4QPOA

Mechanistic basis of plasmid-specific dna binding of the f plasmid regulatory protein, tram
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
53
structure length
53
Chain Sequence
AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Basis of Plasmid-Specific DNA Binding of the F Plasmid Regulatory Protein, TraM.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Relaxosome protein TraM
total genus 14
structure length 53
sequence length 53
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4qpoA00
3OMYA 1DP3A 4QPOA 4QPQA
chains in the Genus database with same CATH superfamily
3AG1H 3VEPA 1QVUA 2YX4A 2BV6A 2GQQA 5J47A 2XB0X 5DCMB 1DGRM 3T8TA 3TOBA 4CICA 2F6CA 2VQLA 5F27A 4N9IA 3KP5A 1H9GA 3CESA 5CQEA 3ZMUA 4BAYA 1OJLA 5BOXA 2BOLA 1HKTA 2HXOA 4I02A 1K4SA 2DT6A 2QBYA 4IHXA 1RUOA 2VC0A 1TLHB 1TQMA 2LK2A 1XX5A 1R49A 4RB3C 2EINH 5CVUA 2QGUA 4ZYGA 3WHBA 1LVKA 2OQRA 2E2HJ 1ETQA 1U3EM 3V8LA 2VONA 2D1VA 2EZLA 5DD4A 1UB9A 2STWA 5KCMA 1YLFA 1OMIA 1U5TA 1XC5A 3EUAA 5IOZA 2L9VA 3I4MJ 3IP4B 2M87A 2PMUA 5F08A 2YSRA 3GLXA 3N4MA 1KZHA 2QBYB 2EZHA 1N75A 3W2AA 2BBYA 2XF5A 4HQEA 4AIJA 3K4NA 5IT9Z 1G6NA 2X85A 3HOVJ 3V7SA 1SFUA 1HOMA 5FLXK 1FMVA 1TQPA 1ETKA 2K5CA 1BBYA 3S15J 2QEXI 2MSYA 2P6TA 1WJAA 3OR1C 1RKWA 3CCSI 3M8EA 3PM1A 4I0AA 4MFDA 5D6FA 5L3GA 4BACA 3CDHA 2WWYA 2CV2A 2I10A 1MH4A 1I39A 1Y8RB 5E3NA 2VOOA 2IA0A 5K5OA 3BC8A 1YTYA 2ZMEC 5FD6A 4A0YA 3DKXA 3CMMA 1MMSA 3H9GA 3OS1A 2B9SA 1U78A 1R1VA 3A1YA 2KRFA 3W6KB 1YW7A 3O8HA 4X0GA 1KYWA 4IRHA 2OC6A 1VQPI 3H35A 1G4DA 3U1DA 3GTLJ 4KICA 3EUHC 3HSRA 1XSVA 2W85A 5FRNA 5DEQA 4XBFA 1RIOH 3Q5FA 2ZJRF 3EUKL 1W0UA 2VPRA 2AO9A 4G7HF 4A3FJ 1SVMA 3HB9A 1YYVA 1ZYRF 4MNUA 3RQIA 1R71A 5FLMJ 1WH7A 1VQKI 3DU5A 2QKMB 3VYRB 4DZPA 2X6YA 3B02A 1MDMB 3BZKA 1LE8B 3GTGJ 1MMGA 2Q1ZB 5LLQA 2Y75A 2PJRB 4O5VA 2KIUA 4HYEA 2KIFA 1APLC 5DS9A 3S32A 5DDGA 3FMSA 3QYBA 2FOKA 1BR4A 1TWAJ 4HA8A 5K7HA 4E6KG 4M3DA 2K9NA 3C2BA 2ZKZA 3FISA 4FETA 1BIAA 1HSTA 2YR2A 1BC7C 3HDDA 1IC8A 2A3SA 2ETHA 2J5PA 4QTRA 1VQ9I 5EG0B 3LSJA 2HOSA 2W00A 4XMYA 4CCJA 1OCZH 3H9QA 5GAHJ 3DLLF 3QOEA 5BPIA 1WHUA 2BW3B 2GBYA 3L09A 5CQGA 1A04A 2M7AA 3BG5A 4M9XA 3V7CA 2FBKA 1OYYA 1X1CA 2H09A 1EJ9A 1DP3A 2V1XA 4WK8F 4QSHA 3OYKA 4JX5A 3WTUC 4LJZF 2ZSIB 3EYIA 3OOUA 5IP7J 2LY9A 1SAUA 1A36A 3F0CA 4HNTA 4EJWA 2R7QA 2DFEA 1IUYA 1JGSA 2R4GA 3D1NI 4I2OA 3FMRA 4CCMA 2F4MB 2VKEA 4Y3OA 1JT0A 3BR1A 3ONQA 4LIUA 1XGMA 3G71I 4F52A 4ZYEA 3JRGA 5E1WA 3QP5A 2DBBA 2NAZA 3GTJJ 4OIQF 2W24A 3K6GA 2VI6A 1U0JA 1OCPA 1WJCA 3SXYA 4ZDLA 4UNOA 2HOAA 3SQNA 1P6RA 3UR3C 2RGVA 1ZGJA 3DEEA 4XSXF 2M0CA 4CUGA 4XORA 2UV1A 4F7ZA 2K4BA 1RUNA 4C9YA 4BQAA 2HPIA 3NAUA 4Y52J 2VQGA 2PLYA 2MG4A 1MBFA 2FQ4A 1M1EB 2HQRA 4II3A 1FSHA 4U87A 3IKVA 1L3LA 2ZXWH 4A3CJ 2UXNA 1V3FA 2HI3A 2DK5A 2CW7A 5FO5A 3S3OA 4BY1J 5AIQA 1IN7A 5CJ9A 1OCRH 2CH0A 2AXLA 1OKRA 2FU4A 2Y0MA 2O0YA 2VBWA 3ULQB 2HYJA 4BGDA 4WXHA 3VDXA 1D3YA 3GFIA 4IOCF 1X4OA 1I1SA 2KIMA 4XRSG 2JVHA 2K7LA 3AL0B 4OAYA 2L4AA 4LITA 2BEOA 3W6JB 1F36A 1P7JA 5GTIC 5EF6A 2EFOA 2QENA 3BR5A 2H8RA 3LSIA 1RR8C 2G0EA 1IF1A 3DXJF 1ERDA 4CCOA 3ZMSA 2DOFA 3LSKA 3TKYA 4BHBA 2RNJA 4XONA 1WWXA 1LDKB 3K4CA 3D5SC 5TISC 1O3QA 1KONA 1TZLA 1YOVB 2IGOA 3B6AA 2R5YB 2P8TA 1ODDA 4C3IJ 2BVLA 4BXUA 2CV0A 1RNLA 1SMYF 2DMUA 3SEQA 1I6HJ 1G59A 3PFYA 1ZHFA 1Y39A 3A4CA 2WADA 4WCGA 2V9VA 2HVSA 2D2WA 1FOWA 5D5VB 1IXSB 2DI3A 3DPTA 3G6EI 2L7ZA 3NWSA 3JRCA 2MD0A 2Y48A 2NRAC 3I0TA 2R7UA 4QIWN 4U0VA 2GXAA 1WJDA 4JK1X 1OLTA 1BI1A 2J5OA 2DA4A 4II2A 2V79A 3F6VA 1GXPA 3F8FA 5CVVA 4LB6B 2V6CA 1YW9A 2OF7A 3MMYB 4RLQA 3IWFA 3N05A 4KNYA 4MGRA 2IP2A 3BZ6A 4F3QA 2W57A 4BY7J 1ETVA 2XC7A 1RRJA 3OYLA 4G94A 1HDPA 4ESFA 3K4BA 1NG6A 3V4GA 2XPVA 1D5YA 2DFHA 2EA2A 4KT6A 4XM3A 3SDGA 5GADJ 1JT6A 4I99C 3CUQA 1YJWI 2IGNA 4JBAA 1SD6A 4FASD 4XRSA 1N25A 2R5YA 3DTKA 1LB2A 4ENNA 5LHGA 3BCAA 1QGPA 4IQ4A 2F5EA 3A0HC 3G73A 2M3AA 4YELA 3CMEI 3HSEA 3T1BA 2OBPA 1YW8A 2XIGA 2E2JJ 3QAHA 2CRGA 5JVTA 5J6XA 5JLXA 2CFOA 4EGZA 2F4IA 1H0MA 3TO7A 2FX0A 1S72I 4FT8A 3EDPA 1X3ZB 2HXIA 2OCCH 2WAQA 3I55I 1PJRA 3CTAA 1BOAA 2DW4A 3L1PA 2Z3YA 4ABZA 4HF1A 5F64A 5D8KB 3FHNA 5FKLA 2O8XA 4XKWA 2NOGA 5HODA 4RAFA 4LD5A 1JHHA 2DXIA 2M9HA 2KZGA 4V2FA 1FEXA 2VT2A 3MCZA 2Y31A 4IL6C 1NG7A 3GUDA 1I6XA 3L2RA 4XLNF 2Q8KA 2P7CB 4IZZA 4Y15A 4M3EA 3GXOA 1D1BA 4XRMA 3DTIA 3GTMJ 2BY3A 2ZJQF 1BL0A 2KKOA 1T56A 4LLGF 1HKSA 4AIDA 2VOPA 3LNQA 1MMNA 1XB4A 2MH9A 4DBQA 3OYIA 1U8RA 2FBHA 5DYMA 1MSFC 3H36A 3GMEA 3E3VA 2VIXA 1U9NA 4GXOA 4ZJZA 5LEJA 4A3MJ 3ZQLA 1W36C 2EB7A 1TWHJ 2CUFA 5IY5H 4OOIA 2Y0SN 1U6GA 5LRRA 2NNNA 2Z1DA 1IRXA 1G8XA 1TT5B 2XAFA 4A93J 3KP7A 3ABLH 3P7NA 2DQRA 2HKXA 2R7WA 3KZIC 4IHSA 1Z3YA 4J00A 2HR3A 1D8JA 2EFQA 2L54A 3FBIB 2BY0A 5LGTA 2QQBA 3OSFA 1BI0A 2F5DA 2K86A 2VBYA 3GFLA 3HXLA 3TGNA 3ZPLA 2NNYA 1WVRA 1VQMI 2CG4A 4C3JJ 3DLAA 3QPLA 1T0FA 4B44A 2EA4A 4HPQA 3IKTA 1LPQA 2GLOA 4PJJA 1R58A 2K4JA 2Q2EA 2FMYA 1MSEC 1DU6A 4TV7A 2E34A 4YFXF 2JRMA 1Z1DA 4HBLA 3CZ6A 4LK1F 3F8CA 3ZQ7A 1F4KA 1GUUA 2Z2SB 1Y0NA 2QA4I 3ASOH 5L3CA 4D9JA 2XKPA 4LG0A 3CDIA 4EVIA 2KL4A 2M45A 1B4AA 3FXMA 4IOAF 1WRJA 1QZYA 3A2KA 3VSKA 2VC1A 5K5RA 1YX5A 1TT0A 4D7NA 1V5FA 3E6DA 3GX4X 2EPFA 3MKYB 1E3HA 4A3JJ 2GXBA 3E5UA 2KLOA 2P5LC 1WJEA 2RQPA 3J81K 1TWFJ 4AD9A 3W6VA 3DU6A 5J1UA 2K27A 4GDFA 1YITI 4OAZA 4BJ6C 4XRFA 3KP2A 4JOMA 3GTQJ 4XKCA 3BDDA 4M6VA 3FXLA 2A6EF 4CCNA 1HCRA 2L0KA 3VYUB 1JTYA 1RR7A 2JMWA 2QWWA 4KN7X 2D5VA 1FP2A 4HLXA 5FKMA 2PFBA 4AIKA 3LOCA 2IA1A 3L7WA 2R5ZA 2QYOA 2O9LA 1KGSA 5B5EC 4A0ZA 4ASNA 3CF5F 2H6BA 5D5XB 2FA5A 4YG2F 2UUZA 1A6IA 4UUSB 1U2WA 5E3OA 3LSTA 1LDDA 3R61A 5TGTA 2LFBA 3HOYJ 5E17F 4OINF 4KDPA 1DPRA 3L2QA 1EV7A 3SZGA 2GOXB 2MLKA 4QWQA 4NC7A 1O3TA 1IRZA 3MVPA 1R1UA 2RQQA 3K4MA 4I76A 4PJMA 5JR3A 3PSIA 4A0XA 3ERED 4XR6A 5E1XA 3BZCA 4CH7A 2XPWA 3KEOA 4DYCA 2XROA 1R5HA 4E7JA 1FMWA 1A5JA 1UHWA 3WTWC 1FWZA 3S2WA 3GYHX 3WTVC 2X6WA 2NVYJ 3GZNB 2LBFA 4HNUA 1YHQI 1ON2A 2LLKA 2VT3A 4IHYA 2FQ3A 1R23A 3OYHA 4B3XA 3ZGKA 3GCMA 1FZPB 1B59A 2YS9A 3TL4X 1F1ZA 2DA2A 2KMUA 3W2VA 4L18B 1U5TC 3BG7A 2HZTA 3J7AO 2HOEA 1PP7U 2K9MA 3ZMDA 4UB6C 5IP9J 1TP4A 5F04A 3FIWA 1ETYA 5CVIA 3CCQI 1ZARA 3OMYA 2F4OB 4ETSA 1G3YA 2P0WA 3HRSA 4DJAA 4KFCA 2CQKA 3BR6A 1J9IA 2DA6A 3DBLB 1HQCA 3MQ0A 2HQAA 1ZK8A 2V9KA 2OTJI 3LFUA 1VFCA 4KIFA 1SVOA 2LTPA 2HOTA 1IXRC 3AG2H 1IZ1A 3LWFA 2OTLI 2CSOA 1ZG5A 2JSPA 1A31A 2R7DA 4BQQA 3FHZA 3IRRA 3TP0A 2YU3A 4ESBA 3H3VK 4D0PA 2DLLA 1SD4A 4U7DA 1WJ5A 4E7HA 3A03A 3R0JA 3GEZA 1D0XA 2IJLA 1DU0A 3QRFF 1T0FC 3U9GA 3ZQHA 3BG3A 4DZJA 5EYRA 1GXQA 3ZXSA 2PJPA 2L2OA 1K78B 1OFCX 4CXFA 3BP8A 3PL8A 3LQQA 4XOTA 2PG4A 5M5YJ 1B72A 3MKWB 3FWEA 1A35A 2LY1A 1R7JA 3D5RC 2A68F 5KNLA 1Q1HA 3IH3A 2E19A 2Q2EB 3LSHA 4MEXF 2A05A 3KIOA 5BNGA 4IHWA 5L3DA 1YI2I 3GTPJ 3KLNA 1GV5A 2EH3A 1BN5A 2BHZA 3WU1B 1L0OC 1FX7A 3JRDA 4DIQA 2XAUA 2L4MA 3BPVA 4C2TA 5FFZA 3BT9A 1T38A 1JKPC 2EFNA 1MDMA 2WB1A 3RKWA 3I3LA 2XAQA 4A12A 3IUOA 3F8NA 4HZFA 5LRSA 1VZ0A 3CJTB 1X1AA 1IN6A 1X1PA 3DBRB 4RA2A 4C3HJ 1GVJA 2FUG2 5ICEA 1MMDA 1R22A 3HGGA 1KU9A 3FM5A 3R60A 3HOXJ 2VLAA 2DK8A 5C4XJ 4GYGA 3OYMA 2LP0A 2X48A 2PQ8A 3RKQA 3RIRA 4C2MJ 1F5TA 2QQAA 1LKXA 3I64A 5B1BH 3N97A 5M3FJ 2L3DA 3FMQA 5HLHA 1BJAA 3HG9A 2QZ8A 1W5CC 3CCRI 1MBGA 4CGZA 4I09A 4D1QA 4PJ0C 1SFEA 1W5SA 1T33A 2VN2A 3O6BB 3RTRA 5E8GA 3I53A 3KEYA 4RMNA 1SD7A 3CD6I 1E3PA 1CF7A 5FJ8J 4KA4A 2OJED 4M9ZA 1J09A 2DJNA 2HVQA 1K61A 1X4PA 1RPWA 