4QPOA

Mechanistic basis of plasmid-specific dna binding of the f plasmid regulatory protein, tram
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
53
structure length
53
Chain Sequence
AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Basis of Plasmid-Specific DNA Binding of the F Plasmid Regulatory Protein, TraM.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Relaxosome protein TraM
total genus 14
structure length 53
sequence length 53
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4qpoA00
3OMYA 4QPOA 1DP3A 4QPQA
chains in the Genus database with same CATH superfamily
3JAMK 1T56A 4C3HJ 3RKXA 4B1RA 4JK1X 2F4OB 3IAM2 1XDSA 2EZKA 3MWMA 4LIVA 4CCMA 4BY1J 1IW7F 4DYCA 2IBDA 3L1PA 2ZJRF 3I56I 1BW5A 4A3GJ 4G7OF 3CJTB 5BPIA 2JWTA 5IT3A 2QWWA 2X85A 2DODA 4IRIA 1TZLA 4OIOF 5GAHJ 4IZZA 3ABKH 4IVNA 4QPQA 3TOBA 1ETVA 1EH8A 4HEA2 3K10A 1FP1D 3H9QA 1FNNA 4MEXF 1IRGA 4IKFA 5EDNA 3GW2A 1GVDA 3SJMA 2BHYA 3FHZA 2FSWA 2KIMA 2FJ1A 3LA3A 3QOPA 2A61A 3IC7A 3VFZA 4CCKA 2XKPA 1FOXA 1B59A 1FBQA 4FE4A 1U2WA 3SFZA 1TW3A 3COAC 1J2XA 2ECCA 3I71A 1FZPB 2VI6A 5TRDA 1S3JA 5HDNA 1XSDA 5IPAA 2JRTA 3HC7A 5TJJA 1R6RA 2WV0A 1D1AA 1ETKA 5FKLA 3ASOH 2CU7A 3QPSA 1Q1HA 1Z3YA 2O6GE 3PSFA 4NUBA 2XASA 1FIPA 4XICA 3ZP5A 3CMAI 3O8HA 4A5NA 4XOTA 3H9GA 1ZN2A 3CZ6A 1JGSA 4XIDA 2OJED 2CO5A 3A1YA 5CJ9A 3S14J 2IXSA 4IJAA 1IN6A 4B44A 2M2EA 3LL7A 4RGXA 3GTGJ 3HB9A 1Y56A 3EUHC 3LSKA 3AG2H 4B43A 3CP2A 2IEKA 5IP9J 5L3EA 3OIPA 5D4SA 2DAOA 4FX4A 2WB1N 1J59A 1B1BA 1LUJB 1M1EB 3L2UA 1Z9CA 2R7WA 1YW7A 2QF7A 3E3VA 5JR3A 2E35A 1IV8A 2NRAC 1F43A 4ENKA 4KFCA 2WADA 3BQZA 4ZTJA 1JKOC 1EF4A 5HNHA 2JA7J 4XN0A 1SAUA 3H92A 4E7LA 2AQEA 5IY5H 2NVXJ 5HS8A 2O8KA 1X3ZB 4IOCF 4JOMA 4GGGA 1HW5A 3BZKA 2IGNA 2RKHA 2KRCA 3UNGC 3M3YJ 4L9VA 2HNHA 2GAUA 2W82A 2XRLA 1TLHB 2GA2A 1XMKA 1UJ8A 1QNTA 3CJQB 2R5YA 3Q9SA 5E17F 4I76A 1ITYA 3K1NA 4NC7A 3S16J 4HNUA 1PUFA 5LHGA 2FE3A 4ENNA 3A0BC 1KYZA 3L2QA 3F3XA 2KDZA 2VC0A 1WQ2A 2GM4A 4OAZA 2Q2EA 3BR3A 3M8EA 1POGA 4M74A 4ETSA 1F4KA 4D7MA 3S1MJ 4KT6A 4FE7A 2CSOA 2CFOA 3OYIA 5J3LA 1W5SA 4OIQF 3QAHA 2K4JA 2CYYA 3GFLA 1VNDA 4AU7A 1FOYA 2IS2A 2JUGA 4IF4A 2EFQA 3W6VA 1GV5A 4RLQA 1BIBA 4XL9A 5EEGA 2O9LA 1U8RA 1ZREA 3G4SI 1R23A 2H09A 2HTJA 2M1BA 3T8TA 5DCFA 1HKQA 4GDFA 5JVTA 3ZQCA 1XTAA 2A05A 1JUMA 1XCVA 2FA5A 2JPCA 3CJNA 3RDIA 2R7RA 3WG7H 1QVUA 3HTUA 2DMTA 2HDCA 3MD2A 2K3FA 3G1LA 3D0SA 2DTRA 5HLHA 3K6GA 2EFWA 1LFUP 4HV6A 1BOAA 3GLLA 2L2OA 3W2WA 1P92A 3A01B 1HBXG 2OV7A 2R93J 3QU3A 1D0ZA 4A6DA 4DW6A 4YFNF 2Y69H 1R71A 1FWZA 1GVJA 2VN2A 4MNUA 4HG2A 5LRRA 1S29A 2L3DA 5FKKA 3VOEA 5F0HA 1R00A 3PUBA 1RZ4A 1KU7A 2HZDA 2CW7A 3SZTA 3JRBA 5AIQA 2CW8A 3G73A 2IS4A 1X1AA 3L00A 3ZMZA 2R3SA 4UUSA 1SAXA 3FXMA 1T6SA 4JX4A 4R79A 1JTXA 2O3FA 1EKEA 3CJRB 1J0RA 2M45A 4G12A 2CW0F 3HKZN 2QVOA 3TO7A 3CCVI 3W3CA 3FM3A 4ABZA 4E6KG 4C2MJ 3S2WA 1X19A 3QODA 3ZQGA 4EJTA 2GBYA 4B48A 2D1VA 3BC8A 3ZQHA 1IJWC 5BMZA 3KZZA 4YIFA 2EFNA 5E1ZB 4XNFA 3AL0B 2ELHA 4A3FJ 4PFOA 5M5YJ 1DDNA 1LEBA 2W57A 2QEXI 2DA7A 1HLVA 1JTYA 1OMIA 1SMTA 4B4CA 2FU4A 3PO3J 1SVLA 2GIZA 5ILSA 2LNBA 4CO8A 4DOZA 1MNEA 2H1KA 4B47A 3TQNA 3CF5F 4KIGA 3JRHA 1T08B 5EYRA 3FMRA 4GYIA 3D1NI 2VONA 1YQAA 2UXNA 2LD5A 5FRNA 4AWXB 2DMPA 3FXOA 5CKTA 2VLAA 5IT9Z 2JJ7A 5DTDA 2JMWA 1JHFA 5D6FA 1BW6A 2PQ8A 4EATA 2EK5A 3RPQA 4L5IA 4KUMA 1ETXA 3GVAA 2E34A 3SDBA 3OOUA 4K2EA 2H6BA 4CZCA 3BT9A 3OYMA 1F1ZA 2WWYA 3KYCB 2JUCA 4CDGA 2Z5UA 3HSEA 1IN5A 4A69C 1PP7U 2R7UA 1IXSB 3P5JA 4KMUX 4I99C 4BE0A 1JKQC 1S72I 2Y0SA 1RR7A 2HVQA 1R36A 1KU3A 1Z6RA 2JT1A 3MVPA 4HOBA 4F55A 3DPTA 1FBUA 3KP2A 2LKXA 1B6AA 3RKQA 1PDNC 2CS3A 3IP4B 3MAJA 5FGMA 3CMEI 1H88C 4V19K 2K9QA 3MZ8A 4BACA 1J75A 1U3EM 1ZRCA 3TO6A 5D5UB 1I1SA 3CO7C 3E5UA 4E7JA 2A68F 1ETYA 1BI3A 1FMVA 4KICA 4RM3A 4E7SA 1RNLA 2K85A 3W2VA 2AQFA 2OZUA 2ZXHA 3OYGA 1U5TC 3Q3SA 4B3XA 3ZMDA 3M07A 3ISPA 3LQQA 1F36A 4P9UA 4M6VA 2P4WA 5J6XA 3T1BA 1BJAA 5L3CA 3HOTA 2IP2A 5CQEA 3G2BA 5E3LA 1U78A 1JXSA 3R4KA 2Z16A 3VB2A 1V5FA 2BXZA 2HTSA 4U7BA 3H3VK 3M1CA 1OCPA 4HX4A 1V4RA 3QWLA 2VL8A 1DGRM 2FOWA 2VQGA 3BTIA 2KKOA 5L3DA 2Q8KA 2XRNA 3FK7A 3TKYA 3JR9A 4LGWA 5KAFC 2JRMA 2JVGA 1FSEA 2E1OA 4Y52J 3C2HA 3SYTA 1ZGAA 4CCOA 3KCCA 1HCRA 3JRFA 4AYBA 4KMFA 3H35A 1Y0NA 3V8LA 2Y9YA 1X2MA 1W7PA 3C3WA 4NDLA 1HF0A 4M9ZA 3S2HJ 3K4CA 4RS8A 1MBHA 4CCLA 4WK8F 1BA5A 1WRJA 2K3PA 3ROUA 5B66C 1MJAA 3BCBA 1R4NB 5A2QK 5D6EA 5JI6A 1EH6A 1VQ7I 3K7AJ 4EM0B 1VQ8I 4D5CA 5J1RA 1XSVA 2E1NA 4DNCA 4I09A 2EIMH 2BVMA 2PX9A 5CVIA 3KP4A 1YTYA 3OYLA 3CDHA 2R5YB 1YW8A 4ZYAA 2DK5A 2KIFA 2LH9A 4DJAA 2ZXJA 3WTYC 1MMSA 4ZYEA 4HNVA 4CYCB 2ZNYA 1W4MA 4IHVA 1U8BA 4ENJA 3K0LA 1X1DA 3H5RA 2DA1A 2DQRA 5EJCA 1WI3A 3RZDJ 5B1AH 3OV8A 4Q47A 4RGUA 1RR8C 1HOMA 2R0QC 1IUFA 1WH7A 3BG7A 2WA0A 4Y7NJ 3H5AA 3CCMI 3MZHA 2A6EF 3KZYA 1ETWA 2FD5A 3K4NA 1HQCA 1ON1A 3S1NJ 2CV1A 1JE8A 2D5VA 2VKHA 3G3ZA 2LDUA 3RSNA 2BXYA 3KP3A 4XONA 3ERMA 1IDZA 2XHKA 4S04A 3ZQLA 1PUFB 1IRXA 2MD5A 1GDTA 3HHGA 3WODF 2EFPA 5KK1A 3CCSI 3S1QJ 3C1DA 1K79A 2HDWA 1QBJA 4XOPA 1ZAOA 1WJCA 3EETA 1RI7A 3Q0UA 5F6FA 3R0JA 3ZGKA 3LQRA 4F52A 1A5JA 2CQKA 1YE9A 3CCEI 1X3UA 4AYBN 3KP6A 5IYBJ 2R7SA 1STZA 1D5VA 1IZ1A 1R7JA 5J47A 2DFEA 3CD6I 1SFXA 4JQFA 4A0YA 4A3IJ 1CF7A 3RZOJ 2GIVA 2OC6A 2E36A 3DPUA 5ILVA 4GXOA 4DYRA 2K27A 1TWCJ 4CZZA 2HWVA 1FX7A 3BR2A 4IO9F 2PJPA 1MD0A 2LR8A 1E0EA 2IGKA 4ESFA 2MC4A 1AKHB 1KU2A 3LAJA 3EYIA 5F27A 2ME6A 4QLCU 1IN4A 4HDUA 2HYJA 5LD2C 1T33A 4PJLA 1FSHA 2JSPA 3D5LA 1BBYA 1YS7A 4UHTA 3OOPA 3CLOA 2B0LA 4ZZDA 3CC2I 1HC8A 5DS9A 1H9TA 1UFMA 5J8FA 4NC8A 5GTHC 2CG4A 4M3EA 4KN4X 1P9QC 2LREA 4DBQA 4XLFA 4KDPA 2L7ZA 3E6BA 5DUIA 2QUFA 5CQGA 3LSPA 4L18B 1E3PA 2L9NA 5AONA 1GHCA 5C4JJ 3J7YJ 3F22A 2Z9OA 3O6BB 3BJAA 4I98B 5KVRA 2L54A 1RUOA 3IAS2 2DOAA 4IOAF 4KIFA 3TDZC 4YG2F 2RQQA 3P9KA 4QWQA 3RYPA 5BOXA 1A36A 2VJIA 4F91B 3GXOA 2FF4A 1EV7A 2X6WA 5J40A 2MLGA 3V8JA 3G1MA 3GYHX 3ABMH 2XSDC 1Z7LA 4UUSB 4Z6YA 2HPIA 2Y31A 3PO2J 2A6HF 3LMMA 1O4XA 1QHGA 5C3EJ 3J7AO 3FXRA 2EILH 4BU2A 4XLCA 3JAMZ 2VB6A 1ZR4A 1ETOA 5D4RA 4G6QA 3EDPA 3ASNH 1UB9A 2KL4A 3C18A 3HRSA 5CVVA 4C30A 3CCYA 4X0GA 2FNPA 1FYMA 3O2PE 4HZFA 4FT8A 3K70D 2BVLA 1YYVA 2PMUA 3QYFA 1X4PA 4BHBA 1GT0C 2MH2A 3B73A 2MYSA 3WU1B 1O3QA 3FF5A 5IYCJ 2QYOA 2XSJC 1UELB 1V3FA 4C9YA 1Y1WJ 4RAZA 2BW3B 1R1TA 5F0FA 1UG0A 3DWLE 2R7VA 3ECOA 3JRAA 4V2FA 2HDDA 2AHQA 4M6YA 4OWRB 4BXUA 1LVAA 2Y30A 3I55I 2Q0OA 2W85A 3RIRA 2B7EA 3IH4A 1F9NA 4E7IA 3S3OA 4XKVA 3LNQA 2BYVE 5E8IA 3HKZA 4L5EA 2KPMA 3DP7A 3ZN1A 3JCUC 2UUZA 2FXAA 2OD5A 2NYXA 2PI0A 3AAFA 4FX0A 4V2GA 3FKIJ 1TW2A 1PJRA 5CYVA 5TGTA 5H20A 4MIMA 4RAFA 2LKPA 3H0GJ 5ERIA 1R49A 2XGCA 2BY3A 2Y0MA 2KT0A 3WTTC 2LSOA 3V8KA 1FY7A 5FJ8J 3FXLA 2ESNA 3FXJA 2EJRA 3OYJA 2DYSH 3RCOA 5LHHA 2WC2A 2W48A 3DKXA 9ANTA 1OFCX 1R9TJ 4KA4A 2E1CA 2W4SA 2MA3A 1YJWI 1FYLA 2L7KA 1BOBA 1MH3A 5KNLA 4D5FA 2H8RA 1YIOA 3T5XA 1W0UA 4FTHA 4MGRA 5LHIA 4XORA 1JHHA 3OMYA 4L0ZB 5IYDJ 3E6CC 4CCNA 2XROA 4A3CJ 1Z0XA 1O3RA 1YS6A 2OCEA 3FIWA 3IH3A 1ON2A 5FKMA 1QHHD 5E18F 1RKWA 1LVKA 3KEYA 1ZGWA 1NK2P 2R5ZB 4U7DA 4Y3OA 3KE2A 3HL2A 4AUXA 2LK2A 1ZQ3P 2MABA 2OCCH 3ECHA 1LFPA 3CCQI 4P5OA 4M3FA 1G3TA 1JKRC 4GRIA 3K1MA 3Q0VA 1XGMA 1OLTA 3V4GA 3BPXA 1S9HA 4E7HA 3H3UA 2A07F 2X1DA 3ZXSA 1QGPA 1TQMA 2DI3A 4AD9A 3S17J 3FMSA 3NQOA 3OL4A 4AIKA 2EV5A 1W1WE 2DA5A 2ZKZA 3RPUA 2B63J 2QBYA 2ETHA 5HS7A 1T0FC 3BDDA 1G3YA 3JRDA 5DM6F 3BPVA 3WU2C 2L01A 4IQJA 1S6LA 1UHMA 