  2A07 F;  2JA6 J;  4XON A;  2OCC H;  4M9X A;  3HC7 A;  3C2G A;  3A2K A;  4BHC A;  4EAT A;  2D45 A;  2E7X A;  3FBN B;  5KHD A;  1ZRD A;  3G1M A;  1BOB A;  3RI4 A;  1ONV A;  3HGG A;  1MMA A;  2CFX A;  3TOB A;  1CF7 B;  2E1O A;  2P7V B;  2E35 A;  1NG7 A;  1UHS A;  2IEK A;  4NUB A;  2DT5 A;  1G59 A;  3E6M A;  5CYV A;  4OU0 A;  2HQ5 A;  4B43 A;  3D5R C;  3DKW A;  1SEU A;  1XMA A;  5J4V A;  1HW2 A;  3U2R A;  2L9S A;  3OYG A;  1UAA A;  4L9V A;  1QGP A;  2O8X A;  4XNF A;  2WA0 A;  4CCN A;  4NC6 A;  3BG7 A;  2LY9 A;  3CJR B;  4IJA A;  4B48 A;  1T95 A;  3WTY C;  4A3B J;  1KQ9 A;  4RAY A;  2R7O A;  3GTQ J;  2VC0 A;  3HOV J;  3LSJ A;  3HJE A;  1IDY A;  4LB5 A;  3BTJ A;  4YG2 F;  4BBR J;  1R36 A;  3H35 A;  1IAW A;  3VFZ A;  4E7J A;  1YIJ I;  2YSR A;  4BDY A;  3BQZ A;  3SYT A;  4WX9 A;  2LD5 A;  1BI3 A;  2WAD A;  2HPM A;  5BNG A;  2KL4 A;  1KYW A;  1FIP A;  1Z77 A;  2ELJ A;  4RMN A;  3ONQ A;  3T5X A;  1IXC A;  2GXG A;  2E7W A;  4Y7N J;  1SFU A;  1Y1V J;  2M7B A;  1MMD A;  1HBX G;  5D4S A;  4M3D A;  2BEO A;  2NS0 A;  1MH3 A;  4W97 A;  2ZME B;  4IHS A;  1ETQ A;  2DDA A;  2EQR A;  3TKY A;  5HDG A;  4HF1 A;  2JQ7 A;  2FOW A;  3OWT A;  3ULQ B;  4OWR B;  1E3O C;  1R49 A;  5GPA A;  3QP5 A;  4L5E A;  1Z21 A;  4BHP A;  3GME A;  1K7A A;  2LSO A;  1MJB A;  2ID3 A;  3PJR A;  2KP6 A;  4M3F A;  5K5Q A;  1JKO C;  4ENK A;  1V54 H;  5LD2 C;  1H9G A;  1H0M A;  4LLN A;  4U87 A;  4CDG A;  3HOZ J;  3HHG A;  3ZRG A;  2HQN A;  3OYL A;  1OLT A;  1IRZ A;  2ZB9 A;  1VQK I;  1IN4 A;  5DM6 F;  1HKT A;  3HIF A;  3TO6 A;  1T8I A;  1Y6I A;  2A5W A;  2D2W A;  1LNW A;  2DYS H;  4CCO A;  4Z6Y A;  3J7Z I;  1J75 A;  5D5W B;  3L00 A;  5HVQ C;  4V2F A;  5L3G A;  1IUF A;  1B4A A;  1R23 A;  2JUC A;  5IYB J;  2W1O A;  2EIJ H;  4DZP A;  3CES A;  3J81 K;  3CUQ A;  5J1U A;  2AQF A;  5IYD J;  5FKM A;  3REO A;  5BOX A;  1YIO A;  2ZJR F;  4ETS A;  2G9W A;  1GHC A;  2LDU A;  4NDL A;  3TW7 A;  9ANT A;  4M3B A;  3GW2 A;  4HEA 2;  1Z0X A;  2IGK A;  2OBP A;  3OR1 C;  3MZH A;  3F9K A;  1BW6 A;  4HBL A;  5KNL A;  5KVR A;  3O2P E;  