5EEGA 2JPCA 4RS8A 3ZR8X 3CCUI 2XASA 4N4NB 3HBLA 3GZ6A 3BTCA 1T08B 3LA7A 4QLCU 3K70D 5TJJA 2CU7A 3JR9A 2WAQN 4X1EA 4YIIA 1PUEE 4KISA 2L7FP 2OQGA 2X6XA 3PFIA 4BDYA 2WV0A 4L9JA 2PEXA 3ML6A 4ZH4F 2LSOA 2XKOA 2R5ZB 1JE8A 4AVZA 4IPAA 4P9UA 2VE9A 5EGOA 2PMZA 4J19A 2M1BA 2OAZA 3FF5A 2IEKA 2QUFA 2HPMA 2ZXJA 3IWZA 5K5QA 2EIKH 3D0SA 2ECBA 2IPQX 5JLWA 4BE1A 3C1DA 5CLSA 3S1QJ 2KP6A 3CC7I 2R7SA 2LRDA 1VQOI 5H6QA 4CDGA 5KAFC 3QWLA 2JA7J 2R7RA 1PUFA 4HV5A 3CDLA 1R36A 3HSFA 4L5EA 4EQQA 3L2VA 1Z9CA 3JW4A 4EMSA 3GLLA 5CVRA 4BH9A 3RYPA 3HJEA 4XN3A 5L3FA 2P4WA 1X19A 2K9QA 4ON0A 4Z6YA 5D4RA 1Z77A 2DN0A 4B4CA 2COBA 2GA1A 3VYSB 2RKHA 1SD5A 3H5AA 3LA2A 4IX7A 2JQ7A 3Q0WA 2NYXA 3KPHA 1WFXA 4L0YB 2YUSA 3BOQA 4CCLA 3W2WA 2CFXA 3OSGA 4RGSA 2JZYA 2LD5A 3AG4H 1MZBA 2DYRH 1XG1A 2KJCA 1B9MA 3OYCA 1Z91A 4WXDA 3ZN0A 2RV8A 2DT5A 3VPRA 3I9V2 2CUEA 3JAMZ 1VQLI 1BW5A 3OL3A 3J7AY 3FXJA 3HOTA 1K6OA 4ENMA 1LE8A 1RI7A 3M1CA 2DDBA 3O8GA 3JRIA 1W7PD 1FOYA 1YE9A 4EJUA 2ZJPF 3HOZJ 1BOBA 3UNGC 5DUIA 4ITVA 3BG6A 2ZMEB 4FE7A 2CV1A 3S1RJ 3BLYA 2XHKA 3PNYA 4ENKA 1UCRA 4BE0A 2VKHA 1H89C 4RM3A 1OQYA 3M3YJ 1JGGA 3WTZA 1ZLKA 3F9KA 2KISA 2EIJH 2LKXA 4AU7A 2CW0F 3IV5A 1K6YA 1WI9A 4AIHA 2L02A 1FBQA 2QSHX 3LL7A 2OU2A 5ERIA 4U7BA 2BW3A 2JK3A 4XN0A 4PJNA 3KZZA 1H8AC 3SZPA 5BPDA 4CYDA 3CCJI 3EUHA 1O57A 3QOPA 1OR7C 4DGWB 2JN6A 3F23A 3BCBA 5ILSA 1G2HA 1Z6TA 2HFHA 3GFMA 1IN5A 1TQIA 2CQQA 2KJBA 3WU2C 5F1RA 2VB6A 3HTSB 1ULYA 5D5UB 1SMTA 1OR7A 2FNPA 5JI6A 3GW2A 2JSCA 3K70C 2KRHA 1A6QA 2K02A 1QZZA 4A3BJ 1O7LA 2A61A 2GXGA 4GO1A 3PJRA 1MGTA 1IJWC 3BR2A 2ZFWA 4XKVA 5M3MJ 3IRQA 4AM3A 3U2RA 4PGGA 2W82A 4F92B 3A02A 3RZDJ 5LGNA 1GLNA 4A3KJ 2FRHA 1YIOA 2ZXIA 1EH7A 4PZJA 2EILH 3CP2A 4P9FA 3S8PA 1IRGA 3DFGA 3V42A 5F0FA 4ZTJA 4UUTA 4UHTA 3HRUA 2H27A 3DKYA 4UVCA 1JTXA 1K4TA 1ZQ3P 2V1DA 1YQAA 2RAEA 4OIPF 1XS9A 4EM1A 4D5FA 4A69C 4PFOA 2R7XA 4L9NA 2VBZA 2K9LA 4KJZA 3P9KA 1P92A 1R5GA 3COAC 4V19K 3EYYA 2W7NA 2FD5A 5EZGA 4Y4RA 1RZ4A 3U21A 1S7AA 1BC8C 4CYCB 4Y33A 3Q9VA 4IVNA 1AWCA 2CUJA 2RN7A 4N9HA 3ABTA 3RSNA 1NH3A 1HLVA 2XUBA 3RQ4A 4HQMA 2M4KA 1MBKA 2A69F 4HG2A 1K83J 2L01A 2STTA 3HGYA 2RREA 2P5VA 4YEJA 3L9FA 4CYCA 3AAFA 2FEZA 2JUCA 1TNSA 2BXYA 2XSDC 3H3UA 2HZDA 4XLFA 1TC3C 1WGXA 3TDUC 3TEDA 1T98A 5LHHA 4U0YA 2JA6J 3PQJA 3AKZA 2NVTJ 4LG3A 4NUBA 3KYLA 3WGGA 1ZRFA 4HX8A 2V1NA 4UVAA 5F0HA 1MD0A 1I27A 3JRFA 2VPLA 5ILUA 5HNFA 1DP7P 2F5CA 3K4LA 1MNEA 3C7JA 2HNHA 4HAMA 4FQGA 2B7EA 4LIVA 2EV0A 5CYVA 2XVCA 2ZCWA 3M1EA 5GAEJ 3L2UA 2Y30A 4EJTA 4BU2A 3GO5A 4M9SA 4V2GA 1OYIA 4N0BA 1FTTA 4HNVA 2OA4A 2JPBA 5BMZA 3OY9A 3WE2A 3BJOA 2Y2ZA 5IP6A 4IJAA 4IEJA 5HNHA 1BA5A 3C3WA 4LB5A 4B3AA 1XGOA 3KZYA 1IW7F 2GZWA 2IT0A 3FM3A 3E6CC 5C3EJ 4C2UA 3HC7A 1MBEA 2M4GA 1QRYA 1IDYA 2DPUA 3H92A 4ZYHA 3IC7A 4B43A 2JT1A 2LY2A 2V1UA 2NOJB 4KYWA 5GTHC 1E0EA 1FPQA 2WA0A 2QCOA 3T0YA 3PNTA 4G9YA 4XK4A 2CJJA 4NC8A 4ENJA 1ZELA 4KMFA 3MZ8A 3REOA 1Y8QB 3WG9A 5JHUA 2X4HA 3K4KA 1MH3A 4YFNF 3KETA 3SJMA 2W84A 3W3CA 1PP8F 4LK0F 1FT9A 1QNTA 1NK3P 3H0GJ 2K9SA 2VJIA 3FKJA 3PUFA 4FCYA 1LQ1A 4HRIA 5E79C 1OISA 2IA2A 3JTGA 3CJRB 4KIGA 4LGWA 3HHGA 4M6YA 3E6BA 2LF8A 3OIPA 5LBQA 3SEZA 1O7FA 3BWGA 4IO9F 4XQFA 4NDLA 3F6OA 4HX4A 4HX7A 1J0RA 1JXSA 1W7PB 4Q4ZF 2KT0A 1J59A 3OIOA 4ZC3A 1WJFA 1LFPA 1P4AA 3CP8A 3E0JB 1Z7UA 2DMPA 4S0HB 3OS0A 3QYEA 2ME6A 2HDDA 3IH4A 4OIOF 1UG0A 2EQRA 4E7ZA 3GVAA 2OUMA 3Q9SA 3CC2I 5BS6A 5HS9A 3FDYA 2DTZA 2QM3A 2FBIA 1QHGA 3M07A 2VJJA 4GYIA 4QPQA 2R7FA 3FXOA 1I5ZA 4XICA 2I8DA 2FSWA 1SC7A 3QQAA 1QHHD 3ZQQA 1U8BA 2IGKA 3R4KA 2ESNA 3WG7H 2VJ4A 3C2GA 1MJAA 3KFWX 1BR2A 3B73A 4FX0A 5F1JA 1JJ6C 1I50J 3BTLA 1J75A 4NB5A 3RKYA 3F3XA 3HHHA 1WI3A 1R9TJ 2E5NA 3JRHA 2KIQA 4EGYA 1W4MA 2X1EA 4UY8I 2X9DA 4E70A 3P9CA 2DJIA 3ZN1A 1EA3A 4NNJA 2DA1A 3V7RA 1VNDA 1XSXA 3JRBA 3QPSA 3MFKA 2E1NA 3A0BC 1H9TA 2ESHA 2QSGX 2V9PA 1IN8A 2HTJA 3PIPF 1JKOC 1FYLA 1QO0D 1FNNA 2ZJ2A 1HF0A 4C30A 4BQNA 4MO7A 3GTOJ 1BI3A 3L2WA 3K0LA 5E8IA 4AYBN 3LQRA 4HF2A 1P9QC 2LC2A 2VE8A 3HKZN 2XRLA 3ASNH 3SHFA 2HVRA 2EWNA 3ZCOA 3OS2A 4HV6A 2XB5A 1B9NA 1FYKA 2XGCA 1IV8A 2V4JC 2ZXHA 3GTKJ 1UMQA 5EDNA 4M3FA 2X6OA 5FD5A 3OV8A 2WAFA 2ME0A 4R1HA 3FX3A 1IDZA 2DT7B 4PGHA 2FE3A 5ICFA 4JX4A 4Q48A 5LD2C 3H3ZA 3P5JA 3BJAA 3RCOA 1GHCA 2HYGD 1ZR2A 2Y9YA 2OV7A 4NQWB 3F8MA 1Z3XA 2ZSHB 3SDBA 4AC0A 1CF7B 3J80Z 1GV2A 3RI4A 4HF0A 4P55A 1W1WE 3F8BA 4BE2A 4BXXJ 2DO7A 2H6CA 3ZMVA 3DKWA 4W1UA 2CO5A 4X6AJ 2A5YB 3G1LA 3R6SA 4RB1A 1D1CA 1G3TA 1MW7A 1UG2A 2HS5A 4RGRA 5H6RA 2Z33A 2FXAA 3ELKA 2ISZA 2ZNYA 4Q47A 1XDSA 3LA3A 2O7OA 4CZZA 2XDVA 5FRMA 1Y56A 2XGEA 2MABA 1SAXA 4BQOA 2DODA 3WHCA 3CUQC 1W0TA 4CA0A 4YIFA 1U9OA 2B0LA 2R7VA 3TDZC 4MQVA 1S5LC 5ILVA 2A6TA 1T39A 1NK2P 1YRNB 3HUGA 2PMZN 3OYBA 5JVGF 4IKFA 3C2HA 5GAGJ 5C44J 4IHTA 4IXAA 2XGDA 3WTTC 1MJBA 1ZLJA 2MC4A 5KK1A 5FGMA 1VQ7I 3KP3A 3HEFA 2FOWA 5B1AH 3KP6A 3MWMA 2CW8A 3NEUA 3ECHA 4I01A 1MNDA 5DUKA 1USSA 1OCOH 1LFUP 2WY7Q 2IRFG 4GCVA 2WBMA 1XGSA 3BR0A 3MN2A 1PYVA 4JX6A 5J4YA 3IH2A 4XOPA 4CCKA 4EATA 1Q1VA 1IAWA 3QYFA 3CMYA 2DCEA 3IAM2 2EK5A 1XMKA 5CPRB 2NS0A 3GFJA 5D4SA 2F5VA 3NARA 1JKRC 3I5UA 3WTSC 3K2ZA 2QKLB 3CCEI 2AXTC 3S1MJ 3VODA 3Q0VA 3G4SI 1K7AA 4RB0A 2KFDA 1T6SA 2DOAA 2M5WA 2EV6A 3TBIA 3RPUD 5HDKA 3NRVA 4KN4X 1QQIA 4RDUA 2VASA 4R79A 3VOEA 4A5NA 3LSRA 3ZQIA 2E1OA 3F72A 4LG0B 2MW8A 2V26A 5L3EA 3IHUA 1DQUA 2W4SA 2DMQA 1YS6A 1YJNI 1VQ8I 1XPXA 2CQ7A 1HA8A 4HEA2 3DQVC 1HW1A 1P4WA 3I54A 4UB8C 4G7ZF 3HUGB 2C6YA 2MC3A 1IGNA 4A2UA 5D5WB 1EF4A 2ID6A 1Z05A 1SFOJ 1ETWA 2X51A 3M9AA 4OU0A 4G8XA 4P96A 2K40A 3FK6A 1I3AA 1MIJA 1P2FA 4HSRA 2E1MC 2E5ZA 4G6QA 1S29A 1XN7A 3BY6A 2RDPA 3LAJA 5LFAA 2PBIA 1RESA 1AU7A 2M7BA 3ECOA 2O3FA 2XAGA 2HKOA 4B8XA 2VL8A 4A3LJ 1DPUA 1X2NA 2VXZA 4EJOA 1MJ9A 2JA5J 1J2XA 2XAJA 3CC4I 4PCQA 4RAZA 1TBXA 2A5WA 1TL8A 1QBJA 1GT0C 2N8GA 1QZEA 3PO2J 2Z5UA 4M74A 2UWMA 5TRDA 3O2PE 1V4RA 3VWBA 2XAHA 1WKMA 1G3SA 4O3MA 1EH6A 2E60A 2XF7A 1RC9A 1S9HA 5F0CA 5GPAA 5IYBJ 4A6EA 3GZ5A 3CCMI 1XSDA 4ZZLA 3KCCA 5FKKA 2E71A 4RAGA 2DFFA 1TWGJ 3DP7A 3LFKA 2JVGA 3EQLF 2R3SA 1FIAA 2AQFA 3F22A 1ZR4A 3HKZA 1MBHA 3HOWJ 3MD2A 2ZO4A 3AFHA 2HQNA 1JKQC 2B63J 4UV8A 2F2EA 5J40A 4KIBA 1YG2A 2G7HA 4MLOA 4MEYF 1AKHB 3AG3H 3RPUA 1GVDA 5AIPA 4OIRF 1R5ID 3SFIA 1FP1D 4BDZA 3F21A 2ISYA 5EEHA 1XMXA 3JAMK 2AHQA 2LH9A 4LLLA 1YJ9I 1KYZA 3RDIA 4CO8A 2VODA 1LEAA 1BJZA 2K85A 3JCUC 3SFZA 2MYSA 2JTVA 5FKNA 1Z21A 5KHDA 4E4HA 1XTAA 5GP9A 3FXQA 3HYIA 4RM2A 2R7ZJ 5HDGA 4DQ2A 3KYCB 4M73A 3TO6A 2M2EA 2BVMA 1Z7LA 2X1CA 3ABMH 4G6DA 1TTYA 2MFZA 3T8RA 4U88A 3OYJA 2E7XA 3ZMZA 5H20A 2ZB9A 1XGNA 2CUZA 5E3LA 4CSWA 1VI0A 1Z6RA 2TCTA 4YRVA 2Y0SA 4KITB 3KE2A 5J8FA 4OMZA 3S16J 4UV9A 2LDUA 2WAEA 2R92J 4BHPA 1LNWA 2XGXA 4G7OF 1ENHA 3TW6A 3HOSA 4KMUX 5FB2A 3E5QA 3G1OA 1T2KA 4M72A 1X3UA 1B8IB 4XL9A 1SFKA 3H0DA 3PQKA 2ICWG 3RKXA 1DUXC 3X2QH 3I59B 5JHFA 4DNCA 4XIDA 1KU7A 1LVAA 4EEFG 3FKIJ 2IS4A 1X1DA 2WTEA 3HZJA 2AS5F 5E1ZB 1MNMC 3LSMA 2JA8J 2V6EA 3CMAI 2KPMA 3S3MA 3K1PA 2CS3A 4PSWA 1N77A 1BR1A 3E1SA 5FFXA 2V7FA 1Y1WJ 4AWXB 2Y9ZA 1OCTC 2KZVA 2L9NA 4OWRB 3MAJA 2M30A 2O8KA 2VBXA 3L2CA 1FC3A 3DWLE 1X2MA 6PAXA 1ZGWA 3H1CA 1KA8A 2H1LA 2KHMA 4FE4A 3DV8A 4RBOA 3K4JA 1T8IA 2EZIA 2BYVE 5IT3A 2LBFB 1S6LA 5EGOB 5IPAA 2EFPA 1UJ8A 1R1TA 4DYQA 3FZVA 3QU6A 4O6JA 2DA3A 4I6ZA 1V5GA 2M0MA 4HDVA 1UHSA 4F93B 1XCVA 1HW5A 2NS8A 2Z9OA 4N4OB 3C18A 1VTNC 3QPTA 1FTZA 1FOXA 4PUSA 2W1OA 1MMAA 2D1HA 3OWTA 1CQTA 1HXDA 2BHYA 4XNFA 3TMOA 