4QPOA

Mechanistic basis of plasmid-specific dna binding of the f plasmid regulatory protein, tram
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
53
structure length
53
Chain Sequence
AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Relaxosome protein TraM
publication title Mechanistic Basis of Plasmid-Specific DNA Binding of the F Plasmid Regulatory Protein, TraM.
pubmed doi rcsb
source organism Escherichia coli
total genus 14
structure length 53
sequence length 53
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4qpoA00
4QPOA 1DP3A 4QPQA 3OMYA
chains in the Genus database with same CATH superfamily
1IXCA 1E3HA 1IUYA 1JUMA 1POGA 5ICEA 1JT6A 3S16J 4RGXA 4BJ5C 4QLCU 2ZMEB 4C3JJ 4PSWA 1MGTA 3QU6A 3F0CA 4BGDA 2YX4A 2CQQA 2XIGA 2WC2A 1Z05A 1ZH5A 2XAQA 2L9RA 2JTVA 1MNMC 1H89C 2K9LA 3R61A 3IKTA 1ZN2A 4XRMA 1G3WA 3WTZA 1T39A 3HOYJ 2E1MC 2BW3B 2HZDA 5GADJ 3RCOA 3GBGA 2Q2EA 5J8CA 2R7RA 1MH4A 4CCJA 4FQGA 1S6LA 2ID3A 2FNAA 1EH8A 1A36A 2DYSH 2IA1A 1Z0XA 1DPRA 3SZPA 2WWYA 5C4JJ 3GTLJ 1K6YA 2QZ8A 1ENHA 2NAZA 1JJ6C 3EUHC 4HF1A 1KYZA 4A3KJ 2EIMH 2A5YB 4BHCA 4DNCA 3SZTA 2OTLI 3EQLF 4MO7A 2KIQA 5LGNA 1KU3A 3MZHA 1FMVA 3F72A 3FXRA 4O6JA 1EA3A 3IAS2 2Z33A 1AOYA 3VEPA 2O5RA 2X6WA 3WE3A 5L3EA 3BQYA 4HLYA 4XLPF 2BY0A 3GTMJ 3V7CA 1ZK8A 3W6VA 4UB6C 3GW2A 1MMNA 1R00A 4M6VA 4ZYGA 3ZP5A 5E1WA 2VJJA 2DFHA 3M7GA 2B0LA 5KK1A 3IRQA 1SMTA 1N78A 3OYHA 2E2IJ 3M8JA 2VI6A 2BHYA 4HOBA 1MMAA 2E7XA 1V3FA 4PGHA 2D2WA 2E71A 2Q1ZB 1EH6A 2NNNA 4BBRJ 4BXFA 1FY7A 1VQPI 3PIPF 1DGWY 3J7AY 1IN6A 3QOEA 3LNQA 2CFOA 2JRMA 4ITVA 4AD9A 1HSTA 4ZDPA 3JRGA 2QKMB 2O9LA 1UELB 1D0ZA 5J40A 2CFXA 3FMRA 3SDBA 1OCOH 2JPCA 2W25A 4CZZA 2OPTA 5EYRA 4Q4ZF 5IOZA 1Z9CA 1PDNC 3S2WA 1WJDA 2DN0A 1XTAA 2ECBA 1WKMA 5DUKA 1GV2A 2Z2SB 3CJNA 2M5WA 1AHDP 4Y17A 2DOEA 3GFLA 4ZJZA 3RYPA 3BR2A 4P1WA 4G7OF 4IF4A 5J1RA 2HNHA 4HBLA 4A2UA 4Y52J 3C2GA 1W5CC 2K3FA 2Y2ZA 2ZXJA 4Q48A 2XGXA 1UAAA 1LFBA 2RDPA 1IN5A 2XF5A 1RR7A 2Q2EB 5IT3A 1LUJB 3K6GA 1BM9A 5BMZA 4BHBA 2FD5A 2IXSA 4ZTFA 1W7PB 3DLLF 1LB2A 3KIOA 3FMQA 4PDKA 1HW2A 2DDAA 1S72I 1S8NA 1ZG1A 3DKWA 3DEUA 3RKYA 3J7ZI 1XSVA 1FOYA 1D1AA 3HRUA 1JKRC 1XGNA 2ZC2A 3LSKA 4E7IA 2AO9A 1MBKA 4G94A 4LLGF 2XPVA 2HQRA 1ETXA 4MLOA 3IV5A 2N8GA 2Y0SN 1A6IA 2OF7A 2OZ6A 3NQOA 2IA0A 2W48A 1AKHA 4G6TB 5EJCA 3IH4A 4LG3A 4PUSA 1N77A 3CP2A 3A0BC 2F6CA 1JTXA 2STTA 3LA2A 2LTPA 2NOGA 5J4YA 2VBYA 2DA1A 4YFKF 3WTSC 2F5DA 1WHUA 2G7UA 3FDYA 3EDPA 4XRFA 1JHFA 2MA3A 1H8AC 3K1NA 3E6MA 2UZKA 1PP7U 1LE8A 1UFMA 1SVOA 3GFJA 4C3HJ 3U21A 1W1WE 2LF7A 4KDPA 3P9IA 1EF4A 2WB1A 3SYTA 3BLYA 4M72A 2OQGA 2ID6A 1OFCX 2QENA 2HFHA 3CC2I 4BXXJ 3H3VK 2H8WA 3LA7A 4LD5A 1MSEC 2QSGX 5M3MJ 4BS9A 1ON1A 1WJBA 3A02A 4XKVA 4FX0A 2Y9ZA 4CICA 3OSFA 3EPZA 1Y1WJ 2E7WA 2OA4A 4PFPA 1HCRA 4A3DJ 2F4MB 1XDSA 3EETA 2DA3A 3Q0VA 4A0YA 2FE3A 1KZHA 3H0GJ 3T0YA 1IN7A 2NVXJ 1YX3A 2R7FA 5LHGA 1Z77A 2D1HA 1FC3A 1ZRCA 1R4NB 2H8RA 2LP0A 1YX5A 1JUPA 4XRSA 3F8CA 4YFXF 2XRLA 1RUNA 4IHXA 3P9CA 2QEXI 5FGMA 1YO5C 2HDWA 5J8FA 3BG7A 1E3PA 1HC8A 3M1EA 1QA6A 1SD5A 4XICA 3ABKH 3O8GA 2F2EA 3G4SI 1FZPB 4F55A 4A0XA 4EVIA 2MABA 2M30A 2CUEA 3BCAA 4RAZA 1D0XA 3S3OA 2V9KA 4A3JJ 2BE5F 2Y0SA 2A05A 4QIWN 5LEJA 2KQRA 4JYKA 4L18B 5FB2A 1QVUA 3KZYA 4XIDA 1R1TA 3BJOA 5L3DA 1AKHB 3AL0B 1ETKA 4YIIA 1GHCA 2BVMA 2FF4A 1UJ8A 2EH3A 2RREA 2V1XA 2VLAA 3CLQA 3DU6A 4QPOA 2CSOA 3FBIB 1BW5A 1WCMJ 2F5FA 3K2AA 3I4MJ 4AWXB 5FLXZ 2L7FP 4AVZA 3KE2A 2VOOA 5JLWA 3D1NI 1LE8B 2QWWA 3GTOJ 3TW7A 2HQ5A 2TDXA 3DWLE 1J2XA 1R71A 1FOWA 3GTKJ 4ANJA 2Z16A 4MQVA 1K78A 1LFPA 4KFCA 3HHGA 1IAWA 6PAXA 3EYYA 3K10A 3KP6A 2V9PA 1VFCA 1LQ1A 3ZN1A 5E8GA 2W1OA 4A3MJ 3TBIA 3W2WA 3QP5A 2HPIA 3K7AJ 1VTNC 1O3QA 3RJPA 4OMYA 4G6DA 1J75A 3F8FA 1LVKA 4A0ZA 2K02A 2KDOA 4DJAA 4IHYA 1Z67A 3M8FA 1IV6A 2DTZA 2DJIA 4A3CJ 2P8TA 5LRRA 3CUQC 1P7JA 4RLQA 2MG4A 4XNFA 2BZTA 4IPAA 5LGTA 3DCFA 4D7MA 2VT2A 1W36D 2OCEA 3FXJA 4QSHA 4EMSA 5L3GA 1S7EA 4W1UA 3K4LA 4HG2A 2V6CA 2QSFX 1USTA 2VASA 3DP7A 4LFUA 1BC8C 3TOAA 2JVGA 1F9NA 2JA6J 2GAUA 3DU5A 3F6VA 1VQ7I 4M71A 2Z3YA 1HKSA 4EGZA 1V5GA 4NHJA 1TQMA 3KX2A 5GAHJ 3L2CA 1B72A 2PBIA 3I71A 4ZZDA 4BE1A 3F21A 1MMGA 3K1MA 1R1VA 3CF2A 2TCTA 4RMNA 1YJWI 3J81Z 4BBSJ 3N4MA 3ZN0A 1YQAA 4MHGA 2WAFA 5J1UA 4E6KG 1R7JA 3M9AA 4E7ZA 1XPXA 3PJRA 3OMYA 3G73A 1IRZA 2KIFA 3PIOF 2M7AA 3MKYB 2VPLA 2DAOA 3PUFA 2LY1A 2W85A 2W82A 2LKSA 1VQ4I 3WTWC 3HSRA 1OPCA 1RRJA 5GTIC 1G3SA 5KHDA 4XM3A 1QVTA 4DYQA 2EIJH 3ERMA 5E18F 1K78B 2VQLA 3BTCA 2WY8Q 3CMEI 2BXYA 2AQFA 2DPUA 1FBUA 2MC3A 1W7PD 3CDHA 3BZ6A 4CUGA 4G7HF 4OAYA 4HX8A 5FLMJ 2DQRA 1S7OA 2CS3A 1PVEA 1MMDA 1BR1A 2DPDA 5F27A 2L7KA 4B44A 3KP2A 3GVAA 4E4HA 2KZVA 2AS5F 3TMOA 2VE8A 4EJWA 1Y8RB 3BG3A 2CW7A 3HC7A 3K4KA 2FQ4A 1ZQ3P 3S15J 4LJZF 2ME6A 4EJTA 2XAJA 3LSHA 3H1CA 3IP4B 1ULYA 3L2WA 3L9FA 3V7RA 1ZLKA 4P5OA 3SJMA 1Z6TA 3OYJA 2MGQA 3ZMTA 2EK5A 3VYSB 3LSJA 5AIPA 3KP5A 3PFIA 5CVVA 1MJAA 1XCVA 5ICFA 1EKEA 4ZZLA 3TOBA 2FA5A 1E17A 5E3NA 3A03A 1P92A 1V55H 2DK5A 2KIMA 3FK7A 2WAQA 3TDZC 3FKIJ 5DUIA 1UMQA 2EV6A 3GYHX 1B72B 2MBFA 3ESWB 3ZRGA 4KYWA 2ZNZA 5IT9K 1A6QA 4MFEA 5E1ZB 3BR6A 1JJ8C 1BJAA 3CC4I 1OCCH 1Q1HA 4A5NA 1NHAA 2R4GA 1U6GA 1MJBA 3FMSA 5JVTA 3FKJA 3DTKA 5HOOA 1AU7A 5IYDJ 4GCVA 2GA2A 1QO0D 2ELKA 4N9IA 1FX7A 5M5YJ 4K2EA 1VI0A 1P9QC 3BTLA 3RKQA 2DMNA 1S3JA 3OIOA 1EH7A 5D8KB 2Y69H 3MQ0A 2JT1A 2DT6A 4JP0A 1ETQA 5L3FA 5D5UB 3H5AA 2LKXA 4PJJA 2NVYJ 2LSOA 2E2HJ 1LEBA 1GUUA 2O3FA 1MSFC 1WWXA 2M4KA 2R93J 4XMYA 2EFOA 2G0EA 2E2JJ 3WHBA 3VPRA 1TNSA 2A6TA 1LDDA 2EZKA 2Z5UA 3PM1A 3BT9A 4OIOF 5FFXA 4CCMA 1MDMA 4C30A 2O8XA 2QCOA 3HHHA 4MGRA 2QQ9A 3I53A 1KU9A 4BAYA 1MBFA 2KRFA 1XC5A 1A5JA 4B4CA 3BZKA 1QQIA 4G12A 1T33A 4PSXA 3OYNA 2PMUA 2IGOA 3LAPA 1SVLA 2VUMJ 1MJ9A 2DLLA 2TRTA 3LSTA 1X2NA 2ZKZA 3JCUC 5DS9A 2MSYA 4OOIA 4EV0A 1ZR2A 1IXSB 2ELHA 3OS2A 5FJ8J 3S1RJ 2ZMEA 5K7HA 1YFHA 3LSRA 1NK3P 5ILVA 2DXIA 5EEAA 2E35A 2ZXHA 4DZJA 3BC8A 3BG6A 2JUCA 4I7HA 1OYWA 2EFNA 2EZHA 2YU9J 5A2QZ 3DTEA 4YIFA 2EBIA 2VXDA 4RGSA 3Q5FA 2XB0X 2PLYA 2F5EA 5M3FJ 1YYVA 3V4GA 4ENJA 4MTEA 2P7CB 1SD7A 2FMYA 4HV5A 2LYCA 2NS0A 4AU7A 2VKHA 1B9NA 1N25A 3NWSA 3QYEA 3CCRI 2W4SA 5L3BA 2LD5A 5F04A 1VQOI 3CDIA 2ADUA 5CVRA 4J19A 3BR5A 2O6GE 3CESA 4WWCA 2F5VA 3QYFA 3E6BA 1D1BA 2CO5A 2RV8A 2NVUB 1FLIA 2A3SA 1TTYA 3QQAA 4A93J 1R5ID 3BP8A 3OYAA 3CUQB 2QA4I 4MEXF 1A35A 5JHFA 1HQCA 4DBQA 1MNEA 2XGCA 2IJLA 3Q9SA 4M3GA 3VYUB 3DQVC 2IS2A 1B8IA 5BNGA 3G2BA 3TW6A 1T6SA 4KN4X 2W24A 4M6XA 4R8HA 2PJRB 4KN7X 2ISYA 2JPBA 3GTGJ 3WGGA 5K1YA 2XSDC 1LEAA 2GOXB 2IS4A 4L9VA 4RBOA 1RZ4A 3HXLA 4AIKA 4QWQA 5L3CA 3Q0UA 1F43A 2A6EF 1R5HA 3MWMA 3J7YJ 4A3GJ 2LNBA 5HLTA 5EG0A 2HWVA 4I98B 1IG7A 4IKFA 4CA0A 1ZARA 1D5YA 3S1NJ 1UG2A 4NNJA 2K9SA 1SMYF 4IOAF 2IP2A 4BDYA 4D0PA 1BOBA 1BR4A 2XAUA 3FX3A 5FRNA 1VQ6I 2I10A 4EATA 4ZYHA 2L9VA 5F1RA 3L2QA 1IZ1A 1JHHA 2MH9A 2IGNA 1K4SA 4RGRA 5KAFC 4I6ZA 4XOPA 3FXQA 2DMPA 2H6CA 4O3MA 3H9QA 3DEEA 4G8XA 4LG0A 3VYTB 2XF7A 2Z1DA 3UKGA 1JT0A 3AG1H 4M3EA 3E5XA 1WJ5A 1W7PA 2W57A 2FU4A 1HXDA 2L4MA 2EA2A 3MMYB 1X19A 2KHMA 2O0YA 2KIUA 3CC7I 1OKRA 4U88A 1IDZA 3IH3A 3JSPA 3HOTA 1XMKA 2UV1A 2HOAA 3HOZJ 5E3MA 3SQNA 2PI0A 1QGPA 3K1PA 3U1KA 4RDUA 2XKOA 4HF0A 4IX7A 4S04A 1I1GA 5C3EJ 2ZXWH 3LSIA 1BN5A 1YITI 1I6HJ 2K85A 1MBEA 4U0YA 2XB5A 2VKEA 2R3SA 3S1MJ 3S17J 1G3TA 2E34A 1PP8F 5CVIA 5DCFA 4ZH4F 3F23A 2VT3A 4IRGA 2XHKA 1G59A 2JVHA 2LK2A 3ECHA 4ESBA 2VL8A 1T8IA 4BDZA 1B8IB 4IRIA 3HSFA 4OMZA 