2IGO A;  1R00 A;  3I4P A;  4IRG A;  1EKE A;  3SQN A;  4HNV A;  4IOC F;  2JRT A;  3BTC A;  3OYH A;  1FZP B;  3DQV C;  2O8K A;  2F5V A;  2KQR A;  3DBR B;  1ZEL A;  4Y15 A;  3RIR A;  3HRM A;  4IL6 C;  4EQQ A;  2CQN A;  5CVJ A;  3EUA A;  2G7H A;  4MFE A;  2F5C A;  4W1U A;  3M1E A;  1M1E B;  5J40 A;  3ESW B;  3WU0 A;  3COA C;  1W0U A;  2CW8 A;  4LLG F;  3HOS A;  3MKY B;  3ZCO A;  3I4M J;  3M1C A;  3CZ6 A;  2NOG A;  2FNP A;  1DP7 P;  4BJ6 C;  1ZG3 A;  2YS9 A;  3DLA A;  2DA5 A;  1OFC X;  1REP C;  2MH2 A;  3V8K A;  4JOM A;  2EFQ A;  1FC3 A;  1Z91 A;  2LVS A;  4CXF A;  3KP3 A;  2VBW A;  2VJI A;  4V19 K;  5CVU A;  2CO5 A;  2JJ7 A;  2L54 A;  3ABM H;  3SJM A;  1T98 A;  3ZMU A;  2Y0S A;  5J1R A;  2M87 A;  2K85 A;  2D5V A;  2F2E A;  1A36 A;  3KIO A;  2DDB A;  4BXU A;  4E6K G;  5F0H A;  4HST A;  6PAX A;  2K9Q A;  3OYC A;  2R4G A;  3G1O A;  4ZYD A;  2JSC A;  2WY8 Q;  3IAS 2;  1XSX A;  4LD5 A;  3TDZ C;  3CC4 I;  1MDM A;  1JGS A;  4CA0 A;  3F8B A;  3SZT A;  3CCM I;  2XAQ A;  3GWZ A;  2JA7 J;  1STZ A;  2EIL H;  2VQH A;  2HTJ A;  3FWE A;  1B72 B;  4BQQ A;  2XUB A;  3Q9S A;  1VND A;  3HTS B;  2Q8K A;  4A3D J;  1A04 A;  4DQ2 A;  3LST A;  5CQG A;  1MZB A;  3HEF A;  4B09 A;  1WJD A;  4ZJZ A;  4RB1 A;  3GXO A;  5C3E J;  2EFW A;  3GTO J;  1SFX A;  3K69 A;  3OOU A;  3HB9 A;  4XN3 A;  2P0W A;  1T56 A; 
#chains in the Genus database with same CATH homology
 3W6J B;  2E1N A;  2MBF A;  2UXX A;  2KJB A;  2OD5 A;  3H3Z A;  1W5S A;  5E8G A;  5E18 F;  4DNC A;  3IL2 A;  2Q0O A;  1BM9 A;  3L09 A;  1EH6 A;  1FBU A;  2K4J A;  2RKH A;  3MAJ A;  5ILV A;  3BY6 A;  3ELK A;  1FY7 A;  2XAH A;  2OU2 A;  3FZV A;  2NYX A;  1I27 A;  5LBQ A;  2VBX A;  2OQG A;  2QQB A;  1SD5 A;  4XRF A;  3J81 Z;  2XKP A;  1Q1H A;  2Z3Y A;  1YW9 A;  2W85 A;  1OYI A;  1AOY A;  1MJ9 A;  2STW A;  4Q48 A;  5LLQ A;  4ENJ A;  4HX8 A;  4HYE A;  3O3K A;  4JK1 X;  4A2U A;  5DD4 A;  3IHU A;  1ZYR F;  1KYZ A;  3I58 A;  5FD6 A;  1LDD A;  4YFN F;  3M9A A;  3E97 A;  3BJA A;  1TNT A;  2L4M A;  2V6C A;  1TQP A;  3G3Z A;  2RN7 A;  4FHT A;  2DBB A;  