4QPOA

Mechanistic basis of plasmid-specific dna binding of the f plasmid regulatory protein, tram
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
53
structure length
53
Chain Sequence
b'AKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Relaxosome protein TraM
publication title Mechanistic Basis of Plasmid-Specific DNA Binding of the F Plasmid Regulatory Protein, TraM.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 14
structure length 53
sequence length 53
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4qpoA00
4QPQA 3OMYA 1DP3A 4QPOA
chains in the Genus database with same CATH superfamily
1YX5A 3CF2A 4FX0A 3FXRA 5GP9A 9ANTA 4CYCB 3HOVJ 2DU9A 5D5WB 2ELJA 2LF7A 3OV8A 2OC6A 2LKXA 1YW9A 1FMWA 1R22A 1UHSA 3IRRA 4A3JJ 1Z6TA 4WF2A 1BJZA 3VSKA 2Y2ZA 4PFOA 1HC8A 3HPHA 3KEOA 4U7BA 5E18F 4CO8A 1HQCA 3RDIA 1IXRC 4EEFG 1UB9A 3LSJA 3IUOA 2OZ6A 1H8AC 5EDNA 1ZH5A 2EA2A 2KRCA 1BW6A 2XF6A 2BXZA 1A6QA 4BE2A 3P9KA 4QSHA 2DA2A 2PMZN 3NWTA 1UAAA 4LG0B 4GCVA 1J59A 5J4YA 2ISZA 3F6OA 2JA8J 2OQRA 3KYLA 1GT0C 1IRGA 5FKOA 3CCVI 3BR0A 4F3QA 4Q47A 1IN4A 3O8HA 2Q0OA 2DTRA 2ECCA 2JA6J 1AU7A 2CG4A 3KYDB 5K5OA 5FB2A 4P96A 3OS0A 2HFHA 4A12A 3P5JA 1W4MA 3DEWA 4IO9F 3CCRI 2V6EA 5KK1A 4AIJA 2HYGD 2CJJA 4L0ZB 2K9QA 2OQGA 1IN6A 1IDZA 2DFIA 3H3UA 5JLWA 1R5ID 3FXQA 3WGIA 1WJEA 1BI0A 3CLQA 3G71I 3VYRB 1QZEA 3GTPJ 3R0JA 4NUBA 3W6JB 2FEZA 2LSOA 3D5LA 2RN7A 3CMMA 1FX7A 3L2QA 5JVGF 2HQRA 2F4MB 3D0SA 3ZN1A 1YTYA 2XB5A 2IBDA 3QU3A 1P7JA 2Y31A 3SFIA 3OYBA 3T1BA 2CQ7A 4M3BA 4XNFA 1RIOH 3DEUA 2IS2A 3QP6A 4U87A 3VPRA 2Y30A 1BL0A 2Y0MA 3ZQCA 1B8IB 1G8XA 2WWYA 2PJRA 3ML6A 3EUHA 4IHSA 4Y13A 4ZDLA 1W5TA 3SHFA 5E3OA 4R8HA 3LL7A 3BJAA 2DT5A 3IRQA 4L9VA 1KU7A 4RB0A 5FKKA 1WJ5A 3L1PA 3ESWB 1RR7A 4XSXF 5FLXK 2PG4A 3OYIA 2K27A 1PUFB 3OY9A 1R5GA 3TOBA 1QGPA 3IKTA 1K79A 5CVIA 3KLOA 2MH2A 4D5CA 2R7UA 4CUGA 5EGOB 3LWFA 3PO3J 4LLNA 3RYRA 2WA0A 2HVSA 4PJ0C 4UNOA 5GAEJ 2EH3A 1STZA 1OMIA 2BVLA 2DAOA 1YFHA 3B6CA 2FSWA 4MO7A 3DP7A 3WTYC 2F4IA 2PEXA 1R00A 2LH9A 1VTNC 3LSTA 3QPLA 3R6SA 3RKWA 1YI2I 1GDTA 2ID3A 1ZGJA 3MKYB 1JTXA 4HQMA 3M7GA 5CPRB 4CCOA 4MEYF 5HS8A 1IV8A 4JQFA 1MMDA 1APLC 4EGZA 1IUYA 1MGTA 3QYEA 2ZSHB 4EM1A 3HSRA 3K4JA 1D1BA 2EIMH 3FHZA 4KA4A 4PJJA 3OYHA 1QRYA 5FGMA 2JRMA 1X1DA 4GXOA 3F23A 5CJ9A 3AG4H 1G3TA 1PYVA 2NOJB 1U8RA 3BY6A 2QF7A 1XPXA 1Z3XA 3BTLA 1MJ9A 3I59B 4XLNF 1JT0A 1MDMA 4FTHA 2RREA 3H5AA 2A5WA 5J47A 3I71A 4XSZF 3S1MJ 4IQJA 2M4GA 2W48A 3WTXC 3CC4I 2BYVE 5FD5A 1G6NA 1ZELA 2UZKA 2K9NA 3OR2C 1JHFA 2IGMA 2ZMEB 4N4OB 4Y52J 4CA0A 4L5JA 2GM4A 2CSOA 3U9GA 4C3IJ 2OTLI 4EM2A 4A2UA 3FK6A 4AYBA 5F27A 1HA8A 4ZYEA 1UG0A 4BQOA 2VPRA 2EJRA 2FBIA 3TW6A 1T8IA 3LQQA 3GLXA 1AKHA 1AA7A 2A05A 4EM0B 2YU3A 2FNAA 4LD5A 4A3MJ 2IAIA 1JJ6C 1JTYA 5ICFA 2UXXA 4HDUA 2B0LA 2L4AA 3DPUA 4XM3A 4G94A 1JE8A 3BG9A 3RIRA 2M0MA 1VQMI 2NXNB 4LJZF 3PM1A 1VQPI 2ZJRF 3DFGA 1HSJA 3SXYA 4U88A 1GXPA 4HNUA 1IJWC 2DOFA 3SZPA 4KISA 3EUAA 2QKLB 1WJBA 2MG4A 4G6QA 2FQ3A 4WXCA 3LNQA 1Z3YA 2XAQA 3DLAA 2AO9A 2BW3B 4JBAA 3GTJJ 2WAEA 3AAFA 2CUFA 5C4XJ 1TW2A 1FT9A 3U21A 1MMGA 2ZMEC 4BQQA 3PIPF 4V19K 1WI3A 4I2OA 2M1BA 4JX6A 2VBXA 4IQ4A 4BEHA 4DGWB 2VQCA 2BZTA 3PQKA 3K70C 3S32A 3UKGA 2OCEA 3JRAA 2FX0A 4MFEA 2VBYA 2FBKA 4BXUA 4M6YA 2AQFA 1TQIA 4PK4A 1C0WA 3PL8A 3CQZJ 3I4MJ 4ETSA 3HIFA 1P9QC 2DW4A 4A3CJ 4ESFA 4MQVA 1H9GA 1XSXA 3T0YA 3LA3A 4UXNA 4ZZLA 3TQNA 2OZUA 2VB6A 1XS9A 2VBWA 2W7NA 4RLQA 3WTVC 2LNBA 1SVMA 4E7LA 3HB9A 4BUPA 2JK3A 1Y6IA 3T8RA 5F64A 5EZHA 5BMZA 2IA0A 2GXAA 2MGQA 3CP8A 4BACA 2FXAA 3JRFA 3CMYA 3QPTA 2EV0A 5D4SA 1R71A 1D0ZA 3BG3A 3W2WA 2DODA 3J81Z 3VB2A 3R0AA 1IUFA 3HOXJ 2PLYA 1K4SA 5B66C 3BG6A 2X4HA 5F04A 2L01A 2VQLA 4XLCA 1NK3P 3DBLB 1FIAA 1HW1A 2EFNA 4XK4A 1MBGA 2HQ5A 2ZNYA 1FYLA 3TEDA 1J7KA 3BR1A 4OOIA 3QYBA 3EETA 2DT7B 3AKZA 1ZQ3P 1U9OA 2FBHA 4IRIA 1TNSA 3M9AA 4MTEA 2ZC2A 2JRTA 3ZQQA 1JKOC 4M73A 1T33A 1CGPA 3S14J 2VJ4A 3MWMA 1K6OA 5LLQA 3CMEI 3A2KA 3NEUA 4FT8A 5ED4A 1QZYA 4IRHA 1T2KA 5F0CA 4B43A 4HX4A 1LJ9A 3TL4X 4IOCF 3V42A 4YRVA 2I10A 2DYSH 3HKZN 3M4OJ 3N4MA 3I0TA 3MKZA 2E5NA 3M8EA 3ABUA 4FE7A 4DNCA 2VC1A 5AONA 1VQ8I 2HOSA 2DFFA 3A01A 2BY2A 2QBYB 3ZQGA 1AOYA 4ZTFA 3GLLA 2V1DA 3OR1C 2OCCH 2V9PA 2D1HA 3L9FA 4CGZA 2GZWA 2A6EF 5C44J 4HAMA 1O7LA 4NC8A 2W4SA 1XD7A 1UMQA 2GXBA 4A0YA 4ANJA 1Z91A 2XAUA 3C2BA 2ECBA 3A0HC 3RPUD 5EZGA 2CV2A 1VQKI 5IT9Z 4EJWA 4XL9A 2ETHA 4D0PA 4B44A 3FKJA 3CCSI 3SDBA 1BA5A 5M5XJ 5B3SH 3VSLA 3CJNA 4FISA 1KQ0A 2HR3A 1SD6A 2EWNA 2KRFA 2P81A 4F55A 3DBHB 1PP8F 5J3LA 3SDGA 4HQEA 2I5UA 4MQ9F 1SD7A 3DQVC 2OPTA 2QENA 1FZPB 3JSOA 2M3AA 4XOTA 5BNGA 3RKYA 5L3FA 3CC2I 1I3AA 4UV9A 4HSRA 3C3WA 2K4BA 2VLAA 3Q5FA 3G2BA 4OAYA 2P5VA 1FYMA 3FM3A 1R7JA 1W5SA 2FOKA 2J5OA 3ZCOA 5IYCJ 2ZXWH 5BPDA 4GO1A 1Y0UA 5EG0B 2VONA 2LY2A 1R1UA 4XRSA 2FD5A 4DYCA 1DQUA 1X2MA 3QPHA 4CXFA 3K7AJ 1GUUA 4RB2C 5F0HA 2KJCA 1ZGWA 2E60A 2LDUA 3D5RC 1F9NA 4A3BJ 2O61A 1U3EM 3F8NA 4AM3A 3IAM2 3HC7A 4P55A 1LFUP 4UY8I 1G3SA 2YX4A 3QODA 4BHBA 2ELKA 2OV7A 1T0FA 3EYIA 3WG9A 4HOBA 3JRIA 1JUPA 2IGNA 2L7FP 3JCUC 2DDBA 2KFDA 4LGWA 1ETWA 1TQMA 1T6SA 2DBBA 1BJAA 3RPUA 1WSUA 3K6GA 2JA2A 3MZ8A 4HV5A 3WTZA 4B3XA 4FE4A 2BV6A 3WTUC 2X6WA 3JRBA 2JA7J 2AQEA 1GHCA 3OYAA 2NS0A 2DO7A 4AIKA 4P9FA 4BQAA 1BOBA 3OYMA 2VT2A 1OQYA 2DTZA 1W0TA 2HDDA 2R5ZA 4BE0A 1YRNB 4EJUA 5JHFA 3V7CA 1Y1WJ 4PJMA 4A0ZA 2M8EA 3HTUA 3ABTA 2VUMJ 4A93J 3ZN0A 1SFOJ 1MD0A 3ABMH 3I55I 1ZRCA 3KP2A 1DU6A 2JSPA 2JWTA 3ROUA 2R7QA 2CU7A 5DYMA 4I02A 1I6HJ 3GX4X 2ICWG 3LOCA 4W97A 3CCJI 5DTDA 2A6TA 2WAQN 2VJJA 3OYLA 3JRCA 4IX7A 2ESHA 2W25A 5HLHA 1SAUA 3E6MA 3F21A 1FP1D 4RMNA 3FM5A 1ZN2A 4G7ZF 2M0CA 3V8LA 1BI2A 1DGRM 1YJ9I 2HOAA 4E70A 3G1OA 4XR6A 1J2XA 4IEJA 3VFZA 1MSFC 1ZR2A 1IO2A 4MTDA 4ENMA 3LFKA 3ZMDA 5E20A 3RQ4A 3Q9SA 4A0XA 3KP6A 3MVPA 2UV1A 3WTSC 1WI9A 3J81K 3Q0UA 2QQBA 2DI3A 1XTAA 2H94A 3BTIA 4ABZA 4L5IA 2E7XA 1SMYF 2NAZA 3HSEA 3LSPA 3M8FA 1U78A 4BXXJ 3GFMA 3BZ6A 2YS9A 1JJ8C 2GXGA 3WG7H 4LMYA 2HTSA 4CZCA 1ETKA 2ZB9A 1SFKA 4HYEA 2BEOA 3DPLC 5EEAA 3TO9A 3TDUC 3VWBA 3MKLA 5DD8A 2D2WA 2V4JC 2CMPA 4XOPA 3SYTA 2CYYA 2K3PA 2VJ5A 5EJCA 2HDCA 2L9RA 2R7TA 4MFDA 1TQPA 2LVSA 2QM3A 4GRIA 2L9VA 1ON1A 1H9TA 2HKOA 4JP0A 2NNNA 4O6JA 3AG1H 3N97A 1TWGJ 2STTA 2VASA 4KYWA 1OR7C 2ZKZA 2COMA 2K3FA 2CW8A 3JTHA 4HSTA 3REOA 3W6KB 4C3JJ 2HPMA 2XKPA 1KA8A 4X6AJ 1TNTA 1VQNI 2JQ7A 1ETYA 2O8KA 1XGNA 5CLSA 2WY7Q 2H8WA 2KPMA 1RZ4A 5K1YA 3KP5A 5IT9K 2FNPA 1TC3C 1MSEC 1R6RA 2Z99A 4MHGA 2CQKA 3Q0VA 1YG2A 1RRJA 1LEBA 1Y8RB 2ADUA 5D6EA 5GTHC 3GTMJ 5J8FA 4XLFA 1HSTA 4UVCA 1FOWA 2CW7A 2OA4A 2DK8A 3T5XA 2Z5UA 3PSFA 3F8FA 2BY1A 3J7AY 2WAFA 3TW7A 4CICA 5FO5A 4FHTA 1VQ7I 1F1ZA 2VOOA 3HOTA 2M34A 4C3HJ 4DQ2A 3S3MA 2ME0A 4GYIA 3CDLA 2JPBA 3NAUA 3QRFF 3DBRB 2GLOA 2WV0A 4ZJZA 1ZTRA 3HHGA 2DMQA 4V2GA 1Q1VA 1LNWA 4HPQA 1SD4A 2LBFB 4LG0A 2IGKA 4IXAA 3CDHA 1I1GA 2HYJA 4OMZA 3WTTC 4B47A 2A69F 1QPIA 2LD5A 1H89C 1WKMA 2PX9A 3HRSA 3E7LA 3S2DJ 5HS7A 2CGPA 4IRGA 3J7YJ 2QLZA 2ZO4A 4KITB 1LB2A 3M3YJ 2IS4A 3HTSB 2QQ8A 3K2ZA 4DBRA 3TP3A 2E7WA 4FX4A 4HLXA 1ZKGA 1VQ9I 2G0EA 2RNJA 2VKDA 5HNFA 3WU2C 2XGXA 1Z21A 2M2EA 2XIGA 3OYJA 3A1YA 3FX3A 4ZYDA 2B7EA 2DA5A 2XRNA 4BE1A 1WH7A 2DMNA 2V1UA 4XLPF 1RI7A 4PGGA 3M1CA 4R79A 4MNUA 1WQ2A 4EJVA 1V3FA 2AHQA 3OIPA 5ICGA 3L2WA 2B63J 2LKSA 2DN0A 3GEZA 5DEQA 4CZZA 3EPZA 2CFOA 2E1OA 2Y69H 4IL6C 3WTWC 3VYSB 3RYPA 1YX3A 1LFBA 1Y8QB 4D1QA 1S3JA 2CRGA 4ZZDA 3MFKA 2ELHA 1QNTA 3Q3SA 