4BJ6C 2KQRA 2HQRA 1UHSA 4XSZF 2LBFB 3MN2A 3FWEA 4RB3C 1LQ1A 4BQAA 2DU9A 1MSFC 1KONA 3QQAA 1ZLJA 2EQRA 5L3GA 2L5QA 4CGZA 4J19A 2EV6A 5ED4A 3UKGA 2F4IA 1HA8A 1ZGJA 3WTXC 1FJLA 1MDMB 1AU7A 3AFHA 4E7ZA 5HDKA 3VYSB 2R7XA 1UMQA 3TOAA 2LYCA 5EEAA 2FX0A 1O7LA 5K7ZA 1WSUA 1K4TA 1UAAA 4JX5A 3IH2A 3SXYA 4HLYA 2K9MA 3SDGA 1SVOA 2V6EA 3I53A 5KCMA 2DFHA 4MTEA 2X4HA 1Z3XA 4PGHA 4NQWB 3ZQFA 3P7NA 1D8JA 2P81A 4WXDA 4AIHA 3WTUC 3V42A 1G59A 4KITB 2YU3A 5E1WA 5LEKA 2E1MB 2W00A 1XGNA 3IKTA 2DT7B 2NS0A 1YOVB 2JPBA 4XN3A 2QENA 2NS7A 3F8NA 3LSJA 2PMZN 3B6CA 2D1HA 4EM2A 3G6EI 5L3BA 4DZJA 4LK0F 4I6ZA 2EFOA 3FK6A 3KP7A 5FO5A 2Z99A 1OCTC 5FD5A 2VQCA 3BTLA 2KISA 1IO2A 1BR4A 2G7UA 3RKWA 1LFBA 2P7VB 1SMYF 4PGGA 1VQPI 2ZXWH 1MMDA 3HPGA 4L9NA 4KNYA 3BWGA 1RIOH 3ONQA 1WJBA 1MJBA 5LGTA 2EBIA 5CVUA 1MMGA 1BN5A 5JFRA 1LDDA 3FISA 3TMOA 4KIBA 3OYBA 4W1UA 2EINH 4RGSA 5BQTA 3JRIA 1ODDA 3KLOA 3BTJA 1TP4A 3V7SA 2A3SA 2W7NA 1T0FA 2HS5A 3FX3A 1TC3C 4PJNA 4NBQA 4YIIA 4EEFG 4ZH4F 3F8FA 5H2FC 2MD0A 2LY2A 3RTRA 2DTZA 3WTWC 1YX5A 3OSFA 1KQ9A 3HGGA 5ILUA 2EPFA 2RC4A 4RDUA 2F5EA 3DKYA 2FQ4A 5HS9A 5BNGA 4XLPF 3JRCA 1ZRFA 3LAPA 1P2FA 3WGHA 4P1WA 4QSHA 1TT5B 3CUQC 3IV5A 1Z1DA 1ZLKA 3LFUA 4A5MA 4PSWA 1HKTA 3R61A 3OYNA 4E4HA 4BJTA 3QPTA 3EQLF 1NG6A 5FD6A 5D5VB 1SD6A 3DTKA 3H9JA 4OMZA 4IHSA 3U1DA 2DMQA 2XF6A 1WI9A 2R5ZA 4XRFA 4A3LJ 5D5XB 3ZR8X 3BOQA 4RAYA 5JLXA 4LITA 2Y48A 2EIKH 1DP7P 3FBNB 4BEHA 3F0CA 2CUFA 3BP8A 5M5XJ 4I2OA 1Y39A 1K4SA 4M73A 2P0WA 4HA8A 3JTGA 1IV6A 2EZLA 4UB6C 3MKZA 1IF1A 3D5RC 1U5TA 3GZNB 4AC0A 3K70C 3DF8A 3VSKA 1Y8QB 3OR1C 2R7ZJ 2PFBA 2IS1A 1TQPA 3TW7A 2GQQA 5FB2A 1SD4A 2KP6A 3OIOA 2VT2A 1XG1A 2E5ZA 2HYGD 1I50J 2BY2A 4UB8C 3OYCA 4DYQA 2RQPA 2L7MP 1TWHJ 1K83J 1XCBA 1MNMC 2OZ6A 1VTNC 1VQMI 2PJRA 2K9LA 1NG7A 3F8BA 1ZK8A 3OWTA 2R7OA 3DEUA 4BHCA 1XD7A 4LG0A 2GLOA 4BQNA 2MH9A 3HG9A 2VC1A 1MBGA 1SVMA 2QQ8A 3VSLA 2AS5F 5F04A 2I8DA 4NHJA 1U9NA 1FTZA 4Y17A 2M7AA 4M9SA 3HOUJ 3LSGA 1OCOH 3KX2A 2JA6J 1AOYA 2KLOA 2M87A 4XSXF 1WPKA 2DMNA 2E71A 5HLGA 4F93B 5D8KB 4DIQA 3ULQB 4XLNF 2QSGX 1MJ9A 4UV8A 1HXDA 3WHCA 4RMNA 1Z05A 2GOMA 4A6EA 2ELJA 3N4MA 2ZJQF 3ZPLA 4O5VA 4IXAA 4U88A 2IGOA 3T8RA 2NOJB 2VE9A 2FNAA 4MTDA 2ZCWA 2WAQA 4L9JA 3TP0A 4ESJA 2Q2EB 3RJPA 1TWAJ 3RQ4A 2YU9J 3L09A 4BS9A 6PAXA 4OOIA 2NNYA 3QYBA 4JX6A 2M0CA 1EA3A 1LEAA 1VQOI 2PBIA 3K4MA 1VQ9I 5FKOA 2VODA 2OA4A 5FLXZ 3OYFA 2EV0A 1BIAA 2RVCA 5F64A 1H89C 5E20A 3KFWX 1WJAA 2V1DA 2XV4S 2K02A 1VQKI 3F9KA 1I1GA 3P9CA 2VBXA 4BQOA 1ZG3A 2LOOA 3IWFA 4HW0A 4LFUA 5DV5A 2ZMEA 4OIPF 3F8MA 4BE2A 4ZYDA 1XPXA 4H0EA 2NVUB 4ENMA 1PVEA 2NS8A 2Z3YA 4BL0B 4EVIA 2E7WA 4PFPA 4WF2A 3HOWJ 1S7AA 2WY7Q 3TW6A 2HOSA 1I6XA 3WTZA 1MNDA 1OYWA 3VODA 3OY9A 2E2HJ 3F23A 3BCAA 2HQ5A 2ZC2A 3E7LA 4MFEA 1RRJA 1E3OC 1WKMA 3RI4A 1E3HA 3GWZA 2F5FA 4LB6B 5E3MA 3OS0A 4UY8I 1K7AA 1YO5C 2E2IJ 4I02A 1RPWA 2FMLA 2ESHA 3GF2A 2VUMJ 1BR1A 1JT0A 4A0ZA 2Y0SN 1VZ0A 3KEOA 1VQLI 4A93J 1IGNA 2DOFA 2CUEA 2ZJ2A 2JA2A 3E5XA 2VKVA 4B09A 3DKWA 2CGPA 3GTQJ 4DQ2A 2F6CA 3OYKA 2ZMEB 1G4DA 2CMPA 2HU9A 1X1CA 4O6JA 3CCLI 2DJIA 3E1SA 2IRFG 3PJRA 2RAEA 1TNSA 2IJLA 1E2XA 3CC7I 1SD7A 1FTTA 4BE1A 3PNYA 5TISC 2K9SA 2IT0A 3VWBA 1N75A 3HXLA 3M1EA 3A01A 1G3SA 1A35A 4HLXA 2YR2A 1QZZA 2F48A 3L9FA 2PLYA 4R8HA 4RBOA 4EGZA 3BROA 3SEQA 3L7WA 2C6YA 1AWCA 1MIJA 4EM1A 2VQLA 4A3KJ 3LA7A 2RN7A 2P6SA 1LNWA 1XC5A 3M8JA 4NB5A 5K1YA 1I3QJ 4RGRA 2XPUA 3H36A 5JLWA 1YITI 4C3JJ 1B8IA 2WBMA 2XGXA 4LOCA 2P5KA 3RKYA 2PEXA 2K86A 3V7RA 2WV1A 2X1CA 3F21A 1ZTRA 5K7FA 5J1YA 5J4YA 1B72B 3IRRA 1SANA 4S0HB 2HEOA 4FHTA 4LJZF 2VBWA 2IPQX 3BG3A 2TCTA 2XAGA 1BI0A 3IKVA 1HDPA 4L5JA 3CTAA 4R1HA 2M4GA 1ENHA 1JT6A 1SFUA 2QA4I 1PYVA 5IP7J 1RETA 5M3FJ 4YIRX 2KIQA 1XGOA 4PK4A 1ZRDA 5E79C 2BY1A 2TRTA 3PIPF 3MKYB 1PUEE 4IHTA 2HQAA 4GCVA 4Q5SF 1ERDA 5M5WJ 3NWTA 2DPDA 4IQ4A 1N78A 1T2KA 2FBIA 3GTKJ 4U0VA 1Q1VA 3VYUB 3MFKA 2F4MB 3CUQA 1R1VA 3NWSA 2DBBA 3H3ZA 2X51A 2XC7A 1T39A 5HDGA 3ZQ7A 4IHXA 1IRZA 1O57A 3BQYA 2V9KA 2WAQN 2FBHA 3JRGA 2DT6A 1OKRA 3V7CA 3WGIA 3AKZA 1LE8B 4HDVA 4P55A 5EF6A 5DD4A 3CESA 3B02A 1Z21A 2KZVA 4FISA 3MKLA 1QPIA 5IP6A 4L0YB 2HR3A 2KFDA 2ICWG 3PSIA 3HYIA 5E3NA 4C2UA 2DFFA 3A02A 2OTJI 4N4NB 1RUNA 1YW9A 3U9GA 3ZMUA 3S2DJ 3C2GA 4IL6C 1QU3A 3BR6A 4OMYA 2LF8A 1QO0D 1DGWY 4BJ5C 3QPLA 3GFMA 4EV0A 4CA0A 3PNVA 5EGOA 3IHUA 2ISZA 4LLNA 2FOKA 4LLGF 3TP3A 4EJVA 1W7PD 2AXTC 2L7FP 2LFBA 2H8WA 2P7CB 2RGVA 3MZYA 2QQBA 3K2ZA 5F0CA 1QVTA 2MBFA 3CUOA 3Q9VA 1KYWA 3I4NJ 4C2TA 1WJ5A 2M5WA 1IC8A 1A04A 3UR3C 2HZTA 2OPTA 4LD5A 2STWA 2E7XA 2BOLA 3DBRB 3HM5A 2D2WA 2XIGA 3HSRA 2FQ3A 2STTA 2BBYA 5FKNA 1GUUA 1MBJA 4ZDOA 3E6MA 3MMYB 3HEFA 2HOTA 1JI8A 2X6YA 1OCZH 2DCEA 4YFXF 3R0AA 1ETQA 4PUSA 3VDXA 1Z91A 2JZYA 1HSTA 3CF2A 4HRIA 3I59B 1KQ0A 2V6CA 4XK4A 2Y2ZA 2RV8A 3HUGA 4FASD 4XLAA 1CQTA 1TWFJ 2HGCA 2QQ9A 4UUTA 4N0BA 1IN8A 3ZN0A 1TTYA 2GZWA 3ERED 1DU6A 1BI2A 1G3WA 2A6TA 1Z67A 2DQLA 2MG4A 4L9TA 4BYYA 3H0DA 2KJBA 3WTSC 4G6DA 4JYKA 2ZB9A 4M3GA 4D9JA 1K78A 1ZKGA 2DFIA 2HPMA 1VF9A 3G71I 4MQVA 1IN7A 4W97A 1ZR2A 4XRMA 2KDOA 2EB7A 4X6AJ 2Y9ZA 3GTPJ 1L0OC 1W0TA 1OR7C 2QLZA 4FCYA 2LY9A 3GTJJ 3NARA 2IVMA 2MLKA 1P7JA 4BGDA 2EZHA 2ACJA 1DPRA 3P9IA 4ESBA 5C4XJ 1J7KA 5HLIA 2ZXIA 2FBKA 3DFGA 4M6XA 1QQIA 2LTPA 4A3EJ 3HDDA 2OF7A 1MSEC 2MSYA 2PG4A 3C7JA 3MKWB 1ZH5A 3ZMTA 4LB5A 4BXFA 3LSHA 2KJCA 2VE8A 2Z33A 3BLYA 2ZO4A 5EZGA 4M3DA 5BPDA 4HBLA 2V1UA 2W84A 5K5RA 4EMSA 5LGNA 1JJ6C 2UXXA 3ABTA 2YSRA 1FC3A 2IS6A 3A0HC 4G7HF 2OQRA 3LFKA 4BY7J 3IRQA 3LSMA 3EUKL 3GLXA 3VYTB 4RB0A 5E1XA 5EG0B 3KETA 1FBSA 2P5VA 4I0BA 2RNJA 1YJNI 2EWNA 2DK8A 2YX7A 4XRSG 5HOOA 1H8AC 2XAUA 3LSRA 2EZIA 4PJJA 4MLOA 1P4AA 3EUAA 4X1EA 1SEUA 1B9NA 2E2JJ 4IRHA 4D0PA 3GTMJ 2M3AA 2VKEA 3LSTA 5IT9K 2XVCA 2R92J 2ISYA 3K4JA 4LK1F 2R7FA 3RQIA 2GWRA 4II2A 4CYDA 1Y1VJ 3HOYJ 2V1NA 2K7LA 3LOCA 2GOXB 1MH4A 3CMYA 3FXUA 5GAEJ 1MZBA 1ORKA 2NOGA 3QPHA 4RAGA 1K78B 3W2AA 2A5WA 4PZJA 1MBFA 3HRUA 4PSXA 5CVRA 4CYCA 4EGYA 5FLVA 1D8KA 2ZFUA 2VJ4A 1D0YA 3GTOJ 1LE8A 1O3TA 4XLEA 3HSFA 2I5UA 4F3QA 1NTCA 5BS6A 1RC9A 1WCMJ 5FLXK 2M9HA 2VASA 4CCJA 3L2RA 3WTVC 2W1OA 5IOZA 2X0LA 2K9NA 3GFJA 2FUG2 1G6NA 3DTIA 5F1RA 4G7ZF 5DCMB 4CH7A 1SFOJ 4ON0A 2G0EA 3WG9A 2XF7A 3IUOA 2V9VA 2LC2A 5H6QA 1OISA 2QBYB 2KZGA 2E1MC 2DA6A 3FBIB 1WHUA 5E8GA 4OIRF 4U87A 1APLC 2HVSA 4RB2C 2R7TA 1A6IA 5EGOB 1BC8C 1EH7A 2LRDA 2Z1DA 5C44J 1FPQA 3OIQA 4HSTA 2LBFA 2AO9A 5LBQA 2LY1A 4YEJA 3CMMA 1OCCH 3CO6C 3ZOBA 1KU9A 2V9PA 3QP5A 4ZC3A 2LVSA 2JA8J 1JJ8C 4A12A 4HNTA 3MEXA 2LF7A 5J1UA 1IDYA 4A2UA 2Q1ZB 3BZCA 5F1JA 4AVZA 3J81K 1MMNA 3HRMA 4FQGA 2O61A 3I9V2 3K69A 2CJJA 4AIJA 4PJ0C 4ZDLA 5DM7F 3TL4X 3F6OA 3X2QH 1AKHA 3TO9A 3IL2A 4RM2A 1B4AA 4UVCA 5K5OA 3RPUD 3HBLA 3TDUC 3FXQA 3OS2A 3DV8A 2QM3A 4NQWA 1TQIA 3HOZJ 1V55H 4HX8A 4YRVA 5D8LB 4Q48A 3BG6A 3I58A 2JK3A 1KA8A 2IA0A 2E19A 2V4JC 5FFZA 3JW4A 3K9TA 4UUVA 2HXOA 3D5SC 3BJOA 2MFZA 1B72A 1ZG5A 3PL8A 1VQNI 3H5NA 2M4KA 3VEPA 3I4MJ 4BH9A 3ELKA 2PMZA 2QSHX 4Y33A 3L2CA 3FHNA 2CRGA 5A2QZ 5H6RA 1FOWA 2CV2A 2K40A 3HOSA 2P5LC 3K1PA 3S3MA 2R7QA 2KMUA 5HLTA 4RLFA 3A4CA 2XF5A 1V54H 4WX9A 2LKSA 4GFBA 3WE2A 1L3LA 1I5ZA 3GO5A 1JKPC 1OYYA 4I0AA 4YFKF 3K4BA 4ITVA 5HNFA 1X2NA 1OYIA 5J8CA 4HF2A 1R5ID 1QZEA 2XAJA 3BTCA 1K6OA 5JHUA 5DUKA 4XMYA 2K5CA 3M4OJ 2BZTA 3VPRA 2K4BA 1J9IA 3GCMA 4PDKA 1MKMA 2M30A 2VPRA 3HHHA 3I54A 3CDLA 1DP3A 4BXXJ 1XN7A 3ZMSA 4ZDPA 1P4WA 3WHBA 2LP0A 3I3LA 1AHDP 4XKWA 3GZ6A 2VJJA 2TDXA 2A69F 2YUSA 