4EVI A;  2GWR A;  5CVV A;  4KMF A;  5HLH A;  1ON2 A;  3GZ6 A;  2F5D A;  1JHH A;  4AD9 A;  5E17 F;  3VB2 A;  4G7Z F;  2RNJ A;  2M5W A;  4MEY F;  3RKW A;  2A69 F;  1ZH5 A;  1DPU A;  4MGR A;  1ON1 A;  1R1U A;  2OQR A;  3FMQ A;  2PMU A;  4Y13 A;  3CUO A;  1XSV A;  2G7U A;  1FP1 D;  4HAM A;  1LDJ A;  4BNC A;  1SD4 A;  2DK8 A;  1CF7 A;  2YX7 A;  2YR2 A;  5AIQ A;  1W5T A;  2QWW A;  3T8T A;  1J2X A;  5LEJ A;  3WTU C;  4M73 A;  2M1B A;  2WV0 A;  1FT9 A;  2K4B A;  3QRF F;  3IKT A;  4R79 A;  4CHU A;  3KE2 A;  2EJR A;  1J59 A;  2X0L A;  3TOA A;  1K79 A;  3EUH A;  3FMR A;  4EJT A;  4EMS A;  4KMU X;  1W7P A;  5TRD A;  1U6G A;  1S8N A;  2C6Y A;  5LHI A;  2A5Y B;  1IN8 A;  3LQR A;  5D6F A;  4WXH A;  4QLC U;  3ECO A;  1F1Z A;  5K5O A;  5FD5 A;  3ZPL A;  2XV4 S;  4I0A A;  5LRR A;  2ZME A;  2VT2 A;  5L3F A;  1WI9 A;  1P2F A;  2AS5 F;  1J7K A;  3FXR A;  1ZHF A;  4IF4 A;  3VEP A;  3WTW C;  3WG9 A;  1SMY F;  1FX7 A;  4HLY A;  2RDP A;  2HFH A;  1SMT A;  3K2Z A;  4OMZ A;  3JTH A;  3QOP A;  2VON A;  3VOD A;  3GLX A;  3F21 A;  1D8J A;  4KIC A;  4RGX A;  2AXL A;  4EM2 A;  3KET A;  1SFE A;  1S6L A;  2A61 A;  1X3U A;  5ERI A;  2LF7 A;  1T39 A;  5DUK A;  4XLP F;  1BN5 A;  2Y48 A;  4M6X A;  3FXU A;  1ZG1 A;  1U78 A;  1OMI A;  5LHG A;  2YPR A;  1FOK A;  1CGP A;  3ERE D;  4MTD A;  5FFZ A;  3QAH A;  4ENM A;  4PDK A;  5LGU A;  4U7D A;  3MZY A;  3WGH A;  5E1Z B;  3MCZ A;  1P4X A;  1Z7U A;  2NRA C;  4I01 A;  3EDP A;  2XAF A;  4HQM A;  1J0R A;  2W84 A;  4OIQ F;  1O3T A;  4PCQ A;  2IPQ X;  2LF8 A;  1HST A;  4H0E A;  4G6Q A;  2ISZ A;  2K27 A;  2ADU A;  5FFX A;  5LEK A;  3GF2 A;  5HOO A;  4KNY A;  3K1N A;  3F72 A;  2FXA A;  1KU3 A;  3DV8 A;  1QPM A;  4G8X A;  3GO5 A;  3KFW X;  4RB3 C;  2HTS A;  3L2C A;  2RV8 A;  2O6G E;  1R22 A;  1XDU A;  3E5U A;  2HWV A;  4FT8 A;  3TQN A;  2HKX A;  4PZJ A;  1R58 A;  2K86 A;  1O3R A;  5ILU A;  2ZJ2 A;  4LK0 F;  5IT9 K;  4U0Y A;  3I53 A;  1QZY A;  2QYO A;  3HSR A;  4AIK A;  4RAZ A;  1UB9 A;  1BC7 C;  5LGN A;  3RJP A;  1QZZ A;  3FHZ A;  3V8J A;  2LKP A;  3ZMZ A;  1S29 A;  