3TP0A 3TP3A 3BZCA 1IUFA 1APLC 4LMYA 3LL7A 4HYEA 1A31A 3BY6A 2XGDA 3CCLI 3MFKA 2JQ7A 2LFBA 1KQ8A 2DMTA 2W84A 1P2FA 5F1JA 1V5EA 2WY7Q 4P55A 3FXMA 1ZGWA 3KP3A 4Z6YA 2WB1N 3H5RA 2VN2A 2NXNB 4F7ZA 5LEKA 4LB5A 4EJVA 3CMAI 5EG0B 1IDYA 4H4KC 1JI8A 2OCCH 2XRNA 2O8KA 2K3PA 4F3QA 2CMPA 4CH7A 2NNYA 4A3LJ 1JKPC 2CGPA 2MD0A 1U5TC 4B43A 2F48A 4FCYA 5HS7A 3I4NJ 1DDNA 2CV0A 2L01A 5GAEJ 3DV8A 4BEHB 2MFZA 1Y0UA 2ZJPF 3BR0A 3FISA 3B6AA 2LVSA 2CQNA 5EZGA 3RQIA 4HX4A 2L5QA 4BKXA 3BJ6A 2OBPA 4G9YA 5DV5A 1ZRDA 1ETVA 4LG0B 3C7JA 3E0JB 3ZGKA 1KYWA 1YG2A 3IHUA 3LAJA 4UV9A 3HM5A 2JK3A 3KYLA 3IWZA 3BG9A 3SEZA 1MW7A 4GO1A 4IHSA 3CJRB 2L0KA 1TL8A 2KPMA 2STWA 2OTJI 1RNLA 4CZCA 3PQJA 3L1PA 3ZQCA 4GGGA 1H9TA 3ZQIA 3G1MA 4RGUA 2RNGA 2LREA 5DTDA 4JX4A 3DKXA 2CWEA 3OL3A 5AONA 2M4GA 3K9TA 5CVJA 3OL4A 2FUG2 5FD5A 3C1DA 2M8GX 4A6EA 1FSHA 4NC6A 3ROUA 2HGCA 4IXAA 3FXLA 3DBLB 4C3IJ 2YR2A 4RAYA 1FTTA 2ETHA 3QPSA 4AYBN 5IP9J 3JRAA 5DCMA 1U9NA 2A69F 2LY2A 4CYCB 4BACA 5HDNA 3B02A 2JJ7A 3CQZJ 2YUSA 1FIAA 1AA7A 3MZ8A 1X1PA 2DO7A 3TEDA 3WG9A 3QU3A 3NRVA 1YW9A 1WJAA 3QPTA 3M4OJ 2DJNA 5LHIA 1WJFA 2VKDA 2M0CA 2V4JC 3Q3SA 3VFZA 2HYJA 5J4VA 1ONVA 3WODF 4XLNF 5HS9A 1XS9A 5HDKA 3S3NA 3H35A 2DODA 1X3UA 1GLNA 3GFIA 3BTIA 1I1SA 3H0DA 2RAEA 2FBIA 2KZGA 2WTEA 4II2A 1YIJI 1XG1A 4OWRB 4UVAA 3IUOA 2EA4A 1FT9A 1WSUA 2CUZA 3EUHA 4Y15A 3WGHA 1C0WA 4PZJA 2DQLA 4UXNA 1TW3A 1IW7F 2R7OA 2GLOA 1F1ZA 1RC9A 4ZDLA 3MVPA 5FO5A 4CCOA 1BIAA 5LLQA 3MEXA 1O3SA 1P4XA 2LG4A 4Y13A 2K27A 2X51A 3K4MA 5CQEA 4HSTA 2E60A 3HYIA 5D8LB 1J9IA 1RPWA 4F93B 2DK8A 3I59A 4OAZA 3N97A 2GXAA 4YIRX 4CCNA 3K4CA 5J3LA 5BQTA 3DFGA 3M1CA 3CCUI 1YI2I 1FYLA 4UY8I 1KGSA 2VOPA 3NARA 1SAUA 3F8MA 3UNGC 2X6OA 2R0QC 1OJLA 3RKWA 4IZZA 4JBAA 3JRBA 2O61A 4BQNA 3T8TA 2WV1A 2DT5A 5EEGA 2BHZA 2V9VA 3Q9VA 2PMHA 2FEZA 4L5JA 2GA1A 3REOA 3JW4A 3CCSI 4RS8A 1RIOH 1IXRC 2CYYA 3KFWX 3OY9A 2NRAC 3CCVI 3DBRB 5GTHC 3OYCA 4PJLA 1HKQA 2EINH 2CU7A 4HF2A 2A68F 3VSKA 1HBXG 2K7LA 3ZQQA 2H1LA 4BH9A 1FYKA 3EUKL 2OV7A 2RKHA 3HRTA 1OLTA 2XAHA 4V2FA 3OYLA 5ILSA 1GXPA 2M8EA 4AYBA 2RVCA 4N9HA 3VODA 3GUDA 2IW5A 2QQ8A 4ZDOA 2H09A 2FQ3A 2KL4A 1PYVA 5DCMB 1SFKA 2VKVA 1IRGA 3S3MA 4PCQA 3DTIA 1DPUA 4YELA 1ZG3A 3FHNA 4EM1A 3HZJA 4RAFA 2JA2A 3FHZA 1RETA 1U3EM 1YIOA 4KMUX 4DIQA 1NH3A 1YE9A 2E1MB 2HVSA 1V4RA 4Y33A 4LITA 1TLHB 3HJEA 1D0YA 3PFYA 2EPFA 2VQCA 1I27A 2PEXA 1X1CA 5K5RA 4XLFA 2L9NA 3W2VA 1OR7A 4I0AA 3NEUA 1ORKA 1WRJA 2KT0A 2R5YA 3DF8A 3OIQA 5AIQA 1O57A 1QZYA 5EDNA 4F92B 1MBHA 3IWFA 3NAUA 1T0FA 2LDUA 2L4AA 2XF6A 4LB6B 3RKXA 1NG7A 2EV0A 1LVAA 4FHTA 2HDDA 1B59A 2H1KA 1T38A 2LF8A 1J0RA 4CDGA 4KISA 3LQRA 4Y4RA 4EM0B 1S9HA 3W6JB 3KLOA 4IQJA 9ANTA 3I54A 3GCMA 4B09A 2CQ7A 2JWTA 2K9NA 1VQMI 3DPLC 3I59B 3QPLA 3MN2A 3U1DA 3EYIA 4ZYDA 2M2EA 3KP4A 5CQGA 4RB3C 3BQZA 1ETWA 4AIHA 2QBYA 2CUJA 4MIMA 2E1OA 2HZTA 2XC7A 1I3QJ 1WI9A 4M9SA 3HDDA 5B1AH 2XROA 4CHUA 4PJNA 1ZYRF 1Z21A 1HA8A 2RQPA 3I9V2 2WAQN 1YOVB 1XCBA 3JAMK 2LMDA 2PN6A 2VQHA 2HEOA 3PUBA 1ZTRA 5B3SH 3J80Z 4I2OA 2VONA 3SDGA 5JR3A 5F08A 3K0LA 1NG6A 3HOUJ 1YHQI 5BPDA 3VDXA 4L0YB 1UB9A 2B9SA 3GTJJ 1FTZA 3WTUC 1HSJA 1HKTA 1WQ2A 1U5TB 1YJNI 3OS1A 2HVQA 4A3FJ 2JN6A 4KIFA 4LIVA 1T08B 4GYIA 2R7XA 4NC8A 5IT9Z 1F36A 2ZBKA 2GQQA 3N05A 2DOFA 4OIPF 2R7DA 4CGZA 5ICGA 3KZIC 2D1VA 1YS7A 4OIQF 2ZMEC 3FXUA 2EB7A 2O03A 3IKVA 4Q47A 5F0CA 1DQUA 4B48A 3S32A 2R5YB 3TQNA 3I56I 2KRHA 2ELJA 2XAFA 4BHPA 1FBSA 2QQAA 4N4NB 1JUSA 3HOSA 3D5LA 2K4BA 3I64A 3F3XA 1XMXA 1X1DA 1IF1A 4HDVA 2CJJA 4F52A 4RB1A 2Y9YA 3A2KA 2GWRA 4MNUA 3ZXSA 3VB2A 2QSHX 1P6RA 1SAXA 4IL6C 1FPQA 1ZLJA 1EJ9A 2K86A 2ZFUA 4HNVA 2HYFA 1RESA 5B66C 4E7HA 2K40A 3T8RA 4I01A 2L3DA 3L00A 3WTTC 1D8KA 1BL0A 3FF5A 4BYYA 2QBYB 1FIPA 2JZYA 3R0AA 3PNTA 2IS1A 2DMUA 2HI3A 4AUXA 3L2UA 3O6BB 3JSOA 4UV8A 4YFNF 2R5ZA 2DFIA 5E3OA 2FMLA 1BJZA 2XDVA 2EFQA 1AWCA 4M3FA 2LLKA 3CLOA 1Z3YA 1WFXA 1X2MA 4JOMA 3GF2A 3ULQB 4YEJA 3CTAA 3UR3C 1S5LC 3D5RC 2HXOA 3KLNA 5TGTA 1SFOJ 2FBKA 3CD6I 4P9UA 2JRTA 5ERIA 3RYRA 1NK2P 4FE4A 4QTRA 4EEFG 3OYIA 1ETYA 3ZR8X 1UHSA 3CCJI 1WGXA 3T5XA 4L9JA 1LKXA 4AIJA 4U7DA 4A3IJ 3I5UA 3CCYA 3WTYC 2QGUA 2EFPA 1TT5B 2ECCA 3W6KB 1Y8QB 2Z99A 4S05A 5D5WB 3CUQA 2XAGA 1Y1VJ 4X6AJ 4HQMA 1D1CA 1KONA 2CV2A 2A61A 3D0SA 2ICWG 3CUOA 4LK0F 4BE2A 3A1YA 5J1YA 2V7FA 4ZYAA 4UUSA 3O3KA 1PJRA 1P4AA 2COMA 1JTYA 2DOAA 2VODA 2V26A 1FWZA 3ASOH 1SVMA 3I58A 3DPUA 1XMAA 5HODA 3JTGA 1OMIA 2P5LC 1K6OA 3ABTA 3AG3H 1J5YA 1MKMA 5JFRA 3OS0A 2PJRA 3ISPA 4P96A 1USSA 1K61A 4A3EJ 4DBRA 1FJLA 2VXZA 1L3LA 5IP6A 1I6XA 4I76A 1ACIA 1Z7LA 4NQWA 4RB2C 1U2WA 4KA4A 2AHQA 2UWMA 1JE8A 2HTSA 4GRIA 4XN0A 3OIPA 1FSEA 1T2KA 1E0EA 5IYCJ 3ZMDA 4B47A 3L7WA 3W3CA 5FFZA 2E1NA 2WADA 5KAIC 5D4SA 4GDFA 2X0LA 3MZYA 4UHTA 4ASNA 2DU9A 4BQQA 1REPC 3GEZA 4LLLA 3LFKA 4BUPA 4CCKA 3CO7C 4D7NA 1WJEA 2DCEA 1B9MA 2NS7A 1U8BA 3RPQA 1UZCA 1Y39A 1PUEE 2BEOA 5HNHA 5B1BH 2V1DA 4LK1F 4MTDA 2QQBA 4BNCA 3BR1A 3COAC 3CF5F 1MD0A 3OWTA 2R7TA 1LFUP 4JX5A 5D6EA 2R5ZB 1MBJA 1QPMA 2OQRA 3FK6A 4B8XA 4A3BJ 2ZCWA 2X6YA 2WA0A 1KU7A 1STZA 2ZB9A 3CCMI 5GPCA 3RDIA 2CW8A 1UHMA 3SEQA 5FKLA 4E7KA 1MNDA 3I0TA 4R1HA 2R7ZJ 4L9TA 1FP2A 3V7SA 4ESJA 5B5EC 3GLLA 4LOCA 3BOQA 2DYRH 5J6XA 2KKOA 2V79A 1VZ0A 5JLXA 3E3VA 2KJCA 3ZQHA 2OU2A 3QWLA 2WV0A 4S0HB 5M5XJ 4D9JA 2BY1A 1VF9A 5DDGA 3HPHA 4WX9A 3L2RA 1I5ZA 1ZRFA 1KQ0A 5ICCA 1BW6A 3HEFA 4XL9A 3K4BA 4UUSB 3ABUA 1JKOC 2M9HA 3GFMA 2VC1A 5LHHA 5TRDA 1E2XA 2Y30A 2W00A 3H9GA 5JHUA 3C18A 1W0TA 1HW1A 5E20A 3HPGA 2M87A 3U2RA 3H3ZA 2CW0F 1O7FA 4ON0A 2PG4A 1VQ9I 4E70A 2L2OA 3KEQA 4RM3A 3PO2J 2E36A 1YTYA 1OISA 3C2HA 1U0JA 1FEXA 4NQWB 1R22A 4DW6A 4HNUA 5CVUA 2CG4A 3GWZA 4ZC3A 4WK8F 4XN3A 1VNDA 2P7VB 4DOZA 2HPMA 4MEYF 3ZMZA 3AKZA 4XLHA 1R4MB 4J01A 2KMUA 2YPRA 4WCGA 1H0MA 3DLAA 2VBZA 3BDDA 3K4JA 3KYCB 4IHTA 2DMQA 4EM2A 5HVQC 5F6FA 1JGGA 1S7AA 1ITYA 2FBHA 4BEHA 4PFOA 3WTXC 3LWFA 1DGRM 1WH5A 4IEJA 4C2MJ 2JA5J 5FKNA 4L5EA 5A2QK 1X3ZB 2DA4A 3FM3A 4ENNA 1HDDC 2ESHA 2BOLA 2I8DA 2Y75A 3P5JA 1X1BA 1SC7A 3CZ6A 1HF0A 1QNTA 3ZMSA 2X1CA 5HLHA 4DQ2A 2MLKA 2DFFA 1BBYA 3GLXA 1SANA 3AL0C 4IOCF 4XOTA 4GFBA 2VJIA 3KPHA 1BI3A 3G3ZA 4KT6A 2UUZA 4FT8A 2GIZA 2RQQA 3JRCA 1G8XA 2XGEA 3VSLA 1B6AA 4KMFA 1W0UA 3ZOBA 2YS9A 2JSCA 5GAGJ 5DYMA 1GVJA 3ABMH 2CRGA 5LGUA 2HYGD 3S2HJ 3R4KA 1IRFA 1LDKB 1BOAA 2MYSA 4IVNA 3C3WA 1WH7A 1O7LA 2YU3A 3OYBA 2X4HA 1TBXA 2A6HF 2UXNA 2FOKA 3QYBA 4CYCA 1VQLI 2LRDA 5K5QA 2FXAA 2VJ4A 4NB5A 2JA8J 4RLFA 5EGOB 3BJAA 4HAMA 2VPRA 5LRSA 3H9JA 4X0GA 2PQ8A 2KDZA 4A5MA 1TT0A 4OIRF 4XSZF 2OUMA 1OQYA 3G1OA 3K70C 4MFDA 3C2BA 3G1LA 5EZHA 3W2AA 4RA2A 4ETSA 4LGWA 1HLVA 2XSJC 1JKQC 1SFUA 1R23A 3TO6A 1MBGA 5EF6A 3OYDA 4XK4A 4FETA 3OYGA 3F6OA 4XLAA 2R7UA 1XN7A 2J5OA 3RI4A 1F5TA 2HQNA 5ILUA 3QODA 3RPUA 3NWTA 1TQIA 4HNTA 3HRSA 5D6FA 4M3DA 4EQQA 1P7IA 3BTJA 1HOMA 2DA5A 1WVRA 2GZWA 1TWAJ 4IJAA 3QP6A 2DI3A 4PJMA 5HLIA 3OYFA 4YG2F 2NVTJ 2FJ1A 3H92A 5H2FC 4Q5SF 2UXXA 1QHGA 2V6EA 3K2ZA 2VBXA 4N4OB 1G4DA 1G6NA 1W5SA 2LR8A 1ZELA 3ZQ7A 3S2DJ 1IRXA 1BI2A 3DEWA 3LQQA 4HEA2 4WXCA 3HOWJ 4PK4A 1LDJA 2IGKA 2Z9OA 5J47A 2YSRA 4ESFA 4KICA 4UVBA 2C6YA 1BIBA 1IO2A 3QPHA 2HOEA 3S14J 3H3UA 3S93A 4E7SA 2YX7A 2GOMA 1K79A 4NDLA 5TISC 1ODDA 5GPAA 4UUTA 1YW7A 4DYCA 2PX9A 1R6RA 2KRCA 5IPAA 2BYVE 1Z91A 4HA8A 3JRHA 2QKLB 4BY1J 1IJWC 2GXBA 3WTVC 2OD5A 5BPIA 1LPQA 3S1QJ 2K9MA 3HSEA 2EZIA 3ZQFA 4ZTJA 1FOKA 5H6QA 2IS6A 3LSPA 1O4XA 3QRFF 1SD4A 3GTPJ 4OU0A 4HDUA 4KJZA 1OR7C 2VIXA 5CLSA 1CQTA 