5J6XA 3OYGA 4KDPA 4LK0F 2Z33A 3LAJA 2H6BA 5LEKA 5HOOA 1MH4A 2MLKA 4F7ZA 2EB7A 5E8IA 1WH5A 1OCTC 3K1MA 2X9DA 1VNDA 5L3DA 1CF7B 4B09A 3BG5A 3K2AA 1ZG3A 4B48A 1O4XA 3FXMA 2KHMA 2DYRH 2K40A 2ZJQF 2DA1A 4RS8A 5EEGA 4WWCA 1JT6A 2W84A 3H9QA 2BGCA 1RNLA 2O03A 2CW0F 4XMYA 5B1AH 1SEUA 4DYQA 4G6TB 5L3GA 2KMUA 2M9HA 5FKNA 5B1BH 1YW7A 3CZ6A 3QOPA 1KU2A 1T98A 4KJZA 3QU6A 2PJPA 1X3UA 4DZJA 1VQ5I 3WE3A 2GBYA 1B72B 3F9KA 3H36A 2EIKH 4BKXA 1XCVA 2RAEA 1FBQA 3AG3H 3GFLA 3S3OA 2EILH 5EGOA 3BWGA 4ZDOA 3PNVA 1I50J 3K70D 5D5VB 1E3OC 1R5HA 2DOEA 1Q1HA 4Y3OA 3FBNB 1D8KA 3E97A 1ITYA 4A6EA 4A3FJ 2DCEA 3ZQFA 5ILUA 2HS5A 3FXLA 3KZIC 3KX2A 3I9V2 2R0QC 2OJED 3CP2A 1OYYA 2XGDA 3KIOA 1MBHA 2PMHA 4M3FA 4B3AA 3GBGA 3PSIA 3GTLJ 4NC7A 5BQTA 3ERMA 3RCOA 1FSHA 4J19A 1TWFJ 3SFZA 4XN0A 1WJAA 2A61A 2BBYA 5DCFA 3TP0A 2LF8A 2R7WA 1WGXA 5EYRA 2H8RA 3H0GJ 1MNMC 3F3XA 3KZZA 2XRLA 4HEA2 4RAYA 1MJBA 1SD5A 2CQQA 3PQJA 4Y15A 5L3EA 1GVJA 3KLNA 2R7OA 5IP7J 1BBYA 1W36C 3FZVA 1ZLJA 3ZXSA 3DPTA 1BC7C 1B4AA 3E5XA 3LSHA 1J09A 1I5ZA 5HDGA 3I59A 4E7JA 4N9IA 4IHTA 2VL8A 3BR2A 2F5EA 2QYOA 1HCRA 1B9NA 3ZMVA 5JVTA 1JUMA 2E34A 1MH3A 2LC2A 3GVAA 5L3CA 2HNHA 4XRSG 1TWAJ 3PJRA 1UHMA 1ENHA 3KFWX 1X58A 2B9SA 2MFZA 1YLFA 1JGSA 1DP7P 1WCMJ 1FYKA 3LSMA 5ICCA 3LQRA 3WHBA 1MW7A 2DA4A 5IT3A 3MQ0A 2COBA 2JPCA 3A03A 5E1XA 2L9SA 3U2RA 3JRHA 3EUHC 1KQ9A 3ELKA 1RESA 4LIVA 4A5MA 4RB1A 1LVAA 3E1SA 2X1EA 3I56I 3FISA 4NB5A 5JR3A 4EGYA 4OIOF 1QPMA 2WV1A 3L00A 3OS2A 3I5UA 5JHUA 1YOVB 2K02A 5IYBJ 1JKPC 1IDYA 2UXNA 4IHWA 2FMLA 4PUSA 2IA2A 1NK2P 4BDZA 3OSFA 3FKIJ 3CUQA 1SANA 1BC8C 2MSYA 3LA7A 2E2HJ 2YU9J 3HBLA 2A07F 2HPIA 3GTOJ 4G12A 2QA4I 1E17A 3ZMUA 1MNEA 2ZXHA 3IV5A 3S1RJ 2VKEA 1LUJB 1BOAA 2IEKA 5J4VA 2XPVA 3H3ZA 4WCGA 1RKWA 2R7RA 4E7SA 3CLOA 2HKXA 2KLOA 4BHCA 2E2JJ 5FKMA 1HW2A 2DJNA 4C2TA 1ETQA 2W82A 2P8TA 4IPAA 4AYBN 2IVMA 1Z9CA 2X0LA 4LK1F 4EJOA 3PO2J 4I01A 1QBJA 1MBEA 3K4KA 2RNGA 2DOAA 3E5QA 2IA1A 2HYFA 2O3FA 5HODA 2R7FA 1KQ8A 1K78A 1LEAA 2P0WA 1AKHB 1P4WA 1IN7A 3BQZA 2L7MP 4I99C 3LSRA 4C9YA 5TISC 2F6CA 3ZRGA 3A4CA 1DUXC 1AWCA 3K69A 1Z7UA 4A3IJ 3DKYA 1IW7F 4E7HA 3PIOF 1KU9A 1UG2A 4B1RA 1ZREA 4NHJA 2L2OA 4HF1A 3FIWA 3OYFA 2QVOA 3HZJA 1S8NA 3GTQJ 1IF1A 2VT3A 1D0XA 3TO6A 2Y48A 3LMMA 2AS5F 1FLIA 3JR9A 5LEJA 3WE2A 3I4PA 3SZTA 2JVGA 4BJ5C 4A3EJ 4LB6B 2NS8A 1R58A 4KMUX 3WODF 1Z7LA 3IWFA 3V8KA 1YHQI 1LFPA 5LFAA 1PVEA 1X2NA 2LYCA 2PQ8A 3W2AA 2BY0A 2F48A 3C2HA 5DUIA 4LG3A 2ZXIA 3SEQA 1QQIA 2EA4A 3FXJA 1WPKA 4CCMA 1NH3A 1E2XA 2WY8Q 2M7BA 3BR3A 1FPQA 3DF8A 2XVCA 2FF4A 3VOEA 1S6LA 2Q2EA 4HZFA 4I98B 3UR3C 3LAPA 2RQQA 3CTAA 4M6XA 1PUEE 3G1MA 5D8LB 5F1RA 4RB3C 4O3MA 1MMNA 1FP2A 3X2QH 5LD2C 2W00A 2XSJC 4NQWA 1FBUA 2RC4A 3HOYJ 5DM7F 4XRFA 1B59A 4BH9A 3H5NA 5J1RA 3S17J 3JRDA 1J75A 1P92A 3S3NA 1U5TA 3BZCA 4NNJA 5DCMA 5F0FA 2X85A 1XGSA 2F5VA 4Q48A 3ZMTA 1ZYRF 2P7CB 2HXOA 1H0MA 5BPIA 4DYRA 5H20A 2HQNA 1ZG5A 1YO5C 2CUJA 1LVKA 4RDUA 2XAJA 1RKTA 2G9WA 1YIJI 3K4LA 2EV5A 2KIFA 2QZ8A 2E1NA 2CV0A 2PFBA 1D8JA 1OCRH 5DDGA 3DTKA 2NS7A 1Z6RA 2JN6A 5ICEA 2OAZA 2DDAA 1HKSA 2QKMB 5FFZA 4CDGA 2H6CA 4CH7A 3ASNH 3A02A 4KNYA 4ESBA 5M5YJ 5HLIA 3L2RA 4DZPA 5HLGA 4PCQA 4N4NB 3BCBA 2XSDC 2QCOA 4WX9A 2EQRA 3L2UA 4U7DA 4Q4ZF 1T08B 3CESA 3NWSA 4MEXF 2VKVA 2IRFG 1FC3A 5J40A 2FRHA 1HF0A 2MH9A 4HV6A 1V5EA 3OMYA 4XONA 4MGRA 4L9TA 2D45A 2IS1A 4XKVA 2DK5A 1S7AA 2VE8A 1JHHA 5HDNA 2XAGA 3L2CA 1R1TA 2DMUA 4ON0A 4OMYA 4OIRF 2HXIA 2JJ7A 3FK7A 2F4OB 1VZ0A 1ZRFA 3A01B 2BOLA 3FXUA 1SVLA 1OCCH 2M30A 1Z1DA 3K4BA 1FIPA 5GPAA 1QA6A 4I76A 2XAFA 1TT0A 2RV8A 4UUTA 1DP3A 3OS1A 4D9JA 3TOAA 2VODA 3FHNA 1S7OA 2XUBA 4Y4RA 1FOXA 4AIHA 3QYFA 3QQAA 1YS7A 2HVRA 4OIQF 5K7HA 3ZGKA 4KIGA 3BR5A 3AG2H 4ENJA 1NHAA 1I27A 4UVBA 4XORA 1UELB 2WTEA 2EZIA 3KPHA 4HNTA 1F5TA 1YYVA 5KCMA 4BAYA 1J5YA 4GYGA 3RTRA 2E1MB 4BNCA 4LB5A 2R92J 4G9YA 2Y9YA 3FMRA 4CCNA 4CCLA 2KQRA 1UJ8A 2GIZA 1IN5A 2K5CA 2K9MA 3GCMA 5FJ8J 1BR1A 4GDFA 5K5QA 2MC4A 3O3KA 4XRMA 3EQLF 4QTRA 2NYXA 1W7PD 3IC7A 5H6QA 3QPSA 5LHIA 2OU2A 4XKBA 3HG9A 1WJFA 2P7VB 1QVTA 3IH4A 1YRNA 1UZCA 2CV1A 5DS9A 3CCEI 3IHUA 2DQLA 2R7ZJ 3OYEA 2EFWA 2A3SA 5D4RA 4YG2F 2V79A 5IPAA 1ZAOA 4JX4A 4U0WA 1SFEA 3JREA 4II3A 3VYUB 3K4NA 1SAXA 2ISYA 2CFXA 4RGRA 4P5OA 4AD9A 3SZGA 1V5GA 2NVTJ 3U1DA 2W57A 2FMYA 2XROA 3SEZA 4A6DA 4P1WA 3O2PE 2LR8A 1XB4A 3GTKJ 1WRJA 2E1MC 2VJIA 3RQIA 3AL0B 3F6VA 2ME6A 3QWLA 1IRFA 4UUSA 3K10A 4HG2A 3S16J 2QUFA 2K86A 3K9TA 4I09A 4DJAA 3CO7C 2VC0A 1IXSB 3FMSA 2FE3A 2O9LA 2R93J 2MLGA 1I3QJ 1IZ1A 2QGUA 1BW5A 1OCOH 1U6GA 2TRTA 1K4TA 3GFJA 1WJDA 4IHVA 3HDDA 2Z9OA 4RGUA 4YFKF 1IV6A 2DPDA 1RPWA 2MA3A 1QHHD 1OR7A 2R5YA 2R5ZB 2DA6A 1T38A 1CQTA 2NNYA 4QPOA 1NG6A 2ZFWA 1X1BA 3AFHA 3COAC 4C2UA 3S2WA 1V5FA 3I4NJ 1W7PA 3ZOBA 2RGVA 3ZMSA 2K9SA 4PSXA 1BI3A 1EA3A 3GW2A 4OAZA 2V9VA 1KYZA 3JW4A 1MBFA 5CVUA 2XASA 1WVRA 3R61A 3MZHA 2XKOA 5E1ZB 2MC3A 5L3BA 2EFQA 3HEFA 2A5YB 3ZP5A 4L18B 3AL0C 4IZZA 2Y0SA 1R36A 3ZQHA 1S9HA 2X1CA 2V1XA 2RKHA 2HWVA 1F43A 3L09A 1K83J 4E7KA 2A6HF 1OJLA 4GFBA 4FCYA 3GTGJ 2GOXB 4X1EA 4IKFA 1KONA 1OPCA 2LRDA 2XHKA 2L7KA 3HPGA 1Z67A 4CCJA 1LPQA 1HLVA 2E71A 1R1VA 1MBKA 2VQGA 1NTCA 4RBOA 4AUXA 2KJBA 4HNVA 2VKHA 3FF5A 1XSVA 5D5XB 1FEXA 1P6RA 2KKOA 4BQNA 2LFBA 5FLMJ 3A0BC 2QWWA 5CQEA 3EUKL 5F08A 4EMSA 3LSGA 2XAHA 4OINF 1IC8A 2XGEA 3DLLF 3W6VA 4M6VA 4KFCA 2HQAA 1O3RA 4QWQA 5KAIC 1HOMA 2LLKA 2WC2A 3H92A 2HOTA 2KIMA 3F8CA 2O6GE 5A2QZ 2JSCA 4A3DJ 3I64A 1HDDC 2HZDA 1BM9A 5C3EJ 2K4JA 4UVAA 2LREA 1X3ZB 1KU3A 4BDYA 1QO0D 3OOPA 4ZYGA 4XIDA 2W1OA 3E5UA 2A68F 3KZYA 2IW5A 3E6BA 4FQGA 1B6AA 4RGXA 1SC7A 4B8XA 4CYCA 2EK5A 4OWRB 2M4KA 5GAHJ 1VQ6I 3HGYA 2YR2A 4NC6A 2X6OA 5DD4A 4DIQA 3K0LA 1ETXA 4BS9A 3G6EI 3G3ZA 1MZBA 1LE8B 3HUGB 1F4KA 4G8XA 1TZLA 2CUEA 2XPUA 3VDXA 1IRZA 4IHXA 3I58A 1X3WB 4R1HA 4EVIA 4HBLA 3RI4A 1OYIA 1RUOA 3D1NI 1ORKA 1MMAA 4UB6C 2H1KA 4HW0A 5AIQA 1H88C 3GWZA 4ENKA 1U2WA 1V55H 2GAUA 3H9JA 5E8GA 4Z6YA 5KHDA 5FLVA 3DTIA 2VN2A 1V4RA 2AXLA 3V7RA 5FD6A 2O7OA 2IJLA 2IXSA 3WGHA 1S5LC 2ESNA 1T39A 1R49A 1A04A 1A35A 4S05A 2O5RA 2X6XA 2PMZA 3GMEA 5DM6F 2PI0A 3QOEA 3IWZA 1REPC 2LOOA 3ULQB 4F52A 4AU7A 2L7ZA 2ZBKA 5J8CA 5LGNA 2ID6A 3WU1B 3E6DA 2GA2A 4ITVA 4UHTA 5AIPA 5K7ZA 1P2FA 2QEXI 3O8GA 2EPFA 4XKWA 3N05A 2F2EA 2EZKA 5HLTA 3J80Z 4GGGA 1EH7A 4LLLA 1RR8C 1FSEA 1KGSA 2HOEA 2VXDA 3M07A 4YIRX 5F6FA 2KDZA 3K4CA 1EV7A 2QQAA 2MYSA 2LG4A 3B02A 1CF7A 3J7AO 2DFHA 4PJNA 5HS9A 1DU0A 4ZC3A 2M7AA 1ZHFA 4A3GJ 4AWXB 4LFUA 1GLNA 2LMDA 4YELA 2P5KA 1S29A 3HGGA 3DTEA 2XC7A 5ERIA 4RM3A 1E3HA 3PUFA 1ZR4A 1W0UA 1BIBA 4Y17A 1B8IA 4A3LJ 3DKWA 4FETA 1G3WA 2VBZA 5B5EC 1T95A 1O3QA 2Z2SB 4M3GA 1VQ4I 4QPQA 2N8GA 3MZYA 1HKTA 1W1WE 1PJRA 3MEXA 3ZQ7A 1B72A 4IOAF 3JTGA 4C2MJ 1N78A 1TW3A 4BJTA 3R4KA 2VI6A 4RAZA 4J00A 2QSHX 3H35A 1SFXA 4WXDA 3BROA 3HHHA 3UNGC 3CDIA 3CF5F 3ONQA 4ASNA 1EH8A 1D5YA 2DMTA 4RA2A 4M3EA 3HOZJ 1MJAA 1PUFA 1LDDA 2KRHA 4QIWN 3CJQB 1JKQC 1XCBA 1TL8A 2NOGA 3QP5A 1DGWY 3IP4B 1O3SA 4I0BA 1XX5A 1U0JA 4F91B 2R4GA 3BT9A 1KZHA 2IPQX 3M8JA 4B4CA 2OD5A 2KDOA 1WWXA 4PGHA 3PNYA 4G7HF 5EF6A 3GXOA 4P9UA 1ZLKA 3OOUA 1DPUA 4BHPA 4H0EA 1GVDA 5J1YA 4M72A 2GWRA 4G6DA 2FA5A 1Z77A 3OIQA 5H6RA 5KVRA 3IL2A 3BPVA 3I3LA 3OYCA 2FJ1A 3HOWJ 3BTCA 1EJ9A 2VPLA 3L2VA 3HRMA 3MAJA 2KISA 2HEOA 4U0VA 3BJOA 2PJRB 1U9NA 4II2A 2ZCWA 3L7WA 2LP0A 2ZFUA 1FBSA 1PDNC 3TKYA 2Q8KA 5E3LA 3ZMZA 1Z05A 5HNHA 2BXYA 3GZ6A 1G2HA 4XLHA 1IXCA 3DKXA 4NBQA 2P5LC 3K1PA 4AVPA 3GFIA 1XDUA 3R60A 