1S7O A;  1XD7 A;  3CJN A;  3H3U A;  1U3E M;  2H6B A;  2Z5U A;  5JR3 A;  2HKO A;  4TV7 A;  4CO8 A;  3T0Y A;  1LJ9 A;  2NNY A;  1ZGJ A;  4Z2Y A;  1U2W A;  2EV6 A;  2F5F A;  4WXD A;  3NRV A;  1LEA A;  1QQI A;  2CQK A;  3M8F A;  3HYI A;  3IWF A;  3ABU A;  4I98 B;  4UNO A;  1DPR A;  2J5O A;  1TLH B;  3KEQ A;  3D0S A;  3ZQ7 A;  2IJL A;  3R0J A;  3E6D A;  2WWY A;  2ZNY A;  4A5N A;  1SAX A;  1G3Y A;  1NHA A;  1KU2 A;  2MA3 A;  4Q4Z F;  4GYG A;  3VOE A;  1RI7 A;  1L3L A;  1FYM A;  2XAJ A;  4RGU A;  3QPH A;  2FRH A;  1XGN A;  1WSU A;  4CGZ A;  3E6B A;  4ZYE A;  1EV7 A;  2PG4 A;  3E5X A;  5L3B A;  5HS8 A;  4IVN A;  4KFC A;  3F22 A;  3F8M A;  1UCR A;  1FBQ A;  3J80 K;  2FA5 A;  4MTE A;  5TJJ A;  2XGX A;  5DDG A;  1D3Y A;  4I09 A;  1IUY A;  5D6E A;  1YW8 A;  4ESJ A;  4KYW A;  4A6D A;  2H94 A;  2VT3 A;  2UZK A;  5KK1 A;  5IT9 Z;  1I5Z A;  4MNU A;  1YLF A;  4G7H F;  1BC8 C;  4YFX F;  2FNA A;  1VTN C;  2BV6 A;  5FLX K;  5EEH A;  1WWX A;  4ESF A;  1UHW A;  3LA3 A;  2R3S A;  2GA2 A;  2DQR A;  3K1M A;  2PI0 A;  1Z6R A;  4OIO F;  2IA2 A;  2VOO A;  3KZZ A;  1JE8 A;  3F8F A;  1O7L A;  3F8N A;  3LQQ A;  1BI1 A;  5AON A;  3H92 A;  4M6Y A;  3KLN A;  3WGG A;  2HR3 A;  5LHH A;  1IN6 A;  2IP2 A;  1UHM A;  2VN2 A;  2M8E A;  2DK5 A;  3KLO A;  1IW7 F;  2A6E F;  2VE8 A;  1ULY A;  3I59 B;  2J5P A;  3BOQ A;  2CG4 A;  3JSP A;  3HHH A;  2EV0 A;  2NAZ A;  4HDU A;  2DU9 A;  3FMS A;  3BRO A;  1P4A A;  2PFB A;  3BJO A;  1KQ8 A;  5L3C A;  4M9S A;  5K5R A;  4A6E A;  1I1G A;  2HS5 A;  4UUV A;  5IT3 A;  3WOD F;  4BHB A;  4ASN A;  2CSO A;  4UVA A;  4A12 A;  2XKO A;  3J80 Z;  4BYY A;  5HS9 A;  3F6V A;  3WTT C;  5HDK A;  4P9U A;  3Q5F A;  4N0B A;  2V1U A;  1SD6 A;  1BIA A;  3JW4 A;  4A0X A;  5LRS A;  4WF2 A;  1O3S A;  1HSJ A;  3SXY A;  3GYH X;  4QWQ A;  2PQ8 A;  2DO7 A;  3DFG A;  3RDI A;  3WTX C;  4HV6 A;  4HZF A;  2FF4 A;  3TGN A;  1H9T A;  2O0Y A;  1OYW A;  5FLX Z;  4HV5 A;  2ZFW A;  4P96 A;  3CO7 C;  3RPU A;  3DPT A;  4LMY A;  4OOI A;  1T2K A;  3DP7 A;  2UWM A;  4L0Z B;  1MGT A;  3OV8 A;  1R5H A;  1F4K A;  