2CQ7A 3QU6A 1FOKA 1T95A 3PFIA 3S3NA 1R58A 4MFDA 2PMHA 1O3SA 4OU0A 3C2BA 2ZBKA 3J7ZI 1J09A 3F72A 5GTIC 2CWEA 4HV5A 1YRNB 5GPCA 2X6XA 5M3MJ 1SFEA 4I01A 1R5GA 3S1RJ 4QTRA 3OR2C 3M9AA 1S5LC 2NVQJ 3T0YA 3ESWB 3BR0A 2HXIA 3U2RA 4WWCA 4A3JJ 1W5CC 1QZYA 2W25A 5ICEA 4CXFA 4TV7A 1BL0A 5LRSA 3PQJA 4Q4ZF 3CCUI 1LJ9A 3N05A 4IHYA 2M8GX 4BDYA 1ULYA 5DEQA 3DCFA 2P8TA 2X9DA 1XDUA 1OJLA 2BEOA 3U1KA 1D1BA 3HGYA 4DZPA 1N25A 1BJZA 3KEQA 4LMYA 2WAFA 2Z2SB 3ZQQA 4M9XA 3HUGB 5GADJ 1FP2A 4F92B 4KYWA 3EUHA 3E0JB 1JUPA 1R5HA 3OYEA 3O8GA 3JREA 2L02A 2G7HA 4N4OB 3GX4X 4MHGA 2J5PA 3KPHA 4B8XA 1YFHA 4ZYHA 2O03A 5FROA 3QOEA 2JTVA 4BNCA 1BM9A 1REPC 4LG0B 3BJ6A 3F6VA 2RDPA 4BHPA 1E17A 4QPOA 1X1BA 2D45A 3SZGA 3HTSB 1D1CA 1FMWA 1DU0A 3MQ0A 5LEJA 1BR2A 2XDVA 4AM3A 3K4KA 1R1UA 4BDZA 2QSFX 5B3SH 1WVRA 1WZ2A 1XMXA 2YX4A 2RNGA 1HW1A 1H9GA 2ZFWA 2OUMA 1WH5A 2YS9A 1G8XA 5ICCA 3QYEA 2UV1A 1FYKA 3E6DA 1ZHFA 1YLFA 2VIXA 3DBHB 2VOPA 4OAYA 1QRYA 5ICGA 2JN6A 5KHDA 1X1PA 3J80Z 3AG1H 3F8CA 1F5TA 4J01A 3S32A 3BR5A 1T38A 2VXZA 4NC6A 4HSRA 1EJ9A 3DEEA 5EZHA 2O8XA 1FT9A 3RYRA 3W6JB 2OTLI 3NAUA 2GA1A 1GXPA 4HX7A 1VI0A 2HKOA 4BBRJ 1I6HJ 1USTA 2I10A 4OINF 2WY8Q 3DQVC 1CF7B 3DLAA 1R4MB 2MGQA 4XRSA 4IEJA 2CQXA 2KIUA 4G6TB 1UCRA 3A03A 3DBLB 3E5QA 4UVBA 1D0XA 1MMAA 5AIPA 5GP9A 4HQMA 2DA2A 1CGPA 1WWXA 1IG7A 4CSWA 2COMA 1WJDA 5DYMA 2IGMA 3S15J 2CUZA 1T8IA 1JUSA 4E7KA 3K4LA 4A3BJ 1FIAA 4ZYGA 2GXGA 1P4XA 2EH3A 2Y75A 3ZQIA 2XGEA 4GYGA 4KN7X 3PUFA 4P96A 2VPLA 2H27A 1Z7UA 2B9SA 3OYDA 1VQ4I 4WXCA 1AA7A 1NHAA 2DDAA 3NRVA 3AL0C 1S7OA 2LG4A 4EQQA 1OPCA 2EIJH 5IOYA 1JGGA 2DXIA 1LDJA 5LGUA 1U5TB 2BV6A 2CQQA 3K2AA 5CVJA 2ELKA 3AG4H 5DCMA 1WGXA 2M8EA 5LFAA 2IA2A 1USSA 2X6OA 3CLQA 3KYDB 5CLSA 1IXRC 5JHFA 1D5YA 2ECBA 4AVPA 1V5EA 4XBFA 1HDDC 3DLLF 4UVAA 4WXHA 3B6AA 2BW3A 3S93A 4CHUA 4WCGA 1X3WB 4BEHB 4A3DJ 3J81Z 2IA1A 3A2KA 1U0JA 2QQAA 2QCOA 1LPQA 4HF0A 5DDGA 2WTEA 2XPVA 4MEYF 5EEHA 1X4OA 2F2EA 3I5UA 4N9IA 4PCQA 1WJFA 4IRGA 2LMDA 4EJOA 1UZCA 2LLKA 2XAFA 3EYYA 3O3KA 1QPMA 4GO1A 4YELA 2WB1A 3MCZA 2QKLB 2DMUA 3J80K 3ABUA 1XS9A 1P7IA 2VT3A 2DPUA 3FKJA 3H1CA 4A3MJ 2MW8A 1SC7A 2HFHA 2XAQA 1Y6IA 3HRTA 4PJMA 3KP5A 1PP8F 2NXNB 1I3AA 3TBIA 2L9VA 1W36D 2HQNA 1HW2A 1OQYA 4CICA 1VQ5I 3CC4I 3DU6A 4C3IJ 1A6QA 1YG2A 4ANJA 3GZ5A 4HPQA 3Q0WA 3U21A 1NK3P 2QZ8A 3ZRGA 4LG3A 4XLHA 3FDYA 1WJEA 2KRHA 4JP0A 4XR6A 2L9RA 2HOAA 2VQHA 3NEUA 2OU2A 3M8FA 4HF1A 2DJNA 2CH0A 5FFXA 2HVRA 1W36C 3HZJA 1FLIA 4RB1A 3HOXJ 3BG5A 3ZMVA 4XQFA 4UNOA 4BBSJ 1BC7C 2DW4A 3FXKA 3R6SA 4P9FA 4MO7A 5GPAA 1W7PB 5D5WB 3GMEA 4ZZLA 2PJRB 2OQGA 1J5YA 2XAHA 1N77A 3S8PA 4M3BA 1V5GA 2UZKA 2V1XA 3TEDA 3I64A 4U0WA 2XUBA 4M71A 1OCRH 4CUGA 2OBPA 1GXQA 2DT5A 2RREA 3I59A 2V7FA 2KHMA 2GXAA 3PM1A 3BZ6A 2ZNZA 2BY0A 4DBRA 5HODA 1Y0UA 3FMQA 4ASNA 5KAIC 4QIWN 3J7AY 1YJ9I 3AG3H 2QKMB 3BY6A 1YX3A 3CDIA 1RESA 3TGNA 1YRNA 2DLLA 4EJWA 4IPAA 2NVTJ 3HIFA 3PQKA 3JSOA 5B5EC 1YIJI 1TNTA 5J4VA 4KT5C 1ACIA 1GV2A 2NVYJ 4KISA 2J5OA 1KQ8A 1GLNA 3PNTA 5K5QA 3PIOF 2E60A 1IXCA 3L2WA 2HI3A 2DA3A 2BGCA 1Z77A 1I39A 1LKXA 2X48A 3KIOA 4E70A 2F5VA 2ZSIB 5CPRB 3ABLH 2X1EA 5HVQC 5EG0A 1VFCA 1MGTA 2EA2A 3LA2A 2DO7A 2FEZA 3ML6A 1TWGJ 2CFXA 1S7EA 2PN6A 4IHWA 4EJUA 1YI2I 4D1QA 1P6RA 1XB4A 2O0YA 4G8XA 4O3MA 1FEXA 3QRFF 2IAIA 1IAWA 4H4KC 3DPLC 1D3YA 2MC3A 1UHWA 2DDBA 4UXNA 1G2HA 2NAZA 2FRHA 1MBEA 1B9MA 2NNNA 4Z2YA 1H0MA 2VXDA 3CQZJ 1TBXA 3OL3A 4I7HA 3SEZA 3IWZA 4U0YA 4BUPA 3FM5A 1MBKA 5L3FA 2OAZA 4G94A 2H94A 5DD8A 3CCRI 2XGDA 5LLQA 2YPRA 5K7HA 3KYLA 3JTHA 3HJEA 3KLNA 1U6GA 4UV9A 1W5TA 3GEZA 3WU0A 3OS1A 4HYEA 2E5NA 2VBYA 1MW7A 3CP8A 3SQNA 4B3AA 4S05A 2F5CA 3JSPA 1ZARA 2V26A 2XB5A 1K6YA 3DEWA 1YHQI 1HKSA 2R4GA 1BI1A 1XSXA 4F7ZA 1MDMA 3L2VA 4ZJZA 2AXLA 2ZMEC 3SFIA 1DQUA 1T98A 4NNJA 2L9SA 3LWFA 4XM3A 3SZPA 2JQ7A 2BHZA 4XKBA 2CQNA 3DTEA 3KZIC 3G1OA 1Z6TA 5FRMA 2HOEA 2JVHA 2DYRH 2ID6A 1OR7A 2DA4A 3I4PA 4J00A 1SFKA 3OYHA 2ZJPF 1XMAA 1U9OA 2V79A 2L4AA 4MQ9F 1O7FA 4FETA 1ONVA 2XB0X 3N97A 4ZTFA 3REOA 3E97A 3OSGA 2VJ5A 3FZVA 2COBA 4BKXA 3BR1A 2A5YB 4RA2A 3Q5FA 1DUXC 1XGSA 3LSIA 1S8NA 2KRFA 5E3OA 4M72A 1SD5A 1ZG1A 4LIUA 3GFIA 1TT0A 2WAEA 1K61A 3HOVJ 2ADUA 2H1LA 2DOEA 5JVGF 2CV0A 3R60A 1KZHA 5ICFA 1ZYRF 1A31A 1RKTA 3ZCOA 2VBZA 2G9WA 2QGUA 3DXJF 2UWMA 3GTLJ 4DGWB 2EA4A 2L0KA 1IRFA 4IX7A 3I0TA 2CUJA 3CUQB 1Y8RB 4XKCA 2F5DA 4Y13A 1WFXA 4A0XA 5GAGJ 2XPWA 3GBGA 2BE5F 1I27A 3VYRB 1LB2A 1R22A 1LDKB 1ZELA 2M0MA 2L4MA 2VKDA 1KGSA 2HKXA 3CCJI 4BAYA 3GUDA 4JBAA 3DU5A 2R7DA 1IUYA 3WGGA 4HQEA 5B1BH 2M34A 3QP6A 2VOOA 3HPHA 1C0WA 2M7BA 3PFYA 2N8GA 1HSJA 3EPZA 2W24A 2JA5J 3BG9A 4Y4RA 2ZSHB 2IW5A 4KJZA 3SHFA 1DPUA 2P6TA 4Y15A 1XX5A 2JSCA 4LLLA 1VQ6I 4II3A 4D7NA 2XKOA 1QA6A 3M7GA 1TL8A 1NH3A 4HAMA 2ME0A 5F08A 3WE3A 4AIDA 2DN0A 4G9YA 2GXBA 4N9HA 2H6CA 3W6KB 2ID3A 2FMYA 2HYFA 2O7OA 3OYAA 2O5RA 1X58A 5FLMJ 4BQQA 1UG2A 1B8IB
chains in the Genus database with same CATH topology
4BL0B 4PFPA 5LD2C 1T95A 2WY7Q 4PJLA 3IAM2 3S3NA 4LIVA 4CCMA 2JSPA 1MNDA 3D5LA 3OY9A 1J09A 3BCAA 4NC8A 3OS0A 2X6XA 2X85A 1BR1A 1TZLA 4IZZA 3OR2C 4QPQA 4HEA2 1P9QC 2LREA 4DBQA 4XLFA 1VZ0A 3K10A 3H9QA 4IKFA 2JA2A 5CQGA 3N05A 2L9NA 4CCKA 4BDYA 2F6CA 3OYKA 2CMPA 2HU9A 1X1CA 2DJIA 3E1SA 3IAS2 2DOAA 3PJRA 1D1BA 2RQQA 2VJIA 4F91B 4BE1A 3HC7A 2X6WA 2WAFA 1R6RA 2Z2SB 3PNYA 3ZQQA 1D1AA 3HUGB 4F92B 3VWBA 1N75A 1Z3YA 3E0JB 3HXLA 3PSFA 4NUBA 3OYEA 1Z7LA 2HPIA 4N4OB 4XOTA 3H9GA 3CZ6A 3LMMA 1QHGA 5FROA 3QOEA 3A1YA 3SEQA 4BU2A 2IXSA 4XLCA 2VB6A 4B44A 3LL7A 2VQLA 4QPOA 1Y56A 3EUHC 2KL4A 1X1BA 3LSKA 4B43A 3CP2A 4C30A 3SZGA 3M8JA 1D1CA 1FMWA 4X0GA 1BR2A 2XDVA 3K4KA 3K70D 3OIPA 2BVLA 4BDZA 3QYFA 1X4PA 2RNGA 3L2UA 2WBMA 2MYSA 2OUMA 1G8XA 2R7WA 2XSJC 3QYEA 1UELB 2UV1A 4C9YA 2X1CA 2BW3B 2VIXA 1UG0A 3DWLE 4OAYA 5KHDA 2R7VA 2WADA 4ZTJA 5HNHA 4OWRB 4J01A 4XN0A 1SAUA 3S32A 4E7LA 2AQEA 2M4GA 1PYVA 4JOMA 2VXZA 4HSRA 2IGNA 3DEEA 4PK4A 4E7IA 3S3OA 4XKVA 3MKYB 3HKZA 2KRCA 3UNGC 2HQAA 2KPMA 2HNHA 1ERDA 2W82A 3NWTA 2UUZA 4IQ4A 2WY8Q 3CJQB 3DQVC 1N78A 3DLAA 4NC7A 4HNUA 4G6TB 5TGTA 1PJRA 3VYUB 1D0XA 1MMAA 3L2QA 3NWSA 4OAZA 2X51A 2XC7A 4CSWA 1WJDA 2IGMA 2V9KA 3OYJA 4KT6A 3RCOA 2CUZA 2CFOA 3OYIA 2DT6A 3DKXA 4E7KA 3K4LA 2W4SA 3AKZA 2L7KA 1BOBA 3CESA 1Z21A 2KZVA 4AU7A 5KNLA 2JUGA 2IS2A 2VPLA 4RLQA 3PSIA 4XL9A 4XORA 3OMYA 4C2UA 4CCNA 3OYDA 1AA7A 4N4NB 3AL0C 1QHHD 2LG4A 3C2GA 1QU3A 1LVKA 1DGWY 4BJ5C 3KEYA 2DXIA 4Y3OA 3HL2A 2R7RA 4CA0A 5LFAA 2MABA 3PNVA 5JHFA 3MD2A 1LFPA 1V5EA 4P5OA 4GRIA 1OLTA 3K6GA 2BW3A 3S93A 1S9HA 4E7HA 2X1DA 3ZXSA 4BEHB 2L2OA 4C2TA 3OL4A 3W2WA 3A2KA 1U0JA 1WJ5A 2OV7A 3UR3C 1T0FC 2BOLA 1X4OA 1WJFA 1D0ZA 4YELA 2WB1A 2QKLB 4ZDOA 4IQJA 4HG2A 3MMYB 2KQRA 4BJ6C 1JI8A 2X6YA 3FKJA 2DCEA 2LBFB 4PJMA 1Y6IA 4PUSA 3VDXA 3PUBA 3CF2A 3TBIA 4HRIA 1W36D 4FASD 2HZDA 2CW7A 4XLAA 2IS4A 2CW8A 1X1AA 1KONA 2L5QA 3DU6A 4R79A 2A6TA 3H0DA 3CJRB 2F4IA 4ANJA 1HA8A 4HPQA 3U21A 3ZRGA 4LG3A 3AFHA 4XLHA 3FDYA 4D9JA 1WJEA 3VYSB 4E7ZA 2KRHA 4XR6A 2HPMA 2R7XA 3W3CA 2VQHA 2LYCA 4E6KG 2CH0A 1UAAA 1X19A 3QODA 2KDOA 2HVRA 2K9MA 4B48A 1W36C 2V6EA 3BC8A 5KCMA 1OR7C 1Z3XA 4NQWB 4XNFA 4XQFA 3AL0B 4PFOA 4BGDA 3V42A 2ZXIA 4KITB 1G59A 2PJRB 1N77A 4DOZA 1MNEA 2E1MB 3S8PA 2W00A 4B47A 1V5GA 2DT7B 3MKWB 4XN3A 4BXFA 3LSHA 3BLYA 4CUGA 5FRNA 5CKTA 2VLAA 2RREA 2IS6A 2V7FA 2KHMA 2VQCA 4EATA 4DBRA 3SDBA 3LSMA 3EUKL 1BR4A 3OOUA 3VYTB 4CZCA 3J7AY 3OYMA 2QKMB 1YX3A 1MMDA 3HPGA 5HOOA 3ONQA 2R7UA 1WJBA 2XAUA 4BE0A 4PJJA 