2P5VA 2ISZA 2DW4A 4KUMA 3MKLA 4HV6A 2ZSHB 2QVOA 3E7LA 3E6DA 3AG4H 2FRHA 2EJRA 1HDPA 2IGMA 1OYYA 2GIVA 3Q0WA 5CKTA 5K7ZA 3LMMA 1T0FC 2GBYA 1TWCJ 2Y48A 2PFBA 3HUGA 3QAHA 2B63J 4UUVA 4D5FA 4B3AA 3BCBA 2X48A 4FX4A 5KVRA 4F91B 2BVLA 3G6EI 4HLXA 2JMWA 3LFUA 3IRRA 2X9DA 2Y31A 4N0BA 3AG2H 4NC7A 2Q0OA 3PQKA 3JRIA 3BG5A 4HW0A 3CDLA 5CYVA 4XONA 3FXKA 4H0EA 1Q1VA 1WPKA 3MD2A 4I09A 1DUXC 1IN4A 3A01A 3PO3J 2IAIA 1OCRH 4NBQA 1D8JA 5DD8A 4FE7A 3TGNA 2P0WA 5F64A 4C9YA 4WXDA 2WAEA 5ED4A 1Y0NA 1BI0A 2ZSIB 2A5WA 2R7QA 4LIUA 2F4OB 2LBFA 3WGIA 5E79C 4HZFA 2E1CA 2I5UA 1SEUA 1FNNA 5FKOA 2HQAA 3L2VA 3JREA 2XUBA 4IRHA 3DXJF 2EILH 3HIFA 4B3XA 2VQGA 3E1SA 2M34A 3V8LA 2DT7B 4II3A 4GXOA 4FASD 1XGMA 4ENKA 1VQ5I 2ZFWA 4CO8A 3I4PA 4GYGA 4D5CA 3GO5A 2OZUA 4D1QA 3M3YJ 4XKBA 2BXZA 5DM6F 3E5UA 1F4KA 5K5OA 4E7LA 1R49A 5HS8A 5IOYA 3PNYA 4UNOA 2M1BA 2KJBA 2KLOA 4W97A 1OCZH 1RR8C 1BR2A 1V5FA 1GDTA 4KIGA 3HTUA 2MLGA 2BGCA 1XB4A 1S29A 1TWFJ 5E3LA 3KCCA 2NVQJ 2R7VA 4ENMA 4FISA 3U9GA 1GT0C 3PNVA 1DP7P 2HS5A 2BY2A 1U5TA 1SD6A 3E97A 1YLFA 3O2PE 1W5TA 3F8NA 3DKYA 2BV6A 2HR3A 3HL2A 3JAMZ 1LJ9A 1P4WA 1GVDA 2HKOA 4MQ9F 3V8KA 4UVCA 2RN7A 3SFIA 2A07F 3HUGB 4XORA 3F9KA 2NS8A 5H6RA 1XGOA 2X85A 2H27A 5D5VB 3RIRA 3ECOA 2IA2A 1E3OC 2EQRA 2P6SA 2B7EA 4BY7J 4BJTA 1BI1A 4CYDA 2K4JA 4XKCA 3BPXA 5KCMA 5KNLA 3A01B 2XASA 2X1EA 3A0HC 3ZMUA 5E1XA 4PGGA 1VQKI 3HGGA 1FMWA 4JK1X 2IBDA 2V1UA 4KNYA 2GXGA 3MCZA 2X6XA 4AIDA 1GV5A 3LOCA 2Q8KA 2LBFB 3T1BA 1NTCA 3BWGA 3P9KA 1OCTC 3B73A 5HDGA 1TW2A 3OR1C 5LD2C 3OYKA 1WJCA 2MC4A 3HKZN 1R58A 2D45A 1HW5A 1ZG5A 2R7WA 3SHFA 4BQOA 2WBMA 1KQ9A 1L0OC 3LA3A 5DD4A 2RC4A 4XQFA 3G71I 1ZGJA 2XKPA 3ASNH 3KEOA 3FBNB 1K7AA 4C2TA 2NYXA 3GZNB 5K7FA 3CP8A 1TC3C 4V19K 3ZPLA 1UHWA 1TWGJ 2QLZA 1R9TJ 4BQAA 3ML6A 2LOOA 2RGVA 1RI7A 2M0MA 3M8EA 3TKYA 3SZGA 1RKTA 4PJ0C 1VQ8I 1Z6RA 4EJUA 4U87A 1X58A 1QRYA 5IP7J 2D5VA 4Z2YA 4IHWA 3K69A 4ZYEA 4YRVA 2EIKH 2L7ZA 2VBWA 2OAZA 3PSIA 4XR6A 4AVPA 1DU6A 2JSPA 1Y6IA 1O3TA 2F5CA 1B1BA 1MH3A 5C44J 2P81A 2XPUA 3HGYA 3LSMA 2F4IA 2L02A 4HPQA 4LLNA 5CJ9A 1V54H 2ZO4A 4I99C 4KIBA 4XLEA 4RB0A 3SFZA 3OOPA 1MIJA 2EFWA 1B4AA 4L5IA 2CH0A 2ZJRF 3GZ5A 4XKWA 4JQFA 2IRFG 2M7BA 2E19A 5FLXK 1YW8A 4HRIA 1PUFA 5JI6A 4U0VA 1X3WB 2DA6A 3MKZA 2LH9A 1R5GA 4ABZA 4G7ZF 1QZEA 2EZLA 2HTJA 1XDUA 1J7KA 3RZOJ 2OJED 4A12A 1ZHFA 1X4PA 1H88C 4M6YA 3JRDA 2HOTA 1ON2A 2K5CA 2K9QA 2VB6A 3HB9A 1QPIA 2P5KA 2ZJ2A 1XX5A 2KP6A 3FWEA 4M9XA 3H36A 2R7SA 5DM7F 4M73A 3IC7A 3WU0A 4QPQA 1FBQA 4IQ4A 5E8IA 3GZ6A 5M5WJ 3HKZA 1TQPA 2XPWA 2O7OA 4KITB 3GX4X 1IGNA 1IV8A 3TDUC 3V8JA 2HU9A 4J00A 4CCLA 2XV4S 2FX0A 1GXQA 2DFEA 4I02A 2LKPA 1XGSA 2DA2A 5TJJA 2FNPA 3RQ4A 4DGWB 4BU2A 3S8PA 4Y3OA 3GMEA 3WE2A 1KA8A 4A69C 1W36C 1UCRA 2JUGA 3TO7A 1TNTA 3BR3A 1TWHJ 2QUFA 3EUAA 1ZR4A 3RTRA 2ACJA 2CV1A 4EJOA 1T56A 3FIWA 5HLGA 4L9NA 1UG0A 3I3LA 2KFDA 2FOWA 4V2GA 1TP4A 2L7MP 3ABLH 4NUBA 4BXUA 2HDCA 2FSWA 3J80K 1R36A 2GM4A 1XSDA 1CF7A 2DDBA 3JR9A 2HOSA 1FP1D 4WF2A 5IYBJ 1J59A 3J81K 2MH2A 4C2UA 4AC0A 3VWBA 1K83J 1RKWA 4HX7A 4O5VA 5JVGF 4FTHA 3OOUA 3RPUD 5FLVA 2JA7J 1FYMA 4AM3A 2CUFA 4BE0A 1LNWA 1H9GA 3JRFA 1TZLA 3L09A 1G3YA 3PL8A 3QOPA 4BL0B 2QF7A 3WG7H 1BA5A 1XD7A 5H20A 3KP7A 3X2QH 4OINF 4DZPA 1U78A 3AAFA 3OYEA 4WXHA 1O3RA 4CXFA 1ERDA 2L54A 3IAM2 3E6CC 1PUFB 1JXSA 5F0FA 2H94A 3DPTA 3HRMA 4IHVA 3CO6C 1CGPA 1Z1DA 2E5NA 2XVCA 2NOJB 3DBHB 1I50J 1MZBA 3SXYA 2LC2A 3V42A 1DP3A 1ZREA 2CQKA 1U9OA 4I0BA 3KETA 4M74A 3O8HA 1RUOA 2EWNA 2KISA 1J09A 2COBA 1QU3A 1ETOA 5LBQA 2IVMA 4RAGA 5HNFA 4E7JA 3I55I 2HVRA 1ZGAA 2CQXA 2E5ZA 1FOXA 4HQEA 5GP9A 5C4XJ 5FROA 4DYRA 2AXLA 3BPVA 4U0WA 2AQEA 3CCEI 5FRMA 1OCPA 3ZMVA 4U7BA 3HTSB 2ESNA 1G2HA 1OYIA 1X4OA 2G9WA 3TO9A 2VE9A 2RNJA 2QYOA 2HXIA 1IN8A 5LFAA 2H6BA 1YRNA 2BY3A 4A6DA 3CJTB 2ME0A 4EGYA 2W7NA 5FKMA 3OV8A 5D4RA 2PJPA 4TV7A 3OR2C 2PMZN 2MD5A 3VOEA 1R1UA 1QZZA 4JX6A 1QHHD 4BJ6C 4XRSG 3TL4X 3WU1B 2M45A 1BC7C 3P7NA 2DTRA 5BOXA 4L0ZB 2M3AA 2AXTC 3R6SA 4Y7NJ 3HG9A 2VC0A 1K4TA 2DBBA 5DEQA 3WU2C 3CMMA 3FM5A 2ZJQF 1CF7B 3MKWB 1ZAOA 3F22A 2ZXIA 3GTQJ 3KYDB 1T98A 5EEHA 1X1AA 3LSGA 2MW8A 3IL2A 2BW3A 4M9ZA 3H5NA 2P6TA 4B1RA 3K4NA 5IY5H 4HSRA 1T95A 3B6CA 2G7HA 3ZCOA 1I39A 3CCQI 4G6QA 1YJ9I 3ELKA 5E17F 2BBYA 1QBJA 1SFEA 2IPQX 2HKXA 2ZNYA 3AFHA 2Y0MA 5EGOA 3M07A 3BROA 3KZZA 4P9FA 3GXOA 1JGSA 1W4MA 5BS6A 3WHCA 1M1EB 5F0HA 1D5VA 4UB8C 1XSXA 1IC8A 3ONQA 1EV7A 3CJQB 1U8RA 3HOVJ 1YS6A 3HOXJ 2L9SA 5CPRB 3ERED 1ZKGA 2IEKA 3J7AO 3K70D 2V1NA 5FD6A 3RSNA 1I3AA 4M3BA 2VJ5A 3RZDJ 1MMSA 5D5XB 1DU0A 3KEYA 4R79A 2X1DA 3F8BA 3IH2A 4XBFA 4CSWA 3OSGA 3D5SC 5FKKA 3A4CA 3ZQGA 4XLCA 3MAJA 4RM2A 3E5QA 1WZ2A 4IO9F 3HBLA 2DA7A 1MDMB 1Z7UA 4XSXF 3OYMA 3VYRB 1Z3XA 3R60A 2J5PA 1Y56A 1D3YA 1WI3A 1YRNB 3ZQLA 1SFXA 3CMYA 2IT0A 3FZVA 2LY9A 1N75A 2R92J 2P4WA 2PMZA 3JTHA 4KT5C 2QM3A 3FXOA 3PSFA 3R0JA 1A04A 1VQNI 2OC6A 4X1EA 1KU2A 2EV5A
chains in the Genus database with same CATH topology
3BCBA 2DT6A 4BJ5C 4F91B 2BVLA 5CQGA 4PSWA 3H5AA 4BGDA 3LFUA 4PJJA 2CUJA 2XC7A 4NC7A 2M4KA 4XMYA 4XONA 2K9LA 4PJNA 3MD2A 1Z21A 2A6TA 1HA8A 3I9V2 2E1MC 2BW3B 4CCMA 2HZDA 2VQHA 4C30A 3RCOA 3GBGA 2P0WA 4C9YA 2R7RA 2WAEA 4CCJA 3PUBA 2ZSIB 2A5WA 2R7QA 4LIUA 2LBFA 1NG6A 1K6YA 4PSXA 3OYNA 3VDXA 2HQAA 3L2VA 2IGOA 3EUHC 4B3XA 2VQGA 3OS1A 3E1SA 2HVQA 2DT7B 4II3A 3OS2A 4LIVA 4FASD 1FMVA 2R7XA 1EA3A 3IAS2 4NC8A 2DXIA 2O5RA 2X6WA 3N05A 4D1QA 4XKBA 2ZXHA 3BC8A 3BG6A 4E7LA 1MMNA 3PNYA 3DTEA 2KLOA 2VXDA 2VJJA 1BR2A 1V5FA 1N78A 1DQUA 3OYHA 4B48A 3M8JA 3S32A 2LYCA 1MMAA 2VKHA 4AU7A 2KRHA 2ELJA 3NWSA 3QYEA 2Q1ZB 4N4NB 3HOSA 4BXFA 3D5LA 2W4SA 3J7AY 1DGWY 1X1DA 2R7VA 3QOEA 2CFOA 3PNVA 4F52A 4ITVA 3A2KA 3ZXSA 4ZDPA 3CESA 2F5VA 2QKMB 3QYFA 1UELB 3DKYA 1D0ZA 3HL2A 1D1BA 3SDBA 2ZFUA 3HUGB 4E7HA 3OYAA 1WJDA 4XORA 3F9KA 5JHFA 4DBQA 1MNEA 2Z2SB 2X85A 3PNTA 2IS1A 4ZJZA 3VYUB 3DQVC 2IS2A 4BJTA 3L2UA 4P1WA 3G2BA 4XKCA 5KCMA 5KNLA 2HNHA 2X1EA 2XDVA 3C2GA 2PJRB 1Z3YA 1UAAA 1FMWA 2Q2EB 2XF5A 1WFXA 2GOXB 4JOMA 3K6GA 4YEJA 2IS4A 3UR3C 3D5RC 2X6XA 5TGTA 3HXLA 2LBFB 2IXSA 4ZTFA 3OYIA 3ZR8X 3OR1C 5HLTA 5LD2C 4IKFA 3OYKA 1WJCA 1LKXA 4CA0A 2MC4A 1D1AA 4NNJA 2R7WA 3LSKA 4E7IA 4BQOA 2WBMA 4BDYA 1D1CA 1KONA 2CV2A 1BOBA 4XQFA 1BR4A 2XAUA 5FRNA 4MLOA 4BE2A 3A1YA 4EATA 2V7FA 4ZYAA 4C2TA 3FBNB 1PJRA 2DOAA 3L2QA 2V26A 3CP8A 2IGNA 4G6TB 3DPUA 4XOPA 4LG3A 4PUSA 1N77A 2LOOA 3CP2A 2F6CA 2M0MA 3OS0A 2PJRA 3SZGA 3H9QA 3DEEA 4DBRA 3VYTB 2XF7A 2Z1DA 4U87A 2VXZA 3FDYA 1Z7LA 4YRVA 2UWMA 1WJ5A 3PSIA 4XR6A 4GRIA 4XN0A 3OIPA 2JSPA 3MMYB 1Y6IA 3U21A 1X19A 2KHMA 1E0EA 2WB1A 4B47A 3SYTA 3BLYA 3LSMA 4HPQA 2F4IA 3W3CA 3HOTA 2UV1A 2WADA 4XLEA 2CH0A 4IX7A 4BQQA 4XKWA 4JQFA 3LSIA 4BUPA 4BS9A 4CCKA 2M7BA 1WJEA 2DCEA 4HRIA 1WJBA 4XKVA 3EPZA 2LH9A 5HNHA 3MKZA 4PFPA 1G59A 2JVHA 2VL8A 4BDZA 3OWTA 2R7TA 1YX3A 1X4PA 2K5CA 2VB6A 2X6YA 3LL7A 2WA0A 2KP6A 1YX5A 2R7SA 2CW8A 4QPQA 3SEQA 1V5EA 2WY7Q 4IQ4A 4E7KA 1MNDA 3H5RA 2HDWA 3BG7A 3HKZA 4H4KC 4KITB 1JI8A 2K3PA 1VZ0A 2HU9A 4F3QA 2CMPA 4CH7A 4J00A 4F55A 4CCLA 2MABA 4D9JA 2MD0A 4B43A 3HPHA 3L2RA 3BCAA 3RQ4A 1D0XA 3S3OA 2V9KA 2CV0A 4DGWB 4BU2A 2Y0SA 4BEHB 4XL9A 2MFZA 3K4BA 2KQRA 3S8PA 4Y3OA 1W36C 2W00A 3H9GA 3AL0B 2JUGA 2CV1A 2L5QA 3EUAA 2BVMA 3RTRA 3HPGA 1UG0A 3I3LA 2RREA 2VLAA 3DU6A 4NUBA 3FBIB 4QPOA 2L2OA 3E0JB 4RM3A 3ZGKA 3C2HA 1U0JA 4AVZA 3KYLA 4NQWB 4HNUA 3SEZA 1MW7A 4C2UA 4ZC3A 3CJRB 3VWBA 2KPMA 4XN3A 3DWLE 4DOZA 4CZCA 2HPMA 3OOUA 2Z16A 4ANJA 3RPUD 1LFPA 3AKZA 4XLHA 3K10A 4J01A 4BE0A 2KMUA 2RNGA 2LREA 2W1OA 3DLAA 3DKXA 3K4JA 1TZLA 3TBIA 3OL3A 3W2WA 3PL8A 2HPIA 2M4GA 4BL0B 5HVQC 3OL4A 2FUG2 1LVKA 2KDOA 4DJAA 4BEHA 4PFOA 1DGRM 3OYEA 2DJIA 2LY2A 1ERDA 3IAM2 4BACA 4RLQA 3DPTA 4XNFA 2BOLA 1AA7A 2I8DA 2E5NA 1W36D 2NOJB 1X1BA 3CZ6A 2X1CA 1WJAA 2LC2A 3V42A 1DP3A 3K4LA 4HG2A 3AL0C 4XOTA 1WJFA 2VJIA 2VKDA 2VASA 2V4JC 1J09A 4KT6A 1QU3A 2UUZA 2JVGA 2RQQA 3S3NA 3H35A 1G8XA 5HNFA 3DU5A 4E7JA 3VSLA 2HVRA 1GLNA 2E5ZA 5FROA 3H0DA 4II2A 2AQEA 5FRMA 4OWRB 1V5GA 3IUOA 4U7BA 3KX2A 1X4OA 2CUZA 1LDKB 4BE1A 2MYSA 1MMGA 2R7OA 5LFAA 3CF2A 3OYBA 4ZDLA 4RMNA 4CCOA 3QYBA 2LG4A 2LRDA 2W7NA 2VJ4A 2X51A 3K4MA 4HSTA 2E60A 5CQEA 4RLFA 4F93B 2WAFA 3OR2C 4E6KG 3H9JA 4X0GA 4BJ6C 1QHHD 4OAZA 1TT0A 3TL4X 4E7ZA 3PJRA 4CCNA 2OUMA 3K4CA 3OMYA 3M1CA 3K70C 2M7AA 3MKYB 1SAUA 2M3AA 3UNGC 2VPLA 4IZZA 2LY1A 3HG9A 3W2AA 3CMMA 2W82A 4BQNA 3MKWB 2ZXIA 2XSJC 1X1AA 3LSGA 3OYDA 2BW3A 4FETA 4XM3A 5KHDA 3OYGA 3H5NA 4XLAA 2R7UA 3OY9A 3K4NA 3QODA 4HSRA 3NWTA 1T95A 2VQLA 2WY8Q 4PJLA 4HNTA 3OYCA 2AQFA 3VSKA 3ZCOA 3ZQQA 3EUKL 4CUGA 2OV7A 1OLTA 4OAYA 3AFHA 3OYLA 4PJMA 3OYFA 2CS3A 4AYBA 1MMDA 1BR1A 4ZDOA 2L7KA 4B44A 2KL4A 1QHGA 1PYVA 1SFKA 4E4HA 2KZVA 2V6EA 4N4OB 3TMOA 3S3MA 1ZELA 2CW7A 3DTIA 1IRXA 3HC7A 3K4KA 4HEA2 3ONQA 4YELA 3CJQB 4PK4A 2IGKA 3FHNA 2L9SA 3IP4B 3LSHA 5CPRB 3L2WA 2JA2A 4P5OA 3K70D 2V1NA 3OYJA 4DIQA 3RSNA 1YE9A 2E1MB 3VYSB 2HVSA 4Y33A 3S93A 4E7SA 4LITA 2GOMA 1D0YA 2VJ5A 3PFYA 2VQCA 3KEYA 1X1CA 4R79A 2X1DA 1R6RA 2KRCA 4XLFA 2L9NA 3W2VA 4CSWA 2QKLB 3D5SC 3A4CA 2WAQA 4XLCA 4RM2A 3OIQA 2K9MA 4F92B 3OYMA 4ZTJA 3VYRB 2IS6A 1Z3XA 1Y56A 2XF6A 3ZRGA 4KJZA 1OR7C 2VIXA 1NG7A 2ZSHB 2R4GA 4KISA 2IGMA 3FKJA 1N75A 3DTKA 4Y4RA 5CKTA 5HOOA 1S9HA 3LMMA 2PMZA 1T0FC 4IQJA 3PSFA 3DPLC 2OC6A 1P9QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QPO A;  1DP3 A;  4QPQ A;  3OMY A; 
#chains in the Genus database with same CATH topology
 1IXC A;  1E3H A;  1IUY A;  1JUM A;  1POG A;  5ICE A;  1JT6 A;  3S16 J;  4RGX A;  4BJ5 C;  4QLC U;  2ZME B;  4C3J J;  4PSW A;  1MGT A;  3QU6 A;  3F0C A;  4BGD A;  2YX4 A;  2CQQ A;  2XIG A;  2WC2 A;  1Z05 A;  1ZH5 A;  2XAQ A;  2L9R A;  2JTV A;  1MNM C;  1H89 C;  2K9L A;  3R61 A;  3IKT A;  1ZN2 A;  4XRM A;  1G3W A;  3WTZ A;  1T39 A;  3HOY J;  2E1M C;  2BW3 B;  2HZD A;  5GAD J;  3RCO A;  3GBG A;  2Q2E A;  5J8C A;  2R7R A;  1MH4 A;  4CCJ A;  4FQG A;  1S6L A;  2ID3 A;  2FNA A;  1EH8 A;  1A36 A;  2DYS H;  2IA1 A;  1Z0X A;  1DPR A;  3SZP A;  2WWY A;  5C4J J;  3GTL J;  1K6Y A;  2QZ8 A;  1ENH A;  2NAZ A;  1JJ6 C;  3EUH C;  4HF1 A;  1KYZ A;  4A3K J;  2EIM H;  2A5Y B;  4BHC A;  4DNC A;  3SZT A;  2OTL I;  3EQL F;  4MO7 A;  2KIQ A;  5LGN A;  1KU3 A;  3MZH A;  1FMV A;  3F72 A;  3FXR A;  4O6J A;  1EA3 A;  3IAS 2;  2Z33 A;  1AOY A;  3VEP A;  2O5R A;  2X6W A;  3WE3 A;  5L3E A;  3BQY A;  4HLY A;  4XLP F;  2BY0 A;  3GTM J;  3V7C A;  1ZK8 A;  3W6V A;  4UB6 C;  3GW2 A;  1MMN A;  1R00 A;  4M6V A;  4ZYG A;  3ZP5 A;  5E1W A;  2VJJ A;  2DFH A;  3M7G A;  2B0L A;  5KK1 A;  3IRQ A;  1SMT A;  1N78 A;  3OYH A;  2E2I J;  3M8J A;  2VI6 A;  2BHY A;  4HOB A;  1MMA A;  2E7X A;  1V3F A;  4PGH A;  2D2W A;  2E71 A;  2Q1Z B;  1EH6 A;  2NNN A;  4BBR J;  4BXF A;  1FY7 A;  1VQP I;  3PIP F;  1DGW Y;  3J7A Y;  1IN6 A;  3QOE A;  3LNQ A;  2CFO A;  2JRM A;  4ITV A;  4AD9 A;  1HST A;  4ZDP A;  3JRG A;  2QKM B;  2O9L A;  1UEL B;  1D0Z A;  5J40 A;  2CFX A;  3FMR A;  3SDB A;  1OCO H;  2JPC A;  2W25 A;  4CZZ A;  2OPT A;  5EYR A;  4Q4Z F;  5IOZ A;  1Z9C A;  1PDN C;  3S2W A;  1WJD A;  2DN0 A;  1XTA A;  2ECB A;  1WKM A;  5DUK A;  1GV2 A;  2Z2S B;  3CJN A;  2M5W A;  1AHD P;  4Y17 A;  2DOE A;  3GFL A;  4ZJZ A;  3RYP A;  3BR2 A;  4P1W A;  4G7O F;  4IF4 A;  5J1R A;  2HNH A;  4HBL A;  4A2U A;  4Y52 J;  3C2G A;  1W5C C;  2K3F A;  2Y2Z A;  2ZXJ A;  4Q48 A;  2XGX A;  1UAA A;  1LFB A;  2RDP A;  1IN5 A;  2XF5 A;  1RR7 A;  2Q2E B;  5IT3 A;  1LUJ B;  3K6G A;  1BM9 A;  5BMZ A;  4BHB A;  2FD5 A;  2IXS A;  4ZTF A;  1W7P B;  3DLL F;  1LB2 A;  3KIO A;  3FMQ A;  4PDK A;  1HW2 A;  2DDA A;  1S72 I;  1S8N A;  1ZG1 A;  3DKW A;  3DEU A;  3RKY A;  3J7Z I;  1XSV A;  1FOY A;  1D1A A;  3HRU A;  1JKR C;  1XGN A;  2ZC2 A;  3LSK A;  4E7I A;  2AO9 A;  1MBK A;  4G94 A;  4LLG F;  2XPV A;  2HQR A;  1ETX A;  4MLO A;  3IV5 A;  2N8G A;  2Y0S N;  1A6I A;  2OF7 A;  2OZ6 A;  3NQO A;  2IA0 A;  2W48 A;  1AKH A;  4G6T B;  5EJC A;  3IH4 A;  4LG3 A;  4PUS A;  1N77 A;  3CP2 A;  3A0B C;  2F6C A;  1JTX A;  2STT A;  3LA2 A;  2LTP A;  2NOG A;  5J4Y A;  2VBY A;  2DA1 A;  4YFK F;  3WTS C;  2F5D A;  1WHU A;  2G7U A;  3FDY A;  3EDP A;  4XRF A;  1JHF A;  2MA3 A;  1H8A C;  3K1N A;  3E6M A;  2UZK A;  1PP7 U;  1LE8 A;  1UFM A;  1SVO A;  3GFJ A;  4C3H J;  3U21 A;  1W1W E;  2LF7 A;  4KDP A;  3P9I A;  1EF4 A;  2WB1 A;  3SYT A;  3BLY A;  4M72 A;  2OQG A;  2ID6 A;  1OFC X;  2QEN A;  2HFH A;  3CC2 I;  4BXX J;  3H3V K;  2H8W A;  3LA7 A;  4LD5 A;  1MSE C;  2QSG X;  5M3M J;  4BS9 A;  1ON1 A;  1WJB A;  3A02 A;  4XKV A;  4FX0 A;  2Y9Z A;  4CIC A;  3OSF A;  3EPZ A;  1Y1W J;  2E7W A;  2OA4 A;  4PFP A;  1HCR A;  4A3D J;  2F4M B;  1XDS A;  3EET A;  2DA3 A;  3Q0V A;  4A0Y A;  2FE3 A;  1KZH A;  3H0G J;  3T0Y A;  1IN7 A;  2NVX J;  1YX3 A;  2R7F A;  5LHG A;  1Z77 A;  2D1H A;  1FC3 A;  1ZRC A;  1R4N B;  2H8R A;  2LP0 A;  1YX5 A;  1JUP A;  4XRS A;  3F8C A;  4YFX F;  2XRL A;  1RUN A;  4IHX A;  3P9C A;  2QEX I;  5FGM A;  1YO5 C;  2HDW A;  5J8F A;  3BG7 A;  1E3P A;  1HC8 A;  3M1E A;  1QA6 A;  1SD5 A;  4XIC A;  3ABK H;  3O8G A;  2F2E A;  3G4S I;  1FZP B;  4F55 A;  4A0X A;  4EVI A;  2MAB A;  2M30 A;  2CUE A;  3BCA A;  4RAZ A;  1D0X A;  3S3O A;  2V9K A;  4A3J J;  2BE5 F;  2Y0S A;  2A05 A;  4QIW N;  5LEJ A;  2KQR A;  4JYK A;  4L18 B;  5FB2 A;  1QVU A;  3KZY A;  4XID A;  1R1T A;  3BJO A;  5L3D A;  1AKH B;  3AL0 B;  1ETK A;  4YII A;  1GHC A;  2BVM A;  2FF4 A;  1UJ8 A;  2EH3 A;  2RRE A;  2V1X A;  2VLA A;  3CLQ A;  3DU6 A;  4QPO A;  2CSO A;  3FBI B;  1BW5 A;  1WCM J;  2F5F A;  3K2A A;  3I4M J;  4AWX B;  5FLX Z;  2L7F P;  4AVZ A;  3KE2 A;  2VOO A;  5JLW A;  3D1N I;  1LE8 B;  2QWW A;  3GTO J;  3TW7 A;  2HQ5 A;  2TDX A;  3DWL E;  1J2X A;  1R71 A;  1FOW A;  3GTK J;  4ANJ A;  2Z16 A;  4MQV A;  1K78 A;  1LFP A;  4KFC A;  3HHG A;  1IAW A;  6PAX A;  3EYY A;  3K10 A;  3KP6 A;  2V9P A;  1VFC A;  1LQ1 A;  3ZN1 A;  5E8G A;  2W1O A;  4A3M J;  3TBI A;  3W2W A;  3QP5 A;  2HPI A;  3K7A J;  1VTN C;  1O3Q A;  3RJP A;  4OMY A;  4G6D A;  1J75 A;  3F8F A;  1LVK A;  4A0Z A;  2K02 A;  2KDO A;  4DJA A;  4IHY A;  1Z67 A;  3M8F A;  1IV6 A;  2DTZ A;  2DJI A;  4A3C J;  2P8T A;  5LRR A;  3CUQ C;  1P7J A;  4RLQ A;  2MG4 A;  4XNF A;  2BZT A;  4IPA A;  5LGT A;  3DCF A;  4D7M A;  2VT2 A;  1W36 D;  2OCE A;  3FXJ A;  4QSH A;  4EMS A;  5L3G A;  1S7E A;  4W1U A;  3K4L A;  4HG2 A;  2V6C A;  2QSF X;  1UST A;  2VAS A;  3DP7 A;  4LFU A;  1BC8 C;  3TOA A;  2JVG A;  1F9N A;  2JA6 J;  2GAU A;  3DU5 A;  3F6V A;  1VQ7 I;  4M71 A;  2Z3Y A;  1HKS A;  4EGZ A;  1V5G A;  4NHJ A;  1TQM A;  3KX2 A;  5GAH J;  3L2C A;  1B72 A;  2PBI A;  3I71 A;  4ZZD A;  4BE1 A;  3F21 A;  1MMG A;  3K1M A;  1R1V A;  3CF2 A;  2TCT A;  4RMN A;  1YJW I;  3J81 Z;  4BBS J;  3N4M A;  3ZN0 A;  1YQA A;  4MHG A;  2WAF A;  5J1U A;  4E6K G;  1R7J A;  3M9A A;  4E7Z A;  1XPX A;  3PJR A;  3OMY A;  3G73 A;  