3I71A 2HYFA 5DTDA 1S8NA 3HRTA 1RETA 3BPXA 4RB2C 3CJQB 2E1CA 1IN4A 4IHVA 3GWZA 4ZYAA 3BR3A 2HGCA 3MEXA 2VQCA 3RZOJ 4PDKA 1BW6A 1DGWY 1E2XA 1K78A 3HL2A 1O4XA 1N78A 2DFIA 3DF8A 1O3RA 1KQ9A 2BXZA 3CLOA 5LHIA 4IRGA 1ON1A 3WODF 3OYNA 3S3NA 4BEHB 3ABKH 5K1YA 3V8JA 4NQWA 3J81Z 3ZP5A 5DD8A 2IGMA 1E3OC 5FKOA 4YFKF 3G1MA 1FY7A 3DPLC 3PIOF 1YS7A 3PUBA 2R7OA 2DPDA 4Y13A 2R7TA 1ZKGA 2P5KA 1UELB 5HS8A 1SANA 3HM5A 3S14J 1YIJI 1ZREA 2BZTA 3J7ZI 1FIPA 2VKVA 1KQ8A 3ISPA 2LKSA 2F5FA 4AVPA 5J1YA 1WZ2A 2L7MP 2IS6A 4XLCA 4BJTA 1QPMA 4G12A 4W97A 1JJ8C 1TW3A 2ZBKA 2LMDA 3UKGA 3CJNA 5HLTA 4A3EJ 4DYRA 2CGPA 4L5JA 4BBRJ 2H94A 4R8HA 1BIBA 4Z2YA 4FHTA 2A07F 2OZ6A 1YRNA 4PFPA 5LGUA 1WSUA 1NHAA 1Z67A 2FMLA 2GWRA 3QODA 4JYKA 4RAYA 4ZDPA 5IYCJ 2H1KA 3AL0C 2WV1A 4B09A 2JRTA 2IS2A 4WX9A 3FXRA 3M8FA 3T5XA 2NVQJ 1V5EA 5DM6F 1R00A 5A2QZ 3JTHA 3VB2A 2E1MB 4ESJA 1LFBA 3VSLA 2EBIA 2HWVA 2VQHA 2R93J 3LSPA 1PVEA 5KAIC 3MKLA 5D6EA 2NVXJ 3EPZA 4BXFA 2Z16A 2L5QA 2GIVA 1F43A 4L9VA 9ANTA 4FISA 5JFRA 1CGPA 2GAUA 3DPUA 1MKMA 4Y7NJ 2DU9A 2DQLA 4OMYA 4IF4A 3OR2C 1X1BA 3DEUA 4BL0B 3S2DJ 3HRMA 4A5MA 2OD5A 2YX7A 2XPUA 4MQ9F 3TO9A 3ZQGA 2D45A 3Q0UA 3BJ6A 1ZN2A 2JUGA 3ZMTA 4D5CA 1UAAA 1XCBA 3OL4A 4S04A 4XSZF 3TQNA 4S05A 3J7YJ 2IW5A 4WF2A 3Q3SA 4HSTA 1HC8A 3HIFA 1YFHA 1P7IA 1ZH5A 3CF2A 2PI0A 3M4OJ 1LJ9A 1KU3A 2LOOA 1E17A 5M5XJ 2FF4A 2NVUB 5ED4A 4I98B 3HPHA 2M8GX 4JQFA 2CQNA 4H0EA 2NXNB 2XF6A 1Y1VJ 2IVMA 1GDTA 4M6XA 4I0BA 3FXKA 4A3IJ 2VUMJ 3M7GA 1B1BA 3TW7A 2LF7A 2LREA 1D8KA 4F91B 1XMAA 4JP0A 1JI8A 1V55H 1IV6A 1D1AA 5J3LA 2L7KA 3K9TA 4E7KA 1LEBA 3I56I 1EH8A 4Y17A 1LUJB 2DMNA 5EEAA 2DAOA 2DYSH 3I4NJ 1AKHA 1OPCA 1I3QJ 2BY2A 2UZKA 3CCVI 1R4NB 3ZQFA 2CQXA 3K7AJ 4NC6A 1IO2A 1B6AA 2QQ9A 1O3SA 2VXDA 5DV5A 3I58A 3KEQA 2ADUA 2GA2A 1JUSA 3S17J 2ZFUA 1PUFB 2FJ1A 4M71A 2DOEA 2LKPA 1T95A 1B8IA 3CUQB 4LMYA 2I5UA 4L9TA 2EIMH 2LYCA 3G2BA 4K2EA 4UUSA 1HDDC 1IUFA 1VF9A 1HSJA 3G3ZA 4ZTFA 4GFBA 4ZZDA 1AHDP 2BGCA 2FNAA 4IRIA 3DEWA 2IAIA 2PX9A 2K3FA 1ITYA 3H5NA 2QQ8A 1K79A 2K3PA 2E7WA 2P6SA 4HW0A 1EKEA 2DA7A 2LVSA 1RKTA 3O3KA 4L0ZB 4WXCA 1ZRCA 1FOKA 3MZHA 3SYTA 3K1MA 3K2AA 3S1NJ 1V54H 3WU0A 5J8CA 3V8KA 5J1RA 5E18F 2ACJA 1VQNI 3TP3A 2IXSA 3BROA 5HVQC 4PSXA 1WCMJ 2ECCA 2MBFA 2WC2A 4PJLA 1UHMA 3B6CA 1WQ2A 5ICCA 2O61A 2P7VB 1X3WB 2EFWA 2VJ5A 1QU3A 2EJRA 1TWCJ 4BUPA 1AOYA 4LLNA 3LAPA 1D5VA 3JREA 3WGHA 4J01A 1VQ5I 4EM0B 2DDAA 4MHGA 5K7FA 5M5WJ 1ORKA 1NTCA 1HKQA 5DCFA 1USTA 4B1RA 4XLPF 3NWTA 2EV5A 2QLZA 1Y0UA 4BKXA 2OZUA 4I7HA 3OYAA 1JHFA 4QPOA 4B48A 2O6GE 1AA7A 3A01A 4A6DA 1TW2A 1P4XA 2YPRA 1Y6IA 3HOUJ 1BI2A 3PSFA 2IBDA 2TRTA 1WH5A 3DBHB 2MD5A 5EG0A 2HDWA 3VFZA 4CHUA 3M8JA 2JA2A 3CUOA 4EV0A 2L9RA 5HLGA 3CO6C 5K7ZA 2ELKA 5IOYA 1W5TA 4ZDOA 4P1WA 3TOAA 2RNGA 2RC4A 4NBQA 2QSFX 3E7LA 2DMTA 1UZCA 2MLGA 1ZGAA 3CCLI 3CQZJ 1KQ0A 3I59A 3MKZA 4P5OA 3E6MA 4MIMA 2A6HF 1HW2A 5FROA 2JJ7A 5D8LB 2ELHA 5HDNA 3QP6A 2BE5F 4GGGA 3RYRA 4FX4A 5B66C 3KLOA 2E36A 3OYEA 1VQ4I 2Z99A 4UUVA 4G6TB 1C0WA 1ZTRA 5HS7A 1XDUA 1B72B 2R0QC 2WY8Q 1JUMA 3LSGA 2CMPA 1ACIA 3I4PA 3GF2A 5C4JJ 4MTEA 3JSPA 5EZHA 3P9IA 4HDUA 2MGQA 4A3GJ 1SFXA 5DCMA 1U5TB 3E97A 2H8WA 1BM9A 2M34A 4HOBA 3U1KA 1IRFA 2AQEA 4LOCA 3NQOA 1J7KA 4UVBA 3S93A 3OYFA 1R6RA 5BQTA 5KVRA 3KYDB 4DW6A 3H9JA 2MH2A 4AUXA 5F6FA 1D0ZA 4XLEA 2Y69H 1SVLA 5E20A 3OIQA 2GOMA 1ZRDA 4MFEA 2VKDA 3QPHA 3BTJA 1JUPA 4BHCA 4HLYA 3BQZA 4DBRA 3D5LA 3WGIA 2G9WA 4U0WA 1Z0XA 4Q5SF 2UXXA 2OPTA 2XRNA 4LFUA 2WB1N 2GIZA 4KT5C 2G7UA 4RGUA 2P81A 2YU9J 5ICGA 1OYWA 1H88C 1R4MB 2QF7A 4M3BA 1IXCA 3K10A 3KP4A 2O5RA 3J80K 3OYGA 2ELJA 3IL2A 3LMMA 3WTXC 5DM7F 1QA6A 4KUMA 3CLQA 1QPIA 5IYDJ 2OCEA 2PN6A 3A01B 4IQJA 3PO3J 2MA3A 2F48A 4CZCA 4YIRX 4MTDA 5LEKA 3OYDA 2TDXA 4M3GA 5GPCA 5FLXZ 4FTHA 1YO5C 1DDNA 1G3WA 3BTIA 3WTYC 1REPC 1KU2A 3GBGA 3K1NA 4BBSJ 3SZTA 2HQ5A 2XV4S 3MZYA 4L5IA 3ZQCA 5HOOA 1S7EA 3QU3A 1F9NA 1MBJA 4B47A 4GRIA 1FJLA 2GM4A 2NS7A 2E35A 4RLFA 5A2QK 5IT9K 1PDNC 4AYBA 1I1GA 2HEOA 1S3JA 2CWEA 4E7IA 3K69A 2ZC2A 1HBXG 3RJPA 2W48A 3ZOBA 3ERMA 1FYMA 2PMHA 4BS9A 3ROUA 1TNTA 3HTUA 1OCCH 3DTEA 3ABUA 1ZG3A 2Q0OA 2KQRA 3IAS2 2CYYA 1XD7A 3WE3A 1WPKA 3L00A 3PNVA 1S7OA 1LDJA 4F55A 3BQYA 2XSJC 1POGA 2RVCA 3H5RA 3ESWB 2KDOA 5HLIA 3S2HJ 5B3SH 2IS1A 2DTRA 2M8EA 2ID3A 4H4KC 4DOZA 5FLVA 4RGXA 4XLHA 4ZYDA 3VYTB 4XKBA 3EETA 1X58A 3HPGA 2KDZA 3FBNB 2L9SA 1UFMA 1STZA 4BJ5C 5EJCA 3RPQA 2HU9A 2PJRA 4WWCA 4A3DJ 1FSEA 4EJVA 3JRAA 5CVJA 1FBSA 1YX3A 1W36D 1WJBA 2LNBA 4EM2A 3CO7C 5CKTA 5H2FC 2QVOA 1ETOA 2LR8A 2COMA 4UXNA 1ONVA 2EZKA 4E7SA 3R0AA 4XLAA 3E5XA 2DA5A 4BEHA 1FLIA 2O03A 3CCYA 5L3BA 1D0YA 3ZRGA 2HDCA 1ETXA 1VQ6I 1IG7A 2ZNZA 1QVTA 3KX2A 3JSOA 1W7PA 4E7LA 4NHJA 1SEUA 2W25A 4ANJA 4BYYA 2HTSA 2BY1A 1ZAOA 5E3MA 2X1DA 3BG9A 2X0LA 1ZG1A 5AONA 1J5YA 2ZMEA 5J4VA 2E2IJ 4D7MA 4BNCA 3DCFA 4PK4A 1FBUA 3FK7A 3FXUA 2KRCA 2JWTA 3OOPA 2LG4A
chains in the Genus database with same CATH topology
3CJQB 4C2UA 3HC7A 3DU6A 4ZYAA 2M4GA 1DGRM 2VQCA 4OAZA 4BJ6C 4B43A 4JOMA 2LY2A 2NOJB 1DGWY 4XKCA 2F6CA 1E0EA 2VQLA 4CCNA 3VYUB 3CESA 3HL2A 5CQEA 2WA0A 1N78A 3PNTA 2BOLA 4NC8A 1ZELA 2DT6A 4BEHB 3OYNA 3S3NA 2IGMA 3K4KA 1LVKA 2UUZA 3W3CA 3DPLC 3PUBA 2R7OA 2R7TA 2VJIA 3FKJA 4HRIA 1UELB 5KCMA 5TGTA 3EUAA 3CJRB 3IP4B 3L2QA 3SZGA 2GOXB 3W2AA 4NC7A 1N75A 3OIPA 3SEZA 2RQQA 2XF5A 3K4MA 4PJMA 2IS6A 4XLCA 4BJTA 4XQFA 3K4NA 3PSIA 4XR6A 4CH7A 2X85A 4E7JA 1FMWA 5HLTA 2X6WA 4ZC3A 1WJFA 1LFPA 2LBFA 3CP8A 3E0JB 4HNUA 3OS0A 3QYEA 3OYHA 1UG0A 1FMVA 4B3XA 4E7ZA 3ZGKA 2K5CA 2OUMA 3FDYA 1WJAA 3OR1C 4PFPA 3TL4X 4BACA 4ZDPA 3QODA 2KMUA 3W2VA 1QHGA 2CV2A 2VJJA 4QPQA 3AL0C 3BG7A 3BC8A 2I8DA 2IS2A 3DKXA 3CMMA 1V5EA 2K9MA 1QHHD 3ZQQA 3H9GA 3OS1A 2IGKA 2E1MB 2VJ4A 3A1YA 3C2GA 3OMYA 3VSLA 1BR2A 2VQHA 2P0WA 4X0GA 2OC6A 3H35A 4DJAA 3EUHC 2E5NA 5FRNA 3EPZA 2X1EA 4BXFA 2HQAA 2L5QA 2V9KA 2Z16A 3EUKL 2DJIA 3LFUA 1EA3A 4NNJA 3DPUA 3DU5A 2QKMB 3VYRB 2X6YA 2JSPA 1X1BA 3OR2C 4BL0B 4BQQA 1MMGA 2Q1ZB 1WJ5A 2PJRB 4E7HA 2JUGA 1D0XA 1UAAA 3OL4A 4C30A 3S32A 4BQNA 1T0FC 3QYBA 3L2WA 1BR4A 4HSTA 3ZXSA 2L2OA 4E6KG 3CF2A 1P9QC 2LC2A 3PL8A 4FETA 4XOTA 2LOOA 3MKWB 2HVRA 3HPHA 4JQFA 2LY1A 2W00A 3D5RC 4XMYA 3ZCOA 4CCJA 3OS2A 5KNLA 3H9QA 2XF6A 2V4JC 2ZXHA 3QOEA 3LSHA 2Q2EB 2BW3B 5CQGA 2WAFA 2M7AA 2LREA 4F91B 2DT7B 4DIQA 2XAUA 5LD2C 3RCOA 1X1CA 4C2TA 1DP3A 1JI8A 1D1AA 2OV7A 4NQWB 3OYKA 1Z3XA 2WB1A 2L7KA 2ZSIB 2ZSHB 3I3LA 3SDBA 3OOUA 4E7KA 3IUOA 1SAUA 1VZ0A 1X1AA 4HNTA 2R7QA 2FUG2 4BE2A 2R4GA 1MMDA 4CCMA 4Y3OA 3ONQA 4LIUA 2VLAA 1D1CA 2VXDA 1MW7A 4F52A 3K6GA 3OYMA 1U0JA 1WJCA 2XDVA 2ZFUA 5FRMA 4ZDLA 1Y56A 2MABA 1LKXA 1T95A 3UR3C 4BQOA 3HG9A 3DEEA 4CA0A 4CUGA 4D1QA 2LYCA 3G2BA 2UV1A 4XORA 2R7VA 4C9YA 2A6TA 3RTRA 3KEYA 2HPIA 4ZTFA 3OYBA 4RMNA 4IKFA 3C2HA 2VQGA 3H5NA 1J09A 2K3PA 4II3A 2HVQA 2MC4A 1X4PA 4U87A 3ZR8X 4N4NB 3SYTA 3K70D 2CW7A 3S3OA 2CW8A 4KISA 1MNDA 2CH0A 2IXSA 2X6XA 5HVQC 4PSXA 4PJLA 2WY7Q 4BDYA 2WBMA 4BGDA 3VDXA 1PYVA 4XOPA 4AVZA 4CCKA 2PMZA 4EATA 1X4OA 2VJ5A 1QU3A 2JVHA 3QYFA 4BUPA 3AL0B 4OAYA 2HPMA 4LITA 2DCEA 3IAM2 4J01A 3LSIA 4BE1A 5CPRB 2KP6A 2F5VA 1ERDA 4CCOA 2R7SA 3NWTA 2LRDA 2QKLB 3LSKA 3OYAA 4QPOA 2R7RA 4B48A 4XONA 3K4CA 1LDKB 3D5SC 1AA7A 1KONA 1TZLA 2IGOA 3L2VA 1Y6IA 2BVLA 2DOAA 3PSFA 3TBIA 3RPUD 2CV0A 4XN3A 3SEQA 1X19A 2VASA 4R79A 2HDWA 1G59A 3M8JA 2JA2A 3PFYA 3VYSB 2V26A 3A4CA 3H5AA 2WADA 1DQUA 2W4SA 4IX7A 2HVSA 4ZDOA 1HA8A 4P1WA 4HEA2 3DQVC 2RNGA 1WFXA 3HUGB 3DPTA 4CCLA 3W2WA 