2Y75 A;  4KT5 C;  1SD7 A;  3BZ6 A;  3G73 A;  3V7C A;  2Z33 A;  4NHJ A;  1U5T B;  2ACJ A;  2L3D A;  2O3F A;  1ZLJ A;  4LJZ F;  4KDP A;  5D8K B;  3F23 A;  1MJA A;  3ML6 A;  3QU6 A;  2VBZ A;  4YII A;  1UST A;  2QBY A;  2V79 A;  3C7J A;  3NQO A;  1K78 A;  1FP2 A;  4Q47 A;  4CZZ A;  2QQA A;  3ZP5 A;  3CLO A;  4NB5 A;  5CVI A;  4N9I A;  3E3V A;  1FNN A;  4RB0 A;  2JT1 A;  4KIB A;  1Z1D A;  2A6H F;  4JBA A;  4EJU A;  4I02 A;  2P8T A;  2GQQ A;  2DLL A;  2DW4 A;  4Q5S F;  5BQT A;  3F6O A;  2VE9 A;  1XN7 A;  2ISY A;  4AWX B;  4E70 A;  4XSZ F;  4L5J A;  3WGI A;  3RPQ A;  4G9Y A;  3J7A O;  1G6N A;  3LWF A;  5H20 A;  2BGC A;  4M74 A;  4MEX F;  4EV0 A;  2XVC A;  2CW0 F;  4AIJ A;  2KIM A;  4YIF A;  4UHT A;  2DTR A;  4IRI A;  2FE3 A;  5ICC A;  1ZG5 A;  2EA4 A;  1TQM A;  1KGS A;  3ABT A;  2DPU A;  3CTA A;  4IPA A;  2ELH A;  3CDH A;  4L18 B;  3QPT A;  1XCV A;  3FM5 A;  1XCB A;  5FGM A;  1HW5 A;  2QM3 A;  4EJV A;  3BWG A;  1YFH A;  3KZY A;  5HDN A;  2P6S A;  2MC3 A;  4BH9 A;  1WKM A;  4UVC A;  5DCM B;  4EGY A;  2WC2 A;  4IRH A;  3RKX A;  3E5Q A;  2KKO A;  2MLG A;  2IVM A;  1ZLK A;  3I71 A;  3MWM A;  5DV5 A;  5K1Y A;  3IKV A;  1XGS A;  4KN7 X;  2UXN A;  1HW1 A;  3GFJ A;  4AIH A;  4KIF A;  1QBJ A;  4U88 A;  4EJW A;  4JQF A;  1T6S A;  2VC1 A;  2P5V A;  1GXP A;  5ICG A;  3SZP A;  2O61 A;  5HS7 A;  5H6R A;  1P4W A;  1Z9C A;  1F5T A;  2ZNZ A;  1B9M A;  3B02 A;  4LGW A;  2HDC A;  1IF1 A;  1T38 A;  2EFN A;  5HLG A;  5DD8 A;  2KJC A;  5BPD A;  1FBS A;  3O6B B;  3WE3 A;  2STT A;  4HA8 A;  1MDM B;  2KIU A;  2VOD A;  1YG2 A;  4P5O A;  4G7O F;  5ED4 A;  2ZCW A;  1DUX C;  3ZMD A;  2WTE A;  1ZRE A;  1XMK A;  2GZW A;  4S05 A;  4OIN F;  2XHK A;  2P5L C;  1B1B A;  5D4R A;  3I0T A;  5J8C A;  1LQ1 A;  1R1T A;  5DYM A;  1WQ2 A;  2CGP A;  2LNB A;  2HZT A;  3E6C C;  3LA7 A;  2HEO A;  4HF0 A;  2OZ6 A;  4O5V A;  1J9I A;  2XIG A;  1ZRC A;  4OMY A;  1TTY A;  1QO0 D;  5BPI A;  4HW0 A;  5JHU A;  1LVA A;  5DEQ A;  1YYV A;  4LFU A;  1HXD A;  3I64 A;  4BAY A;  3KP4 A;  1V4R A;  2PN6 A;  1YW7 A;  2BE5 F;  2FMY A;  4XBF