1IRZ A;  2KIF A;  3PIO F;  2M7A A;  3MKY B;  2VPL A;  2DAO A;  3PUF A;  2LY1 A;  2W85 A;  2W82 A;  2LKS A;  1VQ4 I;  3WTW C;  3HSR A;  1OPC A;  1RRJ A;  5GTI C;  1G3S A;  5KHD A;  4XM3 A;  1QVT A;  4DYQ A;  2EIJ H;  3ERM A;  5E18 F;  1K78 B;  2VQL A;  3BTC A;  2WY8 Q;  3CME I;  2BXY A;  2AQF A;  2DPU A;  1FBU A;  2MC3 A;  1W7P D;  3CDH A;  3BZ6 A;  4CUG A;  4G7H F;  4OAY A;  4HX8 A;  5FLM J;  2DQR A;  1S7O A;  2CS3 A;  1PVE A;  1MMD A;  1BR1 A;  2DPD A;  5F27 A;  2L7K A;  4B44 A;  3KP2 A;  3GVA A;  4E4H A;  2KZV A;  2AS5 F;  3TMO A;  2VE8 A;  4EJW A;  1Y8R B;  3BG3 A;  2CW7 A;  3HC7 A;  3K4K A;  2FQ4 A;  1ZQ3 P;  3S15 J;  4LJZ F;  2ME6 A;  4EJT A;  2XAJ A;  3LSH A;  3H1C A;  3IP4 B;  1ULY A;  3L2W A;  3L9F A;  3V7R A;  1ZLK A;  4P5O A;  3SJM A;  1Z6T A;  3OYJ A;  2MGQ A;  3ZMT A;  2EK5 A;  3VYS B;  3LSJ A;  5AIP A;  3KP5 A;  3PFI A;  5CVV A;  1MJA A;  1XCV A;  5ICF A;  1EKE A;  4ZZL A;  3TOB A;  2FA5 A;  1E17 A;  5E3N A;  3A03 A;  1P92 A;  1V55 H;  2DK5 A;  2KIM A;  3FK7 A;  2WAQ A;  3TDZ C;  3FKI J;  5DUI A;  1UMQ A;  2EV6 A;  3GYH X;  1B72 B;  2MBF A;  3ESW B;  3ZRG A;  4KYW A;  2ZNZ A;  5IT9 K;  1A6Q A;  4MFE A;  5E1Z B;  3BR6 A;  1JJ8 C;  1BJA A;  3CC4 I;  1OCC H;  1Q1H A;  4A5N A;  1NHA A;  2R4G A;  1U6G A;  1MJB A;  3FMS A;  5JVT A;  3FKJ A;  3DTK A;  5HOO A;  1AU7 A;  5IYD J;  4GCV A;  2GA2 A;  1QO0 D;  2ELK A;  4N9I A;  1FX7 A;  5M5Y J;  4K2E A;  1VI0 A;  1P9Q C;  3BTL A;  3RKQ A;  2DMN A;  1S3J A;  3OIO A;  1EH7 A;  5D8K B;  2Y69 H;  3MQ0 A;  2JT1 A;  2DT6 A;  4JP0 A;  1ETQ A;  5L3F A;  5D5U B;  3H5A A;  2LKX A;  4PJJ A;  2NVY J;  2LSO A;  2E2H J;  1LEB A;  1GUU A;  2O3F A;  1MSF C;  1WWX A;  2M4K A;  2R93 J;  4XMY A;  2EFO A;  2G0E A;  2E2J J;  3WHB A;  3VPR A;  1TNS A;  2A6T A;  1LDD A;  2EZK A;  2Z5U A;  3PM1 A;  3BT9 A;  4OIO F;  5FFX A;  4CCM A;  1MDM A;  4C30 A;  2O8X A;  2QCO A;  3HHH A;  4MGR A;  2QQ9 A;  3I53 A;  1KU9 A;  4BAY A;  1MBF A;  2KRF A;  1XC5 A;  1A5J A;  4B4C A;  3BZK A;  1QQI A;  4G12 A;  1T33 A;  4PSX A;  3OYN A;  2PMU A;  2IGO A;  3LAP A;  1SVL A;  2VUM J;  1MJ9 A;  2DLL A;  2TRT A;  3LST A;  1X2N A;  2ZKZ A;  3JCU C;  5DS9 A;  2MSY A;  4OOI A;  4EV0 A;  1ZR2 A;  1IXS B;  2ELH A;  3OS2 A;  5FJ8 J;  3S1R J;  2ZME A;  5K7H A;  1YFH A;  3LSR A;  1NK3 P;  5ILV A;  2DXI A;  5EEA A;  2E35 A;  2ZXH A;  4DZJ A;  3BC8 A;  3BG6 A;  2JUC A;  4I7H A;  1OYW A;  2EFN A;  2EZH A;  2YU9 J;  5A2Q Z;  3DTE A;  4YIF A;  2EBI A;  2VXD A;  4RGS A;  3Q5F A;  2XB0 X;  2PLY A;  2F5E A;  5M3F J;  1YYV A;  3V4G A;  4ENJ A;  4MTE A;  2P7C B;  1SD7 A;  2FMY A;  4HV5 A;  2LYC A;  2NS0 A;  4AU7 A;  2VKH A;  1B9N A;  1N25 A;  3NWS A;  3QYE A;  3CCR I;  2W4S A;  5L3B A;  2LD5 A;  5F04 A;  1VQO I;  3CDI A;  2ADU A;  5CVR A;  4J19 A;  3BR5 A;  2O6G E;  3CES A;  4WWC A;  2F5V A;  3QYF A;  3E6B A;  1D1B A;  2CO5 A;  2RV8 A;  2NVU B;  1FLI A;  2A3S A;  1TTY A;  3QQA A;  4A93 J;  1R5I D;  3BP8 A;  3OYA A;  3CUQ B;  2QA4 I;  4MEX F;  1A35 A;  5JHF A;  1HQC A;  4DBQ A;  1MNE A;  2XGC A;  2IJL A;  3Q9S A;  4M3G A;  3VYU B;  3DQV C;  2IS2 A;  1B8I A;  5BNG A;  3G2B A;  3TW6 A;  1T6S A;  4KN4 X;  2W24 A;  4M6X A;  4R8H A;  2PJR B;  4KN7 X;  2ISY A;  2JPB A;  3GTG J;  3WGG A;  5K1Y A;  2XSD C;  1LEA A;  2GOX B;  2IS4 A;  4L9V A;  4RBO A;  1RZ4 A;  3HXL A;  4AIK A;  4QWQ A;  5L3C A;  3Q0U A;  1F43 A;  2A6E F;  1R5H A;  3MWM A;  3J7Y J;  4A3G J;  2LNB A;  5HLT A;  5EG0 A;  2HWV A;  4I98 B;  1IG7 A;  4IKF A;  4CA0 A;  1ZAR A;  1D5Y A;  3S1N J;  1UG2 A;  4NNJ A;  2K9S A;  1SMY F;  4IOA F;  2IP2 A;  4BDY A;  4D0P A;  1BOB A;  1BR4 A;  2XAU A;  3FX3 A;  5FRN A;  1VQ6 I;  2I10 A;  4EAT A;  4ZYH A;  2L9V A;  5F1R A;  3L2Q A;  1IZ1 A;  1JHH A;  2MH9 A;  2IGN A;  1K4S A;  4RGR A;  5KAF C;  4I6Z A;  4XOP A;  3FXQ A;  2DMP A;  2H6C A;  4O3M A;  3H9Q A;  3DEE A;  4G8X A;  4LG0 A;  3VYT B;  2XF7 A;  2Z1D A;  3UKG A;  1JT0 A;  3AG1 H;  4M3E A;  3E5X A;  1WJ5 A;  1W7P A;  2W57 A;  2FU4 A;  1HXD A;  2L4M A;  2EA2 A;  3MMY B;  1X19 A;  2KHM A;  2O0Y A;  2KIU A;  3CC7 I;  1OKR A;  4U88 A;  1IDZ A;  3IH3 A;  3JSP A;  3HOT A;  1XMK A;  2UV1 A;  2HOA A;  3HOZ J;  5E3M A;  3SQN A;  2PI0 A;  1QGP A;  3K1P A;  3U1K A;  4RDU A;  2XKO A;  4HF0 A;  4IX7 A;  4S04 A;  1I1G A;  5C3E J;  2ZXW H;  3LSI A;  1BN5 A;  1YIT I;  1I6H J;  2K85 A;  1MBE A;  4U0Y A;  2XB5 A;  2VKE A;  2R3S A;  3S1M J;  3S17 J;  1G3T A;  2E34 A;  1PP8 F;  5CVI A;  5DCF A;  4ZH4 F;  3F23 A;  2VT3 A;  4IRG A;  2XHK A;  1G59 A;  2JVH A;  2LK2 A;  3ECH A;  4ESB A;  2VL8 A;  1T8I A;  4BDZ A;  1B8I B;  4IRI A;  3HSF A;  4OMZ A;  3TP0 A;  3TP3 A;  3BZC A;  1IUF A;  1APL C;  4LMY A;  3LL7 A;  4HYE A;  1A31 A;  3BY6 A;  2XGD A;  3CCL I;  3MFK A;  2JQ7 A;  2LFB A;  1KQ8 A;  2DMT A;  2W84 A;  1P2F A;  5F1J A;  1V5E A;  2WY7 Q;  4P55 A;  3FXM A;  1ZGW A;  3KP3 A;  4Z6Y A;  2WB1 N;  3H5R A;  2VN2 A;  2NXN B;  4F7Z A;  5LEK A;  4LB5 A;  4EJV A;  3CMA I;  5EG0 B;  1IDY A;  4H4K C;  1JI8 A;  2OCC H;  2XRN A;  2O8K A;  2K3P A;  4F3Q A;  2CMP A;  4CH7 A;  2NNY A;  4A3L J;  1JKP C;  2CGP A;  2MD0 A;  1U5T C;  4B43 A;  2F48 A;  4FCY A;  5HS7 A;  3I4N J;  1DDN A;  2CV0 A;  2L01 A;  5GAE J;  3DV8 A;  4BEH B;  2MFZ A;  1Y0U A;  2ZJP F;  3BR0 A;  3FIS A;  3B6A A;  2LVS A;  2CQN A;  5EZG A;  3RQI A;  4HX4 A;  2L5Q A;  4BKX A;  3BJ6 A;  2OBP A;  4G9Y A;  5DV5 A;  1ZRD A;  1ETV A;  4LG0 B;  3C7J A;  3E0J B;  3ZGK A;  1KYW A;  1YG2 A;  3IHU A;  3LAJ A;  4UV9 A;  3HM5 A;  2JK3 A;  3KYL A;  3IWZ A;  3BG9 A;  3SEZ A;  1MW7 A;  4GO1 A;  4IHS A;  3CJR B;  2L0K A;  1TL8 A;  2KPM A;  2STW A;  2OTJ I;  1RNL A;  4CZC A;  3PQJ A;  3L1P A;  3ZQC A;  4GGG A;  1H9T A;  3ZQI A;  3G1M A;  4RGU A;  2RNG A;  2LRE A;  5DTD A;  4JX4 A;  3DKX A;  2CWE A;  3OL3 A;  5AON A;  2M4G A;  3K9T A;  5CVJ A;  3OL4 A;  2FUG 2;  5FD5 A;  3C1D A;  2M8G X;  4A6E A;  1FSH A;  4NC6 A;  3ROU A;  2HGC A;  4IXA A;  3FXL A;  3DBL B;  4C3I J;  2YR2 A;  4RAY A;  1FTT A;  2ETH A;  3QPS A;  4AYB N;  5IP9 J;  3JRA A;  5DCM A;  1U9N A;  2A69 F;  2LY2 A;  4CYC B;  4BAC A;  5HDN A;  3B02 A;  2JJ7 A;  3CQZ J;  2YUS A;  1FIA A;  1AA7 A;  3MZ8 A;  1X1P A;  2DO7 A;  3TED A;  3WG9 A;  3QU3 A;  3NRV A;  1YW9 A;  1WJA A;  3QPT A;  3M4O J;  2DJN A;  5LHI A;  1WJF A;  2VKD A;  2M0C A;  2V4J C;  3Q3S A;  3VFZ A;  2HYJ A;  5J4V A;  1ONV A;  3WOD F;  4XLN F;  5HS9 A;  1XS9 A;  5HDK A;  3S3N A;  3H35 A;  2DOD A;  1X3U A;  1GLN A;  3GFI A;  3BTI A;  1I1S A;  3H0D A;  2RAE A;  2FBI A;  2KZG A;  2WTE A;  4II2 A;  1YIJ I;  1XG1 A;  4OWR B;  4UVA A;  3IUO A;  2EA4 A;  1FT9 A;  1WSU A;  2CUZ A;  3EUH A;  4Y15 A;  3WGH A;  1C0W A;  4PZJ A;  2DQL A;  4UXN A;  1TW3 A;  1IW7 F;  2R7O A;  2GLO A;  1F1Z A;  1RC9 A;  4ZDL A;  3MVP A;  5FO5 A;  4CCO A;  1BIA A;  5LLQ A;  3MEX A;  1O3S A;  1P4X A;  2LG4 A;  4Y13 A;  2K27 A;  2X51 A;  3K4M A;  5CQE A;  4HST A;  2E60 A;  3HYI A;  5D8L B;  1J9I A;  1RPW A;  4F93 B;  2DK8 A;  3I59 A;  4OAZ A;  3N97 A;  2GXA A;  4YIR X;  4CCN A;  3K4C A;  5J3L A;  5BQT A;  3DFG A;  3M1C A;  3CCU I;  1YI2 I;  1FYL A;  4UY8 I;  1KGS A;  2VOP A;  3NAR A;  1SAU A;  3F8M A;  3UNG C;  2X6O A;  2R0Q C;  1OJL A;  3RKW A;  4IZZ A;  4JBA A;  3JRB A;  2O61 A;  4BQN A;  3T8T A;  2WV1 A;  2DT5 A;  5EEG A;  2BHZ A;  2V9V A;  3Q9V A;  2PMH A;  2FEZ A;  4L5J