3NWSA 2MD0A 2R7UA 3MKZA 4P5OA 3OYCA 1WJDA 1OLTA 5FROA 2X51A 3I9V2 4II2A 3OL3A 3J7AY 3HOTA 4HSRA 2E1MC 2E5ZA 3M1CA 3OYEA 1YE9A 4G6TB 1BOBA 3MMYB 3UNGC 4RLQA 5LFAA 2WY8Q 4ITVA 3N05A 3BG6A 2M7BA 2CV1A 3LSGA 2CMPA 3BLYA 4F3QA 2VL8A 3PNYA 2VXZA 2XC7A 2VKHA 3OYLA 4BE0A 4RM3A 2A5WA 3K4BA 1NG6A 3F9KA 4AU7A 3OYFA 2AQEA 3S93A 2UWMA 4KT6A 4XM3A 1R6RA 1K6YA 3VWBA 3H9JA 3LL7A 1D0ZA 2E60A 2XF7A 2IGNA 4XLEA 4U7BA 1S9HA 2BW3A 3OIQA 4XN0A 2GOMA 4FASD 4PJNA 2VKDA 3DTKA 4DBRA 3D5LA 1OR7C 2JVGA 4DGWB 3BCAA 2AQFA 4IQ4A 3BCBA 3HKZA 3MD2A 2M3AA 4YELA 3AFHA 2VB6A 2CFOA 2F4IA 4MLOA 3K10A 3K70C 2KRHA 2O5RA 3OYGA 4BDZA 2WAQA 2ELJA 1PJRA 3LMMA 2LH9A 3PJRA 4XKVA 4IQJA 2W82A 3FHNA 4XKWA 2MYSA 4F92B 4CZCA 1GLNA 1Z21A 3OYDA 5KHDA 4E4HA 2ZXIA 2DXIA 3CP2A 4RM2A 1NG7A 3GBGA 3S8PA 3L2RA 5HOOA 2BVMA 1Z7LA 2X1CA 3V42A 2MFZA 4B47A 4ZTJA 4IZZA 4GRIA 3OYJA 4RLFA 2CUZA 1D1BA 3DKYA 4CSWA 4AYBA 4YRVA 2Y0SA 3DTIA 4KITB 4E7IA 4PFOA 2R7XA 2WAEA 2K9LA 4KJZA 4BS9A 1MMNA 3HOSA 4DBQA 3DTEA 2W7NA 2KQRA 4XL9A 3IAS2 1SFKA 4Y4RA 3U21A 3H0DA 3OYIA 4Y33A 3PNVA 2CUJA 5JHFA 4F55A 2XSJC 4ZJZA 2VIXA 1W36C 2IS4A 1X1DA 3H5RA 2KDOA 3RSNA 2IS1A 3RQ4A 2M4KA 4HG2A 4H4KC 4DOZA 3LSMA 2Z1DA 1IRXA 1G8XA 2V6EA 2KPMA 4XLHA 3S3MA 2CS3A 3VYTB 2R7WA 2RREA 4PSWA 1N77A 1BR1A 1Z3YA 4J00A 4XKBA 4YEJA 3E1SA 3HPGA 2V7FA 3FBIB 2L9SA 3FBNB 4BJ5C 2HU9A 2PJRA 2HZDA 4XLFA 2KZVA 2L9NA 3HXLA 4OWRB 1YX3A 1W36D 1WJBA 3DLAA 3DWLE 3AKZA 4B44A 4LG3A 4NUBA 3KYLA 5CKTA 4HPQA 2V1NA 4PJJA 2VPLA 5HNFA 2KHMA 4E7SA 3K4LA 1MNEA 2HNHA 4XLAA 4BEHA 3K4JA 4LIVA 2LBFB 3L2UA 1D0YA 3ZRGA 3CZ6A 4BU2A 2Z2SB 3KX2A 4E7LA 4D9JA 1V5GA 2M0MA 4F93B 2KL4A 4ANJA 4N4OB 3OY9A 4PUSA 3A2KA 2X1DA 2W1OA 3VSKA 1MMAA 5HNHA 3OWTA 1YX5A 1TT0A 4PK4A 1V5FA 4XNFA 3TMOA 3MKYB 2KRCA 2KLOA 1WJEA 2LG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMY A;  1DP3 A;  4QPO A;  4QPQ A; 
#chains in the Genus database with same CATH topology
 3AG1 H;  3VEP A;  1QVU A;  2YX4 A;  2BV6 A;  2GQQ A;  5J47 A;  2XB0 X;  5DCM B;  1DGR M;  3T8T A;  3TOB A;  4CIC A;  2F6C A;  2VQL A;  5F27 A;  4N9I A;  3KP5 A;  1H9G A;  3CES A;  5CQE A;  3ZMU A;  4BAY A;  1OJL A;  5BOX A;  2BOL A;  1HKT A;  2HXO A;  4I02 A;  1K4S A;  2DT6 A;  2QBY A;  4IHX A;  1RUO A;  2VC0 A;  1TLH B;  1TQM A;  2LK2 A;  1XX5 A;  1R49 A;  4RB3 C;  2EIN H;  5CVU A;  2QGU A;  4ZYG A;  3WHB A;  1LVK A;  2OQR A;  2E2H J;  1ETQ A;  1U3E M;  3V8L A;  2VON A;  2D1V A;  2EZL A;  5DD4 A;  1UB9 A;  2STW A;  5KCM A;  1YLF A;  1OMI A;  1U5T A;  1XC5 A;  3EUA A;  5IOZ A;  2L9V A;  3I4M J;  3IP4 B;  2M87 A;  2PMU A;  5F08 A;  2YSR A;  3GLX A;  3N4M A;  1KZH A;  2QBY B;  2EZH A;  1N75 A;  3W2A A;  2BBY A;  2XF5 A;  4HQE A;  4AIJ A;  3K4N A;  5IT9 Z;  1G6N A;  2X85 A;  3HOV J;  3V7S A;  1SFU A;  1HOM A;  5FLX K;  1FMV A;  1TQP A;  1ETK A;  2K5C A;  1BBY A;  3S15 J;  2QEX I;  2MSY A;  2P6T A;  1WJA A;  3OR1 C;  1RKW A;  3CCS I;  3M8E A;  3PM1 A;  4I0A A;  4MFD A;  5D6F A;  5L3G A;  4BAC A;  3CDH A;  2WWY A;  2CV2 A;  2I10 A;  1MH4 A;  1I39 A;  1Y8R B;  5E3N A;  2VOO A;  2IA0 A;  5K5O A;  3BC8 A;  1YTY A;  2ZME C;  5FD6 A;  4A0Y A;  3DKX A;  3CMM A;  1MMS A;  3H9G A;  3OS1 A;  2B9S A;  1U78 A;  1R1V A;  3A1Y A;  2KRF A;  3W6K B;  1YW7 A;  3O8H A;  4X0G A;  1KYW A;  4IRH A;  2OC6 A;  1VQP I;  3H35 A;  1G4D A;  3U1D A;  3GTL J;  4KIC A;  3EUH C;  3HSR A;  1XSV A;  2W85 A;  5FRN A;  5DEQ A;  4XBF A;  1RIO H;  3Q5F A;  2ZJR F;  3EUK L;  1W0U A;  2VPR A;  2AO9 A;  4G7H F;  4A3F J;  1SVM A;  3HB9 A;  1YYV A;  1ZYR F;  4MNU A;  3RQI A;  1R71 A;  5FLM J;  1WH7 A;  1VQK I;  3DU5 A;  2QKM B;  3VYR B;  4DZP A;  2X6Y A;  3B02 A;  1MDM B;  3BZK A;  1LE8 B;  3GTG J;  1MMG A;  2Q1Z B;  5LLQ A;  2Y75 A;  2PJR B;  4O5V A;  2KIU A;  4HYE A;  2KIF A;  1APL C;  5DS9 A;  3S32 A;  5DDG A;  3FMS A;  3QYB A;  2FOK A;  1BR4 A;  1TWA J;  4HA8 A;  5K7H A;  4E6K G;  4M3D A;  2K9N A;  3C2B A;  2ZKZ A;  3FIS A;  4FET A;  1BIA A;  1HST A;  2YR2 A;  1BC7 C;  3HDD A;  1IC8 A;  2A3S A;  2ETH A;  2J5P A;  4QTR A;  1VQ9 I;  5EG0 B;  3LSJ A;  2HOS A;  2W00 A;  4XMY A;  4CCJ A;  1OCZ H;  3H9Q A;  5GAH J;  3DLL F;  3QOE A;  5BPI A;  1WHU A;  2BW3 B;  2GBY A;  3L09 A;  5CQG A;  1A04 A;  2M7A A;  3BG5 A;  4M9X A;  3V7C A;  2FBK A;  1OYY A;  1X1C A;  2H09 A;  1EJ9 A;  1DP3 A;  2V1X A;  4WK8 F;  4QSH A;  3OYK A;  4JX5 A;  3WTU C;  4LJZ F;  2ZSI B;  3EYI A;  3OOU A;  5IP7 J;  2LY9 A;  1SAU A;  1A36 A;  3F0C A;  4HNT A;  4EJW A;  2R7Q A;  2DFE A;  1IUY A;  1JGS A;  2R4G A;  3D1N I;  4I2O A;  3FMR A;  4CCM A;  2F4M B;  2VKE A;  4Y3O A;  1JT0 A;  3BR1 A;  3ONQ A;  4LIU A;  1XGM A;  3G71 I;  4F52 A;  4ZYE A;  3JRG A;  5E1W A;  3QP5 A;  2DBB A;  2NAZ A;  3GTJ J;  4OIQ F;  2W24 A;  3K6G A;  2VI6 A;  1U0J A;  1OCP A;  1WJC A;  3SXY A;  4ZDL A;  4UNO A;  2HOA A;  3SQN A;  1P6R A;  3UR3 C;  2RGV A;  1ZGJ A;  3DEE A;  4XSX F;  2M0C A;  4CUG A;  4XOR A;  2UV1 A;  4F7Z A;  2K4B A;  1RUN A;  4C9Y A;  4BQA A;  2HPI A;  3NAU A;  4Y52 J;  2VQG A;  2PLY A;  2MG4 A;  1MBF A;  2FQ4 A;  1M1E B;  2HQR A;  4II3 A;  1FSH A;  4U87 A;  3IKV A;  1L3L A;  2ZXW H;  4A3C J;  2UXN A;  1V3F A;  2HI3 A;  2DK5 A;  2CW7 A;  5FO5 A;  3S3O A;  4BY1 J;  5AIQ A;  1IN7 A;  5CJ9 A;  1OCR H;  2CH0 A;  2AXL A;  1OKR A;  2FU4 A;  2Y0M A;  2O0Y A;  2VBW A;  3ULQ B;  2HYJ A;  4BGD A;  4WXH A;  3VDX A;  1D3Y A;  3GFI A;  4IOC F;  1X4O A;  1I1S A;  2KIM A;  4XRS G;  2JVH A;  2K7L A;  3AL0 B;  4OAY A;  2L4A A;  4LIT A;  2BEO A;  3W6J B;  1F36 A;  1P7J A;  5GTI C;  5EF6 A;  2EFO A;  2QEN A;  3BR5 A;  2H8R A;  3LSI A;  1RR8 C;  2G0E A;  1IF1 A;  3DXJ F;  1ERD A;  4CCO A;  3ZMS A;  2DOF A;  3LSK A;  3TKY A;  4BHB A;  2RNJ A;  4XON A;  1WWX A;  1LDK B;  3K4C A;  3D5S C;  5TIS C;  1O3Q A;  1KON A;  1TZL A;  1YOV B;  2IGO A;  3B6A A;  2R5Y B;  2P8T A;  1ODD A;  4C3I J;  2BVL A;  4BXU A;  2CV0 A;  1RNL A;  1SMY F;  2DMU A;  3SEQ A;  1I6H J;  1G59 A;  3PFY A;  1ZHF A;  1Y39 A;  3A4C A;  2WAD A;  4WCG A;  2V9V A;  2HVS A;  2D2W A;  1FOW A;  5D5V B;  1IXS B;  2DI3 A;  3DPT A;  3G6E I;  2L7Z A;  3NWS A;  3JRC A;  2MD0 A;  2Y48 A;  2NRA C;  3I0T A;  2R7U A;  4QIW N;  4U0V A;  2GXA A;  1WJD A;  4JK1 X;  1OLT A;  1BI1 A;  2J5O A;  2DA4 A;  4II2 A;  2V79 A;  3F6V A;  1GXP A;  3F8F A;  5CVV A;  4LB6 B;  2V6C A;  1YW9 A;  2OF7 A;  3MMY B;  4RLQ A;  3IWF A;  3N05 A;  4KNY A;  4MGR A;  2IP2 A;  3BZ6 A;  4F3Q A;  2W57 A;  4BY7 J;  1ETV A;  2XC7 A;  1RRJ A;  3OYL A;  4G94 A;  1HDP A;  4ESF A;  3K4B A;  1NG6 A;  3V4G A;  2XPV A;  1D5Y A;  2DFH A;  2EA2 A;  4KT6 A;  4XM3 A;  3SDG A;  5GAD J;  1JT6 A;  4I99 C;  3CUQ A;  1YJW I;  2IGN A;  4JBA A;  1SD6 A;  4FAS D;  4XRS A;  1N25 A;  2R5Y A;  3DTK A;  1LB2 A;  4ENN A;  5LHG A;  3BCA A;  1QGP A;  4IQ4 A;  2F5E A;  3A0H C;  3G73 A;  2M3A A;  4YEL A;  3CME I;  3HSE A;  3T1B A;  2OBP A;  1YW8 A;  2XIG A;  2E2J J;  3QAH A;  2CRG A;  5JVT A;  5J6X A;  5JLX A;  2CFO A;  4EGZ A;  2F4I A;  1H0M A;  3TO7 A;  2FX0 A;  1S72 I;  4FT8 A;  3EDP A;  1X3Z B;  2HXI A;  2OCC H;  2WAQ A;  3I55 I;  1PJR A;  3CTA A;  1BOA A;  2DW4 A;  3L1P A;  2Z3Y A;  4ABZ A;  4HF1 A;  5F64 A;  5D8K B;  3FHN A;  5FKL A;  2O8X A;  4XKW A;  2NOG A;  5HOD A;  4RAF A;  4LD5 A;  1JHH A;  2DXI A;  2M9H A;  2KZG A;  4V2F A;  1FEX A;  2VT2 A;  3MCZ A;  2Y31 A;  4IL6 C;  1NG7 A;  3GUD A;  1I6X A;  3L2R A;  