5GAGJ 3W3CA 2V9KA 1M1EB 3WGGA 2TDXA 3H1CA 1TTYA 3OYDA 2GIVA 4KICA 3CMAI 1R23A 3RSNA 1OCZH 2MD5A 2LY9A 4PDKA 2K9LA 4XN3A 4UV8A 1RC9A 4L5EA 5M3MJ 3C2GA 2H27A 2BHYA 4XBFA 1USTA 3KE2A 2EFOA 2ZMEA 4WK8F 2IS6A 1XG1A 1E3PA 3RKXA 2WBMA 2X51A 3BQYA 2NVXJ 5D8KB 5LGTA 1R9TJ 2BY3A 3W2VA 4HDVA 2H09A 3V8JA 5A2QK 2YPRA 2ZSIB 1S7EA 2UWMA 1UHWA 2DLLA 1IRXA 2V1NA 2YUSA 3JRGA 1RUNA 1ODDA 2JTVA 1KYWA 3CO6C 5E3NA 2EBIA 3G73A 4FASD 2Y9ZA 4E4HA 1ZGAA 3K1NA 1R4MB 2HGCA 2L4MA 1MMSA 3S2HJ 3DEEA 2EINH 4PZJA 3ECOA 2DA7A 3O6BB 1FTTA 1OCPA 1ONVA 3BJ6A 4ESJA 5FROA 1FTZA 2JMWA 2Q1ZB 4CYDA 1U8BA 2KZVA 1W5CC 2I8DA 3HSFA 4RAGA 4M9XA 2Z1DA 2M45A 3GZ5A 4AVZA 4L9NA 2PN6A 3DU6A 3EYYA 2BW3A 4XLAA 5ILVA 1MDMB 1QZZA 3HXLA 2L02A 2DJIA 1LKXA 1XMXA 4EJTA 3HL2A 5GTIC 1LDJA 3BOQA 3MN2A 2XB0X 2KIQA 2X6YA 2DXIA 2HDWA 3KP7A 5M3FJ 2STWA 3CCLI 3H3VK 5LGUA 4OU0A 1UCRA 1P4XA 2C6YA 1Y0NA 1IGNA 5DV5A 3GF2A 1OLTA 3CUQB 4JK1X 1WZ2A 1X1AA 2P4WA 4XKCA 1I1SA 4M71A 3J80K 3ZPLA 4L9JA 4MIMA 2EFPA 2Y75A 4DBQA 2FUG2 4PJLA 1TBXA 3F22A 5JFRA 5FKLA 3TGNA 2MABA 2WADA 3RKQA 5K5RA 4BY1J 4YIFA 1JI8A 4MLOA 4JX5A 2M8GX 3MD2A 3ISPA 3JSPA 5E79C 1XMAA 3S1QJ 2VIXA 1EKEA 1IG7A 2NVYJ 5GPCA 1XGMA 3BG7A 2E35A 5LHGA 5ILSA 2DQRA 1FJLA 1IAWA 2ZJPF 3ZQLA 3HOSA 2BVMA 5KNLA 3MCZA 1TP4A 2KIUA 1YQAA 2VXZA 2Z16A 3RPQA 1DPRA 3CCYA 1ZRDA 3DXJF 1N77A 3T8TA 4BEHB 3FXOA 4ZH4F 1K78B 3M1EA 2XPWA 1SMTA 4KT6A 3F0CA 2PBIA 4BL0B 2R7VA 4ZYHA 3E6CC 3CUQC 1A31A 1O7FA 3GUDA 5LRRA 4L0YB 5JLXA 2L54A 3U1KA 3PNTA 4RLFA 1WJCA 1A6IA 1ERDA 2KZGA 3BLYA 3IAS2 5TRDA 3F8BA 4NDLA 2BHZA 3BZKA 5CYVA 3B73A 3MMYB 4HF2A 3FXKA 3HM5A 5CKTA 4DOZA 1BR4A 1PP7U 3HKZA 3F72A 1R4NB 4D7NA 5HVQC 1J9IA 1G4DA 3BR6A 3FWEA 3HRTA 2CO5A 2PMUA 5CQGA 2P6TA 4N0BA 1SVOA 1FNNA 2DT6A 4F92B 2QBYA 3CD6I 4BJ6C 3P9CA 3BDDA 3P9IA 3H5RA 5LHHA 1JUSA 2LK2A 1XGOA 1JXSA 1FMVA 1VQLI 4DW6A 4JYKA 1LDKB 4EATA 2CUZA 3BCAA 3PUBA 1N75A 2Q2EB 2R7SA 1BIAA 2KP6A 2JVHA 2O8XA 2XF7A 5EEHA 1X1CA 5IP6A 3Q0WA 3ERED 2BE5F 3MKWB 2GOMA 2TCTA 4NQWB 1A5JA 1D0YA 1ETVA 4Q5SF 1I6XA 4LITA 1NG7A 1YE9A 2E19A 3KCCA 3OL3A 3DWLE 4YFNF 4Y33A 1UFMA 4G7OF 1QVUA 4HLYA 4M9ZA 2YSRA 4RGSA 1U5TB 4I0AA 2CS3A 4LOCA 3RZDJ 5DCMB 1D3YA 1QU3A 1X19A 1HXDA 3HYIA 3H0DA 1T56A 1FOKA 3KYCB 1OYWA 3S1NJ 3ABKH 4S04A 4F93B 4LIUA 1RETA 3KP4A 5BOXA 3WHCA 1K61A 4KIFA 4XQFA 2NVQJ 1P7IA 2V7FA 3OWTA 2HTJA 2ZNZA 1OISA 3OL4A 3IH2A 1HBXG 2YX7A 3TDZC 2K7LA 1HKQA 5IYDJ 4KT5C 2J5PA 2DMPA 2JA5J 3GYHX 1TLHB 2Z3YA 4ZYAA 5EG0A 1YS6A 3JAMZ 3NQOA 2L5QA 1TWHJ 1OKRA 3LA2A 1VQOI 2ZXJA 1ON2A 1Y39A 1XSDA 1X4OA 4YEJA 4M74A 3NRVA 5E1WA 4O5VA 2WB1A 4S0HB 1WHUA 1XC5A 3E0JB 2ZJ2A 2GQQA 1V54H 4EQQA 1A36A 3GO5A 4X0GA 5DUKA 3ECHA 3EDPA 3J7ZI 3HRUA 2OTJI 1OFCX 4I6ZA 4M9SA 2R3SA 5D6FA 2F5FA 1U5TC 3CUOA 4HA8A 2EV6A 4BY7J 5CVVA 2EZLA 3VODA 1FOYA 3CCUI 2DPUA 2XV4S 2JT1A 1O3TA 1B1BA 2E5ZA 3BPXA 3BC8A 1XDSA 3IH3A 4EV0A 5FFXA 4ENNA 3LFUA 4D7MA 2P6SA 3BP8A 1O57A 2OUMA 1FY7A 2DA3A 4M3DA 2QSFX 2IGOA 2FOWA 2L9NA 5FRNA 2WB1N 2OF7A 4IVNA 1N25A 5TGTA 5LRSA 1E0EA 4KIBA 3LSKA 4E7ZA 2E36A 4LLGF 3BTJA 2OBPA 3TMOA 4Y7NJ 1ETOA 1YITI 4UB8C 4E6KG 2UUZA 2V6CA 1FWZA 3CJTB 1JKRC 4W1UA 2W24A 2RQPA 1YW8A 1X1PA 3QAHA 5E3MA 4ZTJA 1SFUA 3HJEA 1GV2A 4BBSJ 1P4AA 2E2IJ 4KN4X 2MBFA 1TWCJ 2R7DA 4C30A 2KL4A 2L0KA 2WAQA 1F36A 2MW8A 1I39A 2JUGA 2VOPA 3NARA 5H2FC 5BS6A 1XN7A 2HI3A 1EF4A 2HZTA 5M5WJ 1D5VA 1Y1VJ 3RJPA 3ZR8X 3B6AA 3TO7A 4ZDPA 2QSGX 5E17F 3WU0A 2O0YA 4A69C 1BR2A 3D5SC 4OIPF 3H9GA 1GXQA 4K2EA 1ZK8A 2EZHA 1YJWI 4A5NA 1WFXA 1LQ1A 1YJNI 1B9MA 5J1UA 2G7HA 3SJMA 1J0RA 3CCMI 4UUVA 2AXTC 2R7XA 1HW5A 3PFIA 4I7HA 2CH0A 2FU4A 3S93A 2D5VA 2K85A 3LSIA 2IT0A 2JUCA 2M5WA 5IOYA 5IP9J 3ZQIA 4H4KC 4RAFA 1VF9A 1L0OC 1POGA 3Q9VA 2LY1A 5GADJ 4KUMA 1MKMA 1VFCA 2L3DA 4IF4A 3K4MA 4UUSB 2NRAC 2QQ9A 4V2FA 1S72I 3S15J 1MIJA 3F8MA 1EH6A 5C4JJ 1T0FC 3G1LA 3C1DA 5K7FA 5FLXZ 3V7SA 5FRMA 2MD0A 1DDNA 2G7UA 2HVQA 1MBJA 3SQNA 1K6YA 4BGDA 3OSGA 2VQHA 4AC0A 2V26A 1GV5A 3GZNB 2HU9A 1ULYA 5CVRA 3PFYA 2H1LA 2GA1A 2R5YB 3S8PA 2CQXA 3KETA 3DV8A 2ACJA 3RZOJ 1BN5A 3G4SI 4JOMA 4XICA 2IP2A 1W7PB 4HX7A 1USSA 5F1JA 2EIJH 1IN8A 3CJRB 3FDYA 4XLEA 3DU5A 4RM2A 4J01A 2Y0SN 3HOUJ 1X4PA 1JGGA 5JI6A 4BU2A 2XDVA 1VI0A 2LKPA 3OYNA 4E7IA 4HF0A 1BI1A 1G59A 1D1AA 2X1DA 4CHUA 4N9HA 3IKVA 1HDPA 4TV7A 4IHYA 5IOZA 4Z2YA 4BXFA 2DFEA 4CCKA 5LBQA 1AHDP 4YIIA 5HDKA 4U0YA 1XMKA 5KAFC 3C7JA 1D1CA 1MNDA 3OYKA 5CVJA 2RDPA 3KEQA 1ACIA 1LE8A 3HUGA 3OIOA 3CCQI 4HX8A 3C18A 3V4GA 4IJAA 6PAXA 2CWEA 4AIDA 5TJJA 4PFPA 3KP3A 3E3VA 2E1CA 1L3LA 3VYTB 3VEPA 1YIOA 2W85A 1G3YA 2F5DA 5IY5H 3CC7I 1Y56A 3ABLH 2JZYA 2XGCA 3FMQA 2LBFA 3FBIB 3ASOH 2LTPA 2XF5A 4YFXF 3I54A 4KMFA 1QHGA 2M87A 2F5CA 3I53A 2D1VA 4HRIA 3DCFA 3TBIA 2RVCA 4BBRJ 3JAMK 5D5UB 2X48A 2NVUB 1K7AA 2CQNA 3KEYA 4A3KJ 1ZG1A 1ZARA 4QLCU 4WXHA 1W36D 2FQ4A 4KN7X 4PSWA 4BYYA 1TT5B 1Z0XA 3P7NA 4D5FA 2KT0A 4CSWA 2VE9A
chains in the Genus database with same CATH topology
1YX5A 3CF2A 2W00A 2K9LA 2XSJC 4XN3A 4PJMA 3C2GA 2ELJA 3H5NA 2OC6A 3S3NA 1FMWA 2IS6A 2JSPA 4NNJA 2WBMA 2X85A 2X51A 3VSKA 4PFOA 2F5VA 3HPHA 2R7QA 4U7BA 3W2VA 2ZSIB 2UWMA 1IRXA 3IUOA 4IX7A 2V1NA 2A6TA 2VJJA 3OYLA 2CUJA 1LVKA 1SAUA 3K4LA 2KRCA 2XF6A 2CV0A 4RMNA 4BE2A 4FASD 4E4HA 3DTKA 1DGRM 3NWTA 1UAAA 4XR6A 2QKMB 3DEEA 3KYLA 4CH7A 4F3QA 5FROA 3L2RA 2Q1ZB 3RQ4A 2KZVA 2I8DA 4N4NB 3BCBA 2Z1DA 4AVZA 3DU6A 2UV1A 2BW3A 4XLAA 3L2UA 3CESA 3NWSA 3HXLA 3OS0A 2DJIA 1LKXA 1V5EA 3OMYA 2V6EA 4XONA 3HL2A 2IS1A 4XKVA 2X6YA 2DXIA 2HDWA 1WJEA 1VZ0A 3VYRB 4CZCA 1SFKA 2BOLA 4NUBA 3K4BA 3D5LA 3DPLC 3CMMA 1OLTA 3L2QA 1TT0A 3VWBA 1DP3A 3OS1A 4D9JA 1X1AA 2V4JC 2CMPA 4XOPA 3FHNA 3OYBA 3SYTA 4XKCA 4XNFA 4Y4RA 2IS2A 2K3PA 2VJ5A 4U87A 4DBQA 2R7TA 3QYFA 2FUG2 4PJLA 4GRIA 2HVRA 2MABA 2WADA 1G8XA 3ZGKA 1JI8A 2PJRA 4MLOA 3MD2A 4XORA 4ZDLA 1UELB 4HNTA 5KCMA 2VIXA 3LL7A 2VASA 3RTRA 2E1MB 1OR7C 3BG7A 4CCNA 4CCLA 2CW8A 1WJ5A 2KQRA 4HSTA 2K5CA 2K9MA 2HPMA 1BR1A 2MC4A 3HOSA 2BVMA 5KNLA 2VXZA 2Z16A 3OYIA 3OY9A 2WY7Q 2KPMA 1N77A 4XKBA 4BEHB 3HG9A 1WJFA 4KT6A 1R6RA 2R7UA 4CUGA 2CV1A 4BL0B 2R7VA 2WA0A 2HVSA 3OYEA 4XLFA 2BVLA 3PNTA 4RLFA 1WJCA 1ERDA 2CW7A 4II3A 3VYUB 3PSFA 5LD2C 2F4IA 3BLYA 3IAS2 3K4NA 3J7AY 2WAFA 2LH9A 4P5OA 3SZGA 1V5GA 3HOTA 3MMYB 3S3MA 3SEZA 4P1WA 5CKTA 4DOZA 3MKYB 1BR4A 4ZJZA 2E1MC 2VJIA 3AL0B 3HKZA 5CPRB 5HVQC 4CCOA 3K10A 4HPQA 4HG2A 2LBFB 4JQFA 5CQGA 2IGKA 1MMDA 2DT6A 4F92B 4BJ6C 4DJAA 4B47A 3QYEA 2ZSHB 3K4JA 1D1BA 3H5RA 1FMVA 4PJJA 3OYHA 1X1DA 4KITB 2IS4A 1WJDA 1PYVA 1LDKB 2NOJB 4EATA 4DBRA 2CUZA 3BCAA 3PUBA 1N75A 1Z3XA 2Q2EB 2R7SA 2VKDA 5HNFA 1Z21A 2KP6A 2JVHA 2XF7A 3OYJA 1QHHD 1X1CA 2RREA 3H5AA 3A1YA 3MKWB 2GOMA 2A5WA 4QPOA 4NQWB 1NG6A 4BE1A 1D0YA 1X1BA 3AFHA 4IQJA 2M4GA 1NG7A 4LITA 1YE9A 4C2UA 3OL3A 1V5FA 3DWLE 4Y33A 1ZELA 3OR2C 4N4OB 2IGMA 3M1CA 4R79A 4CA0A 4PSXA 1EA3A 2CS3A 4OAZA 3OIPA 3L2WA 1QU3A 3EPZA 4AYBA 1X19A 2CFOA 1HA8A 3H0DA 1UG0A 3AL0C 3VYSB 1YX3A 4BQOA 4IZZA 2Y0SA 4F93B 4LIUA 1S9HA 2X1CA 4D1QA 4XQFA 2V7FA 3OWTA 4E7KA 1AA7A 3OYGA 3OL4A 5HOOA 2GOXB 4XM3A 3DPUA 4ZYAA 2M0MA 4B48A 4IKFA 1KONA 2L5QA 2KHMA 2LRDA 2L7KA 3HPGA 1X4OA 4YEJA 4CCJA 4HNUA 2WB1A 2VQGA 4KISA 3EUAA 2QKLB 3E0JB 3H9QA 1WJBA 4XMYA 1Z3YA 4G6TB 2KMUA 3DLAA 2VKHA 4X0GA 2BW3B 2WAEA 4BQNA 3CZ6A 3U21A 1MMGA 5CQEA 3EUKL 4BQQA 4KJZA 3LSGA 4IQ4A 4BEHA 3F9KA 4DGWB 2VQCA 2HQAA 3K70C 3S3OA 4ZDOA 2E5ZA 3PNVA 3BC8A 3K70D 3S32A 3LFUA 4Y3OA 3FBNB 2OUMA 2HZDA 2DCEA 2AQFA 4PK4A 2LREA 2IGOA 