4MLOA 3EUAA 2HVQA 2Y0SA 1MMGA 2M3AA 4KISA 3TMOA 3OYBA 4F55A 3DPTA 1GLNA 3K4JA 3PNTA 2CS3A 2E60A 3IP4B 3L2WA 4II2A 2W7NA 1LKXA 2V1NA 4BACA 2ZSIB 2F5VA 2GOXB 4PJNA 5CPRB 2X1EA 5HVQC 4E7JA 3W2AA 2A5WA 2MD0A 1FMVA 2LY2A 3RTRA 4RM3A 4E7SA 4PSXA 3W2VA 1YX5A 2AQFA 2ZFUA 2ZXHA 3OYGA 3DKYA 2VJ4A 1D0YA 4B3XA 4XLEA 4P1WA 4F3QA 4D1QA 2VASA 3LFUA 4CCJA 3L2RA 4PSWA 4H4KC 2W1OA 3DPLC 2FUG2 3HOTA 3OYNA 3DTIA 4E4HA 5CQEA 4BJTA 3G2BA 4CH7A 2VXDA 1NG6A 2Z16A 1V5FA 3DTKA 3H9JA 3OL3A 3SEZA 2XF7A 3IUOA 4BUPA 2LC2A 4U7BA 3M1CA 2XF6A 2E1MC 2VL8A 1DGRM 2VQGA 3FBIB 3KYLA 4U87A 2HVSA 3ZR8X 4LITA 3OS1A 2R7TA 2E5NA 3FBNB 3CP8A 1MW7A 4BEHA 2Z1DA 2LRDA 2V26A 2P0WA 1K6YA 3OIQA 3MKZA 4HSTA 2R4GA 2LBFA 2JVGA 3D5RC 2LY1A 3K70C 3L2VA 4YEJA 3C2HA 3CMMA 3SYTA 4CCOA 4ZJZA 3VSKA 4ZC3A 1DQUA 4NNJA 2L9SA 4XM3A 4AYBA 4XKBA 3OR1C 3H35A 3DTEA 4HNTA 5FRMA 2JVHA 2IS1A 3K4CA 2Q1ZB 4CCLA 4AVZA 4J00A 2KP6A 1SFKA 1MMNA 2E5ZA 2K3PA 3OYHA 3I9V2 3BCBA 3OYCA 4FETA 4ZDLA 3TL4X 4ZTFA 2VJ5A 2PJRA 4RM2A 2K9LA 3RPUD 1NG7A 3LSIA 3OWTA 2BVMA 2R7OA 3OS2A 4BQNA 3HG9A 3OYLA 4LIUA 1TT0A 3VSLA 4ZYAA 2WAEA 2I8DA 2CV0A 2LH9A 4YRVA 4DJAA 2M7AA 3ZCOA 3BG6A 3LSGA 3KX2A 2V4JC 2KLOA 2UWMA 4DGWB 3D5SC 1X1DA 4IX7A 2MFZA 3H5RA 4F93B 3PL8A 2CUJA 4DIQA 3H5NA 2M4KA 4XKCA 2PMZA 1WFXA 3GBGA 4Y33A 3BG7A 2WA0A 3FHNA 3H5AA 4RMNA 2GOMA 3VYRB 2ELJA 1LDKB 1ZELA 2M0MA 2CV2A 2VKDA 3HOSA 3S3MA 3K4NA 2R7QA 2KMUA 5HLTA 4RLFA 3A4CA 2CV1A 3DU5A 2XF5A 2IGOA 2NOJB 2VKHA 3RSNA 3HPHA 4XONA 2WAQA 2M7BA 2Q2EB 3K4BA 3PFYA 4ITVA 1IRXA 5HNFA 3RQ4A 3EPZA 4BS9A 3QYBA 2HDWA 4Y4RA 2ZSHB 1EA3A 4XOPA 1WJCA 4KJZA 2K5CA 3K4MA 4XMYA 3ZGKA 4F52A 1YE9A 4II3A 3OYFA 2R7SA 4JQFA 1WJAA 2OC6A 1DP3A 3F9KA 3DPUA 4ZDPA 4BQOA 2LOOA 3OYAA 3I3LA 2O5RA 4XKWA 4BE2A 1E0EA 2IGKA 2VJJA 2MC4A 4BQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMY A;  4QPO A;  1DP3 A;  4QPQ A; 
#chains in the Genus database with same CATH topology
 3JAM K;  1T56 A;  4C3H J;  3RKX A;  4B1R A;  4JK1 X;  2F4O B;  3IAM 2;  1XDS A;  2EZK A;  3MWM A;  4LIV A;  4CCM A;  4BY1 J;  1IW7 F;  4DYC A;  2IBD A;  3L1P A;  2ZJR F;  3I56 I;  1BW5 A;  4A3G J;  4G7O F;  3CJT B;  5BPI A;  2JWT A;  5IT3 A;  2QWW A;  2X85 A;  2DOD A;  4IRI A;  1TZL A;  4OIO F;  5GAH J;  4IZZ A;  3ABK H;  4IVN A;  4QPQ A;  3TOB A;  1ETV A;  1EH8 A;  4HEA 2;  3K10 A;  1FP1 D;  3H9Q A;  1FNN A;  4MEX F;  1IRG A;  4IKF A;  5EDN A;  3GW2 A;  1GVD A;  3SJM A;  2BHY A;  3FHZ A;  2FSW A;  2KIM A;  2FJ1 A;  3LA3 A;  3QOP A;  2A61 A;  3IC7 A;  3VFZ A;  4CCK A;  2XKP A;  1FOX A;  1B59 A;  1FBQ A;  4FE4 A;  1U2W A;  3SFZ A;  1TW3 A;  3COA C;  1J2X A;  2ECC A;  3I71 A;  1FZP B;  2VI6 A;  5TRD A;  1S3J A;  5HDN A;  1XSD A;  5IPA A;  2JRT A;  3HC7 A;  5TJJ A;  1R6R A;  2WV0 A;  1D1A A;  1ETK A;  5FKL A;  3ASO H;  2CU7 A;  3QPS A;  1Q1H A;  1Z3Y A;  2O6G E;  3PSF A;  4NUB A;  2XAS A;  1FIP A;  4XIC A;  3ZP5 A;  3CMA I;  3O8H A;  4A5N A;  4XOT A;  3H9G A;  1ZN2 A;  3CZ6 A;  1JGS A;  4XID A;  2OJE D;  2CO5 A;  3A1Y A;  5CJ9 A;  3S14 J;  2IXS A;  4IJA A;  1IN6 A;  4B44 A;  2M2E A;  3LL7 A;  4RGX A;  3GTG J;  3HB9 A;  1Y56 A;  3EUH C;  3LSK A;  3AG2 H;  4B43 A;  3CP2 A;  2IEK A;  5IP9 J;  5L3E A;  3OIP A;  5D4S A;  2DAO A;  4FX4 A;  2WB1 N;  1J59 A;  1B1B A;  1LUJ B;  1M1E B;  3L2U A;  1Z9C A;  2R7W A;  1YW7 A;  2QF7 A;  3E3V A;  5JR3 A;  2E35 A;  1IV8 A;  2NRA C;  1F43 A;  4ENK A;  4KFC A;  2WAD A;  3BQZ A;  4ZTJ A;  1JKO C;  1EF4 A;  5HNH A;  2JA7 J;  4XN0 A;  1SAU A;  3H92 A;  4E7L A;  2AQE A;  5IY5 H;  2NVX J;  5HS8 A;  2O8K A;  1X3Z B;  4IOC F;  4JOM A;  4GGG A;  1HW5 A;  3BZK A;  2IGN A;  2RKH A;  2KRC A;  3UNG C;  3M3Y J;  4L9V A;  2HNH A;  2GAU A;  2W82 A;  2XRL A;  1TLH B;  2GA2 A;  1XMK A;  1UJ8 A;  1QNT A;  3CJQ B;  2R5Y A;  3Q9S A;  5E17 F;  4I76 A;  1ITY A;  3K1N A;  4NC7 A;  3S16 J;  4HNU A;  1PUF A;  5LHG A;  2FE3 A;  4ENN A;  3A0B C;  1KYZ A;  3L2Q A;  3F3X A;  2KDZ A;  2VC0 A;  1WQ2 A;  2GM4 A;  4OAZ A;  2Q2E A;  3BR3 A;  3M8E A;  1POG A;  4M74 A;  4ETS A;  1F4K A;  4D7M A;  3S1M J;  4KT6 A;  4FE7 A;  2CSO A;  2CFO A;  3OYI A;  5J3L A;  1W5S A;  4OIQ F;  3QAH A;  2K4J A;  2CYY A;  3GFL A;  1VND A;  4AU7 A;  1FOY A;  2IS2 A;  2JUG A;  4IF4 A;  2EFQ A;  3W6V A;  1GV5 A;  4RLQ A;  1BIB A;  4XL9 A;  5EEG A;  2O9L A;  1U8R A;  1ZRE A;  3G4S I;  1R23 A;  2H09 A;  2HTJ A;  2M1B A;  3T8T A;  5DCF A;  1HKQ A;  4GDF A;  5JVT A;  3ZQC A;  1XTA A;  2A05 A;  1JUM A;  1XCV A;  2FA5 A;  2JPC A;  3CJN A;  3RDI A;  2R7R A;  3WG7 H;  1QVU A;  3HTU A;  2DMT A;  2HDC A;  3MD2 A;  2K3F A;  3G1L A;  3D0S A;  2DTR A;  5HLH A;  3K6G A;  2EFW A;  1LFU P;  4HV6 A;  1BOA A;  3GLL A;  2L2O A;  3W2W A;  1P92 A;  3A01 B;  1HBX G;  2OV7 A;  2R93 J;  3QU3 A;  1D0Z A;  4A6D A;  4DW6 A;  4YFN F;  2Y69 H;  1R71 A;  1FWZ A;  1GVJ A;  2VN2 A;  4MNU A;  4HG2 A;  5LRR A;  1S29 A;  2L3D A;  5FKK A;  3VOE A;  5F0H A;  1R00 A;  3PUB A;  1RZ4 A;  1KU7 A;  2HZD A;  2CW7 A;  3SZT A;  3JRB A;  5AIQ A;  2CW8 A;  3G73 A;  2IS4 A;  1X1A A;  3L00 A;  3ZMZ A;  2R3S A;  4UUS A;  1SAX A;  3FXM A;  1T6S A;  4JX4 A;  4R79 A;  1JTX A;  2O3F A;  1EKE A;  3CJR B;  1J0R A;  2M45 A;  4G12 A;  2CW0 F;  3HKZ N;  2QVO A;  3TO7 A;  3CCV I;  3W3C A;  3FM3 A;  4ABZ A;  4E6K G;  4C2M J;  3S2W A;  1X19 A;  3QOD A;  3ZQG A;  4EJT A;  2GBY A;  4B48 A;  2D1V A;  3BC8 A;  3ZQH A;  1IJW C;  5BMZ A;  3KZZ A;  4YIF A;  2EFN A;  5E1Z B;  4XNF A;  3AL0 B;  2ELH A;  4A3F J;  4PFO A;  5M5Y J;  1DDN A;  1LEB A;  2W57 A;  2QEX I;  2DA7 A;  1HLV A;  1JTY A;  1OMI A;  1SMT A;  4B4C A;  2FU4 A;  3PO3 J;  1SVL A;  2GIZ A;  5ILS A;  2LNB A;  4CO8 A;  4DOZ A;  1MNE A;  2H1K A;  4B47 A;  3TQN A;  3CF5 F;  4KIG A;  3JRH A;  1T08 B;  5EYR A;  3FMR A;  4GYI A;  3D1N I;  2VON A;  1YQA A;  2UXN A;  2LD5 A;  5FRN A;  4AWX B;  2DMP A;  3FXO A;  5CKT A;  2VLA A;  5IT9 Z;  2JJ7 A;  5DTD A;  2JMW A;  1JHF A;  5D6F A;  1BW6 A;  2PQ8 A;  4EAT A;  2EK5 A;  3RPQ A;  4L5I A;  4KUM A;  1ETX A;  3GVA A;  2E34 A;  3SDB A;  3OOU A;  4K2E A;  2H6B A;  4CZC A;  3BT9 A;  3OYM A;  1F1Z A;  2WWY A;  3KYC B;  2JUC A;  4CDG A;  2Z5U A;  3HSE A;  1IN5 A;  4A69 C;  1PP7 U;  2R7U A;  1IXS B;  3P5J A;  4KMU X;  4I99 C;  4BE0 A;  1JKQ C;  1S72 I;  2Y0S A;  1RR7 A;  2HVQ A;  1R36 A;  1KU3 A;  1Z6R A;  2JT1 A;  3MVP A;  4HOB A;  4F55 A;  3DPT A;  1FBU A;  3KP2 A;  2LKX A;  1B6A A;  3RKQ A;  1PDN C;  2CS3 A;  3IP4 B;  3MAJ A;  5FGM A;  3CME I;  1H88 C;  4V19 K;  2K9Q A;  3MZ8 A;  4BAC A;  1J75 A;  1U3E M;  1ZRC A;  3TO6 A;  5D5U B;  1I1S A;  3CO7 C;  3E5U A;  4E7J A;  2A68 F;  1ETY A;  1BI3 A;  1FMV A;  4KIC A;  4RM3 A;  4E7S A;  1RNL A;  2K85 A;  3W2V A;  2AQF A;  2OZU A;  2ZXH A;  3OYG A;  1U5T C;  3Q3S A;  4B3X A;  3ZMD A;  3M07 A;  3ISP A;  3LQQ A;  1F36 A;  4P9U A;  4M6V A;  2P4W A;  5J6X A;  3T1B A;  1BJA A;  5L3C A;  3HOT A;  2IP2 A;  5CQE A;  3G2B A;  5E3L A;  1U78 A;  1JXS A;  3R4K A;  2Z16 A;  3VB2 A;  1V5F A;  2BXZ A;  2HTS A;  4U7B A;  3H3V K;  3M1C A;  1OCP A;  4HX4 A;  1V4R A;  3QWL A;  2VL8 A;  1DGR M;  2FOW A;  2VQG A;  3BTI A;  2KKO A;  5L3D A;  2Q8K A;  2XRN A;  3FK7 A;  3TKY A;  3JR9 A;  4LGW A;  5KAF C;  2JRM A;  2JVG A;  1FSE A;  2E1O A;  4Y52 J;  3C2H A;  3SYT A;  1ZGA A;  4CCO A;  3KCC A;  1HCR A;  3JRF A;  4AYB A;  4KMF A;  3H35 A;  1Y0N A;  3V8L A;  2Y9Y A;  1X2M A;  1W7P A;  