4XLN F;  2Q8K A;  2P7C B;  4IZZ A;  4Y15 A;  4M3E A;  3GXO A;  1D1B A;  4XRM A;  3DTI A;  3GTM J;  2BY3 A;  2ZJQ F;  1BL0 A;  2KKO A;  1T56 A;  4LLG F;  1HKS A;  4AID A;  2VOP A;  3LNQ A;  1MMN A;  1XB4 A;  2MH9 A;  4DBQ A;  3OYI A;  1U8R A;  2FBH A;  5DYM A;  1MSF C;  3H36 A;  3GME A;  3E3V A;  2VIX A;  1U9N A;  4GXO A;  4ZJZ A;  5LEJ A;  4A3M J;  3ZQL A;  1W36 C;  2EB7 A;  1TWH J;  2CUF A;  5IY5 H;  4OOI A;  2Y0S N;  1U6G A;  5LRR A;  2NNN A;  2Z1D A;  1IRX A;  1G8X A;  1TT5 B;  2XAF A;  4A93 J;  3KP7 A;  3ABL H;  3P7N A;  2DQR A;  2HKX A;  2R7W A;  3KZI C;  4IHS A;  1Z3Y A;  4J00 A;  2HR3 A;  1D8J A;  2EFQ A;  2L54 A;  3FBI B;  2BY0 A;  5LGT A;  2QQB A;  3OSF A;  1BI0 A;  2F5D A;  2K86 A;  2VBY A;  3GFL A;  3HXL A;  3TGN A;  3ZPL A;  2NNY A;  1WVR A;  1VQM I;  2CG4 A;  4C3J J;  3DLA A;  3QPL A;  1T0F A;  4B44 A;  2EA4 A;  4HPQ A;  3IKT A;  1LPQ A;  2GLO A;  4PJJ A;  1R58 A;  2K4J A;  2Q2E A;  2FMY A;  1MSE C;  1DU6 A;  4TV7 A;  2E34 A;  4YFX F;  2JRM A;  1Z1D A;  4HBL A;  3CZ6 A;  4LK1 F;  3F8C A;  3ZQ7 A;  1F4K A;  1GUU A;  2Z2S B;  1Y0N A;  2QA4 I;  3ASO H;  5L3C A;  4D9J A;  2XKP A;  4LG0 A;  3CDI A;  4EVI A;  2KL4 A;  2M45 A;  1B4A A;  3FXM A;  4IOA F;  1WRJ A;  1QZY A;  3A2K A;  3VSK A;  2VC1 A;  5K5R A;  1YX5 A;  1TT0 A;  4D7N A;  1V5F A;  3E6D A;  3GX4 X;  2EPF A;  3MKY B;  1E3H A;  4A3J J;  2GXB A;  3E5U A;  2KLO A;  2P5L C;  1WJE A;  2RQP A;  3J81 K;  1TWF J;  4AD9 A;  3W6V A;  3DU6 A;  5J1U A;  2K27 A;  4GDF A;  1YIT I;  4OAZ A;  4BJ6 C;  4XRF A;  3KP2 A;  4JOM A;  3GTQ J;  4XKC A;  3BDD A;  4M6V A;  3FXL A;  2A6E F;  4CCN A;  1HCR A;  2L0K A;  3VYU B;  1JTY A;  1RR7 A;  2JMW A;  2QWW A;  4KN7 X;  2D5V A;  1FP2 A;  4HLX A;  5FKM A;  2PFB A;  4AIK A;  3LOC A;  2IA1 A;  3L7W A;  2R5Z A;  2QYO A;  2O9L A;  1KGS A;  5B5E C;  4A0Z A;  4ASN A;  3CF5 F;  2H6B A;  5D5X B;  2FA5 A;  4YG2 F;  2UUZ A;  1A6I A;  4UUS B;  1U2W A;  5E3O A;  3LST A;  1LDD A;  3R61 A;  5TGT A;  2LFB A;  3HOY J;  5E17 F;  4OIN F;  4KDP A;  1DPR A;  3L2Q A;  1EV7 A;  3SZG A;  2GOX B;  2MLK A;  4QWQ A;  4NC7 A;  1O3T A;  1IRZ A;  3MVP A;  1R1U A;  2RQQ A;  3K4M A;  4I76 A;  4PJM A;  5JR3 A;  3PSI A;  4A0X A;  3ERE D;  4XR6 A;  5E1X A;  3BZC A;  4CH7 A;  2XPW A;  3KEO A;  4DYC A;  2XRO A;  1R5H A;  4E7J A;  1FMW A;  1A5J A;  1UHW A;  3WTW C;  1FWZ A;  3S2W A;  3GYH X;  3WTV C;  2X6W A;  2NVY J;  3GZN B;  2LBF A;  4HNU A;  1YHQ I;  1ON2 A;  2LLK A;  2VT3 A;  4IHY A;  2FQ3 A;  1R23 A;  3OYH A;  4B3X A;  3ZGK A;  3GCM A;  1FZP B;  1B59 A;  2YS9 A;  3TL4 X;  1F1Z A;  2DA2 A;  2KMU A;  3W2V A;  4L18 B;  1U5T C;  3BG7 A;  2HZT A;  3J7A O;  2HOE A;  1PP7 U;  2K9M A;  3ZMD A;  4UB6 C;  5IP9 J;  1TP4 A;  5F04 A;  3FIW A;  1ETY A;  5CVI A;  3CCQ I;  1ZAR A;  3OMY A;  2F4O B;  4ETS A;  1G3Y A;  2P0W A;  3HRS A;  4DJA A;  4KFC A;  2CQK A;  3BR6 A;  1J9I A;  2DA6 A;  3DBL B;  1HQC A;  3MQ0 A;  2HQA A;  1ZK8 A;  2V9K A;  2OTJ I;  3LFU A;  1VFC A;  4KIF A;  1SVO A;  2LTP A;  2HOT A;  1IXR C;  3AG2 H;  1IZ1 A;  3LWF A;  2OTL I;  2CSO A;  1ZG5 A;  2JSP A;  1A31 A;  2R7D A;  4BQQ A;  3FHZ A;  3IRR A;  3TP0 A;  2YU3 A;  4ESB A;  3H3V K;  4D0P A;  2DLL A;  1SD4 A;  4U7D A;  1WJ5 A;  4E7H A;  3A03 A;  3R0J A;  3GEZ A;  1D0X A;  2IJL A;  1DU0 A;  3QRF F;  1T0F C;  3U9G A;  3ZQH A;  3BG3 A;  4DZJ A;  5EYR A;  1GXQ A;  3ZXS A;  2PJP A;  2L2O A;  1K78 B;  1OFC X;  4CXF A;  3BP8 A;  3PL8 A;  3LQQ A;  4XOT A;  2PG4 A;  5M5Y J;  1B72 A;  3MKW B;  3FWE A;  1A35 A;  2LY1 A;  1R7J A;  3D5R C;  2A68 F;  5KNL A;  1Q1H A;  3IH3 A;  2E19 A;  2Q2E B;  3LSH A;  4MEX F;  2A05 A;  3KIO A;  5BNG A;  4IHW A;  5L3D A;  1YI2 I;  3GTP J;  3KLN A;  1GV5 A;  2EH3 A;  1BN5 A;  2BHZ A;  3WU1 B;  1L0O C;  1FX7 A;  3JRD A;  4DIQ A;  2XAU A;  2L4M A;  3BPV A;  4C2T A;  5FFZ A;  3BT9 A;  1T38 A;  1JKP C;  2EFN A;  1MDM A;  2WB1 A;  3RKW A;  3I3L A;  2XAQ A;  4A12 A;  3IUO A;  3F8N A;  4HZF A;  5LRS A;  1VZ0 A;  3CJT B;  1X1A A;  1IN6 A;  1X1P A;  3DBR B;  4RA2 A;  4C3H J;  1GVJ A;  2FUG 2;  5ICE A;  1MMD A;  1R22 A;  3HGG A;  1KU9 A;  3FM5 A;  3R60 A;  3HOX J;  2VLA A;  2DK8 A;  5C4X J;  4GYG A;  3OYM A;  2LP0 A;  2X48 A;  2PQ8 A;  3RKQ A;  3RIR A;  4C2M J;  1F5T A;  2QQA A;  1LKX A;  3I64 A;  5B1B H;  3N97 A;  5M3F J;  2L3D A;  3FMQ A;  5HLH A;  1BJA A;  3HG9 A;  2QZ8 A;  1W5C C;  3CCR I;  1MBG A;  4CGZ A;  4I09 A;  4D1Q A;  4PJ0 C;  1SFE A;  1W5S A;  1T33 A;  2VN2 A;  3O6B B;  3RTR A;  5E8G A;  3I53 A;  3KEY A;  4RMN A;  1SD7 A;  3CD6 I;  1E3P A;  1CF7 A;  5FJ8 J;  4KA4 A;  2OJE D;  4M9Z A;  1J09 A;  2DJN A;  2HVQ A;  1K61 A;  1X4P A;  1RPW A;  5EEG A;  2JPC A;  4RS8 A;  3ZR8 X;  3CCU I;  2XAS A;  4N4N B;  3HBL A;  3GZ6 A;  3BTC A;  1T08 B;  3LA7 A;  4QLC U;  3K70 D;  5TJJ A;  2CU7 A;  3JR9 A;  2WAQ N;  4X1E A;  4YII A;  1PUE E;  4KIS A;  2L7F P;  2OQG A;  2X6X A;  3PFI A;  4BDY A;  2WV0 A;  4L9J A;  2PEX A;  3ML6 A;  4ZH4 F;  2LSO A;  2XKO A;  2R5Z B;  1JE8 A;  4AVZ A;  4IPA A;  4P9U A;  2VE9 A;  5EGO A;  2PMZ A;  4J19 A;  2M1B A;  2OAZ A;  3FF5 A;  2IEK A;  2QUF A;  2HPM A;  2ZXJ A;  3IWZ A;  5K5Q A;  2EIK H;  3D0S A;  2ECB A;  2IPQ X;  5JLW A;  4BE1 A;  3C1D A;  5CLS A;  3S1Q J;  2KP6 A;  3CC7 I;  2R7S A;  2LRD A;  1VQO I;  5H6Q A;  4CDG A;  5KAF C;  3QWL A;  2JA7 J;  2R7R A;  1PUF A;  4HV5 A;  3CDL A;  1R36 A;  3HSF A;  4L5E A;  4EQQ A;  3L2V A;  1Z9C A;  3JW4 A;  4EMS A;  3GLL A;  5CVR A;  4BH9 A;  3RYP A;  3HJE A;  4XN3 A;  5L3F A;  2P4W A;  1X19 A;  2K9Q A;  4ON0 A;  4Z6Y A;  5D4R A;  1Z77 A;  2DN0 A;  4B4C A;  2COB A;  2GA1 A;  3VYS B;  2RKH A;  1SD5 A;  3H5A A;  3LA2 A;  4IX7 A;  2JQ7 A;  3Q0W A;  2NYX A;  3KPH A;  1WFX A;  4L0Y B;  2YUS A;  3BOQ A;  4CCL A;  3W2W A;  2CFX A;  3OSG A;  4RGS A;  2JZY A;  2LD5 A;  3AG4 H;  1MZB A;  2DYR H;  1XG1 A;  2KJC A;  1B9M A;  3OYC A;  1Z91 A;  4WXD A;  3ZN0 A;  2RV8 A;  2DT5 A;  3VPR A;  3I9V 2;  2CUE A;  3JAM Z;  1VQL I;  1BW5 A;  3OL3 A;  3J7A Y;  3FXJ A;  3HOT A;  1K6O A;  4ENM A;  1LE8 A;  1RI7 A;  3M1C A;  2DDB A;  3O8G A;  3JRI A;  1W7P D;  1FOY A;  1YE9 A;  4EJU A;  2ZJP F;  3HOZ J;  1BOB A;  3UNG C;  5DUI A;  4ITV A;  3BG6 A;  2ZME B;  4FE7 A;  2CV1 A;  3S1R J;  3BLY A;  2XHK A;  3PNY A;  4ENK A;  1UCR A;  4BE0 A;  2VKH A;  1H89 C;  4RM3 A;  1OQY A;  3M3Y J;  1JGG A;  3WTZ A;  1ZLK A;  3F9K A;  2KIS A;  2EIJ H;  2LKX A;  4AU7 A;  2CW0 F;  3IV5 A;  1K6Y A;  1WI9 A;  4AIH A;  2L02 A;  1FBQ A;  2QSH X;  3LL7 A;  2OU2 A;  5ERI A;  4U7B A;  2BW3 A;  2JK3 A;  4XN0 A;  4PJN A;  3KZZ A;  1H8A C;  3SZP A;  5BPD A;  4CYD A;  3CCJ I;  3EUH A;  1O57 A;  3QOP A;  1OR7 C;  4DGW B;  2JN6 A;  3F23 A;  3BCB A;  5ILS A;  1G2H A;  1Z6T A;  2HFH A;  3GFM A;  1IN5 A;  1TQI A;  2CQQ A;  2KJB A;  3WU2 C;  5F1R A;  2VB6 A;  3HTS B;  1ULY A;  5D5U B;  1SMT A;  1OR7 A;  2FNP A;  5JI6 A;  3GW2 A;  2JSC A;  3K70 C;  2KRH A;  1A6Q A;  2K02 A;  1QZZ A;  4A3B J;  1O7L A;  2A61 A;  2GXG A;  4GO1 A;  3PJR A;  1MGT A;  1IJW C;  3BR2 A;  2ZFW A;  4XKV A;  5M3M J;  3IRQ A;  4AM3 A;  3U2R A;  4PGG A;  2W82 A;  4F92 B;  3A02 A;  3RZD J;  5LGN A;  1GLN A;  4A3K J;  2FRH A;  1YIO A;  2ZXI A;  1EH7 A;  4PZJ A;  2EIL H;  3CP2 A;  4P9F A;  3S8P A;  1IRG A;  3DFG A;  3V42 A;  5F0F A;  4ZTJ A;  4UUT A;  4UHT A;  3HRU A;  2H27 A;  3DKY A;  4UVC A;  1JTX A;  