3PL8A 2L9NA 5FRNA 4BDYA 5TGTA 1E0EA 3KX2A 2W1OA 1P9QC 3I9V2 3LSKA 4E7ZA 3CP2A 3GBGA 3PSIA 3TMOA 2VB6A 4NC7A 4OWRB 2M4KA 3RCOA 4E6KG 2W7NA 4RLQA 4XN0A 4DIQA 1WJAA 2UUZA 4BS9A 2R7WA 4E7LA 4BUPA 3HUGB 1Y6IA 1TZLA 3VDXA 4ZTJA 4HEA2 3CP8A 4BACA 1MMAA 1D0ZA 3W2WA 4C30A 2R7OA 2KL4A 1W36C 2WAQA 3BG6A 3H9JA 5KHDA 2JUGA 3DTIA 3ZXSA 2VQLA 3DPTA 3LSHA 1J09A 4XLCA 2IXSA 3ZR8X 4ZDPA 4E7JA 2O5RA 2X6XA 2VL8A 2PMZA 3QOEA 3QYBA 1BR2A 3D5SC 3AKZA 2DT7B 2LC2A 2LOOA 4F52A 3H9GA 4AU7A 2HNHA 3PJRA 1WFXA 2MFZA 3ZQQA 4ITVA 2VJ4A 3LSMA 4XKWA 3N05A 3A2KA 2R7XA 1MW7A 3S93A 5HLTA 2CH0A 4B43A 3LSIA 2L9SA 3EUHC 3TL4X 4H4KC 4LIVA 3V42A 3E1SA 4YRVA 2X1EA 2VXDA 2LY1A 3MKZA 2E5NA 3K4CA 3K4MA 2MYSA 2LG4A 3OS2A 4PJNA 4ZTFA 4ZC3A 2M7AA 4PUSA 3OR1C 4BDZA 1T0FC 1GLNA 5FRMA 2MD0A 4NC8A 2W4SA 4YELA 3DTEA 2HVQA 4ANJA 2XC7A 1K6YA 2XAUA 4RM3A 4BGDA 2VQHA 2HPIA 3RPUD 2CV2A 4XL9A 2V26A 1MNEA 2ZXHA 4B44A 3FKJA 3SDBA 2HU9A 4FETA 3PFYA 3S8PA 3VSLA 1T95A 2Z2SB 4QPQA 2R7RA 4E7SA 2KLOA 1PJRA 4F55A 4JOMA 1N78A 4C2TA 4BJTA 4J00A 3H35A 2W82A 3CJRB 3FDYA 3DQVC 3UNGC 4XLEA 3ONQA 3DU5A 3K4KA 2RNGA 4RM2A 4J01A 2DOAA 1X4PA 2M3AA 4XOTA 2KRHA 4BU2A 2XDVA 3CJQB 3OYNA 4E7IA 2P0WA 1G59A 1DGWY 3IP4B 1D1AA 4HSRA 1U0JA 4F91B 2VLAA 3G2BA 2R4GA 2X1DA 4OAYA 4C9YA 3M8JA 2F6CA 3ZRGA 3A4CA 3ZCOA 2KDOA 4BXFA 4CCKA 3DKYA 2LY2A 3PNYA 4E7HA 3OYKA 1D1CA 1MNDA 1DQUA 3OOUA 2L2OA 3OYFA 3OIQA 1D0XA 2E60A 3D5RC 3LMMA 4PFPA 3I3LA 3OYCA 4BJ5C 2JVGA 3IAM2 3HC7A 3VYTB 3L2VA 2VPLA 1Z7LA 2PJRB 1LFPA 3QODA 4II2A 1Y56A 2OV7A 5LFAA 2ZFUA 2LBFA 2LYCA 2IGNA 3FBIB 2XF5A 3W2AA 1QHGA 3C2HA 5HNHA 4HRIA 3TBIA 4LG3A 2ZXIA 3SEQA 4XLHA 3DKXA 3KEYA 4CCMA 3W3CA 2V9KA 2WY8Q 3K6GA 2JA2A 1W36D 4B3XA 2M7BA 2X6WA 4PSWA 2AQEA 3OYAA 3OYDA 1BOBA 3UR3C 2RQQA 3OYMA 4CSWA 4BE0A 3RSNA 1MMNA 5JHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QPQ A;  3OMY A;  1DP3 A;  4QPO A; 
#chains in the Genus database with same CATH topology
 1YX5 A;  3CF2 A;  4FX0 A;  3FXR A;  5GP9 A;  9ANT A;  4CYC B;  3HOV J;  2DU9 A;  5D5W B;  2ELJ A;  2LF7 A;  3OV8 A;  2OC6 A;  2LKX A;  1YW9 A;  1FMW A;  1R22 A;  1UHS A;  3IRR A;  4A3J J;  1Z6T A;  4WF2 A;  1BJZ A;  3VSK A;  2Y2Z A;  4PFO A;  1HC8 A;  3HPH A;  3KEO A;  4U7B A;  5E18 F;  4CO8 A;  1HQC A;  3RDI A;  1IXR C;  4EEF G;  1UB9 A;  3LSJ A;  3IUO A;  2OZ6 A;  1H8A C;  5EDN A;  1ZH5 A;  2EA2 A;  2KRC A;  1BW6 A;  2XF6 A;  2BXZ A;  1A6Q A;  4BE2 A;  3P9K A;  4QSH A;  2DA2 A;  2PMZ N;  3NWT A;  1UAA A;  4LG0 B;  4GCV A;  1J59 A;  5J4Y A;  2ISZ A;  3F6O A;  2JA8 J;  2OQR A;  3KYL A;  1GT0 C;  1IRG A;  5FKO A;  3CCV I;  3BR0 A;  4F3Q A;  4Q47 A;  1IN4 A;  3O8H A;  2Q0O A;  2DTR A;  2ECC A;  2JA6 J;  1AU7 A;  2CG4 A;  3KYD B;  5K5O A;  5FB2 A;  4P96 A;  3OS0 A;  2HFH A;  4A12 A;  3P5J A;  1W4M A;  3DEW A;  4IO9 F;  3CCR I;  2V6E A;  5KK1 A;  4AIJ A;  2HYG D;  2CJJ A;  4L0Z B;  2K9Q A;  2OQG A;  1IN6 A;  1IDZ A;  2DFI A;  3H3U A;  5JLW A;  1R5I D;  3FXQ A;  3WGI A;  1WJE A;  1BI0 A;  3CLQ A;  3G71 I;  3VYR B;  1QZE A;  3GTP J;  3R0J A;  4NUB A;  3W6J B;  2FEZ A;  2LSO A;  3D5L A;  2RN7 A;  3CMM A;  1FX7 A;  3L2Q A;  5JVG F;  2HQR A;  2F4M B;  3D0S A;  3ZN1 A;  1YTY A;  2XB5 A;  2IBD A;  3QU3 A;  1P7J A;  2Y31 A;  3SFI A;  3OYB A;  3T1B A;  2CQ7 A;  4M3B A;  4XNF A;  1RIO H;  3DEU A;  2IS2 A;  3QP6 A;  4U87 A;  3VPR A;  2Y30 A;  1BL0 A;  2Y0M A;  3ZQC A;  1B8I B;  1G8X A;  2WWY A;  2PJR A;  3ML6 A;  3EUH A;  4IHS A;  4Y13 A;  4ZDL A;  1W5T A;  3SHF A;  5E3O A;  4R8H A;  3LL7 A;  3BJA A;  2DT5 A;  3IRQ A;  4L9V A;  1KU7 A;  4RB0 A;  5FKK A;  1WJ5 A;  3L1P A;  3ESW B;  1RR7 A;  4XSX F;  5FLX K;  2PG4 A;  3OYI A;  2K27 A;  1PUF B;  3OY9 A;  1R5G A;  3TOB A;  1QGP A;  3IKT A;  1K79 A;  5CVI A;  3KLO A;  2MH2 A;  4D5C A;  2R7U A;  4CUG A;  5EGO B;  3LWF A;  3PO3 J;  4LLN A;  3RYR A;  2WA0 A;  2HVS A;  4PJ0 C;  4UNO A;  5GAE J;  2EH3 A;  1STZ A;  1OMI A;  2BVL A;  2DAO A;  1YFH A;  3B6C A;  2FSW A;  4MO7 A;  3DP7 A;  3WTY C;  2F4I A;  2PEX A;  1R00 A;  2LH9 A;  1VTN C;  3LST A;  3QPL A;  3R6S A;  3RKW A;  1YI2 I;  1GDT A;  2ID3 A;  1ZGJ A;  3MKY B;  1JTX A;  4HQM A;  3M7G A;  5CPR B;  4CCO A;  4MEY F;  5HS8 A;  1IV8 A;  4JQF A;  1MMD A;  1APL C;  4EGZ A;  1IUY A;  1MGT A;  3QYE A;  2ZSH B;  4EM1 A;  3HSR A;  3K4J A;  1D1B A;  2EIM H;  3FHZ A;  4KA4 A;  4PJJ A;  3OYH A;  1QRY A;  5FGM A;  2JRM A;  1X1D A;  4GXO A;  3F23 A;  5CJ9 A;  3AG4 H;  1G3T A;  1PYV A;  2NOJ B;  1U8R A;  3BY6 A;  2QF7 A;  1XPX A;  1Z3X A;  3BTL A;  1MJ9 A;  3I59 B;  4XLN F;  1JT0 A;  1MDM A;  4FTH A;  2RRE A;  3H5A A;  2A5W A;  5J47 A;  3I71 A;  4XSZ F;  3S1M J;  4IQJ A;  2M4G A;  2W48 A;  3WTX C;  3CC4 I;  2BYV E;  5FD5 A;  1G6N A;  1ZEL A;  2UZK A;  2K9N A;  3OR2 C;  1JHF A;  2IGM A;  2ZME B;  4N4O B;  4Y52 J;  4CA0 A;  4L5J A;  2GM4 A;  2CSO A;  3U9G A;  4C3I J;  2OTL I;  4EM2 A;  4A2U A;  3FK6 A;  4AYB A;  5F27 A;  1HA8 A;  4ZYE A;  1UG0 A;  4BQO A;  2VPR A;  2EJR A;  2FBI A;  3TW6 A;  1T8I A;  3LQQ A;  3GLX A;  1AKH A;  1AA7 A;  2A05 A;  4EM0 B;  2YU3 A;  2FNA A;  4LD5 A;  4A3M J;  2IAI A;  1JJ6 C;  1JTY A;  5ICF A;  2UXX A;  4HDU A;  2B0L A;  2L4A A;  3DPU A;  4XM3 A;  4G94 A;  1JE8 A;  3BG9 A;  3RIR A;  2M0M A;  1VQM I;  2NXN B;  4LJZ F;  3PM1 A;  1VQP I;  2ZJR F;  3DFG A;  1HSJ A;  3SXY A;  4U88 A;  1GXP A;  4HNU A;  1IJW C;  2DOF A;  3SZP A;  4KIS A;  3EUA A;  2QKL B;  1WJB A;  2MG4 A;  4G6Q A;  2FQ3 A;  4WXC A;  3LNQ A;  1Z3Y A;  2XAQ A;  3DLA A;  2AO9 A;  2BW3 B;  4JBA A;  3GTJ J;  2WAE A;  3AAF A;  2CUF A;  5C4X J;  1TW2 A;  1FT9 A;  3U21 A;  1MMG A;  2ZME C;  4BQQ A;  3PIP F;  4V19 K;  1WI3 A;  4I2O A;  2M1B A;  4JX6 A;  2VBX A;  4IQ4 A;  4BEH A;  4DGW B;  2VQC A;  2BZT A;  3PQK A;  3K70 C;  3S32 A;  3UKG A;  2OCE A;  3JRA A;  2FX0 A;  4MFE A;  2VBY A;  2FBK A;  4BXU A;  4M6Y A;  2AQF A;  1TQI A;  4PK4 A;  1C0W A;  3PL8 A;  3CQZ J;  3I4M J;  4ETS A;  3HIF A;  1P9Q C;  2DW4 A;  4A3C J;  4ESF A;  4MQV A;  1H9G A;  1XSX A;  3T0Y A;  3LA3 A;  4UXN A;  4ZZL A;  3TQN A;  2OZU A;  2VB6 A;  1XS9 A;  2VBW A;  2W7N A;  4RLQ A;  3WTV C;  2LNB A;  1SVM A;  4E7L A;  3HB9 A;  4BUP A;  2JK3 A;  1Y6I A;  3T8R A;  5F64 A;  5EZH A;  5BMZ A;  2IA0 A;  2GXA A;  2MGQ A;  3CP8 A;  4BAC A;  2FXA A;  3JRF A;  3CMY A;  3QPT A;  2EV0 A;  5D4S A;  1R71 A;  1D0Z A;  3BG3 A;  3W2W A;  2DOD A;  3J81 Z;  3VB2 A;  3R0A A;  1IUF A;  3HOX J;  2PLY A;  1K4S A;  5B66 C;  3BG6 A;  2X4H A;  5F04 A;  2L01 A;  2VQL A;  4XLC A;  1NK3 P;  3DBL B;  1FIA A;  1HW1 A;  2EFN A;  4XK4 A;  1MBG A;  2HQ5 A;  2ZNY A;  1FYL A;  3TED A;  1J7K A;  3BR1 A;  4OOI A;  3QYB A;  3EET A;  2DT7 B;  3AKZ A;  1ZQ3 P;  1U9O A;  2FBH A;  4IRI A;  1TNS A;  3M9A A;  4MTE A;  2ZC2 A;  2JRT A;  3ZQQ A;  1JKO C;  4M73 A;  1T33 A;  1CGP A;  3S14 J;  2VJ4 A;  3MWM A;  1K6O A;  5LLQ A;  3CME I;  3A2K A;  3NEU A;  4FT8 A;  5ED4 A;  1QZY A;  4IRH A;  1T2K A;  5F0C A;  4B43 A;  4HX4 A;  1LJ9 A;  3TL4 X;  4IOC F;  3V42 A;  4YRV A;  2I10 A;  2DYS H;  3HKZ N;  3M4O J;  3N4M A;  3I0T A;  3MKZ A;  2E5N A;  3M8E A;  3ABU A;  4FE7 A;  4DNC A;  2VC1 A;  5AON A;  1VQ8 I;  2HOS A;  2DFF A;  3A01 A;  2BY2 A;  2QBY B;  3ZQG A;  1AOY A;  4ZTF A;  3GLL A;  2V1D A;  3OR1 C;  2OCC H;  2V9P A;  2D1H A;  3L9F A;  4CGZ A;  2GZW A;  2A6E F;  5C44 J;  4HAM A;  1O7L A;  4NC8 A;  2W4S A;  1XD7 A;  1UMQ A;  2GXB A;  4A0Y A;  4ANJ A;  1Z91 A;  2XAU A;  3C2B A;  2ECB A;  3A0H C;  3RPU D;  5EZG A;  2CV2 A;  1VQK I;  5IT9 Z;  4EJW A;  4XL9 A;  2ETH A;  4D0P A;  4B44 A;  3FKJ A;  3CCS I;  3SDB A;  1BA5 A;  5M5X J;  5B3S H;  3VSL A;  3CJN A;  4FIS A;  1KQ0 A;  2HR3 A;  1SD6 A;  2EWN A;  2KRF A;  2P81 A;  4F55 A;  3DBH B;  1PP8 F;  5J3L A;  3SDG A;  4HQE A;  2I5U A;  4MQ9 F;  1SD7 A;  3DQV C;  2OPT A;  2QEN A;  1FZP B;  3JSO A;  2M3A A;  4XOT A;  5BNG A;  3RKY A;  5L3F A;  3CC2 I;  1I3A A;  4UV9 A;  4HSR A;  3C3W A;  2K4B A;  2VLA A;  3Q5F A;  3G2B A;  4OAY A;  2P5V A;  1FYM A;  3FM3 A;  1R7J A;  1W5S A;  2FOK A;  2J5O A;  3ZCO A;  5IYC J;  2ZXW H;  5BPD A;  4GO1 A;  1Y0U A;  5EG0 B;  2VON A;  2LY2 A;  1R1U A;  4XRS A;  2FD5 A;  4DYC A;  1DQU A;  1X2M A;  3QPH A;  4CXF A;  3K7A J;  1GUU A;  4RB2 C;  5F0H A;  2KJC A;  1ZGW A;  2E60 A;  2LDU A;  3D5R C;  1F9N A;  4A3B J;  2O61 A;  1U3E M;  3F8N A;  4AM3 A;  3IAM 2;  3HC7 A;  4P55 A;  1LFU P;  4UY8 I;  1G3S A;  2YX4 A;  3QOD A;  4BHB A;  2ELK A;  2OV7 A;  1T0F A;  3EYI A;  3WG9 A;  4HOB A;  3JRI A;  1JUP A;  2IGN A;  2L7F P;  3JCU C;  2DDB A;  2KFD A;  4LGW A;  1ETW A;  1TQM A;  1T6S A;  2DBB A;  1BJA A;  3RPU A;  1WSU A;  3K6G A;  2JA2 A;  3MZ8 A;  4HV5 A;  3WTZ A;  4B3X A;  4FE4 A;  2BV6 A;  3WTU C;  2X6W A;  3JRB A;  2JA7 J;  2AQE A;  1GHC A;  3OYA A;  2NS0 A;  2DO7 A;  4AIK A;  4P9F A;  4BQA A;  1BOB A;  3OYM A;  2VT2 A;  1OQY A;  2DTZ A;  1W0T A;  2HDD A;  2R5Z A;  4BE0 A;  1YRN B;  4EJU A;  5JHF A;  3V7C A;  1Y1W J;  4PJM A;  4A0Z A;  2M8E A;  3HTU A;  3ABT A;  2VUM J;  4A93 J;  3ZN0 A;  1SFO J;  1MD0 A;  3ABM H;  3I55 I;  1ZRC A;  3KP2 A;  1DU6 A;  2JSP A;  2JWT A;  3ROU A;  2R7Q A;  2CU7 A;  5DYM A;  4I02 A;  1I6H J;  3GX4 X;  2ICW G;  3LOC A;  4W97 A;  3CCJ I;  5DTD A;  2A6T A;  2WAQ N;  2VJJ A;  3OYL A;  3JRC A;  4IX7 A;  2ESH A;  2W25 A;  5HLH A;  1SAU A;  3E6M A;  3F21 A;  1FP1 D;  4RMN A;  3FM5 A;  1ZN2 A;  4G7Z F;  2M0C A;  3V8L A;  1BI2 A;  1DGR M;  1YJ9 I;  2HOA A;  4E70 A;  3G1O A;  4XR6 A;  1J2X A;  4IEJ A;  3VFZ A;  1MSF C;  1ZR2 A;  1IO2 A;  4MTD A;  4ENM A;  3LFK A;  3ZMD A;  5E20 A;  3RQ4 A;  3Q9S A;  4A0X A;  3KP6 A;  3MVP A;  2UV1 A;  3WTS C;  1WI9 A;  3J81 K;  3Q0U A;  2QQB A;  2DI3 A;  1XTA A;  2H94 A;  3BTI A;  4ABZ A;  4L5I A;  2E7X A;  1SMY F;  2NAZ A;  3HSE A;  3LSP A;  3M8F A;  1U78 A;  4BXX J;  3GFM A;  3BZ6 A;  2YS9 A;  1JJ8 C;  2GXG A;  3WG7 H;  4LMY A;  2HTS A;  4CZC A;  1ETK A;  2ZB9 A;  1SFK A;  4HYE A;  2BEO A;  3DPL C;  5EEA A;  3TO9 A;  3TDU C;  3VWB A;  3MKL A;  5DD8 A;  2D2W A;  2V4J C;  2CMP A;  4XOP A;  3SYT A;  2CYY A;  2K3P A;  2VJ5 A;  5EJC A;  2HDC A;  2L9R A;  2R7T A;  4MFD A;  1TQP A;  2LVS A;  2QM3 A;  4GRI A;  2L9V A;  1ON1 A;  1H9T A;  2HKO A;  4JP0 A;  2NNN A;  4O6J A;  3AG1 H;  3N97 A;  1TWG J;  2STT A;  2VAS A;  4KYW A;  1OR7 C;  2ZKZ A;  2COM A;  2K3F A;  2CW8 A;  3JTH A;  4HST A;  3REO A;  3W6K B;  4C3J J;  2HPM A;  2XKP A;  1KA8 A;  4X6A J;  1TNT A;  1VQN I;  2JQ7 A;  1ETY A;  2O8K A;  1XGN A;  5CLS A;  2WY7 Q;  2H8W A;  2KPM A;  1RZ4 A;  5K1Y A;  3KP5 A;  5IT9 K;  2FNP A;  1TC3 C;  1MSE C;  1R6R A;  2Z99 A;  4MHG A;  2CQK A;  3Q0V A;  1YG2 A;  1RRJ A;  1LEB A;  1Y8R B;  2ADU A;  5D6E A;  5GTH C;  3GTM J;  5J8F A;  4XLF A;  1HST A;  4UVC A;  1FOW A;  2CW7 A;  2OA4 A;  2DK8 A;  3T5X A;  2Z5U A;  3PSF A;  3F8F A;  2BY1 A;  3J7A Y;  2WAF A;  3TW7 A;  4CIC A;  5FO5 A;  4FHT A;  1VQ7 I;  1F1Z A;  2VOO A;  3HOT A;  2M34 A;  4C3H J;  4DQ2 A;  3S3M A;  2ME0 A;  4GYI A;  3CDL A;  2JPB A;  3NAU A;  3QRF F;  3DBR B;  2GLO A;  2WV0 A;  4ZJZ A;  1ZTR A;  3HHG A;  2DMQ A;  4V2G A;  1Q1V A;  1LNW A;  4HPQ A;  1SD4 A;  2LBF B;  4LG0 A;  2IGK A;  4IXA A;  3CDH A;  1I1G A;  2HYJ A;  4OMZ A;  3WTT C;  4B47 A;  2A69 F;  1QPI A;  2LD5 A;  1H89 C;  1WKM A;  2PX9 A;  3HRS A;  3E7L A;  3S2D J;  5HS7 A;  2CGP A;  4IRG A;  3J7Y J;  2QLZ A;  2ZO4 A;  4KIT B;  1LB2 A;  3M3Y J;  2IS4 A;  3HTS B;  2QQ8 A;  3K2Z A;  4DBR A;  3TP3 A;  2E7W A;  4FX4 A;  4HLX A;  1ZKG A;  1VQ9 I;  2G0E A;  2RNJ A;  2VKD A;  5HNF A;  3WU2 C;  2XGX A;  1Z21 A;  2M2E A;  2XIG A;  3OYJ A;  3A1Y A;  3FX3 A;  4ZYD A;  2B7E A;  2DA5 A;  2XRN A;  4BE1 A;  1WH7 A;  2DMN A;  2V1U A;  4XLP F;  1RI7 A;  4PGG A;  3M1C A;  4R79 A;  4MNU A;  1WQ2 A;  4EJV A;  1V3F A;  2AHQ A;  3OIP A;  5ICG A;  3L2W A;  2B63 J;  2LKS A;  2DN0 A;  3GEZ A;  5DEQ A;  4CZZ A;  3EPZ A;  2CFO A;  2E1O A;  2Y69 H;  4IL6 C;  3WTW C;  3VYS B;  3RYP A;  1YX3 A;  1LFB A;  1Y8Q B;  4D1Q A;  1S3J A;  2CRG A;  4ZZD A;  3MFK A;  2ELH A;  1QNT A;  3Q3S A;  5J6X A;  3OYG A;  4KDP A;  4LK0 F;  2Z33 A;  3LAJ A;  2H6B A;  5LEK A;  5HOO A;  1MH4 A;  2MLK A;  4F7Z A;  2EB7 A;  5E8I A;  1WH5 A;  1OCT C;  3K1M A;  2X9D A;  1VND A;  5L3D A;  1CF7 B;  4B09 A;  3BG5 A;  3K2A A;  1ZG3 A;  4B48 A;  1O4X A;  3FXM A;  2KHM A;  2DYR H;  2K40 A;  2ZJQ F;  2DA1 A;  4RS8 A;  5EEG A;  4WWC A;  1JT6 A;  2W84 A;  3H9Q A;  2BGC A;  1RNL A;  2O03 A;  2CW0 F;  4XMY A;  5B1A H;  1SEU A;  4DYQ A;  4G6T B;  5L3G A;  2KMU A;  2M9H A;  5FKN A;  5B1B H;  1YW7 A;  3CZ6 A;  3QOP A;  1KU2 A;  1T98 A;  4KJZ A;  3QU6 A;  2PJP A;  1X3U A;  4DZJ A;  1VQ5 I;  3WE3 A;  2GBY A;  1B72 B;  3F9K A;  3H36 A;  2EIK H;  4BKX A;  1XCV A;  2RAE A;  1FBQ A;  3AG3 H;  3GFL A;  3S3O A;  2EIL H;  5EGO A;  3BWG A;  4ZDO A;  3PNV A;  1I50 J;  3K70 D;  5D5V B;  1E3O C;  1R5H A;  2DOE A;  1Q1H A;  4Y3O A;  3FBN B;  1D8K A;  3E97 A;  1ITY A;  4A6E A;  4A3F J;  2DCE A;  3ZQF A;  5ILU A;  2HS5 A;  3FXL A;  3KZI C;  3KX2 A;  3I9V 2;  2R0Q C;  2OJE D;  3CP2 A;  1OYY A;  2XGD A;  3KIO A;  1MBH A;  2PMH A;  4M3F A;  4B3A A;  3GBG A;  3PSI A;  3GTL J;  4NC7 A;  5BQT A;  3ERM A;  3RCO A;  1FSH A;  4J19 A;  1TWF J;  3SFZ A;  4XN0 A;  1WJA A;  2A61 A;  2BBY A;  5DCF A;  3TP0 A;  2LF8 A;  2R7W A;  1WGX A;  5EYR A;  2H8R A;  3H0G J;  1MNM C;  3F3X A;  3KZZ A;  2XRL A;  4HEA 2;  4RAY A;  1MJB A;  1SD5 A;  2CQQ A;  3PQJ A;  4Y15 A;  5L3E A;  1GVJ A;  3KLN A;  2R7O A;  5IP7 J;  1BBY A;  1W36 C;  3FZV A;  1ZLJ A;  3ZXS A;  3DPT A;  1BC7 C;  1B4A A;  3E5X A;  3LSH A;  1J09 A;  1I5Z A;  5HDG A;  3I59 A;  4E7J A;  4N9I A;  4IHT A;  2VL8 A;  3BR2 A;  2F5E A;  2QYO A;  1HCR A;  1B9N A;  3ZMV A;  5JVT A;  1JUM A;  2E34 A;  1MH3 A;  2LC2 A;  3GVA A;  5L3C A;  2HNH A;  4XRS G;  1TWA J;  3PJR A;  1UHM A;  1ENH A;  3KFW X;  1X58 A;  2B9S A;  2MFZ A;  1YLF A;  1JGS A;  1DP7 P;  1WCM J;  1FYK A;  3LSM A;  5ICC A;  3LQR A;  3WHB A;  1MW7 A;  2DA4 A;  5IT3 A;  3MQ0 A;  2COB A;  2JPC A;  3A03 A;  5E1X A;  2L9S A;  3U2R A;  3JRH A;  3EUH C;  1KQ9 A;  3ELK A;  1RES A;  4LIV A;  4A5M A;  4RB1 A;  1LVA A;  3E1S A;  2X1E A;  3I56 I;  3FIS A;  4NB5 A;  5JR3 A;  4EGY A;  4OIO F;  1QPM A;  2WV1 A;  3L00 A;  3OS2 A;  3I5U A;  5JHU A;  1YOV B;  2K02 A;  5IYB J;  1JKP C;  1IDY A;  2UXN A;  4IHW A;  2FML A;  4PUS A;  2IA2 A;  1NK2 P;  4BDZ A;  3OSF A;  3FKI J;  3CUQ A;  1SAN A;  1BC8 C;  2MSY A;  3LA7 A;  2E2H J;  2YU9 J;  3HBL A;  2A07 F;  2HPI A;  3GTO J;  4G12 A;  2QA4 I;  1E17 A;  3ZMU A;  1MNE A;  2ZXH A;  3IV5 A;  3S1R J;  2VKE A;  1LUJ B;  1BOA A;  2IEK A;  5J4V A;  2XPV A;  3H3Z A;  4WCG A;  1RKW A;  2R7R A;  4E7S A;  3CLO A;  2HKX A;  2KLO A;  4BHC A;  2E2J J;  5FKM A;  1HW2 A;  2DJN A;  