3C3W A;  4NDL A;  1HF0 A;  4M9Z A;  3S2H J;  3K4C A;  4RS8 A;  1MBH A;  4CCL A;  4WK8 F;  1BA5 A;  1WRJ A;  2K3P A;  3ROU A;  5B66 C;  1MJA A;  3BCB A;  1R4N B;  5A2Q K;  5D6E A;  5JI6 A;  1EH6 A;  1VQ7 I;  3K7A J;  4EM0 B;  1VQ8 I;  4D5C A;  5J1R A;  1XSV A;  2E1N A;  4DNC A;  4I09 A;  2EIM H;  2BVM A;  2PX9 A;  5CVI A;  3KP4 A;  1YTY A;  3OYL A;  3CDH A;  2R5Y B;  1YW8 A;  4ZYA A;  2DK5 A;  2KIF A;  2LH9 A;  4DJA A;  2ZXJ A;  3WTY C;  1MMS A;  4ZYE A;  4HNV A;  4CYC B;  2ZNY A;  1W4M A;  4IHV A;  1U8B A;  4ENJ A;  3K0L A;  1X1D A;  3H5R A;  2DA1 A;  2DQR A;  5EJC A;  1WI3 A;  3RZD J;  5B1A H;  3OV8 A;  4Q47 A;  4RGU A;  1RR8 C;  1HOM A;  2R0Q C;  1IUF A;  1WH7 A;  3BG7 A;  2WA0 A;  4Y7N J;  3H5A A;  3CCM I;  3MZH A;  2A6E F;  3KZY A;  1ETW A;  2FD5 A;  3K4N A;  1HQC A;  1ON1 A;  3S1N J;  2CV1 A;  1JE8 A;  2D5V A;  2VKH A;  3G3Z A;  2LDU A;  3RSN A;  2BXY A;  3KP3 A;  4XON A;  3ERM A;  1IDZ A;  2XHK A;  4S04 A;  3ZQL A;  1PUF B;  1IRX A;  2MD5 A;  1GDT A;  3HHG A;  3WOD F;  2EFP A;  5KK1 A;  3CCS I;  3S1Q J;  3C1D A;  1K79 A;  2HDW A;  1QBJ A;  4XOP A;  1ZAO A;  1WJC A;  3EET A;  1RI7 A;  3Q0U A;  5F6F A;  3R0J A;  3ZGK A;  3LQR A;  4F52 A;  1A5J A;  2CQK A;  1YE9 A;  3CCE I;  1X3U A;  4AYB N;  3KP6 A;  5IYB J;  2R7S A;  1STZ A;  1D5V A;  1IZ1 A;  1R7J A;  5J47 A;  2DFE A;  3CD6 I;  1SFX A;  4JQF A;  4A0Y A;  4A3I J;  1CF7 A;  3RZO J;  2GIV A;  2OC6 A;  2E36 A;  3DPU A;  5ILV A;  4GXO A;  4DYR A;  2K27 A;  1TWC J;  4CZZ A;  2HWV A;  1FX7 A;  3BR2 A;  4IO9 F;  2PJP A;  1MD0 A;  2LR8 A;  1E0E A;  2IGK A;  4ESF A;  2MC4 A;  1AKH B;  1KU2 A;  3LAJ A;  3EYI A;  5F27 A;  2ME6 A;  4QLC U;  1IN4 A;  4HDU A;  2HYJ A;  5LD2 C;  1T33 A;  4PJL A;  1FSH A;  2JSP A;  3D5L A;  1BBY A;  1YS7 A;  4UHT A;  3OOP A;  3CLO A;  2B0L A;  4ZZD A;  3CC2 I;  1HC8 A;  5DS9 A;  1H9T A;  1UFM A;  5J8F A;  4NC8 A;  5GTH C;  2CG4 A;  4M3E A;  4KN4 X;  1P9Q C;  2LRE A;  4DBQ A;  4XLF A;  4KDP A;  2L7Z A;  3E6B A;  5DUI A;  2QUF A;  5CQG A;  3LSP A;  4L18 B;  1E3P A;  2L9N A;  5AON A;  1GHC A;  5C4J J;  3J7Y J;  3F22 A;  2Z9O A;  3O6B B;  3BJA A;  4I98 B;  5KVR A;  2L54 A;  1RUO A;  3IAS 2;  2DOA A;  4IOA F;  4KIF A;  3TDZ C;  4YG2 F;  2RQQ A;  3P9K A;  4QWQ A;  3RYP A;  5BOX A;  1A36 A;  2VJI A;  4F91 B;  3GXO A;  2FF4 A;  1EV7 A;  2X6W A;  5J40 A;  2MLG A;  3V8J A;  3G1M A;  3GYH X;  3ABM H;  2XSD C;  1Z7L A;  4UUS B;  4Z6Y A;  2HPI A;  2Y31 A;  3PO2 J;  2A6H F;  3LMM A;  1O4X A;  1QHG A;  5C3E J;  3J7A O;  3FXR A;  2EIL H;  4BU2 A;  4XLC A;  3JAM Z;  2VB6 A;  1ZR4 A;  1ETO A;  5D4R A;  4G6Q A;  3EDP A;  3ASN H;  1UB9 A;  2KL4 A;  3C18 A;  3HRS A;  5CVV A;  4C30 A;  3CCY A;  4X0G A;  2FNP A;  1FYM A;  3O2P E;  4HZF A;  4FT8 A;  3K70 D;  2BVL A;  1YYV A;  2PMU A;  3QYF A;  1X4P A;  4BHB A;  1GT0 C;  2MH2 A;  3B73 A;  2MYS A;  3WU1 B;  1O3Q A;  3FF5 A;  5IYC J;  2QYO A;  2XSJ C;  1UEL B;  1V3F A;  4C9Y A;  1Y1W J;  4RAZ A;  2BW3 B;  1R1T A;  5F0F A;  1UG0 A;  3DWL E;  2R7V A;  3ECO A;  3JRA A;  4V2F A;  2HDD A;  2AHQ A;  4M6Y A;  4OWR B;  4BXU A;  1LVA A;  2Y30 A;  3I55 I;  2Q0O A;  2W85 A;  3RIR A;  2B7E A;  3IH4 A;  1F9N A;  4E7I A;  3S3O A;  4XKV A;  3LNQ A;  2BYV E;  5E8I A;  3HKZ A;  4L5E A;  2KPM A;  3DP7 A;  3ZN1 A;  3JCU C;  2UUZ A;  2FXA A;  2OD5 A;  2NYX A;  2PI0 A;  3AAF A;  4FX0 A;  4V2G A;  3FKI J;  1TW2 A;  1PJR A;  5CYV A;  5TGT A;  5H20 A;  4MIM A;  4RAF A;  2LKP A;  3H0G J;  5ERI A;  1R49 A;  2XGC A;  2BY3 A;  2Y0M A;  2KT0 A;  3WTT C;  2LSO A;  3V8K A;  1FY7 A;  5FJ8 J;  3FXL A;  2ESN A;  3FXJ A;  2EJR A;  3OYJ A;  2DYS H;  3RCO A;  5LHH A;  2WC2 A;  2W48 A;  3DKX A;  9ANT A;  1OFC X;  1R9T J;  4KA4 A;  2E1C A;  2W4S A;  2MA3 A;  1YJW I;  1FYL A;  2L7K A;  1BOB A;  1MH3 A;  5KNL A;  4D5F A;  2H8R A;  1YIO A;  3T5X A;  1W0U A;  4FTH A;  4MGR A;  5LHI A;  4XOR A;  1JHH A;  3OMY A;  4L0Z B;  5IYD J;  3E6C C;  4CCN A;  2XRO A;  4A3C J;  1Z0X A;  1O3R A;  1YS6 A;  2OCE A;  3FIW A;  3IH3 A;  1ON2 A;  5FKM A;  1QHH D;  5E18 F;  1RKW A;  1LVK A;  3KEY A;  1ZGW A;  1NK2 P;  2R5Z B;  4U7D A;  4Y3O A;  3KE2 A;  3HL2 A;  4AUX A;  2LK2 A;  1ZQ3 P;  2MAB A;  2OCC H;  3ECH A;  1LFP A;  3CCQ I;  4P5O A;  4M3F A;  1G3T A;  1JKR C;  4GRI A;  3K1M A;  3Q0V A;  1XGM A;  1OLT A;  3V4G A;  3BPX A;  1S9H A;  4E7H A;  3H3U A;  2A07 F;  2X1D A;  3ZXS A;  1QGP A;  1TQM A;  2DI3 A;  4AD9 A;  3S17 J;  3FMS A;  3NQO A;  3OL4 A;  4AIK A;  2EV5 A;  1W1W E;  2DA5 A;  2ZKZ A;  3RPU A;  2B63 J;  2QBY A;  2ETH A;  5HS7 A;  1T0F C;  3BDD A;  1G3Y A;  3JRD A;  5DM6 F;  3BPV A;  3WU2 C;  2L01 A;  4IQJ A;  1S6L A;  1UHM A;  4BJ6 C;  2KQR A;  2HQR A;  1UHS A;  4XSZ F;  2LBF B;  3MN2 A;  3FWE A;  4RB3 C;  1LQ1 A;  4BQA A;  2DU9 A;  1MSF C;  1KON A;  3QQA A;  1ZLJ A;  2EQR A;  5L3G A;  2L5Q A;  4CGZ A;  4J19 A;  2EV6 A;  5ED4 A;  3UKG A;  2F4I A;  1HA8 A;  1ZGJ A;  3WTX C;  1FJL A;  1MDM B;  1AU7 A;  3AFH A;  4E7Z A;  5HDK A;  3VYS B;  2R7X A;  1UMQ A;  3TOA A;  2LYC A;  5EEA A;  2FX0 A;  1O7L A;  5K7Z A;  1WSU A;  1K4T A;  1UAA A;  4JX5 A;  3IH2 A;  3SXY A;  4HLY A;  2K9M A;  3SDG A;  1SVO A;  2V6E A;  3I53 A;  5KCM A;  2DFH A;  4MTE A;  2X4H A;  1Z3X A;  4PGH A;  4NQW B;  3ZQF A;  3P7N A;  1D8J A;  2P81 A;  4WXD A;  4AIH A;  3WTU C;  3V42 A;  1G59 A;  4KIT B;  2YU3 A;  5E1W A;  5LEK A;  2E1M B;  2W00 A;  1XGN A;  3IKT A;  2DT7 B;  2NS0 A;  1YOV B;  2JPB A;  4XN3 A;  2QEN A;  2NS7 A;  3F8N A;  3LSJ A;  2PMZ N;  3B6C A;  2D1H A;  4EM2 A;  3G6E I;  5L3B A;  4DZJ A;  4LK0 F;  4I6Z A;  2EFO A;  3FK6 A;  3KP7 A;  5FO5 A;  2Z99 A;  1OCT C;  5FD5 A;  2VQC A;  3BTL A;  2KIS A;  1IO2 A;  1BR4 A;  2G7U A;  3RKW A;  1LFB A;  2P7V B;  1SMY F;  4PGG A;  1VQP I;  2ZXW H;  1MMD A;  3HPG A;  4L9N A;  4KNY A;  3BWG A;  1RIO H;  3ONQ A;  1WJB A;  1MJB A;  5LGT A;  2EBI A;  5CVU A;  1MMG A;  1BN5 A;  5JFR A;  1LDD A;  3FIS A;  3TMO A;  4KIB A;  3OYB A;  4W1U A;  2EIN H;  4RGS A;  5BQT A;  3JRI A;  1ODD A;  3KLO A;  3BTJ A;  1TP4 A;  3V7S A;  2A3S A;  2W7N A;  1T0F A;  2HS5 A;  3FX3 A;  1TC3 C;  4PJN A;  4NBQ A;  4YII A;  4EEF G;  4ZH4 F;  3F8F A;  5H2F C;  2MD0 A;  2LY2 A;  3RTR A;  2DTZ A;  3WTW C;  1YX5 A;  3OSF A;  1KQ9 A;  3HGG A;  5ILU A;  2EPF A;  2RC4 A;  4RDU A;  2F5E A;  3DKY A;  2FQ4 A;  5HS9 A;  5BNG A;  4XLP F;  3JRC A;  1ZRF A;  3LAP A;  1P2F A;  3WGH A;  4P1W A;  4QSH A;  1TT5 B;  3CUQ C;  3IV5 A;  1Z1D A;  1ZLK A;  3LFU A;  4A5M A;  4PSW A;  1HKT A;  3R61 A;  3OYN A;  4E4H A;  4BJT A;  3QPT A;  3EQL F;  1NG6 A;  5FD6 A;  5D5V B;  1SD6 A;  3DTK A;  3H9J A;  4OMZ A;  4IHS A;  3U1D A;  2DMQ A;  2XF6 A;  1WI9 A;  2R5Z A;  4XRF A;  4A3L J;  5D5X B;  3ZR8 X;  3BOQ A;  4RAY A;  5JLX A;  4LIT A;  2Y48 A;  2EIK H;  1DP7 P;  3FBN B;  4BEH A;  3F0C A;  2CUF A;  3BP8 A;  5M5X J;  4I2O A;  1Y39 A;  1K4S A;  4M73 A;  2P0W A;  4HA8 A;  3JTG A;  1IV6 A;  2EZL A;  4UB6 C;  3MKZ A;  1IF1 A;  3D5R C;  1U5T A;  3GZN B;  4AC0 A;  3K70 C;  3DF8 A;  3VSK A;  1Y8Q B;  3OR1 C;  2R7Z J;  2PFB A;  2IS1 A;  1TQP A;  3TW7 A;  2GQQ A;  5FB2 A;  1SD4 A;  2KP6 A;  3OIO A;  2VT2 A;  1XG1 A;  2E5Z A;  2HYG D;  1I50 J;  2BY2 A;  4UB8 C;  3OYC A;  4DYQ A;  2RQP A;  2L7M P;  1TWH J;  1K83 J;  1XCB A;  1MNM C;  2OZ6 A;  1VTN C;  1VQM I;  2PJR A;  2K9L A;  1NG7 A;  3F8B A;  1ZK8 A;  3OWT A;  