1K4T A;  1ZQ3 P;  2V1D A;  1YQA A;  2RAE A;  4OIP F;  1XS9 A;  4EM1 A;  4D5F A;  4A69 C;  4PFO A;  2R7X A;  4L9N A;  2VBZ A;  2K9L A;  4KJZ A;  3P9K A;  1P92 A;  1R5G A;  3COA C;  4V19 K;  3EYY A;  2W7N A;  2FD5 A;  5EZG A;  4Y4R A;  1RZ4 A;  3U21 A;  1S7A A;  1BC8 C;  4CYC B;  4Y33 A;  3Q9V A;  4IVN A;  1AWC A;  2CUJ A;  2RN7 A;  4N9H A;  3ABT A;  3RSN A;  1NH3 A;  1HLV A;  2XUB A;  3RQ4 A;  4HQM A;  2M4K A;  1MBK A;  2A69 F;  4HG2 A;  1K83 J;  2L01 A;  2STT A;  3HGY A;  2RRE A;  2P5V A;  4YEJ A;  3L9F A;  4CYC A;  3AAF A;  2FEZ A;  2JUC A;  1TNS A;  2BXY A;  2XSD C;  3H3U A;  2HZD A;  4XLF A;  1TC3 C;  1WGX A;  3TDU C;  3TED A;  1T98 A;  5LHH A;  4U0Y A;  2JA6 J;  3PQJ A;  3AKZ A;  2NVT J;  4LG3 A;  4NUB A;  3KYL A;  3WGG A;  1ZRF A;  4HX8 A;  2V1N A;  4UVA A;  5F0H A;  1MD0 A;  1I27 A;  3JRF A;  2VPL A;  5ILU A;  5HNF A;  1DP7 P;  2F5C A;  3K4L A;  1MNE A;  3C7J A;  2HNH A;  4HAM A;  4FQG A;  2B7E A;  4LIV A;  2EV0 A;  5CYV A;  2XVC A;  2ZCW A;  3M1E A;  5GAE J;  3L2U A;  2Y30 A;  4EJT A;  4BU2 A;  3GO5 A;  4M9S A;  4V2G A;  1OYI A;  4N0B A;  1FTT A;  4HNV A;  2OA4 A;  2JPB A;  5BMZ A;  3OY9 A;  3WE2 A;  3BJO A;  2Y2Z A;  5IP6 A;  4IJA A;  4IEJ A;  5HNH A;  1BA5 A;  3C3W A;  4LB5 A;  4B3A A;  1XGO A;  3KZY A;  1IW7 F;  2GZW A;  2IT0 A;  3FM3 A;  3E6C C;  5C3E J;  4C2U A;  3HC7 A;  1MBE A;  2M4G A;  1QRY A;  1IDY A;  2DPU A;  3H92 A;  4ZYH A;  3IC7 A;  4B43 A;  2JT1 A;  2LY2 A;  2V1U A;  2NOJ B;  4KYW A;  5GTH C;  1E0E A;  1FPQ A;  2WA0 A;  2QCO A;  3T0Y A;  3PNT A;  4G9Y A;  4XK4 A;  2CJJ A;  4NC8 A;  4ENJ A;  1ZEL A;  4KMF A;  3MZ8 A;  3REO A;  1Y8Q B;  3WG9 A;  5JHU A;  2X4H A;  3K4K A;  1MH3 A;  4YFN F;  3KET A;  3SJM A;  2W84 A;  3W3C A;  1PP8 F;  4LK0 F;  1FT9 A;  1QNT A;  1NK3 P;  3H0G J;  2K9S A;  2VJI A;  3FKJ A;  3PUF A;  4FCY A;  1LQ1 A;  4HRI A;  5E79 C;  1OIS A;  2IA2 A;  3JTG A;  3CJR B;  4KIG A;  4LGW A;  3HHG A;  4M6Y A;  3E6B A;  2LF8 A;  3OIP A;  5LBQ A;  3SEZ A;  1O7F A;  3BWG A;  4IO9 F;  4XQF A;  4NDL A;  3F6O A;  4HX4 A;  4HX7 A;  1J0R A;  1JXS A;  1W7P B;  4Q4Z F;  2KT0 A;  1J59 A;  3OIO A;  4ZC3 A;  1WJF A;  1LFP A;  1P4A A;  3CP8 A;  3E0J B;  1Z7U A;  2DMP A;  4S0H B;  3OS0 A;  3QYE A;  2ME6 A;  2HDD A;  3IH4 A;  4OIO F;  1UG0 A;  2EQR A;  4E7Z A;  3GVA A;  2OUM A;  3Q9S A;  3CC2 I;  5BS6 A;  5HS9 A;  3FDY A;  2DTZ A;  2QM3 A;  2FBI A;  1QHG A;  3M07 A;  2VJJ A;  4GYI A;  4QPQ A;  2R7F A;  3FXO A;  1I5Z A;  4XIC A;  2I8D A;  2FSW A;  1SC7 A;  3QQA A;  1QHH D;  3ZQQ A;  1U8B A;  2IGK A;  3R4K A;  2ESN A;  3WG7 H;  2VJ4 A;  3C2G A;  1MJA A;  3KFW X;  1BR2 A;  3B73 A;  4FX0 A;  5F1J A;  1JJ6 C;  1I50 J;  3BTL A;  1J75 A;  4NB5 A;  3RKY A;  3F3X A;  3HHH A;  1WI3 A;  1R9T J;  2E5N A;  3JRH A;  2KIQ A;  4EGY A;  1W4M A;  2X1E A;  4UY8 I;  2X9D A;  4E70 A;  3P9C A;  2DJI A;  3ZN1 A;  1EA3 A;  4NNJ A;  2DA1 A;  3V7R A;  1VND A;  1XSX A;  3JRB A;  3QPS A;  3MFK A;  2E1N A;  3A0B C;  1H9T A;  2ESH A;  2QSG X;  2V9P A;  1IN8 A;  2HTJ A;  3PIP F;  1JKO C;  1FYL A;  1QO0 D;  1FNN A;  2ZJ2 A;  1HF0 A;  4C30 A;  4BQN A;  4MO7 A;  3GTO J;  1BI3 A;  3L2W A;  3K0L A;  5E8I A;  4AYB N;  3LQR A;  4HF2 A;  1P9Q C;  2LC2 A;  2VE8 A;  3HKZ N;  2XRL A;  3ASN H;  3SHF A;  2HVR A;  2EWN A;  3ZCO A;  3OS2 A;  4HV6 A;  2XB5 A;  1B9N A;  1FYK A;  2XGC A;  1IV8 A;  2V4J C;  2ZXH A;  3GTK J;  1UMQ A;  5EDN A;  4M3F A;  2X6O A;  5FD5 A;  3OV8 A;  2WAF A;  2ME0 A;  4R1H A;  3FX3 A;  1IDZ A;  2DT7 B;  4PGH A;  2FE3 A;  5ICF A;  4JX4 A;  4Q48 A;  5LD2 C;  3H3Z A;  3P5J A;  3BJA A;  3RCO A;  1GHC A;  2HYG D;  1ZR2 A;  2Y9Y A;  2OV7 A;  4NQW B;  3F8M A;  1Z3X A;  2ZSH B;  3SDB A;  4AC0 A;  1CF7 B;  3J80 Z;  1GV2 A;  3RI4 A;  4HF0 A;  4P55 A;  1W1W E;  3F8B A;  4BE2 A;  4BXX J;  2DO7 A;  2H6C A;  3ZMV A;  3DKW A;  4W1U A;  2CO5 A;  4X6A J;  2A5Y B;  3G1L A;  3R6S A;  4RB1 A;  1D1C A;  1G3T A;  1MW7 A;  1UG2 A;  2HS5 A;  4RGR A;  5H6R A;  2Z33 A;  2FXA A;  3ELK A;  2ISZ A;  2ZNY A;  4Q47 A;  1XDS A;  3LA3 A;  2O7O A;  4CZZ A;  2XDV A;  5FRM A;  1Y56 A;  2XGE A;  2MAB A;  1SAX A;  4BQO A;  2DOD A;  3WHC A;  3CUQ C;  1W0T A;  4CA0 A;  4YIF A;  1U9O A;  2B0L A;  2R7V A;  3TDZ C;  4MQV A;  1S5L C;  5ILV A;  2A6T A;  1T39 A;  1NK2 P;  1YRN B;  3HUG A;  2PMZ N;  3OYB A;  5JVG F;  4IKF A;  3C2H A;  5GAG J;  5C44 J;  4IHT A;  4IXA A;  2XGD A;  3WTT C;  1MJB A;  1ZLJ A;  2MC4 A;  5KK1 A;  5FGM A;  1VQ7 I;  3KP3 A;  3HEF A;  2FOW A;  5B1A H;  3KP6 A;  3MWM A;  2CW8 A;  3NEU A;  3ECH A;  4I01 A;  1MND A;  5DUK A;  1USS A;  1OCO H;  1LFU P;  2WY7 Q;  2IRF G;  4GCV A;  2WBM A;  1XGS A;  3BR0 A;  3MN2 A;  1PYV A;  4JX6 A;  5J4Y A;  3IH2 A;  4XOP A;  4CCK A;  4EAT A;  1Q1V A;  1IAW A;  3QYF A;  3CMY A;  2DCE A;  3IAM 2;  2EK5 A;  1XMK A;  5CPR B;  2NS0 A;  3GFJ A;  5D4S A;  2F5V A;  3NAR A;  1JKR C;  3I5U A;  3WTS C;  3K2Z A;  2QKL B;  3CCE I;  2AXT C;  3S1M J;  3VOD A;  3Q0V A;  3G4S I;  1K7A A;  4RB0 A;  2KFD A;  1T6S A;  2DOA A;  2M5W A;  2EV6 A;  3TBI A;  3RPU D;  5HDK A;  3NRV A;  4KN4 X;  1QQI A;  4RDU A;  2VAS A;  4R79 A;  3VOE A;  4A5N A;  3LSR A;  3ZQI A;  2E1O A;  3F72 A;  4LG0 B;  2MW8 A;  2V26 A;  5L3E A;  3IHU A;  1DQU A;  2W4S A;  2DMQ A;  1YS6 A;  1YJN I;  1VQ8 I;  1XPX A;  2CQ7 A;  1HA8 A;  4HEA 2;  3DQV C;  1HW1 A;  1P4W A;  3I54 A;  4UB8 C;  4G7Z F;  3HUG B;  2C6Y A;  2MC3 A;  1IGN A;  4A2U A;  5D5W B;  1EF4 A;  2ID6 A;  1Z05 A;  1SFO J;  1ETW A;  2X51 A;  3M9A A;  4OU0 A;  4G8X A;  4P96 A;  2K40 A;  3FK6 A;  1I3A A;  1MIJ A;  1P2F A;  4HSR A;  2E1M C;  2E5Z A;  4G6Q A;  1S29 A;  1XN7 A;  3BY6 A;  2RDP A;  3LAJ A;  5LFA A;  2PBI A;  1RES A;  1AU7 A;  2M7B A;  3ECO A;  2O3F A;  2XAG A;  2HKO A;  4B8X A;  2VL8 A;  4A3L J;  1DPU A;  1X2N A;  2VXZ A;  4EJO A;  1MJ9 A;  2JA5 J;  1J2X A;  2XAJ A;  3CC4 I;  4PCQ A;  4RAZ A;  1TBX A;  2A5W A;  1TL8 A;  1QBJ A;  1GT0 C;  2N8G A;  1QZE A;  3PO2 J;  2Z5U A;  4M74 A;  2UWM A;  5TRD A;  3O2P E;  1V4R A;  3VWB A;  2XAH A;  1WKM A;  1G3S A;  4O3M A;  1EH6 A;  2E60 A;  2XF7 A;  1RC9 A;  1S9H A;  5F0C A;  5GPA A;  5IYB J;  4A6E A;  3GZ5 A;  3CCM I;  1XSD A;  4ZZL A;  3KCC A;  5FKK A;  2E71 A;  4RAG A;  2DFF A;  1TWG J;  3DP7 A;  3LFK A;  2JVG A;  3EQL F;  2R3S A;  1FIA A;  2AQF A;  3F22 A;  1ZR4 A;  3HKZ A;  1MBH A;  3HOW J;  3MD2 A;  2ZO4 A;  3AFH A;  2HQN A;  1JKQ C;  2B63 J;  4UV8 A;  2F2E A;  5J40 A;  4KIB A;  1YG2 A;  2G7H A;  4MLO A;  4MEY F;  1AKH B;  3AG3 H;  3RPU A;  1GVD A;  5AIP A;  4OIR F;  1R5I D;  3SFI A;  1FP1 D;  4BDZ A;  3F21 A;  2ISY A;  5EEH A;  1XMX A;  3JAM K;  2AHQ A;  2LH9 A;  4LLL A;  1YJ9 I;  1KYZ A;  3RDI A;  4CO8 A;  2VOD A;  1LEA A;  1BJZ A;  2K85 A;  3JCU C;  3SFZ A;  2MYS A;  2JTV A;  5FKN A;  1Z21 A;  5KHD A;  4E4H A;  1XTA A;  5GP9 A;  3FXQ A;  3HYI A;  4RM2 A;  2R7Z J;  5HDG A;  4DQ2 A;  3KYC B;  4M73 A;  3TO6 A;  2M2E A;  2BVM A;  1Z7L A;  2X1C A;  3ABM H;  4G6D A;  1TTY A;  2MFZ A;  3T8R A;  4U88 A;  3OYJ A;  2E7X A;  3ZMZ A;  5H20 A;  2ZB9 A;  1XGN A;  2CUZ A;  5E3L A;  4CSW A;  1VI0 A;  1Z6R A;  2TCT A;  4YRV A;  2Y0S A;  4KIT B;  3KE2 A;  5J8F A;  4OMZ A;  3S16 J;  4UV9 A;  2LDU A;  2WAE A;  2R92 J;  4BHP A;  1LNW A;  2XGX A;  4G7O F;  1ENH A;  3TW6 A;  3HOS A;  4KMU X;  5FB2 A;  3E5Q A;  3G1O A;  1T2K A;  4M72 A;  1X3U A;  1B8I