A;  3L9F A;  3HRT A;  3ISP A;  4RGR A;  4KIG A;  2P4W A;  4ZYG A;  1RNL A;  1LEB A;  5D5V B;  3FXQ A;  2D1V A;  4EGZ A;  1K6O A;  3GUD A;  3KP2 A;  1UFM A;  5J8F A;  4GO1 A;  4NQW A;  2OA4 A;  4A0Y A;  1FSE A;  3ECH A;  2W57 A;  5AIP A;  2R7F A;  2M30 A;  2OAZ A;  1KU9 A;  1U5T A;  4I2O A;  1T0F A;  3ZN0 A;  4IHT A;  2Y0M A;  3BJ6 A;  1TBX A;  2ZXJ A;  2W24 A;  3R0A A;  2QVO A;  3LAP A;  2NNN A;  1KA8 A;  2L4A A;  2FBK A;  3JAM K;  3P9K A;  5CJ9 A;  4P9F A;  3EQL F;  1ZRF A;  4WWC A;  2ZKZ A;  3ROU A;  3N97 A;  2FML A;  5E1W A;  3KCC A;  1GXQ A;  3RYR A;  3S2W A;  5L3E A;  4FX4 A;  2TDX A;  2QUF A;  3GFI A;  4P55 A;  2P7C B;  1W7P B;  1AWC A;  3MFK A;  1QNT A;  2V1X A;  1RUO A;  1S7A A;  1O3Q A;  3DPL C;  1MKM A;  1MD0 A;  4ZH4 F;  1ZAO A;  3P9I A;  2HGC A;  3U9G A;  2D1H A;  2E1C A;  1LB2 A;  2CYY A;  1V3F A;  4MHG A;  2V9V A;  1BIB A;  5F1R A;  3SHF A;  1B6A A;  1E2X A;  3V7S A;  1G3T A;  3HSE A;  2EV5 A;  1HQC A;  2H6C A;  2P6T A;  3IWZ A;  2ZO4 A;  1E17 A;  1IRF A;  5E8I A;  2PEX A;  4G6D A;  2FOK A;  2DAO A;  3V7R A;  1IZ1 A;  2EFO A;  1LDK B;  5ICF A;  2EFP A;  2JZY A;  1FWZ A;  4AVP A;  3B73 A;  4HX4 A;  1B59 A;  4O3M A;  2BBY A;  2FU4 A;  1HKQ A;  1IN7 A;  1RZ4 A;  4ZZL A;  2IW5 A;  3PQK A;  1R5G A;  5DCM A;  4KA4 A;  5DUI A;  5FB2 A;  1TQI A;  3ZMS A;  2YU3 A;  3ZMV A;  3R61 A;  3GFM A;  3WU1 B;  4MQV A;  2EK5 A;  4U0V A;  3DXJ F;  2YX4 A;  2VOP A;  5CVR A;  1ZAR A;  4I7H A;  3JAM Z;  4LG0 B;  3OOP A;  1TW3 A;  1XDS A;  1ZGA A;  2XRO A;  1I1S A;  2KIF A;  2IT0 A;  1J5Y A;  2FEZ A;  2QQ9 A;  2GXB A;  5D8L B;  5D5U B;  5FO5 A;  3KP5 A;  4GXO A;  4HOB A;  1YS6 A;  1FPQ A;  3P9C A;  2EWN A;  1W4M A;  1PUE E;  2Z9O A;  2XAG A;  4HQE A;  4LB6 B;  4BQA A;  3K0L A;  4UVB A;  3K1P A;  5L3D A;  1L0O C;  4U0W A;  1W7P D;  1R1V A;  3WTZ A;  2ETH A;  1XSD A;  4ON0 A;  2PJP A;  3GEZ A;  2OZU A;  4G94 A;  3BPX A;  3L7W A;  4UV9 A;  2K7L A;  2PMH A;  4UV8 A;  2HYG D;  1BI0 A;  3FM3 A;  1YS7 A;  5ICE A;  2MH9 A;  4LLL A;  3PFI A;  1BJA A;  4KN4 X;  1G4D A;  3MEX A;  3BP8 