2R7O A;  3DEU A;  4BHC A;  1XD7 A;  4LG0 A;  2GLO A;  4BQN A;  2MH9 A;  3HG9 A;  2VC1 A;  1MBG A;  1SVM A;  2QQ8 A;  3VSL A;  2AS5 F;  5F04 A;  2I8D A;  4NHJ A;  1U9N A;  1FTZ A;  4Y17 A;  2M7A A;  4M9S A;  3HOU J;  3LSG A;  1OCO H;  3KX2 A;  2JA6 J;  1AOY A;  2KLO A;  2M87 A;  4XSX F;  1WPK A;  2DMN A;  2E71 A;  5HLG A;  4F93 B;  5D8K B;  4DIQ A;  3ULQ B;  4XLN F;  2QSG X;  1MJ9 A;  4UV8 A;  1HXD A;  3WHC A;  4RMN A;  1Z05 A;  2GOM A;  4A6E A;  2ELJ A;  3N4M A;  2ZJQ F;  3ZPL A;  4O5V A;  4IXA A;  4U88 A;  2IGO A;  3T8R A;  2NOJ B;  2VE9 A;  2FNA A;  4MTD A;  2ZCW A;  2WAQ A;  4L9J A;  3TP0 A;  4ESJ A;  2Q2E B;  3RJP A;  1TWA J;  3RQ4 A;  2YU9 J;  3L09 A;  4BS9 A;  6PAX A;  4OOI A;  2NNY A;  3QYB A;  4JX6 A;  2M0C A;  1EA3 A;  1LEA A;  1VQO I;  2PBI A;  3K4M A;  1VQ9 I;  5FKO A;  2VOD A;  2OA4 A;  5FLX Z;  3OYF A;  2EV0 A;  1BIA A;  2RVC A;  5F64 A;  1H89 C;  5E20 A;  3KFW X;  1WJA A;  2V1D A;  2XV4 S;  2K02 A;  1VQK I;  3F9K A;  1I1G A;  3P9C A;  2VBX A;  4BQO A;  1ZG3 A;  2LOO A;  3IWF A;  4HW0 A;  4LFU A;  5DV5 A;  2ZME A;  4OIP F;  3F8M A;  4BE2 A;  4ZYD A;  1XPX A;  4H0E A;  2NVU B;  4ENM A;  1PVE A;  2NS8 A;  2Z3Y A;  4BL0 B;  4EVI A;  2E7W A;  4PFP A;  4WF2 A;  3HOW J;  1S7A A;  2WY7 Q;  3TW6 A;  2HOS A;  1I6X A;  3WTZ A;  1MND A;  1OYW A;  3VOD A;  3OY9 A;  2E2H J;  3F23 A;  3BCA A;  2HQ5 A;  2ZC2 A;  3E7L A;  4MFE A;  1RRJ A;  1E3O C;  1WKM A;  3RI4 A;  1E3H A;  3GWZ A;  2F5F A;  4LB6 B;  5E3M A;  3OS0 A;  4UY8 I;  1K7A A;  1YO5 C;  2E2I J;  4I02 A;  1RPW A;  2FML A;  2ESH A;  3GF2 A;  2VUM J;  1BR1 A;  1JT0 A;  4A0Z A;  2Y0S N;  1VZ0 A;  3KEO A;  1VQL I;  4A93 J;  1IGN A;  2DOF A;  2CUE A;  2ZJ2 A;  2JA2 A;  3E5X A;  2VKV A;  4B09 A;  3DKW A;  2CGP A;  3GTQ J;  4DQ2 A;  2F6C A;  3OYK A;  2ZME B;  1G4D A;  2CMP A;  2HU9 A;  1X1C A;  4O6J A;  3CCL I;  2DJI A;  3E1S A;  2IRF G;  3PJR A;  2RAE A;  1TNS A;  2IJL A;  1E2X A;  3CC7 I;  1SD7 A;  1FTT A;  4BE1 A;  3PNY A;  5TIS C;  2K9S A;  2IT0 A;  3VWB A;  1N75 A;  3HXL A;  3M1E A;  3A01 A;  1G3S A;  1A35 A;  4HLX A;  2YR2 A;  1QZZ A;  2F48 A;  3L9F A;  2PLY A;  4R8H A;  4RBO A;  4EGZ A;  3BRO A;  3SEQ A;  3L7W A;  2C6Y A;  1AWC A;  1MIJ A;  4EM1 A;  2VQL A;  4A3K J;  3LA7 A;  2RN7 A;  2P6S A;  1LNW A;  1XC5 A;  3M8J A;  4NB5 A;  5K1Y A;  1I3Q J;  4RGR A;  2XPU A;  3H36 A;  5JLW A;  1YIT I;  4C3J J;  1B8I A;  2WBM A;  2XGX A;  4LOC A;  2P5K A;  3RKY A;  2PEX A;  2K86 A;  3V7R A;  2WV1 A;  2X1C A;  3F21 A;  1ZTR A;  5K7F A;  5J1Y A;  5J4Y A;  1B72 B;  3IRR A;  1SAN A;  4S0H B;  2HEO A;  4FHT A;  4LJZ F;  2VBW A;  2IPQ X;  3BG3 A;  2TCT A;  2XAG A;  1BI0 A;  3IKV A;  1HDP A;  4L5J A;  3CTA A;  4R1H A;  2M4G A;  1ENH A;  1JT6 A;  1SFU A;  2QA4 I;  1PYV A;  5IP7 J;  1RET A;  5M3F J;  4YIR X;  2KIQ A;  1XGO A;  4PK4 A;  1ZRD A;  5E79 C;  2BY1 A;  2TRT A;  3PIP F;  3MKY B;  1PUE E;  4IHT A;  2HQA A;  4GCV A;  4Q5S F;  1ERD A;  5M5W J;  3NWT A;  2DPD A;  4IQ4 A;  1N78 A;  1T2K A;  2FBI A;  3GTK J;  4U0V A;  1Q1V A;  3VYU B;  3MFK A;  2F4M B;  3CUQ A;  1R1V A;  3NWS A;  2DBB A;  3H3Z A;  2X51 A;  2XC7 A;  1T39 A;  5HDG A;  3ZQ7 A;  4IHX A;  1IRZ A;  1O57 A;  3BQY A;  2V9K A;  2WAQ N;  2FBH A;  3JRG A;  2DT6 A;  1OKR A;  3V7C A;  3WGI A;  3AKZ A;  1LE8 B;  4HDV A;  4P55 A;  5EF6 A;  5DD4 A;  3CES A;  3B02 A;  1Z21 A;  2KZV A;  4FIS A;  3MKL A;  1QPI A;  5IP6 A;  4L0Y B;  2HR3 A;  2KFD A;  2ICW G;  3PSI A;  3HYI A;  5E3N A;  4C2U A;  2DFF A;  3A02 A;  2OTJ I;  4N4N B;  1RUN A;  1YW9 A;  3U9G A;  3ZMU A;  3S2D J;  3C2G A;  4IL6 C;  1QU3 A;  3BR6 A;  4OMY A;  2LF8 A;  1QO0 D;  1DGW Y;  4BJ5 C;  3QPL A;  3GFM A;  4EV0 A;  4CA0 A;  3PNV A;  5EGO A;  3IHU A;  2ISZ A;  4LLN A;  2FOK A;  4LLG F;  3TP3 A;  4EJV A;  1W7P D;  2AXT C;  2L7F P;  2LFB A;  2H8W A;  2P7C B;  2RGV A;  3MZY A;  2QQB A;  3K2Z A;  5F0C A;  1QVT A;  2MBF A;  3CUO A;  3Q9V A;  1KYW A;  3I4N J;  4C2T A;  1WJ5 A;  2M5W A;  1IC8 A;  1A04 A;  3UR3 C;  2HZT A;  2OPT A;  4LD5 A;  2STW A;  2E7X A;  2BOL A;  3DBR B;  3HM5 A;  2D2W A;  2XIG A;  3HSR A;  2FQ3 A;  2STT A;  2BBY A;  5FKN A;  1GUU A;  1MBJ A;  4ZDO A;  3E6M A;  3MMY B;  3HEF A;  2HOT A;  1JI8 A;  2X6Y A;  1OCZ H;  2DCE A;  4YFX F;  3R0A A;  1ETQ A;  4PUS A;  3VDX A;  1Z91 A;  2JZY A;  1HST A;  3CF2 A;  4HRI A;  3I59 B;  1KQ0 A;  2V6C A;  4XK4 A;  2Y2Z A;  2RV8 A;  3HUG A;  4FAS D;  4XLA A;  1CQT A;  1TWF J;  2HGC A;  2QQ9 A;  4UUT A;  4N0B A;  1IN8 A;  3ZN0 A;  1TTY A;  2GZW A;  3ERE D;  1DU6 A;  1BI2 A;  1G3W A;  2A6T A;  1Z67 A;  2DQL A;  2MG4 A;  4L9T A;  4BYY A;  3H0D A;  2KJB A;  3WTS C;  4G6D A;  4JYK A;  2ZB9 A;  4M3G A;  4D9J A;  1K78 A;  1ZKG A;  2DFI A;  2HPM A;  1VF9 A;  3G71 I;  4MQV A;  1IN7 A;  4W97 A;  1ZR2 A;  4XRM A;  2KDO A;  2EB7 A;  4X6A J;  2Y9Z A;  3GTP J;  1L0O C;  1W0T A;  1OR7 C;  2QLZ A;  4FCY A;  2LY9 A;  3GTJ J;  3NAR A;  2IVM A;  2MLK A;  1P7J A;  4BGD A;  2EZH A;  2ACJ A;  1DPR A;  3P9I A;  4ESB A;  5C4X J;  1J7K A;  5HLI A;  2ZXI A;  2FBK A;  3DFG A;  4M6X A;  1QQI A;  2LTP A;  4A3E J;  3HDD A;  2OF7 A;  1MSE C;  2MSY A;  2PG4 A;  3C7J A;  3MKW B;  1ZH5 A;  3ZMT A;  4LB5 A;  4BXF A;  3LSH A;  2KJC A;  2VE8 A;  2Z33 A;  3BLY A;  2ZO4 A;  5EZG A;  4M3D A;  5BPD A;  4HBL A;  2V1U A;  2W84 A;  5K5R A;  4EMS A;  5LGN A;  1JJ6 C;  2UXX A;  3ABT A;  2YSR A;  1FC3 A;  2IS6 A;  3A0H C;  4G7H F;  2OQR A;  3LFK A;  4BY7 J;  3IRQ A;  3LSM A;  3EUK L;  3GLX A;  3VYT B;  4RB0 A;  5E1X A;  5EG0 B;  3KET A;  1FBS A;  2P5V A;  4I0B A;  2RNJ A;  1YJN I;  2EWN A;  2DK8 A;  2YX7 A;  4XRS G;  5HOO A;  1H8A C;  2XAU A;  3LSR A;  2EZI A;  4PJJ A;  4MLO A;  1P4A A;  3EUA A;  4X1E A;  1SEU A;  1B9N A;  2E2J J;  4IRH A;  4D0P A;  3GTM J;  2M3A A;  2VKE A;  3LST A;  5IT9 K;  2XVC A;  2R92 J;  2ISY A;  3K4J A;  4LK1 F;  2R7F A;  3RQI A;  2GWR A;  4II2 A;  4CYD A;  1Y1V J;  3HOY J;  2V1N A;  2K7L A;  3LOC A;  2GOX B;  1MH4 A;  3CMY A;  3FXU A;  5GAE J;  1MZB A;  1ORK A;  2NOG A;  3QPH A;  4RAG A;  1K78 B;  3W2A A;  2A5W A;  4PZJ A;  1MBF A;  3HRU A;  4PSX A;  5CVR A;  4CYC A;  4EGY A;  5FLV A;  1D8K A;  2ZFU A;  2VJ4 A;  1D0Y A;  3GTO J;  1LE8 A;  1O3T A;  4XLE A;  3HSF A;  2I5U A;  4F3Q A;  1NTC A;  5BS6 A;  1RC9 A;  1WCM J;  5FLX K;  2M9H A;  2VAS A;  4CCJ A;  3L2R A;  3WTV C;  2W1O A;  5IOZ A;  2X0L A;  2K9N A;  3GFJ A;  2FUG 2;  1G6N A;  3DTI A;  5F1R A;  4G7Z F;  5DCM B;  4CH7 A;  1SFO J;  4ON0 A;  2G0E A;  3WG9 A;  2XF7 A;  3IUO A;  2V9V A;  2LC2 A;  5H6Q A;  1OIS A;  2QBY B;  2KZG A;  2E1M C;  2DA6 A;  3FBI B;  1WHU A;  5E8G A;  4OIR F;  4U87 A;  1APL C;  2HVS A;  4RB2 C;  2R7T A;  1A6I A;  5EGO B;  1BC8 C;  1EH7 A;  2LRD A;  2Z1D A;  5C44 J;  1FPQ A;  3OIQ A;  4HST A;  2LBF A;  2AO9 A;  5LBQ A;  2LY1 A;  4YEJ A;  3CMM A;  1OCC H;  3CO6 C;  3ZOB A;  1KU9 A;  2V9P A;  3QP5 A;  4ZC3 A;  2LVS A;  2JA8 J;  1JJ8 C;  4A12 A;  4HNT A;  3MEX A;  2LF7 A;  5J1U A;  1IDY A;  4A2U A;  2Q1Z B;  3BZC A;  5F1J A;  4AVZ A;  3J81 K;  1MMN A;  3HRM A;  4FQG A;  2O61 A;  3I9V 2;  3K69 A;  2CJJ A;  4AIJ A;  4PJ0 C;  4ZDL A;  5DM7 F;  3TL4 X;  3F6O A;  3X2Q H;  1AKH A;  3TO9 A;  3IL2 A;  4RM2 A;  1B4A A;  4UVC A;  5K5O A;  3RPU D;  3HBL A;  3TDU C;  3FXQ A;  3OS2 A;  3DV8 A;  2QM3 A;  4NQW A;  1TQI A;  3HOZ J;  1V55 H;  4HX8 A;  4YRV A;  5D8L