B;  4XL9 A;  1SFK A;  3H0D A;  3PQK A;  2ICW G;  3RKX A;  1DUX C;  3X2Q H;  3I59 B;  5JHF A;  4DNC A;  4XID A;  1KU7 A;  1LVA A;  4EEF G;  3FKI J;  2IS4 A;  1X1D A;  2WTE A;  3HZJ A;  2AS5 F;  5E1Z B;  1MNM C;  3LSM A;  2JA8 J;  2V6E A;  3CMA I;  2KPM A;  3S3M A;  3K1P A;  2CS3 A;  4PSW A;  1N77 A;  1BR1 A;  3E1S A;  5FFX A;  2V7F A;  1Y1W J;  4AWX B;  2Y9Z A;  1OCT C;  2KZV A;  2L9N A;  4OWR B;  3MAJ A;  2M30 A;  2O8K A;  2VBX A;  3L2C A;  1FC3 A;  3DWL E;  1X2M A;  6PAX A;  1ZGW A;  3H1C A;  1KA8 A;  2H1L A;  2KHM A;  4FE4 A;  3DV8 A;  4RBO A;  3K4J A;  1T8I A;  2EZI A;  2BYV E;  5IT3 A;  2LBF B;  1S6L A;  5EGO B;  5IPA A;  2EFP A;  1UJ8 A;  1R1T A;  4DYQ A;  3FZV A;  3QU6 A;  4O6J A;  2DA3 A;  4I6Z A;  1V5G A;  2M0M A;  4HDV A;  1UHS A;  4F93 B;  1XCV A;  1HW5 A;  2NS8 A;  2Z9O A;  4N4O B;  3C18 A;  1VTN C;  3QPT A;  1FTZ A;  1FOX A;  4PUS A;  2W1O A;  1MMA A;  2D1H A;  3OWT A;  1CQT A;  1HXD A;  2BHY A;  4XNF A;  3TMO A;  3I71 A;  2HYF A;  5DTD A;  1S8N A;  3HRT A;  1RET A;  3BPX A;  4RB2 C;  3CJQ B;  2E1C A;  1IN4 A;  4IHV A;  3GWZ A;  4ZYA A;  3BR3 A;  2HGC A;  3MEX A;  2VQC A;  3RZO J;  4PDK A;  1BW6 A;  1DGW Y;  1E2X A;  1K78 A;  3HL2 A;  1O4X A;  1N78 A;  2DFI A;  3DF8 A;  1O3R A;  1KQ9 A;  2BXZ A;  3CLO A;  5LHI A;  4IRG A;  1ON1 A;  3WOD F;  3OYN A;  3S3N A;  4BEH B;  3ABK H;  5K1Y A;  3V8J A;  4NQW A;  3J81 Z;  3ZP5 A;  5DD8 A;  2IGM A;  1E3O C;  5FKO A;  4YFK F;  3G1M A;  1FY7 A;  3DPL C;  3PIO F;  1YS7 A;  3PUB A;  2R7O A;  2DPD A;  4Y13 A;  2R7T A;  1ZKG A;  2P5K A;  1UEL B;  5HS8 A;  1SAN A;  3HM5 A;  3S14 J;  1YIJ I;  1ZRE A;  2BZT A;  3J7Z I;  1FIP A;  2VKV A;  1KQ8 A;  3ISP A;  2LKS A;  2F5F A;  4AVP A;  5J1Y A;  1WZ2 A;  2L7M P;  2IS6 A;  4XLC A;  4BJT A;  1QPM A;  4G12 A;  4W97 A;  1JJ8 C;  1TW3 A;  2ZBK A;  2LMD A;  3UKG A;  3CJN A;  5HLT A;  4A3E J;  4DYR A;  2CGP A;  4L5J A;  4BBR J;  2H94 A;  4R8H A;  1BIB A;  4Z2Y A;  4FHT A;  2A07 F;  2OZ6 A;  1YRN A;  4PFP A;  5LGU A;  1WSU A;  1NHA A;  1Z67 A;  2FML A;  2GWR A;  3QOD A;  4JYK A;  4RAY A;  4ZDP A;  5IYC J;  2H1K A;  3AL0 C;  2WV1 A;  4B09 A;  2JRT A;  2IS2 A;  4WX9 A;  3FXR A;  3M8F A;  3T5X A;  2NVQ J;  1V5E A;  5DM6 F;  1R00 A;  5A2Q Z;  3JTH A;  3VB2 A;  2E1M B;  4ESJ A;  1LFB A;  3VSL A;  2EBI A;  2HWV A;  2VQH A;  2R93 J;  3LSP A;  1PVE A;  5KAI C;  3MKL A;  5D6E A;  2NVX J;  3EPZ A;  4BXF A;  2Z16 A;  2L5Q A;  2GIV A;  1F43 A;  4L9V A;  9ANT A;  4FIS A;  5JFR A;  1CGP A;  2GAU A;  3DPU A;  1MKM A;  4Y7N J;  2DU9 A;  2DQL A;  4OMY A;  4IF4 A;  3OR2 C;  1X1B A;  3DEU A;  4BL0 B;  3S2D J;  3HRM A;  4A5M A;  2OD5 A;  2YX7 A;  2XPU A;  4MQ9 F;  3TO9 A;  3ZQG A;  2D45 A;  3Q0U A;  3BJ6 A;  1ZN2 A;  2JUG A;  3ZMT A;  4D5C A;  1UAA A;  1XCB A;  3OL4 A;  4S04 A;  4XSZ F;  3TQN A;  4S05 A;  3J7Y J;  2IW5 A;  4WF2 A;  3Q3S A;  4HST A;  1HC8 A;  3HIF A;  1YFH A;  1P7I A;  1ZH5 A;  3CF2 A;  2PI0 A;  3M4O J;  1LJ9 A;  1KU3 A;  2LOO A;  1E17 A;  5M5X J;  2FF4 A;  2NVU B;  5ED4 A;  4I98 B;  3HPH A;  2M8G X;  4JQF A;  2CQN A;  4H0E A;  2NXN B;  2XF6 A;  1Y1V J;  2IVM A;  1GDT A;  4M6X A;  4I0B A;  3FXK A;  4A3I J;  2VUM J;  3M7G A;  1B1B A;  3TW7 A;  2LF7 A;  2LRE A;  1D8K A;  4F91 B;  1XMA A;  4JP0 A;  1JI8 A;  1V55 H;  1IV6 A;  1D1A A;  5J3L A;  2L7K A;  3K9T A;  4E7K A;  1LEB A;  3I56 I;  1EH8 A;  4Y17 A;  1LUJ B;  2DMN A;  5EEA A;  2DAO A;  2DYS H;  3I4N J;  1AKH A;  1OPC A;  1I3Q J;  2BY2 A;  2UZK A;  3CCV I;  1R4N B;  3ZQF A;  2CQX A;  3K7A J;  4NC6 A;  1IO2 A;  1B6A A;  2QQ9 A;  1O3S A;  2VXD A;  5DV5 A;  3I58 A;  3KEQ A;  2ADU A;  2GA2 A;  1JUS A;  3S17 J;  2ZFU A;  1PUF B;  2FJ1 A;  4M71 A;  2DOE A;  2LKP A;  1T95 A;  1B8I A;  3CUQ B;  4LMY A;  2I5U A;  4L9T A;  2EIM H;  2LYC A;  3G2B A;  4K2E A;  4UUS A;  1HDD C;  1IUF A;  1VF9 A;  1HSJ A;  3G3Z A;  4ZTF A;  4GFB A;  4ZZD A;  1AHD P;  2BGC A;  2FNA A;  4IRI A;  3DEW A;  2IAI A;  2PX9 A;  2K3F A;  1ITY A;  3H5N A;  2QQ8 A;  1K79 A;  2K3P A;  2E7W A;  2P6S A;  4HW0 A;  1EKE A;  2DA7 A;  2LVS A;  1RKT A;  3O3K A;  4L0Z B;  4WXC A;  1ZRC A;  1FOK A;  3MZH A;  3SYT A;  3K1M A;  3K2A A;  3S1N J;  1V54 H;  3WU0 A;  5J8C A;  3V8K A;  5J1R A;  5E18 F;  2ACJ A;  1VQN I;  3TP3 A;  2IXS A;  3BRO A;  5HVQ C;  4PSX A;  1WCM J;  2ECC A;  2MBF A;  2WC2 A;  4PJL A;  1UHM A;  3B6C A;  1WQ2 A;  5ICC A;  2O61 A;  2P7V B;  1X3W B;  2EFW A;  2VJ5 A;  1QU3 A;  2EJR A;  1TWC J;  4BUP A;  1AOY A;  4LLN A;  3LAP A;  1D5V A;  3JRE A;  3WGH A;  4J01 A;  1VQ5 I;  4EM0 B;  2DDA A;  4MHG A;  5K7F A;  5M5W J;  1ORK A;  1NTC A;  1HKQ A;  5DCF A;  1UST A;  4B1R A;  4XLP F;  3NWT A;  2EV5 A;  2QLZ A;  1Y0U A;  4BKX A;  2OZU A;  4I7H A;  3OYA A;  1JHF A;  4QPO A;  4B48 A;  2O6G E;  1AA7 A;  3A01 A;  4A6D A;  1TW2 A;  1P4X A;  2YPR A;  1Y6I A;  3HOU J;  1BI2 A;  3PSF A;  2IBD A;  2TRT A;  1WH5 A;  3DBH B;  2MD5 A;  5EG0 A;  2HDW A;  3VFZ A;  4CHU A;  3M8J A;  2JA2 A;  3CUO A;  4EV0 A;  2L9R A;  5HLG A;  3CO6 C;  5K7Z A;  2ELK A;  5IOY A;  1W5T A;  4ZDO A;  4P1W A;  3TOA A;  2RNG A;  2RC4 A;  4NBQ A;  2QSF X;  3E7L A;  2DMT A;  1UZC A;  2MLG A;  1ZGA A;  3CCL I;  3CQZ J;  1KQ0 A;  3I59 A;  3MKZ A;  4P5O A;  3E6M A;  4MIM A;  2A6H F;  1HW2 A;  5FRO A;  2JJ7 A;  5D8L B;  2ELH A;  5HDN A;  3QP6 A;  2BE5 F;  4GGG A;  3RYR A;  4FX4 A;  5B66 C;  3KLO A;  2E36 A;  3OYE A;  1VQ4 I;  2Z99 A;  4UUV A;  4G6T B;  1C0W A;  1ZTR A;  5HS7 A;  1XDU A;  1B72 B;  2R0Q C;  2WY8 Q;  1JUM A;  3LSG A;  2CMP A;  1ACI A;  3I4P A;  3GF2 A;  5C4J J;  4MTE A;  3JSP A;  5EZH A;  3P9I A;  4HDU A;  2MGQ A;  4A3G J;  1SFX A;  5DCM A;  1U5T B;  3E97 A;  2H8W A;  1BM9 A;  2M34 A;  4HOB A;  3U1K A;  1IRF A;  2AQE A;  4LOC A;  3NQO A;  1J7K A;  4UVB A;  3S93 A;  3OYF A;  1R6R A;  5BQT A;  5KVR A;  3KYD B;  4DW6 A;  3H9J A;  2MH2 A;  4AUX A;  5F6F A;  1D0Z A;  4XLE A;  2Y69 H;  1SVL A;  5E20 A;  3OIQ A;  2GOM A;  1ZRD A;  4MFE A;  2VKD A;  3QPH A;  3BTJ A;  1JUP A;  4BHC A;  4HLY A;  3BQZ A;  4DBR A;  3D5L A;  3WGI A;  2G9W A;  4U0W A;  1Z0X A;  4Q5S F;  2UXX A;  2OPT A;  2XRN A;  4LFU A;  2WB1 N;  2GIZ A;  4KT5 C;  2G7U A;  4RGU A;  2P81 A;  2YU9 J;  5ICG A;  1OYW A;  1H88 C;  1R4M B;  2QF7 A;  4M3B A;  1IXC A;  3K10 A;  3KP4 A;  2O5R A;  3J80 K;  3OYG A;  2ELJ A;  3IL2 A;  3LMM A;  3WTX C;  5DM7 F;  1QA6 A;  4KUM A;  3CLQ A;  1QPI A;  5IYD J;  2OCE A;  2PN6 A;  3A01 B;  4IQJ A;  3PO3 J;  2MA3 A;  2F48 A;  4CZC A;  4YIR X;  4MTD A;  5LEK A;  3OYD A;  2TDX A;  4M3G A;  5GPC A;  5FLX Z;  4FTH A;  1YO5 C;  1DDN A;  1G3W A;  3BTI A;  3WTY C;  1REP C;  1KU2 A;  3GBG A;  3K1N A;  4BBS J;  3SZT A;  2HQ5 A;  2XV4 S;  3MZY A;  4L5I A;  3ZQC A;  5HOO A;  1S7E A;  3QU3 A;  1F9N A;  1MBJ A;  4B47 A;  4GRI A;  1FJL A;  2GM4 A;  2NS7 A;  2E35 A;  4RLF A;  5A2Q K;  5IT9 K;  1PDN C;  4AYB A;  1I1G A;  2HEO A;  1S3J A;  2CWE A;  4E7I A;  3K69 A;  2ZC2 A;  1HBX G;  3RJP A;  2W48 A;  3ZOB A;  3ERM A;  1FYM A;  2PMH A;  4BS9 A;  3ROU A;  1TNT A;  3HTU A;  1OCC H;  3DTE A;  3ABU A;  1ZG3 A;  2Q0O A;  2KQR A;  3IAS 2;  2CYY A;  1XD7 A;  3WE3 A;  1WPK A;  3L00 A;  3PNV A;  1S7O A;  1LDJ A;  4F55 A;  3BQY A;  2XSJ C;  1POG A;  2RVC A;  3H5R A;  3ESW B;  2KDO A;  5HLI A;  3S2H J;  5B3S H;  2IS1 A;  2DTR A;  2M8E A;  2ID3 A;  4H4K C;  4DOZ A;  5FLV A;  4RGX A;  4XLH A;  4ZYD A;  3VYT B;  4XKB A;  3EET A;  1X58 A;  3HPG A;  2KDZ A;  3FBN B;  2L9S A;  1UFM A;  1STZ A;  4BJ5 C;  5EJC A;  3RPQ A;  2HU9 A;  2PJR A;  4WWC A;  4A3D J;  1FSE A;  4EJV A;  3JRA A;  5CVJ A;  1FBS A;  1YX3 A;  1W36 D;  1WJB A;  2LNB A;  4EM2 A;  3CO7 C;  5CKT A;  5H2F C;  2QVO A;  1ETO A;  2LR8 A;  2COM A;  4UXN A;  1ONV A;  2EZK A;  4E7S A;  3R0A A;  4XLA A;  3E5X A;  2DA5 A;  4BEH A;  1FLI A;  2O03 A;  3CCY A;  5L3B A;  1D0Y A;  3ZRG A;  2HDC A;  1ETX A;  1VQ6 I;  1IG7 A;  2ZNZ A;  1QVT A;  3KX2 A;  3JSO A;  1W7P A;  4E7L A;  4NHJ A;  1SEU A;  2W25 A;  4ANJ A;  4BYY A;  2HTS A;  2BY1 A;  1ZAO A;  5E3M A;  2X1D A;  3BG9 A;  2X0L A;  1ZG1 A;  5AON A;  1J5Y A;  2ZME A;  5J4V A;  2E2I J;  4D7M A;  4BNC A;  3DCF A;  4PK4 A;  1FBU A;  3FK7 A;  3FXU A;  2KRC A;  2JWT A;  3OOP A;  2LG4 A; 