A;  2GA1 A;  3REO A;  3JW4 A;  3CCS I;  4RS8 A;  1RIO H;  1IXR C;  2CYY A;  3KFW X;  3OY9 A;  2NRA C;  3CCV I;  3DBR B;  5GTH C;  3OYC A;  4PJL A;  1HKQ A;  2EIN H;  2CU7 A;  4HF2 A;  2A68 F;  3VSK A;  1HBX G;  2K7L A;  3ZQQ A;  2H1L A;  4BH9 A;  1FYK A;  3EUK L;  2OV7 A;  2RKH A;  3HRT A;  1OLT A;  2XAH A;  4V2F A;  3OYL A;  5ILS A;  1GXP A;  2M8E A;  4AYB A;  2RVC A;  4N9H A;  3VOD A;  3GUD A;  2IW5 A;  2QQ8 A;  4ZDO A;  2H09 A;  2FQ3 A;  2KL4 A;  1PYV A;  5DCM B;  1SFK A;  2VKV A;  1IRG A;  3S3M A;  4PCQ A;  3DTI A;  1DPU A;  4YEL A;  1ZG3 A;  3FHN A;  4EM1 A;  3HZJ A;  4RAF A;  2JA2 A;  3FHZ A;  1RET A;  1U3E M;  1YIO A;  4KMU X;  4DIQ A;  1NH3 A;  1YE9 A;  2E1M B;  2HVS A;  1V4R A;  4Y33 A;  4LIT A;  1TLH B;  3HJE A;  1D0Y A;  3PFY A;  2EPF A;  2VQC A;  1I27 A;  2PEX A;  1X1C A;  5K5R A;  4XLF A;  2L9N A;  3W2V A;  1OR7 A;  4I0A A;  3NEU A;  1ORK A;  1WRJ A;  2KT0 A;  2R5Y A;  3DF8 A;  3OIQ A;  5AIQ A;  1O57 A;  1QZY A;  5EDN A;  4F92 B;  1MBH A;  3IWF A;  3NAU A;  1T0F A;  2LDU A;  2L4A A;  2XF6 A;  4LB6 B;  3RKX A;  1NG7 A;  2EV0 A;  1LVA A;  4FHT A;  2HDD A;  1B59 A;  2H1K A;  1T38 A;  2LF8 A;  1J0R A;  4CDG A;  4KIS A;  3LQR A;  4Y4R A;  4EM0 B;  1S9H A;  3W6J B;  3KLO A;  4IQJ A;  9ANT A;  3I54 A;  3GCM A;  4B09 A;  2CQ7 A;  2JWT A;  2K9N A;  1VQM I;  3DPL C;  3I59 B;  3QPL A;  3MN2 A;  3U1D A;  3EYI A;  4ZYD A;  2M2E A;  3KP4 A;  5CQG A;  4RB3 C;  3BQZ A;  1ETW A;  4AIH A;  2QBY A;  2CUJ A;  4MIM A;  2E1O A;  2HZT A;  2XC7 A;  1I3Q J;  1WI9 A;  4M9S A;  3HDD A;  5B1A H;  2XRO A;  4CHU A;  4PJN A;  1ZYR F;  1Z21 A;  1HA8 A;  2RQP A;  3I9V 2;  2WAQ N;  1YOV B;  1XCB A;  3JAM K;  2LMD A;  2PN6 A;  2VQH A;  2HEO A;  3PUB A;  1ZTR A;  5B3S H;  3J80 Z;  4I2O A;  2VON A;  3SDG A;  5JR3 A;  5F08 A;  3K0L A;  1NG6 A;  3HOU J;  1YHQ I;  5BPD A;  3VDX A;  4L0Y B;  1UB9 A;  2B9S A;  3GTJ J;  1FTZ A;  3WTU C;  1HSJ A;  1HKT A;  1WQ2 A;  1U5T B;  1YJN I;  3OS1 A;  2HVQ A;  4A3F J;  2JN6 A;  4KIF A;  4LIV A;  1T08 B;  4GYI A;  2R7X A;  4NC8 A;  5IT9 Z;  1F36 A;  2ZBK A;  2GQQ A;  3N05 A;  2DOF A;  4OIP F;  2R7D A;  4CGZ A;  5ICG A;  3KZI C;  2D1V A;  1YS7 A;  4OIQ F;  2ZME C;  3FXU A;  2EB7 A;  2O03 A;  3IKV A;  4Q47 A;  5F0C A;  1DQU A;  4B48 A;  3S32 A;  2R5Y B;  3TQN A;  3I56 I;  2KRH A;  2ELJ A;  2XAF A;  4BHP A;  1FBS A;  2QQA A;  4N4N B;  1JUS A;  3HOS A;  3D5L A;  2K4B A;  3I64 A;  3F3X A;  1XMX A;  1X1D A;  1IF1 A;  4HDV A;  2CJJ A;  4F52 A;  4RB1 A;  2Y9Y A;  3A2K A;  2GWR A;  4MNU A;  3ZXS A;  3VB2 A;  2QSH X;  1P6R A;  1SAX A;  4IL6 C;  1FPQ A;  1ZLJ A;  1EJ9 A;  2K86 A;  2ZFU A;  4HNV A;  2HYF A;  1RES A;  5B66 C;  4E7H A;  2K40 A;  3T8R A;  4I01 A;  2L3D A;  3L00 A;  3WTT C;  1D8K A;  1BL0 A;  3FF5 A;  4BYY A;  2QBY B;  1FIP A;  2JZY A;  3R0A A;  3PNT A;  2IS1 A;  2DMU A;  2HI3 A;  4AUX A;  3L2U A;  3O6B B;  3JSO A;  4UV8 A;  4YFN F;  2R5Z A;  2DFI A;  5E3O A;  2FML A;  1BJZ A;  2XDV A;  2EFQ A;  1AWC A;  4M3F A;  2LLK A;  3CLO A;  1Z3Y A;  1WFX A;  1X2M A;  4JOM A;  3GF2 A;  3ULQ B;  4YEJ A;  3CTA A;  3UR3 C;  1S5L C;  3D5R C;  2HXO A;  3KLN A;  5TGT A;  1SFO J;  2FBK A;  3CD6 I;  4P9U A;  2JRT A;  5ERI A;  3RYR A;  1NK2 P;  4FE4 A;  4QTR A;  4EEF G;  3OYI A;  1ETY A;  3ZR8 X;  1UHS A;  3CCJ I;  1WGX A;  3T5X A;  4L9J A;  1LKX A;  4AIJ A;  4U7D A;  4A3I J;  3I5U A;  3CCY A;  3WTY C;  2QGU A;  2EFP A;  1TT5 B;  2ECC A;  3W6K B;  1Y8Q B;  2Z99 A;  4S05 A;  5D5W B;  3CUQ A;  2XAG A;  1Y1V J;  4X6A J;  4HQM A;  1D1C A;  1KON A;  2CV2 A;  2A61 A;  3D0S A;  2ICW G;  3CUO A;  4LK0 F;  4BE2 A;  3A1Y A;  5J1Y A;  2V7F A;  4ZYA A;  4UUS A;  3O3K A;  1PJR A;  1P4A A;  2COM A;  1JTY A;  2DOA A;  2VOD A;  2V26 A;  1FWZ A;  3ASO H;  1SVM A;  3I58 A;  3DPU A;  1XMA A;  5HOD A;  3JTG A;  1OMI A;  2P5L C;  1K6O A;  3ABT A;  3AG3 H;  1J5Y A;  1MKM A;  5JFR A;  3OS0 A;  2PJR A;  3ISP A;  4P96 A;  1USS A;  1K61 A;  4A3E J;  4DBR A;  1FJL A;  2VXZ A;  1L3L A;  5IP6 A;  1I6X A;  4I76 A;  1ACI A;  1Z7L A;  4NQW A;  4RB2 C;  1U2W A;  4KA4 A;  2AHQ A;  2UWM A;  1JE8 A;  2HTS A;  4GRI A;  4XN0 A;  3OIP A;  1FSE A;  1T2K A;  1E0E A;  5IYC J;  3ZMD A;  4B47 A;  3L7W A;  3W3C A;  5FFZ A;  2E1N A;  2WAD A;  5KAI C;  5D4S A;  4GDF A;  2X0L A;  3MZY A;  4UHT A;  4ASN A;  2DU9 A;  4BQQ A;  1REP C;  3GEZ A;  4LLL A;  3LFK A;  4BUP A;  4CCK A;  3CO7 C;  4D7N A;  1WJE A;  2DCE A;  1B9M A;  2NS7 A;  1U8B A;  3RPQ A;  1UZC A;  1Y39 A;  1PUE E;  2BEO A;  5HNH A;  5B1B H;  2V1D A;  4LK1 F;  4MTD A;  2QQB A;  4BNC A;  3BR1 A;  3COA C;  3CF5 F;  1MD0 A;  3OWT A;  2R7T A;  1LFU P;  4JX5 A;  5D6E A;  2R5Z B;  1MBJ A;  1QPM A;  2OQR A;  3FK6 A;  4B8X A;  4A3B J;  2ZCW A;  2X6Y A;  2WA0 A;  1KU7 A;  1STZ A;  2ZB9 A;  3CCM I;  5GPC A;  3RDI A;  2CW8 A;  1UHM A;  3SEQ A;  5FKL A;  4E7K A;  1MND A;  3I0T A;  4R1H A;  2R7Z J;  4L9T A;  1FP2 A;  3V7S A;  4ESJ A;  5B5E C;  3GLL A;  4LOC A;  3BOQ A;  2DYR H;  5J6X A;  2KKO A;  2V79 A;  1VZ0 A;  5JLX A;  3E3V A;  2KJC A;  3ZQH A;  2OU2 A;  3QWL A;  2WV0 A;  4S0H B;  5M5X J;  4D9J A;  2BY1 A;  1VF9 A;  5DDG A;  3HPH A;  4WX9 A;  3L2R A;  1I5Z A;  1ZRF A;  1KQ0 A;  5ICC A;  1BW6 A;  3HEF A;  4XL9 A;  3K4B A;  4UUS B;  3ABU A;  1JKO C;  2M9H A;  3GFM A;  2VC1 A;  5LHH A;  5TRD A;  1E2X A;  2Y30 A;  2W00 A;  3H9G A;  5JHU A;  3C18 A;  1W0T A;  1HW1 A;  5E20 A;  3HPG A;  2M87 A;  3U2R A;  3H3Z A;  2CW0 F;  1O7F A;  4ON0 A;  2PG4 A;  1VQ9 I;  4E70 A;  2L2O A;  3KEQ A;  4RM3 A;  3PO2 J;  2E36 A;  1YTY A;  1OIS A;  3C2H A;  1U0J A;  1FEX A;  4NQW B;  1R22 A;  4DW6 A;  4HNU A;  5CVU A;  2CG4 A;  3GWZ A;  4ZC3 A;  4WK8 F;  4XN3 A;  1VND A;  2P7V B;  4DOZ A;  2HPM A;  4MEY F;  3ZMZ A;  3AKZ A;  4XLH A;  1R4M B;  4J01 A;  2KMU A;  2YPR A;  4WCG A;  1H0M A;  3DLA A;  2VBZ A;  3BDD A;  3K4J A;  3KYC B;  4IHT A;  2DMQ A;  4EM2 A;  5HVQ C;  5F6F A;  1JGG A;  1S7A A;  1ITY A;  2FBH A;  4BEH A;  4PFO A;  3WTX C;  3LWF A;  1DGR M;  1WH5 A;  4IEJ A;  4C2M J;  2JA5 J;  5FKN A;  4L5E A;  5A2Q K;  1X3Z B;  2DA4 A;  3FM3 A;  4ENN A;  1HDD C;  2ESH A;  2BOL A;  2I8D A;  2Y75 A;  3P5J A;  1X1B A;  1SC7 A;  3CZ6 A;  1HF0 A;  1QNT A;  3ZMS A;  2X1C A;  5HLH A;  4DQ2 A;  2MLK A;  2DFF A;  1BBY A;  3GLX A;  1SAN A;  3AL0 C;  4IOC F;  4XOT A;  4GFB A;  2VJI A;  3KPH A;  1BI3 A;  3G3Z A;  4KT6 A;  2UUZ A;  4FT8 A;  2GIZ A;  2RQQ A;  3JRC A;  1G8X A;  2XGE A;  3VSL A;  1B6A A;  4KMF A;  1W0U A;  3ZOB A;  2YS9 A;  2JSC A;  5GAG J;  5DYM A;  1GVJ A;  3ABM H;  2CRG A;  5LGU A;  2HYG D;  3S2H J;  3R4K A;  1IRF A;  1LDK B;  1BOA A;  2MYS A;  4IVN A;  3C3W A;  1WH7 A;  1O7L A;  2YU3 A;  3OYB A;  2X4H A;  1TBX A;  2A6H F;  2UXN A;  2FOK A;  3QYB A;  4CYC A;  1VQL I;  2LRD A;  5K5Q A;  2FXA A;  2VJ4 A;  4NB5 A;  2JA8 J;  4RLF A;  5EGO B;  3BJA A;  4HAM A;  2VPR A;  5LRS A;  3H9J A;  4X0G A;  2PQ8 A;  2KDZ A;  4A5M A;  1TT0 A;  4OIR F;  4XSZ F;  2OUM A;  1OQY A;  3G1O A;  3K70 C;  4MFD A;  3C2B A;  3G1L A;  5EZH A;  3W2A A;  4RA2 A;  4ETS A;  4LGW A;  1HLV A;  2XSJ C;  1JKQ C;  1SFU A;  1R23 A;  3TO6 A;  1MBG A;  5EF6 A;  3OYD A;  4XK4 A;  4FET A;  3OYG A;  3F6O A;  4XLA A;  2R7U A;  1XN7 A;  2J5O A;  3RI4 A;  1F5T A;  2HQN A;  5ILU A;  3QOD A;  3RPU A;  3NWT A;  1TQI A;  4HNT A;  3HRS A;  5D6F A;  4M3D A;  4EQQ A;  1P7I A;  3BTJ A;  