A;  4GYI A;  1P92 A;  4IXA A;  3TO9 A;  1D5V A;  1TW2 A;  2COM A;  4S04 A;  3C18 A;  3JTG A;  4HDV A;  4M71 A;  3GVA A;  3V4G A;  2MD5 A;  3F8C A;  4UXN A;  1FSH A;  1TNS A;  1G3W A;  1RUN A;  3WTV C;  4F7Z A;  2IA1 A;  1U8R A;  3HOT A;  1P6R A;  4ENN A;  3WE2 A;  4L9T A;  4EM1 A;  3GX4 X;  1S3J A;  1EH8 A;  2DFI A;  1PP8 F;  4HLX A;  4Y17 A;  2KRF A;  2R7D A;  4RS8 A;  1BI2 A;  1JHF A;  4ZYH A;  3GFL A;  3K9T A;  4ESB A;  3F3X A;  2IA0 A;  1XGO A;  1USS A;  3EYI A;  4I0B A;  1IRG A;  5BMZ A;  5E20 A;  1PDN C;  5EEG A;  2V1D A;  1ZN2 A;  5DCF A;  5BS6 A;  1C0W A;  5JFR A;  4A0Z A;  2ESN A;  1FLI A;  2O03 A;  1JXS A;  1Y0U A;  4XSX F;  4FX0 A;  2K02 A;  5J6X A;  3BDD A;  4WCG A;  1FYK A;  2RC4 A;  4PGG A;  1IN5 A;  1Z05 A;  4U7B A;  3D5L A;  4L5I A;  4L9J A;  1PP7 U;  3SFZ A;  2FBI A;  3ZMT A;  1I6X A;  2CWE A;  2RVC A;  3DEU A;  3N4M A;  1OYY A;  4A5M A;  4R8H A;  5A2Q K;  3C1D A;  3R4K A;  1B9N A;  1OPC A;  3W6K B;  1OR7 A;  1GVJ A;  3EYY A;  3WTS C;  3CUQ B;  4CIC A;  3QP6 A;  4O6J A;  1YTY A;  2FSW A;  2RQP A;  2VXZ A;  5JI6 A;  3QU3 A;  4RGS A;  1D8K A;  3HRS A;  3LFK A;  3T1B A;  3I54 A;  2ZBK A;  4D0P A;  1YQA A;  5HLI A;  2DI3 A;  2GAU A;  5F6F A;  2B0L A;  3HTU A;  2P5K A;  2QLZ A;  4WK8 F;  4XLN F;  2PLY A;  1WRJ A;  3KP7 A;  3EET A;  3TO7 A;  3TDU C;  3KEO A;  3IC7 A;  1U5T C;  3FX3 A;  2XRN A;  2XAS A;  4OIR F;  1FYL A;  3ZN1 A;  4M9Z A;  2Z99 A;  3PQJ A;  4ZZD A;  1HKS A;  2ESH A;  2DQL A;  3RKY A;  5JVT A;  5E1X A;  3KP6 A;  2HYF A;  2L02 A;  2QZ8 A;  3R60 A;  3I59 A;  3HSF A;  4K2E A;  3I5U A;  1O7F A;  4GGG A;  5H6Q A;  4RB2 C;  4L9N A;  1OKR A;  2A3S A;  3LAJ A;  2HOE A;  3JSO A;  4GCV A;  1XGM A;  4EJO A;  2DPD A;  2FQ3 A;  4HF2 A;  3HRU A;  3IRQ A;  4LG0 A;  5CLS A;  2JPC A;  3V8L A;  4R1H A;  1YO5 C;  3MQ0 A;  5A2Q Z;  3M7G A;  4CYD A;  3CO6 C;  1BBY A;  1KQ0 A;  4EM0 B;  2X4H A;  5D5X B;  4L0Y B;  1EH7 A;  1XB4 A;  3NEU A;  5F64 A;  4YFK F;  2MLK A;  3FF5 A;  2A68 F;  1F9N A;  1IXR C;  2VBY A;  5ILS A;  1ODD A;  1KU7 A;  3RTR A;  3LA2 A;  1O57 