B;  4Q48 A;  3BG6 A;  3I58 A;  2JK3 A;  1KA8 A;  2IA0 A;  2E19 A;  2V4J C;  5FFZ A;  3JW4 A;  3K9T A;  4UUV A;  2HXO A;  3D5S C;  3BJO A;  2MFZ A;  1B72 A;  1ZG5 A;  3PL8 A;  1VQN I;  3H5N A;  2M4K A;  3VEP A;  3I4M J;  4BH9 A;  3ELK A;  2PMZ A;  2QSH X;  4Y33 A;  3L2C A;  3FHN A;  2CRG A;  5A2Q Z;  5H6R A;  1FOW A;  2CV2 A;  2K40 A;  3HOS A;  2P5L C;  3K1P A;  3S3M A;  2R7Q A;  2KMU A;  5HLT A;  4RLF A;  3A4C A;  2XF5 A;  1V54 H;  4WX9 A;  2LKS A;  4GFB A;  3WE2 A;  1L3L A;  1I5Z A;  3GO5 A;  1JKP C;  1OYY A;  4I0A A;  4YFK F;  3K4B A;  4ITV A;  5HNF A;  1X2N A;  1OYI A;  5J8C A;  4HF2 A;  1R5I D;  1QZE A;  2XAJ A;  3BTC A;  1K6O A;  5JHU A;  5DUK A;  4XMY A;  2K5C A;  3M4O J;  2BZT A;  3VPR A;  2K4B A;  1J9I A;  3GCM A;  4PDK A;  1MKM A;  2M30 A;  2VPR A;  3HHH A;  3I54 A;  3CDL A;  1DP3 A;  4BXX J;  1XN7 A;  3ZMS A;  4ZDP A;  1P4W A;  3WHB A;  2LP0 A;  3I3L A;  1AHD P;  4XKW A;  3GZ6 A;  2VJJ A;  2TDX A;  2A69 F;  2YUS A;  2CQ7 A;  3QU6 A;  1FOK A;  1T95 A;  3PFI A;  3S3N A;  1R58 A;  4MFD A;  2PMH A;  1O3S A;  4OU0 A;  3C2B A;  2ZBK A;  3J7Z I;  1J09 A;  3F72 A;  5GTI C;  2CWE A;  4HV5 A;  1YRN B;  5GPC A;  2X6X A;  5M3M J;  1SFE A;  4I01 A;  1R5G A;  3S1R J;  4QTR A;  3OR2 C;  3M9A A;  1S5L C;  2NVQ J;  3T0Y A;  3ESW B;  3BR0 A;  2HXI A;  3U2R A;  4WWC A;  4A3J J;  1W5C C;  1QZY A;  2W25 A;  5ICE A;  4CXF A;  4TV7 A;  1BL0 A;  5LRS A;  3PQJ A;  4Q4Z F;  3CCU I;  1LJ9 A;  3N05 A;  4IHY A;  2M8G X;  4BDY A;  1ULY A;  5DEQ A;  3DCF A;  2P8T A;  2X9D A;  1XDU A;  1OJL A;  2BEO A;  3U1K A;  1D1B A;  3HGY A;  4DZP A;  1N25 A;  1BJZ A;  3KEQ A;  4LMY A;  2WAF A;  2Z2S B;  3ZQQ A;  4M9X A;  3HUG B;  5GAD J;  1FP2 A;  4F92 B;  4KYW A;  3EUH A;  3E0J B;  1JUP A;  1R5H A;  3OYE A;  3O8G A;  3JRE A;  2L02 A;  2G7H A;  4N4O B;  3GX4 X;  4MHG A;  2J5P A;  3KPH A;  4B8X A;  1YFH A;  4ZYH A;  2O03 A;  5FRO A;  3QOE A;  2JTV A;  4BNC A;  1BM9 A;  1REP C;  4LG0 B;  3BJ6 A;  3F6V A;  2RDP A;  4BHP A;  1E17 A;  4QPO A;  1X1B A;  2D45 A;  3SZG A;  3HTS B;  1D1C A;  1FMW A;  1DU0 A;  3MQ0 A;  5LEJ A;  1BR2 A;  2XDV A;  4AM3 A;  3K4K A;  1R1U A;  4BDZ A;  2QSF X;  5B3S H;  1WVR A;  1WZ2 A;  1XMX A;  2YX4 A;  2RNG A;  1HW1 A;  1H9G A;  2ZFW A;  2OUM A;  1WH5 A;  2YS9 A;  1G8X A;  5ICC A;  3QYE A;  2UV1 A;  1FYK A;  3E6D A;  1ZHF A;  1YLF A;  2VIX A;  3DBH B;  2VOP A;  4OAY A;  1QRY A;  5ICG A;  2JN6 A;  5KHD A;  1X1P A;  3J80 Z;  3AG1 H;  3F8C A;  1F5T A;  4J01 A;  3S32 A;  3BR5 A;  1T38 A;  2VXZ A;  4NC6 A;  4HSR A;  1EJ9 A;  3DEE A;  5EZH A;  2O8X A;  1FT9 A;  3RYR A;  3W6J B;  2OTL I;  3NAU A;  2GA1 A;  1GXP A;  4HX7 A;  1VI0 A;  2HKO A;  4BBR J;  1I6H J;  1UST A;  2I10 A;  4OIN F;  2WY8 Q;  3DQV C;  1CF7 B;  3DLA A;  1R4M B;  2MGQ A;  4XRS A;  4IEJ A;  2CQX A;  2KIU A;  4G6T B;  1UCR A;  3A03 A;  3DBL B;  3E5Q A;  4UVB A;  1D0X A;  1MMA A;  5AIP A;  5GP9 A;  4HQM A;  2DA2 A;  1CGP A;  1WWX A;  1IG7 A;  4CSW A;  2COM A;  1WJD A;  5DYM A;  2IGM A;  3S15 J;  2CUZ A;  1T8I A;  1JUS A;  4E7K A;  3K4L A;  4A3B J;  1FIA A;  4ZYG A;  2GXG A;  1P4X A;  2EH3 A;  2Y75 A;  3ZQI A;  2XGE A;  4GYG A;  4KN7 X;  3PUF A;  4P96 A;  2VPL A;  2H27 A;  1Z7U A;  2B9S A;  3OYD A;  1VQ4 I;  4WXC A;  1AA7 A;  1NHA A;  2DDA A;  3NRV A;  3AL0 C;  1S7O A;  2LG4 A;  4EQQ A;  1OPC A;  2EIJ H;  5IOY A;  1JGG A;  2DXI A;  1LDJ A;  5LGU A;  1U5T B;  2BV6 A;  2CQQ A;  3K2A A;  5CVJ A;  2ELK A;  3AG4 H;  5DCM A;  1WGX A;  2M8E A;  5LFA A;  2IA2 A;  1USS A;  2X6O A;  3CLQ A;  3KYD B;  5CLS A;  1IXR C;  5JHF A;  1D5Y A;  2ECB A;  4AVP A;  1V5E A;  4XBF A;  1HDD C;  3DLL F;  4UVA A;  4WXH A;  3B6A A;  2BW3 A;  3S93 A;  4CHU A;  4WCG A;  1X3W B;  4BEH B;  4A3D J;  3J81 Z;  2IA1 A;  3A2K A;  1U0J A;  2QQA A;  2QCO A;  1LPQ A;  4HF0 A;  5DDG A;  2WTE A;  2XPV A;  4MEY F;  5EEH A;  1X4O A;  2F2E A;  3I5U A;  4N9I A;  4PCQ A;  1WJF A;  4IRG A;  2LMD A;  4EJO A;  1UZC A;  2LLK A;  2XAF A;  3EYY A;  3O3K A;  1QPM A;  4GO1 A;  4YEL A;  2WB1 A;  3MCZ A;  2QKL B;  2DMU A;  3J80 K;  3ABU A;  1XS9 A;  1P7I A;  2VT3 A;  2DPU A;  3FKJ A;  3H1C A;  4A3M J;  2MW8 A;  1SC7 A;  2HFH A;  2XAQ A;  1Y6I A;  3HRT A;  4PJM A;  3KP5 A;  1PP8 F;  2NXN B;  1I3A A;  3TBI A;  2L9V A;  1W36 D;  2HQN A;  1HW2 A;  1OQY A;  4CIC A;  1VQ5 I;  3CC4 I;  3DU6 A;  4C3I J;  1A6Q A;  1YG2 A;  4ANJ A;  3GZ5 A;  4HPQ A;  3Q0W A;  3U21 A;  1NK3 P;  2QZ8 A;  3ZRG A;  4LG3 A;  4XLH A;  3FDY A;  1WJE A;  2KRH A;  4JP0 A;  4XR6 A;  2L9R A;  2HOA A;  2VQH A;  3NEU A;  2OU2 A;  3M8F A;  4HF1 A;  2DJN A;  2CH0 A;  5FFX A;  2HVR A;  1W36 C;  3HZJ A;  1FLI A;  4RB1 A;  3HOX J;  3BG5 A;  3ZMV A;  4XQF A;  4UNO A;  4BBS J;  1BC7 C;  2DW4 A;  3FXK A;  3R6S A;  4P9F A;  4MO7 A;  5GPA A;  1W7P B;  5D5W B;  3GME A;  4ZZL A;  2PJR B;  2OQG A;  1J5Y A;  2XAH A;  1N77 A;  3S8P A;  4M3B A;  1V5G A;  2UZK A;  2V1X A;  3TED A;  3I64 A;  4U0W A;  2XUB A;  4M71 A;  1OCR H;  4CUG A;  2OBP A;  1GXQ A;  2DT5 A;  2RRE A;  3I59 A;  2V7F A;  2KHM A;  2GXA A;  3PM1 A;  3BZ6 A;  2ZNZ A;  2BY0 A;  4DBR A;  5HOD A;  1Y0U A;  3FMQ A;  4ASN A;  5KAI C;  4QIW N;  3J7A Y;  1YJ9 I;  3AG3 H;  2QKM B;  3BY6 A;  1YX3 A;  3CDI A;  1RES A;  3TGN A;  1YRN A;  2DLL A;  4EJW A;  4IPA A;  2NVT J;  3HIF A;  3PQK A;  3JSO A;  5B5E C;  1YIJ I;  1TNT A;  5J4V A;  4KT5 C;  1ACI A;  1GV2 A;  2NVY J;  4KIS A;  2J5O A;  1KQ8 A;  1GLN A;  3PNT A;  5K5Q A;  3PIO F;  2E60 A;  1IXC A;  3L2W A;  2HI3 A;  2DA3 A;  2BGC A;  1Z77 A;  1I39 A;  1LKX A;  2X48 A;  3KIO A;  4E70 A;  2F5V A;  2ZSI B;  5CPR B;  3ABL H;  2X1E A;  5HVQ C;  5EG0 A;  1VFC A;  1MGT A;  2EA2 A;  3LA2 A;  2DO7 A;  2FEZ A;  3ML6 A;  1TWG J;  2CFX A;  1S7E A;  2PN6 A;  4IHW A;  4EJU A;  1YI2 I;  4D1Q A;  1P6R A;  1XB4 A;  2O0Y A;  4G8X A;  4O3M A;  1FEX A;  3QRF F;  2IAI A;  1IAW A;  4H4K C;  3DPL C;  1D3Y A;  2MC3 A;  1UHW A;  2DDB A;  4UXN A;  1G2H A;  2NAZ A;  2FRH A;  1MBE A;  1B9M A;  2NNN A;  4Z2Y A;  1H0M A;  2VXD A;  3CQZ J;  1TBX A;  3OL3 A;  4I7H A;  3SEZ A;  3IWZ A;  4U0Y A;  4BUP A;  3FM5 A;  1MBK A;  5L3F A;  2OAZ A;  4G94 A;  2H94 A;  5DD8 A;  3CCR I;  2XGD A;  5LLQ A;  2YPR A;  5K7H A;  3KYL A;  3JTH A;  3HJE A;  3KLN A;  1U6G A;  4UV9 A;  1W5T A;  3GEZ A;  3WU0 A;  3OS1 A;  4HYE A;  2E5N A;  2VBY A;  1MW7 A;  3CP8 A;  3SQN A;  4B3A A;  4S05 A;  2F5C A;  3JSP A;  1ZAR A;  2V26 A;  2XB5 A;  1K6Y A;  3DEW A;  1YHQ I;  1HKS A;  2R4G A;  1BI1 A;  1XSX A;  4F7Z A;  1MDM A;  3L2V A;  4ZJZ A;  2AXL A;  2ZME C;  3SFI A;  1DQU A;  1T98 A;  4NNJ A;  2L9S A;  3LWF A;  4XM3 A;  3SZP A;  2JQ7 A;  2BHZ A;  4XKB A;  2CQN A;  3DTE A;  3KZI C;  3G1O A;  1Z6T A;  5FRM A;  2HOE A;  2JVH A;  2DYR H;  2ID6 A;  1OR7 A;  2DA4 A;  3I4P A;  4J00 A;  1SFK A;  3OYH A;  2ZJP F;  1XMA A;  1U9O A;  2V79 A;  2L4A A;  4MQ9 F;  1O7F A;  4FET A;  1ONV A;  2XB0 X;  3N97 A;  4ZTF A;  3REO A;  3E97 A;  3OSG A;  2VJ5 A;  3FZV A;  2COB A;  4BKX A;  3BR1 A;  2A5Y B;  4RA2 A;  3Q5F A;  1DUX C;  1XGS A;  3LSI A;  1S8N A;  2KRF A;  5E3O A;  4M72 A;  1SD5 A;  1ZG1 A;  4LIU A;  3GFI A;  1TT0 A;  2WAE A;  1K61 A;  3HOV J;  2ADU A;  2H1L A;  2DOE A;  5JVG F;  2CV0 A;  3R60 A;  1KZH A;  5ICF A;  1ZYR F;  1A31 A;  1RKT A;  3ZCO A;  2VBZ A;  2G9W A;  2QGU A;  3DXJ F;  2UWM A;  3GTL J;  4DGW B;  2EA4 A;  2L0K A;  1IRF A;  4IX7 A;  3I0T A;  2CUJ A;  3CUQ B;  1Y8R B;  4XKC A;  2F5D A;  4Y13 A;  1WFX A;  4A0X A;  5GAG J;  2XPW A;  3GBG A;  2BE5 F;  1I27 A;  3VYR B;  1LB2 A;  1R22 A;  1LDK B;  1ZEL A;  2M0M A;  2L4M A;  2VKD A;  1KGS A;  2HKX A;  3CCJ I;  4BAY A;  3GUD A;  4JBA A;  3DU5 A;  2R7D A;  1IUY A;  3WGG A;  4HQE A;  5B1B H;  2M34 A;  3QP6 A;  2VOO A;  3HPH A;  1C0W A;  2M7B A;  3PFY A;  2N8G A;  1HSJ A;  3EPZ A;  2W24 A;  2JA5 J;  3BG9 A;  4Y4R A;  2ZSH B;  2IW5 A;  4KJZ A;  3SHF A;  1DPU A;  2P6T A;  4Y15 A;  1XX5 A;  2JSC A;  4LLL A;  1VQ6 I;  4II3 A;  4D7N A;  2XKO A;  1QA6 A;  3M7G A;  1TL8 A;  1NH3 A;  4HAM A;  2ME0 A;  5F08 A;  3WE3 A;  4AID A;  2DN0 A;  4G9Y A;  2GXB A;  4N9H A;  2H6C A;  3W6K B;  2ID3 A;  2FMY A;  2HYF A;  2O7O A;  3OYA A;  2O5R A;  1X58 A;  5FLM J;  4BQQ A;  1UG2 A;  1B8I B; 