1HOM A;  2DA5 A;  1WVR A;  2GZW A;  1TWA J;  4IJA A;  3QP6 A;  2DI3 A;  4PJM A;  5HLI A;  3OYF A;  4YG2 F;  2NVT J;  2FJ1 A;  3H92 A;  5H2F C;  4Q5S F;  2UXX A;  1QHG A;  2V6E A;  3K2Z A;  2VBX A;  4N4O B;  1G4D A;  1G6N A;  1W5S A;  2LR8 A;  1ZEL A;  3ZQ7 A;  3S2D J;  1IRX A;  1BI2 A;  3DEW A;  3LQQ A;  4HEA 2;  4WXC A;  3HOW J;  4PK4 A;  1LDJ A;  2IGK A;  2Z9O A;  5J47 A;  2YSR A;  4ESF A;  4KIC A;  4UVB A;  2C6Y A;  1BIB A;  1IO2 A;  3QPH A;  2HOE A;  3S14 J;  3H3U A;  3S93 A;  4E7S A;  2YX7 A;  2GOM A;  1K79 A;  4NDL A;  5TIS C;  1ODD A;  5GPA A;  4UUT A;  1YW7 A;  4DYC A;  2PX9 A;  1R6R A;  2KRC A;  5IPA A;  2BYV E;  1Z91 A;  4HA8 A;  3JRH A;  2QKL B;  4BY1 J;  1IJW C;  2GXB A;  3WTV C;  2OD5 A;  5BPI A;  1LPQ A;  3S1Q J;  2K9M A;  3HSE A;  2EZI A;  3ZQF A;  4ZTJ A;  1FOK A;  5H6Q A;  2IS6 A;  3LSP A;  1O4X A;  3QRF F;  1SD4 A;  3GTP J;  4OU0 A;  4HDU A;  4KJZ A;  1OR7 C;  2VIX A;  5CLS A;  1CQT A;  2P5V A;  2ISZ A;  2DW4 A;  4KUM A;  3MKL A;  4HV6 A;  2ZSH B;  2QVO A;  3E7L A;  3E6D A;  3AG4 H;  2FRH A;  2EJR A;  1HDP A;  2IGM A;  1OYY A;  2GIV A;  3Q0W A;  5CKT A;  5K7Z A;  3LMM A;  1T0F C;  2GBY A;  1TWC J;  2Y48 A;  2PFB A;  3HUG A;  3QAH A;  2B63 J;  4UUV A;  4D5F A;  4B3A A;  3BCB A;  2X48 A;  4FX4 A;  5KVR A;  4F91 B;  2BVL A;  3G6E I;  4HLX A;  2JMW A;  3LFU A;  3IRR A;  2X9D A;  2Y31 A;  4N0B A;  3AG2 H;  4NC7 A;  2Q0O A;  3PQK A;  3JRI A;  3BG5 A;  4HW0 A;  3CDL A;  5CYV A;  4XON A;  3FXK A;  4H0E A;  1Q1V A;  1WPK A;  3MD2 A;  4I09 A;  1DUX C;  1IN4 A;  3A01 A;  3PO3 J;  2IAI A;  1OCR H;  4NBQ A;  1D8J A;  5DD8 A;  4FE7 A;  3TGN A;  2P0W A;  5F64 A;  4C9Y A;  4WXD A;  2WAE A;  5ED4 A;  1Y0N A;  1BI0 A;  2ZSI B;  2A5W A;  2R7Q A;  4LIU A;  2F4O B;  2LBF A;  3WGI A;  5E79 C;  4HZF A;  2E1C A;  2I5U A;  1SEU A;  1FNN A;  5FKO A;  2HQA A;  3L2V A;  3JRE A;  2XUB A;  4IRH A;  3DXJ F;  2EIL H;  3HIF A;  4B3X A;  2VQG A;  3E1S A;  2M34 A;  3V8L A;  2DT7 B;  4II3 A;  4GXO A;  4FAS D;  1XGM A;  4ENK A;  1VQ5 I;  2ZFW A;  4CO8 A;  3I4P A;  4GYG A;  4D5C A;  3GO5 A;  2OZU A;  4D1Q A;  3M3Y J;  4XKB A;  2BXZ A;  5DM6 F;  3E5U A;  1F4K A;  5K5O A;  4E7L A;  1R49 A;  5HS8 A;  5IOY A;  3PNY A;  4UNO A;  2M1B A;  2KJB A;  2KLO A;  4W97 A;  1OCZ H;  1RR8 C;  1BR2 A;  1V5F A;  1GDT A;  4KIG A;  3HTU A;  2MLG A;  2BGC A;  1XB4 A;  1S29 A;  1TWF J;  5E3L A;  3KCC A;  2NVQ J;  2R7V A;  4ENM A;  4FIS A;  3U9G A;  1GT0 C;  3PNV A;  1DP7 P;  2HS5 A;  2BY2 A;  1U5T A;  1SD6 A;  3E97 A;  1YLF A;  3O2P E;  1W5T A;  3F8N A;  3DKY A;  2BV6 A;  2HR3 A;  3HL2 A;  3JAM Z;  1LJ9 A;  1P4W A;  1GVD A;  2HKO A;  4MQ9 F;  3V8K A;  4UVC A;  2RN7 A;  3SFI A;  2A07 F;  3HUG B;  4XOR A;  3F9K A;  2NS8 A;  5H6R A;  1XGO A;  2X85 A;  2H27 A;  5D5V B;  3RIR A;  3ECO A;  2IA2 A;  1E3O C;  2EQR A;  2P6S A;  2B7E A;  4BY7 J;  4BJT A;  1BI1 A;  4CYD A;  2K4J A;  4XKC A;  3BPX A;  5KCM A;  5KNL A;  3A01 B;  2XAS A;  2X1E A;  3A0H C;  3ZMU A;  5E1X A;  4PGG A;  1VQK I;  3HGG A;  1FMW A;  4JK1 X;  2IBD A;  2V1U A;  4KNY A;  2GXG A;  3MCZ A;  2X6X A;  4AID A;  1GV5 A;  3LOC A;  2Q8K A;  2LBF B;  3T1B A;  1NTC A;  3BWG A;  3P9K A;  1OCT C;  3B73 A;  5HDG A;  1TW2 A;  3OR1 C;  5LD2 C;  3OYK A;  1WJC A;  2MC4 A;  3HKZ N;  1R58 A;  2D45 A;  1HW5 A;  1ZG5 A;  2R7W A;  3SHF A;  4BQO A;  2WBM A;  1KQ9 A;  1L0O C;  3LA3 A;  5DD4 A;  2RC4 A;  4XQF A;  3G71 I;  1ZGJ A;  2XKP A;  3ASN H;  3KEO A;  3FBN B;  1K7A A;  4C2T A;  2NYX A;  3GZN B;  5K7F A;  3CP8 A;  1TC3 C;  4V19 K;  3ZPL A;  1UHW A;  1TWG J;  2QLZ A;  1R9T J;  4BQA A;  3ML6 A;  2LOO A;  2RGV A;  1RI7 A;  2M0M A;  3M8E A;  3TKY A;  3SZG A;  1RKT A;  4PJ0 C;  1VQ8 I;  1Z6R A;  4EJU A;  4U87 A;  1X58 A;  1QRY A;  5IP7 J;  2D5V A;  4Z2Y A;  4IHW A;  3K69 A;  4ZYE A;  4YRV A;  2EIK H;  2L7Z A;  2VBW A;  2OAZ A;  3PSI A;  4XR6 A;  4AVP A;  1DU6 A;  2JSP A;  1Y6I A;  1O3T A;  2F5C A;  1B1B A;  1MH3 A;  5C44 J;  2P81 A;  2XPU A;  3HGY A;  3LSM A;  2F4I A;  2L02 A;  4HPQ A;  4LLN A;  5CJ9 A;  1V54 H;  2ZO4 A;  4I99 C;  4KIB A;  4XLE A;  4RB0 A;  3SFZ A;  3OOP A;  1MIJ A;  2EFW A;  1B4A A;  4L5I A;  2CH0 A;  2ZJR F;  3GZ5 A;  4XKW A;  4JQF A;  2IRF G;  2M7B A;  2E19 A;  5FLX K;  1YW8 A;  4HRI A;  1PUF A;  5JI6 A;  4U0V A;  1X3W B;  2DA6 A;  3MKZ A;  2LH9 A;  1R5G A;  4ABZ A;  4G7Z F;  1QZE A;  2EZL A;  2HTJ A;  1XDU A;  1J7K A;  3RZO J;  2OJE D;  4A12 A;  1ZHF A;  1X4P A;  1H88 C;  4M6Y A;  3JRD A;  2HOT A;  1ON2 A;  2K5C A;  2K9Q A;  2VB6 A;  3HB9 A;  1QPI A;  2P5K A;  2ZJ2 A;  1XX5 A;  2KP6 A;  3FWE A;  4M9X A;  3H36 A;  2R7S A;  5DM7 F;  4M73 A;  3IC7 A;  3WU0 A;  4QPQ A;  1FBQ A;  4IQ4 A;  5E8I A;  3GZ6 A;  5M5W J;  3HKZ A;  1TQP A;  2XPW A;  2O7O A;  4KIT B;  3GX4 X;  1IGN A;  1IV8 A;  3TDU C;  3V8J A;  2HU9 A;  4J00 A;  4CCL A;  2XV4 S;  2FX0 A;  1GXQ A;  2DFE A;  4I02 A;  2LKP A;  1XGS A;  2DA2 A;  5TJJ A;  2FNP A;  3RQ4 A;  4DGW B;  4BU2 A;  3S8P A;  4Y3O A;  3GME A;  3WE2 A;  1KA8 A;  4A69 C;  1W36 C;  1UCR A;  2JUG A;  3TO7 A;  1TNT A;  3BR3 A;  1TWH J;  2QUF A;  3EUA A;  1ZR4 A;  3RTR A;  2ACJ A;  2CV1 A;  4EJO A;  1T56 A;  3FIW A;  5HLG A;  4L9N A;  1UG0 A;  3I3L A;  2KFD A;  2FOW A;  4V2G A;  1TP4 A;  2L7M P;  3ABL H;  4NUB A;  4BXU A;  2HDC A;  2FSW A;  3J80 K;  1R36 A;  2GM4 A;  1XSD A;  1CF7 A;  2DDB A;  3JR9 A;  2HOS A;  1FP1 D;  4WF2 A;  5IYB J;  1J59 A;  3J81 K;  2MH2 A;  4C2U A;  4AC0 A;  3VWB A;  1K83 J;  1RKW A;  4HX7 A;  4O5V A;  5JVG F;  4FTH A;  3OOU A;  3RPU D;  5FLV A;  2JA7 J;  1FYM A;  4AM3 A;  2CUF A;  4BE0 A;  1LNW A;  1H9G A;  3JRF A;  1TZL A;  3L09 A;  1G3Y A;  3PL8 A;  3QOP A;  4BL0 B;  2QF7 A;  3WG7 H;  1BA5 A;  1XD7 A;  5H20 A;  3KP7 A;  3X2Q H;  4OIN F;  4DZP A;  1U78 A;  3AAF A;  3OYE A;  4WXH A;  1O3R A;  4CXF A;  1ERD A;  2L54 A;  3IAM 2;  3E6C C;  1PUF B;  1JXS A;  5F0F A;  2H94 A;  3DPT A;  3HRM A;  4IHV A;  3CO6 C;  1CGP A;  1Z1D A;  2E5N A;  2XVC A;  2NOJ B;  3DBH B;  1I50 J;  1MZB A;  3SXY A;  2LC2 A;  3V42 A;  1DP3 A;  1ZRE A;  2CQK A;  1U9O A;  4I0B A;  3KET A;  4M74 A;  3O8H A;  1RUO A;  2EWN A;  2KIS A;  1J09 A;  2COB A;  1QU3 A;  1ETO A;  5LBQ A;  2IVM A;  4RAG A;  5HNF A;  4E7J A;  3I55 I;  2HVR A;  1ZGA A;  2CQX A;  2E5Z A;  1FOX A;  4HQE A;  5GP9 A;  5C4X J;  5FRO A;  4DYR A;  2AXL A;  3BPV A;  4U0W A;  2AQE A;  3CCE I;  5FRM A;  1OCP A;  3ZMV A;  4U7B A;  3HTS B;  2ESN A;  1G2H A;  1OYI A;  1X4O A;  2G9W A;  3TO9 A;  2VE9 A;  2RNJ A;  2QYO A;  2HXI A;  1IN8 A;  5LFA A;  2H6B A;  1YRN A;  2BY3 A;  4A6D A;  3CJT B;  2ME0 A;  4EGY A;  2W7N A;  5FKM A;  3OV8 A;  5D4R A;  2PJP A;  4TV7 A;  3OR2 C;  2PMZ N;  2MD5 A;  3VOE A;  1R1U A;  1QZZ A;  4JX6 A;  1QHH D;  4BJ6 C;  4XRS G;  3TL4 X;  3WU1 B;  2M45 A;  1BC7 C;  3P7N A;  2DTR A;  5BOX A;  4L0Z B;  2M3A A;  2AXT C;  3R6S A;  4Y7N J;  3HG9 A;  2VC0 A;  1K4T A;  2DBB A;  5DEQ A;  3WU2 C;  3CMM A;  3FM5 A;  2ZJQ F;  1CF7 B;  3MKW B;  1ZAO A;  3F22 A;  2ZXI A;  3GTQ J;  3KYD B;  1T98 A;  5EEH A;  1X1A A;  3LSG A;  2MW8 A;  3IL2 A;  2BW3 A;  4M9Z A;  3H5N A;  2P6T A;  4B1R A;  3K4N A;  5IY5 H;  4HSR A;  1T95 A;  3B6C A;  2G7H A;  3ZCO A;  1I39 A;  3CCQ I;  4G6Q A;  1YJ9 I;  3ELK A;  5E17 F;  2BBY A;  1QBJ A;  1SFE A;  2IPQ X;  2HKX A;  2ZNY A;  3AFH A;  2Y0M A;  5EGO A;  3M07 A;  3BRO A;  3KZZ A;  4P9F A;  3GXO A;  1JGS A;  1W4M A;  5BS6 A;  3WHC A;  1M1E B;  5F0H A;  1D5V A;  4UB8 C;  1XSX A;  1IC8 A;  3ONQ A;  1EV7 A;  3CJQ B;  1U8R A;  3HOV J;  1YS6 A;  3HOX J;  2L9S A;  5CPR B;  3ERE D;  1ZKG A;  2IEK A;  3J7A O;  3K70 D;  2V1N A;  5FD6 A;  3RSN A;  1I3A A;  4M3B A;  2VJ5 A;  3RZD J;  1MMS A;  5D5X B;  1DU0 A;  3KEY A;  4R79 A;  2X1D A;  3F8B A;  3IH2 A;  4XBF A;  4CSW A;  3OSG A;  3D5S C;  5FKK A;  3A4C A;  3ZQG A;  4XLC A;  3MAJ A;  4RM2 A;  3E5Q A;  1WZ2 A;  4IO9 F;  3HBL A;  2DA7 A;  1MDM B;  1Z7U A;  4XSX F;  3OYM A;  3VYR B;  1Z3X A;  3R60 A;  2J5P A;  1Y56 A;  1D3Y A;  1WI3 A;  1YRN B;  3ZQL A;  1SFX A;  3CMY A;  2IT0 A;  3FZV A;  2LY9 A;  1N75 A;  2R92 J;  2P4W A;  2PMZ A;  3JTH A;  4KT5 C;  2QM3 A;  3FXO A;  3PSF A;  3R0J A;  1A04 A;  1VQN I;  2OC6 A;  4X1E A;  1KU2 A;  2EV5 A; 