#chains in the Genus database with same CATH homology
 3CJQ B;  4C2U A;  3HC7 A;  3DU6 A;  4ZYA A;  2M4G A;  1DGR M;  2VQC A;  4OAZ A;  4BJ6 C;  4B43 A;  4JOM A;  2LY2 A;  2NOJ B;  1DGW Y;  4XKC A;  2F6C A;  1E0E A;  2VQL A;  4CCN A;  3VYU B;  3CES A;  3HL2 A;  5CQE A;  2WA0 A;  1N78 A;  3PNT A;  2BOL A;  4NC8 A;  1ZEL A;  2DT6 A;  4BEH B;  3OYN A;  3S3N A;  2IGM A;  3K4K A;  1LVK A;  2UUZ A;  3W3C A;  3DPL C;  3PUB A;  2R7O A;  2R7T A;  2VJI A;  3FKJ A;  4HRI A;  1UEL B;  5KCM A;  5TGT A;  3EUA A;  3CJR B;  3IP4 B;  3L2Q A;  3SZG A;  2GOX B;  3W2A A;  4NC7 A;  1N75 A;  3OIP A;  3SEZ A;  2RQQ A;  2XF5 A;  3K4M A;  4PJM A;  2IS6 A;  4XLC A;  4BJT A;  4XQF A;  3K4N A;  3PSI A;  4XR6 A;  4CH7 A;  2X85 A;  4E7J A;  1FMW A;  5HLT A;  2X6W A;  4ZC3 A;  1WJF A;  1LFP A;  2LBF A;  3CP8 A;  3E0J B;  4HNU A;  3OS0 A;  3QYE A;  3OYH A;  1UG0 A;  1FMV A;  4B3X A;  4E7Z A;  3ZGK A;  2K5C A;  2OUM A;  3FDY A;  1WJA A;  3OR1 C;  4PFP A;  3TL4 X;  4BAC A;  4ZDP A;  3QOD A;  2KMU A;  3W2V A;  1QHG A;  2CV2 A;  2VJJ A;  4QPQ A;  3AL0 C;  3BG7 A;  3BC8 A;  2I8D A;  2IS2 A;  3DKX A;  3CMM A;  1V5E A;  2K9M A;  1QHH D;  3ZQQ A;  3H9G A;  3OS1 A;  2IGK A;  2E1M B;  2VJ4 A;  3A1Y A;  3C2G A;  3OMY A;  3VSL A;  1BR2 A;  2VQH A;  2P0W A;  4X0G A;  2OC6 A;  3H35 A;  4DJA A;  3EUH C;  2E5N A;  5FRN A;  3EPZ A;  2X1E A;  4BXF A;  2HQA A;  2L5Q A;  2V9K A;  2Z16 A;  3EUK L;  2DJI A;  3LFU A;  1EA3 A;  4NNJ A;  3DPU A;  3DU5 A;  2QKM B;  3VYR B;  2X6Y A;  2JSP A;  1X1B A;  3OR2 C;  4BL0 B;  4BQQ A;  1MMG A;  2Q1Z B;  1WJ5 A;  2PJR B;  4E7H A;  2JUG A;  1D0X A;  1UAA A;  3OL4 A;  4C30 A;  3S32 A;  4BQN A;  1T0F C;  3QYB A;  3L2W A;  1BR4 A;  4HST A;  3ZXS A;  2L2O A;  4E6K G;  3CF2 A;  1P9Q C;  2LC2 A;  3PL8 A;  4FET A;  4XOT A;  2LOO A;  3MKW B;  2HVR A;  3HPH A;  4JQF A;  2LY1 A;  2W00 A;  3D5R C;  4XMY A;  3ZCO A;  4CCJ A;  3OS2 A;  5KNL A;  3H9Q A;  2XF6 A;  2V4J C;  2ZXH A;  3QOE A;  3LSH A;  2Q2E B;  2BW3 B;  5CQG A;  2WAF A;  2M7A A;  2LRE A;  4F91 B;  2DT7 B;  4DIQ A;  2XAU A;  5LD2 C;  3RCO A;  1X1C A;  4C2T A;  1DP3 A;  1JI8 A;  1D1A A;  2OV7 A;  4NQW B;  3OYK A;  1Z3X A;  2WB1 A;  2L7K A;  2ZSI B;  2ZSH B;  3I3L A;  3SDB A;  3OOU A;  4E7K A;  3IUO A;  1SAU A;  1VZ0 A;  1X1A A;  4HNT A;  2R7Q A;  2FUG 2;  4BE2 A;  2R4G A;  1MMD A;  4CCM A;  4Y3O A;  3ONQ A;  4LIU A;  2VLA A;  1D1C A;  2VXD A;  1MW7 A;  4F52 A;  3K6G A;  3OYM A;  1U0J A;  1WJC A;  2XDV A;  2ZFU A;  5FRM A;  4ZDL A;  1Y56 A;  2MAB A;  1LKX A;  1T95 A;  3UR3 C;  4BQO A;  3HG9 A;  3DEE A;  4CA0 A;  4CUG A;  4D1Q A;  2LYC A;  3G2B A;  2UV1 A;  4XOR A;  2R7V A;  4C9Y A;  2A6T A;  3RTR A;  3KEY A;  2HPI A;  4ZTF A;  3OYB A;  4RMN A;  4IKF A;  3C2H A;  2VQG A;  3H5N A;  1J09 A;  2K3P A;  4II3 A;  2HVQ A;  2MC4 A;  1X4P A;  4U87 A;  3ZR8 X;  4N4N B;  3SYT A;  3K70 D;  2CW7 A;  3S3O A;  2CW8 A;  4KIS A;  1MND A;  2CH0 A;  2IXS A;  2X6X A;  5HVQ C;  4PSX A;  4PJL A;  2WY7 Q;  4BDY A;  2WBM A;  4BGD A;  3VDX A;  1PYV A;  4XOP A;  4AVZ A;  4CCK A;  2PMZ A;  4EAT A;  1X4O A;  2VJ5 A;  1QU3 A;  2JVH A;  3QYF A;  4BUP A;  3AL0 B;  4OAY A;  2HPM A;  4LIT A;  2DCE A;  3IAM 2;  4J01 A;  3LSI A;  4BE1 A;  5CPR B;  2KP6 A;  2F5V A;  1ERD A;  4CCO A;  2R7S A;  3NWT A;  2LRD A;  2QKL B;  3LSK A;  3OYA A;  4QPO A;  2R7R A;  4B48 A;  4XON A;  3K4C A;  1LDK B;  3D5S C;  1AA7 A;  1KON A;  1TZL A;  2IGO A;  3L2V A;  1Y6I A;  2BVL A;  2DOA A;  3PSF A;  3TBI A;  3RPU D;  2CV0 A;  4XN3 A;  3SEQ A;  1X19 A;  2VAS A;  4R79 A;  2HDW A;  1G59 A;  3M8J A;  2JA2 A;  3PFY A;  3VYS B;  2V26 A;  3A4C A;  3H5A A;  2WAD A;  1DQU A;  2W4S A;  4IX7 A;  2HVS A;  4ZDO A;  1HA8 A;  4P1W A;  4HEA 2;  3DQV C;  2RNG A;  1WFX A;  3HUG B;  3DPT A;  4CCL A;  3W2W A;  3NWS A;  2MD0 A;  2R7U A;  3MKZ A;  4P5O A;  3OYC A;  1WJD A;  1OLT A;  5FRO A;  2X51 A;  3I9V 2;  4II2 A;  3OL3 A;  3J7A Y;  3HOT A;  4HSR A;  2E1M C;  2E5Z A;  3M1C A;  3OYE A;  1YE9 A;  4G6T B;  1BOB A;  3MMY B;  3UNG C;  4RLQ A;  5LFA A;  2WY8 Q;  4ITV A;  3N05 A;  3BG6 A;  2M7B A;  2CV1 A;  3LSG A;  2CMP A;  3BLY A;  4F3Q A;  2VL8 A;  3PNY A;  2VXZ A;  2XC7 A;  2VKH A;  3OYL A;  4BE0 A;  4RM3 A;  2A5W A;  3K4B A;  1NG6 A;  3F9K A;  4AU7 A;  3OYF A;  2AQE A;  3S93 A;  2UWM A;  4KT6 A;  4XM3 A;  1R6R A;  1K6Y A;  3VWB A;  3H9J A;  3LL7 A;  1D0Z A;  2E60 A;  2XF7 A;  2IGN A;  4XLE A;  4U7B A;  1S9H A;  2BW3 A;  3OIQ A;  4XN0 A;  2GOM A;  4FAS D;  4PJN A;  2VKD A;  3DTK A;  4DBR A;  3D5L A;  1OR7 C;  2JVG A;  4DGW B;  3BCA A;  2AQF A;  4IQ4 A;  3BCB A;  3HKZ A;  3MD2 A;  2M3A A;  4YEL A;  3AFH A;  2VB6 A;  2CFO A;  2F4I A;  4MLO A;  3K10 A;  3K70 C;  2KRH A;  2O5R A;  3OYG A;  4BDZ A;  2WAQ A;  2ELJ A;  1PJR A;  3LMM A;  2LH9 A;  3PJR A;  4XKV A;  4IQJ A;  2W82 A;  3FHN A;  4XKW A;  2MYS A;  4F92 B;  4CZC A;  1GLN A;  1Z21 A;  3OYD A;  5KHD A;  4E4H A;  2ZXI A;  2DXI A;  3CP2 A;  4RM2 A;  1NG7 A;  3GBG A;  3S8P A;  3L2R A;  5HOO A;  2BVM A;  1Z7L A;  2X1C A;  3V42 A;  2MFZ A;  4B47 A;  4ZTJ A;  4IZZ A;  4GRI A;  3OYJ A;  4RLF A;  2CUZ A;  1D1B A;  3DKY A;  4CSW A;  4AYB A;  4YRV A;  2Y0S A;  3DTI A;  4KIT B;  4E7I A;  4PFO A;  2R7X A;  2WAE A;  2K9L A;  4KJZ A;  4BS9 A;  1MMN A;  3HOS A;  4DBQ A;  3DTE A;  2W7N A;  2KQR A;  4XL9 A;  3IAS 2;  1SFK A;  4Y4R A;  3U21 A;  3H0D A;  3OYI A;  4Y33 A;  3PNV A;  2CUJ A;  5JHF A;  4F55 A;  2XSJ C;  4ZJZ A;  2VIX A;  1W36 C;  2IS4 A;  1X1D A;  3H5R A;  2KDO A;  3RSN A;  2IS1 A;  3RQ4 A;  2M4K A;  4HG2 A;  4H4K C;  4DOZ A;  3LSM A;  2Z1D A;  1IRX A;  1G8X A;  2V6E A;  2KPM A;  4XLH A;  3S3M A;  2CS3 A;  3VYT B;  2R7W A;  2RRE A;  4PSW A;  1N77 A;  1BR1 A;  1Z3Y A;  4J00 A;  4XKB A;  4YEJ A;  3E1S A;  3HPG A;  2V7F A;  3FBI B;  2L9S A;  3FBN B;  4BJ5 C;  2HU9 A;  2PJR A;  2HZD A;  4XLF A;  2KZV A;  2L9N A;  3HXL A;  4OWR B;  1YX3 A;  1W36 D;  1WJB A;  3DLA A;  3DWL E;  3AKZ A;  4B44 A;  4LG3 A;  4NUB A;  3KYL A;  5CKT A;  4HPQ A;  2V1N A;  4PJJ A;  2VPL A;  5HNF A;  2KHM A;  4E7S A;  3K4L A;  1MNE A;  2HNH A;  4XLA A;  4BEH A;  3K4J A;  4LIV A;  2LBF B;  3L2U A;  1D0Y A;  3ZRG A;  3CZ6 A;  4BU2 A;  2Z2S B;  3KX2 A;  4E7L A;  4D9J A;  1V5G A;  2M0M A;  4F93 B;  2KL4 A;  4ANJ A;  4N4O B;  3OY9 A;  4PUS A;  3A2K A;  2X1D A;  2W1O A;  3VSK A;  1MMA A;  5HNH A;  3OWT A;  1YX5 A;  1TT0 A;  4PK4 A;  1V5F A;  4XNF A;  3TMO A;  3MKY B;  2KRC A;  2KLO A;  1WJE A;  2LG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...