4C2T A;  1ETQ A;  2W82 A;  2P8T A;  4IPA A;  4AYB N;  2IVM A;  1Z9C A;  2X0L A;  4LK1 F;  4EJO A;  3PO2 J;  4I01 A;  1QBJ A;  1MBE A;  3K4K A;  2RNG A;  2DOA A;  3E5Q A;  2IA1 A;  2HYF A;  2O3F A;  5HOD A;  2R7F A;  1KQ8 A;  1K78 A;  1LEA A;  2P0W A;  1AKH B;  1P4W A;  1IN7 A;  3BQZ A;  2L7M P;  4I99 C;  3LSR A;  4C9Y A;  5TIS C;  2F6C A;  3ZRG A;  3A4C A;  1DUX C;  1AWC A;  3K69 A;  1Z7U A;  4A3I J;  3DKY A;  1IW7 F;  4E7H A;  3PIO F;  1KU9 A;  1UG2 A;  4B1R A;  1ZRE A;  4NHJ A;  2L2O A;  4HF1 A;  3FIW A;  3OYF A;  2QVO A;  3HZJ A;  1S8N A;  3GTQ J;  1IF1 A;  2VT3 A;  1D0X A;  3TO6 A;  2Y48 A;  3LMM A;  2AS5 F;  1FLI A;  3JR9 A;  5LEJ A;  3WE2 A;  3I4P A;  3SZT A;  2JVG A;  4BJ5 C;  4A3E J;  4LB6 B;  2NS8 A;  1R58 A;  4KMU X;  3WOD F;  1Z7L A;  3IWF A;  3V8K A;  1YHQ I;  1LFP A;  5LFA A;  1PVE A;  1X2N A;  2LYC A;  2PQ8 A;  3W2A A;  2BY0 A;  2F48 A;  3C2H A;  5DUI A;  4LG3 A;  2ZXI A;  3SEQ A;  1QQI A;  2EA4 A;  3FXJ A;  1WPK A;  4CCM A;  1NH3 A;  1E2X A;  2WY8 Q;  2M7B A;  3BR3 A;  1FPQ A;  3DF8 A;  2XVC A;  2FF4 A;  3VOE A;  1S6L A;  2Q2E A;  4HZF A;  4I98 B;  3UR3 C;  3LAP A;  2RQQ A;  3CTA A;  4M6X A;  1PUE E;  3G1M A;  5D8L B;  5F1R A;  4RB3 C;  4O3M A;  1MMN A;  1FP2 A;  3X2Q H;  5LD2 C;  2W00 A;  2XSJ C;  4NQW A;  1FBU A;  2RC4 A;  3HOY J;  5DM7 F;  4XRF A;  1B59 A;  4BH9 A;  3H5N A;  5J1R A;  3S17 J;  3JRD A;  1J75 A;  1P92 A;  3S3N A;  1U5T A;  3BZC A;  4NNJ A;  5DCM A;  5F0F A;  2X85 A;  1XGS A;  2F5V A;  4Q48 A;  3ZMT A;  1ZYR F;  2P7C B;  2HXO A;  1H0M A;  5BPI A;  4DYR A;  5H20 A;  2HQN A;  1ZG5 A;  1YO5 C;  2CUJ A;  1LVK A;  4RDU A;  2XAJ A;  1RKT A;  2G9W A;  1YIJ I;  3K4L A;  2EV5 A;  2KIF A;  2QZ8 A;  2E1N A;  2CV0 A;  2PFB A;  1D8J A;  1OCR H;  5DDG A;  3DTK A;  2NS7 A;  1Z6R A;  2JN6 A;  5ICE A;  2OAZ A;  2DDA A;  1HKS A;  2QKM B;  5FFZ A;  4CDG A;  2H6C A;  4CH7 A;  3ASN H;  3A02 A;  4KNY A;  4ESB A;  5M5Y J;  5HLI A;  3L2R A;  4DZP A;  5HLG A;  4PCQ A;  4N4N B;  3BCB A;  2XSD C;  2QCO A;  4WX9 A;  2EQR A;  3L2U A;  4U7D A;  4Q4Z F;  1T08 B;  3CES A;  3NWS A;  4MEX F;  2VKV A;  2IRF G;  1FC3 A;  5J40 A;  2FRH A;  1HF0 A;  2MH9 A;  4HV6 A;  1V5E A;  3OMY A;  4XON A;  4MGR A;  4L9T A;  2D45 A;  2IS1 A;  4XKV A;  2DK5 A;  1S7A A;  2VE8 A;  1JHH A;  5HDN A;  2XAG A;  3L2C A;  1R1T A;  2DMU A;  4ON0 A;  4OMY A;  4OIR F;  2HXI A;  2JJ7 A;  3FK7 A;  2F4O B;  1VZ0 A;  1ZRF A;  3A01 B;  2BOL A;  3FXU A;  1SVL A;  1OCC H;  2M30 A;  1Z1D A;  3K4B A;  1FIP A;  5GPA A;  1QA6 A;  4I76 A;  2XAF A;  1TT0 A;  2RV8 A;  4UUT A;  1DP3 A;  3OS1 A;  4D9J A;  3TOA A;  2VOD A;  3FHN A;  1S7O A;  2XUB A;  4Y4R A;  1FOX A;  4AIH A;  3QYF A;  3QQA A;  1YS7 A;  2HVR A;  4OIQ F;  5K7H A;  3ZGK A;  4KIG A;  3BR5 A;  3AG2 H;  4ENJ A;  1NHA A;  1I27 A;  4UVB A;  4XOR A;  1UEL B;  2WTE A;  2EZI A;  3KPH A;  4HNT A;  1F5T A;  1YYV A;  5KCM A;  4BAY A;  1J5Y A;  4GYG A;  3RTR A;  2E1M B;  4BNC A;  4LB5 A;  2R92 J;  4G9Y A;  2Y9Y A;  3FMR A;  4CCN A;  4CCL A;  2KQR A;  1UJ8 A;  2GIZ A;  1IN5 A;  2K5C A;  2K9M A;  3GCM A;  5FJ8 J;  1BR1 A;  4GDF A;  5K5Q A;  2MC4 A;  3O3K A;  4XRM A;  3EQL F;  4QTR A;  2NYX A;  1W7P D;  3IC7 A;  5H6Q A;  3QPS A;  5LHI A;  2OU2 A;  4XKB A;  3HG9 A;  1WJF A;  2P7V B;  1QVT A;  3IH4 A;  1YRN A;  1UZC A;  2CV1 A;  5DS9 A;  3CCE I;  3IHU A;  2DQL A;  2R7Z J;  3OYE A;  2EFW A;  2A3S A;  5D4R A;  4YG2 F;  2V79 A;  5IPA A;  1ZAO A;  4JX4 A;  4U0W A;  1SFE A;  3JRE A;  4II3 A;  3VYU B;  3K4N A;  1SAX A;  2ISY A;  2CFX A;  4RGR A;  4P5O A;  4AD9 A;  3SZG A;  1V5G A;  2NVT J;  3U1D A;  2W57 A;  2FMY A;  2XRO A;  3SEZ A;  4A6D A;  4P1W A;  3O2P E;  2LR8 A;  1XB4 A;  3GTK J;  1WRJ A;  2E1M C;  2VJI A;  3RQI A;  3AL0 B;  3F6V A;  2ME6 A;  3QWL A;  1IRF A;  4UUS A;  3K10 A;  4HG2 A;  3S16 J;  2QUF A;  2K86 A;  3K9T A;  4I09 A;  4DJA A;  3CO7 C;  2VC0 A;  1IXS B;  3FMS A;  2FE3 A;  2O9L A;  2R93 J;  2MLG A;  1I3Q J;  1IZ1 A;  2QGU A;  1BW5 A;  1OCO H;  1U6G A;  2TRT A;  1K4T A;  3GFJ A;  1WJD A;  4IHV A;  3HDD A;  2Z9O A;  4RGU A;  4YFK F;  1IV6 A;  2DPD A;  1RPW A;  2MA3 A;  1QHH D;  1OR7 A;  2R5Y A;  2R5Z B;  2DA6 A;  1T38 A;  1CQT A;  2NNY A;  4QPO A;  1NG6 A;  2ZFW A;  1X1B A;  3AFH A;  3COA C;  4C2U A;  3S2W A;  1V5F A;  3I4N J;  1W7P A;  3ZOB A;  2RGV A;  3ZMS A;  2K9S A;  4PSX A;  1BI3 A;  1EA3 A;  3GW2 A;  4OAZ A;  2V9V A;  1KYZ A;  3JW4 A;  1MBF A;  5CVU A;  2XAS A;  1WVR A;  3R61 A;  3MZH A;  2XKO A;  5E1Z B;  2MC3 A;  5L3B A;  2EFQ A;  3HEF A;  2A5Y B;  3ZP5 A;  4L18 B;  3AL0 C;  4IZZ A;  2Y0S A;  1R36 A;  3ZQH A;  1S9H A;  2X1C A;  2V1X A;  2RKH A;  2HWV A;  1F43 A;  3L09 A;  1K83 J;  4E7K A;  2A6H F;  1OJL A;  4GFB A;  4FCY A;  3GTG J;  2GOX B;  4X1E A;  4IKF A;  1KON A;  1OPC A;  2LRD A;  2XHK A;  2L7K A;  3HPG A;  1Z67 A;  4CCJ A;  1LPQ A;  1HLV A;  2E71 A;  1R1V A;  1MBK A;  2VQG A;  1NTC A;  4RBO A;  4AUX A;  2KJB A;  4HNV A;  2VKH A;  3FF5 A;  1XSV A;  5D5X B;  1FEX A;  1P6R A;  2KKO A;  4BQN A;  2LFB A;  5FLM J;  3A0B C;  2QWW A;  5CQE A;  3EUK L;  5F08 A;  4EMS A;  3LSG A;  2XAH A;  4OIN F;  1IC8 A;  2XGE A;  3DLL F;  3W6V A;  4M6V A;  4KFC A;  2HQA A;  1O3R A;  4QWQ A;  5KAI C;  1HOM A;  2LLK A;  2WC2 A;  3H92 A;  2HOT A;  2KIM A;  3F8C A;  2O6G E;  5A2Q Z;  2JSC A;  4A3D J;  3I64 A;  1HDD C;  2HZD A;  1BM9 A;  5C3E J;  2K4J A;  4UVA A;  2LRE A;  1X3Z B;  1KU3 A;  4BDY A;  1QO0 D;  3OOP A;  4ZYG A;  4XID A;  2W1O A;  3E5U A;  2A68 F;  3KZY A;  2IW5 A;  3E6B A;  4FQG A;  1B6A A;  4RGX A;  1SC7 A;  4B8X A;  4CYC A;  2EK5 A;  4OWR B;  2M4K A;  5GAH J;  1VQ6 I;  3HGY A;  2YR2 A;  4NC6 A;  2X6O A;  5DD4 A;  4DIQ A;  3K0L A;  1ETX A;  4BS9 A;  3G6E I;  3G3Z A;  1MZB A;  1LE8 B;  3HUG B;  1F4K A;  4G8X A;  1TZL A;  2CUE A;  2XPU A;  3VDX A;  1IRZ A;  4IHX A;  3I58 A;  1X3W B;  4R1H A;  4EVI A;  4HBL A;  3RI4 A;  1OYI A;  1RUO A;  3D1N I;  1ORK A;  1MMA A;  4UB6 C;  2H1K A;  4HW0 A;  5AIQ A;  1H88 C;  3GWZ A;  4ENK A;  1U2W A;  1V55 H;  2GAU A;  3H9J A;  5E8G A;  4Z6Y A;  5KHD A;  5FLV A;  3DTI A;  2VN2 A;  1V4R A;  2AXL A;  3V7R A;  5FD6 A;  2O7O A;  2IJL A;  2IXS A;  3WGH A;  1S5L C;  2ESN A;  1T39 A;  1R49 A;  1A04 A;  1A35 A;  4S05 A;  2O5R A;  2X6X A;  2PMZ A;  3GME A;  5DM6 F;  2PI0 A;  3QOE A;  3IWZ A;  1REP C;  2LOO A;  3ULQ B;  4F52 A;  4AU7 A;  2L7Z A;  2ZBK A;  5J8C A;  5LGN A;  2ID6 A;  3WU1 B;  3E6D A;  2GA2 A;  4ITV A;  4UHT A;  5AIP A;  5K7Z A;  1P2F A;  2QEX I;  3O8G A;  2EPF A;  4XKW A;  3N05 A;  2F2E A;  2EZK A;  5HLT A;  3J80 Z;  4GGG A;  1EH7 A;  4LLL A;  1RR8 C;  1FSE A;  1KGS A;  2HOE A;  2VXD A;  3M07 A;  4YIR X;  5F6F A;  2KDZ A;  3K4C A;  1EV7 A;  2QQA A;  2MYS A;  2LG4 A;  3B02 A;  1CF7 A;  3J7A O;  2DFH A;  4PJN A;  5HS9 A;  1DU0 A;  4ZC3 A;  2M7A A;  1ZHF A;  4A3G J;  4AWX B;  4LFU A;  1GLN A;  2LMD A;  4YEL A;  2P5K A;  1S29 A;  3HGG A;  3DTE A;  2XC7 A;  5ERI A;  4RM3 A;  1E3H A;  3PUF A;  1ZR4 A;  1W0U A;  1BIB A;  4Y17 A;  1B8I A;  4A3L J;  3DKW A;  4FET A;  1G3W A;  2VBZ A;  5B5E C;  1T95 A;  1O3Q A;  2Z2S B;  4M3G A;  1VQ4 I;  4QPQ A;  2N8G A;  3MZY A;  1HKT A;  1W1W E;  1PJR A;  3MEX A;  3ZQ7 A;  1B72 A;  4IOA F;  3JTG A;  4C2M J;  1N78 A;  1TW3 A;  4BJT A;  3R4K A;  2VI6 A;  4RAZ A;  4J00 A;  2QSH X;  3H35 A;  1SFX A;  4WXD A;  3BRO A;  3HHH A;  