#chains in the Genus database with same CATH homology
 3BCB A;  2DT6 A;  4BJ5 C;  4F91 B;  2BVL A;  5CQG A;  4PSW A;  3H5A A;  4BGD A;  3LFU A;  4PJJ A;  2CUJ A;  2XC7 A;  4NC7 A;  2M4K A;  4XMY A;  4XON A;  2K9L A;  4PJN A;  3MD2 A;  1Z21 A;  2A6T A;  1HA8 A;  3I9V 2;  2E1M C;  2BW3 B;  4CCM A;  2HZD A;  2VQH A;  4C30 A;  3RCO A;  3GBG A;  2P0W A;  4C9Y A;  2R7R A;  2WAE A;  4CCJ A;  3PUB A;  2ZSI B;  2A5W A;  2R7Q A;  4LIU A;  2LBF A;  1NG6 A;  1K6Y A;  4PSX A;  3OYN A;  3VDX A;  2HQA A;  3L2V A;  2IGO A;  3EUH C;  4B3X A;  2VQG A;  3OS1 A;  3E1S A;  2HVQ A;  2DT7 B;  4II3 A;  3OS2 A;  4LIV A;  4FAS D;  1FMV A;  2R7X A;  1EA3 A;  3IAS 2;  4NC8 A;  2DXI A;  2O5R A;  2X6W A;  3N05 A;  4D1Q A;  4XKB A;  2ZXH A;  3BC8 A;  3BG6 A;  4E7L A;  1MMN A;  3PNY A;  3DTE A;  2KLO A;  2VXD A;  2VJJ A;  1BR2 A;  1V5F A;  1N78 A;  1DQU A;  3OYH A;  4B48 A;  3M8J A;  3S32 A;  2LYC A;  1MMA A;  2VKH A;  4AU7 A;  2KRH A;  2ELJ A;  3NWS A;  3QYE A;  2Q1Z B;  4N4N B;  3HOS A;  4BXF A;  3D5L A;  2W4S A;  3J7A Y;  1DGW Y;  1X1D A;  2R7V A;  3QOE A;  2CFO A;  3PNV A;  4F52 A;  4ITV A;  3A2K A;  3ZXS A;  4ZDP A;  3CES A;  2F5V A;  2QKM B;  3QYF A;  1UEL B;  3DKY A;  1D0Z A;  3HL2 A;  1D1B A;  3SDB A;  2ZFU A;  3HUG B;  4E7H A;  3OYA A;  1WJD A;  4XOR A;  3F9K A;  5JHF A;  4DBQ A;  1MNE A;  2Z2S B;  2X85 A;  3PNT A;  2IS1 A;  4ZJZ A;  3VYU B;  3DQV C;  2IS2 A;  4BJT A;  3L2U A;  4P1W A;  3G2B A;  4XKC A;  5KCM A;  5KNL A;  2HNH A;  2X1E A;  2XDV A;  3C2G A;  2PJR B;  1Z3Y A;  1UAA A;  1FMW A;  2Q2E B;  2XF5 A;  1WFX A;  2GOX B;  4JOM A;  3K6G A;  4YEJ A;  2IS4 A;  3UR3 C;  3D5R C;  2X6X A;  5TGT A;  3HXL A;  2LBF B;  2IXS A;  4ZTF A;  3OYI A;  3ZR8 X;  3OR1 C;  5HLT A;  5LD2 C;  4IKF A;  3OYK A;  1WJC A;  1LKX A;  4CA0 A;  2MC4 A;  1D1A A;  4NNJ A;  2R7W A;  3LSK A;  4E7I A;  4BQO A;  2WBM A;  4BDY A;  1D1C A;  1KON A;  2CV2 A;  1BOB A;  4XQF A;  1BR4 A;  2XAU A;  5FRN A;  4MLO A;  4BE2 A;  3A1Y A;  4EAT A;  2V7F A;  4ZYA A;  4C2T A;  3FBN B;  1PJR A;  2DOA A;  3L2Q A;  2V26 A;  3CP8 A;  2IGN A;  4G6T B;  3DPU A;  4XOP A;  4LG3 A;  4PUS A;  1N77 A;  2LOO A;  3CP2 A;  2F6C A;  2M0M A;  3OS0 A;  2PJR A;  3SZG A;  3H9Q A;  3DEE A;  4DBR A;  3VYT B;  2XF7 A;  2Z1D A;  4U87 A;  2VXZ A;  3FDY A;  1Z7L A;  4YRV A;  2UWM A;  1WJ5 A;  3PSI A;  4XR6 A;  4GRI A;  4XN0 A;  3OIP A;  2JSP A;  3MMY B;  1Y6I A;  3U21 A;  1X19 A;  2KHM A;  1E0E A;  2WB1 A;  4B47 A;  3SYT A;  3BLY A;  3LSM A;  4HPQ A;  2F4I A;  3W3C A;  3HOT A;  2UV1 A;  2WAD A;  4XLE A;  2CH0 A;  4IX7 A;  4BQQ A;  4XKW A;  4JQF A;  3LSI A;  4BUP A;  4BS9 A;  4CCK A;  2M7B A;  1WJE A;  2DCE A;  4HRI A;  1WJB A;  4XKV A;  3EPZ A;  2LH9 A;  5HNH A;  3MKZ A;  4PFP A;  1G59 A;  2JVH A;  2VL8 A;  4BDZ A;  3OWT A;  2R7T A;  1YX3 A;  1X4P A;  2K5C A;  2VB6 A;  2X6Y A;  3LL7 A;  2WA0 A;  2KP6 A;  1YX5 A;  2R7S A;  2CW8 A;  4QPQ A;  3SEQ A;  1V5E A;  2WY7 Q;  4IQ4 A;  4E7K A;  1MND A;  3H5R A;  2HDW A;  3BG7 A;  3HKZ A;  4H4K C;  4KIT B;  1JI8 A;  2K3P A;  1VZ0 A;  2HU9 A;  4F3Q A;  2CMP A;  4CH7 A;  4J00 A;  4F55 A;  4CCL A;  2MAB A;  4D9J A;  2MD0 A;  4B43 A;  3HPH A;  3L2R A;  3BCA A;  3RQ4 A;  1D0X A;  3S3O A;  2V9K A;  2CV0 A;  4DGW B;  4BU2 A;  2Y0S A;  4BEH B;  4XL9 A;  2MFZ A;  3K4B A;  2KQR A;  3S8P A;  4Y3O A;  1W36 C;  2W00 A;  3H9G A;  3AL0 B;  2JUG A;  2CV1 A;  2L5Q A;  3EUA A;  2BVM A;  3RTR A;  3HPG A;  1UG0 A;  3I3L A;  2RRE A;  2VLA A;  3DU6 A;  4NUB A;  3FBI B;  4QPO A;  2L2O A;  3E0J B;  4RM3 A;  3ZGK A;  3C2H A;  1U0J A;  4AVZ A;  3KYL A;  4NQW B;  4HNU A;  3SEZ A;  1MW7 A;  4C2U A;  4ZC3 A;  3CJR B;  3VWB A;  2KPM A;  4XN3 A;  3DWL E;  4DOZ A;  4CZC A;  2HPM A;  3OOU A;  2Z16 A;  4ANJ A;  3RPU D;  1LFP A;  3AKZ A;  4XLH A;  3K10 A;  4J01 A;  4BE0 A;  2KMU A;  2RNG A;  2LRE A;  2W1O A;  3DLA A;  3DKX A;  3K4J A;  1TZL A;  3TBI A;  3OL3 A;  3W2W A;  3PL8 A;  2HPI A;  2M4G A;  4BL0 B;  5HVQ C;  3OL4 A;  2FUG 2;  1LVK A;  2KDO A;  4DJA A;  4BEH A;  4PFO A;  1DGR M;  3OYE A;  2DJI A;  2LY2 A;  1ERD A;  3IAM 2;  4BAC A;  4RLQ A;  3DPT A;  4XNF A;  2BOL A;  1AA7 A;  2I8D A;  2E5N A;  1W36 D;  2NOJ B;  1X1B A;  3CZ6 A;  2X1C A;  1WJA A;  2LC2 A;  3V42 A;  1DP3 A;  3K4L A;  4HG2 A;  3AL0 C;  4XOT A;  1WJF A;  2VJI A;  2VKD A;  2VAS A;  2V4J C;  1J09 A;  4KT6 A;  1QU3 A;  2UUZ A;  2JVG A;  2RQQ A;  3S3N A;  3H35 A;  1G8X A;  5HNF A;  3DU5 A;  4E7J A;  3VSL A;  2HVR A;  1GLN A;  2E5Z A;  5FRO A;  3H0D A;  4II2 A;  2AQE A;  5FRM A;  4OWR B;  1V5G A;  3IUO A;  4U7B A;  3KX2 A;  1X4O A;  2CUZ A;  1LDK B;  4BE1 A;  2MYS A;  1MMG A;  2R7O A;  5LFA A;  3CF2 A;  3OYB A;  4ZDL A;  4RMN A;  4CCO A;  3QYB A;  2LG4 A;  2LRD A;  2W7N A;  2VJ4 A;  2X51 A;  3K4M A;  4HST A;  2E60 A;  5CQE A;  4RLF A;  4F93 B;  2WAF A;  3OR2 C;  4E6K G;  3H9J A;  4X0G A;  4BJ6 C;  1QHH D;  4OAZ A;  1TT0 A;  3TL4 X;  4E7Z A;  3PJR A;  4CCN A;  2OUM A;  3K4C A;  3OMY A;  3M1C A;  3K70 C;  2M7A A;  3MKY B;  1SAU A;  2M3A A;  3UNG C;  2VPL A;  4IZZ A;  2LY1 A;  3HG9 A;  3W2A A;  3CMM A;  2W82 A;  4BQN A;  3MKW B;  2ZXI A;  2XSJ C;  1X1A A;  3LSG A;  3OYD A;  2BW3 A;  4FET A;  4XM3 A;  5KHD A;  3OYG A;  3H5N A;  4XLA A;  2R7U A;  3OY9 A;  3K4N A;  3QOD A;  4HSR A;  3NWT A;  1T95 A;  2VQL A;  2WY8 Q;  4PJL A;  4HNT A;  3OYC A;  2AQF A;  3VSK A;  3ZCO A;  3ZQQ A;  3EUK L;  4CUG A;  2OV7 A;  1OLT A;  4OAY A;  3AFH A;  3OYL A;  4PJM A;  3OYF A;  2CS3 A;  4AYB A;  1MMD A;  1BR1 A;  4ZDO A;  2L7K A;  4B44 A;  2KL4 A;  1QHG A;  1PYV A;  1SFK A;  4E4H A;  2KZV A;  2V6E A;  4N4O B;  3TMO A;  3S3M A;  1ZEL A;  2CW7 A;  3DTI A;  1IRX A;  3HC7 A;  3K4K A;  4HEA 2;  3ONQ A;  4YEL A;  3CJQ B;  4PK4 A;  2IGK A;  3FHN A;  2L9S A;  3IP4 B;  3LSH A;  5CPR B;  3L2W A;  2JA2 A;  4P5O A;  3K70 D;  2V1N A;  3OYJ A;  4DIQ A;  3RSN A;  1YE9 A;  2E1M B;  3VYS B;  2HVS A;  4Y33 A;  3S93 A;  4E7S A;  4LIT A;  2GOM A;  1D0Y A;  2VJ5 A;  3PFY A;  2VQC A;  3KEY A;  1X1C A;  4R79 A;  2X1D A;  1R6R A;  2KRC A;  4XLF A;  2L9N A;  3W2V A;  4CSW A;  2QKL B;  3D5S C;  3A4C A;  2WAQ A;  4XLC A;  4RM2 A;  3OIQ A;  2K9M A;  4F92 B;  3OYM A;  4ZTJ A;  3VYR B;  2IS6 A;  1Z3X A;  1Y56 A;  2XF6 A;  3ZRG A;  4KJZ A;  1OR7 C;  2VIX A;  1NG7 A;  2ZSH B;  2R4G A;  4KIS A;  2IGM A;  3FKJ A;  1N75 A;  3DTK A;  4Y4R A;  5CKT A;  5HOO A;  1S9H A;  3LMM A;  2PMZ A;  1T0F C;  4IQJ A;  3PSF A;  3DPL C;  2OC6 A;  1P9Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...