A;  2GA1 A;  3P7N A;  4PGH A;  2HQR A;  1DDN A;  1BOA A;  3T8R A;  2IRF G;  2M45 A;  3M8E A;  2H27 A;  1G3S A;  3BPV A;  1RIO H;  2L01 A;  4B8X A;  4WXC A;  2PBI A;  4MQ9 F;  3C3W A;  4M72 A;  1IXS B;  2EB7 A;  3CUQ C;  1R7J A;  4KUM A;  3IRR A;  2QEN A;  2QBY B;  3DF8 A;  2JTV A;  2H09 A;  2RGV A;  2W25 A;  1K78 B;  2Q2E A;  2FBH A;  2BYV E;  5LGT A;  4HX7 A;  3Q9V A;  4LK1 F;  3HUG A;  4N9H A;  3GZ5 A;  3R6S A;  3RYP A;  1Z6T A;  2EA2 A;  3U1D A;  2GIV A;  2JPB A;  2F5E A;  2A07 F;  3AAF A;  4M9X A;  4BHC A;  2D45 A;  2E7X A;  1ZRD A;  3RI4 A;  1ONV A;  2CFX A;  3TOB A;  1CF7 B;  2P7V B;  2DT5 A;  3E6M A;  5CYV A;  4OU0 A;  3DKW A;  1XMA A;  1HW2 A;  3U2R A;  4L9V A;  1QGP A;  2O8X A;  4IJA A;  3WTY C;  1KQ9 A;  4RAY A;  2VC0 A;  4LB5 A;  4YG2 F;  1R36 A;  1IAW A;  3VFZ A;  2YSR A;  4WX9 A;  1BI3 A;  1KYW A;  3T5X A;  1IXC A;  2GXG A;  2E7W A;  1SFU A;  1HBX G;  5D4S A;  2BEO A;  2NS0 A;  2ZME B;  4IHS A;  3TKY A;  5HDG A;  4HF1 A;  3ULQ B;  3QP5 A;  4BHP A;  1K7A A;  2LSO A;  1MJB A;  5K5Q A;  4ENK A;  1H9G A;  1H0M A;  4LLN A;  4CDG A;  3HHG A;  2HQN A;  1IN4 A;  1HKT A;  3HIF A;  3TO6 A;  2D2W A;  1LNW A;  1J75 A;  5D5W B;  3L00 A;  5HVQ C;  5L3G A;  1B4A A;  1R23 A;  3J81 K;  3CUQ A;  3REO A;  5BOX A;  1YIO A;  4ETS A;  2G9W A;  1GHC A;  2LDU A;  3GW2 A;  2OBP A;  3MZH A;  4HBL A;  5KVR A;  3O2P E;  1R00 A;  3I4P A;  4IRG A;  3SQN A;  2JRT A;  1FZP B;  3DQV C;  4Y15 A;  3RIR A;  3HRM A;  4EQQ A;  5CVJ A;  2G7H A;  2F5C A;  3M1E A;  3WU0 A;  3COA C;  4LLG F;  3HOS A;  2FNP A;  1DP7 P;  1ZG3 A;  1REP C;  2MH2 A;  3V8K A;  2EFQ A;  1FC3 A;  1Z91 A;  4CXF A;  3KP3 A;  2VBW A;  5CVU A;  2CO5 A;  2L54 A;  1T98 A;  3ZMU A;  2M87 A;  2F2E A;  4BXU A;  6PAX A;  4ZYD A;  2JSC A;  1XSX A;  4LD5 A;  3TDZ C;  1MDM A;  1JGS A;  3F8B A;  3SZT A;  2XAQ A;  3GWZ A;  1STZ A;  3FWE A;  2HTJ A;  2XUB A;  3Q9S A;  3HTS B;  2Q8K A;  1A04 A;  4DQ2 A;  3LST A;  1MZB A;  2EFW A;  4B09 A;  4RB1 A;  3GXO A;  1SFX A;  3K69 A;  4OIP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...