#chains in the Genus database with same CATH homology
 4BL0 B;  4PFP A;  5LD2 C;  1T95 A;  2WY7 Q;  4PJL A;  3IAM 2;  3S3N A;  4LIV A;  4CCM A;  2JSP A;  1MND A;  3D5L A;  3OY9 A;  1J09 A;  3BCA A;  4NC8 A;  3OS0 A;  2X6X A;  2X85 A;  1BR1 A;  1TZL A;  4IZZ A;  3OR2 C;  4QPQ A;  4HEA 2;  1P9Q C;  2LRE A;  4DBQ A;  4XLF A;  1VZ0 A;  3K10 A;  3H9Q A;  4IKF A;  2JA2 A;  5CQG A;  3N05 A;  2L9N A;  4CCK A;  4BDY A;  2F6C A;  3OYK A;  2CMP A;  2HU9 A;  1X1C A;  2DJI A;  3E1S A;  3IAS 2;  2DOA A;  3PJR A;  1D1B A;  2RQQ A;  2VJI A;  4F91 B;  4BE1 A;  3HC7 A;  2X6W A;  2WAF A;  1R6R A;  2Z2S B;  3PNY A;  3ZQQ A;  1D1A A;  3HUG B;  4F92 B;  3VWB A;  1N75 A;  1Z3Y A;  3E0J B;  3HXL A;  3PSF A;  4NUB A;  3OYE A;  1Z7L A;  2HPI A;  4N4O B;  4XOT A;  3H9G A;  3CZ6 A;  3LMM A;  1QHG A;  5FRO A;  3QOE A;  3A1Y A;  3SEQ A;  4BU2 A;  2IXS A;  4XLC A;  2VB6 A;  4B44 A;  3LL7 A;  2VQL A;  4QPO A;  1Y56 A;  3EUH C;  2KL4 A;  1X1B A;  3LSK A;  4B43 A;  3CP2 A;  4C30 A;  3SZG A;  3M8J A;  1D1C A;  1FMW A;  4X0G A;  1BR2 A;  2XDV A;  3K4K A;  3K70 D;  3OIP A;  2BVL A;  4BDZ A;  3QYF A;  1X4P A;  2RNG A;  3L2U A;  2WBM A;  2MYS A;  2OUM A;  1G8X A;  2R7W A;  2XSJ C;  3QYE A;  1UEL B;  2UV1 A;  4C9Y A;  2X1C A;  2BW3 B;  2VIX A;  1UG0 A;  3DWL E;  4OAY A;  5KHD A;  2R7V A;  2WAD A;  4ZTJ A;  5HNH A;  4OWR B;  4J01 A;  4XN0 A;  1SAU A;  3S32 A;  4E7L A;  2AQE A;  2M4G A;  1PYV A;  4JOM A;  2VXZ A;  4HSR A;  2IGN A;  3DEE A;  4PK4 A;  4E7I A;  3S3O A;  4XKV A;  3MKY B;  3HKZ A;  2KRC A;  3UNG C;  2HQA A;  2KPM A;  2HNH A;  1ERD A;  2W82 A;  3NWT A;  2UUZ A;  4IQ4 A;  2WY8 Q;  3CJQ B;  3DQV C;  1N78 A;  3DLA A;  4NC7 A;  4HNU A;  4G6T B;  5TGT A;  1PJR A;  3VYU B;  1D0X A;  1MMA A;  3L2Q A;  3NWS A;  4OAZ A;  2X51 A;  2XC7 A;  4CSW A;  1WJD A;  2IGM A;  2V9K A;  3OYJ A;  4KT6 A;  3RCO A;  2CUZ A;  2CFO A;  3OYI A;  2DT6 A;  3DKX A;  4E7K A;  3K4L A;  2W4S A;  3AKZ A;  2L7K A;  1BOB A;  3CES A;  1Z21 A;  2KZV A;  4AU7 A;  5KNL A;  2JUG A;  2IS2 A;  2VPL A;  4RLQ A;  3PSI A;  4XL9 A;  4XOR A;  3OMY A;  4C2U A;  4CCN A;  3OYD A;  1AA7 A;  4N4N B;  3AL0 C;  1QHH D;  2LG4 A;  3C2G A;  1QU3 A;  1LVK A;  1DGW Y;  4BJ5 C;  3KEY A;  2DXI A;  4Y3O A;  3HL2 A;  2R7R A;  4CA0 A;  5LFA A;  2MAB A;  3PNV A;  5JHF A;  3MD2 A;  1LFP A;  1V5E A;  4P5O A;  4GRI A;  1OLT A;  3K6G A;  2BW3 A;  3S93 A;  1S9H A;  4E7H A;  2X1D A;  3ZXS A;  4BEH B;  2L2O A;  4C2T A;  3OL4 A;  3W2W A;  3A2K A;  1U0J A;  1WJ5 A;  2OV7 A;  3UR3 C;  1T0F C;  2BOL A;  1X4O A;  1WJF A;  1D0Z A;  4YEL A;  2WB1 A;  2QKL B;  4ZDO A;  4IQJ A;  4HG2 A;  3MMY B;  2KQR A;  4BJ6 C;  1JI8 A;  2X6Y A;  3FKJ A;  2DCE A;  2LBF B;  4PJM A;  1Y6I A;  4PUS A;  3VDX A;  3PUB A;  3CF2 A;  3TBI A;  4HRI A;  1W36 D;  4FAS D;  2HZD A;  2CW7 A;  4XLA A;  2IS4 A;  2CW8 A;  1X1A A;  1KON A;  2L5Q A;  3DU6 A;  4R79 A;  2A6T A;  3H0D A;  3CJR B;  2F4I A;  4ANJ A;  1HA8 A;  4HPQ A;  3U21 A;  3ZRG A;  4LG3 A;  3AFH A;  4XLH A;  3FDY A;  4D9J A;  1WJE A;  3VYS B;  4E7Z A;  2KRH A;  4XR6 A;  2HPM A;  2R7X A;  3W3C A;  2VQH A;  2LYC A;  4E6K G;  2CH0 A;  1UAA A;  1X19 A;  3QOD A;  2KDO A;  2HVR A;  2K9M A;  4B48 A;  1W36 C;  2V6E A;  3BC8 A;  5KCM A;  1OR7 C;  1Z3X A;  4NQW B;  4XNF A;  4XQF A;  3AL0 B;  4PFO A;  4BGD A;  3V42 A;  2ZXI A;  4KIT B;  1G59 A;  2PJR B;  1N77 A;  4DOZ A;  1MNE A;  2E1M B;  3S8P A;  2W00 A;  4B47 A;  1V5G A;  2DT7 B;  3MKW B;  4XN3 A;  4BXF A;  3LSH A;  3BLY A;  4CUG A;  5FRN A;  5CKT A;  2VLA A;  2RRE A;  2IS6 A;  2V7F A;  2KHM A;  2VQC A;  4EAT A;  4DBR A;  3SDB A;  3LSM A;  3EUK L;  1BR4 A;  3OOU A;  3VYT B;  4CZC A;  3J7A Y;  3OYM A;  2QKM B;  1YX3 A;  1MMD A;  3HPG A;  5HOO A;  3ONQ A;  2R7U A;  1WJB A;  2XAU A;  4BE0 A;  4PJJ A;  4MLO A;  3EUA A;  2HVQ A;  2Y0S A;  1MMG A;  2M3A A;  4KIS A;  3TMO A;  3OYB A;  4F55 A;  3DPT A;  1GLN A;  3K4J A;  3PNT A;  2CS3 A;  2E60 A;  3IP4 B;  3L2W A;  4II2 A;  2W7N A;  1LKX A;  2V1N A;  4BAC A;  2ZSI B;  2F5V A;  2GOX B;  4PJN A;  5CPR B;  2X1E A;  5HVQ C;  4E7J A;  3W2A A;  2A5W A;  2MD0 A;  1FMV A;  2LY2 A;  3RTR A;  4RM3 A;  4E7S A;  4PSX A;  3W2V A;  1YX5 A;  2AQF A;  2ZFU A;  2ZXH A;  3OYG A;  3DKY A;  2VJ4 A;  1D0Y A;  4B3X A;  4XLE A;  4P1W A;  4F3Q A;  4D1Q A;  2VAS A;  3LFU A;  4CCJ A;  3L2R A;  4PSW A;  4H4K C;  2W1O A;  3DPL C;  2FUG 2;  3HOT A;  3OYN A;  3DTI A;  4E4H A;  5CQE A;  4BJT A;  3G2B A;  4CH7 A;  2VXD A;  1NG6 A;  2Z16 A;  1V5F A;  3DTK A;  3H9J A;  3OL3 A;  3SEZ A;  2XF7 A;  3IUO A;  4BUP A;  2LC2 A;  4U7B A;  3M1C A;  2XF6 A;  2E1M C;  2VL8 A;  1DGR M;  2VQG A;  3FBI B;  3KYL A;  4U87 A;  2HVS A;  3ZR8 X;  4LIT A;  3OS1 A;  2R7T A;  2E5N A;  3FBN B;  3CP8 A;  1MW7 A;  4BEH A;  2Z1D A;  2LRD A;  2V26 A;  2P0W A;  1K6Y A;  3OIQ A;  3MKZ A;  4HST A;  2R4G A;  2LBF A;  2JVG A;  3D5R C;  2LY1 A;  3K70 C;  3L2V A;  4YEJ A;  3C2H A;  3CMM A;  3SYT A;  4CCO A;  4ZJZ A;  3VSK A;  4ZC3 A;  1DQU A;  4NNJ A;  2L9S A;  4XM3 A;  4AYB A;  4XKB A;  3OR1 C;  3H35 A;  3DTE A;  4HNT A;  5FRM A;  2JVH A;  2IS1 A;  3K4C A;  2Q1Z B;  4CCL A;  4AVZ A;  4J00 A;  2KP6 A;  1SFK A;  1MMN A;  2E5Z A;  2K3P A;  3OYH A;  3I9V 2;  3BCB A;  3OYC A;  4FET A;  4ZDL A;  3TL4 X;  4ZTF A;  2VJ5 A;  2PJR A;  4RM2 A;  2K9L A;  3RPU D;  1NG7 A;  3LSI A;  3OWT A;  2BVM A;  2R7O A;  3OS2 A;  4BQN A;  3HG9 A;  3OYL A;  4LIU A;  1TT0 A;  3VSL A;  4ZYA A;  2WAE A;  2I8D A;  2CV0 A;  2LH9 A;  4YRV A;  4DJA A;  2M7A A;  3ZCO A;  3BG6 A;  3LSG A;  3KX2 A;  2V4J C;  2KLO A;  2UWM A;  4DGW B;  3D5S C;  1X1D A;  4IX7 A;  2MFZ A;  3H5R A;  4F93 B;  3PL8 A;  2CUJ A;  4DIQ A;  3H5N A;  2M4K A;  4XKC A;  2PMZ A;  1WFX A;  3GBG A;  4Y33 A;  3BG7 A;  2WA0 A;  3FHN A;  3H5A A;  4RMN A;  2GOM A;  3VYR B;  2ELJ A;  1LDK B;  1ZEL A;  2M0M A;  2CV2 A;  2VKD A;  3HOS A;  3S3M A;  3K4N A;  2R7Q A;  2KMU A;  5HLT A;  4RLF A;  3A4C A;  2CV1 A;  3DU5 A;  2XF5 A;  2IGO A;  2NOJ B;  2VKH A;  3RSN A;  3HPH A;  4XON A;  2WAQ A;  2M7B A;  2Q2E B;  3K4B A;  3PFY A;  4ITV A;  1IRX A;  5HNF A;  3RQ4 A;  3EPZ A;  4BS9 A;  3QYB A;  2HDW A;  4Y4R A;  2ZSH B;  1EA3 A;  4XOP A;  1WJC A;  4KJZ A;  2K5C A;  3K4M A;  4XMY A;  3ZGK A;  4F52 A;  1YE9 A;  4II3 A;  3OYF A;  2R7S A;  4JQF A;  1WJA A;  2OC6 A;  1DP3 A;  3F9K A;  3DPU A;  4ZDP A;  4BQO A;  2LOO A;  3OYA A;  3I3L A;  2O5R A;  4XKW A;  4BE2 A;  1E0E A;  2IGK A;  2VJJ A;  2MC4 A;  4BQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...