3UNG C;  3CDI A;  3CF5 F;  3ONQ A;  4ASN A;  1EH8 A;  1D5Y A;  2DMT A;  4RA2 A;  4M3E A;  3HOZ J;  1MJA A;  1PUF A;  1LDD A;  2KRH A;  4QIW N;  3CJQ B;  1JKQ C;  1XCB A;  1TL8 A;  2NOG A;  3QP5 A;  1DGW Y;  3IP4 B;  1O3S A;  4I0B A;  1XX5 A;  1U0J A;  4F91 B;  2R4G A;  3BT9 A;  1KZH A;  2IPQ X;  3M8J A;  4B4C A;  2OD5 A;  2KDO A;  1WWX A;  4PGH A;  3PNY A;  4G7H F;  5EF6 A;  3GXO A;  4P9U A;  1ZLK A;  3OOU A;  1DPU A;  4BHP A;  4H0E A;  1GVD A;  5J1Y A;  4M72 A;  2GWR A;  4G6D A;  2FA5 A;  1Z77 A;  3OIQ A;  5H6R A;  5KVR A;  3IL2 A;  3BPV A;  3I3L A;  3OYC A;  2FJ1 A;  3HOW J;  3BTC A;  1EJ9 A;  2VPL A;  3L2V A;  3HRM A;  3MAJ A;  2KIS A;  2HEO A;  4U0V A;  3BJO A;  2PJR B;  1U9N A;  4II2 A;  2ZCW A;  3L7W A;  2LP0 A;  2ZFU A;  1FBS A;  1PDN C;  3TKY A;  2Q8K A;  5E3L A;  3ZMZ A;  1Z05 A;  5HNH A;  2BXY A;  3GZ6 A;  1G2H A;  4XLH A;  1IXC A;  3DKX A;  4NBQ A;  2P5L C;  3K1P A;  4AVP A;  3GFI A;  1XDU A;  3R60 A;  5GAG J;  3W3C A;  2V9K A;  1M1E B;  3WGG A;  2TDX A;  3H1C A;  1TTY A;  3OYD A;  2GIV A;  4KIC A;  3CMA I;  1R23 A;  3RSN A;  1OCZ H;  2MD5 A;  2LY9 A;  4PDK A;  2K9L A;  4XN3 A;  4UV8 A;  1RC9 A;  4L5E A;  5M3M J;  3C2G A;  2H27 A;  2BHY A;  4XBF A;  1UST A;  3KE2 A;  2EFO A;  2ZME A;  4WK8 F;  2IS6 A;  1XG1 A;  1E3P A;  3RKX A;  2WBM A;  2X51 A;  3BQY A;  2NVX J;  5D8K B;  5LGT A;  1R9T J;  2BY3 A;  3W2V A;  4HDV A;  2H09 A;  3V8J A;  5A2Q K;  2YPR A;  2ZSI B;  1S7E A;  2UWM A;  1UHW A;  2DLL A;  1IRX A;  2V1N A;  2YUS A;  3JRG A;  1RUN A;  1ODD A;  2JTV A;  1KYW A;  3CO6 C;  5E3N A;  2EBI A;  3G73 A;  4FAS D;  2Y9Z A;  4E4H A;  1ZGA A;  3K1N A;  1R4M B;  2HGC A;  2L4M A;  1MMS A;  3S2H J;  3DEE A;  2EIN H;  4PZJ A;  3ECO A;  2DA7 A;  3O6B B;  1FTT A;  1OCP A;  1ONV A;  3BJ6 A;  4ESJ A;  5FRO A;  1FTZ A;  2JMW A;  2Q1Z B;  4CYD A;  1U8B A;  2KZV A;  1W5C C;  2I8D A;  3HSF A;  4RAG A;  4M9X A;  2Z1D A;  2M45 A;  3GZ5 A;  4AVZ A;  4L9N A;  2PN6 A;  3DU6 A;  3EYY A;  2BW3 A;  4XLA A;  5ILV A;  1MDM B;  1QZZ A;  3HXL A;  2L02 A;  2DJI A;  1LKX A;  1XMX A;  4EJT A;  3HL2 A;  5GTI C;  1LDJ A;  3BOQ A;  3MN2 A;  2XB0 X;  2KIQ A;  2X6Y A;  2DXI A;  2HDW A;  3KP7 A;  5M3F J;  2STW A;  3CCL I;  3H3V K;  5LGU A;  4OU0 A;  1UCR A;  1P4X A;  2C6Y A;  1Y0N A;  1IGN A;  5DV5 A;  3GF2 A;  1OLT A;  3CUQ B;  4JK1 X;  1WZ2 A;  1X1A A;  2P4W A;  4XKC A;  1I1S A;  4M71 A;  3J80 K;  3ZPL A;  4L9J A;  4MIM A;  2EFP A;  2Y75 A;  4DBQ A;  2FUG 2;  4PJL A;  1TBX A;  3F22 A;  5JFR A;  5FKL A;  3TGN A;  2MAB A;  2WAD A;  3RKQ A;  5K5R A;  4BY1 J;  4YIF A;  1JI8 A;  4MLO A;  4JX5 A;  2M8G X;  3MD2 A;  3ISP A;  3JSP A;  5E79 C;  1XMA A;  3S1Q J;  2VIX A;  1EKE A;  1IG7 A;  2NVY J;  5GPC A;  1XGM A;  3BG7 A;  2E35 A;  5LHG A;  5ILS A;  2DQR A;  1FJL A;  1IAW A;  2ZJP F;  3ZQL A;  3HOS A;  2BVM A;  5KNL A;  3MCZ A;  1TP4 A;  2KIU A;  1YQA A;  2VXZ A;  2Z16 A;  3RPQ A;  1DPR A;  3CCY A;  1ZRD A;  3DXJ F;  1N77 A;  3T8T A;  4BEH B;  3FXO A;  4ZH4 F;  1K78 B;  3M1E A;  2XPW A;  1SMT A;  4KT6 A;  3F0C A;  2PBI A;  4BL0 B;  2R7V A;  4ZYH A;  3E6C C;  3CUQ C;  1A31 A;  1O7F A;  3GUD A;  5LRR A;  4L0Y B;  5JLX A;  2L54 A;  3U1K A;  3PNT A;  4RLF A;  1WJC A;  1A6I A;  1ERD A;  2KZG A;  3BLY A;  3IAS 2;  5TRD A;  3F8B A;  4NDL A;  2BHZ A;  3BZK A;  5CYV A;  3B73 A;  3MMY B;  4HF2 A;  3FXK A;  3HM5 A;  5CKT A;  4DOZ A;  1BR4 A;  1PP7 U;  3HKZ A;  3F72 A;  1R4N B;  4D7N A;  5HVQ C;  1J9I A;  1G4D A;  3BR6 A;  3FWE A;  3HRT A;  2CO5 A;  2PMU A;  5CQG A;  2P6T A;  4N0B A;  1SVO A;  1FNN A;  2DT6 A;  4F92 B;  2QBY A;  3CD6 I;  4BJ6 C;  3P9C A;  3BDD A;  3P9I A;  3H5R A;  5LHH A;  1JUS A;  2LK2 A;  1XGO A;  1JXS A;  1FMV A;  1VQL I;  4DW6 A;  4JYK A;  1LDK B;  4EAT A;  2CUZ A;  3BCA A;  3PUB A;  1N75 A;  2Q2E B;  2R7S A;  1BIA A;  2KP6 A;  2JVH A;  2O8X A;  2XF7 A;  5EEH A;  1X1C A;  5IP6 A;  3Q0W A;  3ERE D;  2BE5 F;  3MKW B;  2GOM A;  2TCT A;  4NQW B;  1A5J A;  1D0Y A;  1ETV A;  4Q5S F;  1I6X A;  4LIT A;  1NG7 A;  1YE9 A;  2E19 A;  3KCC A;  3OL3 A;  3DWL E;  4YFN F;  4Y33 A;  1UFM A;  4G7O F;  1QVU A;  4HLY A;  4M9Z A;  2YSR A;  4RGS A;  1U5T B;  4I0A A;  2CS3 A;  4LOC A;  3RZD J;  5DCM B;  1D3Y A;  1QU3 A;  1X19 A;  1HXD A;  3HYI A;  3H0D A;  1T56 A;  1FOK A;  3KYC B;  1OYW A;  3S1N J;  3ABK H;  4S04 A;  4F93 B;  4LIU A;  1RET A;  3KP4 A;  5BOX A;  3WHC A;  1K61 A;  4KIF A;  4XQF A;  2NVQ J;  1P7I A;  2V7F A;  3OWT A;  2HTJ A;  2ZNZ A;  1OIS A;  3OL4 A;  3IH2 A;  1HBX G;  2YX7 A;  3TDZ C;  2K7L A;  1HKQ A;  5IYD J;  4KT5 C;  2J5P A;  2DMP A;  2JA5 J;  3GYH X;  1TLH B;  2Z3Y A;  4ZYA A;  5EG0 A;  1YS6 A;  3JAM Z;  3NQO A;  2L5Q A;  1TWH J;  1OKR A;  3LA2 A;  1VQO I;  2ZXJ A;  1ON2 A;  1Y39 A;  1XSD A;  1X4O A;  4YEJ A;  4M74 A;  3NRV A;  5E1W A;  4O5V A;  2WB1 A;  4S0H B;  1WHU A;  1XC5 A;  3E0J B;  2ZJ2 A;  2GQQ A;  1V54 H;  4EQQ A;  1A36 A;  3GO5 A;  4X0G A;  5DUK A;  3ECH A;  3EDP A;  3J7Z I;  3HRU A;  2OTJ I;  1OFC X;  4I6Z A;  4M9S A;  2R3S A;  5D6F A;  2F5F A;  1U5T C;  3CUO A;  4HA8 A;  2EV6 A;  4BY7 J;  5CVV A;  2EZL A;  3VOD A;  1FOY A;  3CCU I;  2DPU A;  2XV4 S;  2JT1 A;  1O3T A;  1B1B A;  2E5Z A;  3BPX A;  3BC8 A;  1XDS A;  3IH3 A;  4EV0 A;  5FFX A;  4ENN A;  3LFU A;  4D7M A;  2P6S A;  3BP8 A;  1O57 A;  2OUM A;  1FY7 A;  2DA3 A;  4M3D A;  2QSF X;  2IGO A;  2FOW A;  2L9N A;  5FRN A;  2WB1 N;  2OF7 A;  4IVN A;  1N25 A;  5TGT A;  5LRS A;  1E0E A;  4KIB A;  3LSK A;  4E7Z A;  2E36 A;  4LLG F;  3BTJ A;  2OBP A;  3TMO A;  4Y7N J;  1ETO A;  1YIT I;  4UB8 C;  4E6K G;  2UUZ A;  2V6C A;  1FWZ A;  3CJT B;  1JKR C;  4W1U A;  2W24 A;  2RQP A;  1YW8 A;  1X1P A;  3QAH A;  5E3M A;  4ZTJ A;  1SFU A;  3HJE A;  1GV2 A;  4BBS J;  1P4A A;  2E2I J;  4KN4 X;  2MBF A;  1TWC J;  2R7D A;  4C30 A;  2KL4 A;  2L0K A;  2WAQ A;  1F36 A;  2MW8 A;  1I39 A;  2JUG A;  2VOP A;  3NAR A;  5H2F C;  5BS6 A;  1XN7 A;  2HI3 A;  1EF4 A;  2HZT A;  5M5W J;  1D5V A;  1Y1V J;  3RJP A;  3ZR8 X;  3B6A A;  3TO7 A;  4ZDP A;  2QSG X;  5E17 F;  3WU0 A;  2O0Y A;  4A69 C;  1BR2 A;  3D5S C;  4OIP F;  3H9G A;  1GXQ A;  4K2E A;  1ZK8 A;  2EZH A;  1YJW I;  4A5N A;  1WFX A;  1LQ1 A;  1YJN I;  1B9M A;  5J1U A;  2G7H A;  3SJM A;  1J0R A;  3CCM I;  4UUV A;  2AXT C;  2R7X A;  1HW5 A;  3PFI A;  4I7H A;  2CH0 A;  2FU4 A;  3S93 A;  2D5V A;  2K85 A;  3LSI A;  2IT0 A;  2JUC A;  2M5W A;  5IOY A;  5IP9 J;  3ZQI A;  4H4K C;  4RAF A;  1VF9 A;  1L0O C;  1POG A;  3Q9V A;  2LY1 A;  5GAD J;  4KUM A;  1MKM A;  1VFC A;  2L3D A;  4IF4 A;  3K4M A;  4UUS B;  2NRA C;  2QQ9 A;  4V2F A;  1S72 I;  3S15 J;  1MIJ A;  3F8M A;  1EH6 A;  5C4J J;  1T0F C;  3G1L A;  3C1D A;  5K7F A;  5FLX Z;  3V7S A;  5FRM A;  2MD0 A;  1DDN A;  2G7U A;  2HVQ A;  1MBJ A;  3SQN A;  1K6Y A;  4BGD A;  3OSG A;  2VQH A;  4AC0 A;  2V26 A;  1GV5 A;  3GZN B;  2HU9 A;  1ULY A;  5CVR A;  3PFY A;  2H1L A;  2GA1 A;  2R5Y B;  3S8P A;  2CQX A;  3KET A;  3DV8 A;  2ACJ A;  3RZO J;  1BN5 A;  3G4S I;  4JOM A;  4XIC A;  2IP2 A;  1W7P B;  4HX7 A;  1USS A;  5F1J A;  2EIJ H;  1IN8 A;  3CJR B;  3FDY A;  4XLE A;  3DU5 A;  4RM2 A;  4J01 A;  2Y0S N;  3HOU J;  1X4P A;  1JGG A;  5JI6 A;  4BU2 A;  2XDV A;  1VI0 A;  2LKP A;  3OYN A;  4E7I A;  4HF0 A;  1BI1 A;  1G59 A;  1D1A A;  2X1D A;  4CHU A;  4N9H A;  3IKV A;  1HDP A;  4TV7 A;  4IHY A;  5IOZ A;  4Z2Y A;  4BXF A;  2DFE A;  4CCK A;  5LBQ A;  1AHD P;  4YII A;  5HDK A;  4U0Y A;  1XMK A;  5KAF C;  3C7J A;  1D1C A;  1MND A;  3OYK A;  5CVJ A;  2RDP A;  3KEQ A;  1ACI A;  1LE8 A;  3HUG A;  3OIO A;  3CCQ I;  4HX8 A;  3C18 A;  3V4G A;  4IJA A;  6PAX A;  2CWE A;  4AID A;  5TJJ A;  4PFP A;  3KP3 A;  3E3V A;  2E1C A;  1L3L A;  3VYT B;  3VEP A;  1YIO A;  2W85 A;  1G3Y A;  2F5D A;  5IY5 H;  3CC7 I;  1Y56 A;  3ABL H;  2JZY A;  2XGC A;  3FMQ A;  2LBF A;  3FBI B;  3ASO H;  2LTP A;  2XF5 A;  4YFX F;  3I54 A;  4KMF A;  1QHG A;  2M87 A;  2F5C A;  3I53 A;  2D1V A;  4HRI A;  3DCF A;  3TBI A;  2RVC A;  4BBR J;  3JAM K;  5D5U B;  2X48 A;  2NVU B;  1K7A A;  2CQN A;  3KEY A;  4A3K J;  1ZG1 A;  1ZAR A;  4QLC U;  4WXH A;  1W36 D;  2FQ4 A;  4KN7 X;  4PSW A;  4BYY A;  1TT5 B;  1Z0X A;  3P7N A;  4D5F A;  2KT0 A;  4CSW A;  2VE9 A; 
#chains in the Genus database with same CATH homology
 1YX5 A;  3CF2 A;  2W00 A;  2K9L A;  2XSJ C;  4XN3 A;  4PJM A;  3C2G A;  2ELJ A;  3H5N A;  2OC6 A;  3S3N A;  1FMW A;  2IS6 A;  2JSP A;  4NNJ A;  2WBM A;  2X85 A;  2X51 A;  3VSK A;  4PFO A;  2F5V A;  3HPH A;  2R7Q A;  4U7B A;  3W2V A;  2ZSI B;  2UWM A;  1IRX A;  3IUO A;  4IX7 A;  2V1N A;  2A6T A;  2VJJ A;  3OYL A;  2CUJ A;  1LVK A;  1SAU A;  3K4L A;  2KRC A;  2XF6 A;  2CV0 A;  4RMN A;  4BE2 A;  4FAS D;  4E4H A;  3DTK A;  1DGR M;  3NWT A;  1UAA A;  4XR6 A;  2QKM B;  3DEE A;  3KYL A;  4CH7 A;  4F3Q A;  5FRO A;  3L2R A;  2Q1Z B;  3RQ4 A;  2KZV A;  2I8D A;  4N4N B;  3BCB A;  2Z1D A;  4AVZ A;  3DU6 A;  2UV1 A;  2BW3 A;  4XLA A;  3L2U A;  3CES A;  3NWS A;  3HXL A;  3OS0 A;  2DJI A;  1LKX A;  1V5E A;  3OMY A;  2V6E A;  4XON A;  3HL2 A;  2IS1 A;  4XKV A;  2X6Y A;  2DXI A;  2HDW A;  1WJE A;  1VZ0 A;  3VYR B;  4CZC A;  1SFK A;  2BOL A;  4NUB A;  3K4B A;  3D5L A;  3DPL C;  3CMM A;  1OLT A;  3L2Q A;  1TT0 A;  3VWB A;  1DP3 A;  3OS1 A;  4D9J A;  1X1A A;  2V4J C;  2CMP A;  4XOP A;  3FHN A;  3OYB A;  3SYT A;  4XKC A;  4XNF A;  4Y4R A;  2IS2 A;  2K3P A;  2VJ5 A;  4U87 A;  4DBQ A;  2R7T A;  3QYF A;  2FUG 2;  4PJL A;  4GRI A;  2HVR A;  2MAB A;  2WAD A;  1G8X A;  3ZGK A;  1JI8 A;  2PJR A;  4MLO A;  3MD2 A;  4XOR A;  4ZDL A;  1UEL B;  4HNT A;  5KCM A;  2VIX A;  3LL7 A;  2VAS A;  3RTR A;  2E1M B;  1OR7 C;  3BG7 A;  4CCN A;  4CCL A;  2CW8 A;  1WJ5 A;  2KQR A;  4HST A;  2K5C A;  2K9M A;  2HPM A;  1BR1 A;  2MC4 A;  3HOS A;  2BVM A;  5KNL A;  2VXZ A;  2Z16 A;  3OYI A;  3OY9 A;  2WY7 Q;  2KPM A;  1N77 A;  4XKB A;  4BEH B;  3HG9 A;  1WJF A;  4KT6 A;  1R6R A;  2R7U A;  4CUG A;  2CV1 A;  4BL0 B;  2R7V A;  2WA0 A;  2HVS A;  3OYE A;  4XLF A;  2BVL A;  3PNT A;  4RLF A;  1WJC A;  1ERD A;  2CW7 A;  4II3 A;  3VYU B;  3PSF A;  5LD2 C;  2F4I A;  3BLY A;  3IAS 2;  3K4N A;  3J7A Y;  2WAF A;  2LH9 A;  4P5O A;  3SZG A;  1V5G A;  3HOT A;  3MMY B;  3S3M A;  3SEZ A;  4P1W A;  5CKT A;  4DOZ A;  3MKY B;  1BR4 A;  4ZJZ A;  2E1M C;  2VJI A;  3AL0 B;  3HKZ A;  5CPR B;  5HVQ C;  4CCO A;  3K10 A;  4HPQ A;  4HG2 A;  2LBF B;  4JQF A;  5CQG A;  2IGK A;  1MMD A;  2DT6 A;  4F92 B;  4BJ6 C;  4DJA A;  4B47 A;  3QYE A;  2ZSH B;  3K4J A;  1D1B A;  3H5R A;  1FMV A;  4PJJ A;  3OYH A;  1X1D A;  4KIT B;  2IS4 A;  1WJD A;  1PYV A;  1LDK B;  2NOJ B;  4EAT A;  4DBR A;  2CUZ A;  3BCA A;  3PUB A;  1N75 A;  1Z3X A;  2Q2E B;  2R7S A;  2VKD A;  5HNF A;  1Z21 A;  2KP6 A;  2JVH A;  2XF7 A;  3OYJ A;  1QHH D;  1X1C A;  2RRE A;  3H5A A;  3A1Y A;  3MKW B;  2GOM A;  2A5W A;  4QPO A;  4NQW B;  1NG6 A;  4BE1 A;  1D0Y A;  1X1B A;  3AFH A;  4IQJ A;  2M4G A;  1NG7 A;  4LIT A;  1YE9 A;  4C2U A;  3OL3 A;  1V5F A;  3DWL E;  4Y33 A;  1ZEL A;  3OR2 C;  4N4O B;  2IGM A;  3M1C A;  4R79 A;  4CA0 A;  4PSX A;  1EA3 A;  2CS3 A;  4OAZ A;  3OIP A;  3L2W A;  1QU3 A;  3EPZ A;  4AYB A;  1X19 A;  2CFO A;  1HA8 A;  3H0D A;  1UG0 A;  3AL0 C;  3VYS B;  1YX3 A;  4BQO A;  4IZZ A;  2Y0S A;  4F93 B;  4LIU A;  1S9H A;  2X1C A;  4D1Q A;  4XQF A;  2V7F A;  3OWT A;  4E7K A;  1AA7 A;  3OYG A;  3OL4 A;  5HOO A;  2GOX B;  4XM3 A;  3DPU A;  4ZYA A;  2M0M A;  4B48 A;  4IKF A;  1KON A;  2L5Q A;  2KHM A;  2LRD A;  2L7K A;  3HPG A;  1X4O A;  4YEJ A;  4CCJ A;  4HNU A;  2WB1 A;  2VQG A;  4KIS A;  3EUA A;  2QKL B;  3E0J B;  3H9Q A;  1WJB A;  4XMY A;  1Z3Y A;  4G6T B;  2KMU A;  3DLA A;  2VKH A;  4X0G A;  2BW3 B;  2WAE A;  4BQN A;  3CZ6 A;  3U21 A;  1MMG A;  5CQE A;  3EUK L;  4BQQ A;  4KJZ A;  3LSG A;  4IQ4 A;  4BEH A;  3F9K A;  4DGW B;  2VQC A;  2HQA A;  3K70 C;  3S3O A;  4ZDO A;  2E5Z A;  3PNV A;  3BC8 A;  3K70 D;  3S32 A;  3LFU A;  4Y3O A;  3FBN B;  2OUM A;  2HZD A;  2DCE A;  2AQF A;  4PK4 A;  2LRE A;  2IGO A;  3PL8 A;  2L9N A;  5FRN A;  4BDY A;  5TGT A;  1E0E A;  3KX2 A;  2W1O A;  1P9Q C;  3I9V 2;  3LSK A;  4E7Z A;  3CP2 A;  3GBG A;  3PSI A;  3TMO A;  2VB6 A;  4NC7 A;  4OWR B;  2M4K A;  3RCO A;  4E6K G;  2W7N A;  4RLQ A;  4XN0 A;  4DIQ A;  1WJA A;  2UUZ A;  4BS9 A;  2R7W A;  4E7L A;  4BUP A;  3HUG B;  1Y6I A;  1TZL A;  3VDX A;  4ZTJ A;  4HEA 2;  3CP8 A;  4BAC A;  1MMA A;  1D0Z A;  3W2W A;  4C30 A;  2R7O A;  2KL4 A;  1W36 C;  2WAQ A;  3BG6 A;  3H9J A;  5KHD A;  2JUG A;  3DTI A;  3ZXS A;  2VQL A;  3DPT A;  3LSH A;  1J09 A;  4XLC A;  2IXS A;  3ZR8 X;  4ZDP A;  4E7J A;  2O5R A;  2X6X A;  2VL8 A;  2PMZ A;  3QOE A;  3QYB A;  1BR2 A;  3D5S C;  3AKZ A;  2DT7 B;  2LC2 A;  2LOO A;  4F52 A;  3H9G A;  4AU7 A;  2HNH A;  3PJR A;  1WFX A;  2MFZ A;  3ZQQ A;  4ITV A;  2VJ4 A;  3LSM A;  4XKW A;  3N05 A;  3A2K A;  2R7X A;  1MW7 A;  3S93 A;  5HLT A;  2CH0 A;  4B43 A;  3LSI A;  2L9S A;  3EUH C;  3TL4 X;  4H4K C;  4LIV A;  3V42 A;  3E1S A;  4YRV A;  2X1E A;  2VXD A;  2LY1 A;  3MKZ A;  2E5N A;  3K4C A;  3K4M A;  2MYS A;  2LG4 A;  3OS2 A;  4PJN A;  4ZTF A;  4ZC3 A;  2M7A A;  4PUS A;  3OR1 C;  4BDZ A;  1T0F C;  1GLN A;  5FRM A;  2MD0 A;  4NC8 A;  2W4S A;  4YEL A;  3DTE A;  2HVQ A;  4ANJ A;  2XC7 A;  1K6Y A;  2XAU A;  4RM3 A;  4BGD A;  2VQH A;  2HPI A;  3RPU D;  2CV2 A;  4XL9 A;  2V26 A;  1MNE A;  2ZXH A;  4B44 A;  3FKJ A;  3SDB A;  2HU9 A;  4FET A;  3PFY A;  3S8P A;  3VSL A;  1T95 A;  2Z2S B;  4QPQ A;  2R7R A;  4E7S A;  2KLO A;  1PJR A;  4F55 A;  4JOM A;  1N78 A;  4C2T A;  4BJT A;  4J00 A;  3H35 A;  2W82 A;  3CJR B;  3FDY A;  3DQV C;  3UNG C;  4XLE A;  3ONQ A;  3DU5 A;  3K4K A;  2RNG A;  4RM2 A;  4J01 A;  2DOA A;  1X4P A;  2M3A A;  4XOT A;  2KRH A;  4BU2 A;  2XDV A;  3CJQ B;  3OYN A;  4E7I A;  2P0W A;  1G59 A;  1DGW Y;  3IP4 B;  1D1A A;  4HSR A;  1U0J A;  4F91 B;  2VLA A;  3G2B A;  2R4G A;  2X1D A;  4OAY A;  4C9Y A;  3M8J A;  2F6C A;  3ZRG A;  3A4C A;  3ZCO A;  2KDO A;  4BXF A;  4CCK A;  3DKY A;  2LY2 A;  3PNY A;  4E7H A;  3OYK A;  1D1C A;  1MND A;  1DQU A;  3OOU A;  2L2O A;  3OYF A;  3OIQ A;  1D0X A;  2E60 A;  3D5R C;  3LMM A;  4PFP A;  3I3L A;  3OYC A;  4BJ5 C;  2JVG A;  3IAM 2;  3HC7 A;  3VYT B;  3L2V A;  2VPL A;  1Z7L A;  2PJR B;  1LFP A;  3QOD A;  4II2 A;  1Y56 A;  2OV7 A;  5LFA A;  2ZFU A;  2LBF A;  2LYC A;  2IGN A;  3FBI B;  2XF5 A;  3W2A A;  1QHG A;  3C2H A;  5HNH A;  4HRI A;  3TBI A;  4LG3 A;  2ZXI A;  3SEQ A;  4XLH A;  3DKX A;  3KEY A;  4CCM A;  3W3C A;  2V9K A;  2WY8 Q;  3K6G A;  2JA2 A;  1W36 D;  4B3X A;  2M7B A;  2X6W A;  4PSW A;  2AQE A;  3OYA A;  3OYD A;  1BOB A;  3UR3 C;  2RQQ A;  3OYM A;  4CSW A;  4BE0 A;  3RSN A;  1MMN A;  5JHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...